3C0FB

Crystal structure of a novel non-pfam protein af1514 from archeoglobus fulgidus dsm 4304 solved by s-sad using a cr x-ray source
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
85
structure length
80
Chain Sequence
b'IMDEIVNLQKEVSLEEAERYANIASYGDGILLSVHDSTGYRAPEVYCCGEKPWEVYACNRGANLISVNQFEFYFRIEVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein AF_1514
publication title Crystal structure of a novel non-Pfam protein AF1514 from Archeoglobus fulgidus DSM 4304 solved by S-SAD using a Cr X-ray source.
pubmed doi rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Unknown function
total genus 17
structure length 80
sequence length 85
ec nomenclature
pdb deposition date 2008-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18505 DUF5619 Domain of unknown function (DUF5619)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.340 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3c0fB00
3C0FB
chains in the Genus database with same CATH superfamily
4QIWA 2JA5A 2BQUA 3R5XA 4ED2A 4RAYA 2HVRA 3HKZE 4QWBA 2NU9B 4DR7H 2V5AA 2W6MA 4O2AF 4ZI7F 4ECTA 2R86A 2XCPA 4FS2A 2WB1E 2YS7A 4X62H 3RB0A 1N56A 5JUMA 4J9LA 4XZ3B 4A3GG 2HHHH 4RNMA 3JZIA 4ZOLF 4BBSG 1T94A 1FKAH 2NVXA 5FD5A 3FKIG 2R8KA 2E5LH 4PDBA 4M9UA 2ALZA 4LSAA 2JEGA 3M4IA 4J9MA 4FS1A 4WBNF 4I7HA 5EOYA 1Y1VA 2WYOA 3M9NB 3ORQA 5KFVA 3K3VA 4F4XA 3JRWA 3VPBA 3WNZA 1I7LA 3ORRA 4HNVA 5KFWA 3RAQA 4EFBA 3RB6A 2VQFH 3RJ0A 4J9NA 2UUAH 3GTQA 1FVIA 3MR2A 4A3EG 2XD4A 1ZQ7A 4YR0A 4DL5A 3KALA 3GIPA 5KFKA 1S97A 3HB9A 5D8DA 1EZ1A 4EBDA 5FPOA 1O75A 5J2UF 2RGVA 4J9QA 2Y0SA 4BY1G 4JI8H 3E5NA 1T36A 2V58A 2VOBA 1CQJB 2R8JA 2JEIA 1Z2OX 4MV6A 5EZYF 4JI2H 1JLLB 5KFRA 3V6HA 3T1HH 4O3NA 3GTLA 4DV5H 5FD6A 1PX2A 5KFOA 4JV1A 4MTEA 4ECWA 1W93A 3RB4A 4LFBH 4PWQA 5IP7G 2C35B 3DF7A 4DV1H 4B3TH 4BBRG 1UC9A 1SCUB 5DGBA 5KFQA 5KFIA 5KFBA 1S0NA 4B3SH 2JA6G 3KHLA 4O3SA 3CQZA 3OUUA 5FLXW 2HGSA 4ECYA 3BQ1A 5C4XG 5FJ8G 4UCRA 2W71A 1EUDB 2J9GA 1ZHQA 4UCSA 3M9MB 3H4BA 1Y14B 1Z2NX 2UVRA 5KFHA 4YHHH 4RUAA 1UC8A 5CA1F 3QZ8A 1N33H 1KJIA 5KT3A 1V4YA 2GLTA 5KFZA 4EYHB 1RK5A 1N34H 3L4KA 1W96A 2VQEH 5CB4F 2V4RA 5C1PA 1ZHSA 4ECZA 4J0MA 3NGDA 3H3VH 1PK8A 5KT5A 2ASJA 2B63G 4DR5H 4IHJF 3RF2A 1S03G 1Y1WG 3T5KA 2W6QA 1A9XA 3RFCA 1JX4A 4R8UA 4NLGA 4DV7H 5KKNB 3KHGA 1FJGH 3GTGA 1KBLA 2YW2A 4O3QA 4B3RH 5IYZF 1AN7A 4AQYH 4DUZH 5EWGA 1BNCA 1GO3E 2NU6B 5C1OA 4TQRA 3MFHA 1T3NA 2W8KA 1VS0A 1M6VA 3N43B 3PW7A 4MA5A 3K5HA 3HOYG 4ME6A 3PR4A 3PR5B 3AYHB 2HJWA 4ECSA 5KG5A 2FLNA 1BJTA 4XX0B 2NVYA 3GIDA 2I80A 4LMYA 3UFXB 3WO0A 