4RAYA

Crystal structure of magnetospirillum gryphiswaldense msr-1 apo-fur
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
136
structure length
135
Chain Sequence
GHMVSRIEQRCIDKGMKMTDQRRVIAQVLSDSAHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
total genus 44
structure length 135
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4rayA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4rayA02
5LGNA 1ON1A 3ZN1A 3DPTA 3I59A 3KETA 4A12A 3IRRA 4PCQA 2KIFA 3KLOA 2IJLA 2RNJA 2ZNZA 2HTJA 4KYWA 4HLYA 2FE3A 1KYWA 4KIBA 2CQKA 4DNCA 3J7AO 1F4KA 4RAYA 3TDZC 1XCVA 1G6NA 1MZBA 2X4HA 2DK8A 2HOEA 3C18A 1R00A 2PJPA 5DCMA 2ETHA 1I1GA 1YW8A 1E17A 1F1ZA 2JSCA 2Y0MA 3TOBA 2IVMA 3ZMVA 2HYGD 4A5MA 4MQ9F 3WTXC 2JRTA 5AONA 5BOXA 3P9KA 5J6XA 2NNNA 2IA0A 3ZPLA 1C0WA 4XSXF 4QLCU 4PGGA 2ZO4A 3KZYA 2MBFA 4N9HA 3GFMA 3F3XA 2MLKA 1DDNA 5FD6A 4NQWA 4I02A 1IN4A 5CVJA 1SFXA 3BPXA 4UV8A 2M30A 4AIHA 4LK0F 3S2WA 4FX4A 3V8KA 1O7LA 2NAZA 3F72A 4G94A 4A2UA 2P5KA 3LWFA 1ZYRF 2JPBA 4L9TA 3KZZA 1BC8C 3SZPA 3WTWC 2EA2A 2EJRA 5KK1A 4BHBA 4HLXA 3E6MA 4I7HA 3K9TA 1YLFA 4JQFA 1UB9A 3M7GA 2EFQA 2HZTA 3RDIA 4UUVA 2V9VA 1U6GA 3L9FA 2OAZA 3I0TA 2YPRA 1MD0A 3J81Z 1O57A 3CLOA 1WKMA 2HTSA 4GYGA 2VODA 5D8KB 1D3YA 4PDKA 2FA5A 1SD4A 4FX0A 3EETA 2LDUA 5TJJA 2RKHA 4FHTA 4HF1A 1YO5C 3BP8A 3AAFA 2XKPA 3O6BB 1FLIA 4EM2A 2CG4A 3F8BA 3P9CA 4A6EA 2LSOA 1LQ1A 3SFZA 4UV9A 4LGWA 1ODDA 1K6OA 3V7RA 1K79A 2PG4A 3IWFA 2ISZA 4MEXF 5A2QK 1TLHB 3N4MA 4R1HA 4NB5A 2Z3YA 4OU0A 4XLPF 2UXNA 2ZCWA 1J75A 2FOKA 5L3CA 3C7JA 3E97A 1FC3A 3P7NA 1JGSA 4ON0A 4ESFA 1OKRA 3BJOA 4R79A 3KLNA 3KP6A 3GWZA 3U2RA 1FBQA 4EJVA 1OYWA 4G8XA 2ZNYA 2X0LA 1VTNC 1HKSA 4NHJA 5F64A 1ONVA 1LDKB 1R1VA 3QRFF 1KQ9A 4KIGA 4IHSA 3HHGA 1D8JA 1K7AA 3BWGA 3EQLF 1D8KA 2QQ9A 2VE8A 1ZH5A 5FO5A 3DF8A 4L9NA 5FFXA 2DFIA 3V7CA 4ZZLA 2V1XA 2PMUA 2B0LA 3WU0A 3FMRA 2UWMA 1XGMA 2VT3A 3M1EA 1T0FA 3I71A 6PAXA 2L01A 3ABUA 3ERED 3SHFA 3KFWX 1U78A 3PQKA 1V3FA 2ZXJA 1YS6A 2L4MA 2L54A 2XHKA 2PMHA 3RKXA 2ZMEA 4EQQA 3J80Z 4ESBA 2QQAA 1L3LA 2VT2A 4N0BA 2D2WA 3E5QA 3E5UA 4CYDA 2W25A 3KP4A 4EJWA 5ICEA 1Z05A 3ZMUA 2WC2A 5EEHA 1CGPA 1FYKA 1X3UA 4G7HF 2OBPA 2XAHA 4F7ZA 4I0BA 2K4BA 1SMTA 1U3EM 1FPQA 2QVOA 3I54A 1IF1A 4I09A 3U1DA 3IL2A 3T8TA 3LQQA 2Z9OA 4LLNA 3ABTA 5CJ9A 1UHMA 1KYZA 4EMSA 1GVJA 3I64A 4YG2F 1XGSA 4EM1A 3H3UA 5TRDA 4Q5SF 2DAOA 3TKYA 1RI7A 2XUBA 4Q4ZF 2QWWA 1U2WA 1S7AA 4RB2C 1YS7A 5ERIA 3L00A 1YW7A 5E8GA 3K1MA 2FNPA 1ZRCA 3GZ5A 1P6RA 2H6CA 2ESHA 4ENKA 4GCVA 4MTEA 3LSTA 1KU3A 3R6SA 1T6SA 5DDGA 1GHCA 1HW2A 2R3SA 2ZJ2A 2A6HF 4BHCA 5L3FA 2K02A 1XMKA 1REPC 1O3QA 2YR2A 1TW3A 3F23A 2QYOA 3VB2A 2A6EF 2IT0A 5CVRA 4KN4X 2UZKA 3RI4A 1O7FA 4EGYA 3HYIA 3LFKA 4U88A 4L0ZB 2YSRA 3F8MA 3SQNA 3E6CC 3QP6A 4RGSA 2VBWA 2CW0F 1LNWA 2A3SA 1YG2A 3RKWA 2DPDA 4MHGA 3LA7A 5D5UB 4I0AA 1R23A 3E6BA 2A07F 5LRSA 1MKMA 5BMZA 2M45A 2XAJA 1Z6RA 4TV7A 1L0OC 1P4WA 3I4PA 4XBFA 3DEUA 5K1YA 2DK5A 3E6DA 2P8TA 3TO6A 4UHTA 4RB0A 4XLNF 3TOAA 1MGTA 1UHWA 2FEZA 3CUQB 4ZYGA 3SZTA 1SFUA 1GXQA 3RTRA 2XVCA 3T0YA 3TGNA 3M8EA 2HDCA 4ZZDA 5FLXZ 3BJAA 5D6FA 2DPUA 2RN7A 2VOPA 4HV5A 3IKTA 4OIPF 5HS8A 4EJTA 1BC7C 4G6DA 1F5TA 1SAXA 5DYMA 1LEBA 4OMZA 3HRSA 3KCCA 1K78B 2KKOA 1BIAA 3JTHA 2DT5A 2Z5UA 1S29A 5E18F 3ELKA 1UFMA 3CUQC 4KFCA 1LEAA 3KP3A 1IRFA 4MNUA 3FHZA 1B59A 2VC1A 3DXJF 2WWYA 4KIFA 1BBYA 4Q48A 2KJCA 2ZBKA 3R4KA 1HKTA 2W24A 3QOPA 4HW0A 3HRUA 2V1DA 2AS5F 4EJUA 1W5SA 3LAJA 5K5OA 2HGCA 3V4GA 4RB3C 1LJ9A 5E1ZB 3GW2A 2BV6A 3HRMA 1RZ4A 2XASA 2DI3A 2VN2A 3KP2A 5BPDA 2IPQX 5A2QZ 1FSEA 1ZGAA 3WGGA 3T1BA 1R5GA 5ILVA 2YU3A 5D5WB 4EV0A 2M5WA 5H6QA 2LNBA 3ZN0A 3GYHX 1FWZA 3BROA 1U5TA 1BN5A 1HW5A 4LB6B 4U7BA 3I59B 1XDUA 2GAUA 2EV6A 1QNTA 3NRVA 3ZMDA 2CGPA 2P5LC 4KICA 3LA3A 2P7CB 1GXPA 3K69A 2P6TA 2R7FA 1DPRA 3H92A 1Y0UA 4LLGF 1S7OA 1FYMA 2GIVA 3FXQA 3K1NA 5L3DA 4OMYA 2FBKA 1YQAA 3MFKA 1ULYA 1U5TB 3JAMZ 2Y48A 4RB1A 1IXCA 4O5VA 4EJOA 1ZARA 1R7JA 5HS9A 4P9UA 4DQ2A 2J5OA 1QQIA 1TQMA 1I27A 1G3TA 4WCGA 3KEQA 1W4MA 3KE2A 2NS0A 1XB4A 2NYXA 3WTYC 1SD7A 1XDSA 2HEOA 2OU2A 4U0YA 1R1UA 5D5VB 4A6DA 1QZYA 1TW2A 4G9YA 1WI9A 3IHUA 5FLXK 1I6XA 4G6QA 1TBXA 4M9ZA 2P4WA 3ZMSA 4OIOF 3BOQA 2HKOA 1FOKA 2EV0A 1FP1D 2K27A 2E7WA 3WE2A 4UVAA 1EH7A 2JTVA 1J2XA 1YYVA 3N97A 4HAMA 4XRFA 4U0VA 4UNOA 1U5TC 3JSOA 2O03A 2PQ8A 1FT9A 1IZ1A 3COAC 3BY6A 4M72A 5LHHA 3QPHA 5J8CA 5D8LB 1G4DA 3U9GA 3L7WA 2RVCA 2QENA 1H9GA 3BPVA 1YIOA 1K78A 4MTDA 4OINF 2H6BA 1HSJA 2VBYA 3O2PE 4L0YB 4G7ZF 3HTSB 3GFJA 3CO6C 4IRGA 2L4AA 1KQ0A 1IXSB 2GA1A 2XIGA 2L3DA 1DUXC 2H27A 1YW9A 4KA4A 3FM3A 2FNAA 3QAHA 1J0RA 3MZYA 3CUQA 3J81K 2HKXA 4IXAA 4MQVA 1RUOA 1Z91A 1T38A 1FZPB 5K5RA 2V79A 5F6FA 2XGXA 1O3SA 1HSTA 4ENMA 3Q9VA 2PLYA 1QBJA 5DCMB 1FSHA 2OZUA 3JTGA 2FMYA 3R60A 5CYVA 3WODF 4KN7X 5E1WA 4JBAA 5HOOA 1OYIA 3WGIA 2Q8KA 5CVIA 2LKPA 1G3WA 2GA2A 2YX7A 3MAJA 2IRFG 2KJBA 2MA3A 2CWEA 3WTSC 3CJNA 3WE3A 2EV5A 1ZLJA 2FU4A 1DPUA 4HDVA 4ENNA 1XMAA 5EEGA 4ZYDA 2GZWA 3DPLC 1FX7A 2E7XA 3DV8A 1LVAA 1ZRFA 2VBZA 2IA2A 2Z99A 3CDHA 3IC7A 4EGZA 5KVRA 4M9SA 5D4RA 1KA8A 2VOOA 