2R93G

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
molecule tags Transferase/rna
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
total genus 25
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r93G01
5IWAL 3E9HA 1HNWL 1I94Q 3HOUH 1HR0W 3TREA 1NMGA 5LMNW 5H1SE 5IYDG 4JI8L 3DM3A 1YVCA 3PO2H 3BJUA 4A3GG 1YJNA 4TVAB 3HOXH 2Z6KA 1NTGA 2GVAA 1MJEA 5IYCG 4HJ7A 3GTMH 4BY7H 1J5EQ 4A4IA 5IYBH 2Q2TA 3MXNB 5JJKA 4LWCA 1YZ6A 1Y1WH 2UUAL 3UE0A 1I3QH 3PO3H 4OX9L 3M85A 4DKAC 4P75A 1UWVA 2JEBI 3S16H 5C4XG 4QL5A 3RLNA 3ULJA 1JE5A 1GVPA 4RMFA 4DR3L 3PUWA 3D31A 4DR2Q 3W1GA 2RHQB 4PZ6A 1L0WA 1XPRA 2JA7G 4IJHA 3TS0A 1KIXA 4IOCA 2R7ZG 4WJ4A 5M3MG 1CKNB 2R6GA 1K83H 3KF6A 3I56A 1PH3A 1VQMA 1IXRA 1W3SA 1MJCA 1PH7A 3U4ZA 2JA8G 2CWAA 3K8AA 2IY5B 1O7IA 2LSSA 3BZCA 4JG2A 4L5QA 1YHBA 3CC4A 4C3HH 2R92G 3TQYA 4P73A 4C2MH 1KC8C 3U58A 4A3KH 3TS2A 4BBSG 2UXCQ 2I5MX 4JI3Q 4HIKA 1HNZQ 1XJVA 3TRZA 3I4MH 2K4KA 2R7DA 1IYJB 3FKIH 1BBUA 1K3RA 3GTPH 1IBMQ 3S1MH 1G6PA 2WP8J 3HKZG 1Y14B 1HNXL 2VY3A 4LF7L 1SRUA 3CMAA 1M90C 4X62Q 1SROA 1XMQL 4A3EH 3M4PA 2RCNA 4AH6A 4Y52H 4JV5Q 4NXNQ 3WWVA 4LW1A 2XGTA 4R1JA 1WJJA 2YTVA 3EIVA 1QVGA 4JI0L 3GTOH 4QQBX 2E2JH 4AQYL 1KD1C 4B3ML 3ULPA 5JJIA 3AFQA 4DUZL 4JI5Q 2NZHA 2ZJRA 1E7ZA 2OTJA 2MO1A 1HZ9A 4GLAC 4R4IA 2Y0SG 5M3FH 2E5LL 5C3EH 1FL0A 3PCOB 2Q2UA 4BA1I 4BBRH 4GOPB 2XTIA 1GM5A 1N32Q 2ZTDA 3AYHB 3F8TA 4DV1L 4DV0Q 1PH5A 1L1OA 1IBLQ 1TWFH 2K5HA 3UDIA 3H0GG 2Q2HA 1VQBA 3SGIA 4DV3L 4JI2L 4GOPC 1WI5A 5E7NA 1VQ7A 1X54A 2KCMA 4GLVB 3T1YL 5M5XH 1K73C 5JJLA 5GADC 1SN8A 1NJIC 2CCZA 4DV7L 1PV4A 5FJ8G 1DGSA 3T1YQ 3S1RH 2FXQA 3A0JA 4OWTB 1GKHA 4IPHA 4LF4Q 3CCRA 1XPUA 1VQ6A 1LTLA 2A1AA 1A62A 4QGUA 4YWMA 3UE1A 5IP9G 2PQAB 3CQZH 4LF8Q 4A3DH 4X66L 2KENA 2MFIA 2K52A 4LFAQ 4HIOA 5ELNA 4JYAQ 1QZGA 1WFQA 3KFUA 5J3BA 4X66Q 4A93G 3FP9A 2K14A 4APVA 1JJCB 2YYZA 1SMXA 1HZAA 2UU9L 4DV4Q 4A3MG 1IBKQ 2R92H 2DUDA 2NZOA 4K0KQ 3F1ZA 3GTGH 2MO0A 1L2FA 2YV5A 4DV7Q 1YJ9A 1PH9A 4MNOA 4A3IG 5LMNQ 1VQFA 1JJ2A 4JI6L 3PIOA 1UEBA 2N49A 2EXDA 3GD7A 4EX5A 2JA6H 3I4MG 1JJGA 2B3GA 2D0OA 2DGYA 2WAQG 2N8NA 5ELOA 4A3FH 4LFBQ 1HZCA 3VDYA 4O0AA 2IT1A 1LM0A 1NBWA 1V43A 3G71A 2UUCL 1TWAH 3I7FA 3G48A 4JI6Q 1YIJA 1UE1A 1K8AC 1KHIA 5GAHC 1SFOH 3STBC 3CCLA 2HT1A 1Q81C 3RN2A 1IZ6A 1D8LA 4A3CG 4DK3C 1K0RA 4KHZA 1CKNA 2MQHA 3PF5A 1JB7A 2VUMG 1EYGA 1IBLL 4JI0Q 4DV6Q 2VNUD 1VQPA 4LNQA 1N33Q 1HZBA 3GTKH 5EAYA 2H5XA 2AMCB 5FLMG 3D0FA 2YU9H 2R93H 3KDFA 4DV6L 4DUZQ 4HJ9A 4ME3A 3RR5A 1RIPA 5IYCH 5GQOA 2R7FA 3S24A 3H0GH 3L2PA 4BY7G 3RZOH 1FVIA 2OQ0A 4L5TA 4A3BG 1WYDA 4A75A 4GLXA 4LF4L 5AJ3Q 4L5SA 2JJQA 2PNHA 3K7UC 1OXTA 4DR7L 4X64Q 3CPFA 4P72A 4QIWE 1VQKA 2F4VL 4NB3A 1VCIA 3S2DH 2IHFA 4LF8L 2Q2IA 3CXCA 2NVQH 2CWPA 2JA5H 1Q12A 4GKJL 1G51A 2GVBA 2B63G 1B70B 4DK6C 5IP7G 5M3MH 1LUZA 1Q7YC 4B3RQ 1YITA 5JEAG 1XNQL 4A3DG 1N32L 3JAMc 3J81c 2Z0SA 3CCJA 1B7YB 3HOUG 3K80C 3F2DA 1X3EA 1QUQB 3CCMA 1XNQQ 1KRTA 1PH6A 1L1OB 1HNWQ 1EFWA 3B6YA 4DUYL 1YI2A 3PUVA 4LFBL 3A5UA 4GOPA 4IPCA 3HOZH 4JC0A 1PA6A 2OTLA 4P71A 5HGQA 4DR1L 1N34Q 4OX9Q 4KHPQ 4HJ8A 1XNRL 3S14H 4A3LH 3J80i 1OXVA 2JA6G 3KOJA 3HOYG 3F2BA 1YNXA 1J5EL 4JOIC 2D0PA 1Z9FA 2RF4A 4POFA 5IE8A 1YHQA 1VQDA 3PGZA 2K5VA 1WOCA 1I6HH 2KBNA 2JA7H 1CKMA 2ID0A 3ICEA 4WJ3M 2N3SA 3J7A5 2UXCL 3S17H 1L1OC 5C44H 1KQSA 4DR4Q 1VQIA 3ER0A 4LF6L 4GKJQ 3OTOL 1VQJA 4HIMA 4DV0L 4DV1Q 4P74A 2EQSA 1YHAA 1N8RC 1HR0L 1XPOA 5LMNL 1ASYA 4LUVA 1S72A 1SLJA 1AE2A 4BXXH 3G4SA 4AYBE 4JI7Q 4MTNA 1U5KA 3FHWA 1S3OA 3KDFB 5IYBG 3KJOA 3BZKA 1Y1VG 3GTJH 5HY6A 1CSPA 3F2CA 1U0LA 4LF9L 4UPAA 4GS3A 4YWKA 3J7ZC 4HJ5A 1E1OA 2K5NA 1B8AA 4JV5L 2MNAA 1XNRQ 2AWOA 1JMCA 2V1CC 2D62A 2NN6G 5FLXc 1VQEA 1WCMG 5DLQE 2HQLA 4JBMA 3W1BA 2BH8A 4A3JG 3H3VH 4MZ9A 2WB1E 3ZJYC 3OW2A 2IX1A 4IFDJ 4X65L 4DR3Q 4C3IH 3G6EA 4UY8C 5C0XI 3M4QA 1XMQQ 1X3GA 4A76A 1PH2A 3CMEA 4YY3L 4DAYB 2F52A 5C3EG 2JA8H 2WFWA 2QEXA 4A93H 4IFDG 2UXBL 1H95A 3I2ZA 4HIDA 2I0QA 3CP0A 4A3GH 1OXSC 4DNIA 3PUXA 4JOIA 3T1HL 4A3KG 1VQOA 1R9TH 1V1QA 3GO5A 3PSIA 4IPGA 3PUYA 1ASZA 5K36G 1TWGH 2F4VQ 4PZ8A 4PZ7A 4A3IH 1PH4A 4BY1G 1XMOQ 1Q1BA 4C3JH 2NVTH 1Y1WG 2F3IA 3JAMi 3J81i 1KAWA 4A3LG 2CQOA 1G291 5BR8Q 2ZJPA 4OO1I 1Q86C 5C0XG 2KHIA 2BA1A 1E3PA 1N9WA 4JYAL 1MIUA 4BA2I 4LFAL 2PQAA 3HKSA 4X62L 4IO9A 4GKKQ 4UP8A 1HJPA 3JC66 5GAEC 1HNXQ 4DV4L 1PYSB 4QJFA 2NN6I 5BR8L 1IBKL 4YCVA 4JCVE 2UU9Q 2VUMH 1VS0A 1TXYA 4JI1Q 5M3FG 1D7QA 1FJGL 2ASBA 2WAQE 4PG3A 1P8LA 2JK8A 3PO2G 4A3MH 2VW9A 3CF5A 3AEVA 1BBWA 4DR5L 3HOXG 4GNXA 3PV0A 1QZHA 4LF5L 1RL2A 3OYYA 3NELA 3HOVH 3CD6A 4BXXG 4IFDI 1HR0Q 4R4OA 4XIGS 1VQ8A 4O2DA 4IJLA 3CCUA 1J6QA 4DV2L 3KF8B 4OONA 4A3FG 5LMUL 5C4XH 2ES2A 4DR5Q 1X55A 1PHJA 2BH2A 1TWCH 3H15A 4TQUS 1IL2A 5AJ3L 4X65Q 2BA0A 2QGQA 2Y0SE 2A8VA 4H02A 4B3MQ 3I55A 1X6OA 4JBKA 4DR2L 2PI2E 4JI4Q 3NENA 1NMFA 2C35B 1W2BA 4DR6Q 4GN4B 1TWHH 1S40A 1HH2P 2OCEA 1A8VA 4IPDA 1A0IA 4OO1G 1C9OA 1NE3A 1Q46A 4JBWA 4OXPA 1UE5A 4YHHL 4DR1Q 1N34L 2LXJA 2ZM6Q 2JE6I 3CPWA 1OTCA 3PF4A 4DR6L 4KHPL 1AH9A 3M3YH 4DAMA 2OWOA 4B3TQ 2ZTCA 1GO3E 3M7NA 4AQYQ 2R93G 2B29A 2LXKA 3K0XA 1YBYA 3RN5A 1KXLA 1Q1EA 2K50A 3HOZG 1VQ4A 1JT8A 2CFMA 2N78A 4A3BH 1E1TA 2KHJA 3BU2A 2HHHL 4BY1H 1QUQA 3PO3G 2UXDL 2VS1A 4JI3L 3U50C 1V9PA 3S1QH 1VQHA 1EQQA 3RLFA 4B3RL 2PI2A 4R4QA 4JI2Q 3CCVA 4DV3Q 3GTQH 2Z6KC 5IWAQ 4DV2Q 1A63A 1CSQA 1UE6A 1MKHA 4DR4L 2E8GA 2IX0A 3KYHC 3CCSA 1KL9A 1Q82C 3M9BA 1VQNA 3KJPA 1E22A 3KF6B 1SE8A 5IP7H 2UXDQ 2L15A 4AIMA 3S15H 2VQEL 3KLWA 2JQOA 5C0XJ 1KRSA 1VQAA 2ZTEA 3Q8DA 4LFCQ 4K0KL 2AWNA 1FJGQ 1I5FA 1Z47A 4ALPA 1QVCA 1QVFA 1CKOA 1AE3A 4RG1A 3AFPA 3HKZE 3M4OH 2VL6A 3CC2A 1FGUA 3GTLH 2HIVA 5M5YH 4LUOA 2VQEQ 5FLMH 1E24A 2AHOB 4GN5A 2YTXA 1EQRA 4PMWA 1N33L 3S2HH 3HOWG 3HOVG 3AQQA 5JEAJ 1Q8KA 2VZAA 3FKIG 2E2IH 3S1NH 1Y1VH 4KI0A 4NXML 3I4NH 2VQFQ 2WB1G 3RNUA 5M5WH 1X3FA 1NY4A 3ERSX 4UP9A 4GN3B 4LFCL 3W5OA 4LF5Q 1CUKA 1HNZL 4YCUA 3DLLA 2KCTA 2YTYA 1XMOL 2OQKA 1VQLA 2HHHQ 1X65A 1YJWA 3TEHB 4QY7A 1I50H 3E9IA 5LMUQ 2ZJQA 3I4OA 4NPSA 4XTCS 5IP9H 3OTOQ 3UDGA 1X56A 4LF6Q 4A3JH 1EOVA 3PUZA 4KLKA 4IOAA 4B3TL 5C44G 3J80c 1OXXK 5C4JH 4B3SL 1P16A 2K75A 2JEAI 1PVOA 1PYBA 5IYDH 3HFZB 4BBRG 4X6AH 4GNXB 4FDBA 1X9NA 2I5LX 3EN2A 2NVYH 3CCQA 4JI5L 3MEFA 3NEMA 4DV5Q 1PH8A 2ALYB 1I94L 2VQFL 1EIFA 4LUZA 1VQ9A 3A5ZB 2NVXH 1LYLA 4DV5L 4OWXB 3IRBA 2ZM6L 4J15A 1C0AA 1PH1A 1N36Q 1EIYB 2RHSB 1XTDA 3GDEA 3HOYH 5FJ8H 1BKBA 1VQCA 4DPGA 4OWWB 1PFSA 3LGJA 2GN5A 1T9HA 4JI4L 4LF9Q 4EQ5A 1M1KC 4R4TA 2AKWB 1EWIA 2CKZB 2R7ZH 3UDFA 3STBD 3RLOA 4YY3Q 4JBJA 2UXBQ 4JI8Q 2QA4A 4GNXC 3UDXA 4A3CH 1VQGA 3K7AH 1UE7A 4UP7A 2UUCQ 4L5RC 2I5HA 4Y7NH 3T1HQ 3EBEA 4NXMQ 2UUBL 2JA9A 4HJAA 3PIPA 3ULLA 3CAMA 3U4VA 2EIFA 4BBSH 2ATWA 4R4CA 4YWLA 4YHHQ 5GAGC 3J81j 4X64L 1N36L 2IHEA 1YEZA 4DR7Q 2E5LQ 3E0EA 3HOWH 3A74A 1EUJA 4JI1L 1GD7A 1C7YA 1K9MC 1VQ5A 2PMZE 4POGA 3I4NG 3CC7A 3CCEA 2HIXA 3RZDH 4JI7L 5GROA 3NBHB 4AYBG 3H3VI 4NXNL 4GKKL 1OXUA 3L7ZC 5IY0A 5IT9c 2E2HH 4A3EG 2UUAQ 3K81C 4B3SQ 2JA5G 3CW2C 1WCMH 1K8GA 4LF7Q 4YCWA 2B63H 2A19A 3L0OA 1SR3A 2UUBQ 1IBML 4DUYQ 1BVSA
chains in the Genus database with same CATH superfamily
5IWAL 2NTSA 3E9HA 4HR7B 1RK5A 4AQYH 4RNOA 2QCPX 1STAA 1R4QB 3P20A 3JSNA 3PO2H 3X3NA 3ETJA 3HOXH 2EYMA 1STNA 4HJ7A 4BY7H 5D1PA 1J5EQ 4A4IA 2JA7A 2XGQA 2BCOA 1O7ZA 2Q2TA 5EOYA 3MXNB 5DNFA 3J7AK 4C1NK 2YS6A 4OX9L 2EY1A 3S16H 2HD3A 4QL5A 3RLNA 1GHJA 4DR3L 5C4XG 4RMFA 4RAZA 1GSHA 5LL6b 1GUNA 4A3JB 2L4NA 1F9SA 5LP6F 4IURA 2MPMA 1L0WA 2A68D 2JA7G 1CHQD 2IMWP 4IOCA 4PQXA 2R6GA 3MAQA 3S1QB 3KF6A 1PH3A 2W9BA 2N55A 4DR3H 1EY7A 4FXGC 3OOCA 1PH7A 1ZEQX 2CWAA 1Y1VB 3BZCA 4RGNA 4BY7B 5JVG3 2RQXA 4C3HH 2R92G 4P73A 4IHJF 2J9GA 3KUPA 2I5MX 5KG3A 4DR6H 3H91A 3O13A 1TWAB 4DXFA 1HNZQ 1XJVA 3GTLB 4A3MB 3PN1A 3M4OB 2R7DA 3H20A 3GTPH 3J80L 4R7RA 2D5DA 5C44B 4FU0A 1CHPD 4HN7A 3HKZG 3LWBA 3FDTA 4FBUA 1Y14B 3T5HA 4LF7L 2AQ1B 2CH4W 2F0EA 1XMQL 4C5BA 2YU9A 4Y52H 3F2UA 3FMAA 4J9PA 5I2XA 4JV5Q 4LW1A 2XGTA 4R1JA 1QVGA 4UCSA 4YBZB 3EPGA 2IP4A 1GSOA 4QCLA 4X3KA 2NZHA 1PZKD 4LH6A 3KHGA 2OTJA 1HZ9A 2ENBA 1M8AA 4GLAC 4I55F 3PO3B 2QILA 1FL0A 1S97A 5FLXW 4Q8FA 4MV6A 3SE7A 4KY6A 3K5IA 1A2TA 3AYHB 1IBLQ 1HNXH 3H0GG 5K36H 1B6RA 4DV3L 4GOPC 1WI5A 4XQNA 1TQOA 1HNZH 1Y8NB 4DU9A 2BE5C 1IYVA 5M3MB 2RDJA 2VQEH 2FXQA 3A0JA 2X0SA 1GKHA 1I3QA 1ML0D 1NR4A 4NKLA 5C0XH 4QWDA 4JI1H 1LTLA 4KY7A 1KJ8A 1A62A 1KTKA 2K28A 4CKBA 5J2UF 5IODA 5L1LA 2MFIA 2RVLA 4QWBA 3NBHA 3IG0A 5ELNA 1CK1A 2QYZA 1QZGA 4J9NA 3N52A 4X66Q 5KFYA 1EIGA 4APVA 4DV4H 1JJCB 4RZRA 4ECTA 2FE3A 1HZAA 3BQ1A 5L1JA 1GYFA 2DUDA 2Z8LA 1M0WA 4KD4A 1MGSA 3GTGH 5KFZA 4R8UB 5F9NA 1YJ9A 5LMNQ 1VQFA 2WIIB 1JJ2A 2B2VA 3PIOA 2N49A 3GD7A 2JA6H 4DV7H 1JKJB 2D0OA 2DGYA 4A3FH 2ZDQA 1KNAA 4YJ2F 5FPOA 4Q8EA 4MV4A 3G71A 4ZQ3A 5I2YA 3H40A 3RV3A 4RWSC 2O5IC 3I7FA 4PV1C 3PZPA 4ULLA 2A6HD 3I73A 1Q81C 2AU0A 1FGBD 1D8LA 4BBSB 4DK3C 1XTCD 2WB1B 4UDUC 4MV1A 2B2TA 5CV5A 3WOFA 1UC8A 3HOYB 2VNUD 1VF5C 5KFJA 3GTKH 1DOMA 1JICA 2ZXRA 5FLMG 2F0TA 4DV6L 3V6KA 2R7ZB 4ME3A 5GQOA 2R7FA 2O5JC 4A3BG 2JJQA 3K7UC 4DR7L 1A6XA 4XDXA 2CVRA 1SR3A 4P72A 2F4VL 5KFIA 5CC4A 2M2LA 3S2DH 3NQIA 1HFGA 5I47A 1BCPF 3M9NB 4DL5A 1H9MA 4NLGA 4IQZA 2JA5H 3PIP3 1G51A 5JOBA 1KJQA 4DK6C 4A2AA 5JEAG 4O3OA 3J81c 4WFN3 1B7YB 3HOUG 3KTMA 3K80C 2DZDA 1VF7A 3CCMA 1KRTA 2C00A 1L1OB 1BCPD 4RKLA 4DUYL 2A73B 4WJWA 2PQEA 3PUVA 2B8GA 1KEEA 3HOZH 2OTLA 4P71A 4DR1L 5T14A 5CV6A 3S14H 2Z6BA 3BVMA 3N41B 5KFEA 2EY6A 3J80i 1A3VA 3KOJA 3HOYG 4M7EA 4MV9A 2XVSA 3EVQA 2RF4A 4M1UB 2E2IB 4EFEA 4K2KA 4A3IB 4ECVA 4XQJA 4LH7A 5EKKA 3ICEA 5KNCA 3S17H 1L1OC 3D6CA 4FXDA 2AGQA 2Z9HA 1VQIA 3RB0A 2LS01 3R8BA 4LAAA 3OTOL 5DGBA 4DV0L 4DV1Q 1HR0L 3MR2A 5LMNL 1S72A 1EY4A 4CJ1B 1SLJA 4F87A 3A7AB 3SR1A 2CW0D 3TP8A 4JI2H 3U9TA 3G4SA 4AYBE 4JI7Q 3NXWA 5IYBG 4UHVA 4LF9L 1Y1VG 4EYHB 4LSXA 3JAMW 5C4ZA 5EGTA 1IKLA 1TKWB 2V1CC 2D62A 1IOWA 1I4GA 5FLXc 4U6PA 1A9XA 4JI0H 1E4EA 2EJMA 2HQLA 3W1BA 3V6HA 2BH8A 2NVYA 3H3VH 3QJYA 2WB1E 3ZJYC 3OW2A 2UUBH 4DR3Q 4UY8C 2VUMA 2K5QA 3BA9A 3TDQA 3GV6A 4APMA 4C3JB 1W96A 4IFDG 2WFWA 1E2ZA 3C1EA 3QZ7A 3CKIB 2DN8A 3BYTB 5FO8B 3BZDB 3T1HL 4LFBH 1BXTA 1V1QA 3PSIA 2AUKA 2EPBA 5K36G 1TWGH 5BN5A 2YRXA 4FS1A 2JEIA 4PZ8A 4LSAA 1Q1BA 2J0TD 3JAMi 4P2CB 4QWAA 4A3DB 4G7OC 1B1ZA 2RDIA 3MWMA 1G291 3GTPB 3TIIA 3E3XA 2KHIA 5FOBB 1JWUD 1N9WA 4JYAL 3ORQA 4J1MA 5I6WA 2R92A 1CM9A 4GKKQ 1RKNA 2F0GA 4Q44A 3GIJA 4FXKC 2L1BA 3MFYA 4EQPA 4O3SA 3GTGA 1PYSB 1SYBA 4YCVA 4JCVE 2UU9Q 4C5AA 1SXTA 1TXYA 4JI1Q 4RUCA 1ZQ7A 4JUZA 2JK8A 3BDLA 4N8FA 3T53B 2VW9A 4UCTA 3HRZC 4AYBA 3WDNA 1JOOA 4GNXA 4UAIA 1RL2A 1QZHA 3NELA 4LF5L 3CD6A 4IFDI 3GQCA 1HR0Q 4XIGS 1ZHSA 2R7LA 2XWBB 4HMJA 2SNMA 1L0YB 3FPPA 3H4BA 3GP7A 4JV2A 3T16A 1Q90A 1X55A 2G5DA 2NN6H 5AJ3L 2FLLA 3N40P 4ECUA 1BF4A 4B3MQ 3I55A 1DD2A 4JBKA 2FK2A 3OSPA 2PI2E 1HR0H 4ZCKA 5FLXE 3S1RB 1SNPA 2R93B 3G8CA 1W2BA 1A8VA 1A0IA 1C9OA 1K83A 1Q46A 4OXPA 4YHHL 4DR1Q 4DR6L 3VPBA 4PNYA 5J22A 3DXJC 1VKZA 4XYOA 2B2WC 2DLNA 1ESFA 2R93G 1GO3E 3M7NA 4AQYQ 3RN5A 3K0XA 1CT1D 4FO2A 2K50A 4XQQA 2RDFA 3BU2A 5C3EB 1QUQA 4MV3A 5KFLA 2PZWA 4DFAA 1VQHA 