2R93G

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
total genus 25
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r93G01
1XMQL 3MEFA 3I4MH 4JI7L 3S14H 1V43A 4TQUS 2ZM6L 3CAMA 3AFPA 2ES2A 1S72A 2XGTA 4GLAC 1Q7YC 1B7YB 1FJGQ 3PGZA 4A3EH 1PH7A 3GTLH 2R92H 3NBHB 3A0JA 2E5LL 1NTGA 5IYCH 3U4ZA 3I4MG 3IRBA 4IFDJ 1VQEA 2N8NA 4OWTB 4BBSH 1Q86C 3VDYA 1YHAA 1SR3A 2Q2IA 4DV7Q 4GKJL 1QZHA 3TRZA 1U5KA 3GDEA 5FJ8H 2JA7G 2R92G 4R1JA 3OTOL 1YJNA 4IPHA 3I4OA 2K50A 3CMAA 4IPCA 1A8VA 2B63H 1XJVA 2UXCQ 3PIOA 1S3OA 1WFQA 2ZJPA 1KAWA 2F4VQ 4NXMQ 4BBSG 2QEXA 2UUBQ 3HOYH 4KHPL 3S2HH 3T1HQ 1LTLA 4O2DA 2B29A 2EIFA 1X3GA 1CSQA 1A0IA 1JJCB 5IP9H 5K36G 5IT9c 2VQFQ 1Q81C 4BY1G 4NXNL 1Q46A 2IHEA 2UXBQ 2HHHQ 4HIDA 1UWVA 1K73C 3HOWH 4POFA 1SN8A 3CCJA 3M7NA 4GKKL 2LSSA 4JI5Q 2NVYH 4QY7A 1TXYA 1X56A 1FL0A 2LXJA 4ALPA 4IOAA 4MTNA 1N34L 3PUXA 3FP9A 4UP7A 3PO3G 1R9TH 1XPOA 1K3RA 4A3KG 5AJ3Q 1YHQA 3CCLA 4DR2L 1W3SA 2HT1A 2K5NA 2AWOA 2AHOB 1G51A 3M9BA 1OXUA 4YY3Q 2VQEL 1JJGA 3AFQA 5BR8Q 2N49A 4XIGS 4DUZQ 1C7YA 4OX9Q 1Y1WG 4A3EG 1O7IA 2Q2TA 4BY7H 5M5YH 4BBRG 2VNUD 1G6PA 2E8GA 4LUOA 1D8LA 4A3KH 4Y7NH 3M4OH 3E9HA 2CWAA 1VQNA 3CMEA 2QA4A 1OXTA 4BXXH 1E24A 1GO3E 4K0KQ 2VUMH 3PUWA 4QIWE 1WYDA 2R6GA 1BBUA 2KHJA 3CPFA 3F2DA 4JI6Q 2E2JH 1JT8A 2VZAA 4JI2L 3UE1A 4DR4L 1I94L 4LF6Q 2F52A 4DV4Q 1HNWQ 3S16H 2Z6KA 2OTLA 1GKHA 3F2BA 1PH5A 4LFAL 5JJIA 4LF5Q 1XNQL 4RG1A 1EUJA 3NELA 4A93H 3PUVA 4AYBE 1QVFA 3UE0A 3BJUA 1NY4A 3ULLA 4DR7L 1AE2A 1OXXK 3KDFA 1RIPA 3S2DH 2KBNA 2IHFA 1UE1A 1K9MC 4J15A 3LGJA 1HNZQ 1HZBA 4BY1H 1VQAA 3PUZA 3T1YQ 1FJGL 3OYYA 1VQFA 1HZAA 2E5LQ 4AQYQ 4A93G 3PSIA 4GNXB 4B3RQ 1E22A 4P73A 3BZKA 4LUZA 5FLMH 3CCEA 4DUYQ 4AIMA 1PH8A 1HNXL 2K4KA 1IBKQ 1YBYA 3J81i 2BA1A 3PO3H 1L1OC 2E2HH 2NN6G 1EYGA 2D62A 3ER0A 2PMZE 1QUQB 4LFCQ 3CCQA 1KC8C 4DR6L 1CKNB 2L15A 2YV5A 5ELOA 4C3JH 1V9PA 2UXCL 4JYAQ 5JEAJ 4NXML 1TWFH 2UU9L 3PF5A 5C4JH 3T1HL 1QVGA 4JBMA 3RN5A 1VQ6A 1VQ9A 1B70B 2A1AA 2H5XA 2ZJQA 1SLJA 3K7AH 4P75A 5IWAQ 4YHHQ 5M3FG 3HOWG 5LMNQ 1QZGA 4NXNQ 4HJ7A 4ME3A 3J80c 1OXSC 1I5FA 1TWHH 2BA0A 3HKZG 3JAMi 3HOZH 2HHHL 4L5TA 4DV3Q 2IT1A 2NVXH 3A5ZB 1VQMA 3STBC 3J7A5 4JV5L 1YZ6A 5IYCG 4A3DH 4H02A 1ASYA 4EX5A 3K81C 4X65L 4LWCA 4KHZA 1N34Q 1XMOL 1PYBA 4B3TL 1MJEA 2IY5B 1Y1WH 4LNQA 2K14A 3UDFA 2CKZB 1K0RA 4GN5A 4IJHA 3ERSX 4YWKA 5FJ8G 4JI3Q 4JG2A 1VQ5A 1IBLQ 3ULPA 1VQBA 2B63G 2CQOA 1XNRQ 4JBWA 3J7ZC 3S1MH 1EIFA 2YTYA 3DM3A 3PV0A 2NZOA 2KCMA 5FLMG 5GQOA 1IL2A 2EXDA 1H95A 1HR0L 3EIVA 4DR5Q 1ASZA 3S15H 1G291 3KLWA 3CCMA 1PYSB 4X66L 5GAHC 1TWAH 4QL5A 1X6OA 2GVBA 3FHWA 4B3ML 1VS0A 1T9HA 2KHIA 2OTJA 4JI2Q 1SRUA 3RN2A 4EQ5A 4JI0L 3H3VH 3JAMc 4IFDG 3J80i 4DR1Q 1VQOA 1MKHA 4JI4L 3ZJYC 1PA6A 1X54A 3GTOH 4A3GG 1EOVA 4L5QA 4LFAQ 1HZCA 1XNQQ 1LUZA 1BBWA 2EQSA 4JOIA 4L5SA 4A3LH 5M3FH 1X9NA 1NE3A 2JA8H 2K5VA 4JC0A 1X3FA 1YEZA 3S24A 4C3HH 1HNZL 3D0FA 2ASBA 2WB1G 3T1YL 1GM5A 1HJPA 4KI0A 2UUAL 4BY7G 1YVCA 3FKIH 4YCUA 3GTMH 1EWIA 1C0AA 3ICEA 3AEVA 2R7ZG 2NN6I 3J81j 1TWCH 4MNOA 4DUYL 4P72A 4JI7Q 1A62A 1HNXQ 2YU9H 4APVA 5DLQE 4A3LG 1JMCA 5GAEC 1IBKL 1UEBA 4KLKA 4YWMA 4C2MH 4OO1I 3NEMA 3H15A 1OTCA 3W5OA 4OWXB 1Z9FA 3CP0A 4A75A 2UUCQ 4A3BH 3FKIG 1QVCA 2AWNA 4DPGA 3KJPA 2VS1A 1SFOH 2RF4A 3L7ZC 4DV2Q 4QQBX 1KRSA 4PG3A 4OO1G 4DV5Q 5IP7G 4A3FH 3STBD 4LF7Q 3CF5A 2YTXA 5IYBG 1EQQA 4WJ4A 1GVPA 4HJAA 2UU9Q 3OW2A 3G4SA 2PQAA 2R93G 3PUYA 4PZ8A 5J3BA 3OTOQ 3KF8B 4X64L 4A3DG 4GLVB 4O0AA 2LXKA 4FDBA 4UY8C 3UDIA 1DGSA 5C3EG 1N8RC 2CFMA 1EFWA 4JV5Q 2XTIA 1Q1EA 2Y0SG 2R93H 3AYHB 2Z6KC 1C9OA 5ELNA 1S40A 2YYZA 3B6YA 4DV1L 2HQLA 4LF9L 5M3MH 4HIMA 4X65Q 4L5RC 4JCVE 1MJCA 1L1OA 4IO9A 1XMOQ 3PO2G 1KQSA 4DV6Q 2JA9A 3TREA 2GVAA 4Y52H 1PFSA 4X62Q 4LFBQ 2JA8G 1X3EA 1BVSA 1I6HH 3KF6A 2JJQA 4OWWB 4NPSA 2D0PA 1VQCA 3L0OA 3CCRA 3K8AA 1AE3A 2V1CC 3F8TA 3KJOA 3PO2H 3WWVA 3TS2A 1VQJA 4DR2Q 3TS0A 1IBML 2HIVA 2R7ZH 1BKBA 1HH2P 4P71A 4HJ9A 1YHBA 3HOUH 3CCVA 4PZ6A 4RMFA 2MFIA 4HJ8A 3I4NG 5LMUL 5BR8L 4A3IH 4JI8L 4XTCS 1PV4A 2KENA 3JC66 1CKMA 1MIUA 3J81c 1VQ7A 3HOZG 5H1SE 3MXNB 4A3GH 4B3MQ 1XMQQ 5C0XI 3G6EA 4R4TA 3DLLA 2UXDL 4JI0Q 4WJ3M 3NENA 1LM0A 3UDXA 4AYBG 2JQOA 4DK6C 2JEBI 3CC7A 1JJ2A 1NMFA 1VQ8A 4GOPB 4BA1I 1L0WA 5IYBH 1Z47A 1PH4A 2FXQA 2JEAI 4GN4B 2I5LX 3L2PA 2ATWA 3W1GA 3I4NH 3HOXH 1HZ9A 1N33L 2PNHA 1K83H 2NZHA 1KHIA 1VQGA 1Y1VG 1RL2A 1V1QA 1XTDA 2R7FA 3KDFB 4HIKA 4P74A 1KIXA 2I0QA 2HIXA 3KFUA 1WCMG 4A3CG 3RR5A 1I94Q 4LF6L 3F2CA 3F1ZA 4IJLA 4A3JH 2JA6G 3E0EA 2OWOA 4YCVA 1YJ9A 4B3SL 3BU2A 2JE6I 2UUAQ 3CXCA 4QJFA 3HOXG 4GN3B 4DV0L 1Y1VH 1NBWA 2I5HA 4A3MH 4GOPC 3S1NH 4DNIA 4DR7Q 1WCMH 4IPDA 5M3MG 1YJWA 4GNXC 2DUDA 3CQZH 2PI2A 1YITA 4KHPQ 3W1BA 1CKNA 2ALYB 3K80C 1FVIA 5IYDH 2UUCL 4R4OA 3Q8DA 1N9WA 2F3IA 4DKAC 5LMNW 4B3RL 1L2FA 1CUKA 2VQFL 2Q2UA 3RZOH 4LF7L 2JA5H 1Y14B 5C0XG 2YTVA 2N3SA 2KCTA 1B8AA 2PI2E 3RNUA 3CW2C 1AH9A 4LUVA 4GLXA 2GN5A 3GO5A 1E1OA 1PVOA 4IPGA 4R4CA 1N36Q 4YCWA 4LFCL 4R4IA 5C3EH 2VW9A 3GTQH 4GKKQ 1SMXA 4JI5L 5M5XH 1E7ZA 4POGA 4JYAL 2MO1A 2A8VA 1OXVA 3H0GH 4DR3L 2MNAA 4GS3A 4TVAB 2WP8J 4UPAA 5EAYA 4JBKA 5HY6A 1N32L 2I5MX 3M4PA 1CSPA 4YHHL 4YY3L 5IWAL 1NMGA 4DUZL 1VQIA 4OX9L 3TQYA 4DV6L 2K75A 1PH2A 4JI1Q 1XPRA 1K8GA 4A3BG 4LFBL 2JA6H 3HOUG 5C4XG 5C44H 1PH3A 4K0KL 3G71A 2C35B 5IP7H 4A3FG 4LF8L 5IY0A 2ZTEA 1YNXA 1J5EL 1Q8KA 1EQRA 4JI3L 4DR4Q 5E7NA 1E3PA 4DV4L 1HNWL 2JK8A 5LMUQ 4UP8A 1HR0W 1IYJB 1I50H 2RHQB 3RLOA 5C44G 2A19A 1X55A 1XNRL 4BA2I 4LF4Q 1P8LA 4NB3A 2UXDQ 4AH6A 2NVTH 2IX1A 1HR0Q 1VCIA 5GAGC 4DR5L 4IOCA 2CCZA 1EIYB 2WAQE 2JA5G 1E1TA 4A3JG 3GTGH 1N33Q 1VQHA 2CWPA 1Q1BA 1PH9A 5JJLA 1YI2A 3K7UC 4A4IA 4AQYL 3CD6A 4LW1A 1J6QA 4A76A 2E2IH 4MZ9A 2VY3A 2ZM6Q 4A3MG 2MQHA 4JI4Q 1VQKA 3S1QH 3GTKH 4B3SQ 1KL9A 3PIPA 1TWGH 3M4QA 4PMWA 4C3IH 4QGUA 4DV0Q 3G48A 2BH2A 4DR6Q 1UE6A 2QGQA 3A5UA 2R7DA 4A3IG 1GD7A 1FGUA 2OQ0A 4R4QA 4GNXA 2IX0A 4DV7L 4GKJQ 2WB1E 3S1RH 5M5WH 1KD1C 3M3YH 1PHJA 3RLFA 4IFDI 4JOIC 1I3QH 3I2ZA 1YIJA 3CCUA 2PQAB 1WJJA 5LMNL 1IZ6A 1JB7A 3H3VI 5C0XJ 2F4VL 1QUQA 3I7FA 2K52A 3ULJA 4BBRH 4DAYB 5HGQA 4DV3L 2UUBL 4DK3C 1N36L 3TEHB 4HIOA 3AQQA 5JEAG 4B3TQ 2Y0SE 4A3CH 1M90C 4DV2L 4BXXG 1U0LA 2VUMG 3HOVG 4DV5L 4HJ5A 4X6AH 1IXRA 5IE8A 4DR3Q 1UE5A 5GADC 1VQ4A 5IP9G 1SROA 2UXBL 2OCEA 1N32Q 1L1OB 2ZTDA 2VL6A 1WOCA 1IBLL 3KYHC 1VQDA 1CKOA 1SE8A 3SGIA 3PCOB 4X64Q 3M85A 3BZCA 2WAQG 3RZDH 3HOVH 4UP9A 2DGYA 5C4XH 1JE5A 5GROA 3KF6B 3HFZB 4JI1L 5AJ3L 3K0XA 3GTJH 3U4VA 5IYDG 1K8AC 3GD7A 1NJIC 2JA7H 1KXLA 3CPWA 1PH6A 1VQPA 2AKWB 2VQEQ 2D0OA 4DV1Q 4JBJA 4LF9Q 4LF8Q 3HKSA 4X66Q 5FLXc 3GTPH 1UE7A 1J5EQ 3I56A 3HOYG 2BH8A 2ZTCA 1KRTA 2RCNA 2B3GA 2ID0A 1Q82C 4X62L 2OQKA 3UDGA 2Z0SA 3U50C 3RLNA 1A63A 4DR1L 1Q12A 1XPUA 5JJKA 2WFWA 3A74A 4DAMA 3I55A 2AMCB 2Q2HA 3H0GG 4OXPA 2N78A 4GOPA 4JI6L 4LF4L 3EBEA 2NVQH 3S17H 4YWLA 3HKZE 1W2BA 1IBMQ 4OONA 3PF4A 3KOJA 4PZ7A 1P16A 1VQLA 2ZJRA 1LYLA 1X65A 3D31A 3CC2A 3U58A 2K5HA 2RHSB 2MO0A 3E9IA 4JI8Q 3CCSA 1PH1A 1D7QA 1M1KC 3CC4A 1WI5A 3EN2A 4LF5L
chains in the Genus database with same CATH superfamily
2FMMA 2JYOA 1DOKA 1STEA 2XSCA 3MEFA 1KNAA 3A8KE 1S72A 4FM9A 1JX4A 2JA6A 1B7YB 3PGZA 2R92H 3EA6A 4KY6A 1G2TA 1BF4A 2E76C 1G8ZD 3BYTB 1BJTA 3Q1KA 4AQYH 3GV8B 2YZNA 1SNMA 2N8NA 4YP3A 1YHAA 1GXDC 3V6KA 2Q2IA 2NYZD 4DV6H 1WTXA 2JA7G 3N8DA 2R92G 3OTOL 1R4QB 4O3OA 2VA2A 4X3UA 2R7ZB 1XJVA 1RYSA 1WFQA 2F4VQ 4O2DA 1GHKA 2DZDA 1X3GA 4GKKH 3MWEA 4JI8H 3H6MA 4I7AA 1LTBD 4H7BA 4V190 3S16B 3Q8QB 4I7ZC 5LL6b 3JAME 4BY1G 4NXNL 4C1NI 2V4QA 3Q24A 1B3AA 5KT3A 4AYBB 4HIDA 1HQMC 1HFNA 3BABA 1TT2A 4NKLA 2BR0A 1Q90A 1SN8A 2W71A 4BY1B 1RJPA 1BNCA 4RAZA 3V6JA 1X56A 4ALPA 4IOAA 4YBZB 1JOQA 1N34L 4UP7A 2NVYB 3PO3G 5K5PA 1XPOA 4A3KG 1R9TH 5AJ3Q 3CCLA 1VKZA 1SYFA 3I70A 1EL0A 3JSNA 4DR7H 3QOLA 3NUCA 3AFQA 2M9VA 3C1EA 4DUZQ 5EPJA 3T56B 4A3EG 1BDOA 2Q2TA 1W96A 5M5YH 1RJTA 1SMYC 3M7GA 3IN5A 1E2VA 3M4OH 3H4DA 5KNBA 3CMEA 1JQYD 2K04A 1GO3E 1EY7A 4K0KQ 4QIWE 1BBUA 3CPFA 5EGTA 4O3RA 4FF4A 2FB9A 3WOFA 3UE1A 2Q8TA 1U4MA 4DV4Q 1SNOA 1PTOB 3S16H 4G3IA 1TWHA 3GV3A 1H9RA 4DAPA 5IGBA 4DGZA 4LFAL 3V4SA 5JJIA 1M0TA 1S68A 2LY7A 4RG1A 3NELA 5COYA 4A93H 5KFAA 1GOZA 3UE0A 1NY4A 1SDFA 1AE2A 3A8IE 1UE1A 4CJ1B 2I07B 4N9PA 2C00A 1B1ZA 3T1YQ 1BBXC 1H9SA 2NN6H 4QUFA 2V5AA 2F0MA 2E5LQ 4A93G 3PSIA 4DUYQ 1PH8A 2V58A 1BCPF 5I47A 2IL8A 1K1SA 5BMVF 4FP5D 2AQ1B 3CRLC 5EKLA 1SJED 2O5JC 1KC8C 4JI4H 3C1FA 3R93A 2Z4HA 1LT3D 2F0LA 3J7AF 4JYAQ 3IG0A 3IL8A 3MXUA 1F9RA 2UU9L 3PVXA 2XWJB 4FXGC 1GHJA 2H1EA 4KK7A 1VQ9A 1B70B 2A1AA 5EOYA 3KHRA 5LMNH 3TQTA 4HNUA 3V96A 3HOWG 1C8CA 4NXNQ 3J80c 3HKZG 1SSOA 3JAMi 4LJZC 1HFGA 4DV3Q 1S03G 1ENFA 4JV5L 2WINB 3STBC 4F4YA 2NVXB 4DL2A 4A3DH 2HCIA 2A73B 1ASYA 4EX5A 1Y1WA 4ME6A 4G57A 1N34Q 1BCPB 3S1QB 1MJEA 1Y1WH 1CI3M 2K14A 5FLXE 3OHBA 4UAIA 2W7OA 2F4IA 3TMEA 4DUYH 2RGRA 5IOCA 2WYOA 5KFUA 3PR4A 3J7ZC 4XYOA 2OXPA 4MV7A 4HTHA 2EYLA 4K14A 1BO0A 5D3IB 1H95A 4R8UB 1TWAB 4ILWA 1HR0L 4DR5Q 2LMCB 1PRTB 2MCTA 4YJ3F 4RB1A 1BNZA 1MI2A 4QL5A 2KHIA 1T9HA 2OTJA 3RN2A 2FKLA 4QW8A 1HUMA 1PK8A 5JVDF 1MKHA 2YRWA 1DV1A 1PA6A 1X54A 2XC9A 3FPUB 2W6ZA 1S5DD 3DWPA 1STYA 5KG3A 4HAEA 3GTGA 4JI6H 4RCNA 3D8GA 4U6PA 1DCZA 2EQSA 4ECWA 4L5SA 1R9TA 4K0KH 5M3FH 1X9NA 1NE3A 2K5VA 3D4RA 4C3HH 3D0FA 4ECRA 2DWCA 4KI0A 4YIJA 4YCUA 4ECUA 5KFEA 2R7ZG 2NN6I 1EIHA 4FF3A 3PW0A 4JI7Q 2ENBA 3GTJB 3Q22A 4APVA 5DGBA 1UEBA 5KT7A 4KLKA 4YWMA 5KKNB 3NEMA 3TP5A 2VPSA 3K5HA 2C2EA 4XQQA 1SNPA 5I6YA 5ELBA 4OWXB 2R8JA 1KDCA 3FKIG 3KJPA 1SFOH 4HNVA 3L7ZC 2F03A 2IJ0A 2NVQB 1T94A 4ZK9B 1EQQA 3HOYB 2W9CB 1GVPA 2UU9Q 2O5IC 1LTGD 5C1OA 2PQEA 2V4RA 2PQAA 3PUYA 4PZ8A 4J0MA 5IT9W 1J9OA 5AFWA 2FMCA 1O7LA 2FJ2A 3VR2A 4XZ3B 3KF8B 4GLVB 4FDBA 1JOKA 2HDMA 4UCSA 5KFMA 1DGSA 5LMUH 2HGSA 4P2CB 4JV5Q 2PCFB 2R93H 2EYFA 4FBTA 1S40A 2WV6D 3OMCA 1SNDA 2YYZA 4A3EB 2HQLA 1ET9A 4LF9L 1BQQT 3DWQA 4HIMA 3RB3A 1MJCA 4IURA 3PZPA 3TREA 4DXFA 3NGDA 3T53B 3I90A 3T5KA 2K5DA 3GTMB 3BG3A 2X0SA 2L1BA 1X3EA 2B2UA 1TR5A 3KF6A 2V1CC 3FKIA 3FVQA 3KJOA 3PO2H 3WWVA 2Z4IA 3HOUH 4X65H 2MUYA 2CW8A 1YHBA 5FPRA 4M8AA 4LFAH 2MFIA 4F4WA 3E5SA 1PMRA 2NTSA 5LMUL 4XTCS 1CKMA 3EVQA 3F2UA 5H1SE 4B3MQ 1EZ6A 1Z2PX 1I4HA 2JEBI 1S5ED 3GIQA 1AFPA 4TRDA 1L0WA 2XCLA 3BJYA 5DG9A 1SYEA 1C4QA 2FXQA 2R85A 3HOXH 1HZ9A 3OPOA 2NZHA 4ZKCB 5JPMC 1KHIA 4UCTA 1Y1VG 1RL2A 1V1QA 1XTDA 1T5XD 2R7FA 1KIXA 5DM73 2CW7A 2UU9H 2HIXA 5JJZA 4LF7H 1I94Q 4DV5H 1S0NA 5IODA 4A3JH 2JA6G 1QILA 3N40P 2OWOA 4F50A 4YCVA 3BU2A 1L0XB 2JE6I 2W8LA 1L2ZA 1Y1VH 1NBWA 4HCSA 2JA6B 4WJWA 4DNIA 4J6HA 1Q3LA 5G3LF 1WCMH 2J0TD 1IOVA 4KN4C 4IPDA 3MAQA 4IR1A 2PI2A 1YITA 3W3AA 1F9QA 4KY5A 1FVIA 3RZOB 4O2BF 4DKAC 4FU0A 2VQFL 5IGEA 1XWEA 2VB2X 1M4VA 2ZT9C 2ZXPA 4XYQA 2KCTA 5C3EB 4APMA 2VUMB 2R8GA 4R4CA 2R8KA 3J80E 3M4IA 1CA6A 5C3EH 2A69C 3GTQH 4UCRA 1SYXB 2FFKB 5F2DA 2E75C 2VR1A 1NUCA 3GIDA 3I4NB 1STBA 1WTPA 5L1JA 1B9MA 4GS3A 3N41B 2A74C 3R5XA 3SXHA 3M4PA 3A7AB 3RAQA 4YY3L 5IWAL 4Z9CB 3M4YA 5IGGA 4DUZL 4C5BA 3GTKB 1TWCA 4DAVA 2K75A 1B3QA 1Z7TA 1Y8NB 1SYGA 4FS1A 1K8GA 1SNQA 3RB4A 3HZXA 4ZRZA 3TN2A 4PMBA 4F4ZA 2NVYA 3LP8A 1EFID 4A3FG 2ZTEA 3J81E 