2FK2A

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'small unit cell' form, cu(i)-bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fk2A00
4PWQA 3KTMA 2FMAA 2M05A 2FKLA 1OWTA 2FK1A 2FK3A 2FJZA 2FK2A
chains in the Genus database with same CATH superfamily
1AUVA 4LSXA 3JSNA 4DUYH 2YU9A 1PK8A 3R5FA 5C3EG 5D1OA 4A93G 2VUMA 3N43B 4YBZB 3LP8A 5D1OB 3PR5B 3GIPA 5IYCG 2W7OA 5DQIA 4NXMH 1TAEA 1TWFA 2RDIA 5KT5A 5FPOA 3HOVG 1BJTA 4DR1H 1X9NA 2W57A 3HXLA 4ME6A 1UC9A 3RJ0A 1RK6A 4HNTA 3RB6A 2W70A 2WE6A 4IR9A 1TWGA 4EBDA 1GSAA 3T5JA 3KHHA 2VUMG 4MTDA 4QW8A 3GTGA 4F50A 2JEIA 2IMWP 1B6RA 1S68A 2PVPA 4RB0A 5LMUH 3OSPA 4AYBA 2XCPA 3HOZG 2W8KA 2J6UA 1GSHA 4RB3C 2IA6A 1GGOA 4L1KA 4TV9F 5KFIA 2AQ4A 4X66H 1FVIA 5CB4F 5LYJF 4QWDA 5KG6A 5H80A 2R8JA 3RAXA 2WAQE 2C28A 3RUPA 2WTFA 2YS6A 4YP3A 4A3DG 4X62H 2I80A 4DV3H 5KFYA 1CQJB 4O3SA 2AGOA 4PDBA 3GILA 3IN5A 4QIWA 5LMNH 3CVZA 3KALA 3RGZA 4F4ZA 1M0TA 2WDTA 4JV1A 2FMAA 5LOVF 3ORQA 3E5NA 2VUGA 2M05A 2ATLA 2E5LH 1DV2A 2CZGA 3FMAA 5D1PA 3GTQA 4RNNA 1P8LA 4XYLB 5EWEA 5DLGA 1M6VA 4M9UA 5L9XA 4YY3H 5KFDA 2W8LA 4ED2A 2C2EA 4IWXA 2R8GA 4FBTA 5KFFA 4JI2H 4XZ3B 3HBLA 3RBDA 5L1IA 2R7NA 5GONF 2GLTA 4ECVA 4R8UB 5KFHA 3V6JA 3EPIA 5KFVA 1GLVA 3AYHB 4J9SA 4XX0B 4BBSG 2YCHA 4RB2C 2W9BA 1V51A 3OUUA 4A3GG 3DF7A 3RB4A 1Z2OX 4GLXA 3HOXG 4LF7H 5KT2A 3V6KA 4KHPH 3KTMA 2BQ3A 4UCVA 4F4YA 2YZMA 2VPQA 4DR3H 2FPPB 4JI4H 4DR4H 2VPSA 3MWMA 3GIIA 4RAZA 5KT3A 1T94A 4RNMA 4TUYF 4ED6A 4JYAH 2BR0A 4R7RA 3G8CA 1GSOA 2BQRA 1K1QA 3GV7B 4GC6A 5C1OA 1KJ8A 5F9LA 3VPDA 4ZOLF 3JAMW 5LA6F 3ETJA 2NU8B 3UFXB 4X64H 3EPGA 2C22A 4A3BG 2YYAA 4APMA 1RJPA 2JEGA 4Q0YA 4JI0H 4JV0A 3Q2OA 4J9QA 3SI8A 5L1LA 3ORRA 5KFZA 3PW4A 4LFBH 3K5HA 1HR0H 3GTLA 5KFUA 1SEIA 4I7HA 3R5XA 4RB1A 4X65H 2ZM6H 3PW2A 2CQYA 2R6FA 3U9SA 4O4IF 4DL6A 4MAMA 2XD4A 4YR0A 1TWCA 4O3NA 4Q45A 4IZOA 3C0FB 3RV4A 3WNZA 4EBCA 2YRXA 3GTMA 3RTXA 5JVLA 2R7MA 2HVQA 1KC7A 5F9NA 3PW7A 2VQDA 1JIHA 3FKIA 5KT7A 3RF2A 2R7ZA 4JV2A 3RB3A 5L1JA 5EOYA 2R87A 3RFCA 3T5HA 