5C4XG

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4xG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c4xG01
1Y1VH 2N78A 4H02A 1KIXA 3CC2A 2OQ0A 2HHHQ 1HR0Q 1OXVA 2H5XA 2NVTH 3H3VH 1XJVA 2R7ZH 4A3LH 3STBC 4A3JH 3GTMH 5ELNA 1QZGA 5JJLA 4GN4B 2WB1G 4C3HH 1P8LA 1IBMQ 3HKSA 3JAMi 1EYGA 4JI3Q 5M3MG 2RHSB 3K80C 2YV5A 3U50C 1SE8A 1PVOA 1XPOA 1VQDA 1KRSA 2OCEA 4QL5A 2R93G 2KHJA 1XMQQ 2PMZE 2QA4A 4LNQA 1BBUA 1QUQB 3OTOL 2ATWA 2NN6G 4PZ6A 1SROA 4OONA 1EFWA 2UXDL 4DAYB 1M1KC 1HH2P 3F2CA 1VQCA 3GTGH 4JOIC 1OXUA 2ZJQA 1WOCA 1A63A 2NVYH 2R93H 2GN5A 4XIGS 1Q82C 2UUAL 4POGA 4OX9Q 1SRUA 1QUQA 1PH6A 1GVPA 4YWKA 3AEVA 2IT1A 4P75A 3J81i 1NJIC 2MFIA 1UWVA 2NN6I 4GN3B 1LTLA 4O2DA 4DV4L 3S1NH 5M3FG 4JI7Q 4B3RL 1D7QA 2CWAA 4MTNA 4JBWA 4QIWE 5IP7H 3T1HL 1T9HA 2F3IA 1YZ6A 1HNWQ 1SN8A 3M4QA 3PGZA 1WCMH 1VQNA 2FXQA 4NB3A 3ULPA 5IYDG 4DUYQ 4GNXA 4DV7L 1PA6A 2NVQH 1KC8C 1VQAA 2JA7G 3KF8B 1NMFA 2AHOB 3HKZG 4DAMA 3K7AH 2IX1A 1IBKQ 4POFA 3W1BA 2PI2A 1VQIA 1FVIA 5GQOA 4C3IH 4GNXB 1QVGA 3K0XA 4IOCA 5FJ8G 2HIVA 1YIJA 2VUMG 2UUCL 1K8GA 3PO2G 3KF6B 1IYJB 4UP9A 2BH8A 1G6PA 1K0RA 2JA6H 5LMNQ 5C4XH 4DV0L 3E0EA 2CCZA 4BBSH 4GNXC 3NELA 2WFWA 1Q86C 4BXXH 2ZM6Q 2PI2E 2KENA 4X65Q 3CXCA 2UUBL 4LFAL 4JI8L 1KXLA 1B8AA 4HJ8A 1N36Q 1OXXK 4JC0A 4DR7Q 4KHPL 1WI5A 5E7NA 5FLMG 2Q2IA 3J81c 2EIFA 1RL2A 2AKWB 5IYCG 1IBLL 1WFQA 4OXPA 4X62Q 1XNRQ 3B6YA 4BXXG 3AFQA 4A93G 3CPWA 2K50A 1I94L 3CC4A 5C4XG 2F4VL 2IHEA 3I2ZA 3UDGA 4IPHA 4JI6L 4DR5Q 1A62A 5C44G 3D31A 1TWAH 2IY5B 3BU2A 1VQOA 2CFMA 4A3BG 5JEAG 1UE1A 3HOUH 1P16A 1U0LA 1HZ9A 2ZTCA 4LF5L 3RN5A 1AE3A 5IYBG 1VQGA 2NZOA 5C4JH 1XTDA 2CWPA 1OXSC 5C0XI 4AQYQ 1YHQA 1VCIA 2B29A 2A8VA 4WJ3M 2Q2UA 2PNHA 5IY0A 4YHHL 1VQ5A 