4ETSA

Crystal structure of campylobacter jejuni ferric uptake regulator
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
146
structure length
141
Chain Sequence
ENVEYDVLLERFKKILRQGGLKYTKQREVLLKTLYHSDTHYTPESLYMEIKQAEPDLNVGIATVYRTLNLLEEAEMVTSISKKYELANKPHHDHMICKNCGKIIEFENPIIERQQALIAKEHGFKLTGHLMQLYGVCGDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferric uptake regulation protein
publication title Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Metal binding protein
total genus 40
structure length 141
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4etsA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4etsA02
5J8CA 3ML6A 2R7DA 4BAYA 4MTDA 3WTYC 2F5EA 1OMIA 2EWNA 1YQAA 1DUXC 4WWCA 2ESNA 4KT5C 3PFIA 5IT9K 4RB2C 2IA1A 1HXDA 5LGNA 4YFXF 1I6XA 1B9NA 3J81Z 3K1PA 1R58A 3MEXA 1Z1DA 4U88A 1OYIA 5LRSA 1R00A 1EH6A 3REOA 3MZHA 2KIFA 2M87A 3TO9A 3C1DA 1JGSA 1J0RA 3IKVA 1MZBA 2DU9A 4GO1A 3WE3A 4KIBA 1W5SA 4I7HA 5ICGA 2X0LA 2K7LA 4I02A 2R7FA 2GA2A 3I0TA 3HOSA 1YS6A 4Z2YA 1U5TB 4KIGA 5J6XA 1H0MA 4KMFA 1H9GA 4ON0A 2K27A 3TOBA 1I27A 4CHUA 3RI4A 2PI0A 2ZO4A 4K2EA 1IRFA 1U5TA 2IW5A 1KGSA 2FSWA 3WODF 3W6JB 2C6YA 3ELKA 2Z33A 2F2EA 1BI3A 5L3CA 4UV9A 1S8NA 4DNCA 3V8LA 4UUVA 4EJUA 3ZMTA 2XAHA 5JFRA 1W4MA 5LHGA 3RPUA 3EYYA 1KU9A 2CWEA 2ZNYA 3BWGA 2MBFA 5DDGA 2OBPA 1RZ4A 1EH8A 5TJJA 3LA3A 5L3FA 1QQIA 1IXSB 2H94A 1P92A 1LDDA 2V9VA 2XVCA 4RB0A 3I54A 4L9VA 1C0WA 2IJLA 3L00A 1FBQA 3DEUA 4LGWA 1B4AA 4LJZF 4U0YA 5BPIA 4BHBA 1XMKA 2QYOA 3F8CA 1XB4A 2QBYB 3DKWA 2P5KA 3IRRA 2CQKA 1RIOH 4FHTA 1E17A 1GHCA 4I0AA 3E97A 2QBYA 2FBKA 4P55A 3WTXC 1MJ9A 2GXBA 5FD5A 2O03A 2UXXA 2VONA 4HV5A 3SFZA 1FBSA 1ZG5A 1J5YA 3ZQ7A 2MA3A 2WWYA 3E6CC 4UHTA 1USSA 2KKOA 5A2QZ 1O3RA 5E1XA 4PGGA 3QAHA 1WWXA 2IRFG 5LEKA 3E6MA 3T0YA 4LG0B 5FFXA 1KU2A 3BPVA 3VEPA 2F5DA 2HTJA 3E3VA 3LQRA 2ZNZA 4GGGA 3FMQA 5CVRA 5D4SA 4LG0A 1I1GA 3ROUA 3EETA 3W6KB 1BJAA 1P4WA 1S7AA 3K69A 1UHMA 2TDXA 1UCRA 3KEQA 3PQJA 3OOPA 5ILVA 4EGYA 1JHHA 4MGRA 1BC7C 2FRHA 1IN6A 1B6AA 3ERED 3ISPA 2EFOA 4RAYA 3ZN0A 2NNYA 4QWQA 2BYVE 3WTVC 4CXFA 2O8XA 3D5LA 2JPCA 4HDVA 2W85A 1UB9A 1FSHA 2QWWA 5KK1A 3GO5A 3M8FA 3GLXA 2RGVA 4XSZF 5FLXK 4JBAA 1YW9A 4G6DA 3KP3A 3GFJA 3BJ6A 3LA2A 2P8TA 2K86A 3U9GA 4A6EA 3WU0A 3H3UA 1KYZA 2JSCA 3VFZA 3GW2A 5H20A 5D5UB 2XUBA 2VT2A 6PAXA 4A2UA 3D0SA 2EJRA 1SFEA 1MD0A 2AXLA 3T8TA 4P9FA 4B09A 1HW2A 5D5XB 1QNTA 4F7ZA 4JK1X 1J75A 4U0VA 1H9TA 3VOEA 1G6NA 3V7SA 2XROA 1BN5A 4RS8A 1FYLA 4KFCA 3WU1B 1FSEA 1U8RA 3FWEA 3K1NA 3J80Z 3DFGA 4YIIA 2M1BA 3HSRA 5CVIA 2ESHA 3Q9SA 1I1SA 4LB5A 1HSTA 2PFBA 3KP7A 4AWXB 1T98A 4LLGF 2GZWA 4P5OA 2LSOA 4G7ZF 1BOAA 1YW8A 1IN8A 1HKTA 2ZBKA 2HDCA 3R6SA 2FBIA 2VBXA 2DPDA 5L3GA 2QM3A 5FGMA 2VOOA 2Y75A 4Y13A 1HW1A 2PMHA 1PUEE 4L18B 5LGUA 1BIAA 4ENKA 3IRQA 5ICEA 4FT8A 4ESFA 4YFNF 4ESBA 3RPQA 1ZRFA 4YG2F 1TNTA 1D8KA 1V4RA 3R60A 1QZYA 3WE2A 2O0YA 2XASA 4HV6A 3M7GA 3PQKA 1G3YA 5E1WA 3C7JA 3DPTA 1ZN2A 3SXYA 1ZREA 3MZYA 4HQMA 5H6QA 1S6LA 2HWVA 3L7WA 4OIPF 3IL2A 4A5NA 3AAFA 1HKSA 2WC2A 3CUOA 3F8MA 1WQ2A 2DK8A 2QUFA 3F72A 3LWFA 1SFXA 4ETSA 2R3SA 1E2XA 1DPUA 3U1DA 2G9WA 1ZLJA 3F6OA 4G8XA 2IT0A 4U0WA 5J8FA 1TLHB 1D5VA 2ELHA 3E5XA 3FXRA 5HOOA 4ENJA 1U5TC 2CG4A 2W25A 3LSTA 3MWMA 5HS7A 1V3FA 4KA4A 1BI1A 4NHJA 2H6CA 2Y0MA 3ABUA 1YYVA 2VBZA 1ZH5A 3KP4A 4ZYHA 1B59A 1IXCA 3P7NA 4UVAA 1TQIA 2FU4A 2V6CA 4HX8A 1ONVA 1LEBA 1STZA 1FZPB 4ZZDA 5FD6A 4LB6B 4I0BA 4M9ZA 4OOIA 3HSFA 1D8JA 2Q8KA 2HQNA 4Y15A 4A0ZA 4HW0A 4HDUA 2LF7A 1LVAA 2OZUA 5D5WB 2ADUA 2KIUA 4XLNF 4Q48A 1QZZA 2Z3YA 2FBHA 2PJPA 3DQVC 4RGRA 4A12A 5D5VB 2XHKA 4YIFA 4NQWA 5D4RA 2O6GE 5K1YA 4LLLA 4BYYA 1IF1A 2HYFA 4I2OA 1U6GA 3BJAA 2XKOA 2FMYA 3O2PE 5L3DA 4MTEA 2G7UA 4M74A 1QPMA 4HYEA 4HQEA 3R0JA 2RKHA 1Z6TA 2EA2A 4AIHA 2P5LC 2O61A 1Z9CA 4MNUA 2F5CA 3IC7A 2MLGA 3F8BA 2E1NA 1OPCA 2BV6A 3KETA 2XGXA 1R1VA 1R23A 3FM3A 3IWZA 4G6QA 2ZFWA 2LNBA 2ZCWA 4LK1F 4A5MA 4R79A 2FNAA 2A3SA 2D1HA 1O3QA 1O7FA 1JXSA 4NB5A 4KIFA 2HFHA 3E6DA 2W24A 3ECOA 4WXCA 3V7RA 2VXZA 1ZGJA 5L3EA 1O7LA 2KJBA 2MD5A 2L54A 2M5WA 2BBYA 5E20A 3ZP5A 1B9MA 3K2ZA 3CUQA 4WK8F 4BH9A 4ENNA 4MQ9F 4UNOA 5A2QK 4JQFA 3I53A 2A69F 4EJTA 3U2RA 4OIQF 2O3FA 1SMYF 3EDPA 3I59B 4ZYGA 3GF2A 4AD9A 2GA1A 1FPQA 4HX7A 5ERIA 5TRDA 1CF7B 4IHSA 4I09A 1MJBA 2NAZA 3I59A 2V1DA 4UVCA 1CF7A 5KVRA 2RNJA 2WTEA 4MEYF 3M1EA 5IT9Z 3WGHA 1SD6A 4E70A 2XAGA 2P6SA 5HLIA 3FMRA 1U78A 3R0AA 3IHUA 1LDKB 3DP7A 5DYMA 2VC0A 1XGOA 4GXOA 3TO6A 4PCQA 2Z9OA 1BBYA 1ZG3A 2EV6A 1R5GA 2GAUA 4RB1A 4HLXA 4IHTA 5DEQA 4KMUX 4RGXA 4TV7A 2Z99A 3SZTA 4KN4X 4OU0A 2D2WA 4L5IA 1G3TA 2L3DA 2PLYA 4MQVA 4XSXF 5D8KB 4BHCA 2YPRA 2DQLA 2A68F 2J5PA 2EV5A 4HLYA 2M8EA 3G3ZA 2FA5A 3I64A 1R1TA 4EM1A 3DF8A 2OAZA 1T39A 3S2WA 5AONA 2FNPA 3GWZA 1LEAA 3CO6C 1AOYA 2KRFA 5F64A 3TDZC 2AS5F 4L9NA 1WI9A 3O3KA 3HTSB 4OIRF 3HRSA 3QRFF 2H09A 4WF2A 4Q5SF 2MC3A 5DCMB 2ETHA 3GVAA 1LQ1A 2FMLA 5HLGA 1IZ1A 4UXNA 1Q1HA 2DTRA 5ILUA 3F3XA 3HHHA 4OMZA 5DCMA 3FHZA 1TBXA 1MGTA 4S04A 5JVTA 2P5VA 5CVVA 4PZJA 1HW5A 1B1BA 3JAMK 1BC8C 3BROA 4OMYA 1Z91A 2A61A 4N0BA 5ED4A 2HYGD 1RUNA 5EEGA 