5D4SA 4YFKF 3RPUA 3M8FA 5L3BA 4HYEA 1D5VA 2BGCA 3GF2A 2QM3A 3W6KB 2F5DA 3MZHA 4AIKA 5JHUA 5ICCA 3ZMTA 1QO0D 2M8EA 3EYIA 3IWZA 2O8XA 2A68F 1YFHA 4HDUA 3F8NA 3HUGA 4KNYA 4AD9A 2M1BA 3ULQB 4BXUA 1JE8A 1W7PB 3CTAA 1R1TA 5ILUA 3GLXA 4GXOA 2HR3A 4S05A 3WTZA 3WGHA 1BJAA 1ZG3A 4GGGA 2HWVA 4M6XA 2G9WA 5DD4A 3REOA 3RYPA 3WTVC 1SD5A 3E3VA 2CYYA 2XRNA 1TTYA 2V6CA 2D1HA 4HF0A 1P4AA 3KP7A 5E8IA 3KP5A 1S6LA 1TQIA 2R7DA 1J5YA 3VODA 3D5LA 1IXRC 3R0JA 1R22A 5LBQA 4Y15A 3L09A 2BYVE 5H20A 1EH6A 2E1CA 3T5XA 3GVAA 5L3GA 3SXYA 3R61A 1RNLA 2CFXA 3HTUA 4HF2A 4IJAA 2JPCA 4LG0A 1KU7A 3TQNA 1BM9A 1P4XA 3B02A 5CVVA 2JT1A 3QPTA 2FXAA 4KDPA 3C3WA 1WSUA 4M9XA 4JK1X 2EB7A 4A0ZA 3ML6A 1OYYA 2STWA 4IRIA 2D1VA 4KMUX 3GX4X 4HBLA 5D6EA 1LB2A 2F5CA 4HA8A 3RPQA 2DW4A 5FD5A 3TO7A 3GFLA 5K5QA 1CF7A 2K4JA 3HSRA 1W7PA 3NEUA 3EYYA 1IW7F 4IPAA 5FFZA 4HX8A 1I5ZA 4H0EA 3FXRA 3MQ0A 2XAGA 2Q0OA 4L9VA 1IN8A 2H94A 2COMA 4U7DA 3FM5A 2MD5A 4ASNA 1HKQA 3QP5A 5DUKA 3Q5FA 1KU9A 5BS6A 1OR7A 5JFRA 4M6YA 5LRRA 1O3RA 3GO5A 1RUNA 4I2OA 4L18B 2O6GE 3FWEA 1EV7A 2DLLA 4YFXF 3JAMK 1TNSA 2K86A 1JHHA 2XROA 2WTEA 1IN5A 4E70A 2XAQA 3VOEA 4G7OF 1WQ2A 1B9NA 2F5EA 5DEQA 2V1UA 2DQLA 3ISPA 2ISYA 2P7VB 4GYIA 4AWXB 1T39A 1LDDA 3ZMZA 1PUEE 3P9IA 1S8NA 1A04A 1XSDA 1XCBA 1Z7UA 3K0LA 1OPCA 2IA1A 1NHAA 5HS7A 5FB2A 2MH9A 2LF8A 1E2XA 1F9NA 3VFZA 1P92A 1FBUA 3ECHA 1QPMA 3ZP5A 3JW4A 3FX3A 3TO9A 3RYRA 4RAZA 3DQVC 3HSEA 3G73A 1FNNA 3K1PA 4UXNA 1IUYA 4LJZF 2Z33A 4BH9A 5JR3A 2LF7A 2EA4A 4ESJA 1ZREA 4M71A 2EK5A 3Q9SA 4Q47A 4BYYA 5LEKA 2F2EA 1AOYA 2IP2A 1FYLA 4GO1A 4BQAA 2YX4A 1BOAA 1KGSA 2VC0A 1BI2A 1BI3A 3LA2A 4MEYF 4KMFA 4YIIA 4B09A 3WTTC 5IT9Z 5HVQC 2G7UA 1PP8F 4IRHA 1TQPA 4RGUA 2ELHA 3K2ZA 4HOBA 1CF7B 4P9FA 1FY7A 2W84A 1ZGJA 1Q1HA 3DFGA 2XAFA 1LDJA 4WK8F 4CO8A 3HOSA 4UVBA 2KIUA 1B9MA 5BPIA 5HDGA 2KIMA 5F1RA 5BQTA 5FGMA 2EFPA 3MCZA 3VEPA 2F5FA 1MJAA 2G7HA 3MWMA 4KT5C 1HBXG 3GUDA 4PGHA 2J5PA 1Z9CA 1MDMB 4I01A 4ENJA 1Z1DA 2VXZA 4UVCA 1BIBA 3V7SA 2Q2EA 2ACJA 2W57A 2OD5A 3TDUC 5AIQA 2RV8A 3F6VA 4LK1F 1ZAOA 1AWCA 3FMQA 3B73A 4M73A 2D45A 1B1BA 4BHPA 4PZJA 4P5OA 2MC3A 4HZFA 2M87A 2HQRA 2WV0A 3O3KA 2QLZA 3HHHA 5DV5A 5E17F 4R8HA 2RGVA 1IRGA 4CICA 4L9JA 1BI0A 3WU1B 1G3YA 2A61A 2MH2A 5DCFA 4P55A 2H09A 3DKWA 4IVNA 1ZHFA 5ILSA 1JHFA 1KU2A 2FRHA 2BBYA 3F6OA 4LMYA 2OQRA 3RJPA 2GQQA 2HYFA 3LQRA 1KQ8A 1J7KA 1JXSA 1SD6A 3DP7A 2C6YA 4EM0B 5IT3A 5HLHA 3PQJA 1SMYF 2K7LA 1H9TA 2TDXA 4HV6A 1USSA 5ED4A 1UCRA 2VONA 4LB5A 2DO7A 5HLIA 4D0PA 3KEOA 3FMSA 1G3SA 2PN6A 2BE5F 5LGUA 2ZFWA 3BZ6A 1USTA 2E1NA 3RIRA 1XSVA 2QBYB 4ZH4F 3ECOA 1Z6TA 1R58A 3IKVA 5LHIA 5CVUA 2RDPA 4BAYA 2PEXA 3PFIA 3R0AA 2O3FA 1B4AA 3CUOA 1P2FA 2DTRA 3EDPA 2HQNA 4RGRA 4ETSA 3BDDA 4HQEA 3W6JB 2UXXA 1I1SA 2O0YA 3OV8A 1IN7A 3F21A 3T8RA 4RGXA 2O61A 4O6JA 4RS8A 4CHUA 4A0XA 1FP2A 3H3ZA 2GXBA 4QWQA 4LLLA 3BJ6A 3I5UA 2XKOA 2KRFA 2GXGA 5LEJA 5AIPA 5HDNA 2CO5A 3V8LA 5LHGA 1IN6A 3FF5A 2RC4A 2P5VA 2AXLA 3D0SA 3GXOA 4ZYHA 2DBBA 1DP7P 4N9IA 4IF4A 5HDKA 2QBYA 1HQCA 4A5NA 1XN7A 5IT9K 4O3MA 2QUFA 4WXHA 2Y75A 4YIFA 1RIOH 1ON2A 4XSZF 1J9IA 1H0MA 3ROUA 2ESNA 2GWRA 2EWNA 1MDMA 3OOPA 4I98B 2OA4A 4M74A 1T98A 4L5IA 1B6AA 1IAWA 4CGZA 5ICGA 1O3TA 1FBSA 5H6RA 4ZYEA 2OZ6A 4AVPA 2XV4S 3G3ZA 3NQOA 4MGRA 1BI1A 2PBIA 2L02A 2FQ3A 3E5XA 2DQRA 3GFIA 3J80K 4IHTA 3ZQ7A 1WWXA 1OMIA 2VBXA 4U0WA 2W85A 2EFNA 1U8RA 2JZYA 2HFHA 4WF2A 5D5XB 1EH8A 4A0YA 4CDGA 4P96A 1QZZA 2FBIA 3HIFA 1J59A 5E20A 3M9AA 3QU3A 4S04A 3GZ6A 4WXDA 2EFOA 4HQMA 5CLSA 3IRQA 2FMLA 5HLGA 1R36A 2RQPA 3FZVA 4LD5A 3GEZA 5E1XA 1HW1A 2STTA 1WRJA 1XSXA 1TNTA 2ZMEB 2MLGA 2QQBA 1S3JA 1MJBA 4LG0B 4WX9A 1W5TA 2NNYA 4OIQF 4KUMA 5LLQA 1PP7U 2QZ8A 1PDNC 2CSOA 1HXDA 4WXCA 1T2KA 3HSFA 3F8CA 4HX4A 2A69F 3JSPA 3F8FA 3CO7C 3WTUC 4WWCA 5JI6A 3I53A 2OQGA 2A5YB 2DU9A 1R5HA 4L5JA 4Z2YA 2FBHA 4B8XA 1XGNA 4K2EA 5L3EA 3EUHA 4HX7A 2FF4A 1XD7A 2HS5A 4FT8A 3HRTA 3MEXA 1XGOA 2ZKZA 2IW5A 1QGPA 4OOIA 2ADUA 4Y17A 3QU6A 1STZA 4OIRF 1V4RA 2PFBA 3RKYA 2PI0A 5DUIA 5LGTA 2BEOA 4YFNF 4AIJA 4LFUA 5ICFA 4Y13A 1ZG5A 1ZRDA 1ZLKA 5JVTA 2P6SA 3F22A 4BNCA 5DD8A 3L2CA 2EFWA 3LAPA 2NRAC 1SFEA 4CZZA 1W7PD 3V8JA 1MJ9A 1ZG1A 3I58A 4EVIA 3C1DA 2VE9A 1ZN2A 3FXUA 5J8FA 4CXFA 3HOTA 1YTYA 2FSWA 3WG9A
chains in the Genus database with same CATH superfamily
4ZJZA 1V4YA 5LGNA 1ON1A 4V2FA 3ZN1A 1Y14B 3BABA 1S5LC 3DPTA 5FLMG 3PW4A 4BL0B 3Q8RB 3I59A 5FJ8J 2DPJA 3KETA 1KZHA 4A12A 2PMZA 3IRRA 1A6QA 5GPCA 4PCQA 2KFDA 2KIFA 2Q1ZB 3KLOA 2X0SA 3TINA 1GV5A 2IJLA 4JI1H 2J6UA 2RNJA 3LSRA 1IV6A 2Q2EB 5J47A 4IHWA 2ZNZA 3HOZJ 2HTJA 2O8KA 2CV0A 4KYWA 5EZGA 4HLYA 3I3LA 2FE3A 4BQQA 4DV6H 1KYWA 4KIBA 5IYBJ 1RJQA 2CQKA 4C3JJ 4DNCA 3MZ8A 3FXJA 4DV2H 5EZHA 5JVDF 4IWYA 3QODA 4FQGA 3J7AO 1F4KA 4RAYA 3TW7A 1GLVA 3L2UA 3N40P 5LP6F 3TDZC 2C28A 1E4FT 2HU9A 1XCVA 1OCTC 4JV5H 1G6NA 2LP0A 3NGDA 4DV3H 4O4LF 1T08B 1MZBA 2V5AA 2X4HA 2YW2A 2DK8A 2HOEA 2IGNA 3DLAA 4XN3A 2V4RA 3OHAA 3S32A 3C18A 1R00A 2PJPA 1B8IB 2LVSA 4HNVA 1PK8A 2VPRA 5DCMA 5M5WJ 3OYDA 4YJ3F 3CC2I 2KISA 2ETHA 1I1GA 3OY9A 3JRCA 5CKTA 1YW8A 4NC8A 2ELKA 4CSWA 