1X3FA 4A3IH 1PH3A 4A3GG 4TQUS 1XMOL 3S14H 3J7ZC 3CMAA 2VQFQ 2UXCL 3S2DH 1L1OC 4A3MG 1J5EL 1XPRA 3ER0A 4DV2L 1EQRA 4X64Q 1YHAA 1X65A 1Q8KA 4GOPA 1HJPA 4LUOA 4RMFA 2N8NA 2ZTDA 3EN2A 1CSPA 4YY3Q 4DK3C 1KQSA 1EQQA 2B3GA 4DV0Q 3L7ZC 3PIPA 3G6EA 1X3GA 4DV3L 4NXNQ 2BH2A 1L1OB 3U4VA 1AE2A 4DKAC 5M5WH 3HOVH 3DLLA 3H3VI 4JI2L 1QVFA 2R7FA 4PZ8A 2ES2A 2CQOA 1K3RA 1AH9A 3CCJA 1KL9A 4LF7L 5C44H 1VQ9A 1I50H 3PUYA 1GM5A 1LYLA 3T1HQ 3BJUA 4C3JH 1WCMG 5IT9c 4BY7H 1XPUA 4LWCA 2I5HA 2WAQE 1L0WA 5IP7G 4OWWB 5JJIA 4B3TQ 4R4QA 5M3FH 5GAEC 3H0GG 3RNUA 5GROA 5IYCH 1PH8A 4BBSG 4YCWA 3OW2A 3H15A 2JQOA 1PH2A 4BY7G 4L5QA 2K4KA 4DR4Q 4DR2L 4A3GH 4AIMA 4DNIA 1N33Q 1LUZA 1C0AA 4DV4Q 4A3FH 1BVSA 5AJ3L 3PUXA 1NMGA 4YCVA 4YWMA 4DV7Q 3CW2C 4DR6L 4JV5L 4UY8C 3F2DA 2F4VQ 1OTCA 3A5UA 2MQHA 4DV5Q 3I4MH 4UP8A 1TWCH 4HJ5A 1HNZL 4LUZA 5ELOA 1VQMA 1HNXL 4LFAQ 1YI2A 3M85A 1GD7A 4B3RQ 5IYDH 4GLXA 2WP8J 3RN2A 3A5ZB 5J3BA 3KFUA 4JYAL 1N9WA 3S2HH 3RZDH 4HIOA 2JA7H 3GDEA 2VZAA 1K83H 4EQ5A 2UXDQ 3BZKA 1X55A 1I3QH 2E5LL 1U5KA 3KOJA 1Z47A 1NE3A 4JBKA 2KCTA 4TVAB 3CAMA 3CCRA 1NTGA 5M5XH 1TXYA 2L15A 4JG2A 2K5NA 1FL0A 1L2FA 4LW1A 1IBML 2ASBA 1V1QA 2RF4A 3CCEA 4AH6A 3PV0A 4LFCL 3RR5A 4X65L 5FLXc 2V1CC 1W2BA 4B3ML 3PO3G 5IYBH 1E24A 2PQAB 4QY7A 4XTCS 1VQHA 1V9PA 2AMCB 4KHPQ 5K36G 1E7ZA 1KHIA 1MIUA 2D0PA 2YYZA 1XMQL 1SMXA 5GAGC 1B70B 4A3KH 2ALYB 4DR1Q 1JB7A 3HOZH 4JI0Q 4Y52H 3PCOB 1MJEA 3M9BA 1BKBA 2JEBI 2YTXA 3KLWA 3CCVA 3STBD 4X66Q 3MEFA 1YJ9A 3FP9A 3FKIH 2LXJA 2C35B 2UUAQ 1C9OA 1Y14B 3T1YL 1PH1A 4PG3A 1EIYB 4NXMQ 1X9NA 2RCNA 2DUDA 4MNOA 3M4OH 1SR3A 4IPGA 3HOXH 4GS3A 5IP9G 3ICEA 1Q46A 1Q1BA 3H0GH 1VQJA 1KRTA 1FGUA 3CCQA 3JC66 3VDYA 3PF5A 1E1TA 2MO1A 4LF6L 4JV5Q 2XGTA 2JA8H 3G4SA 