4ETSA

Crystal structure of campylobacter jejuni ferric uptake regulator
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
146
structure length
141
Chain Sequence
ENVEYDVLLERFKKILRQGGLKYTKQREVLLKTLYHSDTHYTPESLYMEIKQAEPDLNVGIATVYRTLNLLEEAEMVTSISKKYELANKPHHDHMICKNCGKIIEFENPIIERQQALIAKEHGFKLTGHLMQLYGVCGDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Metal binding protein
molecule keywords Ferric uptake regulation protein
total genus 40
structure length 141
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4etsA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4etsA02
4I2OA 5DUIA 2PI0A 2XAJA 2FOKA 4LG0A 1T38A 5E8IA 1I5ZA 3QU3A 2E7XA 3IRRA 2XUBA 3EETA 3V4GA 2O0YA 3VB2A 3FXQA 4BHCA 4CDGA 2O6GE 1AWCA 1STZA 2H09A 3EYYA 1I6XA 1YTYA 4G7ZF 4RGSA 3TKYA 4KA4A 1BJAA 3H92A 2D1VA 2NNNA 1QZYA 4XLPF 1LEBA 3CJNA 3FX3A 4BXUA 1RI7A 3JSPA 4U0WA 3W6KB 1KYWA 2IA0A 4U0VA 3TQNA 3HTUA 2H6CA 4HX8A 3I58A 1ODDA 2L3DA 3L9FA 4BQAA 2FU4A 3NRVA 3WTVC 2M5WA 3ROUA 3CUQC 4G6DA 4M71A 4KFCA 5E1XA 3PQJA 2XVCA 1Z05A 4HLYA 5LHGA 2HYGD 3GFJA 4RB1A 4G7HF 5FFZA 2IA1A 2RGVA 4HV5A 3K9TA 4I0BA 5D8KB 4CZZA 3M8EA 2P8TA 4LGWA 4KN7X 4I0AA 2RVCA 1UFMA 5CVIA 1FLIA 4UVCA 2ELHA 3DEUA 1OPCA 3RPUA 4R1HA 3GXOA 5D6EA 3M1EA 3ZPLA 2M87A 3EYIA 3F23A 2VBZA 2PFBA 1ONVA 3ECHA 3BDDA 5L3DA 1B59A 3QP6A 2QQBA 3FWEA 1J75A 3K1PA 2LKPA 4HF1A 3CO7C 2FF4A 2EV6A 4KMFA 3FM3A 3LA7A 4EV0A 2DPDA 4ZYHA 3QPTA 1S3JA 1KQ0A 3LFKA 1GVJA 5HLHA 2L54A 1R1UA 5F64A 4I09A 5E8GA 4EQQA 5IT9Z 3CUOA 1TBXA 2ZJ2A 2EA2A 4OMZA 3I64A 4IHTA 4Q48A 1XGNA 1BI3A 4GYIA 1QZZA 3GYHX 2MH9A 3J80K 1XSDA 4YG2F 4TV7A 1LQ1A 2JPBA 4P5OA 3T8RA 4N9HA 4NHJA 3HIFA 2D1HA 1Z9CA 4PGGA 2Z5UA 5LEJA 3C7JA 4KN4X 2FBKA 1G3WA 1ZGAA 5A2QK 2O61A 4O6JA 4GYGA 2YPRA 1I27A 3MZHA 1J7KA 2F5EA 2DQRA 4OIRF 2GWRA 4I02A 3MQ0A 1ZH5A 2QYOA 3M9AA 2HTJA 1PP7U 3COAC 1FP1D 1YFHA 5D5UB 4LK1F 5J8CA 2GXGA 2R7FA 4Y17A 2O3FA 2PMHA 4ZYDA 3T8TA 2CO5A 4CGZA 2HZTA 3HSFA 4R8HA 2L02A 1B1BA 1K78A 3C1DA 1DPRA 2JT1A 2CG4A 2VT3A 2MLKA 1ZRFA 2VE8A 4IJAA 2BV6A 1O57A 2DAOA 2VXZA 2FSWA 4BHPA 2BBYA 2DK8A 3NEUA 3GVAA 3TO7A 4A6EA 3E5XA 1R00A 2IP2A 1YW7A 2D45A 2EFQA 4FHTA 5TRDA 5H20A 5IT9K 1ZAOA 2A68F 2XV4S 1T39A 5CJ9A 3ABTA 3GW2A 4IRIA 1MJAA 2DT5A 2G9WA 3K1NA 2HR3A 2C6YA 2JTVA 2CQKA 3GF2A 5HLIA 3T5XA 1ZG1A 2EV0A 1D5VA 2F5DA 4CYDA 3TO6A 4U7BA 3ZMZA 1S8NA 5LRSA 4N9IA 2KIMA 3IHUA 1GXQA 4IVNA 5L3BA 1KQ8A 4KICA 5HVQC 4Q47A 3WE3A 4EJUA 2A61A 3WE2A 2L4AA 4UVAA 2RC4A 1O3SA 1FYLA 2ZBKA 3HSRA 1B6AA 1SMTA 5A2QZ 2FE3A 3B02A 2FRHA 1S29A 1H9GA 2NS0A 4EVIA 5CYVA 2XKPA 4A0XA 4P9UA 1H0MA 4RGRA 4EJWA 4HA8A 5LLQA 4WCGA 4KDPA 3P9IA 1OKRA 3I5UA 2IRFG 2MBFA 2Z3YA 4ESJA 2DFIA 2H27A 1EH6A 4RAZA 1BI2A 1XGMA 1U5TA 3WTYC 1YO5C 3RYPA 1LB2A 2ETHA 2W25A 4A5NA 1HXDA 3I71A 1K79A 2CW0F 4HF0A 1HW2A 1W7PB 2HOEA 3SQNA 4EGZA 3IL2A 1LNWA 4MTEA 5E17F 2OBPA 4WXCA 4YFXF 4BAYA 2XROA 2EFOA 4AVPA 5CVUA 4NB5A 5K1YA 1JE8A 3L2CA 4L5IA 5LHIA 3F8NA 2RDPA 1LDKB 3DXJF 4EMSA 3ABUA 3RPQA 2CSOA 3SXYA 1OMIA 1WKMA 3IKVA 1K78B 1AOYA 5D4RA 5JVTA 4IXAA 5L3CA 4QWQA 1HKQA 2ISZA 5LEKA 3JTHA 4KYWA 1NHAA 3U2RA 2P7CB 1MGTA 3ECOA 1IN8A 1H9TA 1K7AA 1UHWA 3LSTA 1B4AA 2MC3A 5ICGA 1MJBA 3MCZA 3WGIA 3I0TA 3QP5A 4ETSA 5K5QA 1X3UA 3WTZA 3V8LA 3E6DA 1T98A 5AONA 3REOA 5BQTA 1BM9A 5HS8A 2QBYB 3IWZA 5DUKA 2NAZA 2VN2A 3R0AA 1J0RA 1IN7A 3ZMVA 2BYVE 1FY7A 1T2KA 5FFXA 1YW9A 3JAMZ 5BS6A 2PEXA 3E5QA 4RB0A 2QLZA 3ERED 2FA5A 5FGMA 2V1DA 4HZFA 1ZYRF 4PGHA 4FT8A 4HDVA 3ZN0A 1FZPB 2RQPA 3V7SA 1L3LA 1FYMA 1ZN2A 1U78A 4QLCU 1P6RA 2DBBA 1IZ1A 1YLFA 2RN7A 1R1TA 1YYVA 1MKMA 2XAQA 4GGGA 4P9FA 5ILSA 5ICCA 1KU2A 3CUQA 1TW2A 4WK8F 1BIAA 1O3TA 3HYIA 3F3XA 3WTTC 3BZ6A 5JFRA 2P5VA 3ZMTA 1U5TB 5BPIA 1JHHA 1R23A 3HUGA 1HKTA 5CVRA 3G3ZA 5D6FA 4RGUA 1GXPA 3RKYA 1W7PA 2WV0A 2VC0A 2VODA 1SD7A 2FMYA 1E2XA 2LSOA 1FBSA 4KNYA 3KETA 1GHCA 3LA3A 4ZYEA 3K1MA 2M45A 3LWFA 3HTSB 4ENMA 4WWCA 4XBFA 2IPQX 1R7JA 3BJAA 3KP7A 1KU7A 3TGNA 1UHMA 4HQMA 3VODA 3QPHA 4EJTA 1BN5A 2XGXA 2YU3A 4BH9A 3E6CC 4OINF 4A12A 3EQLF 1HSTA 2OAZA 1F5TA 1YG2A 4KIGA 1SMYF 5ICEA 1F9NA 3MZYA 1BI1A 4HYEA 5DEQA 3ZQ7A 4L9NA 4XRFA 4KIFA 4LFUA 1Z6RA 4PZJA 4M9ZA 3FXRA 4LLGF 2QQAA 2HKXA 2QBYA 3JTGA 2K27A 2P5KA 2QZ8A 3KEOA 1FP2A 3KCCA 2HKOA 1I1SA 1BIBA 5H6QA 4S05A 3U9GA 1LJ9A 4CHUA 3L00A 2DU9A 2NRAC 3KP2A 1V4RA 3FMSA 1E17A 2WC2A 1WI9A 1Z1DA 2VBWA 3F72A 3GWZA 1EH7A 1PDNC 1FC3A 5FD6A 5CLSA 1USTA 1G6NA 4HW0A 2OZ6A 1BOAA 2W85A 4EM0B 4UXNA 4UHTA 3IWFA 3MWMA 2R7DA 1T0FA 1ZGJA 2FNAA 1WRJA 4XSZF 2VBYA 1DPUA 4OIOF 2EWNA 5JI6A 2H94A 2STTA 1XD7A 1ZRDA 3NQOA 4G7OF 1JGSA 2DW4A 4WXDA 3V8KA 2P6TA 5HLGA 1OR7A 4MEXF 4ZYGA 1I1GA 2D2WA 1ON2A 2UXNA 3HOSA 4O3MA 5ICFA 2ZO4A 2X4HA 2Z99A 4IHSA 1F1ZA 4M73A 5DCMA 2QENA 4G6QA 5FLXZ 5K5OA 5BPDA 2KJBA 2Q2EA 1HSJA 5E1ZB 4ENKA 2A07F 3GZ5A 2DQLA 5DD4A 4D0PA 4ENNA 2VT2A 3RI4A 4P55A 4ESFA 3RTRA 1K6OA 2CWEA 2HQNA 4L18B 4O5VA 2V6CA 3R61A 2ACJA 1BC8C 3TDUC 2IJLA 3RDIA 5D4SA 3TOAA 4CO8A 4JBAA 3FM5A 5HDKA 1HW1A 4HBLA 3FMRA 4YIIA 1O7FA 2TDXA 4N0BA 2P6SA 1XN7A 2MA3A 2KRFA 4F7ZA 3JW4A 4HX4A 1XMAA 2IA2A 1IN6A 2YX7A 2J5OA 5HDGA 1ZRCA 