4RAYA

Crystal structure of magnetospirillum gryphiswaldense msr-1 apo-fur
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
136
structure length
135
Chain Sequence
GHMVSRIEQRCIDKGMKMTDQRRVIAQVLSDSAHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
total genus 44
structure length 135
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rayA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rayA02
2D45A 5J6XA 5HLIA 2IVMA 4EJUA 4EQQA 2HQNA 3GFLA 3B73A 2HYGD 2HTJA 2K4BA 1EH7A 2DT5A 4HBLA 1SD5A 3QPHA 5ED4A 3CO7C 3KLNA 3GO5A 5FGMA 2DPDA 2E7WA 1Z7UA 4HV5A 2R7DA 2M45A 2QLZA 2FMLA 1BJAA 3WTVC 3P9CA 2YPRA 1LB2A 3QAHA 1KU7A 1FSEA 1OYYA 2IA2A 3QRFF 4EV0A 3MWMA 1LEBA 2NAZA 4KIBA 5LRSA 3R6SA 2Q0OA 3BOQA 1HXDA 4CDGA 1IW7F 1DP7P 3RJPA 4D0PA 3K69A 2VE9A 2A6HF 1TNSA 3I0TA 2C6YA 2RGVA 2L54A 2O3FA 3JSOA 4O3MA 3H92A 4ON0A 1FY7A 3GVAA 2P8TA 3HOSA 1ON2A 4YG2F 4ASNA 4ZYEA 1G3WA 4BHCA 5E1WA 4M9ZA 2Q8KA 2O61A 2UXXA 3NQOA 4CXFA 3SFZA 4R1HA 2EJRA 1P6RA 4ESJA 3K1MA 2XVCA 3M1EA 4Z2YA 1ZYRF 3E97A 2ADUA 3FF5A 1W7PA 4CO8A 1FP1D 1P2FA 2E7XA 4ZZDA 2YR2A 3BP8A 3EYYA 1U6GA 2MLGA 1OYWA 2VC1A 3KFWX 2FNAA 1R5HA 3FMSA 1XMKA 1PP7U 1YLFA 2A3SA 4B8XA 2HEOA 5LGNA 2YU3A 1U5TB 1FYKA 1YS6A 3HTSB 3BPVA 4EJVA 2DW4A 1HKSA 3FZVA 1LVAA 1B9NA 2FA5A 1B9MA 3IWFA 3M8FA 4WX9A 3V8JA 1USTA 4HZFA 4P96A 1H9GA 2O8XA 4M9SA 4BH9A 2BE5F 4A5NA 3GWZA 4M72A 4MGRA 1HW5A 2TDXA 2A61A 2EWNA 5F64A 3O6BB 3T8RA 4IF4A 1OYIA 3DFGA 3TO6A 3REOA 4LK1F 2RKHA 1K7AA 2QYOA 1KU2A 5JFRA 4OINF 2CFXA 2QBYB 1BOAA 5CLSA 1HSJA 5DD4A 1I5ZA 4IPAA 1G3TA 2W84A 1Z6TA 3F21A 2FE3A 4A6EA 5D5WB 4OOIA 4LD5A 1FT9A 4LLNA 5TJJA 1S7AA 4A12A 1TW3A 2ZFWA 4WXHA 4XBFA 4MQVA 4ESFA 3MCZA 5E8IA 3WE2A 4B09A 3GF2A 2JTVA 1IUYA 1ZG1A 4UV9A 4L9JA 2OA4A 4GGGA 2VOOA 4A2UA 3U9GA 5AIQA 1ZARA 2YX7A 1Q1HA 2QVOA 2ESHA 5FD5A 4MNUA 2IPQX 2FMYA 4UV8A 1QZZA 1O3TA 3HTUA 3P9KA 2A07F 3SQNA 1WRJA 4BAYA 1D5VA 4IXAA 5JI6A 3T1BA 1W5SA 2R3SA 3VB2A 3Q5FA 4RGXA 4OIRF 2Q2EA 1HBXG 2QQ9A 3KZZA 3ABTA 2EFPA 1SD6A 3HUGA 3J81K 4RB0A 1JHFA 3WTZA 2PFBA 2CYYA 5ICGA 4OIQF 3V8KA 2JRTA 1F5TA 2KJBA 1J59A 1BI2A 3IRQA 3F72A 1XDSA 2F5DA 1BIAA 5AIPA 1MZBA 4RB3C 4UVBA 3HOTA 1Z9CA 4HOBA 4XLPF 3ZP5A 1ZRDA 2XUBA 4WCGA 5BS6A 4KN7X 5IT9Z 3RKWA 1RUOA 2P5LC 3HRTA 1S8NA 1KQ0A 1IN4A 5D6EA 1IN8A 1YQAA 4KNYA 3TKYA 4YFXF 2P6TA 4L5IA 4L0YB 3DXJF 3BJOA 3KP2A 4I2OA 4HYEA 2FBHA 4N9IA 3JTHA 2STWA 2VE8A 4GO1A 4EJWA 3TOBA 2F5EA 4ENKA 1XB4A 2W25A 3P9IA 2NYXA 5ICCA 4YIIA 2OQGA 4M9XA 4U0WA 4WXCA 3BJ6A 3WODF 5FFXA 4BHBA 1TLHB 3HRSA 4IHSA 2Z99A 2L4AA 2YX4A 3E5UA 1RI7A 2PMHA 1HW2A 3IC7A 4RS8A 1DPRA 5LEJA 3I59A 1R00A 1WI9A 1XGOA 3QPTA 1KQ9A 1TBXA 4KIGA 4BHPA 2W85A 3JSPA 1H0MA 1SFUA 4UUVA 3FM5A 2CWEA 2QM3A 5L3DA 1VTNC 3JAMK 4RAYA 3CJNA 1QPMA 5H6QA 1YO5C 3I54A 5DCMA 5BQTA 4G7ZF 2UXNA 4G6DA 2ETHA 5L3CA 5HLGA 3I4PA 5E8GA 2MC3A 3C1DA 3QU3A 3J80Z 3T8TA 2MBFA 1TQIA 5HDNA 5BOXA 4TV7A 4KDPA 2HQRA 4KIFA 3IHUA 2LKPA 3NRVA 1ZGAA 2Y48A 3DQVC 4HF0A 3GX4X 3QP6A 1UB9A 1MJ9A 3IKTA 1PDNC 3ERED 1YW7A 2ZJ2A 4R8HA 2GA1A 4HF1A 4Y13A 1W7PB 3E5XA 1PUEE 3IRRA 4A0XA 4E70A 3PQJA 3G73A 3LAPA 2V6CA 1MDMA 1ZLKA 1I27A 4MQ9F 1B59A 4RGUA 3KP4A 4LLGF 4KYWA 4L0ZB 2VXZA 2KIUA 1HQCA 5E1ZB 1FOKA 2DAOA 3H3UA 3LA7A 5E20A 4XLNF 2XKPA 3ZMVA 1V4RA 4P9FA 3R0JA 2VT2A 2LDUA 5FFZA 3QU6A 2M30A 2STTA 5LHHA 3WE3A 1J75A 2Z5UA 3MFKA 2QQBA 4G9YA 2Y75A 4ZYDA 1YG2A 2HKOA 2VODA 1YYVA 4G94A 1BC8C 2HR3A 3M9AA 3WTSC 3ISPA 4Q4ZF 1EH6A 3FHZA 3WGIA 2OAZA 3U2RA 2CO5A 4RB2C 2RQPA 3CUOA 2XAJA 4H0EA 4FX4A 3F8NA 2GZWA 3VODA 1U5TC 2RVCA 5ILVA 4Y17A 5CVRA 3VEPA 4I02A 2Z3YA 3M8EA 1WSUA 3WTWC 1FC3A 1ZAOA 1X3UA 4JBAA 3LFKA 3ECHA 5CVVA 1KYZA 4UVCA 3HYIA 3D0SA 4RGRA 1U3EM 4ENMA 2EFOA 2NRAC 1RZ4A 2HS5A 4HAMA 1LDKB 5BMZA 2RDPA 2F2EA 1J0RA 2P6SA 1ZHFA 3PFIA 2GXGA 2K86A 2LSOA 3N4MA 1IXSB 1B6AA 1FPQA 4M74A 1SD7A 2XRNA 4F7ZA 4NB5A 3E5QA 2VT3A 1XMAA 5L3FA 1REPC 2Z9OA 2O6GE 2EFWA 3S2WA 3L7WA 1KQ8A 2LF7A 3CDHA 1S6LA 4HV6A 1D3YA 3KP6A 5D4RA 3I64A 3FMQA 2YSRA 3F3XA 2V9VA 3RYPA 4LLLA 5LEKA 4Y15A 3EDPA 1J7KA 4AWXB 4IRIA 1XSXA 2A5YB 3K2ZA 3ABUA 5LGTA 4IVNA 4ETSA 4RAZA 3I71A 1XCVA 2ZCWA 1ZREA 5DD8A 4PGHA 3LWFA 1PP8F 3R60A 4G7OF 1W4MA 2KIMA 5FD6A 3I59B 5A2QK 1JXSA 2CG4A 1Y0UA 5HS7A 3RYRA 2CGPA 4GCVA 2V79A 4Q48A 4N9HA 4LJZF 1Z1DA 1ONVA 3GFJA 5TRDA 3WTUC 2HGCA 2Z33A 4WK8F 1ZRFA 2JT1A 5ERIA 1MGTA 3JW4A 4HDUA 2A6EF 2GWRA 3J81Z 4CZZA 1T98A 1FWZA 2WV0A 5DCMB 2VBXA 1P4XA 2FSWA 2AS5F 3F22A 3GZ6A 3ZMSA 5F1RA 2F5FA 2QWWA 4MTEA 4A0ZA 1EV7A 2H6CA 3EUHA 1BI3A 1MJBA 2B0LA 3HSEA 3GLXA 4A0YA 5DUIA 1STZA 3DF8A 4RGSA 2E1CA 1K78A 2PG4A 3CO6C 1IN5A 1G6NA 1JGSA 2L4MA 4LFUA 4HLYA 1XGNA 3KP7A 2HWVA 3V8LA 2OU2A 3O3KA 1BI0A 2EK5A 2L3DA 5AONA 2ZXJA 3MQ0A 1YTYA 2EFNA 4EVIA 4L9NA 2FNPA 5CYVA 3F6VA 1XDUA 4CHUA 1MDMB 4UHTA 1FBUA 1SMTA 2BGCA 1MD0A 4ZYHA 1CF7A 1O3SA 2DO7A 4BNCA 3L2CA 1E2XA 3EETA 5FO5A 1TQPA 4GYIA 1F1ZA 5HVQC 2XAHA 2QZ8A 3FXRA 3WGHA 5HS9A 1S3JA 2XIGA 4HX4A 1YFHA 3PQKA 1XSVA 4S04A 2J5OA 2PN6A 2IW5A 3KP5A 4P5OA 4HLXA 3RKXA 2BBYA 1RUNA 1LEAA 1G3YA 1C0WA 3FXQA 2QQAA 3JAMZ 3ZMUA 4JK1X 3CLOA 