2R93G

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
total genus 25
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r93G01
1CUKA 4IPHA 3RLNA 3NENA 2B63H 4R4TA 4LFCQ 4PMWA 3HOXH 2F52A 4QJFA 3CCJA 3T1YQ 4YHHQ 4DR4Q 2ZTEA 4LFCL 4GOPC 2FXQA 1UE7A 2OTJA 2RCNA 1JT8A 3T1YL 2K5NA 2ALYB 1M1KC 4DR4L 4JI2L 2D0PA 4LUOA 1HR0Q 2JA5H 3CD6A 3A0JA 1AE2A 4IPGA 1N8RC 1N9WA 2PI2A 1AH9A 4GNXB 4B3MQ 4NXNQ 1G6PA 3PV0A 3I55A 2KCTA 3ER0A 1HR0L 2VQFL 1LYLA 1J6QA 4DUYQ 3J81j 2NVXH 3EBEA 3CMAA 4DUZQ 1XMQL 4B3ML 4XTCS 4AQYQ 1A0IA 5ELNA 3HOVH 3NBHB 4DUZL 3TRZA 1H95A 4AQYL 3I4OA 4BY1H 1E7ZA 1G291 2NVQH 4UPAA 4R4CA 2I5LX 3K8AA 4DV4Q 2MFIA 4A3KH 5C3EH 1K3RA 1VQOA 1G51A 4EX5A 4JC0A 1VQPA 1NJIC 2R7ZH 4DV4L 1SN8A 1VQLA 1YITA 3ERSX 5C44G 3J7A5 1EIFA 3G48A 5LMNQ 3RN2A 3B6YA 2IY5B 2QA4A 3A5UA 1OXXK 3Q8DA 4YWMA 2JQOA 3LGJA 5LMNL 3KF8B 1S72A 3EIVA 5FJ8G 2EIFA 1VQ8A 4JI6L 2IX1A 4JBMA 4IOAA 4B3TQ 3GTLH 2KHIA 3ULLA 1L1OC 4PZ8A 4BBRG 3M4OH 4DK6C 5M3FG 3FKIH 1IZ6A 4C3JH 1PH7A 2Z6KC 4B3TL 4DV2L 1PH4A 4GKKQ 3KLWA 1MKHA 1Q81C 1IBMQ 2UUBQ 4BBSG 1Y1WG 1JJGA 1YHAA 4QIWE 2KCMA 4HIOA 4IO9A 4GLXA 1VQFA 4JI0Q 2PMZE 1IBML 1A62A 4QY7A 3AYHB 4JI0L 1KQSA 4JI4L 1Q12A 4JI8L 3PSIA 1IBLQ 1TWFH 3BZCA 3CXCA 1VQ9A 3STBD 3HOYH 4UY8C 4JBWA 4X6AH 1YZ6A 3GTGH 2N78A 4DAYB 1QVCA 1KHIA 1E1TA 1GO3E 4JI5Q 1WI5A 1U0LA 2XGTA 4P75A 3I56A 4AYBG 3CCMA 4JI5L 1EYGA 4A3DH 1KAWA 2DGYA 1LTLA 3PUVA 5IYDG 1HJPA 3M9BA 3AEVA 1FL0A 4A3JH 4MZ9A 3CC7A 1YVCA 4DR1Q 1HNWQ 1I50H 4LF9Q 3PO2G 2Q2HA 2JA9A 3PIOA 4DV7Q 3DM3A 5E7NA 4DR1L 2JE6I 3TS0A 1XMOQ 1HNWL 2R92H 3A5ZB 4LF9L 3F2DA 1N34L 2QGQA 2VL6A 4DV7L 4A76A 1K73C 4DV1L 5GAGC 1VQDA 3HKZE 2N8NA 1K0RA 4UP7A 3CCVA 3I4MH 2LXJA 4POFA 1PYSB 3UDGA 4A93G 5BR8Q 1CSQA 3PUZA 4P72A 4FDBA 2JJQA 1YIJA 2B63G 1NMGA 1YI2A 2IHFA 4C3IH 5BR8L 4IFDG 3J7ZC 1D8LA 1K8GA 4BXXH 5EAYA 3HOXG 3JAMi 2ZJQA 1CKOA 2WB1G 2CQOA 1S40A 4LF6L 4LUVA 4DR7Q 3S1MH 1JJCB 2D0OA 1BKBA 3HKZG 3CC2A 3GD7A 4O0AA 1PH2A 1L2FA 3KJOA 2JA5G 1IXRA 5IYCH 4GN4B 1Q86C 5GADC 2JA6H 3I4NH 4DR7L 2UXCQ 5IYBH 4J15A 1EUJA 4DPGA 2UXCL 1VS0A 2EQSA 4JI4Q 4JI3Q 1WOCA 2BH2A 4A3MH 3J80c 1EQRA 4OXPA 3HKSA 3PO3G 4A3CG 1TWAH 1NE3A 3GDEA 1YJ9A 2ZJPA 1MIUA 4IPCA 4JI3L 2AMCB 1X9NA 1KC8C 1PV4A 3FP9A 1X54A 4LF5Q 4WJ3M 1I6HH 1CKMA 3L0OA 1PH1A 4LF5L 4A3KG 1TWHH 1J5EL 1XPUA 1VQHA 5C3EG 4HJ9A 1VQ7A 2R7FA 4C3HH 2R7ZG 3U58A 1S3OA 3PUWA 4HJ8A 3D31A 2OQ0A 4PZ7A 2RHQB 3UDIA 3CPWA 4DR5L 3F2BA 3S17H 3BZKA 4IPDA 4KHZA 3KJPA 1PYBA 4H02A 4JI2Q 3WWVA 1KIXA 1B70B 2JEAI 1Q82C 2GVBA 1HZBA 1XJVA 1SLJA 4A3IH 1VCIA 4GNXA 4OWTB 3CCSA 4B3RL 1WCMH 1P16A 2E2JH 1QZGA 2VQFQ 4LF8Q 1HNXL 1OXVA 2VY3A 1XMQQ 4B3SQ 3KOJA 3FKIG 4BY7H 5ELOA 1WYDA 4L5TA 3GTJH 4HJ5A 4X66Q 4LF8L 1RL2A 3F2CA 1K8AC 4B3SL 3S1NH 2VNUD 4QL5A 2MQHA 4EQ5A 2OQKA 3TREA 2B3GA 4X62Q 4X66L 4BY7G 3M3YH 4WJ4A 5JJLA 2HT1A 5M3MH 1A8VA 4X62L 1OXTA 3OTOL 3M85A 1XPRA 1EQQA 1VQ6A 2VUMH 4R4OA 3HOYG 4R4QA 2K4KA 3F1ZA 3ULJA 1BBUA 3KF6A 2RHSB 1UE6A 4BA2I 2RF4A 3RLOA 2UU9L 4JCVE 1VQBA 3KF6B 2F3IA 3RNUA 1PA6A 1V1QA 4JI6Q 4LUZA 2CWAA 3HOUH 4A3DG 1KXLA 4JI1Q 1X55A 3K80C 4DV2Q 2R7DA 1E22A 4JI1L 5JEAJ 3G4SA 2EXDA 1C9OA 1GD7A 4P74A 2GVAA 3MEFA 1EIYB 3D0FA 2YYZA 1I5FA 2CKZB 3CMEA 2ES2A 2JA8H 4K0KL 1HH2P 4AYBE 3UE0A 2R92G 2WFWA 4JI8Q 4RMFA 1ASYA 1QZHA 1KRSA 1EWIA 1N33Q 2V1CC 2ID0A 2YTXA 3I4MG 1YHBA 3I2ZA 4RG1A 1XNQQ 5GQOA 1SMXA 2VS1A 4YWKA 1XNRQ 3IRBA 1N33L 4A3BG 1PVOA 1Y1VH 1XNQL 5J3BA 1XNRL 4DV3Q 4DR3L 4A3EH 1WJJA 1OTCA 3OYYA 3GO5A 2K14A 3CW2C 2F4VQ 1PFSA 1V43A 4GS3A 2K5HA 2AWOA 3NELA 5H1SE 5LMUL 4DV3L 2MO1A 2NZOA 3I4NG 5C0XJ 4GNXC 1JMCA 3AFQA 1VQKA 1YJNA 2B29A 2F4VL 4JV5Q 4OWWB 4AIMA 2PQAB 3TQYA 4DV0L 4JV5L 4OONA 4P73A 5IYCG 3UDXA 2JA6G 4XIGS 3SGIA 4HIKA 5JJIA 1N34Q 5IYBG 1U5KA 2A19A 3S14H 4DV1Q 2UXDL 4OWXB 1UWVA 4IOCA 2N3SA 1W2BA 4JBJA 1Q1BA 3F8TA 3HOWH 1JB7A 2WB1E 2JK8A 1P8LA 2CCZA 2DUDA 3U4VA 1X6OA 2VW9A 5C4JH 4TVAB 2CFMA 1HNZQ 1WFQA 1C7YA 4DAMA 5FJ8H 2H5XA 3OW2A 1HNZL 1N32L 2KENA 2E5LL 3GTPH 2E2IH 3K7AH 2WAQE 4JOIC 3S24A 2YTVA 3A74A 4C2MH 1HZCA 4NPSA 5M3FH 2OCEA 3CCEA 4JG2A 4GOPB 5C4XH 4LF6Q 4LNQA 4QQBX 3J80i 1Y1WH 1JJ2A 1E24A 1TWCH 4A3IG 4HIDA 4ALPA 1WCMG 5IP7H 5M5XH 4MTNA 2YV5A 3W1BA 3M4PA 1GVPA 3ULPA 2UUCL 1X3EA 2Y0SE 4DR2L 1YHQA 3J81c 5DLQE 4YWLA 1E1OA 2UUAL 2CWPA 3S1QH 2WP8J 4MNOA 2N49A 3ZJYC 2WAQG 2AKWB 4A3LH 1MJCA 3PF4A 4JI7Q 1Q8KA 2HQLA 2LSSA 1J5EQ 5M5YH 2UXBL 1X65A 3GTOH 3S2DH 4BY1G 1VQMA 2ZTDA 4GLVB 2ATWA 4JI7L 3HOVG 5IYDH 4X64L 3STBC 5FLMH 2VUMG 4LFBL 1HZAA 3RLFA 3GTMH 4DR5Q 4O2DA 1VQAA 4KHPQ 1HR0W 1BVSA 3S2HH 1RIPA 1HZ9A 1PH9A 2Y0SG 1YEZA 4AH6A 3S15H 4KHPL 4X65Q 2XTIA 3BJUA 2K50A 4GKJL 1I3QH 2L15A 3HFZB 3UE1A 4B3RQ 4LFAQ 1YJWA 1VQGA 1HNXQ 4X65L 5M5WH 5IP9H 2PI2E 4UP9A 1QUQB 3W1GA 4LFAL 2HIXA 4A3FH 2NZHA 3RR5A 5GAEC 4QGUA 4POGA 2JA8G 1OXSC 1Z9FA 2AWNA 2R93H 2K75A 3H0GH 1CKNA 3BU2A 3OTOQ 4APVA 2A1AA 2AHOB 1PH3A 4TQUS 1EFWA 3L7ZC 4R4IA 5LMNW 2OWOA 1CKNB 2IHEA 2K5VA 2K52A 3CPFA 2E8GA 4UP8A 1GKHA 3U4ZA 1C0AA 1Q46A 3MXNB 2KHJA 5C0XI 1Y1VG 2QEXA 3AFPA 2UU9Q 2BH8A 4YCUA 5JEAG 4YHHL 1YBYA 1V9PA 1X56A 4A3EG 3L2PA 5IT9c 4GN3B 4A3GH 1X3FA 4JOIA 3CP0A 1VQ4A 3PGZA 3G71A 4PZ6A 3PO3H 4HJAA 4A3CH 4NXNL 3TS2A 1VQIA 3PIPA 4A3JG 3KFUA 1SE8A 1UEBA 2IX0A 3UDFA 4DUYL 4K0KQ 1FVIA 2NN6I 3CAMA 3HOZH 3KDFA 3S1RH 2JA7G 3H3VH 1IYJB 4HIMA 3E9HA 5HY6A 1OXUA 3RN5A 1SFOH 5JJKA 2NVYH 3PUXA 3KDFB 4DV6Q 1Q7YC 1W3SA 1O7IA 1KRTA 3HOWG 1PH8A 3CQZH 3M4QA 1IBKQ 4GN5A 4DV6L 4GLAC 5C0XG 3CCRA 1PH5A 2Q2TA 2ZJRA 3M7NA 3PCOB 4DR3Q 5IY0A 1IBKL 1FJGQ 3ICEA 3K81C 1XTDA 1PH6A 3PUYA 2I0QA 3GTQH 2R6GA 5LMUQ 4IJLA 3K0XA 1NBWA 1FJGL 1M90C 1E3PA 1AE3A 4KI0A 4LWCA 4R1JA 4DNIA 4OX9Q 4DV5Q 2JA7H 4A3BH 5C4XG 4BXXG 2PQAA 2NN6G 2ASBA 1NMFA 2C35B 4DV0Q 2NVTH 1K83H 4DV5L 4OX9L 2ZTCA 1B7YB 4GKKL 2E2HH 3AQQA 3RZDH 2IT1A 3FHWA 5IP7G 1GM5A 2UUBL 2VZAA 5GAHC 2ZM6Q 2UXDQ 2Z0SA 1VQJA 4LF4Q 1SRUA 5FLXc 2ZM6L 1CSPA 1LUZA 5IE8A 3CC4A 3CCUA 4LF7Q 1FGUA 4A3MG 2YTYA 1IBLL 4A3LG 4NB3A 4LF4L 1Q1EA 4LW1A 4JBKA 5C44H 3G6EA 1XPOA 4PG3A 3E9IA 1MJEA 1KL9A 4LF7L 1UE1A 1A63A 2YU9H 1B8AA 4ME3A 2I5HA 1N32Q 1X3GA 2JEBI 3CF5A 2E5LQ 4IFDI 4A75A 5FLMG 4GOPA 2HIVA 3KYHC 4BBRH 3JC66 1I94Q 3J81i 4DR6Q 5IWAQ 1IL2A 1L0WA 4BBSH 1VQCA 3VDYA 1I94L 2MO0A 4OO1I 4L5QA 4DR6L 4YY3Q 5IWAL 4Y7NH 1VQEA 2KBNA 1XMOL 1UE5A 4P71A 5IP9G 3DLLA 4DR2Q 5AJ3Q 2UUCQ 2UUAQ 2BA1A 1EOVA 4YCVA 5GROA 4DK3C 4YY3L 4A3FG 4L5RC 5AJ3L 1ASZA 1VQNA 4Y52H 2R93G 3CCQA 2Q2UA 3H0GG 1KD1C 1BBWA 3H3VI 3RZOH 2UXBQ 1SR3A 2PNHA 3T1HQ 3PF5A 4X64Q 1Z47A 4LFBQ 1SROA 2I5MX 3H15A 3E0EA 2BA0A 1R9TH 1QVGA 1LM0A 2VQEQ 1TWGH 3NEMA 5M3MG 2Q2IA 3T1HL 1N36Q 3I7FA 2OTLA 1NTGA 4HJ7A 2D62A 1DGSA 1QVFA 3GTKH 3CCLA 2VQEL 5HGQA 1N36L 4NXMQ 4GKJQ 4BA1I 2MNAA 4OO1G 2GN5A 3EN2A 3PO2H 4A3GG 1NY4A 1T9HA 1L1OA 4NXML 4IFDJ 3S16H 3TEHB 1D7QA 1QUQA 2Z6KA 3JAMc 3HOUG 5K36G 1L1OB 1YNXA 3K7UC 4KLKA 4JYAQ 4A4IA 2HHHQ 3W5OA 1TXYA 2A8VA 1VQ5A 3HOZG 4DKAC 4JYAL 1PHJA 2HHHL 4IJHA 1JE5A 4A93H 2LXKA 1Y14B 3U50C 4YCWA 1K9MC 4L5SA
chains in the Genus database with same CATH superfamily
2B63H 5KFEA 1SAPA 4JK1C 4R4TA 3JAML 4YP3A 1BO0A 2F52A 3OIPA 2ZTEA 1EYAA 1PX2A 3Q2OA 2K5NA 1STAA 2PNRC 2JA5H 3GV8B 3A56A 1AE2A 1GXDC 1XX8A 4G57A 2IW3A 4A3BG 2FMMA 3I55A 3ER0A 2R8IA 2VQFL 1LYLA 4G7HC 2NVXH 1F77A 2FK1A 1Y1VB 1KDBA 5IGDA 3EJIA 4XTCS 1A0IA 4AQYQ 1Q3LA 3NBHB 1CA6A 3HP3A 4JI2H 4AQYL 3I4OA 2A73B 3DUZA 2GLTA 1B9NA 2NVQH 2I46A 2FLNA 4UPAA 2I5LX 4DV4Q 2MFIA 1TIID 4CKCA 1VQOA 1GYFA 2R7ZH 4DV4L 5KT5A 2O5IC 2BOSA 2LKVA 3ERSX 1JC7A 2IY5B 1LTRD 5EQ0A 3RN2A 2UVVA 3D4WA 2RKSA 4DUZH 1OXXK 2IPKD 2R7LA 2DJGC 5I2YA 2QYZA 1STBA 4ZRZA 3X3MA 4PZ8A 3M4OH 5KFKA 3TSSA 3G6VA 1SNPA 2Z6KC 4HCSA 4O2BF 2DNCA 3KLWA 2UUBQ 4BBSG 1IOVA 2W6PA 1YHAA 1YNJC 2HDLA 1LABA 1TS3A 4ZI7F 1IOWA 5LMNH 2PMZE 3VA5A 2P5ZX 1ESFA 3AYHB 2KHSA 1Q12A 5FD6A 3PSIA 1YNNC 2V4DA 5C4XB 3GV5B 3HOYH 2AUJD 2PZTA 1CHQD 3R8BA 4B3TH 3BVZA 3I73A 1SMYC 2MGSA 3D4RA 5CV8A 2KQ3A 3K5OA 2YS7A 4IRCA 4JI5Q 2WDTA 2ICIA 4CKBA 1U0LA 3Q8QB 4AYBG 3VR4A 1W93A 3CCMA 4QWAA 4JI5L 5G3LF 2DGYA 1LTLA 4O3OA 1L0XB 3TP8A 4Q8FA 5KFIA 1HTLD 3CC7A 4ME6A 1IHZA 3V05A 3EPIA 2AGOA 4ECRA 4WORA 2JE6I 4TRDA 1VMPA 5JQWA 1JICA 1Z2OX 1W6KA 1N34L 2QGQA 1S4ZA 1VQDA 3S2HB 3SK5A 2B8GA 1ZXTA 2LXJA 4U6PA 4N9TA 5KG6A 3VYRA 5COYA 1NAPA 3T5LA 1EYZA 4P72A 4DR1H 1EUDB 1HNWH 4J9PA 1YIJA 2VPSA 3J7ZC 1QWYA 3BABA 1K8GA 4O4IF 4BXXH 2K32A 3HOXG 1K28A 3R5FA 3QZ8A 1O78A 2ZJQA 1CKOA 2WB1G 1IKMA 4DR7Q 5EGTA 2GA4B 4O1NA 1RDPD 3PIP3 2JA6H 4DR7L 2R3ZA 2HVQA 4R9WA 1STNA 4IRDA 1FD7D 2YCHA 2WIIB 2BH2A 1IL8A 4OXPA 1XTCD 5LYJF 4PNYA 1TWAH 4IUTA 1GUNA 1X9NA 1PV4A 1SJHD 3FP9A 1X54A 3K59A 4RGTA 4A3GB 4UCVA 2IP4A 3R23A 2ALZA 4A3KG 4RKBA 2B2YA 1VQ7A 1H9MA 4WBNF 4G7OC 1CZGA 1S3OA 4HJ8A 3D31A 3UDIA 1M0WA 5L1JA 1WR2A 4FBTA 3F2BA 4DAPA 1LTBD 4JI2Q 3GLKA 1FGBD 2X6LA 2K33A 2NVYB 5JH7F 2PBZA 1XJVA 4Q0FA 4A3IH 1HCZA 4LF5H 4OWTB 1PRTF 2E2JH 2Z1CA 5CV9A 4RNNA 1HNXL 2VY3A 2I8CA 4JV1A 4B3SQ 3KOJA 3FKIG 2KECA 4L5TA 1QCBD 2FHTA 3F2CA 4IUVA 1K8AC 4QL5A 4B3SL 2VNUD 1A9XA 3Q23A 4ED0A 1HFGA 4WJ4A 1M6VA 2F0QA 5IIFA 5M3MH 3HOVH 1OXTA 1XPRA 2PPBC 2K4KA 5KG5A 2LS01 2NVTB 1UE6A 1T36A 4RB1A 3RUPA 1TS2A 4BA2I 2RF4A 4EYIB 4JCVE 3J7YW 5KFLA 4DU9A 2C2DA 2EYMA 1V1QA 4QW8A 3KBXA 4B9WA 4A3DG 5FLXE 3ITPA 4JI1Q 1KXLA 3OTOH 1X55A 1S0NA 4C5CA 3CKIB 4R8IA 5KFMA 3HGBA 4JI1L 1M0TA 4P74A 2YU9B 1EIYB 3D0FA 2YYZA 3BVMA 2IJ0A 4K0KL 2O4XA 4MA0A 4AYBE 2SEBD 2WFWA 4CC6A 5BN5A 1QZHA 3TDQA 1N33Q 4M7EA 2R84A 4O3RA 1SE3A 2EPBA 5FKAC 2F0TA 2W6QA 2VS1A 1N33L 4YQWA 1Y1VH 1K8MA 4FF2A 4XYOA 4DV3Q 1AEXA 1WJJA 2B2VC 1KEEA 3CW2C 1PFSA 1V43A 4GS3A 5LMUL 4DV3L 3Q24A 2M05A 2NZOA 1IKLA 3RTXA 4HNVA 1LTAD 3DXJC 1JMCA 1I4GA 5I47A 2OEOA 5L1KA 1S5BD 3N6RA 3RZOB 1SYDA 1TWGA 1XNRH 3SDZA 4P73A 5IYCG 2EE1A 5JJIA 4UCRA 2EYPA 3MR5A 5D8DA 1TWGB 1O7ZA 3TZUA 3J7AV 4OWXB 2N3SA 4JBJA 3FEWX 1G2SA 3F8TA 2WB1E 1JR0D 3BG5A 2F4VH 1I3QA 3PO2B 3V6KA 4EQNA 3S16B 1WFQA 1C7YA 2UXDH 5KFSA 2ZM6H 4KV6A 3S24A 4C3HG 3M9OB 2A5HA 5DGAA 4GOPB 5C4XH 4ECQA 4Q0YA 2OXPA 4HIDA 4ALPA 1WCMG 5EWEA 3RAXA 4MTNA 3GV7B 2RDIA 3HKZA 4BS9A 4BY7G 5J1ZA 1E1OA 3T5JA 1KTKA 2QW7A 3BQ2A 2WAQG 2AKWB 3DM1A 3HKZB 1SE2A 2ASDA 3DWPA 3MXGA 4BY1G 1VQMA 2E2DC 2HJWA 4YY3H 2VUMG 5FLMH 2W6ZA 1MZBA 4N9PA 5DLFA 1HR0W 1KLGD 3S2HH 1S97A 1RIPA 5I2XA 4J9MA 2Y0SG 3TQTA 2IMWP 4BY1B 4X65Q 3BJUA 2A68C 2K50A 3HRZC 3BQ1A 2BDOA 3PN1A 3U9SA 3V96A 4DXFA 4X65L 1Z2PX 4RZQA 4LFBH 5J2TF 2FMCA 1I4QA 1TY0A 3WDNA 2KCNA 5JJZA 5GAEC 2JA8G 2AWNA 2CH4W 3G8CA 3K5HA 2DWCA 4GKJH 3OOCA 5LHY1 4U673 3I12A 1PTOB 1Z7TA 3OTOQ 2AHOB 2L12A 2ENBA 3L7ZC 4R4IA 2OWOA 3FPPA 3CPFA 4CDDC 3QWNA 4UP8A 3M9NB 4C3JB 4CGYB 2C22A 3R3OA 4CHTB 2BH8A 4YHHL 2QK4A 1X56A 3VMMA 4GN3B 4S3SA 2RDJA 4A3GH 1X3FA 5JOBA 3K5IA 1VQ4A 1TWFB 3IKJA 3PGZA 2EYFA 3SEBA 5C4HA 3OSOA 5KG0A 1SE8A 4DUYL 1O80A 5AFWA 4ETSA 4RNOA 3A7LA 3H3VH 2JN4A 1XXGA 5HY6A 1AW7A 1OXUA 2NVYH 4MAMA 4ZUJA 5EDWA 1ZYRD 4FU0A 1W3SA 2NTSA 1V1PA 3MWMA 4LSAA 4GN5A 4GLAC 4NLGA 1PH5A 2Q2TA 2R92A 3M7NA 4BWSC 5IY0A 5L37A 3ICEA 5FLXW 3O13A 1CQFA 2R92B 3K0XA 1GSAA 4ED8A 5CAEB 1W6JA 2RDGA 2ZT9C 4C3IG 