3C0FB

Crystal structure of a novel non-pfam protein af1514 from archeoglobus fulgidus dsm 4304 solved by s-sad using a cr x-ray source
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
80
Chain Sequence
IMDEIVNLQKEVSLEEAERYANIASYGDGILLSVHDSTGYRAPEVYCCGEKPWEVYACNRGANLISVNQFEFYFRIEVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein AF_1514
publication title Crystal structure of a novel non-Pfam protein AF1514 from Archeoglobus fulgidus DSM 4304 solved by S-SAD using a Cr X-ray source.
pubmed doi rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Unknown function
total genus 17
structure length 80
sequence length 85
ec nomenclature
pdb deposition date 2008-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18505 DUF5619 Domain of unknown function (DUF5619)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.340 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3c0fB00
3C0FB
chains in the Genus database with same CATH superfamily
4IAJA 3PW2A 1P8LA 4R8UA 4YR2A 1UNNC 4J9LA 3BG5A 4DV5H 4LFCH 1OWTA 1V9PA 2NVXA 5J2UF 3FMAA 4FM9A 4DLKA 3OUZA 2ASLA 4JI3H 4QIWA 4X64H 5D1PA 2R87A 5KT3A 1KJ8A 2JA6A 4UCTA 1O75A 2R82A 4BY1G 3V6HA 5LOVF 4YY3H 5HBRB 4Q0YA 5C1OA 5JVDF 2J6SA 4A3CG 1ZHQA 2FPGB 4QW9A 2BQRA 2DPJA 2R8KA 2R84A 4I50F 3PO2G 3EPGA 3I4MG 4ECUA 2W7PA 3G6XA 3SE7A 1B33N 2ASDA 2Q2TA 1W96A 2R6FA 3HKZA 5FLXW 1BNCA 3TQTA 1EUDB 4A3MG 2FK1A 4DV7H 4R7RA 2ALZA 2E2IA 4IHJF 5KG6A 3RTXA 5EWGA 4DR2H 4QIWE 3RFCA 4MV3A 1L2ZA 2YW2A 5KG5A 3T5JA 1S10A 5D1OA 5L1JA 2UUAH 4JI0H 4ED2A 2YRXA 2R8GA 3R5HA 5H80A 4RB2C 3OUUA 3U9TA 4Q44A 1VS0A 3M9NB 3GIJA 2WDTA 5C4XG 5CB4F 2W9BB 1S0NA 2R8JA 3GTOA 4JV5H 2XCLA 1Y14B 4RAYA 5EZYF 4A3BG 3HKZE 1V4YA 1DGSA 4O2BF 4AYBA 4C5BA 1GSAA 3GV7B 1JDBB 2AU0A 4L1KA 1IOWA 2GPWA 2ZM6H 4NXNH 3H40A 2AQ4A 5KFQA 2E2HA 1TWHA 2R7NA 3N6XA 2V9WA 3BQ2A 2IMWP 1JIHA 4ZQIA 1KJIA 1S9FA 4JV2A 5EDWA 4YP3A 2FMAA 2W9CA 1Y1VG 3JAMW 1RJRA 3GTKA 4UCVA 2PMZA 2JEGA 4RU9A 1I94H 2MCTA 2C35B 4O4IF 4RUCA 2NVYA 4QWAA 1C30A 4GC6A 3GIQA 3V4SA 1EZ1A 4YAJB 3PVXA 2FE3A 2ZJTA 1M7JA 2WAQA 4Q43A 3JSNA 2CQYA 5DQHA 1JKJB 1SEIA 3GIMA 1WH2A 3RJ0A 4LFAH 5IT9W 4YBZB 1IBLH 5F9NA 5IYDG 2VQEH 3H4BA 5KFFA 5L1LA 2QK4A 2CKZB 1FVIA 1Z2OX 1S0OA 4RUAA 1GSHA 2FPIB 3RBEA 3OSPA 4J9SA 1E4EA 3GIPA 4TQRA 4J9PA 2C2EA 1A0IA 5KT7A 3HOZG 2R7ZG 4FS1A 3I12A 5C44G 3PR5B 2XGQA 2C00A 4B3RH 1C3OA 3BABA 1HNZH 3KAKA 5KG4A 5KFZA 4ETSA 4EFBA 4JYAH 3ORQA 5FLMG 4U7CA 3H4DA 2V5AA 4TV9F 3H20A 5L9XA 4ZI7F 3M4IA 1R9TA 2RDJA 4C5AA 2XIGA 3GTQA 4EYHB 4ECRA 2JEJA 2RGVA 2YL2A 3TINA 3RAQA 