4RAYA

Crystal structure of magnetospirillum gryphiswaldense msr-1 apo-fur
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
136
structure length
135
Chain Sequence
GHMVSRIEQRCIDKGMKMTDQRRVIAQVLSDSAHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
total genus 44
structure length 135
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rayA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rayA02
3ABUA 2XV4S 3F8FA 3T8RA 1B1BA 3CLOA 2LSOA 1XSVA 4LJZF 3R4KA 4HBLA 2E1CA 4LB6B 4FX0A 2VOPA 1XSDA 3BROA 1FP2A 2MLGA 5H6RA 3ZMTA 1L3LA 3EYIA 2RKHA 3CJNA 1LJ9A 4L9JA 2ZNYA 4L5JA 4HLXA 4BYYA 2G7HA 3ABTA 2PN6A 4S04A 5LRSA 2NYXA 1LDDA 4HW0A 4Q47A 4KIGA 1IXSB 4CYDA 3GO5A 4KN4X 4I98B 5HLGA 1YG2A 4EM1A 2FRHA 3NEUA 3C1DA 4ZZLA 3T1BA 3GW2A 3WTZA 3T8TA 3KP3A 1DP7P 3I71A 3JTGA 4MQVA 2VC0A 2KIMA 4I7HA 1LEBA 2VN2A 2UZKA 2P7VB 5F64A 4JBAA 1P92A 1B9NA 2NS0A 4ZYDA 2XAJA 1D8KA 3HHHA 4U88A 5CYVA 5ED4A 4L0YB 2EA2A 3M8EA 4OMYA 1ZGJA 1Z05A 5E1ZB 1XGNA 1V4RA 3PFIA 2CO5A 3TQNA 3SZPA 3KP5A 1IZ1A 4ENNA 3GWZA 4R8HA 2H27A 1KA8A 5FB2A 4I0AA 1ULYA 3J81Z 3M1EA 2XRNA 1ODDA 3F23A 1JGSA 4B8XA 4UV8A 1HW1A 3V7RA 2X4HA 3NQOA 4LLGF 5ILSA 2IA0A 3LQRA 1TBXA 4LG0B 4RB1A 4U7BA 2ADUA 2W24A 3AAFA 3ZMVA 3IWFA 4Y17A 4M9ZA 1LQ1A 4XRFA 2GWRA 2ELHA 2DK8A 3MFKA 4HX7A 2Q2EA 1ZG1A 5K5QA 4IRGA 4KNYA 5D6FA 1G3WA 2Z9OA 3G3ZA 5HDNA 1XGMA 4UVBA 3V4GA 2MH9A 2B0LA 3GUDA 3WGGA 3RKWA 2XASA 1TTYA 4YFKF 3HRTA 1FBUA 2GA1A 3FMSA 4NQWA 4EJUA 5BPDA 4EM0B 5HLIA 3EQLF 3JW4A 3KE2A 3FM3A 5ILVA 3R61A 4LGWA 1ON2A 5D8LB 3SQNA 2HR3A 5FLXZ 3IHUA 1X3UA 4OU0A 3Q5FA 3W6KB 4A5MA 5CJ9A 1T6SA 2MA3A 1F4KA 1FLIA 2AS5F 1B9MA 3QU6A 1K7AA 5BQTA 2DU9A 2XVCA 2JT1A 1P2FA 4A0YA 4KFCA 3FXQA 4AD9A 1P4XA 5E8IA 3LFKA 1Z91A 2IP2A 2A61A 4MTDA 3IWZA 2HWVA 4ENJA 3H92A 1GXPA 5ICCA 3F72A 3VOEA 5HS8A 2P7CB 2A3SA 1GVJA 2Z3YA 1YW7A 2CW0F 1XN7A 4XLNF 2RC4A 1XDUA 1ZAOA 2WTEA 2A07F 2VE8A 4I0BA 4ZYEA 3F22A 4M9XA 4HV6A 4Q4ZF 3L2CA 1IXRC 5AIPA 3ZMUA 1HW5A 4EV0A 1E17A 4JQFA 2FEZA 1IF1A 3ZN1A 3EDPA 1FPQA 3E3VA 1LEAA 3P9IA 4EVIA 5LGNA 2QYOA 1T38A 1KQ0A 3KP6A 4GXOA 5CVJA 3C7JA 3R0JA 1GHCA 4YIFA 3QU3A 1RUOA 2KJBA 2YU3A 1XCVA 4AIJA 1FSHA 4ENMA 2HGCA 2OD5A 2VXZA 1KGSA 5LLQA 4MQ9F 3WU0A 2ZMEA 1CF7A 1IXCA 1YQAA 2FE3A 2P5KA 1SD4A 2JPBA 5DUIA 4U0WA 3TOAA 3ZP5A 2VBXA 1ZH5A 3LA7A 3BP8A 4A2UA 4EMSA 2FA5A 1OR7A 5D4SA 3IKVA 4ENKA 3FF5A 2FMYA 4L5IA 3WE2A 4CO8A 2VT2A 3DPLC 2RN7A 1IRFA 4ESFA 3J80K 2YX7A 2F5FA 1ZLJA 2CG4A 5CLSA 4KIFA 3U2RA 1R5HA 1XMAA 5HS7A 2IVMA 5LHIA 1PDNC 3CO6C 4F7ZA 5K5RA 1G4DA 4KIBA 3P9CA 3V8JA 2K4JA 3BDDA 1ZYRF 3GF2A 3MZYA 3SZTA 1R1UA 3LWFA 5D4RA 1J7KA 5HDGA 1H0MA 1ZARA 5LGTA 3KZYA 1TW2A 4XSXF 4OOIA 1Z9CA 2OU2A 4M72A 5DYMA 2CSOA 3EYYA 2FQ3A 5AIQA 3CUQB 1G3YA 3MWMA 4QWQA 5CVVA 5DD4A 3BJAA 1T0FA 2ISZA 3FMQA 5DDGA 1T39A 3J7AO 1R7JA 2D1HA 4HAMA 4IJAA 4L9NA 4B09A 3KP2A 3TO6A 2Z5UA 4EJVA 4IHSA 2EFNA 4OIRF 2H09A 1QPMA 1TLHB 1LDKB 5E17F 2DQRA 3LQQA 1QBJA 1TQPA 2XKPA 5EEGA 1FYLA 4LLNA 1YS7A 2HQNA 3MZHA 2DFIA 2OQRA 1YS6A 3F8CA 2K86A 2VBZA 1TNSA 4Q48A 4YFXF 3F21A 2FBIA 1USTA 1BN5A 2EFOA 3WE3A 2P6TA 1S6LA 4ZYGA 1SFUA 2F5DA 1JHFA 4OMZA 3V7SA 4N9HA 1QZZA 1CGPA 2OA4A 3DEUA 3H3UA 3DFGA 4KYWA 2GAUA 2P6SA 3K1PA 1O3QA 3FMRA 1FOKA 2CWEA 4QLCU 3MEXA 3BWGA 4BH9A 2HYGD 4OIQF 1KU7A 1I27A 4HOBA 5BS6A 3HTSB 5E18F 5J8CA 1TNTA 4UNOA 2OZUA 4LMYA 2M5WA 1Z7UA 1XGSA 2FNAA 2RDPA 3O3KA 1GXQA 4MGRA 1S8NA 2ZO4A 3CO7C 2LNBA 4RAZA 2O3FA 3FXRA 1REPC 1OPCA 2K7LA 2CGPA 2FU4A 5DEQA 5HS9A 1OKRA 1KU3A 5J6XA 5BOXA 2WC2A 2GXBA 1NHAA 1HSJA 4A0XA 1Z1DA 1ZG5A 1PUEE 1HKQA 1U3EM 2DLLA 1S29A 2VBWA 2RNJA 5D5VB 3BJ6A 3U9GA 3IRQA 3RI4A 2HZTA 5ERIA 3T0YA 4DQ2A 4YIIA 5EEHA 2GIVA 3SFZA 2O6GE 1R36A 4BXUA 2G7UA 2J5OA 4O5VA 1HXDA 2H6CA 3LA2A 5DCFA 1P4AA 3M8FA 1CF7B 3QAHA 5KK1A 4H0EA 1UFMA 4AWXB 1R5GA 5L3CA 5LHGA 3WU1B 4RS8A 3BJOA 3GXOA 4M9SA 3HTUA 3VFZA 3IC7A 4P5OA 1R1VA 1ZLKA 3WTSC 3ULQB 2YPRA 2HOEA 3QRFF 6PAXA 4BHCA 3MQ0A 4AIKA 2RGVA 2VBYA 2NAZA 3VB2A 3SHFA 3V8KA 1HKSA 1OYIA 5L3BA 3I54A 4NB5A 3F8BA 2W84A 1USSA 1U5TB 4EJTA 2BYVE 5D5UB 1B4AA 2RV8A 3VEPA 1RIOH 1SFEA 1YW8A 2D1VA 2XROA 4KA4A 5ILUA 3RPUA 2HEOA 4YFNF 2OBPA 2ETHA 1UHWA 2P8TA 3KLOA 4E70A 3GFMA 2Q8KA 1XDSA 1O7FA 4A6EA 2ZXJA 1R22A 2BE5F 2GA2A 1J0RA 2EWNA 2H6BA 2NNNA 3DV8A 2JZYA 1FBQA 2A68F 2PG4A 2X0LA 1U6GA 1EH8A 4LFUA 4WXHA 2OQGA 2HKXA 2MBFA 2QUFA 5DD8A 2Y48A 1KQ9A 1IUYA 1FY7A 2F5EA 2GZWA 4K2EA 4WX9A 2AXLA 2R7DA 3HOTA 4M6YA 3I5UA 3ZN0A 4N0BA 1WQ2A 3OV8A 2L01A 1QGPA 3QOPA 3GZ5A 2WWYA 2L3DA 2YR2A 1W7PB 4CGZA 1WKMA 2MLKA 1J9IA 1U2WA 3LA3A 1ZGAA 3I0TA 2R7FA 3BZ6A 3E6BA 1DDNA 3K2ZA 2FOKA 1BI0A 5FLXK 1IN5A 2QQAA 3HSEA 4HF2A 3WTXC 2QBYB 1FWZA 3F8NA 4N9IA 3FX3A 2KJCA 1V3FA 5L3EA 5BMZA 2DAOA 1ZG3A 1P6RA 2R3SA 1SMYF 4AVPA 2MH2A 3HRUA 2EV0A 3WTUC 1OYWA 3GLXA 4G94A 4PDKA 1LDJA 4LG0A 1G3TA 4UV9A 4AIHA 4KT5C 1F1ZA 4G6QA 3JAMK 4IVNA 3R6SA 1ZRFA 1D5VA 4FT8A 1OMIA 4IPAA 1WWXA 5FD6A 1I5ZA 1WI9A 1K78A 1H9GA 1KYWA 2D2WA 1TQIA 1YYVA 1T2KA 1S7AA 2EB7A 4WWCA 1FYMA 5JR3A 3I64A 5JVTA 3SXYA 3WODF 4FX4A 2ZFWA 4RAYA 2RVCA 2ISYA 2EK5A 3K69A 3M9AA 