4ETSA

Crystal structure of campylobacter jejuni ferric uptake regulator
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
146
structure length
141
Chain Sequence
ENVEYDVLLERFKKILRQGGLKYTKQREVLLKTLYHSDTHYTPESLYMEIKQAEPDLNVGIATVYRTLNLLEEAEMVTSISKKYELANKPHHDHMICKNCGKIIEFENPIIERQQALIAKEHGFKLTGHLMQLYGVCGDCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferric uptake regulation protein
publication title Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Metal binding protein
total genus 40
structure length 141
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4etsA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4etsA02
1J75A 3TDUC 4GCVA 1OMIA 4NB5A 2FNAA 1H9TA 3WTVC 2P6SA 4XSXF 4ZYGA 1ZAOA 1YO5C 3FWEA 3J81Z 1TTYA 2CWEA 2EV5A 2QENA 2RN7A 4MEXF 2UXNA 4O3MA 3GXOA 4LK1F 5E1ZB 2UWMA 1FSHA 1Q1HA 4HV6A 1E2XA 3ABTA 3O6BB 4WCGA 3WTYC 1B9NA 2A5YB 4G8XA 3EETA 1WKMA 1LQ1A 3MZHA 1KU2A 1XGMA 5K5RA 3K2ZA 1FSEA 1ZLKA 2HTJA 4K2EA 2M8EA 3F22A 4IRHA 3M7GA 1FX7A 3HRUA 5ILUA 3LA2A 2VOOA 2G7UA 2GWRA 3FMQA 2JTVA 1IZ1A 4LFUA 2BYVE 5E8IA 2ZFWA 2E1NA 1BM9A 3WTSC 3H92A 4WK8F 3FZVA 2KIFA 4CZZA 2FQ3A 2GXBA 3WE3A 2IA2A 2FXAA 2CW0F 3BOQA 3KFWX 3KP6A 4WXCA 4A6EA 2OAZA 2NYXA 5JR3A 1J59A 3WTTC 3GVAA 2P7CB 5BPIA 5D8KB 3R0JA 1GVJA 4I0BA 2TDXA 2LKPA 3ZMVA 3WU1B 3T5XA 3MFKA 2JPBA 1O7FA 3WTXC 2ZKZA 5F6FA 5LHHA 2HWVA 4Z2YA 4L9VA 1FC3A 5HDNA 4H0EA 4QWQA 2FE3A 2O0YA 1UB9A 4HW0A 5HVQC 1ZYRF 1P4WA 4HLXA 3E6MA 3FX3A 1FBQA 1KGSA 3FHZA 2OZ6A 4XLNF 2D45A 2G9WA 1JGSA 2HTSA 1TQPA 3F21A 2VBYA 1DP7P 1FZPB 1P4XA 1BI0A 1U5TB 3ZMSA 4L9JA 2IT0A 1ZH5A 3DQVC 2DTRA 1G3YA 4EJVA 4R79A 1F9NA 1IXSB 3LFKA 4HF1A 3NQOA 3D0SA 4OINF 3MCZA 1FP1D 2QQAA 1BI2A 5E20A 1TBXA 2HOEA 4AVPA 4RB3C 3Q9SA 3FXRA 2KRFA 4P5OA 1R5HA 1BBYA 1W5TA 1V4RA 3P9KA 4XBFA 3C18A 4ZZLA 1B9MA 4EVIA 5IT9K 4L18B 5JI6A 2D1HA 4L9TA 5EEGA 5ICFA 5KK1A 3WGGA 2O6GE 1SMTA 4RS8A 1ODDA 3C1DA 4HV5A 2BEOA 2P8TA 2XHKA 4Q4ZF 4PGHA 3J7AO 1SFUA 5HS9A 3JTHA 5LEKA 1FP2A 2NNYA 4MHGA 1QPMA 2HS5A 2RC4A 4BHPA 4LJZF 4OIQF 2L3DA 3EYIA 4BH9A 3IHUA 4G6QA 1HBXG 4UVBA 1JHHA 2FOKA 1ONVA 3V8LA 5D5VB 5KVRA 4U88A 2XAJA 2VT2A 1ZRCA 3M9AA 4KFCA 1XD7A 3KP4A 3HOSA 1K79A 2L4AA 2B0LA 1TLHB 4LLNA 3OOPA 1UHMA 2JT1A 4QLCU 2KIMA 2UZKA 3ZN0A 2RGVA 1LJ9A 3GZ6A 2V9VA 5E1XA 2EJRA 3L09A 5BMZA 1NHAA 5CYVA 5IT9Z 5A2QK 1FYLA 3DV8A 3L7WA 1U2WA 2QVOA 3U2RA 5HLHA 2MA3A 4O6JA 1YIOA 1USTA 2DO7A 3SQNA 1JHFA 1TQMA 2MBFA 1A04A 3V7RA 3VFZA 2YSRA 1KU7A 2VBZA 2QZ8A 2V6CA 2RQPA 1T39A 5L3GA 1XCBA 5H6RA 5LEJA 5JFRA 3NRVA 3F8MA 3HSEA 4LD5A 3N4MA 3F23A 4FHTA 3HOTA 5HS8A 1O57A 3IWZA 4U0YA 2LF7A 2V1DA 3ZPLA 5BS6A 2VC1A 3U1DA 1GHCA 4KNYA 1YS6A 1S3JA 1FYKA 1Z05A 3DP7A 1QZZA 1H0MA 6PAXA 3BJ6A 4CYDA 5F1RA 3F8BA 3TGNA 2MH2A 4EMSA 4GO1A 2KKOA 5HOOA 2DQLA 5H20A 3M8EA 4ZZDA 5HS7A 3TO9A 3BJAA 3ECOA 2X0LA 4GXOA 3IL2A 3G73A 3ZN1A 1STZA 2OU2A 3VB2A 2RV8A 4DNCA 3SHFA 1BIBA 1DPRA 1IN5A 3IC7A 3K0LA 4BHCA 2P6TA 3O3KA 3R61A 4P9UA 3RPUA 2VC0A 4KICA 1ZG1A 5AIQA 3CUQB 5LRRA 1S29A 2Z9OA 3LSTA 3U9GA 4M74A 5FB2A 3I4PA 2WWYA 4EM1A 5LGUA 2FEZA 5HDGA 4WXHA 1EV7A 2V79A 3J80K 1C0WA 5FO5A 3HYIA 4I01A 2V1XA 5D6FA 1BOAA 3REOA 2PJPA 1USSA 2FU4A 4HF0A 2UXXA 2XUBA 3I64A 2STWA 2GA1A 1ZRFA 2Z5UA 4ENNA 2DT5A 1I5ZA 4MEYF 1LDKB 4I0AA 4XLPF 4UNOA 4L5IA 2K4BA 3QP6A 2P4WA 4BQAA 1MJBA 2MLKA 4EJUA 1QNTA 2AS5F 2ZXJA 2EA4A 3BJOA 3RJPA 3RKXA 3ULQB 5FLXZ 1R1UA 1W7PB 2BE5F 2ESHA 3E5XA 4PZJA 3T8RA 3E6CC 2IRFG 1F1ZA 1PUEE 2ISZA 3H3UA 3K1PA 1QO0D 4ASNA 3JSPA 2YR2A 2VE8A 1HXDA 2DAOA 2P7VB 3HSFA 3HTUA 1XDUA 2F5EA 3ZMZA 5CVRA 1G3SA 4EJTA 3MEXA 3QP5A 3N97A 5BPDA 1U5TA 3R60A 1QGPA 4M72A 4IVNA 4F7ZA 4HDVA 2NNNA 1VTNC 2JPCA 3PQJA 5J8FA 1KQ9A 1KU9A 3G3ZA 3J80Z 4U0VA 4HF2A 3GO5A 3FXUA 2A69F 3BZ6A 3EYYA 4A5NA 3WU0A 2E7XA 1OYIA 4YG2F 3DF8A 3AAFA 1MKMA 3TDZC 1S8NA 3HTSB 5L3EA 4M6XA 5FGMA 1YTYA 4S05A 1Z1DA 2PMUA 5L3BA 1D8JA 2Q0OA 2Z33A 4MQ9F 2EB7A 2W85A 1QQIA 5FFXA 3HIFA 3M1EA 4KT5C 2M30A 1U3EM 2VE9A 3K1MA 5LGTA 1IXCA 2K4JA 3CTAA 3KP5A 1SAXA 1G3TA 1LEBA 1FOKA 1B59A 1KYWA 5TRDA 3GX4X 2EFNA 3W6KB 5CJ9A 4JK1X 1FNNA 3S2WA 2XAHA 1J0RA 4ON0A 4G6DA 3CO6C 2R7FA 2W25A 2XIGA 5E1WA 3V7SA 1PP7U 3DPTA 1XGNA 2ZBKA 4BHBA 4IF4A 3RI4A 2XAGA 2JZYA 1TW3A 3V8JA 4RB1A 4ESFA 1R7JA 3FF5A 5LBQA 1SD4A 2L01A 2DK5A 2PEXA 5K1YA 5F64A 1K78B 2GAUA 2XV4S 3ABUA 3F8CA 3DPLC 3F6OA 1IN6A 4DQ2A 1T6SA 1YW7A 4RGXA 2QBYA 4M71A 3SZPA 4AIJA 3PFIA 5DCMB 4Y13A 1W4MA 2ZNZA 4GYIA 3NEUA 3I54A 2PFBA 4AIHA 4Q48A 2AXLA 4MGRA 3P9IA 3C7JA 4HX7A 1W7PD 3QOPA 1IXRC 4EQQA 3FXQA 4L0ZB 3GWZA 2CGPA 3RTRA 2EFPA 2L54A 1U6GA 4NQWA 3QAHA 2M45A 3CDHA 1BC7C 4E70A 1ULYA 3CO7C 2IVMA 1BI1A 3PQKA 1R36A 3O2PE 3K9TA 3QU6A 1T2KA 3BWGA 5DD4A 1QZYA 1R5GA 3DEUA 1BC8C 3H3ZA 1XSDA 2IA0A 4ZYHA 4IHSA 1FBSA 1P4AA 1Z6RA 2FF4A 2O3FA 3TOBA 4ZYEA 4CHUA 1G3WA 1AOYA 3QU3A 3MAJA 5EEHA 2DLLA 5CVJA 2H94A 5H6QA 1P92A 5E17F 1OYYA 2PN6A 1I1GA 2PBIA 1YQAA 5IT3A 1TQIA 1MD0A 1YFHA 3W6JB 1I6XA 3MZYA 2W24A 1MJ9A 5DD8A 5LRSA 1XN7A 3LA3A 4HQEA 3B02A 3BY6A 2M5WA 2A07F 4TV7A 2MC3A 4UV8A 4YIIA 3HUGA 1TW2A 2PQ8A 2H09A 2EFWA 2QBYB 2EFQA 2EFOA 5K5QA 4ENJA 2BBYA 