1I5ZA 3TDUC 1TQMA 2HS5A 2YX7A 2LDUA 3BPXA 2VODA 3COAC 4BHPA 4A0XA 1ODDA 1IW7F 4D0PA 4LMYA 1WRJA 4KUMA 4Q47A 1T6SA 2L4MA 2A5YB 3NQOA 4RAZA 4A6DA 1IN7A 4U7DA 1F1ZA 2E1CA 2JTVA 1KYWA 2IA2A 4EGZA 2Z5UA 4WCGA 5K5RA 4LD5A 3CTAA 2V79A 3N4MA 1YTYA 1R22A 3R61A 3F23A 1YO5C 5DD4A 5EEHA 4M9SA 1ZLKA 4EJOA 3K1MA 2VC1A 2HOEA 1PP7U 3CJNA 2YSRA 2QLZA 3ZMVA 4HOBA 1LDJA 4WXHA 3FF5A 3SQNA 1U2WA 5HS9A 4GCVA 5L3BA 5DUKA 1IAWA 3EUHA 3EQLF 1OR7A 5BQTA 2X4HA 2XIGA 1KU7A 1ZAOA 1HKQA 1XN7A 4M9XA 3FZVA 3FXQA 5HLHA 2GQQA 2W84A 1SD4A 3ECHA 3GFMA 4AIKA 4HX4A 3C3WA 3CLOA 2K4JA 3HSEA 1S3JA 1ZYRF 4O5VA 5ICCA 4EQQA 4L0ZB 5JHUA 3HRMA 1FT9A 3GXOA 3F6VA 1ZARA 4G7OF 4CDGA 1ZG1A 1WKMA 1EH7A 4PDKA 2EK5A 5FLXZ 1RI7A 1HBXG 5HDKA 2DO7A 5CJ9A 1YLFA 3JSOA 2CFXA 1F4KA 1USTA 2ZJ2A 3KEOA 4KYWA 2Q0OA 3WTSC 4ZYEA 4R1HA 1K6OA 3T8RA 2BEOA 5JR3A 3V8KA 2W57A 2HTSA 1J7KA 2ZMEB 2OA4A 2GXGA 4CICA 3C18A 3KP6A 2K4BA 2FXAA 4BXUA 4IPAA 2OQGA 2E7WA 4EM2A 3CO7C 1F5TA 3ZMZA 3R4KA 1R7JA 2PMUA 2KJCA 2ZMEA 4EM0B 4KNYA 3J81K 4ZZLA 5CLSA 2D1VA 1ZGAA 1ON1A 2MH9A 1BIBA 4AIJA 4KDPA 1IRGA 2DK5A 3RIRA 1FNNA 1DP7P 3MFKA 1XCBA 2PBIA 2CO5A 5AIQA 4HF1A 1W7PA 4IRHA 1FP2A 2VE9A 5BMZA 1YS7A 1P6RA 5CVUA 3ZMSA 2EV0A 1GVJA 1BI0A 1QO0D 3RKWA 3JTHA 1KQ9A 4ZH4F 3KFWX 4N9HA 1FYKA 3V4GA 5E17F 2DI3A 2MH2A 2OD5A 5CVJA 1REPC 2Y48A 3GX4X 1CGPA 2YX4A 4P9UA 1FYMA 2XAFA 3I4PA 1T0FA 4ASNA 2OQRA 2FOKA 1P2FA 2FE3A 3KZYA 2JRTA 5LEJA 3ZN1A 2P4WA 3ABTA 5FFZA 3E5UA 1IXRC 3KP5A 1XMAA 4HAMA 1LB2A 1XSVA 2K02A 1J9IA 1KU3A 1TTYA 2UXNA 2DW4A 3P9CA 1K7AA 5LHIA 3IKTA 2WV0A 4FX4A 2VT3A 3RKYA 2A6EF 3T5XA 5HDGA 4OIOF 4A0YA 1SD5A 3KP2A 2LKPA 2XAQA 3HOTA 1K79A 3QU6A 3V8JA 3DXJF 1VTNC 2DT5A 3WTUC 1YIOA 5BOXA 1L3LA 5LLQA 5D6EA 4PGHA 1W7PD 2EB7A 4CYDA 2VE8A 4G9YA 3NRVA 5D8LB 4CGZA 1S29A 5F1RA 4EVIA 2B0LA 3CUQB 4R8HA 4IVNA 2RQPA 3LQQA 3T1BA 3BDDA 3HYIA 3JSPA 3BOQA 4I98B 1HQCA 2EFQA 3QOPA 2EFWA 2HEOA 2DFIA 5F6FA 1JHFA 1FOKA 3I5UA 4XLPF 3Q5FA 1W5TA 2STTA 1G3SA 4GYGA 4G7HF 3ZPLA 1XGMA 4IXAA 2YR2A 3L2CA 3JTGA 1OKRA 3GUDA 1P4XA 2VOPA 2ZXJA 3OV8A 1L0OC 4RGSA 3H92A 2ZKZA 5E8IA 3HRUA 5K5QA 3BY6A 1KQ8A 4GYIA 1U3EM 2NS0A 4M72A 2DPUA 2UZKA 1MDMB 2A6HF 3QP5A 1XGNA 3GFIA 1FBUA 1K78B 3I58A 4BQAA 2CGPA 2FEZA 5ILSA 3J7AO 2D45A 3HIFA 1MDMA 3TKYA 2IA0A 2P7VB 2EA4A 2IVMA 4FX0A 2LF8A 1K78A 2HR3A 4HF2A 2L4AA 2DBBA 2M30A 3F21A 1HSJA 4IRIA 3HHGA 3GYHX 1NHAA 2PQ8A 4HZFA 4QLCU 1OYWA 2E7XA 1SMTA 3B02A 5FB2A 3TQNA 4Y17A 5HVQC 2XV4S 1Z7UA 3IWFA 5E8GA 1MKMA 4WXDA 2RC4A 1T38A 3MCZA 2RVCA 3RKXA 5LGTA 3G73A 3WTWC 1XDUA 2H6BA 2DQRA 4I01A 2XRNA 2NNNA 1R36A 1IN5A 1ZHFA 3QPTA 2NYXA 1ULYA 4ZYDA 1XCVA 4EMSA 1KQ0A 4L9JA 2EFPA 4U7BA 4HBLA 3I71A 1J59A 2H27A 1QBJA 3E5QA 2IPQX 2EFNA 1D3YA 1EV7A 2QZ8A 2P6TA 5DV5A 5DD8A 3RDIA 3J80K 4LFUA 3K0LA 1Z6RA 2DLLA 2HKXA 2HZTA 2J5OA 2FF4A 3B73A 2XAJA 3KCCA 3HTUA 1KA8A 1P4AA 2ACJA 1XGSA 1Z05A 4RB3C 1ON2A 2V1UA 2RDPA 3QU3A 2JT1A 2A07F 2HKOA 3WTTC 3WG9A 2QENA 4YFKF 4XRFA 3ZMDA 1X3UA 1LNWA 2F5FA 3Q9VA 1T2KA 4EJWA 2BGCA 4ESJA 2GWRA 1WSUA 3LFKA 1J2XA 1FLIA 1O3SA 1A04A 5DCFA 4CO8A 4O3MA 3SZPA 4MEXF 2P7CB 3LAPA 2YU3A 2DAOA 3BJOA 3RTRA 1DDNA 4HA8A 3HUGA 3WGGA 3P9IA 1XSDA 4L9TA 2L01A 3FMSA 5K5OA 2PG4A 3WGIA 3ZMUA 1BM9A 3VODA 1IN4A 2ISZA 2COMA 1QGPA 2HQRA 2JZYA 1FY7A 3ULQB 2BE5F 3MAJA 1O3TA 5LHHA 3GZ5A 5HDNA 2G7HA 3F22A 1YG2A 4KN7X 3L9FA 1UHWA 5E18F 3MQ0A 4HF0A 2OZ6A 2PEXA 1LJ9A 3CDHA 1MJAA 1YFHA 4IF4A 4UVBA 4CZZA 2VN2A 2STWA 4L0YB 1XDSA 4S05A 1BI2A 3TO7A 2RV8A 4WX9A 5E1ZB 4IRGA 3F8NA 3L09A 4G94A 2CSOA 1GXPA 2PN6A 5BS6A 4MHGA 3GZ6A 1G3WA 1PP8F 1AWCA 1SAXA 1ZRDA 1XSXA 4L5JA 1TW3A 2UWMA 5AIPA 3VB2A 3N97A 3JAMZ 2Q2EA 2VBYA 3BP8A 5LRRA 4M6YA 4LLNA 2QQ9A 1R5HA 1IUYA 2M45A 5BPDA 2QVOA 3FM5A 2FQ3A 1UFMA 3LA7A 1YW7A 2CYYA 1XD7A 3GFLA 3M9AA 3DV8A 3H3ZA 5LBQA 5FO5A 1FWZA 4B8XA 2HGCA 2V1XA 3RJPA 5CYVA 3SHFA 3K9TA 3TOAA 3FXUA 4BNCA 4M73A 2GIVA 2KIMA 4O6JA 3KLNA 3QPHA 1TW2A 1W7PB 4KICA 2MLKA 1DPRA 4RGUA 4H0EA 1FC3A 3TGNA 4LK0F 4OINF 2VBWA 1PDNC 3QP6A 4DQ2A 2CW0F 3O6BB 1FX7A 5ICFA 1RUOA 1R1UA 4AVPA 2NRAC 4P96A 1O57A 2ISYA 4XBFA 4Q4ZF 3HRTA 3JW4A 3CUQC 1JE8A 1TQPA 1TNSA 2L02A 3EYIA 3BZ6A 4EV0A 5IT3A 4ENMA 3F8FA 5D6FA 2IP2A 1SFUA 3KE2A 1GXQA 4UV8A 3DPLC 5DUIA 4M6XA 3NEUA 2JPBA 1S7OA 4N9IA 4IJAA 3GEZA 2RN7A 4M71A 3RYRA 3KLOA 2QQBA 1SD7A 3E6BA 4EJVA 5HS8A 3LAJA 5JI6A 3KZZA 2OU2A 1Y0UA 3RYPA 1ZRCA 1FP1D 1F9NA 3M8EA 5H6RA 2QQAA 3V7CA 3WTZA 1OYYA 2XKPA 3FX3A 3P9KA 1RNLA 1G4DA
chains in the Genus database with same CATH superfamily
