4ETSA

Crystal structure of campylobacter jejuni ferric uptake regulator
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
146
structure length
141
Chain Sequence
ENVEYDVLLERFKKILRQGGLKYTKQREVLLKTLYHSDTHYTPESLYMEIKQAEPDLNVGIATVYRTLNLLEEAEMVTSISKKYELANKPHHDHMICKNCGKIIEFENPIIERQQALIAKEHGFKLTGHLMQLYGVCGDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Ferric uptake regulation protein
publication title Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
total genus 40
structure length 141
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4etsA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4etsA02
3HRTA 4LB5A 1ODDA 3MZYA 2XAJA 2IRFG 2A5YB 1WRJA 2P6SA 4ZZLA 4L9NA 4G94A 3KLOA 1XGSA 3WU1B 3DF8A 2FBKA 3M8EA 4KYWA 3WTSC 4CICA 3ZMDA 3WG9A 4UXNA 2CSOA 2IPQX 3L09A 2HFHA 1DDNA 5FGMA 2A61A 4RB0A 2E7XA 1F5TA 1LDDA 4YFXF 3DV8A 1ZGAA 2VT3A 3NRVA 3I64A 5DCFA 3J80Z 2CYYA 2MBFA 5DUIA 4BYYA 2KIUA 3JTGA 4Y15A 3U2RA 1UB9A 3WGGA 1U6GA 2G9WA 2VOPA 2CWEA 1QPMA 1J59A 2GXGA 1G3TA 1PDNC 3I71A 4EV0A 4ASNA 2VBWA 3LA3A 5ICGA 1P4XA 2EWNA 4UNOA 2OZ6A 4EJWA 3ZMZA 4XBFA 3RYPA 3BY6A 2GAUA 5CVRA 2RKHA 4M74A 1O3SA 4PDKA 3TOAA 4ENNA 4RGSA 3BPVA 5FFZA 2DFIA 4KMUX 1FBSA 5CVVA 4NB5A 4KT5C 4HDVA 3REOA 3GFLA 3GUDA 4M9XA 4KIFA 1DPRA 2FEZA 3EYYA 3HHHA 4R8HA 2WC2A 4FT8A 2RDPA 1BIAA 5LEKA 3P7NA 2RC4A 2VBXA 2QQAA 3WTVC 1F1ZA 5FD6A 4G8XA 4U0WA 4PGHA 1Q1HA 1IN5A 2E7WA 3H3UA 1IW7F 1O7FA 4A6DA 1ZYRF 4A5MA 2G7UA 1TQIA 2F2EA 2FXAA 2PLYA 2FNAA 5IT9Z 2A69F 5K5RA 2ETHA 1MD0A 3V4GA 2A68F 2M5WA 1PP7U 1OYWA 2D1HA 1Z05A 2HTJA 4DNCA 1R1VA 1FP1D 5CYVA 5FD5A 2GZWA 2QLZA 2FE3A 4HLYA 1O3QA 2QWWA 4Q48A 4BAYA 4YG2F 3GYHX 2F5EA 4L9VA 5DD8A 2X4HA 4O3MA 4BHBA 2K86A 3K2ZA 3C7JA 4AVPA 4I98B 2P5KA 3O6BB 1S8NA 4Q5SF 3BPXA 3EETA 1K78A 1TW2A 1WKMA 1S7AA 2M87A 3PFIA 4PCQA 4BHPA 3KZZA 1HKQA 4AIKA 3K9TA 2DPDA 5AIQA 2YU3A 2YPRA 1IAWA 4I01A 2PI0A 2XKPA 4L5JA 4ESJA 1OYIA 2Z33A 1ZLJA 4I09A 2R3SA 4JQFA 2HQNA 2W57A 2GIVA 1ZH5A 5LGTA 1MZBA 1PUEE 4BXUA 2KKOA 2JPBA 1U5TB 2AXLA 4B09A 4RAZA 4WK8F 1FBQA 2O0YA 4G9YA 2TDXA 3M7GA 3Q5FA 4OIQF 5F1RA 3ML6A 1FZPB 4Y17A 2CO5A 2PQ8A 5D5VB 2DLLA 2P8TA 1ZRDA 4GCVA 3R4KA 3O2PE 2MA3A 3D0SA 2E1NA 1J2XA 1G3YA 5AONA 2C6YA 4LGWA 2WWYA 2PMHA 1R1UA 4FX4A 2W84A 3G73A 2XUBA 1R00A 3KP3A 3JSOA 2O8XA 1RIOH 4KN4X 5DEQA 1SD5A 4BH9A 1BI2A 3V7SA 3QPHA 1IN8A 5EEHA 4L9JA 3HRSA 3GFIA 4HX4A 1ZAOA 4IRGA 1EH7A 1ON2A 2P4WA 2Y75A 3KEOA 4LB6B 1IN6A 3KP4A 2ZCWA 3M9AA 2FF4A 5F6FA 5LBQA 1YS6A 1K7AA 2KJCA 4RGRA 1HQCA 1W4MA 3KP2A 1SD4A 5TJJA 4N9HA 2K27A 1UCRA 2XVCA 1FX7A 3BJOA 2QBYA 2PBIA 4M6XA 2L54A 3GO5A 4MEXF 3QP6A 4RAYA 1LDKB 3QPTA 2LKPA 2YX4A 3FM5A 1S6LA 3WE2A 3FF5A 4IF4A 3DQVC 3F22A 4U7BA 1H0MA 2UXXA 1TLHB 2HKXA 3TKYA 1J75A 1YW7A 2P7VB 3OV8A 1UHMA 1I1GA 1QZYA 2V6CA 2QBYB 2FRHA 4ETSA 3H92A 3HUGA 4A5NA 1SFXA 1IN4A 1Z6TA 1U5TC 4L5IA 2EB7A 4B8XA 1EH8A 1YQAA 2W25A 2P6TA 1G3WA 1W7PA 1Z7UA 1ZG5A 4IHSA 5LHHA 3SFZA 3ZMUA 1SAXA 3IWZA 1ZARA 4KA4A 1AOYA 1TNTA 3SQNA 1H9GA 4KNYA 2DI3A 1O3TA 3IWFA 1FPQA 2UWMA 4GYIA 1LNWA 1BM9A 1Z9CA 2EJRA 1MJBA 4Q47A 3MWMA 5DDGA 3F8FA 1KU2A 3GXOA 3E5QA 4A0XA 5CVIA 3ZQ7A 1I5ZA 2CW0F 5D5UB 2EV5A 3T8RA 2HR3A 1R7JA 2LSOA 4WWCA 1JXSA 2GQQA 2V1DA 3L2CA 4IJAA 5J8CA 4L9TA 3FXUA 2YR2A 4HA8A 1FYMA 2JPCA 4HDUA 4FX0A 2NNYA 2D45A 2MLGA 2YSRA 5ICCA 2EK5A 1G4DA 2V1XA 2V9VA 4M72A 3VODA 5D8KB 1QNTA 3LAJA 1HBXG 4PGGA 3R61A 4HX7A 2ZBKA 3NQOA 3ZMSA 4P9FA 5LRRA 5LEJA 1P6RA 2HYGD 1MDMA 1GXQA 1IUYA 1HSJA 2GXBA 2E1CA 1FSEA 2COMA 2ISYA 2H94A 4YFNF 3T0YA 3JSPA 2NNNA 4KN7X 3ELKA 4RB3C 1P2FA 3WTWC 4KIBA 1YIOA 3SHFA 2GA1A 1R5GA 2FQ3A 3GF2A 3GFJA 3I58A 3U1DA 1MDMB 4KMFA 3LQQA 1O57A 3CUOA 1S29A 2IA2A 3KP7A 5HDNA 3M8FA 4ON0A 4U88A 3V8JA 1A04A 3ZMTA 2V1UA 3K69A 1TBXA 2W24A 3C3WA 3RPUA 2WV0A 1UFMA 2MLKA 2Q8KA 5KVRA 1XCVA 1D8JA 3F8BA 2XKOA 5KK1A 4EM2A 4IVNA 4A0ZA 4HBLA 5HS9A 3F21A 4OIRF 2VN2A 2HTSA 1HSTA 2A6EF 4HLXA 2ELHA 4ENKA 4A2UA 4ESFA 4M6YA 4OMZA 4UVCA 2UZKA 1KQ9A 1KU9A 3NEUA 3Q9SA 2BYVE 4EGYA 1XD7A 4BQAA 3IRQA 4K2EA 3FX3A 2H27A 5K5QA 1J9IA 4S04A 5K5OA 1GXPA 2IVMA 2PJPA 2IA1A 1JGSA 2V79A 2HOEA 2VC0A 3R0AA 1WI9A 1FNNA 2D2WA 5L3CA 3H3ZA 3HYIA 4CHUA 2FBHA 2XGXA 2WTEA 2XHKA 1D8KA 2H09A 2OD5A 4G7OF 4HYEA 1F4KA 2M30A 4EM0B 4KDPA 4UVBA 1XGNA 1QZZA 3S2WA 4EMSA 4AWXB 4RB1A 1ONVA 4A6EA 3E6BA 2XAQA 1T38A 5BPDA 2XRNA 1U78A 5DV5A 4G6DA 4KUMA 1LDJA 1HKTA 3HIFA 5H6RA 1XB4A 2ZKZA 1KQ0A 2L02A 3RJPA 1XSXA 3JAMK 2K4BA 2PG4A 1IXSB 3M1EA 4Y13A 1YTYA 5L3BA 1BOAA 2HZTA 1P92A 5CJ9A 5D4RA 1T2KA 2BBYA 3ZMVA 1LEAA 1EV7A 5ED4A 2EA2A 1MKMA 3TDZC 3TO9A 1ZGJA 4LMYA 1FYKA 2XAGA 2ZXJA 3CUQB 2ZNZA 3P9KA 2HWVA 1FP2A 5HDKA 4XSXF 4UHTA 4GGGA 4I0BA 4LD5A 4KICA 3GX4X 3E6DA 4WF2A 2PN6A 4PZJA 3GFMA 4P9UA 1ZHFA 2FU4A 2K7LA 1ULYA 2XAFA 2MD5A 5ERIA 3HOTA 3U9GA 2F5DA 1P4WA 1U5TA 3DPTA 2AS5F 1V4RA 3WTXC 3L7WA 2KJBA 3B73A 1SFUA 3J81K 1W5SA 1QQIA 1IF1A 2OQRA 3DKWA 3LA7A 5HVQC 2CGPA 4HV5A 4DQ2A 2QENA 3COAC 3F8CA 1UHWA 2ESHA 3PQJA 4A0YA 1O3RA 4HV6A 1EH6A 3ERED 1KYZA 4HZFA 3EUHA 5D5XB 5FLXK 3CO6C 2DQRA 2IP2A 1YYVA 2ZO4A 3WU0A 1HKSA 4XLPF 3HTSB 1BI3A 3TGNA 3K1NA 