3WGIA 4KMUX 4IRIA 1FLIA 1LB2A 4Q47A 4LG0A 3TO7A 3EQLF 1RUNA 1D5VA 2A6EF 3RYRA 3SFZA 4ZYDA 3CUQA 2KJBA 1IF1A 1IN4A 1IN7A 5AIPA 5L3DA 4M6YA 2XROA 1OYWA 1XCVA 2R3SA 2ACJA 3KEOA 1K7AA 4BNCA 5D5XB 1S7OA 4P55A 2JRTA 4N0BA 4PCQA 2QWWA 4MQVA 2VOPA 1YW8A 3F6VA 1BN5A 3CJNA 1UHWA 3ZMTA 3E3VA 4JBAA 2EK5A 3GEZA 1HKSA 5K5OA 1EH7A 2CFXA 2RVCA 2XASA 5TJJA 1O3RA 3LQRA 1KA8A 1UCRA 2HGCA 3KLNA 2ISYA 3T1BA 1KYZA 1JE8A 4RGUA 1REPC 3E97A 1QBJA 1LNWA 5HDKA 4A0XA 1LVAA 3SXYA 3ECHA 3GFIA 5FLXK 2KJCA 1XB4A 2F2EA 1U78A 1SFEA 2R7DA 3LWFA 1W7PA 1L0OC 4KN4X 1SMYF 2EV0A 1P2FA 2BV6A 4FX4A 2HQNA 3GW2A 1XDSA 3ZP5A 3JAMZ 4WX9A 5ICEA 2DW4A 3COAC 4CICA 5ERIA 4UVAA 2A3SA 4G94A 1Y0UA 1ZREA 1Z7UA 2XGXA 3I53A 2BGCA 1LEAA 1SD5A 2NAZA 3D5LA 2D1VA 4N9IA 2VONA 4M9ZA 1HKTA 1PDNC 3ERED 2HKOA 1D8KA 1O3QA 4LG0B 3R6SA 1O3SA 2FRHA 3LAPA 1HQCA 1BJAA 2GQQA 4AWXB 1DDNA 2A68F 1T38A 3KCCA 1MZBA 3QPTA 4AD9A 4BXUA 1DPUA 1SD6A 2E7WA 1YG2A 5CVUA 4YFKF 4LK0F 4YFXF 3LA7A 4RGSA 2DK8A 4HBLA 1B1BA 4EJOA 4L9NA 2DI3A 3I59A 4D0PA 1RIOH 3JW4A 3GFJA 1WSUA 3WG9A 4BYYA 2DPDA 4KUMA 3FM5A 2VBWA 3VODA 4LMYA 3P9CA 5FD6A 2CYYA 2Q2EA 3WE2A 2IJLA 3GLXA 1OKRA 1IRFA 2C6YA 4KYWA 4CXFA 2L02A 2KIUA 3RPQA 5LHIA 4ESJA 4OIPF 4IJAA 4ENKA 1KU3A 2QM3A 2DQRA 1B6AA 3R0AA 5D5WB 4HLYA 1ZG3A 3QRFF 4HDUA 4UV9A 4S04A 3KETA 3GUDA 4LB6B 3IRRA 3HRMA 3SZTA 2ZMEB 1R22A 1X3UA 1MDMB 3KLOA 1RUOA 4LB5A 5HLGA 1XSVA 3HHHA 1R00A 2H6CA 4R8HA 4PGGA 4FT8A 2M1BA 1I27A 2FMLA 3F72A 2IP2A 2VBXA 4MTEA 2RNJA 2HR3A 4UXNA 4P9FA 1KQ0A 5BOXA 2X4HA 3RIRA 1CF7B 2LNBA 3TOAA 1DUXC 3MWMA 1RZ4A 1XMKA 4Y15A 3RKWA 1S6LA 2Y0MA 4ETSA 2FA5A 3HSRA 1K78A 5E8GA 4G7ZF 3GFLA 2VT3A 3I59B 4A6DA 1CGPA 3BPXA 2P5LC 1H9GA 5DYMA 4CDGA 3RYPA 4M73A 2A6HF 2CQKA 2FBHA 3TQNA 1R58A 4OMYA 3K1NA 2LSOA 4ESBA 2FBIA 4RAZA 1U8RA 5DCMA 4KDPA 4JQFA 2F5FA 1PP8F 3ZMUA 2OQGA 1F5TA 3FM3A 1ZHFA 3ELKA 1V3FA 1O7LA 2YPRA 3WGHA 4OOIA 2OA4A 1IRGA 1R23A 2ETHA 2XVCA 3OV8A 5DUIA 2DPUA 1HKQA 5LHGA 4M9SA 5ICGA 1EH6A 3GFMA 3GF2A 1E17A 3KP7A 2GIVA 3CUOA 4KN7X 3C3WA 4R1HA 1MGTA 1ZGJA 3KP2A 3I5UA 1ON1A 3T8TA 3V7CA 4AIKA 2Y48A 2J5PA 4A12A 2PG4A 1K6OA 3M8FA 4B8XA 3HHGA 3IKVA 3TKYA 2RKHA 2FSWA 3ISPA 5L3FA 1XMAA 3I0TA 2IPQX 4G7HF 4ZH4F 5AONA 4HAMA 2COMA 3V8KA 1J5YA 1XGOA 5J6XA 5D4RA 2PLYA 1RI7A 1W5SA 2L4MA 4RGRA 1J2XA 4I2OA 1LDJA 1WWXA 1F4KA 4XRFA 4HX4A 1MJAA 4OMZA 2K86A 1J9IA 1IUYA 1T98A 3DXJF 1JXSA 4UUVA 2F5DA 2IA1A 5DEQA 2YX4A 1IN8A 5LGNA 4U7BA 1XGSA 1ZLJA 2XKOA 3F3XA 2QQ9A 1U5TC 4IRGA 4RB2C 4WWCA 2D2WA 3LQQA 2H6BA 2YU3A 4IXAA 4YFNF 2DBBA 3GYHX 1HSJA 3KEQA 2CO5A 2VN2A 2PI0A 4M9XA 4A0ZA 1IAWA 3HRTA 4EV0A 5D6EA 1Z91A 4HQMA 4OU0A 1SD7A 2J5OA 3E5UA 3V4GA 4MTDA 2F5CA 2Y75A 5ED4A 3I58A 1D3YA 3FMRA 3L9FA 4CO8A 1R1VA 4YIFA 3BDDA 2JSCA 3KE2A 3BROA 4EM0B 1ZG5A 3I71A 1SFXA 1HSTA 2FNPA 3JTGA 1BI3A 3RDIA 1Z9CA 5E18F 2HEOA 5L3CA 4NHJA 2RDPA 2O8XA 2OZUA 2NS0A 3LAJA 4UVCA 4I7HA 1J7KA 1G6NA 3IWFA 3ROUA 1UFMA 2GZWA 2HYFA 5CVIA 3WODF 4MNUA 1FY7A 5BQTA 1OR7A 2PMHA 4GGGA 4OIRF 1HW5A 3JAMK 5D8LB 1FYMA 2QUFA 2M87A 2ZO4A 1L3LA 3F8FA 2E1CA 5ILSA 4KMFA 2STTA 4HYEA 2K27A 5D4SA 4IPAA 5DUKA 3R4KA 1KQ8A 2QYOA 2EV6A 1GXPA 2HQRA 2VODA 1ON2A 1ZRDA 2EA2A 1IW7F 4ENMA 1HW1A 4I09A 3E6BA 2WC2A 3F8NA 1T0FA 4LLLA 3KP3A 2WV0A 2P5KA 2ZCWA 2DU9A 4EJWA 2HZTA 2VXZA 3FMSA 4G7OF 1YS7A 4CGZA 1TNTA 2ESNA 4I98B 4LGWA 3KZYA 4KIBA 2MH9A 4U0WA 2QLZA 5DCFA 1FT9A 2K02A 2H27A 1AWCA 4EGYA 4N9HA 1GXQA 3VOEA 3L00A 3KZZA 3BPVA 1WRJA 4Y17A 2W57A 1ZN2A 1P6RA 4UHTA 1OPCA 2FMYA 4P96A 1YW9A 3WTUC 3GZ5A 4I02A 3MQ0A 3L2CA 2P5VA 5D5UB 4A2UA 4EM2A 1S7AA 2Z3YA 1O3TA 1FPQA 2O61A 3CLOA 1I1SA 5ICCA 1WQ2A 4HOBA 3RKYA 3DKWA 4HA8A 1HW2A 5DDGA 2NRAC 2O03A 3IRQA 4LLGF 5HLIA 3QPHA 5JVTA 2DFIA 1G4DA 3DFGA 2ZJ2A 4RB0A 1R1TA 3TO6A 2LF8A 3K69A 4Q5SF 1YLFA 2ZNYA 4RAYA 5ILVA 3ZMDA 1RNLA 1FBUA 2WTEA 4KIFA 2CSOA 4KIGA 2MD5A 2OQRA 1EH8A 1WI9A 2HKXA 3J81K 3EUHA 2ZMEA 3ZQ7A 5J8CA 2MLGA 5DV5A 3E5QA 3B73A 1MDMA 2LDUA 2GXGA 4B09A 2OD5A 5A2QZ 4PDKA 1Z6TA 5FFZA 3WTZA 2XAQA 4GYGA 1XSXA 2XAFA 3WTWC 2Q8KA 2V1UA 3EDPA 4HX8A 4WXDA 2K7LA 4FX0A 4KA4A 4EGZA 1ZGAA 2ADUA 1CF7A 2HFHA 5JHUA 3Q5FA 3ML6A 4G9YA 2IW5A 4WF2A 4HZFA 2EWNA 2FBKA 2HDCA 1BIAA 4A0YA 2A61A 3HRSA 2HYGD 4O5VA 2XKPA 1LDDA 2G7HA 1B4AA 4U7DA 1FWZA 2YX7A 1YYVA 3CUQC 3BP8A 4OIOF 3VEPA 3JSOA 5CLSA 4IHTA 2CG4A 4A5MA 2ELHA 2GA2A 2QQBA 2W84A 3T0YA 4BAYA 4XSZF 1TNSA 1ZARA 3E6DA 2XRNA 4L0YB 5CVVA 5FD5A 3Q9VA 5LLQA 3P7NA 2Z99A 3IKTA 2OBPA 4L5JA
chains in the Genus database with same CATH superfamily