4FU0A 4DL3A 2E2HA 4A3CG 5KFTA 5IYZF 3RBEA 4Q8FA 3MR2A 4UCRA 2V58A 1O75A 1Y1VA 2NU7B 3K3PA 4DV6H 3F8NA 2W7PA 3PO3G 3N44B 2BQUA 2V5AA 1AUXA 2UU9H 3H0GG 2R84A 1Y14B 5C5JA 2ASLA 2FK2A 3JZIA 5HBRB 2YW2A 5EZYF 4QIWE 5KKNB 1Y1VG 5BR8H 3L2PA 4HR7A 1E4FT 4OX9H 3QZ7A 2IBKA 2X0SA 4UFZA 2FPIB 2XC9A 5KG3A 1S0OA 3PW5A 1TWHA 5KG1A 4EYHB 5DG9A 4UCSA 1OWTA 3VMMA 4BWSC 4LF5H 3OUZA 3L4JA 4F4WA 2FLPA 2XCAA 4MV3A 4QWAA 4JI6H 4GKKH 2FB9A 1EZ1A 1IBKH 3M9MB 5C8YF 3KHLA 5KX5F 2JA8G 5IP9G 3ETHA 3Q8QB 4EYIB 2P0AA 1S10A 2UXBH 5FD5A 5FJ8G 2VA2A 4LH6A 2DLNA 2CW8A 1VBHA 2GPWA 1JX4A 1KJ9A 4IHJF 2NUAB 5FPRA 4YR2A 2R82A 1JDEA 4YR3A 5J2TF 3QZ8A 4G3IA 1V4YA 1ZHSA 1IBLH 2J6TA 4ECQA 2J9GA 4I55F 5KG5A 1I3QA 1TWAA 4MV8A 4EEQA 3UQ8A 2AGQA 5CA1F 4JI1H 4A3EG 3Q1KA 3PW0A 3GTJA 3N41B 2MCTA 2R7KA 3HOYG 4FBUA 1Y1WG 1KEEA 5KFOA 4BY1G 4Q43A 1HNWH 4O2BF 5JH7F 4J0MA 5KFGA 3MR5A 5KFEA 2V4RA 3GTOA 4YB8B 1UNNC 5LXTF 1Z2NX 5BMVF 2W6PA 2YZNA 1N33H 4QW9A 3MFHA 3HKZA 4WBNF 1I94H 4QWCA 4LF4H 1XDNA 1IOVA 4R8UA 2UXDH 1EUCB 2NU6B 3LWBA 4ZQIA 2V59A 4JI3H 5JVDF 2W6ZA 4I50F 4B3SH 5DGAA 2UVRA 4DV1H 4J9KA 3JSLA 4ECYA 3V6HA 5DG8A 3MFIA 1DGSA 4EFEA 5KFNA 3G6XA 1I50A 3BG5A 4NXNH 4U7CA 5KFKA 4J9RA 4ED3A 2VOBA 4UCUA 5IWAH 5LP6F 1SCUB 4AQYH 4YQWA 4O3QA 4JV5H 3MWDA 4HQ6A 2FE3A 2Y0SA 2RGRA 5KFRA 1ZHQA 1K1SA 4ECWA 4DR6H 3J7AK 4EGJA 2I87A 4MA5A 5KFSA 4ECXA 3I4NG 1JKJB 4CC6A 4C5BA 3G6VA 2R8HA 3T1YH 4JI5H 3EYYA 4DR5H 1RK5A 2I8CA 2R85A 4TQSA 2GPSA 1KJJA 2ALZA 4A2AA 1L2ZA 2PMZE 5FLXW 4O3PA 3H40A 5KFQA 3N42B 2JA6G 4C2MA 1T36A 3KAJA 1WR2A 2HVRA 3GIKA 1N34H 3HOUG 5KFWA 5BPHA 4LFCH 2WAQA 1W96A 4EG0A 4A3MG 3N8DA 3RGXA 5L1KA 4EEYA 1E4GT 3Q8PB 1XMQH 4RUAA 1S03G 5IT9W 3TQ1A 2UVUA 4C5CA 3U9TA 4B3TH 4ECSA 1KJQA 3H4BA 4CC5A 1VKZA 3KAKA 1CQIB 2ASJA 4ED7A 4J9LA 5I47A 4DV7H 3H0GA 1I6UA 4BY7G 4JI8H 2WB1A 2PBZA 2CW7A 1B33N 2YS7A 4MV9A 4E4TA 4HYKA 4AYBE 4YAKB 5DGBA 2W9CB 2HGSA 2YRWA 4MV7A 4GKJH 3T5LA 1N48A 1FJGH 1DIKA 1E4EB 2JA7A 1VS0A 1I7LA 2XCLA 1N56A 5KFLA 4IRCA 3CQZA 4MV6A 4DR7H 4ECUA 4A3FG 