1Y1WG

Complete rna polymerase ii elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*GP*TP*AP*CP*TP*TP*AP*CP*GP*CP*CP*TP*GP*GP*TP*CP*AP
publication title Complete RNA Polymerase II Elongation Complex Structure and Its Interactions with NTP and TFIIS
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y1wG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y1wG01
3BU2A 2QEXA 1Q81C 4LF4L 3S17H 4TQUS 4IPCA 3RN2A 1PYBA 4LUZA 1G51A 1TWGH 4IOAA 5JEAG 1L2FA 4EX5A 1VQLA 3NEMA 3I56A 1UE7A 1I50H 3J80i 2WFWA 1RL2A 2IT1A 1C0AA 4L5TA 4TVAB 1NY4A 3T1YL 2BA1A 4A3EH 3SGIA 1N8RC 1PH8A 1XNQL 1XNQQ 4BBRG 2YYZA 1MJCA 3E9IA 4POFA 5IYBH 2UUCL 2UUCQ 3K8AA 3G6EA 5AJ3L 2D62A 1EQRA 4IPHA 3A5ZB 3UDIA 5C44H 5M3FG 4HJAA 2E2IH 1V9PA 1GVPA 3S1QH 3DLLA 3W1GA 1HH2P 2UXBQ 1DGSA 1WYDA 4X64L 3UE1A 1PH7A 1YBYA 3STBD 4A3DG 3G4SA 3S1RH 3GD7A 4DK3C 2L15A 4HIOA 1M1KC 5M3MH 1HNXQ 4BY7G 1GM5A 2YTYA 1X55A 5ELNA 2I5LX 1T9HA 4YWLA 3GTGH 4R4CA 1UE6A 3PUWA 3J7ZC 2E5LL 3M4OH 1JB7A 4DV3L 4HJ9A 3ICEA 1BBWA 3E9HA 3W1BA 5BR8Q 1VQ7A 1K8AC 4JOIC 1VQGA 3OTOL 4A76A 1XNRQ 4DKAC 1KL9A 2HIVA 2R92G 1J5EL 2IX1A 3A5UA 3KF6B 2QA4A 2UUBL 1SROA 1S40A 4WJ4A 1IBLL 3TRZA 4GN3B 1HNWL 2R93G 4DV2Q 1IBKQ 3GTPH 4A3MH 4GLVB 4YWKA 1VQMA 4LFAQ 3CMEA 2HHHL 1HR0Q 2JA5H 4POGA 5HGQA 3RR5A 2MFIA 4DR6L 4X66Q 2LXJA 1E22A 2WAQG 4DV4L 4B3SL 1ASZA 4DUZQ 1X65A 4C3JH 1Q82C 4L5QA 4YY3L 5FJ8H 2RHQB 4NPSA 4LFCL 4JYAQ 3U4VA 2F52A 4PZ7A 2MO1A 4GOPC 1QZHA 1XJVA 2UUAL 3S1NH 4X6AH 1PH5A 4JBMA 1A63A 1FVIA 2Z0SA 1YEZA 4DV1L 1IBML 3GTQH 1IBMQ 4IFDJ 3J81i 1UEBA 3CC2A 3CCVA 1D7QA 1X3FA 2WB1E 1J6QA 4NXML 3RNUA 3ER0A 3JAMc 1NMFA 4BBRH 1Q1BA 2N49A 1QUQA 2CQOA 1VQBA 4RG1A 3PUYA 4YCVA 1FL0A 2YTXA 3LGJA 4NXNQ 1FGUA 3PO2G 3GO5A 1R9TH 4A93H 1YJNA 5M5XH 4LFBL 5M3FH 4JI6L 5GADC 4JC0A 1MJEA 1EOVA 2JE6I 5M5WH 1UE5A 3HOXG 4QQBX 2Y0SE 4X65L 4DR7L 4X65Q 4GOPB 3CW2C 1Y1WH 3BZCA 1SR3A 1HJPA 5IE8A 2OTLA 1YNXA 4A3DH 4A3JH 4GN5A 3FKIG 5GAGC 4JBKA 3TEHB 1YJ9A 1XMQL 4JI8Q 4AYBG 4IPGA 5J3BA 1B8AA 1BVSA 1Q1EA 4DR5Q 1U0LA 1VQKA 3VDYA 1XPUA 4DR1Q 3TS2A 2C35B 3CCEA 4LF8L 4KHPL 1XMOL 2MQHA 2D0PA 4L5SA 2UU9L 3CPFA 4BA2I 1A0IA 1NJIC 3F1ZA 3GDEA 1FJGL 2R7ZH 2R92H 2E8GA 1W3SA 3KDFB 2EXDA 4LW1A 2VNUD 4OONA 1CUKA 4LF6L 4DV0Q 1RIPA 5IP7H 4GKKQ 1VQDA 4GNXC 1K3RA 2R7FA 3M9BA 3D31A 4K0KQ 1VS0A 5K36G 4JV5L 3PV0A 2K14A 1VQIA 1OXXK 2NZOA 4JCVE 3ERSX 2Q2TA 4DV5Q 4LF7L 1Y1VG 3G71A 1PH3A 4A3FG 1JMCA 2NVXH 5IP9G 1VCIA 2OQ0A 1V1QA 4DK6C 4DV7L 1CKMA 4DV7Q 2A1AA 4UP9A 3J7A5 4A3CG 3F2CA 3KOJA 4DUYQ 4B3TL 4B3RL 1HNZL 4A3LG 1HZCA 2DGYA 3HOWG 3KF8B 1I6HH 2KCMA 5IY0A 4DR2L 1KIXA 1N32L 1K9MC 3S2DH 1TWFH 2DUDA 4GNXB 5FLMG 2RCNA 3I55A 3KJPA 2PI2E 4DR4L 1KQSA 4LF4Q 1WCMG 3DM3A 1PH1A 4A3GG 4IFDI 4AQYL 1PVOA 1JT8A 3ZJYC 1D8LA 4A75A 3PO2H 2K75A 3JAMi 2JEAI 3PCOB 3KJOA 3HOXH 4NB3A 1X3EA 3T1YQ 1CKNB 4DPGA 4HIDA 4JI7L 1H95A 1Q12A 2UXCL 4IFDG 1AE2A 1GD7A 1EIFA 3CQZH 2HT1A 2NVYH 3FHWA 3I4MH 3FKIH 4JBJA 4JI3L 5AJ3Q 4LF6Q 3HKZE 1SN8A 1I3QH 1GKHA 3ULPA 1I5FA 1E1OA 4X64Q 4JI4L 2K4KA 3UDFA 3AEVA 1N36L 1KC8C 1YVCA 1SLJA 1B70B 1YHAA 1PH6A 3CCLA 5EAYA 4MZ9A 2F3IA 3M4QA 2QGQA 2OCEA 2E5LQ 4JI5L 2ZJRA 4DV3Q 5GAHC 3WWVA 1P16A 3AYHB 2N3SA 2VS1A 2JJQA 2VUMG 4C3HH 3OTOQ 1G291 4A3BH 3RZOH 3H3VI 2NZHA 1I94L 1J5EQ 2PI2A 2UUBQ 3U50C 3HFZB 1IBLQ 2WB1G 4HIMA 2KBNA 2ZTCA 4A3IG 2JA8H 1HNWQ 1Y1VH 2MO0A 4HJ7A 2PQAA 4A3FH 1IL2A 3S1MH 5IP9H 2YV5A 3CAMA 1EYGA 1LM0A 1JE5A 1O7IA 2YTVA 2CCZA 3MXNB 2HHHQ 3CPWA 2D0OA 4J15A 2JA6G 4YWMA 4DR6Q 1CSPA 4LWCA 1LTLA 4DV4Q 4B3SQ 4A3LH 4R4TA 5IWAL 3HOWH 5C4XG 3ULJA 4B3ML 4A3KG 4ME3A 1KD1C 4YY3Q 3T1HL 1PV4A 4YHHL 2I0QA 4LFCQ 3I2ZA 5GQOA 5FLMH 5HY6A 2UUAQ 3GTJH 1WCMH 3CC7A 4ALPA 2ASBA 1YIJA 4A3GH 4PMWA 3HOYG 1BBUA 2N8NA 1OXTA 4DV1Q 1Y14B 1C9OA 4FDBA 3PUZA 2Z6KA 3A0JA 4R4IA 3U58A 3E0EA 1NBWA 4P73A 3UE0A 4NXMQ 4IO9A 4BXXG 5GROA 4BA1I 2B3GA 4DR3L 3U4ZA 3D0FA 1WJJA 4GN4B 1MIUA 5DLQE 2VQEL 1M90C 4LFBQ 2R7DA 4JI6Q 2NVQH 4QIWE 1VQEA 1K8GA 1VQNA 2N78A 4OO1I 2AKWB 1PA6A 4DR7Q 3L0OA 2BH8A 4QY7A 1EIYB 4JI2L 3PIPA 3S2HH 2MNAA 4GKJL 2WP8J 4MNOA 1IYJB 1N33L 4BY7H 3Q8DA 1QZGA 1WFQA 2LXKA 5H1SE 3J80c 2ZM6L 5LMUL 2CKZB 1P8LA 1XMQQ 4AH6A 1UE1A 3AFQA 4OWTB 3RLOA 4QGUA 4OO1G 1KXLA 3MEFA 2K5VA 1TWHH 1X9NA 1IZ6A 4LF8Q 3AQQA 4DAYB 2VUMH 4KHPQ 1XMOQ 2AMCB 1QUQB 2AWNA 1N34L 2K5HA 2XGTA 2UU9Q 2CFMA 1FJGQ 4A3EG 2KCTA 3L7ZC 3PGZA 3RLNA 4DV6L 4HIKA 3RN5A 1VQFA 4YCUA 1A62A 4OWXB 2ALYB 2R93H 4A3IH 4LF5L 1SRUA 1TXYA 3H0GG 4C2MH 5IT9c 2IX0A 2FXQA 1KAWA 2R6GA 4QJFA 3HKSA 2A8VA 2F4VL 4PG3A 5IYDG 3I4NG 3F2DA 1YITA 1BKBA 4LF9L 4JV5Q 3CXCA 5C4XH 3AFPA 3BJUA 1Q7YC 1Q8KA 3CF5A 2K52A 4A3KH 1SFOH 2ZJQA 3PUVA 4LF7Q 4OX9L 1YZ6A 3GTMH 3NELA 1X3GA 1L1OC 3F8TA 1WI5A 3CCUA 1JJ2A 3M4PA 1VQCA 3HOYH 4UPAA 3NENA 4B3TQ 1PH2A 1V43A 1HNZQ 4L5RC 4B3RQ 4Y52H 1G6PA 3GTLH 2JA9A 3M3YH 1S3OA 4DR2Q 1CSQA 1N32Q 4HJ5A 4JBWA 4DR4Q 4LUOA 1HZ9A 5M5YH 4AQYQ 2ZTDA 3S16H 2LSSA 4X62L 5LMNL 1KRTA 2KHIA 1CKNA 2GVBA 4JG2A 3CCRA 1AE3A 1S72A 2ES2A 4WJ3M 2K5NA 4GLAC 3OW2A 3G48A 4IJLA 2RHSB 3IRBA 4XTCS 4JI7Q 4JI0L 2GVAA 2VY3A 3EBEA 4BBSG 1L1OB 5E7NA 2Q2IA 4IJHA 2UXCQ 1PH4A 1OXSC 2BA0A 3M85A 4MTNA 4BY1G 3J81c 4JI3Q 1VQJA 1CKOA 2K50A 2RF4A 3KFUA 4RMFA 2GN5A 4H02A 2OWOA 3CMAA 1AH9A 4APVA 5C0XI 2EQSA 2PNHA 4JI4Q 3STBC 5GAEC 1N36Q 1SE8A 3GTOH 1VQOA 3CCQA 3PO3G 1KRSA 3KLWA 3CCSA 1LYLA 4EQ5A 3J81j 5JJLA 4DAMA 4UP7A 3I4OA 2B63G 1JJGA 3K0XA 3CCJA 4JI5Q 3TQYA 3H0GH 5IYCG 2ATWA 1A8VA 1YHBA 1PFSA 3KF6A 5C0XG 4A93G 2A19A 5IYDH 2JEBI 2V1CC 3I4NH 4O0AA 1I94Q 3EIVA 2UXBL 3K81C 3HOVG 3PF4A 1Y1WG 3S14H 1YI2A 4A3JG 1HNXL 1UWVA 1K83H 2IHEA 1KHIA 3NBHB 4KI0A 3CCMA 1W2BA 4LUVA 2Q2UA 4O2DA 4A3CH 1HZBA 3PSIA 2OTJA 3K80C 4JOIA 4PZ8A 5BR8L 2ID0A 3RLFA 5IWAQ 2E2HH 4Y7NH 2AWOA 4LNQA 2AHOB 4B3MQ 2Y0SG 1XNRL 2JA7G 1E7ZA 1Z47A 1ASYA 2JQOA 3T1HQ 1VQ6A 1K0RA 4XIGS 4YHHQ 2R7ZG 3OYYA 4AIMA 3CP0A 1EWIA 2KHJA 4UP8A 2NN6I 1C7YA 4DV2L 3L2PA 1IBKL 3CD6A 3PUXA 1NTGA 5IP7G 3HOZG 2IHFA 1VQ9A 4LFAL 1HR0L 5JJKA 2H5XA 2Z6KC 5LMNW 4X66L 3A74A 2VQFL 2PQAB 1X56A 4R1JA 2VQFQ 5JEAJ 4DR3Q 4BBSH 4DUZL 4GS3A 2NN6G 5FLXc 2VQEQ 3H15A 4R4QA 4BY1H 4GOPA 4OWWB 1VQAA 2B29A 1VQ8A 4JYAL 3ULLA 3CC4A 2KENA 3HOUG 3PF5A 5C3EG 5C0XJ 4JI2Q 4P75A 3TS0A 1N33Q 4GKJQ 3PO3H 4JI1L 3BZKA 5ELOA 2Q2HA 4JI1Q 2ZM6Q 5LMUQ 2B63H 3M7NA 2PMZE 3B6YA 2NVTH 4NXNL 5JJIA 1EUJA 4PZ6A 5IYCH 1OTCA 1IXRA 3EN2A 3KDFA 2WAQE 3W5OA 4P72A 1N34Q 1GO3E 2ZTEA 1HZAA 4DV6Q 1U5KA 1XPRA 3HOVH 1OXUA 2YU9H 2HQLA 2VW9A 3K7AH 5IYBG 1TWAH 1XPOA 4LF5Q 3PIOA 4P71A 3I4MG 1TWCH 1X6OA 4DNIA 5C44G 1VQ5A 2F4VQ 1SMXA 2IY5B 1LUZA 4JI8L 4C3IH 2CWAA 1OXVA 4OXPA 4DR5L 1K73C 1XTDA 4LF9Q 2JA6H 3H3VH 1N9WA 5C4JH 4DR1L 1E24A 1QVGA 4IOCA 1B7YB 2I5HA 3TREA 4OX9Q 5M3MG 2JA7H 1YJWA 2BH2A 1PYSB 3FP9A 1EFWA 1X54A 2OQKA 1Q46A 3JC66 3K7UC 3S24A 3RZDH 4QL5A 3I7FA 1QVFA 2ZJPA 1QVCA 3S15H 4KLKA 4A4IA 2E2JH 2XTIA 3HKZG 4GNXA 2VZAA 1MKHA 2JK8A 2CWPA 2EIFA 4P74A 4DV0L 4GKKL 2UXDL 3HOZH 2UXDQ 3UDXA 3F2BA 4A3BG 4BXXH 4K0KL 3UDGA 1NMGA 3GTKH 1Z9FA 1PH9A 1HR0W 1WOCA 4AYBE 4KHZA 4R4OA 4DV5L 1VQPA 4X62Q 1PHJA 5LMNQ 2JA8G 2HIXA 4GLXA 4A3MG 1JJCB 1L0WA 2I5MX 4UY8C 1YHQA 1L1OA 2JA5G 1E1TA 3HOUH 4YCWA 3KYHC 4DUYL 4IPDA 1Q86C 1NE3A 4JI0Q 1VQHA 5C3EH 4HJ8A 1VQ4A 1EQQA 1E3PA 2VL6A 5FJ8G
chains in the Genus database with same CATH superfamily
1KNAA 2R7ZB 2R92B 3V2TA 3K5OA 4IOAA 1CQFA 1PYBA 4LUZA 1HA5A 1TU2B 2J9GA 4MN3A 5KNBA 1VQLA 5I9OA 1UE7A 1I50H 1STNA 3MXGA 4TVAB 2BA1A 3K6OA 2A74C 3JAME 1XNQL 1RYSA 3SEBA 4BBRG 2OF1A 3VA7A 4UCUA 3V96A 5JH7F 2AGOA 2CH4W 5AJ3L 4ZOLF 4V0BA 5M3FG 4HJAA 3K59A 1CE8A 1GSOA 3GIMA 5KFKA 4U673 1Q8IA 1GVPA 1WTPA 2IA6A 3DLLA 1T36A 2UXBQ 4YBZB 1DGSA 4XYOA 2BR0A 1PH7A 3MXNA 3STBD 3GIQA 2BOSA 3GD7A 4DK3C 2UXBH 5M3MH 1OO9B 1HNXQ 4BY7G 4IRCA 2MJ8A 4LSAA 4X64H 4A2AA 1HNXH 1UE6A 3PUWA 1JE4A 1BBWA 3E9HA 2X6LA 4JOIC 2E5LH 1VQGA 3OTOL 2F0QA 2HIVA 2IX1A 4HSVA 3KUPA 3KF6B 4H7BA 2R7LA 3HGBA 2R3ZA 1J5EH 3GILA 1JQYD 3QR8A 2ZDHA 3I4MB 2HCCA 2K04A 4DXFA 4MV8A 2BDNA 4RKLA 1HR0Q 2XIGA 1S5ED 5HGQA 3RR5A 1LT6D 4X66Q 1E22A 4DV4L 2G5DA 1ASZA 2V4DA 1F2ZA 1VDZA 5M3MB 2H1EA 1BCPF 4YY3L 1PTOH 4JYAQ 4GOPC 2E2HA 1E2WA 1H9MA 1XJVA 1GHKA 1S68A 1B53A 2K6AA 1FVIA 4RHSA 1IBML 2R8KA 4LFCH 3D4WA 2UUAH 3OMGA 1CTMA 4ZHQF 2AGPA 4YR2A 5FD5A 1PTOC 1X3FA 4G3IA 2QW7A 5JVH3 1ULZA 3DHQA 1NMFA 1Q1BA 2N49A 4FXKC 3PUYA 4NXNQ 2JA8B 3ETJA 1SNDA 4A3FB 4JI6L 1LACA 3JSNA 1H9KA 4NXNH 1L2ZA 1LO5D 2AQ4A 1B3QA 2JE6I 4DF7A 3HOXG 4XX0B 2D2CC 2Y0SE 1BJTA 1JKJB 4DR7L 4GOPB 3CW2C 4YAJB 1YNJD 4A3DH 1DZ1A 4RNNA 3FKIG 1KLGD 3R2IA 5HBRB 3V6JA 1SNCA 4EYHB 1H9SA 2FB9A 1FR3A 3GTJB 1WCMB 1W6JA 1C3OA 1U0LA 1AFPA 4LF8L 2RCFA 1EWCA 3F1ZA 4PQXA 1IOVA 3EYYA 3FMCA 2E8GA 3KAKA 2EXDA 5KNCA 2VNUD 3VYTA 1FJGH 2F0GA 1JR0D 1LV9A 4DK0A 5IP7H 1Y1WA 1BXTA 4LMYA 5M9OA 5KT4A 4O2AF 3KHHA 1VS0A 4KJOA 4JCVE 1TWCA 4YJ3F 2IJ0A 4C1NK 3ERSX 2Q2TA 1QG7A 3ND8A 2NN6H 3S2HB 2VOBA 1Y1VG 2UVVA 4RU9A 3M9NB 1DJRD 5KYIA 2KOLA 3OUUA 4H13C 2F0TA 1RCVD 5IT9W 2OQ0A 4J6HA 4DK6C 3VYRA 4JV2A 2XRQD 4UP9A 2Y0SA 4DUYQ 4B3RL 2K5WA 2F1MA 4OHJA 4DUYH 2EE1A 5IY0A 4F87A 1N32L 3GV6A 2PI2E 4K8JA 4LF4Q 1PH1A 4A3GG 4IFDI 1JT8A 1M8AA 4A3IB 4LF4H 2CZGA 4MV6A 4A75A 3PO2H 1HHVA 5FPRA 2F0UA 2FPGB 2W6OA 3JAMi 2E74C 3KJOA 3T1YQ 4JK1C 2G9DA 4DGZA 4DPGA 4JI7L 3PN1A 2FINB 1Q12A 3FRPB 3T1YH 5C4XB 3CQZH 1SE3A 3PMFA 4WD3A 5DGAA 4A3KB 2CQYA 1NSNS 4JBJA 4LF6Q 2AGQA 3HKZE 2VR1A 2SEBD 4MA0A 1GKHA 1ZKOA 4BWGB 4HTHA 2ENBA 5HV6A 1SYBA 4LF6H 4JI3H 2YRXA 3O13A 1WSCA 4Z9CB 2K4KA 5EPLA 1SNMA 1WR2A 2I8CA 1SLJA 1B70B 1K8OA 2BDOA 3TP5A 3HB9A 3LWBA 2K01A 3FDSA 5IYZF 4ECQA 1SJHD 3IN5A 5J1ZA 4WFN3 1S0MA 5IOCA 4A2BA 4I7AA 2O4XA 3ETHA 1P16A 2GLTA 4CKCA 2VUMG 4JI5H 1ZHQA 1DONA 2XD4A 3WOEA 4HNUA 2PI2A 4YJ2F 5BMVF 4EQOA 2E2IA 5FO7B 4O4HF 1IBLQ 3H4DA 4HIMA 1NAPA 5ELDA 4YIJA 1HNWQ 4IHJF 4TQSA 1I94H 1I3QA 3BJYA 5IP9H 2YV5A 1EYGA 4MV3A 1IBLH 2YTVA 1JE5A 1O7IA 1BF4A 4JVZA 3CPWA 2W6PA 5CB4F 4DR6Q 2Q8IB 3TP8A 3QOJA 4B3SQ 4A3LH 3FEWX 4DR6H 4EFBA 1JOKA 4KHVA 4B3ML 2K7VA 4ME3A 3H4BA 4YHHL 4APMA 3HKZA 3I2ZA 4KTAA 5FLMH 5HY6A 5EWFA 1MBYA 2J4XA 5KG3A 5JEAH 3HOYG 1OXTA 5C1PA 4DV1Q 1C9OA 1STGA 1KNEA 2YZNA 4BXXG 2BQUA 2L4NA 2B3GA 5G3LD 1E4FT 3WNZA 3U4ZA 1T5EA 5KGUA 4X3UA 1WJJA 2VQEL 3KTMA 4QUCA 1K83B 1KAAA 4QIWE 1SYDA 3HXLA 3RFCA 2AKWB 2F0FA 3QWNA 1G91A 1PA6A 3MR3A 1F2MA 1A2TA 2MHVA 3MR5A 4XDXA 1VMPA 4Y7NB 2OLSA 4MNOA 1QILA 3QOLA 4UDUC 3R93A 1WFQA 4G7OC 3SR1A 4PMCA 2ZM6L 1STBA 5LMUL 5GONF 3VR2A 1KXLA 3P1HA 4OWTB 4RGOS 3H20A 3V4ZA 2K5VA 1X9NA 1IZ6A 1JIHA 1IW7C 4DAYB 3TINA 1XMOQ 1TT2A 5KNDA 1N34L 1RTNA 1U4PA 2XGTA 2UU9Q 2F4IA 1R9TA 1SYCA 1VQFA 2UU9H 4RGNA 4F4WA 4XT1B 2Z6BA 2R93H 1TXYA 3H0GG 4C2MH 2VA2A 2IX0A 5KFXA 1KAWA 3HKSA 4V190 1PMRA 2KECA 4LF5H 2UVUA 2DZDA 1BKBA 4LF9L 4JV5Q 2H4OA 3T16A 3BJUA 4R8NA 5KFFA 2K52A 1SFOH 1GHJA 3PUVA 2OH2A 1BBXC 2SCUB 4QIWA 1E2VA 1X3GA 5LXTF 3N42B 3F8TA 1WI5A 4ED8A 3CCUA 2B63B 1JJ2A 3M4PA 2NVTB 2R92A 3J7AK 1B6RA 1BXRA 1KC7A 2JA9A 2VQDA 3M3YH 4YR0A 4JBWA 4U68A 1I4PA 4DR4Q 3HOVB 4LUOA 1HZ9A 2JEIA 4GZYC 4AQYQ 3NP8A 2ZTDA 3TBIB 5JOBA 4X62L 5LMNL 4JG2A 2WAQA 4ECUA 4GLAC 2B39A 2PZUA 3G48A 4IJLA 1Y8NB 1DCZA 