1V51A 2JA5A 2OH2A 4UCOA 4WBNF 4HYKA 2B63A 3H0GG 1RJPA 1GYFA 4ECTA 2W6NA 5C1PA 2PBZA 4MV1A 4DV1H 4EYIB 2NU9B 1BJTA 4F4WA 2R92G 5JH7F 4XZ3B 4LH7A 1GO3E 3KALA 2CW7A 2FB9A 4UCUA 2NU7B 3MWMA 1ZHSA 3QZ8A 1Y1WG 4MV6A 4O4LF 4XYLB 4Y8VB 1I3QA 2YZMA 1E4GT 4J9OA 2FP4B 5LL6b 3KTMA 5I47A 4X65H 5FPRA 1E4FT 4LSAA 5HV6A 1N56A 1N34H 2WYOA 2YZNA 2R93G 1UC8A 3HXLA 4ECVA 4MTEA 5KFLA 4QWCA 3GTMA 4HNTA 4ECZA 1SCUB 4JV0A 4C2MA 1PK8A 4ZHQF 4RNOA 4DR3H 1SFOA 5DGBA 5IP9G 4PDBA 5IP7G 2Y0SE 2Q2UA 1KJJA 4IZOA 1MZBA 3V4ZA 1VBHA 3LWBA 4ED6A 5LYJF 4ED7A 4FBTA 5KFPA 3Q8QB 1TWAA 3MWEA 4F4YA 2VA2A 1CQIB 2XC9A 3L2PA 1TWFA 2R8IA 5BMVF 3N43B 1TWGA 2OWOA 4YJ3F 3PR4A 4MV8A 4R8UB 3T1YH 3J80W 2JA7A 2QYZA 4DL6A 4J9MA 1HNWH 4APMA 5KT5A 2SCUB 3MR3A 5KFDA 4RNNA 2JEFA 4J0MA 3OHBA 3KHHA 3N8DA 4HNVA 3RGZA 3HOUG 2NU6B 5LXTF 5KFCA 3VPDA 2VQDA 4F4XA 2FLLA 4IR9A 3GTLA 3ORRA 2WE6A 4DL7A 1XMQH 2I8CA 2VUGA 4MAMA 4O4HF 4Q8FA 2BQUA 3L4KA 2YS6A 5DG8A 4O3SA 4A3KG 3HOYG 2W9BA 3H0GA 3PW4A 5IYZF 4FBUA 4MA5A 5KKNB 1B04A 2PN1A 4HR7A 5KFIA 5KFNA 1TWCA 1T3NA 5KFUA 2HVQA 1K1QA 4J9RA 5DQGA 4UFZA 1JLLB 5KG7A 3K5IA 1RYRA 3LMLA 5KFWA 3HOXG 2C28A 5FJ8G 4MV9A 1TA8A 5EWFA 1HR0H 5BPFA 2CZGA 3K3PA 3Q8SB 4A3JG 5L1IA 4ED0A 5DG9A 4LF4H 5KFYA 4JV1A 1KBLA 4UCSA 1JDEA 1FJGH 2VPSA 3V6KA 4U6PA 4FS2A 5KFOA 4E4TA 4EBDA 1ZETA 1VBGA 3RV3A 4A2AA 3KHGA 4LF7H 1BXRA 4A3IG 3VPBA 1CE8A 3G6VA 4DL3A 5BR8H 3RB6A 3NGDA 3R23A 5L1KA 1TAEA 2YCHA 2IBKA 1VKZA 4BWSC 2P0AA 2UXDH 1UC9A 2DWCA 3Q8RB 3N40P 4LMYA 3HOWG 3LP8A 1XDNA 3WO0A 3MR2A 4DL5A 4JUZA 4IRKA 5EOYA 4DR7H 3N41B 1KJQA 3GLKA 2YS7A 1JXLA 3JRXA 3RIZA 4NLGA 4BBSG 3U9SA 5J2TF 4EFEA 1BGWA 3PN1A 3H3VH 2DZDA 4ECXA 3QZ7A 1S03G 3KXYT 2V4QA 3EYYA 2YU9A 3CQZA 4NXMH 5KFMA 4DV0H 4Q8EA 2M05A 2R85A 3HOVG 3K3VA 2F4VH 3BJYA 3JRWA 4HNUA 5JQWA 2ZDHA 3MFIA 3R5FA 1EUCB 3L4JA 2UVRA 2RGRA 4ME6A 2UUCH 1N32H 4DL2A 4LSXA 4TUYF 3MR5A 1PX2A 3TIIA 4OX9H 4EG0A 4YAKB 3BA9A 4QWEA 4RNMA 5CA1F 4DV2H 2DIKA 3WNZA 2KSWA 2UVWA 4IWXA 3GV5B 2E5LH 4IRDA 5FD6A 2FLPA 2RDIA 4X62H 1KC7A 4J9QA 2W9AA 1XNRH 2IA6A 4GKKH 2Y0SA 5LP6F 4EEQA 3ETHA 1RYSA 3CVZA 5K2MA 1IBKH 1FKAH 5KFSA 2GLTA 3HB9A 2ASJA 3FKIG 1KEEA 2UVVA 1RK6A 1Y1VA 5DLGA 3R5XA 4DR4H 5KFKA 4QW8A 5KX5F 5KFXA 4MTDA 3Q2OA 4TV8F 1GLVA 3BA8A 1GSOA 2W6PA 4JI5H 2W6ZA 2ATLA 1VAJA 5KFGA 5KFEA 4O3QA 5EWEA 4BXXG 3TIGA 3EPIA 3RB3A 3MJFA 4ED1A 1AUVA 4X66H 3DF7A 4LH6A 3QFFA 4ZOLF 5FPOA 2W8LA 5DQIA 4MA0A 2BR0A 3GIIA 3RGXA 4I7HA 3UQ8A 1WSCA 3UFXB 4WD3A 4YQWA 1DV2A 3GV8B 2W57A 4RZRA 1N36H 4O3OA 2R86A 1T94A 3M9MB 2GPSA 4FU0A 1WR2A 1I50A 4EBCA 2V59A 3PO3G 4J9KA 