4RAYA

Crystal structure of magnetospirillum gryphiswaldense msr-1 apo-fur
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
136
structure length
135
Chain Sequence
GHMVSRIEQRCIDKGMKMTDQRRVIAQVLSDSAHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
total genus 44
structure length 135
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rayA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rayA02
3E5UA 1ZGAA 3ECHA 3HIFA 2M87A 4AIKA 2H6CA 3T0YA 1P4XA 2XAQA 1OYWA 1FWZA 3N97A 3VFZA 1IN7A 4YFKF 3ABUA 1SMTA 4YFXF 2L54A 2JSCA 3M8EA 2FNAA 4EMSA 1ZRDA 4HX8A 4IJAA 4CZZA 4Y17A 2DAOA 1E17A 3GXOA 3TGNA 1ZGJA 2IA1A 3HSRA 2Z9OA 1V3FA 2K7LA 3DEUA 2NAZA 4G6QA 4HW0A 2FF4A 4HF0A 4I09A 2KIUA 4EJUA 5J8CA 4OIPF 1KU2A 5FGMA 2KJCA 4RAZA 4L0ZB 4LMYA 3QP5A 1TW2A 4A0XA 4L9JA 2DTRA 1IXCA 1W7PD 1O7FA 1XMKA 2ZXJA 2PMUA 4UVBA 1QZYA 1ZRFA 3M7GA 1LJ9A 2H94A 1YG2A 3E97A 2R3SA 4CHUA 2ISZA 5FLXZ 2NNNA 3F8FA 4LD5A 1AWCA 1T98A 5HS7A 1R22A 4M6YA 3E3VA 3TDUC 4UUVA 1W5TA 4L5IA 3V4GA 4BHBA 1U5TB 5HLHA 4OINF 4HX4A 1DDNA 3WODF 2DPUA 5LRRA 2ZJ2A 2D1HA 3LFKA 2XROA 2K4BA 2BBYA 2JZYA 2QQ9A 3M9AA 4UVAA 3WG9A 1MJAA 5JI6A 4FT8A 3FXRA 1S29A 2H27A 2F5DA 5LHHA 1SFUA 3EYYA 1KQ0A 5EEHA 1P92A 2A69F 3L9FA 3T8RA 5BPIA 1B1BA 4XLNF 3SZPA 1OYYA 4P9FA 4ESFA 2ZFWA 3F8BA 3GFMA 2RNJA 1BI0A 2QVOA 3MWMA 2E7XA 4JQFA 2RQPA 3NRVA 3REOA 3D5LA 2FBIA 2HEOA 3KP3A 1ULYA 3R4KA 2XKOA 4Q48A 4FHTA 1STZA 2H6BA 2XRNA 1IN6A 4IF4A 3CO7C 4G7OF 4WXCA 1FPQA 4ZYGA 1J59A 3PQKA 3LA7A 1LDDA 4KNYA 1USTA 3ABTA 1MKMA 3WTZA 3WU0A 3SHFA 3IRRA 1G3SA 1J7KA 3I4PA 1QBJA 3E6MA 1EH7A 1Z6RA 4A0YA 4OIQF 2R7FA 5K5OA 3IWZA 3WTVC 5CLSA 1BN5A 4M9ZA 2IW5A 4WXHA 4GXOA 2EA2A 3F72A 4M71A 3B73A 3CUQA 3I59A 4HZFA 2P7VB 1ZYRF 4U0YA 1U3EM 4YG2F 3J80Z 3TKYA 1JHHA 4HV5A 3G73A 3ZPLA 1R23A 1R1VA 1HKQA 4R1HA 4LB5A 1I1GA 5L3EA 4PDKA 2P5VA 1WSUA 2WC2A 1ZREA 2QQBA 3DPLC 2BEOA 1YTYA 2P5KA 2BGCA 1PDNC 2VC1A 1BBYA 1HW2A 2XAJA 4AWXB 1KU9A 1KYWA 3BDDA 1RUOA 3CDHA 2RN7A 4I0AA 2RV8A 2FA5A 4RB3C 3WTUC 1FSHA 2HQNA 3ZMVA 1FC3A 4HV6A 4IHTA 1D5VA 5JR3A 2VBZA 4AIJA 3LQRA 2EWNA 5DDGA 1R58A 4IXAA 2GA2A 1G3YA 4A5MA 1XGOA 2P6TA 5FFXA 3P9KA 1FBUA 4ZZLA 4EGYA 3WTWC 1XGSA 5HLGA 5HS9A 1LEAA 2MA3A 3RYRA 3V8JA 2NRAC 1W7PB 4EM0B 2ISYA 4KFCA 4KMFA 1UFMA 2HKOA 3F8CA 1PP8F 4UNOA 4LJZF 5IT3A 2GAUA 1X3UA 1FOKA 4HQEA 3ZMUA 3E6BA 5LEKA 4LK0F 1XGMA 1IN4A 3ZMZA 3EDPA 3T5XA 4MEXF 4IRGA 2FXAA 3GYHX 5EEGA 3I53A 3C7JA 2W84A 4BYYA 4WX9A 3ROUA 1BIBA 1TTYA 4F7ZA 3LWFA 1FT9A 4CXFA 4ENKA 5TRDA 4M72A 1WI9A 2NYXA 2O6GE 3WGHA 1SD4A 4KICA 3DXJF 1DPUA 5HDGA 4Y13A 5H20A 1Z9CA 2OZUA 4KA4A 4ZYEA 3FZVA 2DPDA 1YLFA 5LGUA 2ACJA 2A5YB 3P9IA 2CG4A 5CVVA 2M8EA 1CF7B 2PEXA 3WGGA 5D5VB 1SFXA 1IW7F 4D0PA 5LLQA 5BPDA 5BOXA 4RGRA 4IHSA 4BNCA 2IA0A 4L0YB 2RVCA 1NHAA 3IKTA 2A3SA 3FWEA 5F64A 2V1XA 3CUOA 4JK1X 2OA4A 4A12A 3QU3A 2D45A 4N9IA 3EQLF 3OOPA 3V8KA 1J5YA 4FX4A 3T8TA 2VOPA 1FZPB 3I71A 1WWXA 4UV9A 2CSOA 2K27A 5E8GA 2O03A 1PUEE 2ADUA 1ZG3A 1L0OC 1Z91A 3SZTA 2DO7A 4GGGA 3TOBA 5ICFA 1RUNA 2E7WA 5ICGA 2BYVE 1R1UA 1XD7A 3DPTA 4N9HA 3WE3A 3E6CC 1FX7A 1MGTA 3WTYC 3BJAA 2XUBA 4QWQA 1FLIA 1MJ9A 2MLKA 1HKTA 1WRJA 5D5UB 3VEPA 1ON1A 2LF8A 4YIIA 2K4JA 4GYIA 2KKOA 2RC4A 4IRIA 4KDPA 1U78A 3QRFF 2ESHA 1GHCA 3F22A 2GZWA 2Z3YA 3V8LA 3E5QA 5IT9Z 3KZZA 1BOAA 5J8FA 2P8TA 3BJOA 2EB7A 2E1NA 2M45A 1HW5A 3BPXA 5ILVA 1LNWA 1IN8A 3L7WA 2XASA 1TW3A 2Y75A 4LB6B 3TO9A 5H6QA 4DNCA 5E20A 2FMLA 1ZARA 1SMYF 3GLXA 2LF7A 3CTAA 3FMQA 4S04A 2WV0A 1BM9A 1YFHA 3DKWA 2YSRA 2PJPA 3L09A 5K1YA 4CO8A 1XDSA 1FP2A 3ZN0A 2VOOA 3GO5A 1JXSA 2UWMA 2JRTA 4OIRF 1W5SA 4EVIA 2HQRA 4RS8A 5ILSA 4M9SA 1KQ9A 4PCQA 1XMAA 5DUKA 3SXYA 2L4MA 3KETA 4ENMA 2VBYA 4RB2C 4A0ZA 5HDKA 1B9NA 3IKVA 2DBBA 3ZMTA 2FQ3A 1GVJA 1U5TC 5E18F 3VB2A 2X4HA 1MDMB 2LDUA 3KZYA 3EUHA 2PMHA 1I27A 3G3ZA 1U6GA 1R5GA 3KLOA 4I2OA 3HTSB 2QENA 4IVNA 4O6JA 2GIVA 2D1VA 1XDUA 3RKXA 5E1ZB 3I5UA 4HOBA 3ZMDA 1TQPA 2JPCA 3R0JA 3FM3A 3JAMZ 3U9GA 4Q5SF 5FD5A 3MZYA 1CGPA 2QBYA 2RKHA 3KP7A 2L4AA 4HLXA 1T39A 4NB5A 3L00A 2FMYA 4ENJA 1TBXA 1UHWA 2Y0MA 4U88A 1E2XA 5ICEA 2XKPA 1O3QA 4KUMA 3JSOA 3W6JB 4BXUA 3SFZA 2BV6A 1Z05A 2A68F 1Y0UA 3TOAA 3LAJA 4JBAA 2CQKA 3FM5A 3J81K 3V7RA 3LAPA 2RDPA 1H9TA 2CO5A 1YS7A 4ZH4F 2EV5A 2Y48A 3KEQA 2HTSA 1HKSA 4MEYF 4GYGA 4A6DA 3FHZA 1G4DA 2AS5F 4Q47A 1BJAA 2HTJA 4L9TA 1B4AA 2OBPA 1FYLA 1S3JA 5KVRA 1JGSA 5KK1A 5LEJA 1T38A 3K0LA 4AVPA 4GO1A 1G3TA 1F5TA 4KMUX 3Q9SA 3Q5FA 4EJOA 1GXPA 4MNUA 1ODDA 2ZKZA 4WK8F 1J9IA 1IXRC 4A5NA 1J0RA 5DV5A 4ESJA 1YIOA 3E6DA 2LSOA 4KT5C 4EGZA 2K02A 3H3UA 4I02A 2K86A 4HDVA 2VC0A 3RKWA 4EJTA 5LGTA 1FY7A 4LLLA 2MLGA 2GA1A 2YX7A 3GUDA 5ED4A 2QUFA 3HRUA 3BROA 2QZ8A 1S8NA 3IWFA 3C18A 3JW4A 4HAMA 4EJVA 1EV7A 2HFHA 3I64A 1C0WA 2A6EF 4YIFA 2TDXA 1LQ1A 2NNYA 3RPUA 5D8KB 3E5XA 3KE2A 3KFWX 3P9CA 1DPRA 4G6DA 3IC7A 1YW8A 2QLZA 2YPRA 5HS8A 4P55A 1T0FA 5FD6A 2ZBKA 3GX4X 3HRMA 1Z7UA 1G3WA 3M1EA 1QO0D 2QWWA 3HSEA 2COMA 4XBFA 2ZNZA 3NQOA 2XGXA 2ZMEA 4Q4ZF 2EV6A 2P5LC 3I58A 1UHMA 1R5HA 4KN7X 5JFRA 2KJBA 2GWRA 1ZLKA 3O3KA 5FB2A 5DCMA 2B0LA 1L3LA 1EH6A 