3LAPA 1R58A 4HQMA 1SFXA 2HFHA 1YW9A 5FO5A 1R23A 5TJJA 1LNWA 2DBBA 4XBFA 4NHJA 3WTVC 4HDUA 1W7PA 2HTSA 3B73A 2VT3A 5AONA 1XMKA 4G8XA 4UUVA 1J75A 1SD7A 1DPUA 1U5TA 1ZHFA 4P9FA 2YSRA 1ONVA 4WXDA 2A5YB 3RPQA 4LB5A 3ECOA 1QQIA 2UWMA 2XAHA 2K02A 3HSRA 3MCZA 2LF8A 5DCMA 2PBIA 4Y15A 2HQRA 2JSCA 3GYHX 4EQQA 1J59A 3J80Z 4I01A 3CTAA 1R00A 2IJLA 2V79A 4Z2YA 1I1SA 1E2XA 2VC1A 4LLLA 5FFZA 2HKOA 1I1GA 2H94A 3RTRA 4M6XA 4MHGA 2QBYA 3C3WA 1BI2A 3T5XA 4IRHA 4TV7A 5LEKA 3BPXA 2EJRA 5DV5A 4BHPA 2COMA 1SMTA 5JI6A 3RYPA 2XAGA 2FXAA 3ZMZA 3I4PA 3B02A 4HX8A 1O3TA 4DNCA 3K1NA 3RKYA 4RGSA 1FNNA 1H9TA 2F2EA 4OIPF 2XAFA 4MNUA 1D8JA 1L0OC 1LVAA 2ZJ2A 3TKYA 3WGHA 2HS5A 1J2XA 4HV5A 3W6JB 2NRAC 2V6CA 5FGMA 3QPHA 2STWA 3N97A 5D5WB 3J81K 4IHTA 4CZZA 4G6DA 1BOAA 4IRIA 4L18B 1Z6TA 2J5PA 1K79A 2O03A 1IN6A 3E97A 2PEXA 4ESJA 3DPTA 1STZA 1IN7A 2GQQA 2QVOA 5L3FA 1G6NA 1ZN2A 4FHTA 5ICGA 1C0WA 4PGGA 2L02A 3HUGA 2ZNZA 3JSOA 2W57A 5K5OA 5IT9Z 1A04A 1RI7A 2ESHA 4RGRA 5L3DA 1EH6A 3E5UA 2EV6A 5D8KB 1I6XA 3QP6A 1SAXA 1B59A 2Y0MA 3Q9VA 2Y75A 1UHMA 3EUHA 4ESBA 3Q9SA 1FBSA 5D5XB 1IN8A 2EV5A 1FZPB 1R1TA 5TRDA 4IXAA 5H20A 1MZBA 2Q0OA 3M7GA 2FSWA 2M8EA 3LSTA 1QZYA 3KZZA 4PCQA 1IN4A 3RKXA 2CFXA 2TDXA 3LAJA 4LK0F 2YX4A 1HKTA 2NNYA 3MAJA 3ERED 2F5CA 4RGUA 2PJPA 2PLYA 1DUXC 1F5TA 5CVIA 3O2PE 4P9UA 5K1YA 4LD5A 2JRTA 1P4WA 3D0SA 2ACJA 2VOOA 2V1XA 3RIRA 4CICA 3IRRA 1JE8A 1BM9A 3L9FA 2O61A 1PP8F 1SD5A 1XCBA 5JHUA 1WRJA 2BEOA 5D6EA 3FWEA 2VODA 2VE9A 4L9TA 4A12A 4EGZA 1O7LA 3K0LA 2QZ8A 1Z6RA 2IPQX 2UXNA 2EA4A 3HSFA 4P96A 1KU2A 4KMFA 1MD0A 4R79A 3ELKA 1U8RA 4KMUX 1BI1A 2LDUA 1BIAA 1KYZA 3KP4A 4G7ZF 5F6FA 1O3SA 1J5YA 2QM3A 3E6CC 3V8LA 4BAYA 2L4AA 1Q1HA 2HYFA 3V7CA 4HZFA 1YO5C 2FF4A 3RYRA 3KEOA 1BIBA 3H3ZA 5FFXA 4GYIA 1UB9A 3ML6A 5LHHA 1F9NA 4MTEA 3D5LA 3HRMA 3P9KA 5JFRA 2GXGA 5DCMB 3FM5A 4I09A 2P4WA 1HW2A 2DPDA 3TO7A 5HDKA 3RDIA 3R0AA 3I59A 3WTTC 2P5LC 4U0VA 4M74A 1KQ8A 4BQAA 3F6OA 3P7NA 3BY6A 4HX4A 3COAC 1MJBA 2A6HF 4RB0A 3GVAA 4O3MA 3DF8A 4RB2C 2BV6A 3ROUA 4PGHA 3FHZA 2XHKA 1ON1A 2PFBA 3S2WA 1ZREA 3HIFA 4G9YA 1ZRCA 4ZZDA 3CUOA 5CVUA 4EM2A 1UCRA 3CUQA 1MDMA 2V1UA 2PMUA 2WV0A 1MKMA 3C18A 3K1MA 2M87A 3E6DA 2KKOA 2W85A 4BNCA 3DKWA 4OIOF 3TDUC 1FP1D 3IL2A 4G7OF 4CDGA 1BI3A 2BGCA 4M71A 3ZQ7A 2CYYA 2DPUA 5A2QK 2DI3A 4ZYHA 3ZMSA 5IT9K 3TO9A 1KU9A 2FBHA 3RJPA 4BHBA 3WGIA 3KETA 3BOQA 4I2OA 1IAWA 1RZ4A 4RGXA 1AOYA 2QQ9A 2EFWA 2QENA 3KEQA 2ZBKA 3GX4X 1MJ9A 3GEZA 1S3JA 3DP7A 3CUQC 3GZ6A 5F1RA 2Z99A 1BC7C 1XD7A 3HYIA 3ZPLA 4MEXF 1BBYA 4HF0A 4D0PA 1U5TC 2ZKZA 4WXCA 4LK1F 5E20A 1FT9A 5J8FA 1W5TA 2HDCA 2D45A 4UXNA 3ISPA 3F8MA 2V9VA 1EH7A 3E6MA 4HDVA 4I02A 5A2QZ 2E7XA 2KIFA 4HLYA 3I59B 2EFPA 3E5QA 3U1DA 5HOOA 1QNTA 2VONA 2PMHA 4UVCA 2IW5A 4WF2A 1K6OA 4ETSA 4A5NA 5H6QA 4L9VA 3JSPA 1FYKA 3OOPA 4G7HF 5HLHA 2P5VA 2FBKA 1XGOA 5BPIA 2RQPA 2DTRA 2XKOA 3KFWX 4IF4A 3I53A 3I58A 4ON0A 3DQVC 5LRRA 4PZJA 1K78B 4U0YA 2DK5A 3WG9A 2IA1A 4CHUA 5LBQA 1SD6A 2PI0A 1W5SA 4A6DA 1OYYA 3VODA 1IRGA 1FC3A 1IW7F 4YG2F 2CQKA 2FMLA 1TQMA 4WCGA 2IA2A 2BBYA 3ZMDA 3QPTA 2JTVA 1XB4A 2XGXA 3ECHA 3L7WA 2LF7A 2M45A 2M30A 4UVAA 1YLFA 1AWCA 4Q5SF 1HBXG 1S7OA 1YIOA 1D3YA 4U7DA 4HYEA 3TOBA 3FZVA 2LKPA 4XSZF 2EFQA 3KLNA 5FD5A 2PQ8A 1JHHA 2QWWA 4EJWA 1U78A 1RUNA 3TGNA 3KP7A 3HOSA 5KVRA 2QLZA 2O0YA 3K9TA 1VTNC 2XAQA 2K27A 1XSXA 4UHTA 1PP7U 3JAMZ 1FSEA 1YTYA 3JTHA 1W4MA 4KICA 3L09A 2STTA 2MC3A 1HQCA 2O8XA 3HHGA 1BJAA 1TW3A 4HQEA 1B6AA 5E8GA 1JXSA 2DT5A 2G9WA 4MEYF 4GO1A 3DXJF 2E7WA 1DPRA 3F6VA 4GCVA 5ICFA 3EETA 4EJOA 2L4MA 2UXXA 1QO0D 3GFJA 3IKTA 3PQJA 2HTJA 4HA8A 3WTYC 4KDPA 5L3GA 2Z33A 2K4BA 3N4MA 3GFLA 5CVRA 5E1WA 4HF1A 1O3RA 5E1XA 2M1BA 2KIUA 3R60A 5IT3A 2DO7A 4L0ZB 4Y13A 4EGYA 1LB2A 2DQLA 3REOA 3NRVA 5DUKA 1Y0UA 1WSUA 4XLPF 2JPCA 4A0ZA 5LEJA 4M73A 3TDZC 5LGUA 4KN7X 5HVQC 5ICEA 4S05A 1MDMB 2A6EF 3GFIA 4O6JA 4OINF 3O6BB 1EV7A 4GGGA 4JK1X 3BPVA 1MJAA 1MGTA 1G3SA 3L00A 2IT0A 3F3XA 2W25A 2ZMEB 2FNPA 2OAZA 1RNLA 4GYGA 3CDHA 2E1NA 2IRFG 4ZH4F 2C6YA 3E5XA 3WTWC 1W7PD 2XIGA 2ZCWA 2DW4A 4RB3C 4CXFA 1HSTA 3FXUA 2OZ6A 2MD5A 1T98A 4R1HA 2KRFA 2V1DA 2ESNA 2QQBA 3PQKA 2L54A 2A69F 3KCCA 3QP5A 4P55A 1O57A 1BC8C 3HRSA 3G73A 4ASNA 1YFHA 1ZRDA 1FX7A 4WK8F 2XUBA 4KUMA
chains in the Genus database with same CATH superfamily
4UUSA 4M6VA 3OUZA 3ABUA 5KT5A 5F9LA 2XV4S 3F8FA 3T8RA 1B1BA 3CLOA 2LSOA 3OYHA 4J9SA 1XDNA 3H3VH 1XSVA 4MA5A 2CW7A 4LJZF 1IUFA 3CMEI 4OX9H 5DLGA 3R4KA 4HBLA 3QZ7A 1NG7A 2E1CA 3HOVG 4BY1J 3KZIC 3GLKA 2W6NA 3X2QH 5KG3A 1XNQH 1JGGA 4F55A 2B63A 4LB6B 3RPUD 2R8HA 4JI4H 4FX0A 2NVUB 1X1PA 1T8IA 4E4HA 2VOPA 4MV8A 1XSDA 5L1IA 2ASDA 3BROA 1FP2A 1X1AA 1R49A 2H1KA 4GLXA 3PO2G 4C2UA 1ETQA 2MLGA 2QA4I 1CQTA 5H6RA 3DBHB 3ZMTA 4TQRA 2BZTA 4PFPA 4JV5H 1L3LA 4C30A 3Q0UA 3OYBA 3EYIA 1I3AA 2RKHA 3CJNA 3JRFA 2WY7Q 4YAKB 1TAEA 1LJ9A 3I12A 1U9OA 3HEFA 1R9TJ 2R7VA 2YUSA 4L9JA 3JRCA 4BWSC 4BKXA 2ZNYA 4FS2A 5GADJ 4L5JA 4BBRJ 3T5LA 2MC4A 4XNFA 4HLXA 4BYYA 3W2VA 2W6QA 4EBEA 4A3JG 2G7HA 4DR3H 2DA1A 4Y4RA 1ETKA 3ABTA 2GIZA 2PN6A 3ZR8X 1B6SA 2VJ5A 2VKDA 3IP4B 4S04A 3BQ0A 