1Y1WG

Complete rna polymerase ii elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete RNA Polymerase II Elongation Complex Structure and Its Interactions with NTP and TFIIS
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-D(P*AP*GP*TP*AP*CP*TP*TP*AP*CP*GP*CP*CP*TP*GP*GP*TP*CP*AP
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y1wG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y1wG01
3G4SA 1YHBA 2Q2HA 5C4JH 1N8RC 2R93H 2UUAQ 1A0IA 2DGYA 1OXXK 4A3MG 1FL0A 1VQPA 1I3QH 3PUYA 4DAYB 1R9TH 1N36L 1FJGL 3HOXH 3EBEA 3TREA 5GAHC 1SRUA 1UEBA 1KQSA 4QIWE 3OTOL 4HIDA 2JA5G 2EQSA 1M1KC 1EIFA 4JI5L 3CW2C 2WB1G 1CSQA 1KL9A 2VQFQ 1KHIA 4PG3A 4IFDI 1ASYA 2Q2IA 1YI2A 3BZKA 3U50C 1VQ9A 5C0XG 2N49A 4O0AA 3KDFB 1AE2A 3BJUA 1JB7A 3MXNB 1C0AA 4LFCQ 4L5SA 2JJQA 4R4QA 3S14H 3HKSA 4DV0L 2H5XA 4BXXH 1HZ9A 3K7UC 2OQKA 4RG1A 4XTCS 1AH9A 4B3TL 1U5KA 2CCZA 1X6OA 2ZTDA 1VQGA 2EXDA 5AJ3Q 1HZBA 3F2CA 1Q1BA 3K81C 1OXVA 4JC0A 4X64Q 4B3ML 4NPSA 4QJFA 1W2BA 1HNZQ 4YY3Q 4TQUS 3AYHB 1TWFH 1VCIA 2MO1A 2N3SA 3GTLH 2UXCL 1BBWA 3PO3G 3TRZA 5C0XJ 3G71A 3PCOB 2Z0SA 1IBLQ 2R7FA 5IYBG 3PO3H 2B63G 3BZCA 4R4TA 3CCUA 1VQ8A 4LUVA 3JC66 1NTGA 4LUOA 4Y7NH 1XNQQ 1NMGA 1SMXA 3DLLA 3CCVA 2UXDL 4DR7Q 1IBML 4OWTB 4H02A 1DGSA 3CC2A 5C44G 3RNUA 4LFAL 5JJKA 1L0WA 2ALYB 4DUZL 4DR2Q 4BY1G 1QZHA 2IX0A 4A3IG 1YHQA 3GTMH 3H3VI 1HNWL 1UE6A 5IP7G 1X56A 4GLVB 2AHOB 4X62Q 3CXCA 1VQ6A 4OWWB 1KXLA 4A3KH 2ZTCA 5IP9G 5C4XH 1A8VA 3KFUA 3AFQA 4JI4L 1PH4A 1OXUA 2HIXA 1VQOA 2JA8H 3PIOA 1B8AA 2PI2A 2Y0SG 2NZOA 2MFIA 3HKZG 4DKAC 4DUYQ 2VNUD 4JI0L 1SN8A 3RN5A 4DR3Q 2ZJPA 3AQQA 3A5ZB 2ATWA 2K5NA 4HIOA 4JI8L 4DV6L 1YJ9A 3ICEA 2E2IH 1TXYA 2PMZE 1N9WA 1YBYA 5M3MH 2K5VA 2ASBA 5JEAG 3CCSA 2QEXA 3UDXA 4A3FH 4OO1I 1KRTA 2R7ZH 3UE0A 1CUKA 2YTYA 1PV4A 1KIXA 2BA1A 2K14A 2R7ZG 1HR0L 4YHHL 2LXJA 2CFMA 1VQBA 4C3JH 3PSIA 4GOPC 3HOZH 2ID0A 3H15A 1YVCA 3TEHB 2Q2UA 1YJWA 2F4VQ 1YNXA 3AFPA 1JJ2A 3S1NH 1UE5A 3M9BA 3M85A 3F2BA 4YWLA 5JEAJ 4DV2L 1I5FA 5C3EG 4LFCL 1Y1VG 1PH5A 1YHAA 4UP8A 4JI1L 4DV0Q 5ELOA 1T9HA 4GNXB 3PV0A 2VUMG 3U58A 4ALPA 3PGZA 5AJ3L 3CMAA 2A8VA 2ZM6L 4DR5Q 3HOWH 4PZ8A 4OX9Q 4KHZA 5EAYA 2K52A 2VL6A 2D0PA 1N34Q 3E9HA 4GS3A 3JAMi 4AQYL 2R6GA 4X6AH 4A3JG 2OCEA 1L1OB 1VQMA 3GD7A 1K8AC 3OW2A 1JMCA 2R93G 2MNAA 1IBLL 1B7YB 4JYAQ 2KCTA 2R7DA 1QVCA 3FKIH 5LMUQ 2HT1A 4BA2I 2N8NA 3F1ZA 4DV3L 4A3DG 4JV5Q 2IHEA 3LGJA 4QY7A 4KHPL 1ASZA 3KF8B 4APVA 2GN5A 3GTGH 1JT8A 4IPCA 1XMQL 4DR7L 1A62A 1B70B 3HOUH 5IYCG 1VQNA 1WFQA 4DR2L 3I4NG 1GO3E 4A3LH 3RN2A 1HNWQ 1HZAA 4PZ6A 1Q81C 1V1QA 4A93H 1E1OA 2A1AA 2E8GA 3I7FA 2GVBA 4JI2L 4DPGA 3HOYG 1KRSA 1W3SA 4A3GH 4JI4Q 3OYYA 3H0GG 1Q7YC 2NVQH 3A0JA 3GO5A 1G6PA 1PH1A 1BBUA 3S16H 2CKZB 1GVPA 3PUVA 3B6YA 4KI0A 1OTCA 4DV5Q 4JI0Q 4GN3B 1XPRA 1VQJA 1XNRL 3PF5A 1JE5A 3KYHC 1PA6A 1NBWA 1XJVA 5HY6A 4LFBL 3ULLA 4JI8Q 4B3RL 1NE3A 1L2FA 5LMNL 4DR6L 4JI6L 1IBKQ 2JA7G 4DR4Q 1X3EA 3J81c 1K73C 3K0XA 4GKJQ 4JBWA 1XPUA 1V9PA 3W1BA 2LSSA 2HQLA 1HNXQ 4IPGA 4MZ9A 3KF6A 4IFDG 3K8AA 2RCNA 5C44H 3RR5A 4POFA 4YHHQ 5GQOA 1EIYB 3OTOQ 4ME3A 2YV5A 5H1SE 4YCUA 3VDYA 1K83H 5IY0A 2PI2E 2VQFL 1LTLA 1V43A 4NXMQ 1UE7A 4DR1Q 4AYBE 3J81i 4GOPA 2IY5B 4HJ5A 3U4VA 3F8TA 1E1TA 1WYDA 1EFWA 3WWVA 3MEFA 3GTJH 3UDFA 2CWPA 3I4OA 2I0QA 2R92H 2JE6I 4QQBX 2UXBL 4B3TQ 1CKNA 1SLJA 2K50A 2VW9A 1KD1C 1QVGA 4DV7Q 4A3JH 2KCMA 4HJ7A 3CC4A 4DR5L 1EQRA 1G291 4LUZA 3Q8DA 4BA1I 1N34L 4OXPA 4X64L 1XMOL 1TWHH 1VQLA 4YCWA 4DV1Q 3M3YH 5C0XI 1X3FA 1VQFA 4JYAL 3J7A5 4L5QA 1HH2P 1VQAA 1PH7A 1QUQA 4HJ8A 1NJIC 2D62A 5LMUL 3K7AH 4NXNL 4HIKA 3T1YQ 1MKHA 1J5EL 2GVAA 3CMEA 2RF4A 3GTPH 4IJHA 3J80c 2HHHQ 1GD7A 4BXXG 4KHPQ 1H95A 4YWMA 3HOVH 2JQOA 2B3GA 1MIUA 3TS0A 1PYBA 1XNQL 1VS0A 2YTXA 1K8GA 1X65A 4A4IA 1XPOA 4GNXA 1NY4A 4IPHA 1EQQA 3RLFA 5M3FG 4DUZQ 4BY7H 4GLXA 2BH2A 1I50H 5M5WH 1E3PA 3NENA 5M5XH 4JI7L 4X62L 4J15A 4IFDJ 5FJ8G 3M4OH 3J80i 3S15H 3CCMA 3J7ZC 3GDEA 3ULPA 4P74A 4BBSH 2ES2A 3M4PA 4DV5L 3CD6A 2A19A 4LF5Q 1UWVA 4OONA 2MO0A 4DUYL 4A3IH 3D0FA 1QVFA 3UDGA 4LFBQ 3S1RH 4IJLA 5IWAL 5BR8L 2UUBQ 4B3RQ 4C3HH 4L5TA 2I5HA 2OWOA 1SE8A 4P71A 5LMNQ 3CCLA 4DR6Q 5C4XG 4DR4L 4LF8Q 5DLQE 4GKJL 4UPAA 2JA8G 4YCVA 5IT9c 1YIJA 2UUCQ 4LF7L 4IO9A 1HNXL 2L15A 2YTVA 1Q1EA 1X54A 2AWOA 3HFZB 5FLMG 1TWCH 2JA7H 1P16A 2DUDA 2KHJA 4DK3C 4LF4L 4C2MH 3GTQH 1FGUA 3HOZG 2Z6KA 3J81j 1HR0Q 4BY1H 4LWCA 1SR3A 4DK6C 4HJAA 3KDFA 4RMFA 4LF6L 4K0KL 4DR1L 3L7ZC 1WCMH 2F4VL 4LF9Q 4R4CA 1TWGH 1SFOH 4UY8C 4DV2Q 2XTIA 1Q12A 4A3MH 4DV4L 3D31A 2VQEQ 2VUMH 4JI1Q 4EQ5A 2UXBQ 1D7QA 3S2HH 3CPWA 4DV7L 4JBKA 1GM5A 1IZ6A 2I5MX 1Q46A 1VQDA 3ER0A 4Y52H 3KF6B 1XMOQ 3GTKH 2ZM6Q 3FP9A 1IXRA 3A74A 3KJPA 3CCEA 4DV1L 1Q86C 3T1HQ 4HJ9A 2NVXH 1E24A 4OWXB 2FXQA 3K80C 1PH3A 1S3OA 1LM0A 1VQCA 1PHJA 3W1GA 2UUAL 3GTOH 4P75A 1Y1VH 4B3SL 2HHHL 1EOVA 3ULJA 1L1OA 3PF4A 1FJGQ 1N32L 3CPFA 3KLWA 4JOIA 2ZJRA 4A3CH 4A3BH 2Y0SE 2D0OA 2IHFA 1Q8KA 3U4ZA 4YWKA 3CCRA 1Y1WG 4JI5Q 4FDBA 1MJCA 1XMQQ 3HOXG 2PNHA 1OXTA 1PH6A 1Y1WH 3A5UA 2JA5H 4DNIA 4X65Q 3H0GH 3I4MG 4JI7Q 4JBMA 2JA9A 5IYBH 3PO2G 1EWIA 1SROA 4JI2Q 4HIMA 4IOAA 5IP9H 4R4OA 3UDIA 3CP0A 1RL2A 4GOPB 3PO2H 1LUZA 3L0OA 1VQHA 3PUWA 3TS2A 1Z9FA 2CQOA 4R4IA 5GADC 5IYCH 2OTLA 2B63H 1WI5A 4JOIC 4DAMA 2JA6H 3I4NH 5IE8A 1VQEA 3RLNA 4YY3L 1OXSC 1VQIA 4MTNA 1HJPA 3HOUG 2F52A 2I5LX 2OTJA 5IYDH 4C3IH 3DM3A 1Z47A 2KBNA 2WP8J 2UUCL 4JI6Q 2AKWB 1WOCA 3HOYH 4GKKQ 4A3FG 3SGIA 2E2JH 1M90C 3E0EA 5FLXc 4P73A 4A3EH 1X55A 2ZJQA 4X66Q 1I94L 3S1QH 2UXDQ 4EX5A 3AEVA 4BBRH 1I6HH 2K4KA 4AIMA 3KOJA 4LFAQ 2QGQA 1TWAH 2KENA 3RLOA 2UU9Q 1CKOA 4WJ3M 4PZ7A 3KJOA 3UE1A 4GNXC 2E2HH 4LF6Q 4K0KQ 3S1MH 4A76A 3G6EA 3IRBA 4NXML 3H3VH 2E5LL 1P8LA 1QZGA 1N33L 1AE3A 4BBSG 1A63A 2B29A 3I56A 1E7ZA 3E9IA 5ELNA 5M3MG 5M5YH 2EIFA 2WB1E 4JBJA 2VQEL 2Q2TA 3I55A 3STBD 1RIPA 2WFWA 1O7IA 3EN2A 5HGQA 4DR3L 2V1CC 2C35B 3CQZH 4QGUA 4JI3Q 3G48A 4GN4B 4JCVE 1FVIA 2JEAI 1HZCA 4MNOA 3HOWG 3T1HL 3RZOH 1CKNB 3BU2A 3I4MH 5GAEC 1S72A 4LW1A 4IPDA 2BH8A 3TQYA 4A3BG 3ERSX 2PQAB 2R92G 2IX1A 5K36G 4B3SQ 1D8LA 1N32Q 3FKIG 3T1YL 1J5EQ 4NXNQ 3S17H 1L1OC 4AH6A 5LMNW 1JJCB 1YEZA 3JAMc 3RZDH 4KLKA 1N36Q 3CC7A 4TVAB 4UP9A 5M3FH 2RHQB 2WAQE 5E7NA 1VQ7A 4OO1G 2VS1A 3PUXA 1NMFA 4A3CG 3STBC 1YJNA 1IYJB 4X65L 4IOCA 1X9NA 4A3LG 5GROA 1J6QA 2CWAA 3PUZA 4A93G 2JA6G 4GN5A 3ZJYC 3L2PA 4A3GG 5C3EH 4A3KG 3HKZE 5J3BA 1VQKA 2ZTEA 4A3DH 2YYZA 3M4QA 2N78A 3CCJA 4OX9L 4BY7G 4LF5L 4B3MQ 2F3IA 1X3GA 4AQYQ 1G51A 2XGTA 2QA4A 1PH9A 3S2DH 1IL2A 4A75A 1HNZL 3CF5A 1CSPA 1PVOA 1MJEA 2VZAA 3I2ZA 4WJ4A 5BR8Q 1KAWA 5IWAQ 2LXKA 1LYLA 2UUBL 2UXCQ 2IT1A 4AYBG 2JK8A 4JG2A 2RHSB 5FLMH 4LF8L 4GLAC 4DV3Q 4JV5L 4GKKL 1BVSA 3EIVA 4LF7Q 1E22A 2K75A 3HOVG 1VQ5A 2NVTH 4L5RC 4X66L 1I94Q 4R1JA 2BA0A 4LNQA 1K3RA 1YZ6A 1C7YA 2NVYH 1EYGA 4LF4Q 1CKMA 1XTDA 2JEBI 1IBMQ 2UU9L 5JJIA 2MQHA 5GAGC 1Y14B 1UE1A 4A3EG 2OQ0A 3CAMA 1PFSA 2HIVA 2VY3A 4BBRG 1GKHA 1K0RA 2KHIA 3S24A 4POGA 2K5HA 3PIPA 5FJ8H 2E5LQ 2NN6I 3NBHB 1N33Q 1BKBA 1S40A 1PH2A 4LF9L 1PH8A 1JJGA 2NZHA 4DV4Q 1EUJA 1VQ4A 5IP7H 4XIGS 1QUQB 2WAQG 4O2DA 2YU9H 4UP7A 1YITA 3NELA 4QL5A 1PYSB 1Q82C 2AWNA 1KC8C 1K9MC 1XNRQ 5IYDG 1C9OA 4JI3L 3FHWA 1U0LA 4P72A 1WCMG 1WJJA 4NB3A 3CCQA 2Z6KC 2NN6G 2PQAA 1HR0W 4DV6Q 1IBKL 2AMCB 5JJLA 4PMWA 3NEMA 3M7NA 3F2DA 3W5OA
chains in the Genus database with same CATH superfamily
3Q1KA 2DGYA 2EPBA 2A6HD 4A3MG 2ZDQA 3HKZA 4ZHQF 4DAYB 1N36L 1PFMA 2VPSA 2SNSA 3HOXH 4YR2A 1Y8PB 1KQSA 4ME6A 4HIDA 1FGBD 3T16A 1H9SB 2EQSA 2H1EA 4QUCA 1DXMA 1GUTA 4JI5L 4IFDI 3DUZA 2Q2IA 3J7AV 1VQ9A 2N49A 1KJ9A 3FPUB 1F9SA 2CH4W 2EVBA 4OO1H 3MXNB 1LV9A 2XCPA 4R4QA 4KK7A 4DGZA 2OQKA 4RGNA 1AH9A 4B3TL 4RUAA 5LYJF 5KFBA 4B3SH 5AJ3Q 4B3ML 1OXVA 1AFPA 4NPSA 3S9WA 2MPMA 1W2BA 2J6UA 4FS2A 4YY3Q 4ZUIA 1K83B 2UXCL 3TP8A 2WB1B 2BQ3A 3TRZA 5C0XJ 4RAUC 1AZQA 2EDGA 4J9OA 2ZJTA 2R7FA 5IODA 4QWEA 5DQHA 5IYBG 2R93B 2V59A 4EBEA 3V6JA 3CCUA 1HXYD 4O3PA 4IUTA 2WV6D 4LUVA 5FLXW 4MA0A 3PMFA 1EZ6A 5IGDA 2G5DA 4FXDA 2YZGA 4ZI7F 3GTPA 4OWTB 3EA6A 3FDTA 2R8KA 5JJKA 3QFFA 2R92A 1L0WA 4DUZL 1QZHA 4DR2Q 1GOZA 1HNWL 1UE6A 4IZ8A 4GLVB 3UQ8A 3LWEA 3OWEB 1IYUA 3CXCA 4F4XA 4OWWB 1I4GA 1KXLA 3QOLA 1S5FD 3S1QB 2WAQB 4IZOA 1S0OA 4JI4L 4N8X1 2HIXA 1VQOA 5CMDA 2JA8H 1CQFA 4Q8EA 1B8AA 2PI2A 4RCOA 2R84A 2DJFC 5KFTA 4DUYQ 3LMLA 5KFHA 2VNUD 2JXMB 1G8ZD 3AQQA 4ILWA 1HQRD 2K5NA 4EQPA 3K5HA 4R8IA 2PMZE 2K5VA 5JEAG 2R92B 3I4LA 3UDXA 4A3FH 1KRTA 3PR4A 2XN9C 4UCTA 1PZJD 4K2KA 4G4KA 2JA7A 4HCEA 4YHHL 4EFBA 4GOPC 4ZOLF 1BBXC 2ID0A 5CV8A 1ICFB 2ATLA 4J9LA 2F4VQ 5EDWA 4F4WA 5I6YA 3M85A 4YWLA 4DV2L 2R8JA 5C3EG 2JA6B 4LFCL 1R4PB 1SNQA 3MFYA 2F3VA 3EPGA 4K14A 1KNEA 1T9HA 2LMCB 2VUMG 3U58A 4ALPA 5M5YB 1EIHA 3TIIA 4DV0H 2ZM6L 2W6PA 4DR5Q 4JI6H 5EAYA 2D0PA 3E9HA 4AQYL 5KNDA 1TWCB 4JV2A 5CBAE 2OCEA 1JMCA 3GD7A 1H95A 4H44C 4UHVA 2MNAA 1QVCA 4DAYA 4ABNA 3GIQA 1U4PA 3MC0B 4YJ2F 5EBDA 3OHAA 4N8FA 4QW9A 4KHPL 1ASZA 5KG3A 3J80W 2GN5A 3BDOA 3K5OA 1JT8A 2RDIA 4ZQIA 2XD4A 4LF4H 5IYCG 1VQNA 1WFQA 2C22A 4C1NK 1TWFB 3Q24A 1GO3E 3S1RB 1JDEA 1RK6A 4UCUA 1SNDA 2UUCH 4O2AF 2E8GA 1UNNC 1V51A 5CA1F 2V4DA 3H0GG 3I91A 1Q7YC 2R3ZA 2RSNA 1PH1A 1BBUA 1WCMA 1PX2A 5FD5A 3F8NA 2J4XA 1S0NA 4DV5Q 4JI0Q 3G7LA 2NU9B 1WCMB 2F0NA 1DCZA 2B39A 5LXTF 1PFBA 1S03G 5HY6A 1GUOA 3M9MB 4MHEA 4FBUA 5C6AA 2R7MA 1SYFA 4KD4A 3S15B 4DR6L 4DL5A 1X3EA 5C4XB 3K0XA 5I4DA 3R8BA 1LACA 2DY8A 1LO5D 4O3OA 3BDLA 1RYRA 4PDBA 1JR0D 2CHBD 3GTPB 4NLGA 4IPGA 3KF6A 2E75C 5C5MA 2NVXB 5KG2A 3KHLA 4TV9F 3CRLC 5FPOA 3JSLA 2YV5A 4K5WA 1T5XD 4YCUA 4MV4A 4DUZH 1LTLA 3FPPA 3V05A 1TWGA 3BZDB 5EGTA 5J1ZA 1KLUD 4RA8A 4C3JG 4JI3H 2CQYA 2IY5B 2Y0SA 2RVLA 2EY6A 4JI4H 2QEJC 3W2DA 1WYDA 3RFCA 3MEFA 2UXBL 2JE6I 5JPMC 2NVYA 4B3TQ 3LNNA 4C2MA 5KX5F 1KBLA 1KD1C 1XX8A 4DV7Q 4HJ7A 1EQRA 2RBMA 4LUZA 3URYA 4BA1I 1XMOL 1TWHH 1A15A 3A8IE 4M9UA 2OH2A 2NVTB 1TVXA 1HRJA 5EWGA 1HH2P 1TR5A 4QB4A 1QUQA 2NTTA 1LTAD 2D62A 3MWYW 3I72A 3MAQA 2RF4A 3GP7A 4QCLA 2W9CB 2HHHQ 3TQ1A 4LSXA 4DA2A 1IYVA 4F7XA 3RAXA 2O5IC 4DL3A 1X65A 1XPOA 1DV2A 3BVMA 4GNXA 1PK8A 2YZMA 3NUCA 4RNMA 4IPHA 1WTOA 1EQQA 3RLFA 2IX3A 4DUZQ 2K03A 5DLGA 3VPBA 1E3PA 3D4DA 1M0WA 1ZYRD 2W70A 4X3KA 3J80i 2HGSA 5BPHA 3S15H 2E5LH 2ASLA 4CKBA 4P74A 2FJ2A 3Q8RB 1DM0B 4QMGA 3M4PA 2A73B 5C4HA 1KNAA 4OONA 2A68C 4LF9H 3MA2B 2HJWA 4LFBQ 4R8NA 2UUBQ 3NE5B 2Z1CA 3R3OA 3RZDB 4DF7A 4L5TA 2OWOA 1HQMC 3GQBA 5C4XG 3BG5A 2F1MA 4DR4L 1O7YA 1S5BD 5DLQE 2VUMA 4UPAA 3NHHA 4WRDA 1K3BC 2UUCQ 2FMCA 4IO9A 5I9PA 4WJWA 2QYZA 1HNWH 3HFZB 1FD7D 5FLMG 3E5NA 1P16A 2Q8IB 4C2MH 4ECUA 1TS5A 4BY1H 3KDFA 1KDAA 1E4GT 3CRKC 4C3JB 4DR1L 2DPJA 1M8AA 4IURA 4BBRB 3C3LA 1SFOH 1TWGH 3TZUA 3OMGA 4DV2Q 3OTOH 1EYCA 3SK8A 3S14B 4ID6A 1YNJC 1AUXA 2FB9A 1DONA 3CHBD 1IZ6A 1RTNA 4B08A 1VQDA 1IXRA 1BXTA 3A74A 3KJPA 1ICWA 3CCEA 5JQWA 4ECWA 4HJ9A 3S16B 3HOWB 5IYZF 2AGPA 1SYXB 5DG7A 2A6EC 2UUAL 4A3DB 3TP5A 3GTOH 4P75A 3GTMA 4XT3B 2PCFB 3BVZA 1W93A 3ULJA 3PF4A 2K33A 3BABA 1VF7A 4GKKH 1TT2A 5D3IB 2D0OA 1SFOB 3U4ZA 3CCRA 4JI5Q 5IT9E 4G7OC 1MJCA 1IOVA 4KMUC 5E4XA 2JEJA 1N33H 1BOSA 2PNHA 1JWMD 3EVQA 5FK9C 1W96A 2J6TA 1DD2A 4DNIA 4K5XA 2Z9HA 1A6XA 4JBMA 1GGOA 1CFMA 