4IUNA 5H80A 3I4MB 4DNIA 2PQAA 2B8FA 1EY6A 2NVTH 1V51A 2ZTCA 1STGA 3K57A 3OIQA 3AQQA 2IT1A 4C3IB 4EVOA 2UXDQ 3X3NA 2ZM6Q 2W8KA 1FJGH 3I70A 3GTKA 2R61A 1A2TA 4LF4Q 5FLXc 2ZM6L 4LF7Q 1ICWA 3CCUA 3GV3A 4A3MG 5D1OA 1TVXA 5DG9A 4LF4L 2L55A 1GSOA 4LF7L 4DV5H 2JEIA 1KL9A 1A63A 2YU9H 5D1OB 1X3PA 1JLLB 3A8IE 1D5XC 1AZPA 4A3MB 3J80E 2HIVA 3KYHC 4KD3A 5FLXL 3JC66 2XIWA 5LL6X 2VXWA 1N56A 3MXPA 1T94A 1I6HB 2B63A 3WO0A 4L5QA 5T1IA 4YY3Q 2KBNA 1BXRA 3DLLA 4P71A 2F1MA 4K14A 4YY3L 1B6RA 4CC5A 4QF4A 3KHHA 3BG3A 1GSHA 1RYSA 3R2IA 1LLRD 3VR2A 4JVZA 2FPPB 1ZKOA 3RZOH 4ED1A 1I94H 2E76C 1SR3A 3V4ZA 4U68A 3NK9A 1JB3A 2NVXA 1Z47A 5HURA 4LFBQ 1SROA 2I5MX 2KVMA 1QVGA 1LM0A 1TWGH 1EY9A 5E1FA 1N36Q 2D62A 1AP0A 2EYOA 1EY4A 1Z2NX 4I7ZC 3CCLA 1N36L 3BYYB 4H0LC 4GKJQ 2NB0A 3M3YB 3MVVA 3PO2H 2K7VA 4FS1A 1T9HA 5BR8H 1U4MA 2R7ZA 3S16H 3TEHB 1D7QA 4ECSA 1QUQA 1O75A 4K2KA 4EQOA 5K36G 1TXYA 1I4XA 3HOZG 4TQSA 4ECYA 4DKAC 4MV1A 1Y8OB 4IJHA 1JE5A 1F2LA 2ICEC 1RODA 1FNVA 1CUKA 4IPHA 3RLNA 3D6WA 5KFAA 5C5LA 2CW8A 3PVXA 1RJQA 3M9MB 1FNWA 4LFCQ 3DF7A 5LP6F 2F0OA 4PMWA 5KX5F 5L1IA 4CJ1B 4V190 4LFCL 2FXQA 2Q8TA 2RCNA 3KHLA 1JDBB 4OHJA 1WTWA 2R8KA 5J2UF 1JOQA 5DEHA 4GNXB 1J8IA 1G6PA 2JA7G 1J6QA 4EBDA 5FK9C 1TY2A 3MTSA 3CMAA 1QE6A 3QOJA 2AU0A 1JQYD 2W57A 5KFNA 1H9SA 5DAUA 4A3EB 3MC0B 3T51B 2W8LA 3CHBD 3OPOA 3NWTA 4BY1H 1G291 3G7LA 2JEJA 2VB2X 3CRLC 1C4QA 3NXWA 4HQ6A 1K3RA 4FF4A 3Q8RB 2VQFH 3MFYA 1F2ZA 1VQLA 5KFBA 1SYFA 4APMA 5C44G 3G48A 2EY5A 2FKLA 2TMPA 3A5UA 3SE7A 4YWMA 2R8JA 3TN2A 1RHPA 2JQOA 3LGJA 4XYQA 5KFWA 3KF8B 1S72A 1KLUD 3SE0A 2L9HA 3DEOA 1VQ8A 1PTOH 2IX1A 1EY5A 3HOWB 1L1OC 4BBRG 2WACA 1GGOA 5C4JB 1CS0A 1IZ6A 4C3JH 4KN7C 4HAEA 1IBMQ 3RMHA 4DA2A 1Y1WG 4JI0Q 2XRQD 1VQFA 3E5NA 2E2IB 1IBML 1A62A 4QY7A 4FF1A 4JI0L 1OWTA 2M00A 2EVBA 4JI8L 1M4VA 4DAYA 1TWFH 3CXCA 1GUTA 5JVLA 1CA5A 1E0BA 1Y1WB 4UY8C 2N78A 2JA6A 2BQUA 1SNDA 1TWCB 4DAYB 4MV3A 1QVCA 4H44C 1GO3E 4JUZA 1B3AA 2F0DA 2XGTA 3VR6A 3I56A 1GUSA 1TWAA 2XWJB 4O3QA 3S1QB 1HTPA 2RA4A 3T56B 3PUVA 5IYDG 1EYGA 4QUCA 3M9BA 3T5KA 3UQ8A 3GTOA 1TWAB 3D8GA 3H09A 5A35A 2ZDHA 2C28A 3L3OC 3FDSA 3TIGA 3IG0A 4LF9Q 3GILA 2PO4A 2MJ8A 3GTOB 3E6ZX 3S2DB 2PZWA 1BNZA 1ZHSA 3DM3A 3OMGA 3TS0A 2XGQA 2R92H 2PMZB 1S5FD 3A5ZB 2F3VA 3I4LA 4LF9L 5FD5A 4JI5H 1L2ZA 1K73C 5GAGC 2F0FA 1K0RA 3I4MH 3RAQA 4XX0B 2J6UA 1DXMA 5KG2A 4JV5H 3A55A 2X6GA 4POFA 2KOLA 2Z4IA 4A93G 5BR8Q 4J9RA 5IGBA 3J80W 4QB4A 1I6UA 1XWEA 4FDBA 2JJQA 1W96A 5JAVA 4C3IH 5BR8L 3GIJA 1N34H 1PK8A 2VUGA 3C1FA 1BCPB 2RSNA 3QB3A 1G6ZA 2Z8LA 2R93B 2CQOA 2FMAA 4LF6L 4LUVA 5FO8B 1JJCB 1CTMA 1I4RA 5KIXA 3L4KA 3T5HA 3JSLA 3KJOA 1IXRA 1Q86C 1LACA 5IYBH 5KFOA 1AFPA 1ZEQX 1T3NA 1VS0A 4JI4Q 2HCIA 4HMIA 4A3MH 3J80c 3MR3A 4J8QA 1EQVA 4DL6A 2V5AA 4JI4L 1MIUA 4WJ3M 3L4JA 2VA2A 1I6HH 3SR1A 3L0OA 4DR7H 1J5EL 2F0JA 1XPUA 2FK2A 1LT3D 1Q8IA 2EJMA 5C3EG 3SVMA 3PUWA 3J80L 2JXMB 2OQ0A 2RHQB 3CPWA 3S1RB 2W9BB 1HA5A 3BZKA 4KTAA 4K5WA 3WWVA 1KIXA 1B4OA 5KFCA 2XD4A 3HEJA 1HZBA 1EY7A 1EEFD 4B3RL 1QZGA 2VQFQ 3T13A 1Y1VA 1OXVA 5D1PA 1JKJB 1EY8A 5ELOA 3NBHA 5CMDA 4HR7A 1RL2A 5JVH3 1PZKD 1HHVA 5KT6A 3H91A 3K5MA 1PMRA 2B3GA 2MPMA 3M3YH 4HR7B 4I7AA 2C2EA 5JJLA 2EDGA 5JPMC 2W9AA 1WSCA 4A3BB 1A8VA 1VBGA 3KHGA 1HNXH 3ULJA 3F1ZA 1BBUA 3KF6A 2L4NA 4UCSA 3L9AX 4ME5A 4B3SH 2DLNA 1MSHA 5FPRA 2UU9L 3H4BA 1VQBA 2A6ED 2SDFA 3KF6B 2F3IA 5EKIA 3V2TA 1ESRA 2CWAA 4ED6A 3PIO3 1DJRD 5DGBA 3A7AB 4KY5A 1A3VA 1E22A 2XCPA 2M9VA 3CMEA 2ES2A 1O7YA 1DOMA 1S5CD 4TUYF 1KBLA 3BAAA 2I80A 3KLSX 4CDCC 1PDQA 5J39A 4YIJA 2ID0A 5KT4A 1QNKA 3ETJA 2PYKA 5KNBA 4RG1A 1BR9A 3UI2A 5I6WA 1XNQQ 1ONLA 4JI1H 4YWKA 2B2YC 3IRBA 4JV2A 3H3VC 4BBSB 3PW5A 5JEAH 2A6HD 1XNQL 4K0KH 2F0SA 4A3EH 1OTCA 5JVG3 3OYYA 2K14A 4E6IA 4IWYA 2WV6D 5H1SE 3HBLA 2MO1A 1WTHA 4PDBA 4DLKA 1Y69U 3AFQA 1VQKA 4JV5Q 3QFFA 4OWWB 1A2UA 1TA8A 1N33H 4QIWA 3TQYA 4JV5L 5BN3A 4OONA 1KAAA 1R4PB 2F0WA 3UDXA 4HIKA 3NBIA 4AYBB 2A69C 1N34Q 3VYSA 4QIWB 5LMUH 4DV3H 1U4PA 3V6JA 2BE5C 2XSCA 3HOWH 2JK8A 1P8LA 2CCZA 2B2TA 2PW5A 5C0XH 3T53B 2VW9A 5C4JH 4TVAB 4ZKCB 4QCLA 1L0YB 1C8CA 1N32L 2V9WA 2E2IH 5KFRA 4JOIC 2YTVA 2NTTA 1HZCA 4NPSA 1JWMD 2OCEA 3CCEA 4KN4C 4QQBX 2NN6H 1JOOA 1Y1WH 3N8DA 3NGDA 2EOTA 2DPIA 1TWCH 3NTIA 5IP7H 3CVZA 4IR1A 4OGQC 4FXKC 2YV5A 2K28A 4EGJA 1GVPA 4DL2A 4L1KA 3HOXB 3G6XA 3S1QH 1YHQA 1II3A 4F4ZA 4YWLA 2UUAL 2ATLA 2CWPA 2WB1B 2N49A 3ZJYC 4A3LH 4DAVA 4FBUA 5I9PA 3PF4A 1RCVD 4Q5VA 3PR4A 1WD1A 4JI7Q 2BQRA 1IYUA 1SYBA 3GTOH 3S2DH 2ATWA 4JI7L 5IYDH 3OSPA 4X64L 3STBC 2FPGB 4OIJA 1SBBB 2C2RA 2FFKB 3UFXB 3TZDA 2NVYA 4FF3A 1UUPA 4RU9A 1TS5A 4AH6A 2XTIA 1I7NA 2YRWA 5IGFA 2YZMA 4A3KB 4LFAQ 4YR2A 2XCAA 1HNXQ 1U4LA 2PW7A 5IP9H 3JZIA 4NW2A 4ECWA 4LFAL 2KEEA 1YNND 3HG9A 1JORA 1CE8A 1RTOA 2F0EA 4RGOS 4POGA 5EBDA 5IGEA 2R93H 2FPIB 2K75A 4YJ2F 3ETHA 3PMFA 3FKIA 2HVRA 4FYDA 4ABNA 4GC7A 4EFEA 4Z9CB 5LMNW 1JDEA 4X65H 3EFXD 1JT8A 4FS2A 4O3NA 4ECUA 3U4ZA 4QWBA 3FKIB 1C0AA 1Q46A 5TSSA 1F9SA 2NU9B 1LTID 4YCUA 2XCLA 1HFNA 3P75A 1V9PA 3BVGA 1RJPA 4FXDA 1EWHA 1PTOF 1AUVA 4JOIA 3N43B 4C5AA 4RA8A 4HJAA 3GIIA 3GTGB 4NXNL 3GQBA 3TS2A 2YU9A 2IX0A 4K0KQ 2I87A 1C48A 4YHHH 2CVRA 1KDCA 3MEHA 3I91A 3S1RH 1HUNA 3D3RA 5KFUA 1SEIA 4O42A 4A3DB 2CW7A 1I4HA 1STEA 1LTGD 4DV6Q 1I50A 1HR0H 4RUAA 1PRTC 4DV6L 1I50B 3CCRA 4DUYH 5EPLA 1HPCA 1GOZA 2IA6A 1DZ1A 3PUYA 4LH6A 1SSOA 5KFQA 5LMUQ 2WTFA 3ND8A 1G91A 4IR9A 1E3PA 1EFID 4R1JA 4A3BH 4N8FA 4RGNA 1EZ1A 3N40P 4G4KA 5G3LD 2NU7B 2ASBA 2J6TA 3H6MA 1S5DD 1B7YB 4GKKL 4EYHB 3C0FB 2Q8RE 3FHWA 1PTOC 1SRUA 1H9KA 2XGPA 1MBYA 3RUZA 1FGUA 2D2CC 1BOSA 1IBLL 3C2PA 4NB3A 1MJEA 3EA6A 3E9IA 3FRPB 4I4TF 1ICFB 4K5VA 2I5HA 1WTRA 1X3GA 5C3WA 5CB4F 4IFDI 3OWFA 3S1NB 4I50F 4J0MA 4M1UB 4GOPA 1CZWA 1UEAB 3MR2A 5F9LA 4LF4H 2R85A 3J81i 3K5LA 5IWAQ 1IL2A 3TP7A 4LF7H 4BBSH 3P1HA 4OO1I 4ECVA 1TWHB 1S10A 3VYTA 3KAKA 5IWAL 4C3HB 1XMOL 3W2DA 2BA1A 1EOVA 3EVQA 4DK3C 4FVMA 3K58A 4A3FG 2EYHA 4Y52H 5CV5A 4Q8EA 2Q2UA 3H0GG 1WD0A 3MFHA 1WTXA 2PNHA 1WCMB 5D65A 3T1HQ 4O3SA 2WKDA 3PF5A 2WAQA 3LWEA 3D6CA 3H15A 2BA0A 1R9TH 4BY7B 3T1HL 1JJGA 2XC9A 2AQ4A 3GTJB 1NTGA 3TP5A 2WAQB 3TBIB 1QVFA 5L9XA 5HGQA 1TS4A 3I90A 2MNAA 2VUMA 4OO1G 2GN5A 3QJYA 2L0CA 3C3LA 1H9RA 4IFDJ 4EEQA 2XWBB 5CV4A 2VUMB 2Y0SA 3MA2B 4YJ3F 1AN7A 3K7UC 1YNXA 4KLKA 4JYAQ 1V1OA 3GQCA 3GP7A 3W5OA 5IT9E 2A8VA 2Y0SB 1N36H 5LOVF 2VA3A 4JYAL 2CQAA 1PHJA 3KBGA 1ZETA 3Q8SB 4L8JA 4YCWA 1K1SA 4ECZA 1MI2A 4IHJF 3NENA 4ZUIA 4BWGB 1KJ9A 1RTNA 1M8AA 3KXYT 3HOXH 3CCJA 3T1YQ 2JA8B 4YHHQ 4JPBW 4DR4Q 3QZ7A 1UE7A 1WTQA 1WTPA 5CV7A 5JPNC 3T1YL 1E2VA 2ALYB 1M1KC 4DR4L 1EUCB 3PZPA 1TWFA 1ENCA 4OEMB 1HR0Q 3A0JA 4IPGA 1V4YA 2BR0A 1N9WA 2PI2A 2UVRA 1AH9A 4B3MQ 2FLPA 2PZUA 2KCTA 4KHVA 1HR0L 3OUZA 4DUYQ 1SYGA 3VA7A 3J81j 3EBEA 1ILPA 1XMQL 1PLFA 4B3ML 4OELB 5CORA 3MWDA 4LFCH 4YBZB 5ELNA 4IRKA 3SHLA 1TKWB 2VB3X 2DNEA 3T4AC 5A2QE 1H95A 1VKZA 5C3XA 4R4CA 3K8AA 5ISRA 4A3KH 4YR3A 4IUPA 3KHRA 2K1BA 1G51A 4EX5A 4JC0A 1VQPA 2RGRA 3IAYA 2JEGA 2UVWA 1SE4A 1SN8A 3OHAA 1YITA 3J7A5 1EIFA 4IURA 2E75C 1SYCA 3GV6A 5D3DA 3URYA 3V4SA 5KFPA 4LK1C 5FJ8G 2EIFA 4JI6L 4JBMA 2R82A 1EU4A 4TV9F 1EOTA 1TR5A 2ZXOA 3MHBA 4DK6C 4NKLA 3FKIH 1PH7A 4DV2L 1S0OA 1MKHA 1DOLA 4QUFA 3Q22A 5FPOA 1B3QA 4HIOA 4XYMB 3K7AB 4C2MB 2K04A 1KQSA 2ZJTA 4RB0A 2G9DA 3BZCA 2VPQA 4CBVA 1VQ9A 2HGSA 4XQQA 3OUUA 5LA6F 4EG0A 2F0MA 4DF7A 5C5JA 3GTGH 1K3BC 3BA9A 1KHIA 1E1TA 1E2ZA 4V0BA 1WI5A 1SCUB 3M7GA 3JSNA 2BCOA 4P75A 5KFZA 2A68D 1IBMH 1LV9A 4X3SA 4JI0H 3RV4A 4A3DH 5NUCA 4JI8H 2HD3A 2J0TD 3AEVA 1FL0A 2PCFB 4ED7A 2HQEA 4MZ9A 1YVCA 1I50H 4IUUA 2LY7A 1S03G 2Q2HA 3PIOA 4B9XA 2YZGA 1T5EA 2PQEA 4DV7Q 1S9FA 1O7LA 1I7LA 3F2DA 3GTMB 5EJWA 3R93A 2VL6A 4DV7L 1GJXA 5CR3A 4DV1L 3HKZE 4IZ8A 3FMAA 3V6HA 5HBRB 2WKCA 4DNRB 3S15B 3J81W 5EOYA 1PYSB 3N41B 3PW4A 2N88A 3NTKA 2NUAB 3PUZA 5M5WB 1BF4A 2B63G 3BA8A 4LF9H 4KK7A 3SXHA 1D8LA 2YZNA 5EAYA 3JAMi 1PFNA 4WJWA 5F2DA 1S40A 1CQIB 4Q43A 5KNDA 3WNZA 1L2FA 4KD4A 2JA5G 5IYCH 2UXCQ 3LP8A 5GADC 5KFTA 5EWFA 4ZHQF 4Q45A 1EUJA 1BCPF 4UCUA 2UXCL 2EQSA 3S1NH 2CW0C 4JI3Q 1WOCA 5KFJA 2EY1A 4F4YA 3HKSA 3LNNA 1DM0B 2GPSA 4F50A 1YJ9A 2ZJPA 4R7RA 4IPCA 4JI3L 2AMCB 1KC8C 4LF6H 1ZHQA 2CQYA 3I8ZA 1IW7C 3SK4A 1CKMA 3VPBA 1TWHH 4QWEA 3LWUA 4X3UA 1KJJA 2R7FA 4C3HH 2R7ZG 4F7XA 2QDBA 4P2CB 1SFOA 1LT4D 4PZ7A 4DR5L 3OW7A 3HOZB 5CA0F 1CK1A 4JI4H 4XXEA 4IPDA 4KHZA 4EGQA 4H02A 5FOBB 1IYVA 1SFOB 3BYTB 1ENFA 2P0AA 1F2MA 2TSSA 1SLJA 2V4RA 4GNXA 4RB2C 4RKLA 1WCMH 1J5EH 5IT9W 1G8ZD 5BMVF 1EQTA 4LF8Q 2R7KA 4BY7H 2ASLA 1WYDA 4RFBA 3GTJH 2VR1A 4HJ5A 4X66Q 2N55A 4LF8L 1BBXC 3GTQB 5DQHA 4KY6A 2OQKA 3J7AF 3TREA 4X62Q 5EPKA 4X66L 2B2WC 1GHJA 3QG1A 2JA7A 1I4PA 4B3RH 4HNUA 2HT1A 4X62L 2JA7B 4FP5D 1B50A 3M85A 3HOYG 2VUMH 1BCPC 5CYUA 3NUCA 2YW2A 1K83B 3NE5B 1DCZA 2MCTA 1B33N 1B6SA 3RLOA 3KF8A 2YYAA 4IUQA 2FINB 5KG7A 4LUZA 4K8IA 2X69A 4XZ3B 4CJ2C 3K80C 5HGTA 2AQ1B 2R7DA 5C44B 5JEAJ 2FP4B 2EXDA 1C9OA 5A2QW 4HCEA 3IFDA 4O4LF 2L11A 2GVAA 3MEFA 1DV2A 3K3VA 2JA8H 2CKZB 4EFBA 1BQQT 2UU9H 2E2IA 1HH2P 2K01A 3H20A 2DJFC 4JI8Q 4C5BA 1B1ZA 4RNMA 5ELBA 4BBRB 1QOHA 1Y1WA 1EEID 1YHBA 3I2ZA 1TWCA 5GQOA 5C8YF 1QNUA 1PVOA 1B04A 4I55F 2F0UA 1EIGA 4DR3L 1CM9A 4KKSA 2F3WA 3GO5A 2WYOA 2JEFA 2AWOA 3NELA 1U4RA 3I4NG 1FR3A 5C0XJ 2GPWA 1YJNA 4MHEA 3MR6A 4DV0L 2V4QA 1XNQH 3G6JB 4RZRA 2PMZA 2JA6G 1SNOA 5KFVA 5DQGA 3S14B 4DL7A 3I4NB 2W70A 1U5KA 2WE6A 4MV8A 4IOCA 2EYLA 1DOKA 1W2BA 4F4WA 1MSGA 4L63B 2YS6A 2DUDA 3U4VA 1X32A 1EIHA 1CQVA 1ML0D 1E4EA 2B2WA 4DXGA 1HNZQ 1HRJA 2R87A 1KABA 5EBCA 4EBEA 3OW2A 5FJ8H 1E4EB 1HNZL 1B44D 2KENA 2E5LL 3GTPH 3K7AH 4MA5A 4C2MH 3A74A 2R93A 5C1PA 2KCCA 4JG2A 2A6EC 4LF6Q 1KC7A 2DPJA 1SJED 4A93B 2SNSA 4K2LA 4PMCA 5CBEE 4KJOA 5K2MA 1SXTA 3C1EA 4A3IG 3KLSA 4KKTA 2IWHA 1N32H 3EYYA 5KFGA 3W1BA 2HUGA 4LSXA 3ULPA 2UUCL 1X3EA 2IX3A 4DR2L 4DL3A 1C30A 4ZLTF 1MJCA 4FNFA 2UVUA 1GUGA 3RBEA 4GC6A 1Q8KA 2HQLA 1SEBD 2LSSA 1J5EQ 2JP1A 2UXBL 4UFZA 4XQJA 2K05A 2F4IA 1PZID 4GLVB 4CKEA 3FVQA 3HOVG 4YAKB 2AGPA 2YRXA 4H7BA 4FM9A 1HZAA 3RLFA 3GTMH 2W9BA 1TT2A 3I3CA 2UUAH 5I4DA 4UDUC 1LTTD 1HZ9A 3SK6A 4XYLB 1XDNA 3S15H 2L15A 1NCVA 4B3RQ 3UE1A 1YJWA 5C3EB 2MHVA 4HEDA 4JI7H 1FNUA 5M5WH 4X64H 4UP9A 1UNNC 3Q0AA 1EWCA 2HIXA 1TQOA 3RR5A 1Z9FA 3GTLA 4NXMH 2R86A 3KTMA 2B2TC 3U9OA 1VF5C 5CC4A 2CH4A 4APVA 2A1AA 1EFWA 1PH3A 4TQUS 3GTLB 3JRXA 5EZYF 1STHA 4UCTA 1ET9A 1GKHA 4LFAH 5LL6S 5BPFA 3MFGA 3JRWA 2KHJA 1Y1VG 5KT3A 3AFPA 2UU9Q 1HXYD 1V8QA 2IL8A 1DV1A 3L2PA 2DY8A 2V59A 2Z9HA 3CP0A 3MZ5A 4L6TB 4TQRA 3G71A 3SK8A 4K6LA 4RUCA 5K36H 5DLGA 4A3JG 2Z4HA 3UDFA 1FVIA 4B08A 3ORQA 3RB3A 3HOZH 3KDFA 1IYJB 3QIAA 1JX4A 2EJGC 1SYEA 1SFOH 5JJKA 5ELEA 3PUXA 4PQXA 5EKKA 2K5DA 3KDFB 2JYOA 2DY7A 1Q7YC 4H13C 1O7IA 4A3JB 1PH8A 3M4QA 3ND9A 1C3OA 5I9OA 4NXNH 1IBKQ 2VQDA 2OLSA 2PN1A 4QMGA 4ECTA 1D2BA 3PCOB 2A74C 2CZGA 4Q44A 1IBKL 1EU3A 3RB0A 2RSOA 3GTQH 1B53A 3BS1A 2I0QA 4J9QA 4ZCKA 1AZQA 1M90C 4PMBA 4LWCA 4KI0A 5LXTF 2JA7H 1BGWA 1HQMC 5C4XG 4DV6H 1S0MA 2NBFA 2O5JC 2EXZA 1NNXA 1K83H 1PFMA 2ZDGA 3RIZA 2QILA 4AYBA 1R9TA 2UUBL 1WH2A 1GM5A 5IGCA 4ZOLF 1EZ8A 2I07B 1RD9D 1R9TB 1QG7A 2EJFC 