1GGOA 3R5HA 3Q8RB 3BQ2A 2AQ4A 2BQRA 5JQWA 3V4ZA 2J6TA 5J2TF 1AUXA 4TUYF 4APMA 2VR1A 1KJ9A 1C3OA 4EFEA 2PBZA 1V51A 4O4HF 2PN1A 1KEEA 3LP8A 5LYJF 2YRWA 3LWBA 2OLSA 2DZDA 3N40P 4JI0H 1JDEA 2XGQA 3Q2OA 4CC5A 4J9KA 4ED3A 3K3PA 2W9CB 2JA7A 3OTOH 1SEIA 4XYMB 2C2DA 4Y8VB 4LF8H 1CQIB 2V9WA 1CS0A 1B6SA 3KAJA 5LMNH 1HNWH 4HR7A 2ZDGA 3VPCA 5HV6A 3R23A 2DLNA 4DR3H 2YZGA 3MWEA 2RGRA 2JEFA 1E4FT 2XGPA 3BG5A 4YJ3F 5KFTA 4GC6A 1V9PA 4J9RA 3Q1KA 3GIKA 2C28A 3TIGA 4G3IA 2VUMA 2FE3A 4ED7A 3GV7B 2FMAA 2VPQA 3T1YH 3T5JA 4O2BF 2HVSA 2R8IA 2CKZB 1XMQH 4O3OA 1TAEA 4ECRA 4MAMA 3GTJA 4JI6H 1N48A 3RTXA 3KXYT 1S10A 1TWGA 3KHRA 2R87A 2JA5G 3MR5A 4ECXA 1HNXH 1Z2PX 4QW8A 2HVQA 4IRKA 1BGWA 3RV4A 2R7MA 2UVVA 4GKKH 4U7CA 4RZRA 2AGPA 5KT2A 5I47A 3N6XA 4DV0H 3HOXG 5KX5F 4YJ2F 1DV2A 1CE8A 2FLPA 2FK3A 3HBLA 1IOWA 4RB0A 4F4YA 5KFSA 1B04A 3K5IA 4TV8F 3QFFA 5KG3A 2X0SA 1IBLH 2WAQE 2YZMA 1ULZA 4O3RA 4JV2A 4DV2H 1KJQA 1Y1VG 2MCTA 4YB8B 5IT9W 4XYLB 2W6OA 2W8LA 2CQYA 3GILA 4ECVA 3HOWG 2PMZE 3HKZA 2W70A 5LP6F 3WO1A 3GLKA 5IYDG 1VKZA 1TWFA 3BA9A 3OSPA 3GV5B 2C2RA 2WB1A 4YAKB 3BABA 4RU9A 4FBTA 1I7NA 2CZGA 5HBRB 3EYYA 3OHAA 4MV8A 4O3PA 5L1LA 5KFUA 3HXLA 3Q8PB 2R7KA 1EHIA 1M7JA 4Q0YA 5KG0A 4EBEA 4LF5H 3GIJA 5DLFA 1GSAA 4C5AA 2E2IA 4RNNA 2UVUA 4HYKA 2IP4A 4MV3A 4JV5H 3IN5A 4J9PA 4BXXG 2IMWP 4JYAH 1SYXB 1GSOA 3G6YA 2CW7A 4DR2H 1VAJA 2DPIA 4A3BG 2IA6A 4O4LF 3KAKA 5IYBG 3BA8A 1EYZA 5JH7F 2NUAB 2W57A 2W9AA 2OWOA 4Q8EA 2JEJA 2YL2A 5L9XA 5KFNA 4LH6A 5KG4A 2WTFA 3KHHA 3MJFA 2R8HA 4K0KH 3LMLA 3N42B 4LFAH 4BY7G 1UNNC 3PZPA 1MZBA 4QWEA 4I55F 2E2HA 4IAJA 1I50A 3N8DA 3UQ8A 4DR1H 1WCMA 4Q43A 2DWCA 2YCHA 4IZOA 4QJFA 5KG7A 2R6FA 2VA2A 2AGOA 4EEQA 4DR4H 2R93A 2R92A 2FB9A 5DQGA 4RAZA 2FPGB 4Q45A 4Q44A 3RB3A 5H80A 3U9SA 3GV8B 3RGZA 3SE7A 3GIQA 3GIIA 4LF9H 3GTKA 5L1KA 4A2AA 4HQ6A 4UCOA 1WH2A 4UCTA 5KFPA 1RYRA 4KHPH 4J9SA 1ZETA 4AYBE 3RUPA 1M0TA 3MWDA 4DV6H 1RYSA 4DL6A 5DLGA 4RZQA 4LF4H 4YBZB 4A3MG 2YYAA 4MV1A 4C5BA 5KT7A 4R7RA 2RDIA 2W9CA 4UFZA 2UVWA 2ATLA 5LMUH 4QIWE 2O03A 3I4MG 4RUCA 2ZJTA 5KFMA 5BR8H 2R7NA 2FK1A 1X9NA 5C5JA 4TQSA 1AUVA 3F8NA 5DQHA 3OUZA 4IRCA 1RJPA 2ZDHA 3V4SA 1EUCB 5D1OA 5T14A 4A3IG 3JSLA 1KJ8A 4ED0A 2R7ZA 2R85A 3GTPA 3MR6A 5KFDA 4MTDA 3JSNA 4ZQIA 2FPIB 4IRDA 5JVLA 4DV3H 2GPWA 2PVPA 5C3EG 1IBMH 3PW2A 1A0IA 1E4EA 1JKJB 1WSCA 2W7OA 3BQ0A 4ED1A 3KTMA 3RBEA 5LXTF 4DL3A 4QWAA 2XC9A 2V4QA 5D1OB 4F50A 2YU9A 2XCLA 4X64H 1GLVA 2KSWA 3T5LA 3V6KA 4MA0A 1BXRA 4ETSA 4DL7A 3RBDA 3V6JA 2UUBH 3TIIA 5CA0F 2QYZA 5KFEA 3J80W 3R5FA 5C8YF 3FKIA 4EG0A 5EDWA 2W9BA 2JA7G 2Y0SE 4IWYA 3PW0A 