1J2XA 2VXZA 2V1UA 4WCGA 3WTSC 2PFBA 2W57A 3T1BA 2KIFA 5CVIA 3BZ6A 5K5RA 4EV0A 5D5WB 2Z5UA 2XVCA 3ELKA 5ILUA 1LB2A 3MFKA 3C1DA 2VONA 2P6SA 1KQ8A 3QOPA 3J7AO 3WTXC 1IF1A 2CGPA 5D5XB 3CUQB 3I59B 5D6EA 1QZZA 1SD6A 2J5PA 2O0YA 4LG0A 4HX7A 5DD4A 3GFLA 2CW0F 2IRFG 5H6RA 2W25A 5CJ9A 1BIAA 3TDZC 1F1ZA 3K1MA 3PQJA 4K2EA 3ERED 4A2UA 2M1BA 1K79A 3BPVA 4OIOF 4OU0A 1WKMA 3S2WA 5JVTA 2IP2A 3CO6C 2HOEA 3GWZA 1XB4A 3FF5A 1R1TA 3CJNA 1HW1A 3MQ0A 3FXQA 1OYIA 2O8XA 2KIMA 2A61A 4ETSA 3KCCA 1K78A 2XAFA 3H92A 1JE8A 2STWA 2EFNA 1XSDA 4ON0A 3EYIA 3I0TA 5A2QK 2FE3A 2OD5A 1PP7U 2V79A 3O6BB 2GXBA 3RYPA 1FSEA 2JPBA 2UZKA 5L3DA 3EETA 3RJPA 3PFIA 4HQMA 1QGPA 2DT5A 4Z2YA 2OZ6A 4HF2A 2BE5F 3F8NA 1Q1HA 4TV7A 4H0EA 3MEXA 3BOQA 3F21A 5LRSA 1P2FA 1R7JA 2QYOA 3CLOA 2XIGA 2HYGD 3HHGA 2EFQA 5HLIA 5L3BA 4M6XA 4WWCA 1XGNA 1YW9A 2EV0A 2VT2A 5HVQC 2ELHA 4I01A 1FBQA 1J75A 1QPMA 1BC7C 2DW4A 3RDIA 4A6EA 4NQWA 2FU4A 2VBXA 2VE8A 4HDUA 1R00A 3GF2A 1ON2A 2DFIA 1ZAOA 3QP6A 5K5QA 1UB9A 1TQMA 2MC3A 4MQ9F 2J5OA 2PLYA 2JT1A 2PBIA 4RGSA 2DK5A 2DK8A 4M74A 2F5EA 2CFXA 1USSA 3ZP5A 2QM3A 2HYFA 2VODA 3KP5A 1ZRCA 4UV8A 1IAWA 5FLXK 1ZH5A 2ZNYA 1LEBA 5BMZA 3TO6A 2IJLA 1D8KA 1BI1A 2GQQA 4ZYHA 4EM1A 2VBWA 2PI0A 1G6NA 2W85A 2G7HA 1QQIA 5HDNA 1TQIA 2LKPA 4NHJA 2HGCA 4CYDA 3WU1B 3QAHA 3BP8A 4Y15A 5DD8A 1SD7A 1U5TA 3V7CA 2M5WA 1IXSB 3K9TA 2EA4A 5D4SA 5ICCA 2IT0A 3HTUA 1KU3A 1WQ2A 2JTVA 4U7DA 1Z6TA 1TLHB 4MGRA 1REPC 4L9VA 4MQVA 1BI3A 3K1PA 2Z99A 5DEQA 5CYVA 2P4WA 4KIFA 5E1WA 2F5FA 3O2PE 4G7HF 1XSVA 3P7NA 1H9GA 4CGZA 3DFGA 3R0AA 1K7AA 3LA3A 1RI7A 3COAC 3R61A 3GEZA 1DUXC 1XCVA 5F1RA 3RI4A 1BI2A 3F6OA 2XHKA 2DQLA 2FBKA 4RGXA 3LA2A 4XLPF 3F3XA 2A07F 2O3FA 3F8MA 1D8JA 2V1DA 4RAYA 3NEUA 4FX0A 1RZ4A 1HXDA 2FNPA 2ZO4A 1FBSA 1IRFA 1H0MA 5DUIA 4EM2A 2RGVA 3I54A 1YS6A 3KP4A 4OMZA 4P9UA 2EJRA 2DI3A 1MJBA 4U7BA 2M30A 1GXQA 1ZLJA 1SFEA 4RGUA 2V9VA 2NS0A 1HQCA 3WTTC 2HZTA 3DP7A 4BHCA 5CVJA 3J80K 2HWVA 4UHTA 1T2KA 3RTRA 1FYKA 4AIHA 4I7HA 2L01A 4MHGA 1Z1DA 5JHUA 1F9NA 4EJWA 5BS6A 2QQAA 1O3RA 3FX3A 1FNNA 2DLLA 2FRHA 2OU2A 3FXUA 3HRSA 5AONA 3M8FA 4U0VA 1DP7P 4OOIA 3HOTA 4U0WA 2IPQX 1KA8A 1SD5A 3GVAA 4HYEA 2FBHA 1LDJA 5D8LB 3H3ZA 3WE2A 3IL2A 3U1DA 5DYMA 1XN7A 2X0LA 3K1NA 4AD9A 1B59A 3BJ6A 3W6KB 3V7SA 4LFUA 4ASNA 1I5ZA 1ZN2A 1VTNC 4I0BA 3KEOA 3AAFA 3L2CA 2QBYB 2V6CA 1IUYA 2ZCWA 5HOOA 4KIGA 3FMSA 3OV8A 4G7ZF 4P5OA 3SQNA 2DQRA 4R79A 2CWEA 1KU7A 5L3GA 4DQ2A 3HRTA 4OMYA 2PQ8A 2IA2A 4RB1A 1A04A 1IZ1A 3ULQB 3ISPA 1QNTA 5BQTA 5L3CA 1OMIA 1O7LA 4QLCU 4XSXF 2Z33A 3IHUA 1FP1D 3K69A 4CICA 2HS5A 3ML6A 1KGSA 3F6VA 4E70A 2UXXA 1P4WA 4M9XA 1W7PA 2PG4A 2R7DA 2WWYA 3MCZA 1BC8C 1P4AA 1U8RA 3J81Z 4O3MA 2EFOA 2FOKA 4N0BA 4PZJA 3CUQC 1B6AA 1MD0A 4LLGF 2YU3A 5D4RA 4L5JA 5J6XA 4RB0A 4BHPA 2Q2EA 1JHFA 2C6YA 3RIRA 4G94A 1HSJA 2E1CA 2MD5A 1O3SA 3ZQ7A 3DV8A 1TNTA 1I1SA 3VOEA 3GFJA 3K2ZA 2Q0OA 5ERIA 3ZMSA 5E17F 1HBXG 3GW2A 1O57A 2XV4S 2MH9A 2G9WA 3MAJA 1W4MA 3KP2A 3JTGA 4CDGA 4XRFA 4UXNA 2H09A 4L9NA 1ZG1A 4G8XA 2VT3A 5CVUA 1OKRA 1ZG5A 4HLYA 1YO5C 1HSTA 1RNLA 2YR2A 1S6LA 4R8HA 3RKYA 3KP6A 2VN2A 1CF7A 2G7UA 5AIQA 2W24A 1OR7A 2MH2A 1S7AA 2AXLA 4YFNF 3ZN1A 3JSPA 1FYMA 1LDKB 4ZYDA 5D6FA 1YQAA 4ESBA 1RIOH 2XAGA 3R60A 5F6FA 3Q9VA 1EH8A 2A6HF 5TJJA 6PAXA 2DU9A 3VODA 2F2EA 4P96A 1UCRA 1XCBA 1T6SA 2LNBA 1I6XA 2ZMEB 4EQQA 1IRGA 3ECOA 5LHGA 2ESNA 4BH9A 4KIBA 4S05A 2MBFA 1LVAA 1IN5A 5DCMB 4BQAA 3TQNA 5E1XA 4HBLA 3B02A 3GZ5A 4ENNA 4L18B 3C3WA 3D0SA 4MTEA 2VE9A 1SAXA 1YW7A 5IT9K 2UXNA 1O3TA 3RPQA 2YX4A 4I98B 4HF1A 3R6SA 2HDCA 4IPAA 3WGIA 4GCVA 1TNSA 4LG0B 3JTHA 2STTA 5FO5A 1YYVA 5LGNA 5CVRA 3LQQA 3QPTA 3BWGA 4B09A 2Q8KA 4PGHA 2XAHA 1R36A 5LBQA 3HYIA 3DQVC 1P6RA 4LLNA 2OQRA 2CYYA 5LHIA 1XSXA 2EFPA 2FEZA 5L3FA 3QU6A 2OQGA 3KLNA 2F5CA 2L02A 3MZHA 3DF8A 4BAYA 3N4MA 2D2WA 1MZBA 4KYWA 1B9MA 3U2RA 1ONVA 2WTEA 2EFWA 2PN6A 2O61A 3F23A 2FSWA 3GZ6A 1KYZA 1K78B 4LGWA 2EK5A 4MTDA 2IVMA 3TO7A 3HOSA 3HUGA 1K6OA 2HKXA 2GXGA 3IRQA 3BY6A 2P7CB 3LSTA 5DCFA 1OPCA 3QPHA 2OAZA 4ZZDA 3HSFA 4KN4X 3HHHA 1V4RA 4PGGA 1MDMA 4WXDA 2KRFA 2ETHA 1U2WA 3JAMK 3FMRA 4WF2A 4LK1F 4HA8A 4UVCA 4B8XA 1AOYA 5A2QZ 2HR3A 4G9YA 1D3YA 4M73A 5FFZA 4IRHA 3GFIA 1ZHFA 5E8IA 4XSZF 5AIPA 2L3DA 4O5VA 1F4KA 1S7OA
chains in the Genus database with same CATH superfamily
3E5UA 1ZGAA 3MMYB 2WTFA 4FM9A 3ECHA 3MZ8A 3HIFA 2M87A 1CQJB 2C22A 4AIKA 2H6CA 2FK1A 3KYCB 3T0YA 4ECRA 1P4XA 2XAQA 4ECUA 3QQAA 2KFDA 1ITYA 1RYRA 2NXNB 2F4MB 3FHNA 1OYWA 1G8XA 3LSHA 1FWZA 2KSWA 3S17J 3N97A 1I50J 2PBZA 3VFZA 1IN7A 4DV4H 3JRAA 4E7ZA 2DMUA 1CE8A 4YFKF 2VOBA 5IYCG 4ABZA 4PSWA 3LSMA 3ABUA 3CCJI 1WH7A 4NQWB 4HQ6A 3L4KA 1IGNA 1KBLA 1SMTA 4YFXF 4UCOA 4BEHB 3A0HC 2KP6A 2JSPA 2L54A 2QCOA 1A5JA 4RNOA 5BPHA 2BOLA 1T8IA 1B8IB 2W70A 2JSCA 4FASD 1JTYA 4Q43A 2DA3A 3LSJA 3M8EA 2FNAA 4EMSA 4ZQIA 2X6WA 1ZRDA 1HOMA 4HX8A 4IJAA 2L2OA 4CZZA 4Y17A 4LITA 3AL0B 4AVZA 3EPGA 1IV8A 4NBQA 2DAOA 4Y3OA 4AU7A 1E17A 2HI3A 4O4IF 1KC7A 3G6YA 1X2MA 2R8GA 3GXOA 3TGNA 1ZGJA 1ZQ7A 1KONA 2IA1A 3VSLA 4FETA 2KZVA 4JX6A 2LBFB 3PJRA 4JI4H 3HZJA 3HSRA 2Z9OA 2NVXA 2Z2SB 