1TQMA 3RYRA 5HS7A 2LDUA 3VFZA 1FX7A 2GQQA 5LGUA 2ZKZA 3LAJA 2HEOA 1YQAA 1W7PD 1IN4A 2JSCA 3F8BA 5F1RA 3JAMK 4G94A 1MZBA 1U3EM 4M6YA 2VONA 1XGOA 2MD5A 2ZMEB 3KLOA 3HRMA 5D8LB 3FXUA 5JHUA 3F6OA 3M8FA 2XAFA 3T1BA 3CLOA 2G7HA 1S7AA 3F8CA 1XCVA 3MEXA 4UV8A 3QAHA 2OD5A 2JZYA 2BE5F 3DQVC 4HQEA 3F8FA 2ESNA 1OYIA 5ILUA 3BPXA 3E6MA 4KUMA 2E1CA 1WQ2A 4GO1A 2EK5A 3WGHA 3J7AO 2KIFA 4E70A 5JR3A 1O3RA 3R6SA 1UB9A 1G3YA 4IRHA 5L3GA 2K7LA 3BJ6A 1P4XA 1BC7C 2HDCA 1IN5A 3BOQA 5HOOA 1FWZA 3ML6A 1IXCA 5HS9A 1T6SA 2DLLA 5E20A 2HWVA 4ZZLA 2CYYA 5FB2A 1VTNC 2EB7A 3HRUA 3E3VA 1XDSA 5L3EA 1XCBA 2GZWA 1JHFA 2WTEA 2EFWA 1IXRC 2H6BA 1HKSA 2HS5A 4YIFA 1W5SA 1P4AA 2Q8KA 2P7VB 2E7WA 4EM2A 1R5GA 4Q4ZF 1U2WA 2W24A 2X0LA 2DO7A 4WXHA 4MQ9F 3CTAA 1FPQA 3O6BB 4M72A 4HOBA 3OOPA 3CUQB 3AAFA 4AD9A 4NQWA 4LMYA 3L09A 2EV5A 2GIVA 4MTDA 3IRQA 4EJVA 1G3SA 2ZCWA 3H3UA 4UUVA 1QGPA 1HQCA 5KVRA 3WU1B 3N97A 3GO5A 1XB4A 3V7RA 3KLNA 3E6BA 3J81Z 2Z33A 1JXSA 2OQRA 4LD5A 1PP8F 5E1WA 4PCQA 5FO5A 4BYYA 3H3ZA 2JRTA 3V8JA 2HYFA 2WWYA 1KA8A 2GXBA 3O3KA 1TQIA 2L4MA 1RZ4A 2XAGA 1YS6A 1R5HA 1J59A 5EEGA 5AIPA 4OIPF 3VOEA 3RJPA 2UZKA 4LB5A 4I01A 2PBIA 3FF5A 1FNNA 1KU9A 2OQGA 3KP3A 4R79A 3HRSA 4YFNF 3ZN1A 2UWMA 3J80Z 4Y13A 4YFKF 2Z9OA 4I98B 2IVMA 3TO9A 2ZMEA 2O8XA 2GAUA 1G4DA 3C3WA 3MFKA 1P4WA 4G9YA 3WU0A 5FD5A 3DKWA 3GX4X 3I54A 3W6JB 3O2PE 2AS5F 2YX4A 4A0ZA 5IT3A 3FZVA 4Z2YA 3BJOA 1Y0UA 4ASNA 3FMQA 4XSXF 1Z91A 4ZH4F 2O03A 2DPUA 4ZZDA 1IF1A 1TQPA 1D3YA 2A3SA 1MD0A 5ED4A 1Z6TA 2GA2A 1P2FA 3BWGA 4GXOA 2B0LA 1KU3A 2HFHA 2RNJA 2EA4A 1TTYA 1ON1A 2A6HF 1USSA 1XSXA 1TNTA 2XHKA 1HBXG 1ZHFA 2LF8A 3IKTA 4RS8A 4ON0A 2XIGA 6PAXA 1P92A 2CFXA 3J81K 3ISPA 1ULYA 1ZG5A 1F4KA 4LK0F 3SZTA 4FX0A 3SZPA 2VOPA 1RUOA 3KP4A 2Y48A 3DPTA 1TNSA 5DDGA 1J5YA 2EJRA 4M74A 1FT9A 2Y75A 1S6LA 3ZP5A 1U8RA 3DV8A 5E18F 1U6GA 3R4KA 3C18A 2V9VA 3ZMDA 2YSRA 3GLXA 1OYWA 5J8FA 4MGRA 2IW5A 4MNUA 1SD6A 4U88A 4OMYA 2A69F 5J6XA 3KEQA 2Q0OA 3I53A 3E97A 3BPVA 2HTSA 4IRGA 4KIBA 5DCMB 1RIOH 3KZZA 3V7CA 1U5TC 1SFEA 2MH2A 1LVAA 2A6EF 3GUDA 2IT0A 5ERIA 1MDMA 2J5PA 4PDKA 1XSVA 3GZ6A 1KGSA 5CVVA 2L01A 4M9XA 2K02A 1LDDA 2PQ8A 3SHFA 3KFWX 4G8XA 4U0YA 4IF4A 1OYYA 2JPCA 1WSUA 5LGNA 4M6XA 2DTRA 1FSEA 2P5LC 1SFXA 1XGSA 2PG4A 1FYKA 2FMLA 1XDUA 2XASA 1PUEE 2M30A 5EEHA 3QRFF 4AIHA 3WG9A 3EDPA 5LBQA 1Q1HA 2KIUA 2E1NA 4UV9A 4GCVA 3TDZC 2W57A 2STWA 1SD4A 2F5CA 4L0YB 2PMUA 3WODF 1HW5A 3P7NA 3LAPA 4EM1A 1YIOA 1SD5A 1Z7UA 3F22A 2A5YB 1IUYA 3M7GA 1TW3A 2RV8A 3CDHA 3KE2A 5DCFA 2EFNA 3LQQA 4AIKA 1BI0A 5D5VB 1SFUA 3VEPA 1FBQA 5K5RA 5FLXK 3K2ZA 4JQFA 4DQ2A 4ESBA 2V1XA 3Q5FA 2V1UA 4I7HA 4EGYA 3F6VA 1G3TA 3I59A 2BEOA 1IRFA 2YR2A 3R60A 2W84A 2ZXJA 1WWXA 3SFZA 4BHBA 3WTXC 1KQ9A 1QO0D 4B8XA 4MQVA 4P96A 5DYMA 3KZYA 4KT5C 4AIJA 3T0YA 3GFIA 3HHGA 4LB6B 4L5JA 3K0LA 1V3FA 2F2EA 3MAJA 1TLHB 5ILVA 3RKWA 3R0JA 4CICA 1O7LA 4HV6A 4DNCA 3WGGA 4WF2A 2K4BA 4A0YA 4JK1X 2OZUA 2QUFA 4H0EA 4OOIA 2XKOA 1QPMA 4OU0A 1REPC 3E5UA 3KP5A 1D8JA 2PLYA 1XMKA 2FQ3A 2VC1A 3Q9SA 4LLLA 2V79A 1MDMB 4L9JA 2M1BA 2QVOA 2QQ9A 3LQRA 3QOPA 2PN6A 3HRTA 5KK1A 2VOOA 5D5XB 4A2UA 2GA1A 5BMZA 4RGXA 3D0SA 2OU2A 3GFLA 3RIRA 4IPAA 3HOTA 4U7DA 1RNLA 1ZARA 2ISYA 2QWWA 1MJ9A 4A5MA 2ZNZA 2FNPA 4AWXB 1DP7P 1IW7F 1LEAA 4Y15A 1CF7B 4L9VA 5LHHA 1DDNA 1R36A 4M9SA 1YW8A 3U1DA 1KYZA 3K69A 1ZG3A 2UXXA 1J9IA 4HX7A 4RB3C 1EV7A 3RKXA 4RB2C 4L0ZB 4LJZF 5D5WB 1R22A 3KP6A 1FBUA 3LA2A 5BOXA 4HDUA 1L0OC 5HDNA 4LG0B 3L7WA 1QBJA 4ENJA 2PJPA 2BGCA 1ZREA 4OIQF 5CVJA 1QQIA 3Q9VA 2ZNYA 3N4MA 4CXFA 4XLNF 4RAYA 2EFPA 1BBYA 1IRGA 3BY6A 4EJOA 4WX9A 3ZMUA 2F5FA 3FHZA 2VBXA 3HHHA 2ADUA 3DF8A 1QNTA 2RKHA 3WTUC 1EH8A 5AIQA 2CGPA 3OV8A 1IXSB 1W5TA 5DD8A 4B09A 2NNYA 4HLXA 3PFIA 3WTSC 4HF2A 3I59B 4K2EA 5L3FA 4Q5SF 2VE9A 2COMA 5LGTA 2KJCA 5LRRA 1ZLKA 1SAXA 3CO6C 2OA4A 3F8MA 3I4PA 1J2XA 2M8EA 2ZFWA 4A6DA 1FSHA 4MHGA 1A04A 3ULQB 3D5LA 3EUHA 2XRNA 2DK5A 2G7UA 3PQKA 2AXLA 1O3QA 3TOBA 1R1VA 4KMUX 2MLGA 1W4MA 2FBIA 3BP8A 3ZMSA 4HAMA 2K4JA 2NYXA 1RUNA 1YS7A 3GEZA 1R58A 5F6FA 2XAHA 1FOKA 4FX4A 3BROA 2QM3A 5TJJA 1B9MA 2ESHA 1C0WA 1ZLJA 1S7OA 3P9CA 1UCRA 1IAWA 5H6RA 2LF7A 2P4WA 3B73A 2LNBA 3P9KA 3F21A 3IC7A 5DV5A 4LLNA 3DP7A 4MEYF 3S2WA 3QU6A 3JSOA 4UNOA 2FXAA 1B9NA 2FBHA 1D8KA 1CF7A 2DI3A 1DUXC 3HSEA 3ELKA 4BNCA 2K86A 1CGPA 2HQRA 2KKOA 3WTWC 2HGCA 3DFGA 4UVBA 4S04A 4L9TA 2R3SA 3GFMA 2FEZA 2Y0MA 3G73A 3DPLC 1LDJA
chains in the Genus database with same CATH superfamily