1K8AC 2YTVA 4YHHQ 3PUWA 3CQZH 1FJGL 3GTOH 4HJAA 3MXNB 4DR5L 4NXNL 4DV3Q 1HR0W 1L1OA 4JI1L 3CCUA 4DR3L 5C3EG 5LMUQ 4GLAC 4LF8L 5IWAQ 1VQKA 3HOVG 2DGYA 2A19A 4BA1I 5C0XJ 1PFSA 2D0OA 2F52A 3K7UC 2EQSA 1C7YA 2MNAA 2HQLA 3PUZA 4B3SQ 4R4TA 1K73C 2NZHA 4JI2Q 2VQFL 1KD1C 4OO1G 1CKNA 4L5SA 3ZJYC 4HIKA 1VQEA 3K81C 3J80i 3UE0A 2GVBA 4A3CG 1KAWA 4IOAA 1Q12A 3K8AA 4A93H 2JA5H 3IRBA 1GKHA 4DUZQ 4JI8Q 1SFOH 1PV4A 5IP9H 4AQYL 2Z0SA 1JE5A 1VS0A 3F8TA 4JBJA 4IPDA 1H95A 1EIFA 1V43A 2Z6KA 5BR8L 4A3IG 4GKJL 4LFBL 4FDBA 3PSIA 3G71A 3CPFA 1QZHA 4K0KQ 4AYBG 4ALPA 4LF9L 2LXKA 3BZCA 5C0XG 5JEAJ 3CMEA 2K5VA 3I4NH 3HFZB 4A3CH 3GO5A 4HIDA 1S72A 4APVA 1QVCA 4A75A 3EBEA 2VQEQ 4PZ7A 4LFCQ 2JJQA 1N34Q 3CCLA 1S3OA 5HGQA 2Q2TA 4IFDG 3I56A 3AYHB 3GD7A 1NY4A 3DM3A 1Z9FA 4KI0A 2Y0SG 1RIPA 1HZCA 2KBNA 3AFPA 4R4IA 4OWTB 4HIMA 4A3EH 4DV5L 4B3TL 3E9IA 3D0FA 1IL2A 4X66L 1IXRA 2R7ZG 3CCMA 1YITA 3T1YQ 1YHBA 3KDFB 3J81j 3PUVA 4GLVB 2OWOA 3HOYH 2UXCQ 1HNZQ 4QQBX 2QEXA 4HJ9A 1LM0A 1YEZA 1TWHH 1HNXQ 4DPGA 2E2HH 3CP0A 4QJFA 1N33L 2JA8G 1N8RC 1MKHA 4LUVA 4DV2Q 3A0JA 3U58A 5LMNW 2I5MX 1YVCA 3S1MH 3GTQH 4DR6Q 1Y1WG 4DK6C 3M3YH 2UU9Q 2AWOA 3GTLH 2B63H 5JJKA 4YY3L 2WB1E 5FJ8H 4GN5A 1K9MC 3HOWH 3CC7A 1BBWA 1JJGA 4A3BH 4DUZL 4HJ7A 5LMUL 2HIXA 1O7IA 3ERSX 4A3FG 2HHHL 1PH5A 4GKKQ 4DR1L 2I0QA 4DV6Q 4GKJQ 3S15H 3J80c 3GTPH 1E3PA 2N3SA 2WAQG 3S1QH 4K0KL 4IFDJ 3FHWA 3W1GA 2XTIA 2MO0A 4R4OA 1UE6A 1EOVA 4GOPB 2RHQB 2K14A 2E8GA 3NBHB 1I6HH 2OTLA 3TQYA 2Z6KC 4MZ9A 4IO9A 5FLMH 2D62A 4NXML 1M90C 2BA1A 1XNQL 4P72A 3M4PA 3KYHC 1Q81C 2JA9A 3HOYG 2K5HA 1VQPA 3F1ZA 2VUMH 1PYSB 2E5LQ 4LFBQ 2Y0SE 2AWNA 4PMWA 3KF6A 4LF9Q 4LF6Q 2R92G 2UXBL 4QGUA 3A74A 1CKNB 1EWIA 1FJGQ 4A3EG 5IE8A 4DR4L 1N32L 4RG1A 