2R93G

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
total genus 25
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r93G01
1HNWQ 3TQYA 3HOWG 2BH8A 2N78A 2ZJQA 2JA9A 5BR8L 4MNOA 5GROA 3PF5A 4A75A 1GM5A 4R4TA 3KF6A 3I4NG 1VQLA 4UP8A 4YWKA 4X65L 1PH1A 4PZ8A 1HNWL 3PO2G 4IPCA 3HOUH 4OWWB 4A3LG 1VQMA 2E2HH 1EUJA 1Y1WH 1I94Q 1I3QH 1PFSA 4YCVA 4JI8L 2NVQH 4DR2L 3S17H 4R4QA 5ELOA 1IBML 1ASZA 4LF8L 1X55A 1Y1VH 3T1YL 2I5LX 3AQQA 4DV6Q 1XPOA 4BY7H 1AH9A 3ICEA 3CXCA 3T1HQ 2WB1E 2ZJPA 2XGTA 5E7NA 1UE5A 4LF9L 4WJ4A 4HJ8A 4LUZA 1IYJB 1VQIA 2KHIA 4MTNA 1VQNA 4IFDG 1JT8A 5JEAJ 2JK8A 4JC0A 4LFBQ 1EWIA 3K7UC 2KCTA 4GKKL 3M4OH 2AWOA 2RF4A 2CCZA 1BBUA 4BY1G 3AEVA 4BXXG 1A62A 3CC2A 4QGUA 1JJGA 1VQGA 3EBEA 4BBRG 2VUMG 1SMXA 3M4PA 1KQSA 4GKJL 4RMFA 2UU9L 2UUCQ 2R92G 3TS2A 4IFDI 4OWXB 3D31A 3PUVA 5M3MG 1I5FA 2MO0A 3UDIA 5IT9c 1WFQA 4R4CA 4R1JA 2UXBL 2RHQB 3JAMc 3FKIG 4LF6L 3K8AA 1S3OA 4X62Q 4LF7Q 1OXVA 4A3GG 1Q1EA 1VQOA 3CCVA 3BZCA 1C9OA 1CKOA 4JI0L 4JI3L 1HNZL 1VQCA 1UWVA 2UUCL 2UU9Q 4JV5L 5FLMG 1VCIA 2MFIA 4A93G 4DPGA 1XMOL 1EIFA 4L5SA 4A3LH 1CKNB 1X3EA 2WP8J 3T1YQ 2B63H 1Q82C 4JI7Q 4Y52H 1W3SA 3NEMA 3K7AH 4IJHA 4DV2Q 4JV5Q 1YVCA 4YY3L 4ALPA 4XTCS 3T1HL 1QZGA 2N49A 2XTIA 3PV0A 5GAEC 1XMQL 4B3SQ 4OO1I 1VQBA 1NMFA 4IPGA 3RN2A 1JJ2A 2RHSB 4GOPA 5M5WH 3BU2A 2E8GA 2NN6G 4A3JG 2CWPA 4HIOA 3OW2A 3PUXA 1UEBA 5IP7G 2ES2A 4A3CH 1W2BA 2KENA 4EQ5A 4BBSG 3M3YH 4HJ9A 1PYBA 3K81C 1BVSA 1I94L 2IHEA 4P73A 2YTYA 2B63G 1OXTA 5IE8A 1LYLA 1Q12A 1GO3E 2Y0SG 5IWAL 3A5UA 3S16H 4B3RQ 1WCMG 2E5LL 5C0XJ 4GN3B 3JC66 4OX9L 3PIOA 4HIMA 1S40A 4IFDJ 4A76A 1M90C 4DR2Q 4JYAL 2JQOA 1AE2A 4DR1Q 5IWAQ 2K5HA 1QVCA 4BBRH 5C44G 2VUMH 4DV4Q 1SRUA 1U5KA 3FP9A 2KCMA 3S1MH 1Z47A 3GTJH 2IY5B 3GTPH 2UXDL 2PNHA 1YITA 3M7NA 5M3MH 2D62A 1C7YA 5IYBG 1EQRA 3I4OA 2IX1A 3CCLA 2R92H 3S15H 3L7ZC 1G51A 2ZTCA 2NVYH 1N33Q 2JEBI 2MO1A 5AJ3Q 4JI6Q 3BJUA 1JE5A 1KRSA 2VS1A 2YTXA 1PH9A 2Z0SA 3E9IA 4LWCA 3CC7A 2D0PA 2JA5H 4JI4Q 1MJCA 3F8TA 3GD7A 3UE1A 2F4VL 4DR7Q 1XMQQ 4A3EG 1QVGA 3PUYA 4B3SL 3G6EA 1HZCA 1TXYA 3CF5A 4IPDA 4DV2L 2E2JH 4BA2I 3CAMA 1V9PA 5LMNQ 2PMZE 1RL2A 3RR5A 3RN5A 1EYGA 4JOIC 1VS0A 1YJ9A 1N9WA 3KJPA 1VQ8A 3M4QA 3CPFA 4GNXB 2JEAI 2QGQA 4JI2L 4IOAA 1YJWA 3WWVA 3J7ZC 3TS0A 4DR7L 2IX0A 3E0EA 2NVXH 2JA8H 3GO5A 2HIXA 1K73C 1PH8A 1FL0A 2CFMA 4HIDA 4GLXA 1PH6A 1VQHA 4K0KQ 1XPUA 5J3BA 2VNUD 4GOPB 1O7IA 5IP9G 1NBWA 3D0FA 4JI1L 3HOZH 3HKZG 4A3CG 1HH2P 3ULJA 3S1QH 2AMCB 2N8NA 1E22A 2UUAL 2ZTDA 2DGYA 3G48A 4R4OA 5IYCH 3TEHB 4QJFA 3UDGA 1KD1C 4JI7L 1NTGA 1MKHA 3STBD 1HZAA 5IP9H 4BBSH 3CCMA 1UE6A 2Q2UA 1XJVA 5DLQE 2K5VA 4LFCL 3KFUA 3I4NH 1AE3A 1WI5A 2WB1G 5C3EG 2Z6KA 4IPHA 1YI2A 1A8VA 2VY3A 4NPSA 1Y1WG 2OQ0A 1IBLQ 1K8AC 4L5QA 2HHHQ 4LF9Q 2UUAQ 2EQSA 4YWLA 1TWAH 4BA1I 1DGSA 2NZOA 4AYBE 5EAYA 4X62L 4LF7L 2KBNA 2UUBL 1I6HH 2HIVA 3ULPA 2ATWA 5IYDG 1HNZQ 1EIYB 2FXQA 3F2BA 4LFAQ 1OXXK 5C4XG 4LW1A 4RG1A 1D8LA 1N32L 4JCVE 1KHIA 4YWMA 3F2CA 1Q46A 5JEAG 4A3KG 3HOVG 3J81i 1VQ6A 4YCUA 2BH2A 1HR0W 3W1GA 4LFBL 1K0RA 3HFZB 1PH2A 1NJIC 1KAWA 2OWOA 3FHWA 4GLVB 3TRZA 1N32Q 4LF4L 3VDYA 3CCEA 4K0KL 1VQAA 5FJ8G 1Q81C 4DV3Q 2E2IH 3EIVA 1CKMA 2HT1A 4JBWA 4KHPL 4X6AH 1E24A 2F3IA 1EFWA 1SR3A 1A63A 2NN6I 3U58A 5LMNW 1HJPA 4JI4L 3RZDH 4DUZL 4GNXA 4NXML 3S2HH 2H5XA 3FKIH 4APVA 2QA4A 3U4ZA 3LGJA 1ASYA 3E9HA 4MZ9A 4DV1L 2HQLA 4LUOA 1N36L 3UE0A 1G291 4OX9Q 4C3JH 1YIJA 3UDFA 2YYZA 1VQDA 3K80C 3KYHC 1Y1VG 3H0GH 1D7QA 3AFPA 4GOPC 3PIPA 3HOUG 1X9NA 1IXRA 4NXMQ 1SE8A 1N36Q 5LMUQ 5BR8Q 3Q8DA 4DNIA 3ERSX 1N8RC 2R6GA 4OONA 1L1OB 2JA5G 3KJOA 1X65A 4DK6C 2UXDQ 2V1CC 3HOYH 1GKHA 3OYYA 1FJGL 1K3RA 2JA7H 5IYBH 4GS3A 4PG3A 4OO1G 3PUWA 3H3VH 1K9MC 1MIUA 4HIKA 3H3VI 4BY1H 2L15A 1VQKA 2ASBA 5LMUL 3PO2H 3OTOL 4ME3A 4KI0A 3I55A 1S72A 1IBMQ 1VQPA 1YJNA 4POGA 4A3JH 2DUDA 4A3KH 3HOVH 1NMGA 3J80i 2Q2IA 1XTDA 1SLJA 3CQZH 1WYDA 2PQAB 1M1KC 4B3RL 4KHPQ 1Z9FA 4H02A 2JA7G 4GN5A 1IBKQ 4HJAA 5IYDH 1Q8KA 2VQEL 3AYHB 3PCOB 2QEXA 3PF4A 4JBJA 1L2FA 1OTCA 4UPAA 3HOZG 1IBLL 2HHHL 2AHOB 1LTLA 5HGQA 1Q86C 1YZ6A 2CQOA 4A3DG 1IL2A 2A8VA 1LUZA 5FLMH 1QUQA 4DV1Q 1PA6A 1J5EL 1JMCA 4LFAL 2GVBA 2I5HA 4A3IH 3G4SA 2F52A 1BKBA 1PH7A 4A3EH 5JJIA 3CCQA 5C3EH 4A3FH 5IYCG 4DV0Q 1N34L 1GD7A 3PUZA 1CKNA 1C0AA 2WAQG 1KL9A 1UE1A 2JA6H 3HKSA 2I5MX 4DR4L 3I2ZA 1V1QA 4DV3L 3J81c 2GVAA 4A3DH 4LF5L 2K5NA 3CPWA 4LF4Q 3MXNB 4JBMA 4HJ5A 1YHQA 4JI3Q 1J6QA 1X3FA 1TWGH 1B70B 4O2DA 4TQUS 4IOCA 3U4VA 4B3ML 3TREA 3NELA 4GN4B 4PZ7A 5HY6A 3RZOH 1I50H 5FLXc 2LXKA 2OQKA 3AFQA 2D0OA 4OWTB 4X64L 1V43A 1SN8A 4NB3A 2ZJRA 1L1OA 4DUYL 2WFWA 4YY3Q 1FGUA 1NE3A 4DR5Q 4J15A 3GTMH 3S2DH 5M5YH 1CSPA 5C44H 1TWFH 4GNXC 3W1BA 1B8AA 2K14A 1GVPA 3RLOA 1LM0A 1PH3A 2B3GA 2JE6I 1A0IA 5JJKA 3CP0A 1FVIA 2K75A 5IY0A 4AQYQ 1HNXQ 5JJLA 4UY8C 4C2MH 5M3FG 2OCEA 5GAGC 1VQ7A 4DKAC 4YHHQ 3HOXH 2VQEQ 2R7ZG 2VQFQ 2UXCL 2GN5A 1JB7A 2R93G 3UDXA 4DV6L 3PSIA 3GTOH 2UXBQ 1E1TA 3A5ZB 1WOCA 2CWAA 1L0WA 2PQAA 3U50C 1VQ4A 3RNUA 1MJEA 3J7A5 1K8GA 4JI2Q 1T9HA 4LFCQ 1X6OA 3ZJYC 5H1SE 4JG2A 1PH5A 1QVFA 2A19A 4X66L 3GDEA 1P8LA 2B29A 2LSSA 4AIMA 5C0XI 1YHBA 5IP7H 5GAHC 3KDFB 1WJJA 5C4XH 3I4MG 2YV5A 4X65Q 4A3IG 1YNXA 4JYAQ 3HOXG 2R7ZH 2R93H 1QUQB 4OXPA 2ID0A 4L5RC 4X66Q 1IBKL 1SFOH 2K50A 1BBWA 4P72A 1UE7A 1E1OA 1PV4A 3IRBA 4DV7L 4JI8Q 1N33L 4Y7NH 1U0LA 2AKWB 5C0XG 4LF8Q 5AJ3L 4JI6L 3ER0A 4O0AA 1FJGQ 2Q2HA 3PO3G 1PYSB 1H95A 2ALYB 3RLNA 1E3PA 1X54A 4DAMA 4DV5Q 4FDBA 4DV7Q 4LUVA 4PMWA 2I0QA 1CSQA 1XNRL 2R7DA 2NZHA 2K4KA 4AQYL 1HNXL 4KLKA 3I4MH 3J80c 2K52A 3I7FA 4A93H 1Q7YC 4QL5A 4AYBG 5M5XH 2UXCQ 2Y0SE 3ULLA 1E7ZA 4R4IA 3A0JA 4DUZQ 4IO9A 1P16A 1Q1BA 4A3BG 3KOJA 4B3MQ 2Z6KC 2VQFL 5ELNA 3PO3H 4EX5A 2CKZB 3S24A 3GTQH 3CMAA 4YHHL 3GTGH 1XNQL 4NXNQ 2JJQA 3MEFA 4L5TA 4BXXH 1EQQA 4B3TQ 3CMEA 2ZM6Q 3H0GG 2OTLA 4QQBX 3CCJA 1K83H 3F2DA 4POFA 4X64Q 3NBHB 3KF6B 1YHAA 4A3BH 3M9BA 2IT1A 2LXJA 4DR5L 1PVOA 1HZBA 4JOIA 1X3GA 3CD6A 4DUYQ 2VZAA 1RIPA 5M3FH 3HOYG 3CCRA 4JI0Q 1OXUA 4DR3Q 4JI5Q 1XMOQ 4C3HH 2E5LQ 4DR6L 4WJ3M 1IZ6A 4GLAC 2YTVA 4A4IA 2C35B 3A74A 4B3TL 2JA8G 3KLWA 1OXSC 4IJLA 4P71A 1YBYA 2VL6A 1HR0Q 3GTKH 1HZ9A 1KXLA 4DV0L 1N34Q 4LF5Q 1G6PA 3KDFA 3M85A 1XPRA 5FJ8H 2OTJA 2MQHA 1B7YB 3L2PA 4KHZA 3NENA 1KC8C 3S1RH 4P74A 1KIXA 2KHJA 2UUBQ 3S14H 4BY7G 4DR3L 5C4JH 3HKZE 4JBKA 2BA0A 1HR0L 2A1AA 4GKJQ 1JJCB 3B6YA 3DM3A 1YEZA 1NY4A 1R9TH 2IHFA 3CC4A 3J81j 4DK3C 3BZKA 1VQ9A 1Y14B 1CUKA 1SROA 2PI2A 1TWCH 4QIWE 3CCSA 1PH4A 4JI1Q 1EOVA 2F4VQ 3K0XA 1J5EQ 2WAQE 3HOWH 3G71A 1PHJA 4AH6A 5K36G 1VQFA 3I56A 5LMNL 2EIFA 2NVTH 4LNQA 4A3FG 4C3IH 4A3MG 1XNQQ 2AWNA 3RLFA 3CCUA 3L0OA 3STBC 5GADC 3JAMi 4QY7A 4DAYB 3H15A 2BA1A 2ZM6L 4HJ7A 4LF6Q 1WCMH 4UP7A 2Q2TA 2PI2E 3F1ZA 2N3SA 4UP9A 5GQOA 1KRTA 4NXNL 1X56A 1VQEA 3CW2C 1VQJA 3EN2A 4DR4Q 4A3GH 3PGZA 4DR1L 2ZTEA 4A3MH 4DV5L 2RCNA 1L1OC 4JI5L 3SGIA 1QZHA 4PZ6A 2JA6G 4XIGS 4DR6Q 4TVAB 2MNAA 3OTOQ 3GTLH 3DLLA 3KF8B 2VW9A 1VQ5A 3W5OA 4YCWA 4GKKQ 4P75A 2YU9H 2EXDA 2R7FA 3S1NH 4DV4L 1TWHH 1XNRQ
chains in the Genus database with same CATH superfamily
4AYBB 2HVRA 1HFGA 1QNKA 2BH8A 2ZJQA 4A3FB 3WOFA 1MGSA 2V59A 2W6ZA 4HN7A 4DU9A 2F0WA 4UP8A 1PH1A 2F0JA 4IPCA 3HOUH 4NMZA 1VQMA 4DV6H 2IPKD 4BWSC 1BDOA 2HVQA 1PFSA 3TBIB 2E2HB 2VXWA 4O1NA 4WFN3 2NVQH 2NBFA 4R4QA 5ELOA 4LF8L 3T1YL 5D1OB 5KFJA 4EQOA 4O42A 3AQQA 4DV6Q 2LMCB 1XPOA 3PIP3 1AH9A 2FK3A 3J7AF 1CQIB 1I7NA 2YRWA 1EUDB 2W57A 1L0YB 2WB1E 1M6VA 4JPBW 5E7NA 1UE5A 4HJ8A 4GKJH 1IYJB 1CHQD 4MTNA 1JT8A 5JEAJ 2JK8A 4JC0A 5IGBA 4LFBQ 3JRWA 1B2TA 2R85A 3G8CA 1EWIA 2KCTA 5FO9B 4GKKL 1E4GT 2RF4A 3LX0A 4XT3B 3TIGA 1N32H 4BXXG 1TQOA 3CRLC 3KHRA 1O80A 2BDOA 1T36A 3CC2A 4YQWA 2VUMG 1SMXA 3M4PA 1KQSA 2UU9L 2UUCQ 1ULZA 1N34H 4IFDI 1EY7A 1ESRA 3PUVA 5FLXL 1D5MC 2R61A 1WFQA 4MA5A 1BJTA 4R1JA 5KFUA 5AFWA 5KFWA 3JAMc 2FKLA 1OXVA 3QIAA 3BZCA 1W96A 4JI3L 2R7LA 1VQCA 1UWVA 1D2BA 2IX3A 3MC0B 3WOEA 2YU9B 4JV5L 4HNTA 4LMYA 2DPIA 1BNZA 1XMOL 4PQXA 1CKNB 1IHZA 2EYHA 2A69D 1STNA 3PW4A 4LF5H 1QCBD 4Y52H 3NEMA 4DV2Q 4JV5Q 4ALPA 4ZUIA 1WTOA 3T1HL 4RNMA 2N49A 2P5ZX 3PV0A 1S9FA 2VA3A 1B1ZA 1MBYA 4IPGA 1NMFA 1A15A 1I6VC 2RHSB 2PNRC 2E2HA 4C5AA 2E8GA 3OHAA 4DR7H 2CWPA 3PUXA 2CW0D 1W2BA 4BBSG 1PYBA 5C4XB 3SK8A 1BVSA 4P73A 1AUXA 4O4LF 1OXTA 5JQWA 5I9OA 3GTQB 3N41B 3EA6A 4L6TB 1LYLA 5IWAL 2Y0SG 4B3RQ 3GIQA 3CVZA 3JZIA 4Q45A 2E5LL 2UUAH 2C2DA 4OX9L 2VQEH 2C9OA 2NTSA 4HIMA 4A76A 2Z4HA 1WTPA 4IFDJ 2UU9H 4Q8FA 4X3SA 1AE2A 2V4RA 5CA0F 1QVCA 4DV4Q 1SRUA 2F0NA 1U5KA 4DR6H 5KT4A 2KCMA 3S1MH 4BBRB 1F9QA 1Z47A 4KKUA 3GTJH 3GTPH 2W8LA 1YITA 1C7YA 2R92H 2IX1A 3TZDA 3S15H 1G51A 2ZTCA 4ETSA 2BE5C 5IYZF 5AJ3Q 2VS1A 3A8IE 3FEWX 4LWCA 2F4VL 2W9BB 3UE1A 4IZOA 4DR3H 4IWYA 3PUYA 1RTNA 1U9RA 2BOSA 1EY6A 4KMUC 4ZRZA 1MZBA 3KLSA 4ECUA 5IOCA 1EYGA 3RN5A 3DM1A 4LF8H 2HCCA 4JOIC 1PZKD 2R8GA 4UCOA 4IR9A 4IOAA 5KFTA 1C8CA 2PYKA 2NVXH 1PMRA 3KHHA 4C3JB 2HIXA 5L1LA 1DV2A 1XNRH 2CFMA 2UVVA 4YIJA 2LY7A 1VQHA 3TP6A 3Q1KA 1M0TA 2R3ZA 1O7IA 1BBXC 1E22A 4RHSA 1RYSA 4MHEA 5IYCH 1AZPA 1C4QA 3KTMA 4X3UA 3STBD 3N8DA 2F0FA 1Z7TA 4G7HC 2PBZA 2F0PA 5DLQE 4RAZA 2A6HC 1EZ1A 1AE3A 1WI5A 1YI2A 1S4ZA 2Z6KA 1Y1WG 3GTGA 1IBLQ 2HHHQ 3GV8B 2UUAQ 1GUWA 2EQSA 2KEEA 4ECXA 2K7VA 3RUZA 4BA1I 4ZAIA 1DGSA 4FF4A 3OSPA 4LF7L 1I6HH 2UUBL 3BZDB 2Q8TA 1SNQA 4PWQA 1SMYC 3L3OC 1EIYB 2SEBD 3SE7A 4KD4A 4RHRA 5C4XG 4EGVA 3EFXD 5JEAG 3I8ZA 2EZVA 2FJZA 2X6LA 5M5XB 2BH2A 1J8IA 1HR0W 4LFBL 1NJIC 2EPBA 2OWOA 2QCPX 4OEMB 2AUJD 1Y1VB 2B39A 3FDTA 3H91A 3TQTA 1S5CD 5D8DA 3VDYA 3CCEA 5FJ8G 5IIFA 2F0LA 1EEFD 1CKMA 2HT1A 4KHPL 1E24A 1EIGA 2F3IA 1SR3A 2DJGC 4HNUA 4M9UA 2GPSA 4QF4A 3BG3A 1QG7A 1Q8IA 2MCTA 4AYBA 3RJ0A 4JI4L 1AZQA 3RBDA 4G57A 1I4XA 3T13A 4NXML 4O2AF 3P1HA 3JSNA 3MWMA 5D14A 4UCRA 3E9HA 5KEEA 4DV1L 2HQLA 2WIIB 4LUOA 3UE0A 1G291 3VA7A 4MTKA 3T56B 5KFDA 3KYHC 1UC8A 3AFPA 4GOPC 5KFNA 1TVXA 2F0TA 3HOUG 4KKSA 2G9DA 2NVQB 4FU0A 3M4YA 2RSNA 3KHLA 3Q8DA 4B9XA 3GTMB 4OONA 1L1OB 5ELCA 2F0EA 2V1CC 1K1QA 2JA7H 5EOYA 2AGQA 2XCLA 3IFTA 4IAJA 1II3A 3D8GA 1F77A 5DM73 5CV4A 3H3VI 3T5LA 3PO2H 1S72A 3HG9A 1VQPA 4YJ3F 3Q8SB 4A3JH 3HOWB 3K7AB 5DNFA 1XTDA 4Q44A 1WYDA 2NU6B 3JRXA 1Z9FA 2RDGA 2JA7G 4HJAA 4IUPA 1Q8KA 2BQRA 3PCOB 2QEXA 5BPFA 3M9OB 2ICIA 4JBJA 2JXMB 1IBLL 2HHHL 5JVH3 3QFFA 2HJWA 1LTLA 5HGQA 1BXRA 2UUCH 3WO0A 1LUZA 5FLMH 1PA6A 3NTKA 1JMCA 1EEID 4EFEA 2W7PA 4N8FA 3J7AK 5CYUA 5JJIA 3RGZA 4KK7A 1K8OA 2L5TA 5A2QW 1BQQT 1I4QA 2XC9A 4DL3A 2YL2A 1CKNA 1KL9A 2RCFA 2JA6H 3N40P 4J9RA 3GV7B 3I2ZA 2W7OA 3GTOA 5KFCA 4JBMA 4TQUS 2GA4B 4IOCA 3SDZA 3U4VA 2RDHA 2UXCH 3NELA 5EZYF 4GN4B 2JP1A 1Z2NX 4L1KA 2XWBB 1KDBA 2D0OA 2EYPA 3J80E 3DF7A 5EBCA 5M5YB 2WFWA 2L1BA 5LA6F 1SNPA 4U68A 1IL8A 1L2ZA 3URYA 1KJJA 3D4WA 2K14A 3RLOA 1EZ6A 1LM0A 4IWXA 2JE6I 1KABA 1HNXQ 1ILPA 4X64H 4DFAA 1SAPA 2F3VA 1EOTA 3HS0C 5M3FG 1VAJA 4HQ6A 4LH7A 2KA7A 3NBHA 1VQ7A 2VQEQ 2R93G 2GN5A 2N55A 1KDCA 3OWFA 1K83A 4KN4C 3RB3A 2FMAA 3GTOH 1K28A 1L0WA 5KG2A 4A3KB 3HOVB 4MV3A 1K8GA 4F4XA 3TZUA 1O7LA 3VMMA 1EYDA 3MXGA 1EY4A 1IW7D 2NB0A 5C4ZA 2PQEA 1TU2B 5C8YF 3C46A 3J80L 1K3BC 4AIMA 1JX4A 2W9BA 1WJJA 1VBHA 4B9WA 3TIIA 