4RAYA

Crystal structure of magnetospirillum gryphiswaldense msr-1 apo-fur
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
136
structure length
135
Chain Sequence
b'GHMVSRIEQRCIDKGMKMTDQRRVIAQVLSDSAHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
total genus 44
structure length 135
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rayA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rayA02
2NS0A 1IZ1A 3DPTA 4EM1A 4HDVA 1XSVA 5ILSA 1G3YA 2DLLA 3WG9A 1XGNA 2BEOA 5HLGA 1W4MA 1LEAA 3FF5A 1J2XA 3SFZA 4IHTA 3CUQA 3EETA 4H0EA 4ESFA 2K4BA 3IL2A 1ZGJA 2ELHA 2XVCA 3RYPA 3JTHA 2A07F 3IWZA 3LSTA 4AIJA 5LGUA 4ZYDA 2E7WA 2D45A 3FXQA 5TRDA 1W5SA 1RIOH 1JXSA 2QQ9A 2KIMA 2P8TA 3FMSA 2EFPA 4Q48A 1XDSA 5L3CA 2Z3YA 4LGWA 1R58A 2P5LC 5D4SA 1VTNC 2PLYA 3BJOA 2HYGD 3PQJA 4FX4A 4EJUA 3ABUA 4WX9A 2QUFA 4JK1X 1XSDA 3C1DA 5E1ZB 4RAZA 3LWFA 3ECHA 1RNLA 4LFUA 3LA3A 3H92A 3CTAA 1DPUA 3IC7A 3MZYA 3GO5A 5D6FA 5FGMA 5E18F 4G9YA 4A6DA 1AOYA 3BP8A 4ETSA 5LGNA 3NQOA 2RNJA 1T6SA 5A2QZ 3QP6A 3V4GA 4Y13A 1UHWA 1FWZA 1SD7A 1XMKA 2VBZA 1FLIA 4N0BA 1O3SA 3ZMVA 1HW2A 1RUNA 2A6EF 4LLNA 4HX7A 4IJAA 4M6YA 2HGCA 4PGHA 4EJTA 4CHUA 4A12A 3WGHA 2NRAC 3R60A 3V7CA 5AONA 5E20A 1G6NA 3BPXA 3TQNA 1H9TA 1J7KA 1USTA 1GXPA 2VBYA 4G6DA 2PJPA 2GA1A 1S8NA 1BC8C 1LEBA 5E17F 3I53A 1GXQA 3RKWA 3GEZA 3TGNA 1MJ9A 1IN7A 5DV5A 4RGSA 3KP6A 2MLKA 3GX4X 4BNCA 4MTEA 2VC0A 1V4RA 1OYYA 2IRFG 2GXGA 1BOAA 1LJ9A 2EV6A 5FD6A 1FNNA 1MGTA 1OMIA 5F1RA 5HDKA 4R79A 3B02A 3GFIA 2P5VA 3HRMA 3HOSA 1L0OC 2HFHA 1KQ0A 3KP7A 2HTJA 2NAZA 4HQMA 2FMYA 5H20A 1T98A 1MJAA 4R8HA 1ZH5A 2EFOA 4LG0A 2YX4A 3C7JA 2XGXA 4U7BA 1WSUA 5L3EA 4Q4ZF 1BJAA 4HA8A 1YG2A 4UUVA 3L00A 4UHTA 3MCZA 3FWEA 3VODA 3Q9VA 1Y0UA 3V8JA 1BI2A 4G6QA 3HTSB 2YR2A 2EA2A 4GYIA 2Q8KA 3HYIA 1CF7B 3L7WA 4A5NA 2C6YA 3J81Z 2B0LA 3VEPA 4K2EA 2OZ6A 2GWRA 2QYOA 4CGZA 3E6MA 1FP2A 3MZHA 2Z5UA 3F8BA 3W6JB 3F22A 5D5XB 4L0ZB 1ZHFA 1W5TA 3I54A 2BV6A 1P92A 1A04A 2ISYA 1FZPB 2LF8A 4BYYA 4KYWA 2FU4A 3N97A 1PUEE 3DF8A 3IKTA 2ZKZA 1ODDA 2L01A 3WTWC 1IXRC 4HDUA 4IHSA 1YW8A 3F6VA 3T8RA 3T1BA 4S05A 4NB5A 1FX7A 4ZH4F 3C3WA 1TW3A 2OD5A 1BIBA 2EV0A 5BMZA 4KIBA 2M5WA 1ZG5A 2W57A 3I64A 1ZG1A 1ZAOA 2V1XA 2P6TA 1SFEA 3K9TA 1WRJA 4L9TA 2ISZA 2EFWA 2JZYA 3WU1B 3KCCA 4ENJA 1LDJA 5F64A 1KQ9A 3D0SA 4OIRF 4OMYA 5CVVA 2NNYA 2FBIA 4YFXF 3AAFA 5FFXA 3DP7A 1B9MA 2FXAA 3M9AA 1QNTA 1PP8F 1KGSA 4P55A 4L9JA 4M9XA 2DK5A 3KP2A 2L3DA 1R00A 3MWMA 4G7ZF 4HAMA 4FT8A 3L2CA 3GFJA 1ZRCA 1UFMA 2IA1A 4UVBA 2HEOA 3K69A 2J5OA 2VE8A 4L0YB 4I02A 2CSOA 1FSHA 3RI4A 4U0YA 5LHIA 1XSXA 4MGRA 1KQ8A 3KZYA 1KU7A 4L5IA 4CZZA 2Y75A 3SZTA 2WTEA 2L02A 3O2PE 3J81K 1XD7A 4RB2C 2TDXA 5FLXZ 4IVNA 2OQGA 1BI0A 5D5WB 2EB7A 2H94A 2DPDA 2JPBA 4L5JA 3VFZA 3QU6A 2HKXA 3F8MA 2HWVA 4MEXF 4A0YA 5AIPA 5LRSA 2RGVA 4EJOA 1G3WA 1IRFA 1R1TA 2D1VA 4B09A 5CLSA 1QO0D 3M8EA 1J0RA 2Q2EA 5HOOA 2K02A 4XLPF 2L4AA 1ONVA 5HDNA 2BYVE 3OV8A 3WE3A 3G73A 5DD4A 4I0AA 1B59A 5HLIA 3U9GA 2YX7A 1FBUA 2ESNA 3W6KB 1Z6RA 4KNYA 3JTGA 1Z05A 2JTVA 1YYVA 2PG4A 1HKTA 1UHMA 3CJNA 4ZZDA 4HLYA 1P4AA 5K5QA 2NYXA 1FBQA 2DPUA 4OIPF 3DV8A 4F7ZA 4IRGA 4CICA 1TQPA 4KT5C 5DEQA 5CJ9A 1QGPA 2ZXJA 5KVRA 4ESBA 4ON0A 5CVIA 1F4KA 2Q0OA 3JSPA 1U5TB 2VONA 4IRHA 1LDDA 1K6OA 1IXSB 1TNTA 4ENMA 2FNAA 1Z91A 5JHUA 5FFZA 3WTTC 1CGPA 2XUBA 5ICGA 3VB2A 3E5XA 2YPRA 4E70A 3LAJA 2W25A 4U7DA 3FXRA 5D8KB 2A6HF 1MDMB 4WXDA 2ETHA 1Z9CA 1D5VA 1R5GA 2WV0A 3RKYA 4OIQF 2QZ8A 3K1PA 5FLXK 4A0XA 4UVAA 1BI3A 4XSZF 5JFRA 5H6RA 3KFWX 2V6CA 2PEXA 5BQTA 1U6GA 4UV9A 3BJ6A 2VXZA 3GVAA 1SFUA 1G3SA 3K1MA 2M8EA 4IRIA 1KU3A 4LK0F 2VC1A 5DCMB 5J8FA 1R36A 4GYGA 2CWEA 4UVCA 1DUXC 2F2EA 1IXCA 4LG0B 2V9VA 5ERIA 5KK1A 1WKMA 3LFKA 1TBXA 3COAC 1KA8A 5CVUA 3RPQA 5K5OA 4EM2A 1B6AA 3P9IA 3FHZA 1TQMA 1D3YA 1SFXA 2F5DA 1S3JA 5HS9A 2MBFA 1BBYA 2O03A 4R1HA 4PCQA 1ON1A 4JQFA 2RN7A 1USSA 3HRSA 1YS7A 5D5VB 4TV7A 5IT9Z 4Y17A 3TKYA 2MA3A 1BI1A 2RV8A 1RZ4A 2FSWA 3RKXA 1LVAA 2COMA 1R22A 3IHUA 3GFLA 1BN5A 2YU3A 3LQQA 1XMAA 1S7OA 1V3FA 5L3FA 4RGXA 2MD5A 3TOAA 3BZ6A 2DFIA 2YSRA 3CUQC 2H27A 3HIFA 4WXCA 1JHFA 1QZYA 4G7OF 1LNWA 5ILVA 4U0VA 4LD5A 1F9NA 1O57A 5EEGA 4AIKA 3J80K 3F21A 4XSXF 5DYMA 3CLOA 2QENA 3RDIA 2VN2A 4G7HF 2K86A 4GO1A 2DW4A 5JR3A 2M87A 2STWA 3LA2A 1EH6A 2AS5F 4A6EA 1REPC 3H3UA 2EFQA 2XAHA 4HOBA 1WQ2A 2VT3A 1ZLJA 2DQRA 4NHJA 4RS8A 3GF2A 3ABTA 3OOPA 4JBAA 1U5TA 4DNCA 1YQAA 2FBHA 4EV0A 3F72A 4I0BA 3O3KA 4HF1A 2LDUA 2JSCA 4AWXB 2VODA 4AVPA 3ZP5A 2L4MA 2XAGA 3DQVC 1IW7F 4L9VA 3KLOA 1G4DA 1MDMA 2O61A 2OZUA 2R3SA 3M7GA 4WCGA 3KP4A 4AIHA 1C0WA 3ZQ7A 3ZMTA 3M1EA 4HX8A 1F5TA 4I2OA 4FX0A 2MH2A 2P4WA 2G7HA 5IT9K 3K0LA 3WGIA 5L3GA 1PDNC 4O3MA 3GXOA 4N9IA 4MEYF 3TDUC 1FYMA 3QPHA 3GWZA 2KJCA 5LLQA 2OA4A 1Q1HA 5DCMA 2HYFA 2UWMA 3H3ZA 2A69F 1FP1D 5LRRA 1JGSA 3BDDA 3V8KA 3FXUA 1STZA 2FBKA 4ZZLA 3FZVA 2XROA 4L18B 2CQKA 2LSOA 5J8CA 1HW5A 2P5KA 1LQ1A 5FB2A 2VOPA 3RPUA 2EV5A 2Y0MA 1BM9A 1D8JA 3QAHA 1IN5A 1JE8A 2MC3A 2G7UA 1SD6A 1E17A 2D1HA 5A2QK 1RUOA 1D8KA 5E1WA 1IN6A 3P9KA 2A5YB 2RKHA 1ZRDA 4KN4X 2DTRA 4A5MA 4PZJA 1IUYA 