2R93G

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 25
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r93G01
5IYDG 2RCNA 2YV5A 5E7NA 4B3ML 5C3EG 4GN3B 1WJJA 4PZ8A 3J81j 1VQ8A 5IYBG 2AWOA 3HOXH 4LUVA 1IBLQ 1EIFA 4B3RL 1N34Q 3CPWA 3I2ZA 2IX1A 3T1HQ 3STBD 3PGZA 4C2MH 4GNXB 4HIDA 2N8NA 3UDFA 1X3GA 1EQQA 4JBKA 2B3GA 3FP9A 1UE1A 4A3LG 2ZJQA 5C44H 1I50H 2VQEL 3WWVA 2E2HH 4A3MG 4DV4Q 1VQ5A 4IFDI 1WCMG 2R93G 5FJ8G 3E9IA 4LFCL 4A3EG 1D8LA 5GAGC 4HIOA 4OWWB 3RZOH 3EN2A 4JV5L 4P73A 2JA8H 4DR3L 4DR5L 4JI0L 4GLVB 3NBHB 3OW2A 2R7ZH 2HQLA 2CKZB 3S16H 1WFQA 3SGIA 5IWAL 3HOUG 3H15A 4UPAA 2HIXA 4XIGS 1PH1A 4DNIA 3J7A5 2B63H 2QA4A 4DV1L 1IYJB 1L0WA 2JA5G 2RF4A 3KJPA 2OTJA 2PI2A 4GS3A 3W1GA 1XNRQ 4JI2L 2HHHL 2CFMA 4RG1A 3HOVH 1QVFA 4LNQA 1CKNB 2KHIA 1EYGA 1HZAA 1X55A 2OQKA 2UXBQ 3U4ZA 4J15A 1WOCA 3CCLA 3H3VH 3TRZA 2JA6G 1N36Q 1IXRA 1CKMA 1TWCH 4JI1L 2DGYA 3ERSX 3NEMA 2RHQB 5M3MH 3G4SA 3CMAA 4GOPA 3UDGA 4BY1H 4A3GH 4OO1G 4A93G 3PUZA 1KD1C 2VQFQ 4DUZL 2BH2A 4PZ6A 2JEAI 2R92H 2A19A 4A3FH 4KHPQ 1HH2P 1MJCA 1X3EA 2KCMA 2PQAB 3OTOQ 3L7ZC 2NN6I 3PSIA 2DUDA 4QL5A 4GNXA 4A3IH 1K8GA 2V1CC 4IFDJ 1PYSB 1QZGA 5C4JH 4P74A 2UXDQ 3GTMH 1VQJA 1Y1VH 4DV7Q 1PH8A 3L0OA 3MEFA 1UEBA 3J80i 4DUYL 4BY7H 1I3QH 5FLMH 4X66L 4WJ4A 3RLFA 1Z9FA 4B3TQ 2EXDA 5LMUQ 1RIPA 1YI2A 2R6GA 1SN8A 3HOVG 4R4TA 4GOPC 4XTCS 3EIVA 3F2BA 4DV2L 4DR4Q 1CUKA 1GD7A 4LFBL 1HNWQ 4OO1I 2UUBL 4IJHA 5GAEC 3J80c 2OCEA 3LGJA 4OWTB 1XMQQ 5M3MG 2CQOA 1JJ2A 1GO3E 2E2IH 4BBSG 3GTLH 4KHZA 4IO9A 3AQQA 3M3YH 1EWIA 4GNXC 1AH9A 1SR3A 4O0AA 1L1OB 5GADC 1CKNA 2ZM6L 1S72A 4IPDA 4TQUS 2NVTH 4OX9Q 1VQBA 3K81C 2KENA 4GKKQ 3J81i 3M7NA 2JJQA 1UE7A 5C0XI 5IYDH 4LF7Q 1FGUA 2VS1A 3TS0A 5IYCH 4A3IG 5C3EH 2ES2A 4X65Q 1VQ4A 1O7IA 4GLAC 1KRSA 4DR1Q 5IYBH 3E9HA 3UE0A 1VQHA 2VUMH 3CXCA 4DV3L 2UUCQ 2ID0A 1EUJA 1VQ7A 4K0KQ 4MZ9A 4R4IA 3J81c 1YJ9A 4OONA 4A3CH 1N32Q 4L5TA 2PQAA 4LF4L 3TS2A 1CSPA 2VZAA 4PZ7A 5GQOA 4GN4B 4DR6Q 4DAYB 3HKZE 2Y0SE 3PV0A 4DV6L 2VNUD 4A3MH 1X65A 3HFZB 1WCMH 1K8AC 2YU9H 4JYAL 2R93H 3PCOB 2VY3A 1IBKQ 4A76A 1XJVA 2WP8J 2MFIA 1E22A 4IFDG 1Q8KA 4JI8L 1J6QA 1IBMQ 1G6PA 1B8AA 3HOUH 2K50A 5H1SE 1HR0L 3PO2H 4JCVE 3NELA 4BA2I 1HR0W 1PVOA 1K3RA 1GVPA 2YTYA 3H0GG 4YCWA 4PG3A 3GTGH 1BKBA 1WYDA 4QJFA 3L2PA 5BR8Q 2JK8A 1QUQB 4JI5L 4LF9L 1I5FA 4DK3C 3Q8DA 4YCVA 3GO5A 5IYCG 4LFCQ 2CWAA 2K14A 1KAWA 5GROA 1M1KC 2MO1A 1Q1BA 4X64Q 2K5HA 5AJ3L 2VUMG 4A4IA 5C0XJ 4DR5Q 4DR3Q 1JT8A 1P16A 4L5SA 3A74A 4HJ9A 1L1OA 4UP9A 2MO0A 3I7FA 1BVSA 2JA6H 2AWNA 4LWCA 3CCQA 4AIMA 4Y7NH 4DV5L 1NJIC 3K7UC 4A3CG 4TVAB 5IP7G 3RN5A 4JI6L 1SROA 2BA0A 3CCUA 3S17H 4A93H 4GKJL 3CCVA 1PFSA 2UU9L 1VS0A 2QGQA 2Q2IA 4EX5A 4R4QA 1E1TA 2HHHQ 1I94L 1MIUA 1YHBA 4DKAC 2F3IA 4YY3Q 1PH4A 3I4NG 1YHAA 4PMWA 1BBUA 4DPGA 4DR7L 5IP9G 1VQDA 4YCUA 5M5WH 3CCSA 3RLNA 4LFAL 3GTQH 2NN6G 4LF8Q 3PO2G 2PI2E 4JI1Q 3I56A 4DR2Q 1Q1EA 4NXNQ 2D0PA 1Q81C 1E24A 3PUYA 1B7YB 1E3PA 2Y0SG 3HKZG 4H02A 4ME3A 4AYBE 4DUZQ 4DV0L 3PO3G 3UDXA 2N78A 1NBWA 4DAMA 2NVXH 4NB3A 2VL6A 2MNAA 1IL2A 1YJNA 2F4VL 4UP8A 4NXML 2AKWB 3RZDH 4UY8C 3PUXA 1VQLA 2KHJA 1OXSC 3HOYH 4C3HH 1IBLL 1OXUA 1L2FA 4YHHQ 4BBSH 1EQRA 1W2BA 4P75A 3T1HL 1WI5A 1QUQA 2N49A 3J7ZC 4A3DH 4HJ7A 2C35B 3ULLA 2HT1A 1B70B 4QGUA 2QEXA 3A0JA 2ZJRA 4OWXB 3AFPA 3K80C 1LTLA 1MKHA 2UUAL 1S3OA 2UXCQ 1SE8A 2ALYB 1H95A 3BJUA 4R4OA 3T1YQ 4GLXA 2A1AA 5C0XG 3ICEA 2UUBQ 3TREA 3G71A 4DR2L 2K4KA 2CWPA 1TWFH 4QQBX 3KF8B 4IOAA 4O2DA 3STBC 4L5QA 1SMXA 1KC8C 2JA9A 3FHWA 2ZM6Q 1VQFA 4JI7Q 2AMCB 2GVBA 3HOZG 1P8LA 4IPCA 3U50C 1Z47A 4BA1I 2Z6KA 3DM3A 1XNRL 5HY6A 2K5VA 3GDEA 3RNUA 4LF6Q 1J5EL 1ASZA 1I6HH 4FDBA 1C0AA 1JJCB 1NMGA 3HOYG 1TWAH 1D7QA 2UXBL 1FL0A 2KBNA 1XMOQ 3CCRA 4HJ8A 1N36L 1W3SA 3TEHB 1Y1WG 1PH6A 1HNZQ 5JJIA 1K83H 1PH9A 4A3DG 5LMNL 3UE1A 3S14H 1V1QA 4LW1A 3RR5A 5M3FG 1LYLA 3H0GH 2PNHA 3MXNB 1HNXQ 3GTKH 1CKOA 2YTVA 4AYBG 2VQFL 5LMNW 4IPGA 4JBMA 4KHPL 2Q2TA 1VQPA 2AHOB 3GTPH 1UE6A 3CW2C 4X62L 1YEZA 4L5RC 1A8VA 2IHEA 4KLKA 3KDFB 2OWOA 4JI8Q 4A3BG 3M4PA 1E7ZA 1M90C 1X54A 1XPOA 1PYBA 4QY7A 3S24A 3BZKA 1HZBA 2B29A 5IP7H 1T9HA 2EQSA 4AQYL 4KI0A 3D31A 3GTJH 1YBYA 1HJPA 2BH8A 2E5LL 3KF6B 3CCJA 4B3TL 1OXTA 5LMUL 3RN2A 4LF9Q 3KFUA 3BZCA 3RLOA 5C4XH 3CC7A 1C9OA 3FKIG 4LF5L 3I4NH 4B3MQ 1X3FA 2EIFA 3F8TA 1FJGL 3NENA 1YITA 4DR4L 5IP9H 1EIYB 3W5OA 3S2DH 2XTIA 4B3RQ 2IT1A 5JEAJ 5IY0A 1S40A 3TQYA 1XNQL 2RHSB 3S1QH 1RL2A 4A3JG 1UWVA 2LXJA 2VQEQ 4JI6Q 3PO3H 4GKJQ 1YNXA 1HZ9A 4JBWA 4OX9L 1N33L 4BXXG 4POGA 4B3SL 5M5XH 4LF7L 1QZHA 3PF4A 3H3VI 4JI3L 1I94Q 4Y52H 4JV5Q 4X65L 4DR1L 2ZTCA 4JI0Q 4DR7Q 3M4QA 2LSSA 3BU2A 1VCIA 4RMFA 4LFAQ 5IWAQ 1PHJA 1JJGA 4JI4L 3I4OA 4K0KL 2YTXA 1KRTA 1EOVA 2ATWA 4DV1Q 3PF5A 3AEVA 3E0EA 2LXKA 2KCTA 3KDFA 3EBEA 1PH2A 1YVCA 1YIJA 3IRBA 4NPSA 3M4OH 2IY5B 4JI2Q 5C4XG 2CCZA 3K0XA 3KOJA 4A3KG 1IBKL 2F4VQ 1KHIA 2JE6I 2VW9A 2I0QA 4NXMQ 2ASBA 1TWHH 1U0LA 3G48A 1IBML 1JB7A 1TXYA 2ZJPA 3KF6A 4JC0A 4YWMA 3CF5A 3B6YA 5J3BA 1VQNA 3I4MH 3AYHB 2WAQG 5ELNA 1OXVA 4A75A 1ASYA 3I55A 2A8VA 3PIOA 1JMCA 1L1OC 1VQGA 1OTCA 3HOZH 2WB1G 2OQ0A 1NY4A 4DK6C 5BR8L 1VQ6A 3S2HH 2UUAQ 2R7FA 2HIVA 1C7YA 2NVQH 3CP0A 3GD7A 4APVA 1VQEA 3ULJA 1NMFA 4X64L 2Q2HA 1K73C 4MTNA 5FLXc 2E2JH 4UP7A 2BA1A 3KYHC 5JEAG 1N34L 4AH6A 3S15H 3ULPA 3F2CA 1Y1WH 2D62A 2L15A 3U58A 4DUYQ 2NZOA 5M3FH 1TWGH 3HOWG 3HKSA 1K0RA 4X66Q 3KJOA 1YJWA 1PH7A 3CCEA 2F52A 2I5HA 4C3JH 4DV4L 1EFWA 3M85A 4YWLA 1QVCA 3CMEA 3S1MH 3S1RH 4DV2Q 5EAYA 4YY3L 1J5EQ 1FVIA 2K52A 4LFBQ 4MNOA 1CSQA 1NTGA 1VQMA 4A3BH 3HOXG 2XGTA 1A63A 3PUWA 1AE3A 5JJKA 1KXLA 3UDIA 1X56A 3D0FA 3K7AH 4HJ5A 1JE5A 2Z0SA 1SFOH 1Y14B 2NVYH 2OTLA 4LF8L 4NXNL 3I4MG 2I5LX 3JC66 4JG2A 5LMNQ 4ALPA 1OXXK 1GKHA 1PV4A 5C44G 1VQOA 4JOIA 1LUZA 2IX0A 1XPUA 3A5ZB 4WJ3M 3M9BA 2E8GA 4BBRH 3FKIH 1A62A 4OXPA 2WFWA 5DLQE 4X62Q 3CQZH 2JA8G 3U4VA 1VQ9A 1DGSA 4DV3Q 2ZTEA 4QIWE 1YHQA 4YHHL 3GTOH 2R7ZG 2K5NA 1HZCA 4HIMA 1N8RC 1PA6A 4POFA 2JEBI 2JA7H 4LF4Q 4A3JH 2K75A 4AQYQ 3CD6A 3DLLA 4EQ5A 3G6EA 3W1BA 4DV6Q 5ELOA 1Q86C 2B63G 1V43A 2E5LQ 4BXXH 4JYAQ 1PH3A 4IPHA 3OTOL 2N3SA 3PIPA 2UXCL 4LF5Q 3T1YL 2IHFA 1FJGQ 4P71A 2PMZE 3CPFA 1Q46A 3K8AA 2R7DA 1K9MC 4R4CA 3A5UA 4JOIC 2UXDL 1YZ6A 3PUVA 1HR0Q 2I5MX 1A0IA 2Z6KC 1BBWA 4DV7L 3CC2A 4JBJA 5M5YH 1UE5A 3VDYA 1XNQQ 4BY1G 4A3GG 1VQCA 2WAQE 3CAMA 1Q82C 1R9TH 1KL9A 4JI7L 2WB1E 1X9NA 1Q7YC 2R92G 4A3FG 1N33Q 4JI5Q 4HJAA 1X6OA 4BBRG 4B3SQ 5JJLA 4A3KH 2H5XA 1SRUA 5K36G 4JI3Q 4LF6L 3ER0A 5AJ3Q 3F2DA 1HNWL 2MQHA 1XPRA 4LUOA 4GN5A 3OYYA 3F1ZA 1MJEA 1G51A 1XMQL 1NE3A 1Y1VG 3JAMi 1XMOL 4DV5Q 3CC4A 3KLWA 1HNZL 4JI4Q 2JA7G 1N9WA 5GAHC 4C3IH 2GVAA 4A3LH 4BY7G 1HNXL 4X6AH 5FLMG 2UU9Q 1U5KA 4GKKL 1VQAA 4P72A 1LM0A 4LUZA 1PH5A 4IJLA 1AE2A 2JQOA 2D0OA 4YWKA 5FJ8H 4A3EH 1KQSA 3JAMc 4R1JA 1QVGA 1V9PA 1SLJA 2UUCL 1KIXA 2NZHA 2YYZA 4HIKA 2FXQA 3CCMA 2ZTDA 1G291 1VQKA 1XTDA 1IZ6A 5IE8A 3ZJYC 5IT9c 1E1OA 1Q12A 1N32L 3S1NH 3HOWH 1GM5A 5HGQA 4DR6L 4DV0Q 3AFQA 2GN5A 2JA5H 1VQIA 4GOPB 2Q2UA 4IOCA
chains in the Genus database with same CATH superfamily
4B3RH 2QK4A 2ALZA 2IL8A 2BOSA 3QOLA 5IYBG 3PMFA 3HOXH 3KTMA 4O3RA 4Q0YA 4J9PA 4DK0A 3CPWA 4K6LA 1WTVA 3RIZA 3STBD 1BO0A 2F0WA 4LSAA 5T1IA 5COYA 1JKJB 4JBKA 4FM9A 2B3GA 4A3LG 4LFCH 4DA2A 1I50H 2VQEL 3KBGA 1VBHA 2NU6B 1RJPA 2AQ4A 3GTQA 3MA2B 1BJTA 4DV4Q 1DV1A 1HPCA 4JI0H 1CK1A 4EQPA 3RZOH 3EN2A 2R82A 2W6MA 1BCPD 4K14A 2JA8H 1MBYA 4DR3L 4O4HF 3Q2OA 3MJFA 5DNFA 2RDHA 2HQLA 4MV1A 3S16H 4Q5VA 1WFQA 3H15A 1F2ZA 2J6SA 4HR7B 3K5OA 2HUGA 2AQ2B 4XIGS 3ONAB 4DNIA 2HHHH 2B63H 4DV1L 2ATLA 1L0WA 2RF4A 2OTJA 3RD4A 3O13A 1XNRQ 2YL2A 1RTNA 4JI2L 1C30A 2CFMA 4RG1A 3HOVH 5DGBA 4LNQA 4O3OA 2MP1A 3CHBD 5LXTF 5CA1F 4AYBA 4M9UA 4IWYA 3H4DA 3VA7A 4ZQ3A 4TQSA 1CKMA 2DNCA 3BDOA 3NEMA 2KEDA 3MXGA 1R9TB 4OO1G 1G91A 5L37A 1NNXA 2I07B 1SNOA 2RBMA 4RU9A 2F0DA 2XNAC 2K33A 2PQAB 5K36H 4ZLTF 1K8GA 2V1CC 4IFDJ 5KFIA 4P74A 3NGDA 1IW7D 3U9OA 3A55A 3FKIA 4O3PA 3L0OA 3UQ8A 5BN4A 4DUYL 4BY7H 4QW8A 4UCSA 5FLMH 4ECXA 1NCVA 1Z9FA 1WTHA 4B3TQ 5DAUA 2ICEC 3DF7A 1YI2A 1K28A 1TKWB 4R4TA 4HNTA 4H7BA 4XTCS 5L9XA 3EIVA 5DLFA 1BNZA 1GD7A 1DYQA 3KLSX 1HNWQ 4J0MA 2N55A 2UUBL 5GAEC 2BQ3A 2ZM6H 1XMQQ 1JJ2A 5M3MG 4KHZA 2QDBA 2PBZA 1EQVA 3V2TA 1CKNA 4N9PA 4IPDA 4TQUS 4DNRB 1TS5A 4OX9Q 1I4GA 4IUVA 3J81i 3M7NA 4H44C 1AFPA 1UE7A 2ZT9C 4HEDA 1CQIB 3R5FA 5LL6b 4F87A 2L9HA 1VQHA 3I4MB 4C2MB 4F8MA 3G7LA 4MZ9A 4ZKBB 4OONA 2FINB 4UCVA 1DZ1A 3TS2A 2JEIA 2F0FA 5CV5A 1CSPA 2PNRC 5FO9B 3S2HB 4U68A 4DV6L 3HKZE 1STYA 2A68C 4XYQA 1WTPA 1WCMH 1EHIA 4JYAL 3BAAA 4J9MA 2R93H 3R23A 1G2TA 1H9KA 3U9TA 5IYZF 2R7ZB 1MHWC 1E22A 1Q8KA 4JI8L 1J6QA 3GV5B 5BPFA 5M3FB 2W9BB 3PO2H 4YR3A 2VA2A 3NELA 4LF9H 1FR3A 1PVOA 1K3RA 1T3NA 1GVPA 2YTYA 5CC4A 3MR5A 4PG3A 3GTGH 5DQIA 3L2PA 2JK8A 1H9RA 2RVLA 1KAWA 3DHQA 1M1KC 2P0AA 5AJ3L 2O5IC 1T5EA 5C0XJ 4DR3Q 1BR9A 1P16A 1TWCB 3A74A 4HJ9A 4L5SA 2W6ZA 4UP9A 2JA6H 4BY1B 4WORA 4LWCA 4GKJH 3P7JA 4RNMA 1NJIC 4R8UB 3K7UC 4MV7A 1GXDC 2A6ED 1TWHA 5IP7G 5KFTA 2R92B 1SROA 1TY0A 4PDBA 4HNVA 3CCVA 4BBRB 4FF1A 1PFSA 1C8CA 2UU9L 3G6VA 2UVRA 4E4TA 4EX5A 1I94L 4MAMA 5IWAH 4DPGA 5M5WH 3R3OA 1QJOA 3GTQH 1TS2A 1A3TA 1VF5C 5KFVA 2NN6G 3QOJA 4LF8Q 2PI2E 3I56A 3IFDA 1JDEA 1Q81C 2F0GA 3HKZG 3BG3A 3UDXA 5FLXE 2N78A 2GPSA 3P75A 1VAJA 2NVXH 1SYEA 1RDPD 2R8IA 3DMUA 2VR1A 2M05A 1YJNA 4UP8A 3FMCA 4UY8C 3BDLA 1OXSC 3HGBA 2OF1A 1Y69U 4KKSA 4KKTA 1QUQA 4K2KA 5E4WC 4HJ7A 2L55A 4QGUA 3K6OA 3BG5A 1LTLA 4G57A 2VB3X 2ALYB 2VA3A 5KFHA 1EQTA 2AQ3B 2PQEA 3V6HA 1EIGA 2A1AA 4RAYA 2IJ0A 2UUBQ 5I6WA 1M6VA 4LSXA 1KABA 3STBC 3DWPA 1CQVA 5KFGA 1XNRH 1GHJA 5D1OB 4DV2H 4DGZA 3GTMA 2XIWA 2GVBA 4KJOA 1Y1VA 2Z6KA 1CM9A 2QDLA 1ESRA 1I6HH 2JEJA 2F3WA 3M9MB 4CGYB 3HOYG 3HOUB 5JH7F 4C3HG 1BCPC 2SOBA 1JDBB 2KBNA 4DU9A 1I4HA 4ME5A 4XZ3B 1N36L 2PW7A 3TEHB 2MCTA 5JJIA 2RDGA 1V1QA 2HJWA 3GLKA 3KHLA 3GQBA 3S9WA 4X62H 1CKOA 4ED7A 4QWBA 4IALA 2LFNA 1JE4A 1JICA 3QO2A 1S5ED 2OWOA 3KDFB 4MV6A 1FYCA 3RAQA 1V1PA 4JI8Q 3MEHA 3OHAA 4Y7NB 3IFTA 1M90C 1X54A 4RKLA 3VYTA 1PYBA 1QNUA 4B3TH 4AQYL 1T9HA 2EQSA 1EL0A 3TP5A 2O5JC 2ZXRA 2E5LL 1FJGH 4YR2A 3CCJA 3KFUA 5LMUL 3I90A 3BZCA 2XCAA 1C9OA 4IHJF 2WAQA 1D5XC 4B3MQ 4G3IA 1YITA 3W5OA 2NWGA 4IN3A 4H0LC 5KFWA 4V190 5IY0A 3TP8A 1IW7C 3TQYA 2E2DC 1WD0A 3PR5B 4OX9H 5FO8B 1W96A 3RUZA 5EKKA 2E75C 2LXJA 2FB9A 4ZRZA 1B04A 5KG5A 1YNXA 4JBWA 4RHSA 1N33L 4BXXG 5FPOA 2CQYA 4C1NI 4LF7L 1QZHA 1YNJD 3H3VI 1I94Q 4JV5Q 4X65L 4HMJA 4J6HA 1SBBB 4KMUC 1VCIA 1GSOA 5LP6F 4HCSA 1JJGA 4JI4L 2WINB 4PNYA 1PZJD 5E1FA 3BDCA 2KCTA 2HVQA 4ED6A 4A3IB 3IRBA 3WNZA 2K5DA 4TRDA 2R8GA 3H09A 2CCZA 5FK9C 1L0YB 1TWHH 1U0LA 3G48A 5D3IB 5HBRB 3RB3A 1JB7A 4QW9A 5IT9L 1TWFB 1U4RA 4XDXA 2CW8A 5IT9W 3B6YA 1STGA 1ASYA 4N8X1 1F9PA 4O42A 2A8VA 4DLKA 5JVDF 1JMCA 1JR0D 3HOZH 1VQGA 2WB1G 2DWCA 1NY4A 3GQCA 2HIVA 2DN8A 1TWAB 4F4XA 3CU7A 1PFNA 1VQEA 1NMFA 4NP5A 1K73C 2BQUA 5FLXc 2E2JH 1H9SA 5HV6A 3KYHC 1ICWA 1B9MA 1N34L 2HVRA 2K5QA 5KFNA 3S15H 3EA6A 3S14B 2L15A 4HMIA 3TSSA 4YJ2F 3GV7B 2NZOA 4RNOA 1TWGH 1L2ZA 3HKSA 2EYLA 3KJOA 1PH7A 3GTPB 2YS6A 2XN9C 2G9DA 4QWDA 1EFWA 3M85A 2PZWA 4RHRA 3S1RH 