4RHSA 1QILA 5IE8A 3CC4A 2L1BA 1E4FT 3NSWA 1LT6D 1BDOA 5IOCA 2YTYA 3HXLA 4MTDA 3PW2A 3S1MB 1DIKA 2R8HA 5C44H 3G6EA 1XPOA 4PG3A 4Y8VB 1UE1A 4GKKH 3WOFA 1KJIA 1N32Q 3E5SA 4KKUA 3MAQA 4ZQ3A 4A75A 3QOLA 2NU6B 5FLMG 4ODGA 4HMJA 3BDOA 4BBRH 1IBLH 5KKNB 2DN8A 2WINB 3R2TA 5KNCA 4DR6Q 1JOKA 2K6AA 1L0WA 4RAUC 3VDYA 2NWGA 1SNQA 4DR6L 4J9LA 3M4IA 5KFHA 1E2WA 5KT7A 2WB1A 2UUAQ 4YCVA 5GROA 4L5RC 3S17B 5HV6A 2R7NA 4QWDA 3CCQA 3VR3A 1KD1C 1BBWA 3H3VI 5DM73 1D6EC 4X64Q 5IWAH 2RCFA 3PR5B 4LJZC 1KJQA 5KG4A 1XMOH 4RGMA 3S14H 3I4NH 1F9PA 2VQEQ 3NEMA 2XIGA 2ASJA 5EKLA 1UC9A 4E4TA 4UHVA 4ZYSA 4C1NI 1D1KA 2R7MA 2VQEL 5FO7B 4NXMQ 2B2UC 3MXUA 3PQIA 4M8AA 3EN2A 4A3GG 1NY4A 4MTKA 4NXML 2KA7A 1YNJD 1JCKB 2Z6KA 3HOUG 3T1HH 2O03A 1D5ZC 4CDFC 2NZ1D 4A4IA 4JV0A 1JE4A 1HQRD 3K3PA 4A2BA 4DFAA 3Q1KA 3AB9A 1VDZA 3NPPA 4A93H 4KMUC 3U50C 3HOUB 1SMYD 2J7ZA 4G7ZC 1WVLA 4L5SA 4ZKBB 5K5PA 3PW0A 2F0KA 1B2TA 4EEYA 4F88A 4QJFA 3AU7A 2AQ3B 3WO1A 1QJOA 4GOPC 4IWXA 5L1LA 2OTJA 3GIDA 5ELCA 4JYAH 2W6MA 4RCNA 4MIUA 4EQPA 4JI2L 3RV3A 2D0PA 4LUOA 3CD6A 2NUCA 1N8RC 2W6OA 1DD2A 3GTGA 2A69D 1I6VC 4NXNQ 3PV0A 2D5DA 2OTLA 5E3FA 2BE5D 4DUZQ 3QR8A 2XRSD 5IYZF 4J9SA 1A15A 3TP6A 1EZ6A 2JSOA 2KUMA 1QB5D 4DUZL 3NHHA 3T1YH 4F87A 3TRZA 4DR4H 1M7JA 1E7ZA 4YR0A 4DN4M 5DM63 4J9KA 2W7PA 2G5DA 3G6YA 1LO5D 4HYKA 5C3EH 1D5MC 3J7AK 1NJIC 2R6FA 3H4DA 4J9NA 1XMQH 4B3MH 1ILQA 5LMNQ 3B6YA 2QA4A 4J6HA 3Q8PB 3Q8DA 2J6SA 4CJ0B 5LMNL 3EIVA 3CU7A 4IOAA 4B3TQ 3GTLH 2KHIA 3ULLA 5IODA 4FO2A 5M3FG 2B2UA 2MP1A 4B3TL 4RWSC 1PH4A 4GKKQ 1Q81C 2FB9A 3WOEA 4QIWE 2KCMA 4GLXA 4IO9A 1RK6A 4WRDA 1NR4A 2RDHA 1FKAH 5M3FB 1MD2D 3HS0C 4JI6H 3KAJA 5IGGA 1IBLQ 3STBD 4ULLA 4LMQD 4JBWA 4X6AH 1YZ6A 4DV2H 4G3IA 3U9TA 3KALA 5T14A 5M5XB 2OT2A 3J81E 1KAWA 5C6AA 3E0JA 1HJPA 3MWEA 4A3JH 3BZDB 4MV6A 2FJ2A 4DR1Q 1HNWQ 3SI8A 1TWHA 2EY6A 3OHBA 1VF7A 5M5YB 3PO2G 3NTHA 2JA9A 4HSVA 5E4WC 3OWEB 4DR1L 1VMCA 5E7NA 1XMOQ 1HNWL 3KUPA 4M9UA 1LT5D 4QW9A 1NR2A 4A2AA 4A76A 4PV1C 4LH7A 2N8NA 4UP7A 3CCVA 4RH6A 2QEJC 5KFDA 2QF7A 3UDGA 1WCMA 1I3QB 2NYZD 5M9OA 1CSQA 3BDCA 1A3UA 3TINA 2H1EA 1ZYRC 4JW0A 3C46A 2O2LD 1NMGA 1GLVA 1YI2A 2IHFA 4DL4A 4IFDG 3GTJA 2AQ2B 2XNAC 4A3FB 3H0GA 4DV7H 4NDXA 4DV1H 2LFNA 4K8JA 4ZQIA 2DZDA 1CHPD 1G2TA 5CGKA 2PVPA 3H0GB 5KG1A 3S1MH 3RB4A 2D0OA 1BKBA 3HKZG 3CC2A 3GD7A 4O0AA 1PH2A 2EZVA 2RDFA 2QCPX 4GN4B 5BPHA 5C5MA 2C9OA 4J15A 2ZDQA 3Q6SA 5D14A 4DPGA 3EROA 3PO3G 1EQRA 4A3CG 4TV8F 1NE3A 1PRTD 1DONA 3GDEA 2Q8IB 1EL0A 2RGVA 4YB8B 3TIIA 4RCOA 4LF5Q 3RGXA 2AUKA 1RJTA 4ZK9B 4LAAA 3K5NA 1PH1A 4LF5L 3VPCA 1STYA 1TAEA 3PO3B 4MN3A 1VQHA 1PRTB 4HJ9A 2UXCH 3U58A 4I7HA 2DIKA 3MJFA 2G9HD 1K0SA 2B2VA 3MWYW 3S17H 3KJPA 4JI3H 4MV4A 1PYBA 4XT3B 3CQZA 2JEAI 1B70B 1Q82C 1JWSD 2GVBA 3A8JE 3EQLC 3IFTA 1BXTA 1VCIA 2F0LA 3CCSA 3GIQA 1WTVA 1P16A 3CQZB 1SNMA 1PTOD 4ZAIA 1AUXA 3N42B 2NU8B 1BUVT 3QO2A 3NQTA 1XMQQ 4ILWA 2F0NA 5CBAE 4C3JG 3RFCA 4DR5H 1JXLA 4KHPH 2MQHA 4EQ5A 1MGSA 1CI3M 1RJRA 1EYDA 2EY2A 2KEDA 3M4YA 5KEEA 3OTOL 1WTOA 1EQQA 1OO9B 4I65A 1VQ6A 4R4OA 4MV7A 4R4QA 2QDLA 2E2HA 1FYCA 1PFBA 2RHSB 4LF8H 1F2YA 5E4XA 5KFXA 2E2HB 2K5QA 3RZDB 1AN8A 1KDAA 2E74C 4C1NK 3RNUA 4X66H 1PA6A 4JI6Q 4PWQA 3RBDA 1XYIA 1PZJD 3HOUH 2Z6BA 1GUWA 1KJ8A 4X62H 3F2UA 4K5XA 2BDNA 4UAIA 3K6OA 4EGVA 3FPUB 4DV2Q 1Z6HA 3G4SA 1GD7A 4N8X1 1I5FA 4X3TA 3GTPA 4LMYA 4C2MA 3UE0A 5BN4A 2R92G 4TKOB 3ORRA 2YL2A 2SNMA 4RMFA 2W9CA 1ASYA 3GTPB 1KRSA 1EWIA 3OHXC 2V1CC 2YTXA 4X3KA 2FJZA 4IZOA 3GIKA 2KSWA 2EYJA 4KJNA 1SNCA 3I4MG 1H9JA 1XNRQ 1GHKA 2W9CB 1SDFA 1SMXA 2V58A 1V1PB 2ZXPA 5CV6A 3N6XA 4NMZA 1BNCA 3HB9A 4DGZA 5J3BA 5KYLA 1XNRL 4Y7NB 3LX0A 4XDXA 3W3AA 2F4VQ 2K5HA 1CFMA 4GNXC 5KRUA 2F4VL 2B29A 1ULZA 4EBCA 2XVSA 4AIMA 5JVDF 1EYCA 2BQ3A 2PQAB 4KY7A 4C56C 4DR3H 3KLRA 4XIGS 3SGIA 3GTMA 3T16A 5IYBG 1RF2D 2F03A 4R8NA 2A19A 4DV1Q 2UXDL 3IN5A 1UWVA 3VR5A 1U9RA 1Q1BA 2QKIC 3GTKB 1JB7A 1RK5A 4ID6A 1E4GT 4OX9H 1X6OA 4GZYC 3LMLA 4F4XA 2CFMA 3ONAB 4DV0H 2C00A 4UCOA 5KYIA 4K6DA 5KFFA 1NUCA 4DAMA 3JAME 2H5XA 2J9GA 4HTHA 3CRKC 1MHWC 1JWUD 1Y8PB 2WAQE 3E3XA 5M3FH 2D9UA 3NQIA 4WFN3 4LNQA 4R8UA 5ELDA 1CQJB 3J80i 1TU2B 4RHRA 4RB3C 1JJ2A 2K5WA 5T1GA 1S68A 1E24A 5CA1F 2B63B 4R8UB 4O2AF 5M5XH 4J1MA 1HNZH 5EPJA 2E5LH 3K0YA 4ED3A 3M4PA 3BJYA 2HVSA 2Y0SE 3P7JA 3J81c 5DLQE 2JA5A 2WP8J 4MNOA 1Q90A 4DK0A 4DNTB 5KFYA 1K1QA 2W6NA 2JA5B 3NWSA 5KT2A 5M5YH 1EHIA 3R5HA 1X65A 1RYRA 3DWAA 2ZTDA 1ZQ7A 4XQNA 2NVXB 4HN7A 4LFBL 2UUCH 4DR5Q 4DR2H 4O2DA 1VQAA 4KHPQ 3J81L 1BVSA 3ERQA 1PH9A 3TMEA 1YEZA 4KHPL 1T5XD 4GKJL 3A54A 3DEPA 2RVLA 1I3QH 2NVQB 3HFZB 4HNTA 2UXBH 3R5XA 1VQGA 5I6YA 2R7ZB 2PI2E 2SOBA 1QUQB 3W1GA 3F8NA 1UC8A 4A3FH 4F8MA 3GTQA 2NZHA 4QGUA 1OXSC 3H0GH 1CKNA 3BU2A 3NP8A 2IBKA 3P20A 3MXNA 4IFDH 2F0IA 1CKNB 1HUMA 2IHEA 2K5VA 2K52A 2E8GA 3M4OB 5J22A 3GIPA 1K83A 2H4OA 3MXNB 1R4QB 4DL5A 3DHQA 3N44B 5C0XI 4XT1B 2QEXA 2HHHH 5JEAG 4J9OA 1YBYA 2HDMA 4A3EG 4OO1H 5IT9c 3EPGA 3H94A 2K03A 3OMCA 4OL7A 3HOYB 4YAJB 1J9OA 4PZ6A 3PO3H 3DMUA 4WD3A 4A3CH 5EWGA 5D3IB 3PW7A 1VQIA 3PIPA 3KFUA 4TSSA 1VAJA 1UEBA 3FMCA 4HSPA 4MV9A 2NN6I 3CAMA 5LL6b 4NP5A 1H9SB 4HIMA 3E9HA 5IT9L 3RN5A 1ENAA 2OH2A 1A3TA 1KRTA 3HOWG 2SCUB 1CT1D 3CQZH 3DWQA 1DYQA 1S5ED 1NSNS 5C0XG 2ZJRA 4QWCA 4CDEC 4DR3Q 1UAPA 5ELFA 1FJGQ 4AQYH 1JIHA 3K81C 1XTDA 3KK7A 1PH6A 2R6GA 2F0PA 2OF1A 4IJLA 4RAYA 1NBWA 1FJGL 5FO9B 1AE3A 4DV4H 4OX9Q 1RKNA 2RQXA 4DV5Q 1PYWD 5GONF 4BXXG 3BDLA 2CW0D 2MUYA 2NN6G 1PXUA 1NMFA 2C35B 5KGUA 4DV0Q 4IQZA 5C4ZA 4O4HF 4OX9L 1UNSA 4DV5L 1IBKH 2E2HH 3RZDH 5IP7G 3RF2A 5KG3A 1IW7D 2VZAA 5GAHC 2R8GA 2Z0SA 1VQJA 1N48A 1EY0A 1CSPA 1LUZA 2F0HA 5A2QL 3MFIA 4ECXA 4A3LG 2RBMA 4IALA 5F9NA 1Q1EA 4FXGC 1LTSD 3I72A 4LW1A 4JBKA 2L5TA 3D4DA 1A6XA 2AGQA 2JA6B 1B8AA 4ME3A 2UUBH 2JEBI 3A8KE 1KNAA 3CF5A 2E5LQ 2W7OA 4O3PA 1HA6A 4U7CA 4DK1A 4IAJA 2LMCB 4RAZA 1KNEA 1X3QA 1F9RA 1BJTA 1I94Q 2CHBD 2FE3A 1GUOA 3TQ1A 1VQCA 1I94L 2MO0A 2XN9C 1ET6A 4Y7NH 1VQEA 1UE5A 5IP9G 2F0VA 4DR2Q 2UUCQ 5AJ3Q 1VBHA 5JUMA 3OSNA 1F9QA 3ZYYX 3RGZA 3RB6A 5C1OA 1BCPD 5AJ3L 1Y8NB 1ASZA 1VQNA 5DG8A 2F0GA 2R93G 3BQ0A 3JAMW 3N52A 4A3IB 2UXBQ 3H40A 3RD4A 4OIKA 2C5CA 5DNFA 2E2JB 1SYXB 4DR6H 2FLLA 3IL8A 2X0SA 4ED2A 3E0EA 1D1IA 2FK3A 5M3MG 2Q2IA 5DG7A 3I7FA 4HJ7A 4MTEA 1DGSA 2B39A 3GTKH 2A6HC 2W71A 2HCCA 2ZXRA 4BA1I 2KJXA 3FDTA 1L1OA 3AMUA 3VPDA 4IN3A 5M3MB 3HOVB 3HZXA 2VOBA 3JAMc 2M2LA 1L1OB 1K8OA 1B9MA 3S9WA 3RJ0A 2HHHQ 2J4XA 2VQEH 1VQ5A 2HHHL 3GIMA 2LXKA 1Y14B 3VYUA 5DQIA 3LWBA 1K9MC
chains in the Genus database with same CATH topology
1CUKA 4IPHA 3RLNA 3NENA 2B63H 4R4TA 4LFCQ 4PMWA 3HOXH 2F52A 4QJFA 3CCJA 3T1YQ 4YHHQ 4DR4Q 2ZTEA 4LFCL 4GOPC 2FXQA 1UE7A 2OTJA 2RCNA 1JT8A 3T1YL 2K5NA 2ALYB 1M1KC 4DR4L 4JI2L 2D0PA 4LUOA 1HR0Q 2JA5H 3CD6A 3A0JA 1AE2A 4IPGA 1N8RC 1N9WA 2PI2A 1AH9A 4GNXB 4B3MQ 4NXNQ 1G6PA 3PV0A 3I55A 2KCTA 3ER0A 1HR0L 2VQFL 1LYLA 1J6QA 4DUYQ 3J81j 2NVXH 3EBEA 3CMAA 4DUZQ 1XMQL 4B3ML 4XTCS 4AQYQ 1A0IA 5ELNA 3HOVH 3NBHB 4DUZL 3TRZA 1H95A 4AQYL 3I4OA 4BY1H 1E7ZA 1G291 2NVQH 4UPAA 4R4CA 2I5LX 3K8AA 4DV4Q 2MFIA 4A3KH 5C3EH 1K3RA 1VQOA 1G51A 4EX5A 4JC0A 1VQPA 1NJIC 2R7ZH 4DV4L 1SN8A 1VQLA 1YITA 3ERSX 5C44G 3J7A5 1EIFA 3G48A 5LMNQ 3RN2A 3B6YA 2IY5B 2QA4A 3A5UA 1OXXK 3Q8DA 4YWMA 2JQOA 3LGJA 5LMNL 3KF8B 1S72A 3EIVA 5FJ8G 2EIFA 1VQ8A 4JI6L 2IX1A 4JBMA 4IOAA 4B3TQ 3GTLH 2KHIA 3ULLA 1L1OC 4PZ8A 4BBRG 3M4OH 4DK6C 5M3FG 3FKIH 1IZ6A 4C3JH 1PH7A 2Z6KC 4B3TL 4DV2L 1PH4A 4GKKQ 3KLWA 1MKHA 1Q81C 1IBMQ 2UUBQ 4BBSG 1Y1WG 1JJGA 1YHAA 4QIWE 2KCMA 4HIOA 4IO9A 4GLXA 1VQFA 4JI0Q 2PMZE 1IBML 1A62A 4QY7A 3AYHB 4JI0L 1KQSA 4JI4L 1Q12A 4JI8L 3PSIA 1IBLQ 1TWFH 3BZCA 3CXCA 1VQ9A 3STBD 3HOYH 4UY8C 4JBWA 4X6AH 1YZ6A 3GTGH 2N78A 4DAYB 1QVCA 1KHIA 1E1TA 1GO3E 4JI5Q 1WI5A 1U0LA 2XGTA 4P75A 3I56A 4AYBG 3CCMA 4JI5L 1EYGA 4A3DH 1KAWA 2DGYA 1LTLA 3PUVA 5IYDG 1HJPA 3M9BA 3AEVA 1FL0A 4A3JH 4MZ9A 3CC7A 1YVCA 4DR1Q 1HNWQ 1I50H 4LF9Q 3PO2G 2Q2HA 2JA9A 3PIOA 4DV7Q 3DM3A 5E7NA 4DR1L 2JE6I 3TS0A 1XMOQ 1HNWL 2R92H 3A5ZB 4LF9L 3F2DA 1N34L 2QGQA 2VL6A 4DV7L 4A76A 1K73C 4DV1L 5GAGC 1VQDA 3HKZE 2N8NA 1K0RA 4UP7A 3CCVA 3I4MH 2LXJA 4POFA 1PYSB 3UDGA 4A93G 5BR8Q 1CSQA 3PUZA 4P72A 4FDBA 2JJQA 1YIJA 2B63G 1NMGA 1YI2A 2IHFA 4C3IH 5BR8L 4IFDG 3J7ZC 1D8LA 1K8GA 4BXXH 5EAYA 3HOXG 3JAMi 2ZJQA 1CKOA 2WB1G 2CQOA 1S40A 4LF6L 4LUVA 4DR7Q 3S1MH 1JJCB 2D0OA 1BKBA 3HKZG 3CC2A 3GD7A 4O0AA 1PH2A 1L2FA 3KJOA 2JA5G 1IXRA 5IYCH 4GN4B 1Q86C 5GADC 2JA6H 3I4NH 4DR7L 2UXCQ 5IYBH 4J15A 1EUJA 4DPGA 2UXCL 1VS0A 2EQSA 4JI4Q 4JI3Q 1WOCA 2BH2A 4A3MH 3J80c 1EQRA 4OXPA 3HKSA 3PO3G 4A3CG 1TWAH 1NE3A 3GDEA 1YJ9A 2ZJPA 1MIUA 4IPCA 4JI3L 2AMCB 1X9NA 1KC8C 1PV4A 3FP9A 1X54A 4LF5Q 4WJ3M 1I6HH 1CKMA 3L0OA 1PH1A 4LF5L 4A3KG 1TWHH 1J5EL 1XPUA 1VQHA 5C3EG 4HJ9A 1VQ7A 2R7FA 4C3HH 2R7ZG 3U58A 1S3OA 3PUWA 4HJ8A 3D31A 2OQ0A 4PZ7A 2RHQB 3UDIA 3CPWA 4DR5L 3F2BA 3S17H 3BZKA 4IPDA 4KHZA 3KJPA 1PYBA 4H02A 4JI2Q 3WWVA 1KIXA 1B70B 2JEAI 1Q82C 2GVBA 1HZBA 1XJVA 1SLJA 4A3IH 1VCIA 4GNXA 4OWTB 3CCSA 4B3RL 1WCMH 1P16A 2E2JH 1QZGA 2VQFQ 4LF8Q 1HNXL 1OXVA 2VY3A 1XMQQ 4B3SQ 3KOJA 3FKIG 4BY7H 5ELOA 1WYDA 4L5TA 3GTJH 4HJ5A 4X66Q 4LF8L 1RL2A 3F2CA 1K8AC 4B3SL 3S1NH 2VNUD 4QL5A 2MQHA 4EQ5A 2OQKA 3TREA 2B3GA 4X62Q 4X66L 4BY7G 3M3YH 4WJ4A 5JJLA 2HT1A 5M3MH 1A8VA 4X62L 1OXTA 3OTOL 3M85A 1XPRA 1EQQA 1VQ6A 2VUMH 4R4OA 3HOYG 4R4QA 2K4KA 3F1ZA 3ULJA 1BBUA 3KF6A 2RHSB 1UE6A 4BA2I 2RF4A 3RLOA 2UU9L 4JCVE 1VQBA 3KF6B 2F3IA 3RNUA 1PA6A 1V1QA 4JI6Q 4LUZA 2CWAA 3HOUH 4A3DG 1KXLA 4JI1Q 1X55A 3K80C 4DV2Q 2R7DA 1E22A 4JI1L 5JEAJ 3G4SA 2EXDA 1C9OA 1GD7A 4P74A 2GVAA 3MEFA 1EIYB 3D0FA 2YYZA 1I5FA 2CKZB 3CMEA 2ES2A 2JA8H 4K0KL 1HH2P 4AYBE 3UE0A 2R92G 2WFWA 4JI8Q 4RMFA 1ASYA 1QZHA 1KRSA 1EWIA 1N33Q 2V1CC 2ID0A 2YTXA 3I4MG 1YHBA 3I2ZA 4RG1A 1XNQQ 5GQOA 1SMXA 2VS1A 4YWKA 1XNRQ 3IRBA 1N33L 4A3BG 1PVOA 1Y1VH 1XNQL 5J3BA 1XNRL 4DV3Q 4DR3L 4A3EH 1WJJA 1OTCA 3OYYA 3GO5A 2K14A 3CW2C 2F4VQ 1PFSA 1V43A 4GS3A 2K5HA 2AWOA 3NELA 5H1SE 5LMUL 4DV3L 2MO1A 2NZOA 3I4NG 5C0XJ 4GNXC 1JMCA 3AFQA 1VQKA 1YJNA 2B29A 2F4VL 4JV5Q 4OWWB 4AIMA 2PQAB 3TQYA 4DV0L 4JV5L 4OONA 4P73A 5IYCG 3UDXA 2JA6G 4XIGS 3SGIA 4HIKA 5JJIA 1N34Q 5IYBG 1U5KA 2A19A 3S14H 4DV1Q 2UXDL 4OWXB 1UWVA 4IOCA 2N3SA 1W2BA 4JBJA 1Q1BA 3F8TA 3HOWH 1JB7A 2WB1E 2JK8A 1P8LA 2CCZA 2DUDA 3U4VA 1X6OA 2VW9A 5C4JH 4TVAB 2CFMA 1HNZQ 1WFQA 1C7YA 4DAMA 5FJ8H 2H5XA 3OW2A 1HNZL 1N32L 2KENA 2E5LL 3GTPH 2E2IH 3K7AH 2WAQE 4JOIC 3S24A 2YTVA 3A74A 4C2MH 1HZCA 4NPSA 5M3FH 2OCEA 3CCEA 4JG2A 4GOPB 5C4XH 4LF6Q 4LNQA 4QQBX 3J80i 1Y1WH 1JJ2A 1E24A 1TWCH 4A3IG 4HIDA 4ALPA 1WCMG 5IP7H 5M5XH 4MTNA 2YV5A 3W1BA 3M4PA 1GVPA 3ULPA 2UUCL 1X3EA 2Y0SE 4DR2L 1YHQA 3J81c 5DLQE 4YWLA 1E1OA 2UUAL 2CWPA 3S1QH 2WP8J 4MNOA 2N49A 3ZJYC 2WAQG 2AKWB 4A3LH 1MJCA 3PF4A 4JI7Q 1Q8KA 2HQLA 2LSSA 1J5EQ 5M5YH 2UXBL 1X65A 3GTOH 3S2DH 4BY1G 1VQMA 2ZTDA 4GLVB 2ATWA 4JI7L 3HOVG 5IYDH 4X64L 3STBC 5FLMH 2VUMG 4LFBL 1HZAA 3RLFA 3GTMH 4DR5Q 4O2DA 1VQAA 4KHPQ 1HR0W 1BVSA 3S2HH 1RIPA 1HZ9A 1PH9A 2Y0SG 1YEZA 4AH6A 3S15H 4KHPL 4X65Q 2XTIA 3BJUA 2K50A 4GKJL 1I3QH 2L15A 3HFZB 3UE1A 4B3RQ 4LFAQ 1YJWA 1VQGA 1HNXQ 