2FK2A

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'small unit cell' form, cu(i)-bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Amyloid beta A4 protein precursor
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fk2A00
1OWTA 3KTMA 2FK3A 2FK1A 2M05A 2FJZA 4PWQA 2FKLA 2FMAA 2FK2A
chains in the Genus database with same CATH superfamily
2W9CA 2X0SA 4O3OA 2DWCA 5FD6A 2W71A 1VAJA 4DV5H 2VQDA 4DL4A 1L2ZA 5KT5A 2NVXA 3PN1A 3Q8SB 3V6KA 4BY7G 1I50A 5IYDG 4EYIB 2R93G 5KT7A 1AUVA 2PMZA 2GPWA 3RV3A 5KG5A 2RDJA 3F8NA 3I12A 4I50F 4G3IA 3V4SA 4MV4A 2B63G 4F4XA 1DIKA 4A3KG 2XCAA 4A2AA 1W93A 4DV7H 3PW5A 4ECTA 5F9LA 4J9OA 2R92G 3MFHA 4DR2H 2CW8A 5DGBA 3RB4A 2IBKA 4LFAH 1KJJA 4IRDA 2W6QA 2V5AA 2NU8B 2J6SA 3TINA 4A3FG 4JI2H 2J6TA 4MV6A 1VS0A 1V9PA 4A3MG 2JEFA 1C3OA 3PO2G 3L2PA 3OTOH 2YZGA 2W9BB 4LF5H 5A2QW 5CA0F 4TV8F 2FKLA 3KXYT 1EZ1A 4XYMB 5D1OA 2JEGA 2R8IA 2UVUA 4DR3H 3JZIA 5C3EG 3MFIA 3EYYA 3V6HA 2JEIA 2FK3A 2QK4A 3N41B 3WO0A 5KFEA 3IG0A 3N42B 4DL7A 3H3VH 2W6PA 2XD4A 5C1OA 2AGOA 4E4TA 4EG0A 2FLNA 1E4GT 3ETJA 3N44B 5HBRB 4U6PA 3J81W 1SEIA 4NLGA 4NXNH 2RGVA 4DR4H 4Q8FA 2ZM6H 2ZDGA 4ECWA 5JH7F 2VUMA 2R7MA 2R8HA 4UFZA 1S03G 1RJPA 5C5JA 4FS1A 1PK8A 5FD5A 4UCVA 2BQRA 2JEJA 4I4TF 5L1KA 4X66H 4LF8H 4EFEA 1Y1VG 4UCSA 4Q45A 2HJWA 5BR8H 4LF6H 4ZHQF 5JUMA 3M4IA 4LH7A 4YQWA 2VOBA 3FKIA 2W9BA 4ZI7F 5IT9W 5KG7A 4YY3H 4RNOA 3KAJA 4MTDA 3L4JA 3MWMA 4A3LG 4BBSG 3R5FA 2AGPA 1ZQ7A 3TIIA 2JA5G 2JA6G 3AYHB 5KG1A 4J9KA 4RUCA 2Q2TA 4PDBA 3VPBA 3K5IA 5KFZA 3GIIA 2M05A 4EGJA 4YR2A 4DL6A 3RB6A 4GKKH 3LMLA 4TQRA 3OSPA 3U9SA 4DR1H 5KT2A 2XCPA 3J7AK 1K1SA 2J9GA 3PW7A 2W9CB 2UU9H 1EUCB 1WCMA 4RB3C 4HNVA 4JV1A 4O3RA 3GIMA 2NU7B 4JI6H 2YS6A 4C5CA 3GQCA 2PN1A 1BJTA 4C5AA 3BABA 3QZ7A 5H80A 4A3CG 4X65H 4LF4H 3RAXA 2YZNA 1E4EB 2NVYA 3GV7B 4J9LA 2V59A 3KHLA 3T5HA 4YR3A 4JI8H 4MTEA 2UUCH 1VBGA 2PVPA 1Y1WA 4R7RA 5K2MA 2DPIA 4F50A 4J9NA 5BPHA 3T5KA 4APMA 5DGAA 2YRXA 2UXDH 1S9FA 1KEEA 1T36A 4J9MA 1J5EH 2OWOA 1B04A 3RFCA 3K5HA 5KFUA 3QZ8A 2W7PA 3T1HH 