2R93G

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 25
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r93G01
2WB1E 4LF9Q 2C35B 1GM5A 1N33L 5JJKA 4B3ML 1LYLA 2B63G 4JBKA 1HZBA 1IBKQ 2KENA 4LF7Q 3I56A 5GQOA 1I94L 5BR8Q 1IL2A 4X65L 4YCWA 2JA6H 3HOWG 3PIOA 5M5YH 5GAGC 3AFQA 3OTOQ 1HNZL 3JAMi 3DLLA 4DR3L 1NE3A 2F4VQ 3G6EA 3S14H 5C44H 3J81j 1X55A 3FKIH 2KCMA 4A3BH 1PYSB 2JA8G 2N49A 1M1KC 4KI0A 1IYJB 4P74A 5FJ8H 3JC66 2UUCL 3S15H 2K5NA 1EYGA 4GLAC 4BY1G 1FJGQ 2K4KA 4A3JH 4JI2L 2I0QA 1VQ4A 1NY4A 3H15A 1YITA 4JI7Q 4MNOA 1JB7A 1BVSA 3A74A 2PI2E 3FHWA 1VQNA 5C4JH 4OX9L 4AH6A 3ERSX 1IBLL 3PO2H 3M4OH 4JG2A 4POFA 1OTCA 3GTKH 4JC0A 2CWAA 3ULJA 3CC2A 3PUYA 2K5VA 4JI3L 1QVFA 4OO1G 4LF4L 2CKZB 1OXUA 4IPGA 1GD7A 4DR1L 4A3FH 3GTOH 1XNQQ 2ASBA 1N8RC 1YJ9A 2AWNA 2HIVA 4PZ7A 4AQYL 1A0IA 2PQAB 3KJOA 3AFPA 1AE2A 1YBYA 1L1OC 2L15A 4FDBA 4TVAB 1G51A 1OXSC 1YHQA 1PH7A 4OWWB 3CCQA 2B3GA 5IYDG 3BZKA 5LMNW 1PVOA 3FP9A 3PUZA 2UXCQ 1C0AA 1SROA 3H0GG 3WWVA 3UDGA 2NVTH 3A0JA 4A3GG 2JJQA 4PZ6A 1TWFH 3KFUA 4BA1I 4JYAL 3PUXA 5C3EG 4BBSH 2MNAA 2NZHA 4LFBL 4BXXH 3GTQH 1LM0A 3I7FA 4HIOA 3AEVA 3TQYA 2K5HA 1EWIA 3UE0A 1VQCA 3EN2A 4GKKQ 2R92H 5K36G 1IBML 2ZTCA 1E22A 1KC8C 4X64Q 2IHFA 3W5OA 4LUVA 4B3TQ 5IWAQ 2GN5A 4DR7Q 3UE1A 1AH9A 4UPAA 4X62Q 2HHHQ 3L7ZC 4A76A 4LF6Q 1XMQL 3STBC 4RMFA 1NJIC 4JI8L 3KDFA 1J5EL 4C2MH 1YJWA 3T1YL 3I4OA 1W3SA 2K75A 4DV6Q 3JAMc 2E2IH 4BA2I 4A3DH 4A3CG 3RZDH 4KHPQ 3J81i 3HOYG 1PH4A 5IT9c 1UE7A 4B3SL 3D0FA 1E24A 5GROA 2WAQE 1EOVA 3TRZA 1CKMA 1Q7YC 1XNRQ 4LNQA 2VQFL 4A3IG 1ASYA 2NZOA 5IYCH 1N33Q 4R4QA 4B3MQ 2HT1A 2JA9A 4GKJL 5IP7G 2F3IA 4GNXB 1KAWA 2UXDQ 2VUMH 1L1OA 1Q82C 4R1JA 2QEXA 1YHBA 2VS1A 1TWAH 2EXDA 2AMCB 1OXXK 1WCMH 1I5FA 4IO9A 4LF5L 2V1CC 1AE3A 4P75A 3HOZH 2ZJRA 4RG1A 3J7A5 1W2BA 1HNXL 2R93G 3GO5A 2OQKA 3ULPA 2ZTEA 2EQSA 4IFDJ 1SRUA 3UDXA 2YTYA 2Y0SE 1PYBA 4DAMA 4B3RL 4KLKA 4GN5A 1SLJA 2JA7G 4O0AA 3TS2A 3CCUA 2ALYB 3KF6A 4JI2Q 4GOPA 4QQBX 1XMOL 2B63H 1WJJA 5C0XJ 1UE6A 3CCMA 3HOWH 1G291 3ICEA 4OX9Q 1JJ2A 4IPHA 2UXBQ 4IPCA 4A3LG 1GO3E 1Q1EA 1Z47A 1JT8A 1RIPA 1V1QA 3BJUA 5IE8A 1E7ZA 1EFWA 1I3QH 1CKNA 5JEAG 3F2BA 1N36Q 2F52A 4JI3Q 2BA1A 3KJPA 1HR0L 4DNIA 4JI6L 2JA8H 5DLQE 2Q2HA 3UDIA 4OO1I 4BY1H 2VY3A 1YJNA 5E7NA 3M3YH 3K80C 1N9WA 1UWVA 4JI5L 4R4TA 3K7UC 2WB1G 1K83H 1HJPA 3E9HA 4LFCL 1PH1A 1KRSA 1VS0A 2E8GA 3OW2A 1HH2P 4IPDA 1K8GA 4JYAQ 4GLVB 4J15A 3I4MG 1VQ9A 4DPGA 5LMUL 1YNXA 3RLNA 1JJGA 5C4XH 3CCVA 3J80c 1QUQB 3J81c 1G6PA 4P73A 1DGSA 1VQMA 2AWOA 4DUYQ 1B70B 1OXTA 2XGTA 3K0XA 3UDFA 1VQGA 5FLXc 3U4VA 5H1SE 1P16A 4R4IA 1IBMQ 3GTGH 4X66L 4JV5Q 5IYDH 3H0GH 4GLXA 2VQEL 4BBRG 1KIXA 1MJEA 3CD6A 4A3GH 4MZ9A 1XMQQ 4DV4Q 4HJ9A 4MTNA 2A8VA 2LXJA 5C3EH 1TXYA 1J5EQ 2PQAA 4GNXC 3T1YQ 2ES2A 2UUAQ 4O2DA 1C7YA 5ELOA 2JE6I 1L0WA 3RNUA 3CW2C 4AYBG 4LUOA 3GDEA 3D31A 1IZ6A 2OQ0A 3PGZA 4DV5Q 3CQZH 4NPSA 1K9MC 4DR4L 4A93G 2JA5G 2VQFQ 5IP9G 1YVCA 2QA4A 4YHHL 4JI1Q 1GVPA 4X6AH 1BBUA 1PV4A 4DV2Q 3PF4A 3MXNB 4BY7G 4JI0Q 5IY0A 2RF4A 4JI4Q 2R7ZG 4A3CH 1N32L 4K0KL 4DAYB 2CWPA 4APVA 3HOYH 2Z6KC 4LF8Q 4QGUA 3EBEA 1FGUA 1NBWA 3M4PA 1PH3A 1HNXQ 3NENA 3S1RH 3PO3G 2MFIA 4DV1L 1MIUA 1SE8A 4YY3Q 1VQFA 2I5HA 4A3IH 3PIPA 4QY7A 3GTJH 4DV7Q 2OTJA 1LTLA 2BH2A 5IP7H 3CAMA 3U58A 1PH6A 4NXNL 3J7ZC 1Y1VG 1VQLA 4WJ4A 1SN8A 1Q1BA 4A3EG 3S1NH 3HOXG 1K0RA 1BKBA 1Y1WH 4HJ7A 1E3PA 3KF8B 2PI2A 4ME3A 2JEBI 4OONA 4DUZL 3T1HL 2XTIA 4R4OA 1PA6A 1HR0Q 2IY5B 2N8NA 2Q2UA 5AJ3L 2DUDA 3L2PA 4DV3L 5EAYA 4GNXA 2JA7H 1V43A 1X56A 1Q12A 2QGQA 2CCZA 2AKWB 3AQQA 1J6QA 2K52A 1N34L 1T9HA 2VZAA 1D8LA 2B29A 4PMWA 1QVGA 2OTLA 4LWCA 4HJAA 2WAQG 2VL6A 4L5QA 1EQQA 3J80i 3PUWA 5M3MG 4JI5Q 4XIGS 4A3LH 4LFCQ 3NBHB 1IBKL 3PUVA 2A19A 4DK3C 5BR8L 4DR2Q 3CCLA 3G4SA 3HFZB 1MKHA 3OTOL 3OYYA 4NXML 2BH8A 4JCVE 5LMUQ 2F4VL 4DR5L 1OXVA 1VQEA 1D7QA 2WFWA 1I94Q 1E1TA 1WFQA 4X65Q 1Q46A 4JOIC 3K8AA 1QZHA 1HNZQ 1X3FA 4PG3A 4LW1A 4DR3Q 3F2CA 1BBWA 4YWKA 3CC4A 3A5ZB 2Y0SG 1VQBA 2VQEQ 3A5UA 3I2ZA 1NMFA 1TWHH 2VW9A 2OCEA 1KRTA 3CPWA 3ER0A 1VQIA 1HZAA 2UU9L 2UUCQ 3I4MH 3CC7A 5JJLA 1V9PA 3HKZE 3LGJA 3PSIA 3W1GA 3CF5A 4JBMA 4JBWA 2RHSB 3CCSA 4A3MG 5IYBG 4IOAA 3S24A 5ELNA 4BBSG 1M90C 1FVIA 1PH2A 1EUJA 1IBLQ 4C3IH 2LXKA 1XPOA 5JJIA 2UUBL 3KDFB 4Y7NH 3CCRA 4BBRH 3DM3A 4YHHQ 4A3KG 2I5LX 3G71A 3RR5A 1CKOA 4LF4Q 1XPUA 4DR1Q 5LMNL 4KHZA 3K81C 1QUQA 2UXCL 2CQOA 4AQYQ 1KXLA 1Y14B 1JJCB 4L5TA 5GADC 1N32Q 3STBD 4K0KQ 4GN4B 1WYDA 1X65A 3PCOB 4TQUS 3ZJYC 1VQ8A 2MO1A 1X54A 1YEZA 3U50C 2HQLA 1I50H 3GD7A 1S40A 3M7NA 3PF5A 4AIMA 2JA5H 2ATWA 4A93H 3IRBA 5IP9H 3CCEA 2FXQA 1JE5A 1LUZA 4GKKL 5M3FG 4LFBQ 4UP8A 1HZCA 4UP9A 1X3EA 4BY7H 3HOVG 4B3TL 4Y52H 3KYHC 4DR7L 2PNHA 2I5MX 4P71A 4DR2L 3RN5A 2R7ZH 4X62L 3F1ZA 2ZM6L 4EQ5A 2YTXA 2D62A 1ASZA 4A4IA 3M9BA 1S72A 3KLWA 3T1HQ 4GOPB 3HOUG 3S16H 4DKAC 4C3HH 1QZGA 3PO3H 5AJ3Q 4DV3Q 4HJ8A 1VQ6A 2D0PA 4QJFA 2R93H 1N34Q 4JI8Q 1H95A 1A63A 4PZ8A 1A8VA 1VQJA 3TEHB 2Q2IA 4YCUA 1Y1VH 1CSPA 2IT1A 1XNRL 2NN6G 2YU9H 1B8AA 4A3EH 3MEFA 2YYZA 3HOXH 3I4NG 2RHQB 4B3SQ 2KHIA 3E9IA 1SFOH 2ZJPA 2UXDL 1MJCA 1JMCA 5HY6A 2IHEA 2Z0SA 4GS3A 2NVYH 1X3GA 4YWLA 3F2DA 4NXMQ 2N3SA 5J3BA 3CMEA 4DR5Q 4GKJQ 1VQHA 4OXPA 3RLFA 1B7YB 4JBJA 2CFMA 2JQOA 2PMZE 4DR6L 1A62A 2YTVA 2H5XA 1UE1A 5M3MH 1YHAA 1L2FA 4HIMA 4LF5Q 4YCVA 2ID0A 1CSQA 2KCTA 1VQPA 2OWOA 4WJ3M 4LFAL 1HNWL 2UXBL 1WOCA 3SGIA 4B3RQ 5JEAJ 1P8LA 2UU9Q 1UEBA 5FLMG 3W1BA 4AYBE 2EIFA 1XMOQ 2NVQH 2IX1A 1X9NA 3VDYA 4IFDG 4HIDA 4DV0L 4A75A 1U5KA 3GTPH 1N36L 1GKHA 2E5LL 1TWCH 4IJHA 1WI5A 2ZTDA 3TREA 2ZJQA 2UUBQ 3AYHB 5C4XG 5C0XG 3G48A 3KOJA 4LUZA 4IJLA 2JA6G 4JI6Q 1IXRA 1K73C 3BU2A 1EQRA 4OWXB 2D0OA 1PH5A 1HR0W 2NVXH 4P72A 5LMNQ 3ULLA 1NMGA 5C44G 1PHJA 1Q8KA 3FKIG 2JK8A 3I55A 1PH9A 4YWMA 1YIJA 4A3BG 1C9OA 2IX0A 3PV0A 1QVCA 4A3MH 3CPFA 5IYBH 1R9TH 5FJ8G 4LF9L 1NTGA 4A3JG 4GOPC 3S1MH 1YI2A 4LF7L 2JEAI 4A3KH 4DUYL 3S17H 1VQOA 3PO2G 2VNUD 4JV5L 1EIFA 2GVBA 3CP0A 1HZ9A 3E0EA 2ZM6Q 4GN3B 1UE5A 2Z6KA 4QL5A 4DV4L 2KBNA 4A3FG 2E2HH 4X66Q 3RN2A 1VQDA 1U0LA 1FJGL 2UUAL 4UP7A 5GAEC 1TWGH 4JI7L 4UY8C 3HKZG 4OWTB 3B6YA 3BZCA 5M3FH 4ALPA 1K3RA 4POGA 1XJVA 2HIXA 3Q8DA 2E2JH 1YZ6A 1K8AC 4DV5L 1RL2A 3GTMH 3HOVH 3S1QH 5HGQA 5M5XH 4JI1L 3CXCA 2R7FA 2R6GA 1S3OA 2NN6I 1CUKA 2GVAA 2BA0A 4L5SA 1XNQL 3NELA 4DV2L 3CCJA 4BXXG 4DR4Q 1O7IA 2LSSA 3RLOA 3M85A 3HOUH 3M4QA 4JI0L 2AHOB 4JI4L 1Y1WG 1KHIA 2R92G 3RZOH 2RCNA 4LF8L 4EX5A 4HJ5A 5M5WH 3H3VI 4DR6Q 2MO0A 1SR3A 4DK6C 1VQ7A 4YY3L 1Z9FA 4L5RC 4R4CA 4DV7L 1XTDA 3HKSA 3I4NH 1KQSA 1Q81C 4LFAQ 1HNWQ 1I6HH 4DV1Q 4A3DG 4IOCA 1L1OB 5GAHC 1EIYB 1VQKA 1VQ5A 2K14A 1VCIA 3S2HH 3NEMA 1FL0A 4HIKA 3H3VH 2Q2TA 1E1OA 4DV0Q 2DGYA 3GTLH 1PFSA 2E5LQ 4X64L 4NXNQ 4JOIA 5IWAL 2YV5A 4IFDI 5IYCG 2K50A 4NB3A 2HHHL 4LF6L 2N78A 1SMXA 3F8TA 3U4ZA 3S2DH 3CMAA 3EIVA 2KHJA 2WP8J 4DUZQ 2VUMG 3KF6B 4QIWE 4H02A 5C0XI 2A1AA 4DV6L 1XPRA 4KHPL 1X6OA 2R7DA 1KL9A 1VQAA 1WCMG 4C3JH 1PH8A 5FLMH 1KD1C 3HOZG 3K7AH 3TS0A 1Q86C 3L0OA 1CKNB 4XTCS 2MQHA
chains in the Genus database with same CATH superfamily
5BN5A 5IGEA 4LF9Q 1B04A 1S10A 2C35B 1DZ1A 2PO4A 3S15B 1RF2D 2SDFA 4LF7Q 4R9WA 2BE5D 4QUCA 1IBKQ 2JA6H 4DV0H 1L0XB 3HOWG 2FMMA 4KV6A 2X6GA 5GAGC 3AFQA 3OTOQ 1PTOC 3T5JA 5C1OA 3Q8RB 4EBEA 1YNND 1JR0D 3FKIH 3K5IA 1TS5A 4O2BF 3NWSA 5L1LA 3BA8A 2E2IA 5EKIA 3JC66 5BN4A 3S15H 4K2KA 4BY1G 1FJGQ 3BQ2A 4FO2A 4PDBA 4JI2L 2V5AA 1ESRA 1BCPF 4JI7Q 4MNOA 4DXFA 1BR9A 4Q44A 1Z6HA 5ELEA 4OX9L 1FKAH 3RMHA 2O4XA 1OTCA 4ZCKA 4MV8A 4C1NK 4KKUA 3JRXA 3RJ0A 2VUGA 4JI3L 1UAPA 3AMUA 4DUYH 2R7MA 4LF4L 2CKZB 4DR1L 2PZUA 1GD7A 1GUSA 4J0MA 4AQYL 5IGBA 5CGKA 4KY6A 4FDBA 2L15A 1YHQA 4ED2A 1DJRD 1EY9A 4ED8A 1SROA 1B44D 2NVTH 4Q0FA 4A3GG 1G91A 4RGMA 3RAQA 2PN1A 3HP3A 4QF4A 5C5MA 5LP6F 2C28A 2RSOA 4HR7A 2QILA 4M8AA 3AEVA 2DN8A 3FVQA 5KFCA 3TQYA 2K5HA 1EWIA 4CHTB 2R92H 5K36G 2ZTCA 1XNQH 4DV2H 4EGVA 1E22A 5FD6A 3KTMA 5KFAA 5IWAQ 2GN5A 3H94A 4FBUA 4UPAA 3KHRA 4X62Q 2SEBD 4G7ZC 3GTMB 3L7ZC 1KJIA 4AYBA 2Z6BA 4B08A 5M5XB 2CH4W 1NJIC 4K6LA 1SEIA 4C2MH 1YJWA 3T1YL 3I4OA 3I4LA 4DV6Q 2VUMB 4A3DH 4KY7A 4EQNA 5JPMC 3J81i 3AB9A 1UE7A 3D0FA 2WAQE 5E4XA 3RB4A 3KHHA 2HGSA 4A3IG 2HT1A 5KFYA 4R4QA 3PMFA 4GKKH 3GTGA 3MA2B 1LTRD 2VUMH 4DR7H 3R93A 2I07B 4F88A 2QEXA 1Y8OB 4LF6H 1GUNA 5JVDF 4LF5L 5A2QE 2R93G 4RG1A 1HNXL 3S2HB 1HQMC 1Y8NB 2A68C 2K6AA 3HB9A 4RAYA 1PYBA 5KFNA 1C8CA 3KF6A 2FK2A 4G3IA 5C0XJ 1RJPA 4IPCA 4A3LG 2R7LA 1Q1EA 4B3MH 1Z47A 4IWXA 1MBYA 2EY2A 1HHVA 2C2DA 2HVSA 3OPOA 2A6HC 1N36Q 2H4OA 1HR0L 5DLQE 2MPMA 2KUMA 1JWUD 4OO1I 2VY3A 1YJNA 1BCPD 2NWGA 1STYA 1N9WA 2A6EC 3GILA 5E1FA 4JI5L 3K7UC 2RBMA 1HJPA 4IUTA 4RB3C 1Y8PB 1K8GA 1NR2A 3MHBA 3HGBA 2YS7A 4DPGA 1SBBB 2F0PA 5C5LA 4DL3A 3J80c 1QUQB 1SNOA 3J81c 4P73A 1EY0A 3N40P 2NVXA 3N43B 1B70B 2XGTA 2FK1A 1IBMQ 3UDFA 4R4IA 4C3IG 1RDPD 3N6RA 5C4JB 3M4OB 4RNOA 4MZ9A 1XMQQ 1STGA 1TA8A 2IA6A 3BVZA 3MXGA 5C3EH 3J7AV 1TXYA 1IKLA 4ODGA 4O2DA 1I7LA 2VB3X 5DLGA 1SYBA 3RBEA 4UFZA 1IKMA 3D31A 4JYAH 4I65A 3K3VA 5IGCA 1F2ZA 2PNRC 5CAEB 3Q23A 2L55A 2W9AA 1CK1A 4A93G 4EEYA 3K5OA 5JQWA 5FO8B 2E2HA 2B39A 3MXNB 4BY7G 2RDGA 1GSHA 3VYRA 1RTNA 1TQOA 4MTEA 5I4DA 4A3CH 1N32L 4DAYB 4DV4H 2CWPA 3HOYH 4QWDA 4DK1A 4OHJA 3WO1A 5L1KA 5I9OA 1J5EH 3NENA 1BJTA 4C3HG 2MFIA 3H09A 2HVRA 3Q24A 1SXTA 1VQFA 1I4HA 5J2TF 4QY7A 3DEPA 3NK9A 4HAEA 3R8BA 2JEGA 5HURA 1L0YB 2JSOA 3SK4A 2GLTA 2I46A 3J7ZC 2VQFH 5FOBB 2H1EA 4DNTB 2QK4A 2E2IB 3X3NA 4A3EG 3HOXG 3KHLA 4ED3A 1D6EC 1E3PA 2PI2A 2NTSA 4DUZL 1PZJD 3T1HL 1PA6A 2K04A 4JI0H 2N8NA 2Q2UA 2EYHA 3L2PA 2JEFA 4GNXA 3H20A 3PF4A 1Q12A 1J6QA 1O7ZA 1SE3A 2K52A 2G5DA 3I70A 1U4LA 1KC7A 4QMGA 1RCVD 1T9HA 1TVXA 4PMWA 1VBGA 5EOYA 1WVLA 4ECVA 1BUVT 4DV7H 3Q0AA 4LFCQ 2EYOA 2F0TA 1ICWA 4JV1A 2DY8A 2F0JA 4YR3A 2B8FA 2DZDA 3OUZA 1VQEA 3D4DA 3G6YA 1E1TA 1BXTA 3JZIA 1IOWA 1EUDB 1TY0A 3K8AA 4G7OC 1EY4A 1QNKA 3HOWB 2ASLA 2XGQA 2F1MA 4JV2A 1VQBA 3KAJA 3A5UA 4HR7B 2F0EA 2DJFC 4OEMB 3ER0A 1V1PB 3VYUA 3CC7A 1V9PA 3HKZE 3CRKC 3VR6A 3PSIA 3BS1A 3W1GA 4BY1B 2NUAB 4CGYB 2RHSB 4DR2H 1SNQA 5ELNA 4AYBB 4BBSG 3MR2A 5LMUH 2PYKA 4YR2A 4I7HA 2PW7A 1K83B 1I94H 3DM3A 4CKBA 2K28A 4DU9A 4YHHQ 1I4GA 3G71A 4X65H 4LF4Q 4DR1Q 2X69A 1GGOA 1ZETA 4AQYQ 1LTBD 4YB8B 2VQEH 4EBDA 1HA6A 3STBD 4ED1A 3EVQA 4V0BA 1WYDA 1KTKA 3PCOB 1B6RA 4HNTA 1GHKA 1X54A 4K8IA 4GC6A 2HQLA 1OWTA 3GTGB 5JJZA 3GIMA 2QDBA 3R3OA 1OO9B 2EJMA 2GPSA 1SYGA 3CCEA 2F03A 4A3GB 1KJQA 2FXQA 4GKKL 4UP9A 3NTHA 3TIIA 3HOVG 2V4QA 3ETJA 4DR7L 2W9CB 3RN5A 4IRDA 5L1IA 4A4IA 3I73A 1CS0A 1S72A 3GIQA 4ULLA 5FK9C 3HOUG 2CZGA 3HZXA 5CC4A 5LL6X 5CV6A 4HJ8A 2XCPA 4K0KH 2D0PA 4IALA 3RUPA 2FMCA 1N34Q 1EY6A 3GTQA 3KK7A 1Y1VH 1Z2OX 2SOBA 5DQGA 4TV9F 5C4ZA 2FPPB 5EGTA 1B8AA 5L1JA 5KFHA 5JVH3 3TQTA 3HRZC 4LH6A 2M00A 3E9IA 4CC5A 1MJCA 4BS9A 2IHEA 3TP5A 3JAML 1BXRA 4TV8F 3Q8SB 2N3SA 3CMEA 4A3IB 3D4WA 5ELDA 4ZKCB 2NVQB 4JBJA 3G8CA 4MA0A 4DL7A 4HNVA 2GPWA 4IRKA 1BNCA 4HIMA 4KKSA 4LF5Q 1SMYC 3V2TA 2ID0A 1EL0A 4R8UA 2VA3A 2R93B 1WOCA 4NW2A 3SGIA 4CDCC 5JEAJ 2UU9Q 2M9VA 2NVXB 2B2UA 2NVQH 3GIKA 4B3SH 1VDZA 3VDYA 1SNCA 2DNCA 4HIDA 4IFDG 3A8JE 3N41B 1WI5A 2ZTDA 3NBHA 