1J5EL 4DV0H 1Q8KA 1BR9A 1Y8OB 4BY7B 1VF5C 1CTMA 5EKKA 3BYYB 4YAJB 1E3PA 3S15B 1F2YA 5KFJA 5LMUQ 5LL6S 3FMAA 4CGYB 3I8ZA 5C44G 1HR0W 1XNRL 4DL3A 2A19A 1AN8A 2P5ZX 5KFGA 1G2SA 1TWFB 4AH6A 1VCIA 2CCZA 1Z2NX 1U4PA 4YHHH 2WAQE 2EY2A 1PZID 3GTGH 2B8FA 2MHVA 3K7UC 4A4IA 1TWHB 3KHLA 1PDQA 2CW0C 2ZM6Q 4JI4Q 3S1QH 1MD2D 4J9QA 3HKZB 1C30A 3N6XA 1RCVD 2YW2A 4B3SQ 2NU9B 4IWYA 3PIPA 4LF9H 4QGUA 4DV0Q 2R8HA 3KALA 2VQEH 5KRUA 3G48A 3MHBA 1EY9A 5ELEA 4DK0A 2PNRC 1JKJB 3TP7A 1FGUA 2B2TC 1TVXA 4R4QA 1OWTA 3V6HA 4DV7L 1EY5A 3RJ0A 2O2LD 2J7ZA 3SK4A 3E6ZX 2PN1A 1PFNA 3M3YH 2B2VC 4WRDA 1PHJA 4QIWA 5BPHA 1GSOA 2AGQA 4JOIC 1D2BA 2VOBA 2K28A 3CCUA 4RB3C 2AQ2B 3H3VI 1XNQH 2L11A 3KHHA 4DV3L 3E5NA 3TEHB 4HIOA 3K5IA 5I2YA 1QE6A 4DV2L 1M90C 3MWDA 1QWYA 1D5ZC 1TS3A 4DV4H 4JV2A 1TY2A 3HOVG 4DV5L 4MTKA 1WTOA 3QWNA 3R2TA 4X6AH 1EIGA 2GA4B 5IE8A 4EEQA 1XDNA 4M9UA 1SROA 2UXBL 3HS0C 1BUVT 3MR3A 4XYLB 3SHLA 1DD2A 1SE8A 5NUCA 3SGIA 3PCOB 1PFBA 4X64Q 3OHXC 2WAQG 4BWGB 3M85A 5M3FB 1JWUD 4UP9A 5C4XH 2Z9HA 5KX5F 3HFZB 4JI1L 2YU9B 1KXLA 5IYDG 1Y1WB 4N9TA 1AZPA 3DUZA 1PXUA 2XRSD 4KD4A 5KFHA 2AQ3B 2D0OA 4DV1Q 1KDAA 4QWAA 5J39A 4RFBA 4MV8A 1J5EQ 3QFFA 3I56A 3BDLA 5L1IA 1U9RA 2CHBD 2RDIA 1TQOA 4N8FA 1Q82C 2AGPA 3UDGA 2UVRA 1FGBD 5EKIA 2DPJA 5JJKA 1ZHSA 2I80A 2WFWA 4CDFC 4LF4L 2N78A 1TWAA 3MR6A 3BS1A 1DXMA 3QOJA 3PQIA 4L63B 1QNUA 1X65A 3U58A 1D7QA 4JI8Q 4Q0FA 3CCSA 1EQVA 5KFVA 1GLVA 4B3MH 3WDNA 5CBAE 2KUMA 1LT6D 4X3KA 3I4MH 1GSAA 5KFFA 3S14H 4QWBA 4DR4H 1FD7D 4EQPA 3AFPA 4IUVA 4ULLA 5T1GA 1R9TB 2L0CA 3GTLH 5JVG3 1PH7A 3NBHB 2R7KA 2V59A 3A0JA 4HMIA 4F88A 5CGKA 1NTGA 3V4ZA 3U4ZA 4FNFA 2F0VA 3I4MG 1H9MA 4LMYA 1T5EA 1SR3A 2LFNA 4DV7Q 4MV1A 1IL8A 3GTJA 1SJHD 3GDEA 5FJ8H 1F9SA 3L3OC 2W6OA 4IPHA 2LS01 2RVLA 3CMAA 4KMUC 1LTTD 1E4GT 2B63H 3M9OB 1MSHA 2XCAA 5HGTA 2K32A 1KJJA 3HOYH 4MHEA 2YCHA 2YZGA 1AN7A 1CSQA 1A0IA 1JJCB 2BDNA 5K36G 2W9CA 1S5BD 4NP5A 1Q81C 4Q0YA 1STAA 4ED0A 3TBIB 3GIIA 4FBUA 2QDBA 2NB0A 1PTOC 2UXBQ 2HHHQ 1KLUD 2CQYA 3J80W 5FKAC 3KF8A 2M00A 5JOBA 3HOWH 3CCJA 2NVYH 1FL0A 2LXJA 1IOWA 3G6XA 1Y1VB 2KECA 4MTNA 4IUTA 3TZDA 1XTCD 4DR2L 1W3SA 3QO2A 2K5NA 3TQ1A 1VAJA 1BGWA 1V51A 3K5NA 2DJGC 3AB9A 2VQEL 2W9BB 2EYMA 2OT2A 1LTSD 3HBLA 4BY7H 4J9PA 2E2HA 1G6PA 4LUOA 4ZHQF 2DY7A 3N43B 4HN7A 1OXTA 2QA4A 4BXXH 4XYMB 2W6NA 2VUMH 3PUWA 1D1IA 2EOTA 4K6DA 4JI6Q 2E2JH 1V8QA 5HURA 2JEIA 4J1MA 4DN4M 4JI2L 4DR4L 3G7LA 1ICWA 1ZYRC 1K28A 5CBEE 4XXEA 2FLPA 3X3MA 4RNNA 5E1FA 2JSOA 1XNQL 4RAYA 1G6ZA 2UXCH 5LP6F 3PUVA 3L9AX 3ULLA 4DR7L 2F0NA 1K9MC 3OWFA 1ZXTA 4BY1H 1HNZQ 5KG5A 4HQ6A 2UVVA 3I91A 1FJGL 3HB9A 5EWFA 1HZAA 1S5FD 4AQYQ 5DQIA 4B3RQ 1Z6HA 2PZTA 4LUZA 1U4RA 1HNXL 5BN3A 3J81i 3OMGA 1TAEA 5KFNA 4IRDA 1L1OC 1NSNS 3M3YB 1EYGA 1IW7D 1QUQB 2ICIA 3CCQA 4LFCQ 4YR3A 5ELOA 2N55A 5DAUA 2HD3A 3CVZA 2EDGA 4NXML 1KNEA 4RGOS 5C4JH 1QVGA 4JBMA 5JQWA 1LLRD 5KT5A 1SEIA 2QDLA 4I65A 5KFQA 4IRCA 5M3FG 5IWAQ 2VUMA 1DONA 4HJ7A 4ME3A 1OXSC 3HOZH 2BA0A 4EQNA 2C2DA 2HHHL 3BQ1A 4IZOA 4J9KA 1VQMA 3PW5A 2W70A 2R6FA 1I6VC 4H02A 5E4XA 5EPKA 3K81C 4X65L 5C5LA 4KHZA 1ZKOA 4A3DB 1XMOL 3GTPA 1PYBA 4MV4A 1KEEA 1SBBB 1TWCB 1K0RA 4OIJA 2CKZB 2Z6BA 4CDCC 5FJ8G 3OIPA 5E3FA 1VQ5A 3GLKA 2ASLA 1HNXH 2A69D 1KAAA 3ULPA 1SE2A 2K01A 1JIHA 1M0WA 3VPBA 4JBWA 1HQRD 2YTYA 3PV0A 2YL2A 4ED3A 1T3NA 3RTXA 4LK1C 1QJOA 1W6JA 5GQOA 4BBRB 3EIVA 2RGVA 2W6PA 1ASZA 3R8BA 3S15H 2NZ1D 5FO8B 1BOSA 5GAHC 4RB0A 1TWAH 4YAKB 1I50B 2F0EA 1IYUA 2C22A 1JDEA 4JI0L 1D1KA 4DR1Q 1H9KA 3ZJYC 4IALA 4K2LA 3K59A 3GTOH 4HYKA 3BZDB 1TWFA 1N36H 3SE0A 2NU6B 2A6ED 3VR5A 1F2ZA 3ND8A 4ZLTF 3LWBA 1BBWA 4ZQ3A 2K05A 4A3LH 2JA8H 2C2RA 1X3FA 2BE5D 1WTQA 4CDEC 2EYHA 3KLSA 1HJPA 2UUAL 4OEMB 1ZHQA 5J22A 3FMCA 1C0AA 3HKZA 3AEVA 4OIKA 4DNTB 5BN5A 4OX9H 1I6HB 1A62A 1HNXQ 2YU9H 4A3LG 1JMCA 1QCBD 4OO1I 4C3JG 3PW7A 1ONLA 1SE3A 2RCFA 3W5OA 3HOUB 3SK8A 2UUCQ 2PO4A 1PRTC 4B3TL 1B4OA 2VS1A 4QQBX 4DV2Q 4B08A 2Z8LA 4PG3A 3NHHA 4H44C 2IWHA 5IP7G 3STBD 4DV5Q 3CF5A 1I94H 4QIWB 3OW2A 2AU0A 3SE7A 4IUQA 2WB1A 4RAUC 1VMPA 4JW0A 3OTOQ 5KG0A 5LHY1 3Q8PB 1O80A 5I4DA 4X64L 1TIID 2IW3A 4A3DG 2LXKA 4UY8C 5D1OA 4JVZA 2KEEA 3UDIA 1N8RC 3GILA 4IUUA 4DL6A 1SNCA 3AYHB 4CC6A 1C9OA 1RK6A 2GPWA 4JCVE 1DOLA 4R9WA 1EQTA 1KQSA 3ERQA 2FLNA 3ETJA 4ECZA 2GVAA 2XNAC 5CV4A 4CBVA 3VR3A 1GUWA 2VXWA 2L12A 4YR2A 2YU9A 2JA5A 1VQCA 4C3IG 3OSPA 2G9DA 4BBSB 2R8IA 2WAQB 1FJGH 4ZUJA 3TS0A 2B63A 3MWYW 2HIVA 1DJRD 4HJ9A 4A3IH 4JV5H 4A3GH 1AUXA 3HOZG 4FF2A 3BAAA 2JP1A 5C0XI 3G6EA 4R4TA 1AZQA 2UXDL 4JI0Q 1ULZA 3BDOA 5C8YF 5E4WC 5DGAA 4K8JA 4E4TA 2CQAA 5IYBH 3T13A 4O4LF 3I4NH 3W1GA 3L4KA 1I7LA 3KYHC 5KGUA 2I0QA 1CT1D 1RTOA 4LF6L 2B2WC 4IR9A 3E0EA 3TINA 3VR6A 3X3NA 1K0SA 1M6VA 4DL4A 2K5QA 3JAML 1S0MA 4GN3B 2I5HA 4RGTA 2F0TA 5C5JA 4O1NA 5C0XH 5M3MG 3NBHA 4G7HC 2DUDA 1B50A 3ETHA 3CQZH 3W1BA 4I55F 1CKNA 1RF2D 3M4OB 3K80C 3OIQA 2XWBB 2ATLA 4JI5H 2B2WA 2QCPX 1KJIA 2NU8B 5M5YB 1N9WA 5LMNW 4RH6A 2DJFC 2Q2UA 3RZOH 3J81L 3OSNA 2O4XA 4A3IB 2RQXA 1N32H 1F2MA 1WSCA 4GLXA 3GTQB 3GO5A 1E1OA 4XT1B 4EVOA 5CC4A 4IPGA 4RGNA 4PQXA 5KNCA 2QF7A 4IAJA 3GTKA 2E2JB 2FK2A 2VW9A 1QG7A 4GKKQ 1SMXA 2NTTA 2Q8RE 2F0HA 2MO1A 4PMCA 2ZXOA 5IGCA 1FNUA 3Q2OA 2MNAA 3VPCA 4TVAB 5EAYA 4O4HF 5HY6A 1N32L 2I5MX 5D8DA 4CKEA 4OX9L 4LH7A 4CKCA 4LSXA 3TQYA 4DV7H 3U9TA 1TWGB 4C3IB 4DV6L 1LTAD 5D65A 1EU3A 1NNXA 3MFYA 5FD6A 4A3BG 3EYYA 5JVH3 1Y1VA 5I9PA 1TKWB 3A8JE 4X62H 1PH3A 1IBLH 2C35B 4KKTA 5IP7H 5IY0A 1KTKA 3KUPA 2K6AA 2W9BA 3CRKC 3MC0B 3NWTA 4JI3L 4DR4Q 2E2HB 3ITPA 2JK8A 1LV9A 2L4NA 1I50H 4O4IF 1X55A 3W2DA 1I4PA 4BA2I 2HUGA 1P8LA 4NB3A 5KFSA 3BA8A 3C0FB 5KFKA 2HQEA 2NVTH 4Q45A 1HR0H 3AU7A 3VMMA 5GAGC 4DR5L 2BOSA 5KFYA 1VQHA 1PH9A 5D1PA 5JVLA 3PIP3 3R5HA 2MQHA 3HRZC 1KJ8A 4YR0A 1KL9A 1X32A 1TWGH 3M4QA 4C3IH 1T36A 4WORA 2BH2A 3RIZA 4DR6Q 2O03A 1UE6A 2QGQA 3PR5B 3A5UA 4A3IG 1GD7A 1CZWA 3R23A 1RJQA 3IFTA 3RUZA 1B6SA 1MZBA 2WB1E 1JB3A 3SI8A 1YIJA 3I2ZA 2CH4W 3R3OA 5LMNL 1IZ6A 3CKIB 3A55A 2P0AA 1QUQA 2IPKD 2K52A 3FDTA 3I7FA 5DNFA 4BBRH 1PLFA 4DAYB 4DXGA 5HGQA 5HV6A 5C3WA 2B2VA 4RCOA 2Y0SE 4A3CH 5KG7A 3M9NB 2JXMB 1YNND 4FF1A 2PYKA 1UE5A 1S97A 1VQ4A 4I4TF 2SOBA 2OCEA 1N32Q 1L1OB 3RZDB 2W7PA 1WOCA 3MVVA 1IBLL 3ORRA 2AQ4A 1VQDA 1M7JA 2R87A 4OGQC 3MXGA 1NAPA 3RBEA 3BZCA 4MA0A 2BCOA 2N88A 3MTSA 1JE5A 5GROA 3VPDA 3CU7A 3GTJH 5AJ3L 3K0XA 1JWMD 1NJIC 2KEDA 1NCVA 3CPWA 1VQPA 3GTPB 4HEDA 2BQ3A 4JBJA 1XYIA 3HKSA 4X66Q 1RD9D 4ECXA 1EZ8A 2KCCA 2C28A 2ID0A 2ZM6H 3U50C 3RLNA 3MXNA 4M1UB 2HVQA 3I55A 3H0GG 2NVQH 2HHHH 3S17H 3T5JA 2IMWP 2L9HA 3HKZE 3PF4A 1CFMA 3KOJA 1I50A 4LH6A 1E2WA 3U9SA 3RB6A 1LYLA 4HSVA 5FK9C 3CC2A 4HNTA 2K5HA 5C5MA 2MO0A 1MGSA 5JAVA 5CB4F 1M1KC 3CC4A 3EN2A 2RKSA 4NXMH 2HDLA 4ZUIA 4CJ2C 4TQUS 2JA8B 2UVUA 1OO9B 1B44D 2XGTA 4C56C 3CQZA 1PZJD 3H91A 2E5LL 4B3RH 5M9OA 4O3NA 4IFDJ 1VQEA 1RKNA 4OL7A 1EUCB 4OWTB 4BBSH 1Q86C 2CH4A 3LX0A 4GKJL 5J1ZA 1QZHA 4RNOA 2OLSA 1C48A 1IYVA 1QOHA 4S3SA 1YJNA 5EWGA 3I4OA 2K50A 1A8VA 3V2TA 4R8NA 3PIOA 1S3OA 1C3OA 1RTNA 3D3RA 4BBSG 4KHPL 3S2HH 1LTLA 4EBEA 5IT9E 2L55A 4U673 4MTEA 3J7AV 4PDBA 5IP9H 2VQFQ 3OTOH 2WB1B 2C9OA 2IHEA 4QWCA 1UWVA 1K73C 2W6MA 4MAMA 2J6SA 4POFA 1N56A 2FPGB 5D1OB 2ALZA 5A2QL 2LSSA 2EY6A 4RNMA 1FNVA 3VA5A 1S10A 2RDFA 3SK5A 1WVLA 5DG7A 4KKSA 1YHQA 1LACA 3Q8SB 1LABA 2AWOA 1UEAB 2AHOB 3A54A 5J2TF 1OXUA 4BWSC 4X66H 4YY3Q 1JJGA 5BR8Q 1C7YA 3S1NB 3P1HA 3RFCA 1GSHA 2I8CA 2X6GA 3TP6A 4BBRG 3RGZA 2E8GA 1CA5A 3EPIA 1D8LA 3FPPA 4A3KH 4Y7NH 2JA5B 3TIIA 2EYJA 3IFDA 4TKOB 1I4RA 1E24A 2WAQA 4IHJF 3NSWA 3MFGA 2F0GA 2B63B 2A6EC 2KHJA 3RUPA 3P7JA 4EG0A 3F2DA 1JT8A 4I50F 3S2HB 1SYDA 3HG9A 3GV5B 4FXDA 4DR3H 2VZAA 5EBDA 3K7AB 2FP4B 4LF6Q 3DF7A 2WTFA 1B04A 2F52A 4WD3A 4MN3A 2Z6KA 2M2LA 4B3TH 2OTLA 4ED2A 1GKHA 1SAPA 2B2UC 1PH5A 2UUBH 4K5WA 2MJ8A 5KFDA 1EUJA 4JK1C 2AUJD 4A2AA 1OXXK 4IZ8A 2KQ3A 5EZYF 1EEID 1RIPA 3S2DH 2KBNA 2IHFA 3J80L 3GP7A 4R7RA 3LGJA 4MV9A 1LTID 4OELB 3PUZA 2YRXA 3OYYA 3OOCA 2HVSA 3HEJA 1VQFA 2W57A 4R8IA 1KDBA 2F0KA 2MP1A 1E22A 4P73A 5FLMH 3CCEA 1CQVA 1D5MC 1W93A 1WCMB 2K4KA 1YBYA 4JI3H 5KFLA 2SEBD 2E2HH 2NN6G 3DMUA 5M5WB 3ER0A 4FS2A 2J9GA 2PMZE 2QILA 2J6TA 3OHAA 1CKNB 2YV5A 4C3JH 5C4JB 3RV3A 5IGDA 3HGBA 1TWFH 2PPBC 4KJOA 1EYDA 3D4WA 4TSSA 5KIXA 2WE6A 3RN5A 1VQ6A 2H5XA 1R4PB 1SLJA 4P75A 4YHHQ 1I4QA 1ML0D 4EQOA 3URYA 3GTQA 2W6QA 2V4DA 3NTKA 4MIUA 1MHWC 1I5FA 1PRTF 3K0YA 4L5TA 5FLXW 2IT1A 4DFAA 5KFPA 3A5ZB 2W9AA 3J7A5 1TS4A 4DV2H 1YZ6A 2R92A 3MEHA 4WFN3 4L6TB 4LWCA 5L37A 1HA5A 1DYQA 4LF8H 5L1LA 4KN7C 4Q8FA 2FK3A 4IJHA 4JI3Q 4ID6A 3ERSX 4YWKA 4WBNF 4JI7H 1TWGA 1A6XA 2XVSA 5KG6A 1VQBA 2FHTA 2CQOA 3RF2A 3S1RB 3CHBD 3I12A 1EHIA 3S1MH 3MWMA 3DM3A 2EXZA 2NZOA 1ZQ7A 4IFDH 1HNZH 2KCMA 1IL2A 2EXDA 3Q0AA 1IHZA 4ZCKA 3GV6A 1PYSB 3O13A 2GVBA 3QIAA 3NXWA 3FHWA 4B3ML 5KT4A 1HUNA 1V4YA 1SRUA 4DR1H 4EQ5A 1HRJA 4EGVA 4JV1A 3JAMc 4IFDG 1EY8A 3J80i 1VQOA 1A15A 4A3GG 2XCPA 1HNWH 1RODA 4L5QA 2FPIB 5KFWA 4LFAQ 4QW9A 2HCCA 4YJ2F 1LUZA 4JOIA 4BS9A 1B33N 3HOVB 1CQIB 5C4XB 1YEZA 4YB8B 2ASBA 3MR2A 1E4FT 3T1YL 1FNWA 1A2TA 4XQNA 2ASDA 3FKIH 3GTMH 4GZYC 1YNNC 4KHPH 3ICEA 2NUAB 2RDJA 3IKJA 1HTLD 4MNOA 5C6AA 3J81j 4P72A 3EROA 4DUYL 4RUAA 3KHGA 4DUZH 4ECSA 5DLQE 5GAEC 4A3BB 3GQCA 2G9HD 5JUMA 2F1MA 3H15A 1SFOB 1UC8A 4L8JA 2KCNA 4C2MB 1Z9FA 3CP0A 4HMJA 2AWNA 2J4XA 4J9OA 1KRSA 3T4AC 1JXLA 4XDXA 4A3FH 2KHSA 4QWDA 2YTXA 5IYBG 4WJ4A 2QK4A 4HJAA 1N33H 4FVMA 1O75A 1K83A 1IKMA 4LAAA 1H9JA 2R93G 2EJFC 1GUSA 5J3BA 5HBRB 2HJWA 4DAYA 3S17B 4G7OC 5L9XA 5FPOA 4O0AA 2XGPA 2R93A 5KFCA 4F7XA 2QKIC 3HOWB 1EFWA 4JYAH 1NR4A 2OEOA 2Y0SG 1TU2B 1I4GA 3MJFA 5ELNA 2CW0D 4DNRB 3GTLB 2R7MA 2ZDGA 1RHPA 1UUPA 5M3MH 4L5RC 4IO9A 1L1OA 3PO2G 4X3TA 2SNMA 4G7ZC 1U4LA 4LFBQ 2JA8G 1BVSA 2PW5A 4NPSA 2D0PA 2Z1CA 4I7HA 4U7CA 3KXYT 4PV1C 3L0OA 2B2TA 4CJ0B 1JC7A 4DR2Q 1IBML 2TMPA 1BKBA 2RA4A 4PZ6A 3HP3A 4A3GB 4RMFA 5CV8A 4HJ8A 1PTOF 3NQIA 2KENA 3JC66 1VQ7A 3MXNB 4RHRA 3EFXD 3DLLA 4PWQA 3NENA 1LM0A 3UDXA 4AYBG 4DK6C 1JJ2A 3CC7A 3FDSA 5M5XB 1NMFA 1G91A 2VB3X 3LMLA 1Z47A 1PH4A 3VYRA 2I5LX 1W6KA 3TS2A 1N33L 4MA5A 1K83H 2PNHA 3KDFB 1V1OA 1VQGA 4HIKA 3KFUA 4O42A 1TY0A 5IGFA 1WCMG 1ENAA 3F2CA 3F1ZA 3PW2A 1CHQD 3RGXA 1S0OA 2KVMA 5M3MB 5EJWA 3K5LA 4A3JB 4B3SL 3CXCA 1E2ZA 4QJFA 3HOXG 4DV0L 1J5EH 3S1NH 4A3MH 3CQZB 4DR7Q 5D3DA 4GNXC 3RB0A 1CK1A 2K1BA 2XN9C 2B2YC 4KHPQ 2GLTA 2VQDA 2XIGA 5IYDH 2J6UA 4J9NA 4RKLA 1JOOA 2F3IA 2X69A 3Q8DA 4B3RL 1L2FA 2F0QA 2PVPA 2MPMA 2FE3A 1Y14B 2UXBH 2N3SA 3I4LA 1B8AA 4Q44A 3CW2C 3G8CA 4LUVA 1VBHA 4RGMA 1N36Q 5C3XA 2D2CC 1GUNA 4YCWA 4LFCL 3BVGA 3H0GB 2CVRA 1E7ZA 2PZWA 3LWUA 4KV6A 1XMQH 3MFIA 2F3VA 3T1HH 2A8VA 4J9MA 1OXVA 4DR3L 2WP8J 4UPAA 4JV0A 4JBKA 1A3TA 2K03A 4QCLA 2KSWA 1B53A 1STGA 2SDFA 3Q8RB 4DR5H 1NMGA 2GPSA 4HR7A 1VQIA 4ZI7F 2ZDQA 5LYJF 3BQ0A 5KFTA 1PH2A 4JI1Q 5J2UF 4LFBL 1KJ9A 1B2TA 4L1KA 4TQSA 1O78A 3VYSA 5C44H 4K0KL 2VA3A 5EWEA 4LF8L 1EUDB 1YNXA 1JCKB 2D9UA 3NPPA 5T14A 5E7NA 3I72A 4DV4L 3WO0A 3WOEA 3H4BA 4UP8A 2RHQB 3RLOA 4ECVA 4LF4Q 3A7LA 1BCPC 4ZKBB 2BQRA 4KTAA 2JEFA 3SDZA 3GTOB 1IBMH 1EYAA 3MA2B 1EIYB 2JA5G 2F3WA 2KA7A 3H94A 1E1TA 5DEHA 