1EQQA 3PW5A 1N32H 5BMVF 5IWAQ 5EWFA 4DV2Q 1A63A 4TQRA 1O7LA 1UE6A 1AN8A 2WKCA 4JK1C 2VXWA 3TSSA 2W9BB 3KJPA 1EYDA 3H0GA 3DWAA 4AIMA 4C1NI 2JQOA 1IKMA 2ZTEA 4O4HF 4KD3A 4PWQA 3ONAB 1Z47A 1Z6HA 1QVFA 3RZOB 4IALA 1U9RA 2RDGA 4IR9A 1LTTD 1PFNA 1GOZA 3S14B 3OHXC 3MJFA 4DR1H 1S0OA 1PZID 4PMWA 3HOWG 4DUYH 3S1NH 1JORA 2RCFA 5DQIA 4KI0A 2VQFQ 3RNUA 5M5WH 5KG5A 1CQJB 5IOCA 1SNOA 3IAYA 1O80A 2UVUA 2V4DA 1E0BA 1BXRA 3SK8A 2K03A 5IT9E 1YJWA 3TEHB 1BNZA 3E9IA 5I6YA 1EZ1A 4NPSA 5L1KA 4XTCS 1XMOH 2D2CC 5JVH3 3GILA 3PUZA 5A35A 5CB4F 2F4IA 5DG9A 4B3TL 3MR3A 3W2DA 1KJJA 1KC7A 1OXXK 5C1OA 2R82A 3L4JA 2PZTA 2FK1A 1R4PB 2ZT9C 2JEAI 5KFKA 4WRDA 4DAVA 2EYJA 2BDNA 3HFZB 5AFWA 5BN3A 1BCPB 4LJZC 4C56C 4FDBA 2I5LX 3EN2A 1S68A 1BDOA 2GPWA 3G6VA 2ATLA 4JI5L 3MEFA 2VQDA 1SE4A 4DV6H 2A69D 3VR2A 3A5ZB 1PDQA 2L0CA 1FYCA 4IUUA 2A74C 5JJZA 4A3GB 2W6PA 3GIQA 2NU9B 4C3JG 1PH1A 4B08A 1EIYB 4DXGA 1E2WA 3HOYH 2BQ3A 5FJ8H 3M9MB 1BKBA 5JVDF 3LGJA 2GN5A 4EGJA 1CFMA 5DQGA 5DQHA 2WYOA 4GC7A 5KG2A 3STBD 2UXBQ 3OIPA 3UDXA 3QR8A 1VQGA 1HUNA 4O3RA 4L5RC 3KLSX 2BE5D 3T1HQ 3EBEA 2F0OA 4ZK9B 1BJTA 2UUBL 2DNCA 3ULLA 1IYUA 3CAMA 4BBSH 2ATWA 3GIIA 5IT9W 4YHHQ 5KFHA 4X64L 1I4RA 2IHEA 2WAQA 3P75A 5JH7F 4F88A 5KT2A 2W71A 3A74A 1DIKA 3D4DA 1VQ5A 4ECRA 1K9MC 5F9LA 2AQ2B 1F77A 4N9PA 3CC7A 1JOQA 2HIXA 5EJWA 2R86A 1T5EA 5GROA 4CJ0B 2GA4B 4AYBG 2V4QA 5ELEA 4ZYSA 1T3NA 1C4QA 2QKIC 2EYHA 3CW2C 5CYUA 2B2VC 3PW2A 4LF7Q 1TWFA 4YCWA 2B63H 3L0OA 2E76C 1TS2A 2EVBA 1FNWA 4YP3A 3OTOH 4FNFA 4EQOA 2WAQB 1WTPA 5GONF 2V5AA 5LMNW 4ECWA 3NSWA 2PMZA 2JYOA 5H1SE 5KFNA 3DM3A 1VMCA 1WH2A 5D1OB 1N33H 2JA5A 1HCZA 3BJUA 1YJNA 3VR6A 3HOUB 3MHBA 2CZGA 2B2YC 1MJEA 3FRPB 5KFWA 4ZI7F 3OIQA 1FJGH 5IYBH 4A93B 2VPSA 1Y1WH 3GIMA 4RGMA 4DKAC 3D8GA 1UWVA 2JEBI 2XNAC 3ULJA 4CDDC 1GVPA 4X62H 4DV2H 5KFDA 3I90A 2RHQB 4PZ6A 3TBIB 3BDCA 1EEID 4E6IA 2R7ZG 3R2TA 4IRCA 1K83H 4JYAH 1NSNS 4ME5A 2PO4A 3I56A 4B9XA 1VQMA 1GUWA 3RTXA 1PMRA 1MJCA 3MTSA 2FB9A 1WSCA 2C28A 4IFDH 4RHSA 1O7IA 3T5LA 2X69A 3AMUA 1YHBA 3CC4A 1TWAA 2WTFA 4C2MH 4GZYC 2RKSA 1XNRH 3DEOA 1ULZA 3IN5A 3I4MH 3SDZA 1BBUA 1Y1VA 1JLLB 5CGKA 2SDFA 5EPLA 1IBMQ 4O3QA 2VY3A 1EYZA 1SRUA 3CMAA 1M90C 2GLTA 3U9OA 2ZM6H 2KEEA 2W7OA 3NPPA 2R93A 1SYCA 2MP1A 2AGOA 1U4PA 2A68C 4JI0L 1UC9A 4QQBX 2E5LH 4LFCH 4G4KA 4AQYL 1QG7A 3ULPA 4LF6H 4JI5Q 2E5LL 4R4IA 4WD3A 3HOVB 1B3AA 1BR9A 3M4YA 4FF1A 2LY7A 4H44C 1GM5A 1RJTA 3Q8PB 2JA7B 4DL4A 5KFCA 4DV1L 4DV0Q 3NHHA 1L1OA 1PH5A 1CQIB 4DLKA 1EY5A 3UDIA 2BDOA 2NUAB 3OPOA 2Q2HA 1VQBA 4JI2L 5E7NA 2R7NA 1X54A 4GLVB 3T1YL 4Y7NB 3HKZA 5JJLA 1NJIC 2JXMB 4DV7L 2P0AA 4O2BF 4DL2A 3S1RH 1SEBD 3T1YQ 1IBMH 1X3PA 3F8NA 1ENAA 1TWFB 1LV9A 2A1AA 2K5WA 1MHWC 3S9WA 4YQWA 3CQZH 4LF8Q 3R5XA 2AUJD 4HIOA 4EEYA 5KFUA 1WFQA 3KFUA 3J81E 4A93G 3RUPA 1U4RA 1IBKH 3SI8A 1B3QA 3OMGA 1I4QA 2UU9L 1E4GT 4OIJA 4DF7A 4A3MG 1I4PA 3RBDA 2R92H 3BDOA 2F0JA 4A3EB 3F1ZA 1L2FA 4A3IG 1V8QA 1HFNA 5IGFA 5ELCA 4LFBQ 2WAQG 2I80A 4RU9A 2DPIA 2R3ZA 1YNJC 1BO0A 3D4RA 2UUCL 1KDCA 2KSWA 3Q8QB 3G48A 2BQRA 3PO2B 4HQ6A 4X66H 1KHIA 3CCLA 3RN2A 4HCEA 1IZ6A 1DCZA 2Y0SB 2XIWA 4A3CG 3K58A 4KHZA 3PF5A 3UI2A 2VUMG 1IBLL 1IOVA 1RTOA 2TSSA 4DV6Q 1PYWD 4LNQA 2K7VA 1N33Q 2KJXA 3BA8A 3K59A 5EAYA 4TV9F 3RFCA 3D0FA 3MR6A 3MR5A 2A69C 1JIHA 5IYCH 3RR5A 4BY7G 3S24A 3H0GH 3L2PA 4QWEA 1FVIA 1MSGA 3WOEA 4A75A 5KFTA 2R8KA 1GXDC 5AJ3Q 2I87A 2W6ZA 4KJNA 1OXTA 3T13A 3N44B 5IYZF 1VQKA 1HQMC 1STHA 3T5KA 2NVQH 2MUYA 1R9TA 4F4WA 1WTQA 1B70B 4DR4H 1RCVD 5IP7G 1TY0A 2CW7A 1YITA 4X3UA 2Z0SA 5DG8A 5BPHA 2QDLA 4M8AA 1D5XC 1LTRD 1X3EA 1FD7D 1STGA 1PH6A 1EFWA 3B6YA 1D1IA 3EPIA 3RIZA 1WCMB 2A6EC 1I50B 4JC0A 1N34Q 4KHPQ 2I46A 2C2DA 1V1PB 4MTEA 3C0FB 4DL6A 1ZKOA 4ECQA 3MXGA 4OIKA 4A3LH 2JA6G 3F2BA 3OMCA 2JP1A 2NU7B 4JOIC 1G2SA 1GGOA 1SMYD 5FO9B 4M9UA 4YB8B 2K5VA 4IAJA 1I6HH 3GTKA 1S9FA 2ID0A 4YR3A 1YNNC 4DR4Q 5JQWA 4LF6L 4KKUA 5CA1F 4GKJQ 1TAEA 4F4XA 4P74A 2EQSA 3FMCA 5IT9L 2AQ3B 3CQZA 1L2ZA 4UCVA 2A6ED 2B2UA 2BOSA 4CGYB 5KGUA 4DV3H 1D5MC 1AE2A 4RKBA 4BXXH 1Y69U 1PRTD 1S3OA 2VA2A 1ET9A 3I4LA 3GTJH 1AN7A 3F2CA 3RB3A 5C5JA 2D9UA 4GS3A 1B8AA 2NVXA 3D3RA 4EGQA 4JV5L 4A2BA 3C2PA 3T1YH 3ZYYX 1JMCA 3TQ1A 1QNKA 2A5HA 2NN6G 1N56A 2XCPA 1WCMG 5EBDA 1SAPA 2Q8TA 4EVOA 4XYMB 1LLRD 4IRDA 1B2TA 1KNEA 4X65L 1BNCA 5KFGA 1PH2A 1X3GA 2KECA 3CMEA 5KYLA 4YY3L 1B44D 5C3EG 4A93H 3RAXA 2QEXA 5BR8H 4HIDA 3CP0A 1CZGA 4A3GH 4DNIA 3PUXA 4JOIA 3HZXA 4HCSA 3GO5A 4OL7A 1ZETA 3PUYA 3OHBA 1PH4A 1JWSD 2F0PA 4BY1G 4HR7A 2CQAA 2NVTH 4FF4A 2WE6A 2F3IA 1GHKA 2F3WA 4J6HA 3GIDA 4IWXA 3H6MA 1AFPA 3S15B 1LT6D 3NTIA 2CH4A 5EWGA 3Q22A 5BR8Q 4OO1I 1VAJA 4EQNA 1Q86C 3N6RA 1JE4A 3N42B 1S0NA 1K8MA 4QWCA 4LFAL 3HGBA 4Z9CB 2PQAA 3TINA 1S10A 1HJPA 3JC66 1LTGD 2FMCA 4QJFA 4JI4H 1JX4A 3IKJA 1S5DD 1SSOA 4K14A 1D7QA 2ASBA 1HTPA 2WAQE 3TP5A 1P8LA 3CF5A 3MFGA 1TWCB 3HOXG 3PV0A 2J4XA 2JEJA 3OYYA 3HOVH 4R4OA 4FBTA 3T51B 3J7AV 1DJRD 1QILA 4DV2L 4MA5A 3KHRA 1TS5A 1F9RA 3GTMA 5LMUL 2XN9C 4ZRZA 4RGTA 5ISRA 1ZXTA 3H09A 2F0FA 1PHJA 5C5LA 3G7LA 4TQUS 5C6AA 1SBBB 2FK3A 2QDBA 4DR2L 1O7YA 2UUCH 4JI4Q 4CC6A 4UCRA 3PW4A 1NMFA 2YU9B 4DR6Q 1S40A 4GKKH 1K1SA 3NTKA 1NE3A 4JBWA 2SCUB 1SEIA 1SNCA 5KG7A 4J9QA 4L63B 4MTKA 4C3IB 1AUVA 5G3LD 2OWOA 4B3TQ 2VR1A 1DOLA 2ZTCA 4QW9A 1KXLA 1PXUA 2K05A 3Q8SB 1F2YA 3LWEA 1N36H 1E2VA 1PLFA 2N78A 2IX3A 3K5LA 2KHJA 1KLUD 5EPJA 1RD9D 3PO3G 2UXDL 4JI3L 4B3RL 2M00A 1LTSD 2PI2A 4JI2Q 4ZLTF 2Z6KC 1YNND 3SE0A 2IX0A 3KYHC 3CCSA 1Q82C 3M9BA 2W7PA 4GKJH 3KF6B 5IP7H 4BS9A 3J80E 1SMYC 1I5FA 3A7LA 1CKOA 3GTQB 3AFPA 3VYUA 3M4OH 3CC2A 4C3HG 2HIVA 5M5YH 1QWYA 1LTID 2HHHH 1FNUA 5FLMH 1QNUA 2YCHA 3S2HH 3MWEA 5JEAJ 4O4LF 1Y1VH 3RUZA 5DLFA 3T4AC 5EKIA 5KYIA 1RJPA 2E2HA 3G6XA 2SOBA 4LF9H 2UUAH 3R3OA 1DOKA 4UP9A 4LFCL 1VQLA 4YCUA 2KCTA 2YTYA 1F2LA 2OQKA 3UFXB 2W6NA 4QY7A 1G6ZA 3R5FA 5IP9H 2XCAA 5KT5A 4LF6Q 4KLKA 1SE3A 5C44G 2OXPA 4B3SL 2SNSA 1Y1WB 4YR2A 5D3DA 5KFFA 2NVTB 3VMMA 1S5FD 1X9NA 2NVYH 1TWCA 3QZ8A 3CCQA 4K5XA 4I4TF 2NBFA 1SNMA 1QCBD 2NVXH 4DV5L 2XSCA 2FLNA 4IUTA 4OWXB 3IRBA 2VB3X 3PMFA 2ZM6L 4NXNH 3J81L 5JAVA 1XTDA 2WB1A 2NB0A 4OWWB 2FLPA 3D6WA 4LF9Q 4YAKB 4EQ5A 4EYIB 2VB2X 4R4TA 2R8IA 2CKZB 2NU8B 1NNXA 3UDFA 3HOXB 4TSSA 2A6HC 4YY3Q 1HPCA 2OEOA 1OWTA 5DLGA 3Q0AA 3TZUA 3I12A 2I5HA 4Y7NH 5KNBA 1TVXA 4R8IA 4A3FB 4NXMQ 5EWEA 1EL0A 5KT4A 3PIPA 2JA5B 3U4VA 2EIFA 3KXYT 4KKTA 4YWLA 4OEMB 4ZUJA 5GAGC 5C1PA 1PRTB 1Q3LA 2DWCA 3NE5B 1EWCA 3E0EA 2FPGB 1GD7A 1C7YA 1I50A 3KHHA 2H1EA 3VYSA 4POGA 1C30A 4RCNA 3CCEA 1SYDA 3NBHB 3MC0B 2ASJA 3H3VI 4NXNL 3PW0A 1OXUA 1F9PA 3L7ZC 1D6EC 5CV7A 3Q24A 4B3SQ 3GTPA 1WCMH 1V1OA 2K1BA 3DMUA 4QMGA 5BPFA 4RB1A 2UUBQ 3HEJA 4DUYQ 1BBXC 2NU6B 3OSNA 3HXLA 5CR3A 1I94Q 3HOUH 1XX8A 1HR0W 3TREA 1NMGA 3MFIA 4J9SA 1ZHQA 3G6YA 5IYDG 1EZ6A 4EBCA 1CA5A 2W6QA 3OW7A 4KKSA 1M6VA 1JCKB 1NTGA 2GVAA 3IL8A 5IYCG 5EBCA 3GTMH 3QFFA 4EEQA 4LMYA 5EPKA 2R7ZA 4BBRB 3E0JA 4ZKCB 2UUAL 3BQ0A 2RA4A 3PO3H 2RBMA 3I91A 4UCOA 2R8GA 1JE5A 1K83B 1JR0D 3PUWA 3D31A 1S4ZA 3K5MA 3OHAA 1XPRA 2HDMA 1HHVA 2YRWA 1IL8A 4IJHA 1KIXA 4WJ4A 3V4SA 1RJRA 3PR5B 5M3MG 2F0NA 1I4XA 5EDWA 3BYYB 2ASLA 2IA6A 4Y8VB 4ED8A 3P7JA 1TWHA 2IWHA 2AQ4A 4L5QA 4PMCA 4ECXA 3GTMB 1G91A 1BGWA 2R85A 1RF2D 3U58A 4A3KH 3TS2A 4JI3Q 2DPJA 4HIKA 5KT7A 5D65A 2K5DA 3TRZA 4TQSA 4K6DA 5F2DA 5C5MA 3LX0A 3RGZA 2KQ3A 1B53A 1G6PA 1A2UA 3RD4A 4B3TH 1HNXL 4IZ8A 1PFBA 5LYJF 1ILQA 4J9LA 4ME6A 4X62Q 3BABA 4A3EH 3M4PA 2RCNA 4O1NA 4ZUIA 1EOTA 1EU4A 3WWVA 4JV0A 3EIVA 3R93A 3R23A 5IGDA 2E2JH 3WO0A 1KD1C 5JJIA 3AFQA 1MD2D 2X6GA 2KCCA 4WBNF 5KX5F 2ZJRA 3S15H 3GTOB 5LHY1 1LTAD 2EYLA 5CMDA 3V2TA 5C3EH 2J6UA 2BQUA 1UAPA 2XTIA 2ZTDA 4IUVA 3F8TA 1EU3A 1GSAA 1QB5D 2EJGC 3FDSA 3A54A 3SGIA 1VQ7A 2CHBD 1SFOA 2DJFC 3WO1A 3VYTA 2WINB 2CCZA 2F0UA 4DN4M 3PR4A 5FJ8G 1DGSA 3HS0C 1EWHA 2PW7A 4IPHA 1STBA 1B04A 1XPUA 2MCTA 4G3IA 4YWMA 1LTBD 3RGXA 2C2RA 5JEAH 3M3YB 4RZQA 2KENA 2FMMA 2RSOA 5LMNH 5C4XB 2K52A 4LFAQ 4TV8F 4DV0H 5KFQA 1PTOF 3GIPA 2Q8RE 3FP9A 1SYFA 2K14A 2YYZA 2NVXB 2WKDA 1AEXA 4DV4Q 1STEA 4DA2A 4K0KQ 2MO0A 2YV5A 4DV7Q 3R2IA 4MNOA 2XIGA 2NUCA 2F4VH 4FM9A 2E75C 1UEBA 2PW5A 4DR7H 2B3GA 2EXZA 4RHRA 5ELOA 2F03A 3N8DA 1XXGA 2FJ2A 5T1IA 3VDYA 4O0AA 2IT1A 1LM0A 2R8HA 1V43A 5KFRA 5J1ZA 2O2LD 4CKEA 5IGEA 1CTMA 1SFOH 3GLKA 2HT1A 3DM1A 1PTOD 4J9MA 2B2YA 1K0RA 3DEPA 5L1IA 4LF8H 3URYA 2NWGA 4RA8A 1EYGA 3DUZA 4JI0Q 2HVQA 1WTOA 4EFBA 2KUMA 5KFXA 4ETSA 4B3MH 4B3SH 4LF4H 5M5XB 3Q8RB 2AMCB 4G57A 3U9SA 1X3QA 2YU9H 5KFAA 4S3SA 1V1PA 3KHLA 3KDFA 4GC6A 2PBZA 4DUZQ 2B2WA 1RIPA 4Q0YA 5DAUA 2YZNA 1GUTA 4L5TA 5E1FA 4GLXA 3CVZA 4HMIA 1D2BA 4JV5H 1XYIA 1GUGA 4X64Q 2MHVA 4QIWE 1DM0B 5IWAH 3W3AA 3GV7B 2IHFA 2Q2IA 3CXCA 4N9TA 4CDCC 2CWPA 4GKJL 2ZDGA 1W93A 2B63G 4U673 5KFSA 5M3MH 1LUZA 4ED7A 1HXYD 3VA7A 3JAMc 1PZJD 1WTRA 4F8MA 5I9PA 3V96A 5IGGA 2EYOA 4NXMH 2WACA 4HEDA 3V05A 3VR3A 4TUYF 4KTAA 1UEAB 3RV4A 5DM63 5HURA 2F0QA 4LFBL 3A5UA 4FS2A 4IPCA 3T56B 2KA7A 3OWFA 4IUNA 1PA6A 5HGQA 1OO9B 2XRSD 1NCVA 2B8FA 4HJ8A 4UFZA 3FKIA 2E2DC 3A56A 2L5TA 1OXVA 1ESRA 1T94A 2UVVA 1YNXA 3LWUA 3BS1A 1Z9FA 3SEBA 2B2TC 1F2ZA 1VQDA 1RYRA 1WOCA 2FINB 5KFOA 3ORRA 2Y0SA 1TWGB 4ED1A 3RMHA 3JSLA 2DY7A 2F0KA 2L9HA 1XWEA 2N3SA 3DWPA 4WJ3M 3DF7A 2XRQD 5C44H 1KQSA 1Z7TA 3ER0A 1IHZA 1VQJA 1VBHA 4HIMA 1PX2A 1YHAA 4ID6A 4LUVA 1LT3D 3NUCA 1GJXA 2HUGA 1I6UA 4KHVA 1JDEA 4MTNA 1U5KA 1I94H 3BZKA 1CSPA 4QF4A 1AP0A 3HB9A 4KN4C 4YWKA 1E1OA 2K5NA 3EFXD 3J7AF 1QOHA 2MNAA 2F0IA 4O2AF 3J81W 2AWOA 3LP8A 1PFMA 4RB0A 2QF7A 3PVXA 2EYFA 1VQEA 5DLQE 2J6TA 2QEJC 4A3JG 1CQVA 2HQEA 3KK7A 3S2DB 3A8KE 2JA6B 4DNTB 1V51A 5C0XI 3KAJA 3M4QA 5FD6A 4K0KH 4A76A 1Z2NX 2V4RA 1SYXB 1KAAA 1L0XB 2UXBL 4XX0B 2JA8H 3RZDB 2I0QA 2Z4IA 3ETHA 2PZUA 3KAKA 4IPGA 5CV4A 4DL3A 4IRKA 4RNMA 2F4VQ 2PCFB 3J81i 1F2MA 1ICFB 2TMPA 4A3LG 4OX9H 3KLSA 2OH2A 2VUMB 4QUFA 5JUMA 2O4XA 1H9RA 1KABA 3BVGA 2ZJPA 2IJ0A 1WVLA 5C0XG 3BJYA 2BA1A 4QB4A 4MAMA 4YR0A 1MIUA 4BA2I 4X62L 3HKSA 4IO9A 1N34H 4KHPH 4RUAA 4HSPA 5GAEC 3EYYA 1HNXQ 4DK1A 1UUPA 1IBKL 5KFPA 2NN6I 5BR8L 3E6ZX 2XCLA 2VUMH 3Q6SA 1PRTC 3GTJB 1T36A 3E5NA 5M3FG 1FJGL 2XC9A 4PG3A 1BQQT 1G8ZD 3QO2A 4KJOA 3PO2G 1SE2A 3I4MB 3AEVA 4CHTB 4N8X1 1SFOB 1Z2OX 1BBWA 3NQTA 5IGCA 2FJZA 3NWTA 4F50A 4LMQD 3PQIA 2W9CA 1Y1WA 1KLGD 1VQ8A 4IJLA 1ET6A 1J6QA 1WTWA 4OONA 3KF8B 4ODGA 1EIHA 4J9OA 1SNDA 3TN2A 5E4WC 3Q2OA 4XYLB 3GV3A 1A15A 2JA6A 3P1HA 1ICWA 5C4JB 1H9JA 3H15A 1IL2A 3DWQA 4X65Q 3ERQA 2QGQA 2Y0SE 5FO7B 2HCIA 4H02A 4CJ2C 1EUCB 4MTDA 2E2IA 1X6OA 2F0WA 2R6FA 1CI3M 4I7HA 3TIGA 2C35B 1S5BD 4ZAIA 4GN4B 4I65A 5FK9C 4OO1G 1K0SA 4R8UA 2EZVA 1K28A 4OHJA 1OTCA 4K8JA 2B2UC 3PF4A 1JT8A 2LXJA 2ZM6Q 3CPWA 4O3PA 2IPKD 2WV6D 1RTNA 4J8QA 1HTLD 1T5XD 2R7MA 4DAMA 4V0BA 2YL2A 2CW0C 3MXNA 2P5ZX 3ND9A 3ITPA 4KK7A 3HOZG 1ENCA 2J7ZA 4WORA 4A3BH 5KRUA 5KG0A 2JEFA 2HHHL 2F1MA 4BY1H 2VS1A 3U50C 4DV3Q 1LABA 3HBLA 4LK1C 1CSQA 2BR0A 4BWGB 1MKHA 4DR4L 2HDLA 3QG1A 1S5ED 2E8GA 4C5CA 5CV8A 5JPNC 2K04A 1VQNA 1E22A 4KY5A 4HNUA 2Z4HA 1BUVT 2L55A 2VQEL 3KLWA 1KRSA 1VQAA 2DNEA 4LFCQ 2AWNA 1D5ZC 2RDHA 4ALPA 5BN4A 2FPIB 3MZ5A 4YIJA 3HKZE 3FKIB 1U4MA 2VL6A 2OF1A 