4AD9A 4HA8A 4OMZA 1R1UA 2PQ8A 3V7SA 2IRFG 2H27A 2FBIA 3HSRA 5CJ9A 4UVAA 4AIJA 4NHJA 2DLLA 2E1NA 3TQNA 1K79A 5J8CA 2DI3A 1ZN2A 2MH2A 2LF8A 4JQFA 2GXBA 3W6KB 2RV8A 4LG0A 2ACJA 2MLKA 3QOPA 3TDUC 3K0LA 2X0LA 1SFXA 3SZTA 2K02A 4GXOA 4AIKA 3VFZA 4PCQA 2XV4S 3KZYA 2GQQA 2JPCA 3KEOA 1QQIA 3IL2A 1Z91A 2HDCA 2ZKZA 3I53A 4A5MA 3B02A 1J9IA 4IHTA 5FB2A 2H94A 3WU0A 5L3BA 5BPDA 2LNBA 1ZG3A 4WXDA 3TDZC 1BIBA 3FWEA 5CVUA 1IN6A 1R7JA 3NEUA 3E6DA 1G3SA 2F5CA 2XAGA 2XGXA 1BM9A 4UNOA 3ROUA 5FLXK 2M1BA 1ULYA 5HS8A 3H3ZA 3CUQC 1ZGJA 4EGZA 3F8BA 1FZPB 2DFIA 4L18B 3COAC 1WQ2A 3KP3A 5D5UB 5E1XA 2HFHA 3ZMZA 4EM0B 4O5VA 2J5PA 2XASA 3ZPLA 3KCCA 3HHGA 3HHHA 1MJAA 1IF1A 4G6QA 5LRRA 1L0OC 2EV6A 2ZNZA 3TO7A 2UZKA 5KVRA 1BBYA 2O0YA 5ILUA 4HDVA 1R1TA 1FSHA 1FLIA 5EEGA 3FM3A 2L01A 4CYDA 1QNTA 2GA2A 1FX7A 3KLOA 1KU3A 3WTYC 2HZTA 1GHCA 2KKOA 2W57A 3SZPA 1GXQA 1O57A 4IRGA 3DV8A 3RIRA 4BYYA 1DDNA 3LSTA 1J2XA 3I5UA 5CVIA 3AAFA 3WTTC 3BDDA 4M6YA 3E3VA 2KRFA 3W6JB 1XN7A 1T39A 2DK8A 2Y0MA 3DKWA 4M73A 3V7CA 2ZMEA 4PZJA 2OZ6A 2NNYA 3GW2A 2WC2A 3M7GA 2HTSA 3GEZA 3K1PA 3RKYA 2VBYA 1KYWA 5K5OA 4EM2A 5D4SA 1SD4A 3FXUA 5D5VB 1K78B 4Q47A 4EM1A 3MEXA 1HKTA 5HDGA 1R22A 1K6OA 2EFQA 1T6SA 1QO0D 1Z05A 1KU9A 2OZUA 1QZYA 2BEOA 2PEXA 5EEHA 3TGNA 2CQKA 5LLQA 1USSA 5IT3A 2D1VA 3QP5A 4NQWA 3C18A 3F8CA 1CF7B 3C3WA 2A68F 2XHKA 2COMA 1IRGA 4I01A 2FU4A 4EJOA 2VBWA 3KE2A 4CICA 1IZ1A 4BXUA 1SAXA 2EB7A 2O03A 3EYIA 4LB6B 2VOPA 2M87A 4GYGA 4O6JA 5A2QZ 1DPUA 2MA3A 3R4KA 3C7JA 1E17A 3T0YA 2OBPA 3RPQA 3RDIA 4ENJA 3KEQA 1OKRA 2JPBA 5BPIA 1S29A 2ISZA 3HRUA 1RNLA 5LGUA 1WWXA 2P5KA 1IAWA 4N0BA 2FF4A 3HSFA 1ZG5A 2ZBKA 4HQEA 4AVPA 4ZH4F 2K7LA 4U0YA 2NNNA 3F8FA 3VOEA 3CTAA 4G7HF 3L00A 4FT8A 3OOPA 1BI1A 1HSTA 2FQ3A 3WTXC 3BWGA 3WGGA 1XCBA 2PBIA 2FEZA 4LG0B 1B1BA 2IP2A 3D5LA 1JHHA 3ZQ7A 4EGYA 2GAUA 2H6BA 1LNWA 1FNNA 1P4WA 2K27A 2RC4A 4HQMA 2D2WA 4EJTA 3SHFA 1TTYA 5JHUA 1HW1A 1O3QA 2IA1A 1NHAA 3GYHX 1QBJA 1I1GA 4KN4X 4P55A 3ULQB 3ZMDA 2BV6A 4M71A 1XSDA 1OPCA 1SMYF 1LDDA 2ESNA 4KMUX 4AIHA 2PJPA 2JSCA 4XRFA 1P4AA 1FYLA 3ZMTA 4XSXF 4ESBA 5CVJA 2R7FA 5F6FA 4I0AA 1OR7A 1O7FA 3ZN0A 1FBSA 3E6BA 2XAFA 1IXRC 3WU1B 2P7CB 2RN7A 2ZNYA 5L3EA 5LHIA 4I98B 1IXCA 5D8LB 3DP7A 5E18F 4UXNA 1ON1A 2MD5A 3GFIA 3EQLF 3SXYA 1UHWA 3LA2A 3JTGA 4HF2A 2PLYA 3GFMA 2HKXA 1JE8A 5DDGA 2DQLA 5JVTA 2HOEA 1R23A 3LQRA 3ML6A 4KA4A 4OIPF 3CUQA 5DV5A 5K5RA 4RB1A 1WKMA 1UFMA 5DYMA 3F23A 4KICA 4KMFA 3TO9A 2VC0A 1R5GA 1FP2A 5DEQA 5K1YA 4QLCU 4U7DA 1ZRCA 2FOKA 3BPXA 1RIOH 4U0VA 3Q9SA 3ELKA 1SFEA 1TQMA 3L9FA 3OV8A 5E17F 1Z6RA 1QGPA 5LBQA 4KUMA 2QENA 1S7OA 3K9TA 4ZYGA 2EA2A 1T2KA 2DPUA 1AWCA 2ZMEB 1F9NA 4YIFA 5D5XB 4OMYA 2P5VA 2CSOA 4BQAA 4A6DA 5FLXZ 4U88A 3RPUA 2L02A 5JR3A 2DTRA 4XSZF 5DCFA 3DPTA 2G9WA 3LQQA 5L3GA 4ZZLA 3MAJA 2OQRA 2PI0A 5HLHA 1O7LA 3BY6A 1O3RA 3MZHA 5ILSA 4L9VA 1YW8A 3I58A 1GVJA 1FYMA 4LK0F 3U1DA 3R61A 5HOOA 5HDKA 3V4GA 4LB5A 4I7HA 2K4JA 1ODDA 4OIOF 3ECOA 2FBKA 4HW0A 1D8KA 2X4HA 4I09A 2XROA 4ENNA 4L5JA 2FRHA 3K1NA 3FX3A 1CGPA 3TOAA 4KT5C 3E6MA 5J8FA 2DK5A 2VBZA 3E6CC 3LA3A 1R1VA 3G3ZA 1U5TA 1DUXC 4YFKF 5KK1A 2HYFA 2G7HA 1YIOA 1I1SA 4LGWA 1IRFA 1F4KA 2IT0A 2MH9A 1R36A 4EMSA 4HX8A 2G7UA 4G8XA 1LJ9A 1D8JA 1W7PD 4MTDA 1U8RA 1LDJA 2WTEA 1BC7C 2KIFA 2M8EA 1IN7A 3F6OA 4P9UA 1XGMA 3LAJA 4PDKA 2AXLA 1MKMA 2M5WA 2VONA 2ISYA 3R0AA 5IT9K 1U2WA 1XGSA 2EV5A 2H09A 3MZYA 4QWQA 2QBYA 2V1DA 1YS7A 3J7AO 3KETA 3GUDA 4MEYF 5H6RA 2DU9A 3HRMA 3V7RA 1J5YA 3N97A 1R58A 1H9TA 4IRHA 2D1HA 2WWYA 1T0FA 4PGGA 1TNTA 2EA4A 4WF2A 4DNCA 1UCRA 2ZO4A 1P92A 1HKQA 4IJAA 4S05A 3T5XA 1L3LA 4I0BA 2QUFA 3O2PE 1B4AA 1TW2A 1XD7A 2DQRA 2P4WA 2OD5A 3GZ5A 3GXOA 5D8KB 3RI4A 4MEXF 2IJLA 6PAXA 3Q9VA 1YW9A 3BZ6A 2V1UA 4Q5SF 1UHMA 2ELHA 1GXPA 4KFCA 2XAQA 4LMYA 2NS0A 3DPLC 1T38A 2JZYA 2V1XA 2A69F 2DBBA 3P7NA 5DUKA 3BROA 4M6XA 2CW0F 1ZH5A 2PMUA 3IWZA 4U7BA 5K5QA 1OMIA 2EV0A 2P7VB 5H20A 5D6FA 2VN2A 2UWMA 3F8MA 1I6XA 2BYVE 2W24A 1V3FA 2XKOA 4WWCA 3WG9A 5ICFA 1AOYA 3J80K 4OU0A 4DQ2A 5LHGA 3BJAA 1ZLJA 1G4DA 1KGSA 3FMRA 4R79A 2IA0A 4K2EA 2KJCA 4FHTA 1KA8A 4FX0A 3ZN1A 2RNJA 3DEUA 2GIVA 3CUQB 1U78A 1A04A 2FXAA 3RTRA 3HIFA 4L9TA 1BN5A 4YFNF 1LQ1A 4HX7A 3L09A 3IKVA 1EH8A 5ICEA 4MHGA 1W5TA 4CGZA 1FBQA
chains in the Genus database with same CATH superfamily
5F9NA 4AYBA 2D45A 2VPQA 5HV6A 5J6XA 3K70D 2IEKA 3JSNA 5HLIA 2IVMA 4EJUA 4EQQA 2HQNA 4B3AA 1ZR2A 3GTKJ 4LH6A 3GFLA 5GADJ 4FCYA 4B47A 2L5QA 3H0DA 1ZETA 3B73A 2H8RA 2HOTA 3S17J 3EPZA 2HYGD 4F4WA 2HTJA 2K4BA 3FBNB 3GIIA 4XOTA 1EH7A 2NU9B 2DT5A 4HBLA 2H8WA 3IH3A 1QHGA 1SD5A 5J2TF 4IQJA 4JUZA 3QPHA 3OYAA 5ED4A 3CO7C 3KLNA 1YE9A 4Q0YA 5KFCA 2C35B 1VNDA 4IWYA 4UCTA 3ETHA 3HOXJ 3M9MB 4OAZA 3GO5A 5FGMA 2DPDA 2WDTA 4PDBA 2BW3A 2R92G 2E7WA 2J6TA 2OH2A 1Z7UA 4XOPA 4HV5A 4GC7A 2R7DA 1K1SA 4P1WA 3A1YA 5KFOA 4IHVA 1Z7LA 2M45A 2QLZA 5L1KA 2FMLA 1BJAA 3WTVC 5B66C 1ETKA 4BGDA 5DM6F 4ZDPA 5FPRA 3K4JA 5KFNA 2L7ZA 3P9CA 5J1YA 1SEUA 2V7FA 2AQ4A 1VAJA 2YPRA 1GUUA 2VL8A 2WYOA 4DL3A 4D5CA 1Z3XA 1LB2A 4DUYH 3OS2A 4C3JJ 4I76A 4JI7H 1X1PA 4EATA 1FJGH 1CQTA 2NOJB 3QAHA 