2BGCA 2OU2A 2XV4S 2O3FA 1H0MA 2UXNA 2IA2A 2NNNA 5JI6A 3WTVC 4HBLA 2XHKA 2ZNYA 3Q5FA 2QQAA 4RB0A 1U3EM 1BIAA 5E1XA 3J7AO 2CFXA 2VBWA 1FPQA 1R7JA 4UV8A 4XRFA 1IAWA 5DUIA 1HSTA 2WWYA 2Z99A 1TQIA 1YW9A 4LJZF 2LNBA 5H6QA 3U2RA 4P96A 2M30A 3GZ5A 4U88A 2HQRA 3DFGA 1O3RA 1O3TA 4YFKF 3ML6A 4AD9A 2DQLA 4Y15A 3KEOA 2XASA 2HOEA 1XN7A 4KIFA 1ON2A 4HLXA 4LB6B 4OMZA 4BQAA 3P9CA 3IRQA 5BPDA 2FA5A 3ZMZA 4OOIA 2A68F 2IT0A 4O5VA 5DCFA 3ERED 1IRGA 1YO5C 4LLGF 3LAPA 3WGGA 1I5ZA 1LB2A 1KU2A 1YIOA 3LA7A 4U0WA 5D5UB 2P7VB 2HR3A 3I5UA 3F6OA 4I98B 1EV7A 4HV5A 4LMYA 4ENKA 1TTYA 1T0FA 4M6XA 2EFNA 3QPTA 4HQEA 1OPCA 2L54A 4OINF 4I7HA 4HF2A 3FM3A 1OR7A 1B1BA 5HS7A 2GZWA 1DDNA 2QBYA 5ILUA 1LDKB 4HX4A 3I59B 2RQPA 3I4PA 3HTUA 3G3ZA 2WC2A 5LEKA 5HLHA 4KA4A 1R23A 3QRFF 2KKOA 2DU9A 2KRFA 2ZBKA 1X3UA 3Q9SA 2OAZA 4MTDA 3L09A 4Z2YA 2DBBA 3I71A 4PGGA 1SAXA 3ELKA 3IRRA 3WODF 4YG2F 1MJBA 3HRTA 4UNOA 2XKOA 1S29A 3L9FA 3HRUA 3TO6A 4HF0A 3E5QA 5LBQA 2W84A 5K1YA 4BXUA 1T39A 3V8LA 4M73A 3E5UA 3E97A 4Q5SF 2W24A 1XGMA 2O8XA 2RC4A 4G8XA 2E7XA 2H6CA 2RDPA 4GGGA 4HW0A 1ZN2A 1Z1DA 2HKOA 4IXAA 2GA2A 1OYIA 3P7NA 1R1VA 1XCVA 2DT5A 2BE5F 4EMSA 3MEXA 4EQQA 3SZPA 4KUMA 3IKVA 5L3DA 2XKPA 4A2UA 2P7CB 2QQBA 3N4MA 1KYWA 4MNUA 3WU0A 3WTSC 4ZYHA 2IJLA 3I0TA 2JRTA 1J75A 3F8CA 3BY6A 2F5FA 1L3LA 2ZFWA 4EJVA 1XCBA 5AIQA 3REOA 2Z33A 4CYDA 4WF2A 5ICEA 4B8XA 2R7FA 4Q47A 1MKMA 4RGRA 1OYWA 1B4AA 1YS6A 1S6LA 2UXXA 3ZN0A 2GXBA 2IP2A 1J5YA 3ZMSA 3PQKA 4BH9A 1K78B 1OKRA 4N9HA 4RAYA 3R0AA 2M1BA 2Z9OA 4LK1F 1DP7P 3V7SA 1R1UA 2FNPA 1FY7A 1ZRFA 1DPRA 3R0JA 1JHHA 4EGYA 5LGTA 4RGUA 4MQ9F 1YFHA 3GYHX 1GHCA 5LEJA 3B73A 1P2FA 2FF4A 3M8FA 3I59A 1IN4A 3NEUA 3ECOA 3CUOA 1G3TA 2EWNA 2CGPA 5FD5A 3EUHA 1O3QA 2ZMEB 3RTRA 5TJJA 1ZGAA 3E6BA 1FOKA 4ZYGA 5K5RA 2MLGA 2PN6A 2EA4A 5LHGA 5HDGA 3TO9A 3TDZC 3F23A 3JW4A 3RYRA 3E6DA 3KP5A 1FYLA 1O7FA 1P6RA 3EQLF 2KIFA 2IW5A 4M71A 1XGOA 6PAXA 1ZARA 4FHTA 2G9WA 4P9FA 2DAOA 4HYEA 3JAMZ 3F3XA 1ZLKA 5LHHA 3WTXC 5BOXA 2DI3A 2ZCWA 1BC7C 5D8LB 4WWCA 4BHPA 1IN8A 3O6BB 5L3BA 2VT2A 2O6GE 1HXDA 1S7AA 3FX3A 1QZZA 2XRNA 2XAQA 4GXOA 4EJWA 3TO7A 2A3SA 4HZFA 4RB3C 3DEUA 2JT1A 1YW7A 4OIOF 3HHHA 2VBXA 3BROA 4KMUX 3R6SA 1QPMA 1I6XA 3KEQA 4LLLA 2PMUA 3QU3A 4YIIA 1XB4A 1T38A 4KFCA 3GUDA 3QP5A 3R4KA 3BOQA 4WK8F 3MAJA 5FO5A 2GAUA 1KU9A 1KYZA 3HHGA 5BS6A 2OQRA 2EJRA 1K79A 1K78A 2FOKA 2AXLA 1TNSA 1HW1A 4WXHA 3CO7C 1ULYA 3KLNA 1FC3A 2IPQX 2EK5A 3ZMUA 2PQ8A 4OU0A 2XAJA 3HSFA 2QBYB 4M9SA 1R5HA 4YFNF 1ZREA 1AWCA 3BJAA 5JVTA 4GCVA 1XDUA 3DPLC 1NHAA 4L9NA 2BBYA 2FMLA 2E1NA 3GLXA 4A0ZA 3T0YA 3C18A 2GQQA 2O0YA 1U5TC 1E2XA 5HS8A 1FSEA 3JSOA 3CO6C 3LQRA 3TOBA 1O7LA 3JAMK 2STTA 4LB5A 2QM3A 1FT9A 4S04A 2CW0F 2R7DA 3WTUC 2ZMEA 2K27A 2PFBA 2FQ3A 2GIVA 5J6XA 5DUKA 1TLHB 2HQNA 3T8TA 3EYYA 1SMYF 3VOEA 1TW2A 3K2ZA 2IVMA 3E6CC 1F1ZA 2X4HA 3ISPA 3HOTA 1J9IA 3DXJF 3EYIA 4M9ZA 3SHFA 3GZ6A 1K7AA 2PI0A 4UXNA 4KN7X 3IWFA 3RIRA 4BHBA 3K1NA 2JPCA 3F8NA 4IF4A 2ESHA 2K4JA 1HKSA 2CG4A 2KJBA 4G94A 2QWWA 2V1UA 1EH8A 2J5PA 3FMQA 1W7PB 5E8GA 4MQVA 3WE2A 4EM0B 1MZBA 1I1SA 2UZKA 2A61A 1T2KA 3KETA 3SXYA 2X0LA 5E8IA 4DQ2A 1YLFA 2HS5A 1J59A 1U8RA 2M45A 5CVJA 4ZYEA 2KIUA 4XLNF 2D2WA 3ZPLA 3FM5A 1EH7A 2CO5A 5CVRA 3KZZA 2V79A 3WTZA 1QBJA 1WI9A 5F6FA 4KMFA 5BPIA 4M72A 5IT3A 3BPVA 1W7PD 2FEZA 3MFKA 2H09A 2OBPA 2E1CA 2ZJ2A 3ROUA 2QLZA 4QWQA 3KP3A 2ADUA 1ZG3A 4NQWA 2QVOA 4IPAA 4KICA 4EVIA 3EDPA 4I09A 3CUQB 3F8FA 4KIGA 4XBFA 2VOOA 1FYKA 1IF1A 2W85A 1P4WA 2LF7A 1SD4A 5ICFA 3ULQB 2HDCA 3HSRA 2HZTA 4O6JA 4BAYA 2LKPA 3SQNA 2PMHA 1WWXA 1UCRA 4RB1A 4MHGA 1P4XA 1ZYRF 1H9GA 3WTYC 2RVCA 2XAFA 2HTSA 4EGZA 1PP7U 3GFMA 4ESJA 1U2WA 4QLCU 2Y48A 2K7LA 3DKWA 1HKQA 4PDKA 3FMRA 4HV6A 1HBXG 3MQ0A 1U78A 4KDPA 5ED4A 2F5EA 3R61A 5D4RA 1RI7A 3HUGA 3PFIA 1CF7A 4P5OA 1Z6TA 4D0PA 2ZNZA 3D5LA 3QOPA 3I58A 5DDGA 1Z7UA 2FRHA 5ICCA 1FBSA 4BHCA 3KE2A 1GVJA 3T5XA 3U1DA 1YTYA 1UB9A 4CO8A 5DD8A 2F5CA 3GW2A 4CXFA 1MD0A 3ZMDA 3BWGA 2V1DA 1HQCA 1I1GA 4ENNA 1SD5A 2VE9A 1W7PA 3E3VA 5D6EA 4P9UA 2XIGA 2IA0A 2CYYA 4YIFA 1I27A 2MH9A 3ZN1A 2FE3A 1SMTA 2ZO4A 3HSEA 3NRVA 2DO7A 1B9NA 5CYVA 4M74A 1QQIA 2H6BA 5HVQC 2P6SA 3CDHA 5EEHA 3V7RA 3J80Z 2DK8A 3S2WA 2PBIA 4I01A 3RJPA 4CDGA 2ACJA 1HSJA 4ASNA 1XGSA
chains in the Genus database with same CATH superfamily
4DV7H 3LSJA 4V19K 2NS0A 5M5WJ 4O4IF 1IZ1A 2DMQA 3DPTA 4EM1A 4HDVA 1XSVA 3ZQLA 2ZXHA 3TIGA 5ILSA 1G3YA 3BZCA 3PVXA 1JDBB 1IRXA 4A3GJ 5FLVA 2DLLA 3WG9A 1XGNA 2BEOA 1YITI 3MR6A 4PWQA 4YY3H 3Q0WA 3CCUI 5HLGA 1W4MA 5C4JJ 1LEAA 3FF5A 2V26A 1IGNA 2JEGA 4AYBA 1J2XA 4YELA 2XCPA 4LFCH 2RQQA 2R84A 3SFZA 4IHTA 2JEJA 3CUQA 2ELKA 3EETA 2W71A 2OLSA 4H0EA 4ESFA 2K4BA 2QCOA 3IL2A 1ZGJA 2JQ7A 2ELHA 2B9SA 3DBHB 2JA7J 2XVCA 4CCKA 4DV2H 3RYPA 3CCQI 3DTEA 2X6XA 3OSNA 2UVRA 1RKTA 1VNDA 3JTHA 1VFCA 2R8JA 2BW3B 2EZIA 4E7JA 2A07F 3IWZA 3LSTA 4AIJA 5LGUA 4FASD 4ZYDA 4UCSA 2E7WA 3MKZA 2D45A 3AL0C 3FXQA 4LF9H 3W3CA 5TRDA 2IS1A 2BY2A 2CKZB 2FOWA 3OIQA 1W5SA 3ETHA 3WU2C 4B48A 2DPIA 1IOWA 1RIOH 5FKMA 3RZDJ 2QQ9A 1UHSA 3GTOJ 1JXSA 1Y14B 3MJFA 4GKJH 2KIMA 2P8TA 3LSIA 