1Y1WG

Complete rna polymerase ii elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete RNA Polymerase II Elongation Complex Structure and Its Interactions with NTP and TFIIS
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-D(P*AP*GP*TP*AP*CP*TP*TP*AP*CP*GP*CP*CP*TP*GP*GP*TP*CP*AP
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y1wG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y1wG01
5BR8Q 2HIXA 3J7ZC 3K8AA 3S15H 1VCIA 2IX1A 1VQ9A 1HH2P 3F2CA 1V9PA 3GTLH 4JC0A 1ASZA 3CMEA 1IBKQ 3BZKA 2GVBA 1IYJB 5C44G 4DV4L 3I4NH 3PF5A 4GLVB 1OXVA 1TWCH 3UDFA 3KFUA 5C0XI 1VQJA 1ASYA 1TWAH 4JOIA 3L0OA 4K0KL 2WB1E 2UUCQ 1K8GA 3RN5A 3PUVA 4BBRH 1X3FA 2K5VA 1E1OA 4DR3L 4HIOA 1VQHA 3E0EA 3OTOQ 1PH3A 3G4SA 2MFIA 4LFAL 3PO3G 1X3GA 1KL9A 1K83H 5JEAG 1KQSA 1NE3A 1PH1A 1VQLA 1AE2A 2NN6G 3UDGA 1X54A 4GNXB 1OXSC 4A3BG 3KDFB 1MJCA 4HIDA 4B3TQ 5AJ3L 4NXMQ 1QVGA 4GKJQ 2JA6H 2R93G 4DPGA 4BY7H 1QUQA 4DV3L 1Z47A 5GADC 3G71A 2XTIA 4YY3L 3FHWA 4JI1L 1PH4A 1J5EQ 4JI8Q 3I4MG 3RLFA 1VQ5A 1G291 4IJHA 2LXKA 1WOCA 2E5LL 2OTJA 1FJGQ 3PGZA 2KBNA 4R4IA 1OTCA 1Q8KA 4LFCL 1VQIA 1E24A 4RMFA 3W1GA 4MTNA 2VQEL 1M1KC 4BY1H 5ELOA 4AYBG 4X65L 2E2IH 2ATWA 4A3MG 4KI0A 3ZJYC 2V1CC 2OTLA 1J6QA 2RCNA 2VQFL 1VQ6A 3WWVA 2YTXA 1PH8A 2AHOB 3DM3A 1GM5A 4DR4Q 1D7QA 3S1MH 3M4PA 1QZGA 3RLNA 5HY6A 3E9IA 3AEVA 1EQRA 4EX5A 4L5QA 1LUZA 2AWOA 3STBC 4AQYQ 4A93H 1Y1WH 2ES2A 1VS0A 1XNRQ 2I0QA 4A3IH 2WFWA 4X62Q 4A3EH 4JBMA 2B29A 2DUDA 5IWAL 4DR6Q 2F4VQ 4IFDG 4JI2Q 5M3MG 3HOZG 2KHIA 2ZTEA 5IT9c 3HOXG 2UU9Q 4PZ6A 4HJAA 1XNRL 4LF6Q 1VQOA 1S72A 1Y1VH 2OQ0A 3F8TA 4R4CA 2JEBI 2E2HH 4NB3A 4OWWB 1CKNB 3U50C 4FDBA 4BA2I 1XPRA 2OWOA 1HZCA 5E7NA 4DKAC 1OXXK 3AQQA 3I2ZA 3KDFA 4PZ8A 3RNUA 3PF4A 3GTJH 1GD7A 5M3MH 3HOZH 4DR4L 2YTYA 3S1NH 1OXTA 1Z9FA 1PFSA 1JJ2A 1C9OA 2VQFQ 1KD1C 4DAYB 1XNQQ 1X65A 3CMAA 4A3LG 2JK8A 2RF4A 4DNIA 2JA7H 4LF7L 4Y7NH 4A3GG 4PZ7A 1SMXA 2R92H 2R7FA 1NMGA 4X65Q 1HR0W 3OW2A 1VQ4A 1VQFA 3CCVA 4QGUA 4A3EG 4A3IG 3CCMA 1B70B 1EYGA 1KC8C 1SE8A 1X55A 1EIYB 3HOUG 4JBWA 1FGUA 1WCMH 4OX9Q 4JV5Q 2KCTA 2BA0A 4BBSH 1FVIA 4DV7Q 2K50A 1SROA 1JJCB 3PUZA 2CFMA 4JI1Q 4AIMA 5LMNW 1M90C 4LF5Q 4A3FG 4IPGA 1H95A 1FL0A 4DV3Q 3S1RH 2ZTCA 4ME3A 4GNXC 2KENA 1X6OA 4NPSA 2HHHL 1HR0Q 2B63G 1CUKA 2EXDA 3H15A 5AJ3Q 1BKBA 1E7ZA 3CD6A 4DK6C 3S17H 4LF5L 5JJIA 1Q7YC 4A3KG 3GD7A 3GTMH 2UXCQ 4OXPA 2N49A 1N34Q 3HOWG 4JV5L 1IZ6A 4B3ML 1A8VA 1X56A 2JA8H 4RG1A 3TS2A 3CPWA 1JB7A 4APVA 2RHQB 2ID0A 1K0RA 4MNOA 4YWMA 3PUXA 3J81c 1PHJA 2FXQA 2MO0A 1VQNA 4JYAQ 2AMCB 4C3IH 2CQOA 3CCQA 2Z6KA 1PH5A 1XNQL 3RZOH 1HJPA 3B6YA 4LW1A 1Y1WG 4IFDJ 4R4OA 3LGJA 5C0XJ 2ZM6Q 2UUAL 4HJ8A 2A8VA 4IOAA 3GTQH 1YEZA 4C2MH 5LMNQ 2WAQE 3AFPA 4UP7A 3I55A 2I5LX 3D0FA 3H0GG 3TQYA 5C3EG 3HKSA 3I56A 4OO1G 5C4XG 1X3EA 4IPCA 3S2DH 1CSQA 1EWIA 2QEXA 4DR7Q 4X66Q 1N33L 3GTGH 4O0AA 1XMOQ 1UE5A 4A93G 1EFWA 4UP9A 1QVFA 4JI4L 4B3SQ 1I50H 2F4VL 3H3VH 1U5KA 2VUMG 1UE7A 4LFBL 4DR6L 1YIJA 2RHSB 4OONA 1YNXA 2DGYA 4BXXH 2VL6A 3J81j 4DV6Q 4DR1Q 1AE3A 4LF4Q 1UE1A 2UXBL 1KAWA 1E1TA 2XGTA 4UP8A 1IBML 3K7AH 4ALPA 3PSIA 1BBWA 1S40A 5IP7G 1Q81C 2UXDQ 3KJOA 1U0LA 1I94L 4L5SA 1WYDA 2BH8A 1XTDA 2K14A 4AH6A 1SFOH 2HQLA 4A3JG 2LSSA 1PH6A 3G48A 3F1ZA 4UPAA 1L0WA 1A63A 2NZHA 4X6AH 1VQEA 3A0JA 3PUYA 3UE1A 5C4XH 4BY1G 2ZJPA 3CCJA 4LUZA 4OWTB 2E8GA 2VQEQ 2ASBA 3FKIH 4JI6L 1VQAA 1P8LA 3A74A 4LFCQ 1DGSA 4LF4L 4P72A 2JA9A 4DR1L 2B63H 3FP9A 1PVOA 4PMWA 3M3YH 3CCRA 3M4OH 2VZAA 2JA5H 4JI0L 4YHHL 4GKKL 1UEBA 3BJUA 3CPFA 1J5EL 4BXXG 4B3SL 3T1HQ 1QVCA 5IE8A 4JOIC 3FKIG 1EOVA 1LM0A 2PNHA 2IT1A 4DV2L 2Q2TA 3CC4A 1I5FA 1N33Q 3HOWH 2YYZA 3STBD 1YI2A 3KF8B 2R6GA 1K3RA 4GKJL 4NXML 1L1OC 1MKHA 4B3TL 2PI2E 5LMNL 5J3BA 1A62A 4LWCA 3M4QA 1N36Q 5GAHC 2B3GA 2ZM6L 4TVAB 2MNAA 1MIUA 1HNWL 4KHPQ 3TREA 4GS3A 5M5XH 3T1YL 2EIFA 5C0XG 3CCLA 3W1BA 1K9MC 3A5UA 2N8NA 2KHJA 1YHAA 5GAGC 1Q12A 5M5YH 3K7UC 3NEMA 2LXJA 4IO9A 3RR5A 3SGIA 3GTKH 5C44H 3ERSX 1TWFH 4BBSG 3AYHB 2QGQA 4C3JH 4EQ5A 4L5TA 4B3MQ 2AKWB 4YCWA 4HJ7A 2JE6I 2D0OA 1S3OA 1N34L 4UY8C 3ER0A 4A3GH 4LUVA 3L7ZC 2C35B 4R1JA 3NELA 4BBRG 1XMQQ 1N36L 2JEAI 4P73A 1UE6A 2NZOA 3GTOH 1L2FA 2I5HA 3E9HA 3PCOB 2BH2A 1PH7A 3M7NA 2R7DA 3PO3H 2HHHQ 2K5NA 1GVPA 3HOUH 4HIMA 3ULLA 2K52A 3BZCA 2Q2IA 2PI2A 2UUBL 4QJFA 3HFZB 3JAMc 3T1HL 1VQCA 4LF9Q 2UXDL 1NTGA 4DR5Q 1NY4A 5IP7H 1N9WA 2F3IA 2F52A 2H5XA 4TQUS 3F2DA 3DLLA 4JI0Q 1JE5A 2AWNA 4OX9L 4A3CG 1L1OA 2Y0SE 1KIXA 1JJGA 2NVYH 4GKKQ 1IXRA 1KXLA 5HGQA 1QZHA 2OQKA 1QUQB 4OO1I 1NBWA 4A75A 4LNQA 4WJ4A 1XPOA 4AYBE 4IOCA 1VQGA 2BA1A 1HNZQ 4LF7Q 1O7IA 1XPUA 3PO2G 2ZJRA 2YV5A 3CCEA 3S1QH 2WAQG 1HNXQ 5LMUQ 3HOVH 3H0GH 5M3FG 1NMFA 1PH9A 1I94Q 2JA5G 4DV5Q 1I3QH 1T9HA 2GVAA 3K80C 2JA6G 3HOYG 1RL2A 1SR3A 4BY7G 2UXBQ 1YVCA 3ICEA 2R92G 2NN6I 2IHEA 4GOPC 4DUZQ 4DV0L 4DV6L 2YTVA 4LF6L 4JI5L 3I7FA 4LFBQ 4POFA 4GN3B 1P16A 5FLMH 1PYBA 3CXCA 4JI2L 4JI4Q 1AH9A 1PYSB 3PIPA 1WCMG 3CAMA 1KRTA 5C3EH 4DR2Q 1IBLQ 3I4NG 1BBUA 1Q1BA 3BU2A 4X66L 2D62A 4R4QA 4AQYL 4B3RL 5H1SE 3PO2H 4QL5A 2CKZB 1TWGH 3KJPA 3CCUA 1CKMA 4IJLA 1G6PA 4A3JH 2UUAQ 5IYCH 3U4VA 2N78A 2K75A 4LF8Q 1Y1VG 2MO1A 3HKZG 3ULJA 1L1OB 3HOYH 3HKZE 1HZ9A 2JQOA 4DUYL 1YJNA 2NVXH 1PV4A 1W3SA 3TRZA 1N32L 4DR7L 1CSPA 1SLJA 3K81C 4JYAL 3K0XA 3S24A 1N8RC 4X64Q 1K73C 4A3BH 4DK3C 4LF8L 5IYCG 4OWXB 4QY7A 2Q2UA 4J15A 5FLMG 2E5LQ 3J80i 2R93H 2PQAA 3S14H 1PH2A 3AFQA 3MXNB 1KRSA 4JI8L 3CCSA 4YWKA 3L2PA 4GNXA 4B3RQ 2UXCL 5EAYA 4H02A 1OXUA 2PQAB 4GLXA 4YY3Q 1VQMA 3PUWA 4P71A 3F2BA 2HIVA 1IBLL 5GROA 4DR2L 4P75A 4QIWE 4GOPB 2VW9A 1HR0L 3I4OA 4Y52H 4JI5Q 4O2DA 5IP9H 3S2HH 1Q86C 3KF6A 4DUZL 5IYDH 3S16H 3NENA 4DV7L 2K4KA 3TEHB 3A5ZB 4A3MH 4C3HH 3G6EA 1Q82C 1VQKA 4LUOA 1HZAA 3RLOA 2WP8J 2VUMH 4LFAQ 1HZBA 3M85A 5M3FH 4HJ5A 3EBEA 5LMUL 4QQBX 3CW2C 4DR3Q 4PG3A 4A76A 2A1AA 2D0PA 1EQQA 1VQDA 2Z0SA 1W2BA 4R4TA 3IRBA 4P74A 1C7YA 1UWVA 1V1QA 1YZ6A 3GDEA 4DV4Q 1X9NA 1NJIC 1JT8A 3GO5A 3KYHC 1WFQA 2PMZE 4BA1I 3W5OA 4XTCS 3Q8DA 1WJJA 1VQ8A 1GO3E 1GKHA 3H3VI 2EQSA 4A3KH 1RIPA 2CWPA 4YCUA 3ULPA 3I4MH 4POGA 4A3DH 5IYBH 1JMCA 4A3CH 4GLAC 1E22A 4DV1Q 1YITA 2UU9L 2QA4A 1V43A 5IWAQ 2JA8G 4X62L 2VS1A 1A0IA 2R7ZG 1XMQL 1MJEA 4A3DG 2JA7G 1VQ7A 2NVTH 1YHQA 1YJWA 4IPDA 2NVQH 4JBKA 1VQBA 1E3PA 4DAMA 3CF5A 3CC7A 1YHBA 5DLQE 4JCVE 1Q46A 4IPHA 5FJ8H 5M5WH 2Y0SG 4X64L 5C4JH 2N3SA 4JI3Q 4L5RC 4YWLA 2OCEA 4DUYQ 3T1YQ 1N32Q 4KHPL 1HNWQ 5IYBG 1SN8A 3JC66 4JI7L 2VNUD 1FJGL 4NXNQ 5JJLA 2A19A 2Q2HA 5IP9G 3EN2A 3M9BA 2WB1G 5IYDG 1KHIA 3NBHB 4GOPA 5JJKA 2GN5A 3U58A 4DV2Q 5JEAJ 3D31A 1VQPA 1BVSA 3U4ZA 3OYYA 1TXYA 2K5HA 5IY0A 3RN2A 4YHHQ 1PA6A 1XJVA 2I5MX 4GN5A 3JAMi 1LYLA 4GN4B 1R9TH 4XIGS 5FJ8G 4HIKA 1CKOA 4DV0Q 2IY5B 4NXNL 4HJ9A 2JJQA 4A3LH 4JI7Q 3J81i 4JI6Q 5GQOA 3KF6B 3KOJA 4JG2A 2IHFA 4JBJA 1YJ9A 4KHZA 1I6HH 3KLWA 2YU9H 4YCVA 4DV5L 4JI3L 3OTOL 1HNXL 3RZDH 1YBYA 4IFDI 2KCMA 1B7YB 3J80c 3UDIA 5ELNA 3TS0A 2UUCL 1EIFA 2IX0A 3PIOA 1HNZL 2ZJQA 4K0KQ 2ALYB 2HT1A 1IBMQ 3UDXA 1K8AC 1WI5A 1Q1EA 4A3FH 3MEFA 3VDYA 3CQZH 2L15A 1C0AA 3PV0A 1IBKL 2ZTDA 2CWAA 1Y14B 2E2JH 5GAEC 3UE0A 1D8LA 1EUJA 2MQHA 5FLXc 4MZ9A 3HOXH 3HOVG 4WJ3M 1TWHH 2VY3A 4KLKA 3J7A5 5K36G 4A4IA 3GTPH 4DR5L 3EIVA 4LF9L 5BR8L 4DV1L 1CKNA 1G51A 2R7ZH 1XMOL 2CCZA 2UUBQ 3CC2A 1SRUA 1B8AA 2Z6KC 1LTLA 3CP0A 1IL2A
chains in the Genus database with same CATH superfamily
1RJRA 2W8KA 3DXJC 3QR8A 1DJRD 4LF7H 5LMUH 1B1ZA 4ZYSA 1ZHSA 2F0NA 1DXMA 4PNYA 2A73B 3CMEA 1C30A 2GVBA 4C1NI 1IYJB 1SNOA 4XYOA 4I7HA 3L4JA 3MR5A 3TSSA 5C0XI 1B6RA 3L0OA 2UUCQ 1FYCA 3CRLC 3RN5A 3PUVA 4BBRH 2W6OA 3PR4A 2K5VA 5HURA 1E1OA 3NQTA 2M9VA 4M1UB 1EY0A 4LFAL 1TU2B 2AQ1B 2WTFA 3PO3G 1QILA 1ML0D 5JEAG 3BVMA 1QNKA 1NE3A 1PH1A 2E2IA 1AE2A 4EBEA 1X54A 4GNXB 1OXSC 3J81E 4A3BG 1I4HA 2F4IA 2HHHH 4NXMQ 4GKJQ 3M4IA 2JA6H 4UCVA 2GLTA 1W96A 1EL0A 5F2DA 4BY7H 2FPGB 2PO4A 2XD4A 3TBIB 3MC0B 4YY3L 2JA6B 4GC6A 3U9SA 1PH4A 4RUCA 3P7JA 3KLSX 1VQ5A 3PW5A 3U9TA 1M0WA 3NWTA 4O2BF 1NAPA 2A68C 5I6WA 4RMFA 4BY1H 1K83A 4O3QA 4X65L 3NBIA 1S0NA 4A3MG 4X62H 2WB1A 1ZXTA 1BCPF 1B44D 2RCNA 4OELB 1VQ6A 3WWVA 2W6QA 3DM3A 1GM5A 4ZUJA 1ENCA 1HUMA 3S1MH 3VYRA 1QZGA 1SNDA 3AEVA 4EX5A 4L5QA 2AWOA 3STBC 4A93H 1ESRA 2R92A 4RZQA 1HNXH 1Y1WH 4A3EH 4X62Q 3HP3A 2B29A 2DUDA 3HOZG 4DAVA 1TWHB 1U4LA 3OMGA 1Y1VH 2A6HD 2E2HH 5FD5A 4FS2A 3A8JE 4N8FA 4OWWB 1TS2A 1VDZA 5I9PA 3GTPB 1ICFB 2YS6A 1QNUA 3SHLA 5E7NA 3G6JB 2RSOA 4ED8A 1HQMC 3GTJH 1GD7A 4ECUA 5KG0A 2NB0A 4J9QA 1OXTA 1STBA 1PFSA 5A35A 2VQFQ 1KD1C 1RCVD 3CMAA 4A3LG 2JK8A 4A3IB 1LTRD 2XWJB 4DNIA 1HXYD 4LF7L 1ZKOA 4Y7NH 4UHVA 4YR2A 1SMXA 1CE8A 1HR0W 4MV1A 1VQ4A 3WDNA 2UUCH 1EUDB 4CJ0B 2FFKB 1SE4A 2F3WA 4A3EG 3UFXB 3CCMA 4H7BA 4FYDA 5EPKA 4QWAA 1G8ZD 4DN4M 2DLNA 1FGUA 3VR3A 5EWEA 2F0UA 1O75A 4BBSH 3HGBA 1FVIA 2UXDQ 2K50A 1SROA 4JI1Q 3PUZA 4Q43A 2ZM6H 1M90C 1BCPD 4IPGA 3S1RH 4ME3A 3V6JA 3TZUA 2F0TA 2B63G 2HHHL 4QW9A 1CUKA 4ZHQF 1A3TA 5AJ3Q 4F7XA 4LF9H 3CD6A 2KJXA 2R8JA 3V4SA 5JJIA 3DM1A 2BE5D 1N34Q 3HOWG 5KT7A 5T1GA 1A8VA 3CPWA 3HBLA 2VB2X 2RHQB 4GZYC 3RZOB 2JEGA 3PZPA 3JSNA 1PH5A 3WOEA 1LABA 1TY2A 1HHVA 1EY4A 2NWGA 4LW1A 4IFDJ 1D5MC 4IOAA 3LGJA 2KEEA 2UUAL 1D6EC 1SYFA 1S97A 3AFPA 3H0GG 3I56A 4OO1G 2P0AA 3QWNA 4EVOA 3MXGA 5K2MA 2GPWA 3BZDB 2DPJA 3GTMA 4M8AA 3S1MB 1TWGB 4DR7Q 1KAAA 4DK0A 5IGFA 4O0AA 2EZVA 1EFWA 4UP9A 1QVFA 4JI4L 1QE6A 1I50H 4B3SQ 1UE7A 5C5MA 4IUUA 3K58A 3OIQA 2YZGA 2RHSB 2W6ZA 3PW7A 2VL6A 3BVGA 4DV6Q 3O13A 3A7LA 1AE3A 3DWQA 4LF4Q 1EIHA 2F0GA 2UXBL 3TP5A 1SYBA 2F0EA 2B2WA 4K2KA 2HJWA 1KC7A 4IALA 5IP7G 4DNTB 1I94L 2K32A 4AH6A 3I72A 2LSSA 4G7OC 3G48A 4DR2H 1MI2A 3EFXD 2XSCA 1S5ED 1VQEA 3PUYA 3S1NB 4DLKA 3HXLA 1BCPC 1SSOA 3G6VA 3GTPA 1DGSA 4LF4L 2JA9A 3W2DA 4MIUA 3FP9A 1PVOA 2FJZA 3M3YH 3M4OH 1FD7D 3MZ5A 2A5HA 1UEBA 3BJUA 3C2PA 4B3SL 2HQEA 4OIJA 1LLRD 4JOIC 1LM0A 3PW2A 2UVWA 1I5FA 2YYZA 2RBMA 4J9NA 1U9RA 5J2UF 2R6GA 5JVDF 4GKJL 4KY6A 4NXML 1CA6A 3E0JA 1L1OC 1MKHA 2PI2E 3VYUA 3M4QA 1N36Q 5EKLA 5KG2A 3TREA 4GS3A 3FKIA 4JI8H 1DV1A 2YS7A 1Z2OX 1QOHA 1YHAA 5GAGC 3RZDB 3J7AV 4J9PA 2B8GA 4BBSG 3AYHB 1IHZA 2NBFA 3E5SA 5C4ZA 1MSHA 4J9SA 2C5CA 2FK3A 2D0OA 3OHXC 1N34L 4F4WA 4UY8C 2E75C 1XMQQ 2K5WA 2PNRC 1S4ZA 3BAAA 1UE6A 4I55F 1Q90A 4RKLA 3GTOH 1L2FA 1PH7A 2Z8LA 2HHHQ 1GUNA 3KHLA 2RDFA 2K52A 1DONA 1JIHA 1M6VA 3D8GA 4ZQIA 3SE0A 3JAMc 2HCCA 1VQCA 2UXDL 1NTGA 2C00A 3N40P 4TQUS 1UC9A 2AWNA 1XMQH 4I7ZC 4EGJA 4JK1C 1QUQB 4LNQA 4A3BB 4EYHB 2EYPA 3S1QB 2F0OA 4LF7Q 3D6CA 1XPUA 2ZJRA 2YV5A 5ELBA 5KFCA 4ZAIA 3S1QH 2WAQG 4KV6A 1B3AA 1HNXQ 5KFVA 3HOVH 1B50A 2OH2A 5NUCA 3H0GH 2B2TA 1AZPA 3R5HA 1HPCA 3SXHA 1I3QH 4H0LC 5IGEA 3HOYG 5G3LF 5M5YB 3LX0A 1RL2A 5IT9E 4ED7A 1SNPA 4BY7G 5KG3A 3GV6A 2K03A 2NVYB 3ICEA 5KFAA 2ALZA 2R7MA 4JI5L 3D4RA 1P16A 5FLMH 2ZXRA 3PIPA 1KRTA 5C3EH 1IBLQ 2AGQA 3GTOB 2Q8RE 3BU2A 4X66L 3GV5B 2IMWP 2NVQB 4R4QA 4ZOLF 1CQFA 3PO2H 3TQTA 5JUMA 3FMAA 5M9OA 3KJPA 1CKMA 3C3LA 1XWEA 4IJLA 3HOYB 1JDBB 3QG1A 2VQEH 2ASJA 4H44C 2FP4B 4LH6A 3HKZG 2EYHA 1YJNA 1VAJA 4BY1B 3TRZA 4ED1A 1KJQA 1Y8PB 2Q8TA 1VF7A 3K81C 2NN6H 2FLLA 3K0XA 2J7ZA 3N43B 1K73C 1WCMA 3A8KE 4DK3C 4LF8L 4APMA 2CW0C 5A2QE 1PMRA 2Q2UA 4J15A 5FLMG 