3GTLH 3NP8A 4LUOA 1DV1A 5I4DA 4ED2A 3C3LA 3NK9A 2YTXA 2V59A 2XD4A 1EQRA 1SYEA 3HOVG 2VQFH 2ALZA 1RJQA 2VZAA 5D8DA 4NXML 4G7HC 2WB1G 1X3FA 1NY4A 4IZOA 2C22A 4LF5Q 1HNZL 1XMOL 1D1KA 4CC5A 4DAYA 3D4WA 3VYRA 1CE8A 2IL8A 4K5VA 2ZJQA 4A3KB 1O75A 3I4OA 3OTOQ 3UDGA 2R8JA 3TQTA 1NUCA 1X56A 3QOJA 4PMBA 4A3JH 1EOVA 1W6KA 1MZBA 4IOAA 3GTLA 2NVYB 2JSOA 4C3IG 3J80c 1YNJD 3CHBD 1W6JA 3OSOA 4RGOS 5L37A 5IYDH 2ICEC 5D3IB 2B63A 5D14A 4DV5Q 1PH8A 3NEMA 2ALYB 4J0MA 4I50F 2VQFL 4RCOA 1Z2PX 4LUZA 1VQ9A 4I7ZC 1LYLA 3GV5B 3RB4A 4QIWB 4ZOLF 1C0AA 1JQYD 1I7NA 3GDEA 1GUOA 1VQCA 4DPGA 2V9WA 1PFSA 2Z1CA 2B39A 4KMUC 1T9HA 5NUCA 4JI4L 1KJIA 3MXPA 3J7YW 1M1KC 5KKNB 3A55A 4ILWA 4LFAH 3RLOA 1B9MA 2FKLA 4A3CH 3RF2A 4MV7A 2PPBC 1UE7A 4OGQC 5L9XA 4ABNA 2UUCQ 2UXBH 1X32A 3VR4A 1WD1A 4ECZA 1G2TA 4DV5H 3S17B 3HOWB 2F0MA 4R4CA 1K1QA 1B50A 2IBKA 3L3OC 5E3FA 1YEZA 4DR7Q 4ZHQF 1WR2A 5KG4A 2R61A 1EUJA 4KN7C 4XZ3B 2HGSA 4IWYA 2L12A 2PMZE 3RZDH 4JI7L 1GLVA 3MWDA 1ZYRD 5T1GA 5IT9c 3Q23A 2E2HH 1RHPA 4C2MB 3EROA 4NW2A 4EBDA 2A19A 3CRLC 5M5WB 1BVSA 4BWSC 1HNWL 1TIID 2W70A 1B4OA 3R5HA 4JI8L 4FVMA 1HA5A 2LKVA 1YVCA 1WTHA 4A3GG 4TVAB 5DG7A 2Z6KA 2Q8IB 2F0SA 2L11A 2RGRA 5JJKA 3HP3A 2UVWA 4HTHA 1YZ6A 4LWCA 2C2EA 3UE0A 1I3QH 3M85A 4P75A 3GTQA 3JRXA 1MSHA 1FR3A 4DR2Q 2KOLA 3W1GA 2E2JB 5FKAC 3TS0A 2I07B 1AUXA 1CKNB 1JC7A 2FPPB 5IIFA 4QIWA 1JWMD 2KVMA 1SDFA 1EY9A 1EY0A 3S16B 1IXRA 1W3SA 1J9OA 3U4ZA 3CU7A 2JA8G 2IY5B 3K8AA 2LSSA 1DYQA 4JG2A 1HRJA 1EUDB 3T1HH 1N48A 4ECYA 3KLRA 3TQYA 1KC8C 2UXCQ 4BBSG 1EQTA 4TRDA 2ZXOA 4RFBA 4AYBB 2K4KA 3FKIH 1IYJB 5J39A 1K3RA 1TWHB 2PMZB 4K2LA 3PIO3 5JVLA 4IN3A 4XT1B 4CDFC 2ZDHA 2F0DA 3VPDA 3S1MH 1MBYA 2WP8J 4DR2H 1TWGA 1SROA 4AH6A 2R92B 4ZKBB 4NXNQ 4RAUC 5FD5A 2RSNA 4CKCA 1WJJA 2YTVA 3GTOH 5M5YB 3NBIA 3MA2B 3A8JE 4B3ML 4DUZH 3NGDA 4DUZL 4YHHH 1E7ZA 2MO1A 2Y0SG 2K32A 1I3QB 5M3FH 3PCOB 4FYDA 2Q2UA 4BA1I 4BBRH 4GOPB 3K57A 2VA3A 5KG6A 1N32Q 4X64H 2FP4B 2V58A 1I6HB 4EBEA 1A3UA 1TWFH 2K5HA 1EYCA 4IUPA 3OUZA 5HBRB 3H4DA 3BG5A 3I8ZA 4DNRB 2KCMA 3KBXA 1J5EH 5LOVF 4ED3A 3GQBA 1J8IA 5M5XH 2ICIA 2EE1A 5GADC 1SN8A 3K7AB 3MXUA 1LO5D 1K73C 3I70A 1C3OA 1PV4A 5KT3A 1H9KA 5C8YF 1SCUB 4A3BB 4OWTB 4LF4Q 1EY8A 3CCRA 1VQ6A 1S5CD 1IW7D 2LMCB 1TR5A 1C8CA 5KT6A 4QGUA 3UE1A 5IP9G 2PQAB 2EYPA 3X3MA 3GIKA 4A3DH 4X66L 1I7LA 5J2TF 2E74C 5LL6S 4H13C 4ED6A 4F4YA 4JYAQ 4DK0A 5J3BA 3JAME 1RODA 5CV9A 2PVPA 3IFDA 1SMXA 1F9QA 2I8CA 1QJOA 2KHSA 2F0VA 2FHTA 3FPUB 1IBKQ 5M9OA 2O03A 4UCUA 4RB2C 2W8LA 2NZOA 4H7BA 4NMZA 5CAEB 4JV1A 1WTVA 1PH9A 1EQVA 4JI6L 3K0YA 5CORA 2HJWA 3EQLC 4EX5A 3I4MG 2EXDA 1PRTF 1Y8PB 1JDBB 1JJGA 2CQYA 1A3TA 2N8NA 2C5CA 1HZCA 3VR5A 2EOTA 2KCNA 1NBWA 1H9SA 3S2HB 1I4HA 3N43B 1TWAH 1VBGA 3AU7A 1HA6A 4JI6Q 1YIJA 1V4YA 2YW2A 2YZGA 1UE1A 1K8AC 5GAHC 2GPSA 3STBC 1AW7A 3KF8A 1RDPD 2R7KA 3HKZB 1JB7A 1CKNA 2MQHA 4K8IA 5ELFA 1JXLA 1VQPA 1KJ9A 3S1NB 1HZBA 2ASDA 3SK6A 5KFVA 3M9OB 1XNQH 2G9DA 2H5XA 1S0MA 2UVRA 2R93H 4DR5H 2HVSA 5HV6A 4Q0FA 4HJ9A 4YJ3F 3H94A 2LFNA 3RZOH 2AGPA 2OQ0A 1WYDA 4LF4L 3L9AX 4L5SA 2PNHA 3QWNA 3C46A 1GUSA 3CPFA 3L4KA 1II3A 4NB3A 1VCIA 3V4ZA 4LF8L 3H0GB 4Q5VA 1Q12A 3DHQA 5ELBA 4X3TA 5KNDA 1TA8A 2GVBA 3I3CA 1Q7YC 4R9WA 4B3RQ 1XNQL 4A3DG 1N32L 3CCJA 3F2DA 3M7GA 1SYGA 2DY8A 2OT2A 1JB3A 1QUQB 1XNQQ 1AZPA 4O42A 1MI2A 1HNWQ 1NAPA 1YI2A 5A2QW 4GOPA 3K6OA 1S03G 5KEEA 3CRKC 3WNZA 3H3VC 4OX9Q 1Q8IA 2EJFC 2G9HD 1XNRL 1VMPA 1NR2A 4B3RH 2UXDH 5CBAE 1J5EL 1SJHD 4K5WA 1B6SA 2D0PA 4POFA 1EZ8A 5IE8A 1YHQA 3PGZA 4L6TB 3V6JA 1TS4A 4U68A 4RB3C 2K33A 2KBNA 1CKMA 2JA7H 4L8JA 2ZJTA 3SXHA 4FF2A 3J7A5 2UXCL 2NZ1D 2FMAA 1WTXA 4HAEA 3UQ8A 5DM73 2RGVA 4FP5D 1LT5D 3SK5A 1PK8A 1N8RC 1XPOA 1EY6A 1STYA 1ASYA 5C3XA 4LF5H 1DONA 1WD0A 2F0HA 5D1OA 4E4TA 4MIUA 3K5HA 1KBLA 3FHWA 3KDFB 3KJOA 4JW0A 5HY6A 5C4HA 3MEHA 1U0LA 5LMUH 2QK4A 4UPAA 2IW3A 3OWEB 4HJ5A 3J7ZC 2K01A 1XNRQ 4XYQA 1HQRD 2UXCH 1UNSA 4MHEA 5JPMC 4DL7A 3IFTA 4JBMA 1CS0A 2DJGC 1HUMA 4MZ9A 4IFDJ 2IX1A 4OO1H 1Y8OB 4C3IH 3G6EA 4PDBA 4NP5A 1XMQQ 2MGSA 3BAAA 4DAYB 2F52A 1H95A 3I2ZA 4EG0A 1OXSC 2W9CB 4JPBW 4G7ZC 3MFHA 4XT3B 4A3KG 1VQOA 1R9TH 1TU2B 2UU9H 1ASZA 1K3BC 4Q43A 4R8NA 4PZ7A 4A3IH 1XMOQ 4C3JH 5K5PA 1Y1WG 3GTJA 2ZXPA 4O4IF 1KAWA 5M3FB 2CQOA 1TY2A 3VA5A 1QE6A 3J80W 4L1KA 1AZQA 3NWSA 3G6JB 3ND8A 1ILPA 5KIXA 1E3PA 2W57A 4CBVA 5HGTA 3AB9A 4UP8A 4JI8H 4DV4L 3A8IE 4DGZA 3JRWA 1VS0A 5LL6X 3I4NB 2PN1A 1B33N 4DV1H 3QOLA 4A3MH 4DR5L 4I7AA 4HNTA 4BXXG 4V190 4QUCA 3SVMA 1M0TA 3I72A 4O2DA 3CCUA 5K2MA 4NDXA 2XGPA 4J9KA 4JI7H 2VPQA 1DXMA 5KG1A 4EGVA 4A3FG 2JEGA 4XXEA 3TZDA 5C4XH 5TSSA 4DR5Q 2ES2A 3SK4A 2M05A 3MWYW 1H9SB 2BH2A 3JZIA 1TWCH 2W9AA 3VPCA 3NTHA 1IW7C 2HCCA 2BA0A 2F3VA 3LNNA 2A8VA 3Q1KA 5A2QE 1B9NA 3S1MB 3NENA 5C3WA 4ECSA 1TWHH 1HH2P 1KDAA 2OCEA 4IPDA 5CBEE 3TP7A 1UE5A 1N34L 4KHPL 4O3NA 2N88A 2JE6I 1AH9A 5LXTF 4H0LC 1HNWH 4JI6H 3M3YH 3KALA 2NYZD 5COYA 4CDEC 1SJED 2B29A 2LXKA 5DEHA 1YBYA 1BCPC 2B63B 3K3PA 3RAQA 1Q1EA 2YYAA 5KFBA 2XWJB 1VQ4A 2CFMA 1E1TA 4LF7H 2EDGA 4JI3H 1V9PA 3PW7A 3S1QH 1UNNC 3RLFA 4IR1A 4R4QA 3CCVA 3GTQH 4MA0A 2KEDA 4F7XA 5EQ0A 2F0LA 1KL9A 3FEWX 1O78A 2YZMA 1SE8A 3GTKB 2UXDQ 2L15A 5I9OA 1EYAA 4C2MA 5C0XJ 2E2HB 3Q8DA 1PTOB 4K0KL 1FJGQ 4ZQIA 3HG9A 1QVCA 5IGBA 5DGAA 1AE3A 3N6XA 2EY2A 4MN3A 4RG1A 4F4ZA 5A2QL 4MV8A 1FGUA 2W6OA 5FPRA 5FLXL 3GTOA 2VQEQ 1E24A 2VUGA 2AHOB 3KBGA 4GN5A 3BG3A 1WCMA 5KFMA 5E4XA 1LT4D 1N33L 3AQQA 1Q8KA 3EA6A 2JN4A 3FKIG 2E2IH 1ONLA 2WDTA 2HVRA 3I4NH 1RK6A 1DZ1A 3ERSX 4HYKA 1U4LA 4GN3B 3W5OA 3SHLA 3QB3A 4JVZA 1CUKA 1CZWA 1EEFD 3E5SA 3DLLA 2HHHQ 1CQFA 1PTOC 1X65A 3K3VA 4RNNA 1R9TB 1I50H 5LMUQ 1C48A 3HOZB 2W6MA 1VDZA 1BOSA 4X3SA 1ZYRC 1IBLH 5C4JH 3MVVA 1XDNA 4BY1B 2YS7A 1P16A 4RAYA 2K75A 1PVOA 1PYBA 3GV8B 3OUUA 2PYKA 4RH6A 3K5NA 4BBRG 4X6AH 3RBEA 3CQZB 4GNXB 2EY5A 1KDBA 1SNQA 5ELDA 4J9RA 1I94L 1FNVA 1EIFA 2MJ8A 3K5OA 1K8OA 4OELB 3T5JA 4ED0A 4IUQA 2OLSA 4FF3A 4J15A 5LA6F 2J6SA 3JAML 1N36Q 2RHSB 2FFKB 4B9WA 3QIAA 4HSVA 2AKWB 1EWIA 3TP6A 1M7JA 2R7ZH 3EJIA 1DV2A 4U7CA 4JBJA 1JOKA 4JI8Q 2QA4A 4GNXC 4YAJB 4UP7A 3K7AH 5CA0F 4C3HB 4YY3H 1FKAH 1TT2A 4K6LA 3RJ0A 2M9VA 5EKLA 1RYSA 1E4FT 4QW8A 4X65H 2JA9A 2R87A 3RB6A 4HJAA 3BQ2A 2PNRC 1PTOH 2NVQB 2K6AA 4Q45A 2NTTA 2W8KA 2SEBD 4JI5H 1N36L 3J81j 2X6LA 3C1FA 3FVQA 2R84A 2DIKA 1EHIA 2E5LQ 3HOWH 2CW8A 4JI1L 1I6VC 1EFID 5EZYF 3I4NG 2C9OA 3M4IA 2JA8B 4TKOB 2VOBA 1ENFA 4GKKL 1E4EB 5IY0A 4HNVA 1CA6A 2QW7A 5G3LF 3BVZA 4DAPA 3K81C 4A3EG 2UUAQ 2JA5G 5H80A 3GTGB 1XMQH 1K8GA 4KV6A 1TS3A 1M4VA 1LACA 3TMEA 2H4OA 1IBML 3LMLA
chains in the Genus database with same CATH topology
5IWAL 3E9HA 1HNWL 1I94Q 3HOUH 1HR0W 3TREA 1NMGA 5LMNW 5H1SE 5IYDG 4JI8L 3DM3A 1YVCA 3PO2H 3BJUA 4A3GG 1YJNA 4TVAB 3HOXH 2Z6KA 1NTGA 2GVAA 1MJEA 5IYCG 4HJ7A 3GTMH 4BY7H 1J5EQ 4A4IA 5IYBH 2Q2TA 3MXNB 5JJKA 4LWCA 1YZ6A 1Y1WH 2UUAL 3UE0A 1I3QH 3PO3H 4OX9L 3M85A 4DKAC 4P75A 1UWVA 2JEBI 3S16H 5C4XG 4QL5A 3RLNA 3ULJA 1JE5A 1GVPA 4RMFA 4DR3L 3PUWA 3D31A 4DR2Q 3W1GA 2RHQB 4PZ6A 1L0WA 1XPRA 2JA7G 4IJHA 3TS0A 1KIXA 4IOCA 2R7ZG 4WJ4A 5M3MG 1CKNB 2R6GA 1K83H 3KF6A 3I56A 1PH3A 1VQMA 1IXRA 1W3SA 1MJCA 1PH7A 3U4ZA 2JA8G 2CWAA 3K8AA 2IY5B 1O7IA 2LSSA 3BZCA 4JG2A 4L5QA 1YHBA 3CC4A 4C3HH 2R92G 3TQYA 4P73A 4C2MH 1KC8C 3U58A 4A3KH 3TS2A 4BBSG 2UXCQ 2I5MX 4JI3Q 4HIKA 1HNZQ 1XJVA 3TRZA 3I4MH 2K4KA 2R7DA 1IYJB 3FKIH 1BBUA 1K3RA 3GTPH 1IBMQ 3S1MH 1G6PA 2WP8J 3HKZG 1Y14B 1HNXL 2VY3A 4LF7L 1SRUA 3CMAA 1M90C 4X62Q 1SROA 1XMQL 4A3EH 3M4PA 2RCNA 4AH6A 4Y52H 4JV5Q 4NXNQ 3WWVA 4LW1A 2XGTA 4R1JA 1WJJA 2YTVA 3EIVA 1QVGA 4JI0L 3GTOH 4QQBX 2E2JH 4AQYL 1KD1C 4B3ML 3ULPA 5JJIA 3AFQA 4DUZL 4JI5Q 2NZHA 2ZJRA 1E7ZA 2OTJA 2MO1A 1HZ9A 4GLAC 4R4IA 2Y0SG 5M3FH 2E5LL 5C3EH 1FL0A 3PCOB 2Q2UA 4BA1I 4BBRH 4GOPB 2XTIA 1GM5A 1N32Q 2ZTDA 3AYHB 3F8TA 4DV1L 4DV0Q 1PH5A 1L1OA 1IBLQ 1TWFH 2K5HA 3UDIA 3H0GG 2Q2HA 1VQBA 3SGIA 4DV3L 4JI2L 4GOPC 1WI5A 5E7NA 1VQ7A 1X54A 2KCMA 4GLVB 3T1YL 5M5XH 1K73C 5JJLA 5GADC 1SN8A 1NJIC 2CCZA 4DV7L 1PV4A 5FJ8G 1DGSA 3T1YQ 3S1RH 2FXQA 3A0JA 4OWTB 1GKHA 4IPHA 4LF4Q 3CCRA 1XPUA 1VQ6A 1LTLA 2A1AA 1A62A 4QGUA 4YWMA 3UE1A 5IP9G 2PQAB 3CQZH 4LF8Q 4A3DH 4X66L 2KENA 2MFIA 2K52A 4LFAQ 4HIOA 5ELNA 4JYAQ 1QZGA 1WFQA 3KFUA 5J3BA 4X66Q 4A93G 3FP9A 2K14A 4APVA 1JJCB 2YYZA 1SMXA 1HZAA 2UU9L 4DV4Q 4A3MG 1IBKQ 2R92H 2DUDA 2NZOA 4K0KQ 3F1ZA 3GTGH 2MO0A 1L2FA 2YV5A 4DV7Q 1YJ9A 1PH9A 4MNOA 4A3IG 5LMNQ 1VQFA 1JJ2A 4JI6L 3PIOA 1UEBA 2N49A 2EXDA 3GD7A 4EX5A 2JA6H 3I4MG 1JJGA 2B3GA 2D0OA 2DGYA 2WAQG 2N8NA 5ELOA 4A3FH 4LFBQ 1HZCA 3VDYA 4O0AA 2IT1A 1LM0A 1NBWA 1V43A 3G71A 2UUCL 1TWAH 3I7FA 3G48A 4JI6Q 1YIJA 1UE1A 1K8AC 1KHIA 5GAHC 1SFOH 3STBC 3CCLA 2HT1A 1Q81C 3RN2A 1IZ6A 1D8LA 4A3CG 4DK3C 1K0RA 4KHZA 1CKNA 2MQHA 3PF5A 1JB7A 2VUMG 1EYGA 1IBLL 4JI0Q 4DV6Q 2VNUD 1VQPA 4LNQA 1N33Q 1HZBA 3GTKH 5EAYA 2H5XA 2AMCB 5FLMG 3D0FA 2YU9H 2R93H 3KDFA 4DV6L 4DUZQ 4HJ9A 4ME3A 3RR5A 1RIPA 5IYCH 5GQOA 2R7FA 3S24A 3H0GH 3L2PA 4BY7G 3RZOH 1FVIA 2OQ0A 4L5TA 4A3BG 1WYDA 4A75A 4GLXA 4LF4L 5AJ3Q 4L5SA 2JJQA 2PNHA 3K7UC 1OXTA 4DR7L 4X64Q 3CPFA 4P72A 4QIWE 1VQKA 2F4VL 4NB3A 1VCIA 3S2DH 2IHFA 4LF8L 2Q2IA 3CXCA 2NVQH 2CWPA 2JA5H 1Q12A 4GKJL 1G51A 2GVBA 2B63G 1B70B 4DK6C 5IP7G 5M3MH 1LUZA 1Q7YC 4B3RQ 1YITA 5JEAG 1XNQL 4A3DG 1N32L 3JAMc 3J81c 2Z0SA 3CCJA 1B7YB 3HOUG 3K80C 3F2DA 1X3EA 1QUQB 3CCMA 1XNQQ 1KRTA 1PH6A 1L1OB 1HNWQ 1EFWA 3B6YA 4DUYL 1YI2A 3PUVA 4LFBL 3A5UA 4GOPA 4IPCA 3HOZH 4JC0A 1PA6A 2OTLA 4P71A 5HGQA 4DR1L 1N34Q 4OX9Q 4KHPQ 4HJ8A 1XNRL 3S14H 4A3LH 3J80i 1OXVA 2JA6G 3KOJA 3HOYG 3F2BA 1YNXA 1J5EL 4JOIC 2D0PA 1Z9FA 2RF4A 4POFA 5IE8A 1YHQA 1VQDA 3PGZA 2K5VA 1WOCA 1I6HH 2KBNA 2JA7H 1CKMA 2ID0A 3ICEA 4WJ3M 2N3SA 3J7A5 2UXCL 3S17H 1L1OC 5C44H 1KQSA 4DR4Q 1VQIA 3ER0A 4LF6L 4GKJQ 3OTOL 1VQJA 4HIMA 4DV0L 4DV1Q 4P74A 2EQSA 1YHAA 1N8RC 1HR0L 1XPOA 5LMNL 1ASYA 4LUVA 1S72A 1SLJA 1AE2A 4BXXH 3G4SA 4AYBE 4JI7Q 4MTNA 1U5KA 3FHWA 1S3OA 3KDFB 5IYBG 3KJOA 3BZKA 1Y1VG 3GTJH 5HY6A 1CSPA 3F2CA 1U0LA 4LF9L 4UPAA 4GS3A 4YWKA 3J7ZC 4HJ5A 1E1OA 2K5NA 1B8AA 4JV5L 2MNAA 1XNRQ 2AWOA 1JMCA 2V1CC 2D62A 2NN6G 5FLXc 1VQEA 1WCMG 5DLQE 2HQLA 4JBMA 3W1BA 2BH8A 4A3JG 3H3VH 4MZ9A 2WB1E 3ZJYC 3OW2A 2IX1A 4IFDJ 4X65L 4DR3Q 4C3IH 3G6EA 4UY8C 5C0XI 3M4QA 1XMQQ 1X3GA 4A76A 1PH2A 3CMEA 4YY3L 4DAYB 2F52A 5C3EG 2JA8H 2WFWA 2QEXA 4A93H 4IFDG 2UXBL 1H95A 3I2ZA 4HIDA 2I0QA 3CP0A 4A3GH 1OXSC 4DNIA 3PUXA 4JOIA 3T1HL 4A3KG 1VQOA 1R9TH 1V1QA 3GO5A 3PSIA 4IPGA 3PUYA 1ASZA 5K36G 1TWGH 2F4VQ 4PZ8A 4PZ7A 4A3IH 1PH4A 4BY1G 1XMOQ 1Q1BA 4C3JH 2NVTH 1Y1WG 2F3IA 3JAMi 3J81i 1KAWA 4A3LG 2CQOA 1G291 5BR8Q 2ZJPA 4OO1I 1Q86C 5C0XG 2KHIA 2BA1A 1E3PA 1N9WA 4JYAL 1MIUA 4BA2I 4LFAL 2PQAA 3HKSA 4X62L 4IO9A 4GKKQ 4UP8A 1HJPA 3JC66 5GAEC 1HNXQ 4DV4L 1PYSB 4QJFA 2NN6I 5BR8L 1IBKL 4YCVA 4JCVE 2UU9Q 2VUMH 1VS0A 1TXYA 4JI1Q 5M3FG 1D7QA 1FJGL 2ASBA 2WAQE 4PG3A 1P8LA 2JK8A 3PO2G 4A3MH 2VW9A 3CF5A 3AEVA 1BBWA 4DR5L 3HOXG 4GNXA 3PV0A 1QZHA 4LF5L 1RL2A 3OYYA 3NELA 3HOVH 3CD6A 4BXXG 4IFDI 1HR0Q 4R4OA 4XIGS 1VQ8A 4O2DA 4IJLA 3CCUA 1J6QA 4DV2L 3KF8B 4OONA 4A3FG 5LMUL 5C4XH 2ES2A 4DR5Q 1X55A 1PHJA 2BH2A 1TWCH 3H15A 4TQUS 1IL2A 