5KG7A 4QWBA 4J9OA 1A0IA 5KG2A 3GV8B 3RAQA 2R86A 5FD6A 1KBLA 5BPFA 3V4SA 3PR4A 3H20A 4LF8H 3H4DA 2JA7G 5A2QW 4A3KG 1MZBA 4ETSA 5KT4A 4PWQA 1S0MA 4Y8VB 4LSAA 3TIIA 4DL2A 3PVXA 1N36H 1EHIA 2JA5A 3GIJA 3V4ZA 4B3MH 3K3VA 2W6OA 5JUMA 4DL5A 5KFBA 3BQ1A 1XNQH 3WO1A 2VR1A 4WD3A 2HVSA 5HV6A 2ZDQA 4DV0H 2WYOA 3KXYT 3MR3A 3VPCA 2ZDGA 2ASDA 2JA5G 3H3VH 4A3LG 3BAAA 4BXXG 4DR2H 1DV1A 2O03A 1K83A 3PN1A 4DLKA 1ULZA 2W6QA 4ED8A 2ZJTA 3Q8RB 2Q2UA 3GLKA 4DL7A 4LF9H 4DUZH 2FK3A 5KT6A 1Y1WA 4DV2H 4EFBA 3R5HA 5KFPA 2V9WA 4O3RA 3Q8SB 4ECRA 1WSCA 2Y0SE 3MR6A 2DPJA 1EUDB 1I7NA 2R8IA 5T14A 2FP4B 4O4LF 1N32H 4BBRG 5EDWA 1SFOA 5C1PA 3GIQA 5DLFA 4DV4H 2OH2A 3MJFA 2RGVA 1RYSA 1XMOH 4XYMB 4ZHQF 5C4XG 1VAJA 3M4IA 3J80W 4DL4A 5IYBG 4JUZA 1HNXH 5K2MA 4IWYA 3T1HH 2YL2A 3RB0A 5KFMA 3T5KA 2R93A 1RYRA 4O3OA 3SE7A 2W6NA 3BQ2A 1WH2A 3M9OB 2NVYA 5IP7G 4FS2A 3HOWG 2C00A 1VBGA 3JRWA 4RUCA 2AU0A 1UC8A 4FM9A 4O4HF 1WCMA 3OSNA 2C2DA 3N40P 4I4TF 5CAEB 2Q2TA 2R93G 5KFAA 1RJRA 3TQTA 3BABA 2WB1E 4HNUA 2HHHH 3GIDA 4RU9A 4J9MA 3N6XA 1R9TA 2V4QA 2W6MA 3TIGA 1C3OA 4IAJA 4M7EA 2FLLA 3J81W 1GYFA 2KSWA 1WCMG 4O2AF 2R8KA 4GC7A 1KJIA 2W9BB 2JA6A 3G6YA 5DQGA 1S0NA 1RJQA 2HJWA 3K5IA 3KHRA 3PZPA 2C2RA 1T3NA 1S9FA 4Q8EA 1HNZH 4RZQA 4UCOA 4HNVA 4MV1A 2J6SA 1GO3E 2VA3A 3FDSA 5IYDG 4IRKA 1M0WA 2DWCA 5EWFA 2RF4A 3I12A 1BNCA 1CS0A 2W71A 2IP4A 1J5EH 3L4KA 2CKZB 1M7JA 3R23A 4K0KH 3JRXA 3RV3A 3GQCA 3OTOH 4ED0A 2FLNA 3NGDA 2NU9B 2QK4A 4YHHH 4JI7H 1W93A 2ZDHA 1ZETA 3GIMA 4RAYA 1JXLA 3GTPA 2SCUB 3GTKA 3RIZA 1IOWA 2OLSA 1FKAH 2OWOA 2QYZA 2XIGA 4Q44A 4NLGA 2UUCH 3TINA 1JLLB 4ZI7F 3BQ0A 4EBEA 4MA0A 1B04A 2JEJA 3QFFA 2RDJA 2VQFH 4TQRA 5FLMG 2B63A 4U6PA 3BJYA 4MTEA 4RNOA 5JQWA 4A2BA 5DQHA 4UCTA 2W9CA 5CA0F 1B6SA 2UVWA 2R7LA 1ZQ7A 5KG4A 4J9NA 3MWEA 5KFCA 3IG0A 2FJZA 1C30A 1E4EA 2JEFA 5LL6b 2B63G 4RZRA 4ECTA 5KG0A 1SYXB 1V9PA 3WO0A 2DZDA 4LMYA 4LH7A 4YJ2F 3M9NB 2UXCH 4ECZA 1IBMH 4F4XA 4ED1A 4LFAH 4YJ3F 4C5AA 5C44G 3I4MG 1TA8A 2FKLA 2FPGB 1EYZA 3BA8A 2PN1A 2YZGA 4A3JG 1XNRH 5DG7A 