2R93G

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
total genus 25
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r93G01
3S1RH 4JOIA 4MNOA 4L5QA 2ZM6L 2E8GA 2Q2HA 4KLKA 5C0XG 1ASYA 2AWOA 2JK8A 4JI7L 4IFDJ 3W1BA 4IPHA 4RG1A 4DR3Q 4B3ML 2R92G 3HOUG 4A76A 4DR6Q 1I3QH 4DR5Q 4L5SA 2MO1A 3FKIH 1VQ7A 3CCSA 3KF8B 3PUXA 4JCVE 1J5EQ 1K3RA 4R4TA 2YTXA 2MNAA 2ES2A 3HOVG 5M5WH 1JE5A 4GOPC 4LUZA 4A3IH 4LW1A 3UDIA 3A5UA 4H02A 3U4ZA 3L2PA 2ATWA 4LFCL 1WCMH 4PZ7A 1SR3A 1XNQL 3M9BA 3RN2A 4JI0L 1VQAA 3G6EA 3JC66 3PO2G 3F2CA 5M3FG 4LFCQ 1N36L 1N32Q 4B3SL 1B7YB 4DV0L 3GDEA 1ASZA 1A62A 4UP8A 4A3MH 4P73A 3K7AH 1VQBA 1G51A 4DR4L 2JEBI 2R6GA 1YIJA 1G6PA 3I4MH 3I4OA 2VZAA 5H1SE 4DV6Q 2JJQA 2OTLA 3KDFA 4DR7L 3I7FA 4HJ5A 1K8AC 3S1MH 1EIFA 5IYCH 3G4SA 1L1OB 2Z6KA 3E0EA 1OTCA 4LF9Q 4A3BG 3AFPA 1HR0L 3NELA 1RL2A 1PYBA 1V9PA 4P72A 1PH3A 2K5NA 4X66Q 3CCQA 4JV5Q 2NN6I 3J81i 4GNXC 4A3EG 1HNZL 5IYDH 4APVA 3AFQA 2CFMA 3Q8DA 2RCNA 3TEHB 1K73C 4IFDI 4QQBX 1PH1A 2CQOA 3J80i 1Q7YC 3HOYG 3GD7A 5C4XH 4L5TA 3RLFA 4DV5L 4KI0A 1KIXA 1C9OA 4JC0A 4DUZL 3T1YL 4JI2L 2IX0A 4IJHA 4A3BH 4GKKQ 1Q1BA 4JI8Q 1LM0A 2I5MX 2XGTA 3RLOA 4BY7G 3D31A 5IYBH 2E5LQ 1L1OC 1TXYA 3PCOB 5JEAJ 1QVGA 1IBMQ 4LF7Q 4AH6A 3BU2A 2VS1A 2BA0A 3S1NH 4HIMA 2F52A 1XJVA 1JJ2A 2HHHQ 4JYAL 1B8AA 1Z9FA 4A3JG 4UP7A 1IL2A 4JG2A 3F8TA 3I55A 3GTLH 1Y1WG 1BVSA 4A4IA 2IX1A 4DV0Q 1KAWA 3NBHB 3EN2A 3ULLA 4AYBG 1M90C 4A93H 3M4QA 4TVAB 3I56A 4JI7Q 1X56A 4MZ9A 1PH7A 2B3GA 2ZJPA 2MO0A 4X64Q 1CKNA 3DM3A 4JI3L 1DGSA 2N49A 1SRUA 2JA8H 4IPCA 4BBRG 1WFQA 3FHWA 4OX9L 3H0GG 4DK6C 2KBNA 5GROA 4JBWA 1X3EA 4NXNL 1HR0W 3M3YH 3M4OH 3T1HL 3IRBA 4LFAQ 2A1AA 4DKAC 2UUAQ 2K50A 3BZKA 1U5KA 4R4QA 4A3KH 2E2JH 1HZBA 2L15A 3E9HA 2EXDA 1C7YA 1T9HA 3J81j 4JI5Q 4A3GG 3S16H 4R4OA 4DAYB 3PIPA 1CKOA 2NZOA 4LUOA 3STBD 3HOXH 4DV4Q 2OQ0A 4GN4B 3W5OA 2F3IA 1HR0Q 2AHOB 3HOXG 1AE3A 4KHPL 4DV7L 3SGIA 1A0IA 4IOAA 1W3SA 2GVBA 5IP7G 4P74A 1S3OA 2B29A 2AMCB 2A19A 3KJOA 4K0KL 3H3VI 3MXNB 3FKIG 2JA5H 3KOJA 4YCUA 3PGZA 2ZTDA 4IOCA 4DV2Q 3E9IA 3HFZB 4OXPA 1Q86C 2R92H 2NVTH 2YYZA 3TQYA 1VQFA 3UDXA 1XPOA 2VUMG 5GAEC 4GLAC 2OQKA 3CPFA 3K7UC 1EQQA 1M1KC 5EAYA 1WYDA 1Y1VG 4X66L 4B3RQ 4X65L 2B63H 4JV5L 1SFOH 1PH9A 2CKZB 3RN5A 2JE6I 4IFDG 1IBKQ 3L0OA 1PYSB 5J3BA 5IP9G 1I94L 4LUVA 4JI1Q 2UUBQ 2WP8J 2UUCQ 3I4NH 3KFUA 2E2HH 1Y1VH 4DR2Q 4RMFA 2VQFQ 1X9NA 3GTPH 2VQEL 1NMGA 4GNXA 5GADC 3H3VH 1SROA 3H15A 2JA8G 3PO3H 1FVIA 2Q2UA 2RHQB 3A0JA 4X62Q 1YJ9A 2BH2A 3HKZE 4YY3L 4UP9A 2PQAA 3PUZA 5AJ3L 5FLMG 4ME3A 5GAGC 2AKWB 1VQOA 4LF7L 4L5RC 1XMOQ 5C4XG 4PMWA 4DK3C 4YCVA 1KHIA 4MTNA 4TQUS 4BXXG 2UXCL 2K52A 4A3LH 4DV3L 2UUBL 4Y52H 5IYDG 4BBRH 3BZCA 1X3GA 5JJLA 4DV3Q 4AQYQ 2PI2E 5LMNW 4LF5Q 1GKHA 1MJCA 1XNRQ 1O7IA 2JEAI 3GTQH 1PH6A 2Y0SE 1KD1C 4DR3L 3GTOH 1L2FA 5LMUQ 2E5LL 4HIDA 3LGJA 1UEBA 1YHAA 4J15A 3TREA 3L7ZC 4DPGA 1KC8C 1VQ5A 4ALPA 2JA5G 3A74A 2EIFA 1P16A 1VQIA 3F2BA 1N33Q 1NJIC 4LF6L 3CC7A 4LFAL 3RZDH 1G291 2ZTEA 1HNXL 1I5FA 4JBJA 4LF8L 1XPUA 1YJNA 2VNUD 1HNZQ 4YWKA 3KYHC 1YITA 1Y1WH 3DLLA 2I0QA 2GVAA 2YTYA 4YCWA 1SMXA 4GS3A 3JAMc 3KJPA 4JYAQ 4A3LG 4WJ3M 3ZJYC 2KCMA 4OWXB 2NVYH 4GNXB 4K0KQ 4HJ7A 1XNRL 4A75A 4A3DG 1OXXK 3K0XA 2HQLA 1X65A 2VL6A 1EUJA 3M85A 4YWMA 4DV6L 4GKJL 2WB1E 4YY3Q 4NXNQ 3G71A 4GLXA 3T1YQ 4DR6L 2Z6KC 4C3HH 1I6HH 2LSSA 2WAQE 4DV2L 2GN5A 4JI3Q 1D8LA 1VQGA 2I5HA 1BBUA 1GO3E 1Q1EA 2AWNA 1UE1A 1WJJA 2N78A 2R7DA 1K9MC 2ASBA 3J81c 1BKBA 1A8VA 4A3KG 3CPWA 4LFBL 4B3RL 5AJ3Q 1IYJB 2PI2A 5FLXc 3CMAA 1FJGQ 3PUWA 1KRTA 2N8NA 1VQEA 1I94Q 4JI0Q 4BBSG 1PV4A 5ELOA 1X55A 2FXQA 5E7NA 5LMNQ 1C0AA 5IWAQ 4WJ4A 1VQLA 4DUZQ 4BA1I 1S40A 3EIVA 2VQFL 1N32L 1L1OA 4HJAA 1E24A 4OWTB 1NTGA 2K5VA 4UPAA 2VW9A 4OX9Q 3TRZA 1V43A 5M3MG 4BY7H 2JA6G 3S2HH 4QY7A 2DGYA 4HIKA 1YNXA 3UE1A 3G48A 3KLWA 1VQJA 1GVPA 3CCMA 1OXSC 3OYYA 5IT9c 3KF6A 4A3MG 4JI6L 4LF9L 3CXCA 2EQSA 1VS0A 2K75A 2MQHA 1QZGA 3AQQA 1J5EL 3BJUA 2D62A 4JBMA 4IO9A 2JA7H 2KCTA 3PF5A 5K36G 4DAMA 1MJEA 1VQMA 3HOUH 4DV4L 1HH2P 3S14H 1JT8A 3PO3G 5GAHC 2PQAB 4P71A 1PH5A 1IBKL 3HOVH 4DV5Q 1Q81C 3F1ZA 2CWPA 1CKMA 5IYCG 5IE8A 4HIOA 1KL9A 1VQCA 3HKZG 3CCUA 5LMUL 2JA7G 1EIYB 2NVQH 1OXTA 1VQ4A 3PUYA 2KHIA 3AEVA 1WOCA 3H0GH 3TS0A 1MKHA 1S72A 2NVXH 1K83H 1LYLA 3HOZH 1PH4A 4PG3A 2D0PA 4R4IA 1JJCB 2K4KA 4JI5L 2YV5A 3CQZH 2QA4A 4R1JA 3K81C 2OWOA 4GLVB 2XTIA 2HHHL 3PO2H 2ZJRA 1XPRA 1HNWL 1E1OA 1QUQA 3I4MG 3U4VA 4DUYQ 1QZHA 2K5HA 3S2DH 1PHJA 3K8AA 3ICEA 3FP9A 4A3JH 2UUCL 3HKSA 2ZM6Q 3KF6B 3CCLA 4YHHL 5JJKA 2QGQA 4IPGA 1XTDA 4QL5A 4JI8L 2IHEA 2LXJA 2K14A 3J7ZC 3RZOH 1V1QA 1QVCA 2NZHA 4YWLA 4X6AH 1HJPA 2F4VL 4X62L 3T1HQ 4GOPA 4JOIC 3RR5A 3CP0A 5DLQE 4QJFA 2H5XA 1YHBA 2MFIA 2WFWA 4KHZA 2UUAL 3PV0A 4POFA 4DR1Q 2RHSB 5C44G 1YVCA 1Q46A 4HJ8A 3M7NA 2CCZA 1Q8KA 2JA6H 3I4NG 3I2ZA 4GN3B 3B6YA 1PH2A 1SN8A 1VQ9A 3PIOA 3GTMH 3PF4A 3GTGH 3ER0A 3OW2A 1IXRA 3A5ZB 4BA2I 5C0XJ 2OTJA 2ID0A 4JI2Q 2R93G 4A3CG 4A3FH 4LNQA 4DR4Q 2DUDA 4A3CH 3JAMi 1YBYA 2PMZE 1TWGH 4JBKA 3MEFA 2LXKA 1EOVA 2UXDL 1CSQA 2VQEQ 1KRSA 1Y14B 4Y7NH 5ELNA 1JB7A 4BBSH 2ALYB 4KHPQ 4EQ5A 4B3MQ 4DNIA 1IBLL 1E3PA 4B3TL 3HOWH 3U50C 4A3IG 3TS2A 5IY0A 2ZJQA 4DR7Q 3CCVA 3OTOQ 1N8RC 5HGQA 3U58A 1LTLA 1E7ZA 2NN6G 4DV7Q 1GM5A 1U0LA 3J80c 4AQYL 3PSIA 5BR8L 4LF5L 3PUVA 1XNQQ 2YTVA 2OCEA 1YEZA 4DR2L 1B70B 2R7FA 2QEXA 3ULJA 1GD7A 1Q82C 4JI1L 3CC2A 3CC4A 4JI4L 4BXXH 1KXLA 1NMFA 4O2DA 1H95A 2HIXA 1N36Q 5LMNL 1UE5A 3HOYH 3S24A 4X64L 2R7ZH 4B3SQ 1SE8A 4YHHQ 3F2DA 4NXMQ 1VQKA 1Z47A 3STBC 4DR5L 2Z0SA 2A8VA 5M3MH 1HZAA 4FDBA 5JJIA 5JEAG 4NXML 3EBEA 1XMQQ 2BH8A 4B3TQ 4AIMA 4LWCA 2CWAA 3CD6A 4OO1G 4NPSA 5M5YH 1OXUA 1A63A 1KQSA 1EQRA 1PFSA 1YZ6A 2Q2TA 3S15H 1X54A 4PZ6A 3GO5A 4C3JH 4XIGS 1RIPA 1HNWQ 1L0WA 1MIUA 5C4JH 4IPDA 3GTKH 1VQ8A 3S17H 5M3FH 2PNHA 1SLJA 3AYHB 1IBLQ 2ZTCA 2F4VQ 2JA9A 3CMEA 1WCMG 1YI2A 1VQ6A 1VQHA 4HJ9A 1VQDA 1YJWA 4R4CA 3S1QH 1VQNA 5C3EG 1YHQA 2WB1G 3UDFA 4LF6Q 4A3GH 2JQOA 3M4PA 2R7ZG 1HZCA 2C35B 5M5XH 4A3DH 2WAQG 4O0AA 1XMQL 1JJGA 3NEMA 5BR8Q 3HOWG 1QVFA 4IJLA 1FL0A 1IZ6A 1CKNB 1N9WA 5HY6A 3RLNA 3J7A5 3K80C 2YU9H 2Q2IA 4EX5A 4GOPB 4A3EH 1WI5A 1FJGL 2VY3A 4QIWE 1PVOA 1J6QA 1AE2A 3CAMA 1VQPA 4OO1I 4UY8C 1R9TH 4DV1Q 1X6OA 4GN5A 4OONA 5FJ8G 1EYGA 5FJ8H 4LF4L 4GKKL 4JI4Q 4NB3A 5IWAL 2VUMH 2N3SA 4A93G 3CCRA 4BY1G 3HOZG 3CW2C 4LF4Q 2E2IH 2UXDQ 4GKJQ 1TWCH 1HZ9A 1N34Q 2B63G 4C2MH 2HT1A 4BY1H 5C44H 2UXBL 1D7QA 3CCJA 4LFBQ 2I5LX 1CSPA 2IT1A 4X65Q 4A3FG 2UU9L 2R93H 2UXBQ 4POGA 1FGUA 3WWVA 5C3EH 3CF5A 2KHJA 4DUYL 5IYBG 1E22A 1PA6A 3NENA 3ERSX 3UDGA 1TWHH 1I50H 4DR1L 1HNXQ 4P75A 1CUKA 3VDYA 4PZ8A 1LUZA 2V1CC 4C3IH 2IY5B 5IP7H 1BBWA 2KENA 1TWFH 1OXVA 1JMCA 5FLMH 4OWWB 4AYBE 1AH9A 1UWVA 1Q12A 3GTJH 3UE0A 3W1GA 1IBML 2BA1A 5GQOA 1XMOL 1UE6A 4JI6Q 1N34L 1NY4A 1EFWA 3OTOL 3ULPA 1TWAH 2RF4A 3KDFB 2UU9Q 1W2BA 3CCEA 1VCIA 1N33L 4QGUA 1P8LA 2D0OA 2IHFA 1NBWA 3RNUA 1UE7A 4XTCS 5C0XI 4LF8Q 5IP9H 4DV1L 1PH8A 2Y0SG 1K8GA 2UXCQ 1NE3A 1EWIA 1K0RA 1QUQB 1E1TA 3D0FA 1X3FA 2HIVA
chains in the Genus database with same CATH superfamily
1PTOC 3Q0AA 4L5QA 2ZM6L 4JI2L 1Y1VA 1EZ8A 5C0XG 2NU9B 4IPHA 4DUYH 3Q6SA 4J9PA 3CHBD 2CQYA 5BMVF 1PXUA 2MO1A 1VQ7A 4QW9A 3CCSA 4R4TA 3MWDA 4ZYSA 4GOPC 1EHIA 2RCFA 3C1FA 4H02A 3L2PA 1HUMA 1ICWA 1WCMH 1JICA 1ZETA 1LTRD 4BWSC 2XNAC 4RAYA 5IT9W 3NSWA 3PQIA 2YS7A 3U9OA 2J9GA 4K5XA 1PDQA 1YIJA 4TQSA 3I4OA 2VZAA 1EY9A 3UFXB 2PQEA 2JP1A 2WB1B 3I7FA 1T3NA 3HGBA 5D1OA 5IYCH 4A3BG 3E0EA 4OEMB 5BN4A 1OTCA 1E4GT 3K5IA 3AFPA 3TMEA 5KFVA 4DR1H 5KFNA 2KEEA 4ECVA 3T53B 2CFMA 2I80A 3RBDA 1K73C 2HCCA 2ZDGA 4YQWA 4QQBX 4X65H 4JK1C 3MVVA 5KEEA 3HOYG 5E4XA 1WVLA 4HEDA 5E1FA 3FEWX 5L9XA 2IX0A 4IJHA 4EGVA 1EIHA 4JI8Q 1LM0A 1AZPA 1ZHSA 5IYBH 1L1OC 2Q8RE 5JEAJ 5CC4A 1IBMQ 4DAVA 4LF7Q 2B63B 5I9PA 2VS1A 1IL8A 4HIMA 3OWEB 2F52A 5LL6X 1BXRA 3V6HA 4EG0A 2CVRA 1PTOH 2NUCA 1IL2A 3LWUA 1HFNA 3F8TA 2FK3A 4I65A 3P7JA 4ZUIA 1ZYRD 4A4IA 1DYQA 4A2AA 1RK6A 5D8DA 3ULLA 3PW2A 1RHPA 3RBEA 3SHLA 5HURA 5JVH3 4CJ0B 3I56A 2B2YA 2W70A 5CV6A 2K33A 1X56A 4YR2A 1S0MA 3PVXA 3HB9A 2B3GA 2MO0A 1K83B 1EY0A 4ZK9B 1EUDB 3KUPA 3M3YH 1AN8A 1X3EA 3HP3A 1F9QA 1UAPA 3PO3B 1IOWA 4ECRA 2UUAQ 1WD1A 2V9WA 3PIPA 4L1KA 4DV4Q 4RB1A 4GN4B 2F3IA 2WKDA 2AHOB 3EROA 5EJWA 1HR0Q 2K5DA 3HOXG 3PMFA 3SGIA 1A0IA 1G6ZA 5IP7G 4K0KL 1N48A 2A19A 3E6ZX 3H3VI 1DONA 4IWXA 1JE4A 2R82A 4MV1A 2JA5H 3GIKA 3Q2OA 2ZTDA 4IOCA 2R92H 4OXPA 1A2UA 2WB1A 2YYZA 2O4XA 3NBHA 4LFCH 1RF2D 5GAEC 3D4DA 3K7UC 5KFBA 1SYXB 3A8JE 2K05A 4RKLA 2PZWA 4X66L 1A3TA 2B63H 2O2LD 1SFOH 5BR8H 4CKEA 5JEAH 1STYA 1PH9A 1HNWL 2JE6I 3C0FB 4LH7A 3Q24A 2UUCQ 4JI1Q 2JEFA 5NUCA 1Y1VH 3LWBA 1RYSA 2IMWP 2VQEL 3BVMA 3H3VH 1CM9A 4WRDA 1IKLA 3PO3H 3A7AB 5HBRB 3GTGB 3GQBA 1FVIA 2Q2UA 2RHQB 3EYYA 1YNND 4JV2A 3KF8A 4YY3L 1L2ZA 3ZYYX 4LF7L 3N42B 5CMDA 1EY7A 3EJIA 4DK3C 2NVYB 5FO8B 4PWQA 3M4IA 4HNVA 5EKLA 4XXEA 3PW0A 2F0NA 2SEBD 1HA6A 4BBRH 1T36A 2R7MA 1C3OA 2JEAI 2X6LA 1XNRQ 3GTQH 2C2RA 5EWFA 2UVVA 5KFGA 2K5WA 2V59A 1RTOA 4HIDA 2PVPA 2ZXPA 4OL7A 1IOVA 1RTNA 1DIKA 3A74A 2UVUA 3F2BA 2L5TA 1NJIC 4QB4A 4JI6H 4JI7H 3J7AF 4LFAL 3VYRA 3RZDH 1G291 4IR1A 2B2WC 2R8IA 2NB0A 3KYHC 5HGTA 4JYAQ 4Q0YA 1SMXA 4GS3A 3ZJYC 4DV1H 1N32H 2KCMA 4OWXB 3SK8A 1BJTA 1ENAA 1G2SA 1L0XB 1XNRL 4I50F 5BN5A 2VL6A 2W8KA 1PMRA 4OELB 4DV6L 2WB1E 4YY3Q 4NXNQ 3MR3A 2A69D 3K57A 4K2LA 2XCAA 1SE3A 2EYMA 4DV2L 2GN5A 4DAPA 2AWNA 1GO3E 1K9MC 2JA8H 1KJ8A 1X32A 2VUGA 5H80A 3J81c 4B3RL 1IYJB 2PI2A 4LJZC 4NDXA 1Q90A 3N52A 2WTFA 5CV5A 1STAA 1VQEA 1WCMB 5I2XA 5KFHA 1PV4A 3HOXB 4MTEA 5LP6F 4C1NK 1TIID 4ZQ3A 1DOMA 1VQLA 3D3RA 4J9NA 3N40P 3MAQA 1NTGA 2E76C 2X6GA 4OX9Q 1HQRD 3I4MB 5M3MG 4J9RA 1HTPA 1EIGA 5EBCA 1RKNA 1VQJA 3T16A 3OYYA 5IT9c 4A3MG 3TIIA 1BCPC 3CXCA 2EQSA 1NUCA 3AQQA 1WH2A 5KFMA 5KFUA 2R8GA 2RA4A 4DL4A 5K36G 4DAMA 5CBAE 1NR4A 4DV4L 3MZ5A 4RGTA 4IR9A 1JT8A 3PO3G 3GV8B 3K5HA 2PQAB 3MXPA 2R7ZA 5DAUA 1Q81C 2F3VA 3OWFA 5KYIA 5IE8A 2FLPA 1VQCA 4M1UB 3ERQA 1OXTA 5FO7B 1I3QB 5JPMC 2KHIA 2XC9A 1WOCA 2W6OA 1F77A 1MKHA 2L1BA 3KLRA 4RHSA 3RD4A 3GTJB 1LYLA 3J81W 4C5BA 4JI5L 2QA4A 2QDBA 1VBGA 2HHHL 3PO2H 4ZAIA 2QW7A 5KG3A 1E1OA 5T1GA 1JWSD 1JDBB 4DUYQ 2R85A 1O78A 2K5HA 4CJ2C 4LH6A 4A3JH 1F9PA 2K5QA 2PN1A 4YHHL 5I47A 4UCOA 1O7LA 4QL5A 2ZXRA 1SNOA 1B4OA 2K14A 3RZOH 1V1QA 2OH2A 3GLKA 4JV0A 5KFEA 1O7YA 2RSOA 4X6AH 2SCUB 1LABA 1Y8OB 4JOIC 1Q3LA 4GOPA 5EPJA 3RR5A 2R8HA 2V58A 1T5XD 3CP0A 1JCKB 4FXKC 1Z6HA 3PV0A 1R9TB 4DR1Q 1TWAB 1JDEA 2RHSB 1A3UA 4HJ8A 3M7NA 1PFNA 2UUBH 1SYGA 2MJ8A 3ND9A 1FYCA 4GN3B 2JA6B 4IFDH 4MV9A 3PIOA 4DR2H 1GLVA 3PF4A 3ER0A 1HHVA 2KSWA 4M7EA 4HMJA 2OTJA 3VR3A 1WTPA 4A3CH 3SI8A 2PMZE 4JI8H 1EOVA 1Q8IA 3GP7A 1GUTA 1HQMC 5L1JA 2F0KA 1JWMD 1JB7A 4B3MQ 5A2QW 4K8JA 4DNIA 3BDOA 1E3PA 1STNA 1TY0A 4A3IG 2KVMA 4DFAA 2ZJQA 1GM5A 3U58A 4DV7Q 4F88A 2YYAA 3BJYA 3TN2A 1SYBA 1I4QA 2PMZA 1Q82C 3TQ1A 1SFOA 2QEJC 1SNPA 5M5WB 5C4HA 1KEEA 5FPOA 5LMNL 1UE5A 4A3FB 3HOYH 4X64L 2IJ0A 1KJQA 1SE8A 5LMUH 3F2DA 1NSNS 5CBEE 4JV1A 2TMPA 1HZAA 1HPCA 3QFFA 3JAML 2FKLA 1Z7TA 2YL2A 2MGSA 5EKKA 5JUMA 5D65A 1B9NA 1KNEA 1A63A 3KBGA 1T94A 1NNXA 1PFSA 3BQ2A 