2FK2A

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'small unit cell' form, cu(i)-bound
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Apoptosis
molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fk2A00
2FJZA 2FKLA 2FK2A 1OWTA 4PWQA 2FK3A 3KTMA 2FMAA 2M05A 2FK1A
chains in the Genus database with same CATH superfamily
2XGQA 5H80A 3U9TA 5KFJA 3H0GA 3QZ7A 4DV3H 2R92A 1ZQ7A 2PMZE 3HKZA 3LMLA 3MFIA 1ULZA 1TWFA 3KAJA 4I4TF 4JI6H 1GSAA 2VQEH 1UNNC 4RB3C 2HVSA 1FVIA 4YP3A 4DR7H 5IYBG 4RNNA 4LSAA 4J9NA 4EBDA 1FJGH 3M9OB 4DL3A 1CQIB 2XCAA 4ED6A 5C1OA 4ME6A 3IN5A 3L4KA 5IYDG 2NVYA 4FBTA 4A93G 3N6XA 2YRWA 2W71A 2C2DA 4DR2H 2R93G 2VUMA 3H20A 4B3RH 5KFBA 2BQUA 3FKIG 5HBRB 2CKZB 4UCVA 5BMVF 3HOXG 3N43B 2JA6A 4EFEA 3GV5B 5EDWA 2R8GA 2DWCA 4LMYA 4DV5H 2C35B 5JUMA 2W70A 2VOBA 5DG8A 4BBRG 1VAJA 4HNTA 1HR0H 2W6PA 2W6NA 2YS7A 2JEIA 1B33N 2R7MA 4JV0A 5T14A 2OH2A 4B3MH 5KG5A 4E4TA 5KT6A 3GILA 1S0MA 2I8CA 2NU8B 4ECSA 4WD3A 4A3GG 2WE6A 2CQYA 2FLLA 1GO3E 2Q2UA 1CE8A 4JUZA 5LMNH 4EYIB 4GKKH 3MR6A 3BABA 1GSOA 4YJ2F 1JIHA 3BAAA 3N41B 3N42B 1RK5A 4A3CG 4QIWE 2V58A 3H4BA 5DLFA 4LFAH 3PR4A 3KHRA 4C5BA 4U6PA 4A2AA 3MR5A 4DR5H 3K3PA 4LF9H 3RBDA 5KT4A 4O2BF 1IBLH 1KEEA 3JRXA 2QYZA 4UCRA 3H40A 3PW0A 2V9WA 4DL5A 5KG1A 5KFKA 3FMAA 5KFLA 4YY3H 1VBHA 3JSNA 4TV9F 3M9NB 4EBCA 5LMUH 5KFDA 1TWHA 3OSPA 3VMMA 4XX0B 3GTMA 1T36A 4IR9A 3ORQA 4DV4H 5L1JA 2BQ3A 4YQWA 1N34H 3HOWG 4O3RA 4LF7H 1V51A 3MWEA 3V4ZA 3GTOA 4LFCH 3Q8PB 4O2AF 1Z2OX 3KTMA 4QWAA 5C8YF 3GV7B 3BA8A 4JI1H 4TQRA 5D1OB 1W93A 3TIGA 3MFHA 5FPOA 4IRKA 2XGPA 2FK3A 3QFFA 3N8DA 1DV2A 5BPHA 3L2PA 4RAYA 1DGSA 5EZYF 3R5HA 1C30A 3J80W 4RB0A 3PW5A 2ASJA 2W7PA 4EG0A 2CW8A 4O3OA 4MV4A 4DV7H 2M05A 4DV1H 4EEQA 1N32H 2ASLA 4RAZA 2R8JA 3JRWA 4Q8EA 3WNZA 1I7NA 5DGBA 3GTGA 4O4IF 3BQ0A 4A3JG 3HXLA 4LH6A 2XD4A 5D1OA 1AUVA 2W7OA 4RU9A 5KX5F 4XYLB 1Y14B 3MWMA 4J9SA 2KSWA 2FPPB 2W9CB 3PN1A 2C22A 4TV8F 2UVVA 3E5NA 4DL4A 4EYHB 5A2QW 1K83A 3PO2G 1DIKA 2UUBH 5D8DA 3GTLA 2R7ZA 2BQRA 4I55F 4UCOA 2R87A 