4YR3A 2OLSA 2HVRA 1EYZA 2R7ZA 2FK3A 4DV3H 1RJQA 5IYCG 2O03A 3VPCA 2UXCH 4QWDA 3JZIA 3RB4A 3MWDA 3Q8PB 5KFVA 2VR1A 4ECSA 3RAXA 4GLXA 1X9NA 2J6UA 3GILA 4YR0A 1A9XA 1WCMG 1EHIA 3IN5A 3TQ1A 2ZDQA 2DPIA 1M0TA 4F50A 1I7LA 4DV4H 2WB1A 4K0KH 2UXBH 2W71A 4YHHH 2J6TA 4BY7G 4LFBH 1M6VA 5IYBG 5KG3A 3WO1A 4A3DG 1S0MA 3KHRA 1T36A 4RZQA 4C5CA 2BQ3A 4JI8H 5F9LA 4ED3A 3BQ0A 5JUMA 3G6YA 3C0FB 1S68A 2I87A 2XGPA 5LMNH 4JI1H 2DLNA 2W6QA 2JA8G 2R92A 2UVUA 4HQ6A 2W7OA 2WTFA 1HNXH 4B3MH 3HBLA 2YZGA 5KT6A 4F4ZA 4LF6H 3GTPA 3N44B 3IG0A 4MV7A 2FLNA 2W70A 1Y1WA 3RV4A 3T5KA 4DR5H 4YJ2F 4RB0A 1GGOA 2WB1E 3FKIA 4I55F 1K1SA 2HJWA 4QJFA 5D1OB 4M7EA 5KFBA 5LMUH 3RF2A 3SI8A 4IR1A 4O2AF 2JA5G 4AQYH 3GIDA 2YRWA 1M0WA 4UCRA 2R93A 3Q1KA 2V4RA 4Q45A 3PW7A 4XYMB 3FDSA 2C2RA 4KHPH 2B63G 2I80A 4RB1A 4J9NA 3JSLA 4M9UA 2AGPA 1IOVA 2PVPA 4XX0B 1JX4A 4GKJH 2FKLA 1DV1A 2XCPA 2AGOA 2VUMG 2HGSA 5BPHA 5CAEB 2CW8A 2W8KA 4ECQA 3I4NG 4A3EG 1J5EH 3GTJA 1AUXA 4DUZH 2W6OA 1ZQ7A 2FJZA 4BBRG 4B3TH 4JI4H 3VMMA 3BAAA 5IWAH 3T5HA 1N48A 2IP4A 3AYHB 2W9CB 4A93G 4ECWA 2R7MA 5JVLA 4ED8A 1SYXB 3J7AK 1B6RA 1Z2PX 5KG1A 4A3LG 3OHAA 1B6SA 4GC7A 4DR6H 4AYBE 1AN7A 4EEYA 5CA0F 4O3PA 2ZDGA 4IRCA 4JI6H 1WCMA 3MR6A 3GQCA 4LF8H 5KFHA 5KT4A 4TQSA 3RBDA 2XD4A 2VQFH 5FD5A 4ECYA 2AGQA 2JA6G 4IWYA 2VOBA 5C3EG 1DIKA 5LA6F 5DGAA 3OSNA 1I6UA 4JI2H 5KFRA 1K83A 5C8YF 4MV4A 2VPQA 2W6MA 5KFJA 4LF9H 3PW0A 2C22A 3F8NA 4I4TF 1CS0A 2PMZE 3M9OB 4LF5H 4G3IA 1E4EB 5A2QW 2YYAA 1XNQH 2FPPB 2JA7G 3RUPA 4B3SH 4O3NA 2RF4A 1I7NA 5D8DA 4EGJA 4DL4A 4CC6A 2WAQE 5KG0A 2JEIA 3PW5A 2R7LA 3KHLA 2UU9H 1CQJB 1W93A 2UUBH 1KJ9A 5KFAA 5KFTA 2HVSA 5T14A 3BQ1A 1RK5A 3V6JA 3MFHA 4JI7H 1IBMH 3N42B 1Z2NX 4EGQA 5GONF 3OTOH 2XCAA 3PZPA 2V58A 4O3RA 3J81W 5C5JA 3E5NA 4A3FG 4CC5A 2FK2A 2R7KA 3RB0A 3GTGA 4RB3C 3GIKA 4YB8B 3K5HA 3T5LA 2VUMA 2VA3A 5KG2A 4EBEA 5DG7A 4RAZA 4A3GG 1S97A 3T1HH 2J9GA 4A2BA 4DUYH 2HHHH 1N33H 4DR1H 2R8HA 2NU8B 2X0SA 4DV6H 4PWQA 1ULZA 5KT2A 5DLFA 3KAJA 4QWBA 2NUAB 1XMOH 3G8CA 3ETJA 2C2DA
chains in the Genus database with same CATH topology
3M4IA 4IAJA 2XIGA 1P8LA 5BR8H 1HNXH 4B3MH 2RGVA 1TAEA 2YCHA 4LF6H 3N44B 3IG0A 4BWSC 4MV7A 4UCOA 4DV5H 4LFCH 2UXDH 1V9PA 3N40P 4LMYA 4RB0A 4DR5H 1GYFA 4FM9A 1XDNA 3FMAA 4DV1H 5EOYA 5D1OB 4M7EA 4JI3H 1BJTA 3N41B 5D1PA 4X64H 5LMUH 3RF2A 3RIZA 4UCTA 1O75A 4LH7A 1BGWA 3PN1A 3KALA 4EFEA 2CW7A 4AQYH 1M0WA 4UCUA 4UCRA 3MWMA 4YY3H 1ZHSA 1S03G 3KXYT 4Q0YA 3EYYA 4KHPH 4RB1A 1ZHQA 3JSLA 1E4GT 4NXMH 5LL6b 4DV0H 4GKJH 3K3VA 4X65H 4LF7H 2F4VH 5FPRA 1E4FT 4LSAA 2Q2TA 2HGSA 5FLXW 2CW8A 1N34H 2WYOA 