1Y1WG

Complete rna polymerase ii elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-D(P*AP*GP*TP*AP*CP*TP*TP*AP*CP*GP*CP*CP*TP*GP*GP*TP*CP*AP
publication title Complete RNA Polymerase II Elongation Complex Structure and Its Interactions with NTP and TFIIS
pubmed doi rcsb
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y1wG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y1wG01
4BXXG 2B63G 3S1NH 3M85A 4LF8Q 3UDGA 4A93G 2OQ0A 1TWGH 2HHHL 2MQHA 2Y0SG 4A3CG 2KCTA 1H95A 4DK3C 1IBKQ 5LMUQ 1NBWA 4GOPA 1S72A 4GKKL 2PI2E 3KLWA 2A8VA 1MJCA 4HJ8A 4WJ4A 4HJ7A 4DR2L 4YCWA 2YTVA 1AE3A 4LUOA 4R1JA 1OXVA 1EFWA 2IX1A 2JA8H 4OO1G 3EIVA 1N36L 4JBMA 1Q1EA 4A75A 4BY7G 1JB7A 1HNZQ 3T1YL 2NVQH 3S14H 1XMQL 2HT1A 4DNIA 3M9BA 4YWKA 2ZTEA 1IXRA 5IE8A 3E9IA 2UXDQ 2NVTH 5J3BA 4A3FG 4R4OA 2VY3A 4DR6L 3H0GH 1LM0A 4NPSA 1E24A 5C4JH 2ZJPA 3U58A 3S2DH 2VZAA 2LXKA 1X6OA 3J81i 5FLMG 4OX9L 1VQ5A 2IX0A 4DR5L 3FP9A 3CXCA 4HJ9A 4LF4Q 1K8GA 1YZ6A 3I2ZA 3G71A 2UUBL 4B3MQ 4POGA 1I3QH 1E1OA 3AEVA 1YNXA 2K5NA 2R6GA 2UU9Q 1VQAA 3PO2H 1SMXA 1IBLL 3KOJA 3GTKH 1CSPA 1KAWA 1I6HH 3G4SA 2EQSA 1IZ6A 4DV1L 4A4IA 3M3YH 3ULJA 3TS2A 2Z6KC 3GO5A 4OXPA 1Q81C 1PH2A 1L1OC 3AFPA 3JC66 3CC2A 2Q2UA 3S15H 1CKNB 1HNWQ 3J7ZC 3MEFA 4A3MG 1D8LA 2JJQA 3EN2A 4HIKA 1EYGA 3F1ZA 2E5LL 2K75A 3KF6A 5C0XI 3H3VI 4LF6L 1TWCH 1BBUA 2YTXA 4QY7A 4YWMA 1KIXA 4GOPC 2MO0A 4BBSH 2JK8A 1FGUA 5IYBH 1VQFA 2KCMA 3PCOB 1IBML 1OTCA 4UP7A 4JI6L 4DR4L 2R93G 3NELA 4DV6Q 1L0WA 1PH5A 2JA5H 1XPUA 1IYJB 3S1RH 3PO2G 5BR8Q 1Y1WH 1PH7A 2CFMA 3PV0A 1QZGA 1KXLA 5JEAG 3J80i 4UP9A 5C44G 1J5EQ 3T1HL 5ELNA 4JI1Q 4DUYL 1SRUA 5ELOA 4DV3Q 1CKNA 3CW2C 2ZJRA 3UE0A 1VQ4A 4DAYB 2EXDA 4A3JH 4LFCQ 1OXXK 1E22A 1X3GA 4DV5L 2HHHQ 4DR1Q 1N33L 4A3GH 1EQRA 2WB1E 4X64Q 3CPFA 2N8NA 2QA4A 4X62L 1XNQQ 3RLNA 1U5KA 1KC8C 1KQSA 3HOVG 3E9HA 1B8AA 3I4MH 1HZAA 1TWAH 3HOXH 4IOCA 1X3FA 3I4OA 4P75A 4OWTB 2ALYB 2UUAL 4JI8L 5IYBG 4UY8C 2BA0A 1YITA 5IP9H 5C0XG 1N36Q 4C3JH 1PFSA 4DAMA 2JA5G 5AJ3L 3KF8B 1A0IA 4JOIC 4B3TL 1X3EA 3ERSX 1XMQQ 1V1QA 4YY3L 1N8RC 2UUCL 1I50H 4MNOA 4RMFA 3CPWA 1JJCB 4DR3L 1GO3E 4BXXH 4XIGS 1V9PA 5M5XH 3NEMA 3PSIA 5HGQA 5IWAL 4A3JG 4A3GG 2F4VL 3GTOH 2GVAA 3KFUA 1U0LA 4X65Q 1W2BA 1XJVA 1ASYA 1ASZA 3I4NG 1L1OB 4DUZL 1S40A 3BZKA 1HNXL 3D0FA 3I4MG 3HOXG 3DLLA 2WAQE 2K5HA 1NTGA 1QUQB 3OTOL 1IBLQ 3KDFB 1VQEA 2NZHA 5IP9G 1VQ7A 3HOYH 2XTIA 1PH6A 1Z47A 2R7ZG 3CC4A 3K7AH 2I5MX 4BY7H 4JI3L 3RLFA 3A5UA 1BBWA 3L0OA 2ZTDA 2RHSB 3CC7A 3PUWA 3NENA 1V43A 1G51A 5FLXc 4IO9A 1B7YB 2VS1A 2Z6KA 4JI7L 5H1SE 4OWWB 1QZHA 2AMCB 4XTCS 5EAYA 5JEAJ 1L1OA 5LMNW 5IP7H 2E5LQ 4LFBL 4A3LH 3JAMc 1HJPA 4JI0L 3UDFA 1PYBA 1YEZA 4DV2Q 3B6YA 3AFQA 3TQYA 5FLMH 3U4ZA 2UXBL 1IBMQ 3HOUH 1QUQA 1R9TH 2F3IA 4JI4Q 3KDFA 3CCJA 3HKZG 4LUVA 1KL9A 2Y0SE 4JI5Q 1N34L 3PO3H 4PZ8A 1HR0L 1NY4A 4B3RQ 2VW9A 1YIJA 1AE2A 1QVFA 3M4PA 1L2FA 1SLJA 4R4CA 3HOYG 3M4OH 1PVOA 5GQOA 1N9WA 4LNQA 3CCRA 3ULPA 4L5SA 1N33Q 1WFQA 4IFDI 1Y1VH 3K81C 2LXJA 1A63A 1XMOL 5FJ8H 2Z0SA 5C0XJ 4X62Q 4A3MH 4LF9L 2K5VA 2VL6A 4A3BH 4AYBG 2PMZE 1P16A 3VDYA 2I0QA 3J81j 3CCMA 1X9NA 3TRZA 1JJGA 5IP7G 2AHOB 2VQEQ 4A3LG 1AH9A 1HH2P 3RN2A 2PNHA 3S24A 1NJIC 1EQQA 1WOCA 4X66Q 4JI8Q 4DV7L 5JJLA 1K8AC 3HOUG 1QVCA 4IOAA 4JV5L 2R93H 4DKAC 1YHAA 2WFWA 4GLXA 4DV0L 5DLQE 4A3KH 1I94Q 2IHEA 2ASBA 3PO3G 4K0KQ 5C44H 1NE3A 4IJHA 4UP8A 4YY3Q 2CCZA 4P72A 1HNWL 1CSQA 2UUCQ 2CWAA 4HJAA 1BVSA 1MKHA 2HQLA 3STBC 1YHQA 3K80C 5GAGC 2AWOA 5JJIA 4JOIA 4QIWE 1VQNA 3G48A 1VQ6A 4GLAC 2F4VQ 1Y1VG 1HR0W 4GKJQ 1Z9FA 1N32Q 1YBYA 4P74A 5FJ8G 2OTLA 2IHFA 2YV5A 4A3BG 5K36G 3HOVH 4BBRH 2VUMH 1E7ZA 4QL5A 1UE1A 1Q46A 1VQJA 2CQOA 4JYAL 4NXML 4DR7Q 1IL2A 4R4TA 4FDBA 4JI2Q 1C0AA 2OCEA 4C2MH 2RF4A 3A0JA 4JBJA 5C3EG 4LUZA 3H3VH 4RG1A 2E2JH 4A3KG 1VQKA 4NXNL 4LF5Q 4JBWA 1M1KC 1TWHH 2B3GA 2K14A 2D62A 3PF5A 4GLVB 4JBKA 1Y14B 1Q7YC 3Q8DA 3RNUA 2VQFL 1KD1C 3CMEA 2VNUD 2UXCL 1C9OA 3G6EA 3F2CA 3ULLA 1JJ2A 3S2HH 3HOZG 3MXNB 4JCVE 2UXBQ 2DUDA 3I4NH 2NVYH 4BBRG 1Q12A 2VUMG 2PQAB 1PA6A 2YTYA 4IPDA 2IT1A 1N34Q 2E2IH 4A76A 4GKKQ 1IBKL 5LMUL 4YHHL 3FKIH 1MJEA 4DR2Q 4HJ5A 3UDXA 2R7ZH 2BA1A 4KHZA 5LMNL 3A5ZB 4IPCA 3ZJYC 1NMGA 3T1YQ 1GVPA 2LSSA 5M5YH 4C3HH 4AQYL 1HNZL 1K83H 1XMOQ 4L5TA 3TEHB 4LF9Q 1K9MC 3U4VA 1YJWA 2UXDL 4DR6Q 1CKOA 3BJUA 1EUJA 1WCMG 1LYLA 1VQCA 3KYHC 1XTDA 2H5XA 2PQAA 5IYDG 4OX9Q 3F8TA 4DV7Q 4DR5Q 5IY0A 1NMFA 1WYDA 4JC0A 4A3EH 1HZ9A 1UE5A 1GD7A 2E8GA 4J15A 2UUBQ 4DV0Q 1PV4A 4LF4L 4OONA 2YYZA 4Y7NH 1XPRA 4LWCA 3GTPH 4DK6C 5M3MH 3FKIG 1SR3A 4POFA 4HIOA 3RZDH 2UU9L 4L5RC 3GTGH 1T9HA 4GN5A 1S3OA 4DV1Q 1RIPA 2K52A 4BA2I 4QQBX 3GTMH 3S16H 4PZ6A 3UDIA 5IYCH 1FL0A 4KHPL 1PH3A 2BH2A 4AIMA 1TWFH 2ZM6L 2L15A 1VQ8A 1D7QA 4WJ3M 1A62A 3GTJH 2QEXA 2ZJQA 4GS3A 5JJKA 1JMCA 1FJGL 3K8AA 1VQGA 4KLKA 4LF6Q 4NXMQ 2QGQA 4OO1I 3CCUA 1XNRL 2EIFA 4JI6Q 4DR4Q 5E7NA 2CKZB 4A3EG 4UPAA 3DM3A 3OW2A 4A3IH 4QJFA 1PHJA 4DV6L 3JAMi 3ER0A 2JA7H 4NXNQ 2WP8J 1VQOA 3WWVA 3TREA 1VQBA 3HKZE 5M3MG 1K3RA 5BR8L 3T1HQ 4DUYQ 3CQZH 5GADC 1J5EL 3PUYA 4JI1L 3D31A 2UXCQ 2JQOA 3HKSA 4PZ7A 5IYCG 4DV5Q 1Q82C 1XPOA 2K50A 2Q2TA 4LFCL 2K4KA 3U50C 2ID0A 1LTLA 4DR1L 4Y52H 3FHWA 1VCIA 2MFIA 3HFZB 4X64L 2GN5A 1YI2A 3AQQA 3PUZA 1XNQL 5GROA 4ALPA 3GTQH 2N49A 2E2HH 2N3SA 1PH8A 4AYBE 4EX5A 3PUXA 4YHHQ 3I56A 2UUAQ 3PGZA 1BKBA 1HZBA 4MTNA 5C3EH 1Q8KA 4R4QA 2ZTCA 4R4IA 4A3IG 1YHBA 5LMNQ 4LF7L 3ICEA 1KHIA 5AJ3Q 2JA7G 2JA6G 4B3TQ 4BY1G 4AQYQ 1Q1BA 2NN6I 2BH8A 1QVGA 4YCVA 3RN5A 2R7DA 1VQPA 2RHQB 1PH4A 3J81c 4DR3Q 1B70B 3PUVA 2MO1A 4LW1A 5HY6A 4PMWA 3CAMA 4DPGA 5IWAQ 2IY5B 1UE6A 4X6AH 4A3DH 1DGSA 2I5HA 3CCSA 3TS0A 1E1TA 1G6PA 1W3SA 2PI2A 3F2DA 2ES2A 3RZOH 3HOZH 3J7A5 1HZCA 4MZ9A 4DV4L 4DUZQ 4X65L 2D0OA 3KF6B 2C35B 4GN4B 5M3FH 1HNXQ 4IFDG 2Q2IA 3H15A 1A8VA 4BA1I 4QGUA 3E0EA 3HOWH 3OTOQ 3AYHB 4LFAL 1YJNA 3STBD 3KJPA 1OXSC 1C7YA 2I5LX 1M90C 1G291 4B3SL 1SE8A 2N78A 4C3IH 2KHIA 2JEAI 3UE1A 4JI3Q 1VS0A 1OXTA 2JA8G 4H02A 1X65A 4KHPQ 1TXYA 3RLOA 3IRBA 1EOVA 3EBEA 1FVIA 2ZM6Q 4GNXB 3CMAA 3CD6A 4O0AA 2MNAA 3PIOA 3GDEA 4APVA 1RL2A 4JI7Q 1WCMH 4OWXB 3W1BA 1FJGQ 2OQKA 1MIUA 3S1MH 4LFBQ 3H0GG 4LF8L 2AKWB 2NN6G 4JI0Q 4A3DG 5IYDH 1XNRQ 1I5FA 3K0XA 2Q2HA 4DV2L 2R92H 4ME3A 3J80c 1KRSA 3M4QA 1VQHA 4KI0A 3L7ZC 1KRTA 1K73C 2HIXA 4JI4L 1UEBA 5M3FG 1OXUA 3I55A 3K7UC 3CCEA 1SROA 1HR0Q 4JI5L 2FXQA 3HOWG 4IJLA 2KHJA 1X54A 2ATWA 4PG3A 4B3RL 1VQMA 4IPGA 2B29A 2KBNA 1EIFA 4GNXA 4P71A 1VQLA 2JA9A 5GAEC 2OTJA 2WB1G 3A74A 5GAHC 2HIVA 4YCUA 2DGYA 1P8LA 1UE7A 4TVAB 4NB3A 1K0RA 4EQ5A 3CCQA 1JT8A 4YWLA 1GKHA 3W5OA 2NZOA 1WI5A 1PH1A 1CUKA 2VQEL 4BBSG 4P73A 3S17H 2V1CC 4L5QA 5C4XH 2R92G 3PF4A 4JV5Q 2XGTA 2KENA 5IT9c 3CCVA 4X66L 1VQDA 3LGJA 3CCLA 4LF7Q 2AWNA 3CF5A 1PH9A 1I94L 2A1AA 4HIMA 1GM5A 4B3ML 1Y1WG 1Q86C 1EIYB 3M7NA 4O2DA 4K0KL 3W1GA 1VQ9A 4IFDJ 4IPHA 3NBHB 3KJOA 3S1QH 3L2PA 2NVXH 2R7FA 2B63H 3F2BA 2JEBI 2GVBA 4A93H 1X55A 3BZCA 4GKJL 2JE6I 5M5WH 3I7FA 4DV4Q 1N32L 1JE5A 3BU2A 3RR5A 1WJJA 3PIPA 2OWOA 4A3CH 1SN8A 2WAQG 1SFOH 1YVCA 4JYAQ 1J6QA 1O7IA 1YJ9A 4LFAQ 4DR7L 1X56A 5C4XG 2YU9H 3GD7A 1VQIA 4JI2L 4B3SQ 4TQUS 1PYSB 4GNXC 4GOPB 2F52A 2JA6H 3OYYA 3SGIA 1UWVA 4BY1H 1LUZA 4LF5L 1EWIA 2CWPA 4GN3B 1E3PA 3CP0A 2A19A 1CKMA 2RCNA 4JG2A 4AH6A 3GTLH 2VQFQ 4DV3L 4HIDA 2D0PA 4A3FH
chains in the Genus database with same CATH superfamily
3S1QB 2B63G 3M85A 5L1LA 2YRXA 4O3NA 2OQ0A 1TWGH 3OSOA 5M5XB 3JRWA 4F4WA 4ECSA 4QUCA 4A3CG 5M5WB 4J0MA 3HBLA 4XT1B 4HR7B 3RD4A 5EPJA 4DK3C 5LMUQ 1NBWA 5IT9W 1CE8A 2RDFA 1JLLB 5CV6A 3OTOH 4HJ8A 4DR2L 2XC9A 1ICFB 4K6DA 1N36L 5ELDA 1Q1EA 2F0VA 2OH2A 3OHAA 2NVXA 1XMQL 5IGGA 4DNIA 2HT1A 2B63A 3MTSA 5JPNC 4GC7A 2NVTH 3DUZA 3T16A 4A3FG 4IQZA 1RJPA 2PPBC 4DR6L 1LM0A 2ZJPA 5C4JH 3S1NB 2FK1A 1SFOA 1A9XA 2VZAA 3J81i 1I4QA 5IT9E 2V5AA 3FP9A 3BVGA 4JVZA 1K8GA 2YU9A 3W2DA 3K5MA 3I2ZA 3J81L 3AEVA 1E1OA 2K5NA 1JOOA 3VR3A 3PIP3 4A4IA 4QIWB 3ULJA 2AQ3B 4RB1A 2IWHA 1GSHA 2C28A 4O4LF 5DLFA 1K28A 1YNNC 4ZKBB 2M9VA 3J7ZC 2DZDA 4ECTA 1J9OA 5JJZA 4A3MB 2W6QA 4HIKA 1EYGA 3QOJA 4CGYB 3KF6A 1H9RA 3Q2OA 1BBUA 2YTXA 3H0GB 1JXLA 4JK1C 1E2WA 1F9QA 1VMPA 2MO0A 2X6GA 2JK8A 2KQ3A 3EJIA 2CW8A 3HEJA 1FGUA 2F0LA 3GV6A 1OTCA 4YAJB 1IYVA 2PO4A 1II3A 4DV6Q 3MFHA 1PH5A 3QR8A 2HJWA 4LF7H 3S1RH 5BR8Q 5J39A 4JV1A 2CFMA 1WD1A 1QZGA 3RGXA 5JEAG 1ICWA 4ODGA 2B2WA 4EG0A 5ELOA 2XSCA 1CKNA 4E4TA 5EWGA 3UE0A 2K33A 2DIKA 3GP7A 1ZHQA 2FFKB 3X3NA 3T53B 1N33L 4K8IA 4DR1Q 2JXMB 3A8IE 4X64Q 3N6XA 2QA4A 3I90A 4RAZA 3RV4A 1XNQQ 3RLNA 1U5KA 4FBTA 3Q8SB 4F88A 3E9HA 1B8AA 3I4MH 4MV3A 5KFZA 3HOXH 4EEQA 4EFEA 5LXTF 2C22A 4HEDA 2ALYB 1EU3A 4UY8C 1TKWB 1ULZA 3KAKA 1PFBA 1E2VA 1MBYA 1N36Q 4DAMA 1V51A 3GTKA 3LWEA 1B1ZA 4M9UA 4B3TL 1X3EA 3ERSX 1XMQQ 4DAYA 4YY3L 1N8RC 2UUCL 4MNOA 1JJCB 1GO3E 4UCTA 4FS1A 4A3JG 1TY0A 3KLSA 3VR4A 4A3GB 3L9AX 3KFUA 2FJ2A 2FMCA 4X65Q 3GV7B 2Z8LA 1XJVA 1TWCA 4QWBA 4J9KA 3PW2A 1MD2D 3D0FA 3DF7A 5C3WA 3K6OA 4CHTB 4J6HA 3SR1A 4LJZC 3RTXA 2GPSA 5KFFA 2FHTA 3MFIA 1CA5A 4O3QA 5IP9G 3HOYH 2W6NA 1Q3LA 2XVSA 5BPFA 4DN4M 3K5LA 4NKLA 2YL2A 4WJWA 3RLFA 2R7ZB 1RD9D 1BBWA 1DCZA 1SNQA 2ZTDA 3L0OA 2B2YC 1HNZH 1D2BA 5C5MA 2VS1A 2H4OA 4JUZA 1BR9A 2Z6KA 1I50B 3I8ZA 1E0BA 1QZHA 5EAYA 4XTCS 3W3AA 1WH2A 5IP7H 3JAMc 2EYOA 5KRUA 1YEZA 4DV2Q 1TAEA 3U4ZA 1EY5A 3SK5A 1TWAA 3BABA 1QUQA 1R9TH 4JI4Q 5KFAA 3KDFA 3CCJA 3VMMA 4XYLB 2W9BB 3BVMA 2FLNA 2DPIA 2R61A 2Y0SE 3NXWA 1B04A 3PO3H 3P20A 1HR0L 1NY4A 4B3RQ 2UU9H 3T13A 2ZDHA 3M4OH 1PVOA 3Q8RB 2XD4A 1N9WA 5LL6b 3CCRA 3ULPA 1N33Q 4BY7B 3VR5A 3QFFA 1F2ZA 2L4NA 1A63A 2R87A 4V0BA 4LF9L 2KEEA 2K5VA 2PMZE 1RCVD 5IODA 3KAJA 3CCMA 3GTOA 3PW0A 4DF7A 3G6XA 1PMRA 1HH2P 3NE5B 3RN2A 2IW3A 2PNHA 3S24A 3TIIA 3H3VC 5J2TF 5KFVA 1TS3A 2UVUA 2ATLA 4DV0L 1I94Q 2F0HA 2K05A 3N44B 1CK1A 4YY3Q 1CSQA 2UUCQ 1ZYRC 1LT4D 4N8X1 1MKHA 1J5EH 3STBC 5GAGC 2AWOA 4ILWA 4JOIA 2I07B 2YW2A 3N43B 2IL8A 5KFPA 1B50A 1M4VA 3E5SA 4WRDA 3HXLA 2B8GA 1Y1VB 2ICEC 4P74A 2HHHH 1BCPD 2IHFA 4A3BG 1CQJB 3L4JA 4L63B 3JAMW 1F77A 5KFWA 4QL5A 1VQJA 4RU9A 4CJ1B 2QYZA 4BWGB 1C30A 4FDBA 1STBA 1E4EB 4JBJA 3A0JA 2AGOA 3H3VH 4IUTA 1SYFA 3VPCA 1KNEA 4DFAA 4NXNL 4A3KB 3VPBA 4GLVB 1BNZA 1SDFA 3RNUA 1KD1C 1X32A 4DNRB 4MV6A 1C9OA 2AU0A 3MXGA 3F2CA 3JAME 3ZYYX 4A2BA 3R2TA 4C5BA 3TP6A 5KG4A 1PA6A 4IPDA 1HQMC 3D4WA 4F4YA 5K5PA 1IBKL 2EY6A 3ONAB 4X3TA 4K5WA 1DM0B 2B39A 1G6ZA 3NTKA 2E2JB 2DJFC 1GVPA 2LSSA 2PYKA 5CYUA 4AQYL 3MWDA 3M9OB 2F4IA 4M8AA 1BBXC 3OIPA 4LF9Q 4IAJA 3QIAA 5JH7F 5KFBA 3HB9A 2UXDL 1CKOA 1WCMG 5CGKA 2PQAA 2E5LH 1HXYD 4OX9Q 1G2TA 1EZ8A 1T5XD 1SSOA 2QDLA 1EQVA 1S9FA 4WBNF 1H9KA 3WDNA 2UUBQ 4DV0Q 4JV2A 4OONA 4C2MA 2EPBA 2A68D 3FKIG 2O4XA 3ITPA 4POFA 4HIOA 3CVZA 3WO0A 3BQ2A 1I6UA 1S3OA 4BA2I 1TWHA 1PRTC 5F9NA 3KHRA 2Z9HA 3S16H 2V59A 1FL0A 1PH3A 3MR5A 1X3QA 1SEBD 2L15A 4Q43A 5KFMA 1XWEA 3K8AA 4KLKA 4LF6Q 2NVYA 4I7ZC 4DA2A 2NB0A 4DR4Q 5E7NA 2CKZB 1PRTF 5FK9C 4A3EB 3FKIA 2YZNA 2SNSA 3JAMi 4NXNQ 2WP8J 4LMQD 3O13A 2AGPA 4Y7NB 1K3RA 3GTPB 2R7ZA 1A3TA 5M3MB 1JWUD 3NSWA 3GTGB 5DNFA 3JAML 3ORQA 3UFXB 3PUYA 4JI1L 1Q8IA 5IYCG 2JEFA 3Q0AA 1Y8OB 4TQSA 2K50A 2LMCB 2Q2TA 4LFCL 3U50C 1TWFB 2F4VH 2MFIA 1N32H 3IKJA 3NTIA 