3C0FB

Crystal structure of a novel non-pfam protein af1514 from archeoglobus fulgidus dsm 4304 solved by s-sad using a cr x-ray source
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
80
Chain Sequence
IMDEIVNLQKEVSLEEAERYANIASYGDGILLSVHDSTGYRAPEVYCCGEKPWEVYACNRGANLISVNQFEFYFRIEVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a novel non-Pfam protein AF1514 from Archeoglobus fulgidus DSM 4304 solved by S-SAD using a Cr X-ray source.
pubmed doi rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Unknown function
molecule keywords Uncharacterized protein AF_1514
total genus 17
structure length 80
sequence length 85
ec nomenclature
pdb deposition date 2008-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18505 DUF5619 Domain of unknown function (DUF5619)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.340 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3c0fB00
3C0FB
chains in the Genus database with same CATH superfamily
1B04A 1GSAA 1S9FA 4HNUA 2W9BB 3GTMA 2ZDQA 4JI4H 2NUAB 2R8HA 2V58A 3H4DA 2Y0SE 4DR4H 5KFVA 4AYBA 3JZIA 4A3GG 4YJ2F 5IYDG 2AGPA 3K5IA 1GLVA 3GIQA 3LMLA 5L9XA 4J9SA 3RIZA 4IWXA 1C30A 4ZHQF 3R5XA 2BR0A 4RAZA 2GPWA 4M7EA 2FJZA 2WB1A 4I50F 4JUZA 4ECYA 4DL3A 4O4LF 4RB3C 4YHHH 4YR3A 1WSCA 1XNQH 3OSPA 1E4EA 4TQRA 5KFCA 1ULZA 1W96A 3U9TA 3T5JA 1A0IA 3H0GA 2C2DA 1DGSA 3GIIA 4NLGA 1S0MA 1RJPA 5KFKA 5CAEB 5LA6F 2WB1E 3KAJA 5FPOA 4RB2C 4DV5H 4O2AF 5BMVF 3HKZA 3PZPA 2FPGB 2W9BA 2PBZA 4B3TH 3G6XA 2JA5A 4A3EG 3TINA 4O3SA 4UCTA 2HJWA 4YBZB 3BAAA 2YRWA 3PW5A 2QYZA 2VQDA 2YW2A 4J9OA 5D8DA 1V9PA 4DV0H 4AYBE 4FS1A 4CC6A 4DL5A 5FJ8G 4A2BA 1XMQH 4FM9A 1N34H 3TQ1A 4JI6H 1WCMG 4ECTA 3PW0A 1WH2A 2UVVA 2XCPA 1N48A 2R84A 2W57A 3CVZA 2W7OA 4Q8FA 1JXLA 3MJFA 2GLTA 1GGOA 4QWBA 1X9NA 4J9RA 2VA2A 2FLPA 5JVLA 2CKZB 5LXTF 4RNNA 1BGWA 5KKNB 1JDEA 2JEIA 1GSHA 3HB9A 4TUYF 1E4FT 3KHHA 4A3FG 2JEFA 3OTOH 3UFXB 4JI7H 4BWSC 2JA7A 4TV8F 1KJJA 5D1OA 5EWGA 2OLSA 4EEYA 2R7MA 3RV3A 1Z2PX 3MWMA 3WO1A 5IYCG 4LFAH 5T14A 1FVIA 4B3SH 1JIHA 3GIJA 3F8NA 4KHPH 3RUPA 3RGXA 2I87A 1JKJB 4ED0A 1E4GT 4DV4H 4R8UB 4O3OA 2VUGA 3RAXA 5KT4A 2AU0A 4MV7A 1Z2OX 4DR6H 2B63G 1CQJB 2XC9A 2BQ3A 3PO2G 5EZYF 2R93A 3H20A 2NVXA 4HNTA 4JYAH 4E4TA 1V4YA 3ORQA 1I50A 4JV2A 4F4XA 2R86A 5CA1F 3GTQA 1B33N 1DV2A 2YCHA 5J2UF 3N40P 5KFXA 3ORRA 3EPGA 2UU9H 1GO3E 4EG0A 2UXDH 2YZNA 2FLLA 3EYYA 3RB6A 3V4ZA 4LF8H 3RGZA 3TIIA 4G3IA 2W9CA 1RYRA 4R7RA 2R7LA 5LMUH 1GSOA 1S0NA 3V6KA 4A3CG 4Q0YA 4I4TF 5IP7G 4ECWA 3HOUG 2WDTA 5IYZF 1S68A 5KFJA 2I80A 1VBGA 3OUUA 3PR5B 2ASLA 