5AJ3L 4X65Q 2BA0A 2QGQA 2Y0SE 2A8VA 4H02A 4B3MQ 3I55A 1X6OA 4JBKA 4DR2L 2PI2E 4JI4Q 3NENA 1NMFA 2C35B 1W2BA 4DR6Q 4GN4B 1TWHH 1S40A 1HH2P 2OCEA 1A8VA 4IPDA 1A0IA 4OO1G 1C9OA 1NE3A 1Q46A 4JBWA 4OXPA 1UE5A 4YHHL 4DR1Q 1N34L 2LXJA 2ZM6Q 2JE6I 3CPWA 1OTCA 3PF4A 4DR6L 4KHPL 1AH9A 3M3YH 4DAMA 2OWOA 4B3TQ 2ZTCA 1GO3E 3M7NA 4AQYQ 2R93G 2B29A 2LXKA 3K0XA 1YBYA 3RN5A 1KXLA 1Q1EA 2K50A 3HOZG 1VQ4A 1JT8A 2CFMA 2N78A 4A3BH 1E1TA 2KHJA 3BU2A 2HHHL 4BY1H 1QUQA 3PO3G 2UXDL 2VS1A 4JI3L 3U50C 1V9PA 3S1QH 1VQHA 1EQQA 3RLFA 4B3RL 2PI2A 4R4QA 4JI2Q 3CCVA 4DV3Q 3GTQH 2Z6KC 5IWAQ 4DV2Q 1A63A 1CSQA 1UE6A 1MKHA 4DR4L 2E8GA 2IX0A 3KYHC 3CCSA 1KL9A 1Q82C 3M9BA 1VQNA 3KJPA 1E22A 3KF6B 1SE8A 5IP7H 2UXDQ 2L15A 4AIMA 3S15H 2VQEL 3KLWA 2JQOA 5C0XJ 1KRSA 1VQAA 2ZTEA 3Q8DA 4LFCQ 4K0KL 2AWNA 1FJGQ 1I5FA 1Z47A 4ALPA 1QVCA 1QVFA 1CKOA 1AE3A 4RG1A 3AFPA 3HKZE 3M4OH 2VL6A 3CC2A 1FGUA 3GTLH 2HIVA 5M5YH 4LUOA 2VQEQ 5FLMH 1E24A 2AHOB 4GN5A 2YTXA 1EQRA 4PMWA 1N33L 3S2HH 3HOWG 3HOVG 3AQQA 5JEAJ 1Q8KA 2VZAA 3FKIG 2E2IH 3S1NH 1Y1VH 4KI0A 4NXML 3I4NH 2VQFQ 2WB1G 3RNUA 5M5WH 1X3FA 1NY4A 3ERSX 4UP9A 4GN3B 4LFCL 3W5OA 4LF5Q 1CUKA 1HNZL 4YCUA 3DLLA 2KCTA 2YTYA 1XMOL 2OQKA 1VQLA 2HHHQ 1X65A 1YJWA 3TEHB 4QY7A 1I50H 3E9IA 5LMUQ 2ZJQA 3I4OA 4NPSA 4XTCS 5IP9H 3OTOQ 3UDGA 1X56A 4LF6Q 4A3JH 1EOVA 3PUZA 4KLKA 4IOAA 4B3TL 5C44G 3J80c 1OXXK 5C4JH 4B3SL 1P16A 2K75A 2JEAI 1PVOA 1PYBA 5IYDH 3HFZB 4BBRG 4X6AH 4GNXB 4FDBA 1X9NA 2I5LX 3EN2A 2NVYH 3CCQA 4JI5L 3MEFA 3NEMA 4DV5Q 1PH8A 2ALYB 1I94L 2VQFL 1EIFA 4LUZA 1VQ9A 3A5ZB 2NVXH 1LYLA 4DV5L 4OWXB 3IRBA 2ZM6L 4J15A 1C0AA 1PH1A 1N36Q 1EIYB 2RHSB 1XTDA 3GDEA 3HOYH 5FJ8H 1BKBA 1VQCA 4DPGA 4OWWB 1PFSA 3LGJA 2GN5A 1T9HA 4JI4L 4LF9Q 4EQ5A 1M1KC 4R4TA 2AKWB 1EWIA 2CKZB 2R7ZH 3UDFA 3STBD 3RLOA 4YY3Q 4JBJA 2UXBQ 4JI8Q 2QA4A 4GNXC 3UDXA 4A3CH 1VQGA 3K7AH 1UE7A 4UP7A 2UUCQ 4L5RC 2I5HA 4Y7NH 3T1HQ 3EBEA 4NXMQ 2UUBL 2JA9A 4HJAA 3PIPA 3ULLA 3CAMA 3U4VA 2EIFA 4BBSH 2ATWA 4R4CA 4YWLA 4YHHQ 5GAGC 3J81j 4X64L 1N36L 2IHEA 1YEZA 4DR7Q 2E5LQ 3E0EA 3HOWH 3A74A 1EUJA 4JI1L 1GD7A 1C7YA 1K9MC 1VQ5A 2PMZE 4POGA 3I4NG 3CC7A 3CCEA 2HIXA 3RZDH 4JI7L 5GROA 3NBHB 4AYBG 3H3VI 4NXNL 4GKKL 1OXUA 3L7ZC 5IY0A 5IT9c 2E2HH 4A3EG 2UUAQ 3K81C 4B3SQ 2JA5G 3CW2C 1WCMH 1K8GA 4LF7Q 4YCWA 2B63H 2A19A 3L0OA 1SR3A 2UUBQ 1IBML 4DUYQ 1BVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA L;  3E9H A;  1HNW L;  1I94 Q;  3HOU H;  1HR0 W;  3TRE A;  1NMG A;  5LMN W;  5H1S E;  5IYD G;  4JI8 L;  3DM3 A;  1YVC A;  3PO2 H;  3BJU A;  4A3G G;  1YJN A;  4TVA B;  3HOX H;  2Z6K A;  1NTG A;  2GVA A;  1MJE A;  5IYC G;  4HJ7 A;  3GTM H;  4BY7 H;  1J5E Q;  4A4I A;  5IYB H;  2Q2T A;  3MXN B;  5JJK A;  4LWC A;  1YZ6 A;  1Y1W H;  2UUA L;  3UE0 A;  1I3Q H;  3PO3 H;  4OX9 L;  3M85 A;  4DKA C;  4P75 A;  1UWV A;  2JEB I;  3S16 H;  5C4X G;  4QL5 A;  3RLN A;  3ULJ A;  1JE5 A;  1GVP A;  4RMF A;  4DR3 L;  3PUW A;  3D31 A;  4DR2 Q;  3W1G A;  2RHQ B;  4PZ6 A;  1L0W A;  1XPR A;  2JA7 G;  4IJH A;  3TS0 A;  1KIX A;  4IOC A;  2R7Z G;  4WJ4 A;  5M3M G;  1CKN B;  2R6G A;  1K83 H;  3KF6 A;  3I56 A;  1PH3 A;  1VQM A;  1IXR A;  1W3S A;  1MJC A;  1PH7 A;  3U4Z A;  2JA8 G;  2CWA A;  3K8A A;  2IY5 B;  1O7I A;  2LSS A;  3BZC A;  4JG2 A;  4L5Q A;  1YHB A;  3CC4 A;  4C3H H;  2R92 G;  3TQY A;  4P73 A;  4C2M H;  1KC8 C;  3U58 A;  4A3K H;  3TS2 A;  4BBS G;  2UXC Q;  2I5M X;  4JI3 Q;  4HIK A;  1HNZ Q;  1XJV A;  3TRZ A;  3I4M H;  2K4K A;  2R7D A;  1IYJ B;  3FKI H;  1BBU A;  1K3R A;  3GTP H;  1IBM Q;  3S1M H;  1G6P A;  2WP8 J;  3HKZ G;  1Y14 B;  1HNX L;  2VY3 A;  4LF7 L;  1SRU A;  3CMA A;  1M90 C;  4X62 Q;  1SRO A;  1XMQ L;  4A3E H;  3M4P A;  2RCN A;  4AH6 A;  4Y52 H;  4JV5 Q;  4NXN Q;  3WWV A;  4LW1 A;  2XGT A;  4R1J A;  1WJJ A;  2YTV A;  3EIV A;  1QVG A;  4JI0 L;  3GTO H;  4QQB X;  2E2J H;  4AQY L;  1KD1 C;  4B3M L;  3ULP A;  5JJI A;  3AFQ A;  4DUZ L;  4JI5 Q;  2NZH A;  2ZJR A;  1E7Z A;  2OTJ A;  2MO1 A;  1HZ9 A;  4GLA C;  4R4I A;  2Y0S G;  5M3F H;  2E5L L;  5C3E H;  1FL0 A;  3PCO B;  2Q2U A;  4BA1 I;  4BBR H;  4GOP B;  2XTI A;  1GM5 A;  1N32 Q;  2ZTD A;  3AYH B;  3F8T A;  4DV1 L;  4DV0 Q;  1PH5 A;  1L1O A;  1IBL Q;  1TWF H;  2K5H A;  3UDI A;  3H0G G;  2Q2H A;  1VQB A;  3SGI A;  4DV3 L;  4JI2 L;  4GOP C;  1WI5 A;  5E7N A;  1VQ7 A;  1X54 A;  2KCM A;  4GLV B;  3T1Y L;  5M5X H;  1K73 C;  5JJL A;  5GAD C;  1SN8 A;  1NJI C;  2CCZ A;  4DV7 L;  1PV4 A;  5FJ8 G;  1DGS A;  3T1Y Q;  3S1R H;  2FXQ A;  3A0J A;  4OWT B;  1GKH A;  4IPH A;  4LF4 Q;  3CCR A;  1XPU A;  1VQ6 A;  1LTL A;  2A1A A;  1A62 A;  4QGU A;  4YWM A;  3UE1 A;  5IP9 G;  2PQA B;  3CQZ H;  4LF8 Q;  4A3D H;  4X66 L;  2KEN A;  2MFI A;  2K52 A;  4LFA Q;  4HIO A;  5ELN A;  4JYA Q;  1QZG A;  1WFQ A;  3KFU A;  5J3B A;  4X66 Q;  4A93 G;  3FP9 A;  2K14 A;  4APV A;  1JJC B;  2YYZ A;  1SMX A;  1HZA A;  2UU9 L;  4DV4 Q;  4A3M G;  1IBK Q;  2R92 H;  2DUD A;  2NZO A;  4K0K Q;  3F1Z A;  3GTG H;  2MO0 A;  1L2F A;  2YV5 A;  4DV7 Q;  1YJ9 A;  1PH9 A;  4MNO A;  4A3I G;  5LMN Q;  1VQF A;  1JJ2 A;  4JI6 L;  3PIO A;  1UEB A;  2N49 A;  2EXD A;  3GD7 A;  4EX5 A;  2JA6 H;  3I4M G;  1JJG A;  2B3G A;  2D0O A;  2DGY A;  2WAQ G;  2N8N A;  5ELO A;  4A3F H;  4LFB Q;  1HZC A;  3VDY A;  4O0A A;  2IT1 A;  1LM0 A;  1NBW A;  1V43 A;  3G71 A;  2UUC L;  1TWA H;  3I7F A;  3G48 A;  4JI6 Q;  1YIJ A;  1UE1 A;  1K8A C;  1KHI A;  5GAH C;  1SFO H;  3STB C;  3CCL A;  2HT1 A;  1Q81 C;  3RN2 A;  1IZ6 A;  1D8L A;  4A3C G;  4DK3 C;  1K0R A;  4KHZ A;  1CKN A;  2MQH A;  3PF5 A;  1JB7 A;  2VUM G;  1EYG A;  1IBL L;  4JI0 Q;  4DV6 Q;  2VNU D;  1VQP A;  4LNQ A;  1N33 Q;  1HZB A;  3GTK H;  5EAY A;  2H5X A;  2AMC B;  5FLM G;  3D0F A;  2YU9 H;  2R93 H;  3KDF A;  4DV6 L;  4DUZ Q;  4HJ9 A;  4ME3 A;  3RR5 A;  1RIP A;  5IYC H;  5GQO A;  2R7F A;  3S24 A;  3H0G H;  3L2P A;  4BY7 G;  3RZO H;  1FVI A;  2OQ0 A;  4L5T A;  4A3B G;  1WYD A;  4A75 A;  4GLX A;  4LF4 L;  5AJ3 Q;  4L5S A;  2JJQ A;  2PNH A;  3K7U C;  1OXT A;  4DR7 L;  4X64 Q;  3CPF A;  4P72 A;  4QIW E;  1VQK A;  2F4V L;  4NB3 A;  1VCI A;  3S2D H;  2IHF A;  4LF8 L;  2Q2I A;  3CXC A;  2NVQ H;  2CWP A;  2JA5 H;  1Q12 A;  4GKJ L;  1G51 A;  2GVB A;  2B63 G;  1B70 B;  4DK6 C;  5IP7 G;  5M3M H;  1LUZ A;  1Q7Y C;  4B3R Q;  1YIT A;  5JEA G;  1XNQ L;  4A3D G;  1N32 L;  3JAM c;  3J81 c;  2Z0S A;  3CCJ A;  1B7Y B;  3HOU G;  3K80 C;  3F2D A;  1X3E A;  1QUQ B;  3CCM A;  1XNQ Q;  1KRT A;  1PH6 A;  1L1O B;  1HNW Q;  1EFW A;  3B6Y A;  4DUY L;  1YI2 A;  3PUV A;  4LFB L;  3A5U A;  4GOP A;  4IPC A;  3HOZ H;  4JC0 A;  1PA6 A;  2OTL A;  4P71 A;  5HGQ A;  4DR1 L;  1N34 Q;  4OX9 Q;  4KHP Q;  4HJ8 A;  1XNR L;  3S14 H;  4A3L H;  3J80 i;  1OXV A;  2JA6 G;  3KOJ A;  3HOY G;  3F2B A;  1YNX A;  1J5E L;  4JOI C;  2D0P A;  1Z9F A;  2RF4 A;  4POF A;  5IE8 A;  1YHQ A;  1VQD A;  3PGZ A;  2K5V A;  1WOC A;  1I6H H;  2KBN A;  2JA7 H;  1CKM A;  2ID0 A;  3ICE A;  4WJ3 M;  2N3S A;  3J7A 5;  2UXC L;  3S17 H;  1L1O C;  5C44 H;  1KQS A;  4DR4 Q;  1VQI A;  3ER0 A;  4LF6 L;  4GKJ Q;  3OTO L;  1VQJ A;  4HIM A;  4DV0 L;  4DV1 Q;  4P74 A;  2EQS A;  1YHA A;  1N8R C;  1HR0 L;  1XPO A;  5LMN L;  1ASY A;  4LUV A;  1S72 A;  1SLJ A;  1AE2 A;  4BXX H;  3G4S A;  4AYB E;  4JI7 Q;  4MTN A;  1U5K A;  3FHW A;  1S3O A;  3KDF B;  5IYB G;  3KJO A;  3BZK A;  1Y1V G;  3GTJ H;  5HY6 A;  1CSP A;  3F2C A;  1U0L A;  4LF9 L;  4UPA A;  4GS3 A;  4YWK A;  3J7Z C;  4HJ5 A;  1E1O A;  2K5N A;  1B8A A;  4JV5 L;  2MNA A;  1XNR Q;  2AWO A;  1JMC A;  2V1C C;  2D62 A;  2NN6 G;  5FLX c;  1VQE A;  1WCM G;  5DLQ E;  2HQL A;  4JBM A;  3W1B A;  2BH8 A;  4A3J G;  3H3V H;  4MZ9 A;  2WB1 E;  3ZJY C;  3OW2 A;  2IX1 A;  4IFD J;  4X65 L;  4DR3 Q;  4C3I H;  3G6E A;  4UY8 C;  5C0X I;  3M4Q A;  1XMQ Q;  1X3G A;  4A76 A;  1PH2 A;  3CME A;  4YY3 L;  4DAY B;  2F52 A;  5C3E G;  2JA8 H;  2WFW A;  2QEX A;  4A93 H;  4IFD G;  2UXB L;  1H95 A;  3I2Z A;  4HID A;  2I0Q A;  3CP0 A;  4A3G H;  1OXS C;  4DNI A;  3PUX A;  4JOI A;  3T1H L;  4A3K G;  1VQO A;  1R9T H;  1V1Q A;  3GO5 A;  3PSI A;  4IPG A;  3PUY A;  1ASZ A;  5K36 G;  1TWG H;  2F4V Q;  4PZ8 A;  4PZ7 A;  4A3I H;  1PH4 A;  4BY1 G;  1XMO Q;  1Q1B A;  4C3J H;  2NVT H;  1Y1W G;  2F3I A;  3JAM i;  3J81 i;  1KAW A;  4A3L G;  2CQO A;  1G29 1;  5BR8 Q;  2ZJP A;  4OO1 I;  1Q86 C;  5C0X G;  2KHI A;  2BA1 A;  1E3P A;  1N9W A;  4JYA L;  1MIU A;  4BA2 I;  4LFA L;  2PQA A;  3HKS A;  4X62 L;  4IO9 A;  4GKK Q;  4UP8 A;  1HJP A;  3JC6 6;  5GAE C;  1HNX Q;  4DV4 L;  1PYS B;  4QJF A;  2NN6 I;  5BR8 L;  1IBK L;  4YCV A;  4JCV E;  2UU9 Q;  2VUM H;  1VS0 A;  1TXY A;  4JI1 Q;  5M3F G;  1D7Q A;  1FJG L;  2ASB A;  2WAQ E;  4PG3 A;  1P8L A;  2JK8 A;  3PO2 G;  4A3M H;  2VW9 A;  3CF5 A;  3AEV A;  1BBW A;  4DR5 L;  3HOX G;  4GNX A;  3PV0 A;  1QZH A;  4LF5 L;  1RL2 A;  3OYY A;  3NEL A;  3HOV H;  3CD6 A;  4BXX G;  4IFD I;  1HR0 Q;  4R4O A;  4XIG S;  1VQ8 A;  4O2D A;  4IJL A;  3CCU A;  1J6Q A;  4DV2 L;  3KF8 B;  4OON A;  4A3F G;  5LMU L;  5C4X H;  2ES2 A;  4DR5 Q;  1X55 A;  1PHJ A;  2BH2 A;  1TWC H;  3H15 A;  4TQU S;  1IL2 A;  5AJ3 L;  4X65 Q;  2BA0 A;  2QGQ A;  2Y0S E;  2A8V A;  4H02 A;  4B3M Q;  3I55 A;  1X6O A;  4JBK A;  4DR2 L;  2PI2 E;  4JI4 Q;  3NEN A;  1NMF A;  2C35 B;  1W2B A;  4DR6 Q;  4GN4 B;  1TWH H;  1S40 A;  1HH2 P;  2OCE A;  1A8V A;  4IPD A;  1A0I A;  4OO1 G;  1C9O A;  1NE3 A;  1Q46 A;  4JBW A;  4OXP A;  1UE5 A;  4YHH L;  4DR1 Q;  1N34 L;  2LXJ A;  2ZM6 Q;  2JE6 I;  3CPW A;  1OTC A;  3PF4 A;  4DR6 L;  4KHP L;  1AH9 A;  3M3Y H;  4DAM A;  2OWO A;  4B3T Q;  2ZTC A;  1GO3 E;  3M7N A;  4AQY Q;  2R93 G;  2B29 A;  2LXK A;  3K0X A;  1YBY A;  3RN5 A;  1KXL A;  1Q1E A;  2K50 A;  3HOZ G;  1VQ4 A;  1JT8 A;  2CFM A;  2N78 A;  4A3B H;  1E1T A;  2KHJ A;  3BU2 A;  2HHH L;  4BY1 H;  1QUQ A;  3PO3 G;  2UXD L;  2VS1 A;  4JI3 L;  3U50 C;  1V9P A;  3S1Q H;  1VQH A;  1EQQ A;  3RLF A;  4B3R L;  2PI2 A;  4R4Q A;  4JI2 Q;  3CCV A;  4DV3 Q;  3GTQ H;  2Z6K C;  5IWA Q;  4DV2 Q;  1A63 A;  1CSQ A;  1UE6 A;  1MKH A;  4DR4 L;  2E8G A;  2IX0 A;  3KYH C;  3CCS A;  1KL9 A;  1Q82 C;  3M9B A;  1VQN A;  3KJP A;  1E22 A;  3KF6 B;  1SE8 A;  5IP7 H;  2UXD Q;  2L15 A;  4AIM A;  3S15 H;  2VQE L;  3KLW A;  2JQO A;  5C0X J;  1KRS A;  1VQA A;  2ZTE A;  3Q8D A;  4LFC Q;  4K0K L;  2AWN A;  1FJG Q;  1I5F A;  1Z47 A;  4ALP A;  1QVC A;  1QVF A;  1CKO A;  1AE3 A;  4RG1 A;  3AFP A;  3HKZ E;  3M4O H;  2VL6 A;  3CC2 A;  1FGU A;  3GTL H;  2HIV A;  5M5Y H;  4LUO A;  2VQE Q;  5FLM H;  1E24 A;  2AHO B;  4GN5 A;  2YTX A;  1EQR A;  4PMW A;  1N33 L;  3S2H H;  3HOW G;  3HOV G;  3AQQ A;  5JEA J;  1Q8K A;  2VZA A;  3FKI G;  2E2I H;  3S1N H;  1Y1V H;  4KI0 A;  4NXM L;  3I4N H;  2VQF Q;  2WB1 G;  3RNU A;  5M5W H;  1X3F A;  1NY4 A;  3ERS X;  4UP9 A;  4GN3 B;  4LFC L;  3W5O A;  4LF5 Q;  1CUK A;  1HNZ L;  4YCU A;  3DLL A;  2KCT A;  2YTY A;  1XMO L;  2OQK A;  1VQL A;  2HHH Q;  1X65 A;  1YJW A;  3TEH B;  4QY7 A;  1I50 H;  3E9I A;  5LMU Q;  2ZJQ A;  3I4O A;  4NPS A;  4XTC S;  5IP9 H;  3OTO Q;  3UDG A;  1X56 A;  4LF6 Q;  4A3J H;  1EOV A;  3PUZ A;  4KLK A;  4IOA A;  4B3T L;  5C44 G;  3J80 c;  1OXX K;  5C4J H;  4B3S L;  1P16 A;  2K75 A;  2JEA I;  1PVO A;  1PYB A;  5IYD H;  3HFZ B;  4BBR G;  4X6A H;  4GNX B;  4FDB A;  1X9N A;  2I5L X;  3EN2 A;  2NVY H;  3CCQ A;  4JI5 L;  3MEF A;  3NEM A;  4DV5 Q;  1PH8 A;  2ALY B;  1I94 L;  2VQF L;  1EIF A;  4LUZ A;  1VQ9 A;  3A5Z B;  2NVX H;  1LYL A;  4DV5 L;  4OWX B;  3IRB A;  2ZM6 L;  4J15 A;  1C0A A;  1PH1 A;  1N36 Q;  1EIY B;  2RHS B;  1XTD A;  3GDE A;  3HOY H;  5FJ8 H;  1BKB A;  1VQC A;  4DPG A;  4OWW B;  1PFS A;  3LGJ A;  2GN5 A;  1T9H A;  4JI4 L;  4LF9 Q;  4EQ5 A;  1M1K C;  4R4T A;  2AKW B;  1EWI A;  2CKZ B;  2R7Z H;  3UDF A;  3STB D;  3RLO A;  4YY3 Q;  4JBJ A;  2UXB Q;  4JI8 Q;  2QA4 A;  4GNX C;  3UDX A;  4A3C H;  1VQG A;  3K7A H;  1UE7 A;  4UP7 A;  2UUC Q;  4L5R C;  2I5H A;  4Y7N H;  3T1H Q;  3EBE A;  4NXM Q;  2UUB L;  2JA9 A;  4HJA A;  3PIP A;  3ULL A;  3CAM A;  3U4V A;  2EIF A;  4BBS H;  2ATW A;  4R4C A;  4YWL A;  4YHH Q;  5GAG C;  3J81 j;  4X64 L;  1N36 L;  2IHE A;  1YEZ A;  4DR7 Q;  2E5L Q;  3E0E A;  3HOW H;  3A74 A;  1EUJ A;  4JI1 L;  1GD7 A;  1C7Y A;  1K9M C;  1VQ5 A;  2PMZ E;  4POG A;  3I4N G;  3CC7 A;  3CCE A;  2HIX A;  3RZD H;  4JI7 L;  5GRO A;  3NBH B;  4AYB G;  3H3V I;  4NXN L;  4GKK L;  1OXU A;  3L7Z C;  5IY0 A;  5IT9 c;  2E2H H;  4A3E G;  2UUA Q;  3K81 C;  4B3S Q;  2JA5 G;  3CW2 C;  1WCM H;  1K8G A;  4LF7 Q;  4YCW A;  2B63 H;  2A19 A;  3L0O A;  1SR3 A;  2UUB Q;  1IBM L;  4DUY Q;  1BVS A; 
