2FK2A

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'small unit cell' form, cu(i)-bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
b'EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fk2A00
1OWTA 4PWQA 2FJZA 2FMAA 2FK2A 2FK3A 2FKLA 3KTMA 2M05A 2FK1A
chains in the Genus database with same CATH superfamily
2YZGA 2R8JA 1RYSA 5KFLA 3WNZA 4AYBE 1R9TA 3WO0A 4IRKA 5FD5A 2YS6A 1VBGA 3N43B 2UXDH 1N56A 4RAZA 5LP6F 2FPGB 3BQ2A 5EWGA 5L1IA 4FS1A 2VUMA 4O3SA 4DL4A 1XMQH 4NLGA 1HR0H 4EGQA 2VPSA 3GTPA 4O3NA 5KFIA 1DV2A 5DG8A 3NGDA 4F4WA 3MFHA 1GSHA 4EFBA 1IBLH 5L1KA 3JZIA 2VUMG 1WSCA 4EEYA 2PVPA 3MR5A 3JAMW 3Q2OA 3N41B 4G3IA 2ATLA 4BXXG 2RGVA 4LH7A 1XNRH 2R86A 3H3VH 4EG0A 1BXRA 4UCRA 2UVVA 2FB9A 3BABA 3H20A 4DR5H 3G8CA 1N34H 4ECSA 2OLSA 2WYOA 4RB2C 4TUYF 4LF5H 1I6UA 5IP9G 2E2IA 5FPRA 4LF4H 5LA6F 3QZ7A 5KG7A 5KFXA 2R8GA 2C35B 5KG5A 4O4HF 1KJ9A 1XNQH 4MV4A 1KBLA 4IHJF 4UCTA 5JH7F 5IWAH 4EYHB 2YL2A 4ECTA 3KHRA 1JDEA 4UCVA 5DG7A 2HHHH 4YB8B 2XC9A 3PR4A 3KAJA 3C0FB 1M6VA 2C00A 4R7RA 1GYFA 1WH2A 2XIGA 5IP7G 4DV3H 2V58A 4LSXA 4RB3C 2XD4A 2C28A 2XGPA 3GLKA 1B6RA 2CW8A 5JVDF 3OSNA 2VR1A 4YJ3F 3HOUG 4HNUA 1N33H 2VUGA 2WB1A 4RUAA 1ULZA 3PN1A 1KEEA 1HNXH 5A2QW 4F4XA 2ASJA 4HNTA 3Q8PB 5KFZA 1S0MA 2FMAA 2FK2A 4F50A 1GSAA 4X66H 2YYAA 4AYBA 1L2ZA 3J81W 4ZQIA 2ZDHA 1V51A 4JYAH 3K5HA 1RJPA 4YY3H 4A3JG 4I55F 1KJJA 4KHPH 2DWCA 3HOVG 4I4TF 2FLLA 3PZPA 5DQIA 2UUBH 3KXYT 5KT3A 3HOXG 3G6XA 1TA8A 1J5EH 4ME6A 1W96A 5KX5F 2J9GA 4MAMA 2ALZA 4DV5H 4I7HA 4A2AA 3L4JA 3SI8A 2QK4A 1TWCA 3PO3G 5C1PA 4QWEA 4DR4H 2W7PA 4DL6A 4JI6H 3PR5B 3MWEA 3PW0A 4QW8A 4A3KG 1N48A 4K0KH 2R93G 3RBEA 2JEJA 1B33N 5KFNA 4J9PA 3MR3A 2UUCH 4QW9A 5LMNH 5BPHA 4L1KA 4Q45A 3GIMA 2V5AA 3ETHA 4PWQA 1Y1VG 1M7JA 2VA3A 4HYKA 4MV3A 4GKKH 5KFHA 2W6OA 2ZM6H 4QIWE 1JX4A 4TQSA 3MR2A 4RZQA 2R8IA 4FM9A 3L4KA 1K1SA 1TWHA 1Y1WA 3M9OB 3N8DA 4Y8VB 3VMMA 4DR7H 1I3QA 5D1PA 2BQUA 4IRDA 4O4IF 4A2BA 5CAEB 5C4XG 1V4YA 4CC5A 5J2UF 2UXBH 4LSAA 4ECXA 2W6QA 4XZ3B 4MTEA 3RFCA 3RAXA 5C8YF 