1V55H 2X85A 4I2OA 2WE6A 2XB5A 5DUIA 4FASD 2PI0A 2XAJA 4J9KA 2FOKA 4LG0A 2DCEA 3DKXA 5E8IA 1T38A 1RJPA 2YCHA 5GADJ 5KFDA 1I5ZA 3HOXJ 2I80A 1FIAA 5EF6A 3QU3A 2E7XA 3IRRA 3GQCA 3RQ4A 2XUBA 3EETA 3V4GA 1V54H 4IQJA 1POGA 2ZJQF 3E7LA 2O0YA 4MV7A 5LFAA 3VB2A 3FXQA 4BHCA 4CDGA 1AWCA 2O6GE 3RB0A 4IRCA 1Y8QB 2WBMA 5M5XJ 3OL4A 2R7TA 1STZA 3M07A 4AM3A 3OIOA 2H09A 3R5HA 3EYYA 4C5AA 2DFEA 3MR2A 1ETKA 4DV0H 2KLOA 1I6XA 3IV5A 2DT6A 2LREA 5LL6b 5J1YA 2IEKA 3HOUJ 1YTYA 2W9CB 4FU0A 4G7ZF 2P0AA 4YR2A 4RGSA 3TKYA 5DM6F 4KA4A 1BJAA 4BDZA 5T14A 1X9NA 1VZ0A 3H92A 2D1VA 2KPMA 2NNNA 1QZYA 3LSKA 2A6TA 5TGTA 1B6SA 4ECXA 4XLPF 2Q2TA 1LEBA 4DZJA 3CJNA 2DDBA 2TCTA 1OCRH 3FX3A 3CCQI 1M7JA 4BBRG 2UXDH 4DBRA 4BXUA 1WJDA 1TP4A 2R7KA 2OF7A 4C5CA 2F4OB 1JLLB 1RI7A 3JSPA 1UHSA 4U0WA 3W6KB 1FIPA 3LSHA 1KYWA 2IA0A 3PO2G 4U0VA 3TQNA 3HTUA 1SYXB 2XB0X 2H6CA 3CDLA 5LMUH 4HX8A 3I58A 1ODDA 4ECRA 2ASLA 4LOCA 5IP9J 2L3DA 3L9FA 4XQFA 4BQAA 5K2MA 2FU4A 1S5LC 4UUTA 1W1WE 3NRVA 3A03A 3WTVC 2EIKH 2W6QA 4E7SA 2M5WA 1E3HA 3OSNA 4JX4A 1I6HJ 2LG4A 1T56A 2EZKA 1OISA 3AYHB 4TV8F 2ICWG 4N4NB 4A3GJ 2VQEH 1MH3A 3V6KA 3ROUA 3RF2A 4DZPA 4DL7A 2UUCH 5J2UF 3CUQC 2EINH 2WYOA 4G6DA 1PJRA 2JUCA 4UB6C 4M71A 2W00A 4IRDA 2KZGA 4KFCA 1JJ6C 3T5LA 4CSWA 3K4JA 2H1KA 5E1XA 3W3CA 2HGSA 1OQYA 4YBZB 1E4FT 3PQJA 4UB8C 2W9AA 4A3CJ 2C2RA 4F4WA 1JGGA 2HDDA 2XVCA 5IP9G 2ZJRF 3J7AK 5EWFA 2P0WA 2DLNA 1JKJB 3PZPA 3CDIA 1Z05A 3H1CA 3L2RA 4HLYA 5LHGA 3JZIA 4PJLA 2HYGD 1I3AA 5D1OA 3GFJA 4RB1A 4NC7A 2IBKA 4G7HF 5FFZA 5IPAA 2IA1A 2RGVA 3AG3H 4EEQA 4HV5A 3VYRB 3K9TA 4I0BA 5D8KB 2YL2A 1XTAA 1WFXA 2C00A 4CZZA 2R8KA 2O8KA 1QU3A 1RJQA 3ZR8X 2RDIA 1GUUA 4J00A 3M8EA 2P8TA 2V7FA 1V4YA 4O4HF 3OUUA 4LGWA 4KN7X 4DR3H 4I0AA 5L1LA 4G3IA 2RVCA 1UFMA 5CVIA 5GAEJ 2QQ8A 1FLIA 1D1BA 3HOVG 1VQOI 4UVCA 3RQIA 2IXSA 4JYKA 1RC9A 2ELHA 3KYDB 3DEUA 1SEIA 5IYDG 2N8GA 2UV1A 1OPCA 3RPUA 3LSMA 3BTLA 4R1HA 3OYGA 5KFXA 5BPHA 2WTFA 3GXOA 3T1HH 5D6EA 2QEXI 1VS0A 3M1EA 2PJRA 1UNNC 5DTDA 4J9OA 2NOJB 3ZPLA 2M87A 1DQUA 2E5ZA 2VBZA 3K4NA 4DYRA 3F23A 3EYIA 2PFBA 1ONVA 1QRYA 2BW3A 1AKHA 3ECHA 2CQNA 2MABA 3BDDA 5L3DA 5FKOA 2R7ZJ 2J9GA 1B59A 3QP6A 2QQBA 1U8BA 3OYBA 3FWEA 1J75A 3OTOH 2R5ZA 2L9SA 1XX5A 3K1PA 3PM1A 3S8PA 4L5EA 3OYEA 2LKPA 1HDDC 3UFXB 4JV0A 4HF1A 3FXKA 3MWEA 3JRHA 1C30A 3CO7C 2W7OA 4F4YA 1ZELA 2FF4A 2EIMH 3L2WA 2VQDA 2EV6A 4KMFA 1JKQC 3K4KA 1GSHA 3FM3A 2E2HA 3LA7A 4EV0A 3QYFA 2DPDA 3FKJA 4UCOA 4ZYHA 1PYVA 2GM4A 2IA6A 5JVGF 3QPTA 3VMMA 1S3JA 1VQPI 1YJWI 1KQ0A 4BXXJ 1TWHJ 4BEHB 2VQGA 2VA2A 1ETOA 3LFKA 1GVJA 1BOBA 5HLHA 2F5VA 2L54A 1T8IA 1VQLI 1QA6A 5TISC 4E4TA 1Z2PX 1R1UA 1VF9A 2IBDA 3IAS2 4I09A 4XOTA 5E8GA 5F64A 4B44A 4EQQA 5IT9Z 3RB4A 3HXLA 3CUOA 1TBXA 1GLNA 2ZJ2A 2EA2A 2YYAA 4OMZA 5C1OA 5EZGA 3I64A 5KG2A 4D5CA 3RZDJ 4IHTA 2QSGX 4Q48A 4XKBA 1B6RA 1K83A 1XGNA 1RYRA 2FD5A 1BI3A 5EG0B 4UY8I 4GYIA 1QZZA 3H0GG 3BQ2A 3GYHX 2X1DA 3M3YJ 1O75A 4B47A 2F48A 2WB1A 5KFYA 3MD2A 3CCUI 2MH9A 4GRIA 3J80K 1XSDA 2KP6A 1B04A 5C1PA 4DR2H 4K0KH 4YG2F 1TAEA 4TV7A 1LQ1A 2JPBA 1SFKA 4P5OA 1DGWY 2GLOA 2W6ZA 3T8RA 2F4VH 4N9HA 4NHJA 1W0UA 2AGQA 3HIFA 3GTLJ 2BZTA 2D1HA 3HEFA 5KT6A 1VI0A 3QYBA 1Z9CA 2LFBA 1R5ID 4PGGA 5J2TF 2Z5UA 3CCYA 5LEJA 3C7JA 2IS6A 2R7XA 2LLKA 2LY1A 3OYAA 4E7HA 2O7OA 4KN4X 4XN3A 2FBKA 4IZZA 4M7EA 3S1MJ 2BR0A 4EFBA 4TUYF 1G3WA 5HV6A 1ZGAA 4PK4A 1MIJA 5A2QK 2O61A 4O6JA 1WZ2A 4GYGA 2YPRA 1I27A 3MZHA 1J7KA 2M0MA 3N05A 3FHNA 4V2FA 2F5EA 1ZHQA 2DQRA 4EG0A 4OIRF 2GWRA 5J1RA 3PSFA 1IRZA 4E7KA 5C3EG 1BJTA 4I02A 3MQ0A 1XMXA 1ZH5A 2QYOA 2NVYA 3U9TA 3M9AA 4MV9A 2HTJA 1JTXA 1PP7U 3COAC 1FP1D 2LVSA 5D5UB 1YFHA 5BR8H 4LK1F 5J8CA 2BY2A 2GXGA 2R7MA 2PMZE 3G6VA 2R7FA 3FXMA 4Y17A 2C28A 2O3FA 2PMHA 1I50A 4ZYDA 3T8TA 1C3OA 2CO5A 3A02A 1RESA 4CGZA 2HZTA 3HSFA 4R8HA 2L02A 3KHRA 1E4EA 1B1BA 1K78A 3RKQA 3C1DA 3CQZJ 4PJNA 1DPRA 1FOWA 2JT1A 2CG4A 5DG8A 2VT3A 2MLKA 1ZRFA 1Q1VA 1ETWA 2VE8A 2JRMA 4IJAA 3EUKL 4CCOA 2BV6A 5K7ZA 1O57A 2DAOA 2VXZA 5KFTA 3TINA 2FSWA 2VJ5A 4BHPA 2CQ7A 9ANTA 5LA6F 2BBYA 2DK8A 1TWFA 2FK1A 3NEUA 4B3AA 2M2EA 3GVAA 3ZQQA 3TO7A 1BJZA 1DU0A 4A6EA 1NK2P 1WPKA 3AG2H 3E5XA 1R00A 2IP2A 1YW7A 3JSLA 3VYSB 1A6QA 4A3EJ 2VPSA 4IRKA 1IBMH 3BAAA 2D45A 2EFQA 2NVXJ 2OCCH 4FHTA 5TRDA 3NWSA 5H20A 3H5AA 5JH7F 3HOWG 2HU9A 4BQQA 4NC8A 5IT9K 2QYZA 1ZAOA 2A68F 4X1EA 2XCAA 2UVRA 2XV4S 5CQGA 2MSYA 5JQWA 3DEWA 1T39A 3BR5A 5CJ9A 3ABTA 4HYKA 3GW2A 1D5YA 1MJAA 2DT5A 2G9WA 4IRIA 3K1NA 2HR3A 2C6YA 2JTVA 2CQKA 4JV5H 1Z7LA 3MFIA 3GCMA 3I55I 3GF2A 5HLIA 3T5XA 3KX2A 4EEYA 1ZG1A 2DMNA 3HG9A 1JI8A 2FK3A 2EV0A 1YJNI 2ASJA 1D5VA 1XS9A 2EBIA 2F5DA 4CYDA 1G59A 3TO6A 4U7BA 3OWTA 3ZMZA 4DR7H 1S8NA 4YR3A 2WAFA 5LRSA 4N9IA 2ZDGA 3Q8PB 4HR7A 3HKZN 4Q43A 2KIMA 3DBRB 1GXQA 3IHUA 2WADA 4IVNA 4XLAA 5FKNA 5DLGA 5L3BA 1KQ8A 4KICA 5HVQC 4ZI7F 4Q47A 3WE3A 2OH2A 3FXLA 4EJUA 2A61A 3B6CA 3WE2A 2R5ZB 2L4AA 4Z6YA 2UVVA 4XIDA 4F93B 4EYIB 4HNTA 3GTOJ 4O3RA 1CQTA 4LIVA 4LIUA 4UVAA 2BHZA 2QKLB 4O3QA 2RC4A 3S3OA 4GFBA 3KYCB 1O3SA 1B8IA 1FYLA 2ZBKA 3OOUA 3HSRA 4IKFA 4B4CA 4YAJB 1B6AA 1X1DA 1SMTA 1QHHD 2ME0A 5A2QZ 1JJ8C 3IH4A 2FE3A 3PNYA 3B02A 5GPAA 1ZKGA 1IBKH 2FRHA 3M9MB 1W36C 2NVTJ 1S0OA 4CA0A 4C2MA 3H0GJ 1S29A 1J5EH 1R71A 4HEA2 1H9GA 2NS0A 4EVIA 4DR4H 3G1MA 5CYVA 1R49A 2XKPA 4A0XA 5GONF 4LF9H 3ZQIA 4P9UA 2MW8A 3VDXA 4XORA 1H0MA 4J9LA 4RGRA 4EJWA 3FK7A 4JV2A 4HA8A 1HLVA 2R7LA 1NG7A 5LLQA 5KT5A 4WCGA 1OCPA 3PW7A 1JXLA 1U9OA 3I3LA 4KDPA 4QWBA 5GAGJ 1LE8B 4YRVA 2LC2A 3P9IA 1BXRA 4LF7H 1OKRA 3I5UA 4JI3H 3DTKA 5KG6A 2MBFA 2Z3YA 4ESJA 2IRFG 2DFIA 2H27A 2OPTA 3QPSA 2YZMA 3CMAI 2PMZN 3BG5A 1EH6A 4RAZA 3PW2A 1BI2A 1XGMA 1U5TA 3RYPA 5E3LA 3WTYC 1YO5C 2ETHA 1LB2A 2W25A 4A5NA 3ETJA 4J9RA 4LF4H 4OAYA 2DOAA 1HXDA 3LNQA 3I71A 1K79A 2CW0F 5IYDJ 4HF0A 