4FBTA 2R93H 5D8DA 1CQVA 2L55A 1C4QA 1H9SA 4GNXA 1H9RA 5EAYA 2UXCL 4KD4A 3GIQA 2PQAB 3AU7A 3H40A 4YY3Q 3M7GA 5BN5A 4P71A 4OHJA 4A93B 3F2BA 2K7VA 4QIWE 1SEIA 2VW9A 3PVXA 1SBBB 3I4OA 3PW4A 4O2DA 3S2HH 3V96A 4DV7L 2K4KA 2NU9B 3T53B 4LSAA 2WIIB 4A2BA 1Y1VA 3NP8A 3RLOA 3EYYA 4LFAQ 2K5DA 4KY5A 3M85A 2F0QA 4HJ5A 4QQBX 5BPHA 5KT5A 4PG3A 4A76A 5D1PA 2EPBA 1KLGD 1QWYA 2BQUA 4B3MH 4R4TA 1EY5A 2GPSA 5DGAA 5M5XB 1PYWD 3KBXA 1V1QA 1YZ6A 3GDEA 1I4PA 1OWTA 2YYAA 3I12A 5KT6A 4R8IA 3KYHC 3K5OA 1SJED 1WFQA 5DQGA 3W5OA 3MWYW 4XTCS 1WJJA 1GKHA 3H3VI 3OSNA 3MWDA 2IX3A 4YCUA 1VKZA 4A3DH 1ZETA 5C5JA 1STNA 3NHHA 4GLAC 1E22A 1YITA 2VUMA 5CAEB 2VS1A 4KD3A 2HVRA 3A7AB 2R7ZG 3Q2OA 4HTHA 4RZRA 1MGSA 2DY7A 1SFOA 1K8MA 3X3MA 4IPDA 2NVQH 5F9LA 2F0IA 1E3PA 3MFHA 5L1IA 2PW7A 3CF5A 3CC7A 3G8CA 5CGKA 4IPHA 5C4JH 1STAA 4JV2A 3H3VC 4KN7C 4PWQA 1JWUD 1SMYD 4L63B 4KN4C 4DNRB 1O80A 2R87A 2K6AA 5CV7A 4KHPL 1C3OA 3E5NA 4I50F 4J9KA 5AFWA 2CZGA 3LWEA 1FJGL 2VNUD 5CBEE 5KFUA 2A19A 3SVMA 2ENBA 4UFZA 5LOVF 3EN2A 4E6IA 1BO0A 4R7RA 4MV3A 5IYDG 1KHIA 1PZKD 2UXCH 4Q45A 3J80E 1L0XB 2MHVA 3D31A 4XQJA 3GTGB 2IP4A 5KFFA 1BVSA 3U4ZA 5EDWA 1PA6A 1I6UA 2I5MX 2NU8B 1LYLA 1AP0A 2ICIA 1EOTA 4NXNL 1TT2A 4A3LH 1NSNS 5GQOA 3PIO3 1ULZA 3KOJA 2R86A 4XDXA 4M9UA 2IBKA 2L11A 4LF8H 1IYUA 3N6RA 4DV5L 4JI3L 2RA4A 1CQJB 1DCZA 1NCVA 4IFDI 4RAUC 3ETHA 2LFNA 2HD3A 1KDBA 3PIOA 1HNZL 2OF1A 1SEBD 2WKDA 1H9JA 3VDYA 2L15A 2VB3X 3OHBA 3PV0A 2IPKD 1IBKL 1SXTA 1CZWA 2E2JH 3BA9A 1D8LA 1Y1VB 1PX2A 4Q0FA 1JE4A 1TR5A 1TWHH 3J7A5 4IZOA 4A4IA 3KHGA 4LF9L 1I4RA 5HV6A 4O1NA 2TSSA 4XQNA 5KFRA 1EZ8A 1B8AA 3GTLH 2Z6KC 1LTLA 3CP0A 4Q8EA 1W93A 3K8AA 3S15H 2IX1A 3NE5B 5CR3A 1V9PA 4ZQ3A 2K28A 5KFJA 2D9UA 2DIKA 4OX9H 3EQLC 5CV4A 3PF5A 3I4NH 1LT4D 3UDFA 1ASYA 1HFNA 4JI5H 3RB6A 4K0KL 2BR0A 2W9CA 4FXKC 4IUQA 3HEJA 1TWFB 1RF2D 1S5CD 3OTOQ 3K5NA 5C44B 1PH3A 3SEBA 2EY1A 5IT9L 1KQSA 1SDFA 3Q6SA 2XGPA 2DNCA 1WH2A 3RF2A 2NN6G 2XC9A 1JORA 3KDFB 4HIDA 3GIIA 2F0MA 4C3IB 1PTOC 1QVGA 1F9QA 2AU0A 1GJXA 4UCTA 1QUQA 1IYVA 1T5EA 1Z47A 3MA2B 3PMFA 3G71A 3FHWA 4OL7A 1J5EQ 2NVTB 1KJ9A 2F0VA 4K6DA 2LXKA 1V4YA 3IAYA 4DV7H 2OTJA 2KBNA 1Q8KA 5K5PA 4LFCL 1VQIA 1AW7A 3W1GA 3M9NB 4DV0H 1CHPD 2SNMA 4I65A 5ELOA 5CMDA 4YY3H 2ASDA 4Y8VB 4A3MB 4R8NA 2V1CC 3TP8A 4CGYB 4ECVA 2F0DA 1S03G 2AUKA 2X69A 3T1HH 2NZ1D 4U673 3M4PA 1KNEA 1FNUA 4LF4H 4DR7H 4F4ZA 4X65H 1LUZA 5C4JB 4AQYQ 4RAZA 2CHBD 2JEFA 2ES2A 1VS0A 1XNRQ 2BCOA 4NDXA 1E2WA 5CV5A 4UCRA 1Q8IA 3PQIA 5IWAL 5M3MG 2XIGA 3FDSA 1M8AA 2KHIA 5DM63 3HOXG 4Y7NB 1XNRL 1S72A 2R7LA 4IUVA 2OQ0A 3F8TA 1VBHA 3D4DA 4LJZC 1TA8A 3N52A 4NB3A 2WAQA 1CKNB 2D2CC 2EJFC 3BDOA 3U50C 2CW8A 2HGSA 3LP8A 5KKNB 5DQIA 4DKAC 1OXXK 3I2ZA 4PZ8A 3RNUA 3PF4A 2CQYA 2YZMA 1BNZA 1E4EB 2YTYA 1JWSD 1JJ2A 3MR3A 1C9OA 4ME6A 2EY5A 4DAYB 1XNQQ 1X65A 4YR0A 2RF4A 1MZBA 1D1KA 4PZ7A 2R92H 4C2MB 5JPMC 5DM73 4FF4A 1VF5C 4QGUA 2L0CA 3R2IA 2F0HA 5IODA 2RDIA 4MAMA 1EYGA 1X55A 1B9MA 4JBWA 4X3KA 1WCMH 1SE3A 4JV5Q 2J9GA 3MFIA 1JC7A 2KCTA 4N9TA 4RB0A 5LMNH 2R7ZB 5LA6F 2JA8B 4AIMA 3MWMA 4LF5Q 2DNEA 4A3FG 1JWMD 1X6OA 4NPSA 5DEHA 1NNXA 1HR0Q 1AN7A 4B9WA 1TVXA 2EXDA 3MJFA 1E7ZA 2XGQA 2F0KA 3HOXB 1HFGA 2N49A 3M4OB 1IZ6A 2RQXA 1T5XD 3ORQA 1CZGA 1M4VA 1HTPA 4RG1A 3R8BA 1L2ZA 5C4XB 1JB7A 4APVA 2BQRA 2J6SA 2Z4HA 3JAME 4MNOA 2MO0A 1VQNA 1RTOA 1FR3A 5LP6F 1GUSA 4C3IH 2XCPA 3OMCA 5CB4F 1BGWA 4RNNA 4IR1A 4WORA 4DL4A 2B2WC 1UNSA 1AUVA 3B6YA 2XCAA 4ECQA 1M0TA 1MSGA 4R4OA 4IWYA 1FKAH 1TIID 4QIWB 5LMNQ 4YR3A 2R85A 2WAQE 3I55A 5D14A 4CDEC 1H9SB 3HKSA 4LF5H 3CU7A 4EQOA 2LMCB 4J1MA 1CSQA 1EWIA 4LAAA 1ICWA 1AN8A 1N33L 4DL2A 2ATLA 3KTMA 4EGQA 2FMMA 2F4VL 2DJGC 3N6XA 3Q23A 1YIJA 4OONA 1YNXA 2DGYA 2I07B 2J0TD 3S2HB 1KNAA 3D4WA 3RB4A 4WRDA 1UE1A 3JZIA 1X32A 3KLSA 3LWBA 1KAWA 4UP8A 3L3OC 4KKSA 5G3LD 5EOYA 3GTKB 3K7AH 1EY7A 5IWAH 1BBWA 3W3AA 3OHAA 5C6AA 1UNNC 1WYDA 4X3UA 2MJ8A 2TMPA 4Q0YA 2NU7B 4KKUA 5C4XH 4BY1G 2ZJPA 2R3ZA 3CCJA 1I50B 4J9MA 3NTKA 2ASBA 3FKIH 4F4YA 4RNOA 3GTGA 1T94A 1VQAA 5KT2A 1P8LA 1NR4A 5KFDA 3NXWA 4DR1L 2B63H 1T36A 4NXMH 1XNRH 1TKWB 3FVQA 4JI0L 4GKKL 1CS0A 1IL8A 3S16B 1WTOA 5IE8A 3NBHA 1EOVA 3NSWA 2Q2TA 1EYCA 3HOWH 1PK8A 5CV6A 3OSOA 1YI2A 2YRWA 5DG9A 4PDBA 1K3RA 1IOVA 3MXUA 4B3TL 3ND8A 1A62A 3IFDA 1EY6A 4IRDA 3V05A 2B3GA 5GAHC 4YP3A 2MNAA 1MIUA 4KHPQ 3K57A 5CA0F 3CCLA 1Z7TA 3W1BA 1K9MC 3T5JA 2N8NA 2KHJA 4DL3A 4WJWA 2FJ2A 5M5YH 4IO9A 4C3JB 1PZID 3GIKA 1XX8A 2NVYA 2SOBA 2VA3A 4C3JH 4EQ5A 4L5TA 5KIXA 4B3MQ 3PIP3 1DD2A 4HJ7A 4IWXA 2JE6I 1MHWC 5JOBA 4LUVA 2B39A 3NELA 4BBRG 5I4DA 2N88A 4DU9A 1R4QB 2I5HA 1G2TA 2BH2A 3M7NA 3TMEA 4K0KH 1VMCA 3PO3H 4LH7A 1RHPA 2K5NA 5BPFA 1GVPA 3HOUH 4HIMA 5KEEA 1BCPB 1STGA 3BZCA 2PI2A 2J6UA 1CT1D 3HFZB 1A2UA 3V6HA 2H5XA 2F52A 1O7ZA 4JI0Q 4GKKQ 4A3CG 3K3PA 4OX9L 1Y1WB 3H4BA 2Y0SE 4F88A 1KIXA 2NVXB 1L0YB 3LNNA 1TWFA 2A69C 3BA8A 1KXLA 3L9AX 5HGQA 2A6HC 4OO1I 1NBWA 4WJ4A 4MN3A 1X3PA 5KYIA 1XPOA 3T56B 4LMYA 4XZ3B 3VYSA 1O7IA 4BWGB 1BF4A 3EPGA 2E5LH 2JN4A 3NUCA 4CJ2C 2EOTA 1LT5D 2JA5G 3Q8SB 3NK9A 4A3KB 2GVAA 1T9HA 2B2VA 2YRXA 4IQZA 2F0LA 1IKMA 5FO9B 1RYRA 2R92G 4HYKA 2IHEA 4GOPC 5EKKA 3R93A 1Q3LA 2YTVA 4ECSA 2RGVA 3BVZA 1N48A 3CXCA 1PYBA 4JI2L 1E4FT 1WCMG 3CAMA 1W6KA 2B2UA 2R93A 1Q1BA 1SYDA 2HVSA 3GIPA 3KK7A 5H1SE 4QL5A 2RDHA 2EE1A 1J9OA 5E3FA 5ISRA 2CKZB 4RHSA 5ELDA 4ZKCB 3CCUA 1WVLA 2HCIA 1E0BA 3RUPA 3SE7A 5F9NA 5JQWA 4B3TH 4A3GB 3QFFA 1B4OA 5IYCH 2K05A 1IKLA 4LF8Q 1Y1VG 2MO1A 3ULJA 4DL5A 2F1MA 4RA8A 4DUYL 1N32L 1PV4A 4XXEA 1KDAA 4DR3H 4RNMA 4DXFA 4DR1H 4LFCH 1WTRA 1B3QA 2IJ0A 4X64Q 4CHTB 4HNTA 3VPBA 1EU3A 4EEQA 1BUVT 3PO2B 2L12A 2W9BA 4MV9A 1Z6HA 3S14H 4EGVA 4KK7A 4MHEA 1YNND 1BDOA 2VUMB 4DGZA 1OXUA 1KDCA 1U4PA 1VQMA 4EEYA 2D5DA 1A15A 2HIVA 1IBLL 2ZT9C 4GOPB 1JICA 1HR0L 1KJIA 1A3UA 1BQQT 5JJZA 4JI5Q 1PDQA 2YZNA 1Q86C 5IYDH 3K5HA 4BBRB 3TEHB 5D3IB 3A5ZB 4L6TB 4C3HH 1FNWA 2G5DA 3G6EA 1Q82C 4FF2A 4EBDA 1JOQA 1HQRD 4RGMA 5HBRB 1HZBA 5M3FH 5EPJA 3C46A 4C3JG 2FLPA 1GHJA 2DWCA 1JX4A 4DUZH 3H94A 1VQDA 3IRBA 5E4WC 4ECRA 1C7YA 1UWVA 1S5BD 2RCFA 4DV4Q 1S68A 3BABA 1X9NA 1JT8A 4HR7A 2EJGC 2PMZE 3HS0C 4BA1I 4RWSC 5T1IA 1VMPA 1VQ8A 1HCZA 4DV3H 1AUXA 2WB1B 1RIPA 4UAIA 3I4MH 4POGA 1TY0A 1DM0B 1EY8A 1V8QA 3I70A 3MHBA 2I8CA 5FK9C 2QA4A 1V43A 5IWAQ 4QCLA 4LSXA 2A68D 1HA6A 3E3XA 4ECWA 5KG1A 4TKOB 5EPLA 1B2TA 4DFAA 3QOJA 1XMQL 1MJEA 1VQ7A 1SYXB 4ILWA 2KSWA 5KFEA 2W6MA 1E4EA 1YJWA 2VPSA 2RKSA 2R7KA 1YHBA 2NUCA 2F03A 1FJGH 5JVH3 5M5WH 2Y0SG 4K8JA 1YNJC 4RH6A 1JQYD 3C0FB 5M3FB 3BQ0A 1XYIA 4YWLA 1LTGD 1S0MA 2RVLA 5IIFA 1IL2A 2QK4A 2JA5A 1F9SA 3A54A 5JJLA 3CVZA 1S10A 1U4MA 1EY9A 5IP9G 2C28A 4MV4A 3M9BA 2BQ3A 2KA7A 3RB0A 4O2AF 1HUNA 5JEAJ 4HCEA 4KHPH 4R9WA 3HOZB 1KABA 1TXYA 3RIZA 3RN2A 5EKIA 5KT4A 3AB9A 4GN4B 1R9TH 4XIGS 5FJ8G 4HIKA 5IOCA 4DV0Q 5C4HA 3BYYB 2JEJA 4JI7Q 4X66H 3KF6B 3NQIA 4V190 1I6HH 1RJTA 4EYIB 2LKVA 2YU9H 2MUYA 3OTOL 3Q24A 1T3NA 4HSVA 1ZYRD 4HN7A 2VOBA 3J80c 2WYOA 2V4QA 2EY2A 3SK4A 2H4OA 3UDIA 1IOWA 2OLSA 4K0KQ 2MGSA 3V2TA 4A3FH 1Q1EA 1K8AC 5T14A 4QWCA 1FNVA 1ET6A 4DL7A 3VMMA 2CWAA 1Y14B 1EUJA 4MZ9A 5K36G 1SAPA 3J7AK 2G9DA 4DR5L 4FM9A 1ONLA 4DV1L 1CKNA 2R7ZH 3N44B 2UUBQ 2BE5C 2V4RA 4DR7L 3TDQA 3RGXA 5FKAC 3J7AF 2HIXA 2XVSA 1JOKA 1ZHQA 4HCSA 1SCUB 3GTLB 1LV9A 3F2CA 2F0FA 5IGGA 4KJOA 4C5CA 1ASZA 1IBKQ 5IT9W 5C44G 2JA6A 2N55A 3H4DA 4CKEA 4GLVB 1GGOA 2KVMA 1TWCH 3KFUA 3BQ2A 3HOUB 1VQJA 2QW7A 4OIKA 2UXDH 2B2VC 2UU9H 1EYAA 3CQZA 1OO9B 1K8GA 3RBEA 2RDGA 3I90A 1X3FA 5CV9A 2M2LA 4DR3L 1D2BA 2PZUA 4HIOA 5A2QL 4G3IA 5K36H 3E0EA 4HR7B 2MFIA 4ABNA 3GQCA 1X3GA 4G57A 1K83H 2F0PA 2WKCA 1TS4A 3RGZA 5C3WA 4IZ8A 1VBGA 4HEDA 4QF4A 1MJCA 2KHSA 5AJ3L 1K28A 2Z6BA 3E6ZX 4IAJA 2HVQA 4DPGA 2W71A 1PRTF 4WFN3 3ETJA 4JI1L 4LF6H 4JI8Q 5I6YA 1G291 3KHHA 2UVVA 1WOCA 1CHQD 2WAQB 2E5LL 3NTHA 1FJGQ 4HMIA 1E24A 2F0SA 3F8NA 3IKJA 4MTNA 2VQEL 1M1KC 4HNVA 4AYBG 5I9OA 2QKIC 5FPRA 3VR2A 2HDMA 2ATWA 2EXZA 3EVQA 3GIMA 3GV3A 4RGOS 4Q8FA 2VQFL 3OTOH 1A3VA 1E2VA 3T5KA 2YTXA 4CBVA 4BBSB 4X64H 3RBDA 1D7QA 3FRPB 1AEXA 2ZDQA 5LL6b 3E9IA 2PW5A 4RB1A 4OEMB 1EQRA 3I91A 2L5TA 2X6LA 1I3QA 5EBCA 2JYOA 2F0JA 2WFWA 4A3IH 4JBMA 4KY7A 4DR6Q 4IFDG 1ZEQX 2W7OA 3T1YH 1RYSA 2NU6B 2ZTEA 3OSPA 4PZ6A 4XX0B 4LF6Q 1VQOA 5EJWA 4CDFC 4HSPA 2JEBI 4G4KA 2NYZD 2B63B 5KFPA 1V1OA 4C3HB 3J80W 2DN8A 2OWOA 2FE3A 3AQQA 4AQYH 3I8ZA 5M3MH 3QOLA 4B9XA 1Z9FA 3RV3A 4RU9A 4RHRA 4NKLA 4A3EB 2J6TA 2R7FA 5L37A 4X65Q 2QF7A 3OW2A 1SYEA 2JA7B 4A3IG 2YU9B 1LACA 3EROA 3TZDA 3V4ZA 4DV1H 1KC8C 3HOUG 2AQ3B 2DPIA 2E2HA 1DOMA 2BA0A 4DV7Q 1JJCB 4EBCA 1EZ1A 2YL2A 1S5DD 2KENA 3KAKA 1EQTA 3GTQA 4XYQA 4ID6A 2B2TC 2EYJA 2W7PA 2PMZA 3S17H 4JI0H 4GKKH 4IUNA 2AUJD 3KUPA 1Q7YC 4BWSC 2UXCQ 1A2TA 1JLLB 2K33A 1X56A 3RAQA 1V1PB 1X3QA 3TS2A 2E74C 3FMCA 3Q1KA 2ID0A 4BS9A 1K0RA 5KGUA 2NUAB 3PUXA 1XDNA 1D5ZC 2AMCB 3KF8A 5J39A 5KFLA 4KKTA 3RZOH 4XYMB 4F50A 5DLFA 2G9HD 2R8IA 1I6HB 1QB5D 1ZQ7A 2W9BB 3N41B 2ZM6Q 1S5FD 2A8VA 2NTTA 3CHBD 3GTQH 1YEZA 4HQ6A 5KFXA 4ED6A 4C2MH 4UP7A 4IURA 2I5LX 3D0FA 3TQYA 1K1QA 5JPNC 4FBUA 2W6NA 3S2DH 2QEXA 2PCFB 4X66Q 4JI7H 3GV8B 3H0GB 1R9TA 3JAML 1UE5A 4A93G 3K5LA 3H3VH 1EQVA 4MTEA 1IW7D 4DR6L 4J0MA 4BXXH 3J81j 2L1BA 3QIAA 4QMGA 2B2YA 3QO2A 1JR0D 3R2TA 1EYDA 2XGTA 4XT3B 3AMUA 1IBML 1SFOB 3PSIA 1Q81C 2AQ2B 1Y8OB 1U0LA 4L5SA 4ETSA 1B04A 2BH8A 1XTDA 3OPOA 1SFOH 1PH6A 2HQLA 4JI3H 3ND9A 1SNCA 3HOWB 1L0WA 4X6AH 5H80A 2BDOA 3A0JA 3LWUA 2OEOA 3JAMW 1HNWH 4LUZA 4OWTB 3A55A 1PRTC 2VQEQ 2QILA 1RK6A 4NXNH 2A74C 4RUAA 3J81W 1I50A 2R7ZA 1C48A 3QB3A 2JA5H 3KHRA 2X0SA 3VR4A 4BXXG 3BQ1A 2E76C 2O2LD 4CJ1B 3FKIG 5KFTA 5L1LA 2PNHA 2IT1A 4DV2L 4M7EA 4C3HG 3STBD 1S9FA 2ZXPA 1RJQA 3K59A 4X3TA 3KF8B 2W9AA 4V0BA 5KFWA 1PTOD 1EHIA 1J8IA 3SK6A 4LWCA 1CQIB 2ZM6L 4TVAB 1HNWL 2CVRA 4F4XA 5C0XG 1LO5D 5KYLA 3A5UA 4Q44A 1WTPA 2PYKA 3GTKH 4TV8F 3RR5A 3SGIA 1DZ1A 4R8UA 5L9XA 5KG5A 5ELEA 3VR6A 5ELCA 2P5ZX 5DG8A 4TQSA 2AKWB 4YCWA 4DR5H 2R8GA 2I46A 4DA2A 1PZJD 2VUGA 4A3GH 2VQFH 2JEAI 1N36L 4P73A 2F0WA 4C56C 2PBZA 4NW2A 3GLKA 2MPMA 2AGPA 1CA5A 4O42A 2UVUA 3RFCA 2Q2IA 2UUBL 4K5WA 4QJFA 3TP7A 2VPQA 4DR5Q 1NY4A 2F3IA 3F2DA 3DLLA 1JE5A 4QUCA 4RFBA 4MA0A 4DV5H 2LY7A 2V9WA 1JJGA 2EYMA 2KOLA 1IXRA 1QZHA 2OQKA 3TIGA 3M3YB 1G91A 2V5AA 5KFIA 3MTSA 4AYBE 4JI6H 4IOCA 1VQGA 4DF7A 3PO2G 2A6ED 2E2JB 1TWCA 4J6HA 1TWAA 3GTOA 1UEAB 5LMUQ 3I73A 3R3OA 1NMFA 5M3FG 1I94Q 5I47A 2JA6G 2DZDA 5C1PA 2UXBQ 3S15B 1F2YA 2NN6I 4OGQC 5M5WB 2ZJTA 2KCNA 4RKBA 4DV0L 4DV6L 4LF6L 5KRUA 4GN3B 4ZCKA 4JI4Q 3Q22A 4DR2Q 3DF7A 1I7NA 3GILA 3I4NG 3T13A 5KNDA 1BBUA 2ZDHA 1WCMB 4S3SA 3PO3B 4J9OA 3SR1A 3QZ7A 1UAPA 1TWGH 4CDDC 1G6PA 1MD2D 4U6PA 2UUAQ 1KJ8A 1L1OB 3HOYH 3HKZE 1GSHA 1HZ9A 2JQOA 2NVXH 1W3SA 1Z2NX 2JA5B 1K8OA 2K01A 2CW7A 3S24A 1N8RC 1RODA 2W8LA 4NP5A 3KALA 5IYCG 4QY7A 3GV7B 2E5LQ 3J80i 3I3CA 3U9OA 3AFQA 1PH2A 5GONF 1KRSA 2FKLA 2ASLA 3QJYA 4JI8L 3L2PA 4B3RQ 4H02A 1FGBD 4HAEA 3T5LA 1J5EH 3OOCA 1PFMA 2WACA 3DWPA 5CYUA 3SI8A 5J22A 4DXGA 4DAPA 4MV6A 5IP9H 2B2UC 4FNFA 3KF6A 4ODGA 4DUZL 2V58A 2Q8IB 4EQNA 3NENA 3S16H 3PN1A 1Y8NB 3ORRA 4IUPA 2RGRA 1HZAA 4PMBA 3R23A 2RDJA 3IL8A 1DOLA 2J4XA 3K0YA 3BDCA 4JUZA 4DR3Q 2D0PA 