4F50A 5KFYA 1WH2A 2UVUA 2YYAA 4J0MA 3T1YH 5KFQA 4GLXA 4EBEA 1RJPA 4AYBA 2E5LH 1WR2A 1WCMA 2VPSA 3V4SA 1KC7A 3CVZA 4IAJA 3OHBA 1M0TA 3GIQA 2XC9A 2DPIA 4J9RA 4EGQA 1BXRA 4HR7A 3JZIA 4A3BG 2E2HA 3Q8QB 1UC9A 2YZGA 2ASDA 2X0SA 4YAJB 5KFNA 2AGPA 3Q8RB 4JI5H 3F8NA 5J2UF 5LP6F 3UFXB 2VQDA 4C2MA 1J5EH 1E4EB 1IBMH 1KJIA 1S03G 1IOVA 3GTJA 3Q1KA 4QWBA 4Y8VB 3H0GG 5KT7A 2CZGA 3SI8A 2JEGA 3VPCA 4CC6A 5JVDF 5C5JA 2V4QA 1XMOH 1HNZH 4DV0H 2R92G 1TWGA 5KFTA 4X65H 1EUDB 4MA0A 3V6KA 3L4JA 2B63A 1KJ9A 4C5AA 4ED7A 4ED2A 3RV3A 1B6SA 3T5KA 2FJZA 4GC6A 4L1KA 4F4WA 4MV8A 4ED8A 2YW2A 3GQCA 4DL2A 1E4EA 2OLSA 3N44B 1KJJA 4A3KG 1GYFA 3I4NG 4BY1G 4NLGA 5F9NA 3BQ1A 2PMZA 3J81W 1L2ZA 5BPFA 4DR6H 2J6UA 1A9XA 4X64H 2FE3A 2W8LA 3RGXA 1RYSA 2GPSA 4ECXA 2IBKA 4BBSG 3GIJA 1TAEA 3RGZA 1GGOA 3WO0A 5DG9A 2JA6G 4RNMA 3K5IA 1RYRA 1HNWH 1R9TA 5CA1F 3BA9A 2FB9A 5IT9W 5DQHA 3PW4A 4YBZB 4JI8H 4MAMA 2WYOA 1S68A 3OUZA 1ZHSA 2PN1A 2O03A 2FP4B 2WB1E 5KFSA 4EGJA 4ZI7F 4TQSA 4I50F 2FK2A 1C3OA 4PWQA 4FM9A 5C44G 3BJYA 1AUXA 2C2EA 1PX2A 3PR5B 3PZPA 3RB3A 1I6UA 3GIMA 5KG6A 4FS2A 1OWTA 1E4FT 4F4YA 2W6ZA 2NU6B 1TA8A 3U9SA 2AU0A 2ZJTA 5EWGA 4FU0A 4JI2H 3SE7A 4BY7G 2C2RA 2V59A 1SFOA 3K5HA 2Y0SE 5FD6A 2YCHA 4KHPH 2WB1A 4J9KA 4ECWA 1P8LA 1TWCA 3JAMW 5LA6F 2VA3A 2JA8G 3KHLA 1IOWA 4QIWA 3EPGA 4RZQA 4UCTA 5IP7G 1BGWA 4DV6H 5KG4A 4X66H 3GLKA 1Z2PX 4A3DG 3GV8B 3GTKA 2R7KA 2R86A 2NVXA 4OX9H 5KFOA 4UCSA 5KFZA 2JA5A 1AN7A 4IWXA 4J9LA 4JI7H 5EWFA 4HQ6A 1VKZA 5KKNB 4JV5H 4I7HA 5IYCG 1S10A 2QK4A 2HHHH 2UUCH 4ECTA 3PVXA 2J6TA 4ED0A 4HNVA 5KG3A 5LOVF 3J7AK 1N56A 2CW7A 3T1HH 2FPIB 2YZNA 3FDSA 3GTPA 2ZM6H 4PDBA 4Q0YA 4MTDA 4ED1A 3M9MB 4LF8H 1RJQA 1Y1WA 1JLLB 4IRDA 1I7LA 5DG7A 4IWYA 2AGOA 5KFWA 4BWSC 1KBLA 4QWDA 1SEIA 4RUCA 4YR0A 3RV4A 1JKJB 5CA0F 2R82A 1N33H 4EEYA 1WSCA 2VR1A 5JH7F 2VQFH 1UC8A 5L1IA 3RIZA 5J2TF 2R7ZG 3H4DA 4MV6A 2WAQE 2UXCH 2C00A 1CQJB 1RJRA 4YR2A 5CB4F 1KJ8A 4YAKB 2VPQA 1JXLA 2DPJA 2R8KA 3G6VA 1VS0A 2IP4A 1Z2NX 5KFHA 2SCUB 4MA5A 4DR1H 5C4XG 4JI3H 2YU9A 1WCMG 5EWEA 