4ETSA

Crystal structure of campylobacter jejuni ferric uptake regulator
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
146
structure length
141
Chain Sequence
ENVEYDVLLERFKKILRQGGLKYTKQREVLLKTLYHSDTHYTPESLYMEIKQAEPDLNVGIATVYRTLNLLEEAEMVTSISKKYELANKPHHDHMICKNCGKIIEFENPIIERQQALIAKEHGFKLTGHLMQLYGVCGDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Metal binding protein
molecule keywords Ferric uptake regulation protein
total genus 40
structure length 141
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4etsA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4etsA02
5FFZA 3WU1B 1YQAA 3M7GA 1BM9A 1FC3A 2HGCA 1U2WA 3IRRA 3I54A 3GFIA 1HXDA 4GGGA 4ENNA 1P4XA 5LBQA 4CXFA 1XGOA 2CYYA 3ZMVA 3GZ6A 3L7WA 2LF7A 2VOOA 3WGIA 1KU3A 3KP2A 5HDKA 1J9IA 3R4KA 2LNBA 3TOBA 3Q9VA 3BZ6A 2IVMA 3C3WA 5JI6A 4I98B 3CJNA 1JHHA 1UHMA 2EB7A 4PCQA 2VBWA 2W57A 3F8MA 4ETSA 3RPQA 3SQNA 1SD6A 1YO5C 2D1HA 4IF4A 4HBLA 4ZZLA 4DNCA 3FZVA 2PLYA 4UV8A 3M9AA 4RGRA 3WTTC 3WODF 1IXSB 2DPUA 2Z9OA 3M1EA 3WTUC 3T0YA 4XLPF 4L9NA 1O3TA 3TQNA 3WE3A 3J81Z 4U7BA 4IVNA 3BDDA 3C7JA 2NNNA 2ADUA 4AWXB 2PEXA 4B09A 5HDNA 3C1DA 1YW7A 3V8LA 5CVUA 1FYKA 2JZYA 1E2XA 5FFXA 1ZH5A 2HEOA 5E8GA 3DFGA 4Q48A 3RKXA 4LFUA 4BHBA 5ICGA 3F8BA 1GHCA 1WWXA 4P55A 4ASNA 3MCZA 3N4MA 3GUDA 3LA2A 1CGPA 1B4AA 2ZBKA 2Z33A 2Y48A 2X4HA 2ISYA 3U9GA 1IW7F 1G3YA 5K5QA 1P4AA 1STZA 3K69A 2OQRA 4HX8A 5KK1A 3PFIA 2FMLA 4AD9A 4RB3C 4JQFA 1R1TA 1EH8A 4MTEA 1S8NA 2A61A 1T38A 2HFHA 2JT1A 3L9FA 4CHUA 4ESFA 2RGVA 3SZTA 4IRGA 3M8FA 2HR3A 3ZPLA 3JTGA 5LRRA 3MEXA 1ZRDA 1J75A 2GXBA 3WTZA 3TDUC 4I2OA 3DXJF 4L18B 2BGCA 2FMYA 1ZGJA 5JVTA 4NB5A 4ON0A 1U6GA 1SD7A 4EJUA 3LQQA 4FX0A 1KQ9A 1RIOH 2CO5A 2M30A 3HRTA 4B8XA 2MC3A 5D8KB 4BAYA 1PUEE 5EEHA 1ZREA 3TO9A 3NEUA 4G7HF 2VT2A 3KEOA 5AIQA 1GXPA 2PG4A 1DPRA 1R22A 1JGSA 2CFXA 4L9VA 3BJ6A 3EETA 3BP8A 3IRQA 1XCBA 3CTAA 2QUFA 1SFXA 5KVRA 4QLCU 1LB2A 4RGUA 3LAPA 1D3YA 3E5QA 2VODA 2OA4A 3FWEA 3HTUA 5DCFA 1T6SA 1B1BA 2A07F 4M6YA 1IN6A 2XUBA 5D6FA 3GO5A 4BHPA 1T0FA 3BPVA 4A5NA 2EV0A 3F8NA 2UZKA 1BBYA 2W24A 5E1WA 3P9CA 1FBQA 3FM3A 2DTRA 4KN4X 1I1SA 2HYFA 3RI4A 1YYVA 2L54A 2XAHA 3EDPA 1C0WA 2LSOA 4UHTA 5LGUA 1O3RA 3CUQA 1LDDA 5LLQA 3T5XA 2XASA 2VBXA 2RV8A 3TKYA 2L4MA 3ZP5A 4CZZA 1OYWA 4L0YB 2CG4A 1SD5A 1QNTA 2EFNA 2MBFA 4IJAA 3NQOA 1FBUA 5ILSA 1R1VA 3FMSA 1HBXG 2ZFWA 1USSA 4KICA 2HS5A 4G7ZF 3BROA 2WWYA 2GQQA 1ZG1A 2K4BA 2FA5A 4WXCA 3TO7A 1U8RA 3KCCA 5CVRA 2K86A 2NS0A 3RYPA 1RUNA 5ICEA 3FHZA 3CLOA 2Y75A 3LQRA 2OAZA 3QU3A 3VB2A 5ILVA 3HUGA 4UV9A 3DPLC 4KFCA 2UWMA 1TQPA 3ERED 2XAGA 4IHTA 3HSRA 5H6QA 2BV6A 1ZLJA 2EK5A 5D5VB 4L5IA 3I53A 2OZUA 3HRUA 1USTA 1K79A 1T39A 2ZNZA 1YFHA 3MQ0A 2W85A 1L0OC 2FEZA 2FNPA 2F5CA 5CJ9A 4OU0A 3CO6C 2VBYA 1W7PB 2E1CA 1OPCA 1S3JA 1YIOA 3CUQB 1B59A 4MEYF 4M9SA 1ON1A 2QM3A 3FM5A 1W5SA 4G94A 1JE8A 5FD5A 1AOYA 3KFWX 2M1BA 4UUVA 2E7XA 2Q2EA 5LEJA 3EYIA 3E5XA 4PGHA 4WWCA 4KIFA 1BI1A 1B9NA 3GFJA 5DUKA 2P7CB 2IA0A 5LHGA 2ZXJA 3M8EA 2X0LA 1H9TA 3PQJA 3N97A 3O3KA 3E6BA 1WRJA 4MHGA 5BQTA 1IN4A 2G7UA 3HHHA 2DT5A 1V3FA 1FBSA 3HRMA 3B73A 3GZ5A 1RUOA 3ULQB 3L09A 2STWA 1QBJA 2GIVA 3C18A 5DV5A 1FPQA 2Z99A 3J81K 3H92A 2HTJA 5IT9K 3GVAA 4P96A 1YS7A 1O3SA 5DEQA 4WXHA 1XGSA 2F5DA 1HSTA 2PQ8A 2RVCA 2AXLA 2F5EA 3RIRA 1PP7U 2AS5F 1PDNC 1FP2A 4HAMA 2V6CA 1LDJA 5ED4A 2EFOA 4XLNF 1OYYA 4I02A 4HV6A 2DK5A 4I09A 2HQNA 4XRFA 2D1VA 2FOKA 2IA1A 4YG2F 2DK8A 4KIGA 3VODA 1LNWA 2QYOA 2P5KA 2D45A 3DV8A 2C6YA 1LVAA 1TW2A 1U5TA 3MAJA 3ZMSA 5E8IA 4S05A 5TRDA 5BOXA 4LLGF 4FX4A 3SZPA 4ZYDA 2GA1A 3I71A 3TO6A 4MQ9F 3F6VA 3HOSA 1IXRC 3WTXC 1K7AA 3SXYA 1NHAA 2YR2A 2P4WA 3BPXA 5DCMB 5HS7A 2ZCWA 3ZMDA 4A5MA 5L3CA 2V1DA 5D5UB 4JK1X 1WKMA 2LF8A 5ICCA 4L0ZB 3DF8A 2ELHA 3O6BB 4ENKA 2BYVE 3QP5A 4L9TA 2ESHA 2PJPA 3GF2A 5J8CA 4ENMA 5LRSA 1R00A 2V79A 2E1NA 2YU3A 3E6DA 4Z2YA 4A6EA 1TNTA 2EFPA 2O61A 2CQKA 4NHJA 3OOPA 1ZHFA 1XB4A 3VFZA 1TBXA 3B02A 1B6AA 3J7AO 1TNSA 1H9GA 2QVOA 1WQ2A 4I0BA 1QZYA 3T1BA 1YG2A 2Z5UA 3T8TA 2H09A 4LLNA 1FX7A 5CLSA 2RQPA 3R0JA 1RZ4A 4Q4ZF 4K2EA 2V1XA 3ELKA 2H6BA 2XAFA 3S2WA 1UFMA 3H3UA 2VOPA 2P5VA 4A2UA 1B9MA 2MA3A 4G6QA 3RKWA 3WE2A 1P6RA 3F3XA 3HSFA 2EJRA 3EUHA 1Y0UA 1E17A 1XCVA 2L01A 1YW8A 2EV6A 3T8RA 1IN7A 2JSCA 4Y13A 3MFKA 4MTDA 4PDKA 5ILUA 1FT9A 2PBIA 1ZGAA 2COMA 1HKQA 2IW5A 3LFKA 4HF2A 1SD4A 3ROUA 2HKOA 1KU7A 2DPDA 3ZMTA 4R1HA 1ZLKA 2IPQX 2P5LC 4OOIA 1ZRFA 2FQ3A 1SMYF 4YIIA 4N9HA 5FD6A 4RB2C 3K1MA 1QO0D 4GYIA 2O6GE 5F64A 1OMIA 1U5TB 1IF1A 4U88A 3GW2A 4O3MA 1XD7A 4WXDA 2DI3A 3IL2A 3L2CA 2JPBA 3GEZA 4YIFA 2XV4S 4WX9A 2DQLA 1FSEA 4L9JA 4MNUA 3I59B 2P6SA 3ML6A 2FE3A 1W5TA 3ISPA 3ECHA 2YX4A 4EGZA 5E18F 1MDMB 3E5UA 1D8KA 2QWWA 1KYZA 1XGMA 4HX7A 1IRFA 4P9UA 5HDGA 1I6XA 2M8EA 4OIRF 4OIOF 2O8XA 2G9WA 3WTYC 1MDMA 1K78B 4OIQF 3LA7A 5H20A 2D2WA 2XVCA 4U0VA 3E6MA 2DAOA 4MQVA 5LHIA 3WGGA 4XSZF 4U0YA 3QU6A 5DD4A 2Z3YA 2OBPA 1FP1D 5CVVA 2RC4A 2CWEA 5BS6A 4CO8A 2EFWA 2A3SA 1DP7P 2GWRA 3FX3A 4LK1F 1UB9A 4CYDA 3G3ZA 1F9NA 2XKOA 1XDSA 3KETA 3JSPA 3LA3A 4BH9A 4GYGA 4KYWA 3I58A 1U78A 2HQRA 2ZJ2A 2WTEA 2DFIA 3HHGA 