4RM3A 3PZPA 4DIQA 1KU7A 1IBMH 4B3RH 1FSEA 1OYYA 3H36A 3K4BA 4RZQA 2NVXA 2IA2A 3QRFF 1A0IA 4EV0A 3MWMA 1X1AA 1LEBA 1N78A 3JRGA 3DBLB 3M9NB 2NAZA 2XPWA 5IP9J 1BR4A 4KIBA 3S1MJ 4IHYA 1MW7A 5LRSA 3R6SA 2Q0OA 3BOQA 1HXDA 2VPSA 4CDGA 2LREA 1UJ8A 1JDEA 3RB6A 1IW7F 5DLFA 1DP7P 3RJPA 4D0PA 2CQYA 1LKXA 4BACA 2RDIA 5LOVF 3HOWG 3K69A 2R93G 2VE9A 2A6HF 2HGSA 1TNSA 3BZKA 3I0TA 5EG0B 2C6YA 2RGVA 1B04A 2Z1DA 2L54A 2O3FA 4HG2A 3HKZE 4D7NA 5K7HA 4BY1J 3JSOA 4O3MA 3H92A 4ON0A 1FY7A 1IV8A 3GVAA 3BG5A 4NNJA 1AA7A 2P8TA 4E4HA 5C1PA 1I39A 2VLAA 3I4NG 1TA8A 3HOSA 4A3DJ 1ON2A 2W1OA 2VUMG 4YG2F 3F9KA 4ASNA 4IQ4A 4ZYEA 1G3WA 5KFDA 4MIMA 1O75A 4YAKB 4BHCA 5E1WA 4M9ZA 2Q8KA 1POGA 3BR5A 2O61A 1JI8A 2UUCH 3VYRB 5K7ZA 2UXXA 3NQOA 5FKLA 4CXFA 3CMEI 1TP4A 3ZQCA 5DS9A 2IS4A 3SFZA 4R1HA 1QHHD 2EJRA 1P6RA 4QPOA 4XL9A 4ESJA 3K1MA 2R7WA 2XVCA 3M1EA 5CAEB 5A2QW 1KJ9A 3PR5B 1LUJB 4Z2YA 2E5ZA 2Y9ZA 4O4HF 1ZYRF 3E97A 2ADUA 3FF5A 2XC9A 1W7PA 2WBMA 4NUBA 1N25A 4CO8A 3PO3J 2YZGA 4FE7A 4HPQA 2L7FP 1FP1D 1P2FA 2E7XA 4AU7A 2HOSA 4ZZDA 2WAQE 2YR2A 3BP8A 4XZ3B 1OWTA 3OYLA 3EYYA 3K2AA 3GTKA 2HPMA 1U6GA 2RREA 2MLGA 1C3OA 1OYWA 4EBEA 3FBIB 2VC1A 3KFWX 3CC7I 4C30A 4KITB 2FNAA 4LF4H 1R5HA 3BZCA 3FMSA 1XMKA 3QZ8A 1PP7U 1YLFA 2A3SA 4B8XA 9ANTA 2HEOA 3NWTA 5LGNA 5D8DA 2KZVA 4E7JA 2ATLA 2YU3A 4B4CA 1U5TB 4RM2A 1FYKA 1YS6A 5KFEA 5C4XJ 3HTSB 3BPVA 4EJVA 2DW4A 1HKSA 3FZVA 1G59A 3OMYA 2YRXA 1LVAA 1B9NA 4D5FA 2W6QA 2R7ZJ 5C5JA 1R9TJ 2VKVA 5KFBA 4E7HA 2FA5A 2DOFA 1B9MA 2KIQA 5E3MA 4I99C 3IWFA 3M8FA 4PJNA 4WX9A 1IBKH 2UVVA 3V8JA 1USTA 4HZFA 1HNWH 4DW6A 4P96A 1H9GA 2O8XA 3IH4A 4M9SA 2UXCH 5I47A 5K7FA 4BH9A 4YJ3F 2BE5F 4A5NA 4DZPA 2E71A 3GWZA 1DV2A 3K10A 4M72A 4MGRA 1AKHB 1HW5A 2TDXA 2A61A 2EWNA 5KT6A 3KYLA 4NXMH 4UFZA 3J7AK 5F64A 4CH7A 3O6BB 2CMPA 3T8RA 4BBRJ 3B6AA 3FXLA 4CZCA 2L7MP 5C1OA 2E5LH 3OYBA 4IF4A 1OYIA 2KRHA 3DFGA 3E7LA 1OJLA 3TO6A 2LKXA 5KT2A 2QYZA 3CCMI 4MFDA 3REOA 3FMAA 2W70A 2VUGA 5LP6F 2FLLA 2O8KA 3G6VA 4LK1F 5IYDJ 2RKHA 1K7AA 4DBRA 2QYOA 1KU2A 5JFRA 2ZSIB 2JJ7A 4OINF 2CFXA 2XAUA 2ZJPF 1BOAA 2QBYB 5CLSA 1KZHA 2DIKA 5DG9A 1HSJA 5DD4A 3PN1A 1I5ZA 4IPAA 3CQZJ 3OYHA 4RNOA 1G3TA 1R4NB 3L2VA 2W84A 3ZQGA 2JSPA 2R0QC 1IUFA 1Z6TA 2FE3A 4A6EA 3F21A 3LFUA 4DBQA 3G1MA 1W0TA 1W0UA 1SCUB 4PFPA 2DCEA 5D5WB 2YCHA 1F36A 4OOIA 4LD5A 2W4SA 1FT9A 4LLNA 1T56A 2V58A 4XRSG 5KFGA 5TJJA 3BABA 1S7AA 2UXDH 2K5CA 2LFBA 2WB1N 4A12A 4IOCF 1TW3A 4PJJA 2ZFWA 3N05A 3UFXB 4WXHA 3VMMA 4XBFA 4MQVA 3LSRA 3CCLI 4ESFA 2NU8B 3OYKA 3KPHA 3MCZA 3IAS2 5E8IA 5C44G 3WE2A 4B09A 3M1CA 2ME6A 1I7LA 2JA5J 3GF2A 4MV4A 2ZDGA 2VJ5A 4ED6A 2R8JA 4C5AA 4A2AA 1A6IA 2DA7A 4YRVA 3D5RC 2I10A 2JTVA 2R5ZB 5EEAA 1XS9A 1IUYA 4JI1H 1N32H 2M9HA 1ZG1A 4II3A 2V5AA 3HL2A 4UV9A 4L9JA 2L9SA 2OA4A 4AM3A 2QKLB 3BR3A 4GGGA 1I3QA 2VOOA 3GIJA 1OCPA 4A2UA 1FOWA 3U9GA 5AIQA 1ZARA 2YX7A 4YP3A 2E1MC 4DV7H 1HR0H 1Q1HA 2ELJA 2QVOA 2ESHA 5FD5A 2LTPA 4MNUA 5JVLA 2JA2A 2IPQX 5C3EG 1LE8B 2FMYA 1MSEC 3LSIA 3GTPA 1Z21A 4F52A 4BE1A 3L2QA 5KG7A 1QA6A 4UV8A 1QZZA 1MBEA 2VJIA 1O3TA 4A3LG 3HTUA 5GPAA 3P9KA 2A07F 5KFXA 3SQNA 1WRJA 4M3GA 1E4EA 4BAYA 1E0EA 1D5VA 2P0WA 4IXAA 3ORQA 3C2BA 3ABKH 5JI6A 4ECWA 3GIQA 3T1BA 1W5SA 2FX0A 1JKPC 2R3SA 3VB2A 1VQ8I 1VBGA 3Q5FA 4RGXA 2C00A 4JV2A 3W3CA 4OIRF 3FXJA 2Q2EA 5KT3A 1HBXG 2QQ9A 3NWSA 4DR3H 2CQ7A 4DV5H 3KZZA 1VBHA 2R7ZA 3ABTA 1R9TA 2EFPA 1VQ7I 1W36C 1MSFC 3GBGA 1SD6A 2EIKH 3HUGA 2QSGX 2KFDA 3J81K 1RJRA 4RB0A 1JHFA 3CMMA 2M4KA 4LOCA 2DA6A 3BTLA 3WTZA 2GLOA 1CQIB 4CA0A 2X85A 2PFBA 2CYYA 5ICGA 4OIQF 3V8KA 2JRTA 1F5TA 4BQQA 2KJBA 4BL0B 4BS9A 1BI2A 3P5JA 3IRQA 3F72A 4DYRA 1J59A 1XDSA 1Z77A 4EFEA 3VYUB 2F5DA 1BIAA 2JVGA 3LOCA 2CJJA 5AIPA 5M5WJ 1MZBA 2CW8A 3I4MJ 1IOWA 1ENHA 4Q44A 2DA4A 4RB3C 2V9WA 5L1IA 4UVBA 3HOTA 1Z9CA 4GDFA 4H4KC 1ZELA 4AYBN 4HOBA 2NVTJ 3PIPF 2NU7B 4XLPF 3S3NA 3K3PA 1YOVB 5CQEA 3ZP5A 1ZRDA 4IWXA 1RJQA 1WJFA 2XUBA 4WCGA 5BS6A 4KN7X 1ZGWA 3RKWA 1RUOA 5IT9Z 2P5LC 1NH3A 3HRTA 1YJWI 3CQZA 1S8NA 1WJCA 1KQ0A 3MWEA 4UCVA 4M7EA 1IN4A 2VKEA 3PJRA 1RK6A 5D6EA 5B5EC 1IN8A 1YQAA 4KNYA 3TKYA 2LY1A 5BNGA 4YFXF 3GIMA 2P6TA 4L5IA 4L0YB 5BPHA 4DR4H 3DXJF 2R84A 3BJOA 2FMAA 3KP2A 4I2OA 4HYEA 2FBHA 3K4CA 2CS3A 5JUMA 3TIIA 1H8AC 1A36A 4N9IA 3JTHA 1JKQC 1Y1WJ 2R8IA 3RBEA 4EEYA 3Q8PB 4A3BG 1WH5A 2DT6A 5IYBJ 2ME0A 3G6EI 2STWA 2VE8A 4GO1A 1P7JA 1OFCX 1VQNI 1XG1A 2XD4A 3H5NA 1AN7A 1ERDA 1WR2A 3OYJA 4EJWA 3OR2C 3TOBA 3AG1H 2F5EA 4U87A 4ENKA 1XB4A 5EF6A 2W25A 4E6KG 3P9IA 3U21A 2NYXA 5ICCA 3MVPA 2R87A 3IG0A 3M8JA 4YEJA 4YIIA 2OQGA 5EDNA 4M9XA 4U0WA 1WPKA 4WXCA 3BJ6A 3WODF 5FFXA 3PW7A 4BHBA 1BJZA 5DQGA 2VI6A 3LSMA 2XCPA 3CP2A 1LFUP 1TLHB 2R7UA 3HRSA 1TWHJ 1D1CA 5KX5F 1IV6A 1OR7C 1W36D 4XKBA 3HGYA 4IHSA 2H1LA 2Z99A 2L4AA 4BDZA 2YX4A 4HSRA 3K6GA 1JGGA 1S10A 3E5UA 1RI7A 1SFKA 2PMHA 1HW2A 1FTZA 3IC7A 3OHBA 4TQRA 4QIWA 2XF7A 1S0OA 4RS8A 3QOEA 2L7KA 3JRWA 1DPRA 5CPRB 3AFHA 2BW3B 5LEJA 3I59A 1R00A 5F08A 1WI9A 3W2WA 1XGOA 2FJ1A 4IL6C 4A3MJ 3QPTA 4JI5H 2BR0A 1XNRH 1KQ9A 4LSXA 1TBXA 4KIGA 4BHPA 2W85A 4E7ZA 2IAIA 2IA6A 3JSPA 2CH0A 5IP7G 3EPGA 