3FDTA 4XIGS 5KG0A 4CC6A 1RIPA 1HNWQ 1VKZA 3ETHA 1PFBA 4CDFC 3J7AV 1BO0A 1AUXA 2FP4B 4JI5H 1IBLQ 5KFWA 1WCMG 4G7HC 4O3QA 2KQ3A 1HR0H 3S1QH 1VQNA 3A56A 3DWPA 3FMAA 1BGWA 5IGEA 4A3DH 2WAQG 4O0AA 3LMLA 4L8JA 1LTGD 4DL5A 5IGFA 3ONAB 1W96A 1FL0A 1IZ6A 1N9WA 4CDDC 3J7A5 5CR3A 1TWHB 4G4KA 4FM9A 2Q2IA 4EX5A 4K2KA 4A3EH 5M3MB 4DV4H 4QIWE 3MC0B 1J6QA 1TS4A 2B2WA 4UY8C 5KG6A 3WO0A 4ODGA 3LNNA 3OOCA 4NB3A 4H13C 5IWAL 4BY1B 1TWHA 1CS0A 3OHXC 2M05A 1M7JA 1GSHA 1I50B 1CE8A 1VAJA 4MV4A 1N34Q 2IW3A 3E5SA 4KKTA 3NXWA 2UXBQ 2K32A 3PN1A 3CF5A 5IYBG 5HV6A 4FVMA 3MJFA 2E2IA 5KT3A 3OIQA 5C4ZA 4XZ3B 4FF2A 3GTOA 4RZRA 1LUZA 4FO2A 3IL8A 3RUZA 1BBWA 1KNAA 5CA1F 1I6VC 1EQVA 1TWFH 2MPMA 1OXVA 2CZGA 1ET6A 4OWWB 4EYHB 2C22A 1F2MA 3TBIB 3NPPA 2RDGA 3UE0A 1IBML 2BA1A 2VR1A 1UE6A 1CZWA 1EFWA 4JI6Q 2F03A 1VCIA 1JLLB 3MFHA 1DV1A 2IHFA 1SXTA 4C3JB 4OGQC 4UCVA 4U7CA 2IL8A 4XTCS 3MFGA 5C0XI 2VQDA 3CRLC 4DV1L 4O3SA 3OSOA 2QCPX 1FKAH 3D0FA 2F0QA 2KEDA 3S1RH 4MNOA 4Q0FA 2E8GA 5C4JB 1K1SA 5DM63 4JI7L 4N8X1 5CB4F 1WD0A 4RG1A 1Z2PX 3MWMA 1I3QH 4DR5Q 4L5SA 1GUGA 2W6MA 2ENBA 2PZUA 4JCVE 1RJQA 2W9CB 1LTTD 4N8FA 2A5HA 2HCIA 2W7OA 2ES2A 2P5ZX 2MHVA 3J80E 4LW1A 5J1ZA 1KBLA 4XQNA 1XNQL 4JI0L 4R7RA 1G2TA 1XDNA 1N32Q 1DZ1A 2RBMA 4B9XA 5C5MA 3GDEA 1B2TA 1A62A 4UP8A 1KABA 3K7AH 4O4LF 2JEBI 2R6GA 1G6PA 3I4MH 4YY3H 4RUCA 4KHPH 5H1SE 4ZOLF 3RV4A 1QE6A 2GPWA 3HKZA 1JXLA 1S5BD 1L1OB 5EBDA 2I87A 2IPKD 4F7XA 4XX0B 3NGDA 3NELA 2SDFA 2VQEH 2F0PA 1V9PA 1PYBA 4J8QA 3HOWB 3EPGA 2K5NA 4X66Q 3CCQA 2NN6I 1HNZL 2A69C 2RCNA 2CW8A 4A3IB 4PV1C 1M8AA 4QUCA 4I7AA 1PH1A 2CQOA 4A3KB 1Q7YC 5J2TF 5C4XH 4G57A 4L5TA 2H1EA 3GTGA 1C9OA 4DUZL 5JQWA 5KFZA 1Q1BA 4C5CA 2B2VA 2I5MX 3RLOA 4BY7G 3D31A 5E4WC 4B9WA 3PCOB 1U4RA 3PW5A 1PZJD 4AH6A 3BU2A 3S1NH 2IP4A 2E2JB 1JJ2A 2HHHQ 1B8AA 2NU7B 1RDPD 1MI2A 3GTQA 3TDQA 4UP7A 3C46A 4QCLA 4RGMA 3T56B 2XVSA 3GTLH 1Y1WG 3GTLB 1BVSA 1S03G 2JEIA 1EWHA 4DV0Q 1KAWA 4AYBG 3EN2A 1M90C 2FLLA 3RZDB 4B08A 3KK7A 4DV5H 4MZ9A 3GTQB 4XYOA 4JI3L 2N49A 1SJHD 1SRUA 4IPCA 1XX8A 4BBRG 3QZ8A 1J8IA 4OX9L 3F2UA 4X3SA 3GIJA 4JBWA 2OEOA 2A74C 4IWYA 5DGBA 2FFKB 1BCPF 2A1AA 2D2CC 5IGCA 2M9VA 4A3KH 2L15A 3E9HA 2VA3A 2EXDA 3RUPA 4B3TH 2AGOA 1T9HA 4JI5Q 3VYTA 2EVBA 5F9NA 5KNDA 3S16H 4R4OA 3HOZB 2NZOA 2Q8IB 3KLSX 3STBD 1I4XA 4KHPL 1AE3A 5D1PA 4BWGB 4LAAA 1I4RA 5IT9L 3L3OC 2PW7A 5KG2A 1Z2NX 2AMCB 3KJOA 2R87A 2XWJB 3MXNB 2GLTA 2WKCA 4YCUA 1WCMA 3HFZB 4JI0H 2NVTH 3TQYA 3T13A 3UDXA 5LMNH 2F1MA 2VUMG 3LWEA 4GLAC 1S10A 1EQQA 4J9MA 4DUZH 1STBA 1J9OA 2YZMA 5KT5A 2XGQA 5LL6S 4XQQA 4CKCA 1Y1VB 4LSXA 2X0SA 1Y1VG 4B3RQ 2LMCB 5I9OA 4X65L 1RODA 4KHVA 2FLNA 2G9DA 4K8IA 4MN3A 1CK1A 3KFUA 2WP8J 2G9HD 5CV8A 4B3MH 4DR2Q 3FDSA 2VQFQ 1X9NA 3GTPH 3VA5A 2JA8G 4LMYA 3G6VA 1CTMA 3A0JA 3BG3A 3OPOA 3HKZE 3VPDA 4J1MA 1B9MA 2B2TA 2PQAA 3PUZA 2R61A 4UP9A 4ZQIA 2AKWB 5DNFA 1S0NA 5KFOA 4L5RC 1YNJD 1H9JA 4PMWA 5IOCA 2WAQB 2NU8B 1KHIA 5KX5F 4TQUS 3S1MB 2BR0A 3MXUA 1CFMA 2K52A 2Z6BA 2UUBL 5IYDG 2WV6D 3T51B 3GTMA 2DNEA 5FLXW 1XNQH 1IBMH 1X3GA 1HRJA 3GV6A 2PI2E 4AQYQ 4LF5Q 4F4XA 4A3MB 4ED0A 2XIWA 2Y0SE 4GC6A 1L2FA 2E5LL 1YHAA 4J15A 2FPPB 3S2HB 3DWQA 4F8MA 5LL6b 2O03A 3L7ZC 3I73A 2K7VA 1J5EH 4ALPA 1P16A 1VQIA 4LF6L 4YP3A 3CC7A 1JB3A 4HYKA 1JR0D 2ZTEA 1RJPA 4RU9A 1GUSA 5IGBA 1HNXL 1I5FA 2HQEA 4JBJA 2RSNA 3DMUA 1XPUA 3OIPA 3C2PA 1GHKA 1I6UA 4YWKA 5J2UF 2I0QA 2GVAA 2YTYA 4RZQA 4ILWA 2HVRA 2VUMA 5DG8A 4KY6A 2R7LA 5EQ0A 4K0KQ 4TRDA 1IW7C 4A3DG 3K0XA 2HQLA 4LF4H 1CHQD 5F2DA 4YWMA 3M85A 5KFXA 3G71A 3T1YQ 1N34H 4C3HH 1I6HH 2XN9C 1WR2A 1WTRA 3RAXA 4LFBH 2I5HA 1BBUA 2R7DA 1UE1A 2WAQA 1BKBA 1SMYC 5CV9A 1GOZA 5AJ3Q 4ZCKA 4UCSA 2KCCA 3BVGA 3PUWA 2VB2X 2HJWA 2DPJA 3GTMB 4C3JG 1GUNA 4BBSG 4XQJA 1CQVA 1TWCB 2NTTA 1LACA 3I4LA 1C0AA 2YRWA 5IWAQ 4WJ4A 4DL7A 4BA1I 3RJ0A 1D5XC 4HJAA 1E24A 3FKIB 1DXMA 1XTCD 3S1QB 1KTKA 4IUNA 3NQTA 1V43A 4BY7H 2JA6G 2YZGA 1HNXH 4HIKA 3KLWA 3CCMA 1GVPA 3W2DA 3KF6A 4YBZB 3H94A 3QZ7A 1BNCA 2L0CA 3BJUA 4GKKH 2KCTA 3BYYB 1MJEA 2M00A 4WORA 5J22A 1I4PA 3S17B 1B6RA 2DWCA 1A6XA 4HIOA 1FNWA 4X64H 5LMUL 4DA2A 3M9MB 4F4ZA 1Y8NB 5I2YA 5KNCA 2X69A 3PUYA 5EGTA 3C3LA 2C2DA 4ME6A 1SYFA 4TQRA 3H0GH 2RDHA 1K8OA 5JOBA 4ZUJA 1PH4A 4EGJA 4R4IA 3PZPA 1JJCB 3CQZH 4A3BB 1TWFA 4GLVB 1SNCA 5DM73 3S14B 1KJJA 1DOKA 4BBRB 2W6QA 3GIPA 1I50A 3S2DH 3K8AA 3ICEA 3HKSA 1K0SA 3KF6B 2EYJA 4LFAH 4KD3A 1MZBA 2GA4B 4LF6H 1XTDA 4JI8L 2IHEA 2V4RA 1L0YB 4C3IG 4IALA 4ZLTF 5K2MA 4ZHQF 1WTQA 4Q44A 1QVCA 3Q23A 5CA0F 5DQHA 2EJMA 2NZHA 4KY5A 2BQ3A 4RCNA 3GTLA 1WTXA 2QKIC 1F2ZA 1SEBD 5DLQE 1QILA 2EJGC 2JEJA 1B1ZA 4IUPA 2B2UC 3R3OA 5C44G 1Q46A 2CCZA 1ULZA 1Q8KA 2JA6H 3I4NG 4ZKCB 4DNTB 3BQ0A 1IXRA 2JSOA 3A5ZB 5EPKA 4YR0A 5C0XJ 2IBKA 2ID0A 4JI2Q 4FBTA 5KFIA 5CAEB 1O7ZA 2LXKA 1GJXA 1CSQA 2VQEQ 3N8DA 3EPIA 3I91A 5ELNA 2IX3A 1AFPA 4RGOS 3T5JA 4DL6A 2HDMA 5M3FB 3NE5B 3VPCA 4ECXA 5KFRA 5FD5A 2HHHH 3ETJA 4FBUA 3KHLA 3V6KA 4EQNA 3I12A 3CCVA 2W57A 2A6HD 3OTOQ 1SJED 1C48A 4PNYA 4OX9H 4HMIA 1D5MC 2NVXA 2AGQA 2E2HA 1U0LA 1CI3M 3J80c 3PSIA 5BR8L 1EUCB 1HFGA 4X66H 4O1NA 4DR2L 2QEXA 1JOQA 3MXGA 4UCUA 3CC2A 4I4TF 3CC4A 1AUVA 3LX0A 1H95A 3PR5B 1N36Q 4YHHQ 3QOLA 1WTWA 3V6JA 1VQKA 1Z47A 2A8VA 5M3MH 1GYFA 2F0IA 4JVZA 2FK1A 4X62H 3RGZA 5JVG3 2F4IA 2JYOA 2BH8A 4B3TQ 3E5NA 4LWCA 4LK1C 5ELEA 1GUWA 1WSCA 4OO1G 4NPSA 5M5YH 1DOLA 2GPSA 2J6TA 1I3QA 1B3AA 1ET9A 5CV4A 5I6YA 4K6LA 2F0OA 4FXDA 1KQSA 3KXYT 1CQFA 2VOBA 4P2CB 2RDFA 1EQRA 3S15H 2LFNA 3H0GB 3GO5A 4PZ6A 4KN7C 1HCZA 5KFPA 4YJ2F 1MIUA 3GTKH 3PIP3 5BN3A 1VQ8A 3S17H 2PNHA 1SLJA 1HNZH 2EY6A 2JA9A 3QJYA 5KIXA 1M0WA 4YJ3F 4J9OA 4JI3H 1VQHA 1VQDA 2H4OA 2FJ2A 1M0TA 4QMGA 1YHQA 2DPIA 4A3GH 2JQOA 4F4WA 3M4PA 1HXYD 1HZCA 2EJFC 1TWAA 4B3RH 3GV3A 5BR8Q 4G3IA 3HOWG 3R5HA 4IJLA 1BCPB 2HUGA 1BF4A 1IHZA 4A3EB 3K80C 2YU9H 3N6XA 4GOPB 4DV2H 1WI5A 2D9UA 2VY3A 1ONLA 1K3BC 3CAMA 1F9RA 3ITPA 3WOEA 1GSOA 2B39A 3FPUB 1X6OA 5FLXE 4DXFA 5FJ8G 2Z4IA 1EYGA 4LF4L 5KT7A 4FS2A 5C5LA 5C8YF 2ICEC 5GONF 1DCZA 4DL3A 5I6WA 5JVDF 5KKNB 1F2YA 2JXMB 3CW2C 1RCVD 1Y1WA 2BQUA 1NAPA 1TWCH 2L55A 3BQ1A 2FJZA 1CHPD 4QWCA 5KG4A 1B44D 4C2MH 1X3PA 5C44H 2NUAB 3CCJA 1TVXA 2AUKA 5AFWA 1PRTF 2D5DA 4A3FG 4LSAA 1SNQA 3URYA 5FD6A 1YNJC 1XWEA 1DM0B 3TP6A 4POGA 1FGUA 3G6XA 3WWVA 1PRTB 5C3EH 1OWTA 1PA6A 5BPFA 2YU9B 1HNXQ 1S5DD 3H3VC 4IUVA 3QR8A 1JORA 1CA6A 2QYZA 2RGVA 5JH7F 4C3IH 5C1PA 2IY5B 1BQQT 3SK4A 5KFLA 2G5DA 3J7AK 1AEXA 3GTKB 1JMCA 5KFYA 1S97A 4YR3A 4ED7A 1Q12A 4QWAA 3W1GA 1R4QB 1TS3A 2F0JA 2RVLA 3NTKA 5GQOA 3EFXD 2QK4A 3ULPA 1TWAH 2I46A 3BG5A 2W9BB 1W2BA 3CCEA 3I8ZA 3ORQA 5M5XB 4CGYB 1E2ZA 4QGUA 1SE2A 4RGNA 5DG9A 2D0OA 1NBWA 1H9SB 2F0LA 3A7LA 1I4GA 1FNVA 1K8GA 2W8LA 4RKBA 3BA8A 1QUQB 1K0RA 5FOBB 1E1TA 3GILA 1X3FA 3RZOB 3S1RB 4KK7A 5D14A 1BCPD 1ASYA 4MV3A 2PZTA 2Q2HA 5ELDA 1HA5A 1ENFA 5IYZF 3VR5A 3H09A 4B3ML 4DR3Q 3HOUG 2EY5A 2R92G 3HOUB 1Y1WB 4DR6Q 4G7OC 1HNWH 2VUMB 3VR6A 2EYOA 3KF8B 3PUXA 1J5EQ 3MEHA 5IODA 2O5JC 2YTXA 4ZRZA 2MNAA 3MR2A 3HOVG 3K5NA 3MXNA 4ID6A 3NTHA 4KTAA 4CKBA 3A5UA 4HNUA 3V05A 3M7GA 2ATWA 3H20A 4LFCL 4PZ7A 1SR3A 5KYLA 2NN6H 1VQAA 3G6EA 3JC66 3PO2G 3F2CA 5M3FG 5EWEA 4EEYA 3P20A 2ATLA 4EQPA 1II3A 2FHTA 3JZIA 4RUAA 4DK0A 2RQXA 2AQ4A 4P73A 1SYDA 1G51A 1VQBA 4KY7A 4XYQA 4O2BF 2AU0A 4FP5D 5L1LA 1NCVA 4O4HF 2F0EA 5JVLA 2JJQA 4YIJA 4DR7L 2R7NA 2AQ1B 4HJ5A 1K8AC 1EIFA 1B04A 1MSHA 3G4SA 2IA6A 4QIWB 2BE5C 1RL2A 4P72A 1PH3A 1ZQ7A 3J80L 4APVA 3J7YW 1C30A 4O42A 5CGKA 4EEQA 3MR5A 2BOSA 3AFQA 3TEHB 2XSCA 1SAPA 3J80i 1I4HA 4WFN3 2UXBH 4DV5L 4KI0A 2A68C 1KIXA 4JC0A 3T1YL 2OT2A 4IURA 4GKKQ 1FD7D 3AU7A 4C2MA 2JA6A 4R8UB 5K36H 4NMZA 2E5LQ 1TXYA 3DHQA 3NBIA 5C0XH 3DXJC 2BA0A 4UDUC 4KJNA 1XJVA 1Z9FA 3AMUA 3PW7A 2VA2A 5IT9E 4O3OA 2IX1A 4J9KA 1XMQH 2OF1A 5FKAC 2K6AA 4MTKA 4TVAB 1CKNA 3DM3A 3VR2A 1DGSA 1WFQA 3FHWA 1W6JA 3H0GG 1RJRA 2KBNA 1B3QA 5GROA 1IYUA 5IGDA 1HR0W 3M4OH 2XCLA 3T1HL 1LV9A 1WTVA 3BYTB 4NW2A 3HXLA 4LFAQ 3OHBA 3KHHA 3RB4A 4DKAC 5KFAA 4R4QA 2E2JH 3GIMA 1HZBA 5KGUA 4MV7A 1WTOA 3J81j 3DF7A 5C6AA 3HOXH 1CKOA 2EE1A 4LUOA 1K28A 3D6WA 4H0LC 2OQ0A 4J9SA 2HVSA 5C3EB 4K14A 4PMCA 4DV7L 4ED1A 1W3SA 2W6ZA 2ASJA 4ETSA 3BA9A 1G91A 4P74A 1V1OA 5ELFA 1G8ZD 3KOJA 4V190 3A8IE 1D2BA 3PGZA 4IQZA 4DV2Q 3ORRA 3T5KA 5KNBA 3NP8A 5KFJA 2OQKA 3M4YA 2N55A 2R93B 1M1KC 2F0HA 2Z4HA 3HZXA 4G7ZC 1A15A 3RAQA 4JV5L 2KECA 2CKZB 3RN5A 2YZNA 1IBKQ 3L0OA 3I4NH 2UUBQ 5FLXL 4LUVA 1TU2B 1I94L 2ZDQA 3KBXA 2B2UA 2R84A 4RMFA 4C56C 5L1IA 4OO1H 1NMGA 4ED3A 2DNCA 4UCTA 1PZID 1X3QA 3H15A 3SVMA 4JI2H 2CH4W 3NTIA 4FS1A 2WE6A 3R23A 2NVXB 1MSGA 1H9MA 1ZHQA 3RB3A 1EU3A 5T1IA 4UAIA 2DY7A 5FO9B 5FLMG 4ME3A 2C2EA 1KDCA 1XMOQ 3K58A 1PRTD 4YCVA 4BXXG 1TR5A 4B3SH 4IN3A 3OTOH 4I55F 4WBNF 1A3VA 2R92B 3BZCA 2Y0SA 3GV7B 4F50A 5LMNW 1GKHA 1O7IA 4F4YA 2A68D 1KD1C 3RV3A 3RF2A 1B33N 1QJOA 2PO4A 5LMUQ 2LS01 2A6ED 1JKJB 4KKSA 4QF4A 3TREA 1KC8C 3OUZA 1VQ5A 1W6KA 3EQLC 2JA5G 3WDNA 2NVQB 4KKUA 1N33Q 2KJXA 3HRZC 2UU9H 1S0OA 4XDXA 4LF8L 4IZOA 3RTXA 1EFID 1STHA 1HNZQ 3M3YB 1TWCA 4ECSA 3DM1A 1Y1WH 3DLLA 4YCWA 3BZDB 5ISRA 3RFCA 3JAMc 4Q45A 2CH4A 4A3LG 4WJ3M 2NYZD 2XGPA 2DZDA 4GNXB 5DQGA 5DGAA 2FINB 4HJ7A 2Z9HA 2B8FA 3GTPB 1UC8A 1YNNC 1XXGA 1VBHA 1PK8A 1Y8PB 1EYCA 3CQZA 1ML0D 3G8CA 5CV7A 4GLXA 5ELBA 4EYIB 2B8GA 5C5JA 3CU7A 2LSSA 2WAQE 1A2TA 2RGRA 4JI3Q 5LXTF 1D8LA 3P1HA 1VQGA 3JSNA 3A54A 1Q1EA 4JUZA 1WJJA 4Q5VA 4MTDA 3I70A 4OIJA 3T5LA 2CW0C 4LFBL 4HR7B 1UNSA 2NZ1D 3IFDA 3X3NA 1I94Q 3IAYA 3LP8A 1NR2A 4DV6H 5ELOA 1AW7A 2ZT9C 1XYIA 4DUZQ 4IAJA 2XRSD 3KLSA 1GUOA 3EIVA 4X3KA 3TSSA 3HG9A 1L1OA 2K5VA 2BDOA 5IGGA 3TRZA 4TSSA 1UUPA 4QY7A 2DGYA 3UE1A 1QB5D 2JA7G 2VQFH 1OXSC 2SNSA 1PTOD 2FMCA 3RB6A 4PMBA 1VS0A 2MQHA 1RJTA 5L37A 1J5EL 4JBMA 3WNZA 4IO9A 2JA7H 5KG5A 1SYEA 3SEBA 3K5OA 3VR4A 3MWEA 3U9TA 3I72A 2V5AA 1VQMA 2E5LH 2JA5A 2PCFB 2UVRA 1KLUD 3S14H 1PTOB 2PBZA 2RDIA 2BCOA 5GAHC 1BUVT 4P71A 3MTSA 1IBKL 5IYCG 1CKMA 4A3BH 4TV9F 3HKZG 3CCUA 3K5MA 3QWNA 5BPHA 3AEVA 2E2DC 1GSAA 4RNOA 4DR6H 3RIZA 3TS0A 2W6PA 3VYUA 2NVXH 1UNNC 4KJOA 1XNRH 4BS9A 1TT2A 2R7ZB 1PRTC 2YV5A 2B2VC 4R1JA 4LF7H 2FE3A 3K81C 2OWOA 5EKIA 1E2VA 4IRDA 1RD9D 2ZJRA 2EXZA 3MR6A 3Q8SB 4QWBA 3GIDA 1MD2D 3QOJA 2WYOA 2V4DA 1PHJA 4AYBA 2F3WA 1JWUD 2UUCL 1TWGA 2ZM6Q 3BDCA 5JJKA 2QGQA 5C3XA 2LXJA 1V4YA 3KHGA 5COYA 4WD3A 4ME5A 3S9WA 4HAEA 3NK9A 2L11A 1GXDC 4BBSB 1CQJB 4YWLA 2XD4A 1HJPA 4RB2C 2F4VL 3T1HQ 2F0DA 3Q8RB 4DR3H 2W6NA 4DR5H 2EYFA 4QJFA 2EDGA 2NBFA 2H5XA 4RWSC 1YHBA 4KHZA 2WFWA 1TS2A 4MA0A 2UUAH 4DAYA 1YVCA 2VB3X 4U6PA 4HNTA 2FMMA 3NWSA 5A35A 4HCEA 1PH2A 1VQ9A 1EEFD 2K03A 3GTMH 4TUYF 2E2IB 2SOBA 1TY2A 3N6RA 3GTGH 2YCHA 4L6TB 3OW2A 3R8BA 2UVWA 3R2TA 2R93G 4A3CG 4DR4Q 1W93A 1YBYA 4JBKA 1TWGH 3M9NB 3MEFA 5IIFA 2FK2A 2ZJTA 4CJ1B 1Y14B 1ILQA 4K5VA 4I7ZC 4C3HG 2ALYB 4Y7NH 5KT2A 1I7NA 1SFOB 4B3TL 4QUFA 1VDZA 3U50C 1TAEA 2NU6B 4DR7Q 5DG7A 3H0GA 3MHBA 1VF5C 3QB3A 2YTVA 1SBBB 2OCEA 1V1PA 2R7FA 2F0VA 1GD7A 3HS0C 4KN4C 4JI1L 2JA5B 1T5EA 1KXLA 2ASLA 2PW5A 4RAUC 3S24A 4B3SQ 3TZDA 2ZDHA 1SYCA 1KLGD 4KV6A 4LMQD 3STBC 4A3JB 1D1IA 2FMAA 2ASDA 1ENCA 4FDBA 3BVZA 3MFYA 4CDEC 1JQYD 5JEAG 2JA7A 