4X65L 5M5WH 5IP9H 2PI2E 4UP9A 1QUQB 3W1GA 4LFAL 2HIXA 4A3FH 2NZHA 3RR5A 5GAEC 4QGUA 4POGA 2JA8G 1OXSC 1Z9FA 2AWNA 2R93H 2K75A 3H0GH 1CKNA 3BU2A 3OTOQ 4APVA 2A1AA 2AHOB 1PH3A 4TQUS 1EFWA 3L7ZC 4R4IA 5LMNW 2OWOA 1CKNB 2IHEA 2K5VA 2K52A 3CPFA 2E8GA 4UP8A 1GKHA 3U4ZA 1C0AA 1Q46A 3MXNB 2KHJA 5C0XI 1Y1VG 2QEXA 3AFPA 2UU9Q 2BH8A 4YCUA 5JEAG 4YHHL 1YBYA 1V9PA 1X56A 4A3EG 3L2PA 5IT9c 4GN3B 4A3GH 1X3FA 4JOIA 3CP0A 1VQ4A 3PGZA 3G71A 4PZ6A 3PO3H 4HJAA 4A3CH 4NXNL 3TS2A 1VQIA 3PIPA 4A3JG 3KFUA 1SE8A 1UEBA 2IX0A 3UDFA 4DUYL 4K0KQ 1FVIA 2NN6I 3CAMA 3HOZH 3KDFA 3S1RH 2JA7G 3H3VH 1IYJB 4HIMA 3E9HA 5HY6A 1OXUA 3RN5A 1SFOH 5JJKA 2NVYH 3PUXA 3KDFB 4DV6Q 1Q7YC 1W3SA 1O7IA 1KRTA 3HOWG 1PH8A 3CQZH 3M4QA 1IBKQ 4GN5A 4DV6L 4GLAC 5C0XG 3CCRA 1PH5A 2Q2TA 2ZJRA 3M7NA 3PCOB 4DR3Q 5IY0A 1IBKL 1FJGQ 3ICEA 3K81C 1XTDA 1PH6A 3PUYA 2I0QA 3GTQH 2R6GA 5LMUQ 4IJLA 3K0XA 1NBWA 1FJGL 1M90C 1E3PA 1AE3A 4KI0A 4LWCA 4R1JA 4DNIA 4OX9Q 4DV5Q 2JA7H 4A3BH 5C4XG 4BXXG 2PQAA 2NN6G 2ASBA 1NMFA 2C35B 4DV0Q 2NVTH 1K83H 4DV5L 4OX9L 2ZTCA 1B7YB 4GKKL 2E2HH 3AQQA 3RZDH 2IT1A 3FHWA 5IP7G 1GM5A 2UUBL 2VZAA 5GAHC 2ZM6Q 2UXDQ 2Z0SA 1VQJA 4LF4Q 1SRUA 5FLXc 2ZM6L 1CSPA 1LUZA 5IE8A 3CC4A 3CCUA 4LF7Q 1FGUA 4A3MG 2YTYA 1IBLL 4A3LG 4NB3A 4LF4L 1Q1EA 4LW1A 4JBKA 5C44H 3G6EA 1XPOA 4PG3A 3E9IA 1MJEA 1KL9A 4LF7L 1UE1A 1A63A 2YU9H 1B8AA 4ME3A 2I5HA 1N32Q 1X3GA 2JEBI 3CF5A 2E5LQ 4IFDI 4A75A 5FLMG 4GOPA 2HIVA 3KYHC 4BBRH 3JC66 1I94Q 3J81i 4DR6Q 5IWAQ 1IL2A 1L0WA 4BBSH 1VQCA 3VDYA 1I94L 2MO0A 4OO1I 4L5QA 4DR6L 4YY3Q 5IWAL 4Y7NH 1VQEA 2KBNA 1XMOL 1UE5A 4P71A 5IP9G 3DLLA 4DR2Q 5AJ3Q 2UUCQ 2UUAQ 2BA1A 1EOVA 4YCVA 5GROA 4DK3C 4YY3L 4A3FG 4L5RC 5AJ3L 1ASZA 1VQNA 4Y52H 2R93G 3CCQA 2Q2UA 3H0GG 1KD1C 1BBWA 3H3VI 3RZOH 2UXBQ 1SR3A 2PNHA 3T1HQ 3PF5A 4X64Q 1Z47A 4LFBQ 1SROA 2I5MX 3H15A 3E0EA 2BA0A 1R9TH 1QVGA 1LM0A 2VQEQ 1TWGH 3NEMA 5M3MG 2Q2IA 3T1HL 1N36Q 3I7FA 2OTLA 1NTGA 4HJ7A 2D62A 1DGSA 1QVFA 3GTKH 3CCLA 2VQEL 5HGQA 1N36L 4NXMQ 4GKJQ 4BA1I 2MNAA 4OO1G 2GN5A 3EN2A 3PO2H 4A3GG 1NY4A 1T9HA 1L1OA 4NXML 4IFDJ 3S16H 3TEHB 1D7QA 1QUQA 2Z6KA 3JAMc 3HOUG 5K36G 1L1OB 1YNXA 3K7UC 4KLKA 4JYAQ 4A4IA 2HHHQ 3W5OA 1TXYA 2A8VA 1VQ5A 3HOZG 4DKAC 4JYAL 1PHJA 2HHHL 4IJHA 1JE5A 4A93H 2LXKA 1Y14B 3U50C 4YCWA 1K9MC 4L5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CUK A;  4IPH A;  3RLN A;  3NEN A;  2B63 H;  4R4T A;  4LFC Q;  4PMW A;  3HOX H;  2F52 A;  4QJF A;  3CCJ A;  3T1Y Q;  4YHH Q;  4DR4 Q;  2ZTE A;  4LFC L;  4GOP C;  2FXQ A;  1UE7 A;  2OTJ A;  2RCN A;  1JT8 A;  3T1Y L;  2K5N A;  2ALY B;  1M1K C;  4DR4 L;  4JI2 L;  2D0P A;  4LUO A;  1HR0 Q;  2JA5 H;  3CD6 A;  3A0J A;  1AE2 A;  4IPG A;  1N8R C;  1N9W A;  2PI2 A;  1AH9 A;  4GNX B;  4B3M Q;  4NXN Q;  1G6P A;  3PV0 A;  3I55 A;  2KCT A;  3ER0 A;  1HR0 L;  2VQF L;  1LYL A;  1J6Q A;  4DUY Q;  3J81 j;  2NVX H;  3EBE A;  3CMA A;  4DUZ Q;  1XMQ L;  4B3M L;  4XTC S;  4AQY Q;  1A0I A;  5ELN A;  3HOV H;  3NBH B;  4DUZ L;  3TRZ A;  1H95 A;  4AQY L;  3I4O A;  4BY1 H;  1E7Z A;  1G29 1;  2NVQ H;  4UPA A;  4R4C A;  2I5L X;  3K8A A;  4DV4 Q;  2MFI A;  4A3K H;  5C3E H;  1K3R A;  1VQO A;  1G51 A;  4EX5 A;  4JC0 A;  1VQP A;  1NJI C;  2R7Z H;  4DV4 L;  1SN8 A;  1VQL A;  1YIT A;  3ERS X;  5C44 G;  3J7A 5;  1EIF A;  3G48 A;  5LMN Q;  3RN2 A;  3B6Y A;  2IY5 B;  2QA4 A;  3A5U A;  1OXX K;  3Q8D A;  4YWM A;  2JQO A;  3LGJ A;  5LMN L;  3KF8 B;  1S72 A;  3EIV A;  5FJ8 G;  2EIF A;  1VQ8 A;  4JI6 L;  2IX1 A;  4JBM A;  4IOA A;  4B3T Q;  3GTL H;  2KHI A;  3ULL A;  1L1O C;  4PZ8 A;  4BBR G;  3M4O H;  4DK6 C;  5M3F G;  3FKI H;  1IZ6 A;  4C3J H;  1PH7 A;  2Z6K C;  4B3T L;  4DV2 L;  1PH4 A;  4GKK Q;  3KLW A;  1MKH A;  1Q81 C;  1IBM Q;  2UUB Q;  4BBS G;  1Y1W G;  1JJG A;  1YHA A;  4QIW E;  2KCM A;  4HIO A;  4IO9 A;  4GLX A;  1VQF A;  4JI0 Q;  2PMZ E;  1IBM L;  1A62 A;  4QY7 A;  3AYH B;  4JI0 L;  1KQS A;  4JI4 L;  1Q12 A;  4JI8 L;  3PSI A;  1IBL Q;  1TWF H;  3BZC A;  3CXC A;  1VQ9 A;  3STB D;  3HOY H;  4UY8 C;  4JBW A;  4X6A H;  1YZ6 A;  3GTG H;  2N78 A;  4DAY B;  1QVC A;  1KHI A;  1E1T A;  1GO3 E;  4JI5 Q;  1WI5 A;  1U0L A;  2XGT A;  4P75 A;  3I56 A;  4AYB G;  3CCM A;  4JI5 L;  1EYG A;  4A3D H;  1KAW A;  2DGY A;  1LTL A;  3PUV A;  5IYD G;  1HJP A;  3M9B A;  3AEV A;  1FL0 A;  4A3J H;  4MZ9 A;  3CC7 A;  1YVC A;  4DR1 Q;  1HNW Q;  1I50 H;  4LF9 Q;  3PO2 G;  2Q2H A;  2JA9 A;  3PIO A;  4DV7 Q;  3DM3 A;  5E7N A;  4DR1 L;  2JE6 I;  3TS0 A;  1XMO Q;  1HNW L;  2R92 H;  3A5Z B;  4LF9 L;  3F2D A;  1N34 L;  2QGQ A;  2VL6 A;  4DV7 L;  4A76 A;  1K73 C;  4DV1 L;  5GAG C;  1VQD A;  3HKZ E;  2N8N A;  1K0R A;  4UP7 A;  3CCV A;  3I4M H;  2LXJ A;  4POF A;  1PYS B;  3UDG A;  4A93 G;  5BR8 Q;  1CSQ A;  3PUZ A;  4P72 A;  4FDB A;  2JJQ A;  1YIJ A;  2B63 G;  1NMG A;  1YI2 A;  2IHF A;  4C3I H;  5BR8 L;  4IFD G;  3J7Z C;  1D8L A;  1K8G A;  4BXX H;  5EAY A;  3HOX G;  3JAM i;  2ZJQ A;  1CKO A;  2WB1 G;  2CQO A;  1S40 A;  4LF6 L;  4LUV A;  4DR7 Q;  3S1M H;  1JJC B;  2D0O A;  1BKB A;  3HKZ G;  3CC2 A;  3GD7 A;  4O0A A;  1PH2 A;  1L2F A;  3KJO A;  2JA5 G;  1IXR A;  5IYC H;  4GN4 B;  1Q86 C;  5GAD C;  2JA6 H;  3I4N H;  4DR7 L;  2UXC Q;  5IYB H;  4J15 A;  1EUJ A;  4DPG A;  2UXC L;  1VS0 A;  2EQS A;  4JI4 Q;  4JI3 Q;  1WOC A;  2BH2 A;  4A3M H;  3J80 c;  1EQR A;  4OXP A;  3HKS A;  3PO3 G;  4A3C G;  1TWA H;  1NE3 A;  3GDE A;  1YJ9 A;  2ZJP A;  1MIU A;  4IPC A;  4JI3 L;  2AMC B;  1X9N A;  1KC8 C;  1PV4 A;  3FP9 A;  1X54 A;  4LF5 Q;  4WJ3 M;  1I6H H;  1CKM A;  3L0O A;  1PH1 A;  4LF5 L;  4A3K G;  1TWH H;  1J5E L;  1XPU A;  1VQH A;  5C3E G;  4HJ9 A;  1VQ7 A;  2R7F A;  4C3H H;  2R7Z G;  3U58 A;  1S3O A;  3PUW A;  4HJ8 A;  3D31 A;  2OQ0 A;  4PZ7 A;  2RHQ B;  3UDI A;  3CPW A;  4DR5 L;  3F2B A;  3S17 H;  3BZK A;  4IPD A;  4KHZ A;  3KJP A;  1PYB A;  4H02 A;  4JI2 Q;  3WWV A;  1KIX A;  1B70 B;  2JEA I;  1Q82 C;  2GVB A;  1HZB A;  1XJV A;  1SLJ A;  4A3I H;  1VCI A;  4GNX A;  4OWT B;  3CCS A;  4B3R L;  1WCM H;  1P16 A;  2E2J H;  1QZG A;  2VQF Q;  4LF8 Q;  1HNX L;  1OXV A;  2VY3 A;  1XMQ Q;  4B3S Q;  3KOJ A;  3FKI G;  4BY7 H;  5ELO A;  1WYD A;  4L5T A;  3GTJ H;  4HJ5 A;  4X66 Q;  4LF8 L;  1RL2 A;  3F2C A;  1K8A C;  4B3S L;  3S1N H;  2VNU D;  4QL5 A;  2MQH A;  4EQ5 A;  2OQK A;  3TRE A;  2B3G A;  4X62 Q;  4X66 L;  4BY7 G;  3M3Y H;  4WJ4 A;  5JJL A;  2HT1 A;  5M3M H;  1A8V A;  4X62 L;  1OXT A;  3OTO L;  3M85 A;  1XPR A;  1EQQ A;  1VQ6 A;  2VUM H;  4R4O A;  3HOY G;  4R4Q A;  2K4K A;  3F1Z A;  3ULJ A;  1BBU A;  3KF6 A;  2RHS B;  1UE6 A;  4BA2 I;  2RF4 A;  3RLO A;  2UU9 L;  4JCV E;  1VQB A;  3KF6 B;  2F3I A;  3RNU A;  1PA6 A;  1V1Q A;  4JI6 Q;  4LUZ A;  2CWA A;  3HOU H;  4A3D G;  1KXL A;  4JI1 Q;  1X55 A;  3K80 C;  4DV2 Q;  2R7D A;  1E22 A;  4JI1 L;  5JEA J;  3G4S A;  2EXD A;  1C9O A;  1GD7 A;  4P74 A;  2GVA A;  3MEF A;  1EIY B;  3D0F A;  2YYZ A;  1I5F A;  2CKZ B;  3CME A;  2ES2 A;  2JA8 H;  4K0K L;  1HH2 P;  4AYB E;  3UE0 A;  2R92 G;  2WFW A;  4JI8 Q;  4RMF A;  1ASY A;  1QZH A;  1KRS A;  1EWI A;  1N33 Q;  2V1C C;  2ID0 A;  2YTX A;  3I4M G;  1YHB A;  3I2Z A;  4RG1 A;  1XNQ Q;  5GQO A;  1SMX A;  2VS1 A;  4YWK A;  1XNR Q;  3IRB A;  1N33 L;  4A3B G;  1PVO A;  1Y1V H;  1XNQ L;  5J3B A;  1XNR L;  4DV3 Q;  4DR3 L;  4A3E H;  1WJJ A;  1OTC A;  3OYY A;  3GO5 A;  2K14 A;  3CW2 C;  2F4V Q;  1PFS A;  1V43 A;  4GS3 A;  2K5H A;  2AWO A;  3NEL A;  5H1S E;  5LMU L;  4DV3 L;  2MO1 A;  2NZO A;  3I4N G;  5C0X J;  4GNX C;  1JMC A;  3AFQ A;  1VQK A;  1YJN A;  2B29 A;  2F4V L;  4JV5 Q;  4OWW B;  4AIM A;  2PQA B;  3TQY A;  4DV0 L;  4JV5 L;  4OON A;  4P73 A;  5IYC G;  3UDX A;  2JA6 G;  4XIG S;  3SGI A;  4HIK A;  5JJI A;  1N34 Q;  5IYB G;  1U5K A;  2A19 A;  3S14 H;  4DV1 Q;  2UXD L;  4OWX B;  1UWV A;  4IOC A;  2N3S A;  1W2B A;  4JBJ A;  1Q1B A;  3F8T A;  3HOW H;  1JB7 A;  2WB1 E;  2JK8 A;  1P8L A;  2CCZ A;  2DUD A;  3U4V A;  1X6O A;  2VW9 A;  5C4J H;  4TVA B;  2CFM A;  1HNZ Q;  1WFQ A;  1C7Y A;  4DAM A;  5FJ8 H;  2H5X A;  3OW2 A;  1HNZ L;  1N32 L;  2KEN A;  2E5L L;  3GTP H;  2E2I H;  3K7A H;  2WAQ E;  4JOI C;  3S24 A;  2YTV A;  3A74 A;  4C2M H;  1HZC A;  4NPS A;  5M3F H;  2OCE A;  3CCE A;  4JG2 A;  4GOP B;  5C4X H;  4LF6 Q;  4LNQ A;  4QQB X;  3J80 i;  1Y1W H;  1JJ2 A;  1E24 A;  1TWC H;  4A3I G;  4HID A;  4ALP A;  1WCM G;  5IP7 H;  5M5X H;  4MTN A;  2YV5 A;  3W1B A;  3M4P A;  1GVP A;  3ULP A;  2UUC L;  1X3E A;  2Y0S E;  4DR2 L;  1YHQ A;  3J81 c;  5DLQ E;  4YWL A;  1E1O A;  2UUA L;  2CWP A;  3S1Q H;  2WP8 J;  4MNO A;  2N49 A;  3ZJY C;  2WAQ G;  2AKW B;  4A3L H;  1MJC A;  3PF4 A;  4JI7 Q;  1Q8K A;  2HQL A;  2LSS A;  1J5E Q;  5M5Y H;  2UXB L;  1X65 A;  3GTO H;  3S2D H;  4BY1 G;  1VQM A;  2ZTD A;  4GLV B;  2ATW A;  4JI7 L;  3HOV G;  5IYD H;  4X64 L;  3STB C;  5FLM H;  2VUM G;  4LFB L;  1HZA A;  3RLF A;  3GTM H;  4DR5 Q;  4O2D A;  1VQA A;  4KHP Q;  1HR0 W;  1BVS A;  3S2H H;  1RIP A;  1HZ9 A;  1PH9 A;  2Y0S G;  1YEZ A;  4AH6 A;  3S15 H;  4KHP L;  4X65 Q;  2XTI A;  3BJU A;  2K50 A;  4GKJ L;  1I3Q H;  2L15 A;  3HFZ B;  3UE1 A;  4B3R Q;  4LFA Q;  1YJW A;  1VQG A;  1HNX Q;  4X65 L;  5M5W H;  5IP9 H;  2PI2 E;  4UP9 A;  1QUQ B;  3W1G A;  4LFA L;  2HIX A;  4A3F H;  2NZH A;  3RR5 A;  5GAE C;  4QGU A;  4POG A;  2JA8 G;  1OXS C;  1Z9F A;  2AWN A;  2R93 H;  2K75 A;  3H0G H;  1CKN A;  3BU2 A;  3OTO Q;  4APV A;  2A1A A;  2AHO B;  1PH3 A;  4TQU S;  1EFW A;  3L7Z C;  4R4I A;  5LMN W;  2OWO A;  1CKN B;  2IHE A;  2K5V A;  2K52 A;  3CPF A;  2E8G A;  4UP8 A;  1GKH A;  3U4Z A;  1C0A A;  1Q46 A;  3MXN B;  2KHJ A;  5C0X I;  1Y1V G;  2QEX A;  3AFP A;  2UU9 Q;  2BH8 A;  4YCU A;  5JEA G;  4YHH L;  1YBY A;  1V9P A;  1X56 A;  4A3E G;  3L2P A;  5IT9 c;  4GN3 B;  4A3G H;  1X3F A;  4JOI A;  3CP0 A;  1VQ4 A;  3PGZ A;  3G71 A;  4PZ6 A;  3PO3 H;  4HJA A;  4A3C H;  4NXN L;  3TS2 A;  1VQI A;  3PIP A;  4A3J G;  3KFU A;  1SE8 A;  1UEB A;  2IX0 A;  3UDF A;  4DUY L;  4K0K Q;  1FVI A;  2NN6 I;  3CAM A;  3HOZ H;  3KDF A;  3S1R H;  2JA7 G;  3H3V H;  1IYJ B;  4HIM A;  3E9H A;  5HY6 A;  1OXU A;  3RN5 A;  1SFO H;  5JJK A;  2NVY H;  3PUX A;  3KDF B;  4DV6 Q;  1Q7Y C;  1W3S A;  1O7I A;  1KRT A;  3HOW G;  1PH8 A;  3CQZ H;  3M4Q A;  1IBK Q;  4GN5 A;  4DV6 L;  4GLA C;  5C0X G;  3CCR A;  1PH5 A;  2Q2T A;  2ZJR A;  3M7N A;  3PCO B;  4DR3 Q;  5IY0 A;  1IBK L;  1FJG Q;  3ICE A;  3K81 C;  1XTD A;  1PH6 A;  3PUY A;  2I0Q A;  3GTQ H;  2R6G A;  5LMU Q;  4IJL A;  3K0X A;  1NBW A;  1FJG L;  1M90 C;  1E3P A;  1AE3 A;  4KI0 A;  4LWC A;  4R1J A;  4DNI A;  4OX9 Q;  4DV5 Q;  2JA7 H;  4A3B H;  5C4X G;  4BXX G;  2PQA A;  2NN6 G;  2ASB A;  1NMF A;  2C35 B;  4DV0 Q;  2NVT H;  1K83 H;  4DV5 L;  4OX9 L;  2ZTC A;  1B7Y B;  4GKK L;  2E2H H;  3AQQ A;  3RZD H;  2IT1 A;  3FHW A;  5IP7 G;  1GM5 A;  2UUB L;  2VZA A;  5GAH C;  2ZM6 Q;  2UXD Q;  2Z0S A;  1VQJ A;  4LF4 Q;  1SRU A;  5FLX c;  2ZM6 L;  1CSP A;  1LUZ A;  5IE8 A;  3CC4 A;  3CCU A;  4LF7 Q;  1FGU A;  4A3M G;  2YTY A;  1IBL L;  4A3L G;  4NB3 A;  4LF4 L;  1Q1E A;  4LW1 A;  4JBK A;  5C44 H;  3G6E A;  1XPO A;  4PG3 A;  3E9I A;  1MJE A;  1KL9 A;  4LF7 L;  1UE1 A;  1A63 A;  2YU9 H;  1B8A A;  4ME3 A;  2I5H A;  1N32 Q;  1X3G A;  2JEB I;  3CF5 A;  2E5L Q;  4IFD I;  4A75 A;  5FLM G;  4GOP A;  2HIV A;  3KYH C;  4BBR H;  3JC6 6;  1I94 Q;  3J81 i;  4DR6 Q;  5IWA Q;  1IL2 A;  1L0W A;  4BBS H;  1VQC A;  3VDY A;  1I94 L;  2MO0 A;  4OO1 I;  4L5Q A;  4DR6 L;  4YY3 Q;  5IWA L;  4Y7N H;  1VQE A;  2KBN A;  1XMO L;  1UE5 A;  4P71 A;  5IP9 G;  3DLL A;  4DR2 Q;  5AJ3 Q;  2UUC Q;  2UUA Q;  2BA1 A;  1EOV A;  4YCV A;  5GRO A;  4DK3 C;  4YY3 L;  4A3F G;  4L5R C;  5AJ3 L;  1ASZ A;  1VQN A;  4Y52 H;  2R93 G;  3CCQ A;  2Q2U A;  3H0G G;  1KD1 C;  1BBW A;  3H3V I;  3RZO H;  2UXB Q;  1SR3 A;  2PNH A;  3T1H Q;  3PF5 A;  4X64 Q;  1Z47 A;  4LFB Q;  1SRO A;  2I5M X;  3H15 A;  3E0E A;  2BA0 A;  1R9T H;  1QVG A;  1LM0 A;  2VQE Q;  1TWG H;  3NEM A;  5M3M G;  2Q2I A;  3T1H L;  1N36 Q;  3I7F A;  2OTL A;  1NTG A;  4HJ7 A;  2D62 A;  1DGS A;  1QVF A;  3GTK H;  3CCL A;  2VQE L;  5HGQ A;  1N36 L;  4NXM Q;  4GKJ Q;  4BA1 I;  2MNA A;  4OO1 G;  2GN5 A;  3EN2 A;  3PO2 H;  4A3G G;  1NY4 A;  1T9H A;  1L1O A;  4NXM L;  4IFD J;  3S16 H;  3TEH B;  1D7Q A;  1QUQ A;  2Z6K A;  3JAM c;  3HOU G;  5K36 G;  1L1O B;  1YNX A;  3K7U C;  4KLK A;  4JYA Q;  4A4I A;  2HHH Q;  3W5O A;  1TXY A;  2A8V A;  1VQ5 A;  3HOZ G;  4DKA C;  4JYA L;  1PHJ A;  2HHH L;  4IJH A;  1JE5 A;  4A93 H;  2LXK A;  1Y14 B;  3U50 C;  4YCW A;  1K9M C;  4L5S A; 