5DGAA 2E5LH 4RB1A 4IR1A 4A3DG 4XYLB 4LF4H 1EHIA 4O3QA 3V4SA 5F9LA 4X62H 2R7ZA 3T1HH 4PWQA 1RK5A 2PMZE 4ME6A 4JV0A 5KFNA 1FKAH 3ETJA 4BY7G 5KG7A 3HOWG 3GIKA 3C0FB 1CQIB 3H40A 3HOXG 2XD4A 1JX4A 4LFCH 3FKIG 2PMZA 1EUDB 2IMWP 4J9KA 3M9NB 3GTLA 1AUXA 4Q44A 4I55F 2RGVA 4NXMH 1VS0A 3PW2A 4IAJA 3BQ1A 1BJTA 1Z2NX 4LH7A 5KT6A 4YJ3F 5DGBA 3J81W 3VMMA 2JA8G 5C8YF 3BJYA 5D1PA 4RZRA 2V59A 4DR7H 5JUMA 3K3PA 3KTMA 2DLNA 2M05A 4UCRA 2W8LA 2CW8A 3JRWA 3JSNA 1TWHA 1SCUB 4WD3A 2W9CB 2C00A 2QK4A 2R93G 2NU7B 1UNNC 4DV7H 2WAQA 2W6PA 5CA0F 2W70A 4J9MA 2RF4A 5FLXW 2J6UA 2FMAA 4LF9H 2R7ZG 5H80A 4TQSA 5EDWA 3GV7B 2R92A 1S10A 1SEIA 4ED2A 4X65H 1T36A 4UCSA 1S97A 4M9UA 1HNWH 5KFTA 4UCUA 3M4IA 3Q8PB 4EGJA 4HR7A 2R8KA 2VPQA 5JVDF 4ED3A 1R9TA 2VPSA 4ECXA 2FK3A 5KG3A 4EEQA 1S0OA 3KHRA 5DLFA 1M0TA 4EFEA 1KJQA 5BPFA 4DL6A 3PVXA 5KFYA 4PDBA 4A3LG 5KFUA 5CB4F 1I7NA 1K1SA 4QWEA 1XNRH 2O03A 2IBKA 4EBEA 4LF5H 1TAEA 4YAJB 4BY1G 2R85A 3RFCA 2FLNA 2CQYA 2YRXA 2IP4A 4DV3H 5EWFA 2NU9B 4DL7A 2JEJA 4O4HF 5L1KA 2C2EA 4JI3H 1BXRA 3IG0A 1I94H 1VBHA 2UUCH 4FBTA 2FE3A 2ASJA 2YS7A 3KAKA 3R23A 4Q43A 1M6VA 4U7CA 2BQUA 3WNZA 2W6ZA 4MV1A 4EFBA 2AQ4A 2WAQE 4DL4A 3K5HA 4GLXA 2WE6A 2JA7G 5C1OA 5KG6A 4ECRA 3MWEA 5HBRB 3GILA 4RNOA 2XCAA 3G8CA 4GC6A 3L2PA 4X66H 5DQIA 4C5AA 3NGDA 2VR1A 3MR5A 2V4QA 3HOVG 3BG5A 4IWYA 5IWAH 2E2IA 3I4MG 1M7JA 5KFFA 3BA9A 2YZGA 3GIDA 1ZQ7A 4J0MA 2UVWA 4MAMA 4BXXG 2ZJTA 4MTEA 3VPBA 4F4YA 1Y1WG 3MFHA 4A3BG 3TIGA 2HGSA 4JI2H 5KT2A 4JV5H 2I8CA 3Q2OA 4EBCA 3RV4A 2OWOA 4JI8H 3CQZA 4YB8B 4ED1A 2J6TA 1W93A 3UQ8A 1XDNA 3R5FA 2RDJA 4ED8A 1O75A 4ZQIA 3GTKA 4LF7H 1AN7A 4K0KH 2W6MA 3JRXA 4MA5A 4C2MA 1JLLB 4R8UA 3RJ0A 4U6PA 1HR0H 2JA5G 5KG5A 4GKKH 4QJFA 5HV6A 1PK8A 3PO3G 2CW7A 2F4VH 3AYHB 5IT9W 1N33H 5KG1A 1RK6A 5KT5A 4X64H 2Q2UA 3GQCA 5A2QW 4UCVA 2VUMA 2R8IA 5KFHA 2VQEH 4HYKA 2GPSA 1RYSA 4O3PA 5J2TF 4DR1H 3I12A 1S03G 5FD5A 2DPIA 3LP8A 4A93G 4EYHB 4Q45A 4MV4A 2XCLA 1I6UA 1V51A 1T94A 3OSNA 1J5EH 3G6VA 1EYZA 2C2RA 4QWAA 3N8DA 1MZBA 1K1QA 3V6JA 4EYIB 4F4WA 4MTDA 2HHHH 3GLKA 5LOVF 4ZI7F 4YY3H 3G6YA 4DV1H 2WTFA 3BABA 4MV6A 4LSXA 4I7HA 4MV8A 1SYXB 2XIGA 3QZ8A 3GV8B 4FBUA 4QW8A 3J80W 2X0SA 3MFIA 1RJRA 2NVYA 1TWGA 2DPJA 5EOYA 2XGQA 1N56A 3HBLA 4F4ZA 2R8GA 2VA3A 5DLGA 2R82A 4A3JG 5KFDA 4QW9A 5L1IA 2R8JA 2FK2A 4Y8VB 4XX0B 2BQRA 5FPRA 5KFPA 2UUBH 2RGRA 2OH2A 3R5HA 1N32H 1L2ZA 2YL2A 1Y1WA 3ETHA 4O4IF 1KC7A 5KFBA 3GIMA 4YQWA 5DG9A 3RB4A 4IHJF 2YU9A 4RB0A 1JDBB 3JSLA 1EZ1A 3PW7A 4DL2A 3FDSA 2CZGA 4XZ3B 3GV5B 2AGOA 4C5CA 2YZMA 4XYMB 4B3MH 3H3VH 2Y0SA 5JQWA 2W7PA 5KT7A 5KT3A 