3TREA 2ZJQA 4DR5H 2EVBA 1WCMA 4ME6A 1B4OA 2CH4A 2RDIA 1J9OA 2VB2X 3KOJA 4LUZA 2JA6G 4J9RA 4IUVA 4KHVA 1PTOD 2NVXH 3BU2A 1O78A 4EBCA 5CV5A 4P72A 2G9DA 1GUWA 4IR1A 4QIWB 2R84A 1PHJA 1Q8KA 3FKIG 3ORRA 4YWMA 2B63A 2KECA 1FNWA 1K3BC 3OMCA 1QVCA 1W93A 2OLSA 4LF9L 5DM63 2O5IC 1RK5A 4GOPC 2OEOA 2JXMB 4EGQA 4LF7L 4A3KH 3R5HA 4QW8A 3SI8A 1XWEA 1KJ9A 2XVSA 2UUBH 2GVBA 5M3FB 3C46A 3CP0A 4XYLB 4CC6A 1HZ9A 4JI6H 2ZM6Q 2XD4A 4GN3B 1G2SA 1UE5A 4QL5A 4DV4L 5LMNH 2BDNA 2E2HH 3T56B 3RN2A 2HVQA 2AQ1B 2WACA 1FJGL 4NMZA 4XXEA 4C3IB 1WTWA 4JI7L 2NU7B 2V4DA 3K0YA 1AN7A 1PTOB 4ZOLF 3BZCA 5FLXL 3I90A 5M3FH 3BDLA 3FDTA 1K3RA 5CB4F 2E2JH 4DV5L 1T5EA 3S1QH 2KJXA 1SYXB 2JA6A 2TMPA 2R7FA 1BQQT 2DY7A 2NN6I 2GVAA 5D14A 2HD3A 3J80E 1MHWC 3NELA 3J81E 3CCJA 1HTPA 2VPSA 2LSSA 3M9OB 3FKIA 3H0GA 4RFBA 2KEDA 4JI0L 2AHOB 2WYOA 4ZYSA 4A93B 2DWCA 2R92G 2HCIA 4EX5A 4JV0A 4FS2A 4BY7B 4C5CA 1EU4A 1EOTA 4DK6C 1PMRA 1VQ7A 4F4ZA 4DV7L 4O4HF 1Q81C 2EYJA 1EY7A 4A3DG 1CE8A 1A6XA 4C3HB 3VR5A 3NEMA 2FP4B 2Q2TA 3GTLH 4DV0Q 1M7JA 3NE5B 5JAVA 5IWAL 3ND8A 2YV5A 1O75A 5KFQA 4ZK9B 1GHJA 5KT5A 4RCNA 4A3EB 4DUZQ 3HOXB 2VUMG 2FLNA 5FPRA 3SK6A 2NYZD 4LJZC 1EHIA 2A1AA 4DV6L 1XPRA 4HCSA 1PH8A 5FLMH 3K7AH 2A68D 4MV3A 5C44B 3KXYT 4LFAH 2K03A 4Q45A 1Q86C 2UXBH 4RA8A 4DR2L 1FD7D 2AGQA 4XTCS 2BOSA 2WB1E 2SNSA 3Q22A 5KG5A 1AN8A 2BDOA 2D5DA 1GM5A 3R2TA 1VMPA 3MR5A 3L9AX 5C0XH 4JBKA 1HZBA 5I2YA 1IL2A 1I94L 5GQOA 4I55F 2E5LH 2FKLA 4X65L 3PIOA 1B53A 5A2QW 5M5YH 2HQEA 5E3FA 1A15A 5KFUA 3DLLA 1NE3A 3S14H 3NSWA 5C44H 5KG6A 3J81j 2EJFC 2A6HD 2UVUA 4X3SA 2KCMA 2YCHA 4DNRB 3GTPB 1GSOA 4ED7A 3KF8A 4CKCA 1TWCB 2K4KA 2K5QA 1VQ4A 1QOHA 2A6ED 4LAAA 1VQNA 2CW0C 3KBXA 5EPJA 3BG3A 3OUUA 5GONF 3UFXB 3PW5A 5KFTA 3PO2H 4JC0A 3H3VC 2LFNA 4MA5A 3DHQA 3CC2A 2K5VA 1XYIA 3HG9A 2X0SA 4Q5VA 1FYCA 1O80A 4IPGA 4RAUC 1XNQQ 4BBSB 2WB1A 1M0WA 1JKJB 2PQAB 1E4FT 3AFPA 3GTQB 1TWHA 1OXSC 1T5XD 5TSSA 4OWWB 1CFMA 1TS2A 5LMNW 1CQJB 3S17B 3FP9A 3M9NB 5HV6A 4F4XA 2UUAH 3V6KA 1S5CD 3A0JA 3KFUA 4ZRZA 4IQZA 1Z2PX 1ML0D 2W6MA 5C3EG 4BBSH 2MNAA 2NZHA 4BXXH 2R87A 3GTQH 1LM0A 5KFGA 5CMDA 2A74C 4GKKQ 4HSPA 1LTAD 4TKOB 1IBML 3OSPA 5HBRB 3OWEB 4MIUA 1EZ6A 1C4QA 1QG7A 4LUVA 4DR7Q 2W8KA 4J9SA 3MFHA 3HOVB 1B2TA 5J1ZA 1TIID 4LF6Q 1XMQL 3IG0A 1S5DD 3STBC 4RMFA 3OSNA 1U4RA 1A2TA 2F0DA 4JI8L 2UXCH 3QZ8A 2C00A 3KDFA 2K75A 4A3CG 2JA5A 5J22A 3RZDH 3HOUB 3HOYG 5KYLA 3V4ZA 3WDNA 4B3SL 1V1OA 3RZOB 2ZDGA 1EOVA 1CKMA 1Q7YC 2K7VA 4LNQA 2F0HA 4MAMA 4B3MQ 2W7OA 2AUKA 4GKJL 3WOEA 3KUPA 1MGSA 4UCRA 4QB4A 4X64H 1L1OA 3QO2A 3DXJC 3OMGA 3N8DA 4G7HC 2HHHH 2VS1A 1UUPA 2EXDA 2NU9B 2UVVA 1WCMH 2E76C 4IO9A 1U4MA 1LABA 1W2BA 3PW0A 3MFYA 2OQKA 4DL4A 1ENAA 2FJ2A 3K59A 1MI2A 4KHPH 2Y0SE 4B3RL 1QCBD 5T14A 4EYIB 2YU9A 4GN5A 4PWQA 1S5FD 4O0AA 1JQYD 4GOPA 2L4NA 2B63H 1XNRH 5KFXA 5KFMA 1WTQA 1N33H 1QWYA 4LK1C 2HDLA 1CKNA 3F2BA 4JI6L 2F52A 1W96A 2BA1A 3KJPA 2R8JA 2JA8H 1XX8A 2Q2HA 1ENFA 1N48A 3P20A 4KK7A 1WTXA 2WINB 2DLNA 3GV7B 5E7NA 2XIGA 3K80C 2JA6B 5CORA 1UWVA 4R4TA 4DAVA 1EFID 3E9HA 4LFCL 1PH1A 5L9XA 1KRSA 1X3PA 3K5NA 2E8GA 1PFBA 3FKIB 2R8KA 4IPDA 4O3RA 4JYAQ 3W3AA 4C56C 4GLVB 2KA7A 3IL8A 2O03A 3U9TA 3RLNA 1JJGA 3KBGA 1LT6D 3W2DA 3K58A 1R4PB 3NUCA 2ASBA 1VQGA 2KHSA 3U4VA 1P16A 1EU3A 5IYDH 2OT2A 2WIIB 4Q0YA 5EPLA 3MFGA 3H0GH 3J7AK 4XYQA 1B33N 4DV4Q 2Z4IA 1KJ8A 2X6LA 2A8VA 4RUAA 1KLGD 3M4YA 1J5EQ 1LTGD 4J9PA 4GNXC 2ES2A 5C4HA 3CW2C 4AYBG 3DEOA 4F50A 4IURA 1TS4A 5KFBA 4IWYA 3PGZA 4DV5Q 1ZXTA 4NPSA 1K9MC 3MWEA 5KT3A 5HGTA 2VQFQ 1XTCD 2RKSA 2FMAA 2NVTB 4YHHL 1BBXC 5KG2A 5KNBA 5DG8A 5KKNB 3EPGA 4IUUA 3PZPA 4JI0Q 2EY1A 2RF4A 2XN9C 5IY0A 3V6HA 1KDAA 4A2AA 4QGUA 1HFNA 1FGUA 4RH6A 3MWYW 2R92B 5CV8A 4RHRA 2DNEA 3S1RH 5D1OA 4QWAA 4R8NA 5KG4A 3BJYA 5IT9E 4FXDA 3A7LA 3IAYA 3PIPA 4DV7Q 2OTJA 1S97A 1E0BA 3BG5A 1PH6A 3U58A 5I6WA 4ECZA 1JC7A 1Y1VG 2XRQD 4C2MB 1SN8A 1Q1BA 4TQRA 4KD3A 4A3DB 1BKBA 3R5XA 2JN4A 3KF8B 4NLGA 4OONA 5DNFA 4RUCA 1X3QA 2DUDA 2KEEA 2EYLA 4DL5A 1SJED 1X56A 2QGQA 2CCZA 1N34L 3AQQA 5H80A 4PQXA 1S0OA 3QZ7A 3KALA 4LWCA 4RKLA 2WAQG 4HJAA 2VL6A 1M6VA 4YY3H 3J80i 3PUWA 1SMYD 4XIGS 2K5DA 2J4XA 2K33A 3MTSA 2F0LA 4B9XA 2A19A 1C3OA 5JEAH 4DR2Q 3NQIA 2BH8A 2MGSA 5LMUQ 3LWBA 3I4MB 1OXVA 2YZGA 2N88A 4MV7A 1D7QA 2WFWA 1I94Q 4X65Q 3RB0A 4JOIC 1QZHA 4UDUC 1NCVA 4LW1A 4DL6A 3CC4A 1ESFA 4O42A 1O7LA 3ITPA 4YWKA 4Y8VB 2O2LD 1BOSA 2VQEQ 5EPKA 3I2ZA 4WFN3 3RB3A 1NMFA 1TWHH 3C0FB 2I87A 4XX0B 2MJ8A 5IGFA 1Y1VA 3I4MH 2UU9L 1M4VA 2W7PA 1ILQA 1QILA 1EZ1A 3NWTA 3LGJA 5I47A 3CF5A 4JBWA 2L9HA 4IOAA 1SYFA 2KQ3A 3S24A 3Q8PB 5KFIA 1FVIA 4PV1C 3MR3A 5JJIA 3N42B 4QWBA 4IHJF 3KDFB 5EWEA 2E2DC 4BBRH 4C5AA 4A3KG 1BO0A 2I5LX 3G6XA 4QW9A 1HNZH 4OIKA 2WAQA 3RIZA 4KHZA 1RD9D 2UXCL 1VF5C 3P75A 2XRSD 4EVOA 1KBLA 1EWCA 4K0KQ 4GN4B 4IZ8A 3TSSA 5J39A 2W71A 2UUCH 2MO1A 2PQEA 1I7NA 1YEZA 1JDEA 3GTKA 2FINB 3ZYYX 2B2TC 3M7NA 2EXZA 2JA5H 1G6ZA 3URYA 5IP9H 3HBLA 1HUNA 1LT3D 4CJ2C 5M3FG 4Y52H 5C3EB 1SEBD 1PFNA 2B2UC 2I5MX 2Z1CA 1DCZA 3BABA 1RJTA 1NSNS 2ZM6L 2YTXA 1EZ8A 1ASZA 3QG1A 2QDLA 3KLWA 4GOPB 5KFPA 2EOTA 4DFAA 4DKAC 4DF7A 1QZGA 3PO3H 5F9NA 1GUOA 4RU9A 2QW7A 1S5ED 1H95A 4JI8Q 3A56A 4FXKC 4HMIA 1PK8A 4UCOA 3TEHB 4GZYC 2Q2IA 3D6WA 1XNRL 2IT1A 3J80W 3J81W 2YU9H 2RDJA 1BCPB 3MEFA 1KDCA 2YYZA 3HOYB 4B3SQ 5DQHA 3A8KE 3LP8A 2UXDL 1JMCA 3H91A 2Z0SA 3F2UA 4YWLA 1X3GA 2J6TA 4DR5Q 4GKJQ 4HCEA 4OXPA 3T16A 1B7YB 2AQ3B 5C3WA 2PMZE 4DV3H 1A62A 2YTVA 1CA5A 2H5XA 4FF3A 4A2BA 5M3MH 4FS1A 2RSNA 1SCUB 1VMCA 4YCVA 2KCTA 1VQPA 4B3RQ 4ME5A 1P8LA 1UEBA 5FLMG 3CU7A 1DXMA 4ZI7F 3O13A 4DV0L 5DAUA 3E5NA 1GKHA 2NU6B 4NXMH 4IJHA 1TWAA 2AGOA 2JEJA 2UUBQ 3AYHB 5C4XG 5C0XG 4R8IA 4JI6Q 4NDXA 5LMNQ 2MUYA 3ULLA 3N44B 3GV6A 1NMGA 5C44G 3ND9A 1JB3A 2JK8A 1WTHA 2EPBA 1PH9A 3VMMA 1GSAA 4A3MH 3CPFA 5IYBH 3MVVA 1CQIB 5D8DA 1E4EA 4J9LA 5EBCA 2XCLA 1NTGA 3S1MH 1XMOH 1YI2A 5IODA 1KEEA 2CW0D 1I3QA 3GTLA 1VBHA 4DUYL 5DG9A 3E5SA 3FMAA 1VQOA 3PO2G 2VNUD 3EYYA 3DWPA 2FB9A 4KN4C 2W9BA 2JP1A 2WKCA 4CKEA 4JK1C 3NXWA 5DQIA 3J7YW 2YRWA 1ULZA 1TWGH 4U673 5A35A 3HKZG 4LMYA 1JICA 1ZHQA 4K5WA 3B6YA 3FPUB 1F2YA 4MV1A 2GA4B 4POGA 4J9OA 1XJVA 3FMCA 4K14A 1RL2A 2MCTA 1ZKOA 2L12A 1PDQA 5HGQA 2AUJD 2R6GA 3MAQA 4EG0A 1I6VC 4BXXG 3I72A 1XNQL 4DV2L 3TINA 2WDTA 4HYKA 1O7IA 2IWHA 1NUCA 4OELB 3RLOA 1F9SA 3GIIA 3M4QA 4X62H 5BMVF 2AQ2B 2XCAA 1KAAA 1S68A 2RCNA 5EQ0A 2FHTA 1PFMA 3R23A 4F4WA 5EZYF 1WH2A 2AQ4A 1U4PA 4YY3L 1CT1D 4L5RC 3CKIB 3I4NH 4RKBA 1B3AA 4OL7A 1KQSA 4N8FA 4LFAQ 4ECRA 2HCCA 2WKDA 5GAHC 1EIYB 4O3OA 4ECUA 1D5ZC 4FYDA 3H3VH 4C3JB 4HIKA 4FBTA 1E1OA 2DGYA 3GV8B 1PFSA 2E5LQ 4XYMB 4JOIA 4O4LF 3CVZA 4IFDI 1KABA 5KFZA 1Y1VB 4LF6L 3I8ZA 3HKZA 2N78A 1SMXA 3F8TA 1STEA 3U4ZA 3S2DH 5I6YA 2WP8J 1GJXA 3KF6B 4H02A 2PPBC 4DR6H 3MXPA 1O7YA 1F2LA 2YRXA 4RZQA 3C3LA 4C3JH 1WCMG 4M9UA 4XT1B 1GUTA 3V05A 1HNWH 3JSLA 1K8MA 4A3BB 4J6HA 4E6IA 3R5FA 2WAQB 4B3ML 3BDCA 1LV9A 1LYLA 2CVRA 2B63G 2EYMA 2CW8A 2KENA 3G6VA 4YCWA 3GV5B 1HNZL 1WR2A 2XNAC 3DMUA 2W6QA 5C6AA 1V4YA 5JVLA 1A3TA 3GTKB 3RB6A 1RTOA 2BQUA 1UNSA 4ZKBB 4A3BH 3SVMA 2KSWA 5K2MA 4EFBA 2JA8G 2N49A 1WTRA 4KI0A 5IGGA 1M1KC 1IYJB 4XZ3B 3T5LA 2UUCL 1TAEA 4A3FB 1EYGA 2BR0A 2IP4A 3PR4A 2B2TA 4A3JH 1EIHA 1YITA 1NY4A 1EQVA 3H15A 1AZQA 1JB7A 5KG1A 1RYSA 3A74A 4JUZA 2ATLA 2CQYA 4LSXA 2FJZA 3ERSX 4JG2A 4POFA 3GTKH 2R3ZA 2I80A 2CWAA 3BYYB 3MEHA 2ZDQA 3PUYA 4U7CA 5BR8H 1QVFA 4A3FH 1OXUA 3GTOH 2C2EA 1PRTF 2Z8LA 2F4VH 2AWNA 2HIVA 2F0NA 4FP5D 4PZ7A 1STBA 5ELCA 3PIO3 2ASDA 3JSNA 3KJOA 1AE2A 3U9OA 1L1OC 4C5BA 3DUZA 1G51A 1F2MA 3J7AF 3CCQA 4A3KB 5IYDG 1WTVA 3PUZA 2UXCQ 3H0GG 3UDGA 1NAPA 1SYDA 1TWFH 4JYAL 5CYUA 3TP8A 5I9PA 2E2HB 3PW7A 2YL2A 3EROA 2FPGB 4K5XA 4YAJB 4KD4A 3KLRA 1VQCA 4UCUA 3EN2A 1H9MA 4M1UB 1LTTD 2NZ1D 1KC8C 4X64Q 1HFGA 2E2JB 2HHHQ 1MZBA 1V8QA 3S1QB 1LT4D 1K1QA 5KX5F 1S5BD 1J5EL 2L11A 3V4SA 1I50A 1JE4A 2J6SA 1W3SA 2FE3A 4BA2I 2F0SA 4KHPQ 2L5TA 3VR3A 1DD2A 3MWMA 1PH4A 3ETHA 2EY5A 5IT9c 1EQTA 3HOZB 3TRZA 1XNRQ 4K5VA 2VQFL 2R7ZA 1ICFB 1N33Q 1ASYA 2NZOA 5IYCH 5EKLA 2JA9A 4CDDC 5LL6b 4GNXB 1JWSD 1KAWA 2NBFA 4FF4A 2UXDQ 4BWGB 2FLPA 4B3TH 4R1JA 1JOQA 1TWAH 4NKLA 2AMCB 3N52A 4KJNA 3QFFA 1OXXK 1SAPA 5KFLA 2EJGC 2F0MA 2C22A 4B9WA 3HOZH 1E4EB 5IT9W 2ZJRA 4ABNA 3J7A5 4RGNA 3GO5A 3MC0B 4CDEC 2ZTEA 3ONAB 3ULPA 3GTLB 1MD2D 1SRUA 1B9NA 1RKNA 4DAMA 3K5LA 4KLKA 4XDXA 4OGQC 2ALYB 2EE1A 1XMOL 4MV9A 2W9BB 1IOVA 1AFPA 1WJJA 1UE6A 1H9KA 4IRCA 1G291 3ICEA 4O3SA 1JJ2A 4IPHA 3RGXA 3TZDA 1S0NA 2F0OA 4MN3A 1I6UA 2K05A 1M0TA 1JT8A 3H40A 1V1QA 1CTMA 3M4IA 2MP1A 1E7ZA 5IE8A 1DOMA 1I3QH 4X3UA 2R8HA 3K7AB 5JEAG 4DNIA 5KNCA 2ZXOA 1JDBB 2B8GA 3E3XA 3M3YH 5C4XB 2XSCA 3T13A 3HEJA 5K5PA 4I4TF 5M5YB 2NU8B 2WB1G 3RTXA 4JI2H 4L6TB 2B2VC 3S14B 1VS0A 3LWEA 3DF7A 1JIHA 2IBKA 3OW2A 1JWMD 2ZXRA 4OX9H 1TY2A 5JPNC 4J15A 3C1EA 3I4MG 4OO1H 4O3QA 1VQ9A 4J9NA 4ECYA 3PW4A 5LMUL 1YNXA 5C4XH 3CCVA 2WV6D 1G6PA 2L0CA 4JI3H 1STAA 4DUYQ 2HUGA 3GQCA 4DR1H 4J1MA 3VR4A 5H1SE 4LMQD 1PXUA 3PO2B 2VQEL 4BBRG 1MJEA 1TKWB 3K57A 1NR4A 4O2AF 2YS6A 3Q1KA 4EEQA 2C5CA 2LXJA 1E4GT 2JE6I 1L0WA 4LUOA 2A73B 3GDEA 4XQJA 4FU0A 2BQ3A 1IZ6A 4RWSC 4F7XA 3HKZB 4TUYF 3CQZH 1D1IA 2JA5G 3T5HA 4K6DA 5IP9G 1Q8IA 2QA4A 1QJOA 1DOLA 1GVPA 2R6FA 1HUMA 5KFVA 4JV5H 4DV2Q 5KFFA 1KDBA 4JPBW 4WJWA 2IJ0A 1LTID 4K0KL 3D4RA 3EBEA 3S1NB 1NBWA 4ZUIA 3JAME 1PH3A 4X3KA 3T1YH 4PNYA 1L2ZA 3PO3G 1PZKD 4MHEA 3NQTA 1MIUA 4YY3Q 1I4QA 2EYPA 2I5HA 5ISRA 4ZQIA 2R7KA 3K5HA 1LTLA 5IP7H 4K2LA 2F0FA 2XC9A 5EKKA 1VQLA 3GIJA 4IR9A 3NTKA 4JI1H 4IN3A 2R85A 3S1NH 3RZDB 1K0RA 3D6CA 4HJ7A 4ME3A 2IY5B 4R4OA 2PBZA 4R8UB 4JI4H 1CQVA 5EBDA 4F87A 3BA9A 3BDOA 3OIQA 3OHBA 2JA7H 4LF5H 4LF8H 1HNXH 1KNEA 2VZAA 1D8LA 2B29A 4CJ1B 2OTLA 2E75C 4L5QA 1EY5A 1HTLD 3EJIA 4NP5A 3VYSA 5M3MG 1EQQA 5KG7A 1I4PA 1C48A 1H9SA 1JCKB 4KN7C 3NBHB 1WCMB 4KKTA 3PUVA 3CRLC 5NUCA 3PIP3 5BR8L 4HQ6A 3MR6A 4ECXA 2C2RA 5A2QL 3CCLA 3G4SA 3HFZB 2IPKD 2F4VL 2V59A 3WO0A 4DR5L 3TBIB 1SE2A 1WD1A 2WTFA 3D8GA 5M9OA 3VYTA 2B63B 5JH7F 1HR0H 4EQPA 1Q46A 3LMLA 1HNZQ 1X3FA 4PG3A 3SK8A 3F2CA 4G57A 2Y0SG 4IZOA 4HTHA 4Y7NB 3E6ZX 4KY5A 2VW9A 1JLLB 2ENBA 4JI5H 1KRTA 2UUCQ 1VQIA 1Q90A 2JA8B 4WRDA 4IAJA 4ZAIA 4XT3B 3CCSA 4A3MG 5IYBG 3C1FA 1M90C 1W6JA 1XPOA 2UUBL 2J6UA 3CCRA 4Y7NH 1I50B 5FLXE 2MHVA 4ZQ3A 1CKOA 5C3XA 4QUFA 4QWEA 2JYOA 1LLRD 4DR3H 5DG7A 5LMNL 3FEWX 2QEJC 1QUQA 1KXLA 2CQOA 4BWSC 1F77A 1Y14B 4RNNA 3GIDA 4L5TA 5GADC 2W6PA 1X65A 4IUPA 4TQUS 3ZJYC 1GYFA 1FNVA 1I50H 3GD7A 1S4ZA 2W6OA 5DM73 1AW7A 3H0GB 2K1BA 3IN5A 4YBZB 1JE5A 1LUZA 1IBLH 3OIPA 1DYQA 1X3EA 1ET9A 1U9RA 4B3TL 2VPQA 2Y0SA 3JRWA 3KYHC 4P71A 3WOFA 2IW3A 2R7ZH 1STHA 3F1ZA 4EQ5A 1Y69U 1G2TA 3NP8A 1H9RA 3LNNA 4ZUJA 2DIKA 4APMA 4J9KA 3M9BA 2D2CC 3S16H 3BQ0A 4JVZA 1N32H 5AJ3Q 4DV3Q 4ZLTF 5KFEA 2LY7A 1E2WA 4QJFA 1H9JA 3MXNA 5KGUA 3FDSA 4PZ8A 1A8VA 1VQJA 4P2CB 2EY6A 1CSPA 3ERQA 3I4NG 2KCNA 4LFBH 4X3TA 2IMWP 5ELBA 5HY6A 1X32A 2B2WA 3VR2A 4GS3A 2NVYH 3F2DA 5ELFA 3S1RB 2K01A 2KVMA 4NXMQ 1VQHA 2FPIB 5KG3A 4DUZH 4TSSA 3T1HH 3RLFA 3EQLC 4F8MA 3PVXA 2JQOA 4HEDA 4H7BA 1TWGA 2ZXPA 2B2VA 1IW7D 4HN7A 5J2UF 4LFAL 2UXBL 5IIFA 2QKIC 