4AU7A 5KFMA 5KT2A 2JA7G 3K5HA 5LRSA 5DQGA 5KFSA 2NVXJ 4Z6YA 2R93G 4AYBA 4O2BF 2NYXA 1LDDA 4HW0A 4Q47A 2JEGA 4KIGA 4C3HJ 1IXSB 4AM3A 4CYDA 3GO5A 3NWTA 1YJWI 4KN4X 4YEJA 4F4ZA 2Q1ZB 4I98B 5HLGA 1YG2A 4C3JJ 1GV5A 5F0HA 3PSFA 4AC0A 2A5WA 3H20A 4QWBA 1Z3YA 2GBYA 3QYEA 4PK4A 1E3OC 3CCEI 3CMAI 4EM1A 2FRHA 1HNXH 2Y0SA 4XONA 2M2EA 3NEUA 3OOUA 2FOWA 1MMDA 3K3PA 3C1DA 5BPHA 4U87A 1I50A 3BQ2A 2MABA 1OCRH 1JUMA 4ZZLA 2Y31A 1AUXA 3T1BA 5J1YA 3GW2A 2Y9ZA 3ESWB 3W2WA 1X58A 4A3CG 3WTZA 3T8TA 3KP3A 4CCJA 3MFIA 2V59A 2V4RA 4BS9A 2XPWA 3H5AA 2VKEA 1DP7P 2NUAB 2AGOA 1RESA 3AG2H 5EG0B 3I71A 3KHHA 3KIOA 3JTGA 1K61A 5E3MA 4MQVA 2VC0A 3CQZJ 2WA0A 2I80A 4QPQA 1AHDP 3H9GA 4NC6A 3H4BA 2KIMA 1OISA 4I7HA 2R93J 1LEBA 2VN2A 3ZRGA 5FPRA 3OYDA 2V4JC 2UZKA 2P7VB 4LIUA 1MNEA 5F64A 4JBAA 1P92A 3V4SA 1B9NA 2DA6A 2NS0A 4ZYDA 4IAJA 1DGRM 2XAJA 3CCSI 1W93A 1D8KA 3HHHA 3H9JA 2C35B 4U88A 4L5EA 2LH9A 5CYVA 5ED4A 4L0YB 1ZR4A 1X1BA 3JRBA 3T1HH 2EA2A 2CH0A 3M8EA 4OMYA 1ZGJA 3I56I 2R92J 4BY1G 1Z05A 5E1ZB 4OWRB 1XGNA 1V4RA 3PFIA 3LMMA 1E3HA 1MMNA 4BQNA 3H40A 3PW7A 2OF7A 2QYZA 3HXLA 2ZXHA 4M3FA 5F0CA 2VUGA 3BA9A 5KFUA 3RGZA 2BQ3A 1RR7A 3L2VA 4C2TA 2CO5A 3TQNA 3Q0WA 1JTYA 2F6CA 2LR8A 3QYFA 3SZPA 3OL3A 5LA6F 2W48A 3KP5A 1IZ1A 3O8GA 4ENNA 3M4IA 3GWZA 2M34A 4X65H 4R8HA 4B44A 3RKQA 2H27A 1XG1A 2W9AA 1KA8A 5C44G 2B63G 5FB2A 5KFRA 4I0AA 2UUAH 5IP9J 1ULYA 3F9KA 3PNVA 3J81Z 1WCMJ 1E4GT 2R84A 3M1EA 3OYKA 2XRNA 1ODDA 3F23A 1JGSA 3Q3SA 1WH2A 4E7HA 4ANJA 4B8XA 3K4KA 4UV8A 4QW8A 3QFFA 1HW1A 1E4EA 5K7ZA 3ZQGA 3V7RA 1F43A 2R86A 2X4HA 5EZGA 2VPRA 1L2ZA 3NQOA 4LLGF 3ZGKA 5ILSA 3HOXJ 4NC7A 1V51A 2IA0A 3RBEA 4PUSA 1A31A 3LQRA 4IHYA 1TBXA 5J4YA 2BHYA 4LG0B 4RB1A 2KHMA 2V9KA 4U7BA 1PJRA 1A36A 2FLLA 3OS2A 2ADUA 4A93G 3PUFA 5KKNB 4BUPA 1YE9A 2W24A 3AAFA 2CV1A 3EPIA 4HNUA 3ZMVA 2J6TA 1ZKGA 2ICWG 2I10A 3IWFA 4J9MA 2XGEA 2DOAA 2NOGA 4MO7A 5E79C 2DTZA 4Y17A 5FKKA 4I6ZA 4A3GG 2ECCA 2TCTA 3U1KA 5E3NA 2ATLA 2JA6G 4M9ZA 1LQ1A 2HU9A 4ZTJA 4XRFA 3LP8A 3DLAA 3S14J 5C1PA 2XF7A 4EEQA 4KITB 2GWRA 5DG7A 2ZJRF 2ELHA 4A93J 2DK8A 3FXKA 3MFKA 4A3BG 4HX7A 2Q2EA 1ZG1A 4XOPA 5K5QA 1I7NA 3FXMA 4IRGA 4KNYA 1TP4A 2LLKA 1IRZA 5D6FA 3G6EI 2IMWP 2K5CA 2WADA 2J9GA 2ASLA 4JI0H 1X19A 1G3WA 2BY0A 1OCCH 3G3ZA 4KT6A 1XGMA 4CA0A 5HDNA 3L2RA 2Z9OA 4J9PA 1Y0NA 4UVBA 3V4GA 2MH9A 5FKOA 2C28A 2B0LA 3GUDA 3WGGA 1IOWA 3OR2C 3RKWA 2R85A 1VQ6I 1WCMG 2XASA 1BW5A 1TTYA 2BXYA 2OC6A 3HRTA 1FBUA 4YFKF 2GA1A 3C2HA 3FMSA 4XN0A 2QSHX 1MBHA 3LSIA 4JI8H 4NQWA 4XKBA 2X9DA 4C5AA 4EJUA 5BPDA 2V26A 2ZMEC 5JLXA 4EM0B 3H35A 5FLXW 3JRXA 4V2GA 5HLIA 2IS4A 3EQLF 3JW4A 5IYBJ 2I8CA 4FU0A 3KE2A 1ZQ3P 4DLKA 2E2IA 3FM3A 5ILVA 4RNOA 4A3BJ 3R61A 1TWFA 2LFBA 4LGWA 1ON2A 2L5QA 5D8LB 3SQNA 2HR3A 1MH3A 2YS6A 5FLXZ 1JKPC 4XRSG 3HOZG 3L4KA 3IHUA 3RBDA 3B6AA 4XLCA 4DBQA 1X3UA 4OU0A 3Q5FA 1SVLA 3I4MJ 3W6KB 4GRIA 4A5MA 3AKZA 5CJ9A 1T6SA 2MA3A 1F4KA 1FLIA 2AS5F 1B9MA 3QU6A 1K7AA 2HI3A 5BQTA 1B8IB 2I8DA 2IS6A 2XD4A 2DU9A 2UUBH 3Q8QB 3TW6A 2LY2A 3BCAA 2ID6A 4UUSB 3TINA 4XR6A 4J9NA 2XVCA 1N77A 5HODA 2XB0X 2JT1A 1P2FA 2N8GA 4HG2A 2YZGA 1MIJA 4A0YA 4KFCA 2IBKA 2JEIA 4MV3A 2V9PA 3FXQA 4AD9A 1T36A 3BTCA 1P4XA 3G71I 5E8IA 3KAJA 2FB9A 3LFKA 5K2MA 1S9FA 1O4XA 1Z91A 3CP8A 3DEWA 2KQRA 3KYCB 2IP2A 3VPCA 2A61A 4NXMH 4PFOA 1QVUA 5KG7A 4MTDA 3IWZA 4EFBA 2HWVA 3L2WA 3H92A 4ENJA 2KFDA 3GTPJ 1MNMC 4ED2A 3BR0A 1GXPA 3S8PA 3GTPA 2VQGA 4J9RA 2UVWA 4RLQA 3F72A 5ICCA 4A3CJ 2CUEA 4BXXG 3A0HC 2JQ7A 2W6OA 3PW4A 1D1AA 4IRKA 3BC8A 3VOEA 5HS8A 4CZCA 3Q8SB 2P7CB 2A3SA 1GVJA 2Z3YA 1LE8A 2EPFA 2JN6A 1YW7A 2M3AA 1HDPA 2CW0F 1XN7A 4PDBA 4XLNF 5IYDJ 1CQJB 1X1CA 2RC4A 1XDUA 1ZAOA 1JXLA 2WTEA 2A07F 1NTCA 2VE8A 4I0BA 4ZYEA 2WAQA 1BGWA 1X2NA 4YRVA 4M9XA 3F22A 4HV6A 4KUMA 4Q4ZF 3L2CA 1IXRC 5AIPA 3ZMUA 3L1PA 1HW5A 4EV0A 5LMNH 1E17A 3RJ0A 4JQFA 2FPIB 4E7ZA 5M5XJ 2FEZA 1IF1A 2LC2A 3PNTA 3ZN1A 1H89C 3TIGA 4DV5H 5FJ8G 3EDPA 3G6XA 4MV6A 2KDOA 2M9HA 4NLGA 1FPQA 3CCJI 3E3VA 1LEAA 4JP0A 3P9IA 4EVIA 5LGNA 3VMMA 2QYOA 1S97A 2L9VA 1T38A 3S3NA 1KQ0A 1OCTC 2MW8A 3KP6A 4GXOA 1S0NA 3RV4A 4UCTA 2RDIA 2XGPA 1MBGA 2VQLA 5CVJA 3C7JA 2ZJQF 3R0JA 1GHCA 3HUGB 3DLLF 4YIFA 3QU3A 1Z0XA 1RUOA 2KJBA 2YU3A 2PMZE 1LVKA 2UVVA 2DT6A 2R8IA 2R7LA 1XCVA 3LSJA 3UKGA 4A3KJ 4AIJA 3H36A 3VSLA 1FSHA 3PR4A 4ENMA 1JKRC 2HGCA 2OD5A 3H0DA 3DPUA 2VXZA 1KGSA 1WJEA 2DA3A 1VNDA 2R7RA 5LLQA 1Z7LA 3AG3H 4IL6C 4M3EA 4MQ9F 3NAUA 1XX5A 3BTJA 2YU9J 3N42B 3WU0A 2VUMG 2YW2A 3I4MG 2ZMEA 3H0GA 2HNHA 3RZDJ 4JI2H 1CF7A 1IXCA 1JUSA 1YQAA 2FE3A 4DR2H 2A05A 3QWLA 4M3GA 2MG4A 5F08A 2P5KA 1SD4A 4RLFA 2JPBA 3CCRI 3BQ1A 2EILH 2RQQA 5BR8H 1WJFA 3LSRA 5DUIA 4U0WA 3TOAA 3ZP5A 5L1KA 3GZNB 5LOVF 2VBXA 1ZH5A 1GLVA 2WB1E 2K3PA 2IGMA 3JRWA 4F4XA 1SFOA 3ONQA 2PN1A 2L7ZA 4DL6A 3LA7A 3BP8A 4A2UA 4EMSA 2FA5A 1OR7A 4QSHA 2YZMA 1DV1A 3FDSA 5D4SA 4FBTA 1EA3A 3IKVA 4ENKA 1ETOA 3FF5A 1QZEA 4JI3H 2FMYA 4L5IA 3WE2A 4CO8A 2VT2A 4PWQA 2K85A 1RK5A 3ZCOA 3DPLC 3AL0B 2IAIA 2RN7A 1IRFA 4ESFA 5IP6A 2YX7A 3J80K 4IZZA 4LOCA 1RJPA 4AYBE 4DUYH 4RA2A 4FTHA 2F5FA 1ZLJA 1WH7A 2CG4A 5CLSA 4O3PA 3FKJA 