3C0FB

Crystal structure of a novel non-pfam protein af1514 from archeoglobus fulgidus dsm 4304 solved by s-sad using a cr x-ray source
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
80
Chain Sequence
IMDEIVNLQKEVSLEEAERYANIASYGDGILLSVHDSTGYRAPEVYCCGEKPWEVYACNRGANLISVNQFEFYFRIEVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein AF_1514
publication title Crystal structure of a novel non-Pfam protein AF1514 from Archeoglobus fulgidus DSM 4304 solved by S-SAD using a Cr X-ray source.
pubmed doi rcsb
source organism Archaeoglobus fulgidus dsm 4304
total genus 17
structure length 80
sequence length 85
ec nomenclature
pdb deposition date 2008-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18505 DUF5619 Domain of unknown function (DUF5619)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.340 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3c0fB00
3C0FB
chains in the Genus database with same CATH superfamily
4J9QA 4FS1A 3ETJA 4C5CA 3M9NB 1FVIA 1SFOA 2W6PA 5KT6A 5KFOA 3G6YA 3HOVG 3GTPA 3BJYA 2W9CA 5LA6F 1UNNC 5DQHA 1VAJA 4WD3A 2W9BA 4A3BG 2CW7A 3LP8A 2BQUA 2JEJA 1SYXB 4ECVA 1N56A 1A0IA 2R8GA 1V4YA 4UCVA 2VA3A 3F8NA 4UCUA 3RBDA 2B63A 4X65H 4Q45A 2E5LH 4JI8H 3KHLA 4MV9A 3BQ1A 5C1OA 3PR5B 2I8CA 4LFAH 5DQIA 4J9NA 5L1LA 2IA6A 1RJQA 3R23A 1M0TA 3HB9A 4AYBA 1DIKA 4C5AA 5DGBA 4XYLB 2YCHA 1OWTA 1B6SA 4QWAA 3H3VH 3BQ0A 2IBKA 3IN5A 4BXXG 4B3RH 2HGSA 2XGQA 4RAYA 1B04A 2W7OA 4A3DG 4YR3A 3U9TA 2C2DA 3FMAA 2WYOA 5EWEA 4MA5A 3FKIA 1E4EA 3M9OB 4B3MH 3PW2A 4O2AF 2PVPA 2YS7A 4ECWA 4DL6A 2FLLA 4DV2H 5KFGA 5J2UF 3UFXB 5KG2A 5LYJF 2UVVA 4RB2C 5IYDG 3H4DA 2UVWA 2PBZA 3Q8SB 5L1IA 5C5JA 4JV0A 3HKZE 1GO3E 2DPJA 3ETHA 3H20A 4BBRG 4DL2A 5DQGA 5KFMA 3PO3G 2R7ZA 4RZQA 4CC6A 2V5AA 1I7LA 5JUMA 1EZ1A 4ED8A 3G8CA 4I4TF 2YRWA 5KFYA 2HHHH 5J2TF 3JSNA 2YZMA 2W6NA 4ED2A 3BG5A 4PDBA 4HNUA 3T5LA 3SE7A 4Q43A 5KFFA 1XMOH 4NXMH 4TUYF 4YAJB 5FJ8G 4MTDA 3H0GG 3TINA 1V51A 3I4NG 2R7LA 4J0MA 2J6SA 4U7CA 1CE8A 4HQ6A 3MR6A 4UFZA 3V6KA 4Q8EA 2W9CB 1KJ8A 1DGSA 3R5XA 5LMNH 3PW4A 4IHJF 1FKAH 3GV5B 2W9BB 4J9RA 5JQWA 4XZ3B 4F4XA 2VUMG 3PW0A 1VBGA 5FPRA 3RF2A 3RGZA 2C35B 2FKLA 2XGPA 3I12A 5KT3A 2HVQA 2W6QA 2FB9A 3NGDA 2W57A 2ASLA 5A2QW 3CVZA 5JVDF 3J7AK 2R93G 4HYKA 3MR5A 3OSPA 2UXCH 1P8LA 2DWCA 4YJ2F 3RAQA 2C00A 2W6ZA 2FLPA 1W96A 5KFBA 3GTOA 1XNQH 1S0NA 4FBTA 3PN1A 5GONF 5CAEB 4KHPH 4MA0A 3QFFA 3Q8RB 3KHRA 4Q44A 4ED6A 2W7PA 4A3IG 1C30A 3UQ8A 1E4EB 2Y0SA 1TWFA 4YY3H 2CQYA 1DV1A 3EYYA 4UCOA 4MV6A 2WE6A 3GIIA 1B33N 4QWCA 4ED3A 2W6MA 3N44B 1Y1WG 1ULZA 