5L1LA 3J7AK 3GTPA 1C3OA 5LYJF 5LMNH 4JI1H 3H4BA 1IOWA 5KFGA 4IRKA 4IRCA 3M9OB 1XMOH 2Q2TA 4LH6A 4AQYH 2R92G 3N42B 4JI0H 1KEEA 3DF7A 3KHLA 4L1KA 4LFBH 1SFOA 4C5BA 2JEGA 3Q8RB 3FKIA 1GYFA 1Y14B 3HOZG 4QIWA 3GTOA 3QFFA 2P0AA 5C1PA 5KFLA 3BQ0A 3N44B 2NU6B 3H0GG 3MWDA 5FD6A 2UXCH 3OUZA 4LSAA 3L4JA 1ZHQA 4YP3A 3MR3A 3QZ7A 2ZM6H 3N43B 2YS6A 1IOVA 5LP6F 3TQTA 3PN1A 4QIWE 2V4RA 4UCOA 4APMA 3IN5A 5I47A 2V9WA 4Q8EA 2UXBH 2JA6A 3RTXA 4BBSG 2FK1A 3HKZE 3HOYG 3BQ2A 4RUCA 2VUMG 4IRDA 1TA8A 5KFOA 5KFAA 3LWBA 2R7KA 2FPPB 4YR2A 4GC7A 5L1JA 4ECSA 4ECVA 2ATLA 4OX9H 3V6HA 2DIKA 5K2MA 1KJ8A 5D1OB 1IBLH 5GONF 2E2HA 1I7LA 4ETSA 3JAMW 1B6SA 1Y1VG 3RBDA 4ED6A 1K83A 4QWCA 5C4XG 2VOBA 5KFEA 2AGQA 3RAQA 4A3MG 1IBMH 4J9QA 1BNCA 1Y1VA 3KHGA 4F50A 4A3KG 1P8LA 2W9AA 2ASDA 1HNZH 5LL6b 1E4EB 3FMAA 2DWCA 4BBRG 4FS2A 2R87A 5DQGA 1PX2A 2XGPA 3PW4A 2RDIA 3T5HA 2UVUA 2FPIB 1A9XA 2C22A 3EPIA 1VAJA 5KFIA 1OWTA 5C5JA 2FB9A 2IA6A 4IR9A 4ZOLF 3U9SA 1AUVA 1KJIA 3L4KA 3T5LA 5KFWA 4EBDA 4JV1A 4DV6H 4ECZA 3M9MB 4RUAA 2ZDGA 2ZDHA 3OHAA 2W71A 5C44G 3RB3A 4DLKA 1DV1A 3N41B 2J6SA 3MR6A 2UUAH 1EUCB 4RNMA 4ECQA 5IP9G 1M0WA 5KFMA 1FJGH 2J9GA 1B6RA 1WR2A 4DV2H 5IYBG 2VQFH 5F9NA 3KALA 3VPDA 5DQHA 2WYOA 3BA8A 4B3RH 4DR5H 3I4NG 4DR2H 1VKZA 2FP4B 3WO0A 1CS0A 4MV3A 5KFQA 1KJ9A 3T5KA 4EGQA 4O3RA 1TWAA 1DIKA 1TWCA 2W6QA 3SE7A 2FKLA 5KFSA 5KG2A 3Q8QB 4J9PA 4GKJH 4YAKB 2W8KA 2YYAA 1HNXH 2R7NA 2DZDA 2HVRA 1CE8A 2W6OA 4YR0A 4LMYA 3RB0A 3GTGA 3HXLA 1TWFA 2PN1A 4RZQA 5DG8A 2R6FA 5BR8H 3OHBA 5DG7A 2UVRA 2ALZA 1UC8A 3E5NA 3N6XA 2W6NA 3KXYT 4ED7A 4J9NA 5JH7F 4RAYA 3PR4A 2C35B 2JA6G 4A3IG 4UFZA 5BPHA 5KX5F 1WCMA 4HQ6A 4RU9A 5C3EG 3SI8A 1UC9A 5KFRA 5KFZA 1ZETA 2MCTA 4O3NA 2C28A 2KSWA 3RBEA 4FU0A 3K3VA 3T1YH 1ZHSA 4DUYH 1RJQA 5KG4A 4NXNH 4DR3H 3GIPA 4ECUA 5EWEA 5FLMG 4CC5A 2NU8B 1I3QA 2SCUB 4DUZH 4QWDA 4JI5H 2V5AA 3MR2A 4WBNF 3RF2A 2PVPA 4J9LA 3Q8SB 4A2AA 1T3NA 4TV9F 2B63A 4IZOA 1IBKH 3Q1KA 5KG0A 4MV9A 1N36H 4O2BF 2HVSA 1KBLA 2HVQA 3GTJA 4MA0A 4LF6H 4HNVA 3VPCA
chains in the Genus database with same CATH topology
3RGZA 3PN1A 1B04A 2ZJTA 4UCOA 4MTEA 4APMA 2UXBH 4R7RA 5LMUH 3RTXA 2HGSA 4Q0YA 4JI2H 4JI4H 4JV5H 4JI8H 2OWOA 1TA8A 2WDTA 4OX9H 1I6UA 4DR4H 3UQ8A 1S68A 1XDNA 1O75A 4LF7H 1AN7A 5D1OB 1IBLH 4K0KH 3RJ0A 4ETSA 3JAMW 4RB1A 2E5LH 1HR0H 4GKKH 2VOBA 3LMLA 4LF4H 4X62H 2CW7A 3T1HH 2F4VH 3RIZA 1IBMH 5IT9W 1N33H 1FKAH 4X64H 2Q2UA 5A2QW 1P8LA 4UCVA 1HNZH 3C0FB 4RAZA 5LL6b 2VQEH 3FMAA 4M7EA 4DR1H 4LFCH 1S03G 5FD5A 2Q2TA 4RB3C 4YHHH 1XNQH 1J5EH 3L4KA 2RGVA 4NXMH 1VS0A 4IAJA 1BJTA 1Z2NX 1A0IA 4LH7A 