2RNGA 1E17A 4ECSA 1F1ZA 4PJLA 4CCLA 2JSCA 2GIZA 1XPXA 4C2MA 4PFPA 3FDSA 2Y0MA 3QZ7A 3TOBA 2IVMA 3ZMVA 3MR6A 5FLXW 3HGGA 5LYJF 2HYGD 2CUEA 2R7VA 4XQFA 2E19A 3I9V2 4A5MA 1I3AA 4MQ9F 4KITB 3WTXC 5EDWA 4FE7A 2JRTA 3V4ZA 2VASA 5AONA 5BOXA 3P9KA 5JVLA 4K0KH 4C5AA 3BG6A 5C8YF 3PW5A 2OUMA 5J6XA 2NVTJ 3VSKA 3WNZA 2NNNA 3BA8A 1KJ8A 2V4QA 4S0HB 4XRSG 2IA0A 3CF2A 1D1CA 1C0WA 3ZPLA 3T1HH 4XSXF 4O3PA 4XONA 5FKKA 5A2QW 4QLCU 4PGGA 1VS0A 1H8AC 2ZO4A 3KZYA 1N36H 2MBFA 4N9HA 3LMMA 1HCRA 3GFMA 3F3XA 3PNYA 2MCTA 2MLKA 1DDNA 1U0JA 4AQYH 1HNXH 3IH4A 5FD6A 4NQWA 2NVQJ 1T95A 1D5YA 3A01B 2VA2A 3LP8A 4I02A 1SFOA 4B3RH 1IN4A 5CVJA 2FP4B 1ITYA 1SFXA 3BPXA 4GKKH 4UV8A 1HC8A 1H88C 1CE8A 4ZI7F 2M30A 4AIHA 3PR5B 4IKFA 3CCVI 4XKWA 4LK0F 4N4NB 4QPQA 1G59A 3S2WA 4FX4A 1IRZA 2OLSA 3V8KA 4ME6A 3ABMH 3OOUA 1O7LA 3OYNA 2NAZA 3AL0C 1I50A 4GLXA 3F72A 3RIZA 4G94A 4A2UA 2P5KA 1B33N 5F1JA 3UFXB 4J9OA 2R7WA 3LWFA 2IGOA 2HJWA 4UUSA 4DYRA 3N43B 1ZYRF 2JPBA 4L9TA 3KZZA 1BC8C 5L1IA 3SZPA 1XNQH 2YS6A 2A5WA 3GMEA 3WTWC 2EA2A 2K9MA 5KAIC 3CMYA 4DR3H 2V9PA 2EJRA 1GVDA 2EIKH 4E7JA 1FJGH 5KK1A 4CZCA 4BHBA 4TV9F 4HLXA 2NU6B 4RM2A 4Y33A 3E6MA 2WDTA 1ZHSA 1LKXA 5EG0A 4I7HA 3K9TA 3VYSB 3KYLA 1GDTA 1YLFA 2Y0SA 4JQFA 1A0IA 2WTFA 3G4SI 4LF4H 1UB9A 3D1NI 2JA8G 3M7GA 3HOYG 1BW6A 2EFQA 2HZTA 3RDIA 3RV3A 3I4MG 3O8HA 4UUVA 2XGQA 1OJLA 2V9VA 1U6GA 5DG9A 2EIMH 3L9FA 3H3VH 3GTMA 2R92J 4J01A 4QW8A 3RSNA 2OAZA 2Y30A 1MBGA 3I0TA 1VQKI 4BBRJ 2YPRA 1MD0A 3J81Z 1O57A 3CLOA 2Y9ZA 4ED0A 1WKMA 4IWXA 2HTSA 5E3NA 4ZYAA 2XCPA 4GYGA 2I87A 2VODA 4G12A 5BR8H 5D8KB 2CQ7A 5LA6F 3CQZJ 4DL2A 1D3YA 2LBFB 1XMXA 4PDKA 2FA5A 4B3AA 4LF8H 2E2JJ 3ERMA 1SD4A 5B5EC 2FD5A 3A2KA 5L1KA 4FX0A 1RKWA 3EETA 3GLKA 2LDUA 5TJJA 2RKHA 4RLQA 2MG4A 4FHTA 4AYBN 4UCVA 5EZYF 3HGYA 4HF1A 4IRCA 1YO5C 3BP8A 3PIOF 1E4EB 4CCOA 3CJQB 2XKPA 3O6BB 3AAFA 4XRMA 3GTGA 3B6AA 4EFEA 4JV1A 5DM7F 1FLIA 2ZB9A 1B72A 4EM2A 2C00A 1S97A 3DPUA 4ECRA 4APMA 2CG4A 3F8BA 3BR6A 3P9CA 5E79C 1WCMJ 5M3MJ 4A6EA 3CDIA 2LSOA 3G1OA 4D5FA 3IAS2 3SFZA 1JUPA 1LQ1A 2QYZA 4UV9A 4LGWA 3VPBA 4XYLB 4M3DA 5IY5H 2UUBH 3C0FB 1ODDA 1K6OA 3V7RA 1K79A 1V54H 1V5FA 3G1MA 1ETOA 1VQ9I 4QIWN 2CU7A 2IGMA 2PG4A 3IWFA 4L1KA 5L1LA 2HHHH 2ISZA 3L4JA 2XPVA 1J5EH 3QWLA 3BG3A 2HPMA 4MEXF 5A2QK 1TLHB 2ECBA 3N4MA 4QWAA 4DV7H 3RQ4A 3CLQA 4R1HA 2VUMA 1S10A 4NB5A 2JQ7A 2Z3YA 4OU0A 4XLPF 3R23A 2UXNA 2ZCWA 1J75A 1IO2A 2FOKA 5L3CA 1PX2A 3C7JA 1FVIA 5EF6A 3AG2H 3E97A 4RM3A 1FC3A 3P7NA 4IL6C 1JGSA 4ON0A 1R9TA 3HEFA 3CMAI 4ESFA 3VYUB 1OKRA 3BJOA 4R79A 5E3MA 1JLLB 2RREA 3KLNA 2NUAB 4RNOA 3KP6A 1JUSA 3GTJA 3GWZA 3K10A 2QSHX 2VQCA 3RPUD 3U2RA 3QFFA 3CCLI 1SEUA 1FBQA 4DR7H 4XOPA 4O3RA 4EJVA 4DV0H 1OYWA 4G8XA 1BXRA 2ZNYA 1SVLA 2X0LA 5GAGJ 3I55I 3SJMA 1VTNC 1JDBB 4LIVA 2LK2A 1HKSA 4XMYA 4NHJA 5F64A 4JOMA 3S2DJ 2NOJB 5IPAA 1ONVA 4BY7J 3S17J 4Y52J 1VKZA 1JXLA 3S3OA 5K7ZA 1POGA 2E5LH 1LDKB 1R1VA 4KHPH 2M0CA 3J7YJ 2VQDA 2IAIA 2VXDA 4DR1H 5DS9A 4KJZA 3FHNA 4M3BA 3QRFF 3WG7H 1KQ9A 1AU7A 1GO3E 1JKPC 3DTEA 3OIQA 4J9KA 3A02A 4KIGA 3A01A 4IHSA 3HHGA 3GV5B 4CA0A 2JMWA 2W6PA 1D8JA 2R7XA 1KJ9A 1K7AA 3CQZA 4I50F 2K5CA 2LC2A 2L7MP 4RDUA 1R49A 4F91B 4JV2A 3BWGA 3DBHB 3FKIJ 3EQLF 5GADJ 1T56A 1D8KA 1VAJA 1PYVA 5J1RA 2R7UA 3MD2A 1VF9A 1EHIA 2QQ9A 1Z2PX 2BXZA 2VE8A 1ZH5A 2K3PA 5FO5A 3V6KA 3DF8A 4HSRA 4NC6A 5KFIA 4L9NA 3RJ0A 5F0FA 4NXMH 5FFXA 2DA5A 4RBOA 2DFIA 3V7CA 4ZZLA 1TL8A 2V1XA 2B63A 2PMUA 1EKEA 3CCSI 2W70A 3RV4A 1N48A 1JKJB 2B0LA 1PVEA 2L9SA 3WU0A 1Y1VJ 3FMRA 2RDJA 3H5AA 3MJFA 2UWMA 1NH3A 2OPTA 1XGMA 1NK2P 2VT3A 4JYKA 1HDDC 1RPWA 3E7LA 1T0FA 3M1EA 3I71A 2E2HJ 5CQEA 6PAXA 2L01A 1JGGA 3ABUA 3CCQI 1X1CA 3LSMA 2JVHA 3M07A 4E7SA 3ERED 3SHFA 1RESA 1SCUB 3KFWX 2KHMA 2QA4I 1U78A 1YX5A 3FDYA 2F4MB 3PQKA 1OCZH 1S0OA 4XIDA 1V3FA 4O4HF 2FLPA 5E3OA 4NNJA 4MAMA 3H1CA 2ZXJA 4DYCA 2UUAH 2L7FP 2WE6A 3OUZA 4Y8VB 2HXIA 1VQNI 4DV1H 5KFQA 5GTHC 1YS6A 2R7TA 2B63J 1OFCX 2L4MA 2L54A 2XHKA 2PMHA 4ZOLF 3PR4A 3HDDA 3RKXA 1YOVB 3HOUJ 2DJNA 2ZMEA 4EQQA 3ZQGA 3J80Z 4ESBA 2QQAA 5KT6A 4EBCA 1L3LA 5J40A 2YZNA 2C35B 2VT2A 3FKIA 2XC7A 4N0BA 3U1KA 3N41B 4XLCA 2D2WA 3BCBA 3E5UA 3E5QA 1JJ8C 1YHQI 4CYDA 2DDAA 2W25A 3KP4A 2QQ8A 4EJWA 5ICEA 1Z05A 2PJRA 1TT5B 1DU0A 2W6QA 3ZMUA 5F0CA 4LF7H 2FK3A 2R85A 2WC2A 3X2QH 5EEHA 2VIXA 1CGPA 1FYKA 4RA2A 4HR7A 1JUMA 2XF5A 4F4XA 4JI0H 3JRAA 1W1WE 4A3KJ 5KG6A 1X3UA 4G7HF 2OBPA 2XAHA 1MIJA 5KKNB 4FBTA 4F7ZA 4I0BA 2K4BA 1SMTA 5KG7A 3RB0A 3PSFA 1U3EM 5FJ8G 1FPQA 4DUYH 2QVOA 3I54A 1IF1A 4RNNA 3TIGA 5GP9A 3W3CA 4A3LJ 4ZDOA 4I09A 3U1DA 5KG0A 4E7ZA 3LSPA 2NU9B 3IL2A 4JI7H 1ERDA 5IT9W 3T8TA 3LQQA 1BNCA 2JA7A 2Z9OA 4LLNA 2H1LA 4M9UA 2IBDA 5KFKA 2YRXA 2K9NA 5T14A 3ABTA 4DL4A 1Z2NX 5CJ9A 2R5YA 3BQZA 1UHMA 3BZCA 3I4NJ 1KYZA 2NOGA 3F9KA 4EMSA 4BGDA 1JI8A 1GVJA 2BY3A 2KDOA 3I64A 4YG2F 3S3NA 3DWLE 1XGSA 2BHYA 1TP4A 4PJNA 4EM1A 2CQQA 3OYKA 3H3UA 5TRDA 4Q5SF 1BA5A 1Z21A 2BQRA 1VFCA 2DAOA 3TKYA 1N78A 1RI7A 4ITVA 4YB8B 2XUBA 3EUAA 2R7RA 1B6SA 4JI4H 4Q4ZF 3HOXG 2H8WA 2QWWA 4PSWA 2HOSA 3AKZA 4M3FA 4C3HJ 3RB6A 3OS2A 1U2WA 3SDBA 1S7AA 3TEDA 1IRXA 