#chains in the Genus database with same CATH topology
 5IWA L;  2NTS A;  3E9H A;  4HR7 B;  1RK5 A;  4AQY H;  4RNO A;  2QCP X;  1STA A;  1R4Q B;  3P20 A;  3JSN A;  3PO2 H;  3X3N A;  3ETJ A;  3HOX H;  2EYM A;  1STN A;  4HJ7 A;  4BY7 H;  5D1P A;  1J5E Q;  4A4I A;  2JA7 A;  2XGQ A;  2BCO A;  1O7Z A;  2Q2T A;  5EOY A;  3MXN B;  5DNF A;  3J7A K;  4C1N K;  2YS6 A;  4OX9 L;  2EY1 A;  3S16 H;  2HD3 A;  4QL5 A;  3RLN A;  1GHJ A;  4DR3 L;  5C4X G;  4RMF A;  4RAZ A;  1GSH A;  5LL6 b;  1GUN A;  4A3J B;  2L4N A;  1F9S A;  5LP6 F;  4IUR A;  2MPM A;  1L0W A;  2A68 D;  2JA7 G;  1CHQ D;  2IMW P;  4IOC A;  4PQX A;  2R6G A;  3MAQ A;  3S1Q B;  3KF6 A;  1PH3 A;  2W9B A;  2N55 A;  4DR3 H;  1EY7 A;  4FXG C;  3OOC A;  1PH7 A;  1ZEQ X;  2CWA A;  1Y1V B;  3BZC A;  4RGN A;  4BY7 B;  5JVG 3;  2RQX A;  4C3H H;  2R92 G;  4P73 A;  4IHJ F;  2J9G A;  3KUP A;  2I5M X;  5KG3 A;  4DR6 H;  3H91 A;  3O13 A;  1TWA B;  4DXF A;  1HNZ Q;  1XJV A;  3GTL B;  4A3M B;  3PN1 A;  3M4O B;  2R7D A;  3H20 A;  3GTP H;  3J80 L;  4R7R A;  2D5D A;  5C44 B;  4FU0 A;  1CHP D;  4HN7 A;  3HKZ G;  3LWB A;  3FDT A;  4FBU A;  1Y14 B;  3T5H A;  4LF7 L;  2AQ1 B;  2CH4 W;  2F0E A;  1XMQ L;  4C5B A;  2YU9 A;  4Y52 H;  3F2U A;  3FMA A;  4J9P A;  5I2X A;  4JV5 Q;  4LW1 A;  2XGT A;  4R1J A;  1QVG A;  4UCS A;  4YBZ B;  3EPG A;  2IP4 A;  1GSO A;  4QCL A;  4X3K A;  2NZH A;  1PZK D;  4LH6 A;  3KHG A;  2OTJ A;  1HZ9 A;  2ENB A;  1M8A A;  4GLA C;  4I55 F;  3PO3 B;  2QIL A;  1FL0 A;  1S97 A;  5FLX W;  4Q8F A;  4MV6 A;  3SE7 A;  4KY6 A;  3K5I A;  1A2T A;  3AYH B;  1IBL Q;  1HNX H;  3H0G G;  5K36 H;  1B6R A;  4DV3 L;  4GOP C;  1WI5 A;  4XQN A;  1TQO A;  1HNZ H;  1Y8N B;  4DU9 A;  2BE5 C;  1IYV A;  5M3M B;  2RDJ A;  2VQE H;  2FXQ A;  3A0J A;  2X0S A;  1GKH A;  1I3Q A;  1ML0 D;  1NR4 A;  4NKL A;  5C0X H;  4QWD A;  4JI1 H;  1LTL A;  4KY7 A;  1KJ8 A;  1A62 A;  1KTK A;  2K28 A;  4CKB A;  5J2U F;  5IOD A;  5L1L A;  2MFI A;  2RVL A;  4QWB A;  3NBH A;  3IG0 A;  5ELN A;  1CK1 A;  2QYZ A;  1QZG A;  4J9N A;  3N52 A;  4X66 Q;  5KFY A;  1EIG A;  4APV A;  4DV4 H;  1JJC B;  4RZR A;  4ECT A;  2FE3 A;  1HZA A;  3BQ1 A;  5L1J A;  1GYF A;  2DUD A;  2Z8L A;  1M0W A;  4KD4 A;  1MGS A;  3GTG H;  5KFZ A;  4R8U B;  5F9N A;  1YJ9 A;  5LMN Q;  1VQF A;  2WII B;  1JJ2 A;  2B2V A;  3PIO A;  2N49 A;  3GD7 A;  2JA6 H;  4DV7 H;  1JKJ B;  2D0O A;  2DGY A;  4A3F H;  2ZDQ A;  1KNA A;  4YJ2 F;  5FPO A;  4Q8E A;  4MV4 A;  3G71 A;  4ZQ3 A;  5I2Y A;  3H40 A;  3RV3 A;  4RWS C;  2O5I C;  3I7F A;  4PV1 C;  3PZP A;  4ULL A;  2A6H D;  3I73 A;  1Q81 C;  2AU0 A;  1FGB D;  1D8L A;  4BBS B;  4DK3 C;  1XTC D;  2WB1 B;  4UDU C;  4MV1 A;  2B2T A;  5CV5 A;  3WOF A;  1UC8 A;  3HOY B;  2VNU D;  1VF5 C;  5KFJ A;  3GTK H;  1DOM A;  1JIC A;  2ZXR A;  5FLM G;  2F0T A;  4DV6 L;  3V6K A;  2R7Z B;  4ME3 A;  5GQO A;  2R7F A;  2O5J C;  4A3B G;  2JJQ A;  3K7U C;  4DR7 L;  1A6X A;  4XDX A;  2CVR A;  1SR3 A;  4P72 A;  2F4V L;  5KFI A;  5CC4 A;  2M2L A;  3S2D H;  3NQI A;  1HFG A;  5I47 A;  1BCP F;  3M9N B;  4DL5 A;  1H9M A;  4NLG A;  4IQZ A;  2JA5 H;  3PIP 3;  1G51 A;  5JOB A;  1KJQ A;  4DK6 C;  4A2A A;  5JEA G;  4O3O A;  3J81 c;  4WFN 3;  1B7Y B;  3HOU G;  3KTM A;  3K80 C;  2DZD A;  1VF7 A;  3CCM A;  1KRT A;  2C00 A;  1L1O B;  1BCP D;  4RKL A;  4DUY L;  2A73 B;  4WJW A;  2PQE A;  3PUV A;  2B8G A;  1KEE A;  3HOZ H;  2OTL A;  4P71 A;  4DR1 L;  5T14 A;  5CV6 A;  3S14 H;  2Z6B A;  3BVM A;  3N41 B;  5KFE A;  2EY6 A;  3J80 i;  1A3V A;  3KOJ A;  3HOY G;  4M7E A;  4MV9 A;  2XVS A;  3EVQ A;  2RF4 A;  4M1U B;  2E2I B;  4EFE A;  4K2K A;  4A3I B;  4ECV A;  4XQJ A;  4LH7 A;  5EKK A;  3ICE A;  5KNC A;  3S17 H;  1L1O C;  3D6C A;  4FXD A;  2AGQ A;  2Z9H A;  1VQI A;  3RB0 A;  2LS0 1;  3R8B A;  4LAA A;  3OTO L;  5DGB A;  4DV0 L;  4DV1 Q;  1HR0 L;  3MR2 A;  5LMN L;  1S72 A;  1EY4 A;  4CJ1 B;  1SLJ A;  4F87 A;  3A7A B;  3SR1 A;  2CW0 D;  3TP8 A;  4JI2 H;  3U9T A;  3G4S A;  4AYB E;  4JI7 Q;  3NXW A;  5IYB G;  4UHV A;  4LF9 L;  1Y1V G;  4EYH B;  4LSX A;  3JAM W;  5C4Z A;  5EGT A;  1IKL A;  1TKW B;  2V1C C;  2D62 A;  1IOW A;  1I4G A;  5FLX c;  4U6P A;  1A9X A;  4JI0 H;  1E4E A;  2EJM A;  2HQL A;  3W1B A;  3V6H A;  2BH8 A;  2NVY A;  3H3V H;  3QJY A;  2WB1 E;  3ZJY C;  3OW2 A;  2UUB H;  4DR3 Q;  4UY8 C;  2VUM A;  2K5Q A;  3BA9 A;  3TDQ A;  3GV6 A;  4APM A;  4C3J B;  1W96 A;  4IFD G;  2WFW A;  1E2Z A;  3C1E A;  3QZ7 A;  3CKI B;  2DN8 A;  3BYT B;  5FO8 B;  3BZD B;  3T1H L;  4LFB H;  1BXT A;  1V1Q A;  3PSI A;  2AUK A;  2EPB A;  5K36 G;  1TWG H;  5BN5 A;  2YRX A;  4FS1 A;  2JEI A;  4PZ8 A;  4LSA A;  1Q1B A;  2J0T D;  3JAM i;  4P2C B;  4QWA A;  4A3D B;  4G7O C;  1B1Z A;  2RDI A;  3MWM A;  1G29 1;  3GTP B;  3TII A;  3E3X A;  2KHI A;  5FOB B;  1JWU D;  1N9W A;  4JYA L;  3ORQ A;  4J1M A;  5I6W A;  2R92 A;  1CM9 A;  4GKK Q;  1RKN A;  2F0G A;  4Q44 A;  3GIJ A;  4FXK C;  2L1B A;  3MFY A;  4EQP A;  4O3S A;  3GTG A;  1PYS B;  1SYB A;  4YCV A;  4JCV E;  2UU9 Q;  4C5A A;  1SXT A;  1TXY A;  4JI1 Q;  4RUC A;  1ZQ7 A;  4JUZ A;  2JK8 A;  3BDL A;  4N8F A;  3T53 B;  2VW9 A;  4UCT A;  3HRZ C;  4AYB A;  3WDN A;  1JOO A;  4GNX A;  4UAI A;  1RL2 A;  1QZH A;  3NEL A;  4LF5 L;  3CD6 A;  4IFD I;  3GQC A;  1HR0 Q;  4XIG S;  1ZHS A;  2R7L A;  2XWB B;  4HMJ A;  2SNM A;  1L0Y B;  3FPP A;  3H4B A;  3GP7 A;  4JV2 A;  3T16 A;  1Q90 A;  1X55 A;  2G5D A;  2NN6 H;  5AJ3 L;  2FLL A;  3N40 P;  4ECU A;  1BF4 A;  4B3M Q;  3I55 A;  1DD2 A;  4JBK A;  2FK2 A;  3OSP A;  2PI2 E;  1HR0 H;  4ZCK A;  5FLX E;  3S1R B;  1SNP A;  2R93 B;  3G8C A;  1W2B A;  1A8V A;  1A0I A;  1C9O A;  1K83 A;  1Q46 A;  4OXP A;  4YHH L;  4DR1 Q;  4DR6 L;  3VPB A;  4PNY A;  5J22 A;  3DXJ C;  1VKZ A;  4XYO A;  2B2W C;  2DLN A;  1ESF A;  2R93 G;  1GO3 E;  3M7N A;  4AQY Q;  3RN5 A;  3K0X A;  1CT1 D;  4FO2 A;  2K50 A;  4XQQ A;  2RDF A;  3BU2 A;  5C3E B;  1QUQ A;  4MV3 A;  5KFL A;  2PZW A;  4DFA A;  1VQH A;  1EQQ A;  3PW5 A;  1N32 H;  5BMV F;  5IWA Q;  5EWF A;  4DV2 Q;  1A63 A;  4TQR A;  1O7L A;  1UE6 A;  1AN8 A;  2WKC A;  4JK1 C;  2VXW A;  3TSS A;  2W9B B;  3KJP A;  1EYD A;  3H0G A;  3DWA A;  4AIM A;  4C1N I;  2JQO A;  1IKM A;  2ZTE A;  4O4H F;  4KD3 A;  4PWQ A;  3ONA B;  1Z47 A;  1Z6H A;  1QVF A;  3RZO B;  4IAL A;  1U9R A;  2RDG A;  4IR9 A;  1LTT D;  1PFN A;  1GOZ A;  3S14 B;  3OHX C;  3MJF A;  4DR1 H;  1S0O A;  1PZI D;  4PMW A;  3HOW G;  4DUY H;  3S1N H;  1JOR A;  2RCF A;  5DQI A;  4KI0 A;  2VQF Q;  3RNU A;  5M5W H;  5KG5 A;  1CQJ B;  5IOC A;  1SNO A;  3IAY A;  1O80 A;  2UVU A;  2V4D A;  1E0B A;  1BXR A;  3SK8 A;  2K03 A;  5IT9 E;  1YJW A;  3TEH B;  1BNZ A;  3E9I A;  5I6Y A;  1EZ1 A;  4NPS A;  5L1K A;  4XTC S;  1XMO H;  2D2C C;  5JVH 3;  3GIL A;  3PUZ A;  5A35 A;  5CB4 F;  2F4I A;  5DG9 A;  4B3T L;  3MR3 A;  3W2D A;  1KJJ A;  1KC7 A;  1OXX K;  5C1O A;  2R82 A;  3L4J A;  2PZT A;  2FK1 A;  1R4P B;  2ZT9 C;  2JEA I;  5KFK A;  4WRD A;  4DAV A;  2EYJ A;  2BDN A;  3HFZ B;  5AFW A;  5BN3 A;  1BCP B;  4LJZ C;  4C56 C;  4FDB A;  2I5L X;  3EN2 A;  1S68 A;  1BDO A;  2GPW A;  3G6V A;  2ATL A;  4JI5 L;  3MEF A;  2VQD A;  1SE4 A;  4DV6 H;  2A69 D;  3VR2 A;  3A5Z B;  1PDQ A;  2L0C A;  1FYC A;  4IUU A;  2A74 C;  5JJZ A;  4A3G B;  2W6P A;  3GIQ A;  2NU9 B;  4C3J G;  1PH1 A;  4B08 A;  1EIY B;  4DXG A;  1E2W A;  3HOY H;  2BQ3 A;  5FJ8 H;  3M9M B;  1BKB A;  5JVD F;  3LGJ A;  2GN5 A;  4EGJ A;  1CFM A;  5DQG A;  5DQH A;  2WYO A;  4GC7 A;  5KG2 A;  3STB D;  2UXB Q;  3OIP A;  3UDX A;  3QR8 A;  1VQG A;  1HUN A;  4O3R A;  4L5R C;  3KLS X;  2BE5 D;  3T1H Q;  3EBE A;  2F0O A;  4ZK9 B;  1BJT A;  2UUB L;  2DNC A;  3ULL A;  1IYU A;  3CAM A;  4BBS H;  2ATW A;  3GII A;  5IT9 W;  4YHH Q;  5KFH A;  4X64 L;  1I4R A;  2IHE A;  2WAQ A;  3P75 A;  5JH7 F;  4F88 A;  5KT2 A;  2W71 A;  3A74 A;  1DIK A;  3D4D A;  1VQ5 A;  4ECR A;  1K9M C;  5F9L A;  2AQ2 B;  1F77 A;  4N9P A;  3CC7 A;  1JOQ A;  2HIX A;  5EJW A;  2R86 A;  1T5E A;  5GRO A;  4CJ0 B;  2GA4 B;  4AYB G;  2V4Q A;  5ELE A;  4ZYS A;  1T3N A;  1C4Q A;  2QKI C;  2EYH A;  3CW2 C;  5CYU A;  2B2V C;  3PW2 A;  4LF7 Q;  1TWF A;  4YCW A;  2B63 H;  3L0O A;  2E76 C;  1TS2 A;  2EVB A;  1FNW A;  4YP3 A;  3OTO H;  4FNF A;  4EQO A;  2WAQ B;  1WTP A;  5GON F;  2V5A A;  5LMN W;  4ECW A;  3NSW A;  2PMZ A;  2JYO A;  5H1S E;  5KFN A;  3DM3 A;  1VMC A;  1WH2 A;  5D1O B;  1N33 H;  2JA5 A;  1HCZ A;  3BJU A;  1YJN A;  3VR6 A;  3HOU B;  3MHB A;  2CZG A;  2B2Y C;  1MJE A;  3FRP B;  5KFW A;  4ZI7 F;  3OIQ A;  1FJG H;  5IYB H;  4A93 B;  2VPS A;  1Y1W H;  3GIM A;  4RGM A;  4DKA C;  3D8G A;  1UWV A;  2JEB I;  2XNA C;  3ULJ A;  4CDD C;  1GVP A;  4X62 H;  4DV2 H;  5KFD A;  3I90 A;  2RHQ B;  4PZ6 A;  3TBI B;  3BDC A;  1EEI D;  4E6I A;  2R7Z G;  3R2T A;  4IRC A;  1K83 H;  4JYA H;  1NSN S;  4ME5 A;  2PO4 A;  3I56 A;  4B9X A;  1VQM A;  1GUW A;  3RTX A;  1PMR A;  1MJC A;  3MTS A;  2FB9 A;  1WSC A;  2C28 A;  4IFD H;  4RHS A;  1O7I A;  3T5L A;  2X69 A;  3AMU A;  1YHB A;  3CC4 A;  1TWA A;  2WTF A;  4C2M H;  4GZY C;  2RKS A;  1XNR H;  3DEO A;  1ULZ A;  3IN5 A;  3I4M H;  3SDZ A;  1BBU A;  1Y1V A;  1JLL B;  5CGK A;  2SDF A;  5EPL A;  1IBM Q;  4O3Q A;  2VY3 A;  1EYZ A;  1SRU A;  3CMA A;  1M90 C;  2GLT A;  3U9O A;  2ZM6 H;  2KEE A;  2W7O A;  3NPP A;  2R93 A;  1SYC A;  2MP1 A;  2AGO A;  1U4P A;  2A68 C;  4JI0 L;  1UC9 A;  4QQB X;  2E5L H;  4LFC H;  4G4K A;  4AQY L;  1QG7 A;  3ULP A;  4LF6 H;  4JI5 Q;  2E5L L;  