3MZ5A 4C3JG 1IHZA 2FK3A 3RGZA 3NBIA 2EIFA 4AYBE 3VA5A 1XMOQ 3NGDA 3TQ1A 4A75A 3P1HA 2E5LL 3EA6A 1KNAA 1SSOA 2J7ZA 4MTKA 3HXLA 1T94A 1UC9A 5D1PA 3BQ1A 3G48A 4IJLA 2FLLA 2F0GA 5KT6A 1PH5A 5E4WC 1HR0W 2D0OA 2V58A 4TRDA 3RD4A 5CBEE 1CHPD 2W6ZA 1YIJA 4A3BG 1MSGA 2IX0A 3BVGA 3PV0A 1WTOA 2AU0A 2XGPA 4DGZA 2EZVA 4Q43A 1EEFD 5T1GA 1AUXA 2F3WA 4A3JG 1JOKA 3BZDB 2WB1B 3CHBD 3RV3A 1V1PA 1TWHB 5CA1F 1K28A 2ICEC 2RA4A 4JV5L 4DA2A 2ZDHA 1T3NA 3QOJA 1RHPA 5IOCA 3OHXC 4A3FG 1SJHD 2KBNA 4OIJA 4QWCA 4ZHQF 2XWJB 1VQDA 1K83A 1U0LA 2UUAL 5DEHA 1EYDA 1Z7TA 4ETSA 2VA2A 4YP3A 4BBRB 5F2DA 3RFCA 1LT5D 4ALPA 2V9WA 2HIXA 1YZ6A 1PRTC 1K8AC 3GTMH 1HRJA 1B1ZA 1J8IA 5M5XH 1EEID 4JI1L 3CXCA 4L5SA 4EGJA 4J8QA 5KEEA 2K5WA 1N56A 2SCUB 5FD5A 1SNPA 4JI4L 3SK5A 2JA5B 1CA6A 1Y1WG 2VOBA 4LF8L 1TR5A 4HJ5A 4X66H 1H9SB 2W9CA 2LKVA 5AFWA 1ET6A 4DR6Q 2MO0A 1KLUD 2NN6H 1PYWD 1Z9FA 3MXUA 4R4CA 1LACA 5CBAE 1D2BA 1E2VA 1HNWQ 2YYAA 1G8ZD 1L1OB 1CZWA 1XDNA 3X3MA 3PO3B 1VQKA 2K14A 2UVRA 1VCIA 3GTOA 3S2HH 1UNNC 1ZYRD 4YQWA 3PN1A 4DR4H 4X64L 1F9RA 2I8CA 1BNZA 5IYCG 2K50A 4NB3A 2HHHL 1K1SA 3TMEA 3OHAA 2YU9B 3F8NA 2OF1A 3CMAA 3EIVA 2KHJA 4RB0A 4QIWE 4ECQA 5C0XI 4KHPL 1TWFA 2R7DA 3GTJA 1KL9A 1VQAA 4L1KA 2BCOA 2DPJA 1KD1C 3HOZG 1EY8A 3TS0A 2F0WA 5C8YF 3L0OA 1CKNB 4DV1H 1IYUA 2NTTA 1N33L 5JJKA 3KAKA 2DJGC 4H13C 1Y1WA 5M3MB 2R93A 2ALZA 3PQIA 3I56A 5BR8Q 4NXNH 2R8IA 5JOBA 3JAMi 4DR3L 2F4VQ 5F9LA 3G6EA 1QB5D 1X55A 5COYA 3T5KA 3BVMA 1PYSB 4J9MA 1VKZA 4P74A 4UCSA 1AEXA 5FJ8H 2K5NA 4GLAC 3A55A 2LS01 2I0QA 4I50F 2Y0SB 3OSOA 2YZMA 2CHBD 1BVSA 3FHWA 2PI2E 2WE6A 3VA7A 5C4JH 4QIWA 5IGDA 5LOVF 4AH6A 3TP7A 2RDHA 4LF9H 2A69D 1IBLL 3M4OH 4UAIA 2FFKB 5JUMA 4LF7H 1IBKH 3ULJA 4RGTA 5BPHA 2AGPA 3OWFA 3MFIA 4OO1G 5LYJF 3OTOH 4A3MB 3KLSX 1N8RC 1YJ9A 1FR3A 1A0IA 3QR8A 4O3PA 3S1MB 3Q6SA 1YBYA 4RHSA 4TVAB 1PH7A 1B50A 3EPIA 2RGVA 5DGBA 2B3GA 2F0KA 4WD3A 3BZKA 1PVOA 1HCZA 2F0VA 1FJGH 1C0AA 3WWVA 4JI7H 2JJQA 4PZ6A 4BA1I 2XIWA 3PUXA 3BYTB 5FO9B 4LFBL 2PMZA 5JVG3 2RCFA 4DV5H 1YNJC 3I7FA 4HSVA 4HIOA 3A54A 3UE0A 4IUQA 2Q8IB 3SDZA 1CHQD 1ENCA 1TWGB 4HMJA 4KTAA 4C1NI 1ZHSA 4UCVA 1RK6A 4RZRA 1TT2A 3MWDA 5FO7B 3Q2OA 4E4TA 4B3TQ 2IHFA 3W5OA 1AH9A 5KFOA 3UE1A 5D1OB 4A76A 1ZQ7A 2DPIA 4S3SA 3KHGA 4MTDA 3OW7A 1C30A 5EWGA 2E2IH 3JAMc 3J80L 2B2YC 3J81L 4PMBA 1GLVA 4ECSA 5EJWA 3TN2A 2ZT9C 4RB2C 1E24A 5GROA 1F9PA 4RB1A 1D5MC 2F0UA 2SNMA 3U9SA 5IP7G 1CZGA 2F3IA 4ID6A 3I4NB 5IWAH 1Q82C 3G7LA 4MV4A 3JAMW 1QNUA 1YHBA 4L63B 1ONLA 3S9WA 2QYZA 1IYVA 1I5FA 2V1CC 1AE3A 4P75A 2RDFA 5KT2A 1PTOF 4PMCA 2EQSA 4DV6H 1SYCA 4IFDJ 3UDXA 2YTYA 1HA5A 1EUCB 1AUVA 1SLJA 2JA7G 4I7AA 3TS2A 3CCUA 2VXWA 3DWQA 4JI2Q 5KG0A 1F9QA 2N55A 1SFOA 3S2DB 3CCMA 3CQZA 3HOWH 2UXBQ 2BE5C 4OX9Q 5EDWA 1GO3E 4RCOA 5KFWA 3NTIA 1RIPA 3DM1A 3BJUA 1E2ZA 4O1NA 1EFWA 2OH2A 2VR1A 4JI3Q 1YNNC 4ED6A 1PX2A 4IUNA 3UDIA 4DLKA 4BY1H 2PZTA 1JXLA 1IW7C 4FF2A 2PVPA 4ED0A 1CM9A 3V96A 5KT7A 1JORA 1K83H 1TU2B 2W70A 3K5MA 2EYFA 4CDFC 1HH2P 3GTPA 1TWCA 4LSAA 2RVLA 4ECWA 4FXGC 3GP7A 1UEAB 2IX3A 1WD0A 4J9QA 4A3JB 1DGSA 1N36H 2HDMA 1VQMA 2AWOA 1OXTA 3K0XA 5FLXc 2M05A 4JV5Q 3GTGH 4QCLA 4X66L 4YIJA 3L4JA 3NHHA 2JA7A 5G3LF 4GLXA 1KIXA 3T53B 4A3GH 3CD6A 1B6SA 2G9HD 3ORQA 3TIGA 4FVMA 4WORA 4EFEA 2Z9HA 1R9TA 2V4RA 4MTNA 3GTOB 1GOZA 2PQAA 3T1YQ 1V51A 2UUAQ 1RODA 4FM9A 1I4XA 5BN3A 1C7YA 5ELOA 3RNUA 1D1KA 2W6NA 4KMUC 4R7RA 5KFJA 5K36H 1DV2A 2OQ0A 4FNFA 5FLXW 2VQDA 2Z4HA 4DR4L 4GC7A 1YVCA 5KYIA 4JI1Q 2R82A 1FNUA 4O3NA 1TWFB 4X6AH 5CV4A 1IBMH 3GTJB 1BBUA 5KNDA 1PV4A 1AZPA 2P0AA 3H4DA 4LH7A 4JI4Q 2R7ZG 1PZID 1XMQH 3GIPA 2PZWA 4APVA 2Z6KC 4LF8Q 1SDFA 4JI8H 3KLSA 4EYHB 3M4PA 1HNXQ 5I2XA 1Y1WB 3A7AB 4DV1L 4G4KA 1SE8A 4A3IH 5D65A 3GTJH 1RJRA 1RYRA 3AU7A 2F3VA 1VF7A 3TZUA 2BH2A 3SR1A 5CA0F 3CAMA 4NXNL 3UQ8A 1HPCA 4XYOA 4WJ4A 2YW2A 4GKJH 2CW7A 1Y1WH 5KRUA 4O4IF 1DM0B 5LXTF 2R93H 2JEBI 4Z9CB 2XTIA 3PW2A 1HR0Q 5AJ3L 4DV3L 1SE4A 3K6OA 5EAYA 1V43A 4QQBX 2AKWB 3GLKA 3RBDA 5FKAC 1QVGA 4B3RH 2R86A 4JI5Q 1K0SA 4DAPA 2RGRA 3TP6A 4A3LH 1TWAB 4YJ3F 1IBKL 4DK3C 4YAKB 1ZYRC 3TDQA 3C2PA 1MKHA 3OTOL 3OYYA 4NXML 4JCVE 1R4QB 2ICIA 3M9MB 1WFQA 1HXYD 1BCPC 1TS3A 2JEIA 4DR3Q 1EIGA 1BBWA 2W8LA 3A5ZB 2R8GA 1ZEQX 2PMZB 4CBVA 1AP0A 3GQBA 3WNZA 3SE0A 1WSCA 1I3QB 2A5HA 3DWAA 4YJ2F 2OCEA 2CQAA 3CPWA 5JJLA 1HZAA 4LFCH 4L8JA 2LMCB 3UI2A 1WTPA 4JW0A 2UVWA 3T4AC 4JBMA 5KT4A 3M3YB 2NVYA 2F0IA 2J0TD 1PH2A 1EUJA 2OXPA 1IBLQ 1QE6A 4C3IH 2LXKA 3SXHA 5G3LD 2M2LA 3I91A 1B9MA 5L37A 1PTOH 2K32A 3L3OC 3RR5A 1SNDA 4XQNA 1XPUA 2B2WC 5EWFA 1GXDC 3K81C 4ILWA 5LL6S 1JJCB 1LTSD 2B2YA 1N32Q 4Q8FA 4H0LC 1VQ8A 3LWUA 1STNA 4WBNF 3U50C 2A69C 1S40A 3PF5A 4AIMA 4A93H 2ATWA 3MJFA 3IRBA 1GUGA 4RGOS 3FPPA 2KCCA 3V6JA 4LFBQ 4UP8A 1D5XC 1HZCA 1PRTD 4BY7H 3RV4A 2PNHA 4YHHH 4X62L 4LF4H 2D62A 2O5JC 3L4KA 3T1HQ 4AQYH 3SHLA 1NNXA 1MSHA 4C3HH 1SFOB 3QOLA 1VQ6A 3CQZB 4DL2A 1DONA 2PCFB 5KFKA 3H4BA 3QWNA 3R2IA 1A63A 4CJ0B 4YCUA 5C1PA 2NN6G 3N6XA 1PLFA 4A3EH 4I7ZC 3LX0A 3HOXH 2R92A 1A9XA 2RHQB 1EYCA 2KHIA 1SFOH 4V190 4U68A 2ZJPA 4U6PA 4TQSA 3D3RA 3RF2A 1VAJA 3P7JA 1DOKA 3G6JB 5J3BA 1K8OA 1LO5D 5IT9L 3M7GA 1PRTB 1EYZA 4C2MA 1EWHA 2KOLA 2CFMA 1A3VA 4DR6L 1KJJA 3IFDA 3VPBA 3NPPA 1UE1A 1DV1A 1YHAA 1L2FA 2BQRA 1N34H 5DLFA 3VPDA 1CSQA 2OWOA 4WJ3M 2IL8A 1BDOA 5CR3A 3GTMA 1A3UA 1HNWL 4UCTA 5DGAA 3W1BA 4KJOA 5LHY1 1X9NA 2IX1A 2JA7B 2VUMA 1IL8A 1M8AA 1U5KA 3H6MA 3GTPH 2RQXA 3OOCA 3T51B 1N36L 2NB0A 1T36A 1TWCH 5C5JA 1BGWA 1R9TB 5T1IA 1IXRA 2XWBB 4OWXB 1EQRA 1K73C 2L1BA 3QJYA 4DXGA 5D3IB 5LA6F 3I55A 3QIAA 4RNMA 1SNMA 3Q8QB 1C9OA 1XXGA 3SEBA 1R9TH 5KIXA 5FJ8G 2UU9H 4N9TA 3RUZA 3PR5B 5IYZF 4H44C 3BAAA 4UHVA 2JEAI 1RJQA 3S17H 2EDGA 2PW5A 3K3PA 1SYEA 4HNUA 4DN4M 4DK0A 1EIFA 4N9PA 1HQRD 3I12A 3GV3A 3IFTA 4YR0A 3E0EA 2R61A 2Z6KA 1S0MA 1B3QA 2TSSA 4X66Q 1EYAA 4XQQA 4EQOA 2C9OA 4UP7A 2F4IA 1FGBD 5GAEC 4FF1A 4Q8EA 3A8IE 3EFXD 4UY8C 4OWTB 5KFDA 3Q8DA 2D9UA 3HOVH 4RAZA 5M5WB 3HS0C 2P5ZX 2HJWA 3FRPB 1S3OA 3RAXA 1CUKA 1Q3LA 1YNJD 2BA0A 4N8X1 4DR4Q 3M85A 1BF4A 3HOUH 2ZJTA 2ZM6H 1I6HB 2W57A 5BPFA 5D3DA 2Q8RE 1S03G 2NUCA 1KHIA 3RZOH 5KFSA 2YZNA 3E0JA 5M5WH 3H3VI 5CV9A 4F4YA 3VPCA 1SR3A 2ASJA 4M7EA 2R7ZB 1I4RA 1XTDA 3HKSA 3I3CA 5CV7A 2E74C 1I6HH 4DV1Q 1Z2NX 4IOCA 2J9GA 3S16B 1VQ5A 1A2UA 2QCPX 2QF7A 4MV6A 3SE7A 1FL0A 1II3A 1DIKA 2UXDH 2R7NA 2F0QA 4NXNQ 3IKJA 1JOOA 3QB3A 1W6KA 1JX4A 4K8JA 5FPOA 1CI3M 1S9FA 1CQFA 4ECTA 1X6OA 5KFRA 2NVYB 1ILPA 1UC8A 2Q8TA 4IFDH 4HJ9A 4DAYA 2MQHA
chains in the Genus database with same CATH topology
2WB1E 4LF9Q 2C35B 1GM5A 1N33L 5JJKA 4B3ML 1LYLA 2B63G 4JBKA 1HZBA 1IBKQ 2KENA 4LF7Q 3I56A 5GQOA 1I94L 5BR8Q 1IL2A 4X65L 4YCWA 2JA6H 3HOWG 3PIOA 5M5YH 5GAGC 3AFQA 3OTOQ 1HNZL 3JAMi 3DLLA 4DR3L 1NE3A 2F4VQ 3G6EA 3S14H 5C44H 3J81j 1X55A 3FKIH 2KCMA 4A3BH 1PYSB 2JA8G 2N49A 1M1KC 4KI0A 1IYJB 4P74A 5FJ8H 3JC66 2UUCL 3S15H 2K5NA 1EYGA 4GLAC 4BY1G 1FJGQ 2K4KA 4A3JH 4JI2L 2I0QA 1VQ4A 1NY4A 3H15A 1YITA 4JI7Q 4MNOA 1JB7A 1BVSA 3A74A 2PI2E 3FHWA 1VQNA 5C4JH 4OX9L 4AH6A 3ERSX 1IBLL 3PO2H 3M4OH 4JG2A 4POFA 1OTCA 3GTKH 4JC0A 2CWAA 3ULJA 3CC2A 3PUYA 2K5VA 4JI3L 1QVFA 4OO1G 4LF4L 2CKZB 1OXUA 4IPGA 1GD7A 4DR1L 4A3FH 3GTOH 1XNQQ 2ASBA 1N8RC 1YJ9A 2AWNA 2HIVA 4PZ7A 4AQYL 1A0IA 2PQAB 3KJOA 3AFPA 1AE2A 1YBYA 1L1OC 2L15A 4FDBA 4TVAB 1G51A 1OXSC 1YHQA 1PH7A 4OWWB 3CCQA 2B3GA 5IYDG 3BZKA 5LMNW 1PVOA 3FP9A 3PUZA 2UXCQ 1C0AA 1SROA 3H0GG 3WWVA 3UDGA 2NVTH 3A0JA 4A3GG 2JJQA 4PZ6A 1TWFH 3KFUA 4BA1I 4JYAL 3PUXA 5C3EG 4BBSH 2MNAA 2NZHA 4LFBL 4BXXH 3GTQH 1LM0A 3I7FA 4HIOA 3AEVA 3TQYA 2K5HA 1EWIA 3UE0A 1VQCA 3EN2A 4GKKQ 2R92H 5K36G 1IBML 2ZTCA 1E22A 1KC8C 4X64Q 2IHFA 3W5OA 4LUVA 4B3TQ 5IWAQ 2GN5A 4DR7Q 3UE1A 1AH9A 4UPAA 4X62Q 2HHHQ 3L7ZC 4A76A 4LF6Q 1XMQL 3STBC 4RMFA 1NJIC 4JI8L 3KDFA 1J5EL 4C2MH 1YJWA 3T1YL 3I4OA 1W3SA 2K75A 4DV6Q 3JAMc 2E2IH 4BA2I 4A3DH 4A3CG 3RZDH 4KHPQ 3J81i 3HOYG 1PH4A 5IT9c 1UE7A 4B3SL 3D0FA 1E24A 5GROA 2WAQE 1EOVA 3TRZA 1CKMA 1Q7YC 1XNRQ 4LNQA 2VQFL 4A3IG 1ASYA 2NZOA 5IYCH 1N33Q 4R4QA 4B3MQ 2HT1A 2JA9A 4GKJL 5IP7G 2F3IA 4GNXB 1KAWA 2UXDQ 2VUMH 1L1OA 1Q82C 4R1JA 2QEXA 1YHBA 2VS1A 1TWAH 2EXDA 2AMCB 1OXXK 1WCMH 1I5FA 4IO9A 4LF5L 2V1CC 1AE3A 4P75A 3HOZH 2ZJRA 4RG1A 3J7A5 1W2BA 1HNXL 2R93G 3GO5A 2OQKA 3ULPA 2ZTEA 2EQSA 4IFDJ 1SRUA 3UDXA 2YTYA 2Y0SE 1PYBA 4DAMA 4B3RL 4KLKA 4GN5A 1SLJA 2JA7G 4O0AA 3TS2A 3CCUA 2ALYB 3KF6A 4JI2Q 4GOPA 4QQBX 1XMOL 2B63H 1WJJA 5C0XJ 1UE6A 3CCMA 3HOWH 1G291 3ICEA 4OX9Q 1JJ2A 4IPHA 2UXBQ 4IPCA 4A3LG 1GO3E 1Q1EA 1Z47A 1JT8A 1RIPA 1V1QA 3BJUA 5IE8A 1E7ZA 1EFWA 1I3QH 1CKNA 5JEAG 3F2BA 1N36Q 2F52A 4JI3Q 2BA1A 3KJPA 1HR0L 4DNIA 4JI6L 2JA8H 5DLQE 2Q2HA 3UDIA 4OO1I 4BY1H 2VY3A 1YJNA 5E7NA 3M3YH 3K80C 1N9WA 1UWVA 4JI5L 4R4TA 3K7UC 2WB1G 1K83H 1HJPA 3E9HA 4LFCL 1PH1A 1KRSA 1VS0A 2E8GA 3OW2A 1HH2P 4IPDA 1K8GA 4JYAQ 4GLVB 4J15A 3I4MG 1VQ9A 4DPGA 5LMUL 1YNXA 3RLNA 1JJGA 5C4XH 3CCVA 3J80c 1QUQB 3J81c 1G6PA 4P73A 1DGSA 1VQMA 2AWOA 4DUYQ 1B70B 1OXTA 2XGTA 3K0XA 3UDFA 1VQGA 5FLXc 3U4VA 5H1SE 1P16A 4R4IA 1IBMQ 3GTGH 4X66L 4JV5Q 5IYDH 3H0GH 4GLXA 2VQEL 4BBRG 1KIXA 1MJEA 3CD6A 4A3GH 4MZ9A 1XMQQ 4DV4Q 4HJ9A 4MTNA 2A8VA 2LXJA 5C3EH 1TXYA 1J5EQ 2PQAA 4GNXC 3T1YQ 2ES2A 2UUAQ 4O2DA 1C7YA 5ELOA 2JE6I 1L0WA 3RNUA 3CW2C 4AYBG 4LUOA 3GDEA 3D31A 1IZ6A 2OQ0A 3PGZA 4DV5Q 3CQZH 4NPSA 1K9MC 4DR4L 4A93G 2JA5G 2VQFQ 5IP9G 1YVCA 2QA4A 4YHHL 4JI1Q 1GVPA 4X6AH 1BBUA 1PV4A 4DV2Q 3PF4A 3MXNB 4BY7G 4JI0Q 5IY0A 2RF4A 4JI4Q 2R7ZG 4A3CH 1N32L 4K0KL 4DAYB 2CWPA 4APVA 3HOYH 2Z6KC 4LF8Q 4QGUA 3EBEA 1FGUA 1NBWA 3M4PA 1PH3A 1HNXQ 3NENA 3S1RH 3PO3G 2MFIA 4DV1L 1MIUA 1SE8A 4YY3Q 1VQFA 2I5HA 4A3IH 3PIPA 4QY7A 3GTJH 4DV7Q 2OTJA 1LTLA 2BH2A 5IP7H 3CAMA 3U58A 1PH6A 4NXNL 3J7ZC 1Y1VG 1VQLA 4WJ4A 1SN8A 1Q1BA 4A3EG 3S1NH 3HOXG 1K0RA 1BKBA 1Y1WH 4HJ7A 1E3PA 3KF8B 2PI2A 4ME3A 2JEBI 4OONA 4DUZL 3T1HL 2XTIA 4R4OA 1PA6A 1HR0Q 2IY5B 2N8NA 2Q2UA 5AJ3L 2DUDA 3L2PA 4DV3L 5EAYA 4GNXA 2JA7H 1V43A 1X56A 1Q12A 2QGQA 2CCZA 2AKWB 3AQQA 1J6QA 2K52A 1N34L 1T9HA 2VZAA 1D8LA 2B29A 4PMWA 1QVGA 2OTLA 4LWCA 4HJAA 2WAQG 2VL6A 4L5QA 1EQQA 3J80i 3PUWA 5M3MG 4JI5Q 4XIGS 4A3LH 4LFCQ 3NBHB 1IBKL 3PUVA 2A19A 4DK3C 5BR8L 4DR2Q 3CCLA 3G4SA 3HFZB 1MKHA 3OTOL 3OYYA 4NXML 2BH8A 4JCVE 5LMUQ 2F4VL 4DR5L 1OXVA 1VQEA 1D7QA 2WFWA 1I94Q 1E1TA 1WFQA 4X65Q 1Q46A 4JOIC 3K8AA 1QZHA 1HNZQ 1X3FA 4PG3A 4LW1A 4DR3Q 3F2CA 1BBWA 4YWKA 3CC4A 3A5ZB 2Y0SG 1VQBA 2VQEQ 3A5UA 3I2ZA 1NMFA 1TWHH 2VW9A 2OCEA 1KRTA 3CPWA 3ER0A 1VQIA 1HZAA 2UU9L 2UUCQ 3I4MH 3CC7A 5JJLA 1V9PA 3HKZE 3LGJA 3PSIA 3W1GA 3CF5A 4JBMA 4JBWA 2RHSB 3CCSA 4A3MG 5IYBG 4IOAA 3S24A 5ELNA 4BBSG 1M90C 1FVIA 1PH2A 1EUJA 1IBLQ 4C3IH 2LXKA 1XPOA 5JJIA 2UUBL 3KDFB 4Y7NH 3CCRA 4BBRH 3DM3A 4YHHQ 4A3KG 2I5LX 3G71A 3RR5A 1CKOA 4LF4Q 1XPUA 4DR1Q 5LMNL 4KHZA 3K81C 1QUQA 2UXCL 2CQOA 4AQYQ 1KXLA 1Y14B 1JJCB 4L5TA 5GADC 1N32Q 3STBD 4K0KQ 4GN4B 1WYDA 1X65A 3PCOB 4TQUS 3ZJYC 1VQ8A 2MO1A 1X54A 1YEZA 3U50C 2HQLA 1I50H 3GD7A 1S40A 3M7NA 3PF5A 4AIMA 2JA5H 2ATWA 4A93H 3IRBA 5IP9H 3CCEA 2FXQA 1JE5A 1LUZA 4GKKL 5M3FG 4LFBQ 4UP8A 1HZCA 4UP9A 1X3EA 4BY7H 3HOVG 4B3TL 4Y52H 3KYHC 4DR7L 2PNHA 2I5MX 