1BI2A 1KYWA 4KMFA 2QQAA 4DQ2A 2ZKZA 2Y0MA 4HYEA 4HX4A 4N9IA 4A6DA 4KUMA 4KMUX 2KIMA 3KLOA 1MJBA 1ZRCA 2ZNYA 1ZG5A 5IT9Z 1XMKA 1K78A 3ABTA 1AWCA 2OU2A 5H6RA 2HYGD 1XSXA 3DQVC 2XHKA 3MWMA 5F6FA 2O03A 3LSTA 2VC0A 3LWFA 2HTSA 3RJPA 1W4MA 1Z91A 2A69F 1ULYA 2RDPA 1DPUA 3W6KB 4LLLA 3QPHA 3BOQA 2BEOA 1FZPB 5HS9A 2IT0A 1EH7A 2JTVA 4EVIA 3WU0A 1R23A 1EV7A 4KIBA 4Q47A 1RI7A 3ECOA 4PZJA 1GVJA 4M9ZA 4P9FA 2P8TA 4U0WA 2DLLA 1S7OA 3KZZA 4RS8A 5E1ZB 3HRSA 3HYIA 2PFBA 2G7HA 4I01A 4CICA 3COAC 1FYMA 3F22A 4R79A 4WCGA 1A04A 1ZYRF 3GWZA 2ETHA 1LJ9A 4EJWA 1JXSA 1P2FA 5DDGA 2VC1A 3AAFA 2MLKA 4FT8A 2DU9A 3E97A 1G3WA 1R7JA 3RPUA 2XROA 2MLGA 3KZYA 2HWVA 4HOBA 1IZ1A 3IC7A 2XKPA 2QBYA 5ERIA 4ZYHA 1MJ9A 4F7ZA 2LKPA 5BPDA 1QGPA 3OV8A 3BJAA 1KA8A 4KNYA 3F21A 2XGXA 3KE2A 2JPCA 1J2XA 1T98A 4E70A 3ZN1A 4HLXA 4Y15A 1FLIA 3I64A 4L5JA 1HKTA 3DEUA 4AIHA 2OQGA 2QQBA 3V7CA 1IRGA 4N0BA 4IHSA 1J5YA 1TTYA 4LB6B 1G3SA 1Z1DA 5K5RA 1TLHB 5CVIA 4LG0A 5L3FA 1W7PA 1XGNA 3PQKA 3LAJA 1Z05A 3KP6A 5HOOA 2A5YB 4Y17A 2W25A 4ESBA 3D5LA 4EJTA 3KEQA 2H94A 2GA2A 2VE9A 2FNAA 2EV5A 1F1ZA 2P7VB 2CGPA 1O3QA 5BPIA 3DP7A 4HF1A 1ON2A 4G7OF 1R36A 1G3TA 3V7RA 1XSDA 4WF2A 1ONVA 4FHTA 1K6OA 3QOPA 4ZYEA 3TDZC 5F1RA 2EA4A 1KQ0A 1XN7A 5K1YA 1IXCA 5D4SA 4KT5C 1OR7A 1Z6TA 4RB1A 4M9XA 1R1UA 2M87A 3GFMA 4UNOA 2W84A 4OMYA 4RGSA 1SFUA 3V8KA 1YW9A 2QZ8A 3Q9SA 2QQ9A 2UXXA 2R7DA 5LGNA 2BE5F 1HW2A 3HSEA 4A0YA 1BC7C 3QP6A 3FF5A 2PI0A 2CW0F 3I0TA 3K2ZA 4EM0B 2NAZA 4XSXF 2K27A 2HOEA 1W7PD 4M72A 4GCVA 4O6JA 1D8JA 5HLGA 1J59A 3FXRA 3VOEA 3FMQA 3P9KA 2DBBA 4HDVA 3ZN0A 1Z6RA 2KRFA 3DKWA 1I5ZA 5D4RA 4P5OA 4EM2A 4UVBA 4XBFA 5BMZA 4LJZF 1HW5A 1DDNA 2L4AA 4PGGA 1I27A 4I0AA 2J5PA 1ZARA 3HTSB 2R3SA 2NRAC 1KU2A 2XAQA 5D5WB 3J80K 3QRFF 1D5VA 4O5VA 3GLXA 2O0YA 3K1NA 5AONA 4UVCA 2MH9A 3RTRA 1RNLA 1IN8A 3IWZA 1Z7UA 2YSRA 3SFZA 3CUOA 4HDUA 1UHWA 4OMZA 1WI9A 2FBIA 2HDCA 3K0LA 3ZMZA 3E6CC 2XAJA 3RDIA 1KGSA 5DYMA 4LG0B 3GYHX 2HKXA 2FSWA 1F5TA 3EYYA 4LGWA 1YS6A 3KP5A 2PN6A 4HLYA 1I1GA 3TGNA 2ESNA 3BWGA 2A6EF 1TQMA 1ODDA 2STTA 2ISZA 2F5FA 1Q1HA 5JR3A 5FLXZ 1H0MA 4EJVA 3JAMK 3QPTA 3IWFA 3E3VA 4BXUA 4AIJA 5E17F 2FU4A 2GXGA 3JTHA 2M45A 3G73A 5FO5A 1G6NA 5D5XB 4EGYA 4G6DA 2KIFA 4TV7A 3WG9A 5J8FA 4HQEA 2GAUA 3ZMUA 4RB0A 3K9TA 3JW4A 1ZAOA 1SAXA 4BYYA 4M71A 2IA2A 3HOTA 2VE8A 2H27A 2WV0A 2B0LA 5K5OA 4AIKA 1O7FA 3KP7A 2DQRA 2FF4A 1WSUA 1U3EM 5HVQC 3GXOA 3WTWC 4UXNA 1BOAA 1FWZA 2RN7A 4UVAA 1JHFA 2VONA 1LDKB 4M73A 4A0XA 2KIUA 4LMYA 4M6XA 4EQQA 1QQIA 3ABUA 4RAZA 2EWNA 5A2QZ 3J80Z 4A12A 4YFXF 3V4GA 2VN2A 2H6CA 3FXUA 2KKOA 3I59A 2FRHA 2OD5A 2DW4A 3I5UA 2MH2A 5DUIA 1EH6A 1PP8F 3IKTA 3SHFA 4M74A 3BJOA 1T2KA 1YTYA 4HV5A 4HW0A 5E20A 3V7SA 1HSJA 4BQAA 1ZN2A 4HZFA 3R61A 3IKVA 4LK0F 2J5OA 1MJAA 3O2PE 2M5WA 3F6OA 4ESJA 5FGMA 2QLZA 2R7FA 2KJCA 6PAXA 4G8XA 3KP4A 1LEBA 3QAHA 1FSHA 4RGXA 4ZYGA 5FB2A 1HQCA 4HF0A 3VEPA 4BNCA 2PMHA 1BIAA 4D0PA 2PMUA 4HQMA 3TOAA 4AVPA 4ZH4F 2XRNA 4S04A 4YFNF 1J7KA 3FXQA 2DO7A 2K7LA 2RKHA 1IUYA 5D6EA 1XSVA 3WGHA 4YFKF 2O3FA 2CSOA 4GO1A 3R6SA 5LGTA 1BI0A 1SMTA 2ZMEB 4LD5A 2K02A 1FY7A 4EMSA 1OKRA 2E7WA 3R60A 1VTNC 2A68F 5ICFA 5L3EA 5AIPA 2KJBA 3JAMZ 4KDPA 3GFLA 5HLIA 1IAWA 1L3LA 4GXOA 2RNJA 4QWQA 5L3DA 1MZBA 2EA2A 1Z9CA 1DUXC 4ENJA 1O57A 4LB5A 3MZHA 3GX4X 3U2RA 2IRFG 1BIBA 5JFRA 5D8LB 2GZWA 4RAYA 1CF7A 1MD0A 3CO7C 1XMAA 1F4KA 1BC8C 1KQ8A 2V1UA 3V8JA 3RYRA 3P7NA 2YX7A 3ZQ7A 3CDHA 2ZMEA 5HS8A 5EEGA 2ACJA 5LHHA 3JSOA 2OZ6A 4H0EA 4I7HA 1U5TC 4EM1A 2Q0OA 2MD5A 3KP3A 2A6HF 3F23A 3Q5FA 3U1DA 2L3DA 2K4JA 5L3GA 2FBKA 4IRHA 3IHUA 2Q8KA 4IRIA 2UXNA 2P6TA 1QZZA 3W6JB 1S7AA 4EV0A 2L02A 4BHCA 2F2EA 4OINF 5HLHA 3FMRA 3REOA 1G4DA 2IJLA 3EQLF 2FXAA 3D0SA 4KN7X 3F8FA 2QENA 2EFQA 4MGRA 1J0RA 2NYXA 5LEKA 1TW3A 5CYVA 5A2QK 3R0AA 4A0ZA 5L3BA 1V4RA 3BY6A 2JRTA 1MKMA 4ZZDA 2V9VA 3L00A 5JHUA 5FLXK 4CGZA 2YPRA 3HIFA 4Q5SF 2NNYA 1P92A 2VT3A 1R5GA 2VBZA 2VXZA 5CVJA 1LEAA 3CUQC 1UCRA 2QBYB 3MZYA 1YLFA 1HKSA 2WC2A 1REPC 3RKYA 4WK8F 1IN5A 4NQWA 4IPAA 4EJOA 4MEXF 1CF7B 1S29A 1O7LA 3I4PA 4G9YA 1FOKA 1TQIA 1X3UA 2HZTA 1MGTA 1QPMA 1P4WA 1BJAA 1S6LA 3F8CA 1SFEA 1BI3A 3K1PA 1LQ1A 1HW1A 3NRVA 5TJJA 4HA8A 1KU9A 1R5HA 1BN5A 3P9IA 5DD8A 1ZG3A 4U7DA 1GXQA 4OIPF 3WTVC 1R58A 2TDXA 3H3ZA 5J6XA 1XDUA 4IXAA 1FYLA 3F72A 5E1XA 1OYIA 2XIGA 3WTSC 4R8HA 2LDUA 5DCMA 2ZO4A 3DPTA 2BBYA 2FBHA 4JBAA 2IP2A 4CDGA 4KA4A 3KLNA 1FNNA 5IT3A
chains in the Genus database with same CATH superfamily