3FKIG 2R92A 3HKZE 1Z2PX 2R7ZG 4FS1A 2XGQA 3KHGA 3OHAA 2UUBH 3PO2G 4J9PA 4YAJB 2UVVA 4TV8F 1CE8A 1JDBB 4EGQA 5J2UF 2FK1A 1BXRA 1A9XA 5D8DA 5KFJA 4LF6H 4MV4A 4QJFA 3VPBA 5EWGA 1S97A 5KFXA 2XGPA 2R92G 2DIKA 2PMZA 2C35B 3BA9A 2VQEH 4DV5H 3OHBA 2F4VH 2AGPA 2UUAH 4IR1A 2E2IA 2DPIA 1BGWA 3GV5B 4IRDA 2NVXA 1PX2A 4QWEA 1AN7A 3LMLA 4A3IG 2W9AA 3HB9A 4B3RH
chains in the Genus database with same CATH topology
4PWQA 3KTMA 2FMAA 2M05A 2FKLA 1OWTA 2FK1A 2FK3A 2FJZA 2FK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PWQ A;  3KTM A;  2FMA A;  2M05 A;  2FKL A;  1OWT A;  2FK1 A;  2FK3 A;  2FJZ A;  2FK2 A; 
#chains in the Genus database with same CATH topology
 1AUV A;  4LSX A;  3JSN A;  4DUY H;  2YU9 A;  1PK8 A;  3R5F A;  5C3E G;  5D1O A;  4A93 G;  2VUM A;  3N43 B;  4YBZ B;  3LP8 A;  5D1O B;  3PR5 B;  3GIP A;  5IYC G;  2W7O A;  5DQI A;  4NXM H;  1TAE A;  1TWF A;  2RDI A;  5KT5 A;  5FPO A;  3HOV G;  1BJT A;  4DR1 H;  1X9N A;  2W57 A;  3HXL A;  4ME6 A;  1UC9 A;  3RJ0 A;  1RK6 A;  4HNT A;  3RB6 A;  2W70 A;  2WE6 A;  4IR9 A;  1TWG A;  4EBD A;  1GSA A;  3T5J A;  3KHH A;  2VUM G;  4MTD A;  4QW8 A;  3GTG A;  4F50 A;  2JEI A;  2IMW P;  1B6R A;  1S68 A;  2PVP A;  4RB0 A;  5LMU H;  3OSP A;  4AYB A;  2XCP A;  3HOZ G;  2W8K A;  2J6U A;  1GSH A;  4RB3 C;  2IA6 A;  1GGO A;  4L1K A;  4TV9 F;  5KFI A;  2AQ4 A;  4X66 H;  1FVI A;  5CB4 F;  5LYJ F;  4QWD A;  5KG6 A;  5H80 A;  2R8J A;  3RAX A;  2WAQ E;  2C28 A;  3RUP A;  2WTF A;  2YS6 A;  4YP3 A;  4A3D G;  4X62 H;  2I80 A;  4DV3 H;  5KFY A;  1CQJ B;  4O3S A;  2AGO A;  4PDB A;  3GIL A;  3IN5 A;  4QIW A;  5LMN H;  3CVZ A;  3KAL A;  3RGZ A;  4F4Z A;  1M0T A;  2WDT A;  4JV1 A;  2FMA A;  5LOV F;  3ORQ A;  3E5N A;  2VUG A;  2M05 A;  2ATL A;  2E5L H;  1DV2 A;  2CZG A;  3FMA A;  5D1P A;  3GTQ A;  4RNN A;  1P8L A;  4XYL B;  5EWE A;  5DLG A;  1M6V A;  4M9U A;  5L9X A;  4YY3 H;  5KFD A;  2W8L A;  4ED2 A;  2C2E A;  4IWX A;  2R8G A;  4FBT A;  5KFF A;  4JI2 H;  4XZ3 B;  3HBL A;  3RBD A;  5L1I A;  