3FDTA 5FLXL 2XWJB 1DOKA 3K5HA 4LF8H 1QWYA 3BQ1A 4A3BH 5FLXW 4JPBW 1JLLB 2RSNA 3UDIA 1X56A 3D0FA 3K7AH 2DLNA 1JE5A 3I4MG 4F4ZA 4M7EA 1OXXK 1GKHA 2A6EC 5EQ0A 1FD7D 2WACA 4ZAIA 4JOIA 1LTID 2IX0A 1XPUA 1GSAA 3A5ZB 3I4NB 1CE8A 3BA9A 2X0SA 2E8GA 4O1NA 3TIIA 4OXPA 1WSCA 2WFWA 1I3QA 3NWSA 1VBGA 5KYIA 1WTWA 2NZ1D 1VQ9A 2J6UA 4OL7A 4YHHL 2R7ZG 2VQFH 1HQRD 3OMCA 1N8RC 3PVXA 4KHPH 2Y0SB 4LF4Q 3PO3B 4AQYQ 1TQOA 3CD6A 2HGSA 4QIWA 2KVMA 4L8JA 5T1GA 1RK5A 5KFJA 3P20A 4EQOA 3Q1KA 2E5LQ 3HB9A 5TSSA 2E2IA 1PH3A 3GTLA 2RGVA 1KEEA 1B3QA 1K83A 4RA8A 4QUCA 3ND9A 3GTKA 4DV7H 2JXMB 3CPFA 1S03G 3K8AA 2R7DA 2UXDL 1KLUD 1SYCA 1SAPA 4P2CB 3A5UA 1PTOD 3PUVA 1HR0Q 2I5MX 2Z6KC 5L1IA 3S17B 3C2PA 4ETSA 4GZYC 4BY1G 3CAMA 4EBCA 1Q82C 3HXLA 4ZUJA 4MV9A 3M4OB 2R92G 5DG8A 1SYFA 3D4RA 1N33Q 5J22A 1QB5D 4JV0A 4BBRG 5JJLA 5DG9A 4A3KH 4MV3A 3D3RA 2J6TA 2K7VA 3T16A 2MHVA 5FKAC 1XPRA 5JPNC 3OYYA 5C3WA 5LHY1 2QILA 5HURA 3KLWA 4JI4Q 5GAHC 1TVXA 4C3IH 2IPKD 2BDOA 4A3LH 1HNXL 4N9TA 1U5KA 4IJLA 2JQOA 2F0NA 2FMCA 4J8QA 4R1JA 1PYWD 2F0SA 1V1OA 5KFLA 2UUCL 3EQLC 1Y1WB 2JEFA 2C9OA 2WE6A 1EIHA 4DR6H 1F2MA 4A3DB 1VQKA 5CBAE 1STBA 3Q8PB 1IZ6A 5IE8A 3NQIA 1TIID 1JIHA 1IBKH 5EJWA 1PLFA 4DV0Q 4CC6A 4X3UA 1ZXTA 2K5WA 1VQIA 4GOPB 5EDWA 2Q2UA 5KEEA 3NWTA 4PMBA 2RCNA 5IYDG 2W9CA 5E7NA 4ZK9B 2CH4A 5C3EG 2R7KA 4IR9A 1T36A 1GGOA 3R5XA 1IBLQ 3MAQA 1E2VA 2B2WC 2NVYB 2FPPB 3DWQA 1N34Q 5D1PA 1ILQA 2AGQA 4F50A 1D5MC 1PRTB 4GNXB 1EU4A 1MI2A 2N8NA 3UDFA 2R87A 1UAPA 5J2UF 5C44H 2ASJA 2AU0A 4RFBA 1VKZA 2M2LA 3CQZB 2N88A 4CKBA 4HIOA 2K1BA 3ZYYX 3SEBA 3GTOB 2FJZA 4O4LF 4DR5L 4GLVB 5KT6A 3NBHB 4XT3B 3SDZA 1EFID 5IWAL 3HOUG 3K57A 4YBZB 3T5LA 2K01A 1EZ8A 1V4YA 5LL6X 4OELB 5F9NA 4CBVA 3H94A 5CR3A 4XYLB 4YAKB 1Z2OX 2PI2A 3HS0C 5KFPA 1KBLA 1ZHSA 5C8YF 1QVFA 4O2BF 2KHIA 1YNJC 4JI1H 1EY5A 4NXNH 4HCEA 5KX5F 2UXBQ 3U4ZA 3CCLA 1WOCA 4X3KA 4B08A 1IXRA 5M3MH 4DR2L 2DGYA 4A3GH 4NW2A 1KD1C 4DUZL 1WTRA 1K0SA 1D6EC 2B2UC 4A3FH 1HH2P 1MJCA 3BVMA 3LNNA 5KG7A 2KCMA 3TZDA 2FKLA 5KFRA 5FD5A 3L7ZC 2SNSA 3S2DB 2NN6I 3PSIA 1PYSB 1QZGA 4IUQA 5C4JH 2UXDQ 3S1QB 1GUOA 4O2AF 3C1FA 1O80A 3J80i 4DK1A 1I3QH 4X66L 4WJ4A 3RLFA 3V4ZA 4UCTA 5KFZA 3PIO3 2EXDA 3KUPA 2EZVA 2VOBA 1SEIA 4GOPC 3N42B 3QG1A 1KC7A 3F2BA 4DV2L 4DR4Q 3DXJC 2F0UA 1R4QB 2F0PA 1H9JA 4MA0A 2OCEA 3LGJA 4BBSG 4JI7H 3BJYA 1GO3E 2E2IH 1B9NA 2WKDA 3GTLH 4LH7A 4MTDA 4WJWA 3AQQA 3AB9A 1PRTC 5D14A 4GNXC 3TIGA 2FLNA 1SR3A 3KBXA 1SNDA 2NVTH 2F1MA 1G2SA 3K81C 2KENA 2JJQA 1ONLA 2ES2A 4A3IG 1VQ4A 4GLAC 1KRSA 5KG1A 3E9HA 4FF4A 3SE0A 1R9TA 2UUCQ 4LF4H 2SEBD 1ILPA 1VQ7A 2HDLA 2XCPA 1I50B 1YJ9A 2YZMA 2BDNA 2PQAA 2JEGA 3H91A 2Y0SE 5AFWA 4A3MH 3BA8A 3HFZB 1K8AC 3KALA 3RZOB 2OH2A 2JA8B 2VY3A 3E0JA 1DXMA 1HR0H 1I4QA 2WP8J 1E4FT 1GYFA 4IFDG 3S16B 1IBMQ 1G6PA 3VYRA 4FU0A 5KT5A 1IKLA 3M4YA 2UVUA 2K50A 3N40P 4LMYA 2B63B 3T5JA 2EY1A 1B3AA 1UUPA 4KJNA 4HSVA 4IZOA 4RUAA 4YCWA 1FKAH 5KFQA 1PMRA 4CKEA 1BKBA 1WYDA 3K5IA 4QJFA 3VR2A 2HQEA 4JI5L 4QCLA 3MWDA 1JORA 1I5FA 4EG0A 2EYPA 3HBLA 2W7OA 5GROA 3PIP3 2DJGC 5EZYF 4DR5Q 4NMZA 3SI8A 2MO0A 3I7FA 3C0FB 2AWNA 3CCQA 3OSOA 1PTOC 1R4PB 3A7AB 5EGTA 4A3CG 2XGQA 4DAPA 4JI6L 3VR6A 4A93H 1UNSA 3H4BA 4DR7H 2PW5A 2QGQA 4IWXA 4C2MA 1E1TA 4NKLA 1BNCA 1YHBA 4CKCA 4S3SA 4DKAC 3I4NG 3GIJA 1YHAA 3OIPA 4PMWA 4C5AA 5IP9G 4YCUA 1N56A 3CCSA 3GV3A 3T5KA 2JA7B 4LFAL 4DV0H 1S97A 4EBDA 4DR2Q 4BY7B 1F9QA 3A8KE 4C1NK 1NSNS 2F03A 2B39A 1RF2D 3PUYA 1B53A 2F0EA 2Y0SG 4DUZQ 3LMLA 3PO3G 4NXMH 3TINA 2F4VH 2R7ZA 3V6JA 1GUSA 2XCLA 2HD3A 2MNAA 2Z4HA 1IL2A 1IBLH 1BXRA 2W9BA 2NTTA 3RZDH 2KHJA 3HOYH 2NYZD 4MN3A 4C3HH 5M5YB 4J1MA 2WDTA 2ASDA 5KFSA 3T1HL 1WI5A 2N49A 4A2AA 3GIDA 2EVBA 2C35B 3ULLA 2UUAH 2K6AA 2NTSA 4XX0B 3AFPA 3T13A 1Z6HA 1MKHA 1I4XA 2PMZB 1S3OA 2UXCQ 1H95A 4GC7A 3BJUA 3T1YQ 4R8UA 2PO4A 5NUCA 5C0XG 2R92A 3RMHA 3ICEA 3FPUB 5J1ZA 2ZJTA 3SK5A 1HCZA 2CWPA 3WOEA 4J9RA 2WB1B 1LV9A 4O2DA 2R8KA 3BVZA 1WCMB 3RF2A 2XC9A 2JA9A 1VQFA 1J5EH 4LFBH 1EEID 2HVSA 4IPCA 5EPJA 3U9SA 4BA1I 3DM3A 1GSHA 2UXBH 5HY6A 2KA7A 3GDEA 4LF6Q 3RGXA 1ASZA 3TBIB 3GIPA 2ASLA 1BQQT 1EY7A 1OO9B 5KNBA 1D7QA 4HJ8A 2A5HA 1HNZQ 1Y1WG 4K2LA 4XYMB 5G3LD 3RGZA 1PH9A 4A3DG 5LMNL 3UE1A 3RR5A 3N6RA 4LW1A 4CDDC 2FFKB 3H0GH 2PNHA 3MXNB 1RJQA 3JZIA 1DOLA 4EFBA 2VQFL 5LMNW 5FO7B 4OIKA 1SMYC 4KHPL 4DV3H 1JWMD 3NUCA 5KT7A 2BQRA 2R7MA 1VQPA 2AHOB 3V96A 1U9RA 1NUCA 3W2DA 1AEXA 2IHEA 2JA6B 2R61A 1E7ZA 1XPOA 5IGCA 4KHVA 3S24A 2E2HB 3BZKA 2B29A 4EYHB 2R86A 4KI0A 1TAEA 3GTJH 3MC0B 3ITPA 4J9OA 2P5ZX 3F8NA 3X3NA 2IX3A 4IUTA 2KSWA 4DR4H 3KF6B 4RCNA 1S4ZA 1ICFB 1BCPF 4LF5L 1KNEA 5M5WB 2W8KA 1X3FA 4IQZA 3KHHA 1GHKA 1XNQH 4C56C 4DL7A 2I87A 1V51A 1TS3A 5D1OA 1B50A 2FK1A 4UCOA 5IIFA 3VMMA 1RL2A 1E2WA 3JAME 2VQEQ 4JI6Q 4O3NA 2NVXB 4ID6A 3H40A 4B3SL 1HFGA 5IT9E 4RNNA 4UCRA 4JI3L 2BCOA 4ZHQF 5KFMA 2B2VC 4DV5H 2V4RA 3DWAA 4DR1L 2ZTCA 3L4KA 2AGPA 5IGBA 3BU2A 2K05A 4LFAQ 1RYRA 4ULLA 2A69D 4K0KL 3G8CA 4IRDA 1EOVA 2ATWA 4XQJA 2PN1A 4M1UB 4DV1Q 3PF5A 3AEVA 3E0EA 3OUZA 4Q45A 3KDFA 3K5MA 2RQXA 4JI2Q 2IMWP 3DEPA 3EROA 3K0XA 3KOJA 4ZUIA 1IBKL 1KDBA 2VW9A 2I0QA 5BMVF 2CQAA 3H6MA 5ELBA 4PV1C 1TXYA 3CRKC 5DGAA 4RB0A 4LMQD 2R8HA 4JC0A 2W8LA 3I4MH 1VQNA 3RBDA 1WTOA 3AYHB 4A75A 5ELNA 1STHA 4EBEA 4RWSC 4DK6C 5BR8L 3S2HH 1I6HB 1HUNA 2R7FA 1F9SA 3F2UA 3UI2A 2NVQH 1EYAA 4ZQIA 3IG0A 4X64L 1GUWA 1I6VC 3TMEA 1A15A 2RA4A 1ZQ7A 3F2CA 3K3VA 4DV4H 5I9OA 4DUYQ 5M3FH 1Z7TA 3HOWG 2FE3A 5EPKA 3SK6A 2Z8LA 4K5WA 3CCEA 2Q8RE 1KJJA 5C3EB 1LT3D 2QKIC 5LL6S 2VUMB 1LTBD 3S1MH 4JV2A 1I6UA 4EGJA 4YY3L 1WTXA 1FVIA 2LMCB 3KLSA 1CSQA 1D1KA 1NTGA 3HOXG 2XGTA 3PUWA 5JJKA 4DL3A 2WV6D 2RGRA 2OTLA 3FMAA 4NXNL 2RSOA 3JC66 5LMNQ 4ALPA 1KDAA 1PV4A 1EZ1A 1SE2A 1O78A 2F0HA 5JOBA 2I80A 4ZI7F 3M9BA 1YNND 1XWEA 3FKIH 4BBRH 1TWFA 3T4AC 5DLQE 1T94A 3SHLA 2JA8G 2F0TA 4TSSA 5BN3A 2K5NA 1U4MA 4HIMA 1C48A 4POFA 2PCFB 1ZKOA 2YRXA 2JEBI 3PR4A 2G9HD 1S0OA 4A3JH 3RBEA 4EQ5A 4DV6Q 3W1BA 2B63G 1TWAA 2UXCH 4EYIB 1I4PA 4JYAQ 3MR2A 3AU7A 3GIKA 4QWAA 3OTOL 2X6GA 1S10A 5D3DA 4LF5Q 5BN5A 3TDQA 2IHFA 1A2UA 2FHTA 3SVMA 2PMZE 1K8OA 1K9MC 1CZGA 2AUKA 4Q43A 5F2DA 2NUAB 3GTPA 3LP8A 2XSCA 4JBJA 2L4NA 4ED8A 4CJ1B 5LA6F 1QCBD 4JI7L 1GLVA 4FS2A 2WB1E 4LF6H 1HNWH 4B3SQ 1TWHB 3VYUA 5K36G 4EGVA 1XMQH 4JI3Q 3J81E 2W9AA 2XD4A 5AJ3Q 3E5SA 4LUOA 2L12A 3OW7A 4GN5A 1AN8A 2F3VA 2K03A 2YU9A 1MJEA 4Q44A 1XMOL 3K0YA 2DZDA 2JA7G 1A3VA 2IWHA 1KJ9A 3HOZB 3VA5A 4BY7G 4FXGC 4X6AH 5FLMG 5F9LA 4JUZA 2UU9Q 4GKKL 1VQAA 2B2WA 5E4XA 4ABNA 3NTHA 2W6OA 1KJ8A 3RB6A 1BDOA 1KQSA 5KFUA 3JAMc 4BBSB 2Y0SA 5CV7A 2KOLA 5IGEA 1SLJA 5C5LA 1KIXA 2YYZA 4M8AA 2FXQA 5M9OA 3S15B 2EYFA 5JEAH 1G291 1X3PA 4B9WA 4NLGA 2C2DA 5IT9c 1TWGB 3ZJYC 1E1OA 3PZPA 1N32L 1GM5A 4ME6A 3VPBA 2W57A 3WO1A 3AFQA 4HSPA 3S1RB 3JAML 2MGSA 2YV5A 5KNDA 4A3BB 3JAMW 4GN3B 3J81j 4PZ8A 1E0BA 2D2CC 1VQ8A 3K7AB 1EIFA 4B3RL 2VQEH 2VPQA 2J0TD 4HIDA 4FF2A 1CTMA 4ECUA 1X3GA 1B4OA 2FPGB 4KY5A 4DL2A 4IFDI 1VQ5A 4J9KA 1WCMG 3D8GA 4DAVA 4DR3H 2F0IA 2R93G 1HRJA 3PW5A 4LFCL 3M9NB 1D8LA 5CGKA 4OWWB 4P73A 1UC8A 3MWEA 1OWTA 1S0MA 4JI0L 1BF4A 4JK1C 3NXWA 3J7AK 2B2UA 2YRWA 3N43B 3SGIA 4FYDA 1PRTD 1X32A 5ELDA 1V8QA 2MUYA 2HIXA 2PZUA 4LH6A 3J7A5 4JI2H 1TR5A 2QA4A 3OSPA 2RCFA 5C5MA 3MFGA 5A2QE 2NU9B 4E6IA 1Y1WA 4GS3A 5D65A 3W1GA 3FDSA 3RB4A 2F0QA 2HHHL 2W6NA 3M4IA 4I4TF 2C2RA 3EJIA 1EYGA 1X55A 1JX4A 3NSWA 2OQKA 4J15A 3H3VH 3TRZA 2JA6G 1N36Q 4MHEA 1E4EB 3UDGA 3ERSX 3CMAA 2RHQB 4GOPA 4K8JA 2V9WA 2A69C 1SCUB 5JVH3 3PUZA 1K1SA 4IUPA 2JEAI 2BH2A 5KG4A 4PZ6A 5C4XB 2W6PA 2A19A 2RDFA 4A3KB 4J9LA 1X3EA 4FXDA 4I65A 4Z9CB 3OTOQ 2NVYA 4A3IH 5I4DA 4GNXA 1LTSD 2EY6A 2ZXOA 1STNA 2A6HC 1AUXA 3MWMA 2KJXA 4DUYH 3GTMH 1VQJA 1Y1VH 5HGTA 4HTHA 4C3IB 1SNPA 1Y8PB 5KGUA 4L1KA 1ULZA 2IBKA 1SJED 1FNUA 2SCUB 3GV8B 3MFYA 1PZID 5M5XB 1B33N 4FXKC 3GTOA 3T51B 4EQNA 5LMUQ 3NBHA 1RIPA 3RV3A 2R6GA 5I9PA 2QYZA 5LYJF 2UUBH 5KFAA 3L4JA 1CT1D 4LFBL 3BQ0A 3LWUA 4IFDH 3MWYW 4OO1I 5CV8A 4RAZA 4GC6A 4QF4A 2OEOA 2CW7A 2VPSA 3R5HA 5L1JA 3NQTA 3OIQA 1RTOA 2F4IA 3DM1A 3M3YH 1EWIA 4C5BA 3MHBA 2ZM6L 1L1OB 5GADC 4GKKQ 3NBIA 5C0XI 4LF7Q 1FNVA 1DIKA 1FGUA 2KQ3A 4X65Q 1O7IA 5IYBH 2EY2A 3UE0A 1W6KA 3CXCA 1BGWA 3NK9A 5DM63 4ZCKA 4DV3L 2ID0A 1RD9D 1SYBA 4OIJA 4G7ZC 2KECA 2O2LD 4DV6H 3HP3A 5C44B 3J81c 4JYAH 4A3CH 1VF7A 1N32Q 1HUMA 2X6LA 4IAJA 2VZAA 5GONF 5GQOA 4GN4B 1ML0D 1U4LA 4DAYB 1F77A 3IN5A 4DL6A 4UHVA 1QNKA 1X65A 2RDIA 1SE4A 2YU9H 4ECTA 2A74C 3JRWA 4JI8H 4DL5A 3MXUA 4R8NA 1YNNC 3NE5B 1XJVA 3HKZA 2MFIA 3ERQA 2KCCA 3J81L 3RB0A 5H1SE 1EYZA 1HHVA 3Q8SB 4BA2I 3J81W 1EYCA 1FGBD 4C3JB 2BR0A 4B3MH 3C3LA 1J9OA 4RGTA 4LF9L 4DK3C 3KHRA 3Q8DA 4LFCQ 3GO5A 5IYCG 2EYJA 2CWAA 2K14A 2L1BA 2QCPX 4CHTB 3G6YA 1MGSA 2MO1A 1Q1BA 2K5HA 2VUMG 2DNEA 1S68A 4MA5A 1SFOB 1XDNA 2YZNA 1DONA 2W6QA 4A3GB 1BVSA 3H20A 4FBUA 4DV5L 1CZWA 4UFZA 5ELCA 4OO1H 2ZDHA 3DUZA 2BA0A 4A3FB 3S17H 1KLGD 3V6KA 1I94H 4GKJL 2MPMA 4OGQC 2C28A 4JV5H 2KCNA 3A7LA 1VS0A 5D8DA 2M00A 1EUDB 2Q2IA 4QWEA 4MTKA 4R4QA 4RGNA 2HHHQ 4PWQA 5C4JB 2F3IA 1PH4A 3Q0AA 1JOQA 4NDXA 1I50A 1CA5A 1VQDA 3RLNA 2NU8B 1WR2A 2TSSA 3QWNA 2EJFC 3WOFA 1Q1EA 2D0PA 1RJTA 1E24A 3E3XA 1SMYD 1B7YB 1ZYRD 3FEWX 2LKVA 4ME3A 4HN7A 1NBWA 4DAMA 1LO5D 1X3QA 2SDFA 2BE5C 4LAAA 2B63A 2F0OA 2PZTA 1OXUA 1L2FA 4DFAA 4YHHQ 5KFBA 1EQRA 1UNNC 4P75A 5EBCA 4RUCA 3OMGA 2FK2A 3J7ZC 4A3DH 2HT1A 1BXTA 3CKIB 2QEXA 2ZJRA 4JV1A 1QILA 3K80C 2B2YC 2XRQD 3QB3A 1SE8A 1ZHQA 5A2QL 1B6SA 3R8BA 1SNQA 5A2QW 3TREA 1BOSA 4DF7A 3T5HA 2K4KA 2B2TC 3UFXB 4KY6A 3A54A 3KF8B 5KFDA 5A35A 1CFMA 1GOZA 4L5QA 4A3MB 3TN2A 1KC8C 2ZM6Q 4A3EB 2AMCB 3HOZG 3U50C 1IOVA 3PN1A 1XNRL 4LJZC 2JA7A 2XVSA 5KG3A 1JWUD 3RNUA 4HR7A 1SEBD 3A8JE 4FDBA 4RZRA 1N36H 1NMGA 3MZ5A 5CORA 2WYOA 3BYYB 3S1NB 3HOWB 2D5DA 1W3SA 2NB0A 1PH6A 2FLPA 1K83H 2JA5B 4TKOB 1PK8A 3GTKH 5KFFA 1LYLA 1HNXQ 1M7JA 2DIKA 4IPGA 1IHZA 3EPIA 3CW2C 4X62L 3HOXB 4K6DA 4L5RC 2YW2A 1A8VA 5DQGA 3WDNA 3ORQA 3MFHA 1Q90A 1C3OA 4RAUC 4AQYH 1ZEQX 4DN4M 4A3BG 3M4PA 5DLGA 2E5LH 4J9NA 4QY7A 1F2LA 3J7AF 5LMUH 1Y8OB 5IP7H 2B2VA 2PMZA 2V4DA 1YBYA 1HJPA 1WTQA 2UVVA 2RKSA 4B3TL 1OXTA 3RN2A 4LF9Q 1UEAB 1ET6A 3RLOA 3CC7A 5K2MA 2TMPA 1LTRD 2EY5A 2IP4A 2AGOA 2EIFA 1FJGL 3K3PA 1EIYB 2WB1A 3SR1A 3S2DH 4ZOLF 1WCMA 4G7OC 2IT1A 5JEAJ 2NN6H 2I46A 2YYAA 3A56A 1PXUA 4DXFA 3S1QH 1N33H 1PTOH 4LF7H 3MVVA 4GKJQ 1I7LA 4KKUA 3HOVB 1HZ9A 4X65H 4OX9L 5ELEA 3DEOA 3PF4A 2DPIA 1D1IA 3VYSA 4FBTA 4JI4H 5CA0F 3M4QA 3MXNA 5JQWA 2XIGA 1LLRD 4RMFA 5IWAQ 1PHJA 2R7NA 3I4OA 1DM0B 2YTXA 5T14A 4V0BA 1AZQA 2O03A 4ED3A 4HAEA 5JJZA 1UC9A 2LXKA 4G7HC 1PH2A 3M7GA 1YVCA 4NPSA 3PW7A 2IY5B 5C4XG 4A3KG 3GP7A 1KHIA 2JE6I 4DXGA 2W71A 2ASBA 2E2HA 2ZXPA 4FNFA 2JP1A 3IKJA 1EEFD 1DD2A 3KF6A 4YWMA 3CF5A 5J3BA 3E6ZX 1II3A 2WAQG 1JXLA 1SYDA 4C3IG 4YB8B 4QWCA 3I55A 2F0MA 3PIOA 3OPOA 1OTCA 4YP3A 2OQ0A 1VQ6A 2WKCA 2J4XA 4ECZA 1N34H 3CP0A 1WH2A 1TA8A 3GD7A 4APVA 3ULJA 1B2TA 2V5AA 3SE7A 3V05A 4CC5A 4MTNA 4F7XA 1IL8A 4HYKA 4UP7A 3KAKA 3TQTA 2BA1A 2NVXA 1M4VA 3ULPA 1EY9A 2EXZA 3H0GB 4KV6A 5CV9A 1W6JA 1S5DD 1STEA 4X66Q 2EE1A 1YJWA 2EDGA 1A9XA 1Q8IA 2F52A 2I5HA 1TWCA 4DV2Q 2XWBB 