2JE6I 3HKZE 4C2MH 3HOUG 3M7NA 3AQQA 4JI7L 4LF4L 3GTJH 5M3MH 1VQ7A 2K52A 4KLKA 5IWAL 4P73A 4B3SL 1GO3E 1YNXA 4DV1Q 1X3EA 1EUJA 2EXDA 1WJJA 4A3MH 1HR0L 4JI0L 1I5FA 2IX0A 3TS0A 4L5RC 3CD6A 1TWGH 2K75A 4J15A 2NVXH 1UEBA 1Y1VG 4JI4L 4X6AH 2R7DA 4DR3Q 3PIOA 1J6QA 1VQ6A 1NBWA 1IZ6A 3E9HA 2VY3A 4DV6L 1CKMA 3KDFA 4KHZA 3FKIG 4X62L 4UP7A 1XNRL 1PYBA 3JAMc 4B3MQ 1Q1EA 1HNWL 2JA6G 4JCVE 2UU9L 4OX9L 1HZBA 4DUYL 4JOIA 5GADC 1YJNA 3RLNA 3KJPA 4A4IA 3HOWG 1PHJA 4BY1G 4GOPC 3SGIA 1VQBA 4YWLA 4P71A 2VQEL 3GTKH 3S16H 2R6GA 4EX5A 1JJCB 2VNUD 1N36L 4DR7L 2ZJPA 3TEHB 3UDFA 2R92H 2BA0A 2UXBQ 4R1JA 2KCMA 3I4OA 4LF8Q 4JI5L 3TS2A 2QGQA 2OTJA 4O0AA 3RLFA 1OXTA 2Q2HA 1Y1WH 1X54A 4OO1I 2YU9H 1CSQA 2PQAA 1VQ4A 1A0IA 3J7A5 1VQLA 4A3LG 1X6OA 4JI3L 3TRZA 4BA2I 1TWFH 3NEMA 1N34L 4JI1Q 3KJOA 3ULLA 5GAHC 1XNQQ 3HOXG 1DGSA 1Q7YC 1VQ8A 3PO2H 3S17H 2N49A 3PO3H 4A3DH 3OTOQ 3TREA 1UE5A 3I4MG 2A1AA 2ZTEA 3I7FA 4IPCA 4NPSA 2LSSA 5BR8Q 2E2JH 2JK8A 1XMOQ 1I94Q 2YTYA 4JI5Q 2ZM6L 4BY1H 1UE7A 2VS1A 3I4NG 5DLQE 1PH9A 2GVAA 1E1OA 5EAYA 3F2BA 3L2PA 3HOZG 3UDIA 1HZAA 4BBRG 4UPAA 3UE1A 4LF7Q 1IBKL 3CF5A 2HT1A 1WYDA 4R4CA 4A76A 2JEAI 2E2IH 1JMCA 4GKKL 5M5YH 4LF4Q 3LGJA 3WWVA 3EIVA 4IJLA 1A8VA 1YBYA 1CKOA 2ID0A 1IBLQ 3NENA 4AYBE 1R9TH 3I55A 5LMNL 3ULJA 4JI6Q 1W3SA 1JJ2A 1MJCA 3L0OA 1VQFA 4JBMA 4IFDI 2IHFA 4JI4Q 3RZOH 3W5OA 2UUBQ 1X56A 3Q8DA 4BBRH 3CCSA 4OWXB 4DR2Q 3S1RH 2JA5G 1E22A 1SLJA 2VL6A 1J5EQ 1ASZA 5AJ3Q 4YCUA 2CKZB 3S24A 4Y7NH 3RLOA 1JT8A 5HY6A 2VW9A 4A3KG 1ASYA 3G48A 4L5TA 2UUCQ 2I5LX 2OQKA 3OYYA 5C3EH 4DV1L 4A3DG 3PF4A 1PH4A 1N32Q 1YJWA 2B63G 4WJ4A 4IJHA 4P74A 1B7YB 1CUKA 1G291 1PH7A 4X64L 4A3JG 2KHIA 1S40A 3U4ZA 4JYAQ 1D8LA 2ZJRA 4LF5Q 3UDXA 5H1SE 1G51A 4ME3A