1MBHA 3HDDA 3JCUC 1ZETA 1EKEA 3Q8SB 3FMSA 2EFPA 1FJLA 2C2DA 4Q48A 4A3LG 1XDSA 5BPFA 5L3CA 2Z3YA 2VOBA 1WFXA 3VDXA 5GTHC 4LGWA 3VYUB 5EDNA 1TT0A 1VZ0A 1R58A 2P5LC 5D4SA 1VTNC 3VPDA 3MKLA 2PLYA 1LUJB 3BJOA 2HYGD 3PQJA 4NC6A 2E2JJ 1FOWA 4FX4A 3KALA 1D1AA 4EJUA 3ABUA 4WX9A 2R82A 5IYDJ 5KFZA 1N25A 2NVXJ 2QUFA 3K7AJ 3IN5A 2R86A 3FKIJ 4JK1X 1SCUB 1XSDA 3C1DA 5DGBA 4XOPA 5E1ZB 4RAZA 3LWFA 3ECHA 1RNLA 1BR4A 4LFUA 2M05A 3LA3A 4BQNA 3H92A 1FVIA 3CJTB 3S8PA 1ULZA 1W0TA 3FBNB 3CTAA 4X0GA 5KHDA 1QU3A 3U21A 1DPUA 2YS7A 4IRDA 4RUCA 2VXDA 1UG0A 1I6HJ 4QPOA 3BZKA 1VQPI 2V4RA 3IC7A 3MZYA 3GO5A 4YR3A 1E3HA 2CFOA 5D6FA 5FGMA 4FISA 1Z21A 2Z1DA 4RZQA 2H8WA 4AQYH 5E18F 4G9YA 4A6DA 3GTQJ 1AOYA 3BP8A 2P81A 3CP2A 4JP0A 1MNMC 4ETSA 1TAEA 1VI0A 3NQOA 4IQ4A 4DW6A 5LGNA 3S1QJ 5B5EC 3KAKA 2LK2A 2JUCA 2RNJA 4IL6C 4CCNA 1EJ9A 4C3HJ 1DQUA 3S93A 5KFSA 1JUMA 3GTLA 1D1BA 1T6SA 5EG0A 1VF9A 5A2QZ 1Y39A 1VQLI 1N78A 4UCUA 2AQFA 3QP6A 1DIKA 3V4GA 2GLTA 3GTGA 4Y13A 1TZLA 1UHWA 3H35A 1VQ7I 1FWZA 1SD7A 1XMKA 2VBZA 3TL4X 4N0BA 1FLIA 1O3SA 2VR1A 3ZMVA 1HW2A 1RUNA 2A6EF 4LLNA 3KHHA 2NOJB 3L4JA 3CLQA 2OUMA 2WBMA 3EUHC 4HX7A 4IJAA 4M6YA 5I47A 2HGCA 3OSPA 4G3IA 3DKYA 4FE7A 3X2QH 1RK5A 2QSHX 4IRKA 4PK4A 4PGHA 4DV3H 4EJTA 1IV8A 5BNGA 1R6RA 2JA7G 1RETA 4G6TB 3VWBA 4CHUA 4MV9A 2E5NA 4A12A 1MMGA 5KT3A 3WGHA 2NRAC 2LFBA 3K70D 3R60A 3V7CA 5AONA 3CDLA 1FEXA 1QRYA 2DTZA 1K6YA 1ORKA 5E20A 1G6NA 1T33A 3BPXA 3TQNA 1XMOH 1H9TA 3OYAA 5J1UA 5EZHA 3PW2A 1J7KA 3S3NA 1YX3A 1USTA 1GXPA 2VBYA 1MBEA 4G6DA 1IJWC 3ERMA 1UZCA 2PJPA 5E3OA 4A3IJ 2GA1A 1S8NA 2W8KA 2M9HA 4YR2A 1WSCA 4KISA 1BC8C 5KNLA 2IMWP 3KPHA 2RDIA 1LEBA 3ABKH 2JA8J 1E0EA 1HDPA 3I53A 5E17F 2MW8A 3MVPA 2R87A 1U9OA 1GXQA 3A4CA 4C2TA 3HL2A 3RKWA 3GEZA 4CCJA 5FJ8J 1M6VA 3RV4A 3TGNA 2UVWA 4O3NA 1MJ9A 2BZTA 1IN7A 5DV5A 4RGSA 3KP6A 2MLKA 5IYDG 2DA7A 5E3MA 3GX4X 4BNCA 2PX9A 3OUZA 3FKIG 4MTEA 1X1BA 4M3FA 2UVUA 2VC0A 4QWBA 5HV6A 1V4RA 5HNHA 1OYYA 1S72I 5KKNB 2IRFG 3CMAI 1QVUA 3A0HC 3WNZA 3FXJA 3SYTA 2AGQA 2GXGA 1BOAA 2MYSA 4IHVA 1LJ9A 2EV6A 5F27A 5FD6A 1FNNA 1MGTA 3VPRA 4A3KJ 1OMIA 4JYAH 4NNJA 5F1RA 4APMA 5HDKA 3K4KA 4R79A 4M3DA 4W97A 3B02A 4CH7A 3GFIA 4DR6H 1F36A 5DTDA 2P5VA 3VYTB 5KFAA 2IS6A 2W9AA 5LD2C 2TRTA 3MKYB 3HRMA 4B3TH 3HOSA 1L0OC 1WCMJ 2HFHA 3KX2A 1KQ0A 3HG9A 4ED0A 4C30A 3KP7A 1VQ9I 4LOCA 2HTJA 2NAZA 4HQMA 5DM7F 4EBEA 2FMYA 5H20A 1T98A 1MJAA 1BJZA 3FIWA 4R8HA 1Y1WJ 1NK2P 1ZH5A 3GTKJ 2OTJI 2EFOA 4LG0A 1N36H 3GV8B 2YX4A 3C7JA 2O61A 1KONA 3M1CA 4NUBA 1MIJA 3KHGA 4MA5A 2FJ1A 2XGXA 4U7BA 3NAUA 4MA0A 5KT6A 4BBSJ 1YJNI 1WSUA 3ORRA 5L3EA 1UG2A 2K40A 4Q4ZF 1KC7A 1BNCA 5FPRA 3MD2A 2CQNA 3LSMA 1BJAA 1BOBA 3KYLA 2R7XA 2KRCA 3GQCA 2VUMJ 2GPWA 4O4LF 4HA8A 2ELJA 3RB0A 1YG2A 3K3PA 4UUVA 3L00A 5EF6A 3S14J 2E2IJ 4J9OA 3TQTA 4UHTA 3HPHA 3MCZA 3OHBA 2CQYA 2Y9ZA 2AHQA 1DV1A 2C2EA 3FWEA 2ZDQA 1RYSA 3VODA 2DFHA 3Q9VA 1Y0UA 2LY2A 4FQGA 3M8JA 1BI2A 4G6QA 3V8JA 2ZJTA 1MBJA 4IWYA 3HTSB 4ZJZA 2YR2A 1J5EH 2X48A 1IUFA 2EA2A 4GYIA 1Y6IA 3PNVA 2Q8KA 2Q2EB 3HYIA 5TISC 1CF7B 3PR4A 3JRFA 2DYRH 2K9LA 1Z2OX 4NDLA 5LMUH 4DZJA 3CC2I 2LH9A 4A3IG 3AG4H 1P7JA 2F6CA 3L7WA 4A5NA 2C6YA 5JVGF 3J81Z 1R9TA 1HCRA 5IOZA 2CW8A 4F4YA 2B0LA 3VEPA 4BJ6C 4K2EA 3PW4A 3OR2C 1ETOA 2OZ6A 3K3VA 2GWRA 2QYOA 2V6EA 4XRMA 4CGZA 3S2HJ 2VQLA 3BR2A 3E6MA 1TWGA 4ZC3A 5KT4A 2JA8G 1FP2A 3MZHA 4B47A 2Z5UA 3F8BA 1IBLH 3W6JB 2DWCA 3F22A 2HXOA 5D5XB 1B04A 4L0ZB 4BJ5C 2ZM6H 1ZHFA 1W5TA 3SFIA 3CMYA 3I54A 1RRJA 3RB3A 2BV6A 3E7LA 1P92A 1A04A 2ISYA 1IDYA 4DGWB 1GSOA 2KSWA 3I3LA 1LVKA 4A69C 4XORA 3L1PA 1FZPB 2WAEA 3JRDA 2K85A 4PJNA 1JKPC 4Q8FA 2ME0A 1DGRM 1G8XA 2LF8A 4BYYA 4KYWA 1N77A 2FU4A 2AXTC 3LOCA 3MN2A 2OH2A 3F0CA 3N97A 1TC3C 4IEJA 4DV1H 2KMUA 1PUEE 3GLKA 4A3KG 4DR4H 3DF8A 2XGDA 2XPVA 3IKTA 4Y8VB 2KQRA 1HC8A 2LOOA 2ZKZA 4RMNA 1ODDA 2ZMEC 4XLFA 2L01A 3WTWC 1FTTA 3G6XA 1IXRC 4HDUA 4RLFA 1YW8A 4NC7A 3F6VA 4FCYA 3T8RA 4C2UA 4IHSA 4O4HF 2JVHA 3K2AA 3T1BA 4S05A 2KZGA 4NB5A 1FX7A 4ZH4F 1S7EA 3BR6A 3G71I 1JIHA 1WCMG 4KITB 1M1EB 2J6TA 2J6UA 2HPIA 2EINH 2DA6A 3CZ6A 2HVRA 3C3WA 3CQZA 3P5JA 1TW3A 2OD5A 1LPQA 1X9NA 1ZKGA 2HYJA 2PJRB 1BIBA 2EV0A 5BMZA 3M4OJ 1Y1WG 4JI1H 4KIBA 2M5WA 2E1OA 3H0GA 1ZG5A 2W57A 3I64A 4HNVA 1ZG1A 1ZAOA 1S68A 4Y4RA 2V1XA 1X1AA 4BBSG 2P6TA 1W1WE 1SFEA 2W6OA 1Z3XA 1PK8A 3K9TA 1WRJA 4L9TA 2ISZA 4Q0YA 2EFWA 4E7HA 2JZYA 3WU1B 2QSGX 5CQGA 3KCCA 2LBFB 2VUMG 4ENJA 1LDJA 2VA3A 1IRZA 1OQYA 4J01A 3Q8QB 3S1NJ 2L9RA 5CQEA 2XGEA 4B3AA 2XCLA 5F64A 4ECXA 4DL5A 1KQ9A 9ANTA 3D0SA 4OIRF 3DU6A 2WB1N 4OMYA 4Y7NJ 3SDGA 1WR2A 3QWLA 3IV5A 5CVVA 2QYZA 1FIAA 2NNYA 2FBIA 4YFXF 3VSLA 3D5SC 5FFXA 3DP7A 3AAFA 3H3VH 1B9MA 5M5YJ 2FXAA 3M9AA 3RIZA 1QNTA 3MKWB 1PP8F 4N4NB 2DOFA 4E4TA 4ECTA 5FLMJ 1PVEA 2Y9YA 1IBMH 1GLVA 2R7MA 4X65H 1N56A 2OCEA 4BE0A 1KGSA 4P55A 4BE2A 2LP0A 4L9JA 5CB4F 4M9XA 4Q8EA 2DK5A 3KP2A 2K5CA 2PVPA 2VJJA 4XYLB 2L3DA 1R00A 2MD0A 3MWMA 4G7ZF 4HAMA 1O4XA 4FT8A 3L2CA 3GFJA 2PBZA 3RAXA 3HPGA 1P7IA 1ZRCA 1UFMA 2IA1A 4UVBA 1XTAA 4ED8A 2HEOA 5LA6F 3K69A 5J40A 2OCCH 3KYCB 2J5OA 2VE8A 5GP9A 4L0YB 2DXIA 2VJ5A 