1H0MA 5FROA 1WGXA 1Z3YA 1QZEA 1SFUA 4UUVA 2R4GA 3FM5A 4ECUA 2CWEA 2QM3A 5L3DA 4A3GJ 4YBZB 2W00A 1VTNC 3JAMK 1T3NA 4RAYA 3GTOA 2CW7A 3W2VA 3SZGA 4JI8H 3CJNA 1QPMA 4N4NB 4S0HB 5H80A 4A2BA 5H6QA 2NS8A 1YO5C 3I54A 3ZRGA 5DCMA 5BQTA 3CC4I 3OYNA 4G7ZF 2UXNA 3DTEA 5E3OA 4G6DA 1SFOJ 4XLFA 2ETHA 5L3CA 5HLGA 3I56I 3RAXA 2HXIA 3I4PA 5E8GA 2IGKA 3A4CA 4BJ5C 2MC3A 4ECYA 4O3SA 2W8LA 1S7EA 3C1DA 5KT5A 3QU3A 3J80Z 4O3QA 3T8TA 3KYCB 3K4LA 2B63J 3FHNA 5KFUA 3AYHB 5J3LA 2MBFA 3BG6A 4GLXA 3LSPA 4DL7A 1TQIA 3S1NJ 5HDNA 5BOXA 4TV7A 1A6QA 2W7NA 4KDPA 2HQRA 2V1NA 3IAM2 3RFCA 1OCOH 3QQAA 4KIFA 1Y8RB 2DOAA 3GTLJ 3IHUA 4IKFA 5KHDA 2LKPA 4ZQIA 5F0HA 3NRVA 5B1BH 1ZGAA 2Y48A 3DQVC 4HF0A 3JR9A 3GX4X 4DR5H 4A3JG 3QP6A 4E7LA 1UB9A 3BR2A 1MJ9A 3IKTA 4IRDA 1Y1WA 4CCJA 1WFXA 4DV2H 1PDNC 2AGQA 3ERED 4RAFA 2RGRA 5J40A 2W9AA 5E79C 1YW7A 2ZJ2A 2HHHH 1ETOA 3DU6A 4R8HA 3I55I 2GA1A 3VYSB 4HF1A 4Y13A 4RLQA 1MMNA 1W7PB 3CD6I 3LNQA 2IGNA 1HDPA 3E5XA 1A31A 2LR8A 1PUEE 1U9OA 2CFOA 3IRRA 5DG8A 4A0XA 4E70A 4UB6C 3PQJA 4YR0A 5FLMG 2JA7A 2DTZA 4UCUA 4RDUA 3G73A 3LAPA 3SI8A 5JH7F 4M6VA 2V6CA 3VWBA 2UUAH 2K85A 1TWHA 1MDMA 1ZLKA 3PFYA 1V9PA 2VA3A 2R6FA 2E2HJ 2WB1A 1I27A 4MV1A 1GYFA 2SCUB 3BAAA 4JX5A 4MQ9F 1B59A 4RGUA 3KP4A 3TMOA 2VKDA 4LLGF 1I3AA 3OR1C 2X0SA 4KYWA 2LK2A 3GTQJ 3PVXA 4CYCA 3HOVJ 4L0ZB 3PNVA 1MMDA 2VXZA 4QSHA 1SC7A 2E35A 2KIUA 2QSHX 1OISA 4IRCA 3H3VK 1HQCA 3ZXSA 5EZGA 3VPDA 2HDDA 5E1ZB 2E2JJ 4KISA 1FOKA 2VQDA 5GP9A 3JSLA 2AGPA 3SJMA 2MGQA 1D0YA 2HXOA 2DAOA 3H3UA 3LA7A 5E20A 4XLNF 2XKPA 3ZMVA 5M3FJ 2UXBH 1V4RA 4P9FA 2DJNA 3R0JA 3J80W 4AC0A 3SDBA 1OCCH 2YL2A 2VT2A 2LDUA 3LSHA 5FFZA 5GONF 2VQEH 1EJ9A 3R5FA 2VKHA 1IJWC 3QU6A 2GBYA 2DA1A 2M4GA 3G6XA 2IP4A 3BA8A 1MMAA 2M30A 1X19A 2UU9H 4B3MH 1QRYA 3HKZA 2STTA 3LMLA 1MMSA 5LHHA 3MD2A 4XONA 3WE3A 2NVUB 1J75A 5LL6b 3BG9A 1SVMA 2Z5UA 3MFKA 2QQBA 4G9YA 1EUDB 5DLGA 1SFOA 2Y75A 1WHUA 4ZYDA 1YG2A 1WJEA 2HKOA 2VODA 3I12A 3CF2A 1YYVA 4O2BF 1U0JA 4G94A 2GPWA 2BQUA 2BZTA 2LY9A 4GKJH 4ITVA 4F4ZA 3RB0A 5M5XJ 4M3DA 2JVHA 5J1UA 1BC8C 4LG3A 1TWFJ 4F93B 3DU5A 2B63A 2HR3A 2V9PA 3M9AA 4EBDA 2I8CA 2Y0SE 3HOZJ 3L4JA 3WTSC 2HPIA 2XC7A 3ISPA 2D5VA 4Q4ZF 3GTLA 1JUPA 3RIZA 4JYAH 1EH6A 3FHZA 2M2EA 4XK4A 1M6VA 3PR4A 3WGIA 2OAZA 2XGEA 3U2RA 4ZJZA 2ZJTA 2WAQA 2CO5A 4RB2C 2RQPA 3CUOA 2XAJA 4H0EA 4FX4A 2I87A 2OPTA 2TCTA 3UKGA 3TQ1A 3T5HA 3F8NA 2GZWA 2MG4A 2V59A 1XMXA 1TC3C 4DR6H 1T36A 3VODA 3JRXA 1MH4A 1U5TC 2ASDA 2RVCA 3BTCA 2EBIA 5ILVA 1TWCJ 4Y17A 5CVRA 4APMA 2K9QA 2K9SA 3OOUA 3VEPA 4NC7A 2VPLA 4I02A 2Z3YA 4G3IA 1WH7A 2C2DA 3BG3A 2YYAA 2JEIA 1E3HA 3M8EA 4DJAA 5F0FA 1RK5A 4XNFA 1WSUA 3Q0WA 3OL3A 3WTWC 1FC3A 2VR1A 3MR5A 3CCRI 3RTXA 5IYZF 3WU2C 4MO7A 5KFIA 2PN1A 1ZAOA 1E4EB 1X3UA 3OL4A 3LFKA 4JBAA 2QKMB 5FLVA 3ECHA 3FXOA 3I3LA 2W8KA 5CVVA 4NXNH 4Q43A 1K1QA 2E2HA 1KYZA 3K4KA 1SAUA 2HOAA 4X0GA 3KTMA 4UVCA 3HYIA 2HDWA 4XQFA 3D0SA 3IH2A 3Q0VA 5DQIA 4RGRA 1U3EM 4YAJB 2Q2EB 4ENMA 2N8GA 2EFOA 1TL8A 4QWDA 3S93A 3E5NA 2NRAC 1M7JA 2JA6G 1RZ4A 4XM3A 2R7TA 3PO2G 1RKTA 3IUOA 2HS5A 3GTQA 4HAMA 1LDKB 1R6RA 5BMZA 2YUSA 3HUGB 3A2KA 2IGOA 5BPFA 1VQ4I 2RDPA 3TL4X 2GLTA 1HOMA 2F2EA 3CMAI 1XX5A 4QTRA 1J0RA 4CSWA 2OCCH 1DGWY 3AG2H 3B6CA 4FBTA 3G1LA 4HNVA 4MLOA 1ZQ3P 2P6SA 4XKWA 4MV3A 1ZHFA 3PFIA 2GXGA 2JK3A 2K86A 1EYZA 3T5LA 5L1LA 2BXYA 2LSOA 3O8HA 4L1KA 1VS0A 4X62H 1X58A 1IXSB 3N4MA 4BE2A 5JVDF 3R23A 2JEFA 4FS2A 1B6AA 2VOBA 1FPQA 5J4YA 1A5JA 1JLLB 4O2AF 1WJ5A 4M74A 1SD7A 2XRNA 4F7ZA 4NB5A 5JVGF 2UVRA 3D1NI 1DV1A 2X48A 3E5QA 2VT3A 1XMAA 5L3FA 3FXMA 2FK2A 1WJDA 2LBFA 2X6WA 1REPC 2O6GE 2Z9OA 2EFWA 1GSAA 2ID6A 2MC4A 3CMYA 1DP3A 3S2WA 2Q2TA 3L7WA 1HC8A 2LOOA 5C4JJ 2ZDQA 4IO9F 1N36H 2W6MA 1RKWA 1KQ8A 2LF7A 1MBGA 3CDHA 4FBUA 1S6LA 2X1CA 4HV6A 1VQ6I 1GO3E 3MR3A 1D3YA 3OYMA 3C2HA 3KP6A 3K4NA 3JRAA 5D4RA 4EYIB 4A3FG 3I64A 4A93J 3FMQA 1TWFA 2YSRA 4QIWN 2WTFA 3OSPA 3F3XA 2TRTA 2V9VA 1GVDA 3RYPA 5FRMA 4I50F 4LLLA 5LEKA 2EZHA 2W6NA 2L9NA 3U1KA 2YS7A 4Y15A 3EDPA 1KC7A 1J7KA 2FUG2 1I3QJ 1XSXA 4AWXB 4IRIA 4R8UA 3K5HA 2ALZA 2A5YB 1J09A 2BVMA 3K2ZA 2OV7A 1YJNI 2NS7A 2M8GX 3ABUA 2XPUA 5LGTA 2R7QA 3S8PA 1OCTC 2XCAA 5LYJF 4IVNA 3BCBA 3GTPJ 2I5UA 2OTLI 4ETSA 2R5YA 4IHWA 4RAZA 4V19K 1FKAH 2XGDA 2CU7A 4ED2A 4LF9H 3I71A 1XCVA 1DU6A 2ZCWA 1TWCA 1ZREA 3RBDA 3DTKA 5DD8A 2V4RA 4ECSA 2DXIA 4WBNF 5C44J 3ZQHA 3H5RA 4PGHA 3LWFA 2W6PA 1PP8F 4FASD 4DR1H 1VI0A 2O9LA 1KJIA 3N41B 4F4YA 3R60A 1YI2I 3RGXA 5KAFC 4G7OF 3OY9A 1W4MA 1ETQA 3TW7A 3H9JA 2ZMEC 2JA8J 4TQSA 2KIMA 5FD6A 2VA2A 3I59B 5DM7F 5A2QK 1JXSA 2CG4A 1LFBA 4DYQA 1S0MA 1BW6A 1Y0UA 3PL8A 2PX9A 5HS7A 3RYRA 2CGPA 1JIHA 5TISC 4GCVA 4IX7A 2DZDA 2V79A 4A3LJ 1YX5A 1JDBB 4Q48A 4N9HA 4LJZF 2NUAB 5KFAA 1Z1DA 1UZCA 2R7LA 3N44B 1ONVA 3HOUJ 3GFJA 2IGMA 5TRDA 4V2GA 3WTUC 1CQJB 2XF5A 1FJLA 2HGCA 4RMNA 3HPHA 2WY8Q 4BXFA 2Z33A 3RKQA 3H35A 2WV1A 1YITI 4IOAF 4I55F 5KFFA 4WK8F 1ZRFA 3OSFA 2JT1A 5ERIA 1MGTA 3JW4A 4XIDA 4HDUA 2R7MA 2C22A 2A6EF 2GWRA 3J81Z 4Y4RA 2M05A 1WH2A 4BY7J 3H9QA 4CZZA 5FPOA 2E1OA 1T98A 1FWZA 2WV0A 3BG7A 1S68A 2AQEA 5DCMB 1B6SA 5K2MA 2VBXA 3J7ZI 