4JYAQ 2R93H 1TS3A 4DGZA 1S5DD 1QUQB 3A7AB 4OXPA 2FK1A 1PDQA 2D5DA 1HTPA 5KRUA 4I4TF 3HEJA 4R8UB 1H9JA 1PV4A 4DR2H 1S5FD 2Y0SB 3P7JA 1LACA 4ECZA 1U0LA 2AKWB 1F9PA 3H40A 4LF8Q 3DMUA 3ER0A 2Q2HA 1PYSB 3FRPB 3T5HA 2ALYB 4RB2C 3MAQA 1E3PA 1X54A 4DAMA 1KLGD 1CSQA 3V2TA 3HKZB 5JVG3 4EGJA 4A93B 4NLGA 2K4KA 4C5CA 1Q7YC 1BGWA 2DPJA 4QL5A 2UXCQ 1PRTD 1PRTB 5ELBA 3ULLA 1LT4D 4J9PA 4ZCKA 4RGTA 2DIKA 2VB3X 3PO3H 4YR0A 4EX5A 3MR3A 3S24A 3N6XA 5KNBA 1VKZA 2R82A 4IZ8A 3GTGB 3QOJA 3PZPA 4JI1H 4EG0A 1E2WA 5KFEA 4O4IF 2FK2A 1EQTA 1K83H 2N88A 5CV7A 5EWEA 2ZDQA 3SR1A 2CHBD 3D6WA 1DOLA 4JOIA 1MI2A 4K6LA 1T3NA 2EJFC 3HOYG 3CCRA 4JI5Q 4WJ3M 4C3HH 1FR3A 1IZ6A 4A4IA 5DGAA 2JA8G 4ECSA 4PV1C 2A6ED 3K5NA 4P71A 2H1EA 4RB0A 3W3AA 2FLPA 2VL6A 1HR0Q 2YCHA 4LF5Q 1Y1VA 2R84A 5KG5A 2DY8A 3GIDA 5CV9A 3NENA 4BY7G 1DXMA 2E2IA 4EQNA 4A2AA 4LF4H 3I4NB 1J5EH 4R8NA 1XWEA 3MZ5A 2EXZA 4MTEA 3RFCA 3M7GA 4KHVA 5I47A 1CQVA 3BZKA 5ELDA 1Y14B 1CUKA 1MD2D 5C1OA 3OIQA 5ISRA 1WSCA 4HNVA 2WAQE 3RIZA 3HKZA 2FMCA 3R2TA 4CJ1B 2CW0C 4A3MG 1TS5A 3JAMi 1QB5D 3FDSA 3HGBA 3BJYA 3S1QB 4QWAA 4QIWA 4LF9Q 3H3VC 1CI3M 2QILA 4LJZC 3TP5A 3CW2C 1VQJA 2ZTEA 3VR3A 2RCNA 4JI5L 5C3XA 4PZ6A 4FF1A 1S0NA 2VQFH 1RJQA 3DLLA 3KF8B 2W70A 4ZUJA 5IT9W 1AFPA 2YU9H 4OO1H 2WACA 2I5MX 1TWHH 4DK0A 4A3IB 5I2XA 3J7AV 3TQYA 3X3MA 3KLRA 3S1NB 5CGKA 2JA9A 4KV6A 1T94A 2DWCA 5BR8L 5GROA 5KFRA 1BNCA 2DNEA 1DOKA 3C0FB 2ALZA 3K5LA 3U9OA 1EQVA 1WD1A 3D4DA 3PO2G 2V58A 5L1KA 4OWWB 1EFID 1TS4A 2K6AA 2EY6A 5KG3A 3O13A 1EUJA 3VPBA 1I3QH 2F0MA 2A6EC 5CBAE 3RZOB 1GUNA 4BY7B 3S17H 1WVLA 2IBKA 2O03A 1B9MA 1KJIA 3HOYB 2E2IB 3RGXA 3K3VA 2XGTA 4LF9L 1JR0D 2AGOA 2YW2A 4LUZA 3SI8A 1XYIA 2BQ3A 1IBMH 1VQNA 1VQIA 2K33A 3VPCA 4TKOB 4IFDG 4C2MA 1B3AA 1QILA 1DONA 3NGDA 3K7UC 4Q0FA 3M4OH 1TT2A 1VF5C 3S1MB 3RB6A 1BBUA 1W6KA 1WTRA 4BY1G 4XYQA 2I8CA 4K2KA 4YBZB 2VUMA 1A62A 4QGUA 3PW7A 3EBEA 2DLNA 4RMFA 3TS2A 2R92G 4X62H 3RV4A 4QIWB 4JI4H 1ZYRD 1W93A 2J7ZA 2MO0A 1GUTA 4IRDA 1JC7A 5IT9c 4LFAH 3SVMA 5A2QL 4NP5A 2RHQB 4GZYC 3FKIG 2WAQB 3K8AA 3GTLA 1Q1EA 1C9OA 1CKOA 2LS01 1BUVT 4A93G 4L5SA 5FLXW 2K5DA 2NVXB 5L1JA 2WDTA 4C56C 4A3LH 3MWYW 2O4XA 5KFSA 1X3EA 2WP8J 2B63H 3MJFA 1Q82C 2J6SA 2L12A 1IOVA 4YY3L 4DAPA 4XTCS 1QZGA 2UUBH 4V0BA 5M5WB 2XTIA 1XMQL 4B3SQ 2WKDA 2DNCA 1VQBA 2QKIC 1EWHA 1AP0A 3V6HA 3BU2A 1VMCA 3FPUB 2B2TC 3BA8A 2ES2A 4HIOA 5EJWA 3EJIA 4DV7H 4L63B 1CHPD 4HR7A 2IHEA 5KFIA 4HMIA 1H9KA 4YB8B 5ELFA 4EYHB 4TQRA 1Q3LA 4DLKA 1XXGA 5KIXA 2Y0SA 3JC66 3KBXA 1TWAA 3EPIA 4X66H 1Q90A 5C3EB 4C2MB 4TV9F 4DR2Q 3Q0AA 2W9CB 3NSWA 3HXLA 1BCPD 5C44G 3H20A 2EOTA 3IAYA 2W71A 5M3FB 4A2BA 1ET9A 3A8KE 2VUMB 4MV1A 2IY5B 5KG4A 2H4OA 2UXDL 2PNHA 2SCUB 3Q6SA 5IYBG 2AUKA 3I4OA 5M9OA 2ZJTA 1IKLA 2HD3A 4EBEA 2BE5D 4JI6Q 2ASDA 1JE5A 2XIGA 1PH9A 2JA5H 3CC7A 2X69A 1JQYD 4ECTA 2B2VC 3G6EA 1HZCA 1A3UA 3KBGA 4IPDA 3BDCA 4RGMA 4BA2I 3CAMA 1V9PA 3QO2A 3BQ0A 1RL2A 1RDPD 4QW9A 2AGPA 3QB3A 3SK5A 1T5EA 1VS0A 1VQ8A 3CPFA 2JEAI 4LSXA 3J7ZC 3J81W 2E75C 1GSOA 3QZ8A 2MHVA 2O5IC 1PH8A 1FL0A 3IKJA 2UVWA 4DNRB 4YY3H 4RKLA 3J7YW 5J3BA 4DUZH 4GOPB 5IP9G 3HOZH 4JI1L 2R7KA 3HKZG 1DD2A 3QJYA 1SYFA 3ULJA 3ND8A 1X32A 2UUAL 1DYQA 1JWUD 2DGYA 3G48A 3UDGA 2JA7B 4RZQA 1HZAA 2R8HA 1LTID 5KFZA 1T5XD 4CDCC 3KFUA 3I4NH 2EDGA 3G6YA 4F88A 1PK8A 4IPHA 4FBUA 4NPSA 2OQ0A 3RB0A 2R8IA 4YWLA 4FXDA 2PW5A 1TWAH 3BVZA 1G2SA 2KHSA 2NZOA 5EAYA 4X62L 2KBNA 3HRZC 3T1HH 2X6GA 2KJXA 4C3IG 3F2BA 4HSPA 1OXXK 1QJOA 4RG1A 5E4WC 4YWMA 4DAYA 4A3KG 3HOVG 3GTKA 2C22A 4YCUA 3K6OA 4ED7A 2DZDA 1WTHA 5M3MB 3D3RA 3HFZB 1PH2A 3MHBA 2QDLA 3E6ZX 1PRTF 4GLVB 3GIJA 1B6SA 1N32Q 3NQIA 2XN9C 4LF9H 4L8JA 3ERQA 4C3HG 5LL6X 3J81L 4DV3Q 3SHLA 1F9SA 4DXFA 1SBBB 1ZXTA 4FBTA 1EFWA 1A63A 1TWHB 5KT3A 2NN6I 2Z8LA 4DV0H 3RZDH 4DUZL 3NUCA 4GNXA 3BAAA 4JV0A 4H44C 3S2HH 3FKIH 2JA6A 3RF2A 4APVA 1WR2A 4S3SA 1LT6D 4CDFC 1ASYA 3I12A 1GLVA 4F4YA 1N36H 2RKSA 4OX9Q 1JKJB 1YIJA 4IRCA 2YYZA 1UNSA 1D7QA 4CJ0B 4FM9A 3ONAB 3OWEB 2M2LA 1X9NA 3MR6A 1BOSA 2ENBA 2KSWA 2JA5A 2Z1CA 2JA7A 2JA5G 5FOBB 1X65A 4DK6C 3HOYH 3S14B 2B2YA 4HAEA 3F8NA 3C1EA 1CA6A 1FNVA 3IL8A 4JI5H 4YP3A 3GV6A 4M7EA 1MIUA 4HIKA 3UFXB 2ASBA 1VQKA 2UXDH 5LMUL 3OW7A 3MXPA 2K5WA 5KG0A 1Y8NB 3MWDA 4O3OA 4QW8A 1YJNA 1AN8A 2IJ0A 4XXEA 2DUDA 4KD3A 4A3KH 3HOVH 3J80i 4B3RH 1EY5A 3C2PA 4B3RL 3U9TA 5TSSA 5D3IB 3VR6A 3VR2A 1Y1WB 3CQZB 5IYDH 3AYHB 5KT2A 4XZ3B 4UPAA 1JE4A 2ATLA 3HOZG 1TAEA 5J1ZA 1YNJD 2EY5A 1Q86C 2ASJA 5KYLA 2B2WA 2FINB 1J5EL 1QE6A 3PIO3 2A69C 3T4AC 3KXYT 2GVBA 4ED0A 4XQQA 2I5HA 1IBLH 1RF2D 2HHHH 1SJHD 3G4SA 4ZYSA 3G6JB 4A3FH 4WRDA 2V9WA 2NVXA 3PUZA 4UCUA 5KFMA 1C0AA 1XMQH 2JEFA 4CKEA 2K5QA 1DV1A 2PN1A 3I4LA 3FKIA 4DV3L 5CMDA 4FP5D 1SEBD 4PDBA 1PX2A 4HJ5A 3HOUB 4JI3Q 1J6QA 3DWAA 1TWGH 3AU7A 5G3LD 4ME6A 3LMLA 2J9GA 4G3IA 5HY6A 2C2EA 1E2ZA 5FLXc 2IMWP 2OQKA 1V43A 2FLNA 1HR0H 5COYA 1V4YA 2F1MA 1NE3A 4J15A 3S2DH 4GC6A 5C44H 4YAJB 5CB4F 3LWEA 2FPGB 1GVPA 2EJGC 3NTHA 3Q2OA 2UXBH 1JOKA 1TWFB 2B3GA 1PH3A 3CP0A 4AQYQ 1GUOA 1LTTD 4UY8C 4C2MH 3Q8QB 1SEIA 5GAGC 1EY0A 4YHHQ 5KG7A 4BY1B 1ZQ7A 3BS1A 1LTBD 1DJRD 1NR2A 4MV8A 2PVPA 1Y8PB 3A5ZB 3LNNA 4K14A 3DXJC 4P2CB 2QW7A 1V1PB 2XWJB 1MJEA 3J7A5 1D1KA 3V6JA 5FD5A 3R3OA 3R93A 3CQZA 3ZJYC 4QWEA 3MXUA 1PH5A 1WCMA 1QVFA 2A19A 2IP4A 3RB4A 2NVYA 3GDEA 1SNCA 2R86A 1SSOA 5C0XI 1YHBA 2W6NA 3LWBA 3KDFB 3NP8A 5CV6A 5EPJA 2YV5A 3M9MB 4X65Q 3F2UA 4RCOA 4NKLA 1EZ8A 2ID0A 4BBSB 4L5RC 1IBKL 1JWMD 1SFOH 1H9MA 1BBWA 1H9RA 2K50A 1UE7A 2R7ZA 4DV5H 1E1OA 2P0AA 3IRBA 5DQIA 2VPQA 2Z9HA 4J8QA 4Y7NH 5I9PA 5FPOA 5C0XG 2LKVA 5AJ3L 2XIWA 5CBEE 4NDXA 4DV5Q 2I0QA 1NCVA 4LUVA 4PMWA 2CW7A 3MXNA 1Z2PX 1ICWA 3H0GA 4MTDA 3KK7A 1X3QA 2VB2X 1E4FT 2QDBA 2NZHA 1HNXL 1IYVA 4KLKA 1PFBA 2K52A 2K01A 1LABA 1G8ZD 1G91A 1HFNA 3EYYA 2R8KA 1E7ZA 1STBA 4MN3A 3A0JA 4DUZQ 3DUZA 3W2DA 1UUPA 4IO9A 4A3BG 3RV3A 2VQFL 2PCFB 3GTQH 2ZDHA 4UCVA 3TINA 2PPBC 5JJZA 4NXNQ 3MEFA 4L5TA 4BXXH 2PZTA 4B3TQ 4I7ZC 1RCVD 5BN3A 1LTAD 1QOHA 3H0GG 4RAUC 1SCUB 4F4WA 4ME5A 2QF7A 4POFA 5KX5F 2MJ8A 4A3BH 3M9BA 4IUNA 1SE3A 1PVOA 2RDFA 3CD6A 2VZAA 1RIPA 2EY2A 1XMOQ 1GSHA 4GLAC 3RMHA 1KDAA 3GTKB 2R7NA 1WTQA 4RU9A 1TIID 4IQZA 4ED6A 2KEDA 4FO2A 1G6PA 4DL4A 3QZ7A 1XPRA 1PTOB 5FJ8H 2OTJA 2KECA 1KC8C 2D2CC 4PMCA 4P74A 1UAPA 1KIXA 2UUBQ 3JAMW 1V8QA 4DR3L 2JSOA 5C4JH 3OOCA 1NR4A 2B2UC 4JBKA 2R7ZB 4Q5VA 2BA0A 3TP8A 4GKJQ 1BO0A 3B6YA 1R9TH 5LL6S 1H9SB 1F2MA 4DK3C 1VQ9A 4IURA 2FE3A 4QIWE 3D6CA 4FS1A 4JI1Q 5FO7B 1TWCA 3G71A 5K36G 2MP1A 3I56A 4EGQA 2HDLA 2NVTH 4A3FG 4ED3A 1ZETA 2L55A 4ILWA 1XNQQ 2AWNA 5KFKA 3CCUA 3STBC 5GADC 4QY7A 2NWGA 4C3IB 2CW8A 4HJ7A 3TMEA 1LTSD 1WCMH 4LF6Q 4LH6A 1NSNS 3F1ZA 2ZJRA 2E2JH 1SYXB 1VQEA 5IWAH 1B44D 4A3MH 4DV5L 1ONLA 2PZWA 2RA4A 1IBKH 4TVAB 2MNAA 3GTLH 2RVLA 5KFBA 4F50A 1PZJD 2EXDA 4APMA 4DV4L 4KY5A 5IT9E 4NXNH 3HB9A 2N78A 1UC9A 4A75A 1N48A 4ED2A 1GUGA 3A55A 1I6HB 2YS7A 4YWKA 4X65L 1HNWL 4A3LG 2E2HH 4K8JA 1Y1WA 1CZWA 1Y1WH 1XMOH 4CHTB 4YCVA 5C5LA 2RSOA 4DR2L 3Q8PB 4ZK9B 1ASZA 1IBML 5KFQA 3K0YA 1Y1VH 1EU4A 2I5LX 1LTGD 1SMYD 1JDEA 3CXCA 2C00A 2PO4A 3T1HQ 4EEYA 4KN7C 2QYZA 3L4KA 3S1RB 4J0MA 1XTCD 1DOMA 2HUGA 3LWUA 1R9TA 5JPMC 1U4MA 4QCLA 2JEJA 2V4QA 3FVQA 2AWOA 4F7XA 4KKTA 5FO8B 1TWCB 1PXUA 1EL0A 3AEVA 1EYCA 2FFKB 3EQLC 4DV3H 1JJGA 1V1OA 5CV8A 2NZ1D 4F87A 4GKJL 4O3SA 4LF7H 3GTPA 2W9AA 2M9VA 3NBIA 2XGQA 5M3MG 1S0OA 2PMZA 4XX0B 4R4CA 4LF7Q 2V5AA 5C44B 4A3GG 3T1YH 4JI0L 4N9PA 1A2TA 5E3FA 4RNNA 1HNZL 3P20A 1BCPC 1VCIA 2MFIA 4DPGA 1IOWA 3V4ZA 4ULLA 4WORA 1HRJA 5A35A 2AQ1B 3PW0A 3T1YQ 4AQYH 2GLTA 4IUTA 1W3SA 3K7AH 4IJHA 4E4TA 4C1NI 4G7OC 1V1PA 1GGOA 3SEBA 3HOZB 2XCPA 3I4MB 4JI6H 5DLGA 5E1FA 1EY8A 3OHBA 2EYJA 5DG9A 2HDMA 4BWGB 4XDXA 1SFOA 4JI0H 4M8AA 5BN4A 2B63G 1O7ZA 5BPHA 2EYLA 5IE8A 1KTKA 2BCOA 1C30A 4ODGA 1B53A 3A5UA 3S16H 4GN3B 4UDUC 2XRSD 3PIOA 1S40A 4IR1A 1RTOA 3HOXB 4Z9CB 4JYAL 2JQOA 4CC5A 2K5HA 3T16A 4BBRH 5IGFA 2CZGA 1NAPA 3FP9A 1EYAA 4U7CA 4DN4M 3S15B 2JEGA 5F9LA 1J9OA 3M7NA 5M3MH 2D62A 3UI2A 2J0TD 2W8KA 4CDEC 3GTPB 3L7ZC 1N33Q 4K6DA 2NVYH 3T53B 1KRSA 3E9IA 5HGTA 2PMZB 2ICEC 3F8TA 3GILA 1TS2A 1XMQQ 4A3EG 2SNSA 3DWQA 4B3SL 2E5LH 1CFMA 3T5JA 1TXYA 2PMZE 4QUFA 3VYUA 2FMMA 3RR5A 1PTOC 1XX8A 4R7RA 2FLLA 1N9WA 3KJPA 2W6MA 1BR9A 3M4QA 2YZGA 2OH2A 1YJWA 4B3TH 1RK6A 4DR7L 2IX0A 1KJ9A 3E3XA 4A3BB 5KFPA 5EQ0A 4DF7A 2IWHA 4HIDA 1HNWH 3QG1A 2A73B 4X65H 2ZXOA 1A3TA 4NXMH 1M0WA 2OF1A 3D0FA 3I73A 5L1IA 2EVBA 4A3CG 1HH2P 1EUCB 2F0HA 2ZTDA 1KD1C 5I4DA 4JI7L 1I4GA 3GTMA 1NTGA 5JVDF 5KFAA 3GP7A 4JI3H 4JVZA 2F0GA 2PZUA 1I94H 1UE6A 1XJVA 1JB3A 3HZXA 2WB1G 4CKCA 5KFGA 1A8VA 2VY3A 1K8AC 5JOBA 4FXKC 3T5KA 3D4RA 3VPDA 2YZMA 4O2BF 5JUMA 4AYBE 3MVVA 5K36H 5DG8A 2HIVA 3ULPA 1G2TA 2NVTB 5F2DA 4LFAQ 1ENFA 1D8LA 3MFYA 1N32L 1KHIA 4HCSA 3F2CA 1VMPA 3OSOA 4U673 2FJ2A 1Y8OB 1K0RA 3FHWA 4J9LA 3HBLA 4A3MB 1S5BD 3H4DA 1VQAA 4JW0A 3SE0A 4DA2A 1Q81C 5DQGA 1DM0B 3H6MA 4X6AH 1HTLD 3A7LA 4LK1C 3I70A 4XT1B 2YS6A 5J2TF 5LMNW 1HJPA 1CM9A 2M00A 3ORRA 4RUAA 3BDLA 3OHXC 2H5XA 1R4PB 3GIKA 4XYLB 3U4ZA 3M4IA 4JUZA 3IFDA 4ECQA 1TWGB 5DQHA 4K8IA 5EWGA 2JA8B 1FNUA 5LXTF 3UDFA 1VQDA 3QWNA 3K80C 3RAQA 3ND9A 3H0GH 1I3QA 3PIPA 4ECRA 3R5FA 4NXMQ 1IXRA 1DIKA 4KY7A 2VUGA 3VYRA 1SE8A 1A3VA 5LMUQ 3WDNA 4DNIA 3ETJA 2L0CA 1N8RC 2R6GA 2AQ3B 4IALA 1PFNA 1FJGL 5C5JA 2F4VH 4YAKB 5C3WA 2MUYA 5DEHA 3H3VH 1K9MC 3GV5B 1LO5D 1X3PA 4JI8H 2D9UA 2L15A 1D6EC 2CQAA 2O2LD 4BY1H 2VR1A 4ECVA 3OTOL 4ME3A 4KI0A 4R8IA 3I55A 4A3JB 5DLFA 1PTOD 4I55F 1HA5A 2JYOA 3PO2B 1NMGA 2L9HA 1LT5D 1GXDC 1B9NA 1F2YA 1SLJA 2Q2IA 3VR4A 2PQAB 1GYFA 1M1KC 3AB9A 4KHPQ 4R9WA 1CQFA 4GN5A 1IBKQ 1QNUA 2VQEL 4OX9H 3QOLA 3K5MA 1L2FA 4RH6A 5J2UF 1PYWD 1CTMA 5KFXA 1E2VA 1YNJC 4CKBA 5KGUA 5KNDA 1YZ6A 2CQOA 4A3DG 4RB3C 1IL2A 2RQXA 1KNAA 2A8VA 2UVRA 4JV2A 2YYAA 4DV1Q 1QUQA 4LAAA 4UHVA 3R5XA 5J22A 2TSSA 4YR2A 5EKLA 4LFAL 1F9RA 4R8UA 4A3IH 1ZHSA 2YU9A 5KNCA 4HTHA 1NNXA 1VBGA 4XQNA 1BKBA 1PH7A 4A3EH 1UNNC 3CCQA 1ZHQA 2ZM6H 5IYCG 3RD4A 1O75A 4O3PA 4RFBA 2WAQG 1UE1A 1TY2A 5IGGA 2WINB 4DR4L 3J81c 5LMNH 2F0IA 1TWGA 4LF5L 2K5NA 3CPWA 1PFMA 5C0XH 1VF7A 3PVXA 2IL8A 3TDQA 1YHQA 4RZRA 4PNYA 1X3FA 4B3ML 3KAJA 3N44B 5NUCA 2R92B 1I3QB 3QR8A 4I7AA 3K5IA 3RZOH 1I50H 1HQMC 2XGPA 3K57A 1I50A 2Q8IB 4NB3A 4H13C 1IW7C 1L1OA 1OWTA 3UQ8A 4YY3Q 1RKNA 3DWPA 2F0DA 3GTQA 2RGVA 1XNQH 4UAIA 1CSPA 5M5YH 2WAQA 3W1BA 2F0VA 4MV4A 1B8AA 3S16B 3GQCA 4OIJA 2IW3A 1A0IA 5IY0A 2K75A 4J6HA 1RK5A 1GOZA 2FHTA 1C3OA 4DKAC 3HOXH 2R7ZG 4N8X1 4LMQD 3R5HA 3L4JA 3OSNA 3UDXA 4ZI7F 4KJOA 3PSIA 2RDJA 1WOCA 1VQ4A 5JVLA 2PQAA 3FMAA 3RNUA 3PMFA 3IN5A 4JI2Q 1T9HA 3GIMA 5H1SE 4KTAA 1RJPA 1P8LA 2B29A 2LSSA 2C5CA 3M3YB 3GIPA 2SNMA 5IP7H 5GAHC 1YNND 4A3IG 3HOXG 2R7ZH 2F0KA 4K0KH 1KBLA 3PW5A 4X66Q 4RUCA 3OUUA 1ESFA 4V190 2YRXA 5JEAH 3VR5A 5CV5A 5LP6F 3RBEA 1GJXA 1HPCA 4JI6L 3PR4A 1MHWC 5G3LF 3N52A 1FGBD 3RLNA 2PW7A 2I80A 2WE6A 3JSLA 1TKWB 3K58A 5K2MA 2R6FA 1STYA 1XNRL 2R7DA 2FPPB 4AQYL 4A3DB 4QWBA 3J80c 1I7LA 4F8MA 2B8FA 3I7FA 5IODA 1D1IA 4A93H 2E2JB 1HUNA 4AYBG 5IGEA 5M5XH 1K0SA 3DEOA 3G6XA 2X0SA 4B3MQ 4M1UB 4RGOS 1BCPB 2CKZB 4PMBA 4UFZA 2B2YC 4EYIB 