3PW2A 1TAEA 4APMA 2R7KA 2YRWA 5HV6A 2QYZA 5EWEA 3GV7B 1Y1WG 1E4GT 1UNNC 2X0SA 3GIQA 4ETSA 1A0IA 3J80W 4DL7A 5LXTF 2VA2A 4JI5H 4PDBA 3BQ1A 4R8UB 1Z2NX 4AQYH 3H0GA 1EYZA 2WTFA 2W9BA 4QWCA 3BA9A 4J0MA 4HNVA 2ASLA 1ZQ7A 4QWBA 2R87A 4O4LF 2HVSA 5BR8H 4DV6H 5KFUA 4TV9F 2UVUA 2PN1A 4C2MA 4YAKB 2W70A 1W93A 4MV7A 4J9RA 1B6SA 3OUZA 5J2TF 3VPBA 4EFEA 2J6SA 3H0GG 2W7OA 3MFIA 3JRWA 3AYHB 2GLTA 3V6JA 1FVIA 2UU9H 4Q8FA 3IG0A 4ECQA 3PW7A 4EBCA 3KALA 1Z2PX 3RV4A 5KFFA 1TWFA 3Q8RB 5K2MA 5KFJA 5LMUH 4JI3H 4Q0YA 5DG9A 3MJFA 3GV5B 2IP4A 4DR3H 3GIDA 5H80A 5C5JA 4E4TA 4QWAA 2RDIA 2CZGA 5EWFA 3KHLA 1N36H 5KT5A 1S68A 4J9OA 4BBSG 2DIKA 5JQWA 3MR6A 4DUZH 2YU9A 1TWAA 4LF6H 5FJ8G 1UC9A 1GO3E 4RNOA 4IZOA 1XDNA 1KJ8A 3WO1A 2NU6B 4J9SA 2PMZA 1M0TA 4B3SH 4LF9H 3R5HA 4R8UA 4A3GG 1EZ1A 4A3BG 3HB9A 1A9XA 1CQJB 5KFQA 5FLXW 4ECRA 3GV8B 3T1YH 3HOWG 1DIKA 3K3VA 4M7EA 4DR2H 4QIWA 2UUAH 2Q2TA 5KG0A 3TQ1A 3QFFA 5KFOA 2IBKA 1Z2OX 4RZRA 1HNZH 4ED3A 4DV0H 5KFPA 1AN7A 5DLGA 3HKZE 1C30A 2PBZA 1JKJB 4YP3A 5DQHA 1S0NA 2YRXA 2Q2UA 2R7ZA 2BR0A 3R5XA 1O75A 1V9PA 3RB6A 2E2HA 4CC6A 2NUAB 2VOBA 3H4DA 4F4ZA 3EYYA 3RV3A 5KG2A 1VKZA 3OHBA 4DL5A 2YCHA 3RGXA 3HBLA 2YZNA 4LH6A 3JRXA 3RBDA 2R7ZG 4BY7G 1SYXB 1EUDB 4RAYA 1Y14B 5KT4A 4MV9A 4RU9A 3OTOH 3GTOA 3OHAA 1DV1A 1TWGA 4EYIB 2RF4A 5C3EG 2AU0A 2R93A 5IYDG 1ZHSA 3ORQA 3BQ0A 2FJZA 4B3TH 2J6UA 2HVRA 4LFCH 3I12A 4UCUA 2BQ3A 2FLNA 2FPPB 2E5LH 1HNWH 2R92G 3RTXA 2I87A 4JI7H 4MV1A 1OWTA 2FPIB 4HR7A 4DV4H 4IWXA 3V6KA 4YAJB 5KT6A 1VS0A 1Y1VA 1C3OA 2R85A 2R6FA 1S9FA 4BWSC 2XCAA 2FK3A 2W57A 2NU7B 3G6VA 4RB1A 5FD6A 5KFAA 4A93G 5CA1F 4A3DG 4A3FG 2JA6A 2R7LA 5KG3A 2O03A 1S03G 2W6NA 2WDTA 3GQCA 5KG6A 5FLMG 3BJYA 4O3RA 4ECZA 2ZJTA 3K3PA 2I8CA 3MWDA 5F9NA 3SE7A 3UFXB 4LMYA 3V4ZA 2VQEH 3GTJA 4ED8A 4QWDA 1JXLA 3CVZA 4LF8H 2AGPA 2FE3A 3RB3A 4YBZB 5C44G 3GIKA 5KFBA 5DGBA 2RGRA 5D1OB 2JA6G 2W71A 1KC7A 2MCTA 2VQFH 5BPFA 2CQYA 4FBTA 2WE6A 5KFDA 2NVYA 4DL3A 3F8NA 1WCMA 3N40P 4Q43A 2JA5A 1SFOA 5KG1A 2UXCH 3LMLA 3FKIA 2V4QA 5JUMA 4J9MA 2HJWA 