3OL4A 2DJIA 4RBOA 3S17J 2R7UA 3TW7A 3FK6A 4I02A 3M4IA 3I4NG 2CSOA 5J4YA 4RDUA 1WJAA 1FSHA 3RI4A 1TWAA 1XMXA 2VPQA 2KP6A 3RQIA 5LHIA 4U0YA 3DF7A 1XSXA 4MGRA 5KFHA 1KQ8A 2KHMA 3KZYA 4XRSG 3CF5F 3J7AY 1KU7A 2SCUB 1V5FA 4L5IA 4CZZA 2OV7A 4QPQA 1YX5A 2CUFA 2VJIA 2Q1ZB 2HDDA 3BQ1A 4IHYA 2WE6A 2Y75A 1Z67A 3SZTA 2WTEA 2L02A 5GPCA 4YQWA 3O2PE 3QYFA 3J81K 2E1MB 1XD7A 3CJRB 2WV1A 4RB2C 2TDXA 1Y8RB 3LMMA 5FLXZ 4LSAA 2HOTA 3QPLA 4IVNA 2OQGA 1BI0A 4RM3A 5D5WB 2EB7A 1Z7LA 2R7QA 4EGJA 1S97A 3RGZA 3QOEA 2H94A 3S2DJ 2RGRA 4MLOA 2DPDA 2B63A 2JPBA 3E1SA 4IHJF 4L5JA 3VFZA 3QU6A 2HKXA 4F50A 2BY1A 3F8MA 2JA5J 4UCRA 2HWVA 5EZYF 4MEXF 4A0YA 1V9PA 1U9NA 2VKHA 2DJNA 5AIPA 1JLLB 2DODA 2VQGA 2XF7A 1VQOI 5FRMA 5LRSA 1X3ZB 2RGVA 3UFXB 3OY9A 5IYZF 4EJOA 1G3WA 4LF8H 3BG6A 5F9NA 5JHFA 1IRFA 1R1TA 4BBRJ 1GVDA 2D1VA 4B09A 4PSWA 5CLSA 1QO0D 3PIPF 3M8EA 1J0RA 3JAMW 3KEYA 2Q2EA 5HOOA 5JVLA 1T0FC 3QZ8A 2K02A 4XLPF 2L4AA 1SAUA 1ONVA 5HDNA 2Y30A 4XQFA 2C00A 3T5LA 2BYVE 3CF2A 2X6WA 3OV8A 3WE3A 3G73A 2ZC2A 2R7RA 1SC7A 2H1KA 5DD4A 3C2BA 4I0AA 2NVYA 1OR7C 1X1DA 2VI6A 3JRIA 1AUVA 4RNNA 1HR0H 4J9NA 1B59A 2JWTA 5HLIA 3BABA 3U9GA 2YX7A 1FBUA 3FDSA 2E60A 2ESNA 3W6KB 4XM3A 3BR3A 1E3PA 1Z6RA 2DA3A 1S0NA 2VPSA 4HR7A 2ZJQF 2WY8Q 4IOAF 4KNYA 3RKQA 2VIXA 1JT6A 5JVDF 4XZ3B 1HA8A 5KFQA 5FLMG 3JTGA 1Z05A 2JTVA 1GUUA 1YYVA 2H1LA 2W82A 2OPTA 2PG4A 2HNHA 2NVTJ 1HKTA 5KFCA 3O8HA 2PN1A 1UHMA 3CJNA 3TMOA 4ZZDA 4HLYA 1P4AA 4AVZA 2YRXA 5K5QA 2NYXA 2VKDA 3OIPA 3CCMI 4QWDA 5J2TF 1FBQA 2DPUA 3H20A 3K4NA 3N40P 2GIZA 4OIPF 3DV8A 1T36A 5L1IA 1EUCB 3T5JA 4F7ZA 1A5JA 4RUAA 3BR5A 4IRGA 4JX5A 4CICA 1TQPA 4KT5C 5F04A 1ZQ3P 2FMAA 2TCTA 5KT2A 3DBRB 3BQZA 5DEQA 3CCEI 1HF0A 5CJ9A 1QGPA 2ZXJA 1JXLA 5KVRA 4ESBA 2YZGA 5L9XA 4ECYA 4AYBN 5GADJ 2ZDHA 2ZFUA 1S0MA 3B6AA 4O3QA 1VS0A 3PUBA 4ON0A 5CVIA 5DQIA 4BQQA 3W6VA 4JI4H 1F4KA 1S03G 2ASDA 2Q0OA 3JSPA 1U5TB 2VONA 4IRHA 4H4KC 2IGKA 1R5ID 3HB9A 5BMVF 1LDDA 1K6OA 1IXSB 2R93A 4LSXA 4ECZA 3K6GA 1TNTA 4ENMA 1W36D 2FNAA 3RBEA 1Z91A 2LG4A 3OL3A 5JHUA 5FFZA 3WTTC 3T1HH 2OF7A 2YS9A 1CGPA 5C5JA 2XUBA 5ICGA 1Y1VJ 3VB2A 4A3JJ 3S1MJ 4DV5H 2HQAA 1V54H 2LBFA 5E3NA 2Y0SN 1GLNA 3OYDA 2WB1E 3E5XA 3UKGA 2ATLA 2YPRA 4E70A 5DG9A 2JA5G 3LAJA 2W25A 2ZXWH 1IG7A 4U7DA 3FXRA 4HEA2 5D8KB 2A6HF 3ASNH 3K4JA 3IH3A 2YZMA 1MDMB 1OCOH 2K3FA 4WXDA 5IYBJ 1MMDA 1R49A 2ETHA 1Z9CA 3N41B 1D5VA 1R5GA 2WV0A 3DLAA 3RKYA 2IGNA 2VPLA 1MH4A 4OIQF 2YU9A 2CQXA 2QZ8A 3K1PA 5FLXK 2BY3A 4BBRG 4A0XA 4UVAA 3UR3C 2XGPA 4I4TF 5IYCJ 4ZQIA 1LFBA 1BI3A 4XSZF 5H6RA 3DKXA 3KFWX 5JFRA 2OJED 2V6CA 4YR0A 3G2BA 4D5FA 1OJLA 1GO3E 2PEXA 5BQTA 1U6GA 5LXTF 3Q3SA 2NU9B 1E3OC 3MWEA 4UV9A 2LY1A 2W9BB 3BJ6A 3G8CA 3GIJA 2MABA 2UXBH 2VXZA 3BTLA 3GVAA 1SFUA 4ECQA 1DV2A 1G3SA 3K1MA 3HOZJ 1TWFA 2M8EA 4IRIA 1KU3A 5FKLA 3UQ8A 2KL4A 5D1PA 4LK0F 2VC1A 4TQSA 3RF2A 2JEFA 5EGOA 3PFYA 2W6QA 2AU0A 2DA5A 3G6YA 1QHHD 5DCMB 5J8FA 1R36A 1BW5A 4GYGA 2CWEA 5DM6F 5L1KA 4M6VA 4UVCA 2OWOA 3JRAA 3K4BA 1DUXC 2C2RA 2F2EA 4AIDA 2R7ZG 3ESWB 1IXCA 5KG2A 4LG0B 2V9VA 5ERIA 4XICA 5KK1A 3IP4B 1NK3P 2EBIA 1ZQ7A 1WKMA 4MO7A 5H80A 2NS7A 2Y0SA 3BR0A 1RJQA 4OX9H 3LFKA 1TBXA 4ZTJA 3COAC 5E3LA 3DLLF 4XX0B 1KA8A 4TV9F 3AG1H 4ZDPA 5CVUA 2QGUA 2QSFX 4KT6A 3RPQA 5K5OA 3C2HA 4EM2A 3A01B 4UFZA 1B6AA 3GTPA 4BQOA 3P9IA 3JRWA 3PW0A 2NXNB 3FHZA 4HNTA 1TQMA 2FQ4A 1D3YA 1SFXA 3CCJI 2F5DA 1S3JA 1SANA 3PNTA 2JA6J 3MR3A 3LSKA 5HS9A 2MBFA 1BBYA 3L2RA 2O03A 4R1HA 4NC8A 3ZCOA 3A2KA 1XG1A 1ENHA 4NBQA 1ON1A 4JQFA 4PCQA 4ZDOA 1K83A 2KRHA 4B1RA 3K5HA 2RN7A 1USSA 3HRSA 1RC9A 1YS7A 5D5VB 4TV7A 3SZGA 5IT9Z 4D7NA 2P0AA 2KISA 1EZ1A 1POGA 2R7LA 3PR5B 4Y17A 2FB9A 4LH6A 1JUPA 1WJBA 3TKYA 1XMQH 3EPGA 3BA9A 2MA3A 5KT5A 2CS3A 4F55A 1BI1A 3BQYA 4XKVA 4XIDA 2RV8A 4DL6A 3J7AK 3DEEA 1RZ4A 3IG0A 2VQCA 3JSNA 4B3SH 2FSWA 3RKXA 4F92B 1LVAA 2COMA 2ME6A 5KX5F 1R22A 3IHUA 2AQ4A 4L1KA 3GFLA 2Z2SB 4PJJA 1BN5A 2R7TA 2XGCA 2YU3A 3LQQA 4LFBH 2EQRA 1XMAA 4YIRX 1S7OA 4F93B 2JUGA 1AN7A 1XS9A 4Q45A 5D8DA 3ZQQA 1V3FA 5L3FA 2I80A 4RGXA 2MD5A 4A3JG 1Y1VG 1GSHA 3TOAA 2XSDC 1A36A 3BZ6A 5GAHJ 4XNFA 3OYHA 2J6SA 2ZB9A 2DFIA 1UJ8A 2YSRA 3CUQC 1BL0A 2NVQJ 2R92A 2H27A 3L4KA 5LL6b 3HIFA 1QVTA 4B3XA 2A05A 4WXCA 1JHFA 3TQ1A 1QZYA 3RPUD 4G7OF 2LC2A 4Y33A 1ZGWA 3VSKA 1LNWA 5ILVA 4A3GG 4U0VA 2NS8A 4LD5A 5J4VA 1F9NA 1O57A 4DYCA 5IYCG 3RAQA 5EEGA 1G59A 4AIKA 5KFWA 3J80K 3F21A 1I50A 3OYNA 4MAMA 2UXDH 3OYJA 4XSXF 4PFOA 5DYMA 3CLOA 2M0MA 2QENA 3RDIA 2VN2A 3DU5A 4G7HF 2K86A 4GO1A 2X1DA 2HQ5A 1BXRA 2DW4A 2V4QA 5JR3A 2P0WA 5J47A 2NUAB 4J19A 2M87A 2STWA 2W1OA 3LA2A 1EH6A 2Y31A 2AS5F 5FKOA 4A6EA 1REPC 3H3UA 2GXAA 3PZPA 4CC5A 2EFQA 2XAHA 1XNQH 5F0HA 1WZ2A 4AYBE 3JZIA 3TP3A 1ZHQA 4HOBA 2XF5A 1WQ2A 1ZR4A 1RPWA 2VT3A 1ZR2A 4IX7A 3TIIA 1ZLJA 2DQRA 4NHJA 4GDFA 4PFPA 4PSXA 4RS8A 3GF2A 2JK3A 3ABTA 3V4ZA 3OOPA 4ED1A 3Q8RB 3AYHB 4JBAA 3TEDA 1OLTA 1U5TA 2BXYA 4G12A 4DNCA 4RNMA 2W70A 1WPKA 3HXLA 3HOXJ 1YQAA 4QWCA 2FBHA 4EV0A 2R7WA 3Q0VA 3F72A 1SVLA 4FTHA 4I0BA 3HBLA 3O3KA 2L2OA 3B6CA 1GDTA 4HF1A 2LDUA 2JA6G 3S15J 5LOVF 2XDVA 4Z6YA 4F4ZA 2CW7A 2JSCA 2QK4A 