4YHHL 3GTGH 3PO3B 2JJQA 2L11A 3GV3A 3I90A 3CCJA 2F4IA 3KLSX 5EBDA 3F2DA 4X64Q 3NBHB 3KF6B 1K83B 2IT1A 5I2YA 4DR5L 2J6TA 1HZBA 4EBDA 1HQRD 1I4RA 5M3FH 4DUYQ 2A5HA 4E6IA 4JI0Q 1OXUA 4DR3Q 4DR6L 2E5LQ 4ECWA 2K32A 2HQEA 2C35B 3A74A 3E0JA 1GSAA 4IJLA 4C3HB 2VOBA 4ED8A 2RDIA 1STGA 5DG7A 4DV0L 1N34Q 4KY6A 3M85A 2F03A 3L2PA 4KHZA 3JAME 2B2WC 3S1RH 2XD4A 1SYCA 1JCKB 2K03A 3HKZE 5EDWA 4ZHQF 2A1AA 4H0LC 4WJWA 1JJCB 3DM3A 4RGNA 4K2LA 2IHFA 3OMCA 1EHIA 4JYAH 3Q23A 1GHKA 1PH4A 4FF3A 1TWCH 2CH4W 3VYTA 3CCSA 1MSGA 3K0XA 5GONF 1J5EQ 3HOWH 4AH6A 2R87A 5LMNL 2EIFA 3BABA 2WV6D 1JLLB 1EWCA 5IT9L 3L0OA 4DAYB 4H7BA 3H15A 2BA1A 2ZM6L 1CT1D 3IG0A 4J9MA 3GTJA 4LSAA 4FS2A 3I72A 2Q2TA 5EGTA 2NU9B 2PI2E 4NXNL 5GQOA 2BR0A 5HV6A 4DR4Q 3EN2A 4A3GH 3PGZA 4DR1L 5LOVF 1N56A 4IHJF 1QZHA 4IUQA 4DR6Q 4XIGS 1KJQA 3OTOQ 5IGCA 1WH2A 1VQ5A 2VW9A 3MR2A 3W5OA 4GKKQ 4P75A 3S1NH 2R7FA 1SYBA 1XNRQ 1HNWQ 3HOWG 1GHJA 4J9SA 1S5ED 3NTIA 4O4HF 4MNOA 3PF5A 2KQ3A 1TR5A 4R4TA 1A2UA 1GM5A 3KF6A 3R23A 3WNZA 3RTXA 2JA6B 4EEQA 3I4NG 1VQLA 5KT6A 5FKAC 4PZ8A 2HCIA 3R2IA 5C1PA 1SYDA 3TSSA 2UVUA 3VA5A 4J9QA 3NWTA 2XNAC 3MA2B 2XVSA 2G5DA 3BVGA 1I94Q 4MV9A 2NUAB 4JI8L 2WKCA 5HBRB 1ET6A 4GC7A 1X55A 5CORA 5EKKA 3N42B 4BY7H 1FJGH 4HR7B 4FNFA 4EQPA 3ICEA 3S17B 4EFBA 1B3QA 2ZJPA 1SE4A 3P75A 1E0BA 4WJ4A 1I4PA 2B2VA 4DL6A 4HYKA 1O78A 3RZDB 2KHIA 1NUCA 4A3EB 2K05A 4MV7A 2W9CA 3Q24A 3SK4A 2CCZA 2K28A 5DM63 3GIIA 3GTOB 1I4HA 3M4OB 1KLUD 3GQBA 3BVMA 1RYRA 4Y8VB 1VQGA 4ZKBB 4BBRG 2R92A 2EYOA 5CC4A 1S03G 4XYOA 1EU3A 1I50B 4ECYA 4OWXB 3D31A 1I5FA 3UDIA 3V4SA 1AN7A 2CQYA 2FP4B 2JEIA 1OO9B 1RHPA 5CAEB 4LF6L 1S3OA 4X62Q 1M7JA 1VQOA 3CCVA 4ZLTF 4U6PA 2UUCL 2UU9Q 5FLMG 3KHGA 1ILQA 1U4LA 1EIFA 4OIKA 2VQDA 4RAYA 5H80A 3DEPA 2G9HD 3RUPA 5K5PA 3T51B 1HNXH 4JI7Q 2WB1B 2OXPA 3Q22A 4FF2A 3BA9A 1YVCA 1ZKOA 1K1SA 5GAEC 1K8MA 4OO1I 1JJ2A 3RN2A 4GOPA 5M5WH 1HA6A 2NN6G 4A3JG 5DGBA 3OW2A 5IP7G 1UEBA 4A3CH 5IGDA 1Z2OX 2KENA 4MIUA 4EQ5A 3M3YH 5KG6A 4HJ9A 2OLSA 3K81C 1I94L 4WBNF 2YTYA 2R7MA 3MTSA 5KFVA 3K3PA 4ABNA 4DR1H 2B2UA 1Q12A 1GO3E 4B08A 2KVMA 3NQTA 4CGYB 1WCMG 1JOQA 5C0XJ 1SNOA 5EWFA 1LTRD 2EE1A 1M90C 4ZQ3A 3NE5B 3U9SA 4J9KA 1KEEA 4DR1Q 5IWAQ 2VUMH 5C4HA 5E4XA 4OL7A 1B6RA 1BXTA 3OPOA 4XYMB 4ZQIA 4IRKA 1ENAA 4JK1C 1GUSA 2MPMA 4DV1H 2I87A 5T14A 1EQRA 2ZDGA 2KUMA 3CCLA 1IKMA 1RJRA 2JEBI 2MO1A 3BJUA 2YTXA 2UXBL 3A8JE 2Z0SA 4IN3A 5KKNB 2HVSA 2D0PA 4JI4Q 1MJCA 3GD7A 5DAUA 4DR7Q 2EJMA 1QVGA 1JXLA 2KCNA 4KHPH 4DAVA 3CF5A 4DV2L 3S2DB 2AU0A 5LMNQ 1WD0A 1I6UA 4CBVA 1YJ9A 1CZGA 2VA2A 4J9NA 5LYJF 2W6PA 4GNXB 2QGQA 4JI2L 3WWVA 3TS0A 3BDOA 3PR5B 1A6XA 1B50A 3E0EA 1Y69U 2JA8H 3DHQA 3GO5A 3SK6A 4FVMA 1K73C 2WB1A 3PW2A 2NN6H 3H0GB 4GLXA 4IUVA 2XRQD 5EPKA 1HHVA 1YNNC 1PH6A 4K0KQ 4QWDA 2C2RA 5FK9C 1XPUA 2VNUD 4G7ZC 4K5VA 1NBWA 1PLFA 3CRKC 3S9WA 5BR8H 3S1QH 1SYEA 3BYTB 2AMCB 2N8NA 3E5NA 2KOLA 1O7YA 5JPNC 4R4OA 3TEHB 4QJFA 1N33H 4BS9A 3I91A 4Q43A 1MKHA 4MV6A 2V4DA 2ASLA 3NWSA 1DZ1A 5IP9H 4BBSH 3CCMA 4ZOLF 1EY9A 2Q2UA 3I3CA 4TRDA 2K5VA 4K5WA 4LFCL 1JIHA 5LHY1 5C3EG 4I65A 1TWAB 5CR3A 1PZID 4L5QA 3PN1A 2VPSA 2IA6A 2J6UA 1AEXA 1L0XB 3EVQA 5JH7F 4J1MA 1STAA 3R8BA 2Q8RE 4Q0YA 4X3KA 2ATWA 5IYDG 1HNZQ 2FXQA 1FD7D 4I50F 2A74C 1Z6HA 4LW1A 5T1IA 4JCVE 1Q46A 3GTJB 2GPWA 3J81i 4TV8F 2F0UA 4CDDC 1VQ6A 5F9NA 5LMUH 1FYCA 2W6OA 1RODA 2NYZD 1PTOF 1D5XC 2QEJC 3W1GA 1HNZH 1KAWA 1S68A 2B8GA 5J39A 1DCZA 4A3GB 3TRZA 1TY0A 4LF4L 4C5BA 5L9XA 4K0KL 1V51A 2XSCA 2E2IH 3KF8A 3EIVA 4NW2A 1TA8A 1STEA 4JBWA 2W6QA 4UCTA 4RKBA 1HUMA 1LV9A 4J9OA 4DUYH 3U58A 1G6ZA 3OUZA 3S2HB 1SNDA 2MGSA 2OT2A 2CH4A 1IYUA 4JV1A 1H9SA 2K1BA 5KYIA 1ZEQX 2A6HD 2QA4A 3LGJA 1XDNA 3FKIB 3CKIB 4MZ9A 3FPPA 4QUCA 1N36L 5A2QE 3WO1A 3C1FA 4C3JH 1JWSD 4G4KA 1AUVA 1Y1VG 2I07B 2HGSA 2EY1A 1SDFA 1F2ZA 2KCCA 1N36Q 3KUPA 5BR8Q 3ERSX 1E4EA 1PTOH 4DV2H 5D3DA 4RA8A 2ZT9C 3KJOA 5KFLA 2UXDQ 1GKHA 3OYYA 1K3RA 3PQIA 5C4JB 1WTWA 4IFDH 1KAAA 5IYBH 4GS3A 2TMPA 1W6JA 3NPPA 4PG3A 4OO1G 3PUWA 3BQ2A 1QWYA 4F4ZA 1TWFA 4Q8EA 3X3NA 2DN8A 4YJ2F 1SNMA 2NU7B 4B3MH 4HSVA 2LFNA 3CHBD 1M4VA 1WTVA 1IBMQ 2B63B 1ICFB 4POGA 2SDFA 4WD3A 4X3TA 3CQZH 1FKAH 3E5SA 3EROA 5KFYA 4H02A 4CJ2C 2M05A 5C5MA 4QWCA 1SYGA 1BCPF 1WCMB 3PF4A 1OTCA 3OMGA 5C6AA 2AHOB 2DJFC 4DV4H 4JV5H 4XQJA 4HCEA 2I46A 5D1OA 1U4RA 2QK4A 3KAKA 1VDZA 3H94A 4DL2A 3GTLB 2C28A 2YZNA 4RWSC 2NU8B 1TWHA 4UCSA 4MA0A 3J80W 4EBCA 2F52A 1JOOA 5C3EH 4DV0Q 1N34L 1GD7A 1U4PA 5CA1F 4C3JG 1EYZA 3HKSA 1STHA 4MAMA 1V1QA 1CK1A 2GVAA 4A3DH 1JORA 4LF4Q 3FMCA 3MXNB 1RJTA 3TN2A 1MSHA 4O3RA 1B4OA 3MFGA 1B70B 4O2DA 3OTOH 3TREA 4TUYF 4DR5H 4GKKH 4PZ7A 3MFIA 4HEDA 3NK9A 4IUUA 1PRTC 2LXKA 2CVRA 4OWTB 3AFQA 4X64L 1CA5A 5KT5A 1SN8A 3VYSA 2JA5B 1E4EB 1C48A 4FXGC 4DUYL 4RB1A 3BYYB 1FGUA 4DR5Q 2F0OA 3GTMH 4YHHH 1SE2A 1TWFH 4GNXC 5FD6A 3Q8RB 1KC7A 5HURA 3AMUA 1SJED 2K04A 3G7LA 3NXWA 5JJKA 5JAVA 5JJLA 1FVIA 4EVOA 1ML0D 2OCEA 5L37A 4TQSA 4OHJA 1ENCA 2UXCL 2VQFQ 2B63A 4RCNA 4TSSA 1JB7A 4DV6L 4I7HA 5LL6b 2UXBQ 1E1TA 5T1GA 2XCAA 2CWAA 3U50C 1EIHA 1HXYD 2BQUA 2O5JC 4LFCQ 2A68D 1X6OA 2WTFA 2Z6BA 2E74C 4JG2A 4X66L 3TP7A 4QB4A 5C4XH 3I4MG 2BDNA 1YNXA 2NTTA 2NUCA 1SFOB 3MR5A 4LFCH 3MWEA 5I6YA 1BF4A 2R93A 4Y7NB 4P72A 3NHHA 5KFOA 4DV7L 5FPRA 2F0SA 1RD9D 4JI8Q 1N33L 1JICA 1HCZA 1F2LA 3M9NB 5EKIA 2RBMA 4O0AA 1FJGQ 3PO3G 3H09A 1KNEA 1H95A 2FPIB 3MFHA 1R4QB 4FDBA 4DV7Q 4YR3A 5KG1A 3I4MH 4CC6A 4DXGA 3K5OA 4OELB 2Y0SE 4JI2H 2Z4IA 3CU7A 4R4IA 2E76C 1M8AA 1P16A 1Q1BA 3KOJA 2A68C 3L9AX 1CE8A 2Z6KC 3C3LA 5ELNA 2SOBA 3BQ1A 2OEOA 4DL7A 3OIPA 5ELEA 3CMAA 1KJ8A 2F0QA 2R8JA 1XNQL 4JI7H 2DY7A 1D5ZC 5EPLA 1FNWA 4ID6A 1AW7A 1EQQA 3CMEA 2ZM6Q 2OTLA 3N6RA 4QQBX 4DNTB 1B33N 1S97A 2RGRA 3A56A 3KALA 1WTXA 1YHAA 1B04A 5D1PA 3RAXA 1S10A 4RNOA 2LXJA 1X3GA 3J81E 4DL5A 5KFFA 3V05A 3ITPA 2ZXPA 4B3TL 2YTVA 2EYFA 2J4XA 3KLWA 5I6WA 1OXSC 4DR4H 2B2TA 3H4BA 4DK1A 4O3NA 2NVYB 1YBYA 5FLXE 1KXLA 3GTKH 1HZ9A 1S0MA 3KDFA 4KJNA 2MQHA 1B7YB 1LLRD 3TQ1A 2KHJA 3S14H 4B3SH 3LP8A 4O3QA 2R93B 1HR0L 2ZXRA 3K59A 3V96A 1YEZA 3ORQA 1NY4A 1UEAB 4C1NK 4LFBH 3CC4A 2E2DC 3J81j 1CS0A 3G6VA 3ETHA 4ZKCB 1SROA 2PI2A 4K5XA 1R9TB 5BN5A 2F3WA 2AQ4A 1EOVA 3HP3A 5D65A 3EPGA 2F4VQ 2WYOA 3JAML 1PHJA 4OGQC 1VQFA 1CQJB 4LNQA 2FB9A 4ED1A 1SXTA 3BG5A 4C3IH 3N43B 3RLFA 2EYMA 4FYDA 4HMJA 4UP7A 4N9TA 4UP9A 1KRTA 2N3SA 1ZYRC 3K5HA 1X56A 1JDBB 4QMGA 5KT7A 3MEHA 1L1OC 3SGIA 2JA6G 5KFHA 2AQ2B 2JN4A 3ZYYX 1A9XA 3GLKA 4YCWA 4LF6H 1LT3D 3A54A 3V6KA 2L4NA 5BMVF 3SXHA
chains in the Genus database with same CATH topology
1HNWQ 3TQYA 3HOWG 2BH8A 2N78A 2ZJQA 2JA9A 5BR8L 4MNOA 5GROA 3PF5A 4A75A 1GM5A 4R4TA 3KF6A 3I4NG 1VQLA 4UP8A 4YWKA 4X65L 1PH1A 4PZ8A 1HNWL 3PO2G 4IPCA 3HOUH 4OWWB 4A3LG 1VQMA 2E2HH 1EUJA 1Y1WH 1I94Q 1I3QH 1PFSA 4YCVA 4JI8L 2NVQH 4DR2L 3S17H 4R4QA 5ELOA 1IBML 1ASZA 4LF8L 1X55A 1Y1VH 3T1YL 2I5LX 3AQQA 4DV6Q 1XPOA 4BY7H 1AH9A 3ICEA 3CXCA 3T1HQ 2WB1E 2ZJPA 2XGTA 5E7NA 1UE5A 4LF9L 4WJ4A 4HJ8A 4LUZA 1IYJB 1VQIA 2KHIA 4MTNA 1VQNA 4IFDG 1JT8A 5JEAJ 2JK8A 4JC0A 4LFBQ 1EWIA 3K7UC 2KCTA 4GKKL 3M4OH 2AWOA 2RF4A 2CCZA 1BBUA 4BY1G 3AEVA 4BXXG 1A62A 3CC2A 4QGUA 1JJGA 1VQGA 3EBEA 4BBRG 2VUMG 1SMXA 3M4PA 1KQSA 4GKJL 4RMFA 2UU9L 2UUCQ 2R92G 3TS2A 4IFDI 4OWXB 3D31A 3PUVA 5M3MG 1I5FA 2MO0A 3UDIA 5IT9c 1WFQA 4R4CA 4R1JA 2UXBL 2RHQB 3JAMc 3FKIG 4LF6L 3K8AA 1S3OA 4X62Q 4LF7Q 1OXVA 4A3GG 1Q1EA 1VQOA 3CCVA 3BZCA 1C9OA 1CKOA 4JI0L 4JI3L 1HNZL 1VQCA 1UWVA 2UUCL 2UU9Q 4JV5L 5FLMG 1VCIA 2MFIA 4A93G 4DPGA 1XMOL 1EIFA 4L5SA 4A3LH 1CKNB 1X3EA 2WP8J 3T1YQ 2B63H 1Q82C 4JI7Q 4Y52H 1W3SA 3NEMA 3K7AH 4IJHA 4DV2Q 4JV5Q 1YVCA 4YY3L 4ALPA 4XTCS 3T1HL 1QZGA 2N49A 2XTIA 3PV0A 5GAEC 1XMQL 4B3SQ 4OO1I 1VQBA 1NMFA 4IPGA 3RN2A 1JJ2A 2RHSB 4GOPA 5M5WH 3BU2A 2E8GA 2NN6G 4A3JG 2CWPA 4HIOA 3OW2A 3PUXA 1UEBA 5IP7G 2ES2A 4A3CH 1W2BA 2KENA 4EQ5A 4BBSG 3M3YH 4HJ9A 1PYBA 3K81C 1BVSA 1I94L 2IHEA 4P73A 2YTYA 2B63G 1OXTA 5IE8A 1LYLA 1Q12A 1GO3E 2Y0SG 5IWAL 3A5UA 3S16H 4B3RQ 1WCMG 2E5LL 5C0XJ 4GN3B 3JC66 4OX9L 3PIOA 4HIMA 1S40A 4IFDJ 4A76A 1M90C 4DR2Q 4JYAL 2JQOA 1AE2A 4DR1Q 5IWAQ 2K5HA 1QVCA 4BBRH 5C44G 2VUMH 4DV4Q 1SRUA 1U5KA 3FP9A 2KCMA 3S1MH 1Z47A 3GTJH 2IY5B 3GTPH 2UXDL 2PNHA 1YITA 3M7NA 5M3MH 2D62A 1C7YA 5IYBG 1EQRA 3I4OA 2IX1A 3CCLA 2R92H 3S15H 3L7ZC 1G51A 2ZTCA 2NVYH 1N33Q 2JEBI 2MO1A 5AJ3Q 4JI6Q 3BJUA 1JE5A 1KRSA 2VS1A 2YTXA 1PH9A 2Z0SA 3E9IA 4LWCA 3CC7A 2D0PA 2JA5H 4JI4Q 1MJCA 3F8TA 3GD7A 3UE1A 2F4VL 4DR7Q 1XMQQ 4A3EG 1QVGA 3PUYA 4B3SL 3G6EA 1HZCA 1TXYA 3CF5A 4IPDA 4DV2L 2E2JH 4BA2I 3CAMA 1V9PA 5LMNQ 2PMZE 1RL2A 3RR5A 3RN5A 1EYGA 4JOIC 1VS0A 1YJ9A 1N9WA 3KJPA 1VQ8A 3M4QA 3CPFA 4GNXB 2JEAI 2QGQA 4JI2L 4IOAA 1YJWA 3WWVA 3J7ZC 3TS0A 4DR7L 2IX0A 3E0EA 2NVXH 2JA8H 3GO5A 2HIXA 1K73C 1PH8A 1FL0A 2CFMA 4HIDA 4GLXA 1PH6A 1VQHA 4K0KQ 1XPUA 5J3BA 2VNUD 4GOPB 1O7IA 5IP9G 1NBWA 3D0FA 4JI1L 3HOZH 3HKZG 4A3CG 1HH2P 3ULJA 3S1QH 2AMCB 2N8NA 1E22A 2UUAL 2ZTDA 2DGYA 3G48A 4R4OA 5IYCH 3TEHB 4QJFA 3UDGA 1KD1C 4JI7L 1NTGA 1MKHA 3STBD 1HZAA 5IP9H 4BBSH 3CCMA 1UE6A 2Q2UA 1XJVA 5DLQE 2K5VA 4LFCL 3KFUA 3I4NH 1AE3A 1WI5A 2WB1G 5C3EG 2Z6KA 4IPHA 1YI2A 1A8VA 2VY3A 4NPSA 1Y1WG 2OQ0A 1IBLQ 1K8AC 4L5QA 2HHHQ 4LF9Q 2UUAQ 2EQSA 4YWLA 1TWAH 4BA1I 1DGSA 2NZOA 4AYBE 5EAYA 4X62L 4LF7L 2KBNA 2UUBL 1I6HH 2HIVA 3ULPA 2ATWA 5IYDG 1HNZQ 1EIYB 2FXQA 3F2BA 4LFAQ 1OXXK 5C4XG 4LW1A 4RG1A 1D8LA 1N32L 4JCVE 1KHIA 4YWMA 3F2CA 1Q46A 5JEAG 4A3KG 3HOVG 3J81i 1VQ6A 4YCUA 2BH2A 1HR0W 3W1GA 4LFBL 1K0RA 3HFZB 1PH2A 1NJIC 1KAWA 2OWOA 3FHWA 4GLVB 3TRZA 1N32Q 4LF4L 3VDYA 3CCEA 4K0KL 1VQAA 5FJ8G 1Q81C 4DV3Q 2E2IH 3EIVA 1CKMA 2HT1A 4JBWA 4KHPL 4X6AH 1E24A 2F3IA 1EFWA 1SR3A 1A63A 2NN6I 3U58A 5LMNW 1HJPA 4JI4L 3RZDH 4DUZL 4GNXA 4NXML 3S2HH 2H5XA 3FKIH 4APVA 2QA4A 3U4ZA 3LGJA 1ASYA 3E9HA 4MZ9A 4DV1L 2HQLA 4LUOA 1N36L 3UE0A 1G291 4OX9Q 4C3JH 1YIJA 3UDFA 2YYZA 1VQDA 3K80C 3KYHC 1Y1VG 3H0GH 1D7QA 3AFPA 4GOPC 3PIPA 3HOUG 1X9NA 1IXRA 4NXMQ 1SE8A 1N36Q 5LMUQ 5BR8Q 3Q8DA 4DNIA 3ERSX 1N8RC 2R6GA 4OONA 1L1OB 2JA5G 3KJOA 1X65A 4DK6C 2UXDQ 2V1CC 3HOYH 1GKHA 3OYYA 1FJGL 1K3RA 2JA7H 5IYBH 4GS3A 4PG3A 4OO1G 3PUWA 3H3VH 1K9MC 1MIUA 4HIKA 3H3VI 4BY1H 2L15A 1VQKA 2ASBA 5LMUL 3PO2H 3OTOL 4ME3A 4KI0A 3I55A 1S72A 1IBMQ 1VQPA 1YJNA 4POGA 4A3JH 2DUDA 4A3KH 3HOVH 1NMGA 3J80i 2Q2IA 1XTDA 1SLJA 3CQZH 1WYDA 2PQAB 1M1KC 4B3RL 4KHPQ 1Z9FA 4H02A 2JA7G 4GN5A 1IBKQ 4HJAA 5IYDH 1Q8KA 2VQEL 3AYHB 3PCOB 2QEXA 3PF4A 4JBJA 1L2FA 1OTCA 4UPAA 3HOZG 1IBLL 2HHHL 2AHOB 1LTLA 5HGQA 1Q86C 1YZ6A 2CQOA 4A3DG 1IL2A 2A8VA 1LUZA 5FLMH 1QUQA 4DV1Q 1PA6A 1J5EL 1JMCA 4LFAL 2GVBA 2I5HA 4A3IH 3G4SA 2F52A 1BKBA 1PH7A 4A3EH 5JJIA 3CCQA 5C3EH 4A3FH 5IYCG 4DV0Q 1N34L 1GD7A 3PUZA 1CKNA 1C0AA 2WAQG 1KL9A 1UE1A 2JA6H 3HKSA 2I5MX 4DR4L 3I2ZA 1V1QA 4DV3L 3J81c 2GVAA 4A3DH 4LF5L 2K5NA 3CPWA 4LF4Q 3MXNB 4JBMA 4HJ5A 1YHQA 4JI3Q 1J6QA 1X3FA 1TWGH 1B70B 4O2DA 4TQUS 4IOCA 3U4VA 4B3ML 3TREA 3NELA 4GN4B 4PZ7A 5HY6A 3RZOH 1I50H 5FLXc 2LXKA 2OQKA 3AFQA 2D0OA 4OWTB 4X64L 1V43A 1SN8A 4NB3A 2ZJRA 1L1OA 4DUYL 2WFWA 4YY3Q 1FGUA 1NE3A 4DR5Q 4J15A 3GTMH 3S2DH 5M5YH 1CSPA 5C44H 1TWFH 4GNXC 3W1BA 1B8AA 2K14A 1GVPA 3RLOA 