2VJ4A 1SEUA 5FFZA 1D1BA 3WU1B 1YQAA 2DMTA 1SFKA 3M7GA 2JQ7A 1BM9A 1Z3XA 4E7SA 1FC3A 2HGCA 1W0UA 1U2WA 4PUSA 3IRRA 3K3VA 3I54A 4A3GG 3GFIA 1HXDA 4GGGA 3S32A 4ENNA 1ZQ7A 2X9DA 1P4XA 5LBQA 4CXFA 1XGOA 2CYYA 3RQ4A 2M7AA 3ZMVA 3GZ6A 4U6PA 3L7WA 2M0MA 2WV1A 2H8RA 2LF7A 3Q8QB 2ZB9A 2VOOA 5KT4A 2KPMA 4IRKA 2W4SA 3H5RA 4NLGA 4RBOA 2N8GA 1V5FA 3M1CA 3WGIA 4A93J 2FB9A 3V42A 2C22A 3J7AK 1KU3A 3KP2A 5HDKA 4ZDLA 2H1KA 4RMNA 1J9IA 2FQ4A 2DDAA 2LFBA 2WBMA 3R4KA 2LNBA 1KZHA 3CF5F 4A3MG 5F0CA 3V4ZA 3OOUA 3TOBA 3LSRA 1YJ9I 1P9QC 2Y9YA 3BQ1A 3Q9VA 2UXDH 2R7NA 3BZ6A 1VFCA 2IVMA 3C3WA 5JI6A 2K85A 4E7JA 4I98B 3H0GA 5C1PA 3CJNA 1E4GT 1JHHA 3MFHA 4NDLA 3CJTB 1OR7C 1UHMA 2DFHA 2EB7A 3QYEA 1EYZA 4PCQA 2VBWA 1N56A 2VKEA 2W57A 2TCTA 2X85A 3F8MA 4ETSA 3RPQA 3SQNA 1SD6A 1YO5C 3ZOBA 1ACIA 3HOXG 3GTOJ 5B66C 2D1HA 2DA4A 4IF4A 2GLTA 5IYBG 4A3KG 2B63G 3PSFA 4HBLA 3PVXA 2R93G 5EYRA 4MV9A 4ZZLA 1UMQA 4DNCA 3FZVA 2PLYA 2IS1A 3FXLA 5DG7A 4UV8A 3GTLJ 3M9AA 3I56I 4RGRA 2PMZA 2P81A 3WTTC 4BWSC 3WODF 1JLLB 1IXSB 3PNVA 5J2UF 2DPUA 2TRTA 4IOCF 3J7AY 4EGJA 4FM9A 3HOYG 4XLHA 4ECVA 2Z9OA 2JWTA 3M1EA 1VBGA 1ETXA 5IY5H 3WTUC 1ITYA 3T0YA 5C8YF 2W6NA 4XLPF 3ORQA 3CCVI 4L9NA 1O3TA 1N32H 3TQNA 3GV8B 3ZR8X 2RF4A 5HBRB 2R8KA 3S15J 2VASA 3JRBA 3CF2A 2XGEA 4MV4A 2WTFA 2BXYA 1PUFA 3WE3A 3J81Z 2ZJPF 4U7BA 4IVNA 3BDDA 3C7JA 4BY7J 2NNNA 2YYAA 2ADUA 2BVMA 5KFDA 4AWXB 2PEXA 4XLFA 1SFOJ 4B09A 5HDNA 3GLKA 2YU9A 1JUPA 1NH3A 3C1DA 1YW7A 4YELA 3V8LA 5CVUA 1FYKA 2JZYA 1WCMA 1UAAA 2R7RA 5LA6F 5L1JA 2OC6A 1E2XA 5FFXA 3RSNA 1ZH5A 4EEFG 2HEOA 2MCTA 5D1OA 2OUMA 5E8GA 3DFGA 1WJCA 4MIMA 2GIZA 4XIDA 4Q48A 3RKXA 2I5UA 4LFUA 4BHBA 5CQGA 5ICGA 3F8BA 1GHCA 3FKJA 4LH7A 1LVKA 5J47A 1WWXA 4P55A 4J01A 4ECUA 4ASNA 1TWHA 1HF0A 1VQ9I 3DTEA 3BA8A 3MCZA 4FS1A 2Q2UA 4BQOA 3N4MA 3GUDA 1X2MA 4X65H 4UY8I 3LA2A 4LIUA 1R9TJ 1CGPA 1B4AA 3MMYB 2LOOA 2E1MB 2ZBKA 2XB0X 2EPFA 2DTZA 3PJRA 2Z33A 2Y48A 2X4HA 4AYBE 2ISYA 3U9GA 1IW7F 1G3YA 4HRIA 5K5QA 5HODA 3JZIA 1P4AA 1STZA 3K69A 2OQRA 1Y1WG 2JEGA 2XF7A 5DG9A 4JI5H 4HX8A 4Y52J 3BCAA 1E0EA 2CUZA 1ZR4A 5KK1A 4RM2A 3PFIA 2HXOA 3CCYA 4PJLA 2FMLA 4AD9A 4RB3C 2ZJTA 1CQTA 2PMZN 5DQGA 4A3LG 1BW6A 2IAIA 4JQFA 1K1SA 4PWQA 3LSPA 4YR3A 1R1TA 4XN3A 3IN5A 2ID6A 3FIWA 2R92G 1EH8A 4X64H 4MTEA 1S8NA 2A61A 5KT3A 2JEFA 1T38A 1VBHA 4JOMA 4D7MA 2HFHA 2JT1A 1N78A 2UUAH 2YL2A 3L9FA 4CHUA 3TEDA 4J0MA 2K9MA 2W6PA 3ZQQA 1X9NA 2UVVA 4ESFA 2RGVA 3SZTA 3BABA 4MO7A 4IRGA 4C2MA 3JCUC 3RV4A 1I6HJ 2VUGA 1W5CC 1ETQA 3M8FA 4EYHB 2NUAB 2DN0A 3K2AA 2CW8A 2HR3A 3ZPLA 3JTGA 1E4EA 5KFBA 5LRRA 1TWHJ 2QKMB 3MEXA 3K4CA 1C3OA 3BLYA 1ZRDA 1J75A 4TQSA 2ALZA 2H8WA 3GIDA 2GXBA 4CCKA 1RKTA 2VJ5A 3TDUC 2KZVA 1MBFA 3DXJF 3WTZA 1R71A 4I2OA 4L18B 2DPJA 1A35A 2BGCA 2FMYA 2JK3A 4II2A 4FS2A 1ZGJA 5JVTA 1ETYA 4NB5A 4ON0A 1U6GA 1SD7A 4XK4A 1T95A 1Y8RB 2NU6B 2BQRA 4EJUA 3LQQA 1X58A 5IP9G 3GQCA 5GPCA 4FX0A 1KQ9A 3OYHA 1RIOH 2VA3A 2CO5A 2M30A 2IGKA 5B3SH 1VI0A 4B3AA 1XG1A 2PMZE 2OWOA 2JA6G 1JKPC 1WJ5A 2DT7B 3HRTA 4B8XA 3HKZE 3K4NA 5HV6A 4YR2A 2MC3A 5D8KB 4I99C 4BKXA 5B5EC 2OH2A 4BAYA 3GTQJ 2NOJB 5EEHA 1PUEE 4XMYA 1ZREA 3TO9A 2R6FA 2E19A 3S1MJ 3NEUA 4G7HF 2VT2A 3KEOA 5AIQA 5IOYA 1GXPA 2PG4A 2I8DA 4FASD 4I6ZA 3S1QJ 1DPRA 3PO2J 1NG7A 3PW4A 2L7FP 2M05A 4L1KA 4O3RA 3G6YA 4DZJA 1RYRA 1R22A 3GTJJ 4LF6H 1PYVA 4A3CJ 1JGSA 4BEHB 2CFXA 1X1DA 5KFUA 1ETVA 1Z7LA 2JRMA 1OJLA 4L9VA 5F08A 3TL4X 2CFOA 4WBNF 1TWFA 1L2ZA 2CKZB 3M9OB 2A6TA 5CPRB 1FKAH 4UUSB 3BJ6A 3EETA 3BP8A 3CCEI 5IP6A 4V2GA 2BHYA 2E2HJ 1ZK8A 5KCMA 4ZQIA 1GV2A 1E4EB 3A02A 1Z67A 3IRQA 2HPIA 1XCBA 1GSOA 3CTAA 3PO3G 2V59A 2QUFA 2QF7A 1WR2A 2LH9A 4NXNH 1SFXA 4M3FA 5JLXA 5KVRA 2ZC2A 2WAQA 5GPAA 2X1CA 5D8DA 5L9XA 4QLCU 2K40A 4YR0A 1LB2A 4RGUA 3LAPA 1WPKA 1D3YA 2Z16A 3E5QA 2GM4A 2XCLA 2MFZA 2VODA 1B72A 4I55F 4F4WA 2OA4A 1JIHA 4N4NB 3HKZN 2K9NA 3OHBA 3FWEA 2K3PA 3HTUA 4UB6C 2EIMH 4O4HF 3T5LA 2DMNA 1WVRA 2DCEA 1F5TA 3IP4B 5DCFA 1T6SA 1B1BA 3ZGKA 4M6YA 3HB9A 2V1NA 5H2FC 2A07F 1IN6A 2XUBA 2CU7A 5D6FA 4NC7A 3GO5A 2W00A 4BHPA 5LP6F 1T0FA 3BPVA 2M9HA 4A5NA 1A36A 3OS0A 2Z1DA 2VQFH 2EV0A 5M5YJ 1QZEA 3F8NA 2UZKA 2M2EA 1KJIA 3HGYA 1RETA 3ETJA 5J4YA 3H9QA 3VSKA 1BBYA 3Q8RB 2W24A 4F92B 4CA0A 5E1WA 1RESA 3P9CA 5FLVA 1FBQA 3FM3A 2DTRA 4KN4X 2BVLA 2E2JJ 1I1SA 2W9CB 2Y31A 1S68A 3PW0A 2HYFA 3VPRA 3H20A 5C4JJ 4E4HA 3FISA 3N44B 3CC7I 1JI8A 3RI4A 3K70C 2FLPA 1YYVA 2L54A 2XAHA 4IHVA 1DIKA 3EDPA 3N43B 3N40P 2NS8A 1C0WA 5EOYA 2WE6A 5D1OB 2LSOA 4UHTA 1MNEA 2UVUA 5LGUA 3PFYA 5LD2C 1O3RA 3CUQA 3QODA 2JEJA 1LDDA 1WHUA 4A3FJ 5LLQA 5DM7F 3T5XA 2XASA 2EZKA 4XRSG 4ED3A 2VBXA 2RV8A 1KJ9A 3TKYA 1EJ9A 1V55H 1E3OC 2L4MA 3ZP5A 1RK6A 3FK6A 4CZZA 2EZHA 1OYWA 4L0YB 2CG4A 4JI2H 3JRCA 3OMYA 3B6CA 4TV9F 1I7NA 1Y0NA 1SD5A 1U8BA 3D5RC 3M4OJ 1QNTA 2JJ7A 1WSCA 2EFNA 2LTPA 2MBFA 4IAJA 4IJAA 3BAAA 3NQOA 3K70D 2ME6A 2MW8A 1FBUA 5ILSA 3OYGA 2WDTA 4LF8H 3QPLA 4EBCA 2W70A 3HOVG 1R1VA 5IYDJ 3RZDJ 3FMSA 1HBXG 2VQEH 2ZFWA 3ZRGA 1EKEA 3WO1A 3FMAA 4ABZA 3LSIA 3KALA 5KFWA 2V26A 3AL0C 3OS2A 3OYLA 4C2UA 4NC6A 1USSA 4KICA 2V9PA 2HS5A 4G7ZF 3G6XA 3BROA 2WWYA 5LOVF 2Y2ZA 2GQQA 1LFPA 1ZG1A 3RAXA 2E5NA 3FKIG 4YJ3F 2K4BA 2FA5A 4WXCA 3TO7A 1M7JA 1U8RA 3KCCA 4ECSA 5FLMJ 5CVRA 2K86A 1HDDC 2NS0A 3RYPA 1RUNA 2UUZA 4HR7A 1S03G 2NVQJ 4O3PA 4UUSA 5ICEA 3FHZA 1T94A 2CQ7A 3QOEA 4QIWA 5D1PA 3CLOA 1RYSA 2Y75A 3LQRA 3Q1KA 2LLKA 1JX4A 2OAZA 4XKBA 1Y1WJ 3LL7A 4JI0H 1AA7A 3CMEI 1MBHA 3GBGA 5F27A 3QU3A 5J3LA 3J80W 3JAMW 4MV6A 3VB2A 3KAKA 3OWTA 5ILVA 4Q8FA 3VYRB 3HUGA 2C35B 4A93G 4UV9A 1Y1VA 2V5AA 3KX2A 3MR5A 3DPLC 5L1IA 3OSGA 3BZKA 4KFCA 2UWMA 3LSGA 3T5KA 5E3LA 2IP4A 5EZYF 1TQPA 4NUBA 2X1EA 2KFDA 2MC4A 1KEEA 1ZHQA 2WAFA 2HNHA 1JKRC 4F4ZA 2R7SA 1MMDA 2XRLA 3ERED 4TUYF 2XAGA 4IHTA 3HSRA 5H6QA 4DL7A 