1NR4A 3IRBA 5KFTA 3EBEA 2R7NA 5L9XA 2RKSA 5C4JB 1PH4A 4RCOA 3KLSA 1SFOB 5DQIA 3M85A 4MTNA 4JI0H 1STEA 5D1OB 2F0LA 1HCZA 4EGQA 1CA5A 2AQ1B 4LMQD 4ECTA 3G7LA 1QCBD 2RDJA 4C5AA 2OWOA 2XIWA 1AH9A 4APVA 5C0XI 1LTRD 2E2JB 3CVZA 3STBC 4Q5VA 5EZYF 4EFEA 2BQRA 5GAEC 3CRLC 3OPOA 3HEJA 2VB2X 1KRSA 3J81j 2W9AA 4ME6A 2ATLA 1E2ZA 3DUZA 4UP7A 3GTKB 1JJGA 3CHBD 3RB4A 3OIQA 4X3KA 3KF6A 4BS9A 2K5QA 2A19A 3R3OA 5IYDH 1ONLA 3I4NH 3ND9A 3K3VA 2FLNA 5D14A 2R61A 3NHHA 2UXBL 3K81C 3MR6A 1T5XD 2D5DA 1LTAD 5C3EB 3S14H 1HNXL 2IHEA 2YCHA 3CCMA 1W2BA 4C3IG 4J9MA 2Q2UA 4A3CH 5BN4A 3M4YA 1UAPA 4J9QA 1TWGB 3PSIA 4JOIA 4DAPA 2KHSA 5IWAQ 3P75A 2E2HH 1VQ6A 5IWAH 4XIGS 1EWIA 3SK5A 2KHJA 1DOKA 2JXMB 3SDZA 5EKIA 2KCNA 1D1IA 3PUXA 5IP7G 5EPJA 2DNCA 1HR0L 5JJKA 5C5JA 4X66L 2VQFL 2PW7A 5FO8B 4DR3Q 1TQOA 4UCVA 4FNFA 2CW0D 2NN6G 5FLXc 4DR3H 5I4DA 4GOPA 2A6HD 3DF7A 4OWWB 1WTQA 2A6ED 1VQ8A 4JYAL 2R85A 3LP8A 2B8GA 4Q43A 4DLKA 2EYJA 1YNJC 5C0XJ 4JI2Q 3GTJA 1WCMA 1JORA 1N33Q 3N52A 2W6ZA 3PO3H 2F0DA 4JI2H 2EY6A 4B08A 2ZXRA 1N33H 2IBKA 5I9PA 4ZCKA 5DLGA 3FPPA 3M7NA 4HMIA 3PQIA 4NXNL 1EUJA 5IYCH 2L11A 3GTPB 3A54A 1EY4A 2IPKD 4ZI7F 1GO3E 2ZTEA 4KV6A 4EBCA 1HZAA 1U5KA 5CBEE 1OXUA 4QWEA 3D3RA 4K2LA 1XPOA 3T5HA 3PIOA 4CHTB 1TWCH 1X6OA 5KT3A 1II3A 1VQ5A 2F4VQ 1SMXA 3IKJA 5ELCA 5KFSA 2JA6H 1RK6A 4ED2A 3S1NB 5FPOA 1K28A 4RFBA 3EJIA 4EVOA 4IUVA 1BGWA 4O3SA 1FYCA 2VUGA 4NKLA 1GUWA 1GOZA 1EFWA 1X54A 2OQKA 3JC66 3VPDA 5A2QE 2R84A 4BBRB 3BABA 1QVCA 4U7CA 1STAA 3S15H 1RTOA 2XTIA 2VZAA 4A93B 4L63B 1A6XA 3HOZH 5M3FB 2AQ2B 5EOYA 2WB1A 2C2EA 4GKKH 1JWUD 4CDCC 2CH4A 4EGVA 3Q24A 1Y1WB 1PH9A 4HNTA 4IR1A 5CA0F 3D4RA 5KX5F 4GLXA 4A3MG 1JJCB 2I5MX 4OELB 2F0EA 3SE0A 2CW7A 2JA5G 1D5XC 4DV5H 3OSOA 2MGSA 4RGMA 3HOUH 4XYQA 4KD3A 4DUYL 2DY8A 1EQQA 4MIUA 2KA7A 5FLXE 4C3JG 4HQ6A 2W70A 5FJ8G 3BU2A 2HGSA 1Q81C 3BZDB 4LF4L 3S17H 3M7GA 4TQUS 1G51A 5KFLA 5JEAG 1VAJA 4EX5A 4O42A 1J9OA 3I56A 4R8UA 4JUZA 1GUGA 2FE3A 4IWXA 2LY7A 2PYKA 3T1YL 3NTHA 1O75A 3A55A 1ET6A 1YNND 5NUCA 2UUCL 4YAKB 2WV6D 4LF6L 3UDIA 5C44H 2E2IH 3BAAA 1AZPA 5FD6A 3W1GA 2QK4A 3FMAA 4DL5A 1WYDA 3NBHA 1G2SA 3NQTA 3S1RH 2L15A 2IL8A 5C3XA 4Y8VB 3C2PA 3A8JE 1TS3A 2YTYA 1X55A 1GM5A 1S4ZA 4YWLA 2AU0A 3E0JA 5KT7A 3AMUA 2L5TA 2NB0A 1KJIA 1JB7A 3MWMA 2WYOA 3ICEA 3W1BA 3C1EA 1AUXA 3Q0AA 1PXUA 3DWPA 1XNRQ 1R4PB 4DKAC 1KL9A 3R8BA 3HOXB 1DIKA 2QA4A 1EZ8A 4WJ4A 1IBLL 1HNWL 2R93G 4DV2Q 3JZIA 2NVYB 1VQMA 1CA6A 3FKIB 3MA2B 4RAYA 4LFAQ 3CMEA 4ECRA 4DV2H 2Z1CA 4O1NA 1EQVA 1I3QB 4DR6L 2LXJA 1K83A 4B3SL 2HHHH 2TSSA 3K5LA 3RUPA 1X65A 1SYXB 5IT9L 2L9HA 1Q82C 4L5QA 5LYJF 5H80A 4NPSA 2EYOA 4HN7A 3U4VA 4Q0FA 1QZHA 2Z9HA 4F4YA 2Z0SA 4DV1L 4X3TA 2L0CA 1UEBA 3EVQA 4QWDA 1B4OA 1D7QA 3BS1A 3RZOB 3T56B 3ER0A 3JAMc 4IALA 4DAYA 4E6IA 1UNNC 1KJ8A 2YS6A 3RGXA 1VQBA 4YCVA 2EXZA 5C0XH 3OW7A 1Y1VB 1R9TH 3S1MB 5M5XH 4JC0A 4ZYSA 4DL4A 2QKIC 1EOVA 5M5WH 3M9OB 4X65L 3RBEA 5CV7A 1YNXA 4LK1C 4KKUA 1STHA 3K3PA 1Y8OB 4JBKA 2CHBD 3GTQA 4IR9A 1YJ9A 1VBGA 1TAEA 4JI8Q 4AYBG 4DR5Q 4A3GB 5JUMA 1W93A 1XPUA 2C35B 2B2UA 3TP6A 1XMOL 2B63A 3DXJC 3RUZA 3GV3A 2UU9L 3CPFA 1A0IA 3OMCA 2R7ZH 2R92H 4IUNA 4HMJA 1MZBA 5KFDA 3KDFB 4LW1A 3A8KE 3S9WA 4Q44A 1AZQA 1RIPA 5M5XB 4RUAA 2J6UA 4C3HG 3MWDA 2R7FA 2NVQB 2GPSA 3GIDA 3IFTA 2ZXPA 4JV5L 2R8HA 3PV0A 2K14A 4MTDA 4F4XA 4OGQC 2RA4A 1NCVA 1ESRA 3DM1A 4OL7A 1PH3A 1VCIA 3K5IA 3GIKA 3X3MA 1Z2PX 3PR5B 2F0OA 1CZGA 3Q6SA 4LF7H 1V1QA 3HBLA 2YL2A 4F4ZA 1CKMA 4DV7Q 2JA7A 3J7A5 4A3CG 5D1OA 3Q8RB 2OT2A 3TQ1A 3HOWG 4DV7H 4K5VA 2KCMA 2VUMB 5DQGA 4KN7C 4PV1C 5C5MA 5C4ZA 3KJPA 2W71A 4DR4L 2EZVA 2PO4A 4DR2H 4AQYL 3ZJYC 3VR4A 3N41B 4C56C 1EZ6A 2NBFA 3GTKA 2K75A 2PMZB 2BE5D 1X3EA 5EJWA 1B6SA 2ICIA 3I8ZA 2WAQB 4IFDG 1GD7A 1EIFA 3T5JA 3I4MH 2LKVA 2W9CA 3WOFA 1SN8A 3G6YA 5KFJA 3ULPA 5JVG3 3HOYB 4X64Q 5G3LF 1O7LA 1KC8C 1YVCA 3GTLB 1TWGA 1ZXTA 5EAYA 1B33N 5KFBA 1NUCA 1SYFA 4PNYA 1CM9A 1N36H 1SMYD 1AN7A 4M8AA 2FLLA 5M5YB 2E5LQ 2EVBA 5KT5A 2ZJRA 5GAHC 3S16B 5JPNC 2P0AA 5F9NA 2VS1A 2JJQA 3OOCA 3NTIA 1J5EQ 1HFGA 2M05A 4O4IF 2UUBQ 1PZID 2EY2A 2KBNA 2ZTCA 2JA8H 2IP4A 4XZ3B 4HJ7A 1F9QA 2UUBH 4A3FH 2XGQA 3CAMA 1LM0A 3OWEB 2V9WA 4K14A 4G7ZC 5KIXA 2XRSD 1PFMA 2GA4B 2JA6G 1SCUB 3QZ8A 5IWAL 4CC6A 2E76C 1EY9A 2CW0C 2QEJC 1KD1C 1ZQ7A 4EG0A 3GV7B 4IRKA 2A6HC 1PV4A 3EFXD 2I0QA 5KFYA 4LFCQ 2A6EC 5GQOA 4NLGA 3WDNA 1RHPA 4ZRZA 3GTJH 1WCMH 2UUAQ 4PMWA 2EJGC 2N8NA 5LL6X 2L12A 3H0GB 3MR2A 1JOQA 3A0JA 3E0EA 2X6GA 4ZUJA 4IO9A 3GV5B 5GROA 1C48A 3SXHA 3GTPA 4XYMB 2K05A 4DR3L 1STYA 5ISRA 1I4GA 4GN4B 1MIUA 3W3AA 5DLQE 1M90C 4PDBA 5AFWA 4LFBQ 1VQNA 4OO1I 1SSOA 1V1PB 4KKSA 4LFBH 3TMEA 3PIO3 1S9FA 2BH8A 4JI2L 3S2HH 2MNAA 3VPBA 3KALA 1N33L 2MPMA 3Q8DA 4QUFA 2LXKA 3J80c 2EY5A 1UE1A 3AFQA 3RLOA 1JWMD 4O2BF 4B9WA 4G57A 2ZDQA 3P7JA 5CMDA 4KY7A 3AQQA 3KLSX 4KHPQ 2AMCB 4CJ1B 2NWGA 2K5HA 2CFMA 1FJGQ 3Q8QB 5L1IA 2KCTA 3I73A 2KCCA 3RLNA 2RQXA 2N55A 2NTSA 1SJED 2ZXOA 3EPIA 3MTSA 4OWXB 4A3IH 2L55A 5BPFA 4J9KA 4QJFA 3SK8A 2A8VA 2F4VL 3PVXA 3F2DA 2PPBC 1Z2OX 2RSNA 1KLUD 5C4XH 2CVRA 4A3KH 3E5SA 1CZWA 3H3VC 4J9PA 1TWHA 3KF8A 1M4VA 1B50A 2JP1A 3KXYT 4IUUA 2C28A 4B3TQ 4LAAA 4ZUIA 1HNZQ 1V43A 2W57A 4B3TH 1CSQA 1HNZH 5JAVA 5KFVA 2IMWP 2WB1B 3K7AB 2LSSA 4R7RA 1KRTA 2KHIA 1CKNA 4QW9A 3R5FA 1PZJD 3OW2A 4ZQ3A 4DN4M 4C3IB 4C5BA 3RB3A 4XTCS 4BBSG 2VY3A 5EWEA 5DG7A 2Q2IA 1YNNC 2EYHA 5DM73 1WTXA 4BY1G 3LMLA 3J81c 4JI3Q 3BVMA 3T13A 3RZDB 3KFUA 4IWYA 2ZT9C 4H02A 1RJPA 5HURA 2PNHA 2DIKA 5KT2A 1LTGD 2XN9C 3T5KA 1CK1A 1SE8A 3UI2A 3CCSA 3J80E 3X3NA 4EQ5A 2N88A 3Q8PB 4RB0A 4R8UB 5KYLA 2EYMA 1F9PA 3I4OA 3I3CA 3CCJA 4JI5Q 3TQYA 3BYYB 5C0XG 1YHBA 1M0TA 1TS5A 2V4QA 3VR3A 2V1CC 5K36H 4O0AA 1I94Q 2NVYA 3EIVA 5I2XA 3PF4A 4TRDA 3FKIA 4G7HC 1B44D 3BG5A 1YI2A 1K1QA 3I12A 1UWVA 1K83H 2B8FA 1B9NA 3NBHB 4LUVA 4M7EA 2HVQA 1HZBA 3K57A 2OTJA 3E6ZX 2PQEA 2HDMA 3RLFA 2HQEA 4Y7NH 2AWOA 5IGCA 5JVLA 1CHPD 2AHOB 2A68D 2EJFC 1XNRL 4RUCA 2XSCA 1ASYA 1M7JA 5BR8H 1K0RA 2SOBA 5J22A 2F0KA 4A3EB 2R7ZG 2BQ3A 2ASDA 2O5IC 4RNOA 3A7AB 5CV4A 3J7AF 1SNOA 4DV2L 3WO1A 3L2PA 5FKAC 4IRDA 1DXMA 2W8KA 1T94A 2IHFA 1VQ9A 4LFAL 2H5XA 2Z6KC 3MXPA 1IYUA 3S1QB 1Y1VA 2R6FA 3A74A 4R1JA 2OEOA 4MA5A 1L0YB 4ECYA 3LWUA 4I7HA 1LT5D 1VQAA 3ULLA 1CFMA 2OXPA 1CQIB 3NQIA 3BVGA 1EY5A 4GKJQ 3J81E 5CV6A 1ILPA 1CS0A 4JI1L 4RB3C 5C1OA 3BZKA 2Q2HA 1AUVA 4GKJH 4FBTA 1A3TA 3IFDA 3L3OC 2B63H 2PMZE 3B6YA 2FMAA 2NVTH 3W2DA 5JJIA 1KDBA 3PR4A 5JVDF 3KDFA 2WAQE 4A3MB 2B2UC 2W8LA 2JA5B 3MXUA 3WO0A 4DV6Q 1XPRA 3HOVH 2W6MA 2HQLA 2LMCB 3NGDA 4LF5Q 2YW2A 4DK1A 4DV6H 3JAMW 4C3JB 5EKLA 4CDEC 3I4MG 1EUCB 5EDWA 4ILWA 1LUZA 4JI8L 2DWCA 4DR5L 4OXPA 5C4JH 3GTQB 5KFQA 1E24A 1KABA 2XCPA 3SK4A 4IOCA 4OX9Q 3HS0C 5M3MG 2JA7H 4CC5A 2BH2A 4DR1H 1EU3A 2PNRC 1EIGA 3K7UC 3S24A 4OX9H 5J2UF 2ICEC 4QL5A 1QVFA 2VUMA 2ZJPA 5E4XA 2E2JH 4QF4A 4EYIB 2A69D 2CWPA 3PW4A 4P74A 2UXDL 3R2TA 4BWSC 3F2BA 5EPKA 4QW8A 5EGTA 5DGBA 1SAPA 1Z9FA 3GTKH 3R5HA 2PMZA 4K0KH 4R8IA 1Y69U 4KHZA 4A3JB 2K5DA 1PHJA 2E75C 2JA8G 5DLFA 4K6LA 3GV8B 1GUNA 4JI0Q 1GUTA 1U4MA 5C3EH 1VQ4A 1E3PA 2JA7B 2VL6A 2XWBB 2WINB 4HCEA 2QEXA 3NWTA 2VA3A 1XX8A 4OO1H 4ECVA 1UC9A 4IPCA 5KFHA 4I65A 3GTLA 1TWGH 2F0IA 1L2FA 3ONAB 1B3AA 3J80i 2W7OA 2IT1A 4L5TA 3ZYYX 2G9HD 1N8RC 1PH8A 4FF4A 3SGIA 3NWSA 3CRKC 1XNQQ 2ZDGA 2YYZA 1U4RA 1MJCA 3E9IA 4POFA 2X69A 5IYBH 1XNQH 5C8YF 1WTHA 3K8AA 3G6EA 2D62A 1HUNA 1SNPA 1QNUA 5KFCA 4J1MA 3JSLA 4EQPA 4OEMB 1HH2P 4ETSA 4X64L 4A3DG 4O4LF 1YBYA 2W9CB 4QB4A 3G4SA 1M1KC 5I6WA 1I6HB 4MV4A 4RWSC 2R8IA 2QILA 5ELNA 1MD2D 1TWFB 2B2YA 2I5LX 3N6RA 3KBGA 4IUQA 3S2DB 2EYFA 2KEDA 1I7LA 2ALZA 1KJJA 3J7ZC 2E5LL 1EUDB 1XXGA 4HJ9A 3BDCA 1W6KA 1GJXA 1K8AC 4A76A 3L4JA 1XDNA 3H0GA 1J5EL 2UUBL 3Q23A 1SROA 2HUGA 2C2RA 1SE2A 3TRZA 4HYKA 3OHXC 5EBCA 1IBKQ 3GTPH 4GC7A 4ED0A 5D65A 4MV1A 2EDGA 1IBKH 5C3WA 3N43B 1ENCA 1S0OA 5TSSA 1EOTA 1RK5A 4DUZQ 1V1PA 1M0WA 5KG6A 1I4QA 1A9XA 1KDAA 2RHQB 3I91A 2RBMA 4LFCL 4DNTB 2NU6B 4YB8B 4O3QA 4DUZH 2PZWA 2F52A 4PZ7A 2MO1A 2NTTA 5L37A 2UUAL 2IW3A 3S1NH 1GSHA 1PH5A 2A73B 1BQQT 4MTKA 1QJOA 5KFUA 2JEJA 1IBMQ 3J81i 3RV4A 2FMCA 3TIGA 4A3BB 4C3HB 1PFNA 1IBMH 2WB1E 1SNQA 1J6QA 3NTKA 3OSNA 4BBRH 2B2WA 1I4RA 2CQOA 1FL0A 2MUYA 2YTXA 4TV9F 3J7AV 1FGUA 3Q22A 3PO2G 3GO5A 1U4LA 4A93H 1YJNA 4LFBL 5M3FH 5GADC 1EEID 1MJEA 1X3PA 2QDLA 4QQBX 1UE5A 4F88A 1Y1WH 3I72A 1O7YA 1FNWA 3HOWB 4EBDA 3PW2A 4DR7H 1PTOD 5GAGC 2F3VA 3GQBA 2DPIA 1SE4A 5J3BA 1B8AA 1GYFA 1Q1EA 2FFKB 2W6QA 4IN3A 3K58A 3CCEA 4KHPL 5DAUA 2MQHA 1AN8A 2D0PA 2O03A 2Z4IA 1NJIC 3GDEA 4CJ0B 1FJGL 1I6UA 1MSGA 2YZMA 4G4KA 4MV9A 4OONA 1KBLA 5KG2A 4FF1A 4DV0Q 4GKKQ 2Z4HA 4J0MA 5HGTA 1SBBB 4DV0H 5K36G 5DM63 3OHAA 1PK8A 1VQIA 3BG3A 3MWEA 4KY5A 4DV5Q 3G71A 4BY7B 5IP9G 3BQ2A 3Q8SB 5C4HA 4O3RA 4RB1A 4TKOB 4ED1A 4L8JA 3F2CA 3KOJA 4B3TL 5F9LA 1HNZL 1L0XB 1HZCA 1Y8PB 1TWHB 3KF8B 2F0PA 4F7XA 4A3LG 1IKMA 2EOTA 4FVMA 1KIXA 2DUDA 5FLMG 2RCNA 3I55A 1EYAA 5T1IA 1KQSA 5A2QL 4UCTA 1N32H 4JV1A 2E2DC 1D8LA 3MFIA 4N8X1 1EQTA 3A7LA 3HOXH 4NB3A 5BPHA 1CKNB 4HIDA 2AQ3B 3RB6A 4KMUC 1AE2A 4I7ZC 4HR7A 4CGYB 5KT6A 2NVYH 1UNSA 4LH6A 3UQ8A 2YYAA 4JI7H 3FKIH 3QIAA 4JI3L 1GGOA 3V6HA 1I3QH 5KFWA 4K6DA 3SE7A 1BR9A 1IHZA 4ODGA 1E1OA 2M9VA 1PRTD 2RVLA 4QWCA 4NW2A 3J7YW 1YHAA 5FLXL 1DV1A 3BQ1A 2HVSA 1S5DD 4MZ9A 2F3IA 3M4QA 1ILQA 2VPSA 1C4QA 2OCEA 2O5JC 2J0TD 4JI5L 4DV3Q 3VPCA 1JX4A 1FKAH 1QE6A 1F2YA 4DV3H 1G291 4FXGC 1TKWB 3RZOH 3AB9A 1GLVA 1GSAA 3H3VI 2NZHA 1I94L 3URYA 3BA8A 3CQZA 3VR6A 1EL0A 2MP1A 4ME5A 3KLRA 3HFZB 5IT9E 1EYCA 1Y1VH 2MO0A 3MHBA 4KKTA 4TSSA 1IL2A 3S1MH 2CCZA 2KJXA 2HHHQ 1S0NA 1CSPA 5EQ0A 2HVRA 4CDFC 5D1PA 3GTGA 2K03A 2JEFA 3GTOB 1MHWC 5I6YA 1ZEQX 1WVLA 2O2LD 4B3MH 3CC7A 3DWAA 4A3GH 2PW5A 4YHHH 4F8MA 4FDBA 3PUZA 3N8DA 2Z6KA 1JLLB 4R4IA 2F03A 4M9UA 1NBWA 4P73A 2B2VC 4NXMQ 2FK2A 5KFIA 5KG0A 1FNVA 4BA1I 4NXMH 1TVXA 2F0VA 4P2CB 4TQRA 2JA5A 3GP7A 2F0HA 1F9RA 4EGJA 2WDTA 2R7DA 2NVQH 2F0MA 1VF5C 2N78A 1G2TA 3SI8A 2HD3A 2K33A 3GIIA 1V51A 2C00A 4QY7A 1EIYB 4K5XA 3F2UA 4GKJL 1WTWA 1QZGA 5KFPA 1XMQQ 4FF2A 2WIIB 4AH6A 4OO1G 4QGUA 1S03G 1XMQH 2KQ3A 3C1FA 2RGVA 5DQHA 4RA8A 2VUMH 3AU7A 1FGBD 1QUQB 2AWNA 5L1LA 4UCOA 3EPGA 4PMBA 3L7ZC 4DV6L 4K5WA 2PCFB 1QWYA 4HIKA 1MGSA 4YCUA 3RN5A 4BBSB 1M6VA 1ZHSA 4O3PA 5CA1F 4UHVA 2ALYB 2NU8B 4LF5L 1SRUA 4ECZA 2A69C 2RGRA 2R6GA 4BY1B 3A56A 1SDFA 5IYDG 4OIKA 3I4NG 1YITA 3K5NA 1DV2A 4ULLA 3BQ0A 2YZGA 3CF5A 2ZJQA 4LF7Q 4OX9L 1D1KA 5KG1A 2FK1A 1WTVA 5BN5A 3HOYH 3NENA 1SYGA 1PH2A 5LOVF 3G6XA 3GTLH 1S3OA 4IQZA 4DR2Q 5KEEA 2R93A 2ASLA 3H6MA 2J6TA 1WD1A 5M5YH 1BNCA 2YU9B 3MC0B 3S16H 2QYZA 2WTFA 1TWAB 2GVBA 1S72A 4WJ3M 4LJZC 1HQRD 1VBHA 4X62H 5LMNH 1OWTA 3RV3A 2NVXA 4JI0L 4MV7A 5E3FA 4UFZA 4DV4H 4XXEA 1O80A 2UXCQ 4ABNA 2BA0A 2CQAA 5CORA 4KY6A 2UXCH 2AUKA 1VF7A 3MFGA 2RF4A 2CW8A 1PZKD 4RMFA 2GN5A 3N40P 4ECXA 1O78A 4NP5A 2KUMA 1TWFA 4JI4Q 2NZ1D 1N36Q 5CGKA 3KHLA 3NXWA 3T53B 3CCQA 3IL8A 3KLWA 3PO3G 4FU0A 4JI4H 1VMCA 5JJLA 4DAMA 3HG9A 2B2YC 3BDLA 4CDDC 4QWBA 1RODA 3H0GH 5IYCG 2ATWA 3M9MB 3ITPA 4A93G 3BVZA 3NUCA 1N56A 1PFBA 2JEBI 1A3VA 3JRXA 1EZ1A 3A8IE 3JAML 4B9XA 1B9MA 1HQMC 1Y1WG 4O3OA 4FO2A 5CV5A 5CBAE 4HAEA 3RD4A 