5EZHA 4MLOA 1HW2A 2LMDA 3JRDA 2E1MC 2X1EA 1W7PB 3DU6A 2HOEA 3KPHA 4GC6A 4RNNA 3SQNA 5EDNA 2LBFA 4EGZA 3R23A 1F36A 3IL2A 2DA3A 1QVUA 2IGMA 1LNWA 2R6FA 2AGOA 2UUBH 1D0XA 4MTEA 5E17F 2OBPA 2HQ5A 3OS2A 2K9MA 3RSNA 4WXCA 4YFXF 1PUFB 5GP9A 3S14J 4BAYA 2XROA 1N33H 5C4XJ 2EFOA 3L4KA 1HNWH 3UKGA 2JK3A 4AVPA 1E4GT 5CVUA 4FS1A 3QQAA 1IV6A 4W97A 3EPZA 4NB5A 3RPUD 5K1YA 1JE8A 3L2CA 4HG2A 2ZJTA 2NU9B 5KNLA 4L5IA 3GTQA 3K4BA 5BPFA 2A05A 5LHIA 4MV1A 3F8NA 2DT7B 2E60A 5L1KA 2RDPA 1LDKB 4ECUA 2ALZA 1KJJA 3K4LA 3GTMJ 3DXJF 2E35A 4KITB 2YUSA 2FX0A 4EMSA 2KL4A 1AHDP 3ABUA 3S17J 1O4XA 3JREA 4KJZA 1FTTA 4JI1H 1NG6A 5F27A 3RPQA 2W8KA 5FLVA 2CSOA 4BY7G 4AIDA 4JUZA 3SXYA 3UNGC 2DYRH 5BMVF 1E4EB 1OMIA 1WKMA 2QSFX 3IKVA 1K78B 5D4RA 1AOYA 5HLTA 4IOCF 5JVTA 4IXAA 4BUPA 1M1EB 2CUFA 2W48A 5L3CA 4QWQA 1HKQA 3KHHA 2ISZA 4II3A 1GLVA 5LEKA 5GTHC 3JTHA 4FCYA 3RUPA 1IRXA 2IS2A 4KYWA 1D0YA 1NHAA 3U2RA 1BA5A 3K3VA 4O3OA 5KG4A 3BTJA 3PO2J 1I39A 4QSHA 2P7CB 1MGTA 4XZ3B 3ECOA 1IN8A 1H9TA 3S3MA 1K7AA 3V6HA 1UHWA 1IGNA 3IUOA 4ZOLF 3LSTA 1B4AA 2MC3A 1OCOH 4QW8A 5ICGA 1MJBA 3MCZA 4CZCA 3WGIA 3I0TA 4LF6H 3CC2I 3QP5A 2XCPA 1JUSA 4EBCA 1T33A 1IDYA 5F08A 4ETSA 4CUGA 5CAEB 5IY5H 5IWAH 5K5QA 1X3UA 2H1LA 3M1CA 4U87A 3WTZA 1TZLA 2LKXA 4IOAF 3JAMW 2JA8G 2UVUA 3V8LA 3PO3G 3E6DA 4I99C 5HNFA 4MA0A 1T98A 3W6VA 5AONA 5E3MA 3OS0A 1ITYA 4IHXA 4UUSB 4V2GA 2W9CA 3REOA 5BQTA 2M4GA 1LKXA 5B3SH 2MCTA 1BM9A 2JUGA 4LG3A 5HS8A 2QBYB 4DUYH 3IWZA 3LSGA 2V5AA 2FOWA 4FISA 5DUKA 2NAZA 4NNJA 1J09A 2VN2A 4B3XA 1Y1WJ 2NVQJ 1K1QA 2SCUB 5DQHA 2IGOA 1VFCA 1WCMJ 3R0AA 1A9XA 1J0RA 1IN7A 3ZMVA 1YE9A 2BYVE 1FY7A 4RLFA 1RR7A 4J9MA 1VBGA 3PL8A 1T2KA 1X3WB 5FFXA 4ECYA 2JEJA 1YW9A 3TMOA 3GIKA 5JUMA 2R7ZA 1I3QJ 3SDGA 5JVDF 3ZOBA 3JAMZ 4BE2A 5KFLA 2Y31A 5BS6A 5EOYA 2XDVA 1MNMC 2PEXA 3RJ0A 2UUZA 3O8HA 3E5QA 3AL0C 2R82A 5J4YA 5E79C 4RB0A 2QLZA 2ID3A 2V58A 2XGPA 4A3BJ 3ERED 1JIHA 2VQHA 4O4LF 4J9SA 2B63A 2FA5A 1T95A 4XLEA 5FGMA 2V1DA 4C3HJ 4IR1A 4FTHA 2R92A 5F9NA 4HZFA 1ZYRF 1WJCA 1TWHA 1CS0A 4PGHA 4FT8A 4HDVA 3LMMA 1JKRC 4MV8A 2BOLA 1KONA 3S3NA 2HJWA 3MFHA 3ZN0A 3GIPA 4RBOA 1FZPB 4FM9A 4DL3A 2RQPA 1JT6A 3V7SA 2JA6A 4BY1G 2FK2A 2XF6A 1WH2A 1L3LA 1FYMA 5HNHA 1I7NA 3K7AJ 5KFOA 1ZHSA 2CJJA 2RNGA 3RFCA 1ZN2A 1U78A 1BR1A 1ZETA 5FKLA 3CJRB 4QLCU 2DOEA 1ERDA 2Y69H 3R5FA 1P6RA 3DBHB 5DG9A 3FBIB 5EWEA 2B9SA 4RNOA 3J7AY 5JHFA 2UU9H 2DBBA 2W71A 5CQEA 4F3QA 4ZTJA 4WD3A 1X4OA 1IZ1A 1YLFA 4C2MJ 2O5RA 2RN7A 1A35A 4RU9A 1R1TA 4QIWN 1YYVA 3BZCA 1MKMA 2XAQA 4GGGA 4P9FA 1ETYA 2HPMA 4A3IJ 2H8RA 5ILSA 3A0BC 4LSAA 5ICCA 4BJ5C 3OSPA 1KU2A 3CUQA 4BQNA 1TW2A 4WK8F 1BIAA 1LE8A 1T0FC 1O3TA 3HYIA 3MZ8A 1KEEA 3F3XA 3I56I 2JVHA 3WTTC 4CCNA 3GIDA 3I4NG 4D7NA 3BZ6A 3FBNB 5JFRA 2FLLA 1IO2A 2P5VA 3ZMTA 1U5TB 5BPIA 2QSHX 1JHHA 1D0ZA 1R23A 1U0JA 2DTZA 3HUGA 3VYUB 5HODA 2R92J 5CVRA 3G3ZA 1HKTA 5D6FA 4YJ3F 3PUFA 2PJRB 4RGUA 1GXPA 4BJ6C 4MV6A 3RKYA 5DGBA 1UMQA 2X6WA 3V6JA 4QWDA 3KHLA 1W7PA 2WV0A 4F92B 5KX5F 2RF4A 2VC0A 2YZNA 2VODA 1SD7A 4XN0A 2JEIA 3OYJA 2FMYA 1E2XA 5IYCG 2XGCA 2LSOA 3F9KA 1FBSA 2WAEA 4KNYA 1JDBB 1UELB 2ELJA 2YRXA 5KFGA 3KETA 1GHCA 3LA3A 4ZYEA 4XICA 3K1MA 1VQ5I 2M45A 3LWFA 3HTSB 3BR3A 1Z77A 3TEDA 4ENMA 4NDLA 4WWCA 3F0CA 4A3JG 4R7RA 1SVOA 4D5FA 2VJ4A 3K4CA 4HNUA 3PO3J 1S97A 4XBFA 3TIIA 2IPQX 1R7JA 3BJAA 3KP7A 4JI6H 2W4SA 1KU7A 2Q2EB 1T36A 3TGNA 1UHMA 3OR1C 3QZ7A 4CC5A 4HQMA 3ZQHA 4HNVA 1JUMA 3M4OJ 3VODA 1TWFJ 2VR1A 2R93J 3QPHA 2ZB9A 1K4TA 4LSXA 4YB8B 4DL4A 4EJTA 4ZQIA 3H0GA 4BBRJ 1Z2NX 5D8DA 4QPOA 1BN5A 2XGXA 4MFEA 1X1BA 1ENHA 2Z16A 2YU3A 3MN2A 4XX0B 4BH9A 4DYQA 1H89C 4EFEA 2XF5A 3E6CC 3E0JB 4D7MA 3WHBA 2HI3A 4TV9F 4OINF 4JX5A 4A12A 3EQLF 1R4NB 3CESA 1HSTA 2OAZA 2CFOA 1F5TA 1YG2A 3HC7A 4KIGA 1DP3A 1LUJB 3T1YH 2CS3A 1MBEA 2R7SA 1SMYF 5ICEA 2L7KA 3BCBA 1YHQI 3J81W 1GGOA 1F9NA 3FMAA 2LOOA 1T94A 3H5RA 3H9QA 3MZYA 1BI1A 1RK6A 1GSAA 1ZR2A 4Q44A 1BL0A 2CZGA 4HYEA 5DEQA 3GILA 1YJ9I 3A0HC 3ASNH 4L9NA 3ZQ7A 3OYDA 3QWLA 3SFIA 2XC7A 2FLNA 4XRFA 4LFAH 1I6UA 4KIFA 3S1RJ 1G2HA 2DOFA 4LFUA 2AQFA 2ZXWH 4DYCA 2DWCA 2OWOA 2K5CA 3VPRA 4QW9A 1Z6RA 4PZJA 4UUSA 4M9ZA 2FB9A 4C9YA 2JA6G 3OSGA 3FXRA 3KTMA 4LLGF 2QQAA 2HKXA 1MBHA 2VLAA 4O2BF 3SE7A 2DODA 5DQIA 1A0IA 1SFOA 2QBYA 3RBEA 5KFHA 3JTGA 2K27A 2P5KA 5KG1A 4BY1J 4O2AF 4A69C 2QZ8A 2DA7A 1AUXA 3BR6A 5DLFA 4IHJF 3JRGA 2V59A 1FJLA 1K1SA 2XSJC 4IHWA 3KEOA 4MAMA 1HDPA 1FP2A 3KCCA 4J0MA 2HKOA 1Y1WG 1I1SA 3X2QH 1OCZH 2JJ7A 3K5HA 4IZOA 1MSEC 3FXJA 3AL0B 4ED3A 5B5EC 1BIBA 5H6QA 4S05A 4A3DJ 4Y4RA 3U9GA 1LJ9A 2R5YA 2DA5A 4J9QA 3ABKH 3KZIC 1EJ9A 4CHUA 2E5LH 3L00A 3S93A 1VNDA 5C8YF 1WCMG 2W82A 2DU9A 2R7UA 2NRAC 1WR2A 3KP2A 3DU5A 2BY3A 4CCMA 2E34A 5H2FC 4GKKH 1V4RA 3FMSA 4PWQA 2FPGB 5J3LA 2LY2A 3TW7A 1Y39A 3PN1A 1LFPA 2YS6A 3M9NB 2MYSA 3GTKJ 1WJFA 2L9NA 1E17A 2CQQA 2WC2A 3GZNB 3AG4H 1WI9A 1Z1DA 2DJNA 4PUSA 2VBWA 2M7BA 3F72A 3GWZA 4X0GA 2JEGA 1I3QA 1EH7A 5J4VA 2DMTA 1PDNC 1OLTA 1FC3A 2OUMA 5FD6A 3P5JA 1VQ4I 2YU9A 4KISA 4MIMA 4JI5H 3RGXA 5CLSA 1JT0A 2L7ZA 1USTA 2W6PA 1AA7A 1G6NA 4HW0A 4WBNF 2OZ6A 2X6XA 4F55A 1IC8A 1BOAA 4GKJH 2W85A 4B3MH 