1SROA 1WTRA 2Q8TA 1H9RA 4IOAA 4K2LA 5KYLA 4R4OA 4GOPB 1DOKA 3TS2A 3L0OA 1Z9FA 4JOIC 4A3GB 2JA6H 4IRDA 2B8FA 1EU4A 4YY3L 1OXSC 1RJQA 2SOBA 1VQIA 2R8HA 2XNAC 1JC7A 2OTJA 4HAEA 1BR9A 2XIWA 3SXHA 4DFAA 2B2WA 2K6AA 1JXLA 3HOYH 4C3HG 4LH7A 4OEMB 1FNVA 1SSOA 3OUUA 2OLSA 1E2WA 4A2AA 1M4VA 2WKDA 1XNQH 1B6SA 3RLOA 1I4XA 1CKOA 2IMWP 1KLGD 4A3IB 3IRBA 3K5IA 2E5LL 1N33L 3ETHA 1AE3A 4YP3A 4NP5A 1E7ZA 5ELNA 2VQEL 1M7JA 4EEYA 2WB1E 1W6JA 1QILA 3C2PA 4B3TH 4QWAA 1JDBB 1HFNA 3MJFA 3RGXA 1STAA 2EE1A 1V1PA 4ECVA 4EG0A 1OWTA 1C4QA 3IKJA 2ZT9C 3G48A 3VYRA 1GSOA 3T1HL 5KT2A 3VYSA 5CGKA 5GAEC 4EQOA 2BH8A 4K8JA 4LF7H 3TQYA 1CA5A 5G3LD 2W8LA 3ERSX 2IX1A 5K36G 1CT1D 1D8LA 1PRTF 1RTOA 2HCIA 2W9AA 2J0TD 2RHQB 5EPKA 3PUXA 3OSNA 3FDSA 3HOUB 3QWNA 3STBC 5AFWA 1O78A 2VA2A 4IOCA 1GSHA 5GROA 2B8GA 3GTKB 3P1HA 5HV6A 3M9OB 1LLRD 3HOVB 4S3SA 1E4EB 5LP6F 3ZJYC 4A3FB 2K01A 2TMPA 3VYUA 4CGYB 5GONF 2HDMA 1QOHA 2ZXRA 4FU0A 2F3IA 4O3SA 4AQYQ 2XGTA 1TY0A 1EWCA 3BG3A 1CSPA 1HNZL 1MJEA 2UUBL 4HQ6A 4QIWA 1TQOA 3T53B 2IT1A 3OHXC 4JG2A 3KTMA 1M6VA 1EU3A 4GLAC 5IGFA 3VR4A 4JV5L 1PRTC 1GLVA 4GKKL 3HOVG 1S9FA 1VMCA 1PTOC 4X66L 4B3RH 4R1JA 1U4MA 4JW0A 1YZ6A 1C7YA 4LF4Q 1H9KA 2JEBI 4HSVA 1IBMQ 2UU9L 2CZGA 4I65A 1Y14B 4BY7B 4UCRA 2CQAA 5KFVA 2HIVA 3HS0C 1K0RA 2VR1A 3KFUA 2K5HA 2K28A 3PIPA 2NN6I 3NBHB 3NK9A 5A2QW 2R7ZA 3J81E 4LF9L 3C0FB 1NUCA 4RU9A 4C56C 4UFZA 1NR2A 4X65H 2K5QA 3N41B 5IP7H 4MV1A 2WAQG 1EIGA 3RD4A 3HRZC 1A3VA 4KY7A 4YBZB 2AWNA 3PIP3 2D9UA 3O13A 1D1KA 1WJJA 3KHRA 3CCQA 5EBCA 2NN6G 2PQAA 2AU0A 2F0KA 4ZCKA 1VBHA 4XYOA 5JJLA 3F2DA 5KFXA 2Q2TA 4RGOS 1YHBA 2Q2HA 4ED2A 5C4JH 5CC4A 2UUAQ 1A0IA 1OXXK 1FL0A 1VQPA 1UC9A 2M00A 1I3QH 3PUYA 1R9TH 4YR0A 3EBEA 3TREA 4XXEA 1GUSA 3OTOL 2C00A 1JWUD 4ZQ3A 4ZKBB 1M1KC 1HUMA 1RF2D 2GA4B 4F88A 1CSQA 1KL9A 4K6LA 1KHIA 1LT3D 2DZDA 2FK1A 3E0JA 1ASYA 5KKNB 3BZKA 2QF7A 3U50C 2AQ2B 2FPIB 3K6OA 1FKAH 5CV9A 3GIIA 1RCVD 4QWBA 1JB7A 1TWAA 2F0HA 2RCFA 2JJQA 4LAAA 5KGUA 3MR5A 4DV0L 2H5XA 3GTQA 1V1OA 2YU9B 1B44D 2RDFA 2FFKB 3VPCA 1CQIB 3GTLA 2UVUA 3F2CA 1Q1BA 2D5DA 2JN4A 4IAJA 1VDZA 2EOTA 4O3QA 3K5MA 5C5JA 1VCIA 2MO1A 3GTLH 4JPBW 2PBZA 4HN7A 3ORQA 3G71A 3TP7A 1KDBA 1PRTB 4TSSA 3TZDA 4YHHH 3PO3H 5LMNH 2HD3A 2J7ZA 4PNYA 4R4TA 1VQ8A 3JC66 1NTGA 4Y7NH 1XNQQ 5KIXA 4RWSC 4JI0H 4H02A 1DGSA 5EJWA 2LS01 2EJMA 2ALYB 2F0WA 1YHQA 2EXZA 1WD1A 2AHOB 3C1EA 5JVG3 1ML0D 1K8MA 1JIHA 5K5PA 3JZIA 1A8VA 3GIPA 1FYCA 1OXUA 5C1PA 2FK3A 1ZEQX 1EWHA 3HKZG 4DKAC 1EL0A 3HXLA 4DR3Q 4TUYF 3I4NB 3A5ZB 2ATWA 4M1UB 4DV6L 1TXYA 5A35A 1N9WA 1R4QB 5DG8A 3QOJA 5LMUH 4WORA 5C5LA 1B53A 2V4QA 2R7ZH 4OELB 1F9QA 3FEWX 3UE0A 1PV4A 2YTYA 2JA5B 2E2HA 1E0BA 5M5XB 2ENBA 2R7ZG 5KG5A 1HFGA 1VF5C 2CFMA 3M7GA 4MAMA 3PSIA 4G7HC 3J80L 1EQVA 2VB2X 4KV6A 2RGVA 2DIKA 2Q2UA 1YJWA 3A7LA 1YNXA 1C3OA 3S1NH 5FO9B 1NCVA 1UE5A 3M9BA 3F2BA 5I9OA 1I5FA 4L8JA 1ESFA 2EYOA 2B63B 1NAPA 4JI1L 4WD3A 3OSPA 1BCPF 5D1OB 1PTOH 4Y8VB 2F03A 4O3NA 4EQNA 3P7JA 2L9HA 2WTFA 1E4EA 3PGZA 5AJ3L 4Q5VA 1C48A 2RKSA 3HOWH 4J8QA 4H7BA 1VAJA 2B2UA 1XDNA 4GS3A 3JAMi 1EUDB 4X6AH 3KLSX 1TAEA 4AYBB 1VQMA 1K8AC 2R93G 1S68A 4GKJH 3DF7A 4RB3C 4YB8B 3FKIH 5KG6A 1N36H 4JV5Q 4EVOA 4A3DG 4J9SA 3LGJA 4HR7B 4V190 2BE5C 1B6RA 4APVA 5JVDF 5I2XA 2F0SA 2K5WA 3BYTB 5DLFA 4DR7L 1XMQL 3G6YA 2G9HD 2A68D 5ELBA 1TKWB 1L0YB 4DR1H 1HNWQ 1HZAA 4PZ6A 1V1QA 4A93H 4ECQA 2A1AA 3ND9A 2SCUB 4DPGA 3VR2A 4A3GH 4JI4Q 2NU6B 2C2DA 2VQDA 3GO5A 1G6PA 3TDQA 1TWHA 2KSWA 5KFCA 1EZ8A 2UUBH 2R7ZB 4KI0A 1OTCA 1D6EC 4NMZA 5DAUA 5KFLA 5LL6b 1JE5A 3KYHC 1B1ZA 4PMCA 4TKOB 4JI8Q 2PW7A 3SR1A 1BJTA 2W7OA 1AN8A 3GTGB 4I7HA 1GJXA 5KFFA 1EYZA 1CS0A 1JWSD 5DM73 4G7ZC 1TU2B 3J7YW 1K73C 3A55A 1XPUA 1V9PA 5J22A 3W1BA 5K36H 1J8IA 4R7RA 1HNXQ 2VPQA 4C3HB 2XGQA 3H0GB 3K8AA 3PZPA 1AZPA 3RR5A 2YL2A 4KKUA 4POFA 3RUZA 5GQOA 2W6QA 5J2UF 3OTOQ 4IHJF 4IWXA 3NTHA 1K8OA 3VDYA 3N43B 1GUGA 4AYBE 1SNOA 5JPNC 1ONLA 4LMQD 2CW0D 3F8TA 4G3IA 5LA6F 2JA7B 3TQTA 1EFWA 3N8DA 5JH7F 3GTJH 3UDFA 3I4OA 4RFBA 4QQBX 2X6GA 1SLJA 4EBDA 1GUWA 2KCMA 2VXWA 4GC6A 5EKIA 1O75A 2CW7A 4X64L 2HUGA 5KNCA 1VQLA 4YCWA 4DV1Q 5C0XI 1X3FA 1VQFA 4Q0FA 1B3QA 1NR4A 4JYAL 4L5QA 4QF4A 1NJIC 5LMUL 1CM9A 5IT9L 3J81L 1SE2A 1YNND 1S5DD 3K7AH 4NXNL 1MKHA 1J5EL 4BWGB 3CMEA 3GTPH 4MV3A 4LK1C 4KHPQ 2MCTA 5KFYA 4YWMA 1KDCA 3AU7A 3HOVH 2YW2A 3DWAA 1XNQL 2YTXA 4HNTA 4I7ZC 1IKMA 4MV8A 5KFGA 1EY8A 3EPIA 4X3SA 1HA5A 3HOXB 4B3MH 2AGOA 4X62L 3FRPB 4IFDJ 4FXGC 2FP4B 1I4HA 1HNXH 4DXGA 2XVSA 4KD3A 2ES2A 1IHZA 2B2YA 3CD6A 1WSCA 1FNWA 1RDPD 2NUAB 2MO0A 4A3IH 2PPBC 3D0FA 4O4IF 2JA5A 5KT6A 3S1RH 1PXUA 4IJLA 5IWAL 3TINA 3PR5B 5F2DA 1AN7A 2JP1A 2V4RA 4GKJL 2JEGA 3BVGA 4QWDA 1Q1EA 3PW7A 1SYEA 2AWOA 2V9WA 2JA7H 2DUDA 4DK3C 4LF4L 1B9MA 2Z6KA 2GLTA 3GTJA 4DK6C 2E2DC 3G6XA 4N9PA 2BCOA 5KYIA 2K05A 4K0KL 4FBTA 4UAIA 3RB3A 4XDXA 3MFHA 4LF9Q 4C1NI 5JJZA 2XTIA 4A3MH 2F0OA 5KG0A 1D5ZC 4XX0B 4JI1Q 4EQ5A 2W7PA 3SVMA 1HTPA 1MZBA 1LTBD 4DV7L 4NW2A 2I5MX 1Q46A 3ER0A 3KF6B 5I6WA 3GTKH 1S97A 3MR6A 4IALA 1T5EA 3VR5A 1G6ZA 2FXQA 5KFPA 3K80C 1PH3A 1S3OA 2F4IA 4ED6A 3ITPA 1PHJA 1N32L 4X3UA 2HHHL 3CPFA 3KLWA 1I50A 2BE5D 2ZJRA 4I7AA 1FR3A 1KEEA 4YWKA 4LFCH 2ICIA 1XMQQ 1TWHB 4CKEA 4ZRZA 3DM1A 2PW5A 2JA5H 3IG0A 1EYDA 3N6XA 5LL6X 5IYBH 3PO2G 3SI8A 3PW5A 1RL2A 1SE4A 1LUZA 5E3FA 4BA2I 4MV7A 4R4IA 2B63H 3I4NH 1J9OA 1S5CD 1ENCA 3P20A 2YYAA 2EJFC 2UVVA 3SK4A 4MTNA 5ISRA 3HOUG 4HCSA 5IYDH 2EYPA 1EEFD 4B9WA 4BS9A 1Z47A 2KBNA 2UUCL 5L1IA 5A2QE 3TBIB 3SGIA 4APMA 5BN4A 1IW7D 4A3EH 4F8MA 4X3TA 3OUZA 1BNCA 4Q0YA 1I6VC 4BBRH 3K5NA 2YS6A 3DHQA 4AIMA 3SHLA 3R5XA 1TWAH 2KENA 4WJ3M 4LF6Q 3H20A 3UE1A 2XC9A 4RGTA 1G91A 4A76A 3G6EA 4MTDA 1AP0A 3GILA 2B29A 3IFDA 4XQNA 5DQIA 3GV8B 4UDUC 2NWGA 2EYLA 3I55A 2PZWA 4LMYA 5CB4F 4CJ2C 3STBD 1UEAB 2C2RA 2ZDHA 3NPPA 1N48A 2WFWA 1O7IA 1SNMA 2NU7B 4CDEC 4HMJA 1TWCA 4DR3L 2V1CC 4QGUA 4JI3Q 4GN4B 4JCVE 1FVIA 3BDCA 3TN2A 3HOWG 4KKSA 3RZOH 4MA5A 3BU2A 1Y69U 1J5EH 4NXNH 4LW1A 1MHWC 2GPSA 2R7KA 4ETSA 3FKIG 1J5EQ 4NXNQ 3S17H 2GPWA 4Q8FA 1JJCB 3RZDH 2K5DA 3UI2A 4TVAB 3MTSA 2NBFA 2NTSA 4UP9A 5KT7A 3QB3A 4L63B 5M3FH 2WAQE 1QCBD 3EYYA 4DN4M 1F77A 1QE6A 4X62H 4A3CG 1YJNA 1IYJB 4DNRB 4X65L 1CQJB 1LT6D 1X9NA 4A3LG 3KHGA 1J6QA 1JORA 1YNNC 3PUZA 5C3EB 2JA6G 4DV5H 4DL4A 4HYKA 1Y8OB 4GN5A 3L2PA 4DL7A 5FO7B 4JI1H 1D2BA 3SEBA 3D3RA 2L4NA 3M4QA 2N78A 4OX9L 1STBA 1TWGB 4BY7G 3OMCA 1X3GA 3S2DH 1G51A 2QA4A 1IL8A 3KK7A 4HEDA 3RTXA 5IWAQ 1KAWA 2UXCQ 3R93A 4M7EA 2XRSD 1I7LA 3T5KA 2RHSB 2F0FA 2SNMA 2XWJB 5FLMH 4LF8L 5EWFA 5IGBA 5KFJA 1BVSA 2TSSA 2NVXA 1E22A 3L4KA 5L1JA 2NVTH 2HHHH 1I94Q 2BA0A 2RDGA 3NXWA 3Q23A 1S4ZA 4FNFA 3MXNA 2NVYH 4DL2A 1EYGA 2Z8LA 3KXYT 2FE3A 1Y1VA 4MV9A 5DGAA 4A3EG 1UE1A 2R7NA 2K04A 4KJOA 3GTQB 2VY3A 3K58A 1E2VA 4BBRG 1GKHA 4POGA 3SK6A 1N33Q 3K57A 1PH8A 3CU7A 2O4XA 4DNTB 1JJGA 4DV7H 3MFIA 4DV4Q 3RJ0A 4NXMH 2RQXA 1U4RA 4R8UA 1KC8C 3MXUA 3WOFA 1K9MC 4CBVA 3FHWA 4P72A 3KHHA 5C44B 4PWQA 3Q2OA 3KBXA 1BGWA 1I6HB 2C2EA 1SXTA 2AMCB 4KKTA 3ORRA 3HP3A 4J9KA 2AUJD 4IWYA 4TQRA 2R93H 1F2YA 3GIKA 3RGZA 2L0CA 2FK2A 5IGEA 5GAHC 1ZYRC 5ELCA 4TRDA 1ZHQA 2V58A 3IFTA 5M5WB 3CW2C 3VMMA 2WB1G 2VQFQ 3EJIA 1CQVA 1YI2A 5T1GA 1CHQD 5FD6A 3I8ZA 5KT4A 3CQZB 3Q0AA 4DLKA 5C0XG 1JKJB 1AE2A 1SDFA 2K32A 3BJUA 3GV3A 1C0AA 1LABA 3SE0A 4DK0A 3KALA 5KFSA 1HZ9A 3I3CA 4YAKB 4XTCS 5KFOA 3J7AF 2I8CA 5CYUA 3NTIA 3OIPA 2CCZA 1X6OA 4FF3A 1PMRA 1VQGA 2EXDA 1HZBA 1TA8A 3K81C 4JC0A 4X64Q 4RNOA 4Q45A 4JI5H 2FJZA 3NSWA 4QJFA 5IGGA 1HNZQ 3AYHB 3BA8A 5FLXE 4LFBH 5F9NA 1BQQT 1JICA 1SYBA 1IBLQ 4RUCA 3WNZA 3T13A 2QILA 4YQWA 3BZCA 1X3PA 3H40A 1JOQA 3H3VC 3DLLA 3CCVA 3CC2A 4FF2A 3RNUA 4C3IG 2F3WA 5C3XA 3EQLC 2IX0A 4A3IG 1STEA 4JI8H 5IP7G 4V0BA 3VA7A 4X62Q 4MTEA 2RGRA 4A3KH 1SFOA 1A9XA 1RODA 3AFQA 2J9GA 1ESRA 2R82A 3C1FA 3PIOA 2DJGC 4JI0L 4X64H 4H13C 1EFID 4DR6H 2R61A 2F4VH 3ICEA 2E2IH 3NGDA 2ASBA 1YBYA 3T1YH 4JV5H 3CCSA 3LX0A 4WBNF 1EY9A 1WD0A 1KJQA 1SE3A 4OO1I 4LF8H 4HSPA 3Q8SB 5JVH3 4DV1H 2I07B 3DEOA 1CUKA 1KIXA 2BA1A 2KUMA 2K14A 3NTKA 2UU9H 1HR0L 1BO0A 1VQBA 4C3JH 1SJHD 1EEID 4ED8A 1PTOD 1FNUA 3BAAA 2F0IA 1YVCA 3TEHB 1A3TA 3BJYA 3DXJC 1ZXTA 4DAVA 4DR3H 5JEAJ 1PH5A 1YHAA 1Z2OX 5A2QL 2IJ0A 3FMAA 4KHPH 4MN3A 1JCKB 3PV0A 4DV4H 3CMAA 1TIID 2F0GA 4O1NA 3GTGA 4OX9Q 4C3IB 1N34Q 2K52A 3J80E 1A2TA 3JSNA 5KFUA 5CORA 3GIJA 2R6GA 2K1BA 4C5BA 4A3JG 4ULLA 3K0YA 3OSOA 3OW2A 3NWTA 3QJYA 2R86A 2PO4A 2HT1A 3V4SA 1IKLA 5F9LA 2IHEA 2VB3X 3H4BA 3PW2A 4QY7A 3KF8B 3GV7B 3GTGH 4I50F 4ECXA 4IPCA 2FPGB 5I47A 4ECTA 1A62A 3HEJA 2HQEA 1B70B 3I4NG 2IPKD 4DR2L 3GTLB 2ICEC 2PMZB 1WTXA 3QO2A 1T36A 1HR0H 1E1OA 3I7FA 2OEOA 2GVBA 3MHBA 4DK1A 3HOYG 1W3SA 4KY6A 1N56A 3C46A 4XZ3B 2NVQH 2W6NA 1G2SA 5T1IA 3A0JA 2RDJA 2CKZB 2Z6BA 3PUVA 5ELEA 4ZK9B 3EFXD 1HCZA 1PA6A 4KJNA 4IUVA 1XJVA 5LL6S 3ULLA 3N6RA 4OIJA 1LT4D 4B3RL 1K1SA 4HTHA 4RGMA 3NQTA 1L2FA 2VQEH 5LMNL 2ZXPA 3J81c 2PYKA 2QCPX 5KRUA 4RKLA 4JV1A 2JA8B 4IFDG 4MZ9A 5C4JB 2F0JA 2I80A 3GLKA 3I73A 4EYIB 4RB1A 5C44H 4C5CA 3G6VA 4YHHQ 5EKLA 2B2WC 1PLFA 4CC6A 1K83H 2VQFL 1V43A 1UE7A 4FF1A 3J81i 1QB5D 1XWEA 3F2UA 3AB9A 3U4VA 5KFRA 3R2IA 5L1KA 3WWVA 2CWPA 2EY1A 2KHSA 2I0QA 2R92H 1QVGA 1PFNA 2A69D 4JI2H 1EY0A 2X6LA 4DR5L 2HVSA 1RHPA 1B50A 3A8JE 2NN6H 3Q8DA 3RV4A 4OXPA 2FLPA 1RJTA 2P5ZX 1SYCA 2B63A 1VQAA 1PH7A 1SNCA 4HJ8A 4IUUA 1F2LA 1QJOA 1ZQ7A 3QZ7A 2MP1A 3V6HA 4LF5H 3T1YQ 4HIKA 1CK1A 3JRXA 3J80c 1GD7A 4OGQC 4K0KH 3G6JB 2CVRA 4J9RA 5IOCA 1K8GA 2KQ3A 2EYJA 3UFXB 3E6ZX 2BDOA 3MWMA 5M3FG 4BY7H 2M05A 1MBYA 1I50H 2WDTA 5M5WH 3OWFA 5M5XH 3VR6A 4JI7L 1Q3LA 4IUPA 4IR1A 5FJ8G 2XRQD 5FOBB 4CDDC 3CCMA 4E4TA 4ODGA 1IW7C 4NKLA 3GDEA 3ULPA 3G8CA 4BBSH 2W9BB 2O03A 2EYFA 4DV5L 1T3NA 2A19A 3GTMB 1B3AA 2WB1A 4JUZA 1XYIA 3UDGA 2EY2A 3NBIA 5BR8L 1LTTD 4C3HH 2I5HA 5DM63 3CCLA 4DR6Q 4HNVA 5HURA 4LF8Q 4EYHB 1WTQA 5EOYA 4J1MA 1GYFA 5IT9c 2IWHA 3D6CA 3GTOB 5EPLA 2L15A 2YTVA 5TSSA 1HNXL 3Q8QB 1TWCH 1WTHA 4YIJA 3KUPA 3HOZG 2KHJA 3MR2A 1RJRA 3RAQA 2E2IB 3J81j 2A6ED 1IOWA 1HR0Q 3R23A 2DY7A 1HPCA 4HJAA 3T51B 4FF4A 3I70A 4RMFA 4UCOA 2JEFA 5FLXL 2XCLA 1WCMH 4N9TA 1CE8A 3PW0A 2W71A 2HCCA 1VMPA 4DV4L 1K83A 5KFDA 3BQ0A 2VQEQ 4QUFA 2UXBQ 1D7QA 3S2HH 2RSOA 4XQJA 1NSNS 4OX9H 4RHRA 4QW8A 4Y52H 2WIIB 1WTWA 1XMOQ 2L5TA 1K28A 1BXRA 5CAEB 3D8GA 4DV1L 3GQCA 1Y8NB 3T1HQ 2NVXH 3RBDA 1E24A 4OWXB 3T56B 3ONAB 2FMMA 3TP6A 2V5AA 5CA0F 1N34H 1I3QB 1EYAA 1R9TB 1ILPA 1LM0A 1VQCA 3ERQA 3W1GA 1KJIA 4FM9A 5J39A 5KG7A 4B3SL 3I12A 1EOVA 3X3NA 1FJGQ 1EZ1A 5EKKA 1STYA 2MHVA 4A3BH 1DZ1A 2WACA 1ET9A 5KFIA 3NQIA 4FDBA 4MIUA 3HOXG 3HGBA 1SJED 2A69C 1PH6A 1QG7A 4G57A 1QNKA 3L3OC 4YR3A 3IN5A 4IUQA 1EWIA 1AUVA 2F0MA 4JI2Q 4EEQA 3IL8A 3LWUA 5JUMA 3MZ5A 1VQHA 2CQOA 1QWYA 5GADC 1W6KA 4RKBA 2WE6A 3V6KA 1EY5A 1U9RA 4CDCC 3RLNA 4XYQA 3T5HA 1ENFA 2JYOA 1HJPA 4YAJB 2F0DA 1F2MA 2CW0C 4C3IH 1JOOA 2Z4IA 1XMQH 3ZYYX 3GIMA 4KTAA 3HG9A 2KECA 1SNPA 1XXGA 1WOCA 2BDNA 5IGCA 1WTPA 3ETJA 4A3FG 5C8YF 2HVRA 1FJGH 1B4OA 3E0EA 4FXKC 5FLXc 3VPDA 1X55A 4X66Q 4EX5A 3AEVA 1GSAA 4UCSA 1I6HH 1Q90A 2K4KA 3KOJA 4LFAQ 2DWCA 2QGQA 2B2VC 1ZKOA 5D1PA 2E2HH 4GNXC 1PZKD 3T1HH 4O4HF 3PIO3 3Q22A 2F0VA 3FMCA 3V4ZA 3H3VH 4QWCA 