1U0JA 5J8CA 1TC3C 2JA7G 3I4MG 5FLVA 3ML6A 4FU0A 2R7DA 1A0IA 4YAKB 2V26A 3LSHA 4BAYA 4MTDA 3WTYC 1JT0A 4JI5H 3KEYA 2F5EA 1OMIA 2EWNA 1YQAA 4DV3H 4ZYAA 1DUXC 3PL8A 3GLKA 3K4MA 4UCVA 1MMDA 2XPUA 5C44G 2OF7A 4WWCA 2ESNA 3MWDA 3SDGA 5DS9A 3QPSA 5LA6F 2P0AA 4KT5C 3PFIA 2K9NA 1TT0A 2RQQA 4CUGA 4RB2C 5IT9K 1HF0A 2IA1A 1HXDA 5LGNA 4YFXF 3HPGA 4B4CA 3I4NG 3L2QA 2XF6A 1I6XA 1B9NA 3ONQA 1Y14B 1MH4A 3J81Z 4DL6A 4PJ0C 3GTKJ 2L9SA 4FE7A 4QWDA 1ETYA 4X64H 3ZQGA 2QSFX 3K1PA 3F0CA 3H0GJ 1KC7A 1R58A 3MEXA 3QYEA 5M5WJ 1Z1DA 4U88A 1OYIA 5LRSA 4YP3A 1C3OA 2B63G 4BY7G 1R00A 1SVOA 3PNYA 5M3FJ 1EH6A 3FXJA 4BXXG 4UCOA 1OCRH 2KSWA 3VYTB 2DMNA 1S9FA 1NG7A 3REOA 1FMVA 5FKOA 3RB0A 3MZHA 2GLTA 5EWEA 2KIFA 2M87A 3FXOA 4CCLA 3TO9A 3C1DA 1JGSA 1J0RA 3IKVA 4QPQA 4F3QA 3KYLA 2W6ZA 1SANA 1MZBA 4BE2A 4JYKA 2DU9A 2QK4A 2W7OA 4GO1A 3HG9A 4CZCA 2R7ZJ 5KFPA 4BQOA 3WE3A 4KIBA 1W5SA 4DV7H 4I7HA 5ICGA 1X1BA 2X0LA 2K7LA 4AM3A 4I02A 2R7FA 4Z6YA 2GA2A 5FKMA 3I0TA 3HOSA 4MV8A 1X4PA 1YS6A 2JN6A 2LVSA 5CQEA 4Z2YA 4ZDOA 2CUFA 2I8CA 1U5TB 1WPKA 4KIGA 5LOVF 2NVQJ 5J6XA 2E5ZA 4YR0A 4BJ5C 1H0MA 4KMFA 3SFIA 1H9GA 4HG2A 4ON0A 2K27A 4B3RH 2IGNA 3TOBA 2CRGA 2EH3A 4M3FA 3L2WA 5BPHA 4CCNA 1I27A 4CHUA 3JRXA 3K4KA 3VMMA 4LITA 5KT3A 3RI4A 2PI0A 2ZO4A 2QEXI 4K2EA 3A0HC 1WR2A 1IRFA 1U5TA 2IW5A 3OUZA 1KGSA 2DFEA 3H9GA 1X1CA 2FSWA 3K3PA 3KHLA 4EATA 2AQ4A 3WODF 2IMWP 4ZQIA 1Y1VA 1ZHSA 4XONA 3W6JB 2C6YA 3ELKA 3NWTA 3A4CA 2KZGA 2K5CA 2J6TA 4IHXA 2Z33A 5C5JA 2F2EA 4J9KA 1BI3A 5L3CA 4C3HJ 3U9SA 3OYCA 2KQRA 3DKYA 3MFIA 4XMYA 4UV9A 5DQIA 1S8NA 4DNCA 3L1PA 2E1MC 3V8LA 4UUVA 4EJUA 2ID3A 3MKZA 3X2QH 3ZMTA 5JUMA 3I3LA 5KG2A 5M3MJ 2XAHA 4C30A 1E4GT 5JFRA 1HCRA 1W4MA 4GFBA 2ME6A 5KFHA 5LHGA 3OSFA 3RPUA 3IAM2 3EYYA 1DIKA 3CP8A 4XN3A 3BZKA 2YS6A 3T5JA 4A3FJ 1KU9A 3RIZA 3K2AA 2CWEA 2ZNYA 3QWLA 2KRHA 3D5SC 1FEXA 2FPGB 3OYIA 3BWGA 2MBFA 2ZDHA 5DDGA 4YB8B 2XGQA 1I50A 2OBPA 1RZ4A 1EH8A 4YEJA 5TJJA 3K4JA 3LA3A 2W9BB 4D9JA 1QQIA 5L3FA 4IO9F 3ETHA 1IXSB 4XL9A 2H94A 1W0TA 1P92A 3K70D 3PO2J 2CZGA 5GADJ 1YE9A 2LH9A 2R84A 3KHGA 1LDDA 2V9VA 1AKHB 1G59A 1I94H 1RR7A 4W97A 5KFZA 2XVCA 2O5RA 2WY7Q 4PSWA 4RB0A 1UNNC 2W9AA 2XSJC 3I54A 4L9VA 4AIDA 3OTOH 1C0WA 3RUPA 4G6TB 1S03G 2W9BA 2DMPA 3R5FA 1BR4A 2IJLA 4BQQA 1WJEA 2YUSA 4A3DG 3L00A 2ZXHA 3DLAA 2NU8B 2E71A 3RB4A 1R4MB 1FBQA 1D0YA 1WH7A 1AKHA 4IHVA 2QGUA 3A03A 3DEUA 2BQ3A 4LGWA 1JKOC 1X4OA 2CW8A 3HXLA 1WCMA 1HDDC 2Q2TA 1B4AA 1RRJA 3S16J 4LJZF 4U0YA 5GONF 1HA8A 4V19K 2VR1A 3R5HA 5BPIA 2AQEA 3G1OA 2XC9A 4LH6A 2DJIA 4BHBA 1VFCA 3SEZA 2YL2A 3OYJA 1XMKA 2WA0A 2JVHA 5JHFA 2QYOA 3F8CA 1MSEC 1XB4A 3PUBA 3HPHA 3VSLA 2QBYB 1TWGA 3DEEA 2JA6J 2YW2A 4Q43A 3DKWA 2P5KA 3IRRA 2CQKA 3OOUA 1RIOH 3DLLF 9ANTA 1EZ1A 2AGQA 3RBEA 2LRDA 4FHTA 1E17A 5DG7A 2NU7B 2DIKA 3QYBA 4I0AA 1GHCA 2VA2A 1ETQA 3E97A 2QBYA 3JRGA 2BXYA 3FK6A 2FBKA 4P55A 3WTXC 1MJ9A 2GXBA 1TWCA 4TV8F 4A3MG 5FD5A 2E2HJ 2O03A 2BY1A 2UXXA 3GTLJ 4J0MA 2VONA 4HV5A 3SFZA 1FBSA 1ZG5A 4BQNA 1J5YA 3CESA 3ZQ7A 3ZXSA 2B9SA 2BXZA 2QSGX 4R8UB 2JA5G 2MA3A 2WWYA 2R7KA 3IP4B 3E6CC 3EUHC 2YS9A 2QYZA 2JUGA 1ORKA 1OR7C 4UCUA 4DGWB 2XGDA 4UHTA 1USSA 5F04A 3M4OJ 2KKOA 3HM5A 2EZLA 2R85A 1TWFA 4R8UA 4PSXA 4FE4A 2L7KA 5A2QZ 1O3RA 3RCOA 4A3BJ 3FXMA 5E1XA 4PGGA 2C2EA 3WO0A 3QAHA 2LG4A 2VQDA 4EGQA 3D5RC 2BHYA 1HLVA 3AG2H 1WWXA 3V6KA 2IRFG 4JI1H 5LEKA 1NG6A 3RAXA 4NBQA 1YJ9I 3E6MA 3T0YA 2ZJRF 1YX3A 1IRXA 4LG0B 3M4IA 4GKKH 5FFXA 5FKNA 1KU2A 3BPVA 3ZR8X 5DQHA 3OYHA 3RPUD 3VEPA 5T14A 2F5DA 2HTJA 3E3VA 1YJWI 1WJCA 3LQRA 4Y3OA 3PZPA 2ZNZA 4GGGA 1P7IA 1M6VA 4D7NA 1B6RA 3FMQA 4PJJA 5CVRA 5D4SA 3EPIA 1RKTA 2ZXIA 3EUAA 1SCUB 2WAEA 4LG0A 1I1GA 2OCEA 3ROUA 3EETA 3CF5F 1GDTA 3W6KB 3VYSB 2X6WA 5IYBJ 1BJAA 1P4WA 1S7AA 3K69A 3H20A 1UHMA 2K9SA 2OPTA 4E7ZA 4IOCF 3T1HH 3S17J 2BY0A 2TDXA 4UUTA 2ZSIB 1UCRA 4O4IF 2BHZA 3KEQA 3PQJA 3ERMA 4CCMA 1JJ6C 3OOPA 5ILVA 4EGYA 2UUAH 2Y9ZA 3LP8A 4ZOLF 2X1DA 1JHHA 4MGRA 2CV1A 2M2EA 1BC7C 2FRHA 3K5IA 1IN6A 5FPOA 1B6AA 3NWSA 3ERED 3ISPA 2EFOA 5C1OA 5KT6A 4RAYA 2BQUA 5FRNA 1O75A 4ED6A 4NDLA 3ZN0A 2NNYA 4QWQA 2UUBH 3T1YH 4J9QA 2BYVE 1N32H 1D1BA 1A35A 1JI8A 4IHWA 3UNGC 3WTVC 5L1IA 3DU5A 2O8XA 1UMQA 4CXFA 3SI8A 3D5LA 1GT0C 1IC8A 2JPCA 4HDVA 3HOWJ 1WZ2A 2EILH 2W85A 3NARA 1KJQA 2Q2UA 1UB9A 1G8XA 3H0GA 1FSHA 4JX4A 2JVGA 2CU7A 2QWWA 1UC8A 2V1NA 5KFJA 5KK1A 3GO5A 3CCMI 3M8FA 4MFEA 2W6QA 2PBZA 3IN5A 3GLXA 2DA7A 2RGVA 3HGGA 3S14J 4XSZF 4BGDA 4N4OB 1VQOI 5FLXK 1KBLA 2WBMA 4JBAA 1WH2A 1YW9A 4G6DA 3N6XA 2GIZA 4RNNA 2VB6A 3RZDJ 4M3GA 3KP3A 1K1QA 3GFJA 3BJ6A 2OH2A 1VQ8I 5IWAH 1JDEA 3LA2A 5FLMJ 2VQLA 2P8TA 3CD6I 2W9CA 1L2ZA 1X2MA 3V6JA 3U9GA 4A6EA 3WU0A 2PJRB 2R7ZA 3H3UA 1KYZA 2JSCA 2X6XA 3WG7H 3VFZA 3GW2A 1H8AC 3WO1A 5H20A 1LVKA 5D5UB 3Q3SA 2XUBA 2ZC2A 1XNRH 2VT2A 4JUZA 6PAXA 4A2UA 3D0SA 1N34H 2EJRA 4A3LG 4CSWA 1VQLI 1Y56A 1IRZA 1SFEA 2X51A 2R7SA 5IP7J 1MD0A 3MR6A 2AXLA 1JT6A 3DTEA 2PJRA 4JI6H 3T8TA 3GCMA 4P9FA 4B09A 1HW2A 1QPIA 5D5XB 1QNTA 1XMXA 2J6UA 4A93J 1GO3E 4F7ZA 4CC6A 3BR6A 3BC8A 1WJDA 4JK1X 1J75A 4U0VA 4JYAH 3CQZJ 1H9TA 3VOEA 1VZ0A 1S68A 1D1AA 1JGGA 1G6NA 1S7EA 5J1UA 3PW7A 3BTJA 1E3PA 1MBJA 5F1JA 1GV2A 1W36C 4GDFA 3V7SA 1JKRC 3V42A 1EUDB 5IYCJ 3G4SI 2JA7J 2R8JA 4ANJA 2DA4A 2XROA 2FJ1A 4MAMA 3WHBA 1BN5A 4RS8A 2K3PA 1QRYA 3Q8RB 4F55A 4TQSA 2WB1E 1RYRA 3CJTB 1D0ZA 1FYLA 1ZGWA 3WU1B 4KFCA 2RAEA 3A1YA 1FSEA 4HNTA 3LWBA 4Y7NJ 1QVUA 2E36A 3S3OA 1U8RA 2FLNA 2HVRA 3RQ4A 3B6AA 3FWEA 2BQRA 3K1NA 3J80Z 5DG9A 3DFGA 3KPHA 3CCRI 4YIIA 5B1AH 2M1BA 3N44B 2TCTA 3HSRA 5FKLA 3I4NJ 3J7YJ 3WNZA 4B1RA 2R7RA 3VYUB 5CVIA 3W2VA 1IOVA 1PUFB 4B44A 1K1SA 2ESHA 3Q9SA 1I1SA 4DL4A 3ZQFA 4LB5A 1VQ4I 1A6QA 1HSTA 3FISA 2PFBA 3KP7A 4RU9A 1BL0A 3HOZJ 4AWXB 1T98A 4MIMA 