4RB3C 2R8GA 1E4EB 2UXBH 2BQ3A 2YZNA 4NXMH 2R7LA 1I3QA 4BWSC 3ETHA 4YR3A 4QWDA 5LA6F 2FPPB 5DG7A 2DPJA 1DIKA 5EWEA 4YAJB 2C2EA 1C30A 5GONF 2CW8A 1XDNA 5D1PA 2VUMG 3I12A 3H4DA 2W9BB 1GSHA 1TA8A 5L1IA 2I8CA 2FKLA 4LF6H 4ECUA 5DQIA 3PW5A 5KFXA 4CC6A 3ETJA 3GIMA 1K1SA 3MWMA 1JXLA 4DL4A 2NU7B 2W7PA 4O4IF 4TV9F 4GC7A 4OX9H 4F4WA 3C0FB 2YS6A 5KFCA 3M9OB 1S0OA 3L4JA 4GKJH 2RDJA 4JI4H 4DR6H 1SFOA 1JIHA 3JRXA 2FK2A 3VPDA 3PN1A 4WD3A 5A2QW 4EBCA 4A3KG 2VA3A 4IR9A 2W6PA 2WDTA 4L1KA 5CAEB 5DGAA 4GLXA 4YP3A 4JI5H 5JVDF 2VPSA 3N41B 5KFJA 2DIKA 2OH2A 2FP4B 2M05A 2JA6A 2I87A 5IP9G 1JDBB 4ZHQF 3SI8A 4A3LG 4EGQA 4I50F 4A93G 1N32H 1S68A 3L2PA 4QW9A 4I4TF 2P0AA 5EWFA 2Q2UA 4FBUA 5FPRA 5K2MA 2F4VH 2W6ZA 1I6UA 5F9LA 3G6XA 3PO2G 4ECQA 4RB1A 1WR2A 1OWTA 1B6RA 2XCAA 2RF4A 2FLLA 2J6SA 3BJYA 3BAAA 5BPFA 1IBKH 1HNZH 5KFGA 3Q8SB 1IOVA 3OSNA 3H0GA 4ED8A 3I4NG 2UXDH 5KFAA 4EGJA 1J5EH 1M0WA 1K83A 1I94H 2WAQA 4QWCA 5KFFA 2QK4A 3G8CA 2B63A 1B33N 1XMOH 5KG2A 1S0MA 3J7AK 1Y1WA 3TQ1A 3G6VA 5IYCG 4F4ZA 2PMZA 1VBGA 2ASDA 4X65H 4ED6A 3FMAA 4UCUA 3RIZA 4EYIB 3GTMA 4MV9A 4A2BA 4LSXA 3OHBA 3MR3A 5BMVF 2SCUB 4B3MH 3H0GG 1R9TA 4M7EA 3HOUG 2NU8B 1K1QA 4EEYA 2R82A 4YQWA 1DGSA 4JI3H 4A3DG 4YY3H 1WCMG 4E4TA 2WE6A 4UCVA 1KJJA 5KG1A 3J81W 1P8LA 1KC7A 3N44B 2C22A 2UU9H 4LFCH 2AGQA 4JI7H 2W6NA 3RGXA 4YR2A 2JA8G 3PVXA 2R92G 2R93G 3U9TA 3H40A 5BPHA 4DUYH 2ASLA 3PW4A 1RJRA 1N36H 1XNRH 4A3CG 3VMMA 4DV4H 1L2ZA 3GQCA 3IG0A 5KFLA 4JUZA 5FLMG 5IWAH 2ZDQA 4MV7A 3HOZG 4A3JG 3TINA 3RV3A 4JI1H 3CVZA 3JAMW 2C00A 4HNTA 5L1JA 4DL2A 3QZ7A 4R8UB 1TWCA 1HR0H 2UUCH 3HOVG 2R84A 2VQDA 2J6UA 1GYFA 2UXCH 1RK6A 1VBHA 2YRXA 4X66H 2BR0A 5C44G 4FM9A 1S9FA 4RNOA 1RJQA 5KT6A 2VUGA 3FDSA 2GPSA 5KG6A 4IR1A 4C2MA 3GTOA 5KT4A 3TQTA 3MFIA 4IWXA 3RAXA 4C5CA 1DV1A 2AU0A 2FJZA 2IBKA 5F9NA 4A3FG 4LH7A 5LL6b 3EPIA 3Q8QB 4NXNH 1XNQH 1E4GT 3EPGA 2ZM6H 4AYBA 4DLKA 1TWHA 2Q2TA 4JV0A 1TWAA 5DG8A 4U6PA 2R7ZG 4MV4A 4J9OA 4FU0A 3T5HA 2XIGA 4LF7H 4Q8FA 4RB2C 4HNUA 5LOVF 3PO3G 5KFYA 2V59A 3H20A 5DG9A
chains in the Genus database with same CATH topology
3LMLA 3N42B 4LFAH 1BJTA 3PN1A 5A2QW 1MZBA 4LMYA 4RAYA 2HVRA 2WDTA 4DR7H 4IAJA 4GLXA 3UQ8A 4DR1H 4JI5H 2YCHA 2VPSA 3N41B 4X62H 4APMA 4EEQA 2HHHH 4DR4H 4EFEA 1N32H 4RAZA 1FKAH 1S68A 3L2PA 5FD5A 2E5LH 2Q2UA 4PDBA 4LSAA 5FPRA 3RGZA 4LF9H 3M4IA 2F4VH 1I6UA 3N40P 4A2AA 4I7HA 4UCOA 1WH2A 4JI0H 5EOYA 4UCTA 2WYOA 4RB1A 4CC5A 3K3VA 4KHPH 3OTOH 1SEIA 4DV6H 1M0TA 4LF8H 4EFBA 3BAAA 3RJ0A 2VQFH 1IBKH 1HNZH 4RZQA 2UUAH 4LF4H 3KAJA 1FVIA 5LMNH 1HNWH 3KALA 2UXDH 1J5EH 1M0WA 4R7RA 1I94H 