3L4JA 4DV7H 4R7RA 2RGRA 1J5EH 4DUZH 3HXLA 3RTXA 4MTEA 4DR2H 4B3TH 4JI4H 2UUCH 1N32H 3BAAA 5IWAH 1L2ZA 4LSXA 5D1OA 4DR3H 2UUAH 4OX9H 4JI0H 3BA9A 4PDBA 2Q2UA 1SYXB 4RB2C 4DV2H 1MZBA 3J7AK 2KSWA 1VS0A 2E5LH 1Z2PX 5FD6A 4GKKH 4X62H 4JYAH 1XNRH 4DR6H 2WDTA 4EEQA 1AN7A 3CVZA 4LF8H 1IBKH 1FKAH 4JI6H 3L2PA 4JV5H 4RAYA 3N43B 1DGSA 2OWOA 4DR7H 2VQFH 5FD5A 4NXNH 4DR4H 2ZM6H 3T1YH 3J80W 2VOBA 4MTDA 1HNWH 3N6XA 1I6UA 4JI2H 3BA8A 4APMA 4JI5H 4LF9H 4J0MA 3F8NA 3RGZA 4LF5H 3JAMW 5A2QW 3DF7A 4LH6A 5FPOA 4UCVA 4X66H 1XNQH 3RGXA 4B3SH 2WE6A 4I7HA 1XMQH 3UQ8A 2VUGA 2MCTA 1I94H 3L4KA 1N36H 2W57A 4CC6A 2FE3A 2ZJTA 2UU9H 2UUBH 1B04A 2HVRA 2HVSA 3JSNA 4DV3H 4JI7H 2O03A 1SEIA 2HVQA 2UXCH 1IBMH 3N42B 1WH2A 4UFZA 1Z2NX 3RJ0A 4LFAH 5IT9W 3OTOH 3LMLA 1IBLH 2VQEH 3J81W 4GLXA 4MV9A 1TA8A 1X9NA 1FVIA 1Z2OX 4CC5A 1HR0H 4RB3C 1A0IA 1M0TA 4DV4H 4LF4H 4K0KH 2UXBH 4RAZA 4YHHH 4LFBH 3T1HH 4B3RH 4UCSA 4A2BA 2VPSA 4RZQA 4DUYH 2HHHH 3BABA 4DR1H 1HNZH 4JI8H 1FJGH 3KAKA 1N33H 4DV6H 4ETSA 1XMOH 3KAJA 4EFBA 3C0FB 1S68A 4A2AA 4JI1H 5LMNH 3H20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0F B; 
#chains in the Genus database with same CATH topology
 4IAJ A;  3PW2 A;  1P8L A;  4R8U A;  4YR2 A;  1UNN C;  4J9L A;  3BG5 A;  4DV5 H;  4LFC H;  1OWT A;  1V9P A;  2NVX A;  5J2U F;  3FMA A;  4FM9 A;  4DLK A;  3OUZ A;  2ASL A;  4JI3 H;  4QIW A;  4X64 H;  5D1P A;  2R87 A;  5KT3 A;  1KJ8 A;  2JA6 A;  4UCT A;  1O75 A;  2R82 A;  4BY1 G;  3V6H A;  5LOV F;  4YY3 H;  5HBR B;  4Q0Y A;  5C1O A;  5JVD F;  2J6S A;  4A3C G;  1ZHQ A;  2FPG B;  4QW9 A;  2BQR A;  2DPJ A;  2R8K A;  2R84 A;  4I50 F;  3PO2 G;  3EPG A;  3I4M G;  4ECU A;  2W7P A;  3G6X A;  3SE7 A;  1B33 N;  2ASD A;  2Q2T A;  1W96 A;  2R6F A;  3HKZ A;  5FLX W;  1BNC A;  3TQT A;  1EUD B;  4A3M G;  2FK1 A;  4DV7 H;  4R7R A;  2ALZ A;  2E2I A;  4IHJ F;  5KG6 A;  3RTX A;  5EWG A;  4DR2 H;  4QIW E;  3RFC A;  4MV3 A;  1L2Z A;  2YW2 A;  5KG5 A;  3T5J A;  1S10 A;  5D1O A;  5L1J A;  2UUA H;  4JI0 H;  4ED2 A;  2YRX A;  2R8G A;  3R5H A;  5H80 A;  4RB2 C;  3OUU A;  3U9T A;  4Q44 A;  1VS0 A;  3M9N B;  3GIJ A;  2WDT A;  5C4X G;  5CB4 F;  2W9B B;  1S0N A;  2R8J A;  3GTO A;  4JV5 H;  2XCL A;  1Y14 B;  4RAY A;  5EZY F;  4A3B G;  3HKZ E;  1V4Y A;  1DGS A;  4O2B F;  4AYB A;  4C5B A;  1GSA A;  3GV7 B;  1JDB B;  2AU0 A;  4L1K A;  1IOW A;  2GPW A;  2ZM6 H;  4NXN H;  3H40 A;  2AQ4 A;  5KFQ A;  2E2H A;  1TWH A;  2R7N A;  3N6X A;  2V9W A;  3BQ2 A;  2IMW P;  1JIH A;  4ZQI A;  1KJI A;  1S9F A;  4JV2 A;  5EDW A;  4YP3 A;  2FMA A;  2W9C A;  1Y1V G;  