4LLGF 3GTMJ 4BY7J 2B63J 1OJLA 2GZWA 4P5OA 1T94A 2OV7A 1N56A 1PUFA 4QPOA 4E7LA 3HOYG 3KYCB 2LSOA 4U87A 4G7ZF 3PW5A 1BOAA 2B7EA 1AA7A 1YW8A 1IN8A 3BCAA 2LD5A 1HKTA 2ZBKA 4ECVA 2HDCA 4BJ6C 1R6RA 3QZ7A 3R6SA 1WHUA 2XCPA 2FBIA 2VBXA 3OL4A 3BQ2A 1M0WA 2DPDA 2EPFA 1SVLA 5L3GA 2QM3A 1T36A 2RGRA 5FGMA 4JV5H 2VOOA 2R92G 2Y75A 2JWTA 3VWBA 1W0UA 1UHSA 2HXOA 4EEYA 2XGCA 4BUPA 2O8KA 4XRSA 3P9KA 4Y13A 5JH7F 1HW1A 3OIQA 3RZOJ 1WSCA 2PMHA 4F91B 1PUEE 4L18B 4ECTA 5LGUA 3K70C 3A2KA 5TGTA 1FVIA 3FKIG 2VPLA 2Y0SE 1BIAA 2YS7A 2CUEA 3I55I 4Y33A 3WU2C 4ENKA 3IRQA 5ICEA 2KP6A 4F50A 2DDAA 2JA6A 4FT8A 4ESFA 4X65H 3V6HA 2LREA 1W5CC 3HKZE 4G3IA 4RZRA 4YFNF 1E3OC 2L2OA 1I6HJ 2DA1A 4IZOA 4XORA 3RPQA 4ESBA 1ZRFA 4YG2F 2M7AA 1TNTA 1DU0A 1D8KA 5DM7F 2Y30A 3FDYA 2RF4A 2HNHA 4QIWN 1V4RA 4RM3A 3R60A 1QZYA 2NOJB 3TL4X 2O0YA 3WE2A 2QQ8A 2XASA 4II2A 4HV6A 3OS2A 1S72I 3M7GA 2VUGA 2E2HA 4QTRA 3GTLA 3BA9A 4AU7A 2QCOA 4EG0A 3PQKA 3QZ8A 4F4WA 1G3YA 5LFAA 2BVLA 4Q44A 5E1WA 3C7JA 3TP0A 3DPTA 1ZN2A 3SXYA 2YRWA 1ZREA 5J4VA 3MZYA 2F5VA 4HQMA 5H6QA 1S6LA 2HWVA 4JI8H 3L7WA 4ZC3A 4OIPF 2FPIB 3IL2A 4A5NA 3AAFA 1D5YA 2W00A 1SVMA 1HKSA 2WC2A 3CUOA 5GAGJ 1I6UA 3F8MA 1SEIA 1WQ2A 2DK8A 3JRFA 2DJNA 3TP3A 3GIQA 2QUFA 3F72A 1X58A 1SFXA 3LWFA 4ETSA 1XS9A 2R3SA 5KFIA 1E2XA 5HNHA 2FOWA 4XLEA 1DPUA 1B8IB 3GLLA 3U1DA 4BU2A 4DBQA 3TQTA 1PVEA 3L2UA 2G9WA 1ZLJA 4Y4RA 3F6OA 4G8XA 2IT0A 4U0WA 4W1UA 2J6SA 1X3ZB 4XYLB 1WJAA 4YHHH 5J8FA 4B3XA 1VQ7I 4IOAF 4A2AA 1TLHB 1D5VA 2ELHA 3I9V2 1B8IA 2UUZA 3E5XA 3FXRA 5HOOA 4ENJA 2BZTA 2CV2A 1ULZA 4QIWA 3ORQA 4EBCA 3KX2A 2JEIA 1U5TC 3W2WA 3AFHA 3RQIA 5HODA 3EUKL 5KFMA 3JRBA 2XB5A 2CG4A 3K5HA 2W25A 2EQRA 4MV6A 5JQWA 3F9KA 3LSTA 3MWMA 5HS7A 1V3FA 4KA4A 1BI1A 1UG0A 4NHJA 3CCQI 4C3IJ 1AN7A 1GSAA 1ZR4A 1IBKH 2H6CA 2Y0MA 3EPZA 4E7JA 3L2VA 4MA5A 3ABUA 2VQHA 1YYVA 1U8BA 2DDBA 2VBZA 3GILA 1ZH5A 5F9LA 2HVQA 1X19A 4KJZA 3KP4A 1X9NA 3PO3G 4BS9A 4ZYHA 1Y1WA 1B59A 1IXCA 3CCVI 3P7NA 4UVAA 4TV9F 1TQIA 1NTCA 2FU4A 2KRCA 2JA8G 5KFYA 2V6CA 4HX8A 3G71I 1ONVA 3A02A 1R71A 1STZA 1IGNA 1LEBA 5CAEB 2CS3A 3AG4H 1FZPB 4ZZDA 5FD6A 1HNWH 4LB6B 2LKXA 2XPWA 2OUMA 4E7KA 4I0BA 4AC0A 5L1JA 4M9ZA 4OOIA 3HSFA 2R7XA 1D8JA 2Q8KA 1M7JA 3GIMA 2HQNA 5JVDF 4Y15A 1TL8A 5LL6b 4A0ZA 2WYOA 1UC9A 4HW0A 2EIJH 3BR3A 2WAQE 1K6YA 2IGKA 2LF7A 1LVAA 2OZUA 5D5WB 2ZJPF 4HDUA 3C0FB 2EINH 2ADUA 2KIUA 3K3VA 2HHHH 2CQQA 4A3MJ 4XLNF 5GAHJ 4NQWB 4Q48A 1XG1A 1QZZA 1GLNA 2Z3YA 1ETVA 3BG3A 2COBA 2JA5J 4CC5A 2FBHA 2PJPA 3DQVC 3G1LA 2XGPA 1IV8A 4RGRA 1ZTRA 5DGBA 5IP9J 4A12A 5D5VB 4DV0H 2LKSA 1OCZH 2XHKA 2PN1A 1UJ8A 4IRKA 2V6EA 4ECQA 2O7OA 1OLTA 4PFOA 4YIFA 3JRAA 2VUMG 5C4XG 1N48A 2X9DA 2P0WA 1I3AA 3HJEA 4NQWA 4FASD 4AQYH 5D4RA 2O6GE 5K1YA 1RKWA 4OWRB 5KT7A 3CJQB 3AL0B 4LLLA 3H5NA 4BYYA 1IF1A 2W6PA 5KG0A 3IAS2 3ZQQA 2HYFA 4I2OA 1X3WB 1U6GA 3BQZA 4RUAA 3BJAA 5KT5A 2HQ5A 4A3CG 2XKOA 1BA5A 2FMYA 3O2PE 4NXMH 3CDIA 1HC8A 5L3DA 3DEWA 1MMSA 1JTYA 4MTEA 4YY3H 2G7UA 2AU0A 4Q8EA 4M74A 1QPMA 4B48A 2ECBA 4HYEA 4HQEA 3PN1A 4FISA 2R87A 3R0JA 1BXRA 2RKHA 4AYBN 1Z6TA 2EA2A 3CQZA 4DR5H 3CCJI 4AIHA 2P5LC 2X6OA 3KHRA 1LPQA 3RGZA 5EWFA 4LF4H 5C4JJ 4XOPA 1Z9CA 3HOUJ 2RNGA 4MNUA 2O61A 2AO9A 2F5CA 2G0EA 3IC7A 3LL7A 4HR7A 2MLGA 2JA7A 2RREA 1V4YA 3F8BA 2WDTA 1OCTC 2E1NA 1GUUA 1ACIA 1Q1VA 2LTPA 1OPCA 1K83J 2HPIA 3H5AA 3CMEI 4IR9A 3MVPA 2BV6A 3UQ8A 3KETA 2LY2A 3G6EI 1LFPA 2KMUA 2XGXA 1DU6A 2DA3A 1N25A 5KKNB 1R1VA 1VQMI 2VASA 2X6YA 3J7ZI 4EFBA 1R23A 1EHIA 1QZEA 2WADA 2X1CA 1VAJA 2QSHX 3FM3A 3IWZA 2DN0A 5GP9A 4XK4A 4G6QA 4EEFG 4BDYA 1R9TJ 2MCTA 5KFQA 1W1WE 2ZFWA 5BPFA 2LNBA 2MSYA 2ZCWA 2ZB9A 2JK3A 4LK1F 4A5MA 2K9QA 3TEDA 4R79A 2M4KA 2FNAA 5KFKA 1OFCX 5H80A 1HNZH 2Q1ZB 2PX9A 3I56I 1VBGA 2A3SA 3HOVG 2D1HA 1O3QA 1XDNA 2ZJQF 2ZJTA 1O7FA 5J1RA 4O4LF 3GTMA 2B63A 2V9KA 2M9HA 1JXSA 5EZGA 3DU6A 4NB5A 4KIFA 3BA8A 2DYSH 2HFHA 4AYBA 3E6DA 3SZGA 2RDIA 4B3MH 2W24A 3ECOA 2HDDA 5KFXA 3PVXA 3JR9A 2R5ZB 2FMAA 4MV4A 4WXCA 3V7RA 2VXZA 1ZGJA 5L3EA 2NVXJ 1O7LA 4IQ4A 2KJBA 2MD5A 4A3IG 2L54A 2M5WA 2BBYA 5E20A 3ZP5A 1B9MA 3K2ZA 3CUQA 4X6AJ 4O3SA 1LFBA 3MJFA 4FBTA 1T33A 1JKPC 4WK8F 4ITVA 4EYIB 2C22A 4BH9A 4DBRA 4MQ9F 4ENNA 4PWQA 4UNOA 2OC6A 3VPCA 5EDNA 5A2QK 4TUYF 4JQFA 2R5ZA 3I53A 2A69F 1SC7A 4EJTA 3U2RA 1H89C 3OWTA 4OIQF 2O3FA 2CQYA 1SMYF 3EDPA 3E5NA 4ECWA 5KAFC 3JRHA 4I4TF 4XX0B 4A3LJ 3I59B 4V2GA 4ZYGA 4DR4H 3LSPA 1JTXA 5KFBA 3GF2A 4DL5A 2L9VA 2Z1DA 2GA1A 4AD9A 4IAJA 3MZ8A 1FPQA 4HX7A 2VJIA 4MLOA 4A3GG 5ERIA 4S0HB 5TRDA 4O4HF 5KFOA 1CF7B 1MMNA 3DPUA 2R7MA 3S93A 3PNVA 4RAGA 3S2DJ 5M5YJ 1VF9A 1WCMG 4IHSA 1MW7A 4I09A 4C3JJ 1SFOJ 1VQNI 1MJBA 4YAJB 4EBDA 3T5KA 2NAZA 2H8WA 3I59A 1MBGA 4NC6A 4PJMA 2PMZE 1W93A 4A3EG 5K7ZA 2CKZB 1QU3A 4WD3A 2CFOA 1VI0A 2V1DA 2R7NA 4UVCA 1CF7A 1P8LA 5KVRA 2RNJA 4M3DA 5HV6A 3RGXA 3G6VA 2WTEA 2F4MB 2YZGA 2JEJA 1CE8A 2VQEH 3JRIA 1IJWC 1T3NA 4MEYF 3M1EA 5IT9Z 4C2MJ 3WGHA 2UVRA 1SD6A 2JA2A 4E70A 1YITI 2AQFA 3Q0VA 2XAGA 4PFPA 4ZI7F 2P6SA 2XSDC 4E6KG 4BACA 5HLIA 1N33H 3FMRA 1U78A 1IDYA 4BDZA 3R0AA 1DGSA 3IHUA 1LDKB 4LOCA 3DP7A 2NU6B 5C3EJ 5DYMA 1RESA 1IDZA 2IAIA 2VC0A 3BABA 1XGOA 