1EQQA 1NR2A 4YIJA 5ELFA 1W2BA 2BDNA 1LT3D 5EBDA 3KXYT 1EIGA 1Z2PX 1GXDC 1F2ZA 4L8JA 4TRDA 4CC6A 1G6ZA 3GO5A 2Y0SB 1WTXA 3Q8DA 4QWEA 3T51B 1F2MA 2QDLA 1ET9A 2I80A 4XT1B 3N42B 2EQSA 3NPPA 2CWPA 4MV8A 4YAKB 2XN9C 5IYBH 3FKIB 3GP7A 4MTDA 4DV1Q 1D1IA 2DY8A 5JH7F 1TWCB 4X62L 4A3FB 5FPOA 3RB3A 2XRSD 3S17B 3M9MB 1CM9A 2JA7G 2NVTH 1YHQA 3RV4A 3K7AB 5KG4A 1VQBA 5DLQE 4JCVE 3G7LA 1MBYA 4X64L 2SNSA 4PMCA 5KFSA 5DGBA 1S0OA 4L5RC 3WNZA 5DQHA 4J9RA 4DUYQ 1N32Q 4CDCC 3T1YQ 1BOSA 4DR6H 1R9TB 2YU9A 5IYBG 3J7YW 4JI7L 2R8KA 1A6XA 3HRZC 3Q8PB 5IGDA 1SYCA 2C2RA 4O3OA 2WB1G 4GOPA 5C8YF 3MVVA 3TN2A 2GN5A 4E4TA 3U58A 1VQPA 5M3MB 3OYYA 2K5HA 4YHHQ 1XJVA 1D5XC 3JAMi 4IHJF 1XNQH 1PTOH 4K5VA 3K5MA 4RAYA 2FLNA 3HB9A 4HJ9A 2F3VA 2JJQA 2PQEA 5FLXE 1PXUA 3J81i 5FO8B 4JI6Q 5C3EB 5KG7A 3R5FA 4JG2A 4JBJA 1YJ9A 4TUYF 4KHZA 4YCVA 2EJMA 3X3NA 3UI2A 2Z4IA 4CKCA 3RZDH 4O3NA 3PR5B 2KCMA 2K5QA 5ELNA 3TS0A 2UUCL 2ZJQA 2IX0A 2KECA 3MFYA 3MEFA 3CQZH 5IYZF 2DJFC 2KQ3A 5JVLA 2VXWA 5GAEC 3UE0A 3HOXH 3HOVG 4DUYH 1N32H 4ZUIA 4DV6H 1N33H 3EIVA 1WTVA 4ULLA 2B63A 1XMOL 2CCZA 3CC2A 1SRUA 3KDFA 3CC4A 1B7YB 1HR0H 3MFGA 3OWEB 1BXTA 5BR8Q 3J7ZC 2XWBB 1KJJA 4YJ2F 4QIWA 1VCIA 4ECYA 1VQ9A 1HH2P 1O7YA 4EFBA 4IFDH 1TS3A 4JC0A 1WR2A 4KJNA 1GUWA 5FLXW 3BJYA 3BZKA 1ZYRC 3VA5A 4DV4L 3PW0A 1OXVA 1LTBD 2Z9HA 5IGBA 1TWAH 2RSNA 4JOIA 3VPDA 3IG0A 2WB1E 3BG5A 4AYBA 3QZ8A 1H9KA 1JOOA 1EWHA 4A3DB 1VQHA 3GQBA 2OXPA 3G4SA 1AZQA 3WO1A 2EDGA 1EU4A 1ILQA 2O5IC 1EEFD 1ENFA 1KL9A 1N36H 1VQLA 3S1RB 3UDGA 2UUBH 4ECTA 2KCCA 1M7JA 3GTQB 2R7NA 2R84A 4B3TQ 1RD9D 3OUUA 4L1KA 1NUCA 1RJPA 2B8FA 1B53A 1CK1A 2FB9A 4QWBA 1Y69U 2R93G 2AQ4A 3H91A 1GUOA 3FDTA 1XTCD 2PZWA 5GADC 4DV3L 4JI2H 4FS1A 2XTIA 3D6WA 3SK8A 3JSLA 1QG7A 4PQXA 1BNCA 3I4MG 3RLFA 1B33N 4YBZB 2W70A 1HA5A 4IJHA 5D65A 3T16A 1K83B 3S2DB 2FPPB 1RTNA 3PGZA 4R4IA 1OTCA 4O4HF 3RMHA 3DEPA 2VA2A 1RDPD 5CORA 3J81L 4B3RH 1EWCA 4J8QA 5DLGA 2E2IH 4ZK9B 1GLVA 1RK5A 4HNUA 4KI0A 3ZJYC 3FPUB 2OTLA 1C8CA 1J6QA 2NTSA 2VR1A 3GTJA 2E2HB 2L9HA 3DUZA 1PH8A 4K2LA 2AHOB 1B9NA 4DR4Q 5C5LA 3S14B 3RLNA 5HY6A 4P2CB 1HNZH 1STEA 4JVZA 4YJ3F 2O03A 2FMCA 1B6SA 2I0QA 1WSCA 4DAYA 1DYQA 4N9PA 2F4VQ 4DV2H 4JI2Q 2X6GA 5IT9c 4K14A 2UU9Q 1PTOB 4HJAA 1BXRA 2WDTA 5KFQA 3BG3A 4R4CA 1WD1A 2R93B 4BA2I 4FDBA 1HRJA 1XPRA 1HZCA 3H20A 3VPCA 3S9WA 4KHVA 2FK1A 3MR2A 3HOZH 3RJ0A 1N34H 4DR4L 3S1NH 3K6OA 4O4IF 4RGTA 5KFMA 3GIJA 2JA7H 4A3GG 4TQRA 1NMGA 1VQFA 3URYA 3CCVA 1BBXC 2NVXA 2ICEC 5DAUA 5KFGA 5KFYA 1B70B 1K0SA 1EIYB 1SE8A 3KLRA 4OX9Q 1STHA 1O7LA 2CH4A 4ME5A 3CKIB 5DNFA 2CFMA 5LMNW 5KFHA 1H95A 1FL0A 4DV3Q 5CC4A 2ZTCA 4MV7A 4GNXC 1DOKA 2R92B 3Q8QB 2FINB 3OW7A 4C2MA 2A69D 2XRQD 3H15A 4IRCA 1BKBA 2WE6A 5EQ0A 4DK6C 4LF5L 2I87A 5KFKA 4A3KG 1SJHD 3GD7A 3GTMH 4YB8B 4OXPA 3HOVB 4JV5L 1H9MA 4B3ML 1TQOA 3P20A 4ZRZA 2ZXOA 4K6LA 2JA8H 3RAXA 1QJOA 1LTSD 1SYGA 4GKJH 2EYFA 1KLUD 4YWMA 3J81c 4RB2C 1PHJA 2FXQA 3JRXA 4F87A 4JYAQ 3CCQA 2CQOA 4ED2A 5KNBA 2Z6KA 1XNQL 1HJPA 1LTAD 1Y1WG 5FOBB 5C0XJ 2FMAA 4HJ8A 5D3DA 2C9OA 2IL8A 4ECXA 4QB4A 1I3QB 5KT3A 2R8HA 5C3EG 2HUGA 3HKZA 5C4XG 1X3EA 5BN3A 4IPCA 5JEAH 2MP1A 3H09A 3GTGH 1JCKB 2SDFA 1XMOQ 3I4MB 1PFBA 2O4XA 3FEWX 3Q0AA 1U5KA 2VUMG 4LFBL 2R82A 3F2UA 4DR1Q 5CV8A 5HGTA 1GHKA 4C3IG 1E1TA 3IFTA 4ALPA 1U4RA 5L1KA 1S40A 1DV2A 1JXLA 3HG9A 3KJOA 1XXGA 4YAJB 4C5AA 1XMOH 2K14A 4XQQA 4A3JG 4ZLTF 4IUTA 3F1ZA 4UPAA 1A63A 2NZHA 3BYTB 1YNNC 3NTIA 3UE1A 1UC8A 4TV9F 4FP5D 4UCUA 2E8GA 3CQZB 4RCOA 4JI6L 2JP1A 3A74A 4LFCQ 1E2ZA 4P72A 3GTMB 4JYAH 4PMWA 4QUFA 3CCRA 2VZAA 1IW7C 3GTKA 5D1OA 4YHHL 4JPBW 1J5EL 3CPFA 4O4LF 2B2YC 1CFMA 4B08A 1QVCA 1LTTD 4EQPA 3T1HQ 2PZTA 1N33Q 5EWGA 1W6JA 2JXMB 1KBLA 4WBNF 2ZDGA 3NGDA 5LMNL 5J3BA 4F8MA 4RB3C 2Z1CA 4NMZA 1IBKH 1EUCB 1PFNA 5M5XH 2EIFA 3T1YL 3K3VA 1CI3M 1PRTD 5COYA 3WO0A 2W9CB 4JV5H 1JKJB 1GSAA 3M4YA 1ILPA 3M9OB 1Q12A 3K7UC 3NEMA 2LXJA 2GA4B 5C44H 4K5XA 4CKBA 3ERSX 1TWFH 1UUPA 2QGQA 3BDLA 4LFAH 1S3OA 3R5XA 2LS01 3ER0A 5EGTA 3MXPA 3L7ZC 2C35B 3P75A 4R1JA 5TSSA 1IBLH 3C1FA 4FO2A 4FVMA 2NZOA 2QCPX 3G6YA 3ZYYX 4IR9A 3E9HA 3PCOB 3H0GA 1KEEA 4Z9CB 2R7DA 2EY6A 3ULLA 5KG6A 1TWHA 3T1HL 3OWFA 4LF9Q 5IP7H 1N9WA 1I6VC 1GYFA 5CBAE 3LMLA 2AGOA 3GTLA 1L1OA 3DEOA 1DIKA 5JAVA 3EJIA 1SNMA 2IW3A 2NVYH 1YNJD 2SCUB 4QWDA 2JEIA 2W57A 1WD0A 4C1NK 4A75A 1HNZQ 2BA1A 1JDEA 4JW0A 4LFBH 3CCEA 5CA1F 1PRTB 2WINB 1V1PA 1PH9A 3FPPA 4DV5Q 4IN3A 4LK1C 2FPIB 3K80C 4FF1A 4EG0A 1Y1WA 3H6MA 3ERQA 2KUMA 1SR3A 5LL6X 2H1EA 5LL6S 1ENAA 1YVCA 2QYZA 3L4KA 2IWHA 1CTMA 4DUZQ 4ZI7F 2FHTA 3DHQA 2CW0D 3I7FA 4LFBQ 4POFA 2XCLA 1AH9A 2UVRA 1PYSB 4G7HC 2QDBA 1RKNA 4OO1H 1GOZA 1R4PB 2D62A 3HZXA 3MAQA 4JV0A 4AQYL 4YQWA 4B3RL 4FU0A 1I4GA 1SNQA 2A6EC 4KMUC 5A2QW 3VYTA 1F2LA 5FD6A 1GUTA 4TSSA 3GTJB 4A3JH 3KAJA 4CC5A 3U4VA 2N78A 3EPIA 2K75A 4UCSA 4A3JB 3NWSA 1I94H 5LYJF 1EZ6A 3MR6A 4DK1A 1CSPA 1SLJA 2HDLA 3CRKC 1WTQA 4JYAL 1WTWA 1F9RA 2V59A 4A3BH 4YHHH 2V4DA 3SK5A 4OWXB 2E2DC 2UXBH 4RGNA 1E4GT 2PQAA 5KFZA 3MXNB 2VQDA 4KTAA 2EYLA 3CCSA 4U68A 4YWKA 2PPBC 5FO7B 3IN5A 4DV4H 4GLXA 5JVG3 1AFPA 1SE2A 3PUWA 1JB3A 2Y0SA 2YW2A 1TWGA 5GROA 4DR2L 4P75A 4Y52H 5E1FA 1GSOA 4MA5A 3RD4A 3OUZA 4A3MH 5BR8H 1STYA 4U7CA 4UDUC 2O5JC 1VQKA 4LUOA 1I4QA 4O3RA 4HMJA 2WP8J 2VUMH 3ITPA 4QW8A 3RTXA 1TAEA 3EBEA 5LMUL 2KEDA 3CW2C 2A1AA 5BN4A 3EA6A 2Z0SA 2C2DA 2MCTA 2UUAH 5L1JA 4P74A 2CQAA 3ONAB 4ED0A 1N56A 4FF3A 1NJIC 2JA7A 4NLGA 4R8UB 1BJTA 3MWEA 5KFOA 1GO3E 4N8X1 1SMYC 3V6KA 2XIWA 1ESFA 4XYLB 1PLFA 4H13C 3KBGA 2CH4W 4A3KH 3ULPA 3Q8RB 1TS5A 4I7AA 1JMCA 2M00A 4A3CH 3JRWA 2UU9L 2PVPA 3TIIA 1QCBD 2JA8G 3I4NB 1EYZA 5I2YA 2E2IB 2M05A 1I7LA 1A0IA 4GC7A 4IRKA 3T4AC 4A3DG 3VR5A 2OT2A 2SEBD 2R61A 3VA7A 3G6XA 4JBKA 4LMQD 4DAMA 4O3PA 3N8DA 4DL6A 1IBMH 4BY7B 1I4XA 4EFEA 1Q46A 2EYOA 2L4NA 5FJ8H 3SDZA 5IGCA 5KFBA 1PTOF 5KFNA 2N3SA 1WTHA 4JI3Q 2IA6A 3UQ8A 1EFID 3I4LA 2OCEA 1LTID 3C1EA 1HNWQ 1SN8A 3JC66 2BOSA 4MTKA 3DMUA 4NXNQ 5LHY1 4FXDA 4WD3A 4ED3A 2Q2HA 3BS1A 4ECZA 3NBHB 5JJKA 1EEID 4X3SA 2W6PA 4K8IA 4PV1C 2PN1A 3GIDA 4UCOA 5C1OA 4ZKBB 4DV2Q 4JI1H 5LXTF 4B3SH 2F4VH 5C3XA 5J1ZA 4RCNA 1K3BC 5EWFA 5IY0A 5E4XA 1LT6D 3P1HA 4GN5A 3OIPA 4DR4H 2K1BA 1CKOA 3T5HA 2IY5B 3TINA 4JV1A 1G2SA 3TQ1A 4FXGC 3DWAA 1II3A 2C2EA 5KX5F 4J9LA 2IHFA 5EZYF 3D3RA 3KLWA 1KTKA 4C5BA 1HTLD 2JSOA 5J2TF 4G7ZC 3WOFA 2WV6D 1HNXL 1GUGA 1BR9A 1YBYA 2PMZB 3J80L 2FK2A 5D1OB 1A9XA 4O3SA 5KNCA 1EIFA 3A56A 1K1SA 2YCHA 4AYBB 3MXNA 4A2AA 2ALYB 5I2XA 1IBMQ 5C0XH 2HT1A 4I4TF 3UDXA 1WI5A 3MEHA 2QEJC 3TP6A 1C0AA 2K04A 1V51A 4Q5VA 2ZTDA 5FLXL 1TWAB 2R6FA 3HKZB 2MQHA 5FLXc 4JI4H 3A8IE 2VY3A 2XNAC 4KLKA 3RUZA 3GTPH 5BMVF 2EVBA 5BR8L 1G51A 1O78A 3K5IA 2C22A 4WJ3M 5DG7A 1F77A 1F9PA
chains in the Genus database with same CATH topology
5BR8Q 2HIXA 3J7ZC 3K8AA 3S15H 1VCIA 2IX1A 1VQ9A 1HH2P 3F2CA 1V9PA 3GTLH 4JC0A 1ASZA 3CMEA 1IBKQ 3BZKA 2GVBA 1IYJB 5C44G 4DV4L 3I4NH 3PF5A 4GLVB 1OXVA 1TWCH 3UDFA 3KFUA 5C0XI 1VQJA 1ASYA 1TWAH 4JOIA 3L0OA 4K0KL 2WB1E 2UUCQ 1K8GA 3RN5A 3PUVA 4BBRH 1X3FA 2K5VA 1E1OA 4DR3L 4HIOA 1VQHA 3E0EA 3OTOQ 1PH3A 3G4SA 2MFIA 4LFAL 3PO3G 1X3GA 1KL9A 1K83H 5JEAG 1KQSA 1NE3A 1PH1A 1VQLA 1AE2A 2NN6G 3UDGA 1X54A 4GNXB 1OXSC 4A3BG 3KDFB 1MJCA 4HIDA 4B3TQ 5AJ3L 4NXMQ 1QVGA 4GKJQ 2JA6H 2R93G 4DPGA 4BY7H 1QUQA 4DV3L 1Z47A 5GADC 3G71A 2XTIA 4YY3L 3FHWA 4JI1L 1PH4A 1J5EQ 4JI8Q 3I4MG 3RLFA 1VQ5A 1G291 4IJHA 2LXKA 1WOCA 2E5LL 2OTJA 1FJGQ 3PGZA 2KBNA 4R4IA 1OTCA 1Q8KA 4LFCL 1VQIA 1E24A 4RMFA 3W1GA 4MTNA 2VQEL 1M1KC 4BY1H 5ELOA 4AYBG 4X65L 2E2IH 2ATWA 4A3MG 4KI0A 3ZJYC 2V1CC 2OTLA 1J6QA 2RCNA 2VQFL 1VQ6A 3WWVA 2YTXA 1PH8A 2AHOB 3DM3A 1GM5A 4DR4Q 1D7QA 3S1MH 3M4PA 1QZGA 3RLNA 5HY6A 3E9IA 3AEVA 1EQRA 4EX5A 4L5QA 1LUZA 2AWOA 3STBC 4AQYQ 4A93H 1Y1WH 2ES2A 1VS0A 1XNRQ 2I0QA 4A3IH 2WFWA 4X62Q 4A3EH 4JBMA 2B29A 2DUDA 5IWAL 4DR6Q 2F4VQ 4IFDG 4JI2Q 5M3MG 3HOZG 2KHIA 2ZTEA 5IT9c 3HOXG 2UU9Q 4PZ6A 4HJAA 1XNRL 4LF6Q 1VQOA 1S72A 1Y1VH 2OQ0A 3F8TA 4R4CA 2JEBI 2E2HH 4NB3A 4OWWB 1CKNB 3U50C 4FDBA 4BA2I 1XPRA 2OWOA 1HZCA 5E7NA 4DKAC 1OXXK 3AQQA 3I2ZA 3KDFA 4PZ8A 3RNUA 3PF4A 3GTJH 1GD7A 5M3MH 3HOZH 4DR4L 2YTYA 3S1NH 1OXTA 1Z9FA 1PFSA 1JJ2A 1C9OA 2VQFQ 1KD1C 4DAYB 1XNQQ 1X65A 3CMAA 4A3LG 2JK8A 2RF4A 4DNIA 2JA7H 4LF7L 4Y7NH 4A3GG 4PZ7A 1SMXA 2R92H 2R7FA 1NMGA 4X65Q 1HR0W 3OW2A 1VQ4A 1VQFA 3CCVA 4QGUA 4A3EG 4A3IG 3CCMA 1B70B 1EYGA 1KC8C 1SE8A 1X55A 1EIYB 3HOUG 4JBWA 1FGUA 1WCMH 4OX9Q 4JV5Q 2KCTA 2BA0A 4BBSH 1FVIA 4DV7Q 2K50A 1SROA 1JJCB 3PUZA 2CFMA 4JI1Q 4AIMA 5LMNW 1M90C 4LF5Q 4A3FG 4IPGA 1H95A 1FL0A 4DV3Q 3S1RH 2ZTCA 4ME3A 4GNXC 2KENA 1X6OA 4NPSA 2HHHL 1HR0Q 2B63G 1CUKA 2EXDA 3H15A 5AJ3Q 1BKBA 1E7ZA 3CD6A 4DK6C 3S17H 4LF5L 5JJIA 1Q7YC 4A3KG 3GD7A 3GTMH 2UXCQ 4OXPA 2N49A 1N34Q 3HOWG 4JV5L 1IZ6A 4B3ML 1A8VA 1X56A 2JA8H 4RG1A 3TS2A 3CPWA 1JB7A 4APVA 2RHQB 2ID0A 1K0RA 4MNOA 4YWMA 3PUXA 3J81c 1PHJA 2FXQA 2MO0A 1VQNA 4JYAQ 2AMCB 4C3IH 2CQOA 3CCQA 2Z6KA 1PH5A 1XNQL 3RZOH 1HJPA 3B6YA 4LW1A 1Y1WG 4IFDJ 4R4OA 3LGJA 5C0XJ 2ZM6Q 2UUAL 4HJ8A 2A8VA 4IOAA 3GTQH 1YEZA 4C2MH 5LMNQ 2WAQE 3AFPA 4UP7A 3I55A 2I5LX 3D0FA 3H0GG 3TQYA 5C3EG 3HKSA 3I56A 4OO1G 5C4XG 1X3EA 4IPCA 3S2DH 1CSQA 1EWIA 2QEXA 4DR7Q 4X66Q 1N33L 3GTGH 4O0AA 1XMOQ 1UE5A 4A93G 1EFWA 4UP9A 1QVFA 4JI4L 4B3SQ 1I50H 2F4VL 3H3VH 1U5KA 2VUMG 1UE7A 4LFBL 4DR6L 1YIJA 2RHSB 4OONA 1YNXA 2DGYA 4BXXH 2VL6A 3J81j 4DV6Q 4DR1Q 1AE3A 4LF4Q 1UE1A 2UXBL 1KAWA 1E1TA 2XGTA 4UP8A 1IBML 3K7AH 4ALPA 3PSIA 1BBWA 1S40A 5IP7G 1Q81C 2UXDQ 3KJOA 1U0LA 1I94L 4L5SA 1WYDA 2BH8A 1XTDA 2K14A 4AH6A 1SFOH 2HQLA 4A3JG 2LSSA 1PH6A 3G48A 3F1ZA 4UPAA 1L0WA 1A63A 2NZHA 4X6AH 1VQEA 3A0JA 3PUYA 3UE1A 5C4XH 4BY1G 2ZJPA 3CCJA 4LUZA 4OWTB 2E8GA 2VQEQ 2ASBA 3FKIH 4JI6L 1VQAA 1P8LA 3A74A 4LFCQ 1DGSA 4LF4L 4P72A 2JA9A 4DR1L 2B63H 3FP9A 1PVOA 4PMWA 3M3YH 3CCRA 3M4OH 2VZAA 2JA5H 4JI0L 4YHHL 4GKKL 1UEBA 3BJUA 3CPFA 1J5EL 4BXXG 4B3SL 3T1HQ 1QVCA 5IE8A 4JOIC 3FKIG 1EOVA 1LM0A 2PNHA 2IT1A 4DV2L 2Q2TA 3CC4A 1I5FA 1N33Q 3HOWH 2YYZA 3STBD 1YI2A 3KF8B 2R6GA 1K3RA 4GKJL 4NXML 1L1OC 1MKHA 4B3TL 2PI2E 5LMNL 5J3BA 1A62A 4LWCA 3M4QA 1N36Q 5GAHC 2B3GA 2ZM6L 4TVAB 2MNAA 1MIUA 1HNWL 4KHPQ 3TREA 4GS3A 5M5XH 3T1YL 2EIFA 5C0XG 3CCLA 3W1BA 1K9MC 3A5UA 2N8NA 2KHJA 1YHAA 5GAGC 1Q12A 5M5YH 3K7UC 3NEMA 2LXJA 4IO9A 3RR5A 3SGIA 3GTKH 5C44H 3ERSX 1TWFH 4BBSG 3AYHB 2QGQA 4C3JH 4EQ5A 4L5TA 4B3MQ 2AKWB 4YCWA 4HJ7A 2JE6I 2D0OA 1S3OA 1N34L 4UY8C 3ER0A 4A3GH 4LUVA 3L7ZC 2C35B 4R1JA 3NELA 4BBRG 1XMQQ 1N36L 2JEAI 4P73A 1UE6A 2NZOA 3GTOH 1L2FA 2I5HA 3E9HA 3PCOB 2BH2A 1PH7A 3M7NA 2R7DA 3PO3H 2HHHQ 2K5NA 1GVPA 3HOUH 4HIMA 3ULLA 2K52A 3BZCA 2Q2IA 2PI2A 2UUBL 4QJFA 3HFZB 3JAMc 3T1HL 1VQCA 4LF9Q 2UXDL 1NTGA 4DR5Q 1NY4A 5IP7H 1N9WA 2F3IA 2F52A 2H5XA 4TQUS 3F2DA 3DLLA 4JI0Q 1JE5A 2AWNA 4OX9L 4A3CG 1L1OA 2Y0SE 1KIXA 1JJGA 2NVYH 4GKKQ 1IXRA 1KXLA 5HGQA 1QZHA 2OQKA 1QUQB 4OO1I 1NBWA 4A75A 4LNQA 4WJ4A 1XPOA 4AYBE 4IOCA 1VQGA 2BA1A 1HNZQ 4LF7Q 1O7IA 1XPUA 3PO2G 2ZJRA 2YV5A 3CCEA 3S1QH 2WAQG 1HNXQ 5LMUQ 3HOVH 3H0GH 5M3FG 1NMFA 1PH9A 1I94Q 2JA5G 4DV5Q 1I3QH 1T9HA 2GVAA 3K80C 2JA6G 3HOYG 1RL2A 1SR3A 4BY7G 2UXBQ 1YVCA 3ICEA 2R92G 2NN6I 2IHEA 4GOPC 4DUZQ 4DV0L 4DV6L 