3J81W 1DGSA 4DV6H 1MZBA 5D1PA 4MTDA 2HHHH 4DR7H 4YY3H 3KAJA 3N41B 5FPOA 4DV1H 4UCRA 4RB2C 4DV5H 2UUAH 2CW8A 3BABA 4LSXA 3JSNA 4I7HA 1M0WA 1SYXB 2XIGA 1FJGH 4B3TH 3J80W 4DV2H 4DV7H 2VQFH 3KALA 4UCTA 5FLXW 2WYOA 4LF9H 3BA8A 3BAAA 4B3RH 4DR5H 1V9PA 4DV0H 5EOYA 4DR2H 4CC6A 1SEIA 4A2BA 2UUCH 4X65H 1XMQH 4UCSA 4FM9A 1N34H 1HNWH 4JI6H 1WH2A 4GKJH 4UCUA 3M4IA 5FPRA 2UUBH 2RGRA 3CVZA 2W57A 1HNXH 1N32H 1L2ZA 2VPSA 1X9NA 4EEQA 2HVRA 4PDBA 1M0TA 4EFEA 4LMYA 1BGWA 3HXLA 4RB0A 4RZQA 3JSLA 5BR8H 1E4FT 3OTOH 4B3MH 3N6XA 4JI7H 3KXYT 4BWSC 1XNRH 2O03A 4RAYA 3J7AK 5D1OA 4LF5H 1TAEA 4UFZA 1Z2PX 3MWMA 5LMNH 4LFAH 4JI1H 1I94H 1FVIA 4B3SH 3F8NA 4DV3H 4KHPH 1XMOH 3RGXA 4JI3H 3IG0A 1E4GT 2MCTA 4LH6A 4DV4H 4AQYH 2FE3A 2KSWA 3T1YH 3K3VA 3KAKA 1ZHSA 3N42B 4JI0H 2VUGA 3DF7A 4DUYH 4NXNH 4DR3H 4MV7A 4LFBH 1Z2OX 4EFBA 4DR6H 4CC5A 4DUZH 4GLXA 2WE6A 4JI5H 1GYFA 3H20A 3BA9A 4JYAH 3RF2A 4A2AA 1IBKH 3N44B 5FD6A 2UXCH 4MV9A 2YCHA 3L2PA 3N40P 4LSAA 4X66H 3L4JA 1N36H 1ZHQA 2HVSA 2UU9H 2UXDH 2HVQA 5IWAH 2ZM6H 3EYYA 4LF6H 3N43B 4LF8H 4J0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0F B; 
#chains in the Genus database with same CATH topology
 1B04 A;  1GSA A;  1S9F A;  4HNU A;  2W9B B;  3GTM A;  2ZDQ A;  4JI4 H;  2NUA B;  2R8H A;  2V58 A;  3H4D A;  2Y0S E;  4DR4 H;  5KFV A;  4AYB A;  3JZI A;  4A3G G;  4YJ2 F;  5IYD G;  2AGP A;  3K5I A;  1GLV A;  3GIQ A;  3LML A;  5L9X A;  4J9S A;  3RIZ A;  4IWX A;  1C30 A;  4ZHQ F;  3R5X A;  2BR0 A;  4RAZ A;  2GPW A;  4M7E A;  2FJZ A;  2WB1 A;  4I50 F;  4JUZ A;  4ECY A;  4DL3 A;  4O4L F;  4RB3 C;  4YHH H;  4YR3 A;  1WSC A;  1XNQ H;  3OSP A;  1E4E A;  4TQR A;  5KFC A;  1ULZ A;  1W96 A;  3U9T A;  3T5J A;  1A0I A;  3H0G A;  2C2D A;  1DGS A;  3GII A;  4NLG A;  1S0M A;  1RJP A;  5KFK A;  5CAE B;  5LA6 F;  2WB1 E;  3KAJ A;  5FPO A;  4RB2 C;  4DV5 H;  4O2A F;  5BMV F;  3HKZ A;  3PZP A;  2FPG B;  2W9B A;  2PBZ A;  4B3T H;  3G6X A;  2JA5 A;  4A3E G;  3TIN A;  4O3S A;  4UCT A;  2HJW A;  4YBZ B;  3BAA A;  2YRW A;  3PW5 A;  2QYZ A;  2VQD A;  2YW2 A;  4J9O A;  5D8D A;  1V9P A;  4DV0 H;  4AYB E;  4FS1 A;  4CC6 A;  4DL5 A;  5FJ8 G;  4A2B A;  1XMQ H;  4FM9 A;  1N34 H;  3TQ1 A;  4JI6 H;  1WCM G;  4ECT A;  3PW0 A;  1WH2 A;  2UVV A;  2XCP A;  1N48 A;  2R84 A;  2W57 A;  3CVZ A;  2W7O A;  4Q8F A;  1JXL A;  3MJF A;  2GLT A;  1GGO A;  4QWB A;  1X9N A;  4J9R A;  2VA2 A;  2FLP A;  5JVL A;  2CKZ B;  5LXT F;  4RNN A;  1BGW A;  5KKN B;  1JDE A;  2JEI A;  1GSH A;  3HB9 A;  4TUY F;  1E4F T;  3KHH A;  4A3F G;  2JEF A;  3OTO H;  3UFX B;  4JI7 H;  