4DR3H 4UFZA 2RGRA 5FPOA 1E4FT 5LMUH 1O75A 1XMOH 2O03A 2RGVA 1V9PA 3J7AK 2ZJTA 2FE3A 5BR8H 4JI8H 3T1YH 1X9NA 3F8NA 2VOBA 2HVSA 4X65H 3FMAA 1Z2OX 4UCUA 3RIZA 1TAEA 1XMQH 4MV9A 4A2BA 4LSXA 5D1OA 4JI2H 4JI6H 3JSLA 3T1HH 3RTXA 3KXYT 4DV5H 5FD6A 4B3MH 4M7EA 4MTDA 3JSNA 4MTEA 1DGSA 1Z2PX 4DV3H 1HNXH 4JI3H 4YY3H 4LFBH 2HVQA 1BGWA 3DF7A 2WE6A 4UCVA 4DV1H 1IBMH 4B3TH 1A0IA 3J81W 1P8LA 2UU9H 3N44B 4GKKH 4LFCH 4JI7H 3RGXA 3N6XA 4B3SH 4DV0H 5FLXW 4DUYH 1N36H 2HGSA 5D1OB 1XNRH 4RB0A 4UCRA 4X64H 1B04A 2KSWA 1ZHQA 4UCSA 4ETSA 4DV4H 1IBLH 1L2ZA 2UUBH 3IG0A 1Z2NX 4DV2H 2MCTA 5IWAH 3J80W 5IT9W 4YHHH 4MV7A 1N33H 4JI1H 4RB3C 3CVZA 3JAMW 2UXBH 4NXMH 1N34H 4BWSC 3BA9A 3L4KA 2VQEH 1HR0H 2UUCH 3BABA 1GYFA 2UXCH 1ZHSA 4X66H 4J0MA 3EYYA 4FM9A 2VUGA 3HXLA 4DR5H 2CW8A 1XDNA 3RF2A 1S03G 5D1PA 4Q0YA 4LF5H 4DV7H 1TA8A 1FJGH 4LF6H 4NXNH 4LH7A 1XNQH 4K0KH 4JV5H 1E4GT 4CC6A 2ZM6H 4B3RH 4JYAH 1SYXB 1AN7A 3MWMA 2CW7A 4DR2H 4AQYH 4DUZH 2Q2TA 3KAKA 4OX9H 3BA8A 3C0FB 2XIGA 4LF7H 3L4JA 4GKJH 1VS0A 2OWOA 2W57A 4JI4H 4DR6H 3N43B 4RB2C 4LH6A 3H20A 5LL6b
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0F B; 
#chains in the Genus database with same CATH topology
 4QIW A;  2JA5 A;  2BQU A;  3R5X A;  4ED2 A;  4RAY A;  2HVR A;  3HKZ E;  4QWB A;  2NU9 B;  4DR7 H;  2V5A A;  2W6M A;  4O2A F;  4ZI7 F;  4ECT A;  2R86 A;  2XCP A;  4FS2 A;  2WB1 E;  2YS7 A;  4X62 H;  3RB0 A;  1N56 A;  5JUM A;  4J9L A;  4XZ3 B;  4A3G G;  2HHH H;  4RNM A;  3JZI A;  4ZOL F;  4BBS G;  1T94 A;  1FKA H;  2NVX A;  5FD5 A;  3FKI G;  2R8K A;  2E5L H;  4PDB A;  4M9U A;  2ALZ A;  4LSA A;  2JEG A;  3M4I A;  4J9M A;  4FS1 A;  4WBN F;  4I7H A;  5EOY A;  1Y1V A;  2WYO A;  3M9N B;  3ORQ A;  5KFV A;  3K3V A;  4F4X A;  3JRW A;  3VPB A;  3WNZ A;  1I7L A;  3ORR A;  4HNV A;  5KFW A;  3RAQ A;  4EFB A;  3RB6 A;  2VQF H;  3RJ0 A;  4J9N A;  2UUA H;  3GTQ A;  1FVI A;  3MR2 A;  4A3E G;  2XD4 A;  1ZQ7 A;  4YR0 A;  4DL5 A;  3KAL A;  3GIP A;  5KFK A;  1S97 A;  3HB9 A;  5D8D A;  1EZ1 A;  4EBD A;  5FPO A;  1O75 A;  5J2U F;  2RGV A;  4J9Q A;  2Y0S A;  4BY1 G;  4JI8 H;  3E5N A;  1T36 A;  2V58 A;  2VOB A;  1CQJ B;  2R8J A;  2JEI A;  1Z2O X;  4MV6 A;  5EZY F;  4JI2 H;  1JLL B;  5KFR A;  3V6H A;  3T1H H;  4O3N A;  3GTL A;  4DV5 H;  5FD6 A;  1PX2 A;  5KFO A;  4JV1 A;  4MTE A;  4ECW A;  1W93 A;  3RB4 A;  4LFB H;  4PWQ A;  5IP7 G;  2C35 B;  3DF7 A;  4DV1 H;  4B3T H;  4BBR G;  1UC9 A;  1SCU B;  5DGB A;  5KFQ A;  5KFI A;  5KFB A;  1S0N A;  4B3S H;  2JA6 G;  3KHL A;  4O3S A;  3CQZ A;  3OUU A;  5FLX W;  2HGS A;  4ECY A;  3BQ1 A;  