1LM0A 1PH3A 2B3GA 2JE6I 1A0IA 5JJKA 3CP0A 1FVIA 2K75A 5IY0A 4AQYQ 1HNXQ 5JJLA 4UY8C 4C2MH 5M3FG 2OCEA 5GAGC 1VQ7A 4DKAC 4YHHQ 3HOXH 2VQEQ 2R7ZG 2VQFQ 2UXCL 2GN5A 1JB7A 2R93G 3UDXA 4DV6L 3PSIA 3GTOH 2UXBQ 1E1TA 3A5ZB 1WOCA 2CWAA 1L0WA 2PQAA 3U50C 1VQ4A 3RNUA 1MJEA 3J7A5 1K8GA 4JI2Q 1T9HA 4LFCQ 1X6OA 3ZJYC 5H1SE 4JG2A 1PH5A 1QVFA 2A19A 4X66L 3GDEA 1P8LA 2B29A 2LSSA 4AIMA 5C0XI 1YHBA 5IP7H 5GAHC 3KDFB 1WJJA 5C4XH 3I4MG 2YV5A 4X65Q 4A3IG 1YNXA 4JYAQ 3HOXG 2R7ZH 2R93H 1QUQB 4OXPA 2ID0A 4L5RC 4X66Q 1IBKL 1SFOH 2K50A 1BBWA 4P72A 1UE7A 1E1OA 1PV4A 3IRBA 4DV7L 4JI8Q 1N33L 4Y7NH 1U0LA 2AKWB 5C0XG 4LF8Q 5AJ3L 4JI6L 3ER0A 4O0AA 1FJGQ 2Q2HA 3PO3G 1PYSB 1H95A 2ALYB 3RLNA 1E3PA 1X54A 4DAMA 4DV5Q 4FDBA 4DV7Q 4LUVA 4PMWA 2I0QA 1CSQA 1XNRL 2R7DA 2NZHA 2K4KA 4AQYL 1HNXL 4KLKA 3I4MH 3J80c 2K52A 3I7FA 4A93H 1Q7YC 4QL5A 4AYBG 5M5XH 2UXCQ 2Y0SE 3ULLA 1E7ZA 4R4IA 3A0JA 4DUZQ 4IO9A 1P16A 1Q1BA 4A3BG 3KOJA 4B3MQ 2Z6KC 2VQFL 5ELNA 3PO3H 4EX5A 2CKZB 3S24A 3GTQH 3CMAA 4YHHL 3GTGH 1XNQL 4NXNQ 2JJQA 3MEFA 4L5TA 4BXXH 1EQQA 4B3TQ 3CMEA 2ZM6Q 3H0GG 2OTLA 4QQBX 3CCJA 1K83H 3F2DA 4POFA 4X64Q 3NBHB 3KF6B 1YHAA 4A3BH 3M9BA 2IT1A 2LXJA 4DR5L 1PVOA 1HZBA 4JOIA 1X3GA 3CD6A 4DUYQ 2VZAA 1RIPA 5M3FH 3HOYG 3CCRA 4JI0Q 1OXUA 4DR3Q 4JI5Q 1XMOQ 4C3HH 2E5LQ 4DR6L 4WJ3M 1IZ6A 4GLAC 2YTVA 4A4IA 2C35B 3A74A 4B3TL 2JA8G 3KLWA 1OXSC 4IJLA 4P71A 1YBYA 2VL6A 1HR0Q 3GTKH 1HZ9A 1KXLA 4DV0L 1N34Q 4LF5Q 1G6PA 3KDFA 3M85A 1XPRA 5FJ8H 2OTJA 2MQHA 1B7YB 3L2PA 4KHZA 3NENA 1KC8C 3S1RH 4P74A 1KIXA 2KHJA 2UUBQ 3S14H 4BY7G 4DR3L 5C4JH 3HKZE 4JBKA 2BA0A 1HR0L 2A1AA 4GKJQ 1JJCB 3B6YA 3DM3A 1YEZA 1NY4A 1R9TH 2IHFA 3CC4A 3J81j 4DK3C 3BZKA 1VQ9A 1Y14B 1CUKA 1SROA 2PI2A 1TWCH 4QIWE 3CCSA 1PH4A 4JI1Q 1EOVA 2F4VQ 3K0XA 1J5EQ 2WAQE 3HOWH 3G71A 1PHJA 4AH6A 5K36G 1VQFA 3I56A 5LMNL 2EIFA 2NVTH 4LNQA 4A3FG 4C3IH 4A3MG 1XNQQ 2AWNA 3RLFA 3CCUA 3L0OA 3STBC 5GADC 3JAMi 4QY7A 4DAYB 3H15A 2BA1A 2ZM6L 4HJ7A 4LF6Q 1WCMH 4UP7A 2Q2TA 2PI2E 3F1ZA 2N3SA 4UP9A 5GQOA 1KRTA 4NXNL 1X56A 1VQEA 3CW2C 1VQJA 3EN2A 4DR4Q 4A3GH 3PGZA 4DR1L 2ZTEA 4A3MH 4DV5L 2RCNA 1L1OC 4JI5L 3SGIA 1QZHA 4PZ6A 2JA6G 4XIGS 4DR6Q 4TVAB 2MNAA 3OTOQ 3GTLH 3DLLA 3KF8B 2VW9A 1VQ5A 3W5OA 4YCWA 4GKKQ 4P75A 2YU9H 2EXDA 2R7FA 3S1NH 4DV4L 1TWHH 1XNRQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW Q;  3TQY A;  3HOW G;  2BH8 A;  2N78 A;  2ZJQ A;  2JA9 A;  5BR8 L;  4MNO A;  5GRO A;  3PF5 A;  4A75 A;  1GM5 A;  4R4T A;  3KF6 A;  3I4N G;  1VQL A;  4UP8 A;  4YWK A;  4X65 L;  1PH1 A;  4PZ8 A;  1HNW L;  3PO2 G;  4IPC A;  3HOU H;  4OWW B;  4A3L G;  1VQM A;  2E2H H;  1EUJ A;  1Y1W H;  1I94 Q;  1I3Q H;  1PFS A;  4YCV A;  4JI8 L;  2NVQ H;  4DR2 L;  3S17 H;  4R4Q A;  5ELO A;  1IBM L;  1ASZ A;  4LF8 L;  1X55 A;  1Y1V H;  3T1Y L;  2I5L X;  3AQQ A;  4DV6 Q;  1XPO A;  4BY7 H;  1AH9 A;  3ICE A;  3CXC A;  3T1H Q;  2WB1 E;  2ZJP A;  2XGT A;  5E7N A;  1UE5 A;  4LF9 L;  4WJ4 A;  4HJ8 A;  4LUZ A;  1IYJ B;  1VQI A;  2KHI A;  4MTN A;  1VQN A;  4IFD G;  1JT8 A;  5JEA J;  2JK8 A;  4JC0 A;  4LFB Q;  1EWI A;  3K7U C;  2KCT A;  4GKK L;  3M4O H;  2AWO A;  2RF4 A;  2CCZ A;  1BBU A;  4BY1 G;  3AEV A;  4BXX G;  1A62 A;  3CC2 A;  4QGU A;  1JJG A;  1VQG A;  3EBE A;  4BBR G;  2VUM G;  1SMX A;  3M4P A;  1KQS A;  4GKJ L;  4RMF A;  2UU9 L;  2UUC Q;  2R92 G;  3TS2 A;  4IFD I;  4OWX B;  3D31 A;  3PUV A;  5M3M G;  1I5F A;  2MO0 A;  3UDI A;  5IT9 c;  1WFQ A;  4R4C A;  4R1J A;  2UXB L;  2RHQ B;  3JAM c;  3FKI G;  4LF6 L;  3K8A A;  1S3O A;  4X62 Q;  4LF7 Q;  1OXV A;  4A3G G;  1Q1E A;  1VQO A;  3CCV A;  3BZC A;  1C9O A;  1CKO A;  4JI0 L;  4JI3 L;  1HNZ L;  1VQC A;  1UWV A;  2UUC L;  2UU9 Q;  4JV5 L;  5FLM G;  1VCI A;  2MFI A;  4A93 G;  4DPG A;  1XMO L;  1EIF A;  4L5S A;  4A3L H;  1CKN B;  1X3E A;  2WP8 J;  3T1Y Q;  2B63 H;  1Q82 C;  4JI7 Q;  4Y52 H;  1W3S A;  3NEM A;  3K7A H;  4IJH A;  4DV2 Q;  4JV5 Q;  1YVC A;  4YY3 L;  4ALP A;  4XTC S;  3T1H L;  1QZG A;  2N49 A;  2XTI A;  3PV0 A;  5GAE C;  1XMQ L;  4B3S Q;  4OO1 I;  1VQB A;  1NMF A;  4IPG A;  3RN2 A;  1JJ2 A;  2RHS B;  4GOP A;  5M5W H;  3BU2 A;  2E8G A;  2NN6 G;  4A3J G;  2CWP A;  4HIO A;  3OW2 A;  3PUX A;  1UEB A;  5IP7 G;  2ES2 A;  4A3C H;  1W2B A;  2KEN A;  4EQ5 A;  4BBS G;  3M3Y H;  4HJ9 A;  1PYB A;  3K81 C;  1BVS A;  1I94 L;  2IHE A;  4P73 A;  2YTY A;  2B63 G;  1OXT A;  5IE8 A;  1LYL A;  1Q12 A;  1GO3 E;  2Y0S G;  5IWA L;  3A5U A;  3S16 H;  4B3R Q;  1WCM G;  2E5L L;  5C0X J;  4GN3 B;  3JC6 6;  4OX9 L;  3PIO A;  4HIM A;  1S40 A;  4IFD J;  4A76 A;  1M90 C;  4DR2 Q;  4JYA L;  2JQO A;  1AE2 A;  4DR1 Q;  5IWA Q;  2K5H A;  1QVC A;  4BBR H;  5C44 G;  2VUM H;  4DV4 Q;  1SRU A;  1U5K A;  3FP9 A;  2KCM A;  3S1M H;  1Z47 A;  3GTJ H;  2IY5 B;  3GTP H;  2UXD L;  2PNH A;  1YIT A;  3M7N A;  5M3M H;  2D62 A;  1C7Y A;  5IYB G;  1EQR A;  3I4O A;  2IX1 A;  3CCL A;  2R92 H;  3S15 H;  3L7Z C;  1G51 A;  2ZTC A;  2NVY H;  1N33 Q;  2JEB I;  2MO1 A;  5AJ3 Q;  4JI6 Q;  3BJU A;  1JE5 A;  1KRS A;  2VS1 A;  2YTX A;  1PH9 A;  2Z0S A;  3E9I A;  4LWC A;  3CC7 A;  2D0P A;  2JA5 H;  4JI4 Q;  1MJC A;  3F8T A;  3GD7 A;  3UE1 A;  2F4V L;  4DR7 Q;  1XMQ Q;  4A3E G;  1QVG A;  3PUY A;  4B3S L;  3G6E A;  1HZC A;  1TXY A;  3CF5 A;  4IPD A;  4DV2 L;  2E2J H;  4BA2 I;  3CAM A;  1V9P A;  5LMN Q;  2PMZ E;  1RL2 A;  3RR5 A;  3RN5 A;  1EYG A;  4JOI C;  1VS0 A;  1YJ9 A;  1N9W A;  3KJP A;  1VQ8 A;  3M4Q A;  3CPF A;  4GNX B;  2JEA I;  2QGQ A;  4JI2 L;  4IOA A;  1YJW A;  3WWV A;  3J7Z C;  3TS0 A;  4DR7 L;  2IX0 A;  3E0E A;  2NVX H;  2JA8 H;  3GO5 A;  2HIX A;  1K73 C;  1PH8 A;  1FL0 A;  2CFM A;  4HID A;  4GLX A;  1PH6 A;  1VQH A;  4K0K Q;  1XPU A;  5J3B A;  2VNU D;  4GOP B;  1O7I A;  5IP9 G;  1NBW A;  3D0F A;  4JI1 L;  3HOZ H;  3HKZ G;  4A3C G;  1HH2 P;  3ULJ A;  3S1Q H;  2AMC B;  2N8N A;  1E22 A;  2UUA L;  2ZTD A;  2DGY A;  3G48 A;  4R4O A;  5IYC H;  3TEH B;  4QJF A;  3UDG A;  1KD1 C;  4JI7 L;  1NTG A;  1MKH A;  3STB D;  1HZA A;  5IP9 H;  4BBS H;  3CCM A;  1UE6 A;  2Q2U A;  1XJV A;  5DLQ E;  2K5V A;  4LFC L;  3KFU A;  3I4N H;  1AE3 A;  1WI5 A;  2WB1 G;  5C3E G;  2Z6K A;  4IPH A;  1YI2 A;  1A8V A;  2VY3 A;  4NPS A;  1Y1W G;  2OQ0 A;  1IBL Q;  1K8A C;  4L5Q A;  2HHH Q;  4LF9 Q;  2UUA Q;  2EQS A;  4YWL A;  1TWA H;  4BA1 I;  1DGS A;  2NZO A;  4AYB E;  5EAY A;  4X62 L;  4LF7 L;  2KBN A;  2UUB L;  1I6H H;  2HIV A;  3ULP A;  2ATW A;  5IYD G;  1HNZ Q;  1EIY B;  2FXQ A;  3F2B A;  4LFA Q;  1OXX K;  5C4X G;  4LW1 A;  4RG1 A;  1D8L A;  1N32 L;  4JCV E;  1KHI A;  4YWM A;  3F2C A;  1Q46 A;  5JEA G;  4A3K G;  3HOV G;  3J81 i;  1VQ6 A;  4YCU A;  2BH2 A;  1HR0 W;  3W1G A;  4LFB L;  1K0R A;  3HFZ B;  1PH2 A;  1NJI C;  1KAW A;  2OWO A;  3FHW A;  4GLV B;  3TRZ A;  1N32 Q;  4LF4 L;  3VDY A;  3CCE A;  4K0K L;  1VQA A;  5FJ8 G;  1Q81 C;  4DV3 Q;  2E2I H;  3EIV A;  1CKM A;  2HT1 A;  4JBW A;  4KHP L;  4X6A H;  1E24 A;  2F3I A;  1EFW A;  1SR3 A;  1A63 A;  2NN6 I;  3U58 A;  5LMN W;  1HJP A;  4JI4 L;  3RZD H;  4DUZ L;  4GNX A;  4NXM L;  3S2H H;  2H5X A;  3FKI H;  4APV A;  2QA4 A;  3U4Z A;  3LGJ A;  1ASY A;  3E9H A;  4MZ9 A;  4DV1 L;  2HQL A;  4LUO A;  1N36 L;  3UE0 A;  1G29 1;  4OX9 Q;  4C3J H;  1YIJ A;  3UDF A;  2YYZ A;  1VQD A;  3K80 C;  3KYH C;  1Y1V G;  3H0G H;  1D7Q A;  3AFP A;  4GOP C;  3PIP A;  3HOU G;  1X9N A;  1IXR A;  4NXM Q;  1SE8 A;  1N36 Q;  5LMU Q;  5BR8 Q;  3Q8D A;  4DNI A;  3ERS X;  1N8R C;  2R6G A;  4OON A;  1L1O B;  2JA5 G;  3KJO A;  1X65 A;  4DK6 C;  2UXD Q;  2V1C C;  3HOY H;  1GKH A;  3OYY A;  1FJG L;  1K3R A;  2JA7 H;  5IYB H;  4GS3 A;  4PG3 A;  4OO1 G;  3PUW A;  3H3V H;  1K9M C;  1MIU A;  4HIK A;  3H3V I;  4BY1 H;  2L15 A;  1VQK A;  2ASB A;  5LMU L;  3PO2 H;  3OTO L;  4ME3 A;  4KI0 A;  3I55 A;  1S72 A;  1IBM Q;  1VQP A;  1YJN A;  4POG A;  4A3J H;  2DUD A;  4A3K H;  3HOV H;  1NMG A;  3J80 i;  2Q2I A;  1XTD A;  1SLJ A;  3CQZ H;  1WYD A;  2PQA B;  1M1K C;  4B3R L;  4KHP Q;  1Z9F A;  4H02 A;  2JA7 G;  4GN5 A;  1IBK Q;  4HJA A;  5IYD H;  1Q8K A;  2VQE L;  3AYH B;  3PCO B;  2QEX A;  3PF4 A;  4JBJ A;  1L2F A;  1OTC A;  4UPA A;  3HOZ G;  1IBL L;  2HHH L;  2AHO B;  1LTL A;  5HGQ A;  1Q86 C;  1YZ6 A;  2CQO A;  4A3D G;  1IL2 A;  2A8V A;  1LUZ A;  5FLM H;  1QUQ A;  4DV1 Q;  1PA6 A;  1J5E L;  1JMC A;  4LFA L;  2GVB A;  2I5H A;  4A3I H;  3G4S A;  2F52 A;  1BKB A;  1PH7 A;  4A3E H;  5JJI A;  3CCQ A;  5C3E H;  4A3F H;  5IYC G;  4DV0 Q;  1N34 L;  1GD7 A;  3PUZ A;  1CKN A;  1C0A A;  2WAQ G;  1KL9 A;  1UE1 A;  2JA6 H;  3HKS A;  2I5M X;  4DR4 L;  3I2Z A;  1V1Q A;  4DV3 L;  3J81 c;  2GVA A;  4A3D H;  4LF5 L;  2K5N A;  3CPW A;  4LF4 Q;  3MXN B;  4JBM A;  4HJ5 A;  1YHQ A;  4JI3 Q;  1J6Q A;  1X3F A;  1TWG H;  1B70 B;  4O2D A;  4TQU S;  4IOC A;  3U4V A;  4B3M L;  3TRE A;  3NEL A;  4GN4 B;  4PZ7 A;  5HY6 A;  3RZO H;  1I50 H;  5FLX c;  2LXK A;  2OQK A;  3AFQ A;  2D0O A;  4OWT B;  4X64 L;  1V43 A;  1SN8 A;  4NB3 A;  2ZJR A;  1L1O A;  4DUY L;  2WFW A;  4YY3 Q;  1FGU A;  1NE3 A;  4DR5 Q;  4J15 A;  3GTM H;  3S2D H;  5M5Y H;  1CSP A;  5C44 H;  1TWF H;  4GNX C;  3W1B A;  1B8A A;  2K14 A;  1GVP A;  3RLO A;  1LM0 A;  1PH3 A;  2B3G A;  2JE6 I;  1A0I A;  5JJK A;  3CP0 A;  1FVI A;  2K75 A;  5IY0 A;  4AQY Q;  1HNX Q;  5JJL A;  4UY8 C;  4C2M H;  5M3F G;  2OCE A;  5GAG C;  1VQ7 A;  4DKA C;  4YHH Q;  3HOX H;  2VQE Q;  2R7Z G;  2VQF Q;  2UXC L;  2GN5 A;  1JB7 A;  2R93 G;  3UDX A;  4DV6 L;  3PSI A;  3GTO H;  2UXB Q;  1E1T A;  3A5Z B;  1WOC A;  2CWA A;  1L0W A;  2PQA A;  3U50 C;  1VQ4 A;  3RNU A;  1MJE A;  3J7A 5;  1K8G A;  4JI2 Q;  1T9H A;  4LFC Q;  1X6O A;  3ZJY C;  5H1S E;  4JG2 A;  1PH5 A;  1QVF A;  2A19 A;  4X66 L;  3GDE A;  1P8L A;  2B29 A;  2LSS A;  4AIM A;  5C0X I;  1YHB A;  5IP7 H;  5GAH C;  3KDF B;  1WJJ A;  5C4X H;  3I4M G;  2YV5 A;  4X65 Q;  4A3I G;  1YNX A;  4JYA Q;  3HOX G;  2R7Z H;  2R93 H;  1QUQ B;  4OXP A;  2ID0 A;  4L5R C;  4X66 Q;  1IBK L;  1SFO H;  2K50 A;  1BBW A;  4P72 A;  1UE7 A;  1E1O A;  1PV4 A;  3IRB A;  4DV7 L;  4JI8 Q;  1N33 L;  4Y7N H;  1U0L A;  2AKW B;  5C0X G;  4LF8 Q;  5AJ3 L;  4JI6 L;  3ER0 A;  4O0A A;  1FJG Q;  2Q2H A;  3PO3 G;  1PYS B;  1H95 A;  2ALY B;  3RLN A;  1E3P A;  1X54 A;  4DAM A;  4DV5 Q;  4FDB A;  4DV7 Q;  4LUV A;  4PMW A;  2I0Q A;  1CSQ A;  1XNR L;  2R7D A;  2NZH A;  2K4K A;  4AQY L;  1HNX L;  4KLK A;  3I4M H;  3J80 c;  2K52 A;  3I7F A;  4A93 H;  1Q7Y C;  4QL5 A;  4AYB G;  5M5X H;  2UXC Q;  2Y0S E;  3ULL A;  1E7Z A;  4R4I A;  3A0J A;  4DUZ Q;  4IO9 A;  1P16 A;  1Q1B A;  4A3B G;  3KOJ A;  4B3M Q;  2Z6K C;  2VQF L;  5ELN A;  3PO3 H;  4EX5 A;  2CKZ B;  3S24 A;  3GTQ H;  3CMA A;  4YHH L;  3GTG H;  1XNQ L;  4NXN Q;  2JJQ A;  3MEF A;  4L5T A;  4BXX H;  1EQQ A;  4B3T Q;  3CME A;  2ZM6 Q;  3H0G G;  2OTL A;  4QQB X;  3CCJ A;  1K83 H;  3F2D A;  4POF A;  4X64 Q;  3NBH B;  3KF6 B;  1YHA A;  4A3B H;  3M9B A;  2IT1 A;  2LXJ A;  4DR5 L;  1PVO A;  1HZB A;  4JOI A;  1X3G A;  3CD6 A;  4DUY Q;  2VZA A;  1RIP A;  5M3F H;  3HOY G;  3CCR A;  4JI0 Q;  1OXU A;  4DR3 Q;  4JI5 Q;  1XMO Q;  4C3H H;  2E5L Q;  4DR6 L;  4WJ3 M;  1IZ6 A;  4GLA C;  2YTV A;  4A4I A;  2C35 B;  3A74 A;  4B3T L;  2JA8 G;  3KLW A;  1OXS C;  4IJL A;  4P71 A;  1YBY A;  2VL6 A;  1HR0 Q;  3GTK H;  1HZ9 A;  1KXL A;  4DV0 L;  1N34 Q;  4LF5 Q;  1G6P A;  3KDF A;  3M85 A;  1XPR A;  5FJ8 H;  2OTJ A;  2MQH A;  1B7Y B;  3L2P A;  4KHZ A;  3NEN A;  1KC8 C;  3S1R H;  4P74 A;  1KIX A;  2KHJ A;  2UUB Q;  3S14 H;  4BY7 G;  4DR3 L;  5C4J H;  3HKZ E;  4JBK A;  2BA0 A;  1HR0 L;  2A1A A;  4GKJ Q;  1JJC B;  3B6Y A;  3DM3 A;  1YEZ A;  1NY4 A;  1R9T H;  2IHF A;  3CC4 A;  3J81 j;  4DK3 C;  3BZK A;  1VQ9 A;  1Y14 B;  1CUK A;  1SRO A;  2PI2 A;  1TWC H;  4QIW E;  3CCS A;  1PH4 A;  4JI1 Q;  1EOV A;  2F4V Q;  3K0X A;  1J5E Q;  2WAQ E;  3HOW H;  3G71 A;  1PHJ A;  4AH6 A;  5K36 G;  1VQF A;  3I56 A;  5LMN L;  2EIF A;  2NVT H;  4LNQ A;  4A3F G;  4C3I H;  4A3M G;  1XNQ Q;  2AWN A;  3RLF A;  3CCU A;  3L0O A;  3STB C;  5GAD C;  3JAM i;  4QY7 A;  4DAY B;  3H15 A;  2BA1 A;  2ZM6 L;  4HJ7 A;  4LF6 Q;  1WCM H;  4UP7 A;  2Q2T A;  2PI2 E;  3F1Z A;  2N3S A;  4UP9 A;  5GQO A;  1KRT A;  4NXN L;  1X56 A;  1VQE A;  3CW2 C;  1VQJ A;  3EN2 A;  4DR4 Q;  4A3G H;  3PGZ A;  4DR1 L;  2ZTE A;  4A3M H;  4DV5 L;  2RCN A;  1L1O C;  4JI5 L;  3SGI A;  1QZH A;  4PZ6 A;  2JA6 G;  4XIG S;  4DR6 Q;  4TVA B;  2MNA A;  3OTO Q;  3GTL H;  3DLL A;  3KF8 B;  2VW9 A;  1VQ5 A;  3W5O A;  4YCW A;  4GKK Q;  4P75 A;  2YU9 H;  2EXD A;  2R7F A;  3S1N H;  4DV4 L;  1TWH H;  1XNR Q; 