3EBEA 3R2IA 1M4VA 1ZEQX 4FF1A 4K5WA 1XMQQ 1CA5A 4AIMA 3SE7A 4IUTA 1LTBD 2KHSA 3CD6A 3HOVB 1S4ZA 3DEOA 4YAJB 1S5ED 5DLFA 2F0TA 4C3JH 4DF7A 4H7BA 4RNNA 1FGBD 1L0WA 4IPDA 3G6JB 2I8CA 3HKZB 2M2LA 1VF7A 4NXNH 4KD4A 4EBDA 5M3FH 3AYHB 2ZTCA 2F4VQ 3MWYW 2MCTA 3C1EA 3CMEA 1VQ6A 4WJWA 4U673 4HJ9A 4O4IF 1QG7A 3FPPA 4R4CA 2WB1G 3UDFA 4LF6Q 1BDOA 4IRCA 1C4QA 5M5XH 1IYVA 5JJZA 2W9BA 2R3ZA 3NEMA 3CQZB 1LT5D 1QVFA 3TP8A 4Q43A 3GTJA 1H9SA 5LA6F 1AE2A 2TSSA 4IRKA 2HDLA 4GN5A 4OONA 1PTOF 3R5XA 3MFIA 4NLGA 3UI2A 4JI4Q 2VUMH 2N3SA 3CCRA 4BY1G 3HOZG 4Q8EA 2EOTA 4CDCC 2E2IH 3DUZA 3A8KE 3JRXA 2WIIB 3L4KA 2NTSA 4OHJA 1HZ9A 1B6SA 3Q22A 2B63G 2HT1A 4BY1H 5T14A 3Q8QB 2AQ2B 3T5HA 1LTAD 1CSPA 4X65Q 3PR4A 3J81L 2R93H 1TA8A 2JA8B 5C44B 2W9AA 1ESFA 2KHJA 4DUYL 1I7LA 3NENA 1TWHH 2K1BA 5CYUA 4DR1L 4QWDA 4P75A 4EQOA 1CUKA 3VDYA 2QILA 4ECUA 4DL2A 4PZ8A 5IP7H 3TIGA 2KENA 4A3DB 1R9TA 5DLGA 5KFDA 1HTLD 1UWVA 4IZ8A 4RFBA 1K83A 1K1QA 3SR1A 4MA5A 5FPRA 1LT4D 2CHBD 4UHVA 1N33H 4CHTB 4DV0H 3GTOB 1S5CD 1KJIA 1LTID 2XCPA 2RF4A 2WINB 1LT3D 3KDFB 1EYZA 3EVQA 2CW7A 2FB9A 5KFKA 4HR7A 3RNUA 1UE7A 4LF8Q 5IP9H 1PH8A 2Y0SG 1QCBD 1CT1D 1NE3A 1B53A 1SMYD 3L4JA 3GTPA 4RHRA 3CVZA 2HIVA 4JOIA 4Y52H 4KLKA 2AWOA 2JK8A 4C2MB 4IFDJ 3W1BA 2PYKA 4HSVA 3X3MA 4DU9A 1EZ1A 1FNUA 4N9PA 4ED8A 4O3PA 4A76A 1D1KA 2ZM6H 3J81E 1S5FD 3FKIH 4C1NI 3HOYB 5M5YB 1K3RA 4RNMA 4HN7A 3IN5A 5M9OA 5K5PA 5M5WH 1JE5A 4A3IH 4LUZA 3UDIA 2HGSA 2W7PA 3U4ZA 5F9LA 3JSLA 4ECTA 3M9BA 3RN2A 5IWAH 4JW0A 1DV2A 1C8CA 4LFCQ 1N36L 1PLFA 2ICIA 4B3SL 3RGXA 1B7YB 3Q8PB 4DV0L 1ASZA 1VMPA 5E3FA 4K0KH 4A3MH 1E4EB 1FJGH 3VA7A 3D4WA 4DR4L 1JX4A 3SK6A 5C1OA 4DV6Q 2OTLA 3KDFA 5J39A 4ULLA 3S1MH 2O5IC 1VMCA 2QDLA 2Z6KA 4LF9Q 2W71A 3RB0A 1HR0L 1BR9A 3P75A 2NVYA 1AN7A 4JV5Q 2AGPA 3J81i 4GNXC 4A3EG 1DD2A 5IYDH 3BAAA 4ZKBB 2FPGB 1I94H 4O3RA 3Q8DA 4IFDI 2IWHA 3GD7A 4IUQA 3OMGA 3RLFA 5FK9C 3VMMA 2K04A 3UQ8A 4V0BA 2XGTA 3K0YA 1E4FT 1U4MA 5LOVF 2J6SA 1QVGA 5KT4A 1LLRD 4S3SA 3FVQA 4Y8VB 4O3NA 1FR3A 3CRKC 4JYAL 4NXMH 4A3JG 3V96A 3QO2A 1STGA 4JG2A 3I55A 2VXWA 2NVTB 4DV7H 2RDJA 5TSSA 4M8AA 1EEID 4DGZA 4DK1A 3NBHB 4A93H 2Z1CA 3M4QA 4FU0A 2R6FA 4JI7Q 1PH7A 2ZJPA 4QIWA 4X64Q 3T4AC 4CC5A 3T1HH 2MP1A 4DK6C 1S9FA 3SXHA 4NXNL 4EFEA 2OXPA 4Z9CB 3IRBA 4DLKA 1TWFB 2K50A 4JPBW 3BZKA 1U5KA 2PPBC 4MIUA 1OO9B 1C7YA 4A3GG 2L4NA 4DAYB 3JAME 5KFTA 2KOLA 2Y0SB 3W5OA 3F8NA 1UEAB 4IOAA 4DR4H 2GVBA 1TS5A 3ND8A 1JIHA 2A6HC 1SSOA 1S3OA 2B29A 1D6EC 1PX2A 1A9XA 3FKIG 3PIO3 5EWGA 3E9IA 4Y7NB 5DEHA 1Q86C 4XT3B 1RK5A 1Z2OX 2A6EC 1VQFA 4I7HA 1XPOA 1TWGB 3CPFA 4ECYA 4JI4H 5EAYA 1GGOA 1V8QA 1WYDA 1E4EA 4FYDA 4IFDG 3OW7A 4KHPQ 4MAMA 1PYSB 5J3BA 5IP9G 3N41B 1JOKA 2E2HH 2XRQD 5KFFA 2F0FA 2EYLA 3KAJA 2A73B 4GNXA 5GADC 1AZQA 4YHHH 1QWYA 4EVOA 1SROA 4R8NA 4X3UA 3K6OA 4N9TA 4X62Q 2EYPA 3I3CA 1YJ9A 2BH2A 3V4ZA 2QF7A 1HUNA 2WACA 2KUMA 1KJ9A 2UXDH 1E2WA 5AJ3L 5GAGC 2E75C 4RH6A 1EYAA 1VQOA 5C4XG 1MBYA 3IG0A 3PW4A 2BE5D 1SE4A 4MTNA 3RMHA 2R8JA 2UXCL 3OUUA 3M4OB 3DEPA 2CW0D 4A3LH 4DV3L 1SEIA 3WOFA 4EBEA 2R7KA 1EYDA 2L12A 4RB3C 5JJLA 4DV3Q 1EY8A 1AH9A 1MJCA 2AUJD 1PH6A 4DNRB 4DR3L 3GTOH 2F4VH 3D6CA 3LGJA 1UEBA 4BY7B 4H44C 1JOOA 3KALA 4DPGA 4J9QA 5KRUA 3GQCA 4DN4M 4MV8A 1U4PA 2EIFA 2DLNA 4C5AA 2Z8LA 2N88A 5KG7A 2C5CA 3W3AA 1ZXTA 3KTMA 4HTHA 3AB9A 2E2HB 1YJNA 2VNUD 3KHRA 5EZYF 5JPNC 1YITA 1EU4A 3KJPA 2JA7B 2NVYH 4FF3A 5KFCA 1PYWD 1ZKOA 2XIGA 4A75A 1OXXK 2K01A 1X65A 1EUJA 3BS1A 4TV8F 4GKJL 4DR6L 4C3HB 3VYSA 1I6HB 2Z6KC 3NHHA 2PMZB 4R8UA 4R9WA 3TINA 3QIAA 3TZUA 2ASBA 2N78A 1EY4A 1V51A 1A8VA 3K5LA 4A3KG 3CPWA 4L63B 5LHY1 5FLXc 3CMAA 1FJGQ 1KRTA 1LT6D 1SDFA 2BDNA 2N8NA 4JI0Q 4GKJH 1F9SA 2DIKA 3IFTA 4TKOB 1X55A 2Q8TA 2FXQA 5E7NA 5LMNQ 2F0WA 3GTKA 1EOTA 1S40A 4LF9H 2EYHA 2VQFL 4Q8FA 1N32L 3H4DA 2EZVA 3JAMW 3OSPA 4OWTB 2DJGC 4UPAA 2VW9A 3KAKA 2FPIB 3S2HH 3BABA 4EFBA 1YNXA 1QNUA 3G48A 5CORA 3NQIA 5A2QE 4LF9L 4JI6L 4UFZA 1EY6A 2SNMA 2K75A 4QWEA 4R8IA 1QZGA 4J9LA 5KFQA 1D5ZC 2HD3A 2D62A 4A93B 1O75A 2B2TC 1BBXC 3PF5A 3TQTA 1KDAA 4CBVA 2R92A 3NWTA 4IUUA 1UC9A 3HOUH 1LO5D 3TP7A 1HH2P 1BNZA 1GHJA 3PO2B 1PH5A 3V4SA 3HOVH 1O80A 4DV5Q 3F1ZA 2CWPA 1KL9A 2NVQH 5A2QL 2L9HA 1EIYB 5LYJF 1VQ4A 2WDTA 2J7ZA 3J80W 4GC7A 3K3PA 3OHAA 1S72A 4XT1B 1CQIB 2UXCH 4E4TA 1K83H 2JN4A 4AYBB 3HOZH 3S16B 4PG3A 2D0PA 4AQYH 4LF5H 2K4KA 3K59A 5EOYA 3H91A 3E3XA 4MV6A 2XTIA 5KG1A 4J0MA 3G6YA 1XPRA 1IBLH 1QUQA 4J6HA 3U4VA 1QZHA 3I4MG 4LF8H 4NKLA 3FP9A 3CCLA 5ELCA 1V1PB 4RB0A 4IPGA 4RCOA 2R93A 3J7ZC 4FNFA 4C3IB 1QNKA 1R4PB 4HCSA 4XYLB 3U9SA 5JAVA 3BDLA 4ED2A 3FRPB 4X62L 5C3WA 1EZ6A 1S68A 4MHEA 3A55A 2J6UA 2EY2A 2MFIA 1F2LA 3S1NB 4RA8A 2UUAL 4POFA 3V2TA 4YAKB 2OLSA 1AP0A 4EGQA 3I4NB 4ECZA 2BQRA 4JI1H 3I2ZA 3CKIB 3B6YA 1SN8A 3L9AX 2YU9A 1JC7A 2RKSA 3D4RA 4BA2I 3R93A 4K6DA 4A3FH 4LNQA 2DUDA 5C4XB 3JAMi 1ESRA 1ILPA 5G3LD 2UXDL 2E74C 3GIIA 5DQIA 1KRSA 3VPBA 2MUYA 4HSPA 2UUCH 2DN8A 4BBSH 1B50A 4ABNA 1SNDA 4EQ5A 3GIQA 1IBLL 3DWAA 3HEJA 3QG1A 3HOWH 3TS2A 1MHWC 2F0GA 1M6VA 5IY0A 1QOHA 2EY1A 4IHJF 1EY5A 1N8RC 4A3GB 5HGQA 1LTLA 1E7ZA 2NN6G 1XNQQ 3FMCA 2B2YC 4AQYL 4LF5L 2V4QA 3PUVA 4JV5H 3OMCA 1YEZA 4A2BA 1B70B 3ULJA 3MA2B 3R5FA 4JI4L 2C00A 4M9UA 4BXXH 4EBCA 3K7AB 1NMFA 4PDBA 4O2DA 2B63A 2HIXA 3HBLA 2R7ZH 4UCRA 4YB8B 3I90A 4NXMQ 1BOSA 3GV5B 4DR5L 2Z0SA 5KT6A 2R8KA 5JJIA 3S15B 1H9RA 4NXML 3SK5A 2YW2A 4ED6A 5D3IB 2CWAA 2AQ3B 2VPSA 1SCUB 2J4XA 1EL0A 3FKIA 1OXUA 1KDBA 3EA6A 2DY8A 2XWBB 2Q2TA 1YZ6A 3Q1KA 3H4BA 1X54A 3H6MA 1N56A 2HVQA 4HQ6A 1IKMA 1DJRD 1KAAA 3G7LA 4KMUC 2ZXOA 5C4JH 2KA7A 1K8MA 2W9CA 3K3VA 1WTHA 2ALZA 4OIKA 5L1KA 3SDZA 5KFSA 2YS6A 3IKJA 2LKVA 3NUCA 3O13A 1YI2A 1MGSA 1RYRA 1YJWA 5C3EG 5I4DA 2R7ZG 2C35B 1Y69U 1XMQL 1JJGA 2KCNA 3OSNA 1IBKH 1CKNB 1U9RA 5HY6A 3RLNA 1FJGL 4DXGA 1CZGA 2VPQA 1PVOA 1VQPA 2C9OA 4JYAH 4OO1I 1BXTA 5G3LF 1R9TH 4DV1Q 2F0SA 4FF4A 3N44B 1IW7D 4GKKL 5D3DA 5FJ8H 5EPLA 4QW8A 2F0MA 4A93G 2LY7A 1TKWB 4LF4Q 3N43B 4NP5A 1STEA 4U68A 1TQOA 4GKJQ 2UXDQ 3E0JA 5EDWA 3D8GA 3T1YH 1EQTA 3H40A 1E0BA 2UXBL 1D7QA 4XYMB 2R86A 4LFBQ 2I5LX 2IT1A 2UU9L 3WO1A 4RAZA 1E22A 3UDGA 3ERSX 1I50H 1LTSD 3SE0A 1ZYRC 4X3TA 2V1CC 4ZI7F 2F0UA 4F87A 4PQXA 4APMA 4DR7H 2I07B 5FLMH 4AYBE 4E6IA 4GZYC 2P0AA 2EPBA 2K28A 3GTJH 1H9KA 3S2DB 4ECWA 2JEGA 1PZKD 3JRWA 2J0TD 1XMOL 2PNRC 5D1OB 1N34L 1NY4A 2DJFC 4DV3H 1U4LA 3OTOL 1KC7A 4O2AF 4FXGC 2UU9Q 1N36H 2NWGA 2C28A 1N33L 3M9OB 1XMOH 1P8LA 1PFMA 3TP5A 1EWCA 2UXCQ 1ICFB 1EWIA 4ECQA 1SNMA 2CQAA 2YRXA
chains in the Genus database with same CATH topology
3S1RH 4JOIA 4MNOA 4L5QA 2ZM6L 2E8GA 2Q2HA 4KLKA 5C0XG 1ASYA 2AWOA 2JK8A 4JI7L 4IFDJ 3W1BA 4IPHA 4RG1A 4DR3Q 4B3ML 2R92G 3HOUG 4A76A 4DR6Q 1I3QH 4DR5Q 4L5SA 2MO1A 3FKIH 1VQ7A 3CCSA 3KF8B 3PUXA 4JCVE 1J5EQ 1K3RA 4R4TA 2YTXA 2MNAA 2ES2A 3HOVG 5M5WH 1JE5A 4GOPC 4LUZA 4A3IH 4LW1A 3UDIA 3A5UA 4H02A 3U4ZA 3L2PA 2ATWA 4LFCL 1WCMH 4PZ7A 1SR3A 1XNQL 3M9BA 3RN2A 4JI0L 1VQAA 3G6EA 3JC66 3PO2G 3F2CA 5M3FG 4LFCQ 1N36L 1N32Q 4B3SL 1B7YB 4DV0L 3GDEA 1ASZA 1A62A 4UP8A 4A3MH 4P73A 3K7AH 1VQBA 1G51A 4DR4L 2JEBI 2R6GA 1YIJA 1G6PA 3I4MH 3I4OA 2VZAA 5H1SE 4DV6Q 2JJQA 2OTLA 3KDFA 4DR7L 3I7FA 4HJ5A 1K8AC 3S1MH 1EIFA 5IYCH 3G4SA 1L1OB 2Z6KA 3E0EA 1OTCA 4LF9Q 4A3BG 3AFPA 1HR0L 3NELA 1RL2A 1PYBA 1V9PA 4P72A 1PH3A 2K5NA 4X66Q 3CCQA 4JV5Q 2NN6I 3J81i 4GNXC 4A3EG 1HNZL 5IYDH 4APVA 3AFQA 2CFMA 3Q8DA 2RCNA 3TEHB 1K73C 4IFDI 4QQBX 1PH1A 2CQOA 3J80i 1Q7YC 3HOYG 3GD7A 5C4XH 4L5TA 3RLFA 4DV5L 4KI0A 1KIXA 1C9OA 4JC0A 4DUZL 3T1YL 4JI2L 2IX0A 4IJHA 4A3BH 4GKKQ 1Q1BA 4JI8Q 1LM0A 2I5MX 2XGTA 3RLOA 4BY7G 3D31A 5IYBH 2E5LQ 1L1OC 1TXYA 3PCOB 5JEAJ 1QVGA 1IBMQ 4LF7Q 4AH6A 3BU2A 2VS1A 2BA0A 3S1NH 4HIMA 2F52A 1XJVA 1JJ2A 2HHHQ 4JYAL 1B8AA 1Z9FA 4A3JG 4UP7A 1IL2A 4JG2A 3F8TA 3I55A 3GTLH 1Y1WG 1BVSA 4A4IA 2IX1A 4DV0Q 1KAWA 3NBHB 3EN2A 3ULLA 4AYBG 1M90C 4A93H 3M4QA 4TVAB 3I56A 4JI7Q 1X56A 4MZ9A 1PH7A 2B3GA 2ZJPA 2MO0A 4X64Q 1CKNA 3DM3A 4JI3L 1DGSA 2N49A 1SRUA 2JA8H 4IPCA 4BBRG 1WFQA 3FHWA 4OX9L 3H0GG 4DK6C 2KBNA 5GROA 4JBWA 1X3EA 4NXNL 1HR0W 3M3YH 3M4OH 3T1HL 3IRBA 4LFAQ 2A1AA 4DKAC 2UUAQ 2K50A 3BZKA 1U5KA 4R4QA 4A3KH 2E2JH 1HZBA 2L15A 3E9HA 2EXDA 1C7YA 1T9HA 3J81j 4JI5Q 4A3GG 3S16H 4R4OA 4DAYB 3PIPA 1CKOA 2NZOA 4LUOA 3STBD 3HOXH 4DV4Q 2OQ0A 4GN4B 3W5OA 2F3IA 1HR0Q 2AHOB 3HOXG 1AE3A 4KHPL 4DV7L 3SGIA 1A0IA 4IOAA 1W3SA 2GVBA 5IP7G 4P74A 1S3OA 2B29A 2AMCB 2A19A 3KJOA 4K0KL 3H3VI 3MXNB 3FKIG 2JA5H 3KOJA 4YCUA 3PGZA 2ZTDA 4IOCA 4DV2Q 3E9IA 3HFZB 4OXPA 1Q86C 2R92H 2NVTH 2YYZA 3TQYA 1VQFA 3UDXA 1XPOA 2VUMG 5GAEC 4GLAC 2OQKA 3CPFA 3K7UC 1EQQA 1M1KC 5EAYA 1WYDA 1Y1VG 4X66L 4B3RQ 4X65L 2B63H 4JV5L 1SFOH 1PH9A 2CKZB 3RN5A 2JE6I 4IFDG 1IBKQ 3L0OA 1PYSB 5J3BA 5IP9G 1I94L 4LUVA 4JI1Q 2UUBQ 2WP8J 2UUCQ 3I4NH 3KFUA 2E2HH 1Y1VH 4DR2Q 4RMFA 2VQFQ 1X9NA 3GTPH 2VQEL 1NMGA 4GNXA 5GADC 3H3VH 1SROA 3H15A 2JA8G 3PO3H 1FVIA 2Q2UA 2RHQB 3A0JA 4X62Q 1YJ9A 2BH2A 3HKZE 4YY3L 4UP9A 2PQAA 3PUZA 5AJ3L 5FLMG 4ME3A 5GAGC 2AKWB 1VQOA 4LF7L 4L5RC 1XMOQ 5C4XG 4PMWA 4DK3C 4YCVA 1KHIA 4MTNA 4TQUS 4BXXG 2UXCL 2K52A 4A3LH 4DV3L 2UUBL 4Y52H 5IYDG 4BBRH 3BZCA 1X3GA 5JJLA 4DV3Q 4AQYQ 2PI2E 5LMNW 4LF5Q 1GKHA 1MJCA 1XNRQ 1O7IA 2JEAI 3GTQH 1PH6A 2Y0SE 1KD1C 4DR3L 3GTOH 1L2FA 5LMUQ 2E5LL 4HIDA 3LGJA 1UEBA 1YHAA 4J15A 3TREA 3L7ZC 4DPGA 1KC8C 1VQ5A 4ALPA 2JA5G 3A74A 2EIFA 1P16A 1VQIA 3F2BA 1N33Q 1NJIC 4LF6L 3CC7A 4LFAL 3RZDH 1G291 2ZTEA 1HNXL 1I5FA 4JBJA 4LF8L 1XPUA 1YJNA 2VNUD 1HNZQ 4YWKA 3KYHC 1YITA 1Y1WH 3DLLA 2I0QA 2GVAA 2YTYA 4YCWA 1SMXA 4GS3A 3JAMc 3KJPA 4JYAQ 4A3LG 4WJ3M 3ZJYC 2KCMA 4OWXB 2NVYH 4GNXB 4K0KQ 4HJ7A 1XNRL 4A75A 4A3DG 1OXXK 3K0XA 2HQLA 1X65A 2VL6A 1EUJA 3M85A 4YWMA 4DV6L 4GKJL 2WB1E 4YY3Q 4NXNQ 3G71A 4GLXA 3T1YQ 4DR6L 2Z6KC 4C3HH 1I6HH 2LSSA 2WAQE 4DV2L 2GN5A 4JI3Q 1D8LA 1VQGA 2I5HA 1BBUA 1GO3E 1Q1EA 2AWNA 1UE1A 1WJJA 2N78A 2R7DA 1K9MC 2ASBA 3J81c 1BKBA 1A8VA 4A3KG 3CPWA 4LFBL 4B3RL 5AJ3Q 1IYJB 2PI2A 5FLXc 3CMAA 1FJGQ 3PUWA 1KRTA 2N8NA 1VQEA 1I94Q 4JI0Q 4BBSG 1PV4A 5ELOA 1X55A 2FXQA 5E7NA 5LMNQ 1C0AA 5IWAQ 4WJ4A 1VQLA 4DUZQ 4BA1I 1S40A 3EIVA 2VQFL 1N32L 1L1OA 4HJAA 1E24A 4OWTB 1NTGA 2K5VA 4UPAA 2VW9A 4OX9Q 3TRZA 1V43A 5M3MG 4BY7H 2JA6G 3S2HH 4QY7A 2DGYA 4HIKA 1YNXA 3UE1A 3G48A 3KLWA 1VQJA 1GVPA 3CCMA 1OXSC 3OYYA 5IT9c 3KF6A 4A3MG 4JI6L 4LF9L 3CXCA 2EQSA 1VS0A 2K75A 2MQHA 1QZGA 3AQQA 1J5EL 3BJUA 2D62A 4JBMA 4IO9A 2JA7H 2KCTA 3PF5A 5K36G 4DAMA 1MJEA 1VQMA 3HOUH 4DV4L 1HH2P 3S14H 1JT8A 3PO3G 5GAHC 2PQAB 4P71A 1PH5A 1IBKL 3HOVH 4DV5Q 1Q81C 3F1ZA 2CWPA 1CKMA 5IYCG 5IE8A 4HIOA 1KL9A 1VQCA 3HKZG 3CCUA 5LMUL 2JA7G 1EIYB 2NVQH 1OXTA 1VQ4A 3PUYA 2KHIA 3AEVA 1WOCA 3H0GH 3TS0A 1MKHA 1S72A 2NVXH 1K83H 1LYLA 3HOZH 1PH4A 4PG3A 2D0PA 4R4IA 1JJCB 2K4KA 4JI5L 2YV5A 3CQZH 2QA4A 4R1JA 3K81C 2OWOA 4GLVB 2XTIA 2HHHL 3PO2H 2ZJRA 1XPRA 1HNWL 1E1OA 1QUQA 3I4MG 3U4VA 4DUYQ 1QZHA 2K5HA 3S2DH 1PHJA 3K8AA 3ICEA 3FP9A 4A3JH 2UUCL 3HKSA 2ZM6Q 3KF6B 3CCLA 4YHHL 5JJKA 2QGQA 4IPGA 1XTDA 4QL5A 4JI8L 2IHEA 2LXJA 2K14A 3J7ZC 3RZOH 1V1QA 1QVCA 2NZHA 4YWLA 4X6AH 1HJPA 2F4VL 4X62L 3T1HQ 4GOPA 4JOIC 3RR5A 3CP0A 5DLQE 4QJFA 2H5XA 1YHBA 2MFIA 2WFWA 