3FK7A 4AWXB 1Z3YA 2VODA 2ID6A 4AVPA 3ZP5A 2Y0SE 1RR8C 1A6IA 1RKWA 4O3OA 1PYVA 2L4MA 3A03A 2VJ4A 2XAGA 4FM9A 3NWSA 3DQVC 2V9KA 1IW7F 4L9VA 1S9FA 3KLOA 5J1RA 2NU6B 2FLNA 2IP4A 1G4DA 1MDMA 4MV4A 2BQUA 3OS2A 3L2VA 2OZUA 2R3SA 3M7GA 4XKWA 4WCGA 2K9SA 2V1NA 3KP4A 4AIHA 4Y52J 4C2MA 5F0CA 4JI7H 1G2HA 5EOYA 1X2NA 2M0CA 1MMAA 2DDAA 4D5CA 1JKQC 2WADA 5H2FC 1C0WA 4YBZB 3ZQ7A 2UV1A 4M3EA 3ZMTA 3M1EA 4HX8A 3EPIA 3HEFA 1F5TA 4I2OA 4CCOA 3H9QA 2DPJA 3GZNB 2MH2A 2P4WA 4FX0A 2G7HA 1TWCA 2BHZA 2BVLA 5IT9K 3JRXA 4DL7A 3K0LA 2W9BA 4RU9A 2DCEA 3WGIA 5L3GA 5KFRA 4FETA 1PDNC 2AGPA 2QKLB 3H1CA 4O3MA 3ZXSA 3GXOA 4N9IA 2QEXI 4MEYF 3TDUC 5LFAA 1FYMA 2R7SA 4B3RH 3QPHA 2HHHH 3RJ0A 1T8IA 1TWHA 1DP3A 3LSHA 4XONA 4B44A 3GWZA 2KJCA 5LLQA 1KZHA 2OA4A 1Q1HA 5DCMA 2HYFA 5KAFC 2UWMA 4BE1A 2FKLA 1JUSA 2GBYA 3H3ZA 4P1WA 3L2QA 2A69F 1AKHA 1UC8A 4A2BA 1N33H 1FP1D 5LRRA 3AFHA 5DQGA 5KFNA 3AG2H 1OCPA 1JKRC 4BU2A 5F0FA 1JGSA 4UCTA 3BDDA 3V8KA 2L5QA 3FXUA 2ZXIA 1STZA 2FBKA 4ZZLA 5HLTA 5KG1A 3FZVA 4JI3H 4N4OB 4MV1A 2XROA 1YOVB 2N8GA 4L18B 3HGGA 3A01A 2CQKA 2LSOA 5J8CA 3JRCA 1HW5A 5EWGA 2P5KA 1W0UA 1LQ1A 5FB2A 3N6XA 2VOPA 3RPUA 3BCAA 2HPMA 2EV5A 2Y0MA 5DQHA 4EEQA 3HGYA 1BM9A 1D8JA 2OC6A 2MFZA 2I8DA 3QAHA 2QA4I 4A93J 5DGAA 5KFXA 3W2AA 3BTIA 1R4NB 2A5WA 1IN5A 3PL8A 1JE8A 5L1LA 1Z77A 2MC3A 2G7UA 2KT0A 4FBUA 2GM4A 4RNOA 3OYGA 1SD6A 1E17A 3HKZN 5GAEJ 2D1HA 2IS2A 3OYEA 5A2QK 4HRIA 2WYOA 1RUOA 2NU8B 2NOGA 3RFCA 1D8KA 5E1WA 1T3NA 5IP7J 1N32H 3S1RJ 1IN6A 1E4GT 3HZJA 5L1JA 4UUSB 1WHUA 1Z0XA 4ECUA 3P9KA 2A5YB 1VQKI 4XOTA 2RKHA 1ZRDA 4KN4X 3HOXG 2NVUB 3GTJA 1ZHSA 3GTLJ 2DTRA 4NXNH 4HSRA 3OYCA 3LSPA 4A5MA 2F4IA 4PZJA 3VPBA 2C28A 1GV2A 3GTGJ 2HVQA 2WAFA 1IUYA 3MFHA 2L9SA 4LF5H 2BGCA 2OU2A 2EZHA 2XV4S 2O3FA 3PIOF 3D1NI 1RYRA 2DT7B 1HNZH 3L2UA 2E5ZA 3H5AA 2BXZA 2H8RA 5FJ8G 1H0MA 2YZNA 1EUDB 5M3FJ 2UXNA 2IA2A 4U87A 4IZOA 1MSFC 1N75A 2NNNA 2XPWA 5KFBA 3GTMA 2W4SA 5JI6A 4II2A 1ETYA 3WTVC 2V9PA 2R7OA 4DBRA 2CQ7A 1IO2A 4HBLA 4QJFA 3KHRA 2XHKA 2ZNYA 3Q5FA 2QQAA 3KHLA 1KJ9A 4RB0A 1PX2A 4JYKA 4HYKA 4JV2A 5LYJF 1U3EM 1BIAA 5E1XA 2PMZA 3J7AO 2CFXA 2VBWA 2R4GA 1FPQA 3H4DA 4BS9A 1MSEC 4PDBA 3KXYT 1R7JA 4UV8A 4NLGA 2YW2A 3HKZA 1UAAA 5C8YF 4XRFA 4YB8B 2M7BA 1IAWA 2R0QC 5DUIA 2K9QA 1HSTA 3ZGKA 4IKFA 4EEYA 4J9QA 4C3IJ 1PUFA 5EEAA 2Z99A 2WWYA 1D0YA 1TQIA 3FISA 1YW9A 2X1CA 2DYSH 4LJZF 2LNBA 4LH7A 5H6QA 2R8HA 1GYFA 1YJ9I 3U2RA 1SFOA 5TGTA 1JDEA 4P96A 2M30A 3GZ5A 4UY8I 2E19A 1V55H 2BVMA 2GOMA 3GMEA 4U88A 5KG5A 4DOZA 3VMMA 2ALZA 3OMYA 4E6KG 3LP8A 1BA5A 2HQRA 3LFUA 4PJLA 1H89C 5E79C 4C9YA 3DFGA 1O3RA 4XYMB 2HGSA 3PN1A 1ETKA 5FPOA 1O3TA 2X6YA 4YFKF 1I3QA 3ML6A 4AD9A 4XR6A 2YCHA 3AL0B 2V5AA 5F1JA 2DQLA 3R5HA 2R7ZA 4Y15A 3BG7A 3KEOA 1B8IB 1AA7A 2XASA 5DS9A 1QPIA 4YJ2F 4BGDA 1JTXA 3QODA 2HOEA 3CESA 1XN7A 2W8LA 4KIFA 1ON2A 4HLXA 4LB6B 2AQEA 4OMZA 4S0HB 4BQAA 3P9CA 3Q2OA 3IRQA 1TL8A 2RDJA 2BQRA 4J9PA 2K9NA 1F43A 1TA8A 2M7AA 3K70C 4CZCA 4ED2A 3T5HA 1HDDC 1OCRH 5BPDA 3EPZA 2VL8A 2FA5A 3I9V2 3ZOBA 3ZMZA 1JJ8C 1VKZA 4MV3A 4OOIA 4A93G 2A68F 2IT0A 3LWBA 3GIKA 4O5VA 5DCFA 4V2FA 3ERED 4IOCF 1IRGA 1YO5C 4LLGF 3LAPA 4EYIB 3V6JA 3WGGA 1S0OA 1FJGH 1I5ZA 4ZTFA 2ECCA 1LB2A 1KU2A 3DCFA 1KJJA 3SI8A 3GV5B 1ZELA 4QTRA 5IP7G 1YIOA 3LA7A 2L7ZA 3OUUA 4U0WA 2DMTA 2W7OA 2ASLA 5D5UB 2P7VB 2I8CA 2HR3A 3SEQA 4KHPH 1XX5A 3GLLA 3Q0UA 3I5UA 5JQWA 1X3WB 3F6OA 4GKKH 4I98B 3E0JB 1EV7A 1YJWI 3RTXA 4HV5A 4QW8A 3KZIC 4LMYA 1YHQI 4ENKA 1V51A 2HOSA 4J9RA 3K4CA 3BC8A 1TTYA 1V5GA 1Y8QB 3ZQHA 1T0FA 3GILA 4M6XA 4BKXA 5EGOB 2EFNA 2LY9A 2RF4A 1Z2PX 3QPTA 4HQEA 1J09A 1OPCA 2L54A 1DGSA 2K9MA 4OINF 4I7HA 4HF2A 2XGQA 3FM3A 4AM3A 1OR7A 1B1BA 4J9KA 2CV2A 3RSNA 5HS7A 3WHBA 5C44J 2GZWA 4LIVA 2X85A 1DDNA 1VQ8I 2QBYA 1CQJB 5ILUA 1NH3A 1XPXA 4BJTA 3ABMH 2DMNA 3SDBA 3JRHA 2ZDGA 1LDKB 1BGWA 3FBIB 3CCVI 3GIQA 2HXIA 3PO3J 3G1OA 1HOMA 2GOXB 4DBQA 4HQ6A 4HX4A 1RK6A 5B66C 2HJWA 1ZK8A 2RQPA 3I59B 5K7FA 3I4PA 1IV6A 3HTUA 1D5YA 3G3ZA 4I50F 2UVVA 1R9TJ 2WC2A 2Q2UA 1PJRA 5LEKA 4R8UA 5HLHA 2DIKA 4KA4A 1AU7A 1R23A 3QRFF 3ETJA 2KKOA 3MWDA 5BPHA 2DU9A 2KRFA 2ZBKA 4QIWN 2PMZE 3S3OA 4JI2H 1TWGJ 2R5YB 4B3MH 2JA2A 3K10A 3HKZE 1X3UA 3Q9SA 2OAZA 4MTDA 3RZOJ 4EFEA 1MBGA 3L09A 2DBBA 4Z2YA 3HOVJ 3CCLI 3I71A 4PGGA 1O75A 5FKNA 5KT7A 1SAXA 3IUOA 2FX0A 3SE7A 2J9GA 2IA6A 2JA7A 4D1QA 3ELKA 3IRRA 2FJZA 3WODF 4YG2F 4MFDA 1WJDA 1MJBA 2LVSA 1W5CC 3HRTA 4UUSA 4UNOA 2XKOA 1S29A 3L9FA 1JT0A 3BJYA 1JJ6C 4JV1A 3HRUA 3TO6A 5JLXA 4ED3A 2E35A 4HF0A 3E5QA 2W84A 4CA0A 5LBQA 5K1YA 2R8GA 5KFLA 3A0BC 5IOYA 3M9NB 3GTOA 4BXUA 1T39A 3NWTA 1JGGA 1JTYA 3HOYJ 4V2GA 3V8LA 2FK1A 3FMAA 2Y2ZA 3RB4A 4M73A 1Y56A 3E5UA 2E2HA 3E97A 4Q5SF 2DMPA 2CQQA 4A3MJ 2W24A 1XGMA 2Z16A 3R5FA 4IWXA 2D5VA 2XB5A 2O8XA 4F52A 4E4HA 1Q1VA 3PO2J 3BA8A 2FPIB 3S32A 2RC4A 4G8XA 2W6NA 3EUKL 2E7XA 3OTOH 3LL7A 2V58A 2H6CA 3CQZJ 2RDPA 3DWLE 4GGGA 2R7VA 4HW0A 1M0TA 2E34A 1ZN2A 2VQHA 4QIWA 1Z1DA 5KFMA 3PSFA 2HOAA 2HKOA 2FK3A 3H0GJ 2IGMA 4O2BF 2NVXA 3PW7A 4IXAA 3FKIA 2QF7A 2GA2A 1OYIA 2L7FP 3P7NA 2MGQA 3FDYA 4M9UA 2LMDA 3LSRA 1R1VA 1E4EB 3BTCA 1XCVA 