4KIFA 5F0FA 2LBFA 1R5HA 1RPWA 2UV1A 2VKHA 3U2RA 1ETYA 2DFHA 1XMAA 4O3NA 3T1YH 3HM5A 5HS7A 5M5YJ 2JA7J 1PVEA 2IVMA 3S15J 2E35A 2OCEA 2R7UA 4MV4A 5EGOB 2Q2TA 5LHIA 3BG9A 5B3SH 1BJTA 5FPOA 3GIPA 4O4IF 1PDNC 4X66H 3CF2A 3CO6C 4A3JJ 4DV7H 4DYRA 3RQ4A 3FIWA 3HOVJ 5C4XJ 3PNYA 2ZXIA 4F7ZA 3R5FA 2SCUB 3JRAA 5K5RA 1G4DA 4UCVA 4KIBA 3GIJA 3P9CA 3D5SC 1EF4A 3V8JA 2W7OA 2K4JA 4YQWA 3BDDA 1ZYRF 3GF2A 1RJRA 1MW7A 3MZYA 1GGOA 3SZTA 1Y14B 2CJJA 1R1UA 3LWFA 2CU7A 3TL4X 5D4RA 3DEEA 1K1QA 3U9TA 3DTIA 1J7KA 1IJWC 1WJBA 2VL8A 5BPFA 2O7OA 5HDGA 4LFCH 1H0MA 1ZARA 4D7MA 5LGTA 4O4HF 3OTOH 4BBSG 1S0OA 2HOAA 3KZYA 1TW2A 2IS1A 3KX2A 2FLNA 1TWGA 4XSXF 2LK2A 3PSIA 3LMLA 4E4TA 4MIMA 4DL5A 4OOIA 1Z9CA 2VR1A 1KJIA 2OU2A 4M72A 1X3ZB 3CC7I 5DYMA 3PJRA 2CSOA 3EYYA 2DWCA 3KAKA 5KT4A 2FQ3A 1GDTA 5AIQA 1AUVA 1N25A 2X6WA 1RYSA 4K0KH 3RIZA 4XLEA 3CUQB 4DZJA 4IRDA 1APLC 3EPGA 2W6ZA 1G3YA 3MWMA 4XLHA 3V6KA 1T3NA 2P0WA 2H8WA 2BVLA 4QWQA 3BJAA 5CVVA 5DD4A 1T0FA 4DYCA 2W70A 1W36D 5KFTA 1FKAH 1N75A 3MMYB 2ISZA 3GTGA 3CDLA 3FXOA 3FMQA 1X3WB 1B72A 4MLOA 4EYIB 5DDGA 3HGYA 1T39A 3J7AO 2UU9H 1R7JA 3HOUJ 5J4VA 3OWTA 3OYAA 1TWHJ 1I50J 2D1HA 4UUTA 5B5EC 2LTPA 1KEEA 2XCAA 4HAMA 4IJAA 4L9NA 5KFQA 4B09A 5J3LA 1RETA 3PW0A 2C22A 3KP2A 2JK3A 2WBMA 4V2FA 3BR5A 2K9NA 3TO6A 2Z5UA 1QPIA 3QQAA 3SFIA 4EJVA 4MV9A 4IHSA 2EFNA 4JUZA 2RNGA 4OIRF 1VQ4I 2H09A 1QPMA 1TLHB 1IDYA 1LDKB 4UCUA 3TQ1A 3F0CA 1ZHSA 2L7FP 5E17F 1VF9A 3OMYA 1SYXB 2DQRA 3LQQA 4LFBH 4I99C 1XMOH 1QBJA 3HDDA 1TQPA 1TWGJ 2XKPA 4EGQA 5EEGA 4FETA 1FYLA 2DA7A 3JZIA 4LLNA 1YS7A 2DT7B 1UNNC 2HQNA 4E6KG 3MZHA 3T5HA 2DFIA 3EUKL 2OQRA 3QODA 4RNNA 2R7QA 2JJ7A 4BXFA 4XM3A 2R82A 1YS6A 3F8CA 3ETJA 2K86A 4AIDA 2VBZA 2BVMA 2FPPB 1TNSA 4FISA 3DF7A 3E7LA 4Q48A 4C2MJ 4YFXF 2WDTA 1P7IA 3FK7A 3GQCA 4F93B 3F21A 2FBIA 1USTA 2HPIA 2XCLA 1HNZH 2R7ZG 1BN5A 2EFOA 4TQSA 2KP6A 3WE3A 2P6TA 5JLWA 4QWDA 1IV6A 3A02A 1KBLA 4CSWA 1S6LA 4G6TB 3DU5A 2WB1N 1ZGWA 2R7SA 4B3RH 4ZYGA 3CCQI 1SFUA 4BY7G 1SFKA 2F5DA 2R8JA 3MKYB 1JHFA 4OMZA 5KFLA 5IP9G 3V7SA 2NS7A 1A9XA 4I76A 2JA7A 4A3LJ 4N9HA 4PJJA 3PN1A 3Q8PB 1QZZA 2ZXWH 1U8BA 1CGPA 2B63J 3IH3A 2FKLA 2OA4A 4XYMB 3DEUA 3U21A 4JV1A 3H3UA 2W7PA 1K6YA 1T08B 2CQYA 2W9BB 1YX3A 3DFGA 3GTOA 4KYWA 2FK3A 2BXZA 4KHPH 2GAUA 2P6SA 4NQWB 3K1PA 3RZOJ 5KFVA 1G8XA 3FMRA 1O3QA 1FOKA 2CWEA 4ZDPA 1I7LA 1IBKH 1MBFA 4CYCB 1HNWH 2PJRA 4OAYA 2CQNA 1M1EB 3FKIJ 4QLCU 3GV5B 3MEXA 4DV0H 1YOVB 3MVPA 5DM6F 1FJLA 2KZVA 4B1RA 4IHXA 3BCBA 3BWGA 4BH9A 2VJJA 2HYGD 2E34A 2ID3A 2P0AA 5KAIC 4OIQF 2VPLA 3DKXA 2QSFX 4IQJA 1E0EA 1Z2OX 2L9RA 3H5NA 1KU7A 5KFWA 4ECXA 1I27A 4HOBA 5BS6A 4A3KG 3I55I 4DZPA 1MMGA 3HTSB 2X1CA 5E18F 3NWSA 4GDFA 1EZ1A 5J8CA 1TNTA 3FXLA 4UNOA 2OZUA 4LMYA 1FMWA 5J1UA 1SC7A 2M5WA 2RDJA 1Z7UA 3BR3A 1XGSA 3H0GJ 3I9V2 2BR0A 2FNAA 3PR5B 2RDPA 3ZQCA 3ASNH 3RAXA 3JRIA 1FTZA 3O3KA 3KPHA 4J0MA 4UB8C 3TIIA 4ZYAA 4DR1H 1Y1WJ 1GXQA 2JA8G 1SEIA 4MGRA 1I3QJ 1S8NA 2DJNA 2ZO4A 3CO7C 2LNBA 4ECTA 4RAZA 4J00A 2UUZA 5KFHA 2O3FA 3FXRA 1QA6A 5KAFC 1REPC 1OPCA 2LY9A 5IYZF 2K7LA 1SVMA 3A03A 4ME6A 5K7FA 5LYJF 3BJYA 4R8UB 4UY8I 2CS3A 2CGPA 1QVTA 3K7AJ 2FU4A 5DEQA 5HS9A 1T94A 1P7JA 1UHSA 2E5LH 1OKRA 1KU3A 2BW3A 5J6XA 5BOXA 2WC2A 3B6CA 3SDBA 5GAGJ 1NHAA 2GXBA 4FE4A 3MKWB 5M5WJ 1RYRA 2OLSA 3RFCA 5KFJA 1HSJA 4A0XA 1Z1DA 3JRDA 4OAZA 3VPBA 3DKYA 1GSHA 1HLVA 4JYKA 2HVRA 3A01B 2VPQA 1VQ7I 1ZG5A 1PUEE 2K9QA 1ZQ7A 1HKQA 1U3EM 3MR2A 1Z21A 2VQFH 3AG1H 2DLLA 1N56A 2KSWA 1S29A 2L0KA 4D9JA 2VBWA 2K9SA 2KPMA 2RNJA 4YELA 5D5VB 3BJ6A 3EPZA 1XC5A 3GBGA 2BY3A 3WU2C 3U9GA 2QGUA 1NK2P 4UFZA 4IO9F 5EWGA 3IRQA 2PX9A 3RI4A 2HZTA 5ERIA 3T0YA 2R7KA 2UUCH 3K4CA 1K4SA 2CUFA 4DQ2A 4YIIA 2XSJC 4DL4A 1I39A 5EEHA 2R6FA 2GIVA 3O8HA 2R7NA 4ECZA 5KCMA 4IZOA 5KFPA 2QKLB 3SFZA 3FMAA 2O6GE 1R36A 3IG0A 2LMDA 5IY5H 3KYDB 4BXUA 1D1CA 2G7UA 2OTJI 5IYCJ 4ECRA 2J5OA 3GMEA 4O5VA 5KG6A 2W9CA 4DV6H 1HXDA 2Z2SB 1IGNA 4XZ3B 2H6CA 4B4CA 4QIWA 3CCMI 3W6VA 4HNTA 5C4JJ 2W6PA 5T14A 3BG6A 2R7TA 5KT6A 3LA2A 5DCFA 4RAGA 1P4AA 3G1LA 2V58A 3M8FA 3MFHA 2EINH 2YS7A 1M0TA 2QKMB 3QAHA 5KK1A 4H0EA 1UFMA 4AWXB 4CUGA 1CF7B 1R5GA 3HOZJ 3RCOA 5L3CA 5LHGA 2X48A 3WU1B 4RS8A 2E71A 3BJOA 3GXOA 1VQPI 2XGCA 5IYBG 2BOLA 4M9SA 3HTUA 5IPAA 3VFZA 1E4EB 1OWTA 3IC7A 2JA5G 1ZELA 1EKEA 2Y0SE 4P5OA 5IOZA 4A2AA 1R1VA 1ZLKA 3WTSC 2DYRH 3SYTA 3ULQB 2YPRA 4LIVA 4IOAF 4YR0A 2HOEA 3QRFF 6PAXA 2CV0A 4BJ6C 3BZKA 3MQ0A 2WAFA 4BHCA 4AIKA 1S68A 4FS1A 3WO1A 5D1OA 2RGVA 4MA0A 4XLFA 2PMZA 1GSOA 1T33A 4YJ3F 2VBYA 2NAZA 3VB2A 1RKTA 3A1YA 1V5GA 3SHFA 3V8KA 1HKSA 1OYIA 5L3BA 4U7CA 5C44J 1RKWA 2X1EA 1GSAA 2E2IJ 3I54A 2ZDGA 1D1BA 3KHLA 3VSKA 4NB5A 3F8BA 1SANA 2W84A 5GPAA 1JKQC 1USSA 1U5TB 4EJTA 2F4IA 5LMUH 2BYVE 5D5UB 1B4AA 2RV8A 3Q0VA 3VEPA 2DFFA 1ZTRA 2KLOA 1RIOH 1JLLB 2ECBA 3N41B 3G1MA 4KISA 5IT9W 3PO3G 3H3VK 1WJAA 1SFEA 4JX4A 1IRXA 4B3MH 3HJEA 3CJTB 4XYLB 4Q8FA 3GTQJ 4RAFA 1YW8A 3PW5A 4I4TF 2D1VA 4FASD 4NDLA 2XROA 4KA4A 1FJGH 5FLMJ 4FQGA 3IAS2 5ILUA 3ZXSA 3JCUC 3RPUA 2HEOA 4YFNF 4O3RA 3WHBA 4EATA 4Q43A 1DQUA 3QPLA 3S3MA 1X4OA 5EZHA 3CLQA 2OBPA 2NVTJ 1UHWA 