3C0FB

Crystal structure of a novel non-pfam protein af1514 from archeoglobus fulgidus dsm 4304 solved by s-sad using a cr x-ray source
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
80
Chain Sequence
IMDEIVNLQKEVSLEEAERYANIASYGDGILLSVHDSTGYRAPEVYCCGEKPWEVYACNRGANLISVNQFEFYFRIEVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a novel non-Pfam protein AF1514 from Archeoglobus fulgidus DSM 4304 solved by S-SAD using a Cr X-ray source.
pubmed doi rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Unknown function
molecule keywords Uncharacterized protein AF_1514
total genus 17
structure length 80
sequence length 85
ec nomenclature
pdb deposition date 2008-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18505 DUF5619 Domain of unknown function (DUF5619)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.340 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3c0fB00
3C0FB
chains in the Genus database with same CATH superfamily
1BXRA 4UFZA 3MFIA 2J6UA 4LFAH 4RB2C 1Z2NX 2V5AA 5LMUH 3M9MB 5DG7A 5C44G 3R5XA 4JI2H 5KFCA 4DV3H 5KG7A 5KT5A 4GC6A 2VA3A 4RNOA 2J9GA 3KXYT 4DL3A 1ZHQA 1K83A 1SEIA 2PN1A 4RAYA 3BJYA 1WCMG 4LH7A 3PW2A 3C0FB 4QW8A 4UCOA 2R7ZG 4J9NA 2FK2A 3EYYA 4ED3A 4MV7A 2ASDA 1DV2A 3H40A 1Y14B 4M9UA 4DV1H 1TWFA 4J9KA 4F50A 2R92A 2JA5A 1DV1A 5L1JA 2IMWP 4FBUA 1V9PA 4LF5H 3N42B 3JRWA 1Y1VA 3ETHA 3TQ1A 2R8JA 4A3EG 1SCUB 3U9SA 4J0MA 2R7KA 1T3NA 4Q45A 2IA6A 1B6SA 3V4ZA 4XX0B 1WSCA 5IYBG 2W6PA 5FPOA 3J80W 4PDBA 4HQ6A 3OHBA 1W93A 4FS1A 1GYFA 3KAJA 1FVIA 2DIKA 1WR2A 5KG6A 5KFFA 5D1PA 1DGSA 3FKIG 4EBDA 2JA6G 3FMAA 4TV9F 4IRKA 1R9TA 4EGJA 2RGVA 3HKZA 5LMNH 3HOZG 4FBTA 3PW7A 3OUZA 2YZGA 3HOYG 3PO2G 3T5KA 1FKAH 4A3KG 5KT3A 4DR1H 5HBRB 1KJJA 4DV0H 1S10A 2ZJTA 4JI4H 5FLXW 1BNCA 3BABA 3GIMA 1B04A 3N41B 1S0OA 4JV1A 4BBRG 2ASLA 2UVRA 3BQ2A 4K0KH 5EDWA 4LFCH 2XC9A 4DR2H 2DPJA 2FJZA 1SFOA 4O3QA 5C8YF 3RGXA 2ZDGA 5KFYA 2NVXA 2UUCH 2CW8A 3BG5A 4JI5H 2I80A 5C1PA 3Q2OA 2PMZE 1EUDB 2R7LA 3BA8A 5JVLA 1T94A 3J81W 2QYZA 2VUGA 2XGPA 2R93G 1DIKA 1AN7A 1W96A 5L1IA 1BGWA 5GONF 4J9RA 1HNXH 4IR1A 1EYZA 2UXCH 2V9WA 1M7JA 1ZQ7A 4QIWE 4MA5A 5CA1F 4EFBA 4O3SA 3RV4A 3Q8RB 2VA2A 4JI6H 3TIIA 3GIKA 4DL7A 3DF7A 3VMMA 3I12A 5KFGA 5C1OA 3HXLA 2FLLA 1E4FT 3HOWG 4O4LF 5KT4A 3I4MG 2YZMA 2UXDH 4BY7G 4ED0A 3KTMA 1I7NA 5KX5F 5IT9W 2NVYA 3GLKA 2AQ4A 1XNRH 3T1YH 1CS0A 4A3JG 4DL6A 3ORQA 4WBNF 4KHPH 1Y1WA 4YY3H 2W6QA 4A3DG 4F4ZA 2FK3A 3K3VA 4B3RH 4QIWA 3I4NG 4EFEA 1UC9A 3M9OB 2W8KA 2VQFH 4PWQA 3PW0A 2NU6B 5KFRA 4A3BG 2WB1E 5JVDF 1OWTA 3CVZA 3RTXA 