2C00A 4WBNF 3GIQA 5KFYA 2UVVA 4QWEA 3HOUG 5KFBA 3JRWA 4Q43A 4JI3H 2DZDA 5KFSA 1JX4A 1E4EA 2SCUB 1JIHA 3Q1KA 4QW8A 5KG2A 4DV0H 2WTFA 2ASJA 2BQ3A 5FLMG 3JAMW 4YP3A 4ED2A 4C2MA 1CQJB 1GLVA 4ECUA 3EPGA 4JV0A 1P8LA 1V4YA 2W7OA 1RK6A 4AYBA 5JQWA 4FM9A 4EFBA 3BA9A 3N40P 4RU9A 4O3QA 5J2TF 4O2AF 1RYRA 3HB9A 4IRCA 2ASLA 1IBMH 1XNRH 2C22A 4X64H 5EWGA 1IBLH 4GC6A 3WO1A 4K0KH 4MV9A 3H4DA 5IP7G 4EEYA 1WH2A 3UFXB 2QYZA 1KJ8A 4GC7A 3KAKA 2R86A 5EWFA 1B6SA 3GLKA 4B3RH 2JA8G 3J80W 2J6UA 2F4VH 1CE8A 1CS0A 1RYSA 2WDTA 2FLPA 2W6ZA 3HOWG 5CA1F 2FMAA 4ECQA 2Y0SE 4YJ2F 2P0AA 3G8CA 2R92A 2R7NA 3HKZA 3H40A 3C0FB 3M9OB 2YZMA 4FBTA 4A3GG 4KHPH 4BWSC 3PW0A 2VQFH 1JDBB 3MJFA 4A3DG 2W8LA 4A3BG 1XNQH 2YU9A 4B3MH 1W96A 2HVRA 4YBZB 3KHRA 5IP9G 1R9TA 1DV1A 2ZDHA 5IWAH 4JI0H 1EYZA 4LF9H 1UC8A 3KTMA 2E2IA 4ED6A 1B33N 3V4ZA 2R8GA 2PMZE 1Z2PX 4AQYH 2I8CA 3U9TA 3NGDA 2R82A 5C8YF 3RBDA 4RB0A 2WAQE 3KHHA 2R7KA 4O2BF 1JLLB 3FMAA 2BQUA 1T3NA 2YRWA 5JVLA 5KFJA 4HNUA 1KBLA 4MV3A 2FPGB 4YJ3F 2CQYA 2NUAB 3T5JA 3BQ2A 2FLLA 4ECRA 1C30A 3FKIG 1EHIA 3G6YA 3QFFA 3M9NB 4ECXA 2R85A 2W8KA 5L1IA 5KFOA 3G6XA 4DV2H 1K1QA 4MV1A 5D8DA 4JI5H 4LF7H 5LYJF 3K3VA 5LA6F 2C35B 3H0GG 2VPSA 1S0OA 1CQIB 2O03A 4ZQIA 5F9NA 5KFMA 5KG3A 4J9SA 2C2RA 4RAZA 2R8JA 1TWAA 4UCRA 2JA7G 3CVZA 2C2DA 2CW7A 5LMNH 2AQ4A 4JYAH 2HVSA 2XCLA 4RNNA 4RB1A 5KFFA 4DV3H 1TWCA 3HXLA 2XC9A 1GO3E 5EOYA 1WSCA 4J0MA 3KHGA 1E4FT 3RAQA 4LFBH 2YYAA 2WE6A 4QWBA 4B3TH 5LL6b 5EWEA 3OSNA 4O4LF 3GTOA 5IYBG 2IP4A 4QWDA 1V51A 1BNCA 1JKJB 3HBLA 4MA0A 5L9XA 3FDSA 5KT6A 4QWCA 4MAMA 4QWAA 3G6VA 1S10A 1FKAH 3OUZA 5KFIA 1WCMG 2MCTA 5GONF 4TV9F 3WNZA 4TUYF 3GTGA 3BAAA 4M9UA 5DG9A 4ED8A 1TWFA 1XMOH 5KFVA 4TQSA 1TWHA 1GSAA 4A93G 2GLTA 4HNTA 4DR6H 1KJ9A 4YB8B 1SCUB 3Q2OA 3PZPA 2IMWP 4ETSA 3PR5B 4MA5A 3GTJA 5C4XG 3TQTA 4ECYA 3GTMA 1T94A 2DPJA 2V58A 2AU0A 5BMVF 4GLXA 2YS7A 2DLNA 3GV5B 5DQIA 2HVQA 3RV4A 1A0IA 1KJIA 4RZRA 3Q8RB 2FPPB 5KFNA 1B6RA 3M9MB 5LP6F 1FVIA 4RB2C 2JA6A 2E5LH 1UC9A 5KKNB 3HKZE 3LWBA 4YHHH 5EZYF 4JV5H 1WR2A 2FK1A 