2YTVA 4LF6L 4JI5L 3I7FA 4LFBQ 4POFA 4GN3B 1P16A 5FLMH 1PYBA 3CXCA 4JI2L 4JI4Q 1AH9A 1PYSB 3PIPA 1WCMG 3CAMA 1KRTA 5C3EH 4DR2Q 1IBLQ 3I4NG 1BBUA 1Q1BA 3BU2A 4X66L 2D62A 4R4QA 4AQYL 4B3RL 5H1SE 3PO2H 4QL5A 2CKZB 1TWGH 3KJPA 3CCUA 1CKMA 4IJLA 1G6PA 4A3JH 2UUAQ 5IYCH 3U4VA 2N78A 2K75A 4LF8Q 1Y1VG 2MO1A 3HKZG 3ULJA 1L1OB 3HOYH 3HKZE 1HZ9A 2JQOA 4DUYL 1YJNA 2NVXH 1PV4A 1W3SA 3TRZA 1N32L 4DR7L 1CSPA 1SLJA 3K81C 4JYAL 3K0XA 3S24A 1N8RC 4X64Q 1K73C 4A3BH 4DK3C 4LF8L 5IYCG 4OWXB 4QY7A 2Q2UA 4J15A 5FLMG 2E5LQ 3J80i 2R93H 2PQAA 3S14H 1PH2A 3AFQA 3MXNB 1KRSA 4JI8L 3CCSA 4YWKA 3L2PA 4GNXA 4B3RQ 2UXCL 5EAYA 4H02A 1OXUA 2PQAB 4GLXA 4YY3Q 1VQMA 3PUWA 4P71A 3F2BA 2HIVA 1IBLL 5GROA 4DR2L 4P75A 4QIWE 4GOPB 2VW9A 1HR0L 3I4OA 4Y52H 4JI5Q 4O2DA 5IP9H 3S2HH 1Q86C 3KF6A 4DUZL 5IYDH 3S16H 3NENA 4DV7L 2K4KA 3TEHB 3A5ZB 4A3MH 4C3HH 3G6EA 1Q82C 1VQKA 4LUOA 1HZAA 3RLOA 2WP8J 2VUMH 4LFAQ 1HZBA 3M85A 5M3FH 4HJ5A 3EBEA 5LMUL 4QQBX 3CW2C 4DR3Q 4PG3A 4A76A 2A1AA 2D0PA 1EQQA 1VQDA 2Z0SA 1W2BA 4R4TA 3IRBA 4P74A 1C7YA 1UWVA 1V1QA 1YZ6A 3GDEA 4DV4Q 1X9NA 1NJIC 1JT8A 3GO5A 3KYHC 1WFQA 2PMZE 4BA1I 3W5OA 4XTCS 3Q8DA 1WJJA 1VQ8A 1GO3E 1GKHA 3H3VI 2EQSA 4A3KH 1RIPA 2CWPA 4YCUA 3ULPA 3I4MH 4POGA 4A3DH 5IYBH 1JMCA 4A3CH 4GLAC 1E22A 4DV1Q 1YITA 2UU9L 2QA4A 1V43A 5IWAQ 2JA8G 4X62L 2VS1A 1A0IA 2R7ZG 1XMQL 1MJEA 4A3DG 2JA7G 1VQ7A 2NVTH 1YHQA 1YJWA 4IPDA 2NVQH 4JBKA 1VQBA 1E3PA 4DAMA 3CF5A 3CC7A 1YHBA 5DLQE 4JCVE 1Q46A 4IPHA 5FJ8H 5M5WH 2Y0SG 4X64L 5C4JH 2N3SA 4JI3Q 4L5RC 4YWLA 2OCEA 4DUYQ 3T1YQ 1N32Q 4KHPL 1HNWQ 5IYBG 1SN8A 3JC66 4JI7L 2VNUD 1FJGL 4NXNQ 5JJLA 2A19A 2Q2HA 5IP9G 3EN2A 3M9BA 2WB1G 5IYDG 1KHIA 3NBHB 4GOPA 5JJKA 2GN5A 3U58A 4DV2Q 5JEAJ 3D31A 1VQPA 1BVSA 3U4ZA 3OYYA 1TXYA 2K5HA 5IY0A 3RN2A 4YHHQ 1PA6A 1XJVA 2I5MX 4GN5A 3JAMi 1LYLA 4GN4B 1R9TH 4XIGS 5FJ8G 4HIKA 1CKOA 4DV0Q 2IY5B 4NXNL 4HJ9A 2JJQA 4A3LH 4JI7Q 3J81i 4JI6Q 5GQOA 3KF6B 3KOJA 4JG2A 2IHFA 4JBJA 1YJ9A 4KHZA 1I6HH 3KLWA 2YU9H 4YCVA 4DV5L 4JI3L 3OTOL 1HNXL 3RZDH 1YBYA 4IFDI 2KCMA 1B7YB 3J80c 3UDIA 5ELNA 3TS0A 2UUCL 1EIFA 2IX0A 3PIOA 1HNZL 2ZJQA 4K0KQ 2ALYB 2HT1A 1IBMQ 3UDXA 1K8AC 1WI5A 1Q1EA 4A3FH 3MEFA 3VDYA 3CQZH 2L15A 1C0AA 3PV0A 1IBKL 2ZTDA 2CWAA 1Y14B 2E2JH 5GAEC 3UE0A 1D8LA 1EUJA 2MQHA 5FLXc 4MZ9A 3HOXH 3HOVG 4WJ3M 1TWHH 2VY3A 4KLKA 3J7A5 5K36G 4A4IA 3GTPH 4DR5L 3EIVA 4LF9L 5BR8L 4DV1L 1CKNA 1G51A 2R7ZH 1XMOL 2CCZA 2UUBQ 3CC2A 1SRUA 1B8AA 2Z6KC 1LTLA 3CP0A 1IL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 Q;  2HIX A;  3J7Z C;  3K8A A;  3S15 H;  1VCI A;  2IX1 A;  1VQ9 A;  1HH2 P;  3F2C A;  1V9P A;  3GTL H;  4JC0 A;  1ASZ A;  3CME A;  1IBK Q;  3BZK A;  2GVB A;  1IYJ B;  5C44 G;  4DV4 L;  3I4N H;  3PF5 A;  4GLV B;  1OXV A;  1TWC H;  3UDF A;  3KFU A;  5C0X I;  1VQJ A;  1ASY A;  1TWA H;  4JOI A;  3L0O A;  4K0K L;  2WB1 E;  2UUC Q;  1K8G A;  3RN5 A;  3PUV A;  4BBR H;  1X3F A;  2K5V A;  1E1O A;  4DR3 L;  4HIO A;  1VQH A;  3E0E A;  3OTO Q;  1PH3 A;  3G4S A;  2MFI A;  4LFA L;  3PO3 G;  1X3G A;  1KL9 A;  1K83 H;  5JEA G;  1KQS A;  1NE3 A;  1PH1 A;  1VQL A;  1AE2 A;  2NN6 G;  3UDG A;  1X54 A;  4GNX B;  1OXS C;  4A3B G;  3KDF B;  1MJC A;  4HID A;  4B3T Q;  5AJ3 L;  4NXM Q;  1QVG A;  4GKJ Q;  2JA6 H;  2R93 G;  4DPG A;  4BY7 H;  1QUQ A;  4DV3 L;  1Z47 A;  5GAD C;  3G71 A;  2XTI A;  4YY3 L;  3FHW A;  4JI1 L;  1PH4 A;  1J5E Q;  4JI8 Q;  3I4M G;  3RLF A;  1VQ5 A;  1G29 1;  4IJH A;  2LXK A;  1WOC A;  2E5L L;  2OTJ A;  1FJG Q;  3PGZ A;  2KBN A;  4R4I A;  1OTC A;  1Q8K A;  4LFC L;  1VQI A;  1E24 A;  4RMF A;  3W1G A;  4MTN A;  2VQE L;  1M1K C;  4BY1 H;  5ELO A;  4AYB G;  4X65 L;  2E2I H;  2ATW A;  4A3M G;  4KI0 A;  3ZJY C;  2V1C C;  2OTL A;  1J6Q A;  2RCN A;  2VQF L;  1VQ6 A;  3WWV A;  2YTX A;  1PH8 A;  2AHO B;  3DM3 A;  1GM5 A;  4DR4 Q;  1D7Q A;  3S1M H;  3M4P A;  1QZG A;  3RLN A;  5HY6 A;  3E9I A;  3AEV A;  1EQR A;  4EX5 A;  4L5Q A;  1LUZ A;  2AWO A;  3STB C;  4AQY Q;  4A93 H;  1Y1W H;  2ES2 A;  1VS0 A;  1XNR Q;  2I0Q A;  4A3I H;  2WFW A;  4X62 Q;  4A3E H;  4JBM A;  2B29 A;  2DUD A;  5IWA L;  4DR6 Q;  2F4V Q;  4IFD G;  4JI2 Q;  5M3M G;  3HOZ G;  2KHI A;  2ZTE A;  5IT9 c;  3HOX G;  2UU9 Q;  4PZ6 A;  4HJA A;  1XNR L;  4LF6 Q;  1VQO A;  1S72 A;  1Y1V H;  2OQ0 A;  3F8T A;  4R4C A;  2JEB I;  2E2H H;  4NB3 A;  4OWW B;  1CKN B;  3U50 C;  4FDB A;  4BA2 I;  1XPR A;  2OWO A;  1HZC A;  5E7N A;  4DKA C;  1OXX K;  3AQQ A;  3I2Z A;  3KDF A;  4PZ8 A;  3RNU A;  3PF4 A;  3GTJ H;  1GD7 A;  5M3M H;  3HOZ H;  4DR4 L;  2YTY A;  3S1N H;  1OXT A;  1Z9F A;  1PFS A;  1JJ2 A;  1C9O A;  2VQF Q;  1KD1 C;  4DAY B;  1XNQ Q;  1X65 A;  3CMA A;  4A3L G;  2JK8 A;  2RF4 A;  4DNI A;  2JA7 H;  4LF7 L;  4Y7N H;  4A3G G;  4PZ7 A;  1SMX A;  2R92 H;  2R7F A;  1NMG A;  4X65 Q;  1HR0 W;  3OW2 A;  1VQ4 A;  1VQF A;  3CCV A;  4QGU A;  4A3E G;  4A3I G;  3CCM A;  1B70 B;  1EYG A;  1KC8 C;  1SE8 A;  1X55 A;  1EIY B;  3HOU G;  4JBW A;  1FGU A;  1WCM H;  4OX9 Q;  4JV5 Q;  2KCT A;  2BA0 A;  4BBS H;  1FVI A;  4DV7 Q;  2K50 A;  1SRO A;  1JJC B;  3PUZ A;  2CFM A;  4JI1 Q;  4AIM A;  5LMN W;  1M90 C;  4LF5 Q;  4A3F G;  4IPG A;  1H95 A;  1FL0 A;  4DV3 Q;  3S1R H;  2ZTC A;  4ME3 A;  4GNX C;  2KEN A;  1X6O A;  4NPS A;  2HHH L;  1HR0 Q;  2B63 G;  1CUK A;  2EXD A;  3H15 A;  5AJ3 Q;  1BKB A;  1E7Z A;  3CD6 A;  4DK6 C;  3S17 H;  4LF5 L;  5JJI A;  1Q7Y C;  4A3K G;  3GD7 A;  3GTM H;  2UXC Q;  4OXP A;  2N49 A;  1N34 Q;  3HOW G;  4JV5 L;  1IZ6 A;  4B3M L;  1A8V A;  1X56 A;  2JA8 H;  4RG1 A;  3TS2 A;  3CPW A;  1JB7 A;  4APV A;  2RHQ B;  2ID0 A;  1K0R A;  4MNO A;  4YWM A;  3PUX A;  3J81 c;  1PHJ A;  2FXQ A;  2MO0 A;  1VQN A;  4JYA Q;  2AMC B;  4C3I H;  2CQO A;  3CCQ A;  2Z6K A;  1PH5 A;  1XNQ L;  3RZO H;  1HJP A;  3B6Y A;  4LW1 A;  1Y1W G;  4IFD J;  4R4O A;  3LGJ A;  5C0X J;  2ZM6 Q;  2UUA L;  4HJ8 A;  2A8V A;  4IOA A;  3GTQ H;  1YEZ A;  4C2M H;  5LMN Q;  2WAQ E;  3AFP A;  4UP7 A;  3I55 A;  2I5L X;  3D0F A;  3H0G G;  3TQY A;  5C3E G;  3HKS A;  3I56 A;  4OO1 G;  5C4X G;  1X3E A;  4IPC A;  3S2D H;  1CSQ A;  1EWI A;  2QEX A;  4DR7 Q;  4X66 Q;  1N33 L;  3GTG H;  4O0A A;  1XMO Q;  1UE5 A;  4A93 G;  1EFW A;  4UP9 A;  1QVF A;  4JI4 L;  4B3S Q;  1I50 H;  2F4V L;  3H3V H;  1U5K A;  2VUM G;  1UE7 A;  4LFB L;  4DR6 L;  1YIJ A;  2RHS B;  4OON A;  1YNX A;  2DGY A;  4BXX H;  2VL6 A;  3J81 j;  4DV6 Q;  4DR1 Q;  1AE3 A;  4LF4 Q;  1UE1 A;  2UXB L;  1KAW A;  1E1T A;  2XGT A;  4UP8 A;  1IBM L;  3K7A H;  4ALP A;  3PSI A;  1BBW A;  1S40 A;  5IP7 G;  1Q81 C;  2UXD Q;  3KJO A;  1U0L A;  1I94 L;  4L5S A;  1WYD A;  2BH8 A;  1XTD A;  2K14 A;  4AH6 A;  1SFO H;  2HQL A;  4A3J G;  2LSS A;  1PH6 A;  3G48 A;  3F1Z A;  4UPA A;  1L0W A;  1A63 A;  2NZH A;  4X6A H;  1VQE A;  3A0J A;  3PUY A;  3UE1 A;  5C4X H;  4BY1 G;  2ZJP A;  3CCJ A;  4LUZ A;  4OWT B;  2E8G A;  2VQE Q;  2ASB A;  3FKI H;  4JI6 L;  1VQA A;  1P8L A;  3A74 A;  4LFC Q;  1DGS A;  4LF4 L;  4P72 A;  2JA9 A;  4DR1 L;  2B63 H;  3FP9 A;  1PVO A;  4PMW A;  3M3Y H;  3CCR A;  3M4O H;  2VZA A;  2JA5 H;  4JI0 L;  4YHH L;  4GKK L;  1UEB A;  3BJU A;  3CPF A;  1J5E L;  4BXX G;  4B3S L;  3T1H Q;  1QVC A;  5IE8 A;  4JOI C;  3FKI G;  1EOV A;  1LM0 A;  2PNH A;  2IT1 A;  4DV2 L;  2Q2T A;  3CC4 A;  1I5F A;  1N33 Q;  3HOW H;  2YYZ A;  3STB D;  1YI2 A;  3KF8 B;  2R6G A;  1K3R A;  4GKJ L;  4NXM L;  1L1O C;  1MKH A;  4B3T L;  2PI2 E;  5LMN L;  5J3B A;  1A62 A;  4LWC A;  3M4Q A;  1N36 Q;  5GAH C;  2B3G A;  2ZM6 L;  4TVA B;  2MNA A;  1MIU A;  1HNW L;  4KHP Q;  3TRE A;  4GS3 A;  5M5X H;  3T1Y L;  2EIF A;  5C0X G;  3CCL A;  3W1B A;  1K9M C;  3A5U A;  2N8N A;  2KHJ A;  1YHA A;  5GAG C;  1Q12 A;  5M5Y H;  3K7U C;  3NEM A;  2LXJ A;  4IO9 A;  3RR5 A;  3SGI A;  3GTK H;  5C44 H;  3ERS X;  1TWF H;  4BBS G;  3AYH B;  2QGQ A;  4C3J H;  4EQ5 A;  4L5T A;  4B3M Q;  2AKW B;  4YCW A;  4HJ7 A;  2JE6 I;  2D0O A;  1S3O A;  1N34 L;  4UY8 C;  3ER0 A;  4A3G H;  4LUV A;  3L7Z C;  2C35 B;  4R1J A;  3NEL A;  4BBR G;  1XMQ Q;  1N36 L;  2JEA I;  4P73 A;  1UE6 A;  2NZO A;  3GTO H;  1L2F A;  2I5H A;  3E9H A;  3PCO B;  2BH2 A;  1PH7 A;  3M7N A;  2R7D A;  3PO3 H;  2HHH Q;  2K5N A;  1GVP A;  3HOU H;  4HIM A;  3ULL A;  2K52 A;  3BZC A;  2Q2I A;  2PI2 A;  2UUB L;  4QJF A;  3HFZ B;  3JAM c;  3T1H L;  1VQC A;  4LF9 Q;  2UXD L;  1NTG A;  4DR5 Q;  1NY4 A;  5IP7 H;  1N9W A;  2F3I A;  2F52 A;  2H5X A;  4TQU S;  3F2D A;  3DLL A;  4JI0 Q;  1JE5 A;  2AWN A;  4OX9 L;  4A3C G;  1L1O A;  2Y0S E;  1KIX A;  1JJG A;  2NVY H;  4GKK Q;  1IXR A;  1KXL A;  5HGQ A;  1QZH A;  2OQK A;  1QUQ B;  4OO1 I;  1NBW A;  4A75 A;  4LNQ A;  4WJ4 A;  1XPO A;  4AYB E;  4IOC A;  1VQG A;  2BA1 A;  1HNZ Q;  4LF7 Q;  1O7I A;  1XPU A;  3PO2 G;  2ZJR A;  2YV5 A;  3CCE A;  3S1Q H;  2WAQ G;  1HNX Q;  5LMU Q;  3HOV H;  3H0G H;  5M3F G;  1NMF A;  1PH9 A;  1I94 Q;  2JA5 G;  4DV5 Q;  1I3Q H;  1T9H A;  2GVA A;  3K80 C;  2JA6 G;  3HOY G;  1RL2 A;  1SR3 A;  4BY7 G;  2UXB Q;  1YVC A;  3ICE A;  2R92 G;  2NN6 I;  2IHE A;  4GOP C;  4DUZ Q;  4DV0 L;  4DV6 L;  2YTV A;  4LF6 L;  4JI5 L;  3I7F A;  4LFB Q;  4POF A;  4GN3 B;  1P16 A;  5FLM H;  1PYB A;  3CXC A;  4JI2 L;  4JI4 Q;  1AH9 A;  1PYS B;  3PIP A;  1WCM G;  3CAM A;  1KRT A;  5C3E H;  4DR2 Q;  1IBL Q;  3I4N G;  1BBU A;  1Q1B A;  3BU2 A;  4X66 L;  2D62 A;  4R4Q A;  4AQY L;  4B3R L;  5H1S E;  3PO2 H;  4QL5 A;  2CKZ B;  1TWG H;  3KJP A;  3CCU A;  1CKM A;  4IJL A;  1G6P A;  4A3J H;  2UUA Q;  5IYC H;  3U4V A;  2N78 A;  2K75 A;  4LF8 Q;  1Y1V G;  2MO1 A;  3HKZ G;  3ULJ A;  1L1O B;  3HOY H;  3HKZ E;  1HZ9 A;  2JQO A;  4DUY L;  1YJN A;  2NVX H;  1PV4 A;  1W3S A;  3TRZ A;  1N32 L;  4DR7 L;  1CSP A;  1SLJ A;  3K81 C;  4JYA L;  3K0X A;  3S24 A;  1N8R C;  4X64 Q;  1K73 C;  4A3B H;  4DK3 C;  4LF8 L;  5IYC G;  4OWX B;  4QY7 A;  2Q2U A;  4J15 A;  5FLM G;  2E5L Q;  3J80 i;  2R93 H;  2PQA A;  3S14 H;  1PH2 A;  3AFQ A;  3MXN B;  1KRS A;  4JI8 L;  3CCS A;  4YWK A;  3L2P A;  4GNX A;  4B3R Q;  2UXC L;  5EAY A;  4H02 A;  1OXU A;  2PQA B;  4GLX A;  4YY3 Q;  1VQM A;  3PUW A;  4P71 A;  3F2B A;  2HIV A;  1IBL L;  5GRO A;  4DR2 L;  4P75 A;  4QIW E;  4GOP B;  2VW9 A;  1HR0 L;  3I4O A;  4Y52 H;  4JI5 Q;  4O2D A;  5IP9 H;  3S2H H;  1Q86 C;  3KF6 A;  4DUZ L;  5IYD H;  3S16 H;  3NEN A;  4DV7 L;  2K4K A;  3TEH B;  3A5Z B;  4A3M H;  4C3H H;  3G6E A;  1Q82 C;  1VQK A;  4LUO A;  1HZA A;  3RLO A;  2WP8 J;  2VUM H;  4LFA Q;  1HZB A;  3M85 A;  5M3F H;  4HJ5 A;  3EBE A;  5LMU L;  4QQB X;  3CW2 C;  4DR3 Q;  4PG3 A;  4A76 A;  2A1A A;  2D0P A;  1EQQ A;  1VQD A;  2Z0S A;  1W2B A;  4R4T A;  3IRB A;  4P74 A;  1C7Y A;  1UWV A;  1V1Q A;  1YZ6 A;  3GDE A;  4DV4 Q;  1X9N A;  1NJI C;  1JT8 A;  3GO5 A;  3KYH C;  1WFQ A;  2PMZ E;  4BA1 I;  3W5O A;  4XTC S;  3Q8D A;  1WJJ A;  1VQ8 A;  1GO3 E;  1GKH A;  3H3V I;  2EQS A;  4A3K H;  1RIP A;  2CWP A;  4YCU A;  3ULP A;  3I4M H;  4POG A;  4A3D H;  5IYB H;  1JMC A;  4A3C H;  4GLA C;  1E22 A;  4DV1 Q;  1YIT A;  2UU9 L;  2QA4 A;  1V43 A;  5IWA Q;  2JA8 G;  4X62 L;  2VS1 A;  1A0I A;  2R7Z G;  1XMQ L;  1MJE A;  4A3D G;  2JA7 G;  1VQ7 A;  2NVT H;  1YHQ A;  1YJW A;  4IPD A;  2NVQ H;  4JBK A;  1VQB A;  1E3P A;  4DAM A;  3CF5 A;  3CC7 A;  1YHB A;  5DLQ E;  4JCV E;  1Q46 A;  4IPH A;  5FJ8 H;  5M5W H;  2Y0S G;  4X64 L;  5C4J H;  2N3S A;  4JI3 Q;  4L5R C;  4YWL A;  2OCE A;  4DUY Q;  3T1Y Q;  1N32 Q;  4KHP L;  1HNW Q;  5IYB G;  1SN8 A;  3JC6 6;  4JI7 L;  2VNU D;  1FJG L;  4NXN Q;  5JJL A;  2A19 A;  2Q2H A;  5IP9 G;  3EN2 A;  3M9B A;  2WB1 G;  5IYD G;  1KHI A;  3NBH B;  4GOP A;  5JJK A;  2GN5 A;  3U58 A;  4DV2 Q;  5JEA J;  3D31 A;  1VQP A;  1BVS A;  3U4Z A;  3OYY A;  1TXY A;  2K5H A;  5IY0 A;  3RN2 A;  4YHH Q;  1PA6 A;  1XJV A;  2I5M X;  4GN5 A;  3JAM i;  1LYL A;  4GN4 B;  1R9T H;  4XIG S;  5FJ8 G;  4HIK A;  1CKO A;  4DV0 Q;  2IY5 B;  4NXN L;  4HJ9 A;  2JJQ A;  4A3L H;  4JI7 Q;  3J81 i;  4JI6 Q;  5GQO A;  3KF6 B;  3KOJ A;  4JG2 A;  2IHF A;  4JBJ A;  1YJ9 A;  4KHZ A;  1I6H H;  3KLW A;  2YU9 H;  4YCV A;  4DV5 L;  4JI3 L;  3OTO L;  1HNX L;  3RZD H;  1YBY A;  4IFD I;  2KCM A;  1B7Y B;  3J80 c;  3UDI A;  5ELN A;  3TS0 A;  2UUC L;  1EIF A;  2IX0 A;  3PIO A;  1HNZ L;  2ZJQ A;  4K0K Q;  2ALY B;  2HT1 A;  1IBM Q;  3UDX A;  1K8A C;  1WI5 A;  1Q1E A;  4A3F H;  3MEF A;  3VDY A;  3CQZ H;  2L15 A;  1C0A A;  3PV0 A;  1IBK L;  2ZTD A;  2CWA A;  1Y14 B;  2E2J H;  5GAE C;  3UE0 A;  1D8L A;  1EUJ A;  2MQH A;  5FLX c;  4MZ9 A;  3HOX H;  3HOV G;  4WJ3 M;  1TWH H;  2VY3 A;  4KLK A;  3J7A 5;  5K36 G;  4A4I A;  3GTP H;  4DR5 L;  3EIV A;  4LF9 L;  5BR8 L;  4DV1 L;  1CKN A;  1G51 A;  2R7Z H;  1XMO L;  2CCZ A;  2UUB Q;  3CC2 A;  1SRU A;  1B8A A;  2Z6K C;  1LTL A;  3CP0 A;  1IL2 A; 