5KG1A 1UNSA 5GROA 4ALPA 2W6MA 3SK6A 1BUVT 5LYJF 2E2HH 2N3SA 1PH8A 4AYBE 3I73A 5KFYA 1PZKD 3VYSA 1BKBA 4RB0A 2ZTCA 4R4IA 4A3IG 4LF7L 4MA5A 2JA6G 2W9CA 3NQIA 4AQYQ 1Q1BA 4WFN3 2RBMA 2W6PA 4BY1B 1SBBB 1EYDA 1VQPA 4CJ0B 2F0GA 3R8BA 1B70B 4O42A 2MO1A 4LW1A 5HY6A 4RZRA 5C1OA 2IY5B 1UE6A 1FNUA 1DGSA 1LTBD 1G6PA 3CCSA 3PW5A 2EY1A 2ZXRA 1QE6A 4UHVA 4OIJA 2RDHA 1F2LA 1QG7A 2C35B 4GN4B 4ZK9B 1GYFA 4C1NI 3Q6SA 2FB9A 3OTOQ 3AYHB 1AUXA 2V4DA 1Q90A 2I5LX 1G291 2K01A 1NUCA 1U4LA 2N78A 5JVLA 4DR2H 2L0CA 4KJOA 1VS0A 2JA8G 1HQRD 5KT7A 3ND8A 1EOVA 2CQAA 3RBDA 3CMAA 3J7AV 1S0NA 3CD6A 2MNAA 2OEOA 5EKLA 5DM63 1WCMH 2XCPA 2OQKA 1MIUA 3S1MH 4DR6H 2NN6G 4A3DG 4B08A 2J4XA 2ZT9C 1S5CD 3DWAA 2R8IA 5C4JB 3HOZB 1Z2OX 3RAQA 1VQHA 1KRTA 2HUGA 1G2SA 2JSOA 1SNOA 5M3FB 4MTEA 1SE4A 1GUSA 2JYOA 2KHJA 3HOWB 2B2UA 4PG3A 1TS2A 1VQMA 4PDBA 1EIFA 2W7PA 1Z2NX 4F87A 1VQLA 4ZOLF 4ED1A 4UCSA 2OTJA 4QW9A 1KJ9A 4CDCC 4C3IB 5GAHC 2WB1B 1P8LA 1SYCA 3CCQA 2LFNA 3V2TA 4N8FA 4OEMB 3Q8QB 1JCKB 3NWSA 3W5OA 1WI5A 1KEEA 2HCCA 5NUCA 1CUKA 4PWQA 4BBSG 1EY9A 4QWAA 5C4XH 2KHSA 1D1IA 2KENA 4X66L 3LGJA 4LF7Q 2L5TA 2E74C 1PH9A 3QO2A 1Y1WG 1Q86C 2DPJA 4O2DA 1PYWD 3W1GA 4ZLTF 1EYAA 1KLGD 3KJOA 5EBDA 4IWXA 4OELB 4RCOA 2R7FA 1GUNA 3F2BA 1SCUB 2UXCH 3NPPA 3R2IA 1MSHA 1MSGA 5E3FA 2J6UA 2F3WA 3MJFA 3BU2A 1WJJA 4ZUIA 1U9RA 1VAJA 2XN9C 1J6QA 2K6AA 4DR7L 2FK3A 5LOVF 3H94A 1X56A 3K57A 4YHHH 5KKNB 1EOTA 2F0MA 4OO1H 4HYKA 2K5DA 3CU7A 2JA6H 3NBHA 2K03A 1UWVA 4XQNA 4LF5L 1EWIA 4B3TH 4GN3B 4ZI7F 3CP0A 2A19A 4IZOA 2BCOA 4JG2A 4AH6A 3V05A 4BXXG 2NVXB 5DG7A 4A93G 3UDGA 3KHLA 2B63B 4EQOA 2HHHL 2MQHA 1VKZA 4HCSA 2Y0SG 1R4PB 1GUTA 2KCTA 1SFOB 1BQQT 4GOPA 3V6JA 4GKKL 4QMGA 2YU9B 2C5CA 1EFWA 1OXVA 2JA8H 4XZ3B 4A75A 4K5VA 5CBAE 1HNZQ 3T1YL 2NVQH 4I55F 3OHBA 2IP4A 1B3QA 3I91A 3PW7A 4KHPH 4YWKA 4FXGC 3DXJC 4XYQA 5J3BA 1JICA 5C8YF 3BG3A 2NN6H 2A5HA 4NPSA 4A3FB 2Y0SA 3FPPA 3MFGA 5D3DA 5FLMG 3GV3A 3T56B 3FDTA 3CXCA 5KT2A 2I46A 1BCPC 2F0EA 1YZ6A 1I3QH 3PO2H 3LMLA 4I65A 2R6GA 1DOMA 2UU9Q 2OXPA 1HR0H 2PCFB 2W70A 1KAWA 3QWNA 1I6HH 2EQSA 4YJ2F 3GTLA 1ET6A 4G7OC 3GO5A 2VPQA 1L1OC 3CC2A 1EIGA 1CKNB 3S14B 4CJ2C 5L9XA 4IALA 2JJQA 1TWGA 5HURA 3N41B 3QZ7A 1BCPF 3F1ZA 2E5LL 2K75A 5C0XI 2WINB 1HA6A 4YWMA 1PTOD 4BBSH 4GOPC 2V58A 3MR6A 2RKSA 4E6IA 5IYBH 4JI6L 3PCOB 1KXLA 1EIHA 2VXWA 3KLSX 4UP7A 3L4KA 2CZGA 2JA5H 1XPUA 1Y1WH 4OL7A 5C44G 4CKCA 1J5EQ 3T1HL 1S97A 1SNMA 4DUYL 1SRUA 3I4LA 5I2YA 2ZJRA 4FF3A 5FO9B 5FD6A 3TN2A 2EXDA 4DAYB 1CA6A 1OXXK 1X3GA 2HHHQ 1VBHA 2EDGA 1EQRA 2N8NA 1KC8C 3S15B 2HD3A 4IUUA 1F2YA 3QB3A 1S0OA 1HZAA 4IOCA 4WORA 1TWCB 1DIKA 2UUAL 3TQTA 2VUGA 2FINB 2PNRC 4QUFA 2PW7A 4C3JH 1C48A 5AJ3L 2R7LA 1EYZA 1RTOA 1AZPA 1D6EC 1CHPD 1I4PA 1V1QA 2WB1A 1U4PA 2KCNA 2A68C 2UVRA 4BXXH 4XIGS 5LHY1 4CKBA 5DQIA 1V9PA 3Q8PB 4CC5A 3D4RA 2F4VL 4A3JB 3CRKC 5F9LA 4ZCKA 4YBZB 2R8KA 1RYSA 2L55A 3RUZA 1EWHA 1ASZA 3IFDA 3I4NG 4DUZL 2EE1A 3BZKA 1HNXL 3I4MG 3HOXG 1HFNA 3X3MA 2WAQE 1TWAB 1IBKH 2RA4A 1QUQB 2NTSA 3AB9A 3KF8A 3KDFB 1LT3D 1TVXA 3DEPA 5AFWA 1BF4A 5KFJA 5BMVF 4DAVA 5JOBA 2XTIA 4GZYC 1NR2A 2F0SA 2I5MX 4K2LA 5I6WA 2KUMA 1A2TA 3CC7A 1KLUD 5CV4A 1O80A 2FPPB 3T5HA 4IO9A 4EGJA 2UXDH 3GILA 2E5LQ 4A3LH 4JI0L 1PYBA 3B6YA 3AFQA 3TQYA 5FLMH 3GTOB 2XNAC 1W6JA 3E0JA 3HOUH 4LUVA 1VF7A 4H44C 4JI5Q 4DK1A 2F0FA 4B3MH 1CTMA 4XQQA 1QVFA 5D14A 4K0KH 4FF4A 3K5IA 4R4CA 3HOYG 4RUCA 2YS6A 1AW7A 1A3UA 3K7AB 3ND9A 1AN8A 3G8CA 3GIKA 1H9SA 3G6YA 4QCLA 1TIID 1UNNC 3ETHA 2LKVA 4AYBG 1GXDC 3VDYA 2NYZD 3TRZA 2WDTA 2OF1A 5IP7G 4ED3A 1NJIC 4KMUC 5FD5A 2QCPX 3E6ZX 1B4OA 1L0XB 3D6WA 1V4YA 2GPWA 1YHAA 2WFWA 4XX0B 1RYRA 2IHEA 2ASBA 3PO3G 4DL6A 5C44H 3HP3A 4NMZA 2UVWA 2CCZA 3KBGA 2CWAA 3VYTA 1BVSA 4JI1H 2W7OA 5JJIA 1C4QA 4DV3H 5IGCA 1VQNA 3RAXA 3TSSA 2F4VQ 4LMYA 1HR0W 2PBZA 4HNTA 1N32Q 4LFCH 1ZQ7A 3MAQA 3MWEA 4BBRH 2VUMH 1E7ZA 1F9RA 1UE1A 3MHBA 2CQOA 4A3BB 2FPIB 3HGBA 5KFDA 4F50A 1IL2A 5CMDA 1R9TA 2E2HB 2XIGA 4RAYA 3KUPA 2DLNA 4Q0YA 4RG1A 1VQKA 4J9MA 2P0AA 3AMUA 5ELBA 1QWYA 3DWPA 1ILPA 1KJQA 2FE3A 4JBKA 1I4HA 1ET9A 1X3PA 3Q8DA 2X0SA 2EY2A 4O4HF 1SYBA 2VNUD 3LWBA 2UXCL 2B2YA 4WD3A 1JJ2A 3S2HH 1KNAA 4I7AA 3I4NH 4NP5A 1Q12A 5JVH3 2EYLA 2PQAB 5L37A 2E2IH 3ORRA 2WYOA 5EJWA 3WOEA 4YHHL 4G7ZC 5D1OA 1A3VA 1BJTA 1QOHA 4DR2Q 3FEWX 4O4IF 1M6VA 1EY4A 3HRZC 4C2MB 1M0TA 3BDCA 4RHRA 4RWSC 3RBEA 4C3HH 1TWHB 1K83H 4RGTA 4HQ6A 2FP4B 3N42B 1K9MC 3U4VA 5DLGA 4IR1A 3MXNA 1YJWA 1K3BC 4DR6Q 3BJUA 2K5WA 3U9SA 1VQCA 3KYHC 4MIUA 1WCMB 2H5XA 4P2CB 4Z9CB 5IYDG 1L0YB 3F8TA 4X3UA 4RUAA 5EBCA 3TP5A 4HSPA 1HZ9A 3MWMA 4QW8A 2NVYB 4LF4L 4J15A 5DGAA 4DL4A 1NSNS 1XPRA 1DV1A 1I7LA 1ML0D 2RSOA 1SXTA 4L5RC 3RZDH 1EY0A 4ECRA 3FKIB 1IYUA 1STAA 2HCIA 4QQBX 3GTMH 1LTGD 4PZ6A 3HZXA 1OO9B 4KHPL 5M5YB 2I87A 1KDCA 1VQ8A 1D7QA 1E4GT 3GTJH 2ZJQA 3U9OA 4GS3A 4X62H 5KT5A 5D3IB 3T5JA 2QDBA 3I12A 1JIHA 2TMPA 3CCUA 2XIWA 5EQ0A 4YAKB 4I4TF 3IAYA 1ENAA 2EY5A 4F7XA 4RGOS 4UPAA 3DM3A 4X66H 4QJFA 2FLLA 4PQXA 4R9WA 1JDEA 2JA7H 1PX2A 3EPGA 1B9NA 2Q8TA 2HVSA 1KJ8A 4ECWA 3WWVA 1VQBA 3HKZE 3CQZH 3OMCA 2NWGA 5GADC 3TBIB 3D31A 2W9CB 2F0QA 2R7KA 2UXCQ 4DR3H 3C3LA 2HVRA 2O03A 1WTHA 2K4KA 5LL6S 3M4YA 3HFZB 5EWFA 1DONA 2JEGA 2GN5A 4HNUA 1JWMD 4APMA 4IFDH 3GTQH 3KTMA 3KALA 4QWCA 1AZQA 3VYUA 3PUXA 1FR3A 4YHHQ 3A54A 2C00A 3M9MB 4DR7H 3MR2A 2NTTA 3PGZA 5I4DA 3BS1A 1KTKA 2PW5A 1Q8KA 4RGNA 3ICEA 2CH4W 2PZWA 2Z4IA 4A3IB 4MN3A 4B3TQ 1HA5A 1M0WA 3SE7A 2L1BA 2JA6B 5GONF 2KA7A 4ZHQF 2BH8A 4LF5H 5KYIA 2CW7A 4FXKC 1BO0A 3RN5A 4MV9A 2F0WA 1O75A 1T36A 3CAMA 2G5DA 2F0PA 4KKTA 1ESRA 1W3SA 3F2DA 3RZOH 1H9MA 2ES2A 3IL8A 1HZCA 1STGA 1LTID 3NBIA 2D0OA 1QILA 4RHSA 2HVQA 3RB4A 4OHJA 2Q2IA 5DM73 3H15A 4QGUA 3E0EA 1XTCD 4TUYF 4O2AF 1YJNA 3RJ0A 4GKKH 3KJPA 4B9WA 1M90C 1PTOC 4IUQA 1SE8A 3AU7A 3OHXC 3I70A 4H02A 1F9PA 1X65A 1TXYA 4KHPQ 2JA8B 1GLVA 3IG0A 2Q8RE 1FVIA 3EBEA 3T1YH 3TINA 2EVBA 2A69D 4TV9F 3GDEA 1RL2A 4EFBA 3EA6A 1CQFA 3H0GG 1Z7TA 5IYDH 4A3DB 3OW7A 2R92H 5CV5A 2E2HA 5KYLA 1PTOF 2CHBD 3J80c 4DV7H 2HIXA 5H80A 1UEBA 2ASDA 3I55A 3K7UC 3CCEA 1HR0Q 1WD0A 1X54A 4EVOA 2ATWA 4DK0A 3H4BA 2KVMA 2B29A 1HHVA 1O78A 1RHPA 4P71A 4TKOB 4EYIB 4RNMA 1PTOH 3TIGA 1I6HB 4DLKA 3OUUA 4QWEA 2P5ZX 5KFGA 2HIVA 5CAEB 5ELCA 2J6SA 4KY7A 3WO1A 4Q45A 1JE4A 4ED7A 5KFQA 1TY2A 4YWLA 4YP3A 4RCNA 4UDUC 5KT6A 4ECXA 4K2KA 1S5DD 2NZOA 5DQHA 1WTVA 2VQEL 4P73A 4MV4A 2V1CC 3BDOA 4NDXA 4BBSB 3CCVA 3QG1A 4JI6H 3N6RA 3R93A 3OPOA 1B53A 5A2QL 2AWNA 3CF5A 5KT3A 4B3ML 1EIYB 5EZYF 4K0KL 2R6FA 4IFDJ 1I4XA 3T1HH 4DUYH 2E75C 3NBHB 3S1QH 4A2AA 2VOBA 5KG0A 1EQTA 3BG5A 4ME5A 4O3OA 1WCMA 5DG8A 2HGSA 4GKJL 5M5WH 1JE5A 2EYFA 3RR5A 2OWOA 1PZJD 1SN8A 2WAQG 2IBKA 5KX5F 1O7IA 1E2ZA 3J80W 1SNPA 3GIQA 1GSAA 5C4XG 5C6AA 4JI2L 2A6ED 2UUAH 4GOPB 1JC7A 2DWCA 4MV8A 3SHLA 4FF1A 1K1SA 5LMNH 4IZ8A 1XXGA 1E3PA 2J0TD 1CKMA 5L1IA 2R86A 4DV3L 2WTFA 3S1NH 1S4ZA 5FPRA 1KABA 1D5MC 4A93B 2WAQA 2R84A 3EQLC 4O1NA 4LSXA 4L8JA 3J80E 2Y0SB 2GLTA 2KOLA 1STHA 3PMFA 5JAVA 4DUZH 1IBKQ 1SJED 1HNXH 4CBVA 4O2BF 2YS7A 5BPHA 3KLWA 2A8VA 1MJCA 1Y8PB 1FNVA 1AE3A 3BYTB 2IX1A 4OO1G 2SDFA 3GIPA 1PDQA 1EUDB 2KJXA 4BY7G 4TQRA 5KFOA 1JB7A 4FVMA 3K59A 2B2VC 2PMZB 5IE8A 3V6KA 3E9IA 2UXDQ 3GTLB 5KNCA 1JX4A 4R4OA 3H0GH 1MZBA 1FJGH 1RKNA 1E24A 4CKEA 3NTHA 1ZKOA 1IHZA 4JI0H 1GGOA 1TWGB 1X6OA 3GIIA 1ONLA 2VA2A 2XWJB 4N9PA 4DR5L 1SMYD 2F03A 4HJ9A 2XGPA 5KT4A 4QF4A 4DXGA 4B3MQ 4POGA 3UQ8A 3KOJA 2JA6A 5BR8H 4DL3A 1CSPA 4DV1L 3SEBA 2NU6B 1MI2A 1LO5D 5COYA 5DEHA 4CC6A 5KG5A 2MHVA 2VQDA 2O5IC 1ILQA 3AFPA 3EVQA 3C46A 1WTXA 5KGUA 4U6PA 1VBGA 1D8LA 4F4XA 4MTDA 1QJOA 2NVTB 1XNQH 3K5HA 3H3VI 4QY7A 3DWQA 3R3OA 2O2LD 1NCVA 1R4QB 2KCMA 4RKBA 3NELA 1BXTA 5IOCA 1L0WA 2J7ZA 5C0XH 2R93G 1DXMA 4IWYA 3GV5B 1IYJB 1DJRD 3PO2G 2EJMA 3ERQA 1B33N 2XCLA 3PV0A 2IJ0A 5C4HA 3J80i 4UP9A 3V4ZA 2VA3A 1N48A 5ELNA 4JI1Q 1EZ1A 2D2CC 5I6YA 4DV3Q 1VQ4A 3CW2C 1ZHSA 3ETJA 3J80L 4FYDA 4LFCQ 4DV5L 4A3GH 4J9LA 4RH6A 3QJYA 5DQGA 4X62L 1KQSA 3HOVG 4DV4H 2G9DA 5E1FA 3PW4A 1M8AA 3I4OA 3VPDA 2W8LA 2R93A 4LFAH 5IYBG 2BQRA 1LT5D 1I3QA 1YITA 1CQIB 4K5XA 5TSSA 2VB3X 2JA5G 1RTNA 2C2DA 2YRWA 2FK2A 3KF8B 1A0IA 3LP8A 3S1RB 5BN3A 5IIFA 1I50H 1NR4A 3Q24A 4Y8VB 4DR3L 3JSLA 1S68A 5IWAL 3NEMA 3PSIA 3RF2A 2GVAA 4LF8H 3RB6A 1JOQA 4OIKA 1W2BA 2I8CA 3RMHA 5IGEA 3N8DA 2QK4A 3DLLA 3I4MB 4CDDC 2PZTA 3HOXB 1LTSD 2JA5A 1VQEA 1GUGA 4IRKA 4O3RA 3HG9A 4IHJF 1Y1WA 1VQ7A 1PH6A 2HDLA 1Z47A 2WKCA 4C3JG 3CC4A 2WV6D 4BY7H 4JI3L 2JEIA 2M00A 2RHSB 2DY8A 4KN4C 2BE5D 3EROA 1G51A 1V8QA 1B7YB 1F2MA 3M4IA 5A35A 2UVVA 4JI7L 2D9UA 2AMCB 4UAIA 1IW7D 1L1OA 5LMNW 4LFBL 5IGDA 1H9SB 1HJPA 1BOSA 2R7MA 2CW0D 2L12A 4IURA 2F3IA 4KV6A 3HKZG 2QEJC 4Q0FA 4LF4H 1BDOA 2FMAA 3JRXA 4PZ8A 5J2UF 3T4AC 2VW9A 1YIJA 1AE2A 3M4PA 1L2FA 1SLJA 4ED2A 1WTPA 3TZDA 3HOYB 4YJ3F 4LNQA 4L5SA 1Y1VH 3K81C 4RKLA 3E3XA 5FJ8H 5C0XJ 4X62Q 2XGQA 3S9WA 1P16A 2VPSA 2R3ZA 3J81j 1X9NA 1SYDA 4AYBB 2X69A 1JJGA 2AHOB 4A3LG 1AH9A 1SEIA 3HKZA 2ASLA 1LTRD 3K58A 1FYCA 1FD7D 1WOCA 2K28A 4X66Q 4DV7L 1EQQA 1K8AC 3HOUG 1QVCA 4JV5L 2R93H 3K3PA 1R9TB 4A3KH 3L3OC 4HSVA 4TRDA 2VB2X 4HTHA 5EOYA 3PO3B 1TR5A 3FMAA 4HJAA 2PMZA 2HQLA 1PK8A 3M4OB 4DNTB 1WR2A 4QIWE 1VQ6A 3BZDB 2W9AA 2CVRA 1Z9FA 3MFYA 1YBYA 4PV1C 2OTLA 4MV1A 4UCOA 1QNUA 3HOVH 5KG6A 3RIZA 2A69C 1B6SA 3CKIB 4FF2A 4DR7Q 4JYAL 1TA8A 4RZQA 4R4TA 5BN5A 1SYGA 1C0AA 4J9RA 2OCEA 3PQIA 5C3EG 4LUZA 4YIJA 3F2UA 2FJZA 2EYPA 2E2JH 4YR3A 1EL0A 5D1OB 4LF5Q 1AEXA 2K14A 2D62A 5JVG3 1Y14B 3TMEA 2WIIB 1DV2A 2VQFL 3CMEA 3VA5A 1QNKA 3SE0A 3ULLA 1BXRA 2CH4A 4XXEA 3MXNB 3TP7A 1CI3M 3HOZG 5C5JA 1HTPA 2DUDA 3RZOB 2H1EA 1HCZA 1UUPA 2C9OA 3MXUA 4BBRG 2MCTA 2VUMG 2F0NA 3G6JB 1C3OA 2YTYA 2AQ4A 2IT1A 3KLRA 3NHHA 4GKKQ 5LMUL 3BDLA 1MJEA 1SNCA 4MHEA 1IBLH 2IPKD 5KFUA 2K32A 3WNZA 4KHZA 5LMNL 3A5ZB 3ZJYC 3T1YQ 3OSPA 2PZUA 1Z6HA 4L5TA 2J9GA 3TEHB 2N88A 3P1HA 5JUMA 4K8JA 1TT2A 1S0MA 2AUKA 2VUMA 1B44D 4DV7Q 5IY0A 1WYDA 4A3EH 1IKMA 1EEFD 5J1ZA 2E8GA 2EXZA 1IBMH 2ZDQA 2XCAA 4Y7NH 1O7ZA 3GTPH 4FU0A 5HV6A 4DK6C 5M3MH 5T14A 3R5HA 3GTGH 2SNMA 1T9HA 4GN5A 4TV8F 5ELEA 4RA8A 2A6EC 2D5DA 5CC4A 3RB0A 1PTOB 4FS2A 4C3HG 4AIMA 1TWFH 2BH2A 2RDGA 2EOTA 1A62A 1W93A 5JJKA 1G8ZD 4ECQA 1CHQD 3CRLC 1JMCA 5KNDA 4U7CA 1FJGL 3QOLA 4OO1I 1DOKA 1I6VC 3IFTA 1I4RA 5I2XA 5LA6F 2EIFA 2VQEH 4JI6Q 2E2IA 5I9PA 4GC6A 4JI8H 1O7YA 4QB4A 4MAMA 3OW2A 4RNOA 1PHJA 4DV6L 3ER0A 1EHIA 4KK7A 4ME6A 1VQOA 3TREA 5BR8L 3BQ0A 3T1HQ 2EZVA 4DUYQ 1HTLD 2NU8B 2F0TA 4I50F 1K83A 2CQYA 2F1MA 1Q82C 3S16B 1XPOA 5FPOA 4EYHB 1AFPA 2YZMA 1LTLA 4DR1L 2ASJA 3FHWA 1VCIA 5EGTA 4X64L 4GKJH 2B8FA 3A8KE 3PUZA 1YI2A 1XNQL 4UCUA 4EX5A 5FO8B 2UUAQ 2W8KA 3V96A 4MTNA 5C3EH 1EY6A 4JPBW 4JI2H 1FNWA 4R4QA 2R8JA 5LMNQ 1GUOA 2IMWP 5AJ3Q 2JA7G 5T1IA 4V190 3SDZA 1SMYC 2NUAB 5KG7A 2NN6I 1EY7A 2Q8IB 3GTMA 4YCVA 2KSWA 2RHQB 1PH4A 4ID6A 3RFCA 4PMWA 4DPGA 3GTJA 4AYBA 1PRTB 2JEJA 4H13C 4JV0A 3TS0A 1E1TA 3HOZH 3J7A5 2F0JA 4MZ9A 5IGFA 4DV4L 5EPKA 4DUZQ 4X65L 2UXBH 1HNXQ 4IFDG 4H0LC 5M3FH 2ENBA 1XDNA 5EWEA 1A8VA 3HOWH 4LFAL 1N34H 2EYMA 3KXYT 3LNNA 5L1KA 1C7YA 3R5XA 2JA7A 4ECYA 3TQ1A 2L9HA 4C3IH 2KHIA 3UE1A 2A73B 3CQZA 4L1KA 4O3SA 2RCFA 5JQWA 2ZXOA 1SAPA 1PFNA 