2VJ5A 2F4VH 1J75A 3TDUC 2ZM6H 4GCVA 5J47A 1OMIA 4NB5A 2FNAA 1H9TA 5KFGA 4E4TA 3WTVC 1IDYA 5DG7A 4X0GA 4P1WA 3ZQCA 2QYZA 2F4MB 4JV2A 5GP9A 2P6SA 3RFCA 2BHYA 1ERDA 3LL7A 4XSXF 4IZOA 4Q8FA 4ZYGA 1Z3XA 2QGUA 1ZAOA 4BQQA 1YO5C 3FWEA 4IZZA 4FM9A 3RKQA 3HOYJ 3J81Z 1TTYA 2CWEA 4AIDA 2KFDA 2PX9A 2EV5A 2VQGA 3RQIA 2QENA 2M4GA 1UC8A 1S7EA 1W1WE 2RN7A 4MEXF 2UXNA 3DTKA 4O3MA 3GXOA 2LRDA 4LK1F 5E1ZB 5KFWA 2UWMA 2X6YA 2XPWA 4XKWA 2X9DA 4WD3A 3H4BA 1FSHA 4RUCA 3RGXA 4ECUA 1MNEA 4QWAA 2M7AA 2BY2A 4QTRA 1Q1HA 3MR2A 4HV6A 1E2XA 3ABTA 3Q8PB 3O6BB 4WCGA 3WTYC 1B9NA 2DA4A 2A5YB 1VQMI 1T94A 2YCHA 3ORRA 4G8XA 1TWAA 3EETA 4X1EA 5KT2A 1S03G 1WKMA 1LQ1A 4M3EA 3MZHA 1KU2A 1XGMA 2BW3A 2O7OA 3FDSA 4J9NA 5HV6A 5K5RA 2F48A 4CUGA 2VKDA 4ED8A 2O8KA 1ETOA 3PNYA 3K2ZA 1FSEA 2DMTA 3RGZA 5KFJA 3HPHA 5GAGJ 3I56I 1ZLKA 4XZ3B 1WH5A 2HTJA 4K2EA 2J9GA 2IA6A 5KFZA 2M8EA 2FOWA 2XPUA 4R8UB 3KYLA 3F22A 4NC7A 2VUGA 4IRHA 4C5AA 2ZXWH 3PSIA 2DOFA 3M7GA 1FX7A 1MSEC 1RK6A 4O3QA 4B3XA 3HEFA 4LSAA 3HRUA 2LY2A 4ITVA 4X65H 4YR0A 5ILUA 4X64H 3LA2A 4PFOA 4CA0A 2VOOA 2G7UA 4TV8F 2GWRA 3O8HA 1D1BA 2JTVA 3FMQA 1IZ1A 5A2QW 2HVQA 4LFUA 5KFVA 2BYVE 2JUGA 2ZMEC 4MV6A 5E8IA 5KFFA 4DIQA 2ZFWA 2JSPA 3GZNB 2QEXI 2E1NA 1BM9A 3GLLA 3MVPA 3H92A 4WK8F 3WTSC 3FZVA 5LMUH 3WO0A 2R7RA 4AM3A 1S10A 2NVTJ 2KIFA 4CZZA 4LFBH 2FQ3A 2GXBA 2LD5A 2RGRA 3WE3A 3M9MB 4JUZA 3J7AK 2IA2A 3KYCB 2FXAA 2ZSIB 2CW0F 3BOQA 3KFWX 1OCRH 3KP6A 4WXCA 1IDZA 2V6EA 4A6EA 3DLLF 4XRMA 2OAZA 2NYXA 2AQEA 4XK4A 4S0HB 5F1JA 1PX2A 3MWEA 4UB6C 4RAGA 5F9LA 1QHGA 5JR3A 2KPMA 1NG6A 5E3LA 3FIWA 1J59A 4FASD 3J7AY 3WTTC 2X1DA 4RA2A 3GVAA 2P7CB 5BPIA 1H8AC 1WCMA 5D8KB 2GOXB 3R0JA 1GVJA 4I0BA 1PJRA 2TDXA 3IH2A 1BA5A 2FPGB 4MA0A 2VQFH 4DL7A 2ZFUA 3FKJA 2V4QA 3OYDA 1ZGWA 2LKPA 3ZMVA 5J4VA 3PR5B 3WU1B 2UVVA 3T5XA 2ELKA 3MFKA 1X2MA 2JPBA 1O7FA 2K3FA 3WTXC 2ZKZA 5F6FA 3VPBA 5LHHA 2HWVA 4RZQA 3DKXA 1T08B 3Q8RB 4LF9H 3N6XA 4C2MA 2YRXA 4LIVA 4Z2YA 2LVSA 4L9VA 3CMYA 3BZKA 1WJCA 4HG2A 4IEJA 1FC3A 5HDNA 4H0EA 2I80A 3R5XA 1Y14B 5KG1A 2CMPA 4UUTA 4QWQA 2ICWG 2W6QA 2FE3A 4G3IA 2O0YA 2XGPA 4UB8C 1T33A 1UB9A 2M0CA 4HW0A 5HVQC 1ZYRF 3ASOH 3V6KA 4BY1G 1P4WA 1FTTA 4HLXA 4HNTA 4YBZB 5JVLA 2KMUA 4G6TB 3GTMJ 3E6MA 3FX3A 5KG2A 3K4KA 2VASA 4XLAA 3RCOA 3SE7A 1N77A 1FBQA 1KGSA 3FHZA 2OZ6A 4XLNF 2D45A 2G9WA 1JGSA 4RM3A 2HTSA 4RBOA 5KG7A 1TQPA 4FISA 5C4XJ 3F21A 1U8BA 2VBYA 1DP7P 2JA8G 3BAAA 1VQ5I 2XAUA 2LBFB 1FZPB 2XC7A 3WG7H 1S0OA 4IAJA 3Q1KA 1P4XA 1BI0A 4YR2A 1U5TB 3ZMSA 3OYFA 4A3GG 1MNMC 3BZCA 4GFBA 4D5CA 4L9JA 2IT0A 1ZH5A 3GV5B 2FPIB 3DQVC 5FLMG 2R93A 1GLVA 4UUSB 2DTRA 1V5GA 1Y1VJ 2WTFA 1G3YA 1EA3A 4EJVA 1I94H 3AL0B 5JVDF 5LFAA 2KP6A 4R79A 3PO3J 1DGRM 1YX3A 1F9NA 1FKAH 1IXSB 3G71I 3T5HA 3LFKA 4BY7J 2Y0SA 5IYCJ 4YRVA 4HF1A 3B6AA 2IS6A 1EZ1A 1D0ZA 1DV1A 3JRHA 2LY9A 3D0SA 3NQOA 4OINF 3J81W 3TP3A 3MCZA 1FP1D 4CYCA 1PUFA 2QQAA 3TMOA 1K4SA 2GM4A 5L1KA 1BI2A 5E20A 1TBXA 3VSKA 2HOEA 3FBIB 1M0TA 4AVPA 1JUSA 3HBLA 4RB3C 3Q9SA 2Y9ZA 2XGCA 4D1QA 4F4ZA 2MSYA 2DCEA 2W4SA 3FXRA 2KRFA 2C00A 4P5OA 1R5HA 1BBYA 5DTDA 1W5TA 1LPQA 1GSHA 4A3MG 2L7MP 1F43A 3NARA 3EUKL 1V4RA 3P9KA 4XBFA 3C18A 3CCEI 4ZQIA 4ZZLA 3UNGC 1B9MA 4EVIA 4JI7H 3CZ6A 1VNDA 1FOXA 5IT9K 4DV0H 4L18B 1ACIA 1Q1VA 5DQIA 2WDTA 2NU8B 2Z2SB 5IY5H 2K9SA 1JUPA 2VUMG 2COBA 5JI6A 4Y7NJ 1WI3A 4J19A 1UZCA 2D1HA 4L9TA 2R5YA 3FMAA 2NUAB 4LG3A 4A3EJ 2HXOA 5EEGA 4ZTJA 1N75A 5ICFA 5KK1A 3WGGA 4Q43A 2O6GE 4ECYA 1TWFA 1SMTA 4RS8A 3ABKH 1LFUP 1ODDA 2WY7Q 4L5EA 1A0IA 1DGWY 3C1DA 4XRSG 4X62H 3J80W 4HV5A 1N78A 2BEOA 2P8TA 2OC6A 2R7OA 2XHKA 4B3SH 4Q4ZF 2L2OA 4PGHA 1IV6A 1OWTA 1I50J 4IQ4A 4XLCA 3J7AO 4E7JA 4C5BA 1SFUA 5HS9A 2B63J 5T14A 3JTHA 5FJ8G 1VF9A 5LEKA 1FP2A 2NNYA 3DLAA 4MHGA 1Z2OX 1QPMA 2HS5A 2DMUA 2RC4A 4LJZF 4BHPA 4OIQF 5DG8A 1MBFA 3KHGA 3H3VH 2L3DA 4C5CA 4C3IJ 3EYIA 4BH9A 4JI0H 4M3BA 3DWLE 3IHUA 4G6QA 1HBXG 2QA4I 3ABLH 4XKVA 4UVBA 2RDJA 4JI8H 4E7HA 1ZR4A 1JHHA 3HJEA 2FOKA 4BJTA 1BJZA 1YE9A 3MZ8A 2L7KA 2IGKA 3KPHA 3E1SA 3RPUD 1ONVA 2WAQN 4C9YA 3V8LA 4ZJZA 4IQJA 4QW8A 2D5VA 5E79C 3R5FA 4XICA 4Y4RA 3S15J 5D5VB 2KZVA 1VQLI 2Y69H 5KVRA 4XIDA 1S9FA 3S3NA 2BHZA 3MWDA 3H20A 4U88A 3GTOJ 2XAJA 4YY3H 2VXDA 2VT2A 4YIRX 3TQTA 1ZRCA 4BBRG 3GV8B 3M9AA 4KFCA 1XD7A 2W9CA 4K0KH 1AHDP 3KP4A 3HOSA 1K79A 4PSXA 2Y31A 2LC2A 1AKHB 2V58A 4QIWN 4FS1A 4N4NB 4D5FA 2L4AA 2C28A 4E7SA 4V2GA 2FLLA 5IOYA 3GBGA 1QHHD 2B0LA 3CQZJ 4B44A 4IHXA 2FP4B 1TLHB 4LLNA 3S17J 2CQYA 5E3OA 4DV5H 3BQZA 5KAFC 2DN0A 1KEEA 3OOPA 1UHMA 4IO9F 4J0MA 2EZLA 2JT1A 1E4EB 5BNGA 4PJMA 1E0EA 1IBLH 3H0GJ 3FK7A 4QLCU 2KIMA 4DR1H 3RV4A 2UZKA 4A3FJ 5FKNA 5KFSA 3M8JA 3ZN0A 2RGVA 2JA7J 1LJ9A 4BGDA 1TP4A 4IWXA 3GZ6A 5IYBG 4A3LG 1RKTA 3OY9A 2V9VA 1JXLA 5E1XA 2FMAA 2EJRA 3GILA 2ASLA 2YYAA 5LYJF 4LF6H 3B6CA 3L09A 5CAEB 5BMZA 1GV2A 1N25A 2JA5J 3HOZJ 4UCSA 2VQHA 1NHAA 2M0MA 3KHRA 1XC5A 5J2UF 3F9KA 2HDDA 1KJ9A 3R5HA 5CYVA 4DBQA 4LF5H 5IT9Z 2ASJA 5A2QK 3ZQQA 1VQ4I 1DIKA 5DQGA 1FYLA 3DV8A 2DPIA 3L7WA 3AG2H 4IRDA 1U2WA 2QVOA 3IG0A 1VBGA 1WGXA 3U2RA 1D0YA 5HLHA 3ZQFA 1DV2A 3VWBA 2MA3A 4O6JA 1YIOA 1USTA 2CFOA 2DO7A 4BU2A 1I7LA 5LXTF 3C2BA 5JH7F 3JSLA 3SQNA 4A3BG 3K4CA 2R86A 2P0AA 2R7XA 5KFEA 4JI5H 1JHFA 1TQMA 1HA8A 2XB0X 2GLTA 4JV1A 2MBFA 1A04A 2E5LH 3FXKA 4A3IG 3W2AA 5J3LA 3V7RA 3VFZA 2YSRA 2BQUA 1KU7A 3H5RA 2B7EA 2VBZA 3ABMH 4L5JA 1E4GT 1KBLA 1JKOC 3H5AA 2RAEA 2QZ8A 2V6CA 4CH7A 2RQPA 4NQWB 3BTJA 3SJMA 3HOWJ 2YZNA 1T39A 1XG1A 5L3GA 4O3OA 3T5KA 4EEYA 1XCBA 4N4OB 3A01A 2JQ7A 1IBKH 3HOXJ 1XNQH 5H6RA 2R7LA 5KT3A 3FKIA 2X85A 5LEJA 2CUFA 5JFRA 3NRVA 3F8MA 3HSEA 1N56A 5KFUA 1RPWA 2ZDQA 4LD5A 1YI2I 3KXYT 2AGPA 3N4MA 4B3TH 4XLEA 3F23A 1AA7A 2HQ5A 4FHTA 3HOTA 2ECCA 3ZQLA 3QYEA 5HLTA 3GIJA 4X6AJ 1WJDA 