4R4I A;  4WD3 A;  3HOV B;  1B3A A;  1BR9 A;  3M4Y A;  4FF1 A;  2LY7 A;  4H44 C;  1GM5 A;  1RJT A;  3Q8P B;  2JA7 B;  4DL4 A;  5KFC A;  4DV1 L;  4DV0 Q;  3NHH A;  1L1O A;  1PH5 A;  1CQI B;  4DLK A;  1EY5 A;  3UDI A;  2BDO A;  2NUA B;  3OPO A;  2Q2H A;  1VQB A;  4JI2 L;  5E7N A;  2R7N A;  1X54 A;  4GLV B;  3T1Y L;  4Y7N B;  3HKZ A;  5JJL A;  1NJI C;  2JXM B;  4DV7 L;  2P0A A;  4O2B F;  4DL2 A;  3S1R H;  1SEB D;  3T1Y Q;  1IBM H;  1X3P A;  3F8N A;  1ENA A;  1TWF B;  1LV9 A;  2A1A A;  2K5W A;  1MHW C;  3S9W A;  4YQW A;  3CQZ H;  4LF8 Q;  3R5X A;  2AUJ D;  4HIO A;  4EEY A;  5KFU A;  1WFQ A;  3KFU A;  3J81 E;  4A93 G;  3RUP A;  1U4R A;  1IBK H;  3SI8 A;  1B3Q A;  3OMG A;  1I4Q A;  2UU9 L;  1E4G T;  4OIJ A;  4DF7 A;  4A3M G;  1I4P A;  3RBD A;  2R92 H;  3BDO A;  2F0J A;  4A3E B;  3F1Z A;  1L2F A;  4A3I G;  1V8Q A;  1HFN A;  5IGF A;  5ELC A;  4LFB Q;  2WAQ G;  2I80 A;  4RU9 A;  2DPI A;  2R3Z A;  1YNJ C;  1BO0 A;  3D4R A;  2UUC L;  1KDC A;  2KSW A;  3Q8Q B;  3G48 A;  2BQR A;  3PO2 B;  4HQ6 A;  4X66 H;  1KHI A;  3CCL A;  3RN2 A;  4HCE A;  1IZ6 A;  1DCZ A;  2Y0S B;  2XIW A;  4A3C G;  3K58 A;  4KHZ A;  3PF5 A;  3UI2 A;  2VUM G;  1IBL L;  1IOV A;  1RTO A;  2TSS A;  4DV6 Q;  1PYW D;  4LNQ A;  2K7V A;  1N33 Q;  2KJX A;  3BA8 A;  3K59 A;  5EAY A;  4TV9 F;  3RFC A;  3D0F A;  3MR6 A;  3MR5 A;  2A69 C;  1JIH A;  5IYC H;  3RR5 A;  4BY7 G;  3S24 A;  3H0G H;  3L2P A;  4QWE A;  1FVI A;  1MSG A;  3WOE A;  4A75 A;  5KFT A;  2R8K A;  1GXD C;  5AJ3 Q;  2I87 A;  2W6Z A;  4KJN A;  1OXT A;  3T13 A;  3N44 B;  5IYZ F;  1VQK A;  1HQM C;  1STH A;  3T5K A;  2NVQ H;  2MUY A;  1R9T A;  4F4W A;  1WTQ A;  1B70 B;  4DR4 H;  1RCV D;  5IP7 G;  1TY0 A;  2CW7 A;  1YIT A;  4X3U A;  2Z0S A;  5DG8 A;  5BPH A;  2QDL A;  4M8A A;  1D5X C;  1LTR D;  1X3E A;  1FD7 D;  1STG A;  1PH6 A;  1EFW A;  3B6Y A;  1D1I A;  3EPI A;  3RIZ A;  1WCM B;  2A6E C;  1I50 B;  4JC0 A;  1N34 Q;  4KHP Q;  2I46 A;  2C2D A;  1V1P B;  4MTE A;  3C0F B;  4DL6 A;  1ZKO A;  4ECQ A;  3MXG A;  4OIK A;  4A3L H;  2JA6 G;  3F2B A;  3OMC A;  2JP1 A;  2NU7 B;  4JOI C;  1G2S A;  1GGO A;  1SMY D;  5FO9 B;  4M9U A;  4YB8 B;  2K5V A;  4IAJ A;  1I6H H;  3GTK A;  1S9F A;  2ID0 A;  4YR3 A;  1YNN C;  4DR4 Q;  5JQW A;  4LF6 L;  4KKU A;  5CA1 F;  4GKJ Q;  1TAE A;  4F4X A;  4P74 A;  2EQS A;  3FMC A;  5IT9 L;  2AQ3 B;  3CQZ A;  1L2Z A;  4UCV A;  2A6E D;  2B2U A;  2BOS A;  4CGY B;  5KGU A;  4DV3 H;  1D5M C;  1AE2 A;  4RKB A;  4BXX H;  1Y69 U;  1PRT D;  1S3O A;  2VA2 A;  1ET9 A;  3I4L A;  3GTJ H;  1AN7 A;  3F2C A;  3RB3 A;  5C5J A;  2D9U A;  4GS3 A;  1B8A A;  2NVX A;  3D3R A;  4EGQ A;  4JV5 L;  4A2B A;  3C2P A;  3T1Y H;  3ZYY X;  1JMC A;  3TQ1 A;  1QNK A;  2A5H A;  2NN6 G;  1N56 A;  2XCP A;  1WCM G;  5EBD A;  1SAP A;  2Q8T A;  4EVO A;  4XYM B;  1LLR D;  4IRD A;  1B2T A;  1KNE A;  4X65 L;  1BNC A;  5KFG A;  1PH2 A;  1X3G A;  2KEC A;  3CME A;  5KYL A;  4YY3 L;  1B44 D;  5C3E G;  4A93 H;  3RAX A;  2QEX A;  5BR8 H;  4HID A;  3CP0 A;  1CZG A;  4A3G H;  4DNI A;  3PUX A;  4JOI A;  3HZX A;  4HCS A;  3GO5 A;  4OL7 A;  1ZET A;  3PUY A;  3OHB A;  1PH4 A;  1JWS D;  2F0P A;  4BY1 G;  4HR7 A;  2CQA A;  2NVT H;  4FF4 A;  2WE6 A;  2F3I A;  1GHK A;  2F3W A;  4J6H A;  3GID A;  4IWX A;  3H6M A;  1AFP A;  3S15 B;  1LT6 D;  3NTI A;  2CH4 A;  5EWG A;  3Q22 A;  5BR8 Q;  4OO1 I;  1VAJ A;  4EQN A;  1Q86 C;  3N6R A;  1JE4 A;  3N42 B;  1S0N A;  1K8M A;  4QWC A;  4LFA L;  3HGB A;  4Z9C B;  2PQA A;  3TIN A;  1S10 A;  1HJP A;  3JC6 6;  1LTG D;  2FMC A;  4QJF A;  4JI4 H;  1JX4 A;  3IKJ A;  1S5D D;  1SSO A;  4K14 A;  1D7Q A;  2ASB A;  1HTP A;  2WAQ E;  3TP5 A;  1P8L A;  3CF5 A;  3MFG A;  1TWC B;  3HOX G;  3PV0 A;  2J4X A;  2JEJ A;  3OYY A;  3HOV H;  4R4O A;  4FBT A;  3T51 B;  3J7A V;  1DJR D;  1QIL A;  4DV2 L;  4MA5 A;  3KHR A;  1TS5 A;  1F9R A;  3GTM A;  5LMU L;  2XN9 C;  4ZRZ A;  4RGT A;  5ISR A;  1ZXT A;  3H09 A;  2F0F A;  1PHJ A;  5C5L A;  3G7L A;  4TQU S;  5C6A A;  1SBB B;  2FK3 A;  2QDB A;  4DR2 L;  1O7Y A;  2UUC H;  4JI4 Q;  4CC6 A;  4UCR A;  3PW4 A;  1NMF A;  2YU9 B;  4DR6 Q;  1S40 A;  4GKK H;  1K1S A;  3NTK A;  1NE3 A;  4JBW A;  2SCU B;  1SEI A;  1SNC A;  5KG7 A;  4J9Q A;  4L63 B;  4MTK A;  4C3I B;  1AUV A;  5G3L D;  2OWO A;  4B3T Q;  2VR1 A;  1DOL A;  2ZTC A;  4QW9 A;  1KXL A;  1PXU A;  2K05 A;  3Q8S B;  1F2Y A;  3LWE A;  1N36 H;  1E2V A;  1PLF A;  2N78 A;  2IX3 A;  3K5L A;  2KHJ A;  1KLU D;  5EPJ A;  1RD9 D;  3PO3 G;  2UXD L;  4JI3 L;  4B3R L;  2M00 A;  1LTS D;  2PI2 A;  4JI2 Q;  4ZLT F;  2Z6K C;  1YNN D;  3SE0 A;  2IX0 A;  3KYH C;  3CCS A;  1Q82 C;  3M9B A;  2W7P A;  4GKJ H;  3KF6 B;  5IP7 H;  4BS9 A;  3J80 E;  1SMY C;  1I5F A;  3A7L A;  1CKO A;  3GTQ B;  3AFP A;  3VYU A;  3M4O H;  3CC2 A;  4C3H G;  2HIV A;  5M5Y H;  1QWY A;  1LTI D;  2HHH H;  1FNU A;  5FLM H;  1QNU A;  2YCH A;  3S2H H;  3MWE A;  5JEA J;  4O4L F;  1Y1V H;  3RUZ A;  5DLF A;  3T4A C;  5EKI A;  5KYI A;  1RJP A;  2E2H A;  3G6X A;  2SOB A;  4LF9 H;  2UUA H;  3R3O A;  1DOK A;  4UP9 A;  4LFC L;  1VQL A;  4YCU A;  2KCT A;  2YTY A;  1F2L A;  2OQK A;  3UFX B;  2W6N A;  4QY7 A;  1G6Z A;  3R5F A;  5IP9 H;  2XCA A;  5KT5 A;  4LF6 Q;  4KLK A;  1SE3 A;  5C44 G;  2OXP A;  4B3S L;  2SNS A;  1Y1W B;  4YR2 A;  5D3D A;  5KFF A;  2NVT B;  3VMM A;  1S5F D;  1X9N A;  2NVY H;  1TWC A;  3QZ8 A;  3CCQ A;  4K5X A;  4I4T F;  2NBF A;  1SNM A;  1QCB D;  2NVX H;  4DV5 L;  2XSC A;  2FLN A;  4IUT A;  4OWX B;  3IRB A;  2VB3 X;  3PMF A;  2ZM6 L;  4NXN H;  3J81 L;  5JAV A;  1XTD A;  2WB1 A;  2NB0 A;  4OWW B;  2FLP A;  3D6W A;  4LF9 Q;  4YAK B;  4EQ5 A;  4EYI B;  2VB2 X;  4R4T A;  2R8I A;  2CKZ B;  2NU8 B;  1NNX A;  3UDF A;  3HOX B;  4TSS A;  2A6H C;  4YY3 Q;  1HPC A;  2OEO A;  1OWT A;  5DLG A;  3Q0A A;  3TZU A;  3I12 A;  2I5H A;  4Y7N H;  5KNB A;  1TVX A;  4R8I A;  4A3F B;  4NXM Q;  5EWE A;  1EL0 A;  5KT4 A;  3PIP A;  2JA5 B;  3U4V A;  2EIF A;  3KXY T;  4KKT A;  4YWL A;  4OEM B;  4ZUJ A;  5GAG C;  5C1P A;  1PRT B;  1Q3L A;  2DWC A;  3NE5 B;  1EWC A;  3E0E A;  2FPG B;  1GD7 A;  1C7Y A;  1I50 A;  3KHH A;  2H1E A;  3VYS A;  4POG A;  1C30 A;  4RCN A;  3CCE A;  1SYD A;  3NBH B;  3MC0 B;  2ASJ A;  3H3V I;  4NXN L;  3PW0 A;  1OXU A;  1F9P A;  3L7Z C;  1D6E C;  5CV7 A;  3Q24 A;  4B3S Q;  3GTP A;  1WCM H;  1V1O A;  2K1B A;  3DMU A;  4QMG A;  5BPF A;  4RB1 A;  2UUB Q;  3HEJ A;  4DUY Q;  1BBX C;  2NU6 B;  3OSN A;  3HXL A;  5CR3 A;  1I94 Q;  3HOU H;  1XX8 A;  1HR0 W;  3TRE A;  1NMG A;  3MFI A;  4J9S A;  1ZHQ A;  3G6Y A;  5IYD G;  1EZ6 A;  4EBC A;  1CA5 A;  2W6Q A;  3OW7 A;  4KKS A;  1M6V A;  1JCK B;  1NTG A;  2GVA A;  3IL8 A;  5IYC G;  5EBC A;  3GTM H;  3QFF A;  4EEQ A;  4LMY A;  5EPK A;  2R7Z A;  4BBR B;  3E0J A;  4ZKC B;  2UUA L;  3BQ0 A;  2RA4 A;  3PO3 H;  2RBM A;  3I91 A;  4UCO A;  2R8G A;  1JE5 A;  1K83 B;  1JR0 D;  3PUW A;  3D31 A;  1S4Z A;  3K5M A;  3OHA A;  1XPR A;  2HDM A;  1HHV A;  2YRW A;  1IL8 A;  4IJH A;  1KIX A;  4WJ4 A;  3V4S A;  1RJR A;  3PR5 B;  5M3M G;  2F0N A;  1I4X A;  5EDW A;  3BYY B;  2ASL A;  2IA6 A;  4Y8V B;  4ED8 A;  3P7J A;  1TWH A;  2IWH A;  2AQ4 A;  4L5Q A;  4PMC A;  4ECX A;  3GTM B;  1G91 A;  1BGW A;  2R85 A;  1RF2 D;  3U58 A;  4A3K H;  3TS2 A;  4JI3 Q;  2DPJ A;  4HIK A;  5KT7 A;  5D65 A;  2K5D A;  3TRZ A;  4TQS A;  4K6D A;  5F2D A;  5C5M A;  3LX0 A;  3RGZ A;  2KQ3 A;  1B53 A;  1G6P A;  1A2U A;  3RD4 A;  4B3T H;  1HNX L;  4IZ8 A;  1PFB A;  5LYJ F;  1ILQ A;  4J9L A;  4ME6 A;  4X62 Q;  3BAB A;  4A3E H;  3M4P A;  2RCN A;  4O1N A;  4ZUI A;  1EOT A;  1EU4 A;  3WWV A;  4JV0 A;  3EIV A;  3R93 A;  3R23 A;  5IGD A;  2E2J H;  3WO0 A;  1KD1 C;  5JJI A;  3AFQ A;  1MD2 D;  2X6G A;  2KCC A;  4WBN F;  5KX5 F;  2ZJR A;  3S15 H;  3GTO B;  5LHY 1;  1LTA D;  2EYL A;  5CMD A;  3V2T A;  5C3E H;  2J6U A;  2BQU A;  1UAP A;  2XTI A;  2ZTD A;  4IUV A;  3F8T A;  1EU3 A;  1GSA A;  1QB5 D;  2EJG C;  3FDS A;  3A54 A;  3SGI A;  1VQ7 A;  2CHB D;  1SFO A;  2DJF C;  3WO1 A;  3VYT A;  2WIN B;  2CCZ A;  2F0U A;  4DN4 M;  3PR4 A;  5FJ8 G;  1DGS A;  3HS0 C;  1EWH A;  2PW7 A;  4IPH A;  1STB A;  1B04 A;  1XPU A;  2MCT A;  4G3I A;  4YWM A;  1LTB D;  3RGX A;  2C2R A;  5JEA H;  3M3Y B;  4RZQ A;  2KEN A;  2FMM A;  2RSO A;  5LMN H;  5C4X B;  2K52 A;  4LFA Q;  4TV8 F;  4DV0 H;  5KFQ A;  1PTO F;  3GIP A;  2Q8R E;  3FP9 A;  1SYF A;  2K14 A;  2YYZ A;  2NVX B;  2WKD A;  1AEX A;  4DV4 Q;  1STE A;  4DA2 A;  4K0K Q;  2MO0 A;  2YV5 A;  4DV7 Q;  3R2I A;  4MNO A;  2XIG A;  2NUC A;  2F4V H;  4FM9 A;  2E75 C;  1UEB A;  2PW5 A;  4DR7 H;  2B3G A;  2EXZ A;  4RHR A;  5ELO A;  2F03 A;  3N8D A;  1XXG A;  2FJ2 A;  5T1I A;  3VDY A;  4O0A A;  2IT1 A;  1LM0 A;  2R8H A;  1V43 A;  5KFR A;  5J1Z A;  2O2L D;  4CKE A;  5IGE A;  1CTM A;  1SFO H;  3GLK A;  2HT1 A;  3DM1 A;  1PTO D;  4J9M A;  2B2Y A;  1K0R A;  3DEP A;  5L1I A;  4LF8 H;  3URY A;  2NWG A;  4RA8 A;  1EYG A;  3DUZ A;  4JI0 Q;  2HVQ A;  1WTO A;  4EFB A;  2KUM A;  5KFX A;  4ETS A;  4B3M H;  4B3S H;  4LF4 H;  5M5X B;  3Q8R B;  2AMC B;  4G57 A;  3U9S A;  1X3Q A;  2YU9 H;  5KFA A;  4S3S A;  1V1P A;  3KHL A;  3KDF A;  4GC6 A;  2PBZ A;  4DUZ Q;  2B2W A;  1RIP A;  4Q0Y A;  5DAU A;  2YZN A;  1GUT A;  4L5T A;  5E1F A;  4GLX A;  3CVZ A;  4HMI A;  1D2B A;  4JV5 H;  1XYI A;  1GUG A;  4X64 Q;  2MHV A;  4QIW E;  1DM0 B;  5IWA H;  3W3A A;  3GV7 B;  2IHF A;  2Q2I A;  3CXC A;  4N9T A;  4CDC C;  2CWP A;  4GKJ L;  2ZDG A;  1W93 A;  2B63 G;  4U67 3;  5KFS A;  5M3M H;  1LUZ A;  4ED7 A;  1HXY D;  3VA7 A;  3JAM c;  1PZJ D;  1WTR A;  4F8M A;  5I9P A;  3V96 A;  5IGG A;  2EYO A;  4NXM H;  2WAC A;  4HED A;  3V05 A;  3VR3 A;  4TUY F;  4KTA A;  1UEA B;  3RV4 A;  5DM6 3;  5HUR A;  2F0Q A;  4LFB L;  3A5U A;  4FS2 A;  4IPC A;  3T56 B;  2KA7 A;  3OWF A;  4IUN A;  1PA6 A;  5HGQ A;  1OO9 B;  2XRS D;  1NCV A;  2B8F A;  4HJ8 A;  4UFZ A;  3FKI A;  2E2D C;  3A56 A;  2L5T A;  1OXV A;  1ESR A;  1T94 A;  2UVV A;  1YNX A;  3LWU A;  3BS1 A;  1Z9F A;  3SEB A;  2B2T C;  1F2Z A;  1VQD A;  1RYR A;  1WOC A;  2FIN B;  5KFO A;  3ORR A;  2Y0S A;  1TWG B;  4ED1 A;  3RMH A;  3JSL A;  2DY7 A;  2F0K A;  2L9H A;  1XWE A;  2N3S A;  3DWP A;  4WJ3 M;  3DF7 A;  2XRQ D;  5C44 H;  1KQS A;  1Z7T A;  3ER0 A;  1IHZ A;  1VQJ A;  1VBH A;  4HIM A;  1PX2 A;  1YHA A;  4ID6 A;  4LUV A;  1LT3 D;  3NUC A;  1GJX A;  2HUG A;  1I6U A;  4KHV A;  1JDE A;  4MTN A;  1U5K A;  1I94 H;  3BZK A;  1CSP A;  4QF4 A;  1AP0 A;  3HB9 A;  4KN4 C;  4YWK A;  1E1O A;  2K5N A;  3EFX D;  3J7A F;  1QOH A;  2MNA A;  2F0I A;  4O2A F;  3J81 W;  2AWO A;  3LP8 A;  1PFM A;  4RB0 A;  2QF7 A;  3PVX A;  2EYF A;  1VQE A;  5DLQ E;  2J6T A;  2QEJ C;  4A3J G;  1CQV A;  2HQE A;  3KK7 A;  3S2D B;  3A8K E;  2JA6 B;  4DNT B;  1V51 A;  5C0X I;  3KAJ A;  3M4Q A;  5FD6 A;  4K0K H;  4A76 A;  1Z2N X;  2V4R A;  1SYX B;  1KAA A;  1L0X B;  2UXB L;  4XX0 B;  2JA8 H;  3RZD B;  2I0Q A;  2Z4I A;  3ETH A;  2PZU A;  3KAK A;  4IPG A;  5CV4 A;  4DL3 A;  4IRK A;  4RNM A;  2F4V Q;  2PCF B;  3J81 i;  1F2M