2RDJA 2JEJA 2IMWP 3V6HA 2JA7A 5KT3A 4DUZH 4LSXA 2W6MA 5KFUA 2W8KA 2F4VH 3RBEA 5IYZF 1Y1VA 2UVWA 3H3VH 4DUYH 3M4IA 4A3EG 4J9OA 5KG2A 4YR3A 2FLPA 2WDTA 3VPDA 5KFMA 2NUAB 2V4RA 4JV1A 5FLXW 4JI4H 2ZDHA 1I50A 4JV2A 3R23A 1B04A 5KFPA 2NU7B 1ZETA 2R6FA 3K3VA 4Q45A 4MV1A 2DIKA 4ECVA 1A0IA 3KAKA 5KT2A 2WTFA 4J9MA 4XYMB 2W6QA 2IA6A 2J6SA 3RAQA 3TINA 3RB6A 4A3IG 2B63G 5L1LA 4A3FG 5KFCA 5BR8H 3DF7A 4ZOLF 5C1PA 1PK8A 2W6OA 4DLKA 5C3EG 3RB0A 1EUCB 2VUMG 1EYZA 3RJ0A 5KT5A 4RNOA 4NXNH 3OUUA 4ZQIA 4F4XA 4ECRA 4Q43A 4ECUA 1V4YA 1I94H 4R8UB 2DZDA 3OTOH 3QZ8A 2UXBH 2RGVA 4QWCA 3KHGA 4G3IA 2R7LA 2C28A 1XDNA 3R5XA 2BR0A 3HOZG 2J9GA 2YZMA 2R93A 2FMAA 4O4HF 4F4ZA 1S0NA 4QW8A 3FKIA 4TUYF 5FJ8G 2W9BB 5IWAH 3NGDA 2P0AA 2R7NA 2HGSA 3GIPA 3RUPA 2R8HA 4O4LF 1DV1A 4DR3H 3T5JA 1S97A 4APMA 3G6XA 4QW9A 4J9QA 1KJQA 2R85A 2JEFA 4Q8FA 1ZHQA 1N48A 4R8UA 5KFFA 1S9FA 5IP9G 4DL6A 2XCPA 1BJTA 3I12A 3OSNA 4UFZA 3RAXA 3UQ8A 1W96A 2NU9B 1XNQH 1BNCA 4RUAA 2W9BA 2AGQA 2ZDQA 3EPIA 4A3LG 2E2IA 3T5LA 1N36H 3VPBA 3LP8A 1I3QA 3PW2A 3HOUG 2GLTA 5L9XA 5KFXA 2W57A 2GPWA 1VBGA 4DL7A 4IHJF 5KFRA 5DQIA 2AQ4A 4AQYH 3OHAA 3EYYA 4CC5A 4WBNF 3ETJA 1EHIA 1K1QA 4RB1A 4A3MG 5D1PA 2FLNA 4GC7A 2VUGA 1CS0A 2MCTA 5JVLA 3BG5A 2DLNA 2W9AA 1JDEA 4RB2C 3AYHB 3HB9A 3I4MG 2UU9H 4QJFA 4YJ3F 4O3SA 5LL6b 5KG0A 4IZOA 5KFVA 4UCUA 2V5AA 2Y0SA 4O3QA 3TQTA 2VA2A 2RGRA 4B3SH 1K1SA 3KHHA 1TWAA 1HNXH 4MTEA 1M6VA 4M9UA 4ED3A 2YL2A 4MV3A 5JQWA 3IG0A 2PBZA 5KG7A 1M0WA 2JA5G 5KFGA 2ZDGA 4ECZA 1E4GT 5LYJF 3PW7A 1GSHA 3GIDA 4O3PA 3RFCA 4C5CA 5KFIA 3ORRA 3KXYT 4A2BA 4BXXG 4IRCA 3RF2A 4LF6H 4M7EA 5FD5A 3WO1A 3PO3G 4Q44A 2HVQA 4B3TH 5F9LA 2UXDH 1T94A 1FKAH 1V9PA 4X62H 1RK6A 4O3NA 3HOVG 1SYXB 3BQ2A 1Y1WG 3Q8SB 2ALZA 2Q2TA 2UUAH 5KFEA 3CQZA 4HNUA 4QWEA 5FPRA 3GIIA 4FBUA 3RTXA 2RDIA 5CAEB 4EFBA 3HOYG 1M7JA 1GLVA 2XIGA 3MWDA 5L1KA 4MV9A 1MZBA 4K0KH 1S0OA 1O75A 2ATLA 3T5HA 4DR4H 1IBKH 4JYAH 3G8CA 5DLGA 4YHHH 4LF4H 2R8IA 4LH7A 1B6RA 2PVPA 4AYBE 3RB4A 2I80A 2UVRA 4LFBH 5FLMG 4U7CA 5GONF 2I87A 4DV2H 2YS6A 3V6JA 