1H88C 3HOVG 2M4KA 5HS8A 1A5JA 5CKTA 1D5YA 4IHVA 1O57A 3BT9A 1OCTC 2FJZA 5B3SH 3UQ8A 2HI3A 2KHMA 3AG4H 1V51A 3D5RC 3IWZA 4U0YA 1DQUA 2LF7A 2V1DA 3ZPLA 5BS6A 4WBNF 2WAFA 2VC1A 3U1DA 1GHCA 5D1OB 2L9SA 3VPDA 4A3DG 1NTCA 4KNYA 2V4RA 3OYLA 4DOZA 1YS6A 1SFOA 2DT7B 2WV1A 4JP0A 1S3JA 1FYKA 4BXFA 2R7ZJ 4A3CG 1CE8A 5EF6A 1Z05A 5GAHJ 2VUMA 1ETVA 3DP7A 3QPSA 1MNDA 1QZZA 4RU9A 3N05A 1H0MA 6PAXA 1IOVA 3BJ6A 4W97A 4AUXA 3LFUA 3PNVA 4CCMA 3OUZA 5LL6b 4CYDA 5F1RA 3F8BA 4M7EA 4ZOLF 2AHQA 2V9KA 4OX9H 3LSJA 3TGNA 1NK3P 5KG6A 4DL5A 1BJTA 3K10A 1QVUA 2MH2A 4EMSA 4F93B 1NG7A 4RM2A 4XRSA 4GO1A 2KKOA 4ED0A 5HOOA 5DGAA 1LE8B 3NGDA 2DQLA 3OSNA 4YJ2F 3GTQA 5H20A 3M8EA 2AQ4A 2Y2ZA 1C30A 3BR2A 4ZZDA 4IR1A 5HS7A 5CQGA 1H89C 2E19A 3K5IA 3TO9A 1RC9A 3RTXA 3BJAA 3ECOA 1CQJB 2X0LA 4GXOA 4DGWB 3IL2A 2HU9A 2K5CA 3G73A 3AFHA 5KCMA 2NU6B 4U7CA 3K70D 5DLGA 3ZN1A 4O2BF 1STZA 2OU2A 4ECTA 3BG3A 2RV8A 3VB2A 4UCTA 1DU6A 4DNCA 4QW9A 3SHFA 3HUGB 3OYGA 2MYSA 1GT0C 1BIBA 1C3OA 2GBYA 5BPFA 2W6NA 1DPRA 2FD5A 5KFQA 3WNZA 2KISA 3EUAA 3OR2C 4EATA 1IN5A 4E7IA 3FK6A 4FE4A 4BWSC 3IC7A 1XTAA 1S0MA 3NWSA 5IYZF 3K0LA 3OMYA 1TT5B 1S72I 4BHCA 5D8DA 1OR7C 2P6TA 3O3KA 4II3A 3G4SI 3MN2A 3R61A 4P9UA 1QRYA 3RPUA 1S9HA 2VC0A 1X4OA 1DGSA 3K4JA 4KICA 3DTEA 5AIQA 3CUQB 5LRRA 5DS9A 1ZG1A 3OYNA 2G0EA 1S29A 2Z9OA 3LSTA 3U9GA 4M74A 3BR3A 5FB2A 3RJ0A 3H9JA 3S3OA 3I4PA 2ME6A 3GTKA 1S68A 2E2HA 1BGWA 4CCNA 2FJ1A 2WWYA 4EM1A 3FHNA 5LGUA 3M3YJ 4Q8EA 4B3RH 1N32H 2ZJPF 2FEZA 3J7YJ 4J9MA 4BUPA 2MCTA 3GIMA 1RYSA 2WAEA 5HDGA 3PIOF 5IYDJ 4WXHA 1E3HA 1EV7A 1VQKI 4R8UA 2V79A 3J80K 2SCUB 3MFHA 1C0WA 4EBCA 5FO5A 3HYIA 1NK2P 5KAIC 3PO2J 2ATLA 3VYUB 5EWGA 2P81A 4HEA2 4I01A 2VQEH 2V1XA 4EFBA 1WR2A 5IT9W 5D6FA 2PBZA 1BOAA 2CQNA 1JUMA 3W2VA 3Q8SB 4M3FA 1R6RA 3REOA 3W6VA 2PJPA 4LH7A 3IN5A 1X3WB 1Y8RB 2HPMA 1USSA 2XF5A 1JT0A 3RB0A 2FU4A 4ECSA 3MKYB 2R93G 4HF0A 2UXXA 2N8GA 2BVMA 2XUBA 4BDZA 1SEUA 4OAZA 4J9QA 4V2FA 2UXDH 2ALZA 3I64A 5DM7F 2X1CA 4MA5A 2VKEA 5C3EJ 1ZELA 3DBRB 2CH0A 5EWEA 2STWA 2HXIA 2GA1A 1ZRFA 3L2QA 2Z5UA 3VMMA 1T0FC 4ENNA 2DT5A 4ABZA 2R0QC 4IHYA 2R92J 3K2AA 4UCOA 5J1RA 1R49A 2EZHA 2FLNA 4LIUA 5KFLA 3E0JB 3HKZN 2XCPA 1I5ZA 3F0CA 4E4HA 2HPIA 5IOZA 1PYVA 4MEYF 3CCQI 1LDKB 2BVLA 2E36A 1I3AA 3L1PA 3G6YA 3ZQGA 1YJWI 3JRFA 4I0AA 3I4NJ 1ZK8A 4XLPF 4UNOA 4L5IA 4DV7H 2K4BA 3QP6A 2P4WA 4BQAA 4TV9F 2BQRA 1MJBA 2MLKA 4EJUA 1ULZA 1QNTA 2AS5F 2ZXJA 2EA4A 3BJOA 5DM6F 4JV5H 3RJPA 3RKXA 3C0FB 3ULQB 5FLXZ 3TL4X 1R1UA 2DA6A 1W7PB 2DOAA 2BE5F 1UG2A 3GTLA 4UFZA 4MIMA 1NH3A 3IV5A 2ESHA 1VQPI 4ECWA 1YHQI 3E5XA 2JK3A 5KFAA 1RETA 4ECQA 4PZJA 3T8RA 3E6CC 1AU7A 2IRFG 4ZYAA 1F1ZA 2VPSA 1OISA 4M6VA 1PUEE 2ISZA 3H3UA 3N44B 2WB1N 2K40A 3K1PA 4MFDA 1X1CA 1XX5A 2JA5A 2XCLA 4AYBN 1OJLA 3UKGA 1QO0D 5F08A 1R4MB 4ASNA 3MKWB 3JSPA 1VQ7I 2YR2A 2EH3A 2VE8A 1HXDA 1W36D 3BG5A 3FBNB 3OIQA 3OYHA 4Y52J 2DAOA 3GIKA 2VPRA 2P7VB 4B1RA 3HSFA 3HTUA 1XDUA 2V4JC 2F5EA 3R23A 3S93A 4EGJA 2V26A 4BEHB 5KNLA 9ANTA 2XGQA 3BC8A 3ZMZA 3S32A 2JA6G 1KJJA 2VJIA 1ZETA 5CVRA 5H2FC 2OCCH 4DR3H 4XYMB 1G3SA 2KLOA 3CMAI 2ZDHA 1E3PA 2YL2A 2LBFA 4EJTA 3MEXA 3QP5A 3N97A 5BPDA 2W71A 2W6MA 1U5TA 4E7KA 3NWTA 1QGPA 3R60A 3V6JA 3RBEA 5KT6A 4M72A 4IVNA 4F7ZA 4EEFG 2M05A 1RR7A 2VKHA 4HDVA 2NNNA 2YU9J 3N42B 4UUSA 2DPJA 1JKJB 1VTNC 2I87A 2JPCA 5L1JA 5JHFA 3HOUJ 4DV2H 2P0WA 3PL8A 2BXYA 3PQJA 1MBJA 5J8FA 3KALA 2A05A 4QWDA 3FISA 1KQ9A 1OCZH 2KT0A 1K61A 2W82A 1KJIA 1I3QA 1KU9A 4EYIB 3G3ZA 3J80Z 1O4XA 4RLFA 3HM5A 3HG9A 4U0VA 4HF2A 3GO5A 4IOAF 3FXUA 3GTPA 4CCKA 4XOTA 4II2A 2A69F 3BZ6A 3EYYA 4A5NA 2ZJRF 4IHWA 5DGBA 1OCCH 2E7XA 3EUHC 3WU0A 3ORQA 1OYIA 4YG2F 2CQXA 4B3AA 3DF8A 3AAFA 3CCRI 1TL8A 2LOOA 4F4XA 1ZHQA 4XNFA 5FKMA 4PDBA 4ECRA 1MKMA 2E1MB 2F4OB 1GUUA 3GTJJ 3PW2A 3TDZC 1S8NA 2X1EA 3PM1A 4RNMA 3K4LA 5JLWA 2PJRB 3PZPA 2IP4A 4DYRA 4TUYF 3HTSB 4ECVA 2VA2A 5L3EA 2DJIA 2Z1DA 4A3KJ 4JV0A 5TISC 1I7NA 2KIQA 2R7UA 4M6XA 3LSKA 5FGMA 4F4YA 3K3VA 1YTYA 3KTMA 4S05A 1Z1DA 3BA8A 2PMUA 5L3BA 1ETXA 1D8JA 2Q0OA 2NS8A 3RSNA 4EG0A 2CKZB 4DW6A 3TEDA 1F36A 2Z33A 4MQ9F 1JDEA 2X6WA 3W3CA 2EB7A 2Q2EB 2W85A 1QQIA 5KT4A 2Q1ZB 3LOCA 3HIFA 3M1EA 2WBMA 4KT5C 5FFXA 1S0NA 4BE1A 2M30A 3ASNH 1U3EM 1B8IA 1ITYA 3V42A 2VE9A 3KIOA 3K1MA 5LGTA 4NBQA 2LH9A 1IXCA 4C30A 2CV1A 3BCBA 2K4JA 3G6XA 4XORA 4ANJA 3CTAA 2C2EA 3KP5A 1SAXA 1G3TA 4BDYA 1LEBA 4A93J 2CZGA 2HNHA 2R7WA 1FOKA 4NXMH 4OWRB 1X2NA 4ECZA 1B59A 1KYWA 2OWOA 3FXOA 5TRDA 2H8WA 3S1NJ 3GX4X 5B66C 2HVSA 4DLKA 3MR3A 2EFNA 1FMVA 1JGGA 3W6KB 2UUBH 3RAQA 2O9LA 5CJ9A 2NVXJ 4JK1X 1M0WA 1FNNA 3BR5A 2IMWP 1RJRA 1B33N 2OV7A 1A6IA 3S2WA 2YS9A 3WU2C 2XAHA 1J0RA 2DA2A 4ON0A 2GPWA 2E2IA 3G6EI 2ID6A 3ZXSA 4G6DA 1JKPC 3CO6C 2R7FA 2I8CA 2W25A 2XIGA 5J4YA 2MGQA 3BQ1A 2HYJA 4NUBA 3KYDB 1GYFA 5E1WA 3V7SA 1K83A 4JI4H 2ME0A 1PP7U 3WHBA 3LSMA 2DZDA 3DPTA 1XGNA 2ZBKA 3TIIA 4BHBA 5GTIC 4FBUA 1V4YA 4LSXA 3GQCA 4X66H 3ZGKA 5M3FJ 4IF4A 3S2HJ 1GSAA 3RI4A 5KFHA 2XAGA 2JZYA 2JA2A 1TWCJ 1TW3A 3V8JA 5GTHC 5IP6A 5FLXW 1HCRA 1OCPA 2DA1A 4AU7A 2V9WA 4RB1A 3FXMA 4ESFA 1AKHA 3CCYA 1FIPA 1R7JA 3HXLA 3G1OA 5BMVF 3LSRA 1VQ9I 2Q2TA 5KFRA 