4AIDA 5LA6F 2KPMA 1P4XA 2BVLA 2FSWA 5KFWA 2OF7A 2AS5F 3F22A 4X6AJ 3PW0A 3GZ6A 3ZMSA 4NBQA 3T1HH 5F1RA 2F5FA 2QWWA 1IBLH 1D0ZA 4MTEA 1M0TA 1I94H 4UY8I 3AG4H 4YB8B 4A0ZA 1JT6A 5HNHA 2PVPA 1EV7A 2M3AA 3EPIA 2H6CA 3CLQA 4EEQA 4EYHB 3EUHA 4D1QA 1BI3A 1MJBA 2KZGA 3S1QJ 2B0LA 4PK4A 1ACIA 3HSEA 4BY1G 3GLXA 4A0YA 5DUIA 3QZ7A 3ABMH 2L2OA 4DGWB 1PK8A 1STZA 1MMGA 1WJBA 2X9DA 2XRLA 3DF8A 2RQQA 3GLKA 4DV0H 3PNTA 2W82A 4M3BA 3L4KA 2W48A 4A3DG 4PUSA 3CCSI 4RGSA 3HB9A 2E1CA 1AHDP 4IZZA 1K78A 4YHHH 1JJ6C 2PG4A 3CO6C 3OHAA 1IN5A 1G6NA 3DEEA 1JGSA 2W6OA 3EUKL 4ZI7F 2L4MA 3LMMA 3BC8A 4LFUA 4HLYA 1CE8A 2LYCA 1XGNA 3GQCA 3KP7A 4F91B 1N34H 3ZOBA 1JXLA 2HWVA 3T5KA 3V8LA 5CA0F 2OU2A 3O3KA 1BI0A 3S15J 2EK5A 2W7OA 2L3DA 5AONA 3ESWB 2JEGA 2K9NA 2ZXJA 1EZ1A 2CV0A 4FETA 4GRIA 3MQ0A 1YTYA 1K4SA 3F0CA 4KT6A 4XRSA 2EFNA 4YJ2F 4EVIA 3DCFA 4L9NA 2FNPA 3QWLA 4CC6A 5CYVA 4O4IF 5JLWA 3F6VA 2IMWP 1XDUA 4CHUA 2QGUA 1MDMB 4A3CJ 4NC8A 4UHTA 3RSNA 4Y33A 2KRCA 1FBUA 3BLYA 5HODA 1SMTA 2BGCA 3HKZN 1ULZA 5LXTF 1MD0A 4ABZA 2PMZE 3L2WA 5F04A 4ZYHA 1CF7A 1O3SA 5CB4F 2DO7A 5KAIC 4BNCA 3L2CA 1E2XA 2R7ZG 3HG9A 3EETA 4JI3H 1X1CA 5FO5A 1DGRM 1TQPA 5IYCJ 3E1SA 4GYIA 1F1ZA 4E7SA 4BJ6C 3J81W 1ETVA 2XAHA 5HVQC 4CYCB 1N56A 5L9XA 2QZ8A 3FXRA 4NLGA 4XLHA 4BJTA 3WGHA 4DL5A 2QSFX 1W96A 4BWSC 1BNCA 2ID3A 5HS9A 1S3JA 2OWOA 5KG1A 2XIGA 4HX4A 3ZQLA 1YFHA 1K61A 2JWTA 2I8DA 2EQRA 2ICWG 2Y31A 3PQKA 4RLFA 1XSVA 3J7YJ 5EWEA 1IRXA 2CKZB 3GTOJ 4S04A 2CZGA 3ZGKA 3DEWA 4X66H 2J5OA 2PN6A 2IW5A 4YQWA 3OIPA 3M07A 5LD2C 3KP5A 3PW2A 4P5OA 4HLXA 1KONA 2BBYA 3RKXA 4IZOA 1RUNA 5LFAA 3N43B 1LEAA 5IYDG 2WAQN 1G3YA 1QVTA 1TT5B 4QPQA 1V54H 1C0WA 3FXQA 1Y6IA 2V26A 2QQAA 3JAMZ 3ZMUA 5IP7J 2R7OA 2L9RA 4JK1X 3CLOA 3GZNB 1I6UA 2R86A 4AD9A 1T33A 4C2MJ 3A0HC 4HA8A 1Y1VJ 4A69C 4OMZA 1R1UA 1ETWA 2LG4A 2PQ8A 2VQLA 4G6TB 3V7SA 2DMTA 1Z2NX 1X3ZB 4ZC3A 2ZB9A 2IRFG 4MAMA 2H27A 2FBIA 2NXNB 3HSRA 4MFEA 3WO0A 5CJ9A 2KL4A 4UVAA 4AIJA 5FJ8J 4NHJA 3OUZA 2BY1A 5KFJA 4IR1A 2EINH 2OTJI 1NG6A 2DLLA 3KXYT 2OC6A 1I7NA 3HJEA 1A35A 2E1NA 4QW8A 4F4XA 3TQNA 1K79A 3V6JA 5J8CA 2DI3A 3C0FB 3Q8QB 1ZN2A 1JKOC 3KHRA 2R7VA 4YY3H 2MH2A 3RCOA 1BOBA 2LF8A 4RAGA 2GOXB 1FMWA 4JQFA 1XDNA 5KFKA 2GXBA 2R7KA 4A3EG 2AO9A 2RV8A 3W6KB 5D1OA 4LG0A 4JX4A 4ECTA 2ACJA 4HQ6A 2MLKA 4R7RA 3QOPA 2ZXHA 3TDUC 4D9JA 1PUFA 2JA7J 1IRZA 3K0LA 2X0LA 3A02A 3GLLA 1SFXA 2XSJC 2HVSA 4EG0A 3CJQB 2XDVA 2LKSA 3EUAA 1S97A 1Q1VA 3SZTA 3SDGA 2K02A 1QVUA 4GXOA 4AIKA 4IEJA 4JV5H 3VFZA 3DTIA 2COBA 4PCQA 5GTHC 1UNNC 2XV4S 3KZYA 2GQQA 3H0GG 4C5BA 2JPCA 1MIJA 3KEOA 1QQIA 4UUSA 5CKTA 3IL2A 1UAAA 1Z91A 2AQFA 2ZDHA 2HDCA 2NVQJ 2ZKZA 4UCSA 2KP6A 3RQ4A 2DA2A 3I53A 2DPJA 2R7RA 4A5MA 3B02A 4EFBA 4RNNA 4ED0A 4I6ZA 2R8GA 1V51A 1J9IA 3HXLA 4IHTA 5FB2A 2H94A 1X2MA 3DBRB 3VDXA 1EA3A 3WU0A 2VQCA 4JP0A 5L3BA 5BPDA 2LNBA 4K0KH 1ZG3A 1ZKGA 4WXDA 1SANA 2ASJA 3TDZC 1BIBA 2E1MB 2QK4A 4UCRA 2DT7B 3FWEA 4RZRA 2JA5G 2ZM6H 4B1RA 4ED3A 1IC8A 5KNLA 5IT9W 1JTYA 1EF4A 5CVUA 3BT9A 3H4BA 1IN6A 1R7JA 2BY2A 3OYCA 1BGWA 2OLSA 3NEUA 4LF7H 4ECQA 3T1YH 3E6DA 1G3SA 4U7CA 2F5CA 2XAGA 3I4MG 2XGXA 1T94A 1BM9A 2FKLA 1XNQH 3TW6A 1Y56A 2LC2A 4LFAH 4HRIA 4UNOA 3ROUA 1LFPA 1KJQA 5FLXK 2M7BA 2MCTA 2M1BA 1ULYA 3FIWA 4CC5A 5HS8A 4A3IJ 4WD3A 3H3ZA 1CS0A 3KHGA 3BR6A 3CUQC 1ZGJA 2Y0SA 3VYTB 4EGZA 3F8BA 2LP0A 2LBFB 1FZPB 3N8DA 3RV3A 4C2MA 2DFIA 1TWGJ 3L1PA 1E3OC 1KJ8A 1Y1VA 3IN5A 4L18B 2X1EA 3OYGA 3WG7H 3COAC 1WQ2A 2YS6A 2CV1A 2DMNA 4GFBA 2ELKA 3KP3A 5D5UB 5E1XA 1WSCA 5F1JA 2HFHA 2HI3A 3ZMZA 2EIMH 4BQNA 4C3IJ 1LVKA 5LMUH 5FKMA 2P0AA 4LFCH 4EM0B 4O5VA 2J5PA 3MKYB 4B3XA 2XASA 1MH3A 1Y0NA 2VASA 5IYBG 3KZIC 3ZPLA 1B72A 3J7AY 1UHSA 4XYMB 4Y8VB 2FJZA 4XN3A 3ZQQA 4BBSG 1Z0XA 3RQIA 3KCCA 4DLKA 1X1BA 2BHZA 1RRJA 2EZKA 2CRGA 3HHHA 3HHGA 4R8UB 2V9KA 1MJAA 3JRDA 4EGQA 1IF1A 2F4IA 2H1KA 3H40A 4O3RA 4G6QA 5LRRA 1AUVA 1L0OC 2EV6A 2ZNZA 3TO7A 5EZYF 3S32A 2J9GA 2UZKA 5FKOA 3FISA 3JRCA 2UV1A 5KVRA 2R5YB 3DF7A 3QPSA 3PUFA 3HM5A 4B3TH 1OCRH 1LPQA 1XTAA 3FKJA 1S72I 1BBYA 5IOYA 1VQLI 2O0YA 5ILUA 3Q8SB 2MFZA 1R1TA 4HDVA 1Y39A 1FLIA 1FSHA 5EEGA 2FPPB 3FM3A 2L01A 2VQGA 1ETXA 3UNGC 2HQ5A 4CYDA 1QU3A 4FTHA 4ZYAA 1D5YA 2K3PA 3MFHA 2DOEA 2VQFH 1QNTA 2GA2A 4MV7A 1FX7A 3CCEI 3KLOA 5EZHA 1KU3A 5JLXA 4AVZA 3WTYC 4A3MG 4J9RA 3MR6A 1RESA 5D1PA 2HZTA 1GHCA 3O8GA 2KKOA 1MBFA 2DPIA 2W57A 5EJCA 3U9SA 1OQYA 3SZPA 3ZR8X 3FKIG 3BQ2A 4DL2A 1GXQA 1O57A 2E2IJ 1P8LA 3K5IA 2O5RA 2R7XA 4IRGA 4A3GG 2DJIA 3DV8A 3DKYA 2EPFA 3RIRA 4BYYA 4HNTA 2QA4I 1DDNA 1PJRA 3LSTA 1J2XA 1D1BA 4A3KG 2W9CB 5KFYA 3I5UA 5CVIA 3AAFA 2PBZA 1GLNA 1HNZH 3WTTC 3KYDB 2Y2ZA 2XPVA 3BDDA 3K70C 4MV9A 4M6YA 3GTMJ 3E3VA 5E3NA 1VQ9I 3QFFA 2KRFA 3W6JB 3MR2A 2KT0A 2Y9YA 4YR2A 2R92J 1XN7A 1T39A 1RYSA 2I80A 2DK8A 2ZJRF 3JZIA 2Y0MA 1XMOH 4BXXG 3RB4A 2V4JC 3DKWA 5KT7A 3ONQA 1WCMG 4W1UA 4M73A 3V7CA 1X3WB 2F48A 3PNYA 5BR8H 4ZDLA 4YIRX 2ZMEA 4PZJA 4J19A 4J9OA 3S16J 1WVRA 2OZ6A 4Q8EA 3KX2A 3SFIA 3FK6A 3TP0A 3GW2A 3MKWB 2NNYA 3GV8B 4JI0H 2WC2A 3GTJA 2QQ8A 2B63G 3M7GA 4HR7A 3Q8RB 2IS2A 2HTSA 3GEZA 3K1PA 3RKYA 1TWGA 5H2FC 2F4MB 