2E1OA 2FPPB 4V2GA 3BTIA 4RB2C 1YS7A 1FEXA 5ERIA 3L00A 1YW7A 5DGAA 3ABLH 5CPRB 5E8GA 1YJNI 1WH5A 2E36A 3VPRA 3K1MA 2FNPA 3LL7A 2WB1N 1ZRCA 3GZ5A 2DIKA 1P6RA 2H6CA 4A3GG 3S93A 2ESHA 4ENKA 4GCVA 4MTEA 2C2RA 2M9HA 3LSTA 1KU3A 2M7AA 3R6SA 1S9FA 1T6SA 5DDGA 3VPCA 4HSTA 3T5KA 1BGWA 4XK4A 1GHCA 1HW2A 2PMZE 2R3SA 2ZJ2A 2PVPA 1G8XA 2A6HF 4BHCA 2R8IA 5L3FA 2K02A 1XMKA 5J1UA 1O75A 2YL2A 4J00A 1TA8A 1REPC 1O3QA 1Z3XA 2YR2A 3CCUI 1TW3A 4XX0B 3F23A 4ZQIA 2QYOA 3VB2A 2A6EF 2IT0A 4I76A 2ME6A 5CVRA 4KN4X 2UZKA 2L7KA 3RI4A 1O7FA 2FMAA 4UCTA 4EGYA 2RF4A 3HYIA 3PO3G 3LFKA 2X85A 4U88A 4L0ZB 3GTGJ 2V9WA 5DTDA 2YSRA 5KFDA 4QIWA 3F8MA 3SQNA 4ZTJA 3E6CC 3QP6A 2LYCA 4XYMB 4RGSA 3PIPF 2VBWA 3H20A 4BDZA 4O2BF 2W9BB 4BJ5C 2CW0F 4FISA 1WGXA 2LBFA 1K83A 1FIPA 3TW6A 2VB6A 1LNWA 1WH7A 2ZMEC 3K2AA 3BG9A 2CMPA 3BCAA 1FOXA 2A3SA 1I39A 1YG2A 3RKWA 1U9NA 2AGPA 2DPDA 4MHGA 5KAFC 3LA7A 5D5UB 2CH0A 4I0AA 2YUSA 1N75A 1R23A 3E6BA 3MMYB 3G71I 4C30A 1IOVA 1Q1VA 2A07F 5B1AH 1X58A 2QKMB 2FQ4A 4JX4A 5LRSA 1MKMA 5BMZA 2M45A 2XAJA 4EEYA 1Z6RA 1EZ1A 4TV7A 2B9SA 2R93A 1L0OC 3ABKH 3BQYA 1P4WA 3I4PA 4XBFA 3DEUA 5K1YA 4C2TA 2GLTA 4OAZA 3N05A 2DK5A 2JRMA 4C2UA 3E6DA 2P8TA 2N8GA 3TO6A 1SVOA 4UHTA 3LWBA 1VQMI 4RB0A 4XLNF 5EG0B 3TOAA 1MGTA 1UHWA 2FEZA 3CUQB 4ZYGA 3SZTA 2OJED 1SFUA 3WU2C 3Q8QB 1GXQA 2JA5J 3RTRA 4NDLA 4DUZH 2XPUA 2XVCA 3CP2A 3T0YA 3TGNA 3HL2A 1BR1A 3M8EA 2E5NA 4ZDPA 9ANTA 2HDCA 1WCMG 4ZZDA 5FLXZ 3G6EI 4LF9H 3LOCA 3V42A 3BJAA 5D6FA 2LKXA 2DPUA 1TWAJ 2RN7A 2VOPA 2I10A 4HV5A 3IKTA 5F04A 1D0XA 3ZQLA 4OIPF 4O4IF 5HS8A 5D1PA 2DFFA 4EJTA 2VI6A 4G6DA 1BC7C 1F5TA 1SAXA 3OYAA 5EWFA 3PW2A 3TBIA 4D7NA 5DYMA 4YAJB 1LEBA 4B3MH 4OMZA 3HRSA 4B4CA 3KCCA 1K78B 2AXTC 5KT7A 2KKOA 4IOCF 2HDDA 3LMLA 2M4GA 3QPSA 1T3NA 1BIAA 3JTHA 2DT5A 1RK5A 2DPIA 3NWSA 1AA7A 1RC9A 3PW0A 2AQ4A 3FXMA 1VBGA 3JSNA 2OH2A 2NS8A 2Z5UA 3H3VK 4M6VA 3ASOH 1S29A 5F08A 2CKZB 3Q2OA 3RAXA 3CCMI 2VKEA 5E18F 2C2EA 3ELKA 3TQTA 1UFMA 1X19A 3CUQC 2YCHA 2JA7G 3GIIA 4KFCA 3CVZA 3SZGA 1LEAA 3KP3A 3ESWB 4J19A 3OYFA 4DGWB 4IRKA 2F48A 2M7BA 1Z77A 3K4LA 2CV1A 1ULZA 5JLXA 1IRFA 1UG0A 4MNUA 2JUCA 4XLAA 1B59A 2VC1A 3DXJF 3FHZA 4WD3A 2WWYA 4KIFA 4C3IJ 1BBYA 4Q48A 3VYRB 2KJCA 2OF7A 2ZBKA 2XGDA 2V7FA 4BEHB 3R4KA 1HKTA 4EEQA 2W24A 3QOPA 5K7FA 2I8DA 3QZ8A 1MMNA 4HW0A 2DCEA 2AQEA 1JT0A 3HRUA 2K3FA 2UVWA 2V1DA 1Y6IA 1DV1A 3K3VA 3HOUG 5GAEJ 1YIJI 4E7KA 3GIJA 2W9BA 2AS5F 5IOZA 1VI0A 2V58A 3E5NA 4EJUA 1LE8B 4DIQA 1W5SA 3LAJA 5K5OA 4BXXG 5EGOA 2HGCA 3S8PA 3V4GA 4RB3C 1LJ9A 1SEIA 3T5LA 5E1ZB 4QWDA 4QW9A 3GW2A 3IH3A 2L2OA 3VDXA 1TWGJ 1ZR4A 2R92G 2BV6A 3HRMA 1RZ4A 3MKZA 1B8IA 1TWFJ 1MBJA 2XASA 2YZGA 3K6GA 3Q0UA 3BQ0A 2DI3A 2W7PA 2VN2A 2EZKA 4A3IG 1QHHD 3KP2A 1OWTA 2R93J 2WAQN 1TT0A 3EPIA 5BPDA 5C4XG 4O3NA 4QWCA 4HYKA 1BJZA 2IPQX 3I56I 4ED3A 3M4IA 1JTYA 5KFRA 4PDBA 2Y69H 4IHVA 5A2QZ 1FSEA 2W1OA 1ZGAA 3G6YA 1NG6A 3WGGA 3T1YH 2Q2TA 2HQ5A 3FBNB 3T1BA 1R5GA 3GILA 5ILVA 2YU3A 3OHBA 3H9GA 5D5WB 1B72B 4GRIA 2EINH 4E7HA 4EV0A 2M5WA 5H6QA 5CB4F 3K70C 2LNBA 5IYCJ 1NTCA 4OAYA 4ANJA 2X9DA 3HPGA 3ZN0A 4RAFA 3GYHX 1FWZA 3W2VA 2Q2UA 5M5XJ 3BROA 1ENHA 2DA6A 1WSCA 1U5TA 2XGCA 2VPQA 1BN5A 1HW5A 1IJWC 1X2NA 2R5ZB 4LB6B 4U7BA 2FKLA 3HM5A 4NXNH 3I59B 1XDUA 4PJ0C 2GAUA 3OS1A 1D0YA 2EV6A 4CH7A 1QNTA 3HOWJ 5LXTF 1Y1WA 3NRVA 4EYIB 2R7ZJ 4L5EA 4MIMA 4RNMA 3H40A 3GTLA 2VJ5A 2ZC2A 3FKJA 5DLFA 4A93G 1M0TA 2F5VA 4EYHB 2XRLA 3ZMDA 2ZM6H 2JUGA 2DYRH 1N77A 3RBDA 2CGPA 2VJJA 5J4VA 2P5LC 1K1QA 4JI3H 4JYAH 4KICA 1IBLH 5KFZA 2CRGA 3LA3A 2P7CB 4H4KC 4BBSG 3RZDJ 1GXPA 2WA0A 5EEAA 3K69A 1X4OA 2P6TA 4F50A 3CCJI 2R7FA 4ZHQF 3J7AK 3JRWA 1XS9A 1DPRA 2OCCH 2E60A 2IXSA 3KHGA 2KL4A 2VUMG 3H92A 4IHXA 3CD6I 4II3A 1Y0UA 1LPQA 1MNMC 3OSGA 4LLGF 2JVGA 1S7OA 5JHFA 1FYMA 2M34A 2GIVA 4EBEA 2ASDA 3H5RA 3L4KA 2RDIA 4BE2A 5DLGA 3FXQA 1LFPA 4DR4H 3K1NA 4XKVA 5L3DA 4OMYA 4D1QA 5KG4A 3PFYA 2FBKA 3LSJA 1YQAA 1WPKA 3MFKA 1ULYA 3PNTA 1YE9A 1HDPA 5KFGA 3HOXJ 1X1DA 1U5TB 3BZKA 2Y48A 4BUPA 3JAMZ 1KJJA 1IOWA 4RB1A 1IXCA 1A35A 4O5VA 5DG7A 1FMVA 3BR3A 2VKVA 1B04A 3FXOA 1ZARA 4EJOA 1R7JA 5IYBG 3TL4X 2ZDQA 3N42B 3HZJA 5HS9A 4P9UA 3GTLJ 3HPHA 3ZCOA 1OLTA 1H89C 3G6XA 1MH4A 3ONQA 4DQ2A 3MR3A 4LFAH 2J5OA 2W00A 1QQIA 1ZR2A 1N34H 1TQMA 4YAKB 3A4CA 3Q1KA 2M4KA 1MMDA 5HNHA 4EGQA 3NAUA 1I27A 2X6XA 1G3TA 4WCGA 3KEQA 1W4MA 3GV7B 3ZQIA 3KE2A 2NS0A 1XB4A 2DMUA 2NYXA 4DBRA 5KFYA 3DU5A 1JJ6C 4EATA 4D5CA 2B63G 3WTYC 1SD7A 3EPGA 1XDSA 3JRHA 3Q0WA 2HEOA 2VKDA 2OU2A 4U0YA 1R1UA 5D5VB 2IS4A 4A6DA 1QZYA 4KT6A 2EBIA 1TW2A 3CF5F 2W48A 4YY3H 1K4SA 4JI8H 4G9YA 1N32H 1V5GA 1WI9A 3IHUA 2YZMA 2W82A 4AC0A 5FLXK 1C3OA 1I6XA 4G6QA 2VQLA 2E34A 3SFIA 3S15J 1TBXA 4M9ZA 2MGQA 4UY8I 2BVLA 2P4WA 4IEJA 1VZ0A 3ZMSA 5DG8A 2NVXA 1YITI 1TWGA 4ED6A 4OIOF 1OCCH 3BOQA 2HKOA 1FOKA 4I55F 2EV0A 2DODA 1N56A 4A3FJ 4O3SA 2VJIA 1ZKGA 1FP1D 2K27A 2O5RA 3G2BA 2E7WA 2BZTA 3WE2A 3D5SC 2J6SA 2XC9A 4UVAA 3N8DA 1I3QJ 5JLWA 4UCOA 4GKJH 2KPMA 1W0TA 1EH7A 2JTVA 1J2XA 1YYVA 4RZRA 3H0DA 3N97A 4HAMA 4E7IA 3VWBA 4XRFA 2G0EA 4U0VA 4UNOA 4QSHA 2OTLI 4CCMA 3L2VA 4RZQA 4Q43A 1U5TC 