1JDEA 2OLSA 4DL4A 2V58A 4O2BF 2JA6G 4IWXA 4Q8FA 1KJ9A 1EUCB 3BA9A 4YAKB 4ETSA 2B63G 1EHIA 4RAZA 2WB1E 5K2MA 3KHHA 5EWFA 4ED0A 3C0FB 2OH2A 5L1JA 3RBEA 3GV8B 1WSCA 5CA1F 4RZRA 3GTMA 2WTFA 4YHHH 1SEIA 5KFRA 4DV5H 5H80A 2R93A 4DUYH 5IYBG 4Q0YA 4ECQA 2PMZA 3LMLA 3JAMW 3RB0A 4YJ3F 4RNMA 1K1QA 3TIGA 1Z2OX 1BGWA 5JH7F 5LOVF 4G3IA 2JEFA 2YU9A 2P0AA 5T14A 3EPGA 4X62H 5IYCG 4ECTA 3ORQA 4O3PA 4QIWA 5KG6A 2YZGA 2VQDA 2XCPA 5KFQA 5C4XG 4MV1A 4YR0A 1S0MA 5EWGA 1GSHA 4JI1H 2JEIA 2DPIA 4UCSA 2R92G 1UC9A 5KG1A 3M9MB 4ED1A 1M6VA 4IAJA 4QJFA 5DG9A 2UXBH 1E4GT 3HBLA 1T3NA 1T94A 2RGVA 3GIPA 4EGQA 5C44G 4A3GG 1Y1WA 2W70A 4RB1A 4AYBE 4DLKA 3T5KA 1TAEA 1MZBA 2R7ZG 2UUCH 4NXNH 4YQWA 5HBRB 5KFTA 4EFEA 2JA6A 2HVRA 2MCTA 3U9SA 2FJZA 2R7KA 3MJFA 5KG0A 1IBLH 1GSAA 1S68A 2ZJTA 3FDSA 1DV2A 1E4FT 3M4IA 2ASJA 4A3LG 5LL6b 1KJIA 1TA8A 2C22A 1XNRH 2YRXA 2FP4B 3QZ8A 3RIZA 4TQRA 1JXLA 5I47A 3RFCA 1XDNA 5FD5A 4BY7G 4DR2H 5KFPA 4TQSA 4LF9H 3N41B 1KJJA 4IRCA 1JDBB 4E4TA 5DGAA 5D8DA 2BQ3A 4DR1H 2FPGB 4J9OA 2R8IA 4A3CG 2DZDA 1N48A 4QW9A 4DV4H 2NVXA 2V9WA 4LFCH 4CC5A 2ZM6H 2QYZA 5DLFA 2E2HA 3HOWG 5KFCA 3H4BA 5FPOA 2M05A 2AGPA 2I80A 4O4LF 3H40A 2ASDA 2R92A 4C2MA 3CQZA 4J9SA 5IWAH 5KT4A 5KT7A 4BBSG 5KFWA 1AUVA 4YR2A 2DIKA 2JA5A 2V4RA 1T36A 5C1PA 4ECXA 2E2IA 1IBMH 3OHBA 2RDIA 1I7NA 5IYZF 4DV3H 4BWSC 2WAQA 3MR3A 3KTMA 5LP6F 1ZQ7A 4B3TH 1RYSA 4DV7H 2J9GA 4JI3H 1JIHA 3KXYT 4IRDA 2JA7G 2V59A 1JKJB 4FS2A 4JI6H 2GLTA 1ZHSA 3HOZG 3PO2G 2XCLA 1RK6A 4IWYA 2YS6A 4ECZA 2ZDHA 4EGJA 4MV4A 1WH2A 3RV4A 3EPIA 4F4YA 3KALA 3RB4A 2C28A 2XIGA 1CS0A 1KJQA 2R6FA 4O4HF 2RGRA 4O4IF 3VPDA 4DR5H 1KEEA 2W8LA 4GC7A 4O3SA 2UVUA 2W8KA 1WCMG 3GTQA 1S03G 4EBEA 2R8JA 4MV7A 1TWGA 4MTEA 3RTXA 3GIMA 5LMUH 2Y0SE 3VPCA 1PX2A 2X0SA 4ZOLF 2W71A 1KC7A 2R7MA 5EZYF 2YW2A 2VQFH 4DV0H 2AGQA 3MFHA 4DL5A 4A93G 5FLMG 2UUBH 4JI5H 4I55F 2O03A 1TWHA 2RDJA 2IP4A 2FPPB 2R8KA 2R82A 4EYIB 2VA2A 5KFLA 5EDWA 4UCTA 3JRWA 4JYAH 3J80W 2XC9A 2UXDH 2JA7A 2DLNA 4A3KG 1J5EH 5DG8A 3BABA 1TWCA 4GLXA 4RB3C 5IP9G 3K3VA 4HNTA 2JA8G 3V4ZA 2PMZE 4EFBA 2Q2UA 3GILA 1Y1VA 2BR0A 2QK4A 3N42B 3BQ2A 4FBUA 3PW5A 3OHAA 4RNOA 5F9NA 2FK2A 4DV1H 1S97A 1VKZA 1WCMA 3MWEA 3R5HA 3G6VA 2FK1A 4QIWE 1IOWA 2FPIB 4OX9H 3TQ1A 3OUUA 3WO1A 1AUXA 1XMQH 3J81W 4DR3H 4ZQIA 4ECUA 2OWOA 4QWBA 1GSOA 2FE3A 1K1SA 3RAXA 1B6RA 3WNZA 3BA8A 1VBHA 1SCUB 4ECRA 3MWMA 3WO0A 2YYAA 1IBKH 4X66H 2ZDQA 4IR1A 3I4MG 4JUZA 3PZPA 2NU8B 1C3OA 4O3NA 4I7HA 1WR2A 3N8DA 2FLNA 3GV7B 4LSXA 3GTJA 3ORRA 4JI0H 3JSLA 1EUDB 5C3EG 3E5NA 3MR2A 4JI2H 1R9TA 4M7EA 3GIKA 4FM9A 5KKNB 2V4QA 4F50A 4M9UA 