#chains in the Genus database with same CATH topology
 1RJR A;  2W8K A;  3DXJ C;  3QR8 A;  1DJR D;  4LF7 H;  5LMU H;  1B1Z A;  4ZYS A;  1ZHS A;  2F0N A;  1DXM A;  4PNY A;  2A73 B;  3CME A;  1C30 A;  2GVB A;  4C1N I;  1IYJ B;  1SNO A;  4XYO A;  4I7H A;  3L4J A;  3MR5 A;  3TSS A;  5C0X I;  1B6R A;  3L0O A;  2UUC Q;  1FYC A;  3CRL C;  3RN5 A;  3PUV A;  4BBR H;  2W6O A;  3PR4 A;  2K5V A;  5HUR A;  1E1O A;  3NQT A;  2M9V A;  4M1U B;  1EY0 A;  4LFA L;  1TU2 B;  2AQ1 B;  2WTF A;  3PO3 G;  1QIL A;  1ML0 D;  5JEA G;  3BVM A;  1QNK A;  1NE3 A;  1PH1 A;  2E2I A;  1AE2 A;  4EBE A;  1X54 A;  4GNX B;  1OXS C;  3J81 E;  4A3B G;  1I4H A;  2F4I A;  2HHH H;  4NXM Q;  4GKJ Q;  3M4I A;  2JA6 H;  4UCV A;  2GLT A;  1W96 A;  1EL0 A;  5F2D A;  4BY7 H;  2FPG B;  2PO4 A;  2XD4 A;  3TBI B;  3MC0 B;  4YY3 L;  2JA6 B;  4GC6 A;  3U9S A;  1PH4 A;  4RUC A;  3P7J A;  3KLS X;  1VQ5 A;  3PW5 A;  3U9T A;  1M0W A;  3NWT A;  4O2B F;  1NAP A;  2A68 C;  5I6W A;  4RMF A;  4BY1 H;  1K83 A;  4O3Q A;  4X65 L;  3NBI A;  1S0N A;  4A3M G;  4X62 H;  2WB1 A;  1ZXT A;  1BCP F;  1B44 D;  2RCN A;  4OEL B;  1VQ6 A;  3WWV A;  2W6Q A;  3DM3 A;  1GM5 A;  4ZUJ A;  1ENC A;  1HUM A;  3S1M H;  3VYR A;  1QZG A;  1SND A;  3AEV A;  4EX5 A;  4L5Q A;  2AWO A;  3STB C;  4A93 H;  1ESR A;  2R92 A;  4RZQ A;  1HNX H;  1Y1W H;  4A3E H;  4X62 Q;  3HP3 A;  2B29 A;  2DUD A;  3HOZ G;  4DAV A;  1TWH B;  1U4L A;  3OMG A;  1Y1V H;  2A6H D;  2E2H H;  5FD5 A;  4FS2 A;  3A8J E;  4N8F A;  4OWW B;  1TS2 A;  1VDZ A;  5I9P A;  3GTP B;  1ICF B;  2YS6 A;  1QNU A;  3SHL A;  5E7N A;  3G6J B;  2RSO A;  4ED8 A;  1HQM C;  3GTJ H;  1GD7 A;  4ECU A;  5KG0 A;  2NB0 A;  4J9Q A;  1OXT A;  1STB A;  1PFS A;  5A35 A;  2VQF Q;  1KD1 C;  1RCV D;  3CMA A;  4A3L G;  2JK8 A;  4A3I B;  1LTR D;  2XWJ B;  4DNI A;  1HXY D;  4LF7 L;  1ZKO A;  4Y7N H;  4UHV A;  4YR2 A;  1SMX A;  1CE8 A;  1HR0 W;  4MV1 A;  1VQ4 A;  3WDN A;  2UUC H;  1EUD B;  4CJ0 B;  2FFK B;  1SE4 A;  2F3W A;  4A3E G;  3UFX B;  3CCM A;  4H7B A;  4FYD A;  5EPK A;  4QWA A;  1G8Z D;  4DN4 M;  2DLN A;  1FGU A;  3VR3 A;  5EWE A;  2F0U A;  1O75 A;  4BBS H;  3HGB A;  1FVI A;  2UXD Q;  2K50 A;  1SRO A;  4JI1 Q;  3PUZ A;  4Q43 A;  2ZM6 H;  1M90 C;  1BCP D;  4IPG A;  3S1R H;  4ME3 A;  3V6J A;  3TZU A;  2F0T A;  2B63 G;  2HHH L;  4QW9 A;  1CUK A;  4ZHQ F;  1A3T A;  5AJ3 Q;  4F7X A;  4LF9 H;  3CD6 A;  2KJX A;  2R8J A;  3V4S A;  5JJI A;  3DM1 A;  2BE5 D;  1N34 Q;  3HOW G;  5KT7 A;  5T1G A;  1A8V A;  3CPW A;  3HBL A;  2VB2 X;  2RHQ B;  4GZY C;  3RZO B;  2JEG A;  3PZP A;  3JSN A;  1PH5 A;  3WOE A;  1LAB A;  1TY2 A;  1HHV A;  1EY4 A;  2NWG A;  4LW1 A;  4IFD J;  1D5M C;  4IOA A;  3LGJ A;  2KEE A;  2UUA L;  1D6E C;  1SYF A;  1S97 A;  3AFP A;  3H0G G;  3I56 A;  4OO1 G;  2P0A A;  3QWN A;  4EVO A;  3MXG A;  5K2M A;  2GPW A;  3BZD B;  2DPJ A;  3GTM A;  4M8A A;  3S1M B;  1TWG B;  4DR7 Q;  1KAA A;  4DK0 A;  5IGF A;  4O0A A;  2EZV A;  1EFW A;  4UP9 A;  1QVF A;  4JI4 L;  1QE6 A;  1I50 H;  4B3S Q;  1UE7 A;  5C5M A;  4IUU A;  3K58 A;  3OIQ A;  2YZG A;  2RHS B;  2W6Z A;  3PW7 A;  2VL6 A;  3BVG A;  4DV6 Q;  3O13 A;  3A7L A;  1AE3 A;  3DWQ A;  4LF4 Q;  1EIH A;  2F0G A;  2UXB L;  3TP5 A;  1SYB A;  2F0E A;  2B2W A;  4K2K A;  2HJW A;  1KC7 A;  4IAL A;  5IP7 G;  4DNT B;  1I94 L;  2K32 A;  4AH6 A;  3I72 A;  2LSS A;  4G7O C;  3G48 A;  4DR2 H;  1MI2 A;  3EFX D;  2XSC A;  1S5E D;  1VQE A;  3PUY A;  3S1N B;  4DLK A;  3HXL A;  1BCP C;  1SSO A;  3G6V A;  3GTP A;  1DGS A;  4LF4 L;  2JA9 A;  3W2D A;  4MIU A;  3FP9 A;  1PVO A;  2FJZ A;  3M3Y H;  3M4O H;  1FD7 D;  3MZ5 A;  2A5H A;  1UEB A;  3BJU A;  3C2P A;  4B3S L;  2HQE A;  4OIJ A;  1LLR D;  4JOI C;  1LM0 A;  3PW2 A;  2UVW A;  1I5F A;  2YYZ A;  2RBM A;  4J9N A;  1U9R A;  5J2U F;  2R6G A;  5JVD F;  4GKJ L;  4KY6 A;  4NXM L;  1CA6 A;  3E0J A;  1L1O C;  1MKH A;  2PI2 E;  3VYU A;  3M4Q A;  1N36 Q;  5EKL A;  5KG2 A;  3TRE A;  4GS3 A;  3FKI A;  4JI8 H;  1DV1 A;  2YS7 A;  1Z2O X;  1QOH A;  1YHA A;  5GAG C;  3RZD B;  3J7A V;  4J9P A;  2B8G A;  4BBS G;  3AYH B;  1IHZ A;  2NBF A;  3E5S A;  5C4Z A;  1MSH A;  4J9S A;  2C5C A;  2FK3 A;  2D0O A;  3OHX C;  1N34 L;  4F4W A;  4UY8 C;  2E75 C;  1XMQ Q;  2K5W A;  2PNR C;  1S4Z A;  3BAA A;  1UE6 A;  4I55 F;  1Q90 A;  4RKL A;  3GTO H;  1L2F A;  1PH7 A;  2Z8L A;  2HHH Q;  1GUN A;  3KHL A;  2RDF A;  2K52 A;  1DON A;  1JIH A;  1M6V A;  3D8G A;  4ZQI A;  3SE0 A;  3JAM c;  2HCC A;  1VQC A;  2UXD L;  1NTG A;  2C00 A;  3N40 P;  4TQU S;  1UC9 A;  2AWN A;  1XMQ H;  4I7Z C;  4EGJ A;  4JK1 C;  1QUQ B;  4LNQ A;  4A3B B;  4EYH B;  2EYP A;  3S1Q B;  2F0O A;  4LF7 Q;  3D6C A;  1XPU A;  2ZJR A;  2YV5 A;  5ELB A;  5KFC A;  4ZAI A;  3S1Q H;  2WAQ G;  4KV6 A;  1B3A A;  1HNX Q;  5KFV A;  3HOV H;  1B50 A;  2OH2 A;  5NUC A;  3H0G H;  2B2T A;  1AZP A;  3R5H A;  1HPC A;  3SXH A;  1I3Q H;  4H0L C;  5IGE A;  3HOY G;  5G3L F;  5M5Y B;  3LX0 A;  1RL2 A;  5IT9 E;  4ED7 A;  1SNP A;  4BY7 G;  5KG3 A;  3GV6 A;  2K03 A;  2NVY B;  3ICE A;  5KFA A;  2ALZ A;  2R7M A;  4JI5 L;  3D4R A;  1P16 A;  5FLM H;  2ZXR A;  3PIP A;  1KRT A;  5C3E H;  1IBL Q;  2AGQ A;  3GTO B;  2Q8R E;  3BU2 A;  4X66 L;  3GV5 B;  2IMW P;  2NVQ B;  4R4Q A;  4ZOL F;  1CQF A;  3PO2 H;  3TQT A;  5JUM A;  3FMA A;  5M9O A;  3KJP A;  1CKM A;  3C3L A;  1XWE A;  4IJL A;  3HOY B;  1JDB B;  3QG1 A;  2VQE H;  2ASJ A;  4H44 C;  2FP4 B;  4LH6 A;  3HKZ G;  2EYH A;  1YJN A;  1VAJ A;  4BY1 B;  3TRZ A;  4ED1 A;  1KJQ A;  1Y8P B;  2Q8T A;  1VF7 A;  3K81 C;  2NN6 H;  2FLL A;  3K0X A;  2J7Z A;  3N43 B;  1K73 C;  1WCM A;  3A8K E;  4DK3 C;  4LF8 L;  4APM A;  2CW0 C;  5A2Q E;  1PMR A;  2Q2U A;  4J15 A;  5FLM G;  4FBT A;  2R93 H;  5D8D A;  1CQV A;  2L55 A;  1C4Q A;  1H9S A;  4GNX A;  1H9R A;  5EAY A;  2UXC L;  4KD4 A;  3GIQ A;  2PQA B;  3AU7 A;  3H40 A;  4YY3 Q;  3M7G A;  5BN5 A;  4P71 A;  4OHJ A;  4A93 B;  3F2B A;  2K7V A;  4QIW E;  1SEI A;  2VW9 A;  3PVX A;  1SBB B;  3I4O A;  3PW4 A;  4O2D A;  3S2H H;  3V96 A;  4DV7 L;  2K4K A;  2NU9 B;  3T53 B;  4LSA A;  2WII B;  4A2B A;  1Y1V A;  3NP8 A;  3RLO A;  3EYY A;  4LFA Q;  2K5D A;  4KY5 A;  3M85 A;  2F0Q A;  4HJ5 A;  4QQB X;  5BPH A;  5KT5 A;  4PG3 A;  4A76 A;  5D1P A;  2EPB A;  1KLG D;  1QWY A;  2BQU A;  4B3M H;  4R4T A;  1EY5 A;  2GPS A;  5DGA A;  5M5X B;  1PYW D;  3KBX A;  1V1Q A;  1YZ6 A;  3GDE A;  1I4P A;  1OWT A;  2YYA A;  3I12 A;  5KT6 A;  4R8I A;  3KYH C;  3K5O A;  1SJE D;  1WFQ A;  5DQG A;  3W5O A;  3MWY W;  4XTC S;  1WJJ A;  1GKH A;  3H3V I;  3OSN A;  3MWD A;  2IX3 A;  4YCU A;  1VKZ A;  4A3D H;  1ZET A;  5C5J A;  1STN A;  3NHH A;  4GLA C;  1E22 A;  1YIT A;  2VUM A;  5CAE B;  2VS1 A;  4KD3 A;  2HVR A;  3A7A B;  2R7Z G;  3Q2O A;  4HTH A;  4RZR A;  1MGS A;  2DY7 A;  1SFO A;  1K8M A;  3X3M A;  4IPD A;  2NVQ H;  5F9L A;  2F0I A;  1E3P A;  3MFH A;  5L1I A;  2PW7 A;  3CF5 A;  3CC7 A;  3G8C A;  5CGK A;  4IPH A;  5C4J H;  1STA A;  4JV2 A;  3H3V C;  4KN7 C;  4PWQ A;  1JWU D;  1SMY D;  4L63 B;  4KN4 C;  4DNR B;  1O80 A;  2R87 A;  2K6A A;  5CV7 A;  4KHP L;  1C3O A;  3E5N A;  4I50 F;  4J9K A;  5AFW A;  2CZG A;  3LWE A;  1FJG L;  2VNU D;  5CBE E;  5KFU A;  2A19 A;  3SVM A;  2ENB A;  4UFZ A;  5LOV F;  3EN2 A;  4E6I A;  1BO0 A;  4R7R A;  4MV3 A;  5IYD G;  1KHI A;  1PZK D;  2UXC H;  4Q45 A;  3J80 E;  1L0X B;  2MHV A;  3D31 A;  4XQJ A;  3GTG B;  2IP4 A;  5KFF A;  1BVS A;  3U4Z A;  5EDW A;  1PA6 A;  1I6U A;  2I5M X;  2NU8 B;  1LYL A;  1AP0 A;  2ICI A;  1EOT A;  4NXN L;  1TT2 A;  4A3L H;  1NSN S;  5GQO A;  3PIO 3;  1ULZ A;  3KOJ A;  2R86 A;  4XDX A;  4M9U A;  2IBK A;  2L11 A;  4LF8 H;  1IYU A;  3N6R A;  4DV5 L;  4JI3 L;  2RA4 A;  1CQJ B;  1DCZ A;  1NCV A;  4IFD I;  4RAU C;  3ETH A;  2LFN A;  2HD3 A;  1KDB A;  3PIO A;  1HNZ L;  2OF1 A;  1SEB D;  2WKD A;  1H9J A;  3VDY A;  2L15 A;  2VB3 X;  3OHB A;  3PV0 A;  2IPK D;  1IBK L;  1SXT A;  1CZW A;  2E2J H;  3BA9 A;  1D8L A;  1Y1V B;  1PX2 A;  4Q0F A;  1JE4 A;  1TR5 A;  1TWH H;  3J7A 5;  4IZO A;  4A4I A;  3KHG A;  4LF9 L;  1I4R A;  5HV6 A;  4O1N A;  2TSS A;  4XQN A;  5KFR A;  1EZ8 A;  1B8A A;  3GTL H;  2Z6K C;  1LTL A;  3CP0 A;  4Q8E A;  1W93 A;  3K8A A;  3S15 H;  2IX1 A;  3NE5 B;  5CR3 A;  1V9P A;  4ZQ3 A;  2K28 A;  5KFJ A;  2D9U A;  2DIK A;  4OX9 H;  3EQL C;  5CV4 A;  3PF5 A;  3I4N H;  1LT4 D;  3UDF A;  1ASY A;  1HFN A;  4JI5 H;  3RB6 A;  4K0K L;  2BR0 A;  2W9C A;  4FXK C;  4IUQ A;  3HEJ A;  1TWF B;  1RF2 D;  1S5C D;  3OTO Q;  3K5N A;  5C44 B;  1PH3 A;  3SEB A;  2EY1 A;  5IT9 L;  1KQS A;  1SDF A;  3Q6S A;  2XGP A;  2DNC A;  1WH2 A;  3RF2 A;  2NN6 G;  2XC9 A;  1JOR A;  3KDF B;  4HID A;  3GII A;  2F0M A;  4C3I B;  1PTO C;  1QVG A;  1F9Q A;  2AU0 A;  1GJX A;  4UCT A;  1QUQ A;  1IYV A;  1T5E A;  1Z47 A;  3MA2 B;  3PMF A;  3G71 A;  3FHW A;  4OL7 A;  1J5E Q;  2NVT B;  1KJ9 A;  2F0V A;  4K6D A;  2LXK A;  1V4Y A;  3IAY A;  4DV7 H;  2OTJ A;  2KBN A;  1Q8K A;  5K5P A;  4LFC L;  1VQI A;  1AW7 A;  3W1G A;  3M9N B;  4DV0 H;  1CHP D;  2SNM A;  4I65 A;  5ELO A;  5CMD A;  4YY3 H;  2ASD A;  4Y8V B;  4A3M B;  4R8N A;  2V1C C;  3TP8 A;  4CGY B;  4ECV A;  2F0D A;  1S03 G;  2AUK A;  2X69 A;  3T1H H;  2NZ1 D;  4U67 3;  3M4P A;  1KNE A;  1FNU A;  4LF4 H;  4DR7 H;  4F4Z A;  4X65 H;  1LUZ A;  5C4J B;  4AQY Q;  4RAZ A;  2CHB D;  2JEF A;  2ES2 A;  1VS0 A;  1XNR Q;  2BCO A;  4NDX A;  1E2W A;  5CV5 A;  4UCR A;  1Q8I