1N33Q 4CKBA 2A6HC 2CWPA 1Q1BA 5JJLA 1WTWA 2UVWA 5FO9B 1YI2A 3CD6A 3G6YA 3OSOA 2E2IH 5KFZA 4MZ9A 4YQWA 1VQKA 3GTKH 1VBGA 4ED7A 5KT6A 4PMWA 3RAXA 3V05A 2DIKA 3MR5A 4NW2A 5C1PA 4EFBA 2ASJA 3VYUA 3D6WA 2R7DA 4EYIB 1Q8IA 2AGOA 2E5LH 5KFBA 1EY6A 1ZEQX 4TV8F 1WCMA 4F87A 3QR8A 3RLFA 4IFDI 4MV3A 1PRTD 1WJJA 4RWSC 4DK1A 5C0XJ 1D5XC 3ULJA 2UUBL 3L4JA 2WKDA 4LF5H 4DK3C 2F0OA 1N36L 4B3TQ 3C46A 4EBCA 4BXXG 3WO1A 4XQJA 2VUMG 2DNEA 4DR3Q 5CA0F 2QYZA 5IP9G 3HOZB 4C5AA 4J9RA 3I4MB 2M05A 5FD5A 1GGOA 4A2BA 1A3VA 1ESRA 2AUKA 2E2IB 5JH7F 1CKOA 1HPCA 4GKJH 3HOVH 3VA7A 2ZJTA 4ETSA 4KY7A 2JA7A 2R92B 1E4EA 4JUZA 1TA8A 1K8AC 3U4VA 3LWEA 2JA7H 3SK6A 1AW7A 5CV5A 1KJQA 5KFOA 2AKWB 2VQEQ 4GC6A 4LF8Q 3NTIA 3GTPH 1ZETA 4HCEA 1UE7A 2F0FA 2WIIB 1STHA 3BVZA 2BH8A 1KRTA 2HVRA 2B3GA 4X62L 4A3FB 3TP8A 2Z0SA 4MTDA 1A63A 1Q12A 1HHVA 5CA1F 4LMQD 5BPFA 3A74A 4DV3H 3H20A 2AMCB 4GOPA 4JI6L 5IYZF 5F9LA 3K58A 4YWLA 1A9XA 1EYZA 3GV7B 4CDDC 1P16A 1VQLA 3JRWA 2BDOA 3E9IA 3HOXB 5IT9L 3K3VA 2IY5B 4LF5L 1I7NA 1XMQL 1XXGA 4JI7L 5KFXA 4LFCH 1V43A 3KK7A 2ZM6L 3CAMA 2JEJA 2ES2A 4FYDA 4GLAC 1I4XA 1Q7YC 3S14B 1CHPD 1FJGQ 1F2LA 4A3EH 1SXTA 3MXPA 2SNSA 3UI2A 5EQ0A 1AEXA 5IYCH 2I46A 2E74C 2MGSA 3SR1A 3IRBA 3QG1A 5I2XA 3H40A 1RYRA 4LFBH 3VDYA 1FYCA 3D6CA 4U68A 3TRZA 3T16A 5ELCA 1U5KA 5DQGA 4Y7NB 3EPGA 4R1JA 4FO2A 1PX2A 4LSAA 1SFOA 3QB3A 1IW7C 4IPCA 2UXCQ 1HXYD 4C2MA 4FXKC 2ZJPA 1KAWA 1STNA 4NXMQ 2QEXA 2UUBQ 3T1HQ 3G6VA 2EPBA 2B29A 2EIFA 3I3CA 4ED8A 2EJMA 3RV4A 5IT9c 4QUCA 1K83B 1RK5A 3KAKA 1Q46A 1SYCA 3E0JA 4QWEA 1S5CD 3FEWX 4ECTA 2K7VA 2R93B 3M7NA 4GKKL 5K36H 4JI5Q 3G6JB 5EBCA 3TDQA 1EEFD 1TXYA 4QY7A 2IA6A 3PUXA 3FP9A 4F8MA 3AMUA 2HT1A 3LNNA 1K3RA 4HSPA 5KFRA 4UCVA 2R82A 5CV9A 3GTLA 1GYFA 4YY3H 2RSNA 3SVMA 1G51A 1ZYRD 3M9BA 3T5HA 1V1PA 2NWGA 2N49A 4XIGS 4OX9Q 1DOMA 1Y1WG 3PO3B 1I3QA 3UFXB 1HA6A 1O7IA 2VNUD 4O2AF 3J81W 2PMZA 5CORA 2E2DC 1GUTA 3E9HA 4C3JB 2CWAA 1VQNA 5KT2A 3NE5B 3DM1A 1QB5D 1SMYD 1WYDA 2R6GA 3TZUA 5H80A 4EGJA 1O7ZA 2RBMA 1SYBA 5LXTF 1I94L 5L1KA 1M8AA 4XX0B 1HNWQ 1ILQA 4H0LC 1CS0A 4G4KA 4Q8EA 3JAMW 3F2BA 4DA2A 3P75A 4LF5Q 5CAEB 4AYBE 1QVFA 3BJUA 3KDFA 5FOBB 1KC7A 1KLGD 4ODGA 4J15A 2EZVA 4TV9F 1HZBA 2NUCA 1VQAA 2Y0SA 3ND9A 2QW7A 2ZXRA 2FINB 1WD0A 2EY5A 4B9XA 1PYWD 4GNXB 1BXTA 3BZKA 1RJRA 4AIMA 4ZOLF 4ZAIA 1IBKQ 3JRXA 1UC9A 1L0YB 2BA1A 3PO3H 5KYLA 5C44B 4ED1A 2D62A 3JSLA 2R7LA 4DR6L 2L15A 5BN4A 1V9PA 2UXCL 4EGQA 5JEAJ 4DF7A 3PF5A 3T1HL 4RZQA 1X3PA 4NXNH 2WACA 1RDPD 2D5DA 2ZJQA 3UQ8A 3NK9A 3K7AH 3ZYYX 5IWAH 1F9PA 5LMNQ 5C4ZA 4C3HG 1QZGA 1TWHH 2TSSA 2UXDH 2W8KA 1GUGA 2NVXH 3H0GA 2RSOA 3BDCA 2XIWA 3S9WA 4UCOA 3QJYA 5KG4A 5IYCG 5ISRA 4C3HB 3C3LA 4RU9A 3KBGA 4EBDA 2K33A 3DEPA 5I9OA 1B9NA 4K5XA 2EYOA 1TS5A 4LNQA 2XGQA 4HR7B 3H09A 3UDFA 4GN5A 1NR2A 4JG2A 4KJNA 4DLKA 1IBLQ 2PW7A 1HCZA 1SE4A 1VDZA 3S1MB 2BQUA 2B63G 1XNRQ 3Q6SA 1S9FA 3PW4A 4K6LA 4JI1H 5DLFA 1EIFA 5K2MA 4ED6A 5LL6X 3A56A 4ECYA 4DL5A 5FLMG 2FK1A 1G291 3E3XA 3KLWA 3CCMA 4X66L 2B39A 3WNZA 1X6OA 4QF4A 5JPNC 1ET6A 1AP0A 1VS0A 1EZ1A 4JI2Q 3H3VH 3RMHA 4ECQA 4JI4L 1EOVA 1Z2OX 4EEYA 1HZCA 1XNQQ 3GTOA 1KBLA 1CM9A 2VUGA 1DIKA 1SCUB 5IIFA 1EOTA 1A2UA 5FLXL 4JC0A 2IX3A 3S24A 5T1IA 1HNZL 1F77A 2WB1G 1GM5A 2YS7A 1AUVA 4BY7G 1YVCA 4O3PA 2DLNA 1EWIA 3BQ2A 5DLGA 2KJXA 1TWCH 1ESFA 2OH2A 4KD3A 5KG1A 2C5CA 4EYHB 3BA9A 1EWHA 1IBKL 3K57A 4C2MH 4C5CA 1N34H 3T51B 1OTCA 2R84A 1PFMA 2R7ZA 4A75A 4A3BH 2A5HA 2EVBA 1QVCA 2OF1A 4DPGA 2EE1A 3KLRA 1CE8A 2RF4A 4RUCA 2FPPB 4OO1G 4ME5A 3VR4A 4LF7Q 3GIMA 4J9LA 2F0UA 3U9OA 3G4SA 1UNNC 4IWXA 5EDWA 2FMAA 1WTVA 1K3BC 4AYBA 4K2KA 2JEGA 4LF4H 4OO1H 4RKBA 1GUOA 1GJXA 5C3EG 2CFMA 1LTRD 2XTIA 1Q1EA 3VYTA 4GC7A 1II3A 2Z6KC 2FLLA 3K5MA 3B6YA 4DV1L 2KOLA 4X65Q 2K5WA 4DR2H 3GIPA 1XMOQ 4DV6Q 2JA9A 3OW7A 4Y52H 3GIJA 1PFSA 4UFZA 4X62Q 2E2IA 4RHSA 5EPLA 1JDBB 2JA7B 1LT5D 1JWSD 5CR3A 4E6IA 1I6HH 2X6LA 2JJQA 2Q8IB 4OWWB 1E4EB 5F9NA 3NTHA 4QB4A 3ONAB 4ABNA 3CCRA 3T1YH 3K8AA 1AE3A 2FJZA 3F8TA 3N6RA 1XMOH 1VQJA 2EYPA 2R7ZH 1HH2P 3GQBA 4P71A 3Q23A 1J8IA 3CCVA 4KHVA 1WTHA 3K3PA 3I4NG 3EJIA 5BR8L 4JI8L 1PV4A 1MIUA 3J81c 1ILPA 2DNCA 4J9SA 2YZMA 1XMQQ 4TUYF 4WJ3M 1JLLB 3DWAA 1LT4D 2JQOA 2CZGA 1VQ8A 1VF7A 4GOPB 4BA1I 2JEAI 4DL7A 4GN4B 3L2PA 2ATWA 1YNJC 2F0PA 2JN4A 4A93B 2IP4A 5A2QW 4NLGA 1Y8PB 4P74A 1K8OA 4A3CG 1H9SB 2BE5C 3RR5A 3MZ5A 3DHQA 4IJLA 3S2DB 4TQRA 5A35A 5CYUA 3F8NA 3BG5A 2UUCH 2QEJC 1YJ9A 2UUAQ 4IQZA 4RA8A 2A68D 2R61A 5BR8H 3RBDA 3HXLA 3R2IA 4GOPC 1B6RA 4J8QA 4DV1H 1YJWA 4A3MB 1FKAH 5A2QE 3M9MB 3OUUA 2UUAH 2ALYB 3NWSA 3OUZA 2UUCL 4R4OA 3PO2B 4RZRA 2RDHA 4NMZA 1CUKA 3P20A 4LF7L 3EQLC 2JA5H 5C0XG 2YTVA 3RNUA 1ICFB 2PI2E 1AH9A 3SEBA 4Q5VA 2F0WA 2GN5A 3K5OA 5ELFA 1PVOA 4Q43A 1UNSA 4DU9A 5KYIA 2NVTB 4R4IA 4PNYA 3KLSX 4JI5L 5M5XH 4JI0H 3QZ8A 4POGA 4JYAL 2A68C 4CC5A 5DM63 4JI2H 3H0GH 2NVXA 2F4VH 2VPQA 2WKCA 2XD4A 5I6WA 1O7YA 1CSPA 5LOVF 4YHHL 2NBFA 4MV6A 4K5VA 1KABA 5FO7B 3BVMA 1XPRA 2G5DA 1EU4A 2JA6H 3HOUG 5C4XG 3G71A 2ICEC 1CQJB 4R8UA 4EFEA 2DPIA 1EQRA 3GIKA 1V1PB 1WR2A 3NP8A 1I3QB 4A3KB 3NQTA 1HNWL 4IN3A 2DN8A 2PMZB 4H13C 1IYJB 2A6HD 5GONF 4NDXA 4C1NK 4XT3B 5G3LD 4JPBW 4OHJA 2UXDQ 1K8MA 1WD1A 4B9WA 3PMFA 3H3VC 5CV7A 2F0JA 3N44B 3GTGB 4O3QA 2IX1A 2YS6A 4M7EA 1HR0Q 1MSGA 1WH2A 4IOCA 1BCPD 1PTOH 4ZQIA 4A3JG 3N52A 1CQFA 1XX8A 4O3SA 4AQYL 2F0DA 4LW1A 1J6QA 1JR0D 2R3ZA 2F0SA 4A76A 5CMDA 1E0BA 2VY3A 3R5FA 4A3MG 1WTRA 3OWEB 3I73A 4F4XA 1LO5D 3IAYA 1X3QA 5TSSA 1IBKH 2Y0SB 1EY0A 3TSSA 4IUNA 4X3SA 1JORA 3KBXA 5KG2A 2L5TA 4IUPA 2OQ0A 4GNXA 2IX0A 3N42B 4GKJQ 4RB2C 4ZYSA 4X64H 5JEAH 3J7YW 3S1RH 2EJGC 5M5WH 1KD1C 3MFHA 5LA6F 1JICA 1I3QH 1I6UA 2PQAB 3DEOA 1JB7A 1DM0B 2B8GA 2F4VL 2WDTA 4K8IA 3KAJA 3AQQA 5JEAG 5D14A 3JZIA 1U0LA 5KNDA 2V9WA 4LF6H 4HJ5A 3TIGA 4UDUC 5DQHA 1IXRA 2R7NA 1ENCA 5GADC 1UAPA 2H4OA 1EY4A 1CZGA 3K6OA 1MBYA 2ZTDA 2VL6A 3FRPB 1DZ1A 2PZUA 1N48A 1QNKA 1D6EC 1TS2A 3T5LA 2EY1A 4V0BA 3RZDH 1BXRA 1SEBD 3GTMA 3C2PA 1PZKD 2DGYA 3D4DA 1PTOD 1XNRH 1VMCA 3KF6B 1HTPA 3RD4A 1IKLA 3GD7A 5KFIA 1DV2A 1PH6A 2DY8A 4DR6H 3FKIB 2PBZA 2ZDHA 1EYCA 4LF9Q 5FLXc 3DXJC 3QZ7A 4B3SH 3NBIA 1A3UA 3HOYG 4UHVA 2ZTCA 2IBKA 2RCNA 3PIO3 2YYAA 2OQKA 2I87A 2F0IA 4QMGA 1S4ZA 4DR1L 1XPUA 2B2YA 3KTMA 4IRKA 4KKUA 4UCUA 5KEEA 4DAMA 1YNJD 4CHTB 2Q2HA 4OXPA 2SCUB 1JE4A 3EBEA 5C4HA 1Y69U 1W2BA 1IBMQ 4Y8VB 4OONA 5ELDA 2R86A 2LKVA 3PN1A 4PZ7A 3J7AK 5CV6A 2VQFH 2ZJRA 4N8X1 3D31A 2RDGA 3ORQA 1K1QA 2RHSB 1PH1A 2NU7B 1EWCA 2XRQD 1FR3A 1WI5A 5DG8A
chains in the Genus database with same CATH topology
1XMQL 3MEFA 3I4MH 4JI7L 3S14H 1V43A 4TQUS 2ZM6L 3CAMA 3AFPA 2ES2A 1S72A 2XGTA 4GLAC 1Q7YC 1B7YB 1FJGQ 3PGZA 4A3EH 1PH7A 3GTLH 2R92H 3NBHB 3A0JA 2E5LL 1NTGA 5IYCH 3U4ZA 3I4MG 3IRBA 4IFDJ 1VQEA 2N8NA 4OWTB 4BBSH 1Q86C 3VDYA 1YHAA 1SR3A 2Q2IA 4DV7Q 4GKJL 1QZHA 3TRZA 1U5KA 3GDEA 5FJ8H 2JA7G 2R92G 4R1JA 3OTOL 1YJNA 4IPHA 3I4OA 2K50A 3CMAA 4IPCA 1A8VA 2B63H 1XJVA 2UXCQ 3PIOA 1S3OA 1WFQA 2ZJPA 1KAWA 2F4VQ 4NXMQ 4BBSG 2QEXA 2UUBQ 3HOYH 4KHPL 3S2HH 3T1HQ 1LTLA 4O2DA 2B29A 2EIFA 1X3GA 1CSQA 1A0IA 1JJCB 5IP9H 5K36G 5IT9c 2VQFQ 1Q81C 4BY1G 4NXNL 1Q46A 2IHEA 2UXBQ 2HHHQ 4HIDA 1UWVA 1K73C 3HOWH 4POFA 1SN8A 3CCJA 3M7NA 4GKKL 2LSSA 4JI5Q 2NVYH 4QY7A 1TXYA 1X56A 1FL0A 2LXJA 4ALPA 4IOAA 4MTNA 1N34L 3PUXA 3FP9A 4UP7A 3PO3G 1R9TH 1XPOA 1K3RA 4A3KG 5AJ3Q 1YHQA 3CCLA 4DR2L 1W3SA 2HT1A 2K5NA 2AWOA 2AHOB 1G51A 3M9BA 1OXUA 4YY3Q 2VQEL 1JJGA 3AFQA 5BR8Q 2N49A 4XIGS 4DUZQ 1C7YA 4OX9Q 1Y1WG 4A3EG 1O7IA 2Q2TA 4BY7H 5M5YH 4BBRG 2VNUD 1G6PA 2E8GA 4LUOA 1D8LA 4A3KH 4Y7NH 3M4OH 3E9HA 2CWAA 1VQNA 3CMEA 2QA4A 1OXTA 4BXXH 1E24A 1GO3E 4K0KQ 2VUMH 3PUWA 4QIWE 1WYDA 2R6GA 1BBUA 2KHJA 3CPFA 3F2DA 4JI6Q 2E2JH 1JT8A 2VZAA 4JI2L 3UE1A 4DR4L 1I94L 4LF6Q 2F52A 4DV4Q 1HNWQ 3S16H 2Z6KA 2OTLA 1GKHA 3F2BA 1PH5A 4LFAL 5JJIA 4LF5Q 1XNQL 4RG1A 1EUJA 3NELA 4A93H 3PUVA 4AYBE 1QVFA 3UE0A 3BJUA 1NY4A 3ULLA 4DR7L 1AE2A 1OXXK 3KDFA 1RIPA 3S2DH 2KBNA 2IHFA 1UE1A 1K9MC 4J15A 3LGJA 1HNZQ 1HZBA 4BY1H 1VQAA 3PUZA 3T1YQ 1FJGL 3OYYA 1VQFA 1HZAA 2E5LQ 4AQYQ 4A93G 3PSIA 4GNXB 4B3RQ 1E22A 4P73A 3BZKA 4LUZA 5FLMH 3CCEA 4DUYQ 4AIMA 1PH8A 1HNXL 2K4KA 1IBKQ 1YBYA 3J81i 2BA1A 3PO3H 1L1OC 2E2HH 2NN6G 1EYGA 2D62A 3ER0A 2PMZE 1QUQB 4LFCQ 3CCQA 1KC8C 4DR6L 1CKNB 2L15A 2YV5A 5ELOA 4C3JH 1V9PA 2UXCL 4JYAQ 5JEAJ 4NXML 1TWFH 2UU9L 3PF5A 5C4JH 3T1HL 1QVGA 4JBMA 3RN5A 1VQ6A 1VQ9A 1B70B 2A1AA 2H5XA 2ZJQA 1SLJA 3K7AH 4P75A 5IWAQ 4YHHQ 5M3FG 3HOWG 5LMNQ 1QZGA 4NXNQ 4HJ7A 4ME3A 3J80c 1OXSC 1I5FA 1TWHH 2BA0A 3HKZG 3JAMi 3HOZH 2HHHL 4L5TA 4DV3Q 2IT1A 2NVXH 3A5ZB 1VQMA 3STBC 3J7A5 4JV5L 1YZ6A 5IYCG 4A3DH 4H02A 1ASYA 4EX5A 3K81C 4X65L 4LWCA 4KHZA 1N34Q 1XMOL 1PYBA 4B3TL 1MJEA 2IY5B 1Y1WH 4LNQA 2K14A 3UDFA 2CKZB 1K0RA 4GN5A 4IJHA 3ERSX 4YWKA 5FJ8G 4JI3Q 4JG2A 1VQ5A 1IBLQ 3ULPA 1VQBA 2B63G 2CQOA 1XNRQ 4JBWA 3J7ZC 3S1MH 1EIFA 2YTYA 3DM3A 3PV0A 2NZOA 2KCMA 5FLMG 5GQOA 1IL2A 2EXDA 1H95A 1HR0L 3EIVA 4DR5Q 1ASZA 3S15H 1G291 3KLWA 3CCMA 1PYSB 4X66L 5GAHC 1TWAH 4QL5A 1X6OA 2GVBA 3FHWA 4B3ML 1VS0A 1T9HA 2KHIA 2OTJA 4JI2Q 1SRUA 3RN2A 4EQ5A 4JI0L 3H3VH 3JAMc 4IFDG 3J80i 4DR1Q 1VQOA 1MKHA 4JI4L 3ZJYC 1PA6A 1X54A 3GTOH 4A3GG 1EOVA 4L5QA 4LFAQ 1HZCA 1XNQQ 1LUZA 1BBWA 2EQSA 4JOIA 4L5SA 4A3LH 5M3FH 1X9NA 1NE3A 2JA8H 2K5VA 4JC0A 1X3FA 1YEZA 3S24A 4C3HH 1HNZL 3D0FA 2ASBA 2WB1G 3T1YL 1GM5A 1HJPA 4KI0A 2UUAL 4BY7G 1YVCA 3FKIH 4YCUA 3GTMH 1EWIA 1C0AA 3ICEA 3AEVA 2R7ZG 2NN6I 3J81j 1TWCH 4MNOA 4DUYL 4P72A 4JI7Q 1A62A 1HNXQ 2YU9H 4APVA 5DLQE 4A3LG 1JMCA 5GAEC 1IBKL 1UEBA 4KLKA 4YWMA 4C2MH 4OO1I 3NEMA 3H15A 1OTCA 3W5OA 4OWXB 1Z9FA 3CP0A 4A75A 2UUCQ 4A3BH 3FKIG 1QVCA 2AWNA 4DPGA 3KJPA 2VS1A 1SFOH 2RF4A 3L7ZC 4DV2Q 4QQBX 1KRSA 4PG3A 4OO1G 4DV5Q 5IP7G 4A3FH 3STBD 4LF7Q 3CF5A 2YTXA 5IYBG 1EQQA 4WJ4A 1GVPA 4HJAA 2UU9Q 3OW2A 3G4SA 2PQAA 2R93G 3PUYA 4PZ8A 5J3BA 3OTOQ 3KF8B 4X64L 4A3DG 4GLVB 4O0AA 2LXKA 4FDBA 4UY8C 3UDIA 1DGSA 5C3EG 1N8RC 2CFMA 1EFWA 4JV5Q 2XTIA 1Q1EA 2Y0SG 2R93H 3AYHB 2Z6KC 1C9OA 5ELNA 1S40A 2YYZA 3B6YA 4DV1L 2HQLA 4LF9L 5M3MH 4HIMA 4X65Q 4L5RC 4JCVE 1MJCA 1L1OA 4IO9A 1XMOQ 3PO2G 1KQSA 4DV6Q 2JA9A 3TREA 2GVAA 4Y52H 1PFSA 4X62Q 4LFBQ 2JA8G 1X3EA 1BVSA 1I6HH 3KF6A 2JJQA 4OWWB 4NPSA 2D0PA 1VQCA 3L0OA 3CCRA 3K8AA 1AE3A 2V1CC 3F8TA 3KJOA 3PO2H 3WWVA 3TS2A 1VQJA 4DR2Q 3TS0A 1IBML 2HIVA 2R7ZH 1BKBA 1HH2P 4P71A 4HJ9A 1YHBA 3HOUH 3CCVA 4PZ6A 4RMFA 2MFIA 4HJ8A 3I4NG 5LMUL 5BR8L 4A3IH 4JI8L 4XTCS 1PV4A 2KENA 3JC66 1CKMA 1MIUA 3J81c 1VQ7A 3HOZG 5H1SE 3MXNB 4A3GH 4B3MQ 1XMQQ 5C0XI 3G6EA 4R4TA 3DLLA 2UXDL 4JI0Q 4WJ3M 3NENA 1LM0A 3UDXA 4AYBG 2JQOA 4DK6C 2JEBI 3CC7A 1JJ2A 1NMFA 1VQ8A 4GOPB 4BA1I 1L0WA 5IYBH 1Z47A 1PH4A 2FXQA 2JEAI 4GN4B 2I5LX 3L2PA 2ATWA 3W1GA 3I4NH 3HOXH 1HZ9A 1N33L 2PNHA 1K83H 2NZHA 1KHIA 1VQGA 1Y1VG 1RL2A 1V1QA 1XTDA 2R7FA 3KDFB 4HIKA 4P74A 1KIXA 2I0QA 2HIXA 3KFUA 1WCMG 4A3CG 3RR5A 1I94Q 4LF6L 3F2CA 3F1ZA 4IJLA 4A3JH 2JA6G 3E0EA 2OWOA 4YCVA 1YJ9A 4B3SL 3BU2A 2JE6I 2UUAQ 3CXCA 4QJFA 3HOXG 4GN3B 4DV0L 1Y1VH 1NBWA 2I5HA 4A3MH 4GOPC 3S1NH 4DNIA 4DR7Q 1WCMH 4IPDA 5M3MG 1YJWA 4GNXC 2DUDA 3CQZH 2PI2A 1YITA 4KHPQ 3W1BA 1CKNA 2ALYB 3K80C 