#chains in the Genus database with same CATH topology
 2B63 H;  5KFE A;  1SAP A;  4JK1 C;  4R4T A;  3JAM L;  4YP3 A;  1BO0 A;  2F52 A;  3OIP A;  2ZTE A;  1EYA A;  1PX2 A;  3Q2O A;  2K5N A;  1STA A;  2PNR C;  2JA5 H;  3GV8 B;  3A56 A;  1AE2 A;  1GXD C;  1XX8 A;  4G57 A;  2IW3 A;  4A3B G;  2FMM A;  3I55 A;  3ER0 A;  2R8I A;  2VQF L;  1LYL A;  4G7H C;  2NVX H;  1F77 A;  2FK1 A;  1Y1V B;  1KDB A;  5IGD A;  3EJI A;  4XTC S;  1A0I A;  4AQY Q;  1Q3L A;  3NBH B;  1CA6 A;  3HP3 A;  4JI2 H;  4AQY L;  3I4O A;  2A73 B;  3DUZ A;  2GLT A;  1B9N A;  2NVQ H;  2I46 A;  2FLN A;  4UPA A;  2I5L X;  4DV4 Q;  2MFI A;  1TII D;  4CKC A;  1VQO A;  1GYF A;  2R7Z H;  4DV4 L;  5KT5 A;  2O5I C;  2BOS A;  2LKV A;  3ERS X;  1JC7 A;  2IY5 B;  1LTR D;  5EQ0 A;  3RN2 A;  2UVV A;  3D4W A;  2RKS A;  4DUZ H;  1OXX K;  2IPK D;  2R7L A;  2DJG C;  5I2Y A;  2QYZ A;  1STB A;  4ZRZ A;  3X3M A;  4PZ8 A;  3M4O H;  5KFK A;  3TSS A;  3G6V A;  1SNP A;  2Z6K C;  4HCS A;  4O2B F;  2DNC A;  3KLW A;  2UUB Q;  4BBS G;  1IOV A;  2W6P A;  1YHA A;  1YNJ C;  2HDL A;  1LAB A;  1TS3 A;  4ZI7 F;  1IOW A;  5LMN H;  2PMZ E;  3VA5 A;  2P5Z X;  1ESF A;  3AYH B;  2KHS A;  1Q12 A;  5FD6 A;  3PSI A;  1YNN C;  2V4D A;  5C4X B;  3GV5 B;  3HOY H;  2AUJ D;  2PZT A;  1CHQ D;  3R8B A;  4B3T H;  3BVZ A;  3I73 A;  1SMY C;  2MGS A;  3D4R A;  5CV8 A;  2KQ3 A;  3K5O A;  2YS7 A;  4IRC A;  4JI5 Q;  2WDT A;  2ICI A;  4CKB A;  1U0L A;  3Q8Q B;  4AYB G;  3VR4 A;  1W93 A;  3CCM A;  4QWA A;  4JI5 L;  5G3L F;  2DGY A;  1LTL A;  4O3O A;  1L0X B;  3TP8 A;  4Q8F A;  5KFI A;  1HTL D;  3CC7 A;  4ME6 A;  1IHZ A;  3V05 A;  3EPI A;  2AGO A;  4ECR A;  4WOR A;  2JE6 I;  4TRD A;  1VMP A;  5JQW A;  1JIC A;  1Z2O X;  1W6K A;  1N34 L;  2QGQ A;  1S4Z A;  1VQD A;  3S2H B;  3SK5 A;  2B8G A;  1ZXT A;  2LXJ A;  4U6P A;  4N9T A;  5KG6 A;  3VYR A;  5COY A;  1NAP A;  3T5L A;  1EYZ A;  4P72 A;  4DR1 H;  1EUD B;  1HNW H;  4J9P A;  1YIJ A;  2VPS A;  3J7Z C;  1QWY A;  3BAB A;  1K8G A;  4O4I F;  4BXX H;  2K32 A;  3HOX G;  1K28 A;  3R5F A;  3QZ8 A;  1O78 A;  2ZJQ A;  1CKO A;  2WB1 G;  1IKM A;  4DR7 Q;  5EGT A;  2GA4 B;  4O1N A;  1RDP D;  3PIP 3;  2JA6 H;  4DR7 L;  2R3Z A;  2HVQ A;  4R9W A;  1STN A;  4IRD A;  1FD7 D;  2YCH A;  2WII B;  2BH2 A;  1IL8 A;  4OXP A;  1XTC D;  5LYJ F;  4PNY A;  1TWA H;  4IUT A;  1GUN A;  1X9N A;  1PV4 A;  1SJH D;  3FP9 A;  1X54 A;  3K59 A;  4RGT A;  4A3G B;  4UCV A;  2IP4 A;  3R23 A;  2ALZ A;  4A3K G;  4RKB A;  2B2Y A;  1VQ7 A;  1H9M A;  4WBN F;  4G7O C;  1CZG A;  1S3O A;  4HJ8 A;  3D31 A;  3UDI A;  1M0W A;  5L1J A;  1WR2 A;  4FBT A;  3F2B A;  4DAP A;  1LTB D;  4JI2 Q;  3GLK A;  1FGB D;  2X6L A;  2K33 A;  2NVY B;  5JH7 F;  2PBZ A;  1XJV A;  4Q0F A;  4A3I H;  1HCZ A;  4LF5 H;  4OWT B;  1PRT F;  2E2J H;  2Z1C A;  5CV9 A;  4RNN A;  1HNX L;  2VY3 A;  2I8C A;  4JV1 A;  4B3S Q;  3KOJ A;  3FKI G;  2KEC A;  4L5T A;  1QCB D;  2FHT A;  3F2C A;  4IUV A;  1K8A C;  4QL5 A;  4B3S L;  2VNU D;  1A9X A;  3Q23 A;  4ED0 A;  1HFG A;  4WJ4 A;  1M6V A;  2F0Q A;  5IIF A;  5M3M H;  3HOV H;  1OXT A;  1XPR A;  2PPB C;  2K4K A;  5KG5 A;  2LS0 1;  2NVT B;  1UE6 A;  1T36 A;  4RB1 A;  3RUP A;  1TS2 A;  4BA2 I;  2RF4 A;  4EYI B;  4JCV E;  3J7Y W;  5KFL A;  4DU9 A;  2C2D A;  2EYM A;  1V1Q A;  4QW8 A;  3KBX A;  4B9W A;  4A3D G;  5FLX E;  3ITP A;  4JI1 Q;  1KXL A;  3OTO H;  1X55 A;  1S0N A;  4C5C A;  3CKI B;  4R8I A;  5KFM A;  3HGB A;  4JI1 L;  1M0T A;  4P74 A;  2YU9 B;  1EIY B;  3D0F A;  2YYZ A;  3BVM A;  2IJ0 A;  4K0K L;  2O4X A;  4MA0 A;  4AYB E;  2SEB D;  2WFW A;  4CC6 A;  5BN5 A;  1QZH A;  3TDQ A;  1N33 Q;  4M7E A;  2R84 A;  4O3R A;  1SE3 A;  2EPB A;  5FKA C;  2F0T A;  2W6Q A;  2VS1 A;  1N33 L;  4YQW A;  1Y1V H;  1K8M A;  4FF2 A;  4XYO A;  4DV3 Q;  1AEX A;  1WJJ A;  2B2V C;  1KEE A;  3CW2 C;  1PFS A;  1V43 A;  4GS3 A;  5LMU L;  4DV3 L;  3Q24 A;  2M05 A;  2NZO A;  1IKL A;  3RTX A;  4HNV A;  1LTA D;  3DXJ C;  1JMC A;  1I4G A;  5I47 A;  2OEO A;  5L1K A;  1S5B D;  3N6R A;  3RZO B;  1SYD A;  1TWG A;  1XNR H;  3SDZ A;  4P73 A;  5IYC G;  2EE1 A;  5JJI A;  4UCR A;  2EYP A;  3MR5 A;  5D8D A;  1TWG B;  1O7Z A;  3TZU A;  3J7A V;  4OWX B;  2N3S A;  4JBJ A;  3FEW X;  1G2S A;  3F8T A;  2WB1 E;  1JR0 D;  3BG5 A;  2F4V H;  1I3Q A;  3PO2 B;  3V6K A;  4EQN A;  3S16 B;  1WFQ A;  1C7Y A;  2UXD H;  5KFS A;  2ZM6 H;  4KV6 A;  3S24 A;  4C3H G;  3M9O B;  2A5H A;  5DGA A;  4GOP B;  5C4X H;  4ECQ A;  4Q0Y A;  2OXP A;  4HID A;  4ALP A;  1WCM G;  5EWE A;  3RAX A;  4MTN A;  3GV7 B;  2RDI A;  3HKZ A;  4BS9 A;  4BY7 G;  5J1Z A;  1E1O A;  3T5J A;  1KTK A;  2QW7 A;  3BQ2 A;  2WAQ G;  2AKW B;  3DM1 A;  3HKZ B;  1SE2 A;  2ASD A;  3DWP A;  3MXG A;  4BY1 G;  1VQM A;  2E2D C;  2HJW A;  4YY3 H;  2VUM G;  5FLM H;  2W6Z A;  1MZB A;  4N9P A;  5DLF A;  1HR0 W;  1KLG D;  3S2H H;  1S97 A;  1RIP A;  5I2X A;  4J9M A;  2Y0S G;  3TQT A;  2IMW P;  4BY1 B;  4X65 Q;  3BJU A;  2A68 C;  2K50 A;  3HRZ C;  3BQ1 A;  2BDO A;  3PN1 A;  3U9S A;  3V96 A;  4DXF A;  4X65 L;  1Z2P X;  4RZQ A;  4LFB H;  5J2T F;  2FMC A;  1I4Q A;  1TY0 A;  3WDN A;  2KCN A;  5JJZ A;  5GAE C;  2JA8 G;  2AWN A;  2CH4 W;  3G8C A;  3K5H A;  2DWC A;  4GKJ H;  3OOC A;  5LHY 1;  4U67 3;  3I12 A;  1PTO B;  1Z7T A;  3OTO Q;  2AHO B;  2L12 A;  2ENB A;  3L7Z C;  4R4I A;  2OWO A;  3FPP A;  3CPF A;  4CDD C;  3QWN A;  4UP8 A;  3M9N B;  4C3J B;  4CGY B;  2C22 A;  3R3O A;  4CHT B;  2BH8 A;  4YHH L;  2QK4 A;  1X56 A;  3VMM A;  4GN3 B;  4S3S A;  2RDJ A;  4A3G H;  1X3F A;  5JOB A;  3K5I A;  1VQ4 A;  1TWF B;  3IKJ A;  3PGZ A;  2EYF A;  3SEB A;  5C4H A;  3OSO A;  5KG0 A;  1SE8 A;  4DUY L;  1O80 A;  5AFW A;  4ETS A;  4RNO A;  3A7L A;  3H3V H;  2JN4 A;  1XXG A;  5HY6 A;  1AW7 A;  1OXU A;  2NVY H;  4MAM A;  4ZUJ A;  5EDW A;  1ZYR D;  4FU0 A;  1W3S A;  2NTS A;  1V1P A;  3MWM A;  4LSA A;  4GN5 A;  4GLA C;  4NLG A;  1PH5 A;  2Q2T A;  2R92 A;  3M7N A;  4BWS C;  5IY0 A;  5L37 A;  3ICE A;  5FLX W;  3O13 A;  1CQF A;  2R92 B;  3K0X A;  1GSA A;  4ED8 A;  5CAE B;  1W6J A;  2RDG A;  2ZT9 C;  4C3I G;  4IUN A;  5H80 A;  3I4M B;  4DNI A;  2PQA A;  2B8F A;  1EY6 A;  2NVT H;  1V51 A;  2ZTC A;  1STG A;  3K57 A;  3OIQ A;  3AQQ A;  2IT1 A;  4C3I B;  4EVO A;  2UXD Q;  3X3N A;  2ZM6 Q;  2W8K A;  1FJG H;  3I70 A;  3GTK A;  2R61 A;  1A2T A;  4LF4 Q;  5FLX c;  2ZM6 L;  4LF7 Q;  1ICW A;  3CCU A;  3GV3 A;  4A3M G;  5D1O A;  1TVX A;  5DG9 A;  4LF4 L;  2L55 A;  1GSO A;  4LF7 L;  4DV5 H;  2JEI A;  1KL9 A;  1A63 A;  2YU9 H;  5D1O B;  1X3P A;  1JLL B;  3A8I E;  1D5X C;  1AZP A;  4A3M B;  3J80 E;  2HIV A;  3KYH C;  4KD3 A;  5FLX L;  3JC6 6;  2XIW A;  5LL6 X;  2VXW A;  1N56 A;  3MXP A;  1T94 A;  1I6H B;  2B63 A;  3WO0 A;  4L5Q A;  5T1I A;  4YY3 Q;  2KBN A;  1BXR A;  3DLL A;  4P71 A;  2F1M A;  4K14 A;  4YY3 L;  1B6R A;  4CC5 A;  4QF4 A;  3KHH A;  3BG3 A;  1GSH A;  1RYS A;  3R2I A;  1LLR D;  3VR2 A;  4JVZ A;  2FPP B;  1ZKO A;  3RZO H;  4ED1 A;  1I94 H;  2E76 C;  1SR3 A;  3V4Z A;  4U68 A;  3NK9 A;  1JB3 A;  2NVX A;  1Z47 A;  5HUR A;  4LFB Q;  1SRO A;  2I5M X;  2KVM A;  1QVG A;  1LM0 A;  1TWG H;  1EY9 A;  5E1F A;  1N36 Q;  2D62 A;  1AP0 A;  2EYO A;  1EY4 A;  1Z2N X;  4I7Z C;  3CCL A;  1N36 L;  3BYY B;  4H0L C;  4GKJ Q;  2NB0 A;  3M3Y B;  3MVV A;  3PO2 H;  2K7V A;  4FS1 A;  1T9H A;  5BR8 H;  1U4M A;  2R7Z A;  3S16 H;  3TEH B;  1D7Q A;  4ECS A;  1QUQ A;  1O75 A;  4K2K A;  4EQO A;  5K36 G;  1TXY A;  1I4X A;  3HOZ G;  4TQS A;  4ECY A;  4DKA C;  4MV1 A;  1Y8O B;  4IJH A;  1JE5 A;  1F2L A;  2ICE C;  1ROD A;  1FNV A;  1CUK A;  4IPH A;  3RLN A;  3D6W A;  5KFA A;  5C5L A;  2CW8 A;  3PVX A;  1RJQ A;  3M9M B;  1FNW A;  4LFC Q;  3DF7 A;  5LP6 F;  2F0O A;  4PMW A;  5KX5 F;  5L1I A;  4CJ1 B;  4V19 0;  4LFC L;  2FXQ A;  2Q8T A;  2RCN A;  3KHL A;  1JDB B;  4OHJ A;  1WTW A;  2R8K A;  5J2U F;  1JOQ A;  5DEH A;  4GNX B;  1J8I A;  1G6P A;  2JA7 G;  1J6Q A;  4EBD A;  5FK9 C;  1TY2 A;  3MTS A;  3CMA A;  1QE6 A;  3QOJ A;  2AU0 A;  1JQY D;  2W57 A;  5KFN A;  1H9S A;  5DAU A;  4A3E B;  3MC0 B;  3T51 B;  2W8L A;  3CHB D;  3OPO A;  3NWT A;  4BY1 H;  1G29 1;  3G7L A;  2JEJ A;  2VB2 X;  3CRL C;  1C4Q A;  3NXW A;  4HQ6 A;  1K3R A;  4FF4 A;  3Q8R B;  2VQF H;  3MFY A;  1F2Z A;  1VQL A;  5KFB A;  1SYF A;  4APM A;  5C44 G;  3G48 A;  2EY5 A;  2FKL A;  2TMP A;  3A5U A;  3SE7 A;  4YWM A;  2R8J A;  3TN2 A;  1RHP A;  2JQO A;  3LGJ A;  4XYQ A;  5KFW A;  3KF8 B;  1S72 A;  1KLU D;  3SE0 A;  2L9H A;  3DEO A;  1VQ8 A;  1PTO H;  2IX1 A;  1EY5 A;  3HOW B;  1L1O C;  4BBR G;  2WAC A;  1GGO A;  5C4J B;  1CS0 A;  1IZ6 A;  4C3J H;  4KN7 C;  4HAE A;  1IBM Q;  3RMH A;  4DA2 A;  1Y1W G;  4JI0 Q;  2XRQ D;  1VQF A;  3E5N A;  2E2I B;  1IBM L;  1A62 A;  4QY7 A;  4FF1 A;  4JI0 L;  1OWT A;  2M00 A;  2EVB A;  4JI8 L;  1M4V A;  4DAY A;  1TWF H;  3CXC A;  1GUT A;  5JVL A;  1CA5 A;  1E0B A;  1Y1W B;  4UY8 C;  2N78 A;  2JA6 A;  2BQU A;  1SND A;  1TWC B;  4DAY B;  4MV3 A;  1QVC A;  4H44 C;  1GO3 E;  4JUZ A;  1B3A A;  2F0D A;  2XGT A;  3VR6 A;  3I56 A;  1GUS A;  1TWA A;  2XWJ B;  4O3Q A;  3S1Q B;  1HTP A;  2RA4 A;  3T56 B;  3PUV A;  5IYD G;  1EYG A;  4QUC A;  3M9B A;  3T5K A;  3UQ8 A;  3GTO A;  1TWA B;  3D8G A;  3H09 A;  5A35 A;  2ZDH A;  2C28 A;  3L3O C;  3FDS A;  3TIG A;  3IG0 A;  4LF9 Q;  3GIL A;  2PO4 A;  2MJ8 A;  3GTO B;  3E6Z X;  3S2D B;  2PZW A;  1BNZ A;  1ZHS A;  3DM3 A;  3OMG A;  3TS0 A;  2XGQ A;  2R92 H;  2PMZ B;  1S5F D;  3A5Z B;  2F3V A;  3I4L A;  4LF9 L;  5FD5 A;  4JI5 H;  1L2Z