2ISZA 3VEPA 1T39A 3O3KA 4L0YB 2MC3A 1ZG1A 5K1YA 4ZYGA 1ZN2A 3EDPA 1FWZA 4HQMA 1FC3A 3QU3A 1PP8F 4TV7A 2A07F 2ZFWA 3LFKA 1XSVA 2DW4A 4XLNF 1BIBA 3L9FA 1K6OA 3RDIA 3HRUA 1H9TA 3ECOA 2K02A 3VOEA 1BC8C 2OBPA 2QQBA 3E3VA 1RUNA 2EFWA 1OKRA 4ENJA 5LGNA 1TNSA 1ON1A 1LQ1A 5DCMA 3Q9VA 5JVTA 3CUQC 3F6OA 3DEUA 1ZLKA 3ZP5A 5TRDA 1IN7A 2GWRA 3GEZA 5HLIA 3OOPA 3V7RA 4ZYDA 4JK1X 1Z1DA 5D6EA 4F7ZA 3GZ6A 2O3FA 3FWEA 5CLSA 3RPQA 3EQLF 1R23A 5DCMB 4YFKF 3LWFA 4WXCA 1BI1A 3D5LA 3V8LA 5ILVA 2FA5A 4I2OA 4L0ZB 2ZNYA 2VODA 5ICFA 2QZ8A 2ESNA 3E6CC 1MJAA 3R0JA 4LLNA 2ZMEA 1T6SA 3AAFA 1R1TA 1QBJA 2ADUA 1LVAA 3ZN1A 4LFUA 3ZPLA 2KIFA 4UV8A 2Q0OA 2JSCA 2GA2A 4GO1A 3E6MA 1Z91A 1SD7A 3F6VA 3BOQA 4Z2YA 4WXHA 5DD4A 2OU2A 4HQEA 3P9CA 1U8RA 1STZA 4P96A 2ZMEB 1SMYF 2IT0A 3I4PA 2P5VA 3E97A 1BN5A 1T98A 5L3FA 2RQPA 3W6JB 2Q2EA 3BJ6A 5AIPA 3MEXA 4HX8A 5ILSA 1XDSA 4U0YA 3HSEA 4D0PA 4MTDA 4RS8A 4R1HA 3CTAA 4ENMA 5A2QK 1U3EM 2DK5A 4FHTA 4HW0A 3RIRA 2M45A 5JFRA 2XIGA 2DU9A 2VBZA 2BEOA 2NYXA 1YFHA 4CO8A 4HF1A 3HRMA 2QUFA 3CDHA 3N4MA 1FLIA 2QVOA 4IPAA 2MH9A 2IJLA 4OOIA 1OYYA 1TW3A 2CQKA 2HYFA 1O7LA 1U2WA 4KIGA 2Z99A 3SXYA 3BDDA 2HDCA 2HS5A 3ABTA 3IKVA 4ZYHA 2ZJ2A 3F3XA 3WTTC 1J7KA 3IL2A 4WX9A 5L3EA 2STWA 5HLHA 3ECHA 2LDUA 4N0BA 3PQKA 4MTEA 1YS7A 3K0LA 4MGRA 5JR3A 2EV6A 3BWGA 3FXRA 3R6SA 3DFGA 1LB2A 1YG2A 2VE8A 3V8KA 2Z9OA 3KE2A 4Q4ZF 1DUXC 3E5UA 1MJ9A 2PMUA 4HAMA 3WGHA 2NS0A 3LA2A 1USTA 5E20A 4ZH4F 5BPIA 5EEGA 3BROA 1L0OC 1KGSA 3TQNA 4GYGA 1HW2A 3G3ZA 3BJAA 2XV4S 3MZHA 1USSA 2RNJA 4E70A 1D5VA 1OMIA 3MAJA 4IHTA 3ISPA 4ZZDA 4S05A 4N9IA 2DTRA 4IRIA 1FY7A 1X3UA 1KU7A 1FSHA 3HSFA 5LLQA 4AIJA 5BOXA 4YIFA 4M73A 4EM1A 2H6CA 3JW4A 3FZVA 2MH2A 3TO7A 4UV9A 2QQ9A 5J8FA 2F5FA 3QU6A 2VXZA 1G6NA 2NRAC 3VFZA 2DQLA 5LHIA 3K1PA 3IRRA 1FYLA 2BE5F 5JI6A 3CJNA 3WGIA 4YIIA 2Y48A 1HXDA 5ICEA 2O03A 2PEXA 4EJUA 2XAHA 5F64A 2RVCA 4HF2A 3T5XA 1GVJA 4IXAA 1R22A 1JHFA 3FMQA 3I53A 3QRFF 2DT5A 3JAMZ 1OR7A 1GHCA 2L4MA 4OINF 2EFQA 3F8NA 2VONA 2J5PA 1W7PD 1R36A 4RGUA 4LLGF 2O6GE 2HEOA 6PAXA 3KP6A 4AD9A 1SMTA 3HSRA 2P5LC 4U0VA 1W5TA 1NHAA 1QO0D 3CO7C 1Z6RA 3I59A 3RKXA 1LJ9A 1VTNC 1E17A 4UUVA 5DYMA 2KIMA 1YW8A 2D1VA 3DP7A 2B0LA 1B9NA 3HOSA 3ULQB 3J7AO 2EFNA 5D8LB 3WTZA 4G7ZF 3KZYA 4I7HA 1SD6A 5HS7A 4UVAA 1F9NA 3LSTA 3I59B 1P4AA 3LQRA 1KU3A 1BJAA 4BNCA 3C18A 3GVAA 4LK1F 5IT3A 3SZTA 1ZG3A 3J81Z 1B6AA 4CXFA 5JHUA 1B1BA 1AWCA 1WSUA 3SZPA 1FBUA 3CUQA 5DUKA 3TOBA 3F8MA 1WQ2A 5FO5A 4I0AA 1SFEA 1KA8A 4OMYA 2EFPA 4EJVA 3I5UA 3J80K 3RKYA 2P7CB 5E1WA 5FLXZ 3VB2A 2DAOA 4CZZA 4A12A 3WTUC 5J6XA 1XCBA 3FM3A 4G6QA 4EVIA 5HDGA 4WCGA 4CYDA 2FMLA 5L3DA 3F72A 3B02A 3KEQA 2FSWA 1TQMA 5ILUA 2FBIA 2ACJA 4EQQA 1YW9A 2FMYA 1ZRCA 3E5XA 3CLOA 5HS8A 3WODF 2XROA 1REPC 4NHJA 1KYWA 1XMAA 4WXDA 3FMRA 5E8GA 2BGCA 3N97A 2JZYA 3KP5A 3KFWX 3GZ5A 1FT9A 1ZRFA 1KQ8A 2NAZA 2STTA 3DPLC 1BC7C 1S7OA 1J0RA 2EA4A 3T1BA 1LEBA 1V3FA 3MQ0A 1RNLA 4AIHA 4QLCU 5H20A 3QOPA 1D3YA 4LK0F 5H6QA 1K78B 5E1ZB 1HW1A 1WWXA 1YO5C 2OZUA 2IW5A 3JTHA 2X0LA 3W6KB 1QGPA 2CFXA 1E2XA 3LAPA 3IHUA 5CVUA 2KRFA 5IT9K 2RGVA 3T8TA 3RYRA 2A3SA 4OU0A 2K4JA 4KFCA 4BHCA 2FNPA 4EJTA 2HGCA 2VC1A 3KCCA 4MEYF 4U7DA 3GWZA 3WTYC 4NQWA 3BZ6A 2QM3A 1TQPA 1RI7A 2L4AA 5HOOA 1I1SA 5FB2A 2DPUA 4ZYEA 4RB2C 1IZ1A 3ABUA 5E18F 3WE3A 1B59A 1BI0A 5LRSA 3ROUA 2O61A 4LG0A 1YLFA 1OPCA 4I02A 5A2QZ 2OAZA 2F5CA 1BBYA 4XRFA 3MCZA 4MNUA 1ZREA 1MGTA 4O5VA 3TDUC 2LF8A 1B4AA 3KLNA 5HLGA 1TTYA 2JT1A 3RI4A 1C0WA 1I27A 1IXCA 5E17F 4LG0B 4P5OA 4CGZA 3L00A 2DK8A 3IC7A 4H0EA 3FXQA 1XSDA 1XMKA 5CVJA 3QP5A 1RZ4A 3HHGA 2HQRA 3FHZA 1XN7A 1XDUA 3TO6A 2R7FA 2PFBA 5D6FA 3K1MA 2LF7A 2JRTA 5D4SA 3ZN0A 1CF7A 2QYOA 4EGZA 2L01A 5E1XA 5LGUA 4MHGA 3IKTA 1I6XA 3I54A 1S3JA 4P55A 3DXJF 2Z3YA 4L18B 4QWQA 1IRGA 2XASA 2VOOA 2UXNA 2RN7A 5BQTA 5LHGA 3P9IA 1Y0UA 1CF7B 1G3SA 4G7HF 2OQGA 5E8IA 3KETA 1JHHA 3R60A 4XSZF 2Y0MA 3GLXA 1R5HA 4IRHA 1FOKA 2RV8A 2A6HF 2OA4A 2EFOA 2W85A 1XGMA 2G7HA 1IRFA 4LLLA 5D5WB 4HF0A 3MFKA 1XGOA 1CGPA 1W7PB 4O6JA 1J5YA 2BV6A 3HTUA 2J5OA 4M9ZA 1DPUA 4HOBA 3RKWA 3V7CA 2LNBA 2JTVA 4JBAA 2VBYA 2M8EA 2DO7A 3FMSA 2YX7A 2HKOA 4EJOA 3I0TA 2DBBA 4M71A 4RGXA 4LJZF 1B9MA 3RTRA 3EYIA 1RUOA 4MQVA 2EV0A 4R79A 2R7DA 2H6BA 4CDGA 2M1BA 2IA0A 1K79A 3QAHA 1R58A 1DP7P 5BS6A 5BMZA 1IXRC 4MQ9F 2VT2A 4ESBA 2L3DA 1HW5A 4GXOA 2VE9A 1T0FA 2CG4A 1L3LA 4OIOF 3BP8A 3GW2A 4M9SA 5L3GA 2Z5UA 2FOKA 3C1DA 1JE8A 4OIPF 5FFXA 3F23A
chains in the Genus database with same CATH superfamily