4EM0B 3CMMA 3SI8A 1WVRA 1S9HA 2PVPA 4UXNA 4KHPH 4JOMA 4UHTA 2OJED 4XONA 3GTGJ 3RV3A 3IWFA 3MWMA 2QK4A 3CCMI 2A5WA 1XNQH 4UCRA 3CLQA 4A3JJ 2R7DA 1N25A 1T0FA 1ZGJA 2FNAA 1WRJA 4ME6A 3RV4A 2CUJA 4XSZF 1EUCB 2FKLA 2VBYA 2FQ4A 5B66C 4D9JA 1RR8C 1DPUA 1K83J 4OIOF 2EWNA 5JI6A 2H94A 1NTCA 3HUGB 3ZQCA 2STTA 5KFAA 3HOYG 1JUPA 2BVMA 4PDBA 2VKVA 1XD7A 1N32H 1ZRDA 4Q8EA 1ULZA 3NQOA 4G7OF 3JRFA 4TQSA 1JGSA 2DW4A 2LR8A 3H3VK 3FDSA 1MBJA 4CCLA 4WXDA 3V8KA 5CPRB 2BXYA 2P6TA 1SCUB 5GTIC 5HLGA 4Q8FA 1OR7A 4YELA 1MMGA 4ZYGA 1LPQA 4MEXF 2CV2A 3S1QJ 3V4SA 4II2A 1I1GA 5JVLA 3T5HA 2J6SA 2D2WA 3G2BA 3G71I 1ON2A 5F0HA 4NXMH 2UXNA 2ZFUA 3HOSA 3MR3A 2XGDA 4O3MA 5ICFA 2ZO4A 1V5GA 4YIRX 3HOYJ 2KQRA 3L2UA 1A6IA 2X4HA 5FROA 1B8IB 2Z99A 1SEUA 4IHSA 3E5NA 1F1ZA 2AGPA 2Y2ZA 3RGZA 3EUAA 4BACA 4M73A 5DCMA 3HOZJ 2VJIA 2QENA 4G6QA 2YRWA 5FLXZ 5KFZA 3G6EI 4CC6A 5K5OA 3VSKA 1X3ZB 5BPDA 1Z3YA 2O9LA 2KJBA 2Q2EA 1HSJA 3ABMH 5E1ZB 5J1UA 1TA8A 3CF2A 4A3KJ 4ENKA 2A07F 3GZ5A 2DQLA 2R7RA 4IWXA 3N8DA 2CMPA 5DD4A 3H0DA 4D0PA 1B72A 4ENNA 2VT2A 1CQIB 1TWGJ 2K9QA 3ERMA 3RI4A 3GTPA 3L4JA 3HZJA 1VQ6I 1XPXA 3CF5F 4P55A 4ESFA 1KJ9A 4NUBA 5FLXW 2JQ7A 1OWTA 2V6EA 3GV8B 3V42A 3L2QA 3RTRA 5C3EJ 1K6OA 4C3IJ 4Y8VB 4EBDA 4NQWB 3BC8A 3L2VA 2CWEA 2VUMJ 2HQNA 3MKLA 4L18B 2ZMEC 4O5VA 2V6CA 4F4XA 3R61A 3I4MG 4AYBN 5CA0F 2ACJA 4J19A 1BC8C 3TDUC 1YITI 2IJLA 1WH5A 3RDIA 4JI2H 4EGQA 4QIWA 5D4SA 2IS1A 4YAKB 1ETVA 3TOAA 4CO8A 2Y9ZA 5HBRB 2WAQN 1MBFA 1OR7C 4JBAA 3RTXA 3OYHA 3FM5A 5HDKA 1HW1A 4HBLA 1I7LA 1S9FA 3FMRA 3D5SC 4YIIA 1O7FA 2B63J 2KSWA 4DR5H 2NOGA 4CH7A 1N77A 2TDXA 4MFDA 4N0BA 1RRJA 2P6SA 1XN7A 2MA3A 3Q3SA 2BQ3A 2HVQA 3JR9A 5DQGA 2I8DA 2KRFA 2LBFB 1WH7A 4F7ZA 2R87A 2B63G 2DMUA 4ED1A 4DBQA 3JW4A 4HX4A 2XGEA 1MBGA 2E2JJ 1P8LA 1XMAA 2IA2A 4XM3A 1IN6A 3A1YA 4BBSJ 1MMNA 2YX7A 5IYBJ 3CD6I 1PUFA 4DL6A 2DN0A 4U6PA 2EPFA 2J5OA 5HDGA 1ETQA 3EUHC 1ZRCA 1Y1VG 1TQMA 3RYRA 4QWCA 5HS7A 2LDUA 3ZCOA 2R0QC 2VI6A 1RKWA 3VFZA 3QPLA 1S03G 5C44G 1FX7A 2GQQA 5LGUA 4ZTFA 5IYBG 2ZKZA 1K61A 3H9GA 4G12A 2DA6A 3S16J 3LAJA 2HEOA 2J6TA 1YQAA 3JRBA 3OHBA 4UFZA 5KFNA 3PUBA 2GXAA 1W7PD 2K3FA 1IN4A 4IO9F 2JSCA 3F8BA 1YI2I 2I10A 1YRNA 1KJQA 1FOYA 5F1RA 3JAMK 3WU2C 4G94A 4FE7A 4RLQA 1SANA 3OYMA 1M0WA 4TQRA 2AHQA 3FKIA 5KT4A 4ECVA 3ZQLA 1MZBA 1U3EM 3BG3A 4M6YA 2VONA 1ACIA 1XGOA 2MD5A 2VKEA 1YX3A 2ZMEB 5EGOB 3KLOA 2BVLA 5KFBA 4RZRA 1F43A 2R4GA 3HRMA 5D8LB 3FXUA 5JHUA 3EPGA 2OC6A 3F6OA 2E2IJ 3GIIA 3M8FA 1XC5A 2VA3A 5KFWA 2XAFA 4QTRA 3H4DA 1EUDB 3T1BA 3CLOA 3W2WA 2G7HA 1S7AA 3F8CA 1XCVA 3DWLE 4ZDLA 5CB4F 3OUZA 3SJMA 1TWAJ 2V9WA 2LYCA 3MEXA 4UV8A 1VQ9I 1VQKI 3QAHA 2OD5A 2JZYA 2F6CA 2X0SA 3PR4A 3GTLA 2LK2A 2VPRA 3CJQB 2BE5F 3DQVC 3A01A 4HQEA 3F8FA 3TBIA 2ESNA 1EYZA 1OYIA 3CCLI 4JI7H 5ILUA 3BPXA 3E6MA 2XAUA 2LRDA 4KUMA 2V4RA 3KYLA 4M3DA 2E1CA 2WA0A 3HPHA 1GDTA 1WQ2A 3LSIA 4GO1A 2EK5A 3V4ZA 3WGHA 3CCJI 3J7AO 3H3VH 2K9SA 2KIFA 3HOVJ 2J6UA 2K9NA 2R93A 3GBGA 5DG7A 4J9PA 1UG0A 4YJ2F 2WY8Q 4I55F 4DL5A 2UUAH 1SC7A 4E70A 3O8GA 3QYEA 1ORKA 2ELKA 5JR3A 5DGAA 1O3RA 2BXZA 2ECBA 3R6SA 4IHVA 3J7YJ 1UB9A 1G3YA 4IRHA 5L3GA 2CV1A 2K7LA 2AXTC 1V5EA 3BJ6A 2FP4B 1EA3A 1W96A 2VUGA 1P4XA 1BC7C 2HDCA 2OCEA 4BE0A 1IN5A 2R93G 3BOQA 5HOOA 1FWZA 3ML6A 2M8GX 4JP0A 4BXFA 3K70D 1IXCA 4XLCA 5HS9A 3IAM2 3K70C 3ABLH 4ZHQF 4FBTA 1T6SA 4HPQA 1Z2OX 4ED2A 4MO7A 2DLLA 2W6NA 2V4QA 5E20A 4A3EG 2K3PA 4KT6A 5IYCJ 2HWVA 4ZZLA 2CYYA 5FB2A 2VKDA 1VTNC 2FPIB 3GLKA 3QFFA 2EB7A 3HRUA 2KFDA 3E3VA 3TIGA 1XDSA 5L3EA 1XCBA 1CE8A 2GZWA 1JHFA 2IMWP 2WTEA 2V9PA 2EFWA 2NVYJ 1IXRC 1BNCA 1VQ7I 2H6BA 4DLKA 5KT7A 1HKSA 4E7JA 4RM3A 2W8LA 4ED6A 2I8CA 3CVZA 4ECQA 2JWTA 4R8UA 3S32A 3CZ6A 2HS5A 4YIFA 1W5SA 1P4AA 2I87A 4X62H 2Q8KA 1YIJI 1R4MB 2P7VB 2E7WA 4EM2A 1R5GA 4YHHH 3K6GA 3U21A 3GTOA 4Q4ZF 1U2WA 2W24A 2X0LA 2DO7A 4WXHA 3RAXA 1WSCA 3HB9A 2MD0A 3G6YA 4MQ9F 3CTAA 2WB1E 2VJJA 1B72B 5CKTA 2Z1DA 1FPQA 2R84A 3O6BB 4A3FG 4M72A 4XKVA 2C35B 3K10A 2W70A 2WAQA 3OMYA 4HOBA 3WNZA 3OOPA 3FKIG 2KIQA 3CUQB 5FPOA 2KMUA 3FIWA 3AAFA 4AD9A 4NQWA 2FJZA 3T5KA 4LMYA 2ATLA 5F0FA 3L09A 2EV5A 3H5NA 4X64H 3ASOH 2CU7A 3WG7H 4A3DG 4BL0B 2GIVA 4MTDA 1TWCA 1RETA 3IRQA 4E6KG 1E3OC 2QF7A 3BG7A 4EJVA 1G3SA 2ZCWA 4W1UA 3H3UA 1Y8RB 4UUVA 2C22A 1QGPA 3C2GA 4XRSG 1JKPC 5F9LA 1HQCA 1BR2A 1Z67A 5KVRA 3WU1B 3N97A 4BXXG 3GO5A 1XB4A 3V7RA 3KLNA 3E6BA 3J81Z 5K7HA 2QGUA 2GBYA 2Z33A 4V19K 1JXSA 2OQRA 4LD5A 1PP8F 3ZRGA 5E1WA 3A2KA 4DV6H 2E71A 4PCQA 3J80W 5FO5A 4BYYA 3H3ZA 4XRMA 3BR1A 3PW0A 2JRTA 3C2BA 3V8JA 1K4SA 3LSRA 1HOMA 2F4MB 4I6ZA 2HYFA 2WWYA 3CCEI 3NWTA 1KA8A 2GXBA 1DV1A 2GPWA 3UR3C 3O3KA 5GPCA 2KDZA 1TQIA 2L4MA 1RZ4A 3HOUG 4DL2A 3R5XA 2XAGA 4DV1H 2ZJPF 1YS6A 4ED0A 5LD2C 2DJIA 3GLLA 4HSTA 1S68A 1R5HA 3BG9A 3GIMA 1P7JA 3RB6A 4RDUA 1J59A 5EEGA 5AIPA 4OIPF 4XMYA 3VOEA 2CH0A 3RJPA 2UZKA 4LB5A 4I01A 3PW5A 4DJAA 2PBIA 3FF5A 2E2HJ 1FNNA 4I4TF 1KU9A 2OQGA 3KP3A 1UC8A 5IP7J 5M3FJ 4R79A 2Y0SA 3HRSA 4YFNF 4L1KA 3ZN1A 4OWRB 2UWMA 3J80Z 2NVUB 4DR1H 3OSFA 3BQ1A 2R7OA 4ECWA 4Y13A 4YFKF 2Z9OA 1MH4A 2M7AA 4I98B 3A4CA 2NU7B 3KXYT 1X2MA 2IVMA 3TO9A 3L1PA 3PNTA 2ZMEA 