A;  1K73 C;  5GAG C;  2F0F A;  1K0R A;  3I4M H;  3RAQ A;  4XX0 B;  2J6U A;  1DXM A;  5KG2 A;  4JV5 H;  3A55 A;  2X6G A;  4POF A;  2KOL A;  2Z4I A;  4A93 G;  5BR8 Q;  4J9R A;  5IGB A;  3J80 W;  4QB4 A;  1I6U A;  1XWE A;  4FDB A;  2JJQ A;  1W96 A;  5JAV A;  4C3I H;  5BR8 L;  3GIJ A;  1N34 H;  1PK8 A;  2VUG A;  3C1F A;  1BCP B;  2RSN A;  3QB3 A;  1G6Z A;  2Z8L A;  2R93 B;  2CQO A;  2FMA A;  4LF6 L;  4LUV A;  5FO8 B;  1JJC B;  1CTM A;  1I4R A;  5KIX A;  3L4K A;  3T5H A;  3JSL A;  3KJO A;  1IXR A;  1Q86 C;  1LAC A;  5IYB H;  5KFO A;  1AFP A;  1ZEQ X;  1T3N A;  1VS0 A;  4JI4 Q;  2HCI A;  4HMI A;  4A3M H;  3J80 c;  3MR3 A;  4J8Q A;  1EQV A;  4DL6 A;  2V5A A;  4JI4 L;  1MIU A;  4WJ3 M;  3L4J A;  2VA2 A;  1I6H H;  3SR1 A;  3L0O A;  4DR7 H;  1J5E L;  2F0J A;  1XPU A;  2FK2 A;  1LT3 D;  1Q8I A;  2EJM A;  5C3E G;  3SVM A;  3PUW A;  3J80 L;  2JXM B;  2OQ0 A;  2RHQ B;  3CPW A;  3S1R B;  2W9B B;  1HA5 A;  3BZK A;  4KTA A;  4K5W A;  3WWV A;  1KIX A;  1B4O A;  5KFC A;  2XD4 A;  3HEJ A;  1HZB A;  1EY7 A;  1EEF D;  4B3R L;  1QZG A;  2VQF Q;  3T13 A;  1Y1V A;  1OXV A;  5D1P A;  1JKJ B;  1EY8 A;  5ELO A;  3NBH A;  5CMD A;  4HR7 A;  1RL2 A;  5JVH 3;  1PZK D;  1HHV A;  5KT6 A;  3H91 A;  3K5M A;  1PMR A;  2B3G A;  2MPM A;  3M3Y H;  4HR7 B;  4I7A A;  2C2E A;  5JJL A;  2EDG A;  5JPM C;  2W9A A;  1WSC A;  4A3B B;  1A8V A;  1VBG A;  3KHG A;  1HNX H;  3ULJ A;  3F1Z A;  1BBU A;  3KF6 A;  2L4N A;  4UCS A;  3L9A X;  4ME5 A;  4B3S H;  2DLN A;  1MSH A;  5FPR A;  2UU9 L;  3H4B A;  1VQB A;  2A6E D;  2SDF A;  3KF6 B;  2F3I A;  5EKI A;  3V2T A;  1ESR A;  2CWA A;  4ED6 A;  3PIO 3;  1DJR D;  5DGB A;  3A7A B;  4KY5 A;  1A3V A;  1E22 A;  2XCP A;  2M9V A;  3CME A;  2ES2 A;  1O7Y A;  1DOM A;  1S5C D;  4TUY F;  1KBL A;  3BAA A;  2I80 A;  3KLS X;  4CDC C;  1PDQ A;  5J39 A;  4YIJ A;  2ID0 A;  5KT4 A;  1QNK A;  3ETJ A;  2PYK A;  5KNB A;  4RG1 A;  1BR9 A;  3UI2 A;  5I6W A;  1XNQ Q;  1ONL A;  4JI1 H;  4YWK A;  2B2Y C;  3IRB A;  4JV2 A;  3H3V C;  4BBS B;  3PW5 A;  5JEA H;  2A6H D;  1XNQ L;  4K0K H;  2F0S A;  4A3E H;  1OTC A;  5JVG 3;  3OYY A;  2K14 A;  4E6I A;  4IWY A;  2WV6 D;  5H1S E;  3HBL A;  2MO1 A;  1WTH A;  4PDB A;  4DLK A;  1Y69 U;  3AFQ A;  1VQK A;  4JV5 Q;  3QFF A;  4OWW B;  1A2U A;  1TA8 A;  1N33 H;  4QIW A;  3TQY A;  4JV5 L;  5BN3 A;  4OON A;  1KAA A;  1R4P B;  2F0W A;  3UDX A;  4HIK A;  3NBI A;  4AYB B;  2A69 C;  1N34 Q;  3VYS A;  4QIW B;  5LMU H;  4DV3 H;  1U4P A;  3V6J A;  2BE5 C;  2XSC A;  3HOW H;  2JK8 A;  1P8L A;  2CCZ A;  2B2T A;  2PW5 A;  5C0X H;  3T53 B;  2VW9 A;  5C4J H;  4TVA B;  4ZKC B;  4QCL A;  1L0Y B;  1C8C A;  1N32 L;  2V9W A;  2E2I H;  5KFR A;  4JOI C;  2YTV A;  2NTT A;  1HZC A;  4NPS A;  1JWM D;  2OCE A;  3CCE A;  4KN4 C;  4QQB X;  2NN6 H;  1JOO A;  1Y1W H;  3N8D A;  3NGD A;  2EOT A;  2DPI A;  1TWC H;  3NTI A;  5IP7 H;  3CVZ A;  4IR1 A;  4OGQ C;  4FXK C;  2YV5 A;  2K28 A;  4EGJ A;  1GVP A;  4DL2 A;  4L1K A;  3HOX B;  3G6X A;  3S1Q H;  1YHQ A;  1II3 A;  4F4Z A;  4YWL A;  2UUA L;  2ATL A;  2CWP A;  2WB1 B;  2N49 A;  3ZJY C;  4A3L H;  4DAV A;  4FBU A;  5I9P A;  3PF4 A;  1RCV D;  4Q5V A;  3PR4 A;  1WD1 A;  4JI7 Q;  2BQR A;  1IYU A;  1SYB A;  3GTO H;  3S2D H;  2ATW A;  4JI7 L;  5IYD H;  3OSP A;  4X64 L;  3STB C;  2FPG B;  4OIJ A;  1SBB B;  2C2R A;  2FFK B;  3UFX B;  3TZD A;  2NVY A;  4FF3 A;  1UUP A;  4RU9 A;  1TS5 A;  4AH6 A;  2XTI A;  1I7N A;  2YRW A;  5IGF A;  2YZM A;  4A3K B;  4LFA Q;  4YR2 A;  2XCA A;  1HNX Q;  1U4L A;  2PW7 A;  5IP9 H;  3JZI A;  4NW2 A;  4ECW A;  4LFA L;  2KEE A;  1YNN D;  3HG9 A;  1JOR A;  1CE8 A;  1RTO A;  2F0E A;  4RGO S;  4POG A;  5EBD A;  5IGE A;  2R93 H;  2FPI B;  2K75 A;  4YJ2 F;  3ETH A;  3PMF A;  3FKI A;  2HVR A;  4FYD A;  4ABN A;  4GC7 A;  4EFE A;  4Z9C B;  5LMN W;  1JDE A;  4X65 H;  3EFX D;  1JT8 A;  4FS2 A;  4O3N A;  4ECU A;  3U4Z A;  4QWB A;  3FKI B;  1C0A A;  1Q46 A;  5TSS A;  1F9S A;  2NU9 B;  1LTI D;  4YCU A;  2XCL A;  1HFN A;  3P75 A;  1V9P A;  3BVG A;  1RJP A;  4FXD A;  1EWH A;  1PTO F;  1AUV A;  4JOI A;  3N43 B;  4C5A A;  4RA8 A;  4HJA A;  3GII A;  3GTG B;  4NXN L;  3GQB A;  3TS2 A;  2YU9 A;  2IX0 A;  4K0K Q;  2I87 A;  1C48 A;  4YHH H;  2CVR A;  1KDC A;  3MEH A;  3I91 A;  3S1R H;  1HUN A;  3D3R A;  5KFU A;  1SEI A;  4O42 A;  4A3D B;  2CW7 A;  1I4H A;  1STE A;  1LTG D;  4DV6 Q;  1I50 A;  1HR0 H;  4RUA A;  1PRT C;  4DV6 L;  1I50 B;  3CCR A;  4DUY H;  5EPL A;  1HPC A;  1GOZ A;  2IA6 A;  1DZ1 A;  3PUY A;  4LH6 A;  1SSO A;  5KFQ A;  5LMU Q;  2WTF A;  3ND8 A;  1G91 A;  4IR9 A;  1E3P A;  1EFI D;  4R1J A;  4A3B H;  4N8F A;  4RGN A;  1EZ1 A;  3N40 P;  4G4K A;  5G3L D;  2NU7 B;  2ASB A;  2J6T A;  3H6M A;  1S5D D;  1B7Y B;  4GKK L;  4EYH B;  3C0F B;  2Q8R E;  3FHW A;  1PTO C;  1SRU A;  1H9K A;  2XGP A;  1MBY A;  3RUZ A;  1FGU A;  2D2C C;  1BOS A;  1IBL L;  3C2P A;  4NB3 A;  1MJE A;  3EA6 A;  3E9I A;  3FRP B;  4I4T F;  1ICF B;  4K5V A;  2I5H A;  1WTR A;  1X3G A;  5C3W A;  5CB4 F;  4IFD I;  3OWF A;  3S1N B;  4I50 F;  4J0M A;  4M1U B;  4GOP A;  1CZW A;  1UEA B;  3MR2 A;  5F9L A;  4LF4 H;  2R85 A;  3J81 i;  3K5L A;  5IWA Q;  1IL2 A;  3TP7 A;  4LF7 H;  4BBS H;  3P1H A;  4OO1 I;  4ECV A;  1TWH B;  1S10 A;  3VYT A;  3KAK A;  5IWA L;  4C3H B;  1XMO L;  3W2D A;  2BA1 A;  1EOV A;  3EVQ A;  4DK3 C;  4FVM A;  3K58 A;  4A3F G;  2EYH A;  4Y52 H;  5CV5 A;  4Q8E A;  2Q2U A;  3H0G G;  1WD0 A;  3MFH A;  1WTX A;  2PNH A;  1WCM B;  5D65 A;  3T1H Q;  4O3S A;  2WKD A;  3PF5 A;  2WAQ A;  3LWE A;  3D6C A;  3H15 A;  2BA0 A;  1R9T H;  4BY7 B;  3T1H L;  1JJG A;  2XC9 A;  2AQ4 A;  3GTJ B;  1NTG A;  3TP5 A;  2WAQ B;  3TBI B;  1QVF A;  5L9X A;  5HGQ A;  1TS4 A;  3I90 A;  2MNA A;  2VUM A;  4OO1 G;  2GN5 A;  3QJY A;  2L0C A;  3C3L A;  1H9R A;  4IFD J;  4EEQ A;  2XWB B;  5CV4 A;  2VUM B;  2Y0S A;  3MA2 B;  4YJ3 F;  1AN7 A;  3K7U C;  1YNX A;  4KLK A;  4JYA Q;  1V1O A;  3GQC A;  3GP7 A;  3W5O A;  5IT9 E;  2A8V A;  2Y0S B;  1N36 H;  5LOV F;  2VA3 A;  4JYA L;  2CQA A;  1PHJ A;  3KBG A;  1ZET A;  3Q8S B;  4L8J A;  4YCW A;  1K1S A;  4ECZ A;  1MI2 A;  4IHJ F;  3NEN A;  4ZUI A;  4BWG B;  1KJ9 A;  1RTN A;  1M8A A;  3KXY T;  3HOX H;  3CCJ A;  3T1Y Q;  2JA8 B;  4YHH Q;  4JPB W;  4DR4 Q;  3QZ7 A;  1UE7 A;  1WTQ A;  1WTP A;  5CV7 A;  5JPN C;  3T1Y L;  1E2V A;  2ALY B;  1M1K C;  4DR4 L;  1EUC B;  3PZP A;  1TWF A;  1ENC A;  4OEM B;  1HR0 Q;  3A0J A;  4IPG A;  1V4Y A;  2BR0 A;  1N9W A;  2PI2 A;  2UVR A;  1AH9 A;  4B3M Q;  2FLP A;  2PZU A;  2KCT A;  4KHV A;  1HR0 L;  3OUZ A;  4DUY Q;  1SYG A;  3VA7 A;  3J81 j;  3EBE A;  1ILP A;  1XMQ L;  1PLF A;  4B3M L;  4OEL B;  5COR A;  3MWD A;  4LFC H;  4YBZ B;  5ELN A;  4IRK A;  3SHL A;  1TKW B;  2VB3 X;  2DNE A;  3T4A C;  5A2Q E;  1H95 A;  1VKZ A;  5C3X A;  4R4C A;  3K8A A;  5ISR A;  4A3K H;  4YR3 A;  4IUP A;  3KHR A;  2K1B A;  1G51 A;  4EX5 A;  4JC0 A;  1VQP A;  2RGR A;  3IAY A;  2JEG A;  2UVW A;  1SE4 A;  1SN8 A;  3OHA A;  1YIT A;  3J7A 5;  1EIF A;  4IUR A;  2E75 C;  1SYC A;  3GV6 A;  5D3D A;  3URY A;  3V4S A;  5KFP A;  4LK1 C;  5FJ8 G;  2EIF A;  4JI6 L;  4JBM A;  2R82 A;  1EU4 A;  4TV9 F;  1EOT A;  1TR5 A;  2ZXO A;  3MHB A;  4DK6 C;  4NKL A;  3FKI H;  1PH7 A;  4DV2 L;  1S0O A;  1MKH A;  1DOL A;  4QUF A;  3Q22 A;  5FPO A;  1B3Q A;  4HIO A;  4XYM B;  3K7A B;  4C2M B;  2K04 A;  1KQS A;  2ZJT A;  4RB0 A;  2G9D A;  3BZC A;  2VPQ A;  4CBV A;  1VQ9 A;  2HGS A;  4XQQ A;  3OUU A;  5LA6 F;  4EG0 A;  2F0M A;  4DF7 A;  5C5J A;  3GTG H;  1K3B C;  3BA9 A;  1KHI A;  1E1T A;  1E2Z A;  4V0B A;  1WI5 A;  1SCU B;  3M7G A;  3JSN A;  2BCO A;  4P75 A;  5KFZ A;  2A68 D;  1IBM H;  1LV9 A;  4X3S A;  4JI0 H;  3RV4 A;  4A3D H;  5NUC A;  4JI8 H;  2HD3 A;  2J0T D;  3AEV A;  1FL0 A;  2PCF B;  4ED7 A;  2HQE A;  4MZ9 A;  1YVC A;  1I50 H;  4IUU A;  2LY7 A;  1S03 G;  2Q2H A;  3PIO A;  4B9X A;  2YZG A;  1T5E A;  2PQE A;  4DV7 Q;  1S9F A;  1O7L A;  1I7L A;  3F2D A;  3GTM B;  5EJW A;  3R93 A;  2VL6 A;  4DV7 L;  1GJX A;  5CR3 A;  4DV1 L;  3HKZ E;  4IZ8 A;  3FMA A;  3V6H A;  5HBR B;  2WKC A;  4DNR B;  3S15 B;  3J81 W;  5EOY A;  1PYS B;  3N41 B;  3PW4 A;  2N88 A;  3NTK A;  2NUA B;  3PUZ A;  5M5W B;  1BF4 A;  2B63 G;  3BA8 A;  4LF9 H;  4KK7 A;  3SXH A;  1D8L A;  2YZN A;  5EAY A;  3JAM i;  1PFN A;  4WJW A;  5F2D A;  1S40 A;  1CQI B;  4Q43 A;  5KND A;  3WNZ A;  1L2F A;  4KD4 A;  2JA5 G;  5IYC H;  2UXC Q;  3LP8 A;  5GAD C;  5KFT A;  5EWF A;  4ZHQ F;  4Q45 A;  1EUJ A;  1BCP F;  4UCU A;  2UXC L;  2EQS A;  3S1N H;  2CW0 C;  4JI3 Q;  1WOC A;  5KFJ A;  2EY1 A;  4F4Y A;  3HKS A;  3LNN A;  1DM0 B;  2GPS A;  4F50 A;  1YJ9 A;  2ZJP A;  4R7R A;  4IPC A;  4JI3 L;  2AMC B;  1KC8 C;  4LF6 H;  1ZHQ A;  2CQY A;  3I8Z A;  1IW7 C;  3SK4 A;  1CKM A;  3VPB A;  1TWH H;  4QWE A;  3LWU A;  4X3U A;  1KJJ A;  2R7F A;  4C3H H;  2R7Z G;  4F7X A;  2QDB A;  4P2C B;  1SFO A;  1LT4 D;  4PZ7 A;  4DR5 L;  3OW7 A;  3HOZ B;  5CA0 F;  1CK1 A;  4JI4 H;  4XXE A;  4IPD A;  4KHZ A;  4EGQ A;  4H02 A;  5FOB B;  1IYV A;  1SFO B;  3BYT B;  1ENF A;  2P0A A;  1F2M A;  2TSS A;  1SLJ A;  2V4R A;  4GNX A;  4RB2 C;  4RKL A;  1WCM H;  1J5E H;  5IT9 W;  1G8Z D;  5BMV F;  1EQT A;  4LF8 Q;  2R7K A;  4BY7 H;  2ASL A;  1WYD A;  4RFB A;  3GTJ H;  2VR1 A;  4HJ5 A;  4X66 Q;  2N55 A;  4LF8 L;  1BBX C;  3GTQ B;  5DQH A;  4KY6 A;  2OQK A;  3J7A F;  3TRE A;  4X62 Q;  5EPK A;  4X66 L;  2B2W C;  1GHJ A;  3QG1 A;  2JA7 A;  1I4P A;  4B3R H;  4HNU A;  2HT1 A;  4X62 L;  2JA7 B;  4FP5 D;  1B50 A;  3M85 A;  3HOY G;  2VUM H;  1BCP C;  5CYU A;  3NUC A;  2YW2 A;  1K83 B;  3NE5 B;  1DCZ A;  2MCT A;  1B33 N;  1B6S A;  3RLO A;  3KF8 A;  2YYA A;  4IUQ A;  2FIN B;  5KG7 A;  4LUZ A;  4K8I A;  2X69 A;  4XZ3 B;  4CJ2 C;  3K80 C;  5HGT A;  2AQ1 B;  2R7D A;  5C44 B;  5JEA J;  2FP4 B;  2EXD A;  1C9O A;  5A2Q W;  4HCE A;  3IFD A;  4O4L F;  2L11 A;  2GVA A;  3MEF A;  1DV2 A;  3K3V A;  2JA8 H;  2CKZ B;  4EFB A;  1BQQ T;  2UU9 H;  2E2I A;  1HH2 P;  2K01 A;  3H20 A;  2DJF C;  4JI8 Q;  4C5B A;  1B1Z A;  4RNM A;  5ELB A;  4BBR B;  1QOH A;  1Y1W A;  1EEI D;  1YHB A;  3I2Z A;  1TWC A;  5GQO A;  5C8Y F;  1QNU A;  1PVO A;  1B04 A;  4I55 F;  2F0U A;  1EIG A;  4DR3 L;  1CM9 A;  4KKS A;  2F3W A;  3GO5 A;  2WYO A;  2JEF A;  2AWO A;  3NEL A;  1U4R A;  3I4N G;  1FR3 A;  5C0X J;  2GPW A;  1YJN A;  4MHE A;  3MR6 A;  4DV0 L;  2V4Q A;  1XNQ H;  3G6J B;  4RZR A;  2PMZ A;  2JA6 G;  1SNO A;  5KFV A;  5DQG A;  3S14 B;  4DL7 A;  3I4N B;  2W70 A;  1U5K A;  2WE6 A;  4MV8 A;  4IOC A;  2EYL A;  1DOK A;  1W2B A;  4F4W A;  1MSG A;  4L63 B;  2YS6 A;  2DUD A;  3U4V A;  1X32 A;  1EIH A;  1CQV A;  1ML0 D;  1E4E A;  2B2W A;  4DXG A;  1HNZ Q;  1HRJ A;  2R87 A;  1KAB A;  5EBC A;  4EBE A;  3OW2 A;  5FJ8 H;  1E4E B;  1HNZ L;  1B44 D;  2KEN A;  2E5L L;  3GTP H;  3K7A H;  4MA5 A;  4C2M H;  3A74 A;  2R93 A;  5C1P A;  2KCC A;  4JG2 A;  2A6E C;  4LF6 Q;  1KC7 A;  2DPJ A;  1SJE D;  4A93 B;  2SNS A;  4K2L A;  4PMC A;  5CBE E;  4KJO A;  5K2M A;  1SXT