1JX4A 4LF5H 4HYKA 2FKLA 1T3NA 2HVRA 5LXTF 2FPGB 1EZ1A 4YB8B 5DGAA 3TIIA 4MV7A 3R5FA 2OWOA 2YRXA 2R84A 3Q2OA 2JA7G 4JI0H 1XNRH 1X9NA 5EOYA 4ECYA 5DQGA 1XMQH 2XCLA 3HKZE 4GKJH 3LWBA 2RF4A 3HBLA 2FK1A 3KALA 5KFAA 4ETSA 4NXMH 1Y1VG 2WAQA 4FS1A 4J9PA 3GIKA 1SCUB 3JSLA 3C0FB 4ECQA 5I47A 3TQ1A 3G6YA 1JDBB 5K2MA 4IR1A 4RZRA 2W9CA 3GTQA 3MR2A 2HJWA 3N40P 3MJFA 3MR3A 4ZHQF 4XZ3B 5HV6A 3ETHA 4R7RA
chains in the Genus database with same CATH topology
2FJZA 2FKLA 2FK2A 1OWTA 4PWQA 2FK3A 3KTMA 2FMAA 2M05A 2FK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJZ A;  2FKL A;  2FK2 A;  1OWT A;  4PWQ A;  2FK3 A;  3KTM A;  2FMA A;  2M05 A;  2FK1 A; 
#chains in the Genus database with same CATH topology
 2XGQ A;  5H80 A;  3U9T A;  5KFJ A;  3H0G A;  3QZ7 A;  4DV3 H;  2R92 A;  1ZQ7 A;  2PMZ E;  3HKZ A;  3LML A;  3MFI A;  1ULZ A;  1TWF A;  3KAJ A;  4I4T F;  4JI6 H;  1GSA A;  2VQE H;  1UNN C;  4RB3 C;  2HVS A;  1FVI A;  4YP3 A;  4DR7 H;  5IYB G;  4RNN A;  4LSA A;  4J9N A;  4EBD A;  1FJG H;  3M9O B;  4DL3 A;  1CQI B;  2XCA A;  4ED6 A;  5C1O A;  4ME6 A;  3IN5 A;  3L4K A;  5IYD G;  2NVY A;  4FBT A;  4A93 G;  3N6X A;  2YRW A;  2W71 A;  2C2D A;  4DR2 H;  2R93 G;  2VUM A;  3H20 A;  4B3R H;  5KFB A;  2BQU A;  3FKI G;  5HBR B;  2CKZ B;  4UCV A;  5BMV F;  3HOX G;  3N43 B;  2JA6 A;  4EFE A;  3GV5 B;  5EDW A;  2R8G A;  2DWC A;  4LMY A;  4DV5 H;  2C35 B;  5JUM A;  2W70 A;  2VOB A;  5DG8 A;  4BBR G;  1VAJ A;  4HNT A;  1HR0 H;  2W6P A;  2W6N A;  2YS7 A;  2JEI A;  1B33 N;  2R7M A;  4JV0 A;  5T14 A;  2OH2 A;  4B3M H;  5KG5 A;  4E4T A;  5KT6 A;  3GIL A;  1S0M A;  2I8C A;  2NU8 B;  4ECS A;  4WD3 A;  4A3G G;  2WE6 A;  2CQY A;  2FLL A;  1GO3 E;  2Q2U A;  1CE8 A;  4JUZ A;  5LMN H;  4EYI B;  4GKK H;  3MR6 A;  3BAB A;  1GSO A;  4YJ2 F;  1JIH A;  3BAA A;  3N41 B;  3N42 B;  1RK5 A;  4A3C G;  4QIW E;  2V58 A;  3H4B A;  5DLF A;  4LFA H;  3PR4 A;  3KHR A;  4C5B A;  4U6P A;  4A2A A;  3MR5 A;  4DR5 H;  3K3P A;  4LF9 H;  3RBD A;  5KT4 A;  4O2B F;  1IBL H;  