2BV6A 2R7LA 4QJFA 1S7EA 1ZLJA 2LR8A 2EK5A 5D5VB 1M0WA 1TWCA 2FK3A 2YZMA 2ZM6H 4L5IA 4IHWA 3I53A 1B33N 3OYJA 2OZUA 1IG7A 4A3IG 1YE9A 1USTA 3HRUA 1K79A 5KFPA 3I4MG 4DV6H 1T39A 2NVXA 2ZNZA 1YFHA 3MQ0A 1SVLA 2W85A 1L0OC 3AYHB 2FEZA 2FNPA 2F5CA 5CJ9A 4OU0A 4L5EA 2L7ZA 3CO6C 1VQ6I 2VBYA 4A3JG 1W7PB 3BJYA 2E1CA 3GMEA 1LUJB 2CZGA 4DL4A 1OCCH 1OPCA 1S3JA 2RQQA 4EBDA 3R5FA 1YIOA 2GLOA 2JVGA 3SE7A 5JUMA 2FJZA 3CUQB 1B59A 5GTHC 2AQFA 3QYFA 5K2MA 4D5FA 2JA2A 3CDIA 4MEYF 2UV1A 4M9SA 5M5XJ 1MMSA 2A5WA 4HQ6A 1ON1A 2QM3A 2WB1A 2BY0A 4BACA 4BY1G 3FM5A 1N36H 1W5SA 2W7OA 1DGRM 3OL4A 4G94A 3PUBA 5FD5A 4IZZA 1JE8A 3HOZJ 1AOYA 2DZDA 2VPSA 3CVZA 4XYMB 1WJEA 3KFWX 2M1BA 2E5ZA 4F93B 4UUVA 3H3VK 2DODA 2E7XA 2Q2EA 5LEJA 2KDZA 3GTKA 2EIJH 3EYIA 3E5XA 1FMWA 4PGHA 4WWCA 5LYJF 4KIFA 3MJFA 3G1MA 1BI1A 3S3OA 4AYBN 1JJ6C 4CC6A 1ETWA 1B9NA 4D1QA 1LKXA 2VPRA 3GFJA 1MBEA 5DUKA 2P7CB 2IA0A 3QZ8A 5LHGA 2ZXJA 3M8EA 4CZCA 2X0LA 2IBDA 3KHRA 1H9TA 3PQJA 3N97A 3O3KA 2W82A 3E6BA 3MKZA 2ID3A 3L2PA 1C30A 4ECRA 4JV1A 2CJJA 3R23A 3RB6A 1WRJA 4MHGA 1A6QA 5BQTA 1Y56A 3K4MA 1IN4A 2G7UA 2X6XA 2DT5A 3HHHA 5E3NA 3VPBA 1M0TA 1V3FA 3MR6A 1HDPA 2KDOA 2V7FA 1FBSA 3HRMA 3B73A 2JA6J 4O3SA 3GZ5A 3BR5A 2JEIA 2AU0A 2CUEA 1D1CA 1RUOA 3P5JA 4Y7NJ 4PSXA 3ULQB 2X6WA 3L09A 1VQLI 1VF9A 2STWA 1SEIA 5JQWA 1O75A 3BG6A 1QBJA 1NTCA 1U0JA 1XC5A 2GIVA 3H0DA 3C18A 1KC7A 2QSFX 5DV5A 1FPQA 2AQEA 3QPSA 4E7ZA 3OYAA 1QRYA 2Z99A 3J81K 3DTKA 1MBGA 2DDBA 4DL5A 4KJZA 4F91B 2DJIA 3MR3A 3T5HA 2FOWA 2HVQA 3H92A 9ANTA 2HTJA 2V58A 5IT9K 3GVAA 3JRWA 4P96A 1YS7A 1O3SA 5CKTA 4WXHA 1XGSA 5DEQA 2F5DA 4ED7A 2BQUA 3G4SI 2YCHA 4ZTFA 1HSTA 4FBTA 2ZXWH 2PQ8A 2RVCA 4Y33A 2AXLA 2F48A 3WHCA 3DBHB 2F5EA 2JA5A 4J9QA 4FE4A 3RIRA 1HCRA 1FOYA 2ZFUA 1JKOC 1ZQ3P 2YU9J 1RR7A 1PP7U 2AS5F 1PDNC 4C9YA 3OYIA 1F36A 1EZ1A 1S0OA 1FP2A 2DFEA 4HAMA 2V6CA 5IP7J 2KISA 1LDJA 5C3EG 5ED4A 2EFOA 2XAUA 4XLNF 3OYEA 2R93A 2KLOA 1OYYA 1IBLH 3T1YH 4I02A 4X62H 3HC7A 4YEJA 3OYNA 2BY1A 2KHMA 4HV6A 2ASLA 2DK5A 4I09A 2HQNA 4XRFA 2K9SA 2D1VA 2FOKA 2P0WA 4BU2A 2IA1A 1ORKA 2AHQA 4YG2F 3W2AA 2DK8A 4KIGA 3CQZA 3HOUG 1SVOA 4JI4H 4HSRA 3VODA 1LNWA 1D0ZA 2P5KA 2EIKH 3DV8A 2QYOA 2D45A 2CV2A 2C6YA 1LVAA 1JT0A 2VQDA 4II3A 2PVPA 1BJZA 1TW2A 3KTMA 1U5TA 3MAJA 1G2HA 4BE1A 3ZMSA 2WAQE 2WAEA 2EINH 4HPQA 5KFYA 3MWDA 3WO0A 2R92A 3GIKA 3TP3A 5E8IA 4S05A 3CJQB 3EUAA 2B9SA 3O8HA 4JX6A 3RCOA 5TRDA 4GFBA 5KG3A 5BOXA 4LLGF 4FX4A 3SZPA 3VMMA 4IR9A 4ZYDA 2R8IA 4DUZH 4FCYA 1CQJB 3Q8SB 1YRNB 2GA1A 5CQEA 2ASDA 3I71A 3TO6A 4MQ9F 3F6VA 3HOSA 2DA5A 4IWYA 1IXRC 2VQLA 3WTXC 1QU3A 3GTOA 1K7AA 3S2HJ 1JT6A 4AUXA 3F0CA 1FIAA 2Y30A 3SXYA 4BBSJ 1S97A 1NHAA 4PDBA 5KFCA 2YR2A 2P4WA 4EYIB 3OSNA 1XMQH 3BPXA 5DCMB 5HS7A 5FRMA 5BR8H 4J19A 4ZTJA 3QQAA 2ZCWA 4KHPH 3ZMDA 4A5MA 3DU5A 5DQHA 5L3CA 4EFEA 2V1DA 5D5UB 4JK1X 2X51A 5K7HA 1I7LA 4YY3H 2NVYA 2R5ZA 4F50A 4B44A 2LBFA 1WKMA 1N75A 3S2DJ 3RAQA 1MSFC 1LPQA 2LD5A 2M0CA 1POGA 2NVXJ 3IH2A 4BBSG 1U9NA 4DR6H 2DMQA 2LF8A 5ICCA 4L0ZB 3DF8A 3U9TA 4YP3A 2ELHA 3O6BB 4ENKA 2BYVE 3QP5A 3VPDA 3OR1C 5LMUH 4ED1A 4L9TA 2PX9A 2ESHA 2PJPA 3GF2A 3MD2A 5J8CA 4ENMA 5LRSA 2VQCA 1R00A 3Q0VA 2KRCA 2V79A 4IHYA 2E1NA 2LKXA 3E6DA 2YU3A 2VKHA 4Z2YA 4A6EA 2VIXA 4M7EA 2V4RA 3U1KA 3D1NI 1AKHB 5DLGA 2OJED 2ZMEC 5EEAA 1SC7A 1V51A 1MMAA 1TNTA 2EFPA 2V6EA 2O61A 2JA7A 3A1YA 5TGTA 4ANJA 2CQKA 4IR1A 1M1EB 5HNFA 4NHJA 3OOPA 2R8JA 1ZHFA 1I3AA 2GBYA 1XB4A 3VFZA 1TBXA 3B02A 3R5XA 1B6AA 3VDXA 3EUKL 1ZTRA 3JRDA 3J7AO 1TNSA 5KFGA 4C3JJ 5KFMA 1K6YA 4NNJA 4MLOA 2C28A 1H9GA 4C30A 2KT0A 2QVOA 1WQ2A 4I0BA 2R8GA 1QZYA 3I3LA 3T1BA 2E2HA 1YG2A 1EA3A 2Z5UA 2ZJRF 4GC6A 2YW2A 2YRXA 3N05A 3T8TA 2H09A 4C3IJ 1VAJA 3Q2OA 2R7QA 4DJAA 4ME6A 2XCAA 2LREA 1HNWH 2HGSA 4LLNA 2RDIA 2J6UA 1KJJA 1FX7A 5LMNH 3PR4A 2FJ1A 4AQYH 2Y0SA 2VUMG 1TWGJ 5JVGF 5CLSA 3H1CA 4X6AJ 4DV5H 1FOXA 4APMA 3KXYT 2RQPA 4HNTA 2OTJI 4IWXA 4LSXA 3KYDB 4OAZA 2ATLA 3S1NJ 3R0JA 3ZQIA 1RZ4A 4Q4ZF 4K2EA 2V1XA 1AHDP 3L4JA 3ELKA 4IEJA 2H6BA 2XAFA 1R6RA 5LXTF 3S2WA 5F04A 3K6GA 1BNCA 1UFMA 3H3UA 2W7NA 2VOPA 4DIQA 2H1LA 2P5VA 4MFEA 4BQNA 1YJNI 3NWTA 1NK2P 2W9BB 2RGRA 1GYFA 1FTTA 4YQWA 4ED0A 4A2UA 4BGDA 4O4IF 1B9MA 2MA3A 4G6QA 5FLXW 3RKWA 3WE2A 1P6RA 2X6OA 3F3XA 3HSFA 2EJRA 1EUCB 1S9FA 3EUHA 1RJPA 1UNNC 1I50A 5I47A 5KG7A 3FXJA 1F43A 1Y0UA 2VI6A 1E17A 1XCVA 2EH3A 5IPAA 2L01A 3IUOA 1YW8A 3KHGA 3CJRB 4A3JJ 2AGQA 2F4MB 2EV6A 3T8RA 3ORRA 3Q8PB 1VKZA 2ZSHB 1IN7A 2JSCA 3GTJA 4G12A 4Y13A 3MFKA 4MTDA 4PDKA 1YIJI 1AN7A 1BGWA 1N48A 4Q44A 1MBJA 5ILUA 2JA5J 1FT9A 3MWEA 2PBIA 1ZGAA 2COMA 1HKQA 2IW5A 3LFKA 4HF2A 2MG4A 3L2RA 1SD4A 3DBRB 3ROUA 3TIGA 4KISA 1ZKGA 5CAEB 2HKOA 2UVRA 4LFAH 1KU7A 3JR9A 1VNDA 3HZJA 2DPDA 3ZXSA 5E79C 3ZMTA 3NAUA 4R1HA 2QSHX 4A3KJ 1VQPI 2B63J 3NARA 1K83A 1ZLKA 2IPQX 2VLAA 2W1OA 4Y4RA 2P5LC 5KFQA 4DBRA 4OOIA 5IYCG 2FQ3A 1SMYF 1ZRFA 4YIIA 3LSMA 4N9HA 3VYUB 5FD6A 4IX7A 4JUZA 4RB2C 4RZRA 3K1MA 1MIJA 1QO0D 5F9LA 2B7EA 3HOZG 4GYIA 4GC7A 3JSNA 2Y0SN 4ECTA 2QQ8A 2O6GE 5F64A 1MH3A 1OMIA 3RV3A 4A3MJ 1JUSA 5EG0B 1U5TB 5IYCJ 1IF1A 2R84A 1YX3A 4U88A 2R7ZJ 1RK5A 4F52A 2F4VH 3GW2A 