1FVIA 5IYDH 2UUCL 4R4OA 3Q8DA 1N9WA 2F3IA 4DKAC 5LMNW 4B3RL 1L2FA 1CUKA 2VQFL 2Q2UA 3RZOH 4LF7L 2JA5H 1Y14B 5C0XG 2YTVA 2N3SA 2KCTA 1B8AA 2PI2E 3RNUA 3CW2C 1AH9A 4LUVA 4GLXA 2GN5A 3GO5A 1E1OA 1PVOA 4IPGA 4R4CA 1N36Q 4YCWA 4LFCL 4R4IA 5C3EH 2VW9A 3GTQH 4GKKQ 1SMXA 4JI5L 5M5XH 1E7ZA 4POGA 4JYAL 2MO1A 2A8VA 1OXVA 3H0GH 4DR3L 2MNAA 4GS3A 4TVAB 2WP8J 4UPAA 5EAYA 4JBKA 5HY6A 1N32L 2I5MX 3M4PA 1CSPA 4YHHL 4YY3L 5IWAL 1NMGA 4DUZL 1VQIA 4OX9L 3TQYA 4DV6L 2K75A 1PH2A 4JI1Q 1XPRA 1K8GA 4A3BG 4LFBL 2JA6H 3HOUG 5C4XG 5C44H 1PH3A 4K0KL 3G71A 2C35B 5IP7H 4A3FG 4LF8L 5IY0A 2ZTEA 1YNXA 1J5EL 1Q8KA 1EQRA 4JI3L 4DR4Q 5E7NA 1E3PA 4DV4L 1HNWL 2JK8A 5LMUQ 4UP8A 1HR0W 1IYJB 1I50H 2RHQB 3RLOA 5C44G 2A19A 1X55A 1XNRL 4BA2I 4LF4Q 1P8LA 4NB3A 2UXDQ 4AH6A 2NVTH 2IX1A 1HR0Q 1VCIA 5GAGC 4DR5L 4IOCA 2CCZA 1EIYB 2WAQE 2JA5G 1E1TA 4A3JG 3GTGH 1N33Q 1VQHA 2CWPA 1Q1BA 1PH9A 5JJLA 1YI2A 3K7UC 4A4IA 4AQYL 3CD6A 4LW1A 1J6QA 4A76A 2E2IH 4MZ9A 2VY3A 2ZM6Q 4A3MG 2MQHA 4JI4Q 1VQKA 3S1QH 3GTKH 4B3SQ 1KL9A 3PIPA 1TWGH 3M4QA 4PMWA 4C3IH 4QGUA 4DV0Q 3G48A 2BH2A 4DR6Q 1UE6A 2QGQA 3A5UA 2R7DA 4A3IG 1GD7A 1FGUA 2OQ0A 4R4QA 4GNXA 2IX0A 4DV7L 4GKJQ 2WB1E 3S1RH 5M5WH 1KD1C 3M3YH 1PHJA 3RLFA 4IFDI 4JOIC 1I3QH 3I2ZA 1YIJA 3CCUA 2PQAB 1WJJA 5LMNL 1IZ6A 1JB7A 3H3VI 5C0XJ 2F4VL 1QUQA 3I7FA 2K52A 3ULJA 4BBRH 4DAYB 5HGQA 4DV3L 2UUBL 4DK3C 1N36L 3TEHB 4HIOA 3AQQA 5JEAG 4B3TQ 2Y0SE 4A3CH 1M90C 4DV2L 4BXXG 1U0LA 2VUMG 3HOVG 4DV5L 4HJ5A 4X6AH 1IXRA 5IE8A 4DR3Q 1UE5A 5GADC 1VQ4A 5IP9G 1SROA 2UXBL 2OCEA 1N32Q 1L1OB 2ZTDA 2VL6A 1WOCA 1IBLL 3KYHC 1VQDA 1CKOA 1SE8A 3SGIA 3PCOB 4X64Q 3M85A 3BZCA 2WAQG 3RZDH 3HOVH 4UP9A 2DGYA 5C4XH 1JE5A 5GROA 3KF6B 3HFZB 4JI1L 5AJ3L 3K0XA 3GTJH 3U4VA 5IYDG 1K8AC 3GD7A 1NJIC 2JA7H 1KXLA 3CPWA 1PH6A 1VQPA 2AKWB 2VQEQ 2D0OA 4DV1Q 4JBJA 4LF9Q 4LF8Q 3HKSA 4X66Q 5FLXc 3GTPH 1UE7A 1J5EQ 3I56A 3HOYG 2BH8A 2ZTCA 1KRTA 2RCNA 2B3GA 2ID0A 1Q82C 4X62L 2OQKA 3UDGA 2Z0SA 3U50C 3RLNA 1A63A 4DR1L 1Q12A 1XPUA 5JJKA 2WFWA 3A74A 4DAMA 3I55A 2AMCB 2Q2HA 3H0GG 4OXPA 2N78A 4GOPA 4JI6L 4LF4L 3EBEA 2NVQH 3S17H 4YWLA 3HKZE 1W2BA 1IBMQ 4OONA 3PF4A 3KOJA 4PZ7A 1P16A 1VQLA 2ZJRA 1LYLA 1X65A 3D31A 3CC2A 3U58A 2K5HA 2RHSB 2MO0A 3E9IA 4JI8Q 3CCSA 1PH1A 1D7QA 1M1KC 3CC4A 1WI5A 3EN2A 4LF5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ L;  3MEF A;  3I4M H;  4JI7 L;  3S14 H;  1V43 A;  4TQU S;  2ZM6 L;  3CAM A;  3AFP A;  2ES2 A;  1S72 A;  2XGT A;  4GLA C;  1Q7Y C;  1B7Y B;  1FJG Q;  3PGZ A;  4A3E H;  1PH7 A;  3GTL H;  2R92 H;  3NBH B;  3A0J A;  2E5L L;  1NTG A;  5IYC H;  3U4Z A;  3I4M G;  3IRB A;  4IFD J;  1VQE A;  2N8N A;  4OWT B;  4BBS H;  1Q86 C;  3VDY A;  1YHA A;  1SR3 A;  2Q2I A;  4DV7 Q;  4GKJ L;  1QZH A;  3TRZ A;  1U5K A;  3GDE A;  5FJ8 H;  2JA7 G;  2R92 G;  4R1J A;  3OTO L;  1YJN A;  4IPH A;  3I4O A;  2K50 A;  3CMA A;  4IPC A;  1A8V A;  2B63 H;  1XJV A;  2UXC Q;  3PIO A;  1S3O A;  1WFQ A;  2ZJP A;  1KAW A;  2F4V Q;  4NXM Q;  4BBS G;  2QEX A;  2UUB Q;  3HOY H;  4KHP L;  3S2H H;  3T1H Q;  1LTL A;  4O2D A;  2B29 A;  2EIF A;  1X3G A;  1CSQ A;  1A0I A;  1JJC B;  5IP9 H;  5K36 G;  5IT9 c;  2VQF Q;  1Q81 C;  4BY1 G;  4NXN L;  1Q46 A;  2IHE A;  2UXB Q;  2HHH Q;  4HID A;  1UWV A;  1K73 C;  3HOW H;  4POF A;  1SN8 A;  3CCJ A;  3M7N A;  4GKK L;  2LSS A;  4JI5 Q;  2NVY H;  4QY7 A;  1TXY A;  1X56 A;  1FL0 A;  2LXJ A;  4ALP A;  4IOA A;  4MTN A;  1N34 L;  3PUX A;  3FP9 A;  4UP7 A;  3PO3 G;  1R9T H;  1XPO A;  1K3R A;  4A3K G;  5AJ3 Q;  1YHQ A;  3CCL A;  4DR2 L;  1W3S A;  2HT1 A;  2K5N A;  2AWO A;  2AHO B;  1G51 A;  3M9B A;  1OXU A;  4YY3 Q;  2VQE L;  1JJG A;  3AFQ A;  5BR8 Q;  2N49 A;  4XIG S;  4DUZ Q;  1C7Y A;  4OX9 Q;  1Y1W G;  4A3E G;  1O7I A;  2Q2T A;  4BY7 H;  5M5Y H;  4BBR G;  2VNU D;  1G6P A;  2E8G A;  4LUO A;  1D8L A;  4A3K H;  4Y7N H;  3M4O H;  3E9H A;  2CWA A;  1VQN A;  3CME A;  2QA4 A;  1OXT A;  4BXX H;  1E24 A;  1GO3 E;  4K0K Q;  2VUM H;  3PUW A;  4QIW E;  1WYD A;  2R6G A;  1BBU A;  2KHJ A;  3CPF A;  3F2D A;  4JI6 Q;  2E2J H;  1JT8 A;  2VZA A;  4JI2 L;  3UE1 A;  4DR4 L;  1I94 L;  4LF6 Q;  2F52 A;  4DV4 Q;  1HNW Q;  3S16 H;  2Z6K A;  2OTL A;  1GKH A;  3F2B A;  1PH5 A;  4LFA L;  5JJI A;  4LF5 Q;  1XNQ L;  4RG1 A;  1EUJ A;  3NEL A;  4A93 H;  3PUV A;  4AYB E;  1QVF A;  3UE0 A;  3BJU A;  1NY4 A;  3ULL A;  4DR7 L;  1AE2 A;  1OXX K;  3KDF A;  1RIP A;  3S2D H;  2KBN A;  2IHF A;  1UE1 A;  1K9M C;  4J15 A;  3LGJ A;  1HNZ Q;  1HZB A;  4BY1 H;  1VQA A;  3PUZ A;  3T1Y Q;  1FJG L;  3OYY A;  1VQF A;  1HZA A;  2E5L Q;  4AQY Q;  4A93 G;  3PSI A;  4GNX B;  4B3R Q;  1E22 A;  4P73 A;  3BZK A;  4LUZ A;  5FLM H;  3CCE A;  4DUY Q;  4AIM A;  1PH8 A;  1HNX L;  2K4K A;  1IBK Q;  1YBY A;  3J81 i;  2BA1 A;  3PO3 H;  1L1O C;  2E2H H;  2NN6 G;  1EYG A;  2D62 A;  3ER0 A;  2PMZ E;  1QUQ B;  4LFC Q;  3CCQ A;  1KC8 C;  4DR6 L;  1CKN B;  2L15 A;  2YV5 A;  5ELO A;  4C3J H;  1V9P A;  2UXC L;  4JYA Q;  5JEA J;  4NXM L;  1TWF H;  2UU9 L;  3PF5 A;  5C4J H;  3T1H L;  1QVG A;  4JBM A;  3RN5 A;  1VQ6 A;  1VQ9 A;  1B70 B;  2A1A A;  2H5X A;  2ZJQ A;  1SLJ A;  3K7A H;  4P75 A;  5IWA Q;  4YHH Q;  5M3F G;  3HOW G;  5LMN Q;  1QZG A;  4NXN Q;  4HJ7 A;  4ME3 A;  3J80 c;  1OXS C;  1I5F A;  1TWH H;  2BA0 A;  3HKZ G;  3JAM i;  3HOZ H;  2HHH L;  4L5T A;  4DV3 Q;  2IT1 A;  2NVX H;  3A5Z B;  1VQM A;  3STB C;  3J7A 5;  4JV5 L;  1YZ6 A;  5IYC G;  4A3D H;  4H02 A;  1ASY A;  4EX5 A;  3K81 C;  4X65 L;  4LWC A;  4KHZ A;  1N34 Q;  1XMO L;  1PYB A;  4B3T L;  1MJE A;  2IY5 B;  1Y1W H;  4LNQ A;  2K14 A;  3UDF A;  2CKZ B;  1K0R A;  4GN5 A;  4IJH A;  3ERS X;  4YWK A;  5FJ8 G;  4JI3 Q;  4JG2 A;  1VQ5 A;  1IBL Q;  3ULP A;  1VQB A;  2B63 G;  2CQO A;  1XNR Q;  4JBW A;  3J7Z C;  3S1M H;  1EIF A;  2YTY A;  3DM3 A;  3PV0 A;  2NZO A;  2KCM A;  5FLM G;  5GQO A;  1IL2 A;  2EXD A;  1H95 A;  1HR0 L;  3EIV A;  4DR5 Q;  1ASZ A;  3S15 H;  1G29 1;  3KLW A;  3CCM A;  1PYS B;  4X66 L;  5GAH C;  1TWA H;  4QL5 A;  1X6O A;  2GVB A;  3FHW A;  4B3M L;  1VS0 A;  1T9H A;  2KHI A;  2OTJ A;  4JI2 Q;  1SRU A;  3RN2 A;  4EQ5 A;  4JI0 L;  3H3V H;  3JAM c;  4IFD G;  3J80 i;  4DR1 Q;  1VQO A;  1MKH A;  4JI4 L;  3ZJY C;  1PA6 A;  1X54 A;  3GTO H;  4A3G G;  1EOV A;  4L5Q A;  4LFA Q;  1HZC A;  1XNQ Q;  1LUZ A;  1BBW A;  2EQS A;  4JOI A;  4L5S A;  4A3L H;  5M3F H;  1X9N A;  1NE3 A;  2JA8 H;  2K5V A;  4JC0 A;  1X3F A;  1YEZ A;  3S24 A;  4C3H H;  1HNZ L;  3D0F A;  2ASB A;  2WB1 G;  3T1Y L;  1GM5 A;  1HJP A;  4KI0 A;  2UUA L;  4BY7 G;  1YVC A;  3FKI H;  4YCU A;  3GTM H;  1EWI A;  1C0A A;  3ICE A;  3AEV A;  2R7Z G;  2NN6 I;  3J81 j;  1TWC H;  4MNO A;  4DUY L;  4P72 A;  4JI7 Q;  1A62 A;  1HNX Q;  2YU9 H;  4APV A;  5DLQ E;  4A3L G;  1JMC A;  5GAE C;  1IBK L;  1UEB A;  4KLK A;  4YWM A;  4C2M H;  4OO1 I;  3NEM A;  3H15 A;  1OTC A;  3W5O A;  4OWX B;  1Z9F A;  3CP0 A;  4A75 A;  2UUC Q;  4A3B H;  3FKI G;  1QVC A;  2AWN A;  4DPG A;  3KJP A;  2VS1 A;  1SFO H;  2RF4 A;  3L7Z C;  4DV2 Q;  4QQB X;  1KRS A;  4PG3 A;  4OO1 G;  4DV5 Q;  5IP7 G;  4A3F H;  3STB D;  4LF7 Q;  3CF5 A;  2YTX A;  5IYB G;  1EQQ A;  4WJ4 A;  1GVP A;  4HJA A;  2UU9 Q;  3OW2 A;  3G4S A;  2PQA A;  2R93 G;  3PUY A;  4PZ8 A;  5J3B A;  3OTO Q;  3KF8 B;  4X64 L;  4A3D G;  4GLV B;  4O0A A;  2LXK A;  4FDB A;  4UY8 C;  3UDI A;  1DGS A;  5C3E G;  1N8R C;  2CFM A;  1EFW A;  4JV5 Q;  2XTI A;  1Q1E A;  2Y0S G;  2R93 H;  3AYH B;  2Z6K C;  1C9O A;  5ELN A;  1S40 A;  2YYZ A;  3B6Y A;  4DV1 L;  2HQL A;  4LF9 L;  5M3M H;  4HIM A;  4X65 Q;  4L5R C;  4JCV E;  1MJC A;  1L1O A;  4IO9 A;  1XMO Q;  3PO2 G;  1KQS A;  4DV6 Q;  2JA9 A;  3TRE A;  2GVA A;  4Y52 H;  1PFS A;  4X62 Q;  4LFB Q;  2JA8 G;  1X3E A;  1BVS A;  1I6H H;  3KF6 A;  2JJQ A;  4OWW B;  4NPS A;  2D0P A;  1VQC A;  3L0O A;  3CCR A;  3K8A A;  1AE3 A;  2V1C C;  3F8T A;  3KJO A;  3PO2 H;  3WWV A;  3TS2 A;  1VQJ A;  4DR2 Q;  3TS0 A;  1IBM L;  2HIV A;  2R7Z H;  1BKB A;  1HH2 P;  4P71 A;  4HJ9 A;  1YHB A;  3HOU H;  3CCV A;  4PZ6 A;  4RMF A;  2MFI A;  4HJ8 A;  3I4N G;  5LMU L;  5BR8 L;  4A3I H;  4JI8 L;  4XTC S;  1PV4 A;  2KEN A;  3JC6 6;  1CKM A;  1MIU A;  3J81 c;  1VQ7 A;  3HOZ G;  5H1S E;  3MXN B;  4A3G H;  4B3M Q;  1XMQ Q;  5C0X I;  3G6E A;  4R4T A;  3DLL A;  2UXD L;  4JI0 Q;  4WJ3 M;  3NEN A;  1LM0 A;  3UDX A;  4AYB G;  2JQO A;  4DK6 C;  2JEB I;  3CC7 A;  1JJ2 A;  1NMF A;  1VQ8 A;  4GOP B;  4BA1 I;  1L0W A;  5IYB H;  1Z47 A;  1PH4 A;  2FXQ A;  2JEA I;  4GN4 B;  2I5L X;  3L2P A;  2ATW A;  3W1G A;  3I4N H;  3HOX H;  1HZ9 A;  1N33 L;  2PNH A;  1K83 H;  2NZH A;  1KHI A;  1VQG A;  1Y1V G;  1RL2 A;  1V1Q A;  1XTD A;  2R7F A;  3KDF B;  4HIK A;  4P74 A;  1KIX A;  2I0Q A;  2HIX A;  3KFU A;  1WCM G;  4A3C G;  3RR5 A;  1I94 Q;  4LF6 L;  3F2C A;  3F1Z A;  4IJL A;  4A3J H;  2JA6 G;  3E0E A;  2OWO A;  4YCV A;  1YJ9 A;  4B3S L;  3BU2 A;  2JE6 I;  2UUA Q;  3CXC A;  4QJF A;  3HOX G;  4GN3 B;  4DV0 L;  1Y1V H;  1NBW A;  2I5H A;  4A3M H;  4GOP C;  3S1N H;  4DNI A;  4DR7 Q;  1WCM H;  4IPD A;  5M3M G;  1YJW A;  4GNX C;  2DUD A;  3CQZ H;  2PI2 A;  1YIT A;  4KHP Q;  3W1B A;  1CKN A;  2ALY B;  3K80 C;  1FVI A;  5IYD H;  2UUC L;  4R4O A;  3Q8D A;  1N9W A;  2F3I A;  4DKA C;  5LMN W;  4B3R L;  1L2F A;  1CUK A;  2VQF L;  2Q2U A;  3RZO H;  4LF7 L;  2JA5 H;  1Y14 B;  5C0X G;  2YTV A;  2N3S A;  2KCT A;  1B8A A;  2PI2 E;  3RNU A;  3CW2 C;  1AH9 A;  4LUV A;  4GLX A;  2GN5 A;  3GO5 A;  1E1O A;  1PVO A;  4IPG A;  4R4C A;  1N36 Q;  4YCW A;  4LFC L;  4R4I A;  5C3E H;  2VW9 A;  3GTQ H;  4GKK Q;  1SMX A;  4JI5 L;  5M5X H;  1E7Z A;  4POG A;  4JYA L;  2MO1 A;  2A8V A;  1OXV A;  3H0G H;  4DR3 L;  2MNA A;  4GS3 A;  4TVA B;  2WP8 J;  4UPA A;  5EAY A;  4JBK A;  5HY6 A;  1N32 L;  2I5M X;  3M4P A;  1CSP A;  4YHH L;  4YY3 L;  5IWA L;  1NMG A;  4DUZ L;  1VQI A;  4OX9 L;  3TQY A;  4DV6 L;  2K75 A;  1PH2 A;  4JI1 Q;  1XPR A;  1K8G A;  4A3B G;  4LFB L;  2JA6 H;  3HOU G;  5C4X G;  5C44 H;  1PH3 A;  4K0K L;  3G71 A;  2C35 B;  5IP7 H;  4A3F G;  4LF8 L;  5IY0 A;  2ZTE A;  1YNX A;  1J5E L;  1Q8K A;  1EQR A;  4JI3 L;  4DR4 Q;  5E7N A;  1E3P A;  4DV4 L;  1HNW L;  2JK8 A;  5LMU Q;  4UP8 A;  1HR0 W;  1IYJ B;  1I50 H;  2RHQ B;  3RLO A;  5C44 G;  2A19 A;  1X55 A;  1XNR L;  4BA2 I;  4LF4 Q;  1P8L A;  4NB3 A;  2UXD Q;  4AH6 A;  2NVT H;  2IX1 A;  1HR0 Q;  1VCI A;  5GAG C;  4DR5 L;  4IOC A;  2CCZ A;  1EIY B;  2WAQ E;  2JA5 G;  1E1T A;  4A3J G;  3GTG H;  1N33 Q;  1VQH A;  2CWP A;  1Q1B A;  1PH9 A;  5JJL A;  1YI2 A;  3K7U C;  4A4I A;  4AQY L;  3CD6 A;  4LW1 A;  1J6Q A;  4A76 A;  2E2I H;  4MZ9 A;  2VY3 A;  2ZM6 Q;  4A3M G;  2MQH A;  4JI4 Q;  1VQK A;  3S1Q H;  3GTK H;  4B3S Q;  1KL9 A;  3PIP A;  1TWG H;  3M4Q A;  4PMW A;  4C3I H;  4QGU A;  4DV0 Q;  3G48 A;  2BH2 A;  4DR6 Q;  1UE6 A;  2QGQ A;  3A5U A;  2R7D A;  4A3I G;  1GD7 A;  1FGU A;  2OQ0 A;  4R4Q A;  4GNX A;  2IX0 A;  4DV7 L;  4GKJ Q;  2WB1 E;  3S1R H;  5M5W H;  1KD1 C;  3M3Y H;  1PHJ A;  3RLF A;  4IFD I;  4JOI C;  1I3Q H;  3I2Z A;  1YIJ A;  3CCU A;  2PQA B;  1WJJ A;  5LMN L;  1IZ6 A;  1JB7 A;  3H3V I;  5C0X J;  2F4V L;  1QUQ A;  3I7F A;  2K52 A;  3ULJ A;  4BBR H;  4DAY B;  5HGQ A;  4DV3 L;  2UUB L;  4DK3 C;  1N36 L;  3TEH B;  4HIO A;  3AQQ A;  5JEA G;  4B3T Q;  2Y0S E;  4A3C H;  1M90 C;  4DV2 L;  4BXX G;  1U0L A;  2VUM G;  3HOV G;  4DV5 L;  4HJ5 A;  4X6A H;  1IXR A;  5IE8 A;  4DR3 Q;  1UE5 A;  5GAD C;  1VQ4 A;  5IP9 G;  1SRO A;  2UXB L;  2OCE A;  1N32 Q;  1L1O B;  2ZTD A;  2VL6 A;  1WOC A;  1IBL L;  3KYH C;  1VQD A;  1CKO A;  1SE8 A;  3SGI A;  3PCO B;  4X64 Q;  3M85 A;  3BZC A;  2WAQ G;  3RZD H;  3HOV H;  4UP9 A;  2DGY A;  5C4X H;  1JE5 A;  5GRO A;  3KF6 B;  3HFZ B;  4JI1 L;  5AJ3 L;  3K0X A;  3GTJ H;  3U4V A;  5IYD G;  1K8A C;  3GD7 A;  1NJI C;  2JA7 H;  1KXL A;  3CPW A;  1PH6 A;  1VQP A;  2AKW B;  2VQE Q;  2D0O A;  4DV1 Q;  4JBJ A;  4LF9 Q;  4LF8 Q;  3HKS A;  4X66 Q;  5FLX c;  3GTP H;  1UE7 A;  1J5E Q;  3I56 A;  3HOY G;  2BH8 A;  2ZTC A;  1KRT A;  2RCN A;  2B3G A;  2ID0 A;  1Q82 C;  4X62 L;  2OQK A;  3UDG A;  2Z0S A;  3U50 C;  3RLN A;  1A63 A;  4DR1 L;  1Q12 A;  1XPU A;  5JJK A;  2WFW A;  3A74 A;  4DAM A;  3I55 A;  2AMC B;  2Q2H A;  3H0G G;  4OXP A;  2N78 A;  4GOP A;  4JI6 L;  4LF4 L;  3EBE A;  2NVQ H;  3S17 H;  4YWL A;  3HKZ E;  1W2B A;  1IBM Q;  4OON A;  3PF4 A;  3KOJ A;  4PZ7 A;  1P16 A;  1VQL A;  2ZJR A;  1LYL A;  1X65 A;  3D31 A;  3CC2 A;  3U58 A;  2K5H A;  2RHS B;  2MO0 A;  3E9I A;  4JI8 Q;  3CCS A;  1PH1 A;  1D7Q A;  1M1K C;  3CC4 A;  1WI5 A;  3EN2 A;  4LF5 L; 