5M3FJ 4BY1J 3JSOA 1IGNA 2O03A 2PQ8A 2HOAA 2K85A 1IC8A 2WB1A 1FT9A 3V6HA 2E1MC 4BBSJ 4ECXA 1IZ1A 3COAC 5FPOA 3BY6A 1GLNA 4M72A 2MABA 5LHHA 3QPHA 4PSXA 5J8CA 4J0MA 1MBHA 2RAEA 5D8LB 1G4DA 3JAMW 4TQSA 3U9GA 3GTPA 5KFPA 3L7WA 2DXIA 1QU3A 1E0EA 2RVCA 2QENA 2ZJTA 4ED7A 1OR7C 1H9GA 3BPVA 2NS7A 1YIOA 4A93J 1K78A 4LH7A 2W4SA 4MA0A 4MTDA 1XMQH 3JRBA 4OINF 2R7NA 4DLKA 3S3MA 4MA5A 5KT4A 4ED8A 4TUYF 2H6BA 1HSJA 4DOZA 4A2BA 2VBYA 4UUTA 1Y8QB 3ORRA 4NUBA 2ZXIA 1I94H 1RJPA 3O2PE 4U87A 4L0YB 4G7ZF 3HTSB 3GFJA 3H35A 3CO6C 4IRGA 1I6HJ 2JA6G 2XGEA 2L4AA 2JSPA 1KQ0A 3BC8A 1IXSB 4PJMA 2GA1A 2XIGA 4C9YA 3KIOA 5M5YJ 3M9OB 2XDVA 2L3DA 1V5EA 1RYSA 2NVYJ 1BR4A 2UV1A 4E4TA 1DUXC 4UB6C 2XF7A 1YW9A 2H27A 4KA4A 3FM3A 2FNAA 3W2AA 2R7MA 2W6MA 3QAHA 4JI5H 1J0RA 3MZYA 3CUQA 2MFZA 5J2UF 5IYCG 5TGTA 3J81K 2GPSA 4Q8EA 1VNDA 4LH6A 1BW5A 3ZQFA 2HKXA 3BG5A 4IXAA 4MQVA 1RUOA 4F4YA 2F4OB 1WCMA 3SEZA 1Z91A 5CQGA 5C44J 1T38A 1FZPB 2XSDC 2NVYA 2DOFA 2R0QC 2LREA 2R8JA 5TISC 5K5RA 5CA0F 2C2DA 2V79A 5F6FA 5IYZF 5FRMA 2XGXA 1O3SA 2ZSIB 4A3DJ 5C4XJ 4A3JG 1HSTA 5C4JJ 4ENMA 3BT9A 3Q9VA 2V26A 4CYCB 4J9SA 2NU8B 2PLYA 1QBJA 1R5ID 5DCMB 3J80W 3E1SA 1FSHA 2OZUA 4BE0A 3JTGA 2FMYA 2E2IJ 3R60A 5CYVA 3WODF 1FTZA 2FJ1A 3H0GJ 4G3IA 2LY9A 4KN7X 5E1WA 1PUFB 4JBAA 5HOOA 3K4JA 3H4BA 3PW7A 1OYIA 3WGIA 4DZPA 3PO3J 2JA6A 2Q8KA 2FPGB 5CVIA 4YHHH 2RQQA 2LKPA 3UNGC 2KDZA 4Y3OA 1G3WA 2GA2A 2YX7A 3MAJA 4E6KG 2IRFG 2R82A 2JA2A 2MD0A 1DGWY 1W93A 2KJBA 3CMEI 2MA3A 1Y56A 4A3FG 2CWEA 4JV0A 3WTSC 3A0BC 3CJNA 5BPHA 3WE3A 2EV5A 5K7HA 1ZLJA 3K3PA 2WADA 2KLOA 2H8RA 1NG7A 2W6OA 1WZ2A 3TIIA 5B1BH 2E5ZA 2FU4A 1ZK8A 2GOXB 4HDVA 1DPUA 1LUJB 4IO9F 2FK1A 3JZIA 3I4NG 4ENNA 5KHDA 4IAJA 1XMAA 1D0ZA 3JRIA 1WJFA 3OYBA 1T36A 5EEGA 1WH2A 2F6CA 3CCYA 1ETXA 3K4KA 3RZOJ 3U9SA 1DIKA 3UQ8A 3JSLA 4ZYDA 2DA4A 2E71A 2GZWA 3DPLC 3M4OJ 3VPDA 1FX7A 4BWSC 2E7XA 2XSJC 3DV8A 5B66C 1WJCA 2DA7A 1UC9A 4CUGA 3PO2G 3FISA 1LVAA 1ZRFA 2FLNA 2VBZA 5LMUH 4CYCA 3RGXA 2IA2A 2Z99A 3HKZE 5JVGF 1E3HA 3CDHA 3IC7A 4EGZA 2H1KA 2VQEH 5KVRA 4A3KG 3V6JA 2LY2A 3S14J 3RFCA 2JN6A 2DA1A 2BQ3A 4BBRG 4M9SA 1KEEA 5BPFA 5D4RA 1KA8A 1AUVA 2VOOA 5D4SA 2O7OA 4G6TB 3RPUA 3M8FA 4YFKF 3K5IA 3HUGB 5L3BA 1A6IA 4HYEA 3GIMA 1HOMA 1MNEA 5KT2A 4BEHA 4PJJA 1D5VA 2BGCA 3GF2A 5KG5A 1ETQA 2QM3A 2F5DA 1LVKA 3W6KB 4AIKA 5FROA 3MZHA 3S1QJ 5JHUA 5ICCA 2K9QA 3ZMTA 3G1LA 1QO0D 2M8EA 4LITA 3EYIA 4MV7A 3IWZA 1W36C 2O8XA 3TQ1A 2L9RA 2A68F 2R8HA 3T5JA 1Y1WG 1YFHA 4HDUA 3F8NA 2WYOA 3HUGA 4KNYA 3ZQHA 4AD9A 3W6VA 2PMZN 1CQJB 2M1BA 4JX5A 5IP7G 4ECZA 3ULQB 4BXUA 1FMWA 1W7PB 3CTAA 3FIWA 1JE8A 4Q0YA 4O3OA 5KFVA 5C1OA 3MFHA 4DL7A 1R1TA 3FK7A 5KFOA 2JWTA 5ILUA 2A6TA 4IZOA 5DGBA 1N33H 2FK2A 5FKMA 4C5CA 1OISA 1A31A 3GLXA 4WBNF 4GXOA 1W5CC 4I6ZA 3J7AY 2WB1E 3V4SA 1BOBA 1QVTA 1ZELA 2HR3A 2M3AA 4S05A 4GC7A 3RB3A 3WTZA 4RMNA 5EJCA 4XL9A 2XB0X 4X1EA 3WGHA 3H0GG 4JUZA 2E2HA 1BJAA 3GIDA 2R7OA 1ZG3A 4GGGA 3KZIC 1SANA 2DT7B 2G9WA 2HWVA 3NWTA 4M6XA 5DD4A 3REOA 3ETJA 3GLLA 3RYPA 2UUZA 3KPHA 3N44B 3WTVC 5K2MA 3RGZA 3L2RA 1SD5A 1U8BA 3N6XA 3KAJA 4X65H 4I99C 3KHHA 3E3VA 5KFWA 4J9RA 2IBKA 2CYYA 1ZHQA 5F9LA 2XRNA 2W8KA 2L7ZA 1TTYA 2W71A 2V6CA 4N4OB 1QZEA 2D1HA 2R7ZG 2MC4A 2F4VH 3NARA 4DJAA 4HNUA 1X3WB 1P4AA 4HF0A 1XDNA 3KP7A 2X6OA 1E4EA 1C30A 5E8IA 3JRGA 3KP5A 5LOVF 1MBFA 1S6LA 1TQIA 2W6ZA 3S16J 2EQRA 2YS7A 4V19K 2R7DA 4YP3A 1J5YA 3VODA 3OYIA 1AN7A 3D5LA 3PM1A 1IXRC 1YI2I 2E35A 3R0JA 1R22A 3JREA 5LBQA 2Y9YA 2Y31A 2XCLA 1DP3A 2HGSA 4Y15A 5KT3A 2BXYA 3L09A 3BTLA 1S72I 1SVMA 5C44G 4EG0A 2BYVE 5H20A 1EH6A 2E1CA 3T5XA 2L5QA 3GVAA 5KFBA 4NBQA 5L3GA 3M9MB 2ZXHA 3RF2A 3SXYA 3GBGA 2KMUA 3R61A 4ECYA 3JRFA 4BY7G 1RNLA 4CC6A 1OCRH 1B6RA 3HOWG 5KG1A 2CFXA 3U21A 2KRHA 3HTUA 1SFOJ 2R8KA 5JQWA 3GTOJ 4IQJA 4HF2A 4MV6A 2O9LA 3CP8A 1MH3A 4IJAA 1UELB 2JPCA 3PL8A 4LG0A 1XMOH 4BQOA 1KU7A 3TQNA 1BM9A 1P4XA 3P5JA 1RETA 4A3MG 2W7NA 3B02A 2XCAA 4J9MA 4FM9A 5CVVA 1MBKA 2JT1A 1GSAA 3QPTA 2FXAA 2ID6A 2CW7A 2VKHA 4KDPA 3C3WA 4B48A 1G2HA 1WSUA 3BQ1A 5KFXA 4J9PA 4M9XA 3PJRA 4R7RA 4JK1X 2ZDHA 2EB7A 3LSKA 3DU6A 1VQ6I 3SE7A 1M1EB 4A0ZA 5F9NA 3ML6A 3OTOH 4A3IJ 1I6UA 1OYYA 2STWA 4XORA 4IRIA 1JKOC 2EZIA 2K40A 4F92B 2R7LA 2D1VA 4KMUX 4FS1A 4DL3A 3GX4X 3K70D 3JRXA 3AG1H 2ME0A 4HBLA 5D6EA 1BL0A 1LB2A 1W36D 2F5CA 2P81A 4HG2A 2L9VA 4HA8A 3L2PA 3RPQA 1P8LA 1P9QC 4LF5H 4ED2A 1L2ZA 3EPZA 5H2FC 2ZFUA 2W9CB 1M7JA 2DW4A 5FD5A 3H36A 3R5FA 3TO7A 1V9PA 2XGPA 5IP7J 3GFLA 5EWEA 5K5QA 1CF7A 2K4JA 1JKQC 2GPWA 4NQWB 4RAGA 1IBMH 3HSRA 4YELA 1W7PA 1P7IA 4AYBE 2IS1A 4XOTA 4ECQA 3J7ZI 3NEUA 4F52A 1U9OA 2IS6A 1ETVA 3BG7A 1J09A 3EYYA 4DR2H 1IW7F 2EIJH 2KIQA 4IPAA 5FFZA 1Y1WJ 2VL8A 4BACA 5IP9J 1WJ5A 5HODA 1GSHA 3E0JB 2DA2A 3S1NJ 4HX8A 1I5ZA 1UHSA 2MSYA 3OYMA 4B1RA 4H0EA 1LFUP 3FXRA 1BR2A 1JT6A 3KEYA 3MQ0A 3QOEA 2XAGA 2GBYA 2Q0OA 4L9VA 1IN8A 2H94A 4W1UA 2COMA 4U7DA 3ASNH 3FM5A 2MD5A 4ASNA 1HKQA 2JA5G 3QP5A 2BW3A 2E1MB 3BR5A 4HPQA 5DUKA 3Q5FA 5KX5F 1KU9A 5BS6A 3G8CA 1OR7A 3B6CA 5JFRA 2KRCA 4M6YA 5LRRA 2X51A 3L1PA 2GXAA 1DU6A 1D1AA 1O3RA 4XZ3B 2EH3A 1EA3A 3GO5A 1RUNA 4I2OA 