chains in the Genus database with same CATH superfamily
1KIXA 3CQZA 5KFQA 1OXVA 3HS0C 4A3LH 4A3JH 3H3VC 2PCFB 4GN4B 2R8GA 2GA4B 1E2ZA 2QKIC 2YS6A 3X3MA 1IBMQ 3HKSA 4JI3Q 5M3MG 4CBVA 3DWAA 2RHSB 1S10A 4DR4H 2YV5A 5C6AA 1JWUD 4QL5A 1LTTD 2OCEA 3BDCA 1XPOA 5FPOA 4HEDA 4DL3A 2PMZE 1BBUA 3AU7A 4OGQC 2UXDL 1EFWA 2P0AA 4ZQ3A 1LTAD 4DAYB 1M1KC 4F4XA 4JOIC 2HUGA 3GTOB 2RDJA 2ZJQA 1IW7D 5CORA 4FF1A 5I6YA 2NTTA 4XIGS 2UUAL 1UC8A 4DV4H 1WCMB 4YWKA 2ALZA 1YNND 3AEVA 3Q8PB 4F8MA 1TY2A 2KUMA 3J81i 4DV4L 1EZ6A 3BVZA 5CV9A 1CA5A 4DXFA 4JI7Q 1MD2D 2V4QA 2CWAA 3A56A 1HNWQ 1SE2A 2O03A 2F0OA 4WFN3 2FXQA 4NB3A 1F2ZA 3ULPA 5I9OA 1L0YB 3RD4A 2VQDA 2R8KA 4NXMH 2AHOB 2L55A 4C2MA 3QO2A 3K7AH 1FNWA 4F87A 4DV7H 4RAZA 4RCNA 1I6VC 2C2RA 3WO1A 1O75A 1HCZA 2WB1A 3A55A 1K8GA 2RKSA 1U4RA 1Y69U 1G6PA 3TZDA 2JA6H 3IG0A 5LMNQ 3MWEA 2X6LA 1RJPA 2R82A 4LF6H 3NELA 1XTCD 3CXCA 4HAEA 1LO5D 1N36Q 3TBIB 3J80L 1O7YA 5FLMG 1GUWA 2EIFA 1E0BA 1S68A 3H4BA 2QCPX 3H91A 4ZUIA 2IX3A 5DG8A 4OXPA 3R5HA 4N8FA 1VMCA 1CHPD 4KV6A 1A9XA 1H9RA 4IPHA 4XT1B 1UEAB 4ILWA 5C44G 5ISRA 3V2TA 2EY1A 2CFMA 3KBXA 4FXKC 4K5VA 4KD3A 1UE1A 3HOUH 1DIKA 2NVXA 2SDFA 3IAYA 5C4JH 4DUYH 1KDCA 3M4IA 1VCIA 2B29A 3BVMA 3M3YB 4DL7A 2Q2UA 2HCIA 1HQMC 1N33H 2XNAC 3NP8A 4OELB 4A3IH 3HKZA 4RNNA 2B2TC 3OMGA 2JA7A 1MSHA 3OHXC 3VYUA 2C5CA 3S2DH 1PMRA 4YIJA 3I70A 4M9UA 4HNTA 1ZETA 1KLGD 3PN1A 4KKTA 1TWFA 1EQRA 1RJTA 1SAPA 1EY8A 4X64Q 4GOPA 4AQYH 4S3SA 3MHBA 2RA4A 3D6CA 4MA5A 3TINA 3OSNA 2ZTDA 3EN2A 3ND9A 5J39A 4DK3C 2B3GA 3L7ZC 1W6KA 1SJHD 2D2CC 2BH2A 2WIIB 4IURA 5M9OA 3RZOB 3MEHA 3HOVH 1OO9B 5JUMA 3E6ZX 3BS1A 1OWTA 1K0SA 3RUZA 2ES2A 5M3FB 1H9SB 1VQ9A 1I50H 3PUYA 1GOZA 1J9OA 1LYLA 4C3JH 1WCMG 2Z9HA 4RB1A 1SCUB 5EZYF 