1HNXH 1MNEA 2DT5A 5IP9J 1EHIA 4J00A 2BE5F 4EMSA 3MEXA 3VYRB 1N48A 4EQQA 4M7EA 3SZPA 3GCMA 1GT0C 1ERDA 4KUMA 3IKVA 4TV8F 4XN0A 2M4KA 2EZLA 3CP8A 2CU7A 5L3DA 1FIPA 3C2GA 4M3GA 2XKPA 4ZYAA 1MW7A 4A2UA 1BJTA 2R6FA 2P7CB 2CH0A 2QQBA 2W6MA 3N4MA 4CUGA 3H9GA 3RB6A 1KYWA 4MNUA 3V6HA 3WU0A 3WTSC 4ZYHA 3GTQA 2IJLA 3I0TA 2V59A 2R85A 2JRTA 2C35B 1J75A 2BQ3A 3F8CA 3BY6A 3PO3G 3FHNA 1QHGA 3IAM2 3WO1A 5KFKA 4EG0A 1B8IA 2F5FA 3PSIA 1WJEA 1L3LA 3S16J 4Q44A 5J1YA 5KFOA 2ZFWA 4JOMA 5DG7A 4EJVA 2ASJA 1DGWY 1X2MA 1XCBA 5AIQA 3REOA 1WH2A 2Z33A 4XK4A 4CYDA 4WF2A 2YUSA 3JSLA 4I76A 3OR1C 4R7RA 1TWAJ 5ICEA 1APLC 3H3VK 5IY5H 4B8XA 3M3YJ 2VQFH 2R7FA 3RUPA 1BR2A 1X19A 4Q47A 4JI8H 4II3A 1MKMA 2VQDA 4RGRA 4UB6C 1OYWA 2LTPA 1C3OA 3H0DA 1B4AA 1WI3A 1WJCA 1YS6A 2HU9A 4GRIA 5KCMA 2ECBA 1S6LA 2O8KA 2UXXA 3ZN0A 2YS6A 2GXBA 1ZTRA 1S10A 1VQ5I 3MFIA 4JV0A 1MNDA 2IP2A 3M9MB 2ZSHB 1J5YA 3ZMSA 3PQKA 4A3FJ 4BH9A 1K78B 1AUXA 1OKRA 4N9HA 2DFEA 2JJ7A 2RAEA 3R0AA 4RAYA 4RM2A 3OHAA 2M1BA 4F3QA 2W7PA 2Z9OA 5KFTA 3OSFA 3G4SI 4LK1F 1DP7P 3NARA 1SEIA 5M5XJ 3HOYG 2B63J 4UUTA 1WGXA 3V7SA 2JEIA 2LLKA 3G1MA 1R1UA 4DV4H 3CMMA 1AKHB 2YL2A 2FNPA 2O7OA 1FY7A 1SFKA 2HZDA 3QPSA 1ZRFA 4A3CJ 1FTZA 4C5BA 4A3MG 1XNRH 5GTIC 1DPRA 3FXLA 3IH4A 3R0JA 4LF4H 1JHHA 1A31A 4ZOLF 4EGYA 1P8LA 2JRMA 5F9LA 3PO2G 5LGTA 5KG4A 4RGUA 4YJ3F 3CC7I 5J2UF 4MQ9F 2L7KA 2E36A 4U7CA 3AG3H 3K4MA 3H0GG 4YRVA 1YFHA 4TUYF 5DLGA 3GYHX 4K0KH 4DR3H 1GHCA 5LEJA 3B73A 1P2FA 2FF4A 2I87A 1S9HA 2XB0X 3C0FB 1UELB 3M8FA 3I4MJ 2BOLA 4E7ZA 3I59A 4IQJA 1IN4A 3F9KA 2R8IA 5IP9G 1VQ6I 2KZVA 3NEUA 3ECOA 3CUOA 4QIWE 2NVYJ 1G3TA 2EWNA 3LSGA 2ICWG 3OYMA 5FROA 5CA0F 2CGPA 5FD5A 3EUHA 3KIOA 1O3QA 1I7LA 2YYAA 2ZMEB 4DZPA 2R5YA 3RTRA 5TJJA 2E2HJ 2Y69H 4RAFA 4E7KA 5KFDA 1ZGAA 5KFJA 2F48A 4W1UA 1SYXB 5KFUA 3E6BA 4F4XA 2FD5A 3J81W 1TT5B 1FOKA 4ZYGA 5K5RA 2MLGA 2PN6A 2ZJRF 2EA4A 2Q2TA 1LE8B 2LYCA 2XF6A 5LHGA 4DR5H 1WCMA 5HDGA 4MV7A 4CC6A 4QW9A 3TO9A 3TDZC 1WJ5A 4FE4A 3F23A 3H9JA 3JW4A 1U8BA 3RYRA 4ABZA 1XDNA 2E5LH 3E6DA 3KP5A 1FYLA 3U9SA 3GTKA 1Y1WA 1O7FA 1P6RA 3EQLF 5B1AH 2KIFA 4I55F 2IW5A 3QZ7A 4M71A 4DYRA 1XGOA 2W6PA 4QWAA 2X1EA 3BG3A 3BLYA 6PAXA 1ZARA 3BT9A 4BY1J 1LKXA 5K7HA 1WVRA 2IS4A 4FHTA 1FOYA 2WAQN 4FS1A 5CKTA 5GPAA 2VUMA 5IYBG 2G9WA 2CRGA 1V5EA 4P9FA 1VAJA 2DAOA 3OOUA 4BACA 2X0SA 4HYEA 1EA3A 2FUG2 3JAMZ 3F3XA 1ZLKA 4B4CA 5LHHA 2E2IA 4DV6H 3ORQA 4ME6A 1T94A 1R4MB 3H36A 2M3AA 4A3DJ 3WTXC 5BOXA 2DI3A 2M8GX 5C3EJ 2ZCWA 3OYFA 1BC7C 2OTLI 4BDYA 1VQ4I 4WD3A 4DL2A 3V6KA 4IRCA 2F4VH 4X6AJ 3MR5A 1VBGA 5KFFA 1IC8A 2JN6A 3DTKA 4XLAA 5D8LB 3OIOA 1MMSA 2R93J 3G6VA 2V9WA 5B1BH 4PJMA 4A3FG 2VQEH 5GAGJ 1PUFB 3QYBA 4WWCA 2CMPA 2E1MC 4BHPA 1IN8A 3HOZG 3O6BB 1DU6A 5L3BA 1E4EA 5DLFA 2VT2A 5EJCA 1I39A 4XKCA 2O6GE 2B63G 1HXDA 4BXFA 4ZDLA 1VQNI 3J7ZI 1S7AA 1TP4A 4OWRB 5IP6A 3FX3A 5JH7F 2HVSA 1GGOA 1QZZA 1L2ZA 1JKJB 4A3CG 2XRNA 4DL3A 1T56A 5D1OB 4BDZA 4X66H 2ZSIB 2VPRA 2XAQA 2DDBA 4XLEA 4GXOA 5KFGA 4DR1H 3WHCA 1W96A 2I5UA 4DIQA 2LKSA 5KFIA 5CA1F 5EWEA 4EJWA 3TO7A 2A3SA 2FLPA 3M07A 2V4JC 4CSWA 4HZFA 3VPCA 4RB3C 2YU9J 4OAZA 4YAKB 3DEUA 3HOUJ 1RJRA 3GV7B 2JT1A 4XRSA 2RREA 3SJMA 1YW7A 4OIOF 1WH7A 1AHDP 3OYLA 2WAQA 1W93A 4AU7A 3HHHA 2UXCH 3ZRGA 2VBXA 3BROA 4KMUX 4E7SA 1IDZA 3EUAA 1I3AA 4Y3OA 3I4MG 3FXOA 1A9XA 3R6SA 4MV8A 2F5VA 1OCTC 3H4BA 1QPMA 2DFFA 3OYBA 1I6XA 3KEQA 4LLLA 2PMUA 3QU3A 4YEJA 2ID3A 1TWFJ 4B43A 2DA1A 2IBDA 2COBA 2AGOA 4A2AA 2JSPA 4YIIA 1XB4A 1T38A 1OCCH 1E4FT 2R7KA 2EIJH 1CQTA 1OCZH 4KFCA 4O2AF 3GUDA 3IH2A 3QP5A 3R4KA 4FBTA 3BOQA 3QYEA 4WK8F 3MAJA 1W36C 4ZHQF 1ETXA 2G0EA 4CCMA 4CYCB 5FO5A 2DA4A 2GAUA 1KU9A 2KFDA 3QQAA 1KYZA 1X58A 3HHGA 4IZZA 1H8AC 5KFYA 5BS6A 2OQRA 2IXSA 2RNGA 3V42A 3H5RA 3GTPJ 2EJRA 1R71A 2LRDA 1K79A 4IO9F 1K78A 2FOKA 2AXLA 4NQWB 1TNSA 1HW1A 4WXHA 3CO7C 1D1CA 1ULYA 3KLNA 3ZQFA 3FXMA 1FC3A 5DG8A 4BY1G 1K83J 4BUPA 2IPQX 2VB6A 4JI5H 2EK5A 2JVGA 3ZMUA 4BEHB 2PQ8A 4NXMH 2UUZA 3CJQB 4OU0A 2XAJA 4IR1A 3BCBA 3G6EI 1X4OA 3HSFA 2QBYB 4M9SA 1R5HA 1RJPA 3K5IA 4YFNF 3HJEA 1ACIA 4RAGA 1AWCA 3BJAA 1ZREA 5JVTA 5FLXW 3OYKA 2MC4A 3TW6A 3TBIA 2FPPB 4GCVA 5HODA 3Q1KA 1B6SA 1XDUA 1V4YA 4A3DG 3DPLC 4XMYA 5KG0A 2CV0A 5C3EG 2DMUA 2KIQA 1NHAA 3N05A 4L9NA 1Y0NA 2BBYA 2EPFA 2FMLA 3IAS2 2E1NA 3GLXA 4A0ZA 3CCRI 3HC7A 3T0YA 3C18A 2GQQA 2V7FA 4ECWA 2R93G 1SVOA 2O0YA 4R8UB 1U5TC 5HBRB 4HSTA 1E2XA 5HS8A 3OYIA 1FSEA 4I6ZA 2BW3A 3E5NA 4LG3A 3JSOA 3CO6C 1UNNC 4IHXA 3LQRA 3TOBA 3PNYA 4DLKA 2BR0A 2YRWA 2E71A 2XPUA 1M0WA 1O7LA 1JX4A 2PMZN 2VKEA 3JAMK 2STTA 4LB5A 3N44B 2W9CB 2CUEA 2QM3A 2R92J 1FT9A 3AKZA 4S04A 3ZQIA 2CW0F 2R7DA 3RGXA 1P9QC 3KAJA 3WTUC 2ZMEA 2DOAA 2I10A 4QWEA 1KJQA 1MBKA 2K27A 2VLAA 3I55I 2PFBA 3I56I 3CVZA 5KG3A 4JI6H 5KFEA 2FQ3A 1K61A 1QA6A 2GIVA 3HOUG 1ETQA 4J9SA 5J6XA 5DUKA 3ABLH 5HNFA 4D9JA 2HDWA 3G1LA 2UUCH 1LE8A 1TLHB 4BXXJ 2HQNA 2O5RA 3T8TA 3JRGA 1I50J 3N8DA 3T1YH 1T08B 3U1KA 4DUYH 2VASA 2EILH 3EYYA 3R23A 1SMYF 3TINA 4GC7A 3KTMA 3HUGB 3VOEA 1BR1A 1TW2A 3K2ZA 2IVMA 3E6CC 1F1ZA 1YRNB 3N42B 5M3MJ 2X4HA 3ISPA 2R5ZB 3HOTA 1J9IA 4DR7H 2WAQE 