4EGJA 3K5HA 4L18B 3DBLB 3IN5A 2O6GE 4BE1A 1T33A 3FWEA 1HNWH 1EV7A 2V4JC 4Y7NJ 2DLLA 3I4MJ 5L9XA 3DEWA 4YFXF 3JAMK 4YR3A 4F4ZA 1TNSA 2K86A 1JHHA 2XROA 1W96A 2WTEA 3FXLA 3DLLF 4A3CJ 1O4XA 2ICWG 1IN5A 5GONF 3OSNA 4E70A 3DF7A 4QTRA 2XAQA 3VOEA 1QA6A 4G7OF 1WQ2A 1T94A 3CCRI 3ETHA 1JX4A 2Y0SN 1Y1VG 1B9NA 2F5EA 3ZQQA 3DCFA 4U6PA 2CUZA 5DEQA 1ETKA 2DQLA 3ISPA 2V1UA 4IHYA 2ZXWH 1IDZA 3FXKA 5IYDG 2ISYA 5KFMA 2P7VB 4BQNA 3OIOA 4Q45A 4GYIA 1X1BA 4AWXB 4XICA 2KQRA 2VJ4A 1T39A 1D1BA 1WHUA 2LG4A 3CZ6A 3SEQA 1JIHA 4X62H 4FASD 2DMPA 1E3PA 1YJ9I 1LDDA 4UCSA 4UCRA 2JA6J 1X2MA 2KZVA 3ZMZA 4AUXA 2JEGA 2HVRA 1PUEE 3P9IA 2YS9A 1PUFA 2UXCH 1S8NA 4FE4A 1A04A 4A3JJ 2AGQA 4A3DG 3LFUA 1XSDA 3H0GA 2VPSA 1XCBA 1Z7UA 3K4MA 2OV7A 3BJYA 2QSGX 3M9NB 2IS2A 2IEKA 2BVMA 3K0LA 1FTTA 4MV9A 1OPCA 2HVQA 1CS0A 4Q8FA 2IA1A 3FBIB 1NHAA 1UAAA 5HS7A 5FB2A 2MH9A 3MKLA 3H9JA 1SC7A 2YYAA 1V55H 2LF8A 3AG4H 1E2XA 3BLYA 1F9NA 1KONA 3VFZA 1P92A 3MR5A 2SCUB 3OR2C 1FBUA 3ECHA 1QPMA 4AIDA 3ZP5A 3JW4A 3TMOA 3FX3A 3TO9A 4ECUA 3RYRA 4RAZA 4RUCA 3BQ2A 2R5ZA 4LFBH 3QYFA 4BU2A 3DQVC 1QHGA 2LRDA 3JR9A 2OTJI 5KFCA 3HSEA 1VQ8I 3IV5A 2R92A 3G73A 3OYJA 2CUFA 4XKBA 1FNNA 3K1PA 4UXNA 1IUYA 5D8DA 4LJZF 5KG3A 2Z33A 4MLOA 3CCEI 4BH9A 5JR3A 2LF7A 2EA4A 4I4TF 1WVRA 4ESJA 1T8IA 3KALA 1UJ8A 1ZREA 5JH7F 4M71A 4XR6A 2EK5A 4QPOA 5FPRA 3U9TA 3IH2A 4B44A 3Q9SA 4Q47A 2NVUB 1ZETA 3PSIA 1PJRA 1KJQA 4BYYA 5LEKA 2DMQA 1KJIA 4YEJA 2F2EA 4R8UB 4R8UA 2AGOA 1IG7A 1UC8A 2GM4A 2FJZA 1AOYA 3KYDB 1XTAA 2IP2A 4BKXA 4GO1A 1FYLA 4BQAA 2YX4A 1BOAA 4BXXJ 3MWDA 1KGSA 4A3BJ 4A3GJ 2VC0A 1S03G 1VBHA 1MMGA 2VQGA 3GTQA 2WAQE 1BI2A 1R71A 1BI3A 2OWOA 4E4HA 3LA2A 4NC7A 2Y0SE 3C2HA 2HVSA 3EUHC 2VLAA 4II2A 1KBLA 2J6TA 1BJTA 4MEYF 1LE8A 2K9SA 2EPFA 3VMMA 4KMFA 4YIIA 4F93B 1A9XA 4ZTFA 4A3CG 4FS2A 4B09A 1XNRH 4W97A 4MO7A 3WTTC 2IA6A 5IT9Z 2I8CA 2DFHA 5HVQC 5FLVA 2G7UA 1PP8F 2HNHA 5GPAA 5DQGA 4IRHA 1TQPA 4RGUA 2ELHA 3K4NA 3K2ZA 2VQFH 4LSAA 1RYRA 3HOZG 4HOBA 4P9FA 1QVUA 1CF7B 2DTZA 1FY7A 4MV1A 2WAEA 2W84A 1F43A 1ZGJA 1Q1HA 1X4PA 3DFGA 2XAFA 1I7NA 4TV8F 2ALZA 1LDJA 2CQXA 5E3LA 4WK8F 4CO8A 5FKLA 3HOSA 4RU9A 4FBUA 4YIRX 4UVBA 2ASJA 2COBA 5LFAA 2KIUA 3T5HA 4TQRA 1B9MA 2R87A 2ATLA 4U7CA 3GZNB 5BPIA 2DJIA 5HDGA 5IP6A 3MN2A 5KFFA 4EBDA 2HXOA 1K6YA 2DMTA 2KIMA 1Z0XA 3DBRB 5F1RA 5BQTA 1HR0H 5FGMA 4M3EA 4EFBA 1SFKA 2EFPA 3MCZA 4HNTA 2CS3A 3VEPA 2BY1A 4Q44A 3I12A 2F5FA 2KT0A 4IR9A 2LD5A 1MJAA 2G7HA 4PUSA 3ORQA 3H9QA 4A2AA 4LOCA 3MWMA 4KT5C 4MFDA 3GUDA 2BY0A 1HBXG 2JA8J 5KFAA 5BMVF 4A3EG 4PGHA 4UB8C 4JI2H 2J5PA 1Z9CA 3BAAA 1MDMB 1TWHA 4I01A 3EUKL 4ENJA 1RR7A 1Z1DA 2VXZA 4UVCA 1P7JA 4FTHA 2UVRA 1BIBA 5EYRA 2ZJRF 1VQ7I 3V7SA 2Q2EA 2ACJA 2W57A 1TWHJ 3HG9A 4P1WA 2KP6A 2OD5A 3HC7A 3TDUC 1X3ZB 5AIQA 4EEFG 5DM6F 1DGRM 2RV8A 2QEXI 3PO2J 2M0MA 3F6VA 5GTIC 4LK1F 1ZAOA 1AWCA 3FMQA 2HPIA 5LD2C 2CQYA 2W7OA 3B73A 1JTXA 4M73A 1ETYA 2FOWA 2X6WA 2D45A 1MNDA 2HZDA 3IAM2 1B1BA 4BHPA 4RUAA 4PZJA 4QWBA 1Y1VA 3WHCA 4P5OA 2V1NA 5F0HA 3HOYJ 2R5YB 2MC3A 4XN0A 4HZFA 2DZDA 2M87A 2HQRA 2A05A 2WV0A 3O3KA 1UG2A 2QLZA 2EZLA 3HHHA 5DV5A 3RKQA 1FIAA 2QF7A 3WO1A 4DV4H 4IQ4A 5E17F 3HKZN 2IP4A 4R8HA 4BS9A 2RGVA 3GTKA 3K4CA 1IRGA 3MVPA 4X0GA 4MFEA 4CICA 4LSXA 4L9JA 4GC6A 2FB9A 4M3GA 1R4NB 1RK6A 1BI0A 3WU1B 2R7ZA 2X1DA 5EDNA 2PBZA 3KHRA 1G3YA 2F4IA 1R6RA 4GFBA 2VOBA 1S0NA 4XRSA 3WHBA 2HOTA 2EZHA 2LR8A 2A61A 1A36A 1KC7A 4GDFA 1SYXB 2MH2A 5DCFA 1QPIA 4DBQA 2R7SA 3QYBA 2L9NA 4P55A 4UUSB 5IYDJ 2H09A 2NXNB 2ZDGA 1GUUA 2ELJA 3DKWA 4IVNA 1AKHB 1ZHFA 2MW8A 5ILSA 1CQTA 4ECTA 1JHFA 2YRWA 1AUXA 1KU2A 3FK6A 2BBYA 2FRHA 3F6OA 2LH9A 3LSHA 4LMYA 2OQRA 3GIPA 2VA3A 1GSOA 3RJPA 4F3QA 2GQQA 2HYFA 4QIWE 3LQRA 1KQ8A 1J7KA 2ZSHB 5LMNH 3ZQCA 4A3EJ 1JXSA 1VQ4I 1UMQA 4BJTA 3TP3A 1E4GT 1SD6A 2AHQA 3BR0A 3DP7A 4DW6A 2C6YA 2XD4A 1IV8A 1TZLA 2VQHA 4EM0B 5IT3A 5HLHA 1TWAA 3PQJA 5KFNA 4DR6H 1SMYF 3H5NA 2K7LA 3GTJJ 3BTJA 3G6VA 3Q3SA 2LLKA 1ACIA 2FLLA 1I3QA 3BR2A 1H9TA 2DYSH 2TDXA 4HV6A 2CZGA 1USSA 4J9QA 1WJDA 3QQAA 2J9GA 2UVUA 2QCOA 5ED4A 2XB5A 4CC5A 2FUG2 2JA5A 1UCRA 2VUGA 3DTIA 2VONA 2NVXJ 4LB5A 1HA8A 2DO7A 2CV2A 4XLFA 2R86A 5HLIA 4B3TH 4D0PA 1IDYA 3KEOA 3LSGA 1TWCJ 2LKSA 3FMSA 4AM3A 1G3SA 4IR1A 2MYSA 2OCEA 3M8JA 2BOLA 1ZQ3P 4O3QA 1K4TA 4YR2A 2PN6A 2BE5F 4UCUA 2W6NA 5J3LA 5LGUA 5BNGA 3OYHA 4D9JA 4IHJF 2ZFWA 1CQIB 1JDEA 4ABZA 2HYJA 5KG2A 3BZ6A 3DKYA 3R5HA 1USTA 2E1NA 3RIRA 1GT0C 4BY1G 2DA3A 1XSVA 2QBYB 2UUCH 4ZH4F 2R84A 3ECOA 1Z6TA 1R58A 3IKVA 5LHIA 5F27A 2K9LA 3BTCA 5CVUA 2RDPA 2NU7B 4LG3A 4BAYA 2PEXA 5FLMJ 1V51A 3AYHB 3PVXA 4DL5A 3PFIA 2JK3A 3VYTB 3R0AA 2O3FA 1B4AA 3CUOA 5KCMA 4X6AJ 1MW7A 1P2FA 2DTRA 3VSLA 3UKGA 3EDPA 2HQNA 4YBZB 5KFHA 4RGRA 4BJ6C 4ETSA 3BDDA 1MBEA 3HJEA 4ED1A 1HNZH 1X1AA 3KAKA 4HQEA 3GIQA 3ZXSA 5J2TF 5C5JA 3W6JB 2UXXA 4DYQA 1I1SA 3WO0A 1YRNB 2O0YA 3OV8A 1VQOI 4XKCA 2JEFA 4PK4A 2DMNA 1IN7A 3OYLA 4J9LA 1AKHA 2JJ7A 2Z2SB 3RAQA 3DEEA 3F21A 4CCNA 4FETA 3OUUA 5KFEA 3T8RA 2P0WA 2PJRB 3A1YA 4RGXA 2B7EA 4JX6A 3IG0A 3CC4I 1Z67A 2O61A 4O6JA 5KFTA 4RS8A 1Y0NA 2WAQA 3JRDA 2YU9A 4X66H 3RTXA 4CHUA 