5KG6A 2K52A 1KJIA 5LOVF 1I7NA 1DCZA 4CDFC 3D6CA 1AE3A 5DQHA 1S5BD 4LF8L 4HJ5A 2Z0SA 4FP5D 3GTJB 3QZ7A 4APMA 3VR4A 2I5LX 4PMCA 4O4IF 4JG2A 2ICIA 2R93B 5CV4A 5C44G 3CVZA 1VQOA 5KG0A 5L1KA 1S0NA 2HCIA 1C4QA 1A62A 1HQMC 3C46A 4X62Q 4YHHH 4RKBA 3I4LA 5ELFA 3U4VA 1DGSA 5KFYA 3PO2B 4R7RA 4QIWE 5KFKA 1SYGA 1QG7A 1AUVA 3T56B 2JA7H 3GTGB 4BWSC 3T53B 4ZKCB 3DLLA 3Q23A 1O7LA 1V43A 3NTKA 4C3JG 4XQNA 4BXXH 3J80E 3ORRA 1ZYRC 1NR2A 2UXDH 4XXEA 1SE3A 3PIPA 4TV9F 2E76C 1FJGQ 4P71A 1LTAD 1VMPA 2YCHA 4I7ZC 2W70A 4C5CA 1B44D 1BBWA 4F88A 1SJHD 4DV7L 5M5YH 1UE5A 3KXYT 2D9UA 2DY7A 3HRZC 4A3GG 3OWEB 2CZGA 5I2YA 2VUMA 1CQJB 5EWFA 1R9TH 1MZBA 5CB4F 3Q8RB 2HCCA 4A3FG 4JI5Q 4HJAA 1X6OA 2CW0D 1SRUA 3N44B 4JW0A 4BS9A 2DY8A 3ER0A 5KNCA 3F2DA 3GTQB 5IGFA 2GLTA 1G51A 2ZDQA 4XYOA 3IAYA 1NE3A 1IOWA 3BZDB 1HNXH 1XX8A 1AW7A 5EKIA 1N9WA 5KRUA 5CMDA 2Q8IB 4X3SA 1LACA 4RH6A 2NVQB 2UUCH 1AE2A 4YWKA 2D0OA 3NTIA 1QVGA 1PFMA 2FMAA 4WBNF 4L63B 1V9PA 4QB4A 3TQ1A 4TUYF 2NZHA 4HIKA 3CCMA 2WTFA 2ZTDA 4WD3A 1WD1A 1XTDA 5KKNB 1DOMA 4N8FA 2B8FA 2VQDA 4AYBB 2ENBA 5HGQA 4DR6L 4RB2C 5H80A 2GN5A 3L9AX 3I8ZA 3I3CA 3S1MB 1IBMH 5FPRA 3KAJA 1CHPD 4IOCA 2Z6BA 2A6HD 4B3ML 1WJJA 1BCPB 2AWOA 4KN4C 4LUVA 2YS7A 3I2ZA 2IX1A 3T1HQ 4C2MH 3PGZA 3I12A 1Y8NB 1GJXA 5L1LA 1EQQA 3FP9A 1UE1A 2ZJQA 2E2HH 3WWVA 1EZ6A 1S9FA 3FKIB 4A3MG 1TT2A 4DR5H 3EFXD 4CDCC 3LWEA 3E9IA 5FJ8G 4A3EG 3EPGA 5GAGC 1O7ZA 2JYOA 3P1HA 4JV5L 4HNUA 1GUNA 5EPLA 1Q3LA 4ECSA 2CVRA 3OW2A 2R7ZH 2QF7A 2CKZB 5G3LF 4A3JB 3M9OB 3PW4A 4UPAA 2I8CA 1M0TA 5ISRA 1PH1A 1IYJB 2JA5G 4ED1A 3KJPA 2OXPA 5KFXA 1AZPA 3BVGA 3CRLC 1TU2B 3C1EA 4KTAA 3SK8A 3J7YW 3OSNA 1CKNB 4CDEC 1TWGA 1XYIA 1S5CD 4DR2H 4JVZA 4IZ8A 1HZAA 4Q8FA 1SDFA 5DG7A 4QMGA 4DUZH 1TWCH 4JI1L 3G4SA 4BY1H 3R93A 4MV4A 4A93G 2VQFQ 4MV8A 2R92H 1ZETA 4CJ0B 4KHPQ 2C00A 2EJGC 2EYHA 1RKNA 4BWGB 2AQ1B 2V59A 2F0VA 3E5NA 2Z1CA 3RJ0A 2C2EA 2DUDA 3FRPB 4QL5A 4IURA 1IYVA 5C4ZA 1CS0A 1SNCA 3OUUA 1RYSA 4EFEA 4MIUA 4X66H 5KFCA 2K04A 4DV7Q 3QFFA 1PH8A 1AP0A 3RTXA 3MEFA 1UEBA 2KUMA 2QW7A 4Q0FA 1E2ZA 3RV4A 1EY6A 3T1YH 5E3FA 4I50F 1K3BC 3MFIA 1CQFA 1JCKB 4PQXA 1SN8A 3HOVG 4I7AA 4TQRA 5KT4A 1CUKA 2FK3A 3X3MA 1A2TA 5CYUA 1O7YA 4U7CA 4IJHA 3J80c 1VDZA 1K1QA 4OWTB 2CQOA 3EVQA 3PQIA 5I47A 4IO9A 1WVLA 1AH9A 1S72A 4O0AA 1AN7A 2R8JA 1BUVT 4K8IA 1VQBA 3NP8A 1XXGA 5IYDH 3W3AA 2WIIB 4ECQA 2VS1A 2FJ2A 3BYTB 5IYCH 2JN4A 5C3EH 3BS1A 3TS0A 1E4EA 3J80L 4FO2A 4DR1Q 1RK6A 1HNZH 4O3SA 2VUMH 2JSOA 2DPJA 3J80W 1EUJA 1A6XA 1T5XD 4K0KQ 2KHSA 4R4IA 4X3TA 3GIQA 4ODGA 4L5TA 1RHPA 4LF4L 4PZ7A 4DR6Q 4QUFA 1F2YA 4R9WA 3PV0A 4ED2A 2VNUD 3RUPA 1LABA 1HTLD 2BE5D 3PCOB 4ED0A 3K5LA 1IBKQ 1MSHA 5KT3A 2E2JB 4A76A 1IKMA 1B8AA 1LTGD 2GA4B 3HOUH 1HR0L 1ESFA 3ND8A 4JCVE 3VPCA 1ET9A 1HR0W 4JI5H 3QR8A 2NBFA 3H0GG 3KK7A 3OOCA 1JWSD 4K5XA 2UVWA 5BR8Q 3L3OC 1QUQB 2VUGA 4YAJB 2EPBA 4YCVA 5I2XA 4X64Q 2Z9HA 3BABA 3I72A 3SK4A 4YQWA 4A4IA 1JT8A 2EYOA 2V58A 1L1OA 3IL8A 4JI6H 1IYUA 3QZ8A 1EU3A 4AIMA 4Y7NH 1GUTA 3GIMA 3HEJA 4TVAB 1QE6A 3RN5A 1Z2PX 3CCUA 4ECRA 3D6WA 2VB2X 4I7HA 2KEEA 2LY7A 1U4PA 4LFAH 1MIUA 4G4KA 1B1ZA 1LTTD 2CW0C 4YY3Q 3GTMB 1BBUA 2CH4W 4DR7L 1EOTA 1Y1VB 1HA6A 1SSOA 3URYA 4DV1H 4DAYA 2B2YA 5KYLA 3PO2G 4JI1Q 4IUNA 4NXNQ 3VR5A 2H1EA 2R7LA 1E3PA 4H02A 2Z4IA 4AYBE 4DV0L 4RB3C 3R2TA 4IR1A 1ENAA 3AMUA 1NAPA 4ILWA 4NB3A 5JVLA 2B2TA 2VL6A 2M9VA 2F4VL 4NXML 2AKWB 2G5DA 2SNMA 2GPWA 3PUXA 3T1HH 1VQLA 3MR3A 1IBLL 2K32A 5EWGA 4BBSH 1W2BA 3M3YB 5FOBB 3OWFA 5DM73 3FVQA 1V1PB 2C5CA 1B70B 4IRCA 3D4DA 3A0JA 4OWXB 1MD2D 1PZKD 1SFOA 5CAEB 1EWHA 3QIAA 2UUAL 4ECWA 4R4OA 4GLXA 1EY0A 3JSLA 4F4YA 3MR6A 1PDQA 2WAQB 3G71A 4KD3A 2L0CA 4UCUA 1TWFH 4QQBX 4IOAA 3CQZA 1SMXA 2RDJA 2YU9B 5BPHA 3FHWA 3ETHA 4KN7C 4JI7Q 1Z2NX 4YR0A 1P8LA 1Z47A 3GV6A 2K5VA 2FMMA 2R3ZA 2XRSD 1J5EL 1C0AA 1JJCB 3OHXC 2EYMA 1B6RA 1CI3M 3I73A 1TWAH 5LMNH 1ENFA 4B9XA 1FL0A 4YIJA 2OT2A 3H3VC 2UXBL 1PX2A 1XMOQ 3CCRA 2QEJC 2F0JA 1J8IA 2V4QA 1I4RA 4L6TB 2J9GA 5IGGA 4O3QA 3S14H 4OEMB 5M3FG 3D4WA 3N6XA 1D5ZC 2YTVA 4AYBG 4ZYSA 4KK7A 4JBMA 3FPPA 1CHQD 2Q2TA 3GTPH 4MTEA 1UE6A 5JUMA 1YEZA 3K5NA 1QOHA 3I91A 4KLKA 5FD6A 2IW3A 2O4XA 3V4SA 5IODA 5KG2A 3NHHA 5EWEA 4UDUC 4LK1C 1HZBA 1NR4A 3D31A 4LF5H 2BH8A 3Q22A 5C1PA 5C4XH 3FKIG 2F0LA 1KTKA 1BBXC 3I4NH 3F8TA 2Q8TA 3MTSA 3NENA 4DR4L 1TY2A 3KF8A 5IP9H 1PRTF 1KNAA 4U673 5KT2A 2XTIA 3NPPA 4B3RQ 5EKLA 4DL4A 1RODA 1E4GT 1S40A 5K5PA 1XNQL 2RHSB 1RJRA 4B3SH 4A3JG 1UWVA 1H9SB 3Q6SA 4JI3H 3PO3H 5C3XA 3KHGA 5KIXA 4I55F 3MXPA 4DR1H 4POGA 5M5XH 3K58A 2L11A 1LT5D 4Y52H 4U6PA 2R6FA 4YJ3F 1SYXB 1JOOA 5EOYA 4K0KH 2FPIB 4JI0Q 4DR7Q 5M3MB 2ZDGA 2FLLA 2LSSA 2JA5A 3EYYA 4F4WA 2PPBC 3SXHA 5EBDA 1JB3A 2MJ8A 3OHBA 3BQ2A 2UU9H 1KRTA 5IGDA 1LT4D 2YZGA 3HZXA 5CBEE 4UAIA 4OHJA 5C4HA 3EBEA 5I6YA 1YIJA 3M4OH 3GIIA 4Y8VB 3J7AV 4EEQA 2F4VQ 4NXMQ 5C0XH 3TP7A 4ECVA 1IBML 2ZJPA 4J9QA 1JOKA 4RZQA 1I3QB 4J9SA 2F0KA 3PW0A 5BR8H 1ENCA 1XTCD 1OXVA 3RAXA 2AUJD 2FP4B 1L1OC 2PYKA 3N8DA 1M0WA 4X64H 2NUCA 2UUAQ 4QIWB 1C7YA 2R85A 2OLSA 1PTOF 4H13C 2Q2HA 2PVPA 2E2IB 3GTLB 3QJYA 4RB1A 5JEAG 1K83B 4AH6A 2NU7B 4KY7A 1Y1WH 1F9RA 2D62A 4FF3A 3U58A 3GTKB 2NVTB 2E74C 1K0RA 2W7PA 1SNMA 4YY3H 1SXTA 4DV4L 2EOTA 4C3JH 4TV8F 2X69A 4YWLA 5C5JA 2HDMA 1QVCA 3CMEA 1HA5A 4A2BA 5EAYA 1J5EQ 4LFBQ 3JSNA 1RCVD 1L0XB 4MNOA 4RGMA 1VQMA 1JQYD 1D2BA 5IOCA 1A63A 1KXLA 2CHBD 4WRDA 1SFOH 1Y14B 2NVYH 5JAVA 4IRKA 3LX0A 3TP6A 3PW2A 2A68D 5KFEA 2H4OA 1N48A 3Q24A 1MSGA 1LUZA 5KFOA 2L5TA 1EY4A 2B8GA 4WJ3M 1O75A 1DJRD 5JPMC 4XT1B 2R84A 3CQZH 4HQ6A 4DV3Q 2ZTEA 4IUUA 1YHQA 3GTOH 1PTOB 1HZCA 1FNWA 1PA6A 1K8MA 4ECYA 3HKZB 2K75A 3OTOH 2C22A 3G6EA 5ELOA 1Q86C 2EJMA 4EEYA 3GILA 3Q8QB 2VXWA 4IPHA 1A3UA 2N3SA 3VPDA 3A8IE 4XQQA 2UXCL 1M8AA 1EWCA 1H9MA 3T1YL 3H0GA 4R8IA 5C1OA 4RGOS 1Q46A 4R4CA 4JOIC 1YZ6A 2W9CB 1W93A 1A0IA 4A93B 3CC2A 3VDYA 2DJFC 1XNQQ 1VQCA 2WAQE 3VR3A 5J2TF 1KDCA 3WO0A 4EGQA 1PFBA 1KL9A 3N41B 1X9NA 1Q7YC 1JC7A 4Q8EA 1EUCB 4RCOA 2H5XA 4LF6L 1XMOH 1CA6A 3GTJA 1HNWL 2K28A 2MQHA 3K59A 1DV2A 1HTPA 3RFCA 3TZUA 2R93A 1VMCA 3F1ZA 1XMQL 2J7ZA 1KJQA 1HXYD 1Y1VG 3LWBA 4FVMA 3JAMi 4DV5Q 3CC4A 4GKKH 1HNZL 4EVOA 4DNTB 3G6XA 2GVAA 1KAAA 1G8ZD 3I70A 1S5FD 4KD4A 4WFN3 3JRXA 4P72A 1LM0A 4FS1A 4LUZA 1LT6D 4K5VA 3RZDB 1PH5A 5FJ8H 5C6AA 4A3EH 3HOYB 3ETJA 2XGPA 1GUGA 4C3HB 1EYDA 2IA6A 3GTGA 1N32H 2A73B 3HG9A 5DEHA 5J39A 3KLRA 1Q12A 4CJ2C 1HFNA 3S1NH 3HOWH 3G6JB 2LS01 1STAA 2JA5H 2JA6A 1EY8A 3R2IA 1G6ZA 3N52A 5CV6A 1TS4A 5JVG3
chains in the Genus database with same CATH topology
5IYDG 2RCNA 2YV5A 5E7NA 4B3ML 5C3EG 4GN3B 1WJJA 4PZ8A 3J81j 1VQ8A 5IYBG 2AWOA 3HOXH 4LUVA 1IBLQ 1EIFA 4B3RL 1N34Q 3CPWA 3I2ZA 2IX1A 3T1HQ 3STBD 3PGZA 4C2MH 4GNXB 4HIDA 2N8NA 3UDFA 1X3GA 1EQQA 4JBKA 2B3GA 3FP9A 1UE1A 4A3LG 2ZJQA 5C44H 1I50H 2VQEL 3WWVA 2E2HH 4A3MG 4DV4Q 1VQ5A 4IFDI 1WCMG 2R93G 5FJ8G 3E9IA 4LFCL 4A3EG 1D8LA 5GAGC 4HIOA 4OWWB 3RZOH 3EN2A 4JV5L 4P73A 2JA8H 4DR3L 4DR5L 4JI0L 4GLVB 3NBHB 3OW2A 2R7ZH 2HQLA 2CKZB 3S16H 1WFQA 3SGIA 5IWAL 3HOUG 3H15A 4UPAA 2HIXA 4XIGS 1PH1A 4DNIA 3J7A5 2B63H 2QA4A 4DV1L 1IYJB 1L0WA 2JA5G 2RF4A 3KJPA 2OTJA 2PI2A 4GS3A 3W1GA 1XNRQ 4JI2L 2HHHL 2CFMA 4RG1A 3HOVH 1QVFA 4LNQA 1CKNB 2KHIA 1EYGA 1HZAA 1X55A 2OQKA 2UXBQ 3U4ZA 4J15A 1WOCA 3CCLA 3H3VH 3TRZA 2JA6G 1N36Q 1IXRA 1CKMA 1TWCH 4JI1L 2DGYA 3ERSX 3NEMA 2RHQB 5M3MH 3G4SA 3CMAA 4GOPA 3UDGA 4BY1H 4A3GH 4OO1G 4A93G 3PUZA 1KD1C 2VQFQ 4DUZL 2BH2A 4PZ6A 2JEAI 2R92H 2A19A 4A3FH 4KHPQ 1HH2P 1MJCA 1X3EA 2KCMA 2PQAB 3OTOQ 3L7ZC 2NN6I 3PSIA 2DUDA 4QL5A 4GNXA 4A3IH 1K8GA 2V1CC 4IFDJ 1PYSB 1QZGA 5C4JH 4P74A 2UXDQ 3GTMH 1VQJA 1Y1VH 4DV7Q 1PH8A 3L0OA 3MEFA 1UEBA 3J80i 4DUYL 4BY7H 1I3QH 5FLMH 4X66L 4WJ4A 3RLFA 1Z9FA 4B3TQ 2EXDA 5LMUQ 1RIPA 1YI2A 2R6GA 1SN8A 3HOVG 4R4TA 4GOPC 4XTCS 3EIVA 3F2BA 4DV2L 4DR4Q 1CUKA 1GD7A 4LFBL 1HNWQ 4OO1I 2UUBL 4IJHA 5GAEC 3J80c 2OCEA 3LGJA 4OWTB 1XMQQ 5M3MG 2CQOA 1JJ2A 1GO3E 2E2IH 4BBSG 3GTLH 4KHZA 4IO9A 3AQQA 3M3YH 1EWIA 4GNXC 1AH9A 1SR3A 4O0AA 1L1OB 5GADC 1CKNA 2ZM6L 1S72A 4IPDA 4TQUS 2NVTH 4OX9Q 1VQBA 3K81C 2KENA 4GKKQ 3J81i 3M7NA 2JJQA 1UE7A 5C0XI 5IYDH 4LF7Q 1FGUA 2VS1A 3TS0A 5IYCH 4A3IG 5C3EH 2ES2A 4X65Q 1VQ4A 1O7IA 4GLAC 1KRSA 4DR1Q 5IYBH 3E9HA 3UE0A 1VQHA 2VUMH 3CXCA 4DV3L 2UUCQ 2ID0A 1EUJA 1VQ7A 4K0KQ 4MZ9A 4R4IA 3J81c 1YJ9A 4OONA 4A3CH 1N32Q 4L5TA 2PQAA 4LF4L 3TS2A 1CSPA 2VZAA 4PZ7A 5GQOA 4GN4B 4DR6Q 4DAYB 3HKZE 2Y0SE 3PV0A 4DV6L 2VNUD 4A3MH 1X65A 3HFZB 1WCMH 1K8AC 2YU9H 4JYAL 2R93H 3PCOB 2VY3A 1IBKQ 4A76A 1XJVA 2WP8J 2MFIA 1E22A 4IFDG 1Q8KA 4JI8L 1J6QA 1IBMQ 1G6PA 1B8AA 3HOUH 2K50A 5H1SE 1HR0L 3PO2H 4JCVE 3NELA 4BA2I 1HR0W 1PVOA 1K3RA 1GVPA 2YTYA 3H0GG 4YCWA 4PG3A 3GTGH 1BKBA 1WYDA 4QJFA 3L2PA 5BR8Q 2JK8A 1QUQB 4JI5L 4LF9L 1I5FA 4DK3C 3Q8DA 4YCVA 3GO5A 5IYCG 4LFCQ 2CWAA 2K14A 1KAWA 5GROA 1M1KC 2MO1A 1Q1BA 4X64Q 2K5HA 5AJ3L 2VUMG 4A4IA 5C0XJ 4DR5Q 4DR3Q 1JT8A 1P16A 4L5SA 3A74A 4HJ9A 1L1OA 4UP9A 2MO0A 3I7FA 1BVSA 2JA6H 2AWNA 4LWCA 3CCQA 4AIMA 4Y7NH 4DV5L 1NJIC 3K7UC 4A3CG 4TVAB 5IP7G 3RN5A 4JI6L 1SROA 2BA0A 3CCUA 3S17H 4A93H 4GKJL 3CCVA 1PFSA 2UU9L 1VS0A 2QGQA 2Q2IA 4EX5A 4R4QA 1E1TA 2HHHQ 1I94L 1MIUA 1YHBA 4DKAC 2F3IA 4YY3Q 1PH4A 3I4NG 1YHAA 4PMWA 1BBUA 4DPGA 4DR7L 5IP9G 1VQDA 4YCUA 5M5WH 3CCSA 3RLNA 4LFAL 3GTQH 2NN6G 4LF8Q 3PO2G 2PI2E 4JI1Q 3I56A 4DR2Q 1Q1EA 4NXNQ 2D0PA 1Q81C 1E24A 3PUYA 1B7YB 1E3PA 2Y0SG 3HKZG 4H02A 4ME3A 4AYBE 4DUZQ 4DV0L 3PO3G 3UDXA 2N78A 1NBWA 4DAMA 2NVXH 4NB3A 2VL6A 2MNAA 1IL2A 1YJNA 2F4VL 4UP8A 4NXML 2AKWB 3RZDH 4UY8C 3PUXA 1VQLA 2KHJA 1OXSC 3HOYH 4C3HH 1IBLL 1OXUA 1L2FA 4YHHQ 4BBSH 1EQRA 1W2BA 4P75A 3T1HL 1WI5A 1QUQA 2N49A 3J7ZC 4A3DH 4HJ7A 2C35B 3ULLA 2HT1A 1B70B 4QGUA 2QEXA 3A0JA 2ZJRA 4OWXB 3AFPA 3K80C 1LTLA 1MKHA 2UUAL 1S3OA 2UXCQ 1SE8A 2ALYB 1H95A 3BJUA 4R4OA 3T1YQ 4GLXA 2A1AA 5C0XG 3ICEA 2UUBQ 3TREA 3G71A 4DR2L 2K4KA 2CWPA 1TWFH 4QQBX 3KF8B 4IOAA 4O2DA 3STBC 4L5QA 1SMXA 1KC8C 2JA9A 3FHWA 2ZM6Q 1VQFA 4JI7Q 2AMCB 2GVBA 3HOZG 1P8LA 4IPCA 3U50C 1Z47A 4BA1I 2Z6KA 3DM3A 1XNRL 5HY6A 2K5VA 3GDEA 3RNUA 4LF6Q 1J5EL 1ASZA 1I6HH 4FDBA 1C0AA 1JJCB 1NMGA 3HOYG 1TWAH 1D7QA 2UXBL 1FL0A 2KBNA 1XMOQ 3CCRA 4HJ8A 1N36L 1W3SA 3TEHB 1Y1WG 1PH6A 1HNZQ 5JJIA 1K83H 1PH9A 4A3DG 5LMNL 3UE1A 3S14H 1V1QA 4LW1A 3RR5A 5M3FG 1LYLA 3H0GH 2PNHA 3MXNB 1HNXQ 3GTKH 1CKOA 2YTVA 4AYBG 2VQFL 5LMNW 4IPGA 4JBMA 4KHPL 2Q2TA 1VQPA 2AHOB 3GTPH 1UE6A 3CW2C 4X62L 1YEZA 4L5RC 1A8VA 2IHEA 4KLKA 3KDFB 2OWOA 4JI8Q 4A3BG 3M4PA 1E7ZA 1M90C 1X54A 1XPOA 1PYBA 4QY7A 3S24A 3BZKA 1HZBA 2B29A 5IP7H 1T9HA 2EQSA 4AQYL 4KI0A 3D31A 3GTJH 1YBYA 1HJPA 2BH8A 2E5LL 3KF6B 3CCJA 4B3TL 1OXTA 5LMUL 3RN2A 4LF9Q 3KFUA 3BZCA 3RLOA 5C4XH 3CC7A 1C9OA 3FKIG 4LF5L 3I4NH 4B3MQ 1X3FA 2EIFA 3F8TA 1FJGL 3NENA 1YITA 4DR4L 5IP9H 1EIYB 3W5OA 3S2DH 2XTIA 4B3RQ 2IT1A 5JEAJ 5IY0A 1S40A 3TQYA 1XNQL 2RHSB 3S1QH 1RL2A 4A3JG 1UWVA 2LXJA 2VQEQ 4JI6Q 3PO3H 4GKJQ 1YNXA 1HZ9A 4JBWA 4OX9L 1N33L 4BXXG 4POGA 4B3SL 5M5XH 4LF7L 1QZHA 3PF4A 3H3VI 4JI3L 1I94Q 4Y52H 4JV5Q 4X65L 4DR1L 2ZTCA 4JI0Q 4DR7Q 3M4QA 2LSSA 3BU2A 1VCIA 4RMFA 4LFAQ 5IWAQ 1PHJA 1JJGA 4JI4L 3I4OA 4K0KL 2YTXA 1KRTA 1EOVA 2ATWA 