4O3MA 1XD7A 3H9JA 3PSIA 5JH7F 4TQRA 3EPGA 4WXDA 2GXAA 5CA0F 3WG7H 2DI3A 3IL2A 3SDBA 3L2CA 1UJ8A 3ESWB 1FJGH 2JPBA 4QIWE 3GEZA 4YIFA 2XV4S 4WX9A 3F9KA 3DF7A 2OCCH 4XRMA 3CMMA 2DQLA 1FSEA 4L9JA 4MNUA 3I59B 3DPUA 2W6OA 2BY3A 1QVTA 5B1AH 1B04A 1FJLA 1I3QJ 4B3XA 2L7MP 2P6SA 3JRAA 3ML6A 2FE3A 1YHQI 3FDSA 2FPIB 4QW9A 1W5TA 2IXSA 2E1MC 4BXFA 3ISPA 3ECHA 3JRIA 1HLVA 2YX4A 4UUTA 4FETA 4EGZA 5EJCA 5E18F 3CCSI 1MDMB 2CQYA 1OFCX 3OS1A 4QWBA 3E5UA 4CUGA 4C2MJ 2DA6A 5GAHJ 3RB3A 1TP4A 1D8KA 2WY7Q 4E7IA 1FIPA 4DBQA 2QWWA 3M9NB 3HOVJ 1KYZA 4KITB 4XZ3B 1XGMA 4HX7A 2R5YA 2HOTA 1IRFA 4P9UA 3L2QA 1WJFA 3RFCA 2IMWP 2YRWA 5HDGA 1I6XA 2M8EA 1GDTA 4OIRF 4OIOF 2W8LA 2O8XA 2IGNA 2YS7A 5KFEA 2G9WA 4Y8VB 4CCMA 1PX2A 3QZ7A 3WTYC 1HNXH 4BJ6C 1DU0A 3KHHA 2VA2A 4H4KC 1MDMA 1K78B 4OIQF 3LA7A 1ZGWA 5H20A 2D2WA 1K4TA 2VUMJ 4AM3A 3BA9A 2XVCA 4LSAA 3SI8A 4R8UA 4U0VA 4DV4H 3V6KA 1X1CA 2ZXIA 2UU9H 3E6MA 5K7ZA 4HG2A 2DAOA 3K4LA 5IOZA 3S14J 4KT6A 4OWRB 4MQVA 2X6YA 4DOZA 4A2BA 5LHIA 5FPRA 4HNUA 5FKOA 3WGGA 4Z6YA 4XSZF 4AC0A 4EFBA 1MW7A 3MFIA 4U0YA 2BW3B 3QU6A 3KZIC 5DD4A 3CCQI 2FKLA 3DU6A 4LIVA 2Z3YA 5KG0A 3M9MB 3H4BA 4OX9H 3FBNB 1O4XA 2WB1E 2OBPA 1DGWY 5GP9A 1RC9A 1FP1D 2R5ZB 5CVVA 4ZDPA 1B72B 3H5NA 1Z2PX 2RC4A 5KAIC 2CWEA 4DV1H 5L1LA 3DEWA 3BZCA 5BS6A 2R7UA 4CO8A 4ITVA 2EFWA 1DV2A 2VKVA 4JP0A 2A3SA 2DOFA 2HOSA 1DP7P 1R5ID 4RLQA 4DR2H 1J5EH 1Y1WA 2GWRA 3FX3A 4LK1F 1UB9A 4CYDA 3G3ZA 2FLNA 3CCMI 1F9NA 1JDEA 2ECBA 2XKOA 5EWGA 1XDSA 4LF5H 3KETA 1GT0C 3JSPA 3LA3A 4BH9A 2W9AA 4GYGA 4KYWA 1Y1VJ 1K1QA 3I58A 3CCUI 1U78A 2HQRA 1S72I 2XPUA 4J9NA 4PJJA 2ZJ2A 2WTEA 4HEA2 1XDNA 4ECQA 2IEKA 2DFIA 5KX5F 3HHGA 1BI2A 1IBKH 2HQAA 2CS3A 1GO3E 2YZNA 2F4IA 1KYWA 2DWCA 4KMFA 2QQAA 3I4NJ 4O3QA 4DQ2A 2ZKZA 3MN2A 2X0SA 2Y0MA 2M4KA 3N41B 4HYEA 5KT2A 3D5SC 4HX4A 4QWEA 4N9IA 1VQ8I 5KHDA 5TISC 4A6DA 3C2GA 1M6VA 2VPQA 4Q43A 4KUMA 3OHAA 2QGUA 2HQ5A 3OIPA 2CV1A 4KMUX 2KIMA 3KLOA 3CDLA 5GONF 1MJBA 3IH3A 1ZRCA 1X1BA 2R92J 3PN1A 2IS2A 2ZNYA 1HOMA 2HHHH 1ZG5A 3I4MJ 5IT9Z 1XMKA 1DV1A 1GV5A 1K78A 4A3FG 3GIIA 3ABTA 1AWCA 5KG2A 2FPGB 2OU2A 5H6RA 1XNRH 2HYGD 4IQ4A 1XSXA 3AG3H 3FDYA 1XMXA 2XGDA 1Z2OX 3DQVC 2YZGA 2W6QA 2C2RA 5KFAA 1RJRA 2XHKA 1IJWC 5KFHA 1R9TA 3MWMA 5F6FA 2ZDQA 5IYZF 2O03A 3LSTA 4Y3OA 1IRXA 2VC0A 2IGOA 3LWFA 2UUBH 2HTSA 3RJPA 1X4PA 3PR5B 3H3VH 1W4MA 1Z91A 3W2WA 3EUHC 2A69F 2OCEA 1ULYA 3V6JA 2RDPA 3KHLA 2F5VA 1DPUA 3W6KB 1PK8A 4LLLA 3KIOA 2DJNA 2I87A 3QPHA 4LG3A 5FKKA 3L1PA 3BOQA 5GADJ 3BT9A 3DKXA 3OSPA 1FVIA 5IT9W 2HI3A 2GOXB 2BEOA 1E3PA 1G59A 1FZPB 3MVPA 1JTYA 1VZ0A 3CZ6A 5FJ8G 2R7ZA 4BQQA 4ZDOA 5HS9A 2IT0A 1EH7A 1WJAA 3W3CA 3J81W 2JTVA 4W1UA 4EVIA 3WU0A 4CYCB 4D9JA 5KKNB 1R23A 1V9PA 3GTPA 1EV7A 4KIBA 4Q47A 4O2BF 1RI7A 3E5NA 1U9OA 1BR4A 4RM3A 1JKJB 5IP7G 4XKVA 3ECOA 5HNHA 3S8PA 1KBLA 2E34A 4PZJA 2JA5G 1GVJA 4M9ZA 3N6XA 4P9FA 2P8TA 2EBIA 4JYAH 2QYZA 4U0WA 2LP0A 3A2KA 2QCOA 2FUG2 4UB8C 2ZDGA 2DLLA 3GIQA 1S7OA 2V9KA 2DIKA 4RAFA 3KZZA 3TW6A 2ELKA 3GTPJ 1MNMC 4RS8A 5E1ZB 2D5VA 4QW8A 2HVRA 3W6VA 4C5AA 3JRXA 3HRSA 3HYIA 1IOWA 2PFBA 2G7HA 4I01A 1SANA 4ED8A 3CP2A 3JSLA 4CICA 3COAC 1FYMA 4BUPA 3F22A 4R79A 4JI7H 1N77A 4WCGA 1AU7A 1JGGA 1A04A 3LMMA 4N4OB 1ZYRF 3GWZA 4JX5A 2ETHA 1LJ9A 2RREA 4EJWA 1JXSA 3GILA 4XICA 1P2FA 1WZ2A 2L0KA 3LOCA 3OL3A 1I6UA 1SAUA 5DDGA 2L5QA 2VC1A 4BDYA 3AAFA 1H88C 3LSKA 2NVTJ 2XGQA 2X1DA 5KFFA 2MLKA 2HXIA 4QPQA 5FJ8J 1JDBB 4FT8A 5CA1F 1D0XA 2DU9A 2GPSA 4B48A 1UG0A 1OISA 3G8CA 3BR6A 2KL4A 3E97A 1G3WA 3H35A 4ZI7F 1R7JA 1KJ8A 3RPUA 4YRVA 4XNFA 4GRIA 2XROA 2JUGA 1ZHSA 2MLGA 4LF4H 3KZYA 2HWVA 4HOBA 4NQWB 4XKCA 1IZ1A 3IC7A 1TWGA 5JVDF 4E7LA 3PUFA 3HOUJ 2LKSA 4O3OA 4GKJH 2XKPA 5E3OA 2XF5A 5ERIA 2W48A 4ZYHA 5J1YA 2QBYA 2I80A 3RB0A 1MJ9A 4F7ZA 4IL6C 2LKPA 5BPHA 2ELJA 4IZOA 5BPDA 3K4BA 3GTMA 1QGPA 1KJQA 3V6HA 3RQIA 4A2AA 1HR0H 3HPHA 3OV8A 5C5JA 3BJAA 5KFTA 1KA8A 4KNYA 3F21A 2KMUA 2XGXA 4MA0A 2E35A 4I4TF 2VOBA 3KE2A 3PIOF 1X3ZB 5F1JA 1MMNA 2JPCA 1P8LA 1J2XA 1T98A 4FE7A 3CC4I 4E70A 3ZN1A 5GAEJ 3K5HA 2VKDA 3A4CA 5JHFA 3L2WA 4HLXA 4B43A 4Y15A 1FLIA 2Y9ZA 2G0EA 1DP3A 3OR2C 1IO2A 2L9SA 4JX4A 1WJDA 3SZGA 3I64A 4L5JA 5FKMA 4UCSA 3PZPA 1HKTA 3DEUA 1A9XA 3ERMA 3K7AJ 2EQRA 1Z21A 3RBEA 2ZXHA 1JUMA 1ULZA 4EEYA 2Q1ZB 4AIHA 4D5CA 1W0TA 5F0HA 2OQGA 2QQBA 3V7CA 2E1OA 2LVSA 1PVEA 1IRGA 4RNOA 4N0BA 2O5RA 4IHSA 1J5YA 1TTYA 3FHNA 4LB6B 1G3SA 1Z1DA 3CC2I 3MR2A 1A6IA 5K5RA 1TLHB 3UQ8A 2FK1A 5CVIA 1PJRA 4LG0A 5C1OA 5L3FA 3C2HA 1W7PA 1XGNA 3PQKA 3C2BA 3LAJA 1Z05A 2R93J 3H0GJ 3KPHA 1A0IA 3KP6A 5HOOA 3L2VA 2A5YB 4C5BA 4DV0H 4Y17A 3RBDA 3G2BA 1IBMH 4GKKH 3RTXA 1J09A 2W25A 4F4XA 4ESBA 2JVHA 4J9OA 3D5LA 2C2DA 3M3YJ 2XC9A 5KFSA 4EJTA 2CUFA 3H36A 3S93A 3T5JA 3KEQA 2H94A 1R49A 2GA2A 3ZQCA 2VE9A 2FNAA 1F1ZA 2EV5A 2P7VB 1X1PA 3GIPA 4M3EA 3GTLA 2CGPA 2WA0A 1X3WB 1MSEC 2QSGX 1O3QA 5BPIA 3DP7A 2XC7A 3B6AA 4FISA 1ON2A 4PK4A 4HF1A 5FRNA 4XLEA 2NOGA 4G7OF 1V5GA 1GUUA 1R36A 2EZLA 5BNGA 3T1HH 1W1WE 1G3TA 3V7RA 2XGPA 1WI3A 1XSDA 4WF2A 1MH4A 1TT5B 4FBUA 1KONA 1ONVA 4FHTA 2E71A 2R7WA 2K9LA 5FPOA 3BTJA 1K6OA 1VQ5I 3QOPA 4U87A 3I12A 4ZYEA 3TDZC 3BTIA 