1QZGA 4CDFC 5D8DA 3E9IA 3BA9A 4WFN3 2EIFA 3K59A 4JBJA 5IIFA 1G2TA 3RMHA 3EN2A 5KFZA 4ECSA 3HKZB 2C35B 3GV6A 1KABA 2JEAI 1HZCA 3M9NB 2XIGA 2XSCA 5KFKA 1JE4A 2MUYA 1S72A 1DV1A 1F9RA 1BUVT 4HR7A 3QIAA 1EY7A 1GXDC 1DOMA 4IRCA 1N32Q 1M0TA 3TSSA 3T1YL 1JB3A 1L1OC 1AW7A 4AH6A 5LMNW 1YEZA 2RA4A 3T5JA 4KLKA 1N36Q 3CC7A 2UVRA 1PZID 1X3QA 4YJ3F 5KFQA 2R8GA 1F2ZA 2KEEA 2HVQA 1C8CA 1VQ7A 2VS1A 4DXFA 1NMFA 1TS3A 2Q8RE 1JX4A 3ND8A 2CWAA 4DR5H 4C2MB 3H0GA 4JYAH 4FS1A 5C3EH 4LSAA 4A3KG 1KJ8A 3HKZE 5J3BA 2ZTEA 5FKAC 3CCJA 4JVZA 4LF5L 1I50B 4B3MQ 1HHVA 2QDBA 1PH9A 4A75A 3CF5A 1UNSA 2KOLA 4WJ4A 2B2TA 5CV7A 5BR8Q 2X69A 1LYLA 3KLSA 4FP5D 2E76C 1ZHSA 3DMUA 4YY3H 2JK8A 2W9CA 2ZDGA 3MXPA 1BDOA 1XNRH 1JOKA 1PTOF 4DV3Q 4K6DA 3S17B 3EIVA 1MD2D 2IBKA 1VQ5A 4L5RC 1ILQA 4LNQA 3TIGA 1UAPA 3U9OA 1DYQA 5L1LA 3QR8A 1CKMA 1XTDA 5DG9A 4RZRA 1STNA 3GTOA 4F4ZA 5D3DA 2NVYB 1ENAA 1KTKA 3Q6SA 1I94H 2VA3A 2I46A 2OQ0A 1PFSA 1XTCD 3CAMA 1RYSA 2F0QA 2AUKA 1DJRD 2KHIA 2E5LQ 1PH2A 2A5HA 3P75A 2NZHA 3HOYB 5H80A 1EUJA 5IWAH 2N55A 1QUQB 4O2DA 4ZLTF 2YU9H 2YZNA 1KAAA 3NELA 1PYSB 4QL5A 3RUPA 1Q82C 2WAQA 4DL6A 2N88A 4P2CB 5IYDG 1U0LA 2WYOA 2W8KA 3D6WA 2F0UA 2Z6KC 2L12A 1HR0W 2XGPA 2DNCA 4ECRA 5KG1A 4PQXA 4MV6A 1IBKL 4PMWA 1CHPD 1CZWA 3G4SA 2YCHA 4K5VA 4J9PA 2PNRC 3CQZA 1N8RC 2KEDA 4HMIA 3TMEA 1FJGL 2E74C 1SRUA 1UEBA 3LWBA 1XMOH 4QIWE 2L55A 2JA5G 4RZQA 1EIFA 5BN3A 3KBGA 4PG3A 2B2VA 4O2BF 2DLNA 2DN8A 1O7LA 2MJ8A 4O0AA 3KDFB 4ED0A 5KEEA 3U9TA 1HA6A 3E5SA 4LFCQ 1RD9D 5JOBA 4L5SA 3S14H 3HKSA 4E6IA 4BXXH 3K7UC 4RG1A 1U5KA 2JA6A 1N32H 1SMYD 1TWFA 4LH6A 2ZTDA 2M2LA 3I4MG 3FVQA 5CV6A 3V2TA 1S10A 4TQUS 2EZVA 3J7AK 1TWFH 2N3SA 2Z4HA 1E2ZA 1BBWA 2PZTA 3PO3G 5FPRA 2NB0A 3PCOB 4OHJA 2Z0SA 1II3A 1JQYD 4Q43A 2B63G 2KVMA 2F0PA 3GTJB 4DR2H 4LUOA 1NMGA 1SMXA 2UXDL 5COYA 1IBML 4DR7Q 3S2DB 4ED7A 2BQRA 2PN1A 4X66H 5C44G 4LFAL 4XQQA 4J0MA 4BY1G 2X0SA 2OF1A 5KFMA 3GTMH 3H3VI 4KY5A 1X56A 4ED1A 4BBSB 1VQ6A 3M4IA 2ZTCA 5IP9G 2ASJA 2EYMA 5CR3A 2EJGC 5C4XH 4BWSC 5JVLA 1PH4A 2LFNA 5J2TF 4TV8F 2B2UC 2NZOA 2MFIA 2Y0SG 1C30A 1SN8A 4U68A 3RN5A 3GIDA 2ZJPA 1E4FT 1A2UA 2KCNA 1L2ZA 4HIOA 4JI8L 1YJ9A 2YU9A 1Y1VB 5M3MH 4Z9CB 2QEXA 4XYMB 3VYTA 3T5LA 1SCUB 1EY6A 1SBBB 3JAME 2VUGA 5DNFA 4U673 3R5FA 1MSHA 3I4MB 3JAMW 2VQFH 3HOZB 1B2TA 2MGSA 2LXJA 2QK4A 3HOZH 1SYDA 3H15A 1SAPA 1DIKA 4DV6H 1GUNA 3AFPA 4IR9A 1PRTD 2NUCA 1JJ2A 3MR3A 2UUAH 3R2TA 1I6UA 2CW8A 1Y1VG 2ZXOA 4UP8A 4DV0Q 5KNBA 5ELOA 1LT5D 3H91A 4RAZA 4GNXB 2KA7A 2A8VA 2HDLA 3R5HA 3KF8A 4Q44A 4PZ8A 4KHZA 1B04A 2VL6A 4JK1C 1LTSD 5HBRB 4RH6A 1L1OB 4JYAQ 4KHVA 1B7YB 3DWQA 2KCTA 2R7DA 1IBLL 2E2JB 1VBGA 2FLLA 2P0AA 5LMUQ 2N8NA 3F1ZA 3RB6A 4DV3L 4FVMA 5FO8B 3D4RA 2IW3A 3M4OB 2YRWA 2FPPB 1WH2A 4I55F 5LHY1 5D14A 1L0XB 3PQIA 3M3YB 3DEPA 2OXPA 2KJXA 3HOUH 4F4YA 3EROA 5C0XH 4JI7H 4A3LH 3RN2A 1Z2NX 3WO1A 3HBLA 2W6OA 1Q81C 1STGA 2SDFA 5K2MA 5KT3A 4JI2L 5KT5A 3A7AB 1KRSA 2K7VA 3OYYA 2R6FA 3KAKA 3S16H 3OIQA 1GVPA 3I90A 3B6YA 4GN3B 1XPRA 1VQJA 4QIWB 1XNRL 3PF5A 2M9VA 5JEAH 2PZUA 1NBWA 1IBKH 1HTLD 4LFBL 5E1FA 1Z2PX 1X32A 5BMVF 4O42A 2CH4A 1NE3A 4C5AA 4JI6L 1IBKQ 2JA7G 4DR4Q 2ZM6H 3VA5A 2JSOA 4GKJQ 4JBWA 4IN3A 3GTKA 2LSSA 3SK5A 2HQLA 1V4YA 1I7NA 5BN5A 1BF4A 2L1BA 2RCNA 3SDZA 2VUMB 2UXBH 2FINB 4B9XA 2LY7A 4LFAH 1V8QA 4L1KA 1MI2A 1D1IA 1EIYB 3RBEA 4ME3A 2UXDH 5H1SE 5NUCA 1EY4A 5LOVF 4J9QA 5IY0A 2PI2E 4NXMQ 4DR1Q 1H9MA 4GOPA 1SEIA 2W9BA 4HJ5A 2O5JC 2ASDA 1EOTA 4DAPA 5EWEA 1E1TA 3WDNA 2VOBA 2AQ3B 3BS1A 2IA6A 3NWSA 4L6TB 5EPJA 1CKNA 2K50A 2VW9A 4A3JH 4OL7A 3CC4A 1VKZA 3RB0A 1G291 4XYLB 5BPFA 1N34L 3PN1A 4A3JB 1TWAB 5C3WA 3W3AA 3M3YH 5KFNA 3J7A5 1SMYC 4R8UB 5E4WC 2GVAA 4IJHA 3V96A 4ME5A 3NBHA 4BXXG 4TQSA 2B2TC 2JQOA 4RCNA 2B3GA 1MIUA 2RDHA 2B2YC 2L11A 1PYBA 3TS0A 2O2LD 1VS0A 2C28A 4LJZC 2FHTA 4A4IA 3D4WA 1NY4A 3OW7A 3N42B 4U6PA 4ED3A 2J6SA 1NNXA 2R7LA 2WKCA 4GLXA 2BH2A 3NENA 3VR3A 3M4YA 4J15A 4DR4H 5KG4A 3M4OH 2OT2A 3MXGA 1V1PB 3J7ZC 2R85A 5L37A 2D2CC 4EGQA 3K3PA 2Y0SB 3CVZA 4R9WA 4LF5Q 1UWVA 3RB4A 4DUYL 1Y1WB 1QVFA 3AMUA 4I4TF 1I3QA 1R9TA 4B3RQ 4ZUJA 4EFEA 1SE8A 4P71A 5LMNQ 5IT9W 5M3FB 4DV3H 1IBMH 1IBLH 2JA8G 3K7AB 4YCVA 1YIJA 1TS2A 4LF7L 1PTOB 1EHIA 3HB9A 1X54A 1RJPA 3KAJA 2NYZD 2PVPA 1ZETA 3GTQH 1FGUA 1D5MC 5M9OA 1CA6A 3H6MA 4LWCA 1SR3A 1HUNA 3MWDA 1JLLB 4LF6L 4A3EB 3A56A 3RZOB 1B33N 1AEXA 2UVWA 1BCPB 2R8IA 3L7ZC 2F4VL 3QG1A 1MSGA 4R4CA 3BQ2A 4UY8C 1Z6HA 1GHKA 4KN7C 2YS7A 1Q12A 1K1QA 3D31A 2VUMH 2A74C 3S1NB 1BCPC 3NP8A 1A3UA 1CI3M 5DEHA 3CPWA 1ULZA 4JBKA 3N44B 4RHSA 1GM5A 4F50A 4EBCA 2ZM6Q 3FP9A 3S1MB 3GV5B 2LKVA 1S0MA 1UUPA 1Q86C 3RF2A 2A6HC 1WTVA 4FO2A 3PO2B 2AQ1B 2FMAA 1F9PA 4ZAIA 2W57A 3PW4A 4PMBA 4Y7NB 1LTRD 1HNZH 1I4PA 1Z7TA 1MGSA 3A54A 2XCAA 1PYWD 1O80A 1H9SA 1Y1VH 5M3MB 1B9NA 1L1OA 1PDQA 3K3VA 4JOIA 4A3CH 2F0TA 2Y0SE 3FKIB 2IHFA 1Q8KA 4XT1B 2ALZA 3K5LA 1Y1WG 4AYBA 4J9MA 4EGJA 2AQ4A 2FLNA 1OXTA 3E3XA 1WVLA 1Y1WH 3A5UA 2YRXA 4X65Q 5T14A 3H0GH 5ELFA 3JRWA 4JI7Q 3MEHA 2JA9A 2R87A 3N40P 4MTKA 3DWPA 4DU9A 4GZYC 4HIMA 2W6MA 1STHA 5IP9H 3UDIA 3PO2H 3CP0A 4A93B 3RV3A 3SE7A 3CKIB 3PUWA 2NVQB 3WO0A 1GHJA 4CJ0B 5IYCH 2OTLA 1WI5A 2KCCA 4DAMA 4IRKA 3H09A 4UCVA 5IE8A 1VQEA 4CJ1B 2G9DA 1OO9B 1CZGA 3FKIA 2F52A 2I5LX 4CC5A 4M8AA 3PO3B 3DM3A 1K0SA 2WP8J 4JI6Q 1EQTA 2AKWB 4HNUA 3J81W 4GKKQ 2SEBD 2E2JH 3WOEA 1M90C 2ZJQA 4P73A 5C1OA 1RKNA 1TS4A 1I94L 3S1QH 5EZYF 2UXDQ 3LP8A 3PVXA 1EUCB 2W6ZA 2UU9Q 4PZ7A 3KJOA 4K0KQ 2R93A 2NZ1D 3S1MH 3S2HB 1I4RA 4NXML 1P8LA 3H94A 4H0LC 2EYHA 4IFDH 4ECZA 4BBSG 3X3MA 1A63A 2C5CA 3I56A 5M5YH 5M3MG 3L4JA 4FYDA 5L9XA 2E2IA 4RB2C 3RIZA 3BQ1A 1RIPA 1SYGA 1KC7A 5HGQA 2PMZA 4CHTB 4DV2H 3CQZH 4A2BA 5KFAA 4RB0A 4DUYH 4O3RA 4MNOA 2QDLA 2UXCH 1CKNB 1I4QA 3I4MH 3HZXA 2H4OA 3BYYB 3MFGA 4IPDA 1BNZA 4A3BG 2PQAB 2R92G 4RAYA 4ZKCB 5HGTA 4A3KB 4B3SQ 4IUNA 5ELDA 5DGBA 1U4LA 4O4LF 1T94A 1LTGD 3JAMc 4A3MB 3OHBA 3MWEA 1ET6A 2BOSA 2PQEA 5JAVA 1RK5A 2AGQA 5E7NA 2NU8B 4OO1G 1KJJA 4EGVA 2FKLA 5KFEA 4LF6H 1S5ED 1D5XC 1UC8A 4RNNA 4F87A 2IL8A 2QW7A 4A93G 4DR7H 2C9OA 1WR2A 5CBEE 4A3BB 4ECYA 4A3GG 5I2YA 5CV4A 5DQGA 1VQKA 4A3DH 4OIKA 2YYZA 5EQ0A 4J6HA 1Q8IA 2JEIA 1O7ZA 1LTID 3MVVA 2IP4A 2BQUA 1PVOA 1IL2A 2EY5A 2VZAA 3I2ZA 2LXKA 4AYBG 1Y1WA 3T4AC 2WINB 5CV5A 3U9SA 3KLRA 3QZ8A 4LF7Q 4J9NA 2K75A 3Q8PB 1H9JA 2XWBB 3IAYA 5G3LF 4NDXA 2DPIA 4JV0A 1K3RA 4GC7A 4CKCA 3A8KE 1CTMA 5KFWA 2F0LA 5JJIA 2MQHA 5GAGC 5D65A 2I87A 2F0EA 3S24A 4BY1B 5FJ8H 1TY2A 1BKBA 4IQZA 4PV1C 1S40A 3OOCA 1VQ4A 3OPOA 5BR8H 3H4DA 4XIGS 4UP7A 2QKIC 4ZYSA 1YITA 4U7CA 4KN4C 1XNRQ 4K8IA 5C4ZA 3L9AX 1C9OA 4JI3L 3N52A 1WCMG 4NB3A 2E2HB 1SEBD 2DNEA 2BR0A 1YNJD 3JAML 4DV6Q 1BCPD 1DOLA 5D1OA 1QNUA 3M7NA 3NEMA 4AQYH 3W5OA
chains in the Genus database with same CATH topology
3G4SA 1YHBA 2Q2HA 5C4JH 1N8RC 2R93H 2UUAQ 1A0IA 2DGYA 1OXXK 4A3MG 1FL0A 1VQPA 1I3QH 3PUYA 4DAYB 1R9TH 1N36L 1FJGL 3HOXH 3EBEA 3TREA 5GAHC 1SRUA 1UEBA 1KQSA 4QIWE 3OTOL 4HIDA 2JA5G 2EQSA 1M1KC 1EIFA 4JI5L 3CW2C 2WB1G 1CSQA 1KL9A 2VQFQ 1KHIA 4PG3A 4IFDI 1ASYA 2Q2IA 1YI2A 3BZKA 3U50C 1VQ9A 5C0XG 2N49A 4O0AA 3KDFB 1AE2A 3BJUA 1JB7A 3MXNB 1C0AA 4LFCQ 4L5SA 2JJQA 4R4QA 3S14H 3HKSA 4DV0L 2H5XA 4BXXH 1HZ9A 3K7UC 2OQKA 4RG1A 4XTCS 1AH9A 4B3TL 1U5KA 2CCZA 1X6OA 2ZTDA 1VQGA 2EXDA 5AJ3Q 1HZBA 3F2CA 1Q1BA 3K81C 1OXVA 4JC0A 4X64Q 4B3ML 4NPSA 4QJFA 1W2BA 1HNZQ 4YY3Q 4TQUS 3AYHB 1TWFH 1VCIA 2MO1A 2N3SA 3GTLH 2UXCL 1BBWA 3PO3G 3TRZA 5C0XJ 3G71A 3PCOB 2Z0SA 1IBLQ 2R7FA 5IYBG 3PO3H 2B63G 3BZCA 4R4TA 3CCUA 1VQ8A 4LUVA 3JC66 1NTGA 4LUOA 4Y7NH 1XNQQ 1NMGA 1SMXA 3DLLA 3CCVA 2UXDL 4DR7Q 1IBML 4OWTB 4H02A 1DGSA 3CC2A 5C44G 3RNUA 4LFAL 5JJKA 1L0WA 2ALYB 4DUZL 4DR2Q 4BY1G 1QZHA 2IX0A 4A3IG 1YHQA 3GTMH 3H3VI 1HNWL 1UE6A 5IP7G 1X56A 4GLVB 2AHOB 4X62Q 3CXCA 1VQ6A 4OWWB 1KXLA 4A3KH 2ZTCA 5IP9G 5C4XH 1A8VA 3KFUA 3AFQA 4JI4L 1PH4A 1OXUA 2HIXA 1VQOA 2JA8H 3PIOA 1B8AA 2PI2A 2Y0SG 2NZOA 2MFIA 3HKZG 4DKAC 4DUYQ 2VNUD 4JI0L 1SN8A 3RN5A 4DR3Q 2ZJPA 3AQQA 3A5ZB 2ATWA 2K5NA 4HIOA 4JI8L 4DV6L 1YJ9A 3ICEA 2E2IH 1TXYA 2PMZE 1N9WA 1YBYA 5M3MH 2K5VA 2ASBA 5JEAG 3CCSA 2QEXA 3UDXA 4A3FH 4OO1I 1KRTA 2R7ZH 3UE0A 1CUKA 2YTYA 1PV4A 1KIXA 2BA1A 2K14A 2R7ZG 1HR0L 4YHHL 2LXJA 2CFMA 1VQBA 4C3JH 3PSIA 4GOPC 3HOZH 2ID0A 3H15A 1YVCA 3TEHB 2Q2UA 1YJWA 2F4VQ 1YNXA 3AFPA 1JJ2A 3S1NH 1UE5A 3M9BA 3M85A 3F2BA 4YWLA 5JEAJ 4DV2L 1I5FA 5C3EG 4LFCL 1Y1VG 1PH5A 1YHAA 4UP8A 4JI1L 4DV0Q 5ELOA 1T9HA 4GNXB 3PV0A 2VUMG 3U58A 4ALPA 3PGZA 5AJ3L 3CMAA 2A8VA 2ZM6L 4DR5Q 3HOWH 4PZ8A 4OX9Q 4KHZA 5EAYA 2K52A 2VL6A 2D0PA 1N34Q 3E9HA 4GS3A 3JAMi 4AQYL 2R6GA 4X6AH 4A3JG 2OCEA 1L1OB 1VQMA 3GD7A 1K8AC 3OW2A 1JMCA 2R93G 2MNAA 1IBLL 1B7YB 4JYAQ 2KCTA 2R7DA 1QVCA 3FKIH 5LMUQ 2HT1A 4BA2I 2N8NA 3F1ZA 4DV3L 4A3DG 4JV5Q 2IHEA 3LGJA 4QY7A 4KHPL 1ASZA 3KF8B 4APVA 2GN5A 3GTGH 1JT8A 4IPCA 1XMQL 4DR7L 1A62A 1B70B 3HOUH 5IYCG 1VQNA 1WFQA 4DR2L 3I4NG 1GO3E 4A3LH 3RN2A 1HNWQ 1HZAA 4PZ6A 1Q81C 1V1QA 4A93H 1E1OA 2A1AA 2E8GA 3I7FA 2GVBA 4JI2L 4DPGA 3HOYG 1KRSA 1W3SA 4A3GH 4JI4Q 3OYYA 3H0GG 1Q7YC 2NVQH 3A0JA 3GO5A 1G6PA 1PH1A 1BBUA 3S16H 2CKZB 1GVPA 3PUVA 3B6YA 4KI0A 1OTCA 4DV5Q 4JI0Q 4GN3B 1XPRA 1VQJA 1XNRL 3PF5A 1JE5A 3KYHC 1PA6A 1NBWA 1XJVA 5HY6A 4LFBL 3ULLA 4JI8Q 4B3RL 1NE3A 1L2FA 5LMNL 4DR6L 4JI6L 1IBKQ 2JA7G 4DR4Q 1X3EA 3J81c 1K73C 3K0XA 4GKJQ 4JBWA 1XPUA 1V9PA 3W1BA 2LSSA 2HQLA 1HNXQ 4IPGA 4MZ9A 3KF6A 4IFDG 3K8AA 2RCNA 5C44H 3RR5A 4POFA 4YHHQ 5GQOA 1EIYB 3OTOQ 4ME3A 2YV5A 5H1SE 4YCUA 3VDYA 1K83H 5IY0A 2PI2E 2VQFL 1LTLA 1V43A 4NXMQ 1UE7A 4DR1Q 4AYBE 3J81i 4GOPA 2IY5B 4HJ5A 3U4VA 3F8TA 1E1TA 1WYDA 1EFWA 3WWVA 3MEFA 3GTJH 3UDFA 2CWPA 3I4OA 2I0QA 2R92H 2JE6I 4QQBX 2UXBL 4B3TQ 1CKNA 1SLJA 2K50A 2VW9A 1KD1C 1QVGA 4DV7Q 4A3JH 2KCMA 4HJ7A 3CC4A 4DR5L 1EQRA 1G291 4LUZA 3Q8DA 4BA1I 1N34L 4OXPA 4X64L 1XMOL 1TWHH 1VQLA 4YCWA 4DV1Q 3M3YH 5C0XI 1X3FA 1VQFA 4JYAL 3J7A5 4L5QA 1HH2P 1VQAA 1PH7A 1QUQA 4HJ8A 1NJIC 2D62A 5LMUL 3K7AH 4NXNL 4HIKA 3T1YQ 1MKHA 1J5EL 2GVAA 3CMEA 2RF4A 3GTPH 4IJHA 3J80c 2HHHQ 1GD7A 4BXXG 4KHPQ 1H95A 4YWMA 3HOVH 2JQOA 2B3GA 1MIUA 3TS0A 1PYBA 1XNQL 1VS0A 2YTXA 1K8GA 1X65A 4A4IA 1XPOA 4GNXA 1NY4A 4IPHA 1EQQA 3RLFA 5M3FG 4DUZQ 4BY7H 4GLXA 2BH2A 1I50H 5M5WH 1E3PA 3NENA 5M5XH 4JI7L 4X62L 4J15A 4IFDJ 5FJ8G 3M4OH 3J80i 3S15H 3CCMA 3J7ZC 3GDEA 3ULPA 4P74A 4BBSH 2ES2A 3M4PA 4DV5L 3CD6A 2A19A 4LF5Q 1UWVA 4OONA 2MO0A 4DUYL 4A3IH 3D0FA 1QVFA 3UDGA 4LFBQ 3S1RH 4IJLA 5IWAL 5BR8L 2UUBQ 4B3RQ 4C3HH 4L5TA 2I5HA 2OWOA 1SE8A 4P71A 5LMNQ 3CCLA 4DR6Q 5C4XG 4DR4L 4LF8Q 5DLQE 4GKJL 4UPAA 2JA8G 4YCVA 5IT9c 1YIJA 2UUCQ 4LF7L 4IO9A 1HNXL 2L15A 2YTVA 1Q1EA 1X54A 2AWOA 3HFZB 5FLMG 1TWCH 2JA7H 1P16A 2DUDA 2KHJA 4DK3C 4LF4L 4C2MH 3GTQH 1FGUA 3HOZG 2Z6KA 3J81j 1HR0Q 4BY1H 4LWCA 1SR3A 4DK6C 4HJAA 3KDFA 4RMFA 4LF6L 4K0KL 4DR1L 3L7ZC 1WCMH 2F4VL 4LF9Q 4R4CA 1TWGH 1SFOH 4UY8C 4DV2Q 2XTIA 1Q12A 4A3MH 4DV4L 3D31A 2VQEQ 2VUMH 4JI1Q 4EQ5A 2UXBQ 1D7QA 3S2HH 3CPWA 4DV7L 4JBKA 1GM5A 1IZ6A 2I5MX 1Q46A 1VQDA 3ER0A 4Y52H 3KF6B 1XMOQ 3GTKH 2ZM6Q 3FP9A 1IXRA 3A74A 3KJPA 3CCEA 4DV1L 1Q86C 3T1HQ 4HJ9A 2NVXH 1E24A 4OWXB 2FXQA 3K80C 1PH3A 1S3OA 1LM0A 1VQCA 1PHJA 3W1GA 2UUAL 3GTOH 4P75A 1Y1VH 4B3SL 2HHHL 