4ZHQF 4J9MA 2JA5G 3OUZA 3KHGA 4J9PA 3AYHB 3MWDA 4A3JG 4LF7H 1BJTA 2ATLA 3GIDA 2PN1A 4JV1A 3TQTA 5FLXW 5CA0F 3G6XA 1JX4A 2JEGA 5IP7G 4XYMB 2YZNA 1N32H 4EG0A 3T5HA 4HNVA 5D1OA 4TV8F 4RNNA 4ECSA 2WDTA 2VPQA 3GIJA 3K3PA 1ZHQA 3HOYG 1M0WA 1V9PA 4F4WA 4R8UB 1S0OA 3QZ7A 1CQIB 3LWBA 3PR4A 4O3OA 3TIIA 2VQEH 4J9LA 3RV3A 4LH6A 5EOYA 4GC6A 1W93A 4O3QA 1AN7A 2HVSA 5BPHA 2XD4A 5HV6A 2AU0A 3R5FA 1UC8A 4F4ZA 1RK5A 3KAJA 4Y8VB 2WAQE 4X64H 4A3MG 4TV9F 4DL3A 2UUAH 1Z2NX 4GKJH 4XX0B 5KFUA 4DR6H 3K5IA 4EEQA 1PK8A 4ZI7F 2VPSA 4YBZB 2NU7B 5CB4F 3GLKA 1RJPA 3N6XA 2C2RA 1JLLB 4APMA 1BXRA 1L2ZA 2R87A 4PWQA 5BR8H 3RB3A 5KG5A 1M7JA 4LF8H 3Q1KA 3T5JA 4JI4H 2VR1A 4AQYH 1GGOA 5L9XA 5BMVF 3DF7A 5KFIA 2R8HA 1RYRA 1TWAA 5KG7A 1VS0A 5KT5A 2R86A 1A9XA 5KT2A 1Y1VG 5L1KA 4DR4H 2C2EA 1BNCA 4MV3A 5F9LA 1GYFA 4EYHB 5KFZA 4LFBH 5KFXA 5DG7A 1X9NA 1N34H 1N33H 1K83A 3RJ0A 3GIQA 2ALZA 2NU6B 4QWEA 3L4JA 3HKZA 4K0KH 4DL7A 4ME6A 1EYZA 1GLVA 4FU0A 5D1OB 4RU9A 3N43B 3V4SA 3BAAA 2FK3A 2FMAA 2R85A 4EBCA 4A3EG 4I50F 2AGOA 1HNWH 2VUGA 4JI7H 4LSAA 4RUAA 4R7RA 3OSNA 1IOVA 3RUPA 4YP3A 4LF4H 4U6PA 3Q8PB 1S10A 1Y14B 4NLGA 5LXTF 1HNZH 4DR7H 2CKZB 5C8YF 4LH7A 2W6OA 4UCRA 4C5BA 3KAKA 4R8UA 5KFDA 4RUCA 3T1HH 4A2AA 1RJRA 5KX5F 3VMMA 2XCAA 1CQJB 4MAMA 4RB0A 4ED7A 2IMWP 5KFVA 1O75A 2NU9B 5BPFA 1N36H 3HOUG 1ZETA 4L1KA 4A2BA 3RGXA 3GQCA 4IR9A 4LF5H 5KFKA 5KFEA 2YL2A 1HR0H 5D1PA 2NUAB 5KFAA 2AQ4A 4IZOA 1S9FA 3V6JA 2UVRA 4MV8A 3IG0A 4QWDA 3GTLA 4DUZH 3N40P 1KBLA 4J9KA 2J6UA 1HNXH 2ZDGA 5KFSA 4ECYA 2VOBA 2SCUB 4QW8A 5KFNA 3SI8A 2Q2TA 3H0GA 4LMYA 1FJGH 1I3QA 5KFHA 3JZIA 4HR7A 4O3RA 4DV6H 5KG4A 5KG3A 2BQRA 2CZGA 2GPWA 5JVLA 3MFIA 2W9AA 3Q8QB 2GPSA 3PW7A 2VUMA 2KSWA 2R84A 2I87A 4JV5H 3V6HA 3PVXA 2RF4A 4EBDA 3L2PA 4IRKA 3GTKA 2F4VH 5FD6A 4A3FG 5IT9W 4GKKH 3T1YH 2R7NA 2UU9H 4YB8B 2CW8A 3OTOH 3GTGA 3RB6A 1Z2PX 2WB1A 3HOXG 4EEYA 3K5HA 4LF6H 5DLGA 2NVYA 2HJWA 1I50A 2J6TA 3Q2OA 3VPBA 4JV2A 1I6UA 3HXLA 4B3SH 5KFJA 1I94H 4BY1G 3L4KA 3FKIG 4WBNF 3JRXA
chains in the Genus database with same CATH topology
1L2ZA 3BA9A 1FVIA 4MV7A 4ETSA 5BR8H 4MTEA 3RTXA 4LF8H 4RAZA 5LMUH 3C0FB 4JI4H 4AQYH 2CW7A 4YHHH 1SEIA 1SYXB 1A0IA 4DV5H 3DF7A 4UCVA 2VQFH 3F8NA 4Q0YA 4UCUA 4DUYH 4DV0H 3LMLA 3JAMW 2UUBH 4X65H 4JI5H 1Z2OX 1BGWA 2E5LH 2O03A 1VS0A 4JI8H 4MV9A 4LFAH 4X62H 4UCTA 4DR4H 4JYAH 3J80W 1M0TA 2UXDH 1J5EH 1GYFA 2YCHA 3BABA 4LFBH 4GLXA 4RB3C 1X9NA 3K3VA 1N34H 1N33H 3RJ0A 4EFBA 2Q2UA 4JI1H 4UCSA 3L4JA 4B3RH 2HGSA 4K0KH 4RAYA 1B04A 3N42B 4IAJA 5D1OB 2UXBH 1E4GT 3FMAA 2WYOA 3N43B 2RGVA 4B3MH 3BAAA 4RB1A 4DV1H 