3HKZA 4NXMH 2SCUB 3N44B 1UC8A 2BQRA 1KJIA 5I47A 4TQRA 3R23A 3GIIA 1AUVA 2M05A 2OH2A 5IYZF 4X64H 4LFBH 3T5HA 4ED0A 1S10A 1WCMG 3FMAA 2JA5G 5KT7A 4DV2H 4YR2A 2DPIA 3FKIG 3T1HH 2W8LA 4GLXA 2GPSA 3JSLA 1CQIB 1T94A 1ZHQA 5KFKA 5GONF 1ZETA 2V9WA 4DV1H 4ECYA 4U7CA 1PK8A 1PX2A 3N6XA 1P8LA 3KHGA 2AGOA 2FK1A 2IMWP 4MA5A 1MZBA 4ECUA 4ECWA 1RK5A 1IBMH 4EBEA 2UVRA 3J7AK 3V6HA 5KFYA 3GTLA 3PO2G 1IOWA 2CW7A 5D1OA 2JEGA 5IT9W 2JA8G 4O2AF 3L2PA 3TIIA 5LYJF 4HQ6A 5C1OA 4JUZA 1DGSA 4QJFA 4F4YA 2NU8B 1I7LA 1KJQA 2XCLA 3V4SA 4Q8EA 3T5JA 2NVXA 5T14A 3KHHA 2C2EA 1WR2A 4MTDA 1EUCB 3OSPA 1E4EB 4ZI7F 4J9NA 2Y0SE 3EPIA 4O3QA 4A3EG 2P0AA 1M0WA 3M9MB 1CS0A 4JI1H 4JV1A 2R84A 1CE8A 4UFZA 5L9XA 4B3MH 2IA6A 3G6YA 3VPCA 3BG5A 4JI8H 2FLPA 3VPDA 1S0OA 3I4NG 1EHIA 4U6PA 4IAJA 3EPGA 4FBUA 1BJTA 1X9NA 3LP8A 2W6PA 4XYLB 3RIZA 2I80A 4LF7H 4DR1H 4RUCA 3Q8QB 4JV5H 3N42B 4IRCA 2ZDQA 2F4VH 3LWBA 2NU9B 4MV8A 3TQTA 2FP4B 4RNNA 3RF2A 2CKZB 2W9CB 1RYRA 2R82A 3BAAA 5BMVF 4ZOLF 3GTMA 3GIJA 4LFAH 3U9SA 4YQWA 4X62H 2C22A 4M9UA 5KFEA 4X65H 3U9TA 3RB4A 3OUUA 3TIGA 4J9KA 5FPOA 2R92A 2WAQE 3RGZA 4ED7A 3CQZA 2VPQA 3ETJA 4WBNF 5DGAA 3Q1KA 5KKNB 2B63A 1I94H 3GTKA 4JV0A 4O3PA 4XYMB 2HGSA 3Q8SB 2V4RA 2R7NA 3E5NA 4EBDA 4NXNH 4A3CG 1E4EA 4JI2H 2ASDA 4DV7H 1JLLB 2FKLA 2XCPA 2XGQA 5DQGA 4J9LA 3DF7A 5KT2A 4DUYH 1XMOH 4UCSA 1VAJA 5KG4A 2RDJA 4YR3A 3UQ8A 1T3NA 2W9AA 2KSWA 4DR6H 2JEIA 3KTMA 4ED6A 5EDWA 5KFTA 2B63G 1E4FT 1AUXA 4JV2A 2YS7A 4O3OA 4A3MG 1IBKH 3RAQA 4A3LG 2V59A 3IN5A 4DL2A 3PW5A 2DPJA 1BGWA 1K1QA 4EGJA 3RJ0A 4YR0A 4GC6A 5KFRA 5JVLA 1FKAH 4BY1G 2W6ZA 2DLNA 1SEIA 2W9CA 2R7MA 4ZHQF 4C5CA 5DLFA 2R8KA 2JA7A 3JSNA 1VBHA 4I50F 3T5KA 4YJ2F 4BBRG 5KFMA 1BNCA 3GILA 5L1JA 4ED1A 1FJGH 3HOZG 5KFWA 2OWOA 3M4IA 4B3RH 2W6MA 5KFCA 2GPWA 3FDSA 1GSOA 1I50A 2J6TA 3GIPA 2AQ4A 2W9BB 1JIHA 1JDBB 3ORRA 2AGQA 2UVWA 2Y0SA 2JEFA 4DLKA 1K83A 5EOYA 1N32H 1GGOA 4OX9H 2JA7G 4J9QA 2PMZE 3PVXA 3PW4A 1S97A 5IYCG 5IYBG 1RJQA 2W8KA 4O2BF 3HOYG 3BA8A 3TINA 5D8DA 1IOVA 5LOVF 4ECVA 5KFSA 3H40A 2C2RA 