1EOVA 3ULJA 1L1OA 3PF4A 1FJGQ 1N32L 3CPFA 3KLWA 4JOIA 2ZJRA 4A3CH 4A3BH 2Y0SE 2D0OA 2IHFA 1Q8KA 3U4ZA 4YWKA 3CCRA 1Y1WG 4JI5Q 4FDBA 1MJCA 1XMQQ 3HOXG 2PNHA 1OXTA 1PH6A 1Y1WH 3A5UA 2JA5H 4DNIA 4X65Q 3H0GH 3I4MG 4JI7Q 4JBMA 2JA9A 5IYBH 3PO2G 1EWIA 1SROA 4JI2Q 4HIMA 4IOAA 5IP9H 4R4OA 3UDIA 3CP0A 1RL2A 4GOPB 3PO2H 1LUZA 3L0OA 1VQHA 3PUWA 3TS2A 1Z9FA 2CQOA 4R4IA 5GADC 5IYCH 2OTLA 2B63H 1WI5A 4JOIC 4DAMA 2JA6H 3I4NH 5IE8A 1VQEA 3RLNA 4YY3L 1OXSC 1VQIA 4MTNA 1HJPA 3HOUG 2F52A 2I5LX 2OTJA 5IYDH 4C3IH 3DM3A 1Z47A 2KBNA 2WP8J 2UUCL 4JI6Q 2AKWB 1WOCA 3HOYH 4GKKQ 4A3FG 3SGIA 2E2JH 1M90C 3E0EA 5FLXc 4P73A 4A3EH 1X55A 2ZJQA 4X66Q 1I94L 3S1QH 2UXDQ 4EX5A 3AEVA 4BBRH 1I6HH 2K4KA 4AIMA 3KOJA 4LFAQ 2QGQA 1TWAH 2KENA 3RLOA 2UU9Q 1CKOA 4WJ3M 4PZ7A 3KJOA 3UE1A 4GNXC 2E2HH 4LF6Q 4K0KQ 3S1MH 4A76A 3G6EA 3IRBA 4NXML 3H3VH 2E5LL 1P8LA 1QZGA 1N33L 1AE3A 4BBSG 1A63A 2B29A 3I56A 1E7ZA 3E9IA 5ELNA 5M3MG 5M5YH 2EIFA 2WB1E 4JBJA 2VQEL 2Q2TA 3I55A 3STBD 1RIPA 2WFWA 1O7IA 3EN2A 5HGQA 4DR3L 2V1CC 2C35B 3CQZH 4QGUA 4JI3Q 3G48A 4GN4B 4JCVE 1FVIA 2JEAI 1HZCA 4MNOA 3HOWG 3T1HL 3RZOH 1CKNB 3BU2A 3I4MH 5GAEC 1S72A 4LW1A 4IPDA 2BH8A 3TQYA 4A3BG 3ERSX 2PQAB 2R92G 2IX1A 5K36G 4B3SQ 1D8LA 1N32Q 3FKIG 3T1YL 1J5EQ 4NXNQ 3S17H 1L1OC 4AH6A 5LMNW 1JJCB 1YEZA 3JAMc 3RZDH 4KLKA 1N36Q 3CC7A 4TVAB 4UP9A 5M3FH 2RHQB 2WAQE 5E7NA 1VQ7A 4OO1G 2VS1A 3PUXA 1NMFA 4A3CG 3STBC 1YJNA 1IYJB 4X65L 4IOCA 1X9NA 4A3LG 5GROA 1J6QA 2CWAA 3PUZA 4A93G 2JA6G 4GN5A 3ZJYC 3L2PA 4A3GG 5C3EH 4A3KG 3HKZE 5J3BA 1VQKA 2ZTEA 4A3DH 2YYZA 3M4QA 2N78A 3CCJA 4OX9L 4BY7G 4LF5L 4B3MQ 2F3IA 1X3GA 4AQYQ 1G51A 2XGTA 2QA4A 1PH9A 3S2DH 1IL2A 4A75A 1HNZL 3CF5A 1CSPA 1PVOA 1MJEA 2VZAA 3I2ZA 4WJ4A 5BR8Q 1KAWA 5IWAQ 2LXKA 1LYLA 2UUBL 2UXCQ 2IT1A 4AYBG 2JK8A 4JG2A 2RHSB 5FLMH 4LF8L 4GLAC 4DV3Q 4JV5L 4GKKL 1BVSA 3EIVA 4LF7Q 1E22A 2K75A 3HOVG 1VQ5A 2NVTH 4L5RC 4X66L 1I94Q 4R1JA 2BA0A 4LNQA 1K3RA 1YZ6A 1C7YA 2NVYH 1EYGA 4LF4Q 1CKMA 1XTDA 2JEBI 1IBMQ 2UU9L 5JJIA 2MQHA 5GAGC 1Y14B 1UE1A 4A3EG 2OQ0A 3CAMA 1PFSA 2HIVA 2VY3A 4BBRG 1GKHA 1K0RA 2KHIA 3S24A 4POGA 2K5HA 3PIPA 5FJ8H 2E5LQ 2NN6I 3NBHB 1N33Q 1BKBA 1S40A 1PH2A 4LF9L 1PH8A 1JJGA 2NZHA 4DV4Q 1EUJA 1VQ4A 5IP7H 4XIGS 1QUQB 2WAQG 4O2DA 2YU9H 4UP7A 1YITA 3NELA 4QL5A 1PYSB 1Q82C 2AWNA 1KC8C 1K9MC 1XNRQ 5IYDG 1C9OA 4JI3L 3FHWA 1U0LA 4P72A 1WCMG 1WJJA 4NB3A 3CCQA 2Z6KC 2NN6G 2PQAA 1HR0W 4DV6Q 1IBKL 2AMCB 5JJLA 4PMWA 3NEMA 3M7NA 3F2DA 3W5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S A;  1YHB A;  2Q2H A;  5C4J H;  1N8R C;  2R93 H;  2UUA Q;  1A0I A;  2DGY A;  1OXX K;  4A3M G;  1FL0 A;  1VQP A;  1I3Q H;  3PUY A;  4DAY B;  1R9T H;  1N36 L;  1FJG L;  3HOX H;  3EBE A;  3TRE A;  5GAH C;  1SRU A;  1UEB A;  1KQS A;  4QIW E;  3OTO L;  4HID A;  2JA5 G;  2EQS A;  1M1K C;  1EIF A;  4JI5 L;  3CW2 C;  2WB1 G;  1CSQ A;  1KL9 A;  2VQF Q;  1KHI A;  4PG3 A;  4IFD I;  1ASY A;  2Q2I A;  1YI2 A;  3BZK A;  3U50 C;  1VQ9 A;  5C0X G;  2N49 A;  4O0A A;  3KDF B;  1AE2 A;  3BJU A;  1JB7 A;  3MXN B;  1C0A A;  4LFC Q;  4L5S A;  2JJQ A;  4R4Q A;  3S14 H;  3HKS A;  4DV0 L;  2H5X A;  4BXX H;  1HZ9 A;  3K7U C;  2OQK A;  4RG1 A;  4XTC S;  1AH9 A;  4B3T L;  1U5K A;  2CCZ A;  1X6O A;  2ZTD A;  1VQG A;  2EXD A;  5AJ3 Q;  1HZB A;  3F2C A;  1Q1B A;  3K81 C;  1OXV A;  4JC0 A;  4X64 Q;  4B3M L;  4NPS A;  4QJF A;  1W2B A;  1HNZ Q;  4YY3 Q;  4TQU S;  3AYH B;  1TWF H;  1VCI A;  2MO1 A;  2N3S A;  3GTL H;  2UXC L;  1BBW A;  3PO3 G;  3TRZ A;  5C0X J;  3G71 A;  3PCO B;  2Z0S A;  1IBL Q;  2R7F A;  5IYB G;  3PO3 H;  2B63 G;  3BZC A;  4R4T A;  3CCU A;  1VQ8 A;  4LUV A;  3JC6 6;  1NTG A;  4LUO A;  4Y7N H;  1XNQ Q;  1NMG A;  1SMX A;  3DLL A;  3CCV A;  2UXD L;  4DR7 Q;  1IBM L;  4OWT B;  4H02 A;  1DGS A;  3CC2 A;  5C44 G;  3RNU A;  4LFA L;  5JJK A;  1L0W A;  2ALY B;  4DUZ L;  4DR2 Q;  4BY1 G;  1QZH A;  2IX0 A;  4A3I G;  1YHQ A;  3GTM H;  3H3V I;  1HNW L;  1UE6 A;  5IP7 G;  1X56 A;  4GLV B;  2AHO B;  4X62 Q;  3CXC A;  1VQ6 A;  4OWW B;  1KXL A;  4A3K H;  2ZTC A;  5IP9 G;  5C4X H;  1A8V A;  3KFU A;  3AFQ A;  4JI4 L;  1PH4 A;  1OXU A;  2HIX A;  1VQO A;  2JA8 H;  3PIO A;  1B8A A;  2PI2 A;  2Y0S G;  2NZO A;  2MFI A;  3HKZ G;  4DKA C;  4DUY Q;  2VNU D;  4JI0 L;  1SN8 A;  3RN5 A;  4DR3 Q;  2ZJP A;  3AQQ A;  3A5Z B;  2ATW A;  2K5N A;  4HIO A;  4JI8 L;  4DV6 L;  1YJ9 A;  3ICE A;  2E2I H;  1TXY A;  2PMZ E;  1N9W A;  1YBY A;  5M3M H;  2K5V A;  2ASB A;  5JEA G;  3CCS A;  2QEX A;  3UDX A;  4A3F H;  4OO1 I;  1KRT A;  2R7Z H;  3UE0 A;  1CUK A;  2YTY A;  1PV4 A;  1KIX A;  2BA1 A;  2K14 A;  2R7Z G;  1HR0 L;  4YHH L;  2LXJ A;  2CFM A;  1VQB A;  4C3J H;  3PSI A;  4GOP C;  3HOZ H;  2ID0 A;  3H15 A;  1YVC A;  3TEH B;  2Q2U A;  1YJW A;  2F4V Q;  1YNX A;  3AFP A;  1JJ2 A;  3S1N H;  1UE5 A;  3M9B A;  3M85 A;  3F2B A;  4YWL A;  5JEA J;  4DV2 L;  1I5F A;  5C3E G;  4LFC L;  1Y1V G;  1PH5 A;  1YHA A;  4UP8 A;  4JI1 L;  4DV0 Q;  5ELO A;  1T9H A;  4GNX B;  3PV0 A;  2VUM G;  3U58 A;  4ALP A;  3PGZ A;  5AJ3 L;  3CMA A;  2A8V A;  2ZM6 L;  4DR5 Q;  3HOW H;  4PZ8 A;  4OX9 Q;  4KHZ A;  5EAY A;  2K52 A;  2VL6 A;  2D0P A;  1N34 Q;  3E9H A;  4GS3 A;  3JAM i;  4AQY L;  2R6G A;  4X6A H;  4A3J G;  2OCE A;  1L1O B;  1VQM A;  3GD7 A;  1K8A C;  3OW2 A;  1JMC A;  2R93 G;  2MNA A;  1IBL L;  1B7Y B;  4JYA Q;  2KCT A;  2R7D A;  1QVC A;  3FKI H;  5LMU Q;  2HT1 A;  4BA2 I;  2N8N A;  3F1Z A;  4DV3 L;  4A3D G;  4JV5 Q;  2IHE A;  3LGJ A;  4QY7 A;  4KHP L;  1ASZ A;  3KF8 B;  4APV A;  2GN5 A;  3GTG H;  1JT8 A;  4IPC A;  1XMQ L;  4DR7 L;  1A62 A;  1B70 B;  3HOU H;  5IYC G;  1VQN A;  1WFQ A;  4DR2 L;  3I4N G;  1GO3 E;  4A3L H;  3RN2 A;  1HNW Q;  1HZA A;  4PZ6 A;  1Q81 C;  1V1Q A;  4A93 H;  1E1O A;  2A1A A;  2E8G A;  3I7F A;  2GVB A;  4JI2 L;  4DPG A;  3HOY G;  1KRS A;  1W3S A;  4A3G H;  4JI4 Q;  3OYY A;  3H0G G;  1Q7Y C;  2NVQ H;  3A0J A;  3GO5 A;  1G6P A;  1PH1 A;  1BBU A;  3S16 H;  2CKZ B;  1GVP A;  3PUV A;  3B6Y A;  4KI0 A;  1OTC A;  4DV5 Q;  4JI0 Q;  4GN3 B;  1XPR A;  1VQJ A;  1XNR L;  3PF5 A;  1JE5 A;  3KYH C;  1PA6 A;  1NBW A;  1XJV A;  5HY6 A;  4LFB L;  3ULL A;  4JI8 Q;  4B3R L;  1NE3 A;  1L2F A;  5LMN L;  4DR6 L;  4JI6 L;  1IBK Q;  2JA7 G;  4DR4 Q;  1X3E A;  3J81 c;  1K73 C;  3K0X A;  4GKJ Q;  4JBW A;  1XPU A;  1V9P A;  3W1B A;  2LSS A;  2HQL A;  1HNX Q;  4IPG A;  4MZ9 A;  3KF6 A;  4IFD G;  3K8A A;  2RCN A;  5C44 H;  3RR5 A;  4POF A;  4YHH Q;  5GQO A;  1EIY B;  3OTO Q;  4ME3 A;  2YV5 A;  5H1S E;  4YCU A;  3VDY A;  1K83 H;  5IY0 A;  2PI2 E;  2VQF L;  1LTL A;  1V43 A;  4NXM Q;  1UE7 A;  4DR1 Q;  4AYB E;  3J81 i;  4GOP A;  2IY5 B;  4HJ5 A;  3U4V A;  3F8T A;  1E1T A;  1WYD A;  1EFW A;  3WWV A;  3MEF A;  3GTJ H;  3UDF A;  2CWP A;  3I4O A;  2I0Q A;  2R92 H;  2JE6 I;  4QQB X;  2UXB L;  4B3T Q;  1CKN A;  1SLJ A;  2K50 A;  2VW9 A;  1KD1 C;  1QVG A;  4DV7 Q;  4A3J H;  2KCM A;  4HJ7 A;  3CC4 A;  4DR5 L;  1EQR A;  1G29 1;  4LUZ A;  3Q8D A;  4BA1 I;  1N34 L;  4OXP A;  4X64 L;  1XMO L;  1TWH H;  1VQL A;  4YCW A;  4DV1 Q;  3M3Y H;  5C0X I;  1X3F A;  1VQF A;  4JYA L;  3J7A 5;  4L5Q A;  1HH2 P;  1VQA A;  1PH7 A;  1QUQ A;  4HJ8 A;  1NJI C;  2D62 A;  5LMU L;  3K7A H;  4NXN L;  4HIK A;  3T1Y Q;  1MKH A;  1J5E L;  2GVA A;  3CME A;  2RF4 A;  3GTP H;  4IJH A;  3J80 c;  2HHH Q;  1GD7 A;  4BXX G;  4KHP Q;  1H95 A;  4YWM A;  3HOV H;  2JQO A;  2B3G A;  1MIU A;  3TS0 A;  1PYB A;  1XNQ L;  1VS0 A;  2YTX A;  1K8G A;  1X65 A;  4A4I A;  1XPO A;  4GNX A;  1NY4 A;  4IPH A;  1EQQ A;  3RLF A;  5M3F G;  4DUZ Q;  4BY7 H;  4GLX A;  2BH2 A;  1I50 H;  5M5W H;  1E3P A;  3NEN A;  5M5X H;  4JI7 L;  4X62 L;  4J15 A;  4IFD J;  5FJ8 G;  3M4O H;  3J80 i;  3S15 H;  3CCM A;  3J7Z C;  3GDE A;  3ULP A;  4P74 A;  4BBS H;  2ES2 A;  3M4P A;  4DV5 L;  3CD6 A;  2A19 A;  4LF5 Q;  1UWV A;  4OON A;  2MO0 A;  4DUY L;  4A3I H;  3D0F A;  1QVF A;  3UDG A;  4LFB Q;  3S1R H;  4IJL A;  5IWA L;  5BR8 L;  2UUB Q;  4B3R Q;  4C3H H;  4L5T A;  2I5H A;  2OWO A;  1SE8 A;  4P71 A;  5LMN Q;  3CCL A;  4DR6 Q;  5C4X G;  4DR4 L;  4LF8 Q;  5DLQ E;  4GKJ L;  4UPA A;  2JA8 G;  4YCV A;  5IT9 c;  1YIJ A;  2UUC Q;  4LF7 L;  4IO9 A;  1HNX L;  2L15 A;  2YTV A;  1Q1E A;  1X54 A;  2AWO A;  3HFZ B;  5FLM G;  1TWC H;  2JA7 H;  1P16 A;  2DUD A;  2KHJ A;  4DK3 C;  4LF4 L;  4C2M H;  3GTQ H;  1FGU A;  3HOZ G;  2Z6K A;  3J81 j;  1HR0 Q;  4BY1 H;  4LWC A;  1SR3 A;  4DK6 C;  4HJA A;  3KDF A;  4RMF A;  4LF6 L;  4K0K L;  4DR1 L;  3L7Z C;  1WCM H;  2F4V L;  4LF9 Q;  4R4C A;  1TWG H;  1SFO H;  4UY8 C;  4DV2 Q;  2XTI A;  1Q12 A;  4A3M H;  4DV4 L;  3D31 A;  2VQE Q;  2VUM H;  4JI1 Q;  4EQ5 A;  2UXB Q;  1D7Q A;  3S2H H;  3CPW A;  4DV7 L;  4JBK A;  1GM5 A;  1IZ6 A;  2I5M X;  1Q46 A;  1VQD A;  3ER0 A;  4Y52 H;  3KF6 B;  1XMO Q;  3GTK H;  2ZM6 Q;  3FP9 A;  1IXR A;  3A74 A;  3KJP A;  3CCE A;  4DV1 L;  1Q86 C;  3T1H Q;  4HJ9 A;  2NVX H;  1E24 A;  4OWX B;  2FXQ A;  3K80 C;  1PH3 A;  1S3O A;  1LM0 A;  1VQC A;  1PHJ A;  3W1G A;  2UUA L;  3GTO H;  4P75 A;  1Y1V H;  4B3S L;  2HHH L;  1EOV A;  3ULJ A;  1L1O A;  3PF4 A;  1FJG Q;  1N32 L;  3CPF A;  3KLW A;  4JOI A;  2ZJR A;  4A3C H;  4A3B H;  2Y0S E;  2D0O A;  2IHF A;  1Q8K A;  3U4Z A;  4YWK A;  3CCR A;  1Y1W G;  4JI5 Q;  4FDB A;  1MJC A;  1XMQ Q;  3HOX G;  2PNH A;  1OXT A;  1PH6 A;  1Y1W H;  3A5U A;  2JA5 H;  4DNI A;  4X65 Q;  3H0G H;  3I4M G;  4JI7 Q;  4JBM A;  2JA9 A;  5IYB H;  3PO2 G;  1EWI A;  1SRO A;  4JI2 Q;  4HIM A;  4IOA A;  5IP9 H;  4R4O A;  3UDI A;  3CP0 A;  1RL2 A;  4GOP B;  3PO2 H;  1LUZ A;  3L0O A;  1VQH A;  3PUW A;  3TS2 A;  1Z9F A;  2CQO A;  4R4I A;  5GAD C;  5IYC H;  2OTL A;  2B63 H;  1WI5 A;  4JOI C;  4DAM A;  2JA6 H;  3I4N H;  5IE8 A;  1VQE A;  3RLN A;  4YY3 L;  1OXS C;  1VQI A;  4MTN A;  1HJP A;  3HOU G;  2F52 A;  2I5L X;  2OTJ A;  5IYD H;  4C3I H;  3DM3 A;  1Z47 A;  2KBN A;  2WP8 J;  2UUC L;  4JI6 Q;  2AKW B;  1WOC A;  3HOY H;  4GKK Q;  4A3F G;  3SGI A;  2E2J H;  1M90 C;  3E0E A;  5FLX c;  4P73 A;  4A3E H;  1X55 A;  2ZJQ A;  4X66 Q;  1I94 L;  3S1Q H;  2UXD Q;  4EX5 A;  3AEV A;  4BBR H;  1I6H H;  2K4K A;  4AIM A;  3KOJ A;  4LFA Q;  2QGQ A;  1TWA H;  2KEN A;  3RLO A;  2UU9 Q;  1CKO A;  4WJ3 M;  4PZ7 A;  3KJO A;  3UE1 A;  4GNX C;  2E2H H;  4LF6 Q;  4K0K Q;  3S1M H;  4A76 A;  3G6E A;  3IRB A;  4NXM L;  3H3V H;  2E5L L;  1P8L A;  1QZG A;  1N33 L;  1AE3 A;  4BBS G;  1A63 A;  2B29 A;  3I56 A;  1E7Z A;  3E9I A;  5ELN A;  5M3M G;  5M5Y H;  2EIF A;  2WB1 E;  4JBJ A;  2VQE L;  2Q2T A;  3I55 A;  3STB D;  1RIP A;  2WFW A;  1O7I A;  3EN2 A;  5HGQ A;  4DR3 L;  2V1C C;  2C35 B;  3CQZ H;  4QGU A;  4JI3 Q;  3G48 A;  4GN4 B;  4JCV E;  1FVI A;  2JEA I;  1HZC A;  4MNO A;  3HOW G;  3T1H L;  3RZO H;  1CKN B;  3BU2 A;  3I4M H;  5GAE C;  1S72 A;  4LW1 A;  4IPD A;  2BH8 A;  3TQY A;  4A3B G;  3ERS X;  2PQA B;  2R92 G;  2IX1 A;  5K36 G;  4B3S Q;  1D8L A;  1N32 Q;  3FKI G;  3T1Y L;  1J5E Q;  4NXN Q;  3S17 H;  1L1O C;  4AH6 A;  5LMN W;  1JJC B;  1YEZ A;  3JAM c;  3RZD H;  4KLK A;  1N36 Q;  3CC7 A;  4TVA B;  4UP9 A;  5M3F H;  2RHQ B;  2WAQ E;  5E7N A;  1VQ7 A;  4OO1 G;  2VS1 A;  3PUX A;  1NMF A;  4A3C G;  3STB C;  1YJN A;  1IYJ B;  4X65 L;  4IOC A;  1X9N A;  4A3L G;  5GRO A;  1J6Q A;  2CWA A;  3PUZ A;  4A93 G;  2JA6 G;  4GN5 A;  3ZJY C;  3L2P A;  4A3G G;  5C3E H;  4A3K G;  3HKZ E;  5J3B A;  1VQK A;  2ZTE A;  4A3D H;  2YYZ A;  3M4Q A;  2N78 A;  3CCJ A;  4OX9 L;  4BY7 G;  4LF5 L;  4B3M Q;  2F3I A;  1X3G A;  4AQY Q;  1G51 A;  2XGT A;  2QA4 A;  1PH9 A;  3S2D H;  1IL2 A;  4A75 A;  1HNZ L;  3CF5 A;  1CSP A;  1PVO A;  1MJE A;  2VZA A;  3I2Z A;  4WJ4 A;  5BR8 Q;  1KAW A;  5IWA Q;  2LXK A;  1LYL A;  2UUB L;  2UXC Q;  2IT1 A;  4AYB G;  2JK8 A;  4JG2 A;  2RHS B;  5FLM H;  4LF8 L;  4GLA C;  4DV3 Q;  4JV5 L;  4GKK L;  1BVS A;  3EIV A;  4LF7 Q;  1E22 A;  2K75 A;  3HOV G;  1VQ5 A;  2NVT H;  4L5R C;  4X66 L;  1I94 Q;  4R1J A;  2BA0 A;  4LNQ A;  1K3R A;  1YZ6 A;  1C7Y A;  2NVY H;  1EYG A;  4LF4 Q;  1CKM A;  1XTD A;  2JEB I;  1IBM Q;  2UU9 L;  5JJI A;  2MQH A;  5GAG C;  1Y14 B;  1UE1 A;  4A3E G;  2OQ0 A;  3CAM A;  1PFS A;  2HIV A;  2VY3 A;  4BBR G;  1GKH A;  1K0R A;  2KHI A;  3S24 A;  4POG A;  2K5H A;  3PIP A;  5FJ8 H;  2E5L Q;  2NN6 I;  3NBH B;  1N33 Q;  1BKB A;  1S40 A;  1PH2 A;  4LF9 L;  1PH8 A;  1JJG A;  2NZH A;  4DV4 Q;  1EUJ A;  1VQ4 A;  5IP7 H;  4XIG S;  1QUQ B;  2WAQ G;  4O2D A;  2YU9 H;  4UP7 A;  1YIT A;  3NEL A;  4QL5 A;  1PYS B;  1Q82 C;  2AWN A;  1KC8 C;  1K9M C;  1XNR Q;  5IYD G;  1C9O A;  4JI3 L;  3FHW A;  1U0L A;  4P72 A;  1WCM G;  1WJJ A;  4NB3 A;  3CCQ A;  2Z6K C;  2NN6 G;  2PQA A;  1HR0 W;  4DV6 Q;  1IBK L;  2AMC B;  5JJL A;  4PMW A;  3NEM A;  3M7N A;  3F2D A;  3W5O A; 