A;  1ICF B;  2TMP A;  4A3L G;  4OX9 H;  3KLS A;  2OH2 A;  2VUM B;  4QUF A;  5JUM A;  2O4X A;  1H9R A;  1KAB A;  3BVG A;  2ZJP A;  2IJ0 A;  1WVL A;  5C0X G;  3BJY A;  2BA1 A;  4QB4 A;  4MAM A;  4YR0 A;  1MIU A;  4BA2 I;  4X62 L;  3HKS A;  4IO9 A;  1N34 H;  4KHP H;  4RUA A;  4HSP A;  5GAE C;  3EYY A;  1HNX Q;  4DK1 A;  1UUP A;  1IBK L;  5KFP A;  2NN6 I;  5BR8 L;  3E6Z X;  2XCL A;  2VUM H;  3Q6S A;  1PRT C;  3GTJ B;  1T36 A;  3E5N A;  5M3F G;  1FJG L;  2XC9 A;  4PG3 A;  1BQQ T;  1G8Z D;  3QO2 A;  4KJO A;  3PO2 G;  1SE2 A;  3I4M B;  3AEV A;  4CHT B;  4N8X 1;  1SFO B;  1Z2O X;  1BBW A;  3NQT A;  5IGC A;  2FJZ A;  3NWT A;  4F50 A;  4LMQ D;  3PQI A;  2W9C A;  1Y1W A;  1KLG D;  1VQ8 A;  4IJL A;  1ET6 A;  1J6Q A;  1WTW A;  4OON A;  3KF8 B;  4ODG A;  1EIH A;  4J9O A;  1SND A;  3TN2 A;  5E4W C;  3Q2O A;  4XYL B;  3GV3 A;  1A15 A;  2JA6 A;  3P1H A;  1ICW A;  5C4J B;  1H9J A;  3H15 A;  1IL2 A;  3DWQ A;  4X65 Q;  3ERQ A;  2QGQ A;  2Y0S E;  5FO7 B;  2HCI A;  4H02 A;  4CJ2 C;  1EUC B;  4MTD A;  2E2I A;  1X6O A;  2F0W A;  2R6F A;  1CI3 M;  4I7H A;  3TIG A;  2C35 B;  1S5B D;  4ZAI A;  4GN4 B;  4I65 A;  5FK9 C;  4OO1 G;  1K0S A;  4R8U A;  2EZV A;  1K28 A;  4OHJ A;  1OTC A;  4K8J A;  2B2U C;  3PF4 A;  1JT8 A;  2LXJ A;  2ZM6 Q;  3CPW A;  4O3P A;  2IPK D;  2WV6 D;  1RTN A;  4J8Q A;  1HTL D;  1T5X D;  2R7M A;  4DAM A;  4V0B A;  2YL2 A;  2CW0 C;  3MXN A;  2P5Z X;  3ND9 A;  3ITP A;  4KK7 A;  3HOZ G;  1ENC A;  2J7Z A;  4WOR A;  4A3B H;  5KRU A;  5KG0 A;  2JEF A;  2HHH L;  2F1M A;  4BY1 H;  2VS1 A;  3U50 C;  4DV3 Q;  1LAB A;  3HBL A;  4LK1 C;  1CSQ A;  2BR0 A;  4BWG B;  1MKH A;  4DR4 L;  2HDL A;  3QG1 A;  1S5E D;  2E8G A;  4C5C A;  5CV8 A;  5JPN C;  2K04 A;  1VQN A;  1E22 A;  4KY5 A;  4HNU A;  2Z4H A;  1BUV T;  2L55 A;  2VQE L;  3KLW A;  1KRS A;  1VQA A;  2DNE A;  4LFC Q;  2AWN A;  1D5Z C;  2RDH A;  4ALP A;  5BN4 A;  2FPI B;  3MZ5 A;  4YIJ A;  3HKZ E;  3FKI B;  1U4M A;  2VL6 A;  2OF1 A;  3GTL H;  3NP8 A;  4LUO A;  1DV1 A;  5I4D A;  4ED2 A;  3C3L A;  3NK9 A;  2YTX A;  2V59 A;  2XD4 A;  1EQR A;  1SYE A;  3HOV G;  2VQF H;  2ALZ A;  1RJQ A;  2VZA A;  5D8D A;  4NXM L;  4G7H C;  2WB1 G;  1X3F A;  1NY4 A;  4IZO A;  2C22 A;  4LF5 Q;  1HNZ L;  1XMO L;  1D1K A;  4CC5 A;  4DAY A;  3D4W A;  3VYR A;  1CE8 A;  2IL8 A;  4K5V A;  2ZJQ A;  4A3K B;  1O75 A;  3I4O A;  3OTO Q;  3UDG A;  2R8J A;  3TQT A;  1NUC A;  1X56 A;  3QOJ A;  4PMB A;  4A3J H;  1EOV A;  1W6K A;  1MZB A;  4IOA A;  3GTL A;  2NVY B;  2JSO A;  4C3I G;  3J80 c;  1YNJ D;  3CHB D;  1W6J A;  3OSO A;  4RGO S;  5L37 A;  5IYD H;  2ICE C;  5D3I B;  2B63 A;  5D14 A;  4DV5 Q;  1PH8 A;  3NEM A;  2ALY B;  4J0M A;  4I50 F;  2VQF L;  4RCO A;  1Z2P X;  4LUZ A;  1VQ9 A;  4I7Z C;  1LYL A;  3GV5 B;  3RB4 A;  4QIW B;  4ZOL F;  1C0A A;  1JQY D;  1I7N A;  3GDE A;  1GUO A;  1VQC A;  4DPG A;  2V9W A;  1PFS A;  2Z1C A;  2B39 A;  4KMU C;  1T9H A;  5NUC A;  4JI4 L;  1KJI A;  3MXP A;  3J7Y W;  1M1K C;  5KKN B;  3A55 A;  4ILW A;  4LFA H;  3RLO A;  1B9M A;  2FKL A;  4A3C H;  3RF2 A;  4MV7 A;  2PPB C;  1UE7 A;  4OGQ C;  5L9X A;  4ABN A;  2UUC Q;  2UXB H;  1X32 A;  3VR4 A;  1WD1 A;  4ECZ A;  1G2T A;  4DV5 H;  3S17 B;  3HOW B;  2F0M A;  4R4C A;  1K1Q A;  1B50 A;  2IBK A;  3L3O C;  5E3F A;  1YEZ A;  4DR7 Q;  4ZHQ F;  1WR2 A;  5KG4 A;  2R61 A;  1EUJ A;  4KN7 C;  4XZ3 B;  2HGS A;  4IWY A;  2L12 A;  2PMZ E;  3RZD H;  4JI7 L;  1GLV A;  3MWD A;  1ZYR D;  5T1G A;  5IT9 c;  3Q23 A;  2E2H H;  1RHP A;  4C2M B;  3ERO A;  4NW2 A;  4EBD A;  2A19 A;  3CRL C;  5M5W B;  1BVS A;  4BWS C;  1HNW L;  1TII D;  2W70 A;  1B4O A;  3R5H A;  4JI8 L;  4FVM A;  1HA5 A;  2LKV A;  1YVC A;  1WTH A;  4A3G G;  4TVA B;  5DG7 A;  2Z6K A;  2Q8I B;  2F0S A;  2L11 A;  2RGR A;  5JJK A;  3HP3 A;  2UVW A;  4HTH A;  1YZ6 A;  4LWC A;  2C2E A;  3UE0 A;  1I3Q H;  3M85 A;  4P75 A;  3GTQ A;  3JRX A;  1MSH A;  1FR3 A;  4DR2 Q;  2KOL A;  3W1G A;  2E2J B;  5FKA C;  3TS0 A;  2I07 B;  1AUX A;  1CKN B;  1JC7 A;  2FPP B;  5IIF A;  4QIW A;  1JWM D;  2KVM A;  1SDF A;  1EY9 A;  1EY0 A;  3S16 B;  1IXR A;  1W3S A;  1J9O A;  3U4Z A;  3CU7 A;  2JA8 G;  2IY5 B;  3K8A A;  2LSS A;  1DYQ A;  4JG2 A;  1HRJ A;  1EUD B;  3T1H H;  1N48 A;  4ECY A;  3KLR A;  3TQY A;  1KC8 C;  2UXC Q;  4BBS G;  1EQT A;  4TRD A;  2ZXO A;  4RFB A;  4AYB B;  2K4K A;  3FKI H;  1IYJ B;  5J39 A;  1K3R A;  1TWH B;  2PMZ B;  4K2L A;  3PIO 3;  5JVL A;  4IN3 A;  4XT1 B;  4CDF C;  2ZDH A;  2F0D A;  3VPD A;  3S1M H;  1MBY A;  2WP8 J;  4DR2 H;  1TWG A;  1SRO A;  4AH6 A;  2R92 B;  4ZKB B;  4NXN Q;  4RAU C;  5FD5 A;  2RSN A;  4CKC A;  1WJJ A;  2YTV A;  3GTO H;  5M5Y B;  3NBI A;  3MA2 B;  3A8J E;  4B3M L;  4DUZ H;  3NGD A;  4DUZ L;  4YHH H;  1E7Z A;  2MO1 A;  2Y0S G;  2K32 A;  1I3Q B;  5M3F H;  3PCO B;  4FYD A;  2Q2U A;  4BA1 I;  4BBR H;  4GOP B;  3K57 A;  2VA3 A;  5KG6 A;  1N32 Q;  4X64 H;  2FP4 B;  2V58 A;  1I6H B;  4EBE A;  1A3U A;  1TWF H;  2K5H A;  1EYC A;  4IUP A;  3OUZ A;  5HBR B;  3H4D A;  3BG5 A;  3I8Z A;  4DNR B;  2KCM A;  3KBX A;  1J5E H;  5LOV F;  4ED3 A;  3GQB A;  1J8I A;  5M5X H;  2ICI A;  2EE1 A;  5GAD C;  1SN8 A;  3K7A B;  3MXU A;  1LO5 D;  1K73 C;  3I70 A;  1C3O A;  1PV4 A;  5KT3 A;  1H9K A;  5C8Y F;  1SCU B;  4A3B B;  4OWT B;  4LF4 Q;  1EY8 A;  3CCR A;  1VQ6 A;  1S5C D;  1IW7 D;  2LMC B;  1TR5 A;  1C8C A;  5KT6 A;  4QGU A;  3UE1 A;  5IP9 G;  2PQA B;  2EYP A;  3X3M A;  3GIK A;  4A3D H;  4X66 L;  1I7L A;  5J2T F;  2E74 C;  5LL6 S;  4H13 C;  4ED6 A;  4F4Y A;  4JYA Q;  4DK0 A;  5J3B A;  3JAM E;  1ROD A;  5CV9 A;  2PVP A;  3IFD A;  1SMX A;  1F9Q A;  2I8C A;  1QJO A;  2KHS A;  2F0V A;  2FHT A;  3FPU B;  1IBK Q;  5M9O A;  2O03 A;  4UCU A;  4RB2 C;  2W8L A;  2NZO A;  4H7B A;  4NMZ A;  5CAE B;  4JV1 A;  1WTV A;  1PH9 A;  1EQV A;  4JI6 L;  3K0Y A;  5COR A;  2HJW A;  3EQL C;  4EX5 A;  3I4M G;  2EXD A;  1PRT F;  1Y8P B;  1JDB B;  1JJG A;  2CQY A;  1A3T A;  2N8N A;  2C5C A;  1HZC A;  3VR5 A;  2EOT A;  2KCN A;  1NBW A;  1H9S A;  3S2H B;  1I4H A;  3N43 B;  1TWA H;  1VBG A;  3AU7 A;  1HA6 A;  4JI6 Q;  1YIJ A;  1V4Y A;  2YW2 A;  2YZG A;  1UE1 A;  1K8A C;  5GAH C;  2GPS A;  3STB C;  1AW7 A;  3KF8 A;  1RDP D;  2R7K A;  3HKZ B;  1JB7 A;  1CKN A;  2MQH A;  4K8I A;  5ELF A;  1JXL A;  1VQP A;  1KJ9 A;  3S1N B;  1HZB A;  2ASD A;  3SK6 A;  5KFV A;  3M9O B;  1XNQ H;  2G9D A;  2H5X A;  1S0M A;  2UVR A;  2R93 H;  4DR5 H;  2HVS A;  5HV6 A;  4Q0F A;  4HJ9 A;  4YJ3 F;  3H94 A;  2LFN A;  3RZO H;  2AGP A;  2OQ0 A;  1WYD A;  4LF4 L;  3L9A X;  4L5S A;  2PNH A;  3QWN A;  3C46 A;  1GUS A;  3CPF A;  3L4K A;  1II3 A;  4NB3 A;  1VCI A;  3V4Z A;  4LF8 L;  3H0G B;  4Q5V A;  1Q12 A;  3DHQ A;  5ELB A;  4X3T A;  5KND A;  1TA8 A;  2GVB A;  3I3C A;  1Q7Y C;  4R9W A;  4B3R Q;  1XNQ L;  4A3D G;  1N32 L;  3CCJ A;  3F2D A;  3M7G A;  1SYG A;  2DY8 A;  2OT2 A;  1JB3 A;  1QUQ B;  1XNQ Q;  1AZP A;  4O42 A;  1MI2 A;  1HNW Q;  1NAP A;  1YI2 A;  5A2Q W;  4GOP A;  3K6O A;  1S03 G;  5KEE A;  3CRK C;  3WNZ A;  3H3V C;  4OX9 Q;  1Q8I A;  2EJF C;  2G9H D;  1XNR L;  1VMP A;  1NR2 A;  4B3R H;  2UXD H;  5CBA E;  1J5E L;  1SJH D;  4K5W A;  1B6S A;  2D0P A;  4POF A;  1EZ8 A;  5IE8 A;  1YHQ A;  3PGZ A;  4L6T B;  3V6J A;  1TS4 A;  4U68 A;  4RB3 C;  2K33 A;  2KBN A;  1CKM A;  2JA7 H;  4L8J A;  2ZJT A;  3SXH A;  4FF2 A;  3J7A 5;  2UXC L;  2NZ1 D;  2FMA A;  1WTX A;  4HAE A;  3UQ8 A;  5DM7 3;  2RGV A;  4FP5 D;  1LT5 D;  3SK5 A;  1PK8 A;  1N8R C;  1XPO A;  1EY6 A;  1STY A;  1ASY A;  5C3X A;  4LF5 H;  1DON A;  1WD0 A;  2F0H A;  5D1O A;  4E4T A;  4MIU A;  3K5H A;  1KBL A;  3FHW A;  3KDF B;  3KJO A;  4JW0 A;  5HY6 A;  5C4H A;  3MEH A;  1U0L A;  5LMU H;  2QK4 A;  4UPA A;  2IW3 A;  3OWE B;  4HJ5 A;  3J7Z C;  2K01 A;  1XNR Q;  4XYQ A;  1HQR D;  2UXC H;  1UNS A;  4MHE A;  5JPM C;  4DL7 A;  3IFT A;  4JBM A;  1CS0 A;  2DJG C;  1HUM A;  4MZ9 A;  4IFD J;  2IX1 A;  4OO1 H;  1Y8O B;  4C3I H;  3G6E A;  4PDB A;  4NP5 A;  1XMQ Q;  2MGS A;  3BAA A;  4DAY B;  2F52 A;  1H95 A;  3I2Z A;  4EG0 A;  1OXS C;  2W9C B;  4JPB W;  4G7Z C;  3MFH A;  4XT3 B;  4A3K G;  1VQO A;  1R9T H;  1TU2 B;  2UU9 H;  1ASZ A;  1K3B C;  4Q43 A;  4R8N A;  4PZ7 A;  4A3I H;  1XMO Q;  4C3J H;  5K5P A;  1Y1W G;  3GTJ A;  2ZXP A;  4O4I F;  1KAW A;  5M3F B;  2CQO A;  1TY2 A;  3VA5 A;  1QE6 A;  3J80 W;  4L1K A;  1AZQ A;  3NWS A;  3G6J B;  3ND8 A;  1ILP A;  5KIX A;  1E3P A;  2W57 A;  4CBV A;  5HGT A;  3AB9 A;  4UP8 A;  4JI8 H;  4DV4 L;  3A8I E;  4DGZ A;  3JRW A;  1VS0 A;  5LL6 X;  3I4N B;  2PN1 A;  1B33 N;  4DV1 H;  3QOL A;  4A3M H;  4DR5 L;  4I7A A;  4HNT A;  4BXX G;  4V19 0;  4QUC A;  3SVM A;  1M0T A;  3I72 A;  4O2D A;  3CCU A;  5K2M A;  4NDX A;  2XGP A;  4J9K A;  4JI7 H;  2VPQ A;  1DXM A;  5KG1 A;  4EGV A;  4A3F G;  2JEG A;  4XXE A;  3TZD A;  5C4X H;  5TSS A;  4DR5 Q;  2ES2 A;  3SK4 A;  2M05 A;  3MWY W;  1H9S B;  2BH2 A;  3JZI A;  1TWC H;  2W9A A;  3VPC A;  3NTH A;  1IW7 C;  2HCC A;  2BA0 A;  2F3V A;  3LNN A;  2A8V A;  3Q1K A;  5A2Q E;  1B9N A;  3S1M B;  3NEN A;  5C3W A;  4ECS A;  1TWH H;  1HH2 P;  1KDA A;  2OCE A;  4IPD A;  5CBE E;  3TP7 A;  1UE5 A;  1N34 L;  4KHP L;  4O3N A;  2N88 A;  2JE6 I;  1AH9 A;  5LXT F;  4H0L C;  1HNW H;  4JI6 H;  3M3Y H;  3KAL A;  2NYZ D;  5COY A;  4CDE C;  1SJE D;  2B29 A;  2LXK A;  5DEH A;  1YBY A;  1BCP C;  2B63 B;  3K3P A;  3RAQ A;  1Q1E A;  2YYA A;  5KFB A;  2XWJ B;  1VQ4 A;  2CFM A;  1E1T A;  4LF7 H;  2EDG A;  4JI3 H;  1V9P A;  3PW7 A;  3S1Q H;  1UNN C;  3RLF A;  4IR1 A;  4R4Q A;  3CCV A;  3GTQ H;  4MA0 A;  2KED A;  4F7X A;  5EQ0 A;  2F0L A;  1KL9 A;  3FEW X;  1O78 A;  2YZM A;  1SE8 A;  3GTK B;  2UXD Q;  2L15 A;  5I9O A;  1EYA A;  4C2M A;  5C0X J;  2E2H B;  3Q8D A;  1PTO B;  4K0K L;  1FJG Q;  4ZQI A;  3HG9 A;  1QVC A;  5IGB A;  5DGA A;  1AE3 A;  3N6X A;  2EY2 A;  4MN3 A;  4RG1 A;  4F4Z A;  5A2Q L;  4MV8 A;  1FGU A;  2W6O A;  5FPR A;  5FLX L;  3GTO A;  2VQE Q;  1E24 A;  2VUG A;  2AHO B;  3KBG A;  4GN5 A;  3BG3 A;  1WCM A;  5KFM A;  5E4X A;  1LT4 D;  1N33 L;  3AQQ A;  1Q8K A;  3EA6 A;  2JN4 A;  3FKI G;  2E2I H;  1ONL A;  2WDT A;  2HVR A;  3I4N H;  1RK6 A;  1DZ1 A;  3ERS X;  4HYK A;  1U4L A;  4GN3 B;  3W5O A;  3SHL A;  3QB3 A;  4JVZ A;  1CUK A;  1CZW A;  1EEF D;  3E5S A;  3DLL A;  2HHH Q;  1CQF A;  1PTO C;  1X65 A;  3K3V A;  4RNN A;  1R9T B;  1I50 H;  5LMU Q;  1C48 A;  3HOZ B;  2W6M A;  1VDZ A;  1BOS A;  4X3S A;  1ZYR C;  1IBL H;  5C4J H;  3MVV A;  1XDN A;  4BY1 B;  2YS7 A;  1P16 A;  4RAY A;  2K75 A;  1PVO A;  1PYB A;  3GV8 B;  3OUU A;  2PYK A;  4RH6 A;  3K5N A;  4BBR G;  4X6A H;  3RBE A;  3CQZ B;  4GNX B;  2EY5 A;  1KDB A;  1SNQ A;  5ELD A;  4J9R A;  1I94 L;  1FNV A;  1EIF A;  2MJ8 A;  3K5O A;  1K8O A;  4OEL B;  3T5J A;  4ED0 A;  4IUQ A;  2OLS A;  4FF3 A;  4J15 A;  5LA6 F;  2J6S A;  3JAM L;  1N36 Q;  2RHS B;  2FFK B;  4B9W A;  3QIA A;  4HSV A;  2AKW B;  1EWI A;  3TP6 A;  1M7J A;  2R7Z H;  3EJI A;  1DV2 A;  4U7C A;  4JBJ A;  1JOK A;  4JI8 Q;  2QA4 A;  4GNX C;  4YAJ B;  4UP7 A;  3K7A H;  5CA0 F;  4C3H B;  4YY3 H;  1FKA H;  1TT2 A;  4K6L A;  3RJ0 A;  2M9V A;  5EKL A;  1RYS A;  1E4F T;  4QW8 A;  4X65 H;  2JA9 A;  2R87 A;  3RB6 A;  4HJA A;  3BQ2 A;  2PNR C;  1PTO H;  2NVQ B;  2K6A A;  4Q45 A;  2NTT A;  2W8K A;  2SEB D;  4JI5 H;  1N36 L;  3J81 j;  2X6L A;  3C1F A;  3FVQ A;  2R84 A;  2DIK A;  1EHI A;  2E5L Q;  3HOW H;  2CW8 A;  4JI1 L;  1I6V C;  1EFI D;  5EZY F;  3I4N G;  2C9O A;  3M4I A;  2JA8 B;  4TKO B;  2VOB A;  1ENF A;  4GKK L;  1E4E B;  5IY0 A;  4HNV A;  1CA6 A;  2QW7 A;  5G3L F;  3BVZ A;  4DAP A;  3K81 C;  4A3E G;  2UUA Q;  2JA5 G;  5H80 A;  3GTG B;  1XMQ H;  1K8G A;  4KV6 A;  1TS3 A;  1M4V A;  1LAC A;  3TME A;  2H4O A;  1IBM L;  3LML A; 