2R7N A;  5GON F;  2GLT A;  4ECV A;  4R8U B;  5KFH A;  3V6J A;  3EPI A;  5KFV A;  1GLV A;  3AYH B;  4J9S A;  4XX0 B;  4BBS G;  2YCH A;  4RB2 C;  2W9B A;  1V51 A;  3OUU A;  4A3G G;  3DF7 A;  3RB4 A;  1Z2O X;  4GLX A;  3HOX G;  4LF7 H;  5KT2 A;  3V6K A;  4KHP H;  3KTM A;  2BQ3 A;  4UCV A;  4F4Y A;  2YZM A;  2VPQ A;  4DR3 H;  2FPP B;  4JI4 H;  4DR4 H;  2VPS A;  3MWM A;  3GII A;  4RAZ A;  5KT3 A;  1T94 A;  4RNM A;  4TUY F;  4ED6 A;  4JYA H;  2BR0 A;  4R7R A;  3G8C A;  1GSO A;  2BQR A;  1K1Q A;  3GV7 B;  4GC6 A;  5C1O A;  1KJ8 A;  5F9L A;  3VPD A;  4ZOL F;  3JAM W;  5LA6 F;  3ETJ A;  2NU8 B;  3UFX B;  4X64 H;  3EPG A;  2C22 A;  4A3B G;  2YYA A;  4APM A;  1RJP A;  2JEG A;  4Q0Y A;  4JI0 H;  4JV0 A;  3Q2O A;  4J9Q A;  3SI8 A;  5L1L A;  3ORR A;  5KFZ A;  3PW4 A;  4LFB H;  3K5H A;  1HR0 H;  3GTL A;  5KFU A;  1SEI A;  4I7H A;  3R5X A;  4RB1 A;  4X65 H;  2ZM6 H;  3PW2 A;  2CQY A;  2R6F A;  3U9S A;  4O4I F;  4DL6 A;  4MAM A;  2XD4 A;  4YR0 A;  1TWC A;  4O3N A;  4Q45 A;  4IZO A;  3C0F B;  3RV4 A;  3WNZ A;  4EBC A;  2YRX A;  3GTM A;  3RTX A;  5JVL A;  2R7M A;  2HVQ A;  1KC7 A;  5F9N A;  3PW7 A;  2VQD A;  1JIH A;  3FKI A;  5KT7 A;  3RF2 A;  2R7Z A;  4JV2 A;  3RB3 A;  5L1J A;  5EOY A;  2R87 A;  3RFC A;  3T5H A;  4FU0 A;  4DL3 A;  2E2H A;  4A3C G;  5KFT A;  5IYZ F;  3RBE A;  4Q8F A;  3MR2 A;  4UCR A;  2V58 A;  1O75 A;  1Y1V A;  2NU7 B;  3K3P A;  4DV6 H;  3F8N A;  2W7P A;  3PO3 G;  3N44 B;  2BQU A;  2V5A A;  1AUX A;  2UU9 H;  3H0G G;  2R84 A;  1Y14 B;  5C5J A;  2ASL A;  2FK2 A;  3JZI A;  5HBR B;  2YW2 A;  5EZY F;  4QIW E;  5KKN B;  1Y1V G;  5BR8 H;  3L2P A;  4HR7 A;  1E4F T;  4OX9 H;  3QZ7 A;  2IBK A;  2X0S A;  4UFZ A;  2FPI B;  2XC9 A;  5KG3 A;  1S0O A;  3PW5 A;  1TWH A;  5KG1 A;  4EYH B;  5DG9 A;  4UCS A;  1OWT A;  3VMM A;  4BWS C;  4LF5 H;  3OUZ A;  3L4J A;  4F4W A;  2FLP A;  2XCA A;  4MV3 A;  4QWA A;  4JI6 H;  4GKK H;  2FB9 A;  1EZ1 A;  1IBK H;  3M9M B;  5C8Y F;  3KHL A;  5KX5 F;  2JA8 G;  5IP9 G;  3ETH A;  3Q8Q