2R8HA 4WD3A 5KFGA 4C5AA 1RK6A 4YHHH 3GTGA 3MWMA 2HVQA 2ZDGA 4MA0A 4XX0B 5CA0F 4FS2A 1I7NA 2DZDA 3T5LA 4A3IG 4IR1A 3M9NB 4IWYA 2YW2A 1T36A 4TV8F 2C2DA 2YZMA 3R5FA 5HBRB 5L1LA 3QZ8A 1B04A 4FU0A 4MV6A 5EZYF 1GLVA 3RUPA 5CB4F 4JI0H 3HXLA 2WB1E 1SCUB 3KAKA 4UCOA 4RNMA 4IR9A 1RJRA 3K5IA 4EEQA 3GTQA 3H4BA 4C5BA 2VQDA 4GKJH 4Q44A 5KFVA 4RB0A 3RB0A 5F9LA 5LL6b 4ED2A 2WAQA 4JI4H 3I4MG 4GC7A
chains in the Genus database with same CATH topology
1OWTA 4PWQA 2FJZA 2FMAA 2FK2A 2FK3A 2FKLA 3KTMA 2M05A 2FK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OWT A;  4PWQ A;  2FJZ A;  2FMA A;  2FK2 A;  2FK3 A;  2FKL A;  3KTM A;  2M05 A;  2FK1 A; 
#chains in the Genus database with same CATH topology
 2YZG A;  2R8J A;  1RYS A;  5KFL A;  3WNZ A;  4AYB E;  1R9T A;  3WO0 A;  4IRK A;  5FD5 A;  2YS6 A;  1VBG A;  3N43 B;  2UXD H;  1N56 A;  4RAZ A;  5LP6 F;  2FPG B;  3BQ2 A;  5EWG A;  5L1I A;  4FS1 A;  2VUM A;  4O3S A;  4DL4 A;  1XMQ H;  4NLG A;  1HR0 H;  4EGQ A;  2VPS A;  3GTP A;  4O3N A;  5KFI A;  1DV2 A;  5DG8 A;  3NGD A;  4F4W A;  3MFH A;  1GSH A;  4EFB A;  1IBL H;  5L1K A;  3JZI A;  2VUM G;  1WSC A;  4EEY A;  2PVP A;  3MR5 A;  3JAM W;  3Q2O A;  3N41 B;  4G3I A;  2ATL A;  4BXX G;  2RGV A;  4LH7 A;  1XNR H;  2R86 A;  3H3V H;  4EG0 A;  1BXR A;  4UCR A;  2UVV A;  2FB9 A;  3BAB A;  3H20 A;  4DR5 H;  3G8C A;  1N34 H;  4ECS A;  2OLS A;  2WYO A;  4RB2 C;  4TUY F;  4LF5 H;  1I6U A;  5IP9 G;  2E2I A;  5FPR A;  4LF4 H;  5LA6 F;  3QZ7 A;  5KG7 A;  5KFX A;  2R8G A;  2C35 B;  5KG5 A;  4O4H F;  1KJ9 A;  1XNQ H;  4MV4 A;  1KBL A;  4IHJ F;  4UCT A;  5JH7 F;  5IWA H;  4EYH B;  2YL2 A;  4ECT A;  3KHR A;  1JDE A;  4UCV A;  5DG7 A;  2HHH H;  4YB8 B;  2XC9 A;  3PR4 A;  3KAJ A;  3C0F B;  1M6V A;  2C00 A;  4R7R A;  1GYF A;  1WH2 A;  2XIG A;  5IP7 G;  4DV3 H;  2V58 A;  4LSX A;  4RB3 C;  2XD4 A;  2C28 A;  2XGP A;  3GLK A;  1B6R A;  2CW8 A;  5JVD F;  3OSN A;  2VR1 A;  4YJ3 F;  3HOU G;  4HNU A;  1N33 H;  2VUG A;  2WB1 A;  4RUA A;  1ULZ A;  3PN1 A;  1KEE A;  