4P71A 4DR2L 3RN5A 2R7ZH 4X62L 3F1ZA 2ZM6L 4EQ5A 2YTXA 2D62A 1ASZA 4A4IA 3M9BA 1S72A 3KLWA 3T1HQ 4GOPB 3HOUG 3S16H 4DKAC 4C3HH 1QZGA 3PO3H 5AJ3Q 4DV3Q 4HJ8A 1VQ6A 2D0PA 4QJFA 2R93H 1N34Q 4JI8Q 1H95A 1A63A 4PZ8A 1A8VA 1VQJA 3TEHB 2Q2IA 4YCUA 1Y1VH 1CSPA 2IT1A 1XNRL 2NN6G 2YU9H 1B8AA 4A3EH 3MEFA 2YYZA 3HOXH 3I4NG 2RHQB 4B3SQ 2KHIA 3E9IA 1SFOH 2ZJPA 2UXDL 1MJCA 1JMCA 5HY6A 2IHEA 2Z0SA 4GS3A 2NVYH 1X3GA 4YWLA 3F2DA 4NXMQ 2N3SA 5J3BA 3CMEA 4DR5Q 4GKJQ 1VQHA 4OXPA 3RLFA 1B7YB 4JBJA 2CFMA 2JQOA 2PMZE 4DR6L 1A62A 2YTVA 2H5XA 1UE1A 5M3MH 1YHAA 1L2FA 4HIMA 4LF5Q 4YCVA 2ID0A 1CSQA 2KCTA 1VQPA 2OWOA 4WJ3M 4LFAL 1HNWL 2UXBL 1WOCA 3SGIA 4B3RQ 5JEAJ 1P8LA 2UU9Q 1UEBA 5FLMG 3W1BA 4AYBE 2EIFA 1XMOQ 2NVQH 2IX1A 1X9NA 3VDYA 4IFDG 4HIDA 4DV0L 4A75A 1U5KA 3GTPH 1N36L 1GKHA 2E5LL 1TWCH 4IJHA 1WI5A 2ZTDA 3TREA 2ZJQA 2UUBQ 3AYHB 5C4XG 5C0XG 3G48A 3KOJA 4LUZA 4IJLA 2JA6G 4JI6Q 1IXRA 1K73C 3BU2A 1EQRA 4OWXB 2D0OA 1PH5A 1HR0W 2NVXH 4P72A 5LMNQ 3ULLA 1NMGA 5C44G 1PHJA 1Q8KA 3FKIG 2JK8A 3I55A 1PH9A 4YWMA 1YIJA 4A3BG 1C9OA 2IX0A 3PV0A 1QVCA 4A3MH 3CPFA 5IYBH 1R9TH 5FJ8G 4LF9L 1NTGA 4A3JG 4GOPC 3S1MH 1YI2A 4LF7L 2JEAI 4A3KH 4DUYL 3S17H 1VQOA 3PO2G 2VNUD 4JV5L 1EIFA 2GVBA 3CP0A 1HZ9A 3E0EA 2ZM6Q 4GN3B 1UE5A 2Z6KA 4QL5A 4DV4L 2KBNA 4A3FG 2E2HH 4X66Q 3RN2A 1VQDA 1U0LA 1FJGL 2UUAL 4UP7A 5GAEC 1TWGH 4JI7L 4UY8C 3HKZG 4OWTB 3B6YA 3BZCA 5M3FH 4ALPA 1K3RA 4POGA 1XJVA 2HIXA 3Q8DA 2E2JH 1YZ6A 1K8AC 4DV5L 1RL2A 3GTMH 3HOVH 3S1QH 5HGQA 5M5XH 4JI1L 3CXCA 2R7FA 2R6GA 1S3OA 2NN6I 1CUKA 2GVAA 2BA0A 4L5SA 1XNQL 3NELA 4DV2L 3CCJA 4BXXG 4DR4Q 1O7IA 2LSSA 3RLOA 3M85A 3HOUH 3M4QA 4JI0L 2AHOB 4JI4L 1Y1WG 1KHIA 2R92G 3RZOH 2RCNA 4LF8L 4EX5A 4HJ5A 5M5WH 3H3VI 4DR6Q 2MO0A 1SR3A 4DK6C 1VQ7A 4YY3L 1Z9FA 4L5RC 4R4CA 4DV7L 1XTDA 3HKSA 3I4NH 1KQSA 1Q81C 4LFAQ 1HNWQ 1I6HH 4DV1Q 4A3DG 4IOCA 1L1OB 5GAHC 1EIYB 1VQKA 1VQ5A 2K14A 1VCIA 3S2HH 3NEMA 1FL0A 4HIKA 3H3VH 2Q2TA 1E1OA 4DV0Q 2DGYA 3GTLH 1PFSA 2E5LQ 4X64L 4NXNQ 4JOIA 5IWAL 2YV5A 4IFDI 5IYCG 2K50A 4NB3A 2HHHL 4LF6L 2N78A 1SMXA 3F8TA 3U4ZA 3S2DH 3CMAA 3EIVA 2KHJA 2WP8J 4DUZQ 2VUMG 3KF6B 4QIWE 4H02A 5C0XI 2A1AA 4DV6L 1XPRA 4KHPL 1X6OA 2R7DA 1KL9A 1VQAA 1WCMG 4C3JH 1PH8A 5FLMH 1KD1C 3HOZG 3K7AH 3TS0A 1Q86C 3L0OA 1CKNB 4XTCS 2MQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 E;  4LF9 Q;  2C35 B;  1GM5 A;  1N33 L;  5JJK A;  4B3M L;  1LYL A;  2B63 G;  4JBK A;  1HZB A;  1IBK Q;  2KEN A;  4LF7 Q;  3I56 A;  5GQO A;  1I94 L;  5BR8 Q;  1IL2 A;  4X65 L;  4YCW A;  2JA6 H;  3HOW G;  3PIO A;  5M5Y H;  5GAG C;  3AFQ A;  3OTO Q;  1HNZ L;  3JAM i;  3DLL A;  4DR3 L;  1NE3 A;  2F4V Q;  3G6E A;  3S14 H;  5C44 H;  3J81 j;  1X55 A;  3FKI H;  2KCM A;  4A3B H;  1PYS B;  2JA8 G;  2N49 A;  1M1K C;  4KI0 A;  1IYJ B;  4P74 A;  5FJ8 H;  3JC6 6;  2UUC L;  3S15 H;  2K5N A;  1EYG A;  4GLA C;  4BY1 G;  1FJG Q;  2K4K A;  4A3J H;  4JI2 L;  2I0Q A;  1VQ4 A;  1NY4 A;  3H15 A;  1YIT A;  4JI7 Q;  4MNO A;  1JB7 A;  1BVS A;  3A74 A;  2PI2 E;  3FHW A;  1VQN A;  5C4J H;  4OX9 L;  4AH6 A;  3ERS X;  1IBL L;  3PO2 H;  3M4O H;  4JG2 A;  4POF A;  1OTC A;  3GTK H;  4JC0 A;  2CWA A;  3ULJ A;  3CC2 A;  3PUY A;  2K5V A;  4JI3 L;  1QVF A;  4OO1 G;  4LF4 L;  2CKZ B;  1OXU A;  4IPG A;  1GD7 A;  4DR1 L;  4A3F H;  3GTO H;  1XNQ Q;  2ASB A;  1N8R C;  1YJ9 A;  2AWN A;  2HIV A;  4PZ7 A;  4AQY L;  1A0I A;  2PQA B;  3KJO A;  3AFP A;  1AE2 A;  1YBY A;  1L1O C;  2L15 A;  4FDB A;  4TVA B;  1G51 A;  1OXS C;  1YHQ A;  1PH7 A;  4OWW B;  3CCQ A;  2B3G A;  5IYD G;  3BZK A;  5LMN W;  1PVO A;  3FP9 A;  3PUZ A;  2UXC Q;  1C0A A;  1SRO A;  3H0G G;  3WWV A;  3UDG A;  2NVT H;  3A0J A;  4A3G G;  2JJQ A;  4PZ6 A;  1TWF H;  3KFU A;  4BA1 I;  4JYA L;  3PUX A;  5C3E G;  4BBS H;  2MNA A;  2NZH A;  4LFB L;  4BXX H;  3GTQ H;  1LM0 A;  3I7F A;  4HIO A;  3AEV A;  3TQY A;  2K5H A;  1EWI A;  3UE0 A;  1VQC A;  3EN2 A;  4GKK Q;  2R92 H;  5K36 G;  1IBM L;  2ZTC A;  1E22 A;  1KC8 C;  4X64 Q;  2IHF A;  3W5O A;  4LUV A;  4B3T Q;  5IWA Q;  2GN5 A;  4DR7 Q;  3UE1 A;  1AH9 A;  4UPA A;  4X62 Q;  2HHH Q;  3L7Z C;  4A76 A;  4LF6 Q;  1XMQ L;  3STB C;  4RMF A;  1NJI C;  4JI8 L;  3KDF A;  1J5E L;  4C2M H;  1YJW A;  3T1Y L;  3I4O A;  1W3S A;  2K75 A;  4DV6 Q;  3JAM c;  2E2I H;  4BA2 I;  4A3D H;  4A3C G;  3RZD H;  4KHP Q;  3J81 i;  3HOY G;  1PH4 A;  5IT9 c;  1UE7 A;  4B3S L;  3D0F A;  1E24 A;  5GRO A;  2WAQ E;  1EOV A;  3TRZ A;  1CKM A;  1Q7Y C;  1XNR Q;  4LNQ A;  2VQF L;  4A3I G;  1ASY A;  2NZO A;  5IYC H;  1N33 Q;  4R4Q A;  4B3M Q;  2HT1 A;  2JA9 A;  4GKJ L;  5IP7 G;  2F3I A;  4GNX B;  1KAW A;  2UXD Q;  2VUM H;  1L1O A;  1Q82 C;  4R1J A;  2QEX A;  1YHB A;  2VS1 A;  1TWA H;  2EXD A;  2AMC B;  1OXX K;  1WCM H;  1I5F A;  4IO9 A;  4LF5 L;  2V1C C;  1AE3 A;  4P75 A;  3HOZ H;  2ZJR A;  4RG1 A;  3J7A 5;  1W2B A;  1HNX L;  2R93 G;  3GO5 A;  2OQK A;  3ULP A;  2ZTE A;  2EQS A;  4IFD J;  1SRU A;  3UDX A;  2YTY A;  2Y0S E;  1PYB A;  4DAM A;  4B3R L;  4KLK A;  4GN5 A;  1SLJ A;  2JA7 G;  4O0A A;  3TS2 A;  3CCU A;  2ALY B;  3KF6 A;  4JI2 Q;  4GOP A;  4QQB X;  1XMO L;  2B63 H;  1WJJ A;  5C0X J;  1UE6 A;  3CCM A;  3HOW H;  1G29 1;  3ICE A;  4OX9 Q;  1JJ2 A;  4IPH A;  2UXB Q;  4IPC A;  4A3L G;  1GO3 E;  1Q1E A;  1Z47 A;  1JT8 A;  1RIP A;  1V1Q A;  3BJU A;  5IE8 A;  1E7Z A;  1EFW A;  1I3Q H;  1CKN A;  5JEA G;  3F2B A;  1N36 Q;  2F52 A;  4JI3 Q;  2BA1 A;  3KJP A;  1HR0 L;  4DNI A;  4JI6 L;  2JA8 H;  5DLQ E;  2Q2H A;  3UDI A;  4OO1 I;  4BY1 H;  2VY3 A;  1YJN A;  5E7N A;  3M3Y H;  3K80 C;  1N9W A;  1UWV A;  4JI5 L;  4R4T A;  3K7U C;  2WB1 G;  1K83 H;  1HJP A;  3E9H A;  4LFC L;  1PH1 A;  1KRS A;  1VS0 A;  2E8G A;  3OW2 A;  1HH2 P;  4IPD A;  1K8G A;  4JYA Q;  4GLV B;  4J15 A;  3I4M G;  1VQ9 A;  4DPG A;  5LMU L;  1YNX A;  3RLN A;  1JJG A;  5C4X H;  3CCV A;  3J80 c;  1QUQ B;  3J81 c;  1G6P A;  4P73 A;  1DGS A;  1VQM A;  2AWO A;  4DUY Q;  1B70 B;  1OXT A;  2XGT A;  3K0X A;  3UDF A;  1VQG A;  5FLX c;  3U4V A;  5H1S E;  1P16 A;  4R4I A;  1IBM Q;  3GTG H;  4X66 L;  4JV5 Q;  5IYD H;  3H0G H;  4GLX A;  2VQE L;  4BBR G;  1KIX A;  1MJE A;  3CD6 A;  4A3G H;  4MZ9 A;  1XMQ Q;  4DV4 Q;  4HJ9 A;  4MTN A;  2A8V A;  2LXJ A;  5C3E H;  1TXY A;  1J5E Q;  2PQA A;  4GNX C;  3T1Y Q;  2ES2 A;  2UUA Q;  4O2D A;  1C7Y A;  5ELO A;  2JE6 I;  1L0W A;  3RNU A;  3CW2 C;  4AYB G;  4LUO A;  3GDE A;  3D31 A;  1IZ6 A;  2OQ0 A;  3PGZ A;  4DV5 Q;  3CQZ H;  4NPS A;  1K9M C;  4DR4 L;  4A93 G;  2JA5 G;  2VQF Q;  5IP9 G;  1YVC A;  2QA4 A;  4YHH L;  4JI1 Q;  1GVP A;  4X6A H;  1BBU A;  1PV4 A;  4DV2 Q;  3PF4 A;  3MXN B;  4BY7 G;  4JI0 Q;  5IY0 A;  2RF4 A;  4JI4 Q;  2R7Z G;  4A3C H;  1N32 L;  4K0K L;  4DAY B;  2CWP A;  4APV A;  3HOY H;  2Z6K C;  4LF8 Q;  4QGU A;  3EBE A;  1FGU A;  1NBW A;  3M4P A;  1PH3 A;  1HNX Q;  3NEN A;  3S1R H;  3PO3 G;  2MFI A;  4DV1 L;  1MIU A;  1SE8 A;  4YY3 Q;  1VQF A;  2I5H A;  4A3I H;  3PIP A;  4QY7 A;  3GTJ H;  4DV7 Q;  2OTJ A;  1LTL A;  2BH2 A;  5IP7 H;  3CAM A;  3U58 A;  1PH6 A;  4NXN L;  3J7Z C;  1Y1V G;  1VQL A;  4WJ4 A;  1SN8 A;  1Q1B A;  4A3E G;  3S1N H;  3HOX G;  1K0R A;  1BKB A;  1Y1W H;  4HJ7 A;  1E3P A;  3KF8 B;  2PI2 A;  4ME3 A;  2JEB I;  4OON A;  4DUZ L;  3T1H L;  2XTI A;  4R4O A;  1PA6 A;  1HR0 Q;  2IY5 B;  2N8N A;  2Q2U A;  5AJ3 L;  2DUD A;  3L2P A;  4DV3 L;  5EAY A;  4GNX A;  2JA7 H;  1V43 A;  1X56 A;  1Q12 A;  2QGQ A;  2CCZ A;  2AKW B;  3AQQ A;  1J6Q A;  2K52 A;  1N34 L;  1T9H A;  2VZA A;  1D8L A;  2B29 A;  4PMW A;  1QVG A;  2OTL A;  4LWC A;  4HJA A;  2WAQ G;  2VL6 A;  4L5Q A;  1EQQ A;  3J80 i;  3PUW A;  5M3M G;  4JI5 Q;  4XIG S;  4A3L H;  4LFC Q;  3NBH B;  1IBK L;  3PUV A;  2A19 A;  4DK3 C;  5BR8 L;  4DR2 Q;  3CCL A;  3G4S A;  3HFZ B;  1MKH A;  3OTO L;  3OYY A;  4NXM L;  2BH8 A;  4JCV E;  5LMU Q;  2F4V L;  4DR5 L;  1OXV A;  1VQE A;  1D7Q A;  2WFW A;  1I94 Q;  1E1T A;  1WFQ A;  4X65 Q;  1Q46 A;  4JOI C;  3K8A A;  1QZH A;  1HNZ Q;  1X3F A;  4PG3 A;  4LW1 A;  4DR3 Q;  3F2C A;  1BBW A;  4YWK A;  3CC4 A;  3A5Z B;  2Y0S G;  1VQB A;  2VQE Q;  3A5U A;  3I2Z A;  1NMF A;  1TWH H;  2VW9 A;  2OCE A;  1KRT A;  3CPW A;  3ER0 A;  1VQI A;  1HZA A;  2UU9 L;  2UUC Q;  3I4M H;  3CC7 A;  5JJL A;  1V9P A;  3HKZ E;  3LGJ A;  3PSI A;  3W1G A;  3CF5 A;  4JBM A;  4JBW A;  2RHS B;  3CCS A;  4A3M G;  5IYB G;  4IOA A;  3S24 A;  5ELN A;  4BBS G;  1M90 C;  1FVI A;  1PH2 A;  1EUJ A;  1IBL Q;  4C3I H;  2LXK A;  1XPO A;  5JJI A;  2UUB L;  3KDF B;  4Y7N H;  3CCR A;  4BBR H;  3DM3 A;  4YHH Q;  4A3K G;  2I5L X;  3G71 A;  3RR5 A;  1CKO A;  4LF4 Q;  1XPU A;  4DR1 Q;  5LMN L;  4KHZ A;  3K81 C;  1QUQ A;  2UXC L;  2CQO A;  4AQY Q;  1KXL A;  1Y14 B;  1JJC B;  4L5T A;  5GAD C;  1N32 Q;  3STB D;  4K0K Q;  4GN4 B;  1WYD A;  1X65 A;  3PCO B;  4TQU S;  3ZJY C;  1VQ8 A;  2MO1 A;  1X54 A;  1YEZ A;  3U50 C;  2HQL A;  1I50 H;  3GD7 A;  1S40 A;  3M7N A;  3PF5 A;  4AIM A;  2JA5 H;  2ATW A;  4A93 H;  3IRB A;  5IP9 H;  3CCE A;  2FXQ A;  1JE5 A;  1LUZ A;  4GKK L;  5M3F G;  4LFB Q;  4UP8 A;  1HZC A;  4UP9 A;  1X3E A;  4BY7 H;  3HOV G;  4B3T L;  4Y52 H;  3KYH C;  4DR7 L;  2PNH A;  2I5M X;  4P71 A;  4DR2 L;  3RN5 A;  2R7Z H;  4X62 L;  3F1Z A;  2ZM6 L;  4EQ5 A;  2YTX A;  2D62 A;  1ASZ A;  4A4I A;  3M9B A;  1S72 A;  3KLW A;  3T1H Q;  4GOP B;  3HOU G;  3S16 H;  4DKA C;  4C3H H;  1QZG A;  3PO3 H;  5AJ3 Q;  4DV3 Q;  4HJ8 A;  1VQ6 A;  2D0P A;  4QJF A;  2R93 H;  1N34 Q;  4JI8 Q;  1H95 A;  1A63 A;  4PZ8 A;  1A8V A;  1VQJ A;  3TEH B;  2Q2I A;  4YCU A;  1Y1V H;  1CSP A;  2IT1 A;  1XNR L;  2NN6 G;  2YU9 H;  1B8A A;  4A3E H;  3MEF A;  2YYZ A;  3HOX H;  3I4N G;  2RHQ B;  4B3S Q;  2KHI A;  3E9I A;  1SFO H;  2ZJP A;  2UXD L;  1MJC A;  1JMC A;  5HY6 A;  2IHE A;  2Z0S A;  4GS3 A;  2NVY H;  1X3G A;  4YWL A;  3F2D A;  4NXM Q;  2N3S A;  5J3B A;  3CME A;  4DR5 Q;  4GKJ Q;  1VQH A;  4OXP A;  3RLF A;  1B7Y B;  4JBJ A;  2CFM A;  2JQO A;  2PMZ E;  4DR6 L;  1A62 A;  2YTV A;  2H5X A;  1UE1 A;  5M3M H;  1YHA A;  1L2F A;  4HIM A;  4LF5 Q;  4YCV A;  2ID0 A;  1CSQ A;  2KCT A;  1VQP A;  2OWO A;  4WJ3 M;  4LFA L;  1HNW L;  2UXB L;  1WOC A;  3SGI A;  4B3R Q;  5JEA J;  1P8L A;  2UU9 Q;  1UEB A;  5FLM G;  3W1B A;  4AYB E;  2EIF A;  1XMO Q;  2NVQ H;  2IX1 A;  1X9N A;  3VDY A;  4IFD G;  4HID A;  4DV0 L;  4A75 A;  1U5K A;  3GTP H;  1N36 L;  1GKH A;  2E5L L;  1TWC H;  4IJH A;  1WI5 A;  2ZTD A;  3TRE A;  2ZJQ A;  2UUB Q;  3AYH B;  5C4X G;  5C0X G;  3G48 A;  3KOJ A;  4LUZ A;  4IJL A;  2JA6 G;  4JI6 Q;  1IXR A;  1K73 C;  3BU2 A;  1EQR A;  4OWX B;  2D0O A;  1PH5 A;  1HR0 W;  2NVX H;  4P72 A;  5LMN Q;  3ULL A;  1NMG A;  5C44 G;  1PHJ A;  1Q8K A;  3FKI G;  2JK8 A;  3I55 A;  1PH9 A;  4YWM A;  1YIJ A;  4A3B G;  1C9O A;  2IX0 A;  3PV0 A;  1QVC A;  4A3M H;  3CPF A;  5IYB H;  1R9T H;  5FJ8 G;  4LF9 L;  1NTG A;  4A3J G;  4GOP C;  3S1M H;  1YI2 A;  4LF7 L;  2JEA I;  4A3K H;  4DUY L;  3S17 H;  1VQO A;  3PO2 G;  2VNU D;  4JV5 L;  1EIF A;  2GVB A;  3CP0 A;  1HZ9 A;  3E0E A;  2ZM6 Q;  4GN3 B;  1UE5 A;  2Z6K A;  4QL5 A;  4DV4 L;  2KBN A;  4A3F G;  2E2H H;  4X66 Q;  3RN2 A;  1VQD A;  1U0L A;  1FJG L;  2UUA L;  4UP7 A;  5GAE C;  1TWG H;  4JI7 L;  4UY8 C;  3HKZ G;  4OWT B;  3B6Y A;  3BZC A;  5M3F H;  4ALP A;  1K3R A;  4POG A;  1XJV A;  2HIX A;  3Q8D A;  2E2J H;  1YZ6 A;  1K8A C;  4DV5 L;  1RL2 A;  3GTM H;  3HOV H;  3S1Q H;  5HGQ A;  5M5X H;  4JI1 L;  3CXC A;  2R7F A;  2R6G A;  1S3O A;  2NN6 I;  1CUK A;  2GVA A;  2BA0 A;  4L5S A;  1XNQ L;  3NEL A;  4DV2 L;  3CCJ A;  4BXX G;  4DR4 Q;  1O7I A;  2LSS A;  3RLO A;  3M85 A;  3HOU H;  3M4Q A;  4JI0 L;  2AHO B;  4JI4 L;  1Y1W G;  1KHI A;  2R92 G;  3RZO H;  2RCN A;  4LF8 L;  4EX5 A;  4HJ5 A;  5M5W H;  3H3V I;  4DR6 Q;  2MO0 A;  1SR3 A;  4DK6 C;  1VQ7 A;  4YY3 L;  1Z9F A;  4L5R C;  4R4C A;  4DV7 L;  1XTD A;  3HKS A;  3I4N H;  1KQS A;  1Q81 C;  4LFA Q;  1HNW Q;  1I6H H;  4DV1 Q;  4A3D G;  4IOC A;  1L1O B;  5GAH C;  1EIY B;  1VQK A;  1VQ5 A;  2K14 A;  1VCI A;  3S2H H;  3NEM A;  1FL0 A;  4HIK A;  3H3V H;  2Q2T A;  1E1O A;  4DV0 Q;  2DGY A;  3GTL H;  1PFS A;  2E5L Q;  4X64 L;  4NXN Q;  4JOI A;  5IWA L;  2YV5 A;  4IFD I;  5IYC G;  2K50 A;  4NB3 A;  2HHH L;  4LF6 L;  2N78 A;  1SMX A;  3F8T A;  3U4Z A;  3S2D H;  3CMA A;  3EIV A;  2KHJ A;  2WP8 J;  4DUZ Q;  2VUM G;  3KF6 B;  4QIW E;  4H02 A;  5C0X I;  2A1A A;  4DV6 L;  1XPR A;  4KHP L;  1X6O A;  2R7D A;  1KL9 A;  1VQA A;  1WCM G;  4C3J H;  1PH8 A;  5FLM H;  1KD1 C;  3HOZ G;  3K7A H;  3TS0 A;  1Q86 C;  3L0O A;  1CKN B;  4XTC S;  2MQH A; 