A;  3C1E A;  4A3I G;  3KLS A;  4KKT A;  2IWH A;  1N32 H;  3EYY A;  5KFG A;  3W1B A;  2HUG A;  4LSX A;  3ULP A;  2UUC L;  1X3E A;  2IX3 A;  4DR2 L;  4DL3 A;  1C30 A;  4ZLT F;  1MJC A;  4FNF A;  2UVU A;  1GUG A;  3RBE A;  4GC6 A;  1Q8K A;  2HQL A;  1SEB D;  2LSS A;  1J5E Q;  2JP1 A;  2UXB L;  4UFZ A;  4XQJ A;  2K05 A;  2F4I A;  1PZI D;  4GLV B;  4CKE A;  3FVQ A;  3HOV G;  4YAK B;  2AGP A;  2YRX A;  4H7B A;  4FM9 A;  1HZA A;  3RLF A;  3GTM H;  2W9B A;  1TT2 A;  3I3C A;  2UUA H;  5I4D A;  4UDU C;  1LTT D;  1HZ9 A;  3SK6 A;  4XYL B;  1XDN A;  3S15 H;  2L15 A;  1NCV A;  4B3R Q;  3UE1 A;  1YJW A;  5C3E B;  2MHV A;  4HED A;  4JI7 H;  1FNU A;  5M5W H;  4X64 H;  4UP9 A;  1UNN C;  3Q0A A;  1EWC A;  2HIX A;  1TQO A;  3RR5 A;  1Z9F A;  3GTL A;  4NXM H;  2R86 A;  3KTM A;  2B2T C;  3U9O A;  1VF5 C;  5CC4 A;  2CH4 A;  4APV A;  2A1A A;  1EFW A;  1PH3 A;  4TQU S;  3GTL B;  3JRX A;  5EZY F;  1STH A;  4UCT A;  1ET9 A;  1GKH A;  4LFA H;  5LL6 S;  5BPF A;  3MFG A;  3JRW A;  2KHJ A;  1Y1V G;  5KT3 A;  3AFP A;  2UU9 Q;  1HXY D;  1V8Q A;  2IL8 A;  1DV1 A;  3L2P A;  2DY8 A;  2V59 A;  2Z9H A;  3CP0 A;  3MZ5 A;  4L6T B;  4TQR A;  3G71 A;  3SK8 A;  4K6L A;  4RUC A;  5K36 H;  5DLG A;  4A3J G;  2Z4H A;  3UDF A;  1FVI A;  4B08 A;  3ORQ A;  3RB3 A;  3HOZ H;  3KDF A;  1IYJ B;  3QIA A;  1JX4 A;  2EJG C;  1SYE A;  1SFO H;  5JJK A;  5ELE A;  3PUX A;  4PQX A;  5EKK A;  2K5D A;  3KDF B;  2JYO A;  2DY7 A;  1Q7Y C;  4H13 C;  1O7I A;  4A3J B;  1PH8 A;  3M4Q A;  3ND9 A;  1C3O A;  5I9O A;  4NXN H;  1IBK Q;  2VQD A;  2OLS A;  2PN1 A;  4QMG A;  4ECT A;  1D2B A;  3PCO B;  2A74 C;  2CZG A;  4Q44 A;  1IBK L;  1EU3 A;  3RB0 A;  2RSO A;  3GTQ H;  1B53 A;  3BS1 A;  2I0Q A;  4J9Q A;  4ZCK A;  1AZQ A;  1M90 C;  4PMB A;  4LWC A;  4KI0 A;  5LXT F;  2JA7 H;  1BGW A;  1HQM C;  5C4X G;  4DV6 H;  1S0M A;  2NBF A;  2O5J C;  2EXZ A;  1NNX A;  1K83 H;  1PFM A;  2ZDG A;  3RIZ A;  2QIL A;  4AYB A;  1R9T A;  2UUB L;  1WH2 A;  1GM5 A;  5IGC A;  4ZOL F;  1EZ8 A;  2I07 B;  1RD9 D;  1R9T B;  1QG7 A;  2EJF C;  4RHS A;  1QIL A;  5IE8 A;  3CC4 A;  2L1B A;  1E4F T;  3NSW A;  1LT6 D;  1BDO A;  5IOC A;  2YTY A;  3HXL A;  4MTD A;  3PW2 A;  3S1M B;  1DIK A;  2R8H A;  5C44 H;  3G6E A;  1XPO A;  4PG3 A;  4Y8V B;  1UE1 A;  4GKK H;  3WOF A;  1KJI A;  1N32 Q;  3E5S A;  4KKU A;  3MAQ A;  4ZQ3 A;  4A75 A;  3QOL A;  2NU6 B;  5FLM G;  4ODG A;  4HMJ A;  3BDO A;  4BBR H;  1IBL H;  5KKN B;  2DN8 A;  2WIN B;  3R2T A;  5KNC A;  4DR6 Q;  1JOK A;  2K6A A;  1L0W A;  4RAU C;  3VDY A;  2NWG A;  1SNQ A;  4DR6 L;  4J9L A;  3M4I A;  5KFH A;  1E2W A;  5KT7 A;  2WB1 A;  2UUA Q;  4YCV A;  5GRO A;  4L5R C;  3S17 B;  5HV6 A;  2R7N A;  4QWD A;  3CCQ A;  3VR3 A;  1KD1 C;  1BBW A;  3H3V I;  5DM7 3;  1D6E C;  4X64 Q;  5IWA H;  2RCF A;  3PR5 B;  4LJZ C;  1KJQ A;  5KG4 A;  1XMO H;  4RGM A;  3S14 H;  3I4N H;  1F9P A;  2VQE Q;  3NEM A;  2XIG A;  2ASJ A;  5EKL A;  1UC9 A;  4E4T A;  4UHV A;  4ZYS A;  4C1N I;  1D1K A;  2R7M A;  2VQE L;  5FO7 B;  4NXM Q;  2B2U C;  3MXU A;  3PQI A;  4M8A A;  3EN2 A;  4A3G G;  1NY4 A;  4MTK A;  4NXM L;  2KA7 A;  1YNJ D;  1JCK B;  2Z6K A;  3HOU G;  3T1H H;  2O03 A;  1D5Z C;  4CDF C;  2NZ1 D;  4A4I A;  4JV0 A;  1JE4 A;  1HQR D;  3K3P A;  4A2B A;  4DFA A;  3Q1K A;  3AB9 A;  1VDZ A;  3NPP A;  4A93 H;  4KMU C;  3U50 C;  3HOU B;  1SMY D;  2J7Z A;  4G7Z C;  1WVL A;  4L5S A;  4ZKB B;  5K5P A;  3PW0 A;  2F0K A;  1B2T A;  4EEY A;  4F88 A;  4QJF A;  3AU7 A;  2AQ3 B;  3WO1 A;  1QJO A;  4GOP C;  4IWX A;  5L1L A;  2OTJ A;  3GID A;  5ELC A;  4JYA H;  2W6M A;  4RCN A;  4MIU A;  4EQP A;  4JI2 L;  3RV3 A;  2D0P A;  4LUO A;  3CD6 A;  2NUC A;  1N8R C;  2W6O A;  1DD2 A;  3GTG A;  2A69 D;  1I6V C;  4NXN Q;  3PV0 A;  2D5D A;  2OTL A;  5E3F A;  2BE5 D;  4DUZ Q;  3QR8 A;  2XRS D;  5IYZ F;  4J9S A;  1A15 A;  3TP6 A;  1EZ6 A;  2JSO A;  2KUM A;  1QB5 D;  4DUZ L;  3NHH A;  3T1Y H;  4F87 A;  3TRZ A;  4DR4 H;  1M7J A;  1E7Z A;  4YR0 A;  4DN4 M;  5DM6 3;  4J9K A;  2W7P A;  2G5D A;  3G6Y A;  1LO5 D;  4HYK A;  5C3E H;  1D5M C;  3J7A K;  1NJI C;  2R6F A;  3H4D A;  4J9N A;  1XMQ H;  4B3M H;  1ILQ A;  5LMN Q;  3B6Y A;  2QA4 A;  4J6H A;  3Q8P B;  3Q8D A;  2J6S A;  4CJ0 B;  5LMN L;  3EIV A;  3CU7 A;  4IOA A;  4B3T Q;  3GTL H;  2KHI A;  3ULL A;  5IOD A;  4FO2 A;  5M3F G;  2B2U A;  2MP1 A;  4B3T L;  4RWS C;  1PH4 A;  4GKK Q;  1Q81 C;  2FB9 A;  3WOE A;  4QIW E;  2KCM A;  4GLX A;  4IO9 A;  1RK6 A;  4WRD A;  1NR4 A;  2RDH A;  1FKA H;  5M3F B;  1MD2 D;  3HS0 C;  4JI6 H;  3KAJ A;  5IGG A;  1IBL Q;  3STB D;  4ULL A;  4LMQ D;  4JBW A;  4X6A H;  1YZ6 A;  4DV2 H;  4G3I A;  3U9T A;  3KAL A;  5T14 A;  5M5X B;  2OT2 A;  3J81 E;  1KAW A;  5C6A A;  3E0J A;  1HJP A;  3MWE A;  4A3J H;  3BZD B;  4MV6 A;  2FJ2 A;  4DR1 Q;  1HNW Q;  3SI8 A;  1TWH A;  2EY6 A;  3OHB A;  1VF7 A;  5M5Y B;  3PO2 G;  3NTH A;  2JA9 A;  4HSV A;  5E4W C;  3OWE B;  4DR1 L;  1VMC A;  5E7N A;  1XMO Q;  1HNW L;  3KUP A;  4M9U A;  1LT5 D;  4QW9 A;  1NR2 A;  4A2A A;  4A76 A;  4PV1 C;  4LH7 A;  2N8N A;  4UP7 A;  3CCV A;  4RH6 A;  2QEJ C;  5KFD A;  2QF7 A;  3UDG A;  1WCM A;  1I3Q B;  2NYZ D;  5M9O A;  1CSQ A;  3BDC A;  1A3U A;  3TIN A;  2H1E A;  1ZYR C;  4JW0 A;  3C46 A;  2O2L D;  1NMG A;  1GLV A;  1YI2 A;  2IHF A;  4DL4 A;  4IFD G;  3GTJ A;  2AQ2 B;  2XNA C;  4A3F B;  3H0G A;  4DV7 H;  4NDX A;  4DV1 H;  2LFN A;  4K8J A;  4ZQI A;  2DZD A;  1CHP D;  1G2T A;  5CGK A;  2PVP A;  3H0G B;  5KG1 A;  3S1M H;  3RB4 A;  2D0O A;  1BKB A;  3HKZ G;  3CC2 A;  3GD7 A;  4O0A A;  1PH2 A;  2EZV A;  2RDF A;  2QCP X;  4GN4 B;  5BPH A;  5C5M A;  2C9O A;  4J15 A;  2ZDQ A;  3Q6S A;  5D14 A;  4DPG A;  3ERO A;  3PO3 G;  1EQR A;  4A3C G;  4TV8 F;  1NE3 A;  1PRT D;  1DON A;  3GDE A;  2Q8I B;  1EL0 A;  2RGV A;  4YB8 B;  3TII A;  4RCO A;  4LF5 Q;  3RGX A;  2AUK A;  1RJT A;  4ZK9 B;  4LAA A;  3K5N A;  1PH1 A;  4LF5 L;  3VPC A;  1STY A;  1TAE A;  3PO3 B;  4MN3 A;  1VQH A;  1PRT B;  4HJ9 A;  2UXC H;  3U58 A;  4I7H A;  2DIK A;  3MJF A;  2G9H D;  1K0S A;  2B2V A;  3MWY W;  3S17 H;  3KJP A;  4JI3 H;  4MV4 A;  1PYB A;  4XT3 B;  3CQZ A;  2JEA I;  1B70 B;  1Q82 C;  1JWS D;  2GVB A;  3A8J E;  3EQL C;  3IFT A;  1BXT A;  1VCI A;  2F0L A;  3CCS A;  3GIQ A;  1WTV A;  1P16 A;  3CQZ B;  1SNM A;  1PTO D;  4ZAI A;  1AUX A;  3N42 B;  2NU8 B;  1BUV T;  3QO2 A;  3NQT A;  1XMQ Q;  4ILW A;  2F0N A;  5CBA E;  4C3J G;  3RFC A;  4DR5 H;  1JXL A;  4KHP H;  2MQH A;  4EQ5 A;  1MGS A;  1CI3 M;  1RJR A;  1EYD A;  2EY2 A;  2KED A;  3M4Y A;  5KEE A;  3OTO L;  1WTO A;  1EQQ A;  1OO9 B;  4I65 A;  1VQ6 A;  4R4O A;  4MV7 A;  4R4Q A;  2QDL A;  2E2H A;  1FYC A;  1PFB A;  2RHS B;  4LF8 H;  1F2Y A;  5E4X A;  5KFX A;  2E2H B;  2K5Q A;  3RZD B;  1AN8 A;  1KDA A;  2E74 C;  4C1N K;  3RNU A;  4X66 H;  1PA6 A;  4JI6 Q;  4PWQ A;  3RBD A;  1XYI A;  1PZJ D;  3HOU H;  2Z6B A;  1GUW A;  1KJ8 A;  4X62 H;  3F2U A;  4K5X A;  2BDN A;  4UAI A;  3K6O A;  4EGV A;  3FPU B;  4DV2 Q;  1Z6H A;  3G4S A;  1GD7 A;  4N8X 1;  1I5F A;  4X3T A;  3GTP A;  4LMY A;  4C2M A;  3UE0 A;  5BN4 A;  2R92 G;  4TKO B;  3ORR A;  2YL2 A;  2SNM A;  4RMF A;  2W9C A;  1ASY A;  3GTP B;  1KRS A;  1EWI A;  3OHX C;  2V1C C;  2YTX A;  4X3K A;  2FJZ A;  4IZO A;  3GIK A;  2KSW A;  2EYJ A;  4KJN A;  1SNC A;  3I4M G;  1H9J A;  1XNR Q;  1GHK A;  2W9C B;  1SDF A;  1SMX A;  2V58 A;  1V1P B;  2ZXP A;  5CV6 A;  3N6X A;  4NMZ A;  1BNC A;  3HB9 A;  4DGZ A;  5J3B A;  5KYL A;  1XNR L;  4Y7N B;  3LX0 A;  4XDX A;  3W3A A;  2F4V Q;  2K5H A;  1CFM A;  4GNX C;  5KRU A;  2F4V L;  2B29 A;  1ULZ A;  4EBC A;  2XVS A;  4AIM A;  5JVD F;  1EYC A;  2BQ3 A;  2PQA B;  4KY7 A;  4C56 C;  4DR3 H;  3KLR A;  4XIG S;  3SGI A;  3GTM A;  3T16 A;  5IYB G;  1RF2 D;  2F03 A;  4R8N A;  2A19 A;  4DV1 Q;  2UXD L;  3IN5 A;  1UWV A;  3VR5 A;  1U9R A;  1Q1B A;  2QKI C;  3GTK B;  1JB7 A;  1RK5 A;  4ID6 A;  1E4G T;  4OX9 H;  1X6O A;  4GZY C;  3LML A;  4F4X A;  2CFM A;  3ONA B;  4DV0 H;  2C00 A;  4UCO A;  5KYI A;  4K6D A;  5KFF A;  1NUC A;  4DAM A;  3JAM E;  2H5X A;  2J9G A;  4HTH A;  3CRK C;  1MHW C;  1JWU D;  1Y8P B;  2WAQ E;  3E3X A;  5M3F H;  2D9U A;  3NQI A;  4WFN 3;  4LNQ A;  4R8U A;  5ELD A;  1CQJ B;  3J80 i;  1TU2 B;  4RHR A;  4RB3 C;  1JJ2 A;  2K5W A;  5T1G A;  1S68 A;  1E24 A;  5CA1 F;  2B63 B;  4R8U B;  4O2A F;  5M5X H;  4J1M A;  1HNZ H;  5EPJ A;  2E5L H;  3K0Y A;  4ED3 A;  3M4P A;  3BJY A;  2HVS A;  2Y0S E;  3P7J A;  3J81 c;  5DLQ E;  2JA5 A;  2WP8 J;  4MNO A;  1Q90 A;  4DK0 A;  4DNT B;  5KFY A;  1K1Q A;  2W6N A;  2JA5 B;  3NWS A;  5KT2 A;  5M5Y H;  1EHI A;  3R5H A;  1X65 A;  1RYR A;  3DWA A;  2ZTD A;  1ZQ7 A;  4XQN A;  2NVX B;  4HN7 A;  4LFB L;  2UUC H;  4DR5 Q;  4DR2 H;  4O2D A;  1VQA A;  4KHP Q;  3J81 L;  1BVS A;  3ERQ A;  1PH9 A;  3TME A;  1YEZ A;  4KHP L;  1T5X D;  4GKJ L;  3A54 A;  3DEP A;  2RVL A;  1I3Q H;  2NVQ B;  3HFZ B;  4HNT A;  2UXB H;  3R5X A;  1VQG A;  5I6Y A;  2R7Z B;  2PI2 E;  2SOB A;  1QUQ B;  3W1G A;  3F8N A;  1UC8 A;  4A3F H;  4F8M A;  3GTQ A;  2NZH A;  4QGU A;  1OXS C;  3H0G H;  1CKN A;  3BU2 A;  3NP8 A;  2IBK A;  3P20 A;  3MXN A;  4IFD H;  2F0I A;  1CKN B;  1HUM A;  2IHE A;  2K5V A;  2K52 A;  2E8G A;  3M4O B;  5J22 A;  3GIP A;  1K83 A;  2H4O A;  3MXN B;  1R4Q B;  4DL5 A;  3DHQ A;  3N44 B;  5C0X I;  4XT1 B;  2QEX A;  2HHH H;  5JEA G;  4J9O A;  1YBY A;  2HDM A;  4A3E G;  4OO1 H;  5IT9 c;  3EPG A;  3H94 A;  2K03 A;  3OMC A;  4OL7 A;  3HOY B;  4YAJ B;  1J9O A;  4PZ6 A;  3PO3 H;  3DMU A;  4WD3 A;  4A3C H;  5EWG A;  5D3I B;  3PW7 A;  1VQI A;  3PIP A;  3KFU A;  4TSS A;  1VAJ A;  1UEB A;  3FMC A;  4HSP A;  4MV9 A;  2NN6 I;  3CAM A;  5LL6 b;  4NP5 A;  1H9S B;  4HIM A;  3E9H A;  5IT9 L;  3RN5 A;  1ENA A;  2OH2 A;  1A3T A;  1KRT A;  3HOW G;  2SCU B;  1CT1 D;  3CQZ H;  3DWQ A;  1DYQ A;  1S5E D;  1NSN S;  5C0X G;  2ZJR A;  4QWC A;  4CDE C;  4DR3 Q;  1UAP A;  5ELF A;  1FJG Q;  4AQY H;  1JIH A;  3K81 C;  1XTD A;  3KK7 A;  1PH6 A;  2R6G A;  2F0P A;  2OF1 A;  4IJL A;  4RAY A;  1NBW A;  1FJG L;  5FO9 B;  1AE3 A;  4DV4 H;  4OX9 Q;  1RKN A;  2RQX A;  4DV5 Q;  1PYW D;  5GON F;  4BXX G;  3BDL A;  2CW0 D;  2MUY A;  2NN6 G;  1PXU A;  1NMF A;  2C35 B;  5KGU A;  4DV0 Q;  4IQZ A;  5C4Z A;  4O4H F;  4OX9 L;  1UNS A;  4DV5 L;  1IBK H;  2E2H H;  3RZD H;  5IP7 G;  3RF2 A;  5KG3 A;  1IW7 D;  2VZA A;  5GAH C;  2R8G A;  2Z0S A;  1VQJ A;  1N48 A;  1EY0 A;  1CSP A;  1LUZ A;  2F0H A;  5A2Q L;  3MFI A;  4ECX A;  4A3L G;  2RBM A;  4IAL A;  5F9N A;  1Q1E A;  4FXG C;  1LTS D;  3I72 A;  4LW1 A;  4JBK A;  2L5T A;  3D4D A;  1A6X A;  2AGQ A;  2JA6 B;  1B8A A;  4ME3 A;  2UUB H;  2JEB I;  3A8K E;  1KNA A;  3CF5 A;  2E5L Q;  2W7O A;  4O3P A;  1HA6 A;  4U7C A;  4DK1 A;  4IAJ A;  2LMC B;  4RAZ A;  1KNE A;  1X3Q A;  1F9R A;  1BJT A;  1I94 Q;  2CHB D;  2FE3 A;  1GUO A;  3TQ1 A;  1VQC A;  1I94 L;  2MO0 A;  2XN9 C;  1ET6 A;  4Y7N H;  1VQE A;  1UE5 A;  5IP9 G;  2F0V A;  4DR2 Q;  2UUC Q;  5AJ3 Q;  1VBH A;  5JUM A;  3OSN A;  1F9Q A;  3ZYY X;  3RGZ A;  3RB6 A;  5C1O A;  1BCP D;  5AJ3 L;  1Y8N B;  1ASZ A;  1VQN A;  5DG8 A;  2F0G A;  2R93 G;  3BQ0 A;  3JAM W;  3N52 A;  4A3I B;  2UXB Q;  3H40 A;  3RD4 A;  4OIK A;  2C5C A;  5DNF A;  2E2J B;  1SYX B;  4DR6 H;  2FLL A;  3IL8 A;  2X0S A;  4ED2 A;  3E0E A;  1D1I A;  2FK3 A;  5M3M G;  2Q2I A;  5DG7 A;  3I7F A;  4HJ7 A;  4MTE A;  1DGS A;  2B39 A;  3GTK H;  2A6H C;  2W71 A;  2HCC A;  2ZXR A;  4BA1 I;  2KJX A;  3FDT A;  1L1O A;  3AMU A;  3VPD A;  4IN3 A;  5M3M B;  3HOV B;  3HZX A;  2VOB A;  3JAM c;  2M2L A;  1L1O B;  1K8O A;  1B9M A;  3S9W A;  3RJ0 A;  2HHH Q;  2J4X A;  2VQE H;  1VQ5 A;  2HHH L;  3GIM A;  2LXK A;  1Y14 B;  3VYU A;  5DQI A;  3LWB A;  1K9M C; 