4DA2A 4AYBA 4M1UB 1RJTA 2D9UA 2NU9B 4KI0A 3V6KA 3IAYA 2B2TC 5FK9C 2WACA 2VPQA 5KFAA 1I6VC 3K80C 2ID0A 3DEOA 4LNQA 5CC4A 1I50B 3NSWA 3U9SA 2Y0SG 2R82A 1S97A 1JCKB 1E7ZA 1HXYD 3MVVA 3T1HQ 4EEYA 3OYYA 1KEEA 3T1HH 4RB2C 1SEBD 4UP8A 1C7YA 3LX0A 1ESFA 1IBKL 3CD6A 4FF3A 5A2QW 1NTGA 2DLNA 3HOZG 1S10A 2RDHA 3K0YA 3GQCA 3VYSA 2PQAB 1X56A 2VQFQ 5JEAJ 1HR0H 4DUZL 1JDBB 4UCSA 2B2WC 4UCRA 5KG7A 4X66H 2LS01 3H94A 2VQFH 2DN8A 4RNMA 3RTXA 2B29A 4HSPA 1RD9D 3CC4A 3PIP3 2I46A 3HOUG 1K1SA 2JSOA 4JYAH 1LTBD 2EPBA 1UC8A 3FDTA 3VA5A 5ELOA 2C22A 2XCAA 1K8MA 5FLXW 4EBEA 1A2UA 3PZPA 3E3XA 4PZ6A 5KFGA 1A3UA 1IXRA 3EN2A 1E4GT 2Z8LA 3I70A 3W5OA 3F8NA 4P72A 4RAZA 2VXWA 5CYUA 3NBIA 1KDCA 4X3SA 2VW9A 3K7AH 1XWEA 1NNXA 5L1JA 3TN2A 4DNIA 5C44G 4HEDA 2IY5B 2QF7A 1PTOB 4C3IH 2W9BA 4J9LA 2DPJA 4PWQA 1S5FD 1K73C 3H3VH 1EHIA 1N9WA 1PDQA 4IURA 2FJZA 1QVGA 3TQTA 3MZ5A 4IZ8A 5A35A 2YS7A 4NMZA 4E4TA 5EWGA 2PBZA 1PYSB 3FP9A 4HNVA 3RZDH 5LL6S 1NR2A 4DXGA 4A4IA 3HKZG 2KEEA 4DV0L 3C3LA 1IL8A 1V1OA 4GKKL 3T51B 4FXDA 1HRJA 3UDGA 1NMGA 1K0SA 1WOCA 1TIID 4FP5D 4N8FA 4A3DB 1UUPA 1B2TA 4DV5L 4R4OA 1VQPA 2JA6A 2RDFA 1LLRD 4UY8C 1L1OA 1JDEA 5KFRA 1E1TA 5FOBB 4YCWA 4ED3A 2SDFA 3GTMA 2VB3X 1RYRA 2V58A 5IGDA 4NDXA 4L1KA 3DMUA 3D8GA 3ULJA 4HCSA 1B04A 1CT1D 3OWFA 5KRUA 5CV9A 3RN2A 3HP3A 4IAJA 1HFNA 1PRTC 2QCPX 3NEMA 2NUAB 3RGZA 4ZAIA 1E0BA 1EY7A 3Q1KA 4XT3B 1AEXA 4YQWA 2WFWA 1RL2A 1C0AA 4FBUA 1NY4A 4A3EH 3QZ7A 4ECSA 2NUCA 3MEHA 2DJGC 1BOSA 1TS2A 3GIJA 2UUCQ 4DAVA 1KTKA 1EQRA 2HDLA 3A5ZB 1HTLD 1BUVT 4IPHA 3K5HA 2UUCH 1V9PA 4HR7B 3S1QH 4I55F 1CQJB 1MSHA 3MAQA 1R4QB 5LL6b 3UE1A 2FPPB 1ZYRD 4HIOA 1EWHA 1PRTB 5KFZA 1ENAA 1GUSA 2TMPA 2LFNA 3NPPA 1T9HA 4RH6A 4J8QA 3GTGH 4R4CA 3IG0A 3RB0A 3GTOA 3M4OH 4DV3L 3NE5B 2FLPA 5BR8Q 1VQ7A 3PO2B 1C30A 2R8GA 3VMMA 2R92G 1PTOF 3J80L 3A5UA 1EYZA 1S40A 4Q8EA 4H0LC 1DOMA 1JICA 3CQZB 4GN3B 4MAMA 1D2BA 4A3MH 3EQLC 4GLVB 4YWKA 5K2MA 3RAQA 1HNWH 2HHHL 4XYLB 2JA5H 3QO2A 4POGA 1ICFB 2MFIA 3N6XA 2WAQG 3U9OA 3V05A 2UVWA 5I47A 3QG1A 4C3JH 5FJ8H 4B3SH 1H9JA 1F9SA 1JWSD 4RGTA 1D5MC 3GTGB 4X6AH 3OHBA 4JBMA 3M4OB 1A63A 4IFDJ 1YEZA 3GTQH 3MFHA 3KBXA 4FS1A 2DNEA 2B2VA 3CCVA 3CC2A 2R7MA 4DV1H 4NXML 3PW7A 3I4LA 1B1ZA 3RNUA 1JXLA 2IX3A 3R5XA 5IGEA 1JOOA 1QUQA 4RG1A 3LGJA 2R87A 3KHRA 1TA8A 3ORQA 2PVPA 4DNRB 2PN1A 2JEGA 3T4AC 2Q8RE 1XTCD 5KKNB 4X65Q 2M2LA 4CKEA 3BZCA 1SR3A 1HJPA 5IE8A 5JPMC 2OTLA 4A3JH 3CKIB 4GN5A 4X65H 4J9RA 3TEHB 4S3SA 3G6JB 1TR5A 1Z7TA 2PZTA 4K2KA 1XMQL 1F2LA 3C46A 4IPGA 2XCLA 1BVSA 1VQKA 2MCTA 3L4KA 3VDYA 4DR1Q 3TS2A 4IUPA 1F77A 1BDOA 4L5SA 4BA2I 4ED7A 3J81L 3G8CA 4ECWA 3G6VA 1XMOH 1W3SA 4WRDA 1RJRA 2GPWA 1QNKA 3QJYA 1BCPD 4KHPH 1CUKA 4MTEA 2QDBA 1PRTF 3D6CA 1VQDA 4GNXC 2YU9A 1K3RA 2EY1A 3M9BA 3NK9A 3D31A 1PLFA 4K0KQ 1TWAA 3H40A 2NZOA 1OXXK 4N9TA 1N48A 2IWHA 3Q2OA 2J7ZA 2JYOA 3SVMA 4LF7L 1I4XA 4TV8F 1K3BC 5JQWA 1JMCA 4A3FG 2NVXH 2NYZD 4JV5H 3MFYA 1KJ9A 1TY0A 4TUYF 2BE5C 5IODA 2L1BA 5CV8A 4DV7L 3KAJA 5F2DA 1H9RA 4ED6A 2A1AA 5ELBA 1E4EB 1GXDC 1QOHA 3RAXA 3EROA 1EFID 4UAIA 2R7ZA 2DGYA 1I6HH 3QB3A 1EIHA 1JC7A 4DR2L 5EKKA 3RJ0A 1K9MC 3ERQA 3S2DH 1TWFH 4C1NI 4GNXB 2W7PA 1WCMG 3DM3A 3KK7A 1PVOA 5KFEA 5IIFA 2R93B 2C9OA 4C2MB 4DR4H 1EU4A 1WTRA 3TDQA 4AQYH 4N9PA 4LH7A 3HZXA 2JEAI 1I7NA 3PCOB 2YRWA 4LSXA 2V4RA 4R9WA 1IKLA 1SMYC 1H95A 5ELEA 1U9RA 1O7ZA 2UXCL 5DNFA 3GIPA 2HT1A 3FHWA 3LWEA 4H44C 2NVXB 3MJFA 5AJ3Q 4I50F 2SNSA 5LHY1 1I5FA 4JI4L 2WKCA 3UDFA 3AEVA 1N36L 1LTTD 1KJQA 3TP7A 4XQJA 1PH6A 3CCLA 4KD4A 3M3YB 4C5CA 2QGQA 2JN4A 4DL6A 3PW0A 3LNNA 1I50A 2AUJD 1DM0B 3WWVA 4XQNA 3N44B 3AYHB 2N3SA 4A3BH 4C3HH 3OTOQ 2I80A 4DL7A 4QWAA 3OTOH 2F3WA 3U50C 1ML0D 3HRZC 5IGGA 3QFFA 2WB1G 4A3IG 5L1KA 1SYEA 2V59A 2PQAA 2K28A 3SHLA 2B2TA 3RMHA 3E5NA 3MXNB 4FM9A 4AYBB 2D0OA 4J15A 4YWMA 1EYDA 4LWCA 5JJZA 1ICWA 1LTLA 4DV4Q 4FYDA 5C4XG 4R4TA 2WKDA 3HOWH 4A3KG 4YY3Q 2HCIA 3T1HL 2NU7B 4EEQA 4YY3H 4ALPA 2ASBA 3L9AX 1YIJA 1PX2A 1FD7D 4J9OA 1BBUA 1Y14B 5LP6F 1Q90A 4QMGA 5DG8A 4JW0A 2HJWA 3U58A 3UE0A 2I87A 3I90A 4CJ2C 3I4NB 2X0SA 1X32A 1EY0A 2FPIB 3PW5A 1Z6HA 4IUTA 1EY8A 2V5AA 3D0FA 4IFDH 5KFMA 3S14B 5C5LA 1QB5D 5BN3A 4JI6Q 1VQEA 1K8GA 4JI6H 4KN4C 4DR7Q 3L0OA 4KK7A 2K32A 3PIPA 2E2HB 2WP8J 4BY7H 1IYJB 3FPUB 5H1SE 5C6AA 2CKZB 1P8LA 3DEPA 4WJWA 1PYWD 1RJQA 3EA6A 3MEFA 2XWJB 1BNZA 1TWHH 1LTID 1A15A 3TZDA 5D8DA 4J9NA 4DFAA 4LF8Q 3BA9A 1LT3D 3KHGA 4ZLTF 3RBDA 1WTOA 4LF8H 1D6EC 5T1GA 4A3EG 3PGZA 1X3QA 3DWQA 1Q3LA 2KSWA 1A62A 1EY6A 3J80W 5IT9c 5KFNA 1TY2A 2FXQA 4PG3A 5KG4A 4CKBA 1C8CA 4RCNA 3CXCA 1HTPA 4FS2A 1RKNA 4Q0YA 3AFPA 2F4VH 2W9BB 1Q7YC 1H9SB 1Q8KA 3PO3B 1YZ6A 2XVSA 4EQNA 3GTMH 4CBVA 2P5ZX 2R7KA 3NELA 4WBNF 1L1OC 4ZKBB 3D6WA 1VQCA 4UPAA 4B3RQ 4Y52H 1G6PA 4L5RC 3C0FB 3TIIA 4B3RH 3R23A 1N32Q 1S5BD 4HJ5A 2EYPA 2XC9A 5EBDA 2R86A 1RF2D 1J8IA 3M4IA 1DYQA 2XNAC 4J9SA 4RAUC 3CCRA 1IYVA 1AE3A 1GUOA 1TWCB 1I4HA 2K5NA 4JPBW 2ES2A 5KFOA 2F0NA 4ZK9B 2RHSB 2JA6B 3FVQA 4JI7Q 1UEAB 1AW7A 2GVAA 1L1OB 5E7NA 4IJHA 1ET9A 3P20A 4DL2A 1OXSC 2Y0SB 4YP3A 3UFXB 3GTMB 1VQJA 1CKOA 2K50A 1CQVA 5DG9A 2DJFC 3CMAA 3S15B 4QCLA 2EQSA 4RHRA 1FNUA 1ZYRC 3HOZB 3GTOH 1VQOA 1LYLA 1BO0A 1G8ZD 2B63G 1ZETA 3J81W 3K0XA 2EJMA 1A8VA 1PFSA 4MHEA 2A68C 3VR5A 2EYLA 4DU9A 2Q8TA 4RKBA 3T5LA 3HOUB 3HOVG 3H09A 4A3JG 5KG5A 4O3NA 3TSSA 5DEHA 1KHIA 2I07B 3SK6A 2FHTA 5K5PA 1WD0A 1V8QA 4O2DA 4WORA 3S17B 1DOLA 2F0WA 4PZ8A 2FP4B 2XGPA 4Q8FA 2FMMA 5BR8L 4XQQA 4B3MQ 2JA7G 2R8JA 1Z47A 2JQOA 1V4YA 2RDIA 4YHHQ 2ASJA 4YR3A 4AIMA 2WE6A 3CP0A 1XNRH 4IZOA 1LABA 5LA6F 1LT4D 3OUZA 3U9TA 2NN6I 3BDOA 5D3DA 3VYUA 1HPCA 1CI3M 5C44B 2E2IB 5T14A 5LMNW 2FJ2A 2FK3A 4BBSH 4LFAH 4GS3A 3S1RB 4ID6A 1T3NA 2VQEQ 3H15A 4R4QA 4F50A 4BY1H 1AP0A 5FO9B 1Z2NX 5I2YA 3D4DA 2SNMA 2VQEH 3V4SA 1HUMA 4Q45A 1CHQD 2J6SA 2KENA 3MWYW 3PF5A 5C3EG 3HKZB 4OIJA 4P75A 1JB3A 3TS0A 1ENFA 2M00A 1G6ZA 4JI1Q 2ZM6Q 5LMUQ 2C2DA 1TS4A 2KVMA 5CR3A 4JI1H 2ZM6H 5LMUH 2RDGA 1OTCA 5E4WC 5ELFA 4RZQA 1XYIA 3BYTB 2F0JA 1N34Q 2F0SA 2ZJTA 2BCOA 5IGFA 3RF2A 1N34H 2YU9H 3H91A 5IYBG 1BCPC 1TWAH 2DY7A 4P71A 3GLKA 1LTSD 2CWAA 1OXVA 4K8IA 1XTDA 4LF9Q 3ORRA 3TZUA 1D5ZC 4DR1L 1SEIA 3JRWA 4JI8H 1WH2A 1IW7D 1B7YB 2I5HA 4DR5H 3TREA 4LF9H 4RZRA 1YJWA 2C5CA 1E4EA 1VKZA 4DL3A 5J2TF 1Q46A 3K5MA 4I4TF 1S5CD 3I7FA 2UVRA 2K1BA 1W96A 4KLKA 4ZKCB 4GNXA 1MKHA 2JK8A 1IOWA 4GC6A 1MI2A 1EEFD 2EIFA 1R9TB 2W6NA 4ZQIA 1BCPB 2UXDQ 3UDXA 4A3BG 4BXXH 4K0KL 1SXTA 4L6TB 4C2MA 5M5WB 2A5HA 2FKLA 3CU7A 2UXDH 5J39A 5E1FA 1DD2A 1HR0W 4AYBE 1HA6A 2RSOA 5CAEB 4KJNA 4X62Q 4U6PA 5LMNQ 2HIXA 3OSPA 1L0WA 1YHQA 3OIPA 4JV0A 3RIZA 1RDPD 1SFOA 3KYHC 5D3IB 4IPDA 1NE3A 1VQHA 4HJ8A 4QIWB 5COYA 5IGBA 1Q86C
chains in the Genus database with same CATH topology
3BU2A 2QEXA 1Q81C 4LF4L 3S17H 4TQUS 4IPCA 3RN2A 1PYBA 4LUZA 1G51A 1TWGH 4IOAA 5JEAG 1L2FA 4EX5A 1VQLA 3NEMA 3I56A 1UE7A 1I50H 3J80i 2WFWA 1RL2A 2IT1A 1C0AA 4L5TA 4TVAB 1NY4A 3T1YL 2BA1A 4A3EH 3SGIA 1N8RC 1PH8A 1XNQL 1XNQQ 4BBRG 2YYZA 1MJCA 3E9IA 4POFA 5IYBH 2UUCL 2UUCQ 3K8AA 3G6EA 5AJ3L 2D62A 1EQRA 4IPHA 3A5ZB 3UDIA 5C44H 5M3FG 4HJAA 2E2IH 1V9PA 1GVPA 3S1QH 3DLLA 3W1GA 1HH2P 2UXBQ 1DGSA 1WYDA 4X64L 3UE1A 1PH7A 1YBYA 3STBD 4A3DG 3G4SA 3S1RH 3GD7A 4DK3C 2L15A 4HIOA 1M1KC 5M3MH 1HNXQ 4BY7G 1GM5A 2YTYA 1X55A 5ELNA 2I5LX 1T9HA 4YWLA 3GTGH 4R4CA 1UE6A 3PUWA 3J7ZC 2E5LL 3M4OH 1JB7A 4DV3L 4HJ9A 3ICEA 1BBWA 3E9HA 3W1BA 5BR8Q 1VQ7A 1K8AC 4JOIC 1VQGA 3OTOL 4A76A 1XNRQ 4DKAC 1KL9A 2HIVA 2R92G 1J5EL 2IX1A 3A5UA 3KF6B 2QA4A 2UUBL 1SROA 1S40A 4WJ4A 1IBLL 3TRZA 4GN3B 1HNWL 2R93G 4DV2Q 1IBKQ 3GTPH 4A3MH 4GLVB 4YWKA 1VQMA 4LFAQ 3CMEA 2HHHL 1HR0Q 2JA5H 4POGA 5HGQA 3RR5A 2MFIA 4DR6L 4X66Q 2LXJA 1E22A 2WAQG 4DV4L 4B3SL 1ASZA 4DUZQ 1X65A 4C3JH 1Q82C 4L5QA 4YY3L 5FJ8H 2RHQB 4NPSA 4LFCL 4JYAQ 3U4VA 2F52A 4PZ7A 2MO1A 4GOPC 1QZHA 1XJVA 2UUAL 3S1NH 4X6AH 1PH5A 4JBMA 1A63A 1FVIA 2Z0SA 1YEZA 4DV1L 1IBML 3GTQH 1IBMQ 4IFDJ 3J81i 1UEBA 3CC2A 3CCVA 1D7QA 1X3FA 2WB1E 1J6QA 4NXML 3RNUA 3ER0A 3JAMc 1NMFA 4BBRH 1Q1BA 2N49A 1QUQA 2CQOA 1VQBA 4RG1A 3PUYA 4YCVA 1FL0A 2YTXA 3LGJA 4NXNQ 1FGUA 3PO2G 3GO5A 1R9TH 4A93H 1YJNA 5M5XH 4LFBL 5M3FH 4JI6L 5GADC 4JC0A 1MJEA 1EOVA 2JE6I 5M5WH 1UE5A 3HOXG 4QQBX 2Y0SE 4X65L 4DR7L 4X65Q 4GOPB 3CW2C 1Y1WH 3BZCA 1SR3A 1HJPA 5IE8A 2OTLA 1YNXA 4A3DH 4A3JH 4GN5A 3FKIG 5GAGC 4JBKA 3TEHB 1YJ9A 1XMQL 4JI8Q 4AYBG 4IPGA 5J3BA 1B8AA 1BVSA 1Q1EA 4DR5Q 1U0LA 1VQKA 3VDYA 1XPUA 4DR1Q 3TS2A 2C35B 3CCEA 4LF8L 4KHPL 1XMOL 2MQHA 2D0PA 4L5SA 2UU9L 3CPFA 4BA2I 1A0IA 1NJIC 3F1ZA 3GDEA 1FJGL 2R7ZH 2R92H 2E8GA 1W3SA 3KDFB 2EXDA 4LW1A 2VNUD 4OONA 1CUKA 4LF6L 4DV0Q 1RIPA 5IP7H 4GKKQ 1VQDA 4GNXC 1K3RA 2R7FA 3M9BA 3D31A 4K0KQ 1VS0A 5K36G 4JV5L 3PV0A 2K14A 1VQIA 1OXXK 2NZOA 4JCVE 3ERSX 2Q2TA 4DV5Q 4LF7L 1Y1VG 3G71A 1PH3A 4A3FG 1JMCA 2NVXH 5IP9G 1VCIA 2OQ0A 1V1QA 4DK6C 4DV7L 1CKMA 4DV7Q 2A1AA 4UP9A 3J7A5 4A3CG 3F2CA 3KOJA 4DUYQ 4B3TL 4B3RL 1HNZL 4A3LG 1HZCA 2DGYA 3HOWG 3KF8B 1I6HH 2KCMA 5IY0A 4DR2L 1KIXA 1N32L 1K9MC 3S2DH 1TWFH 2DUDA 4GNXB 5FLMG 2RCNA 3I55A 3KJPA 2PI2E 4DR4L 1KQSA 4LF4Q 1WCMG 3DM3A 1PH1A 4A3GG 4IFDI 4AQYL 1PVOA 1JT8A 3ZJYC 1D8LA 4A75A 3PO2H 2K75A 3JAMi 2JEAI 3PCOB 3KJOA 3HOXH 4NB3A 1X3EA 3T1YQ 1CKNB 4DPGA 4HIDA 4JI7L 1H95A 1Q12A 2UXCL 4IFDG 1AE2A 1GD7A 1EIFA 3CQZH 2HT1A 2NVYH 3FHWA 3I4MH 3FKIH 4JBJA 4JI3L 5AJ3Q 4LF6Q 3HKZE 1SN8A 1I3QH 1GKHA 3ULPA 1I5FA 1E1OA 4X64Q 4JI4L 2K4KA 3UDFA 3AEVA 1N36L 1KC8C 1YVCA 1SLJA 1B70B 1YHAA 1PH6A 3CCLA 5EAYA 4MZ9A 2F3IA 3M4QA 2QGQA 2OCEA 2E5LQ 4JI5L 2ZJRA 4DV3Q 5GAHC 3WWVA 1P16A 3AYHB 2N3SA 2VS1A 2JJQA 2VUMG 4C3HH 3OTOQ 1G291 4A3BH 3RZOH 3H3VI 2NZHA 1I94L 1J5EQ 2PI2A 2UUBQ 3U50C 3HFZB 1IBLQ 2WB1G 4HIMA 2KBNA 2ZTCA 4A3IG 2JA8H 1HNWQ 1Y1VH 2MO0A 4HJ7A 2PQAA 4A3FH 1IL2A 3S1MH 5IP9H 2YV5A 3CAMA 1EYGA 1LM0A 1JE5A 1O7IA 2YTVA 2CCZA 3MXNB 2HHHQ 3CPWA 2D0OA 4J15A 2JA6G 4YWMA 4DR6Q 1CSPA 4LWCA 1LTLA 4DV4Q 4B3SQ 4A3LH 4R4TA 5IWAL 3HOWH 5C4XG 3ULJA 4B3ML 4A3KG 4ME3A 1KD1C 4YY3Q 3T1HL 1PV4A 4YHHL 2I0QA 4LFCQ 3I2ZA 5GQOA 5FLMH 5HY6A 2UUAQ 3GTJH 1WCMH 3CC7A 4ALPA 2ASBA 1YIJA 4A3GH 4PMWA 3HOYG 1BBUA 2N8NA 1OXTA 4DV1Q 1Y14B 1C9OA 4FDBA 3PUZA 2Z6KA 3A0JA 4R4IA 3U58A 3E0EA 1NBWA 4P73A 3UE0A 4NXMQ 4IO9A 4BXXG 5GROA 4BA1I 2B3GA 4DR3L 3U4ZA 3D0FA 1WJJA 4GN4B 1MIUA 5DLQE 2VQEL 1M90C 4LFBQ 2R7DA 4JI6Q 2NVQH 4QIWE 1VQEA 1K8GA 1VQNA 2N78A 4OO1I 2AKWB 1PA6A 4DR7Q 3L0OA 2BH8A 4QY7A 1EIYB 4JI2L 3PIPA 3S2HH 2MNAA 4GKJL 2WP8J 4MNOA 1IYJB 1N33L 4BY7H 3Q8DA 1QZGA 1WFQA 2LXKA 5H1SE 3J80c 2ZM6L 5LMUL 2CKZB 1P8LA 1XMQQ 4AH6A 1UE1A 3AFQA 4OWTB 3RLOA 4QGUA 4OO1G 1KXLA 3MEFA 2K5VA 1TWHH 1X9NA 1IZ6A 4LF8Q 3AQQA 4DAYB 2VUMH 4KHPQ 1XMOQ 2AMCB 1QUQB 2AWNA 1N34L 2K5HA 2XGTA 2UU9Q 2CFMA 1FJGQ 4A3EG 2KCTA 3L7ZC 3PGZA 3RLNA 4DV6L 4HIKA 3RN5A 1VQFA 4YCUA 1A62A 4OWXB 2ALYB 2R93H 4A3IH 4LF5L 1SRUA 1TXYA 3H0GG 4C2MH 5IT9c 2IX0A 2FXQA 1KAWA 2R6GA 4QJFA 3HKSA 2A8VA 2F4VL 4PG3A 5IYDG 3I4NG 3F2DA 1YITA 1BKBA 4LF9L 4JV5Q 3CXCA 5C4XH 3AFPA 3BJUA 1Q7YC 1Q8KA 3CF5A 2K52A 4A3KH 1SFOH 2ZJQA 3PUVA 4LF7Q 4OX9L 1YZ6A 3GTMH 3NELA 1X3GA 1L1OC 3F8TA 1WI5A 3CCUA 1JJ2A 3M4PA 1VQCA 3HOYH 4UPAA 3NENA 4B3TQ 1PH2A 1V43A 1HNZQ 4L5RC 4B3RQ 4Y52H 