B;  4EYI B;  2P0A A;  1S10 A;  2UXB H;  5FD5 A;  5FJ8 G;  2VA2 A;  4LH6 A;  2DLN A;  2CW8 A;  1VBH A;  2GPW A;  1JX4 A;  1KJ9 A;  4IHJ F;  2NUA B;  5FPR A;  4YR2 A;  2R82 A;  1JDE A;  4YR3 A;  5J2T F;  3QZ8 A;  4G3I A;  1V4Y A;  1ZHS A;  1IBL H;  2J6T A;  4ECQ A;  2J9G A;  4I55 F;  5KG5 A;  1I3Q A;  1TWA A;  4MV8 A;  4EEQ A;  3UQ8 A;  2AGQ A;  5CA1 F;  4JI1 H;  4A3E G;  3Q1K A;  3PW0 A;  3GTJ A;  3N41 B;  2MCT A;  2R7K A;  3HOY G;  4FBU A;  1Y1W G;  1KEE A;  5KFO A;  4BY1 G;  4Q43 A;  1HNW H;  4O2B F;  5JH7 F;  4J0M A;  5KFG A;  3MR5 A;  5KFE A;  2V4R A;  3GTO A;  4YB8 B;  1UNN C;  5LXT F;  1Z2N X;  5BMV F;  2W6P A;  2YZN A;  1N33 H;  4QW9 A;  3MFH A;  3HKZ A;  4WBN F;  1I94 H;  4QWC A;  4LF4 H;  1XDN A;  1IOV A;  4R8U A;  2UXD H;  1EUC B;  2NU6 B;  3LWB A;  4ZQI A;  2V59 A;  4JI3 H;  5JVD F;  2W6Z A;  4I50 F;  4B3S H;  5DGA A;  2UVR A;  4DV1 H;  4J9K A;  3JSL A;  4ECY A;  3V6H A;  5DG8 A;  3MFI A;  1DGS A;  4EFE A;  5KFN A;  3G6X A;  1I50 A;  3BG5 A;  4NXN H;  4U7C A;  5KFK A;  4J9R A;  4ED3 A;  2VOB A;  4UCU A;  5IWA H;  5LP6 F;  1SCU B;  4AQY H;  4YQW A;  4O3Q A;  4JV5 H;  3MWD A;  4HQ6 A;  2FE3 A;  2Y0S A;  2RGR A;  5KFR A;  1ZHQ A;  1K1S A;  4ECW A;  4DR6 H;  3J7A K;  4EGJ A;  2I87 A;  4MA5 A;  5KFS A;  4ECX A;  3I4N G;  1JKJ B;  4CC6 A;  4C5B A;  3G6V A;  2R8H A;  3T1Y H;  4JI5 H;  3EYY A;  4DR5 H;  1RK5 A;  2I8C A;  2R85 A;  4TQS A;  2GPS A;  1KJJ A;  2ALZ A;  4A2A A;  1L2Z A;  2PMZ E;  5FLX W;  4O3P A;  3H40 A;  5KFQ A;  3N42 B;  2JA6 G;  4C2M A;  1T36 A;  3KAJ A;  1WR2 A;  2HVR A;  3GIK A;  1N34 H;  3HOU G;  5KFW A;  5BPH A;  4LFC H;  2WAQ A;  1W96 A;  4EG0 A;  4A3M G;  3N8D A;  3RGX A;  5L1K A;  4EEY A;  1E4G T;  3Q8P B;  1XMQ H;  4RUA A;  1S03 G;  5IT9 W;  3TQ1 A;  2UVU A;  4C5C A;  3U9T A;  4B3T H;  4ECS A;  1KJQ A;  3H4B A;  4CC5 A;  1VKZ A;  3KAK A;  1CQI B;  2ASJ A;  4ED7 A;  4J9L A;  5I47 A;  4DV7 H;  3H0G A;  1I6U A;  4BY7 G;  4JI8 H;  2WB1 A;  2PBZ A;  2CW7 A;  1B33 N;  2YS7 A;  4MV9 