#chains in the Genus database with same CATH topology
 5BN5 A;  5IGE A;  4LF9 Q;  1B04 A;  1S10 A;  2C35 B;  1DZ1 A;  2PO4 A;  3S15 B;  1RF2 D;  2SDF A;  4LF7 Q;  4R9W A;  2BE5 D;  4QUC A;  1IBK Q;  2JA6 H;  4DV0 H;  1L0X B;  3HOW G;  2FMM A;  4KV6 A;  2X6G A;  5GAG C;  3AFQ A;  3OTO Q;  1PTO C;  3T5J A;  5C1O A;  3Q8R B;  4EBE A;  1YNN D;  1JR0 D;  3FKI H;  3K5I A;  1TS5 A;  4O2B F;  3NWS A;  5L1L A;  3BA8 A;  2E2I A;  5EKI A;  3JC6 6;  5BN4 A;  3S15 H;  4K2K A;  4BY1 G;  1FJG Q;  3BQ2 A;  4FO2 A;  4PDB A;  4JI2 L;  2V5A A;  1ESR A;  1BCP F;  4JI7 Q;  4MNO A;  4DXF A;  1BR9 A;  4Q44 A;  1Z6H A;  5ELE A;  4OX9 L;  1FKA H;  3RMH A;  2O4X A;  1OTC A;  4ZCK A;  4MV8 A;  4C1N K;  4KKU A;  3JRX A;  3RJ0 A;  2VUG A;  4JI3 L;  1UAP A;  3AMU A;  4DUY H;  2R7M A;  4LF4 L;  2CKZ B;  4DR1 L;  2PZU A;  1GD7 A;  1GUS A;  4J0M A;  4AQY L;  5IGB A;  5CGK A;  4KY6 A;  4FDB A;  2L15 A;  1YHQ A;  4ED2 A;  1DJR D;  1EY9 A;  4ED8 A;  1SRO A;  1B44 D;  2NVT H;  4Q0F A;  4A3G G;  1G91 A;  4RGM A;  3RAQ A;  2PN1 A;  3HP3 A;  4QF4 A;  5C5M A;  5LP6 F;  2C28 A;  2RSO A;  4HR7 A;  2QIL A;  4M8A A;  3AEV A;  2DN8 A;  3FVQ A;  5KFC A;  3TQY A;  2K5H A;  1EWI A;  4CHT B;  2R92 H;  5K36 G;  2ZTC A;  1XNQ H;  4DV2 H;  4EGV A;  1E22 A;  5FD6 A;  3KTM A;  5KFA A;  5IWA Q;  2GN5 A;  3H94 A;  4FBU A;  4UPA A;  3KHR A;  4X62 Q;  2SEB D;  4G7Z C;  3GTM B;  3L7Z C;  1KJI A;  4AYB A;  2Z6B A;  4B08 A;  5M5X B;  2CH4 W;  1NJI C;  4K6L A;  1SEI A;  4C2M H;  1YJW A;  3T1Y L;  3I4O A;  3I4L A;  4DV6 Q;  2VUM B;  4A3D H;  4KY7 A;  4EQN A;  5JPM C;  3J81 i;  3AB9 A;  1UE7 A;  3D0F A;  2WAQ E;  5E4X A;  3RB4 A;  3KHH A;  2HGS A;  4A3I G;  2HT1 A;  5KFY A;  4R4Q A;  3PMF A;  4GKK H;  3GTG A;  3MA2 B;  1LTR D;  2VUM H;  4DR7 H;  3R93 A;  2I07 B;  4F88 A;  2QEX A;  1Y8O B;  4LF6 H;  1GUN A;  5JVD F;  4LF5 L;  5A2Q E;  2R93 G;  4RG1 A;  1HNX L;  3S2H B;  1HQM C;  1Y8N B;  2A68 C;  2K6A A;  3HB9 A;  4RAY A;  1PYB A;  5KFN A;  1C8C A;  3KF6 A;  2FK2 A;  4G3I A;  5C0X J;  1RJP A;  4IPC A;  4A3L G;  2R7L A;  1Q1E A;  4B3M H;  1Z47 A;  4IWX A;  1MBY A;  2EY2 A;  1HHV A;  2C2D A;  2HVS A;  3OPO A;  2A6H C;  1N36 Q;  2H4O A;  1HR0 L;  5DLQ E;  2MPM A;  2KUM A;  1JWU D;  4OO1 I;  2VY3 A;  1YJN A;  1BCP D;  2NWG A;  1STY A;  1N9W A;  2A6E C;  3GIL A;  5E1F A;  4JI5 L;  3K7U C;  2RBM A;  1HJP A;  4IUT A;  4RB3 C;  1Y8P B;  1K8G A;  1NR2 A;  3MHB A;  3HGB A;  2YS7 A;  4DPG A;  1SBB B;  2F0P A;  5C5L A;  4DL3 A;  3J80 c;  1QUQ B;  1SNO A;  3J81 c;  4P73 A;  1EY0 A;  3N40 P;  2NVX A;  3N43 B;  1B70 B;  2XGT A;  2FK1 A;  1IBM Q;  3UDF A;  4R4I A;  4C3I G;  1RDP D;  3N6R A;  5C4J B;  3M4O B;  4RNO A;  4MZ9 A;  1XMQ Q;  1STG A;  1TA8 A;  2IA6 A;  3BVZ A;  3MXG A;  5C3E H;  3J7A V;  1TXY A;  1IKL A;  4ODG A;  4O2D A;  1I7L A;  2VB3 X;  5DLG A;  1SYB A;  3RBE A;  4UFZ A;  1IKM A;  3D31 A;  4JYA H;  4I65 A;  3K3V A;  5IGC A;  1F2Z A;  2PNR C;  5CAE B;  3Q23 A;  2L55 A;  2W9A A;  1CK1 A;  4A93 G;  4EEY A;  3K5O A;  5JQW A;  5FO8 B;  2E2H A;  2B39 A;  3MXN B;  4BY7 G;  2RDG A;  1GSH A;  3VYR A;  1RTN A;  1TQO A;  4MTE A;  5I4D A;  4A3C H;  1N32 L;  4DAY B;  4DV4 H;  2CWP A;  3HOY H;  4QWD A;  4DK1 A;  4OHJ A;  3WO1 A;  5L1K A;  5I9O A;  1J5E H;  3NEN A;  1BJT A;  4C3H G;  2MFI A;  3H09 A;  2HVR A;  3Q24 A;  1SXT A;  1VQF A;  1I4H A;  5J2T F;  4QY7 A;  3DEP A;  3NK9 A;  4HAE A;  3R8B A;  2JEG A;  5HUR A;  1L0Y B;  2JSO A;  3SK4 A;  2GLT A;  2I46 A;  3J7Z C;  2VQF H;  5FOB B;  2H1E A;  4DNT B;  2QK4 A;  2E2I B;  3X3N A;  4A3E G;  3HOX G;  3KHL A;  4ED3 A;  1D6E C;  1E3P A;  2PI2 A;  2NTS A;  4DUZ L;  1PZJ D;  3T1H L;  1PA6 A;  2K04 A;  4JI0 H;  2N8N A;  2Q2U A;  2EYH A;  3L2P A;  2JEF A;  4GNX A;  3H20 A;  3PF4 A;  1Q12 A;  1J6Q A;  1O7Z A;  1SE3 A;  2K52 A;  2G5D A;  3I70 A;  1U4L A;  1KC7 A;  4QMG A;  1RCV D;  1T9H A;  1TVX A;  4PMW A;  1VBG A;  5EOY A;  1WVL A;  4ECV A;  1BUV T;  4DV7 H;  3Q0A A;  4LFC Q;  2EYO A;  2F0T A;  1ICW A;  4JV1 A;  2DY8 A;  2F0J A;  4YR3 A;  2B8F A;  2DZD A;  3OUZ A;  1VQE A;  3D4D A;  3G6Y A;  1E1T A;  1BXT A;  3JZI A;  1IOW A;  1EUD B;  1TY0 A;  3K8A A;  4G7O C;  1EY4 A;  1QNK A;  3HOW B;  2ASL A;  2XGQ A;  2F1M A;  4JV2 A;  1VQB A;  3KAJ A;  3A5U A;  4HR7 B;  2F0E A;  2DJF C;  4OEM B;  3ER0 A;  1V1P B;  3VYU A;  3CC7 A;  1V9P A;  3HKZ E;  3CRK C;  3VR6 A;  3PSI A;  3BS1 A;  3W1G A;  4BY1 B;  2NUA B;  4CGY B;  2RHS B;  4DR2 H;  1SNQ A;  5ELN A;  4AYB B;  4BBS G;  3MR2 A;  5LMU H;  2PYK A;  4YR2 A;  4I7H A;  2PW7 A;  1K83 B;  1I94 H;  3DM3 A;  4CKB A;  2K28 A;  4DU9 A;  4YHH Q;  1I4G A;  3G71 A;  4X65 H;  4LF4 Q;  4DR1 Q;  2X69 A;  1GGO A;  1ZET A;  4AQY Q;  1LTB D;  4YB8 B;  2VQE H;  4EBD A;  1HA6 A;  3STB D;  4ED1 A;  3EVQ A;  4V0B A;  1WYD A;  1KTK A;  3PCO B;  1B6R A;  4HNT A;  1GHK A;  1X54 A;  4K8I A;  4GC6 A;  2HQL A;  1OWT A;  3GTG B;  5JJZ A;  3GIM A;  2QDB A;  3R3O A;  1OO9 B;  2EJM A;  2GPS A;  1SYG A;  3CCE A;  2F03 A;  4A3G B;  1KJQ A;  2FXQ A;  4GKK L;  4UP9 A;  3NTH A;  3TII A;  3HOV G;  2V4Q A;  3ETJ A;  4DR7 L;  2W9C B;  3RN5 A;  4IRD A;  5L1I A;  4A4I A;  3I73 A;  1CS0 A;  1S72 A;  3GIQ A;  4ULL A;  5FK9 C;  3HOU G;  2CZG A;  3HZX A;  5CC4 A;  5LL6 X;  5CV6 A;  4HJ8 A;  2XCP A;  4K0K H;  2D0P A;  4IAL A;  3RUP A;  2FMC A;  1N34 Q;  1EY6 A;  3GTQ A;  3KK7 A;  1Y1V H;  1Z2O X;  2SOB A;  5DQG A;  4TV9 F;  5C4Z A;  2FPP B;  5EGT A;  1B8A A;  5L1J A;  5KFH A;  5JVH 3;  3TQT A;  3HRZ C;  4LH6 A;  2M00 A;  3E9I A;  4CC5 A;  1MJC A;  4BS9 A;  2IHE A;  3TP5 A;  3JAM L;  1BXR A;  4TV8 F;  3Q8S B;  2N3S A;  3CME A;  4A3I B;  3D4W A;  5ELD A;  4ZKC B;  2NVQ B;  4JBJ A;  3G8C A;  4MA0 A;  4DL7 A;  4HNV A;  2GPW A;  4IRK A;  1BNC A;  4HIM A;  4KKS A;  4LF5 Q;  1SMY C;  3V2T A;  2ID0 A;  1EL0 A;  4R8U A;  2VA3 A;  2R93 B;  1WOC A;  4NW2 A;  3SGI A;  4CDC C;  5JEA J;  2UU9 Q;  2M9V A;  2NVX B;  2B2U A;  2NVQ H;  3GIK A;  4B3S H;  1VDZ A;  3VDY A;  1SNC A;  2DNC A;  4HID A;  4IFD G;  3A8J E;  3N41 B;  1WI5 A;  2ZTD A;  3NBH A;  3TRE A;  2ZJQ A;  4DR5 H;  2EVB A;  1WCM A;  4ME6 A;  1B4O A;  2CH4 A;  2RDI A;  1J9O A;  2VB2 X;  3KOJ A;  4LUZ A;  2JA6 G;  4J9R A;  4IUV A;  4KHV A;  1PTO D;  2NVX H;  3BU2 A;  1O78 A;  4EBC A;  5CV5 A;  4P72 A;  2G9D A;  1GUW A;  4IR1 A;  4QIW B;  2R84 A;  1PHJ A;  1Q8K A;  3FKI G;  3ORR A;  4YWM A;  2B63 A;  2KEC A;  1FNW A;  1K3B C;  3OMC A;  1QVC A;  1W93 A;  2OLS A;  4LF9 L;  5DM6 3;  2O5I C;  1RK5 A;  4GOP C;  2OEO A;  2JXM B;  4EGQ A;  4LF7 L;  4A3K H;  3R5H A;  4QW8 A;  3SI8 A;  1XWE A;  1KJ9 A;  2XVS A;  2UUB H;  2GVB A;  5M3F B;  3C46 A;  3CP0 A;  4XYL B;  4CC6 A;  1HZ9 A;  4JI6 H;  2ZM6 Q;  2XD4 A;  4GN3 B;  1G2S A;  1UE5 A;  4QL5 A;  4DV4 L;  5LMN H;  2BDN A;  2E2H H;  3T56 B;  3RN2 A;  2HVQ A;  2AQ1 B;  2WAC A;  1FJG L;  4NMZ A;  4XXE A;  4C3I B;  1WTW A;  4JI7 L;  2NU7 B;  2V4D A;  3K0Y A;  1AN7 A;  1PTO B;  4ZOL F;  3BZC A;  5FLX L;  3I90 A;  5M3F H;  3BDL A;  3FDT A;  1K3R A;  5CB4 F;  2E2J H;  4DV5 L;  1T5E A;  3S1Q H;  2KJX A;  1SYX B;  2JA6 A;  2TMP A;  2R7F A;  1BQQ T;  2DY7 A;  2NN6 I;  2GVA A;  5D14 A;  2HD3 A;  3J80 E;  1MHW C;  3NEL A;  3J81 E;  3CCJ A;  1HTP A;  2VPS A;  2LSS A;  3M9O B;  3FKI A;  3H0G A;  4RFB A;  2KED A;  4JI0 L;  2AHO B;  2WYO A;  4ZYS A;  4A93 B;  2DWC A;  2R92 G;  2HCI A;  4EX5 A;  4JV0 A;  4FS2 A;  4BY7 B;  4C5C A;  1EU4 A;  1EOT A;  4DK6 C;  1PMR A;  1VQ7 A;  4F4Z A;  4DV7 L;  4O4H F;  1Q81 C;  2EYJ A;  1EY7 A;  4A3D G;  1CE8 A;  1A6X A;  4C3H B;  3VR5 A;  3NEM A;  2FP4 B;  2Q2T A;  3GTL H;  4DV0 Q;  1M7J A;  3NE5 B;  5JAV A;  5IWA L;  3ND8 A;  2YV5 A;  1O75 A;  5KFQ A;  4ZK9 B;  1GHJ A;  5KT5 A;  4RCN A;  4A3E B;  4DUZ Q;  3HOX B;  2VUM G;  2FLN A;  5FPR A;  3SK6 A;  2NYZ D;  4LJZ C;  1EHI A;  2A1A A;  4DV6 L;  1XPR A;  4HCS A;  1PH8 A;  5FLM H;  3K7A H;  2A68 D;  4MV3 A;  5C44 B;  3KXY T;  4LFA H;  2K03 A;  4Q45 A;  1Q86 C;  2UXB H;  4RA8 A;  4DR2 L;  1FD7 D;  2AGQ A;  4XTC S;  2BOS A;  2WB1 E;  2SNS A;  3Q22 A;  5KG5 A;  1AN8 A;  2BDO A;  2D5D A;  1GM5 A;  3R2T A;  1VMP A;  3MR5 A;  3L9A X;  5C0X H;  4JBK A;  1HZB A;  5I2Y A;  1IL2 A;  1I94 L;  5GQO A;  4I55 F;  2E5L H;  2FKL A;  4X65 L;  3PIO A;  1B53 A;  5A2Q W;  5M5Y H;  2HQE A;  5E3F A;  1A15 A;  5KFU A;  3DLL A;  1NE3 A;  3S14 H;  3NSW A;  5C44 H;  5KG6 A;  3J81 j;  2EJF C;  2A6H D;  2UVU A;  4X3S A;  2KCM A;  2YCH A;  4DNR B;  3GTP B;  1GSO A;  4ED7 A;  3KF8 A;  4CKC A;  1TWC B;  2K4K A;  2K5Q A;  1VQ4 A;  1QOH A;  2A6E D;  4LAA A;  1VQN A;  2CW0 C;  3KBX A;  5EPJ A;  3BG3 A;  3OUU A;  5GON F;  3UFX B;  3PW5 A;  5KFT A;  3PO2 H;  4JC0 A;  3H3V C;  2LFN A;  4MA5 A;  3DHQ A;  3CC2 A;  2K5V A;  1XYI A;  3HG9 A;  2X0S A;  4Q5V A;  1FYC A;  1O80 A;  4IPG A;  4RAU C;  1XNQ Q;  4BBS B;  2WB1 A;  1M0W A;  1JKJ B;  2PQA B;  1E4F T;  3AFP A;  3GTQ B;  1TWH A;  1OXS C;  1T5X D;  5TSS A;  4OWW B;  1CFM A;  1TS2 A;  5LMN W;  1CQJ B;  3S17 B;  3FP9 A;  3M9N B;  5HV6 A;  4F4X A;  2UUA H;  3V6K A;  1S5C D;  3A0J A;  3KFU A;  4ZRZ A;  4IQZ A;  1Z2P X;  1ML0 D;  2W6M A;  5C3E G;  4BBS H;  2MNA A;  2NZH A;  4BXX H;  2R87 A;  3GTQ H;  1LM0 A;  5KFG A;  5CMD A;  2A74 C;  4GKK Q;  4HSP A;  1LTA D;  4TKO B;  1IBM L;  3OSP A;  5HBR B;  3OWE B;  4MIU A;  1EZ6 A;  1C4Q A;  1QG7 A;  4LUV A;  4DR7 Q;  2W8K A;  4J9S A;  3MFH A;  3HOV B;  1B2T A;  5J1Z A;  1TII D;  4LF6 Q;  1XMQ L;  3IG0 A;  1S5D D;  3STB C;  