4ED2A 3RF2A 4DR6H 5EZYF 5BPFA 3G6VA 4IAJA 5IP7G 2CKZB 2XIGA 4DR4H 4O4IF 4A2BA 3OSNA 2JEJA 3N8DA 1KJIA 4E4TA 2HVSA 2UUAH 3HOUG 2R93A 2BQUA 1S68A 1TWAA 2FMAA 2R84A 1VKZA 3R23A 2V58A 3PN1A 2YYAA 5HV6A 1CQJB 1ULZA 2PMZA 1FJGH 3TINA 3LMLA 4ECQA 4APMA 2R6FA 1RYRA 4A3GG 4DV5H 4TQSA 2WYOA 5FD6A 4YJ3F 1KBLA 2OH2A 5DGBA 3KALA 3VPBA 4EEQA 2WB1A 4MV9A 4QWCA 3M9NB 3G8CA 4I4TF 3QZ7A 2R92G 5D1OB 4MA0A 3G6YA 2GPWA 3OUUA 5LA6F 1VBGA 4XYMB 1HNZH 4X64H 3RJ0A 2R8GA 2DWCA 3SE7A 1WCMA 4DL4A 2R8IA 3MR2A 3VPCA 5KFVA 5KT7A 1Y1VG 5C3EG 4ECVA 4J9LA 5FPRA 5KFBA 3L4JA 1GGOA 3GTMA 4MAMA 3GV7B 3RAXA 4JYAH 4FS2A 1S0MA 1SYXB 4UCRA 2W8LA 5J2UF 1HR0H 1JXLA 2ZM6H 3BAAA 5L9XA 2YS6A 5KFIA 3PVXA 1S97A 1XNQH 3GTPA 2OWOA 4EYIB 2E2HA 4JV0A 5KFSA 2W7PA 1RK5A 4ECSA 3CQZA 4DLKA 4TV8F 2YRXA 3GQCA 4R8UB 4ED1A 5KG4A 2ALZA 1TWHA 3GTGA 2C2DA 2I87A 3GIQA 2ZDQA 2O03A 2DZDA 1T36A 3LP8A 4HNUA 4HNTA 4O2BF 3FKIA 5K2MA 5IP9G 1N32H 4AYBA 5EWEA 4RB1A 1GLVA 2JEIA 3H4BA 2FP4B 4J9PA 2B63A 3N6XA 5LOVF 3KHGA 2NU7B 3HBLA 5DQGA 5KT6A 5LL6b 2VOBA 3MFHA 2R7NA 3EPGA 3OSPA 5D1OA 3LWBA 3V6KA 5IYZF 4DR3H 4JV5H 1IBLH 2JA8G 4DL5A 1TAEA 4RZQA 3JRXA 1N34H 1Z2PX 2V4RA 4LF8H 4QWAA 2YU9A 3JAMW 4L1KA 4ECZA 2AGOA 3UFXB 4ETSA 2C00A 4YR0A 2BQRA 1N56A 4AQYH 5JH7F 3N44B 2W9BB 4LMYA 4Q8EA 4IR9A 3HB9A 2JA7G 1I7LA 5DG9A 3L2PA 1RK6A 1KJ9A 4EYHB 5BR8H 2P0AA 3BA9A 3T5HA 3V6HA 3WO1A 2ASJA 3Q8PB 3PW5A 1BJTA 5DLFA 1MZBA 4RU9A 4RNMA 2C2RA 4I50F 1M6VA 4BXXG 4QWEA 2FPPB 4FU0A 4C2MA 2XGQA 3EPIA 2R7ZA 4YQWA 1E4EA 2CZGA 2PBZA 1ZHSA 5BPHA 5KFJA 4UCSA 5J2TF 5DG8A 4G3IA 5KG0A 1KC7A 3RB6A 3H3VH 4IRDA 2W9CA 5KG2A 5H80A 1CQIB 1M0WA 4C5BA 3GV5B 2C22A 2UVUA 2PVPA 4MV3A 2C2EA 1GSOA 3N40P 2M05A 4RNNA 1JDEA 5LXTF 3V4SA 4RUCA 4Y8VB 3BQ0A 5DQHA 4X62H 4NXNH 5CA0F 4YB8B 5KFOA 4F4YA 1XMQH 4B3SH 3R5HA 2VUMA 1V51A 4JI0H 4EG0A 2HVQA 3ORRA 5T14A 4GLXA 4O3OA 4J9QA 2HJWA 4O3NA 4JI1H 1TWCA 4AYBE 5EWFA 3U9TA 4ZI7F 2JEFA 2Q2UA 5KFXA 3ETJA 1RJRA 1M0TA 1RJQA 3PZPA 4LF4H 4C5CA 2UVVA 1VAJA 2W57A 5DQIA 3Q8QB 5KKNB 4B3MH 2FLPA 1L2ZA 4IWYA 3PW4A 3RAQA 4JI7H 2R87A 2UXBH 2DPIA 3GTOA 1JDBB 4DUYH 2V59A 4YJ2F 4DR7H 2IBKA 4Q0YA 4TQRA 4JI8H 4X66H 2W9CB 4O2AF 2WAQE 2B63G 2YW2A 4RAZA 4EEYA 3H0GG 4EGQA 3K3PA 4GC7A 2VPQA 2WAQA 2VQDA 2X0SA 2XCLA 5KG5A 1JKJB 1S0NA 3HOVG 1A0IA 1XDNA 2W6MA 4NLGA 3SI8A 2YS7A 2VPSA 3H20A 4XZ3B 1WH2A 4LSXA 3G6XA 2Q2TA 2AGPA 5KG3A 3Q8SB 4QW9A 4ECTA 1P8LA 3AYHB 1E4EB 4YAKB 5IWAH 3OTOH 4DV4H 4LFBH 2WE6A 4FM9A 4BY1G 4XYLB 5L1KA 4ZOLF 2W7OA 1B33N 2W71A 2HGSA 5JUMA 2Y0SE 4LF7H 1GSAA 4ED7A 4ZHQF 2JA6A 3GTKA 1V4YA 2RGRA 5FJ8G 5L1LA 4HYKA 