4BWS C;  2JA7 A;  4TV8 F;  1KJJ A;  5D1O A;  5EWG A;  2OLS A;  4EEY A;  2R7M A;  3RV3 A;  1Z2P X;  3MWM A;  3WO1 A;  5IYC G;  4LFA H;  5T14 A;  1FVI A;  4B3S H;  1JIH A;  3GIJ A;  3F8N A;  4KHP H;  3RUP A;  3RGX A;  2I87 A;  1JKJ B;  4ED0 A;  1E4G T;  4DV4 H;  4R8U B;  4O3O A;  2VUG A;  3RAX A;  5KT4 A;  2AU0 A;  4MV7 A;  1Z2O X;  4DR6 H;  2B63 G;  1CQJ B;  2XC9 A;  2BQ3 A;  3PO2 G;  5EZY F;  2R93 A;  3H20 A;  2NVX A;  4HNT A;  4JYA H;  4E4T A;  1V4Y A;  3ORQ A;  1I50 A;  4JV2 A;  4F4X A;  2R86 A;  5CA1 F;  3GTQ A;  1B33 N;  1DV2 A;  2YCH A;  5J2U F;  3N40 P;  5KFX A;  3ORR A;  3EPG A;  2UU9 H;  1GO3 E;  4EG0 A;  2UXD H;  2YZN A;  2FLL A;  3EYY A;  3RB6 A;  3V4Z A;  4LF8 H;  3RGZ A;  3TII A;  4G3I A;  2W9C A;  1RYR A;  4R7R A;  2R7L A;  5LMU H;  1GSO A;  1S0N A;  3V6K A;  4A3C G;  4Q0Y A;  4I4T F;  5IP7 G;  4ECW A;  3HOU G;  2WDT A;  5IYZ F;  1S68 A;  5KFJ A;  2I80 A;  1VBG A;  3OUU A;  3PR5 B;  2ASL A;  5DGA A;  2E5L H;  4RB1 A;  4IR1 A;  4A3D G;  4XYL B;  4LF4 H;  1EHI A;  4O3Q A;  3V4S A;  5F9L A;  4X62 H;  2R7Z A;  3T1H H;  4PWQ A;  1RK5 A;  2PMZ E;  4ME6 A;  4JV0 A;  5KFN A;  1FKA H;  3ETJ A;  4BY7 G;  5KG7 A;  3HOW G;  3GIK A;  3C0F B;  1CQI B;  3H40 A;  3HOX G;  2XD4 A;  1JX4 A;  4LFC H;  3FKI G;  2PMZ A;  1EUD B;  2IMW P;  4J9K A;  3M9N B;  3GTL A;  1AUX A;  4Q44 A;  4I55 F;  2RGV A;  4NXM H;  1VS0 A;  3PW2 A;  4IAJ A;  3BQ1 A;  1BJT A;  1Z2N X;  4LH7 A;  5KT6 A;  4YJ3 F;  5DGB A;  3J81 W;  3VMM A;  2JA8 G;  5C8Y F;  3BJY A;  5D1P A;  4RZR A;  2V59 A;  4DR7 H;  5JUM A;  3K3P A;  3KTM A;  2DLN A;  2M05 A;  4UCR A;  2W8L A;  2CW8 A;  3JRW A;  3JSN A;  1TWH A;  1SCU B;  4WD3 A;  2W9C B;  2C00 A;  2QK4 A;  2R93 G;  2NU7 B;  1UNN C;  4DV7 H;  2WAQ A;  2W6P A;  5CA0 F;  2W70 A;  4J9M A;  2RF4 A;  5FLX W;  2J6U A;  2FMA A;  4LF9 H;  2R7Z G;  5H80 A;  4TQS A;  5EDW A;  3GV7 B;  2R92 A;  1S10 A;  1SEI A;  4ED2 A;  4X65 H;  1T36 A;  4UCS A;  1S97 A;  4M9U A;  1HNW H;  5KFT A;  4UCU A;  3M4I A;  3Q8P B;  4EGJ A;  4HR7 A;  2R8K A;  2VPQ A;  5JVD F;  4ED3 A;  1R9T A;  2VPS A;  4ECX A;  2FK3 A;  5KG3 A;  4EEQ A;  1S0O A;  3KHR A;  5DLF A;  1M0T A;  4EFE A;  1KJQ A;  5BPF A;  4DL6 A;  3PVX A;  5KFY A;  4PDB A;  4A3L G;  5KFU A;  5CB4 F;  1I7N A;  1K1S A;  4QWE A;  1XNR H;  2O03 A;  2IBK A;  4EBE A;  4LF5 H;  1TAE A;  4YAJ B;  4BY1 G;  2R85 A;  3RFC A;  2FLN A;  2CQY A;  2YRX A;  2IP4 A;  4DV3 H;  5EWF A;  2NU9 B;  4DL7 A;  2JEJ A;  4O4H F;  5L1K A;  2C2E A;  4JI3 H;  1BXR A;  3IG0 A;  1I94 H;  1VBH A;  2UUC H;  4FBT A;  2FE3 