3BTLA 5F1RA 1K61A 2EA4A 2YS6A 4QWDA 2LC2A 1KQ0A 2R82A 1XN7A 5K1YA 1IXCA 1OLTA 2ZJQF 4A3GJ 3CCJI 3MKLA 5D4SA 4B3RH 1IC8A 4KT5C 5H80A 3S3MA 3AG1H 3FXOA 4X66H 1OR7A 5IYDG 1Z6TA 4RB1A 4M9XA 1R1UA 2M87A 4DR1H 4XONA 1ENHA 3GFMA 2I8CA 1WH7A 1WH5A 2W84A 4UNOA 4OMYA 1TWCJ 4A3EJ 3A01B 1R4NB 4RGSA 1ZR2A 1IDZA 1SFUA 3V8KA 1YW9A 3HOXJ 2QZ8A 3Q9SA 2QQ9A 2BW3A 2LY1A 2UXXA 2E2IJ 4DV3H 3IAS2 2C00A 2HPMA 4LFBH 4HSTA 4XOTA 1N33H 2R7DA 4XL9A 2LY2A 5LGNA 5KT6A 2BE5F 3BCBA 1HW2A 3V4SA 3HSEA 2I10A 2IA6A 4A3IJ 4A0YA 3S3NA 1TA8A 4QTRA 1BC7C 2W71A 2JA8J 3QP6A 2F4OB 3FF5A 2PI0A 1BR1A 2CW0F 3I0TA 3HG9A 3RKQA 3K2ZA 3A01A 4EM0B 2L7KA 2NAZA 4RUAA 5KT7A 4XSXF 2K27A 2HOEA 1W36D 1W7PD 4M72A 4GCVA 4O6JA 4OAYA 4QIWN 1D8JA 5HLGA 1J59A 3GLLA 1Z77A 3FXRA 3VOEA 1QVUA 3FMQA 1K4SA 5EG0A 4CSWA 2DMPA 4RNNA 1RRJA 4EATA 3P9KA 2DBBA 5KFXA 1JJ8C 4HDVA 1VQKI 3ZN0A 1Z6RA 2KRFA 3DKWA 3AKZA 2RDJA 1I5ZA 1RKWA 3AFHA 2VL8A 2DA7A 5D4RA 1TWAA 2HJWA 3PNYA 4P5OA 1JXLA 4EM2A 5FKNA 4BJ5C 3L2UA 4IRCA 4UVBA 4XBFA 3X2QH 1UC9A 1T0FC 4A3BJ 4RZQA 1UC8A 3LSJA 5BMZA 3UR3C 4LJZF 4PJ0C 3SJMA 3H40A 3BQ0A 1HW5A 1DDNA 1RJQA 2IGMA 1WH2A 2L4AA 2OTLI 4PGGA 1ETOA 1I27A 2WAQN 4I0AA 2J5PA 3BR2A 1T08B 1IRZA 3IG0A 1DU6A 2KZGA 1H8AC 2R0QC 1IV6A 1ZARA 4DR5H 3HTSB 2R3SA 3SEZA 2NRAC 2LBFB 4BY7G 1KU2A 2XAQA 2BZTA 2GOMA 4UCRA 5D5WB 4J9RA 3J80K 3QRFF 1D5VA 4O5VA 3GLXA 3GV5B 2O0YA 2PJRB 3K1NA 3BG5A 5AONA 5F9NA 5K7FA 1W36C 2O8KA 4C2TA 3RF2A 1BJTA 5EZGA 1A5JA 4ED2A 4B3MH 4B3SH 2BXZA 4UVCA 3KAJA 2DFFA 4ECWA 2DXIA 4HNVA 1CQIB 2R86A 2XPWA 2FD5A 2MH9A 3RTRA 3CD6I 1RNLA 1IN8A 3IWZA 4Q45A 1SYXB 1Z7UA 2CW7A 3HOWG 2YSRA 3SFZA 3CUOA 1WCMJ 4ECXA 1E3HA 2JSPA 4HDUA 3G6VA 1UHWA 4OMZA 1WI9A 4YIRX 2FBIA 1B8IA 4B1RA 1WJBA 1GVDA 4XN0A 2HDCA 2XSJC 3AG4H 2DYRH 2EZIA 3K0LA 2NXNB 4I76A 3ZMZA 2OF7A 5EF6A 2YUSA 1JTXA 2R7XA 4DGWB 3E6CC 2V4QA 2XAJA 3RDIA 1GGOA 4AU7A 1KGSA 1LFBA 5DYMA 1Z0XA 4LG0B 2WYOA 3DWLE 3GYHX 2HKXA 5C4XG 2WB1N 3HOYJ 1HC8A 2FSWA 1VQNI 1N25A 3EPIA 3UNGC 4DYCA 3EYYA 3PM1A 1YS6A 3KP5A 4LGWA 2PN6A 4HLYA 1I1GA 2E36A 3TGNA 3ZQLA 4J9KA 4B47A 4S0HB 2ESNA 2J9GA 3BWGA 2W9BA 2A6EF 2V4JC 1TQMA 1ODDA 5EWFA 3FXMA 2STTA 3HBLA 2ISZA 3BC8A 1TZLA 2F5FA 5LL6b 3VSLA 1Q1HA 5JR3A 5FLXZ 1H0MA 2CQQA 4DW6A 3UKGA 4EJVA 2A05A 4AYBA 1H89C 1DGSA 3E7LA 2R8HA 2M4GA 4DYRA 3JAMK 1FMVA 5IP9J 3QPTA 3VYTB 3IWFA 3E3VA 4BXUA 5KG1A 4CCLA 4YJ2F 4AIJA 5E17F 1YJWI 3PW5A 1IUFA 1OCTC 2FU4A 4IHJF 1QHHD 5JLWA 2GXGA 4ECYA 3SEQA 1S5LC 4QSHA 3JTHA 1BL0A 3RGXA 1UELB 3SDGA 1VQ4I 2KRHA 2M45A 2MD0A 5FO5A 3G73A 1G6NA 1ERDA 3L4KA 5D5XB 4EGYA 4G6DA 2MYSA 2VQGA 5GAGJ 4GLXA 2KIFA 2LY9A 3GCMA 4TV7A 2KIQA 3WG9A 5J8FA 2GAUA 4HQEA 4EEQA 5IWAH 3G1OA 3ZMUA 4RAGA 4RB0A 4K0KH 3K9TA 4A3EG 3JW4A 1ZAOA 2O9LA 2EILH 1SAXA 4BYYA 3UFXB 3AG2H 4M71A 4BE0A 2IA2A 2W7PA 2DPIA 1V54H 2W6ZA 3HOTA 2VE8A 4CH7A 2QEXI 1G8XA 3ZQGA 4BBRJ 2LYCA 2WV0A 3SYTA 1Y39A 2B0LA 5K5OA 1UZCA 4AIKA 1O7FA 2H27A 1CE8A 3KP7A 2DQRA 3RIZA 2DOEA 3BR0A 3I9V2 1K83J 2OPTA 2FF4A 2QK4A 3WHBA 3AL0B 1AUXA 1WSUA 1U3EM 5HVQC 3I55I 5KG4A 1YX5A 3GXOA 3WTWC 4DL2A 3J7YJ 4UXNA 3OIOA 3ABMH 2W8KA 4CC5A 1IDYA 4JI1H 1BOAA 4BJTA 1FWZA 3TQTA 4BXXG 2RN7A 4BS9A 4LH6A 4UVAA 1JHFA 1IV8A 3BR3A 2VONA 1LDKB 4M73A 4A0XA 2KIUA 4XOPA 4YAJB 2ZDHA 2XCPA 4LMYA 4M6XA 4EQQA 5M5WJ 2WADA 4G6TB 2DLNA 1QQIA 3ABUA 4RAZA 4DYQA 2EWNA 5A2QZ 2JN6A 3J80Z 4A12A 2GPWA 5FROA 2IBKA 2ME0A 2RAEA 5KFZA 3BG7A 5B1BH 2AXTC 4JYKA 3ASOH 4YFXF 4B4CA 3V4GA 1W96A 2VN2A 2H6CA 5KFIA 3FXUA 2KKOA 2XDVA 4BE2A 1TL8A 4NXMH 3GIMA 3I59A 5KFLA 2R7OA 2XF6A 3OYBA 2FRHA 2OD5A 2NU7B 2DW4A 1IOVA 1VQOI 3K3PA 3I5UA 2WY8Q 3M8JA 5M3FJ 2MH2A 3CMAI 4B3TH 3ABLH 3IH4A 5DUIA 4DL6A 1EH6A 2K9QA 3HGGA 1PP8F 3IKTA 1FTZA 3H4DA 4NC8A 4LITA 3HL2A 2R7KA 4CCJA 3WNZA 3SHFA 4MV1A 2K3FA 4M74A 5J40A 1TC3C 3BJOA 1T2KA 2R7VA 1W93A 4LFCH 4YB8B 1YTYA 4HV5A 4J9MA 4HW0A 5KAFC 3GTKJ 1WFXA 5E20A 5FKLA 3V7SA 2P0AA 1HSJA 2J6TA 4BQAA 1ZN2A 4HZFA 4A3DJ 3R61A 5LFAA 3DCFA 2PBZA 1A31A 3PO3J 3IKVA 1TWFJ 2FK2A 3Q0WA 4LK0F 3BQYA 2J5OA 4RLFA 1YI2I 2DA3A 2MGQA 5F0FA 4BBRG 1MJAA 2IS6A 1X1AA 3O2PE 3NWSA 2NU9B 2M5WA 2NVYJ 2O7OA 4YHHH 3F6OA 3IAM2 3G1LA 4ESJA 1I39A 5FGMA 4IQJA 5C44G 1NG6A 2KSWA 3S1RJ 3BG3A 2QLZA 3H9GA 2R7FA 4XKWA 2KJCA 1GLVA 1X19A 4G8XA 6PAXA 3KP4A 1LEBA 1Y14B 3QAHA 2M3AA 4DV2H 1FSHA 5DGAA 4Q0YA 3ZQHA 4RGXA 4DR3H 5J1RA 4ZYGA 5FB2A 1HQCA 4HF0A 3VEPA 4BNCA 1E4FT 2AGOA 3HOWJ 4JI6H 2PMHA 1BIAA 4D0PA 1OQYA 1TAEA 2PMUA 4HQMA 2BOLA 4E4TA 4UCOA 4XLAA 4M3GA 3J7ZI 5EZHA 4ZJZA 1T3NA 3TOAA 4AVPA 4ZH4F 3JREA 3OUZA 2COBA 1Z3YA 2XRNA 3A03A 4S04A 2NVUB 3JRGA 5EDWA 2JUCA 2JA7J 4YFNF 5DLFA 3LWBA 5J2TF 3GTGA 1J7KA 3FXQA 4XX0B 1CS0A 1BW5A 2DO7A 2K7LA 2RKHA 3E1SA 1IUYA 4O3NA 5D6EA 1XSVA 1P7JA 3MZ8A 3WGHA 4DZPA 2YS9A 3IV5A 1BA5A 2LRDA 4YFKF 5KFOA 3K5IA 2O3FA 2CSOA 3DLAA 3TP0A 4M3DA 5J4VA 1QA6A 1OCOH 3GTMJ 4GO1A 1HA8A 3GTGJ 4O2AF 3R6SA 2FPPB 4XYLB 5LGTA 2XSDC 1BI0A 1SMTA 2HZDA 1S0NA 2FLLA 1S0MA 2ZSIB 1SFOA 2ZMEB 4LD5A 2K02A 1FY7A 3ZQFA 2CUJA 4EMSA 4FTHA 1OKRA 3CMYA 3S17J 3MKWB 2E7WA 2HDDA 3R60A 1QHGA 1OWTA 1VTNC 5KNLA 2KQRA 3GZNB 2A68F 3RJ0A 5ICFA 4XR6A 1MBKA 