2IXSA 1YHQI 2VBYA 3DLLF 1KYWA 4EM2A 5K5OA 5D4SA 3WHCA 3ASNH 3OUUA 3HPGA 5KFRA 2BQRA 4C5CA 1SD4A 3FXUA 2VJJA 5D5VB 3OS0A 1K78B 2YU9A 4Q47A 3MMYB 2FK1A 4EM1A 1AU7A 3MEXA 1HKTA 2Z16A 5HDGA 1R22A 5EWFA 4ECRA 1K6OA 2EFQA 4XLEA 1T6SA 2X1DA 3HOWJ 2R93J 4E4TA 2KHMA 1VQKI 1QO0D 1Z05A 2MSYA 3H20A 4XKCA 3PSIA 4LF8H 3CF5F 4LH7A 2CQQA 4FS1A 3BJYA 4Z6YA 1KU9A 3TIGA 1HF0A 3JCUC 2L0KA 2OZUA 2JRMA 3WHBA 3V4ZA 2O7OA 1K83J 1QZYA 2BEOA 3I4NJ 4MA0A 2FPGB 2PEXA 5EEHA 5E3LA 3TGNA 2CQKA 5LLQA 2VUMJ 4QJFA 1JUSA 4J9PA 3NGDA 2UUZA 3DWLE 2IBDA 4TV9F 5EGOA 4G12A 2K9LA 2RNGA 2WA0A 3RPUD 5HNFA 1RPWA 1USSA 5IT3A 2D1VA 5KFVA 3LSJA 3QP5A 2AHQA 4NQWA 3C18A 3F8CA 4ECVA 1CF7B 3NAUA 3C3WA 5GPCA 2A68F 2XHKA 2IBKA 2DDAA 3TQTA 4PJLA 4DL6A 3PIOF 2Z2SB 2COMA 1IRGA 2EZIA 3CZ6A 4I01A 4NDLA 1YRNA 1IOVA 4DV1H 2FU4A 3HOVG 1VQPI 4EJOA 2VBWA 2CUZA 1X1DA 3KE2A 4CICA 1IZ1A 1NK3P 1YJ9I 4X1EA 4BXUA 1SAXA 4D7MA 2EB7A 4C2TA 1I6HJ 2O03A 3EYIA 4LB6B 5JQWA 2XB0X 2VOPA 1RYRA 1W1WE 1AUXA 2M87A 4GYGA 1Z2PX 4DZJA 4DV6H 4PSWA 1X9NA 4O6JA 2MD0A 5A2QZ 2YS9A 2MA3A 3MKLA 1DPUA 2E2IA 4IHXA 4ED8A 5M3MJ 2HVRA 3W2AA 1UELB 1IDZA 4W97A 3R4KA 2FB9A 2DWCA 4ECXA 4LSAA 4CCMA 5IWAH 2DFHA 3HGGA 1HCRA 3C7JA 4M3FA 3GTGJ 2V4QA 4DV4H 2DMUA 1S03G 4QWAA 1E17A 3GTMA 5EDWA 3T0YA 1GSOA 2WB1E 2OBPA 1MBJA 4J9LA 2MABA 3A01A 3HOYG 3QYFA 4B44A 2R92A 2YZMA 5KG6A 1NK2P 3RPQA 2OCEA 5DQHA 1DU0A 3RDIA 4ENJA 3KEQA 2JA6A 1OKRA 2DMPA 2JPBA 4UUTA 5BPIA 1UC8A 2W71A 1T0FC 1VF9A 1S29A 3AG3H 2ISZA 3HRUA 3FK7A 3AL0B 1RNLA 5LGUA 3JRFA 3AKZA 3SEZA 1WWXA 1UMQA 2P5KA 4E7IA 4OWRB 3FDSA 1IAWA 4N0BA 4UB8C 2R8KA 2BY3A 2FF4A 3HSFA 2VQHA 1ZG5A 2ZBKA 4HQEA 4M3EA 1HLVA 3DKXA 4AVPA 4ZH4F 1EKEA 2K7LA 3X2QH 4U0YA 2NNNA 3HOZG 3F8FA 3VOEA 3LP8A 3CTAA 1T8IA 2LD5A 4G7HF 3L00A 4XICA 2R8HA 4BEHA 4FT8A 3G1OA 1T95A 1ZHQA 5L1JA 3OOPA 1GGOA 5EWGA 2QEXI 1P7IA 3H5AA 1BI1A 3QYEA 2JN6A 3HBLA 1HDDC 1HSTA 1EHIA 2FQ3A 3CCVI 3WTXC 5KG4A 2GXAA 1VQ5I 3BWGA 3WGGA 4XLCA 3KAJA 2DDBA 1XCBA 2PBIA 3TP3A 3DPUA 2FEZA 1RJPA 3N40P 2R93A 5D1OB 4LG0B 1TWAJ 2M7AA 2PMZA 1B1BA 1PUFB 1TT0A 2IP2A 3D5LA 2HVQA 1DQUA 3RGZA 2RAEA 1JHHA 3SEQA 3H4DA 2EZLA 1K6YA 2A6TA 3ZQ7A 5GAEJ 1JUMA 1ZHSA 4EGYA 2GAUA 1SYXB 2NOGA 1S0NA 1K83A 2UUBH 1W93A 1B33N 2H6BA 3C2GA 3Q2OA 1LNWA 1FNNA 1O4XA 1P4WA 3OYFA 1BW5A 2K27A 2LVSA 2RC4A 4QWBA 2VUMA 4HQMA 4O3PA 4J9MA 2D2WA 4EJTA 2DODA 2DLNA 3SHFA 1S9FA 1F43A 1TTYA 3HOXG 5JHUA 1HW1A 1ORKA 1O3QA 1HA8A 1FOYA 1NHAA 2IA1A 3N6XA 2LH9A 4UUSB 3GYHX 3R5XA 1QBJA 2Y0SN 4HEA2 1I1GA 2K9MA 2XGCA 4KN4X 4FQGA 2Y30A 4P55A 3ULQB 3ZMDA 2BV6A 2WY7Q 3WNZA 4CCLA 5C3EJ 4M71A 3GILA 1XPXA 3DLAA 1XSDA 1OPCA 1SMYF 1LDDA 2ESNA 4KMUX 1V5EA 2DFFA 4AIHA 1ZTRA 1FBQA 2AGOA 2PJPA 2JSCA 4XRFA 4AYBE 4RUAA 1B6RA 3GV7B 4OX9H 1P4AA 2PJRA 3G8CA 1V5FA 1RR7A 1FYLA 3FDYA 3ZMTA 2C2EA 4ZHQF 1WZ2A 4XSXF 4JI4H 4ZTJA 4AQYH 2DN0A 4ESBA 4J01A 2W9BA 4IRKA 4CUGA 5CVJA 2R7FA 2VIXA 5F6FA 4RNMA 4I0AA 1OR7A 2CQXA 3SYTA 1O7FA 2KDZA 4PJMA 3GTGA 1NG7A 3ZN0A 3L2PA 1FBSA 3E6BA 5IP9G 2AU0A 4LF5H 3HC7A 2FP4B 2XAFA 1B8IA 4DL4A 1IXRC 3WU1B 4U6PA 3JRHA 1RETA 2FD5A 1J5EH 2CV2A 2A5WA 5J2UF 4C2UA 2P7CB 2RN7A 4LITA 2ZNYA 4HSTA 5L3EA 3CJTB 1HNXH 5LHIA 4XLAA 3NARA 4I98B 1IXCA 5D8LB 3RAQA 3BA9A 3DP7A 5E18F 4CCKA 4JV0A 4UXNA 1ON1A 1S9HA 4A93G 4BE0A 2MD5A 2W9CA 3GFIA 3EQLF 3SXYA 1B72B 1UHWA 1I50J 3HEFA 4ED7A 3S14J 2X51A 2ZC2A 3LA2A 4DR2H 1N48A 4RU9A 2HNHA 5KFLA 3V6HA 4F3QA 4MV6A 4RA2A 5DTDA 3JTGA 4HF2A 1W5CC 4V2FA 2PLYA 1Y8QB 3GFMA 1GLVA 5IOZA 3BQ1A 2HKXA 4ME6A 3ABLH 1VQMI 3OTOH 3QYBA 1JE8A 5DDGA 2E5NA 3G2BA 4C3HJ 5KG3A 2DQLA 1UG0A 5JVTA 1ETYA 1ZQ7A 2HOEA 5M5YJ 3PO3G 1R23A 4C9YA 3LQRA 3ML6A 1FTTA 4QWCA 1U9NA 4KA4A 1GT0C 4OIPF 3CC2I 3CUQA 5DV5A 5KFTA 5K5RA 4RB1A 1JT0A 1WKMA 1TWAA 1UFMA 2DMQA 4Y7NJ 5DYMA 3F23A 1X2NA 2DYRH 1GSHA 3VSKA 3KAKA 2IS6A 2KQRA 4KICA 4KMFA 3TO9A 2E34A 2F5VA 2OJED 3MFIA 3JRIA 3CDLA 2JA8G 5C4XG 2VC0A 1R5GA 3RV4A 1FP2A 5DEQA 4LIUA 5K1YA 3S3MA 4A3EJ 4QLCU 4U7DA 1H89C 2DA5A 5EOYA 1GDTA 4XN0A 2AXTC 1ZRCA 3BCAA 1GV5A 2XGPA 1H88C 2F4OB 2FOKA 2FLPA 3BPXA 5JHFA 1RIOH 4U0VA 3VPCA 3Q9SA 3HOUG 4YELA 3IV5A 3ELKA 3H9GA 3LL7A 1SFEA 1TQMA 3L9FA 5EYRA 2FOWA 4ZTFA 3MWDA 2MW8A 4RUCA 3OYIA 5F9LA 3OV8A 2F6CA 5E17F 1Z6RA 4BBRG 1S5LC 3CCUI 4DV3H 3BTJA 5FKNA 1JKRC 3ERMA 2DYSH 3H0GJ 4BY7G 4Q8FA 4NC6A 1QGPA 5LBQA 4KUMA 2QENA 5BMVF 1TAEA 1S7OA 3K9TA 4BQOA 4JYKA 3MJFA 3ZQFA 4ZYGA 1BR1A 1MNDA 2ZJQF 1KEEA 2EA2A 4XRMA 1P9QC 3VSLA 2K3FA 1X4PA 1T2KA 2DPUA 1JTXA 2HZDA 3BTIA 3QPLA 2ZMEB 1F9NA 1AWCA 2JEJA 4YIFA 2KMUA 2XCLA 5D5XB 4OMYA 2P5VA 2CSOA 1UG2A 1BL0A 1PVEA 1XMQH 3BR0A 2A05A 4BQAA 4GKKH 1MNMC 2LMDA 2QF7A 4A6DA 1JJ8C 1NTCA 2YW2A 5FLXZ 1SVLA 3OSGA 1FOXA 2DA3A 5KG2A 5LMNH 2HU9A 3K4MA 1DIKA 2WAEA 2XF6A 4JOMA 2YRWA 2BHYA 4U88A 3RPUA 1BJTA 4X65H 3PW5A 1G8XA 2LLKA 2L02A 5JR3A 3S3OA 2DTRA 1MNEA 2R7NA 4QWEA 2VXDA 3ZCOA 1VZ0A 4F55A 4XSZF 5DCFA 5F27A 3DPTA 3CJRB 2G9WA 3LQQA 2KDOA 5FKKA 5CQGA 5L3GA 5HBRB 5KKNB 4O4LF 4ZZLA 3K7AJ 1I50A 3MAJA 1MBHA 2OQRA 3VPBA 2J6UA 2PI0A 5HLHA 2VPRA 5DGAA 5EG0A 1O7LA 1FIPA 3BY6A 3KIOA 3KALA 1O3RA 1VFCA 1BR2A 