3JAM W;  1RJR A;  3GTK A;  4UCV A;  2PMZ A;  2JEG A;  4RU9 A;  1I94 H;  2MCT A;  2C35 B;  4O4I F;  4RUC A;  2NVY A;  4QWA A;  1C30 A;  4GC6 A;  3GIQ A;  3V4S A;  1EZ1 A;  4YAJ B;  3PVX A;  2FE3 A;  2ZJT A;  1M7J A;  2WAQ A;  4Q43 A;  3JSN A;  2CQY A;  5DQH A;  1JKJ B;  1SEI A;  3GIM A;  1WH2 A;  3RJ0 A;  4LFA H;  5IT9 W;  4YBZ B;  1IBL H;  5F9N A;  5IYD G;  2VQE H;  3H4B A;  5KFF A;  5L1L A;  2QK4 A;  2CKZ B;  1FVI A;  1Z2O X;  1S0O A;  4RUA A;  1GSH A;  2FPI B;  3RBE A;  3OSP A;  4J9S A;  1E4E A;  3GIP A;  4TQR A;  4J9P A;  2C2E A;  1A0I A;  5KT7 A;  3HOZ G;  2R7Z G;  4FS1 A;  3I12 A;  5C44 G;  3PR5 B;  2XGQ A;  2C00 A;  4B3R H;  1C3O A;  3BAB A;  1HNZ H;  3KAK A;  5KG4 A;  5KFZ A;  4ETS A;  4EFB A;  4JYA H;  3ORQ A;  5FLM G;  4U7C A;  3H4D A;  2V5A A;  4TV9 F;  3H20 A;  5L9X A;  4ZI7 F;  3M4I A;  1R9T A;  2RDJ A;  4C5A A;  2XIG A;  3GTQ A;  4EYH B;  4ECR A;  2JEJ A;  2RGV A;  2YL2 A;  3TIN A;  3RAQ A;  1V51 A;  2JA5 A;  2OH2 A;  4UCO A;  4WBN F;  4HYK A;  2B63 A;  3H0G G;  1RJP A;  1GYF A;  4ECT A;  2W6N A;  5C1P A;  2PBZ A;  4MV1 A;  4DV1 H;  4EYI B;  2NU9 B;  1BJT A;  4F4W A;  2R92 G;  5JH7 F;  4XZ3 B;  4LH7 A;  1GO3 E;  3KAL A;  2CW7 A;  2FB9 A;  4UCU A;  2NU7 B;  3MWM A;  1ZHS A;  3QZ8 A;  1Y1W G;  4MV6 A;  4O4L F;  4XYL B;  4Y8V B;  1I3Q A;  2YZM A;  1E4G T;  4J9O A;  2FP4 B;  5LL6 b;  3KTM A;  5I47 A;  4X65 H;  5FPR A;  1E4F T;  4LSA A;  5HV6 A;  1N56 A;  1N34 H;  2WYO A;  2YZN A;  2R93 G;  1UC8 A;  3HXL A;  4ECV A;  4MTE A;  5KFL A;  4QWC A;  3GTM A;  4HNT A;  4ECZ A;  1SCU B;  4JV0 A;  4C2M A;  1PK8 A;  4ZHQ F;  4RNO A;  4DR3 H;  1SFO A;  5DGB A;  5IP9 G;  4PDB A;  5IP7 G;  2Y0S E;  2Q2U A;  1KJJ A;  4IZO A;  1MZB A;  3V4Z A;  1VBH A;  3LWB A;  4ED6 A;  5LYJ F;  4ED7 A;  4FBT A;  5KFP A;  3Q8Q B;  1TWA A;  3MWE A;  4F4Y A;  2VA2 A;  1CQI B;  2XC9 A;  3L2P A;  1TWF A;  2R8I A;  5BMV F;  3N43 B;  1TWG A;  2OWO A;  4YJ3 F;  3PR4 A;  4MV8 A;  4R8U B;  3T1Y H;  3J80 W;  2JA7 A;  2QYZ A;  4DL6 A;  4J9M A;  1HNW H;  4APM A;  5KT5 A;  2SCU B;  3MR3 A;  5KFD A;  4RNN A;  2JEF A;  4J0M A;  3OHB A;  3KHH A;  3N8D A;  4HNV A;  3RGZ A;  3HOU G;  2NU6 B;  5LXT F;  5KFC A;  3VPD A;  2VQD A;  4F4X A;  2FLL A;  4IR9 A;  3GTL A;  3ORR A;  2WE6 A;  4DL7 A;  1XMQ H;  2I8C A;  2VUG A;  4MAM A;  4O4H F;  4Q8F A;  2BQU A;  3L4K A;  2YS6 A;  5DG8 A;  4O3S A;  4A3K G;  3HOY G;  2W9B A;  3H0G A;  3PW4 A;  5IYZ F;  4FBU A;  4MA5 A;  5KKN B;  1B04 A;  2PN1 A;  4HR7 A;  5KFI A;  5KFN A;  1TWC A;  1T3N A;  5KFU A;  2HVQ A;  1K1Q A;  4J9R