1OCPA 2ETHA 3KEYA 4AQYH 3WNZA 4XMYA 4O4LF 1A6QA 2P8TA 3KLOA 4E70A 3GFMA 4HEA2 4D7NA 2W6MA 2GOMA 1WJCA 3MKZA 3HOXG 2Q8KA 1O7FA 1XDSA 4A6EA 3R5HA 1WI3A 3G8CA 1ACIA 2R4GA 2ZXJA 1Y1VA 2NU6B 1R22A 2BE5F 2GA2A 5B1AH 1J0RA 2EWNA 3LSHA 3QZ8A 2JUCA 5M3MJ 2H6BA 2NNNA 3GIDA 4ZJZA 3DV8A 1GLNA 4IR9A 3I4NG 2JZYA 4NXNH 3MR3A 1FBQA 3K5IA 5C4XG 2A68F 1W1WE 3OS1A 1H88C 2PG4A 2X0LA 2DDAA 1U6GA 1VZ0A 1EH8A 2NOJB 3JAMW 2F4MB 4LFUA 5HV6A 4U6PA 3K4NA 4WXHA 2W00A 1WJ5A 2OQGA 2HKXA 4CCNA 4DUZH 4IHVA 2EZKA 4DV3H 4A69C 2ZDHA 2HXIA 1R5ID 4NNJA 5K7HA 2LG4A 3GIQA 1VKZA 5BMVF 1RK6A 2MBFA 2QUFA 4IHJF 5DD8A 2DPIA 1BW6A 3HOWJ 3GTOJ 2Y48A 1KQ9A 1IUYA 1FY7A 2F5EA 2VLAA 2GZWA 4K2EA 4WX9A 2AXLA 4X6AJ 1AN7A 1M0WA 2R7DA 3GTJA 2I87A 3IN5A 2YS9A 1SVOA 2TRTA 3HOTA 4S0HB 4M6YA 3OYGA 4HSTA 3I5UA 3OIOA 4N0BA 2JUGA 3ZN0A 1WQ2A 4UCSA 3OV8A 3UR3C 3IH2A 2L01A 2VUMA 1QGPA 3QOPA 1F36A 2VIXA 2D5VA 3GZ5A 2WWYA 2L3DA 2YR2A 3M07A 2O5RA 5KT7A 1W7PB 1XS9A 4RZQA 1LFBA 1AA7A 4CGZA 2JA6A 1WHUA 4C2MA 2DFEA 1WKMA 2DPJA 1GO3E 2M4KA 5EYRA 1DV2A 2R92A 5KFFA 2MLKA 2VQCA 5EF6A 3N05A 5IP7J 1J9IA 1U2WA 4BBRG 3S2HJ 5EJCA 3LA3A 3S1MJ 1ZGAA 1GV2A 3I0TA 3GTKJ 2EH3A 2R7FA 3BZ6A 4A3FG 3E6BA 1UZCA 5F04A 1YITI 5F1JA 2FOKA 3K2ZA 3HL2A 1DDNA 1BI0A 5FLXK 2DMQA 3CZ6A 4XQFA 2Z1DA 2ZDQA 1IN5A 4JI5H 2UVUA 2QQAA 3HSEA 1HCRA 1W36C 4HF2A 2HZDA 3WTXC 2QBYB 1FWZA 5IOYA 3CESA 3F8NA 4N9IA 3M9NB 3FX3A 1JDBB 2KJCA 5JUMA 4D5CA 1PUFB 1V3FA 2EBIA 5L3EA 1YHQI 5BMZA 5C5JA 2DAOA 1MMAA 1ZG3A 2KDZA 1XTAA 5LD2C 3SEZA 2X0SA 2W1OA 1JUPA 4Q8EA 5FKLA 1P6RA 5GP9A 2ZB9A 2R3SA 1CQIB 1RR8C 5FLMG 1SMYF 4RUCA 5HLTA 4AVPA 2LOOA 2P81A 3FKIG 2MH2A 1YIJI 2ZM6H 3HRUA 4JOMA 4JYAH 3S2DJ 2EV0A 3WTUC 1OYWA 4ECUA 3GTGJ 2E2HA 3GLXA 4G94A 4PDKA 1LDJA 4LG0A 2HQAA 1G3TA 1V55H 3VPDA 1B33N 2FP4B 2HGSA 2IBDA 4UV9A 1FOWA 4AIHA 1MSFC 1GVDA 1GUUA 4KT5C 1F1ZA 3M3YJ 3DWLE 4XL9A 2FK1A 3RB3A 3CCLI 4F52A 3OL4A 5F27A 3I3LA 1K83A 3E5NA 4G6QA 3DTKA 3JAMK 4IVNA 4BGDA 4QPOA 3R6SA 4A3DJ 4UCRA 2I5UA 1ZRFA 5IYDG 4MV7A 4EEYA 2DJIA 2LKXA 1YJNI 1D5VA 4FT8A 2LRDA 1OMIA 2FMAA 2PVPA 1UG2A 2KL4A 4IPAA 1WWXA 2JWTA 5FD6A 1TC3C 4J9QA 4GC6A 2NVXA 1Y39A 4WBNF 2BY2A 2R7ZJ 5FRNA 2KISA 1I5ZA 1WI9A 1K78A 4YY3H 2DYSH 1H9GA 1QHGA 3GTKA 2DDBA 1KYWA 2D2WA 4ZI7F 4JV0A 3K70D 1TQIA 3UQ8A 3ZQIA 3HKZA 1MH4A 1OQYA 2FPGB 1YYVA 3C2GA 1T2KA 2XB5A 1S7AA 2JA6J 5J2UF 4B43A 4LSAA 3MR5A 4BQOA 3EUHC 3PIOF 4IEJA 1T56A 3EUAA 2EB7A 3BQYA 4WWCA 2J6SA 3M8JA 2CFOA 1CE8A 1FYMA 5JR3A 3I64A 5JVTA 4HYKA 4QIWN 3SXYA 3RQIA 3WODF 2FD5A 4FX4A 2ZFWA 4RAYA 2RVCA 3R23A 2VXDA 2ELKA 1OR7C 1M6VA 3G1OA 1X4PA 2EK5A 2ISYA 3K69A 2K9MA 2M8GX 2GLOA 3M9AA 2XGDA 1R58A 3LAPA 4HQMA 3S3OA 3GTJJ 1SFXA 1BJZA 4FE7A 2R5ZA 2ZSIB 2HFHA 1YW9A 1R6RA 2HQ5A 5FO5A 1R23A 4ZDLA 3LSMA 3C0FB 1UELB 5TJJA 2XC7A 4Q0YA 1LNWA 2DBBA 3M1CA 3SI8A 4XBFA 4NHJA 1X2MA 3HOYG 1C30A 1KJQA 3MN2A 3BR6A 3WTVC 5DLFA 4HDUA 1W7PA 2JA5A 2XAUA 1ZHQA 2Z16A 5EDWA 2HTSA 1Y8QB 3B73A 2HOTA 4ABZA 2VT3A 3GTMJ 5AONA 1S72I 5CQEA 1W5CC 3AG4H 1BL0A 1XMKA 4G8XA 1DGWY 4UUVA 2XRLA 2WTFA 1J75A 3G6VA 1Z67A 3PIPF 1SD7A 1ORKA 2BW3B 1DPUA 3BAAA 1U5TA 1ZHFA 4BL0B 4P9FA 4II3A 3ZQLA 2YSRA 5KT3A 1ONVA 2RF4A 1VFCA 5JVDF 2X85A 3MZ8A 4WXDA 2A5YB 4NC8A 1UG0A 5HNFA 3RPQA 2DXIA 1VQOI 4LB5A 1B04A 1BR4A 4GFBA 4F4WA 3ECOA 1QQIA 2UWMA 4CCMA 2XAHA 4ED7A 2K02A 3HSRA 3HZJA 4DBRA 4B3AA 1S03G 3MCZA 4D5FA 2LF8A 5DCMA 1VQMI 5BNGA 1BXRA 5CKTA 5H2FC 5M3FJ 2PBIA 1EYZA 4Y15A 5L9XA 4UCOA 4PJ0C 2VJIA 2HQRA 2JSCA 2M0MA 3GYHX 2LP0A 4EQQA 4RM3A 1V9PA 1LUJB 3LSKA 3OS0A 1J59A 3GTQA 1YRNB 3J80Z 1TZLA 1ZR2A 1WZ2A 5H80A 4I01A 3CTAA 4PSWA 3J7AY 2V1NA 1SCUB 2DA5A 3CCUI 1R00A 4IX7A 2IJLA 3OIPA 3BABA 3HGGA 2V79A 4Z2YA 1I1SA 1E2XA 2YL2A 2VC1A 4LLLA 4A3GJ 5FFZA 3S16J 2HKOA 3OSNA 1I1GA 3OYFA 2H94A 3RTRA 4XRMA 4GKJH 4M6XA 4MHGA 2UXBH 3LSGA 2QBYA 2VA3A 4I50F 3C3WA 1BI2A 3T5XA 2VA2A 4M3DA 2W82A 4IRHA 4TV7A 2X51A 5LEKA 3BPXA 2EJRA 5IYCG 5DV5A 4BHPA 2COMA 2G0EA 1SMTA 1ENHA 5JI6A 5DS9A 3RYPA 3CC2I 1E4FT 3GV7B 1PYVA 1S9HA 2XAGA 3J7AK 3GTLA 3CCVI 3LL7A 2FXAA 3ZMZA 4LF5H 3I4PA 3B02A 5EG0A 4E7JA 5GAHJ 2JEFA 4HX8A 5E3OA 2C2RA 1ETXA 5LFAA 4DNCA 3GCMA 4BE2A 1O3TA 3HG9A 2C2DA 4BQQA 4Q45A 1KONA 2FX0A 3VPRA 4RDUA 3K1NA 4XOTA 3RKYA 2WAEA 2A6TA 3OHBA 3PW2A 2X6YA 3HOWG 4RGSA 1FNNA 2X1DA 1H9TA 2F2EA 5FJ8J 4OIPF 4WD3A 1Y6IA 2XAFA 1U0JA 3BTIA 4PJNA 4MNUA 1P9QC 1D8JA 1MBKA 2XSDC 4YAJB 4C3IJ 4JX5A 4EGJA 4BU2A 1ZK8A 1L0OC 2GOXB 5C3EG 1LVAA 4XK4A 4PJLA 2ZJ2A 2ZSHB 2HDWA 3TKYA 3WGHA 2HS5A 1J2XA 4HV5A 3W6JB 3CC4I 3RV3A 2NRAC 2V6CA 2V9WA 1XNRH 5KG2A 3QYBA 1S5LC 4N4OB 5FGMA 3QPHA 2M7BA 2VQHA 2STWA 1EHIA 2E60A 2FUG2 3N97A 4E7LA 5D5WB 4F92B 1PX2A 1GT0C 3TW7A 3J81K 3ORQA 2R92G 4IHTA 4II2A 3SDGA 5KG4A 2WB1A 4CZZA 4G6DA 1BOAA 4IRIA 2DOEA 3CP2A 4L18B 1Z6TA 2J5PA 5CPRB 3OYEA 1HC8A 1Y1VG 5FKMA 2CQ7A 1K79A 2O03A 5KFGA 4LF4H 1FVIA 2DN0A 2E5ZA 3P5JA 4LG3A 1JX4A 1CS0A 2FJ1A 3HBLA 1IN6A 4QWEA 1WH5A 3E97A 2PEXA 3DPTA 4ESJA 1A5JA 1STZA 3WG7H 1IN7A 2CMPA 2GQQA 2QVOA 4JI1H 4J01A 2JA8J 3VYUB 2KT0A 5L3FA 1G6NA 1S7EA 4BEHB 1JI8A 1ZN2A 4FHTA 5ICGA 1C0WA 1RJQA 4PGGA 4XLAA 