2R7TA 3FF5A 2F6CA 5LBQA 1SD4A 3FKIG 2UVRA 2L01A 2DK5A 2PEXA 3PIPF 5K1YA 1E4EA 2DMQA 5L9XA 5J2TF 3H9QA 5F64A 2C2DA 2W7PA 4JI2H 4ZDOA 2AU0A 4BKXA 4PSWA 2R5ZB 2DXIA 4XLHA 3M9OB 1MMSA 1ETWA 1K78B 4DR2H 1N33H 4EEQA 2GAUA 1G59A 1FIAA 2XV4S 3ABUA 1D1AA 3F8CA 1Y1WJ 2IGOA 3TINA 3QYBA 3TIGA 3DPLC 3F6OA 4BJ6C 3HGGA 5IP7J 3QZ7A 4LFAH 1YJ9I 3BLYA 4KHPH 1YRNB 2NVYA 4U6PA 1X58A 4E6KG 3HGYA 1EUCB 3PNTA 3M1CA 1IN6A 2R6FA 4CSWA 3BCAA 1UJ8A 4DQ2A 3MR5A 1OLTA 1MBHA 4ZI7F 1T6SA 1XMQH 1YW7A 4RGXA 2GLOA 2QBYA 3BJYA 4M71A 3SZPA 4AIJA 5J40A 1V5EA 3N40P 3PFIA 4NC8A 5DCMB 1W4MA 2ZNZA 4Y13A 1Y1VG 3DKYA 4GYIA 3NEUA 4O3PA 2E71A 5C44J 3I54A 1I6HJ 1JT6A 3L2VA 2PFBA 4AIHA 5GAEJ 4QPQA 2JA6A 2L7ZA 3KEYA 1O75A 4Q48A 2AXLA 4MGRA 3P9IA 3C7JA 5B1BH 1ZQ7A 4HX7A 4JYKA 1BR4A 1VZ0A 1W7PD 2K9MA 3QOPA 5LOVF 1B8IB 5IWAH 5IYCG 1IXRC 2RREA 3FDYA 2X51A 4EQQA 1QA6A 2K9LA 4J9OA 3FXQA 4L0ZB 3GWZA 5IPAA 2VLAA 2CGPA 4YJ3F 3RTRA 2EFPA 4DZJA 3GTGJ 2L54A 4C3HJ 1WVRA 3JRCA 5GPAA 2LK2A 1WJFA 4NLGA 1U6GA 4NQWA 4YQWA 3QAHA 2M45A 5KFBA 3CCVI 3U21A 1FTZA 1J5EH 3CDHA 1BC7C 3L2RA 4Y3OA 4E70A 2MG4A 1ULYA 3CO7C 2IVMA 2F5VA 3GIDA 1BI1A 3PQKA 1R36A 3O2PE 3IH3A 3K9TA 4BBSJ 4I50F 3QU6A 1T2KA 1TWHJ 2LMDA 3BWGA 3TBIA 5DD4A 3HDDA 1QZYA 2E1OA 1R5GA 3DEUA 2ELJA 1JKQC 2M7BA 1K1SA 3A02A 1BC8C 3H3ZA 4XOPA 4ZHQF 1HR0H 1XSDA 2DMNA 2QCOA 4QPOA 4PFPA 4IKFA 1D1CA 2IS2A 2IA0A 2DFHA 4ZYHA 4A3JJ 3CDIA 1AUXA 3BQYA 3BG7A 4IHSA 4AC0A 1FBSA 1P4AA 4JOMA 3SFIA 3RZOJ 4A3EG 1KC7A 2VKVA 1M7JA 1Z6RA 4ED1A 2FF4A 2O3FA 2PMZN 5K7HA 3D5SC 1Z0XA 3CDLA 1KJ8A 3TOBA 2LKXA 2LKSA 3ETJA 4GKKH 4ZYEA 4CHUA 5D1OA 1G3WA 1AOYA 5J1YA 3QU3A 1FMWA 1HDDC 4FU0A 5LA6F 2LYCA 3MAJA 5EEHA 5IYBJ 3L2PA 2DLLA 3RAXA 2VQCA 4D9JA 2B63G 3DPUA 5CVJA 3CP8A 3I55I 1P7JA 4YR3A 2H94A 5H6QA 1P92A 5E17F 5KFOA 4IRKA 1LFPA 1R9TJ 1OYYA 1WJEA 5K2MA 2PN6A 5EZYF 3C2GA 1JX4A 4FETA 1KJQA 2DYRH 1I1GA 2IGNA 2PBIA 1YQAA 1IBMH 4I4TF 5IT3A 1TQIA 1MD0A 1YFHA 3W6JB 3K4BA 5KX5F 1I6XA 1A9XA 3U9TA 3MZYA 2JEIA 2GPSA 1LE8A 2W24A 1MJ9A 5DD8A 1XMXA 4MV4A 2WAQE 5LRSA 1V9PA 1XN7A 1WPKA 3LA3A 2R4GA 2UXCH 4JX4A 3TW7A 2W70A 4HYKA 3T5JA 4C3JJ 3B02A 4HQEA 4JI1H 4JI6H 3BY6A 1T95A 2HJWA 3EPZA 5EZHA 4QJFA 4UCVA 1ENHA 3LSHA 2M5WA 2CUZA 2W00A 2A07F 5J1UA 1DP3A 4TV7A 2AQFA 3SDBA 2OTJI 2MC3A 4UV8A 1UAAA 2ID3A 3ZQHA 4YIIA 3HUGA 1TW2A 2PQ8A 2H09A 2EFWA 2QBYB 4APMA 2EFOA 3BR0A 2J6TA 4QIWE 5KFKA 3H35A 4BQOA 2FK2A 1MH4A 5K5QA 4ENJA 1WJBA 4FQGA 1IGNA 2R7VA 3G8CA 4XYLB 4FS2A 2BBYA 2B9SA 3WGIA 3BTLA 2OH2A 4FBTA 4KMUX 4IRIA 1FLIA 1LB2A 4Q47A 4LG0A 4ED3A 1ZQ3P 3TO7A 3VPCA 3EQLF 1S5LC 1VFCA 1RUNA 2DDAA 3I3LA 1D5VA 2DJNA 1HNWH 2A6EF 1MMGA 1Y6IA 3RYRA 3SFZA 4ZYDA 3CUQA 3H0GG 2KJBA 1IF1A 4I55F 1BR1A 1IN4A 2L7FP 4PJNA 1IN7A 5AIPA 4EBDA 4NNJA 3OIPA 3SYTA 5L3DA 2W7NA 3MFIA 3GIQA 3UFXB 4IX7A 4E7ZA 2Q2UA 2JA7G 2FPPB 4M3DA 4M6YA 1TWAJ 2HOSA 4F4WA 3N8DA 2BQ3A 1ZTRA 5BR8H 1B04A 2XROA 1OYWA 1XCVA 2R3SA 1T8IA 3I12A 4MV9A 1MW7A 3QFFA 2ACJA 3KEOA 2KRCA 2JA5G 3HOZG 1GVDA 2I5UA 1Z7LA 2EILH 1K7AA 3JRIA 2L9NA 4BNCA 5D5XB 1S7OA 2C2RA 4P55A 2HOTA 2E34A 2HZDA 2LP0A 2JRTA 4BJ5C 3RBDA 4N0BA 3GTMA 1WJAA 2OPTA 4PCQA 1XMOH 2QWWA 2IEKA 2R8JA 2IS1A 4MQVA 3UR3C 2C35B 2E60A 3CESA 4YP3A 1POGA 3GIIA 3K7AJ 2VOPA 1YW8A 3OIOA 3F6VA 3JZIA 1BN5A 3ONQA 3CJNA 5KFNA 1UHWA 3PW0A 5FPOA 3ZMTA 1APLC 5F0FA 3E3VA 3X2QH 1Y0NA 4JBAA 2M8GX 2EK5A 3GEZA 1HKSA 2TCTA 4ED7A 5K5OA 3KZIC 1EH7A 2CFXA 5D1PA 3GLKA 3K6GA 2RVCA 5EEAA 1A36A 1SEIA 2DFEA 2XASA 5TJJA 1FVIA 3KHHA 1O3RA 1W5CC 4J01A 3LQRA 4B43A 1KA8A 2R8HA 3O8GA 1JTYA 1UCRA 3DCFA 5CPRB 1D0XA 4D7MA 4BXXJ 1JIHA 1QZEA 2HGCA 2VJ4A 3KLNA 1Y1VA 2ISYA 3T1BA 1KYZA 4DZPA 1IG7A 1JE8A 4RGUA 2KSWA 3H9GA 4CCOA 1REPC 5H80A 2CRGA 3E97A 3PSFA 1QBJA 1LNWA 5HDKA 3HOXG 4XKCA 3KHLA 2VQDA 4A0XA 3BABA 1LVAA 3SXYA 3ECHA 5TGTA 4A2AA 3AKZA 2BR0A 4LITA 3GFIA 5FLXK 2J6SA 2KJCA 1EF4A 4GC7A 1XB4A 2F2EA 1U78A 1OFCX 1SFEA 2R7DA 3LWFA 4EBEA 1W7PA 2M3AA 3M07A 1L0OC 1ZR2A 2VIXA 4KN4X 3OYAA 1SMYF 2EV0A 1GGOA 1FOWA 3N43B 1WCMJ 4QWBA 2H1KA 1P2FA 2BV6A 4FX4A 2HQNA 2DA7A 3GW2A 1XDSA 3ZP5A 3JAMZ 4WX9A 5ICEA 2DW4A 3COAC 3L2UA 4CICA 3P5JA 2VB6A 4GRIA 5ERIA 1VQOI 2EZKA 4UVAA 3TW6A 2A3SA 2KRHA 4G94A 4J9LA 2PN1A 1WJ5A 3OYEA 1OCOH 1Y0UA 2NXNB 4F3QA 1ZREA 4C2MJ 1Z7UA 2XGXA 3I53A 2BGCA 1LEAA 1SD5A 3WO1A 2NAZA 3D5LA 2D1VA 4N9IA 3KAJA 2VONA 4M9ZA 4FTHA 2R7ZG 3DEEA 3K4NA 1BW5A 1HKTA 1PDNC 3ERED 2HKOA 1D8KA 2A5WA 4BEHA 3LSPA 1O3QA 1M6VA 4CC5A 1KONA 2BY0A 3R6SA 4LG0B 5C1PA 4RAFA 1O3SA 4PJ0C 3I4MJ 4HQ6A 4XM3A 5IP9G 3Q0VA 5FPRA 2FRHA 5C5JA 3LAPA 3RIZA 1HQCA 1BJAA 2IBDA 5EOYA 2FLPA 2GQQA 4AWXB 4M9UA 4BACA 1DDNA 5F0CA 2A68F 4LOCA 5EG0B 4HRIA 1T38A 1XNRH 3QPLA 3CMEI 1I50A 4Q44A 3KCCA 4PK4A 4DR5H 5HODA 3OTOH 2B63A 1R71A 1JDBB 3CC7I 4MV3A 1MZBA 2W6PA 3QPTA 2JEGA 4QWEA 2DFFA 2NS7A 4KT6A 4AD9A 1EUDB 4BXUA 1DPUA 1SD6A 5C8YF 4RLQA 2E7WA 1VQNI 5KHDA 1YG2A 3SI8A 5CVUA 4YFKF 2JEFA 4LK0F 4YFXF 3MKZA 4GDFA 2R93J 5BPHA 2Y0SN 2DTZA 3LA7A 4RGSA 2DK8A 1JI8A 4JI3H 5M5YJ 3S14J 4F50A 2F4IA 4HBLA 4Q0YA 1IV8A 1B1BA 4EJOA 3BTCA 1SFKA 4L9NA 2DI3A 3VPRA 3G6VA 3I59A 4C2UA 4D0PA 3JREA 1UHSA 1RIOH 4I76A 