2XF6A 2IXSA 4EGJA 2QA4I 1B04A 3HRTA 2BQ3A 2X6WA 3J7AK 1X58A 4LB5A 4A3BG 3QZ7A 4H4KC 1ODDA 2L0KA 2XD4A 2X1EA 5GONF 3A03A 4IRDA 2ATLA 3FXMA 3MZYA 3CCQI 3HOVJ 2AXTC 2LY9A 2XAJA 4DW6A 4YQWA 2HQAA 1C30A 2R85A 4DL6A 2IRFG 1W36D 2A5YB 1WRJA 2VJIA 2P6SA 4ZZLA 4NC8A 3ZQGA 5EG0B 4L9NA 4G94A 2K3PA 2R7XA 3GTOA 1TWAJ 2JWTA 2BHYA 3OIPA 4XICA 1Z67A 4KHPH 1VQOI 3KLOA 2OWOA 3VYRB 2A5WA 3SE7A 5F04A 1JKPC 1IRXA 3GTLJ 1XGSA 5EWEA 4RNMA 4V2FA 3WU1B 3DF8A 2DMQA 1N34H 3K5IA 2FBKA 2JSPA 3NWTA 3M8EA 4KYWA 3WTSC 2FK2A 2GLOA 4CICA 3ZMDA 3C2GA 3RIZA 2V26A 3WG9A 1VQ7I 4UXNA 2YL2A 2CSOA 5IP7J 4L5EA 1K1SA 3FKJA 4BJ5C 1MSFC 1ZETA 2IPQX 1HNZH 3L09A 2CUJA 2FLLA 2HFHA 5L9XA 4PUSA 3TP3A 1DDNA 5FGMA 4ECZA 2CMPA 3GIQA 2V4RA 2A61A 4RB0A 3RB4A 1Y8RB 2E7XA 5J4VA 1JJ8C 1F5TA 3HOYG 2R84A 1LDDA 5F0HA 5IYCG 2OJED 3PN1A 2F4OB 3OYAA 2CW8A 2FX0A 4YFXF 5IT9W 3DV8A 2R0QC 3ZRGA 1ZGAA 2VT3A 4PSXA 4IZOA 2EIMH 3JRWA 3NRVA 3T5HA 4E7SA 1I94H 3I64A 1IRZA 5DCFA 2FLNA 2DJNA 1G59A 2VUGA 1X2NA 3J80Z 1BXRA 4BE1A 1ZKGA 1N56A 2CYYA 2MBFA 5DUIA 4BYYA 2KIUA 1TT5B 4QW9A 1D1BA 3JTGA 4Y15A 4ECXA 4FBTA 3U2RA 3CJRB 1UB9A 3WGGA 4F93B 1U6GA 2G9WA 2Y0SE 1OCPA 3HKZA 2VOPA 4ED8A 2CWEA 1V55H 1QPMA 3RV3A 1J59A 4AYBE 3FBNB 2GXGA 2ASLA 5EDWA 2C28A 1G3TA 1PDNC 3H4BA 1KC7A 2E1MC 3I71A 2FQ4A 4DR6H 4EV0A 3OL4A 2HZDA 4AIDA 2F48A 4ASNA 2NU7B 4IL6C 3GV5B 1TT0A 2VBWA 3LA3A 4XKWA 5ICGA 1P4XA 1VI0A 2EWNA 4UNOA 2Y9YA 2OZ6A 2PX9A 2J9GA 4EJWA 3ZMZA 1RYSA 4QJFA 3ORQA 4XBFA 1I39A 5CKTA 2E34A 3RYPA 3BY6A 2GAUA 5KG6A 1VQMI 5CVRA 1Y1WG 4F4ZA 2RKHA 1BR1A 3AL0C 4M74A 3HOWG 4EEFG 3K70C 3KYLA 1O3SA 3GTOJ 4PDKA 4IHJF 2Q1ZB 3TOAA 4BE2A 4ENNA 4RGSA 5KHDA 2O8KA 3VPRA 5LA6F 3BPVA 5FFZA 2DFIA 2JRMA 2OPTA 4KMUX 5F27A 4FS1A 4JI1H 1FBSA 5CVVA 5KFFA 2TRTA 4NB5A 4KT5C 2AU0A 2OF7A 4HDVA 1DU6A 4CCNA 4E7LA 1JUPA 3REOA 2NOJB 1MBJA 3GFLA 3GUDA 2OUMA 4CC5A 1KEEA 2C35B 1MNDA 4M9XA 4XX0B 4CH7A 4KIFA 1DPRA 3M4OJ 2FEZA 3EYYA 5KG5A 4J9NA 2HDWA 5B1BH 3QFFA 2V7FA 3HHHA 4R8HA 4FTHA 2WC2A 2BY1A 2M3AA 2VPQA 4FT8A 1IUFA 5HBRB 4ANJA 2RDPA 1BIAA 4W97A 2M0MA 5LEKA 1HDDC 3P7NA 4D7NA 2RC4A 2DT7B 2QQAA 2VBXA 3TW7A 1B6RA 3ZOBA 3U9TA 3PW0A 1YJWI 4MV1A 2KL4A 3WTVC 4HR7A 1FIPA 1QHHD 1XMQH 2ZFUA 1F1ZA 5FD6A 3OIOA 1DGWY 4G8XA 3PJRA 4ED0A 2RREA 4U0WA 4PGHA 1Q1HA 3BTIA 1IN5A 3BR1A 2FPIB 3R5XA 2E7WA 4YEJA 2R8JA 3MR3A 3H3UA 3KIOA 2WAFA 2PMZE 5DQHA 1VFCA 2IAIA 1VS0A 1IW7F 1O7FA 3CCLI 2WAQN 4XONA 4A6DA 3M4IA 1UC8A 3OR2C 1ZYRF 3PO3G 4A5MA 2CUFA 1Y0NA 4R8UA 2G7UA 1QVTA 4Y7NJ 4B3MH 1TQIA 2F2EA 2FXAA 2PLYA 3N41B 3RV4A 3I4MJ 2FNAA 4P1WA 3UFXB 5IT9Z 2A69F 5K5RA 2ETHA 2XPVA 5KCMA 1MD0A 2I80A 4ED2A 2L9NA 3V4GA 1D1AA 2A68F 2M5WA 2QQ8A 3S15J 4A3DG 1PP7U 1OYWA 3OYJA 2W6ZA 5FPOA 2FB9A 2D1HA 3HJEA 1TAEA 1Z05A 2HTJA 4XK4A 4DNCA 1WZ2A 4ITVA 1R1VA 3DBRB 2EINH 1FP1D 1HDPA 5J1YA 2DN0A 5CYVA 2L7MP 4DZJA 5FD5A 4S0HB 3BR2A 1MSEC 2GZWA 2QLZA 2FE3A 4XLHA 4E7JA 2ZJPF 2F4MB 2IGNA 2ZSIB 3PNVA 5FJ8J 4HLYA 1O3QA 1KJ9A 2QWWA 4Q48A 3V42A 4BAYA 2XB5A 4E7KA 4YR2A 2I5UA 3W2WA 4YG2F 2F5EA 3GYHX 4IWYA 5J2UF 1MMAA 4L9VA 5DD8A 2SCUB 2X4HA 1I3QA 5M3FJ 4O3MA 4BHBA 1DV2A 1UHSA 3GMEA 2K86A 3CP2A 3K2ZA 3GIJA 3C7JA 1MBHA 2J6SA 1X4OA 4AVPA 2BQRA 2DFFA 1UMQA 4I98B 5DG7A 2P5KA 3O6BB 1S8NA 4Q5SF 3AFHA 3BPXA 3EETA 4B3AA 3TBIA 1K78A 1TW2A 1WKMA 2XPUA 2HOSA 1S7AA 2M87A 5CPRB 2DMNA 3H5AA 3WO1A 3B6AA 4F91B 2IA6A 1IOVA 1I7NA 2E2JJ 2L9SA 4A3JJ 4XLEA 5FKKA 1M6VA 3PFIA 4PCQA 4BHPA 4A3IJ 3KZZA 1HKQA 2FJ1A 4AIKA 2R4GA 2OTLI 3T1HH 5KFEA 3UKGA 1MBKA 3BR5A 5KG2A 3K9TA 3CP8A 2DPDA 4O3PA 2UVUA 4I6ZA 5AIQA 4FE7A 2YU3A 2VLAA 2YPRA 2DOAA 4QWCA 1GLNA 5JUMA 2JA2A 1EUCB 3JRXA 1IAWA 4LH6A 3UNGC 4I01A 2PMZA 1ERDA 3IN5A 1IG7A 4KITB 2PI0A 2XKPA 2R7TA 4DV3H 4L5JA 3VYSB 4ESJA 5L1LA 1FJGH 4BQQA 4XZ3B 2M34A 1J09A 1OYIA 2Z33A 1EKEA 4A2BA 1ZLJA 5KFWA 4I09A 2JUGA 2YUSA 3S93A 3O8HA 1IGNA 2R3SA 4JQFA 4BQNA 3J7AY 3K4JA 2HQNA 2W57A 1I6UA 2XCLA 2GIVA 1ZH5A 4HSTA 5LGTA 1K4SA 2E19A 5LD2C 1EHIA 1MZBA 2V9PA 1PUEE 4BXUA 2W9AA 2KKOA 2JPBA 5EWGA 3T5LA 1U5TB 5D8DA 3OYBA 2AXLA 3GLLA 3GBGA 1HOMA 4B09A 3PIPF 1GYFA 4RAZA 1FEXA 4WK8F 1FBQA 2O0YA 4G9YA 5GADJ 4A3LG 2TDXA 5CB4F 2P0AA 3M7GA 3BABA 3Q5FA 4XLAA 3C2HA 4OIQF 4UCOA 2DT6A 3ABLH 2XSDC 5F1RA 3ML6A 4D5CA 3Q8PB 3NARA 4Q8EA 1FZPB 4Y17A 2CO5A 4BDZA 2PQ8A 1YITI 3GQCA 5D5VB 2DLLA 2VA2A 2P8TA 4BY1G 5KG3A 1ZRDA 4LH7A 4Z6YA 2UUBH 1WH2A 4GCVA 3OY9A 3R4KA 3O2PE 2MA3A 3D0SA 2E1NA 1J2XA 1G3YA 3DU5A 4J01A 2OTJI 2UV1A 5KFRA 5AONA 2C6YA 4LGWA 4JI7H 4F4XA 2WWYA 1I3QJ 2EIJH 4KJZA 2XGCA 2PMHA 1K6YA 1BJTA 1X4PA 1R1UA 4FX4A 2W84A 1X3ZB 4ZTJA 3G73A 2XUBA 2ZM6H 3N44B 4MV3A 3SDBA 1HA8A 1R00A 3KPHA 4GFBA 3KP3A 3JSOA 5L1KA 3G6YA 2O8XA 1RIOH 3JRGA 1FTTA 3MR6A 4KN4X 5DEQA 4LOCA 5KT2A 1WCMG 1SD5A 4U87A 4XRSA 1NK3P 3FK7A 4BH9A 1P7IA 1BI2A 3V7SA 4DBQA 3QPHA 4DL2A 1IN8A 5EEHA 4L9JA 3HRSA 3GFIA 4HX4A 1ZAOA 4IRGA 1RJRA 1EH7A 1ON2A 2P4WA 2Y75A 3KEOA 4LB6B 3JRDA 1IN6A 3GIMA 3KP4A 2B63A 2ZCWA 3M9AA 1QA6A 2FF4A 3ZQQA 5F6FA 3N43B 5LBQA 4FASD 1YS6A 1K7AA 5DS9A 4YR0A 2KJCA 4RGRA 2KDOA 2W71A 1HR0H 1HQCA 2HU9A 1W4MA 1WJAA 4J0MA 1AN7A 3KP2A 3VMMA 1SD4A 1BA5A 5KFIA 2ASDA 5TJJA 1N33H 3FXJA 4N9HA 3QYEA 5FKOA 2R7MA 2K27A 1UCRA 1P7JA 2XVCA 3GTGA 1FX7A 3BJOA 2Y69H 3UQ8A 2LREA 3B6CA 5E3LA 3M9NB 4JUZA 4Q8FA 3E7LA 4DL7A 2EZLA 2QBYA 2MD0A 5FKMA 2PBIA 4M6XA 5FKLA 5HNFA 2L54A 5E3NA 3GO5A 2KQRA 1D1CA 4MEXF 3QP6A 3BJYA 4RA2A 4RAYA 5C3EJ 1LDKB 1MBEA 3HGGA 4EATA 1O4XA 3QODA 3QPTA 2LKPA 2YX4A 4E7ZA 3FM5A 3Q0VA 3VPCA 3N8DA 4CSWA 3T5KA 1JIHA 1S6LA 3WE2A 5LFAA 4EEQA 2Y0SN 4EBDA 2DLNA 3FF5A 2JK3A 4IRCA 4IF4A 4AYBN 2JA5A 2DTZA 3DQVC 1GUUA 3F22A 2V5AA 1R4NB 4U7BA 2UXXA 1TLHB 2HKXA 3TKYA 1H0MA 1J75A 1YW7A 1O75A 2P7VB 3DTKA 2EPFA 3A0BC 2RDIA 1OWTA 3KALA 3OV8A 1UHMA 1I1GA 3VDXA 