5BPFA 5KFTA 2ASDA 1Z2OX 1FJGH 2ATLA 1EUDB 5KFKA 4R8UB 4ED3A 1O75A 2V9WA 3MR6A 3GIPA 4DR5H 2NU6B 3ORQA 3VMMA 3RGZA 4AYBE 3N6XA 4UCUA 3R5XA 3KALA 2WB1A 5KT4A 2NU9B 1KJQA 4DUZH 4ED0A 2VA3A 2W6MA 5KG0A 5KFCA 5FLXW 2V4RA 4IRKA 2HHHH 4MV8A 2W57A 3V6JA 1HR0H 4RNMA 2XGQA 4EBDA 2FB9A 5EDWA 1M0TA 5KFLA 2R84A 4J9PA 4Q44A 2Q2UA 3T1YH 4IZOA 1I94H 4IR1A 2VA2A 4QIWE 1I6UA 2AGQA 4ME6A 3MWDA 4HR7A 5KT3A 2XIGA 2R8KA 4A2BA 2WYOA 1M0WA 4ECZA 5JVDF 2W70A 3BA8A 1ZHQA 1Y14B 4IAJA 4UCTA 5DG8A 4RUAA 3HOZG 1HNXH 1HNWH 1AUXA 4LH6A 4BY1G 5L1JA 2FJZA 4J9RA 2JA7A 3I4NG 4UCOA 1ULZA 4Q0YA 3JRXA 4LSXA 4DV4H 1K83A 2UXBH 4IR9A 3OUUA 4O3SA 2ALZA 3LP8A 4EBEA 4ECSA 2UXCH 4L1KA 5KFQA 5KFHA 3PW4A 1PX2A 4ECVA 1N56A 3N8DA 4GKJH 3H4BA 1GYFA 5IYZF 3PVXA 1IOWA 5I47A 3RB3A 3I4MG 3CQZA 3HOYG 4MV7A 4IWYA 5C1PA 1GSOA 3GTLA 1X9NA 2VUMG 2I80A 4A3IG 3ETHA 5KFXA 4F4YA 2VUGA 1S0NA 2UVRA 5J2UF 2C2EA 2YW2A 4O4HF 1UNNC 3H20A 4O3NA 1JDEA 4EGQA 5LOVF 2CKZB 3Q8QB 4XYLB 2RGRA 3GTKA 2W6NA 1DGSA 2UVWA 3T5LA 1Z2NX 2BR0A 5KFPA 2UUBH 1DV2A 3JSNA 4IHJF 2W6OA 4BXXG 4ZOLF 3H0GA 4RZQA 4JUZA 4DL5A 4JI4H 1S0MA 4OX9H 4JI7H 2Y0SA 3GTQA 4I7HA 2VPQA 3BQ1A 5FPRA 4PWQA 3VPCA 3R5HA 2WB1E 3RTXA 4DLKA 2V4QA 4XX0B 2C28A 4DL3A 1N36H 1I3QA 4XZ3B 3OHBA 3JSLA 2VQEH 4EEQA 3GIJA 3RBEA 2CZGA 3BJYA 1N34H 3E5NA 1BGWA 3UQ8A 4FU0A 5D1OB 5DLFA 2ZJTA 3GILA 4LFCH 3PW2A 3MR5A 2YL2A 3TIGA 4QIWA 3GIDA 5T14A 1ZETA 2KSWA 4IWXA 2VR1A 4YAJB 3MR2A 5LMUH 1N48A 1SFOA 4Q8EA 4JV2A 4EBCA 3L4KA 2FP4B 4J9QA 2WAQA 4O4IF 4YR0A 2YCHA 3MR3A 4CC5A 3BG5A 4BBRG 1ZHSA 4FS2A 1N33H 3N43B 3TQ1A 4ED7A 1HNZH 1AN7A 2FE3A 5KFRA 3RUPA 1TA8A 2DIKA 1Y1VA 3PO3G 5IYCG 4A3EG 3MWEA 4I55F 1RJQA 4F4ZA 1S97A 4CC6A 3RIZA 3PR4A 2OLSA 3ORRA 5LXTF 4O3PA 5KFGA 4RAYA 5CB4F 2R7ZG 4ED1A 4YAKB 1GSHA 2XGPA 3RB0A 3R23A 4DV1H 4LSAA 1IBKH 2ZDQA 1RJRA 1M6VA 4R8UA 2RDIA 5DQGA 4Y8VB 4DUYH 5KX5F 2I87A 4LMYA 3GV8B 5C44G 3HOXG 2R6FA 5CAEB 3VPDA 3IN5A 1S68A 2OH2A 1Y1WG 2R87A 4M7EA 4DL2A 4A3JG 4B3SH 5L1LA 3RF2A 4DV6H 1GGOA 1I7NA 2W9AA 2R93A 5DQHA 3GTPA 4F4WA 