4DV1Q 3PF5A 3AEVA 3E0EA 2LXKA 2KCTA 3KDFA 3EBEA 1PH2A 1YVCA 1YIJA 3IRBA 4NPSA 3M4OH 2IY5B 4JI2Q 5C4XG 2CCZA 3K0XA 3KOJA 4A3KG 1IBKL 2F4VQ 1KHIA 2JE6I 2VW9A 2I0QA 4NXMQ 2ASBA 1TWHH 1U0LA 3G48A 1IBML 1JB7A 1TXYA 2ZJPA 3KF6A 4JC0A 4YWMA 3CF5A 3B6YA 5J3BA 1VQNA 3I4MH 3AYHB 2WAQG 5ELNA 1OXVA 4A75A 1ASYA 3I55A 2A8VA 3PIOA 1JMCA 1L1OC 1VQGA 1OTCA 3HOZH 2WB1G 2OQ0A 1NY4A 4DK6C 5BR8L 1VQ6A 3S2HH 2UUAQ 2R7FA 2HIVA 1C7YA 2NVQH 3CP0A 3GD7A 4APVA 1VQEA 3ULJA 1NMFA 4X64L 2Q2HA 1K73C 4MTNA 5FLXc 2E2JH 4UP7A 2BA1A 3KYHC 5JEAG 1N34L 4AH6A 3S15H 3ULPA 3F2CA 1Y1WH 2D62A 2L15A 3U58A 4DUYQ 2NZOA 5M3FH 1TWGH 3HOWG 3HKSA 1K0RA 4X66Q 3KJOA 1YJWA 1PH7A 3CCEA 2F52A 2I5HA 4C3JH 4DV4L 1EFWA 3M85A 4YWLA 1QVCA 3CMEA 3S1MH 3S1RH 4DV2Q 5EAYA 4YY3L 1J5EQ 1FVIA 2K52A 4LFBQ 4MNOA 1CSQA 1NTGA 1VQMA 4A3BH 3HOXG 2XGTA 1A63A 3PUWA 1AE3A 5JJKA 1KXLA 3UDIA 1X56A 3D0FA 3K7AH 4HJ5A 1JE5A 2Z0SA 1SFOH 1Y14B 2NVYH 2OTLA 4LF8L 4NXNL 3I4MG 2I5LX 3JC66 4JG2A 5LMNQ 4ALPA 1OXXK 1GKHA 1PV4A 5C44G 1VQOA 4JOIA 1LUZA 2IX0A 1XPUA 3A5ZB 4WJ3M 3M9BA 2E8GA 4BBRH 3FKIH 1A62A 4OXPA 2WFWA 5DLQE 4X62Q 3CQZH 2JA8G 3U4VA 1VQ9A 1DGSA 4DV3Q 2ZTEA 4QIWE 1YHQA 4YHHL 3GTOH 2R7ZG 2K5NA 1HZCA 4HIMA 1N8RC 1PA6A 4POFA 2JEBI 2JA7H 4LF4Q 4A3JH 2K75A 4AQYQ 3CD6A 3DLLA 4EQ5A 3G6EA 3W1BA 4DV6Q 5ELOA 1Q86C 2B63G 1V43A 2E5LQ 4BXXH 4JYAQ 1PH3A 4IPHA 3OTOL 2N3SA 3PIPA 2UXCL 4LF5Q 3T1YL 2IHFA 1FJGQ 4P71A 2PMZE 3CPFA 1Q46A 3K8AA 2R7DA 1K9MC 4R4CA 3A5UA 4JOIC 2UXDL 1YZ6A 3PUVA 1HR0Q 2I5MX 1A0IA 2Z6KC 1BBWA 4DV7L 3CC2A 4JBJA 5M5YH 1UE5A 3VDYA 1XNQQ 4BY1G 4A3GG 1VQCA 2WAQE 3CAMA 1Q82C 1R9TH 1KL9A 4JI7L 2WB1E 1X9NA 1Q7YC 2R92G 4A3FG 1N33Q 4JI5Q 4HJAA 1X6OA 4BBRG 4B3SQ 5JJLA 4A3KH 2H5XA 1SRUA 5K36G 4JI3Q 4LF6L 3ER0A 5AJ3Q 3F2DA 1HNWL 2MQHA 1XPRA 4LUOA 4GN5A 3OYYA 3F1ZA 1MJEA 1G51A 1XMQL 1NE3A 1Y1VG 3JAMi 1XMOL 4DV5Q 3CC4A 3KLWA 1HNZL 4JI4Q 2JA7G 1N9WA 5GAHC 4C3IH 2GVAA 4A3LH 4BY7G 1HNXL 4X6AH 5FLMG 2UU9Q 1U5KA 4GKKL 1VQAA 4P72A 1LM0A 4LUZA 1PH5A 4IJLA 1AE2A 2JQOA 2D0OA 4YWKA 5FJ8H 4A3EH 1KQSA 3JAMc 4R1JA 1QVGA 1V9PA 1SLJA 2UUCL 1KIXA 2NZHA 2YYZA 4HIKA 2FXQA 3CCMA 2ZTDA 1G291 1VQKA 1XTDA 1IZ6A 5IE8A 3ZJYC 5IT9c 1E1OA 1Q12A 1N32L 3S1NH 3HOWH 1GM5A 5HGQA 4DR6L 4DV0Q 3AFQA 2GN5A 2JA5H 1VQIA 4GOPB 2Q2UA 4IOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYD G;  2RCN A;  2YV5 A;  5E7N A;  4B3M L;  5C3E G;  4GN3 B;  1WJJ A;  4PZ8 A;  3J81 j;  1VQ8 A;  5IYB G;  2AWO A;  3HOX H;  4LUV A;  1IBL Q;  1EIF A;  4B3R L;  1N34 Q;  3CPW A;  3I2Z A;  2IX1 A;  3T1H Q;  3STB D;  3PGZ A;  4C2M H;  4GNX B;  4HID A;  2N8N A;  3UDF A;  1X3G A;  1EQQ A;  4JBK A;  2B3G A;  3FP9 A;  1UE1 A;  4A3L G;  2ZJQ A;  5C44 H;  1I50 H;  2VQE L;  3WWV A;  2E2H H;  4A3M G;  4DV4 Q;  1VQ5 A;  4IFD I;  1WCM G;  2R93 G;  5FJ8 G;  3E9I A;  4LFC L;  4A3E G;  1D8L A;  5GAG C;  4HIO A;  4OWW B;  3RZO H;  3EN2 A;  4JV5 L;  4P73 A;  2JA8 H;  4DR3 L;  4DR5 L;  4JI0 L;  4GLV B;  3NBH B;  3OW2 A;  2R7Z H;  2HQL A;  2CKZ B;  3S16 H;  1WFQ A;  3SGI A;  5IWA L;  3HOU G;  3H15 A;  4UPA A;  2HIX A;  4XIG S;  1PH1 A;  4DNI A;  3J7A 5;  2B63 H;  2QA4 A;  4DV1 L;  1IYJ B;  1L0W A;  2JA5 G;  2RF4 A;  3KJP A;  2OTJ A;  2PI2 A;  4GS3 A;  3W1G A;  1XNR Q;  4JI2 L;  2HHH L;  2CFM A;  4RG1 A;  3HOV H;  1QVF A;  4LNQ A;  1CKN B;  2KHI A;  1EYG A;  1HZA A;  1X55 A;  2OQK A;  2UXB Q;  3U4Z A;  4J15 A;  1WOC A;  3CCL A;  3H3V H;  3TRZ A;  2JA6 G;  1N36 Q;  1IXR A;  1CKM A;  1TWC H;  4JI1 L;  2DGY A;  3ERS X;  3NEM A;  2RHQ B;  5M3M H;  3G4S A;  3CMA A;  4GOP A;  3UDG A;  4BY1 H;  4A3G H;  4OO1 G;  4A93 G;  3PUZ A;  1KD1 C;  2VQF Q;  4DUZ L;  2BH2 A;  4PZ6 A;  2JEA I;  2R92 H;  2A19 A;  4A3F H;  4KHP Q;  1HH2 P;  1MJC A;  1X3E A;  2KCM A;  2PQA B;  3OTO Q;  3L7Z C;  2NN6 I;  3PSI A;  2DUD A;  4QL5 A;  4GNX A;  4A3I H;  1K8G A;  2V1C C;  4IFD J;  1PYS B;  1QZG A;  5C4J H;  4P74 A;  2UXD Q;  3GTM H;  1VQJ A;  1Y1V H;  4DV7 Q;  1PH8 A;  3L0O A;  3MEF A;  1UEB A;  3J80 i;  4DUY L;  4BY7 H;  1I3Q H;  5FLM H;  4X66 L;  4WJ4 A;  3RLF A;  1Z9F A;  4B3T Q;  2EXD A;  5LMU Q;  1RIP A;  1YI2 A;  2R6G A;  1SN8 A;  3HOV G;  4R4T A;  4GOP C;  4XTC S;  3EIV A;  3F2B A;  4DV2 L;  4DR4 Q;  1CUK A;  1GD7 A;  4LFB L;  1HNW Q;  4OO1 I;  2UUB L;  4IJH A;  5GAE C;  3J80 c;  2OCE A;  3LGJ A;  4OWT B;  1XMQ Q;  5M3M G;  2CQO A;  1JJ2 A;  1GO3 E;  2E2I H;  4BBS G;  3GTL H;  4KHZ A;  4IO9 A;  3AQQ A;  3M3Y H;  1EWI A;  4GNX C;  1AH9 A;  1SR3 A;  4O0A A;  1L1O B;  5GAD C;  1CKN A;  2ZM6 L;  1S72 A;  4IPD A;  4TQU S;  2NVT H;  4OX9 Q;  1VQB A;  3K81 C;  2KEN A;  4GKK Q;  3J81 i;  3M7N A;  2JJQ A;  1UE7 A;  5C0X I;  5IYD H;  4LF7 Q;  1FGU A;  2VS1 A;  3TS0 A;  5IYC H;  4A3I G;  5C3E H;  2ES2 A;  4X65 Q;  1VQ4 A;  1O7I A;  4GLA C;  1KRS A;  4DR1 Q;  5IYB H;  3E9H A;  3UE0 A;  1VQH A;  2VUM H;  3CXC A;  4DV3 L;  2UUC Q;  2ID0 A;  1EUJ A;  1VQ7 A;  4K0K Q;  4MZ9 A;  4R4I A;  3J81 c;  1YJ9 A;  4OON A;  4A3C H;  1N32 Q;  4L5T A;  2PQA A;  4LF4 L;  3TS2 A;  1CSP A;  2VZA A;  4PZ7 A;  5GQO A;  4GN4 B;  4DR6 Q;  4DAY B;  3HKZ E;  2Y0S E;  3PV0 A;  4DV6 L;  2VNU D;  4A3M H;  1X65 A;  3HFZ B;  1WCM H;  1K8A C;  2YU9 H;  4JYA L;  2R93 H;  3PCO B;  2VY3 A;  1IBK Q;  4A76 A;  1XJV A;  2WP8 J;  2MFI A;  1E22 A;  4IFD G;  1Q8K A;  4JI8 L;  1J6Q A;  1IBM Q;  1G6P A;  1B8A A;  3HOU H;  2K50 A;  5H1S E;  1HR0 L;  3PO2 H;  4JCV E;  3NEL A;  4BA2 I;  1HR0 W;  1PVO A;  1K3R A;  1GVP A;  2YTY A;  3H0G G;  4YCW A;  4PG3 A;  3GTG H;  1BKB A;  1WYD A;  4QJF A;  3L2P A;  5BR8 Q;  2JK8 A;  1QUQ B;  4JI5 L;  4LF9 L;  1I5F A;  4DK3 C;  3Q8D A;  4YCV A;  3GO5 A;  5IYC G;  4LFC Q;  2CWA A;  2K14 A;  1KAW A;  5GRO A;  1M1K C;  2MO1 A;  1Q1B A;  4X64 Q;  2K5H A;  5AJ3 L;  2VUM G;  4A4I A;  5C0X J;  4DR5 Q;  4DR3 Q;  1JT8 A;  1P16 A;  4L5S A;  3A74 A;  4HJ9 A;  1L1O A;  4UP9 A;  2MO0 A;  3I7F A;  1BVS A;  2JA6 H;  2AWN A;  4LWC A;  3CCQ A;  4AIM A;  4Y7N H;  4DV5 L;  1NJI C;  3K7U C;  4A3C G;  4TVA B;  5IP7 G;  3RN5 A;  4JI6 L;  1SRO A;  2BA0 A;  3CCU A;  3S17 H;  4A93 H;  4GKJ L;  3CCV A;  1PFS A;  2UU9 L;  1VS0 A;  2QGQ A;  2Q2I A;  4EX5 A;  4R4Q A;  1E1T A;  2HHH Q;  1I94 L;  1MIU A;  1YHB A;  4DKA C;  2F3I A;  4YY3 Q;  1PH4 A;  3I4N G;  1YHA A;  4PMW A;  1BBU A;  4DPG A;  4DR7 L;  5IP9 G;  1VQD A;  4YCU A;  5M5W H;  3CCS A;  3RLN A;  4LFA L;  3GTQ H;  2NN6 G;  4LF8 Q;  3PO2 G;  2PI2 E;  4JI1 Q;  3I56 A;  4DR2 Q;  1Q1E A;  4NXN Q;  2D0P A;  1Q81 C;  1E24 A;  3PUY A;  1B7Y B;  1E3P A;  2Y0S G;  3HKZ G;  4H02 A;  4ME3 A;  4AYB E;  4DUZ Q;  4DV0 L;  3PO3 G;  3UDX A;  2N78 A;  1NBW A;  4DAM A;  2NVX H;  4NB3 A;  2VL6 A;  2MNA A;  1IL2 A;  1YJN A;  2F4V L;  4UP8 A;  4NXM L;  2AKW B;  3RZD H;  4UY8 C;  3PUX A;  1VQL A;  2KHJ A;  1OXS C;  3HOY H;  4C3H H;  1IBL L;  1OXU A;  1L2F A;  4YHH Q;  4BBS H;  1EQR A;  1W2B A;  4P75 A;  3T1H L;  1WI5 A;  1QUQ A;  2N49 A;  3J7Z C;  4A3D H;  4HJ7 A;  2C35 B;  3ULL A;  2HT1 A;  1B70 B;  4QGU A;  2QEX A;  3A0J A;  2ZJR A;  4OWX B;  3AFP A;  3K80 C;  1LTL A;  1MKH A;  2UUA L;  1S3O A;  2UXC Q;  1SE8 A;  2ALY B;  1H95 A;  3BJU A;  4R4O A;  3T1Y Q;  4GLX A;  2A1A A;  5C0X G;  3ICE A;  2UUB Q;  3TRE A;  3G71 A;  4DR2 L;  2K4K A;  2CWP A;  1TWF H;  4QQB X;  3KF8 B;  4IOA A;  4O2D A;  3STB C;  4L5Q A;  1SMX A;  1KC8 C;  2JA9 A;  3FHW A;  2ZM6 Q;  1VQF A;  4JI7 Q;  2AMC B;  2GVB A;  3HOZ G;  1P8L A;  4IPC A;  3U50 C;  1Z47 A;  4BA1 I;  2Z6K A;  3DM3 A;  1XNR L;  5HY6 A;  2K5V A;  3GDE A;  3RNU A;  4LF6 Q;  1J5E L;  1ASZ A;  1I6H H;  4FDB A;  1C0A A;  1JJC B;  1NMG A;  3HOY G;  1TWA H;  1D7Q A;  2UXB L;  1FL0 A;  2KBN A;  1XMO Q;  3CCR A;  4HJ8 A;  1N36 L;  1W3S A;  3TEH B;  1Y1W G;  1PH6 A;  1HNZ Q;  5JJI A;  1K83 H;  1PH9 A;  4A3D G;  5LMN L;  3UE1 A;  3S14 H;  1V1Q A;  4LW1 A;  3RR5 A;  5M3F G;  1LYL A;  3H0G H;  2PNH A;  3MXN B;  1HNX Q;  3GTK H;  1CKO A;  2YTV A;  4AYB G;  2VQF L;  5LMN W;  4IPG A;  4JBM A;  4KHP L;  2Q2T A;  1VQP A;  2AHO B;  3GTP H;  1UE6 A;  3CW2 C;  4X62 L;  1YEZ A;  4L5R C;  1A8V A;  2IHE A;  4KLK A;  3KDF B;  2OWO A;  4JI8 Q;  4A3B G;  3M4P A;  1E7Z A;  1M90 C;  1X54 A;  1XPO A;  1PYB A;  4QY7 A;  3S24 A;  3BZK A;  1HZB A;  2B29 A;  5IP7 H;  1T9H A;  2EQS A;  4AQY L;  4KI0 A;  3D31 A;  3GTJ H;  1YBY A;  1HJP A;  2BH8 A;  2E5L L;  3KF6 B;  3CCJ A;  4B3T L;  1OXT A;  5LMU L;  3RN2 A;  4LF9 Q;  3KFU A;  3BZC A;  3RLO A;  5C4X H;  3CC7 A;  1C9O A;  3FKI G;  4LF5 L;  3I4N H;  4B3M Q;  1X3F A;  2EIF A;  3F8T A;  1FJG L;  3NEN A;  1YIT A;  4DR4 L;  5IP9 H;  1EIY B;  3W5O A;  3S2D H;  2XTI A;  4B3R Q;  2IT1 A;  5JEA J;  5IY0 A;  1S40 A;  3TQY A;  1XNQ L;  2RHS B;  3S1Q H;  1RL2 A;  4A3J G;  1UWV A;  2LXJ A;  2VQE Q;  4JI6 Q;  3PO3 H;  4GKJ Q;  1YNX A;  1HZ9 A;  4JBW A;  4OX9 L;  1N33 L;  4BXX G;  4POG A;  4B3S L;  5M5X H;  4LF7 L;  1QZH A;  3PF4 A;  3H3V I;  4JI3 L;  1I94 Q;  4Y52 H;  4JV5 Q;  4X65 L;  4DR1 L;  2ZTC A;  4JI0 Q;  4DR7 Q;  3M4Q A;  2LSS A;  3BU2 A;  1VCI A;  4RMF A;  4LFA Q;  5IWA Q;  1PHJ A;  1JJG A;  4JI4 L;  3I4O A;  4K0K L;  2YTX A;  1KRT A;  1EOV A;  2ATW A;  4DV1 Q;  3PF5 A;  3AEV A;  3E0E A;  2LXK A;  2KCT A;  3KDF A;  3EBE A;  1PH2 A;  1YVC A;  1YIJ A;  3IRB A;  4NPS A;  3M4O H;  2IY5 B;  4JI2 Q;  5C4X G;  2CCZ A;  3K0X A;  3KOJ A;  4A3K G;  1IBK L;  2F4V Q;  1KHI A;  2JE6 I;  2VW9 A;  2I0Q A;  4NXM Q;  2ASB A;  1TWH H;  1U0L A;  3G48 A;  1IBM L;  1JB7 A;  1TXY A;  2ZJP A;  3KF6 A;  4JC0 A;  4YWM A;  3CF5 A;  3B6Y A;  5J3B A;  1VQN A;  3I4M H;  3AYH B;  2WAQ G;  5ELN A;  1OXV A;  4A75 A;  1ASY A;  3I55 A;  2A8V A;  3PIO A;  1JMC A;  1L1O C;  1VQG A;  1OTC A;  3HOZ H;  2WB1 G;  2OQ0 A;  1NY4 A;  4DK6 C;  5BR8 L;  1VQ6 A;  3S2H H;  2UUA Q;  2R7F A;  2HIV A;  1C7Y A;  2NVQ H;  3CP0 A;  3GD7 A;  4APV A;  1VQE A;  3ULJ A;  1NMF A;  4X64 L;  2Q2H A;  1K73 C;  4MTN A;  5FLX c;  2E2J H;  4UP7 A;  2BA1 A;  3KYH C;  5JEA G;  1N34 L;  4AH6 A;  3S15 H;  3ULP A;  3F2C A;  1Y1W H;  2D62 A;  2L15 A;  3U58 A;  4DUY Q;  2NZO A;  5M3F H;  1TWG H;  3HOW G;  3HKS A;  1K0R A;  4X66 Q;  3KJO A;  1YJW A;  1PH7 A;  3CCE A;  2F52 A;  2I5H A;  4C3J H;  4DV4 L;  1EFW A;  3M85 A;  4YWL A;  1QVC A;  3CME A;  3S1M H;  3S1R H;  4DV2 Q;  5EAY A;  4YY3 L;  1J5E Q;  1FVI A;  2K52 A;  4LFB Q;  4MNO A;  1CSQ A;  1NTG A;  1VQM A;  4A3B H;  3HOX G;  2XGT A;  1A63 A;  3PUW A;  1AE3 A;  5JJK A;  1KXL A;  3UDI A;  1X56 A;  3D0F A;  3K7A H;  4HJ5 A;  1JE5 A;  2Z0S A;  1SFO H;  1Y14 B;  2NVY H;  2OTL A;  4LF8 L;  4NXN L;  3I4M G;  2I5L X;  3JC6 6;  4JG2 A;  5LMN Q;  4ALP A;  1OXX K;  1GKH A;  1PV4 A;  5C44 G;  1VQO A;  4JOI A;  1LUZ A;  2IX0 A;  1XPU A;  3A5Z B;  4WJ3 M;  3M9B A;  2E8G A;  4BBR H;  3FKI H;  1A62 A;  4OXP A;  2WFW A;  5DLQ E;  4X62 Q;  3CQZ H;  2JA8 G;  3U4V A;  1VQ9 A;  1DGS A;  4DV3 Q;  2ZTE A;  4QIW E;  1YHQ A;  4YHH L;  3GTO H;  2R7Z G;  2K5N A;  1HZC A;  4HIM A;  1N8R C;  1PA6 A;  4POF A;  2JEB I;  2JA7 H;  4LF4 Q;  4A3J H;  2K75 A;  4AQY Q;  3CD6 A;  3DLL A;  4EQ5 A;  3G6E A;  3W1B A;  4DV6 Q;  5ELO A;  1Q86 C;  2B63 G;  1V43 A;  2E5L Q;  4BXX H;  4JYA Q;  1PH3 A;  4IPH A;  3OTO L;  2N3S A;  3PIP A;  2UXC L;  4LF5 Q;  3T1Y L;  2IHF A;  1FJG Q;  4P71 A;  2PMZ E;  3CPF A;  1Q46 A;  3K8A A;  2R7D A;  1K9M C;  4R4C A;  3A5U A;  4JOI C;  2UXD L;  1YZ6 A;  3PUV A;  1HR0 Q;  2I5M X;  1A0I A;  2Z6K C;  1BBW A;  4DV7 L;  3CC2 A;  4JBJ A;  5M5Y H;  1UE5 A;  3VDY A;  1XNQ Q;  4BY1 G;  4A3G G;  1VQC A;  2WAQ E;  3CAM A;  1Q82 C;  1R9T H;  1KL9 A;  4JI7 L;  2WB1 E;  1X9N A;  1Q7Y C;  2R92 G;  4A3F G;  1N33 Q;  4JI5 Q;  4HJA A;  1X6O A;  4BBR G;  4B3S Q;  5JJL A;  4A3K H;  2H5X A;  1SRU A;  5K36 G;  4JI3 Q;  4LF6 L;  3ER0 A;  5AJ3 Q;  3F2D A;  1HNW L;  2MQH A;  1XPR A;  4LUO A;  4GN5 A;  3OYY A;  3F1Z A;  1MJE A;  1G51 A;  1XMQ L;  1NE3 A;  1Y1V G;  3JAM i;  1XMO L;  4DV5 Q;  3CC4 A;  3KLW A;  1HNZ L;  4JI4 Q;  2JA7 G;  1N9W A;  5GAH C;  4C3I H;  2GVA A;  4A3L H;  4BY7 G;  1HNX L;  4X6A H;  5FLM G;  2UU9 Q;  1U5K A;  4GKK L;  1VQA A;  4P72 A;  1LM0 A;  4LUZ A;  1PH5 A;  4IJL A;  1AE2 A;  2JQO A;  2D0O A;  4YWK A;  5FJ8 H;  4A3E H;  1KQS A;  3JAM c;  4R1J A;  1QVG A;  1V9P A;  1SLJ A;  2UUC L;  1KIX A;  2NZH A;  2YYZ A;  4HIK A;  2FXQ A;  3CCM A;  2ZTD A;  1G29 1;  1VQK A;  1XTD A;  1IZ6 A;  5IE8 A;  3ZJY C;  5IT9 c;  1E1O A;  1Q12 A;  1N32 L;  3S1N H;  3HOW H;  1GM5 A;  5HGQ A;  4DR6 L;  4DV0 Q;  3AFQ A;  2GN5 A;  2JA5 H;  1VQI A;  4GOP B;  2Q2U A;  4IOC A; 