1F36A 1V3FA 2K7LA 3G2BA 3DEUA 3S14J 3DTKA 4CCOA 2NAZA 2R92J 4G6QA 4HW0A 2ZDGA 4TV8F 1WPKA 2EZLA 2FF4A 4HF0A 4I09A 2KIUA 4R7RA 2XC7A 4EJUA 4A3CJ 5J8CA 3FDYA 1TWGJ 4OIPF 1KU2A 4LSAA 5FGMA 4A3LJ 2KJCA 4RAZA 5C4JJ 4L0ZB 5KG5A 5KFJA 1BR1A 1CS0A 5IP9G 4IEJA 4LMYA 4ED7A 3QWLA 3K4MA 3QP5A 5L1LA 1TW2A 4A0XA 2WA0A 2RQQA 4L9JA 1JDEA 2DTRA 1S03G 3DBRB 4RAFA 2XGCA 4P1WA 4YHHH 1Z67A 1IXCA 4XR6A 1W7PD 2X51A 2LYCA 1O7FA 1MH4A 1XMKA 4XMYA 5FROA 4Z6YA 3OIQA 1D5YA 2ZXJA 5GPCA 2WADA 4Q45A 4Y52J 4DV0H 4D7MA 2WV1A 1AKHB 3DU5A 1PYVA 2BVLA 2PMUA 3M07A 3GBGA 3LMMA 4UVBA 3EUHC 3GTQJ 1EA3A 1QZYA 3B6CA 2JA8G 4A3GG 1ZRFA 2CU7A 4LG3A 3M7GA 2BQRA 1LJ9A 2H94A 3H40A 2GOXB 1YG2A 3E97A 2R3SA 4CHUA 2K9LA 1RR7A 5FKKA 2ISZA 5FLXZ 2NNNA 3F8FA 4LD5A 1AWCA 1T98A 3FXKA 3PUFA 2VPLA 1RK6A 4MV3A 3G8CA 1DGSA 3GV8B 5HS7A 1R22A 2M2EA 4M6YA 1W1WE 4II3A 4ZDLA 3E3VA 3TDUC 4UUVA 2RGRA 1WHUA 1SFOJ 2FJZA 2VKDA 3HOXJ 1TA8A 1GSAA 4C3HJ 1W5TA 4L5IA 3V4GA 4BHBA 3RF2A 1U5TB 2R7ZJ 5A2QW 2R7OA 4CZCA 1A6QA 5HLHA 2CQ7A 1POGA 2BXZA 4OINF 4JI5H 2OCCH 3J7YJ 2KT0A 4HX4A 1DDNA 4NXMH 3WODF 2DPUA 5LRRA 2ZJ2A 2D1HA 3LFKA 2XROA 5E3MA 2K4BA 3DEEA 4C2TA 2KRCA 2BBYA 4YELA 4FBUA 1VI0A 3HOZJ 5KFFA 1X9NA 2JZYA 2QQ9A 4F91B 3M9AA 2MW8A 4UVAA 3WG9A 1SYXB 1MJAA 3BCBA 3FXRA 1S29A 2EILH 4FT8A 5JI6A 3K4JA 5EF6A 2F5DA 5LHHA 1SFUA 1ZHSA 3EYYA 1K83J 2CQNA 2M3AA 2XAUA 1KQ0A 3BTCA 3CDIA 5KCMA 3GTGA 5EEHA 1XPXA 2NVYJ 1OJLA 2Z16A 1S5LC 1P92A 3HKZA 1TZLA 3JRCA 2A69F 4WBNF 2HHHH 2XF5A 3RZDJ 4FE4A 3L9FA 3Q3SA 3T8RA 2KHMA 5F27A 3CCEI 4X6AJ 5BPIA 2WAQE 5KFTA 1B1BA 4I99C 3OSFA 1QHGA 4XLNF 4LF4H 3JRHA 3SZPA 1OYYA 3N44B 4P9FA 4ESFA 3TMOA 1W36C 2ZFWA 3OIPA 3HPHA 2R7XA 4QW9A 2DMPA 3F8BA 3GFMA 4BDYA 5KKNB 1HDDC 2RNJA 3HGGA 1BI0A 2R0QC 2QVOA 3MWMA 4NNJA 2E7XA 3K4CA 1ULZA 2Z1DA 3RV3A 2M7AA 4JQFA 2DODA 3A1YA 2B7EA 2RQPA 1B72A 3GLLA 3NRVA 3OOUA 1TWHJ 3REOA 3NGDA 3RB6A 5EG0A 3D5LA 1MMDA 2FBIA 2K3PA 4EFBA 2HEOA 3GTJA 3KP3A 3PM1A 5EGOA 1ULYA 2NU9B 1X4PA 5DM7F 3R4KA 2XKOA 5KFYA 4J9SA 4Q48A 4B3TH 1Y39A 2F5VA 4FHTA 1Y1VG 1STZA 2H6BA 2XRNA 1WGXA 1WJEA 4RAGA 2F4VH 2Y9YA 1IN6A 1VNDA 4J9QA 3PW4A 4IF4A 3CO7C 1MBHA 2LLKA 4G7OF 4WXCA 1FPQA 4ZYGA 1GO3E 5DG8A 4XLFA 1J59A 3PQKA 3LA7A 1LDDA 4KNYA 1E4FT 4YR3A 1USTA 3DU6A 3ABTA 2M9HA 3SDGA 1MKMA 5M5YJ 2UVVA 3WTZA 3PZPA 3WU0A 3SHFA 3IRRA 3N40P 4E4TA 4PDBA 1X1DA 4BQNA 1G3SA 2OC6A 4IO9F 4PJMA 5TGTA 1Z21A 3CD6I 2AXTC 5KFDA 1J7KA 5DG9A 5IPAA 2V9KA 2XRLA 3BA9A 3I4PA 1QBJA 4A3DJ 3E6MA 3RCOA 2F6CA 1EH7A 1Z6RA 4A0YA 1YJWI 4OIQF 3DKYA 2VXDA 2R7FA 4O3SA 4RU9A 3RZOJ 2J6SA 3UQ8A 1WH5A 5D8DA 5K5OA 3IWZA 3WTVC 1U8BA 5CLSA 3H5AA 1BN5A 2DYSH 2M8GX 2UXDH 5IP7G 4M9ZA 3L2RA 2IAIA 4JP0A 2C35B 2IW5A 5FJ8G 1X3ZB 4WXHA 4GXOA 3VSKA 5I47A 1LFPA 2R93J 2IBDA 2YRXA 5JLWA 2HOTA 2UU9H 4II2A 4FTHA 2EA2A 3F72A 4M71A 4YIRX 4CC5A 3B73A 3IAM2 3CUQA 3JRXA 3I59A 4HZFA 3OS0A 2P7VB 5FLXW 1ZYRF 3KAKA 4KISA 2EIMH 4U0YA 1U3EM 1MMNA 4YG2F 3J80Z 1Y0NA 3TKYA 1LE8A 1NG6A 3IH2A 1JHHA 1HNZH 2HVSA 1YI2I 4HV5A 3G73A 1JKOC 3FIWA 2LR8A 2R5YA 3VPRA 3ZPLA 4LF5H 1RPWA 1E4GT 1ETKA 4JUZA 1R23A 1RK5A 5DQIA 4DUZH 1D0ZA 1R1VA 2Y0SN 2LRDA 2OLSA 2M4GA 5KFSA 2RDJA 3ZXSA 1HKQA 4R1HA 2MC4A 4LB5A 1I1GA 5L3EA 3L1PA 1GLNA 1B6SA 1N48A 4PDKA 5EDWA 2P5VA 1LFUP 3IUOA 1WSUA 4C9YA 4FS1A 1ETOA 2WC2A 1ZREA 3OYBA 1YRNB 1DGWY 3ZCOA 5EWEA 3MVPA 3PO3J 4IWYA 3ESWB 2QQBA 1TAEA 3DPLC 1Y1WJ 2BEOA 1X4OA 1YTYA 1WVRA 2P5KA 1H89C 2M4KA 1RETA 3CCQI 2IBKA 5F0HA 2WYOA 2GPWA 4BACA 2DT7B 3PNTA 1OISA 2BGCA 3IV5A 1FMWA 1PDNC 2VJ4A 2VC1A 1BBYA 4HRIA 3RSNA 1HW2A 2XAJA 4X0GA 4AWXB 4BUPA 1KU9A 1KYWA 1T0FC 3BDDA 1IOWA 1RUOA 3CDHA 1GV5A 2RN7A 4M3DA 4I0AA 2BXYA 3W2WA 5KFGA 2RV8A 2KQRA 2ZXHA 2FA5A 2DWCA 3KHHA 4RB3C 3GIIA 3WTUC 5L1JA 4XZ3B 1FSHA 2E36A 2HQNA 1I6HJ 3ZMVA 4XRMA 3W6VA 1FC3A 4HV6A 2W00A 2NVQJ 3WHBA 2HXOA 1HCRA 1ZHQA 2ZC2A 4IHTA 2GLTA 2ZMEC 4ED3A 4CCKA 3N41B 1D5VA 2DZDA 5JR3A 2AGQA 2VBZA 5J1UA 3VYTB 4AIJA 2FB9A 2I80A 2NU6B 3LQRA 3JSNA 2EWNA 4QWCA 5DDGA 4FS2A 1R58A 4IXAA 2XGEA 2GA2A 5T14A 4UUSA 1TL8A 1VQ4I 5IYDJ 3K4LA 1G3YA 2V9PA 4A5MA 2W82A 4CCJA 4IWXA 3N6XA 4BJ6C 2W6NA 1XGOA 2P6TA 5DGAA 1VZ0A 5FFXA 3P9KA 3DKXA 5KFBA 4A93J 4XYMB 2NOJB 5CA1F 1FBUA 2W71A 3HEFA 3K10A 4ZZLA 4EGYA 3AFHA 3WTWC 2VUMJ 1XGSA 1I50A 4ZDPA 5HLGA 3PFYA 5HS9A 2IS4A 1LEAA 2LK2A 2F48A 4IZOA 2MA3A 4MV6A 3PVXA 2V59A 5IOZA 2KISA 3LSKA 3RYRA 3FXMA 3V8JA 2L7MP 2KDOA 1W7PB 3A02A 4EM0B 2ISYA 2GLOA 2NRAC 4KFCA 4K0KH 5FKMA 4BY1J 4KMFA 3GTOJ 1WJAA 5CQEA 5FKNA 4Y4RA 3L4JA 1RESA 1N78A 3FKIJ 2A05A 1UFMA 1BW5A 2HKOA 4A3JJ 3F8CA 1PP8F 4UNOA 2R85A 3RV4A 5IYBG 4RNNA 2LH9A 4LJZF 1ZKGA 5IT3A 4A3MG 1AUVA 1XMXA 2GAUA 5EZYF 3GIPA 1X3UA 3FK7A 3V6KA 1FOKA 5C1OA 2ECBA 4HQEA 4A3EG 1AN7A 2R7MA 3ZMUA 2CKZB 1KJIA 1IBLH 3KX2A 2R86A 3T5JA 5M3MJ 1FJGH 3E6BA 5LEKA 1I7LA 1JKPC 3HOYJ 2Q2EB 4LK0F 1RKWA 4XOPA 1XGMA 1IN4A 3ZMZA 1VQ5I 2W6ZA 3EDPA 3T5XA 4MEXF 1Z0XA 4IRGA 1IRZA 4RNMA 2HQAA 1Z3YA 4CCLA 2FXAA 4B44A 2K40A 3GYHX 2Y9ZA 5EEGA 2VA3A 3D5RC 3I53A 3BQYA 3HOWJ 3BG3A 3C7JA 2W84A 4BKXA 3OYIA 2R7NA 3BABA 1TWGA 2GIZA 2NUAB 3J80W 4BYYA 4WX9A 3ROUA 