4KHZA 2UUAL 3PV0A 4POFA 4DR1Q 2RHSB 5C44G 1YVCA 1Q46A 4HJ8A 3M7NA 2CCZA 1Q8KA 2JA6H 3I4NG 3I2ZA 4GN3B 3B6YA 1PH2A 1SN8A 1VQ9A 3PIOA 3GTMH 3PF4A 3GTGH 3ER0A 3OW2A 1IXRA 3A5ZB 4BA2I 5C0XJ 2OTJA 2ID0A 4JI2Q 2R93G 4A3CG 4A3FH 4LNQA 4DR4Q 2DUDA 4A3CH 3JAMi 1YBYA 2PMZE 1TWGH 4JBKA 3MEFA 2LXKA 1EOVA 2UXDL 1CSQA 2VQEQ 1KRSA 1Y14B 4Y7NH 5ELNA 1JB7A 4BBSH 2ALYB 4KHPQ 4EQ5A 4B3MQ 4DNIA 1IBLL 1E3PA 4B3TL 3HOWH 3U50C 4A3IG 3TS2A 5IY0A 2ZJQA 4DR7Q 3CCVA 3OTOQ 1N8RC 5HGQA 3U58A 1LTLA 1E7ZA 2NN6G 4DV7Q 1GM5A 1U0LA 3J80c 4AQYL 3PSIA 5BR8L 4LF5L 3PUVA 1XNQQ 2YTVA 2OCEA 1YEZA 4DR2L 1B70B 2R7FA 2QEXA 3ULJA 1GD7A 1Q82C 4JI1L 3CC2A 3CC4A 4JI4L 4BXXH 1KXLA 1NMFA 4O2DA 1H95A 2HIXA 1N36Q 5LMNL 1UE5A 3HOYH 3S24A 4X64L 2R7ZH 4B3SQ 1SE8A 4YHHQ 3F2DA 4NXMQ 1VQKA 1Z47A 3STBC 4DR5L 2Z0SA 2A8VA 5M3MH 1HZAA 4FDBA 5JJIA 5JEAG 4NXML 3EBEA 1XMQQ 2BH8A 4B3TQ 4AIMA 4LWCA 2CWAA 3CD6A 4OO1G 4NPSA 5M5YH 1OXUA 1A63A 1KQSA 1EQRA 1PFSA 1YZ6A 2Q2TA 3S15H 1X54A 4PZ6A 3GO5A 4C3JH 4XIGS 1RIPA 1HNWQ 1L0WA 1MIUA 5C4JH 4IPDA 3GTKH 1VQ8A 3S17H 5M3FH 2PNHA 1SLJA 3AYHB 1IBLQ 2ZTCA 2F4VQ 2JA9A 3CMEA 1WCMG 1YI2A 1VQ6A 1VQHA 4HJ9A 1VQDA 1YJWA 4R4CA 3S1QH 1VQNA 5C3EG 1YHQA 2WB1G 3UDFA 4LF6Q 4A3GH 2JQOA 3M4PA 2R7ZG 1HZCA 2C35B 5M5XH 4A3DH 2WAQG 4O0AA 1XMQL 1JJGA 3NEMA 5BR8Q 3HOWG 1QVFA 4IJLA 1FL0A 1IZ6A 1CKNB 1N9WA 5HY6A 3RLNA 3J7A5 3K80C 2YU9H 2Q2IA 4EX5A 4GOPB 4A3EH 1WI5A 1FJGL 2VY3A 4QIWE 1PVOA 1J6QA 1AE2A 3CAMA 1VQPA 4OO1I 4UY8C 1R9TH 4DV1Q 1X6OA 4GN5A 4OONA 5FJ8G 1EYGA 5FJ8H 4LF4L 4GKKL 4JI4Q 4NB3A 5IWAL 2VUMH 2N3SA 4A93G 3CCRA 4BY1G 3HOZG 3CW2C 4LF4Q 2E2IH 2UXDQ 4GKJQ 1TWCH 1HZ9A 1N34Q 2B63G 4C2MH 2HT1A 4BY1H 5C44H 2UXBL 1D7QA 3CCJA 4LFBQ 2I5LX 1CSPA 2IT1A 4X65Q 4A3FG 2UU9L 2R93H 2UXBQ 4POGA 1FGUA 3WWVA 5C3EH 3CF5A 2KHJA 4DUYL 5IYBG 1E22A 1PA6A 3NENA 3ERSX 3UDGA 1TWHH 1I50H 4DR1L 1HNXQ 4P75A 1CUKA 3VDYA 4PZ8A 1LUZA 2V1CC 4C3IH 2IY5B 5IP7H 1BBWA 2KENA 1TWFH 1OXVA 1JMCA 5FLMH 4OWWB 4AYBE 1AH9A 1UWVA 1Q12A 3GTJH 3UE0A 3W1GA 1IBML 2BA1A 5GQOA 1XMOL 1UE6A 4JI6Q 1N34L 1NY4A 1EFWA 3OTOL 3ULPA 1TWAH 2RF4A 3KDFB 2UU9Q 1W2BA 3CCEA 1VCIA 1N33L 4QGUA 1P8LA 2D0OA 2IHFA 1NBWA 3RNUA 1UE7A 4XTCS 5C0XI 4LF8Q 5IP9H 4DV1L 1PH8A 2Y0SG 1K8GA 2UXCQ 1NE3A 1EWIA 1K0RA 1QUQB 1E1TA 3D0FA 1X3FA 2HIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1R H;  4JOI A;  4MNO A;  4L5Q A;  2ZM6 L;  2E8G A;  2Q2H A;  4KLK A;  5C0X G;  1ASY A;  2AWO A;  2JK8 A;  4JI7 L;  4IFD J;  3W1B A;  4IPH A;  4RG1 A;  4DR3 Q;  4B3M L;  2R92 G;  3HOU G;  4A76 A;  4DR6 Q;  1I3Q H;  4DR5 Q;  4L5S A;  2MO1 A;  3FKI H;  1VQ7 A;  3CCS A;  3KF8 B;  3PUX A;  4JCV E;  1J5E Q;  1K3R A;  4R4T A;  2YTX A;  2MNA A;  2ES2 A;  3HOV G;  5M5W H;  1JE5 A;  4GOP C;  4LUZ A;  4A3I H;  4LW1 A;  3UDI A;  3A5U A;  4H02 A;  3U4Z A;  3L2P A;  2ATW A;  4LFC L;  1WCM H;  4PZ7 A;  1SR3 A;  1XNQ L;  3M9B A;  3RN2 A;  4JI0 L;  1VQA A;  3G6E A;  3JC6 6;  3PO2 G;  3F2C A;  5M3F G;  4LFC Q;  1N36 L;  1N32 Q;  4B3S L;  1B7Y B;  4DV0 L;  3GDE A;  1ASZ A;  1A62 A;  4UP8 A;  4A3M H;  4P73 A;  3K7A H;  1VQB A;  1G51 A;  4DR4 L;  2JEB I;  2R6G A;  1YIJ A;  1G6P A;  3I4M H;  3I4O A;  2VZA A;  5H1S E;  4DV6 Q;  2JJQ A;  2OTL A;  3KDF A;  4DR7 L;  3I7F A;  4HJ5 A;  1K8A C;  3S1M H;  1EIF A;  5IYC H;  3G4S A;  1L1O B;  2Z6K A;  3E0E A;  1OTC A;  4LF9 Q;  4A3B G;  3AFP A;  1HR0 L;  3NEL A;  1RL2 A;  1PYB A;  1V9P A;  4P72 A;  1PH3 A;  2K5N A;  4X66 Q;  3CCQ A;  4JV5 Q;  2NN6 I;  3J81 i;  4GNX C;  4A3E G;  1HNZ L;  5IYD H;  4APV A;  3AFQ A;  2CFM A;  3Q8D A;  2RCN A;  3TEH B;  1K73 C;  4IFD I;  4QQB X;  1PH1 A;  2CQO A;  3J80 i;  1Q7Y C;  3HOY G;  3GD7 A;  5C4X H;  4L5T A;  3RLF A;  4DV5 L;  4KI0 A;  1KIX A;  1C9O A;  4JC0 A;  4DUZ L;  3T1Y L;  4JI2 L;  2IX0 A;  4IJH A;  4A3B H;  4GKK Q;  1Q1B A;  4JI8 Q;  1LM0 A;  2I5M X;  2XGT A;  3RLO A;  4BY7 G;  3D31 A;  5IYB H;  2E5L Q;  1L1O C;  1TXY A;  3PCO B;  5JEA J;  1QVG A;  1IBM Q;  4LF7 Q;  4AH6 A;  3BU2 A;  2VS1 A;  2BA0 A;  3S1N H;  4HIM A;  2F52 A;  1XJV A;  1JJ2 A;  2HHH Q;  4JYA L;  1B8A A;  1Z9F A;  4A3J G;  4UP7 A;  1IL2 A;  4JG2 A;  3F8T A;  3I55 A;  3GTL H;  1Y1W G;  1BVS A;  4A4I A;  2IX1 A;  4DV0 Q;  1KAW A;  3NBH B;  3EN2 A;  3ULL A;  4AYB G;  1M90 C;  4A93 H;  3M4Q A;  4TVA B;  3I56 A;  4JI7 Q;  1X56 A;  4MZ9 A;  1PH7 A;  2B3G A;  2ZJP A;  2MO0 A;  4X64 Q;  1CKN A;  3DM3 A;  4JI3 L;  1DGS A;  2N49 A;  1SRU A;  2JA8 H;  4IPC A;  4BBR G;  1WFQ A;  3FHW A;  4OX9 L;  3H0G G;  4DK6 C;  2KBN A;  5GRO A;  4JBW A;  1X3E A;  4NXN L;  1HR0 W;  3M3Y H;  3M4O H;  3T1H L;  3IRB A;  4LFA Q;  2A1A A;  4DKA C;  2UUA Q;  2K50 A;  3BZK A;  1U5K A;  4R4Q A;  4A3K H;  2E2J H;  1HZB A;  2L15 A;  3E9H A;  2EXD A;  1C7Y A;  1T9H A;  3J81 j;  4JI5 Q;  4A3G G;  3S16 H;  4R4O A;  4DAY B;  3PIP A;  1CKO A;  2NZO A;  4LUO A;  3STB D;  3HOX H;  4DV4 Q;  2OQ0 A;  4GN4 B;  3W5O A;  2F3I A;  1HR0 Q;  2AHO B;  3HOX G;  1AE3 A;  4KHP L;  4DV7 L;  3SGI A;  1A0I A;  4IOA A;  1W3S A;  2GVB A;  5IP7 G;  4P74 A;  1S3O A;  2B29 A;  2AMC B;  2A19 A;  3KJO A;  4K0K L;  3H3V I;  3MXN B;  3FKI G;  2JA5 H;  3KOJ A;  4YCU A;  3PGZ A;  2ZTD A;  4IOC A;  4DV2 Q;  3E9I A;  3HFZ B;  4OXP A;  1Q86 C;  2R92 H;  2NVT H;  2YYZ A;  3TQY A;  1VQF A;  3UDX A;  1XPO A;  2VUM G;  5GAE C;  4GLA C;  2OQK A;  3CPF A;  3K7U C;  1EQQ A;  1M1K C;  5EAY A;  1WYD A;  1Y1V G;  4X66 L;  4B3R Q;  4X65 L;  2B63 H;  4JV5 L;  1SFO H;  1PH9 A;  2CKZ B;  3RN5 A;  2JE6 I;  4IFD G;  1IBK Q;  3L0O A;  1PYS B;  5J3B A;  5IP9 G;  1I94 L;  4LUV A;  4JI1 Q;  2UUB Q;  2WP8 J;  2UUC Q;  3I4N H;  3KFU A;  2E2H H;  1Y1V H;  4DR2 Q;  4RMF A;  2VQF Q;  1X9N A;  3GTP H;  2VQE L;  1NMG A;  4GNX A;  5GAD C;  3H3V H;  1SRO A;  3H15 A;  2JA8 G;  3PO3 H;  1FVI A;  2Q2U A;  2RHQ B;  3A0J A;  4X62 Q;  1YJ9 A;  2BH2 A;  3HKZ E;  4YY3 L;  4UP9 A;  2PQA A;  3PUZ A;  5AJ3 L;  5FLM G;  4ME3 A;  5GAG C;  2AKW B;  1VQO A;  4LF7 L;  4L5R C;  1XMO Q;  5C4X G;  4PMW A;  4DK3 C;  4YCV A;  1KHI A;  4MTN A;  4TQU S;  4BXX G;  2UXC L;  2K52 A;  4A3L H;  4DV3 L;  2UUB L;  4Y52 H;  5IYD G;  4BBR H;  3BZC A;  1X3G A;  5JJL A;  4DV3 Q;  4AQY Q;  2PI2 E;  5LMN W;  4LF5 Q;  1GKH A;  1MJC A;  1XNR Q;  1O7I A;  2JEA I;  3GTQ H;  1PH6 A;  2Y0S E;  1KD1 C;  4DR3 L;  3GTO H;  1L2F A;  5LMU Q;  2E5L L;  4HID A;  3LGJ A;  1UEB A;  1YHA A;  4J15 A;  3TRE A;  3L7Z C;  4DPG A;  1KC8 C;  1VQ5 A;  4ALP A;  2JA5 G;  3A74 A;  2EIF A;  1P16 A;  1VQI A;  3F2B A;  1N33 Q;  1NJI C;  4LF6 L;  3CC7 A;  4LFA L;  3RZD H;  1G29 1;  2ZTE A;  1HNX L;  1I5F A;  4JBJ A;  4LF8 L;  1XPU A;  1YJN A;  2VNU D;  1HNZ Q;  4YWK A;  3KYH C;  1YIT A;  1Y1W H;  3DLL A;  2I0Q A;  2GVA A;  2YTY A;  4YCW A;  1SMX A;  4GS3 A;  3JAM c;  3KJP A;  4JYA Q;  4A3L G;  4WJ3 M;  3ZJY C;  2KCM A;  4OWX B;  2NVY H;  4GNX B;  4K0K Q;  4HJ7 A;  1XNR L;  4A75 A;  4A3D G;  1OXX K;  3K0X A;  2HQL A;  1X65 A;  2VL6 A;  1EUJ A;  3M85 A;  4YWM A;  4DV6 L;  4GKJ L;  2WB1 E;  4YY3 Q;  4NXN Q;  3G71 A;  4GLX A;  3T1Y Q;  4DR6 L;  2Z6K C;  4C3H H;  1I6H H;  2LSS A;  2WAQ E;  4DV2 L;  2GN5 A;  4JI3 Q;  1D8L A;  1VQG A;  2I5H A;  1BBU A;  1GO3 E;  1Q1E A;  2AWN A;  1UE1 A;  1WJJ A;  2N78 A;  2R7D A;  1K9M C;  2ASB A;  3J81 c;  1BKB A;  1A8V A;  4A3K G;  3CPW A;  4LFB L;  4B3R L;  5AJ3 Q;  1IYJ B;  2PI2 A;  5FLX c;  3CMA A;  1FJG Q;  3PUW A;  1KRT A;  2N8N A;  1VQE A;  1I94 Q;  4JI0 Q;  4BBS G;  1PV4 A;  5ELO A;  1X55 A;  2FXQ A;  5E7N A;  5LMN Q;  1C0A A;  5IWA Q;  4WJ4 A;  1VQL A;  4DUZ Q;  4BA1 I;  1S40 A;  3EIV A;  2VQF L;  1N32 L;  1L1O A;  4HJA A;  1E24 A;  4OWT B;  1NTG A;  2K5V A;  4UPA A;  2VW9 A;  4OX9 Q;  3TRZ A;  1V43 A;  5M3M G;  4BY7 H;  2JA6 G;  3S2H H;  4QY7 A;  2DGY A;  4HIK A;  1YNX A;  3UE1 A;  3G48 A;  3KLW A;  1VQJ A;  1GVP A;  3CCM A;  1OXS C;  3OYY A;  5IT9 c;  3KF6 A;  4A3M G;  4JI6 L;  4LF9 L;  3CXC A;  2EQS A;  1VS0 A;  2K75 A;  2MQH A;  1QZG A;  3AQQ A;  1J5E L;  3BJU A;  2D62 A;  4JBM A;  4IO9 A;  2JA7 H;  2KCT A;  3PF5 A;  5K36 G;  4DAM A;  1MJE A;  1VQM A;  3HOU H;  4DV4 L;  1HH2 P;  3S14 H;  1JT8 A;  3PO3 G;  5GAH C;  2PQA B;  4P71 A;  1PH5 A;  1IBK L;  3HOV H;  4DV5 Q;  1Q81 C;  3F1Z A;  2CWP A;  1CKM A;  5IYC G;  5IE8 A;  4HIO A;  1KL9 A;  1VQC A;  3HKZ G;  3CCU A;  5LMU L;  2JA7 G;  1EIY B;  2NVQ H;  1OXT A;  1VQ4 A;  3PUY A;  2KHI A;  3AEV A;  1WOC A;  3H0G H;  3TS0 A;  1MKH A;  1S72 A;  2NVX H;  1K83 H;  1LYL A;  3HOZ H;  1PH4 A;  4PG3 A;  2D0P A;  4R4I A;  1JJC B;  2K4K A;  4JI5 L;  2YV5 A;  3CQZ H;  2QA4 A;  4R1J A;  3K81 C;  2OWO A;  4GLV B;  2XTI A;  2HHH L;  3PO2 H;  2ZJR A;  1XPR A;  1HNW L;  1E1O A;  1QUQ A;  3I4M G;  3U4V A;  4DUY Q;  1QZH A;  2K5H A;  3S2D H;  1PHJ A;  3K8A A;  3ICE A;  3FP9 A;  4A3J H;  2UUC L;  3HKS A;  2ZM6 Q;  3KF6 B;  3CCL A;  4YHH L;  5JJK A;  2QGQ A;  4IPG A;  1XTD A;  4QL5 A;  4JI8 L;  2IHE A;  2LXJ A;  2K14 A;  3J7Z C;  3RZO H;  1V1Q A;  1QVC A;  2NZH A;  4YWL A;  4X6A H;  1HJP A;  2F4V L;  4X62 L;  3T1H Q;  4GOP A;  4JOI C;  3RR5 A;  3CP0 A;  5DLQ E;  4QJF A;  2H5X A;  1YHB A;  2MFI A;  2WFW A;  4KHZ A;  2UUA L;  3PV0 A;  4POF A;  4DR1 Q;  2RHS B;  5C44 G;  1YVC A;  1Q46 A;  4HJ8 A;  3M7N A;  2CCZ A;  1Q8K A;  2JA6 H;  3I4N G;  3I2Z A;  4GN3 B;  3B6Y A;  1PH2 A;  1SN8 A;  1VQ9 A;  3PIO A;  3GTM H;  3PF4 A;  3GTG H;  3ER0 A;  3OW2 A;  1IXR A;  3A5Z B;  4BA2 I;  5C0X J;  2OTJ A;  2ID0 A;  4JI2 Q;  2R93 G;  4A3C G;  4A3F H;  4LNQ A;  4DR4 Q;  2DUD A;  4A3C H;  3JAM i;  1YBY A;  2PMZ E;  1TWG H;  4JBK A;  3MEF A;  2LXK A;  1EOV A;  2UXD L;  1CSQ A;  2VQE Q;  1KRS A;  1Y14 B;  4Y7N H;  5ELN A;  1JB7 A;  4BBS H;  2ALY B;  4KHP Q;  4EQ5 A;  4B3M Q;  4DNI A;  1IBL L;  1E3P A;  4B3T L;  3HOW H;  3U50 C;  4A3I G;  3TS2 A;  5IY0 A;  2ZJQ A;  4DR7 Q;  3CCV A;  3OTO Q;  1N8R C;  5HGQ A;  3U58 A;  1LTL A;  1E7Z A;  2NN6 G;  4DV7 Q;  1GM5 A;  1U0L A;  3J80 c;  4AQY L;  3PSI A;  5BR8 L;  4LF5 L;  3PUV A;  1XNQ Q;  2YTV A;  2OCE A;  1YEZ A;  4DR2 L;  1B70 B;  2R7F A;  2QEX A;  3ULJ A;  1GD7 A;  1Q82 C;  4JI1 L;  3CC2 A;  3CC4 A;  4JI4 L;  4BXX H;  1KXL A;  1NMF A;  4O2D A;  1H95 A;  2HIX A;  1N36 Q;  5LMN L;  1UE5 A;  3HOY H;  3S24 A;  4X64 L;  2R7Z H;  4B3S Q;  1SE8 A;  4YHH Q;  3F2D A;  4NXM Q;  1VQK A;  1Z47 A;  3STB C;  4DR5 L;  2Z0S A;  2A8V A;  5M3M H;  1HZA A;  4FDB A;  5JJI A;  5JEA G;  4NXM L;  3EBE A;  1XMQ Q;  2BH8 A;  4B3T Q;  4AIM A;  4LWC A;  2CWA A;  3CD6 A;  4OO1 G;  4NPS A;  5M5Y H;  1OXU A;  1A63 A;  1KQS A;  1EQR A;  1PFS A;  1YZ6 A;  2Q2T A;  3S15 H;  1X54 A;  4PZ6 A;  3GO5 A;  4C3J H;  4XIG S;  1RIP A;  1HNW Q;  1L0W A;  1MIU A;  5C4J H;  4IPD A;  3GTK H;  1VQ8 A;  3S17 H;  5M3F H;  2PNH A;  1SLJ A;  3AYH B;  1IBL Q;  2ZTC A;  2F4V Q;  2JA9 A;  3CME A;  1WCM G;  1YI2 A;  1VQ6 A;  1VQH A;  4HJ9 A;  1VQD A;  1YJW A;  4R4C A;  3S1Q H;  1VQN A;  5C3E G;  1YHQ A;  2WB1 G;  3UDF A;  4LF6 Q;  4A3G H;  2JQO A;  3M4P A;  2R7Z G;  1HZC A;  2C35 B;  5M5X H;  4A3D H;  2WAQ G;  4O0A A;  1XMQ L;  1JJG A;  3NEM A;  5BR8 Q;  3HOW G;  1QVF A;  4IJL A;  1FL0 A;  1IZ6 A;  1CKN B;  1N9W A;  5HY6 A;  3RLN A;  3J7A 5;  3K80 C;  2YU9 H;  2Q2I A;  4EX5 A;  4GOP B;  4A3E H;  1WI5 A;  1FJG L;  2VY3 A;  4QIW E;  1PVO A;  1J6Q A;  1AE2 A;  3CAM A;  1VQP A;  4OO1 I;  4UY8 C;  1R9T H;  4DV1 Q;  1X6O A;  4GN5 A;  4OON A;  5FJ8 G;  1EYG A;  5FJ8 H;  4LF4 L;  4GKK L;  4JI4 Q;  4NB3 A;  5IWA L;  2VUM H;  2N3S A;  4A93 G;  3CCR A;  4BY1 G;  3HOZ G;  3CW2 C;  4LF4 Q;  2E2I H;  2UXD Q;  4GKJ Q;  1TWC H;  1HZ9 A;  1N34 Q;  2B63 G;  4C2M H;  2HT1 A;  4BY1 H;  5C44 H;  2UXB L;  1D7Q A;  3CCJ A;  4LFB Q;  2I5L X;  1CSP A;  2IT1 A;  4X65 Q;  4A3F G;  2UU9 L;  2R93 H;  2UXB Q;  4POG A;  1FGU A;  3WWV A;  5C3E H;  3CF5 A;  2KHJ A;  4DUY L;  5IYB G;  1E22 A;  1PA6 A;  3NEN A;  3ERS X;  3UDG A;  1TWH H;  1I50 H;  4DR1 L;  1HNX Q;  4P75 A;  1CUK A;  3VDY A;  4PZ8 A;  1LUZ A;  2V1C C;  4C3I H;  2IY5 B;  5IP7 H;  1BBW A;  2KEN A;  1TWF H;  1OXV A;  1JMC A;  5FLM H;  4OWW B;  4AYB E;  1AH9 A;  1UWV A;  1Q12 A;  3GTJ H;  3UE0 A;  3W1G A;  1IBM L;  2BA1 A;  5GQO A;  1XMO L;  1UE6 A;  4JI6 Q;  1N34 L;  1NY4 A;  1EFW A;  3OTO L;  3ULP A;  1TWA H;  2RF4 A;  3KDF B;  2UU9 Q;  1W2B A;  3CCE A;  1VCI A;  1N33 L;  4QGU A;  1P8L A;  2D0O A;  2IHF A;  1NBW A;  3RNU A;  1UE7 A;  4XTC S;  5C0X I;  4LF8 Q;  5IP9 H;  4DV1 L;  1PH8 A;  2Y0S G;  1K8G A;  2UXC Q;  1NE3 A;  1EWI A;  1K0R A;  1QUQ B;  1E1T A;  3D0F A;  1X3F A;  2HIV A; 