2L02A 1FOXA 3HUGA 5EGOA 2ZNZA 5DG9A 3SJMA 3JSOA 2W57A 5K5OA 5IT9Z 3H0GG 1A04A 1RI7A 1XMQH 1UAAA 1UJ8A 2XPVA 1PK8A 3M9MB 2F4VH 2ESHA 4RGRA 5JHFA 1H8AC 1TA8A 2KZGA 5GPCA 1HDDC 5L3DA 1EH6A 3E5UA 2EV6A 2NS8A 1I6XA 5D8KB 5FLVA 3QP6A 5KFOA 4Y33A 1SAXA 2RREA 1Y56A 1B59A 2Y0MA 3Q9VA 3BG3A 2GM4A 2Y75A 1UHMA 2BHZA 3EUHA 4ESBA 3Q9SA 1FBSA 4IHWA 3SE7A 1DP3A 2MFZA 3RF2A 5DTDA 5D5XB 2XF5A 3BR2A 1IN8A 4ED8A 2EV5A 3UNGC 4DJAA 3G4SI 2R7WA 3LNQA 1FZPB 2NVYA 4FCYA 1D0YA 1R1TA 3CJRB 5TRDA 2K9LA 4IXAA 4R7RA 2L7KA 1I3QA 5H20A 4CCLA 1YJ9I 3DBLB 3S1QJ 1JDEA 1XMXA 1MZBA 2Q0OA 4X0GA 1AKHA 3M7GA 2E5NA 2CV2A 4A2BA 2FSWA 4G12A 2ME0A 2M8EA 1RC9A 3LSTA 1QZYA 3KZZA 4KJZA 4PCQA 4A3IJ 4IWXA 1IN4A 1T95A 3H1CA 4CCKA 4BDYA 1VQ5I 3PM1A 1HA8A 3HOYJ 3E0JB 3RKXA 3WHCA 2CFXA 4BEHA 2TDXA 2R5YB 3N8DA 1WR2A 3OUUA 2ELJA 3KXYT 3VYRB 2ASJA 2CRGA 4BY7J 3CMMA 1TWCA 2DMNA 3LAJA 4LK0F 2YX4A 5FRMA 1HKTA 4ECYA 3WO0A 1BR2A 2NNYA 1A35A 1NH3A 3PZPA 5LXTF 1K1SA 3MAJA 2H8RA 3HKZN 3ERED 2V4QA 3FBIB 2F5CA 2HXOA 4A3EJ 2AGQA 4RGUA 2PJPA 3ZQQA 4LF6H 2XGQA 1Z3XA 3L2PA 1VQNI 2PLYA 3PO2J 1DUXC 1F5TA 4EG0A 3CCYA 3O2PE 5CVIA 4BJTA 3FKIA 2FQ4A 4RU9A 3J80W 2M4GA 3N40P 2QEXI 5EDNA 2RGRA 4P9UA 3H9QA 4LD5A 5K1YA 2JRTA 4TUYF 3ZOBA 3LOCA 1P4WA 3NGDA 4D1QA 3GILA 4EYHB 2PMZN 5KFDA 2KIQA 4ECQA 3N6XA 3D0SA 3DBRB 2ACJA 1YX5A 2VOOA 2DA2A 4ZOLF 2V1XA 3RIRA 4V19K 5A2QW 4CICA 1QHHD 3A2KA 1WCMA 1I94H 3BQZA 1KJ9A 2EIMH 3IRRA 1JE8A 5KFEA 2AXTC 1BM9A 3L9FA 2O61A 1PP8F 1SD5A 1XCBA 5JHUA 2O8KA 3RB0A 2YCHA 1WRJA 5B66C 4ED0A 4EFEA 2BEOA 5D6EA 3FWEA 3CMYA 4PJMA 2COBA 2VODA 4IWYA 2VE9A 4L9TA 4A12A 4DR7H 4EGZA 1O7LA 2IGNA 2XPUA 3K0LA 2QZ8A 1Z6RA 5LP6F 3OSPA 2IPQX 2OWOA 2UXNA 3HC7A 2EA4A 2MYSA 5LL6b 2AQ4A 3HSFA 4P96A 1KU2A 4KMFA 2R8KA 1MD0A 4R79A 5EWFA 4DR5H 1LE8B 3ELKA 1N34H 2FJZA 1LFUP 1U8RA 4KMUX 1BI1A 2LDUA 1BIAA 1KYZA 3KP4A 3TBIA 4LF7H 2VJ4A 1D5YA 4G7ZF 1X1DA 5F6FA 2HJWA 3ABKH 3HB9A 2CZGA 2AQEA 2LKSA 1FEXA 2VPSA 1O3SA 5DGBA 2K40A 2VQEH 1J5YA 4B3XA 3JRGA 3RSNA 1W96A 2QM3A 1MNDA 2R7OA 3E6CC 3OIQA 5CA1F 3IUOA 4Y7NJ 4AYBN 3V8LA 2R5YA 4DW6A 2LREA 4BAYA 1VS0A 2L4AA 2YRWA 2C00A 1Q1HA 2HYFA 3V7CA 4HZFA 3K3VA 1YO5C 2FF4A 5KX5F 3RYRA 3KEOA 1BIBA 3H3ZA 5FFXA 5KHDA 4XORA 1O75A 2KRCA 2E1MC 5DQIA 4GYIA 1UB9A 3ML6A 2F5VA 2JA2A 5LHHA 1F9NA 4MTEA 3D5LA 1G59A 1YRNA 3HRMA 4BBSJ 2BQRA 3TP0A 1TWHA 3K4BA 1OCZH 1Z2PX 3P9KA 2QQ8A 3LFUA 5JFRA 5DM7F 1KC7A 4NUBA 3G6YA 1R4MB 3Q1KA 2GXGA 1JIHA 4DL2A 4RUAA 3AFHA 3CDIA 4E7KA 4O3SA 4HQ6A 3AL0C 2V5AA 5J2TF 5DCMB 3LSPA 3FM5A 4I09A 4AUXA 3C2BA 4A3DG 2P4WA 2H1LA 5FKNA 1HW2A 2DPDA 3SEQA 3TO7A 1WVRA 4JI7H 5HDKA 2NXNB 1I6UA 3RDIA 1KJ8A 4CCOA 3R0AA 1XPXA 3GLLA 3I59A 3WTTC 3GV8B 2AU0A 3N43B 3NARA 2DA4A 2P5LC 4U0VA 2NVQJ 2Y2ZA 2AHQA 4M74A 1KQ8A 4BQAA 2E19A 1DIKA 3F6OA 5KFXA 3U9SA 5KFNA 2CUJA 3TEDA 3P7NA 5DG8A 1DU0A 2EIJH 3VDXA 3BY6A 4HX4A 3OYJA 2UXCH 3GIKA 3COAC 2B9SA 2O9LA 4MFEA 3IH4A 5JVLA 2MSYA 1MJBA 2A6HF 2OJED 4RB0A 4JI6H 3GVAA 4O3MA 3DF8A 4BACA 4RB2C 5GONF 2BV6A 1R9TA 2HDDA 3ROUA 4PGHA 3FHZA 2FK2A 3BR1A 4C5CA 2XHKA 1ON1A 2PFBA 3S2WA 1ZREA 3HIFA 4G9YA 4PSXA 1ZRCA 4ZZDA 3CUOA 5CVUA 4EM2A 1UCRA 3CUQA 4HNVA 4Y8VB 2M05A 1MDMA 2HHHH 3ZQHA 3ERMA 3L2QA 2V1UA 2PMUA 2WV0A 1NK3P 1MKMA 1G2HA 3GTMA 3C18A 4DR6H 4LF8H 2CQQA 3H4DA 4IOCF 3K1MA 2EIKH 4Q44A 2W8KA 2M87A 2R93A 2RAEA 5JQWA 1Y8RB 3MKLA 3E6DA 4XICA 2ME6A 2KKOA 2ALZA 2W85A 1WJDA 4BNCA 1IV8A 4F4YA 3DKWA 4ZHQF 4DV2H 4CYCA 4OIOF 3TDUC 2W7NA 2DIKA 1FP1D 3IL2A 4G7OF 3MWEA 4CDGA 4B47A 5J1RA 1JT6A 2IS2A 3AYHB 3RTXA 1BI3A 1QRYA 1FMVA 3BLYA 4YB8B 3KHGA 4M7EA 2DMTA 2BGCA 4LFAH 1HF0A 1Q1VA 1SFOJ 1M7JA 4O2AF 1D0ZA 4F3QA 4M71A 3ZQ7A 2CYYA 1KJJA 1P8LA 4B3TH 2DPUA 1D0XA 5C1OA 5A2QK 4JX6A 2DI3A 4DR4H 1LKXA 4ZYHA 3ZMSA 5IT9K 3SZGA 3TO9A 1KU9A 3FISA 3S1NJ 2FBHA 2LBFB 3RJPA 4BHBA 3WGIA 3KETA 3BOQA 1JKOC 4I2OA 1IAWA 1VQLI 1RZ4A 1I6HJ 2VI6A 4JV2A 4E7SA 4RGXA 3TQTA 3T5JA 2GXAA 2CUZA 2IP4A 1AOYA 2QQ9A 1IC8A 2EFWA 2YU9A 2QENA 3KEQA 3TP3A 3L2UA 4BDZA 3OYLA 2ZBKA 2YZNA 3GX4X 1MJ9A 1OFCX 3GEZA 3KYLA 1TT0A 5TISC 1S3JA 3DP7A 2R5ZB 4LH6A 3CUQC 2EZIA 2GLTA 3HOUG 4YIRX 5DGAA 2JVHA 3BG5A 3GZ6A 2R7ZA 4J9LA 2VASA 1UMQA 4RZRA 5F1RA 3V6JA 1JTXA 5GTHC 1QU3A 2Z99A 1BC7C 3MWDA 3J7YJ 1XD7A 3K6GA 1IG7A 2HOSA 1W0UA 4YP3A 3HYIA 1WFXA 4X1EA 3ZPLA 1POGA 2OCCH 1K83J 4MEXF 1BBYA 4HF0A 4D0PA 1JJ8C 1JT0A 3W3CA 3K4LA 1U5TC 2ZKZA 4WXCA 1IBMH 2LYCA 4LK1F 3E1SA 2ZC2A 5E20A 1FT9A 1RRJA 3FDYA 3ABMH 2AO9A 3RB4A 3BTLA 1WPKA 5J8FA 2UXDH 1W5TA 2HDCA 1FOYA 2B7EA 1WSCA 3DTEA 2W8LA 4ED6A 4ECVA 1V4YA 2D45A 4C9YA 2E2HJ 3RB6A 4IR1A 1S10A 1FTTA 4UXNA 3ISPA 3F8MA 4BJ5C 9ANTA 1UC9A 2V9VA 2JMWA 1EH7A 2XCPA 3E6MA 3PO3J 1BOBA 4HDVA 4I02A 2QCOA 5A2QZ 5EOYA 3GIMA 3T5KA 4FBUA 3QOEA 2XC9A 2E7XA 2KIFA 3S32A 2W9BA 4RBOA 4HLYA 1MBEA 3I59B 2EFPA 2L9NA 3E5QA 2V6EA 1IOVA 4HPQA 4A3MG 4UB6C 2E1MB 3S93A 4ECWA 3DU6A 3U1DA 5HOOA 1A6IA 4TV8F 1N36H 1QNTA 1B8IA 3TMOA 2VONA 4ZC3A 2CKZB 2PMHA 2Y69H 1X9NA 4BE1A 4UVCA 2MGQA 2IW5A 4WF2A 1K6OA 2E36A 5GAEJ 4ETSA 4HR7A 1ETWA 3K10A 1IBLH 3HPHA 2NU8B 4A5NA 4Y3OA 5H6QA 4L9VA 5EEAA 3JSPA 1FYKA 