5E3OA 1BIBA 3NAUA 4RDUA 1TTYA 4AUXA 4QIWE 4F7ZA 4HNTA 3LWFA 3ZQQA 1FT9A 1T56A 3GTKJ 1NH3A 4CXFA 4ENKA 1E4EA 4M72A 5TRDA 1WI9A 3TIIA 2NYXA 5H2FC 2VLAA 2O6GE 5KFHA 3WGHA 1SD4A 3Q8PB 4KICA 3PR4A 3DXJF 1DPUA 5HDGA 1XNRH 2MABA 4Y13A 5H20A 3JR9A 4A2BA 1Z9CA 2OZUA 4CUGA 4EEYA 2AGPA 2LVSA 2VUGA 5B1AH 5C4XJ 4KA4A 1S68A 3GTQA 1FJLA 2VQLA 2COBA 4ZYEA 2W1OA 1K4SA 3FZVA 5GAGJ 1FTZA 4DL4A 2DPDA 1YLFA 2R5ZA 4I55F 5LP6F 4JV2A 4PSXA 5LGUA 4ECXA 3KALA 2ACJA 2A5YB 2LTPA 2MSYA 3P9IA 3AKZA 2CG4A 3MR2A 3K4KA 2M8EA 5CVVA 2VQHA 1P7IA 1CF7B 2OCEA 2PEXA 5KFMA 2K9NA 3WGGA 2UUBH 5D5VB 1SFXA 3PNVA 3LL7A 2DA6A 4XKCA 1IW7F 4D0PA 5LLQA 2IP4A 3BTJA 1SFOA 5BPDA 3A4CA 3VYUB 4RGRA 5BOXA 1HLVA 4IHSA 2R7ZA 4BNCA 2VQGA 2IA0A 3R23A 4L0YB 4LH6A 5B3SH 5GTHC 2RVCA 4CH7A 1NHAA 3IKTA 1E3HA 2A3SA 1VF9A 2MGQA 3FWEA 4NDLA 2V1XA 5F64A 5JVLA 3CUOA 3FBNB 4JK1X 2HZDA 2OA4A 4A3BJ 4A12A 3K3VA 1IBMH 3ZQLA 3QU3A 2D45A 5LMNH 4N9IA 3EQLF 3OOPA 3S1QJ 3V8KA 1J5YA 4FX4A 3I4NJ 2XD4A 3T8TA 4ZTJA 2VOPA 3CDLA 1T3NA 3FKJA 3QYEA 4JI1H 2I8CA 4AC0A 5FRMA 3PO2G 1K83A 1FZPB 2FK2A 3I71A 4X1EA 1WWXA 3CC4I 2ASDA 3OR2C 4UV9A 3K70D 2WB1E 2NVYA 4IKFA 4PK4A 3E0JB 4D5FA 2BZTA 2DMQA 5CA0F 2L9NA 1UG2A 2CSOA 2K5CA 4B4CA 1MMSA 3QYFA 4ECYA 2K27A 5E8GA 2O03A 3VYRB 3OTOH 3OUUA 2ZXWH 1PUEE 2ADUA 1ZG3A 4AYBN 1L0OC 1Z91A 3MKZA 4F4XA 4RMNA 3SZTA 2DO7A 4GGGA 2JA7G 3IP4B 4XKWA 4PFPA 3J7AK 1I94H 4HPQA 3TOBA 5ICFA 3PW5A 4BJ5C 1RUNA 1QU3A 4XX0B 1I3QJ 2KZGA 3GTPJ 1QVUA 1PK8A 2E7WA 3FXOA 4NUBA 5ICGA 1BGWA 4MA5A 4LFCH 2BYVE 1I7NA 2E1MB 1Z77A 1R1UA 4YRVA 2VI6A 3H0GA 3K7AJ 3HOUG 2K9SA 1FOXA 5CB4F 2WY7Q 4ECZA 1XD7A 3WO0A 3Q0WA 2TRTA 3DPTA 4N9HA 1TWHA 2JA5G 1XTAA 3WE3A 1FX7A 3E6CC 3F0CA 4JYKA 2Y2ZA 1MGTA 4ECTA 2JMWA 3WTYC 4X64H 4BY7J 3BJAA 2XUBA 4QWQA 1FEXA 1FLIA 5KFRA 3HOVG 1MJ9A 2MLKA 1HKTA 3BQ0A 2R7QA 1EUDB 3OL3A 1WRJA 5D5UB 3UFXB 3VEPA 1ON1A 2FUG2 3AG2H 2CQXA 2E35A 4M9UA 2LF8A 2YYAA 3MKLA 2ASLA 2Q2TA 4YIIA 2OWOA 3U1KA 4DR2H 2K85A 4XKBA 3S1NJ 2IS2A 2K4JA 4GYIA 4V19K 2KIQA 2R7WA 2KKOA 2RC4A 4IRIA 4KDPA 1U78A 2Q1ZB 2H8RA 4MV4A 1XMQH 1BR2A 4PJNA 2C2DA 2DPJA 3QRFF 4DL6A 3TP3A 2ESHA 4DL3A 2DMNA 1GHCA 4E7SA 3F22A 3GIKA 2GZWA 2Z3YA 3V8LA 3E5QA 1MIJA 2L7FP 3S1MJ 5IT9Z 1IBKH 3KZZA 1BOAA 5J8FA 3GQCA 2YW2A 1Z2PX 3PSFA 2P8TA 3BJOA 4HSRA 3CC2I 2EB7A 3AL0C 2E1NA 1SVMA 2DJIA 2M45A 1HW5A 3BPXA 4ECSA 4ZYAA 5CQGA 2HDWA 5ILVA 1BR4A 4IRCA 2O8KA 3I4MJ 1N33H 5FRNA 1LNWA 2LFBA 3HPGA 1IN8A 3DBLB 3H3VH 2R93A 5K7HA 3W3CA 1G2HA 1W5CC 4F4YA 3L7WA 2JUGA 2XF7A 2XASA 2Y69H 1JT0A 1TW3A 2Y75A 1T36A 4MA0A 4KJZA 1TT5B 4LB6B 3TO9A 5H6QA 2D5VA 4DNCA 5E20A 4DW6A 2R8HA 2FMLA 4YAJB 1D1BA 1ZARA 4LFBH 2E34A 1SMYF 3GLXA 3OYKA 2W6MA 2LF7A 3CTAA 3FMQA 4S04A 3BQ2A 1JIHA 4YJ2F 2IGMA 2QKLB 1BM9A 2DYRH 2RAEA 2W48A 2WV0A 3TW6A 1YFHA 2L0KA 2UUZA 3DKWA 4C2MJ 2YSRA 2V4JC 3TBIA 1FOWA 4DJAA 2PJPA 2DIKA 3RBEA 4A2AA 2DFEA 1M7JA 3L09A 2VIXA 5K1YA 4CO8A 1RYSA 4FE7A 1XDSA 1BOBA 1FP2A 3ZN0A 2VOOA 2VKVA 3GO5A 2Y31A 2DA1A 1JXSA 2XDVA 3I56I 2UWMA 2JRTA 1X2NA 5C3EJ 4OIRF 4UB6C 4XLHA 3KPHA 2FOWA 4YJ3F 1RR8C 1W5SA 3BG5A 3G6VA 4EVIA 3CMAI 4YR2A 2HQRA 4RS8A 3RAXA 4B3RH 5ILSA 4M9SA 3KIOA 3U9SA 1GT0C 1KQ9A 3HUGB 3S2HJ 5KFWA 2MG4A 4PCQA 5KFKA 2QSGX 1S9HA 3BR3A 1Y1WA 5LD2C 1XMAA 5DUKA 3SXYA 4LIVA 1GVDA 3V6HA 3OYLA 2L4MA 2LKSA 3KETA 4ENMA 3ZQGA 2ZJQF 2VBYA 4A3CG 4RB2C 1DIKA 4A0ZA 5HDKA 1A9XA 1W96A 1B9NA 1BL0A 3IKVA 1O4XA 2DBBA 3M9MB 3ZMTA 2FQ3A 3TIGA 1MBFA 1GVJA 5F0CA 1JT6A 2HVRA 5CAEB 2I5UA 1OWTA 1U5TC 5E18F 3VB2A 3Q8SB 2X4HA 1MDMB 3ZQHA 2W9CB 1S0OA 2LDUA 4XONA 3KZYA 3EUHA 2PMHA 3G4SI 1I27A 1X1AA 3G3ZA 1U6GA 3HJEA 3IH3A 1R5GA 1ENHA 1JKRC 4UCSA 4DLKA 3KLOA 3JREA 1OCTC 4DBRA 3FXJA 4I2OA 3HTSB 2QENA 2ICWG 4DYRA 5HNFA 4IVNA 1K4TA 2GM4A 4O6JA 3ORQA 1EYZA 2GIVA 5EDNA 3H5RA 2D1VA 4U87A 1XDUA 3RKXA 5KFOA 1TWCJ 1ZTRA 1JUSA 5E1ZB 3I5UA 4MV7A 3JRDA 2ZXIA 4HOBA 2WBMA 1RC9A 4PUSA 3ZMDA 1MSEC 1K1SA 1VQMI 1TQPA 5D1OA 5HBRB 4V2GA 4DL7A 3PW2A 2JPCA 3R0JA 5DLFA 5KFVA 5LYJF 3FM3A 3U9TA 3JAMZ 2R7UA 2XPVA 3MR5A 2PMZE 4TQRA 4XM3A 3U9GA 4B3MH 5KG2A 2F4OB 5FD5A 4Q5SF 2WAQN 2H1LA 4EATA 4EEQA 3MZYA 1CGPA 1W93A 2QBYA 2RKHA 3L2WA 3CVZA 2R4GA 2VUMA 3KP7A 2L4AA 4O2AF 4J0MA 2UVWA 2KPMA 5HODA 2NU7B 4HLXA 1U9OA 2R7ZG 1UC9A 1ETYA 3MWDA 1T39A 1WH2A 4IHWA 2BY0A 4NB5A 3CCUI 3OYFA 4LH7A 1MBKA 3L00A 2FMYA 2CS3A 1TBXA 2CMPA 4F3QA 4ENJA 1UHWA 5BR8H 3RB0A 2Y0MA 5KT4A 1V9PA 3GTOA 4U88A 1E2XA 3WG7H 2DDAA 5ICEA 2V5AA 3WNZA 2V9WA 5IT9W 3HOZG 2XKPA 1O3QA 4KUMA 1YIJI 1VQLI 1Z3XA 2JVHA 3JSOA 2YZNA 3FKIA 1MNDA 2W7OA 4A3IG 3W6JB 4ECQA 4BXUA 3RB4A 3SFZA 3SZGA 2BV6A 2JA8J 4JI0H 3TINA 2JEIA 4O3OA 4BE0A 1Z05A 2VJJA 2A68F 1Y0UA 3VDXA 4BS9A 3JRBA 4HEA2 3TOAA 3LAJA 5IWAH 3HGYA 5F9NA 1IDYA 4RM3A 1IUFA 1G59A 4JBAA 3EUAA 2CQKA 3JRIA 2E19A 4JI8H 3FM5A 3RGXA 3J81K 3V7RA 2RDPA 4XORA 3LAPA 1H9TA 2CO5A 1YS7A 4ZH4F 2EV5A 2Y48A 1PX2A 2JQ7A 3KEQA 1X19A 1MMAA 2HTSA 1HKSA 3CCLI 4MEYF 3H0GG 1Z7LA 1FIAA 4GYGA 4ED6A 4A6DA 1YJ9I 1R6RA 3FHZA 3OIOA 1SAUA 1G4DA 1Y6IA 2AS5F 5EWFA 4ED1A 5L9XA 1MW7A 4JI7H 4Q47A 5JLXA 3L2UA 1Y56A 4BGDA 4G6TB 1XMOH 5M5XJ 2R7SA 5HV6A 