3ZR8X 5HBRB 2R7QA 3RB6A 4YHHH 3JW4A 2EQRA 4G12A 4UCUA 2W8LA 2GXAA 3GFJA 1WSUA 2PJRA 3WG9A 2WAQA 2L9VA 4BYYA 2EIKH 2DPDA 3RB3A 3GTOA 5EWFA 1T36A 5KT5A 1V54H 4KUMA 4XN3A 1MMAA 3FM5A 3MJFA 5EGOB 2ECBA 2VBWA 2KDZA 3VODA 4LMYA 2OF7A 4Y33A 1N48A 3P9CA 1K4TA 3CCMI 5FD6A 2JUCA 2K9NA 3E7LA 2QF7A 1P9QC 3A1YA 5DQHA 3CQZA 3V4SA 4DL2A 2CYYA 2I8DA 2Q2EA 5IYDG 1PK8A 1HDPA 2MC4A 2IJLA 3WE2A 3CJQB 5KFMA 3GLXA 2L5QA 2C22A 2EINH 4QIWA 1YITI 3OYKA 3H0GA 5KFTA 1OKRA 1U9NA 1Z77A 1IRFA 4F52A 2C6YA 5GPCA 4KYWA 2KDOA 2XGEA 4CXFA 2L02A 2X6XA 2KIUA 3RPQA 4IL6C 5LHIA 2JA7A 2KL4A 1TWFJ 2RQQA 2JWTA 4ESJA 4OIPF 1BL0A 2MW8A 5FROA 1X1DA 4IJAA 4ENKA 2AGQA 1KU3A 1MSFC 2QM3A 2DQRA 3RB4A 1YJNI 4I99C 4B47A 2X0SA 4ZC3A 1B6AA 4XL9A 3R0AA 2IGMA 3GMEA 4M3GA 5D5WB 2DA3A 1SANA 1Y39A 2CV2A 4HLYA 5KFYA 5C3EG 4DL4A 4DV4H 5GADJ 3HKZE 1ZG3A 3ERMA 3CCUI 3QRFF 4YAJB 5KKNB 5KG5A 5FRMA 2R92G 1B6RA 3K3PA 4HDUA 4UV9A 3G2BA 2JRMA 4O3NA 4S04A 1IO2A 3KETA 1GO3E 2UU9H 2XF7A 3GUDA 4LB6B 2JMWA 1X1AA 4XKBA 3IRRA 2QQ8A 3HRMA 3SZTA 2XGDA 1A35A 2ZMEB 3I4NG 1X19A 1R22A 5M5WJ 2VQLA 1X3UA 1MDMB 3KLOA 1RUOA 3PVXA 2UVUA 2FX0A 2DOEA 4LB5A 1WH2A 5HLGA 1XSVA 2HQAA 2RF4A 1WH7A 3HHHA 3V4ZA 1R00A 1RK5A 2H6CA 4R8HA 2W1OA 4FT8A 4PGGA 2X6OA 2IS4A 2M1BA 3L4KA 1I27A 2FMLA 3F72A 2IP2A 3S3MA 2VBXA 4MTEA 2RNJA 2HR3A 5FKOA 4UXNA 1QPIA 1GDTA 1AN7A 3IAM2 2EZIA 4P9FA 1KQ0A 5BOXA 2X4HA 1QU3A 3RIRA 1UC9A 1CF7B 2LNBA 3TOAA 1W0TA 2R7NA 2WB1E 3JAMW 3LMMA 1HNXH 4EFEA 4AYBE 2W8KA 3IP4B 1DUXC 2FQ4A 3MWMA 1RZ4A 1XMKA 4Y15A 3RKWA 3HOYG 1S6LA 4DV3H 2Y0MA 4DUZH 5EZGA 1JJ8C 4ETSA 2FA5A 2R5ZA 1BOBA 4KISA 3LP8A 4YAKB 1S97A 3HSRA 2AO9A 2RNGA 3H4DA 2CQ7A 1G8XA 1LUJB 2YUSA 5E8GA 4G7ZF 1K78A 3GFLA 2VT3A 1E4FT 3OOUA 3I59B 4A6DA 3PW5A 3JSNA 4Y8VB 1CGPA 3Q8QB 4LF7H 3BPXA 2P5LC 1H9GA 1JKRC 1BXRA 4KJZA 5DYMA 2CJJA 3ZOBA 4CDGA 1YRNA 1RJQA 3OYJA 1BW6A 2DLNA 4M73A 2A6HF 3RYPA 1FEXA 2VOBA 2CQKA 2FBHA 3Q0UA 4XONA 3TQNA 5CA1F 3A0HC 3IUOA 4QWCA 3MR6A 1TWGJ 2CW7A 2W9AA 4MV7A 2NU7B 3KX2A 1R58A 4OMYA 3K1NA 5KT7A 2DMPA 2LSOA 4ESBA 2FBIA 2L9RA 4RAZA 2DWCA 3CVZA 1U8RA 2R7ZA 5DCMA 4KDPA 2ZC2A 1MBKA 4JQFA 2F5FA 1JLLB 1PP8F 3ZMUA 5B1AH 2OQGA 3HOUG 1F5TA 3FM3A 2FB9A 1ZHFA 3RV3A 1TAEA 2M9HA 3ELKA 1V3FA 1O7LA 2YPRA 4BY1J 4MV8A 2Y9YA 3WGHA 4OOIA 3Q3SA 5F27A 4J00A 2AXTC 4O2AF 4B3MH 2OA4A 3HC7A 1IRGA 4O4HF 3DU6A 3A03A 1RYRA 4PJJA 1R23A 2ETHA 2QSHX 2XVCA 3OV8A 5DUIA 2DPUA 2HGSA 2BY3A 4HNVA 1HF0A 1HKQA 1B72B 1A6QA 5B5EC 3PW4A 2JJ7A 5LHGA 3U9SA 4M9SA 5ICGA 1EH6A 3GFMA 2JA8J 1SCUB 2XDVA 3GF2A 1E17A 4MLOA 4E7LA 1TA8A 3KP7A 2YZGA 3VYSB 4A3GJ 2GIVA 3CUOA 4KN7X 3C3WA 4R1HA 4B4CA 3JRWA 3OSPA 3OL4A 3A2KA 2FUG2 1MGTA 4OAYA 1ZGJA 3KP2A 4IHJF 5FLMJ 3EPIA 3M9NB 2KZGA 3I5UA 4A3KG 4CZCA 1ON1A 2E1MC 3OYIA 4O4IF 3T8TA 3V7CA 4AIKA 2Y48A 2EIJH 2J5PA 4A12A 2PG4A 2XC9A 1X1PA 1K6OA 3M8FA 4B8XA 2V59A 2WYOA 5JQWA 3HHGA 2EPFA 2BXZA 5C1OA 4B48A 4HSRA 4TQRA 3FKIJ 1R5ID 2XF6A 3LMLA 3PUFA 5LP6F 2LLKA 3IKVA 2EIMH 2RKHA 3TKYA 4EYHB 1MBGA 2FSWA 3ISPA 2LR8A 1M1EB 3A0BC 4XMYA 5L3FA 1XMAA 3I0TA 2IPQX 3H3VK 3GIPA 3T1HH 4G7HF 3CCLI 4ZH4F 4O3SA 5AONA 4EGQA 4HAMA 1IRXA 2R7MA 4YEJA 3TQ1A 3BR6A 1BNCA 1SYXB 2WE6A 4A3MJ 2COMA 4ED6A 1IC8A 1YIJI 4A93G 3ETHA 3V8KA 1N36H 2UXBH 3QYFA 2CU7A 3CJTB 1GLNA 1J5YA 1XGOA 5J6XA 5D4RA 4DR4H 3U1KA 1IJWC 4DL3A 2BW3B 1R4NB 4XR6A 2XSDC 1SFOJ 1RI7A 2PLYA 3BQ2A 2LREA 3EPGA 1W5SA 5L1LA 3HPGA 2L4MA 4RGRA 4J9RA 1J2XA 2VUMJ 2WADA 3OL3A 4I2OA 1LDJA 2FK3A 1WWXA 1F4KA 2ZDGA 1JTXA 1QVTA 1G2HA 4XRFA 1UMQA 2PVPA 5CB4F 4GC6A 4RNOA 4HX4A 4CCJA 3FXJA 1IUFA 1MJAA 4U87A 2VL8A 3AG1H 3OSFA 4OMZA 2K86A 5KFPA 3H5NA 1J9IA 4FCYA 1IUYA 4CCLA 1T98A 3DXJF 3CF2A 1JXSA 4UUVA 2F5DA 3ZCOA 4BS9A 2IA1A 3T1YH 5DEQA 5C4XG 2YX4A 3H36A 1GSOA 1IN8A 5LGNA 4U7BA 3BQ0A 1XGSA 3L4JA 1P7IA 2X48A 3JRBA 4DYCA 3GTQJ 1ZLJA 2R7KA 2XKOA 1Z21A 3F3XA 4L1KA 4A2BA 5FJ8J 1BR2A 2R92A 3MKLA 3CD6I 2E2JJ 2R85A 2R8KA 2QQ9A 1WSCA 5L1IA 1TZLA 1U5TC 4IRGA 3DU5A 4YELA 3DBHB 3PO3G 3IAS2 1SC7A 1HLVA 4RB2C 4WWCA 2D2WA 1ORKA 2QK4A 2V5AA 3LQQA 1I39A 2GOMA 2CUJA 4HPQA 2H6BA 2VA3A 2L0KA 4LF4H 2YU3A 3HKZA 2QKMB 4IXAA 4YFNF 2DBBA 4Z6YA 3GYHX 3VSLA 3AL0C 1SVMA 4RZRA 5CQEA 4J9SA 1HSJA 1IOWA 4IRCA 5JVGF 3KEQA 2CO5A 2VN2A 4PJLA 3QODA 2PI0A 3H1CA 1MIJA 2HDWA 3AG3H 4M9XA 4A0ZA 1IAWA 2YZMA 3CJRB 2UUAH 2H8RA 3GV7B 3HRTA 1LKXA 5F9NA 1N34H 3E5NA 5DG9A 2HOAA 2IXSA 4EV0A 5D6EA 1MMDA 1Z91A 4MAMA 1Y1WG 4DJAA 5C4JJ 4ZDPA 4HQMA 4OU0A 5IP7G 4BBRJ 1V5FA 2ZSHB 2R8IA 1SD7A 4LF8H 2J5OA 3OHAA 3CF5F 3CCSI 3GTKJ 3E5UA 1W93A 4JYAH 3V4GA 4MTDA 2F5CA 2E2HJ 3PN1A 2Y75A 3MD2A 5ED4A 2IAIA 1TT0A 3I58A 1VQ6I 4W1UA 1VKZA 3K4MA 4F92B 2VPQA 1D3YA 2HHHH 2CW8A 2CS3A 3FMRA 3TP0A 3L9FA 2WB1A 4CO8A 1R1VA 4YIFA 4LFCH 5EDNA 1TC3C 3BDDA 5C44G 4AYBA 2JSCA 3K70C 2EBIA 3M4IA 2K9QA 2K85A 3KE2A 2W6OA 3BROA 4EM0B 4NXNH 2JN6A 4DYQA 1ZG5A 3I71A 4MV1A 2OJED 2NOGA 2UUCH 3MMYB 3DF7A 1SFXA 1HSTA 2FNPA 3G1LA 3JTGA 1XPXA 1L2ZA 4LH6A 1BI3A 1VBHA 3RDIA 4A3LJ 1Z9CA 5E18F 2HEOA 2CUEA 5E3NA 5L3CA 1GV5A 4BE2A 4NHJA 2RDPA 1HOMA 4FE7A 2YU9A 2O8XA 2JEJA 3CMMA 2OZUA 2NS0A 4UVCA 3LAJA 4I7HA 1J7KA 1G6NA 1Z3YA 2E5NA 3IWFA 3WHCA 