4JI1H 5HV6A 1OWTA 1VKZA 1A9XA 5KFWA 4HQ6A 4EYHB 1XDNA 2UUAH 2FPIB 4NXMH 2JA5A 4WD3A 4C5BA 2B63A 3K3PA 1MZBA 5DLGA 2E2HA 5FPOA 4X62H 5DG7A 2IA6A 3RGXA 2RF4A 1KC7A 1JXLA 4U7CA 5KG6A 1XMQH 4DR7H 4QJFA 2PBZA 1RK5A 1SYXB 2R7LA 3SE7A 1VBHA 2HGSA 4FBUA 1M7JA 2R7ZA 4QW9A 1TAEA 3BQ0A 5FJ8G 3Q8PB 1TWGA 5KFDA 4HYKA 1N32H 1I7LA 3RJ0A 2FK2A 5KFAA 3OHAA 3GIKA 1IOVA 5D1PA 3HOVG 3DF7A 5KG4A 3EPIA 3SI8A 1BXRA 2GPSA
chains in the Genus database with same CATH topology
1OWTA 3KTMA 2FK3A 2FK1A 2M05A 2FJZA 4PWQA 2FKLA 2FMAA 2FK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OWT A;  3KTM A;  2FK3 A;  2FK1 A;  2M05 A;  2FJZ A;  4PWQ A;  2FKL A;  2FMA A;  2FK2 A; 
#chains in the Genus database with same CATH topology
 2W9C A;  2X0S A;  4O3O A;  2DWC A;  5FD6 A;  2W71 A;  1VAJ A;  4DV5 H;  2VQD A;  4DL4 A;  1L2Z A;  5KT5 A;  2NVX A;  3PN1 A;  3Q8S B;  3V6K A;  4BY7 G;  1I50 A;  5IYD G;  4EYI B;  2R93 G;  5KT7 A;  1AUV A;  2PMZ A;  2GPW A;  3RV3 A;  5KG5 A;  2RDJ A;  3F8N A;  3I12 A;  4I50 F;  4G3I A;  3V4S A;  4MV4 A;  2B63 G;  4F4X A;  1DIK A;  4A3K G;  2XCA A;  4A2A A;  1W93 A;  4DV7 H;  3PW5 A;  4ECT A;  5F9L A;  4J9O A;  2R92 G;  3MFH A;  4DR2 H;  2CW8 A;  5DGB A;  3RB4 A;  2IBK A;  4LFA H;  1KJJ A;  4IRD A;  2W6Q A;  2V5A A;  2NU8 B;  2J6S A;  3TIN A;  4A3F G;  4JI2 H;  2J6T A;  4MV6 A;  1VS0 A;  1V9P A;  4A3M G;  2JEF A;  1C3O A;  3PO2 G;  3L2P A;  3OTO H;  2YZG A;  2W9B B;  4LF5 H;  5A2Q W;  5CA0 F;  4TV8 F;  2FKL A;  3KXY T;  1EZ1 A;  4XYM B;  5D1O A;  2JEG A;  2R8I A;  2UVU A;  4DR3 H;  3JZI A;  5C3E G;  3MFI A;  3EYY A;  3V6H A;  2JEI A;  2FK3 A;  2QK4 A;  3N41 B;  3WO0 A;  5KFE A;  3IG0 A;  3N42 B;  4DL7 A;  3H3V H;  2W6P A;  2XD4 A;  5C1O A;  2AGO A;  4E4T A;  4EG0 A;  2FLN A;  1E4G T;  3ETJ A;  3N44 B;  5HBR B;  4U6P A;  3J81 W;  1SEI A;  4NLG A;  4NXN H;  2RGV A;  4DR4 H;  4Q8F A;  2ZM6 H;  2ZDG A;  4ECW A;  5JH7 F;  2VUM A;  2R7M A;  2R8H A;  4UFZ A;  1S03 G;  1RJP A;  5C5J A;  4FS1 A;  1PK8 A;  5FD5 A;  4UCV A;  