5HODA 1QZYA 2V6CA 2LMDA 5H2FC 1K1QA 1DV1A 5JLWA 1FJLA 5KG0A 3PW5A 3MR5A 3BG5A 2QBYB 2FRHA 4MO7A 1A6IA 3DKXA 1R6RA 4ETSA 4O4LF 3H92A 3HUGA 4A5NA 1SFXA 4E6KG 2DDAA 4QIWE 5KFQA 1IN4A 2HVQA 1FVIA 4ED7A 1Z6TA 4JV2A 1DGSA 5E79C 1U5TC 4L5IA 5KG7A 2EB7A 4Q45A 4B8XA 5IPAA 1EH8A 3LMMA 2C2RA 4XKCA 2KDZA 3LOCA 2FOWA 3FIWA 5J4YA 4DL3A 3NWSA 4X65H 3G1OA 3CDLA 3FMAA 1YQAA 2HVRA 2W25A 2P6TA 1KBLA 4QWEA 1G3WA 1W7PA 3GTQA 1Z7UA 4A3KG 2M9HA 4D9JA 1ZG5A 4IHSA 1JT6A 1NG7A 5LHHA 4XIDA 3SFZA 2GPSA 3ZMUA 4U7CA 3QWLA 1SAXA 4PJNA 3KTMA 4DLKA 2BVLA 3IWZA 3HPHA 4Y8VB 3H0GG 4OAYA 2JA6A 2A6TA 2JA8G 3HUGB 1ZARA 3QOEA 4KA4A 1M0TA 1QPIA 3CF2A 1AOYA 1TNTA 4IHWA 2B63J 4EFEA 3SQNA 5JLXA 1H9GA 2YS9A 4KNYA 1JXLA 4X0GA 1I7LA 2DI3A 4G12A 2W8LA 1BR4A 3N6XA 4EFBA 2JUCA 1O3TA 2ELJA 3IWFA 1FPQA 2UWMA 3PM1A 3L2QA 1ZGWA 4GYIA 4C5CA 3WO0A 4JYAH 2CV2A 3M1CA 1LNWA 1BM9A 3L2UA 5C44J 1S72I 3OS2A 4A3FG 1Z9CA 2EJRA 2E71A 1MJBA 2IP4A 3ZQHA 4Q47A 1XTAA 3MWMA 4HEA2 2FUG2 5DDGA 3F8FA 3DLLF 3MJFA 5IYZF 1KU2A 1E4EB 3GTGJ 3GXOA 4F4WA 3E5QA 1T95A 2NOGA 2UUZA 5CVIA 3ZQ7A 1I5ZA 2CW0F 4A0XA 4CZCA 5KFYA 4RDUA 5D5UB 3HOZJ 4ZJZA 1YRNA 4F52A 2EV5A 3T8RA 5LYJF 3Q3SA 2CS3A 2HR3A 3FISA 3N42B 4MV8A 2FD5A 2DPIA 4BBSG 2PMZN 3DLAA 1JKRC 1R7JA 2ZXHA 3BTJA 2E60A 2LSOA 3R5HA 1RJQA 5M3MJ 4WWCA 1JXSA 5B1AH 3GCMA 2GQQA 3DBHB 2QYZA 2V1DA 3FXOA 2VQHA 3L2CA 2GLTA 3AYHB 4F3QA 1JKQC 4IJAA 5J8CA 4L9TA 2R5YB 3FXUA 2YR2A 3VSKA 4HA8A 5DG8A 1FYMA 4B4CA 2JPCA 4HDUA 5EZGA 5F0CA 2Z16A 5KFXA 4FX0A 2ZJRF 1VQPI 2JA5J 3KXYT 2NNYA 3RJ0A 2R87A 2HPMA 2D45A 2MLGA 3FXLA 5IY5H 2YSRA 4E7HA 3K5HA 5ICCA 2EK5A 3L2WA 1G4DA 3A01A 2V1XA 2LP0A 2V9VA 4M72A 3VODA 5D8KB 1QNTA 3LAJA 3JSNA 2XCAA 1HBXG 1JKJB 3WG7H 4PGGA 4PJMA 3Q0WA 1MW7A 2CFOA 1UC9A 3R61A 4HX7A 3HOVG 2PBZA 3HBLA 2ZBKA 3G4SI 2CW7A 2IBDA 3NQOA 3H9JA 4CCOA 3ZMSA 5FLMG 3RFCA 1WJCA 4P9FA 5LRRA 4TV8F 1D0YA 5LEJA 3H20A 4HSRA 1P6RA 2HYGD 2LC2A 2JQ7A 5DGBA 4X64H 2XPWA 4DV7H 5GTIC 1JTYA 2DCEA 5JVDF 1F43A 2GBYA 3V6JA 4UB6C 3W2AA 4BQOA 1MDMA 3PNYA 3GTQJ 1GXQA 1IUYA 3BG9A 1B33N 4JI0H 1HSJA 1YX3A 2W1OA 2GXBA 3V4ZA 2V4JC 3RZDJ 1MMSA 2E1CA 1FSEA 1CS0A 2CV1A 2COMA 4NC6A 5K2MA 1W36C 4X62H 5TISC 2ISYA 4BU2A 2Z1DA 3MKZA 2JA6J 2H94A 4YFNF 3T0YA 5EG0A 1DU0A 4IAJA 4XYLB 3JSPA 2NNNA 4KN7X 4LFAH 4NBQA 1HLVA 1MH4A 1WJDA 2VA3A 5KT6A 3ELKA 4RB3C 5C4XJ 5KFCA 1P2FA 3WTWC 4KIBA 1YIOA 3SHFA 3CQZA 2GA1A 2JA7G 1D0XA 2LH9A 1GSHA 1R5GA 2DMUA 2FQ3A 3GF2A 4XNFA 1T94A 3BZCA 3GFJA 4AM3A 3GTPA 3I58A 3TP0A 3J7YJ 3I56I 4IHVA 3HKZE 3U1DA 4ZDOA 1MDMB 4KMFA 3LQQA 1KJ8A 2RGRA 1O57A 3HOXJ 1MBGA 4NXMH 4AVZA 3H40A 3CUOA 3LFUA 1S29A 2ZMEC 4J9LA 2IA2A 3KP7A 1EZ1A 5DG9A 2NU6B 2YW2A 2ZXIA 1BJZA 5HDNA 4AU7A 2J6TA 2IGMA 3LL7A 3M8FA 1Y1VA 4ON0A 1GLVA 4U88A 3V8JA 5F9LA 2MC4A 3Q8SB 2FMAA 1S0OA 1A04A 4QPOA 2OLSA 3ZMTA 2V1UA 3K69A 2PN1A 1TBXA 2W24A 3C3WA 2HXOA 5EEAA 3RPUA 2WV0A 2R5ZA 1UFMA 2KP6A 2MLKA 1LVKA 2BR0A 1X3WB 4JI4H 3OYGA 4O3SA 2V4QA 1X1AA 4N4OB 2Q8KA 2NVQJ 1MMDA 5KVRA 3LSHA 1XCVA 4UUTA 4XN0A 3F8BA 3HOUJ 1I6HJ 1RR8C 1D8JA 2XKOA 3ABKH 5KK1A 4EM2A 3M3YJ 4IVNA 4A0ZA 2WV1A 3IAM2 4EYIB 2DA4A 2LK2A 4HBLA 5KFTA 2VXDA 1RC9A 4A3GJ 5C4JJ 4RM2A 5HS9A 3CMAI 3F21A 4TQSA 4OIRF 4TUYF 2Z2SB 2L7FP 2R7SA 3T5JA 2VN2A 2HTSA 4B47A 2FPPB 1HSTA 4UCUA 4RAFA 1E4FT 1S7EA 3R5FA 2A6EF 4HLXA 2ELHA 3RB6A 4DR4H 2ECCA 4CCLA 4FE4A 4ENKA 4A2UA 2R5ZB 4ESFA 1PK8A 4M6YA 2R86A 3DKYA 3JRCA 2QSFX 4OMZA 1YJNI 4UVCA 2UZKA 3OIQA 3RAQA 1KQ9A 1KU9A 4HPQA 4IOCF 3NEUA 2H8RA 2LY1A 2IGKA 4X6AJ 1IBLH 3Q9SA 4XOTA 2BYVE 4BJ6C 4EGYA 1XD7A 2CKZB 4BQAA 4DV0H 4GDFA 5H80A 3IRQA 2C2EA 4K2EA 3FX3A 1J5EH 2FJZA 2H27A 5K5QA 5KT7A 3NAUA 1J9IA 3K4MA 2VR1A 2VB6A 4JOMA 1IDYA 3LP8A 1ZK8A 4YJ3F 4S04A 2W6NA 2R7QA 3CJQB 3OYFA 5K5OA 1GXPA 3VWBA 2O9LA 2IVMA 1YIJI 3CQZJ 2PJPA 4I4TF 4O4HF 2AGQA 4O3NA 2XB0X 3MKLA 2MGQA 4B44A 1E0EA 1EF4A 1S9HA 3GTPJ 1D0ZA 2IA1A 1JGSA 2ZJTA 5IP9J 1VQ4I 2V79A 2HOEA 2X6OA 2VC0A 3JRHA 3N40P 3AG1H 3R0AA 3LMLA 4Q44A 5L1IA 3GILA 2N8GA 3RQIA 3CCSI 3G1MA 1BNCA 3BR3A 1Y14B 3TIGA 5C5JA 5LMNH 1WI9A 1ZR4A 1X2MA 1V9PA 4UUSB 3JZIA 5EYRA 1Y1VJ 3DWLE 2QKLB 4MLOA 1FNNA 4D5FA 2W6MA 4BBRG 1QU3A 2W8KA 2D2WA 3JREA 5L3CA 3H3ZA 3MWEA 1S0NA 5IP6A 2DDBA 4AQYH 1MNEA 3DEWA 1VQKI 4Y52J 3HYIA 4CHUA 2FBHA 1RK5A 2XGXA 3WHBA 2BY0A 2H1KA 2WTEA 2XHKA 4J00A 1SC7A 4LF7H 5KFKA 2LTPA 1D8KA 2H09A 2OD5A 5CQEA 4CA0A 2BXYA 2CUEA 4G7OF 3HOYJ 1OCTC 4HYEA 1F4KA 4I55F 2M30A 3BAAA 3RB0A 2M7BA 4XOPA 5IYCJ 1ETVA 4EM0B 4KDPA 3K3VA 4UVBA 1XGNA 1B72B 2DFEA 5KX5F 2MW8A 1QZZA 2ZJQF 3S2WA 4EMSA 1QVUA 2GM4A 2EIKH 2LOOA 4AWXB 3Q1KA 5EOYA 5EWFA 5GTHC 4UY8I 3OSPA 4RB1A 1E3PA 2EILH 1ONVA 5EDNA 5FJ8G 3D1NI 4A6EA 3E6BA 2XAQA 5KFVA 1LPQA 1ITYA 4DYQA 3EUAA 1T38A 2TCTA 3CCEI 5BPDA 2XRNA 1U78A 5J3LA 3TIIA 2RAEA 5M5XJ 1GT0C 3H36A 3ABMH 2ZXWH 4QWBA 5GAGJ 4QIWN 2C2DA 5DV5A 4G6DA 1FOWA 3M07A 4KUMA 1LDJA 1OCOH 2EQRA 1HKTA 3HIFA 1X1PA 4HG2A 1N78A 3EPIA 2R7OA 3BTLA 4X66H 5HLTA 3ETJA 4LSAA 5H6RA 1XB4A 2QSGX 4IHYA 2YU9A 2ZKZA 2HOTA 5KT3A 2V6EA 4A3IG 1KQ0A 1VQ8I 2L02A 4GLXA 5LXTF 3RJPA 1XSXA 1ETXA 3JAMK 4TV9F 3RB3A 2K4BA 2PG4A 1IXSB 3M1EA 5BR8H 1A0IA 4Y13A 