1BJAA 1MNEA 2W6OA 5KG3A 4G12A 2JEFA 3H20A 1VAJA 3ASOH 4NC6A 2L7ZA 3CLQA 2HTJA 3A03A 1ZR4A 2VKEA 2Y0SA 1S9FA 2K3FA 3I3LA 3LP8A 5J2TF 4L9TA 4DUYH 1B4AA 2OBPA 3CP2A 1FYLA 3Q0VA 1S3JA 2JUCA 2H8WA 5KVRA 4IOAF 3HB9A 1U0JA 1JGSA 3GZNB 2OTJI 3MFHA 5KK1A 5LEJA 1T38A 5EJCA 2RNGA 1QA6A 4M3FA 1V5FA 4BWSC 1EUCB 4QWDA 2BY3A 3K0LA 4AVPA 2PJRA 5FLVA 4GO1A 1G3TA 3S16J 1F5TA 3DTIA 4KMUX 5F9LA 4LF8H 3Q9SA 2KDZA 2O5RA 2ID3A 3Q5FA 4EJOA 1GXPA 2IGKA 3RJ0A 4A3DG 4MNUA 2JEJA 1I39A 1ODDA 2ZKZA 2YUSA 5HLTA 4WK8F 1J9IA 2R82A 3KHRA 2FK3A 1IXRC 3V42A 4X65H 4A5NA 2O9LA 1FOYA 1J0RA 3BTIA 4BU2A 5DV5A 5KG6A 4ESJA 1YIOA 2FLNA 3E6DA 4ZHQF 3D1NI 2LSOA 4WD3A 1EZ1A 4KT5C 4EGZA 3GMEA 4C2UA 3KYLA 3FXLA 3GIQA 4U7CA 2IGOA 2K02A 4N4NB 4D1QA 4A3FJ 1V51A 4LF7H 4DGWB 3H3UA 1ETWA 1R4MB 3K4NA 4I02A 1HC8A 1FTTA 4DBQA 2K86A 4HDVA 3V4SA 2R93G 2VC0A 2C2EA 3RKWA 4EJTA 5LGTA 4UY8I 1FY7A 1QVTA 1WJBA 4LLLA 2MLGA 2UVUA 2GA1A 2YX7A 3GUDA 2XCAA 5ED4A 2QUFA 1RJQA 3HRUA 3BROA 2QZ8A 1S8NA 1ZGWA 1KEEA 3IWFA 3C18A 3OYCA 2P81A 3HG9A 3JW4A 3ZGKA 4HAMA 1KJJA 4EJVA 3JAMW 1EV7A 2HFHA 4IRKA 1ETVA 2ELKA 4IZZA 2AQ4A 4QJFA 2E1OA 4IHXA 3G1LA 3BR2A 3I64A 4ZJZA 1C0WA 3GV5B 2A6EF 4YIFA 2E5NA 2M0CA 2FLPA 4IHVA 2X1CA 2TDXA 1TWFJ 4BE1A 4O3QA 1WR2A 3IAS2 1LQ1A 1H88C 1IV6A 3L2PA 3MJFA 1I3QA 3GTPA 2NNYA 3RPUA 2NVUB 1EJ9A 5D8KB 2UXBH 3DBHB 2XSJC 2L9RA 3E5XA 2QK4A 5GAHJ 3OYMA 1GDTA 1HNXH 3KE2A 3ZRGA 1K6YA 3KFWX 3P9CA 5IP7J 4YR0A 3MFIA 1DPRA 4G6DA 4IOCF 5FJ8J 4APMA 2UVRA 5JHFA 5KT2A 3IC7A 1YW8A 2QLZA 2YPRA 3K4BA 5HS8A 4P55A 4DV6H 1T0FA 5FD6A 2ZBKA 4EGJA 1Y1WG 4IR1A 1T33A 3GX4X 4NXNH 3HRMA 1IG7A 3CP8A 2W7NA 1B72B 1Z7UA 1G3WA 1YX3A 3M1EA 5C44G 1M0TA 1QO0D 2PX9A 2QWWA 3LOCA 5EG0B 3HSEA 3A01A 1N75A 3CESA 2COMA 4XBFA 3BR5A 3DCFA 5EGOB 2ZNZA 3NQOA 1X1CA 2XGXA 2VB6A 2ZMEA 2NVTJ 5J4VA 3VWBA 4Q4ZF 2EV6A 4YBZB 2W7PA 4ECVA 2M34A 4ANJA 3MKYB 2P5LC 4O2BF 1MBEA 4C3JJ 3HM5A 3I58A 4YQWA 1OCRH 1UHMA 1R5HA 4KN7X 5JFRA 3EPZA 3CCRI 3VMMA 2KJBA 2GWRA 1ZLKA 3O3KA 5FB2A 1HF0A 5DCMA 2DN0A 2B0LA 1L3LA 5B66C 1EH6A 1J2XA 2VXZA 3DTEA 2V1UA 4WCGA 3HKZE 4RLQA 1R71A 3BC8A 3WTSC 2OF7A 4Y7NJ 2PFBA 2W57A 3T1BA 5GP9A 2LKXA 2KIFA 5CVIA 3OS2A 3BZ6A 3SE7A 3QZ7A 5CKTA 5LXTF 5K5RA 1D0YA 4QW8A 4EV0A 5F0FA 2Z5UA 5B1BH 5D5WB 3MR6A 1PUFA 2XVCA 2YZGA 3LWBA 3ELKA 5ILUA 4A93G 1UMQA 2R7VA 3M3YJ 1LB2A 4IX7A 3MFKA 3K5HA 3C1DA 1YJNI 1XS9A 1IDZA 2VUMG 1BJZA 2VONA 5KFPA 1M1EB 2P6SA 3SEZA 1KQ8A 1UELB 3QOPA 3BQZA 2X6XA 4M6VA 4J9KA 3J7AO 3VYSB 4DV7H 3SDBA 3WTXC 5J1YA 1IF1A 2R8JA 2CGPA 2WDTA 3OYEA 2W6PA 3M9OB 5D5XB 4C2MA 1XDNA 3CUQB 2E5ZA 4QIWN 3I59B 2ECCA 1TP4A 4QPOA 3FBIB 3PR5B 2EZKA 3NWSA 5D6EA 4A69C 1QZZA 1SD6A 2J5PA 3FKIG 4A3JG 2O0YA 4LG0A 1V4YA 5LOVF 2X1EA 2E5LH 3TW7A 4HX7A 3F9KA 1S97A 5DD4A 1LE8B 3GFLA 3CQZJ 2CW0F 2IRFG 2IS1A 5H6RA 5GADJ 3QFFA 2W25A 2QQ8A 2R5YB 4B3AA 1M6VA 2W9BA 5DTDA 1Z2NX 5CJ9A 1BIAA 3TDZC 4X62H 4G3IA 2I87A 1F1ZA 4M7EA 2QYZA 2WAFA 1X1PA 3K1MA 3PQJA 4K2EA 9ANTA 3ERED 2ALZA 5D1PA 4A2UA 3HOYG 2OUMA 1Y14B 2M1BA 3H9QA 3BPVA 1K79A 4OIOF 2B63J 2EZHA 4OU0A 2CH0A 1WKMA 3B6AA 3OR1C 3S2WA 3OYHA 2JA6J 3BR1A 1BXRA 5JVTA 3SJMA 4I50F 5FKLA 5KFAA 2YU9J 2IP2A 1UJ8A 5E3NA 3CO6C 1OR7C 2HOEA 3GTLJ 3M4IA 3HOWG 3AYHB 3H9JA 3GWZA 2CV2A 1S72I 2R92A 1XB4A 3FF5A 2R84A 1R1TA 3H9GA 3BA8A 4EBCA 3CJNA 1HW1A 3MQ0A 5KFXA 1ZELA 3FXQA 3C2BA 4H4KC 2KMUA 1OYIA 4LFAH 2HPMA 2OV7A 2O8XA 5FLMJ 4PJJA 5IYBJ 1GSHA 1U9NA 2KIMA 4AYBA 4IL6C 4UCRA 2BW3A 4A3MJ 1JJ8C 5KFQA 4X66H 1V5EA 4CYCA 3JZIA 4EG0A 1E3PA 2XGQA 3ZQFA 5KT3A 2CV0A 5C4XG 2BHZA 2FMAA 2EIJH 2DA5A 5K7ZA 2A61A 4ETSA 3KCCA 4ZC3A 1TWCA 3LMLA 2H27A 4XQFA 3OYJA 4Y33A 1K78A 5K2MA 4RA2A 1E0EA 3RGZA 5J47A 1A31A 3ZQCA 3SFIA 2XAFA 2OH2A 1YE9A 2WB1N 3H92A 1JE8A 3ABMH 2STWA 3ZOBA 2FP4B 2EFNA 1XSDA 5KT7A 2DFFA 3C2GA 4ON0A 4UUSB 3I0TA 4B48A 3EYIA 3IN5A 2J9GA 3S3MA 5A2QK 1LUJB 2FE3A 2OD5A 2UXCH 3BR6A 1ACIA 3BZKA 1PP7U 2NS8A 4J9RA 2V79A 4OX9H 1TT0A 5KT5A 2BY1A 2E1MC 4XKVA 4C5CA 1LKXA 3O6BB 4E6KG 2GXBA 5EYRA 3RYPA 4BQQA 1FSEA 4BBRG 2JPBA 2UZKA 5L3DA 4KITB 4A3KJ 3EETA 3KHGA 3O8HA 2V4QA 4A3BG 3RJPA 3I4NG 1MBGA 2YRWA 3M4OJ 3CCMI 3S3OA 1P7JA 5KG1A 3PFIA 4HQMA 3L2VA 1RKTA 1QGPA 2DT5A 4Z2YA 2OZ6A 4HF2A 4I4TF 2BE5F 3F8NA 2X1DA 4QWAA 2VA2A 1Q1HA 3BAAA 5KG7A 4R8UA 4TV7A 2EH3A 4H0EA 1VBHA 2K9QA 2KLOA 3MEXA 4C30A 5BNGA 3C2HA 3OYGA 4JV5H 2IXSA 2OJED 1DV2A 3BJYA 1O75A 3BOQA 1H8AC 2XC9A 3F21A 3EPIA 3T5HA 2DA7A 4CSWA 1P2FA 5LRSA 1S0MA 1R7JA 1WCMJ 3IH4A 3PSIA 5EZGA 4RZQA 3G6XA 2QYOA 3CLOA 1NK2P 2E2IJ 4O3RA 4NC8A 2ZFUA 2ME0A 1IC8A 4TQSA 2VASA 2XIGA 1Y8QB 2HYGD 2DMTA 1KJ8A 5KFCA 3HHGA 2VPQA 4B3SH 2UUCH 3CCSI 2EFQA 5HLIA 2LC2A 5L3BA 1MBJA 5E79C 1K1QA 4M6XA 2ZM6H 1SFKA 3TQ1A 4WWCA 1XGNA 1YW9A 1N32H 4JV1A 4NC7A 2X48A 2EV0A 4PWQA 2MFZA 2VT2A 5HVQC 1I6UA 2ELHA 3QYBA 4I01A 4MIMA 4FU0A 2AGOA 4LF6H 1FBQA 3HXLA 1DU6A 4L1KA 3LSIA 1GSOA 1J75A 1QPMA 3PUBA 3QODA 1OCCH 4F55A 1BC7C 4BY7G 3PO2J 1DQUA 1X1BA 4EBDA 2DW4A 4XIDA 4BXXG 4JX4A 2EQRA 2TCTA 4ZI7F 2WAEA 3KTMA 2I8DA 3RDIA 4A6EA 3M9NB 2LY9A 2DCEA 4NQWA 1YITI 1E4EB 2FU4A 3TQTA 2V7FA 2VBXA 3RBDA 4BEHA 2VE8A 1SC7A 