1G6PA 3GTLH 2JA9A 3M3YH 1S3OA 4DR2Q 1CSQA 1N32Q 4HJ5A 4JBWA 4DR4Q 4LUOA 1HZ9A 5M5YH 4AQYQ 2ZTDA 3S16H 2LSSA 4X62L 5LMNL 1KRTA 2KHIA 1CKNA 2GVBA 4JG2A 3CCRA 1AE3A 1S72A 2ES2A 4WJ3M 2K5NA 4GLAC 3OW2A 3G48A 4IJLA 2RHSB 3IRBA 4XTCS 4JI7Q 4JI0L 2GVAA 2VY3A 3EBEA 4BBSG 1L1OB 5E7NA 2Q2IA 4IJHA 2UXCQ 1PH4A 1OXSC 2BA0A 3M85A 4MTNA 4BY1G 3J81c 4JI3Q 1VQJA 1CKOA 2K50A 2RF4A 3KFUA 4RMFA 2GN5A 4H02A 2OWOA 3CMAA 1AH9A 4APVA 5C0XI 2EQSA 2PNHA 4JI4Q 3STBC 5GAEC 1N36Q 1SE8A 3GTOH 1VQOA 3CCQA 3PO3G 1KRSA 3KLWA 3CCSA 1LYLA 4EQ5A 3J81j 5JJLA 4DAMA 4UP7A 3I4OA 2B63G 1JJGA 3K0XA 3CCJA 4JI5Q 3TQYA 3H0GH 5IYCG 2ATWA 1A8VA 1YHBA 1PFSA 3KF6A 5C0XG 4A93G 2A19A 5IYDH 2JEBI 2V1CC 3I4NH 4O0AA 1I94Q 3EIVA 2UXBL 3K81C 3HOVG 3PF4A 1Y1WG 3S14H 1YI2A 4A3JG 1HNXL 1UWVA 1K83H 2IHEA 1KHIA 3NBHB 4KI0A 3CCMA 1W2BA 4LUVA 2Q2UA 4O2DA 4A3CH 1HZBA 3PSIA 2OTJA 3K80C 4JOIA 4PZ8A 5BR8L 2ID0A 3RLFA 5IWAQ 2E2HH 4Y7NH 2AWOA 4LNQA 2AHOB 4B3MQ 2Y0SG 1XNRL 2JA7G 1E7ZA 1Z47A 1ASYA 2JQOA 3T1HQ 1VQ6A 1K0RA 4XIGS 4YHHQ 2R7ZG 3OYYA 4AIMA 3CP0A 1EWIA 2KHJA 4UP8A 2NN6I 1C7YA 4DV2L 3L2PA 1IBKL 3CD6A 3PUXA 1NTGA 5IP7G 3HOZG 2IHFA 1VQ9A 4LFAL 1HR0L 5JJKA 2H5XA 2Z6KC 5LMNW 4X66L 3A74A 2VQFL 2PQAB 1X56A 4R1JA 2VQFQ 5JEAJ 4DR3Q 4BBSH 4DUZL 4GS3A 2NN6G 5FLXc 2VQEQ 3H15A 4R4QA 4BY1H 4GOPA 4OWWB 1VQAA 2B29A 1VQ8A 4JYAL 3ULLA 3CC4A 2KENA 3HOUG 3PF5A 5C3EG 5C0XJ 4JI2Q 4P75A 3TS0A 1N33Q 4GKJQ 3PO3H 4JI1L 3BZKA 5ELOA 2Q2HA 4JI1Q 2ZM6Q 5LMUQ 2B63H 3M7NA 2PMZE 3B6YA 2NVTH 4NXNL 5JJIA 1EUJA 4PZ6A 5IYCH 1OTCA 1IXRA 3EN2A 3KDFA 2WAQE 3W5OA 4P72A 1N34Q 1GO3E 2ZTEA 1HZAA 4DV6Q 1U5KA 1XPRA 3HOVH 1OXUA 2YU9H 2HQLA 2VW9A 3K7AH 5IYBG 1TWAH 1XPOA 4LF5Q 3PIOA 4P71A 3I4MG 1TWCH 1X6OA 4DNIA 5C44G 1VQ5A 2F4VQ 1SMXA 2IY5B 1LUZA 4JI8L 4C3IH 2CWAA 1OXVA 4OXPA 4DR5L 1K73C 1XTDA 4LF9Q 2JA6H 3H3VH 1N9WA 5C4JH 4DR1L 1E24A 1QVGA 4IOCA 1B7YB 2I5HA 3TREA 4OX9Q 5M3MG 2JA7H 1YJWA 2BH2A 1PYSB 3FP9A 1EFWA 1X54A 2OQKA 1Q46A 3JC66 3K7UC 3S24A 3RZDH 4QL5A 3I7FA 1QVFA 2ZJPA 1QVCA 3S15H 4KLKA 4A4IA 2E2JH 2XTIA 3HKZG 4GNXA 2VZAA 1MKHA 2JK8A 2CWPA 2EIFA 4P74A 4DV0L 4GKKL 2UXDL 3HOZH 2UXDQ 3UDXA 3F2BA 4A3BG 4BXXH 4K0KL 3UDGA 1NMGA 3GTKH 1Z9FA 1PH9A 1HR0W 1WOCA 4AYBE 4KHZA 4R4OA 4DV5L 1VQPA 4X62Q 1PHJA 5LMNQ 2JA8G 2HIXA 4GLXA 4A3MG 1JJCB 1L0WA 2I5MX 4UY8C 1YHQA 1L1OA 2JA5G 1E1TA 3HOUH 4YCWA 3KYHC 4DUYL 4IPDA 1Q86C 1NE3A 4JI0Q 1VQHA 5C3EH 4HJ8A 1VQ4A 1EQQA 1E3PA 2VL6A 5FJ8G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BU2 A;  2QEX A;  1Q81 C;  4LF4 L;  3S17 H;  4TQU S;  4IPC A;  3RN2 A;  1PYB A;  4LUZ A;  1G51 A;  1TWG H;  4IOA A;  5JEA G;  1L2F A;  4EX5 A;  1VQL A;  3NEM A;  3I56 A;  1UE7 A;  1I50 H;  3J80 i;  2WFW A;  1RL2 A;  2IT1 A;  1C0A A;  4L5T A;  4TVA B;  1NY4 A;  3T1Y L;  2BA1 A;  4A3E H;  3SGI A;  1N8R C;  1PH8 A;  1XNQ L;  1XNQ Q;  4BBR G;  2YYZ A;  1MJC A;  3E9I A;  4POF A;  5IYB H;  2UUC L;  2UUC Q;  3K8A A;  3G6E A;  5AJ3 L;  2D62 A;  1EQR A;  4IPH A;  3A5Z B;  3UDI A;  5C44 H;  5M3F G;  4HJA A;  2E2I H;  1V9P A;  1GVP A;  3S1Q H;  3DLL A;  3W1G A;  1HH2 P;  2UXB Q;  1DGS A;  1WYD A;  4X64 L;  3UE1 A;  1PH7 A;  1YBY A;  3STB D;  4A3D G;  3G4S A;  3S1R H;  3GD7 A;  4DK3 C;  2L15 A;  4HIO A;  1M1K C;  5M3M H;  1HNX Q;  4BY7 G;  1GM5 A;  2YTY A;  1X55 A;  5ELN A;  2I5L X;  1T9H A;  4YWL A;  3GTG H;  4R4C A;  1UE6 A;  3PUW A;  3J7Z C;  2E5L L;  3M4O H;  1JB7 A;  4DV3 L;  4HJ9 A;  3ICE A;  1BBW A;  3E9H A;  3W1B A;  5BR8 Q;  1VQ7 A;  1K8A C;  4JOI C;  1VQG A;  3OTO L;  4A76 A;  1XNR Q;  4DKA C;  1KL9 A;  2HIV A;  2R92 G;  1J5E L;  2IX1 A;  3A5U A;  3KF6 B;  2QA4 A;  2UUB L;  1SRO A;  1S40 A;  4WJ4 A;  1IBL L;  3TRZ A;  4GN3 B;  1HNW L;  2R93 G;  4DV2 Q;  1IBK Q;  3GTP H;  4A3M H;  4GLV B;  4YWK A;  1VQM A;  4LFA Q;  3CME A;  2HHH L;  1HR0 Q;  2JA5 H;  4POG A;  5HGQ A;  3RR5 A;  2MFI A;  4DR6 L;  4X66 Q;  2LXJ A;  1E22 A;  2WAQ G;  4DV4 L;  4B3S L;  1ASZ A;  4DUZ Q;  1X65 A;  4C3J H;  1Q82 C;  4L5Q A;  4YY3 L;  5FJ8 H;  2RHQ B;  4NPS A;  4LFC L;  4JYA Q;  3U4V A;  2F52 A;  4PZ7 A;  2MO1 A;  4GOP C;  1QZH A;  1XJV A;  2UUA L;  3S1N H;  4X6A H;  1PH5 A;  4JBM A;  1A63 A;  1FVI A;  2Z0S A;  1YEZ A;  4DV1 L;  1IBM L;  3GTQ H;  1IBM Q;  4IFD J;  3J81 i;  1UEB A;  3CC2 A;  3CCV A;  1D7Q A;  1X3F A;  2WB1 E;  1J6Q A;  4NXM L;  3RNU A;  3ER0 A;  3JAM c;  1NMF A;  4BBR H;  1Q1B A;  2N49 A;  1QUQ A;  2CQO A;  1VQB A;  4RG1 A;  3PUY A;  4YCV A;  1FL0 A;  2YTX A;  3LGJ A;  4NXN Q;  1FGU A;  3PO2 G;  3GO5 A;  1R9T H;  4A93 H;  1YJN A;  5M5X H;  4LFB L;  5M3F H;  4JI6 L;  5GAD C;  4JC0 A;  1MJE A;  1EOV A;  2JE6 I;  5M5W H;  1UE5 A;  3HOX G;  4QQB X;  2Y0S E;  4X65 L;  4DR7 L;  4X65 Q;  4GOP B;  3CW2 C;  1Y1W H;  3BZC A;  1SR3 A;  1HJP A;  5IE8 A;  2OTL A;  1YNX A;  4A3D H;  4A3J H;  4GN5 A;  3FKI G;  5GAG C;  4JBK A;  3TEH B;  1YJ9 A;  1XMQ L;  4JI8 Q;  4AYB G;  4IPG A;  5J3B A;  1B8A A;  1BVS A;  1Q1E A;  4DR5 Q;  1U0L A;  1VQK A;  3VDY A;  1XPU A;  4DR1 Q;  3TS2 A;  2C35 B;  3CCE A;  4LF8 L;  4KHP L;  1XMO L;  2MQH A;  2D0P A;  4L5S A;  2UU9 L;  3CPF A;  4BA2 I;  1A0I A;  1NJI C;  3F1Z A;  3GDE A;  1FJG L;  2R7Z H;  2R92 H;  2E8G A;  1W3S A;  3KDF B;  2EXD A;  4LW1 A;  2VNU D;  4OON A;  1CUK A;  4LF6 L;  4DV0 Q;  1RIP A;  5IP7 H;  4GKK Q;  1VQD A;  4GNX C;  1K3R A;  2R7F A;  3M9B A;  3D31 A;  4K0K Q;  1VS0 A;  5K36 G;  4JV5 L;  3PV0 A;  2K14 A;  1VQI A;  1OXX K;  2NZO A;  4JCV E;  3ERS X;  2Q2T A;  4DV5 Q;  4LF7 L;  1Y1V G;  3G71 A;  1PH3 A;  4A3F G;  1JMC A;  2NVX H;  5IP9 G;  1VCI A;  2OQ0 A;  1V1Q A;  4DK6 C;  4DV7 L;  1CKM A;  4DV7 Q;  2A1A A;  4UP9 A;  3J7A 5;  4A3C G;  3F2C A;  3KOJ A;  4DUY Q;  4B3T L;  4B3R L;  1HNZ L;  4A3L G;  1HZC A;  2DGY A;  3HOW G;  3KF8 B;  1I6H H;  2KCM A;  5IY0 A;  4DR2 L;  1KIX A;  1N32 L;  1K9M C;  3S2D H;  1TWF H;  2DUD A;  4GNX B;  5FLM G;  2RCN A;  3I55 A;  3KJP A;  2PI2 E;  4DR4 L;  1KQS A;  4LF4 Q;  1WCM G;  3DM3 A;  1PH1 A;  4A3G G;  4IFD I;  4AQY L;  1PVO A;  1JT8 A;  3ZJY C;  1D8L A;  4A75 A;  3PO2 H;  2K75 A;  3JAM i;  2JEA I;  3PCO B;  3KJO A;  3HOX H;  4NB3 A;  1X3E A;  3T1Y Q;  1CKN B;  4DPG A;  4HID A;  4JI7 L;  1H95 A;  1Q12 A;  2UXC L;  4IFD G;  1AE2 A;  1GD7 A;  1EIF A;  3CQZ H;  2HT1 A;  2NVY H;  3FHW A;  3I4M H;  3FKI H;  4JBJ A;  4JI3 L;  5AJ3 Q;  4LF6 Q;  3HKZ E;  1SN8 A;  1I3Q H;  1GKH A;  3ULP A;  1I5F A;  1E1O A;  4X64 Q;  4JI4 L;  2K4K A;  3UDF A;  3AEV A;  1N36 L;  1KC8 C;  1YVC A;  1SLJ A;  1B70 B;  1YHA A;  1PH6 A;  3CCL A;  5EAY A;  4MZ9 A;  2F3I A;  3M4Q A;  2QGQ A;  2OCE A;  2E5L Q;  4JI5 L;  2ZJR A;  4DV3 Q;  5GAH C;  3WWV A;  1P16 A;  3AYH B;  2N3S A;  2VS1 A;  2JJQ A;  2VUM G;  4C3H H;  3OTO Q;  1G29 1;  4A3B H;  3RZO H;  3H3V I;  2NZH A;  1I94 L;  1J5E Q;  2PI2 A;  2UUB Q;  3U50 C;  3HFZ B;  1IBL Q;  2WB1 G;  4HIM A;  2KBN A;  2ZTC A;  4A3I G;  2JA8 H;  1HNW Q;  1Y1V H;  2MO0 A;  4HJ7 A;  2PQA A;  4A3F H;  1IL2 A;  3S1M H;  5IP9 H;  2YV5 A;  3CAM A;  1EYG A;  1LM0 A;  1JE5 A;  1O7I A;  2YTV A;  2CCZ A;  3MXN B;  2HHH Q;  3CPW A;  2D0O A;  4J15 A;  2JA6 G;  4YWM A;  4DR6 Q;  1CSP A;  4LWC A;  1LTL A;  4DV4 Q;  4B3S Q;  4A3L H;  4R4T A;  5IWA L;  3HOW H;  5C4X G;  3ULJ A;  4B3M L;  4A3K G;  4ME3 A;  1KD1 C;  4YY3 Q;  3T1H L;  1PV4 A;  4YHH L;  2I0Q A;  4LFC Q;  3I2Z A;  5GQO A;  5FLM H;  5HY6 A;  2UUA Q;  3GTJ H;  1WCM H;  3CC7 A;  4ALP A;  2ASB A;  1YIJ A;  4A3G H;  4PMW A;  3HOY G;  1BBU A;  2N8N A;  1OXT A;  4DV1 Q;  1Y14 B;  1C9O A;  4FDB A;  3PUZ A;  2Z6K A;  3A0J A;  4R4I A;  3U58 A;  3E0E A;  1NBW A;  4P73 A;  3UE0 A;  4NXM Q;  4IO9 A;  4BXX G;  5GRO A;  4BA1 I;  2B3G A;  4DR3 L;  3U4Z A;  3D0F A;  1WJJ A;  4GN4 B;  1MIU A;  5DLQ E;  2VQE L;  1M90 C;  4LFB Q;  2R7D A;  4JI6 Q;  2NVQ H;  4QIW E;  1VQE A;  1K8G A;  1VQN A;  2N78 A;  4OO1 I;  2AKW B;  1PA6 A;  4DR7 Q;  3L0O A;  2BH8 A;  4QY7 A;  1EIY B;  4JI2 L;  3PIP A;  3S2H H;  2MNA A;  4GKJ L;  2WP8 J;  4MNO A;  1IYJ B;  1N33 L;  4BY7 H;  3Q8D A;  1QZG A;  1WFQ A;  2LXK A;  5H1S E;  3J80 c;  2ZM6 L;  5LMU L;  2CKZ B;  1P8L A;  1XMQ Q;  4AH6 A;  1UE1 A;  3AFQ A;  4OWT B;  3RLO A;  4QGU A;  4OO1 G;  1KXL A;  3MEF A;  2K5V A;  1TWH H;  1X9N A;  1IZ6 A;  4LF8 Q;  3AQQ A;  4DAY B;  2VUM H;  4KHP Q;  1XMO Q;  2AMC B;  1QUQ B;  2AWN A;  1N34 L;  2K5H A;  2XGT A;  2UU9 Q;  2CFM A;  1FJG Q;  4A3E G;  2KCT A;  3L7Z C;  3PGZ A;  3RLN A;  4DV6 L;  4HIK A;  3RN5 A;  1VQF A;  4YCU A;  1A62 A;  4OWX B;  2ALY B;  2R93 H;  4A3I H;  4LF5 L;  1SRU A;  1TXY A;  3H0G G;  4C2M H;  5IT9 c;  2IX0 A;  2FXQ A;  1KAW A;  2R6G A;  4QJF A;  3HKS A;  2A8V A;  2F4V L;  4PG3 A;  5IYD G;  3I4N G;  3F2D A;  1YIT A;  1BKB A;  4LF9 L;  4JV5 Q;  3CXC A;  5C4X H;  3AFP A;  3BJU A;  1Q7Y C;  1Q8K A;  3CF5 A;  2K52 A;  4A3K H;  1SFO H;  2ZJQ A;  3PUV A;  4LF7 Q;  4OX9 L;  1YZ6 A;  3GTM H;  3NEL A;  1X3G A;  1L1O C;  3F8T A;  1WI5 A;  3CCU A;  1JJ2 A;  3M4P A;  1VQC A;  3HOY H;  4UPA A;  3NEN A;  4B3T Q;  1PH2 A;  1V43 A;  1HNZ Q;  4L5R C;  4B3R Q;  4Y52 H;  1G6P A;  3GTL H;  2JA9 A;  3M3Y H;  1S3O A;  4DR2 Q;  1CSQ A;  1N32 Q;  4HJ5 A;  4JBW A;  4DR4 Q;  4LUO A;  1HZ9 A;  5M5Y H;  4AQY Q;  2ZTD A;  3S16 H;  2LSS A;  4X62 L;  5LMN L;  1KRT A;  2KHI A;  1CKN A;  2GVB A;  4JG2 A;  3CCR A;  1AE3 A;  1S72 A;  2ES2 A;  4WJ3 M;  2K5N A;  4GLA C;  3OW2 A;  3G48 A;  4IJL A;  2RHS B;  3IRB A;  4XTC S;  4JI7 Q;  4JI0 L;  2GVA A;  2VY3 A;  3EBE A;  4BBS G;  1L1O B;  5E7N A;  2Q2I A;  4IJH A;  2UXC Q;  1PH4 A;  1OXS C;  2BA0 A;  3M85 A;  4MTN A;  4BY1 G;  3J81 c;  4JI3 Q;  1VQJ A;  1CKO A;  2K50 A;  2RF4 A;  3KFU A;  4RMF A;  2GN5 A;  4H02 A;  2OWO A;  3CMA A;  1AH9 A;  4APV A;  5C0X I;  2EQS A;  2PNH A;  4JI4 Q;  3STB C;  5GAE C;  1N36 Q;  1SE8 A;  3GTO H;  1VQO A;  3CCQ A;  3PO3 G;  1KRS A;  3KLW A;  3CCS A;  1LYL A;  4EQ5 A;  3J81 j;  5JJL A;  4DAM A;  4UP7 A;  3I4O A;  2B63 G;  1JJG A;  3K0X A;  3CCJ A;  4JI5 Q;  3TQY A;  3H0G H;  5IYC G;  2ATW A;  1A8V A;  1YHB A;  1PFS A;  3KF6 A;  5C0X G;  4A93 G;  2A19 A;  5IYD H;  2JEB I;  2V1C C;  3I4N H;  4O0A A;  1I94 Q;  3EIV A;  2UXB L;  3K81 C;  3HOV G;  3PF4 A;  1Y1W G;  3S14 H;  1YI2 A;  4A3J G;  1HNX L;  1UWV A;  1K83 H;  2IHE A;  1KHI A;  3NBH B;  4KI0 A;  3CCM A;  1W2B A;  4LUV A;  2Q2U A;  4O2D A;  4A3C H;  1HZB A;  3PSI A;  2OTJ A;  3K80 C;  4JOI A;  4PZ8 A;  5BR8 L;  2ID0 A;  3RLF A;  5IWA Q;  2E2H H;  4Y7N H;  2AWO A;  4LNQ A;  2AHO B;  4B3M Q;  2Y0S G;  1XNR L;  2JA7 G;  1E7Z A;  1Z47 A;  1ASY A;  2JQO A;  3T1H Q;  1VQ6 A;  1K0R A;  4XIG S;  4YHH Q;  2R7Z G;  3OYY A;  4AIM A;  3CP0 A;  1EWI A;  2KHJ A;  4UP8 A;  2NN6 I;  1C7Y A;  4DV2 L;  3L2P A;  1IBK L;  3CD6 A;  3PUX A;  1NTG A;  5IP7 G;  3HOZ G;  2IHF A;  1VQ9 A;  4LFA L;  1HR0 L;  5JJK A;  2H5X A;  2Z6K C;  5LMN W;  4X66 L;  3A74 A;  2VQF L;  2PQA B;  1X56 A;  4R1J A;  2VQF Q;  5JEA J;  4DR3 Q;  4BBS H;  4DUZ L;  4GS3 A;  2NN6 G;  5FLX c;  2VQE Q;  3H15 A;  4R4Q A;  4BY1 H;  4GOP A;  4OWW B;  1VQA A;  2B29 A;  1VQ8 A;  4JYA L;  3ULL A;  3CC4 A;  2KEN A;  3HOU G;  3PF5 A;  5C3E G;  5C0X J;  4JI2 Q;  4P75 A;  3TS0 A;  1N33 Q;  4GKJ Q;  3PO3 H;  4JI1 L;  3BZK A;  5ELO A;  2Q2H A;  4JI1 Q;  2ZM6 Q;  5LMU Q;  2B63 H;  3M7N A;  2PMZ E;  3B6Y A;  2NVT H;  4NXN L;  5JJI A;  1EUJ A;  4PZ6 A;  5IYC H;  1OTC A;  1IXR A;  3EN2 A;  3KDF A;  2WAQ E;  3W5O A;  4P72 A;  1N34 Q;  1GO3 E;  2ZTE A;  1HZA A;  4DV6 Q;  1U5K A;  1XPR A;  3HOV H;  1OXU A;  2YU9 H;  2HQL A;  2VW9 A;  3K7A H;  5IYB G;  1TWA H;  1XPO A;  4LF5 Q;  3PIO A;  4P71 A;  3I4M G;  1TWC H;  1X6O A;  4DNI A;  5C44 G;  1VQ5 A;  2F4V Q;  1SMX A;  2IY5 B;  1LUZ A;  4JI8 L;  4C3I H;  2CWA A;  1OXV A;  4OXP A;  4DR5 L;  1K73 C;  1XTD A;  4LF9 Q;  2JA6 H;  3H3V H;  1N9W A;  5C4J H;  4DR1 L;  1E24 A;  1QVG A;  4IOC A;  1B7Y B;  2I5H A;  3TRE A;  4OX9 Q;  5M3M G;  2JA7 H;  1YJW A;  2BH2 A;  1PYS B;  3FP9 A;  1EFW A;  1X54 A;  2OQK A;  1Q46 A;  3JC6 6;  3K7U C;  3S24 A;  3RZD H;  4QL5 A;  3I7F A;  1QVF A;  2ZJP A;  1QVC A;  3S15 H;  4KLK A;  4A4I A;  2E2J H;  2XTI A;  3HKZ G;  4GNX A;  2VZA A;  1MKH A;  2JK8 A;  2CWP A;  2EIF A;  4P74 A;  4DV0 L;  4GKK L;  2UXD L;  3HOZ H;  2UXD Q;  3UDX A;  3F2B A;  4A3B G;  4BXX H;  4K0K L;  3UDG A;  1NMG A;  3GTK H;  1Z9F A;  1PH9 A;  1HR0 W;  1WOC A;  4AYB E;  4KHZ A;  4R4O A;  4DV5 L;  1VQP A;  4X62 Q;  1PHJ A;  5LMN Q;  2JA8 G;  2HIX A;  4GLX A;  4A3M G;  1JJC B;  1L0W A;  2I5M X;  4UY8 C;  1YHQ A;  1L1O A;  2JA5 G;  1E1T A;  3HOU H;  4YCW A;  3KYH C;  4DUY L;  4IPD A;  1Q86 C;  1NE3 A;  4JI0 Q;  1VQH A;  5C3E H;  4HJ8 A;  1VQ4 A;  1EQQ A;  1E3P A;  2VL6 A;  5FJ8 G; 