4UCTA 3VPDA 2CW7A 5LP6F 5KFDA 4GKKH 4YP3A 2UUBH 1N48A 4MV8A 3GV8B 4IHJF 3TIGA 4O3RA 3J7AK 5KFQA 4LH6A 2UU9H 4YR3A 1A9XA 1TA8A 2MCTA 3N43B 1Z2OX 2XCPA 4UCUA 3MJFA 5EWGA 4F4XA 1AUXA 3PO3G 4JV2A 4TUYF 4JUZA 5CAEB 4U7CA 3GIJA 3JZIA 1KJQA 4LSAA 2F4VH 4J9OA 4M7EA 1TWGA 4B3TH 3PR5B 4LF9H 1X9NA 3M4IA 2HHHH 4ZQIA 2GLTA 4ECRA 2J6SA 4ED6A 4IRCA 2ATLA 3PR4A 3GIDA 3K5HA 1GSHA 5FD5A 3JSLA 4RB0A 2AGQA 1CE8A 5A2QW 3MR6A 5KFAA 2XD4A 4I55F 2CQYA 5KFMA 1N36H 2UVWA 2RF4A 4RUAA 2HVRA 5KFPA 4EBCA 5KFLA 2W70A 1IOVA 3T5JA 3F8NA 1JX4A 5JQWA 1EHIA 3KHLA 2C28A 4F4WA 1HNWH 5F9NA 3MWEA 5BMVF 4MV1A 1GO3E 3KHRA 3V6JA 1I3QA 2BR0A 4DUZH 4A93G 2XCAA 2Y0SA 3E5NA 4HR7A 2IP4A 1IOWA 5KT2A 2KSWA 3Q1KA 1Y1WG 1EUCB 2W9BA 4JI3H 4HNVA 4ECXA 1J5EH 4A3CG 2FE3A 4A3MG 3GILA 1IBMH 4LF6H 3MR5A 2I8CA 3GIIA 3H4DA 3GTLA 1UNNC 3RUPA 5F9LA 4DR5H 2FLNA 1KJ8A 2FB9A 1I6UA 1EZ1A 1C30A 4Q43A 5FLMG 2OLSA 4ME6A 1RYSA 1JIHA 2FPIB 3MWMA 3TQTA 4A3LG 5KFHA 3RBDA 2W6OA 4ECUA 2SCUB 1K1SA 4OX9H 4X65H 4GKJH 3T1HH 4BWSC 4DV7H 4WD3A 5KFWA 2VQEH 2YZNA 3FDSA 4DL2A 4ECWA 5KFUA 3IG0A 4YHHH 4IZOA 4O4HF 2W6NA 2AU0A 5C4XG 1C3OA 1I50A 3UQ8A 2J6TA 2JEGA 5I47A 5IYDG 1UC8A 2YL2A 3H0GA 2R82A 2R86A 5DGAA 3JSNA 4DV6H 2QK4A 4CC5A 3BQ1A 2JA5G 4R7RA 4QWDA 4J9SA 1S03G 5IYCG 1KEEA 3WNZA 2WDTA 4MTEA 2ZDHA 3GTQA 3RV3A 2FK1A 2YCHA 1ZETA 2VUMG 2NU9B 3HKZE 3L4KA 1K1QA 4QWBA 4A3FG 2WTFA 5KG1A 3GTJA 3R5FA 3T5LA 4R8UA 3OHAA 2FPGB 1I94H 3GIPA 2JA7A 2NUAB 1VBHA 4NXMH 1S9FA 3QFFA 3RB4A 3NGDA 1B6RA 2R85A 5C5JA 5LYJF 4RB3C 4CC6A 4MTDA 5CB4F 3QZ8A 1AUVA 5D8DA 3WO0A 4EBEA 3RFCA 2W9AA 4MV4A 3RGZA 3RIZA 1N33H 4I7HA 3MR3A 5KFZA 5KFKA 2R8KA 1VS0A 3HOXG 4Q44A 3RBEA 2FKLA 1JLLB 5EOYA 2DLNA 1IBKH 1E4GT 4QJFA 4YBZB 4YAJB 3MWDA 3K5IA 2NU8B 2RDIA 2E5LH 1PX2A 4U6PA 2C35B 4UCVA 2E2IA 4IWXA 4C5AA 2BQ3A 5DLGA 1XMOH 3KHHA 3RB0A 4DV2H 1PK8A 4A2AA 4A3IG 4YR2A 3IN5A 3RB3A 3KAKA 2R7MA 2V4QA 4Q8FA 4BBSG 4J9MA 2W6ZA 2VR1A 4ECYA 4RZRA 2GPSA 2YRWA 2R8HA 5KFNA 1O75A 5KFEA 2RDJA 4ED8A 1RJPA 4O3PA 5KFTA 4MV6A
chains in the Genus database with same CATH topology
2HVRA 3N40P 3CVZA 4UFZA 3RTXA 4LFAH 3RF2A 4RB2C 4DR6H 1Z2NX 3F8NA 4IAJA 5LMUH 2XIGA 4DR4H 4A2BA 1HNWH 2HVSA 4JI2H 2UUAH 4DV3H 4X62H 1S68A 4NXNH 1XMQH 3KXYT 4DUZH 3PN1A 1ZHQA 4JI0H 1SEIA 4RAYA 4LH7A 2HVQA 2KSWA 3C0FB 4GLXA 4UCOA 1FJGH 3EYYA 4JI3H 4MV7A 3LMLA 4APMA 4DV1H 1J5EH 2FE3A 4DV5H 4JI1H 2WYOA 2Q2UA 5FD6A 1V9PA 1IBMH 4LF4H 1M0TA 3KALA 4EEQA 4LF6H 4LF5H 3N42B 4MV9A 1I6UA 4DR5H 2W57A 5D1OB 4J0MA 4B3MH 1HNZH 4X64H 1L2ZA 3RJ0A 3MWMA 2UXBH 4JI7H 5FPOA 3J80W 4PDBA 4OX9H 4X65H 4DUYH 4DR7H 