5C4X G;  5FJ8 G;  4UCR A;  2W71 A;  1EUD B;  2J9G A;  1ZHQ A;  4UCS A;  3M9M B;  3H4B A;  1Y14 B;  1Z2N X;  2UVR A;  5KFH A;  4YHH H;  4RUA A;  1UC8 A;  5CA1 F;  3QZ8 A;  1N33 H;  1KJI A;  5KT3 A;  1V4Y A;  2GLT A;  5KFZ A;  4EYH B;  1RK5 A;  1N34 H;  3L4K A;  1W96 A;  2VQE H;  5CB4 F;  2V4R A;  5C1P A;  1ZHS A;  4ECZ A;  4J0M A;  3NGD A;  3H3V H;  1PK8 A;  5KT5 A;  2ASJ A;  2B63 G;  4DR5 H;  4IHJ F;  3RF2 A;  1S03 G;  1Y1W G;  3T5K A;  2W6Q A;  1A9X A;  3RFC A;  1JX4 A;  4R8U A;  4NLG A;  4DV7 H;  5KKN B;  3KHG A;  1FJG H;  3GTG A;  1KBL A;  2YW2 A;  4O3Q A;  4B3R H;  5IYZ F;  1AN7 A;  4AQY H;  4DUZ H;  5EWG A;  1BNC A;  1GO3 E;  2NU6 B;  5C1O A;  4TQR A;  3MFH A;  1T3N A;  2W8K A;  1VS0 A;  1M6V A;  3N43 B;  3PW7 A;  4MA5 A;  3K5H A;  3HOY G;  4ME6 A;  3PR4 A;  3PR5 B;  3AYH B;  2HJW A;  4ECS A;  5KG5 A;  2FLN A;  1BJT A;  4XX0 B;  2NVY A;  3GID A;  2I80 A;  4LMY A;  3UFX B;  3WO0 A;  1GGO A;  3R5H A;  3Q8R B;  3BQ2 A;  2AQ4 A;  2BQR A;  5JQW A;  3V4Z A;  2J6T A;  5J2T F;  1AUX A;  4TUY F;  4APM A;  2VR1 A;  1KJ9 A;  1C3O A;  4EFE A;  2PBZ A;  1V51 A;  4O4H F;  2PN1 A;  1KEE A;  3LP8 A;  5LYJ F;  2YRW A;  3LWB A;  2OLS A;  2DZD A;  3N40 P;  4JI0 H;  1JDE A;  2XGQ A;  3Q2O A;  4CC5 A;  4J9K A;  4ED3 A;  3K3P A;  2W9C B;  2JA7 A;  3OTO H;  1SEI A;  4XYM B;  2C2D A;  4Y8V B;  4LF8 H;  1CQI B;  2V9W A;  1CS0 A;  1B6S A;  3KAJ A;  5LMN H;  1HNW H;  4HR7 A;  2ZDG A;  3VPC A;  5HV6 A;  3R23 A;  2DLN A;  4DR3 H;  2YZG A;  3MWE A;  2RGR A;  2JEF A;  1E4F T;  2XGP A;  3BG5 A;  4YJ3 F;  5KFT A;  4GC6 A;  1V9P A;  4J9R A;  3Q1K A;  3GIK A;  2C28 A;  3TIG A;  4G3I A;  2VUM A;  2FE3 A;  4ED7 A;  3GV7 B;  2FMA A;  2VPQ A;  3T1Y H;  3T5J A;  4O2B F;  2HVS A;  2R8I A;  2CKZ B;  1XMQ H;  4O3O A;  1TAE A;  4ECR A;  4MAM A;  3GTJ A;  4JI6 H;  1N48 A;  3RTX A;  3KXY T;  1S10 A;  1TWG A;  3KHR A;  2R87 A;  2JA5 G;  3MR5 A;  4ECX A;  1HNX H;  1Z2P X;  4QW8 A;  2HVQ A;  4IRK A;  1BGW A;  3RV4 A;  2R7M A;  2UVV A;  4GKK H;  4U7C A;  4RZR A;  2AGP A;  5KT2 A;  5I47 A;  3N6X A;  4DV0 H;  3HOX G;  5KX5 F;  4YJ2 F;  1DV2 A;  1CE8 A;  2FLP A;  2FK3 A;  3HBL A;  1IOW A;  4RB0 A;  4F4Y A;  5KFS A;  1B04 A;  3K5I A;  4TV8 F;  3QFF A;  5KG3 A;  2X0S A;  1IBL H;  2WAQ E;  2YZM A;  1ULZ A;  4O3R A;  4JV2 A;  4DV2 H;  1KJQ A;  1Y1V G;  2MCT A;  4YB8 B;  5IT9 W;  4XYL B;  2W6O A;  2W8L A;  2CQY A;  3GIL A;  4ECV A;  3HOW G;  2PMZ E;  3HKZ A;  2W70 A;  5LP6 F;  3WO1 A;  3GLK A;  5IYD G;  1VKZ A;  1TWF A;  3BA9 A;  3OSP A;  3GV5 B;  2C2R A;  2WB1 A;  4YAK