2O8XA 5EGOA 1XNRH 1X1CA 2GAUA 1P7IA 1Z21A 1G4DA 3FK6A 1N75A 3KEYA 3C3WA 5JLWA 3MFKA 2UXBH 1P4WA 3OYCA 2ZSHB 2M34A 4G9YA 3WU0A 3S1NJ 3LWBA 4A3FJ 4M3EA 5EEAA 5FD5A 3DKWA 4UCSA 5EJCA 3GX4X 3OYKA 4CCJA 3BQYA 3I54A 3W6JB 5KFMA 2E36A 4PSWA 2P81A 3O2PE 2ZDQA 2AS5F 1WJ5A 3A01B 4LFBH 1YOVB 2YX4A 3CP2A 2HHHH 4A0ZA 5IT3A 2AU0A 4DW6A 3FZVA 3PJRA 1RJRA 4Z2YA 3BJOA 5FJ8G 1E3PA 2M3AA 3LSPA 2W1OA 1Y0UA 4ASNA 1MMSA 3FMQA 3HGYA 4XSXF 2M4KA 4A2BA 2Z2SB 1Z91A 2R7NA 4ZH4F 2VKHA 2HQAA 5KFVA 2O03A 3VWBA 3GV5B 2DPUA 4ZZDA 1IF1A 1TQPA 3BT9A 2BY1A 1N78A 1D3YA 2A3SA 1MD0A 2QCOA 2V9KA 3G8CA 3JRWA 5ED4A 2IAIA 1Z6TA 2GA2A 3B6AA 1W5CC 1JKOC 4ECSA 3G1OA 1W36D 1S0NA 1P2FA 3ONQA 1B33N 1JX4A 3BWGA 1MMDA 1WJBA 2L7FP 4GXOA 2B0LA 1KU3A 2KRHA 4M9UA 2HFHA 2DXIA 1V51A 3LP8A 5LP6F 2RNJA 1TT5B 2MFZA 1TTYA 2EA4A 1ON1A 2A6HF 5B1BH 1PX2A 3KALA 1USSA 1GSOA 2C2EA 1XSXA 2ZSIB 1IOVA 2GPSA 1TNTA 2ZM6H 2XHKA 3I4NJ 2DPIA 1IBLH 2OLSA 2VQCA 1HBXG 1ZHFA 4XKCA 2DFHA 4MV4A 1WJAA 2EQRA 2LF8A 2R5YB 3IKTA 4ZJZA 4RS8A 2XPVA 4ON0A 4M3GA 1NH3A 2NUAB 4BDYA 2NS8A 2XIGA 1KJIA 4PFPA 2XPWA 1EZ1A 2DPJA 6PAXA 2IP4A 2R7QA 1P92A 3IP4B 4RAGA 4E7LA 1HNXH 3SZGA 2CFXA 2X1CA 2HOSA 3J81K 3ISPA 1LFBA 1BW5A 3N42B 4UCTA 4R8UB 4ED8A 2X6YA 3ETHA 2COBA 5KFIA 3N44B 1ULYA 1ZK8A 1ZG5A 1F4KA 3M4IA 2B7EA 2HXIA 4LK0F 3SZTA 2Y30A 5DS9A 3BLYA 4FX0A 3SZPA 1H88C 3WO1A 2DA1A 4O4IF 4RA2A 4B43A 2VOPA 1RUOA 4X6AJ 1RKTA 1LFUP 2ZDHA 3KP4A 2Y48A 1MMAA 3DPTA 1XG1A 1TNSA 5DDGA 5C4XG 1VBHA 4QPQA 4ED7A 1J5YA 3DEEA 2WB1N 3I12A 5KFKA 1EKEA 2EJRA 4M74A 3CCSI 1FT9A 5IP7G 2Y75A 1HC8A 3C2HA 1S6LA 2FLPA 3ZP5A 4A3BG 1U8RA 1EHIA 4RM2A 4A3LG 2XF7A 3DV8A 3CC7I 5E18F 1L2ZA 1U6GA 4ZYAA 3R4KA 2D5VA 4BS9A 4GLXA 3GTMA 2OTJI 4RUCA 3C18A 3H4BA 3K3PA 5L9XA 1FKAH 4NXNH 3RAQA 2DYSH 4AC0A 1GV2A 4D1QA 1CQJB 2V9VA 2R86A 4XOPA 2JA7A 2HNHA 3DTEA 1ZTRA 2DA2A 3DLAA 3MVPA 3MR5A 4AYBE 1TT0A 3SDBA 4G6TB 3ZMDA 5IOZA 2YSRA 2NU8B 3GLXA 1OYWA 4O3NA 5J8FA 4IAJA 1IOWA 2VPLA 4MGRA 2IW5A 5FPRA 1N36H 2F4IA 4MNUA 2X6OA 3HOXG 2EZHA 1SD6A 4U88A 3GMEA 4OMYA 4U7CA 4J9NA 2A69F 3IN5A 5J6XA 3J7ZI 3KEQA 2Q0OA 2CRGA 4M3FA 4A3MJ 1M6VA 2UXCH 5C5JA 2YZGA 2R8GA 2XPUA 4FQGA 4ZC3A 2M0CA 5E3OA 3I53A 3E97A 3D1NI 2AO9A 2DMPA 3BPVA 2HTSA 4IRGA 4KIBA 5DCMB 4GDFA 3CQZA 5KFCA 4Y33A 4NC6A 3OYLA 3RCOA 5GAHJ 3AFHA 1RIOH 3KZZA 2W7PA 3V7CA 3DBLB 2VIXA 3HKZA 1U5TC 4XK4A 1SFEA 1QHGA 4AU7A 5EDWA 2MH2A 1LVAA 3ZQFA 2A6EF 3GUDA 3ZXSA 4Q45A 1MW7A 2Q2UA 2IT0A 3GTKA 3H9JA 5ERIA 1MDMA 1RPWA 2J5PA 3HBLA 1EF4A 4IWYA 4PDKA 2R8HA 4EEFG 1XSVA 1UAAA 3I4MJ 2E5NA 2GOXB 5IP6A 1R9TA 3GZ6A 1KGSA 5CVVA 2L01A 1D1CA 5IOYA 2R92G 4M9XA 1P9QC 4AVZA 5J47A 4F52A 2K02A 1LDDA 5KFEA 4B3SH 2PQ8A 4OAZA 4CCKA 3G6XA 3SHFA 3KFWX 4G8XA 4U0YA 4A93J 3ESWB 4IF4A 1OYYA 2JPCA 5LMNH 1WSUA 5LGNA 4M6XA 3JCUC 2DTRA 4C2TA 3RIZA 1FSEA 1OCTC 2KZVA 2Y9YA 2QKMB 2VL8A 3K2AA 1TWCJ 2P5LC 3HOWJ 1SFXA 3TL4X 1XDNA 2YW2A 1HA8A 4RAFA 1ZQ7A 2XSDC 1XGSA 2PG4A 2K9LA 4FE4A 1FYKA 4EGJA 4DV4H 2HZDA 4ABZA 5KG5A 2FMLA 1XDUA 4PJJA 2XASA 1UJ8A 1U9NA 1OFCX 3BQZA 2Y0SN 1A31A 1PUEE 4LH7A 2JA5A 2VPQA 2M30A 5EEHA 3QRFF 2RGRA 2XD4A 5FLMJ 2RAEA 4AIHA 3WG9A 3Q2OA 2ID6A 3EDPA 5LBQA 2V26A 1Q1HA 3ORRA 3PNVA 2KIUA 3QZ8A 3KAKA 3BZKA 1WGXA 3N43B 4BJTA 2E1NA 1JTYA 3KHGA 4I50F 2IGKA 2EILH 4UV9A 4GCVA 3TDZC 2FPPB 5FLMG 2W57A 1NK3P 3H36A 2R8JA 1S72I 2STWA 2QA4I 1SD4A 2CUZA 5C4JJ 4APMA 4JV1A 3OL3A 3PFYA 3MWDA 3N6XA 3CP8A 4YEJA 3M9OB 1KJ8A 3ZQGA 1Y1WA 2E1MB 1FMWA 2F5CA 2RREA 4L0YB 5L1JA 4NBQA 2PMUA 3WODF 4BQOA 2CQXA 2DIKA 2JA7G 1HW5A 1OCCH 3FISA 3HKZE 1I94H 2LY9A 1YRNB 1VKZA 1HCRA 2V4JC 3P7NA 3LAPA 3Q0VA 4UCUA 1DU6A 3BJYA 4EM1A 2DZDA 1YIOA 1SD5A 2W6OA 2L5QA 1Z7UA 3AG1H 4HSRA 4M3BA 3GTJA 2VB6A 2EH3A 2K40A 3F22A 2A5YB 2LKSA 1IUYA 3FDYA 1FVIA 4FS2A 3M7GA 4EYHB 1TW3A 2RV8A 3GIJA 1FEXA 3MKWB 2GIZA 3CDHA 3KE2A 5DCFA 4UCVA 2EFNA 3LQQA 4AIKA 1BI0A 1IJWC 5D5VB 2BQUA 4FBUA 1SAUA 4ECZA 2VXDA 2YU9J 1SFUA 1V5FA 5IYZF 4E7ZA 3VEPA 2CQYA 2PN1A 3Q1KA 5KKNB 1FBQA 3K4MA 5K5RA 3CMEI 5FLXK 2NVXA 3K2ZA 3LL7A 4B3RH 5KAIC 2KDOA 1PK8A 3W2VA 4JQFA 1D1AA 4DV3H 4B48A 4DQ2A 4ESBA 2V1XA 3Q5FA 1H8AC 3MJFA 2JA8J 2V1UA 5A2QW 4I7HA 4EGYA 1S0MA 3JRXA 4C3JJ 3PVXA 5KAFC 4QWEA 4A2AA 2CW7A 3F6VA 1G3TA 3I59A 2BEOA 2XC9A 1IRFA 1AU7A 3NAUA 1BW6A 2YR2A 3R60A 2G0EA 2W84A 5FRMA 2ZXJA 2AQEA 3FXOA 3DTIA 1WWXA 2ZXIA 3SFZA 4C2UA 2YS9A 3IH2A 1TWAA 3Q8RB 1QVTA 1XMQH 4BHBA 3WTXC 1Y14B 4E7IA 1KQ9A 2R85A 1QO0D 4B8XA 3TP3A 4MQVA 2C2DA 4P96A 3GIQA 5DYMA 5KG7A 4YY3H 3OY9A 3KZYA 3MR6A 4KT5C 4AIJA 1IV8A 2H8WA 2HPIA 1R6RA 4Y3OA 4BWSC 4X65H 1S7EA 4ZDOA 4CYCA 1A5JA 1IUFA 3T0YA 3GFIA 4IHYA 3HHGA 4LB6B 2X48A 2VQFH 4L5JA 1DGSA 3BCAA 3W2AA 2E19A 1GT0C 1FTZA 3BA8A 3FKIJ 2I5UA 1V3FA 2F2EA 3K0LA 3D5RC 3MAJA 1TLHB 5ILVA 2AQ4A 2W9BB 1T3NA 3RKWA 2Q1ZB 3OHAA 3HL2A 3R0JA 4CICA 1O7LA 4HV6A 4DNCA 3WGGA 2JEFA 4RMNA 1BR4A 4WF2A 3WHCA 2K4BA 1ZR4A 2VOBA 4RNMA 1PVEA 3GTQJ 1Z0XA 4A0YA 1VQ8I 2VUMG 4LF8H 2EZIA 2KISA 4JK1X 2IGNA 2OZUA 2ME6A 2GLTA 3NGDA 3GTPJ 3JSNA 2QUFA 4H0EA 3NARA 1ZGWA 4AQYH 2W7NA 3JRCA 2KRCA 1Z3XA 2XKOA 4OOIA 1S10A 1QPMA 5EG0A 4OU0A 2E2IA 1REPC 2WDTA 1Y0NA 