1KEE A;  3JRX A;  2QYZ A;  4UCR A;  3H40 A;  3PW0 A;  2V9W A;  4DL5 A;  5KG1 A;  5KFK A;  3FMA A;  5KFL A;  4YY3 H;  1VBH A;  3JSN A;  4TV9 F;  3M9N B;  4EBC A;  5LMU H;  5KFD A;  1TWH A;  3OSP A;  3VMM A;  4XX0 B;  3GTM A;  1T36 A;  4IR9 A;  3ORQ A;  4DV4 H;  5L1J A;  2BQ3 A;  4YQW A;  1N34 H;  3HOW G;  4O3R A;  4LF7 H;  1V51 A;  3MWE A;  3V4Z A;  3GTO A;  4LFC H;  3Q8P B;  4O2A F;  1Z2O X;  3KTM A;  4QWA A;  5C8Y F;  3GV7 B;  3BA8 A;  4JI1 H;  4TQR A;  5D1O B;  1W93 A;  3TIG A;  3MFH A;  5FPO A;  4IRK A;  2XGP A;  2FK3 A;  3QFF A;  3N8D A;  1DV2 A;  5BPH A;  3L2P A;  4RAY A;  1DGS A;  5EZY F;  3R5H A;  1C30 A;  3J80 W;  4RB0 A;  3PW5 A;  2ASJ A;  2W7P A;  4EG0 A;  2CW8 A;  4O3O A;  4MV4 A;  4DV7 H;  2M05 A;  4DV1 H;  4EEQ A;  1N32 H;  2ASL A;  4RAZ A;  2R8J A;  3JRW A;  4Q8E A;  3WNZ A;  1I7N A;  5DGB A;  3GTG A;  4O4I F;  3BQ0 A;  4A3J G;  3HXL A;  4LH6 A;  2XD4 A;  5D1O A;  1AUV A;  2W7O A;  4RU9 A;  5KX5 F;  4XYL B;  1Y14 B;  3MWM A;  4J9S A;  2KSW A;  2FPP B;  2W9C B;  3PN1 A;  2C22 A;  4TV8 F;  2UVV A;  3E5N A;  4DL4 A;  4EYH B;  5A2Q W;  1K83 A;  3PO2 G;  1DIK A;  2UUB H;  5D8D A;  3GTL A;  2R7Z A;  2BQR A;  4I55 F;  4UCO A;  2R87 A;  4F50 A;  5KFY A;  1WH2 A;  2UVU A;  2YYA A;  4J0M A;  3T1Y H;  5KFQ A;  4GLX A;  4EBE A;  1RJP A;  4AYB A;  2E5L H;  1WR2 A;  1WCM A;  2VPS A;  3V4S A;  1KC7 A;  3CVZ A;  4IAJ A;  3OHB A;  1M0T A;  3GIQ A;  2XC9 A;  2DPI A;  4J9R A;  4EGQ A;  1BXR A;  4HR7 A;  3JZI A;  4A3B G;  2E2H A;  3Q8Q B;  1UC9 A;  2YZG A;  2ASD A;  2X0S A;  4YAJ B;  5KFN A;  2AGP A;  3Q8R B;  4JI5 H;  3F8N A;  5J2U F;  5LP6 F;  3UFX B;  2VQD A;  4C2M A;  1J5E H;  1E4E B;  1IBM H;  1KJI A;  1S03 G;  1IOV A;  3GTJ A;  3Q1K A;  4QWB A;  4Y8V B;  3H0G G;  5KT7 A;  2CZG A;  3SI8 A;  2JEG A;  3VPC A;  4CC6 A;  5JVD F;  5C5J A;  2V4Q A;  1XMO H;  1HNZ H;  4DV0 H;  2R92 G;  1TWG A;  5KFT A;  4X65 H;  1EUD B;  4MA0 A;  3V6K A;  3L4J A;  2B63 A;  1KJ9 A;  4C5A A;  4ED7 A;  4ED2 A;  3RV3 A;  1B6S A;  3T5K A;  