1HNX H;  5A2Q W;  4F4X A;  2ASJ A;  4HNT A;  3Q8P B;  5KFZ A;  1S0M A;  2FMA A;  2FK2 A;  4F50 A;  1GSA A;  4X66 H;  2YYA A;  4AYB A;  1L2Z A;  3J81 W;  4ZQI A;  2ZDH A;  1V51 A;  4JYA H;  3K5H A;  1RJP A;  4YY3 H;  4A3J G;  4I55 F;  1KJJ A;  4KHP H;  2DWC A;  3HOV G;  4I4T F;  2FLL A;  3PZP A;  5DQI A;  2UUB H;  3KXY T;  5KT3 A;  3HOX G;  3G6X A;  1TA8 A;  1J5E H;  4ME6 A;  1W96 A;  5KX5 F;  2J9G A;  4MAM A;  2ALZ A;  4DV5 H;  4I7H A;  4A2A A;  3L4J A;  3SI8 A;  2QK4 A;  1TWC A;  3PO3 G;  5C1P A;  4QWE A;  4DR4 H;  2W7P A;  4DL6 A;  4JI6 H;  3PR5 B;  3MWE A;  3PW0 A;  4QW8 A;  4A3K G;  1N48 A;  4K0K H;  2R93 G;  3RBE A;  2JEJ A;  1B33 N;  5KFN A;  4J9P A;  3MR3 A;  2UUC H;  4QW9 A;  5LMN H;  5BPH A;  4L1K A;  4Q45 A;  3GIM A;  2V5A A;  3ETH A;  4PWQ A;  1Y1V G;  1M7J A;  2VA3 A;  4HYK A;  4MV3 A;  4GKK H;  5KFH A;  2W6O A;  2ZM6 H;  4QIW E;  1JX4 A;  4TQS A;  3MR2 A;  4RZQ A;  2R8I A;  4FM9 A;  3L4K A;  1K1S A;  1TWH A;  1Y1W A;  3M9O B;  3N8D A;  4Y8V B;  3VMM A;  4DR7 H;  1I3Q A;  5D1P A;  2BQU A;  4IRD A;  4O4I F;  4A2B A;  5CAE B;  5C4X G;  1V4Y A;  4CC5 A;  5J2U F;  2UXB H;  4LSA A;  4ECX A;  2W6Q A;  4XZ3 B;  4MTE A;  3RFC A;  3RAX A;  5C8Y F;  3PW2 A;  1TAE A;  4APM A;  2R7K A;  2YRW A;  5HV6 A;  2QYZ A;  5EWE A;  3GV7 B;  1Y1W G;  1E4G T;  1UNN C;  2X0S A;  3GIQ A;  4ETS A;  1A0I A;  3J80 W;  4DL7 A;  5LXT F;  2VA2 A;  4JI5 H;  4PDB A;  3BQ1 A;  4R8U B;  1Z2N X;  4AQY H;  3H0G A;  1EYZ A;  2WTF A;  2W9B A;  4QWC A;  3BA9 A;  4J0M A;  4HNV A;  2ASL A;  1ZQ7 A;  4QWB A;  2R87 A;  4O4L F;  2HVS A;  5BR8 H;  4DV6 H;  5KFU A;  4TV9 F;  2UVU A;  2PN1 A;  4C2M A;  4YAK B;  2W70 A;  1W93 A;  4MV7 A;  4J9R A;  1B6S A;  3OUZ A;  5J2T F;  3VPB A;  4EFE A;  2J6S A;  3H0G G;  2W7O A;  3MFI A;  3JRW A;  3AYH B;  2GLT A;  3V6J A;  1FVI A;  2UU9 H;  4Q8F A;  3IG0 A;  4ECQ A;  3PW7 A;  4EBC A;  3KAL A;  1Z2P X;  3RV4 A;  5KFF A;  1TWF A;  3Q8R B;  5K2M A;  5KFJ A;  5LMU H;  4JI3 H;  4Q0Y A;  5DG9 A;  3MJF A;  3GV5 