4RLQA 5KG7A 3A02A 3DXJF 4L5EA 3EYIA 4I99C 3W2WA 3ZR8X 4M9ZA 4HNUA 4BY7J 5B3SH 5IPAA 3SHFA 3GZ6A 1K7AA 4ITVA 3ZQCA 2PI0A 1JKOC 4EBDA 2JA5A 4UXNA 4KN7X 3I4NJ 3IWFA 1ETVA 3RIRA 2R8KA 4BHBA 2B7EA 3K1NA 1KJ8A 2JPCA 1GV5A 3V4SA 3FKJA 5CAEB 5C1OA 2CUZA 1EYZA 2NU7B 2W7NA 3F8NA 4IF4A 4D7MA 1I6UA 3H5NA 1D0ZA 2X9DA 2ESHA 4EFBA 2EZKA 2K4JA 2KDZA 1HKSA 4A3EJ 5IWAH 1WJFA 2CG4A 4MIMA 2MG4A 5EYRA 2KJBA 4G94A 2QWWA 3BR1A 2V1UA 1EH8A 1C30A 2J5PA 1T95A 2C22A 3FMQA 1W7PB 5E8GA 4MQVA 3WE2A 1YE9A 4EM0B 3R5XA 2W48A 1MZBA 3LNQA 4F4WA 1I1SA 2UZKA 4ECRA 5D1OA 2IBKA 4A3BJ 5KFPA 2A61A 4GLXA 4LF6H 3D5RC 2ZJPF 2AO9A 3VYSB 4C2MJ 3J80W 1K4TA 1T2KA 5C1PA 3KETA 3SXYA 2BY0A 1SVMA 3DPUA 2L0KA 4ANJA 2X0LA 5E8IA 1WH5A 5GONF 4DQ2A 4UCVA 1YLFA 2F4OB 2HS5A 1B72B 4ED7A 2L9NA 1J59A 4YHHH 1U8RA 4ED6A 3ZQGA 5JLWA 2M45A 2QKMB 4X1EA 3OSGA 3RBDA 3SEZA 2WY7Q 5CVJA 4ZYEA 1N34H 1TWCJ 3PUFA 4ZI7F 2KIUA 4XLNF 3CDIA 2XC9A 2WTFA 4TQRA 4LITA 4JX4A 2D2WA 2VA2A 2HI3A 3ZPLA 4UCOA 4YP3A 2R92G 3FM5A 1A0IA 4EATA 2UU9H 1TWHJ 1EH7A 3RCOA 1MH3A 3DBLB 2IAIA 3T5KA 2CO5A 2KPMA 3K4LA 1H88C 5CPRB 5CVRA 2JMWA 4LIUA 3KZZA 5EWFA 4GFBA 2V79A 2KLOA 3WTZA 1QBJA 4CYCA 1WI9A 1X1CA 3ONQA 5F6FA 4M72A 3J7YJ 5IT3A 5BPIA 4KMFA 1OFCX 5BR8H 1I94H 1IBKH 3BPVA 2UUAH 4BXXG 1W7PD 4U6PA 2XRLA 2FEZA 3MFKA 2H09A 3BQ0A 3FXKA 2XD4A 2OBPA 2CZGA 3MZ8A 2ZJ2A 2E1CA 2MSYA 3OS0A 3ROUA 2QLZA 4QWQA 3KP3A 3BG5A 2ADUA 4DYQA 4C3JJ 1ZG3A 4XKBA 3U9TA 4XLHA 3BQ2A 4NQWA 2QVOA 4IPAA 2EIKH 3HOWJ 4QSHA 4KICA 3HM5A 5K2MA 5LP6F 2DN0A 1LFUP 1BW6A 4EVIA 2R7NA 3M9OB 4LFAH 3EDPA 4I09A 3CUQB 1KJIA 4BEHA 3F8FA 4KIGA 2IEKA 5EZGA 4XBFA 1Y1VA 3WO0A 3UNGC 1U0JA 2VOOA 1CE8A 4BY7G 1FYKA 1IF1A 4O3RA 2W85A 1P4WA 2LF7A 1SD4A 5ICFA 3ULQB 2EH3A 2HDCA 2FLLA 2LREA 3HSRA 4HG2A 1ITYA 2MCTA 4IAJA 2HZTA 5C4XJ 4O6JA 2F4MB 1QZEA 4BAYA 4CCLA 2GLOA 4BWSC 4XLCA 4LF7H 2LKXA 3MR2A 1FMVA 3GTJJ 5IT9W 3L2WA 2LKPA 3SQNA 2LD5A 2PMHA 1XC5A 1WWXA 1EF4A 3BAAA 1UCRA 4A3EG 4RB1A 4M3BA 2W6ZA 5J3LA 5LMNH 4MHGA 1RR7A 3MMYB 1P4XA 1ZYRF 1H9GA 1X4PA 3WTYC 4XL9A 2K3PA 2RVCA 2WB1A 2XAFA 4C5CA 2HTSA 1MMNA 1GSAA 3GIMA 4ECSA 4EGZA 1PP7U 3GFMA 4JUZA 3L2PA 3KYDB 1UMQA 4WBNF 2W9CA 4ESJA 3GIIA 3O8GA 3PW5A 1U2WA 1ETWA 1KEEA 3GTMJ 4QLCU 4DR2H 2WDTA 2Y48A 4A3BG 2K7LA 1YI2I 4F91B 2M2EA 3S3MA 3DKWA 1HKQA 3CCSI 4PDKA 2XSJC 2DLNA 4MV6A 5KFVA 2XAUA 3FMRA 2X6OA 2DA2A 4HV6A 1HBXG 1K1SA 3H40A 4DUZH 3PM1A 3MQ0A 4GC6A 4Q43A 1FOXA 1U78A 2DOEA 1SEUA 1FKAH 4KDPA 3TP0A 4PUSA 5T14A 5ED4A 2F5EA 3R61A 5D4RA 5JUMA 4J9LA 1RI7A 2UUBH 4DV0H 2FK2A 3HUGA 3CCYA 1OISA 1DU0A 3CD6I 1VBHA 4MFEA 3NGDA 3PFIA 3DTIA 1YRNA 1B6RA 1HNWH 1CF7A 4P5OA 1Z6TA 4AUXA 4D0PA 2ZNZA 3D5LA 3QOPA 2R5ZA 3I58A 5F08A 2JA6A 5A2QW 1SFOJ 1MBFA 4RA2A 1NG7A 1Z7UA 5DDGA 2XC7A 2FRHA 3JRBA 1HLVA 2GPSA 1D0XA 4FS2A 2VKVA 5ICCA 1OWTA 1FBSA 2CJJA 3QFFA 4PJ0C 3WG7H 2WA0A 4BHCA 5EDWA 3KE2A 3I12A 4OAYA 1GVJA 4E7IA 3CC4I 4AC0A 1I3QJ 1NG6A 2BHYA 3BG9A 3T5XA 4J9MA 3RQ4A 1Z2NX 3U1DA 4YAJB 4E7LA 1YTYA 1FMWA 1UB9A 2DT6A 4CO8A 5DD8A 2F5CA 3GBGA 2R7ZJ 3GW2A 4O3PA 3LMLA 1KBLA 1CQIB 2W00A 5KAIC 4CXFA 1MD0A 3ZMDA 5EG0B 1CS0A 4IR9A 2KDOA 3BWGA 3JREA 3CMEI 4X64H 3HOWG 2DZDA 2V1DA 3GIDA 1HQCA 2CV1A 1I1GA 1NTCA 4ENNA 1SD5A 1LFPA 2M34A 3OWTA 3RV3A 2VUGA 4EGQA 5C44G 4EBCA 2VE9A 1W7PA 4A3LJ 4XN3A 4C5AA 5FRNA 1JI8A 3E3VA 2CUJA 5D6EA 4P9UA 2XIGA 3DEWA 2IA0A 2CYYA 2IGOA 4YIFA 1I27A 1K1QA 2XCAA 2MH9A 4BL0B 5C4XG 2O9LA 4O3SA 4ECVA 5K7ZA 4JV5H 4JX6A 1A6QA 1K4SA 3JR9A 3Q8PB 1YIJI 3ZN1A 2FE3A 2M4GA 4JI0H 3ASOH 1SMTA 2ZO4A 3A1YA 4EEFG 1RESA 2L7MP 2QQ8A 3HSEA 3NRVA 2DO7A 3OS1A 1B9NA 2FP4B 3N43B 4J0MA 1VQMI 1B72A 2L9VA 3GIPA 1S5LC 3BTJA 1B33N 5CYVA 2PJRA 4M74A 4FU0A 1QQIA 4RZRA 2LR8A 2H6BA 2A6TA 5HVQC 2P6SA 3CDHA 5EEHA 3V7RA 4DJAA 4UB8C 1UC9A 1IOVA 3HOVG 4KJZA 3J80Z 2EIMH 2DK8A 3S2WA 2PBIA 4HPQA 1A35A 2FPGB 4I01A 4IHWA 5KG6A 2X51A 1M7JA 3RJPA 4EYHB 4CDGA 4DL4A 1X1PA 3W2VA 5FKKA 3PJRA 2ACJA 4X62H 1HSJA 4ASNA 1I7NA 1XGSA
chains in the Genus database with same CATH topology
4DV7H 2NS0A 1IZ1A 3DPTA 4EM1A 4HDVA 1XSVA 5ILSA 1G3YA 2DLLA 3WG9A 1XGNA 2BEOA 4YY3H 5HLGA 1W4MA 1LEAA 3FF5A 1J2XA 4LFCH 3SFZA 4IHTA 3CUQA 3EETA 4H0EA 4ESFA 2K4BA 3IL2A 1ZGJA 2ELHA 4DV2H 2XVCA 3RYPA 3JTHA 2A07F 3IWZA 3LSTA 4AIJA 5LGUA 4ZYDA 4UCSA 2E7WA 2D45A 3FXQA 4LF9H 5TRDA 1W5SA 1RIOH 1JXSA 2QQ9A 4GKJH 2KIMA 2P8TA 3FMSA 2EFPA 4Q48A 1XDSA 5L3CA 2Z3YA 2VOBA 4LGWA 1R58A 2P5LC 5D4SA 1VTNC 2PLYA 3BJOA 2HYGD 3PQJA 4FX4A 3KALA 4EJUA 3ABUA 4WX9A 2QUFA 4JK1X 1XSDA 3C1DA 5E1ZB 4RAZA 3LWFA 3ECHA 1RNLA 4LFUA 3LA3A 3H92A 1FVIA 3CTAA 1DPUA 3IC7A 3MZYA 3GO5A 5D6FA 5FGMA 4RZQA 4AQYH 5E18F 4G9YA 4A6DA 1AOYA 3BP8A 4ETSA 1TAEA 5LGNA 3NQOA 3KAKA 2RNJA 1T6SA 5A2QZ 4UCUA 3QP6A 3V4GA 4Y13A 1UHWA 1FWZA 1SD7A 1XMKA 2VBZA 1FLIA 4N0BA 1O3SA 3ZMVA 1HW2A 1RUNA 2A6EF 4LLNA 3L4JA 4HX7A 4IJAA 4M6YA 2HGCA 4PGHA 4DV3H 4EJTA 4CHUA 4MV9A 4A12A 3WGHA 2NRAC 3R60A 3V7CA 5AONA 5E20A 1G6NA 3BPXA 3TQNA 1XMOH 1H9TA 1J7KA 1USTA 1GXPA 2VBYA 4G6DA 2PJPA 2GA1A 1S8NA 1BC8C 1LEBA 5E17F 3I53A 1GXQA 3RKWA 3GEZA 3TGNA 1MJ9A 1IN7A 5DV5A 4RGSA 3KP6A 2MLKA 3GX4X 