1YTYA 2NVTJ 3KEYA 3LSJA 4YR3A 5L3BA 2IS6A 1Y1WJ 1BOAA 4XRMA 3CC7I 5BPFA 2HZTA 3G6EI 1P92A 4PJLA 3HOWJ 5CJ9A 5D4RA 1JX4A 1T2KA 4HQ6A 2BBYA 3ZMVA 1LEAA 2AQ4A 3T1YH 1WH7A 1EV7A 5ED4A 2EA2A 4A3MJ 1VAJA 1MKMA 3TDZC 3ZQCA 2QK4A 2OV7A 4QPQA 3TO9A 1ZGJA 4C3HJ 3SEQA 4LMYA 1FYKA 1KJJA 2XAGA 4UCVA 5BPHA 2ZXJA 3ZQFA 3CUQB 4DUYH 2ZNZA 3P9KA 1S5LC 2HWVA 1FP2A 1H88C 5HDKA 4MFDA 4XSXF 2RQQA 3A02A 3SEZA 1XDNA 4NC7A 1N25A 2WDTA 4UHTA 1V51A 4GGGA 4Y33A 4E4TA 4I0BA 4LD5A 1Z7LA 4KICA 1XPXA 5CA0F 2W7PA 3AG2H 3GX4X 4DV6H 4QWAA 5KFSA 2I87A 1X19A 5KKNB 3E6DA 3HM5A 4WF2A 2PN6A 4PZJA 3S1QJ 3R23A 3LSRA 2COBA 4BEHB 2YZGA 3JRBA 3GTJA 2XAUA 3GFMA 4P9UA 3ZGKA 3IH2A 1ZHFA 2FU4A 3H35A 2K7LA 1ULYA 2XAFA 2MD5A 2J6UA 3HG9A 5ERIA 3JR9A 2M7AA 2VPLA 3HOTA 1BW5A 1QRYA 2V9KA 5C1PA 1X1DA 1FIAA 3BQ0A 1ORKA 2HNHA 3U9GA 2F5DA 4UCRA 2HI3A 4F92B 1P4WA 2YS6A 1U5TA 3DPTA 2AS5F 3GZNB 4I99C 1V4RA 4LF5H 3WTXC 3L7WA 1VQNI 2KJBA 3B73A 1SFUA 3OL3A 3E5NA 3BR0A 2GPWA 3J81K 4LF6H 4EG0A 1W5SA 3ZQIA 3PO3J 1QQIA 4JV1A 1UZCA 2K5CA 5DM6F 3HL2A 4YJ2F 1IF1A 4MV9A 1ZQ3P 2OQRA 3DKWA 3PIOF 3LA7A 5HVQC 1OR7C 2CGPA 3MR2A 4HV5A 5GPCA 1Y39A 4DQ2A 2QENA 2C00A 2HPIA 3QZ8A 4FS2A 3COAC 5EF6A 2HYJA 3F8CA 1UHWA 3G2BA 2YRXA 5KFOA 4A3DJ 2ESHA 3ZCOA 4DJAA 1TC3C 3PQJA 2L5QA 1K4TA 2YU9J 5DLFA 4A0YA 2CQQA 2NS7A 4EBCA 1TWFA 1O3RA 5D1OA 2DMTA 2IBKA 4HV6A 2VL8A 4BWSC 1EH6A 3ERED 1KYZA 3G8CA 4HZFA 3EUHA 1AA7A 5D5XB 1MH3A 1M1EB 5FLXK 2F4VH 2WB1E 3CO6C 4ZHQF 2DQRA 2IP2A 1YYVA 2ZO4A 1HKSA 3WU0A 3KX2A 4HNTA 4XLPF 2X1DA 1W96A 1WJEA 3HTSB 1BI3A 3TGNA 3K1NA 3I9V2 1JKOC 5LP6F 4NXNH 3OS1A 2ISZA 3W2VA 3K6GA 3IH3A 3VEPA 1W5CC 1T39A 4BY7G 1SFKA 4K0KH 3O3KA 2QGUA 4L0YB 3VPDA 2MC3A 1TZLA 3FHNA 5J47A 4BACA 2BY3A 4LIUA 4L1KA 1LFPA 1ZG1A 4RLFA 2Q2TA 4JV5H 5K1YA 3FDYA 5D1OB 3OWTA 4ZYGA 3HKZN 1ZN2A 3ETHA 3EDPA 1FWZA 4ECVA 2VUMA 4HQMA 2AGPA 1FC3A 2NVXA 3QU3A 1PP8F 1LUJB 3CCRI 2FK1A 4TV7A 5IYDJ 3RGZA 2A07F 2ZFWA 3LFKA 1XSVA 2DW4A 4XLNF 1BIBA 3L9FA 1K6OA 3K3PA 3V6KA 3I4NJ 1WI3A 3RDIA 3HRUA 3GTJJ 4ECQA 2W48A 4DYCA 1H9TA 1BL0A 2AQEA 2KFDA 3ECOA 3PZPA 4JI2H 2K02A 3VOEA 1BC8C 2OBPA 2E2IA 5DQGA 2QQBA 4JYKA 3E3VA 1BOBA 2VIXA 4IQ4A 1RUNA 3S17J 3BC8A 2EFWA 1OKRA 2UXBH 1WVRA 4ENJA 1FMVA 5LGNA 1TNSA 1KJQA 1ON1A 1LQ1A 5DCMA 3KHGA 3E1SA 1Z3XA 1E3HA 3Q9VA 2WA0A 5JVTA 3H9QA 5F08A 3S32A 3CUQC 1PUFA 3F6OA 5IOYA 5KFPA 3DEUA 1ZLKA 4DZPA 2DOFA 3ZP5A 5TRDA 3PO2J 4O2BF 1AUXA 1IN7A 2GWRA 3GEZA 5HLIA 3DU6A 3OOPA 3V7RA 4ZYDA 3RBEA 4YRVA 4JK1X 4BS9A 4R7RA 1Z1DA 5D6EA 3DBLB 2AHQA 3S3NA 2R7ZA 4HNVA 4B3RH 4F7ZA 1N48A 3GZ6A 4CCKA 2O3FA 3FWEA 4B3SH 5CLSA 2C22A 3RPQA 5EJCA 3EQLF 5KG1A 1MNMC 2WB1A 1TL8A 3CDIA 3CC2I 3K4NA 1TWFJ 4F55A 1R23A 4B43A 5DCMB 3TL4X 4DR3H 4PDBA 2UUAH 4YFKF 3LWFA 4WXCA 1BI1A 4XRSG 3D5LA 4FCYA 1PUFB 3V8LA 5ILVA 4FU0A 2FA5A 5BNGA 1S0MA 1YHQI 3WNZA 4I2OA 1R71A 4L0ZB 5FPRA 2ZNYA 4BY1J 1UNNC 2ICWG 3F0CA 4DGWB 5ICFA 2QZ8A 3TMOA 2VODA 1TA8A 4LFBH 2V1NA 2E36A 2ESNA 4QTRA 5GPAA 3E6CC 1FOYA 2ASJA 1MJAA 4M7EA 2B63G 3R0JA 2R7RA 1N75A 4LLNA 4GC6A 1V5GA 5M5YJ 3OS0A 2KMUA 1V54H 2QF7A 3RSNA 2ZMEA 4I76A 1T6SA 3JRIA 3AAFA 3LWBA 2CU7A 5DTDA 1R1TA 1QBJA 2ADUA 2KIQA 1LVAA 3JRAA 5I47A 2YCHA 3ZN1A 4ZTFA 4LFUA 3QYBA 1RYRA 5C44G 1S97A 5B5EC 3ZPLA 2KIFA 2LBFB 3S14J 4UV8A 2E35A 2Q0OA 3ZQLA 2W4SA 4XMYA 5JHFA 5GAEJ 4F50A 1NG6A 2JSCA 4DV1H 2D5VA 1MMNA 1VQ6I 3K4KA 1I3AA 2GA2A 2VJJA 2VUMJ 1WFXA 4GO1A 2XGPA 2NVXJ 4A3CJ 3E6MA 1Z91A 2VJ5A 1YJ9I 5KFLA 1SD7A 1U9OA 2QEXI 3F6VA 2R92G 3BOQA 4CC6A 4Z2YA 3CZ6A 4GRIA 1SCUB 3C0FB 2R82A 1FOXA 2ZC2A 2BW3A 4II3A 4V2GA 4WXHA 5DD4A 3H0GA 2OU2A 3G6VA 1U0JA 4HQEA 3P9CA 2NU9B 1U8RA 2E2IJ 1STZA 4P96A 2ZMEB 1AUVA 3GIIA 1SMYF 5DGAA 1SVMA 2IT0A 3I4PA 1JTXA 2P5VA 1E4EA 3Q8QB 3E97A 1BN5A 1T98A 5L3FA 2RQPA 4ZC3A 3PR5B 3W6JB 2Q2EA 3BJ6A 5IWAH 4YBZB 2JA5G 5AIPA 3S1MJ 9ANTA 3MEXA 4HX8A 5ILSA 1XDSA 4U0YA 3HSEA 4D0PA 3M8JA 4MTDA 2K9SA 4O3OA 4RS8A 1DIKA 2VQEH 4YIRX 2XGQA 1U9NA 3CTAA 4R1HA 3I12A 1MIJA 1D5YA 4ENMA 1RK6A 5A2QK 5EGOB 2HOAA 4XLFA 2OH2A 1U3EM 2DK5A 5KFUA 1DQUA 3EUHC 4UB8C 4FHTA 4HW0A 3RIRA 3VSLA 2R5YA 4A2AA 3IAS2 1T36A 2R8IA 2BW3B 2M45A 5JFRA 2XIGA 2DU9A 2VBZA 1CE8A 2R7ZJ 2BEOA 1DGRM 5EZYF 3RF2A 3KHHA 2MYSA 2NYXA 2XRLA 3EPGA 4NLGA 1YFHA 5KFGA 3PSFA 4CO8A 4HF1A 3PNTA 4CYCA 3HZJA 2EZKA 3HRMA 4YB8B 2Q2EB 2QUFA 4LIVA 3L2VA 4OAZA 1LE8A 1E4GT 1JDBB 2DA5A 3CDHA 2VOBA 3N4MA 1FLIA 3SFIA 4A93J 2GOMA 2QVOA 1ULZA 2VPRA 2X9DA 1N77A 3K2AA 5KAFC 3I3LA 3CESA 2Y2ZA 3A1YA 3CLQA 4IPAA 4MA5A 2WADA 3BCBA 4XLCA 2JA6G 3PW2A 2MH9A 4MV7A 2IJLA 1NTCA 4OOIA 1A31A 4B3XA 3DTEA 2NXNB 1OYYA 3TEDA 3KZIC 3LSMA 1TW3A 4CCMA 2CQKA 2W82A 2HYFA 1O7LA 1U2WA 4KIGA 2Z99A 2GIZA 3PSIA 3SXYA 4IOAF 1I50A 2LRDA 3SI8A 5E3OA 1IBKH 2KZGA 3BDDA 1PVEA 2M4KA 3ZXSA 5C4XG 2HDCA 2KISA 2MG4A 2HS5A 3ABTA 3IKVA 2E5LH 2VQCA 3OHAA 4ZYHA 4CYCB 4RNNA 4ZYAA 3FKIA 3OHBA 1LE8B 5FKNA 1B8IA 2LYCA 1JDEA 2ZJ2A 4RAGA 3F3XA 3HOXG 2LR8A 4Y4RA 2MCTA 3WTTC 3Q8RB 2K9LA 1GSAA 4HYKA 4Q43A 2R93A 1J7KA 1IOWA 5BMVF 2P0WA 3IL2A 4WX9A 5L3EA 3GLKA 2STWA 5HLHA 3ECHA 2LDUA 4MFEA 2W7NA 3OYLA 4DL5A 5J40A 4N0BA 3H0GJ 4MIMA 2DPJA 2V59A 2EH3A 3I55I 