5ILSA 4L9VA 3MZHA 1YW8A 4CCNA 3I58A 1GVJA 2KISA 1FYMA 4LK0F 3U1DA 2FK3A 2ECBA 3CCJI 1V5GA 3R61A 3LSGA 1UC9A 2L9VA 1XC5A 3RB3A 1SVOA 5HOOA 4F50A 5HDKA 4A3JJ 3V4GA 4A3CG 4LB5A 5HLTA 5EGOB 4I7HA 2K4JA 1ODDA 1OLTA 4BBSJ 3A03A 4OIOF 4GC6A 3ECOA 2B9SA 2FBKA 3A0BC 3MN2A 4HW0A 1D8KA 4NQWB 2WE6A 2X4HA 4ED1A 3Q0UA 4IAJA 2R7SA 4B43A 1V55H 4I09A 2XROA 4KJZA 2NVYJ 1R5ID 4BKXA 5GAHJ 4I4TF 4N4OB 1RC9A 4ENNA 3ORRA 5IYCG 4X64H 1YRNB 2BOLA 5KFMA 1E3PA 4L5JA 2FRHA 1N77A 4TV8F 3M9OB 3ETJA 1ZK8A 3MKZA 3K1NA 1FIAA 2RF4A 4E7KA 4HYKA 3FX3A 1CGPA 3TOAA 4L5EA 1BXRA 1G2HA 4KT5C 3E6MA 5FLMJ 4O3NA 3JAMW 1L2ZA 3V4SA 5J8FA 2HQAA 5KG5A 4J9KA 1X4OA 2DK5A 2M34A 2VBZA 1DGSA 2OUMA 3E6CC 3WO1A 1IG7A 1FVIA 2VB6A 3OIOA 3CDIA 1R1VA 2JUGA 3G3ZA 3LA3A 2CUEA 1U5TA 4KHPH 4Y3OA 2GPSA 1DUXC 3GIKA 1N33H 4YFKF 5F0CA 5KK1A 3S1RJ 4M9UA 2HYFA 3OS1A 3LWBA 4MV8A 3S2DJ 1MBKA 5FLXW 3GV5B 3RF2A 4XMYA 4JI6H 3S2HJ 5DGBA 3EUHC 1IGNA 2GM4A 2M0MA 3H0GA 2G7HA 1E4GT 1YIOA 1I1SA 2QCOA 1IRFA 1M1EB 4LGWA 1FEXA 2R82A 4DYCA 3CVZA 1F4KA 3A01B 2IT0A 2YZNA 5KFSA 2MH9A 1R36A 4EMSA 4HX8A 1WJAA 2G7UA 3FKIJ 4G8XA 1LJ9A 3RZDJ 3ZQIA 3GTJJ 1W7PD 2DFEA 1D8JA 1Y1VG 4J0MA 1AKHA 1VQOI 3CCQI 4MTDA 1U8RA 3Q3SA 2PMZN 1LDJA 2WTEA 3I9V2 1BC7C 2KIFA 4A3KJ 2P81A 5CA1F 1QPIA 4B48A 2C28A 4J00A 2UVUA 2M8EA 1IN7A 1YX3A 3F6OA 3GMEA 4P9UA 2EILH 1XGMA 2JMWA 3GCMA 2X6YA 4PDKA 3LAJA 5IP6A 3Q1KA 2AXLA 4MA5A 1KBLA 1MKMA 2M5WA 4RBOA 2WADA 2JA5A 1APLC 4DOZA 2BQ3A 2ZFUA 2VONA 4IHJF 2ISYA 3R0AA 5IT9K 5FJ8G 2IS1A 5C8YF 4BXXJ 2YU9J 1U2WA 1XGSA 4CCOA 1Y1WG 2EV5A 1WCMJ 2H09A 3MZYA 1VKZA 3E0JB 4QWQA 2XSDC 2QBYA 2V1DA 3OWTA 1YS7A 1JKJB 4BEHB 4JX6A 4XKVA 3J7AO 3M4OJ 4YR3A 3KETA 3GUDA 4MEYF 5TGTA 5H6RA 2DU9A 3HRMA 3OIQA 3V7RA 4LF6H 1J5YA 3BQYA 4F92B 3N97A 3SE7A 4IR9A 4LFBH 5FRNA 1R58A 1H9TA 2EIJH 3LSKA 2X6XA 3V42A 3D5SC 3TBIA 4IRHA 2D1HA 4XX0B 1KJJA 2JA7G 2KSWA 1Y14B 2CUJA 2WWYA 2C2RA 4BU2A 4EGJA 1T0FA 4PGGA 2ZSHB 4XR6A 3RZOJ 1TNTA 2EA4A 5IPAA 1ZR4A 4AUXA 4WF2A 4DR7H 4DNCA 3UR3C 2FPIB 1UCRA 2ZO4A 4UCOA 3G6YA 1P92A 4XORA 1HKQA 4IJAA 4S05A 1V4YA 4Q45A 3T5XA 2V6EA 5KFZA 2JUCA 3HZJA 1L3LA 1OCZH 4I0BA 4ANJA 3U9TA 2R5ZA 4JV1A 1N75A 2GIZA 2XB5A 3MZ8A 3R5HA 2HYJA 3GIPA 5KT4A 2E19A 3IP4B 2QUFA 3O2PE 5GAGJ 1B4AA 3G71I 5IY5H 4B3SH 1EUCB 1K4TA 1Z2OX 1TW2A 1XD7A 2NVYA 1R49A 2F4VH 2RDJA 3V6KA 2GOMA 2DQRA 1LE8A 1T08B 2P4WA 3H1CA 1GV2A 2OD5A 3GZ5A 3GXOA 5GTIC 5D8KB 3RI4A 4MEXF 1D1AA 3M3YJ 2IJLA 4ECZA 2E36A 2Y69H 4LIVA 6PAXA 2LRDA 4Y52J 3Q9VA 1YW9A 3BZ6A 1BA5A 2V1UA 2PJRB 4Q5SF 1UHMA 2ELHA 5KCMA 5KFPA 1GXPA 2JQ7A 3BR1A 4KFCA 4ZDOA 1PX2A 4FM9A 2XAQA 2Q1ZB 4LMYA 3L2RA 1E4FT 2NS0A 4ZOLF 2W9BB 2ZXIA 1PYVA 2E60A 3DPLC 1T38A 5KG0A 3KHLA 3ASOH 3AL0C 2JZYA 2V1XA 2XGQA 2A69F 2DBBA 4JI2H 3P7NA 5DUKA 2W7PA 2R85A 2G0EA 2EH3A 3BROA 4BDYA 4O3OA 4M6XA 4A3IG 4J9NA 2Q2UA 2CQNA 2CW0F 2JA6J 3PO2J 1ZH5A 2PMUA 3IWZA 4U7BA 3T5JA 5J4VA 4FU0A 3W6VA 4PSXA 1B8IB 4QIWE 4DUZH 5K5QA 2J6SA 1OMIA 3FKIA 2EV0A 3M4IA 2P7VB 3PW4A 1Z67A 2ASLA 2MYSA 1D0XA 4PFOA 5H20A 1JX4A 2NVXJ 2NU6B 2CUFA 3CCYA 5D6FA 1C30A 4PWQA 2VN2A 2UWMA 1M0WA 3KEYA 1U8BA 1IO2A 5DG7A 3CP8A 1I6XA 3DBHB 2BYVE 3F8MA 4FE4A 2W24A 1V3FA 5B1AH 3JRBA 2XKOA 4WWCA 3WG9A 5ICFA 1AOYA 1ITYA 4HNUA 2LY2A 3J80K 4OU0A 4DQ2A 5J1RA 2W6ZA 2UVWA 3HOYJ 5LHGA 2VJ4A 3TEDA 3BJAA 1ZLJA 3OYDA 5T14A 2ECCA 5B3SH 1G4DA 3OSNA 2FLNA 2WAFA 1KGSA 4J9SA 3FMRA 3OYEA 4BUPA 1TZLA 2M0CA 2FQ4A 1WCMA 4R79A 1SEIA 2IA0A 4K2EA 5KFQA 3QODA 4PJ0C 2ZXWH 3N42B 2KJCA 3PM1A 4A3BJ 4FHTA 3VPRA 4II2A 3TINA 2K40A 1KA8A 1RR8C 2HJWA 4FISA 4FX0A 2BY0A 3ZN1A 3L2UA 3RUPA 5KFHA 2RNJA 3BQZA 3DEUA 1YIJI 2GIVA 3KHHA 3UQ8A 3PUBA 2B7EA 3CUQB 4A3FJ 1R71A 1U78A 1A04A 2FXAA 3FXKA 3RTRA 4EBCA 3HIFA 4L9TA 4TUYF 2X6OA 1BN5A 3H3VH 4XYLB 3G4SI 1IDYA 3GIDA 3JREA 3BQ0A 4YFNF 3PSFA 1LQ1A 4HX7A 3HDDA 3L09A 2KLOA 1WI3A 3IKVA 4OAYA 3RJ0A 1EH8A 4QW9A 1A9XA 1R4MB 2BXZA 3CESA 5ICEA 4EEFG 4MHGA 4CGZA 4J9QA 5J47A 1FMVA 3K3VA 1W5TA
chains in the Genus database with same CATH topology
2D45A 5J6XA 3JSNA 5HLIA 2IVMA 4EJUA 4EQQA 2HQNA 4LH6A 3GFLA 3B73A 2HYGD 2HTJA 2K4BA 1EH7A 2DT5A 4HBLA 1SD5A 3QPHA 5ED4A 3CO7C 3KLNA 4Q0YA 4UCTA 3GO5A 5FGMA 2DPDA 2WDTA 4PDBA 2E7WA 1Z7UA 4HV5A 2R7DA 2M45A 2QLZA 2FMLA 1BJAA 3WTVC 5FPRA 3P9CA 2YPRA 2WYOA 4DUYH 1LB2A 4JI7H 1FJGH 1IBMH 3QAHA 1KU7A 4B3RH 1FSEA 1OYYA 4RZQA 2IA2A 3QRFF 1A0IA 4EV0A 3MWMA 1LEBA 2NAZA 4KIBA 5LRSA 3R6SA 2Q0OA 3BOQA 1HXDA 2VPSA 4CDGA 1IW7F 1DP7P 3RJPA 4D0PA 3K69A 2VE9A 2A6HF 2HGSA 1TNSA 3I0TA 2C6YA 2RGVA 1B04A 2L54A 2O3FA 3JSOA 4O3MA 3H92A 4ON0A 1FY7A 3GVAA 2P8TA 1TA8A 3HOSA 1ON2A 4YG2F 4ASNA 4ZYEA 1G3WA 1O75A 4BHCA 5E1WA 4M9ZA 2Q8KA 2O61A 2UUCH 2UXXA 3NQOA 4CXFA 3SFZA 4R1HA 2EJRA 1P6RA 4ESJA 3K1MA 5A2QW 2XVCA 3M1EA 4Z2YA 1ZYRF 3E97A 2ADUA 3FF5A 1W7PA 4CO8A 1FP1D 1P2FA 2E7XA 4ZZDA 2YR2A 3BP8A 3EYYA 1U6GA 2MLGA 1OYWA 2VC1A 3KFWX 2FNAA 4LF4H 1R5HA 3FMSA 1XMKA 1PP7U 1YLFA 2A3SA 4B8XA 2HEOA 5LGNA 2YU3A 1U5TB 1FYKA 1YS6A 3HTSB 3BPVA 4EJVA 2DW4A 1HKSA 3FZVA 1LVAA 1B9NA 2FA5A 1B9MA 3IWFA 3M8FA 1IBKH 4WX9A 3V8JA 1USTA 4HZFA 1HNWH 4P96A 1H9GA 2O8XA 