A;  4E4T A;  4HYK A;  4AYB E;  4YAK B;  5DGB A;  2W9C B;  2HGS A;  2YRW A;  4MV7 A;  4GKJ H;  3T5L A;  1N48 A;  1FJG H;  1DIK A;  1E4E B;  2JA7 A;  1VS0 A;  1I7L A;  2XCL A;  1N56 A;  5KFL A;  4IRC A;  3CQZ A;  4MV6 A;  4DR7 H;  4ECU A;  4A3F G;  5KG7 A;  4QWB A;  4J9O A;  1A0I A;  5KG2 A;  3GV8 B;  3RAQ A;  2R86 A;  5FD6 A;  1KBL A;  5BPF A;  3V4S A;  3PR4 A;  3H20 A;  4LF8 H;  3H4D A;  2JA7 G;  5A2Q W;  4A3K G;  1MZB A;  4ETS A;  5KT4 A;  4PWQ A;  1S0M A;  4Y8V B;  4LSA A;  3TII A;  4DL2 A;  3PVX A;  1N36 H;  1EHI A;  2JA5 A;  3GIJ A;  3V4Z A;  4B3M H;  3K3V A;  2W6O A;  5JUM A;  4DL5 A;  5KFB A;  3BQ1 A;  1XNQ H;  3WO1 A;  2VR1 A;  4WD3 A;  2HVS A;  5HV6 A;  2ZDQ A;  4DV0 H;  2WYO A;  3KXY T;  3MR3 A;  3VPC A;  2ZDG A;  2ASD A;  2JA5 G;  3H3V H;  4A3L G;  3BAA A;  4BXX G;  4DR2 H;  1DV1 A;  2O03 A;  1K83 A;  3PN1 A;  4DLK A;  1ULZ A;  2W6Q A;  4ED8 A;  2ZJT A;  3Q8R B;  2Q2U A;  3GLK A;  4DL7 A;  4LF9 H;  4DUZ H;  2FK3 A;  5KT6 A;  1Y1W A;  4DV2 H;  4EFB A;  3R5H A;  5KFP A;  2V9W A;  4O3R A;  3Q8S B;  4ECR A;  1WSC A;  2Y0S E;  3MR6 A;  2DPJ A;  1EUD B;  1I7N A;  2R8I A;  5T14 A;  2FP4 B;  4O4L F;  1N32 H;  4BBR G;  5EDW A;  1SFO A;  5C1P A;  3GIQ A;  5DLF A;  4DV4 H;  2OH2 A;  3MJF A;  2RGV A;  1RYS A;  1XMO H;  4XYM B;  4ZHQ F;  5C4X G;  1VAJ A;  3M4I A;  3J80 W;  4DL4 A;  5IYB G;  4JUZ A;  1HNX H;  5K2M A;  4IWY A;  3T1H H;  2YL2 A;  3RB0 A;  5KFM A;  3T5K A;  2R93 A;  1RYR A;  4O3O A;  3SE7 A;  2W6N A;  3BQ2 A;  1WH2 A;  3M9O B;  2NVY A;  5IP7 G;  4FS2 A;  3HOW G;  2C00 A;  1VBG A;  3JRW A;  4RUC A;  2AU0 A;  1UC8 A;  4FM9 A;  4O4H F;  1WCM A;  3OSN A;  2C2D A;  3N40 P;  4I4T F;  5CAE B;  2Q2T A;  2R93 G;  5KFA A;  1RJR A;  3TQT A;  3BAB A;  2WB1 E;  4HNU A;  2HHH H;  3GID A;  4RU9 A;  4J9M A;  3N6X A;  1R9T A;  2V4Q A;  2W6M A;  3TIG A;  1C3O A;  4IAJ A;  4M7E A;  2FLL A;  3J81 W;  1GYF A;  2KSW A;  1WCM G;  4O2A F;  2R8K A;  4GC7 A;  1KJI A;  2W9B B;  2JA6 A;  3G6Y A;  5DQG A;  1S0N A;  