4RMF A;  3OSN A;  1U4R A;  1A2T A;  2F0D A;  4JI8 L;  2UXC H;  3QZ8 A;  2C00 A;  3KDF A;  2K75 A;  4A3C G;  2JA5 A;  5J22 A;  3RZD H;  3HOU B;  3HOY G;  5KYL A;  3V4Z A;  3WDN A;  4B3S L;  1V1O A;  3RZO B;  2ZDG A;  1EOV A;  1CKM A;  1Q7Y C;  2K7V A;  4LNQ A;  2F0H A;  4MAM A;  4B3M Q;  2W7O A;  2AUK A;  4GKJ L;  3WOE A;  3KUP A;  1MGS A;  4UCR A;  4QB4 A;  4X64 H;  1L1O A;  3QO2 A;  3DXJ C;  3OMG A;  3N8D A;  4G7H C;  2HHH H;  2VS1 A;  1UUP A;  2EXD A;  2NU9 B;  2UVV A;  1WCM H;  2E76 C;  4IO9 A;  1U4M A;  1LAB A;  1W2B A;  3PW0 A;  3MFY A;  2OQK A;  4DL4 A;  1ENA A;  2FJ2 A;  3K59 A;  1MI2 A;  4KHP H;  2Y0S E;  4B3R L;  1QCB D;  5T14 A;  4EYI B;  2YU9 A;  4GN5 A;  4PWQ A;  1S5F D;  4O0A A;  1JQY D;  4GOP A;  2L4N A;  2B63 H;  1XNR H;  5KFX A;  5KFM A;  1WTQ A;  1N33 H;  1QWY A;  4LK1 C;  2HDL A;  1CKN A;  3F2B A;  4JI6 L;  2F52 A;  1W96 A;  2BA1 A;  3KJP A;  2R8J A;  2JA8 H;  1XX8 A;  2Q2H A;  1ENF A;  1N48 A;  3P20 A;  4KK7 A;  1WTX A;  2WIN B;  2DLN A;  3GV7 B;  5E7N A;  2XIG A;  3K80 C;  2JA6 B;  5COR A;  1UWV A;  4R4T A;  4DAV A;  1EFI D;  3E9H A;  4LFC L;  1PH1 A;  5L9X A;  1KRS A;  1X3P A;  3K5N A;  2E8G A;  1PFB A;  3FKI B;  2R8K A;  4IPD A;  4O3R A;  4JYA Q;  3W3A A;  4C56 C;  4GLV B;  2KA7 A;  3IL8 A;  2O03 A;  3U9T A;  3RLN A;  1JJG A;  3KBG A;  1LT6 D;  3W2D A;  3K58 A;  1R4P B;  3NUC A;  2ASB A;  1VQG A;  2KHS A;  3U4V A;  1P16 A;  1EU3 A;  5IYD H;  2OT2 A;  2WII B;  4Q0Y A;  5EPL A;  3MFG A;  3H0G H;  3J7A K;  4XYQ A;  1B33 N;  4DV4 Q;  2Z4I A;  1KJ8 A;  2X6L A;  2A8V A;  4RUA A;  1KLG D;  3M4Y A;  1J5E Q;  1LTG D;  4J9P A;  4GNX C;  2ES2 A;  5C4H A;  3CW2 C;  4AYB G;  3DEO A;  4F50 A;  4IUR A;  1TS4 A;  5KFB A;  4IWY A;  3PGZ A;  4DV5 Q;  1ZXT A;  4NPS A;  1K9M C;  3MWE A;  5KT3 A;  5HGT A;  2VQF Q;  1XTC D;  2RKS A;  2FMA A;  2NVT B;  4YHH L;  1BBX C;  5KG2 A;  5KNB A;  5DG8 A;  5KKN B;  3EPG A;  4IUU A;  3PZP A;  4JI0 Q;  2EY1 A;  2RF4 A;  2XN9 C;  5IY0 A;  3V6H A;  1KDA A;  4A2A A;  4QGU A;  1HFN A;  1FGU A;  4RH6 A;  3MWY W;  2R92 B;  5CV8 A;  4RHR A;  2DNE A;  3S1R H;  5D1O A;  4QWA A;  4R8N A;  5KG4 A;  3BJY A;  5IT9 E;  4FXD A;  3A7L A;  3IAY A;  3PIP A;  4DV7 Q;  2OTJ A;  1S97 A;  1E0B A;  3BG5 A;  1PH6 A;  3U58 A;  5I6W A;  4ECZ A;  1JC7 A;  1Y1V G;  2XRQ D;  4C2M B;  1SN8 A;  1Q1B A;  4TQR A;  4KD3 A;  4A3D B;  1BKB A;  3R5X A;  2JN4 A;  3KF8 B;  4NLG A;  4OON A;  5DNF A;  4RUC A;  1X3Q A;  2DUD A;  2KEE A;  2EYL A;  4DL5 A;  1SJE D;  1X56 A;  2QGQ A;  2CCZ A;  1N34 L;  3AQQ A;  5H80 A;  4PQX A;  1S0O A;  3QZ7 A;  3KAL A;  4LWC A;  4RKL A;  2WAQ G;  4HJA A;  2VL6 A;  1M6V A;  4YY3 H;  3J80 i;  3PUW A;  1SMY D;  4XIG S;  2K5D A;  2J4X A;  2K33 A;  3MTS A;  2F0L A;  4B9X A;  2A19 A;  1C3O A;  5JEA H;  4DR2 Q;  3NQI A;  2BH8 A;  2MGS A;  5LMU Q;  3LWB A;  3I4M B;  1OXV A;  2YZG A;  2N88 A;  4MV7 A;  1D7Q A;  2WFW A;  1I94 Q;  4X65 Q;  3RB0 A;  4JOI C;  1QZH A;  4UDU C;  1NCV A;  4LW1 A;  4DL6 A;  3CC4 A;  1ESF A;  4O42 A;  1O7L A;  3ITP A;  4YWK A;  4Y8V B;  2O2L D;  1BOS A;  2VQE Q;  5EPK A;  3I2Z A;  4WFN 3;  3RB3 A;  1NMF A;  1TWH H;  3C0F B;  2I87 A;  4XX0 B;  2MJ8 A;  5IGF A;  1Y1V A;  3I4M H;  2UU9 L;  1M4V A;  2W7P A;  1ILQ A;  1QIL A;  1EZ1 A;  3NWT A;  3LGJ A;  5I47 A;  3CF5 A;  4JBW A;  2L9H A;  4IOA A;  1SYF A;  2KQ3 A;  3S24 A;  3Q8P B;  5KFI A;  1FVI A;  4PV1 C;  3MR3 A;  5JJI A;  3N42 B;  4QWB A;  4IHJ F;  3KDF B;  5EWE A;  2E2D C;  4BBR H;  4C5A A;  4A3K G;  1BO0 A;  2I5L X;  3G6X A;  4QW9 A;  1HNZ H;  4OIK A;  2WAQ A;  3RIZ A;  4KHZ A;  1RD9 D;  2UXC L;  1VF5 C;  3P75 A;  2XRS D;  4EVO A;  1KBL A;  1EWC A;  4K0K Q;  4GN4 B;  4IZ8 A;  3TSS A;  5J39 A;  2W71 A;  2UUC H;  2MO1 A;  2PQE A;  1I7N A;  1YEZ A;  1JDE A;  3GTK A;  2FIN B;  3ZYY X;  2B2T C;  3M7N A;  2EXZ A;  2JA5 H;  1G6Z A;  3URY A;  5IP9 H;  3HBL A;  1HUN A;  1LT3 D;  4CJ2 C;  5M3F G;  4Y52 H;  5C3E B;  1SEB D;  1PFN A;  2B2U C;  2I5M X;  2Z1C A;  1DCZ A;  3BAB A;  1RJT A;  1NSN S;  2ZM6 L;  2YTX A;  1EZ8 A;  1ASZ A;  3QG1 A;  2QDL A;  3KLW A;  4GOP B;  5KFP A;  2EOT A;  4DFA A;  4DKA C;  4DF7 A;  1QZG A;  3PO3 H;  5F9N A;  1GUO A;  4RU9 A;  2QW7 A;  1S5E D;  1H95 A;  4JI8 Q;  3A56 A;  4FXK C;  4HMI A;  1PK8 A;  4UCO A;  3TEH B;  4GZY C;  2Q2I A;  3D6W A;  1XNR L;  2IT1 A;  3J80 W;  3J81 W;  2YU9 H;  2RDJ A;  1BCP B;  3MEF A;  1KDC A;  2YYZ A;  3HOY B;  4B3S Q;  5DQH A;  3A8K E;  3LP8 A;  2UXD L;  1JMC A;  3H91 A;  2Z0S A;  3F2U A;  4YWL A;  1X3G A;  2J6T A;  4DR5 Q;  4GKJ Q;  4HCE A;  4OXP A;  3T16 A;  1B7Y B;  2AQ3 B;  5C3W A;  2PMZ E;  4DV3 H;  1A62 A;  2YTV A;  1CA5 A;  2H5X A;  4FF3 A;  4A2B A;  5M3M H;  4FS1 A;  2RSN A;  1SCU B;  1VMC A;  4YCV A;  2KCT A;  1VQP A;  4B3R Q;  4ME5 A;  1P8L A;  1UEB A;  5FLM G;  3CU7 A;  1DXM A;  4ZI7 F;  3O13 A;  4DV0 L;  5DAU A;  3E5N A;  1GKH A;  2NU6 B;  4NXM H;  4IJH A;  1TWA A;  2AGO A;  2JEJ A;  2UUB Q;  3AYH B;  5C4X G;  5C0X G;  4R8I A;  4JI6 Q;  4NDX A;  5LMN Q;  2MUY A;  3ULL A;  3N44 B;  3GV6 A;  1NMG A;  5C44 G;  3ND9 A;  1JB3 A;  2JK8 A;  1WTH A;  2EPB A;  1PH9 A;  3VMM A;  1GSA A;  4A3M H;  3CPF A;  5IYB H;  3MVV A;  1CQI B;  5D8D A;  1E4E A;  4J9L A;  5EBC A;  2XCL A;  1NTG A;  3S1M H;  1XMO H;  1YI2 A;  5IOD A;  1KEE A;  2CW0 D;  1I3Q A;  3GTL A;  1VBH A;  4DUY L;  5DG9 A;  3E5S A;  3FMA A;  1VQO A;  3PO2 G;  2VNU D;  3EYY A;  3DWP A;  2FB9 A;  4KN4 C;  2W9B A;  2JP1 A;  2WKC A;  4CKE A;  4JK1 C;  3NXW A;  5DQI A;  3J7Y W;  2YRW A;  1ULZ A;  1TWG H;  4U67 3;  5A35 A;  3HKZ G;  4LMY A;  1JIC A;  1ZHQ A;  4K5W A;  3B6Y A;  3FPU B;  1F2Y A;  4MV1 A;  2GA4 B;  4POG A;  4J9O A;  1XJV A;  3FMC A;  4K14 A;  1RL2 A;  2MCT A;  1ZKO A;  2L12 A;  1PDQ A;  5HGQ A;  2AUJ D;  2R6G A;  3MAQ A;  4EG0 A;  1I6V C;  4BXX G;  3I72 A;  1XNQ L;  4DV2 L;  3TIN A;  2WDT A;  4HYK A;  1O7I A;  2IWH A;  1NUC A;  4OEL B;  3RLO A;  1F9S A;  3GII A;  3M4Q A;  4X62 H;  5BMV F;  2AQ2 B;  2XCA A;  1KAA A;  1S68 A;  2RCN A;  5EQ0 A;  2FHT A;  1PFM A;  3R23 A;  4F4W A;  5EZY F;  1WH2 A;  2AQ4 A;  1U4P A;  4YY3 L;  1CT1 D;  4L5R C;  3CKI B;  3I4N H;  4RKB A;  1B3A A;  4OL7 A;  1KQS A;  4N8F A;  4LFA Q;  4ECR A;  2HCC A;  2WKD A;  5GAH C;  1EIY B;  4O3O A;  4ECU A;  1D5Z C;  4FYD A;  3H3V H;  4C3J B;  4HIK A;  4FBT A;  1E1O A;  2DGY A;  3GV8 B;  1PFS A;  2E5L Q;  4XYM B;  4JOI A;  4O4L F;  3CVZ A;  4IFD I;  1KAB A;  5KFZ A;  1Y1V B;  4LF6 L;  3I8Z A;  3HKZ A;  2N78 A;  1SMX A;  3F8T A;  1STE A;  3U4Z A;  3S2D H;  5I6Y A;  2WP8 J;  1GJX A;  3KF6 B;  4H02 A;  2PPB C;  4DR6 H;  3MXP A;  1O7Y A;  1F2L A;  2YRX A;  4RZQ A;  3C3L A;  4C3J H;  1WCM G;  4M9U A;  4XT1 B;  1GUT A;  3V05 A;  1HNW H;  3JSL A;  1K8M A;  4A3B B;  4J6H A;  4E6I A;  3R5F A;  2WAQ B;  4B3M L;  3BDC A;  1LV9 A;  1LYL A;  2CVR A;  2B63 G;  2EYM A;  2CW8 A;  2KEN A;  3G6V A;  4YCW A;  3GV5 B;  1HNZ L;  1WR2 A;  2XNA C;  3DMU A;  2W6Q A;  5C6A A;  1V4Y A;  5JVL A;  1A3T A;  3GTK B;  3RB6 A;  1RTO A;  2BQU A;  1UNS A;  4ZKB B;  4A3B H;  3SVM A;  2KSW A;  5K2M A;  4EFB A;  2JA8 G;  2N49 A;  1WTR A;  4KI0 A;  5IGG A;  1M1K C;  1IYJ B;  4XZ3 B;  3T5L A;  2UUC L;  1TAE A;  4A3F B;  1EYG A;  2BR0 A;  2IP4 A;  3PR4 A;  2B2T A;  4A3J H;  1EIH A;  1YIT A;  1NY4 A;  1EQV A;  3H15 A;  1AZQ A;  1JB7 A;  5KG1 A;  1RYS A;  3A74 A;  4JUZ A;  2ATL A;  2CQY A;  4LSX A;  2FJZ A;  3ERS X;  4JG2 A;  4POF A;  3GTK H;  2R3Z A;  2I80 A;  2CWA A;  3BYY B;  3MEH A;  2ZDQ A;  3PUY A;  4U7C A;  5BR8 H;  1QVF A;  4A3F H;  1OXU A;  3GTO H;  2C2E A;  1PRT F;  2Z8L A;  2F4V H;  2AWN A;  2HIV A;  2F0N A;  4FP5 D;  4PZ7 A;  1STB A;  5ELC A;  3PIO 3;  2ASD A;  3JSN A;  3KJO A;  1AE2 A;  3U9O A;  1L1O C;  4C5B A;  3DUZ A;  1G51 A;  1F2M A;  3J7A F;  3CCQ A;  4A3K B;  5IYD G;  1WTV A;  3PUZ A;  2UXC Q;  3H0G G;  3UDG A;  1NAP A;  1SYD A;  1TWF H;  4JYA L;  5CYU A;  3TP8 A;  5I9P A;  2E2H B;  3PW7 A;  2YL2 A;  3ERO A;  2FPG B;  4K5X A;  4YAJ B;  4KD4 A;  3KLR A;  1VQC A;  4UCU A;  3EN2 A;  1H9M A;  4M1U B;  1LTT D;  2NZ1 D;  1KC8 C;  4X64 Q;  1HFG A;  2E2J B;  2HHH Q;  1MZB A;  1V8Q A;  3S1Q B;  1LT4 D;  1K1Q A;  5KX5 F;  1S5B D;  1J5E L;  2L11 A;  3V4S A;  1I50 A;  1JE4 A;  2J6S A;  1W3S A;  2FE3 A;  4BA2 I;  2F0S A;  4KHP Q;  2L5T A;  3VR3 A;  1DD2 A;  3MWM A;  1PH4 A;  3ETH A;  2EY5 A;  5IT9 c;  1EQT A;  3HOZ B;  3TRZ A;  1XNR Q;  4K5V A;  2VQF L;  2R7Z A;  1ICF B;  1N33 Q;  1ASY A;  2NZO A;  5IYC H;  5EKL A;  2JA9 A;  4CDD C;  5LL6 b;  4GNX B;  1JWS D;  1KAW A;  2NBF A;  4FF4 A;  2UXD Q;  4BWG B;  2FLP A;  4B3T H;  4R1J A;  1JOQ A;  1TWA H;  4NKL A;  2AMC B;  3N52 A;  4KJN A;  3QFF A;  1OXX K;  1SAP A;  5KFL A;  2EJG C;  2F0M A;  2C22 A;  4B9W A;  3HOZ H;  1E4E B;  5IT9 W;  2ZJR A;  4ABN A;  3J7A 5;  4RGN A;  3GO5 A;  3MC0 B;  4CDE C;  2ZTE A;  3ONA B;  3ULP A;  3GTL B;  1MD2 D;  1SRU A;  1B9N A;  1RKN A;  4DAM A;  3K5L A;  4KLK A;  4XDX A;  4OGQ C;  2ALY B;  2EE1 A;  1XMO L;  4MV9 A;  2W9B B;  1IOV A;  1AFP A;  1WJJ A;  1UE6 A;  1H9K A;  4IRC A;  1G29 1;  3ICE A;  4O3S A;  1JJ2 A;  4IPH A;  3RGX A;  3TZD A;  1S0N A;  2F0O A;  4MN3 A;  1I6U A;  2K05 A;  1M0T A;  1JT8 A;  3H40 A;  1V1Q A;  1CTM A;  3M4I A;  2MP1 A;  1E7Z A;  5IE8 A;  1DOM A;  1I3Q H;  4X3U A;  2R8H A;  3K7A B;  5JEA G;  4DNI A;  5KNC A;  2ZXO A;  1JDB B;  2B8G A;  3E3X A;  3M3Y H;  5C4X B;  2XSC A;  3T13 A;  3HEJ A;  5K5P A;  4I4T F;  5M5Y B;  2NU8 B;  2WB1 G;  3RTX A;  4JI2 H;  4L6T B;  2B2V C;  3S14 B;  1VS0 A;  3LWE A;  3DF7 A;  1JIH A;  2IBK A;  3OW2 A;  1JWM D;  2ZXR A;  4OX9 H;  1TY2 A;  5JPN C;  4J15 A;  3C1E A;  3I4M G;  4OO1 H;  4O3Q A;  1VQ9 A;  4J9N A;  4ECY A;  3PW4 A;  5LMU L;  1YNX A;  5C4X H;  3CCV A;  2WV6 D;  1G6P A;  2L0C A;  4JI3 H;  1STA A;  4DUY Q;  2HUG A;  3GQC A;  4DR1 H;  4J1M A;  3VR4 A;  5H1S E;  4LMQ D;  1PXU A;  3PO2 B;  2VQE L;  4BBR G;  1MJE A;  1TKW B;  3K57 A;  1NR4 A;  4O2A F;  2YS6 A;  3Q1K A;  4EEQ A;  2C5C A;  2LXJ A;  1E4G T;  2JE6 I;  1L0W A;  4LUO A;  2A73 B;  3GDE A;  4XQJ A;  4FU0 A;  2BQ3 A;  1IZ6 A;  4RWS C;  4F7X A;  3HKZ B;  4TUY F;  3CQZ H;  1D1I A;  2JA5 G;  3T5H A;  4K6D A;  5IP9 G;  1Q8I A;  2QA4 A;  1QJO A;  1DOL A;  1GVP A;  2R6F A;  1HUM A;  5KFV A;  4JV5 H;  4DV2 Q;  5KFF A;  1KDB A;  4JPB W;  4WJW A;  2IJ0 A;  1LTI D;  4K0K L;  3D4R A;  3EBE A;  3S1N B;  1NBW A;  4ZUI A;  3JAM E;  1PH3 A;  4X3K A;  3T1Y H;  4PNY A;  1L2Z A;  3PO3 G;  1PZK D;  4MHE A;  3NQT A;  1MIU A;  4YY3 Q;  1I4Q A;  2EYP A;  2I5H A;  5ISR A;  4ZQI A;  2R7K A;  3K5H A;  1LTL A;  5IP7 H;  4K2L A;  2F0F A;  2XC9 A;  5EKK A;  1VQL A;  3GIJ A;  4IR9 A;  3NTK A;  4JI1 H;  4IN3 A;  2R85 A;  3S1N H;  3RZD B;  1K0R A;  3D6C A;  4HJ7 A;  4ME3 A;  2IY5 B;  4R4O A;  2PBZ A;  4R8U B;  4JI4 H;  1CQV A;  5EBD A;  4F87 A;  3BA9 A;  3BDO A;  3OIQ A;  3OHB A;  2JA7 H;  4LF5 H;  4LF8 H;  1HNX H;  1KNE A;  2VZA A;  1D8L A;  2B29 A;  4CJ1 B;  2OTL A;  2E75 C;  