2C2RA 4HDUA 1R00A 3GF2A 2HGSA 5FPRA 3QZ8A 1R49A 1ON2A 1B8IA 2DTZA 2JA7J 4C5BA 3CCYA 3FISA 2DFIA 1WI3A 1ZAOA 5J40A 4J01A 3QP6A 5K5QA 4J9MA 4BBSJ 1UB9A 4LOCA 1X3WB 4IAJA 1TQMA 2XPWA 2R5ZB 4XLAA 2MC3A 2O7OA 4MQ9F 5KHDA 2J5OA 1W36D 2BQ3A 2PLYA 2LBFA 2BVMA 2JT1A 2PBIA 3RQIA 1XNQH 4RGSA 2DK5A 2DK8A 2JA5J 3R5XA 5L1KA 4M74A 4ZOLF 2V58A 2HOSA 4XLCA 2F5EA 2CFXA 5KFZA 1USSA 3QOEA 4B43A 3ZP5A 3BT9A 3ONQA 1IJWC 2QM3A 4HSTA 3HOVJ 2DA2A 2FQ4A 2LP0A 4Q8EA 1B6RA 5BPFA 2HYFA 2VODA 5LL6b 2HDDA 3KP5A 3S32A 3ORRA 1ZRCA 4UV8A 2W6QA 3ERMA 1OFCX 1IAWA 3ABLH 1APLC 4F93B 1V55H 2LG4A 4M3EA 2HXIA 4O3NA 2WY8Q 4FBTA 2E2HJ 4V2FA 5FLXK 3CF5F 4QWBA 3E1SA 1ZH5A 4ED2A 3BTLA 2X6OA 2ZNYA 2VL8A 1LEBA 5BMZA 3FMAA 3TO6A 2IJLA 1N25A 1D8KA 1Y8RB 2CUJA 1BJTA 5KFNA 3MR3A 1BI1A 2VJ5A 2GQQA 3J7AY 1AKHA 2JN6A 1QZEA 1WJDA 2R7TA 4ZYHA 1ETQA 2QKMB 4EM1A 1TWFA 3KZIC 2VBWA 2PI0A 2WAQA 4AM3A 3DF7A 1G6NA 2W85A 2L5QA 2G7HA 3S2DJ 1QQIA 5HDNA 1VQKI 2DOFA 5C3EG 1TQIA 2LKPA 1J5EH 2MD0A 1HA8A 2XGPA 2CRGA 2QSHX 4NHJA 2XSDC 5E3LA 1ZR2A 2DLNA 3BG7A 2HGCA 2ZB9A 4CYDA 3WU1B 3QAHA 3T1HH 1VFCA 3BP8A 4Y15A 5DD8A 4ZTFA 1SD7A 3BZCA 4JI6H 4NLGA 3OL4A 1U5TA 3V7CA 5DGBA 2M5WA 1JKQC 5KG0A 4IRDA 1IXSB 3K9TA 4O3PA 2EA4A 4XNFA 3DLLF 5D4SA 1SEUA 5ICCA 2WE6A 2IT0A 1WJ5A 2PMZN 4AIDA 3HTUA 1T08B 1KU3A 1WQ2A 2R92G 2XB0X 3JCUC 1JDBB 3DWLE 3S8PA 5JVDF 4D7NA 2JTVA 4XLEA 1Z6TA 4U7DA 3OHBA 5IYCJ 3CC7I 1TLHB 1S7EA 4MGRA 4F52A 4A3LG 1REPC 1T94A 4L9VA 4MQVA 1A35A 2JEGA 1BI3A 3K1PA 2EBIA 2Z99A 5DEQA 4TV9F 1OCZH 5KFEA 5CYVA 1UC8A 4DR3H 4JOMA 2P4WA 4RUAA 4JX5A 1WJCA 5F1JA 4KIFA 3GIJA 5B5EC 2I10A 5E1WA 4MV8A 3RB3A 2F5FA 3O2PE 2FPGB 4G7HF 1UZCA 4I6ZA 4ME6A 1XSVA 5KFUA 3WU2C 3P7NA 1H9GA 1FIPA 4CGZA 3DFGA 3R0AA 1K7AA 3N43B 2XF6A 3LA3A 1RI7A 3LNQA 3COAC 3R61A 3GEZA 1DUXC 1WZ2A 1JKJB 2M05A 4OAZA 1XCVA 5F1RA 1W0UA 4EYHB 5GPAA 5KG4A 1LVKA 2R8IA 3RPUD 3CZ6A 1P8LA 2OTLI 3RI4A 3RUPA 5DLGA 1BI2A 3F6OA 2X85A 2XHKA 2YL2A 1GUUA 2DQLA 2FBKA 3K5IA 3GV7B 1D1CA 4RGXA 3LA2A 4XLPF 3F3XA 2A07F 5DG7A 3MN2A 1SVOA 2VKHA 3QPSA 2ME6A 5DQGA 2O3FA 3F8MA 4Y8VB 1D8JA 2V1DA 4LF9H 3I12A 4RAYA 4JV0A 3NEUA 5IP9J 1XG1A 2QF7A 4FX0A 3S15J 3CMMA 4PJ0C 3HOXG 1GV2A 4HYKA 1RZ4A 1QRYA 4U6PA 1HXDA 3P5JA 2FNPA 4MO7A 1ERDA 3Q8QB 2ZO4A 1FBSA 5EOYA 1IRFA 2JWTA 5GTIC 1H0MA 4LSXA 1N36H 3H0DA 2VPRA 2R87A 5DUIA 4EM2A 3CQZA 4HNVA 3UR3C 3BCAA 1A36A 2DFHA 2RGVA 3I54A 4RUCA 4EYIB 1YS6A 3KP4A 4OMZA 4P9UA 2DI3A 2EJRA 4IR9A 4D9JA 3T1YH 1MJBA 3OYDA 3K70C 4XOTA 4D5CA 1KJQA 3JSLA 4U7BA 2M30A 4A3GJ 1GXQA 1ZLJA 1SFEA 1JUPA 4RGUA 2V9VA 2NS0A 3NWTA 1VQ7I 1HQCA 1AUXA 4J9PA 4J9LA 5J3LA 3WTTC 3N42B 1UAAA 1PJRA 3ABKH 2HZTA 4XK4A 2B63A 2ZJRF 1HDPA 4J9NA 3DP7A 2JA6A 4BHCA 5CVJA 2DOEA 3WO1A 2QSFX 3J80K 2YU9A 3GTLA 5DS9A 2DT6A 4F50A 4DR5H 1DV1A 2HWVA 4UHTA 1T2KA 3RTRA 1FYKA 5DM6F 2XCLA 4ED8A 1DGRM 1JX4A 4AIHA 4GLXA 4I7HA 2L01A 4MHGA 1Z1DA 1YOVB 1ZETA 4RLFA 5JHUA 4E4HA 3I55I 1F9NA 4A3IJ 2J6TA 4EJWA 5BS6A 2QQAA 1O3RA 3FX3A 1FNNA 2FX0A 5EZHA 2HU9A 3LSRA 5JQWA 2ASJA 5M5WJ 2DLLA 2FRHA 2VQCA 3BG9A 3LSPA 5JH7F 2OU2A 3FXUA 3BLYA 3HRSA 1QHHD 4ITVA 3WHCA 5J4YA 2HYJA 3RKQA 1N56A 3GTKA 3NARA 5AONA 3M8FA 4N4OB 4U0VA 1DP7P 2G0EA 4C3IJ 4GFBA 3K6GA 4OOIA 3HOTA 5FPOA 4CCMA 1NG7A 4U0WA 2IPQX 1KA8A 1TWAJ 2EINH 2KL4A 3O8GA 1VQ6I 2VQDA 1SD5A 1WJFA 2GXAA 2PVPA 3A2KA 3GVAA 2X6YA 4HYEA 3J7ZI 2FBHA 1LDJA 4KT6A 5D8LB 2AU0A 3H3ZA 2FLLA 2E71A 3WE2A 5H80A 1SEIA 1P9QC 2FD5A 3IL2A 2R8KA 3H36A 5D1OB 3U1DA 1C3OA 2XCPA 4B1RA 5DYMA 1VQOI 1XN7A 2X0LA 3H0GJ 3PW0A 4GC6A 3K1NA 4AD9A 1B59A 3BJ6A 3W6KB 3V7SA 4LFUA 4ASNA 2LD5A 3T5KA 1YRNA 5IY5H 1I5ZA 1JUMA 1ZN2A 4E7KA 1VTNC 3EUKL 4I0BA 3DPUA 3KEOA 3AAFA 3GIDA 4DIQA 3SEQA 2LY2A 1IRXA 2A5WA 2HPIA 2VQEH 3L2CA 3G6EI 5TISC 5C5JA 1VQ8I 2QBYB 2V6CA 4DL2A 1IUYA 1ZQ3P 4A3FG 2ZCWA 5HOOA 4KIGA 3FMSA 4QTRA 1KJ9A 4DZJA 3OV8A 4G7ZF 3M8JA 4P5OA 3SQNA 2DQRA 2V26A 2UUAH 1Y1VJ 2IGNA 4R79A 4DV2H 2CWEA 2QGUA 1KU7A 3LSGA 3GTMJ 5L3GA 4DQ2A 1AU7A 2CJJA 2R6FA 1W0TA 4DYCA 5K7FA 2YZMA 5F08A 3HRTA 4OMYA 2PQ8A 5BMVF 2IA2A 4RB1A 4XN0A 1A04A 1DP3A 1JXLA 1IZ1A 5KFIA 1WCMA 2W9AA 3ULQB 1JLLB 2H1KA 3QPLA 3ISPA 4IQJA 2YS6A 4F4WA 2E2IA 1QNTA 5BQTA 4HR7A 3V6JA 4UCVA 1K61A 1JJ6C 1VQNI 5L3CA 1OMIA 3IG0A 1O7LA 4OAYA 4QLCU 4XSXF 2Z33A 4YAKB 3UKGA 1GLVA 2LY1A 4RZRA 2NU8B 2M7BA 4XRSA 4MLOA 3IHUA 1FP1D 3K69A 5IP6A 1UHSA 4CICA 2HS5A 1R9TJ 2FKLA 4Q8FA 3HKZN 3ML6A 1KGSA 5HNHA 3PN1A 3F6VA 4QIWA 3A0BC 2X0SA 4E70A 3C0FB 1YX5A 4MFEA 3HL2A 2UXXA 1P4WA 1A6IA 4M9XA 2JJ7A 1EKEA 4QSHA 3R5HA 4CCNA 1IOVA 3U21A 1VQ9I 2DDBA 4XYLB 1W7PA 2PG4A 2ZJTA 1FMVA 3PW7A 3PO3G 2R7DA 2WWYA 4FISA 4J19A 4YB8B 3GIMA 3MCZA 4J9OA 2J6UA 1BC8C 1P4AA 1OQYA 2DPIA 1U8RA 3H3VK 3FDSA 3H4DA 3J81Z 2JA7A 3MKWB 4O3MA 2EFOA 2GPSA 2FOKA 3ASNH 2CUFA 4N0BA 4PZJA 2CW7A 3BR0A 1N77A 1V54H 2HVQA 3CUQC 1B6AA 2N8GA 2CUEA 1MD0A 4LLGF 3Q0UA 2YU3A 1ETXA 3CJRB 3BG6A 4F92B 5D4RA 4DR7H 4L5JA 5J6XA 4Q0YA 4RB0A 3GCMA 4BHPA 1CQIB 2Q2EA 4XL9A 4MAMA 1S0NA 1L2ZA 2MCTA 1JHFA 4M3BA 2C6YA 2JA5A 4DV1H 3RIRA 2PJRB 1LFBA 4G94A 3N05A 1HSJA 1T95A 1MSFC 2E1CA 2YS9A 4E7HA 3E7LA 2MD5A 