2DMUA 3OOPA 3MJFA 1TL8A 2IA6A 2OTLI 2PBZA 2DOFA 2VKVA 4G7HF 1E3PA 5HLHA 5L1JA 2P5VA 2FBKA 1XGOA 1FIPA 5B1BH 4ZDOA 4QWAA 5BPIA 1N48A 2RQPA 1Z2NX 5KG0A 2J6UA 1OLTA 2DTRA 2XKOA 2VUMJ 2OH2A 3KFWX 4IF4A 5CA0F 3I53A 5IWAH 4N4NB 3GIIA 3I58A 4ON0A 3MD2A 4EBDA 3HKZE 3DQVC 5J40A 3RGXA 5LRRA 4PZJA 1K78B 2LVSA 4U0YA 2FLPA 2DK5A 3WG9A 3FK6A 2IA1A 2XF6A 2Y0SN 4CHUA 4Y52J 1YI2I 5LBQA 1SD6A 4XKCA 2ZJPF 2PI0A 3OYNA 4X62H 3S1RJ 4A3EG 1W5SA 3LWBA 2NU9B 4A6DA 1OYYA 4ZTFA 4I55F 3VODA 3D5RC 1IRGA 1NG6A 3L4JA 2M7AA 1MBJA 5EWEA 1FC3A 2HPMA 1IW7F 1Y1WG 4YG2F 5EZYF 4A3FJ 4YHHH 1TWFJ 2CQKA 3ABLH 3K2AA 2MCTA 2R7MA 4APMA 2FMLA 5C8YF 4LF9H 1TQMA 3OR1C 3PUBA 4WCGA 2IA2A 2BBYA 2OV7A 5TGTA 1IO2A 3ZMDA 3QPTA 1GYFA 2JTVA 1VAJA 1XB4A 2XGXA 2JSPA 4ZQIA 3ECHA 3L7WA 2UVRA 2LF7A 2M45A 1T0FC 3FBNB 2DLNA 2M30A 4UVAA 4DIQA 1YLFA 1C3OA 1AWCA 1ETVA 4F50A 4Q5SF 2EQRA 1HBXG 1S7OA 1VI0A 1YIOA 1Y1VJ 2QF7A 4ITVA 1TWCJ 4XIDA 4J9KA 5KFCA 2GPWA 5JVGF 2CQXA 4ED1A 1EJ9A 5CAEB 1D3YA 3V42A 3OYCA 4YR3A 1LPQA 5KG1A 1EUCB 3J7ZI 2R0QC 4U7DA 4QJFA 1TWAJ 4HYEA 3TOBA 5KFYA 3FZVA 2LKPA 3OY9A 4M3BA 3OSFA 4XSZF 1TWAA 3K4MA 2EFQA 3KLNA 4QTRA 5FD5A 4M9UA 5I47A 5C3EJ 5JH7F 1V5FA 1JHHA 2PQ8A 2C2EA 2QWWA 4LSXA 4EJWA 1A0IA 2F48A 3JREA 3UFXB 1U78A 4GKKH 1RUNA 3VWBA 2NVYJ 3BA8A 3TGNA 3D1NI 5KFZA 3KP7A 3S17J 1JKJB 2W71A 3HOSA 5KVRA 5CQGA 3OHAA 2CW8A 2QLZA 2O0YA 5HBRB 3K9TA 3RAQA 1VTNC 1V5EA 3M9OB 2XAQA 4LITA 1UC8A 2K27A 1MMSA 2WY8Q 1XSXA 3G2BA 4BE0A 2VQDA 4DV4H 1AU7A 4DGWB 4NBQA 1ERDA 5FROA 2WE6A 1ZETA 4UHTA 4HSRA 2AGPA 2ZFUA 3JAMZ 1PP7U 1FSEA 1YTYA 3JTHA 1DGSA 1W4MA 3A0BC 4KICA 2X6OA 3L09A 4DV1H 2STTA 3JSNA 2MC3A 2QK4A 1HQCA 2O8XA 3K4JA 3HHGA 3ZQFA 2VB6A 1BJAA 1TW3A 2E1OA 4HQEA 1B6AA 4IRCA 4E7IA 2LD5A 3BT9A 4P1WA 5L1LA 3HPGA 2HVQA 5E8GA 1JXSA 5KFAA 2DT5A 1FIAA 2G9WA 4MEYF 4MFDA 3M4OJ 5KFKA 4GO1A 3W2AA 4H4KC 4X64H 3PL8A 5IP7G 3DXJF 1VQ9I 2QSGX 2R7XA 2E7WA 3IV5A 2R8GA 3KALA 1DPRA 4QW9A 3CD6I 3F6VA 4XRSA 4EEFG 2WAQE 4YBZB 3Q2OA 4ECSA 4GCVA 5D1PA 1W0TA 2KRHA 2LY1A 5ICFA 1ULZA 3EETA 2BY1A 4EJOA 4XKVA 2L4MA 1OJLA 3QPSA 2E2JJ 2UXXA 3A01A 2XDVA 4F91B 5DQHA 2L2OA 4XKWA 1QO0D 2K3FA 3GFJA 3V4ZA 3IKTA 5KFBA 3PQJA 4DOZA 4DL7A 1N32H 1BA5A 2Q2UA 2HTJA 3VYSB 4HA8A 1N33H 3PVXA 3WTYC 2Y30A 4W1UA 5L3GA 4KDPA 2Z33A 1WGXA 3JSLA 4O3QA 2JEJA 3K70C 2K4BA 5E1WA 3GFLA 5CVRA 5J47A 3N4MA 4HF1A 2GPSA 5E3LA 5KFIA 5CB4F 2F4OB 1O3RA 3Q8RB 4GC7A 5E1XA 1J5EH 3IAM2 3VYTB 2IGOA 4DYQA 3OYIA 4R8UA 2M1BA 2YYAA 2KIUA 2DMPA 3R60A 3CQZA 4FM9A 2EZHA 5IT3A 1HR0H 2DO7A 2Y9YA 4W97A 2L9SA 1U9NA 4L0ZB 1R4NB 2L7MP 4BXXJ 3OSGA 4CH7A 5GTIC 4DL3A 2R87A 2JRMA 3JRHA 1Z77A 4Y13A 1AKHB 1OCOH 2M0CA 4EGYA 1LB2A 2DQLA 2WV1A 1HOMA 4A3LG 3REOA 3NRVA 1J09A 1V54H 5DUKA 2V7FA 4RMNA 1K4TA 1Y0UA 1WSUA 4XLPF 2JPCA 3H5RA 4A0ZA 3GTLJ 3I4NJ 4J19A 5LEJA 2VOBA 4M73A 3TDZC 3OYMA 5KG5A 2EZLA 1ITYA 5LGUA 1PUFA 4KN7X 5HVQC 3DCFA 2DODA 2Q2EB 5ICEA 2OPTA 1VQ8I 3CJQB 4S05A 1MDMB 2A6EF 1VQKI 3GFIA 4HRIA 3R5XA 4O6JA 4CC5A 4OINF 2DCEA 3FXJA 4L1KA 1IDZA 4RM2A 2BQUA 1EUDB 2OUMA 3O6BB 1EV7A 4GGGA 4JK1X 1MSEC 3MR6A 3BPVA 1MJAA 1MGTA 2HYJA 1G3SA 3L00A 2IT0A 4LH7A 4MV1A 5D1OB 3F3XA 5D8DA 3A4CA 2W25A 2PJRB 4CC6A 2ZMEB 1SEUA 4XX0B 2AQFA 2FNPA 1TT5B 1RNLA 2OAZA 4GYGA 3CDHA 3KTMA 2E1NA 2IRFG 4ZH4F 2C6YA 3E5XA 3WTWC 3JR9A 3KHRA 1W7PD 2KMUA 2XIGA 2JVGA 2ZCWA 4EBCA 4A3IG 2X6XA 2DW4A 1Y1WA 1B72B 2DZDA 4RB3C 1DU6A 4CXFA 1HSTA 4J9OA 3FXUA 3RUPA 4YJ2F 2HVSA 2OZ6A 2W4SA 2MD5A 5HNHA 1N78A 1JJ6C 4IKFA 3CVZA 4QWCA 1T98A 5KNLA 4O3OA 4R1HA 3CF5F 3ETHA 3J81W 1BR1A 2KRFA 2V1DA 2ESNA 4XN3A 2QQBA 3PQKA 1VBGA 2WYOA 2YRXA 3N44B 4TV9F 1S0MA 4C5BA 2ZJTA 3BG7A 2L54A 4B48A 2WAQN 2A69F 4MAMA 1BNCA 3KCCA 1R71A 3QP5A 4P55A 4AVZA 5F9NA 3FHNA 1O57A 1BC8C 3PFYA 3V6HA 1VBHA 3HRSA 3G73A 4RNMA 4YR2A 2IEKA 2IGKA 3ASOH 1KZHA 4A3MJ 4QIWE 2W9CB 4ED3A 2JA5J 4ASNA 1LFPA 1SAUA 3ORRA 4G3IA 2MD0A 1YFHA 4IQ4A 1ZRDA 2IXSA 4B3SH 1FX7A 1B6RA 4WK8F 2XUBA 3BZCA 2NU7B
chains in the Genus database with same CATH topology
3ABUA 2XV4S 3F8FA 3T8RA 1B1BA 3CLOA 2LSOA 1XDNA 1XSVA 2CW7A 4LJZF 4OX9H 3R4KA 4HBLA 2E1CA 1XNQH 4LB6B 4JI4H 4FX0A 2VOPA 1XSDA 3BROA 1FP2A 4GLXA 2MLGA 4JV5H 5H6RA 3ZMTA 1L3LA 3EYIA 2RKHA 3CJNA 1TAEA 1LJ9A 4BWSC 4L9JA 2ZNYA 4L5JA 4HLXA 4BYYA 2G7HA 4DR3H 3ABTA 2PN6A 4S04A 5LRSA 2NYXA 1LDDA 4HW0A 4Q47A 4KIGA 1IXSB 4CYDA 3GO5A 4KN4X 4I98B 5HLGA 1YG2A 3H20A 4EM1A 2FRHA 1HNXH 3NEUA 3C1DA 4ZZLA 3T1BA 3GW2A 3WTZA 3T8TA 3KP3A 1DP7P 3I71A 3JTGA 4MQVA 2VC0A 2KIMA 4I7HA 1LEBA 2VN2A 5FPRA 2UZKA 2P7VB 5F64A 4JBAA 1P92A 1B9NA 2NS0A 4IAJA 4ZYDA 2XAJA 1D8KA 3HHHA 4U88A 5CYVA 5ED4A 4L0YB 3T1HH 2EA2A 3M8EA 4OMYA 1ZGJA 1Z05A 5E1ZB 1XGNA 1V4RA 3PFIA 3BA9A 3HXLA 2VUGA 3RGZA 2CO5A 3TQNA 3SZPA 3KP5A 1IZ1A 4ENNA 3M4IA 3GWZA 4X65H 4R8HA 2H27A 1KA8A 5FB2A 4I0AA 2UUAH 1ULYA 1E4GT 3J81Z 3M1EA 2XRNA 1ODDA 3F23A 1JGSA 1WH2A 4B8XA 4UV8A 1HW1A 3V7RA 2X4HA 1L2ZA 3NQOA 4LLGF 5ILSA 2IA0A 3LQRA 1TBXA 4LG0B 4RB1A 4U7BA 2ADUA 2W24A 3AAFA 3ZMVA 3IWFA 4Y17A 4M9ZA 1LQ1A 4XRFA 4EEQA 2GWRA 2ELHA 2DK8A 3MFKA 4HX7A 2Q2EA 1ZG1A 5K5QA 4IRGA 4KNYA 5D6FA 4JI0H 