#chains in the Genus database with same CATH topology
 1KNA A;  2R7Z B;  2R92 B;  3V2T A;  3K5O A;  4IOA A;  1CQF A;  1PYB A;  4LUZ A;  1HA5 A;  1TU2 B;  2J9G A;  4MN3 A;  5KNB A;  1VQL A;  5I9O A;  1UE7 A;  1I50 H;  1STN A;  3MXG A;  4TVA B;  2BA1 A;  3K6O A;  2A74 C;  3JAM E;  1XNQ L;  1RYS A;  3SEB A;  4BBR G;  2OF1 A;  3VA7 A;  4UCU A;  3V96 A;  5JH7 F;  2AGO A;  2CH4 W;  5AJ3 L;  4ZOL F;  4V0B A;  5M3F G;  4HJA A;  3K59 A;  1CE8 A;  1GSO A;  3GIM A;  5KFK A;  4U67 3;  1Q8I A;  1GVP A;  1WTP A;  2IA6 A;  3DLL A;  1T36 A;  2UXB Q;  4YBZ B;  1DGS A;  4XYO A;  2BR0 A;  1PH7 A;  3MXN A;  3STB D;  3GIQ A;  2BOS A;  3GD7 A;  4DK3 C;  2UXB H;  5M3M H;  1OO9 B;  1HNX Q;  4BY7 G;  4IRC A;  2MJ8 A;  4LSA A;  4X64 H;  4A2A A;  1HNX H;  1UE6 A;  3PUW A;  1JE4 A;  1BBW A;  3E9H A;  2X6L A;  4JOI C;  2E5L H;  1VQG A;  3OTO L;  2F0Q A;  2HIV A;  2IX1 A;  4HSV A;  3KUP A;  3KF6 B;  4H7B A;  2R7L A;  3HGB A;  2R3Z A;  1J5E H;  3GIL A;  1JQY D;  3QR8 A;  2ZDH A;  3I4M B;  2HCC A;  2K04 A;  4DXF A;  4MV8 A;  2BDN A;  4RKL A;  1HR0 Q;  2XIG A;  1S5E D;  5HGQ A;  3RR5 A;  1LT6 D;  4X66 Q;  1E22 A;  4DV4 L;  2G5D A;  1ASZ A;  2V4D A;  1F2Z A;  1VDZ A;  5M3M B;  2H1E A;  1BCP F;  4YY3 L;  1PTO H;  4JYA Q;  4GOP C;  2E2H A;  1E2W A;  1H9M A;  1XJV A;  1GHK A;  1S68 A;  1B53 A;  2K6A A;  1FVI A;  4RHS A;  1IBM L;  2R8K A;  4LFC H;  3D4W A;  2UUA H;  3OMG A;  1CTM A;  4ZHQ F;  2AGP A;  4YR2 A;  5FD5 A;  1PTO C;  1X3F A;  4G3I A;  2QW7 A;  5JVH 3;  1ULZ A;  3DHQ A;  1NMF A;  1Q1B A;  2N49 A;  4FXK C;  3PUY A;  4NXN Q;  2JA8 B;  3ETJ A;  1SND A;  4A3F B;  4JI6 L;  1LAC A;  3JSN A;  1H9K A;  4NXN H;  1L2Z A;  1LO5 D;  2AQ4 A;  1B3Q A;  2JE6 I;  4DF7 A;  3HOX G;  4XX0 B;  2D2C C;  2Y0S E;  1BJT A;  1JKJ B;  4DR7 L;  4GOP B;  3CW2 C;  4YAJ B;  1YNJ D;  4A3D H;  1DZ1 A;  4RNN A;  3FKI G;  1KLG D;  3R2I A;  5HBR B;  3V6J A;  1SNC A;  4EYH B;  1H9S A;  2FB9 A;  1FR3 A;  3GTJ B;  1WCM B;  1W6J A;  1C3O A;  1U0L A;  1AFP A;  4LF8 L;  2RCF A;  1EWC A;  3F1Z A;  4PQX A;  1IOV A;  3EYY A;  3FMC A;  2E8G A;  3KAK A;  2EXD A;  5KNC A;  2VNU D;  3VYT A;  1FJG H;  2F0G A;  1JR0 D;  1LV9 A;  4DK0 A;  5IP7 H;  1Y1W A;  1BXT A;  4LMY A;  5M9O A;  5KT4 A;  4O2A F;  3KHH A;  1VS0 A;  4KJO A;  4JCV E;  1TWC A;  4YJ3 F;  2IJ0 A;  4C1N K;  3ERS X;  2Q2T A;  1QG7 A;  3ND8 A;  2NN6 H;  3S2H B;  2VOB A;  1Y1V G;  2UVV A;  4RU9 A;  3M9N B;  1DJR D;  5KYI A;  2KOL A;  3OUU A;  4H13 C;  2F0T A;  1RCV D;  5IT9 W;  2OQ0 A;  4J6H A;  4DK6 C;  3VYR A;  4JV2 A;  2XRQ D;  4UP9 A;  2Y0S A;  4DUY Q;  4B3R L;  2K5W A;  2F1M A;  4OHJ A;  4DUY H;  2EE1 A;  5IY0 A;  4F87 A;  1N32 L;  3GV6 A;  2PI2 E;  4K8J A;  4LF4 Q;  1PH1 A;  4A3G G;  4IFD I;  1JT8 A;  1M8A A;  4A3I B;  4LF4 H;  2CZG A;  4MV6 A;  4A75 A;  3PO2 H;  1HHV A;  5FPR A;  2F0U A;  2FPG B;  2W6O A;  3JAM i;  2E74 C;  3KJO A;  3T1Y Q;  4JK1 C;  2G9D A;  4DGZ A;  4DPG A;  4JI7 L;  3PN1 A;  2FIN B;  1Q12 A;  3FRP B;  3T1Y H;  5C4X B;  3CQZ H;  1SE3 A;  3PMF A;  4WD3 A;  5DGA A;  4A3K B;  2CQY A;  1NSN S;  4JBJ A;  4LF6 Q;  2AGQ A;  3HKZ E;  2VR1 A;  2SEB D;  4MA0 A;  1GKH A;  1ZKO A;  4BWG B;  4HTH A;  2ENB A;  5HV6 A;  1SYB A;  4LF6 H;  4JI3 H;  2YRX A;  3O13 A;  1WSC A;  4Z9C B;  2K4K A;  5EPL A;  1SNM A;  1WR2 A;  2I8C A;  1SLJ A;  1B70 B;  1K8O A;  2BDO A;  3TP5 A;  3HB9 A;  3LWB A;  2K01 A;  3FDS A;  5IYZ F;  4ECQ A;  1SJH D;  3IN5 A;  5J1Z A;  4WFN 3;  1S0M A;  5IOC A;  4A2B A;  4I7A A;  2O4X A;  3ETH A;  1P16 A;  2GLT A;  4CKC A;  2VUM G;  4JI5 H;  1ZHQ A;  1DON A;  2XD4 A;  3WOE A;  4HNU A;  2PI2 A;  4YJ2 F;  5BMV F;  4EQO A;  2E2I A;  5FO7 B;  4O4H F;  1IBL Q;  3H4D A;  4HIM A;  1NAP A;  5ELD A;  4YIJ A;  1HNW Q;  4IHJ F;  4TQS A;  1I94 H;  1I3Q A;  3BJY A;  5IP9 H;  2YV5 A;  1EYG A;  4MV3 A;  1IBL H;  2YTV A;  1JE5 A;  1O7I A;  1BF4 A;  4JVZ A;  3CPW A;  2W6P A;  5CB4 F;  4DR6 Q;  2Q8I B;  3TP8 A;  3QOJ A;  4B3S Q;  4A3L H;  3FEW X;  4DR6 H;  4EFB A;  1JOK A;  4KHV A;  4B3M L;  2K7V A;  4ME3 A;  3H4B A;  4YHH L;  4APM A;  3HKZ A;  3I2Z A;  4KTA A;  5FLM H;  5HY6 A;  5EWF A;  1MBY A;  2J4X A;  5KG3 A;  5JEA H;  3HOY G;  1OXT A;  5C1P A;  4DV1 Q;  1C9O A;  1STG A;  1KNE A;  2YZN A;  4BXX G;  2BQU A;  2L4N A;  2B3G A;  5G3L D;  1E4F T;  3WNZ A;  3U4Z A;  1T5E A;  5KGU A;  4X3U A;  1WJJ A;  2VQE L;  3KTM A;  4QUC A;  1K83 B;  1KAA A;  4QIW E;  1SYD A;  3HXL A;  3RFC A;  2AKW B;  2F0F A;  3QWN A;  1G91 A;  1PA6 A;  3MR3 A;  1F2M A;  1A2T A;  2MHV A;  3MR5 A;  4XDX A;  1VMP A;  4Y7N B;  2OLS A;  4MNO A;  1QIL A;  3QOL A;  4UDU C;  3R93 A;  1WFQ A;  4G7O C;  3SR1 A;  4PMC A;  2ZM6 L;  1STB A;  5LMU L;  5GON F;  3VR2 A;  1KXL A;  3P1H A;  4OWT B;  4RGO S;  3H20 A;  3V4Z A;  2K5V A;  1X9N A;  1IZ6 A;  1JIH A;  1IW7 C;  4DAY B;  3TIN A;  1XMO Q;  1TT2 A;  5KND A;  1N34 L;  1RTN A;  1U4P A;  2XGT A;  2UU9 Q;  2F4I A;  1R9T A;  1SYC A;  1VQF A;  2UU9 H;  4RGN A;  4F4W A;  4XT1 B;  2Z6B A;  2R93 H;  1TXY A;  3H0G G;  4C2M H;  2VA2 A;  2IX0 A;  5KFX A;  1KAW A;  3HKS A;  4V19 0;  1PMR A;  2KEC A;  4LF5 H;  2UVU A;  2DZD A;  1BKB A;  4LF9 L;  4JV5 Q;  2H4O A;  3T16 A;  3BJU A;  4R8N A;  5KFF A;  2K52 A;  1SFO H;  1GHJ A;  3PUV A;  2OH2 A;  1BBX C;  2SCU B;  4QIW A;  1E2V A;  1X3G A;  5LXT F;  3N42 B;  3F8T A;  1WI5 A;  4ED8 A;  3CCU A;  2B63 B;  1JJ2 A;  3M4P A;  2NVT B;  2R92 A;  3J7A K;  1B6R A;  1BXR A;  1KC7 A;  2JA9 A;  2VQD A;  3M3Y H;  4YR0 A;  4JBW A;  4U68 A;  1I4P A;  4DR4 Q;  3HOV B;  4LUO A;  1HZ9 A;  2JEI A;  4GZY C;  4AQY Q;  3NP8 A;  2ZTD A;  3TBI B;  5JOB A;  4X62 L;  5LMN L;  4JG2 A;  2WAQ A;  4ECU A;  4GLA C;  2B39 A;  2PZU A;  3G48 A;  4IJL A;  1Y8N B;  1DCZ A;  1NR4 A;  3IRB A;  5KFT A;  3EBE A;  2R7N A;  5L9X A;  2RKS A;  5C4J B;  1PH4 A;  4RCO A;  3KLS A;  1SFO B;  5DQI A;  3M85 A;  4MTN A;  4JI0 H;  1STE A;  5D1O B;  2F0L A;  1HCZ A;  4EGQ A;  1CA5 A;  2AQ1 B;  4LMQ D;  4ECT A;  3G7L A;  1QCB D;  2RDJ A;  4C5A A;  2OWO A;  2XIW A;  1AH9 A;  4APV A;  5C0X I;  1LTR D;  2E2J B;  3CVZ A;  3STB C;  4Q5V A;  5EZY F;  4EFE A;  2BQR A;  5GAE C;  3CRL C;  3OPO A;  3HEJ A;  2VB2 X;  1KRS A;  3J81 j;  2W9A A;  4ME6 A;  2ATL A;  1E2Z A;  3DUZ A;  4UP7 A;  3GTK B;  1JJG A;  3CHB D;  3RB4 A;  3OIQ A;  4X3K A;  3KF6 A;  4BS9 A;  2K5Q A;  2A19 A;  3R3O A;  5IYD H;  1ONL A;  3I4N H;  3ND9 A;  3K3V A;  2FLN A;  5D14 A;  2R61 A;  3NHH A;  2UXB L;  3K81 C;  3MR6 A;  1T5X D;  2D5D A;  1LTA D;  5C3E B;  3S14 H;  1HNX L;  2IHE A;  2YCH A;  3CCM A;  1W2B A;  4C3I G;  4J9M A;  2Q2U A;  4A3C H;  5BN4 A;  3M4Y A;  1UAP A;  4J9Q A;  1TWG B;  3PSI A;  4JOI A;  4DAP A;  2KHS A;  5IWA Q;  3P75 A;  2E2H H;  1VQ6 A;  5IWA H;  4XIG S;  1EWI A;  3SK5 A;  2KHJ A;  1DOK A;  2JXM B;  3SDZ A;  5EKI A;  2KCN A;  1D1I A;  3PUX A;  5IP7 G;  5EPJ A;  2DNC A;  1HR0 L;  5JJK A;  5C5J A;  4X66 L;  2VQF L;  2PW7 A;  5FO8 B;  4DR3 Q;  1TQO A;  4UCV A;  4FNF A;  2CW0 D;  2NN6 G;  5FLX c;  4DR3 H;  5I4D A;  4GOP A;  2A6H D;  3DF7 A;  4OWW B;  1WTQ A;  2A6E D;  1VQ8 A;  4JYA L;  2R85 A;  3LP8 A;  2B8G A;  4Q43 A;  4DLK A;  2EYJ A;  1YNJ C;  5C0X J;  4JI2 Q;  3GTJ A;  1WCM A;  1JOR A;  1N33 Q;  3N52 A;  2W6Z A;  3PO3 H;  2F0D A;  4JI2 H;  2EY6 A;  4B08 A;  2ZXR A;  1N33 H;  2IBK A;  5I9P A;  4ZCK A;  5DLG A;  3FPP A;  3M7N A;  4HMI A;  3PQI A;  4NXN L;  1EUJ A;  5IYC H;  2L11 A;  3GTP B;  3A54 A;  1EY4 A;  2IPK D;  4ZI7 F;  1GO3 E;  2ZTE A;  4KV6 A;  4EBC A;  1HZA A;  1U5K A;  5CBE E;  1OXU A;  4QWE A;  3D3R A;  4K2L A;  1XPO A;  3T5H A;  3PIO A;  4CHT B;  1TWC H;  1X6O A;  5KT3 A;  1II3 A;  1VQ5 A;  2F4V Q;  1SMX A;  3IKJ A;  5ELC A;  5KFS A;  2JA6 H;  1RK6 A;  4ED2 A;  3S1N B;  5FPO A;  1K28 A;  4RFB A;  3EJI A;  4EVO A;  4IUV A;  1BGW A;  4O3S A;  1FYC A;  2VUG A;  4NKL A;  1GUW A;  1GOZ A;  1EFW A;  1X54 A;  2OQK A;  3JC6 6;  3VPD A;  5A2Q E;  2R84 A;  4BBR B;  3BAB A;  1QVC A;  4U7C A;  1STA A;  3S15 H;  1RTO A;  2XTI A;  2VZA A;  4A93 B;  4L63 B;  1A6X A;  3HOZ H;  5M3F B;  2AQ2 B;  5EOY A;  2WB1 A;  2C2E A;  4GKK H;  1JWU D;  4CDC C;  2CH4 A;  4EGV A;  3Q24 A;  1Y1W B;  1PH9 A;  4HNT A;  4IR1 A;  5CA0 F;  3D4R A;  5KX5 F;  4GLX A;  4A3M G;  1JJC B;  2I5M X;  4OEL B;  2F0E A;  3SE0 A;  2CW7 A;  2JA5 G;  1D5X C;  4DV5 H;  3OSO A;  2MGS A;  4RGM A;  3HOU H;  4XYQ A;  4KD3 A;  4DUY L;  2DY8 A;  1EQQ A;  4MIU A;  2KA7 A;  5FLX E;  4C3J G;  4HQ6 A;  2W70 A;  5FJ8 G;  3BU2 A;  2HGS A;  1Q81 C;  3BZD B;  4LF4 L;  3S17 H;  3M7G A;  4TQU S;  1G51 A;  5KFL A;  5JEA G;  1VAJ A;  4EX5 A;  4O42 A;  1J9O A;  3I56 A;  4R8U A;  4JUZ A;  1GUG A;  2FE3 A;  4IWX A;  2LY7 A;  2PYK A;  3T1Y L;  3NTH A;  1O75 A;  3A55 A;  1ET6 A;  1YNN D;  5NUC A;  2UUC L;  4YAK B;  2WV6 D;  4LF6 L;  3UDI A;  5C44 H;  2E2I H;  3BAA A;  1AZP A;  5FD6 A;  3W1G A;  2QK4 A;  3FMA A;  4DL5 A;  1WYD A;  3NBH A;  1G2S A;  3NQT A;  3S1R H;  2L15 A;  2IL8 A;  5C3X A;  4Y8V B;  3C2P A;  3A8J E;  1TS3 A;  2YTY A;  1X55 A;  1GM5 A;  1S4Z A;  4YWL A;  2AU0 A;  3E0J A;  5KT7 A;  3AMU A;  2L5T A;  2NB0 A;  1KJI A;  1JB7 A;  3MWM A;  2WYO A;  3ICE A;  3W1B A;  3C1E A;  1AUX A;  3Q0A A;  1PXU A;  3DWP A;  1XNR Q;  1R4P B;  4DKA C;  1KL9 A;  3R8B A;  3HOX B;  1DIK A;  2QA4 A;  1EZ8 A;  4WJ4 A;  1IBL L;  1HNW L;  2R93 G;  4DV2 Q;  3JZI A;  2NVY B;  1VQM A;  1CA6 A;  3FKI B;  