4GXOA 4I50F 3TO6A 5GTIC 4ZTJA 1N77A 4PCQA 2Z9OA 4EGJA 4Q45A 4DV6H 4MO7A 1BBYA 1DGRM 2HVSA 5IPAA 4LFCH 1ZG3A 3PM1A 2NS7A 5E3OA 1XX5A 2EV6A 1R5GA 5DGAA 4C2TA 3R23A 1XPXA 2O9LA 1AHDP 2GAUA 3JSLA 4RB1A 1TAEA 2W7PA 4HLXA 4IHTA 4HRIA 5DEQA 4KMUX 3GIIA 3FKJA 3G2BA 4P1WA 3H9JA 4RGXA 1GLVA 3C2GA 1ETOA 4TV7A 2EIKH 2C35B 2LBFB 2E2JJ 2Z99A 3ZCOA 5H2FC 2K85A 4TQRA 1M1EB 3SZTA 4BBSG 4DLKA 2R8HA 4KN4X 3U21A 3ZOBA 4DR2H 5KAIC 1IBMH 4OU0A 4JV2A 2D2WA 2I5UA 4L5IA 4OAYA 2F4IA 4DL3A 1G3TA 4ZDPA 2LY9A 5HNFA 2L3DA 2IBDA 4ED7A 1QHHD 1PYVA 2PLYA 4MQVA 1LE8B 1JDBB 4XSXF 5D8KB 2LBFA 4BHCA 3BAAA 1MIJA 2R92J 3QODA 2YPRA 2DQLA 2L9NA 2CW7A 2DA2A 2A68F 2FUG2 2EV5A 2E35A 2J5PA 2HYJA 4XLAA 4HLYA 1EF4A 3HB9A 2M8EA 3V4ZA 3BTIA 2IXSA 1Z3YA 3TIIA 1Z0XA 2FA5A 3G3ZA 3I64A 3MMYB 2TRTA 2L7FP 3FKIJ 1LE8A 1W96A 4LF6H 4CCKA 3GTOJ 4ZTFA 1R1TA 1A6IA 4B3AA 2ASJA 3HC7A 3O8HA 1FOWA 4EM1A 1YJNI 4O3QA 2RDJA 3DF8A 2IS1A 2FK3A 3PW0A 2E2IJ 2OAZA 4BJTA 5LD2C 3L2RA 3LSKA 3S2WA 1T39A 5AONA 1SEUA 4C5BA 4BE1A 2CUJA 2FNPA 3GWZA 3MN2A 1LEAA 3CO6C 3VPRA 2DODA 3HOXJ 1AOYA 2KRFA 5F64A 2XGEA 3TDZC 2AS5F 1IO2A 1WI9A 4L9NA 4ED3A 2VIXA 1OISA 5I47A 3H5RA 3GMEA 3O3KA 2FK2A 2JEFA 2XC7A 1Z2NX 1R4NB 3HTSB 2DOFA 2ELKA 3OIOA 4J00A 4OIRF 2JA5A 3HRSA 3QRFF 1HNXH 2H09A 1XTAA 4WF2A 4KT6A 3VPDA 2E1MB 1EJ9A 3S15J 4Q5SF 1ZK8A 5E3NA 1RR8C 4F92B 2MC3A 3MR3A 4DR1H 1X1DA 5DCMB 4DIQA 3OS0A 2ETHA 3LSGA 3LNQA 2BR0A 5FJ8J 1N75A 1SAUA 1ZR2A 1RK5A 1JUPA 3GVAA 1LQ1A 3PIOF 2FMLA 4EFEA 2J9GA 5HLGA 2WE6A 1Y1WJ 1IZ1A 4UXNA 4DV1H 1Q1HA 1V5FA 2DTRA 4LF5H 1WH5A 2BY3A 5ILUA 3F3XA 3HHHA 2K40A 2I80A 2Y2ZA 4XKCA 4OMZA 1A9XA 4C5CA 2E5NA 5DCMA 4C9YA 3FHZA 3RTXA 5BMVF 1TBXA 1MGTA 2OLSA 4S04A 5JVTA 4B47A 2DLNA 2P5VA 5CVVA 1N78A 4PZJA 1HW5A 2DT7B 5GAEJ 5KG5A 1B1BA 3JAMK 1BC8C 1IUFA 3BROA 4OMYA 2R6FA 1DGWY 1Z91A 4WBNF 5CKTA 2OTJI 4C5AA 2A61A 3ZGKA 2R7ZG 2MYSA 3K4BA 3TW7A 4KITB 2ASDA 1TWAJ 1I3QJ 2WB1N 1G2HA 4EBEA 1YX5A 4N0BA 5ED4A 2HYGD 1A36A 1RUNA 4QWBA 2XDVA 5EEGA 2UU9H 2NU9B 3TBIA 2W4SA 1I5ZA 3TDUC 1TQMA 2HS5A 2YX7A 1S5LC 3PFYA 4IRCA 2KISA 4DV4H 3AG3H 2E60A 2LDUA 3BPXA 3ORRA 3Q2OA 2VODA 1ITYA 4IEJA 3COAC 4A3JJ 1K83A 4BHPA 4E7HA 3KXYT 4U7CA 3H0DA 1U9NA 5A2QW 2YU9J 4A0XA 3UR3C 4F93B 2KDZA 4B3TH 1ODDA 1QHGA 2H8RA 5KFGA 4X66H 5J47A 3K4LA 1IW7F 4D0PA 1V55H 5JLWA 3ESWB 4DUZH 4JP0A 4YR3A 4RUCA 4LMYA 1WRJA 4KUMA 4Q47A 5KFDA 1T6SA 2L4MA 1AUVA 3PR4A 2A5YB 3NQOA 4RAZA 4A6DA 1R9TA 3PNTA 1IN7A 4G12A 4U7DA 2DMTA 1F1ZA 2XPVA 2LK2A 4QSHA 3OYGA 2JTVA 2E1CA 3JZIA 1BGWA 5KG6A 1MNEA 5IOYA 1S9HA 1KYWA 2R7WA 2IA2A 5GTHC 2IGOA 2NS8A 4EGZA 4QW8A 2Z5UA 4WCGA 1S0MA 5K5RA 3KALA 1VQ9I 2ELJA 4LD5A 1T56A 3CTAA 3S32A 3LOCA 2V79A 2VL8A 3UFXB 4A3FG 2V9WA 4I55F 2WB1A 3N4MA 1YTYA 3U9TA 1R22A 3R61A 4ABZA 3F23A 3BR5A 1YO5C 3BLYA 5DD4A 3W3CA 2W6NA 2NVXA 5EEHA 1ZELA 3I4MJ 4M9SA 1ZLKA 1S97A 2UXCH 2R7OA 4EJOA 2JMWA 3BJYA 3K1MA 2VC1A 2HOEA 3QYFA 4ED1A 2VUMJ 1PP7U 5C4XJ 2KHMA 3CJNA 2YSRA 3PSFA 2CQXA 2QLZA 3ZMVA 5C44J 4F4XA 1MBHA 2YZNA 5KG7A 3CMYA 4HOBA 3HKZN 3LFUA 4M6VA 1LDJA 4WXHA 4BKXA 3FF5A 1RC9A 3H36A 4ED0A 4FS1A 3SQNA 1U2WA 4AVZA 4E4TA 3RKQA 3RJ0A 4PJNA 1DV1A 1GSOA 1LKXA 5HS9A 2DA6A 1JUSA 4GCVA 2AGPA 2M34A 5L3BA 5DUKA 1IAWA 3EUHA 3Q8QB 3EQLF 3D1NI 1OR7A 1ETKA 2CQ7A 4IQJA 5BQTA 2X4HA 4DUYH 2XIGA 1BR2A 1KU7A 1ZAOA 4FM9A 2AGOA 1HKQA 1XN7A 2IGMA 1TZLA 1SFOA 4M9XA 3HEFA 4J9LA 2FJZA 3FZVA 3FXQA 4XRSG 5HLHA 4XIDA 3JRCA 5J2UF 3CCUI 2GQQA 2W84A 4NNJA 4K0KH 4BXXJ 3FHNA 1SD4A 2VPRA 3ECHA 3GFMA 1YRNB 4AIKA 4ECRA 4HX4A 3U1KA 2L7ZA 4MV7A 3C3WA 4E7IA 3CLOA 1ZHQA 3GIDA 2UVWA 2MW8A 4XN0A 2K4JA 3HSEA 4C2MA 1S3JA 4JI2H 1ZYRF 3OHBA 2ZDQA 4O5VA 2H1LA 2W48A 2GOXB 5FKKA 5ICCA 4BE0A 3RAQA 1S0NA 4EQQA 4L0ZB 1K61A 1UG2A 5JHUA 3VYRB 1YRNA 3CJRB 3HRMA 1FT9A 4A2BA 3K4NA 5HLTA 3GXOA 4YJ3F 2M3AA 2W1OA 3F6VA 2L5QA 1WJFA 1ZARA 3LMLA 1F43A 4G7OF 1XMOH 2W71A 3HKZA 1WGXA 4CDGA 1ZG1A 3J7AK 1WKMA 1EH7A 4XNFA 2LYCA 3OSGA 1Y8QB 4PDKA 3RF2A 5KG1A 2EK5A 2K3FA 5E3MA 4L1KA 5FLXZ 2YYAA 2DPJA 2WAFA 3HOVJ 4J9OA 1VQ5I 4YJ2F 1RI7A 4FS2A 1HBXG 4XLFA 3BR0A 3HDDA 2DZDA 5HDKA 3K6GA 2DO7A 5CJ9A 1YLFA 2X85A 3JSOA 2L7MP 2CFXA 4J9SA 1DQUA 1F4KA 2ZXWH 1USTA 2VQCA 2ZJ2A 3AL0C 5LMNH 5KHDA 1Z2PX 3KEOA 4KYWA 3ETJA 2Q0OA 3WTSC 4ZYEA 1E4EB 4R1HA 1K6OA 3T8RA 3ABKH 2H1KA 2BEOA 3GTGJ 5JR3A 3V8KA 1EKEA 2W57A 2R92A 1GVDA 2HTSA 1J7KA 2ZMEB 3IH4A 3TW6A 3SEQA 2I87A 2OA4A 2GXGA 4CICA 5D1OB 3FBNB 3W6VA 4B3SH 3C18A 3KP6A 2F6CA 2K4BA 1E4EA 2FXAA 4BXUA 2UV1A 4IPAA 2OQGA 2E7WA 4EM2A 2HQAA 3CO7C 1F5TA 3ZMZA 3FKIA 3R4KA 1R7JA 3NGDA 2NVYJ 3GTOA 3GTQJ 2PMUA 2CQNA 2KJCA 5C1PA 2ZMEA 2WAQN 4EM0B 4KNYA 1VQ6I 3J81K 4ZZLA 5CLSA 2GXAA 2SCUB 1ON1A 1ZGAA 2D1VA 5D1OA 2MH9A 1E4FT 5J2TF 1BIBA 5M5XJ 4IHJF 3JAMW 4AIJA 4KDPA 2W70A 1R49A 1QA6A 2E2IA 1IRGA 3IG0A 4Y8VB 5EJCA 4QWEA 5KT2A 5K2MA 2DK5A 1WJ5A 4XLCA 1MBKA 3RIRA 3OS1A 1FNNA 2MC4A 2HGSA 1DP7P 4A3EJ 2E5LH 2A05A 4XOTA 3BTLA 3MFKA 1XCBA 3M9MB 2PBIA 2CO5A 5AIQA 4HF1A 1W7PA 4JX6A 1CS0A 4IRHA 3GV7B 3RSNA 1FP2A 2QF7A 1FOYA 2VE9A 4NC8A 3S8PA 2OWOA 1Z7LA 1LFUP 4XRMA 4AUXA 2DPIA 3OYDA 4A3DJ 2VPSA 5BMZA 3MFHA 1YS7A 2R7UA 2HZDA 1UAAA 