#chains in the Genus database with same CATH topology
 3Q1K A;  2DGY A;  2EPB A;  2A6H D;  4A3M G;  2ZDQ A;  3HKZ A;  4ZHQ F;  4DAY B;  1N36 L;  1PFM A;  2VPS A;  2SNS A;  3HOX H;  4YR2 A;  1Y8P B;  1KQS A;  4ME6 A;  4HID A;  1FGB D;  3T16 A;  1H9S B;  2EQS A;  2H1E A;  4QUC A;  1DXM A;  1GUT A;  4JI5 L;  4IFD I;  3DUZ A;  2Q2I A;  3J7A V;  1VQ9 A;  2N49 A;  1KJ9 A;  3FPU B;  1F9S A;  2CH4 W;  2EVB A;  4OO1 H;  3MXN B;  1LV9 A;  2XCP A;  4R4Q A;  4KK7 A;  4DGZ A;  2OQK A;  4RGN A;  1AH9 A;  4B3T L;  4RUA A;  5LYJ F;  5KFB A;  4B3S H;  5AJ3 Q;  4B3M L;  1OXV A;  1AFP A;  4NPS A;  3S9W A;  2MPM A;  1W2B A;  2J6U A;  4FS2 A;  4YY3 Q;  4ZUI A;  1K83 B;  2UXC L;  3TP8 A;  2WB1 B;  2BQ3 A;  3TRZ A;  5C0X J;  4RAU C;  1AZQ A;  2EDG A;  4J9O A;  2ZJT A;  2R7F A;  5IOD A;  4QWE A;  5DQH A;  5IYB G;  2R93 B;  2V59 A;  4EBE A;  3V6J A;  3CCU A;  1HXY D;  4O3P A;  4IUT A;  2WV6 D;  4LUV A;  5FLX W;  4MA0 A;  3PMF A;  1EZ6 A;  5IGD A;  2G5D A;  4FXD A;  2YZG A;  4ZI7 F;  3GTP A;  4OWT B;  3EA6 A;  3FDT A;  2R8K A;  5JJK A;  3QFF A;  2R92 A;  1L0W A;  4DUZ L;  1QZH A;  4DR2 Q;  1GOZ A;  1HNW L;  1UE6 A;  4IZ8 A;  4GLV B;  3UQ8 A;  3LWE A;  3OWE B;  1IYU A;  3CXC A;  4F4X A;  4OWW B;  1I4G A;  1KXL A;  3QOL A;  1S5F D;  3S1Q B;  2WAQ B;  4IZO A;  1S0O A;  4JI4 L;  4N8X 1;  2HIX A;  1VQO A;  5CMD A;  2JA8 H;  1CQF A;  4Q8E A;  1B8A A;  2PI2 A;  4RCO A;  2R84 A;  2DJF C;  5KFT A;  4DUY Q;  3LML A;  5KFH A;  2VNU D;  2JXM B;  1G8Z D;  3AQQ A;  4ILW A;  1HQR D;  2K5N A;  4EQP A;  3K5H A;  4R8I A;  2PMZ E;  2K5V A;  5JEA G;  2R92 B;  3I4L A;  3UDX A;  4A3F H;  1KRT A;  3PR4 A;  2XN9 C;  4UCT A;  1PZJ D;  4K2K A;  4G4K A;  2JA7 A;  4HCE A;  4YHH L;  4EFB A;  4GOP C;  4ZOL F;  1BBX C;  2ID0 A;  5CV8 A;  1ICF B;  2ATL A;  4J9L A;  2F4V Q;  5EDW A;  4F4W A;  5I6Y A;  3M85 A;  4YWL A;  4DV2 L;  2R8J A;  5C3E G;  2JA6 B;  4LFC L;  1R4P B;  1SNQ A;  3MFY A;  2F3V A;  3EPG A;  4K14 A;  1KNE A;  1T9H A;  2LMC B;  2VUM G;  3U58 A;  4ALP A;  5M5Y B;  1EIH A;  3TII A;  4DV0 H;  2ZM6 L;  2W6P A;  4DR5 Q;  4JI6 H;  5EAY A;  2D0P A;  3E9H A;  4AQY L;  5KND A;  1TWC B;  4JV2 A;  5CBA E;  2OCE A;  1JMC A;  3GD7 A;  1H95 A;  4H44 C;  4UHV A;  2MNA A;  1QVC A;  4DAY A;  4ABN A;  3GIQ A;  1U4P A;  3MC0 B;  4YJ2 F;  5EBD A;  3OHA A;  4N8F A;  4QW9 A;  4KHP L;  1ASZ A;  5KG3 A;  3J80 W;  2GN5 A;  3BDO A;  3K5O A;  1JT8 A;  2RDI A;  4ZQI A;  2XD4 A;  4LF4 H;  5IYC G;  1VQN A;  1WFQ A;  2C22 A;  4C1N K;  1TWF B;  3Q24 A;  1GO3 E;  3S1R B;  1JDE A;  1RK6 A;  4UCU A;  1SND A;  2UUC H;  4O2A F;  2E8G A;  1UNN C;  1V51 A;  5CA1 F;  2V4D A;  3H0G G;  3I91 A;  1Q7Y C;  2R3Z A;  2RSN A;  1PH1 A;  1BBU A;  1WCM A;  1PX2 A;  5FD5 A;  3F8N A;  2J4X A;  1S0N A;  4DV5 Q;  4JI0 Q;  3G7L A;  2NU9 B;  1WCM B;  2F0N A;  1DCZ A;  2B39 A;  5LXT F;  1PFB A;  1S03 G;  5HY6 A;  1GUO A;  3M9M B;  4MHE A;  4FBU A;  5C6A A;  2R7M A;  1SYF A;  4KD4 A;  3S15 B;  4DR6 L;  4DL5 A;  1X3E A;  5C4X B;  3K0X A;  5I4D A;  3R8B A;  1LAC A;  2DY8 A;  1LO5 D;  4O3O A;  3BDL A;  1RYR A;  4PDB A;  1JR0 D;  2CHB D;  3GTP B;  4NLG A;  4IPG A;  3KF6 A;  2E75 C;  5C5M A;  2NVX B;  5KG2 A;  3KHL A;  4TV9 F;  3CRL C;  5FPO A;  3JSL A;  2YV5 A;  4K5W A;  1T5X D;  4YCU A;  4MV4 A;  4DUZ H;  1LTL A;  3FPP A;  3V05 A;  1TWG A;  3BZD B;  5EGT A;  5J1Z A;  1KLU D;  4RA8 A;  4C3J G;  4JI3 H;  2CQY A;  2IY5 B;  2Y0S A;  2RVL A;  2EY6 A;  4JI4 H;  2QEJ C;  3W2D A;  1WYD A;  3RFC A;  3MEF A;  2UXB L;  2JE6 I;  5JPM C;  2NVY A;  4B3T Q;  3LNN A;  4C2M A;  5KX5 F;  1KBL A;  1KD1 C;  1XX8 A;  4DV7 Q;  4HJ7 A;  1EQR A;  2RBM A;  4LUZ A;  3URY A;  4BA1 I;  1XMO L;  1TWH H;  1A15 A;  3A8I E;  4M9U A;  2OH2 A;  2NVT B;  1TVX A;  1HRJ A;  5EWG A;  1HH2 P;  1TR5 A;  4QB4 A;  1QUQ A;  2NTT A;  1LTA D;  2D62 A;  3MWY W;  3I72 A;  3MAQ A;  2RF4 A;  3GP7 A;  4QCL A;  2W9C B;  2HHH Q;  3TQ1 A;  4LSX A;  4DA2 A;  1IYV A;  4F7X A;  3RAX A;  2O5I C;  4DL3 A;  1X65 A;  1XPO A;  1DV2 A;  3BVM A;  4GNX A;  1PK8 A;  2YZM A;  3NUC A;  4RNM A;  4IPH A;  1WTO A;  1EQQ A;  3RLF A;  2IX3 A;  4DUZ Q;  2K03 A;  5DLG A;  3VPB A;  1E3P A;  3D4D A;  1M0W A;  1ZYR D;  2W70 A;  4X3K A;  3J80 i;  2HGS A;  5BPH A;  3S15 H;  2E5L H;  2ASL A;  4CKB A;  4P74 A;  2FJ2 A;  3Q8R B;  1DM0 B;  4QMG A;  3M4P A;  2A73 B;  5C4H A;  1KNA A;  4OON A;  2A68 C;  4LF9 H;  3MA2 B;  2HJW A;  4LFB Q;  4R8N A;  2UUB Q;  3NE5 B;  2Z1C A;  3R3O A;  3RZD B;  4DF7 A;  4L5T A;  2OWO A;  1HQM C;  3GQB A;  5C4X G;  3BG5 A;  2F1M A;  4DR4 L;  1O7Y A;  1S5B D;  5DLQ E;  2VUM A;  4UPA A;  3NHH A;  4WRD A;  1K3B C;  2UUC Q;  2FMC A;  4IO9 A;  5I9P A;  4WJW A;  2QYZ A;  1HNW H;  3HFZ B;  1FD7 D;  5FLM G;  3E5N A;  1P16 A;  2Q8I B;  4C2M H;  4ECU A;  1TS5 A;  4BY1 H;  3KDF A;  1KDA A;  1E4G T;  3CRK C;  4C3J B;  4DR1 L;  2DPJ A;  1M8A A;  4IUR A;  4BBR B;  3C3L A;  1SFO H;  1TWG H;  3TZU A;  3OMG A;  4DV2 Q;  3OTO H;  1EYC A;  3SK8 A;  3S14 B;  4ID6 A;  1YNJ C;  1AUX A;  2FB9 A;  1DON A;  3CHB D;  1IZ6 A;  1RTN A;  4B08 A;  1VQD A;  1IXR A;  1BXT A;  3A74 A;  3KJP A;  1ICW A;  3CCE A;  5JQW A;  4ECW A;  4HJ9 A;  3S16 B;  3HOW B;  5IYZ F;  2AGP A;  1SYX B;  5DG7 A;  2A6E C;  2UUA L;  4A3D B;  3TP5 A;  3GTO H;  4P75 A;  3GTM A;  4XT3 B;  2PCF B;  3BVZ A;  1W93 A;  3ULJ A;  3PF4 A;  2K33 A;  3BAB A;  1VF7 A;  4GKK H;  1TT2 A;  5D3I B;  2D0O A;  1SFO B;  3U4Z A;  3CCR A;  4JI5 Q;  5IT9 E;  4G7O C;  1MJC A;  1IOV A;  4KMU C;  5E4X A;  2JEJ A;  1N33 H;  1BOS A;  2PNH A;  1JWM D;  3EVQ A;  5FK9 C;  1W96 A;  2J6T A;  1DD2 A;  4DNI A;  4K5X A;  2Z9H A;  1A6X A;  4JBM A;  1GGO A;  1CFM A;  1SRO A;  1WTR A;  2Q8T A;  1H9R A;  4IOA A;  4K2L A;  5KYL A;  4R4O A;  4GOP B;  1DOK A;  3TS2 A;  3L0O A;  1Z9F A;  4JOI C;  4A3G B;  2JA6 H;  4IRD A;  2B8F A;  1EU4 A;  4YY3 L;  1OXS C;  1RJQ A;  2SOB A;  1VQI A;  2R8H A;  2XNA C;  1JC7 A;  2OTJ A;  4HAE A;  1BR9 A;  2XIW A;  3SXH A;  4DFA A;  2B2W A;  2K6A A;  1JXL A;  3HOY H;  4C3H G;  4LH7 A;  4OEM B;  1FNV A;  1SSO A;  3OUU A;  2OLS A;  1E2W A;  4A2A A;  1M4V A;  2WKD A;  1XNQ H;  1B6S A;  3RLO A;  1I4X A;  1CKO A;  2IMW P;  1KLG D;  4A3I B;  3IRB A;  3K5I A;  2E5L L;  1N33 L;  3ETH A;  1AE3 A;  4YP3 A;  4NP5 A;  1E7Z A;  5ELN A;  2VQE L;  1M7J A;  4EEY A;  2WB1 E;  1W6J A;  1QIL A;  3C2P A;  4B3T H;  4QWA A;  1JDB B;  1HFN A;  3MJF A;  3RGX A;  1STA A;  2EE1 A;  1V1P A;  4ECV A;  4EG0 A;  1OWT A;  1C4Q A;  3IKJ A;  2ZT9 C;  3G48 A;  3VYR A;  1GSO A;  3T1H L;  5KT2 A;  3VYS A;  5CGK A;  5GAE C;  4EQO A;  2BH8 A;  4K8J A;  4LF7 H;  3TQY A;  1CA5 A;  5G3L D;  2W8L A;  3ERS X;  2IX1 A;  5K36 G;  1CT1 D;  1D8L A;  1PRT F;  1RTO A;  2HCI A;  2W9A A;  2J0T D;  2RHQ B;  5EPK A;  3PUX A;  3OSN A;  3FDS A;  3HOU B;  3QWN A;  3STB C;  5AFW A;  1O78 A;  2VA2 A;  4IOC A;  1GSH A;  5GRO A;  2B8G A;  3GTK B;  3P1H A;  5HV6 A;  3M9O B;  1LLR D;  3HOV B;  4S3S A;  1E4E B;  5LP6 F;  3ZJY C;  4A3F B;  2K01 A;  2TMP A;  3VYU A;  4CGY B;  5GON F;  2HDM A;  1QOH A;  2ZXR A;  4FU0 A;  2F3I A;  4O3S A;  4AQY Q;  2XGT A;  1TY0 A;  1EWC A;  3BG3 A;  1CSP A;  1HNZ L;  1MJE A;  2UUB L;  4HQ6 A;  4QIW A;  1TQO A;  3T53 B;  2IT1 A;  3OHX C;  4JG2 A;  3KTM A;  1M6V A;  1EU3 A;  4GLA C;  5IGF A;  3VR4 A;  4JV5 L;  1PRT C;  1GLV A;  4GKK L;  3HOV G;  1S9F A;  1VMC A;  1PTO C;  4X66 L;  4B3R H;  4R1J A;  1U4M A;  4JW0 A;  1YZ6 A;  1C7Y A;  4LF4 Q;  1H9K A;  2JEB I;  4HSV A;  1IBM Q;  2UU9 L;  2CZG A;  4I65 A;  1Y14 B;  4BY7 B;  4UCR A;  2CQA A;  5KFV A;  2HIV A;  3HS0 C;  1K0R A;  2VR1 A;  3KFU A;  2K5H A;  2K28 A;  3PIP A;  2NN6 I;  3NBH B;  3NK9 A;  5A2Q W;  2R7Z A;  3J81 E;  4LF9 L;  3C0F B;  1NUC A;  4RU9 A;  4C56 C;  4UFZ A;  1NR2 A;  4X65 H;  2K5Q A;  3N41 B;  5IP7 H;  4MV1 A;  2WAQ G;  1EIG A;  3RD4 A;  3HRZ C;  1A3V A;  4KY7 A;  4YBZ B;  2AWN A;  3PIP 3;  2D9U A;  3O13 A;  1D1K A;  1WJJ A;  3KHR A;  3CCQ A;  5EBC A;  2NN6 G;  2PQA A;  2AU0 A;  2F0K A;  4ZCK A;  1VBH A;  4XYO A;  5JJL A;  3F2D A;  5KFX A;  2Q2T A;  4RGO S;  1YHB A;  2Q2H A;  4ED2 A;  5C4J H;  5CC4 A;  2UUA Q;  1A0I A;  1OXX K;  1FL0 A;  1VQP A;  1UC9 A;  2M00 A;  1I3Q H;  3PUY A;  1R9T H;  4YR0 A;  3EBE A;  3TRE A;  4XXE A;  1GUS A;  3OTO L;  2C00 A;  1JWU D;  4ZQ3 A;  4ZKB B;  1M1K C;  1HUM A;  1RF2 D;  2GA4 B;  4F88 A;  1CSQ A;  1KL9 A;  4K6L A;  1KHI A;  1LT3 D;  2DZD A;  2FK1 A;  3E0J A;  1ASY A;  5KKN B;  3BZK A;  2QF7 A;  3U50 C;  2AQ2 B;  2FPI B;  3K6O A;  1FKA H;  5CV9 A;  3GII A;  1RCV D;  4QWB A;  1JB7 A;  1TWA A;  2F0H A;  2RCF A;  2JJQ A;  4LAA A;  5KGU A;  3MR5 A;  4DV0 L;  2H5X A;  3GTQ A;  1V1O A;  2YU9 B;  1B44 D;  2RDF A;  2FFK B;  3VPC A;  1CQI B;  3GTL A;  2UVU A;  3F2C A;  1Q1B A;  2D5D A;  2JN4 A;  4IAJ A;  1VDZ A;  2EOT A;  4O3Q A;  3K5M A;  5C5J A;  1VCI A;  2MO1 A;  3GTL H;  4JPB W;  2PBZ A;  4HN7 A;  3ORQ A;  3G71 A;  3TP7 A;  1KDB A;  1PRT B;  4TSS A;  3TZD A;  4YHH H;  3PO3 H;  5LMN H;  2HD3 A;  2J7Z A;  4PNY A;  4R4T A;  1VQ8 A;  3JC6 6;  1NTG A;  4Y7N H;  1XNQ Q;  5KIX A;  4RWS C;  4JI0 H;  4H02 A;  1DGS A;  5EJW A;  2LS0 1;  2EJM A;  2ALY B;  2F0W A;  1YHQ A;  2EXZ A;  1WD1 A;  2AHO B;  3C1E A;  5JVG 3;  1ML0 D;  1K8M A;  1JIH A;  5K5P A;  3JZI A;  1A8V A;  3GIP A;  1FYC A;  1OXU A;  5C1P A;  2FK3 A;  1ZEQ X;  1EWH A;  3HKZ G;  4DKA