A;  3PQI A;  5IWA L;  5M3M G;  2XIG A;  3FDS A;  1M8A A;  2KHI A;  5DM6 3;  3HOX G;  4Y7N B;  1XNR L;  1S72 A;  2R7L A;  4IUV A;  2OQ0 A;  3F8T A;  1VBH A;  3D4D A;  4LJZ C;  1TA8 A;  3N52 A;  4NB3 A;  2WAQ A;  1CKN B;  2D2C C;  2EJF C;  3BDO A;  3U50 C;  2CW8 A;  2HGS A;  3LP8 A;  5KKN B;  5DQI A;  4DKA C;  1OXX K;  3I2Z A;  4PZ8 A;  3RNU A;  3PF4 A;  2CQY A;  2YZM A;  1BNZ A;  1E4E B;  2YTY A;  1JWS D;  1JJ2 A;  3MR3 A;  1C9O A;  4ME6 A;  2EY5 A;  4DAY B;  1XNQ Q;  1X65 A;  4YR0 A;  2RF4 A;  1MZB A;  1D1K A;  4PZ7 A;  2R92 H;  4C2M B;  5JPM C;  5DM7 3;  4FF4 A;  1VF5 C;  4QGU A;  2L0C A;  3R2I A;  2F0H A;  5IOD A;  2RDI A;  4MAM A;  1EYG A;  1X55 A;  1B9M A;  4JBW A;  4X3K A;  1WCM H;  1SE3 A;  4JV5 Q;  2J9G A;  3MFI A;  1JC7 A;  2KCT A;  4N9T A;  4RB0 A;  5LMN H;  2R7Z B;  5LA6 F;  2JA8 B;  4AIM A;  3MWM A;  4LF5 Q;  2DNE A;  4A3F G;  1JWM D;  1X6O A;  4NPS A;  5DEH A;  1NNX A;  1HR0 Q;  1AN7 A;  4B9W A;  1TVX A;  2EXD A;  3MJF A;  1E7Z A;  2XGQ A;  2F0K A;  3HOX B;  1HFG A;  2N49 A;  3M4O B;  1IZ6 A;  2RQX A;  1T5X D;  3ORQ A;  1CZG A;  1M4V A;  1HTP A;  4RG1 A;  3R8B A;  1L2Z A;  5C4X B;  1JB7 A;  4APV A;  2BQR A;  2J6S A;  2Z4H A;  3JAM E;  4MNO A;  2MO0 A;  1VQN A;  1RTO A;  1FR3 A;  5LP6 F;  1GUS A;  4C3I H;  2XCP A;  3OMC A;  5CB4 F;  1BGW A;  4RNN A;  4IR1 A;  4WOR A;  4DL4 A;  2B2W C;  1UNS A;  1AUV A;  3B6Y A;  2XCA A;  4ECQ A;  1M0T A;  1MSG A;  4R4O A;  4IWY A;  1FKA H;  1TII D;  4QIW B;  5LMN Q;  4YR3 A;  2R85 A;  2WAQ E;  3I55 A;  5D14 A;  4CDE C;  1H9S B;  3HKS A;  4LF5 H;  3CU7 A;  4EQO A;  2LMC B;  4J1M A;  1CSQ A;  1EWI A;  4LAA A;  1ICW A;  1AN8 A;  1N33 L;  4DL2 A;  2ATL A;  3KTM A;  4EGQ A;  2FMM A;  2F4V L;  2DJG C;  3N6X A;  3Q23 A;  1YIJ A;  4OON A;  1YNX A;  2DGY A;  2I07 B;  2J0T D;  3S2H B;  1KNA A;  3D4W A;  3RB4 A;  4WRD A;  1UE1 A;  3JZI A;  1X32 A;  3KLS A;  3LWB A;  1KAW A;  4UP8 A;  3L3O C;  4KKS A;  5G3L D;  5EOY A;  3GTK B;  3K7A H;  1EY7 A;  5IWA H;  1BBW A;  3W3A A;  3OHA A;  5C6A A;  1UNN C;  1WYD A;  4X3U A;  2MJ8 A;  2TMP A;  4Q0Y A;  2NU7 B;  4KKU A;  5C4X H;  4BY1 G;  2ZJP A;  2R3Z A;  3CCJ A;  1I50 B;  4J9M A;  3NTK A;  2ASB A;  3FKI H;  4F4Y A;  4RNO A;  3GTG A;  1T94 A;  1VQA A;  5KT2 A;  1P8L A;  1NR4 A;  5KFD A;  3NXW A;  4DR1 L;  2B63 H;  1T36 A;  4NXM H;  1XNR H;  1TKW B;  3FVQ A;  4JI0 L;  4GKK L;  1CS0 A;  1IL8 A;  3S16 B;  1WTO A;  5IE8 A;  3NBH A;  1EOV A;  3NSW A;  2Q2T A;  1EYC A;  3HOW H;  1PK8 A;  5CV6 A;  3OSO A;  1YI2 A;  2YRW A;  5DG9 A;  4PDB A;  1K3R A;  1IOV A;  3MXU A;  4B3T L;  3ND8 A;  1A62 A;  3IFD A;  1EY6 A;  4IRD A;  3V05 A;  2B3G A;  5GAH C;  4YP3 A;  2MNA A;  1MIU A;  4KHP Q;  3K57 A;  5CA0 F;  3CCL A;  1Z7T A;  3W1B A;  1K9M C;  3T5J A;  2N8N A;  2KHJ A;  4DL3 A;  4WJW A;  2FJ2 A;  5M5Y H;  4IO9 A;  4C3J B;  1PZI D;  3GIK A;  1XX8 A;  2NVY A;  2SOB A;  2VA3 A;  4C3J H;  4EQ5 A;  4L5T A;  5KIX A;  4B3M Q;  3PIP 3;  1DD2 A;  4HJ7 A;  4IWX A;  2JE6 I;  1MHW C;  5JOB A;  4LUV A;  2B39 A;  3NEL A;  4BBR G;  5I4D A;  2N88 A;  4DU9 A;  1R4Q B;  2I5H A;  1G2T A;  2BH2 A;  3M7N A;  3TME A;  4K0K H;  1VMC A;  3PO3 H;  4LH7 A;  1RHP A;  2K5N A;  5BPF A;  1GVP A;  3HOU H;  4HIM A;  5KEE A;  1BCP B;  1STG A;  3BZC A;  2PI2 A;  2J6U A;  1CT1 D;  3HFZ B;  1A2U A;  3V6H A;  2H5X A;  2F52 A;  1O7Z A;  4JI0 Q;  4GKK Q;  4A3C G;  3K3P A;  4OX9 L;  1Y1W B;  3H4B A;  2Y0S E;  4F88 A;  1KIX A;  2NVX B;  1L0Y B;  3LNN A;  1TWF A;  2A69 C;  3BA8 A;  1KXL A;  3L9A X;  5HGQ A;  2A6H C;  4OO1 I;  1NBW A;  4WJ4 A;  4MN3 A;  1X3P A;  5KYI A;  1XPO A;  3T56 B;  4LMY A;  4XZ3 B;  3VYS A;  1O7I A;  4BWG B;  1BF4 A;  3EPG A;  2E5L H;  2JN4 A;  3NUC A;  4CJ2 C;  2EOT A;  1LT5 D;  2JA5 G;  3Q8S B;  3NK9 A;  4A3K B;  2GVA A;  1T9H A;  2B2V A;  2YRX A;  4IQZ A;  2F0L A;  1IKM A;  5FO9 B;  1RYR A;  2R92 G;  4HYK A;  2IHE A;  4GOP C;  5EKK A;  3R93 A;  1Q3L A;  2YTV A;  4ECS A;  2RGV A;  3BVZ A;  1N48 A;  3CXC A;  1PYB A;  4JI2 L;  1E4F T;  1WCM G;  3CAM A;  1W6K A;  2B2U A;  2R93 A;  1Q1B A;  1SYD A;  2HVS A;  3GIP A;  3KK7 A;  5H1S E;  4QL5 A;  2RDH A;  2EE1 A;  1J9O A;  5E3F A;  5ISR A;  2CKZ B;  4RHS A;  5ELD A;  4ZKC B;  3CCU A;  1WVL A;  2HCI A;  1E0B A;  3RUP A;  3SE7 A;  5F9N A;  5JQW A;  4B3T H;  4A3G B;  3QFF A;  1B4O A;  5IYC H;  2K05 A;  1IKL A;  4LF8 Q;  1Y1V G;  2MO1 A;  3ULJ A;  4DL5 A;  2F1M A;  4RA8 A;  4DUY L;  1N32 L;  1PV4 A;  4XXE A;  1KDA A;  4DR3 H;  4RNM A;  4DXF A;  4DR1 H;  4LFC H;  1WTR A;  1B3Q A;  2IJ0 A;  4X64 Q;  4CHT B;  4HNT A;  3VPB A;  1EU3 A;  4EEQ A;  1BUV T;  3PO2 B;  2L12 A;  2W9B A;  4MV9 A;  1Z6H A;  3S14 H;  4EGV A;  4KK7 A;  4MHE A;  1YNN D;  1BDO A;  2VUM B;  4DGZ A;  1OXU A;  1KDC A;  1U4P A;  1VQM A;  4EEY A;  2D5D A;  1A15 A;  2HIV A;  1IBL L;  2ZT9 C;  4GOP B;  1JIC A;  1HR0 L;  1KJI A;  1A3U A;  1BQQ T;  5JJZ A;  4JI5 Q;  1PDQ A;  2YZN A;  1Q86 C;  5IYD H;  3K5H A;  4BBR B;  3TEH B;  5D3I B;  3A5Z B;  4L6T B;  4C3H H;  1FNW A;  2G5D A;  3G6E A;  1Q82 C;  4FF2 A;  4EBD A;  1JOQ A;  1HQR D;  4RGM A;  5HBR B;  1HZB A;  5M3F H;  5EPJ A;  3C46 A;  4C3J G;  2FLP A;  1GHJ A;  2DWC A;  1JX4 A;  4DUZ H;  3H94 A;  1VQD A;  3IRB A;  5E4W C;  4ECR A;  1C7Y A;  1UWV A;  1S5B D;  2RCF A;  4DV4 Q;  1S68 A;  3BAB A;  1X9N A;  1JT8 A;  4HR7 A;  2EJG C;  2PMZ E;  3HS0 C;  4BA1 I;  4RWS C;  5T1I A;  1VMP A;  1VQ8 A;  1HCZ A;  4DV3 H;  1AUX A;  2WB1 B;  1RIP A;  4UAI A;  3I4M H;  4POG A;  1TY0 A;  1DM0 B;  1EY8 A;  1V8Q A;  3I70 A;  3MHB A;  2I8C A;  5FK9 C;  2QA4 A;  1V43 A;  5IWA Q;  4QCL A;  4LSX A;  2A68 D;  1HA6 A;  3E3X A;  4ECW A;  5KG1 A;  4TKO B;  5EPL A;  1B2T A;  4DFA A;  3QOJ A;  1XMQ L;  1MJE A;  1VQ7 A;  1SYX B;  4ILW A;  2KSW A;  5KFE A;  2W6M A;  1E4E A;  1YJW A;  2VPS A;  2RKS A;  2R7K A;  1YHB A;  2NUC A;  2F03 A;  1FJG H;  5JVH 3;  5M5W H;  2Y0S G;  4K8J A;  1YNJ C;  4RH6 A;  1JQY D;  3C0F B;  5M3F B;  3BQ0 A;  1XYI A;  4YWL A;  1LTG D;  1S0M A;  2RVL A;  5IIF A;  1IL2 A;  2QK4 A;  2JA5 A;  1F9S A;  3A54 A;  5JJL A;  3CVZ A;  1S10 A;  1U4M A;  1EY9 A;  5IP9 G;  2C28 A;  4MV4 A;  3M9B A;  2BQ3 A;  2KA7 A;  3RB0 A;  4O2A F;  1HUN A;  5JEA J;  4HCE A;  4KHP H;  4R9W A;  3HOZ B;  1KAB A;  1TXY A;  3RIZ A;  3RN2 A;  5EKI A;  5KT4 A;  3AB9 A;  4GN4 B;  1R9T H;  4XIG S;  5FJ8 G;  4HIK A;  5IOC A;  4DV0 Q;  5C4H A;  3BYY B;  2JEJ A;  4JI7 Q;  4X66 H;  3KF6 B;  3NQI A;  4V19 0;  1I6H H;  1RJT A;  4EYI B;  2LKV A;  2YU9 H;  2MUY A;  3OTO L;  3Q24 A;  1T3N A;  4HSV A;  1ZYR D;  4HN7 A;  2VOB A;  3J80 c;  2WYO A;  2V4Q A;  2EY2 A;  3SK4 A;  2H4O A;  3UDI A;  1IOW A;  2OLS A;  4K0K Q;  2MGS A;  3V2T A;  4A3F H;  1Q1E A;  1K8A C;  5T14 A;  4QWC A;  1FNV A;  1ET6 A;  4DL7 A;  3VMM A;  2CWA A;  1Y14 B;  1EUJ A;  4MZ9 A;  5K36 G;  1SAP A;  3J7A K;  2G9D A;  4DR5 L;  4FM9 A;  1ONL A;  4DV1 L;  1CKN A;  2R7Z H;  3N44 B;  2UUB Q;  2BE5 C;  2V4R A;  4DR7 L;  3TDQ A;  3RGX A;  5FKA C;  3J7A F;  2HIX A;  2XVS A;  1JOK A;  1ZHQ A;  4HCS A;  1SCU B;  3GTL B;  1LV9 A;  3F2C A;  2F0F A;  5IGG A;  4KJO A;  4C5C A;  1ASZ A;  1IBK Q;  5IT9 W;  5C44 G;  2JA6 A;  2N55 A;  3H4D A;  4CKE A;  4GLV B;  1GGO A;  2KVM A;  1TWC H;  3KFU A;  3BQ2 A;  3HOU B;  1VQJ A;  2QW7 A;  4OIK A;  2UXD H;  2B2V C;  2UU9 H;  1EYA A;  3CQZ A;  1OO9 B;  1K8G A;  3RBE A;  2RDG A;  3I90 A;  1X3F A;  5CV9 A;  2M2L A;  4DR3 L;  1D2B A;  2PZU A;  4HIO A;  5A2Q L;  4G3I A;  5K36 H;  3E0E A;  4HR7 B;  2MFI A;  4ABN A;  3GQC A;  1X3G A;  4G57 A;  1K83 H;  2F0P A;  2WKC A;  1TS4 A;  3RGZ A;  5C3W A;  4IZ8 A;  1VBG A;  4HED A;  4QF4 A;  1MJC A;  2KHS A;  5AJ3 L;  1K28 A;  2Z6B A;  3E6Z X;  4IAJ A;  2HVQ A;  4DPG A;  2W71 A;  1PRT F;  4WFN 3;  3ETJ A;  4JI1 L;  4LF6 H;  4JI8 Q;  5I6Y A;  1G29 1;  3KHH A;  2UVV A;  1WOC A;  1CHQ D;  2WAQ B;  2E5L L;  3NTH A;  1FJG Q;  4HMI A;  1E24 A;  2F0S A;  3F8N A;  3IKJ A;  4MTN A;  2VQE L;  1M1K C;  4HNV A;  4AYB G;  5I9O A;  2QKI C;  5FPR A;  3VR2 A;  2HDM A;  2ATW A;  2EXZ A;  3EVQ A;  3GIM A;  3GV3 A;  4RGO S;  4Q8F A;  2VQF L;  3OTO H;  1A3V A;  1E2V A;  3T5K A;  2YTX A;  4CBV A;  4BBS B;  4X64 H;  3RBD A;  1D7Q A;  3FRP B;  1AEX A;  2ZDQ A;  5LL6 b;  3E9I A;  2PW5 A;  4RB1 A;  4OEM B;  1EQR A;  3I91 A;  2L5T A;  2X6L A;  1I3Q A;  5EBC A;  2JYO A;  2F0J A;  2WFW A;  4A3I H;  4JBM A;  4KY7 A;  4DR6 Q;  4IFD G;  1ZEQ X;  2W7O A;  3T1Y H;  1RYS A;  2NU6 B;  2ZTE A;  3OSP A;  4PZ6 A;  4XX0 B;  4LF6 Q;  1VQO A;  5EJW A;  4CDF C;  4HSP A;  2JEB I;  4G4K A;  2NYZ D;  2B63 B;  5KFP A;  1V1O A;  4C3H B;  3J80 W;  2DN8 A;  2OWO A;  2FE3 A;  3AQQ A;  4AQY H;  3I8Z A;  5M3M H;  3QOL A;  4B9X A;  1Z9F A;  3RV3 A;  4RU9 A;  4RHR A;  4NKL A;  4A3E B;  2J6T A;  2R7F A;  5L37 A;  4X65 Q;  2QF7 A;  3OW2 A;  1SYE A;  2JA7 B;  4A3I G;  2YU9 B;  1LAC A;  3ERO A;  3TZD A;  3V4Z A;  4DV1 H;  1KC8 C;  3HOU G;  2AQ3 B;  2DPI A;  2E2H A;  1DOM A;  2BA0 A;  4DV7 Q;  1JJC B;  4EBC A;  1EZ1 A;  2YL2 A;  1S5D D;  2KEN A;  3KAK A;  1EQT A;  3GTQ A;  4XYQ A;  4ID6 A;  2B2T C;  2EYJ A;  2W7P A;  2PMZ A;  3S17 H;  4JI0 H;  4GKK H;  4IUN A;  2AUJ D;  3KUP A;  1Q7Y C;  4BWS C;  2UXC Q;  1A2T A;  1JLL B;  2K33 A;  1X56 A;  3RAQ A;  1V1P B;  1X3Q A;  3TS2 A;  2E74 C;  3FMC A;  3Q1K A;  2ID0 A;  4BS9 A;  1K0R A;  5KGU A;  2NUA B;  3PUX A;  1XDN A;  1D5Z C;  2AMC B;  3KF8 A;  5J39 A;  5KFL A;  4KKT A;  3RZO H;  4XYM B;  4F50 A;  5DLF A;  2G9H D;  2R8I A;  1I6H B;  1QB5 D;  1ZQ7 A;  2W9B B;  3N41 B;  2ZM6 Q;  1S5F D;  2A8V A;  2NTT A;  3CHB D;  3GTQ H;  1YEZ A;  4HQ6 A;  5KFX A;  4ED6 A;  4C2M H;  4UP7 A;  4IUR A;  2I5L X;  3D0F A;  3TQY A;  1K1Q A;  5JPN C;  4FBU A;  2W6N A;  3S2D H;  2QEX A;  2PCF B;  4X66 Q;  4JI7 H;  3GV8 B;  3H0G B;  1R9T A;  3JAM L;  1UE5 A;  4A93 G;  3K5L A;  3H3V H;  1EQV A;  4MTE A;  1IW7 D;  4DR6 L;  4J0M A;  4BXX H;  3J81 j;  2L1B A;  3QIA A;  4QMG A;  2B2Y A;  3QO2 A;  1JR0 D;  3R2T A;  1EYD A;  2XGT A;  4XT3 B;  3AMU A;  1IBM L;  1SFO B;  3PSI A;  1Q81 C;  2AQ2 B;  1Y8O B;  1U0L A;  4L5S A;  4ETS A;  1B04 A;  2BH8 A;  1XTD A;  3OPO A;  1SFO H;  1PH6 A;  2HQL A;  4JI3 H;  3ND9 A;  1SNC A;  3HOW B;  1L0W A;  4X6A H;  5H80 A;  2BDO A;  3A0J A;  3LWU A;  2OEO A;  3JAM W;  1HNW H;  4LUZ A;  4OWT B;  3A55 A;  1PRT C;  2VQE Q;  2QIL A;  1RK6 A;  4NXN H;  2A74 C;  4RUA A;  3J81 W;  1I50 A;  2R7Z A;  1C48 A;  3QB3 A;  2JA5 H;  3KHR A;  2X0S A;  3VR4 A;  4BXX G;  3BQ1 A;  2E76 C;  2O2L D;  4CJ1 B;  3FKI G;  5KFT A;  5L1L A;  2PNH A;  2IT1 A;  4DV2 L;  4M7E A;  4C3H G;  3STB D;  1S9F A;  2ZXP A;  1RJQ A;  3K59 A;  4X3T A;  3KF8 B;  2W9A A;  4V0B A;  5KFW A;  1PTO D;  1EHI A;  1J8I A;  3SK6 A;  4LWC A;  1CQI B;  2ZM6 L;  4TVA B;  1HNW L;  2CVR A;  4F4X A;  5C0X G;  1LO5 D;  5KYL A;  3A5U A;  4Q44 A;  1WTP A;  2PYK A;  3GTK H;  4TV8 F;  3RR5 A;  3SGI A;  1DZ1 A;  4R8U A;  5L9X A;  5KG5 A;  5ELE A;  3VR6 A;  5ELC A;  2P5Z X;  5DG8 A;  4TQS A;  2AKW B;  4YCW A;  4DR5 H;  