2FJZ A;  4GC6 A;  4L1K A;  4F4W A;  4MV8 A;  4ED8 A;  2YW2 A;  3GQC A;  4DL2 A;  1E4E A;  2OLS A;  3N44 B;  1KJJ A;  4A3K G;  1GYF A;  3I4N G;  4BY1 G;  4NLG A;  5F9N A;  3BQ1 A;  2PMZ A;  3J81 W;  1L2Z A;  5BPF A;  4DR6 H;  2J6U A;  1A9X A;  4X64 H;  2FE3 A;  2W8L A;  3RGX A;  1RYS A;  2GPS A;  4ECX A;  2IBK A;  4BBS G;  3GIJ A;  1TAE A;  3RGZ A;  1GGO A;  3WO0 A;  5DG9 A;  2JA6 G;  4RNM A;  3K5I A;  1RYR A;  1HNW H;  1R9T A;  5CA1 F;  3BA9 A;  2FB9 A;  5IT9 W;  5DQH A;  3PW4 A;  4YBZ B;  4JI8 H;  4MAM A;  2WYO A;  1S68 A;  3OUZ A;  1ZHS A;  2PN1 A;  2O03 A;  2FP4 B;  2WB1 E;  5KFS A;  4EGJ A;  4ZI7 F;  4TQS A;  4I50 F;  2FK2 A;  1C3O A;  4PWQ A;  4FM9 A;  5C44 G;  3BJY A;  1AUX A;  2C2E A;  1PX2 A;  3PR5 B;  3PZP A;  3RB3 A;  1I6U A;  3GIM A;  5KG6 A;  4FS2 A;  1OWT A;  1E4F T;  4F4Y A;  2W6Z A;  2NU6 B;  1TA8 A;  3U9S A;  2AU0 A;  2ZJT A;  5EWG A;  4FU0 A;  4JI2 H;  3SE7 A;  4BY7 G;  2C2R A;  2V59 A;  1SFO A;  3K5H A;  2Y0S E;  5FD6 A;  2YCH A;  4KHP H;  2WB1 A;  4J9K A;  4ECW A;  1P8L A;  1TWC A;  3JAM W;  5LA6 F;  2VA3 A;  2JA8 G;  3KHL A;  1IOW A;  4QIW A;  3EPG A;  4RZQ A;  4UCT A;  5IP7 G;  1BGW A;  4DV6 H;  5KG4 A;  4X66 H;  3GLK A;  1Z2P X;  4A3D G;  3GV8 B;  3GTK A;  2R7K A;  2R86 A;  2NVX A;  4OX9 H;  5KFO A;  4UCS A;  5KFZ A;  2JA5 A;  1AN7 A;  4IWX A;  4J9L A;  4JI7 H;  5EWF A;  4HQ6 A;  1VKZ A;  5KKN B;  4JV5 H;  4I7H A;  5IYC G;  1S10 A;  2QK4 A;  2HHH H;  2UUC H;  4ECT A;  3PVX A;  2J6T A;  4ED0 A;  4HNV A;  5KG3 A;  5LOV F;  3J7A K;  1N56 A;  2CW7 A;  3T1H H;  2FPI B;  2YZN A;  3FDS A;  3GTP A;  2ZM6 H;  4PDB A;  4Q0Y A;  4MTD A;  4ED1 A;  3M9M B;  4LF8 H;  1RJQ A;  1Y1W A;  1JLL B;  4IRD A;  1I7L A;  5DG7 A;  4IWY A;  2AGO A;  5KFW A;  4BWS C;  1KBL A;  4QWD A;  1SEI A;  4RUC A;  4YR0 A;  3RV4 A;  1JKJ B;  5CA0 F;  2R82 A;  1N33 H;  4EEY A;  1WSC A;  2VR1 A;  5JH7 F;  2VQF H;  1UC8 A;  5L1I A;  3RIZ A;  5J2T F;  2R7Z G;  3H4D A;  4MV6 A;  2WAQ E;  2UXC H;  2C00 A;  1CQJ B;  1RJR A;  4YR2 