4RNNA 5FOBB 2AGQA 1JWSD 4O0AA 1UAPA 1XMOH 3PIOA 2QF7A 4APVA 1RK6A 2R7NA 3IN5A 4OWXB 2EYHA 4LH7A 1FJGQ 3URYA 3SXHA 1AN7A 1NNXA 4LF8L 2AKWB 4JI0Q 4KD4A 4R8IA 3GTQA 2BQUA 2Q2HA 4DV2L 1JOKA 3M4QA 1S03G 4KI0A 3BJYA 4DR5H 1K73C 1CZGA 4JI4L 4HN7A 4ZQIA 1SROA 5KFHA 1EU4A 4B3RL 5IYZF 5C5LA 4IPGA 4GNXA 3NUCA 4ZKCB 1HNWH 4X3KA 4YQWA 4DV1H 5GAEC 4FO2A 2X6LA 1KJJA 3V4SA 4IUVA 1A6XA 5JPMC 2FLPA 3BA8A 2DGYA 2OLSA 4G3IA 4TVAB 4NB3A 1K0RA 5DAUA 4EQ5A 4G7HC 2W57A 3C0FB 5L1JA 1JKJB 4LK1C 1L2ZA 1IOVA 1BGWA 4UCRA 3S1MB 1LLRD 4MTKA 4C1NK 4NXMH 4IRCA 2HQEA 3S17H 2R92G 2XGTA 5KG3A 1VQDA 5KFRA 3CCLA 4ECVA 1VF5C 3KHGA 1I94L 2A1AA 5CV9A 4HMIA 1W96A 5KFCA 2JN4A 4KN7C 1HUNA 1V1PA 4IPHA 3BQ1A 2PQEA 3MA2B 3L2PA 2NVXH 1Y69U 2B63H 4PMBA 5IT9L 1GHKA 2FKLA 3MEHA 2XRQD 1X55A 4HMJA 4I7HA 1PXUA 1XX8A 4LSAA 4DV5H 2AUJD 3TDQA 5KFNA 2RGRA 1U4MA 2IX3A 4DV4Q 3BVZA 4A3CH 2K1BA 1SFOH 2BE5C 1YVCA 1B9MA 1EYCA 2WAQB 2R92A 1CS0A 4HNVA 4LAAA 5FKAC 1YJ9A 4R8NA 3FRPB 4LFAQ 3VYRA 4YR2A 2YU9H 1IW7C 1VQIA 3GD7A 3PIO3 5C4XB 4TQUS 4GNXC 2B2WC 5EKKA 2F52A 2CW0C 1MGSA 5E4WC 1LUZA 5CR3A 2RDJA 1KAAA 5ELFA 3EYYA 1CM9A 3KHHA 2D0PA 4A3FH 3HS0C 4LF8Q 4NW2A 5A2QW 4KTAA 5IWAH 1MHWC 1RJTA 1RK5A 3A8JE 1S5BD 4YR0A 4H7BA 3DHQA 3M7GA 1H95A 3RB3A 1QB5D 1Y8NB 3PVXA 2KCCA 1S72A 5I47A 1DD2A 2PI2E 4RGMA 3Q22A 3MZ5A 4ED0A 3N52A 1ZXTA 4WJ4A 4HJ7A 4YCWA 2YTVA 1G91A 4LUOA 4R1JA 3JZIA 3PR5B 3EIVA 4JBMA 1GHJA 4EBEA 4JI3H 4ZRZA 3S14H 3M9BA 2ZTEA 1IXRA 4ZYSA 5A2QE 2ZM6H 5HGTA 1HUMA 1I4GA 2VY3A 1PLFA 1EUCB 4JI7H 2MGSA 2C2EA 4HR7A 3U58A 4JW0A 5LL6X 3K0YA 3S2DH 4LFBH 2LXKA 4OX9L 1XNRH 1VQ5A 2IX0A 3RUPA 2ZXPA 4B9XA 4U673 4LF4Q 3BAAA 2SOBA 3OSNA 3G71A 2UUBL 4J9PA 1CZWA 1JQYD 1YNXA 1VQAA 1SMXA 5JEAH 1IBLL 4RB3C 2MP1A 2G9HD 3GTKH 3G4SA 1IZ6A 2V4RA 3M3YH 4KD3A 5C1PA 2RDIA 3TS2A 2Z6KC 1KC7A 4OXPA 2GA4B 3D4DA 2AQ2B 4C56C 1WTWA 1Q81C 1PH2A 3JC66 2NVQB 5JVDF 2Q2UA 3S15H 5M9OA 2PVPA 3MEFA 4A3MG 1HRJA 2PN1A 3EN2A 2EJFC 4LF6L 1TWCH 1KIXA 2L11A 2NU7B 1B3AA 4DL5A 1FKAH 3Q1KA 5KFEA 1ZETA 4DR4L 1VQFA 4K6LA 1IBML 3K3VA 4JV5H 1GJXA 4ULLA 2R93B 5EPLA 4QIWA 1PH7A 3LX0A 1I3QB 3FVQA 3PO2B 1RF2D 1RJQA 2V4QA 4U68A 2RSNA 5KFTA 5CORA 4QWDA 4A3JH 1E22A 1EZ6A 3FPUB 5G3LD 2WB1E 3CPFA 3H0GA 4CDEC 2MPMA 4K14A 4MV7A 4J9SA 2SEBD 2LY7A 1KJIA 3HOVB 2NZ1D 1TWAH 1STEA 4X3SA 4JYAH 1X3FA 5EKIA 1RODA 4P75A 5J22A 1RJRA 4OWTB 4JI8L 2BA0A 2YCHA 5IP9H 4B3SH 4UCVA 5C0XG 1PFSA 3C1FA 5F2DA 2JA5B 2DNEA 4JOIC 1WTOA 1Y1WB 2E2DC 1BCPB 3QZ8A 3SK4A 2F3VA 4RMFA 2BQ3A 3CPWA 2VQFH 4XQJA 2B2VA 5M5XH 5HGQA 4A3GG 5KFKA 5I9OA 3GTOH 1OWTA 3GQBA 4C5CA 1U0LA 1ASYA 1L1OB 2DNCA 1S40A 2QILA 4XT3B 5IGBA 2F0OA 2K5QA 2JP1A 2NBFA 4EQPA 2ZJTA 4Q8FA 5FO7B 2A6HD 1S5FD 2K5HA 3GIMA 5T1GA 1NTGA 3OTOL 1EEID 1IBLQ 5LMUH 3OMGA 4JI5H 1BNCA 1I7NA 1B2TA 1D1KA 1ESFA 2NZHA 4DU9A 1UC9A 2R7ZG 3K7AH 1V1OA 3A5UA 4C3JB 3SVMA 1Z2PX 2FPGB 3NWTA 2C2RA 4NLGA 3H09A 3PUWA 4O3PA 3NENA 1V43A 2EJGC 4KY6A 5FLXc 1GUWA 4F4ZA 3T5LA 3VR6A 4OWWB 5H1SE 4FNFA 3DEOA 5JEAJ 2V9WA 4KHVA 3UDFA 1YNJD 4DL2A 3GIDA 4ZUJA 2UXBL 1IBMQ 4ED8A 4XDXA 1KL9A 3HKZB 2Z4HA 2RQXA 1N34L 5CV7A 1O7LA 3R23A 2R82A 2I80A 1T94A 1C8CA 3KBXA 5GQOA 4ZQ3A 4FBUA 5DGBA 3SI8A 2Z6BA 4IFDI 2N55A 1IOWA 1I50A 1WFQA 4BWSC 2LS01 2LXJA 2R8HA 1XMOL 1JDBB 2Z0SA 4A3MH 2VL6A 3K5NA 1VMCA 4ABNA 4A3BH 1GSOA 4G57A 2I0QA 1N56A 3OIQA 3F8NA 2W9BA 3G7LA 2VQEQ 1TS5A 2NUCA 3VA7A 2W71A 2IA6A 4RFBA 2F0DA 2K04A 4JI8Q 5JJLA 4IOAA 4DKAC 4GLXA 3HOUB 5HBRB 5DLQE 4DV6H 4IUNA 4IRDA 1T5EA 4K0KQ 1NE3A 4IJHA 4UP8A 1HNWL 5KG2A 4P72A 4C5AA 3MXPA 1YHQA 1GOZA 1WTRA 2DY7A 3K80C 4KKSA 3G48A 1SE2A 4GLAC 5FLXW 1Y1VG 4GKJQ 5EDWA 5FJ8G 4DGZA 4N9TA 4DR1H 2YV5A 5KNBA 4X64H 5K36G 3T5KA 3J7AK 1Q46A 1ZEQX 4NXML 3FDSA 3A55A 1K0SA 4R8UB 2ICIA 4JI2Q 3TP8A 1STNA 4C2MH 2RF4A 5C3EB 1TS4A 4A3KG 2R85A 1YNND 1K8OA 4LH6A 4JBWA 1M1KC 1TWHH 1N36H 2B3GA 4OGQC 3PF5A 5C3XA 4J8QA 5C44B 2B2TA 1Q7YC 4XYOA 1XMQH 5FLXE 5BN4A 1Y1VA 1FGBD 2DN8A 4PMCA 2R8GA 3G6EA 1STYA 1WTQA 5CV8A 4JCVE 2UXBQ 2NVYH 2F0KA 1XYIA 3SK8A 1LT6D 2KECA 4F8MA 1E4EA 4X65H 4BBRB 3C2PA 2VUMB 1N34Q 2RGVA 3K5OA 4A76A 3P7JA 1TQOA 3FKIH 2W6OA 2F0UA 4Q5VA 2YZGA 1M7JA 4HJ5A 2HDMA 3UDXA 3H20A 3H40A 2R7ZH 2BA1A 1UC8A 2ALZA 4IPCA 1HFGA 1NMGA 5M5YH 4M7EA 1HNZL 4MA0A 1XMOQ 2AQ1B 3V6HA 4RAUC 3A7AB 3FMCA 1J8IA 1EUJA 4Q44A 1LYLA 4YB8B 1XTDA 4S3SA 1IKLA 2BDOA 4DR5Q 3S2HB 4DV2H 1NMFA 5CBEE 4JC0A 1UE5A 1E4FT 1GD7A 3C1EA 1F9SA 3I4NB 3NGDA 1PV4A 4JI4H 2YYZA 3EPIA 1S5ED 2BR0A 4LWCA 1SE3A 1CFMA 4FXDA 2E2IB 4EBCA 4FM9A 1WSCA 2M05A 1SR3A 2UU9L 1HNWQ 4DV1Q 4B3RH 1RIPA 2K52A 5CA0F 2B2TC 2QKIC 4EEYA 1U4RA 3KK7A 3UDIA 2MUYA 5IYCH 3D8GA 4L6TB 5KFIA 4EBDA 2ZM6L 2K7VA 1N33H 4C3HB 2J6TA 4WJ3M 1WVLA 1K83B 2QEXA 1NAPA 2W6ZA 5E4XA 1K1QA 1VQGA 4NXMQ 3J7AF 2QGQA 2ZDGA 1KBLA 1XNRL 4A3EG 2B2UC 3S17B 4UFZA 4A3IH 3WOFA 4J1MA 4IN3A 5FLXL 3MR3A 1KDAA 1SYEA 5M3MG 3G6VA 4J9NA 3J7YW 1I94H 1A2UA 3JSNA 3RZDB 1J5EL 1S10A 5KEEA 4ETSA 4YY3H 1W6KA 2UUCH 4ECUA 3OOCA 2JQOA 3D3RA 3HKSA 4PZ7A 4KKUA 4DV5Q 3GTMB 3CHBD 2Z1CA 3BA9A 2BOSA 4Y52H 2ID0A 1EFID 2WKDA 2EYJA 5K36H 4HCEA 5KFSA 2E76C 3H4DA 3AQQA 3GTJB 1B6RA 4EGVA 2N49A 1AP0A 5LP6F 3VR2A 4EQNA 2BDNA 3I56A 5C4ZA 4FP5D 2F0IA 1HZBA 1LTTD 3GTPA 4IUPA 1YHBA 3GTGA 3I72A 1KHIA 1QCBD 1IL8A 2WE6A 2JA7B 4J9OA 4BY1G 1HPCA 1QVGA 2R7DA 3CQZB 3J81c 4DR3Q 3PUVA 4DXFA 1AUVA 1TWFA 1KDBA 4ECZA 3MVVA 5IWAQ 4X6AH 4A3DH 2I5HA 2KEDA 2PI2A 3R5FA 3H6MA 2TSSA 1A15A 3KF6B 3PZPA 2RVLA 3GTQB 4DAPA 4BA1I 1UEAB 1ZYRD 3RV3A 3STBD 5D8DA 1OXSC 3NP8A 3A56A 1D5ZC 4B3SL 1VDZA 4KY5A 3I3CA 2JEAI 4JI3Q 1OXTA 1JB3A 3RLOA 3RGZA 3IRBA 1DZ1A 4GNXB 3NQTA 2ZM6Q 3T51B 1D5XC 4LF9H 3MWYW 2WACA 3W1BA 4JI7Q 2XRSD 3BYYB 2QW7A 4LFBQ 1ENCA 4G4KA 5DG9A 3GQCA 1XNRQ 1LABA 3OWEB 1I5FA 3K0XA 3PN1A 5ISRA 1H9JA 4OX9H 4ME3A 3S2DB 4R8UA 5CA1F 1KRSA 4IR9A 3L7ZC 1PZID 3MC0B 5M3FG 2VR1A 1OXUA 1JORA 4JI5L 2FXQA 3HOWG 4DV0H 4IJLA 2XWBB 3OWFA 2UUBH 1ENFA 2KBNA 3GIJA 2JA9A 4C3IG 3GTKB 1CQVA 2WB1G 4CDFC 3A74A 3M3YB 1DOLA 4YCUA 5D1PA 1V1PB 2MJ8A 3J81W 1UE7A 3NK9A 1CT1D 3DM1A 3E5NA 1EWCA 3GLKA 1JT8A 1LV9A 5G3LF 1TU2B 1RDPD 4RB2C 3LWUA 1GKHA 2M2LA 2O5JC 3U9TA 3TZUA 4ED6A 1T3NA 1EY8A 1PH1A 4LF6H 4R7RA 4L5QA 3PF4A 3H91A 4JV5Q 3A7LA 5IT9c 2R92B 2DJGC 4DR4H 1JR0D 3EFXD 1K8MA 1SYXB 4HIMA 1GM5A 2A74C 3M7NA 4EGQA 4NXNH 1VQ9A 2A6HC 3GV8B 3J81E 2YYAA 1PFMA 3OUZA 4KJNA 4PNYA 2JEBI 2GVBA 5D65A 3P75A 4TSSA 4A93H 5CB4F 3BZCA 3Q23A 4DL7A 2JE6I 1N32L 3I7FA 1LTAD 4ZAIA 4XYMB 3PIPA 3DMUA 3UI2A 4J9QA 4JYAQ 3M9NB 2FMMA 3N40P 2OT2A 5KIXA 5KFXA 5K2MA 1PRTD 4BS9A 4B3SQ 2SCUB 4M1UB 1PYSB 1SJHD 1YNJC 4HAEA 5KFLA 1LACA 3OYYA 4Q8EA 3SGIA 4BY1H 2NU9B 2CWPA 3PR4A 4AQYH 2RCNA 1DYQA 3GTLH 2VQFQ 4HIDA 1SNDA 3D6CA
chains in the Genus database with same CATH topology
4BXXG 2B63G 3S1NH 3M85A 4LF8Q 3UDGA 4A93G 2OQ0A 1TWGH 2HHHL 2MQHA 2Y0SG 4A3CG 2KCTA 1H95A 4DK3C 1IBKQ 5LMUQ 1NBWA 4GOPA 1S72A 4GKKL 2PI2E 3KLWA 2A8VA 1MJCA 4HJ8A 4WJ4A 4HJ7A 4DR2L 4YCWA 2YTVA 1AE3A 4LUOA 4R1JA 1OXVA 1EFWA 2IX1A 2JA8H 4OO1G 3EIVA 1N36L 4JBMA 1Q1EA 4A75A 4BY7G 1JB7A 1HNZQ 3T1YL 2NVQH 3S14H 1XMQL 2HT1A 4DNIA 3M9BA 4YWKA 2ZTEA 1IXRA 5IE8A 3E9IA 2UXDQ 2NVTH 5J3BA 4A3FG 4R4OA 2VY3A 4DR6L 3H0GH 1LM0A 4NPSA 1E24A 5C4JH 2ZJPA 3U58A 3S2DH 2VZAA 2LXKA 1X6OA 3J81i 5FLMG 4OX9L 1VQ5A 2IX0A 4DR5L 3FP9A 3CXCA 4HJ9A 4LF4Q 1K8GA 1YZ6A 3I2ZA 3G71A 2UUBL 4B3MQ 4POGA 1I3QH 1E1OA 3AEVA 1YNXA 2K5NA 2R6GA 2UU9Q 1VQAA 3PO2H 1SMXA 1IBLL 3KOJA 3GTKH 1CSPA 1KAWA 1I6HH 3G4SA 2EQSA 1IZ6A 4DV1L 4A4IA 3M3YH 3ULJA 3TS2A 2Z6KC 3GO5A 4OXPA 1Q81C 1PH2A 1L1OC 3AFPA 3JC66 3CC2A 2Q2UA 3S15H 1CKNB 1HNWQ 3J7ZC 3MEFA 4A3MG 1D8LA 2JJQA 3EN2A 4HIKA 1EYGA 3F1ZA 2E5LL 2K75A 3KF6A 5C0XI 3H3VI 4LF6L 1TWCH 1BBUA 2YTXA 4QY7A 4YWMA 1KIXA 4GOPC 2MO0A 4BBSH 2JK8A 1FGUA 5IYBH 1VQFA 2KCMA 3PCOB 1IBML 1OTCA 4UP7A 4JI6L 4DR4L 2R93G 3NELA 4DV6Q 1L0WA 1PH5A 2JA5H 1XPUA 1IYJB 3S1RH 3PO2G 5BR8Q 1Y1WH 1PH7A 2CFMA 3PV0A 1QZGA 1KXLA 5JEAG 3J80i 4UP9A 5C44G 1J5EQ 3T1HL 5ELNA 4JI1Q 4DUYL 1SRUA 5ELOA 4DV3Q 1CKNA 3CW2C 2ZJRA 3UE0A 1VQ4A 4DAYB 2EXDA 4A3JH 4LFCQ 1OXXK 1E22A 1X3GA 4DV5L 2HHHQ 4DR1Q 1N33L 4A3GH 1EQRA 2WB1E 4X64Q 3CPFA 2N8NA 2QA4A 4X62L 1XNQQ 3RLNA 1U5KA 1KC8C 1KQSA 3HOVG 3E9HA 1B8AA 3I4MH 1HZAA 1TWAH 3HOXH 4IOCA 1X3FA 3I4OA 4P75A 4OWTB 2ALYB 2UUAL 4JI8L 5IYBG 4UY8C 2BA0A 1YITA 5IP9H 5C0XG 1N36Q 4C3JH 1PFSA 4DAMA 2JA5G 5AJ3L 3KF8B 1A0IA 4JOIC 4B3TL 1X3EA 3ERSX 1XMQQ 1V1QA 4YY3L 1N8RC 2UUCL 1I50H 4MNOA 4RMFA 3CPWA 1JJCB 4DR3L 1GO3E 4BXXH 4XIGS 1V9PA 5M5XH 3NEMA 3PSIA 5HGQA 5IWAL 4A3JG 4A3GG 2F4VL 3GTOH 2GVAA 3KFUA 1U0LA 4X65Q 1W2BA 1XJVA 1ASYA 1ASZA 3I4NG 1L1OB 4DUZL 1S40A 3BZKA 1HNXL 3D0FA 3I4MG 3HOXG 3DLLA 2WAQE 2K5HA 1NTGA 1QUQB 3OTOL 1IBLQ 3KDFB 1VQEA 2NZHA 5IP9G 1VQ7A 3HOYH 2XTIA 1PH6A 1Z47A 2R7ZG 3CC4A 3K7AH 2I5MX 4BY7H 4JI3L 3RLFA 3A5UA 1BBWA 3L0OA 2ZTDA 2RHSB 3CC7A 3PUWA 3NENA 1V43A 1G51A 5FLXc 4IO9A 1B7YB 2VS1A 2Z6KA 4JI7L 5H1SE 4OWWB 1QZHA 2AMCB 4XTCS 5EAYA 5JEAJ 1L1OA 5LMNW 5IP7H 2E5LQ 4LFBL 4A3LH 3JAMc 1HJPA 4JI0L 3UDFA 1PYBA 1YEZA 4DV2Q 3B6YA 3AFQA 3TQYA 5FLMH 3U4ZA 2UXBL 1IBMQ 3HOUH 1QUQA 1R9TH 2F3IA 4JI4Q 3KDFA 3CCJA 3HKZG 4LUVA 1KL9A 2Y0SE 4JI5Q 1N34L 3PO3H 4PZ8A 1HR0L 1NY4A 4B3RQ 2VW9A 1YIJA 1AE2A 1QVFA 3M4PA 1L2FA 1SLJA 4R4CA 3HOYG 3M4OH 1PVOA 5GQOA 1N9WA 4LNQA 3CCRA 3ULPA 4L5SA 1N33Q 1WFQA 4IFDI 1Y1VH 3K81C 2LXJA 1A63A 1XMOL 5FJ8H 2Z0SA 5C0XJ 4X62Q 4A3MH 4LF9L 2K5VA 2VL6A 4A3BH 4AYBG 2PMZE 1P16A 3VDYA 2I0QA 3J81j 3CCMA 1X9NA 3TRZA 1JJGA 5IP7G 2AHOB 2VQEQ 4A3LG 1AH9A 1HH2P 3RN2A 2PNHA 3S24A 1NJIC 1EQQA 1WOCA 4X66Q 4JI8Q 4DV7L 5JJLA 1K8AC 3HOUG 1QVCA 4IOAA 4JV5L 2R93H 4DKAC 1YHAA 2WFWA 4GLXA 4DV0L 5DLQE 4A3KH 1I94Q 2IHEA 2ASBA 3PO3G 4K0KQ 5C44H 1NE3A 4IJHA 4UP8A 4YY3Q 2CCZA 4P72A 1HNWL 1CSQA 2UUCQ 2CWAA 4HJAA 1BVSA 1MKHA 2HQLA 3STBC 1YHQA 3K80C 5GAGC 2AWOA 5JJIA 4JOIA 4QIWE 1VQNA 3G48A 1VQ6A 4GLAC 2F4VQ 1Y1VG 1HR0W 4GKJQ 1Z9FA 1N32Q 1YBYA 4P74A 5FJ8G 2OTLA 2IHFA 2YV5A 4A3BG 5K36G 3HOVH 4BBRH 2VUMH 1E7ZA 4QL5A 1UE1A 1Q46A 1VQJA 2CQOA 4JYAL 4NXML 4DR7Q 1IL2A 4R4TA 4FDBA 4JI2Q 1C0AA 2OCEA 4C2MH 2RF4A 3A0JA 4JBJA 5C3EG 4LUZA 3H3VH 4RG1A 2E2JH 4A3KG 1VQKA 4NXNL 4LF5Q 4JBWA 1M1KC 1TWHH 2B3GA 2K14A 2D62A 3PF5A 4GLVB 4JBKA 1Y14B 1Q7YC 3Q8DA 3RNUA 2VQFL 1KD1C 3CMEA 2VNUD 2UXCL 1C9OA 3G6EA 3F2CA 3ULLA 1JJ2A 3S2HH 3HOZG 3MXNB 4JCVE 2UXBQ 2DUDA 3I4NH 2NVYH 4BBRG 1Q12A 2VUMG 2PQAB 1PA6A 2YTYA 4IPDA 2IT1A 1N34Q 2E2IH 4A76A 4GKKQ 1IBKL 5LMUL 4YHHL 3FKIH 1MJEA 4DR2Q 4HJ5A 3UDXA 2R7ZH 2BA1A 4KHZA 5LMNL 3A5ZB 4IPCA 3ZJYC 1NMGA 3T1YQ 1GVPA 2LSSA 5M5YH 4C3HH 4AQYL 1HNZL 1K83H 1XMOQ 4L5TA 3TEHB 4LF9Q 1K9MC 3U4VA 1YJWA 2UXDL 4DR6Q 1CKOA 3BJUA 1EUJA 1WCMG 1LYLA 1VQCA 3KYHC 1XTDA 2H5XA 2PQAA 5IYDG 4OX9Q 3F8TA 4DV7Q 4DR5Q 5IY0A 1NMFA 1WYDA 4JC0A 4A3EH 1HZ9A 1UE5A 1GD7A 2E8GA 4J15A 2UUBQ 4DV0Q 1PV4A 4LF4L 4OONA 2YYZA 4Y7NH 1XPRA 4LWCA 3GTPH 4DK6C 5M3MH 3FKIG 1SR3A 4POFA 4HIOA 3RZDH 2UU9L 4L5RC 3GTGH 1T9HA 4GN5A 1S3OA 4DV1Q 1RIPA 2K52A 4BA2I 4QQBX 3GTMH 3S16H 4PZ6A 3UDIA 5IYCH 1FL0A 4KHPL 1PH3A 2BH2A 4AIMA 1TWFH 2ZM6L 2L15A 1VQ8A 1D7QA 4WJ3M 1A62A 3GTJH 2QEXA 2ZJQA 4GS3A 5JJKA 1JMCA 1FJGL 3K8AA 1VQGA 4KLKA 4LF6Q 4NXMQ 