3T1HH 4Q0YA 4JI8H 4BWSC 4X66H 4DV7H 1GYFA 2VQEH 5FPRA 3L4JA 3KAJA 1FVIA 4RAZA 3IG0A 1DGSA 5D1PA 4YHHH 4JYAH 1SYXB 4UCRA 3FMAA 1A0IA 1HR0H 2ZM6H 1XDNA 2RGVA 3UQ8A 3BAAA 5LMNH 1XNQH 2OWOA 3H20A 2VPSA 1FKAH 3JSNA 1WH2A 4LSXA 4DR1H 4DV0H 4DV6H 4B3SH 2Q2TA 2ZJTA 4CC5A 5FLXW 4JI4H 3BABA 4R7RA 1B04A 3N41B 1S03G 2O03A 2WDTA 4MTEA 4K0KH 1P8LA 2YCHA 5IWAH 3OTOH 4DV4H 4DR2H 4LFCH 4LFBH 2WE6A 4FM9A 3L4KA 3RGXA 1N32H 4RB1A 2UUCH 2CW8A 2HGSA 3N6XA 4JI5H 1I94H 3BA8A 2VOBA 5LL6b 4LF7H 5D1OA 3J81W 2VUGA 2RGRA 4NXMH 1AN7A 4DR3H 4JV5H 1BGWA 1IBLH 4UCTA 1HNXH 2UXCH 2CW7A 4GKKH 1TAEA 4RZQA 1N34H 2UUBH 1Z2PX 4EFBA 4RB3C 4LF8H 4CC6A 4MTDA 3J7AK 3JAMW 4JI6H 3RGZA 3DF7A 4LH6A 4ETSA 3RIZA 2UU9H 1N33H 4I7HA 3HXLA 4AQYH 1E4FT 3N44B 1TA8A 4LMYA 1VS0A 2MCTA 3N43B 1Z2OX 3L2PA 4UCUA 5EOYA 2UXDH 1IBKH 1E4GT 5BR8H 2E5LH 5IT9W 3BA9A 1XNRH 4UCVA 4LSAA 1BJTA 1XMOH 2F4VH 3T1YH 1MZBA 4M7EA 4DV2H 4B3TH 4LF9H 4A2AA 1X9NA 3M4IA 2HHHH 4KHPH 3KAKA 4YY3H 3K3VA 4B3RH 4GKJH 1ZHSA 4EFEA 4UCSA 5FD5A 2VQFH 3JSLA 4RB0A 5A2QW 1M0WA 1O75A 1N36H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0F B; 
#chains in the Genus database with same CATH topology
 1BXR A;  4UFZ A;  3MFI A;  2J6U A;  4LFA H;  4RB2 C;  1Z2N X;  2V5A A;  5LMU H;  3M9M B;  5DG7 A;  5C44 G;  3R5X A;  4JI2 H;  5KFC A;  4DV3 H;  5KG7 A;  5KT5 A;  4GC6 A;  2VA3 A;  4RNO A;  2J9G A;  3KXY T;  4DL3 A;  1ZHQ A;  1K83 A;  1SEI A;  2PN1 A;  4RAY A;  3BJY A;  1WCM G;  4LH7 A;  3PW2 A;  3C0F B;  4QW8 A;  4UCO A;  2R7Z G;  4J9N A;  2FK2 A;  3EYY A;  4ED3 A;  4MV7 A;  2ASD A;  1DV2 A;  3H40 A;  1Y14 B;  4M9U A;  4DV1 H;  1TWF A;  4J9K A;  4F50 A;  2R92 A;  2JA5 A;  1DV1 A;  5L1J A;  2IMW P;  4FBU A;  1V9P A;  4LF5 H;  3N42 B;  3JRW A;  1Y1V A;  3ETH A;  3TQ1 A;  2R8J A;  4A3E G;  1SCU B;  3U9S A;  4J0M A;  2R7K A;  1T3N A;  4Q45 A;  2IA6 A;  1B6S A;  3V4Z A;  4XX0 B;  1WSC A;  5IYB G;  2W6P A;  5FPO A;  3J80 W;  4PDB A;  4HQ6 A;  3OHB A;  1W93 A;  4FS1 A;  1GYF A;  3KAJ A;  1FVI A;  2DIK A;  1WR2 A;  5KG6 A;  5KFF A;  5D1P A;  1DGS A;  3FKI G;  4EBD A;  2JA6 G;  3FMA A;  4TV9 F;  4IRK A;  1R9T A;  4EGJ A;  2RGV A;  3HKZ A;  5LMN H;  3HOZ G;  4FBT A;  3PW7 A;  3OUZ A;  2YZG A;  3HOY G;  3PO2 G;  3T5K A;  1FKA H;  4A3K G;  5KT3 A;  4DR1 H;  5HBR B;  1KJJ A;  4DV0 H;  1S10 A;  2ZJT A;  4JI4 H;  5FLX W;  1BNC A;  3BAB A;  3GIM A;  1B04 A;  3N41 B;  1S0O A;  4JV1 A;  4BBR G;  2ASL A;  2UVR A;  3BQ2 A;  4K0K H;  5EDW A;  4LFC H;  2XC9 A;  4DR2 H;  2DPJ A;  2FJZ A;  1SFO A;  4O3Q A;  5C8Y F;  3RGX A;  2ZDG A;  