#chains in the Genus database with same CATH topology
 4B3R H;  2QK4 A;  2ALZ A;  2IL8 A;  2BOS A;  3QOL A;  5IYB G;  3PMF A;  3HOX H;  3KTM A;  4O3R A;  4Q0Y A;  4J9P A;  4DK0 A;  3CPW A;  4K6L A;  1WTV A;  3RIZ A;  3STB D;  1BO0 A;  2F0W A;  4LSA A;  5T1I A;  5COY A;  1JKJ B;  4JBK A;  4FM9 A;  2B3G A;  4A3L G;  4LFC H;  4DA2 A;  1I50 H;  2VQE L;  3KBG A;  1VBH A;  2NU6 B;  1RJP A;  2AQ4 A;  3GTQ A;  3MA2 B;  1BJT A;  4DV4 Q;  1DV1 A;  1HPC A;  4JI0 H;  1CK1 A;  4EQP A;  3RZO H;  3EN2 A;  2R82 A;  2W6M A;  1BCP D;  4K14 A;  2JA8 H;  1MBY A;  4DR3 L;  4O4H F;  3Q2O A;  3MJF A;  5DNF A;  2RDH A;  2HQL A;  4MV1 A;  3S16 H;  4Q5V A;  1WFQ A;  3H15 A;  1F2Z A;  2J6S A;  4HR7 B;  3K5O A;  2HUG A;  2AQ2 B;  4XIG S;  3ONA B;  4DNI A;  2HHH H;  2B63 H;  4DV1 L;  2ATL A;  1L0W A;  2RF4 A;  2OTJ A;  3RD4 A;  3O13 A;  1XNR Q;  2YL2 A;  1RTN A;  4JI2 L;  1C30 A;  2CFM A;  4RG1 A;  3HOV H;  5DGB A;  4LNQ A;  4O3O A;  2MP1 A;  3CHB D;  5LXT F;  5CA1 F;  4AYB A;  4M9U A;  4IWY A;  3H4D A;  3VA7 A;  4ZQ3 A;  4TQS A;  1CKM A;  2DNC A;  3BDO A;  3NEM A;  2KED A;  3MXG A;  1R9T B;  4OO1 G;  1G91 A;  5L37 A;  1NNX A;  2I07 B;  1SNO A;  2RBM A;  4RU9 A;  2F0D A;  2XNA C;  2K33 A;  2PQA B;  5K36 H;  4ZLT F;  1K8G A;  2V1C C;  4IFD J;  5KFI A;  4P74 A;  3NGD A;  1IW7 D;  3U9O A;  3A55 A;  3FKI A;  4O3P A;  3L0O A;  3UQ8 A;  5BN4 A;  4DUY L;  4BY7 H;  4QW8 A;  4UCS A;  5FLM H;  4ECX A;  1NCV A;  1Z9F A;  1WTH A;  4B3T Q;  5DAU A;  2ICE C;  3DF7 A;  1YI2 A;  1K28 A;  1TKW B;  4R4T A;  4HNT A;  4H7B A;  4XTC S;  5L9X A;  3EIV A;  5DLF A;  1BNZ A;  1GD7 A;  1DYQ A;  3KLS X;  1HNW Q;  4J0M A;  2N55 A;  2UUB L;  5GAE C;  2BQ3 A;  2ZM6 H;  1XMQ Q;  1JJ2 A;  5M3M G;  4KHZ A;  2QDB A;  2PBZ A;  1EQV A;  3V2T A;  1CKN A;  4N9P A;  4IPD A;  4TQU S;  4DNR B;  1TS5 A;  4OX9 Q;  1I4G A;  4IUV A;  3J81 i;  3M7N A;  4H44 C;  1AFP A;  1UE7 A;  2ZT9 C;  4HED A;  1CQI B;  3R5F A;  5LL6 b;  4F87 A;  2L9H A;  1VQH A;  3I4M B;  4C2M B;  4F8M A;  3G7L A;  4MZ9 A;  4ZKB B;  4OON A;  2FIN B;  4UCV A;  1DZ1 A;  3TS2 A;  2JEI A;  2F0F A;  5CV5 A;  1CSP A;  2PNR C;  5FO9 B;  3S2H B;  4U68 A;  4DV6 L;  3HKZ E;  1STY A;  2A68 C;  4XYQ A;  1WTP A;  1WCM H;  1EHI A;  4JYA L;  3BAA A;  4J9M A;  2R93 H;  3R23 A;  1G2T A;  1H9K A;  3U9T A;  5IYZ F;  2R7Z B;  1MHW C;  1E22 A;  1Q8K A;  4JI8 L;  1J6Q A;  3GV5 B;  5BPF A;  5M3F B;  2W9B B;  3PO2 H;  4YR3 A;  2VA2 A;  3NEL A;  4LF9 H;  1FR3 A;  1PVO A;  1K3R A;  1T3N A;  1GVP A;  2YTY A;  5CC4 A;  3MR5 A;  4PG3 A;  3GTG H;  5DQI A;  3L2P A;  2JK8 A;  1H9R A;  2RVL A;  1KAW A;  3DHQ A;  1M1K C;  2P0A A;  5AJ3 L;  2O5I C;  1T5E A;  5C0X J;  4DR3 Q;  1BR9 A;  1P16 A;  1TWC B;  3A74 A;  4HJ9 A;  4L5S A;  2W6Z A;  4UP9 A;  2JA6 H;  4BY1 B;  4WOR A;  4LWC A;  4GKJ H;  3P7J A;  4RNM A;  1NJI C;  4R8U B;  3K7U C;  4MV7 A;  1GXD C;  2A6E D;  1TWH A;  5IP7 G;  5KFT A;  2R92 B;  1SRO A;  1TY0 A;  4PDB A;  4HNV A;  3CCV A;  4BBR B;  4FF1 A;  1PFS A;  1C8C A;  2UU9 L;  3G6V A;  2UVR A;  4E4T A;  4EX5 A;  1I94 L;  4MAM A;  5IWA H;  4DPG A;  5M5W H;  3R3O A;  1QJO A;  3GTQ H;  1TS2 A;  1A3T A;  1VF5 C;  5KFV A;  2NN6 G;  3QOJ A;  4LF8 Q;  2PI2 E;  3I56 A;  3IFD A;  1JDE A;  1Q81 C;  2F0G A;  3HKZ G;  3BG3 A;  3UDX A;  5FLX E;  2N78 A;  2GPS A;  3P75 A;  1VAJ A;  2NVX H;  1SYE A;  1RDP D;  2R8I A;  3DMU A;  2VR1 A;  2M05 A;  1YJN A;  4UP8 A;  3FMC A;  4UY8 C;  3BDL A;  1OXS C;  3HGB A;  2OF1 A;  1Y69 U;  4KKS A;  4KKT A;  1QUQ A;  4K2K A;  5E4W C;  4HJ7 A;  2L55 A;  4QGU A;  3K6O A;  3BG5 A;  1LTL A;  4G57 A;  2VB3 X;  2ALY B;  2VA3 A;  5KFH A;  1EQT A;  2AQ3 B;  2PQE A;  3V6H A;  1EIG A;  2A1A A;  4RAY A;  2IJ0 A;  2UUB Q;  5I6W A;  1M6V A;  4LSX A;  1KAB A;  3STB C;  3DWP A;  1CQV A;  5KFG A;  1XNR H;  1GHJ A;  5D1O B;  4DV2 H;  4DGZ A;  3GTM A;  2XIW A;  2GVB A;  4KJO A;  1Y1V A;  2Z6K A;  1CM9 A;  2QDL A;  1ESR A;  1I6H H;  2JEJ A;  2F3W A;  3M9M B;  4CGY B;  3HOY G;  3HOU B;  5JH7 F;  4C3H G;  1BCP C;  2SOB A;  1JDB B;  2KBN A;  4DU9 A;  1I4H A;  4ME5 A;  4XZ3 B;  1N36 L;  2PW7 A;  3TEH B;  2MCT A;  5JJI A;  2RDG A;  1V1Q A;  2HJW A;  3GLK A;  3KHL A;  3GQB A;  3S9W A;  4X62 H;  1CKO A;  4ED7 A;  4QWB A;  4IAL A;  2LFN A;  1JE4 A;  1JIC A;  3QO2 A;  1S5E D;  2OWO A;  3KDF B;  4MV6 A;  1FYC A;  3RAQ A;  1V1P A;  4JI8 Q;  3MEH A;  3OHA A;  4Y7N B;  3IFT A;  1M90 C;  1X54 A;  4RKL A;  3VYT A;  1PYB A;  1QNU A;  4B3T H;  4AQY L;  1T9H A;  2EQS A;  1EL0 A;  3TP5 A;  2O5J C;  2ZXR A;  2E5L L;  1FJG H;  4YR2 A;  3CCJ A;  3KFU A;  5LMU L;  3I90 A;  3BZC A;  2XCA A;  1C9O A;  4IHJ F;  2WAQ A;  1D5X C;  4B3M Q;  4G3I A;  1YIT A;  3W5O A;  2NWG A;  4IN3 A;  4H0L C;  5KFW A;  4V19 0;  5IY0 A;  3TP8 A;  1IW7 C;  3TQY A;  2E2D C;  1WD0 A;  3PR5 B;  4OX9 H;  5FO8 B;  1W96 A;  3RUZ A;  5EKK A;  2E75 C;  2LXJ A;  2FB9 A;  4ZRZ A;  1B04 A;  5KG5 A;  1YNX A;  4JBW A;  4RHS A;  1N33 L;  4BXX G;  5FPO A;  2CQY A;  4C1N I;  4LF7 L;  1QZH A;  1YNJ D;  3H3V I;  1I94 Q;  4JV5 Q;  4X65 L;  4HMJ A;  4J6H A;  1SBB B;  4KMU C;  1VCI A;  1GSO A;  5LP6 F;  4HCS A;  1JJG A;  4JI4 L;  2WIN B;  4PNY A;  1PZJ D;  5E1F A;  3BDC A;  2KCT A;  2HVQ A;  4ED6 A;  4A3I B;  3IRB A;  3WNZ A;  2K5D A;  4TRD A;  2R8G A;  3H09 A;  2CCZ A;  5FK9 C;  1L0Y B;  1TWH H;  1U0L A;  3G48 A;  5D3I B;  5HBR B;  3RB3 A;  1JB7 A;  4QW9 A;  5IT9 L;  1TWF B;  1U4R A;  4XDX A;  2CW8 A;  5IT9 W;  3B6Y A;  1STG A;  1ASY A;  4N8X 1;  1F9P A;  4O42 A;  2A8V A;  4DLK A;  5JVD F;  1JMC A;  1JR0 D;  3HOZ H;  1VQG A;  2WB1 G;  2DWC A;  1NY4 A;  3GQC A;  2HIV A;  2DN8 A;  1TWA B;  4F4X A;  3CU7 A;  1PFN A;  1VQE A;  1NMF A;  4NP5 A;  1K73 C;  2BQU A;  5FLX c;  2E2J H;  1H9S A;  5HV6 A;  3KYH C;  1ICW A;  1B9M A;  1N34 L;  2HVR A;  2K5Q A;  5KFN A;  3S15 H;  3EA6 A;  3S14 B;  2L15 A;  4HMI A;  3TSS A;  4YJ2 F;  3GV7 B;  2NZO A;  4RNO A;  1TWG H;  1L2Z A;  3HKS A;  2EYL A;  3KJO A;  1PH7 A;  3GTP B;  2YS6 A;  2XN9 C;  2G9D A;  4QWD A;  1EFW A;  3M85 A;  2PZW A;  4RHR A;  3S1R H;  3FDT A;  5FLX L;  2XWJ B;  1DOK A;  3K5H A;  4LF8 H;  1QWY A;  3BQ1 A;  4A3B H;  5FLX W;  4JPB W;  1JLL B;  2RSN A;  3UDI A;  1X56 A;  3D0F A;  3K7A H;  2DLN A;  1JE5 A;  3I4M G;  4F4Z A;  4M7E A;  1OXX K;  1GKH A;  2A6E C;  5EQ0 A;  1FD7 D;  2WAC A;  4ZAI A;  4JOI A;  1LTI D;  2IX0 A;  1XPU A;  1GSA A;  3A5Z B;  3I4N B;  1CE8 A;  3BA9 A;  2X0S A;  2E8G A;  4O1N A;  3TII A;  4OXP A;  1WSC A;  2WFW A;  1I3Q A;  3NWS A;  1VBG A;  5KYI A;  1WTW A;  2NZ1 D;  1VQ9 A;  2J6U A;  4OL7 A;  4YHH L;  2R7Z G;  2VQF H;  1HQR D;  3OMC A;  1N8R C;  3PVX A;  4KHP H;  2Y0S B;  4LF4 Q;  3PO3 B;  4AQY Q;  1TQO A;  3CD6 A;  2HGS A;  4QIW A;  2KVM A;  4L8J A;  5T1G A;  1RK5 A;  5KFJ A;  3P20 A;  4EQO A;  3Q1K A;  2E5L Q;  3HB9 A;  5TSS A;  2E2I A;  1PH3 A;  3GTL A;  2RGV A;  1KEE A;  1B3Q A;  1K83 A;  4RA8 A;  4QUC A;  3ND9 A;  3GTK A;  4DV7 H;  2JXM B;  3CPF A;  1S03 G;  3K8A A;  2R7D A;  2UXD L;  1KLU D;  1SYC A;  1SAP A;  4P2C B;  3A5U A;  1PTO D;  3PUV A;  1HR0 Q;  2I5M X;  2Z6K C;  5L1I A;  3S17 B;  3C2P A;  4ETS A;  4GZY C;  4BY1 G;  3CAM A;  4EBC A;  1Q82 C;  3HXL A;  4ZUJ A;  4MV9 A;  3M4O B;  2R92 G;  5DG8 A;  1SYF A;  3D4R A;  1N33 Q;  5J22 A;  1QB5 D;  4JV0 A;  4BBR G;  5JJL A;  5DG9 A;  4A3K H;  4MV3 A;  3D3R A;  2J6T A;  2K7V A;  3T16 A;  2MHV A;  5FKA C;  1XPR A;  5JPN C;  3OYY A;  5C3W A;  5LHY 1;  2QIL A;  5HUR A;  3KLW A;  4JI4 Q;  5GAH C;  1TVX A;  4C3I H;  2IPK D;  2BDO A;  4A3L H;  1HNX L;  4N9T A;  1U5K A;  4IJL A;  2JQO A;  2F0N A;  2FMC A;  4J8Q A;  4R1J A;  1PYW D;  2F0S A;  1V1O A;  5KFL A;  2UUC L;  3EQL C;  1Y1W B;  2JEF A;  2C9O A;  2WE6 A;  1EIH A;  4DR6 H;  1F2M A;  4A3D B;  1VQK A;  5CBA E;  1STB A;  3Q8P B;  1IZ6 A;  5IE8 A;  3NQI A;  1TII D;  1JIH A;  1IBK H;  5EJW A;  1PLF A;  4DV0 Q;  4CC6 A;  4X3U A;  1ZXT A;  2K5W A;  1VQI A;  4GOP B;  5EDW A;  2Q2U A;  5KEE A;  3NWT A;  4PMB A;  2RCN A;  5IYD G;  2W9C A;  5E7N A;  4ZK9 B;  2CH4 A;  5C3E G;  2R7K A;  4IR9 A;  1T36 A;  1GGO A;  3R5X A;  1IBL Q;  3MAQ A;  1E2V A;  2B2W C;  2NVY B;  2FPP B;  3DWQ A;  1N34 Q;  5D1P A;  1ILQ A;  2AGQ A;  4F50 A;  1D5M C;  1PRT B;  4GNX B;  1EU4 A;  1MI2 A;  2N8N A;  3UDF A;  2R87 A;  1UAP A;  5J2U F;  5C44 H;  2ASJ A;  2AU0 A;  4RFB A;  1VKZ A;  2M2L A;  3CQZ B;  2N88 A;  4CKB A;  4HIO A;  2K1B A;  3ZYY X;  3SEB A;  3GTO B;  2FJZ A;  4O4L F;  4DR5 L;  4GLV B;  5KT6 A;  3NBH B;  4XT3 B;  3SDZ A;  1EFI D;  5IWA L;  3HOU G;  3K57 A;  4YBZ B;  3T5L A;  2K01 A;  1EZ8 A;  1V4Y A;  5LL6 X;  4OEL B;  5F9N A;  4CBV A;  3H94 A;  5CR3 A;  4XYL B;  4YAK B;  1Z2O X;  2PI2 A;  3HS0 C;  5KFP A;  1KBL A;  1ZHS A;  5C8Y F;  1QVF A;  4O2B F;  2KHI A;  1YNJ C;  4JI1 H;  1EY5 A;  4NXN H;  4HCE A;  5KX5 F;  2UXB Q;  3U4Z A;  3CCL A;  1WOC A;  4X3K A;  4B08 A;  1IXR A;  5M3M H;  4DR2 L;  2DGY A;  4A3G H;  4NW2 A;  1KD1 C;  4DUZ L;  1WTR A;  1K0S A;  1D6E C;  2B2U C;  4A3F H;  1HH2 P;  1MJC A;  3BVM A;  3LNN A;  5KG7 A;  2KCM A;  3TZD A;  2FKL A;  5KFR A;  5FD5 A;  3L7Z C;  2SNS A;  3S2D B;  2NN6 I;  3PSI A;  1PYS B;  1QZG A;  4IUQ A;  5C4J H;  2UXD Q;  3S1Q B;  1GUO A;  4O2A F;  3C1F A;  1O80 A;  3J80 i;  4DK1 A;  1I3Q H;  4X66 L;  4WJ4 A;  3RLF A;  3V4Z A;  4UCT A;  5KFZ A;  3PIO 3;  2EXD A;  3KUP A;  2EZV A;  2VOB A;  1SEI A;  4GOP C;  3N42 B;  3QG1 A;  1KC7 A;  3F2B A;  4DV2 L;  4DR4 Q;  3DXJ C;  2F0U A;  1R4Q B;  