#chains in the Genus database with same CATH topology
 1PTO C;  3Q0A A;  4L5Q A;  2ZM6 L;  4JI2 L;  1Y1V A;  1EZ8 A;  5C0X G;  2NU9 B;  4IPH A;  4DUY H;  3Q6S A;  4J9P A;  3CHB D;  2CQY A;  5BMV F;  1PXU A;  2MO1 A;  1VQ7 A;  4QW9 A;  3CCS A;  4R4T A;  3MWD A;  4ZYS A;  4GOP C;  1EHI A;  2RCF A;  3C1F A;  4H02 A;  3L2P A;  1HUM A;  1ICW A;  1WCM H;  1JIC A;  1ZET A;  1LTR D;  4BWS C;  2XNA C;  4RAY A;  5IT9 W;  3NSW A;  3PQI A;  2YS7 A;  3U9O A;  2J9G A;  4K5X A;  1PDQ A;  1YIJ A;  4TQS A;  3I4O A;  2VZA A;  1EY9 A;  3UFX B;  2PQE A;  2JP1 A;  2WB1 B;  3I7F A;  1T3N A;  3HGB A;  5D1O A;  5IYC H;  4A3B G;  3E0E A;  4OEM B;  5BN4 A;  1OTC A;  1E4G T;  3K5I A;  3AFP A;  3TME A;  5KFV A;  4DR1 H;  5KFN A;  2KEE A;  4ECV A;  3T53 B;  2CFM A;  2I80 A;  3RBD A;  1K73 C;  2HCC A;  2ZDG A;  4YQW A;  4QQB X;  4X65 H;  4JK1 C;  3MVV A;  5KEE A;  3HOY G;  5E4X A;  1WVL A;  4HED A;  5E1F A;  3FEW X;  5L9X A;  2IX0 A;  4IJH A;  4EGV A;  1EIH A;  4JI8 Q;  1LM0 A;  1AZP A;  1ZHS A;  5IYB H;  1L1O C;  2Q8R E;  5JEA J;  5CC4 A;  1IBM Q;  4DAV A;  4LF7 Q;  2B63 B;  5I9P A;  2VS1 A;  1IL8 A;  4HIM A;  3OWE B;  2F52 A;  5LL6 X;  1BXR A;  3V6H A;  4EG0 A;  2CVR A;  1PTO H;  2NUC A;  1IL2 A;  3LWU A;  1HFN A;  3F8T A;  2FK3 A;  4I65 A;  3P7J A;  4ZUI A;  1ZYR D;  4A4I A;  1DYQ A;  4A2A A;  1RK6 A;  5D8D A;  3ULL A;  3PW2 A;  1RHP A;  3RBE A;  3SHL A;  5HUR A;  5JVH 3;  4CJ0 B;  3I56 A;  2B2Y A;  2W70 A;  5CV6 A;  2K33 A;  1X56 A;  4YR2 A;  1S0M A;  3PVX A;  3HB9 A;  2B3G A;  2MO0 A;  1K83 B;  1EY0 A;  4ZK9 B;  1EUD B;  3KUP A;  3M3Y H;  1AN8 A;  1X3E A;  3HP3 A;  1F9Q A;  1UAP A;  3PO3 B;  1IOW A;  4ECR A;  2UUA Q;  1WD1 A;  2V9W A;  3PIP A;  4L1K A;  4DV4 Q;  4RB1 A;  4GN4 B;  2F3I A;  2WKD A;  2AHO B;  3ERO A;  5EJW A;  1HR0 Q;  2K5D A;  3HOX G;  3PMF A;  3SGI A;  1A0I A;  1G6Z A;  5IP7 G;  4K0K L;  1N48 A;  2A19 A;  3E6Z X;  3H3V I;  1DON A;  4IWX A;  1JE4 A;  2R82 A;  4MV1 A;  2JA5 H;  3GIK A;  3Q2O A;  2ZTD A;  4IOC A;  2R92 H;  4OXP A;  1A2U A;  2WB1 A;  2YYZ A;  2O4X A;  3NBH A;  4LFC H;  1RF2 D;  5GAE C;  3D4D A;  3K7U C;  5KFB A;  1SYX B;  3A8J E;  2K05 A;  4RKL A;  2PZW A;  4X66 L;  1A3T A;  2B63 H;  2O2L D;  1SFO H;  5BR8 H;  4CKE A;  5JEA H;  1STY A;  1PH9 A;  1HNW L;  2JE6 I;  3C0F B;  4LH7 A;  3Q24 A;  2UUC Q;  4JI1 Q;  2JEF A;  5NUC A;  1Y1V H;  3LWB A;  1RYS A;  2IMW P;  2VQE L;  3BVM A;  3H3V H;  1CM9 A;  4WRD A;  1IKL A;  3PO3 H;  3A7A B;  5HBR B;  3GTG B;  3GQB A;  1FVI A;  2Q2U A;  2RHQ B;  3EYY A;  1YNN D;  4JV2 A;  3KF8 A;  4YY3 L;  1L2Z A;  3ZYY X;  4LF7 L;  3N42 B;  5CMD A;  1EY7 A;  3EJI A;  4DK3 C;  2NVY B;  5FO8 B;  4PWQ A;  3M4I A;  4HNV A;  5EKL A;  4XXE A;  3PW0 A;  2F0N A;  2SEB D;  1HA6 A;  4BBR H;  1T36 A;  2R7M A;  1C3O A;  2JEA I;  2X6L A;  1XNR Q;  3GTQ H;  2C2R A;  5EWF A;  2UVV A;  5KFG A;  2K5W A;  2V59 A;  1RTO A;  4HID A;  2PVP A;  2ZXP A;  4OL7 A;  1IOV A;  1RTN A;  1DIK A;  3A74 A;  2UVU A;  3F2B A;  2L5T A;  1NJI C;  4QB4 A;  4JI6 H;  4JI7 H;  3J7A F;  4LFA L;  3VYR A;  3RZD H;  1G29 1;  4IR1 A;  2B2W C;  2R8I A;  2NB0 A;  3KYH C;  5HGT A;  4JYA Q;  4Q0Y A;  1SMX A;  4GS3 A;  3ZJY C;  4DV1 H;  1N32 H;  2KCM A;  4OWX B;  3SK8 A;  1BJT A;  1ENA A;  1G2S A;  1L0X B;  1XNR L;  4I50 F;  5BN5 A;  2VL6 A;  2W8K A;  1PMR A;  4OEL B;  4DV6 L;  2WB1 E;  4YY3 Q;  4NXN Q;  3MR3 A;  2A69 D;  3K57 A;  4K2L A;  2XCA A;  1SE3 A;  2EYM A;  4DV2 L;  2GN5 A;  4DAP A;  2AWN A;  1GO3 E;  1K9M C;  2JA8 H;  1KJ8 A;  1X32 A;  2VUG A;  5H80 A;  3J81 c;  4B3R L;  1IYJ B;  2PI2 A;  4LJZ C;  4NDX A;  1Q90 A;  3N52 A;  2WTF A;  5CV5 A;  1STA A;  1VQE A;  1WCM B;  5I2X A;  5KFH A;  1PV4 A;  3HOX B;  4MTE A;  5LP6 F;  4C1N K;  1TII D;  4ZQ3 A;  1DOM A;  1VQL A;  3D3R A;  4J9N A;  3N40 P;  3MAQ A;  1NTG A;  2E76 C;  2X6G A;  4OX9 Q;  1HQR D;  3I4M B;  5M3M G;  4J9R A;  1HTP A;  1EIG A;  5EBC A;  1RKN A;  1VQJ A;  3T16 A;  3OYY A;  5IT9 c;  4A3M G;  3TII A;  1BCP C;  3CXC A;  2EQS A;  1NUC A;  3AQQ A;  1WH2 A;  5KFM A;  5KFU A;  2R8G A;  2RA4 A;  4DL4 A;  5K36 G;  4DAM A;  5CBA E;  1NR4 A;  4DV4 L;  3MZ5 A;  4RGT A;  4IR9 A;  1JT8 A;  3PO3 G;  3GV8 B;  3K5H A;  2PQA B;  3MXP A;  2R7Z A;  5DAU A;  1Q81 C;  2F3V A;  3OWF A;  5KYI A;  5IE8 A;  2FLP A;  1VQC A;  4M1U B;  3ERQ A;  1OXT A;  5FO7 B;  1I3Q B;  5JPM C;  2KHI A;  2XC9 A;  1WOC A;  2W6O A;  1F77 A;  1MKH A;  2L1B A;  3KLR A;  4RHS A;  3RD4 A;  3GTJ B;  1LYL A;  3J81 W;  4C5B A;  4JI5 L;  2QA4 A;  2QDB A;  1VBG A;  2HHH L;  3PO2 H;  4ZAI A;  2QW7 A;  5KG3 A;  1E1O A;  5T1G A;  1JWS D;  1JDB B;  4DUY Q;  2R85 A;  1O78 A;  2K5H A;  4CJ2 C;  4LH6 A;  4A3J H;  1F9P A;  2K5Q A;  2PN1 A;  4YHH L;  5I47 A;  4UCO A;  1O7L A;  4QL5 A;  2ZXR A;  1SNO A;  1B4O A;  2K14 A;  3RZO H;  1V1Q A;  2OH2 A;  3GLK A;  4JV0 A;  5KFE A;  1O7Y A;  2RSO A;  4X6A H;  2SCU B;  1LAB A;  1Y8O B;  4JOI C;  1Q3L A;  4GOP A;  5EPJ A;  3RR5 A;  2R8H A;  2V58 A;  1T5X D;  3CP0 A;  1JCK B;  4FXK C;  1Z6H A;  3PV0 A;  1R9T B;  4DR1 Q;  1TWA B;  1JDE A;  2RHS B;  1A3U A;  4HJ8 A;  3M7N A;  1PFN A;  2UUB H;  1SYG A;  2MJ8 A;  3ND9 A;  1FYC A;  4GN3 B;  2JA6 B;  4IFD H;  4MV9 A;  3PIO A;  4DR2 H;  1GLV A;  3PF4 A;  3ER0 A;  1HHV A;  2KSW A;  4M7E A;  4HMJ A;  2OTJ A;  3VR3 A;  1WTP A;  4A3C H;  3SI8 A;  2PMZ E;  4JI8 H;  1EOV A;  1Q8I A;  3GP7 A;  1GUT A;  1HQM C;  5L1J A;  2F0K A;  1JWM D;  1JB7 A;  4B3M Q;  5A2Q W;  4K8J A;  4DNI A;  3BDO A;  1E3P A;  1STN A;  1TY0 A;  4A3I G;  2KVM A;  4DFA A;  2ZJQ A;  1GM5 A;  3U58 A;  4DV7 Q;  4F88 A;  2YYA A;  3BJY A;  3TN2 A;  1SYB A;  1I4Q A;  2PMZ A;  1Q82 C;  3TQ1 A;  1SFO A;  2QEJ C;  1SNP A;  5M5W B;  5C4H A;  1KEE A;  5FPO A;  5LMN L;  1UE5 A;  4A3F B;  3HOY H;  4X64 L;  2IJ0 A;  1KJQ A;  1SE8 A;  5LMU H;  3F2D A;  1NSN S;  5CBE E;  4JV1 A;  2TMP A;  1HZA A;  1HPC A;  3QFF A;  3JAM L;  2FKL A;  1Z7T A;  2YL2 A;  2MGS A;  5EKK A;  5JUM A;  5D65 A;  1B9N A;  1KNE A;  1A63 A;  3KBG A;  1T94 A;  1NNX A;  1PFS A;  3BQ2 A;  3FDT A;  4XIG S;  5KG0 A;  4CC6 A;  1RIP A;  1HNW Q;  1VKZ A;  3ETH A;  1PFB A;  4CDF C;  3J7A V;  1BO0 A;  1AUX A;  2FP4 B;  4JI5 H;  1IBL Q;  5KFW A;  1WCM G;  4G7H C;  4O3Q A;  2KQ3 A;  1HR0 H;  3S1Q H;  1VQN A;  3A56 A;  3DWP A;  3FMA A;  1BGW A;  5IGE A;  4A3D H;  2WAQ G;  4O0A A;  3LML A;  4L8J A;  1LTG D;  4DL5 A;  5IGF A;  3ONA B;  1W96 A;  1FL0 A;  1IZ6 A;  1N9W A;  4CDD C;  3J7A 5;  5CR3 A;  1TWH B;  4G4K A;  4FM9 A;  2Q2I A;  4EX5 A;  4K2K A;  4A3E H;  5M3M B;  4DV4 H;  4QIW E;  3MC0 B;  1J6Q A;  1TS4 A;  2B2W A;  4UY8 C;  5KG6 A;  3WO0 A;  4ODG A;  3LNN A;  3OOC A;  4NB3 A;  4H13 C;  5IWA L;  4BY1 B;  1TWH A;  1CS0 A;  3OHX C;  2M05 A;  1M7J A;  1GSH A;  1I50 B;  1CE8 A;  1VAJ A;  4MV4 A;  1N34 Q;  2IW3 A;  3E5S A;  4KKT A;  3NXW A;  2UXB Q;  2K32 A;  3PN1 A;  3CF5 A;  5IYB G;  5HV6 A;  4FVM A;  3MJF A;  2E2I A;  5KT3 A;  3OIQ A;  5C4Z A;  4XZ3 B;  4FF2 A;  3GTO A;  4RZR A;  1LUZ A;  4FO2 A;  3IL8 A;  3RUZ A;  1BBW A;  1KNA A;  5CA1 F;  1I6V C;  1EQV A;  1TWF H;  2MPM A;  1OXV A;  2CZG A;  1ET6 A;  4OWW B;  4EYH B;  2C22 A;  1F2M A;  3TBI B;  3NPP A;  2RDG A;  3UE0 A;  1IBM L;  2BA1 A;  2VR1 A;  1UE6 A;  1CZW A;  1EFW A;  4JI6 Q;  2F03 A;  1VCI A;  1JLL B;  3MFH A;  1DV1 A;  2IHF A;  1SXT A;  4C3J B;  4OGQ C;  4UCV A;  4U7C A;  2IL8 A;  4XTC S;  3MFG A;  5C0X I;  2VQD A;  3CRL C;  4DV1 L;  4O3S A;  3OSO A;  2QCP X;  1FKA H;  3D0F A;  2F0Q A;  2KED A;  3S1R H;  4MNO A;  4Q0F A;  2E8G A;  5C4J B;  1K1S A;  5DM6 3;  4JI7 L;  4N8X 1;  5CB4 F;  1WD0 A;  4RG1 A;  1Z2P X;  3MWM A;  1I3Q H;  4DR5 Q;  4L5S A;  1GUG A;  2W6M A;  2ENB A;  2PZU A;  4JCV E;  1RJQ A;  2W9C B;  1LTT D;  4N8F A;  2A5H A;  2HCI A;  2W7O A;  2ES2 A;  2P5Z X;  2MHV A;  3J80 E;  4LW1 A;  5J1Z A;  1KBL A;  4XQN A;  1XNQ L;  4JI0 L;  4R7R A;  1G2T A;  1XDN A;  1N32 Q;  1DZ1 A;  2RBM A;  4B9X A;  5C5M A;  3GDE A;  1B2T A;  1A62 A;  4UP8 A;  1KAB A;  3K7A H;  4O4L F;  2JEB I;  2R6G A;  1G6P A;  3I4M H;  4YY3 H;  4RUC A;  4KHP H;  5H1S E;  4ZOL F;  3RV4 A;  1QE6 A;  2GPW A;  3HKZ A;  1JXL A;  1S5B D;  1L1O B;  5EBD A;  2I87 A;  2IPK D;  4F7X A;  4XX0 B;  3NGD A;  3NEL A;  2SDF A;  2VQE H;  2F0P A;  1V9P A;  1PYB A;  4J8Q A;  3HOW B;  3EPG A;  2K5N A;  4X66 Q;  3CCQ A;  2NN6 I;  1HNZ L;  2A69 C;  2RCN A;  2CW8 A;  4A3I B;  4PV1 C;  1M8A A;  4QUC A;  4I7A A;  1PH1 A;  2CQO A;  4A3K B;  1Q7Y C;  5J2T F;  5C4X H;  4G57 A;  4L5T A;  2H1E A;  3GTG A;  1C9O A;  4DUZ L;  5JQW A;  5KFZ A;  1Q1B A;  4C5C A;  2B2V A;  2I5M X;  3RLO A;  4BY7 G;  3D31 A;  5E4W C;  4B9W A;  3PCO B;  1U4R A;  3PW5 A;  1PZJ D;  4AH6 A;  3BU2 A;  3S1N H;  2IP4 A;  2E2J B;  1JJ2 A;  2HHH Q;  1B8A A;  2NU7 B;  1RDP D;  1MI2 A;  3GTQ A;  3TDQ A;  4UP7 A;  3C46 A;  4QCL A;  4RGM A;  3T56 B;  2XVS A;  3GTL H;  1Y1W G;  3GTL B;  1BVS A;  1S03 G;  2JEI A;  1EWH A;  4DV0 Q;  1KAW A;  4AYB G;  3EN2 A;  1M90 C;  2FLL A;  3RZD B;  4B08 A;  3KK7 A;  4DV5 H;  4MZ9 A;  3GTQ B;  4XYO A;  4JI3 L;  2N49 A;  1SJH D;  1SRU A;  4IPC A;  1XX8 A;  4BBR G;  3QZ8 A;  1J8I A;  4OX9 L;  3F2U A;  4X3S A;  3GIJ A;  4JBW A;  2OEO A;  2A74 C;  4IWY A;  5DGB A;  2FFK B;  1BCP F;  2A1A A;  2D2C C;  5IGC A;  2M9V A;  4A3K H;  2L15 A;  3E9H A;  2VA3 A;  2EXD A;  3RUP A;  4B3T H;  2AGO A;  1T9H A;  4JI5 Q;  3VYT A;  2EVB A;  5F9N A;  5KND A;  3S16 H;  4R4O A;  3HOZ B;  2NZO A;  2Q8I B;  3KLS X;  3STB