4L5Q A;  1EY5 A;  1HTL D;  3EJI A;  4NP5 A;  3VYS A;  5M3M G;  1EQQ A;  5KG7 A;  1I4P A;  1C48 A;  1H9S A;  1JCK B;  4KN7 C;  3NBH B;  1WCM B;  4KKT A;  3PUV A;  3CRL C;  5NUC A;  3PIP 3;  5BR8 L;  4HQ6 A;  3MR6 A;  4ECX A;  2C2R A;  5A2Q L;  3CCL A;  3G4S A;  3HFZ B;  2IPK D;  2F4V L;  2V59 A;  3WO0 A;  4DR5 L;  3TBI B;  1SE2 A;  1WD1 A;  2WTF A;  3D8G A;  5M9O A;  3VYT A;  2B63 B;  5JH7 F;  1HR0 H;  4EQP A;  1Q46 A;  3LML A;  1HNZ Q;  1X3F A;  4PG3 A;  3SK8 A;  3F2C A;  4G57 A;  2Y0S G;  4IZO A;  4HTH A;  4Y7N B;  3E6Z X;  4KY5 A;  2VW9 A;  1JLL B;  2ENB A;  4JI5 H;  1KRT A;  2UUC Q;  1VQI A;  1Q90 A;  2JA8 B;  4WRD A;  4IAJ A;  4ZAI A;  4XT3 B;  3CCS A;  4A3M G;  5IYB G;  3C1F A;  1M90 C;  1W6J A;  1XPO A;  2UUB L;  2J6U A;  3CCR A;  4Y7N H;  1I50 B;  5FLX E;  2MHV A;  4ZQ3 A;  1CKO A;  5C3X A;  4QUF A;  4QWE A;  2JYO A;  1LLR D;  4DR3 H;  5DG7 A;  5LMN L;  3FEW X;  2QEJ C;  1QUQ A;  1KXL A;  2CQO A;  4BWS C;  1F77 A;  1Y14 B;  4RNN A;  3GID A;  4L5T A;  5GAD C;  2W6P A;  1X65 A;  4IUP A;  4TQU S;  3ZJY C;  1GYF A;  1FNV A;  1I50 H;  3GD7 A;  1S4Z A;  2W6O A;  5DM7 3;  1AW7 A;  3H0G B;  2K1B A;  3IN5 A;  4YBZ B;  1JE5 A;  1LUZ A;  1IBL H;  3OIP A;  1DYQ A;  1X3E A;  1ET9 A;  1U9R A;  4B3T L;  2VPQ A;  2Y0S A;  3JRW A;  3KYH C;  4P71 A;  3WOF A;  2IW3 A;  2R7Z H;  1STH A;  3F1Z A;  4EQ5 A;  1Y69 U;  1G2T A;  3NP8 A;  1H9R A;  3LNN A;  4ZUJ A;  2DIK A;  4APM A;  4J9K A;  3M9B A;  2D2C C;  3S16 H;  3BQ0 A;  4JVZ A;  1N32 H;  5AJ3 Q;  4DV3 Q;  4ZLT F;  5KFE A;  2LY7 A;  1E2W A;  4QJF A;  1H9J A;  3MXN A;  5KGU A;  3FDS A;  4PZ8 A;  1A8V A;  1VQJ A;  4P2C B;  2EY6 A;  1CSP A;  3ERQ A;  3I4N G;  2KCN A;  4LFB H;  4X3T A;  2IMW P;  5ELB A;  5HY6 A;  1X32 A;  2B2W A;  3VR2 A;  4GS3 A;  2NVY H;  3F2D A;  5ELF A;  3S1R B;  2K01 A;  2KVM A;  4NXM Q;  1VQH A;  2FPI B;  5KG3 A;  4DUZ H;  4TSS A;  3T1H H;  3RLF A;  3EQL C;  4F8M A;  3PVX A;  2JQO A;  4HED A;  4H7B A;  1TWG A;  2ZXP A;  2B2V A;  1IW7 D;  4HN7 A;  5J2U F;  4LFA L;  2UXB L;  5IIF A;  2QKI C;  3MZ5 A;  4C3J G;  1IHZ A;  2FK3 A;  3RGZ A;  3NBI A;  2EIF A;  4AYB E;  3VA5 A;  1XMO Q;  3NGD A;  3TQ1 A;  4A75 A;  3P1H A;  2E5L L;  3EA6 A;  1KNA A;  1SSO A;  2J7Z A;  4MTK A;  3HXL A;  1T94 A;  1UC9 A;  5D1P A;  3BQ1 A;  3G48 A;  4IJL A;  2FLL A;  2F0G A;  5KT6 A;  1PH5 A;  5E4W C;  1HR0 W;  2D0O A;  2V58 A;  4TRD A;  3RD4 A;  5CBE E;  1CHP D;  2W6Z A;  1YIJ A;  4A3B G;  1MSG A;  2IX0 A;  3BVG A;  3PV0 A;  1WTO A;  2AU0 A;  2XGP A;  4DGZ A;  2EZV A;  4Q43 A;  1EEF D;  5T1G A;  1AUX A;  2F3W A;  4A3J G;  1JOK A;  3BZD B;  2WB1 B;  3CHB D;  3RV3 A;  1V1P A;  1TWH B;  5CA1 F;  1K28 A;  2ICE C;  2RA4 A;  4JV5 L;  4DA2 A;  2ZDH A;  1T3N A;  3QOJ A;  1RHP A;  5IOC A;  3OHX C;  4A3F G;  1SJH D;  2KBN A;  4OIJ A;  4QWC A;  4ZHQ F;  2XWJ B;  1VQD A;  1K83 A;  1U0L A;  2UUA L;  5DEH A;  1EYD A;  1Z7T A;  4ETS A;  2VA2 A;  4YP3 A;  4BBR B;  5F2D A;  3RFC A;  1LT5 D;  4ALP A;  2V9W A;  2HIX A;  1YZ6 A;  1PRT C;  1K8A C;  3GTM H;  1HRJ A;  1B1Z A;  1J8I A;  5M5X H;  1EEI D;  4JI1 L;  3CXC A;  4L5S A;  4EGJ A;  4J8Q A;  5KEE A;  2K5W A;  1N56 A;  2SCU B;  5FD5 A;  1SNP A;  4JI4 L;  3SK5 A;  2JA5 B;  1CA6 A;  1Y1W G;  2VOB A;  4LF8 L;  1TR5 A;  4HJ5 A;  4X66 H;  1H9S B;  2W9C A;  2LKV A;  5AFW A;  1ET6 A;  4DR6 Q;  2MO0 A;  1KLU D;  2NN6 H;  1PYW D;  1Z9F A;  3MXU A;  4R4C A;  1LAC A;  5CBA E;  1D2B A;  1E2V A;  1HNW Q;  2YYA A;  1G8Z D;  1L1O B;  1CZW A;  1XDN A;  3X3M A;  3PO3 B;  1VQK A;  2K14 A;  2UVR A;  1VCI A;  3GTO A;  3S2H H;  1UNN C;  1ZYR D;  4YQW A;  3PN1 A;  4DR4 H;  4X64 L;  1F9R A;  2I8C A;  1BNZ A;  5IYC G;  2K50 A;  4NB3 A;  2HHH L;  1K1S A;  3TME A;  3OHA A;  2YU9 B;  3F8N A;  2OF1 A;  3CMA A;  3EIV A;  2KHJ A;  4RB0 A;  4QIW E;  4ECQ A;  5C0X I;  4KHP L;  1TWF A;  2R7D A;  3GTJ A;  1KL9 A;  1VQA A;  4L1K A;  2BCO A;  2DPJ A;  1KD1 C;  3HOZ G;  1EY8 A;  3TS0 A;  2F0W A;  5C8Y F;  3L0O A;  1CKN B;  4DV1 H;  1IYU A;  2NTT A;  1N33 L;  5JJK A;  3KAK A;  2DJG C;  4H13 C;  1Y1W A;  5M3M B;  2R93 A;  2ALZ A;  3PQI A;  3I56 A;  5BR8 Q;  4NXN H;  2R8I A;  5JOB A;  3JAM i;  4DR3 L;  2F4V Q;  5F9L A;  3G6E A;  1QB5 D;  1X55 A;  5COY A;  3T5K A;  3BVM A;  1PYS B;  4J9M A;  1VKZ A;  4P74 A;  4UCS A;  1AEX A;  5FJ8 H;  2K5N A;  4GLA C;  3A55 A;  2LS0 1;  2I0Q A;  4I50 F;  2Y0S B;  3OSO A;  2YZM A;  2CHB D;  1BVS A;  3FHW A;  2PI2 E;  2WE6 A;  3VA7 A;  5C4J H;  4QIW A;  5IGD A;  5LOV F;  4AH6 A;  3TP7 A;  2RDH A;  4LF9 H;  2A69 D;  1IBL L;  3M4O H;  4UAI A;  2FFK B;  5JUM A;  4LF7 H;  1IBK H;  3ULJ A;  4RGT A;  5BPH A;  2AGP A;  3OWF A;  3MFI A;  4OO1 G;  5LYJ F;  3OTO H;  4A3M B;  3KLS X;  1N8R C;  1YJ9 A;  1FR3 A;  1A0I A;  3QR8 A;  4O3P A;  3S1M B;  3Q6S A;  1YBY A;  4RHS A;  4TVA B;  1PH7 A;  1B50 A;  3EPI A;  2RGV A;  5DGB A;  2B3G A;  2F0K A;  4WD3 A;  3BZK A;  1PVO A;  1HCZ A;  2F0V A;  1FJG H;  1C0A A;  3WWV A;  4JI7 H;  2JJQ A;  4PZ6 A;  4BA1 I;  2XIW A;  3PUX A;  3BYT B;  5FO9 B;  4LFB L;  2PMZ A;  5JVG 3;  2RCF A;  4DV5 H;  1YNJ C;  3I7F A;  4HSV A;  4HIO A;  3A54 A;  3UE0 A;  4IUQ A;  2Q8I B;  3SDZ A;  1CHQ D;  1ENC A;  1TWG B;  4HMJ A;  4KTA A;  4C1N I;  1ZHS A;  4UCV A;  1RK6 A;  4RZR A;  1TT2 A;  3MWD A;  5FO7 B;  3Q2O A;  4E4T A;  4B3T Q;  2IHF A;  3W5O A;  1AH9 A;  5KFO A;  3UE1 A;  5D1O B;  4A76 A;  1ZQ7 A;  2DPI A;  4S3S A;  3KHG A;  4MTD A;  3OW7 A;  1C30 A;  5EWG A;  2E2I H;  3JAM c;  3J80 L;  2B2Y C;  3J81 L;  4PMB A;  1GLV A;  4ECS A;  5EJW A;  3TN2 A;  2ZT9 C;  4RB2 C;  1E24 A;  5GRO A;  1F9P A;  4RB1 A;  1D5M C;  2F0U A;  2SNM A;  3U9S A;  5IP7 G;  1CZG A;  2F3I A;  4ID6 A;  3I4N B;  5IWA H;  1Q82 C;  3G7L A;  4MV4 A;  3JAM W;  1QNU A;  1YHB A;  4L63 B;  1ONL A;  3S9W A;  2QYZ A;  1IYV A;  1I5F A;  2V1C C;  1AE3 A;  4P75 A;  2RDF A;  5KT2 A;  1PTO F;  4PMC A;  2EQS A;  4DV6 H;  1SYC A;  4IFD J;  3UDX A;  2YTY A;  1HA5 A;  1EUC B;  1AUV A;  1SLJ A;  2JA7 G;  4I7A A;  3TS2 A;  3CCU A;  2VXW A;  3DWQ A;  4JI2 Q;  5KG0 A;  1F9Q A;  2N55 A;  1SFO A;  3S2D B;  3CCM A;  3CQZ A;  3HOW H;  2UXB Q;  2BE5 C;  4OX9 Q;  5EDW A;  1GO3 E;  4RCO A;  5KFW A;  3NTI A;  1RIP A;  3DM1 A;  3BJU A;  1E2Z A;  4O1N A;  1EFW A;  2OH2 A;  2VR1 A;  4JI3 Q;  1YNN C;  4ED6 A;  1PX2 A;  4IUN A;  3UDI A;  4DLK A;  4BY1 H;  2PZT A;  1JXL A;  1IW7 C;  4FF2 A;  2PVP A;  4ED0 A;  1CM9 A;  3V96 A;  5KT7 A;  1JOR A;  1K83 H;  1TU2 B;  2W70 A;  3K5M A;  2EYF A;  4CDF C;  1HH2 P;  3GTP A;  1TWC A;  4LSA A;  2RVL A;  4ECW A;  4FXG C;  3GP7 A;  1UEA B;  2IX3 A;  1WD0 A;  4J9Q A;  4A3J B;  1DGS A;  1N36 H;  2HDM A;  1VQM A;  2AWO A;  1OXT A;  3K0X A;  5FLX c;  2M05 A;  4JV5 Q;  3GTG H;  4QCL A;  4X66 L;  4YIJ A;  3L4J A;  3NHH A;  2JA7 A;  5G3L F;  4GLX A;  1KIX A;  3T53 B;  4A3G H;  3CD6 A;  1B6S A;  2G9H D;  3ORQ A;  3TIG A;  4FVM A;  4WOR A;  4EFE A;  2Z9H A;  1R9T A;  2V4R A;  4MTN A;  3GTO B;  1GOZ A;  2PQA A;  3T1Y Q;  1V51 A;  2UUA Q;  1ROD A;  4FM9 A;  1I4X A;  5BN3 A;  1C7Y A;  5ELO A;  3RNU A;  1D1K A;  2W6N A;  4KMU C;  4R7R A;  5KFJ A;  5K36 H;  1DV2 A;  2OQ0 A;  4FNF A;  5FLX W;  2VQD A;  2Z4H A;  4DR4 L;  4GC7 A;  1YVC A;  5KYI A;  4JI1 Q;  2R82 A;  1FNU A;  4O3N A;  1TWF B;  4X6A H;  5CV4 A;  1IBM H;  3GTJ B;  1BBU A;  5KND A;  1PV4 A;  1AZP A;  2P0A A;  3H4D A;  4LH7 A;  4JI4 Q;  2R7Z G;  1PZI D;  1XMQ H;  3GIP A;  2PZW A;  4APV A;  2Z6K C;  4LF8 Q;  1SDF A;  4JI8 H;  3KLS A;  4EYH B;  3M4P A;  1HNX Q;  5I2X A;  1Y1W B;  3A7A B;  4DV1 L;  4G4K A;  1SE8 A;  4A3I H;  5D65 A;  3GTJ H;  1RJR A;  1RYR A;  3AU7 A;  2F3V A;  1VF7 A;  3TZU A;  2BH2 A;  3SR1 A;  5CA0 F;  3CAM A;  4NXN L;  3UQ8 A;  1HPC A;  4XYO A;  4WJ4 A;  2YW2 A;  4GKJ H;  2CW7 A;  1Y1W H;  5KRU A;  4O4I F;  1DM0 B;  5LXT F;  2R93 H;  2JEB I;  4Z9C B;  2XTI A;  3PW2 A;  1HR0 Q;  5AJ3 L;  4DV3 L;  1SE4 A;  3K6O A;  5EAY A;  1V43 A;  4QQB X;  2AKW B;  3GLK A;  3RBD A;  5FKA C;  1QVG A;  4B3R H;  2R86 A;  4JI5 Q;  1K0S A;  4DAP A;  2RGR A;  3TP6 A;  4A3L H;  1TWA B;  4YJ3 F;  1IBK L;  4DK3 C;  4YAK B;  1ZYR C;  3TDQ A;  3C2P A;  1MKH A;  3OTO L;  3OYY A;  4NXM L;  4JCV E;  1R4Q B;  2ICI A;  3M9M B;  1WFQ A;  1HXY D;  1BCP C;  1TS3 A;  2JEI A;  4DR3 Q;  1EIG A;  1BBW A;  2W8L A;  3A5Z B;  2R8G A;  1ZEQ X;  2PMZ B;  4CBV A;  1AP0 A;  3GQB A;  3WNZ A;  3SE0 A;  1WSC A;  1I3Q B;  2A5H A;  3DWA A;  4YJ2 F;  2OCE A;  2CQA A;  3CPW A;  5JJL A;  1HZA A;  4LFC H;  4L8J A;  2LMC B;  3UI2 A;  1WTP A;  4JW0 A;  2UVW A;  3T4A C;  4JBM A;  5KT4 A;  3M3Y B;  2NVY A;  2F0I A;  2J0T D;  1PH2 A;  1EUJ A;  2OXP A;  1IBL Q;  1QE6 A;  4C3I H;  2LXK A;  3SXH A;  5G3L D;  2M2L A;  3I91 A;  1B9M A;  5L37 A;  1PTO H;  2K32 A;  3L3O C;  3RR5 A;  1SND A;  4XQN A;  1XPU A;  2B2W C;  5EWF A;  1GXD C;  3K81 C;  4ILW A;  5LL6 S;  1JJC B;  1LTS D;  2B2Y A;  1N32 Q;  4Q8F A;  4H0L C;  1VQ8 A;  3LWU A;  1STN A;  4WBN F;  3U50 C;  2A69 C;  1S40 A;  3PF5 A;  4AIM A;  4A93 H;  2ATW A;  3MJF A;  3IRB A;  1GUG A;  4RGO S;  3FPP A;  2KCC A;  3V6J A;  4LFB Q;  4UP8 A;  1D5X C;  1HZC A;  1PRT D;  4BY7 H;  3RV4 A;  2PNH A;  4YHH H;  4X62 L;  4LF4 H;  2D62 A;  2O5J C;  3L4K A;  3T1H Q;  4AQY H;  3SHL A;  1NNX A;  1MSH A;  4C3H H;  1SFO B;  3QOL A;  1VQ6 A;  3CQZ B;  4DL2 A;  1DON A;  2PCF B;  5KFK A;  3H4B A;  3QWN A;  3R2I A;  1A63 A;  4CJ0 B;  4YCU A;  5C1P A;  2NN6 G;  3N6X A;  1PLF A;  4A3E H;  4I7Z C;  3LX0 A;  3HOX H;  2R92 A;  1A9X A;  2RHQ B;  1EYC A;  2KHI A;  1SFO H;  4V19 0;  4U68 A;  2ZJP A;  4U6P A;  4TQS A;  3D3R A;  3RF2 A;  1VAJ A;  3P7J A;  1DOK A;  3G6J B;  5J3B A;  1K8O A;  1LO5 D;  5IT9 L;  3M7G A;  1PRT B;  1EYZ A;  4C2M A;  1EWH A;  2KOL A;  2CFM A;  1A3V A;  4DR6 L;  1KJJ A;  3IFD A;  3VPB A;  3NPP A;  1UE1 A;  1DV1 A;  1YHA A;  1L2F A;  2BQR A;  1N34 H;  5DLF A;  3VPD A;  1CSQ A;  2OWO A;  4WJ3 M;  2IL8 A;  1BDO A;  5CR3 A;  3GTM A;  1A3U A;  1HNW L;  4UCT A;  5DGA A;  3W1B A;  4KJO A;  5LHY 1;  1X9N A;  2IX1 A;  2JA7 B;  2VUM A;  1IL8 A;  1M8A A;  1U5K A;  3H6M A;  3GTP H;  2RQX A;  3OOC A;  3T51 B;  1N36 L;  2NB0 A;  1T36 A;  1TWC H;  5C5J A;  1BGW A;  1R9T B;  5T1I A;  1IXR A;  2XWB B;  4OWX B;  1EQR A;  1K73 C;  2L1B A;  3QJY A;  4DXG A;  5D3I B;  5LA6 F;  3I55 A;  3QIA A;  4RNM A;  1SNM A;  3Q8Q B;  1C9O A;  1XXG A;  3SEB A;  1R9T H;  5KIX A;  5FJ8 G;  2UU9 H;  4N9T A;  3RUZ A;  3PR5 B;  5IYZ F;  4H44 C;  3BAA A;  4UHV A;  2JEA I;  1RJQ A;  3S17 H;  2EDG A;  2PW5 A;  3K3P A;  1SYE A;  4HNU A;  4DN4 M;  4DK0 A;  1EIF A;  4N9P A;  1HQR D;  3I12 A;  3GV3 A;  3IFT A;  4YR0 A;  3E0E A;  2R61 A;  2Z6K A;  1S0M A;  1B3Q A;  2TSS A;  4X66 Q;  1EYA A;  4XQQ A;  4EQO A;  2C9O A;  4UP7 A;  2F4I A;  1FGB D;  5GAE C;  4FF1 A;  4Q8E A;  3A8I E;  3EFX D;  4UY8 C;  4OWT B;  5KFD A;  3Q8D A;  2D9U A;  3HOV H;  4RAZ A;  5M5W B;  3HS0 C;  2P5Z X;  2HJW A;  3FRP B;  1S3O A;  3RAX A;  1CUK A;  1Q3L A;  1YNJ D;  2BA0 A;  4N8X 1;  4DR4 Q;  3M85 A;  1BF4 A;  3HOU H;  2ZJT A;  2ZM6 H;  1I6H B;  2W57 A;  5BPF A;  5D3D A;  2Q8R E;  1S03 G;  2NUC A;  1KHI A;  3RZO H;  5KFS A;  2YZN A;  3E0J A;  5M5W H;  3H3V I;  5CV9 A;  4F4Y A;  3VPC A;  1SR3 A;  2ASJ A;  4M7E A;  2R7Z B;  1I4R A;  1XTD A;  3HKS A;  3I3C A;  5CV7 A;  2E74 C;  1I6H H;  4DV1 Q;  1Z2N X;  4IOC A;  2J9G A;  3S16 B;  1VQ5 A;  1A2U A;  2QCP X;  2QF7 A;  4MV6 A;  3SE7 A;  1FL0 A;  1II3 A;  1DIK A;  2UXD H;  2R7N A;  2F0Q A;  4NXN Q;  3IKJ A;  1JOO A;  3QB3 A;  1W6K A;  1JX4 A;  4K8J A;  5FPO A;  1CI3 M;  1S9F A;  1CQF A;  4ECT A;  1X6O A;  5KFR A;  2NVY B;  1ILP A;  1UC8 A;  2Q8T A;  4IFD H;  4HJ9 A;  4DAY A;  2MQH A; 
#chains in the Genus database with same CATH homology
 2WB1 E;  4LF9 Q;  2C35 B;  1GM5 A;  1N33 L;  5JJK A;  4B3M L;  1LYL A;  2B63 G;  4JBK A;  1HZB A;  1IBK Q;  2KEN A;  4LF7 Q;  3I56 A;  5GQO A;  1I94 L;  5BR8 Q;  1IL2 A;  4X65 L;  4YCW A;  2JA6 H;  3HOW G;  3PIO A;  5M5Y H;  5GAG C;  3AFQ A;  3OTO Q;  1HNZ L;  3JAM i;  3DLL A;  4DR3 L;  1NE3 A;  2F4V Q;  3G6E A;  3S14 H;  5C44 H;  3J81 j;  1X55 A;  3FKI H;  2KCM A;  4A3B H;  1PYS B;  2JA8 G;  2N49 A;  1M1K C;  4KI0 A;  1IYJ B;  4P74 A;  5FJ8 H;  3JC6 6;  2UUC L;  3S15 H;  2K5N A;  1EYG A;  4GLA C;  4BY1 G;  1FJG Q;  2K4K A;  4A3J H;  4JI2 L;  2I0Q A;  1VQ4 A;  1NY4 A;  3H15 A;  1YIT A;  4JI7 Q;  4MNO A;  1JB7 A;  1BVS A;  3A74 A;  2PI2 E;  3FHW A;  1VQN A;  5C4J H;  4OX9 L;  4AH6 A;  3ERS X;  1IBL L;  3PO2 H;  3M4O H;  4JG2 A;  4POF A;  1OTC A;  3GTK H;  4JC0 A;  2CWA A;  3ULJ A;  3CC2 A;  3PUY A;  2K5V A;  4JI3 L;  1QVF A;  4OO1 G;  4LF4 L;  2CKZ B;  1OXU A;  4IPG A;  1GD7 A;  4DR1 L;  4A3F H;  3GTO H;  1XNQ Q;  2ASB A;  1N8R C;  1YJ9 A;  2AWN A;  2HIV A;  4PZ7 A;  4AQY L;  1A0I A;  2PQA B;  3KJO A;  3AFP A;  1AE2 A;  1YBY A;  1L1O C;  2L15 A;  4FDB A;  4TVA B;  1G51 A;  1OXS C;  1YHQ A;  1PH7 A;  4OWW B;  3CCQ A;  2B3G A;  5IYD G;  3BZK A;  5LMN W;  1PVO A;  3FP9 A;  3PUZ A;  2UXC Q;  1C0A A;  1SRO A;  3H0G G;  3WWV A;  3UDG A;  2NVT H;  3A0J A;  4A3G G;  2JJQ A;  4PZ6 A;  1TWF H;  3KFU A;  4BA1 I;  4JYA L;  3PUX A;  5C3E G;  4BBS H;  2MNA A;  2NZH A;  4LFB L;  4BXX H;  3GTQ H;  1LM0 A;  3I7F A;  4HIO A;  3AEV A;  3TQY A;  2K5H A;  1EWI A;  3UE0 A;  1VQC A;  3EN2 A;  4GKK Q;  2R92 H;  5K36 G;  1IBM L;  2ZTC A;  1E22 A;  1KC8 C;  4X64 Q;  2IHF A;  3W5O A;  4LUV A;  4B3T Q;  5IWA Q;  2GN5 A;  4DR7 Q;  3UE1 A;  1AH9 A;  4UPA A;  4X62 Q;  2HHH Q;  3L7Z C;  4A76 A;  4LF6 Q;  1XMQ L;  3STB C;  4RMF A;  1NJI C;  4JI8 L;  3KDF A;  1J5E L;  4C2M H;  1YJW A;  3T1Y L;  3I4O A;  1W3S A;  2K75 A;  4DV6 Q;  3JAM c;  2E2I H;  4BA2 I;  4A3D H;  4A3C G;  3RZD H;  4KHP Q;  3J81 i;  3HOY G;  1PH4 A;  5IT9 c;  1UE7 A;  4B3S L;  3D0F A;  1E24 A;  5GRO A;  2WAQ E;  1EOV A;  3TRZ A;  1CKM A;  1Q7Y C;  1XNR Q;  4LNQ A;  2VQF L;  4A3I G;  1ASY A;  2NZO A;  5IYC H;  1N33 Q;  4R4Q A;  4B3M Q;  2HT1 A;  2JA9 A;  4GKJ L;  5IP7 G;  2F3I A;  4GNX B;  1KAW A;  2UXD Q;  2VUM H;  1L1O A;  1Q82 C;  4R1J A;  2QEX A;  1YHB A;  2VS1 A;  1TWA H;  2EXD A;  2AMC B;  1OXX K;  1WCM H;  1I5F A;  4IO9 A;  4LF5 L;  2V1C C;  1AE3 A;  4P75 A;  3HOZ H;  2ZJR A;  4RG1 A;  3J7A 5;  1W2B A;  1HNX L;  2R93 G;  3GO5 A;  2OQK A;  3ULP A;  2ZTE A;  2EQS A;  4IFD J;  1SRU A;  3UDX A;  2YTY A;  2Y0S E;  1PYB A;  4DAM A;  4B3R L;  4KLK A;  4GN5 A;  1SLJ A;  2JA7 G;  4O0A A;  3TS2 A;  3CCU A;  2ALY B;  3KF6 A;  4JI2 Q;  4GOP A;  4QQB X;  1XMO L;  2B63 H;  1WJJ A;  5C0X J;  1UE6 A;  3CCM A;  3HOW H;  1G29 1;  3ICE A;  4OX9 Q;  1JJ2 A;  4IPH A;  2UXB Q;  4IPC A;  4A3L G;  1GO3 E;  1Q1E A;  1Z47 A;  1JT8 A;  1RIP A;  1V1Q A;  3BJU A;  5IE8 A;  1E7Z A;  1EFW A;  1I3Q H;  1CKN A;  5JEA G;  3F2B A;  1N36 Q;  2F52 A;  4JI3 Q;  2BA1 A;  3KJP A;  1HR0 L;  4DNI A;  4JI6 L;  2JA8 H;  5DLQ E;  2Q2H A;  3UDI A;  4OO1 I;  4BY1 H;  2VY3 A;  1YJN A;  5E7N A;  3M3Y H;  3K80 C;  1N9W A;  1UWV A;  4JI5 L;  4R4T A;  3K7U C;  2WB1 G;  1K83 H;  1HJP A;  3E9H A;  4LFC L;  1PH1 A;  1KRS A;  1VS0 A;  2E8G A;  3OW2 A;  1HH2 P;  4IPD A;  1K8G A;  4JYA Q;  4GLV B;  4J15 A;  3I4M G;  1VQ9 A;  4DPG A;  5LMU L;  1YNX A;  3RLN A;  1JJG A;  5C4X H;  3CCV A;  3J80 c;  1QUQ B;  3J81 c;  1G6P A;  4P73 A;  1DGS A;  1VQM A;  2AWO A;  4DUY Q;  1B70 B;  1OXT A;  2XGT A;  3K0X A;  3UDF A;  1VQG A;  5FLX c;  3U4V A;  5H1S E;  1P16 A;  4R4I A;  1IBM Q;  3GTG H;  4X66 L;  4JV5 Q;  5IYD H;  3H0G H;  4GLX A;  2VQE L;  4BBR G;  1KIX A;  1MJE A;  3CD6 A;  4A3G H;  4MZ9 A;  1XMQ Q;  4DV4 Q;  4HJ9 A;  4MTN A;  2A8V A;  2LXJ A;  5C3E H;  1TXY A;  1J5E Q;  2PQA A;  4GNX C;  3T1Y Q;  2ES2 A;  2UUA Q;  4O2D A;  1C7Y A;  5ELO A;  2JE6 I;  1L0W A;  3RNU A;  3CW2 C;  4AYB G;  4LUO A;  3GDE A;  3D31 A;  1IZ6 A;  2OQ0 A;  3PGZ A;  4DV5 Q;  3CQZ H;  4NPS A;  1K9M C;  4DR4 L;  4A93 G;  2JA5 G;  2VQF Q;  5IP9 G;  1YVC A;  2QA4 A;  4YHH L;  4JI1 Q;  1GVP A;  4X6A H;  1BBU A;  1PV4 A;  4DV2 Q;  3PF4 A;  3MXN B;  4BY7 G;  4JI0 Q;  5IY0 A;  2RF4 A;  4JI4 Q;  2R7Z G;  4A3C H;  1N32 L;  4K0K L;  4DAY B;  2CWP A;  4APV A;  3HOY H;  2Z6K C;  4LF8 Q;  4QGU A;  3EBE A;  1FGU A;  1NBW A;  3M4P A;  1PH3 A;  1HNX Q;  3NEN A;  3S1R H;  3PO3 G;  2MFI A;  4DV1 L;  1MIU A;  1SE8 A;  4YY3 Q;  1VQF A;  2I5H A;  4A3I H;  3PIP A;  4QY7 A;  3GTJ H;  4DV7 Q;  2OTJ A;  1LTL A;  2BH2 A;  5IP7 H;  3CAM A;  3U58 A;  1PH6 A;  4NXN L;  3J7Z C;  1Y1V G;  1VQL A;  4WJ4 A;  1SN8 A;  1Q1B A;  4A3E G;  3S1N H;  3HOX G;  1K0R A;  1BKB A;  1Y1W H;  4HJ7 A;  1E3P A;  3KF8 B;  2PI2 A;  4ME3 A;  2JEB I;  4OON A;  4DUZ L;  3T1H L;  2XTI A;  4R4O A;  1PA6 A;  1HR0 Q;  2IY5 B;  2N8N A;  2Q2U A;  5AJ3 L;  2DUD A;  3L2P A;  4DV3 L;  5EAY A;  4GNX A;  2JA7 H;  1V43 A;  1X56 A;  1Q12 A;  2QGQ A;  2CCZ A;  2AKW B;  3AQQ A;  1J6Q A;  2K52 A;  1N34 L;  1T9H A;  2VZA A;  1D8L A;  2B29 A;  4PMW A;  1QVG A;  2OTL A;  4LWC A;  4HJA A;  2WAQ G;  2VL6 A;  4L5Q A;  1EQQ A;  3J80 i;  3PUW A;  5M3M G;  4JI5 Q;  4XIG S;  4A3L H;  4LFC Q;  3NBH B;  1IBK L;  3PUV A;  2A19 A;  4DK3 C;  5BR8 L;  4DR2 Q;  3CCL A;  3G4S A;  3HFZ B;  1MKH A;  3OTO L;  3OYY A;  4NXM L;  2BH8 A;  4JCV E;  5LMU Q;  2F4V L;  4DR5 L;  1OXV A;  1VQE A;  1D7Q A;  2WFW A;  1I94 Q;  1E1T A;  1WFQ A;  4X65 Q;  1Q46 A;  4JOI C;  3K8A A;  1QZH A;  1HNZ Q;  1X3F A;  4PG3 A;  4LW1 A;  4DR3 Q;  3F2C A;  1BBW A;  4YWK A;  3CC4 A;  3A5Z B;  2Y0S G;  1VQB A;  2VQE Q;  3A5U A;  3I2Z A;  1NMF A;  1TWH H;  2VW9 A;  2OCE A;  1KRT A;  3CPW A;  3ER0 A;  1VQI A;  1HZA A;  2UU9 L;  2UUC Q;  3I4M H;  3CC7 A;  5JJL A;  1V9P A;  3HKZ E;  3LGJ A;  3PSI A;  3W1G A;  3CF5 A;  4JBM A;  4JBW A;  2RHS B;  3CCS A;  4A3M G;  5IYB G;  4IOA A;  3S24 A;  5ELN A;  4BBS G;  1M90 C;  1FVI A;  1PH2 A;  1EUJ A;  1IBL Q;  4C3I H;  2LXK A;  1XPO A;  5JJI A;  2UUB L;  3KDF B;  4Y7N H;  3CCR A;  4BBR H;  3DM3 A;  4YHH Q;  4A3K G;  2I5L X;  3G71 A;  3RR5 A;  1CKO A;  4LF4 Q;  1XPU A;  4DR1 Q;  5LMN L;  4KHZ A;  3K81 C;  1QUQ A;  2UXC L;  2CQO A;  4AQY Q;  1KXL A;  1Y14 B;  1JJC B;  4L5T A;  5GAD C;  1N32 Q;  3STB D;  4K0K Q;  4GN4 B;  1WYD A;  1X65 A;  3PCO B;  4TQU S;  3ZJY C;  1VQ8 A;  2MO1 A;  1X54 A;  1YEZ A;  3U50 C;  2HQL A;  1I50 H;  3GD7 A;  1S40 A;  3M7N A;  3PF5 A;  4AIM A;  2JA5 H;  2ATW A;  4A93 H;  3IRB A;  5IP9 H;  3CCE A;  2FXQ A;  1JE5 A;  1LUZ A;  4GKK L;  5M3F G;  4LFB Q;  4UP8 A;  1HZC A;  4UP9 A;  1X3E A;  4BY7 H;  3HOV G;  4B3T L;  4Y52 H;  3KYH C;  4DR7 L;  2PNH A;  2I5M X;  4P71 A;  4DR2 L;  3RN5 A;  2R7Z H;  4X62 L;  3F1Z A;  2ZM6 L;  4EQ5 A;  2YTX A;  2D62 A;  1ASZ A;  4A4I A;  3M9B A;  1S72 A;  3KLW A;  3T1H Q;  4GOP B;  3HOU G;  3S16 H;  4DKA C;  4C3H H;  1QZG A;  3PO3 H;  5AJ3 Q;  4DV3 Q;  4HJ8 A;  1VQ6 A;  2D0P A;  4QJF A;  2R93 H;  1N34 Q;  4JI8 Q;  1H95 A;  1A63 A;  4PZ8 A;  1A8V A;  1VQJ A;  3TEH B;  2Q2I A;  4YCU A;  1Y1V H;  1CSP A;  2IT1 A;  1XNR L;  2NN6 G;  2YU9 H;  1B8A A;  4A3E H;  3MEF A;  2YYZ A;  3HOX H;  3I4N G;  2RHQ B;  4B3S Q;  2KHI A;  3E9I A;  1SFO H;  2ZJP A;  2UXD L;  1MJC A;  1JMC A;  5HY6 A;  2IHE A;  2Z0S A;  4GS3 A;  2NVY H;  1X3G A;  4YWL A;  3F2D A;  4NXM Q;  2N3S A;  5J3B A;  3CME A;  4DR5 Q;  4GKJ Q;  1VQH A;  4OXP A;  3RLF A;  1B7Y B;  4JBJ A;  2CFM A;  2JQO A;  2PMZ E;  4DR6 L;  1A62 A;  2YTV A;  2H5X A;  1UE1 A;  5M3M H;  1YHA A;  1L2F A;  4HIM A;  4LF5 Q;  4YCV A;  2ID0 A;  1CSQ A;  2KCT A;  1VQP A;  2OWO A;  4WJ3 M;  4LFA L;  1HNW L;  2UXB L;  1WOC A;  3SGI A;  4B3R Q;  5JEA J;  1P8L A;  2UU9 Q;  1UEB A;  5FLM G;  3W1B A;  4AYB E;  2EIF A;  1XMO Q;  2NVQ H;  2IX1 A;  1X9N A;  3VDY A;  4IFD G;  4HID A;  4DV0 L;  4A75 A;  1U5K A;  3GTP H;  1N36 L;  1GKH A;  2E5L L;  1TWC H;  4IJH A;  1WI5 A;  2ZTD A;  3TRE A;  2ZJQ A;  2UUB Q;  3AYH B;  5C4X G;  5C0X G;  3G48 A;  3KOJ A;  4LUZ A;  4IJL A;  2JA6 G;  4JI6 Q;  1IXR A;  1K73 C;  3BU2 A;  1EQR A;  4OWX B;  2D0O A;  1PH5 A;  1HR0 W;  2NVX H;  4P72 A;  5LMN Q;  3ULL A;  1NMG A;  5C44 G;  1PHJ A;  1Q8K A;  3FKI G;  2JK8 A;  3I55 A;  1PH9 A;  4YWM A;  1YIJ A;  4A3B G;  1C9O A;  2IX0 A;  3PV0 A;  1QVC A;  4A3M H;  3CPF A;  5IYB H;  1R9T H;  5FJ8 G;  4LF9 L;  1NTG A;  4A3J G;  4GOP C;  3S1M H;  1YI2 A;  4LF7 L;  2JEA I;  4A3K H;  4DUY L;  3S17 H;  1VQO A;  3PO2 G;  2VNU D;  4JV5 L;  1EIF A;  2GVB A;  3CP0 A;  1HZ9 A;  3E0E A;  2ZM6 Q;  4GN3 B;  1UE5 A;  2Z6K A;  4QL5 A;  4DV4 L;  2KBN A;  4A3F G;  2E2H H;  4X66 Q;  3RN2 A;  1VQD A;  1U0L A;  1FJG L;  2UUA L;  4UP7 A;  5GAE C;  1TWG H;  4JI7 L;  4UY8 C;  3HKZ G;  4OWT B;  3B6Y A;  3BZC A;  5M3F H;  4ALP A;  1K3R A;  4POG A;  1XJV A;  2HIX A;  3Q8D A;  2E2J H;  1YZ6 A;  1K8A C;  4DV5 L;  1RL2 A;  3GTM H;  3HOV H;  3S1Q H;  5HGQ A;  5M5X H;  4JI1 L;  3CXC A;  2R7F A;  2R6G A;  1S3O A;  2NN6 I;  1CUK A;  2GVA A;  2BA0 A;  4L5S A;  1XNQ L;  3NEL A;  4DV2 L;  3CCJ A;  4BXX G;  4DR4 Q;  1O7I A;  2LSS A;  3RLO A;  3M85 A;  3HOU H;  3M4Q A;  4JI0 L;  2AHO B;  4JI4 L;  1Y1W G;  1KHI A;  2R92 G;  3RZO H;  2RCN A;  4LF8 L;  4EX5 A;  4HJ5 A;  5M5W H;  3H3V I;  4DR6 Q;  2MO0 A;  1SR3 A;  4DK6 C;  1VQ7 A;  4YY3 L;  1Z9F A;  4L5R C;  4R4C A;  4DV7 L;  1XTD A;  3HKS A;  3I4N H;  1KQS A;  1Q81 C;  4LFA Q;  1HNW Q;  1I6H H;  4DV1 Q;  4A3D G;  4IOC A;  1L1O B;  5GAH C;  1EIY B;  1VQK A;  1VQ5 A;  2K14 A;  1VCI A;  3S2H H;  3NEM A;  1FL0 A;  4HIK A;  3H3V H;  2Q2T A;  1E1O A;  4DV0 Q;  2DGY A;  3GTL H;  1PFS A;  2E5L Q;  4X64 L;  4NXN Q;  4JOI A;  5IWA L;  2YV5 A;  4IFD I;  5IYC G;  2K50 A;  4NB3 A;  2HHH L;  4LF6 L;  2N78 A;  1SMX A;  3F8T A;  3U4Z A;  3S2D H;  3CMA A;  3EIV A;  2KHJ A;  2WP8 J;  4DUZ Q;  2VUM G;  3KF6 B;  4QIW E;  4H02 A;  5C0X I;  2A1A A;  4DV6 L;  1XPR A;  4KHP L;  1X6O A;  2R7D A;  1KL9 A;  1VQA A;  1WCM G;  4C3J H;  1PH8 A;  5FLM H;  1KD1 C;  3HOZ G;  3K7A H;  3TS0 A;  1Q86 C;  3L0O A;  1CKN B;  4XTC S;  2MQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...