A;  2ASJ A;  2YS7 A;  3KAK A;  3R23 A;  4Q43 A;  1M6V A;  4U7C A;  2BQU A;  3WNZ A;  2W6Z A;  4MV1 A;  4EFB A;  2AQ4 A;  2WAQ E;  4DL4 A;  3K5H A;  4GLX A;  2WE6 A;  2JA7 G;  5C1O A;  5KG6 A;  4ECR A;  3MWE A;  5HBR B;  3GIL A;  4RNO A;  2XCA A;  3G8C A;  4GC6 A;  3L2P A;  4X66 H;  5DQI A;  4C5A A;  3NGD A;  2VR1 A;  3MR5 A;  2V4Q A;  3HOV G;  3BG5 A;  4IWY A;  5IWA H;  2E2I A;  3I4M G;  1M7J A;  5KFF A;  3BA9 A;  2YZG A;  3GID A;  1ZQ7 A;  4J0M A;  2UVW A;  4MAM A;  4BXX G;  2ZJT A;  4MTE A;  3VPB A;  4F4Y A;  1Y1W G;  3MFH A;  4A3B G;  3TIG A;  2HGS A;  4JI2 H;  5KT2 A;  4JV5 H;  2I8C A;  3Q2O A;  4EBC A;  3RV4 A;  2OWO A;  4JI8 H;  3CQZ A;  4YB8 B;  4ED1 A;  2J6T A;  1W93 A;  3UQ8 A;  1XDN A;  3R5F A;  2RDJ A;  4ED8 A;  1O75 A;  4ZQI A;  3GTK A;  4LF7 H;  1AN7 A;  4K0K H;  2W6M A;  3JRX A;  4MA5 A;  4C2M A;  1JLL B;  4R8U A;  3RJ0 A;  4U6P A;  1HR0 H;  2JA5 G;  5KG5 A;  4GKK H;  4QJF A;  5HV6 A;  1PK8 A;  3PO3 G;  2CW7 A;  2F4V H;  3AYH B;  5IT9 W;  1N33 H;  5KG1 A;  1RK6 A;  5KT5 A;  4X64 H;  2Q2U A;  3GQC A;  5A2Q W;  4UCV A;  2VUM A;  2R8I A;  5KFH A;  2VQE H;  4HYK A;  2GPS A;  1RYS A;  4O3P A;  5J2T F;  4DR1 H;  3I12 A;  1S03 G;  5FD5 A;  2DPI A;  3LP8 A;  4A93 G;  4EYH B;  4Q45 A;  4MV4 A;  2XCL A;  1I6U A;  1V51 A;  1T94 A;  3OSN A;  1J5E H;  3G6V A;  1EYZ A;  2C2R A;  4QWA A;  3N8D A;  1MZB A;  1K1Q A;  3V6J A;  4EYI B;  4F4W A;  4MTD A;  2HHH H;  3GLK A;  5LOV F;  4ZI7 F;  4YY3 H;  3G6Y A;  4DV1 H;  2WTF A;  3BAB A;  4MV6 A;  4LSX A;  4I7H A;  4MV8 A;  1SYX B;  2XIG A;  3QZ8 A;  3GV8 B;  4FBU A;  4QW8 A;  3J80 W;  2X0S A;  3MFI A;  1RJR A;  2NVY A;  1TWG A;  2DPJ A;  5EOY A;  2XGQ A;  1N56 A;  3HBL A;  4F4Z A;  2R8G A;  2VA3 A;  5DLG A;  2R82 A;  4A3J G;  5KFD A;  4QW9 A;  5L1I A;  2R8J A;  2FK2 A;  4Y8V B;  4XX0 B;  2BQR A;  5FPR A;  5KFP A;  2UUB H;  2RGR A;  2OH2 A;  3R5H A;  1N32 H;  1L2Z A;  2YL2 A;  1Y1W A;  3ETH A;  4O4I F;  1KC7 A;  5KFB A;  3GIM A;  4YQW A;  5DG9 A;  3RB4 A;  4IHJ F;  2YU9 A;  4RB0 A;  1JDB B;  3JSL A;  1EZ1 A;  3PW7 A;  4DL2 A;  3FDS A;  2CZG A;  4XZ3 B;  3GV5 B;  2AGO A;  4C5C A;  2YZM A;  4XYM B;  4B3M H;  3H3V H;  2Y0S A;  5JQW A;  2W7P A;  5KT7 A;  5KT3 A;  5L1L A;  3J7A K;  3GTP A;  1C3O A;  5LYJ F;  5LMN H;  4JI1 H;  3H4B A;  1IOW A;  5KFG A;  4IRK A;  4IRC A;  3M9O B;  1XMO H;  2Q2T A;  4LH6 A;  4AQY H;  2R92 G;  3N42 B;  4JI0 H;  1KEE A;  3DF7 A;  3KHL A;  4L1K A;  4LFB H;  1SFO A;  4C5B A;  2JEG A;  3Q8R B;  3FKI A;  1GYF A;  1Y14 B;  3HOZ G;  4QIW A;  3GTO A;  3QFF