2MCTA 3Q2OA 1JORA 5GAEC 5DNFA 2KQ3A 4YCWA 3D4RA 2VQFH 4R8UA 1PZKD 1N32H 1NCVA 4ZKBB 4A3GH 1TWGA 3N6XA 4QWEA 2R8JA 4YR2A 1BVSA 1V4YA 4C3IG 5KFWA 3G6JB 3RJ0A 4JV5L 2F4VQ 3H40A 3A5UA 5KKNB 4DNRB 1KJQA 4IALA 3VA5A 1TWCH 2EY6A 1HNZL 3G7LA 1JWMD 2OLSA 4LFAQ 1BNZA 5IYDH 2WYOA 4GLXA 4IUNA 1I7NA 3EPGA 3KFUA 4KN4C 1C8CA 3E5SA 4HIOA 2JA7H 1PTOH 3GV5B 3JZIA 1SYCA 3H94A 3N40P 1Z47A 2PW7A 3MZ5A 3Q1KA 5KNBA 4JBKA 2C2EA 4TVAB 2R93B 1QG7A 2PN1A 4X64H 1FL0A 4LW1A 1V1QA 5KT4A 1Q3LA 4ZLTF 4Q44A 3BG5A 5KFBA 4U673 4QY7A 1VQHA 2AMCB 2CW0C 3RMHA 5DGAA 1MIUA 2QW7A 1SMXA 2OF1A 3HOZH 3SE0A 2D9UA 1STBA 4EGQA 2YTXA 3KK7A 1I50A 5E3FA 3FP9A 2K5WA 3T4AC 1EIYB 3K58A 3KTMA 2XCLA 3EFXD 1SR3A 2WACA 4IPGA 2F0TA 3KALA 3MXNA 5LA6F 3MXPA 3N8DA 1Q46A 1ESRA 3VDYA 4X3KA 1FGUA 1CT1D 5I6WA 3PF5A 1E1TA 1KTKA 4LF6L 2XGTA 1RKNA 3ZYYX 4A3EB 1F2LA 1KABA 3G4SA 1K8AC 1KJ9A 2YTVA 3TN2A 3K5HA 4YP3A 1D5MC 4HJAA 4DV3Q 3OIQA 2EY2A 3HOXB 1WSCA 4YR3A 5LL6X 1JLLB 4EYHB 1VKZA 2KSWA 4FP5D 4LF8L 2C9OA 5IWAQ 3JAMW 5KFPA 1I3QB 4BA1I 1ONLA 2BCOA 1PFSA 1IBKH 3Q0AA 1IHZA 1ZHQA 2EQSA 2A6ED 4DXGA 5BPHA 5A2QL 4EQNA 3ZJYC 2MUYA 1RK5A 4A3CG 4IOAA 1M0WA 4DUZQ 1PV4A 3I4NB 3K7AB 4YJ2F 4JBJA 2K04A 1T3NA 5KFIA 1H95A 1EIFA 4U68A 5BR8L 2V5AA 4FDBA 1PRTC 2FPIB 5LL6b 2X6GA 4WBNF 2PO4A 1EEID 3FMCA 4HIDA 5CR3A 1I6HB 2VQEQ 4MN3A 1KJJA 4O4HF 5H80A 3GV7B 3RBEA 2W6ZA 1S3OA 3V6KA 2PVPA 1SE3A 4DR5H 3GD7A 1NY4A 4KI0A 2G9HD 2X69A 2Y0SG 1HZCA 4R4IA 4V190 4IR9A 2AGQA 2QILA 1HRJA 3KLSA 5KFYA 3IL8A 1IXRA 4N9PA 2R7ZG 2YYAA 3IFDA 2L5TA 1YHBA 3NHHA 3BZDB 5FO9B 3HOYH 2OWOA 4QQBX 1PZJD 5C4HA 4HJ9A 4B08A 1HNXQ 4QJFA 2I87A 1UUPA 3UFXB 5L1JA 4RHRA 4ME6A 3TSSA 1E4FT 2BR0A 2I5MX 5C3EB 1Y1WG 3QG1A 2UU9Q 4RUCA 2B63H 4LF4H 