4BNCA 4MTEA 2VC0A 1V4RA 1OYYA 2IRFG 2GXGA 1BOAA 1LJ9A 2EV6A 5FD6A 1FNNA 1MGTA 1OMIA 4JYAH 5F1RA 4APMA 5HDKA 4R79A 3B02A 3GFIA 4DR6H 2P5VA 3HRMA 4B3TH 3HOSA 1L0OC 2HFHA 1KQ0A 3KP7A 2HTJA 2NAZA 4HQMA 2FMYA 5H20A 1T98A 1MJAA 4R8HA 1ZH5A 2EFOA 4LG0A 1N36H 2YX4A 3C7JA 2XGXA 4U7BA 1WSUA 5L3EA 4Q4ZF 5FPRA 1BJAA 4HA8A 1YG2A 4UUVA 3L00A 4UHTA 3MCZA 3FWEA 3VODA 3Q9VA 1Y0UA 3V8JA 1BI2A 4G6QA 2ZJTA 3HTSB 2YR2A 1J5EH 2EA2A 4GYIA 2Q8KA 3HYIA 1CF7B 1Z2OX 5LMUH 3L7WA 4A5NA 2C6YA 3J81Z 2CW8A 2B0LA 3VEPA 4K2EA 3K3VA 2OZ6A 2GWRA 2QYOA 4CGZA 3E6MA 1FP2A 3MZHA 2Z5UA 3F8BA 1IBLH 3W6JB 3F22A 5D5XB 1B04A 4L0ZB 2ZM6H 1ZHFA 1W5TA 3I54A 2BV6A 1P92A 1A04A 2ISYA 2KSWA 1FZPB 2LF8A 4BYYA 4KYWA 2FU4A 3N97A 4DV1H 1PUEE 4DR4H 3DF8A 3IKTA 2ZKZA 1ODDA 2L01A 3WTWC 1IXRC 4HDUA 4IHSA 1YW8A 3F6VA 3T8RA 3T1BA 4S05A 4NB5A 1FX7A 4ZH4F 2HVRA 3C3WA 1TW3A 2OD5A 1X9NA 1BIBA 2EV0A 5BMZA 4JI1H 4KIBA 2M5WA 1ZG5A 2W57A 3I64A 1ZG1A 1S68A 1ZAOA 2V1XA 2P6TA 1SFEA 3K9TA 1WRJA 4L9TA 2ISZA 4Q0YA 2EFWA 2JZYA 3WU1B 3KCCA 4ENJA 1LDJA 5F64A 1KQ9A 3D0SA 4OIRF 4OMYA 5CVVA 2NNYA 2FBIA 4YFXF 3AAFA 5FFXA 3DP7A 1B9MA 2FXAA 3M9AA 3RIZA 1QNTA 1PP8F 1IBMH 4X65H 1KGSA 4P55A 4L9JA 4M9XA 2DK5A 3KP2A 2L3DA 1R00A 3MWMA 4G7ZF 4HAMA 4FT8A 3L2CA 3GFJA 1ZRCA 1UFMA 2IA1A 4UVBA 2HEOA 3K69A 2J5OA 2VE8A 4L0YB 4I02A 3M4IA 2CSOA 1FSHA 3RI4A 4U0YA 5LHIA 3DF7A 1XSXA 4MGRA 1KQ8A 3KZYA 1KU7A 4L5IA 4CZZA 2WE6A 2Y75A 3SZTA 2WTEA 2L02A 3O2PE 3J81K 1XD7A 4RB2C 2TDXA 4LSAA 5FLXZ 4IVNA 2OQGA 1BI0A 5D5WB 2EB7A 3RGZA 2H94A 2RGRA 2DPDA 2JPBA 4L5JA 3VFZA 3QU6A 2HKXA 3F8MA 4UCRA 2HWVA 4MEXF 4A0YA 1V9PA 5AIPA 5LRSA 2RGVA 4EJOA 1G3WA 4LF8H 1IRFA 1R1TA 2D1VA 4B09A 5CLSA 1QO0D 3M8EA 1J0RA 3JAMW 2Q2EA 5HOOA 2K02A 4XLPF 2L4AA 1ONVA 5HDNA 2BYVE 3OV8A 3WE3A 3G73A 5DD4A 4I0AA 1HR0H 1B59A 5HLIA 3BABA 3U9GA 2YX7A 1FBUA 2ESNA 3W6KB 1Z6RA 2VPSA 4KNYA 3JTGA 1Z05A 2JTVA 1YYVA 2PG4A 1HKTA 1UHMA 3CJNA 4ZZDA 4HLYA 1P4AA 5K5QA 2NYXA 1FBQA 2DPUA 3H20A 3N40P 4OIPF 3DV8A 4F7ZA 4IRGA 4CICA 1TQPA 4KT5C 5DEQA 5CJ9A 1QGPA 2ZXJA 5KVRA 4ESBA 1VS0A 4ON0A 5CVIA 4JI4H 1F4KA 1S03G 2Q0OA 3JSPA 1U5TB 2VONA 4IRHA 1LDDA 1K6OA 1IXSB 4LSXA 1TNTA 4ENMA 2FNAA 1Z91A 5JHUA 5FFZA 3WTTC 3T1HH 1CGPA 2XUBA 5ICGA 3VB2A 4DV5H 3E5XA 2YPRA 4E70A 3LAJA 2W25A 4U7DA 3FXRA 5D8KB 2A6HF 1MDMB 4WXDA 2ETHA 1Z9CA 3N41B 1D5VA 1R5GA 2WV0A 3RKYA 4OIQF 2QZ8A 3K1PA 5FLXK 4A0XA 4UVAA 1BI3A 4XSZF 5JFRA 5H6RA 3KFWX 2V6CA 2PEXA 5BQTA 1U6GA 4UV9A 3BJ6A 2UXBH 2VXZA 3GVAA 1SFUA 1G3SA 3K1MA 2M8EA 4IRIA 1KU3A 3UQ8A 5D1PA 4LK0F 2VC1A 3RF2A 5DCMB 5J8FA 1R36A 4GYGA 2CWEA 4UVCA 2OWOA 1DUXC 2F2EA 1IXCA 4LG0B 2V9VA 5ERIA 5KK1A 1WKMA 4OX9H 3LFKA 1TBXA 3COAC 1KA8A 5CVUA 3RPQA 5K5OA 4UFZA 4EM2A 1B6AA 3P9IA 3FHZA 1TQMA 1D3YA 1SFXA 2F5DA 1S3JA 5HS9A 2MBFA 1BBYA 2O03A 4R1HA 4PCQA 1ON1A 4JQFA 2RN7A 1USSA 3HRSA 1YS7A 5D5VB 4TV7A 5IT9Z 4Y17A 4LH6A 3TKYA 1XMQH 3BA9A 2MA3A 1BI1A 2RV8A 3J7AK 1RZ4A 3IG0A 3JSNA 4B3SH 2FSWA 3RKXA 1LVAA 2COMA 1R22A 3IHUA 3GFLA 1BN5A 2YU3A 3LQQA 4LFBH 1XMAA 1AN7A 1S7OA 1V3FA 5L3FA 4RGXA 2MD5A 3TOAA 3BZ6A 2DFIA 2YSRA 3CUQC 2H27A 3L4KA 5LL6b 3HIFA 4WXCA 1JHFA 1QZYA 4G7OF 1LNWA 5ILVA 4U0VA 4LD5A 1F9NA 1O57A 5EEGA 4AIKA 3J80K 3F21A 2UXDH 4XSXF 5DYMA 3CLOA 2QENA 3RDIA 2VN2A 4G7HF 2K86A 4GO1A 2DW4A 5JR3A 2M87A 2STWA 3LA2A 1EH6A 2AS5F 4A6EA 1REPC 3H3UA 4CC5A 2EFQA 2XAHA 1XNQH 1ZHQA 4HOBA 1WQ2A 2VT3A 1ZLJA 2DQRA 4NHJA 4RS8A 3GF2A 3ABTA 3OOPA 4JBAA 1U5TA 4DNCA 3HXLA 1YQAA 2FBHA 4EV0A 3F72A 4I0BA 3O3KA 4HF1A 2LDUA 2CW7A 2JSCA 4AWXB 2VODA 4AVPA 3ZP5A 2L4MA 2XAGA 4FM9A 3DQVC 1IW7F 4L9VA 3KLOA 1G4DA 1MDMA 2O61A 2OZUA 2R3SA 3M7GA 4WCGA 3KP4A 4AIHA 4JI7H 5EOYA 1C0WA 3ZQ7A 3ZMTA 3M1EA 4HX8A 1F5TA 4I2OA 4FX0A 2MH2A 2P4WA 2G7HA 5IT9K 3K0LA 3WGIA 5L3GA 1PDNC 4O3MA 3GXOA 4N9IA 4MEYF 3TDUC 1FYMA 4B3RH 3QPHA 2HHHH 3RJ0A 3GWZA 2KJCA 5LLQA 2OA4A 1Q1HA 5DCMA 2HYFA 2UWMA 4A2BA 3H3ZA 1N33H 2A69F 1FP1D 5LRRA 1JGSA 4UCTA 3BDDA 3V8KA 3FXUA 1STZA 2FBKA 4ZZLA 3FZVA 4JI3H 2XROA 4L18B 2CQKA 2LSOA 5J8CA 1HW5A 2P5KA 1LQ1A 5FB2A 3N6XA 2VOPA 3RPUA 2EV5A 2Y0MA 4EEQA 1BM9A 1D8JA 3QAHA 1IN5A 1JE8A 2MC3A 2G7UA 1SD6A 1E17A 2D1HA 5A2QK 2WYOA 1RUOA 1D8KA 5E1WA 1N32H 1IN6A 1E4GT 3P9KA 2A5YB 2RKHA 1ZRDA 4KN4X 4NXNH 1ZHSA 2DTRA 4A5MA 4PZJA 2HVQA 1IUYA 4LF5H 2BGCA 2OU2A 2XV4S 2O3FA 1HNZH 1H0MA 2UXNA 2IA2A 2NNNA 5JI6A 3WTVC 4HBLA 2XHKA 2ZNYA 3Q5FA 2QQAA 4RB0A 1U3EM 1BIAA 5E1XA 3J7AO 2CFXA 2VBWA 1FPQA 4PDBA 3KXYT 1R7JA 4UV8A 4XRFA 1IAWA 5DUIA 1HSTA 2WWYA 2Z99A 1TQIA 1YW9A 4LH7A 4LJZF 2LNBA 1GYFA 5H6QA 3U2RA 4P96A 2M30A 3GZ5A 4U88A 2HQRA 3DFGA 1O3RA 5FPOA 2HGSA 3PN1A 1O3TA 4YFKF 3ML6A 4AD9A 2YCHA 2DQLA 4Y15A 3KEOA 2XASA 2HOEA 1XN7A 4KIFA 1ON2A 4HLXA 4LB6B 4OMZA 4BQAA 3P9CA 3IRQA 1TA8A 5BPDA 2FA5A 3ZMZA 4OOIA 2A68F 2IT0A 4O5VA 5DCFA 3ERED 1IRGA 1YO5C 4LLGF 3LAPA 3WGGA 1FJGH 1I5ZA 1LB2A 1KU2A 1YIOA 3LA7A 4U0WA 5D5UB 2P7VB 2HR3A 4KHPH 3I5UA 3F6OA 4GKKH 4I98B 1EV7A 3RTXA 4HV5A 4LMYA 4ENKA 1TTYA 1T0FA 4M6XA 2EFNA 1Z2PX 3QPTA 4HQEA 1OPCA 2L54A 1DGSA 4OINF 4I7HA 4HF2A 3FM3A 1OR7A 1B1BA 5HS7A 2GZWA 1DDNA 2QBYA 5ILUA 1LDKB 1BGWA 4HX4A <