C;  1EL0 A;  3HXL A;  4DR3 Q;  4TUY F;  3I4N B;  3A5Z B;  2ATW A;  4M1U B;  4DV6 L;  1TXY A;  5A35 A;  1N9W A;  1R4Q B;  5DG8 A;  3QOJ A;  5LMU H;  4WOR A;  5C5L A;  1B53 A;  2V4Q A;  2R7Z H;  4OEL B;  1F9Q A;  3FEW X;  3UE0 A;  1PV4 A;  2YTY A;  2JA5 B;  2E2H A;  1E0B A;  5M5X B;  2ENB A;  2R7Z G;  5KG5 A;  1HFG A;  1VF5 C;  2CFM A;  3M7G A;  4MAM A;  3PSI A;  4G7H C;  3J80 L;  1EQV A;  2VB2 X;  4KV6 A;  2RGV A;  2DIK A;  2Q2U A;  1YJW A;  3A7L A;  1YNX A;  1C3O A;  3S1N H;  5FO9 B;  1NCV A;  1UE5 A;  3M9B A;  3F2B A;  5I9O A;  1I5F A;  4L8J A;  1ESF A;  2EYO A;  2B63 B;  1NAP A;  4JI1 L;  4WD3 A;  3OSP A;  1BCP F;  5D1O B;  1PTO H;  4Y8V B;  2F03 A;  4O3N A;  4EQN A;  3P7J A;  2L9H A;  2WTF A;  1E4E A;  3PGZ A;  5AJ3 L;  4Q5V A;  1C48 A;  2RKS A;  3HOW H;  4J8Q A;  4H7B A;  1VAJ A;  2B2U A;  1XDN A;  4GS3 A;  3JAM i;  1EUD B;  4X6A H;  3KLS X;  1TAE A;  4AYB B;  1VQM A;  1K8A C;  2R93 G;  1S68 A;  4GKJ H;  3DF7 A;  4RB3 C;  4YB8 B;  3FKI H;  5KG6 A;  1N36 H;  4JV5 Q;  4EVO A;  4A3D G;  4J9S A;  3LGJ A;  4HR7 B;  4V19 0;  2BE5 C;  1B6R A;  4APV A;  5JVD F;  5I2X A;  2F0S A;  2K5W A;  3BYT B;  5DLF A;  4DR7 L;  1XMQ L;  3G6Y A;  2G9H D;  2A68 D;  5ELB A;  1TKW B;  1L0Y B;  4DR1 H;  1HNW Q;  1HZA A;  4PZ6 A;  1V1Q A;  4A93 H;  4ECQ A;  2A1A A;  3ND9 A;  2SCU B;  4DPG A;  3VR2 A;  4A3G H;  4JI4 Q;  2NU6 B;  2C2D A;  2VQD A;  3GO5 A;  1G6P A;  3TDQ A;  1TWH A;  2KSW A;  5KFC A;  1EZ8 A;  2UUB H;  2R7Z B;  4KI0 A;  1OTC A;  1D6E C;  4NMZ A;  5DAU A;  5KFL A;  5LL6 b;  1JE5 A;  3KYH C;  1B1Z A;  4PMC A;  4TKO B;  4JI8 Q;  2PW7 A;  3SR1 A;  1BJT A;  2W7O A;  1AN8 A;  3GTG B;  4I7H A;  1GJX A;  5KFF A;  1EYZ A;  1CS0 A;  1JWS D;  5DM7 3;  4G7Z C;  1TU2 B;  3J7Y W;  1K73 C;  3A55 A;  1XPU A;  1V9P A;  5J22 A;  3W1B A;  5K36 H;  1J8I A;  4R7R A;  1HNX Q;  2VPQ A;  4C3H B;  2XGQ A;  3H0G B;  3K8A A;  3PZP A;  1AZP A;  3RR5 A;  2YL2 A;  4KKU A;  4POF A;  3RUZ A;  5GQO A;  2W6Q A;  5J2U F;  3OTO Q;  4IHJ F;  4IWX A;  3NTH A;  1K8O A;  3VDY A;  3N43 B;  1GUG A;  4AYB E;  1SNO A;  5JPN C;  1ONL A;  4LMQ D;  2CW0 D;  3F8T A;  4G3I A;  5LA6 F;  2JA7 B;  3TQT A;  1EFW A;  3N8D A;  5JH7 F;  3GTJ H;  3UDF A;  3I4O A;  4RFB A;  4QQB X;  2X6G A;  1SLJ A;  4EBD A;  1GUW A;  2KCM A;  2VXW A;  4GC6 A;  5EKI A;  1O75 A;  2CW7 A;  4X64 L;  2HUG A;  5KNC A;  1VQL A;  4YCW A;  4DV1 Q;  5C0X I;  1X3F A;  1VQF A;  4Q0F A;  1B3Q A;  1NR4 A;  4JYA L;  4L5Q A;  4QF4 A;  1NJI C;  5LMU L;  1CM9 A;  5IT9 L;  3J81 L;  1SE2 A;  1YNN D;  1S5D D;  3K7A H;  4NXN L;  1MKH A;  1J5E L;  4BWG B;  3CME A;  3GTP H;  4MV3 A;  4LK1 C;  4KHP Q;  2MCT A;  5KFY A;  4YWM A;  1KDC A;  3AU7 A;  3HOV H;  2YW2 A;  3DWA A;  1XNQ L;  2YTX A;  4HNT A;  4I7Z C;  1IKM A;  4MV8 A;  5KFG A;  1EY8 A;  3EPI A;  4X3S A;  1HA5 A;  3HOX B;  4B3M H;  2AGO A;  4X62 L;  3FRP B;  4IFD J;  4FXG C;  2FP4 B;  1I4H A;  1HNX H;  4DXG A;  2XVS A;  4KD3 A;  2ES2 A;  1IHZ A;  2B2Y A;  3CD6 A;  1WSC A;  1FNW A;  1RDP D;  2NUA B;  2MO0 A;  4A3I H;  2PPB C;  3D0F A;  4O4I F;  2JA5 A;  5KT6 A;  3S1R H;  1PXU A;  4IJL A;  5IWA L;  3TIN A;  3PR5 B;  5F2D A;  1AN7 A;  2JP1 A;  2V4R A;  4GKJ L;  2JEG A;  3BVG A;  4QWD A;  1Q1E A;  3PW7 A;  1SYE A;  2AWO A;  2V9W A;  2JA7 H;  2DUD A;  4DK3 C;  4LF4 L;  1B9M A;  2Z6K A;  2GLT A;  3GTJ A;  4DK6 C;  2E2D C;  3G6X A;  4N9P A;  2BCO A;  5KYI A;  2K05 A;  4K0K L;  4FBT A;  4UAI A;  3RB3 A;  4XDX A;  3MFH A;  4LF9 Q;  4C1N I;  5JJZ A;  2XTI A;  4A3M H;  2F0O A;  5KG0 A;  1D5Z C;  4XX0 B;  4JI1 Q;  4EQ5 A;  2W7P A;  3SVM A;  1HTP A;  1MZB A;  1LTB D;  4DV7 L;  4NW2 A;  2I5M X;  1Q46 A;  3ER0 A;  3KF6 B;  5I6W A;  3GTK H;  1S97 A;  3MR6 A;  4IAL A;  1T5E A;  3VR5 A;  1G6Z A;  2FXQ A;  5KFP A;  3K80 C;  1PH3 A;  1S3O A;  2F4I A;  4ED6 A;  3ITP A;  1PHJ A;  1N32 L;  4X3U A;  2HHH L;  3CPF A;  3KLW A;  1I50 A;  2BE5 D;  2ZJR A;  4I7A A;  1FR3 A;  1KEE A;  4YWK A;  4LFC H;  2ICI A;  1XMQ Q;  1TWH B;  4CKE A;  4ZRZ A;  3DM1 A;  2PW5 A;  2JA5 H;  3IG0 A;  1EYD A;  3N6X A;  5LL6 X;  5IYB H;  3PO2 G;  3SI8 A;  3PW5 A;  1RL2 A;  1SE4 A;  1LUZ A;  5E3F A;  4BA2 I;  4MV7 A;  4R4I A;  2B63 H;  3I4N H;  1J9O A;  1S5C D;  1ENC A;  3P20 A;  2YYA A;  2EJF C;  2UVV A;  3SK4 A;  4MTN A;  5ISR A;  3HOU G;  4HCS A;  5IYD H;  2EYP A;  1EEF D;  4B9W A;  4BS9 A;  1Z47 A;  2KBN A;  2UUC L;  5L1I A;  5A2Q E;  3TBI B;  3SGI A;  4APM A;  5BN4 A;  1IW7 D;  4A3E H;  4F8M A;  4X3T A;  3OUZ A;  1BNC A;  4Q0Y A;  1I6V C;  4BBR H;  3K5N A;  2YS6 A;  3DHQ A;  4AIM A;  3SHL A;  3R5X A;  1TWA H;  2KEN A;  4WJ3 M;  4LF6 Q;  3H20 A;  3UE1 A;  2XC9 A;  4RGT A;  1G91 A;  4A76 A;  3G6E A;  4MTD A;  1AP0 A;  3GIL A;  2B29 A;  3IFD A;  4XQN A;  5DQI A;  3GV8 B;  4UDU C;  2NWG A;  2EYL A;  3I55 A;  2PZW A;  4LMY A;  5CB4 F;  4CJ2 C;  3STB D;  1UEA B;  2C2R A;  2ZDH A;  3NPP A;  1N48 A;  2WFW A;  1O7I A;  1SNM A;  2NU7 B;  4CDE C;  4HMJ A;  1TWC A;  4DR3 L;  2V1C C;  4QGU A;  4JI3 Q;  4GN4 B;  4JCV E;  1FVI A;  3BDC A;  3TN2 A;  3HOW G;  4KKS A;  3RZO H;  4MA5 A;  3BU2 A;  1Y69 U;  1J5E H;  4NXN H;  4LW1 A;  1MHW C;  2GPS A;  2R7K A;  4ETS A;  3FKI G;  1J5E Q;  4NXN Q;  3S17 H;  2GPW A;  4Q8F A;  1JJC B;  3RZD H;  2K5D A;  3UI2 A;  4TVA B;  3MTS A;  2NBF A;  2NTS A;  4UP9 A;  5KT7 A;  3QB3 A;  4L63 B;  5M3F H;  2WAQ E;  1QCB D;  3EYY A;  4DN4 M;  1F77 A;  1QE6 A;  4X62 H;  4A3C G;  1YJN A;  1IYJ B;  4DNR B;  4X65 L;  1CQJ B;  1LT6 D;  1X9N A;  4A3L G;  3KHG A;  1J6Q A;  1JOR A;  1YNN C;  3PUZ A;  5C3E B;  2JA6 G;  4DV5 H;  4DL4 A;  4HYK A;  1Y8O B;  4GN5 A;  3L2P A;  4DL7 A;  5FO7 B;  4JI1 H;  1D2B A;  3SEB A;  3D3R A;  2L4N A;  3M4Q A;  2N78 A;  4OX9 L;  1STB A;  1TWG B;  4BY7 G;  3OMC A;  1X3G A;  3S2D H;  1G51 A;  2QA4 A;  1IL8 A;  3KK7 A;  4HED A;  3RTX A;  5IWA Q;  1KAW A;  2UXC Q;  3R93 A;  4M7E A;  2XRS D;  1I7L A;  3T5K A;  2RHS B;  2F0F A;  2SNM A;  2XWJ B;  5FLM H;  4LF8 L;  5EWF A;  5IGB A;  5KFJ A;  1BVS A;  2TSS A;  2NVX A;  1E22 A;  3L4K A;  5L1J A;  2NVT H;  2HHH H;  1I94 Q;  2BA0 A;  2RDG A;  3NXW A;  3Q23 A;  1S4Z A;  4FNF A;  3MXN A;  2NVY H;  4DL2 A;  1EYG A;  2Z8L A;  3KXY T;  2FE3 A;  1Y1V A;  4MV9 A;  5DGA A;  4A3E G;  1UE1 A;  2R7N A;  2K04 A;  4KJO A;  3GTQ B;  2VY3 A;  3K58 A;  1E2V A;  4BBR G;  1GKH A;  4POG A;  3SK6 A;  1N33 Q;  3K57 A;  1PH8 A;  3CU7 A;  2O4X A;  4DNT B;  1JJG A;  4DV7 H;  3MFI A;  4DV4 Q;  3RJ0 A;  4NXM H;  2RQX A;  1U4R A;  4R8U A;  1KC8 C;  3MXU A;  3WOF A;  1K9M C;  4CBV A;  3FHW A;  4P72 A;  3KHH A;  5C44 B;  4PWQ A;  3Q2O A;  3KBX A;  1BGW A;  1I6H B;  2C2E A;  1SXT A;  2AMC B;  4KKT A;  3ORR A;  3HP3 A;  4J9K A;  2AUJ D;  4IWY A;  4TQR A;  2R93 H;  1F2Y A;  3GIK A;  3RGZ A;  2L0C A;  2FK2 A;  5IGE A;  5GAH C;  1ZYR C;  5ELC A;  4TRD A;  1ZHQ A;  2V58 A;  3IFT A;  5M5W B;  3CW2 C;  3VMM A;  2WB1 G;  2VQF Q;  3EJI A;  1CQV A;  1YI2 A;  5T1G A;  1CHQ D;  5FD6 A;  3I8Z A;  5KT4 A;  3CQZ B;  3Q0A A;  4DLK A;  5C0X G;  1JKJ B;  1AE2 A;  1SDF A;  2K32 A;  3BJU A;  3GV3 A;  1C0A A;  1LAB A;  3SE0 A;  4DK0 A;  3KAL A;  5KFS A;  1HZ9 A;  3I3C A;  4YAK B;  4XTC S;  5KFO A;  3J7A F;  2I8C A;  5CYU A;  3NTI A;  3OIP A;  2CCZ A;  1X6O A;  4FF3 A;  1PMR A;  1VQG A;  2EXD A;  1HZB A;  1TA8 A;  3K81 C;  4JC0 A;  4X64 Q;  4RNO A;  4Q45 A;  4JI5 H;  2FJZ A;  3NSW A;  4QJF A;  5IGG A;  1HNZ Q;  3AYH B;  3BA8 A;  5FLX E;  4LFB H;  5F9N A;  1BQQ T;  1JIC A;  1SYB A;  1IBL Q;  4RUC A;  3WNZ A;  3T13 A;  2QIL A;  4YQW A;  3BZC A;  1X3P A;  3H40 A;  1JOQ A;  3H3V C;  3DLL A;  3CCV A;  3CC2 A;  4FF2 A;  3RNU A;  4C3I G;  2F3W A;  5C3X A;  3EQL C;  2IX0 A;  4A3I G;  1STE A;  4JI8 H;  5IP7 G;  4V0B A;  3VA7 A;  4X62 Q;  4MTE A;  2RGR A;  4A3K H;  1SFO A;  1A9X A;  1ROD A;  3AFQ A;  2J9G A;  1ESR A;  2R82 A;  3C1F A;  3PIO A;  2DJG C;  4JI0 L;  4X64 H;  4H13 C;  1EFI D;  4DR6 H;  2R61 A;  2F4V H;  3ICE A;  2E2I H;  3NGD A;  2ASB A;  1YBY A;  3T1Y H;  4JV5 H;  3CCS A;  3LX0 A;  4WBN F;  1EY9 A;  1WD0 A;  1KJQ A;  1SE3 A;  4OO1 I;  4LF8 H;  4HSP A;  3Q8S B;  5JVH 3;  4DV1 H;  2I07 B;  3DEO A;  1CUK A;  1KIX A;  2BA1 A;  2KUM A;  2K14 A;  3NTK A;  2UU9 H;  1HR0 L;  1BO0 A;  1VQB A;  4C3J H;  1SJH D;  1EEI D;  4ED8 A;  1PTO D;  1FNU A;  3BAA A;  2F0I A;  1YVC A;  3TEH B;  1A3T A;  3BJY A;  3DXJ C;  1ZXT A;  4DAV A;  4DR3 H;  5JEA J;  1PH5 A;  1YHA A;  1Z2O X;  5A2Q L;  2IJ0 A;  3FMA A;  4KHP H;  4MN3 A;  1JCK B;  3PV0 A;  4DV4 H;  3CMA A;  1TII D;  2F0G A;  4O1N A;  3GTG A;  4OX9 Q;  4C3I B;  1N34 Q;  2K52 A;  3J80 E;  1A2T A;  3JSN A;  5KFU A;  5COR A;  3GIJ A;  2R6G A;  2K1B A;  4C5B A;  4A3J G;  4ULL A;  3K0Y A;  3OSO A;  3OW2 A;  3NWT A;  3QJY A;  2R86 A;  2PO4 A;  2HT1 A;  3V4S A;  1IKL A;  5F9L A;  2IHE A;  2VB3 X;  3H4B A;  3PW2 A;  4QY7 A;  3KF8 B;  3GV7 B;  3GTG H;  4I50 F;  4ECX A;  4IPC A;  2FPG B;  5I47 A;  4ECT A;  1A62 A;  3HEJ A;  2HQE A;  1B70 B;  3I4N G;  2IPK D;  4DR2 L;  3GTL B;  2ICE C;  2PMZ B;  1WTX A;  3QO2 A;  1T36 A;  1HR0 H;  1E1O A;  3I7F A;  2OEO A;  2GVB A;  3MHB A;  4DK1 A;  3HOY G;  1W3S A;  4KY6 A;  1N56 A;  3C46 A;  4XZ3 B;  2NVQ H;  2W6N A;  1G2S A;  5T1I A;  3A0J A;  2RDJ A;  2CKZ B;  2Z6B A;  3PUV A;  5ELE A;  4ZK9 B;  3EFX D;  1HCZ A;  1PA6 A;  4KJN A;  4IUV A;  1XJV A;  5LL6 S;  3ULL A;  3N6R A;  4OIJ A;  1LT4 D;  4B3R L;  1K1S A;  4HTH A;  4RGM A;  3NQT A;  1L2F A;  2VQE H;  5LMN L;  2ZXP A;  3J81 c;  2PYK A;  2QCP X;  5KRU A;  4RKL A;  4JV1 A;  2JA8 B;  4IFD G;  4MZ9 A;  5C4J B;  2F0J A;  2I80 A;  3GLK A;  3I73 A;  4EYI B;  4RB1 A;  5C44 H;  4C5C A;  3G6V A;  4YHH Q;  5EKL A;  2B2W C;  1PLF A;  4CC6 A;  1K83 H;  2VQF L;  1V43 A;  1UE7 A;  4FF1 A;  3J81 i;  1QB5 D;  1XWE A;  3F2U A;  3AB9 A;  3U4V A;  5KFR A;  3R2I A;  5L1K A;  3WWV A;  2CWP A;  2EY1 A;  2KHS A;  2I0Q A;  2R92 H;  1QVG A;  1PFN A;  2A69 D;  4JI2 H;  1EY0 A;  2X6L A;  4DR5 L;  2HVS A;  1RHP A;  1B50 A;  3A8J E;  2NN6 H;  3Q8D A;  3RV4 A;  4OXP A;  2FLP A;  1RJT A;  2P5Z X;  1SYC A;  2B63 A;  1VQA A;  1PH7 A;  1SNC A;  4HJ8 A;  4IUU A;  1F2L A;  1QJO A;  1ZQ7 A;  3QZ7 A;  2MP1 A;  3V6H A;  4LF5 H;  3T1Y Q;  4HIK A;  1CK1 A;  3JRX A;  3J80 c;  1GD7 A;  4OGQ C;  4K0K H;  3G6J B;  2CVR A;  4J9R A;  5IOC A;  1K8G A;  2KQ3 A;  2EYJ A;  3UFX B;  3E6Z X;  2BDO A;  3MWM A;  5M3F G;  4BY7 H;  2M05 A;  1MBY A;  1I50 H;  2WDT A;  5M5W H;  3OWF A;  5M5X H;  3VR6 A;  4JI7 L;  1Q3L A;  4IUP A;  4IR1 A;  5FJ8 G;  2XRQ D;  5FOB B;  4CDD C;  3CCM A;  4E4T A;  4ODG A;  1IW7 C;  4NKL A;  3GDE A;  3ULP A;  3G8C A;  4BBS H;  2W9B B;  2O03 A;  2EYF A;  4DV5 L;  1T3N A;  2A19 A;  3GTM B;  1B3A A;  2WB1 A;  4JUZ A;  1XYI A;  3UDG A;  2EY2 A;  3NBI A;  5BR8 L;  1LTT D;  4C3H H;  2I5H A;  5DM6 3;  3CCL A;  4DR6 Q;  4HNV A;  5HUR A;  4LF8 Q;  4EYH B;  1WTQ A;  5EOY A;  4J1M A;  1GYF A;  5IT9 c;  2IWH A;  3D6C A;  3GTO B;  5EPL A;  2L15 A;  2YTV A;  5TSS A;  1HNX L;  3Q8Q B;  1TWC H;  1WTH A;  4YIJ A;  