4A0XA 1FP2A 3OSFA 3H3ZA 2XF6A 4DR5H 3OL3A 4A3BG 2GXBA 4QWQA 4LLLA 3BJ6A 2Y2ZA 3PUBA 3I5UA 2XKOA 5HBRB 4ECWA 2R7KA 4B3SH 2KRFA 3OYEA 2GXGA 5LEJA 5AIPA 4J9NA 1EF4A 2X6YA 1FOYA 3TP0A 4Y4RA 5HDNA 3ZOBA 3ZGKA 3AL0B 3BA9A 1S9HA 2CO5A 2EILH 4QWEA 3CJRB 2XAUA 2W9AA 2VUMJ 2LMDA 3KX2A 3V8LA 5LHGA 2UXBH 1IN6A 1WJBA 3GTOA 3FF5A 2RC4A 1FJLA 2P5VA 5FKNA 3SI8A 2AXLA 4OWRB 1EYZA 4DZJA 3D0SA 3L2QA 4B43A 2WY7Q 1I50J 2FX0A 3GXOA 1RRJA 4YJ2F 2M05A 1UZCA 4ZYHA 3H4DA 5L1JA 2DBBA 1DP7P 4N9IA 4IF4A 5HDKA 2QBYA 1EUCB 1HQCA 4A5NA 1NK3P 5D1OB 1XN7A 2KZGA 3QPLA 2OC6A 5IT9K 4O3MA 5CAEB 2QUFA 3MWEA 4WXHA 2Y75A 4YIFA 1RIOH 4XLHA 4IZZA 1ETWA 1TC3C 2WY8Q 1ON2A 3GIKA 4XSZF 3OL4A 3QYEA 3MKYB 3S1MJ 1IUFA 4XNFA 1J9IA 1H0MA 3ROUA 2ESNA 3M3YJ 3RBEA 2EWNA 1WI3A 2GWRA 2BHZA 2ZJQF 1MDMA 5JUMA 3OOPA 4I98B 1RJRA 1Y8RB 3HB9A 2OA4A 4M74A 1T98A 1M0WA 4PWQA 3PZPA 2HDWA 4L5IA 3Q8PB 1B6AA 1IAWA 4CGZA 5ICGA 3GTKJ 2JEJA 1O3TA 1FBSA 5H6RA 1XG1A 1XC5A 1FKAH 4ZYEA 5C3EG 1VQPI 1I7LA 2OZ6A 3SYTA 3OR1C 4AVPA 2XV4S 3GV8B 4M7EA 3G3ZA 4MV3A 3NQOA 3O8GA 1Z3YA 1RKTA 1Z7LA 2WAFA 4JP0A 2GLOA 4MGRA 4YRVA 1S7EA 3M1CA 4LF6H 1TAEA 1BI1A 4A3LG 2PBIA 4PFOA 4YQWA 3MKWB 2L02A 4LIUA 2FQ3A 2V59A 2QSFX 1F36A 3E5XA 1E3OC 1IBKH 2XPWA 3LSIA 2DFEA 3K7AJ 1OQYA 2CW8A 2DQRA 3KTMA 4DV5H 2TRTA 3GFIA 4HEA2 1YX3A 2DOEA 1XX5A 1ZTRA 4FU0A 2L0KA 3J80K 4IX7A 3Q0VA 1LFBA 5I47A 4AU7A 1W0UA 4IHTA 3ZQ7A 2R4GA 1WWXA 4ECVA 1OMIA 3L2WA 4E7LA 2AU0A 3KYCB 4Z6YA 2DT6A 2V9KA 2VBXA 2CFOA 4U0WA 4LFCH 2W85A 3RCOA 1K1SA 1K61A 3HKZA 2EFNA 3UR3C 3KHLA 2IGKA 1U8RA 3J81W 2JZYA 2HFHA 1R4MB 2PX9A 4WF2A 5D5XB 4O2AF 5IP9G 2Z16A 3C2BA 2FPIB 1A5JA 2R6FA 3BR1A 2QKLB 3HOVJ 1EH8A 4A0YA 3HBLA 4CDGA 2DWCA 3OYCA 3A0HC 3C2GA 4P96A 5FRNA 5IWAH 1QZZA 2JA7J 2FBIA 3A03A 4B47A 3GQCA 3HIFA 3OS0A 1Y39A 2D5VA 1J59A 2TCTA 5E20A 1WFXA 5FKOA 2X1EA 1T0FC 2ID3A 3M9AA 2BQUA 3QU3A 1FOWA 4S04A 3RB4A 2WV1A 1VQ5I 1WJAA 4CCKA 4F55A 4WXDA 3GZ6A 2DDBA 3DKXA 2EFOA 4HQMA 3W2WA 5CLSA 3HOVG 4QJFA 3IRQA 4C5BA 1TWCA 2FMLA 5HLGA 1R36A 2ZJPF 5KFSA 3S2HJ 2C22A 5IOYA 1S68A 1TWFA 2RQPA 2LY1A 4DL6A 3FZVA 4IOAF 3CESA 3MFIA 2PN1A 1YRNA 4LD5A 3GEZA 5E1XA 1HW1A 1WRJA 1XSXA 4A69C 2M8GX 5HLTA 2STTA 3OMYA 2IMWP 1TNTA 1QRYA 3IUOA 2ZMEB 2MLGA 2LTPA 2QQBA 1S3JA 1MJBA 3K4BA 4LG0B 1DV2A 2ASLA 4WX9A 1W5TA 2NNYA 2YU9J 4KUMA 4OIQF 5HNFA 4HQ6A 2LOOA 1GV2A 1WR2A 5LLQA 1PP7U 4MV4A 4UFZA 2CJJA 2QZ8A 1MMAA 3CMMA 3JCUC 3SDGA 3GCMA 1PDNC 2CSOA 3GTQJ 1OCOH 5DQHA 1HXDA 4WXCA 4C2MJ 1AHDP 1HF0A 5KT5A 3S1RJ 1T2KA 3HSFA 2WBMA 3F8CA 4HX4A 1ZQ7A 2A69F 3JSPA 3F8FA 3CO7C 3WTUC 2I80A 4WWCA 2QGUA 4BXFA 5JI6A 5KFUA 3I53A 3D5RC 2OQGA 2R8GA 4ZC3A 2A5YB 2Z1DA 1X1PA 3Q8SB 1VQLI 1UNNC 4HRIA 1K83J 3RUPA 2DU9A 5DQIA 4AVZA 2V6EA 1R5HA 4L5JA 4X64H 4CCJA 2AO9A 4Z2YA 2I5UA 2FBHA 3OWTA 1JKRC 4IRDA 3HXLA 1OCPA 4B8XA 1XGNA 4K2EA 5L3EA 4A3MJ 2E2IA 5CA1F 2AQFA 3AG3H 3EUHA 4D7MA 4HX7A 2FF4A 1YJWI 2ECCA 1XD7A 5B3SH 2HI3A 3FKIG 4B3XA 2HS5A 4OX9H 1DGSA 4FT8A 1RR8C 3HRTA 3MEXA 1XGOA 3AFHA 4KISA 2ZKZA 2UVVA 2IW5A 1ZGWA 3CDLA 5C3EJ 1QGPA 5J4YA 3LNQA 4OOIA 1MSFC 2ADUA 4Y17A 3QU6A 4JI6H 3CJTB 4MV8A 3FMAA 3R5XA 1X9NA 1STZA 2R7QA 4OIRF 1N25A 1V4RA 1APLC 2PFBA 2RGRA 3RKYA 1ORKA 2PI0A 5DUIA 5LGTA 5KFLA 2BEOA 2CUJA 5J1YA 2VPLA 4XM3A 2M2EA 1S0MA 4NLGA 5C1PA 2BR0A 4YFNF 4AIJA 2DN0A 1EUDB 5H80A 2X48A 2UU9H 1WJEA 1EJ9A 2KSWA 4LFUA 4ZDLA 4FCYA 5ICFA 5EGOB 2JEIA 2DLNA 4Y13A 2CQNA 2R93G 1ZG5A 1DQUA 1ZRDA 1ZLKA 2P0AA 2BW3B 4F4WA 3PNVA 2DOAA 3DTKA 3CC7I 5JVTA 5EOYA 2P6SA 5LL6b 4BDYA 5EWGA 2LFBA 3OYGA 5KFJA 4AYBA 3ZR8X 2X1CA 2BY2A 3GTPJ 1GGOA 5D1OA 1M6VA 3F22A 4BNCA 3OSPA 5DD8A 2VR1A 1GYFA 3L2CA 2EFWA 3PUFA 5GAHJ 3LAPA 1R9TJ 2NRAC 1SFEA 1MSEC 4XLEA 3RQIA 4CZZA 3GTMJ 1W7PD 2GOMA 3V8JA 3KXYT 3ZRGA 1MJ9A 1ZG1A 2HQAA 3I58A 3C1DA 4EVIA 1MMSA 2VE9A 2W9CA 3F0CA 1ZN2A 2QK4A 4YR0A 2W8LA 3FXUA 5J8FA 4CXFA 1HLVA 1SAUA 3PN1A 5KNLA 4RLFA 3HOTA 1YTYA 3IP4B 3OIPA 2FSWA 5HV6A 3MR2A 3WG9A 2UXDH 1Z2OX
chains in the Genus database with same CATH topology
5LGNA 1ON1A 3BABA 3ZN1A 3DPTA 3I59A 3KETA 4A12A 3IRRA 4PCQA 2KIFA 3KLOA 2IJLA 4JI1H 2RNJA 2ZNZA 2HTJA 4KYWA 4HLYA 2FE3A 4DV6H 1KYWA 4KIBA 2CQKA 4DNCA 4DV2H 3J7AO 1F4KA 4RAYA 3N40P 3TDZC 1E4FT 1XCVA 4JV5H 1G6NA 4DV3H 1MZBA 2X4HA 2DK8A 2HOEA 3C18A 1R00A 2PJPA 5DCMA 2ETHA 1I1GA 1YW8A 1E17A 1F1ZA 2JSCA 2Y0MA 3TOBA 2IVMA 3ZMVA 5FLXW 2HYGD 4A5MA 4MQ9F 3WTXC 2JRTA 5AONA 4K0KH 5BOXA 3P9KA 5J6XA 2NNNA 3BA8A 2IA0A 3ZPLA 1C0WA 3T1HH 4XSXF 5A2QW 4QLCU 4PGGA 1VS0A 2ZO4A 3KZYA 1N36H 2MBFA 4N9HA 3GFMA 3F3XA 2MCTA 2MLKA 1DDNA 4AQYH 1HNXH 5FD6A 4NQWA 4I02A 4B3RH 1IN4A 5CVJA 1SFXA 3BPXA 4GKKH 4UV8A 2M30A 4AIHA 4LK0F 3S2WA 4FX4A 3V8KA 4GLXA 1O7LA 2NAZA 3F72A 3RIZA 4G94A 4A2UA 2P5KA 3LWFA 3N43B 1ZYRF 2JPBA 4L9TA 3KZZA 1BC8C 3SZPA 1XNQH 3WTWC 2EA2A 4DR3H 2EJRA 1FJGH 5KK1A 4BHBA 4HLXA 3E6MA 2WDTA 1ZHSA 4I7HA 3K9TA 1YLFA 1A0IA 4JQFA 4LF4H 1UB9A 3M7GA 2EFQA 2HZTA 3RDIA 4UUVA 2V9VA 1U6GA 3L9FA 2OAZA 3I0TA 2YPRA 1MD0A 3J81Z 1O57A 3CLOA 1WKMA 2HTSA 4GYGA 2VODA 5BR8H 5D8KB 1D3YA 4PDKA 2FA5A 4LF8H 1SD4A 4FX0A 3EETA 4UCVA 4FM9A 2LDUA 5TJJA 