3FPUB 4A3BH 3KAKA 3N44B 1U9RA 4HJ7A 3SI8A 5LMUL 3S2DB 1Y8NB 1TR5A 1BCPD 2F0EA 4CHTB 4ED2A 1Y1VB 1PH5A 2K6AA 4ZCKA 2ZXRA 2I0QA 4GKJQ 2EYPA 3J80c 3S15H 1EIHA 3EPIA 5K2MA 2EYFA 5KFSA 2PNRC 2XTIA 2IJ0A 1UAPA 5KG4A 1EOVA 2DZDA 1SFOA 2K14A 3NWSA 3NBHB 3TQYA 3GTKB 2Z6KC 4IO9A 1L2ZA 4XYQA 2W7OA 2WKDA 1VAJA 3HOVB 1RJRA 3GIJA 5FLMH 3NUCA 3P1HA 2OEOA 1M90C 1G91A 1CI3M 3KYHC 2K5HA 4DFAA 2A6EC 1PYSB 4ULLA 2W8LA 3K3PA 5KT3A 3KF6A 4RAYA 4K8IA 4C5AA 4Y8VB 5DQIA 2K05A 1ICWA 2CH4A 2W9AA 2UUBH 1XMQH 3HKZE 3HOUG 1SSOA 4JI7L 3Q22A 3GTJH 5JJZA 1CZWA 2ASDA 1KDAA 5EPLA 1YNXA 4DV1Q 3HOZB 1DV1A 1HR0L 4KMUC 1I5FA 3X3NA 5CYUA 3TS0A 1TWGH 2NVXH 2EVBA 1HNXH 1EY0A 1EYAA 2V4RA 4JI2H 1NBWA 5HGTA 3KDFA 4C3IB 1WR2A 3MAQA 5F9LA 1SNPA 1SYEA 4Q45A 2UXBH 3V6HA 4HMIA 4B3MQ 1HFNA 2JA6G 4JCVE 4GZYC 1Z7TA 4A4IA 3HOWG 3J7YW 1HUNA 4GOPC 4J6HA 5D1OA 4YWLA 2VQEL 4P71A 2K7VA 5J1ZA 1TT2A 3MWDA 4H44C 4XYMB 3S16H 2RDIA 1N36L 1DJRD 2H1EA 4MTDA 1ILPA 2KCMA 3I4OA 4K6LA 3TS2A 1LTGD 2QGQA 2KEEA 4C56C 2Q8TA 2A69D 3S9WA 2YU9H 1IBLH 1SEIA 1RTNA 3VR6A 2PQAA 1VQ4A 4LSXA 4IRKA 3J7A5 1JXLA 4DA2A 3KHGA 2M00A 4C2MB 5C44B 1VMPA 3NEMA 5A2QW 3ULLA 1Y1WB 2W9CA 1DGSA 1Q7YC 3S17H 3PO3H 3GTOA 4WD3A 2WB1B 1AUXA 1UE5A 2ZDHA 3I4MG 4NPSA 2ZTEA 3I7FA 1G8ZD 4DLKA 2FE3A 1WCMA 2HVSA 2A68D 4HCEA 2ZM6L 3GIPA 5I2XA 4R8IA 1I4HA 2W70A 3PO3G 1STGA 4J9OA 1NAPA 4X3SA 1WTVA 5C3XA 4UPAA 4ZI7F 3CF5A 4KKUA 4R4CA 5DAUA 5M5YH 4LF4Q 5C1PA 3T5LA 4TQRA 5E4XA 3T5JA 5C0XH 2GPWA 4QMGA 1ENCA 2PMZA 4DV2H 1A8VA 1YBYA 3I72A 4CKBA 4JI6Q 5BMVF 1W3SA 1BCPF 3L0OA 2ZDGA 4JBMA 1UC9A 4JI4Q 3Q8DA 4BBRH 3CCSA 4OWXB 3S1RH 2N55A 2PW5A 4JPBW 4EBDA 2VL6A 1ASZA 4G7OC 1TWHB 1R9TB 1PK8A 4LF9H 3Q8SB 4A3KG 2EZVA 2ICEC 5C3EH 2EDGA 4KK7A 5DM63 