#chains in the Genus database with same CATH topology
 4AYB B;  2HVR A;  1HFG A;  1QNK A;  2BH8 A;  2ZJQ A;  4A3F B;  3WOF A;  1MGS A;  2V59 A;  2W6Z A;  4HN7 A;  4DU9 A;  2F0W A;  4UP8 A;  1PH1 A;  2F0J A;  4IPC A;  3HOU H;  4NMZ A;  1VQM A;  4DV6 H;  2IPK D;  4BWS C;  1BDO A;  2HVQ A;  1PFS A;  3TBI B;  2E2H B;  2VXW A;  4O1N A;  4WFN 3;  2NVQ H;  2NBF A;  4R4Q A;  5ELO A;  4LF8 L;  3T1Y L;  5D1O B;  5KFJ A;  4EQO A;  4O42 A;  3AQQ A;  4DV6 Q;  2LMC B;  1XPO A;  3PIP 3;  1AH9 A;  2FK3 A;  3J7A F;  1CQI B;  1I7N A;  2YRW A;  1EUD B;  2W57 A;  1L0Y B;  2WB1 E;  1M6V A;  4JPB W;  5E7N A;  1UE5 A;  4HJ8 A;  4GKJ H;  1IYJ B;  1CHQ D;  4MTN A;  1JT8 A;  5JEA J;  2JK8 A;  4JC0 A;  5IGB A;  4LFB Q;  3JRW A;  1B2T A;  2R85 A;  3G8C A;  1EWI A;  2KCT A;  5FO9 B;  4GKK L;  1E4G T;  2RF4 A;  3LX0 A;  4XT3 B;  3TIG A;  1N32 H;  4BXX G;  1TQO A;  3CRL C;  3KHR A;  1O80 A;  2BDO A;  1T36 A;  3CC2 A;  4YQW A;  2VUM G;  1SMX A;  3M4P A;  1KQS A;  2UU9 L;  2UUC Q;  1ULZ A;  1N34 H;  4IFD I;  1EY7 A;  1ESR A;  3PUV A;  5FLX L;  1D5M C;  2R61 A;  1WFQ A;  4MA5 A;  1BJT A;  4R1J A;  5KFU A;  5AFW A;  5KFW A;  3JAM c;  2FKL A;  1OXV A;  3QIA A;  3BZC A;  1W96 A;  4JI3 L;  2R7L A;  1VQC A;  1UWV A;  1D2B A;  2IX3 A;  3MC0 B;  3WOE A;  2YU9 B;  4JV5 L;  4HNT A;  4LMY A;  2DPI A;  1BNZ A;  1XMO L;  4PQX A;  1CKN B;  1IHZ A;  2EYH A;  2A69 D;  1STN A;  3PW4 A;  4LF5 H;  1QCB D;  4Y52 H;  3NEM A;  4DV2 Q;  4JV5 Q;  4ALP A;  4ZUI A;  1WTO A;  3T1H L;  4RNM A;  2N49 A;  2P5Z X;  3PV0 A;  1S9F A;  2VA3 A;  1B1Z A;  1MBY A;  4IPG A;  1NMF A;  1A15 A;  1I6V C;  2RHS B;  2PNR C;  2E2H A;  4C5A A;  2E8G A;  3OHA A;  4DR7 H;  2CWP A;  3PUX A;  2CW0 D;  1W2B A;  4BBS G;  1PYB A;  5C4X B;  3SK8 A;  1BVS A;  4P73 A;  1AUX A;  4O4L F;  1OXT A;  5JQW A;  5I9O A;  3GTQ B;  3N41 B;  3EA6 A;  4L6T B;  1LYL A;  5IWA L;  2Y0S G;  4B3R Q;  3GIQ A;  3CVZ A;  3JZI A;  4Q45 A;  2E5L L;  2UUA H;  2C2D A;  4OX9 L;  2VQE H;  2C9O A;  2NTS A;  4HIM A;  4A76 A;  2Z4H A;  1WTP A;  4IFD J;  2UU9 H;  4Q8F A;  4X3S A;  1AE2 A;  2V4R A;  5CA0 F;  1QVC A;  4DV4 Q;  1SRU A;  2F0N A;  1U5K A;  4DR6 H;  5KT4 A;  2KCM A;  3S1M H;  4BBR B;  1F9Q A;  1Z47 A;  4KKU A;  3GTJ H;  3GTP H;  2W8L A;  1YIT A;  1C7Y A;  2R92 H;  2IX1 A;  3TZD A;  3S15 H;  1G51 A;  2ZTC A;  4ETS A;  2BE5 C;  5IYZ F;  5AJ3 Q;  2VS1 A;  3A8I E;  3FEW X;  4LWC A;  2F4V L;  2W9B B;  3UE1 A;  4IZO A;  4DR3 H;  4IWY A;  3PUY A;  1RTN A;  1U9R A;  2BOS A;  1EY6 A;  4KMU C;  4ZRZ A;  1MZB A;  3KLS A;  4ECU A;  5IOC A;  1EYG A;  3RN5 A;  3DM1 A;  4LF8 H;  2HCC A;  4JOI C;  1PZK D;  2R8G A;  4UCO A;  4IR9 A;  4IOA A;  5KFT A;  1C8C A;  2PYK A;  2NVX H;  1PMR A;  3KHH A;  4C3J B;  2HIX A;  5L1L A;  1DV2 A;  1XNR H;  2CFM A;  2UVV A;  4YIJ A;  2LY7 A;  1VQH A;  3TP6 A;  3Q1K A;  1M0T A;  2R3Z A;  1O7I A;  1BBX C;  1E22 A;  4RHS A;  1RYS A;  4MHE A;  5IYC H;  1AZP A;  1C4Q A;  3KTM A;  4X3U A;  3STB D;  3N8D A;  2F0F A;  1Z7T A;  4G7H C;  2PBZ A;  2F0P A;  5DLQ E;  4RAZ A;  2A6H C;  1EZ1 A;  1AE3 A;  1WI5 A;  1YI2 A;  1S4Z A;  2Z6K A;  1Y1W G;  3GTG A;  1IBL Q;  2HHH Q;  3GV8 B;  2UUA Q;  1GUW A;  2EQS A;  2KEE A;  4ECX A;  2K7V A;  3RUZ A;  4BA1 I;  4ZAI A;  1DGS A;  4FF4 A;  3OSP A;  4LF7 L;  1I6H H;  2UUB L;  3BZD B;  2Q8T A;  1SNQ A;  4PWQ A;  1SMY C;  3L3O C;  1EIY B;  2SEB D;  3SE7 A;  4KD4 A;  4RHR A;  5C4X G;  4EGV A;  3EFX D;  5JEA G;  3I8Z A;  2EZV A;  2FJZ A;  2X6L A;  5M5X B;  2BH2 A;  1J8I A;  1HR0 W;  4LFB L;  1NJI C;  2EPB A;  2OWO A;  2QCP X;  4OEM B;  2AUJ D;  1Y1V B;  2B39 A;  3FDT A;  3H91 A;  3TQT A;  1S5C D;  5D8D A;  3VDY A;  3CCE A;  5FJ8 G;  5IIF A;  2F0L A;  1EEF D;  1CKM A;  2HT1 A;  4KHP L;  1E24 A;  1EIG A;  2F3I A;  1SR3 A;  2DJG C;  4HNU A;  4M9U A;  2GPS A;  4QF4 A;  3BG3 A;  1QG7 A;  1Q8I A;  2MCT A;  4AYB A;  3RJ0 A;  4JI4 L;  1AZQ A;  3RBD A;  4G57 A;  1I4X A;  3T13 A;  4NXM L;  4O2A F;  3P1H A;  3JSN A;  3MWM A;  5D14 A;  4UCR A;  3E9H A;  5KEE A;  4DV1 L;  2HQL A;  2WII B;  4LUO A;  3UE0 A;  1G29 1;  3VA7 A;  4MTK A;  3T56 B;  5KFD A;  3KYH C;  1UC8 A;  3AFP A;  4GOP C;  5KFN A;  1TVX A;  2F0T A;  3HOU G;  4KKS A;  2G9D A;  2NVQ B;  4FU0 A;  3M4Y A;  2RSN A;  3KHL A;  3Q8D A;  4B9X A;  3GTM B;  4OON A;  1L1O B;  5ELC A;  2F0E A;  2V1C C;  1K1Q A;  2JA7 H;  5EOY A;  2AGQ A;  2XCL A;  3IFT A;  4IAJ A;  1II3 A;  3D8G A;  1F77 A;  5DM7 3;  5CV4 A;  3H3V I;  3T5L A;  3PO2 H;  1S72 A;  3HG9 A;  1VQP A;  4YJ3 F;  3Q8S B;  4A3J H;  3HOW B;  3K7A B;  5DNF A;  1XTD A;  4Q44 A;  1WYD A;  2NU6 B;  3JRX A;  1Z9F A;  2RDG A;  2JA7 G;  4HJA A;  4IUP A;  1Q8K A;  2BQR A;  3PCO B;  2QEX A;  5BPF A;  3M9O B;  2ICI A;  4JBJ A;  2JXM B;  1IBL L;  2HHH L;  5JVH 3;  3QFF A;  2HJW A;  1LTL A;  5HGQ A;  1BXR A;  2UUC H;  3WO0 A;  1LUZ A;  5FLM H;  1PA6 A;  3NTK A;  1JMC A;  1EEI D;  4EFE A;  2W7P A;  4N8F A;  3J7A K;  5CYU A;  5JJI A;  3RGZ A;  4KK7 A;  1K8O A;  2L5T A;  5A2Q W;  1BQQ T;  1I4Q A;  2XC9 A;  4DL3 A;  2YL2 A;  1CKN A;  1KL9 A;  2RCF A;  2JA6 H;  3N40 P;  4J9R A;  3GV7 B;  3I2Z A;  2W7O A;  3GTO A;  5KFC A;  4JBM A;  4TQU S;  2GA4 B;  4IOC A;  3SDZ A;  3U4V A;  2RDH A;  2UXC H;  3NEL A;  5EZY F;  4GN4 B;  2JP1 A;  1Z2N X;  4L1K A;  2XWB B;  1KDB A;  2D0O A;  2EYP A;  3J80 E;  3DF7 A;  5EBC A;  5M5Y B;  2WFW A;  2L1B A;  5LA6 F;  1SNP A;  4U68 A;  1IL8 A;  1L2Z A;  3URY A;  1KJJ A;  3D4W A;  2K14 A;  3RLO A;  1EZ6 A;  1LM0 A;  4IWX A;  2JE6 I;  1KAB A;  1HNX Q;  1ILP A;  4X64 H;  4DFA A;  1SAP A;  2F3V A;  1EOT A;  3HS0 C;  5M3F G;  1VAJ A;  4HQ6 A;  4LH7 A;  2KA7 A;  3NBH A;  1VQ7 A;  2VQE Q;  2R93 G;  2GN5 A;  2N55 A;  1KDC A;  3OWF A;  1K83 A;  4KN4 C;  3RB3 A;  2FMA A;  3GTO H;  1K28 A;  1L0W A;  5KG2 A;  4A3K B;  3HOV B;  4MV3 A;  1K8G A;  4F4X A;  3TZU A;  1O7L A;  3VMM A;  1EYD A;  3MXG A;  1EY4 A;  1IW7 D;  2NB0 A;  5C4Z A;  2PQE A;  1TU2 B;  5C8Y F;  3C46 A;  3J80 L;  1K3B C;  4AIM A;  1JX4 A;  2W9B A;  1WJJ A;  1VBH A;  4B9W A;  3TII A;  4JYA Q;  2R93 H;  1TS3 A;  4DGZ A;  1S5D D;  1QUQ B;  3A7A B;  4OXP A;  2FK1 A;  1PDQ A;  2D5D A;  1HTP A;  5KRU A;  4I4T F;  3HEJ A;  4R8U B;  1H9J A;  1PV4 A;  4DR2 H;  1S5F D;  2Y0S B;  3P7J A;  1LAC A;  4ECZ A;  1U0L A;  2AKW B;  1F9P A;  3H40 A;  4LF8 Q;  3DMU A;  3ER0 A;  2Q2H A;  1PYS B;  3FRP B;  3T5H A;  2ALY B;  4RB2 C;  3MAQ A;  1E3P A;  1X54 A;  4DAM A;  1KLG D;  1CSQ A;  3V2T A;  3HKZ B;  5JVG 3;  4EGJ A;  4A93 B;  4NLG A;  2K4K A;  4C5C A;  1Q7Y C;  1BGW A;  2DPJ A;  4QL5 A;  2UXC Q;  1PRT D;  1PRT B;  5ELB A;  3ULL A;  1LT4 D;  4J9P A;  4ZCK A;  4RGT A;  2DIK A;  2VB3 X;  3PO3 H;  4YR0 A;  4EX5 A;  3MR3 A;  3S24 A;  3N6X A;  5KNB A;  1VKZ A;  2R82 A;  4IZ8 A;  3GTG B;  3QOJ A;  3PZP A;  4JI1 H;  4EG0 A;  1E2W A;  5KFE A;  4O4I F;  2FK2 A;  1EQT A;  1K83 H;  2N88 A;  5CV7 A;  5EWE A;  2ZDQ A;  3SR1 A;  2CHB D;  3D6W A;  1DOL A;  4JOI A;  1MI2 A;  4K6L A;  1T3N A;  2EJF C;  3HOY G;  3CCR A;  4JI5 Q;  4WJ3 M;  4C3H H;  1FR3 A;  1IZ6 A;  4A4I A;  5DGA A;  2JA8 G;  4ECS A;  4PV1 C;  2A6E D;  3K5N A;  4P71 A;  2H1E A;  4RB0 A;  3W3A A;  2FLP A;  2VL6 A;  1HR0 Q;  2YCH A;  4LF5 Q;  1Y1V A;  2R84 A;  5KG5 A;  2DY8 A;  3GID A;  5CV9 A;  3NEN A;  4BY7 G;  1DXM A;  2E2I A;  4EQN A;  4A2A A;  4LF4 H;  3I4N B;  1J5E H;  4R8N A;  1XWE A;  3MZ5 A;  2EXZ A;  4MTE A;  3RFC A;  3M7G A;  4KHV A;  5I47 A;  1CQV A;  3BZK A;  5ELD A;  1Y14 B;  1CUK A;  1MD2 D;  5C1O A;  3OIQ A;  5ISR A;  1WSC A;  4HNV A;  2WAQ E;  3RIZ A;  3HKZ A;  2FMC A;  3R2T A;  4CJ1 B;  2CW0 C;  4A3M G;  1TS5 A;  3JAM i;  1QB5 D;  3FDS A;  3HGB A;  3BJY A;  3S1Q B;  4QWA A;  4QIW A;  4LF9 Q;  3H3V C;  1CI3 M;  2QIL A;  4LJZ C;  3TP5 A;  3CW2 C;  1VQJ A;  2ZTE A;  3VR3 A;  2RCN A;  4JI5 L;  5C3X A;  4PZ6 A;  4FF1 A;  1S0N A;  2VQF H;  1RJQ A;  3DLL A;  3KF8 B;  2W70 A;  4ZUJ A;  5IT9 W;  1AFP A;  2YU9 H;  4OO1 H;  2WAC A;  2I5M X;  1TWH H;  4DK0 A;  4A3I B;  5I2X A;  3J7A V;  3TQY A;  3X3M A;  3KLR A;  3S1N B;  5CGK A;  2JA9 A;  4KV6 A;  1T94 A;  2DWC A;  5BR8 L;  5GRO A;  5KFR A;  1BNC A;  2DNE A;  1DOK A;  3C0F B;  2ALZ A;  3K5L A;  3U9O A;  1EQV A;  1WD1 A;  3D4D A;  3PO2 G;  2V58 A;  5L1K A;  4OWW B;  1EFI D;  1TS4 A;  2K6A A;  2EY6 A;  5KG3 A;  3O13 A;  1EUJ A;  3VPB A;  1I3Q H;  2F0M A;  2A6E C;  5CBA E;  3RZO B;  1GUN A;  4BY7 B;  3S17 H;  1WVL A;  2IBK A;  2O03 A;  1B9M A;  1KJI A;  3HOY B;  2E2I B;  3RGX A;  3K3V A;  2XGT A;  4LF9 L;  1JR0 D;  2AGO A;  2YW2 A;  4LUZ A;  3SI8 A;  1XYI A;  2BQ3 A;  1IBM H;  1VQN A;  1VQI A;  2K33 A;  3VPC A;  4TKO B;  4IFD G;  4C2M A;  1B3A A;  1QIL A;  1DON A;  3NGD A;  3K7U C;  4Q0F A;  3M4O H;  1TT2 A;  1VF5 C;  3S1M B;  3RB6 A;  1BBU A;  1W6K A;  1WTR A;  4BY1 G;  4XYQ A;  2I8C A;  4K2K A;  4YBZ B;  2VUM A;  1A62 A;  4QGU A;  3PW7 A;  3EBE A;  2DLN A;  4RMF A;  3TS2 A;  2R92 G;  4X62 H;  3RV4 A;  4QIW B;  4JI4 H;  1ZYR D;  1W93 A;  2J7Z A;  2MO0 A;  1GUT A;  4IRD A;  1JC7 A;  5IT9 c;  4LFA H;  3SVM A;  5A2Q L;  4NP5 A;  2RHQ B;  4GZY C;  3FKI G;  2WAQ B;  3K8A A;  3GTL A;  1Q1E A;  1C9O A;  1CKO A;  2LS0 1;  1BUV T;  4A93 G;  4L5S A;  5FLX W;  2K5D A;  2NVX B;  5L1J A;  2WDT A;  4C56 C;  4A3L H;  3MWY W;  2O4X A;  5KFS A;  1X3E A;  2WP8 J;  2B63 H;  3MJF A;  1Q82 C;  2J6S A;  2L12 A;  1IOV A;  4YY3 L;  4DAP A;  4XTC S;  1QZG A;  2UUB H;  4V0B A;  5M5W B;  2XTI A;  1XMQ L;  4B3S Q;  2WKD A;  2DNC