#chains in the Genus database with same CATH topology
 2FMM A;  2JYO A;  1DOK A;  1STE A;  2XSC A;  3MEF A;  1KNA A;  3A8K E;  1S72 A;  4FM9 A;  1JX4 A;  2JA6 A;  1B7Y B;  3PGZ A;  2R92 H;  3EA6 A;  4KY6 A;  1G2T A;  1BF4 A;  2E76 C;  1G8Z D;  3BYT B;  1BJT A;  3Q1K A;  4AQY H;  3GV8 B;  2YZN A;  1SNM A;  2N8N A;  4YP3 A;  1YHA A;  1GXD C;  3V6K A;  2Q2I A;  2NYZ D;  4DV6 H;  1WTX A;  2JA7 G;  3N8D A;  2R92 G;  3OTO L;  1R4Q B;  4O3O A;  2VA2 A;  4X3U A;  2R7Z B;  1XJV A;  1RYS A;  1WFQ A;  2F4V Q;  4O2D A;  1GHK A;  2DZD A;  1X3G A;  4GKK H;  3MWE A;  4JI8 H;  3H6M A;  4I7A A;  1LTB D;  4H7B A;  4V19 0;  3S16 B;  3Q8Q B;  4I7Z C;  5LL6 b;  3JAM E;  4BY1 G;  4NXN L;  4C1N I;  2V4Q A;  3Q24 A;  1B3A A;  5KT3 A;  4AYB B;  4HID A;  1HQM C;  1HFN A;  3BAB A;  1TT2 A;  4NKL A;  2BR0 A;  1Q90 A;  1SN8 A;  2W71 A;  4BY1 B;  1RJP A;  1BNC A;  4RAZ A;  3V6J A;  1X56 A;  4ALP A;  4IOA A;  4YBZ B;  1JOQ A;  1N34 L;  4UP7 A;  2NVY B;  3PO3 G;  5K5P A;  1XPO A;  4A3K G;  1R9T H;  5AJ3 Q;  3CCL A;  1VKZ A;  1SYF A;  3I70 A;  1EL0 A;  3JSN A;  4DR7 H;  3QOL A;  3NUC A;  3AFQ A;  2M9V A;  3C1E A;  4DUZ Q;  5EPJ A;  3T56 B;  4A3E G;  1BDO A;  2Q2T A;  1W96 A;  5M5Y H;  1RJT A;  1SMY C;  3M7G A;  3IN5 A;  1E2V A;  3M4O H;  3H4D A;  5KNB A;  3CME A;  1JQY D;  2K04 A;  1GO3 E;  1EY7 A;  4K0K Q;  4QIW E;  1BBU A;  3CPF A;  5EGT A;  4O3R A;  4FF4 A;  2FB9 A;  3WOF A;  3UE1 A;  2Q8T A;  1U4M A;  4DV4 Q;  1SNO A;  1PTO B;  3S16 H;  4G3I A;  1TWH A;  3GV3 A;  1H9R A;  4DAP A;  5IGB A;  4DGZ A;  4LFA L;  3V4S A;  5JJI A;  1M0T A;  1S68 A;  2LY7 A;  4RG1 A;  3NEL A;  5COY A;  4A93 H;  5KFA A;  1GOZ A;  3UE0 A;  1NY4 A;  1SDF A;  1AE2 A;  3A8I E;  1UE1 A;  4CJ1 B;  2I07 B;  4N9P A;  2C00 A;  1B1Z A;  3T1Y Q;  1BBX C;  1H9S A;  2NN6 H;  4QUF A;  2V5A A;  2F0M A;  2E5L Q;  4A93 G;  3PSI A;  4DUY Q;  1PH8 A;  2V58 A;  1BCP F;  5I47 A;  2IL8 A;  1K1S A;  5BMV F;  4FP5 D;  2AQ1 B;  3CRL C;  5EKL A;  1SJE D;  2O5J C;  1KC8 C;  4JI4 H;  3C1F A;  3R93 A;  2Z4H A;  1LT3 D;  2F0L A;  3J7A F;  4JYA Q;  3IG0 A;  3IL8 A;  3MXU A;  1F9R A;  2UU9 L;  3PVX A;  2XWJ B;  4FXG C;  1GHJ A;  2H1E A;  4KK7 A;  1VQ9 A;  1B70 B;  2A1A A;  5EOY A;  3KHR A;  5LMN H;  3TQT A;  4HNU A;  3V96 A;  3HOW G;  1C8C A;  4NXN Q;  3J80 c;  3HKZ G;  1SSO A;  3JAM i;  4LJZ C;  1HFG A;  4DV3 Q;  1S03 G;  1ENF A;  4JV5 L;  2WIN B;  3STB C;  4F4Y A;  2NVX B;  4DL2 A;  4A3D H;  2HCI A;  2A73 B;  1ASY A;  4EX5 A;  1Y1W A;  4ME6 A;  4G57 A;  1N34 Q;  1BCP B;  3S1Q B;  1MJE A;  1Y1W H;  1CI3 M;  2K14 A;  5FLX E;  3OHB A;  4UAI A;  2W7O A;  2F4I A;  3TME A;  4DUY H;  2RGR A;  5IOC A;  2WYO A;  5KFU A;  3PR4 A;  3J7Z C;  4XYO A;  2OXP A;  4MV7 A;  4HTH A;  2EYL A;  4K14 A;  1BO0 A;  5D3I B;  1H95 A;  4R8U B;  1TWA B;  4ILW A;  1HR0 L;  4DR5 Q;  2LMC B;  1PRT B;  2MCT A;  4YJ3 F;  4RB1 A;  1BNZ A;  1MI2 A;  4QL5 A;  2KHI A;  1T9H A;  2OTJ A;  3RN2 A;  2FKL A;  4QW8 A;  1HUM A;  1PK8 A;  5JVD F;  1MKH A;  2YRW A;  1DV1 A;  1PA6 A;  1X54 A;  2XC9 A;  3FPU B;  2W6Z A;  1S5D D;  3DWP A;  1STY A;  5KG3 A;  4HAE A;  3GTG A;  4JI6 H;  4RCN A;  3D8G A;  4U6P A;  1DCZ A;  2EQS A;  4ECW A;  4L5S A;  1R9T A;  4K0K H;  5M3F H;  1X9N A;  1NE3 A;  2K5V A;  3D4R A;  4C3H H;  3D0F A;  4ECR A;  2DWC A;  4KI0 A;  4YIJ A;  4YCU A;  4ECU A;  5KFE A;  2R7Z G;  2NN6 I;  1EIH A;  4FF3 A;  3PW0 A;  4JI7 Q;  2ENB A;  3GTJ B;  3Q22 A;  4APV A;  5DGB A;  1UEB A;  5KT7 A;  4KLK A;  4YWM A;  5KKN B;  3NEM A;  3TP5 A;  2VPS A;  3K5H A;  2C2E A;  4XQQ A;  1SNP A;  5I6Y A;  5ELB A;  4OWX B;  2R8J A;  1KDC A;  3FKI G;  3KJP A;  1SFO H;  4HNV A;  3L7Z C;  2F03 A;  2IJ0 A;  2NVQ B;  1T94 A;  4ZK9 B;  1EQQ A;  3HOY B;  2W9C B;  1GVP A;  2UU9 Q;  2O5I C;  1LTG D;  5C1O A;  2PQE A;  2V4R A;  2PQA A;  3PUY A;  4PZ8 A;  4J0M A;  5IT9 W;  1J9O A;  5AFW A;  2FMC A;  1O7L A;  2FJ2 A;  3VR2 A;  4XZ3 B;  3KF8 B;  4GLV B;  4FDB A;  1JOK A;  2HDM A;  4UCS A;  5KFM A;  1DGS A;  5LMU H;  2HGS A;  4P2C B;  4JV5 Q;  2PCF B;  2R93 H;  2EYF A;  4FBT A;  1S40 A;  2WV6 D;  3OMC A;  1SND A;  2YYZ A;  4A3E B;  2HQL A;  1ET9 A;  4LF9 L;  1BQQ T;  3DWQ A;  4HIM A;  3RB3 A;  1MJC A;  4IUR A;  3PZP A;  3TRE A;  4DXF A;  3NGD A;  3T53 B;  3I90 A;  3T5K A;  2K5D A;  3GTM B;  3BG3 A;  2X0S A;  2L1B A;  1X3E A;  2B2U A;  1TR5 A;  3KF6 A;  2V1C C;  3FKI A;  3FVQ A;  3KJO A;  3PO2 H;  3WWV A;  2Z4I A;  3HOU H;  4X65 H;  2MUY A;  2CW8 A;  1YHB A;  5FPR A;  4M8A A;  4LFA H;  2MFI A;  4F4W A;  3E5S A;  1PMR A;  2NTS A;  5LMU L;  4XTC S;  1CKM A;  3EVQ A;  3F2U A;  5H1S E;  4B3M Q;  1EZ6 A;  1Z2P X;  1I4H A;  2JEB I;  1S5E D;  3GIQ A;  1AFP A;  4TRD A;  1L0W A;  2XCL A;  3BJY A;  5DG9 A;  1SYE A;  1C4Q A;  2FXQ A;  2R85 A;  3HOX H;  1HZ9 A;  3OPO A;  2NZH A;  4ZKC B;  5JPM C;  1KHI A;  4UCT A;  1Y1V G;  1RL2 A;  1V1Q A;  1XTD A;  1T5X D;  2R7F A;  1KIX A;  5DM7 3;  2CW7 A;  2UU9 H;  2HIX A;  5JJZ A;  4LF7 H;  1I94 Q;  4DV5 H;  1S0N A;  5IOD A;  4A3J H;  2JA6 G;  1QIL A;  3N40 P;  2OWO A;  4F50 A;  4YCV A;  3BU2 A;  1L0X B;  2JE6 I;  2W8L A;  1L2Z A;  1Y1V H;  1NBW A;  4HCS A;  2JA6 B;  4WJW A;  4DNI A;  4J6H A;  1Q3L A;  5G3L F;  1WCM H;  2J0T D;  1IOV A;  4KN4 C;  4IPD A;  3MAQ A;  4IR1 A;  2PI2 A;  1YIT A;  3W3A A;  1F9Q A;  4KY5 A;  1FVI A;  3RZO B;  4O2B F;  4DKA C;  4FU0 A;  2VQF L;  5IGE A;  1XWE A;  2VB2 X;  1M4V A;  2ZT9 C;  2ZXP A;  4XYQ A;  2KCT A;  5C3E B;  4APM A;  2VUM B;  2R8G A;  4R4C A;  2R8K A;  3J80 E;  3M4I A;  1CA6 A;  5C3E H;  2A69 C;  3GTQ H;  4UCR A;  1SYX B;  2FFK B;  5F2D A;  2E75 C;  2VR1 A;  1NUC A;  3GID A;  3I4N B;  1STB A;  1WTP A;  5L1J A;  1B9M A;  4GS3 A;  3N41 B;  2A74 C;  3R5X A;  3SXH A;  3M4P A;  3A7A B;  3RAQ A;  4YY3 L;  5IWA L;  4Z9C B;  3M4Y A;  5IGG A;  4DUZ L;  4C5B A;  3GTK B;  1TWC A;  4DAV A;  2K75 A;  1B3Q A;  1Z7T A;  1Y8N B;  1SYG A;  4FS1 A;  1K8G A;  1SNQ A;  3RB4 A;  3HZX A;  4ZRZ A;  3TN2 A;  4PMB A;  4F4Z A;  2NVY A;  3LP8 A;  1EFI D;  4A3F G;  2ZTE A;  3J81 E;  1J5E L;  4DV0 H;  1Q8K A;  1BR9 A;  1Y8O B;  4BY7 B;  1VF5 C;  1CTM A;  5EKK A;  3BYY B;  4YAJ B;  1E3P A;  3S15 B;  1F2Y A;  5KFJ A;  5LMU Q;  5LL6 S;  3FMA A;  4CGY B;  3I8Z A;  5C44 G;  1HR0 W;  1XNR L;  4DL3 A;  2A19 A;  1AN8 A;  2P5Z X;  5KFG A;  1G2S A;  1TWF B;  4AH6 A;  1VCI A;  2CCZ A;  1Z2N X;  1U4P A;  4YHH H;  2WAQ E;  2EY2 A;  1PZI D;  3GTG H;  2B8F A;  2MHV A;  3K7U C;  4A4I A;  1TWH B;  3KHL A;  1PDQ A;  2CW0 C;  2ZM6 Q;  4JI4 Q;  3S1Q H;  1MD2 D;  4J9Q A;  3HKZ B;  1C30 A;  3N6X A;  1RCV D;  2YW2 A;  4B3S Q;  2NU9 B;  4IWY A;  3PIP A;  4LF9 H;  4QGU A;  4DV0 Q;  2R8H A;  3KAL A;  2VQE H;  5KRU A;  3G48 A;  3MHB A;  1EY9 A;  5ELE A;  4DK0 A;  2PNR C;  1JKJ B;  3TP7 A;  1FGU A;  2B2T C;  1TVX A;  4R4Q A;  1OWT A;  3V6H A;  4DV7 L;  1EY5 A;  3RJ0 A;  2O2L D;  2J7Z A;  3SK4 A;  3E6Z X;  2PN1 A;  1PFN A;  3M3Y H;  2B2V C;  4WRD A;  1PHJ A;  4QIW A;  5BPH A;  1GSO A;  2AGQ A;  4JOI C;  1D2B A;  2VOB A;  2K28 A;  3CCU A;  4RB3 C;  2AQ2 B;  3H3V I;  1XNQ H;  2L11 A;  3KHH A;  4DV3 L;  3E5N A;  3TEH B;  4HIO A;  3K5I A;  5I2Y A;  1QE6 A;  4DV2 L;  1M90 C;  3MWD A;  1QWY A;  1D5Z C;  1TS3 A;  4DV4 H;  4JV2 A;  1TY2 A;  3HOV G;  4DV5 L;  4MTK A;  1WTO A;  3QWN A;  3R2T A;  4X6A H;  1EIG A;  2GA4 B;  5IE8 A;  4EEQ A;  1XDN A;  4M9U A;  1SRO A;  2UXB L;  3HS0 C;  1BUV T;  3MR3 A;  4XYL B;  3SHL A;  1DD2 A;  1SE8 A;  5NUC A;  3SGI A;  3PCO B;  1PFB A;  4X64 Q;  3OHX C;  2WAQ G;  4BWG B;  3M85 A;  5M3F B;  1JWU D;  4UP9 A;  5C4X H;  2Z9H A;  5KX5 F;  3HFZ B;  4JI1 L;  2YU9 B;  1KXL A;  5IYD G;  1Y1W B;  4N9T A;  1AZP A;  3DUZ A;  1PXU A;  2XRS D;  4KD4 A;  5KFH A;  2AQ3 B;  2D0O A;  4DV1 Q;  1KDA A;  4QWA A;  5J39 A;  4RFB A;  4MV8 A;  1J5E Q;  3QFF A;  3I56 A;  3BDL A;  5L1I A;  1U9R A;  2CHB D;  2RDI A;  1TQO A;  4N8F A;  1Q82 C;  2AGP A;  3UDG A;  2UVR A;  1FGB D;  5EKI A;  2DPJ A;  5JJK A;  1ZHS A;  2I80 A;  2WFW A;  4CDF C;  4LF4 L;  2N78 A;  1TWA A;  3MR6 A;  3BS1 A;  1DXM A;  3QOJ A;  3PQI A;  4L63 B;  1QNU A;  1X65 A;  3U58 A;  1D7Q A;  4JI8 Q;  4Q0F A;  3CCS A;  1EQV A;  5KFV A;  1GLV A;  4B3M H;  3WDN A;  5CBA E;  2KUM A;  1LT6 D;  4X3K A;  3I4M H;  1GSA A;  5KFF A;  3S14 H;  4QWB A;  4DR4 H;  1FD7 D;  4EQP A;  3AFP A;  4IUV A;  4ULL A;  5T1G A;  1R9T B;  2L0C A;  3GTL H;  5JVG 3;  1PH7 A;  3NBH B;  2R7K A;  2V59 A;  3A0J A;  4HMI A;  4F88 A;  5CGK A;  1NTG A;  3V4Z A;  3U4Z A;  4FNF A;  2F0V A;  3I4M G;  1H9M A;  4LMY A;  1T5E A;  1SR3 A;  2LFN A;  4DV7 Q;  4MV1 A;  1IL8 A;  3GTJ A;  1SJH D;  3GDE A;  5FJ8 H;  1F9S A;  3L3O C;  2W6O A;  4IPH A;  2LS0 1;  2RVL A;  3CMA A;  4KMU C;  1LTT D;  1E4G T;  2B63 H;  3M9O B;  1MSH A;  2XCA A;  5HGT A;  2K32 A;  1KJJ A;  3HOY H;  4MHE A;  2YCH A;  2YZG A;  1AN7 A;  1CSQ A;  1A0I A;  1JJC B;  2BDN A;  5K36 G;  2W9C A;  1S5B D;  4NP5 A;  1Q81 C;  4Q0Y A;  1STA A;  4ED0 A;  3TBI B;  3GII A;  4FBU A;  2QDB A;  2NB0 A;  1PTO C;  2UXB Q;  2HHH Q;  1KLU D;  2CQY A;  3J80 W;  5FKA C;  3KF8 A;  2M00 A;  5JOB A;  3HOW H;  3CCJ A;  2NVY H;  1FL0 A;  2LXJ A;  1IOW A;  3G6X A;  1Y1V B;  2KEC A;  4MTN A;  4IUT A;  3TZD A;  1XTC D;  4DR2 L;  1W3S A;  3QO2 A;  2K5N A;  3TQ1 A;  1VAJ A;  1BGW A;  1V51 A;  3K5N A;  2DJG C;  3AB9 A;  2VQE L;  2W9B B;  2EYM A;  2OT2 A;  1LTS D;  3HBL A;  4BY7 H;  4J9P A;  2E2H A;  1G6P A;  4LUO A;  4ZHQ F;  2DY7 A;  3N43 B;  4HN7 A;  1OXT