2BQR A;  2JEJ A;  4I4T F;  5L1K A;  4X66 H;  4LF8 H;  4EFE A;  1Y1V G;  4UCS A;  4Q45 A;  2HJW A;  5BR8 H;  4LF6 H;  4ZHQ F;  5JUM A;  3M4I A;  4LH7 A;  4YQW A;  2VOB A;  3FKI A;  2W9B A;  4ZI7 F;  5IT9 W;  5KG7 A;  4YY3 H;  4RNO A;  3KAJ A;  4MTD A;  3L4J A;  3MWM A;  4A3L G;  4BBS G;  3R5F A;  2AGP A;  1ZQ7 A;  3TII A;  2JA5 G;  2JA6 G;  3AYH B;  5KG1 A;  4J9K A;  4RUC A;  2Q2T A;  4PDB A;  3VPB A;  3K5I A;  5KFZ A;  3GII A;  2M05 A;  4EGJ A;  4YR2 A;  4DL6 A;  3RB6 A;  4GKK H;  3LML A;  4TQR A;  3OSP A;  3U9S A;  4DR1 H;  5KT2 A;  2XCP A;  3J7A K;  1K1S A;  2J9G A;  3PW7 A;  2W9C B;  2UU9 H;  1EUC B;  1WCM A;  4RB3 C;  4HNV A;  4JV1 A;  4O3R A;  3GIM A;  2NU7 B;  4JI6 H;  2YS6 A;  4C5C A;  3GQC A;  2PN1 A;  1BJT A;  4C5A A;  3BAB A;  3QZ7 A;  5H80 A;  4A3C G;  4X65 H;  4LF4 H;  3RAX A;  2YZN A;  1E4E B;  2NVY A;  3GV7 B;  4J9L A;  2V59 A;  3KHL A;  3T5H A;  4YR3 A;  4JI8 H;  4MTE A;  2UUC H;  1VBG A;  2PVP A;  1Y1W A;  4R7R A;  5K2M A;  2DPI A;  4F50 A;  4J9N A;  5BPH A;  3T5K A;  4APM A;  5DGA A;  2YRX A;  2UXD H;  1S9F A;  1KEE A;  1T36 A;  4J9M A;  1J5E H;  2OWO A;  1B04 A;  3RFC A;  3K5H A;  5KFU A;  3QZ8 A;  2W7P A;  3T1H H;  2C00 A;  4WBN F;  3GIQ A;  5KFY A;  2UVV A;  4QWE A;  3HOU G;  5KFB A;  3JRW A;  4Q43 A;  4JI3 H;  2DZD A;  5KFS A;  1JX4 A;  1E4E A;  2SCU B;  1JIH A;  3Q1K A;  4QW8 A;  5KG2 A;  4DV0 H;  2WTF A;  2ASJ A;  2BQ3 A;  5FLM G;  3JAM W;  4YP3 A;  4ED2 A;  4C2M A;  1CQJ B;  1GLV A;  4ECU A;  3EPG A;  4JV0 A;  1P8L A;  1V4Y A;  2W7O A;  1RK6 A;  4AYB A;  5JQW A;  4FM9 A;  4EFB A;  3BA9 A;  3N40 P;  4RU9 A;  4O3Q A;  5J2T F;  4O2A F;  1RYR A;  3HB9 A;  4IRC A;  2ASL A;  1IBM H;  1XNR H;  2C22 A;  4X64 H;  5EWG A;  1IBL H;  4GC6 A;  3WO1 A;  4K0K H;  4MV9 A;  3H4D A;  5IP7 G;  4EEY A;  1WH2 A;  3UFX B;  2QYZ A;  1KJ8 A;  4GC7 A;  3KAK A;  2R86 A;  5EWF A;  1B6S A;  3GLK A;  4B3R H;  2JA8 G;  3J80 W;  2J6U A;  2F4V H;  1CE8 A;  1CS0 A;  1RYS A;  2WDT A;  2FLP A;  2W6Z A;  3HOW G;  5CA1 F;  