D;  1I4X A;  4KHP L;  1AE3 A;  5D1P A;  4BWG B;  4LAA A;  1I4R A;  5IT9 L;  3L3O C;  2PW7 A;  5KG2 A;  1Z2N X;  2AMC B;  3KJO A;  2R87 A;  2XWJ B;  3MXN B;  2GLT A;  2WKC A;  4YCU A;  1WCM A;  3HFZ B;  4JI0 H;  2NVT H;  3TQY A;  3T13 A;  3UDX A;  5LMN H;  2F1M A;  2VUM G;  3LWE A;  4GLA C;  1S10 A;  1EQQ A;  4J9M A;  4DUZ H;  1STB A;  1J9O A;  2YZM A;  5KT5 A;  2XGQ A;  5LL6 S;  4XQQ A;  4CKC A;  1Y1V B;  4LSX A;  2X0S A;  1Y1V G;  4B3R Q;  2LMC B;  5I9O A;  4X65 L;  1ROD A;  4KHV A;  2FLN A;  2G9D A;  4K8I A;  4MN3 A;  1CK1 A;  3KFU A;  2WP8 J;  2G9H D;  5CV8 A;  4B3M H;  4DR2 Q;  3FDS A;  2VQF Q;  1X9N A;  3GTP H;  3VA5 A;  2JA8 G;  4LMY A;  3G6V A;  1CTM A;  3A0J A;  3BG3 A;  3OPO A;  3HKZ E;  3VPD A;  4J1M A;  1B9M A;  2B2T A;  2PQA A;  3PUZ A;  2R61 A;  4UP9 A;  4ZQI A;  2AKW B;  5DNF A;  1S0N A;  5KFO A;  4L5R C;  1YNJ D;  1H9J A;  4PMW A;  5IOC A;  2WAQ B;  2NU8 B;  1KHI A;  5KX5 F;  4TQU S;  3S1M B;  2BR0 A;  3MXU A;  1CFM A;  2K52 A;  2Z6B A;  2UUB L;  5IYD G;  2WV6 D;  3T51 B;  3GTM A;  2DNE A;  5FLX W;  1XNQ H;  1IBM H;  1X3G A;  1HRJ A;  3GV6 A;  2PI2 E;  4AQY Q;  4LF5 Q;  4F4X A;  4A3M B;  4ED0 A;  2XIW A;  2Y0S E;  4GC6 A;  1L2F A;  2E5L L;  1YHA A;  4J15 A;  2FPP B;  3S2H B;  3DWQ A;  4F8M A;  5LL6 b;  2O03 A;  3L7Z C;  3I73 A;  2K7V A;  1J5E H;  4ALP A;  1P16 A;  1VQI A;  4LF6 L;  4YP3 A;  3CC7 A;  1JB3 A;  4HYK A;  1JR0 D;  2ZTE A;  1RJP A;  4RU9 A;  1GUS A;  5IGB A;  1HNX L;  1I5F A;  2HQE A;  4JBJ A;  2RSN A;  3DMU A;  1XPU A;  3OIP A;  3C2P A;  1GHK A;  1I6U A;  4YWK A;  5J2U F;  2I0Q A;  2GVA A;  2YTY A;  4RZQ A;  4ILW A;  2HVR A;  2VUM A;  5DG8 A;  4KY6 A;  2R7L A;  5EQ0 A;  4K0K Q;  4TRD A;  1IW7 C;  4A3D G;  3K0X A;  2HQL A;  4LF4 H;  1CHQ D;  5F2D A;  4YWM A;  3M85 A;  5KFX A;  3G71 A;  3T1Y Q;  1N34 H;  4C3H H;  1I6H H;  2XN9 C;  1WR2 A;  1WTR A;  3RAX A;  4LFB H;  2I5H A;  1BBU A;  2R7D A;  1UE1 A;  2WAQ A;  1BKB A;  1SMY C;  5CV9 A;  1GOZ A;  5AJ3 Q;  4ZCK A;  4UCS A;  2KCC A;  3BVG A;  3PUW A;  2VB2 X;  2HJW A;  2DPJ A;  3GTM B;  4C3J G;  1GUN A;  4BBS G;  4XQJ A;  1CQV A;  1TWC B;  2NTT A;  1LAC A;  3I4L A;  1C0A A;  2YRW A;  5IWA Q;  4WJ4 A;  4DL7 A;  4BA1 I;  3RJ0 A;  1D5X C;  4HJA A;  1E24 A;  3FKI B;  1DXM A;  1XTC D;  3S1Q B;  1KTK A;  4IUN A;  3NQT A;  1V43 A;  4BY7 H;  2JA6 G;  2YZG A;  1HNX H;  4HIK A;  3KLW A;  3CCM A;  1GVP A;  3W2D A;  3KF6 A;  4YBZ B;  3H94 A;  3QZ7 A;  1BNC A;  2L0C A;  3BJU A;  4GKK H;  2KCT A;  3BYY B;  1MJE A;  2M00 A;  4WOR A;  5J22 A;  1I4P A;  3S17 B;  1B6R A;  2DWC A;  1A6X A;  4HIO A;  1FNW A;  4X64 H;  5LMU L;  4DA2 A;  3M9M B;  4F4Z A;  1Y8N B;  5I2Y A;  5KNC A;  2X69 A;  3PUY A;  5EGT A;  3C3L A;  2C2D A;  4ME6 A;  1SYF A;  4TQR A;  3H0G H;  2RDH A;  1K8O A;  5JOB A;  4ZUJ A;  1PH4 A;  4EGJ A;  4R4I A;  3PZP A;  1JJC B;  3CQZ H;  4A3B B;  1TWF A;  4GLV B;  1SNC A;  5DM7 3;  3S14 B;  1KJJ A;  1DOK A;  4BBR B;  2W6Q A;  3GIP A;  1I50 A;  3S2D H;  3K8A A;  3ICE A;  3HKS A;  1K0S A;  3KF6 B;  2EYJ A;  4LFA H;  4KD3 A;  1MZB A;  2GA4 B;  4LF6 H;  1XTD A;  4JI8 L;  2IHE A;  2V4R A;  1L0Y B;  4C3I G;  4IAL A;  4ZLT F;  5K2M A;  4ZHQ F;  1WTQ A;  4Q44 A;  1QVC A;  3Q23 A;  5CA0 F;  5DQH A;  2EJM A;  2NZH A;  4KY5 A;  2BQ3 A;  4RCN A;  3GTL A;  1WTX A;  2QKI C;  1F2Z A;  1SEB D;  5DLQ E;  1QIL A;  2EJG C;  2JEJ A;  1B1Z A;  4IUP A;  2B2U C;  3R3O A;  5C44 G;  1Q46 A;  2CCZ A;  1ULZ A;  1Q8K A;  2JA6 H;  3I4N G;  4ZKC B;  4DNT B;  3BQ0 A;  1IXR A;  2JSO A;  3A5Z B;  5EPK A;  4YR0 A;  5C0X J;  2IBK A;  2ID0 A;  4JI2 Q;  4FBT A;  5KFI A;  5CAE B;  1O7Z A;  2LXK A;  1GJX A;  1CSQ A;  2VQE Q;  3N8D A;  3EPI A;  3I91 A;  5ELN A;  2IX3 A;  1AFP A;  4RGO S;  3T5J A;  4DL6 A;  2HDM A;  5M3F B;  3NE5 B;  3VPC A;  4ECX A;  5KFR A;  5FD5 A;  2HHH H;  3ETJ A;  4FBU A;  3KHL A;  3V6K A;  4EQN A;  3I12 A;  3CCV A;  2W57 A;  2A6H D;  3OTO Q;  1SJE D;  1C48 A;  4PNY A;  4OX9 H;  4HMI A;  1D5M C;  2NVX A;  2AGQ A;  2E2H A;  1U0L A;  1CI3 M;  3J80 c;  3PSI A;  5BR8 L;  1EUC B;  1HFG A;  4X66 H;  4O1N A;  4DR2 L;  2QEX A;  1JOQ A;  3MXG A;  4UCU A;  3CC2 A;  4I4T F;  3CC4 A;  1AUV A;  3LX0 A;  1H95 A;  3PR5 B;  1N36 Q;  4YHH Q;  3QOL A;  1WTW A;  3V6J A;  1VQK A;  1Z47 A;  2A8V A;  5M3M H;  1GYF A;  2F0I A;  4JVZ A;  2FK1 A;  4X62 H;  3RGZ A;  5JVG 3;  2F4I A;  2JYO A;  2BH8 A;  4B3T Q;  3E5N A;  4LWC A;  4LK1 C;  5ELE A;  1GUW A;  1WSC A;  4OO1 G;  4NPS A;  5M5Y H;  1DOL A;  2GPS A;  2J6T A;  1I3Q A;  1B3A A;  1ET9 A;  5CV4 A;  5I6Y A;  4K6L A;  2F0O A;  4FXD A;  1KQS A;  3KXY T;  1CQF A;  2VOB A;  4P2C B;  2RDF A;  1EQR A;  3S15 H;  2LFN A;  3H0G B;  3GO5 A;  4PZ6 A;  4KN7 C;  1HCZ A;  5KFP A;  4YJ2 F;  1MIU A;  3GTK H;  3PIP 3;  5BN3 A;  1VQ8 A;  3S17 H;  2PNH A;  1SLJ A;  1HNZ H;  2EY6 A;  2JA9 A;  3QJY A;  5KIX A;  1M0W A;  4YJ3 F;  4J9O A;  4JI3 H;  1VQH A;  1VQD A;  2H4O A;  2FJ2 A;  1M0T A;  4QMG A;  1YHQ A;  2DPI A;  4A3G H;  2JQO A;  4F4W A;  3M4P A;  1HXY D;  1HZC A;  2EJF C;  1TWA A;  4B3R H;  3GV3 A;  5BR8 Q;  4G3I A;  3HOW G;  3R5H A;  4IJL A;  1BCP B;  2HUG A;  1BF4 A;  1IHZ A;  4A3E B;  3K80 C;  2YU9 H;  3N6X A;  4GOP B;  4DV2 H;  1WI5 A;  2D9U A;  2VY3 A;  1ONL A;  1K3B C;  3CAM A;  1F9R A;  3ITP A;  3WOE A;  1GSO A;  2B39 A;  3FPU B;  1X6O A;  5FLX E;  4DXF A;  5FJ8 G;  2Z4I A;  1EYG A;  4LF4 L;  5KT7 A;  4FS2 A;  5C5L A;  5C8Y F;  2ICE C;  5GON F;  1DCZ A;  4DL3 A;  5I6W A;  5JVD F;  5KKN B;  1F2Y A;  2JXM B;  3CW2 C;  1RCV D;  1Y1W A;  2BQU A;  1NAP A;  1TWC H;  2L55 A;  3BQ1 A;  2FJZ A;  1CHP D;  4QWC A;  5KG4 A;  1B44 D;  4C2M H;  1X3P A;  5C44 H;  2NUA B;  3CCJ A;  1TVX A;  2AUK A;  5AFW A;  1PRT F;  2D5D A;  4A3F G;  4LSA A;  1SNQ A;  3URY A;  5FD6 A;  1YNJ C;  1XWE A;  1DM0 B;  3TP6 A;  4POG A;  1FGU A;  3G6X A;  3WWV A;  1PRT B;  5C3E H;  1OWT A;  1PA6 A;  5BPF A;  2YU9 B;  1HNX Q;  1S5D D;  3H3V C;  4IUV A;  3QR8 A;  1JOR A;  1CA6 A;  2QYZ A;  2RGV A;  5JH7 F;  4C3I H;  5C1P A;  2IY5 B;  1BQQ T;  3SK4 A;  5KFL A;  2G5D A;  3J7A K;  1AEX A;  3GTK B;  1JMC A;  5KFY A;  1S97 A;  4YR3 A;  4ED7 A;  1Q12 A;  4QWA A;  3W1G A;  1R4Q B;  1TS3 A;  2F0J A;  2RVL A;  3NTK A;  5GQO A;  3EFX D;  2QK4 A;  3ULP A;  1TWA H;  2I46 A;  3BG5 A;  2W9B B;  1W2B A;  3CCE A;  3I8Z A;  3ORQ A;  5M5X B;  4CGY B;  1E2Z A;  4QGU A;  1SE2 A;  4RGN A;  5DG9 A;  2D0O A;  1NBW A;  1H9S B;  2F0L A;  3A7L A;  1I4G A;  1FNV A;  1K8G A;  2W8L A;  4RKB A;  3BA8 A;  1QUQ B;  1K0R A;  5FOB B;  1E1T A;  3GIL A;  1X3F A;  3RZO B;  3S1R B;  4KK7 A;  5D14 A;  1BCP D;  1ASY A;  4MV3 A;  2PZT A;  2Q2H A;  5ELD A;  1HA5 A;  1ENF A;  5IYZ F;  3VR5 A;  3H09 A;  4B3M L;  4DR3 Q;  3HOU G;  2EY5 A;  2R92 G;  3HOU B;  1Y1W B;  4DR6 Q;  4G7O C;  1HNW H;  2VUM B;  3VR6 A;  2EYO A;  3KF8 B;  3PUX A;  1J5E Q;  3MEH A;  5IOD A;  2O5J C;  2YTX A;  4ZRZ A;  2MNA A;  3MR2 A;  3HOV G;  3K5N A;  3MXN A;  4ID6 A;  3NTH A;  4KTA A;  4CKB A;  3A5U A;  4HNU A;  3V05 A;  3M7G A;  2ATW A;  3H20 A;  4LFC L;  4PZ7 A;  1SR3 A;  5KYL A;  2NN6 H;  1VQA A;  3G6E A;  3JC6 6;  3PO2 G;  3F2C A;  5M3F G;  5EWE A;  4EEY A;  3P20 A;  2ATL A;  4EQP A;  1II3 A;  2FHT A;  3JZI A;  4RUA A;  4DK0 A;  2RQX A;  2AQ4 A;  4P73 A;  1SYD A;  1G51 A;  1VQB A;  4KY7 A;  4XYQ A;  4O2B F;  2AU0 A;  4FP5 D;  5L1L A;  1NCV A;  4O4H F;  2F0E A;  5JVL A;  2JJQ A;  4YIJ A;  4DR7 L;  2R7N A;  2AQ1 B;  4HJ5 A;  1K8A C;  1EIF A;  1B04 A;  1MSH A;  3G4S A;  2IA6 A;  4QIW B;  2BE5 C;  1RL2 A;  4P72 A;  1PH3 A;  1ZQ7 A;  3J80 L;  4APV A;  3J7Y W;  1C30 A;  4O42 A;  5CGK A;  4EEQ A;  3MR5 A;  2BOS A;  3AFQ A;  3TEH B;  2XSC A;  1SAP A;  3J80 i;  1I4H A;  4WFN 3;  2UXB H;  4DV5 L;  4KI0 A;  2A68 C;  1KIX A;  4JC0 A;  3T1Y L;  2OT2 A;  4IUR A;  4GKK Q;  1FD7 D;  3AU7 A;  4C2M A;  2JA6 A;  4R8U B;  5K36 H;  4NMZ A;  2E5L Q;  1TXY A;  3DHQ A;  3NBI A;  5C0X H;  3DXJ C;  2BA0 A;  4UDU C;  4KJN A;  1XJV A;  1Z9F A;  3AMU A;  3PW7 A;  2VA2 A;  5IT9 E;  4O3O A;  2IX1 A;  4J9K A;  1XMQ H;  2OF1 A;  5FKA C;  2K6A A;  4MTK A;  4TVA B;  1CKN A;  3DM3 A;  3VR2 A;  1DGS A;  1WFQ A;  3FHW A;  1W6J A;  3H0G G;  1RJR A;  2KBN A;  1B3Q A;  5GRO A;  1IYU A;  5IGD A;  1HR0 W;  3M4O H;  2XCL A;  3T1H L;  1LV9 A;  1WTV A;  3BYT B;  4NW2 A;  3HXL A;  4LFA Q;  3OHB A;  3KHH A;  3RB4 A;  4DKA C;  5KFA A;  4R4Q A;  2E2J H;  3GIM A;  1HZB A;  5KGU A;  4MV7 A;  1WTO A;  3J81 j;  3DF7 A;  5C6A A;  3HOX H;  1CKO A;  2EE1 A;  4LUO A;  1K28 A;  3D6W A;  4H0L C;  2OQ0 A;  4J9S A;  2HVS A;  5C3E B;  4K14 A;  4PMC A;  4DV7 L;  4ED1 A;  1W3S A;  2W6Z A;  2ASJ A;  4ETS A;  3BA9 A;  1G91 A;  4P74 A;  1V1O A;  5ELF A;  1G8Z D;  3KOJ A;  4V19 0;  3A8I E;  1D2B A;  3PGZ A;  4IQZ A;  4DV2 Q;  3ORR A;  3T5K A;  5KNB A;  3NP8 A;  5KFJ A;  2OQK A;  3M4Y A;  2N55 A;  2R93 B;  1M1K C;  2F0H A;  2Z4H A;  3HZX A;  4G7Z C;  1A15 A;  3RAQ A;  4JV5 L;  2KEC A;  2CKZ B;  3RN5 A;  2YZN A;  1IBK Q;  3L0O A;  3I4N H;  2UUB Q;  5FLX L;  4LUV A;  1TU2 B;  1I94 L;  2ZDQ A;  3KBX A;  2B2U A;  2R84 A;  4RMF A;  4C56 C;  5L1I A;  4OO1 H;  1NMG A;  4ED3 A;  2DNC A;  4UCT A;  1PZI D;  1X3Q A;  3H15 A;  3SVM A;  4JI2 H;  2CH4 W;  3NTI A;  4FS1 A;  2WE6 A;  3R23 A;  2NVX B;  1MSG A;  1H9M A;  1ZHQ A;  3RB3 A;  1EU3 A;  5T1I A;  4UAI A;  2DY7 A;  5FO9 B;  5FLM G;  4ME3 A;  2C2E A;  1KDC A;  1XMO Q;  3K58 A;  1PRT D;  4YCV A;  4BXX G;  1TR5 A;  4B3S H;  4IN3 A;  3OTO H;  4I55 F;  4WBN F;  1A3V A;  2R92 B;  3BZC A;  2Y0S A;  3GV7 B;  4F50 A;  5LMN W;  1GKH A;  1O7I A;  4F4Y A;  2A68 D;  1KD1 C;  3RV3 A;  3RF2 A;  1B33 N;  1QJO A;  2PO4 A;  5LMU Q;  2LS0 1;  2A6E D;  1JKJ B;  4KKS A;  4QF4 A;  3TRE A;  1KC8 C;  3OUZ A;  1VQ5 A;  1W6K A;  3EQL C;  2JA5 G;  3WDN A;  2NVQ B;  4KKU A;  1N33 Q;  2KJX A;  3HRZ C;  2UU9 H;  1S0O A;  4XDX A;  4LF8 L;  4IZO A;  3RTX A;  1EFI D;  1STH A;  1HNZ Q;  3M3Y B;  1TWC A;  4ECS A;  3DM1 A;  1Y1W H;  3DLL A;  4YCW A;  3BZD B;  5ISR A;  3RFC A;  3JAM c;  4Q45 A;  2CH4 A;  4A3L G;  4WJ3 M;  2NYZ D;  2XGP A;  2DZD A;  4GNX B;  5DQG A;  5DGA A;  2FIN B;  4HJ7 A;  2Z9H A;  2B8F A;  3GTP B;  1UC8 A;  1YNN C;  1XXG A;  1VBH A;  1PK8 A;  1Y8P B;  1EYC A;  3CQZ A;  1ML0 D;  3G8C A;  5CV7 A;  4GLX A;  5ELB A;  4EYI B;  2B8G A;  5C5J A;  3CU7 A;  2LSS A;  2WAQ E;  1A2T A;  2RGR A;  4JI3 Q;  5LXT F;  1D8L A;  3P1H A;  1VQG A;  3JSN A;  3A54 A;  1Q1E A;  4JUZ A;  1WJJ A;  4Q5V A;  4MTD A;  3I70 A;  4OIJ A;  3T5L A;  2CW0 C;  4LFB L;  4HR7 B;  1UNS A;  2NZ1 D;  3IFD A;  3X3N A;  1I94 Q;  3IAY A;  3LP8 A;  1NR2 A;  4DV6 H;  5ELO A;  1AW7 A;  2ZT9 C;  1XYI A;  4DUZ Q;  4IAJ A;  2XRS D;  3KLS A;  1GUO A;  3EIV A;  4X3K A;  3TSS A;  3HG9 A;  1L1O A;  2K5V A;  2BDO A;  5IGG A;  3TRZ A;  4TSS A;  1UUP A;  4QY7 A;  2DGY A;  3UE1 A;  1QB5 D;  2JA7 G;  2VQF H;  1OXS C;  2SNS A;  1PTO D;  2FMC A;  3RB6 A;  4PMB A;  1VS0 A;  2MQH A;  1RJT A;  5L37 A;  1J5E L;  4JBM A;  3WNZ A;  4IO9 A;  2JA7 H;  5KG5 A;  1SYE A;  3SEB A;  3K5O A;  3VR4 A;  3MWE A;  3U9T A;  3I72 A;  2V5A A;  1VQM A;  2E5L H;  2JA5 A;  2PCF B;  2UVR A;  1KLU D;  3S14 H;  1PTO B;  2PBZ A;  2RDI A;  2BCO A;  5GAH C;  1BUV T;  4P71 A;  3MTS A;  1IBK L;  5IYC G;  1CKM A;  4A3B H;  4TV9 F;  3HKZ G;  3CCU A;  3K5M A;  3QWN A;  5BPH A;  3AEV A;  2E2D C;  1GSA A;  4RNO A;  4DR6 H;  3RIZ A;  3TS0 A;  2W6P A;  3VYU A;  2NVX H;  1UNN C;  4KJO A;  1XNR H;  4BS9 A;  1TT2 A;  2R7Z B;  1PRT C;  2YV5 A;  2B2V C;  4R1J A;  4LF7 H;  2FE3 A;  3K81 C;  2OWO A;  5EKI A;  1E2V A;  4IRD A;  1RD9 D;  2ZJR A;  2EXZ A;  3MR6 A;  3Q8S B;  4QWB A;  3GID A;  1MD2 D;  3QOJ A;  2WYO A;  2V4D A;  1PHJ A;  4AYB A;  2F3W A;  1JWU D;  2UUC L;  1TWG A;  2ZM6 Q;  3BDC A;  5JJK A;  2QGQ A;  5C3X A;  2LXJ A;  1V4Y A;  3KHG A;  5COY A;  4WD3 A;  4ME5 A;  3S9W A;  4HAE A;  3NK9 A;  2L11 A;  1GXD C;  4BBS B;  1CQJ B;  4YWL A;  2XD4 A;  1HJP A;  4RB2 C;  2F4V L;  3T1H Q;  2F0D A;  3Q8R B;  4DR3 H;  2W6N A;  4DR5 H;  2EYF A;  4QJF A;  2EDG A;  2NBF A;  2H5X A;  4RWS C;  1YHB A;  4KHZ A;  2WFW A;  1TS2 A;  4MA0 A;  2UUA H;  4DAY A;  1YVC A;  2VB3 X;  4U6P A;  4HNT A;  2FMM A;  3NWS A;  5A35 A;  4HCE A;  1PH2 A;  1VQ9 A;  1EEF D;  2K03 A;  3GTM H;  4TUY F;  2E2I B;  2SOB A;  1TY2 A;  3N6R A;  3GTG H;  2YCH A;  4L6T B;  3OW2 A;  3R8B A;  2UVW A;  3R2T A;  2R93 G;  4A3C G;  4DR4 Q;  1W93 A;  1YBY A;  4JBK A;  1TWG H;  3M9N B;  3MEF A;  5IIF A;  2FK2 A;  2ZJT A;  4CJ1 B;  1Y14 B;  1ILQ A;  4K5V A;  4I7Z C;  4C3H G;  2ALY B;  4Y7N H;  5KT2 A;  1I7N A;  1SFO B;  4B3T L;  4QUF A;  1VDZ A;  3U50 C;  1TAE A;  2NU6 B;  4DR7 Q;  5DG7 A;  3H0G A;  3MHB A;  1VF5 C;  3QB3 A;  2YTV A;  1SBB B;  2OCE A;  1V1P A;  2R7F A;  2F0V A;  1GD7 A;  3HS0 C;  4KN4 C;  4JI1 L;  2JA5 B;  1T5E A;  1KXL A;  2ASL A;  2PW5 A;  4RAU C;  3S24 A;  4B3S Q;  3TZD A;  2ZDH A;  1SYC A;  1KLG D;  4KV6 A;  4LMQ D;  3STB C;  4A3J B;  1D1I A;  2FMA A;  2ASD A;  1ENC A;  4FDB A;  3BVZ A;  3MFY A;  4CDE C;  1JQY D;  5JEA G;  2JA7 A;  3EBE A;  3R2I A;  1M4V A;  1ZEQ X;  4FF1 A;  4K5W A;  1XMQ Q;  1CA5 A;  4AIM A;  3SE7 A;  4IUT A;  1LTB D;  2KHS A;  3CD6 A;  3HOV B;  1S4Z A;  3DEO A;  4YAJ B;  1S5E D;  5DLF A;  2F0T A;  4C3J H;  4DF7 A;  4H7B A;  4RNN A;  1FGB D;  1L0W A;  4IPD A;  3G6J B;  2I8C A;  3HKZ B;  2M2L A;  1VF7 A;  4NXN H;  4KD4 A;  4EBD A;  5M3F H;  3AYH B;  2ZTC A;  2F4V Q;  3MWY W;  2MCT A;  3C1E A;  3CME A;  1VQ6 A;  4WJW A;  4U67 3;  4HJ9 A;  4O4I F;  1QG7 A;  3FPP A;  4R4C A;  2WB1 G;  3UDF A;  4LF6 Q;  1BDO A;  4IRC A;  1C4Q A;  5M5X H;  1IYV A;  5JJZ A;  2W9B A;  2R3Z A;  3NEM A;  3CQZ B;  1LT5 D;  1QVF A;  3TP8 A;  4Q43 A;  3GTJ A;  1H9S A;  5LA6 F;  1AE2 A;  2TSS A;  4IRK A;  2HDL A;  4GN5 A;  4OON A;  1PTO F;  3R5X A;  3MFI A;  4NLG A;  3UI2 A;  4JI4 Q;  2VUM H;  2N3S A;  3CCR A;  4BY1 G;  3HOZ G;  4Q8E A;  2EOT A;  4CDC C;  2E2I H;  3DUZ A;  3A8K E;  3JRX A;  2WII B;  3L4K A;  2NTS A;  4OHJ A;  1HZ9 A;  1B6S A;  3Q22 A;  2B63 G;  2HT1 A;  4BY1 H;  5T14 A;  3Q8Q B;  2AQ2 B;  3T5H A;  1LTA D;  1CSP A;  4X65 Q;  3PR4 A;  3J81 L;  2R93 H;  1TA8 A;  2JA8 B;  5C44 B;  2W9A A;  1ESF A;  2KHJ A;  4DUY L;  1I7L A;  3NEN A;  1TWH H;  2K1B A;  5CYU A;  4DR1 L;  4QWD A;  4P75 A;  4EQO A;  1CUK A;  3VDY A;  2QIL A;  4ECU A;  4DL2 A;  4PZ8 A;  5IP7 H;  3TIG A;  2KEN A;  4A3D B;  1R9T A;  5DLG A;  5KFD A;  1HTL D;  1UWV A;  4IZ8 A;  4RFB A;  1K83 A;  1K1Q A;  3SR1 A;  4MA5 A;  5FPR A;  1LT4 D;  2CHB D;  4UHV A;  1N33 H;  4CHT B;  4DV0 H;  3GTO B;  1S5C D;  1KJI A;  1LTI D;  2XCP A;  2RF4 A;  2WIN B;  1LT3 D;  3KDF B;  1EYZ A;  3EVQ A;  2CW7 A;  2FB9 A;  5KFK A;  4HR7 A;  3RNU A;  1UE7 A;  4LF8 Q;  5IP9 H;  1PH8 A;  2Y0S G;  1QCB D;  1CT1 D;  1NE3 A;  1B53 A;  1SMY D;  3L4J A;  3GTP A;  4RHR A;  3CVZ A;  2HIV A;  4JOI A;  4Y52 H;  4KLK A;  2AWO A;  2JK8 A;  4C2M B;  4IFD J;  3W1B A;  2PYK A;  4HSV A;  3X3M A;  4DU9 A;  1EZ1 A;  1FNU A;  4N9P A;  4ED8 A;  4O3P A;  4A76 A;  1D1K A;  2ZM6 H;  3J81 E;  1S5F D;  3FKI H;  4C1N I;  3HOY B;  5M5Y B;  1K3R A;  4RNM A;  4HN7 A;  3IN5 A;  5M9O A;  5K5P A;  5M5W H;  1JE5 A;  4A3I H;  4LUZ A;  3UDI A;  2HGS A;  2W7P A;  3U4Z A;  5F9L A;  3JSL A;  4ECT A;  3M9B A;  3RN2 A;  5IWA H;  4JW0 A;  1DV2 A;  1C8C A;  4LFC Q;  1N36 L;  1PLF A;  2ICI A;  4B3S L;  3RGX A;  1B7Y B;  3Q8P B;  4DV0 L;  1ASZ A;  1VMP A;  5E3F A;  4K0K H;  4A3M H;  1E4E B;  1FJG H;  3VA7 A;  3D4W A;  4DR4 L;  1JX4 A;  3SK6 A;  5C1O A;  4DV6 Q;  2OTL A;  3KDF A;  5J39 A;  4ULL A;  3S1M H;  2O5I C;  1VMC A;  2QDL A;  2Z6K A;  4LF9 Q;  2W71 A;  3RB0 A;  1HR0 L;  1BR9 A;  3P75 A;  2NVY A;  1AN7 A;  4JV5 Q;  2AGP A;  3J81 i;  4GNX C;  4A3E G;  1DD2 A;  5IYD H;  3BAA A;  4ZKB B;  2FPG B;  1I94 H;  4O3R A;  3Q8D A;  4IFD I;  2IWH A;  3GD7 A;  4IUQ A;  3OMG A;  3RLF A;  5FK9 C;  3VMM A;  2K04 A;  3UQ8 A;  4V0B A;  2XGT A;  3K0Y A;  1E4F T;  1U4M A;  5LOV F;  2J6S A;  1QVG A;  5KT4 A;  1LLR D;  4S3S A;  3FVQ A;  4Y8V B;  4O3N A;  1FR3 A;  3CRK C;  4JYA L;  4NXM H;  4A3J G;  3V96 A;  3QO2 A;  1STG A;  4JG2 A;  3I55 A;  2VXW A;  2NVT B;  4DV7 H;  2RDJ A;  5TSS A;  4M8A A;  1EEI D;  4DGZ A;  4DK1 A;  3NBH B;  4A93 H;  2Z1C A;  3M4Q A;  4FU0 A;  2R6F A;  4JI7 Q;  1PH7 A;  2ZJP A;  4QIW A;  4X64 Q;  3T4A C;  4CC5 A;  3T1H H;  2MP1 A;  4DK6 C;  1S9F A;  3SXH A;  4NXN L;  4EFE A;  2OXP A;  4Z9C B;  3IRB A;  4DLK A;  1TWF B;  2K50 A;  4JPB W;  3BZK A;  1U5K A;  2PPB C;  4MIU A;  1OO9 B;  1C7Y A;  4A3G G;  2L4N A;  4DAY B;  3JAM E;  5KFT A;  2KOL A;  2Y0S B;  3W5O A;  3F8N A;  1UEA B;  4IOA A;  4DR4 H;  2GVB A;  1TS5 A;  3ND8 A;  1JIH A;  2A6H C;  1SSO A;  1S3O A;  2B29 A;  1D6E C;  1PX2 A;  1A9X A;  3FKI G;  3PIO 3;  5EWG A;  3E9I A;  4Y7N B;  5DEH A;  1Q86 C;  4XT3 B;  1RK5 A;  1Z2O X;  2A6E C;  1VQF A;  4I7H A;  1XPO A;  1TWG B;  3CPF A;  4ECY A;  4JI4 H;  5EAY A;  1GGO A;  1V8Q A;  1WYD A;  1E4E A;  4FYD A;  4IFD G;  3OW7 A;  4KHP Q;  4MAM A;  1PYS B;  5J3B A;  5IP9 G;  3N41 B;  1JOK A;  2E2H H;  2XRQ D;  5KFF A;  2F0F A;  2EYL A;  3KAJ A;  2A73 B;  4GNX A;  5GAD C;  1AZQ A;  4YHH H;  1QWY A;  4EVO A;  1SRO A;  4R8N A;  4X3U A;  3K6O A;  4N9T A;  4X62 Q;  2EYP A;  3I3C A;  1YJ9 A;  2BH2 A;  3V4Z A;  2QF7 A;  1HUN A;  2WAC A;  2KUM A;  1KJ9 A;  2UXD H;  1E2W A;  5AJ3 L;  5GAG C;  2E75 C;  4RH6 A;  1EYA A;  1VQO A;  5C4X G;  1MBY A;  3IG0 A;  3PW4 A;  2BE5 D;  1SE4 A;  4MTN A;  3RMH A;  2R8J A;  2UXC L;  3OUU A;  3M4O B;  3DEP A;  2CW0 D;  4A3L H;  4DV3 L;  1SEI A;  3WOF A;  4EBE A;  2R7K A;  1EYD A;  2L12 A;  4RB3 C;  5JJL A;  4DV3 Q;  1EY8 A;  1AH9 A;  1MJC A;  2AUJ D;  1PH6 A;  4DNR B;  4DR3 L;  3GTO H;  2F4V H;  3D6C A;  3LGJ A;  1UEB A;  4BY7 B;  4H44 C;  1JOO A;  3KAL A;  4DPG A;  4J9Q A;  5KRU A;  3GQC A;  4DN4 M;  4MV8 A;  1U4P A;  2EIF A;  2DLN A;  4C5A A;  2Z8L A;  2N88 A;  5KG7 A;  2C5C A;  3W3A A;  1ZXT A;  3KTM A;  4HTH A;  3AB9 A;  2E2H B;  1YJN A;  2VNU D;  3KHR A;  5EZY F;  5JPN C;  1YIT A;  1EU4 A;  3KJP A;  2JA7 B;  2NVY H;  4FF3 A;  5KFC A;  1PYW D;  1ZKO A;  2XIG A;  4A75 A;  1OXX K;  2K01 A;  1X65 A;  1EUJ A;  3BS1 A;  4TV8 F;  4GKJ L;  4DR6 L;  4C3H B;  3VYS A;  1I6H B;  2Z6K C;  3NHH A;  2PMZ B;  4R8U A;  4R9W A;  3TIN A;  3QIA A;  3TZU A;  2ASB A;  2N78 A;  1EY4 A;  1V51 A;  1A8V A;  3K5L A;  4A3K G;  3CPW A;  4L63 B;  5LHY 1;  5FLX c;  3CMA A;  1FJG Q;  1KRT A;  1LT6 D;  1SDF A;  2BDN A;  2N8N A;  4JI0 Q;  4GKJ H;  1F9S A;  2DIK A;  3IFT A;  4TKO B;  1X55 A;  2Q8T A;  2FXQ A;  5E7N A;  5LMN Q;  2F0W A;  3GTK A;  1EOT A;  1S40 A;  4LF9 H;  2EYH A;  2VQF L;  4Q8F A;  1N32 L;  3H4D A;  2EZV A;  3JAM W;  3OSP A;  4OWT B;  2DJG C;  4UPA A;  2VW9 A;  3KAK A;  2FPI B;  3S2H H;  3BAB A;  4EFB A;  1YNX A;  1QNU A;  3G48 A;  5COR A;  3NQI A;  5A2Q E;  4LF9 L;  4JI6 L;  4UFZ A;  1EY6 A;  2SNM A;  2K75 A;  4QWE A;  4R8I A;  1QZG A;  4J9L A;  5KFQ A;  1D5Z C;  2HD3 A;  2D62 A;  4A93 B;  1O75 A;  2B2T C;  1BBX C;  3PF5 A;  3TQT A;  1KDA A;  4CBV A;  2R92 A;  3NWT A;  4IUU A;  1UC9 A;  3HOU H;  1LO5 D;  3TP7 A;  1HH2 P;  1BNZ A;  1GHJ A;  3PO2 B;  1PH5 A;  3V4S A;  3HOV H;  1O80 A;  4DV5 Q;  3F1Z A;  2CWP A;  1KL9 A;  2NVQ H;  5A2Q L;  2L9H A;  1EIY B;  5LYJ F;  1VQ4 A;  2WDT A;  2J7Z A;  3J80 W;  4GC7 A;  3K3P A;  3OHA A;  1S72 A;  4XT1 B;  1CQI B;  2UXC H;  4E4T A;  1K83 H;  2JN4 A;  4AYB B;  3HOZ H;  3S16 B;  4PG3 A;  2D0P A;  4AQY H;  4LF5 H;  2K4K A;  3K59 A;  5EOY A;  3H91 A;  3E3X A;  4MV6 A;  2XTI A;  5KG1 A;  4J0M A;  3G6Y A;  1XPR A;  1IBL H;  1QUQ A;  4J6H A;  3U4V A;  1QZH A;  3I4M G;  4LF8 H;  4NKL A;  3FP9 A;  3CCL A;  5ELC A;  1V1P B;  4RB0 A;  4IPG A;  4RCO A;  2R93 A;  3J7Z C;  4FNF A;  4C3I B;  1QNK A;  1R4P B;  4HCS A;  4XYL B;  3U9S A;  5JAV A;  3BDL A;  4ED2 A;  3FRP B;  4X62 L;  5C3W A;  1EZ6 A;  1S68 A;  4MHE A;  3A55 A;  2J6U A;  2EY2 A;  2MFI A;  1F2L A;  3S1N B;  4RA8 A;  2UUA L;  4POF A;  3V2T A;  4YAK B;  2OLS A;  1AP0 A;  4EGQ A;  3I4N B;  4ECZ A;  2BQR A;  4JI1 H;  3I2Z A;  3CKI B;  3B6Y A;  1SN8 A;  3L9A X;  2YU9 A;  1JC7 A;  2RKS A;  3D4R A;  4BA2 I;  3R93 A;  4K6D A;  4A3F H;  4LNQ A;  2DUD A;  5C4X B;  3JAM i;  1ESR A;  1ILP A;  5G3L D;  2UXD L;  2E74 C;  3GII A;  5DQI A;  1KRS A;  3VPB A;  2MUY A;  4HSP A;  2UUC H;  2DN8 A;  4BBS H;  1B50 A;  4ABN A;  1SND A;  4EQ5 A;  3GIQ A;  1IBL L;  3DWA A;  3HEJ A;  3QG1 A;  3HOW H;  3TS2 A;  1MHW C;  2F0G A;  1M6V A;  5IY0 A;  1QOH A;  2EY1 A;  4IHJ F;  1EY5 A;  1N8R C;  4A3G B;  5HGQ A;  1LTL A;  1E7Z A;  2NN6 G;  1XNQ Q;  3FMC A;  2B2Y C;  4AQY L;  4LF5 L;  2V4Q A;  3PUV A;  4JV5 H;  3OMC A;  1YEZ A;  4A2B A;  1B70 B;  3ULJ A;  3MA2 B;  3R5F A;  4JI4 L;  2C00 A;  4M9U A;  4BXX H;  4EBC A;  3K7A B;  1NMF A;  4PDB A;  4O2D A;  2B63 A;  2HIX A;  3HBL A;  2R7Z H;  4UCR A;  4YB8 B;  3I90 A;  4NXM Q;  1BOS A;  3GV5 B;  4DR5 L;  2Z0S A;  5KT6 A;  2R8K A;  5JJI A;  3S15 B;  1H9R A;  4NXM L;  3SK5 A;  2YW2 A;  4ED6 A;  5D3I B;  2CWA A;  2AQ3 B;  2VPS A;  1SCU B;  2J4X A;  1EL0 A;  3FKI A;  1OXU A;  1KDB A;  3EA6 A;  2DY8 A;  2XWB B;  2Q2T A;  1YZ6 A;  3Q1K A;  3H4B A;  1X54 A;  3H6M A;  1N56 A;  2HVQ A;  4HQ6 A;  1IKM A;  1DJR D;  1KAA A;  3G7L A;  4KMU C;  2ZXO A;  5C4J H;  2KA7 A;  1K8M A;  2W9C A;  3K3V A;  1WTH A;  2ALZ A;  4OIK A;  5L1K A;  3SDZ A;  5KFS A;  2YS6 A;  3IKJ A;  2LKV A;  3NUC A;  3O13 A;  1YI2 A;  1MGS A;  1RYR A;  1YJW A;  5C3E G;  5I4D A;  2R7Z G;  2C35 B;  1Y69 U;  1XMQ L;  1JJG A;  2KCN A;  3OSN A;  1IBK H;  1CKN B;  1U9R A;  5HY6 A;  3RLN A;  1FJG L;  4DXG A;  1CZG A;  2VPQ A;  1PVO A;  1VQP A;  2C9O A;  4JYA H;  4OO1 I;  1BXT A;  5G3L F;  1R9T H;  4DV1 Q;  2F0S A;  4FF4 A;  3N44 B;  1IW7 D;  4GKK L;  5D3D A;  5FJ8 H;  5EPL A;  4QW8 A;  2F0M A;  4A93 G;  2LY7 A;  1TKW B;  4LF4 Q;  3N43 B;  4NP5 A;  1STE A;  4U68 A;  1TQO A;  4GKJ Q;  2UXD Q;  3E0J A;  5EDW A;  3D8G A;  3T1Y H;  1EQT A;  3H40 A;  1E0B A;  2UXB L;  1D7Q A;  4XYM B;  2R86 A;  4LFB Q;  2I5L X;  2IT1 A;  2UU9 L;  3WO1 A;  4RAZ A;  1E22 A;  3UDG A;  3ERS X;  1I50 H;  1LTS D;  3SE0 A;  1ZYR C;  4X3T A;  2V1C C;  4ZI7 F;  2F0U A;  4F87 A;  4PQX A;  4APM A;  4DR7 H;  2I07 B;  5FLM H;  4AYB E;  4E6I A;  4GZY C;  2P0A A;  2EPB A;  2K28 A;  3GTJ H;  1H9K A;  3S2D B;  4ECW A;  2JEG A;  1PZK D;  3JRW A;  2J0T D;  1XMO L;  2PNR C;  5D1O B;  1N34 L;  1NY4 A;  2DJF C;  4DV3 H;  1U4L A;  3OTO L;  1KC7 A;  4O2A F;  4FXG C;  2UU9 Q;  1N36 H;  2NWG A;  2C28 A;  1N33 L;  3M9O B;  1XMO H;  1P8L A;  1PFM A;  3TP5 A;  1EWC A;  2UXC Q;  1ICF B;  1EWI A;  4ECQ A;  1SNM A;  2CQA A;  2YRX A; 