1G3WA 2Z9OA 3G3ZA 5HDNA 1XGMA 4UVBA 3V4GA 2MH9A 2B0LA 3GUDA 3WGGA 3RKWA 2XASA 1TTYA 4YFKF 3HRTA 1FBUA 2GA1A 3FMSA 4JI8H 4NQWA 4EJUA 5BPDA 4EM0B 5FLXW 5HLIA 3EQLF 3JW4A 3KE2A 3FM3A 5ILVA 3R61A 4LGWA 1ON2A 5D8LB 3SQNA 2HR3A 5FLXZ 3L4KA 3IHUA 1X3UA 4OU0A 3Q5FA 3W6KB 4A5MA 5CJ9A 1T6SA 2MA3A 1F4KA 1FLIA 2AS5F 1B9MA 3QU6A 1K7AA 5BQTA 2DU9A 2UUBH 2XVCA 2JT1A 1P2FA 4A0YA 4KFCA 3FXQA 4AD9A 1P4XA 5E8IA 3KAJA 3LFKA 1Z91A 2IP2A 2A61A 4NXMH 4MTDA 3IWZA 4EFBA 2HWVA 4ENJA 3H92A 1GXPA 5ICCA 3F72A 3VOEA 5HS8A 2P7CB 2A3SA 1GVJA 2Z3YA 1YW7A 2CW0F 1XN7A 4PDBA 4XLNF 2RC4A 1XDUA 1ZAOA 2WTEA 2A07F 2VE8A 4I0BA 4ZYEA 1BGWA 3F22A 4M9XA 4HV6A 4Q4ZF 3L2CA 1IXRC 5AIPA 3ZMUA 1HW5A 4EV0A 5LMNH 1E17A 3RJ0A 4JQFA 2FEZA 1IF1A 3ZN1A 4DV5H 3EDPA 1FPQA 3E3VA 1LEAA 3P9IA 4EVIA 5LGNA 2QYOA 1T38A 1KQ0A 3KP6A 4GXOA 4UCTA 5CVJA 3C7JA 3R0JA 1GHCA 4YIFA 3QU3A 1RUOA 2KJBA 2YU3A 1XCVA 4AIJA 1FSHA 4ENMA 2HGCA 2OD5A 2VXZA 1KGSA 5LLQA 4MQ9F 3N42B 3WU0A 2ZMEA 4JI2H 1CF7A 1IXCA 1YQAA 4DR2H 2FE3A 2P5KA 1SD4A 2JPBA 5BR8H 5DUIA 4U0WA 3TOAA 3ZP5A 2VBXA 1ZH5A 3LA7A 3BP8A 4A2UA 4EMSA 2FA5A 1OR7A 5D4SA 3IKVA 4ENKA 3FF5A 4JI3H 2FMYA 4L5IA 3WE2A 4CO8A 2VT2A 3DPLC 2RN7A 1IRFA 4ESFA 3J80K 2YX7A 4DUYH 2F5FA 1ZLJA 2CG4A 5CLSA 4KIFA 3U2RA 1R5HA 3T1YH 1XMAA 5HS7A 2IVMA 2Q2TA 5LHIA 1BJTA 5FPOA 1PDNC 4X66H 3CO6C 4DV7H 4F7ZA 5K5RA 1G4DA 4UCVA 4KIBA 3P9CA 3V8JA 2K4JA 3BDDA 1ZYRF 3GF2A 3MZYA 3SZTA 1R1UA 3LWFA 5D4RA 1J7KA 5HDGA 4LFCH 1H0MA 1ZARA 5LGTA 3OTOH 3KZYA 1TW2A 4XSXF 3LMLA 4OOIA 1Z9CA 2OU2A 4M72A 5DYMA 2CSOA 3EYYA 3KAKA 2FQ3A 5AIQA 4K0KH 3RIZA 3CUQB 1G3YA 3MWMA 4QWQA 5CVVA 5DD4A 3BJAA 1T0FA 1FKAH 2ISZA 3FMQA 5DDGA 1T39A 2UU9H 3J7AO 1R7JA 2D1HA 4HAMA 4IJAA 4L9NA 4B09A 3KP2A 3TO6A 2Z5UA 4EJVA 4MV9A 4IHSA 2EFNA 4OIRF 2H09A 1QPMA 1TLHB 1LDKB 4UCUA 1ZHSA 5E17F 1SYXB 2DQRA 3LQQA 4LFBH 1XMOH 1QBJA 1TQPA 2XKPA 5EEGA 1FYLA 4LLNA 1YS7A 2HQNA 3MZHA 2DFIA 2OQRA 1YS6A 3F8CA 2K86A 2VBZA 1TNSA 3DF7A 4Q48A 4YFXF 2WDTA 3F21A 2FBIA 1USTA 1HNZH 1BN5A 2EFOA 3WE3A 2P6TA 1S6LA 4B3RH 4ZYGA 1SFUA 2F5DA 1JHFA 4OMZA 3V7SA 4N9HA 3PN1A 1QZZA 1CGPA 2OA4A 3DEUA 3H3UA 3DFGA 4KYWA 4KHPH 2GAUA 2P6SA 3K1PA 1O3QA 3FMRA 1FOKA 2CWEA 1IBKH 1HNWH 4QLCU 3MEXA 4DV0H 3BWGA 4BH9A 2HYGD 4OIQF 1Z2OX 1KU7A 1I27A 4HOBA 5BS6A 3HTSB 5E18F 5J8CA 1TNTA 4UNOA 2OZUA 4LMYA 2M5WA 1Z7UA 1XGSA 2FNAA 2RDPA 3O3KA 4J0MA 4DR1H 1GXQA 1SEIA 4MGRA 1S8NA 2ZO4A 3CO7C 2LNBA 4RAZA 2O3FA 3FXRA 1REPC 1OPCA 2K7LA 2CGPA 2FU4A 5DEQA 5HS9A 2E5LH 1OKRA 1KU3A 5J6XA 5BOXA 2WC2A 2GXBA 1NHAA 1HSJA 4A0XA 1Z1DA 2HVRA 1ZG5A 1PUEE 1HKQA 1U3EM 2VQFH 2DLLA 2KSWA 1S29A 2VBWA 2RNJA 5D5VB 3BJ6A 3U9GA 4UFZA 3IRQA 3RI4A 2HZTA 5ERIA 3T0YA 2UUCH 4DQ2A 4YIIA 5EEHA 2GIVA 3SFZA 3FMAA 2O6GE 1R36A 3IG0A 4BXUA 2G7UA 2J5OA 4O5VA 4DV6H 1HXDA 2H6CA 3LA2A 5DCFA 1P4AA 3M8FA 1M0TA 1CF7B 3QAHA 5KK1A 4H0EA 1UFMA 4AWXB 1R5GA 5L3CA 5LHGA 3WU1B 4RS8A 3BJOA 3GXOA 4M9SA 3HTUA 3VFZA 3IC7A 4P5OA 4A2AA 1R1VA 1ZLKA 3WTSC 3ULQB 2YPRA 2HOEA 3QRFF 6PAXA 4BHCA 3MQ0A 4AIKA 1S68A 5D1OA 2RGVA 2VBYA 2NAZA 3VB2A 3SHFA 3V8KA 1HKSA 1OYIA 5L3BA 3I54A 4NB5A 3F8BA 2W84A 1USSA 1U5TB 4EJTA 5LMUH 2BYVE 5D5UB 1B4AA 2RV8A 3VEPA 1RIOH 3N41B 5IT9W 1SFEA 4B3MH 1YW8A 2D1VA 2XROA 4KA4A 1FJGH 5ILUA 3RPUA 2HEOA 4YFNF 2OBPA 2ETHA 1UHWA 2P8TA 3KLOA 4E70A 3GFMA 2Q8KA 1XDSA 1O7FA 4A6EA 2ZXJA 1R22A 2BE5F 2GA2A 1J0RA 2EWNA 2H6BA 2NNNA 3DV8A 2JZYA 4NXNH 1FBQA 2A68F 2PG4A 2X0LA 1U6GA 1EH8A 3JAMW 4LFUA 4WXHA 4DUZH 2OQGA 2HKXA 4DV3H 2MBFA 2QUFA 5DD8A 2Y48A 1KQ9A 1IUYA 1FY7A 2F5EA 2GZWA 4K2EA 4WX9A 2AXLA 1AN7A 1M0WA 2R7DA 3HOTA 4M6YA 3I5UA 3ZN0A 4N0BA 1WQ2A 4UCSA 3OV8A 2L01A 1QGPA 3QOPA 3GZ5A 2WWYA 2L3DA 2YR2A 1W7PB 4RZQA 4CGZA 1WKMA 2MLKA 1J9IA 1U2WA 3LA3A 1ZGAA 3I0TA 2R7FA 3BZ6A 3E6BA 1DDNA 3K2ZA 2FOKA 1BI0A 5FLXK 1IN5A 4JI5H 2QQAA 3HSEA 4HF2A 3WTXC 2QBYB 1FWZA 3F8NA 4N9IA 3FX3A 2KJCA 1V3FA 5L3EA 5BMZA 2DAOA 1ZG3A 1P6RA 2R3SA 1SMYF 4AVPA 2MH2A 2ZM6H 3HRUA 4JYAH 2EV0A 3WTUC 1OYWA 3GLXA 4G94A 4PDKA 1LDJA 4LG0A 1G3TA 2HGSA 4UV9A 4AIHA 4KT5C 1F1ZA 4G6QA 3JAMK 4IVNA 3R6SA 4UCRA 1ZRFA 4MV7A 1D5VA 4FT8A 1OMIA 4IPAA 1WWXA 5FD6A 1I5ZA 1WI9A 1K78A 4YY3H 1H9GA 1KYWA 2D2WA 1TQIA 3UQ8A 1YYVA 1T2KA 1S7AA 4LSAA 2EB7A 4WWCA 1FYMA 5JR3A 3I64A 5JVTA 3SXYA 3WODF 4FX4A 2ZFWA 4RAYA 2RVCA 2ISYA 2EK5A 3K69A 3M9AA 3LAPA 1R58A 4HQMA 1SFXA 2HFHA 1YW9A 5FO5A 1R23A 3C0FB 5TJJA 4Q0YA 1LNWA 2DBBA 4XBFA 4NHJA 3WTVC 4HDUA 1W7PA 1ZHQA 2HTSA 3B73A 2VT3A 5AONA 1XMKA 4G8XA 4UUVA 1J75A 1SD7A 1DPUA 3BAAA 1U5TA 1ZHFA 4P9FA 2YSRA 1ONVA 4WXDA 2A5YB 3RPQA 1B04A 4LB5A 3ECOA 1QQIA 2UWMA 2XAHA 2K02A 3HSRA 1S03G 3MCZA 2LF8A 5DCMA 2PBIA 4Y15A 4UCOA 2HQRA 2JSCA 3GYHX 4EQQA 1V9PA 1J59A 3J80Z 4I01A 3CTAA 1R00A 2IJLA 3BABA 2V79A 4Z2YA 1I1SA 1E2XA 2VC1A 4LLLA 5FFZA 2HKOA 1I1GA 2H94A 3RTRA 4GKJH 4M6XA 4MHGA 2UXBH 2QBYA 3C3WA 1BI2A 3T5XA 4IRHA 4TV7A 5LEKA 3BPXA 2EJRA 5DV5A 4BHPA 2COMA 1SMTA 5JI6A 3RYPA 1E4FT 3J7AK 2XAGA 2FXAA 3ZMZA 4LF5H 3I4PA 3B02A 4HX8A 1O3TA 4DNCA 3K1NA 3RKYA 4RGSA 1FNNA 1H9TA 2F2EA 4OIPF 2XAFA 4MNUA 1D8JA 1L0OC 1LVAA 2ZJ2A 3TKYA 3WGHA 2HS5A 1J2XA 4HV5A 3W6JB