3MA2 B;  4RAY A;  4LFA Q;  3CME A;  4ECR A;  4DV2 H;  2Z1C A;  4O1N A;  1EQV A;  1I3Q B;  4DR6 L;  2LXJ A;  1K83 A;  4B3S L;  2HHH H;  2TSS A;  3K5L A;  3RUP A;  1X65 A;  1SYX B;  5IT9 L;  2L9H A;  1Q82 C;  4L5Q A;  5LYJ F;  5H80 A;  4NPS A;  2EYO A;  4HN7 A;  3U4V A;  4Q0F A;  1QZH A;  2Z9H A;  4F4Y A;  2Z0S A;  4DV1 L;  4X3T A;  2L0C A;  1UEB A;  3EVQ A;  4QWD A;  1B4O A;  1D7Q A;  3BS1 A;  3RZO B;  3T56 B;  3ER0 A;  3JAM c;  4IAL A;  4DAY A;  4E6I A;  1UNN C;  1KJ8 A;  2YS6 A;  3RGX A;  1VQB A;  4YCV A;  2EXZ A;  5C0X H;  3OW7 A;  1Y1V B;  1R9T H;  3S1M B;  5M5X H;  4JC0 A;  4ZYS A;  4DL4 A;  2QKI C;  1EOV A;  5M5W H;  3M9O B;  4X65 L;  3RBE A;  5CV7 A;  1YNX A;  4LK1 C;  4KKU A;  1STH A;  3K3P A;  1Y8O B;  4JBK A;  2CHB D;  3GTQ A;  4IR9 A;  1YJ9 A;  1VBG A;  1TAE A;  4JI8 Q;  4AYB G;  4DR5 Q;  4A3G B;  5JUM A;  1W93 A;  1XPU A;  2C35 B;  2B2U A;  3TP6 A;  1XMO L;  2B63 A;  3DXJ C;  3RUZ A;  3GV3 A;  2UU9 L;  3CPF A;  1A0I A;  3OMC A;  2R7Z H;  2R92 H;  4IUN A;  4HMJ A;  1MZB A;  5KFD A;  3KDF B;  4LW1 A;  3A8K E;  3S9W A;  4Q44 A;  1AZQ A;  1RIP A;  5M5X B;  4RUA A;  2J6U A;  4C3H G;  3MWD A;  2R7F A;  2NVQ B;  2GPS A;  3GID A;  3IFT A;  2ZXP A;  4JV5 L;  2R8H A;  3PV0 A;  2K14 A;  4MTD A;  4F4X A;  4OGQ C;  2RA4 A;  1NCV A;  1ESR A;  3DM1 A;  4OL7 A;  1PH3 A;  1VCI A;  3K5I A;  3GIK A;  3X3M A;  1Z2P X;  3PR5 B;  2F0O A;  1CZG A;  3Q6S A;  4LF7 H;  1V1Q A;  3HBL A;  2YL2 A;  4F4Z A;  1CKM A;  4DV7 Q;  2JA7 A;  3J7A 5;  4A3C G;  5D1O A;  3Q8R B;  2OT2 A;  3TQ1 A;  3HOW G;  4DV7 H;  4K5V A;  2KCM A;  2VUM B;  5DQG A;  4KN7 C;  4PV1 C;  5C5M A;  5C4Z A;  3KJP A;  2W71 A;  4DR4 L;  2EZV A;  2PO4 A;  4DR2 H;  4AQY L;  3ZJY C;  3VR4 A;  3N41 B;  4C56 C;  1EZ6 A;  2NBF A;  3GTK A;  2K75 A;  2PMZ B;  2BE5 D;  1X3E A;  5EJW A;  1B6S A;  2ICI A;  3I8Z A;  2WAQ B;  4IFD G;  1GD7 A;  1EIF A;  3T5J A;  3I4M H;  2LKV A;  2W9C A;  3WOF A;  1SN8 A;  3G6Y A;  5KFJ A;  3ULP A;  5JVG 3;  3HOY B;  4X64 Q;  5G3L F;  1O7L A;  1KC8 C;  1YVC A;  3GTL B;  1TWG A;  1ZXT A;  5EAY A;  1B33 N;  5KFB A;  1NUC A;  1SYF A;  4PNY A;  1CM9 A;  1N36 H;  1SMY D;  1AN7 A;  4M8A A;  2FLL A;  5M5Y B;  2E5L Q;  2EVB A;  5KT5 A;  2ZJR A;  5GAH C;  3S16 B;  5JPN C;  2P0A A;  5F9N A;  2VS1 A;  2JJQ A;  3OOC A;  3NTI A;  1J5E Q;  1HFG A;  2M05 A;  4O4I F;  2UUB Q;  1PZI D;  2EY2 A;  2KBN A;  2ZTC A;  2JA8 H;  2IP4 A;  4XZ3 B;  4HJ7 A;  1F9Q A;  2UUB H;  4A3F H;  2XGQ A;  3CAM A;  1LM0 A;  3OWE B;  2V9W A;  4K14 A;  4G7Z C;  5KIX A;  2XRS D;  1PFM A;  2GA4 B;  2JA6 G;  1SCU B;  3QZ8 A;  5IWA L;  4CC6 A;  2E76 C;  1EY9 A;  2CW0 C;  2QEJ C;  1KD1 C;  1ZQ7 A;  4EG0 A;  3GV7 B;  4IRK A;  2A6H C;  1PV4 A;  3EFX D;  2I0Q A;  5KFY A;  4LFC Q;  2A6E C;  5GQO A;  4NLG A;  3WDN A;  1RHP A;  4ZRZ A;  3GTJ H;  1WCM H;  2UUA Q;  4PMW A;  2EJG C;  2N8N A;  5LL6 X;  2L12 A;  3H0G B;  3MR2 A;  1JOQ A;  3A0J A;  3E0E A;  2X6G A;  4ZUJ A;  4IO9 A;  3GV5 B;  5GRO A;  1C48 A;  3SXH A;  3GTP A;  4XYM B;  2K05 A;  4DR3 L;  1STY A;  5ISR A;  1I4G A;  4GN4 B;  1MIU A;  3W3A A;  5DLQ E;  1M90 C;  4PDB A;  5AFW A;  4LFB Q;  1VQN A;  4OO1 I;  1SSO A;  1V1P B;  4KKS A;  4LFB H;  3TME A;  3PIO 3;  1S9F A;  2BH8 A;  4JI2 L;  3S2H H;  2MNA A;  3VPB A;  3KAL A;  1N33 L;  2MPM A;  3Q8D A;  4QUF A;  2LXK A;  3J80 c;  2EY5 A;  1UE1 A;  3AFQ A;  3RLO A;  1JWM D;  4O2B F;  4B9W A;  4G57 A;  2ZDQ A;  3P7J A;  5CMD A;  4KY7 A;  3AQQ A;  3KLS X;  4KHP Q;  2AMC B;  4CJ1 B;  2NWG A;  2K5H A;  2CFM A;  1FJG Q;  3Q8Q B;  5L1I A;  2KCT A;  3I73 A;  2KCC A;  3RLN A;  2RQX A;  2N55 A;  2NTS A;  1SJE D;  2ZXO A;  3EPI A;  3MTS A;  4OWX B;  4A3I H;  2L55 A;  5BPF A;  4J9K A;  4QJF A;  3SK8 A;  2A8V A;  2F4V L;  3PVX A;  3F2D A;  2PPB C;  1Z2O X;  2RSN A;  1KLU D;  5C4X H;  2CVR A;  4A3K H;  3E5S A;  1CZW A;  3H3V C;  4J9P A;  1TWH A;  3KF8 A;  1M4V A;  1B50 A;  2JP1 A;  3KXY T;  4IUU A;  2C28 A;  4B3T Q;  4LAA A;  4ZUI A;  1HNZ Q;  1V43 A;  2W57 A;  4B3T H;  1CSQ A;  1HNZ H;  5JAV A;  5KFV A;  2IMW P;  2WB1 B;  3K7A B;  2LSS A;  4R7R A;  1KRT A;  2KHI A;  1CKN A;  4QW9 A;  3R5F A;  1PZJ D;  3OW2 A;  4ZQ3 A;  4DN4 M;  4C3I B;  4C5B A;  3RB3 A;  4XTC S;  4BBS G;  2VY3 A;  5EWE A;  5DG7 A;  2Q2I A;  1YNN C;  2EYH A;  5DM7 3;  1WTX A;  4BY1 G;  3LML A;  3J81 c;  4JI3 Q;  3BVM A;  3T13 A;  3RZD B;  3KFU A;  4IWY A;  2ZT9 C;  4H02 A;  1RJP A;  5HUR A;  2PNH A;  2DIK A;  5KT2 A;  1LTG D;  2XN9 C;  3T5K A;  1CK1 A;  1SE8 A;  3UI2 A;  3CCS A;  3J80 E;  3X3N A;  4EQ5 A;  2N88 A;  3Q8P B;  4RB0 A;  4R8U B;  5KYL A;  2EYM A;  1F9P A;  3I4O A;  3I3C A;  3CCJ A;  4JI5 Q;  3TQY A;  3BYY B;  5C0X G;  1YHB A;  1M0T A;  1TS5 A;  2V4Q A;  3VR3 A;  2V1C C;  5K36 H;  4O0A A;  1I94 Q;  2NVY A;  3EIV A;  5I2X A;  3PF4 A;  4TRD A;  3FKI A;  4G7H C;  1B44 D;  3BG5 A;  1YI2 A;  1K1Q A;  3I12 A;  1UWV A;  1K83 H;  2B8F A;  1B9N A;  3NBH B;  4LUV A;  4M7E A;  2HVQ A;  1HZB A;  3K57 A;  2OTJ A;  3E6Z X;  2PQE A;  2HDM A;  3RLF A;  2HQE A;  4Y7N H;  2AWO A;  5IGC A;  5JVL A;  1CHP D;  2AHO B;  2A68 D;  2EJF C;  1XNR L;  4RUC A;  2XSC A;  1ASY A;  1M7J A;  5BR8 H;  1K0R A;  2SOB A;  5J22 A;  2F0K A;  4A3E B;  2R7Z G;  2BQ3 A;  2ASD A;  2O5I C;  4RNO A;  3A7A B;  5CV4 A;  3J7A F;  1SNO A;  4DV2 L;  3WO1 A;  3L2P A;  5FKA C;  4IRD A;  1DXM A;  2W8K A;  1T94 A;  2IHF A;  1VQ9 A;  4LFA L;  2H5X A;  2Z6K C;  3MXP A;  1IYU A;  3S1Q B;  1Y1V A;  2R6F A;  3A74 A;  4R1J A;  2OEO A;  4MA5 A;  1L0Y B;  4ECY A;  3LWU A;  4I7H A;  1LT5 D;  1VQA A;  3ULL A;  1CFM A;  2OXP A;  1CQI B;  3NQI A;  3BVG A;  1EY5 A;  4GKJ Q;  3J81 E;  5CV6 A;  1ILP A;  1CS0 A;  4JI1 L;  4RB3 C;  5C1O A;  3BZK A;  2Q2H A;  1AUV A;  4GKJ H;  4FBT A;  1A3T A;  3IFD A;  3L3O C;  2B63 H;  2PMZ E;  3B6Y A;  2FMA A;  2NVT H;  3W2D A;  5JJI A;  1KDB A;  3PR4 A;  5JVD F;  3KDF A;  2WAQ E;  4A3M B;  2B2U C;  2W8L A;  2JA5 B;  3MXU A;  3WO0 A;  4DV6 Q;  1XPR A;  3HOV H;  2W6M A;  2HQL A;  2LMC B;  3NGD A;  4LF5 Q;  2YW2 A;  4DK1 A;  4DV6 H;  3JAM W;  4C3J B;  5EKL A;  4CDE C;  3I4M G;  1EUC B;  5EDW A;  4ILW A;  1LUZ A;  4JI8 L;  2DWC A;  4DR5 L;  4OXP A;  5C4J H;  3GTQ B;  5KFQ A;  1E24 A;  1KAB A;  2XCP A;  3SK4 A;  4IOC A;  4OX9 Q;  3HS0 C;  5M3M G;  2JA7 H;  4CC5 A;  2BH2 A;  4DR1 H;  1EU3 A;  2PNR C;  1EIG A;  3K7U C;  3S24 A;  4OX9 H;  5J2U F;  2ICE C;  4QL5 A;  1QVF A;  2VUM A;  2ZJP A;  5E4X A;  2E2J H;  4QF4 A;  4EYI B;  2A69 D;  2CWP A;  3PW4 A;  4P74 A;  2UXD L;  3R2T A;  4BWS C;  3F2B A;  5EPK A;  4QW8 A;  5EGT A;  5DGB A;  1SAP A;  1Z9F A;  3GTK H;  3R5H A;  2PMZ A;  4K0K H;  4R8I A;  1Y69 U;  4KHZ A;  4A3J B;  2K5D A;  1PHJ A;  2E75 C;  2JA8 G;  5DLF A;  4K6L A;  3GV8 B;  1GUN A;  4JI0 Q;  1GUT A;  1U4M A;  5C3E H;  1VQ4 A;  1E3P A;  2JA7 B;  2VL6 A;  2XWB B;  2WIN B;  4HCE A;  2QEX A;  3NWT A;  2VA3 A;  1XX8 A;  4OO1 H;  4ECV A;  1UC9 A;  4IPC A;  5KFH A;  4I65 A;  3GTL A;  1TWG H;  2F0I A;  1L2F A;  3ONA B;  1B3A A;  3J80 i;  2W7O A;  2IT1 A;  4L5T A;  3ZYY X;  2G9H D;  1N8R C;  1PH8 A;  4FF4 A;  3SGI A;  3NWS A;  3CRK C;  1XNQ Q;  2ZDG A;  2YYZ A;  1U4R A;  1MJC A;  3E9I A;  4POF A;  2X69 A;  5IYB H;  1XNQ H;  5C8Y F;  1WTH A;  3K8A A;  3G6E A;  2D62 A;  1HUN A;  1SNP A;  1QNU A;  5KFC A;  4J1M A;  3JSL A;  4EQP A;  4OEM B;  1HH2 P;  4ETS A;  4X64 L;  4A3D G;  4O4L F;  1YBY A;  2W9C B;  4QB4 A;  3G4S A;  1M1K C;  5I6W A;  1I6H B;  4MV4 A;  4RWS C;  2R8I A;  2QIL A;  5ELN A;  1MD2 D;  1TWF B;  2B2Y A;  2I5L X;  3N6R A;  3KBG A;  4IUQ A;  3S2D B;  2EYF A;  2KED A;  1I7L A;  2ALZ A;  1KJJ A;  3J7Z C;  2E5L L;  1EUD B;  1XXG A;  4HJ9 A;  3BDC A;  1W6K A;  1GJX A;  1K8A C;  4A76 A;  3L4J A;  1XDN A;  3H0G A;  1J5E L;  2UUB L;  3Q23 A;  1SRO A;  2HUG A;  2C2R A;  1SE2 A;  3TRZ A;  4HYK A;  3OHX C;  5EBC A;  1IBK Q;  3GTP H;  4GC7 A;  4ED0 A;  5D65 A;  4MV1 A;  2EDG A;  1IBK H;  5C3W A;  3N43 B;  1ENC A;  1S0O A;  5TSS A;  1EOT A;  1RK5 A;  4DUZ Q;  1V1P A;  1M0W A;  5KG6 A;  1I4Q A;  1A9X A;  1KDA A;  2RHQ B;  3I91 A;  2RBM A;  4LFC L;  4DNT B;  2NU6 B;  4YB8 B;  4O3Q A;  4DUZ H;  2PZW A;  2F52 A;  4PZ7 A;  2MO1 A;  2NTT A;  5L37 A;  2UUA L;  2IW3 A;  3S1N H;  1GSH A;  1PH5 A;  2A73 B;  1BQQ T;  4MTK A;  1QJO A;  5KFU A;  2JEJ A;  1IBM Q;  3J81 i;  3RV4 A;  2FMC A;  3TIG A;  4A3B B;  4C3H B;  1PFN A;  1IBM H;  2WB1 E;  1SNQ A;  1J6Q A;  3NTK A;  3OSN A;  4BBR H;  2B2W A;  1I4R A;  2CQO A;  1FL0 A;  2MUY A;  2YTX A;  4TV9 F;  3J7A V;  1FGU A;  3Q22 A;  3PO2 G;  3GO5 A;  1U4L A;  4A93 H;  1YJN A;  4LFB L;  5M3F H;  5GAD C;  1EEI D;  1MJE A;  1X3P A;  2QDL A;  4QQB X;  1UE5 A;  4F88 A;  1Y1W H;  3I72 A;  1O7Y A;  1FNW A;  3HOW B;  4EBD A;  3PW2 A;  4DR7 H;  1PTO D;  5GAG C;  2F3V A;  3GQB A;  2DPI A;  1SE4 A;  5J3B A;  1B8A A;  1GYF A;  1Q1E A;  2FFK B;  2W6Q A;  4IN3 A;  3K58 A;  3CCE A;  4KHP L;  5DAU A;  2MQH A;  1AN8 A;  2D0P A;  2O03 A;  2Z4I A;  1NJI C;  3GDE A;  4CJ0 B;  1FJG L;  1I6U A;  1MSG A;  2YZM A;  4G4K A;  4MV9 A;  4OON A;  1KBL A;  5KG2 A;  4FF1 A;  4DV0 Q;  4GKK Q;  2Z4H A;  4J0M A;  5HGT A;  1SBB B;  4DV0 H;  5K36 G;  5DM6 3;  3OHA A;  1PK8 A;  1VQI A;  3BG3 A;  3MWE A;  4KY5 A;  4DV5 Q;  3G71 A;  4BY7 B;  5IP9 G;  3BQ2 A;  3Q8S B;  5C4H A;  4O3R A;  4RB1 A;  4TKO B;  4ED1 A;  4L8J A;  3F2C A;  3KOJ A;  4B3T L;  5F9L A;  1HNZ L;  1L0X B;  1HZC A;  1Y8P B;  1TWH B;  3KF8 B;  2F0P A;  4F7X A;  4A3L G;  1IKM A;  2EOT A;  4FVM A;  1KIX A;  2DUD A;  5FLM G;  2RCN A;  3I55 A;  1EYA A;  5T1I A;  1KQS A;  5A2Q L;  4UCT A;  1N32 H;  4JV1 A;  2E2D C;  1D8L A;  3MFI A;  4N8X 1;  1EQT A;  3A7L A;  3HOX H;  4NB3 A;  5BPH A;  1CKN B;  4HID A;  2AQ3 B;  3RB6 A;  4KMU C;  1AE2 A;  4I7Z C;  4HR7 A;  4CGY B;  5KT6 A;  2NVY H;  1UNS A;  4LH6 A;  3UQ8 A;  2YYA A;  4JI7 H;  3FKI H;  3QIA A;  4JI3 L;  1GGO A;  3V6H A;  1I3Q H;  5KFW A;  4K6D A;  3SE7 A;  1BR9 A;  1IHZ A;  4ODG A;  1E1O A;  2M9V A;  1PRT D;  2RVL A;  4QWC A;  4NW2 A;  3J7Y W;  1YHA A;  5FLX L;  1DV1 A;  3BQ1 A;  2HVS A;  1S5D D;  4MZ9 A;  2F3I A;  3M4Q A;  1ILQ A;  2VPS A;  1C4Q A;  2OCE A;  2O5J C;  2J0T D;  4JI5 L;  4DV3 Q;  3VPC A;  1JX4 A;  1FKA H;  1QE6 A;  1F2Y A;  4DV3 H;  1G29 1;  4FXG C;  1TKW B;  3RZO H;  3AB9 A;  1GLV A;  1GSA A;  3H3V I;  2NZH A;  1I94 L;  3URY A;  3BA8 A;  3CQZ A;  3VR6 A;  1EL0 A;  2MP1 A;  4ME5 A;  3KLR A;  3HFZ B;  5IT9 E;  1EYC A;  1Y1V H;  2MO0 A;  3MHB A;  4KKT A;  4TSS A;  1IL2 A;  3S1M H;  2CCZ A;  2KJX A;  2HHH Q;  1S0N A;  1CSP A;  5EQ0 A;  2HVR A;  4CDF C;  5D1P A;  3GTG A;  2K03 A;  2JEF A;  3GTO B;  1MHW C;  5I6Y A;  1ZEQ X;  1WVL A;  2O2L D;  4B3M H;  3CC7 A;  3DWA A;  4A3G H;  2PW5 A;  4YHH H;  4F8M A;  4FDB A;  3PUZ A;  3N8D A;  2Z6K A;  1JLL B;  4R4I A;  2F03 A;  4M9U A;  1NBW A;  4P73 A;  2B2V C;  4NXM Q;  2FK2 A;  5KFI A;  5KG0 A;  1FNV A;  4BA1 I;  4NXM H;  1TVX A;  2F0V A;  4P2C B;  4TQR A;  2JA5 A;  3GP7 A;  2F0H A;  1F9R A;  4EGJ A;  2WDT A;  