B;  2IP4 A;  4DR3 H;  3GID A;  5H80 A;  5C5J A;  4E4T A;  4QWA A;  2RDI A;  2CZG A;  5EWF A;  3KHL A;  1N36 H;  5KT5 A;  1S68 A;  4J9O A;  4BBS G;  2DIK A;  5JQW A;  3MR6 A;  4DUZ H;  2YU9 A;  1TWA A;  4LF6 H;  5FJ8 G;  1UC9 A;  1GO3 E;  4RNO A;  4IZO A;  1XDN A;  1KJ8 A;  3WO1 A;  2NU6 B;  4J9S A;  2PMZ A;  1M0T A;  4B3S H;  4LF9 H;  3R5H A;  4R8U A;  4A3G G;  1EZ1 A;  4A3B G;  3HB9 A;  1A9X A;  1CQJ B;  5KFQ A;  5FLX W;  4ECR A;  3GV8 B;  3T1Y H;  3HOW G;  1DIK A;  3K3V A;  4M7E A;  4DR2 H;  4QIW A;  2UUA H;  2Q2T A;  5KG0 A;  3TQ1 A;  3QFF A;  5KFO A;  2IBK A;  1Z2O X;  4RZR A;  1HNZ H;  4ED3 A;  4DV0 H;  5KFP A;  1AN7 A;  5DLG A;  3HKZ E;  1C30 A;  2PBZ A;  1JKJ B;  4YP3 A;  5DQH A;  1S0N A;  2YRX A;  2Q2U A;  2R7Z A;  2BR0 A;  3R5X A;  1O75 A;  1V9P A;  3RB6 A;  2E2H A;  4CC6 A;  2NUA B;  2VOB A;  3H4D A;  4F4Z A;  3EYY A;  3RV3 A;  5KG2 A;  1VKZ A;  3OHB A;  4DL5 A;  2YCH A;  3RGX A;  3HBL A;  2YZN A;  4LH6 A;  3JRX A;  3RBD A;  2R7Z G;  4BY7 G;  1SYX B;  1EUD B;  4RAY A;  1Y14 B;  5KT4 A;  4MV9 A;  4RU9 A;  3OTO H;  3GTO A;  3OHA A;  1DV1 A;  1TWG A;  4EYI B;  2RF4 A;  5C3E G;  2AU0 A;  2R93 A;  5IYD G;  1ZHS A;  3ORQ A;  3BQ0 A;  2FJZ A;  4B3T H;  2J6U A;  2HVR A;  4LFC H;  3I12 A;  4UCU A;  2BQ3 A;  2FLN A;  2FPP B;  2E5L H;  1HNW H;  2R92 G;  3RTX A;  2I87 A;  4JI7 H;  4MV1 A;  1OWT A;  2FPI B;  4HR7 A;  4DV4 H;  4IWX A;  3V6K A;  4YAJ B;  5KT6 A;  1VS0 A;  1Y1V A;  1C3O A;  2R85 A;  2R6F A;  1S9F A;  4BWS C;  2XCA A;  2FK3 A;  2W57 A;  2NU7 B;  3G6V A;  4RB1 A;  5FD6 A;  5KFA A;  4A93 G;  5CA1 F;  4A3D G;  4A3F G;  2JA6 A;  2R7L A;  5KG3 A;  2O03 A;  1S03 G;  2W6N A;  2WDT A;  3GQC A;  5KG6 A;  5FLM G;  3BJY A;  4O3R A;  4ECZ A;  2ZJT A;  3K3P A;  2I8C A;  3MWD A;  5F9N A;  3SE7 A;  3UFX B;  4LMY A;  3V4Z A;  2VQE H;  3GTJ A;  4ED8 A;  4QWD A;  1JXL A;  3CVZ A;  4LF8 H;  2AGP A;  2FE3 A;  3RB3 A;  4YBZ B;  5C44 G;  3GIK A;  5KFB A;  5DGB A;  2RGR A;  5D1O B;  2JA6 G;  2W71 A;  1KC7 A;  2MCT A;  