3ROUA 1UFMA 2XRLA 4NDLA 3M4OJ 2GZWA 5EYRA 2HYFA 2I10A 2FK1A 5CVIA 1CQIB 3BG6A 3WODF 4BBSG 4MNUA 1FY7A 5BQTA 1OR7A 3A4CA 1JJ6C 2PMHA 3J7ZI 4BL0B 2BOLA 2OTLI 2R7SA 3SEZA 1KZHA 4AQYH 1UG0A 4GGGA 4ZTFA 4OIRF 1HW5A 3OYBA 3QZ8A 1I6UA 1T56A 2R87A 4J9PA 3OYCA 5KFIA 1EHIA 2OLSA 4A3JG 3JAMK 4A3BJ 2NVQJ 1RKWA 1W96A 2W6ZA 5D8LB 2OCEA 4O4LF 1FYMA 1FJLA 2VR1A 2PMZE 1MMNA 5K7ZA 2XD4A 2QUFA 3OHBA 3RUPA 3GTJA 1PUFB 4CYCB 5KFXA 4A3IJ 2M87A 1K1QA 4NC6A 4XQFA 3QWLA 3T5LA 2ZO4A 2W7OA 1L3LA 3LNQA 3SZGA 1WZ2A 3F8FA 3S1RJ 5GONF 1WHUA 3JR9A 2XCAA 2NU9B 3GTLJ 2E1CA 4UY8I 4DBRA 2R84A 5ILSA 4KMFA 2STTA 1TWGA 1VI0A 4HYEA 1HNZH 4KITB 2K27A 5D4SA 3JRDA 1FOYA 4IPAA 5KG3A 2DT6A 5DUKA 2NOJB 3R4KA 2QYOA 1KQ8A 4F55A 2EV6A 1HC8A 1EJ9A 5KFDA 2W9BA 3HL2A 1GXPA 4ED2A 3G1MA 3LSIA 4MO7A 4DUYH 3GCMA 2XB5A 4A69C 1ETYA 2LY1A 5EJCA 2HQRA 4RUAA 2VODA 2QSGX 4BQNA 3L2WA 1ON2A 1ZHSA 2Z16A 1ZRDA 2XSJC 2FKLA 4XN0A 3JRXA 4V19K 4UCRA 3PW7A 2EA2A 1IW7F 4ENMA 5EG0A 2V1NA 1E3OC 4A3FG 3HOVJ 3NAUA 1HW1A 3QQAA 1ETKA 3E6BA 4I09A 2R5YB 3V6HA 2WC2A 2R82A 3F8NA 3H0DA 3AYHB 2RDIA 1T0FA 5M5XJ 4LLLA 3KP3A 2WV0A 4AVZA 2P5KA 1LVKA 2ZCWA 2DU9A 4EJWA 2HZTA 2VXZA 3FMSA 4A3DJ 4G7OF 4O3RA 2QKLB 1YS7A 4BY7G 4CGZA 5LMNH 1TNTA 2ESNA 4I98B 3OS0A 3JRGA 1P8LA 2VI6A 5E3MA 4A3CJ 2UVWA 2DDBA 4LGWA 3KZYA 2NVXA 4KIBA 3W2WA 2LTPA 3N41B 2MH9A 4GLXA 1UELB 3S1MJ 4ECXA 4U0WA 2ZXHA 1I3QJ 3BG9A 5K7FA 4DV1H 4BE0A 3CC2I 1J09A 2QLZA 4HSTA 3CCJI 1W0UA 5DCFA 2ZB9A 1FT9A 2K02A 2NVUB 2H27A 1AWCA 1ETQA 4EGYA 3GTPJ 4N9HA 3PFYA 1GXQA 5HNHA 1LFBA 3I9V2 3VOEA 3VYRB 3L00A 1W36C 3RF2A 3KZZA 3BPVA 5EGOA 1WRJA 4Y17A 3KAKA 2W57A 2E5ZA 1ZN2A 2YS6A 1UNNC 1P6RA 4UHTA 1TWCA 2R8GA 1OPCA 3S16J 2FMYA 1A31A 2ASDA 4RMNA 4P96A 3HOWG 1YW9A 2DA5A 3OUUA 1RESA 3HB9A 3RQ4A 3WTUC 2UUZA 3GZ5A 1SAUA 4I02A 2TRTA 4C2TA 3VYTB 4JX5A 3MQ0A 2A6TA 3L2CA 5KG0A 2ZJQF 2P5VA 1B6SA 2W9CB 1Z67A 1WFXA 2AGOA 3OR1C 1T3NA 1X3ZB 3H40A 2DODA 5D5UB 2VPLA 2V7FA 3OWTA 4A2UA 4EM2A 4D7NA 1Z2NX 3K5HA 1Y56A 2QSFX 3VDXA 4HNUA 4CC6A 1S7AA 2Z3YA 2J6UA 1O3TA 4MFEA 5F0HA 1Z2PX 2MABA 4YB8B 1FPQA 4PUSA 3CLOA 5IP9J 2O61A 1I1SA 1Y1WA 4ZDLA 1WQ2A 4HOBA 1SVLA 3RKYA 3DKWA 4HA8A 5ICCA 1HW2A 5DDGA 2NRAC 5DLFA 4DR6H 3OS1A 2O03A 3IRQA 1K6YA 4LLGF 5FKKA 1DU0A 5HLIA 1RJPA 3QPHA 5JVTA 4DL6A 4J9KA 1OQYA 1PVEA 2DFIA 1G4DA 3DFGA 2ZJ2A 1CQTA 4RB0A 1XDNA 5KG4A 1R1TA 3TO6A 4DV6H 2Y30A 3D1NI 2LF8A 2YS7A 3K69A 3S1QJ 3C2HA 4Q5SF 2O5RA 1YLFA 4F91B 2ZNYA 3DEWA 4RAYA 3ZMDA 1RNLA 1FBUA 3ZQIA 2WTEA 4KIFA 5ILVA 4BXXG 5F04A 2CSOA 3S2DJ 1CS0A 1AUVA 4KIGA 2K3PA 2MD5A 2OQRA 4Q45A 2W9BB 1EH8A 1YOVB 3ZRGA 1WI9A 2HKXA 3J81K 3EUHA 2ZMEA 3ZQ7A 5J8CA 2MLGA 5JUMA 3Q2OA 3ESWB 4QSHA 5DV5A 3E5QA 3B73A 1VS0A 4ME6A 1MDMA 2LDUA 2GXGA 4B09A 2UV1A 2YRWA 1VAJA 4R7RA 2XPVA 2OD5A 5A2QZ 4PDKA 2E2IJ 1Z6TA 5FFZA 2V9PA 4I6ZA 3WTZA 2XAQA 3DBLB 1XSXA 2XAFA 4GYGA 5CA0F 3WTWC 1VQ8I 5FKLA 1U0JA 2Q8KA 2V1UA 3SEQA 2W48A 1RRJA 3EDPA 1K83J 4HX8A 4WXDA 2K7LA 3GTGA 4FX0A 4KA4A 1WCMG 3JRAA 2JVGA 1IRZA 4EGZA 1ZGAA 2ADUA 3DTIA 2CV0A 2MFZA 1CF7A 1XS9A 3QOEA 3FXLA 2HFHA 2KQRA 3SDGA 5JHUA 1X4PA 3ML6A 3Q5FA 4G9YA 2IW5A 2VJJA 1TWHA 1U9OA 1YX5A 3S8PA 2DYSH 2YW2A 3Q0WA 4WF2A 3IH4A 3LSGA 4HZFA 2WY8Q 2DIKA 5KFCA 5EDWA 4IOCF 2WA0A 3A01B 5FLVA 2CQQA 2EWNA 1V55H 2JVHA 5M3MJ 2FBKA 3JCUC 2OUMA 4XX0B 2HDCA 1BIAA 3OSGA 4A0YA 2A61A 3OYMA 3HRSA 2HYGD 4O5VA 2E35A 3BA9A 2XKPA 4GKJH 1X1BA 3BTIA 3I4MG 1LDDA 3LWBA 1X9NA 4RDUA 2ZJTA 2G7HA 4H4KC 1B4AA 2M2EA 4U7DA 3CP2A 1FWZA 2YX7A 1ZKGA 1YYVA 1MH3A 5JLXA 3CUQC 2ZXIA 2BY1A 3BP8A 4OIOF 2HVRA 2PMZA 4RNNA 3VEPA 2NVYJ 3JSOA 5CLSA 3HZJA 1RR8C 1R9TA 4IHTA 4XLFA 2CG4A 4PWQA 4DR7H 4A5MA 2Y0SE 2W84A 2ELHA 1SVOA 2GA2A 2H1LA 2LG4A 2QQBA 3T0YA 4BAYA 4IR9A 4XSZF 3PR4A 2M34A 1EKEA 2GIZA 1TNSA 2IBKA 5HNFA 1FJGH 3PO2G 4HR7A 1ZARA 4IWYA 2LFBA 3E6DA 2XRNA 2MD0A 4L0YB 3RZDJ 1MBEA 1B72A 2JA6J 3CLQA 3OS2A 5FRNA 3BR1A 5CVVA 3CC4I 5FD5A 4JX6A 3Q9VA 5LLQA 5LD2C 3P7NA 2Z99A 1Y8QB 4TQSA 3IKTA 3PJRA 1EYZA 2OBPA 5I47A 3PUBA 2BZTA 2EFQA
chains in the Genus database with same CATH topology
2F4VH 1J75A 3TDUC 2ZM6H 4GCVA 1OMIA 4NB5A 2FNAA 1H9TA 3WTVC 2P6SA 4XSXF 4ZYGA 1ZAOA 1YO5C 3FWEA 4FM9A 3J81Z 1TTYA 2CWEA 2EV5A 2QENA 2RN7A 4MEXF 2UXNA 4O3MA 3GXOA 4LK1F 5E1ZB 2UWMA 1FSHA 3RGXA 1Q1HA 4HV6A 1E2XA 3ABTA 3O6BB 4WCGA 3WTYC 1B9NA 2A5YB 2YCHA 4G8XA 3EETA 1S03G 1WKMA 1LQ1A 3MZHA 1KU2A 1XGMA 5K5RA 3K2ZA 1FSEA 3RGZA 1ZLKA 2HTJA 4K2EA 2M8EA 3F22A 2VUGA 4IRHA 3M7GA 1FX7A 4LSAA 3HRUA 4X65H 5ILUA 4X64H 3LA2A 2VOOA 2G7UA 2GWRA 3FMQA 2JTVA 5A2QW 1IZ1A 2HVQA 4LFUA 2BYVE 5E8IA 2ZFWA 2E1NA 1BM9A 3WTSC 3H92A 4WK8F 3FZVA 5LMUH 2KIFA 4CZZA 4LFBH 2FQ3A 2GXBA 2RGRA 3J7AK 3WE3A 2IA2A 2FXAA 2CW0F 3BOQA 3KFWX 3KP6A 4WXCA 4A6EA 2OAZA 2NYXA 5JR3A 1J59A 3WTTC 3GVAA 2P7CB 5BPIA 5D8KB 3R0JA 1GVJA 4I0BA 2TDXA 2VQFH 2LKPA 3ZMVA 3WU1B 3T5XA 3MFKA 2JPBA 1O7FA 3WTXC 2ZKZA 5F6FA 5LHHA 2HWVA 4RZQA 4LF9H 3N6XA 4Z2YA 4L9VA 1FC3A 5HDNA 4H0EA 4QWQA 2FE3A 2O0YA 1UB9A 4HW0A 5HVQC 1ZYRF 1P4WA 4HLXA 3E6MA 3FX3A 1FBQA 1KGSA 3FHZA 2OZ6A 4XLNF 2D45A 2G9WA 1JGSA 2HTSA 1TQPA 3F21A 2VBYA 1DP7P 3BAAA 1FZPB 4IAJA 1P4XA 