3GV8B 2IMWP 3JAMW 3PQKA 4MTEA 3TQTA 2HQ5A 1YS7A 1JUMA 3K0LA 4YHHH 1NH3A 3V4SA 4M3DA 3S3OA 3LSKA 3QPLA 2DA2A 4MGRA 4ZQIA 2NS8A 5JR3A 1XMOH 3HOUG 2EV6A 2OCEA 3BWGA 3FXRA 3R6SA 1GGOA 1ACIA 3DFGA 5GP9A 1RR7A 1LB2A 1B8IB 4DR7H 1YG2A 1ZELA 3OYKA 2VE8A 3V8KA 2Z9OA 4IRKA 3KE2A 4Q4ZF 1DUXC 3E5UA 1MJ9A 1LKXA 2PMUA 5IP7G 1SFOA 2WY8Q 4D1QA 4HAMA 2FP4B 1Z3YA 3WGHA 3JRFA 2CJJA 2NS0A 1EUDB 3LA2A 2CQ7A 1USTA 5E20A 4ZH4F 3CCYA 1HF0A 5BPIA 5EEGA 3BROA 4J19A 1SEIA 1L0OC 1KGSA 3TQNA 4GYGA 3CCJI 4BXXJ 4O4IF 1HW2A 1OFCX 3G3ZA 4RBOA 3BJAA 4M3GA 1QHGA 2HXIA 2XV4S 3MZHA 4UCTA 1USSA 2RNJA 5FRNA 4E70A 1D5VA 1OMIA 3BQZA 3CJTB 2VKHA 3MAJA 4IHTA 3ISPA 4RMNA 4ZZDA 3ASNH 4N9IA 4S05A 2DTRA 4O3QA 4IRIA 3MFIA 1FY7A 1X3UA 1KU7A 3P5JA 1FSHA 3HSFA 5LLQA 2R7NA 2R7LA 4F4YA 4AIJA 2UVVA 5BOXA 2DMPA 4YIFA 2M4GA 1FTZA 3M9MB 2X1CA 2W7OA 4M73A 2UXCH 3FXKA 4EM1A 2H6CA 3JW4A 2JEFA 3FZVA 5B3SH 1UG2A 2UXDH 3CC4I 2MH2A 3TO7A 4UV9A 4J9KA 1V5FA 2QQ9A 3PVXA 1WPKA 4MV6A 5J8FA 4DV5H 1S03G 1ZTRA 1I50J 2VPSA 4RU9A 2F5FA 5J2TF 3H5NA 2R8GA 3QU6A 3S16J 1HNXH 2L9RA 4NNJA 2KZVA 1TP4A 2W9CA 2WB1N 3JSLA 3J81W 3D5RC 2WBMA 4E4HA 5J1RA 5FLMJ 2VXZA 3FKIJ 2W9BB 1G6NA 3L4JA 2QKMB 3FK6A 2QCOA 2NRAC 5IP9G 2F6CA 3VFZA 2DQLA 5LHIA 3K1PA 3RCOA 2JEGA 3IRRA 1FYLA 2BE5F 2RDJA 5JI6A 3OMYA 1CQIB 1YX5A 2R93J 2NUAB 2IGOA 4A3EJ 3KAKA 3CJNA 2E1OA 2V58A 1T56A 3X2QH 1HCRA 4XKBA 1Y1VG 3HDDA 3WGIA 5K7HA 3VYUB 1T08B 4IEJA 1VQLI 1OQYA 4MAMA 2YZNA 4YIIA 1H8AC 2Y48A 1HXDA 3WU2C 3BQ1A 5ICEA 2O03A 1SEUA 4QWDA 1T8IA 5IYBJ 2LKSA 2JMWA 2XAHA 1RESA 2PEXA 5F64A 2RVCA 4EJUA 5FLXW 2EBIA 3OYEA 3CMEI 2W9CB 4HF2A 3WHCA 3T5XA 2CQNA 1ETWA 4IHXA 2VQFH 5EZHA 3F9KA 1RRJA 5CQGA 3TW6A 3BT9A 4UUSA 4B3TH 1GVJA 4IXAA 1R22A 1SFOJ 1Y8QB 1W0TA 1IBMH 3S1RJ 4A3BJ 1JHFA 3FMQA 5KFAA 5K7FA 2X6XA 1RJPA 3I53A 3AKZA 3QRFF 1OCCH 2DT5A 4XM3A 4EBEA 3JAMZ 1OR7A 3MWDA 2R7WA 2WYOA 4QW8A 2XDVA 1Y1WA 2FPGB 2ZDHA 1GHCA 2L4MA 2W6PA 4OINF 2EFQA 4JI3H 3F8NA 2VONA 4BJTA 4GKJH 2J5PA 1W7PD 2RNGA 1HNWH 5TGTA 5JH7F 1R36A 2EZHA 4RGUA 4LLGF 2O6GE 2HEOA 6PAXA 3KP6A 4AD9A 1B72A 1ZHSA 1SMTA 2KRCA 3HSRA 2P5LC 2Y9ZA 2DFHA 2DIKA 4FM9A 1PJRA 4U0VA 1W5TA 1TWGA 5IOZA 4UCSA 1NHAA 2ID6A 1ZHQA 1IC8A 1QO0D 3CO7C 1GV2A 1Z6RA 1RETA 3I59A 5J1UA 3RKXA 1LJ9A 3RBDA 1VTNC 4V19K 1E17A 2ME6A 4PWQA 3RTXA 4UUVA 2DZDA 3OYHA 5C8YF 5DYMA 3L2PA 3KHLA 2KIMA 3CF5F 1YW8A 2BVMA 2D1VA 3GIPA 3DP7A 2B0LA 3GIKA 2LVSA 3I4MG 1W0UA 4ECUA 1B9NA 1SVLA 3HOSA 4EGQA 4PFPA 1FKAH 1ETKA 3ULQB 3J7AO 4C5BA 2EFNA 5D8LB 3WTZA 4G7ZF 3KZYA 1MBFA 4I7HA 1WJBA 2DODA 4NUBA 3OUUA 2ME0A 1GSOA 2IS4A 1SD6A 1AKHA 2YYAA 4A3MG 2L7ZA 4CUGA 3CVZA 5HS7A 4LF8H 1IV8A 1T3NA 4C3JJ 4UVAA 1Y56A 1F9NA 3IP4B 2IS2A 3PW7A 3H3VH 4C2MA 3AG3H 3LSTA 2K9MA 2HDDA 3I59B 1M7JA 3TQ1A 2K9QA 1P4AA 5FRMA 3LQRA 1KU3A 1BJAA 2R7KA 2KSWA 5HNHA 1K83A 4M6VA 4BNCA 3C18A 3OOUA 1PX2A 3MKYB 3GVAA 4LK1F 5IT3A 3SZTA 1ZG3A 4M3FA 3J81Z 1B6AA 4XL9A 4CXFA 5JHUA 2R7UA 4FQGA 1B1BA 2ZB9A 1AWCA 1WSUA 3SZPA 2UVRA 1FBUA 1IO2A 1IDZA 3K70D 2CQXA 3ZR8X 5JVLA 5KFMA 3CUQA 4BXFA 5DUKA 1AKHB 3L1PA 1VF9A 3TOBA 3OYDA 3F8MA 1T0FC 1WQ2A 5FO5A 4A3JG 1POGA 5DQIA 2M2EA 4I0AA 1WH5A 1SFEA 2W00A 4ZDLA 4JX5A 1KA8A 5F1JA 3JCUC 4YAJB 4OMYA 2EFPA 4EJVA 4IQJA 3I5UA 3CMYA 1OJLA 3J80K 2MFZA 3RKYA 1GDTA 2P7CB 2KLOA 1UJ8A 3K4LA 5E1WA 2Y0SA 4G3IA 3QQAA 4AYBA 5FLXZ 1Z21A 4PJ0C 3VB2A 4BEHA 2WTFA 3DPUA 4ABZA 2DAOA 2MABA 2BHZA 4CZZA 4OWRB 5E3MA 4BBRJ 2O5RA 4A12A 3WTUC 3OYMA 5J6XA 1XCBA 4RUAA 2F5VA 3FM3A 4G6QA 4D7MA 5HDGA 4DOZA 4EVIA 1U8BA 2B9SA 3BTCA 4DBRA 4CYDA 1A6QA 4WCGA 3RKQA 5KFZA 1R9TA 1XNRH 2FMLA 3KYDB 1KONA 4XR6A 1SYXB 4A69C 5L3DA 1TWGJ 2HGSA 5C1OA 3GTMA 4WD3A 4LFCH 3F72A 3B02A 1RKTA 2YZMA 3VPBA 3KEQA 1SVOA 2VQDA 5HV6A 2FSWA 1TQMA 5ILUA 2X51A 4XORA 2HVSA 4GKKH 2L7KA 1WGXA 1P9QC 3Q0UA 2FBIA 3PW4A 4YELA 1OCZH 1WJ5A 2VKDA 3HC7A 4EQQA 2ACJA 1YW9A 4HRIA 2FMYA 4WBNF 1ZRCA 5FLVA 1B6SA 2IEKA 2JJ7A 3E5XA 4II2A 4DV4H 5A2QW 3CLOA 4R8UB 5HS8A 2OC6A 3WODF 2XROA 1REPC 1C3OA 4NHJA 2HJWA 1KYWA 1WJFA 1XMAA 1MMGA 2I10A 4WXDA 2E5ZA 3FMRA 4DR1H 5E8GA 2WAEA 1VBHA 4C2MJ 4DL4A 2BGCA 3BQYA 2DA3A 4MA0A 3N97A 1Z2OX 4LSXA 1P8LA 3V6HA 2JZYA 3DEEA 2AGOA 2VKEA 2DA7A 3RPUD 4O3RA 3KP5A 1WSCA 4RNOA 3KFWX 3BR6A 2DA1A 3GZ5A 1K83J 1FT9A 1ZRFA 3H5RA 4E7IA 1JGGA 3ONQA 3C2BA 4LITA 1KQ8A 5IYDG 2W6OA 3IV5A 2JEIA 3VYTB 1A5JA 1X1BA 4ME6A 4FETA 3RGXA 1XMXA 3GV7B 4ED1A 2NAZA 2STTA 3I4NG 3DPLC 3HGYA 4BDYA 1OLTA 1BC7C 1S7OA 1J0RA 4ECYA 2EA4A 2DYSH 4XN3A 3T1BA 3OSFA 3K4CA 1LEBA 2KT0A 3CCMI 5KT5A 4C2UA 3RUPA 1V3FA 3MQ0A 4IR1A 1H89C 1RNLA 4ECTA 1V4YA 4AIHA 1XC5A 1JUSA 4QLCU 5H20A 3QOPA 2LD5A 2PJRA 1D3YA 4LK0F 5H6QA 5KAIC 1RPWA 5E1ZB 1K78B 3RAXA 1XS9A 1V5EA 3S3MA 2IS1A 2JA7A 1HW1A 4BE0A 3G71I 1WWXA 1YO5C 2OZUA 3N05A 4ED3A 2IW5A 3JTHA 2X0LA 2YRWA 5D1PA 2LLKA 2PVPA 5KT4A 2AQFA 3BLYA 3W6KB 2I8DA 3PO2G 3LNQA 1QGPA 2CFXA 1E2XA 3LAPA 4ZOLF 2ALZA 3U9SA 2I8CA 2G0EA 3K4BA 3L4KA 3IHUA 5CVUA 3RZOJ 2KRFA 5IT9K 3ORRA 2RGVA 1R9TJ 1EYZA 5DM7F 4JI6H 3T8TA 3RYRA 1CQTA 2A3SA 1PYVA 4OU0A 2K4JA 1NK2P 2DWCA 3MZ8A 4KFCA 3GTMJ 3FDSA 4YAKB 2XCPA 3J7ZI 3MN2A 4G6TB 3OYCA 2UUCH 2EZIA 4BHCA 