A;  1VQB A;  2QKI C;  1EWH A;  1AP0 A;  3V6H A;  3BU2 A;  1VMC A;  3FPU B;  2B2T C;  3BA8 A;  2ES2 A;  4HIO A;  5EJW A;  3EJI A;  4DV7 H;  4L63 B;  1CHP D;  4HR7 A;  2IHE A;  5KFI A;  4HMI A;  1H9K A;  4YB8 B;  5ELF A;  4EYH B;  4TQR A;  1Q3L A;  4DLK A;  1XXG A;  5KIX A;  2Y0S A;  3JC6 6;  3KBX A;  1TWA A;  3EPI A;  4X66 H;  1Q90 A;  5C3E B;  4C2M B;  4TV9 F;  4DR2 Q;  3Q0A A;  2W9C B;  3NSW A;  3HXL A;  1BCP D;  5C44 G;  3H20 A;  2EOT A;  3IAY A;  2W71 A;  5M3F B;  4A2B A;  1ET9 A;  3A8K E;  2VUM B;  4MV1 A;  2IY5 B;  5KG4 A;  2H4O A;  2UXD L;  2PNH A;  2SCU B;  3Q6S A;  5IYB G;  2AUK A;  3I4O A;  5M9O A;  2ZJT A;  1IKL A;  2HD3 A;  4EBE A;  2BE5 D;  4JI6 Q;  2ASD A;  1JE5 A;  2XIG A;  1PH9 A;  2JA5 H;  3CC7 A;  2X69 A;  1JQY D;  4ECT A;  2B2V C;  3G6E A;  1HZC A;  1A3U A;  3KBG A;  4IPD A;  3BDC A;  4RGM A;  4BA2 I;  3CAM A;  1V9P A;  3QO2 A;  3BQ0 A;  1RL2 A;  1RDP D;  4QW9 A;  2AGP A;  3QB3 A;  3SK5 A;  1T5E A;  1VS0 A;  1VQ8 A;  3CPF A;  2JEA I;  4LSX A;  3J7Z C;  3J81 W;  2E75 C;  1GSO A;  3QZ8 A;  2MHV A;  2O5I C;  1PH8 A;  1FL0 A;  3IKJ A;  2UVW A;  4DNR B;  4YY3 H;  4RKL A;  3J7Y W;  5J3B A;  4DUZ H;  4GOP B;  5IP9 G;  3HOZ H;  4JI1 L;  2R7K A;  3HKZ G;  1DD2 A;  3QJY A;  1SYF A;  3ULJ A;  3ND8 A;  1X32 A;  2UUA L;  1DYQ A;  1JWU D;  2DGY A;  3G48 A;  3UDG A;  2JA7 B;  4RZQ A;  1HZA A;  2R8H A;  1LTI D;  5KFZ A;  1T5X D;  4CDC C;  3KFU A;  3I4N H;  2EDG A;  3G6Y A;  4F88 A;  1PK8 A;  4IPH A;  4FBU A;  4NPS A;  2OQ0 A;  3RB0 A;  2R8I A;  4YWL A;  4FXD A;  2PW5 A;  1TWA H;  3BVZ A;  1G2S A;  2KHS A;  2NZO A;  5EAY A;  4X62 L;  2KBN A;  3HRZ C;  3T1H H;  2X6G A;  2KJX A;  4C3I G;  3F2B A;  4HSP A;  1OXX K;  1QJO A;  4RG1 A;  5E4W C;  4YWM A;  4DAY A;  4A3K G;  3HOV G;  3GTK A;  2C22 A;  4YCU A;  3K6O A;  4ED7 A;  2DZD A;  1WTH A;  5M3M B;  3D3R A;  3HFZ B;  1PH2 A;  3MHB A;  2QDL A;  3E6Z X;  1PRT F;  4GLV B;  3GIJ A;  1B6S A;  1N32 Q;  3NQI A;  2XN9 C;  4LF9 H;  4L8J A;  3ERQ A;  4C3H G;  5LL6 X;  3J81 L;  4DV3 Q;  3SHL A;  1F9S A;  4DXF A;  1SBB B;  1ZXT A;  4FBT A;  1EFW A;  1A63 A;  1TWH B;  5KT3 A;  2NN6 I;  2Z8L A;  4DV0 H;  3RZD H;  4DUZ L;  3NUC A;  4GNX A;  3BAA A;  4JV0 A;  4H44 C;  3S2H H;  3FKI H;  2JA6 A;  3RF2 A;  4APV A;  1WR2 A;  4S3S A;  1LT6 D;  4CDF C;  1ASY A;  3I12 A;  1GLV A;  4F4Y A;  1N36 H;  2RKS A;  4OX9 Q;  1JKJ B;  1YIJ A;  4IRC A;  2YYZ A;  1UNS A;  1D7Q A;  4CJ0 B;  4FM9 A;  3ONA B;  3OWE B;  2M2L A;  1X9N A;  3MR6 A;  1BOS A;  2ENB A;  2KSW A;  2JA5 A;  2Z1C A;  2JA7 A;  2JA5 G;  5FOB B;  1X65 A;  4DK6 C;  3HOY H;  3S14 B;  2B2Y A;  4HAE A;  3F8N A;  3C1E A;  1CA6 A;  1FNV A;  3IL8 A;  4JI5 H;  4YP3 A;  3GV6 A;  4M7E A;  1MIU A;  4HIK A;  3UFX B;  2ASB A;  1VQK A;  2UXD H;  5LMU L;  3OW7 A;  3MXP A;  2K5W A;  5KG0 A;  1Y8N B;  3MWD A;  4O3O A;  4QW8 A;  1YJN A;  1AN8 A;  2IJ0 A;  4XXE A;  2DUD A;  4KD3 A;  4A3K H;  3HOV H;  3J80 i;  4B3R H;  1EY5 A;  3C2P A;  4B3R L;  3U9T A;  5TSS A;  5D3I B;  3VR6 A;  3VR2 A;  1Y1W B;  3CQZ B;  5IYD H;  3AYH B;  5KT2 A;  4XZ3 B;  4UPA A;  1JE4 A;  2ATL A;  3HOZ G;  1TAE A;  5J1Z A;  1YNJ D;  2EY5 A;  1Q86 C;  2ASJ A;  5KYL A;  2B2W A;  2FIN B;  1J5E L;  1QE6 A;  3PIO 3;  2A69 C;  3T4A C;  3KXY T;  2GVB A;  4ED0 A;  4XQQ A;  2I5H A;  1IBL H;  1RF2 D;  2HHH H;  1SJH D;  3G4S A;  4ZYS A;  3G6J B;  4A3F H;  4WRD A;  2V9W A;  2NVX A;  3PUZ A;  4UCU A;  5KFM A;  1C0A A;  1XMQ H;  2JEF A;  4CKE A;  2K5Q A;  1DV1 A;  2PN1 A;  3I4L A;  3FKI A;  4DV3 L;  5CMD A;  4FP5 D;  1SEB D;  4PDB A;  1PX2 A;  4HJ5 A;  3HOU B;  4JI3 Q;  1J6Q A;  3DWA A;  1TWG H;  3AU7 A;  5G3L D;  4ME6 A;  3LML A;  2J9G A;  4G3I A;  5HY6 A;  2C2E A;  1E2Z A;  5FLX c;  2IMW P;  2OQK A;  1V43 A;  2FLN A;  1HR0 H;  5COY A;  1V4Y A;  2F1M A;  1NE3 A;  4J15 A;  3S2D H;  4GC6 A;  5C44 H;  4YAJ B;  5CB4 F;  3LWE A;  2FPG B;  1GVP A;  2EJG C;  3NTH A;  3Q2O A;  2UXB H;  1JOK A;  1TWF B;  2B3G A;  1PH3 A;  3CP0 A;  4AQY Q;  1GUO A;  1LTT D;  4UY8 C;  4C2M H;  3Q8Q B;  1SEI A;  5GAG C;  1EY0 A;  4YHH Q;  5KG7 A;  4BY1 B;  1ZQ7 A;  3BS1 A;  1LTB D;  1DJR D;  1NR2 A;  4MV8 A;  2PVP A;  1Y8P B;  3A5Z B;  3LNN A;  4K14 A;  3DXJ C;  4P2C B;  2QW7 A;  1V1P B;  2XWJ B;  1MJE A;  3J7A 5;  1D1K A;  3V6J A;  5FD5 A;  3R3O A;  3R93 A;  3CQZ A;  3ZJY C;  4QWE A;  3MXU A;  1PH5 A;  1WCM A;  1QVF A;  2A19 A;  2IP4 A;  3RB4 A;  2NVY A;  3GDE A;  1SNC A;  2R86 A;  1SSO A;  5C0X I;  1YHB A;  2W6N A;  3LWB A;  3KDF B;  3NP8 A;  5CV6 A;  5EPJ A;  2YV5 A;  3M9M B;  4X65 Q;  3F2U A;  4RCO A;  4NKL A;  1EZ8 A;  2ID0 A;  4BBS B;  4L5R C;  1IBK L;  1JWM D;  1SFO H;  1H9M A;  1BBW A;  1H9R A;  2K50 A;  1UE7 A;  2R7Z A;  4DV5 H;  1E1O A;  2P0A A;  3IRB A;  5DQI A;  2VPQ A;  2Z9H A;  4J8Q A;  4Y7N H;  5I9P A;  5FPO A;  5C0X G;  2LKV A;  5AJ3 L;  2XIW A;  5CBE E;  4NDX A;  4DV5 Q;  2I0Q A;  1NCV A;  4LUV A;  4PMW A;  2CW7 A;  3MXN A;  1Z2P X;  1ICW A;  3H0G A;  4MTD A;  3KK7 A;  1X3Q A;  2VB2 X;  1E4F T;  2QDB A;  2NZH A;  1HNX L;  1IYV A;  4KLK A;  1PFB A;  2K52 A;  2K01 A;  1LAB A;  1G8Z D;  1G91 A;  1HFN A;  3EYY A;  2R8K A;  1E7Z A;  1STB A;  4MN3 A;  3A0J A;  4DUZ Q;  3DUZ A;  3W2D A;  1UUP A;  4IO9 A;  4A3B G;  3RV3 A;  2VQF L;  2PCF B;  3GTQ H;  2ZDH A;  4UCV A;  3TIN A;  2PPB C;  5JJZ A;  4NXN Q;  3MEF A;  4L5T A;  4BXX H;  2PZT A;  4B3T Q;  4I7Z C;  1RCV D;  5BN3 A;  1LTA D;  1QOH A;  3H0G G;  4RAU C;  1SCU B;  4F4W A;  4ME5 A;  2QF7 A;  4POF A;  5KX5 F;  2MJ8 A;  4A3B H;  3M9B A;  4IUN A;  1SE3 A;  1PVO A;  2RDF A;  3CD6 A;  2VZA A;  1RIP A;  2EY2 A;  1XMO Q;  1GSH A;  4GLA C;  3RMH A;  1KDA A;  3GTK B;  2R7N A;  1WTQ A;  4RU9 A;  1TII D;  4IQZ A;  4ED6 A;  2KED A;  4FO2 A;  1G6P A;  4DL4 A;  3QZ7 A;  1XPR A;  1PTO B;  5FJ8 H;  2OTJ A;  2KEC A;  1KC8 C;  2D2C C;  4PMC A;  4P74 A;  1UAP A;  1KIX A;  2UUB Q;  3JAM W;  1V8Q A;  4DR3 L;  2JSO A;  5C4J H;  3OOC A;  1NR4 A;  2B2U C;  4JBK A;  2R7Z B;  4Q5V A;  2BA0 A;  3TP8 A;  4GKJ Q;  1BO0 A;  3B6Y A;  1R9T H;  5LL6 S;  1H9S B;  1F2M A;  4DK3 C;  1VQ9 A;  4IUR A;  2FE3 A;  4QIW E;  3D6C A;  4FS1 A;  4JI1 Q;  5FO7 B;  1TWC A;  3G71 A;  5K36 G;  2MP1 A;  3I56 A;  4EGQ A;  2HDL A;  2NVT H;  4A3F G;  4ED3 A;  1ZET A;  2L55 A;  4ILW A;  1XNQ Q;  2AWN A;  5KFK A;  3CCU A;  3STB C;  5GAD C;  4QY7 A;  2NWG A;  4C3I B;  2CW8 A;  4HJ7 A;  3TME A;  1LTS D;  1WCM H;  4LF6 Q;  4LH6 A;  1NSN S;  3F1Z A;  2ZJR A;  2E2J H;  1SYX B;  1VQE A;  5IWA H;  1B44 D;  4A3M H;  4DV5 L;  1ONL A;  2PZW A;  2RA4 A;  1IBK H;  4TVA B;  2MNA A;  3GTL H;  2RVL A;  5KFB A;  4F50 A;  1PZJ D;  2EXD A;  4APM A;  4DV4 L;  4KY5 A;  5IT9 E;  4NXN H;  3HB9 A;  2N78 A;  1UC9 A;  4A75 A;  1N48 A;  4ED2 A;  1GUG A;  3A55 A;  1I6H B;  2YS7 A;  4YWK A;  4X65 L;  1HNW L;  4A3L G;  2E2H H;  4K8J A;  1Y1W A;  1CZW A;  1Y1W H;  1XMO H;  4CHT B;  4YCV A;  5C5L A;  2RSO A;  4DR2 L;  3Q8P B;  4ZK9 B;  1ASZ A;  1IBM L;  5KFQ A;  3K0Y A;  1Y1V H;  1EU4 A;  2I5L X;  1LTG D;  1SMY D;  1JDE A;  3CXC A;  2C00 A;  2PO4 A;  3T1H Q;  4EEY A;  4KN7 C;  2QYZ A;  3L4K A;  3S1R B;  4J0M A;  1XTC D;  1DOM A;  2HUG A;  3LWU A;  1R9T A;  5JPM C;  1U4M A;  4QCL A;  2JEJ A;  2V4Q A;  3FVQ A;  2AWO A;  4F7X A;  4KKT A;  5FO8 B;  1TWC B;  1PXU A;  1EL0 A;  3AEV A;  1EYC A;  2FFK B;  3EQL C;  4DV3 H;  1JJG A;  1V1O A;  5CV8 A;  2NZ1 D;  4F87 A;  4GKJ L;  4O3S A;  4LF7 H;  3GTP A;  2W9A A;  2M9V A;  3NBI A;  2XGQ A;  5M3M G;  1S0O A;  2PMZ A;  4XX0 B;  4R4C A;  4LF7 Q;  2V5A A;  5C44 B;  4A3G G;  3T1Y H;  4JI0 L;  4N9P A;  1A2T A;  5E3F A;  4RNN A;  1HNZ L;  3P20 A;  1BCP C;  1VCI A;  2MFI A;  4DPG A;  1IOW A;  3V4Z A;  4ULL A;  4WOR A;  1HRJ A;  5A35 A;  2AQ1 B;  3PW0 A;  3T1Y Q;  4AQY H;  2GLT A;  4IUT A;  1W3S A;  3K7A H;  4IJH A;  4E4T A;  4C1N I;  4G7O C;  1V1P A;  1GGO A;  3SEB A;  3HOZ B;  2XCP A;  3I4M B;  4JI6 H;  5DLG A;  5E1F A;  1EY8 A;  3OHB A;  2EYJ A;  5DG9 A;  2HDM A;  4BWG B;  4XDX A;  1SFO A;  4JI0 H;  4M8A A;  5BN4 A;  2B63 G;  1O7Z A;  5BPH A;  2EYL A;  5IE8 A;  1KTK A;  2BCO A;  1C30 A;  4ODG A;  1B53 A;  3A5U A;  3S16 H;  4GN3 B;  4UDU C;  2XRS D;  3PIO A;  1S40 A;  4IR1 A;  1RTO A;  3HOX B;  4Z9C B;  4JYA L;  2JQO A;  4CC5 A;  2K5H A;  3T16 A;  4BBR H;  5IGF A;  2CZG A;  1NAP A;  3FP9 A;  1EYA A;  4U7C A;  4DN4 M;  3S15 B;  2JEG A;  5F9L A;  1J9O A;  3M7N A;  5M3M H;  2D62 A;  3UI2 A;  2J0T D;  2W8K A;  4CDE C;  3GTP B;  3L7Z C;  1N33 Q;  4K6D A;  2NVY H;  3T53 B;  1KRS A;  3E9I A;  5HGT A;  2PMZ B;  2ICE C;  3F8T A;  3GIL A;  1TS2 A;  1XMQ Q;  4A3E G;  2SNS A;  3DWQ A;  4B3S L;  2E5L H;  1CFM A;  3T5J A;  1TXY A;  2PMZ E;  4QUF A;  3VYU A;  2FMM A;  3RR5 A;  1PTO C;  1XX8 A;  4R7R A;  2FLL A;  1N9W A;  3KJP A;  2W6M A;  1BR9 A;  3M4Q A;  2YZG A;  2OH2 A;  1YJW A;  4B3T H;  1RK6 A;  4DR7 L;  2IX0 A;  1KJ9 A;  3E3X A;  4A3B B;  5KFP A;  5EQ0 A;  4DF7 A;  2IWH A;  4HID A;  1HNW H;  3QG1 A;  2A73 B;  4X65 H;  2ZXO A;  1A3T A;  4NXM H;  1M0W A;  2OF1 A;  3D0F A;  3I73 A;  5L1I A;  2EVB A;  4A3C G;  1HH2 P;  1EUC B;  2F0H A;  2ZTD A;  1KD1 C;  5I4D A;  4JI7 L;  1I4G A;  3GTM A;  1NTG A;  5JVD F;  5KFA A;  3GP7 A;  4JI3 H;  4JVZ A;  2F0G A;  2PZU A;  1I94 H;  1UE6 A;  1XJV A;  1JB3 A;  3HZX A;  2WB1 G;  4CKC A;  5KFG A;  1A8V A;  2VY3 A;  1K8A C;  5JOB A;  4FXK C;  3T5K A;  3D4R A;  3VPD A;  2YZM A;  4O2B F;  5JUM A;  4AYB E;  3MVV A;  5K36 H;  5DG8 A;  2HIV A;  3ULP A;  1G2T A;  2NVT B;  5F2D A;  4LFA Q;  1ENF A;  1D8L A;  3MFY A;  1N32 L;  1KHI A;  4HCS A;  3F2C A;  1VMP A;  3OSO A;  4U67 3;  2FJ2 A;  1Y8O B;  1K0R A;  3FHW A;  4J9L A;  3HBL A;  4A3M B;  1S5B D;  3H4D A;  1VQA A;  4JW0 A;  3SE0 A;  4DA2 A;  1Q81 C;  5DQG A;  1DM0 B;  3H6M A;  4X6A H;  1HTL D;  3A7L A;  4LK1 C;  3I70 A;  4XT1 B;  2YS6 A;  5J2T F;  5LMN W;  1HJP A;  1CM9 A;  2M00 A;  3ORR A;  4RUA A;  3BDL A;  3OHX C;  2H5X A;  1R4P B;  3GIK A;  4XYL B;  3U4Z A;  3M4I A;  4JUZ A;  3IFD A;  4ECQ A;  1TWG B;  5DQH A;  4K8I A;  5EWG A;  2JA8 B;  1FNU A;  5LXT F;  3UDF A;  1VQD A;  3QWN A;  3K80 C;  3RAQ A;  3ND9 A;  3H0G H;  1I3Q A;  3PIP A;  4ECR A;  3R5F A;  4NXM Q;  1IXR A;  1DIK A;  4KY7 A;  2VUG A;  3VYR A;  1SE8 A;  1A3V A;  5LMU Q;  3WDN A;  4DNI A;  3ETJ A;  2L0C A;  1N8R C;  2R6G A;  2AQ3 B;  4IAL A;  1PFN A;  1FJG L;  5C5J A;  2F4V H;  4YAK B;  5C3W A;  2MUY A;  5DEH A;  3H3V H;  1K9M C;  3GV5 B;  1LO5 D;  1X3P A;  4JI8 H;  2D9U A;  2L15 A;  1D6E C;  2CQA A;  2O2L D;  4BY1 H;  2VR1 A;  4ECV A;  3OTO L;  4ME3 A;  4KI0 A;  4R8I A;  3I55 A;  4A3J B;  5DLF A;  1PTO D;  4I55 F;  1HA5 A;  2JYO A;  3PO2 B;  1NMG A;  2L9H A;  1LT5 D;  1GXD C;  1B9N A;  1F2Y A;  1SLJ A;  2Q2I A;  3VR4 A;  2PQA B;  1GYF A;  1M1K C;  3AB9 A;  4KHP Q;  4R9W A;  1CQF A;  4GN5 A;  1IBK Q;  1QNU A;  2VQE L;  4OX9 H;  3QOL A;  3K5M A;  1L2F A;  4RH6 A;  5J2U F;  1PYW D;  1CTM A;  5KFX A;  1E2V A;  1YNJ C;  4CKB A;  5KGU A;  5KND A;  1YZ6 