5KFY A;  2NVX A;  2UUC H;  2CW8 A;  3BG5 A;  4JI5 H;  2I80 A;  5C1P A;  3Q2O A;  2PMZ E;  1EUD B;  2R7L A;  3BA8 A;  5JVL A;  1T94 A;  3J81 W;  2QYZ A;  2VUG A;  2XGP A;  2R93 G;  1DIK A;  1AN7 A;  1W96 A;  5L1I A;  1BGW A;  5GON F;  4J9R A;  1HNX H;  4IR1 A;  1EYZ A;  2UXC H;  2V9W A;  1M7J A;  1ZQ7 A;  4QIW E;  4MA5 A;  5CA1 F;  4EFB A;  4O3S A;  3RV4 A;  3Q8R B;  2VA2 A;  4JI6 H;  3TII A;  3GIK A;  4DL7 A;  3DF7 A;  3VMM A;  3I12 A;  5KFG A;  5C1O A;  3HXL A;  2FLL A;  1E4F T;  3HOW G;  4O4L F;  5KT4 A;  3I4M G;  2YZM A;  2UXD H;  4BY7 G;  4ED0 A;  3KTM A;  1I7N A;  5KX5 F;  5IT9 W;  2NVY A;  3GLK A;  2AQ4 A;  1XNR H;  3T1Y H;  1CS0 A;  4A3J G;  4DL6 A;  3ORQ A;  4WBN F;  4KHP H;  1Y1W A;  4YY3 H;  2W6Q A;  4A3D G;  4F4Z A;  2FK3 A;  3K3V A;  4B3R H;  4QIW A;  3I4N G;  4EFE A;  1UC9 A;  3M9O B;  2W8K A;  2VQF H;  4PWQ A;  3PW0 A;  2NU6 B;  5KFR A;  4A3B G;  2WB1 E;  5JVD F;  1OWT A;  3CVZ A;  3RTX A;  4ED2 A;  3RF2 A;  4DR6 H;  5EZY F;  5BPF A;  3G6V A;  4IAJ A;  5IP7 G;  2CKZ B;  2XIG A;  4DR4 H;  4O4I F;  4A2B A;  3OSN A;  2JEJ A;  3N8D A;  1KJI A;  4E4T A;  2HVS A;  2UUA H;  3HOU G;  2R93 A;  2BQU A;  1S68 A;  1TWA A;  2FMA A;  2R84 A;  1VKZ A;  3R23 A;  2V58 A;  3PN1 A;  2YYA A;  5HV6 A;  1CQJ B;  1ULZ A;  2PMZ A;  1FJG H;  3TIN A;  3LML A;  4ECQ A;  4APM A;  2R6F A;  1RYR A;  4A3G G;  4DV5 H;  4TQS A;  2WYO A;  5FD6 A;  4YJ3 F;  1KBL A;  2OH2 A;  5DGB A;  3KAL A;  3VPB A;  4EEQ A;  2WB1 A;  4MV9 A;  4QWC A;  3M9N B;  3G8C A;  4I4T F;  3QZ7 A;  2R92 G;  5D1O B;  4MA0 A;  3G6Y A;  2GPW A;  3OUU A;  5LA6 F;  1VBG A;  4XYM B;  1HNZ H;  4X64 H;  3RJ0 A;  2R8G A;  2DWC A;  3SE7 A;  1WCM A;  4DL4 A;  2R8I A;  3MR2 A;  3VPC A;  5KFV A;  5KT7 A;  1Y1V G;  5C3E G;  4ECV A;  4J9L A;  5FPR A;  5KFB A;  3L4J A;  1GGO A;  3GTM A;  4MAM A;  3GV7 B;  3RAX A;  4JYA H;  4FS2 A;  1S0M A;  1SYX B;  4UCR A;  2W8L A;  5J2U F;  1HR0 H;  1JXL A;  2ZM6 H;  3BAA A;  5L9X A;  2YS6 A;  5KFI A;  3PVX A;  1S97 A;  1XNQ H;  3GTP A;  2OWO A;  4EYI B;  2E2H A;  4JV0 A;  5KFS A;  2W7P A;  1RK5 A;  4ECS A;  3CQZ A;  4DLK A;  4TV8 F;  2YRX A;  3GQC A;  4R8U B;  4ED1 A;  5KG4 A;  2ALZ A;  1TWH A;  3GTG A;  2C2D A;  2I87 A;  3GIQ A;  2ZDQ A;  2O03 A;  2DZD A;  1T36 A;  3LP8 A;  4HNU A;  4HNT A;  4O2B F;  3FKI A;  5K2M A;  5IP9 G;  1N32 H;  4AYB A;  5EWE A;  4RB1 A;  1GLV A;  2JEI A;  3H4B A;  2FP4 B;  4J9P A;  2B63 A;  3N6X A;  5LOV F;  3KHG A;  2NU7 B;  3HBL A;  5DQG A;  5KT6 A;  5LL6 b;  2VOB A;  3MFH A;  2R7N A;  3EPG A;  3OSP A;  5D1O A;  3LWB