2FMA A;  4ECQ A;  2Y0S E;  4YJ2 F;  2P0A A;  3G8C A;  2R92 A;  2R7N A;  3HKZ A;  3H40 A;  3C0F B;  3M9O B;  2YZM A;  4FBT A;  4A3G G;  4KHP H;  4BWS C;  3PW0 A;  2VQF H;  1JDB B;  3MJF A;  4A3D G;  2W8L A;  4A3B G;  1XNQ H;  2YU9 A;  4B3M H;  1W96 A;  2HVR A;  4YBZ B;  3KHR A;  5IP9 G;  1R9T A;  1DV1 A;  2ZDH A;  5IWA H;  4JI0 H;  1EYZ A;  4LF9 H;  1UC8 A;  3KTM A;  2E2I A;  4ED6 A;  1B33 N;  3V4Z A;  2R8G A;  2PMZ E;  1Z2P X;  4AQY H;  2I8C A;  3U9T A;  3NGD A;  2R82 A;  5C8Y F;  3RBD A;  4RB0 A;  2WAQ E;  3KHH A;  2R7K A;  4O2B F;  1JLL B;  3FMA A;  2BQU A;  1T3N A;  2YRW A;  5JVL A;  5KFJ A;  4HNU A;  1KBL A;  4MV3 A;  2FPG B;  4YJ3 F;  2CQY A;  2NUA B;  3T5J A;  3BQ2 A;  2FLL A;  4ECR A;  1C30 A;  3FKI G;  1EHI A;  3G6Y A;  3QFF A;  3M9N B;  4ECX A;  2R85 A;  2W8K A;  5L1I A;  5KFO A;  3G6X A;  4DV2 H;  1K1Q A;  4MV1 A;  5D8D A;  4JI5 H;  4LF7 H;  5LYJ F;  3K3V A;  5LA6 F;  2C35 B;  3H0G G;  2VPS A;  1S0O A;  1CQI B;  2O03 A;  4ZQI A;  5F9N A;  5KFM A;  5KG3 A;  4J9S A;  2C2R A;  4RAZ A;  2R8J A;  1TWA A;  4UCR A;  2JA7 G;  3CVZ A;  2C2D A;  2CW7 A;  5LMN H;  2AQ4 A;  4JYA H;  2HVS A;  2XCL A;  4RNN A;  4RB1 A;  5KFF A;  4DV3 H;  1TWC A;  3HXL A;  2XC9 A;  1GO3 E;  5EOY A;  1WSC A;  4J0M A;  3KHG A;  1E4F T;  3RAQ A;  4LFB H;  2YYA A;  2WE6 A;  4QWB A;  4B3T H;  5LL6 b;  5EWE A;  3OSN A;  4O4L F;  3GTO A;  5IYB G;  2IP4 A;  4QWD A;  1V51 A;  1BNC A;  1JKJ B;  3HBL A;  4MA0 A;  5L9X A;  3FDS A;  5KT6 A;  4QWC A;  4MAM A;  4QWA A;  3G6V A;  1S10 A;  1FKA H;  3OUZ A;  5KFI A;  1WCM G;  2MCT A;  5GON F;  4TV9 F;  3WNZ A;  4TUY F;  3GTG A;  3BAA A;  4M9U A;  5DG9 A;  4ED8 A;  1TWF A;  1XMO H;  5KFV A;  4TQS A;  1TWH A;  1GSA A;  4A93 G;  2GLT A;  4HNT A;  4DR6 H;  1KJ9 A;  4YB8 B;  1SCU B;  3Q2O A;  3PZP A;  2IMW P;  4ETS A;  3PR5 B;  4MA5 A;  3GTJ A;  5C4X G;  3TQT A;  4ECY A;  3GTM A;  1T94 A;  2DPJ A;  2V58 A;  2AU0 A;  5BMV F;  4GLX A;  2YS7 A;  2DLN A;  3GV5 B;  5DQI A;  2HVQ A;  3RV4 A;  1A0I A;  1KJI A;  