2VQF H;  5BPF A;  2CQY A;  4FBT A;  2WE6 A;  5KFD A;  2NVY A;  4DL3 A;  3F8N A;  1WCM A;  3N40 P;  4Q43 A;  2JA5 A;  1SFO A;  5KG1 A;  2UXC H;  3LML A;  3FKI A;  2V4Q A;  5JUM A;  4J9M A;  2HJW A;  3HKZ A;  4NXM H;  2SCU B;  3N44 B;  1UC8 A;  2BQR A;  1KJI A;  5I47 A;  4TQR A;  3R23 A;  3GII A;  1AUV A;  2M05 A;  2OH2 A;  5IYZ F;  4X64 H;  4LFB H;  3T5H A;  4ED0 A;  1S10 A;  1WCM G;  3FMA A;  2JA5 G;  5KT7 A;  4DV2 H;  4YR2 A;  2DPI A;  3FKI G;  3T1H H;  2W8L A;  4GLX A;  2GPS A;  3JSL A;  1CQI B;  1T94 A;  1ZHQ A;  5KFK A;  5GON F;  1ZET A;  2V9W A;  4DV1 H;  4ECY A;  4U7C A;  1PK8 A;  1PX2 A;  3N6X A;  1P8L A;  3KHG A;  2AGO A;  2FK1 A;  2IMW P;  4MA5 A;  1MZB A;  4ECU A;  4ECW A;  1RK5 A;  1IBM H;  4EBE A;  2UVR A;  3J7A K;  3V6H A;  5KFY A;  3GTL A;  3PO2 G;  1IOW A;  2CW7 A;  5D1O A;  2JEG A;  5IT9 W;  2JA8 G;  4O2A F;  3L2P A;  3TII A;  5LYJ F;  4HQ6 A;  5C1O A;  4JUZ A;  1DGS A;  4QJF A;  4F4Y A;  2NU8 B;  1I7L A;  1KJQ A;  2XCL A;  3V4S A;  4Q8E A;  3T5J A;  2NVX A;  5T14 A;  3KHH A;  2C2E A;  1WR2 A;  4MTD A;  1EUC B;  3OSP A;  1E4E B;  4ZI7 F;  4J9N A;  2Y0S E;  3EPI A;  4O3Q A;  4A3E G;  2P0A A;  1M0W A;  3M9M B;  1CS0 A;  4JI1 H;  4JV1 A;  2R84 A;  1CE8 A;  4UFZ A;  5L9X A;  4B3M H;  2IA6 A;  3G6Y A;  3VPC A;  3BG5 A;  4JI8 H;  2FLP A;  3VPD A;  1S0O A;  3I4N G;  1EHI A;  4U6P A;  4IAJ A;  3EPG A;  4FBU A;  1BJT A;  1X9N A;  3LP8 A;  2W6P A;  4XYL B;  3RIZ A;  2I80 A;  4LF7 H;  4DR1 H;  4RUC A;  3Q8Q B;  4JV5 H;  3N42 B;  4IRC A;  2ZDQ A;  2F4V H;  3LWB A;  2NU9 B;  4MV8 A;  3TQT A;  2FP4 B;  4RNN A;  3RF2 A;  2CKZ B;  2W9C B;  1RYR A;  2R82 A;  3BAA A;  5BMV F;  4ZOL F;  3GTM A;  3GIJ A;  4LFA H;  3U9S A;  4YQW A;  4X62 H;  2C22 A;  4M9U A;  5KFE A;  4X65 H;  3U9T A;  3RB4 A;  3OUU A;  3TIG A;  4J9K A;  5FPO A;  2R92 A;  2WAQ E;  3RGZ A;  4ED7 A;  3CQZ A;  2VPQ A;  3ETJ A;  4WBN F;  5DGA A;  3Q1K A;  5KKN B;  2B63 A;  1I94 H;  3GTK A;  4JV0 A;  4O3P A;  4XYM B;  2HGS A;  3Q8S B;  2V4R A;  