3VPBA 4PSXA 2LP0A 5FKMA 3PIPF 5IT9W 3E5UA 3KP5A 2FMAA 2NS7A 4ZDPA 4BKXA 2R7WA 1HF0A 2PLYA 2JA7J 1XMKA 1D8JA 2FQ3A 3QODA 1AUVA 3Q8SB 2XRLA 2VC1A 3Q9SA 4DOZA 3Q0UA 2VQLA 1X4PA 4LLLA 2V79A 4J01A 1MDMB 4L9JA 3VYTB 2M1BA 2QVOA 1X2NA 2QQ9A 2DA4A 5B1AH 5LYJF 1Y1VA 2MGQA 3LQRA 5M3MJ 3QOPA 1TL8A 4QJFA 3E1SA 5EWGA 4ECTA 4ANJA 1XMOH 2PN6A 3HRTA 1ZQ3P 1X19A 5KK1A 2VOOA 2EIJH 2EZLA 4A2UA 5D5XB 3HOZG 2GA1A 5BMZA 4PJ0C 4RGXA 3D0SA 4NLGA 2OU2A 1X1PA 1KC7A 3GFLA 1T08B 2L2OA 1GV5A 3RIRA 4IPAA 4EBEA 3HOTA 2KT0A 4U7DA 1RNLA 1ZARA 1APLC 2ISYA 2QWWA 3PIOF 1IDZA 1MJ9A 4QWAA 4A5MA 2ZNZA 2FNPA 2IS4A 2ASDA 4AWXB 5DM7F 1DP7P 4HRIA 4XYLB 1IW7F 1LEAA 4Y15A 1CF7B 4L9VA 2TRTA 5KCMA 4E4HA 1N48A 5K7FA 5KT2A 5LHHA 3ZGKA 1DDNA 2KHMA 4A3CG 2HYJA 2E1OA 4BE1A 3GTGA 1R36A 1HR0H 1IG7A 5KFRA 4YP3A 4M9SA 1YW8A 4GC7A 4M6VA 3U1DA 1KYZA 3K69A 4AUXA 5C44J 4XR6A 1ZG3A 2UXXA 4A93G 4JI0H 4DR6H 1J9IA 3GV7B 4HX7A 3RZOJ 4RB3C 1EV7A 1WI3A 3LOCA 4C30A 3RKXA 2CV0A 4RB2C 5F1JA 3AKZA 2ECCA 4IEJA 4L0ZB 1G8XA 4F4ZA 4LJZF 5D5WB 3QOEA 1R22A 2WV1A 3KP6A 3S15J 1N34H 4FETA 1FMVA 5JLXA 3PW4A 4XLFA 1FBUA 2OTLI 4LH6A 3LA2A 5BOXA 4HDUA 5I47A 2XGQA 1L0OC 5HDNA 4IR9A 2BHYA 4LG0B 1OJLA 3L7WA 3LSJA 2ZXHA 1QBJA 4ENJA 1RYSA 4QIWE 2PJPA 3OYIA 3H40A 3HGGA 3HM5A 5KFFA 2BGCA 2Y0SE 2DMQA 2GOMA 2X51A 4BU2A 2L0KA 1ZREA 2LTPA 4OIQF 5KHDA 5CVJA 1QQIA 3Q9VA 1QZEA 3UQ8A 4JI4H 1FJGH 2V1NA 2ZNYA 3N4MA 3LMLA 4IX7A 4DGWB 1BGWA 4HQ6A 3ORQA 5KFUA 4CXFA 4XLNF 4O3PA 4RAYA 4OX9H 4MV3A 2EFPA 4BBSG 1M0TA 2HVSA 2W6MA 1BBYA 3BA9A 3U1KA 1Y6IA 3BY6A 1IRGA 2PX9A 4A3MG 1SVLA 5E3NA 5EZYF 2NU6B 4EJOA 4WX9A 1HNZH 4A3LJ 5LOVF 5FKKA 3ZMUA 2F5FA 3FHZA 2VBXA 3BR0A 1TC3C 3HHHA 2ADUA 3DF8A 4B1RA 1QNTA 2RKHA 2R7VA 3WTUC 1Y1VJ 2DFFA 1EH8A 3IG0A 4JX6A 5AIQA 4I76A 3BG6A 3M8JA 2CGPA 3OV8A 1IXSB 1MBKA 1W5TA 5KG3A 4A3KG 5DD8A 4B09A 3KAJA 5L1IA 1KZHA 2RDJA 2NNYA 4HLXA 2L9VA 1X58A 3PFIA 3SEQA 2JA6J 1N56A 3S2DJ 2NXNB 3MMYB 3WTSC 1ETXA 3HPGA 4HF2A 3H20A 3I59B 3BQ0A 2VUMA 5F0CA 4K2EA 2HOAA 5L3FA 4Q5SF 3CJTB 3N41B 5KFJA 2VE9A 2BQRA 4F50A 3K5IA 4LFCH 2R7ZG 2COMA 1VQNI 2VASA 1UG2A 5LGTA 5D1PA 3T5JA 3TW6A 4JYAH 2KJCA 4LITA 4P1WA 5LRRA 3CMYA 1GO3E 1R9TJ 4XNFA 1W0TA 2WAQE 3BABA 1ZLKA 2FJ1A 1SAXA 2DDAA 3CO6C 2JSPA 3G4SI 1WJEA 2OA4A 3TP0A 4XL9A 3BTIA 3F8MA 3I4PA 3OYFA 2PMZA 1J2XA 2M8EA 3KIOA 2LH9A 3VPCA 3L2PA 4CYCB 4LF5H 2ZFWA 3Q0WA 5KFSA 4A6DA 1FSHA 1YX5A 3DPUA 3JRAA 5KT3A 4MHGA 2HDWA 1A04A 2HXOA 3PSIA 3ULQB 4RUAA 3D5LA 1AN7A 1UZCA 3EUHA 1K6YA 2MC4A 2XRNA 1TWGA 2DK5A 2G7UA 5D1OB 2PBZA 2W9BA 3OS1A 1VAJA 3HJEA 2JMWA 3LFUA 3PQKA 2ZC2A 2AXLA 2L9RA 3H35A 3CCVI 1O3QA 2X9DA 2CKZB 1WHUA 4A3GG 2L7MP 3TOBA 5F04A 4PJMA 1R1VA 4DIQA 1I50J 2JA5J 1A36A 2HOTA 2WY7Q 2MLGA 2RQQA 3BTCA 4KMUX 1W4MA 4Q0YA 2FBIA 3BP8A 3ZMSA 3DF7A 3TQ1A 2CUEA 2XCLA 4HAMA 3JRIA 4IL6C 2K4JA 1WCMA 4N4OB 2JN6A 3I9V2 3MKZA 1VQMI 3BR2A 3EPIA 4DV5H 2NYXA 2JA5G 1RUNA 1YS7A 2LD5A 2M9HA 3GEZA 3DCFA 4O3SA 1R58A 4EATA 5F6FA 3VPDA 5CA1F 2XAHA 1FOKA 1V9PA 4FX4A 4AYBA 3CCRI 2HVRA 3BROA 4DV2H 2QM3A 5TJJA 3SYTA 4MA5A 1B9MA 5KG0A 2ESHA 2YS7A 4F91B 2MG4A 2BW3B 1AKHB 2R8IA 1C0WA 4YQWA 1Y56A 1ZLJA 1S7OA 3P9CA 1LVKA 1UCRA 2FUG2 4XRSA 1DIKA 3RBDA 3IH3A 2UVWA 1IAWA 2K85A 4YR0A 5H6RA 4BGDA 2LF7A 3GTJJ 2P4WA 3B73A 2LNBA 5J40A 3SEZA 2M05A 2JA2A 1E0EA 3P9KA 4Y7NJ 1DV2A 3DLLF 3IC7A 5DV5A 3F21A 4MEYF 3DP7A 4LLNA 1UC9A 3C0FB 3S2WA 3QU6A 4X66H 4ITVA 3OIPA 3RB3A 3JSOA 5KFPA 1DGRM 4JI8H 3PR5B 5EYRA 4UNOA 5FRNA 3MKYB 3S2HJ 2FXAA 3DKYA 5FJ8J 4PFOA 1MNDA 1B9NA 1MNEA 1D8KA 2FBHA 3OR2C 3OYNA 1CF7A 2CW8A 4H4KC 5M5YJ 2DI3A 1DUXC 3HSEA 3ELKA 5BNGA 4BEHA 3HDDA 5H80A 4BNCA 1KBLA 2K86A 1CGPA 2BY0A 4C5BA 1SFOJ 1SVMA 1RK5A 4XKWA 3CC4I 2HQRA 4RZQA 1GVDA 2KKOA 1GYFA 2JVGA 1QPIA 3G1LA 3WTWC 3OIQA 3WO0A 4S0HB 2HGCA 3DFGA 4UVBA 4S04A 1FOXA 4Y52J 3Q8QB 4BY7J 4L9TA 4DUZH 1MSFC 4DV7H 3VSLA 4XYMB 3N40P 4B3TH 5M5WJ 2OV7A 3TQTA 1W93A 4IQ4A 2R3SA 3GFMA 2FEZA 2Y0MA 3U9SA 5LXTF 5KFQA 4XLHA 3G73A 4A3IG 1X1AA 3DPLC 1JDEA 1LDJA
chains in the Genus database with same CATH topology
4I2OA 2WE6A 5DUIA 2PI0A 2XAJA 2FOKA 4LG0A 1T38A 5E8IA 2YCHA 1I5ZA 3QU3A 2E7XA 3IRRA 2XUBA 3EETA 3V4GA 2O0YA 4MV7A 3VB2A 3FXQA 4BHCA 4CDGA 2O6GE 1AWCA 1STZA 2H09A 3EYYA 4DV0H 1I6XA 1YTYA 4G7ZF 4RGSA 3TKYA 4KA4A 1BJAA 3H92A 2D1VA 2Q2TA 2NNNA 1QZYA 4XLPF 1LEBA 3CJNA 3FX3A 2UXDH 4BXUA 1RI7A 3JSPA 4U0WA 3W6KB 1KYWA 2IA0A 4U0VA 3TQNA 3HTUA 1SYXB 2H6CA 5LMUH 4HX8A 3I58A 1ODDA 2L3DA 3L9FA 4BQAA 2FU4A 3NRVA 3WTVC 2M5WA 2VQEH 3ROUA 3RF2A 2UUCH 3CUQC 2WYOA 4G6DA 4M71A 4KFCA 5E1XA 2HGSA 1E4FT 3PQJA 2XVCA 3J7AK 1Z05A 4HLYA 5LHGA 2HYGD 5D1OA 3GFJA 4RB1A 4G7HF 5FFZA 2IA1A 2RGVA 4EEQA 4HV5A 3K9TA 4I0BA 5D8KB 4CZZA 3M8EA 2P8TA 4LGWA 4KN7X 4DR3H 4I0AA 2RVCA 1UFMA 5CVIA 1FLIA 4UVCA 2ELHA 1SEIA 3DEUA 1OPCA 3RPUA 4R1HA 3GXOA 3T1HH 5D6EA 1VS0A 3M1EA 3ZPLA 2M87A 3EYIA 3F23A 2VBZA 2PFBA 1ONVA 3ECHA 3BDDA 5L3DA 1B59A 3QP6A 2QQBA 3FWEA 1J75A 3OTOH 3K1PA 2LKPA 4HF1A 3CO7C 2FF4A 2EV6A 4KMFA 3FM3A 3LA7A 4EV0A 2DPDA 4UCOA 4ZYHA 3QPTA 1S3JA 1KQ0A 3LFKA 1GVJA 1X9NA 5HLHA 2L54A 1Z2PX 1R1UA 5F64A 4I09A 5E8GA 4EQQA 5IT9Z 