1TAEA 1MZBA 4DV2H 2UUCH 4NXNH 1HNWH 4EFEA 2VUGA 4JI7H 4OX9H 2HVRA 2MCTA 4LSAA 4R7RA 4RB2C 1IBLH 1S68A 2ZJTA 3J81W 4DR3H 1XMQH 4LF4H 1E4FT 3M4IA 2OWOA 2FE3A 5LL6b 1HNZH 3BA8A 1TA8A 1XNRH 4DR7H 3H20A 4LH7A 3MWMA 4RZQA 4UCRA 3KAKA 4CC6A 3RIZA 3T1HH 4X66H 1IBKH 4A2AA 1XDNA 5FD5A 4RB0A 2HHHH 4DR2H 1O75A 3JSNA 4I7HA 1N36H 3N41B 4LF9H 4A2BA 4LSXA 3RGXA 4LF5H 4DR1H 4JI0H 4PDBA 3JSLA 1XMOH 1HR0H 4NXMH 5D1PA 4JI2H 4DV4H 4M7EA 4MTDA 4FM9A 4LFCH 4CC5A 3IG0A 2ZM6H 4DUZH 3N40P 4J0MA 5FPOA 4UFZA 1HNXH 4LF7H 1DGSA 1BJTA 5LMNH 1FKAH 2VOBA 5FLXW 2Q2TA 4LMYA 1FJGH 5FPRA 3RF2A 3RGZA 5IWAH 2HVQA 4DV6H 1N32H 2W57A 5D1OA 3J7AK 5A2QW 3CVZA 2WDTA 1IBMH 1ZHQA 2UXCH 1M0WA 1V9PA 2KSWA 4DV3H 4JV5H 1P8LA 4BWSC 2VQEH 4B3TH 4LH6A 4DV7H 1XNQH 3L2PA 4JI3H 5EOYA 5FD6A 2F4VH 5IT9W 3KXYT 4GKKH 3T1YH 3PN1A 2UU9H 1AN7A 2HVSA 4JI6H 1ZHSA 2CW8A 3OTOH 4KHPH 1WH2A 3KAJA 1Z2PX 3KALA 3UQ8A 4YY3H 4LF6H 4X64H 2XIGA 4GKJH 2UUAH 3EYYA 1Z2NX 4UCOA 2RGRA 2WE6A 3HXLA 4DR5H 4B3SH 4DR6H 1I6UA 1I94H 4EEQA 3L4KA 2VPSA 3N44B 3N6XA 4APMA 1S03G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0F B; 
#chains in the Genus database with same CATH topology
 4J9Q A;  4FS1 A;  3ETJ A;  4C5C A;  3M9N B;  1FVI A;  1SFO A;  2W6P A;  5KT6 A;  5KFO A;  3G6Y A;  3HOV G;  3GTP A;  3BJY A;  2W9C A;  5LA6 F;  1UNN C;  5DQH A;  1VAJ A;  4WD3 A;  2W9B A;  4A3B G;  2CW7 A;  3LP8 A;  2BQU A;  2JEJ A;  1SYX B;  4ECV A;  1N56 A;  1A0I A;  2R8G A;  1V4Y A;  4UCV A;  2VA3 A;  3F8N A;  4UCU A;  3RBD A;  2B63 A;  4X65 H;  4Q45 A;  2E5L H;  4JI8 H;  3KHL A;  4MV9 A;  3BQ1 A;  5C1O A;  3PR5 B;  2I8C A;  4LFA H;  5DQI A;  4J9N A;  5L1L A;  2IA6 A;  1RJQ A;  3R23 A;  1M0T A;  3HB9 A;  4AYB A;  1DIK A;  4C5A A;  5DGB A;  4XYL B;  2YCH A;  1OWT A;  1B6S A;  4QWA A;  3H3V H;  3BQ0 A;  2IBK A;  3IN5 A;  4BXX G;  4B3R H;  2HGS A;  2XGQ A;  4RAY A;  1B04 A;  2W7O A;  4A3D G;  4YR3 A;  3U9T A;  2C2D A;  3FMA A;  2WYO A;  5EWE A;  4MA5 A;  3FKI A;  1E4E A;  3M9O B;  4B3M H;  3PW2 A;  4O2A F;  2PVP A;  2YS7 A;  4ECW A;  4DL6 A;  2FLL A;  4DV2 H;  5KFG A;  5J2U F;  3UFX B;  5KG2 A;  5LYJ F;  2UVV A;  4RB2 C;  5IYD G;  3H4D A;  2UVW A;  2PBZ A;  3Q8S B;  5L1I A;  5C5J A;  4JV0 A;  3HKZ E;  1GO3 E;  2DPJ A;  3ETH A;  3H20 A;  4BBR G;  4DL2 A;  5DQG A;  5KFM A;  3PO3 G;  2R7Z A;  4RZQ A;  4CC6 A;  2V5A A;  1I7L A;  5JUM A;  1EZ1 A;  4ED8 A;  3G8C A;  4I4T F;  2YRW A;  5KFY A;  2HHH H;  5J2T F;  3JSN A;  2YZM A;  2W6N A;  4ED2 A;  3BG5 A;  4PDB A;  4HNU A;  3T5L A;  3SE7 A;  4Q43 A;  5KFF A;  1XMO H;  4NXM H;  