A;  2P0A A;  5C1P A;  5KFL A;  3BQ0 A;  3N44 B;  2NU6 B;  3H0G G;  3MWD A;  5FD6 A;  2UXC H;  3OUZ A;  4LSA A;  3L4J A;  1ZHQ A;  4YP3 A;  3MR3 A;  3QZ7 A;  2ZM6 H;  3N43 B;  2YS6 A;  1IOV A;  5LP6 F;  3TQT A;  3PN1 A;  4QIW E;  2V4R A;  4UCO A;  4APM A;  3IN5 A;  5I47 A;  2V9W A;  4Q8E A;  2UXB H;  2JA6 A;  3RTX A;  4BBS G;  2FK1 A;  3HKZ E;  3HOY G;  3BQ2 A;  4RUC A;  2VUM G;  4IRD A;  1TA8 A;  5KFO A;  5KFA A;  3LWB A;  2R7K A;  2FPP B;  4YR2 A;  4GC7 A;  5L1J A;  4ECS A;  4ECV A;  2ATL A;  4OX9 H;  3V6H A;  2DIK A;  5K2M A;  1KJ8 A;  5D1O B;  1IBL H;  5GON F;  2E2H A;  1I7L A;  4ETS A;  3JAM W;  1B6S A;  1Y1V G;  3RBD A;  4ED6 A;  1K83 A;  4QWC A;  5C4X G;  2VOB A;  5KFE A;  2AGQ A;  3RAQ A;  4A3M G;  1IBM H;  4J9Q A;  1BNC A;  1Y1V A;  3KHG A;  4F50 A;  4A3K G;  1P8L A;  2W9A A;  2ASD A;  1HNZ H;  5LL6 b;  1E4E B;  3FMA A;  2DWC A;  4BBR G;  4FS2 A;  2R87 A;  5DQG A;  1PX2 A;  2XGP A;  3PW4 A;  2RDI A;  3T5H A;  2UVU A;  2FPI B;  1A9X A;  2C22 A;  3EPI A;  1VAJ A;  5KFI A;  1OWT A;  5C5J A;  2FB9 A;  2IA6 A;  4IR9 A;  4ZOL F;  3U9S A;  1AUV A;  1KJI A;  3L4K A;  3T5L A;  5KFW A;  4EBD A;  4JV1 A;  4DV6 H;  4ECZ A;  3M9M B;  4RUA A;  2ZDG A;  2ZDH A;  3OHA A;  2W71 A;  5C44 G;  3RB3 A;  4DLK A;  1DV1 A;  3N41 B;  2J6S A;  3MR6 A;  2UUA H;  1EUC B;  4RNM A;  4ECQ A;  5IP9 G;  1M0W A;  5KFM A;  1FJG H;  2J9G A;  1B6R A;  1WR2 A;  4DV2 H;  5IYB G;  2VQF H;  5F9N A;  3KAL A;  3VPD A;  5DQH A;  2WYO A;  3BA8 A;  4B3R H;  4DR5 H;  3I4N G;  4DR2 H;  1VKZ A;  2FP4 B;  3WO0 A;  1CS0 A;  4MV3 A;  5KFQ A;  1KJ9 A;  3T5K A;  4EGQ A;  4O3R A;  1TWA A;  1DIK A;  1TWC A;  2W6Q A;  3SE7 A;  2FKL A;  5KFS A;  5KG2 A;  3Q8Q B;  4J9P A;  4GKJ H;  4YAK B;  2W8K A;  2YYA A;  1HNX H;  2R7N A;  2DZD A;  2HVR A;  1CE8 A;  2W6O A;  4YR0 A;  4LMY A;  3RB0 A;  3GTG A;  3HXL A;  1TWF A;  2PN1 A;  4RZQ A;  5DG8 A;  2R6F A;  5BR8 H;  3OHB A;  5DG7 A;  2UVR A;  2ALZ A;  1UC8 A;  3E5N A;  3N6X A;  2W6N A;  3KXY T;  4ED7 A;  4J9N A;  5JH7 F;  4RAY A;  3PR4 A;  2C35 B;  2JA6 G;  4A3I G;  4UFZ A;  5BPH A;  5KX5 F;  1WCM A;  4HQ6 A;  4RU9 A;  5C3E G;  3SI8 A;  1UC9 A;  5KFR A;  5KFZ A;  1ZET A;  2MCT A;  4O3N A;  2C28 A;  2KSW A;  3RBE A;  4FU0 A;  3K3V A;  3T1Y H;  1ZHS A;  4DUY H;  1RJQ A;  5KG4 A;  4NXN H;  4DR3 H;  3GIP A;  4ECU A;  5EWE A;  5FLM G;  4CC5 A;  2NU8 B;  1I3Q A;  2SCU B;  4DUZ H;  4QWD A;  4JI5 H;  2V5A A;  3MR2 A;  4WBN F;  3RF2 A;  2PVP A;  4J9L A;  3Q8S B;  4A2A A;  1T3N A;  4TV9 F;  2B63 A;  4IZO A;  1IBK H;  3Q1K A;  5KG0 A;  4MV9 A;  1N36 H;  4O2B F;  2HVS A;  1KBL A;  2HVQ A;  3GTJ A;  4MA0 A;  4LF6 H;  4HNV A;  3VPC A; 