A;  5CB4 F;  1KJ8 A;  4YAK B;  2VPQ A;  1JXL A;  2DPJ A;  2R8K A;  3G6V A;  1VS0 A;  2IP4 A;  1Z2N X;  5KFH A;  2SCU B;  4MA5 A;  4DR1 H;  5C4X G;  4JI3 H;  2YU9 A;  1WCM G;  5EWE A;  2RDJ A;  2JEJ A;  2IMW P;  3V6H A;  2JA7 A;  5KT3 A;  4DUZ H;  4LSX A;  2W6M A;  5KFU A;  2W8K A;  2F4V H;  3RBE A;  5IYZ F;  1Y1V A;  2UVW A;  3H3V H;  4DUY H;  3M4I A;  4A3E G;  4J9O A;  5KG2 A;  4YR3 A;  2FLP A;  2WDT A;  3VPD A;  5KFM A;  2NUA B;  2V4R A;  4JV1 A;  5FLX W;  4JI4 H;  2ZDH A;  1I50 A;  4JV2 A;  3R23 A;  1B04 A;  5KFP A;  2NU7 B;  1ZET A;  2R6F A;  3K3V A;  4Q45 A;  4MV1 A;  2DIK A;  4ECV A;  1A0I A;  3KAK A;  5KT2 A;  2WTF A;  4J9M A;  4XYM B;  2W6Q A;  2IA6 A;  2J6S A;  3RAQ A;  3TIN A;  3RB6 A;  4A3I G;  2B63 G;  5L1L A;  4A3F G;  5KFC A;  5BR8 H;  3DF7 A;  4ZOL F;  5C1P A;  1PK8 A;  2W6O A;  4DLK A;  5C3E G;  3RB0 A;  1EUC B;  2VUM G;  1EYZ A;  3RJ0 A;  5KT5 A;  4RNO A;  4NXN H;  3OUU A;  4ZQI A;  4F4X A;  4ECR A;  4Q43 A;  4ECU A;  1V4Y A;  1I94 H;  4R8U B;  2DZD A;  3OTO H;  3QZ8 A;  2UXB H;  2RGV A;  4QWC A;  3KHG A;  4G3I A;  2R7L A;  2C28 A;  1XDN A;  3R5X A;  2BR0 A;  3HOZ G;  2J9G A;  2YZM A;  2R93 A;  2FMA A;  4O4H F;  4F4Z A;  1S0N A;  4QW8 A;  3FKI A;  4TUY F;  5FJ8 G;  2W9B B;  5IWA H;  3NGD A;  2P0A A;  2R7N A;  2HGS A;  3GIP A;  3RUP A;  2R8H A;  4O4L F;  1DV1 A;  4DR3 H;  3T5J A;  1S97 A;  4APM A;  3G6X A;  4QW9 A;  4J9Q A;  1KJQ A;  2R85 A;  2JEF A;  4Q8F A;  1ZHQ A;  1N48 A;  4R8U A;  5KFF A;  1S9F A;  5IP9 G;  4DL6 A;  2XCP A;  1BJT A;  3I12 A;  3OSN A;  4UFZ A;  3RAX A;  3UQ8 A;  1W96 A;  2NU9 B;  1XNQ H;  1BNC A;  4RUA A;  2W9B A;  2AGQ A;  2ZDQ A;  3EPI A;  4A3L G;  2E2I A;  3T5L A;  1N36 H;  3VPB A;  3LP8 A;  1I3Q A;  3PW2 A;  3HOU G;  2GLT A;  5L9X A;  5KFX A;  2W57 A;  2GPW A;  1VBG A;  4DL7 A;  4IHJ F;  5KFR A;  5DQI A;  2AQ4 A;  4AQY H;  3OHA A;  3EYY A;  4CC5 A;  4WBN F;  3ETJ A;  1EHI A;  1K1Q A;  4RB1 A;  4A3M G;  5D1P A;  2FLN A;  4GC7 A;  2VUG A;  1CS0 A;  2MCT A;  5JVL A;  