2FNPA 4EJTA 2VI6A 2HHHH 2PJRB 3BG7A 2LKXA 3G1LA 2H1LA 2HGCA 4C9YA 1BW6A 2VC1A 1OISA 3KCCA 1WCMA 2ZDGA 3HXLA 4MEYF 4U7DA 3GWZA 4YP3A 1A35A 2M0CA 3CCVI 3S1NJ 1TWCA 3WTYC 1QZEA 4IO9F 4MV4A 2LY2A 2CQYA 2E2HA 1XX5A 1N32H 5C3EG 3MVPA 4NQWA 3BZ6A 2QM3A 1TQPA 1RI7A 2CRGA 2L4AA 3K7AJ 3ERMA 3HEFA 4N4NB 5FROA 2KHMA 1K61A 5HOOA 4RZQA 2VKVA 3OYIA 1I1SA 5FB2A 4DV2H 2DPUA 4ZYEA 4RB2C 3SZGA 5KFBA 4LG3A 1R49A 4RZRA 5KFDA 3H3VK 3SJMA 1IZ1A 1GO3E 2FKLA 4JX6A 3BA9A 1WHUA 3ABUA 2ELKA 1HC8A 5E18F 3WE3A 1S9FA 1A36A 1B59A 2LFBA 1Z2PX 2GOXB 4ED6A 1BI0A 2K3FA 5LRSA 3ROUA 2W70A 2VUMG 2O61A 4LG0A 1X1CA 4IWXA 4A3CG 1YLFA 5F0FA 2X85A 1OPCA 4I02A 5A2QZ 4NQWB 2OAZA 1TWHA 5CA1F 2JN6A 3LSGA 2ECBA 2F5CA 3PR4A 1EA3A 1BBYA 4XRFA 3RQ4A 4YY3H 3EUKL 3DF7A 2BXZA 4O2AF 3MCZA 4MNUA 1AHDP 1ZREA 4A3LJ 3BA8A 1LFBA 3UR3C 3QPSA 5LL6b 2LBFA 2KRHA 4BUPA 5F9NA 1MGTA 1Z77A 4O5VA 3TDUC 4ECRA 4AC0A 4J9RA 2LF8A 1UAAA 2O7OA 5GAHJ 4J9OA 4DYRA 2XC7A 1B4AA 4DUZH 2R7VA 3KLNA 4BY7J 2JA7J 5HLGA 1TTYA 2JT1A 3RI4A 2XSJC 3BCAA 1C0WA 1I27A 2R6FA 1IXCA 2E5NA 4PJJA 5E17F 2M8GX 3H9GA 2QSHX 2Y31A 3A2KA 3GTKA 4LG0B 4P5OA 1XNQH 4X1EA 2A05A 3MD2A 3MKWB 1AU7A 3IUOA 2DXIA 4CGZA 3L00A 2DK8A 3IC7A 4H0EA 3A0HC 3S8PA 3DTIA 4FISA 4RM3A 1XG1A 5JQWA 3FXQA 1Z0XA 1XMKA 1SAUA 1XSDA 5CVJA 3GIDA 3QP5A 3CD6I 1KZHA 1RZ4A 2BOLA 3MMYB 2R7ZG 4JV0A 2Q2UA 1E3OC 3HHGA 2HQRA 2R92A 2WE6A 4KT6A 4HNUA 3D5SC 3FHZA 1OCRH 4J9PA 4U6PA 2CUZA 2P81A 3E0JB 1XN7A 1XDUA 4JX4A 3TO6A 5KFJA 2VASA 2R7FA 3BZKA 1JLLB 2AO9A 5KFNA 2PFBA 3BG6A 5D6FA 3K1MA 2BY2A 2JVHA 3S2DJ 2CV0A 1WCMJ 3HOZG 2LF7A 4A93G 2JRTA 3HPGA 2X6YA 5D4SA 1TWCJ 2DOEA 5EGOA 1JI8A 3ZN0A 1CF7A 2QYOA 2KPMA 4EGZA 3K10A 2E2HJ 2L01A 1G2HA 4RUCA 5E1XA 1N36H 5LGUA 3KYCB 4MHGA 2M05A 4RLQA 3KAJA 3PUFA 3IKTA 1I6XA 2DYRH 3I54A 3G6XA 1VZ0A 1S3JA 4OX9H 2OCCH 4XYMB 2K40A 3H1CA 4P55A 2NU8B 2R8KA 3DXJF 2R8HA 4AUXA 3OSGA 4Y3OA 2Z3YA 1YI2I 4L18B 1JJ6C 4QWQA 2VQLA 2WY7Q 1Q1VA 2XASA 1IRGA 1A9XA 2CH0A 2XGEA 2VOOA 2F4IA 2UXNA 4BGDA 2RN7A 1ZR2A 5KNLA 2WAQE 2ZDQA 1BR2A 4ECSA 5BQTA 5LHGA 2NVYA 4J9QA 3P9IA 3DCFA 1W93A 1Y0UA 2CZGA 4DR2H 1CF7B 1G3SA 3CMMA 3BG3A 4G7HF 2OQGA 1TWHJ 4DR5H 3KHRA 3OUZA 2NVUB 2YS7A 3NGDA 5E8IA 3KETA 1JHHA 3R60A 4XSZF 2Y0MA 3GLXA 1R5HA 4IRHA 1FOKA 1ZQ7A 4ZDPA 3ASOH 2RV8A 5LMUH 2UU9H 1M0WA 4FBUA 2H8WA 2Y30A 2A6HF 1CQJB 2XC9A 4J9MA 4XKVA 3PL8A 1R5ID 3U21A 3W3CA 5CAEB 4LF4H 3MFHA 4PK4A 2OA4A 1EJ9A 2XF7A 1RKWA 2EFOA 4IR9A 1VQ9I 1WR2A 4JI5H 1SANA 4EYHB 1VKZA 2MSYA 2W85A 1XGMA 1T33A 2G7HA 4IX7A 1IRFA 1ENHA 2LG4A 4LLLA 4C3IJ 1LFUP 4IKFA 4I50F 3H0DA 4W1UA 4HF0A 5D5WB 3GTKJ 1F36A 3MFKA 5M5WJ 1BGWA 4LF9H 1APLC 2JVGA 1XGOA 1CGPA 2FLPA 4JI8H 1W7PB 3PUBA 4C2TA 2JEJA 4O6JA 1J5YA 2BV6A 4Q0YA 1X9NA 2VQGA 2J5OA 3HTUA 2K85A 4QSHA 4M9ZA 4PFOA 3OYNA 4APMA 2DA6A 4ECWA 2XGDA 1R4MB 1ETOA 1DPUA 4HOBA 1KJIA 4EEYA 3RKWA 4BXXG 3LSIA 3V7CA 2R92J 2LNBA 2JTVA 4JBAA 1IJWC 3OTOH 4IZZA 4BKXA 2VBYA 2M8EA 1UELB 2DO7A 3U1KA 3FMSA 1FMWA 1TWAA 3W6VA 1L2ZA 2FK3A 5LOVF 3A4CA 1IV6A 3AG4H 2YX7A 4CCJA 5K7ZA 3GTLA 3O8GA 5KG4A 2L9VA 4A3KJ 1YOVB 2HKOA 1YE9A 3M9OB 5DLGA 4EJOA 3I0TA 4QIWA 2DBBA 4M71A 4RGXA 2B7EA 2UVWA 4LJZF 4GC7A 1B9MA 3RTRA 2V9WA 3EYIA 3LSPA 1RUOA 4KISA 2JA8J 4TQRA 1G8XA 4MQVA 2EV0A 4NDLA 2WAQA 4R79A 1GV5A 3J80W 1Z2NX 2R7DA 3BQ2A 1YRNB 3ESWB 2ZSHB 2H6BA 4CDGA 1JT0A 1W1WE 2K9NA 1VBGA 3HB9A 3CCUI 2E1MB 3IG0A 3PFYA 5L1JA 3Q2OA 2DJIA 2M1BA 2X0SA 4M3EA 4B1RA 3FBIB 2IA0A 1K79A 2BZTA 2RF4A 2BQUA 4A3FJ 3FKIG 4C5AA 1VNDA 5B66C 3TINA 2XF5A 3QAHA 4M9UA 2ID3A 1R58A 2NVYJ 4A3GG 1DP7P 4J9SA 5BS6A 5BMZA 3EPZA 1IXRC 1DP3A 5KFHA 4UFZA 4MQ9F 2VT2A 4C30A 4ESBA 4A3EG 2L3DA 2R93G 1S68A 1ETQA 3S2HJ 3AL0B 1HW5A 4DIQA 2L2OA 4GXOA 4BBSJ 2VE9A 2VJ4A 3A01B 3SYTA 4B48A 5T14A 3L2RA 4JP0A 1T0FA 2CG4A 2W9BA 4PSWA 3H4DA 5IYBG 4M3BA 5JVGF 1L3LA 4OIOF 1Y6IA 4BL0B 2GXAA 1S10A 3BP8A 1ETYA 3GW2A 4ZI7F 4M9SA 5L3GA 2Z5UA 3IH4A 3OR1C 1UG0A 1VQ5I 2W6QA 2FOKA 3QYFA 2X48A 3C1DA 3SDGA 5FFXA 1JE8A 4OIPF 3F23A 4XQFA 3OSNA 1GVDA
chains in the Genus database with same CATH topology
1B04A 3HRTA 3J7AK 4LB5A 1ODDA 3MZYA 2XAJA 2IRFG 2A5YB 1WRJA 2P6SA 4ZZLA 4L9NA 4G94A 4KHPH 2OWOA 3KLOA 1XGSA 3WU1B 3DF8A 1N34H 2FBKA 3M8EA 4KYWA 3WTSC 4CICA 3ZMDA 3RIZA 3WG9A 4UXNA 2CSOA 2IPQX 1HNZH 3L09A 2HFHA 1DDNA 5FGMA 2A61A 4RB0A 2E7XA 1F5TA 1LDDA 3PN1A 2CW8A 4YFXF 5IT9W 3DV8A 1ZGAA 2VT3A 3NRVA 1I94H 3I64A 5DCFA 2VUGA 3J80Z 2CYYA 2MBFA 5DUIA 4BYYA 2KIUA 3JTGA 4Y15A 3U2RA 1UB9A 3WGGA 1U6GA 2G9WA 2VOPA 2CWEA 1QPMA 1J59A 2GXGA 1G3TA 1PDNC 3I71A 4DR6H 4EV0A 4ASNA 2VBWA 3LA3A 5ICGA 1P4XA 2EWNA 4UNOA 2OZ6A 4EJWA 3ZMZA 4XBFA 3RYPA 3BY6A 2GAUA 5CVRA 2RKHA 4M74A 1O3SA 4PDKA 3TOAA 4ENNA 4RGSA 3BPVA 5FFZA 2DFIA 4KMUX 4JI1H 1FBSA 5CVVA 4NB5A 4KT5C 4HDVA 3REOA 4CC5A 3GFLA 3GUDA 4M9XA 4KIFA 1DPRA 2FEZA 3EYYA 3HHHA 4R8HA 2WC2A 4FT8A 2RDPA 1BIAA 5LEKA 3P7NA 2RC4A 2VBXA 2QQAA 3WTVC 1XMQH 1F1ZA 5FD6A 4G8XA 4U0WA 4PGHA 1Q1HA 1IN5A 2E7WA 3H3UA 1VS0A 1IW7F 1O7FA 3M4IA 4A6DA 1ZYRF 4A5MA 2G7UA 4B3MH 1TQIA 2F2EA 2FXAA 2PLYA 3N41B 2FNAA 5IT9Z 2A69F 5K5RA 2ETHA 1MD0A 3V4GA 2A68F 2M5WA 1PP7U 1OYWA 5FPOA 2D1HA 