4TUY F;  4YAJ B;  5FJ8 G;  4MTD A;  3H0G G;  3TIN A;  1V51 A;  3I4N G;  2R7L A;  4J0M A;  2J6S A;  4U7C A;  1CE8 A;  4HQ6 A;  3MR6 A;  4UFZ A;  3V6K A;  4Q8E A;  2W9C B;  1KJ8 A;  1DGS A;  3R5X A;  5LMN H;  3PW4 A;  4IHJ F;  1FKA H;  3GV5 B;  2W9B B;  4J9R A;  5JQW A;  4XZ3 B;  4F4X A;  2VUM G;  3PW0 A;  1VBG A;  5FPR A;  3RF2 A;  3RGZ A;  2C35 B;  2FKL A;  2XGP A;  3I12 A;  5KT3 A;  2HVQ A;  2W6Q A;  2FB9 A;  3NGD A;  2W57 A;  2ASL A;  5A2Q W;  3CVZ A;  5JVD F;  3J7A K;  2R93 G;  4HYK A;  3MR5 A;  3OSP A;  2UXC H;  1P8L A;  2DWC A;  4YJ2 F;  3RAQ A;  2C00 A;  2W6Z A;  2FLP A;  1W96 A;  5KFB A;  3GTO A;  1XNQ H;  1S0N A;  4FBT A;  3PN1 A;  5GON F;  5CAE B;  4KHP H;  4MA0 A;  3QFF A;  3Q8R B;  3KHR A;  4Q44 A;  4ED6 A;  2W7P A;  4A3I G;  1C30 A;  3UQ8 A;  1E4E B;  2Y0S A;  1TWF A;  4YY3 H;  2CQY A;  1DV1 A;  3EYY A;  4UCO A;  4MV6 A;  2WE6 A;  3GII A;  1B33 N;  4QWC A;  4ED3 A;  2W6M A;  3N44 B;  1Y1W G;  1ULZ A;  1JDE A;  2OLS A;  4DL4 A;  2V58 A;  4O2B F;  2JA6 G;  4IWX A;  4Q8F A;  1KJ9 A;  1EUC B;  3BA9 A;  4YAK B;  4ETS A;  2B63 G;  1EHI A;  4RAZ A;  2WB1 E;  5K2M A;  3KHH A;  5EWF A;  4ED0 A;  3C0F B;  2OH2 A;  5L1J A;  3RBE A;  3GV8 B;  1WSC A;  5CA1 F;  4RZR A;  3GTM A;  2WTF A;  4YHH H;  1SEI A;  5KFR A;  4DV5 H;  5H80 A;  2R93 A;  4DUY H;  5IYB G;  4Q0Y A;  4ECQ A;  2PMZ A;  3LML A;  3JAM W;  3RB0 A;  4YJ3 F;  4RNM A;  1K1Q A;  3TIG A;  1Z2O X;  1BGW A;  5JH7 F;  5LOV F;  4G3I A;  2JEF A;  2YU9 A;  2P0A A;  5T14 A;  3EPG A;  4X62 H;  5IYC G;  4ECT A;  3ORQ A;  4O3P A;  4QIW A;  5KG6 A;  2YZG A;  2VQD A;  2XCP A;  5KFQ A;  5C4X G;  4MV1 A;  4YR0 A;  1S0M A;  5EWG A;  1GSH A;  4JI1 H;  2JEI A;  2DPI A;  4UCS A;  2R92 G;  1UC9 A;  5KG1 A;  3M9M B;  4ED1 A;  1M6V A;  4IAJ A;  4QJF A;  5DG9 A;  2UXB H;  1E4G T;  3HBL A;  1T3N A;  1T94 A;  2RGV A;  3GIP A;  4EGQ A;  5C44 G;  4A3G G;  1Y1W A;  2W70 A;  4RB1 A;  4AYB E;  4DLK A;  3T5K A;  1TAE A;  1MZB A;  2R7Z G;  2UUC H;  4NXN H;  4YQW A;  5HBR B;  5KFT A;  4EFE A;  2JA6 A;  2HVR A;  2MCT A;  3U9S A;  2FJZ A;  2R7K A;  3MJF A;  5KG0 A;  1IBL H;  1GSA A;  1S68 A;  2ZJT A;  3FDS A;  1DV2 A;  1E4F T;  3M4I A;  2ASJ A;  4A3L G;  5LL6 b;  1KJI A;  1TA8 A;  2C22 A;  1XNR H;  2YRX A;  2FP4 B;  3QZ8 A;  3RIZ A;  4TQR A;  1JXL A;  5I47 A;  3RFC A;  1XDN A;  5FD5 A;  4BY7 G;  4DR2 H;  5KFP A;  4TQS A;  4LF9 H;  3N41 B;  1KJJ A;  4IRC A;  1JDB B;  4E4T A;  5DGA A;  5D8D A;  2BQ3 A;  4DR1 H;  2FPG B;  4J9O A;  2R8I A;  4A3C G;  2DZD A;  1N48 A;  4QW9 A;  4DV4 H;  2NVX A;  