3KUP A;  3HOZ G;  2KHJ A;  3MR2 A;  1RJR A;  3RAQ A;  2E2I B;  3J81 j;  2A6E D;  1IOW A;  1HR0 Q;  3R23 A;  2DY7 A;  1HPC A;  4HJA A;  3T51 B;  4FF4 A;  3I70 A;  4RMF A;  4UCO A;  2JEF A;  5FLX L;  2XCL A;  1WCM H;  4N9T A;  1CE8 A;  3PW0 A;  2W71 A;  2HCC A;  1VMP A;  4DV4 L;  1K83 A;  5KFD A;  3BQ0 A;  2VQE Q;  4QUF A;  2UXB Q;  1D7Q A;  3S2H H;  2RSO A;  4XQJ A;  1NSN S;  4OX9 H;  4RHR A;  4QW8 A;  4Y52 H;  2WII B;  1WTW A;  1XMO Q;  2L5T A;  1K28 A;  1BXR A;  5CAE B;  3D8G A;  4DV1 L;  3GQC A;  1Y8N B;  3T1H Q;  2NVX H;  3RBD A;  1E24 A;  4OWX B;  3T56 B;  3ONA B;  2FMM A;  3TP6 A;  2V5A A;  5CA0 F;  1N34 H;  1I3Q B;  1EYA A;  1R9T B;  1ILP A;  1LM0 A;  1VQC A;  3ERQ A;  3W1G A;  1KJI A;  4FM9 A;  5J39 A;  5KG7 A;  4B3S L;  3I12 A;  1EOV A;  3X3N A;  1FJG Q;  1EZ1 A;  5EKK A;  1STY A;  2MHV A;  4A3B H;  1DZ1 A;  2WAC A;  1ET9 A;  5KFI A;  3NQI A;  4FDB A;  4MIU A;  3HOX G;  3HGB A;  1SJE D;  2A69 C;  1PH6 A;  1QG7 A;  4G57 A;  1QNK A;  3L3O C;  4YR3 A;  3IN5 A;  4IUQ A;  1EWI A;  1AUV A;  2F0M A;  4JI2 Q;  4EEQ A;  3IL8 A;  3LWU A;  5JUM A;  3MZ5 A;  1VQH A;  2CQO A;  1QWY A;  5GAD C;  1W6K A;  4RKB A;  2WE6 A;  3V6K A;  1EY5 A;  1U9R A;  4CDC C;  3RLN A;  4XYQ A;  3T5H A;  1ENF A;  2JYO A;  1HJP A;  4YAJ B;  2F0D A;  1F2M A;  2CW0 C;  4C3I H;  1JOO A;  2Z4I A;  1XMQ H;  3ZYY X;  3GIM A;  4KTA A;  3HG9 A;  2KEC A;  1SNP A;  1XXG A;  1WOC A;  2BDN A;  5IGC A;  1WTP A;  3ETJ A;  4A3F G;  5C8Y F;  2HVR A;  1FJG H;  1B4O A;  3E0E A;  4FXK C;  5FLX c;  3VPD A;  1X55 A;  4X66 Q;  4EX5 A;  3AEV A;  1GSA A;  4UCS A;  1I6H H;  1Q90 A;  2K4K A;  3KOJ A;  4LFA Q;  2DWC A;  2QGQ A;  2B2V C;  1ZKO A;  5D1P A;  2E2H H;  4GNX C;  1PZK D;  3T1H H;  4O4H F;  3PIO 3;  3Q22 A;  2F0V A;  3FMC A;  3V4Z A;  3H3V H;  4QWC A;  1QZG A;  4CDF C;  5D8D A;  3E9I A;  3BA9 A;  4WFN 3;  2EIF A;  3K59 A;  4JBJ A;  5IIF A;  1G2T A;  3RMH A;  3EN2 A;  5KFZ A;  4ECS A;  3HKZ B;  2C35 B;  3GV6 A;  1KAB A;  2JEA I;  1HZC A;  3M9N B;  2XIG A;  2XSC A;  5KFK A;  1JE4 A;  2MUY A;  1S72 A;  1DV1 A;  1F9R A;  1BUV T;  4HR7 A;  3QIA A;  1EY7 A;  1GXD C;  1DOM A;  4IRC A;  1N32 Q;  1M0T A;  3TSS A;  3T1Y L;  1JB3 A;  1L1O C;  1AW7 A;  4AH6 A;  5LMN W;  1YEZ A;  2RA4 A;  3T5J A;  4KLK A;  1N36 Q;  3CC7 A;  2UVR A;  1PZI D;  1X3Q A;  4YJ3 F;  5KFQ A;  2R8G A;  1F2Z A;  2KEE A;  2HVQ A;  1C8C A;  1VQ7 A;  2VS1 A;  4DXF A;  1NMF A;  1TS3 A;  2Q8R E;  1JX4 A;  3ND8 A;  2CWA A;  4DR5 H;  4C2M B;  3H0G A;  4JYA H;  4FS1 A;  5C3E H;  4LSA A;  4A3K G;  1KJ8 A;  3HKZ E;  5J3B A;  2ZTE A;  5FKA C;  3CCJ A;  4JVZ A;  4LF5 L;  1I50 B;  4B3M Q;  1HHV A;  2QDB A;  1PH9 A;  4A75 A;  3CF5 A;  1UNS A;  2KOL A;  4WJ4 A;  2B2T A;  5CV7 A;  5BR8 Q;  2X69 A;  1LYL A;  3KLS A;  4FP5 D;  2E76 C;  1ZHS A;  3DMU A;  4YY3 H;  2JK8 A;  2W9C A;  2ZDG A;  3MXP A;  1BDO A;  1XNR H;  1JOK A;  1PTO F;  4DV3 Q;  4K6D A;  3S17 B;  3EIV A;  1MD2 D;  2IBK A;  1VQ5 A;  4L5R C;  1ILQ A;  4LNQ A;  3TIG A;  1UAP A;  3U9O A;  1DYQ A;  5L1L A;  3QR8 A;  1CKM A;  1XTD A;  5DG9 A;  4RZR A;  1STN A;  3GTO A;  4F4Z A;  5D3D A;  2NVY B;  1ENA A;  1KTK A;  3Q6S A;  1I94 H;  2VA3 A;  2I46 A;  2OQ0 A;  1PFS A;  1XTC D;  3CAM A;  1RYS A;  2F0Q A;  2AUK A;  1DJR D;  2KHI A;  2E5L Q;  1PH2 A;  2A5H A;  3P75 A;  2NZH A;  3HOY B;  5H80 A;  1EUJ A;  5IWA H;  2N55 A;  1QUQ B;  4O2D A;  4ZLT F;  2YU9 H;  2YZN A;  1KAA A;  3NEL A;  1PYS B;  4QL5 A;  3RUP A;  1Q82 C;  2WAQ A;  4DL6 A;  2N88 A;  4P2C B;  5IYD G;  1U0L A;  2WYO A;  2W8K A;  3D6W A;  2F0U A;  2Z6K C;  2L12 A;  1HR0 W;  2XGP A;  2DNC A;  4ECR A;  5KG1 A;  4PQX A;  4MV6 A;  1IBK L;  4PMW A;  1CHP D;  1CZW A;  3G4S A;  2YCH A;  4K5V A;  4J9P A;  2PNR C;  3CQZ A;  1N8R C;  2KED A;  4HMI A;  3TME A;  1FJG L;  2E74 C;  1SRU A;  1UEB A;  3LWB A;  1XMO H;  4QIW E;  2L55 A;  2JA5 G;  4RZQ A;  1EIF A;  5BN3 A;  3KBG A;  4PG3 A;  2B2V A;  4O2B F;  2DLN A;  2DN8 A;  1O7L A;  2MJ8 A;  4O0A A;  3KDF B;  4ED0 A;  5KEE A;  3U9T A;  1HA6 A;  3E5S A;  4LFC Q;  1RD9 D;  5JOB A;  4L5S A;  3S14 H;  3HKS A;  4E6I A;  4BXX H;  3K7U C;  4RG1 A;  1U5K A;  2JA6 A;  1N32 H;  1SMY D;  1TWF A;  4LH6 A;  2ZTD A;  2M2L A;  3I4M G;  3FVQ A;  5CV6 A;  3V2T A;  1S10 A;  4TQU S;  2EZV A;  3J7A K;  1TWF H;  2N3S A;  2Z4H A;  1E2Z A;  1BBW A;  2PZT A;  3PO3 G;  5FPR A;  2NB0 A;  3PCO B;  4OHJ A;  2Z0S A;  1II3 A;  1JQY D;  4Q43 A;  2B63 G;  2KVM A;  2F0P A;  3GTJ B;  4DR2 H;  4LUO A;  1NMG A;  1SMX A;  2UXD L;  5COY A;  1IBM L;  4DR7 Q;  3S2D B;  4ED7 A;  2BQR A;  2PN1 A;  4X66 H;  5C44 G;  4LFA L;  4XQQ A;  4J0M A;  4BY1 G;  2X0S A;  2OF1 A;  5KFM A;  3GTM H;  3H3V I;  4KY5 A;  1X56 A;  4ED1 A;  4BBS B;  1VQ6 A;  3M4I A;  2ZTC A;  5IP9 G;  2ASJ A;  2EYM A;  5CR3 A;  2EJG C;  5C4X H;  4BWS C;  5JVL A;  1PH4 A;  2LFN A;  5J2T F;  4TV8 F;  2B2U C;  2NZO A;  2MFI A;  2Y0S G;  1C30 A;  1SN8 A;  4U68 A;  3RN5 A;  3GID A;  2ZJP A;  1E4F T;  1A2U A;  2KCN A;  1L2Z A;  4HIO A;  4JI8 L;  1YJ9 A;  2YU9 A;  1Y1V B;  5M3M H;  4Z9C B;  2QEX A;  4XYM B;  3VYT A;  3T5L A;  1SCU B;  1EY6 A;  1SBB B;  3JAM E;  2VUG A;  5DNF A;  4U67 3;  3R5F A;  1MSH A;  3I4M B;  3JAM W;  2VQF H;  3HOZ B;  1B2T A;  2MGS A;  2LXJ A;  2QK4 A;  3HOZ H;  1SYD A;  3H15 A;  1SAP A;  1DIK A;  4DV6 H;  1GUN A;  3AFP A;  4IR9 A;  1PRT D;  2NUC A;  1JJ2 A;  3MR3 A;  2UUA H;  3R2T A;  1I6U A;  2CW8 A;  1Y1V G;  2ZXO A;  4UP8 A;  4DV0 Q;  5KNB A;  5ELO A;  1LT5 D;  3H91 A;  4RAZ A;  4GNX B;  2KA7 A;  2A8V A;  2HDL A;  3R5H A;  3KF8 A;  4Q44 A;  4PZ8 A;  4KHZ A;  1B04 A;  2VL6 A;  4JK1 C;  1LTS D;  5HBR B;  4RH6 A;  1L1O B;  4JYA Q;  4KHV A;  1B7Y B;  3DWQ A;  2KCT A;  2R7D A;  1IBL L;  2E2J B;  1VBG A;  2FLL A;  2P0A A;  5LMU Q;  2N8N A;  3F1Z A;  3RB6 A;  4DV3 L;  4FVM A;  5FO8 B;  3D4R A;  2IW3 A;  3M4O B;  2YRW A;  2FPP B;  1WH2 A;  4I55 F;  5LHY 1;  5D14 A;  1L0X B;  3PQI A;  3M3Y B;  3DEP A;  2OXP A;  2KJX A;  3HOU H;  4F4Y A;  3ERO A;  5C0X H;  4JI7 H;  4A3L H;  3RN2 A;  1Z2N X;  3WO1 A;  3HBL A;  2W6O A;  1Q81 C;  1STG A;  2SDF A;  5K2M A;  5KT3 A;  4JI2 L;  5KT5 A;  3A7A B;  1KRS A;  2K7V A;  3OYY A;  2R6F A;  3KAK A;  3S16 H;  3OIQ A;  1GVP A;  3I90 A;  3B6Y A;  4GN3 B;  1XPR A;  1VQJ A;  4QIW B;  1XNR L;  3PF5 A;  2M9V A;  5JEA H;  2PZU A;  1NBW A;  1IBK H;  1HTL D;  4LFB L;  5E1F A;  1Z2P X;  1X32 A;  5BMV F;  4O42 A;  2CH4 A;  1NE3 A;  4C5A A;  4JI6 L;  1IBK Q;  2JA7 G;  4DR4 Q;  2ZM6 H;  3VA5 A;  2JSO A;  4GKJ Q;  4JBW A;  4IN3 A;  3GTK A;  2LSS A;  3SK5 A;  2HQL A;  1V4Y A;  1I7N A;  5BN5 A;  1BF4 A;  2L1B A;  2RCN A;  3SDZ A;  2VUM B;  2UXB H;  2FIN B;  4B9X A;  2LY7 A;  4LFA H;  1V8Q A;  4L1K A;  1MI2 A;  1D1I A;  1EIY B;  3RBE A;  4ME3 A;  2UXD H;  5H1S E;  5NUC A;  1EY4 A;  5LOV F;  4J9Q A;  5IY0 A;  2PI2 E;  4NXM Q;  4DR1 Q;  1H9M A;  4GOP A;  1SEI A;  2W9B A;  4HJ5 A;  2O5J C;  2ASD A;  1EOT A;  4DAP A;  5EWE A;  1E1T A;  3WDN A;  2VOB A;  2AQ3 B;  3BS1 A;  2IA6 A;  3NWS A;  4L6T B;  5EPJ A;  1CKN A;  2K50 A;  2VW9 A;  4A3J H;  4OL7 A;  3CC4 A;  1VKZ A;  3RB0 A;  1G29 1;  4XYL B;  5BPF A;  1N34 L;  3PN1 A;  4A3J B;  1TWA B;  5C3W A;  3W3A A;  3M3Y H;  5KFN A;  3J7A 5;  1SMY C;  4R8U B;  5E4W C;  2GVA A;  4IJH A;  3V96 A;  4ME5 A;  3NBH A;  4BXX G;  4TQS A;  2B2T C;  2JQO A;  4RCN A;  2B3G A;  1MIU A;  2RDH A;  2B2Y C;  2L11 A;  1PYB A;  3TS0 A;  2O2L D;  1VS0 A;  2C28 A;  4LJZ C;  2FHT A;  4A4I A;  3D4W A;  1NY4 A;  3OW7 A;  3N42 B;  4U6P A;  4ED3 A;  2J6S A;  1NNX A;  2R7L A;  2WKC A;  4GLX A;  2BH2 A;  3NEN A;  3VR3 A;  3M4Y A;  4J15 A;  4DR4 H;  5KG4 A;  3M4O H;  2OT2 A;  3MXG A;  1V1P B;  3J7Z C;  2R85 A;  5L37 A;  2D2C C;  4EGQ A;  3K3P A;  2Y0S B;  3CVZ A;  4R9W A;  4LF5 Q;  1UWV A;  3RB4 A;  4DUY L;  1Y1W B;  1QVF A;  3AMU A;  4I4T F;  1I3Q A;  1R9T A;  4B3R Q;  4ZUJ A;  4EFE A;  1SE8 A;  4P71 A;  5LMN Q;  5IT9 W;  5M3F B;  4DV3 H;  1IBM H;  1IBL H;  2JA8 G;  3K7A B;  4YCV A;  1YIJ A;  1TS2 A;  4LF7 L;  1PTO B;  1EHI A;  3HB9 A;  1X54 A;  1RJP A;  3KAJ A;  2NYZ D;  2PVP A;  1ZET A;  3GTQ H;  1FGU A;  1D5M C;  5M9O A;  1CA6 A;  3H6M A;  4LWC A;  1SR3 A;  1HUN A;  3MWD A;  1JLL B;  4LF6 L;  4A3E B;  3A56 A;  3RZO B;  1B33 N;  1AEX A;  2UVW A;  1BCP B;  2R8I A;  3L7Z C;  2F4V L;  3QG1 A;  1MSG A;  4R4C A;  3BQ2 A;  4UY8 C;  1Z6H A;  1GHK A;  4KN7 C;  2YS7 A;  1Q12 A;  1K1Q A;  3D31 A;  2VUM H;  2A74 C;  3S1N B;  1BCP C;  3NP8 A;  1A3U A;  1CI3 M;  5DEH A;  3CPW A;  1ULZ A;  4JBK A;  3N44 B;  4RHS A;  1GM5 A;  4F50 A;  4EBC A;  2ZM6 Q;  3FP9 A;  3S1M B;  3GV5 B;  2LKV A;  1S0M A;  1UUP A;  1Q86 C;  3RF2 A;  2A6H C;  1WTV A;  4FO2 A;  3PO2 B;  2AQ1 B;  2FMA A;  1F9P A;  4ZAI A;  2W57 A;  3PW4 A;  4PMB A;  4Y7N B;  1LTR D;  1HNZ H;  1I4P A;  1Z7T A;  1MGS A;  3A54 A;  2XCA A;  1PYW D;  1O80 A;  1H9S A;  1Y1V H;  5M3M B;  1B9N A;  1L1O A;  1PDQ A;  3K3V A;  4JOI A;  4A3C H;  2F0T A;  2Y0S E;  3FKI B;  2IHF A;  1Q8K A;  4XT1 B;  2ALZ A;  3K5L A;  1Y1W G;  4AYB A;  4J9M A;  4EGJ A;  2AQ4 A;  2FLN A;  1OXT A;  3E3X A;  1WVL A;  1Y1W H;  3A5U A;  2YRX A;  4X65 Q;  5T14 A;  3H0G H;  5ELF A;  3JRW A;  4JI7 Q;  3MEH A;  2JA9 A;  2R87 A;  3N40 P;  4MTK A;  3DWP A;  4DU9 A;  4GZY C;  4HIM A;  2W6M A;  1STH A;  5IP9 H;  3UDI A;  3PO2 H;  3CP0 A;  4A93 B;  3RV3 A;  3SE7 A;  3CKI B;  3PUW A;  2NVQ B;  3WO0 A;  1GHJ A;  4CJ0 B;  5IYC H;  2OTL A;  1WI5 A;  2KCC A;  4DAM A;  4IRK A;  3H09 A;  4UCV A;  5IE8 A;  1VQE A;  4CJ1 B;  2G9D A;  1OO9 B;  1CZG A;  3FKI A;  2F52 A;  2I5L X;  4CC5 A;  4M8A A;  3PO3 B;  3DM3 A;  1K0S A;  2WP8 J;  4JI6 Q;  1EQT A;  2AKW B;  4HNU A;  3J81 W;  4GKK Q;  2SEB D;  2E2J H;  3WOE A;  1M90 C;  2ZJQ A;  4P73 A;  5C1O A;  1RKN A;  1TS4 A;  1I94 L;  3S1Q H;  5EZY F;  2UXD Q;  3LP8 A;  3PVX A;  1EUC B;  2W6Z A;  2UU9 Q;  4PZ7 A;  3KJO A;  4K0K Q;  2R93 A;  2NZ1 D;  3S1M H;  3S2H B;  1I4R A;  4NXM L;  1P8L A;  3H94 A;  4H0L C;  2EYH A;  4IFD H;  4ECZ A;  4BBS G;  3X3M A;  1A63 A;  2C5C A;  3I56 A;  5M5Y H;  5M3M G;  3L4J A;  4FYD A;  5L9X A;  2E2I A;  4RB2 C;  3RIZ A;  3BQ1 A;  1RIP A;  1SYG A;  1KC7 A;  5HGQ A;  2PMZ A;  4CHT B;  4DV2 H;  3CQZ H;  4A2B A;  5KFA A;  4RB0 A;  4DUY H;  4O3R A;  4MNO A;  2QDL A;  2UXC H;  1CKN B;  1I4Q A;  3I4M H;  3HZX A;  2H4O A;  3BYY B;  3MFG A;  4IPD A;  1BNZ A;  4A3B G;  2PQA B;  2R92 G;  4RAY A;  4ZKC B;  5HGT A;  4A3K B;  4B3S Q;  4IUN A;  5ELD A;  5DGB A;  1U4L A;  4O4L F;  1T94 A;  1LTG D;  3JAM c;  4A3M B;  3OHB A;  3MWE A;  1ET6 A;  2BOS A;  2PQE A;  5JAV A;  1RK5 A;  2AGQ A;  5E7N A;  2NU8 B;  4OO1 G;  1KJJ A;  4EGV A;  2FKL A;  5KFE A;  4LF6 H;  1S5E D;  1D5X C;  1UC8 A;  4RNN A;  4F87 A;  2IL8 A;  2QW7 A;  4A93 G;  4DR7 H;  2C9O A;  1WR2 A;  5CBE E;  4A3B B;  4ECY A;  4A3G G;  5I2Y A;  5CV4 A;  5DQG A;  1VQK A;  4A3D H;  4OIK A;  2YYZ A;  5EQ0 A;  4J6H A;  1Q8I A;  2JEI A;  1O7Z A;  1LTI D;  3MVV A;  2IP4 A;  2BQU A;  1PVO A;  1IL2 A;  2EY5 A;  2VZA A;  3I2Z A;  2LXK A;  4AYB G;  1Y1W A;  3T4A C;  2WIN B;  5CV5 A;  3U9S A;  3KLR A;  3QZ8 A;  4LF7 Q;  4J9N A;  2K75 A;  3Q8P B;  1H9J A;  2XWB B;  3IAY A;  5G3L F;  4NDX A;  2DPI A;  4JV0 A;  1K3R A;  4GC7 A;  4CKC A;  3A8K E;  1CTM A;  5KFW A;  2F0L A;  5JJI A;  2MQH A;  5GAG C;  5D65 A;  2I87 A;  2F0E A;  3S24 A;  4BY1 B;  5FJ8 H;  1TY2 A;  1BKB A;  4IQZ A;  4PV1 C;  1S40 A;  3OOC A;  1VQ4 A;  3OPO A;  5BR8 H;  3H4D A;  4XIG S;  4UP7 A;  2QKI C;  4ZYS A;  1YIT A;  4U7C A;  4KN4 C;  1XNR Q;  4K8I A;  5C4Z A;  3L9A X;  1C9O A;  4JI3 L;  3N52 A;  1WCM G;  4NB3 A;  2E2H B;  1SEB D;  2DNE A;  2BR0 A;  1YNJ D;  3JAM L;  4DV6 Q;  1BCP D;  1DOL A;  5D1O A;  1QNU A;  3M7N A;  3NEM A;  4AQY H;  3W5O A; 