1I7LA 1P6RA 4Y52J 4GKJH 3S1NJ 5CVUA 3ZMSA 2R5YB 1BW5A 3CP2A 3G8CA 4O2AF 1FTTA 2EV0A 1FJLA 3HOWG 1GVJA 1K4TA 5FPRA 3MKWB 3UKGA 1N36H 3EPGA 2HI3A 1MNMC 3OYBA 1OWTA 5KFSA 1BI0A 2FLPA 1QO0D 3RKWA 3JTHA 1KQ9A 4ZH4F 3OYEA 2M8GX 2ALZA 3N05A 3KFWX 4LSAA 4RLFA 4QWCA 4N9HA 1FYKA 3V4GA 1IBLH 3M07A 2R5YA 5E17F 5C8YF 4U6PA 2KFDA 2WV1A 4BBRG 2ID6A 5EG0A 2DI3A 1JJ8C 1JKJB 3FK7A 2MH2A 2OD5A 5CVJA 2AXTC 2FD5A 2WAQA 3ZRGA 3S1RJ 1REPC 2R82A 4ED8A 5FROA 5CA1F 2Y48A 4BBSJ 3DKXA 5GPCA 3I12A 3KHHA 3GX4X 1CGPA 2YX4A 2Y31A 1TWAA 4P9UA 3S1QJ 1I3QA 5KT4A 1FYMA 4BWSC 3GTJJ 2QA4I 2XAFA 3MR5A 3I4PA 1T0FA 4ASNA 2OQRA 2FOKA 1P2FA 4JOMA 2GBYA 2FE3A 3KZYA 2JRTA 5LEJA 3ZN1A 2P4WA 4LFAH 3N42B 3ABTA 3TINA 5FFZA 1IOWA 3E5UA 2FP4B 2C00A 3OYFA 2VKEA 2YU9A 4NC7A 4A93G 4MV9A 2L0KA 4E4HA 2KT0A 3CMAI 1IXRC 2KZVA 2ICWG 3KP5A 1XMAA 4HAMA 1LB2A 4ZHQF 5KG4A 2HPMA 3LSIA 1ERDA 2P81A 3JCUC 1XSVA 2K02A 3HZJA 3SYTA 1RJPA 4M3EA 3GTPJ 4KISA 1J9IA 2VKVA 1KU3A 1TTYA 2KPMA 4DYCA 2UXNA 5IYCG 3FIWA 1XNQH 3KZIC 2DW4A 3P9CA 4DYQA 1K7AA 5LHIA 4YELA 3IKTA 2WV0A 2ZDGA 4NLGA 4ECZA 3BT9A 4FX4A 2VT3A 3RKYA 2A6EF 2NVUB 3T5XA 5HDGA 5B66C 1BJTA 3KAKA 2HOSA 4OIOF 5EZYF 2R8GA 3RB3A 4A0YA 1SD5A 5BR8H 5LMUH 4GC7A 3KP2A 4HEA2 2EZKA 2LKPA 2XAQA 2DOEA 3SDBA 4RBOA 1Y39A 2LOOA 3P5JA 3HOTA 3L4JA 3CCLI 1K79A 4JV1A 3QU6A 4LF8H 1OCOH 3V8JA 5DM6F 5EOYA 3BZCA 4DV5H 1KJ8A 3DXJF 2R93G 1VTNC 1H88C 3OL3A 4J9RA 3L4KA 1Z2OX 2VOBA 1D0XA 2DT5A 5K7HA 3WTUC 5KFWA 3TQ1A 1OQYA 1YIOA 5BOXA 1L3LA 1KJJA 1KEEA 4YBZB 5LLQA 1T8IA 4FCYA 5IYDG 2VUMA 5D6EA 1F36A 3CMMA 4J01A 4QW9A 3HOZG 4EYHB 4PGHA 1W7PD 2EB7A 3TMOA 1BNCA 4CYDA 1Y1VG 4A3KG 2VE8A 3JRDA 4L5EA 4G9YA 4RM2A 3C2BA 1AUXA 2PMZN 1UZCA 5EGOB 1P7JA 3NRVA 5D8LB 4LG3A 4CGZA 1S29A 1FMWA 5F1RA 4EVIA 1X2NA 1I7NA 4LIUA 2B0LA 4JI0H 1W36D 3RV3A 1GGOA 2W7NA 3CUQB 1EYZA 1MBFA 5EGOA 4R8HA 3CDLA 4IVNA 2RQPA 3LQQA 3T1BA 4FBUA 3MKLA 3BDDA 2DXIA 2YRXA 1P9QC 5CA0F 3HYIA 3JSPA 4UCRA 1MMAA 2VXDA 3BOQA 5EF6A 2V5AA 2X0SA 4IR1A 4I98B 5IOZA 1HQCA 3MR2A 2W8LA 3K7AJ 2EFQA 3LSMA 2XCAA 1J09A 2UVVA 5K7FA 3QOPA 2EFWA 4RMNA 1ENHA 2DFIA 2HEOA 4BY1G 1FJGH 2BY2A 5F6FA 1JHFA 2JQ7A 1ETXA 2KDOA 4MFDA 5F0FA 1FOKA 3I5UA 2XCLA 3H4BA 1FIPA 3N43B 1V54H 4DZJA 4XLPF 3Q5FA 1W5TA 2STTA 2C2DA 4HYKA 1G3SA 3BQYA 4XKWA 4Q0YA 2MG4A 4GYGA 4GLXA 2GOMA 4G7HF 3J81W 2R93J 2KIQA 3ZPLA 4HNVA 1XGMA 4D7MA 4AYBE 4LSXA 4IXAA 2DFHA 5F27A 2PMZA 4XQFA 2MD0A 3W2AA 3S1MJ 1WJBA 4D5FA 3AKZA 3AYHB 2YR2A 5L1LA 2DTZA 2DYRH 4DV2H 3L2CA 3KAJA 3JTGA 1Y0NA 2LP0A 5KFVA 1PK8A 1OKRA 3GUDA 4GC6A 2FLLA 2A6TA 3C2HA 1P4XA 1VNDA 2VOPA 2ZXJA 3OV8A 3IH3A 5D1PA 1L0OC 4RGSA 3H92A 3AG1H 2ZKZA 5E8IA 5KG3A 3HRUA 3H3VK 5K5QA 5JVLA 3BY6A 4ZJZA 1KQ8A 1JX4A 2R7QA 4CCJA 4GYIA 3OYNA 2XD4A 2YZMA 3GTGA 1TT5B 3OR1C 1U3EM 2NS0A 4M72A 3N8DA 5JLXA 3GIJA 5DLGA 2DPUA 2UZKA 1MDMB 2FB9A 4IKFA 2A6HF 4LF9H 3QP5A 1XGNA 3GFIA 5DG8A 1FBUA 3DTKA 2BVMA 2M7BA 1K78B 3I58A 2M0MA 4BQAA 2M4GA 3JRWA 4H4KC 2HOAA 3OMYA 2CGPA 5DLFA 2FEZA 5ILSA 2ZSHB 3OR2C 2NVYA 1GYFA 3J7AO 2D45A 3HIFA 1MDMA 3S2HJ 3TKYA 2VKDA 3GTQA 2IA0A 5KFTA 2P7VB 2EA4A 2IVMA 4FX0A 3BQ0A 2LF8A 3OYMA 1K78A 2HR3A 4HF2A 2L4AA 2DBBA 2M30A 3GBGA 3VPBA 3F21A 4MV1A 1E3HA 1HSJA 2BOLA 3FBIB 3T5LA 1MMGA 4IRIA 3HHGA 2DOAA 4R7RA 4I99C 3GYHX 1NHAA 2LC2A 4RA2A 5KFEA 3CC2I 5EYRA 2DCEA 4D1QA 3N40P 2PQ8A 4HZFA 3HOYJ 4ECXA 2JJ7A 1V5EA 2LR8A 4QLCU 4X0GA 1OYWA 1HOMA 5J40A 3A0BC 2E7XA 3DCFA 1SMTA 3B02A 2OJED 4DR3H 5FB2A 3PIPF 3TQNA 3ZQCA 4Y17A 2K9LA 4YRVA 1ZETA 4XZ3B 3G6XA 4F4ZA 3VDXA 2IEKA 5HVQC 3JSNA 3Q8SB 3BTCA 2XV4S 2IBKA 4KHPH 1Z7UA 3IWFA 5E8GA 1V51A 2VLAA 1I39A 1MKMA 2FX0A 1BJZA 4WXDA 2RC4A 4YQWA 1T38A 2NVTJ 3MCZA 2RVCA 2XAUA 4UUSB 3RKXA 5B5EC 5LGTA 5IYZF 3G73A 2XF7A 3H35A 4UB6C 2UVUA 3GV8B 2VKHA 3ABLH 5BNGA 3WTWC 2I10A 1XDUA 2LY1A 4IWXA 4HQ6A 2H6BA 2DQRA 1T95A 4JV0A 2WY8Q 2XRNA 4I01A 3R5XA 3OHAA 2NNNA 4PDBA 1R36A 3DF7A 3HGYA 5IP9G 3FXKA 4UUSA 5F0HA 1IN5A 1RK6A 3CC7I 1ZHFA 3PSIA 1O4XA 3QPTA 2V4QA 2NYXA 4FQGA 2VQFH 1ULYA 4ZYDA 1MNDA 1XCVA 4EMSA 2MFZA 1S0OA 5IT9W 1KQ0A 4L9JA 2VI6A 1VQPI 4YR2A 2EFPA 4U7BA 3BR1A 3GTJA 4ME6A 2F48A 3VSKA 4HBLA 3I71A 3O8GA 1J59A 2H27A 1KONA 4RDUA 2LFBA 1QBJA 3E5QA 5IP6A 2IPQX 5TISC 3LMMA 2EFNA 1D3YA 2OTLI 1EV7A 5JVGF 2QZ8A 2P6TA 5DV5A 2R7TA 4Q8FA 5DD8A 3RDIA 1YOVB 3J80K 2Y0SN 4LFUA 3K0LA 1Z6RA 2DLLA 2NOGA 3H0GG 1ZQ7A 2XB0X 5J1YA 4EEQA 4MA0A 5DTDA 1BOBA 2HKXA 2HZTA 2J5OA 4RZQA 1B04A 4IRDA 3GTPA 3G1MA 5F9NA 3HOUG 4DR6H 2FF4A 3IV5A 3B73A 2XAJA 3KCCA 3HTUA 4JI4H 3OY9A 1KA8A 1P4AA 1IV6A 2IS6A 2ACJA 3DBHB 4MV3A 2EZIA 4F4YA 1XGSA 1Z05A 4RB3C 3IH2A 3FDSA 1KZHA 3E7LA 1A31A 3T5HA 1ON2A 4II3A 2ME0A 2V1UA 2IS4A 2RDPA 3QU3A 1J5EH 2JT1A 2NXNB 1S10A 3S3MA 2FKLA 4DOZA 2HKOA 2A07F 3WTTC 3WG9A 1GV5A 3CLQA 2QENA 4YFKF 1TWHJ 4XRFA 2JSPA 3ZMDA 1X3UA 1LNWA 2F5FA 5KFFA 3Q9VA 2CH0A 2V59A 1T2KA 4EJWA 3NAUA 2BGCA 2OCCH 1VBHA 4C2UA 1LUJB 4ESJA 4IX7A 3DTIA 2GWRA 3CZ6A 1XC5A 1Y6IA 3GTKA 4CCOA 4IL6C 1WSUA 1DV2A 3LFKA 4J9NA 1J2XA 4DZPA 1FLIA 1O3SA 1A04A 3PO3J 4J19A 5DCFA 4CO8A 4O3MA 3SZPA 3PJRA 5F08A 4E7SA 2IA6A 2Y0SA 2C28A 3HUGB 4MEXF 2YCHA 5KNLA 2JA8J 4IWYA 2P7CB 