2V9W A;  4LFC H;  4CC5 A;  2ZM6 H;  2QYZ A;  5DLF A;  2E2H A;  3HOW G;  5KFC A;  3H4B A;  5FPO A;  2M05 A;  2AGP A;  2I80 A;  4O4L F;  3H40 A;  2ASD A;  2R92 A;  4C2M A;  3CQZ A;  4J9S A;  5IWA H;  5KT4 A;  5KT7 A;  4BBS G;  5KFW A;  1AUV A;  4YR2 A;  2DIK A;  2JA5 A;  2V4R A;  1T36 A;  5C1P A;  4ECX A;  2E2I A;  1IBM H;  3OHB A;  2RDI A;  1I7N A;  5IYZ F;  4DV3 H;  4BWS C;  2WAQ A;  3MR3 A;  3KTM A;  5LP6 F;  1ZQ7 A;  4B3T H;  1RYS A;  4DV7 H;  2J9G A;  4JI3 H;  1JIH A;  3KXY T;  4IRD A;  2JA7 G;  2V59 A;  1JKJ B;  4FS2 A;  4JI6 H;  2GLT A;  1ZHS A;  3HOZ G;  3PO2 G;  2XCL A;  1RK6 A;  4IWY A;  2YS6 A;  4ECZ A;  2ZDH A;  4EGJ A;  4MV4 A;  1WH2 A;  3RV4 A;  3EPI A;  4F4Y A;  3KAL A;  3RB4 A;  2C28 A;  2XIG A;  1CS0 A;  1KJQ A;  2R6F A;  4O4H F;  2RGR A;  4O4I F;  3VPD A;  4DR5 H;  1KEE A;  2W8L A;  4GC7 A;  4O3S A;  2UVU A;  2W8K A;  1WCM G;  3GTQ A;  1S03 G;  4EBE A;  2R8J A;  4MV7 A;  1TWG A;  4MTE A;  3RTX A;  3GIM A;  5LMU H;  2Y0S E;  3VPC A;  1PX2 A;  2X0S A;  4ZOL F;  2W71 A;  1KC7 A;  2R7M A;  5EZY F;  2YW2 A;  2VQF H;  4DV0 H;  2AGQ A;  3MFH A;  4DL5 A;  4A93 G;  5FLM G;  2UUB H;  4JI5 H;  4I55 F;  2O03 A;  1TWH A;  2RDJ A;  2IP4 A;  2FPP B;  2R8K A;  2R82 A;  4EYI B;  2VA2 A;  5KFL A;  5EDW A;  4UCT A;  3JRW A;  4JYA H;  3J80 W;  2XC9 A;  2UXD H;  2JA7 A;  2DLN A;  4A3K G;  1J5E H;  5DG8 A;  3BAB A;  1TWC A;  4GLX A;  4RB3 C;  5IP9 G;  3K3V A;  4HNT A;  2JA8 G;  3V4Z A;  2PMZ E;  4EFB A;  2Q2U A;  3GIL A;  1Y1V A;  2BR0 A;  2QK4 A;  3N42 B;  3BQ2 A;  4FBU A;  3PW5 A;  3OHA A;  4RNO A;  5F9N A;  2FK2 A;  4DV1 H;  1S97 A;  1VKZ A;  1WCM A;  3MWE A;  3R5H A;  3G6V A;  2FK1 A;  4QIW E;  1IOW A;  2FPI B;  4OX9 H;  3TQ1 A;  3OUU A;  3WO1 A;  1AUX A;  1XMQ H;  3J81 W;  4DR3 H;  4ZQI A;  4ECU A;  2OWO A;  4QWB A;  1GSO A;  2FE3 A;  1K1S A;  3RAX A;  1B6R A;  3WNZ A;  3BA8 A;  1VBH A;  1SCU B;  4ECR A;  3MWM A;  3WO0 A;  2YYA A;  1IBK H;  4X66 H;  2ZDQ A;  4IR1 A;  3I4M G;  4JUZ A;  3PZP A;  2NU8 B;  1C3O A;  4O3N A;  4I7H A;  1WR2 A;  3N8D A;  2FLN A;  3GV7 B;  4LSX A;  3GTJ A;  3ORR A;  4JI0 H;  3JSL A;  1EUD B;  5C3E G;  3E5N A;  3MR2 A;  4JI2 H;  1R9T A;  4M7E A;  3GIK A;  4FM9 A;  5KKN B;  2V4Q A;  4F50 A;  4M9U A;  4ZHQ F;  4J9M A;  2JA5 G;  3OUZ A;  3KHG A;  4J9P A;  3AYH B;  3MWD A;  4A3J G;  4LF7 H;  1BJT A;  2ATL A;  3GID A;  2PN1 A;  4JV1 A;  3TQT A;  5FLX W;  5CA0 F;  3G6X A;  1JX4 A;  2JEG A;  5IP7 G;  4XYM B;  2YZN A;  1N32 H;  4EG0 A;  3T5H A;  4HNV A;  5D1O A;  4TV8 F;  4RNN A;  4ECS A;  2WDT A;  