#chains in the Genus database with same CATH homology
 5IWA L;  3E9H A;  1HNW L;  1I94 Q;  3HOU H;  1HR0 W;  3TRE A;  1NMG A;  5LMN W;  5H1S E;  5IYD G;  4JI8 L;  3DM3 A;  1YVC A;  3PO2 H;  3BJU A;  4A3G G;  1YJN A;  4TVA B;  3HOX H;  2Z6K A;  1NTG A;  2GVA A;  1MJE A;  5IYC G;  4HJ7 A;  3GTM H;  4BY7 H;  1J5E Q;  4A4I A;  5IYB H;  2Q2T A;  3MXN B;  5JJK A;  4LWC A;  1YZ6 A;  1Y1W H;  2UUA L;  3UE0 A;  1I3Q H;  3PO3 H;  4OX9 L;  3M85 A;  4DKA C;  4P75 A;  1UWV A;  2JEB I;  3S16 H;  5C4X G;  4QL5 A;  3RLN A;  3ULJ A;  1JE5 A;  1GVP A;  4RMF A;  4DR3 L;  3PUW A;  3D31 A;  4DR2 Q;  3W1G A;  2RHQ B;  4PZ6 A;  1L0W A;  1XPR A;  2JA7 G;  4IJH A;  3TS0 A;  1KIX A;  4IOC A;  2R7Z G;  4WJ4 A;  5M3M G;  1CKN B;  2R6G A;  1K83 H;  3KF6 A;  3I56 A;  1PH3 A;  1VQM A;  1IXR A;  1W3S A;  1MJC A;  1PH7 A;  3U4Z A;  2JA8 G;  2CWA A;  3K8A A;  2IY5 B;  1O7I A;  2LSS A;  3BZC A;  4JG2 A;  4L5Q A;  1YHB A;  3CC4 A;  4C3H H;  2R92 G;  3TQY A;  4P73 A;  4C2M H;  1KC8 C;  3U58 A;  4A3K H;  3TS2 A;  4BBS G;  2UXC Q;  2I5M X;  4JI3 Q;  4HIK A;  1HNZ Q;  1XJV A;  3TRZ A;  3I4M H;  2K4K A;  2R7D A;  1IYJ B;  3FKI H;  1BBU A;  1K3R A;  3GTP H;  1IBM Q;  3S1M H;  1G6P A;  2WP8 J;  3HKZ G;  1Y14 B;  1HNX L;  2VY3 A;  4LF7 L;  1SRU A;  3CMA A;  1M90 C;  4X62 Q;  1SRO A;  1XMQ L;  4A3E H;  3M4P A;  2RCN A;  4AH6 A;  4Y52 H;  4JV5 Q;  4NXN Q;  3WWV A;  4LW1 A;  2XGT A;  4R1J A;  1WJJ A;  2YTV A;  3EIV A;  1QVG A;  4JI0 L;  3GTO H;  4QQB X;  2E2J H;  4AQY L;  1KD1 C;  4B3M L;  3ULP A;  5JJI A;  3AFQ A;  4DUZ L;  4JI5 Q;  2NZH A;  2ZJR A;  1E7Z A;  2OTJ A;  2MO1 A;  1HZ9 A;  4GLA C;  4R4I A;  2Y0S G;  5M3F H;  2E5L L;  5C3E H;  1FL0 A;  3PCO B;  2Q2U A;  4BA1 I;  4BBR H;  4GOP B;  2XTI A;  1GM5 A;  1N32 Q;  2ZTD A;  3AYH B;  3F8T A;  4DV1 L;  4DV0 Q;  1PH5 A;  1L1O A;  1IBL Q;  1TWF H;  2K5H A;  3UDI A;  3H0G G;  2Q2H A;  1VQB A;  3SGI A;  4DV3 L;  4JI2 L;  4GOP C;  1WI5 A;  5E7N A;  1VQ7 A;  1X54 A;  2KCM A;  4GLV B;  3T1Y L;  5M5X H;  1K73 C;  5JJL A;  5GAD C;  1SN8 A;  1NJI C;  2CCZ A;  4DV7 L;  1PV4 A;  5FJ8 G;  1DGS A;  3T1Y Q;  3S1R H;  2FXQ A;  3A0J A;  4OWT B;  1GKH A;  4IPH A;  4LF4 Q;  3CCR A;  1XPU A;  1VQ6 A;  1LTL A;  2A1A A;  1A62 A;  4QGU A;  4YWM A;  3UE1 A;  5IP9 G;  2PQA B;  3CQZ H;  4LF8 Q;  4A3D H;  4X66 L;  2KEN A;  2MFI A;  2K52 A;  4LFA Q;  4HIO A;  5ELN A;  4JYA Q;  1QZG A;  1WFQ A;  3KFU A;  5J3B A;  4X66 Q;  4A93 G;  3FP9 A;  2K14 A;  4APV A;  1JJC B;  2YYZ A;  1SMX A;  1HZA A;  2UU9 L;  4DV4 Q;  4A3M G;  1IBK Q;  2R92 H;  2DUD A;  2NZO A;  4K0K Q;  3F1Z A;  3GTG H;  2MO0 A;  1L2F A;  2YV5 A;  4DV7 Q;  1YJ9 A;  1PH9 A;  4MNO A;  4A3I G;  5LMN Q;  1VQF A;  1JJ2 A;  4JI6 L;  3PIO A;  1UEB A;  2N49 A;  2EXD A;  3GD7 A;  4EX5 A;  2JA6 H;  3I4M G;  1JJG A;  2B3G A;  2D0O A;  2DGY A;  2WAQ G;  2N8N A;  5ELO A;  4A3F H;  4LFB Q;  1HZC A;  3VDY A;  4O0A A;  2IT1 A;  1LM0 A;  1NBW A;  1V43 A;  3G71 A;  2UUC L;  1TWA H;  3I7F A;  3G48 A;  4JI6 Q;  1YIJ A;  1UE1 A;  1K8A C;  1KHI A;  5GAH C;  1SFO H;  3STB C;  3CCL A;  2HT1 A;  1Q81 C;  3RN2 A;  1IZ6 A;  1D8L A;  4A3C G;  4DK3 C;  1K0R A;  4KHZ A;  1CKN A;  2MQH A;  3PF5 A;  1JB7 A;  2VUM G;  1EYG A;  1IBL L;  4JI0 Q;  4DV6 Q;  2VNU D;  1VQP A;  4LNQ A;  1N33 Q;  1HZB A;  3GTK H;  5EAY A;  2H5X A;  2AMC B;  5FLM G;  3D0F A;  2YU9 H;  2R93 H;  3KDF A;  4DV6 L;  4DUZ Q;  4HJ9 A;  4ME3 A;  3RR5 A;  1RIP A;  5IYC H;  5GQO A;  2R7F A;  3S24 A;  3H0G H;  3L2P A;  4BY7 G;  3RZO H;  1FVI A;  2OQ0 A;  4L5T A;  4A3B G;  1WYD A;  4A75 A;  4GLX A;  4LF4 L;  5AJ3 Q;  4L5S A;  2JJQ A;  2PNH A;  3K7U C;  1OXT A;  4DR7 L;  4X64 Q;  3CPF A;  4P72 A;  4QIW E;  1VQK A;  2F4V L;  4NB3 A;  1VCI A;  3S2D H;  2IHF A;  4LF8 L;  2Q2I A;  3CXC A;  2NVQ H;  2CWP A;  2JA5 H;  1Q12 A;  4GKJ L;  1G51 A;  2GVB A;  2B63 G;  1B70 B;  4DK6 C;  5IP7 G;  5M3M H;  1LUZ A;  1Q7Y C;  4B3R Q;  1YIT A;  5JEA G;  1XNQ L;  4A3D G;  1N32 L;  3JAM c;  3J81 c;  2Z0S A;  3CCJ A;  1B7Y B;  3HOU G;  3K80 C;  3F2D A;  1X3E A;  1QUQ B;  3CCM A;  1XNQ Q;  1KRT A;  1PH6 A;  1L1O B;  1HNW Q;  1EFW A;  3B6Y A;  4DUY L;  1YI2 A;  3PUV A;  4LFB L;  3A5U A;  4GOP A;  4IPC A;  3HOZ H;  4JC0 A;  1PA6 A;  2OTL A;  4P71 A;  5HGQ A;  4DR1 L;  1N34 Q;  4OX9 Q;  4KHP Q;  4HJ8 A;  1XNR L;  3S14 H;  4A3L H;  3J80 i;  1OXV A;  2JA6 G;  3KOJ A;  3HOY G;  3F2B A;  1YNX A;  1J5E L;  4JOI C;  2D0P A;  1Z9F A;  2RF4 A;  4POF A;  5IE8 A;  1YHQ A;  1VQD A;  3PGZ A;  2K5V A;  1WOC A;  1I6H H;  2KBN A;  2JA7 H;  1CKM A;  2ID0 A;  3ICE A;  4WJ3 M;  2N3S A;  3J7A 5;  2UXC L;  3S17 H;  1L1O C;  5C44 H;  1KQS A;  4DR4 Q;  1VQI A;  3ER0 A;  4LF6 L;  4GKJ Q;  3OTO L;  1VQJ A;  4HIM A;  4DV0 L;  4DV1 Q;  4P74 A;  2EQS A;  1YHA A;  1N8R C;  1HR0 L;  1XPO A;  5LMN L;  1ASY A;  4LUV A;  1S72 A;  1SLJ A;  1AE2 A;  4BXX H;  3G4S A;  4AYB E;  4JI7 Q;  4MTN A;  1U5K A;  3FHW A;  1S3O A;  3KDF B;  5IYB G;  3KJO A;  3BZK A;  1Y1V G;  3GTJ H;  5HY6 A;  1CSP A;  3F2C A;  1U0L A;  4LF9 L;  4UPA A;  4GS3 A;  4YWK A;  3J7Z C;  4HJ5 A;  1E1O A;  2K5N A;  1B8A A;  4JV5 L;  2MNA A;  1XNR Q;  2AWO A;  1JMC A;  2V1C C;  2D62 A;  2NN6 G;  5FLX c;  1VQE A;  1WCM G;  5DLQ E;  2HQL A;  4JBM A;  3W1B A;  2BH8 A;  4A3J G;  3H3V H;  4MZ9 A;  2WB1 E;  3ZJY C;  3OW2 A;  2IX1 A;  4IFD J;  4X65 L;  4DR3 Q;  4C3I H;  3G6E A;  4UY8 C;  5C0X I;  3M4Q A;  1XMQ Q;  1X3G A;  4A76 A;  1PH2 A;  3CME A;  4YY3 L;  4DAY B;  2F52 A;  5C3E G;  2JA8 H;  2WFW A;  2QEX A;  4A93 H;  4IFD G;  2UXB L;  1H95 A;  3I2Z A;  4HID A;  2I0Q A;  3CP0 A;  4A3G H;  1OXS C;  4DNI A;  3PUX A;  4JOI A;  3T1H L;  4A3K G;  1VQO A;  1R9T H;  1V1Q A;  3GO5 A;  3PSI A;  4IPG A;  3PUY A;  1ASZ A;  5K36 G;  1TWG H;  2F4V Q;  4PZ8 A;  4PZ7 A;  4A3I H;  1PH4 A;  4BY1 G;  1XMO Q;  1Q1B A;  4C3J H;  2NVT H;  1Y1W G;  2F3I A;  3JAM i;  3J81 i;  1KAW A;  4A3L G;  2CQO A;  1G29 1;  5BR8 Q;  2ZJP A;  4OO1 I;  1Q86 C;  5C0X G;  2KHI A;  2BA1 A;  1E3P A;  1N9W A;  4JYA L;  1MIU A;  4BA2 I;  4LFA L;  2PQA A;  3HKS A;  4X62 L;  4IO9 A;  4GKK Q;  4UP8 A;  1HJP A;  3JC6 6;  5GAE C;  1HNX Q;  4DV4 L;  1PYS B;  4QJF A;  2NN6 I;  5BR8 L;  1IBK L;  4YCV A;  4JCV E;  2UU9 Q;  2VUM H;  1VS0 A;  1TXY A;  4JI1 Q;  5M3F G;  1D7Q A;  1FJG L;  2ASB A;  2WAQ E;  4PG3 A;  1P8L A;  2JK8 A;  3PO2 G;  4A3M H;  2VW9 A;  3CF5 A;  3AEV A;  1BBW A;  4DR5 L;  3HOX G;  4GNX A;  3PV0 A;  1QZH A;  4LF5 L;  1RL2 A;  3OYY A;  3NEL A;  3HOV H;  3CD6 A;  4BXX G;  4IFD I;  1HR0 Q;  4R4O A;  4XIG S;  1VQ8 A;  4O2D A;  4IJL A;  3CCU A;  1J6Q A;  4DV2 L;  3KF8 B;  4OON A;  4A3F G;  5LMU L;  5C4X H;  2ES2 A;  4DR5 Q;  1X55 A;  1PHJ A;  2BH2 A;  1TWC H;  3H15 A;  4TQU S;  1IL2 A;  5AJ3 L;  4X65 Q;  2BA0 A;  2QGQ A;  2Y0S E;  2A8V A;  4H02 A;  4B3M Q;  3I55 A;  1X6O A;  4JBK A;  4DR2 L;  2PI2 E;  4JI4 Q;  3NEN A;  1NMF A;  2C35 B;  1W2B A;  4DR6 Q;  4GN4 B;  1TWH H;  1S40 A;  1HH2 P;  2OCE A;  1A8V A;  4IPD A;  1A0I A;  4OO1 G;  1C9O A;  1NE3 A;  1Q46 A;  4JBW A;  4OXP A;  1UE5 A;  4YHH L;  4DR1 Q;  1N34 L;  2LXJ A;  2ZM6 Q;  2JE6 I;  3CPW A;  1OTC A;  3PF4 A;  4DR6 L;  4KHP L;  1AH9 A;  3M3Y H;  4DAM A;  2OWO A;  4B3T Q;  2ZTC A;  1GO3 E;  3M7N A;  4AQY Q;  2R93 G;  2B29 A;  2LXK A;  3K0X A;  1YBY A;  3RN5 A;  1KXL A;  1Q1E A;  2K50 A;  3HOZ G;  1VQ4 A;  1JT8 A;  2CFM A;  2N78 A;  4A3B H;  1E1T A;  2KHJ A;  3BU2 A;  2HHH L;  4BY1 H;  1QUQ A;  3PO3 G;  2UXD L;  2VS1 A;  4JI3 L;  3U50 C;  1V9P A;  3S1Q H;  1VQH A;  1EQQ A;  3RLF A;  4B3R L;  2PI2 A;  4R4Q A;  4JI2 Q;  3CCV A;  4DV3 Q;  3GTQ H;  2Z6K C;  5IWA Q;  4DV2 Q;  1A63 A;  1CSQ A;  1UE6 A;  1MKH A;  4DR4 L;  2E8G A;  2IX0 A;  3KYH C;  3CCS A;  1KL9 A;  1Q82 C;  3M9B A;  1VQN A;  3KJP A;  1E22 A;  3KF6 B;  1SE8 A;  5IP7 H;  2UXD Q;  2L15 A;  4AIM A;  3S15 H;  2VQE L;  3KLW A;  2JQO A;  5C0X J;  1KRS A;  1VQA A;  2ZTE A;  3Q8D A;  4LFC Q;  4K0K L;  2AWN A;  1FJG Q;  1I5F A;  1Z47 A;  4ALP A;  1QVC A;  1QVF A;  1CKO A;  1AE3 A;  4RG1 A;  3AFP A;  3HKZ E;  3M4O H;  2VL6 A;  3CC2 A;  1FGU A;  3GTL H;  2HIV A;  5M5Y H;  4LUO A;  2VQE Q;  5FLM H;  1E24 A;  2AHO B;  4GN5 A;  2YTX A;  1EQR A;  4PMW A;  1N33 L;  3S2H H;  3HOW G;  3HOV G;  3AQQ A;  5JEA J;  1Q8K A;  2VZA A;  3FKI G;  2E2I H;  3S1N H;  1Y1V H;  4KI0 A;  4NXM L;  3I4N H;  2VQF Q;  2WB1 G;  3RNU A;  5M5W H;  1X3F A;  1NY4 A;  3ERS X;  4UP9 A;  4GN3 B;  4LFC L;  3W5O A;  4LF5 Q;  1CUK A;  1HNZ L;  4YCU A;  3DLL A;  2KCT A;  2YTY A;  1XMO L;  2OQK A;  1VQL A;  2HHH Q;  1X65 A;  1YJW A;  3TEH B;  4QY7 A;  1I50 H;  3E9I A;  5LMU Q;  2ZJQ A;  3I4O A;  4NPS A;  4XTC S;  5IP9 H;  3OTO Q;  3UDG A;  1X56 A;  4LF6 Q;  4A3J H;  1EOV A;  3PUZ A;  4KLK A;  4IOA A;  4B3T L;  5C44 G;  3J80 c;  1OXX K;  5C4J H;  4B3S L;  1P16 A;  2K75 A;  2JEA I;  1PVO A;  1PYB A;  5IYD H;  3HFZ B;  4BBR G;  4X6A H;  4GNX B;  4FDB A;  1X9N A;  2I5L X;  3EN2 A;  2NVY H;  3CCQ A;  4JI5 L;  3MEF A;  3NEM A;  4DV5 Q;  1PH8 A;  2ALY B;  1I94 L;  2VQF L;  1EIF A;  4LUZ A;  1VQ9 A;  3A5Z B;  2NVX H;  1LYL A;  4DV5 L;  4OWX B;  3IRB A;  2ZM6 L;  4J15 A;  1C0A A;  1PH1 A;  1N36 Q;  1EIY B;  2RHS B;  1XTD A;  3GDE A;  3HOY H;  5FJ8 H;  1BKB A;  1VQC A;  4DPG A;  4OWW B;  1PFS A;  3LGJ A;  2GN5 A;  1T9H A;  4JI4 L;  4LF9 Q;  4EQ5 A;  1M1K C;  4R4T A;  2AKW B;  1EWI A;  2CKZ B;  2R7Z H;  3UDF A;  3STB D;  3RLO A;  4YY3 Q;  4JBJ A;  2UXB Q;  4JI8 Q;  2QA4 A;  4GNX C;  3UDX A;  4A3C H;  1VQG A;  3K7A H;  1UE7 A;  4UP7 A;  2UUC Q;  4L5R C;  2I5H A;  4Y7N H;  3T1H Q;  3EBE A;  4NXM Q;  2UUB L;  2JA9 A;  4HJA A;  3PIP A;  3ULL A;  3CAM A;  3U4V A;  2EIF A;  4BBS H;  2ATW A;  4R4C A;  4YWL A;  4YHH Q;  5GAG C;  3J81 j;  4X64 L;  1N36 L;  2IHE A;  1YEZ A;  4DR7 Q;  2E5L Q;  3E0E A;  3HOW H;  3A74 A;  1EUJ A;  4JI1 L;  1GD7 A;  1C7Y A;  1K9M C;  1VQ5 A;  2PMZ E;  4POG A;  3I4N G;  3CC7 A;  3CCE A;  2HIX A;  3RZD H;  4JI7 L;  5GRO A;  3NBH B;  4AYB G;  3H3V I;  4NXN L;  4GKK L;  1OXU A;  3L7Z C;  5IY0 A;  5IT9 c;  2E2H H;  4A3E G;  2UUA Q;  3K81 C;  4B3S Q;  2JA5 G;  3CW2 C;  1WCM H;  1K8G A;  4LF7 Q;  4YCW A;  2B63 H;  2A19 A;  3L0O A;  1SR3 A;  2UUB Q;  1IBM L;  4DUY Q;  1BVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...