A;  5DQG A;  4UFZ A;  1JLL B;  5KG7 A;  3K5I A;  1RYR A;  3LML A;  5KFW A;  3HOX G;  2C28 A;  5FJ8 G;  4MV9 A;  1TA8 A;  5EWF A;  1HR0 H;  5BPF A;  2CZG A;  3K3P A;  3Q8S B;  4A3J G;  5L1I A;  4ED0 A;  5DG9 A;  4LF4 H;  5KFY A;  4JV1 A;  1KBL A;  4UCS A;  1JDE A;  1FJG H;  2VPS A;  3V6K A;  4U6P A;  4FS2 A;  5KFO A;  4E4T A;  4EBD A;  1ZET A;  1VBG A;  3RV3 A;  4A2A A;  3KHG A;  4LF7 H;  1BXR A;  4A3I G;  3VPB A;  1CE8 A;  3G6V A;  4DL3 A;  5BR8 H;  3RB6 A;  3NGD A;  3R23 A;  5L1K A;  1TAE A;  2YCH A;  2IBK A;  1VKZ A;  4BWS C;  2P0A A;  2UXD H;  1UC9 A;  2DWC A;  3Q8R B;  3N40 P;  4LMY A;  3HOW G;  3LP8 A;  1XDN A;  3WO0 A;  3MR2 A;  4DL5 A;  4JUZ A;  4IRK A;  5EOY A;  4DR7 H;  3N41 B;  1KJQ A;  3GLK A;  2YS7 A;  1JXL A;  3JRX A;  3RIZ A;  4NLG A;  4BBS G;  3U9S A;  5J2T F;  4EFE A;  1BGW A;  3PN1 A;  3H3V H;  2DZD A;  4ECX A;  3QZ7 A;  1S03 G;  3KXY T;  2V4Q A;  3EYY A;  2YU9 A;  3CQZ A;  4NXM H;  5KFM A;  4DV0 H;  4Q8E A;  2M05 A;  2R85 A;  3HOV G;  3K3V A;  2F4V H;  3BJY A;  3JRW A;  4HNU A;  5JQW A;  2ZDH A;  3MFI A;  3R5F A;  1EUC B;  3L4J A;  2UVR A;  2RGR A;  4ME6 A;  2UUC H;  1N32 H;  4DL2 A;  4LSX A;  4TUY F;  3MR5 A;  1PX2 A;  3TII A;  4OX9 H;  4EG0 A;  4YAK B;  3BA9 A;  4QWE A;  4RNM A;  5CA1 F;  4DV2 H;  2DIK A;  3WNZ A;  2KSW A;  2UVW A;  4IWX A;  3GV5 B;  2E5L H;  4IRD A;  5FD6 A;  2FLP A;  2RDI A;  4X62 H;  1KC7 A;  4J9Q A;  2W9A A;  1XNR H;  2IA6 A;  4GKK H;  2Y0S A;  5LP6 F;  4EEQ A;  3ETH A;  1RYS A;  3CVZ A;  5K2M A;  1IBK H;  1FKA H;  5KFS A;  2GLT A;  3HB9 A;  2ASJ A;  3FKI G;  1KEE A;  2UVV A;  1RK6 A;  1Y1V A;  5DLG A;  3R5X A;  4DR4 H;  5KFK A;  4QW8 A;  5KX5 F;  5KFX A;  4MTD A;  3Q2O A;  4TV8 F;  1GLV A;  3BA8 A;  1GSO A;  2W6P A;  4JI5 H;  2W6Z A;  2ATL A;  1VAJ A;  5KFG A;  5KFE A;  4O3Q A;  5EWE A;  4BXX G;  3TIG A;  3EPI A;  3RB3 A;  3MJF A;  4ED1 A;  1AUV A;  4X66 H;  3DF7 A;  4LH6 A;  3QFF A;  4ZOL F;  5FPO A;  2W8L A;  5DQI A;  4MA0 A;  2BR0 A;  3GII A;  3RGX A;  4I7H A;  3UQ8 A;  1WSC A;  3UFX B;  4WD3 A;  4YQW A;  1DV2 A;  3GV8 B;  2W57 A;  4RZR A;  1N36 H;  4O3O A;  2R86 A;  1T94 A;  3M9M B;  2GPS A;  4FU0 A;  1WR2 A;  1I50 A;  4EBC A;  2V59 A;  3PO3 G;  4J9K A;  4YR3 A;  2OLS A;  2HVR A;  1EYZ A;  2R7Z A;  2FK3 A;  4DV3 H;  1RJQ A;  5IYC G;  2O03 A;  3VPC A;  2UXC H;  4QWD A;  3JZI A;  3RB4 A;  3MWD A;  3Q8P B;  5KFV A;  2VR1 A;  4ECS A;  3RAX A;  4GLX A;  1X9N A;  2J6U A;  3GIL A;  4YR0 A;  1A9X A;  1WCM G;  1EHI A;  3IN5 A;  3TQ1 A;  2ZDQ A;  2DPI A;  1M0T A;  4F50 A;  1I7L