2QGQA 4OO1I 3CCUA 1XNRL 2EIFA 4JI6Q 4DR4Q 5E7NA 2CKZB 4A3EG 4UPAA 3DM3A 3OW2A 4A3IH 4QJFA 1PHJA 4DV6L 3JAMi 3ER0A 2JA7H 4NXNQ 2WP8J 1VQOA 3WWVA 3TREA 1VQBA 3HKZE 5M3MG 1K3RA 5BR8L 3T1HQ 4DUYQ 3CQZH 5GADC 1J5EL 3PUYA 4JI1L 3D31A 2UXCQ 2JQOA 3HKSA 4PZ7A 5IYCG 4DV5Q 1Q82C 1XPOA 2K50A 2Q2TA 4LFCL 2K4KA 3U50C 2ID0A 1LTLA 4DR1L 4Y52H 3FHWA 1VCIA 2MFIA 3HFZB 4X64L 2GN5A 1YI2A 3AQQA 3PUZA 1XNQL 5GROA 4ALPA 3GTQH 2N49A 2E2HH 2N3SA 1PH8A 4AYBE 4EX5A 3PUXA 4YHHQ 3I56A 2UUAQ 3PGZA 1BKBA 1HZBA 4MTNA 5C3EH 1Q8KA 4R4QA 2ZTCA 4R4IA 4A3IG 1YHBA 5LMNQ 4LF7L 3ICEA 1KHIA 5AJ3Q 2JA7G 2JA6G 4B3TQ 4BY1G 4AQYQ 1Q1BA 2NN6I 2BH8A 1QVGA 4YCVA 3RN5A 2R7DA 1VQPA 2RHQB 1PH4A 3J81c 4DR3Q 1B70B 3PUVA 2MO1A 4LW1A 5HY6A 4PMWA 3CAMA 4DPGA 5IWAQ 2IY5B 1UE6A 4X6AH 4A3DH 1DGSA 2I5HA 3CCSA 3TS0A 1E1TA 1G6PA 1W3SA 2PI2A 3F2DA 2ES2A 3RZOH 3HOZH 3J7A5 1HZCA 4MZ9A 4DV4L 4DUZQ 4X65L 2D0OA 3KF6B 2C35B 4GN4B 5M3FH 1HNXQ 4IFDG 2Q2IA 3H15A 1A8VA 4BA1I 4QGUA 3E0EA 3HOWH 3OTOQ 3AYHB 4LFAL 1YJNA 3STBD 3KJPA 1OXSC 1C7YA 2I5LX 1M90C 1G291 4B3SL 1SE8A 2N78A 4C3IH 2KHIA 2JEAI 3UE1A 4JI3Q 1VS0A 1OXTA 2JA8G 4H02A 1X65A 4KHPQ 1TXYA 3RLOA 3IRBA 1EOVA 3EBEA 1FVIA 2ZM6Q 4GNXB 3CMAA 3CD6A 4O0AA 2MNAA 3PIOA 3GDEA 4APVA 1RL2A 4JI7Q 1WCMH 4OWXB 3W1BA 1FJGQ 2OQKA 1MIUA 3S1MH 4LFBQ 3H0GG 4LF8L 2AKWB 2NN6G 4JI0Q 4A3DG 5IYDH 1XNRQ 1I5FA 3K0XA 2Q2HA 4DV2L 2R92H 4ME3A 3J80c 1KRSA 3M4QA 1VQHA 4KI0A 3L7ZC 1KRTA 1K73C 2HIXA 4JI4L 1UEBA 5M3FG 1OXUA 3I55A 3K7UC 3CCEA 1SROA 1HR0Q 4JI5L 2FXQA 3HOWG 4IJLA 2KHJA 1X54A 2ATWA 4PG3A 4B3RL 1VQMA 4IPGA 2B29A 2KBNA 1EIFA 4GNXA 4P71A 1VQLA 2JA9A 5GAEC 2OTJA 2WB1G 3A74A 5GAHC 2HIVA 4YCUA 2DGYA 1P8LA 1UE7A 4TVAB 4NB3A 1K0RA 4EQ5A 3CCQA 1JT8A 4YWLA 1GKHA 3W5OA 2NZOA 1WI5A 1PH1A 1CUKA 2VQEL 4BBSG 4P73A 3S17H 2V1CC 4L5QA 5C4XH 2R92G 3PF4A 4JV5Q 2XGTA 2KENA 5IT9c 3CCVA 4X66L 1VQDA 3LGJA 3CCLA 4LF7Q 2AWNA 3CF5A 1PH9A 1I94L 2A1AA 4HIMA 1GM5A 4B3ML 1Y1WG 1Q86C 1EIYB 3M7NA 4O2DA 4K0KL 3W1GA 1VQ9A 4IFDJ 4IPHA 3NBHB 3KJOA 3S1QH 3L2PA 2NVXH 2R7FA 2B63H 3F2BA 2JEBI 2GVBA 4A93H 1X55A 3BZCA 4GKJL 2JE6I 5M5WH 3I7FA 4DV4Q 1N32L 1JE5A 3BU2A 3RR5A 1WJJA 3PIPA 2OWOA 4A3CH 1SN8A 2WAQG 1SFOH 1YVCA 4JYAQ 1J6QA 1O7IA 1YJ9A 4LFAQ 4DR7L 1X56A 5C4XG 2YU9H 3GD7A 1VQIA 4JI2L 4B3SQ 4TQUS 1PYSB 4GNXC 4GOPB 2F52A 2JA6H 3OYYA 3SGIA 1UWVA 4BY1H 1LUZA 4LF5L 1EWIA 2CWPA 4GN3B 1E3PA 3CP0A 2A19A 1CKMA 2RCNA 4JG2A 4AH6A 3GTLH 2VQFQ 4DV3L 4HIDA 2D0PA 4A3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX G;  2B63 G;  3S1N H;  3M85 A;  4LF8 Q;  3UDG A;  4A93 G;  2OQ0 A;  1TWG H;  2HHH L;  2MQH A;  2Y0S G;  4A3C G;  2KCT A;  1H95 A;  4DK3 C;  1IBK Q;  5LMU Q;  1NBW A;  4GOP A;  1S72 A;  4GKK L;  2PI2 E;  3KLW A;  2A8V A;  1MJC A;  4HJ8 A;  4WJ4 A;  4HJ7 A;  4DR2 L;  4YCW A;  2YTV A;  1AE3 A;  4LUO A;  4R1J A;  1OXV A;  1EFW A;  2IX1 A;  2JA8 H;  4OO1 G;  3EIV A;  1N36 L;  4JBM A;  1Q1E A;  4A75 A;  4BY7 G;  1JB7 A;  1HNZ Q;  3T1Y L;  2NVQ H;  3S14 H;  1XMQ L;  2HT1 A;  4DNI A;  3M9B A;  4YWK A;  2ZTE A;  1IXR A;  5IE8 A;  3E9I A;  2UXD Q;  2NVT H;  5J3B A;  4A3F G;  4R4O A;  2VY3 A;  4DR6 L;  3H0G H;  1LM0 A;  4NPS A;  1E24 A;  5C4J H;  2ZJP A;  3U58 A;  3S2D H;  2VZA A;  2LXK A;  1X6O A;  3J81 i;  5FLM G;  4OX9 L;  1VQ5 A;  2IX0 A;  4DR5 L;  3FP9 A;  3CXC A;  4HJ9 A;  4LF4 Q;  1K8G A;  1YZ6 A;  3I2Z A;  3G71 A;  2UUB L;  4B3M Q;  4POG A;  1I3Q H;  1E1O A;  3AEV A;  1YNX A;  2K5N A;  2R6G A;  2UU9 Q;  1VQA A;  3PO2 H;  1SMX A;  1IBL L;  3KOJ A;  3GTK H;  1CSP A;  1KAW A;  1I6H H;  3G4S A;  2EQS A;  1IZ6 A;  4DV1 L;  4A4I A;  3M3Y H;  3ULJ A;  3TS2 A;  2Z6K C;  3GO5 A;  4OXP A;  1Q81 C;  1PH2 A;  1L1O C;  3AFP A;  3JC6 6;  3CC2 A;  2Q2U A;  3S15 H;  1CKN B;  1HNW Q;  3J7Z C;  3MEF A;  4A3M G;  1D8L A;  2JJQ A;  3EN2 A;  4HIK A;  1EYG A;  3F1Z A;  2E5L L;  2K75 A;  3KF6 A;  5C0X I;  3H3V I;  4LF6 L;  1TWC H;  1BBU A;  2YTX A;  4QY7 A;  4YWM A;  1KIX A;  4GOP C;  2MO0 A;  4BBS H;  2JK8 A;  1FGU A;  5IYB H;  1VQF A;  2KCM A;  3PCO B;  1IBM L;  1OTC A;  4UP7 A;  4JI6 L;  4DR4 L;  2R93 G;  3NEL A;  4DV6 Q;  1L0W A;  1PH5 A;  2JA5 H;  1XPU A;  1IYJ B;  3S1R H;  3PO2 G;  5BR8 Q;  1Y1W H;  1PH7 A;  2CFM A;  3PV0 A;  1QZG A;  1KXL A;  5JEA G;  3J80 i;  4UP9 A;  5C44 G;  1J5E Q;  3T1H L;  5ELN A;  4JI1 Q;  4DUY L;  1SRU A;  5ELO A;  4DV3 Q;  1CKN A;  3CW2 C;  2ZJR A;  3UE0 A;  1VQ4 A;  4DAY B;  2EXD A;  4A3J H;  4LFC Q;  1OXX K;  1E22 A;  1X3G A;  4DV5 L;  2HHH Q;  4DR1 Q;  1N33 L;  4A3G H;  1EQR A;  2WB1 E;  4X64 Q;  3CPF A;  2N8N A;  2QA4 A;  4X62 L;  1XNQ Q;  3RLN A;  1U5K A;  1KC8 C;  1KQS A;  3HOV G;  3E9H A;  1B8A A;  3I4M H;  1HZA A;  1TWA H;  3HOX H;  4IOC A;  1X3F A;  3I4O A;  4P75 A;  4OWT B;  2ALY B;  2UUA L;  4JI8 L;  5IYB G;  4UY8 C;  2BA0 A;  1YIT A;  5IP9 H;  5C0X G;  1N36 Q;  4C3J H;  1PFS A;  4DAM A;  2JA5 G;  5AJ3 L;  3KF8 B;  1A0I A;  4JOI C;  4B3T L;  1X3E A;  3ERS X;  1XMQ Q;  1V1Q A;  4YY3 L;  1N8R C;  2UUC L;  1I50 H;  4MNO A;  4RMF A;  3CPW A;  1JJC B;  4DR3 L;  1GO3 E;  4BXX H;  4XIG S;  1V9P A;  5M5X H;  3NEM A;  3PSI A;  5HGQ A;  5IWA L;  4A3J G;  4A3G G;  2F4V L;  3GTO H;  2GVA A;  3KFU A;  1U0L A;  4X65 Q;  1W2B A;  1XJV A;  1ASY A;  1ASZ A;  3I4N G;  1L1O B;  4DUZ L;  1S40 A;  3BZK A;  1HNX L;  3D0F A;  3I4M G;  3HOX G;  3DLL A;  2WAQ E;  2K5H A;  1NTG A;  1QUQ B;  3OTO L;  1IBL Q;  3KDF B;  1VQE A;  2NZH A;  5IP9 G;  1VQ7 A;  3HOY H;  2XTI A;  1PH6 A;  1Z47 A;  2R7Z G;  3CC4 A;  3K7A H;  2I5M X;  4BY7 H;  4JI3 L;  3RLF A;  3A5U A;  1BBW A;  3L0O A;  2ZTD A;  2RHS B;  3CC7 A;  3PUW A;  3NEN A;  1V43 A;  1G51 A;  5FLX c;  4IO9 A;  1B7Y B;  2VS1 A;  2Z6K A;  4JI7 L;  5H1S E;  4OWW B;  1QZH A;  2AMC B;  4XTC S;  5EAY A;  5JEA J;  1L1O A;  5LMN W;  5IP7 H;  2E5L Q;  4LFB L;  4A3L H;  3JAM c;  1HJP A;  4JI0 L;  3UDF A;  1PYB A;  1YEZ A;  4DV2 Q;  3B6Y A;  3AFQ A;  3TQY A;  5FLM H;  3U4Z A;  2UXB L;  1IBM Q;  3HOU H;  1QUQ A;  1R9T H;  2F3I A;  4JI4 Q;  3KDF A;  3CCJ A;  3HKZ G;  4LUV A;  1KL9 A;  2Y0S E;  4JI5 Q;  1N34 L;  3PO3 H;  4PZ8 A;  1HR0 L;  1NY4 A;  4B3R Q;  2VW9 A;  1YIJ A;  1AE2 A;  1QVF A;  3M4P A;  1L2F A;  1SLJ A;  4R4C A;  3HOY G;  3M4O H;  1PVO A;  5GQO A;  1N9W A;  4LNQ A;  3CCR A;  3ULP A;  4L5S A;  1N33 Q;  1WFQ A;  4IFD I;  1Y1V H;  3K81 C;  2LXJ A;  1A63 A;  1XMO L;  5FJ8 H;  2Z0S A;  5C0X J;  4X62 Q;  4A3M H;  4LF9 L;  2K5V A;  2VL6 A;  4A3B H;  4AYB G;  2PMZ E;  1P16 A;  3VDY A;  2I0Q A;  3J81 j;  3CCM A;  1X9N A;  3TRZ A;  1JJG A;  5IP7 G;  2AHO B;  2VQE Q;  4A3L G;  1AH9 A;  1HH2 P;  3RN2 A;  2PNH A;  3S24 A;  1NJI C;  1EQQ A;  1WOC A;  4X66 Q;  4JI8 Q;  4DV7 L;  5JJL A;  1K8A C;  3HOU G;  1QVC A;  4IOA A;  4JV5 L;  2R93 H;  4DKA C;  1YHA A;  2WFW A;  4GLX A;  4DV0 L;  5DLQ E;  4A3K H;  1I94 Q;  2IHE A;  2ASB A;  3PO3 G;  4K0K Q;  5C44 H;  1NE3 A;  4IJH A;  4UP8 A;  4YY3 Q;  2CCZ A;  4P72 A;  1HNW L;  1CSQ A;  2UUC Q;  2CWA A;  4HJA A;  1BVS A;  1MKH A;  2HQL A;  3STB C;  1YHQ A;  3K80 C;  5GAG C;  2AWO A;  5JJI A;  4JOI A;  4QIW E;  1VQN A;  3G48 A;  1VQ6 A;  4GLA C;  2F4V Q;  1Y1V G;  1HR0 W;  4GKJ Q;  1Z9F A;  1N32 Q;  1YBY A;  4P74 A;  5FJ8 G;  2OTL A;  2IHF A;  2YV5 A;  4A3B G;  5K36 G;  3HOV H;  4BBR H;  2VUM H;  1E7Z A;  4QL5 A;  1UE1 A;  1Q46 A;  1VQJ A;  2CQO A;  4JYA L;  4NXM L;  4DR7 Q;  1IL2 A;  4R4T A;  4FDB A;  4JI2 Q;  1C0A A;  2OCE A;  4C2M H;  2RF4 A;  3A0J A;  4JBJ A;  5C3E G;  4LUZ A;  3H3V H;  4RG1 A;  2E2J H;  4A3K G;  1VQK A;  4NXN L;  4LF5 Q;  4JBW A;  1M1K C;  1TWH H;  2B3G A;  2K14 A;  2D62 A;  3PF5 A;  4GLV B;  4JBK A;  1Y14 B;  1Q7Y C;  3Q8D A;  3RNU A;  2VQF L;  1KD1 C;  3CME A;  2VNU D;  2UXC L;  1C9O A;  3G6E A;  3F2C A;  3ULL A;  1JJ2 A;  3S2H H;  3HOZ G;  3MXN B;  4JCV E;  2UXB Q;  2DUD A;  3I4N H;  2NVY H;  4BBR G;  1Q12 A;  2VUM G;  2PQA B;  1PA6 A;  2YTY A;  4IPD A;  2IT1 A;  1N34 Q;  2E2I H;  4A76 A;  4GKK Q;  1IBK L;  5LMU L;  4YHH L;  3FKI H;  1MJE A;  4DR2 Q;  4HJ5 A;  3UDX A;  2R7Z H;  2BA1 A;  4KHZ A;  5LMN L;  3A5Z B;  4IPC A;  3ZJY C;  1NMG A;  3T1Y Q;  1GVP A;  2LSS A;  5M5Y H;  4C3H H;  4AQY L;  1HNZ L;  1K83 H;  1XMO Q;  4L5T A;  3TEH B;  4LF9 Q;  1K9M C;  3U4V A;  1YJW A;  2UXD L;  4DR6 Q;  1CKO A;  3BJU A;  1EUJ A;  1WCM G;  1LYL A;  1VQC A;  3KYH C;  1XTD A;  2H5X A;  2PQA A;  5IYD G;  4OX9 Q;  3F8T A;  4DV7 Q;  4DR5 Q;  5IY0 A;  1NMF A;  1WYD A;  4JC0 A;  4A3E H;  1HZ9 A;  1UE5 A;  1GD7 A;  2E8G A;  4J15 A;  2UUB Q;  4DV0 Q;  1PV4 A;  4LF4 L;  4OON A;  2YYZ A;  4Y7N H;  1XPR A;  4LWC A;  3GTP H;  4DK6 C;  5M3M H;  3FKI G;  1SR3 A;  4POF A;  4HIO A;  3RZD H;  2UU9 L;  4L5R C;  3GTG H;  1T9H A;  4GN5 A;  1S3O A;  4DV1 Q;  1RIP A;  2K52 A;  4BA2 I;  4QQB X;  3GTM H;  3S16 H;  4PZ6 A;  3UDI A;  5IYC H;  1FL0 A;  4KHP L;  1PH3 A;  2BH2 A;  4AIM A;  1TWF H;  2ZM6 L;  2L15 A;  1VQ8 A;  1D7Q A;  4WJ3 M;  1A62 A;  3GTJ H;  2QEX A;  2ZJQ A;  4GS3 A;  5JJK A;  1JMC A;  1FJG L;  3K8A A;  1VQG A;  4KLK A;  4LF6 Q;  4NXM Q;  2QGQ A;  4OO1 I;  3CCU A;  1XNR L;  2EIF A;  4JI6 Q;  4DR4 Q;  5E7N A;  2CKZ B;  4A3E G;  4UPA A;  3DM3 A;  3OW2 A;  4A3I H;  4QJF A;  1PHJ A;  4DV6 L;  3JAM i;  3ER0 A;  2JA7 H;  4NXN Q;  2WP8 J;  1VQO A;  3WWV A;  3TRE A;  1VQB A;  3HKZ E;  5M3M G;  1K3R A;  5BR8 L;  3T1H Q;  4DUY Q;  3CQZ H;  5GAD C;  1J5E L;  3PUY A;  4JI1 L;  3D31 A;  2UXC Q;  2JQO A;  3HKS A;  4PZ7 A;  5IYC G;  4DV5 Q;  1Q82 C;  1XPO A;  2K50 A;  2Q2T A;  4LFC L;  2K4K A;  3U50 C;  2ID0 A;  1LTL A;  4DR1 L;  4Y52 H;  3FHW A;  1VCI A;  2MFI A;  3HFZ B;  4X64 L;  2GN5 A;  1YI2 A;  3AQQ A;  3PUZ A;  1XNQ L;  5GRO A;  4ALP A;  3GTQ H;  2N49 A;  2E2H H;  2N3S A;  1PH8 A;  4AYB E;  4EX5 A;  3PUX A;  4YHH Q;  3I56 A;  2UUA Q;  3PGZ A;  1BKB A;  1HZB A;  4MTN A;  5C3E H;  1Q8K A;  4R4Q A;  2ZTC A;  4R4I A;  4A3I G;  1YHB A;  5LMN Q;  4LF7 L;  3ICE A;  1KHI A;  5AJ3 Q;  2JA7 G;  2JA6 G;  4B3T Q;  4BY1 G;  4AQY Q;  1Q1B A;  2NN6 I;  2BH8 A;  1QVG A;  4YCV A;  3RN5 A;  2R7D A;  1VQP A;  2RHQ B;  1PH4 A;  3J81 c;  4DR3 Q;  1B70 B;  3PUV A;  2MO1 A;  4LW1 A;  5HY6 A;  4PMW A;  3CAM A;  4DPG A;  5IWA Q;  2IY5 B;  1UE6 A;  4X6A H;  4A3D H;  1DGS A;  2I5H A;  3CCS A;  3TS0 A;  1E1T A;  1G6P A;  1W3S A;  2PI2 A;  3F2D A;  2ES2 A;  3RZO H;  3HOZ H;  3J7A 5;  1HZC A;  4MZ9 A;  4DV4 L;  4DUZ Q;  4X65 L;  2D0O A;  3KF6 B;  2C35 B;  4GN4 B;  5M3F H;  1HNX Q;  4IFD G;  2Q2I A;  3H15 A;  1A8V A;  4BA1 I;  4QGU A;  3E0E A;  3HOW H;  3OTO Q;  3AYH B;  4LFA L;  1YJN A;  3STB D;  3KJP A;  1OXS C;  1C7Y A;  2I5L X;  1M90 C;  1G29 1;  4B3S L;  1SE8 A;  2N78 A;  4C3I H;  2KHI A;  2JEA I;  3UE1 A;  4JI3 Q;  1VS0 A;  1OXT A;  2JA8 G;  4H02 A;  1X65 A;  4KHP Q;  1TXY A;  3RLO A;  3IRB A;  1EOV A;  3EBE A;  1FVI A;  2ZM6 Q;  4GNX B;  3CMA A;  3CD6 A;  4O0A A;  2MNA A;  3PIO A;  3GDE A;  4APV A;  1RL2 A;  4JI7 Q;  1WCM H;  4OWX B;  3W1B A;  1FJG Q;  2OQK A;  1MIU A;  3S1M H;  4LFB Q;  3H0G G;  4LF8 L;  2AKW B;  2NN6 G;  4JI0 Q;  4A3D G;  5IYD H;  1XNR Q;  1I5F A;  3K0X A;  2Q2H A;  4DV2 L;  2R92 H;  4ME3 A;  3J80 c;  1KRS A;  3M4Q A;  1VQH A;  4KI0 A;  3L7Z C;  1KRT A;  1K73 C;  2HIX A;  4JI4 L;  1UEB A;  5M3F G;  1OXU A;  3I55 A;  3K7U C;  3CCE A;  1SRO A;  1HR0 Q;  4JI5 L;  2FXQ A;  3HOW G;  4IJL A;  2KHJ A;  1X54 A;  2ATW A;  4PG3 A;  4B3R L;  1VQM A;  4IPG A;  2B29 A;  2KBN A;  1EIF A;  4GNX A;  4P71 A;  1VQL A;  2JA9 A;  5GAE C;  2OTJ A;  2WB1 G;  3A74 A;  5GAH C;  2HIV A;  4YCU A;  2DGY A;  1P8L A;  1UE7 A;  4TVA B;  4NB3 A;  1K0R A;  4EQ5 A;  3CCQ A;  1JT8 A;  4YWL A;  1GKH A;  3W5O A;  2NZO A;  1WI5 A;  1PH1 A;  1CUK A;  2VQE L;  4BBS G;  4P73 A;  3S17 H;  2V1C C;  4L5Q A;  5C4X H;  2R92 G;  3PF4 A;  4JV5 Q;  2XGT A;  2KEN A;  5IT9 c;  3CCV A;  4X66 L;  1VQD A;  3LGJ A;  3CCL A;  4LF7 Q;  2AWN A;  3CF5 A;  1PH9 A;  1I94 L;  2A1A A;  4HIM A;  1GM5 A;  4B3M L;  1Y1W G;  1Q86 C;  1EIY B;  3M7N A;  4O2D A;  4K0K L;  3W1G A;  1VQ9 A;  4IFD J;  4IPH A;  3NBH B;  3KJO A;  3S1Q H;  3L2P A;  2NVX H;  2R7F A;  2B63 H;  3F2B A;  2JEB I;  2GVB A;  4A93 H;  1X55 A;  3BZC A;  4GKJ L;  2JE6 I;  5M5W H;  3I7F A;  4DV4 Q;  1N32 L;  1JE5 A;  3BU2 A;  3RR5 A;  1WJJ A;  3PIP A;  2OWO A;  4A3C H;  1SN8 A;  2WAQ G;  1SFO H;  1YVC A;  4JYA Q;  1J6Q A;  1O7I A;  1YJ9 A;  4LFA Q;  4DR7 L;  1X56 A;  5C4X G;  2YU9 H;  3GD7 A;  1VQI A;  4JI2 L;  4B3S Q;  4TQU S;  1PYS B;  4GNX C;  4GOP B;  2F52 A;  2JA6 H;  3OYY A;  3SGI A;  1UWV A;  4BY1 H;  1LUZ A;  4LF5 L;  1EWI A;  2CWP A;  4GN3 B;  1E3P A;  3CP0 A;  2A19 A;  1CKM A;  2RCN A;  4JG2 A;  4AH6 A;  3GTL H;  2VQF Q;  4DV3 L;  4HID A;  2D0P A;  4A3F H; 