2F0P A;  1H9J A;  4MA0 A;  2OCE A;  3LGJ A;  4BBS G;  4JI7 H;  3BJY A;  1GO3 E;  2E2I H;  1B9N A;  2WKD A;  3GTL H;  4LH7 A;  4MTD A;  4WJW A;  3AQQ A;  3AB9 A;  1PRT C;  5D14 A;  4GNX C;  3TIG A;  2FLN A;  1SR3 A;  3KBX A;  1SND A;  2NVT H;  2F1M A;  1G2S A;  3K81 C;  2KEN A;  2JJQ A;  1ONL A;  2ES2 A;  4A3I G;  1VQ4 A;  4GLA C;  1KRS A;  5KG1 A;  3E9H A;  4FF4 A;  3SE0 A;  1R9T A;  2UUC Q;  4LF4 H;  2SEB D;  1ILP A;  1VQ7 A;  2HDL A;  2XCP A;  1I50 B;  1YJ9 A;  2YZM A;  2BDN A;  2PQA A;  2JEG A;  3H91 A;  2Y0S E;  5AFW A;  4A3M H;  3BA8 A;  3HFZ B;  1K8A C;  3KAL A;  3RZO B;  2OH2 A;  2JA8 B;  2VY3 A;  3E0J A;  1DXM A;  1HR0 H;  1I4Q A;  2WP8 J;  1E4F T;  1GYF A;  4IFD G;  3S16 B;  1IBM Q;  1G6P A;  3VYR A;  4FU0 A;  5KT5 A;  1IKL A;  3M4Y A;  2UVU A;  2K50 A;  3N40 P;  4LMY A;  2B63 B;  3T5J A;  2EY1 A;  1B3A A;  1UUP A;  4KJN A;  4HSV A;  4IZO A;  4RUA A;  4YCW A;  1FKA H;  5KFQ A;  1PMR A;  4CKE A;  1BKB A;  1WYD A;  3K5I A;  4QJF A;  3VR2 A;  2HQE A;  4JI5 L;  4QCL A;  3MWD A;  1JOR A;  1I5F A;  4EG0 A;  2EYP A;  3HBL A;  2W7O A;  5GRO A;  3PIP 3;  2DJG C;  5EZY F;  4DR5 Q;  4NMZ A;  3SI8 A;  2MO0 A;  3I7F A;  3C0F B;  2AWN A;  3CCQ A;  3OSO A;  1PTO C;  1R4P B;  3A7A B;  5EGT A;  4A3C G;  2XGQ A;  4DAP A;  4JI6 L;  3VR6 A;  4A93 H;  1UNS A;  3H4B A;  4DR7 H;  2PW5 A;  2QGQ A;  4IWX A;  4C2M A;  1E1T A;  4NKL A;  1BNC A;  1YHB A;  4CKC A;  4S3S A;  4DKA C;  3I4N G;  3GIJ A;  1YHA A;  3OIP A;  4PMW A;  4C5A A;  5IP9 G;  4YCU A;  1N56 A;  3CCS A;  3GV3 A;  3T5K A;  2JA7 B;  4LFA L;  4DV0 H;  1S97 A;  4EBD A;  4DR2 Q;  4BY7 B;  1F9Q A;  3A8K E;  4C1N K;  1NSN S;  2F03 A;  2B39 A;  1RF2 D;  3PUY A;  1B53 A;  2F0E A;  2Y0S G;  4DUZ Q;  3LML A;  3PO3 G;  4NXM H;  3TIN A;  2F4V H;  2R7Z A;  3V6J A;  1GUS A;  2XCL A;  2HD3 A;  2MNA A;  2Z4H A;  1IL2 A;  1IBL H;  1BXR A;  2W9B A;  2NTT A;  3RZD H;  2KHJ A;  3HOY H;  2NYZ D;  4MN3 A;  4C3H H;  5M5Y B;  4J1M A;  2WDT A;  2ASD A;  5KFS A;  3T1H L;  1WI5 A;  2N49 A;  4A2A A;  3GID A;  2EVB A;  2C35 B;  3ULL A;  2UUA H;  2K6A A;  2NTS A;  4XX0 B;  3AFP A;  3T13 A;  1Z6H A;  1MKH A;  1I4X A;  2PMZ B;  1S3O A;  2UXC Q;  1H95 A;  4GC7 A;  3BJU A;  3T1Y Q;  4R8U A;  2PO4 A;  5NUC A;  5C0X G;  2R92 A;  3RMH A;  3ICE A;  3FPU B;  5J1Z A;  2ZJT A;  3SK5 A;  1HCZ A;  2CWP A;  3WOE A;  4J9R A;  2WB1 B;  1LV9 A;  4O2D A;  2R8K A;  3BVZ A;  1WCM B;  3RF2 A;  2XC9 A;  2JA9 A;  1VQF A;  1J5E H;  4LFB H;  1EEI D;  2HVS A;  4IPC A;  5EPJ A;  3U9S A;  4BA1 I;  3DM3 A;  1GSH A;  2UXB H;  5HY6 A;  2KA7 A;  3GDE A;  4LF6 Q;  3RGX A;  1ASZ A;  3TBI B;  3GIP A;  2ASL A;  1BQQ T;  1EY7 A;  1OO9 B;  5KNB A;  1D7Q A;  4HJ8 A;  2A5H A;  1HNZ Q;  1Y1W G;  4K2L A;  4XYM B;  5G3L D;  3RGZ A;  1PH9 A;  4A3D G;  5LMN L;  3UE1 A;  3RR5 A;  3N6R A;  4LW1 A;  4CDD C;  2FFK B;  3H0G H;  2PNH A;  3MXN B;  1RJQ A;  3JZI A;  1DOL A;  4EFB A;  2VQF L;  5LMN W;  5FO7 B;  4OIK A;  1SMY C;  4KHP L;  4DV3 H;  1JWM D;  3NUC A;  5KT7 A;  2BQR A;  2R7M A;  1VQP A;  2AHO B;  3V96 A;  1U9R A;  1NUC A;  3W2D A;  1AEX A;  2IHE A;  2JA6 B;  2R61 A;  1E7Z A;  1XPO A;  5IGC A;  4KHV A;  3S24 A;  2E2H B;  3BZK A;  2B29 A;  4EYH B;  2R86 A;  4KI0 A;  1TAE A;  3GTJ H;  3MC0 B;  3ITP A;  4J9O A;  2P5Z X;  3F8N A;  3X3N A;  2IX3 A;  4IUT A;  2KSW A;  4DR4 H;  3KF6 B;  4RCN A;  1S4Z A;  1ICF B;  1BCP F;  4LF5 L;  1KNE A;  5M5W B;  2W8K A;  1X3F A;  4IQZ A;  3KHH A;  1GHK A;  1XNQ H;  4C56 C;  4DL7 A;  2I87 A;  1V51 A;  1TS3 A;  5D1O A;  1B50 A;  2FK1 A;  4UCO A;  5IIF A;  3VMM A;  1RL2 A;  1E2W A;  3JAM E;  2VQE Q;  4JI6 Q;  4O3N A;  2NVX B;  4ID6 A;  3H40 A;  4B3S L;  1HFG A;  5IT9 E;  4RNN A;  4UCR A;  4JI3 L;  2BCO A;  4ZHQ F;  5KFM A;  2B2V C;  4DV5 H;  2V4R A;  3DWA A;  4DR1 L;  2ZTC A;  3L4K A;  2AGP A;  5IGB A;  3BU2 A;  2K05 A;  4LFA Q;  1RYR A;  4ULL A;  2A69 D;  4K0K L;  3G8C A;  4IRD A;  1EOV A;  2ATW A;  4XQJ A;  2PN1 A;  4M1U B;  4DV1 Q;  3PF5 A;  3AEV A;  3E0E A;  3OUZ A;  4Q45 A;  3KDF A;  3K5M A;  2RQX A;  4JI2 Q;  2IMW P;  3DEP A;  3ERO A;  3K0X A;  3KOJ A;  4ZUI A;  1IBK L;  1KDB A;  2VW9 A;  2I0Q A;  5BMV F;  2CQA A;  3H6M A;  5ELB A;  4PV1 C;  1TXY A;  3CRK C;  5DGA A;  4RB0 A;  4LMQ D;  2R8H A;  4JC0 A;  2W8L A;  3I4M H;  1VQN A;  3RBD A;  1WTO A;  3AYH B;  4A75 A;  5ELN A;  1STH A;  4EBE A;  4RWS C;  4DK6 C;  5BR8 L;  3S2H H;  1I6H B;  1HUN A;  2R7F A;  1F9S A;  3F2U A;  3UI2 A;  2NVQ H;  1EYA A;  4ZQI A;  3IG0 A;  4X64 L;  1GUW A;  1I6V C;  3TME A;  1A15 A;  2RA4 A;  1ZQ7 A;  3F2C A;  3K3V A;  4DV4 H;  5I9O A;  4DUY Q;  5M3F H;  1Z7T A;  3HOW G;  2FE3 A;  5EPK A;  3SK6 A;  2Z8L A;  4K5W A;  3CCE A;  2Q8R E;  1KJJ A;  5C3E B;  1LT3 D;  2QKI C;  5LL6 S;  2VUM B;  1LTB D;  3S1M H;  4JV2 A;  1I6U A;  4EGJ A;  4YY3 L;  1WTX A;  1FVI A;  2LMC B;  3KLS A;  1CSQ A;  1D1K A;  1NTG A;  3HOX G;  2XGT A;  3PUW A;  5JJK A;  4DL3 A;  2WV6 D;  2RGR A;  2OTL A;  3FMA A;  4NXN L;  2RSO A;  3JC6 6;  5LMN Q;  4ALP A;  1KDA A;  1PV4 A;  1EZ1 A;  1SE2 A;  1O78 A;  2F0H A;  5JOB A;  2I80 A;  4ZI7 F;  3M9B A;  1YNN D;  1XWE A;  3FKI H;  4BBR H;  1TWF A;  3T4A C;  5DLQ E;  1T94 A;  3SHL A;  2JA8 G;  2F0T A;  4TSS A;  5BN3 A;  2K5N A;  1U4M A;  4HIM A;  1C48 A;  4POF A;  2PCF B;  1ZKO A;  2YRX A;  2JEB I;  3PR4 A;  2G9H D;  1S0O A;  4A3J H;  3RBE A;  4EQ5 A;  4DV6 Q;  3W1B A;  2B63 G;  1TWA A;  2UXC H;  4EYI B;  1I4P A;  4JYA Q;  3MR2 A;  3AU7 A;  3GIK A;  4QWA A;  3OTO L;  2X6G A;  1S10 A;  5D3D A;  4LF5 Q;  5BN5 A;  3TDQ A;  2IHF A;  1A2U A;  2FHT A;  3SVM A;  2PMZ E;  1K8O A;  1K9M C;  1CZG A;  2AUK A;  4Q43 A;  5F2D A;  2NUA B;  3GTP A;  3LP8 A;  2XSC A;  4JBJ A;  2L4N A;  4ED8 A;  4CJ1 B;  5LA6 F;  1QCB D;  4JI7 L;  1GLV A;  4FS2 A;  2WB1 E;  4LF6 H;  1HNW H;  4B3S Q;  1TWH B;  3VYU A;  5K36 G;  4EGV A;  1XMQ H;  4JI3 Q;  3J81 E;  2W9A A;  2XD4 A;  5AJ3 Q;  3E5S A;  4LUO A;  2L12 A;  3OW7 A;  4GN5 A;  1AN8 A;  2F3V A;  2K03 A;  2YU9 A;  1MJE A;  4Q44 A;  1XMO L;  3K0Y A;  2DZD A;  2JA7 G;  1A3V A;  2IWH A;  1KJ9 A;  3HOZ B;  3VA5 A;  4BY7 G;  4FXG C;  4X6A H;  5FLM G;  5F9L A;  4JUZ A;  2UU9 Q;  4GKK L;  1VQA A;  2B2W A;  5E4X A;  4ABN A;  3NTH A;  2W6O A;  1KJ8 A;  3RB6 A;  1BDO A;  1KQS A;  5KFU A;  3JAM c;  4BBS B;  2Y0S A;  5CV7 A;  2KOL A;  5IGE A;  1SLJ A;  5C5L A;  1KIX A;  2YYZ A;  4M8A A;  2FXQ A;  5M9O A;  3S15 B;  2EYF A;  5JEA H;  1G29 1;  1X3P A;  4B9W A;  4NLG A;  2C2D A;  5IT9 c;  1TWG B;  3ZJY C;  1E1O A;  3PZP A;  1N32 L;  1GM5 A;  4ME6 A;  3VPB A;  2W57 A;  3WO1 A;  3AFQ A;  4HSP A;  3S1R B;  3JAM L;  2MGS A;  2YV5 A;  5KND A;  4A3B B;  3JAM W;  4GN3 B;  3J81 j;  4PZ8 A;  1E0B A;  2D2C C;  1VQ8 A;  3K7A B;  1EIF A;  4B3R L;  2VQE H;  2VPQ A;  2J0T D;  4HID A;  4FF2 A;  1CTM A;  4ECU A;  1X3G A;  1B4O A;  2FPG B;  4KY5 A;  4DL2 A;  4IFD I;  1VQ5 A;  4J9K A;  1WCM G;  3D8G A;  4DAV A;  4DR3 H;  2F0I A;  2R93 G;  1HRJ A;  3PW5 A;  4LFC L;  3M9N B;  1D8L A;  5CGK A;  4OWW B;  4P73 A;  1UC8 A;  3MWE A;  1OWT A;  1S0M A;  4JI0 L;  1BF4 A;  4JK1 C;  3NXW A;  3J7A K;  2B2U A;  2YRW A;  3N43 B;  3SGI A;  4FYD A;  1PRT D;  1X32 A;  5ELD A;  1V8Q A;  2MUY A;  2HIX A;  2PZU A;  4LH6 A;  3J7A 5;  4JI2 H;  1TR5 A;  2QA4 A;  3OSP A;  2RCF A;  5C5M A;  3MFG A;  5A2Q E;  2NU9 B;  4E6I A;  1Y1W A;  4GS3 A;  5D65 A;  3W1G A;  3FDS A;  3RB4 A;  2F0Q A;  2HHH L;  2W6N A;  3M4I A;  4I4T F;  2C2R A;  3EJI A;  1EYG A;  1X55 A;  1JX4 A;  3NSW A;  2OQK A;  4J15 A;  3H3V H;  3TRZ A;  2JA6 G;  1N36 Q;  4MHE A;  1E4E B;  3UDG A;  3ERS X;  3CMA A;  2RHQ B;  4GOP A;  4K8J A;  2V9W A;  2A69 C;  1SCU B;  5JVH 3;  3PUZ A;  1K1S A;  4IUP A;  2JEA I;  2BH2 A;  5KG4 A;  4PZ6 A;  5C4X B;  2W6P A;  2A19 A;  2RDF A;  4A3K B;  4J9L A;  1X3E A;  4FXD A;  4I65 A;  4Z9C B;  3OTO Q;  2NVY A;  4A3I H;  5I4D A;  4GNX A;  1LTS D;  2EY6 A;  2ZXO A;  1STN A;  2A6H C;  1AUX A;  3MWM A;  2KJX A;  4DUY H;  3GTM H;  1VQJ A;  1Y1V H;  5HGT A;  4HTH A;  4C3I B;  1SNP A;  1Y8P B;  5KGU A;  4L1K A;  1ULZ A;  2IBK A;  1SJE D;  1FNU A;  2SCU B;  3GV8 B;  3MFY A;  1PZI D;  5M5X B;  1B33 N;  4FXK C;  3GTO A;  3T51 B;  4EQN A;  5LMU Q;  3NBH A;  1RIP A;  3RV3 A;  2R6G A;  5I9P A;  2QYZ A;  5LYJ F;  2UUB H;  5KFA A;  3L4J A;  1CT1 D;  4LFB L;  3BQ0 A;  3LWU A;  4IFD H;  3MWY W;  4OO1 I;  5CV8 A;  4RAZ A;  4GC6 A;  4QF4 A;  2OEO A;  2CW7 A;  2VPS A;  3R5H A;  5L1J A;  3NQT A;  3OIQ A;  1RTO A;  2F4I A;  3DM1 A;  3M3Y H;  1EWI A;  4C5B A;  3MHB A;  2ZM6 L;  1L1O B;  5GAD C;  4GKK Q;  3NBI A;  5C0X I;  4LF7 Q;  1FNV A;  1DIK A;  1FGU A;  2KQ3 A;  4X65 Q;  1O7I A;  5IYB H;  2EY2 A;  3UE0 A;  1W6K A;  3CXC A;  1BGW A;  3NK9 A;  5DM6 3;  4ZCK A;  4DV3 L;  2ID0 A;  1RD9 D;  1SYB A;  4OIJ A;  4G7Z C;  2KEC A;  2O2L D;  4DV6 H;  3HP3 A;  5C44 B;  3J81 c;  4JYA H;  4A3C H;  1VF7 A;  1N32 Q;  1HUM A;  2X6L A;  4IAJ A;  2VZA A;  5GON F;  5GQO A;  4GN4 B;  1ML0 D;  1U4L A;  4DAY B;  1F77 A;  3IN5 A;  4DL6 A;  4UHV A;  1QNK A;  1X65 A;  2RDI A;  1SE4 A;  2YU9 H;  4ECT A;  2A74 C;  3JRW A;  4JI8 H;  4DL5 A;  3MXU A;  4R8N A;  1YNN C;  3NE5 B;  1XJV A;  3HKZ A;  2MFI A;  3ERQ A;  2KCC A;  3J81 L;  3RB0 A;  5H1S E;  1EYZ A;  1HHV A;  3Q8S B;  4BA2 I;  3J81 W;  1EYC A;  1FGB D;  4C3J B;  2BR0 A;  4B3M H;  3C3L A;  1J9O A;  4RGT A;  4LF9 L;  4DK3 C;  3KHR A;  3Q8D A;  4LFC Q;  3GO5 A;  5IYC G;  2EYJ A;  2CWA A;  2K14 A;  2L1B A;  2QCP X;  4CHT B;  3G6Y A;  1MGS A;  2MO1 A;  1Q1B A;  2K5H A;  2VUM G;  2DNE A;  1S68 A;  4MA5 A;  1SFO B;  1XDN A;  2YZN A;  1DON A;  2W6Q A;  4A3G B;  1BVS A;  3H20 A;  4FBU A;  4DV5 L;  1CZW A;  4UFZ A;  5ELC A;  4OO1 H;  2ZDH A;  3DUZ A;  2BA0 A;  4A3F B;  3S17 H;  1KLG D;  3V6K A;  1I94 H;  4GKJ L;  2MPM A;  4OGQ C;  2C28 A;  4JV5 H;  2KCN A;  3A7L A;  1VS0 A;  5D8D A;  2M00 A;  1EUD B;  2Q2I A;  4QWE A;  4MTK A;  4R4Q A;  4RGN A;  2HHH Q;  4PWQ A;  5C4J B;  2F3I A;  1PH4 A;  3Q0A A;  1JOQ A;  4NDX A;  1I50 A;  1CA5 A;  1VQD A;  3RLN A;  2NU8 B;  1WR2 A;  2TSS A;  3QWN A;  2EJF C;  3WOF A;  1Q1E A;  2D0P A;  1RJT A;  1E24 A;  3E3X A;  1SMY D;  1B7Y B;  1ZYR D;  3FEW X;  2LKV A;  4ME3 A;  4HN7 A;  1NBW A;  4DAM A;  1LO5 D;  1X3Q A;  2SDF A;  2BE5 C;  4LAA A;  2B63 A;  2F0O A;  2PZT A;  1OXU A;  1L2F A;  4DFA A;  4YHH Q;  5KFB A;  1EQR A;  1UNN C;  4P75 A;  5EBC A;  4RUC A;  3OMG A;  2FK2 A;  3J7Z C;  4A3D H;  2HT1 A;  1BXT A;  3CKI B;  2QEX A;  2ZJR A;  4JV1 A;  1QIL A;  3K80 C;  2B2Y C;  2XRQ D;  3QB3 A;  1SE8 A;  1ZHQ A;  5A2Q L;  1B6S A;  3R8B A;  1SNQ A;  5A2Q W;  3TRE A;  1BOS A;  4DF7 A;  3T5H A;  2K4K A;  2B2T C;  3UFX B;  4KY6 A;  3A54 A;  3KF8 B;  5KFD A;  5A35 A;  1CFM A;  1GOZ A;  4L5Q A;  4A3M B;  3TN2 A;  1KC8 C;  2ZM6 Q;  4A3E B;  2AMC B;  3HOZ G;  3U50 C;  1IOV A;  3PN1 A;  1XNR L;  4LJZ C;  2JA7 A;  2XVS A;  5KG3 A;  1JWU D;  3RNU A;  4HR7 A;  1SEB D;  3A8J E;  4FDB A;  4RZR A;  1N36 H;  1NMG A;  3MZ5 A;  