4UCTA 1O3SA 3ZQ7A 3DV8A 1TNTA 1KZHA 1I1SA 2R7LA 3VOEA 3GFJA 3K2ZA 3ZR8X 2Q0OA 2V1NA 5ERIA 2Q2UA 2HQ5A 3ZMSA 5C44J 5E17F 5IYDG 2YS7A 2NVXJ 2JVGA 3W2AA 5KNLA 1HBXG 3GW2A 1O57A 3OYAA 1LPQA 2L9VA 2XV4S 2E2HA 3X2QH 2KRHA 2M0MA 2MH9A 2G9WA 3OSNA 2GBYA 4I76A 3K2AA 3G1MA 3MAJA 1W4MA 4W1UA 3KP2A 2AQEA 3JTGA 5LMUH 3OUZA 4CDGA 3H1CA 4XRFA 1RJRA 2W8LA 2C28A 4UXNA 2H09A 4L9NA 1ZG1A 3RFCA 1VKZA 4GC7A 4JI3H 3W2VA 3HC7A 4G8XA 4XN3A 2ZSHB 3PIPF 2VT3A 5GAEJ 1VQPI 2CZGA 5CVUA 1OKRA 2WB1A 2DA4A 1ZG5A 4B47A 4HLYA 1YO5C 1HSTA 1WFXA 2DOAA 2Y0SE 1RNLA 2YR2A 1S6LA 3MD2A 4BY1G 4BQOA 2HJWA 1Q1VA 2L7KA 1M0WA 3PNYA 4R8HA 4RM2A 3ETHA 3RKYA 1MMGA 3CCVI 4BE2A 3KP6A 2VN2A 4EGQA 3RIZA 1CF7A 2G7UA 5AIQA 2W24A 1OR7A 2MH2A 1CQTA 1S7AA 1E3OC 2AXLA 2RDIA 4HG2A 5KT6A 4YFNF 3ZN1A 2B63G 3JSPA 1FYMA 2R7KA 2JA6G 4UUTA 1LDKB 4ZYDA 5DQHA 3MWEA 5FKOA 5D6FA 1YQAA 3AG4H 4ESBA 1SANA 1RIOH 1S10A 1WSCA 2XAGA 1XC5A 3R60A 5F6FA 3Q9VA 1EH8A 2A6HF 5TJJA 2K9MA 6PAXA 3PL8A 3KXYT 2UV1A 2SCUB 3CJTB 2DU9A 3SI8A 3OMYA 3VODA 2YCHA 1BW6A 2A6TA 3KEYA 3FK6A 2C00A 4C5AA 5FLMG 2VQFH 4GRIA 2IA6A 3A01B 2F2EA 4OWRB 2ZDQA 3H35A 4P96A 4KHPH 1UCRA 1PVEA 1XCBA 1T6SA 3HDDA 2LNBA 1I6XA 2ZMEB 4UCUA 2RF4A 4EQQA 1IRGA 3PIOF 3ECOA 5LHGA 1TC3C 2ESNA 4BH9A 4KIBA 4F4ZA 4M3GA 2NS7A 2CUZA 4DR1H 4S05A 2MBFA 1JTXA 1LVAA 4A3EJ 1IN5A 3GTGJ 5J1RA 2CW8A 5DCMB 4BQAA 2L9SA 5E1XA 3AG3H 3TQNA 4HBLA 2VJIA 4ED0A 2DXIA 3B02A 2B9SA 3GZ5A 4ENNA 4UFZA 1EHIA 1UG0A 4L18B 3C3WA 3S3NA 1OCPA 3D0SA 1QPIA 1FVIA 3M1CA 3N8DA 2ZDHA 4E7LA 5KAFC 3ZQIA 4O4LF 3R5FA 5IYZF 2CQQA 4E7JA 1OCOH 1X58A 4JI2H 1SCUB 3J81W 4ECWA 4MTEA 2VE9A 1JI8A 4EFEA 1PUFB 5KFLA 4B3XA 5J2UF 2R7RA 1SAXA 4CC6A 2BY2A 4O4HF 3CMEI 1YW7A 2HNHA 2ID6A 1NTCA 1XX5A 1VBGA 5IT9K 3L2QA 2UXNA 1O3TA 4A3KG 3RPQA 5LA6F 2YX4A 2FPPB 1YHQI 2Y30A 4BL0B 4TUYF 3GTJJ 3GLKA 4I98B 2ZJPF 3K3PA 4HF1A 3T5LA 1R4NB 3R6SA 2HDCA 4DL5A 4IPAA 3WGIA 2FPIB 2XB5A 1AA7A 4GCVA 3OSGA 5LFAA 1TNSA 2E2JJ 2BR0A 4W97A 4Q44A 1MNMC 4LG0B 5JUMA 1J09A 3JTHA 4IHYA 2STTA 1A0IA 5FO5A 4S0HB 1YYVA 1HNWH 1R5ID 2EIKH 5LGNA 4QWEA 3KHLA 4DR6H 1WCMG 2W9BB 2IEKA 5CVRA 3LQQA 4FQGA 3QPTA 3BWGA 5C8YF 3JRFA 4B09A 2Q8KA 4PGHA 1Z2OX 2XAHA 2FJ1A 1RJPA 5EEAA 3Q8RB 3OSPA 1R36A 5LBQA 1ZK8A 1B33N 2X9DA 4BBRJ 3HYIA 4CA0A 4ZDOA 2P0WA 1JGGA 2LREA 4XRSG 3Q1KA 3BQ1A 2AO9A 3DQVC 1P6RA 2LOOA 4LLNA 2OQRA 1DU0A 1EF4A 2CYYA 4PJLA 1XSXA 5LHIA 4EBEA 3VPCA 2EFPA 1VS0A 4GDFA 2FEZA 1OLTA 4XICA 5L3FA 3QU6A 2OQGA 4J00A 1FKAH 2OPTA 3KLNA 2F5CA 2L02A 3MZHA 3RTXA 1I3AA 3DF8A 4BAYA 3N4MA 2ELJA 2XGDA 3H4BA 4GKJH 3CJQB 2JRMA 1D0XA 1V5GA 3KYDB 4L5EA 2NOGA 3OY9A 2CFOA 3AG1H 5M3FJ 2BW3B 3OWTA 3DEWA 3SYTA 2D2WA 5JVGF 1MZBA 3TL4X 4KYWA 1B9MA 4CYCB 2V6EA 3E5NA 3U2RA 1MH3A 1ONVA 1BNCA 1C30A 1TWAA 2IMWP 4MFDA 2WTEA 4PFOA 3JRGA 1BA5A 5KX5F 4GKKH 2EFWA 1ORKA 2W8KA 2AHQA 2PN6A 2O61A 5GONF 4YEJA 3F23A 2FSWA 3GZ6A 2BHYA 4BBSG 1KYZA 3CMYA 1K78B 4LGWA 2EK5A 4MV9A 4MTDA 4DV5H 5IOYA 2PN1A 2IVMA 2PMZA 3TO7A 3HOSA 3S1RJ 2VR1A 1RRJA 3TP0A 2BQUA 3HUGA 4HNUA 2CQYA 4IQ4A 1K6OA 3RQ4A 2HKXA 4YP3A 3OYNA 2IS6A 2RREA 3TEDA 4UB8C 3RAQA 2VPSA 3HOUJ 5C1PA 2E60A 5KAIC 3JRWA 4DOZA 3I9V2 1N34H 1HR0H 2GXGA 3IRQA 1SVLA 3BY6A 4BJTA 2P7CB 5CPRB 3LSTA 4BXXJ 2W4SA 5DCFA 3Q2OA 2EPFA 2CV1A 1OPCA 3QPHA 4AQYH 2OAZA 4ZZDA 3OHAA 5EWGA 3HSFA 1F43A 4KN4X 3HHHA 1V4RA 4PGGA 1Y1VA 2JK3A 3I4MG 1NK3P 1GYFA 3G1OA 4RBOA 4WXDA 2AQFA 1MDMA 2W9CA 2KRFA 2ETHA 4EEFG 1U2WA 3JAMK 3VPBA 1B04A 2HOAA 3GTMA 3FMRA 4WF2A 4IHJF 3CF2A 1IO2A 3LFUA 4LK1F 2ZSIB 2JA2A 5F04A 4QPQA 2XPUA 2MYSA 4HA8A 4UVCA 4B8XA 4DZPA 1AOYA 4AYBE 3GILA 2QEXI 4JYAH 3UNGC 1GGOA 2P0AA 4DR4H 3VPDA 5A2QZ 3KAJA 2F4IA 4YY3H 2HR3A 5L1IA 4DYQA 2EZIA 4R8UB 4MV1A 4LIUA 1AHDP 2DJNA 4G9YA 3OS1A 2LMDA 1D1AA 4BXFA 3S93A 4FCYA 1D3YA 4E7IA 3D5SC 4M73A 3H5NA 5FFZA 2V4RA 4DV3H 4IRHA 1R9TA 3GFIA 1ZHFA 3ETJA 2ATLA 2GOMA 5E8IA 4XSZF 3HBLA 4BDZA 5AIPA 2L3DA 3DLAA 4O5VA 3G71I 1F4KA 1UNNC 2QA4I 3V4ZA 1S7OA
chains in the Genus database with same CATH topology
3E5UA 1ZGAA 4FM9A 3ECHA 3HIFA 2M87A 4AIKA 2H6CA 3T0YA 1P4XA 2XAQA 1OYWA 1FWZA 2KSWA 3N97A 3VFZA 1IN7A 4DV4H 4YFKF 2VOBA 3ABUA 3L4KA 1SMTA 4YFXF 4UCOA 2L54A 2JSCA 3M8EA 2FNAA 4EMSA 1ZRDA 4HX8A 4IJAA 4CZZA 4Y17A 2DAOA 1E17A 3GXOA 3TGNA 1ZGJA 2IA1A 4JI4H 3HSRA 2Z9OA 1V3FA 2K7LA 3DEUA 2NAZA 4G6QA 4HW0A 2FF4A 4HF0A 4I09A 2KIUA 4R7RA 4EJUA 5J8CA 4OIPF 4LSAA 1KU2A 5FGMA 2KJCA 4RAZA 4L0ZB 4LMYA 3QP5A 1TW2A 4A0XA 4L9JA 1S03G 2DTRA 4YHHH 1IXCA 1W7PD 1O7FA 1XMKA 2ZXJA 4DV0H 2PMUA 4UVBA 1QZYA 1ZRFA 3M7GA 1LJ9A 2H94A 1YG2A 3E97A 2R3SA 4CHUA 2ISZA 5FLXZ 2NNNA 3F8FA 4LD5A 1AWCA 1T98A 1DGSA 5HS7A 1R22A 4M6YA 3E3VA 3TDUC 4UUVA 2RGRA 1TA8A 1W5TA 4L5IA 3V4GA 4BHBA 3RF2A 1U5TB 5A2QW 5HLHA 4OINF 4JI5H 4HX4A 1DDNA 4NXMH 3WODF 2DPUA 5LRRA 2ZJ2A 2D1HA 3LFKA 2XROA 2K4BA 2BBYA 1X9NA 2JZYA 2QQ9A 3M9AA 4UVAA 3WG9A 1SYXB 1MJAA 5JI6A 4FT8A 3FXRA 1S29A 2H27A 2F5DA 5LHHA 1SFUA 1ZHSA 3EYYA 1KQ0A 5EEHA 1P92A 2HHHH 2A69F 3L9FA 3T8RA 5BPIA 1B1BA 4LF4H 4XLNF 3SZPA 1OYYA 3N44B 4P9FA 4ESFA 2ZFWA 3F8BA 3GFMA 2RNJA 1BI0A 2QVOA 3MWMA 2E7XA 4JQFA 2RQPA 