A;  2CQO A;  4A3D G;  4RB3 C;  1IL2 A;  2RQX A;  1KNA A;  2A8V A;  2UVR A;  4JV2 A;  2YYA A;  4DV1 Q;  1QUQ A;  4LAA A;  4UHV A;  3R5X A;  5J22 A;  2TSS A;  4YR2 A;  5EKL A;  4LFA L;  1F9R A;  4R8U A;  4A3I H;  1ZHS A;  2YU9 A;  5KNC A;  4HTH A;  1NNX A;  1VBG A;  4XQN A;  1BKB A;  1PH7 A;  4A3E H;  1UNN C;  3CCQ A;  1ZHQ A;  2ZM6 H;  5IYC G;  3RD4 A;  1O75 A;  4O3P A;  4RFB A;  2WAQ G;  1UE1 A;  1TY2 A;  5IGG A;  2WIN B;  4DR4 L;  3J81 c;  5LMN H;  2F0I A;  1TWG A;  4LF5 L;  2K5N A;  3CPW A;  1PFM A;  5C0X H;  1VF7 A;  3PVX A;  2IL8 A;  3TDQ A;  1YHQ A;  4RZR A;  4PNY A;  1X3F A;  4B3M L;  3KAJ A;  3N44 B;  5NUC A;  2R92 B;  1I3Q B;  3QR8 A;  4I7A A;  3K5I A;  3RZO H;  1I50 H;  1HQM C;  2XGP A;  3K57 A;  1I50 A;  2Q8I B;  4NB3 A;  4H13 C;  1IW7 C;  1L1O A;  1OWT A;  3UQ8 A;  4YY3 Q;  1RKN A;  3DWP A;  2F0D A;  3GTQ A;  2RGV A;  1XNQ H;  4UAI A;  1CSP A;  5M5Y H;  2WAQ A;  3W1B A;  2F0V A;  4MV4 A;  1B8A A;  3S16 B;  3GQC A;  4OIJ A;  2IW3 A;  1A0I A;  5IY0 A;  2K75 A;  4J6H A;  1RK5 A;  1GOZ A;  2FHT A;  1C3O A;  4DKA C;  3HOX H;  2R7Z G;  4N8X 1;  4LMQ D;  3R5H A;  3L4J A;  3OSN A;  3UDX A;  4ZI7 F;  4KJO A;  3PSI A;  2RDJ A;  1WOC A;  1VQ4 A;  5JVL A;  2PQA A;  3FMA A;  3RNU A;  3PMF A;  3IN5 A;  4JI2 Q;  1T9H A;  3GIM A;  5H1S E;  4KTA A;  1RJP A;  1P8L A;  2B29 A;  2LSS A;  2C5C A;  3M3Y B;  3GIP A;  2SNM A;  5IP7 H;  5GAH C;  1YNN D;  4A3I G;  3HOX G;  2R7Z H;  2F0K A;  4K0K H;  1KBL A;  3PW5 A;  4X66 Q;  4RUC A;  3OUU A;  1ESF A;  4V19 0;  2YRX A;  5JEA H;  3VR5 A;  5CV5 A;  5LP6 F;  3RBE A;  1GJX A;  1HPC A;  4JI6 L;  3PR4 A;  1MHW C;  5G3L F;  3N52 A;  1FGB D;  3RLN A;  2PW7 A;  2I80 A;  2WE6 A;  3JSL A;  1TKW B;  3K58 A;  5K2M A;  2R6F A;  1STY A;  1XNR L;  2R7D A;  2FPP B;  4AQY L;  4A3D B;  4QWB A;  3J80 c;  1I7L A;  4F8M A;  2B8F A;  3I7F A;  5IOD A;  1D1I A;  4A93 H;  2E2J B;  1HUN A;  4AYB G;  5IGE A;  5M5X H;  1K0S A;  3DEO A;  3G6X A;  2X0S A;  4B3M Q;  4M1U B;  4RGO S;  1BCP B;  2CKZ B;  4PMB A;  4UFZ A;  2B2Y C;  4EYI B;  4YHH L;  3GTG H;  3PO3 B;  2JJQ A;  2L11 A;  3GV3 A;  3I90 A;  3CCJ A;  2F4I A;  3KLS X;  5EBD A;  3F2D A;  4X64 Q;  3NBH B;  3KF6 B;  1K83 B;  2IT1 A;  5I2Y A;  4DR5 L;  2J6T A;  1HZB A;  4EBD A;  1HQR D;  1I4R A;  5M3F H;  4DUY Q;  2A5H A;  4E6I A;  4JI0 Q;  1OXU A;  4DR3 Q;  4DR6 L;  2E5L Q;  4ECW A;  2K32 A;  2HQE A;  2C35 B;  3A74 A;  3E0J A;  1GSA A;  4IJL A;  4C3H B;  2VOB A;  4ED8 A;  2RDI A;  1STG A;  5DG7 A;  4DV0 L;  1N34 Q;  4KY6 A;  3M85 A;  2F03 A;  3L2P A;  4KHZ A;  3JAM E;  2B2W C;  3S1R H;  2XD4 A;  1SYC A;  1JCK B;  2K03 A;  3HKZ E;  5EDW A;  4ZHQ F;  2A1A A;  4H0L C;  4WJW A;  1JJC B;  3DM3 A;  4RGN A;  4K2L A;  2IHF A;  3OMC A;  1EHI A;  4JYA H;  3Q23 A;  1GHK A;  1PH4 A;  4FF3 A;  1TWC H;  2CH4 W;  3VYT A;  3CCS A;  1MSG A;  3K0X A;  5GON F;  1J5E Q;  3HOW H;  4AH6 A;  2R87 A;  5LMN L;  2EIF A;  3BAB A;  2WV6 D;  1JLL B;  1EWC A;  5IT9 L;  3L0O A;  4DAY B;  4H7B A;  3H15 A;  2BA1 A;  2ZM6 L;  1CT1 D;  3IG0 A;  4J9M A;  3GTJ A;  4LSA A;  4FS2 A;  3I72 A;  2Q2T A;  5EGT A;  2NU9 B;  2PI2 E;  4NXN L;  5GQO A;  2BR0 A;  5HV6 A;  4DR4 Q;  3EN2 A;  4A3G H;  3PGZ A;  4DR1 L;  5LOV F;  1N56 A;  4IHJ F;  1QZH A;  4IUQ A;  4DR6 Q;  4XIG S;  1KJQ A;  3OTO Q;  5IGC A;  1WH2 A;  1VQ5 A;  2VW9 A;  3MR2 A;  3W5O A;  4GKK Q;  4P75 A;  3S1N H;  2R7F A;  1SYB A;  1XNR Q;  1HNW Q;  3HOW G;  1GHJ A;  4J9S A;  1S5E D;  3NTI A;  4O4H F;  4MNO A;  3PF5 A;  2KQ3 A;  1TR5 A;  4R4T A;  1A2U A;  1GM5 A;  3KF6 A;  3R23 A;  3WNZ A;  3RTX A;  2JA6 B;  4EEQ A;  3I4N G;  1VQL A;  5KT6 A;  5FKA C;  4PZ8 A;  2HCI A;  3R2I A;  5C1P A;  1SYD A;  3TSS A;  2UVU A;  3VA5 A;  4J9Q A;  3NWT A;  2XNA C;  3MA2 B;  2XVS A;  2G5D A;  3BVG A;  1I94 Q;  4MV9 A;  2NUA B;  4JI8 L;  2WKC A;  5HBR B;  1ET6 A;  4GC7 A;  1X55 A;  5COR A;  5EKK A;  3N42 B;  4BY7 H;  1FJG H;  4HR7 B;  4FNF A;  4EQP A;  3ICE A;  3S17 B;  4EFB A;  1B3Q A;  2ZJP A;  1SE4 A;  3P75 A;  1E0B A;  4WJ4 A;  1I4P A;  2B2V A;  4DL6 A;  4HYK A;  1O78 A;  3RZD B;  2KHI A;  1NUC A;  4A3E B;  2K05 A;  4MV7 A;  2W9C A;  3Q24 A;  3SK4 A;  2CCZ A;  2K28 A;  5DM6 3;  3GII A;  3GTO B;  1I4H A;  3M4O B;  1KLU D;  3GQB A;  3BVM A;  1RYR A;  4Y8V B;  1VQG A;  4ZKB B;  4BBR G;  2R92 A;  2EYO A;  5CC4 A;  1S03 G;  4XYO A;  1EU3 A;  1I50 B;  4ECY A;  4OWX B;  3D31 A;  1I5F A;  3UDI A;  3V4S A;  1AN7 A;  2CQY A;  2FP4 B;  2JEI A;  1OO9 B;  1RHP A;  5CAE B;  4LF6 L;  1S3O A;  4X62 Q;  1M7J A;  1VQO A;  3CCV A;  4ZLT F;  4U6P A;  2UUC L;  2UU9 Q;  5FLM G;  3KHG A;  1ILQ A;  1U4L A;  1EIF A;  4OIK A;  2VQD A;  4RAY A;  5H80 A;  3DEP A;  2G9H D;  3RUP A;  5K5P A;  3T51 B;  1HNX H;  4JI7 Q;  2WB1 B;  2OXP A;  3Q22 A;  4FF2 A;  3BA9 A;  1YVC A;  1ZKO A;  1K1S A;  5GAE C;  1K8M A;  4OO1 I;  1JJ2 A;  3RN2 A;  4GOP A;  5M5W H;  1HA6 A;  2NN6 G;  4A3J G;  5DGB A;  3OW2 A;  5IP7 G;  1UEB A;  4A3C H;  5IGD A;  1Z2O X;  2KEN A;  4MIU A;  4EQ5 A;  3M3Y H;  5KG6 A;  4HJ9 A;  2OLS A;  3K81 C;  1I94 L;  4WBN F;  2YTY A;  2R7M A;  3MTS A;  5KFV A;  3K3P A;  4ABN A;  4DR1 H;  2B2U A;  1Q12 A;  1GO3 E;  4B08 A;  2KVM A;  3NQT A;  4CGY B;  1WCM G;  1JOQ A;  5C0X J;  1SNO A;  5EWF A;  1LTR D;  2EE1 A;  1M90 C;  4ZQ3 A;  3NE5 B;  3U9S A;  4J9K A;  1KEE A;  4DR1 Q;  5IWA Q;  2VUM H;  5C4H A;  5E4X A;  4OL7 A;  1B6R A;  1BXT A;  3OPO A;  4XYM B;  4ZQI A;  4IRK A;  1ENA A;  4JK1 C;  1GUS A;  2MPM A;  4DV1 H;  2I87 A;  5T14 A;  1EQR A;  2ZDG A;  2KUM A;  3CCL A;  1IKM A;  1RJR A;  2JEB I;  2MO1 A;  3BJU A;  2YTX A;  2UXB L;  3A8J E;  2Z0S A;  4IN3 A;  5KKN B;  2HVS A;  2D0P A;  4JI4 Q;  1MJC A;  3GD7 A;  5DAU A;  4DR7 Q;  2EJM A;  1QVG A;  1JXL A;  2KCN A;  4KHP H;  4DAV A;  3CF5 A;  4DV2 L;  3S2D B;  2AU0 A;  5LMN Q;  1WD0 A;  1I6U A;  4CBV A;  1YJ9 A;  1CZG A;  2VA2 A;  4J9N A;  5LYJ F;  2W6P A;  4GNX B;  2QGQ A;  4JI2 L;  3WWV A;  3TS0 A;  3BDO A;  3PR5 B;  1A6X A;  1B50 A;  3E0E A;  1Y69 U;  2JA8 H;  3DHQ A;  3GO5 A;  3SK6 A;  4FVM A;  1K73 C;  2WB1 A;  3PW2 A;  2NN6 H;  3H0G B;  4GLX A;  4IUV A;  2XRQ D;  5EPK A;  1HHV A;  1YNN C;  1PH6 A;  4K0K Q;  4QWD A;  2C2R A;  5FK9 C;  1XPU A;  2VNU D;  4G7Z C;  4K5V A;  1NBW A;  1PLF A;  3CRK C;  3S9W A;  5BR8 H;  3S1Q H;  1SYE A;  3BYT B;  2AMC B;  2N8N A;  3E5N A;  2KOL A;  1O7Y A;  5JPN C;  4R4O A;  3TEH B;  4QJF A;  1N33 H;  4BS9 A;  3I91 A;  4Q43 A;  1MKH A;  4MV6 A;  2V4D A;  2ASL A;  3NWS A;  1DZ1 A;  5IP9 H;  4BBS H;  3CCM A;  4ZOL F;  1EY9 A;  2Q2U A;  3I3C A;  4TRD A;  2K5V A;  4K5W A;  4LFC L;  1JIH A;  5LHY 1;  5C3E G;  4I65 A;  1TWA B;  5CR3 A;  1PZI D;  4L5Q A;  3PN1 A;  2VPS A;  2IA6 A;  2J6U A;  1AEX A;  1L0X B;  3EVQ A;  5JH7 F;  4J1M A;  1STA A;  3R8B A;  2Q8R E;  4Q0Y A;  4X3K A;  2ATW A;  5IYD G;  1HNZ Q;  2FXQ A;  1FD7 D;  4I50 F;  2A74 C;  1Z6H A;  4LW1 A;  5T1I A;  4JCV E;  1Q46 A;  3GTJ B;  2GPW A;  3J81 i;  4TV8 F;  2F0U A;  4CDD C;  1VQ6 A;  5F9N A;  5LMU H;  1FYC A;  2W6O A;  1ROD A;  2NYZ D;  1PTO F;  1D5X C;  2QEJ C;  3W1G A;  1HNZ H;  1KAW A;  1S68 A;  2B8G A;  5J39 A;  1DCZ A;  4A3G B;  3TRZ A;  1TY0 A;  4LF4 L;  4C5B A;  5L9X A;  4K0K L;  1V51 A;  2XSC A;  2E2I H;  3KF8 A;  3EIV A;  4NW2 A;  1TA8 A;  1STE A;  4JBW A;  2W6Q A;  4UCT A;  4RKB A;  1HUM A;  1LV9 A;  4J9O A;  4DUY H;  3U58 A;  1G6Z A;  3OUZ A;  3S2H B;  1SND A;  2MGS A;  2OT2 A;  2CH4 A;  1IYU A;  4JV1 A;  1H9S A;  2K1B A;  5KYI A;  1ZEQ X;  2A6H D;  2QA4 A;  3LGJ A;  1XDN A;  3FKI B;  3CKI B;  4MZ9 A;  3FPP A;  4QUC A;  1N36 L;  5A2Q E;  3WO1 A;  3C1F A;  4C3J H;  1JWS D;  4G4K A;  1AUV A;  1Y1V G;  2I07 B;  2HGS A;  2EY1 A;  1SDF A;  1F2Z A;  2KCC A;  1N36 Q;  3KUP A;  5BR8 Q;  3ERS X;  1E4E A;  1PTO H;  4DV2 H;  5D3D A;  4RA8 A;  2ZT9 C;  3KJO A;  5KFL A;  2UXD Q;  1GKH A;  3OYY A;  1K3R A;  3PQI A;  5C4J B;  1WTW A;  4IFD H;  1KAA A;  5IYB H;  4GS3 A;  2TMP A;  1W6J A;  3NPP A;  4PG3 A;  4OO1 G;  3PUW A;  3BQ2 A;  1QWY A;  4F4Z A;  1TWF A;  4Q8E A;  3X3N A;  2DN8 A;  4YJ2 F;  1SNM A;  2NU7 B;  4B3M H;  4HSV A;  2LFN A;  3CHB D;  1M4V A;  1WTV A;  1IBM Q;  2B63 B;  1ICF B;  4POG A;  2SDF A;  4WD3 A;  4X3T A;  3CQZ H;  1FKA H;  3E5S A;  3ERO A;  5KFY A;  4H02 A;  4CJ2 C;  2M05 A;  5C5M A;  4QWC A;  1SYG A;  1BCP F;  1WCM B;  3PF4 A;  1OTC A;  3OMG A;  5C6A A;  2AHO B;  2DJF C;  4DV4 H;  4JV5 H;  4XQJ A;  4HCE A;  2I46 A;  5D1O A;  1U4R A;  2QK4 A;  3KAK A;  1VDZ A;  3H94 A;  4DL2 A;  3GTL B;  2C28 A;  2YZN A;  4RWS C;  2NU8 B;  1TWH A;  4UCS A;  4MA0 A;  3J80 W;  4EBC A;  2F52 A;  1JOO A;  5C3E H;  4DV0 Q;  1N34 L;  1GD7 A;  1U4P A;  5CA1 F;  4C3J G;  1EYZ A;  3HKS A;  1STH A;  4MAM A;  1V1Q A;  1CK1 A;  2GVA A;  4A3D H;  1JOR A;  4LF4 Q;  3FMC A;  3MXN B;  1RJT A;  3TN2 A;  1MSH A;  4O3R A;  1B4O A;  3MFG A;  1B70 B;  4O2D A;  3OTO H;  3TRE A;  4TUY F;  4DR5 H;  4GKK H;  4PZ7 A;  3MFI A;  4HED A;  3NK9 A;  4IUU A;  1PRT C;  2LXK A;  2CVR A;  4OWT B;  3AFQ A;  4X64 L;  1CA5 A;  5KT5 A;  1SN8 A;  3VYS A;  2JA5 B;  1E4E B;  1C48 A;  4FXG C;  4DUY L;  4RB1 A;  3BYY B;  1FGU A;  4DR5 Q;  2F0O A;  3GTM H;  4YHH H;  1SE2 A;  1TWF H;  4GNX C;  5FD6 A;  3Q8R B;  1KC7 A;  5HUR A;  3AMU A;  1SJE D;  2K04 A;  3G7L A;  3NXW A;  5JJK A;  5JAV A;  5JJL A;  1FVI A;  4EVO A;  1ML0 D;  2OCE A;  5L37 A;  4TQS A;  4OHJ A;  1ENC A;  2UXC L;  2VQF Q;  2B63 A;  4RCN A;  4TSS A;  1JB7 A;  4DV6 L;  4I7H A;  5LL6 b;  2UXB Q;  1E1T A;  5T1G A;  2XCA A;  2CWA A;  3U50 C;  1EIH A;  1HXY D;  2BQU A;  2O5J C;  4LFC Q;  2A68 D;  1X6O A;  2WTF A;  2Z6B A;  2E74 C;  4JG2 A;  4X66 L;  3TP7 A;  4QB4 A;  5C4X H;  3I4M G;  2BDN A;  1YNX A;  2NTT A;  2NUC A;  1SFO B;  3MR5 A;  4LFC H;  3MWE A;  5I6Y A;  1BF4 A;  2R93 A;  4Y7N B;  4P72 A;  3NHH A;  5KFO A;  4DV7 L;  5FPR A;  2F0S A;  1RD9 D;  4JI8 Q;  1N33 L;  1JIC A;  1HCZ A;  1F2L A;  3M9N B;  5EKI A;  2RBM A;  4O0A A;  1FJG Q;  3PO3 G;  3H09 A;  1KNE A;  1H95 A;  2FPI B;  3MFH A;  1R4Q B;  4FDB A;  4DV7 Q;  4YR3 A;  5KG1 A;  3I4M H;  4CC6 A;  4DXG A;  3K5O A;  4OEL B;  2Y0S E;  4JI2 H;  2Z4I A;  3CU7 A;  4R4I A;  2E76 C;  1M8A A;  1P16 A;  1Q1B A;  3KOJ A;  2A68 C;  3L9A X;  1CE8 A;  2Z6K C;  3C3L A;  5ELN A;  2SOB A;  3BQ1 A;  2OEO A;  4DL7 A;  3OIP A;  5ELE A;  3CMA A;  1KJ8 A;  2F0Q A;  2R8J A;  1XNQ L;  4JI7 H;  2DY7 A;  1D5Z C;  5EPL A;  1FNW A;  4ID6 A;  1AW7 A;  1EQQ A;  3CME A;  2ZM6 Q;  2OTL A;  3N6R A;  4QQB X;  4DNT B;  1B33 N;  1S97 A;  2RGR A;  3A56 A;  3KAL A;  1WTX A;  1YHA A;  1B04 A;  5D1P A;  3RAX A;  1S10 A;  4RNO A;  2LXJ A;  1X3G A;  3J81 E;  4DL5 A;  5KFF A;  3V05 A;  3ITP A;  2ZXP A;  4B3T L;  2YTV A;  2EYF A;  2J4X A;  3KLW A;  5I6W A;  1OXS C;  4DR4 H;  2B2T A;  3H4B A;  4DK1 A;  4O3N A;  2NVY B;  1YBY A;  5FLX E;  1KXL A;  3GTK H;  1HZ9 A;  1S0M A;  3KDF A;  4KJN A;  2MQH A;  1B7Y B;  1LLR D;  3TQ1 A;  2KHJ A;  3S14 H;  4B3S H;  3LP8 A;  4O3Q A;  2R93 B;  1HR0 L;  2ZXR A;  3K59 A;  3V96 A;  1YEZ A;  3ORQ A;  1NY4 A;  1UEA B;  4C1N K;  4LFB H;  3CC4 A;  2E2D C;  3J81 j;  1CS0 A;  3G6V A;  3ETH A;  4ZKC B;  1SRO A;  2PI2 A;  4K5X A;  1R9T B;  5BN5 A;  2F3W A;  2AQ4 A;  1EOV A;  3HP3 A;  5D65 A;  3EPG A;  2F4V Q;  2WYO A;  3JAM L;  1PHJ A;  4OGQ C;  1VQF A;  1CQJ B;  4LNQ A;  2FB9 A;  4ED1 A;  1SXT A;  3BG5 A;  4C3I H;  3N43 B;  3RLF A;  2EYM A;  4FYD A;  4HMJ A;  4UP7 A;  4N9T A;  4UP9 A;  1KRT A;  2N3S A;  1ZYR C;  3K5H A;  1X56 A;  1JDB B;  4QMG A;  5KT7 A;  3MEH A;  1L1O C;  3SGI A;  2JA6 G;  5KFH A;  2AQ2 B;  2JN4 A;  3ZYY X;  1A9X A;  3GLK A;  4YCW A;  4LF6 H;  1LT3 D;  3A54 A;  3V6K A;  2L4N A;  5BMV F;  3SXH A; 