3HXLA 3CUOA 1TBXA 2ZJ2A 2EA2A 4OMZA 3I64A 4IHTA 4Q48A 1XGNA 1BI3A 4GYIA 1QZZA 3GYHX 1O75A 1B04A 2MH9A 3J80K 4DR2H 1XSDA 4K0KH 4YG2F 1TAEA 4TV7A 1LQ1A 2JPBA 4P5OA 3T8RA 2F4VH 4N9HA 4NHJA 3HIFA 2D1HA 1Z9CA 4PGGA 2Z5UA 5LEJA 3C7JA 4KN4X 4M7EA 2FBKA 4EFBA 1G3WA 1ZGAA 5A2QK 2O61A 4O6JA 4GYGA 2YPRA 1I27A 3MZHA 1J7KA 2F5EA 1ZHQA 2DQRA 4OIRF 2GWRA 1BJTA 4I02A 3MQ0A 1ZH5A 2QYOA 3M9AA 4MV9A 2HTJA 1PP7U 3COAC 1FP1D 1YFHA 5D5UB 5BR8H 4LK1F 5J8CA 2GXGA 2R7FA 4Y17A 2O3FA 2PMHA 4ZYDA 3T8TA 2CO5A 4CGZA 2HZTA 3HSFA 4R8HA 2L02A 1B1BA 1K78A 3C1DA 1DPRA 2JT1A 2CG4A 2VT3A 2MLKA 1ZRFA 2VE8A 4IJAA 2BV6A 1O57A 2DAOA 2VXZA 2FSWA 4BHPA 2BBYA 2DK8A 3NEUA 3GVAA 3TO7A 4A6EA 3E5XA 1R00A 2IP2A 1YW7A 3JSLA 2VPSA 1IBMH 3BAAA 2D45A 2EFQA 4FHTA 5TRDA 5H20A 5IT9K 1ZAOA 2A68F 2XV4S 1T39A 5CJ9A 3ABTA 3GW2A 4IRIA 1MJAA 2DT5A 2G9WA 3K1NA 2HR3A 2C6YA 2JTVA 2CQKA 4JV5H 3GF2A 5HLIA 3T5XA 1ZG1A 2EV0A 1D5VA 2F5DA 4CYDA 3TO6A 4U7BA 3ZMZA 4DR7H 1S8NA 5LRSA 4N9IA 2KIMA 3IHUA 1GXQA 4IVNA 5L3BA 1KQ8A 4KICA 5HVQC 4Q47A 3WE3A 4EJUA 2A61A 3WE2A 2L4AA 4UVAA 2RC4A 1O3SA 1FYLA 2ZBKA 3HSRA 1B6AA 1SMTA 5A2QZ 2FE3A 3B02A 1IBKH 2FRHA 1S29A 1J5EH 1H9GA 2NS0A 4EVIA 4DR4H 5CYVA 2XKPA 4A0XA 4LF9H 4P9UA 1H0MA 4RGRA 4EJWA 4HA8A 5LLQA 4WCGA 4KDPA 3P9IA 4LF7H 1OKRA 3I5UA 4JI3H 2IRFG 2MBFA 2Z3YA 4ESJA 2DFIA 2H27A 1EH6A 4RAZA 1BI2A 1XGMA 1U5TA 3WTYC 1YO5C 3RYPA 1LB2A 2ETHA 2W25A 4A5NA 4LF4H 1HXDA 3I71A 1K79A 2CW0F 4HF0A 1HW2A 1W7PB 2HOEA 3SQNA 4EGZA 3IL2A 1LNWA 2UUBH 4MTEA 5E17F 2OBPA 4WXCA 4YFXF 4BAYA 2XROA 1N33H 3L4KA 2EFOA 1HNWH 4AVPA 1E4GT 5CVUA 4NB5A 2ZJTA 5K1YA 1JE8A 3L2CA 4L5IA 5LHIA 3F8NA 2RDPA 1LDKB 3DXJF 4EMSA 3ABUA 4JI1H 3RPQA 2CSOA 3SXYA 1OMIA 1WKMA 3IKVA 1K78B 1AOYA 5D4RA 5JVTA 4IXAA 5L3CA 4QWQA 1HKQA 2ISZA 5LEKA 3JTHA 4KYWA 1NHAA 3K3VA 3U2RA 2P7CB 1MGTA 3ECOA 1IN8A 1H9TA 1K7AA 1UHWA 3LSTA 1B4AA 2MC3A 5ICGA 1MJBA 3MCZA 3WGIA 4LF6H 3I0TA 3QP5A 4ETSA 5IWAH 5K5QA 1X3UA 3WTZA 3JAMW 3V8LA 3E6DA 1T98A 5AONA 3REOA 5BQTA 2MCTA 1BM9A 5HS8A 2QBYB 4DUYH 3IWZA 5DUKA 2NAZA 2VN2A 3R0AA 1J0RA 1IN7A 3ZMVA 2BYVE 1FY7A 1T2KA 5FFXA 1YW9A 3JAMZ 5BS6A 5EOYA 2PEXA 3RJ0A 3E5QA 4RB0A 2QLZA 3ERED 2FA5A 5FGMA 2V1DA 4HZFA 1ZYRF 4PGHA 4FT8A 4HDVA 3ZN0A 1FZPB 4FM9A 2RQPA 3V7SA 1WH2A 1L3LA 1FYMA 1ZHSA 1ZN2A 1U78A 4QLCU 1P6RA 2UU9H 2DBBA 1IZ1A 1YLFA 2RN7A 1R1TA 1YYVA 1MKMA 2XAQA 4GGGA 4P9FA 5ILSA 4LSAA 5ICCA 1KU2A 3CUQA 1TW2A 4WK8F 1BIAA 1O3TA 3HYIA 3F3XA 3WTTC 3BZ6A 5JFRA 2P5VA 3ZMTA 1U5TB 5BPIA 1JHHA 1R23A 3HUGA 1HKTA 5CVRA 3G3ZA 5D6FA 4RGUA 1GXPA 3RKYA 1W7PA 2WV0A 2VC0A 2VODA 1SD7A 2FMYA 1E2XA 2LSOA 1FBSA 4KNYA 3KETA 1GHCA 3LA3A 4ZYEA 3K1MA 2M45A 3LWFA 3HTSB 4ENMA 4WWCA 4R7RA 4XBFA 2IPQX 1R7JA 3BJAA 3KP7A 4JI6H 1KU7A 3TGNA 1UHMA 4CC5A 4HQMA 3VODA 3QPHA 4LSXA 4EJTA 1Z2NX 1BN5A 2XGXA 2YU3A 4BH9A 4EFEA 3E6CC 4OINF 4A12A 3EQLF 1HSTA 2OAZA 1F5TA 1YG2A 4KIGA 3T1YH 1SMYF 5ICEA 3J81W 1F9NA 3FMAA 3MZYA 1BI1A 4HYEA 5DEQA 3ZQ7A 4L9NA 4XRFA 4LFAH 1I6UA 4KIFA 4LFUA 2OWOA 1Z6RA 4PZJA 4M9ZA 3FXRA 4LLGF 2QQAA 2HKXA 1A0IA 2QBYA 3JTGA 2K27A 2P5KA 2QZ8A 3KEOA 1FP2A 3KCCA 4J0MA 2HKOA 1I1SA 1BIBA 5H6QA 4S05A 3U9GA 1LJ9A 4CHUA 2E5LH 3L00A 2DU9A 2NRAC 3KP2A 4GKKH 1V4RA 3FMSA 3PN1A 1E17A 2WC2A 1WI9A 1Z1DA 2VBWA 3F72A 3GWZA 1EH7A 1PDNC 1FC3A 5FD6A 4JI5H 3RGXA 5CLSA 1USTA 1G6NA 4HW0A 2OZ6A 4GKJH 1BOAA 2W85A 4B3MH 4EM0B 4UXNA 4KHPH 4UHTA 3IWFA 3MWMA 1XNQH 4UCRA 2R7DA 1T0FA 1ZGJA 2FNAA 1WRJA 4XSZF 2VBYA 1DPUA 4OIOF 2EWNA 5JI6A 2H94A 2STTA 4PDBA 1XD7A 1N32H 1ZRDA 3NQOA 4G7OF 1JGSA 2DW4A 4WXDA 3V8KA 2P6TA 5HLGA 1OR7A 4MEXF 4ZYGA 1I1GA 2D2WA 1ON2A 4NXMH 2UXNA 3HOSA 4O3MA 5ICFA 2ZO4A 2X4HA 2Z99A 4IHSA 1F1ZA 3RGZA 4M73A 5DCMA 2QENA 4G6QA 4CC6A 5FLXZ 5K5OA 5BPDA 2KJBA 2Q2EA 1HSJA 1TA8A 5E1ZB 4ENKA 2A07F 3GZ5A 2DQLA 5DD4A 4D0PA 4ENNA 2VT2A 3RI4A 3L4JA 4P55A 4ESFA 5FLXW 3RTRA 1K6OA 2CWEA 2HQNA 4L18B 4O5VA 2V6CA 3R61A 2ACJA 1BC8C 3TDUC 2IJLA 3RDIA 4JI2H 5D4SA 3TOAA 4CO8A 4JBAA 3RTXA 3FM5A 5HDKA 1HW1A 4HBLA 3FMRA 2KSWA 4YIIA 1O7FA 4DR5H 2TDXA 4N0BA 2P6SA 1XN7A 2MA3A 2HVQA 2KRFA 4F7ZA 3JW4A 4HX4A 1P8LA 1XMAA 2IA2A 1IN6A 2YX7A 2J5OA 5HDGA 1ZRCA 1TQMA 3RYRA 5HS7A 2LDUA 3VFZA 1S03G 1FX7A 2GQQA 5LGUA 2ZKZA 3LAJA 2HEOA 1YQAA 4UFZA 1W7PD 1IN4A 2JSCA 3F8BA 5F1RA 3JAMK 4G94A 1M0WA 1MZBA 1U3EM 4M6YA 2VONA 1XGOA 2MD5A 2ZMEB 3KLOA 3HRMA 5D8LB 3FXUA 5JHUA 3F6OA 3M8FA 2XAFA 3T1BA 3CLOA 2G7HA 1S7AA 3F8CA 1XCVA 3MEXA 4UV8A 3QAHA 2OD5A 2JZYA 2BE5F 3DQVC 4HQEA 3F8FA 2ESNA 1OYIA 4JI7H 5ILUA 3BPXA 3E6MA 4KUMA 2E1CA 4LF8H 1WQ2A 4GO1A 2EK5A 3WGHA 3J7AO 2KIFA 2UUAH 4E70A 5JR3A 1O3RA 3R6SA 1UB9A 1G3YA 4IRHA 5L3GA 2K7LA 3BJ6A 2VUGA 1P4XA 1BC7C 2HDCA 1IN5A 3BOQA 5HOOA 1FWZA 3ML6A 1IXCA 5HS9A 1T6SA 1Z2OX 2DLLA 5E20A 2HWVA 4ZZLA 2CYYA 5FB2A 1VTNC 2EB7A 3HRUA 3E3VA 1XDSA 5L3EA 1XCBA 2GZWA 1JHFA 2WTEA 2EFWA 1IXRC 2H6BA 1HKSA 3CVZA 2HS5A 4YIFA 1W5SA 1P4AA 4X62H 2Q8KA 2P7VB 2E7WA 4EM2A 1R5GA 4YHHH 4Q4ZF 1U2WA 2W24A 2X0LA 2DO7A 4WXHA 4MQ9F 3CTAA 1FPQA 3O6BB 4M72A 4HOBA 3OOPA 5FPOA 3CUQB 3AAFA 4AD9A 4NQWA 4LMYA 3L09A 2EV5A 4X64H 2GIVA 4MTDA 3IRQA 4EJVA 1G3SA 2ZCWA 3H3UA 4UUVA 1QGPA 1HQCA 5KVRA