#chains in the Genus database with same CATH topology
 3S1Q B;  2B63 G;  3M85 A;  5L1L A;  2YRX A;  4O3N A;  2OQ0 A;  1TWG H;  3OSO A;  5M5X B;  3JRW A;  4F4W A;  4ECS A;  4QUC A;  4A3C G;  5M5W B;  4J0M A;  3HBL A;  4XT1 B;  4HR7 B;  3RD4 A;  5EPJ A;  4DK3 C;  5LMU Q;  1NBW A;  5IT9 W;  1CE8 A;  2RDF A;  1JLL B;  5CV6 A;  3OTO H;  4HJ8 A;  4DR2 L;  2XC9 A;  1ICF B;  4K6D A;  1N36 L;  5ELD A;  1Q1E A;  2F0V A;  2OH2 A;  3OHA A;  2NVX A;  1XMQ L;  5IGG A;  4DNI A;  2HT1 A;  2B63 A;  3MTS A;  5JPN C;  4GC7 A;  2NVT H;  3DUZ A;  3T16 A;  4A3F G;  4IQZ A;  1RJP A;  2PPB C;  4DR6 L;  1LM0 A;  2ZJP A;  5C4J H;  3S1N B;  2FK1 A;  1SFO A;  1A9X A;  2VZA A;  3J81 i;  1I4Q A;  5IT9 E;  2V5A A;  3FP9 A;  3BVG A;  4JVZ A;  1K8G A;  2YU9 A;  3W2D A;  3K5M A;  3I2Z A;  3J81 L;  3AEV A;  1E1O A;  2K5N A;  1JOO A;  3VR3 A;  3PIP 3;  4A4I A;  4QIW B;  3ULJ A;  2AQ3 B;  4RB1 A;  2IWH A;  1GSH A;  2C28 A;  4O4L F;  5DLF A;  1K28 A;  1YNN C;  4ZKB B;  2M9V A;  3J7Z C;  2DZD A;  4ECT A;  1J9O A;  5JJZ A;  4A3M B;  2W6Q A;  4HIK A;  1EYG A;  3QOJ A;  4CGY B;  3KF6 A;  1H9R A;  3Q2O A;  1BBU A;  2YTX A;  3H0G B;  1JXL A;  4JK1 C;  1E2W A;  1F9Q A;  1VMP A;  2MO0 A;  2X6G A;  2JK8 A;  2KQ3 A;  3EJI A;  2CW8 A;  3HEJ A;  1FGU A;  2F0L A;  3GV6 A;  1OTC A;  4YAJ B;  1IYV A;  2PO4 A;  1II3 A;  4DV6 Q;  3MFH A;  1PH5 A;  3QR8 A;  2HJW A;  4LF7 H;  3S1R H;  5BR8 Q;  5J39 A;  4JV1 A;  2CFM A;  1WD1 A;  1QZG A;  3RGX A;  5JEA G;  1ICW A;  4ODG A;  2B2W A;  4EG0 A;  5ELO A;  2XSC A;  1CKN A;  4E4T A;  5EWG A;  3UE0 A;  2K33 A;  2DIK A;  3GP7 A;  1ZHQ A;  2FFK B;  3X3N A;  3T53 B;  1N33 L;  4K8I A;  4DR1 Q;  2JXM B;  3A8I E;  4X64 Q;  3N6X A;  2QA4 A;  3I90 A;  4RAZ A;  3RV4 A;  1XNQ Q;  3RLN A;  1U5K A;  4FBT A;  3Q8S B;  4F88 A;  3E9H A;  1B8A A;  3I4M H;  4MV3 A;  5KFZ A;  3HOX H;  4EEQ A;  4EFE A;  5LXT F;  2C22 A;  4HED A;  2ALY B;  1EU3 A;  4UY8 C;  1TKW B;  1ULZ A;  3KAK A;  1PFB A;  1E2V A;  1MBY A;  1N36 Q;  4DAM A;  1V51 A;  3GTK A;  3LWE A;  1B1Z A;  4M9U A;  4B3T L;  1X3E A;  3ERS X;  1XMQ Q;  4DAY A;  4YY3 L;  1N8R C;  2UUC L;  4MNO A;  1JJC B;  1GO3 E;  4UCT A;  4FS1 A;  4A3J G;  1TY0 A;  3KLS A;  3VR4 A;  4A3G B;  3L9A X;  3KFU A;  2FJ2 A;  2FMC A;  4X65 Q;  3GV7 B;  2Z8L A;  1XJV A;  1TWC A;  4QWB A;  4J9K A;  3PW2 A;  1MD2 D;  3D0F A;  3DF7 A;  5C3W A;  3K6O A;  4CHT B;  4J6H A;  3SR1 A;  4LJZ C;  3RTX A;  2GPS A;  5KFF A;  2FHT A;  3MFI A;  1CA5 A;  4O3Q A;  5IP9 G;  3HOY H;  2W6N A;  1Q3L A;  2XVS A;  5BPF A;  4DN4 M;  3K5L A;  4NKL A;  2YL2 A;  4WJW A;  3RLF A;  2R7Z B;  1RD9 D;  1BBW A;  1DCZ A;  1SNQ A;  2ZTD A;  3L0O A;  2B2Y C;  1HNZ H;  1D2B A;  5C5M A;  2VS1 A;  2H4O A;  4JUZ A;  1BR9 A;  2Z6K A;  1I50 B;  3I8Z A;  1E0B A;  1QZH A;  5EAY A;  4XTC S;  3W3A A;  1WH2 A;  5IP7 H;  3JAM c;  2EYO A;  5KRU A;  1YEZ A;  4DV2 Q;  1TAE A;  3U4Z A;  1EY5 A;  3SK5 A;  1TWA A;  3BAB A;  1QUQ A;  1R9T H;  4JI4 Q;  5KFA A;  3KDF A;  3CCJ A;  3VMM A;  4XYL B;  2W9B B;  3BVM A;  2FLN A;  2DPI A;  2R61 A;  2Y0S E;  3NXW A;  1B04 A;  3PO3 H;  3P20 A;  1HR0 L;  1NY4 A;  4B3R Q;  2UU9 H;  3T13 A;  2ZDH A;  3M4O H;  1PVO A;  3Q8R B;  2XD4 A;  1N9W A;  5LL6 b;  3CCR A;  3ULP A;  1N33 Q;  4BY7 B;  3VR5 A;  3QFF A;  1F2Z A;  2L4N A;  1A63 A;  2R87 A;  4V0B A;  4LF9 L;  2KEE A;  2K5V A;  2PMZ E;  1RCV D;  5IOD A;  3KAJ A;  3CCM A;  3GTO A;  3PW0 A;  4DF7 A;  3G6X A;  1PMR A;  1HH2 P;  3NE5 B;  3RN2 A;  2IW3 A;  2PNH A;  3S24 A;  3TII A;  3H3V C;  5J2T F;  5KFV A;  1TS3 A;  2UVU A;  2ATL A;  4DV0 L;  1I94 Q;  2F0H A;  2K05 A;  3N44 B;  1CK1 A;  4YY3 Q;  1CSQ A;  2UUC Q;  1ZYR C;  1LT4 D;  4N8X 1;  1MKH A;  1J5E H;  3STB C;  5GAG C;  2AWO A;  4ILW A;  4JOI A;  2I07 B;  2YW2 A;  3N43 B;  2IL8 A;  5KFP A;  1B50 A;  1M4V A;  3E5S A;  4WRD A;  3HXL A;  2B8G A;  1Y1V B;  2ICE C;  4P74 A;  2HHH H;  1BCP D;  2IHF A;  4A3B G;  1CQJ B;  3L4J A;  4L63 B;  3JAM W;  1F77 A;  5KFW A;  4QL5 A;  1VQJ A;  4RU9 A;  4CJ1 B;  2QYZ A;  4BWG B;  1C30 A;  4FDB A;  1STB A;  1E4E B;  4JBJ A;  3A0J A;  2AGO A;  3H3V H;  4IUT A;  1SYF A;  3VPC A;  1KNE A;  4DFA A;  4NXN L;  4A3K B;  3VPB A;  4GLV B;  1BNZ A;  1SDF A;  3RNU A;  1KD1 C;  1X32 A;  4DNR B;  4MV6 A;  1C9O A;  2AU0 A;  3MXG A;  3F2C A;  3JAM E;  3ZYY X;  4A2B A;  3R2T A;  4C5B A;  3TP6 A;  5KG4 A;  1PA6 A;  4IPD A;  1HQM C;  3D4W A;  4F4Y A;  5K5P A;  1IBK L;  2EY6 A;  3ONA B;  4X3T A;  4K5W A;  1DM0 B;  2B39 A;  1G6Z A;  3NTK A;  2E2J B;  2DJF C;  1GVP A;  2LSS A;  2PYK A;  5CYU A;  4AQY L;  3MWD A;  3M9O B;  2F4I A;  4M8A A;  1BBX C;  3OIP A;  4LF9 Q;  4IAJ A;  3QIA A;  5JH7 F;  5KFB A;  3HB9 A;  2UXD L;  1CKO A;  1WCM G;  5CGK A;  2PQA A;  2E5L H;  1HXY D;  4OX9 Q;  1G2T A;  1EZ8 A;  1T5X D;  1SSO A;  2QDL A;  1EQV A;  1S9F A;  4WBN F;  1H9K A;  3WDN A;  2UUB Q;  4DV0 Q;  4JV2 A;  4OON A;  4C2M A;  2EPB A;  2A68 D;  3FKI G;  2O4X A;  3ITP A;  4POF A;  4HIO A;  3CVZ A;  3WO0 A;  3BQ2 A;  1I6U A;  1S3O A;  4BA2 I;  1TWH A;  1PRT C;  5F9N A;  3KHR A;  2Z9H A;  3S16 H;  2V59 A;  1FL0 A;  1PH3 A;  3MR5 A;  1X3Q A;  1SEB D;  2L15 A;  4Q43 A;  5KFM A;  1XWE A;  3K8A A;  4KLK A;  4LF6 Q;  2NVY A;  4I7Z C;  4DA2 A;  2NB0 A;  4DR4 Q;  5E7N A;  2CKZ B;  1PRT F;  5FK9 C;  4A3E B;  3FKI A;  2YZN A;  2SNS A;  3JAM i;  4NXN Q;  2WP8 J;  4LMQ D;  3O13 A;  2AGP A;  4Y7N B;  1K3R A;  3GTP B;  2R7Z A;  1A3T A;  5M3M B;  1JWU D;  3NSW A;  3GTG B;  5DNF A;  3JAM L;  3ORQ A;  3UFX B;  3PUY A;  4JI1 L;  1Q8I A;  5IYC G;  2JEF A;  3Q0A A;  1Y8O B;  4TQS A;  2K50 A;  2LMC B;  2Q2T A;  4LFC L;  3U50 C;  1TWF B;  2F4V H;  2MFI A;  1N32 H;  3IKJ A;  3NTI A;  5KG1 A;  1UNS A;  5GRO A;  4ALP A;  2W6M A;  3SK6 A;  1BUV T;  5LYJ F;  2E2H H;  2N3S A;  1PH8 A;  4AYB E;  3I73 A;  5KFY A;  1PZK D;  3VYS A;  1BKB A;  4RB0 A;  2ZTC A;  4R4I A;  4A3I G;  4LF7 L;  4MA5 A;  2JA6 G;  2W9C A;  3NQI A;  4AQY Q;  1Q1B A;  4WFN 3;  2RBM A;  2W6P A;  4BY1 B;  1SBB B;  1EYD A;  1VQP A;  4CJ0 B;  2F0G A;  3R8B A;  1B70 B;  4O42 A;  2MO1 A;  4LW1 A;  5HY6 A;  4RZR A;  5C1O A;  2IY5 B;  1UE6 A;  1FNU A;  1DGS A;  1LTB D;  1G6P A;  3CCS A;  3PW5 A;  2EY1 A;  2ZXR A;  1QE6 A;  4UHV A;  4OIJ A;  2RDH A;  1F2L A;  1QG7 A;  2C35 B;  4GN4 B;  4ZK9 B;  1GYF A;  4C1N I;  3Q6S A;  2FB9 A;  3OTO Q;  3AYH B;  1AUX A;  2V4D A;  1Q90 A;  2I5L X;  1G29 1;  2K01 A;  1NUC A;  1U4L A;  2N78 A;  5JVL A;  4DR2 H;  2L0C A;  4KJO A;  1VS0 A;  2JA8 G;  1HQR D;  5KT7 A;  3ND8 A;  1EOV A;  2CQA A;  3RBD A;  3CMA A;  3J7A V;  1S0N A;  3CD6 A;  2MNA A;  2OEO A;  5EKL A;  5DM6 3;  1WCM H;  2XCP A;  2OQK A;  1MIU A;  3S1M H;  4DR6 H;  2NN6 G;  4A3D G;  4B08 A;  2J4X A;  2ZT9 C;  1S5C D;  3DWA A;  2R8I A;  5C4J B;  3HOZ B;  1Z2O X;  3RAQ A;  1VQH A;  1KRT A;  2HUG A;  1G2S A;  2JSO A;  1SNO A;  5M3F B;  4MTE A;  1SE4 A;  1GUS A;  2JYO A;  2KHJ A;  3HOW B;  2B2U A;  4PG3 A;  1TS2 A;  1VQM A;  4PDB A;  1EIF A;  2W7P A;  1Z2N X;  4F87 A;  1VQL A;  4ZOL F;  4ED1 A;  4UCS A;  2OTJ A;  4QW9 A;  1KJ9 A;  4CDC C;  4C3I B;  5GAH C;  2WB1 B;  1P8L A;  1SYC A;  3CCQ A;  2LFN A;  3V2T A;  4N8F A;  4OEM B;  3Q8Q B;  1JCK B;  3NWS A;  3W5O A;  1WI5 A;  1KEE A;  2HCC A;  5NUC A;  1CUK A;  4PWQ A;  4BBS G;  1EY9 A;  4QWA A;  5C4X H;  2KHS A;  1D1I A;  2KEN A;  4X66 L;  3LGJ A;  4LF7 Q;  2L5T A;  2E74 C;  1PH9 A;  3QO2 A;  1Y1W G;  1Q86 C;  2DPJ A;  4O2D A;  1PYW D;  3W1G A;  4ZLT F;  1EYA A;  1KLG D;  3KJO A;  5EBD A;  4IWX A;  4OEL B;  4RCO A;  2R7F A;  1GUN A;  3F2B A;  1SCU B;  2UXC H;  3NPP A;  3R2I A;  1MSH A;  1MSG A;  5E3F A;  2J6U A;  2F3W A;  3MJF A;  3BU2 A;  1WJJ A;  4ZUI A;  1U9R A;  1VAJ A;  2XN9 C;  1J6Q A;  2K6A A;  4DR7 L;  2FK3 A;  5LOV F;  3H94 A;  1X56 A;  3K57 A;  4YHH H;  5KKN B;  1EOT A;  2F0M A;  4OO1 H;  4HYK A;  2K5D A;  3CU7 A;  2JA6 H;  3NBH A;  2K03 A;  1UWV A;  4XQN A;  4LF5 L;  1EWI A;  4B3T H;  4GN3 B;  4ZI7 F;  3CP0 A;  2A19 A;  4IZO A;  2BCO A;  4JG2 A;  4AH6 A;  3V05 A;  4BXX G;  2NVX B;  5DG7 A;  4A93 G;  3UDG A;  3KHL A;  2B63 B;  4EQO A;  2HHH L;  2MQH A;  1VKZ A;  4HCS A;  2Y0S G;  1R4P B;  1GUT A;  2KCT A;  1SFO B;  1BQQ T;  4GOP A;  3V6J A;  4GKK L;  4QMG A;  2YU9 B;  2C5C A;  1EFW A;  1OXV A;  2JA8 H;  4XZ3 B;  4A75 A;  4K5V A;  5CBA E;  1HNZ Q;  3T1Y L;  2NVQ H;  4I55 F;  3OHB A;  2IP4 A;  1B3Q A;  3I91 A;  3PW7 A;  4KHP H;  4YWK A;  4FXG C;  3DXJ C;  4XYQ A;  5J3B A;  1JIC A;  5C8Y F;  3BG3 A;  2NN6 H;  2A5H A;  4NPS A;  4A3F B;  2Y0S A;  3FPP A;  3MFG A;  5D3D A;  5FLM G;  3GV3 A;  3T56 B;  3FDT A;  3CXC A;  5KT2 A;  2I46 A;  1BCP C;  2F0E A;  1YZ6 A;  1I3Q H;  3PO2 H;  3LML A;  4I65 A;  2R6G A;  1DOM A;  2UU9 Q;  2OXP A;  1HR0 H;  2PCF B;  2W70 A;  1KAW A;  3QWN A;  1I6H H;  2EQS A;  4YJ2 F;  3GTL A;  1ET6 A;  4G7O C;  3GO5 A;  2VPQ A;  1L1O C;  3CC2 A;  1EIG A;  1CKN B;  3S14 B;  4CJ2 C;  5L9X A;  4IAL A;  2JJQ A;  1TWG A;  5HUR A;  3N41 B;  3QZ7 A;  1BCP F;  3F1Z A;  2E5L L;  2K75 A;  5C0X I;  2WIN B;  1HA6 A;  4YWM A;  1PTO D;  4BBS H;  4GOP C;  2V58 A;  3MR6 A;  2RKS A;  4E6I A;  5IYB H;  4JI6 L;  3PCO B;  1KXL A;  1EIH A;  2VXW A;  3KLS X;  4UP7 A;  3L4K A;  2CZG A;  2JA5 H;  1XPU A;  1Y1W H;  4OL7 A;  5C44 G;  4CKC A;  1J5E Q;  3T1H L;  1S97 A;  1SNM A;  4DUY L;  1SRU A;  3I4L A;  5I2Y A;  2ZJR A;  4FF3 A;  5FO9 B;  