2MABA 3LAPA 3QFFA 2YU3A 3H3VH 4XM3A 4BBRJ 5B1BH 2FK1A 2N8GA 2V4JC 1VQKI 2DAOA 1K4SA 3BJOA 1TA8A 4LIVA 5HBRB 3RTRA 2M0CA 1RYSA 3SJMA 2CMPA 1RJRA 1QVTA 1DDNA 4GRIA 1E0EA 5L1KA 2CJJA 2JUCA 2X48A 3M8JA 2ZMEC 4HA8A 3HUGA 4XICA 1MH3A 3WGGA 3P9IA 1XSDA 4L9TA 2D5VA 3DBLB 2XRLA 2L01A 1X1AA 3FMSA 3CCEI 1GSHA 4D5CA 3GQCA 2DA5A 1HR0H 1SYXB 5K5OA 3ZQLA 4LH7A 2JEGA 2I8DA 2PG4A 3WGIA 3ZMUA 1ZKGA 2ECCA 4YIRX 1BM9A 3VODA 1BW6A 1IN4A 2ISZA 4JI3H 2COMA 3LSRA 1QGPA 2HQRA 2QKLB 2JZYA 1FY7A 3ULQB 5IY5H 3H9QA 3HL2A 2DMUA 2BE5F 3MAJA 4O3RA 1O3TA 5LHHA 3GZ5A 2Z2SB 2NUAB 5HDNA 1B72B 2G7HA 4V2FA 1POGA 3F22A 4FETA 2F4OB 4DL7A 1YG2A 3MD2A 4KN7X 1RPWA 4QJFA 3L9FA 1UHWA 3M1CA 3PO2G 4B43A 5EDWA 3OSNA 3G6YA 5E18F 2KLOA 3MQ0A 4N4NB 4HF0A 1EA3A 5EZHA 5B3SH 3OYKA 1B72A 3V4SA 4O3NA 2OZ6A 3H4DA 3N41B 2PEXA 3Q1KA 1LJ9A 2R93A 4A3CJ 3EYIA 3CDHA 1MJAA 1YFHA 3IUOA 4IF4A 3M9OB 2ZM6H 2E19A 1MBEA 5E3LA 4UVBA 4CYCB 4CZZA 2VN2A 1FKAH 2GLOA 4DYRA 2STWA 3OIPA 4OAZA 4L0YB 1XDSA 1MSFC 4S05A 1BI2A 3MWEA 3TO7A 4JI7H 4I6ZA 2X1EA 2RV8A 4WX9A 5E1ZB 2L9RA 5GPAA 4IRGA 2F4VH 4CYCA 5C3EG 5DQGA 3F8NA 2R86A 2Z16A 3L09A 2Y9YA 4G94A 2CSOA 2K9MA 3J7AY 2Q2EB 3Q8PB 1YI2I 1GXPA 2ATLA 4O2BF 2PN6A 5BS6A 4MHGA 3GZ6A 1G3WA 3BR2A 1PP8F 2V7FA 3GIKA 1C30A 4XR6A 1VS0A 4J9MA 1T0FC 2JA6G 2IP4A 1AWCA 3MKYB 3Q0UA 5KCMA 1SAXA 1ZRDA 1XSXA 5IYDJ 2CV0A 1X1PA 1B6SA 4L5JA 1TW3A 2UWMA 5LP6F 5AIPA 3OUUA 3E0JB 3VB2A 3N97A 2MGQA 4XYMB 2Q2EA 2VBYA 3JAMZ 3BP8A 5LRRA 4M6YA 3S3NA 1D1CA 1Y1VJ 4LLNA 3RFCA 2QQ9A 1BR1A 4A69C 4A3KJ 4ED2A 3WHCA 2UUCH 2HJWA 3HBLA 3CCSI 4FTHA 2W6OA 4CH7A 1R5HA 4UCTA 4LFBH 1IUYA 3FXLA 1NK2P 4NXNH 1JKQC 1KJIA 1NH3A 3FMAA 2M45A 2EZHA 1A5JA 2KL4A 1R5ID 3KYDB 3OYLA 4DW6A 4BXFA 1HDPA 5BPDA 4I76A 4J9PA 1JLLB 2HU9A 1Z67A 2VJ4A 2ASLA 5KFNA 2QVOA 4HPQA 4NUBA 2LLKA 3BG5A 4PK4A 1FIAA 5EWGA 3FM5A 3JREA 2FQ3A 1UFMA 3LA7A 2W82A 1YW7A 1NK3P 2HOTA 2V4RA 2R4GA 2CYYA 2LMDA 2GPSA 1T08B 1JIHA 3KTMA 1XD7A 4XKBA 5J4YA 2IS2A 2EIMH 2DWCA 3GFLA 3K4CA 2R8KA 3M9AA 2FQ4A 2VQGA 3DV8A 1PJRA 3H3ZA 3QPLA 5LBQA 4A3BG 4XLHA 4A3IJ 5FO5A 1FWZA 4B8XA 1I50J 1SFKA 2VJJA 2Y69H 2HGCA 3ASOH 3GV5B 1V5GA 2V1XA 3RJPA 5F0CA 5CYVA 1DP3A 4BY1J 3SHFA 1CQIB 3J80W 3L2PA 2V58A 1JXLA 4PJLA 1RJQA 3K9TA 2EBIA 3TOAA 3HOXG 3FXUA 3CF2A 1Z3XA 3CC4I 5J3LA 4BNCA 4M73A 4X62H 5EEAA 2GIVA 2KIMA 1ZQ3P 4O3OA 3PW2A 1APLC 4O6JA 3KLNA 3QPHA 1TW2A 2W6MA 4UB8C 5CQGA 4A3GJ 4ECUA 1W7PB 4KICA 2A5WA 2MLKA 1DPRA 4RGUA 4H0EA 1FC3A 5FRMA 3TGNA 1B33N 4BEHB 4LK0F 4RLQA 3OSPA 4OX9H 1WCMJ 2AHQA 4OINF 5IYBG 1XMQH 5D8DA 5L9XA 4O3PA 3DWLE 3QQAA 4HSTA 1M0TA 4M7EA 1IG7A 3RB6A 3ASNH 5FJ8G 3QOEA 1OCPA 1UELB 2VBWA 3H1CA 3GZNB 1Y1WG 2JRMA 1PDNC 3QP6A 5CB4F 1CQJB 4BEHA 2CW0F 4DQ2A 3RV4A 3O6BB 1YHQI 1OCCH 4RAFA 2BW3B 1FX7A 2ZFUA 1V9PA 1TWGJ 5ICFA 1RUOA 1R1UA 3A01B 1WFXA 4AVPA 2NRAC 2M05A 4XKVA 4P96A 2VPQA 4UCSA 4JX5A 1O57A 1KJ9A 3LSJA 2E34A 2ISYA 1TP4A 4DR7H 4XBFA 3SE7A 5EG0B 4Q4ZF 4IHYA 2UXDH 4IZZA 3HRTA 3JW4A 4UY8I 3CUQC 1JE8A 2BW3A 1TQPA 1TNSA 1Y8RB 1ETWA 2L02A 3ABMH 3BZ6A 5CPRB 4EV0A 3BG7A 5IT3A 3OYAA 2PVPA 4QWAA 3A01A 2W8KA 3B6CA 2R8IA 1EUCB 2CUZA 4ENMA 5FLXW 2XF5A 2WTFA 3F8FA 1TWCJ 1VKZA 3GIPA 5D6FA 2IP2A 1AU7A 1YIJI 1SFUA 1Z21A 1U9OA 3KE2A 3PR5B 2FPPB 2DT6A 1GXQA 4PUSA 4F52A 4QIWE 3TIGA 4RNOA 4UV8A 2R7LA 3CCYA 3DBRB 3DPLC 4LF7H 3Q0WA 4DJAA 2GPWA 4A3JG 5DUIA 4M6XA 5KFLA 5KFCA 3NEUA 1WVRA 3M9NB 2JPBA 5FLMG 3M3YJ 1S7OA 2V9PA 4N9IA 5KFAA 2E1OA 4IJAA 3GEZA 3KIOA 2DMQA 1FTZA 5KFUA 5LXTF 2C2RA 2RN7A 1RETA 3BQ1A 1TWFJ 2HDWA 3H40A 1TWHA 4HSRA 4X1EA 5KX5F 4M71A 3RYRA 4M9UA 3ZQHA 3KLOA 2QQBA 1JUMA 1SD7A 2R0QC 3K10A 1FOXA 1PX2A 4ZDLA 3E6BA 4EJVA 4HNUA 3CVZA 3PUFA 5HS8A 3BG6A 3LAJA 4APMA 5IP7G 5JI6A 4CA0A 2DFFA 3KZZA 2OU2A 5E79C 1CQTA 2R7VA 2W9CB 1Y0UA 3RYPA 3E1SA 1ZRCA 1FP1D 3PW4A 1F9NA 4ECSA 3BG9A 4UFZA 4BL0B 3M8EA 4M3BA 3ZQIA 2VA3A 4ECYA 4DL2A 3BCBA 4RNMA 1WI3A 5H6RA 2QQAA 5KFRA 2GM4A 3V7CA 2UXBH 3WTZA 1OYYA 5LYJF 3RBDA 1Z77A 2HXIA 2XKPA 2QKMB 2VJ5A 3FX3A 2K86A 1RNLA 1G4DA
chains in the Genus database with same CATH topology
5J8CA 3ML6A 2R7DA 1A0IA 4BAYA 4MTDA 3WTYC 4JI5H 2F5EA 1OMIA 2EWNA 1YQAA 4DV3H 1DUXC 4UCVA 4WWCA 2ESNA 4KT5C 3PFIA 5IT9K 4RB2C 2IA1A 1HXDA 5LGNA 4YFXF 1I6XA 1B9NA 3J81Z 4X64H 3K1PA 1R58A 3MEXA 1Z1DA 4U88A 1OYIA 5LRSA 1R00A 1EH6A 4UCOA 2KSWA 3REOA 3MZHA 2KIFA 2M87A 3TO9A 3C1DA 1JGSA 1J0RA 3IKVA 1MZBA 2DU9A 4GO1A 3WE3A 4KIBA 1W5SA 4DV7H 4I7HA 5ICGA 2X0LA 2K7LA 4I02A 2R7FA 2GA2A 3I0TA 3HOSA 1YS6A 4Z2YA 1U5TB 4KIGA 5J6XA 1H0MA 4KMFA 1H9GA 4ON0A 2K27A 4B3RH 3TOBA 1I27A 4CHUA 3RI4A 2PI0A 2ZO4A 4K2EA 1IRFA 1U5TA 2IW5A 1KGSA 2FSWA 3WODF 1ZHSA 3W6JB 2C6YA 3ELKA 2Z33A 2F2EA 1BI3A 5L3CA 4UV9A 1S8NA 4DNCA 3V8LA 4UUVA 4EJUA 3ZMTA 2XAHA 1E4GT 5JFRA 1W4MA 5LHGA 3RPUA 3EYYA 1KU9A 3RIZA 2CWEA 2ZNYA 3BWGA 2MBFA 5DDGA 2OBPA 1RZ4A 1EH8A 5TJJA 3LA3A 5L3FA 1QQIA 1IXSB 2H94A 1P92A 1LDDA 2V9VA 1I94H 2XVCA 4RB0A 3I54A 4L9VA 3OTOH 1C0WA 1S03G 2IJLA 3L00A 1FBQA 3DEUA 4LGWA 2CW8A 3HXLA 2Q2TA 1B4AA 4LJZF 4U0YA 5BPIA 4LH6A 4BHBA 1XMKA 2QYOA 3F8CA 1XB4A 2QBYB 3DKWA 2P5KA 3IRRA 2CQKA 1RIOH 4FHTA 1E17A 1GHCA 4I0AA 