#chains in the Genus database with same CATH homology
 3RGZ A;  3PN1 A;  1B04 A;  2ZJT A;  4UCO A;  4MTE A;  4APM A;  2UXB H;  4R7R A;  5LMU H;  3RTX A;  2HGS A;  4Q0Y A;  4JI2 H;  4JI4 H;  4JV5 H;  4JI8 H;  2OWO A;  1TA8 A;  2WDT A;  4OX9 H;  1I6U A;  4DR4 H;  3UQ8 A;  1S68 A;  1XDN A;  1O75 A;  4LF7 H;  1AN7 A;  5D1O B;  1IBL H;  4K0K H;  3RJ0 A;  4ETS A;  3JAM W;  4RB1 A;  2E5L H;  1HR0 H;  4GKK H;  2VOB A;  3LML A;  4LF4 H;  4X62 H;  2CW7 A;  3T1H H;  2F4V H;  3RIZ A;  1IBM H;  5IT9 W;  1N33 H;  1FKA H;  4X64 H;  2Q2U A;  5A2Q W;  1P8L A;  4UCV A;  1HNZ H;  3C0F B;  4RAZ A;  5LL6 b;  2VQE H;  3FMA A;  4M7E A;  4DR1 H;  4LFC H;  1S03 G;  5FD5 A;  2Q2T A;  4RB3 C;  4YHH H;  1XNQ H;  1J5E H;  3L4K A;  2RGV A;  4NXM H;  1VS0 A;  4IAJ A;  1BJT A;  1Z2N X;  1A0I A;  4LH7 A;  3J81 W;  1DGS A;  4DV6 H;  1MZB A;  5D1P A;  4MTD A;  2HHH H;  4DR7 H;  4YY3 H;  3KAJ A;  3N41 B;  5FPO A;  4DV1 H;  4UCR A;  4RB2 C;  4DV5 H;  2UUA H;  2CW8 A;  3BAB A;  4LSX A;  3JSN A;  4I7H A;  1M0W A;  1SYX B;  2XIG A;  1FJG H;  4B3T H;  3J80 W;  4DV2 H;  4DV7 H;  2VQF H;  3KAL A;  4UCT A;  5FLX W;  2WYO A;  4LF9 H;  3BA8 A;  3BAA A;  4B3R H;  4DR5 H;  1V9P A;  4DV0 H;  5EOY A;  4DR2 H;  4CC6 A;  1SEI A;  4A2B A;  2UUC H;  4X65 H;  1XMQ H;  4UCS A;  4FM9 A;  1N34 H;  1HNW H;  4JI6 H;  1WH2 A;  4GKJ H;  4UCU A;  3M4I A;  5FPR A;  2UUB H;  2RGR A;  3CVZ A;  2W57 A;  1HNX H;  1N32 H;  1L2Z A;  2VPS A;  1X9N A;  4EEQ A;  2HVR A;  4PDB A;  1M0T A;  4EFE A;  4LMY A;  1BGW A;  3HXL A;  4RB0 A;  4RZQ A;  3JSL A;  5BR8 H;  1E4F T;  3OTO H;  4B3M H;  3N6X A;  4JI7 H;  3KXY T;  4BWS C;  1XNR H;  2O03 A;  4RAY A;  3J7A K;  5D1O A;  4LF5 H;  1TAE A;  4UFZ A;  1Z2P X;  3MWM A;  5LMN H;  4LFA H;  4JI1 H;  1I94 H;  1FVI A;  4B3S H;  3F8N A;  4DV3 H;  4KHP H;  1XMO H;  3RGX A;  4JI3 H;  3IG0 A;  1E4G T;  2MCT A;  4LH6 A;  4DV4 H;  4AQY H;  2FE3 A;  2KSW A;  3T1Y H;  3K3V A;  3KAK A;  1ZHS A;  3N42 B;  4JI0 H;  2VUG A;  3DF7 A;  4DUY H;  4NXN H;  4DR3 H;  4MV7 A;  4LFB H;  1Z2O X;  4EFB A;  4DR6 H;  4CC5 A;  4DUZ H;  4GLX A;  2WE6 A;  4JI5 H;  1GYF A;  3H20 A;  3BA9 A;  4JYA H;  3RF2 A;  4A2A A;  1IBK H;  3N44 B;  5FD6 A;  2UXC H;  4MV9 A;  2YCH A;  3L2P A;  3N40 P;  4LSA A;  4X66 H;  3L4J A;  1N36 H;  1ZHQ A;  2HVS A;  2UU9 H;  2UXD H;  2HVQ A;  5IWA H;  2ZM6 H;  3EYY A;  4LF6 H;  3N43 B;  4LF8 H;  4J0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...