A;  3V6K A;  5IYZ F;  4DR3 H;  4JV5 H;  1IBL H;  2JA8 G;  4DL5 A;  1TAE A;  4RZQ A;  3JRX A;  1N34 H;  1Z2P X;  2V4R A;  4LF8 H;  4QWA A;  2YU9 A;  3JAM W;  4L1K A;  4ECZ A;  2AGO A;  3UFX B;  4ETS A;  2C00 A;  4YR0 A;  2BQR A;  1N56 A;  4AQY H;  5JH7 F;  3N44 B;  2W9B B;  4LMY A;  4Q8E A;  4IR9 A;  3HB9 A;  2JA7 G;  1I7L A;  5DG9 A;  3L2P A;  1RK6 A;  1KJ9 A;  4EYH B;  5BR8 H;  2P0A A;  3BA9 A;  3T5H A;  3V6H A;  3WO1 A;  2ASJ A;  3Q8P B;  3PW5 A;  1BJT A;  5DLF A;  1MZB A;  4RU9 A;  4RNM A;  2C2R A;  4I50 F;  1M6V A;  4BXX G;  4QWE A;  2FPP B;  4FU0 A;  4C2M A;  2XGQ A;  3EPI A;  2R7Z A;  4YQW A;  1E4E A;  2CZG A;  2PBZ A;  1ZHS A;  5BPH A;  5KFJ A;  4UCS A;  5J2T F;  5DG8 A;  4G3I A;  5KG0 A;  1KC7 A;  3RB6 A;  3H3V H;  4IRD A;  2W9C A;  5KG2 A;  5H80 A;  1CQI B;  1M0W A;  4C5B A;  3GV5 B;  2C22 A;  2UVU A;  2PVP A;  4MV3 A;  2C2E A;  1GSO A;  3N40 P;  2M05 A;  4RNN A;  1JDE A;  5LXT F;  3V4S A;  4RUC A;  4Y8V B;  3BQ0 A;  5DQH A;  4X62 H;  4NXN H;  5CA0 F;  4YB8 B;  5KFO A;  4F4Y A;  1XMQ H;  4B3S H;  3R5H A;  2VUM A;  1V51 A;  4JI0 H;  4EG0 A;  2HVQ A;  3ORR A;  5T14 A;  4GLX A;  4O3O A;  4J9Q A;  2HJW A;  4O3N A;  4JI1 H;  1TWC A;  4AYB E;  5EWF A;  3U9T A;  4ZI7 F;  2JEF A;  2Q2U A;  5KFX A;  3ETJ A;  1RJR A;  1M0T A;  1RJQ A;  3PZP A;  4LF4 H;  4C5C A;  2UVV A;  1VAJ A;  2W57 A;  5DQI A;  3Q8Q B;  5KKN B;  4B3M H;  2FLP A;  1L2Z A;  4IWY A;  3PW4 A;  3RAQ A;  4JI7 H;  2R87 A;  2UXB H;  2DPI A;  3GTO A;  1JDB B;  4DUY H;  2V59 A;  4YJ2 F;  4DR7 H;  2IBK A;  4Q0Y A;  4TQR A;  4JI8 H;  4X66 H;  2W9C B;  4O2A F;  2WAQ E;  2B63 G;  2YW2 A;  4RAZ A;  4EEY A;  3H0G G;  4EGQ A;  3K3P A;  4GC7 A;  2VPQ A;  2WAQ A;  2VQD A;  2X0S A;  2XCL A;  5KG5 A;  1JKJ B;  1S0N A;  3HOV G;  1A0I A;  1XDN A;  2W6M A;  4NLG A;  3SI8 A;  2YS7 A;  2VPS A;  3H20 A;  4XZ3 B;  1WH2 A;  4LSX A;  3G6X A;  2Q2T A;  2AGP A;  5KG3 A;  3Q8S B;  4QW9 A;  4ECT A;  1P8L A;  3AYH B;  1E4E B;  4YAK B;  5IWA H;  3OTO H;  4DV4 H;  4LFB H;  2WE6 A;  4FM9 A;  4BY1 G;  4XYL B;  5L1K A;  4ZOL F;  2W7O A;  1B33 N;  2W71 A;  2HGS A;  5JUM A;  2Y0S E;  4LF7 H;  1GSA A;  4ED7 A;  4ZHQ F;  2JA6 A;  3GTK A;  1V4Y A;  2RGR A;  5FJ8 G;  5L1L A;  4HYK A;  4UCT A;  3VPD A;  2CW7 A;  5LP6 F;  5KFD A;  4GKK H;  4YP3 A;  2UUB H;  1N48 A;  4MV8 A;  3GV8 B;  4IHJ F;  3TIG A;  4O3R A;  3J7A K;  5KFQ A;  4LH6 A;  2UU9 H;  4YR3 A;  1A9X A;  1TA8 A;  2MCT A;  3N43 B;  1Z2O X;  2XCP A;  4UCU A;  3MJF A;  5EWG A;  4F4X A;  1AUX A;  3PO3 G;  4JV2 A;  4TUY F;  4JUZ A;  5CAE