2VPQ A;  3GIJ A;  3K3P A;  1ZHQ A;  3HOY G;  1M0W A;  1V9P A;  4F4W A;  4R8U B;  1S0O A;  3QZ7 A;  1CQI B;  3LWB A;  3PR4 A;  4O3O A;  3TII A;  2VQE H;  4J9L A;  3RV3 A;  4LH6 A;  5EOY A;  4GC6 A;  1W93 A;  4O3Q A;  1AN7 A;  2HVS A;  5BPH A;  2XD4 A;  5HV6 A;  2AU0 A;  3R5F A;  1UC8 A;  4F4Z A;  1RK5 A;  3KAJ A;  4Y8V B;  2WAQ E;  4X64 H;  4A3M G;  4TV9 F;  4DL3 A;  2UUA H;  1Z2N X;  4GKJ H;  4XX0 B;  5KFU A;  4DR6 H;  3K5I A;  4EEQ A;  1PK8 A;  4ZI7 F;  2VPS A;  4YBZ B;  2NU7 B;  5CB4 F;  3GLK A;  1RJP A;  3N6X A;  2C2R A;  1JLL B;  4APM A;  1BXR A;  1L2Z A;  2R87 A;  4PWQ A;  5BR8 H;  3RB3 A;  5KG5 A;  1M7J A;  4LF8 H;  3Q1K A;  3T5J A;  4JI4 H;  2VR1 A;  4AQY H;  1GGO A;  5L9X A;  5BMV F;  3DF7 A;  5KFI A;  2R8H A;  1RYR A;  1TWA A;  5KG7 A;  1VS0 A;  5KT5 A;  2R86 A;  1A9X A;  5KT2 A;  1Y1V G;  5L1K A;  4DR4 H;  2C2E A;  1BNC A;  4MV3 A;  5F9L A;  1GYF A;  4EYH B;  5KFZ A;  4LFB H;  5KFX A;  5DG7 A;  1X9N A;  1N34 H;  1N33 H;  1K83 A;  3RJ0 A;  3GIQ A;  2ALZ A;  2NU6 B;  4QWE A;  3L4J A;  3HKZ A;  4K0K H;  4DL7 A;  4ME6 A;  1EYZ A;  1GLV A;  4FU0 A;  5D1O B;  4RU9 A;  3N43 B;  3V4S A;  3BAA A;  2FK3 A;  2FMA A;  2R85 A;  4EBC A;  4A3E G;  4I50 F;  2AGO A;  1HNW H;  2VUG A;  4JI7 H;  4LSA A;  4RUA A;  4R7R A;  3OSN A;  1IOV A;  3RUP A;  4YP3 A;  4LF4 H;  4U6P A;  3Q8P B;  1S10 A;  1Y14 B;  4NLG A;  5LXT F;  1HNZ H;  4DR7 H;  2CKZ B;  5C8Y F;  4LH7 A;  2W6O A;  4UCR A;  4C5B A;  3KAK A;  4R8U A;  5KFD A;  4RUC A;  3T1H H;  4A2A A;  1RJR A;  5KX5 F;  3VMM A;  2XCA A;  1CQJ B;  4MAM A;  4RB0 A;  4ED7 A;  2IMW P;  5KFV A;  1O75 A;  2NU9 B;  5BPF A;  1N36 H;  3HOU G;  1ZET A;  4L1K A;  4A2B A;  3RGX A;  3GQC A;  4IR9 A;  4LF5 H;  5KFK A;  5KFE A;  2YL2 A;  1HR0 H;  5D1P A;  2NUA B;  5KFA A;  2AQ4 A;  4IZO A;  1S9F A;  3V6J A;  2UVR A;  4MV8 A;  3IG0 A;  4QWD A;  3GTL A;  4DUZ H;  3N40 P;  1KBL A;  4J9K A;  2J6U A;  1HNX H;  2ZDG A;  5KFS A;  4ECY A;  2VOB A;  2SCU B;  4QW8 A;  5KFN A;  3SI8 A;  2Q2T A;  3H0G A;  4LMY A;  1FJG H;  1I3Q A;  5KFH A;  3JZI A;  4HR7 A;  4O3R A;  4DV6 H;  5KG4 A;  5KG3 A;  2BQR A;  2CZG A;  2GPW A;  5JVL A;  3MFI A;  2W9A A;  3Q8Q B;  2GPS A;  3PW7 A;  2VUM A;  2KSW A;  2R84 A;  2I87 A;  4JV5 H;  3V6H A;  3PVX A;  2RF4 A;  4EBD A;  3L2P A;  4IRK A;  3GTK A;  2F4V H;  5FD6 A;  4A3F G;  5IT9 W;  4GKK H;  3T1Y H;  2R7N A;  2UU9 H;  4YB8 B;  2CW8 A;  3OTO H;  3GTG A;  3RB6 A;  1Z2P X;  2WB1 A;  3HOX G;  4EEY A;  3K5H A;  4LF6 H;  5DLG A;  2NVY A;  2HJW A;  1I50 A;  2J6T A;  3Q2O A;  3VPB A;  4JV2 A;  1I6U A;  3HXL A;  4B3S H;  5KFJ A;  1I94 H;  4BY1 G;  3L4K A;  3FKI G;  4WBN F;  3JRX A; 