4RZR A;  3Q8R B;  2FPP B;  5KFN A;  1B6R A;  3M9M B;  5LP6 F;  1FVI A;  4RB2 C;  2JA6 A;  2E5L H;  1UC9 A;  5KKN B;  3HKZ E;  3LWB A;  4YHH H;  5EZY F;  4JV5 H;  1WR2 A;  2FK1 A;  5BPF A;  5KFT A;  2ASD A;  1Z2O X;  1FJG H;  2ATL A;  1EUD B;  5KFK A;  4R8U B;  4ED3 A;  1O75 A;  2V9W A;  3MR6 A;  3GIP A;  4DR5 H;  2NU6 B;  3ORQ A;  3VMM A;  3RGZ A;  4AYB E;  3N6X A;  4UCU A;  3R5X A;  3KAL A;  2WB1 A;  5KT4 A;  2NU9 B;  1KJQ A;  4DUZ H;  4ED0 A;  2VA3 A;  2W6M A;  5KG0 A;  5KFC A;  5FLX W;  2V4R A;  4IRK A;  2HHH H;  4MV8 A;  2W57 A;  3V6J A;  1HR0 H;  4RNM A;  2XGQ A;  4EBD A;  2FB9 A;  5EDW A;  1M0T A;  5KFL A;  2R84 A;  4J9P A;  4Q44 A;  2Q2U A;  3T1Y H;  4IZO A;  1I94 H;  4IR1 A;  2VA2 A;  4QIW E;  1I6U A;  2AGQ A;  4ME6 A;  3MWD A;  4HR7 A;  5KT3 A;  2XIG A;  2R8K A;  4A2B A;  2WYO A;  1M0W A;  4ECZ A;  5JVD F;  2W70 A;  3BA8 A;  1ZHQ A;  1Y14 B;  4IAJ A;  4UCT A;  5DG8 A;  4RUA A;  3HOZ G;  1HNX H;  1HNW H;  1AUX A;  4LH6 A;  4BY1 G;  5L1J A;  2FJZ A;  4J9R A;  2JA7 A;  3I4N G;  4UCO A;  1ULZ A;  4Q0Y A;  3JRX A;  4LSX A;  4DV4 H;  1K83 A;  2UXB H;  4IR9 A;  3OUU A;  4O3S A;  2ALZ A;  3LP8 A;  4EBE A;  4ECS A;  2UXC H;  4L1K A;  5KFQ A;  5KFH A;  3PW4 A;  1PX2 A;  4ECV A;  1N56 A;  3N8D A;  4GKJ H;  3H4B A;  1GYF A;  5IYZ F;  3PVX A;  1IOW A;  5I47 A;  3RB3 A;  3I4M G;  3CQZ A;  3HOY G;  4MV7 A;  4IWY A;  5C1P A;  1GSO A;  3GTL A;  1X9N A;  2VUM G;  2I80 A;  4A3I G;  3ETH A;  5KFX A;  4F4Y A;  2VUG A;  1S0N A;  2UVR A;  5J2U F;  2C2E A;  2YW2 A;  4O4H F;  1UNN C;  3H20 A;  4O3N A;  1JDE A;  4EGQ A;  5LOV F;  2CKZ B;  3Q8Q B;  4XYL B;  2RGR A;  3GTK A;  2W6N A;  1DGS A;  2UVW A;  3T5L A;  1Z2N X;  2BR0 A;  5KFP A;  2UUB H;  1DV2 A;  3JSN A;  4IHJ F;  2W6O A;  4BXX G;  4ZOL F;  3H0G A;  4RZQ A;  4JUZ A;  4DL5 A;  4JI4 H;  1S0M A;  4OX9 H;  4JI7 H;  2Y0S A;  3GTQ A;  4I7H A;  2VPQ A;  3BQ1 A;  5FPR A;  4PWQ A;  3VPC A;  3R5H A;  2WB1 E;  3RTX A;  4DLK A;  2V4Q A;  4XX0 B;  2C28 A;  4DL3 A;  1N36 H;  1I3Q A;  