3NRVA 3REOA 3D5LA 2FBIA 4EFBA 2HEOA 3KP3A 1ULYA 3R4KA 2XKOA 4Q48A 4B3TH 4FHTA 1STZA 2H6BA 2XRNA 2F4VH 1IN6A 4IF4A 3CO7C 4G7OF 4WXCA 1FPQA 4ZYGA 1J59A 3PQKA 3LA7A 1LDDA 4KNYA 1E4FT 1USTA 3ABTA 1MKMA 3WTZA 3WU0A 3SHFA 3IRRA 3N40P 4PDBA 1G3SA 1J7KA 3BA9A 3I4PA 1QBJA 3E6MA 1EH7A 1Z6RA 4A0YA 4OIQF 2R7FA 3UQ8A 5K5OA 3IWZA 3WTVC 5CLSA 1BN5A 2UXDH 4M9ZA 2IW5A 4WXHA 4GXOA 2UU9H 2EA2A 3F72A 4M71A 4CC5A 3B73A 3CUQA 3I59A 4HZFA 2P7VB 5FLXW 1ZYRF 3KAKA 4U0YA 1U3EM 4YG2F 3J80Z 3TKYA 1JHHA 1HNZH 2HVSA 4HV5A 3G73A 3ZPLA 4LF5H 1E4GT 1R23A 4DUZH 1R1VA 1HKQA 4R1HA 4LB5A 1I1GA 5L3EA 4PDKA 2P5VA 1WSUA 2WC2A 1ZREA 2QQBA 1TAEA 3DPLC 2BEOA 1YTYA 2P5KA 2WYOA 2BGCA 1PDNC 2VC1A 1BBYA 1HW2A 2XAJA 4AWXB 1KU9A 1KYWA 3BDDA 1RUOA 3CDHA 2RN7A 4I0AA 2RV8A 2FA5A 4RB3C 3WTUC 1FSHA 2HQNA 3ZMVA 1FC3A 4HV6A 1ZHQA 4IHTA 3N41B 1D5VA 5JR3A 2VBZA 4AIJA 3LQRA 3JSNA 2EWNA 5DDGA 1R58A 4IXAA 2GA2A 1G3YA 4A5MA 3N6XA 1XGOA 2P6TA 5FFXA 3P9KA 1FBUA 4ZZLA 4EGYA 3WTWC 1XGSA 5HLGA 5HS9A 1LEAA 2MA3A 3RYRA 3V8JA 2NRAC 4K0KH 1W7PB 4EM0B 2ISYA 4KFCA 4KMFA 3L4JA 1UFMA 2HKOA 3F8CA 1PP8F 4UNOA 4LJZF 5IT3A 2GAUA 1X3UA 1FOKA 4HQEA 1AN7A 3ZMUA 1IBLH 1FJGH 3E6BA 5LEKA 4LK0F 1XGMA 1IN4A 3ZMZA 3EDPA 3T5XA 4MEXF 4IRGA 2FXAA 3GYHX 5EEGA 3I53A 3C7JA 2W84A 3BABA 3J80W 4BYYA 4WX9A 3ROUA 1BIBA 1TTYA 4F7ZA 3LWFA 1FT9A 4CXFA 4ENKA 5TRDA 4M72A 1WI9A 2NYXA 2O6GE 3WGHA 1SD4A 4KICA 3DXJF 1DPUA 5HDGA 1XNRH 4Y13A 5H20A 4A2BA 1Z9CA 2OZUA 2VUGA 4KA4A 1S68A 4ZYEA 3FZVA 2DPDA 1YLFA 5LGUA 3KALA 2ACJA 2A5YB 3P9IA 2CG4A 5CVVA 2M8EA 1CF7B 2PEXA 3WGGA 2UUBH 5D5VB 1SFXA 1IW7F 4D0PA 5LLQA 5BPDA 5BOXA 4RGRA 4IHSA 4BNCA 2IA0A 4L0YB 4LH6A 2RVCA 1NHAA 3IKTA 2A3SA 3FWEA 5F64A 2V1XA 3CUOA 4JK1X 2OA4A 4A12A 3K3VA 1IBMH 5LMNH 3QU3A 2D45A 4N9IA 3EQLF 3OOPA 3V8KA 1J5YA 4FX4A 3T8TA 2VOPA 4JI1H 1FZPB 3I71A 1WWXA 4UV9A 2CSOA 2K27A 5E8GA 2O03A 3OTOH 1PUEE 2ADUA 1ZG3A 1L0OC 1Z91A 3SZTA 2DO7A 4GGGA 3J7AK 1I94H 3TOBA 5ICFA 1RUNA 2E7WA 1BGWA 5ICGA 4LFCH 2BYVE 1R1UA 1XD7A 3DPTA 4N9HA 3WE3A 3E6CC 1FX7A 1MGTA 3WTYC 4X64H 3BJAA 2XUBA 4QWQA 1FLIA 1MJ9A 2MLKA 1HKTA 1WRJA 5D5UB 3VEPA 1ON1A 2LF8A 2Q2TA 4YIIA 2OWOA 4DR2H 2K4JA 4GYIA 2KKOA 2RC4A 4IRIA 4KDPA 1U78A 1XMQH 3QRFF 2ESHA 1GHCA 3F22A 2GZWA 2Z3YA 3V8LA 3E5QA 5IT9Z 1IBKH 3KZZA 1BOAA 5J8FA 1Z2PX 2P8TA 3BJOA 2EB7A 2E1NA 2M45A 1HW5A 3BPXA 5ILVA 1N33H 1LNWA 1IN8A 3L7WA 2XASA 1TW3A 2Y75A 4LB6B 3TO9A 5H6QA 4DNCA 5E20A 2FMLA 1ZARA 4LFBH 1SMYF 3GLXA 2LF7A 3CTAA 3FMQA 4S04A 2WV0A 1BM9A 1YFHA 3DKWA 2YSRA 2PJPA 4A2AA 3L09A 5K1YA 4CO8A 1XDSA 1FP2A 3ZN0A 2VOOA 3GO5A 1JXSA 2UWMA 2JRTA 4OIRF 1W5SA 4EVIA 2HQRA 4RS8A 4B3RH 5ILSA 4M9SA 1KQ9A 4PCQA 1XMAA 5DUKA 3SXYA 2L4MA 3KETA 4ENMA 2VBYA 4RB2C 4A0ZA 5HDKA 1B9NA 3IKVA 2DBBA 3ZMTA 2FQ3A 1GVJA 2HVRA 1U5TC 5E18F 3VB2A 2X4HA 1MDMB 2LDUA 3KZYA 3EUHA 2PMHA 1I27A 3G3ZA 1U6GA 1R5GA 4UCSA 3KLOA 4I2OA 3HTSB 2QENA 4IVNA 4O6JA 2GIVA 2D1VA 1XDUA 3RKXA 4MV7A 5E1ZB 3I5UA 4HOBA 3ZMDA 5D1OA 1TQPA 2JPCA 3R0JA 3FM3A 3JAMZ 3U9GA 4B3MH 4Q5SF 5FD5A 4EEQA 3MZYA 1CGPA 3CVZA 2QBYA 2RKHA 3KP7A 2L4AA 4J0MA 4HLXA 1T39A 1WH2A 4LH7A 4NB5A 3L00A 2FMYA 4ENJA 1TBXA 5BR8H 1UHWA 2Y0MA 1V9PA 4U88A 1E2XA 5ICEA 5IT9W 2XKPA 1O3QA 4KUMA 3JSOA 3W6JB 4BXUA 3SFZA 2BV6A 4JI0H 1Z05A 2A68F 1Y0UA 3TOAA 3LAJA 5IWAH 4JBAA 2CQKA 4JI8H 3FM5A 3RGXA 3J81K 3V7RA 3LAPA 2RDPA 1H9TA 2CO5A 1YS7A 4ZH4F 2EV5A 2Y48A 3KEQA 2HTSA 1HKSA 4MEYF 4GYGA 4A6DA 3FHZA 1G4DA 2AS5F 4JI7H 4Q47A 1XMOH 1BJAA 3H20A 2HTJA 4L9TA 4DUYH 1B4AA 2OBPA 1FYLA 1S3JA 5KVRA 1JGSA 5KK1A 5LEJA 1T38A 4BWSC 3K0LA 4AVPA 4GO1A 1G3TA 1F5TA 4KMUX 4LF8H 3Q9SA 3Q5FA 4EJOA 1GXPA 3RJ0A 4MNUA 1ODDA 2ZKZA 4WK8F 1J9IA 1IXRC 4X65H 4A5NA 1J0RA 5DV5A 4ESJA 1YIOA 3E6DA 2LSOA 4KT5C 4EGZA 2K02A 4LF7H 3H3UA 4I02A 2K86A 4HDVA 2VC0A 3RKWA 4EJTA 5LGTA 1FY7A 4LLLA 2MLGA 2GA1A 2YX7A 3GUDA 5ED4A 2QUFA 3HRUA 3BROA 2QZ8A 1S8NA 3IWFA 3C18A 3JW4A 4HAMA 4EJVA 3JAMW 1EV7A 2HFHA 3I64A 1C0WA 2A6EF 4YIFA 2TDXA 1LQ1A 3L2PA 2NNYA 3RPUA 5D8KB 2UXBH 3E5XA 1HNXH 3KE2A 3KFWX 3P9CA 1DPRA 4G6DA 4APMA 3IC7A 1YW8A 2QLZA 2YPRA 4DV6H 5HS8A 4P55A 1T0FA 5FD6A 2ZBKA 4NXNH 3GX4X 3HRMA 1Z7UA 1G3WA 3M1EA 1M0TA 1QO0D 2QWWA 3HSEA 2COMA 4XBFA 2ZNZA 3NQOA 2XGXA 2ZMEA 4Q4ZF 2EV6A 2P5LC 3I58A 1UHMA 1R5HA 4KN7X 5JFRA 2KJBA 2GWRA 1ZLKA 3O3KA 5FB2A 5DCMA 2B0LA 1L3LA 1EH6A 1J2XA 2VXZA 2V1UA 4WCGA 3WTSC 2PFBA 2W57A 3T1BA 2KIFA 5CVIA 3BZ6A 5K5RA 4EV0A 5D5WB 2Z5UA 2XVCA 3ELKA 5ILUA 1LB2A 3MFKA 3C1DA 2VONA 2P6SA 1KQ8A 3QOPA 3J7AO 4DV7H 3WTXC 1IF1A 2CGPA 2WDTA 5D5XB 1XDNA 3CUQB 3I59B 5D6EA 1QZZA 1SD6A 2J5PA 2O0YA 4LG0A 2E5LH 4HX7A 5DD4A 3GFLA 2CW0F 2IRFG 5H6RA 2W25A 1Z2NX 5CJ9A 1BIAA 3TDZC 4X62H 1F1ZA 4M7EA 3K1MA 3PQJA 4K2EA 3ERED 5D1PA 4A2UA 2M1BA 1K79A 3BPVA 4OIOF 4OU0A 1WKMA 3S2WA 5JVTA 2IP2A 3CO6C 2HOEA 3M4IA 3GWZA 1XB4A 3FF5A 1R1TA 3BA8A 3CJNA 1HW1A 3MQ0A 3FXQA 4LFAH 1OYIA 2O8XA 2KIMA 4UCRA 4X66H 2A61A 4ETSA 3KCCA 3LMLA 1K78A 3RGZA 2XAFA 3H92A 1JE8A 2STWA 2EFNA 1XSDA 4ON0A 3EYIA 3I0TA 5A2QK 2FE3A 2OD5A 2UXCH 1PP7U 2V79A 4OX9H 3O6BB 2GXBA 3RYPA 1FSEA 2JPBA 2UZKA 5L3DA 3EETA 3RJPA 3PFIA 4HQMA 1QGPA