#chains in the Genus database with same CATH homology
 1HNW Q;  3TQY A;  3HOW G;  2BH8 A;  2N78 A;  2ZJQ A;  2JA9 A;  5BR8 L;  4MNO A;  5GRO A;  3PF5 A;  4A75 A;  1GM5 A;  4R4T A;  3KF6 A;  3I4N G;  1VQL A;  4UP8 A;  4YWK A;  4X65 L;  1PH1 A;  4PZ8 A;  1HNW L;  3PO2 G;  4IPC A;  3HOU H;  4OWW B;  4A3L G;  1VQM A;  2E2H H;  1EUJ A;  1Y1W H;  1I94 Q;  1I3Q H;  1PFS A;  4YCV A;  4JI8 L;  2NVQ H;  4DR2 L;  3S17 H;  4R4Q A;  5ELO A;  1IBM L;  1ASZ A;  4LF8 L;  1X55 A;  1Y1V H;  3T1Y L;  2I5L X;  3AQQ A;  4DV6 Q;  1XPO A;  4BY7 H;  1AH9 A;  3ICE A;  3CXC A;  3T1H Q;  2WB1 E;  2ZJP A;  2XGT A;  5E7N A;  1UE5 A;  4LF9 L;  4WJ4 A;  4HJ8 A;  4LUZ A;  1IYJ B;  1VQI A;  2KHI A;  4MTN A;  1VQN A;  4IFD G;  1JT8 A;  5JEA J;  2JK8 A;  4JC0 A;  4LFB Q;  1EWI A;  3K7U C;  2KCT A;  4GKK L;  3M4O H;  2AWO A;  2RF4 A;  2CCZ A;  1BBU A;  4BY1 G;  3AEV A;  4BXX G;  1A62 A;  3CC2 A;  4QGU A;  1JJG A;  1VQG A;  3EBE A;  4BBR G;  2VUM G;  1SMX A;  3M4P A;  1KQS A;  4GKJ L;  4RMF A;  2UU9 L;  2UUC Q;  2R92 G;  3TS2 A;  4IFD I;  4OWX B;  3D31 A;  3PUV A;  5M3M G;  1I5F A;  2MO0 A;  3UDI A;  5IT9 c;  1WFQ A;  4R4C A;  4R1J A;  2UXB L;  2RHQ B;  3JAM c;  3FKI G;  4LF6 L;  3K8A A;  1S3O A;  4X62 Q;  4LF7 Q;  1OXV A;  4A3G G;  1Q1E A;  1VQO A;  3CCV A;  3BZC A;  1C9O A;  1CKO A;  4JI0 L;  4JI3 L;  1HNZ L;  1VQC A;  1UWV A;  2UUC L;  2UU9 Q;  4JV5 L;  5FLM G;  1VCI A;  2MFI A;  4A93 G;  4DPG A;  1XMO L;  1EIF A;  4L5S A;  4A3L H;  1CKN B;  1X3E A;  2WP8 J;  3T1Y Q;  2B63 H;  1Q82 C;  4JI7 Q;  4Y52 H;  1W3S A;  3NEM A;  3K7A H;  4IJH A;  4DV2 Q;  4JV5 Q;  1YVC A;  4YY3 L;  4ALP A;  4XTC S;  3T1H L;  1QZG A;  2N49 A;  2XTI A;  3PV0 A;  5GAE C;  1XMQ L;  4B3S Q;  4OO1 I;  1VQB A;  1NMF A;  4IPG A;  3RN2 A;  1JJ2 A;  2RHS B;  4GOP A;  5M5W H;  3BU2 A;  2E8G A;  2NN6 G;  4A3J G;  2CWP A;  4HIO A;  3OW2 A;  3PUX A;  1UEB A;  5IP7 G;  2ES2 A;  4A3C H;  1W2B A;  2KEN A;  4EQ5 A;  4BBS G;  3M3Y H;  4HJ9 A;  1PYB A;  3K81 C;  1BVS A;  1I94 L;  2IHE A;  4P73 A;  2YTY A;  2B63 G;  1OXT A;  5IE8 A;  1LYL A;  1Q12 A;  1GO3 E;  2Y0S G;  5IWA L;  3A5U A;  3S16 H;  4B3R Q;  1WCM G;  2E5L L;  5C0X J;  4GN3 B;  3JC6 6;  4OX9 L;  3PIO A;  4HIM A;  1S40 A;  4IFD J;  4A76 A;  1M90 C;  4DR2 Q;  4JYA L;  2JQO A;  1AE2 A;  4DR1 Q;  5IWA Q;  2K5H A;  1QVC A;  4BBR H;  5C44 G;  2VUM H;  4DV4 Q;  1SRU A;  1U5K A;  3FP9 A;  2KCM A;  3S1M H;  1Z47 A;  3GTJ H;  2IY5 B;  3GTP H;  2UXD L;  2PNH A;  1YIT A;  3M7N A;  5M3M H;  2D62 A;  1C7Y A;  5IYB G;  1EQR A;  3I4O A;  2IX1 A;  3CCL A;  2R92 H;  3S15 H;  3L7Z C;  1G51 A;  2ZTC A;  2NVY H;  1N33 Q;  2JEB I;  2MO1 A;  5AJ3 Q;  4JI6 Q;  3BJU A;  1JE5 A;  1KRS A;  2VS1 A;  2YTX A;  1PH9 A;  2Z0S A;  3E9I A;  4LWC A;  3CC7 A;  2D0P A;  2JA5 H;  4JI4 Q;  1MJC A;  3F8T A;  3GD7 A;  3UE1 A;  2F4V L;  4DR7 Q;  1XMQ Q;  4A3E G;  1QVG A;  3PUY A;  4B3S L;  3G6E A;  1HZC A;  1TXY A;  3CF5 A;  4IPD A;  4DV2 L;  2E2J H;  4BA2 I;  3CAM A;  1V9P A;  5LMN Q;  2PMZ E;  1RL2 A;  3RR5 A;  3RN5 A;  1EYG A;  4JOI C;  1VS0 A;  1YJ9 A;  1N9W A;  3KJP A;  1VQ8 A;  3M4Q A;  3CPF A;  4GNX B;  2JEA I;  2QGQ A;  4JI2 L;  4IOA A;  1YJW A;  3WWV A;  3J7Z C;  3TS0 A;  4DR7 L;  2IX0 A;  3E0E A;  2NVX H;  2JA8 H;  3GO5 A;  2HIX A;  1K73 C;  1PH8 A;  1FL0 A;  2CFM A;  4HID A;  4GLX A;  1PH6 A;  1VQH A;  4K0K Q;  1XPU A;  5J3B A;  2VNU D;  4GOP B;  1O7I A;  5IP9 G;  1NBW A;  3D0F A;  4JI1 L;  3HOZ H;  3HKZ G;  4A3C G;  1HH2 P;  3ULJ A;  3S1Q H;  2AMC B;  2N8N A;  1E22 A;  2UUA L;  2ZTD A;  2DGY A;  3G48 A;  4R4O A;  5IYC H;  3TEH B;  4QJF A;  3UDG A;  1KD1 C;  4JI7 L;  1NTG A;  1MKH A;  3STB D;  1HZA A;  5IP9 H;  4BBS H;  3CCM A;  1UE6 A;  2Q2U A;  1XJV A;  5DLQ E;  2K5V A;  4LFC L;  3KFU A;  3I4N H;  1AE3 A;  1WI5 A;  2WB1 G;  5C3E G;  2Z6K A;  4IPH A;  1YI2 A;  1A8V A;  2VY3 A;  4NPS A;  1Y1W G;  2OQ0 A;  1IBL Q;  1K8A C;  4L5Q A;  2HHH Q;  4LF9 Q;  2UUA Q;  2EQS A;  4YWL A;  1TWA H;  4BA1 I;  1DGS A;  2NZO A;  4AYB E;  5EAY A;  4X62 L;  4LF7 L;  2KBN A;  2UUB L;  1I6H H;  2HIV A;  3ULP A;  2ATW A;  5IYD G;  1HNZ Q;  1EIY B;  2FXQ A;  3F2B A;  4LFA Q;  1OXX K;  5C4X G;  4LW1 A;  4RG1 A;  1D8L A;  1N32 L;  4JCV E;  1KHI A;  4YWM A;  3F2C A;  1Q46 A;  5JEA G;  4A3K G;  3HOV G;  3J81 i;  1VQ6 A;  4YCU A;  2BH2 A;  1HR0 W;  3W1G A;  4LFB L;  1K0R A;  3HFZ B;  1PH2 A;  1NJI C;  1KAW A;  2OWO A;  3FHW A;  4GLV B;  3TRZ A;  1N32 Q;  4LF4 L;  3VDY A;  3CCE A;  4K0K L;  1VQA A;  5FJ8 G;  1Q81 C;  4DV3 Q;  2E2I H;  3EIV A;  1CKM A;  2HT1 A;  4JBW A;  4KHP L;  4X6A H;  1E24 A;  2F3I A;  1EFW A;  1SR3 A;  1A63 A;  2NN6 I;  3U58 A;  5LMN W;  1HJP A;  4JI4 L;  3RZD H;  4DUZ L;  4GNX A;  4NXM L;  3S2H H;  2H5X A;  3FKI H;  4APV A;  2QA4 A;  3U4Z A;  3LGJ A;  1ASY A;  3E9H A;  4MZ9 A;  4DV1 L;  2HQL A;  4LUO A;  1N36 L;  3UE0 A;  1G29 1;  4OX9 Q;  4C3J H;  1YIJ A;  3UDF A;  2YYZ A;  1VQD A;  3K80 C;  3KYH C;  1Y1V G;  3H0G H;  1D7Q A;  3AFP A;  4GOP C;  3PIP A;  3HOU G;  1X9N A;  1IXR A;  4NXM Q;  1SE8 A;  1N36 Q;  5LMU Q;  5BR8 Q;  3Q8D A;  4DNI A;  3ERS X;  1N8R C;  2R6G A;  4OON A;  1L1O B;  2JA5 G;  3KJO A;  1X65 A;  4DK6 C;  2UXD Q;  2V1C C;  3HOY H;  1GKH A;  3OYY A;  1FJG L;  1K3R A;  2JA7 H;  5IYB H;  4GS3 A;  4PG3 A;  4OO1 G;  3PUW A;  3H3V H;  1K9M C;  1MIU A;  4HIK A;  3H3V I;  4BY1 H;  2L15 A;  1VQK A;  2ASB A;  5LMU L;  3PO2 H;  3OTO L;  4ME3 A;  4KI0 A;  3I55 A;  1S72 A;  1IBM Q;  1VQP A;  1YJN A;  4POG A;  4A3J H;  2DUD A;  4A3K H;  3HOV H;  1NMG A;  3J80 i;  2Q2I A;  1XTD A;  1SLJ A;  3CQZ H;  1WYD A;  2PQA B;  1M1K C;  4B3R L;  4KHP Q;  1Z9F A;  4H02 A;  2JA7 G;  4GN5 A;  1IBK Q;  4HJA A;  5IYD H;  1Q8K A;  2VQE L;  3AYH B;  3PCO B;  2QEX A;  3PF4 A;  4JBJ A;  1L2F A;  1OTC A;  4UPA A;  3HOZ G;  1IBL L;  2HHH L;  2AHO B;  1LTL A;  5HGQ A;  1Q86 C;  1YZ6 A;  2CQO A;  4A3D G;  1IL2 A;  2A8V A;  1LUZ A;  5FLM H;  1QUQ A;  4DV1 Q;  1PA6 A;  1J5E L;  1JMC A;  4LFA L;  2GVB A;  2I5H A;  4A3I H;  3G4S A;  2F52 A;  1BKB A;  1PH7 A;  4A3E H;  5JJI A;  3CCQ A;  5C3E H;  4A3F H;  5IYC G;  4DV0 Q;  1N34 L;  1GD7 A;  3PUZ A;  1CKN A;  1C0A A;  2WAQ G;  1KL9 A;  1UE1 A;  2JA6 H;  3HKS A;  2I5M X;  4DR4 L;  3I2Z A;  1V1Q A;  4DV3 L;  3J81 c;  2GVA A;  4A3D H;  4LF5 L;  2K5N A;  3CPW A;  4LF4 Q;  3MXN B;  4JBM A;  4HJ5 A;  1YHQ A;  4JI3 Q;  1J6Q A;  1X3F A;  1TWG H;  1B70 B;  4O2D A;  4TQU S;  4IOC A;  3U4V A;  4B3M L;  3TRE A;  3NEL A;  4GN4 B;  4PZ7 A;  5HY6 A;  3RZO H;  1I50 H;  5FLX c;  2LXK A;  2OQK A;  3AFQ A;  2D0O A;  4OWT B;  4X64 L;  1V43 A;  1SN8 A;  4NB3 A;  2ZJR A;  1L1O A;  4DUY L;  2WFW A;  4YY3 Q;  1FGU A;  1NE3 A;  4DR5 Q;  4J15 A;  3GTM H;  3S2D H;  5M5Y H;  1CSP A;  5C44 H;  1TWF H;  4GNX C;  3W1B A;  1B8A A;  2K14 A;  1GVP A;  3RLO A;  1LM0 A;  1PH3 A;  2B3G A;  2JE6 I;  1A0I A;  5JJK A;  3CP0 A;  1FVI A;  2K75 A;  5IY0 A;  4AQY Q;  1HNX Q;  5JJL A;  4UY8 C;  4C2M H;  5M3F G;  2OCE A;  5GAG C;  1VQ7 A;  4DKA C;  4YHH Q;  3HOX H;  2VQE Q;  2R7Z G;  2VQF Q;  2UXC L;  2GN5 A;  1JB7 A;  2R93 G;  3UDX A;  4DV6 L;  3PSI A;  3GTO H;  2UXB Q;  1E1T A;  3A5Z B;  1WOC A;  2CWA A;  1L0W A;  2PQA A;  3U50 C;  1VQ4 A;  3RNU A;  1MJE A;  3J7A 5;  1K8G A;  4JI2 Q;  1T9H A;  4LFC Q;  1X6O A;  3ZJY C;  5H1S E;  4JG2 A;  1PH5 A;  1QVF A;  2A19 A;  4X66 L;  3GDE A;  1P8L A;  2B29 A;  2LSS A;  4AIM A;  5C0X I;  1YHB A;  5IP7 H;  5GAH C;  3KDF B;  1WJJ A;  5C4X H;  3I4M G;  2YV5 A;  4X65 Q;  4A3I G;  1YNX A;  4JYA Q;  3HOX G;  2R7Z H;  2R93 H;  1QUQ B;  4OXP A;  2ID0 A;  4L5R C;  4X66 Q;  1IBK L;  1SFO H;  2K50 A;  1BBW A;  4P72 A;  1UE7 A;  1E1O A;  1PV4 A;  3IRB A;  4DV7 L;  4JI8 Q;  1N33 L;  4Y7N H;  1U0L A;  2AKW B;  5C0X G;  4LF8 Q;  5AJ3 L;  4JI6 L;  3ER0 A;  4O0A A;  1FJG Q;  2Q2H A;  3PO3 G;  1PYS B;  1H95 A;  2ALY B;  3RLN A;  1E3P A;  1X54 A;  4DAM A;  4DV5 Q;  4FDB A;  4DV7 Q;  4LUV A;  4PMW A;  2I0Q A;  1CSQ A;  1XNR L;  2R7D A;  2NZH A;  2K4K A;  4AQY L;  1HNX L;  4KLK A;  3I4M H;  3J80 c;  2K52 A;  3I7F A;  4A93 H;  1Q7Y C;  4QL5 A;  4AYB G;  5M5X H;  2UXC Q;  2Y0S E;  3ULL A;  1E7Z A;  4R4I A;  3A0J A;  4DUZ Q;  4IO9 A;  1P16 A;  1Q1B A;  4A3B G;  3KOJ A;  4B3M Q;  2Z6K C;  2VQF L;  5ELN A;  3PO3 H;  4EX5 A;  2CKZ B;  3S24 A;  3GTQ H;  3CMA A;  4YHH L;  3GTG H;  1XNQ L;  4NXN Q;  2JJQ A;  3MEF A;  4L5T A;  4BXX H;  1EQQ A;  4B3T Q;  3CME A;  2ZM6 Q;  3H0G G;  2OTL A;  4QQB X;  3CCJ A;  1K83 H;  3F2D A;  4POF A;  4X64 Q;  3NBH B;  3KF6 B;  1YHA A;  4A3B H;  3M9B A;  2IT1 A;  2LXJ A;  4DR5 L;  1PVO A;  1HZB A;  4JOI A;  1X3G A;  3CD6 A;  4DUY Q;  2VZA A;  1RIP A;  5M3F H;  3HOY G;  3CCR A;  4JI0 Q;  1OXU A;  4DR3 Q;  4JI5 Q;  1XMO Q;  4C3H H;  2E5L Q;  4DR6 L;  4WJ3 M;  1IZ6 A;  4GLA C;  2YTV A;  4A4I A;  2C35 B;  3A74 A;  4B3T L;  2JA8 G;  3KLW A;  1OXS C;  4IJL A;  4P71 A;  1YBY A;  2VL6 A;  1HR0 Q;  3GTK H;  1HZ9 A;  1KXL A;  4DV0 L;  1N34 Q;  4LF5 Q;  1G6P A;  3KDF A;  3M85 A;  1XPR A;  5FJ8 H;  2OTJ A;  2MQH A;  1B7Y B;  3L2P A;  4KHZ A;  3NEN A;  1KC8 C;  3S1R H;  4P74 A;  1KIX A;  2KHJ A;  2UUB Q;  3S14 H;  4BY7 G;  4DR3 L;  5C4J H;  3HKZ E;  4JBK A;  2BA0 A;  1HR0 L;  2A1A A;  4GKJ Q;  1JJC B;  3B6Y A;  3DM3 A;  1YEZ A;  1NY4 A;  1R9T H;  2IHF A;  3CC4 A;  3J81 j;  4DK3 C;  3BZK A;  1VQ9 A;  1Y14 B;  1CUK A;  1SRO A;  2PI2 A;  1TWC H;  4QIW E;  3CCS A;  1PH4 A;  4JI1 Q;  1EOV A;  2F4V Q;  3K0X A;  1J5E Q;  2WAQ E;  3HOW H;  3G71 A;  1PHJ A;  4AH6 A;  5K36 G;  1VQF A;  3I56 A;  5LMN L;  2EIF A;  2NVT H;  4LNQ A;  4A3F G;  4C3I H;  4A3M G;  1XNQ Q;  2AWN A;  3RLF A;  3CCU A;  3L0O A;  3STB C;  5GAD C;  3JAM i;  4QY7 A;  4DAY B;  3H15 A;  2BA1 A;  2ZM6 L;  4HJ7 A;  4LF6 Q;  1WCM H;  4UP7 A;  2Q2T A;  2PI2 E;  3F1Z A;  2N3S A;  4UP9 A;  5GQO A;  1KRT A;  4NXN L;  1X56 A;  1VQE A;  3CW2 C;  1VQJ A;  3EN2 A;  4DR4 Q;  4A3G H;  3PGZ A;  4DR1 L;  2ZTE A;  4A3M H;  4DV5 L;  2RCN A;  1L1O C;  4JI5 L;  3SGI A;  1QZH A;  4PZ6 A;  2JA6 G;  4XIG S;  4DR6 Q;  4TVA B;  2MNA A;  3OTO Q;  3GTL H;  3DLL A;  3KF8 B;  2VW9 A;  1VQ5 A;  3W5O A;  4YCW A;  4GKK Q;  4P75 A;  2YU9 H;  2EXD A;  2R7F A;  3S1N H;  4DV4 L;  1TWH H;  1XNR Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...