#chains in the Genus database with same CATH homology
 1L2Z A;  3BA9 A;  1FVI A;  4MV7 A;  4ETS A;  5BR8 H;  4MTE A;  3RTX A;  4LF8 H;  4RAZ A;  5LMU H;  3C0F B;  4JI4 H;  4AQY H;  2CW7 A;  4YHH H;  1SEI A;  1SYX B;  1A0I A;  4DV5 H;  3DF7 A;  4UCV A;  2VQF H;  3F8N A;  4Q0Y A;  4UCU A;  4DUY H;  4DV0 H;  3LML A;  3JAM W;  2UUB H;  4X65 H;  4JI5 H;  1Z2O X;  1BGW A;  2E5L H;  2O03 A;  1VS0 A;  4JI8 H;  4MV9 A;  4LFA H;  4X62 H;  4UCT A;  4DR4 H;  4JYA H;  3J80 W;  1M0T A;  2UXD H;  1J5E H;  1GYF A;  2YCH A;  3BAB A;  4LFB H;  4GLX A;  4RB3 C;  1X9N A;  3K3V A;  1N34 H;  1N33 H;  3RJ0 A;  4EFB A;  2Q2U A;  4JI1 H;  4UCS A;  3L4J A;  4B3R H;  2HGS A;  4K0K H;  4RAY A;  1B04 A;  3N42 B;  4IAJ A;  5D1O B;  2UXB H;  1E4G T;  3FMA A;  2WYO A;  3N43 B;  2RGV A;  4B3M H;  3BAA A;  4RB1 A;  4DV1 H;  1TAE A;  1MZB A;  4DV2 H;  2UUC H;  4NXN H;  1HNW H;  4EFE A;  2VUG A;  4JI7 H;  4OX9 H;  2HVR A;  2MCT A;  4LSA A;  4R7R A;  4RB2 C;  1IBL H;  1S68 A;  2ZJT A;  3J81 W;  4DR3 H;  1XMQ H;  4LF4 H;  1E4F T;  3M4I A;  2OWO A;  2FE3 A;  5LL6 b;  1HNZ H;  3BA8 A;  1TA8 A;  1XNR H;  4DR7 H;  3H20 A;  4LH7 A;  3MWM A;  4RZQ A;  4UCR A;  3KAK A;  4CC6 A;  3RIZ A;  3T1H H;  4X66 H;  1IBK H;  4A2A A;  1XDN A;  5FD5 A;  4RB0 A;  2HHH H;  4DR2 H;  1O75 A;  3JSN A;  4I7H A;  1N36 H;  3N41 B;  4LF9 H;  4A2B A;  4LSX A;  3RGX A;  4LF5 H;  4DR1 H;  4JI0 H;  4PDB A;  3JSL A;  1XMO H;  1HR0 H;  4NXM H;  5D1P A;  4JI2 H;  4DV4 H;  4M7E A;  4MTD A;  4FM9 A;  4LFC H;  4CC5 A;  3IG0 A;  2ZM6 H;  4DUZ H;  3N40 P;  4J0M A;  5FPO A;  4UFZ A;  1HNX H;  4LF7 H;  1DGS A;  1BJT A;  5LMN H;  1FKA H;  2VOB A;  5FLX W;  2Q2T A;  4LMY A;  1FJG H;  5FPR A;  3RF2 A;  3RGZ A;  5IWA H;  2HVQ A;  4DV6 H;  1N32 H;  2W57 A;  5D1O A;  3J7A K;  5A2Q W;  3CVZ A;  2WDT A;  1IBM H;  1ZHQ A;  2UXC H;  1M0W A;  1V9P A;  2KSW A;  4DV3 H;  4JV5 H;  1P8L A;  4BWS C;  2VQE H;  4B3T H;  4LH6 A;  4DV7 H;  1XNQ H;  3L2P A;  4JI3 H;  5EOY A;  5FD6 A;  2F4V H;  5IT9 W;  3KXY T;  4GKK H;  3T1Y H;  3PN1 A;  2UU9 H;  1AN7 A;  2HVS A;  4JI6 H;  1ZHS A;  2CW8 A;  3OTO H;  4KHP H;  1WH2 A;  3KAJ A;  1Z2P X;  3KAL A;  3UQ8 A;  4YY3 H;  4LF6 H;  4X64 H;  2XIG A;  4GKJ H;  2UUA H;  3EYY A;  1Z2N X;  4UCO A;  2RGR A;  2WE6 A;  3HXL A;  4DR5 H;  4B3S H;  4DR6 H;  1I6U A;  1I94 H;  4EEQ A;  3L4K A;  2VPS A;  3N44 B;  3N6X A;  4APM A;  1S03 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...