B;  3BAB A;  4RU9 A;  4FBT A;  1I7N A;  2CZG A;  5HBR B;  3EYY A;  3OHA A;  4MV8 A;  4O3P A;  5L1L A;  5KFU A;  3HXL A;  3Q8P B;  2R7K A;  1EHI A;  1M7J A;  4Q0Y A;  5KG0 A;  4EBE A;  4LF5 H;  3GIJ A;  5DLF A;  1GSA A;  4C5A A;  2E2I A;  4RNN A;  2UVU A;  4HYK A;  2IP4 A;  4MV3 A;  4JV5 H;  3IN5 A;  4J9P A;  4BXX G;  2IMW P;  4JYA H;  1SYX B;  1GSO A;  3G6Y A;  2CW7 A;  4DR2 H;  1VAJ A;  2DPI A;  4A3B G;  2IA6 A;  4O4L F;  3KAK A;  5IYB G;  3BA8 A;  1EYZ A;  5JH7 F;  2NUA B;  2W57 A;  2W9A A;  2OWO A;  4Q8E A;  2JEJ A;  2YL2 A;  5L9X A;  5KFN A;  4LH6 A;  5KG4 A;  2WTF A;  3KHH A;  3MJF A;  2R8H A;  4K0K H;  3LML A;  3N42 B;  4LFA H;  4BY7 G;  1UNN C;  3PZP A;  1MZB A;  4QWE A;  4I55 F;  2E2H A;  4IAJ A;  1I50 A;  3N8D A;  3UQ8 A;  4DR1 H;  1WCM A;  4Q43 A;  2DWC A;  2YCH A;  4IZO A;  4QJF A;  5KG7 A;  2R6F A;  2VA2 A;  2AGO A;  4EEQ A;  4DR4 H;  2R93 A;  2R92 A;  2FB9 A;  5DQG A;  4RAZ A;  2FPG B;  4Q45 A;  4Q44 A;  3RB3 A;  5H80 A;  3U9S A;  3GV8 B;  3RGZ A;  3SE7 A;  3GIQ A;  3GII A;  4LF9 H;  3GTK A;  5L1K A;  4A2A A;  4HQ6 A;  4UCO A;  1WH2 A;  4UCT A;  5KFP A;  1RYR A;  4KHP H;  4J9S A;  1ZET A;  4AYB E;  3RUP A;  1M0T A;  3MWD A;  4DV6 H;  1RYS A;  4DL6 A;  5DLG A;  4RZQ A;  4LF4 H;  4YBZ B;  4A3M G;  2YYA A;  4MV1 A;  4C5B A;  5KT7 A;  4R7R A;  2RDI A;  2W9C A;  4UFZ A;  2UVW A;  2ATL A;  5LMU H;  4QIW E;  2O03 A;  3I4M G;  4RUC A;  2ZJT A;  5KFM A;  5BR8 H;  2R7N A;  2FK1 A;  1X9N A;  5C5J A;  4TQS A;  1AUV A;  3F8N A;  5DQH A;  3OUZ A;  4IRC A;  1RJP A;  2ZDH A;  3V4S A;  1EUC B;  5D1O A;  5T14 A;  4A3I G;  3JSL A;  1KJ8 A;  4ED0 A;  2R7Z A;  2R85 A;  3GTP A;  3MR6 A;  5KFD A;  4MTD A;  3JSN A;  4ZQI A;  2FPI B;  4IRD A;  5JVL A;  4DV3 H;  2GPW A;  2PVP A;  5C3E G;  1IBM H;  3PW2 A;  1A0I A;  1E4E A;  1JKJ B;  1WSC A;  2W7O A;  3BQ0 A;  4ED1 A;  3KTM A;  3RBE A;  5LXT F;  4DL3 A;  4QWA A;  2XC9 A;  2V4Q A;  5D1O B;  4F50 A;  2YU9 A;  2XCL A;  4X64 H;  1GLV A;  2KSW A;  3T5L A;  3V6K A;  4MA0 A;  1BXR A;  4ETS A;  4DL7 A;  3RBD A;  3V6J A;  2UUB H;  3TII A;  5CA0 F;  2QYZ A;  5KFE A;  3J80 W;  3R5F A;  5C8Y F;  3FKI A;  4EG0 A;  5EDW A;  2W9B A;  2JA7 G;  2Y0S E;  4IWY A;  3PW0 A;  4RB3 C;  2R8G A;  1E4E B;  2UXB H;  2BQ3 A;  2YZN A;  4NXM H;  2R7L A;  1I3Q A;  4BWS C;  3ETH A;  4YR3 A;  4QWD A;  5LA6 F;  2FPP B;  5DG7 A;  2DPJ A;  1DIK A;  5EWE A;  4YAJ B;  2C2E A;  1C30 A;  5GON F;  2CW8 A;  1XDN A;  5D1P A;  2VUM G;  3I12 A;  3H4D A;  2W9B B;  1GSH A;  1TA8 A;  5L1I A;  2I8C A;  2FKL A;  4LF6 H;  4ECU A;  