5FD6 A;  3TN2 A;  2EXD A;  4DAY B;  1CA6 A;  1OXX K;  1X3G A;  2HHH Q;  1VBH A;  2EDG A;  1EQR A;  2N8N A;  1KC8 C;  3S15 B;  2HD3 A;  4IUU A;  1F2Y A;  3QB3 A;  1S0O A;  1HZA A;  4IOC A;  4WOR A;  1TWC B;  1DIK A;  2UUA L;  3TQT A;  2VUG A;  2FIN B;  2PNR C;  4QUF A;  2PW7 A;  4C3J H;  1C48 A;  5AJ3 L;  2R7L A;  1EYZ A;  1RTO A;  1AZP A;  1D6E C;  1CHP D;  1I4P A;  1V1Q A;  2WB1 A;  1U4P A;  2KCN A;  2A68 C;  2UVR A;  4BXX H;  4XIG S;  5LHY 1;  4CKB A;  5DQI A;  1V9P A;  3Q8P B;  4CC5 A;  3D4R A;  2F4V L;  4A3J B;  3CRK C;  5F9L A;  4ZCK A;  4YBZ B;  2R8K A;  1RYS A;  2L55 A;  3RUZ A;  1EWH A;  1ASZ A;  3IFD A;  3I4N G;  4DUZ L;  2EE1 A;  3BZK A;  1HNX L;  3I4M G;  3HOX G;  1HFN A;  3X3M A;  2WAQ E;  1TWA B;  1IBK H;  2RA4 A;  1QUQ B;  2NTS A;  3AB9 A;  3KF8 A;  3KDF B;  1LT3 D;  1TVX A;  3DEP A;  5AFW A;  1BF4 A;  5KFJ A;  5BMV F;  4DAV A;  5JOB A;  2XTI A;  4GZY C;  1NR2 A;  2F0S A;  2I5M X;  4K2L A;  5I6W A;  2KUM A;  1A2T A;  3CC7 A;  1KLU D;  5CV4 A;  1O80 A;  2FPP B;  3T5H A;  4IO9 A;  4EGJ A;  2UXD H;  3GIL A;  2E5L Q;  4A3L H;  4JI0 L;  1PYB A;  3B6Y A;  3AFQ A;  3TQY A;  5FLM H;  3GTO B;  2XNA C;  1W6J A;  3E0J A;  3HOU H;  4LUV A;  1VF7 A;  4H44 C;  4JI5 Q;  4DK1 A;  2F0F A;  4B3M H;  1CTM A;  4XQQ A;  1QVF A;  5D14 A;  4K0K H;  4FF4 A;  3K5I A;  4R4C A;  3HOY G;  4RUC A;  2YS6 A;  1AW7 A;  1A3U A;  3K7A B;  3ND9 A;  1AN8 A;  3G8C A;  3GIK A;  1H9S A;  3G6Y A;  4QCL A;  1TII D;  1UNN C;  3ETH A;  2LKV A;  4AYB G;  1GXD C;  3VDY A;  2NYZ D;  3TRZ A;  2WDT A;  2OF1 A;  5IP7 G;  4ED3 A;  1NJI C;  4KMU C;  5FD5 A;  2QCP X;  3E6Z X;  1B4O A;  1L0X B;  3D6W A;  1V4Y A;  2GPW A;  1YHA A;  2WFW A;  4XX0 B;  1RYR A;  2IHE A;  2ASB A;  3PO3 G;  4DL6 A;  5C44 H;  3HP3 A;  4NMZ A;  2UVW A;  2CCZ A;  3KBG A;  2CWA A;  3VYT A;  1BVS A;  4JI1 H;  2W7O A;  5JJI A;  1C4Q A;  4DV3 H;  5IGC A;  1VQN A;  3RAX A;  3TSS A;  2F4V Q;  4LMY A;  1HR0 W;  2PBZ A;  4HNT A;  1N32 Q;  4LFC H;  1ZQ7 A;  3MAQ A;  3MWE A;  4BBR H;  2VUM H;  1E7Z A;  1F9R A;  1UE1 A;  3MHB A;  2CQO A;  4A3B B;  2FPI B;  3HGB A;  5KFD A;  4F50 A;  1IL2 A;  5CMD A;  1R9T A;  2E2H B;  2XIG A;  4RAY A;  3KUP A;  2DLN A;  4Q0Y A;  4RG1 A;  1VQK A;  4J9M A;  2P0A A;  3AMU A;  5ELB A;  1QWY A;  3DWP A;  1ILP A;  1KJQ A;  2FE3 A;  4JBK A;  1I4H A;  1ET9 A;  1X3P A;  3Q8D A;  2X0S A;  2EY2 A;  4O4H F;  1SYB A;  2VNU D;  3LWB A;  2UXC L;  2B2Y A;  4WD3 A;  1JJ2 A;  3S2H H;  1KNA A;  4I7A A;  3I4N H;  4NP5 A;  1Q12 A;  5JVH 3;  2EYL A;  2PQA B;  5L37 A;  2E2I H;  3ORR A;  2WYO A;  5EJW A;  3WOE A;  4YHH L;  4G7Z C;  5D1O A;  1A3V A;  1BJT A;  1QOH A;  4DR2 Q;  3FEW X;  4O4I F;  1M6V A;  1EY4 A;  3HRZ C;  4C2M B;  1M0T A;  3BDC A;  4RHR A;  4RWS C;  3RBE A;  4C3H H;  1TWH B;  1K83 H;  4RGT A;  4HQ6 A;  2FP4 B;  3N42 B;  1K9M C;  3U4V A;  5DLG A;  4IR1 A;  3MXN A;  1YJW A;  1K3B C;  4DR6 Q;  3BJU A;  2K5W A;  3U9S A;  1VQC A;  3KYH C;  4MIU A;  1WCM B;  2H5X A;  4P2C B;  4Z9C B;  5IYD G;  1L0Y B;  3F8T A;  4X3U A;  4RUA A;  5EBC A;  3TP5 A;  4HSP A;  1HZ9 A;  3MWM A;  4QW8 A;  2NVY B;  4LF4 L;  4J15 A;  5DGA A;  4DL4 A;  1NSN S;  1XPR A;  1DV1 A;  1I7L A;  1ML0 D;  2RSO A;  1SXT A;  4L5R C;  3RZD H;  1EY0 A;  4ECR A;  3FKI B;  1IYU A;  1STA A;  2HCI A;  4QQB X;  3GTM H;  1LTG D;  4PZ6 A;  3HZX A;  1OO9 B;  4KHP L;  5M5Y B;  2I87 A;  1KDC A;  1VQ8 A;  1D7Q A;  1E4G T;  3GTJ H;  2ZJQ A;  3U9O A;  4GS3 A;  4X62 H;  5KT5 A;  5D3I B;  3T5J A;  2QDB A;  3I12 A;  1JIH A;  2TMP A;  3CCU A;  2XIW A;  5EQ0 A;  4YAK B;  4I4T F;  3IAY A;  1ENA A;  2EY5 A;  4F7X A;  4RGO S;  4UPA A;  3DM3 A;  4X66 H;  4QJF A;  2FLL A;  4PQX A;  4R9W A;  1JDE A;  2JA7 H;  1PX2 A;  3EPG A;  1B9N A;  2Q8T A;  2HVS A;  1KJ8 A;  4ECW A;  3WWV A;  1VQB A;  3HKZ E;  3CQZ H;  3OMC A;  2NWG A;  5GAD C;  3TBI B;  3D31 A;  2W9C B;  2F0Q A;  2R7K A;  2UXC Q;  4DR3 H;  3C3L A;  2HVR A;  2O03 A;  1WTH A;  2K4K A;  5LL6 S;  3M4Y A;  3HFZ B;  5EWF A;  1DON A;  2JEG A;  2GN5 A;  4HNU A;  1JWM D;  4APM A;  4IFD H;  3GTQ H;  3KTM A;  3KAL A;  4QWC A;  1AZQ A;  3VYU A;  3PUX A;  1FR3 A;  4YHH Q;  3A54 A;  2C00 A;  3M9M B;  4DR7 H;  3MR2 A;  2NTT A;  3PGZ A;  5I4D A;  3BS1 A;  1KTK A;  2PW5 A;  1Q8K A;  4RGN A;  3ICE A;  2CH4 W;  2PZW A;  2Z4I A;  4A3I B;  4MN3 A;  4B3T Q;  1HA5 A;  1M0W A;  3SE7 A;  2L1B A;  2JA6 B;  5GON F;  2KA7 A;  4ZHQ F;  2BH8 A;  4LF5 H;  5KYI A;  2CW7 A;  4FXK C;  1BO0 A;  3RN5 A;  4MV9 A;  2F0W A;  1O75 A;  1T36 A;  3CAM A;  2G5D A;  2F0P A;  4KKT A;  1ESR A;  1W3S A;  3F2D A;  3RZO H;  1H9M A;  2ES2 A;  3IL8 A;  1HZC A;  1STG A;  1LTI D;  3NBI A;  2D0O A;  1QIL A;  4RHS A;  2HVQ A;  3RB4 A;  4OHJ A;  2Q2I A;  5DM7 3;  3H15 A;  4QGU A;  3E0E A;  1XTC D;  4TUY F;  4O2A F;  1YJN A;  3RJ0 A;  4GKK H;  3KJP A;  4B9W A;  1M90 C;  1PTO C;  4IUQ A;  1SE8 A;  3AU7 A;  3OHX C;  3I70 A;  4H02 A;  1F9P A;  1X65 A;  1TXY A;  4KHP Q;  2JA8 B;  1GLV A;  3IG0 A;  2Q8R E;  1FVI A;  3EBE A;  3T1Y H;  3TIN A;  2EVB A;  2A69 D;  4TV9 F;  3GDE A;  1RL2 A;  4EFB A;  3EA6 A;  1CQF A;  3H0G G;  1Z7T A;  5IYD H;  4A3D B;  3OW7 A;  2R92 H;  5CV5 A;  2E2H A;  5KYL A;  1PTO F;  2CHB D;  3J80 c;  4DV7 H;  2HIX A;  5H80 A;  1UEB A;  2ASD A;  3I55 A;  3K7U C;  3CCE A;  1HR0 Q;  1WD0 A;  1X54 A;  4EVO A;  2ATW A;  4DK0 A;  3H4B A;  2KVM A;  2B29 A;  1HHV A;  1O78 A;  1RHP A;  4P71 A;  4TKO B;  4EYI B;  4RNM A;  1PTO H;  3TIG A;  1I6H B;  4DLK A;  3OUU A;  4QWE A;  2P5Z X;  5KFG A;  2HIV A;  5CAE B;  5ELC A;  2J6S A;  4KY7 A;  3WO1 A;  4Q45 A;  1JE4 A;  4ED7 A;  5KFQ A;  1TY2 A;  4YWL A;  4YP3 A;  4RCN A;  4UDU C;  5KT6 A;  4ECX A;  4K2K A;  1S5D D;  2NZO A;  5DQH A;  1WTV A;  2VQE L;  4P73 A;  4MV4 A;  2V1C C;  3BDO A;  4NDX A;  4BBS B;  3CCV A;  3QG1 A;  4JI6 H;  3N6R A;  3R93 A;  3OPO A;  1B53 A;  5A2Q L;  2AWN A;  3CF5 A;  5KT3 A;  4B3M L;  1EIY B;  5EZY F;  4K0K L;  2R6F A;  4IFD J;  1I4X A;  3T1H H;  4DUY H;  2E75 C;  3NBH B;  3S1Q H;  4A2A A;  2VOB A;  5KG0 A;  1EQT A;  3BG5 A;  4ME5 A;  4O3O A;  1WCM A;  5DG8 A;  2HGS A;  4GKJ L;  5M5W H;  1JE5 A;  2EYF A;  3RR5 A;  2OWO A;  1PZJ D;  1SN8 A;  2WAQ G;  2IBK A;  5KX5 F;  1O7I A;  1E2Z A;  3J80 W;  1SNP A;  3GIQ A;  1GSA A;  5C4X G;  5C6A A;  4JI2 L;  2A6E D;  2UUA H;  4GOP B;  1JC7 A;  2DWC A;  4MV8 A;  3SHL A;  4FF1 A;  1K1S A;  5LMN H;  4IZ8 A;  1XXG A;  1E3P A;  2J0T D;  1CKM A;  5L1I A;  2R86 A;  4DV3 L;  2WTF A;  3S1N H;  1S4Z A;  5FPR A;  1KAB A;  1D5M C;  4A93 B;  2WAQ A;  2R84 A;  3EQL C;  4O1N A;  4LSX A;  4L8J A;  3J80 E;  2Y0S B;  2GLT A;  2KOL A;  1STH A;  3PMF A;  5JAV A;  4DUZ H;  1IBK Q;  1SJE D;  1HNX H;  4CBV A;  4O2B F;  2YS7 A;  5BPH A;  3KLW A;  2A8V A;  1MJC A;  1Y8P B;  1FNV A;  1AE3 A;  3BYT B;  2IX1 A;  4OO1 G;  2SDF A;  3GIP A;  1PDQ A;  1EUD B;  2KJX A;  4BY7 G;  4TQR A;  5KFO A;  1JB7 A;  4FVM A;  3K59 A;  2B2V C;  2PMZ B;  5IE8 A;  3V6K A;  3E9I A;  2UXD Q;  3GTL B;  5KNC A;  1JX4 A;  4R4O A;  3H0G H;  1MZB A;  1FJG H;  1RKN A;  1E24 A;  4CKE A;  3NTH A;  1ZKO A;  1IHZ A;  4JI0 H;  1GGO A;  1TWG B;  1X6O A;  3GII A;  1ONL A;  2VA2 A;  2XWJ B;  4N9P A;  4DR5 L;  1SMY D;  2F03 A;  4HJ9 A;  2XGP A;  5KT4 A;  4QF4 A;  4DXG A;  4B3M Q;  4POG A;  3UQ8 A;  3KOJ A;  2JA6 A;  5BR8 H;  4DL3 A;  1CSP A;  4DV1 L;  3SEB A;  2NU6 B;  1MI2 A;  1LO5 D;  5COY A;  5DEH A;  4CC6 A;  5KG5 A;  2MHV A;  2VQD A;  2O5I C;  1ILQ A;  3AFP A;  3EVQ A;  3C46 A;  1WTX A;  5KGU A;  4U6P A;  1VBG A;  1D8L A;  4F4X A;  4MTD A;  1QJO A;  2NVT B;  1XNQ H;  3K5H A;  3H3V I;  4QY7 A;  3DWQ A;  3R3O A;  2O2L D;  1NCV A;  1R4Q B;  2KCM A;  4RKB A;  3NEL A;  1BXT A;  5IOC A;  1L0W A;  2J7Z A;  5C0X H;  2R93 G;  1DXM A;  4IWY A;  3GV5 B;  1IYJ B;  1DJR D;  3PO2 G;  2EJM A;  3ERQ A;  1B33 N;  2XCL A;  3PV0 A;  2IJ0 A;  5C4H A;  3J80 i;  4UP9 A;  3V4Z A;  2VA3 A;  1N48 A;  5ELN A;  4JI1 Q;  1EZ1 A;  2D2C C;  5I6Y A;  4DV3 Q;  1VQ4 A;  3CW2 C;  1ZHS A;  3ETJ A;  3J80 L;  4FYD A;  4LFC Q;  4DV5 L;  4A3G H;  4J9L A;  4RH6 A;  3QJY A;  5DQG A;  4X62 L;  1KQS A;  3HOV G;  4DV4 H;  2G9D A;  5E1F A;  3PW4 A;  1M8A A;  3I4O A;  3VPD A;  2W8L A;  2R93 A;  4LFA H;  5IYB G;  2BQR A;  1LT5 D;  1I3Q A;  1YIT A;  1CQI B;  4K5X A;  5TSS A;  2VB3 X;  2JA5 G;  1RTN A;  2C2D A;  2YRW A;  2FK2 A;  3KF8 B;  1A0I A;  3LP8 A;  3S1R B;  5BN3 A;  5IIF A;  1I50 H;  1NR4 A;  3Q24 A;  4Y8V B;  4DR3 L;  3JSL A;  1S68 A;  5IWA L;  3NEM A;  3PSI A;  3RF2 A;  2GVA A;  4LF8 H;  3RB6 A;  1JOQ A;  4OIK A;  1W2B A;  2I8C A;  3RMH A;  5IGE A;  3N8D A;  2QK4 A;  3DLL A;  3I4M B;  4CDD C;  2PZT A;  3HOX B;  1LTS D;  2JA5 A;  1VQE A;  1GUG A;  4IRK A;  4O3R A;  3HG9 A;  4IHJ F;  1Y1W A;  1VQ7 A;  1PH6 A;  2HDL A;  1Z47 A;  2WKC A;  4C3J G;  3CC4 A;  2WV6 D;  4BY7 H;  4JI3 L;  2JEI A;  2M00 A;  2RHS B;  2DY8 A;  4KN4 C;  2BE5 D;  3ERO A;  1G51 A;  1V8Q A;  1B7Y B;  1F2M A;  3M4I A;  5A35 A;  2UVV A;  4JI7 L;  2D9U A;  2AMC B;  4UAI A;  1IW7 D;  1L1O A;  5LMN W;  4LFB L;  5IGD A;  1H9S B;  1HJP A;  1BOS A;  2R7M A;  2CW0 D;  2L12 A;  4IUR A;  2F3I A;  4KV6 A;  3HKZ G;  2QEJ C;  4Q0F A;  4LF4 H;  1BDO A;  2FMA A;  3JRX A;  4PZ8 A;  5J2U F;  3T4A C;  2VW9 A;  1YIJ A;  1AE2 A;  3M4P A;  1L2F A;  1SLJ A;  4ED2 A;  1WTP A;  3TZD A;  3HOY B;  4YJ3 F;  4LNQ A;  4L5S A;  1Y1V H;  3K81 C;  4RKL A;  3E3X A;  5FJ8 H;  5C0X J;  4X62 Q;  2XGQ A;  3S9W A;  1P16 A;  2VPS A;  2R3Z A;  3J81 j;  1X9N A;  1SYD A;  4AYB B;  2X69 A;  1JJG A;  2AHO B;  4A3L G;  1AH9 A;  1SEI A;  3HKZ A;  2ASL A;  1LTR D;  3K58 A;  1FYC A;  1FD7 D;  1WOC A;  2K28 A;  4X66 Q;  4DV7 L;  1EQQ A;  1K8A C;  3HOU G;  1QVC A;  4JV5 L;  2R93 H;  3K3P A;  1R9T B;  4A3K H;  3L3O C;  4HSV A;  4TRD A;  2VB2 X;  4HTH A;  5EOY A;  3PO3 B;  1TR5 A;  3FMA A;  4HJA A;  2PMZ A;  2HQL A;  1PK8 A;  3M4O B;  4DNT B;  1WR2 A;  4QIW E;  1VQ6 A;  3BZD B;  2W9A A;  2CVR A;  1Z9F A;  3MFY A;  1YBY A;  4PV1 C;  2OTL A;  4MV1 A;  4UCO A;  1QNU A;  3HOV H;  5KG6 A;  3RIZ A;  2A69 C;  1B6S A;  3CKI B;  4FF2 A;  4DR7 Q;  4JYA L;  1TA8 A;  4RZQ A;  4R4T A;  5BN5 A;  1SYG A;  1C0A A;  4J9R A;  2OCE A;  3PQI A;  5C3E G;  4LUZ A;  4YIJ A;  3F2U A;  2FJZ A;  2EYP A;  2E2J H;  4YR3 A;  1EL0 A;  5D1O B;  4LF5 Q;  1AEX A;  2K14 A;  2D62 A;  5JVG 3;  1Y14 B;  3TME A;  2WII B;  1DV2 A;  2VQF L;  3CME A;  3VA5 A;  1QNK A;  3SE0 A;  3ULL A;  1BXR A;  2CH4 A;  4XXE A;  3MXN B;  3TP7 A;  1CI3 M;  3HOZ G;  5C5J A;  1HTP A;  2DUD A;  3RZO B;  2H1E A;  1HCZ A;  1UUP A;  2C9O A;  3MXU A;  4BBR G;  2MCT A;  2VUM G;  2F0N A;  3G6J B;  1C3O A;  2YTY A;  2AQ4 A;  2IT1 A;  3KLR A;  3NHH A;  4GKK Q;  5LMU L;  3BDL A;  1MJE A;  1SNC A;  4MHE A;  1IBL H;  2IPK D;  5KFU A;  2K32 A;  3WNZ A;  4KHZ A;  5LMN L;  3A5Z B;  3ZJY C;  3T1Y Q;  3OSP A;  2PZU A;  1Z6H A;  4L5T A;  2J9G A;  3TEH B;  2N88 A;  3P1H A;  5JUM A;  4K8J A;  1TT2 A;  1S0M A;  2AUK A;  2VUM A;  1B44 D;  4DV7 Q;  5IY0 A;  1WYD A;  4A3E H;  1IKM