5COR A;  2WYO A;  3BYY B;  3S1N B;  3HOW B;  2D5D A;  1W3S A;  2NB0 A;  1PH6 A;  2FLP A;  1K83 H;  2JA5 B;  4TKO B;  1PK8 A;  3GTK H;  5KFF A;  1LYL A;  1HNX Q;  1M7J A;  2DIK A;  4IPG A;  1IHZ A;  3EPI A;  3CW2 C;  4X62 L;  3HOX B;  4K6D A;  4L5R C;  2YW2 A;  1A8V A;  5DQG A;  3WDN A;  3ORQ A;  3MFH A;  1Q90 A;  1C3O A;  4RAU C;  4AQY H;  1ZEQ X;  4DN4 M;  4A3B G;  3M4P A;  5DLG A;  2E5L H;  4J9N A;  4QY7 A;  1F2L A;  3J7A F;  5LMU H;  1Y8O B;  5IP7 H;  2B2V A;  2PMZ A;  2V4D A;  1YBY A;  1HJP A;  1WTQ A;  2UVV A;  2RKS A;  4B3T L;  1OXT A;  3RN2 A;  4LF9 Q;  1UEA B;  1ET6 A;  3RLO A;  3CC7 A;  5K2M A;  2TMP A;  1LTR D;  2EY5 A;  2IP4 A;  2AGO A;  2EIF A;  1FJG L;  3K3P A;  1EIY B;  2WB1 A;  3SR1 A;  3S2D H;  4ZOL F;  1WCM A;  4G7O C;  2IT1 A;  5JEA J;  2NN6 H;  2I46 A;  2YYA A;  3A56 A;  1PXU A;  4DXF A;  3S1Q H;  1N33 H;  1PTO H;  4LF7 H;  3MVV A;  4GKJ Q;  1I7L A;  4KKU A;  3HOV B;  1HZ9 A;  4X65 H;  4OX9 L;  5ELE A;  3DEO A;  3PF4 A;  2DPI A;  1D1I A;  3VYS A;  4FBT A;  4JI4 H;  5CA0 F;  3M4Q A;  3MXN A;  5JQW A;  2XIG A;  1LLR D;  4RMF A;  5IWA Q;  1PHJ A;  2R7N A;  3I4O A;  1DM0 B;  2YTX A;  5T14 A;  4V0B A;  1AZQ A;  2O03 A;  4ED3 A;  4HAE A;  5JJZ A;  1UC9 A;  2LXK A;  4G7H C;  1PH2 A;  3M7G A;  1YVC A;  4NPS A;  3PW7 A;  2IY5 B;  5C4X G;  4A3K G;  3GP7 A;  1KHI A;  2JE6 I;  4DXG A;  2W71 A;  2ASB A;  2E2H A;  2ZXP A;  4FNF A;  2JP1 A;  3IKJ A;  1EEF D;  1DD2 A;  3KF6 A;  4YWM A;  3CF5 A;  5J3B A;  3E6Z X;  1II3 A;  2WAQ G;  1JXL A;  1SYD A;  4C3I G;  4YB8 B;  4QWC A;  3I55 A;  2F0M A;  3PIO A;  3OPO A;  1OTC A;  4YP3 A;  2OQ0 A;  1VQ6 A;  2WKC A;  2J4X A;  4ECZ A;  1N34 H;  3CP0 A;  1WH2 A;  1TA8 A;  3GD7 A;  4APV A;  3ULJ A;  1B2T A;  2V5A A;  3SE7 A;  3V05 A;  4CC5 A;  4MTN A;  4F7X A;  1IL8 A;  4HYK A;  4UP7 A;  3KAK A;  3TQT A;  2BA1 A;  2NVX A;  1M4V A;  3ULP A;  1EY9 A;  2EXZ A;  3H0G B;  4KV6 A;  5CV9 A;  1W6J A;  1S5D D;  1STE A;  4X66 Q;  2EE1 A;  1YJW A;  2EDG A;  1A9X A;  1Q8I A;  2F52 A;  2I5H A;  1TWC A;  4DV2 Q;  2XWB B;  5KG6 A;  2K52 A;  1KJI A;  5LOV F;  1I7N A;  1DCZ A;  4CDF C;  3D6C A;  1AE3 A;  5DQH A;  1S5B D;  4LF8 L;  4HJ5 A;  2Z0S A;  4FP5 D;  3GTJ B;  3QZ7 A;  4APM A;  3VR4 A;  2I5L X;  4PMC A;  4O4I F;  4JG2 A;  2ICI A;  2R93 B;  5CV4 A;  5C44 G;  3CVZ A;  1VQO A;  5KG0 A;  5L1K A;  1S0N A;  2HCI A;  1C4Q A;  1A62 A;  1HQM C;  3C46 A;  4X62 Q;  4YHH H;  4RKB A;  3I4L A;  5ELF A;  3U4V A;  1DGS A;  5KFY A;  3PO2 B;  4R7R A;  4QIW E;  5KFK A;  1SYG A;  1QG7 A;  1AUV A;  3T56 B;  2JA7 H;  3GTG B;  4BWS C;  3T53 B;  4ZKC B;  3DLL A;  3Q23 A;  1O7L A;  1V43 A;  3NTK A;  4C3J G;  4XQN A;  4BXX H;  3J80 E;  3ORR A;  1ZYR C;  1NR2 A;  2UXD H;  4XXE A;  1SE3 A;  3PIP A;  4TV9 F;  2E76 C;  1FJG Q;  4P71 A;  1LTA D;  1VMP A;  2YCH A;  4I7Z C;  2W70 A;  4C5C A;  1B44 D;  1BBW A;  4F88 A;  1SJH D;  4DV7 L;  5M5Y H;  1UE5 A;  3KXY T;  2D9U A;  2DY7 A;  3HRZ C;  4A3G G;  3OWE B;  2CZG A;  5I2Y A;  2VUM A;  1CQJ B;  5EWF A;  1R9T H;  1MZB A;  5CB4 F;  3Q8R B;  2HCC A;  4A3F G;  4JI5 Q;  4HJA A;  1X6O A;  2CW0 D;  1SRU A;  3N44 B;  4JW0 A;  4BS9 A;  2DY8 A;  3ER0 A;  5KNC A;  3F2D A;  3GTQ B;  5IGF A;  2GLT A;  1G51 A;  2ZDQ A;  4XYO A;  3IAY A;  1NE3 A;  1IOW A;  3BZD B;  1HNX H;  1XX8 A;  1AW7 A;  5EKI A;  1N9W A;  5KRU A;  5CMD A;  2Q8I B;  4X3S A;  1LAC A;  4RH6 A;  2NVQ B;  2UUC H;  1AE2 A;  4YWK A;  2D0O A;  3NTI A;  1QVG A;  1PFM A;  2FMA A;  4WBN F;  4L63 B;  1V9P A;  4QB4 A;  3TQ1 A;  4TUY F;  2NZH A;  4HIK A;  3CCM A;  2WTF A;  2ZTD A;  4WD3 A;  1WD1 A;  1XTD A;  5KKN B;  1DOM A;  4N8F A;  2B8F A;  2VQD A;  4AYB B;  2ENB A;  5HGQ A;  4DR6 L;  4RB2 C;  5H80 A;  2GN5 A;  3L9A X;  3I8Z A;  3I3C A;  3S1M B;  1IBM H;  5FPR A;  3KAJ A;  1CHP D;  4IOC A;  2Z6B A;  2A6H D;  4B3M L;  1WJJ A;  1BCP B;  2AWO A;  4KN4 C;  4LUV A;  2YS7 A;  3I2Z A;  2IX1 A;  3T1H Q;  4C2M H;  3PGZ A;  3I12 A;  1Y8N B;  1GJX A;  5L1L A;  1EQQ A;  3FP9 A;  1UE1 A;  2ZJQ A;  2E2H H;  3WWV A;  1EZ6 A;  1S9F A;  3FKI B;  4A3M G;  1TT2 A;  4DR5 H;  3EFX D;  4CDC C;  3LWE A;  3E9I A;  5FJ8 G;  4A3E G;  3EPG A;  5GAG C;  1O7Z A;  2JYO A;  3P1H A;  4JV5 L;  4HNU A;  1GUN A;  5EPL A;  1Q3L A;  4ECS A;  2CVR A;  3OW2 A;  2R7Z H;  2QF7 A;  2CKZ B;  5G3L F;  4A3J B;  3M9O B;  3PW4 A;  4UPA A;  2I8C A;  1M0T A;  5ISR A;  1PH1 A;  1IYJ B;  2JA5 G;  4ED1 A;  3KJP A;  2OXP A;  5KFX A;  1AZP A;  3BVG A;  3CRL C;  1TU2 B;  3C1E A;  4KTA A;  3SK8 A;  3J7Y W;  3OSN A;  1CKN B;  4CDE C;  1TWG A;  1XYI A;  1S5C D;  4DR2 H;  4JVZ A;  4IZ8 A;  1HZA A;  4Q8F A;  1SDF A;  5DG7 A;  4QMG A;  4DUZ H;  1TWC H;  4JI1 L;  3G4S A;  4BY1 H;  3R93 A;  4MV4 A;  4A93 G;  2VQF Q;  4MV8 A;  2R92 H;  1ZET A;  4CJ0 B;  4KHP Q;  2C00 A;  2EJG C;  2EYH A;  1RKN A;  4BWG B;  2AQ1 B;  2V59 A;  2F0V A;  3E5N A;  2Z1C A;  3RJ0 A;  2C2E A;  2DUD A;  3FRP B;  4QL5 A;  4IUR A;  1IYV A;  5C4Z A;  1CS0 A;  1SNC A;  3OUU A;  1RYS A;  4EFE A;  4MIU A;  4X66 H;  5KFC A;  2K04 A;  4DV7 Q;  3QFF A;  1PH8 A;  1AP0 A;  3RTX A;  3MEF A;  1UEB A;  2KUM A;  2QW7 A;  4Q0F A;  1E2Z A;  3RV4 A;  1EY6 A;  3T1Y H;  5E3F A;  4I50 F;  1K3B C;  3MFI A;  1CQF A;  1JCK B;  4PQX A;  1SN8 A;  3HOV G;  4I7A A;  4TQR A;  5KT4 A;  1CUK A;  2FK3 A;  3X3M A;  1A2T A;  5CYU A;  1O7Y A;  4U7C A;  4IJH A;  3J80 c;  1VDZ A;  1K1Q A;  4OWT B;  2CQO A;  3EVQ A;  3PQI A;  5I47 A;  4IO9 A;  1WVL A;  1AH9 A;  1S72 A;  4O0A A;  1AN7 A;  2R8J A;  1BUV T;  4K8I A;  1VQB A;  3NP8 A;  1XXG A;  5IYD H;  3W3A A;  2WII B;  4ECQ A;  2VS1 A;  2FJ2 A;  3BYT B;  5IYC H;  2JN4 A;  5C3E H;  3BS1 A;  3TS0 A;  1E4E A;  3J80 L;  4FO2 A;  4DR1 Q;  1RK6 A;  1HNZ H;  4O3S A;  2VUM H;  2JSO A;  2DPJ A;  3J80 W;  1EUJ A;  1A6X A;  1T5X D;  4K0K Q;  2KHS A;  4R4I A;  4X3T A;  3GIQ A;  4ODG A;  4L5T A;  1RHP A;  4LF4 L;  4PZ7 A;  4DR6 Q;  4QUF A;  1F2Y A;  4R9W A;  3PV0 A;  4ED2 A;  2VNU D;  3RUP A;  1LAB A;  1HTL D;  2BE5 D;  3PCO B;  4ED0 A;  3K5L A;  1IBK Q;  1MSH A;  5KT3 A;  2E2J B;  4A76 A;  1IKM A;  1B8A A;  1LTG D;  2GA4 B;  3HOU H;  1HR0 L;  1ESF A;  3ND8 A;  4JCV E;  3VPC A;  1ET9 A;  1HR0 W;  4JI5 H;  3QR8 A;  2NBF A;  3H0G G;  3KK7 A;  3OOC A;  1JWS D;  4K5X A;  2UVW A;  5BR8 Q;  3L3O C;  1QUQ B;  2VUG A;  4YAJ B;  2EPB A;  4YCV A;  5I2X A;  4X64 Q;  2Z9H A;  3BAB A;  3I72 A;  3SK4 A;  4YQW A;  4A4I A;  1JT8 A;  2EYO A;  2V58 A;  1L1O A;  3IL8 A;  4JI6 H;  1IYU A;  3QZ8 A;  1EU3 A;  4AIM A;  4Y7N H;  1GUT A;  3GIM A;  3HEJ A;  4TVA B;  1QE6 A;  3RN5 A;  1Z2P X;  3CCU A;  4ECR A;  3D6W A;  2VB2 X;  4I7H A;  2KEE A;  2LY7 A;  1U4P A;  4LFA H;  1MIU A;  4G4K A;  1B1Z A;  1LTT D;  2CW0 C;  4YY3 Q;  3GTM B;  1BBU A;  2CH4 W;  4DR7 L;  1EOT A;  1Y1V B;  1HA6 A;  1SSO A;  3URY A;  4DV1 H;  4DAY A;  2B2Y A;  5KYL A;  3PO2 G;  4JI1 Q;  4IUN A;  4NXN Q;  3VR5 A;  2H1E A;  2R7L A;  1E3P A;  4H02 A;  2Z4I A;  4AYB E;  4DV0 L;  4RB3 C;  3R2T A;  4IR1 A;  1ENA A;  3AMU A;  1NAP A;  4ILW A;  4NB3 A;  5JVL A;  2B2T A;  2VL6 A;  2M9V A;  2F4V L;  4NXM L;  2AKW B;  2G5D A;  2SNM A;  2GPW A;  3PUX A;  3T1H H;  1VQL A;  3MR3 A;  1IBL L;  2K32 A;  5EWG A;  4BBS H;  1W2B A;  3M3Y B;  5FOB B;  3OWF A;  5DM7 3;  3FVQ A;  1V1P B;  2C5C A;  1B70 B;  4IRC A;  3D4D A;  3A0J A;  4OWX B;  1MD2 D;  1PZK D;  1SFO A;  5CAE B;  1EWH A;  3QIA A;  2UUA L;  4ECW A;  4R4O A;  4GLX A;  1EY0 A;  3JSL A;  4F4Y A;  3MR6 A;  1PDQ A;  2WAQ B;  3G71 A;  4KD3 A;  2L0C A;  4UCU A;  1TWF H;  4QQB X;  4IOA A;  3CQZ A;  1SMX A;  2RDJ A;  2YU9 B;  5BPH A;  3FHW A;  3ETH A;  4KN7 C;  4JI7 Q;  1Z2N X;  4YR0 A;  1P8L A;  1Z47 A;  3GV6 A;  2K5V A;  2FMM A;  2R3Z A;  2XRS D;  1J5E L;  1C0A A;  1JJC B;  3OHX C;  2EYM A;  1B6R A;  1CI3 M;  3I73 A;  1TWA H;  5LMN H;  1ENF A;  4B9X A;  1FL0 A;  4YIJ A;  2OT2 A;  3H3V C;  2UXB L;  1PX2 A;  1XMO Q;  3CCR A;  2QEJ C;  2F0J A;  1J8I A;  2V4Q A;  1I4R A;  4L6T B;  2J9G A;  5IGG A;  4O3Q A;  3S14 H;  4OEM B;  5M3F G;  3D4W A;  3N6X A;  1D5Z C;  2YTV A;  4AYB G;  4ZYS A;  4KK7 A;  4JBM A;  3FPP A;  1CHQ D;  2Q2T A;  3GTP H;  4MTE A;  1UE6 A;  5JUM A;  1YEZ A;  3K5N A;  1QOH A;  3I91 A;  4KLK A;  5FD6 A;  2IW3 A;  2O4X A;  3V4S A;  5IOD A;  5KG2 A;  3NHH A;  5EWE A;  4UDU C;  4LK1 C;  1HZB A;  1NR4 A;  3D31 A;  4LF5 H;  2BH8 A;  3Q22 A;  5C1P A;  5C4X H;  3FKI G;  2F0L A;  1KTK A;  1BBX C;  3I4N H;  3F8T A;  2Q8T A;  3MTS A;  3NEN A;  4DR4 L;  1TY2 A;  3KF8 A;  5IP9 H;  1PRT F;  1KNA A;  4U67 3;  5KT2 A;  2XTI A;  3NPP A;  4B3R Q;  5EKL A;  4DL4 A;  1ROD A;  1E4G T;  1S40 A;  5K5P A;  1XNQ L;  2RHS B;  1RJR A;  4B3S H;  4A3J G;  1UWV A;  1H9S B;  3Q6S A;  4JI3 H;  3PO3 H;  5C3X A;  3KHG A;  5KIX A;  4I55 F;  3MXP A;  4DR1 H;  4POG A;  5M5X H;  3K58 A;  2L11 A;  1LT5 D;  4Y52 H;  4U6P A;  2R6F A;  4YJ3 F;  1SYX B;  1JOO A;  5EOY A;  4K0K H;  2FPI B;  4JI0 Q;  4DR7 Q;  5M3M B;  2ZDG A;  2FLL A;  2LSS A;  2JA5 A;  3EYY A;  4F4W A;  2PPB C;  3SXH A;  5EBD A;  1JB3 A;  2MJ8 A;  3OHB A;  3BQ2 A;  2UU9 H;  1KRT A;  5IGD A;  1LT4 D;  2YZG A;  3HZX A;  5CBE E;  4UAI A;  4OHJ A;  5C4H A;  3EBE A;  5I6Y A;  1YIJ A;  3M4O H;  3GII A;  4Y8V B;  3J7A V;  4EEQ A;  2F4V Q;  4NXM Q;  5C0X H;  3TP7 A;  4ECV A;  1IBM L;  2ZJP A;  4J9Q A;  1JOK A;  4RZQ A;  1I3Q B;  4J9S A;  2F0K A;  3PW0 A;  5BR8 H;  1ENC A;  1XTC D;  1OXV A;  3RAX A;  2AUJ D;  2FP4 B;  1L1O C;  2PYK A;  3N8D A;  1M0W A;  4X64 H;  2NUC A;  2UUA Q;  4QIW B;  1C7Y A;  2R85 A;  2OLS A;  1PTO F;  4H13 C;  2Q2H A;  2PVP A;  2E2I B;  3GTL B;  3QJY A;  4RB1 A;  5JEA G;  1K83 B;  4AH6 A;  2NU7 B;  4KY7 A;  1Y1W H;  1F9R A;  2D62 A;  4FF3 A;  3U58 A;  3GTK B;  2NVT B;  2E74 C;  1K0R A;  2W7P A;  1SNM A;  4YY3 H;  1SXT A;  4DV4 L;  2EOT A;  4C3J H;  4TV8 F;  2X69 A;  4YWL A;  5C5J A;  2HDM A;  1QVC A;  3CME A;  1HA5 A;  4A2B A;  5EAY A;  1J5E Q;  4LFB Q;  3JSN A;  1RCV D;  1L0X B;  4MNO A;  4RGM A;  1VQM A;  1JQY D;  1D2B A;  5IOC A;  1A63 A;  1KXL A;  2CHB D;  4WRD A;  1SFO H;  1Y14 B;  2NVY H;  5JAV A;  4IRK A;  3LX0 A;  3TP6 A;  3PW2 A;  2A68 D;  5KFE A;  2H4O A;  1N48 A;  3Q24 A;  1MSG A;  1LUZ A;  5KFO A;  2L5T A;  1EY4 A;  2B8G A;  4WJ3 M;  1O75 A;  1DJR D;  5JPM C;  4XT1 B;  2R84 A;  3CQZ H;  4HQ6 A;  4DV3 Q;  2ZTE A;  4IUU A;  1YHQ A;  3GTO H;  1PTO B;  1HZC A;  1FNW A;  1PA6 A;  1K8M A;  4ECY A;  3HKZ B;  2K75 A;  3OTO H;  2C22 A;  3G6E A;  5ELO A;  1Q86 C;  2EJM A;  4EEY A;  3GIL A;  3Q8Q B;  2VXW A;  4IPH A;  1A3U A;  2N3S A;  3VPD A;  3A8I E;  4XQQ A;  2UXC L;  1M8A A;  1EWC A;  1H9M A;  3T1Y L;  3H0G A;  4R8I A;  5C1O A;  4RGO S;  1Q46 A;  4R4C A;  4JOI C;  1YZ6 A;  2W9C B;  1W93 A;  1A0I A;  4A93 B;  3CC2 A;  3VDY A;  2DJF C;  1XNQ Q;  1VQC A;  2WAQ E;  3VR3 A;  5J2T F;  1KDC A;  3WO0 A;  4EGQ A;  1PFB A;  1KL9 A;  3N41 B;  1X9N A;  1Q7Y C;  1JC7 A;  4Q8E A;  1EUC B;  4RCO A;  2H5X A;  4LF6 L;  1XMO H;  1CA6 A;  3GTJ A;  1HNW L;  2K28 A;  2MQH A;  3K59 A;  1DV2 A;  1HTP A;  3RFC A;  3TZU A;  2R93 A;  1VMC A;  3F1Z A;  1XMQ L;  2J7Z A;  1KJQ A;  1HXY D;  1Y1V G;  3LWB A;  4FVM A;  3JAM i;  4DV5 Q;  3CC4 A;  4GKK H;  1HNZ L;  4EVO A;  4DNT B;  3G6X A;  2GVA A;  1KAA A;  1G8Z D;  3I70 A;  1S5F D;  4KD4 A;  4WFN 3;  3JRX A;  4P72 A;  1LM0 A;  4FS1 A;  4LUZ A;  1LT6 D;  4K5V A;  3RZD B;  1PH5 A;  5FJ8 H;  5C6A A;  4A3E H;  3HOY B;  3ETJ A;  2XGP A;  1GUG A;  4C3H B;  1EYD A;  2IA6 A;  3GTG A;  1N32 H;  2A73 B;  3HG9 A;  5DEH A;  5J39 A;  3KLR A;  1Q12 A;  4CJ2 C;  1HFN A;  3S1N H;  3HOW H;  3G6J B;  2LS0 1;  1STA A;  2JA5 H;  2JA6 A;  1EY8 A;  3R2I A;  1G6Z A;  3N52 A;  5CV6 A;  1TS4 A;  5JVG 3; 