5DQI A;  3PW5 A;  5KFX A;  4CC6 A;  3ETJ A;  3GIM A;  1K1S A;  3MWM A;  1JXL A;  4DL4 A;  2NU7 B;  2W7P A;  4O4I F;  4TV9 F;  4GC7 A;  4OX9 H;  4F4W A;  3C0F B;  2YS6 A;  5KFC A;  3M9O B;  1S0O A;  3L4J A;  4GKJ H;  2RDJ A;  4JI4 H;  4DR6 H;  1SFO A;  1JIH A;  3JRX A;  2FK2 A;  3VPD A;  3PN1 A;  4WD3 A;  5A2Q W;  4EBC A;  4A3K G;  2VA3 A;  4IR9 A;  2W6P A;  2WDT A;  4L1K A;  5CAE B;  5DGA A;  4GLX A;  4YP3 A;  4JI5 H;  5JVD F;  2VPS A;  3N41 B;  5KFJ A;  2DIK A;  2OH2 A;  2FP4 B;  2M05 A;  2JA6 A;  2I87 A;  5IP9 G;  1JDB B;  4ZHQ F;  3SI8 A;  4A3L G;  4EGQ A;  4I50 F;  4A93 G;  1N32 H;  1S68 A;  3L2P A;  4QW9 A;  4I4T F;  2P0A A;  5EWF A;  2Q2U A;  4FBU A;  5FPR A;  5K2M A;  2F4V H;  2W6Z A;  1I6U A;  5F9L A;  3G6X A;  3PO2 G;  4ECQ A;  4RB1 A;  1WR2 A;  1OWT A;  1B6R A;  2XCA A;  2RF4 A;  2FLL A;  2J6S A;  3BJY A;  3BAA A;  5BPF A;  1IBK H;  1HNZ H;  5KFG A;  3Q8S B;  1IOV A;  3OSN A;  3H0G A;  4ED8 A;  3I4N G;  2UXD H;  5KFA A;  4EGJ A;  1J5E H;  1M0W A;  1K83 A;  1I94 H;  2WAQ A;  4QWC A;  5KFF A;  2QK4 A;  3G8C A;  2B63 A;  1B33 N;  1XMO H;  5KG2 A;  1S0M A;  3J7A K;  1Y1W A;  3TQ1 A;  3G6V A;  5IYC G;  4F4Z A;  2PMZ A;  1VBG A;  2ASD A;  4X65 H;  4ED6 A;  3FMA A;  4UCU A;  3RIZ A;  4EYI B;  3GTM A;  4MV9 A;  4A2B A;  4LSX A;  3OHB A;  3MR3 A;  5BMV F;  2SCU B;  4B3M H;  3H0G G;  1R9T A;  4M7E A;  3HOU G;  2NU8 B;  1K1Q A;  4EEY A;  2R82 A;  4YQW A;  1DGS A;  4JI3 H;  4A3D G;  4YY3 H;  1WCM G;  4E4T A;  2WE6 A;  4UCV A;  1KJJ A;  5KG1 A;  3J81 W;  1P8L A;  1KC7 A;  3N44 B;  2C22 A;  2UU9 H;  4LFC H;  2AGQ A;  4JI7 H;  2W6N A;  3RGX A;  4YR2 A;  2JA8 G;  3PVX A;  2R92 G;  2R93 G;  3U9T A;  3H40 A;  5BPH A;  4DUY H;  2ASL A;  3PW4 A;  1RJR A;  1N36 H;  1XNR H;  4A3C G;  3VMM A;  4DV4 H;  1L2Z A;  3GQC A;  3IG0 A;  5KFL A;  4JUZ A;  5FLM G;  5IWA H;  2ZDQ A;  4MV7 A;  3HOZ G;  4A3J G;  3TIN A;  3RV3 A;  4JI1 H;  3CVZ A;  3JAM W;  2C00 A;  4HNT A;  5L1J A;  4DL2 A;  3QZ7 A;  4R8U B;  1TWC A;  1HR0 H;  2UUC H;  3HOV G;  2R84 A;  2VQD A;  2J6U A;  1GYF A;  2UXC H;  1RK6 A;  1VBH A;  2YRX A;  4X66 H;  2BR0 A;  5C44 G;  4FM9 A;  1S9F A;  4RNO A;  1RJQ A;  5KT6 A;  2VUG A;  3FDS A;  2GPS A;  5KG6 A;  4IR1 A;  4C2M A;  3GTO A;  5KT4 A;  3TQT A;  3MFI A;  4IWX A;  3RAX A;  4C5C A;  1DV1 A;  2AU0 A;  2FJZ A;  2IBK A;  5F9N A;  4A3F G;  4LH7 A;  5LL6 b;  3EPI A;  3Q8Q B;  4NXN H;  1XNQ H;  1E4G T;  3EPG A;  2ZM6 H;  4AYB A;  4DLK A;  1TWH A;  2Q2T A;  4JV0 A;  1TWA A;  5DG8 A;  4U6P A;  2R7Z G;  4MV4 A;  4J9O A;  4FU0 A;  3T5H A;  2XIG A;  4LF7 H;  4Q8F A;  4RB2 C;  4HNU A;  5LOV F;  3PO3 G;  5KFY A;  2V59 A;  3H20 A;  5DG9 A; 