#chains in the Genus database with same CATH homology
 3S1R H;  4JOI A;  4MNO A;  4L5Q A;  2ZM6 L;  2E8G A;  2Q2H A;  4KLK A;  5C0X G;  1ASY A;  2AWO A;  2JK8 A;  4JI7 L;  4IFD J;  3W1B A;  4IPH A;  4RG1 A;  4DR3 Q;  4B3M L;  2R92 G;  3HOU G;  4A76 A;  4DR6 Q;  1I3Q H;  4DR5 Q;  4L5S A;  2MO1 A;  3FKI H;  1VQ7 A;  3CCS A;  3KF8 B;  3PUX A;  4JCV E;  1J5E Q;  1K3R A;  4R4T A;  2YTX A;  2MNA A;  2ES2 A;  3HOV G;  5M5W H;  1JE5 A;  4GOP C;  4LUZ A;  4A3I H;  4LW1 A;  3UDI A;  3A5U A;  4H02 A;  3U4Z A;  3L2P A;  2ATW A;  4LFC L;  1WCM H;  4PZ7 A;  1SR3 A;  1XNQ L;  3M9B A;  3RN2 A;  4JI0 L;  1VQA A;  3G6E A;  3JC6 6;  3PO2 G;  3F2C A;  5M3F G;  4LFC Q;  1N36 L;  1N32 Q;  4B3S L;  1B7Y B;  4DV0 L;  3GDE A;  1ASZ A;  1A62 A;  4UP8 A;  4A3M H;  4P73 A;  3K7A H;  1VQB A;  1G51 A;  4DR4 L;  2JEB I;  2R6G A;  1YIJ A;  1G6P A;  3I4M H;  3I4O A;  2VZA A;  5H1S E;  4DV6 Q;  2JJQ A;  2OTL A;  3KDF A;  4DR7 L;  3I7F A;  4HJ5 A;  1K8A C;  3S1M H;  1EIF A;  5IYC H;  3G4S A;  1L1O B;  2Z6K A;  3E0E A;  1OTC A;  4LF9 Q;  4A3B G;  3AFP A;  1HR0 L;  3NEL A;  1RL2 A;  1PYB A;  1V9P A;  4P72 A;  1PH3 A;  2K5N A;  4X66 Q;  3CCQ A;  4JV5 Q;  2NN6 I;  3J81 i;  4GNX C;  4A3E G;  1HNZ L;  5IYD H;  4APV A;  3AFQ A;  2CFM A;  3Q8D A;  2RCN A;  3TEH B;  1K73 C;  4IFD I;  4QQB X;  1PH1 A;  2CQO A;  3J80 i;  1Q7Y C;  3HOY G;  3GD7 A;  5C4X H;  4L5T A;  3RLF A;  4DV5 L;  4KI0 A;  1KIX A;  1C9O A;  4JC0 A;  4DUZ L;  3T1Y L;  4JI2 L;  2IX0 A;  4IJH A;  4A3B H;  4GKK Q;  1Q1B A;  4JI8 Q;  1LM0 A;  2I5M X;  2XGT A;  3RLO A;  4BY7 G;  3D31 A;  5IYB H;  2E5L Q;  1L1O C;  1TXY A;  3PCO B;  5JEA J;  1QVG A;  1IBM Q;  4LF7 Q;  4AH6 A;  3BU2 A;  2VS1 A;  2BA0 A;  3S1N H;  4HIM A;  2F52 A;  1XJV A;  1JJ2 A;  2HHH Q;  4JYA L;  1B8A A;  1Z9F A;  4A3J G;  4UP7 A;  1IL2 A;  4JG2 A;  3F8T A;  3I55 A;  3GTL H;  1Y1W G;  1BVS A;  4A4I A;  2IX1 A;  4DV0 Q;  1KAW A;  3NBH B;  3EN2 A;  3ULL A;  4AYB G;  1M90 C;  4A93 H;  3M4Q A;  4TVA B;  3I56 A;  4JI7 Q;  1X56 A;  4MZ9 A;  1PH7 A;  2B3G A;  2ZJP A;  2MO0 A;  4X64 Q;  1CKN A;  3DM3 A;  4JI3 L;  1DGS A;  2N49 A;  1SRU A;  2JA8 H;  4IPC A;  4BBR G;  1WFQ A;  3FHW A;  4OX9 L;  3H0G G;  4DK6 C;  2KBN A;  5GRO A;  4JBW A;  1X3E A;  4NXN L;  1HR0 W;  3M3Y H;  3M4O H;  3T1H L;  3IRB A;  4LFA Q;  2A1A A;  4DKA C;  2UUA Q;  2K50 A;  3BZK A;  1U5K A;  4R4Q A;  4A3K H;  2E2J H;  1HZB A;  2L15 A;  3E9H A;  2EXD A;  1C7Y A;  1T9H A;  3J81 j;  4JI5 Q;  4A3G G;  3S16 H;  4R4O A;  4DAY B;  3PIP A;  1CKO A;  2NZO A;  4LUO A;  3STB D;  3HOX H;  4DV4 Q;  2OQ0 A;  4GN4 B;  3W5O A;  2F3I A;  1HR0 Q;  2AHO B;  3HOX G;  1AE3 A;  4KHP L;  4DV7 L;  3SGI A;  1A0I A;  4IOA A;  1W3S A;  2GVB A;  5IP7 G;  4P74 A;  1S3O A;  2B29 A;  2AMC B;  2A19 A;  3KJO A;  4K0K L;  3H3V I;  3MXN B;  3FKI G;  2JA5 H;  3KOJ A;  4YCU A;  3PGZ A;  2ZTD A;  4IOC A;  4DV2 Q;  3E9I A;  3HFZ B;  4OXP A;  1Q86 C;  2R92 H;  2NVT H;  2YYZ A;  3TQY A;  1VQF A;  3UDX A;  1XPO A;  2VUM G;  5GAE C;  4GLA C;  2OQK A;  3CPF A;  3K7U C;  1EQQ A;  1M1K C;  5EAY A;  1WYD A;  1Y1V G;  4X66 L;  4B3R Q;  4X65 L;  2B63 H;  4JV5 L;  1SFO H;  1PH9 A;  2CKZ B;  3RN5 A;  2JE6 I;  4IFD G;  1IBK Q;  3L0O A;  1PYS B;  5J3B A;  5IP9 G;  1I94 L;  4LUV A;  4JI1 Q;  2UUB Q;  2WP8 J;  2UUC Q;  3I4N H;  3KFU A;  2E2H H;  1Y1V H;  4DR2 Q;  4RMF A;  2VQF Q;  1X9N A;  3GTP H;  2VQE L;  1NMG A;  4GNX A;  5GAD C;  3H3V H;  1SRO A;  3H15 A;  2JA8 G;  3PO3 H;  1FVI A;  2Q2U A;  2RHQ B;  3A0J A;  4X62 Q;  1YJ9 A;  2BH2 A;  3HKZ E;  4YY3 L;  4UP9 A;  2PQA A;  3PUZ A;  5AJ3 L;  5FLM G;  4ME3 A;  5GAG C;  2AKW B;  1VQO A;  4LF7 L;  4L5R C;  1XMO Q;  5C4X G;  4PMW A;  4DK3 C;  4YCV A;  1KHI A;  4MTN A;  4TQU S;  4BXX G;  2UXC L;  2K52 A;  4A3L H;  4DV3 L;  2UUB L;  4Y52 H;  5IYD G;  4BBR H;  3BZC A;  1X3G A;  5JJL A;  4DV3 Q;  4AQY Q;  2PI2 E;  5LMN W;  4LF5 Q;  1GKH A;  1MJC A;  1XNR Q;  1O7I A;  2JEA I;  3GTQ H;  1PH6 A;  2Y0S E;  1KD1 C;  4DR3 L;  3GTO H;  1L2F A;  5LMU Q;  2E5L L;  4HID A;  3LGJ A;  1UEB A;  1YHA A;  4J15 A;  3TRE A;  3L7Z C;  4DPG A;  1KC8 C;  1VQ5 A;  4ALP A;  2JA5 G;  3A74 A;  2EIF A;  1P16 A;  1VQI A;  3F2B A;  1N33 Q;  1NJI C;  4LF6 L;  3CC7 A;  4LFA L;  3RZD H;  1G29 1;  2ZTE A;  1HNX L;  1I5F A;  4JBJ A;  4LF8 L;  1XPU A;  1YJN A;  2VNU D;  1HNZ Q;  4YWK A;  3KYH C;  1YIT A;  1Y1W H;  3DLL A;  2I0Q A;  2GVA A;  2YTY A;  4YCW A;  1SMX A;  4GS3 A;  3JAM c;  3KJP A;  4JYA Q;  4A3L G;  4WJ3 M;  3ZJY C;  2KCM A;  4OWX B;  2NVY H;  4GNX B;  4K0K Q;  4HJ7 A;  1XNR L;  4A75 A;  4A3D G;  1OXX K;  3K0X A;  2HQL A;  1X65 A;  2VL6 A;  1EUJ A;  3M85 A;  4YWM A;  4DV6 L;  4GKJ L;  2WB1 E;  4YY3 Q;  4NXN Q;  3G71 A;  4GLX A;  3T1Y Q;  4DR6 L;  2Z6K C;  4C3H H;  1I6H H;  2LSS A;  2WAQ E;  4DV2 L;  2GN5 A;  4JI3 Q;  1D8L A;  1VQG A;  2I5H A;  1BBU A;  1GO3 E;  1Q1E A;  2AWN A;  1UE1 A;  1WJJ A;  2N78 A;  2R7D A;  1K9M C;  2ASB A;  3J81 c;  1BKB A;  1A8V A;  4A3K G;  3CPW A;  4LFB L;  4B3R L;  5AJ3 Q;  1IYJ B;  2PI2 A;  5FLX c;  3CMA A;  1FJG Q;  3PUW A;  1KRT A;  2N8N A;  1VQE A;  1I94 Q;  4JI0 Q;  4BBS G;  1PV4 A;  5ELO A;  1X55 A;  2FXQ A;  5E7N A;  5LMN Q;  1C0A A;  5IWA Q;  4WJ4 A;  1VQL A;  4DUZ Q;  4BA1 I;  1S40 A;  3EIV A;  2VQF L;  1N32 L;  1L1O A;  4HJA A;  1E24 A;  4OWT B;  1NTG A;  2K5V A;  4UPA A;  2VW9 A;  4OX9 Q;  3TRZ A;  1V43 A;  5M3M G;  4BY7 H;  2JA6 G;  3S2H H;  4QY7 A;  2DGY A;  4HIK A;  1YNX A;  3UE1 A;  3G48 A;  3KLW A;  1VQJ A;  1GVP A;  3CCM A;  1OXS C;  3OYY A;  5IT9 c;  3KF6 A;  4A3M G;  4JI6 L;  4LF9 L;  3CXC A;  2EQS A;  1VS0 A;  2K75 A;  2MQH A;  1QZG A;  3AQQ A;  1J5E L;  3BJU A;  2D62 A;  4JBM A;  4IO9 A;  2JA7 H;  2KCT A;  3PF5 A;  5K36 G;  4DAM A;  1MJE A;  1VQM A;  3HOU H;  4DV4 L;  1HH2 P;  3S14 H;  1JT8 A;  3PO3 G;  5GAH C;  2PQA B;  4P71 A;  1PH5 A;  1IBK L;  3HOV H;  4DV5 Q;  1Q81 C;  3F1Z A;  2CWP A;  1CKM A;  5IYC G;  5IE8 A;  4HIO A;  1KL9 A;  1VQC A;  3HKZ G;  3CCU A;  5LMU L;  2JA7 G;  1EIY B;  2NVQ H;  1OXT A;  1VQ4 A;  3PUY A;  2KHI A;  3AEV A;  1WOC A;  3H0G H;  3TS0 A;  1MKH A;  1S72 A;  2NVX H;  1K83 H;  1LYL A;  3HOZ H;  1PH4 A;  4PG3 A;  2D0P A;  4R4I A;  1JJC B;  2K4K A;  4JI5 L;  2YV5 A;  3CQZ H;  2QA4 A;  4R1J A;  3K81 C;  2OWO A;  4GLV B;  2XTI A;  2HHH L;  3PO2 H;  2ZJR A;  1XPR A;  1HNW L;  1E1O A;  1QUQ A;  3I4M G;  3U4V A;  4DUY Q;  1QZH A;  2K5H A;  3S2D H;  1PHJ A;  3K8A A;  3ICE A;  3FP9 A;  4A3J H;  2UUC L;  3HKS A;  2ZM6 Q;  3KF6 B;  3CCL A;  4YHH L;  5JJK A;  2QGQ A;  4IPG A;  1XTD A;  4QL5 A;  4JI8 L;  2IHE A;  2LXJ A;  2K14 A;  3J7Z C;  3RZO H;  1V1Q A;  1QVC A;  2NZH A;  4YWL A;  4X6A H;  1HJP A;  2F4V L;  4X62 L;  3T1H Q;  4GOP A;  4JOI C;  3RR5 A;  3CP0 A;  5DLQ E;  4QJF A;  2H5X A;  1YHB A;  2MFI A;  2WFW A;  4KHZ A;  2UUA L;  3PV0 A;  4POF A;  4DR1 Q;  2RHS B;  5C44 G;  1YVC A;  1Q46 A;  4HJ8 A;  3M7N A;  2CCZ A;  1Q8K A;  2JA6 H;  3I4N G;  3I2Z A;  4GN3 B;  3B6Y A;  1PH2 A;  1SN8 A;  1VQ9 A;  3PIO A;  3GTM H;  3PF4 A;  3GTG H;  3ER0 A;  3OW2 A;  1IXR A;  3A5Z B;  4BA2 I;  5C0X J;  2OTJ A;  2ID0 A;  4JI2 Q;  2R93 G;  4A3C G;  4A3F H;  4LNQ A;  4DR4 Q;  2DUD A;  4A3C H;  3JAM i;  1YBY A;  2PMZ E;  1TWG H;  4JBK A;  3MEF A;  2LXK A;  1EOV A;  2UXD L;  1CSQ A;  2VQE Q;  1KRS A;  1Y14 B;  4Y7N H;  5ELN A;  1JB7 A;  4BBS H;  2ALY B;  4KHP Q;  4EQ5 A;  4B3M Q;  4DNI A;  1IBL L;  1E3P A;  4B3T L;  3HOW H;  3U50 C;  4A3I G;  3TS2 A;  5IY0 A;  2ZJQ A;  4DR7 Q;  3CCV A;  3OTO Q;  1N8R C;  5HGQ A;  3U58 A;  1LTL A;  1E7Z A;  2NN6 G;  4DV7 Q;  1GM5 A;  1U0L A;  3J80 c;  4AQY L;  3PSI A;  5BR8 L;  4LF5 L;  3PUV A;  1XNQ Q;  2YTV A;  2OCE A;  1YEZ A;  4DR2 L;  1B70 B;  2R7F A;  2QEX A;  3ULJ A;  1GD7 A;  1Q82 C;  4JI1 L;  3CC2 A;  3CC4 A;  4JI4 L;  4BXX H;  1KXL A;  1NMF A;  4O2D A;  1H95 A;  2HIX A;  1N36 Q;  5LMN L;  1UE5 A;  3HOY H;  3S24 A;  4X64 L;  2R7Z H;  4B3S Q;  1SE8 A;  4YHH Q;  3F2D A;  4NXM Q;  1VQK A;  1Z47 A;  3STB C;  4DR5 L;  2Z0S A;  2A8V A;  5M3M H;  1HZA A;  4FDB A;  5JJI A;  5JEA G;  4NXM L;  3EBE A;  1XMQ Q;  2BH8 A;  4B3T Q;  4AIM A;  4LWC A;  2CWA A;  3CD6 A;  4OO1 G;  4NPS A;  5M5Y H;  1OXU A;  1A63 A;  1KQS A;  1EQR A;  1PFS A;  1YZ6 A;  2Q2T A;  3S15 H;  1X54 A;  4PZ6 A;  3GO5 A;  4C3J H;  4XIG S;  1RIP A;  1HNW Q;  1L0W A;  1MIU A;  5C4J H;  4IPD A;  3GTK H;  1VQ8 A;  3S17 H;  5M3F H;  2PNH A;  1SLJ A;  3AYH B;  1IBL Q;  2ZTC A;  2F4V Q;  2JA9 A;  3CME A;  1WCM G;  1YI2 A;  1VQ6 A;  1VQH A;  4HJ9 A;  1VQD A;  1YJW A;  4R4C A;  3S1Q H;  1VQN A;  5C3E G;  1YHQ A;  2WB1 G;  3UDF A;  4LF6 Q;  4A3G H;  2JQO A;  3M4P A;  2R7Z G;  1HZC A;  2C35 B;  5M5X H;  4A3D H;  2WAQ G;  4O0A A;  1XMQ L;  1JJG A;  3NEM A;  5BR8 Q;  3HOW G;  1QVF A;  4IJL A;  1FL0 A;  1IZ6 A;  1CKN B;  1N9W A;  5HY6 A;  3RLN A;  3J7A 5;  3K80 C;  2YU9 H;  2Q2I A;  4EX5 A;  4GOP B;  4A3E H;  1WI5 A;  1FJG L;  2VY3 A;  4QIW E;  1PVO A;  1J6Q A;  1AE2 A;  3CAM A;  1VQP A;  4OO1 I;  4UY8 C;  1R9T H;  4DV1 Q;  1X6O A;  4GN5 A;  4OON A;  5FJ8 G;  1EYG A;  5FJ8 H;  4LF4 L;  4GKK L;  4JI4 Q;  4NB3 A;  5IWA L;  2VUM H;  2N3S A;  4A93 G;  3CCR A;  4BY1 G;  3HOZ G;  3CW2 C;  4LF4 Q;  2E2I H;  2UXD Q;  4GKJ Q;  1TWC H;  1HZ9 A;  1N34 Q;  2B63 G;  4C2M H;  2HT1 A;  4BY1 H;  5C44 H;  2UXB L;  1D7Q A;  3CCJ A;  4LFB Q;  2I5L X;  1CSP A;  2IT1 A;  4X65 Q;  4A3F G;  2UU9 L;  2R93 H;  2UXB Q;  4POG A;  1FGU A;  3WWV A;  5C3E H;  3CF5 A;  2KHJ A;  4DUY L;  5IYB G;  1E22 A;  1PA6 A;  3NEN A;  3ERS X;  3UDG A;  1TWH H;  1I50 H;  4DR1 L;  1HNX Q;  4P75 A;  1CUK A;  3VDY A;  4PZ8 A;  1LUZ A;  2V1C C;  4C3I H;  2IY5 B;  5IP7 H;  1BBW A;  2KEN A;  1TWF H;  1OXV A;  1JMC A;  5FLM H;  4OWW B;  4AYB E;  1AH9 A;  1UWV A;  1Q12 A;  3GTJ H;  3UE0 A;  3W1G A;  1IBM L;  2BA1 A;  5GQO A;  1XMO L;  1UE6 A;  4JI6 Q;  1N34 L;  1NY4 A;  1EFW A;  3OTO L;  3ULP A;  1TWA H;  2RF4 A;  3KDF B;  2UU9 Q;  1W2B A;  3CCE A;  1VCI A;  1N33 L;  4QGU A;  1P8L A;  2D0O A;  2IHF A;  1NBW A;  3RNU A;  1UE7 A;  4XTC S;  5C0X I;  4LF8 Q;  5IP9 H;  4DV1 L;  1PH8 A;  2Y0S G;  1K8G A;  2UXC Q;  1NE3 A;  1EWI A;  1K0R A;  1QUQ B;  1E1T A;  3D0F A;  1X3F A;  2HIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...