A;  2QA4 A;  4BXX H;  4XYM B;  2W6N A;  2VUM H;  3PUW A;  1D1I A;  2EOT A;  4K6D A;  4JI6 Q;  2E2J H;  1V8Q A;  5HUR A;  2JEI A;  4J1M A;  4DN4 M;  4JI2 L;  4DR4 L;  3G7L A;  1ICW A;  1ZYR C;  1K28 A;  5CBE E;  4XXE A;  2FLP A;  3X3M A;  4RNN A;  5E1F A;  2JSO A;  1XNQ L;  4RAY A;  1G6Z A;  2UXC H;  5LP6 F;  3PUV A;  3L9A X;  3ULL A;  4DR7 L;  2F0N A;  1K9M C;  3OWF A;  1ZXT A;  4BY1 H;  1HNZ Q;  5KG5 A;  4HQ6 A;  2UVV A;  3I91 A;  1FJG L;  3HB9 A;  5EWF A;  1HZA A;  1S5F D;  4AQY Q;  5DQI A;  4B3R Q;  1Z6H A;  2PZT A;  4LUZ A;  1U4R A;  1HNX L;  5BN3 A;  3J81 i;  3OMG A;  1TAE A;  5KFN A;  4IRD A;  1L1O C;  1NSN S;  3M3Y B;  1EYG A;  1IW7 D;  1QUQ B;  2ICI A;  3CCQ A;  4LFC Q;  4YR3 A;  5ELO A;  2N55 A;  5DAU A;  2HD3 A;  3CVZ A;  2EDG A;  4NXM L;  1KNE A;  4RGO S;  5C4J H;  1QVG A;  4JBM A;  5JQW A;  1LLR D;  5KT5 A;  1SEI A;  2QDL A;  4I65 A;  5KFQ A;  4IRC A;  5M3F G;  5IWA Q;  2VUM A;  1DON A;  4HJ7 A;  4ME3 A;  1OXS C;  3HOZ H;  2BA0 A;  4EQN A;  2C2D A;  2HHH L;  3BQ1 A;  4IZO A;  4J9K A;  1VQM A;  3PW5 A;  2W70 A;  2R6F A;  1I6V C;  4H02 A;  5E4X A;  5EPK A;  3K81 C;  4X65 L;  5C5L A;  4KHZ A;  1ZKO A;  4A3D B;  1XMO L;  3GTP A;  1PYB A;  4MV4 A;  1KEE A;  1SBB B;  1TWC B;  1K0R A;  4OIJ A;  2CKZ B;  2Z6B A;  4CDC C;  5FJ8 G;  3OIP A;  5E3F A;  1VQ5 A;  3GLK A;  2ASL A;  1HNX H;  2A69 D;  1KAA A;  3ULP A;  1SE2 A;  2K01 A;  1JIH A;  1M0W A;  3VPB A;  4JBW A;  1HQR D;  2YTY A;  3PV0 A;  2YL2 A;  4ED3 A;  1T3N A;  3RTX A;  4LK1 C;  1QJO A;  1W6J A;  5GQO A;  4BBR B;  3EIV A;  2RGV A;  2W6P A;  1ASZ A;  3R8B A;  3S15 H;  2NZ1 D;  5FO8 B;  1BOS A;  5GAH C;  4RB0 A;  1TWA H;  4YAK B;  1I50 B;  2F0E A;  1IYU A;  2C22 A;  1JDE A;  4JI0 L;  1D1K A;  4DR1 Q;  1H9K A;  3ZJY C;  4IAL A;  4K2L A;  3K59 A;  3GTO H;  4HYK A;  3BZD B;  1TWF A;  1N36 H;  3SE0 A;  2NU6 B;  2A6E D;  3VR5 A;  1F2Z A;  3ND8 A;  4ZLT F;  3LWB A;  1BBW A;  4ZQ3 A;  2K05 A;  4A3L H;  2JA8 H;  2C2R A;  1X3F A;  2BE5 D;  1WTQ A;  4CDE C;  2EYH A;  3KLS A;  1HJP A;  2UUA L;  4OEM B;  1ZHQ A;  5J22 A;  3FMC A;  1C0A A;  3HKZ A;  3AEV A;  4OIK A;  4DNT B;  5BN5 A;  4OX9 H;  1I6H B;  1A62 A;  1HNX Q;  2YU9 H;  4A3L G;  1JMC A;  1QCB D;  4OO1 I;  4C3J G;  3PW7 A;  1ONL A;  1SE3 A;  2RCF A;  3W5O A;  3HOU B;  3SK8 A;  2UUC Q;  2PO4 A;  1PRT C;  4B3T L;  1B4O A;  2VS1 A;  4QQB X;  4DV2 Q;  4B08 A;  2Z8L A;  4PG3 A;  3NHH A;  4H44 C;  2IWH A;  5IP7 G;  3STB D;  4DV5 Q;  3CF5 A;  1I94 H;  4QIW B;  3OW2 A;  2AU0 A;  3SE7 A;  4IUQ A;  2WB1 A;  4RAU C;  1VMP A;  4JW0 A;  3OTO Q;  5KG0 A;  5LHY 1;  3Q8P B;  1O80 A;  5I4D A;  4X64 L;  1TII D;  2IW3 A;  4A3D G;  2LXK A;  4UY8 C;  5D1O A;  4JVZ A;  2KEE A;  3UDI A;  1N8R C;  3GIL A;  4IUU A;  4DL6 A;  1SNC A;  3AYH B;  4CC6 A;  1C9O A;  1RK6 A;  2GPW A;  4JCV E;  1DOL A;  4R9W A;  1EQT A;  1KQS A;  3ERQ A;  2FLN A;  3ETJ A;  4ECZ A;  2GVA A;  2XNA C;  5CV4 A;  4CBV A;  3VR3 A;  1GUW A;  2VXW A;  2L12 A;  4YR2 A;  2YU9 A;  2JA5 A;  1VQC A;  4C3I G;  3OSP A;  2G9D A;  4BBS B;  2R8I A;  2WAQ B;  1FJG H;  4ZUJ A;  3TS0 A;  2B63 A;  3MWY W;  2HIV A;  1DJR D;  4HJ9 A;  4A3I H;  4JV5 H;  4A3G H;  1AUX A;  3HOZ G;  4FF2 A;  3BAA A;  2JP1 A;  5C0X I;  3G6E A;  4R4T A;  1AZQ A;  2UXD L;  4JI0 Q;  1ULZ A;  3BDO A;  5C8Y F;  5E4W C;  5DGA A;  4K8J A;  4E4T A;  2CQA A;  5IYB H;  3T13 A;  4O4L F;  3I4N H;  3W1G A;  3L4K A;  1I7L A;  3KYH C;  5KGU A;  2I0Q A;  1CT1 D;  1RTO A;  4LF6 L;  2B2W C;  4IR9 A;  3E0E A;  3TIN A;  3VR6 A;  3X3N A;  1K0S A;  1M6V A;  4DL4 A;  2K5Q A;  3JAM L;  1S0M A;  4GN3 B;  2I5H A;  4RGT A;  2F0T A;  5C5J A;  4O1N A;  5C0X H;  5M3M G;  3NBH A;  4G7H C;  2DUD A;  1B50 A;  3ETH A;  3CQZ H;  3W1B A;  4I55 F;  1CKN A;  1RF2 D;  3M4O B;  3K80 C;  3OIQ A;  2XWB B;  2ATL A;  4JI5 H;  2B2W A;  2QCP X;  1KJI A;  2NU8 B;  5M5Y B;  1N9W A;  5LMN W;  4RH6 A;  2DJF C;  2Q2U A;  3RZO H;  3J81 L;  3OSN A;  2O4X A;  4A3I B;  2RQX A;  1N32 H;  1F2M A;  1WSC A;  4GLX A;  3GTQ B;  3GO5 A;  1E1O A;  4XT1 B;  4EVO A;  5CC4 A;  4IPG A;  4RGN A;  4PQX A;  5KNC A;  2QF7 A;  4IAJ A;  3GTK A;  2E2J B;  2FK2 A;  2VW9 A;  1QG7 A;  4GKK Q;  1SMX A;  2NTT A;  2Q8R E;  2F0H A;  2MO1 A;  4PMC A;  2ZXO A;  5IGC A;  1FNU A;  3Q2O A;  2MNA A;  3VPC A;  4TVA B;  5EAY A;  4O4H F;  5HY6 A;  1N32 L;  2I5M X;  5D8D A;  4CKE A;  4OX9 L;  4LH7 A;  4CKC A;  4LSX A;  3TQY A;  4DV7 H;  3U9T A;  1TWG B;  4C3I B;  4DV6 L;  1LTA D;  5D65 A;  1EU3 A;  1NNX A;  3MFY A;  5FD6 A;  4A3B G;  3EYY A;  5JVH 3;  1Y1V A;  5I9P A;  1TKW B;  3A8J E;  4X62 H;  1PH3 A;  1IBL H;  2C35 B;  4KKT A;  5IP7 H;  5IY0 A;  1KTK A;  3KUP A;  2K6A A;  2W9B A;  3CRK C;  3MC0 B;  3NWT A;  4JI3 L;  4DR4 Q;  2E2H B;  3ITP A;  2JK8 A;  1LV9 A;  2L4N A;  1I50 H;  4O4I F;  1X55 A;  3W2D A;  1I4P A;  4BA2 I;  2HUG A;  1P8L A;  4NB3 A;  5KFS A;  3BA8 A;  3C0F B;  5KFK A;  2HQE A;  2NVT H;  4Q45 A;  1HR0 H;  3AU7 A;  3VMM A;  5GAG C;  4DR5 L;  2BOS A;  5KFY A;  1VQH A;  1PH9 A;  5D1P A;  5JVL A;  3PIP 3;  3R5H A;  2MQH A;  3HRZ C;  1KJ8 A;  4YR0 A;  1KL9 A;  1X32 A;  1TWG H;  3M4Q A;  4C3I H;  1T36 A;  4WOR A;  2BH2 A;  3RIZ A;  4DR6 Q;  2O03 A;  1UE6 A;  2QGQ A;  3PR5 B;  3A5U A;  4A3I G;  1GD7 A;  1CZW A;  3R23 A;  1RJQ A;  3IFT A;  3RUZ A;  1B6S A;  1MZB A;  2WB1 E;  1JB3 A;  3SI8 A;  1YIJ A;  3I2Z A;  2CH4 W;  3R3O A;  5LMN L;  1IZ6 A;  3CKI B;  3A55 A;  2P0A A;  1QUQ A;  2IPK D;  2K52 A;  3FDT A;  3I7F A;  5DNF A;  4BBR H;  1PLF A;  4DAY B;  4DXG A;  5HGQ A;  5HV6 A;  5C3W A;  2B2V A;  4RCO A;  2Y0S E;  4A3C H;  5KG7 A;  3M9N B;  2JXM B;  1YNN D;  4FF1 A;  2PYK A;  1UE5 A;  1S97 A;  1VQ4 A;  4I4T F;  2SOB A;  2OCE A;  1N32 Q;  1L1O B;  3RZD B;  2W7P A;  1WOC A;  3MVV A;  1IBL L;  3ORR A;  2AQ4 A;  1VQD A;  1M7J A;  2R87 A;  4OGQ C;  3MXG A;  1NAP A;  3RBE A;  3BZC A;  4MA0 A;  2BCO A;  2N88 A;  3MTS A;  1JE5 A;  5GRO A;  3VPD A;  3CU7 A;  3GTJ H;  5AJ3 L;  3K0X A;  1JWM D;  1NJI C;  2KED A;  1NCV A;  3CPW A;  1VQP A;  3GTP B;  4HED A;  2BQ3 A;  4JBJ A;  1XYI A;  3HKS A;  4X66 Q;  1RD9 D;  4ECX A;  1EZ8 A;  2KCC A;  2C28 A;  2ID0 A;  2ZM6 H;  3U50 C;  3RLN A;  3MXN A;  4M1U B;  2HVQ A;  3I55 A;  3H0G G;  2NVQ H;  2HHH H;  3S17 H;  3T5J A;  2IMW P;  2L9H A;  3HKZ E;  3PF4 A;  1CFM A;  3KOJ A;  1I50 A;  4LH6 A;  1E2W A;  3U9S A;  3RB6 A;  1LYL A;  4HSV A;  5FK9 C;  3CC2 A;  4HNT A;  2K5H A;  5C5M A;  2MO0 A;  1MGS A;  5JAV A;  5CB4 F;  1M1K C;  3CC4 A;  3EN2 A;  2RKS A;  4NXM H;  2HDL A;  4ZUI A;  4CJ2 C;  4TQU S;  2JA8 B;  2UVU A;  1OO9 B;  1B44 D;  2XGT A;  4C56 C;  3CQZ A;  1PZJ D;  3H91 A;  2E5L L;  4B3R H;  5M9O A;  4O3N A;  4IFD J;  1VQE A;  1RKN A;  4OL7 A;  1EUC B;  4OWT B;  4BBS H;  1Q86 C;  2CH4 A;  3LX0 A;  4GKJ L;  5J1Z A;  1QZH A;  4RNO A;  2OLS A;  1C48 A;  1IYV A;  1QOH A;  4S3S A;  1YJN A;  5EWG A;  3I4O A;  2K50 A;  1A8V A;  3V2T A;  4R8N A;  3PIO A;  1S3O A;  1C3O A;  1RTN A;  3D3R A;  4BBS G;  4KHP L;  3S2H H;  1LTL A;  4EBE A;  5IT9 E;  2L55 A;  4U67 3;  4MTE A;  3J7A V;  4PDB A;  5IP9 H;  2VQF Q;  3OTO H;  2WB1 B;  2C9O A;  2IHE A;  4QWC A;  1UWV A;  1K73 C;  2W6M A;  4MAM A;  2J6S A;  4POF A;  1N56 A;  2FPG B;  5D1O B;  2ALZ A;  5A2Q L;  2LSS A;  2EY6 A;  4RNM A;  1FNV A;  3VA5 A;  1S10 A;  2RDF A;  3SK5 A;  1WVL A;  5DG7 A;  4KKS A;  1YHQ A;  1LAC A;  3Q8S B;  1LAB A;  2AWO A;  1UEA B;  2AHO B;  3A54 A;  5J2T F;  1OXU A;  4BWS C;  4X66 H;  4YY3 Q;  1JJG A;  5BR8 Q;  1C7Y A;  3S1N B;  3P1H A;  3RFC A;  1GSH A;  2I8C A;  2X6G A;  3TP6 A;  4BBR G;  3RGZ A;  2E8G A;  1CA5 A;  3EPI A;  1D8L A;  3FPP A;  4A3K H;  4Y7N H;  2JA5 B;  3TII A;  2EYJ A;  3IFD A;  4TKO B;  1I4R A;  1E24 A;  2WAQ A;  4IHJ F;  3NSW A;  3MFG A;  2F0G A;  2B63 B;  2A6E C;  2KHJ A;  3RUP A;  3P7J A;  4EG0 A;  3F2D A;  1JT8 A;  4I50 F;  3S2H B;  1SYD A;  3HG9 A;  3GV5 B;  4FXD A;  4DR3 H;  2VZA A;  5EBD A;  3K7A B;  2FP4 B;  4LF6 Q;  3DF7 A;  2WTF A;  1B04 A;  2F52 A;  4WD3 A;  4MN3 A;  2Z6K A;  2M2L A;  4B3T H;  2OTL A;  4ED2 A;  1GKH A;  1SAP A;  2B2U C;  1PH5 A;  2UUB H;  4K5W A;  2MJ8 A;  5KFD A;  1EUJ A;  4JK1 C;  2AUJ D;  4A2A A;  1OXX K;  4IZ8 A;  2KQ3 A;  5EZY F;  1EEI D;  1RIP A;  3S2D H;  2KBN A;  2IHF A;  3J80 L;  3GP7 A;  4R7R A;  3LGJ A;  4MV9 A;  1LTI D;  4OEL B;  3PUZ A;  2YRX A;  3OYY A;  3OOC A;  2HVS A;  3HEJ A;  1VQF A;  2W57 A;  4R8I A;  1KDB A;  2F0K A;  2MP1 A;  1E22 A;  4P73 A;  5FLM H;  3CCE A;  1CQV A;  1D5M C;  1W93 A;  1WCM B;  2K4K A;  1YBY A;  4JI3 H;  5KFL A;  2SEB D;  2E2H H;  2NN6 G;  3DMU A;  5M5W B;  3ER0 A;  4FS2 A;  2J9G A;  2PMZ E;  2QIL A;  2J6T A;  3OHA A;  1CKN B;  2YV5 A;  4C3J H;  5C4J B;  3RV3 A;  5IGD A;  3HGB A;  1TWF H;  2PPB C;  4KJO A;  1EYD A;  3D4W A;  4TSS A;  5KIX A;  2WE6 A;  3RN5 A;  1VQ6 A;  2H5X A;  1R4P B;  1SLJ A;  4P75 A;  4YHH Q;  1I4Q A;  1ML0 D;  4EQO A;  3URY A;  3GTQ A;  2W6Q A;  2V4D A;  3NTK A;  4MIU A;  1MHW C;  1I5F A;  1PRT F;  3K0Y A;  4L5T A;  5FLX W;  2IT1 A;  4DFA A;  5KFP A;  3A5Z B;  2W9A A;  3J7A 5;  1TS4 A;  4DV2 H;  1YZ6 A;  2R92 A;  3MEH A;  4WFN 3;  4L6T B;  4LWC A;  5L37 A;  1HA5 A;  1DYQ A;  4LF8 H;  5L1L A;  4KN7 C;  4Q8F A;  2FK3 A;  4IJH A;  4JI3 Q;  4ID6 A;  3ERS X;  4YWK A;  4WBN F;  4JI7 H;  1TWG A;  1A6X A;  2XVS A;  5KG6 A;  1VQB A;  2FHT A;  2CQO A;  3RF2 A;  3S1R B;  3CHB D;  3I12 A;  1EHI A;  3S1M H;  3MWM A;  3DM3 A;  2EXZ A;  2NZO A;  1ZQ7 A;  4IFD H;  1HNZ H;  2KCM A;  1IL2 A;  2EXD A;  3Q0A A;  1IHZ A;  4ZCK A;  3GV6 A;  1PYS B;  3O13 A;  2GVB A;  3QIA A;  3NXW A;  3FHW A;  4B3M L;  5KT4 A;  1HUN A;  1V4Y A;  1SRU A;  4DR1 H;  4EQ5 A;  1HRJ A;  4EGV A;  4JV1 A;  3JAM c;  4IFD G;  1EY8 A;  3J80 i;  1VQO A;  1A15 A;  4A3G G;  2XCP A;  1HNW H;  1ROD A;  4L5Q A;  2FPI B;  5KFW A;  4LFA Q;  4QW9 A;  2HCC A;  4YJ2 F;  1LUZ A;  4JOI A;  4BS9 A;  1B33 N;  3HOV B;  1CQI B;  5C4X B;  1YEZ A;  4YB8 B;  2ASB A;  3MR2 A;  1E4F T;  3T1Y L;  1FNW A;  1A2T A;  4XQN A;  2ASD A;  3FKI H;  3GTM H;  4GZY C;  1YNN C;  4KHP H;  3ICE A;  2NUA B;  2RDJ A;  3IKJ A;  1HTL D;  4MNO A;  5C6A A;  3J81 j;  4P72 A;  3ERO A;  4DUY L;  4RUA A;  3KHG A;  4DUZ H;  4ECS A;  5DLQ E;  5GAE C;  4A3B B;  3GQC A;  2G9H D;  5JUM A;  2F1M A;  3H15 A;  1SFO B;  1UC8 A;  4L8J A;  2KCN A;  4C2M B;  1Z9F A;  3CP0 A;  4HMJ A;  2AWN A;  2J4X A;  4J9O A;  1KRS A;  3T4A C;  1JXL A;  4XDX A;  4A3F H;  2KHS A;  4QWD A;  2YTX A;  5IYB G;  4WJ4 A;  2QK4 A;  4HJA A;  1N33 H;  4FVM A;  1O75 A;  1K83 A;  1IKM A;  4LAA A;  1H9J A;  2R93 G;  2EJF C;  1GUS A;  5J3B A;  5HBR B;  2HJW A;  4DAY A;  3S17 B;  4G7O C;  5L9X A;  5FPO A;  4O0A A;  2XGP A;  2R93 A;  5KFC A;  4F7X A;  2QKI C;  3HOW B;  1EFW A;  4JYA H;  1NR4 A;  2OEO A;  2Y0S G;  1TU2 B;  1I4G A;  3MJF A;  5ELN A;  2CW0 D;  4DNR B;  3GTL B;  2R7M A;  2ZDG A;  1RHP A;  1UUP A;  5M3M H;  4L5R C;  4IO9 A;  1L1O A;  3PO2 G;  4X3T A;  2SNM A;  4G7Z C;  1U4L A;  4LFB