4XZ3 B;  3OHB A;  3JSL A;  2VQE H;  4EEQ A;  3GIJ A;  3RBE A;  2CZG A;  3BJY A;  1N34 H;  3E5N A;  1BGW A;  3UQ8 A;  4FU0 A;  5D1O B;  5DLF A;  2ZJT A;  3GIL A;  4LFC H;  3PW2 A;  3MR5 A;  2YL2 A;  3TIG A;  4QIW A;  3GID A;  5T14 A;  1ZET A;  2KSW A;  4IWX A;  2VR1 A;  4YAJ B;  3MR2 A;  5LMU H;  1N48 A;  1SFO A;  4Q8E A;  4JV2 A;  4EBC A;  3L4K A;  2FP4 B;  4J9Q A;  2WAQ A;  4O4I F;  4YR0 A;  2YCH A;  3MR3 A;  4CC5 A;  3BG5 A;  4BBR G;  1ZHS A;  4FS2 A;  1N33 H;  3N43 B;  3TQ1 A;  4ED7 A;  1HNZ H;  1AN7 A;  2FE3 A;  5KFR A;  3RUP A;  1TA8 A;  2DIK A;  1Y1V A;  3PO3 G;  5IYC G;  4A3E G;  3MWE A;  4I55 F;  1RJQ A;  4F4Z A;  1S97 A;  4CC6 A;  3RIZ A;  3PR4 A;  2OLS A;  3ORR A;  5LXT F;  4O3P A;  5KFG A;  4RAY A;  5CB4 F;  2R7Z G;  4ED1 A;  4YAK B;  1GSH A;  2XGP A;  3RB0 A;  3R23 A;  4DV1 H;  4LSA A;  1IBK H;  2ZDQ A;  1RJR A;  1M6V A;  4R8U A;  2RDI A;  5DQG A;  4Y8V B;  4DUY H;  5KX5 F;  2I87 A;  4LMY A;  3GV8 B;  5C44 G;  3HOX G;  2R6F A;  5CAE B;  3VPD A;  3IN5 A;  1S68 A;  2OH2 A;  1Y1W G;  2R87 A;  4M7E A;  4DL2 A;  4A3J G;  4B3S H;  5L1L A;  3RF2 A;  4DV6 H;  1GGO A;  1I7N A;  2W9A A;  2R93 A;  5DQH A;  3GTP A;  4F4W A;  4JI1 H;  5HV6 A;  1OWT A;  1VKZ A;  1A9X A;  5KFW A;  4HQ6 A;  4EYH B;  1XDN A;  2UUA H;  2FPI B;  4NXM H;  2JA5 A;  4WD3 A;  4C5B A;  2B63 A;  3K3P A;  1MZB A;  5DLG A;  2E2H A;  5FPO A;  4X62 H;  5DG7 A;  2IA6 A;  3RGX A;  2RF4 A;  1KC7 A;  1JXL A;  4U7C A;  5KG6 A;  1XMQ H;  4DR7 H;  4QJF A;  2PBZ A;  1RK5 A;  1SYX B;  2R7L A;  3SE7 A;  1VBH A;  2HGS A;  4FBU A;  1M7J A;  2R7Z A;  4QW9 A;  1TAE A;  3BQ0 A;  5FJ8 G;  3Q8P B;  1TWG A;  5KFD A;  4HYK A;  1N32 H;  1I7L A;  3RJ0 A;  2FK2 A;  5KFA A;  3OHA A;  3GIK A;  1IOV A;  5D1P A;  3HOV G;  3DF7 A;  5KG4 A;  3EPI A;  3SI8 A;  1BXR A;  2GPS A; 
#chains in the Genus database with same CATH homology
 1OWT A;  3KTM A;  2FK3 A;  2FK1 A;  2M05 A;  2FJZ A;  4PWQ A;  2FKL A;  2FMA A;  2FK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...