5L3EA 5EDNA 3ETHA 5AIPA 1IGNA 2W6MA 4ECZA 3W2VA 2KJBA 3JAMZ 1B6SA 1FEXA 2PJRA 4KDPA 3GFLA 2L9VA 5HLIA 4YAKB 3GV7B 4G3IA 4R8UB 2CQXA 2VJIA 1T8IA 1IAWA 4UCTA 1L3LA 4J9SA 1BXRA 5DGBA 4FU0A 4GXOA 2RNJA 5KT5A 4M6VA 2DYSH 3PNTA 2R7TA 4QWQA 2XD4A 2E2IA 2L2OA 5L3DA 2HYJA 5KFRA 1MZBA 2EA2A 4MV3A 3G6EI 5KFJA 1Z9CA 4BY1J 1B6RA 5GTIC 1DUXC 4ENJA 1O57A 1X2NA 4P1WA 1I94H 2LG4A 2CV0A 2FP4B 4ED6A 3TQ1A 1TT0A 4LB5A 2DA2A 3NGDA 3MZHA 2L9NA 3GX4X 3U2RA 3ONQA 2IRFG 1GSHA 3C0FB 4ZC3A 4LOCA 1BIBA 2SCUB 2W9CA 2JA6A 4MV8A 1PUFB 1I50J 4M3BA 5JFRA 3Q0UA 5D8LB 1XS9A 3TINA 2X48A 4IRDA 1ETKA 3MKYB 4V2FA 1VS0A 3TBIA 3GIJA 2VJJA 1SCUB 2NU8B 5EGOB 2GZWA 4RAYA 1LFUP 2CMPA 3BQZA 1CF7A 2Y69H 3HM5A 1MD0A 4F55A 3TIIA 3CO7C 3BR1A 1XMAA 3H5AA 4RA2A 1TWAJ 3ZCOA 3A0BC 4F3QA 1F4KA 3JRHA 2VPLA 1BC8C 5BPFA 1KQ8A 1XMOH 2HVSA 3RZOJ 5FLMG 2CRGA 2OV7A 3R5HA 3KYLA 2V1UA 3V8JA 4QWAA 3RYRA 3PIPF 3RUPA 2K5CA 1ZETA 1BOBA 3P7NA 4PJNA 1YITI 5KG6A 4DR7H 2YX7A 3ZQ7A 3CDHA 3N42B 2MABA 4IHXA 1Y6IA 4A69C 5C44J 2DMUA 2ZMEA 4PFOA 5HS8A 1Z2NX 3SFIA 3G71I 4EG0A 5EEGA 3PW2A 3OYKA 3E0JB 3FXKA 2ACJA 5DTDA 5DM6F 2J6SA 4ZYAA 1MMGA 3PL8A 5LHHA 3JSOA 2PN1A 1YRNA 2OZ6A 1LE8A 4H0EA 3OIQA 4I7HA 3OYMA 1JKQC 3LMLA 1D1AA 1U5TC 4XQFA 5J1UA 3CLQA 2VQHA 4EM1A 1YOVB 2UUCH 2Q0OA 4M9UA 3BQ2A 1B8IB 3Q3SA 1I3QA 3RPUD 4AIDA 4X0GA 4BL0B 3A0HC 3H0GG 2MD5A 4EBEA 1DQUA 4RNMA 1FOWA 4FQGA 4DL3A 4C5CA 1T36A 3KP3A 2A6HF 4MV7A 4C3HJ 3F23A 5C3EJ 3Q5FA 3U1DA 4HYKA 2L3DA 3OSFA 3GTQA 2K4JA 3VWBA 5L3GA 3OTOH 2M8GX 2FBKA 3ASNH 1V5EA 4IRHA 4LF9H 2V9WA 3IHUA 2XB5A 2Q8KA 4J9LA 3KEYA 4IRIA 2UXNA 1LE8B 2P6TA 3K4KA 1QZZA 3W6JB 1UHSA 4BEHA 1S7AA 4EV0A 2L02A 4A3DG 4BHCA 1OCZH 1R4MB 3M07A 5KFVA 2F2EA 4OINF 5HLHA 3N8DA 2M7BA 3FMRA 3REOA 1G4DA 5M3MJ 4UCVA 2MSYA 3M4IA 5E3MA 4BDZA 4DLKA 2CH0A 4DV7H 2IJLA 2ICWG 3EQLF 3DLLF 2ECCA 2FXAA 3D0SA 1V4YA 3HKZA 2Z2SB 4KN7X 3F8FA 2QENA 2EFQA 4MGRA 4W97A 1J0RA 2E60A 2HU9A 2NYXA 5LEKA 5KFKA 1TW3A 5CYVA 3HPGA 5A2QK 1VQ7I 3CP8A 4CCNA 3R0AA 3OUUA 4A0ZA 2KP6A 4A3BG 5L3BA 1V4RA 4UFZA 1EUDB 4IKFA 1ZELA 3BY6A 5CB4F 5DQIA 2UXBH 1SVMA 2JA7G 3OYDA 2JRTA 4JV5H 2CQNA 3PO2G 4X1EA 1MKMA 4ZZDA 3OY9A 2BR0A 3FBIB 2V9VA 5DG8A 2M34A 3HDDA 1XPXA 2HOAA 3L00A 1UG2A 2XPVA 3HJEA 5JHUA 4RUCA 1GLNA 5FLXK 3QYBA 3EPZA 4CGZA 4E6KG 1XTAA 2UXCH 3DEEA 3LSHA 2YPRA 1QPIA 4JI3H 2R7MA 2R85A 2Q2EB 3HIFA 2UVWA 3WU2C 4MFDA 2BHZA 3CCLI 4Q5SF 3VYSB 4IOAF 2NNYA 4ZHQF 3LNQA 4ZOLF 4CCOA 2JA8G 1P92A 2VT3A 4CYCA 1R5GA 4J00A 3O8GA 2VBZA 2VXZA 2VUMA 5CVJA 4TV8F 5KFNA 1LEAA 5EGOA 2XGCA 2E5LH 3CUQC 2AGPA 1MNDA 1T33A 1UCRA 2QBYB 4I50F 4Q8EA 3MZYA 1YLFA 2B63A 1HKSA 5EWEA 3TW7A 4AVZA 2ASJA 2R5YB 2JMWA 2WC2A 1REPC 1GSAA 4XRSA 1S10A 2NS7A 3RKYA 3DBLB 5KG5A 2DOAA 5DS9A 3OYCA 4DR4H 4WK8F 1IN5A 4V19K 1AUVA 4MA5A 4WD3A 5BMVF 2C2EA 3CQZJ 4NQWA 3U21A 4IPAA 4QPOA 5IYBJ 4EJOA 4MEXF 3HEFA 4MAMA 4JV0A 3RGZA 4PSWA 1CF7B 1S29A 1O7LA 4O4LF 3I4PA 3VPCA 1APLC 4G9YA 2FMAA 2R7ZG 3HXLA 1T56A 1FOKA 1TQIA 1X3UA 2QKLB 2HZTA 3QWLA 1RPWA 2FX0A 1MGTA 4RDUA 2VR1A 4YBZB 2LMDA 1QPMA 1P4WA 4XM3A 1BJAA 1Y8QB 1S6LA 3F8CA 4NBQA 4GDFA 3PW7A 1SFEA 3LFUA 4A3LJ 4E7HA 1VQMI 3BTCA 1BI3A 1XX5A 3K1PA 2AO9A 3JRFA 3K10A 3DTIA 1LQ1A 1HW1A 3DKYA 3S16J 1OCPA 3CCRI 5C4XJ 3FKIA 3QFFA 3NRVA 5TJJA 3K4JA 4UCUA 1EF4A 4HA8A 1N34H 1WGXA 1KU9A 1R5HA 1BN5A 3P9IA 2Q2TA 4JI8H 1BR2A 2LK2A 5DD8A 2VB6A 4XLCA 1ZG3A 3U9SA 4U7CA 5L1KA 2BQ3A 3HUGB 4U7DA 2L9RA 4E7KA 2R4GA 2QA4I 4BXXJ 1GXQA 3BG9A 3WTVC 4OIPF 1WCMG 1HNZH 2OLSA 3FK7A 5A2QW 4EGQA 2Y0SE 4QWCA 3CESA 1RR8C 4A3CG 2AQ4A 1P7IA 1R58A 2TDXA 2RNGA 2IS4A 5JVLA 3H3ZA 1D5YA 2HDWA 5J6XA 1XDUA 4IXAA 1FYLA 4D7NA 4J9PA 3F72A 1X4OA 4PFPA 5E1XA 1EHIA 2R87A 3RB4A 4JV2A 1Q1VA 1OYIA 3OYFA 2XIGA 1S9HA 3WTSC 4R8HA 2DA1A 2LDUA 2DT6A 3ABKH 2BY2A 4XORA 4F4YA 1OCRH 4LF7H 4DUYH 5DCMA 2ZO4A 3TMOA 3DPTA 1Y1VG 4R7RA 2BBYA 2FBHA 2F6CA 4JBAA 5HLTA 2IP2A 2VXDA 1AKHA 5T14A 4CDGA 4KA4A 3FKIJ 3KLNA 4PJMA 1D0YA 4RU9A 1FNNA 3KYCB 3LP8A 3I4NG 1NK3P 1XNQH 4IO9F 5IT3A
chains in the Genus database with same CATH topology
5FFZA 3WU1B 1YQAA 3M7GA 1BM9A 1FC3A 2HGCA 1U2WA 3IRRA 3K3VA 3I54A 3GFIA 1HXDA 4GGGA 4ENNA 1P4XA 5LBQA 4CXFA 1XGOA 2CYYA 3ZMVA 3GZ6A 3L7WA 2LF7A 2VOOA 3WGIA 3J7AK 1KU3A 3KP2A 5HDKA 1J9IA 3R4KA 2LNBA 3TOBA 3Q9VA 2UXDH 3BZ6A 2IVMA 3C3WA 5JI6A 4I98B 3CJNA 1E4GT 1JHHA 1UHMA 2EB7A 4PCQA 2VBWA 2W57A 3F8MA 4ETSA 3RPQA 3SQNA 1SD6A 1YO5C 2D1HA 4IF4A 4HBLA 4MV9A 4ZZLA 4DNCA 3FZVA 2PLYA 4UV8A 3M9AA 4RGRA 3WTTC 4BWSC 3WODF 1IXSB 2DPUA 4FM9A 2Z9OA 3M1EA 3WTUC 3T0YA 4XLPF 4L9NA 1O3TA 1N32H 3TQNA 3WE3A 3J81Z 4U7BA 4IVNA 3BDDA 3C7JA 2NNNA 2ADUA 4AWXB 2PEXA 4B09A 5HDNA 3C1DA 1YW7A 3V8LA 5CVUA 1FYKA 2JZYA 1E2XA 5FFXA 1ZH5A 5D1OA 2HEOA 2MCTA 5E8GA 3DFGA 4Q48A 3RKXA 4LFUA 4BHBA 5ICGA 3F8BA 1GHCA 4LH7A 1WWXA 4P55A 4ASNA 2Q2UA 3BA8A 3MCZA 4X65H 3N4MA 3GUDA 3LA2A 1CGPA 1B4AA 2ZBKA 2Z33A 2Y48A 2X4HA 2ISYA 3U9GA 1IW7F 1G3YA 5K5QA 1P4AA 1STZA 3K69A 2OQRA 4JI5H 4HX8A 5KK1A 3PFIA 2FMLA 4AD9A 4RB3C 2ZJTA 4JQFA 1R1TA 1EH8A 4X64H 4MTEA 1S8NA 2A61A 1T38A 2HFHA 2JT1A 2UUAH 3L9FA 4CHUA 4J0MA 1X9NA 4ESFA 2RGVA 3SZTA 3BABA 