#chains in the Genus database with same CATH homology
 5IYD G;  2RCN A;  2YV5 A;  5E7N A;  4B3M L;  5C3E G;  4GN3 B;  1WJJ A;  4PZ8 A;  3J81 j;  1VQ8 A;  5IYB G;  2AWO A;  3HOX H;  4LUV A;  1IBL Q;  1EIF A;  4B3R L;  1N34 Q;  3CPW A;  3I2Z A;  2IX1 A;  3T1H Q;  3STB D;  3PGZ A;  4C2M H;  4GNX B;  4HID A;  2N8N A;  3UDF A;  1X3G A;  1EQQ A;  4JBK A;  2B3G A;  3FP9 A;  1UE1 A;  4A3L G;  2ZJQ A;  5C44 H;  1I50 H;  2VQE L;  3WWV A;  2E2H H;  4A3M G;  4DV4 Q;  1VQ5 A;  4IFD I;  1WCM G;  2R93 G;  5FJ8 G;  3E9I A;  4LFC L;  4A3E G;  1D8L A;  5GAG C;  4HIO A;  4OWW B;  3RZO H;  3EN2 A;  4JV5 L;  4P73 A;  2JA8 H;  4DR3 L;  4DR5 L;  4JI0 L;  4GLV B;  3NBH B;  3OW2 A;  2R7Z H;  2HQL A;  2CKZ B;  3S16 H;  1WFQ A;  3SGI A;  5IWA L;  3HOU G;  3H15 A;  4UPA A;  2HIX A;  4XIG S;  1PH1 A;  4DNI A;  3J7A 5;  2B63 H;  2QA4 A;  4DV1 L;  1IYJ B;  1L0W A;  2JA5 G;  2RF4 A;  3KJP A;  2OTJ A;  2PI2 A;  4GS3 A;  3W1G A;  1XNR Q;  4JI2 L;  2HHH L;  2CFM A;  4RG1 A;  3HOV H;  1QVF A;  4LNQ A;  1CKN B;  2KHI A;  1EYG A;  1HZA A;  1X55 A;  2OQK A;  2UXB Q;  3U4Z A;  4J15 A;  1WOC A;  3CCL A;  3H3V H;  3TRZ A;  2JA6 G;  1N36 Q;  1IXR A;  1CKM A;  1TWC H;  4JI1 L;  2DGY A;  3ERS X;  3NEM A;  2RHQ B;  5M3M H;  3G4S A;  3CMA A;  4GOP A;  3UDG A;  4BY1 H;  4A3G H;  4OO1 G;  4A93 G;  3PUZ A;  1KD1 C;  2VQF Q;  4DUZ L;  2BH2 A;  4PZ6 A;  2JEA I;  2R92 H;  2A19 A;  4A3F H;  4KHP Q;  1HH2 P;  1MJC A;  1X3E A;  2KCM A;  2PQA B;  3OTO Q;  3L7Z C;  2NN6 I;  3PSI A;  2DUD A;  4QL5 A;  4GNX A;  4A3I H;  1K8G A;  2V1C C;  4IFD J;  1PYS B;  1QZG A;  5C4J H;  4P74 A;  2UXD Q;  3GTM H;  1VQJ A;  1Y1V H;  4DV7 Q;  1PH8 A;  3L0O A;  3MEF A;  1UEB A;  3J80 i;  4DUY L;  4BY7 H;  1I3Q H;  5FLM H;  4X66 L;  4WJ4 A;  3RLF A;  1Z9F A;  4B3T Q;  2EXD A;  5LMU Q;  1RIP A;  1YI2 A;  2R6G A;  1SN8 A;  3HOV G;  4R4T A;  4GOP C;  4XTC S;  3EIV A;  3F2B A;  4DV2 L;  4DR4 Q;  1CUK A;  1GD7 A;  4LFB L;  1HNW Q;  4OO1 I;  2UUB L;  4IJH A;  5GAE C;  3J80 c;  2OCE A;  3LGJ A;  4OWT B;  1XMQ Q;  5M3M G;  2CQO A;  1JJ2 A;  1GO3 E;  2E2I H;  4BBS G;  3GTL H;  4KHZ A;  4IO9 A;  3AQQ A;  3M3Y H;  1EWI A;  4GNX C;  1AH9 A;  1SR3 A;  4O0A A;  1L1O B;  5GAD C;  1CKN A;  2ZM6 L;  1S72 A;  4IPD A;  4TQU S;  2NVT H;  4OX9 Q;  1VQB A;  3K81 C;  2KEN A;  4GKK Q;  3J81 i;  3M7N A;  2JJQ A;  1UE7 A;  5C0X I;  5IYD H;  4LF7 Q;  1FGU A;  2VS1 A;  3TS0 A;  5IYC H;  4A3I G;  5C3E H;  2ES2 A;  4X65 Q;  1VQ4 A;  1O7I A;  4GLA C;  1KRS A;  4DR1 Q;  5IYB H;  3E9H A;  3UE0 A;  1VQH A;  2VUM H;  3CXC A;  4DV3 L;  2UUC Q;  2ID0 A;  1EUJ A;  1VQ7 A;  4K0K Q;  4MZ9 A;  4R4I A;  3J81 c;  1YJ9 A;  4OON A;  4A3C H;  1N32 Q;  4L5T A;  2PQA A;  4LF4 L;  3TS2 A;  1CSP A;  2VZA A;  4PZ7 A;  5GQO A;  4GN4 B;  4DR6 Q;  4DAY B;  3HKZ E;  2Y0S E;  3PV0 A;  4DV6 L;  2VNU D;  4A3M H;  1X65 A;  3HFZ B;  1WCM H;  1K8A C;  2YU9 H;  4JYA L;  2R93 H;  3PCO B;  2VY3 A;  1IBK Q;  4A76 A;  1XJV A;  2WP8 J;  2MFI A;  1E22 A;  4IFD G;  1Q8K A;  4JI8 L;  1J6Q A;  1IBM Q;  1G6P A;  1B8A A;  3HOU H;  2K50 A;  5H1S E;  1HR0 L;  3PO2 H;  4JCV E;  3NEL A;  4BA2 I;  1HR0 W;  1PVO A;  1K3R A;  1GVP A;  2YTY A;  3H0G G;  4YCW A;  4PG3 A;  3GTG H;  1BKB A;  1WYD A;  4QJF A;  3L2P A;  5BR8 Q;  2JK8 A;  1QUQ B;  4JI5 L;  4LF9 L;  1I5F A;  4DK3 C;  3Q8D A;  4YCV A;  3GO5 A;  5IYC G;  4LFC Q;  2CWA A;  2K14 A;  1KAW A;  5GRO A;  1M1K C;  2MO1 A;  1Q1B A;  4X64 Q;  2K5H A;  5AJ3 L;  2VUM G;  4A4I A;  5C0X J;  4DR5 Q;  4DR3 Q;  1JT8 A;  1P16 A;  4L5S A;  3A74 A;  4HJ9 A;  1L1O A;  4UP9 A;  2MO0 A;  3I7F A;  1BVS A;  2JA6 H;  2AWN A;  4LWC A;  3CCQ A;  4AIM A;  4Y7N H;  4DV5 L;  1NJI C;  3K7U C;  4A3C G;  4TVA B;  5IP7 G;  3RN5 A;  4JI6 L;  1SRO A;  2BA0 A;  3CCU A;  3S17 H;  4A93 H;  4GKJ L;  3CCV A;  1PFS A;  2UU9 L;  1VS0 A;  2QGQ A;  2Q2I A;  4EX5 A;  4R4Q A;  1E1T A;  2HHH Q;  1I94 L;  1MIU A;  1YHB A;  4DKA C;  2F3I A;  4YY3 Q;  1PH4 A;  3I4N G;  1YHA A;  4PMW A;  1BBU A;  4DPG A;  4DR7 L;  5IP9 G;  1VQD A;  4YCU A;  5M5W H;  3CCS A;  3RLN A;  4LFA L;  3GTQ H;  2NN6 G;  4LF8 Q;  3PO2 G;  2PI2 E;  4JI1 Q;  3I56 A;  4DR2 Q;  1Q1E A;  4NXN Q;  2D0P A;  1Q81 C;  1E24 A;  3PUY A;  1B7Y B;  1E3P A;  2Y0S G;  3HKZ G;  4H02 A;  4ME3 A;  4AYB E;  4DUZ Q;  4DV0 L;  3PO3 G;  3UDX A;  2N78 A;  1NBW A;  4DAM A;  2NVX H;  4NB3 A;  2VL6 A;  2MNA A;  1IL2 A;  1YJN A;  2F4V L;  4UP8 A;  4NXM L;  2AKW B;  3RZD H;  4UY8 C;  3PUX A;  1VQL A;  2KHJ A;  1OXS C;  3HOY H;  4C3H H;  1IBL L;  1OXU A;  1L2F A;  4YHH Q;  4BBS H;  1EQR A;  1W2B A;  4P75 A;  3T1H L;  1WI5 A;  1QUQ A;  2N49 A;  3J7Z C;  4A3D H;  4HJ7 A;  2C35 B;  3ULL A;  2HT1 A;  1B70 B;  4QGU A;  2QEX A;  3A0J A;  2ZJR A;  4OWX B;  3AFP A;  3K80 C;  1LTL A;  1MKH A;  2UUA L;  1S3O A;  2UXC Q;  1SE8 A;  2ALY B;  1H95 A;  3BJU A;  4R4O A;  3T1Y Q;  4GLX A;  2A1A A;  5C0X G;  3ICE A;  2UUB Q;  3TRE A;  3G71 A;  4DR2 L;  2K4K A;  2CWP A;  1TWF H;  4QQB X;  3KF8 B;  4IOA A;  4O2D A;  3STB C;  4L5Q A;  1SMX A;  1KC8 C;  2JA9 A;  3FHW A;  2ZM6 Q;  1VQF A;  4JI7 Q;  2AMC B;  2GVB A;  3HOZ G;  1P8L A;  4IPC A;  3U50 C;  1Z47 A;  4BA1 I;  2Z6K A;  3DM3 A;  1XNR L;  5HY6 A;  2K5V A;  3GDE A;  3RNU A;  4LF6 Q;  1J5E L;  1ASZ A;  1I6H H;  4FDB A;  1C0A A;  1JJC B;  1NMG A;  3HOY G;  1TWA H;  1D7Q A;  2UXB L;  1FL0 A;  2KBN A;  1XMO Q;  3CCR A;  4HJ8 A;  1N36 L;  1W3S A;  3TEH B;  1Y1W G;  1PH6 A;  1HNZ Q;  5JJI A;  1K83 H;  1PH9 A;  4A3D G;  5LMN L;  3UE1 A;  3S14 H;  1V1Q A;  4LW1 A;  3RR5 A;  5M3F G;  1LYL A;  3H0G H;  2PNH A;  3MXN B;  1HNX Q;  3GTK H;  1CKO A;  2YTV A;  4AYB G;  2VQF L;  5LMN W;  4IPG A;  4JBM A;  4KHP L;  2Q2T A;  1VQP A;  2AHO B;  3GTP H;  1UE6 A;  3CW2 C;  4X62 L;  1YEZ A;  4L5R C;  1A8V A;  2IHE A;  4KLK A;  3KDF B;  2OWO A;  4JI8 Q;  4A3B G;  3M4P A;  1E7Z A;  1M90 C;  1X54 A;  1XPO A;  1PYB A;  4QY7 A;  3S24 A;  3BZK A;  1HZB A;  2B29 A;  5IP7 H;  1T9H A;  2EQS A;  4AQY L;  4KI0 A;  3D31 A;  3GTJ H;  1YBY A;  1HJP A;  2BH8 A;  2E5L L;  3KF6 B;  3CCJ A;  4B3T L;  1OXT A;  5LMU L;  3RN2 A;  4LF9 Q;  3KFU A;  3BZC A;  3RLO A;  5C4X H;  3CC7 A;  1C9O A;  3FKI G;  4LF5 L;  3I4N H;  4B3M Q;  1X3F A;  2EIF A;  3F8T A;  1FJG L;  3NEN A;  1YIT A;  4DR4 L;  5IP9 H;  1EIY B;  3W5O A;  3S2D H;  2XTI A;  4B3R Q;  2IT1 A;  5JEA J;  5IY0 A;  1S40 A;  3TQY A;  1XNQ L;  2RHS B;  3S1Q H;  1RL2 A;  4A3J G;  1UWV A;  2LXJ A;  2VQE Q;  4JI6 Q;  3PO3 H;  4GKJ Q;  1YNX A;  1HZ9 A;  4JBW A;  4OX9 L;  1N33 L;  4BXX G;  4POG A;  4B3S L;  5M5X H;  4LF7 L;  1QZH A;  3PF4 A;  3H3V I;  4JI3 L;  1I94 Q;  4Y52 H;  4JV5 Q;  4X65 L;  4DR1 L;  2ZTC A;  4JI0 Q;  4DR7 Q;  3M4Q A;  2LSS A;  3BU2 A;  1VCI A;  4RMF A;  4LFA Q;  5IWA Q;  1PHJ A;  1JJG A;  4JI4 L;  3I4O A;  4K0K L;  2YTX A;  1KRT A;  1EOV A;  2ATW A;  4DV1 Q;  3PF5 A;  3AEV A;  3E0E A;  2LXK A;  2KCT A;  3KDF A;  3EBE A;  1PH2 A;  1YVC A;  1YIJ A;  3IRB A;  4NPS A;  3M4O H;  2IY5 B;  4JI2 Q;  5C4X G;  2CCZ A;  3K0X A;  3KOJ A;  4A3K G;  1IBK L;  2F4V Q;  1KHI A;  2JE6 I;  2VW9 A;  2I0Q A;  4NXM Q;  2ASB A;  1TWH H;  1U0L A;  3G48 A;  1IBM L;  1JB7 A;  1TXY A;  2ZJP A;  3KF6 A;  4JC0 A;  4YWM A;  3CF5 A;  3B6Y A;  5J3B A;  1VQN A;  3I4M H;  3AYH B;  2WAQ G;  5ELN A;  1OXV A;  4A75 A;  1ASY A;  3I55 A;  2A8V A;  3PIO A;  1JMC A;  1L1O C;  1VQG A;  1OTC A;  3HOZ H;  2WB1 G;  2OQ0 A;  1NY4 A;  4DK6 C;  5BR8 L;  1VQ6 A;  3S2H H;  2UUA Q;  2R7F A;  2HIV A;  1C7Y A;  2NVQ H;  3CP0 A;  3GD7 A;  4APV A;  1VQE A;  3ULJ A;  1NMF A;  4X64 L;  2Q2H A;  1K73 C;  4MTN A;  5FLX c;  2E2J H;  4UP7 A;  2BA1 A;  3KYH C;  5JEA G;  1N34 L;  4AH6 A;  3S15 H;  3ULP A;  3F2C A;  1Y1W H;  2D62 A;  2L15 A;  3U58 A;  4DUY Q;  2NZO A;  5M3F H;  1TWG H;  3HOW G;  3HKS A;  1K0R A;  4X66 Q;  3KJO A;  1YJW A;  1PH7 A;  3CCE A;  2F52 A;  2I5H A;  4C3J H;  4DV4 L;  1EFW A;  3M85 A;  4YWL A;  1QVC A;  3CME A;  3S1M H;  3S1R H;  4DV2 Q;  5EAY A;  4YY3 L;  1J5E Q;  1FVI A;  2K52 A;  4LFB Q;  4MNO A;  1CSQ A;  1NTG A;  1VQM A;  4A3B H;  3HOX G;  2XGT A;  1A63 A;  3PUW A;  1AE3 A;  5JJK A;  1KXL A;  3UDI A;  1X56 A;  3D0F A;  3K7A H;  4HJ5 A;  1JE5 A;  2Z0S A;  1SFO H;  1Y14 B;  2NVY H;  2OTL A;  4LF8 L;  4NXN L;  3I4M G;  2I5L X;  3JC6 6;  4JG2 A;  5LMN Q;  4ALP A;  1OXX K;  1GKH A;  1PV4 A;  5C44 G;  1VQO A;  4JOI A;  1LUZ A;  2IX0 A;  1XPU A;  3A5Z B;  4WJ3 M;  3M9B A;  2E8G A;  4BBR H;  3FKI H;  1A62 A;  4OXP A;  2WFW A;  5DLQ E;  4X62 Q;  3CQZ H;  2JA8 G;  3U4V A;  1VQ9 A;  1DGS A;  4DV3 Q;  2ZTE A;  4QIW E;  1YHQ A;  4YHH L;  3GTO H;  2R7Z G;  2K5N A;  1HZC A;  4HIM A;  1N8R C;  1PA6 A;  4POF A;  2JEB I;  2JA7 H;  4LF4 Q;  4A3J H;  2K75 A;  4AQY Q;  3CD6 A;  3DLL A;  4EQ5 A;  3G6E A;  3W1B A;  4DV6 Q;  5ELO A;  1Q86 C;  2B63 G;  1V43 A;  2E5L Q;  4BXX H;  4JYA Q;  1PH3 A;  4IPH A;  3OTO L;  2N3S A;  3PIP A;  2UXC L;  4LF5 Q;  3T1Y L;  2IHF A;  1FJG Q;  4P71 A;  2PMZ E;  3CPF A;  1Q46 A;  3K8A A;  2R7D A;  1K9M C;  4R4C A;  3A5U A;  4JOI C;  2UXD L;  1YZ6 A;  3PUV A;  1HR0 Q;  2I5M X;  1A0I A;  2Z6K C;  1BBW A;  4DV7 L;  3CC2 A;  4JBJ A;  5M5Y H;  1UE5 A;  3VDY A;  1XNQ Q;  4BY1 G;  4A3G G;  1VQC A;  2WAQ E;  3CAM A;  1Q82 C;  1R9T H;  1KL9 A;  4JI7 L;  2WB1 E;  1X9N A;  1Q7Y C;  2R92 G;  4A3F G;  1N33 Q;  4JI5 Q;  4HJA A;  1X6O A;  4BBR G;  4B3S Q;  5JJL A;  4A3K H;  2H5X A;  1SRU A;  5K36 G;  4JI3 Q;  4LF6 L;  3ER0 A;  5AJ3 Q;  3F2D A;  1HNW L;  2MQH A;  1XPR A;  4LUO A;  4GN5 A;  3OYY A;  3F1Z A;  1MJE A;  1G51 A;  1XMQ L;  1NE3 A;  1Y1V G;  3JAM i;  1XMO L;  4DV5 Q;  3CC4 A;  3KLW A;  1HNZ L;  4JI4 Q;  2JA7 G;  1N9W A;  5GAH C;  4C3I H;  2GVA A;  4A3L H;  4BY7 G;  1HNX L;  4X6A H;  5FLM G;  2UU9 Q;  1U5K A;  4GKK L;  1VQA A;  4P72 A;  1LM0 A;  4LUZ A;  1PH5 A;  4IJL A;  1AE2 A;  2JQO A;  2D0O A;  4YWK A;  5FJ8 H;  4A3E H;  1KQS A;  3JAM c;  4R1J A;  1QVG A;  1V9P A;  1SLJ A;  2UUC L;  1KIX A;  2NZH A;  2YYZ A;  4HIK A;  2FXQ A;  3CCM A;  2ZTD A;  1G29 1;  1VQK A;  1XTD A;  1IZ6 A;  5IE8 A;  3ZJY C;  5IT9 c;  1E1O A;  1Q12 A;  1N32 L;  3S1N H;  3HOW H;  1GM5 A;  5HGQ A;  4DR6 L;  4DV0 Q;  3AFQ A;  2GN5 A;  2JA5 H;  1VQI A;  4GOP B;  2Q2U A;  4IOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...