1RJQ A;  2HJW A;  3K5I A;  3KHR A;  3PZP A;  2C2R A;  1T3N A;  1S9F A;  4Q8E A;  1HNZ H;  4RZQ A;  4UCO A;  4HNV A;  4MV1 A;  2J6S A;  1GO3 E;  2VA3 A;  3FDS A;  5IYD G;  4IRK A;  1M0W A;  2DWC A;  5EWF A;  2RF4 A;  3I12 A;  1BNC A;  1CS0 A;  2W71 A;  2IP4 A;  1J5E H;  3L4K A;  2CKZ B;  1M7J A;  3R23 A;  4K0K H;  3JRX A;  3RV3 A;  3GQC A;  3OTO H;  4ED0 A;  2FLN A;  3NGD A;  2NU9 B;  2QK4 A;  4YHH H;  4JI7 H;  1W93 A;  2ZDH A;  1ZET A;  3GIM A;  4RAY A;  1JXL A;  3GTP A;  2SCU B;  3GTK A;  3RIZ A;  1IOW A;  2OLS A;  1FKA H;  2OWO A;  2QYZ A;  2XIG A;  4Q44 A;  4NLG A;  2UUC H;  3TIN A;  1JLL B;  4ZI7 F;  3BQ0 A;  4EBE A;  4MA0 A;  1B04 A;  2JEJ A;  3QFF A;  2RDJ A;  2VQF H;  4TQR A;  5FLM G;  2B63 A;  4U6P A;  3BJY A;  4MTE A;  4RNO A;  5JQW A;  4A2B A;  5DQH A;  4UCT A;  2W9C A;  5CA0 F;  1B6S A;  2UVW A;  2R7L A;  1ZQ7 A;  5KG4 A;  4J9N A;  3MWE A;  5KFC A;  3IG0 A;  2FJZ A;  1C30 A;  1E4E A;  2JEF A;  5LL6 b;  2B63 G;  4RZR A;  4ECT A;  5KG0 A;  1SYX B;  1V9P A;  3WO0 A;  2DZD A;  4LMY A;  4LH7 A;  4YJ2 F;  3M9N B;  2UXC H;  4ECZ A;  1IBM H;  4F4X A;  4ED1 A;  4LFA H;  4YJ3 F;  4C5A A;  5C44 G;  3I4M G;  1TA8 A;  2FKL A;  2FPG B;  1EYZ A;  3BA8 A;  2PN1 A;  2YZG A;  4A3J G;  1XNR H;  5DG7 A;  3FKI G;  2R92 A;  3HKZ E;  1Z2P X;  2R7Z G;  4FS1 A;  2XGQ A;  3KHG A;  3OHA A;  2UUB H;  3PO2 G;  4J9P A;  4YAJ B;  2UVV A;  4TV8 F;  1CE8 A;  1JDB B;  4EGQ A;  5J2U F;  2FK1 A;  1BXR A;  1A9X A;  5D8D A;  5KFJ A;  4LF6 H;  4MV4 A;  4QJF A;  3VPB A;  5EWG A;  1S97 A;  5KFX A;  2XGP A;  2R92 G;  2DIK A;  2PMZ A;  2C35 B;  3BA9 A;  2VQE H;  4DV5 H;  3OHB A;  2F4V H;  2AGP A;  2UUA H;  4IR1 A;  2E2I A;  2DPI A;  1BGW A;  3GV5 B;  4IRD A;  2NVX A;  1PX2 A;  4QWE A;  1AN7 A;  3LML A;  4A3I G;  2W9A A;  3HB9 A;  4B3R H; 
#chains in the Genus database with same CATH homology
 4PWQ A;  3KTM A;  2FMA A;  2M05 A;  2FKL A;  1OWT A;  2FK1 A;  2FK3 A;  2FJZ A;  2FK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...