2R7N A;  3E5N A;  4EBD A;  4NXN H;  4A3C G;  1E4E A;  4JI2 H;  2ASD A;  4DV7 H;  1JLL B;  2FKL A;  2XCP A;  2XGQ A;  5DQG A;  4J9L A;  3DF7 A;  5KT2 A;  4DUY H;  1XMO H;  4UCS A;  1VAJ A;  5KG4 A;  2RDJ A;  4YR3 A;  3UQ8 A;  1T3N A;  2W9A A;  2KSW A;  4DR6 H;  2JEI A;  3KTM A;  4ED6 A;  5EDW A;  5KFT A;  2B63 G;  1E4F T;  1AUX A;  4JV2 A;  2YS7 A;  4O3O A;  4A3M G;  1IBK H;  3RAQ A;  4A3L G;  2V59 A;  3IN5 A;  4DL2 A;  3PW5 A;  2DPJ A;  1BGW A;  1K1Q A;  4EGJ A;  3RJ0 A;  4YR0 A;  4GC6 A;  5KFR A;  5JVL A;  1FKA H;  4BY1 G;  2W6Z A;  2DLN A;  1SEI A;  2W9C A;  2R7M A;  4ZHQ F;  4C5C A;  5DLF A;  2R8K A;  2JA7 A;  3JSN A;  1VBH A;  4I50 F;  3T5K A;  4YJ2 F;  4BBR G;  5KFM A;  1BNC A;  3GIL A;  5L1J A;  4ED1 A;  1FJG H;  3HOZ G;  5KFW A;  2OWO A;  3M4I A;  4B3R H;  2W6M A;  5KFC A;  2GPW A;  3FDS A;  1GSO A;  1I50 A;  2J6T A;  3GIP A;  2AQ4 A;  2W9B B;  1JIH A;  1JDB B;  3ORR A;  2AGQ A;  2UVW A;  2Y0S A;  2JEF A;  4DLK A;  1K83 A;  5EOY A;  1N32 H;  1GGO A;  4OX9 H;  2JA7 G;  4J9Q A;  2PMZ E;  3PVX A;  3PW4 A;  1S97 A;  5IYC G;  5IYB G;  1RJQ A;  2W8K A;  4O2B F;  3HOY G;  3BA8 A;  3TIN A;  5D8D A;  1IOV A;  5LOV F;  4ECV A;  5KFS A;  3H40 A;  2C2R A;  2R8H A;  4WD3 A;  5KFG A;  4C5A A;  1RK6 A;  4YHH H;  3GTG A;  3MWM A;  2HVQ A;  2ZDG A;  4MA0 A;  4XX0 B;  5CA0 F;  4FS2 A;  1I7N A;  2DZD A;  3T5L A;  4A3I G;  4IR1 A;  3M9N B;  4IWY A;  2YW2 A;  1T36 A;  4TV8 F;  2C2D A;  2YZM A;  3R5F A;  5HBR B;  5L1L A;  3QZ8 A;  1B04 A;  4FU0 A;  4MV6 A;  5EZY F;  1GLV A;  3RUP A;  5CB4 F;  4JI0 H;  3HXL A;  2WB1 E;  1SCU B;  3KAK A;  4UCO A;  4RNM A;  4IR9 A;  1RJR A;  3K5I A;  4EEQ A;  3GTQ A;  3H4B A;  4C5B A;  2VQD A;  4GKJ H;  4Q44 A;  5KFV A;  4RB0 A;  3RB0 A;  5F9L A;  5LL6 b;  4ED2 A;  2WAQ A;  4JI4 H;  3I4M G;  4GC7 A; 
#chains in the Genus database with same CATH homology
 1OWT A;  4PWQ A;  2FJZ A;  2FMA A;  2FK2 A;  2FK3 A;  2FKL A;  3KTM A;  2M05 A;  2FK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...