2R7D A;  2NVQ H;  2F0M A;  1VF5 C;  2N78 A;  1G2T A;  3SI8 A;  2HD3 A;  2K33 A;  3GII A;  1V51 A;  2C00 A;  4QY7 A;  1EIY B;  4K5X A;  3F2U A;  4GKJ L;  1WTW A;  1QZG A;  5KFP A;  1XMQ Q;  4FF2 A;  2WII B;  4AH6 A;  4OO1 G;  4QGU A;  1S03 G;  1XMQ H;  2KQ3 A;  3C1F A;  2RGV A;  5DQH A;  4RA8 A;  2VUM H;  3AU7 A;  1FGB D;  1QUQ B;  2AWN A;  5L1L A;  4UCO A;  3EPG A;  4PMB A;  3L7Z C;  4DV6 L;  4K5W A;  2PCF B;  1QWY A;  4HIK A;  1MGS A;  4YCU A;  3RN5 A;  4BBS B;  1M6V A;  1ZHS A;  4O3P A;  5CA1 F;  4UHV A;  2ALY B;  2NU8 B;  4LF5 L;  1SRU A;  4ECZ A;  2A69 C;  2RGR A;  2R6G A;  4BY1 B;  3A56 A;  1SDF A;  5IYD G;  4OIK A;  3I4N G;  1YIT A;  3K5N A;  1DV2 A;  4ULL A;  3BQ0 A;  2YZG A;  3CF5 A;  2ZJQ A;  4LF7 Q;  4OX9 L;  1D1K A;  5KG1 A;  2FK1 A;  1WTV A;  5BN5 A;  3HOY H;  3NEN A;  1SYG A;  1PH2 A;  5LOV F;  3G6X A;  3GTL H;  1S3O A;  4IQZ A;  4DR2 Q;  5KEE A;  2R93 A;  2ASL A;  3H6M A;  2J6T A;  1WD1 A;  5M5Y H;  1BNC A;  2YU9 B;  3MC0 B;  3S16 H;  2QYZ A;  2WTF A;  1TWA B;  2GVB A;  1S72 A;  4WJ3 M;  4LJZ C;  1HQR D;  1VBH A;  4X62 H;  5LMN H;  1OWT A;  3RV3 A;  2NVX A;  4JI0 L;  4MV7 A;  5E3F A;  4UFZ A;  4DV4 H;  4XXE A;  1O80 A;  2UXC Q;  4ABN A;  2BA0 A;  2CQA A;  5COR A;  4KY6 A;  2UXC H;  2AUK A;  1VF7 A;  3MFG A;  2RF4 A;  2CW8 A;  1PZK D;  4RMF A;  2GN5 A;  3N40 P;  4ECX A;  1O78 A;  4NP5 A;  2KUM A;  1TWF A;  4JI4 Q;  2NZ1 D;  1N36 Q;  5CGK A;  3KHL A;  3NXW A;  3T53 B;  3CCQ A;  3IL8 A;  3KLW A;  3PO3 G;  4FU0 A;  4JI4 H;  1VMC A;  5JJL A;  4DAM A;  3HG9 A;  2B2Y C;  3BDL A;  4CDD C;  4QWB A;  1ROD A;  3H0G H;  5IYC G;  2ATW A;  3M9M B;  3ITP A;  4A93 G;  3BVZ A;  3NUC A;  1N56 A;  1PFB A;  2JEB I;  1A3V A;  3JRX A;  1EZ1 A;  3A8I E;  3JAM L;  4B9X A;  1B9M A;  1HQM C;  1Y1W G;  4O3O A;  4FO2 A;  5CV5 A;  5CBA E;  4HAE A;  3RD4 A;  4DA2 A;  4AYB A;  4M1U B;  1RJT A;  2D9U A;  2NU9 B;  4KI0 A;  3V6K A;  3IAY A;  2B2T C;  5FK9 C;  2WAC A;  2VPQ A;  5KFA A;  1I6V C;  3K80 C;  2ID0 A;  3DEO A;  4LNQ A;  5CC4 A;  1I50 B;  3NSW A;  3U9S A;  2Y0S G;  2R82 A;  1S97 A;  1JCK B;  1E7Z A;  1HXY D;  3MVV A;  3T1H Q;  4EEY A;  3OYY A;  1KEE A;  3T1H H;  4RB2 C;  1SEB D;  4UP8 A;  1C7Y A;  3LX0 A;  1ESF A;  1IBK L;  3CD6 A;  4FF3 A;  5A2Q W;  1NTG A;  2DLN A;  3HOZ G;  1S10 A;  2RDH A;  3K0Y A;  3GQC A;  3VYS A;  2PQA B;  1X56 A;  2VQF Q;  5JEA J;  1HR0 H;  4DUZ L;  1JDB B;  4UCS A;  2B2W C;  4UCR A;  5KG7 A;  4X66 H;  2LS0 1;  3H94 A;  2VQF H;  2DN8 A;  4RNM A;  3RTX A;  2B29 A;  4HSP A;  1RD9 D;  3CC4 A;  3PIP 3;  2I46 A;  3HOU G;  1K1S A;  2JSO A;  4JYA H;  1LTB D;  2EPB A;  1UC8 A;  3FDT A;  3VA5 A;  5ELO A;  2C22 A;  2XCA A;  1K8M A;  5FLX W;  4EBE A;  1A2U A;  3PZP A;  3E3X A;  4PZ6 A;  5KFG A;  1A3U A;  1IXR A;  3EN2 A;  1E4G T;  2Z8L A;  3I70 A;  3W5O A;  3F8N A;  4P72 A;  4RAZ A;  2VXW A;  5CYU A;  3NBI A;  1KDC A;  4X3S A;  2VW9 A;  3K7A H;  1XWE A;  1NNX A;  5L1J A;  3TN2 A;  4DNI A;  5C44 G;  4HED A;  2IY5 B;  2QF7 A;  1PTO B;  4C3I H;  2W9B A;  4J9L A;  2DPJ A;  4PWQ A;  1S5F D;  1K73 C;  3H3V H;  1EHI A;  1N9W A;  1PDQ A;  4IUR A;  2FJZ A;  1QVG A;  3TQT A;  3MZ5 A;  4IZ8 A;  5A35 A;  2YS7 A;  4NMZ A;  4E4T A;  5EWG A;  2PBZ A;  1PYS B;  3FP9 A;  4HNV A;  3RZD H;  5LL6 S;  1NR2 A;  4DXG A;  4A4I A;  3HKZ G;  2KEE A;  4DV0 L;  3C3L A;  1IL8 A;  1V1O A;  4GKK L;  3T51 B;  4FXD A;  1HRJ A;  3UDG A;  1NMG A;  1K0S A;  1WOC A;  1TII D;  4FP5 D;  4N8F A;  4A3D B;  1UUP A;  1B2T A;  4DV5 L;  4R4O A;  1VQP A;  2JA6 A;  2RDF A;  1LLR D;  4UY8 C;  1L1O A;  1JDE A;  5KFR A;  1E1T A;  5FOB B;  4YCW A;  4ED3 A;  2SDF A;  3GTM A;  2VB3 X;  1RYR A;  2V58 A;  5IGD A;  4NDX A;  4L1K A;  3DMU A;  3D8G A;  3ULJ A;  4HCS A;  1B04 A;  1CT1 D;  3OWF A;  5KRU A;  5CV9 A;  3RN2 A;  3HP3 A;  4IAJ A;  1HFN A;  1PRT C;  2QCP X;  3NEM A;  2NUA B;  3RGZ A;  4ZAI A;  1E0B A;  1EY7 A;  3Q1K A;  4XT3 B;  1AEX A;  4YQW A;  2WFW A;  1RL2 A;  1C0A A;  4FBU A;  1NY4 A;  4A3E H;  3QZ7 A;  4ECS A;  2NUC A;  3MEH A;  2DJG C;  1BOS A;  1TS2 A;  3GIJ A;  2UUC Q;  4DAV A;  1KTK A;  1EQR A;  2HDL A;  3A5Z B;  1HTL D;  1BUV T;  4IPH A;  3K5H A;  2UUC H;  1V9P A;  4HR7 B;  3S1Q H;  4I55 F;  1CQJ B;  1MSH A;  3MAQ A;  1R4Q B;  5LL6 b;  3UE1 A;  2FPP B;  1ZYR D;  4HIO A;  1EWH A;  1PRT B;  5KFZ A;  1ENA A;  1GUS A;  2TMP A;  2LFN A;  3NPP A;  1T9H A;  4RH6 A;  4J8Q A;  3GTG H;  4R4C A;  3IG0 A;  3RB0 A;  3GTO A;  3M4O H;  4DV3 L;  3NE5 B;  2FLP A;  5BR8 Q;  1VQ7 A;  3PO2 B;  1C30 A;  2R8G A;  3VMM A;  2R92 G;  1PTO F;  3J80 L;  3A5U A;  1EYZ A;  1S40 A;  4Q8E A;  4H0L C;  1DOM A;  1JIC A;  3CQZ B;  4GN3 B;  4MAM A;  1D2B A;  4A3M H;  3EQL C;  4GLV B;  4YWK A;  5K2M A;  3RAQ A;  1HNW H;  2HHH L;  4XYL B;  2JA5 H;  3QO2 A;  4POG A;  1ICF B;  2MFI A;  3N6X A;  2WAQ G;  3U9O A;  3V05 A;  2UVW A;  5I47 A;  3QG1 A;  4C3J H;  5FJ8 H;  4B3S H;  1H9J A;  1F9S A;  1JWS D;  4RGT A;  1D5M C;  3GTG B;  4X6A H;  3OHB A;  4JBM A;  3M4O B;  1A63 A;  4IFD J;  1YEZ A;  3GTQ H;  3MFH A;  3KBX A;  4FS1 A;  2DNE A;  2B2V A;  3CCV A;  3CC2 A;  2R7M A;  4DV1 H;  4NXM L;  3PW7 A;  3I4L A;  1B1Z A;  3RNU A;  1JXL A;  2IX3 A;  3R5X A;  5IGE A;  1JOO A;  1QUQ A;  4RG1 A;  3LGJ A;  2R87 A;  3KHR A;  1TA8 A;  3ORQ A;  2PVP A;  4DNR B;  2PN1 A;  2JEG A;  3T4A C;  2Q8R E;  1XTC D;  5KKN B;  4X65 Q;  2M2L A;  4CKE A;  3BZC A;  1SR3 A;  1HJP A;  5IE8 A;  5JPM C;  2OTL A;  4A3J H;  3CKI B;  4GN5 A;  4X65 H;  4J9R A;  3TEH B;  4S3S A;  3G6J B;  1TR5 A;  1Z7T A;  2PZT A;  4K2K A;  1XMQ L;  1F2L A;  3C46 A;  4IPG A;  2XCL A;  1BVS A;  1VQK A;  2MCT A;  3L4K A;  3VDY A;  4DR1 Q;  3TS2 A;  4IUP A;  1F77 A;  1BDO A;  4L5S A;  4BA2 I;  4ED7 A;  3J81 L;  3G8C A;  4ECW A;  3G6V A;  1XMO H;  1W3S A;  4WRD A;  1RJR A;  2GPW A;  1QNK A;  3QJY A;  1BCP D;  4KHP H;  1CUK A;  4MTE A;  2QDB A;  1PRT F;  3D6C A;  1VQD A;  4GNX C;  2YU9 A;  1K3R A;  2EY1 A;  3M9B A;  3NK9 A;  3D31 A;  1PLF A;  4K0K Q;  1TWA A;  3H40 A;  2NZO A;  1OXX K;  4N9T A;  1N48 A;  2IWH A;  3Q2O A;  2J7Z A;  2JYO A;  3SVM A;  4LF7 L;  1I4X A;  4TV8 F;  1K3B C;  5JQW A;  1JMC A;  4A3F G;  2NVX H;  2NYZ D;  4JV5 H;  3MFY A;  1KJ9 A;  1TY0 A;  4TUY F;  2BE5 C;  5IOD A;  2L1B A;  5CV8 A;  4DV7 L;  3KAJ A;  5F2D A;  1H9R A;  4ED6 A;  2A1A A;  5ELB A;  1E4E B;  1GXD C;  1QOH A;  3RAX A;  3ERO A;  1EFI D;  4UAI A;  2R7Z A;  2DGY A;  1I6H H;  3QB3 A;  1EIH A;  1JC7 A;  4DR2 L;  5EKK A;  3RJ0 A;  1K9M C;  3ERQ A;  3S2D H;  1TWF H;  4C1N I;  4GNX B;  2W7P A;  1WCM G;  3DM3 A;  3KK7 A;  1PVO A;  5KFE A;  5IIF A;  2R93 B;  2C9O A;  4C2M B;  4DR4 H;  1EU4 A;  1WTR A;  3TDQ A;  4AQY H;  4N9P A;  4LH7 A;  3HZX A;  2JEA I;  1I7N A;  3PCO B;  2YRW A;  4LSX A;  2V4R A;  4R9W A;  1IKL A;  1SMY C;  1H95 A;  5ELE A;  1U9R A;  1O7Z A;  2UXC L;  5DNF A;  3GIP A;  2HT1 A;  3FHW A;  3LWE A;  4H44 C;  2NVX B;  3MJF A;  5AJ3 Q;  4I50 F;  2SNS A;  5LHY 1;  1I5F A;  4JI4 L;  2WKC A;  3UDF A;  3AEV A;  1N36 L;  1LTT D;  1KJQ A;  3TP7 A;  4XQJ A;  1PH6 A;  3CCL A;  4KD4 A;  3M3Y B;  4C5C A;  2QGQ A;  2JN4 A;  4DL6 A;  3PW0 A;  3LNN A;  1I50 A;  2AUJ D;  1DM0 B;  3WWV A;  4XQN A;  3N44 B;  3AYH B;  2N3S A;  4A3B H;  4C3H H;  3OTO Q;  2I80 A;  4DL7 A;  4QWA A;  3OTO H;  2F3W A;  3U50 C;  1ML0 D;  3HRZ C;  5IGG A;  3QFF A;  2WB1 G;  4A3I G;  5L1K A;  1SYE A;  2V59 A;  2PQA A;  2K28 A;  3SHL A;  2B2T A;  3RMH A;  3E5N A;  3MXN B;  4FM9 A;  4AYB B;  2D0O A;  4J15 A;  4YWM A;  1EYD A;  4LWC A;  5JJZ A;  1ICW A;  1LTL A;  4DV4 Q;  4FYD A;  5C4X G;  4R4T A;  2WKD A;  3HOW H;  4A3K G;  4YY3 Q;  2HCI A;  3T1H L;  2NU7 B;  4EEQ A;  4YY3 H;  4ALP A;  2ASB A;  3L9A X;  1YIJ A;  1PX2 A;  1FD7 D;  4J9O A;  1BBU A;  1Y14 B;  5LP6 F;  1Q90 A;  4QMG A;  5DG8 A;  4JW0 A;  2HJW A;  3U58 A;  3UE0 A;  2I87 A;  3I90 A;  4CJ2 C;  3I4N B;  2X0S A;  1X32 A;  1EY0 A;  2FPI B;  3PW5 A;  1Z6H A;  4IUT A;  1EY8 A;  2V5A A;  3D0F A;  4IFD H;  5KFM A;  3S14 B;  5C5L A;  1QB5 D;  5BN3 A;  4JI6 Q;  1VQE A;  1K8G A;  4JI6 H;  4KN4 C;  4DR7 Q;  3L0O A;  4KK7 A;  2K32 A;  3PIP A;  2E2H B;  2WP8 J;  4BY7 H;  1IYJ B;  3FPU B;  5H1S E;  5C6A A;  2CKZ B;  1P8L A;  3DEP A;  4WJW A;  1PYW D;  1RJQ A;  3EA6 A;  3MEF A;  2XWJ B;  1BNZ A;  1TWH H;  1LTI D;  1A15 A;  3TZD A;  5D8D A;  4J9N A;  4DFA A;  4LF8 Q;  3BA9 A;  1LT3 D;  3KHG A;  4ZLT F;  3RBD A;  1WTO A;  4LF8 H;  1D6E C;  5T1G A;  4A3E G;  3PGZ A;  1X3Q A;  3DWQ A;  1Q3L A;  2KSW A;  1A62 A;  1EY6 A;  3J80 W;  5IT9 c;  5KFN A;  1TY2 A;  2FXQ A;  4PG3 A;  5KG4 A;  4CKB A;  1C8C A;  4RCN A;  3CXC A;  1HTP A;  4FS2 A;  1RKN A;  4Q0Y A;  3AFP A;  2F4V H;  2W9B B;  1Q7Y C;  1H9S B;  1Q8K A;  3PO3 B;  1YZ6 A;  2XVS A;  4EQN A;  3GTM H;  4CBV A;  2P5Z X;  2R7K A;  3NEL A;  4WBN F;  1L1O C;  4ZKB B;  3D6W A;  1VQC A;  4UPA A;  4B3R Q;  4Y52 H;  1G6P A;  4L5R C;  3C0F B;  3TII A;  4B3R H;  3R23 A;  1N32 Q;  1S5B D;  4HJ5 A;  2EYP A;  2XC9 A;  5EBD A;  2R86 A;  1RF2 D;  1J8I A;  3M4I A;  1DYQ A;  2XNA C;  4J9S A;  4RAU C;  3CCR A;  1IYV A;  1AE3 A;  1GUO A;  1TWC B;  1I4H A;  2K5N A;  4JPB W;  2ES2 A;  5KFO A;  2F0N A;  4ZK9 B;  2RHS B;  2JA6 B;  3FVQ A;  4JI7 Q;  1UEA B;  1AW7 A;  2GVA A;  1L1O B;  5E7N A;  4IJH A;  1ET9 A;  3P20 A;  4DL2 A;  1OXS C;  2Y0S B;  4YP3 A;  3UFX B;  3GTM B;  1VQJ A;  1CKO A;  2K50 A;  1CQV A;  5DG9 A;  2DJF C;  3CMA A;  3S15 B;  4QCL A;  2EQS A;  4RHR A;  1FNU A;  1ZYR C;  3HOZ B;  3GTO H;  1VQO A;  1LYL A;  1BO0 A;  1G8Z D;  2B63 G;  1ZET A;  3J81 W;  3K0X A;  2EJM A;  1A8V A;  1PFS A;  4MHE A;  2A68 C;  3VR5 A;  2EYL A;  4DU9 A;  2Q8T A;  4RKB A;  3T5L A;  3HOU B;  3HOV G;  3H09 A;  4A3J G;  5KG5 A;  4O3N A;  3TSS A;  5DEH A;  1KHI A;  2I07 B;  3SK6 A;  2FHT A;  5K5P A;  1WD0 A;  1V8Q A;  4O2D A;  4WOR A;  3S17 B;  1DOL A;  2F0W A;  4PZ8 A;  2FP4 B;  2XGP A;  4Q8F A;  2FMM A;  5BR8 L;  4XQQ A;  4B3M Q;  2JA7 G;  2R8J A;  1Z47 A;  2JQO A;  1V4Y A;  2RDI A;  4YHH Q;  2ASJ A;  4YR3 A;  4AIM A;  2WE6 A;  3CP0 A;  1XNR H;  4IZO A;  1LAB A;  5LA6 F;  1LT4 D;  3OUZ A;  3U9T A;  2NN6 I;  3BDO A;  5D3D A;  3VYU A;  1HPC A;  1CI3 M;  5C44 B;  2E2I B;  5T14 A;  5LMN W;  2FJ2 A;  2FK3 A;  4BBS H;  4LFA H;  4GS3 A;  3S1R B;  4ID6 A;  1T3N A;  2VQE Q;  3H15 A;  4R4Q A;  4F50 A;  4BY1 H;  1AP0 A;  5FO9 B;  1Z2N X;  5I2Y A;  3D4D A;  2SNM A;  2VQE H;  3V4S A;  1HUM A;  4Q45 A;  1CHQ D;  2J6S A;  2KEN A;  3MWY W;  3PF5 A;  5C3E G;  3HKZ B;  4OIJ A;  4P75 A;  1JB3 A;  3TS0 A;  1ENF A;  2M00 A;  1G6Z A;  4JI1 Q;  2ZM6 Q;  5LMU Q;  2C2D A;  1TS4 A;  2KVM A;  5CR3 A;  4JI1 H;  2ZM6 H;  5LMU H;  2RDG A;  1OTC A;  5E4W C;  5ELF A;  4RZQ A;  1XYI A;  3BYT B;  2F0J A;  1N34 Q;  2F0S A;  2ZJT A;  2BCO A;  5IGF A;  3RF2 A;  1N34 H;  2YU9 H;  3H91 A;  5IYB G;  1BCP C;  1TWA H;  2DY7 A;  4P71 A;  3GLK A;  1LTS D;  2CWA A;  1OXV A;  4K8I A;  1XTD A;  4LF9 Q;  3ORR A;  3TZU A;  1D5Z C;  4DR1 L;  1SEI A;  3JRW A;  4JI8 H;  1WH2 A;  1IW7 D;  1B7Y B;  2I5H A;  4DR5 H;  3TRE A;  4LF9 H;  4RZR A;  1YJW A;  2C5C A;  1E4E A;  1VKZ A;  4DL3 A;  5J2T F;  1Q46 A;  3K5M A;  4I4T F;  1S5C D;  3I7F A;  2UVR A;  2K1B A;  1W96 A;  4KLK A;  4ZKC B;  4GNX A;  1MKH A;  2JK8 A;  1IOW A;  4GC6 A;  1MI2 A;  1EEF D;  2EIF A;  1R9T B;  2W6N A;  4ZQI A;  1BCP B;  2UXD Q;  3UDX A;  4A3B G;  4BXX H;  4K0K L;  1SXT A;  4L6T B;  4C2M A;  5M5W B;  2A5H A;  2FKL A;  3CU7 A;  2UXD H;  5J39 A;  5E1F A;  1DD2 A;  1HR0 W;  4AYB E;  1HA6 A;  2RSO A;  5CAE B;  4KJN A;  4X62 Q;  4U6P A;  5LMN Q;  2HIX A;  3OSP A;  1L0W A;  1YHQ A;  3OIP A;  4JV0 A;  3RIZ A;  1RDP D;  1SFO A;  3KYH C;  5D3I B;  4IPD A;  1NE3 A;  1VQH A;  4HJ8 A;  4QIW B;  5COY A;  5IGB A;  1Q86 C; 