A;  4DV4 H;  2WB1 A;  4K0K H;  2UXB H;  2W71 A;  4YHH H;  2J6T A;  4BY7 G;  4LFB H;  1M6V A;  5IYB G;  5KG3 A;  3WO1 A;  4A3D G;  1S0M A;  3KHR A;  1T36 A;  4RZQ A;  4C5C A;  2BQ3 A;  4JI8 H;  5F9L A;  4ED3 A;  3BQ0 A;  5JUM A;  3G6Y A;  3C0F B;  1S68 A;  2I87 A;  2XGP A;  5LMN H;  4JI1 H;  2DLN A;  2W6Q A;  2JA8 G;  2R92 A;  2UVU A;  4HQ6 A;  2W7O A;  2WTF A;  1HNX H;  4B3M H;  3HBL A;  2YZG A;  5KT6 A;  4F4Z A;  4LF6 H;  3GTP A;  3N44 B;  3IG0 A;  4MV7 A;  2FLN A;  2W70 A;  1Y1W A;  3RV4 A;  3T5K A;  4DR5 H;  4YJ2 F;  4RB0 A;  1GGO A;  2WB1 E;  3FKI A;  4I55 F;  1K1S A;  2HJW A;  4QJF A;  5D1O B;  4M7E A;  5KFB A;  5LMU H;  3RF2 A;  3SI8 A;  4IR1 A;  4O2A F;  2JA5 G;  4AQY H;  3GID A;  2YRW A;  1M0W A;  4UCR A;  2R93 A;  3Q1K A;  2V4R A;  4Q45 A;  3PW7 A;  4XYM B;  3FDS A;  2C2R A;  4KHP H;  2B63 G;  2I80 A;  4RB1 A;  4J9N A;  3JSL A;  4M9U A;  2AGP A;  1IOV A;  2PVP A;  4XX0 B;  1JX4 A;  4GKJ H;  2FKL A;  1DV1 A;  2XCP A;  2AGO A;  2VUM G;  2HGS A;  5BPH A;  5CAE B;  2CW8 A;  2W8K A;  4ECQ A;  3I4N G;  4A3E G;  1J5E H;  3GTJ A;  1AUX A;  4DUZ H;  2W6O A;  1ZQ7 A;  2FJZ A;  4BBR G;  4B3T H;  4JI4 H;  3VMM A;  3BAA A;  5IWA H;  3T5H A;  1N48 A;  2IP4 A;  3AYH B;  2W9C B;  4A93 G;  4ECW A;  2R7M A;  5JVL A;  4ED8 A;  1SYX B;  3J7A K;  1B6R A;  1Z2P X;  5KG1 A;  4A3L G;  3OHA A;  1B6S A;  4GC7 A;  4DR6 H;  4AYB E;  1AN7 A;  4EEY A;  5CA0 F;  4O3P A;  2ZDG A;  4IRC A;  4JI6 H;  1WCM A;  3MR6 A;  3GQC A;  4LF8 H;  5KFH A;  5KT4 A;  4TQS A;  3RBD A;  2XD4 A;  2VQF H;  5FD5 A;  4ECY A;  2AGQ A;  2JA6 G;  4IWY A;  2VOB A;  5C3E G;  1DIK A;  5LA6 F;  5DGA A;  3OSN A;  1I6U A;  4JI2 H;  5KFR A;  1K83 A;  5C8Y F;  4MV4 A;  2VPQ A;  2W6M A;  5KFJ A;  4LF9 H;  3PW0 A;  2C22 A;  3F8N A;  4I4T F;  1CS0 A;  2PMZ E;  3M9O B;  4LF5 H;  4G3I A;  1E4E B;  5A2Q W;  2YYA A;  1XNQ H;  2FPP B;  2JA7 G;  3RUP A;  4B3S H;  4O3N A;  2RF4 A;  1I7N A;  5D8D A;  4EGJ A;  4DL4 A;  4CC6 A;  2WAQ E;  5KG0 A;  2JEI A;  3PW5 A;  2R7L A;  3KHL A;  2UU9 H;  1CQJ B;  1W93 A;  2UUB H;  1KJ9 A;  5KFA A;  5KFT A;  2HVS A;  5T14 A;  3BQ1 A;  1RK5 A;  3V6J A;  3MFH A;  4JI7 H;  1IBM H;  3N42 B;  1Z2N X;  4EGQ A;  5GON F;  3OTO H;  2XCA A;  3PZP A;  2V58 A;  4O3R A;  3J81 W;  5C5J A;  3E5N A;  4A3F G;  4CC5 A;  2FK2 A;  2R7K A;  3RB0 A;  3GTG A;  4RB3 C;  3GIK A;  4YB8 B;  3K5H A;  3T5L A;  2VUM A;  2VA3 A;  5KG2 A;  4EBE A;  5DG7 A;  4RAZ A;  4A3G G;  1S97 A;  3T1H H;  2J9G A;  4A2B A;  4DUY H;  2HHH H;  1N33 H;  4DR1 H;  2R8H A;  2NU8 B;  2X0S A;  4DV6 H;  4PWQ A;  1ULZ A;  5KT2 A;  5DLF A;  3KAJ A;  4QWB A;  2NUA B;  1XMO H;  3G8C A;  3ETJ A;  2C2D A; 