B;  4U7C A;  3GIJ A;  3JZI A;  1KJQ A;  4LSA A;  2F4V H;  4J9O A;  4M7E A;  1TWG A;  4B3T H;  3PR5 B;  4LF9 H;  1X9N A;  3M4I A;  2HHH H;  4ZQI A;  2GLT A;  4ECR A;  2J6S A;  4ED6 A;  4IRC A;  2ATL A;  3PR4 A;  3GID A;  3K5H A;  1GSH A;  5FD5 A;  3JSL A;  4RB0 A;  2AGQ A;  1CE8 A;  5A2Q W;  3MR6 A;  5KFA A;  2XD4 A;  4I55 F;  2CQY A;  5KFM A;  1N36 H;  2UVW A;  2RF4 A;  4RUA A;  2HVR A;  5KFP A;  4EBC A;  5KFL A;  2W70 A;  1IOV A;  3T5J A;  3F8N A;  1JX4 A;  5JQW A;  1EHI A;  3KHL A;  2C28 A;  4F4W A;  1HNW H;  5F9N A;  3MWE A;  5BMV F;  4MV1 A;  1GO3 E;  3KHR A;  3V6J A;  1I3Q A;  2BR0 A;  4DUZ H;  4A93 G;  2XCA A;  2Y0S A;  3E5N A;  4HR7 A;  2IP4 A;  1IOW A;  5KT2 A;  2KSW A;  3Q1K A;  1Y1W G;  1EUC B;  2W9B A;  4JI3 H;  4HNV A;  4ECX A;  1J5E H;  4A3C G;  2FE3 A;  4A3M G;  3GIL A;  1IBM H;  4LF6 H;  3MR5 A;  2I8C A;  3GII A;  3H4D A;  3GTL A;  1UNN C;  3RUP A;  5F9L A;  4DR5 H;  2FLN A;  1KJ8 A;  2FB9 A;  1I6U A;  1EZ1 A;  1C30 A;  4Q43 A;  5FLM G;  2OLS A;  4ME6 A;  1RYS A;  1JIH A;  2FPI B;  3MWM A;  3TQT A;  4A3L G;  5KFH A;  3RBD A;  2W6O A;  4ECU A;  2SCU B;  1K1S A;  4OX9 H;  4X65 H;  4GKJ H;  3T1H H;  4BWS C;  4DV7 H;  4WD3 A;  5KFW A;  2VQE H;  2YZN A;  3FDS A;  4DL2 A;  4ECW A;  5KFU A;  3IG0 A;  4YHH H;  4IZO A;  4O4H F;  2W6N A;  2AU0 A;  5C4X G;  1C3O A;  1I50 A;  3UQ8 A;  2J6T A;  2JEG A;  5I47 A;  5IYD G;  1UC8 A;  2YL2 A;  3H0G A;  2R82 A;  2R86 A;  5DGA A;  3JSN A;  4DV6 H;  2QK4 A;  4CC5 A;  3BQ1 A;  2JA5 G;  4R7R A;  4QWD A;  4J9S A;  1S03 G;  5IYC G;  1KEE A;  3WNZ A;  2WDT A;  4MTE A;  2ZDH A;  3GTQ A;  3RV3 A;  2FK1 A;  2YCH A;  1ZET A;  2VUM G;  2NU9 B;  3HKZ E;  3L4K A;  1K1Q A;  4QWB A;  4A3F G;  2WTF A;  5KG1 A;  3GTJ A;  3R5F A;  3T5L A;  4R8U A;  3OHA A;  2FPG B;  1I94 H;  3GIP A;  2JA7 A;  2NUA B;  1VBH A;  4NXM H;  1S9F A;  3QFF A;  3RB4 A;  3NGD A;  1B6R A;  2R85 A;  5C5J A;  5LYJ F;  4RB3 C;  4CC6 A;  4MTD A;  5CB4 F;  3QZ8 A;  1AUV A;  5D8D A;  3WO0 A;  4EBE A;  3RFC A;  2W9A A;  4MV4 A;  3RGZ A;  3RIZ A;  1N33 H;  4I7H A;  3MR3 A;  5KFZ A;  5KFK A;  2R8K A;  1VS0 A;  3HOX G;  4Q44 A;  3RBE A;  2FKL A;  1JLL B;  5EOY A;  2DLN A;  1IBK H;  1E4G T;  4QJF A;  4YBZ B;  4YAJ B;  3MWD A;  3K5I A;  2NU8 B;  2RDI A;  2E5L H;  1PX2 A;  4U6P A;  2C35 B;  4UCV A;  2E2I A;  4IWX A;  4C5A A;  2BQ3 A;  5DLG A;  1XMO H;  3KHH A;  3RB0 A;  4DV2 H;  1PK8 A;  4A2A A;  4A3I G;  4YR2 A;  3IN5 A;  3RB3 A;  3KAK A;  2R7M A;  2V4Q A;  4Q8F A;  4BBS G;  4J9M A;  2W6Z A;  2VR1 A;  4ECY A;  4RZR A;  2GPS A;  2YRW A;  2R8H A;  5KFN A;  1O75 A;  5KFE A;  2RDJ A;  4ED8 A;  1RJP A;  4O3P A;  5KFT A;  4MV6 A; 