3E97A 2QBYA 2FBKA 4P55A 3WTXC 1MJ9A 2GXBA 5FD5A 2O03A 2UXXA 4J0MA 2VONA 4HV5A 3SFZA 1FBSA 1ZG5A 1SYXB 1J5YA 3ZQ7A 2MA3A 2WWYA 3E6CC 4UCUA 4UHTA 1USSA 2KKOA 5A2QZ 1O3RA 5E1XA 4PGGA 3QAHA 1WWXA 2IRFG 4JI1H 5LEKA 3E6MA 3T0YA 4LG0B 3M4IA 4GKKH 5FFXA 1KU2A 3BPVA 3VEPA 2F5DA 2HTJA 3E3VA 3LQRA 2ZNZA 4GGGA 3FMQA 5CVRA 5D4SA 4LG0A 1I1GA 3ROUA 3EETA 3W6KB 1BJAA 1P4WA 1S7AA 3K69A 3H20A 1UHMA 3T1HH 2TDXA 1UCRA 3KEQA 3PQJA 3OOPA 5ILVA 4EGYA 2UUAH 1JHHA 4MGRA 1BC7C 2FRHA 1IN6A 5FPOA 1B6AA 3ERED 3ISPA 2EFOA 4RAYA 1O75A 3ZN0A 2NNYA 4QWQA 2UUBH 3T1YH 2BYVE 1N32H 3WTVC 4CXFA 2O8XA 3D5LA 2JPCA 4HDVA 2W85A 2Q2UA 1UB9A 1FSHA 2QWWA 5KK1A 3GO5A 3M8FA 3GLXA 2RGVA 4XSZF 5FLXK 4JBAA 1WH2A 1YW9A 4G6DA 3N6XA 3KP3A 3GFJA 3BJ6A 5IWAH 3LA2A 1L2ZA 2P8TA 2K86A 3U9GA 4A6EA 3WU0A 3H3UA 1KYZA 2JSCA 3VFZA 3GW2A 5H20A 5D5UB 2XUBA 1XNRH 2VT2A 6PAXA 4A2UA 3D0SA 1N34H 2EJRA 1SFEA 1MD0A 4JI6H 2AXLA 3T8TA 4P9FA 4B09A 1HW2A 5D5XB 1QNTA 4F7ZA 4CC6A 4JK1X 1J75A 4U0VA 4JYAH 1H9TA 3VOEA 1S68A 1G6NA 3V7SA 2XROA 1BN5A 4RS8A 1FYLA 4KFCA 3WU1B 1FSEA 1U8RA 2HVRA 3FWEA 3K1NA 3J80Z 3DFGA 4YIIA 2M1BA 3N44B 3HSRA 5CVIA 2ESHA 3Q9SA 1I1SA 4LB5A 1HSTA 2PFBA 3KP7A 4AWXB 1T98A 4LLGF 2GZWA 4P5OA 2LSOA 4G7ZF 1BOAA 1YW8A 1IN8A 1HKTA 2ZBKA 2HDCA 3R6SA 2FBIA 2VBXA 1M0WA 2DPDA 5L3GA 2QM3A 2RGRA 5FGMA 4JV5H 2VOOA 2Y75A 4Y13A 1HW1A 2PMHA 1PUEE 4L18B 5LGUA 1FVIA 1BIAA 4ENKA 3IRQA 5ICEA 4FT8A 4ESFA 4X65H 4YFNF 4ESBA 3RPQA 1ZRFA 4YG2F 1TNTA 1D8KA 1V4RA 3R60A 1QZYA 3WE2A 2O0YA 2XASA 2VUGA 4HV6A 3M7GA 3BA9A 3PQKA 1G3YA 5E1WA 3C7JA 3DPTA 1ZN2A 3SXYA 1ZREA 3MZYA 4HQMA 5H6QA 1S6LA 2HWVA 4JI8H 3L7WA 4OIPF 3IL2A 4A5NA 3AAFA 1HKSA 2WC2A 3CUOA 1I6UA 3F8MA 1SEIA 1WQ2A 2DK8A 2QUFA 3F72A 3LWFA 1SFXA 4ETSA 2R3SA 1E2XA 1DPUA 3U1DA 2G9WA 1ZLJA 3F6OA 4G8XA 2IT0A 4U0WA 4YHHH 5J8FA 4A2AA 1TLHB 1D5VA 2ELHA 3E5XA 3FXRA 5HOOA 4ENJA 1U5TC 2CG4A 2W25A 3LSTA 3MWMA 5HS7A 1V3FA 4KA4A 1BI1A 4NHJA 1AN7A 1IBKH 2H6CA 2Y0MA 3ABUA 1YYVA 2VBZA 1ZH5A 2HVQA 3KP4A 1X9NA 4ZYHA 1B59A 1IXCA 3P7NA 4UVAA 1TQIA 2FU4A 2V6CA 4HX8A 1ONVA 1LEBA 1STZA 1FZPB 4ZZDA 5FD6A 1HNWH 4LB6B 4I0BA 4M9ZA 4OOIA 3HSFA 1D8JA 2Q8KA 2HQNA 4Y15A 5LL6b 4A0ZA 2WYOA 4HW0A 4HDUA 2LF7A 1LVAA 2OZUA 5D5WB 3C0FB 3K3VA 2ADUA 2KIUA 2HHHH 4XLNF 4Q48A 1QZZA 2Z3YA 4CC5A 2FBHA 2PJPA 3DQVC 4RGRA 4A12A 5D5VB 4DV0H 2XHKA 4YIFA 4NQWA 4AQYH 5D4RA 2O6GE 5K1YA 4LLLA 4BYYA 1IF1A 2HYFA 4I2OA 1U6GA 3BJAA 2XKOA 2FMYA 3O2PE 4NXMH 5L3DA 4YY3H 4MTEA 2G7UA 4M74A 1QPMA 4HYEA 4HQEA 3PN1A 3R0JA 2RKHA 1Z6TA 2EA2A 4DR5H 4AIHA 2P5LC 3RGZA 4LF4H 2O61A 1Z9CA 4MNUA 2F5CA 3IC7A 2MLGA 3F8BA 2WDTA 2E1NA 1OPCA 2BV6A 3UQ8A 3KETA 2XGXA 1R1VA 4EFBA 1R23A 3FM3A 3IWZA 4G6QA 2MCTA 2ZFWA 2LNBA 2ZCWA 4LK1F 4A5MA 4R79A 2FNAA 1HNZH 2A3SA 2D1HA 1O3QA 1XDNA 2ZJTA 1O7FA 1JXSA 4NB5A 4KIFA 3BA8A 2HFHA 3E6DA 4B3MH 2W24A 3ECOA 4WXCA 3V7RA 2VXZA 1ZGJA 5L3EA 1O7LA 2KJBA 2MD5A 2L54A 2M5WA 2BBYA 5E20A 3ZP5A 1B9MA 3K2ZA 3CUQA 4WK8F 4BH9A 4ENNA 4MQ9F 4UNOA 5A2QK 4JQFA 3I53A 2A69F 4EJTA 3U2RA 4OIQF 2O3FA 1SMYF 3EDPA 3I59B 4ZYGA 4DR4H 3GF2A 4AD9A 2GA1A 4IAJA 1FPQA 4HX7A 5ERIA 5TRDA 1CF7B 4IHSA 4I09A 1MJBA 2NAZA 3I59A 2V1DA 4UVCA 1CF7A 1P8LA 5KVRA 2RNJA 3RGXA 2WTEA 2VQEH 4MEYF 3M1EA 5IT9Z 3WGHA 1SD6A 4E70A 2XAGA 2P6SA 1N33H 5HLIA 3FMRA 1U78A 3R0AA 1DGSA 3IHUA 1LDKB 3DP7A 5DYMA 2VC0A 3BABA 1XGOA 4GXOA 3TO6A 4PCQA 2Z9OA 4DV6H 1BBYA 2HVSA 4LFCH 1ZG3A 2EV6A 1R5GA 2GAUA 3JSLA 4RB1A 1TAEA 4HLXA 4IHTA 5DEQA 4KMUX 4RGXA 4TV7A 2Z99A 3SZTA 4KN4X 4DR2H 1IBMH 4OU0A 2D2WA 4L5IA 1G3TA 2L3DA 2PLYA 4MQVA 4XSXF 5D8KB 4BHCA 3BAAA 2YPRA 2DQLA 2CW7A 2A68F 2J5PA 2EV5A 4HLYA 2M8EA 3G3ZA 2FA5A 3I64A 4LF6H 1R1TA 4EM1A 3DF8A 2OAZA 1T39A 3S2WA 5AONA 2FNPA 3GWZA 1LEAA 3CO6C 1AOYA 2KRFA 5F64A 3TDZC 2AS5F 4L9NA 1WI9A 3O3KA 1Z2NX 3HTSB 4OIRF 3HRSA 3QRFF 1HNXH 2H09A 4WF2A 4Q5SF 4DR1H 2MC3A 5DCMB 2ETHA 3GVAA 1LQ1A 2FMLA 4EFEA 5HLGA 2WE6A 1IZ1A 4UXNA 4DV1H 1Q1HA 2DTRA 4LF5H 5ILUA 3F3XA 3HHHA 4OMZA 5DCMA 3FHZA 3RTXA 1TBXA 1MGTA 4S04A 5JVTA 2P5VA 5CVVA 4PZJA 1HW5A 1B1BA 3JAMK 1BC8C 3BROA 4OMYA 1Z91A 2A61A 4N0BA 5ED4A 2HYGD 1RUNA 5EEGA 2UU9H 1I5ZA 3TDUC 1TQMA 2HS5A 2YX7A 4DV4H 2LDUA 3BPXA 2VODA 3COAC 4BHPA 3KXYT 5A2QW 4A0XA 4B3TH 1ODDA 4X66H 1IW7F 4D0PA 4DUZH 4LMYA 1WRJA 4KUMA 4Q47A 1T6SA 2L4MA 2A5YB 3NQOA 4RAZA 4A6DA 1IN7A 4U7DA 1F1ZA 2E1CA 2JTVA 1BGWA 1KYWA 2IA2A 4EGZA 2Z5UA 4WCGA 5K5RA 3KALA 4LD5A 3CTAA 2V79A 3N4MA 1YTYA 1R22A 3R61A 3F23A 1YO5C 5DD4A 5EEHA 4M9SA 1ZLKA 2UXCH 4EJOA 3K1MA 2VC1A 2HOEA 1PP7U 3CJNA 2YSRA 2QLZA 3ZMVA 4HOBA 1LDJA 4WXHA 3FF5A 3SQNA 1U2WA 3RJ0A 5HS9A 4GCVA 5L3BA 5DUKA 1IAWA 3EUHA 3EQLF 1OR7A 5BQTA 2X4HA 4DUYH 2XIGA 1KU7A 1ZAOA 4FM9A 1HKQA 1XN7A 4M9XA 3FZVA 3FXQA 5HLHA 2GQQA 2W84A 4K0KH 1SD4A 3ECHA 3GFMA 4AIKA 4HX4A 4MV7A 3C3WA 3CLOA 1ZHQA 2K4JA 3HSEA 1S3JA 4JI2H 1ZYRF 4O5VA 5ICCA 4EQQA 4L0ZB 5JHUA 3HRMA 1FT9A 4A2BA 3GXOA 3F6VA 1ZARA 3LMLA 4G7OF 1XMOH 4CDGA 1ZG1A 3J7AK 1WKMA 1EH7A 4PDKA 3RF2A 2EK5A 5FLXZ 1RI7A 1HBXG 5HDKA 2DO7A 5CJ9A 1YLFA 3JSOA 2CFXA 1F4KA 1USTA 2ZJ2A 5LMNH 1Z2PX 3KEOA 4KYWA 2Q0OA 3WTSC 4ZYEA 4R1HA 1K6OA 3T8RA 2BEOA 5JR3A 3V8KA 2W57A 2HTSA