2RKHA 4FHTA 4HF1A 1YO5C 3BP8A 3AAFA 2XKPA 3O6BB 4EFEA 1FLIA 4EM2A 4APMA 2CG4A 3F8BA 3P9CA 4A6EA 2LSOA 1LQ1A 3SFZA 4UV9A 4LGWA 2UUBH 3C0FB 1ODDA 1K6OA 3V7RA 1K79A 2PG4A 3IWFA 2HHHH 2ISZA 3L4JA 1J5EH 4MEXF 5A2QK 1TLHB 3N4MA 4DV7H 4R1HA 4NB5A 2Z3YA 4OU0A 4XLPF 2UXNA 2ZCWA 1J75A 2FOKA 5L3CA 3C7JA 1FVIA 3E97A 1FC3A 3P7NA 1JGSA 4ON0A 4ESFA 1OKRA 3BJOA 4R79A 3KLNA 3KP6A 3GWZA 3U2RA 4DR7H 1FBQA 4EJVA 4DV0H 1OYWA 4G8XA 2ZNYA 2X0LA 1VTNC 1HKSA 4NHJA 5F64A 1ONVA 4KHPH 1LDKB 1R1VA 4DR1H 3QRFF 1KQ9A 4KIGA 4IHSA 3HHGA 1D8JA 1K7AA 3BWGA 3EQLF 1D8KA 2QQ9A 1Z2PX 2VE8A 1ZH5A 5FO5A 3DF8A 4NXMH 4L9NA 3RJ0A 5FFXA 2DFIA 3V7CA 4ZZLA 2V1XA 2PMUA 2B0LA 3WU0A 3FMRA 2UWMA 1XGMA 2VT3A 3M1EA 1T0FA 3I71A 6PAXA 2L01A 3ABUA 3ERED 3SHFA 3KFWX 1U78A 3PQKA 1V3FA 2ZXJA 2UUAH 2WE6A 4DV1H 1YS6A 2L4MA 2L54A 2XHKA 2PMHA 3RKXA 2ZMEA 4EQQA 3J80Z 4ESBA 2QQAA 1L3LA 2VT2A 4N0BA 3N41B 2D2WA 3E5QA 3E5UA 4CYDA 2W25A 3KP4A 4EJWA 5ICEA 1Z05A 3ZMUA 4LF7H 2WC2A 5EEHA 1CGPA 1FYKA 4JI0H 1X3UA 4G7HF 2OBPA 2XAHA 4F7ZA 4I0BA 2K4BA 1SMTA 1U3EM 1FPQA 4DUYH 2QVOA 3I54A 1IF1A 4I09A 3U1DA 4JI7H 3IL2A 5IT9W 3T8TA 3LQQA 2Z9OA 4LLNA 3ABTA 1Z2NX 5CJ9A 1UHMA 1KYZA 4EMSA 1GVJA 3I64A 4YG2F 1XGSA 4EM1A 3H3UA 5TRDA 4Q5SF 2DAOA 3TKYA 1RI7A 2XUBA 4JI4H 4Q4ZF 2QWWA 1U2WA 1S7AA 4RB2C 1YS7A 5ERIA 3L00A 1YW7A 5E8GA 3K1MA 2FNPA 1ZRCA 3GZ5A 1P6RA 2H6CA 2ESHA 4ENKA 4GCVA 4MTEA 3LSTA 1KU3A 3R6SA 1T6SA 5DDGA 1BGWA 1GHCA 1HW2A 2R3SA 2ZJ2A 2A6HF 4BHCA 5L3FA 2K02A 1XMKA 1O75A 1TA8A 1REPC 1O3QA 2YR2A 1TW3A 3F23A 2QYOA 3VB2A 2A6EF 2IT0A 5CVRA 4KN4X 2UZKA 3RI4A 1O7FA 4UCTA 4EGYA 3HYIA 3LFKA 4U88A 4L0ZB 2YSRA 3F8MA 3SQNA 3E6CC 3QP6A 4RGSA 2VBWA 3H20A 2CW0F 1LNWA 2A3SA 1YG2A 3RKWA 2DPDA 4MHGA 3LA7A 5D5UB 4I0AA 1R23A 3E6BA 2A07F 5LRSA 1MKMA 5BMZA 2M45A 2XAJA 1Z6RA 4TV7A 1L0OC 1P4WA 3I4PA 4XBFA 3DEUA 5K1YA 2DK5A 3E6DA 2P8TA 3TO6A 4UHTA 4RB0A 4XLNF 3TOAA 1MGTA 1UHWA 2FEZA 3CUQB 4ZYGA 3SZTA 1SFUA 1GXQA 4DUZH 3RTRA 2XVCA 3T0YA 3TGNA 3M8EA 2HDCA 4ZZDA 5FLXZ 4LF9H 3BJAA 5D6FA 2DPUA 2RN7A 2VOPA 4HV5A 3IKTA 4OIPF 5D1PA 5HS8A 4EJTA 1BC7C 4G6DA 1F5TA 1SAXA 5DYMA 1LEBA 4B3MH 4OMZA 3HRSA 3KCCA 1K78B 2KKOA 3LMLA 1BIAA 3JTHA 2DT5A 3JSNA 2Z5UA 1S29A 5E18F 3ELKA 1UFMA 3CUQC 2YCHA 4KFCA 3CVZA 1LEAA 3KP3A 1IRFA 4MNUA 3FHZA 1B59A 2VC1A 3DXJF 2WWYA 4KIFA 1BBYA 4Q48A 2KJCA 2ZBKA 3R4KA 1HKTA 4EEQA 2W24A 3QOPA 4HW0A 3HRUA 2V1DA 3K3VA 2AS5F 4EJUA 1W5SA 3LAJA 5K5OA 2HGCA 3V4GA 4RB3C 1LJ9A 1SEIA 5E1ZB 3GW2A 2BV6A 3HRMA 1RZ4A 2XASA 2DI3A 2VN2A 3KP2A 5BPDA 2IPQX 3M4IA 4PDBA 5A2QZ 1FSEA 2Q2TA 1ZGAA 3WGGA 3T1YH 3T1BA 1R5GA 5ILVA 2YU3A 5D5WB 4EV0A 2M5WA 5H6QA 2LNBA 3ZN0A 3GYHX 1FWZA 2Q2UA 3BROA 1U5TA 1BN5A 1HW5A 4LB6B 4U7BA 4NXNH 3I59B 1XDUA 2GAUA 2EV6A 1QNTA 3NRVA 1M0TA 3ZMDA 2ZM6H 2CGPA 2P5LC 4JYAH 4JI3H 4KICA 1IBLH 3LA3A 2P7CB 1GXPA 3K69A 2P6TA 2R7FA 3J7AK 1DPRA 3H92A 1Y0UA 4LLGF 1S7OA 1FYMA 2GIVA 3L4KA 3FXQA 4DR4H 3K1NA 5L3DA 4OMYA 2FBKA 1YQAA 3MFKA 1ULYA 1U5TB 3JAMZ 2Y48A 4RB1A 1IXCA 4O5VA 1B04A 4EJOA 1ZARA 1R7JA 3N42B 5HS9A 4P9UA 4DQ2A 4LFAH 2J5OA 1QQIA 1N34H 1TQMA 1I27A 1G3TA 4WCGA 3KEQA 1W4MA 3KE2A 2NS0A 1XB4A 2NYXA 3WTYC 1SD7A 1XDSA 2HEOA 2OU2A 4U0YA 1R1UA 5D5VB 4A6DA 1QZYA 1TW2A 4YY3H 4JI8H 4G9YA 1N32H 1WI9A 3IHUA 5FLXK 1I6XA 4G6QA 1TBXA 4M9ZA 2P4WA 3ZMSA 4OIOF 3BOQA 2HKOA 1FOKA 2EV0A 1FP1D 2K27A 2E7WA 3WE2A 4UVAA 4UCOA 4GKJH 1EH7A 2JTVA 1J2XA 1YYVA 3N97A 4HAMA 4XRFA 4U0VA 4UNOA 4RZQA 1U5TC 3JSOA 2O03A 2PQ8A 1FT9A 1IZ1A 3COAC 5FPOA 3BY6A 4M72A 5LHHA 3QPHA 5J8CA 4J0MA 5D8LB 1G4DA 3JAMW 3U9GA 3L7WA 2RVCA 2QENA 2ZJTA 1H9GA 3BPVA 1XMQH 1YIOA 4LH7A 1K78A 4MTDA 4OINF 2H6BA 1HSJA 4A2BA 2VBYA 1I94H 3O2PE 4L0YB 4G7ZF 3HTSB 3GFJA 3CO6C 4IRGA 2L4AA 1KQ0A 1IXSB 2GA1A 2XIGA 2L3DA 1DUXC 2H27A 1YW9A 4KA4A 3FM3A 2FNAA 4JI5H 3QAHA 1J0RA 3MZYA 3CUQA 3J81K 4LH6A 2HKXA 4IXAA 4MQVA 1RUOA 1Z91A 1T38A 1FZPB 5K5RA 2V79A 5F6FA 2XGXA 1O3SA 1HSTA 4ENMA 3Q9VA 2PLYA 1QBJA 5DCMB 3J80W 1FSHA 2OZUA 3JTGA 2FMYA 3R60A 5CYVA 3WODF 4KN7X 5E1WA 4JBAA 5HOOA 1OYIA 3WGIA 2Q8KA 5CVIA 4YHHH 2LKPA 1G3WA 2GA2A 2YX7A 3MAJA 2IRFG 2KJBA 2MA3A 2CWEA 3WTSC 3CJNA 3WE3A 2EV5A 1ZLJA 2FU4A 1DPUA 4HDVA 4ENNA 4IAJA 1XMAA 1WH2A 5EEGA 3UQ8A 3JSLA 4ZYDA 4BWSC 2GZWA 3DPLC 1FX7A 2E7XA 3DV8A 1LVAA 1ZRFA 2VBZA 5LMUH 3RGXA 2IA2A 2Z99A 3CDHA 3IC7A 4EGZA 2VQEH 5KVRA 4M9SA 5D4RA 1KA8A 2VOOA 5D4SA 4YFKF 3RPUA 3M8FA 5L3BA 4HYEA 1D5VA 2BGCA 3GF2A 2QM3A 3W6KB 2F5DA 3MZHA 4R7RA 4AIKA 5JHUA 5ICCA 3ZMTA 1QO0D 2M8EA 3EYIA 4MV7A 3IWZA 2O8XA 2A68F 1YFHA 4HDUA 3F8NA 2WYOA 3HUGA 4KNYA 4AD9A 2M1BA 3ULQB 4BXUA 1JE8A 1W7PB 3CTAA 4Q0YA 1R1TA 5ILUA 1N33H 3GLXA 4GXOA 2E5LH 2HR3A 4S05A 3WTZA 3WGHA 1BJAA 1ZG3A 4GGGA 2HWVA 4M6XA 2G9WA 5DD4A 3REOA 3RYPA 3N44B 3WTVC 3RGZA 1SD5A 3N6XA 3KAJA 4X65H 3E3VA 2CYYA 1ZHQA 2XRNA 1TTYA 2V6CA 2D1HA 2F4VH 4HF0A 1P4AA 1XDNA 3KP7A 5E8IA 3KP5A 1S6LA 1TQIA 2R7DA 1J5YA 3VODA 1AN7A 3D5LA 1IXRC 3R0JA 1R22A 5LBQA 2HGSA 4Y15A 3L09A 2BYVE 5H20A 1EH6A 2E1CA 3T5XA 3GVAA 5L3GA 3RF2A 3SXYA 3R61A 1RNLA 4CC6A 2CFXA 3HTUA 4HF2A 4IJAA 2JPCA 4LG0A 1XMOH 1KU7A 3TQNA 1BM9A 1P4XA 3B02A 5CVVA 2JT1A