Q;  2JA8 G;  1BVS A;  2PW5 A;  4NPS A;  2D0P A;  2Z1C A;  4I7H A;  4U7C A;  3KXY T;  4PV1 C;  3L0O A;  2B2T A;  4CJ0 B;  1JC7 A;  4DR2 Q;  1IBM L;  2TMP A;  1BKB A;  2RA4 A;  4PZ6 A;  3HP3 A;  4A3G B;  4RMF A;  5CV8 A;  4HJ8 A;  1PTO F;  3NQI A;  2KEN A;  3JC6 6;  1VQ7 A;  3MXN B;  4RHR A;  3EFX D;  3DLL A;  4PWQ A;  3NEN A;  1LM0 A;  3UDX A;  4AYB G;  4DK6 C;  1JJ2 A;  3CC7 A;  3FDS A;  5M5X B;  1NMF A;  1G91 A;  2VB3 X;  3LML A;  1Z47 A;  1PH4 A;  3VYR A;  2I5L X;  1W6K A;  3TS2 A;  1N33 L;  4MA5 A;  1K83 H;  2PNH A;  3KDF B;  1V1O A;  1VQG A;  4HIK A;  3KFU A;  4O42 A;  1TY0 A;  5IGF A;  1WCM G;  1ENA A;  3F2C A;  3F1Z A;  3PW2 A;  1CHQ D;  3RGX A;  1S0O A;  2KVM A;  5M3M B;  5EJW A;  3K5L A;  4A3J B;  4B3S L;  3CXC A;  1E2Z A;  4QJF A;  3HOX G;  4DV0 L;  1J5E H;  3S1N H;  4A3M H;  3CQZ B;  4DR7 Q;  5D3D A;  4GNX C;  3RB0 A;  1CK1 A;  2K1B A;  2XN9 C;  2B2Y C;  4KHP Q;  2GLT A;  2VQD A;  2XIG A;  5IYD H;  2J6U A;  4J9N A;  4RKL A;  1JOO A;  2F3I A;  2X69 A;  3Q8D A;  4B3R L;  1L2F A;  2F0Q A;  2PVP A;  2MPM A;  2FE3 A;  1Y14 B;  2UXB H;  2N3S A;  3I4L A;  1B8A A;  4Q44 A;  3CW2 C;  3G8C A;  4LUV A;  1VBH A;  4RGM A;  1N36 Q;  5C3X A;  2D2C C;  1GUN A;  4YCW A;  4LFC L;  3BVG A;  3H0G B;  2CVR A;  1E7Z A;  2PZW A;  3LWU A;  4KV6 A;  1XMQ H;  3MFI A;  2F3V A;  3T1H H;  2A8V A;  4J9M A;  1OXV A;  4DR3 L;  2WP8 J;  4UPA A;  4JV0 A;  4JBK A;  1A3T A;  2K03 A;  4QCL A;  2KSW A;  1B53 A;  1STG A;  2SDF A;  3Q8R B;  4DR5 H;  1NMG A;  2GPS A;  4HR7 A;  1VQI A;  4ZI7 F;  2ZDQ A;  5LYJ F;  3BQ0 A;  5KFT A;  1PH2 A;  4JI1 Q;  5J2U F;  4LFB L;  1KJ9 A;  1B2T A;  4L1K A;  4TQS A;  1O78 A;  3VYS A;  5C44 H;  4K0K L;  2VA3 A;  5EWE A;  4LF8 L;  1EUD B;  1YNX A;  1JCK B;  2D9U A;  3NPP A;  5T14 A;  5E7N A;  3I72 A;  4DV4 L;  3WO0 A;  3WOE A;  3H4B A;  4UP8 A;  2RHQ B;  3RLO A;  4ECV A;  4LF4 Q;  3A7L A;  1BCP C;  4ZKB B;  2BQR A;  4KTA A;  2JEF A;  3SDZ A;  3GTO B;  1IBM H;  1EYA A;  3MA2 B;  1EIY B;  2JA5 G;  2F3W A;  2KA7 A;  3H94 A;  1E1T A;  5DEH A;  1N33 Q;  4CKB A;  2A6H C;  2CWP A;  1Q1B A;  5JJL A;  1WTW A;  2UVW A;  5FO9 B;  1YI2 A;  3CD6 A;  3G6Y A;  3OSO A;  2E2I H;  5KFZ A;  4MZ9 A;  4YQW A;  1VQK A;  3GTK H;  1VBG A;  4ED7 A;  5KT6 A;  4PMW A;  3RAX A;  3V05 A;  2DIK A;  3MR5 A;  4NW2 A;  5C1P A;  4EFB A;  2ASJ A;  3VYU A;  3D6W A;  2R7D A;  4EYI B;  1Q8I A;  2AGO A;  2E5L H;  5KFB A;  1EY6 A;  1ZEQ X;  4TV8 F;  1WCM A;  4F87 A;  3QR8 A;  3RLF A;  4IFD I;  4MV3 A;  1PRT D;  1WJJ A;  4RWS C;  4DK1 A;  5C0X J;  1D5X C;  3ULJ A;  2UUB L;  3L4J A;  2WKD A;  4LF5 H;  4DK3 C;  2F0O A;  1N36 L;  4B3T Q;  3C46 A;  4EBC A;  4BXX G;  3WO1 A;  4XQJ A;  2VUM G;  2DNE A;  4DR3 Q;  5CA0 F;  2QYZ A;  5IP9 G;  3HOZ B;  4C5A A;  4J9R A;  3I4M B;  2M05 A;  5FD5 A;  1GGO A;  4A2B A;  1A3V A;  1ESR A;  2AUK A;  2E2I B;  5JH7 F;  1CKO A;  1HPC A;  4GKJ H;  3HOV H;  3VA7 A;  2ZJT A;  4ETS A;  4KY7 A;  2JA7 A;  2R92 B;  1E4E A;  4JUZ A;  1TA8 A;  1K8A C;  3U4V A;  3LWE A;  2JA7 H;  3SK6 A;  1AW7 A;  5CV5 A;  1KJQ A;  5KFO A;  2AKW B;  2VQE Q;  4GC6 A;  4LF8 Q;  3NTI A;  3GTP H;  1ZET A;  4HCE A;  1UE7 A;  2F0F A;  2WII B;  1STH A;  3BVZ A;  2BH8 A;  1KRT A;  2HVR A;  2B3G A;  4X62 L;  4A3F B;  3TP8 A;  2Z0S A;  4MTD A;  1A63 A;  1Q12 A;  1HHV A;  5CA1 F;  4LMQ D;  5BPF A;  3A74 A;  4DV3 H;  3H20 A;  2AMC B;  4GOP A;  4JI6 L;  5IYZ F;  5F9L A;  3K58 A;  4YWL A;  1A9X A;  1EYZ A;  3GV7 B;  4CDD C;  1P16 A;  1VQL A;  3JRW A;  2BDO A;  3E9I A;  3HOX B;  5IT9 L;  3K3V A;  2IY5 B;  4LF5 L;  1I7N A;  1XMQ L;  1XXG A;  4JI7 L;  5KFX A;  4LFC H;  1V43 A;  3KK7 A;  2ZM6 L;  3CAM A;  2JEJ A;  2ES2 A;  4FYD A;  4GLA C;  1I4X A;  1Q7Y C;  3S14 B;  1CHP D;  1FJG Q;  1F2L A;  4A3E H;  1SXT A;  3MXP A;  2SNS A;  3UI2 A;  5EQ0 A;  1AEX A;  5IYC H;  2I46 A;  2E74 C;  2MGS A;  3SR1 A;  3IRB A;  3QG1 A;  5I2X A;  3H40 A;  1RYR A;  4LFB H;  3VDY A;  1FYC A;  3D6C A;  4U68 A;  3TRZ A;  3T16 A;  5ELC A;  1U5K A;  5DQG A;  4Y7N B;  3EPG A;  4R1J A;  4FO2 A;  1PX2 A;  4LSA A;  1SFO A;  3QB3 A;  1IW7 C;  4IPC A;  2UXC Q;  1HXY D;  4C2M A;  4FXK C;  2ZJP A;  1KAW A;  1STN A;  4NXM Q;  2QEX A;  2UUB Q;  3T1H Q;  3G6V A;  2EPB A;  2B29 A;  2EIF A;  3I3C A;  4ED8 A;  2EJM A;  3RV4 A;  5IT9 c;  4QUC A;  1K83 B;  1RK5 A;  3KAK A;  1Q46 A;  1SYC A;  3E0J A;  4QWE A;  1S5C D;  3FEW X;  4ECT A;  2K7V A;  2R93 B;  3M7N A;  4GKK L;  5K36 H;  4JI5 Q;  3G6J B;  5EBC A;  3TDQ A;  1EEF D;  1TXY A;  4QY7 A;  2IA6 A;  3PUX A;  3FP9 A;  4F8M A;  3AMU A;  2HT1 A;  3LNN A;  1K3R A;  4HSP A;  5KFR A;  4UCV A;  2R82 A;  5CV9 A;  3GTL A;  1GYF A;  4YY3 H;  2RSN A;  3SVM A;  1G51 A;  1ZYR D;  3M9B A;  3T5H A;  1V1P A;  2NWG A;  2N49 A;  4XIG S;  4OX9 Q;  1DOM A;  1Y1W G;  3PO3 B;  1I3Q A;  3UFX B;  1HA6 A;  1O7I A;  2VNU D;  4O2A F;  3J81 W;  2PMZ A;  5COR A;  2E2D C;  1GUT A;  3E9H A;  4C3J B;  2CWA A;  1VQN A;  5KT2 A;  3NE5 B;  3DM1 A;  1QB5 D;  1SMY D;  1WYD A;  2R6G A;  3TZU A;  5H80 A;  4EGJ A;  1O7Z A;  2RBM A;  1SYB A;  5LXT F;  1I94 L;  5L1K A;  1M8A A;  4XX0 B;  1HNW Q;  1ILQ A;  4H0L C;  1CS0 A;  4G4K A;  4Q8E A;  3JAM W;  3F2B A;  4DA2 A;  3P75 A;  4LF5 Q;  5CAE B;  4AYB E;  1QVF A;  3BJU A;  3KDF A;  5FOB B;  1KC7 A;  1KLG D;  4ODG A;  4J15 A;  2EZV A;  4TV9 F;  1HZB A;  2NUC A;  1VQA A;  2Y0S A;  3ND9 A;  2QW7 A;  2ZXR A;  2FIN B;  1WD0 A;  2EY5 A;  4B9X A;  1PYW D;  4GNX B;  1BXT A;  3BZK A;  1RJR A;  4AIM A;  4ZOL F;  4ZAI A;  1IBK Q;  3JRX A;  1UC9 A;  1L0Y B;  2BA1 A;  3PO3 H;  5KYL A;  5C44 B;  4ED1 A;  2D62 A;  3JSL A;  2R7L A;  4DR6 L;  2L15 A;  5BN4 A;  1V9P A;  2UXC L;  4EGQ A;  5JEA J;  4DF7 A;  3PF5 A;  3T1H L;  4RZQ A;  1X3P A;  4NXN H;  2WAC A;  1RDP D;  2D5D A;  2ZJQ A;  3UQ8 A;  3NK9 A;  3K7A H;  3ZYY X;  5IWA H;  1F9P A;  5LMN Q;  5C4Z A;  4C3H G;  1QZG A;  1TWH H;  2TSS A;  2UXD H;  2W8K A;  1GUG A;  2NVX H;  3H0G A;  2RSO A;  3BDC A;  2XIW A;  3S9W A;  4UCO A;  3QJY A;  5KG4 A;  5IYC G;  5ISR A;  4C3H B;  3C3L A;  4RU9 A;  3KBG A;  4EBD A;  2K33 A;  3DEP A;  5I9O A;  1B9N A;  4K5X A;  2EYO A;  1TS5 A;  4LNQ A;  2XGQ A;  4HR7 B;  3H09 A;  3UDF A;  4GN5 A;  1NR2 A;  4JG2 A;  4KJN A;  4DLK A;  1IBL Q;  2PW7 A;  1HCZ A;  1SE4 A;  1VDZ A;  3S1M B;  2BQU A;  2B63 G;  1XNR Q;  3Q6S A;  1S9F A;  3PW4 A;  4K6L A;  4JI1 H;  5DLF A;  1EIF A;  5K2M A;  4ED6 A;  5LL6 X;  3A56 A;  4ECY A;  4DL5 A;  5FLM G;  2FK1 A;  1G29 1;  3E3X A;  3KLW A;  3CCM A;  4X66 L;  2B39 A;  3WNZ A;  1X6O A;  4QF4 A;  5JPN C;  1ET6 A;  1AP0 A;  1VS0 A;  1EZ1 A;  4JI2 Q;  3H3V H;  3RMH A;  4ECQ A;  4JI4 L;  1EOV A;  1Z2O X;  4EEY A;  1HZC A;  1XNQ Q;  3GTO A;  1KBL A;  1CM9 A;  2VUG A;  1DIK A;  1SCU B;  5IIF A;  1EOT A;  1A2U A;  5FLX L;  4JC0 A;  2IX3 A;  3S24 A;  5T1I A;  1HNZ L;  1F77 A;  2WB1 G;  1GM5 A;  2YS7 A;  1AUV A;  4BY7 G;  1YVC A;  4O3P A;  2DLN A;  1EWI A;  3BQ2 A;  5DLG A;  2KJX A;  1TWC H;  1ESF A;  2OH2 A;  4KD3 A;  5KG1 A;  2C5C A;  4EYH B;  3BA9 A;  1EWH A;  1IBK L;  3K57 A;  4C2M H;  4C5C A;  1N34 H;  3T51 B;  1OTC A;  2R84 A;  1PFM A;  2R7Z A;  4A75 A;  4A3B H;  2A5H A;  2EVB A;  1QVC A;  2OF1 A;  4DPG A;  2EE1 A;  3KLR A;  1CE8 A;  2RF4 A;  4RUC A;  2FPP B;  4OO1 G;  4ME5 A;  3VR4 A;  4LF7 Q;  3GIM A;  4J9L A;  2F0U A;  3U9O A;  3G4S A;  1UNN C;  4IWX A;  5EDW A;  2FMA A;  1WTV A;  1K3B C;  4AYB A;  4K2K A;  2JEG A;  4LF4 H;  4OO1 H;  4RKB A;  1GUO A;  1GJX A;  5C3E G;  2CFM A;  1LTR D;  2XTI A;  1Q1E A;  3VYT A;  4GC7 A;  1II3 A;  2Z6K C;  2FLL A;  3K5M A;  3B6Y A;  4DV1 L;  2KOL A;  4X65 Q;  2K5W A;  4DR2 H;  3GIP A;  1XMO Q;  4DV6 Q;  2JA9 A;  3OW7 A;  4Y52 H;  3GIJ A;  1PFS A;  4UFZ A;  4X62 Q;  2E2I A;  4RHS A;  5EPL A;  1JDB B;  2JA7 B;  1LT5 D;  1JWS D;  5CR3 A;  4E6I A;  1I6H H;  2X6L A;  2JJQ A;  2Q8I B;  4OWW B;  1E4E B;  5F9N A;  3NTH A;  4QB4 A;  3ONA B;  4ABN A;  3CCR A;  3T1Y H;  3K8A A;  1AE3 A;  2FJZ A;  3F8T A;  3N6R A;  1XMO H;  1VQJ A;  2EYP A;  2R7Z H;  1HH2 P;  3GQB A;  4P71 A;  3Q23 A;  1J8I A;  3CCV A;  4KHV A;  1WTH A;  3K3P A;  3I4N G;  3EJI A;  5BR8 L;  4JI8 L;  1PV4 A;  1MIU A;  3J81 c;  1ILP A;  2DNC A;  4J9S A;  2YZM A;  1XMQ Q;  4TUY F;  4WJ3 M;  1JLL B;  3DWA A;  1LT4 D;  2JQO A;  2CZG A;  1VQ8 A;  1VF7 A;  4GOP B;  4BA1 I;  2JEA I;  4DL7 A;  4GN4 B;  3L2P A;  2ATW A;  1YNJ C;  2F0P A;  2JN4 A;  4A93 B;  2IP4 A;  5A2Q W;  4NLG A;  1Y8P B;  4P74 A;  1K8O A;  4A3C G;  1H9S B;  2BE5 C;  3RR5 A;  3MZ5 A;  3DHQ A;  4IJL A;  3S2D B;  4TQR A;  5A35 A;  5CYU A;  3F8N A;  3BG5 A;  2UUC H;  2QEJ C;  1YJ9 A;  2UUA Q;  4IQZ A;  4RA8 A;  2A68 D;  2R61 A;  5BR8 H;  3RBD A;  3HXL A;  3R2I A;  4GOP C;  1B6R A;  4J8Q A;  4DV1 H;  1YJW A;  4A3M B;  1FKA H;  5A2Q E;  3M9M B;  3OUU A;  2UUA H;  2ALY B;  3NWS A;  3OUZ A;  2UUC L;  4R4O A;  3PO2 B;  4RZR A;  2RDH A;  4NMZ A;  1CUK A;  3P20 A;  4LF7 L;  3EQL C;  2JA5 H;  5C0X G;  2YTV A;  3RNU A;  1ICF B;  2PI2 E;  1AH9 A;  3SEB A;  4Q5V A;  2F0W A;  2GN5 A;  3K5O A;  5ELF A;  1PVO A;  4Q43 A;  1UNS A;  4DU9 A;  5KYI A;  2NVT B;  4R4I A;  4PNY A;  3KLS X;  4JI5 L;  5M5X H;  4JI0 H;  3QZ8 A;  4POG A;  4JYA L;  2A68 C;  4CC5 A;  5DM6 3;  4JI2 H;  3H0G H;  2NVX A;  2F4V H;  2VPQ A;  2WKC A;  2XD4 A;  5I6W A;  1O7Y A;  1CSP A;  5LOV F;  4YHH L;  2NBF A;  4MV6 A;  4K5V A;  1KAB A;  5FO7 B;  3BVM A;  1XPR A;  2G5D A;  1EU4 A;  2JA6 H;  3HOU G;  5C4X G;  3G71 A;  2ICE C;  1CQJ B;  4R8U A;  4EFE A;  2DPI A;  1EQR A;  3GIK A;  1V1P B;  1WR2 A;  3NP8 A;  1I3Q B;  4A3K B;  3NQT A;  1HNW L;  4IN3 A;  2DN8 A;  2PMZ B;  4H13 C;  1IYJ B;  2A6H D;  5GON F;  4NDX A;  4C1N K;  4XT3 B;  5G3L D;  4JPB W;  4OHJ A;  2UXD Q;  1K8M A;  1WD1 A;  4B9W A;  3PMF A;  3H3V C;  5CV7 A;  2F0J A;  3N44 B;  3GTG B;  4O3Q A;  2IX1 A;  2YS6 A;  4M7E A;  1HR0 Q;  1MSG A;  1WH2 A;  4IOC A;  1BCP D;  1PTO H;  4ZQI A;  4A3J G;  3N52 A;  1CQF A;  1XX8 A;  4O3S A;  4AQY L;  2F0D A;  4LW1 A;  1J6Q A;  1JR0 D;  2R3Z A;  2F0S A;  4A76 A;  5CMD A;  1E0B A;  2VY3 A;  3R5F A;  4A3M G;  1WTR A;  3OWE B;  3I73 A;  4F4X A;  1LO5 D;  3IAY A;  1X3Q A;  5TSS A;  1IBK H;  2Y0S B;  1EY0 A;  3TSS A;  4IUN A;  4X3S A;  1JOR A;  3KBX A;  5KG2 A;  2L5T A;  4IUP A;  2OQ0 A;  4GNX A;  2IX0 A;  3N42 B;  4GKJ Q;  4RB2 C;  4ZYS A;  4X64 H;  5JEA H;  3J7Y W;  3S1R H;  2EJG C;  5M5W H;  1KD1 C;  3MFH A;  5LA6 F;  1JIC A;  1I3Q H;  1I6U A;  2PQA B;  3DEO A;  1JB7 A;  1DM0 B;  2B8G A;  2F4V L;  2WDT A;  4K8I A;  3KAJ A;  3AQQ A;  5JEA G;  5D14 A;  3JZI A;  1U0L A;  5KND A;  2V9W A;  4LF6 H;  4HJ5 A;  3TIG A;  4UDU C;  5DQH A;  1IXR A;  2R7N A;  1ENC A;  5GAD C;  1UAP A;  2H4O A;  1EY4 A;  1CZG A;  3K6O A;  1MBY A;  2ZTD A;  2VL6 A;  3FRP B;  1DZ1 A;  2PZU A;  1N48 A;  1QNK A;  1D6E C;  1TS2 A;  3T5L A;  2EY1 A;  4V0B A;  3RZD H;  1BXR A;  1SEB D;  3GTM A;  3C2P A;  1PZK D;  2DGY A;  3D4D A;  1PTO D;  1XNR H;  1VMC A;  3KF6 B;  1HTP A;  3RD4 A;  1IKL A;  3GD7 A;  5KFI A;  1DV2 A;  1PH6 A;  2DY8 A;  4DR6 H;  3FKI B;  2PBZ A;  2ZDH A;  1EYC A;  4LF9 Q;  5FLX c;  3DXJ C;  3QZ7 A;  4B3S H;  3NBI A;  1A3U A;  3HOY G;  4UHV A;  2ZTC A;  2IBK A;  2RCN A;  3PIO 3;  2YYA A;  2OQK A;  2I87 A;  2F0I A;  4QMG A;  1S4Z A;  4DR1 L;  1XPU A;  2B2Y A;  3KTM A;  4IRK A;  4KKU A;  4UCU A;  5KEE A;  4DAM A;  1YNJ D;  4CHT B;  2Q2H A;  4OXP A;  2SCU B;  1JE4 A;  3EBE A;  5C4H A;  1Y69 U;  1W2B A;  1IBM Q;  4Y8V B;  4OON A;  5ELD A;  2R86 A;  2LKV A;  3PN1 A;  4PZ7 A;  3J7A K;  5CV6 A;  2VQF H;  2ZJR A;  4N8X 1;  3D31 A;  2RDG A;  3ORQ A;  1K1Q A;  2RHS B;  1PH1 A;  2NU7 B;  1EWC A;  2XRQ D;  1FR3 A;  1WI5 A;  5DG8 A; 