#chains in the Genus database with same CATH homology
 3LML A;  3N42 B;  4LFA H;  1BJT A;  3PN1 A;  5A2Q W;  1MZB A;  4LMY A;  4RAY A;  2HVR A;  2WDT A;  4DR7 H;  4IAJ A;  4GLX A;  3UQ8 A;  4DR1 H;  4JI5 H;  2YCH A;  2VPS A;  3N41 B;  4X62 H;  4APM A;  4EEQ A;  2HHH H;  4DR4 H;  4EFE A;  1N32 H;  4RAZ A;  1FKA H;  1S68 A;  3L2P A;  5FD5 A;  2E5L H;  2Q2U A;  4PDB A;  4LSA A;  5FPR A;  3RGZ A;  4LF9 H;  3M4I A;  2F4V H;  1I6U A;  3N40 P;  4A2A A;  4I7H A;  4UCO A;  1WH2 A;  4JI0 H;  5EOY A;  4UCT A;  2WYO A;  4RB1 A;  4CC5 A;  3K3V A;  4KHP H;  3OTO H;  1SEI A;  4DV6 H;  1M0T A;  4LF8 H;  4EFB A;  3BAA A;  3RJ0 A;  2VQF H;  1IBK H;  1HNZ H;  4RZQ A;  2UUA H;  4LF4 H;  3KAJ A;  1FVI A;  5LMN H;  1HNW H;  3KAL A;  2UXD H;  1J5E H;  1M0W A;  4R7R A;  1I94 H;  4DR3 H;  4UFZ A;  2RGR A;  5FPO A;  1E4F T;  5LMU H;  1O75 A;  1XMO H;  2O03 A;  2RGV A;  1V9P A;  3J7A K;  2ZJT A;  2FE3 A;  5BR8 H;  4JI8 H;  3T1Y H;  1X9N A;  3F8N A;  2VOB A;  2HVS A;  4X65 H;  3FMA A;  1Z2O X;  4UCU A;  3RIZ A;  1TAE A;  1XMQ H;  4MV9 A;  4A2B A;  4LSX A;  5D1O A;  4JI2 H;  4JI6 H;  3JSL A;  3T1H H;  3RTX A;  3KXY T;  4DV5 H;  5FD6 A;  4B3M H;  4M7E A;  4MTD A;  3JSN A;  4MTE A;  1DGS A;  1Z2P X;  4DV3 H;  1HNX H;  4JI3 H;  4YY3 H;  4LFB H;  2HVQ A;  1BGW A;  3DF7 A;  2WE6 A;  4UCV A;  4DV1 H;  1IBM H;  4B3T H;  1A0I A;  3J81 W;  1P8L A;  2UU9 H;  3N44 B;  4GKK H;  4LFC H;  4JI7 H;  3RGX A;  3N6X A;  4B3S H;  4DV0 H;  5FLX W;  4DUY H;  1N36 H;  2HGS A;  5D1O B;  1XNR H;  4RB0 A;  4UCR A;  4X64 H;  1B04 A;  2KSW A;  1ZHQ A;  4UCS A;  4ETS A;  4DV4 H;  1IBL H;  1L2Z A;  2UUB H;  3IG0 A;  1Z2N X;  4DV2 H;  2MCT A;  5IWA H;  3J80 W;  5IT9 W;  4YHH H;  4MV7 A;  1N33 H;  4JI1 H;  4RB3 C;  3CVZ A;  3JAM W;  2UXB H;  4NXM H;  1N34 H;  4BWS C;  3BA9 A;  3L4K A;  2VQE H;  1HR0 H;  2UUC H;  3BAB A;  1GYF A;  2UXC H;  1ZHS A;  4X66 H;  4J0M A;  3EYY A;  4FM9 A;  2VUG A;  3HXL A;  4DR5 H;  2CW8 A;  1XDN A;  3RF2 A;  1S03 G;  5D1P A;  4Q0Y A;  4LF5 H;  4DV7 H;  1TA8 A;  1FJG H;  4LF6 H;  4NXN H;  4LH7 A;  1XNQ H;  4K0K H;  4JV5 H;  1E4G T;  4CC6 A;  2ZM6 H;  4B3R H;  4JYA H;  1SYX B;  1AN7 A;  3MWM A;  2CW7 A;  4DR2 H;  4AQY H;  4DUZ H;  2Q2T A;  3KAK A;  4OX9 H;  3BA8 A;  3C0F B;  2XIG A;  4LF7 H;  3L4J A;  4GKJ H;  1VS0 A;  2OWO A;  2W57 A;  4JI4 H;  4DR6 H;  3N43 B;  4RB2 C;  4LH6 A;  3H20 A;  5LL6 b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...