2R8G A;  2I46 A;  4DA2 A;  1PZJ D;  2VUG A;  4A3G H;  2VQF H;  2JEA I;  1N36 L;  4P73 A;  2F0W A;  4C56 C;  2PBZ A;  4NW2 A;  3GLK A;  2MPM A;  2AGP A;  1CA5 A;  4O42 A;  2UVU A;  3RFC A;  2Q2I A;  2UUB L;  4K5W A;  4QJF A;  3TP7 A;  2VPQ A;  4DR5 Q;  1NY4 A;  2F3I A;  3F2D A;  3DLL A;  1JE5 A;  4QUC A;  4RFB A;  4MA0 A;  4DV5 H;  2LY7 A;  2V9W A;  1JJG A;  2EYM A;  2KOL A;  1IXR A;  1QZH A;  2OQK A;  3TIG A;  3M3Y B;  1G91 A;  2V5A A;  5KFI A;  3MTS A;  4AYB E;  4JI6 H;  4IOC A;  1VQG A;  4DF7 A;  3PO2 G;  2A6E D;  2E2J B;  1TWC A;  4J6H A;  1TWA A;  3GTO A;  1UEA B;  5LMU Q;  3I73 A;  3R3O A;  1NMF A;  5M3F G;  1I94 Q;  5I47 A;  2JA6 G;  2DZD A;  5C1P A;  2UXB Q;  3S15 B;  1F2Y A;  2NN6 I;  4OGQ C;  5M5W B;  2ZJT A;  2KCN A;  4RKB A;  4DV0 L;  4DV6 L;  4LF6 L;  5KRU A;  4GN3 B;  4ZCK A;  4JI4 Q;  3Q22 A;  4DR2 Q;  3DF7 A;  1I7N A;  3GIL A;  3I4N G;  3T13 A;  5KND A;  1BBU A;  2ZDH A;  1WCM B;  4S3S A;  3PO3 B;  4J9O A;  3SR1 A;  3QZ7 A;  1UAP A;  1TWG H;  4CDD C;  1G6P A;  1MD2 D;  4U6P A;  2UUA Q;  1KJ8 A;  1L1O B;  3HOY H;  3HKZ E;  1GSH A;  1HZ9 A;  2JQO A;  2NVX H;  1W3S A;  1Z2N X;  2JA5 B;  1K8O A;  2K01 A;  2CW7 A;  3S24 A;  1N8R C;  1ROD A;  2W8L A;  4NP5 A;  3KAL A;  5IYC G;  4QY7 A;  3GV7 B;  2E5L Q;  3J80 i;  3I3C A;  3U9O A;  3AFQ A;  1PH2 A;  5GON F;  1KRS A;  2FKL A;  2ASL A;  3QJY A;  4JI8 L;  3L2P A;  4B3R Q;  4H02 A;  1FGB D;  4HAE A;  3T5L A;  1J5E H;  3OOC A;  1PFM A;  2WAC A;  3DWP A;  5CYU A;  3SI8 A;  5J22 A;  4DXG A;  4DAP A;  4MV6 A;  5IP9 H;  2B2U C;  4FNF A;  3KF6 A;  4ODG A;  4DUZ L;  2V58 A;  2Q8I B;  4EQN A;  3NEN A;  3S16 H;  3PN1 A;  1Y8N B;  3ORR A;  4IUP A;  2RGR A;  1HZA A;  4PMB A;  3R23 A;  2RDJ A;  3IL8 A;  1DOL A;  2J4X A;  3K0Y A;  3BDC A;  4JUZ A;  4DR3 Q;  2D0P A;  1EQQ A;  1NR2 A;  4YIJ A;  5ELF A;  1W2B A;  2BDN A;  1LT3 D;  5EBD A;  3KXY T;  1EIG A;  1Z2P X;  1GXD C;  1F2Z A;  4L8J A;  4TRD A;  4CC6 A;  1G6Z A;  3GO5 A;  2Y0S B;  1WTX A;  3Q8D A;  4QWE A;  3T51 B;  1F2M A;  2QDL A;  1ET9 A;  2I80 A;  4XT1 B;  3N42 B;  2EQS A;  3NPP A;  2CWP A;  4MV8 A;  4YAK B;  2XN9 C;  5IYB H;  3FKI B;  3GP7 A;  4MTD A;  4DV1 Q;  1D1I A;  2DY8 A;  5JH7 F;  1TWC B;  4X62 L;  4A3F B;  5FPO A;  3RB3 A;  2XRS D;  3S17 B;  3M9M B;  1CM9 A;  2JA7 G;  2NVT H;  1YHQ A;  3RV4 A;  3K7A B;  5KG4 A;  1VQB A;  5DLQ E;  4JCV E;  3G7L A;  1MBY A;  4X64 L;  2SNS A;  4PMC A;  5KFS A;  5DGB A;  1S0O A;  4L5R C;  3WNZ A;  5DQH A;  4J9R A;  4DUY Q;  1N32 Q;  4CDC C;  3T1Y Q;  1BOS A;  4DR6 H;  1R9T B;  2YU9 A;  5IYB G;  3J7Y W;  4JI7 L;  2R8K A;  1A6X A;  3HRZ C;  3Q8P B;  5IGD A;  1SYC A;  2C2R A;  4O3O A;  2WB1 G;  4GOP A;  5C8Y F;  3MVV A;  3TN2 A;  2GN5 A;  4E4T A;  3U58 A;  1VQP A;  5M3M B;  3OYY A;  2K5H A;  4YHH Q;  1XJV A;  1D5X C;  3JAM i;  4IHJ F;  1XNQ H;  1PTO H;  4K5V A;  3K5M A;  4RAY A;  2FLN A;  3HB9 A;  4HJ9 A;  2F3V A;  2JJQ A;  2PQE A;  5FLX E;  1PXU A;  3J81 i;  5FO8 B;  4JI6 Q;  5C3E B;  5KG7 A;  3R5F A;  4JG2 A;  4JBJ A;  1YJ9 A;  4TUY F;  4KHZ A;  4YCV A;  2EJM A;  3X3N A;  3UI2 A;  2Z4I A;  4CKC A;  3RZD H;  4O3N A;  3PR5 B;  2KCM A;  2K5Q A;  5ELN A;  3TS0 A;  2UUC L;  2ZJQ A;  2IX0 A;  2KEC A;  3MFY A;  3MEF A;  3CQZ H;  5IYZ F;  2DJF C;  2KQ3 A;  5JVL A;  2VXW A;  5GAE C;  3UE0 A;  3HOX H;  3HOV G;  4DUY H;  1N32 H;  4ZUI A;  4DV6 H;  1N33 H;  3EIV A;  1WTV A;  4ULL A;  2B63 A;  1XMO L;  2CCZ A;  3CC2 A;  1SRU A;  3KDF A;  3CC4 A;  1B7Y B;  1HR0 H;  3MFG A;  3OWE B;  1BXT A;  5BR8 Q;  3J7Z C;  2XWB B;  1KJJ A;  4YJ2 F;  4QIW A;  1VCI A;  4ECY A;  1VQ9 A;  1HH2 P;  1O7Y A;  4EFB A;  4IFD H;  1TS3 A;  4JC0 A;  1WR2 A;  4KJN A;  1GUW A;  5FLX W;  3BJY A;  3BZK A;  1ZYR C;  3VA5 A;  4DV4 L;  3PW0 A;  1OXV A;  1LTB D;  2Z9H A;  5IGB A;  1TWA H;  2RSN A;  4JOI A;  3VPD A;  3IG0 A;  2WB1 E;  3BG5 A;  4AYB A;  3QZ8 A;  1H9K A;  1JOO A;  1EWH A;  4A3D B;  1VQH A;  3GQB A;  2OXP A;  3G4S A;  1AZQ A;  3WO1 A;  2EDG A;  1EU4 A;  1ILQ A;  2O5I C;  1EEF D;  1ENF A;  1KL9 A;  1N36 H;  1VQL A;  3S1R B;  3UDG A;  2UUB H;  4ECT A;  2KCC A;  1M7J A;  3GTQ B;  2R7N A;  2R84 A;  4B3T Q;  1RD9 D;  3OUU A;  4L1K A;  1NUC A;  1RJP A;  2B8F A;  1B53 A;  1CK1 A;  2FB9 A;  4QWB A;  1Y69 U;  2R93 G;  2AQ4 A;  3H91 A;  1GUO A;  3FDT A;  1XTC D;  2PZW A;  5GAD C;  4DV3 L;  4JI2 H;  4FS1 A;  2XTI A;  3D6W A;  3SK8 A;  3JSL A;  1QG7 A;  4PQX A;  1BNC A;  3I4M G;  3RLF A;  1B33 N;  4YBZ B;  2W70 A;  1HA5 A;  4IJH A;  5D65 A;  3T16 A;  1K83 B;  3S2D B;  2FPP B;  1RTN A;  3PGZ A;  4R4I A;  1OTC A;  4O4H F;  3RMH A;  3DEP A;  2VA2 A;  1RDP D;  5COR A;  3J81 L;  4B3R H;  1EWC A;  4J8Q A;  5DLG A;  2E2I H;  4ZK9 B;  1GLV A;  1RK5 A;  4HNU A;  4KI0 A;  3ZJY C;  3FPU B;  2OTL A;  1C8C A;  1J6Q A;  2NTS A;  2VR1 A;  3GTJ A;  2E2H B;  2L9H A;  3DUZ A;  1PH8 A;  4K2L A;  2AHO B;  1B9N A;  4DR4 Q;  5C5L A;  3S14 B;  3RLN A;  5HY6 A;  4P2C B;  1HNZ H;  1STE A;  4JVZ A;  4YJ3 F;  2O03 A;  2FMC A;  1B6S A;  2I0Q A;  1WSC A;  4DAY A;  1DYQ A;  4N9P A;  2F4V Q;  4DV2 H;  4JI2 Q;  2X6G A;  5IT9 c;  4K14 A;  2UU9 Q;  1PTO B;  4HJA A;  1BXR A;  2WDT A;  5KFQ A;  3BG3 A;  4R4C A;  1WD1 A;  2R93 B;  4BA2 I;  4FDB A;  1HRJ A;  1XPR A;  1HZC A;  3H20 A;  3VPC A;  3S9W A;  4KHV A;  2FK1 A;  3MR2 A;  3HOZ H;  3RJ0 A;  1N34 H;  4DR4 L;  3S1N H;  3K6O A;  4O4I F;  4RGT A;  5KFM A;  3GIJ A;  2JA7 H;  4A3G G;  4TQR A;  1NMG A;  1VQF A;  3URY A;  3CCV A;  1BBX C;  2NVX A;  2ICE C;  5DAU A;  5KFG A;  5KFY A;  1B70 B;  1K0S A;  1EIY B;  1SE8 A;  3KLR A;  4OX9 Q;  1STH A;  1O7L A;  2CH4 A;  4ME5 A;  3CKI B;  5DNF A;  2CFM A;  5LMN W;  5KFH A;  1H95 A;  1FL0 A;  4DV3 Q;  5CC4 A;  2ZTC A;  4MV7 A;  4GNX C;  1DOK A;  2R92 B;  3Q8Q B;  2FIN B;  3OW7 A;  4C2M A;  2A69 D;  2XRQ D;  3H15 A;  4IRC A;  1BKB A;  2WE6 A;  5EQ0 A;  4DK6 C;  4LF5 L;  2I87 A;  5KFK A;  4A3K G;  1SJH D;  3GD7 A;  3GTM H;  4YB8 B;  4OXP A;  3HOV B;  4JV5 L;  1H9M A;  4B3M L;  1TQO A;  3P20 A;  4ZRZ A;  2ZXO A;  4K6L A;  2JA8 H;  3RAX A;  1QJO A;  1LTS D;  1SYG A;  4GKJ H;  2EYF A;  1KLU D;  4YWM A;  3J81 c;  4RB2 C;  1PHJ A;  2FXQ A;  3JRX A;  4F87 A;  4JYA Q;  3CCQ A;  2CQO A;  4ED2 A;  5KNB A;  2Z6K A;  1XNQ L;  1HJP A;  1LTA D;  1Y1W G;  5FOB B;  5C0X J;  2FMA A;  4HJ8 A;  5D3D A;  2C9O A;  2IL8 A;  4ECX A;  4QB4 A;  1I3Q B;  5KT3 A;  2R8H A;  5C3E G;  2HUG A;  3HKZ A;  5C4X G;  1X3E A;  5BN3 A;  4IPC A;  5JEA H;  2MP1 A;  3H09 A;  3GTG H;  1JCK B;  2SDF A;  1XMO Q;  3I4M B;  1PFB A;  2O4X A;  3FEW X;  3Q0A A;  1U5K A;  2VUM G;  4LFB L;  2R82 A;  3F2U A;  4DR1 Q;  5CV8 A;  5HGT A;  1GHK A;  4C3I G;  1E1T A;  3IFT A;  4ALP A;  1U4R A;  5L1K A;  1S40 A;  1DV2 A;  1JXL A;  3HG9 A;  3KJO A;  1XXG A;  4YAJ B;  4C5A A;  1XMO H;  2K14 A;  4XQQ A;  4A3J G;  4ZLT F;  4IUT A;  3F1Z A;  4UPA A;  1A63 A;  2NZH A;  3BYT B;  1YNN C;  3NTI A;  3UE1 A;  1UC8 A;  4TV9 F;  4FP5 D;  4UCU A;  2E8G A;  3CQZ B;  4RCO A;  4JI6 L;  2JP1 A;  3A74 A;  4LFC Q;  1E2Z A;  4P72 A;  3GTM B;  4JYA H;  4PMW A;  4QUF A;  3CCR A;  2VZA A;  1IW7 C;  3GTK A;  5D1O A;  4YHH L;  4JPB W;  1J5E L;  3CPF A;  4O4L F;  2B2Y C;  1CFM A;  4B08 A;  1QVC A;  1LTT D;  4EQP A;  3T1H Q;  2PZT A;  1N33 Q;  5EWG A;  1W6J A;  2JXM B;  1KBL A;  4WBN F;  2ZDG A;  3NGD A;  5LMN L;  5J3B A;  4F8M A;  4RB3 C;  2Z1C A;  4NMZ A;  1IBK H;  1EUC B;  1PFN A;  5M5X H;  2EIF A;  3T1Y L;  3K3V A;  1CI3 M;  1PRT D;  5COY A;  3WO0 A;  2W9C B;  4JV5 H;  1JKJ B;  1GSA A;  3M4Y A;  1ILP A;  3M9O B;  1Q12 A;  3K7U C;  3NEM A;  2LXJ A;  2GA4 B;  5C44 H;  4K5X A;  4CKB A;  3ERS X;  1TWF H;  1UUP A;  2QGQ A;  3BDL A;  4LFA H;  1S3O A;  3R5X A;  2LS0 1;  3ER0 A;  5EGT A;  3MXP A;  3L7Z C;  2C35 B;  3P75 A;  4R1J A;  5TSS A;  1IBL H;  3C1F A;  4FO2 A;  4FVM A;  2NZO A;  2QCP X;  3G6Y A;  3ZYY X;  4IR9 A;  3E9H A;  3PCO B;  3H0G A;  1KEE A;  4Z9C B;  2R7D A;  2EY6 A;  3ULL A;  5KG6 A;  1TWH A;  3T1H L;  3OWF A;  4LF9 Q;  5IP7 H;  1N9W A;  1I6V C;  1GYF A;  5CBA E;  3LML A;  2AGO A;  3GTL A;  1L1O A;  3DEO A;  1DIK A;  5JAV A;  3EJI A;  1SNM A;  2IW3 A;  2NVY H;  1YNJ D;  2SCU B;  4QWD A;  2JEI A;  2W57 A;  1WD0 A;  4C1N K;  4A75 A;  1HNZ Q;  2BA1 A;  1JDE A;  4JW0 A;  4LFB H;  3CCE A;  5CA1 F;  1PRT B;  2WIN B;  1V1P A;  1PH9 A;  3FPP A;  4DV5 Q;  4IN3 A;  4LK1 C;  2FPI B;  3K80 C;  4FF1 A;  4EG0 A;  1Y1W A;  3H6M A;  3ERQ A;  2KUM A;  1SR3 A;  5LL6 X;  2H1E A;  5LL6 S;  1ENA A;  1YVC A;  2QYZ A;  3L4K A;  2IWH A;  1CTM A;  4DUZ Q;  4ZI7 F;  2FHT A;  3DHQ A;  2CW0 D;  3I7F A;  4LFB Q;  4POF A;  2XCL A;  1AH9 A;  2UVR A;  1PYS B;  4G7H C;  2QDB A;  1RKN A;  4OO1 H;  1GOZ A;  1R4P B;  2D62 A;  3HZX A;  3MAQ A;  4JV0 A;  4AQY L;  4YQW A;  4B3R L;  4FU0 A;  1I4G A;  1SNQ A;  2A6E C;  4KMU C;  5A2Q W;  3VYT A;  1F2L A;  5FD6 A;  1GUT A;  4TSS A;  3GTJ B;  4A3J H;  3KAJ A;  4CC5 A;  3U4V A;  2N78 A;  3EPI A;  2K75 A;  4UCS A;  4A3J B;  3NWS A;  1I94 H;  5LYJ F;  1EZ6 A;  3MR6 A;  4DK1 A;  1CSP A;  1SLJ A;  2HDL A;  3CRK C;  1WTQ A;  4JYA L;  1WTW A;  1F9R A;  2V59 A;  4A3B H;  4YHH H;  2V4D A;  3SK5 A;  4OWX B;  2E2D C;  2UXB H;  4RGN A;  1E4G T;  2PQA A;  5KFZ A;  3MXN B;  2VQD A;  4KTA A;  2EYL A;  3CCS A;  4U68 A;  4YWK A;  2PPB C;  5FO7 B;  3IN5 A;  4DV4 H;  4GLX A;  5JVG 3;  1AFP A;  1SE2 A;  3PUW A;  1JB3 A;  2Y0S A;  2YW2 A;  1TWG A;  5GRO A;  4DR2 L;  4P75 A;  4Y52 H;  5E1F A;  1GSO A;  4MA5 A;  3RD4 A;  3OUZ A;  4A3M H;  5BR8 H;  1STY A;  4U7C A;  4UDU C;  2O5J C;  1VQK A;  4LUO A;  1I4Q A;  4O3R A;  4HMJ A;  2WP8 J;  2VUM H;  3ITP A;  4QW8 A;  3RTX A;  1TAE A;  3EBE A;  5LMU L;  2KED A;  3CW2 C;  2A1A A;  5BN4 A;  3EA6 A;  2Z0S A;  2C2D A;  2MCT A;  2UUA H;  5L1J A;  4P74 A;  2CQA A;  3ONA B;  4ED0 A;  1N56 A;  4FF3 A;  1NJI C;  2JA7 A;  4NLG A;  4R8U B;  1BJT A;  3MWE A;  5KFO A;  1GO3 E;  4N8X 1;  1SMY C;  3V6K A;  2XIW A;  1ESF A;  4XYL B;  1PLF A;  4H13 C;  3KBG A;  2CH4 W;  4A3K H;  3ULP A;  3Q8R B;  1TS5 A;  4I7A A;  1JMC A;  2M00 A;  4A3C H;  3JRW A;  2UU9 L;  2PVP A;  3TII A;  1QCB D;  2JA8 G;  3I4N B;  1EYZ A;  5I2Y A;  2E2I B;  2M05 A;  1I7L A;  1A0I A;  4GC7 A;  4IRK A;  3T4A C;  4A3D G;  3VR5 A;  2OT2 A;  2SEB D;  2R61 A;  3VA7 A;  3G6X A;  4JBK A;  4LMQ D;  4DAM A;  4O3P A;  3N8D A;  4DL6 A;  1IBM H;  4BY7 B;  1I4X A;  4EFE A;  1Q46 A;  2EYO A;  2L4N A;  5FJ8 H;  3SDZ A;  5IGC A;  5KFB A;  1PTO F;  5KFN A;  2N3S A;  1WTH A;  4JI3 Q;  2IA6 A;  3UQ8 A;  1EFI D;  3I4L A;  2OCE A;  1LTI D;  3C1E A;  1HNW Q;  1SN8 A;  3JC6 6;  2BOS A;  4MTK A;  3DMU A;  4NXN Q;  5LHY 1;  4FXD A;  4WD3 A;  4ED3 A;  2Q2H A;  3BS1 A;  4ECZ A;  3NBH B;  5JJK A;  1EEI D;  4X3S A;  2W6P A;  4K8I A;  4PV1 C;  2PN1 A;  3GID A;  4UCO A;  5C1O A;  4ZKB B;  4DV2 Q;  4JI1 H;  5LXT F;  4B3S H;  2F4V H;  5C3X A;  5J1Z A;  4RCN A;  1K3B C;  5EWF A;  5IY0 A;  5E4X A;  1LT6 D;  3P1H A;  4GN5 A;  3OIP A;  4DR4 H;  2K1B A;  1CKO A;  3T5H A;  2IY5 B;  3TIN A;  4JV1 A;  1G2S A;  3TQ1 A;  4FXG C;  3DWA A;  1II3 A;  2C2E A;  5KX5 F;  4J9L A;  2IHF A;  5EZY F;  3D3R A;  3KLW A;  1KTK A;  4C5B A;  1HTL D;  2JSO A;  5J2T F;  4G7Z C;  3WOF A;  2WV6 D;  1HNX L;  1GUG A;  1BR9 A;  1YBY A;  2PMZ B;  3J80 L;  2FK2 A;  5D1O B;  1A9X A;  4O3S A;  5KNC A;  1EIF A;  3A56 A;  1K1S A;  2YCH A;  4AYB B;  3MXN A;  4A2A A;  2ALY B;  5I2X A;  1IBM Q;  5C0X H;  2HT1 A;  4I4T F;  3UDX A;  1WI5 A;  3MEH A;  2QEJ C;  3TP6 A;  1C0A A;  2K04 A;  1V51 A;  4Q5V A;  2ZTD A;  5FLX L;  1TWA B;  2R6F A;  3HKZ B;  2MQH A;  5FLX c;  4JI4 H;  3A8I E;  2VY3 A;  2XNA C;  4KLK A;  3RUZ A;  3GTP H;  5BMV F;  2EVB A;  5BR8 L;  1G51 A;  1O78 A;  3K5I A;  2C22 A;  4WJ3 M;  5DG7 A;  1F77 A;  1F9P A; 