#chains in the Genus database with same CATH homology
 1XMQ L;  3MEF A;  3I4M H;  4JI7 L;  3S14 H;  1V43 A;  4TQU S;  2ZM6 L;  3CAM A;  3AFP A;  2ES2 A;  1S72 A;  2XGT A;  4GLA C;  1Q7Y C;  1B7Y B;  1FJG Q;  3PGZ A;  4A3E H;  1PH7 A;  3GTL H;  2R92 H;  3NBH B;  3A0J A;  2E5L L;  1NTG A;  5IYC H;  3U4Z A;  3I4M G;  3IRB A;  4IFD J;  1VQE A;  2N8N A;  4OWT B;  4BBS H;  1Q86 C;  3VDY A;  1YHA A;  1SR3 A;  2Q2I A;  4DV7 Q;  4GKJ L;  1QZH A;  3TRZ A;  1U5K A;  3GDE A;  5FJ8 H;  2JA7 G;  2R92 G;  4R1J A;  3OTO L;  1YJN A;  4IPH A;  3I4O A;  2K50 A;  3CMA A;  4IPC A;  1A8V A;  2B63 H;  1XJV A;  2UXC Q;  3PIO A;  1S3O A;  1WFQ A;  2ZJP A;  1KAW A;  2F4V Q;  4NXM Q;  4BBS G;  2QEX A;  2UUB Q;  3HOY H;  4KHP L;  3S2H H;  3T1H Q;  1LTL A;  4O2D A;  2B29 A;  2EIF A;  1X3G A;  1CSQ A;  1A0I A;  1JJC B;  5IP9 H;  5K36 G;  5IT9 c;  2VQF Q;  1Q81 C;  4BY1 G;  4NXN L;  1Q46 A;  2IHE A;  2UXB Q;  2HHH Q;  4HID A;  1UWV A;  1K73 C;  3HOW H;  4POF A;  1SN8 A;  3CCJ A;  3M7N A;  4GKK L;  2LSS A;  4JI5 Q;  2NVY H;  4QY7 A;  1TXY A;  1X56 A;  1FL0 A;  2LXJ A;  4ALP A;  4IOA A;  4MTN A;  1N34 L;  3PUX A;  3FP9 A;  4UP7 A;  3PO3 G;  1R9T H;  1XPO A;  1K3R A;  4A3K G;  5AJ3 Q;  1YHQ A;  3CCL A;  4DR2 L;  1W3S A;  2HT1 A;  2K5N A;  2AWO A;  2AHO B;  1G51 A;  3M9B A;  1OXU A;  4YY3 Q;  2VQE L;  1JJG A;  3AFQ A;  5BR8 Q;  2N49 A;  4XIG S;  4DUZ Q;  1C7Y A;  4OX9 Q;  1Y1W G;  4A3E G;  1O7I A;  2Q2T A;  4BY7 H;  5M5Y H;  4BBR G;  2VNU D;  1G6P A;  2E8G A;  4LUO A;  1D8L A;  4A3K H;  4Y7N H;  3M4O H;  3E9H A;  2CWA A;  1VQN A;  3CME A;  2QA4 A;  1OXT A;  4BXX H;  1E24 A;  1GO3 E;  4K0K Q;  2VUM H;  3PUW A;  4QIW E;  1WYD A;  2R6G A;  1BBU A;  2KHJ A;  3CPF A;  3F2D A;  4JI6 Q;  2E2J H;  1JT8 A;  2VZA A;  4JI2 L;  3UE1 A;  4DR4 L;  1I94 L;  4LF6 Q;  2F52 A;  4DV4 Q;  1HNW Q;  3S16 H;  2Z6K A;  2OTL A;  1GKH A;  3F2B A;  1PH5 A;  4LFA L;  5JJI A;  4LF5 Q;  1XNQ L;  4RG1 A;  1EUJ A;  3NEL A;  4A93 H;  3PUV A;  4AYB E;  1QVF A;  3UE0 A;  3BJU A;  1NY4 A;  3ULL A;  4DR7 L;  1AE2 A;  1OXX K;  3KDF A;  1RIP A;  3S2D H;  2KBN A;  2IHF A;  1UE1 A;  1K9M C;  4J15 A;  3LGJ A;  1HNZ Q;  1HZB A;  4BY1 H;  1VQA A;  3PUZ A;  3T1Y Q;  1FJG L;  3OYY A;  1VQF A;  1HZA A;  2E5L Q;  4AQY Q;  4A93 G;  3PSI A;  4GNX B;  4B3R Q;  1E22 A;  4P73 A;  3BZK A;  4LUZ A;  5FLM H;  3CCE A;  4DUY Q;  4AIM A;  1PH8 A;  1HNX L;  2K4K A;  1IBK Q;  1YBY A;  3J81 i;  2BA1 A;  3PO3 H;  1L1O C;  2E2H H;  2NN6 G;  1EYG A;  2D62 A;  3ER0 A;  2PMZ E;  1QUQ B;  4LFC Q;  3CCQ A;  1KC8 C;  4DR6 L;  1CKN B;  2L15 A;  2YV5 A;  5ELO A;  4C3J H;  1V9P A;  2UXC L;  4JYA Q;  5JEA J;  4NXM L;  1TWF H;  2UU9 L;  3PF5 A;  5C4J H;  3T1H L;  1QVG A;  4JBM A;  3RN5 A;  1VQ6 A;  1VQ9 A;  1B70 B;  2A1A A;  2H5X A;  2ZJQ A;  1SLJ A;  3K7A H;  4P75 A;  5IWA Q;  4YHH Q;  5M3F G;  3HOW G;  5LMN Q;  1QZG A;  4NXN Q;  4HJ7 A;  4ME3 A;  3J80 c;  1OXS C;  1I5F A;  1TWH H;  2BA0 A;  3HKZ G;  3JAM i;  3HOZ H;  2HHH L;  4L5T A;  4DV3 Q;  2IT1 A;  2NVX H;  3A5Z B;  1VQM A;  3STB C;  3J7A 5;  4JV5 L;  1YZ6 A;  5IYC G;  4A3D H;  4H02 A;  1ASY A;  4EX5 A;  3K81 C;  4X65 L;  4LWC A;  4KHZ A;  1N34 Q;  1XMO L;  1PYB A;  4B3T L;  1MJE A;  2IY5 B;  1Y1W H;  4LNQ A;  2K14 A;  3UDF A;  2CKZ B;  1K0R A;  4GN5 A;  4IJH A;  3ERS X;  4YWK A;  5FJ8 G;  4JI3 Q;  4JG2 A;  1VQ5 A;  1IBL Q;  3ULP A;  1VQB A;  2B63 G;  2CQO A;  1XNR Q;  4JBW A;  3J7Z C;  3S1M H;  1EIF A;  2YTY A;  3DM3 A;  3PV0 A;  2NZO A;  2KCM A;  5FLM G;  5GQO A;  1IL2 A;  2EXD A;  1H95 A;  1HR0 L;  3EIV A;  4DR5 Q;  1ASZ A;  3S15 H;  1G29 1;  3KLW A;  3CCM A;  1PYS B;  4X66 L;  5GAH C;  1TWA H;  4QL5 A;  1X6O A;  2GVB A;  3FHW A;  4B3M L;  1VS0 A;  1T9H A;  2KHI A;  2OTJ A;  4JI2 Q;  1SRU A;  3RN2 A;  4EQ5 A;  4JI0 L;  3H3V H;  3JAM c;  4IFD G;  3J80 i;  4DR1 Q;  1VQO A;  1MKH A;  4JI4 L;  3ZJY C;  1PA6 A;  1X54 A;  3GTO H;  4A3G G;  1EOV A;  4L5Q A;  4LFA Q;  1HZC A;  1XNQ Q;  1LUZ A;  1BBW A;  2EQS A;  4JOI A;  4L5S A;  4A3L H;  5M3F H;  1X9N A;  1NE3 A;  2JA8 H;  2K5V A;  4JC0 A;  1X3F A;  1YEZ A;  3S24 A;  4C3H H;  1HNZ L;  3D0F A;  2ASB A;  2WB1 G;  3T1Y L;  1GM5 A;  1HJP A;  4KI0 A;  2UUA L;  4BY7 G;  1YVC A;  3FKI H;  4YCU A;  3GTM H;  1EWI A;  1C0A A;  3ICE A;  3AEV A;  2R7Z G;  2NN6 I;  3J81 j;  1TWC H;  4MNO A;  4DUY L;  4P72 A;  4JI7 Q;  1A62 A;  1HNX Q;  2YU9 H;  4APV A;  5DLQ E;  4A3L G;  1JMC A;  5GAE C;  1IBK L;  1UEB A;  4KLK A;  4YWM A;  4C2M H;  4OO1 I;  3NEM A;  3H15 A;  1OTC A;  3W5O A;  4OWX B;  1Z9F A;  3CP0 A;  4A75 A;  2UUC Q;  4A3B H;  3FKI G;  1QVC A;  2AWN A;  4DPG A;  3KJP A;  2VS1 A;  1SFO H;  2RF4 A;  3L7Z C;  4DV2 Q;  4QQB X;  1KRS A;  4PG3 A;  4OO1 G;  4DV5 Q;  5IP7 G;  4A3F H;  3STB D;  4LF7 Q;  3CF5 A;  2YTX A;  5IYB G;  1EQQ A;  4WJ4 A;  1GVP A;  4HJA A;  2UU9 Q;  3OW2 A;  3G4S A;  2PQA A;  2R93 G;  3PUY A;  4PZ8 A;  5J3B A;  3OTO Q;  3KF8 B;  4X64 L;  4A3D G;  4GLV B;  4O0A A;  2LXK A;  4FDB A;  4UY8 C;  3UDI A;  1DGS A;  5C3E G;  1N8R C;  2CFM A;  1EFW A;  4JV5 Q;  2XTI A;  1Q1E A;  2Y0S G;  2R93 H;  3AYH B;  2Z6K C;  1C9O A;  5ELN A;  1S40 A;  2YYZ A;  3B6Y A;  4DV1 L;  2HQL A;  4LF9 L;  5M3M H;  4HIM A;  4X65 Q;  4L5R C;  4JCV E;  1MJC A;  1L1O A;  4IO9 A;  1XMO Q;  3PO2 G;  1KQS A;  4DV6 Q;  2JA9 A;  3TRE A;  2GVA A;  4Y52 H;  1PFS A;  4X62 Q;  4LFB Q;  2JA8 G;  1X3E A;  1BVS A;  1I6H H;  3KF6 A;  2JJQ A;  4OWW B;  4NPS A;  2D0P A;  1VQC A;  3L0O A;  3CCR A;  3K8A A;  1AE3 A;  2V1C C;  3F8T A;  3KJO A;  3PO2 H;  3WWV A;  3TS2 A;  1VQJ A;  4DR2 Q;  3TS0 A;  1IBM L;  2HIV A;  2R7Z H;  1BKB A;  1HH2 P;  4P71 A;  4HJ9 A;  1YHB A;  3HOU H;  3CCV A;  4PZ6 A;  4RMF A;  2MFI A;  4HJ8 A;  3I4N G;  5LMU L;  5BR8 L;  4A3I H;  4JI8 L;  4XTC S;  1PV4 A;  2KEN A;  3JC6 6;  1CKM A;  1MIU A;  3J81 c;  1VQ7 A;  3HOZ G;  5H1S E;  3MXN B;  4A3G H;  4B3M Q;  1XMQ Q;  5C0X I;  3G6E A;  4R4T A;  3DLL A;  2UXD L;  4JI0 Q;  4WJ3 M;  3NEN A;  1LM0 A;  3UDX A;  4AYB G;  2JQO A;  4DK6 C;  2JEB I;  3CC7 A;  1JJ2 A;  1NMF A;  1VQ8 A;  4GOP B;  4BA1 I;  1L0W A;  5IYB H;  1Z47 A;  1PH4 A;  2FXQ A;  2JEA I;  4GN4 B;  2I5L X;  3L2P A;  2ATW A;  3W1G A;  3I4N H;  3HOX H;  1HZ9 A;  1N33 L;  2PNH A;  1K83 H;  2NZH A;  1KHI A;  1VQG A;  1Y1V G;  1RL2 A;  1V1Q A;  1XTD A;  2R7F A;  3KDF B;  4HIK A;  4P74 A;  1KIX A;  2I0Q A;  2HIX A;  3KFU A;  1WCM G;  4A3C G;  3RR5 A;  1I94 Q;  4LF6 L;  3F2C A;  3F1Z A;  4IJL A;  4A3J H;  2JA6 G;  3E0E A;  2OWO A;  4YCV A;  1YJ9 A;  4B3S L;  3BU2 A;  2JE6 I;  2UUA Q;  3CXC A;  4QJF A;  3HOX G;  4GN3 B;  4DV0 L;  1Y1V H;  1NBW A;  2I5H A;  4A3M H;  4GOP C;  3S1N H;  4DNI A;  4DR7 Q;  1WCM H;  4IPD A;  5M3M G;  1YJW A;  4GNX C;  2DUD A;  3CQZ H;  2PI2 A;  1YIT A;  4KHP Q;  3W1B A;  1CKN A;  2ALY B;  3K80 C;  1FVI A;  5IYD H;  2UUC L;  4R4O A;  3Q8D A;  1N9W A;  2F3I A;  4DKA C;  5LMN W;  4B3R L;  1L2F A;  1CUK A;  2VQF L;  2Q2U A;  3RZO H;  4LF7 L;  2JA5 H;  1Y14 B;  5C0X G;  2YTV A;  2N3S A;  2KCT A;  1B8A A;  2PI2 E;  3RNU A;  3CW2 C;  1AH9 A;  4LUV A;  4GLX A;  2GN5 A;  3GO5 A;  1E1O A;  1PVO A;  4IPG A;  4R4C A;  1N36 Q;  4YCW A;  4LFC L;  4R4I A;  5C3E H;  2VW9 A;  3GTQ H;  4GKK Q;  1SMX A;  4JI5 L;  5M5X H;  1E7Z A;  4POG A;  4JYA L;  2MO1 A;  2A8V A;  1OXV A;  3H0G H;  4DR3 L;  2MNA A;  4GS3 A;  4TVA B;  2WP8 J;  4UPA A;  5EAY A;  4JBK A;  5HY6 A;  1N32 L;  2I5M X;  3M4P A;  1CSP A;  4YHH L;  4YY3 L;  5IWA L;  1NMG A;  4DUZ L;  1VQI A;  4OX9 L;  3TQY A;  4DV6 L;  2K75 A;  1PH2 A;  4JI1 Q;  1XPR A;  1K8G A;  4A3B G;  4LFB L;  2JA6 H;  3HOU G;  5C4X G;  5C44 H;  1PH3 A;  4K0K L;  3G71 A;  2C35 B;  5IP7 H;  4A3F G;  4LF8 L;  5IY0 A;  2ZTE A;  1YNX A;  1J5E L;  1Q8K A;  1EQR A;  4JI3 L;  4DR4 Q;  5E7N A;  1E3P A;  4DV4 L;  1HNW L;  2JK8 A;  5LMU Q;  4UP8 A;  1HR0 W;  1IYJ B;  1I50 H;  2RHQ B;  3RLO A;  5C44 G;  2A19 A;  1X55 A;  1XNR L;  4BA2 I;  4LF4 Q;  1P8L A;  4NB3 A;  2UXD Q;  4AH6 A;  2NVT H;  2IX1 A;  1HR0 Q;  1VCI A;  5GAG C;  4DR5 L;  4IOC A;  2CCZ A;  1EIY B;  2WAQ E;  2JA5 G;  1E1T A;  4A3J G;  3GTG H;  1N33 Q;  1VQH A;  2CWP A;  1Q1B A;  1PH9 A;  5JJL A;  1YI2 A;  3K7U C;  4A4I A;  4AQY L;  3CD6 A;  4LW1 A;  1J6Q A;  4A76 A;  2E2I H;  4MZ9 A;  2VY3 A;  2ZM6 Q;  4A3M G;  2MQH A;  4JI4 Q;  1VQK A;  3S1Q H;  3GTK H;  4B3S Q;  1KL9 A;  3PIP A;  1TWG H;  3M4Q A;  4PMW A;  4C3I H;  4QGU A;  4DV0 Q;  3G48 A;  2BH2 A;  4DR6 Q;  1UE6 A;  2QGQ A;  3A5U A;  2R7D A;  4A3I G;  1GD7 A;  1FGU A;  2OQ0 A;  4R4Q A;  4GNX A;  2IX0 A;  4DV7 L;  4GKJ Q;  2WB1 E;  3S1R H;  5M5W H;  1KD1 C;  3M3Y H;  1PHJ A;  3RLF A;  4IFD I;  4JOI C;  1I3Q H;  3I2Z A;  1YIJ A;  3CCU A;  2PQA B;  1WJJ A;  5LMN L;  1IZ6 A;  1JB7 A;  3H3V I;  5C0X J;  2F4V L;  1QUQ A;  3I7F A;  2K52 A;  3ULJ A;  4BBR H;  4DAY B;  5HGQ A;  4DV3 L;  2UUB L;  4DK3 C;  1N36 L;  3TEH B;  4HIO A;  3AQQ A;  5JEA G;  4B3T Q;  2Y0S E;  4A3C H;  1M90 C;  4DV2 L;  4BXX G;  1U0L A;  2VUM G;  3HOV G;  4DV5 L;  4HJ5 A;  4X6A H;  1IXR A;  5IE8 A;  4DR3 Q;  1UE5 A;  5GAD C;  1VQ4 A;  5IP9 G;  1SRO A;  2UXB L;  2OCE A;  1N32 Q;  1L1O B;  2ZTD A;  2VL6 A;  1WOC A;  1IBL L;  3KYH C;  1VQD A;  1CKO A;  1SE8 A;  3SGI A;  3PCO B;  4X64 Q;  3M85 A;  3BZC A;  2WAQ G;  3RZD H;  3HOV H;  4UP9 A;  2DGY A;  5C4X H;  1JE5 A;  5GRO A;  3KF6 B;  3HFZ B;  4JI1 L;  5AJ3 L;  3K0X A;  3GTJ H;  3U4V A;  5IYD G;  1K8A C;  3GD7 A;  1NJI C;  2JA7 H;  1KXL A;  3CPW A;  1PH6 A;  1VQP A;  2AKW B;  2VQE Q;  2D0O A;  4DV1 Q;  4JBJ A;  4LF9 Q;  4LF8 Q;  3HKS A;  4X66 Q;  5FLX c;  3GTP H;  1UE7 A;  1J5E Q;  3I56 A;  3HOY G;  2BH8 A;  2ZTC A;  1KRT A;  2RCN A;  2B3G A;  2ID0 A;  1Q82 C;  4X62 L;  2OQK A;  3UDG A;  2Z0S A;  3U50 C;  3RLN A;  1A63 A;  4DR1 L;  1Q12 A;  1XPU A;  5JJK A;  2WFW A;  3A74 A;  4DAM A;  3I55 A;  2AMC B;  2Q2H A;  3H0G G;  4OXP A;  2N78 A;  4GOP A;  4JI6 L;  4LF4 L;  3EBE A;  2NVQ H;  3S17 H;  4YWL A;  3HKZ E;  1W2B A;  1IBM Q;  4OON A;  3PF4 A;  3KOJ A;  4PZ7 A;  1P16 A;  1VQL A;  2ZJR A;  1LYL A;  1X65 A;  3D31 A;  3CC2 A;  3U58 A;  2K5H A;  2RHS B;  2MO0 A;  3E9I A;  4JI8 Q;  3CCS A;  1PH1 A;  1D7Q A;  1M1K C;  3CC4 A;  1WI5 A;  3EN2 A;  4LF5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...