A;  1EEF D;  5J1Z A;  2E8G A;  2EXZ A;  1IBM H;  2ZDQ A;  2XCA A;  4Y7N H;  1O7Z A;  3GTP H;  4FU0 A;  5HV6 A;  4DK6 C;  5M3M H;  5T14 A;  3R5H A;  3GTG H;  2SNM A;  1T9H A;  4GN5 A;  4TV8 F;  5ELE A;  4RA8 A;  2A6E C;  2D5D A;  5CC4 A;  3RB0 A;  1PTO B;  4FS2 A;  4C3H G;  4AIM A;  1TWF H;  2BH2 A;  2RDG A;  2EOT A;  1A62 A;  1W93 A;  5JJK A;  1G8Z D;  4ECQ A;  1CHQ D;  3CRL C;  1JMC A;  5KND A;  4U7C A;  1FJG L;  3QOL A;  4OO1 I;  1DOK A;  1I6V C;  3IFT A;  1I4R A;  5I2X A;  5LA6 F;  2EIF A;  2VQE H;  4JI6 Q;  2E2I A;  5I9P A;  4GC6 A;  4JI8 H;  1O7Y A;  4QB4 A;  4MAM A;  3OW2 A;  4RNO A;  1PHJ A;  4DV6 L;  3ER0 A;  1EHI A;  4KK7 A;  4ME6 A;  1VQO A;  3TRE A;  5BR8 L;  3BQ0 A;  3T1H Q;  2EZV A;  4DUY Q;  1HTL D;  2NU8 B;  2F0T A;  4I50 F;  1K83 A;  2CQY A;  2F1M A;  1Q82 C;  3S16 B;  1XPO A;  5FPO A;  4EYH B;  1AFP A;  2YZM A;  1LTL A;  4DR1 L;  2ASJ A;  3FHW A;  1VCI A;  5EGT A;  4X64 L;  4GKJ H;  2B8F A;  3A8K E;  3PUZ A;  1YI2 A;  1XNQ L;  4UCU A;  4EX5 A;  5FO8 B;  2UUA Q;  2W8K A;  3V96 A;  4MTN A;  5C3E H;  1EY6 A;  4JPB W;  4JI2 H;  1FNW A;  4R4Q A;  2R8J A;  5LMN Q;  1GUO A;  2IMW P;  5AJ3 Q;  2JA7 G;  5T1I A;  4V19 0;  3SDZ A;  1SMY C;  2NUA B;  5KG7 A;  2NN6 I;  1EY7 A;  2Q8I B;  3GTM A;  4YCV A;  2KSW A;  2RHQ B;  1PH4 A;  4ID6 A;  3RFC A;  4PMW A;  4DPG A;  3GTJ A;  4AYB A;  1PRT B;  2JEJ A;  4H13 C;  4JV0 A;  3TS0 A;  1E1T A;  3HOZ H;  3J7A 5;  2F0J A;  4MZ9 A;  5IGF A;  4DV4 L;  5EPK A;  4DUZ Q;  4X65 L;  2UXB H;  1HNX Q;  4IFD G;  4H0L C;  5M3F H;  2ENB A;  1XDN A;  5EWE A;  1A8V A;  3HOW H;  4LFA L;  1N34 H;  2EYM A;  3KXY T;  3LNN A;  5L1K A;  1C7Y A;  3R5X A;  2JA7 A;  4ECY A;  3TQ1 A;  2L9H A;  4C3I H;  2KHI A;  3UE1 A;  2A73 B;  3CQZ A;  4L1K A;  4O3S A;  2RCF A;  5JQW A;  2ZXO A;  1SAP A;  1PFN A;  4RNN A;  5FOB B;  2AGQ A;  1JWS D;  4O0A A;  1UAP A;  1XMO H;  3PIO A;  2QF7 A;  4APV A;  1RK6 A;  2R7N A;  3IN5 A;  4OWX B;  2EYH A;  4LH7 A;  1FJG Q;  3URY A;  3SXH A;  1AN7 A;  1NNX A;  4LF8 L;  2AKW B;  4JI0 Q;  4KD4 A;  4R8I A;  3GTQ A;  2BQU A;  2Q2H A;  4DV2 L;  1JOK A;  3M4Q A;  1S03 G;  4KI0 A;  3BJY A;  4DR5 H;  1K73 C;  1CZG A;  4JI4 L;  4HN7 A;  4ZQI A;  1SRO A;  5KFH A;  1EU4 A;  4B3R L;  5IYZ F;  5C5L A;  4IPG A;  4GNX A;  3NUC A;  4ZKC B;  1HNW H;  4X3K A;  4YQW A;  4DV1 H;  5GAE C;  4FO2 A;  2X6L A;  1KJJ A;  3V4S A;  4IUV A;  1A6X A;  5JPM C;  2FLP A;  3BA8 A;  2DGY A;  2OLS A;  4G3I A;  4TVA B;  4NB3 A;  1K0R A;  5DAU A;  4EQ5 A;  4G7H C;  2W57 A;  3C0F B;  5L1J A;  1JKJ B;  4LK1 C;  1L2Z A;  1IOV A;  1BGW A;  4UCR A;  3S1M B;  1LLR D;  4MTK A;  4C1N K;  4NXM H;  4IRC A;  2HQE A;  3S17 H;  2R92 G;  2XGT A;  5KG3 A;  1VQD A;  5KFR A;  3CCL A;  4ECV A;  1VF5 C;  3KHG A;  1I94 L;  2A1A A;  5CV9 A;  4HMI A;  1W96 A;  5KFC A;  2JN4 A;  4KN7 C;  1HUN A;  1V1P A;  4IPH A;  3BQ1 A;  2PQE A;  3MA2 B;  3L2P A;  2NVX H;  1Y69 U;  2B63 H;  4PMB A;  5IT9 L;  1GHK A;  2FKL A;  3MEH A;  2XRQ D;  1X55 A;  4HMJ A;  4I7H A;  1PXU A;  1XX8 A;  4LSA A;  4DV5 H;  2AUJ D;  3TDQ A;  5KFN A;  2RGR A;  1U4M A;  2IX3 A;  4DV4 Q;  3BVZ A;  4A3C H;  2K1B A;  1SFO H;  2BE5 C;  1YVC A;  1B9M A;  1EYC A;  2WAQ B;  2R92 A;  1CS0 A;  4HNV A;  4LAA A;  5FKA C;  1YJ9 A;  4R8N A;  3FRP B;  4LFA Q;  3VYR A;  4YR2 A;  2YU9 H;  1IW7 C;  1VQI A;  3GD7 A;  3PIO 3;  5C4X B;  4TQU S;  4GNX C;  2B2W C;  5EKK A;  2F52 A;  2CW0 C;  1MGS A;  5E4W C;  1LUZ A;  5CR3 A;  2RDJ A;  1KAA A;  5ELF A;  3EYY A;  1CM9 A;  3KHH A;  2D0P A;  4A3F H;  3HS0 C;  4LF8 Q;  4NW2 A;  5A2Q W;  4KTA A;  5IWA H;  1MHW C;  1RJT A;  1RK5 A;  3A8J E;  1S5B D;  4YR0 A;  4H7B A;  3DHQ A;  3M7G A;  1H95 A;  3RB3 A;  1QB5 D;  1Y8N B;  3PVX A;  2KCC A;  1S72 A;  5I47 A;  1DD2 A;  2PI2 E;  4RGM A;  3Q22 A;  3MZ5 A;  4ED0 A;  3N52 A;  1ZXT A;  4WJ4 A;  4HJ7 A;  4YCW A;  2YTV A;  1G91 A;  4LUO A;  4R1J A;  3JZI A;  3PR5 B;  3EIV A;  4JBM A;  1GHJ A;  4EBE A;  4JI3 H;  4ZRZ A;  3S14 H;  3M9B A;  2ZTE A;  1IXR A;  4ZYS A;  5A2Q E;  2ZM6 H;  5HGT A;  1HUM A;  1I4G A;  2VY3 A;  1PLF A;  1EUC B;  4JI7 H;  2MGS A;  2C2E A;  4HR7 A;  3U58 A;  4JW0 A;  5LL6 X;  3K0Y A;  3S2D H;  4LFB H;  2LXK A;  4OX9 L;  1XNR H;  1VQ5 A;  2IX0 A;  3RUP A;  2ZXP A;  4B9X A;  4U67 3;  4LF4 Q;  3BAA A;  2SOB A;  3OSN A;  3G71 A;  2UUB L;  4J9P A;  1CZW A;  1JQY D;  1YNX A;  1VQA A;  1SMX A;  5JEA H;  1IBL L;  4RB3 C;  2MP1 A;  2G9H D;  3GTK H;  3G4S A;  1IZ6 A;  2V4R A;  3M3Y H;  4KD3 A;  5C1P A;  2RDI A;  3TS2 A;  2Z6K C;  1KC7 A;  4OXP A;  2GA4 B;  3D4D A;  2AQ2 B;  4C56 C;  1WTW A;  1Q81 C;  1PH2 A;  3JC6 6;  2NVQ B;  5JVD F;  2Q2U A;  3S15 H;  5M9O A;  2PVP A;  3MEF A;  4A3M G;  1HRJ A;  2PN1 A;  3EN2 A;  2EJF C;  4LF6 L;  1TWC H;  1KIX A;  2L11 A;  2NU7 B;  1B3A A;  4DL5 A;  1FKA H;  3Q1K A;  5KFE A;  1ZET A;  4DR4 L;  1VQF A;  4K6L A;  1IBM L;  3K3V A;  4JV5 H;  1GJX A;  4ULL A;  2R93 B;  5EPL A;  4QIW A;  1PH7 A;  3LX0 A;  1I3Q B;  3FVQ A;  3PO2 B;  1RF2 D;  1RJQ A;  2V4Q A;  4U68 A;  2RSN A;  5KFT A;  5COR A;  4QWD A;  4A3J H;  1E22 A;  1EZ6 A;  3FPU B;  5G3L D;  2WB1 E;  3CPF A;  3H0G A;  4CDE C;  2MPM A;  4K14 A;  4MV7 A;  4J9S A;  2SEB D;  2LY7 A;  1KJI A;  3HOV B;  2NZ1 D;  1TWA H;  1STE A;  4X3S A;  4JYA H;  1X3F A;  5EKI A;  1ROD A;  4P75 A;  5J22 A;  1RJR A;  4OWT B;  4JI8 L;  2BA0 A;  2YCH A;  5IP9 H;  4B3S H;  4UCV A;  5C0X G;  1PFS A;  3C1F A;  5F2D A;  2JA5 B;  2DNE A;  4JOI C;  1WTO A;  1Y1W B;  2E2D C;  1BCP B;  3QZ8 A;  3SK4 A;  2F3V A;  4RMF A;  2BQ3 A;  3CPW A;  2VQF H;  4XQJ A;  2B2V A;  5M5X H;  5HGQ A;  4A3G G;  5KFK A;  5I9O A;  3GTO H;  1OWT A;  3GQB A;  4C5C A;  1U0L A;  1ASY A;  1L1O B;  2DNC A;  1S40 A;  2QIL A;  4XT3 B;  5IGB A;  2F0O A;  2K5Q A;  2JP1 A;  2NBF A;  4EQP A;  2ZJT A;  4Q8F A;  5FO7 B;  2A6H D;  1S5F D;  2K5H A;  3GIM A;  5T1G A;  1NTG A;  3OTO L;  1EEI D;  1IBL Q;  5LMU H;  3OMG A;  4JI5 H;  1BNC A;  1I7N A;  1B2T A;  1D1K A;  1ESF A;  2NZH A;  4DU9 A;  1UC9 A;  2R7Z G;  3K7A H;  1V1O A;  3A5U A;  4C3J B;  3SVM A;  1Z2P X;  2FPG B;  3NWT A;  2C2R A;  4NLG A;  3H09 A;  3PUW A;  4O3P A;  3NEN A;  1V43 A;  2EJG C;  4KY6 A;  5FLX c;  1GUW A;  4F4Z A;  3T5L A;  3VR6 A;  4OWW B;  5H1S E;  4FNF A;  3DEO A;  5JEA J;  2V9W A;  4KHV A;  3UDF A;  1YNJ D;  4DL2 A;  3GID A;  4ZUJ A;  2UXB L;  1IBM Q;  4ED8 A;  4XDX A;  1KL9 A;  3HKZ B;  2Z4H A;  2RQX A;  1N34 L;  5CV7 A;  1O7L A;  3R23 A;  2R82 A;  2I80 A;  1T94 A;  1C8C A;  3KBX A;  5GQO A;  4ZQ3 A;  4FBU A;  5DGB A;  3SI8 A;  2Z6B A;  4IFD I;  2N55 A;  1IOW A;  1I50 A;  1WFQ A;  4BWS C;  2LS0 1;  2LXJ A;  2R8H A;  1XMO L;  1JDB B;  2Z0S A;  4A3M H;  2VL6 A;  3K5N A;  1VMC A;  4ABN A;  4A3B H;  1GSO A;  4G57 A;  2I0Q A;  1N56 A;  3OIQ A;  3F8N A;  2W9B A;  3G7L A;  2VQE Q;  1TS5 A;  2NUC A;  3VA7 A;  2W71 A;  2IA6 A;  4RFB A;  2F0D A;  2K04 A;  4JI8 Q;  5JJL A;  4IOA A;  4DKA C;  4GLX A;  3HOU B;  5HBR B;  5DLQ E;  4DV6 H;  4IUN A;  4IRD A;  1T5E A;  4K0K Q;  1NE3 A;  4IJH A;  4UP8 A;  1HNW L;  5KG2 A;  4P72 A;  4C5A A;  3MXP A;  1YHQ A;  1GOZ A;  1WTR A;  2DY7 A;  3K80 C;  4KKS A;  3G48 A;  1SE2 A;  4GLA C;  5FLX W;  1Y1V G;  4GKJ Q;  5EDW A;  5FJ8 G;  4DGZ A;  4N9T A;  4DR1 H;  2YV5 A;  5KNB A;  4X64 H;  5K36 G;  3T5K A;  3J7A K;  1Q46 A;  1ZEQ X;  4NXM L;  3FDS A;  3A55 A;  1K0S A;  4R8U B;  2ICI A;  4JI2 Q;  3TP8 A;  1STN A;  4C2M H;  2RF4 A;  5C3E B;  1TS4 A;  4A3K G;  2R85 A;  1YNN D;  1K8O A;  4LH6 A;  4JBW A;  1M1K C;  1TWH H;  1N36 H;  2B3G A;  4OGQ C;  3PF5 A;  5C3X A;  4J8Q A;  5C44 B;  2B2T A;  1Q7Y C;  4XYO A;  1XMQ H;  5FLX E;  5BN4 A;  1Y1V A;  1FGB D;  2DN8 A;  4PMC A;  2R8G A;  3G6E A;  1STY A;  1WTQ A;  5CV8 A;  4JCV E;  2UXB Q;  2NVY H;  2F0K A;  1XYI A;  3SK8 A;  1LT6 D;  2KEC A;  4F8M A;  1E4E A;  4X65 H;  4BBR B;  3C2P A;  2VUM B;  1N34 Q;  2RGV A;  3K5O A;  4A76 A;  3P7J A;  1TQO A;  3FKI H;  2W6O A;  2F0U A;  4Q5V A;  2YZG A;  1M7J A;  4HJ5 A;  2HDM A;  3UDX A;  3H20 A;  3H40 A;  2R7Z H;  2BA1 A;  1UC8 A;  2ALZ A;  4IPC A;  1HFG A;  1NMG A;  5M5Y H;  4M7E A;  1HNZ L;  4MA0 A;  1XMO Q;  2AQ1 B;  3V6H A;  4RAU C;  3A7A B;  3FMC A;  1J8I A;  1EUJ A;  4Q44 A;  1LYL A;  4YB8 B;  1XTD A;  4S3S A;  1IKL A;  2BDO A;  4DR5 Q;  3S2H B;  4DV2 H;  1NMF A;  5CBE E;  4JC0 A;  1UE5 A;  1E4F T;  1GD7 A;  3C1E A;  1F9S A;  3I4N B;  3NGD A;  1PV4 A;  4JI4 H;  2YYZ A;  3EPI A;  1S5E D;  2BR0 A;  4LWC A;  1SE3 A;  1CFM A;  4FXD A;  2E2I B;  4EBC A;  4FM9 A;  1WSC A;  2M05 A;  1SR3 A;  2UU9 L;  1HNW Q;  4DV1 Q;  4B3R H;  1RIP A;  2K52 A;  5CA0 F;  2B2T C;  2QKI C;  4EEY A;  1U4R A;  3KK7 A;  3UDI A;  2MUY A;  5IYC H;  3D8G A;  4L6T B;  5KFI A;  4EBD A;  2ZM6 L;  2K7V A;  1N33 H;  4C3H B;  2J6T A;  4WJ3 M;  1WVL A;  1K83 B;  2QEX A;  1NAP A;  2W6Z A;  5E4X A;  1K1Q A;  1VQG A;  4NXM Q;  3J7A F;  2QGQ A;  2ZDG A;  1KBL A;  1XNR L;  4A3E G;  2B2U C;  3S17 B;  4UFZ A;  4A3I H;  3WOF A;  4J1M A;  4IN3 A;  5FLX L;  3MR3 A;  1KDA A;  1SYE A;  5M3M G;  3G6V A;  4J9N A;  3J7Y W;  1I94 H;  1A2U A;  3JSN A;  3RZD B;  1J5E L;  1S10 A;  5KEE A;  4ETS A;  4YY3 H;  1W6K A;  2UUC H;  4ECU A;  3OOC A;  2JQO A;  3D3R A;  3HKS A;  4PZ7 A;  4KKU A;  4DV5 Q;  3GTM B;  3CHB D;  2Z1C A;  3BA9 A;  2BOS A;  4Y52 H;  2ID0 A;  1EFI D;  2WKD A;  2EYJ A;  5K36 H;  4HCE A;  5KFS A;  2E76 C;  3H4D A;  3AQQ A;  3GTJ B;  1B6R A;  4EGV A;  2N49 A;  1AP0 A;  5LP6 F;  3VR2 A;  4EQN A;  2BDN A;  3I56 A;  5C4Z A;  4FP5 D;  2F0I A;  1HZB A;  1LTT D;  3GTP A;  4IUP A;  1YHB A;  3GTG A;  3I72 A;  1KHI A;  1QCB D;  1IL8 A;  2WE6 A;  2JA7 B;  4J9O A;  4BY1 G;  1HPC A;  1QVG A;  2R7D A;  3CQZ B;  3J81 c;  4DR3 Q;  3PUV A;  4DXF A;  1AUV A;  1TWF A;  1KDB A;  4ECZ A;  3MVV A;  5IWA Q;  4X6A H;  4A3D H;  2I5H A;  2KED A;  2PI2 A;  3R5F A;  3H6M A;  2TSS A;  1A15 A;  3KF6 B;  3PZP A;  2RVL A;  3GTQ B;  4DAP A;  4BA1 I;  1UEA B;  1ZYR D;  3RV3 A;  3STB D;  5D8D A;  1OXS C;  3NP8 A;  3A56 A;  1D5Z C;  4B3S L;  1VDZ A;  4KY5 A;  3I3C A;  2JEA I;  4JI3 Q;  1OXT A;  1JB3 A;  3RLO A;  3RGZ A;  3IRB A;  1DZ1 A;  4GNX B;  3NQT A;  2ZM6 Q;  3T51 B;  1D5X C;  4LF9 H;  3MWY W;  2WAC A;  3W1B A;  4JI7 Q;  2XRS D;  3BYY B;  2QW7 A;  4LFB Q;  1ENC A;  4G4K A;  5DG9 A;  3GQC A;  1XNR Q;  1LAB A;  3OWE B;  1I5F A;  3K0X A;  3PN1 A;  5ISR A;  1H9J A;  4OX9 H;  4ME3 A;  3S2D B;  4R8U A;  5CA1 F;  1KRS A;  4IR9 A;  3L7Z C;  1PZI D;  3MC0 B;  5M3F G;  2VR1 A;  1OXU A;  1JOR A;  4JI5 L;  2FXQ A;  3HOW G;  4DV0 H;  4IJL A;  2XWB B;  3OWF A;  2UUB H;  1ENF A;  2KBN A;  3GIJ A;  2JA9 A;  4C3I G;  3GTK B;  1CQV A;  2WB1 G;  4CDF C;  3A74 A;  3M3Y B;  1DOL A;  4YCU A;  5D1P A;  1V1P B;  2MJ8 A;  3J81 W;  1UE7 A;  3NK9 A;  1CT1 D;  3DM1 A;  3E5N A;  1EWC A;  3GLK A;  1JT8 A;  1LV9 A;  5G3L F;  1TU2 B;  1RDP D;  4RB2 C;  3LWU A;  1GKH A;  2M2L A;  2O5J C;  3U9T A;  3TZU A;  4ED6 A;  1T3N A;  1EY8 A;  1PH1 A;  4LF6 H;  4R7R A;  4L5Q A;  3PF4 A;  3H91 A;  4JV5 Q;  3A7L A;  5IT9 c;  2R92 B;  2DJG C;  4DR4 H;  1JR0 D;  3EFX D;  1K8M A;  1SYX B;  4HIM A;  1GM5 A;  2A74 C;  3M7N A;  4EGQ A;  4NXN H;  1VQ9 A;  2A6H C;  3GV8 B;  3J81 E;  2YYA A;  1PFM A;  3OUZ A;  4KJN A;  4PNY A;  2JEB I;  2GVB A;  5D65 A;  3P75 A;  4TSS A;  4A93 H;  5CB4 F;  3BZC A;  3Q23 A;  4DL7 A;  2JE6 I;  1N32 L;  3I7F A;  1LTA D;  4ZAI A;  4XYM B;  3PIP A;  3DMU A;  3UI2 A;  4J9Q A;  4JYA Q;  3M9N B;  2FMM A;  3N40 P;  2OT2 A;  5KIX A;  5KFX A;  5K2M A;  1PRT D;  4BS9 A;  4B3S Q;  2SCU B;  4M1U B;  1PYS B;  1SJH D;  1YNJ C;  4HAE A;  5KFL A;  1LAC A;  3OYY A;  4Q8E A;  3SGI A;  4BY1 H;  2NU9 B;  2CWP A;  3PR4 A;  4AQY H;  2RCN A;  1DYQ A;  3GTL H;  2VQF Q;  4HID A;  1SND A;  3D6C A; 