4M9SA 2UXCH 4BH9A 2BE5F 4A5NA 3GWZA 4M72A 4MGRA 1HW5A 2TDXA 2A61A 2EWNA 4NXMH 4UFZA 3J7AK 5F64A 3O6BB 3T8RA 2E5LH 4IF4A 1OYIA 3DFGA 3TO6A 3REOA 3FMAA 2VUGA 4LK1F 2RKHA 1K7AA 2QYOA 1KU2A 5JFRA 4OINF 2CFXA 2QBYB 1BOAA 5CLSA 1HSJA 5DD4A 3PN1A 1I5ZA 4IPAA 1G3TA 2W84A 1Z6TA 3F21A 2FE3A 4A6EA 5D5WB 2YCHA 4OOIA 4LD5A 1FT9A 4LLNA 5TJJA 3BABA 1S7AA 2UXDH 4A12A 1TW3A 2ZFWA 4WXHA 4XBFA 4MQVA 4ESFA 3MCZA 5E8IA 3WE2A 4B09A 3GF2A 4A2AA 4JI1H 2JTVA 1IUYA 1N32H 1ZG1A 4UV9A 4L9JA 2OA4A 4GGGA 2VOOA 4A2UA 3U9GA 5AIQA 1ZARA 2YX7A 4DV7H 1HR0H 1Q1HA 2QVOA 2ESHA 5FD5A 4MNUA 2IPQX 2FMYA 4UV8A 1QZZA 1O3TA 3HTUA 3P9KA 2A07F 3SQNA 1WRJA 4BAYA 1D5VA 4IXAA 5JI6A 3T1BA 1W5SA 2R3SA 3VB2A 3Q5FA 4RGXA 4OIRF 2Q2EA 1HBXG 2QQ9A 4DR3H 4DV5H 3KZZA 3ABTA 2EFPA 1SD6A 3HUGA 3J81K 4RB0A 1JHFA 3WTZA 2PFBA 2CYYA 5ICGA 4OIQF 3V8KA 2JRTA 1F5TA 2KJBA 1J59A 1BI2A 3IRQA 3F72A 4EFEA 1XDSA 2F5DA 1BIAA 5AIPA 1MZBA 2CW8A 4RB3C 4UVBA 3HOTA 1Z9CA 4HOBA 4XLPF 3ZP5A 1ZRDA 2XUBA 4WCGA 5BS6A 4KN7X 5IT9Z 3RKWA 1RUOA 2P5LC 3HRTA 1S8NA 1KQ0A 4UCVA 4M7EA 1IN4A 5D6EA 1IN8A 1YQAA 4KNYA 3TKYA 4YFXF 2P6TA 4L5IA 4L0YB 4DR4H 3DXJF 3BJOA 3KP2A 4I2OA 4HYEA 2FBHA 4N9IA 3JTHA 2STWA 2VE8A 4GO1A 1AN7A 4EJWA 3TOBA 2F5EA 4ENKA 1XB4A 2W25A 3P9IA 2NYXA 5ICCA 3IG0A 4YIIA 2OQGA 4M9XA 4U0WA 4WXCA 3BJ6A 3WODF 5FFXA 4BHBA 1TLHB 3HRSA 4IHSA 2Z99A 2L4AA 2YX4A 3E5UA 1RI7A 2PMHA 1HW2A 3IC7A 4RS8A 1DPRA 5LEJA 3I59A 1R00A 1WI9A 1XNRH 1XGOA 3QPTA 4JI5H 1KQ9A 4LSXA 1TBXA 4KIGA 4BHPA 2W85A 3JSPA 1H0MA 1SFUA 4UUVA 3FM5A 2CWEA 2QM3A 5L3DA 1VTNC 3JAMK 4RAYA 2CW7A 4JI8H 3CJNA 1QPMA 4A2BA 5H6QA 1YO5C 3I54A 5DCMA 5BQTA 4G7ZF 2UXNA 4G6DA 2ETHA 5L3CA 5HLGA 3I4PA 5E8GA 2MC3A 3C1DA 3QU3A 3J80Z 3T8TA 2MBFA 4GLXA 1TQIA 5HDNA 5BOXA 4TV7A 4KDPA 2HQRA 4KIFA 3IHUA 2LKPA 3NRVA 1ZGAA 2Y48A 3DQVC 4HF0A 3GX4X 4DR5H 3QP6A 1UB9A 1MJ9A 3IKTA 4DV2H 1PDNC 3ERED 2RGRA 1YW7A 2ZJ2A 2HHHH 4R8HA 2GA1A 4HF1A 4Y13A 1W7PB 3E5XA 1PUEE 3IRRA 4A0XA 4E70A 3PQJA 4UCUA 3G73A 3LAPA 2V6CA 2UUAH 1MDMA 1ZLKA 1V9PA 1I27A 1GYFA 3BAAA 4MQ9F 1B59A 4RGUA 3KP4A 4LLGF 4KYWA 4L0ZB 2VXZA 2KIUA 1HQCA 5E1ZB 1FOKA 3JSLA 2DAOA 3H3UA 3LA7A 5E20A 4XLNF 2XKPA 3ZMVA 2UXBH 1V4RA 4P9FA 3R0JA 3J80W 2VT2A 2LDUA 5FFZA 2VQEH 3QU6A 3BA8A 2M30A 2UU9H 4B3MH 3LMLA 2STTA 5LHHA 3WE3A 1J75A 5LL6b 2Z5UA 3MFKA 2QQBA 4G9YA 2Y75A 4ZYDA 1YG2A 2HKOA 2VODA 1YYVA 4G94A 4GKJH 1BC8C 2HR3A 3M9AA 3L4JA 3WTSC 3ISPA 4Q4ZF 3RIZA 4JYAH 1EH6A 3FHZA 3WGIA 2OAZA 3U2RA 2ZJTA 2CO5A 4RB2C 2RQPA 3CUOA 2XAJA 4H0EA 4FX4A 3F8NA 2GZWA 4DR6H 3VODA 1U5TC 2RVCA 5ILVA 4Y17A 5CVRA 4APMA 3VEPA 4I02A 2Z3YA 3M8EA 1WSUA 3WTWC 1FC3A 3RTXA 1ZAOA 1X3UA 4JBAA 3LFKA 3ECHA 5CVVA 4NXNH 1KYZA 4UVCA 3HYIA 3D0SA 4RGRA 1U3EM 4ENMA 2EFOA 2NRAC 1RZ4A 2HS5A 4HAMA 1LDKB 5BMZA 2RDPA 2F2EA 1J0RA 2P6SA 1ZHFA 3PFIA 2GXGA 2K86A 2LSOA 1VS0A 4X62H 3N4MA 1IXSB 1B6AA 2VOBA 1FPQA 4M74A 1SD7A 2XRNA 4F7ZA 4NB5A 3E5QA 2VT3A 1XMAA 5L3FA 1REPC 2Z9OA 2O6GE 2EFWA 3S2WA 2Q2TA 3L7WA 1N36H 1KQ8A 2LF7A 3CDHA 1S6LA 4HV6A 1D3YA 3KP6A 5D4RA 3I64A 3FMQA 2YSRA 3F3XA 2V9VA 3RYPA 4LLLA 5LEKA 4Y15A 3EDPA 1J7KA 4AWXB 4IRIA 1XSXA 2A5YB 3K2ZA 3ABUA 5LGTA 4IVNA 4ETSA 4RAZA 1FKAH 4LF9H 3I71A 1XCVA 2ZCWA 1ZREA 5DD8A 4PGHA 3LWFA 1PP8F 4DR1H 3N41B 3R60A 3RGXA 4G7OF 1W4MA 2KIMA 5FD6A 3I59B 5A2QK 1JXSA 2CG4A 1Y0UA 5HS7A 3RYRA 2CGPA 4GCVA 2V79A 4Q48A 4N9HA 4LJZF 1Z1DA 3N44B 1ONVA 3GFJA 5TRDA 3WTUC 2HGCA 2Z33A 4WK8F 1ZRFA 2JT1A 5ERIA 1MGTA 3JW4A 4HDUA 2A6EF 2GWRA 3J81Z 1WH2A 5FPOA 4CZZA 1T98A 1FWZA 2WV0A 1S68A 5DCMB 2VBXA 1P4XA 2FSWA 2AS5F 3F22A 3GZ6A 3ZMSA 3T1HH 5F1RA 2F5FA 2QWWA 1IBLH 4MTEA 1M0TA 1I94H 4A0ZA 1EV7A 2H6CA 4EEQA 3EUHA 1BI3A 1MJBA 2B0LA 3HSEA 3GLXA 4A0YA 5DUIA 1STZA 3DF8A 4DV0H 3L4KA 4RGSA 2E1CA 1K78A 4YHHH 2PG4A 3CO6C 1IN5A 1G6NA 1JGSA 2L4MA 4LFUA 4HLYA 1XGNA 3KP7A 1N34H 2HWVA 3V8LA 2OU2A 3O3KA 1BI0A 2EK5A 2L3DA 5AONA 2ZXJA 3MQ0A 1YTYA 2EFNA 4EVIA 4L9NA 2FNPA 4CC6A 5CYVA 3F6VA 1XDUA 4CHUA 1MDMB 4UHTA 1FBUA 1SMTA 2BGCA 1MD0A 4ZYHA 1CF7A 1O3SA 2DO7A 4BNCA 3L2CA 1E2XA 3EETA 4JI3H 5FO5A 1TQPA 4GYIA 1F1ZA 3J81W 5HVQC 2XAHA 2QZ8A 3FXRA 3WGHA 4BWSC 5HS9A 1S3JA 2OWOA 2XIGA 4HX4A 1YFHA 3PQKA 1XSVA 4S04A 4X66H 2J5OA 2PN6A 2IW5A 3KP5A 4P5OA 4HLXA 3RKXA 2BBYA 1RUNA 3N43B 1LEAA 1G3YA 1C0WA 3FXQA 2QQAA 3JAMZ 3ZMUA 4JK1X 3CLOA 1I6UA 4AD9A 4HA8A 4OMZA 1R1UA 2PQ8A 3V7SA 1Z2NX 2IRFG 2H27A 2FBIA 3HSRA 5CJ9A 4UVAA 4AIJA 4NHJA 2DLLA 3KXYT 2E1NA 3TQNA 1K79A 5J8CA 2DI3A 3C0FB 1ZN2A 4YY3H 2MH2A 2LF8A 4JQFA 1XDNA 2GXBA 3W6KB 2RV8A 5D1OA 4LG0A 2ACJA 2MLKA 4R7RA 3QOPA 3TDUC 3K0LA 2X0LA 2HVSA 1SFXA 3SZTA 2K02A 4GXOA 4AIKA 3VFZA 4PCQA 2XV4S 3KZYA 2GQQA 2JPCA 3KEOA 1QQIA 3IL2A 1Z91A 2HDCA 2ZKZA 4UCSA 3I53A 4A5MA 3B02A 4EFBA 1J9IA 3HXLA 4IHTA 5FB2A 2H94A 3WU0A 5L3BA 5BPDA 4K0KH 2LNBA 1ZG3A 4WXDA 3TDZC 1BIBA 4UCRA 3FWEA 2ZM6H 5IT9W 5CVUA 1IN6A 1R7JA 1BGWA 4LF7H 3NEUA 3T1YH 3E6DA 1G3SA 2F5CA 2XAGA 2XGXA 1BM9A 1XNQH 4LFAH 4UNOA 3ROUA 5FLXK 2MCTA 2M1BA 1ULYA 4CC5A 5HS8A 3H3ZA 3CUQC 1ZGJA 4EGZA 3F8BA 1FZPB 2DFIA 4L18B 3COAC 1WQ2A 3KP3A 5D5UB 5E1XA 2HFHA 5LMUH 3ZMZA 4LFCH 4EM0B 4O5VA 2J5PA