#chains in the Genus database with same CATH homology
 2HVR A;  3N40 P;  3CVZ A;  4UFZ A;  3RTX A;  4LFA H;  3RF2 A;  4RB2 C;  4DR6 H;  1Z2N X;  3F8N A;  4IAJ A;  5LMU H;  2XIG A;  4DR4 H;  4A2B A;  1HNW H;  2HVS A;  4JI2 H;  2UUA H;  4DV3 H;  4X62 H;  1S68 A;  4NXN H;  1XMQ H;  3KXY T;  4DUZ H;  3PN1 A;  1ZHQ A;  4JI0 H;  1SEI A;  4RAY A;  4LH7 A;  2HVQ A;  2KSW A;  3C0F B;  4GLX A;  4UCO A;  1FJG H;  3EYY A;  4JI3 H;  4MV7 A;  3LML A;  4APM A;  4DV1 H;  1J5E H;  2FE3 A;  4DV5 H;  4JI1 H;  2WYO A;  2Q2U A;  5FD6 A;  1V9P A;  1IBM H;  4LF4 H;  1M0T A;  3KAL A;  4EEQ A;  4LF6 H;  4LF5 H;  3N42 B;  4MV9 A;  1I6U A;  4DR5 H;  2W57 A;  5D1O B;  4J0M A;  4B3M H;  1HNZ H;  4X64 H;  1L2Z A;  3RJ0 A;  3MWM A;  2UXB H;  4JI7 H;  5FPO A;  3J80 W;  4PDB A;  4OX9 H;  4X65 H;  4DUY H;  4DR7 H;  3T1H H;  4Q0Y A;  4JI8 H;  4BWS C;  4X66 H;  4DV7 H;  1GYF A;  2VQE H;  5FPR A;  3L4J A;  3KAJ A;  1FVI A;  4RAZ A;  3IG0 A;  1DGS A;  5D1P A;  4YHH H;  4JYA H;  1SYX B;  4UCR A;  3FMA A;  1A0I A;  1HR0 H;  2ZM6 H;  1XDN A;  2RGV A;  3UQ8 A;  3BAA A;  5LMN H;  1XNQ H;  2OWO A;  3H20 A;  2VPS A;  1FKA H;  3JSN A;  1WH2 A;  4LSX A;  4DR1 H;  4DV0 H;  4DV6 H;  4B3S H;  2Q2T A;  2ZJT A;  4CC5 A;  5FLX W;  4JI4 H;  3BAB A;  4R7R A;  1B04 A;  3N41 B;  1S03 G;  2O03 A;  2WDT A;  4MTE A;  4K0K H;  1P8L A;  2YCH A;  5IWA H;  3OTO H;  4DV4 H;  4DR2 H;  4LFC H;  4LFB H;  2WE6 A;  4FM9 A;  3L4K A;  3RGX A;  1N32 H;  4RB1 A;  2UUC H;  2CW8 A;  2HGS A;  3N6X A;  4JI5 H;  1I94 H;  3BA8 A;  2VOB A;  5LL6 b;  4LF7 H;  5D1O A;  3J81 W;  2VUG A;  2RGR A;  4NXM H;  1AN7 A;  4DR3 H;  4JV5 H;  1BGW A;  1IBL H;  4UCT A;  1HNX H;  2UXC H;  2CW7 A;  4GKK H;  1TAE A;  4RZQ A;  1N34 H;  2UUB H;  1Z2P X;  4EFB A;  4RB3 C;  4LF8 H;  4CC6 A;  4MTD A;  3J7A K;  3JAM W;  4JI6 H;  3RGZ A;  3DF7 A;  4LH6 A;  4ETS A;  3RIZ A;  2UU9 H;  1N33 H;  4I7H A;  3HXL A;  4AQY H;  1E4F T;  3N44 B;  1TA8 A;  4LMY A;  1VS0 A;  2MCT A;  3N43 B;  1Z2O X;  3L2P A;  4UCU A;  5EOY A;  2UXD H;  1IBK H;  1E4G T;  5BR8 H;  2E5L H;  5IT9 W;  3BA9 A;  1XNR H;  4UCV A;  4LSA A;  1BJT A;  1XMO H;  2F4V H;  3T1Y H;  1MZB A;  4M7E A;  4DV2 H;  4B3T H;  4LF9 H;  4A2A A;  1X9N A;  3M4I A;  2HHH H;  4KHP H;  3KAK A;  4YY3 H;  3K3V A;  4B3R H;  4GKJ H;  1ZHS A;  4EFE A;  4UCS A;  5FD5 A;  2VQF H;  3JSL A;  4RB0 A;  5A2Q W;  1M0W A;  1O75 A;  1N36 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...