#chains in the Genus database with same CATH homology
 4BXX G;  2B63 G;  3S1N H;  3M85 A;  4LF8 Q;  3UDG A;  4A93 G;  2OQ0 A;  1TWG H;  2HHH L;  2MQH A;  2Y0S G;  4A3C G;  2KCT A;  1H95 A;  4DK3 C;  1IBK Q;  5LMU Q;  1NBW A;  4GOP A;  1S72 A;  4GKK L;  2PI2 E;  3KLW A;  2A8V A;  1MJC A;  4HJ8 A;  4WJ4 A;  4HJ7 A;  4DR2 L;  4YCW A;  2YTV A;  1AE3 A;  4LUO A;  4R1J A;  1OXV A;  1EFW A;  2IX1 A;  2JA8 H;  4OO1 G;  3EIV A;  1N36 L;  4JBM A;  1Q1E A;  4A75 A;  4BY7 G;  1JB7 A;  1HNZ Q;  3T1Y L;  2NVQ H;  3S14 H;  1XMQ L;  2HT1 A;  4DNI A;  3M9B A;  4YWK A;  2ZTE A;  1IXR A;  5IE8 A;  3E9I A;  2UXD Q;  2NVT H;  5J3B A;  4A3F G;  4R4O A;  2VY3 A;  4DR6 L;  3H0G H;  1LM0 A;  4NPS A;  1E24 A;  5C4J H;  2ZJP A;  3U58 A;  3S2D H;  2VZA A;  2LXK A;  1X6O A;  3J81 i;  5FLM G;  4OX9 L;  1VQ5 A;  2IX0 A;  4DR5 L;  3FP9 A;  3CXC A;  4HJ9 A;  4LF4 Q;  1K8G A;  1YZ6 A;  3I2Z A;  3G71 A;  2UUB L;  4B3M Q;  4POG A;  1I3Q H;  1E1O A;  3AEV A;  1YNX A;  2K5N A;  2R6G A;  2UU9 Q;  1VQA A;  3PO2 H;  1SMX A;  1IBL L;  3KOJ A;  3GTK H;  1CSP A;  1KAW A;  1I6H H;  3G4S A;  2EQS A;  1IZ6 A;  4DV1 L;  4A4I A;  3M3Y H;  3ULJ A;  3TS2 A;  2Z6K C;  3GO5 A;  4OXP A;  1Q81 C;  1PH2 A;  1L1O C;  3AFP A;  3JC6 6;  3CC2 A;  2Q2U A;  3S15 H;  1CKN B;  1HNW Q;  3J7Z C;  3MEF A;  4A3M G;  1D8L A;  2JJQ A;  3EN2 A;  4HIK A;  1EYG A;  3F1Z A;  2E5L L;  2K75 A;  3KF6 A;  5C0X I;  3H3V I;  4LF6 L;  1TWC H;  1BBU A;  2YTX A;  4QY7 A;  4YWM A;  1KIX A;  4GOP C;  2MO0 A;  4BBS H;  2JK8 A;  1FGU A;  5IYB H;  1VQF A;  2KCM A;  3PCO B;  1IBM L;  1OTC A;  4UP7 A;  4JI6 L;  4DR4 L;  2R93 G;  3NEL A;  4DV6 Q;  1L0W A;  1PH5 A;  2JA5 H;  1XPU A;  1IYJ B;  3S1R H;  3PO2 G;  5BR8 Q;  1Y1W H;  1PH7 A;  2CFM A;  3PV0 A;  1QZG A;  1KXL A;  5JEA G;  3J80 i;  4UP9 A;  5C44 G;  1J5E Q;  3T1H L;  5ELN A;  4JI1 Q;  4DUY L;  1SRU A;  5ELO A;  4DV3 Q;  1CKN A;  3CW2 C;  2ZJR A;  3UE0 A;  1VQ4 A;  4DAY B;  2EXD A;  4A3J H;  4LFC Q;  1OXX K;  1E22 A;  1X3G A;  4DV5 L;  2HHH Q;  4DR1 Q;  1N33 L;  4A3G H;  1EQR A;  2WB1 E;  4X64 Q;  3CPF A;  2N8N A;  2QA4 A;  4X62 L;  1XNQ Q;  3RLN A;  1U5K A;  1KC8 C;  1KQS A;  3HOV G;  3E9H A;  1B8A A;  3I4M H;  1HZA A;  1TWA H;  3HOX H;  4IOC A;  1X3F A;  3I4O A;  4P75 A;  4OWT B;  2ALY B;  2UUA L;  4JI8 L;  5IYB G;  4UY8 C;  2BA0 A;  1YIT A;  5IP9 H;  5C0X G;  1N36 Q;  4C3J H;  1PFS A;  4DAM A;  2JA5 G;  5AJ3 L;  3KF8 B;  1A0I A;  4JOI C;  4B3T L;  1X3E A;  3ERS X;  1XMQ Q;  1V1Q A;  4YY3 L;  1N8R C;  2UUC L;  1I50 H;  4MNO A;  4RMF A;  3CPW A;  1JJC B;  4DR3 L;  1GO3 E;  4BXX H;  4XIG S;  1V9P A;  5M5X H;  3NEM A;  3PSI A;  5HGQ A;  5IWA L;  4A3J G;  4A3G G;  2F4V L;  3GTO H;  2GVA A;  3KFU A;  1U0L A;  4X65 Q;  1W2B A;  1XJV A;  1ASY A;  1ASZ A;  3I4N G;  1L1O B;  4DUZ L;  1S40 A;  3BZK A;  1HNX L;  3D0F A;  3I4M G;  3HOX G;  3DLL A;  2WAQ E;  2K5H A;  1NTG A;  1QUQ B;  3OTO L;  1IBL Q;  3KDF B;  1VQE A;  2NZH A;  5IP9 G;  1VQ7 A;  3HOY H;  2XTI A;  1PH6 A;  1Z47 A;  2R7Z G;  3CC4 A;  3K7A H;  2I5M X;  4BY7 H;  4JI3 L;  3RLF A;  3A5U A;  1BBW A;  3L0O A;  2ZTD A;  2RHS B;  3CC7 A;  3PUW A;  3NEN A;  1V43 A;  1G51 A;  5FLX c;  4IO9 A;  1B7Y B;  2VS1 A;  2Z6K A;  4JI7 L;  5H1S E;  4OWW B;  1QZH A;  2AMC B;  4XTC S;  5EAY A;  5JEA J;  1L1O A;  5LMN W;  5IP7 H;  2E5L Q;  4LFB L;  4A3L H;  3JAM c;  1HJP A;  4JI0 L;  3UDF A;  1PYB A;  1YEZ A;  4DV2 Q;  3B6Y A;  3AFQ A;  3TQY A;  5FLM H;  3U4Z A;  2UXB L;  1IBM Q;  3HOU H;  1QUQ A;  1R9T H;  2F3I A;  4JI4 Q;  3KDF A;  3CCJ A;  3HKZ G;  4LUV A;  1KL9 A;  2Y0S E;  4JI5 Q;  1N34 L;  3PO3 H;  4PZ8 A;  1HR0 L;  1NY4 A;  4B3R Q;  2VW9 A;  1YIJ A;  1AE2 A;  1QVF A;  3M4P A;  1L2F A;  1SLJ A;  4R4C A;  3HOY G;  3M4O H;  1PVO A;  5GQO A;  1N9W A;  4LNQ A;  3CCR A;  3ULP A;  4L5S A;  1N33 Q;  1WFQ A;  4IFD I;  1Y1V H;  3K81 C;  2LXJ A;  1A63 A;  1XMO L;  5FJ8 H;  2Z0S A;  5C0X J;  4X62 Q;  4A3M H;  4LF9 L;  2K5V A;  2VL6 A;  4A3B H;  4AYB G;  2PMZ E;  1P16 A;  3VDY A;  2I0Q A;  3J81 j;  3CCM A;  1X9N A;  3TRZ A;  1JJG A;  5IP7 G;  2AHO B;  2VQE Q;  4A3L G;  1AH9 A;  1HH2 P;  3RN2 A;  2PNH A;  3S24 A;  1NJI C;  1EQQ A;  1WOC A;  4X66 Q;  4JI8 Q;  4DV7 L;  5JJL A;  1K8A C;  3HOU G;  1QVC A;  4IOA A;  4JV5 L;  2R93 H;  4DKA C;  1YHA A;  2WFW A;  4GLX A;  4DV0 L;  5DLQ E;  4A3K H;  1I94 Q;  2IHE A;  2ASB A;  3PO3 G;  4K0K Q;  5C44 H;  1NE3 A;  4IJH A;  4UP8 A;  4YY3 Q;  2CCZ A;  4P72 A;  1HNW L;  1CSQ A;  2UUC Q;  2CWA A;  4HJA A;  1BVS A;  1MKH A;  2HQL A;  3STB C;  1YHQ A;  3K80 C;  5GAG C;  2AWO A;  5JJI A;  4JOI A;  4QIW E;  1VQN A;  3G48 A;  1VQ6 A;  4GLA C;  2F4V Q;  1Y1V G;  1HR0 W;  4GKJ Q;  1Z9F A;  1N32 Q;  1YBY A;  4P74 A;  5FJ8 G;  2OTL A;  2IHF A;  2YV5 A;  4A3B G;  5K36 G;  3HOV H;  4BBR H;  2VUM H;  1E7Z A;  4QL5 A;  1UE1 A;  1Q46 A;  1VQJ A;  2CQO A;  4JYA L;  4NXM L;  4DR7 Q;  1IL2 A;  4R4T A;  4FDB A;  4JI2 Q;  1C0A A;  2OCE A;  4C2M H;  2RF4 A;  3A0J A;  4JBJ A;  5C3E G;  4LUZ A;  3H3V H;  4RG1 A;  2E2J H;  4A3K G;  1VQK A;  4NXN L;  4LF5 Q;  4JBW A;  1M1K C;  1TWH H;  2B3G A;  2K14 A;  2D62 A;  3PF5 A;  4GLV B;  4JBK A;  1Y14 B;  1Q7Y C;  3Q8D A;  3RNU A;  2VQF L;  1KD1 C;  3CME A;  2VNU D;  2UXC L;  1C9O A;  3G6E A;  3F2C A;  3ULL A;  1JJ2 A;  3S2H H;  3HOZ G;  3MXN B;  4JCV E;  2UXB Q;  2DUD A;  3I4N H;  2NVY H;  4BBR G;  1Q12 A;  2VUM G;  2PQA B;  1PA6 A;  2YTY A;  4IPD A;  2IT1 A;  1N34 Q;  2E2I H;  4A76 A;  4GKK Q;  1IBK L;  5LMU L;  4YHH L;  3FKI H;  1MJE A;  4DR2 Q;  4HJ5 A;  3UDX A;  2R7Z H;  2BA1 A;  4KHZ A;  5LMN L;  3A5Z B;  4IPC A;  3ZJY C;  1NMG A;  3T1Y Q;  1GVP A;  2LSS A;  5M5Y H;  4C3H H;  4AQY L;  1HNZ L;  1K83 H;  1XMO Q;  4L5T A;  3TEH B;  4LF9 Q;  1K9M C;  3U4V A;  1YJW A;  2UXD L;  4DR6 Q;  1CKO A;  3BJU A;  1EUJ A;  1WCM G;  1LYL A;  1VQC A;  3KYH C;  1XTD A;  2H5X A;  2PQA A;  5IYD G;  4OX9 Q;  3F8T A;  4DV7 Q;  4DR5 Q;  5IY0 A;  1NMF A;  1WYD A;  4JC0 A;  4A3E H;  1HZ9 A;  1UE5 A;  1GD7 A;  2E8G A;  4J15 A;  2UUB Q;  4DV0 Q;  1PV4 A;  4LF4 L;  4OON A;  2YYZ A;  4Y7N H;  1XPR A;  4LWC A;  3GTP H;  4DK6 C;  5M3M H;  3FKI G;  1SR3 A;  4POF A;  4HIO A;  3RZD H;  2UU9 L;  4L5R C;  3GTG H;  1T9H A;  4GN5 A;  1S3O A;  4DV1 Q;  1RIP A;  2K52 A;  4BA2 I;  4QQB X;  3GTM H;  3S16 H;  4PZ6 A;  3UDI A;  5IYC H;  1FL0 A;  4KHP L;  1PH3 A;  2BH2 A;  4AIM A;  1TWF H;  2ZM6 L;  2L15 A;  1VQ8 A;  1D7Q A;  4WJ3 M;  1A62 A;  3GTJ H;  2QEX A;  2ZJQ A;  4GS3 A;  5JJK A;  1JMC A;  1FJG L;  3K8A A;  1VQG A;  4KLK A;  4LF6 Q;  4NXM Q;  2QGQ A;  4OO1 I;  3CCU A;  1XNR L;  2EIF A;  4JI6 Q;  4DR4 Q;  5E7N A;  2CKZ B;  4A3E G;  4UPA A;  3DM3 A;  3OW2 A;  4A3I H;  4QJF A;  1PHJ A;  4DV6 L;  3JAM i;  3ER0 A;  2JA7 H;  4NXN Q;  2WP8 J;  1VQO A;  3WWV A;  3TRE A;  1VQB A;  3HKZ E;  5M3M G;  1K3R A;  5BR8 L;  3T1H Q;  4DUY Q;  3CQZ H;  5GAD C;  1J5E L;  3PUY A;  4JI1 L;  3D31 A;  2UXC Q;  2JQO A;  3HKS A;  4PZ7 A;  5IYC G;  4DV5 Q;  1Q82 C;  1XPO A;  2K50 A;  2Q2T A;  4LFC L;  2K4K A;  3U50 C;  2ID0 A;  1LTL A;  4DR1 L;  4Y52 H;  3FHW A;  1VCI A;  2MFI A;  3HFZ B;  4X64 L;  2GN5 A;  1YI2 A;  3AQQ A;  3PUZ A;  1XNQ L;  5GRO A;  4ALP A;  3GTQ H;  2N49 A;  2E2H H;  2N3S A;  1PH8 A;  4AYB E;  4EX5 A;  3PUX A;  4YHH Q;  3I56 A;  2UUA Q;  3PGZ A;  1BKB A;  1HZB A;  4MTN A;  5C3E H;  1Q8K A;  4R4Q A;  2ZTC A;  4R4I A;  4A3I G;  1YHB A;  5LMN Q;  4LF7 L;  3ICE A;  1KHI A;  5AJ3 Q;  2JA7 G;  2JA6 G;  4B3T Q;  4BY1 G;  4AQY Q;  1Q1B A;  2NN6 I;  2BH8 A;  1QVG A;  4YCV A;  3RN5 A;  2R7D A;  1VQP A;  2RHQ B;  1PH4 A;  3J81 c;  4DR3 Q;  1B70 B;  3PUV A;  2MO1 A;  4LW1 A;  5HY6 A;  4PMW A;  3CAM A;  4DPG A;  5IWA Q;  2IY5 B;  1UE6 A;  4X6A H;  4A3D H;  1DGS A;  2I5H A;  3CCS A;  3TS0 A;  1E1T A;  1G6P A;  1W3S A;  2PI2 A;  3F2D A;  2ES2 A;  3RZO H;  3HOZ H;  3J7A 5;  1HZC A;  4MZ9 A;  4DV4 L;  4DUZ Q;  4X65 L;  2D0O A;  3KF6 B;  2C35 B;  4GN4 B;  5M3F H;  1HNX Q;  4IFD G;  2Q2I A;  3H15 A;  1A8V A;  4BA1 I;  4QGU A;  3E0E A;  3HOW H;  3OTO Q;  3AYH B;  4LFA L;  1YJN A;  3STB D;  3KJP A;  1OXS C;  1C7Y A;  2I5L X;  1M90 C;  1G29 1;  4B3S L;  1SE8 A;  2N78 A;  4C3I H;  2KHI A;  2JEA I;  3UE1 A;  4JI3 Q;  1VS0 A;  1OXT A;  2JA8 G;  4H02 A;  1X65 A;  4KHP Q;  1TXY A;  3RLO A;  3IRB A;  1EOV A;  3EBE A;  1FVI A;  2ZM6 Q;  4GNX B;  3CMA A;  3CD6 A;  4O0A A;  2MNA A;  3PIO A;  3GDE A;  4APV A;  1RL2 A;  4JI7 Q;  1WCM H;  4OWX B;  3W1B A;  1FJG Q;  2OQK A;  1MIU A;  3S1M H;  4LFB Q;  3H0G G;  4LF8 L;  2AKW B;  2NN6 G;  4JI0 Q;  4A3D G;  5IYD H;  1XNR Q;  1I5F A;  3K0X A;  2Q2H A;  4DV2 L;  2R92 H;  4ME3 A;  3J80 c;  1KRS A;  3M4Q A;  1VQH A;  4KI0 A;  3L7Z C;  1KRT A;  1K73 C;  2HIX A;  4JI4 L;  1UEB A;  5M3F G;  1OXU A;  3I55 A;  3K7U C;  3CCE A;  1SRO A;  1HR0 Q;  4JI5 L;  2FXQ A;  3HOW G;  4IJL A;  2KHJ A;  1X54 A;  2ATW A;  4PG3 A;  4B3R L;  1VQM A;  4IPG A;  2B29 A;  2KBN A;  1EIF A;  4GNX A;  4P71 A;  1VQL A;  2JA9 A;  5GAE C;  2OTJ A;  2WB1 G;  3A74 A;  5GAH C;  2HIV A;  4YCU A;  2DGY A;  1P8L A;  1UE7 A;  4TVA B;  4NB3 A;  1K0R A;  4EQ5 A;  3CCQ A;  1JT8 A;  4YWL A;  1GKH A;  3W5O A;  2NZO A;  1WI5 A;  1PH1 A;  1CUK A;  2VQE L;  4BBS G;  4P73 A;  3S17 H;  2V1C C;  4L5Q A;  5C4X H;  2R92 G;  3PF4 A;  4JV5 Q;  2XGT A;  2KEN A;  5IT9 c;  3CCV A;  4X66 L;  1VQD A;  3LGJ A;  3CCL A;  4LF7 Q;  2AWN A;  3CF5 A;  1PH9 A;  1I94 L;  2A1A A;  4HIM A;  1GM5 A;  4B3M L;  1Y1W G;  1Q86 C;  1EIY B;  3M7N A;  4O2D A;  4K0K L;  3W1G A;  1VQ9 A;  4IFD J;  4IPH A;  3NBH B;  3KJO A;  3S1Q H;  3L2P A;  2NVX H;  2R7F A;  2B63 H;  3F2B A;  2JEB I;  2GVB A;  4A93 H;  1X55 A;  3BZC A;  4GKJ L;  2JE6 I;  5M5W H;  3I7F A;  4DV4 Q;  1N32 L;  1JE5 A;  3BU2 A;  3RR5 A;  1WJJ A;  3PIP A;  2OWO A;  4A3C H;  1SN8 A;  2WAQ G;  1SFO H;  1YVC A;  4JYA Q;  1J6Q A;  1O7I A;  1YJ9 A;  4LFA Q;  4DR7 L;  1X56 A;  5C4X G;  2YU9 H;  3GD7 A;  1VQI A;  4JI2 L;  4B3S Q;  4TQU S;  1PYS B;  4GNX C;  4GOP B;  2F52 A;  2JA6 H;  3OYY A;  3SGI A;  1UWV A;  4BY1 H;  1LUZ A;  4LF5 L;  1EWI A;  2CWP A;  4GN3 B;  1E3P A;  3CP0 A;  2A19 A;  1CKM A;  2RCN A;  4JG2 A;  4AH6 A;  3GTL H;  2VQF Q;  4DV3 L;  4HID A;  2D0P A;  4A3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...