#chains in the Genus database with same CATH homology
 3M4I A;  4IAJ A;  2XIG A;  1P8L A;  5BR8 H;  1HNX H;  4B3M H;  2RGV A;  1TAE A;  2YCH A;  4LF6 H;  3N44 B;  3IG0 A;  4BWS C;  4MV7 A;  4UCO A;  4DV5 H;  4LFC H;  2UXD H;  1V9P A;  3N40 P;  4LMY A;  4RB0 A;  4DR5 H;  1GYF A;  4FM9 A;  1XDN A;  3FMA A;  4DV1 H;  5EOY A;  5D1O B;  4M7E A;  4JI3 H;  1BJT A;  3N41 B;  5D1P A;  4X64 H;  5LMU H;  3RF2 A;  3RIZ A;  4UCT A;  1O75 A;  4LH7 A;  1BGW A;  3PN1 A;  3KAL A;  4EFE A;  2CW7 A;  4AQY H;  1M0W A;  4UCU A;  4UCR A;  3MWM A;  4YY3 H;  1ZHS A;  1S03 G;  3KXY T;  4Q0Y A;  3EYY A;  4KHP H;  4RB1 A;  1ZHQ A;  3JSL A;  1E4G T;  4NXM H;  5LL6 b;  4DV0 H;  4GKJ H;  3K3V A;  4X65 H;  4LF7 H;  2F4V H;  5FPR A;  1E4F T;  4LSA A;  2Q2T A;  2HGS A;  5FLX W;  2CW8 A;  1N34 H;  2WYO A;  3L4J A;  4DV7 H;  4R7R A;  2RGR A;  1J5E H;  4DUZ H;  3HXL A;  3RTX A;  4MTE A;  4DR2 H;  4B3T H;  4JI4 H;  2UUC H;  1N32 H;  3BAA A;  5IWA H;  1L2Z A;  4LSX A;  5D1O A;  4DR3 H;  2UUA H;  4OX9 H;  4JI0 H;  3BA9 A;  4PDB A;  2Q2U A;  1SYX B;  4RB2 C;  4DV2 H;  1MZB A;  3J7A K;  2KSW A;  1VS0 A;  2E5L H;  1Z2P X;  5FD6 A;  4GKK H;  4X62 H;  4JYA H;  1XNR H;  4DR6 H;  2WDT A;  4EEQ A;  1AN7 A;  3CVZ A;  4LF8 H;  1IBK H;  1FKA H;  4JI6 H;  3L2P A;  4JV5 H;  4RAY A;  3N43 B;  1DGS A;  2OWO A;  4DR7 H;  2VQF H;  5FD5 A;  4NXN H;  4DR4 H;  2ZM6 H;  3T1Y H;  3J80 W;  2VOB A;  4MTD A;  1HNW H;  3N6X A;  1I6U A;  4JI2 H;  3BA8 A;  4APM A;  4JI5 H;  4LF9 H;  4J0M A;  3F8N A;  3RGZ A;  4LF5 H;  3JAM W;  5A2Q W;  3DF7 A;  4LH6 A;  5FPO A;  4UCV A;  4X66 H;  1XNQ H;  3RGX A;  4B3S H;  2WE6 A;  4I7H A;  1XMQ H;  3UQ8 A;  2VUG A;  2MCT A;  1I94 H;  3L4K A;  1N36 H;  2W57 A;  4CC6 A;  2FE3 A;  2ZJT A;  2UU9 H;  2UUB H;  1B04 A;  2HVR A;  2HVS A;  3JSN A;  4DV3 H;  4JI7 H;  2O03 A;  1SEI A;  2HVQ A;  2UXC H;  1IBM H;  3N42 B;  1WH2 A;  4UFZ A;  1Z2N X;  3RJ0 A;  4LFA H;  5IT9 W;  3OTO H;  3LML A;  1IBL H;  2VQE H;  3J81 W;  4GLX A;  4MV9 A;  1TA8 A;  1X9N A;  1FVI A;  1Z2O X;  4CC5 A;  1HR0 H;  4RB3 C;  1A0I A;  1M0T A;  4DV4 H;  4LF4 H;  4K0K H;  2UXB H;  4RAZ A;  4YHH H;  4LFB H;  3T1H H;  4B3R H;  4UCS A;  4A2B A;  2VPS A;  4RZQ A;  4DUY H;  2HHH H;  3BAB A;  4DR1 H;  1HNZ H;  4JI8 H;  1FJG H;  3KAK A;  1N33 H;  4DV6 H;  4ETS A;  1XMO H;  3KAJ A;  4EFB A;  3C0F B;  1S68 A;  4A2A A;  4JI1 H;  5LMN H;  3H20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...