#chains in the Genus database with same CATH homology
 1CUK A;  4IPH A;  3RLN A;  3NEN A;  2B63 H;  4R4T A;  4LFC Q;  4PMW A;  3HOX H;  2F52 A;  4QJF A;  3CCJ A;  3T1Y Q;  4YHH Q;  4DR4 Q;  2ZTE A;  4LFC L;  4GOP C;  2FXQ A;  1UE7 A;  2OTJ A;  2RCN A;  1JT8 A;  3T1Y L;  2K5N A;  2ALY B;  1M1K C;  4DR4 L;  4JI2 L;  2D0P A;  4LUO A;  1HR0 Q;  2JA5 H;  3CD6 A;  3A0J A;  1AE2 A;  4IPG A;  1N8R C;  1N9W A;  2PI2 A;  1AH9 A;  4GNX B;  4B3M Q;  4NXN Q;  1G6P A;  3PV0 A;  3I55 A;  2KCT A;  3ER0 A;  1HR0 L;  2VQF L;  1LYL A;  1J6Q A;  4DUY Q;  3J81 j;  2NVX H;  3EBE A;  3CMA A;  4DUZ Q;  1XMQ L;  4B3M L;  4XTC S;  4AQY Q;  1A0I A;  5ELN A;  3HOV H;  3NBH B;  4DUZ L;  3TRZ A;  1H95 A;  4AQY L;  3I4O A;  4BY1 H;  1E7Z A;  1G29 1;  2NVQ H;  4UPA A;  4R4C A;  2I5L X;  3K8A A;  4DV4 Q;  2MFI A;  4A3K H;  5C3E H;  1K3R A;  1VQO A;  1G51 A;  4EX5 A;  4JC0 A;  1VQP A;  1NJI C;  2R7Z H;  4DV4 L;  1SN8 A;  1VQL A;  1YIT A;  3ERS X;  5C44 G;  3J7A 5;  1EIF A;  3G48 A;  5LMN Q;  3RN2 A;  3B6Y A;  2IY5 B;  2QA4 A;  3A5U A;  1OXX K;  3Q8D A;  4YWM A;  2JQO A;  3LGJ A;  5LMN L;  3KF8 B;  1S72 A;  3EIV A;  5FJ8 G;  2EIF A;  1VQ8 A;  4JI6 L;  2IX1 A;  4JBM A;  4IOA A;  4B3T Q;  3GTL H;  2KHI A;  3ULL A;  1L1O C;  4PZ8 A;  4BBR G;  3M4O H;  4DK6 C;  5M3F G;  3FKI H;  1IZ6 A;  4C3J H;  1PH7 A;  2Z6K C;  4B3T L;  4DV2 L;  1PH4 A;  4GKK Q;  3KLW A;  1MKH A;  1Q81 C;  1IBM Q;  2UUB Q;  4BBS G;  1Y1W G;  1JJG A;  1YHA A;  4QIW E;  2KCM A;  4HIO A;  4IO9 A;  4GLX A;  1VQF A;  4JI0 Q;  2PMZ E;  1IBM L;  1A62 A;  4QY7 A;  3AYH B;  4JI0 L;  1KQS A;  4JI4 L;  1Q12 A;  4JI8 L;  3PSI A;  1IBL Q;  1TWF H;  3BZC A;  3CXC A;  1VQ9 A;  3STB D;  3HOY H;  4UY8 C;  4JBW A;  4X6A H;  1YZ6 A;  3GTG H;  2N78 A;  4DAY B;  1QVC A;  1KHI A;  1E1T A;  1GO3 E;  4JI5 Q;  1WI5 A;  1U0L A;  2XGT A;  4P75 A;  3I56 A;  4AYB G;  3CCM A;  4JI5 L;  1EYG A;  4A3D H;  1KAW A;  2DGY A;  1LTL A;  3PUV A;  5IYD G;  1HJP A;  3M9B A;  3AEV A;  1FL0 A;  4A3J H;  4MZ9 A;  3CC7 A;  1YVC A;  4DR1 Q;  1HNW Q;  1I50 H;  4LF9 Q;  3PO2 G;  2Q2H A;  2JA9 A;  3PIO A;  4DV7 Q;  3DM3 A;  5E7N A;  4DR1 L;  2JE6 I;  3TS0 A;  1XMO Q;  1HNW L;  2R92 H;  3A5Z B;  4LF9 L;  3F2D A;  1N34 L;  2QGQ A;  2VL6 A;  4DV7 L;  4A76 A;  1K73 C;  4DV1 L;  5GAG C;  1VQD A;  3HKZ E;  2N8N A;  1K0R A;  4UP7 A;  3CCV A;  3I4M H;  2LXJ A;  4POF A;  1PYS B;  3UDG A;  4A93 G;  5BR8 Q;  1CSQ A;  3PUZ A;  4P72 A;  4FDB A;  2JJQ A;  1YIJ A;  2B63 G;  1NMG A;  1YI2 A;  2IHF A;  4C3I H;  5BR8 L;  4IFD G;  3J7Z C;  1D8L A;  1K8G A;  4BXX H;  5EAY A;  3HOX G;  3JAM i;  2ZJQ A;  1CKO A;  2WB1 G;  2CQO A;  1S40 A;  4LF6 L;  4LUV A;  4DR7 Q;  3S1M H;  1JJC B;  2D0O A;  1BKB A;  3HKZ G;  3CC2 A;  3GD7 A;  4O0A A;  1PH2 A;  1L2F A;  3KJO A;  2JA5 G;  1IXR A;  5IYC H;  4GN4 B;  1Q86 C;  5GAD C;  2JA6 H;  3I4N H;  4DR7 L;  2UXC Q;  5IYB H;  4J15 A;  1EUJ A;  4DPG A;  2UXC L;  1VS0 A;  2EQS A;  4JI4 Q;  4JI3 Q;  1WOC A;  2BH2 A;  4A3M H;  3J80 c;  1EQR A;  4OXP A;  3HKS A;  3PO3 G;  4A3C G;  1TWA H;  1NE3 A;  3GDE A;  1YJ9 A;  2ZJP A;  1MIU A;  4IPC A;  4JI3 L;  2AMC B;  1X9N A;  1KC8 C;  1PV4 A;  3FP9 A;  1X54 A;  4LF5 Q;  4WJ3 M;  1I6H H;  1CKM A;  3L0O A;  1PH1 A;  4LF5 L;  4A3K G;  1TWH H;  1J5E L;  1XPU A;  1VQH A;  5C3E G;  4HJ9 A;  1VQ7 A;  2R7F A;  4C3H H;  2R7Z G;  3U58 A;  1S3O A;  3PUW A;  4HJ8 A;  3D31 A;  2OQ0 A;  4PZ7 A;  2RHQ B;  3UDI A;  3CPW A;  4DR5 L;  3F2B A;  3S17 H;  3BZK A;  4IPD A;  4KHZ A;  3KJP A;  1PYB A;  4H02 A;  4JI2 Q;  3WWV A;  1KIX A;  1B70 B;  2JEA I;  1Q82 C;  2GVB A;  1HZB A;  1XJV A;  1SLJ A;  4A3I H;  1VCI A;  4GNX A;  4OWT B;  3CCS A;  4B3R L;  1WCM H;  1P16 A;  2E2J H;  1QZG A;  2VQF Q;  4LF8 Q;  1HNX L;  1OXV A;  2VY3 A;  1XMQ Q;  4B3S Q;  3KOJ A;  3FKI G;  4BY7 H;  5ELO A;  1WYD A;  4L5T A;  3GTJ H;  4HJ5 A;  4X66 Q;  4LF8 L;  1RL2 A;  3F2C A;  1K8A C;  4B3S L;  3S1N H;  2VNU D;  4QL5 A;  2MQH A;  4EQ5 A;  2OQK A;  3TRE A;  2B3G A;  4X62 Q;  4X66 L;  4BY7 G;  3M3Y H;  4WJ4 A;  5JJL A;  2HT1 A;  5M3M H;  1A8V A;  4X62 L;  1OXT A;  3OTO L;  3M85 A;  1XPR A;  1EQQ A;  1VQ6 A;  2VUM H;  4R4O A;  3HOY G;  4R4Q A;  2K4K A;  3F1Z A;  3ULJ A;  1BBU A;  3KF6 A;  2RHS B;  1UE6 A;  4BA2 I;  2RF4 A;  3RLO A;  2UU9 L;  4JCV E;  1VQB A;  3KF6 B;  2F3I A;  3RNU A;  1PA6 A;  1V1Q A;  4JI6 Q;  4LUZ A;  2CWA A;  3HOU H;  4A3D G;  1KXL A;  4JI1 Q;  1X55 A;  3K80 C;  4DV2 Q;  2R7D A;  1E22 A;  4JI1 L;  5JEA J;  3G4S A;  2EXD A;  1C9O A;  1GD7 A;  4P74 A;  2GVA A;  3MEF A;  1EIY B;  3D0F A;  2YYZ A;  1I5F A;  2CKZ B;  3CME A;  2ES2 A;  2JA8 H;  4K0K L;  1HH2 P;  4AYB E;  3UE0 A;  2R92 G;  2WFW A;  4JI8 Q;  4RMF A;  1ASY A;  1QZH A;  1KRS A;  1EWI A;  1N33 Q;  2V1C C;  2ID0 A;  2YTX A;  3I4M G;  1YHB A;  3I2Z A;  4RG1 A;  1XNQ Q;  5GQO A;  1SMX A;  2VS1 A;  4YWK A;  1XNR Q;  3IRB A;  1N33 L;  4A3B G;  1PVO A;  1Y1V H;  1XNQ L;  5J3B A;  1XNR L;  4DV3 Q;  4DR3 L;  4A3E H;  1WJJ A;  1OTC A;  3OYY A;  3GO5 A;  2K14 A;  3CW2 C;  2F4V Q;  1PFS A;  1V43 A;  4GS3 A;  2K5H A;  2AWO A;  3NEL A;  5H1S E;  5LMU L;  4DV3 L;  2MO1 A;  2NZO A;  3I4N G;  5C0X J;  4GNX C;  1JMC A;  3AFQ A;  1VQK A;  1YJN A;  2B29 A;  2F4V L;  4JV5 Q;  4OWW B;  4AIM A;  2PQA B;  3TQY A;  4DV0 L;  4JV5 L;  4OON A;  4P73 A;  5IYC G;  3UDX A;  2JA6 G;  4XIG S;  3SGI A;  4HIK A;  5JJI A;  1N34 Q;  5IYB G;  1U5K A;  2A19 A;  3S14 H;  4DV1 Q;  2UXD L;  4OWX B;  1UWV A;  4IOC A;  2N3S A;  1W2B A;  4JBJ A;  1Q1B A;  3F8T A;  3HOW H;  1JB7 A;  2WB1 E;  2JK8 A;  1P8L A;  2CCZ A;  2DUD A;  3U4V A;  1X6O A;  2VW9 A;  5C4J H;  4TVA B;  2CFM A;  1HNZ Q;  1WFQ A;  1C7Y A;  4DAM A;  5FJ8 H;  2H5X A;  3OW2 A;  1HNZ L;  1N32 L;  2KEN A;  2E5L L;  3GTP H;  2E2I H;  3K7A H;  2WAQ E;  4JOI C;  3S24 A;  2YTV A;  3A74 A;  4C2M H;  1HZC A;  4NPS A;  5M3F H;  2OCE A;  3CCE A;  4JG2 A;  4GOP B;  5C4X H;  4LF6 Q;  4LNQ A;  4QQB X;  3J80 i;  1Y1W H;  1JJ2 A;  1E24 A;  1TWC H;  4A3I G;  4HID A;  4ALP A;  1WCM G;  5IP7 H;  5M5X H;  4MTN A;  2YV5 A;  3W1B A;  3M4P A;  1GVP A;  3ULP A;  2UUC L;  1X3E A;  2Y0S E;  4DR2 L;  1YHQ A;  3J81 c;  5DLQ E;  4YWL A;  1E1O A;  2UUA L;  2CWP A;  3S1Q H;  2WP8 J;  4MNO A;  2N49 A;  3ZJY C;  2WAQ G;  2AKW B;  4A3L H;  1MJC A;  3PF4 A;  4JI7 Q;  1Q8K A;  2HQL A;  2LSS A;  1J5E Q;  5M5Y H;  2UXB L;  1X65 A;  3GTO H;  3S2D H;  4BY1 G;  1VQM A;  2ZTD A;  4GLV B;  2ATW A;  4JI7 L;  3HOV G;  5IYD H;  4X64 L;  3STB C;  5FLM H;  2VUM G;  4LFB L;  1HZA A;  3RLF A;  3GTM H;  4DR5 Q;  4O2D A;  1VQA A;  4KHP Q;  1HR0 W;  1BVS A;  3S2H H;  1RIP A;  1HZ9 A;  1PH9 A;  2Y0S G;  1YEZ A;  4AH6 A;  3S15 H;  4KHP L;  4X65 Q;  2XTI A;  3BJU A;  2K50 A;  4GKJ L;  1I3Q H;  2L15 A;  3HFZ B;  3UE1 A;  4B3R Q;  4LFA Q;  1YJW A;  1VQG A;  1HNX Q;  4X65 L;  5M5W H;  5IP9 H;  2PI2 E;  4UP9 A;  1QUQ B;  3W1G A;  4LFA L;  2HIX A;  4A3F H;  2NZH A;  3RR5 A;  5GAE C;  4QGU A;  4POG A;  2JA8 G;  1OXS C;  1Z9F A;  2AWN A;  2R93 H;  2K75 A;  3H0G H;  1CKN A;  3BU2 A;  3OTO Q;  4APV A;  2A1A A;  2AHO B;  1PH3 A;  4TQU S;  1EFW A;  3L7Z C;  4R4I A;  5LMN W;  2OWO A;  1CKN B;  2IHE A;  2K5V A;  2K52 A;  3CPF A;  2E8G A;  4UP8 A;  1GKH A;  3U4Z A;  1C0A A;  1Q46 A;  3MXN B;  2KHJ A;  5C0X I;  1Y1V G;  2QEX A;  3AFP A;  2UU9 Q;  2BH8 A;  4YCU A;  5JEA G;  4YHH L;  1YBY A;  1V9P A;  1X56 A;  4A3E G;  3L2P A;  5IT9 c;  4GN3 B;  4A3G H;  1X3F A;  4JOI A;  3CP0 A;  1VQ4 A;  3PGZ A;  3G71 A;  4PZ6 A;  3PO3 H;  4HJA A;  4A3C H;  4NXN L;  3TS2 A;  1VQI A;  3PIP A;  4A3J G;  3KFU A;  1SE8 A;  1UEB A;  2IX0 A;  3UDF A;  4DUY L;  4K0K Q;  1FVI A;  2NN6 I;  3CAM A;  3HOZ H;  3KDF A;  3S1R H;  2JA7 G;  3H3V H;  1IYJ B;  4HIM A;  3E9H A;  5HY6 A;  1OXU A;  3RN5 A;  1SFO H;  5JJK A;  2NVY H;  3PUX A;  3KDF B;  4DV6 Q;  1Q7Y C;  1W3S A;  1O7I A;  1KRT A;  3HOW G;  1PH8 A;  3CQZ H;  3M4Q A;  1IBK Q;  4GN5 A;  4DV6 L;  4GLA C;  5C0X G;  3CCR A;  1PH5 A;  2Q2T A;  2ZJR A;  3M7N A;  3PCO B;  4DR3 Q;  5IY0 A;  1IBK L;  1FJG Q;  3ICE A;  3K81 C;  1XTD A;  1PH6 A;  3PUY A;  2I0Q A;  3GTQ H;  2R6G A;  5LMU Q;  4IJL A;  3K0X A;  1NBW A;  1FJG L;  1M90 C;  1E3P A;  1AE3 A;  4KI0 A;  4LWC A;  4R1J A;  4DNI A;  4OX9 Q;  4DV5 Q;  2JA7 H;  4A3B H;  5C4X G;  4BXX G;  2PQA A;  2NN6 G;  2ASB A;  1NMF A;  2C35 B;  4DV0 Q;  2NVT H;  1K83 H;  4DV5 L;  4OX9 L;  2ZTC A;  1B7Y B;  4GKK L;  2E2H H;  3AQQ A;  3RZD H;  2IT1 A;  3FHW A;  5IP7 G;  1GM5 A;  2UUB L;  2VZA A;  5GAH C;  2ZM6 Q;  2UXD Q;  2Z0S A;  1VQJ A;  4LF4 Q;  1SRU A;  5FLX c;  2ZM6 L;  1CSP A;  1LUZ A;  5IE8 A;  3CC4 A;  3CCU A;  4LF7 Q;  1FGU A;  4A3M G;  2YTY A;  1IBL L;  4A3L G;  4NB3 A;  4LF4 L;  1Q1E A;  4LW1 A;  4JBK A;  5C44 H;  3G6E A;  1XPO A;  4PG3 A;  3E9I A;  1MJE A;  1KL9 A;  4LF7 L;  1UE1 A;  1A63 A;  2YU9 H;  1B8A A;  4ME3 A;  2I5H A;  1N32 Q;  1X3G A;  2JEB I;  3CF5 A;  2E5L Q;  4IFD I;  4A75 A;  5FLM G;  4GOP A;  2HIV A;  3KYH C;  4BBR H;  3JC6 6;  1I94 Q;  3J81 i;  4DR6 Q;  5IWA Q;  1IL2 A;  1L0W A;  4BBS H;  1VQC A;  3VDY A;  1I94 L;  2MO0 A;  4OO1 I;  4L5Q A;  4DR6 L;  4YY3 Q;  5IWA L;  4Y7N H;  1VQE A;  2KBN A;  1XMO L;  1UE5 A;  4P71 A;  5IP9 G;  3DLL A;  4DR2 Q;  5AJ3 Q;  2UUC Q;  2UUA Q;  2BA1 A;  1EOV A;  4YCV A;  5GRO A;  4DK3 C;  4YY3 L;  4A3F G;  4L5R C;  5AJ3 L;  1ASZ A;  1VQN A;  4Y52 H;  2R93 G;  3CCQ A;  2Q2U A;  3H0G G;  1KD1 C;  1BBW A;  3H3V I;  3RZO H;  2UXB Q;  1SR3 A;  2PNH A;  3T1H Q;  3PF5 A;  4X64 Q;  1Z47 A;  4LFB Q;  1SRO A;  2I5M X;  3H15 A;  3E0E A;  2BA0 A;  1R9T H;  1QVG A;  1LM0 A;  2VQE Q;  1TWG H;  3NEM A;  5M3M G;  2Q2I A;  3T1H L;  1N36 Q;  3I7F A;  2OTL A;  1NTG A;  4HJ7 A;  2D62 A;  1DGS A;  1QVF A;  3GTK H;  3CCL A;  2VQE L;  5HGQ A;  1N36 L;  4NXM Q;  4GKJ Q;  4BA1 I;  2MNA A;  4OO1 G;  2GN5 A;  3EN2 A;  3PO2 H;  4A3G G;  1NY4 A;  1T9H A;  1L1O A;  4NXM L;  4IFD J;  3S16 H;  3TEH B;  1D7Q A;  1QUQ A;  2Z6K A;  3JAM c;  3HOU G;  5K36 G;  1L1O B;  1YNX A;  3K7U C;  4KLK A;  4JYA Q;  4A4I A;  2HHH Q;  3W5O A;  1TXY A;  2A8V A;  1VQ5 A;  3HOZ G;  4DKA C;  4JYA L;  1PHJ A;  2HHH L;  4IJH A;  1JE5 A;  4A93 H;  2LXK A;  1Y14 B;  3U50 C;  4YCW A;  1K9M C;  4L5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...