3BG5 A;  2DLN A;  2W9A A;  1JDE A;  4RB2 C;  3AYH B;  3HB9 A;  3I4M G;  2UU9 H;  4QJF A;  4YJ3 F;  4O3S A;  5LL6 b;  5KG0 A;  4IZO A;  5KFV A;  4UCU A;  2V5A A;  2Y0S A;  4O3Q A;  3TQT A;  2VA2 A;  2RGR A;  4B3S H;  1K1S A;  3KHH A;  1TWA A;  1HNX H;  4MTE A;  1M6V A;  4M9U A;  4ED3 A;  2YL2 A;  4MV3 A;  5JQW A;  3IG0 A;  2PBZ A;  5KG7 A;  1M0W A;  2JA5 G;  5KFG A;  2ZDG A;  4ECZ A;  1E4G T;  5LYJ F;  3PW7 A;  1GSH A;  3GID A;  4O3P A;  3RFC A;  4C5C A;  5KFI A;  3ORR A;  3KXY T;  4A2B A;  4BXX G;  4IRC A;  3RF2 A;  4LF6 H;  4M7E A;  5FD5 A;  3WO1 A;  3PO3 G;  4Q44 A;  2HVQ A;  4B3T H;  5F9L A;  2UXD H;  1T94 A;  1FKA H;  1V9P A;  4X62 H;  1RK6 A;  4O3N A;  3HOV G;  1SYX B;  3BQ2 A;  1Y1W G;  3Q8S B;  2ALZ A;  2Q2T A;  2UUA H;  5KFE A;  3CQZ A;  4HNU A;  4QWE A;  5FPR A;  3GII A;  4FBU A;  3RTX A;  2RDI A;  5CAE B;  4EFB A;  3HOY G;  1M7J A;  1GLV A;  2XIG A;  3MWD A;  5L1K A;  4MV9 A;  1MZB A;  4K0K H;  1S0O A;  1O75 A;  2ATL A;  3T5H A;  4DR4 H;  1IBK H;  4JYA H;  3G8C A;  5DLG A;  4YHH H;  4LF4 H;  2R8I A;  4LH7 A;  1B6R A;  2PVP A;  4AYB E;  3RB4 A;  2I80 A;  2UVR A;  4LFB H;  5FLM G;  4U7C A;  5GON F;  2I87 A;  4DV2 H;  2YS6 A;  3V6J A;  1JX4 A;  4LF5 H;  4HYK A;  2FKL A;  1T3N A;  2HVR A;  5LXT F;  2FPG B;  1EZ1 A;  4YB8 B;  5DGA A;  3TII A;  4MV7 A;  3R5F A;  2OWO A;  2YRX A;  2R84 A;  3Q2O A;  2JA7 G;  4JI0 H;  1XNR H;  1X9N A;  5EOY A;  4ECY A;  5DQG A;  1XMQ H;  2XCL A;  3HKZ E;  4GKJ H;  3LWB A;  2RF4 A;  3HBL A;  2FK1 A;  3KAL A;  5KFA A;  4ETS A;  4NXM H;  1Y1V G;  2WAQ A;  4FS1 A;  4J9P A;  3GIK A;  1SCU B;  3JSL A;  3C0F B;  4ECQ A;  5I47 A;  3TQ1 A;  3G6Y A;  1JDB B;  5K2M A;  4IR1 A;  4RZR A;  2W9C A;  3GTQ A;  3MR2 A;  2HJW A;  3N40 P;  3MJF A;  3MR3 A;  4ZHQ F;  4XZ3 B;  5HV6 A;  3ETH A;  4R7R A; 
#chains in the Genus database with same CATH homology
 2FJZ A;  2FKL A;  2FK2 A;  1OWT A;  4PWQ A;  2FK3 A;  3KTM A;  2FMA A;  2M05 A;  2FK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...