4IRGA 2VUGA 3M8FA 2CW8A 2HR3A 3ZPLA 3JTGA 5LRRA 3MEXA 1ZRDA 1J75A 2GXBA 3WTZA 3TDUC 4I2OA 3DXJF 4L18B 2BGCA 2FMYA 1ZGJA 5JVTA 4NB5A 4ON0A 1U6GA 1SD7A 4EJUA 3LQQA 4FX0A 1KQ9A 1RIOH 2CO5A 2M30A 2OWOA 3HRTA 4B8XA 2MC3A 5D8KB 4BAYA 1PUEE 5EEHA 1ZREA 3TO9A 3NEUA 4G7HF 2VT2A 3KEOA 5AIQA 1GXPA 2PG4A 1DPRA 1R22A 4LF6H 1JGSA 2CFXA 4L9VA 1L2ZA 1FKAH 3BJ6A 3EETA 3BP8A 3IRQA 1XCBA 3CTAA 2QUFA 4NXNH 1SFXA 5KVRA 4QLCU 1LB2A 4RGUA 3LAPA 1D3YA 3E5QA 2VODA 2OA4A 3FWEA 3HTUA 5DCFA 1T6SA 1B1BA 2A07F 4M6YA 1IN6A 2XUBA 5D6FA 3GO5A 4BHPA 1T0FA 3BPVA 4A5NA 2VQFH 2EV0A 3F8NA 2UZKA 1BBYA 2W24A 5E1WA 3P9CA 1FBQA 3FM3A 2DTRA 4KN4X 1I1SA 1S68A 2HYFA 3H20A 3N44B 3RI4A 1YYVA 2L54A 2XAHA 3N43B 3EDPA 3N40P 1C0WA 5EOYA 2WE6A 5D1OB 2LSOA 4UHTA 5LGUA 1O3RA 3CUQA 1LDDA 5LLQA 3T5XA 2XASA 2VBXA 2RV8A 3TKYA 2L4MA 3ZP5A 4CZZA 1OYWA 4L0YB 2CG4A 4JI2H 1SD5A 1QNTA 2EFNA 2MBFA 4IAJA 4IJAA 3BAAA 3NQOA 1FBUA 5ILSA 2WDTA 4LF8H 1R1VA 3FMSA 1HBXG 2VQEH 2ZFWA 3FMAA 3KALA 1USSA 4KICA 2HS5A 4G7ZF 3BROA 2WWYA 2GQQA 1ZG1A 2K4BA 2FA5A 4WXCA 3TO7A 1U8RA 3KCCA 5CVRA 2K86A 2NS0A 3RYPA 1RUNA 1S03G 5ICEA 3FHZA 5D1PA 3CLOA 2Y75A 3LQRA 2OAZA 4JI0H 3J80W 3QU3A 3JAMW 3VB2A 3KAKA 5ILVA 3HUGA 4UV9A 3DPLC 4KFCA 2UWMA 1TQPA 1ZHQA 3ERED 2XAGA 4IHTA 3HSRA 5H6QA 2BV6A 1ZLJA 2EK5A 5D5VB 1M0WA 2ZM6H 4L5IA 3I53A 2OZUA 3HRUA 1USTA 1K79A 4DV6H 1T39A 2ZNZA 1YFHA 3MQ0A 2W85A 1L0OC 2FEZA 2FNPA 2F5CA 5CJ9A 4OU0A 3CO6C 2VBYA 1W7PB 2E1CA 1OPCA 1S3JA 1YIOA 3CUQB 1B59A 4MEYF 4M9SA 1ON1A 2QM3A 3FM5A 1N36H 1W5SA 4G94A 1JE8A 2VPSA 5FD5A 1AOYA 3CVZA 3KFWX 2M1BA 4UUVA 2E7XA 2Q2EA 5LEJA 3EYIA 3E5XA 4PGHA 4WWCA 4KIFA 1BI1A 4CC6A 1B9NA 3GFJA 5DUKA 2P7CB 2IA0A 5LHGA 2ZXJA 3M8EA 2X0LA 1H9TA 3PQJA 3N97A 3O3KA 3E6BA 3L2PA 1WRJA 4MHGA 5BQTA 1IN4A 2G7UA 3HHHA 2DT5A 1M0TA 1V3FA 1FBSA 3HRMA 3B73A 3GZ5A 1RUOA 3ULQB 1SEIA 3L09A 2STWA 1O75A 1QBJA 2GIVA 3C18A 5DV5A 1FPQA 2Z99A 3J81K 2HVQA 3H92A 2HTJA 5IT9K 3GVAA 4P96A 1YS7A 1O3SA 5DEQA 4WXHA 1XGSA 2F5DA 2YCHA 1HSTA 2PQ8A 2RVCA 2AXLA 2F5EA 3RIRA 1PP7U 2AS5F 1PDNC 1FP2A 4HAMA 2V6CA 1LDJA 5ED4A 2EFOA 4XLNF 1OYYA 1IBLH 3T1YH 4I02A 4X62H 4HV6A 2DK5A 4I09A 2HQNA 4XRFA 2D1VA 2FOKA 2IA1A 4YG2F 2DK8A 4KIGA 4JI4H 3VODA 1LNWA 2QYOA 2P5KA 2D45A 3DV8A 2C6YA 1LVAA 1TW2A 1U5TA 3MAJA 3ZMSA 5E8IA 4S05A 5TRDA 5BOXA 4LLGF 4FX4A 3SZPA 4ZYDA 4DUZH 2GA1A 3I71A 3TO6A 4MQ9F 3F6VA 3HOSA 1IXRC 3WTXC 1K7AA 3SXYA 4PDBA 1NHAA 2YR2A 2P4WA 1XMQH 3BPXA 5DCMB 5HS7A 5BR8H 2ZCWA 4KHPH 3ZMDA 4A5MA 5L3CA 4EFEA 2V1DA 5D5UB 4JK1X 4YY3H 1WKMA 4DR6H 2LF8A 5ICCA 4L0ZB 3DF8A 2ELHA 3O6BB 4ENKA 2BYVE 3QP5A 5LMUH 4L9TA 2ESHA 2PJPA 3GF2A 5J8CA 4ENMA 5LRSA 1R00A 2V79A 2E1NA 2YU3A 3E6DA 4Z2YA 4A6EA 4M7EA 1TNTA 2EFPA 2O61A 2CQKA 4NHJA 3OOPA 1ZHFA 1XB4A 3VFZA 1TBXA 3B02A 1B6AA 3J7AO 1TNSA 1H9GA 2QVOA 1WQ2A 4I0BA 1QZYA 3T1BA 1YG2A 2Z5UA 3T8TA 2H09A 1HNWH 2HGSA 4LLNA 1FX7A 5LMNH 4AQYH 5CLSA 4DV5H 4APMA 3KXYT 2RQPA 4LSXA 3R0JA 1RZ4A 4Q4ZF 4K2EA 2V1XA 3L4JA 3ELKA 2H6BA 2XAFA 3S2WA 1UFMA 3H3UA 2VOPA 2P5VA 2RGRA 1GYFA 4A2UA 1B9MA 2MA3A 4G6QA 5FLXW 3RKWA 3WE2A 1P6RA 3F3XA 3HSFA 2EJRA 3EUHA 1Y0UA 1E17A 1XCVA 2L01A 1YW8A 2EV6A 3T8RA 1IN7A 2JSCA 4Y13A 3MFKA 4MTDA 4PDKA 1AN7A 1BGWA 5ILUA 1FT9A 2PBIA 1ZGAA 2COMA 1HKQA 2IW5A 3LFKA 4HF2A 1SD4A 3ROUA 2HKOA 4LFAH 1KU7A 2DPDA 3ZMTA 4R1HA 1ZLKA 2IPQX 2P5LC 4OOIA 1ZRFA 2FQ3A 1SMYF 4YIIA 4N9HA 5FD6A 4RB2C 3K1MA 1QO0D 4GYIA 3JSNA 2O6GE 5F64A 1OMIA 1U5TB 1IF1A 4U88A 2F4VH 3GW2A 4O3MA 1XD7A 4WXDA 2DI3A 3IL2A 3L2CA 1FJGH 2JPBA 3GEZA 4YIFA 2XV4S 4WX9A 3DF7A 2DQLA 1FSEA 4L9JA 4MNUA 3I59B 1B04A 2P6SA 3ML6A 2FE3A 1W5TA 3ISPA 3ECHA 2YX4A 4EGZA 5E18F 1MDMB 3E5UA 1D8KA 2QWWA 1KYZA 1XGMA 4HX7A 1IRFA 4P9UA 5HDGA 1I6XA 2M8EA 4OIRF 4OIOF 2O8XA 2G9WA 3WTYC 1HNXH 1MDMA 1K78B 4OIQF 3LA7A 5H20A 2D2WA 3BA9A 4LSAA 2XVCA 4U0VA 4DV4H 2UU9H 3E6MA 2DAOA 4MQVA 4A2BA 5LHIA 5FPRA 3WGGA 4XSZF 4EFBA 4U0YA 3QU6A 5DD4A 2Z3YA 4OX9H 2OBPA 1FP1D 5CVVA 1Z2PX 2RC4A 2CWEA 4DV1H 5BS6A 4CO8A 2EFWA 2A3SA 4DR2H 1DP7P 1J5EH 2GWRA 3FX3A 4LK1F 1UB9A 4CYDA 3G3ZA 1F9NA 2XKOA 1XDSA 4LF5H 3KETA 3JSPA 3LA3A 4BH9A 4GYGA 4KYWA 3I58A 1U78A 2HQRA 2ZJ2A 2WTEA 1XDNA 2DFIA 3HHGA 1BI2A 1IBKH 1KYWA 4KMFA 2QQAA 4DQ2A 2ZKZA 2Y0MA 3N41B 4HYEA 4HX4A 4N9IA 4A6DA 4KUMA 4KMUX 2KIMA 3KLOA 1MJBA 1ZRCA 3PN1A 2ZNYA 2HHHH 1ZG5A 5IT9Z 1XMKA 1K78A 3ABTA 1AWCA 1XNRH 2OU2A 5H6RA 2HYGD 1XSXA 1Z2OX 3DQVC 2XHKA 3MWMA 5F6FA 2O03A 3LSTA 2VC0A 3LWFA 2UUBH 2HTSA 3RJPA 1W4MA 1Z91A 2A69F 1ULYA 2RDPA 1DPUA 3W6KB 4LLLA 3QPHA 3BOQA 1FVIA 5IT9W 2BEOA 1FZPB 5HS9A 2IT0A 1EH7A 3J81W 2JTVA 4EVIA 3WU0A 1R23A 1V9PA 1EV7A 4KIBA 4Q47A 1RI7A 3ECOA 4PZJA 1GVJA 4M9ZA 3N6XA 4P9FA 2P8TA 4JYAH 4U0WA 2DLLA 1S7OA 3KZZA 4RS8A 5E1ZB 2HVRA 3HRSA 3HYIA 2PFBA 2G7HA 4I01A 3JSLA 4CICA 3COAC 1FYMA 3F22A 4R79A 4JI7H 4WCGA 1A04A 1ZYRF 3GWZA 2ETHA 1LJ9A 4EJWA 1JXSA 1P2FA 1I6UA 5DDGA 2VC1A 3AAFA 2MLKA 4FT8A 2DU9A 3E97A 1G3WA 1R7JA 3RPUA 2XROA 1ZHSA 2MLGA 4LF4H 3KZYA 2HWVA 4HOBA 1IZ1A 3IC7A 4GKJH 2XKPA 2QBYA 5ERIA 4ZYHA 1MJ9A 4F7ZA 2LKPA 5BPDA 1QGPA 4A2AA 1HR0H 3OV8A 3BJAA 1KA8A 4KNYA 3F21A 2XGXA 2VOBA 3KE2A 2JPCA 1P8LA 1J2XA