#chains in the Genus database with same CATH homology
 5BR8 Q;  2HIX A;  3J7Z C;  3K8A A;  3S15 H;  1VCI A;  2IX1 A;  1VQ9 A;  1HH2 P;  3F2C A;  1V9P A;  3GTL H;  4JC0 A;  1ASZ A;  3CME A;  1IBK Q;  3BZK A;  2GVB A;  1IYJ B;  5C44 G;  4DV4 L;  3I4N H;  3PF5 A;  4GLV B;  1OXV A;  1TWC H;  3UDF A;  3KFU A;  5C0X I;  1VQJ A;  1ASY A;  1TWA H;  4JOI A;  3L0O A;  4K0K L;  2WB1 E;  2UUC Q;  1K8G A;  3RN5 A;  3PUV A;  4BBR H;  1X3F A;  2K5V A;  1E1O A;  4DR3 L;  4HIO A;  1VQH A;  3E0E A;  3OTO Q;  1PH3 A;  3G4S A;  2MFI A;  4LFA L;  3PO3 G;  1X3G A;  1KL9 A;  1K83 H;  5JEA G;  1KQS A;  1NE3 A;  1PH1 A;  1VQL A;  1AE2 A;  2NN6 G;  3UDG A;  1X54 A;  4GNX B;  1OXS C;  4A3B G;  3KDF B;  1MJC A;  4HID A;  4B3T Q;  5AJ3 L;  4NXM Q;  1QVG A;  4GKJ Q;  2JA6 H;  2R93 G;  4DPG A;  4BY7 H;  1QUQ A;  4DV3 L;  1Z47 A;  5GAD C;  3G71 A;  2XTI A;  4YY3 L;  3FHW A;  4JI1 L;  1PH4 A;  1J5E Q;  4JI8 Q;  3I4M G;  3RLF A;  1VQ5 A;  1G29 1;  4IJH A;  2LXK A;  1WOC A;  2E5L L;  2OTJ A;  1FJG Q;  3PGZ A;  2KBN A;  4R4I A;  1OTC A;  1Q8K A;  4LFC L;  1VQI A;  1E24 A;  4RMF A;  3W1G A;  4MTN A;  2VQE L;  1M1K C;  4BY1 H;  5ELO A;  4AYB G;  4X65 L;  2E2I H;  2ATW A;  4A3M G;  4KI0 A;  3ZJY C;  2V1C C;  2OTL A;  1J6Q A;  2RCN A;  2VQF L;  1VQ6 A;  3WWV A;  2YTX A;  1PH8 A;  2AHO B;  3DM3 A;  1GM5 A;  4DR4 Q;  1D7Q A;  3S1M H;  3M4P A;  1QZG A;  3RLN A;  5HY6 A;  3E9I A;  3AEV A;  1EQR A;  4EX5 A;  4L5Q A;  1LUZ A;  2AWO A;  3STB C;  4AQY Q;  4A93 H;  1Y1W H;  2ES2 A;  1VS0 A;  1XNR Q;  2I0Q A;  4A3I H;  2WFW A;  4X62 Q;  4A3E H;  4JBM A;  2B29 A;  2DUD A;  5IWA L;  4DR6 Q;  2F4V Q;  4IFD G;  4JI2 Q;  5M3M G;  3HOZ G;  2KHI A;  2ZTE A;  5IT9 c;  3HOX G;  2UU9 Q;  4PZ6 A;  4HJA A;  1XNR L;  4LF6 Q;  1VQO A;  1S72 A;  1Y1V H;  2OQ0 A;  3F8T A;  4R4C A;  2JEB I;  2E2H H;  4NB3 A;  4OWW B;  1CKN B;  3U50 C;  4FDB A;  4BA2 I;  1XPR A;  2OWO A;  1HZC A;  5E7N A;  4DKA C;  1OXX K;  3AQQ A;  3I2Z A;  3KDF A;  4PZ8 A;  3RNU A;  3PF4 A;  3GTJ H;  1GD7 A;  5M3M H;  3HOZ H;  4DR4 L;  2YTY A;  3S1N H;  1OXT A;  1Z9F A;  1PFS A;  1JJ2 A;  1C9O A;  2VQF Q;  1KD1 C;  4DAY B;  1XNQ Q;  1X65 A;  3CMA A;  4A3L G;  2JK8 A;  2RF4 A;  4DNI A;  2JA7 H;  4LF7 L;  4Y7N H;  4A3G G;  4PZ7 A;  1SMX A;  2R92 H;  2R7F A;  1NMG A;  4X65 Q;  1HR0 W;  3OW2 A;  1VQ4 A;  1VQF A;  3CCV A;  4QGU A;  4A3E G;  4A3I G;  3CCM A;  1B70 B;  1EYG A;  1KC8 C;  1SE8 A;  1X55 A;  1EIY B;  3HOU G;  4JBW A;  1FGU A;  1WCM H;  4OX9 Q;  4JV5 Q;  2KCT A;  2BA0 A;  4BBS H;  1FVI A;  4DV7 Q;  2K50 A;  1SRO A;  1JJC B;  3PUZ A;  2CFM A;  4JI1 Q;  4AIM A;  5LMN W;  1M90 C;  4LF5 Q;  4A3F G;  4IPG A;  1H95 A;  1FL0 A;  4DV3 Q;  3S1R H;  2ZTC A;  4ME3 A;  4GNX C;  2KEN A;  1X6O A;  4NPS A;  2HHH L;  1HR0 Q;  2B63 G;  1CUK A;  2EXD A;  3H15 A;  5AJ3 Q;  1BKB A;  1E7Z A;  3CD6 A;  4DK6 C;  3S17 H;  4LF5 L;  5JJI A;  1Q7Y C;  4A3K G;  3GD7 A;  3GTM H;  2UXC Q;  4OXP A;  2N49 A;  1N34 Q;  3HOW G;  4JV5 L;  1IZ6 A;  4B3M L;  1A8V A;  1X56 A;  2JA8 H;  4RG1 A;  3TS2 A;  3CPW A;  1JB7 A;  4APV A;  2RHQ B;  2ID0 A;  1K0R A;  4MNO A;  4YWM A;  3PUX A;  3J81 c;  1PHJ A;  2FXQ A;  2MO0 A;  1VQN A;  4JYA Q;  2AMC B;  4C3I H;  2CQO A;  3CCQ A;  2Z6K A;  1PH5 A;  1XNQ L;  3RZO H;  1HJP A;  3B6Y A;  4LW1 A;  1Y1W G;  4IFD J;  4R4O A;  3LGJ A;  5C0X J;  2ZM6 Q;  2UUA L;  4HJ8 A;  2A8V A;  4IOA A;  3GTQ H;  1YEZ A;  4C2M H;  5LMN Q;  2WAQ E;  3AFP A;  4UP7 A;  3I55 A;  2I5L X;  3D0F A;  3H0G G;  3TQY A;  5C3E G;  3HKS A;  3I56 A;  4OO1 G;  5C4X G;  1X3E A;  4IPC A;  3S2D H;  1CSQ A;  1EWI A;  2QEX A;  4DR7 Q;  4X66 Q;  1N33 L;  3GTG H;  4O0A A;  1XMO Q;  1UE5 A;  4A93 G;  1EFW A;  4UP9 A;  1QVF A;  4JI4 L;  4B3S Q;  1I50 H;  2F4V L;  3H3V H;  1U5K A;  2VUM G;  1UE7 A;  4LFB L;  4DR6 L;  1YIJ A;  2RHS B;  4OON A;  1YNX A;  2DGY A;  4BXX H;  2VL6 A;  3J81 j;  4DV6 Q;  4DR1 Q;  1AE3 A;  4LF4 Q;  1UE1 A;  2UXB L;  1KAW A;  1E1T A;  2XGT A;  4UP8 A;  1IBM L;  3K7A H;  4ALP A;  3PSI A;  1BBW A;  1S40 A;  5IP7 G;  1Q81 C;  2UXD Q;  3KJO A;  1U0L A;  1I94 L;  4L5S A;  1WYD A;  2BH8 A;  1XTD A;  2K14 A;  4AH6 A;  1SFO H;  2HQL A;  4A3J G;  2LSS A;  1PH6 A;  3G48 A;  3F1Z A;  4UPA A;  1L0W A;  1A63 A;  2NZH A;  4X6A H;  1VQE A;  3A0J A;  3PUY A;  3UE1 A;  5C4X H;  4BY1 G;  2ZJP A;  3CCJ A;  4LUZ A;  4OWT B;  2E8G A;  2VQE Q;  2ASB A;  3FKI H;  4JI6 L;  1VQA A;  1P8L A;  3A74 A;  4LFC Q;  1DGS A;  4LF4 L;  4P72 A;  2JA9 A;  4DR1 L;  2B63 H;  3FP9 A;  1PVO A;  4PMW A;  3M3Y H;  3CCR A;  3M4O H;  2VZA A;  2JA5 H;  4JI0 L;  4YHH L;  4GKK L;  1UEB A;  3BJU A;  3CPF A;  1J5E L;  4BXX G;  4B3S L;  3T1H Q;  1QVC A;  5IE8 A;  4JOI C;  3FKI G;  1EOV A;  1LM0 A;  2PNH A;  2IT1 A;  4DV2 L;  2Q2T A;  3CC4 A;  1I5F A;  1N33 Q;  3HOW H;  2YYZ A;  3STB D;  1YI2 A;  3KF8 B;  2R6G A;  1K3R A;  4GKJ L;  4NXM L;  1L1O C;  1MKH A;  4B3T L;  2PI2 E;  5LMN L;  5J3B A;  1A62 A;  4LWC A;  3M4Q A;  1N36 Q;  5GAH C;  2B3G A;  2ZM6 L;  4TVA B;  2MNA A;  1MIU A;  1HNW L;  4KHP Q;  3TRE A;  4GS3 A;  5M5X H;  3T1Y L;  2EIF A;  5C0X G;  3CCL A;  3W1B A;  1K9M C;  3A5U A;  2N8N A;  2KHJ A;  1YHA A;  5GAG C;  1Q12 A;  5M5Y H;  3K7U C;  3NEM A;  2LXJ A;  4IO9 A;  3RR5 A;  3SGI A;  3GTK H;  5C44 H;  3ERS X;  1TWF H;  4BBS G;  3AYH B;  2QGQ A;  4C3J H;  4EQ5 A;  4L5T A;  4B3M Q;  2AKW B;  4YCW A;  4HJ7 A;  2JE6 I;  2D0O A;  1S3O A;  1N34 L;  4UY8 C;  3ER0 A;  4A3G H;  4LUV A;  3L7Z C;  2C35 B;  4R1J A;  3NEL A;  4BBR G;  1XMQ Q;  1N36 L;  2JEA I;  4P73 A;  1UE6 A;  2NZO A;  3GTO H;  1L2F A;  2I5H A;  3E9H A;  3PCO B;  2BH2 A;  1PH7 A;  3M7N A;  2R7D A;  3PO3 H;  2HHH Q;  2K5N A;  1GVP A;  3HOU H;  4HIM A;  3ULL A;  2K52 A;  3BZC A;  2Q2I A;  2PI2 A;  2UUB L;  4QJF A;  3HFZ B;  3JAM c;  3T1H L;  1VQC A;  4LF9 Q;  2UXD L;  1NTG A;  4DR5 Q;  1NY4 A;  5IP7 H;  1N9W A;  2F3I A;  2F52 A;  2H5X A;  4TQU S;  3F2D A;  3DLL A;  4JI0 Q;  1JE5 A;  2AWN A;  4OX9 L;  4A3C G;  1L1O A;  2Y0S E;  1KIX A;  1JJG A;  2NVY H;  4GKK Q;  1IXR A;  1KXL A;  5HGQ A;  1QZH A;  2OQK A;  1QUQ B;  4OO1 I;  1NBW A;  4A75 A;  4LNQ A;  4WJ4 A;  1XPO A;  4AYB E;  4IOC A;  1VQG A;  2BA1 A;  1HNZ Q;  4LF7 Q;  1O7I A;  1XPU A;  3PO2 G;  2ZJR A;  2YV5 A;  3CCE A;  3S1Q H;  2WAQ G;  1HNX Q;  5LMU Q;  3HOV H;  3H0G H;  5M3F G;  1NMF A;  1PH9 A;  1I94 Q;  2JA5 G;  4DV5 Q;  1I3Q H;  1T9H A;  2GVA A;  3K80 C;  2JA6 G;  3HOY G;  1RL2 A;  1SR3 A;  4BY7 G;  2UXB Q;  1YVC A;  3ICE A;  2R92 G;  2NN6 I;  2IHE A;  4GOP C;  4DUZ Q;  4DV0 L;  4DV6 L;  2YTV A;  4LF6 L;  4JI5 L;  3I7F A;  4LFB Q;  4POF A;  4GN3 B;  1P16 A;  5FLM H;  1PYB A;  3CXC A;  4JI2 L;  4JI4 Q;  1AH9 A;  1PYS B;  3PIP A;  1WCM G;  3CAM A;  1KRT A;  5C3E H;  4DR2 Q;  1IBL Q;  3I4N G;  1BBU A;  1Q1B A;  3BU2 A;  4X66 L;  2D62 A;  4R4Q A;  4AQY L;  4B3R L;  5H1S E;  3PO2 H;  4QL5 A;  2CKZ B;  1TWG H;  3KJP A;  3CCU A;  1CKM A;  4IJL A;  1G6P A;  4A3J H;  2UUA Q;  5IYC H;  3U4V A;  2N78 A;  2K75 A;  4LF8 Q;  1Y1V G;  2MO1 A;  3HKZ G;  3ULJ A;  1L1O B;  3HOY H;  3HKZ E;  1HZ9 A;  2JQO A;  4DUY L;  1YJN A;  2NVX H;  1PV4 A;  1W3S A;  3TRZ A;  1N32 L;  4DR7 L;  1CSP A;  1SLJ A;  3K81 C;  4JYA L;  3K0X A;  3S24 A;  1N8R C;  4X64 Q;  1K73 C;  4A3B H;  4DK3 C;  4LF8 L;  5IYC G;  4OWX B;  4QY7 A;  2Q2U A;  4J15 A;  5FLM G;  2E5L Q;  3J80 i;  2R93 H;  2PQA A;  3S14 H;  1PH2 A;  3AFQ A;  3MXN B;  1KRS A;  4JI8 L;  3CCS A;  4YWK A;  3L2P A;  4GNX A;  4B3R Q;  2UXC L;  5EAY A;  4H02 A;  1OXU A;  2PQA B;  4GLX A;  4YY3 Q;  1VQM A;  3PUW A;  4P71 A;  3F2B A;  2HIV A;  1IBL L;  5GRO A;  4DR2 L;  4P75 A;  4QIW E;  4GOP B;  2VW9 A;  1HR0 L;  3I4O A;  4Y52 H;  4JI5 Q;  4O2D A;  5IP9 H;  3S2H H;  1Q86 C;  3KF6 A;  4DUZ L;  5IYD H;  3S16 H;  3NEN A;  4DV7 L;  2K4K A;  3TEH B;  3A5Z B;  4A3M H;  4C3H H;  3G6E A;  1Q82 C;  1VQK A;  4LUO A;  1HZA A;  3RLO A;  2WP8 J;  2VUM H;  4LFA Q;  1HZB A;  3M85 A;  5M3F H;  4HJ5 A;  3EBE A;  5LMU L;  4QQB X;  3CW2 C;  4DR3 Q;  4PG3 A;  4A76 A;  2A1A A;  2D0P A;  1EQQ A;  1VQD A;  2Z0S A;  1W2B A;  4R4T A;  3IRB A;  4P74 A;  1C7Y A;  1UWV A;  1V1Q A;  1YZ6 A;  3GDE A;  4DV4 Q;  1X9N A;  1NJI C;  1JT8 A;  3GO5 A;  3KYH C;  1WFQ A;  2PMZ E;  4BA1 I;  3W5O A;  4XTC S;  3Q8D A;  1WJJ A;  1VQ8 A;  1GO3 E;  1GKH A;  3H3V I;  2EQS A;  4A3K H;  1RIP A;  2CWP A;  4YCU A;  3ULP A;  3I4M H;  4POG A;  4A3D H;  5IYB H;  1JMC A;  4A3C H;  4GLA C;  1E22 A;  4DV1 Q;  1YIT A;  2UU9 L;  2QA4 A;  1V43 A;  5IWA Q;  2JA8 G;  4X62 L;  2VS1 A;  1A0I A;  2R7Z G;  1XMQ L;  1MJE A;  4A3D G;  2JA7 G;  1VQ7 A;  2NVT H;  1YHQ A;  1YJW A;  4IPD A;  2NVQ H;  4JBK A;  1VQB A;  1E3P A;  4DAM A;  3CF5 A;  3CC7 A;  1YHB A;  5DLQ E;  4JCV E;  1Q46 A;  4IPH A;  5FJ8 H;  5M5W H;  2Y0S G;  4X64 L;  5C4J H;  2N3S A;  4JI3 Q;  4L5R C;  4YWL A;  2OCE A;  4DUY Q;  3T1Y Q;  1N32 Q;  4KHP L;  1HNW Q;  5IYB G;  1SN8 A;  3JC6 6;  4JI7 L;  2VNU D;  1FJG L;  4NXN Q;  5JJL A;  2A19 A;  2Q2H A;  5IP9 G;  3EN2 A;  3M9B A;  2WB1 G;  5IYD G;  1KHI A;  3NBH B;  4GOP A;  5JJK A;  2GN5 A;  3U58 A;  4DV2 Q;  5JEA J;  3D31 A;  1VQP A;  1BVS A;  3U4Z A;  3OYY A;  1TXY A;  2K5H A;  5IY0 A;  3RN2 A;  4YHH Q;  1PA6 A;  1XJV A;  2I5M X;  4GN5 A;  3JAM i;  1LYL A;  4GN4 B;  1R9T H;  4XIG S;  5FJ8 G;  4HIK A;  1CKO A;  4DV0 Q;  2IY5 B;  4NXN L;  4HJ9 A;  2JJQ A;  4A3L H;  4JI7 Q;  3J81 i;  4JI6 Q;  5GQO A;  3KF6 B;  3KOJ A;  4JG2 A;  2IHF A;  4JBJ A;  1YJ9 A;  4KHZ A;  1I6H H;  3KLW A;  2YU9 H;  4YCV A;  4DV5 L;  4JI3 L;  3OTO L;  1HNX L;  3RZD H;  1YBY A;  4IFD I;  2KCM A;  1B7Y B;  3J80 c;  3UDI A;  5ELN A;  3TS0 A;  2UUC L;  1EIF A;  2IX0 A;  3PIO A;  1HNZ L;  2ZJQ A;  4K0K Q;  2ALY B;  2HT1 A;  1IBM Q;  3UDX A;  1K8A C;  1WI5 A;  1Q1E A;  4A3F H;  3MEF A;  3VDY A;  3CQZ H;  2L15 A;  1C0A A;  3PV0 A;  1IBK L;  2ZTD A;  2CWA A;  1Y14 B;  2E2J H;  5GAE C;  3UE0 A;  1D8L A;  1EUJ A;  2MQH A;  5FLX c;  4MZ9 A;  3HOX H;  3HOV G;  4WJ3 M;  1TWH H;  2VY3 A;  4KLK A;  3J7A 5;  5K36 G;  4A4I A;  3GTP H;  4DR5 L;  3EIV A;  4LF9 L;  5BR8 L;  4DV1 L;  1CKN A;  1G51 A;  2R7Z H;  1XMO L;  2CCZ A;  2UUB Q;  3CC2 A;  1SRU A;  1B8A A;  2Z6K C;  1LTL A;  3CP0 A;  1IL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...