#chains in the Genus database with same CATH homology
 3BU2 A;  2QEX A;  1Q81 C;  4LF4 L;  3S17 H;  4TQU S;  4IPC A;  3RN2 A;  1PYB A;  4LUZ A;  1G51 A;  1TWG H;  4IOA A;  5JEA G;  1L2F A;  4EX5 A;  1VQL A;  3NEM A;  3I56 A;  1UE7 A;  1I50 H;  3J80 i;  2WFW A;  1RL2 A;  2IT1 A;  1C0A A;  4L5T A;  4TVA B;  1NY4 A;  3T1Y L;  2BA1 A;  4A3E H;  3SGI A;  1N8R C;  1PH8 A;  1XNQ L;  1XNQ Q;  4BBR G;  2YYZ A;  1MJC A;  3E9I A;  4POF A;  5IYB H;  2UUC L;  2UUC Q;  3K8A A;  3G6E A;  5AJ3 L;  2D62 A;  1EQR A;  4IPH A;  3A5Z B;  3UDI A;  5C44 H;  5M3F G;  4HJA A;  2E2I H;  1V9P A;  1GVP A;  3S1Q H;  3DLL A;  3W1G A;  1HH2 P;  2UXB Q;  1DGS A;  1WYD A;  4X64 L;  3UE1 A;  1PH7 A;  1YBY A;  3STB D;  4A3D G;  3G4S A;  3S1R H;  3GD7 A;  4DK3 C;  2L15 A;  4HIO A;  1M1K C;  5M3M H;  1HNX Q;  4BY7 G;  1GM5 A;  2YTY A;  1X55 A;  5ELN A;  2I5L X;  1T9H A;  4YWL A;  3GTG H;  4R4C A;  1UE6 A;  3PUW A;  3J7Z C;  2E5L L;  3M4O H;  1JB7 A;  4DV3 L;  4HJ9 A;  3ICE A;  1BBW A;  3E9H A;  3W1B A;  5BR8 Q;  1VQ7 A;  1K8A C;  4JOI C;  1VQG A;  3OTO L;  4A76 A;  1XNR Q;  4DKA C;  1KL9 A;  2HIV A;  2R92 G;  1J5E L;  2IX1 A;  3A5U A;  3KF6 B;  2QA4 A;  2UUB L;  1SRO A;  1S40 A;  4WJ4 A;  1IBL L;  3TRZ A;  4GN3 B;  1HNW L;  2R93 G;  4DV2 Q;  1IBK Q;  3GTP H;  4A3M H;  4GLV B;  4YWK A;  1VQM A;  4LFA Q;  3CME A;  2HHH L;  1HR0 Q;  2JA5 H;  4POG A;  5HGQ A;  3RR5 A;  2MFI A;  4DR6 L;  4X66 Q;  2LXJ A;  1E22 A;  2WAQ G;  4DV4 L;  4B3S L;  1ASZ A;  4DUZ Q;  1X65 A;  4C3J H;  1Q82 C;  4L5Q A;  4YY3 L;  5FJ8 H;  2RHQ B;  4NPS A;  4LFC L;  4JYA Q;  3U4V A;  2F52 A;  4PZ7 A;  2MO1 A;  4GOP C;  1QZH A;  1XJV A;  2UUA L;  3S1N H;  4X6A H;  1PH5 A;  4JBM A;  1A63 A;  1FVI A;  2Z0S A;  1YEZ A;  4DV1 L;  1IBM L;  3GTQ H;  1IBM Q;  4IFD J;  3J81 i;  1UEB A;  3CC2 A;  3CCV A;  1D7Q A;  1X3F A;  2WB1 E;  1J6Q A;  4NXM L;  3RNU A;  3ER0 A;  3JAM c;  1NMF A;  4BBR H;  1Q1B A;  2N49 A;  1QUQ A;  2CQO A;  1VQB A;  4RG1 A;  3PUY A;  4YCV A;  1FL0 A;  2YTX A;  3LGJ A;  4NXN Q;  1FGU A;  3PO2 G;  3GO5 A;  1R9T H;  4A93 H;  1YJN A;  5M5X H;  4LFB L;  5M3F H;  4JI6 L;  5GAD C;  4JC0 A;  1MJE A;  1EOV A;  2JE6 I;  5M5W H;  1UE5 A;  3HOX G;  4QQB X;  2Y0S E;  4X65 L;  4DR7 L;  4X65 Q;  4GOP B;  3CW2 C;  1Y1W H;  3BZC A;  1SR3 A;  1HJP A;  5IE8 A;  2OTL A;  1YNX A;  4A3D H;  4A3J H;  4GN5 A;  3FKI G;  5GAG C;  4JBK A;  3TEH B;  1YJ9 A;  1XMQ L;  4JI8 Q;  4AYB G;  4IPG A;  5J3B A;  1B8A A;  1BVS A;  1Q1E A;  4DR5 Q;  1U0L A;  1VQK A;  3VDY A;  1XPU A;  4DR1 Q;  3TS2 A;  2C35 B;  3CCE A;  4LF8 L;  4KHP L;  1XMO L;  2MQH A;  2D0P A;  4L5S A;  2UU9 L;  3CPF A;  4BA2 I;  1A0I A;  1NJI C;  3F1Z A;  3GDE A;  1FJG L;  2R7Z H;  2R92 H;  2E8G A;  1W3S A;  3KDF B;  2EXD A;  4LW1 A;  2VNU D;  4OON A;  1CUK A;  4LF6 L;  4DV0 Q;  1RIP A;  5IP7 H;  4GKK Q;  1VQD A;  4GNX C;  1K3R A;  2R7F A;  3M9B A;  3D31 A;  4K0K Q;  1VS0 A;  5K36 G;  4JV5 L;  3PV0 A;  2K14 A;  1VQI A;  1OXX K;  2NZO A;  4JCV E;  3ERS X;  2Q2T A;  4DV5 Q;  4LF7 L;  1Y1V G;  3G71 A;  1PH3 A;  4A3F G;  1JMC A;  2NVX H;  5IP9 G;  1VCI A;  2OQ0 A;  1V1Q A;  4DK6 C;  4DV7 L;  1CKM A;  4DV7 Q;  2A1A A;  4UP9 A;  3J7A 5;  4A3C G;  3F2C A;  3KOJ A;  4DUY Q;  4B3T L;  4B3R L;  1HNZ L;  4A3L G;  1HZC A;  2DGY A;  3HOW G;  3KF8 B;  1I6H H;  2KCM A;  5IY0 A;  4DR2 L;  1KIX A;  1N32 L;  1K9M C;  3S2D H;  1TWF H;  2DUD A;  4GNX B;  5FLM G;  2RCN A;  3I55 A;  3KJP A;  2PI2 E;  4DR4 L;  1KQS A;  4LF4 Q;  1WCM G;  3DM3 A;  1PH1 A;  4A3G G;  4IFD I;  4AQY L;  1PVO A;  1JT8 A;  3ZJY C;  1D8L A;  4A75 A;  3PO2 H;  2K75 A;  3JAM i;  2JEA I;  3PCO B;  3KJO A;  3HOX H;  4NB3 A;  1X3E A;  3T1Y Q;  1CKN B;  4DPG A;  4HID A;  4JI7 L;  1H95 A;  1Q12 A;  2UXC L;  4IFD G;  1AE2 A;  1GD7 A;  1EIF A;  3CQZ H;  2HT1 A;  2NVY H;  3FHW A;  3I4M H;  3FKI H;  4JBJ A;  4JI3 L;  5AJ3 Q;  4LF6 Q;  3HKZ E;  1SN8 A;  1I3Q H;  1GKH A;  3ULP A;  1I5F A;  1E1O A;  4X64 Q;  4JI4 L;  2K4K A;  3UDF A;  3AEV A;  1N36 L;  1KC8 C;  1YVC A;  1SLJ A;  1B70 B;  1YHA A;  1PH6 A;  3CCL A;  5EAY A;  4MZ9 A;  2F3I A;  3M4Q A;  2QGQ A;  2OCE A;  2E5L Q;  4JI5 L;  2ZJR A;  4DV3 Q;  5GAH C;  3WWV A;  1P16 A;  3AYH B;  2N3S A;  2VS1 A;  2JJQ A;  2VUM G;  4C3H H;  3OTO Q;  1G29 1;  4A3B H;  3RZO H;  3H3V I;  2NZH A;  1I94 L;  1J5E Q;  2PI2 A;  2UUB Q;  3U50 C;  3HFZ B;  1IBL Q;  2WB1 G;  4HIM A;  2KBN A;  2ZTC A;  4A3I G;  2JA8 H;  1HNW Q;  1Y1V H;  2MO0 A;  4HJ7 A;  2PQA A;  4A3F H;  1IL2 A;  3S1M H;  5IP9 H;  2YV5 A;  3CAM A;  1EYG A;  1LM0 A;  1JE5 A;  1O7I A;  2YTV A;  2CCZ A;  3MXN B;  2HHH Q;  3CPW A;  2D0O A;  4J15 A;  2JA6 G;  4YWM A;  4DR6 Q;  1CSP A;  4LWC A;  1LTL A;  4DV4 Q;  4B3S Q;  4A3L H;  4R4T A;  5IWA L;  3HOW H;  5C4X G;  3ULJ A;  4B3M L;  4A3K G;  4ME3 A;  1KD1 C;  4YY3 Q;  3T1H L;  1PV4 A;  4YHH L;  2I0Q A;  4LFC Q;  3I2Z A;  5GQO A;  5FLM H;  5HY6 A;  2UUA Q;  3GTJ H;  1WCM H;  3CC7 A;  4ALP A;  2ASB A;  1YIJ A;  4A3G H;  4PMW A;  3HOY G;  1BBU A;  2N8N A;  1OXT A;  4DV1 Q;  1Y14 B;  1C9O A;  4FDB A;  3PUZ A;  2Z6K A;  3A0J A;  4R4I A;  3U58 A;  3E0E A;  1NBW A;  4P73 A;  3UE0 A;  4NXM Q;  4IO9 A;  4BXX G;  5GRO A;  4BA1 I;  2B3G A;  4DR3 L;  3U4Z A;  3D0F A;  1WJJ A;  4GN4 B;  1MIU A;  5DLQ E;  2VQE L;  1M90 C;  4LFB Q;  2R7D A;  4JI6 Q;  2NVQ H;  4QIW E;  1VQE A;  1K8G A;  1VQN A;  2N78 A;  4OO1 I;  2AKW B;  1PA6 A;  4DR7 Q;  3L0O A;  2BH8 A;  4QY7 A;  1EIY B;  4JI2 L;  3PIP A;  3S2H H;  2MNA A;  4GKJ L;  2WP8 J;  4MNO A;  1IYJ B;  1N33 L;  4BY7 H;  3Q8D A;  1QZG A;  1WFQ A;  2LXK A;  5H1S E;  3J80 c;  2ZM6 L;  5LMU L;  2CKZ B;  1P8L A;  1XMQ Q;  4AH6 A;  1UE1 A;  3AFQ A;  4OWT B;  3RLO A;  4QGU A;  4OO1 G;  1KXL A;  3MEF A;  2K5V A;  1TWH H;  1X9N A;  1IZ6 A;  4LF8 Q;  3AQQ A;  4DAY B;  2VUM H;  4KHP Q;  1XMO Q;  2AMC B;  1QUQ B;  2AWN A;  1N34 L;  2K5H A;  2XGT A;  2UU9 Q;  2CFM A;  1FJG Q;  4A3E G;  2KCT A;  3L7Z C;  3PGZ A;  3RLN A;  4DV6 L;  4HIK A;  3RN5 A;  1VQF A;  4YCU A;  1A62 A;  4OWX B;  2ALY B;  2R93 H;  4A3I H;  4LF5 L;  1SRU A;  1TXY A;  3H0G G;  4C2M H;  5IT9 c;  2IX0 A;  2FXQ A;  1KAW A;  2R6G A;  4QJF A;  3HKS A;  2A8V A;  2F4V L;  4PG3 A;  5IYD G;  3I4N G;  3F2D A;  1YIT A;  1BKB A;  4LF9 L;  4JV5 Q;  3CXC A;  5C4X H;  3AFP A;  3BJU A;  1Q7Y C;  1Q8K A;  3CF5 A;  2K52 A;  4A3K H;  1SFO H;  2ZJQ A;  3PUV A;  4LF7 Q;  4OX9 L;  1YZ6 A;  3GTM H;  3NEL A;  1X3G A;  1L1O C;  3F8T A;  1WI5 A;  3CCU A;  1JJ2 A;  3M4P A;  1VQC A;  3HOY H;  4UPA A;  3NEN A;  4B3T Q;  1PH2 A;  1V43 A;  1HNZ Q;  4L5R C;  4B3R Q;  4Y52 H;  1G6P A;  3GTL H;  2JA9 A;  3M3Y H;  1S3O A;  4DR2 Q;  1CSQ A;  1N32 Q;  4HJ5 A;  4JBW A;  4DR4 Q;  4LUO A;  1HZ9 A;  5M5Y H;  4AQY Q;  2ZTD A;  3S16 H;  2LSS A;  4X62 L;  5LMN L;  1KRT A;  2KHI A;  1CKN A;  2GVB A;  4JG2 A;  3CCR A;  1AE3 A;  1S72 A;  2ES2 A;  4WJ3 M;  2K5N A;  4GLA C;  3OW2 A;  3G48 A;  4IJL A;  2RHS B;  3IRB A;  4XTC S;  4JI7 Q;  4JI0 L;  2GVA A;  2VY3 A;  3EBE A;  4BBS G;  1L1O B;  5E7N A;  2Q2I A;  4IJH A;  2UXC Q;  1PH4 A;  1OXS C;  2BA0 A;  3M85 A;  4MTN A;  4BY1 G;  3J81 c;  4JI3 Q;  1VQJ A;  1CKO A;  2K50 A;  2RF4 A;  3KFU A;  4RMF A;  2GN5 A;  4H02 A;  2OWO A;  3CMA A;  1AH9 A;  4APV A;  5C0X I;  2EQS A;  2PNH A;  4JI4 Q;  3STB C;  5GAE C;  1N36 Q;  1SE8 A;  3GTO H;  1VQO A;  3CCQ A;  3PO3 G;  1KRS A;  3KLW A;  3CCS A;  1LYL A;  4EQ5 A;  3J81 j;  5JJL A;  4DAM A;  4UP7 A;  3I4O A;  2B63 G;  1JJG A;  3K0X A;  3CCJ A;  4JI5 Q;  3TQY A;  3H0G H;  5IYC G;  2ATW A;  1A8V A;  1YHB A;  1PFS A;  3KF6 A;  5C0X G;  4A93 G;  2A19 A;  5IYD H;  2JEB I;  2V1C C;  3I4N H;  4O0A A;  1I94 Q;  3EIV A;  2UXB L;  3K81 C;  3HOV G;  3PF4 A;  1Y1W G;  3S14 H;  1YI2 A;  4A3J G;  1HNX L;  1UWV A;  1K83 H;  2IHE A;  1KHI A;  3NBH B;  4KI0 A;  3CCM A;  1W2B A;  4LUV A;  2Q2U A;  4O2D A;  4A3C H;  1HZB A;  3PSI A;  2OTJ A;  3K80 C;  4JOI A;  4PZ8 A;  5BR8 L;  2ID0 A;  3RLF A;  5IWA Q;  2E2H H;  4Y7N H;  2AWO A;  4LNQ A;  2AHO B;  4B3M Q;  2Y0S G;  1XNR L;  2JA7 G;  1E7Z A;  1Z47 A;  1ASY A;  2JQO A;  3T1H Q;  1VQ6 A;  1K0R A;  4XIG S;  4YHH Q;  2R7Z G;  3OYY A;  4AIM A;  3CP0 A;  1EWI A;  2KHJ A;  4UP8 A;  2NN6 I;  1C7Y A;  4DV2 L;  3L2P A;  1IBK L;  3CD6 A;  3PUX A;  1NTG A;  5IP7 G;  3HOZ G;  2IHF A;  1VQ9 A;  4LFA L;  1HR0 L;  5JJK A;  2H5X A;  2Z6K C;  5LMN W;  4X66 L;  3A74 A;  2VQF L;  2PQA B;  1X56 A;  4R1J A;  2VQF Q;  5JEA J;  4DR3 Q;  4BBS H;  4DUZ L;  4GS3 A;  2NN6 G;  5FLX c;  2VQE Q;  3H15 A;  4R4Q A;  4BY1 H;  4GOP A;  4OWW B;  1VQA A;  2B29 A;  1VQ8 A;  4JYA L;  3ULL A;  3CC4 A;  2KEN A;  3HOU G;  3PF5 A;  5C3E G;  5C0X J;  4JI2 Q;  4P75 A;  3TS0 A;  1N33 Q;  4GKJ Q;  3PO3 H;  4JI1 L;  3BZK A;  5ELO A;  2Q2H A;  4JI1 Q;  2ZM6 Q;  5LMU Q;  2B63 H;  3M7N A;  2PMZ E;  3B6Y A;  2NVT H;  4NXN L;  5JJI A;  1EUJ A;  4PZ6 A;  5IYC H;  1OTC A;  1IXR A;  3EN2 A;  3KDF A;  2WAQ E;  3W5O A;  4P72 A;  1N34 Q;  1GO3 E;  2ZTE A;  1HZA A;  4DV6 Q;  1U5K A;  1XPR A;  3HOV H;  1OXU A;  2YU9 H;  2HQL A;  2VW9 A;  3K7A H;  5IYB G;  1TWA H;  1XPO A;  4LF5 Q;  3PIO A;  4P71 A;  3I4M G;  1TWC H;  1X6O A;  4DNI A;  5C44 G;  1VQ5 A;  2F4V Q;  1SMX A;  2IY5 B;  1LUZ A;  4JI8 L;  4C3I H;  2CWA A;  1OXV A;  4OXP A;  4DR5 L;  1K73 C;  1XTD A;  4LF9 Q;  2JA6 H;  3H3V H;  1N9W A;  5C4J H;  4DR1 L;  1E24 A;  1QVG A;  4IOC A;  1B7Y B;  2I5H A;  3TRE A;  4OX9 Q;  5M3M G;  2JA7 H;  1YJW A;  2BH2 A;  1PYS B;  3FP9 A;  1EFW A;  1X54 A;  2OQK A;  1Q46 A;  3JC6 6;  3K7U C;  3S24 A;  3RZD H;  4QL5 A;  3I7F A;  1QVF A;  2ZJP A;  1QVC A;  3S15 H;  4KLK A;  4A4I A;  2E2J H;  2XTI A;  3HKZ G;  4GNX A;  2VZA A;  1MKH A;  2JK8 A;  2CWP A;  2EIF A;  4P74 A;  4DV0 L;  4GKK L;  2UXD L;  3HOZ H;  2UXD Q;  3UDX A;  3F2B A;  4A3B G;  4BXX H;  4K0K L;  3UDG A;  1NMG A;  3GTK H;  1Z9F A;  1PH9 A;  1HR0 W;  1WOC A;  4AYB E;  4KHZ A;  4R4O A;  4DV5 L;  1VQP A;  4X62 Q;  1PHJ A;  5LMN Q;  2JA8 G;  2HIX A;  4GLX A;  4A3M G;  1JJC B;  1L0W A;  2I5M X;  4UY8 C;  1YHQ A;  1L1O A;  2JA5 G;  1E1T A;  3HOU H;  4YCW A;  3KYH C;  4DUY L;  4IPD A;  1Q86 C;  1NE3 A;  4JI0 Q;  1VQH A;  5C3E H;  4HJ8 A;  1VQ4 A;  1EQQ A;  1E3P A;  2VL6 A;  5FJ8 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...