1BI0A 1U5TB 3ZMSA 4L9JA 2IT0A 1ZH5A 3DQVC 2DTRA 1G3YA 4EJVA 1I94H 4R79A 1F9NA 1FKAH 1IXSB 3LFKA 4HF1A 3NQOA 3D0SA 3J81W 4OINF 3MCZA 1FP1D 2QQAA 1BI2A 5E20A 1TBXA 2HOEA 1M0TA 4AVPA 4RB3C 3Q9SA 3FXRA 2KRFA 4P5OA 1R5HA 1BBYA 1W5TA 1V4RA 3P9KA 4XBFA 3C18A 4ZZLA 1B9MA 4EVIA 4JI7H 4DV0H 5IT9K 4L18B 2WDTA 5JI6A 2D1HA 4L9TA 3FMAA 5EEGA 5ICFA 5KK1A 3WGGA 2O6GE 1SMTA 4RS8A 1ODDA 1A0IA 3C1DA 4X62H 3J80W 4HV5A 2BEOA 2P8TA 2XHKA 4B3SH 4Q4ZF 4PGHA 3J7AO 1SFUA 5HS9A 3JTHA 5LEKA 1FP2A 2NNYA 4MHGA 1Z2OX 1QPMA 2HS5A 2RC4A 4BHPA 4LJZF 4OIQF 2L3DA 3EYIA 4BH9A 4JI0H 3IHUA 4G6QA 1HBXG 4UVBA 4JI8H 1JHHA 2FOKA 1ONVA 3V8LA 5D5VB 5KVRA 3H20A 4U88A 2XAJA 4YY3H 2VT2A 1ZRCA 3M9AA 4KFCA 1XD7A 4K0KH 3KP4A 3HOSA 1K79A 2L4AA 2B0LA 1TLHB 4LLNA 4DV5H 3OOPA 1UHMA 4J0MA 2JT1A 1IBLH 4QLCU 2KIMA 4DR1H 2UZKA 3ZN0A 2RGVA 1LJ9A 3GZ6A 2V9VA 5E1XA 2EJRA 4LF6H 3L09A 5BMZA 4UCSA 1NHAA 5CYVA 4LF5H 5IT9Z 5A2QK 1FYLA 3DV8A 3L7WA 1U2WA 2QVOA 3IG0A 3U2RA 5HLHA 2MA3A 4O6JA 1YIOA 1USTA 2DO7A 3JSLA 3SQNA 4JI5H 1JHFA 1TQMA 2MBFA 1A04A 2E5LH 3V7RA 3VFZA 2YSRA 1KU7A 2VBZA 1E4GT 2QZ8A 2V6CA 2RQPA 1T39A 5L3GA 1XCBA 1IBKH 1XNQH 5H6RA 5LEJA 5JFRA 3NRVA 3F8MA 3HSEA 4LD5A 3KXYT 3N4MA 4B3TH 3F23A 4FHTA 3HOTA 5HS8A 1O57A 3UQ8A 3IWZA 4U0YA 2LF7A 2V1DA 3ZPLA 5BS6A 2VC1A 3U1DA 1GHCA 5D1OB 4KNYA 1YS6A 1S3JA 1FYKA 1Z05A 3DP7A 1QZZA 1H0MA 6PAXA 3BJ6A 5LL6b 4CYDA 5F1RA 3F8BA 4M7EA 4OX9H 3TGNA 1BJTA 2MH2A 4EMSA 4GO1A 2KKOA 5HOOA 2DQLA 5H20A 3M8EA 4ZZDA 5HS7A 3TO9A 3RTXA 3BJAA 3ECOA 2X0LA 4GXOA 3IL2A 3G73A 3ZN1A 1STZA 2OU2A 3VB2A 2RV8A 4UCTA 4DNCA 3SHFA 1BIBA 1DPRA 1IN5A 4BWSC 3IC7A 3K0LA 4BHCA 2P6TA 3O3KA 3R61A 4P9UA 3RPUA 2VC0A 1DGSA 4KICA 1ZG1A 5AIQA 3CUQB 5LRRA 1S29A 2Z9OA 3LSTA 3U9GA 4M74A 5FB2A 3RJ0A 3I4PA 1S68A 1BGWA 2WWYA 4EM1A 5LGUA 4B3RH 1N32H 2FEZA 2MCTA 5HDGA 4WXHA 1EV7A 2V79A 3J80K 1C0WA 5FO5A 3HYIA 4I01A 2VQEH 2V1XA 4EFBA 5IT9W 5D6FA 1BOAA 3REOA 2PJPA 4LH7A 1USSA 2FU4A 4HF0A 2UXXA 2XUBA 2UXDH 3I64A 2STWA 2GA1A 1ZRFA 2Z5UA 4ENNA 2DT5A 4UCOA 1I5ZA 4MEYF 1LDKB 4I0AA 4XLPF 4UNOA 4L5IA 4DV7H 2K4BA 3QP6A 2P4WA 4BQAA 1MJBA 2MLKA 4EJUA 1QNTA 2AS5F 2ZXJA 2EA4A 3BJOA 4JV5H 3RJPA 3RKXA 3C0FB 3ULQB 5FLXZ 1R1UA 1W7PB 2BE5F 4UFZA 2ESHA 3E5XA 4PZJA 3T8RA 3E6CC 2IRFG 2VPSA 1F1ZA 1PUEE 2ISZA 3H3UA 3N44B 3K1PA 1QO0D 4ASNA 3JSPA 2YR2A 2VE8A 1HXDA 2DAOA 2P7VB 3HSFA 3HTUA 1XDUA 2F5EA 3ZMZA 5CVRA 4DR3H 1G3SA 4EJTA 3MEXA 3QP5A 3N97A 5BPDA 1U5TA 3R60A 1QGPA 4M72A 4IVNA 4F7ZA 4HDVA 2NNNA 3N42B 1VTNC 2JPCA 4DV2H 3PQJA 5J8FA 3KALA 1KQ9A 1KU9A 3G3ZA 3J80Z 4U0VA 4HF2A 3GO5A 3FXUA 2A69F 3BZ6A 3EYYA 4A5NA 3WU0A 2E7XA 1OYIA 4YG2F 3DF8A 3AAFA 1ZHQA 4PDBA 1MKMA 3TDZC 1S8NA 3HTSB 5L3EA 4M6XA 5FGMA 3K3VA 1YTYA 4S05A 1Z1DA 3BA8A 2PMUA 5L3BA 1D8JA 2Q0OA 2Z33A 4MQ9F 2EB7A 2W85A 1QQIA 5FFXA 3HIFA 3M1EA 4KT5C 2M30A 1U3EM 2VE9A 3K1MA 5LGTA 1IXCA 2K4JA 3CTAA 3KP5A 1SAXA 1G3TA 1LEBA 1FOKA 4NXMH 1B59A 1KYWA 2OWOA 5TRDA 3GX4X 2HVSA 2EFNA 2UUBH 3W6KB 1M0WA 5CJ9A 4JK1X 1FNNA 3S2WA 2XAHA 1J0RA 4ON0A 4G6DA 3CO6C 2R7FA 2W25A 2XIGA 1GYFA 5E1WA 3V7SA 4JI4H 1PP7U 3DPTA 1XGNA 2ZBKA 4BHBA 4LSXA 4X66H 4IF4A 3RI4A 2XAGA 2JZYA 1TW3A 3V8JA 5FLXW 4RB1A 4ESFA 1R7JA 3HXLA 2Q2TA 3FF5A 5LBQA 1SD4A 2L01A 2DK5A 2PEXA 5K1YA 5F64A 4JI2H 1K78B 4DR2H 1N33H 4EEQA 2GAUA 2XV4S 3ABUA 3F8CA 3DPLC 3F6OA 4LFAH 4KHPH 1IN6A 4DQ2A 1T6SA 1XMQH 1YW7A 4RGXA 2QBYA 4M71A 3SZPA 4AIJA 3N40P 3PFIA 5DCMB 4Y13A 1W4MA 2ZNZA 4GYIA 3NEUA 3I54A 2PFBA 4AIHA 1O75A 4Q48A 2AXLA 4MGRA 3P9IA 3C7JA 4HX7A 1W7PD 5IWAH 3QOPA 1IXRC 4EQQA 3FXQA 4L0ZB 3GWZA 2CGPA 3RTRA 2EFPA 2L54A 1U6GA 4NQWA 3QAHA 2M45A 1J5EH 3CDHA 1BC7C 4E70A 1ULYA 3CO7C 2IVMA 1BI1A 3PQKA 1R36A 3O2PE 3K9TA 3QU6A 1T2KA 3BWGA 5DD4A 1QZYA 1R5GA 3DEUA 1BC8C 3H3ZA 1HR0H 1XSDA 2IA0A 4ZYHA 4IHSA 1FBSA 1P4AA 1Z6RA 2FF4A 2O3FA 3TOBA 4GKKH 4ZYEA 4CHUA 5D1OA 1G3WA 1AOYA 3QU3A 3MAJA 5EEHA 3L2PA 2DLLA 5CVJA 2H94A 5H6QA 1P92A 5E17F 1OYYA 2PN6A 1I1GA 2PBIA 1YQAA 1IBMH 5IT3A 1TQIA 1MD0A 1YFHA 3W6JB 1I6XA 3MZYA 2W24A 1MJ9A 5DD8A 5LRSA 1V9PA 1XN7A 3LA3A 2UXCH 4HQEA 3B02A 4JI1H 4JI6H 3BY6A 4UCVA 2M5WA 2A07F 4TV7A 2MC3A 4UV8A 4YIIA 3HUGA 1TW2A 2PQ8A 2H09A 2EFWA 2QBYB 4APMA 2EFQA 2EFOA 5K5QA 4ENJA 2BBYA 3WGIA 4KMUX 4IRIA 1FLIA 1LB2A 4Q47A 4LG0A 3TO7A 3EQLF 1RUNA 1D5VA 1HNWH 2A6EF 3RYRA 3SFZA 4ZYDA 3CUQA 2KJBA 1IF1A 1IN4A 1IN7A 5AIPA 5L3DA 2Q2UA 4M6YA 5BR8H 1B04A 2XROA 1OYWA 1XCVA 2R3SA 4MV9A 2ACJA 3KEOA 1K7AA 4BNCA 5D5XB 1S7OA 4P55A 2JRTA 4N0BA 4PCQA 1XMOH 2QWWA 4MQVA 2VOPA 1YW8A 3F6VA 1BN5A 3CJNA 1UHWA 5FPOA 3ZMTA 3E3VA 4JBAA 2EK5A 3GEZA 1HKSA 5K5OA 1EH7A 2CFXA 5D1PA 2RVCA 1SEIA 2XASA 5TJJA 1FVIA 1O3RA 3LQRA 1KA8A 1UCRA 2HGCA 3KLNA 2ISYA 3T1BA 1KYZA 1JE8A 4RGUA 2KSWA 1REPC 3E97A 1QBJA 1LNWA 5HDKA 4A0XA 3BABA 1LVAA 3SXYA 3ECHA 4A2AA 3GFIA 5FLXK 2KJCA 1XB4A 2F2EA 1U78A 1SFEA 2R7DA 3LWFA 1W7PA 1L0OC 4KN4X 3N43B 1SMYF 2EV0A 1P2FA 2BV6A 4FX4A 2HQNA 3GW2A 1XDSA 3ZP5A 3JAMZ 4WX9A 5ICEA 2DW4A 3COAC 4CICA 5ERIA 4UVAA 2A3SA 4G94A 1Y0UA 1ZREA 1Z7UA 2XGXA 3I53A 2BGCA 1LEAA 1SD5A 2NAZA 3D5LA 2D1VA 4N9IA 3KAJA 2VONA 4M9ZA 1HKTA 1PDNC 3ERED 2HKOA 1D8KA 1O3QA 4CC5A 4LG0B 3R6SA