1TAEA 1Z05A 2HTJA 4DNCA 1R1VA 1FP1D 5CYVA 5FD5A 2GZWA 2QLZA 2FE3A 4HLYA 1O3QA 2QWWA 4Q48A 4BAYA 4YG2F 3GYHX 2F5EA 4L9VA 5DD8A 2X4HA 4O3MA 4BHBA 2K86A 3K2ZA 3C7JA 4AVPA 4I98B 2P5KA 3O6BB 1S8NA 4Q5SF 3BPXA 3EETA 1K78A 1TW2A 1WKMA 1S7AA 2M87A 3PFIA 4PCQA 4BHPA 3KZZA 1HKQA 4AIKA 3T1HH 3K9TA 2DPDA 5AIQA 2YU3A 2YPRA 1IAWA 4LH6A 4I01A 2PI0A 2XKPA 4DV3H 4L5JA 4ESJA 1FJGH 1OYIA 2Z33A 4A2BA 1ZLJA 4I09A 2R3SA 4JQFA 2HQNA 2W57A 1I6UA 2GIVA 1ZH5A 5LGTA 1MZBA 1PUEE 4BXUA 2KKOA 2JPBA 1U5TB 2AXLA 4B09A 1GYFA 4RAZA 4WK8F 1FBQA 2O0YA 4G9YA 2TDXA 3M7GA 3BABA 3Q5FA 4OIQF 4UCOA 5F1RA 3ML6A 1FZPB 4Y17A 2CO5A 2PQ8A 5D5VB 2DLLA 2P8TA 1ZRDA 4LH7A 2UUBH 1WH2A 4GCVA 3R4KA 3O2PE 2MA3A 3D0SA 2E1NA 1J2XA 1G3YA 5AONA 2C6YA 4LGWA 4JI7H 2WWYA 2PMHA 1BJTA 1R1UA 4FX4A 2W84A 2ZM6H 3G73A 2XUBA 3N44B 1R00A 3KP3A 3JSOA 2O8XA 1RIOH 4KN4X 5DEQA 1SD5A 4BH9A 1BI2A 3V7SA 3QPHA 1IN8A 5EEHA 4L9JA 3HRSA 3GFIA 4HX4A 1ZAOA 4IRGA 1EH7A 1ON2A 2P4WA 2Y75A 3KEOA 4LB6B 1IN6A 3KP4A 2ZCWA 3M9AA 2FF4A 5F6FA 3N43B 5LBQA 1YS6A 1K7AA 2KJCA 4RGRA 1HR0H 1HQCA 1W4MA 4J0MA 1AN7A 3KP2A 1SD4A 5TJJA 1N33H 4N9HA 2K27A 1UCRA 2XVCA 1FX7A 3BJOA 3UQ8A 2QBYA 2PBIA 4M6XA 2L54A 3GO5A 4MEXF 3QP6A 4RAYA 1LDKB 3QPTA 2LKPA 2YX4A 3FM5A 1S6LA 3WE2A 4EEQA 3FF5A 4IF4A 3DQVC 3F22A 4U7BA 1H0MA 2UXXA 1TLHB 2HKXA 3TKYA 1J75A 1YW7A 1O75A 2P7VB 3KALA 3OV8A 1UHMA 1I1GA 1QZYA 2V6CA 2QBYB 2FRHA 4ETSA 1XNRH 3H92A 3HUGA 4A5NA 1SFXA 1IN4A 2HVQA 1FVIA 1Z6TA 1DGSA 1U5TC 4L5IA 2EB7A 4B8XA 1EH8A 4X65H 3FMAA 1YQAA 2HVRA 2W25A 2P6TA 1G3WA 1W7PA 1Z7UA 1ZG5A 4IHSA 5LHHA 3SFZA 3ZMUA 1SAXA 3IWZA 1ZARA 4KA4A 1M0TA 1AOYA 1TNTA 4EFEA 3SQNA 1H9GA 4KNYA 2DI3A 3N6XA 4EFBA 1O3TA 3IWFA 1FPQA 2UWMA 4GYIA 4JYAH 1LNWA 1BM9A 1Z9CA 2EJRA 1MJBA 4Q47A 3MWMA 5DDGA 3F8FA 1KU2A 3GXOA 3E5QA 4A0XA 5CVIA 3ZQ7A 1I5ZA 2CW0F 5D5UB 2EV5A 3T8RA 2HR3A 3N42B 1R7JA 2LSOA 4WWCA 1JXSA 2GQQA 2V1DA 3L2CA 4IJAA 5J8CA 4L9TA 3FXUA 2YR2A 4HA8A 1FYMA 2JPCA 4HDUA 4FX0A 3KXYT 2NNYA 3RJ0A 2D45A 2MLGA 2YSRA 5ICCA 2EK5A 1G4DA 2V1XA 2V9VA 4M72A 3VODA 5D8KB 1QNTA 3LAJA 3JSNA 1HBXG 4PGGA 3R61A 4HX7A 2ZBKA 3NQOA 2CW7A 3ZMSA 4P9FA 5LRRA 5LEJA 3H20A 1P6RA 2HYGD 4X64H 4DV7H 1MDMA 1GXQA 1IUYA 4JI0H 1HSJA 2GXBA 2E1CA 1FSEA 2COMA 4X62H 2ISYA 2H94A 4YFNF 3T0YA 4IAJA 3JSPA 2NNNA 4KN7X 4LFAH 3ELKA 4RB3C 1P2FA 3WTWC 4KIBA 1YIOA 3SHFA 2GA1A 1R5GA 2FQ3A 3GF2A 3GFJA 3I58A 3U1DA 1MDMB 4KMFA 3LQQA 2RGRA 1O57A 4NXMH 3CUOA 1S29A 2IA2A 3KP7A 5HDNA 3M8FA 4ON0A 4U88A 3V8JA 1A04A 3ZMTA 2V1UA 3K69A 1TBXA 2W24A 3C3WA 3RPUA 2WV0A 1UFMA 2MLKA 4JI4H 2Q8KA 5KVRA 1XCVA 1N36H 1D8JA 3F8BA 2XKOA 5KK1A 4EM2A 4IVNA 4A0ZA 4HBLA 5HS9A 3F21A 4OIRF 2VN2A 2HTSA 1HSTA 4UCUA 1E4FT 2A6EF 4HLXA 2ELHA 4DR4H 4ENKA 4A2UA 4ESFA 4M6YA 4OMZA 4UVCA 2UZKA 1KQ9A 1KU9A 3NEUA 1IBLH 3Q9SA 2BYVE 4EGYA 1XD7A 4BQAA 4DV0H 3IRQA 4K2EA 3FX3A 1J5EH 2H27A 5K5QA 1J9IA 4S04A 5K5OA 1GXPA 2IVMA 2PJPA 2IA1A 1JGSA 2ZJTA 2V79A 2HOEA 2VC0A 3N40P 3R0AA 3LMLA 5LMNH 1WI9A 1V9PA 1FNNA 2D2WA 5L3CA 3H3ZA 4AQYH 3HYIA 4CHUA 2FBHA 2XGXA 2WTEA 2XHKA 4LF7H 1D8KA 2H09A 2OD5A 4G7OF 4HYEA 1F4KA 2M30A 3BAAA 4EM0B 4KDPA 3K3VA 4UVBA 1XGNA 1QZZA 3S2WA 4EMSA 4AWXB 5EOYA 4RB1A 1ONVA 4A6EA 3E6BA 2XAQA 1T38A 5BPDA 2XRNA 1U78A 5DV5A 4G6DA 4KUMA 1LDJA 1HKTA 3HIFA 4X66H 4LSAA 5H6RA 1XB4A 2ZKZA 1KQ0A 2L02A 4GLXA 3RJPA 1XSXA 3JAMK 2K4BA 2PG4A 1IXSB 3M1EA 5BR8H 1A0IA 4Y13A 1YTYA 5L3BA 1BOAA 2HZTA 1P92A 5CJ9A 5D4RA 1T2KA 2BBYA 3ZMVA 1LEAA 3T1YH 1EV7A 5ED4A 2EA2A 1MKMA 3TDZC 3TO9A 1ZGJA 4LMYA 1FYKA 4UCVA 2XAGA 2ZXJA 3CUQB 4DUYH 2ZNZA 3P9KA 2HWVA 1FP2A 5HDKA 4XSXF 1XDNA 2WDTA 4UHTA 4GGGA 4I0BA 4LD5A 4KICA 3GX4X 4DV6H 3E6DA 4WF2A 2PN6A 4PZJA 3GFMA 4P9UA 1ZHFA 2FU4A 2K7LA 1ULYA 2XAFA 2MD5A 5ERIA 3HOTA 3U9GA 2F5DA 4UCRA 1P4WA 1U5TA 3DPTA 2AS5F 1V4RA 4LF5H 3WTXC 3L7WA 2KJBA 3B73A 1SFUA 4LF6H 3J81K 1W5SA 1QQIA 1IF1A 4MV9A 2OQRA 3DKWA 3LA7A 5HVQC 2CGPA 4HV5A 4DQ2A 2QENA 3COAC 3F8CA 1UHWA 2ESHA 3PQJA 4A0YA 1O3RA 5D1OA 4HV6A 4BWSC 1EH6A 3ERED 1KYZA 4HZFA 3EUHA 5D5XB 5FLXK 2F4VH 3CO6C 2DQRA 2IP2A 1YYVA 2ZO4A 3WU0A 1HKSA 4XLPF 3HTSB 1BI3A 3TGNA 3K1NA 4NXNH 2ISZA 3VEPA 1T39A 4K0KH 3O3KA 4L0YB 2MC3A 1ZG1A 4JV5H 2Q2TA 5K1YA 5D1OB 4ZYGA 1ZN2A 3EDPA 1FWZA 4HQMA 1FC3A 3QU3A 1PP8F 4TV7A 3RGZA 2A07F 2ZFWA 3LFKA 1XSVA 2DW4A 4XLNF 1BIBA 3L9FA 1K6OA 3RDIA 3HRUA 1H9TA 3ECOA 4JI2H 2K02A 3VOEA 1BC8C 2OBPA 2QQBA 3E3VA 1RUNA 2EFWA 1OKRA 2UXBH 4ENJA 5LGNA 1TNSA 1ON1A 1LQ1A 5DCMA 3Q9VA 5JVTA 3CUQC 3F6OA 3DEUA 1ZLKA 3ZP5A 5TRDA 1IN7A 2GWRA 3GEZA 5HLIA 3OOPA 3V7RA 4ZYDA 4JK1X 4R7RA 1Z1DA 5D6EA 4B3RH 4F7ZA 3GZ6A 2O3FA 3FWEA 4B3SH 5CLSA 3RPQA 3EQLF 1R23A 5DCMB 4DR3H 4PDBA 2UUAH 4YFKF 3LWFA 4WXCA 1BI1A 3D5LA 3V8LA 5ILVA 2FA5A 4I2OA 4L0ZB 5FPRA 2ZNYA 2VODA 5ICFA 2QZ8A 1TA8A 2ESNA 3E6CC 1MJAA 4M7EA 3R0JA 4LLNA 2ZMEA 1T6SA 3AAFA 1R1TA 1QBJA 2ADUA 1LVAA 2YCHA 3ZN1A 4LFUA 3ZPLA 2KIFA 4UV8A 2Q0OA 2JSCA 4DV1H 2GA2A 4GO1A 3E6MA 1Z91A 1SD7A 3F6VA 3BOQA 4CC6A 4Z2YA 3C0FB 4WXHA 5DD4A 2OU2A 4HQEA 3P9CA 1U8RA 1STZA 4P96A 2ZMEB 1SMYF 2IT0A 3I4PA 2P5VA 3E97A 1BN5A 1T98A 5L3FA 2RQPA 3W6JB 2Q2EA 3BJ6A 5IWAH 5AIPA 3MEXA 4HX8A 5ILSA 1XDSA