#chains in the Genus database with same CATH homology
 3G4S A;  1YHB A;  2Q2H A;  5C4J H;  1N8R C;  2R93 H;  2UUA Q;  1A0I A;  2DGY A;  1OXX K;  4A3M G;  1FL0 A;  1VQP A;  1I3Q H;  3PUY A;  4DAY B;  1R9T H;  1N36 L;  1FJG L;  3HOX H;  3EBE A;  3TRE A;  5GAH C;  1SRU A;  1UEB A;  1KQS A;  4QIW E;  3OTO L;  4HID A;  2JA5 G;  2EQS A;  1M1K C;  1EIF A;  4JI5 L;  3CW2 C;  2WB1 G;  1CSQ A;  1KL9 A;  2VQF Q;  1KHI A;  4PG3 A;  4IFD I;  1ASY A;  2Q2I A;  1YI2 A;  3BZK A;  3U50 C;  1VQ9 A;  5C0X G;  2N49 A;  4O0A A;  3KDF B;  1AE2 A;  3BJU A;  1JB7 A;  3MXN B;  1C0A A;  4LFC Q;  4L5S A;  2JJQ A;  4R4Q A;  3S14 H;  3HKS A;  4DV0 L;  2H5X A;  4BXX H;  1HZ9 A;  3K7U C;  2OQK A;  4RG1 A;  4XTC S;  1AH9 A;  4B3T L;  1U5K A;  2CCZ A;  1X6O A;  2ZTD A;  1VQG A;  2EXD A;  5AJ3 Q;  1HZB A;  3F2C A;  1Q1B A;  3K81 C;  1OXV A;  4JC0 A;  4X64 Q;  4B3M L;  4NPS A;  4QJF A;  1W2B A;  1HNZ Q;  4YY3 Q;  4TQU S;  3AYH B;  1TWF H;  1VCI A;  2MO1 A;  2N3S A;  3GTL H;  2UXC L;  1BBW A;  3PO3 G;  3TRZ A;  5C0X J;  3G71 A;  3PCO B;  2Z0S A;  1IBL Q;  2R7F A;  5IYB G;  3PO3 H;  2B63 G;  3BZC A;  4R4T A;  3CCU A;  1VQ8 A;  4LUV A;  3JC6 6;  1NTG A;  4LUO A;  4Y7N H;  1XNQ Q;  1NMG A;  1SMX A;  3DLL A;  3CCV A;  2UXD L;  4DR7 Q;  1IBM L;  4OWT B;  4H02 A;  1DGS A;  3CC2 A;  5C44 G;  3RNU A;  4LFA L;  5JJK A;  1L0W A;  2ALY B;  4DUZ L;  4DR2 Q;  4BY1 G;  1QZH A;  2IX0 A;  4A3I G;  1YHQ A;  3GTM H;  3H3V I;  1HNW L;  1UE6 A;  5IP7 G;  1X56 A;  4GLV B;  2AHO B;  4X62 Q;  3CXC A;  1VQ6 A;  4OWW B;  1KXL A;  4A3K H;  2ZTC A;  5IP9 G;  5C4X H;  1A8V A;  3KFU A;  3AFQ A;  4JI4 L;  1PH4 A;  1OXU A;  2HIX A;  1VQO A;  2JA8 H;  3PIO A;  1B8A A;  2PI2 A;  2Y0S G;  2NZO A;  2MFI A;  3HKZ G;  4DKA C;  4DUY Q;  2VNU D;  4JI0 L;  1SN8 A;  3RN5 A;  4DR3 Q;  2ZJP A;  3AQQ A;  3A5Z B;  2ATW A;  2K5N A;  4HIO A;  4JI8 L;  4DV6 L;  1YJ9 A;  3ICE A;  2E2I H;  1TXY A;  2PMZ E;  1N9W A;  1YBY A;  5M3M H;  2K5V A;  2ASB A;  5JEA G;  3CCS A;  2QEX A;  3UDX A;  4A3F H;  4OO1 I;  1KRT A;  2R7Z H;  3UE0 A;  1CUK A;  2YTY A;  1PV4 A;  1KIX A;  2BA1 A;  2K14 A;  2R7Z G;  1HR0 L;  4YHH L;  2LXJ A;  2CFM A;  1VQB A;  4C3J H;  3PSI A;  4GOP C;  3HOZ H;  2ID0 A;  3H15 A;  1YVC A;  3TEH B;  2Q2U A;  1YJW A;  2F4V Q;  1YNX A;  3AFP A;  1JJ2 A;  3S1N H;  1UE5 A;  3M9B A;  3M85 A;  3F2B A;  4YWL A;  5JEA J;  4DV2 L;  1I5F A;  5C3E G;  4LFC L;  1Y1V G;  1PH5 A;  1YHA A;  4UP8 A;  4JI1 L;  4DV0 Q;  5ELO A;  1T9H A;  4GNX B;  3PV0 A;  2VUM G;  3U58 A;  4ALP A;  3PGZ A;  5AJ3 L;  3CMA A;  2A8V A;  2ZM6 L;  4DR5 Q;  3HOW H;  4PZ8 A;  4OX9 Q;  4KHZ A;  5EAY A;  2K52 A;  2VL6 A;  2D0P A;  1N34 Q;  3E9H A;  4GS3 A;  3JAM i;  4AQY L;  2R6G A;  4X6A H;  4A3J G;  2OCE A;  1L1O B;  1VQM A;  3GD7 A;  1K8A C;  3OW2 A;  1JMC A;  2R93 G;  2MNA A;  1IBL L;  1B7Y B;  4JYA Q;  2KCT A;  2R7D A;  1QVC A;  3FKI H;  5LMU Q;  2HT1 A;  4BA2 I;  2N8N A;  3F1Z A;  4DV3 L;  4A3D G;  4JV5 Q;  2IHE A;  3LGJ A;  4QY7 A;  4KHP L;  1ASZ A;  3KF8 B;  4APV A;  2GN5 A;  3GTG H;  1JT8 A;  4IPC A;  1XMQ L;  4DR7 L;  1A62 A;  1B70 B;  3HOU H;  5IYC G;  1VQN A;  1WFQ A;  4DR2 L;  3I4N G;  1GO3 E;  4A3L H;  3RN2 A;  1HNW Q;  1HZA A;  4PZ6 A;  1Q81 C;  1V1Q A;  4A93 H;  1E1O A;  2A1A A;  2E8G A;  3I7F A;  2GVB A;  4JI2 L;  4DPG A;  3HOY G;  1KRS A;  1W3S A;  4A3G H;  4JI4 Q;  3OYY A;  3H0G G;  1Q7Y C;  2NVQ H;  3A0J A;  3GO5 A;  1G6P A;  1PH1 A;  1BBU A;  3S16 H;  2CKZ B;  1GVP A;  3PUV A;  3B6Y A;  4KI0 A;  1OTC A;  4DV5 Q;  4JI0 Q;  4GN3 B;  1XPR A;  1VQJ A;  1XNR L;  3PF5 A;  1JE5 A;  3KYH C;  1PA6 A;  1NBW A;  1XJV A;  5HY6 A;  4LFB L;  3ULL A;  4JI8 Q;  4B3R L;  1NE3 A;  1L2F A;  5LMN L;  4DR6 L;  4JI6 L;  1IBK Q;  2JA7 G;  4DR4 Q;  1X3E A;  3J81 c;  1K73 C;  3K0X A;  4GKJ Q;  4JBW A;  1XPU A;  1V9P A;  3W1B A;  2LSS A;  2HQL A;  1HNX Q;  4IPG A;  4MZ9 A;  3KF6 A;  4IFD G;  3K8A A;  2RCN A;  5C44 H;  3RR5 A;  4POF A;  4YHH Q;  5GQO A;  1EIY B;  3OTO Q;  4ME3 A;  2YV5 A;  5H1S E;  4YCU A;  3VDY A;  1K83 H;  5IY0 A;  2PI2 E;  2VQF L;  1LTL A;  1V43 A;  4NXM Q;  1UE7 A;  4DR1 Q;  4AYB E;  3J81 i;  4GOP A;  2IY5 B;  4HJ5 A;  3U4V A;  3F8T A;  1E1T A;  1WYD A;  1EFW A;  3WWV A;  3MEF A;  3GTJ H;  3UDF A;  2CWP A;  3I4O A;  2I0Q A;  2R92 H;  2JE6 I;  4QQB X;  2UXB L;  4B3T Q;  1CKN A;  1SLJ A;  2K50 A;  2VW9 A;  1KD1 C;  1QVG A;  4DV7 Q;  4A3J H;  2KCM A;  4HJ7 A;  3CC4 A;  4DR5 L;  1EQR A;  1G29 1;  4LUZ A;  3Q8D A;  4BA1 I;  1N34 L;  4OXP A;  4X64 L;  1XMO L;  1TWH H;  1VQL A;  4YCW A;  4DV1 Q;  3M3Y H;  5C0X I;  1X3F A;  1VQF A;  4JYA L;  3J7A 5;  4L5Q A;  1HH2 P;  1VQA A;  1PH7 A;  1QUQ A;  4HJ8 A;  1NJI C;  2D62 A;  5LMU L;  3K7A H;  4NXN L;  4HIK A;  3T1Y Q;  1MKH A;  1J5E L;  2GVA A;  3CME A;  2RF4 A;  3GTP H;  4IJH A;  3J80 c;  2HHH Q;  1GD7 A;  4BXX G;  4KHP Q;  1H95 A;  4YWM A;  3HOV H;  2JQO A;  2B3G A;  1MIU A;  3TS0 A;  1PYB A;  1XNQ L;  1VS0 A;  2YTX A;  1K8G A;  1X65 A;  4A4I A;  1XPO A;  4GNX A;  1NY4 A;  4IPH A;  1EQQ A;  3RLF A;  5M3F G;  4DUZ Q;  4BY7 H;  4GLX A;  2BH2 A;  1I50 H;  5M5W H;  1E3P A;  3NEN A;  5M5X H;  4JI7 L;  4X62 L;  4J15 A;  4IFD J;  5FJ8 G;  3M4O H;  3J80 i;  3S15 H;  3CCM A;  3J7Z C;  3GDE A;  3ULP A;  4P74 A;  4BBS H;  2ES2 A;  3M4P A;  4DV5 L;  3CD6 A;  2A19 A;  4LF5 Q;  1UWV A;  4OON A;  2MO0 A;  4DUY L;  4A3I H;  3D0F A;  1QVF A;  3UDG A;  4LFB Q;  3S1R H;  4IJL A;  5IWA L;  5BR8 L;  2UUB Q;  4B3R Q;  4C3H H;  4L5T A;  2I5H A;  2OWO A;  1SE8 A;  4P71 A;  5LMN Q;  3CCL A;  4DR6 Q;  5C4X G;  4DR4 L;  4LF8 Q;  5DLQ E;  4GKJ L;  4UPA A;  2JA8 G;  4YCV A;  5IT9 c;  1YIJ A;  2UUC Q;  4LF7 L;  4IO9 A;  1HNX L;  2L15 A;  2YTV A;  1Q1E A;  1X54 A;  2AWO A;  3HFZ B;  5FLM G;  1TWC H;  2JA7 H;  1P16 A;  2DUD A;  2KHJ A;  4DK3 C;  4LF4 L;  4C2M H;  3GTQ H;  1FGU A;  3HOZ G;  2Z6K A;  3J81 j;  1HR0 Q;  4BY1 H;  4LWC A;  1SR3 A;  4DK6 C;  4HJA A;  3KDF A;  4RMF A;  4LF6 L;  4K0K L;  4DR1 L;  3L7Z C;  1WCM H;  2F4V L;  4LF9 Q;  4R4C A;  1TWG H;  1SFO H;  4UY8 C;  4DV2 Q;  2XTI A;  1Q12 A;  4A3M H;  4DV4 L;  3D31 A;  2VQE Q;  2VUM H;  4JI1 Q;  4EQ5 A;  2UXB Q;  1D7Q A;  3S2H H;  3CPW A;  4DV7 L;  4JBK A;  1GM5 A;  1IZ6 A;  2I5M X;  1Q46 A;  1VQD A;  3ER0 A;  4Y52 H;  3KF6 B;  1XMO Q;  3GTK H;  2ZM6 Q;  3FP9 A;  1IXR A;  3A74 A;  3KJP A;  3CCE A;  4DV1 L;  1Q86 C;  3T1H Q;  4HJ9 A;  2NVX H;  1E24 A;  4OWX B;  2FXQ A;  3K80 C;  1PH3 A;  1S3O A;  1LM0 A;  1VQC A;  1PHJ A;  3W1G A;  2UUA L;  3GTO H;  4P75 A;  1Y1V H;  4B3S L;  2HHH L;  1EOV A;  3ULJ A;  1L1O A;  3PF4 A;  1FJG Q;  1N32 L;  3CPF A;  3KLW A;  4JOI A;  2ZJR A;  4A3C H;  4A3B H;  2Y0S E;  2D0O A;  2IHF A;  1Q8K A;  3U4Z A;  4YWK A;  3CCR A;  1Y1W G;  4JI5 Q;  4FDB A;  1MJC A;  1XMQ Q;  3HOX G;  2PNH A;  1OXT A;  1PH6 A;  1Y1W H;  3A5U A;  2JA5 H;  4DNI A;  4X65 Q;  3H0G H;  3I4M G;  4JI7 Q;  4JBM A;  2JA9 A;  5IYB H;  3PO2 G;  1EWI A;  1SRO A;  4JI2 Q;  4HIM A;  4IOA A;  5IP9 H;  4R4O A;  3UDI A;  3CP0 A;  1RL2 A;  4GOP B;  3PO2 H;  1LUZ A;  3L0O A;  1VQH A;  3PUW A;  3TS2 A;  1Z9F A;  2CQO A;  4R4I A;  5GAD C;  5IYC H;  2OTL A;  2B63 H;  1WI5 A;  4JOI C;  4DAM A;  2JA6 H;  3I4N H;  5IE8 A;  1VQE A;  3RLN A;  4YY3 L;  1OXS C;  1VQI A;  4MTN A;  1HJP A;  3HOU G;  2F52 A;  2I5L X;  2OTJ A;  5IYD H;  4C3I H;  3DM3 A;  1Z47 A;  2KBN A;  2WP8 J;  2UUC L;  4JI6 Q;  2AKW B;  1WOC A;  3HOY H;  4GKK Q;  4A3F G;  3SGI A;  2E2J H;  1M90 C;  3E0E A;  5FLX c;  4P73 A;  4A3E H;  1X55 A;  2ZJQ A;  4X66 Q;  1I94 L;  3S1Q H;  2UXD Q;  4EX5 A;  3AEV A;  4BBR H;  1I6H H;  2K4K A;  4AIM A;  3KOJ A;  4LFA Q;  2QGQ A;  1TWA H;  2KEN A;  3RLO A;  2UU9 Q;  1CKO A;  4WJ3 M;  4PZ7 A;  3KJO A;  3UE1 A;  4GNX C;  2E2H H;  4LF6 Q;  4K0K Q;  3S1M H;  4A76 A;  3G6E A;  3IRB A;  4NXM L;  3H3V H;  2E5L L;  1P8L A;  1QZG A;  1N33 L;  1AE3 A;  4BBS G;  1A63 A;  2B29 A;  3I56 A;  1E7Z A;  3E9I A;  5ELN A;  5M3M G;  5M5Y H;  2EIF A;  2WB1 E;  4JBJ A;  2VQE L;  2Q2T A;  3I55 A;  3STB D;  1RIP A;  2WFW A;  1O7I A;  3EN2 A;  5HGQ A;  4DR3 L;  2V1C C;  2C35 B;  3CQZ H;  4QGU A;  4JI3 Q;  3G48 A;  4GN4 B;  4JCV E;  1FVI A;  2JEA I;  1HZC A;  4MNO A;  3HOW G;  3T1H L;  3RZO H;  1CKN B;  3BU2 A;  3I4M H;  5GAE C;  1S72 A;  4LW1 A;  4IPD A;  2BH8 A;  3TQY A;  4A3B G;  3ERS X;  2PQA B;  2R92 G;  2IX1 A;  5K36 G;  4B3S Q;  1D8L A;  1N32 Q;  3FKI G;  3T1Y L;  1J5E Q;  4NXN Q;  3S17 H;  1L1O C;  4AH6 A;  5LMN W;  1JJC B;  1YEZ A;  3JAM c;  3RZD H;  4KLK A;  1N36 Q;  3CC7 A;  4TVA B;  4UP9 A;  5M3F H;  2RHQ B;  2WAQ E;  5E7N A;  1VQ7 A;  4OO1 G;  2VS1 A;  3PUX A;  1NMF A;  4A3C G;  3STB C;  1YJN A;  1IYJ B;  4X65 L;  4IOC A;  1X9N A;  4A3L G;  5GRO A;  1J6Q A;  2CWA A;  3PUZ A;  4A93 G;  2JA6 G;  4GN5 A;  3ZJY C;  3L2P A;  4A3G G;  5C3E H;  4A3K G;  3HKZ E;  5J3B A;  1VQK A;  2ZTE A;  4A3D H;  2YYZ A;  3M4Q A;  2N78 A;  3CCJ A;  4OX9 L;  4BY7 G;  4LF5 L;  4B3M Q;  2F3I A;  1X3G A;  4AQY Q;  1G51 A;  2XGT A;  2QA4 A;  1PH9 A;  3S2D H;  1IL2 A;  4A75 A;  1HNZ L;  3CF5 A;  1CSP A;  1PVO A;  1MJE A;  2VZA A;  3I2Z A;  4WJ4 A;  5BR8 Q;  1KAW A;  5IWA Q;  2LXK A;  1LYL A;  2UUB L;  2UXC Q;  2IT1 A;  4AYB G;  2JK8 A;  4JG2 A;  2RHS B;  5FLM H;  4LF8 L;  4GLA C;  4DV3 Q;  4JV5 L;  4GKK L;  1BVS A;  3EIV A;  4LF7 Q;  1E22 A;  2K75 A;  3HOV G;  1VQ5 A;  2NVT H;  4L5R C;  4X66 L;  1I94 Q;  4R1J A;  2BA0 A;  4LNQ A;  1K3R A;  1YZ6 A;  1C7Y A;  2NVY H;  1EYG A;  4LF4 Q;  1CKM A;  1XTD A;  2JEB I;  1IBM Q;  2UU9 L;  5JJI A;  2MQH A;  5GAG C;  1Y14 B;  1UE1 A;  4A3E G;  2OQ0 A;  3CAM A;  1PFS A;  2HIV A;  2VY3 A;  4BBR G;  1GKH A;  1K0R A;  2KHI A;  3S24 A;  4POG A;  2K5H A;  3PIP A;  5FJ8 H;  2E5L Q;  2NN6 I;  3NBH B;  1N33 Q;  1BKB A;  1S40 A;  1PH2 A;  4LF9 L;  1PH8 A;  1JJG A;  2NZH A;  4DV4 Q;  1EUJ A;  1VQ4 A;  5IP7 H;  4XIG S;  1QUQ B;  2WAQ G;  4O2D A;  2YU9 H;  4UP7 A;  1YIT A;  3NEL A;  4QL5 A;  1PYS B;  1Q82 C;  2AWN A;  1KC8 C;  1K9M C;  1XNR Q;  5IYD G;  1C9O A;  4JI3 L;  3FHW A;  1U0L A;  4P72 A;  1WCM G;  1WJJ A;  4NB3 A;  3CCQ A;  2Z6K C;  2NN6 G;  2PQA A;  1HR0 W;  4DV6 Q;  1IBK L;  2AMC B;  5JJL A;  4PMW A;  3NEM A;  3M7N A;  3F2D A;  3W5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...