1N34H 2L4NA 1C48A 2G5DA 5DG7A 1PH4A 5D1PA 4F88A 3AMUA 5JVH3 4K6DA 3EYYA 1B7YB 2BQ3A 4O3SA 3PQIA 2HQEA 3I90A 4A3JG 2KHIA 1D8LA 4LF5Q 3UDXA 4QWCA 2UVUA 4MIUA 5D3DA 5LXTF 1Y1VH 2RGVA 1HR0Q 5KFKA 2H5XA 3VYRA 2R7ZH 3QIAA 3RB3A 2DJFC 1QZGA 1K3BC 3KHRA 1SNMA 2PZTA 4I7HA 1EYGA 2Z8LA 1LT3D 3Q24A 1Z2PX 1UNSA 1VQDA 3VR5A 3KAJA 4DV0H 2QA4A 1DCZA 1QUQB 2NN6G 1SROA 4OONA 5ELBA 1GXDC 1HH2P 3GTGH 3SVMA 3D4WA 4IWXA 1GSOA 5L1IA 2WE6A 4QIWB 3VR3A 2HVQA 1LABA 4QW9A 2R7KA 2GN5A 5FD6A 1Q82C 4LFBH 4DL2A 1QNUA 4RGTA 4YB8B 2O5IC 3C1FA 2IT1A 3NBIA 2F0VA 3A8JE 4GN3B 1NJIC 4CC6A 1V1PA 3GTJB 4MTNA 3T1HL 1T9HA 5FLXL 3R2IA 3M4QA 3PGZA 5FOBB 4B3RH 3GTQA 3ORQA 2MPMA 1KC8C 3ND8A 4RFBA 3KF8B 2F4IA 3HBLA 3TIIA 1XYIA 4DAMA 4KY5A 2IX1A 4QUCA 1SYFA 3RGZA 1VQIA 5GQOA 4GNXB 1QVGA 3K5IA 4IOCA 4GC6A 2BE5D 2HCCA 2UUCL 2CW7A 4J9MA 2C2DA 2FJZA 2BH8A 2MP1A 5CC4A 4R7RA 2XWJB 4XDXA 1WTHA 1S5DD 5C4XH 2CCZA 4JVZA 4BBSH 4BXXH 1B33N 2KENA 2WV6D 3D3RA 4O3OA 4JC0A 4XXEA 1WI5A 5E7NA 5KG2A 5DG9A 4ECRA 1T94A 3SK4A 1EWHA 2XWBB 4Q0YA 4CC5A 3BABA 1JC7A 4BXXG 5IOCA 2K1BA 4A93G 1PFBA 2K50A 5C4XG 5EGTA 3UDGA 1T5XD 2E74C 3BU2A 4A3BG 1WD1A 4IRDA 5ELEA 1P16A 3N41B 5IYBG 2NZOA 5EPJA 1VBGA 1XTDA 5KT7A 4YR0A 1JWSD 3RUPA 4WJ3M 2UUCH 5IY0A 3DHQA 1PH3A 2WAQB 3QFFA 3N6RA 2NVQB 4A3GG 2H4OA 4UDUC 4Q0FA 2VQEH 1S5BD 3R23A 1BCPC 3T51B 1N36H 2VA2A 1S5FD 1FNVA 1WTQA 1NUCA 3EJIA 1BXRA 3W3AA 1DV2A 2N8NA 1D1KA 1N56A 5BN3A 1W93A 1EQVA 1BR9A 1HUMA 4PNYA 4DV0Q 1AUVA 4NXNQ 4C3JB 3U4VA 2R92A 4DKAC 1B9NA 3DLLA 4JI2L 3H3VI 3S1RB 3G8CA 2CQOA 2XC9A 3MC0B 1KJIA 5C44H 1GM5A 5KFAA 4J9NA 1GHKA 5IT9c 2Q8RE 1DZ1A 1E4EA 2R84A 2SOBA 4RAUC 4RH6A 1S5ED 1XPUA 4L8JA 2I5HA 3GTQB 4X65H 2J6SA 5IP7G 4OWWB 5JJIA 1WVLA 2OT2A 3R2TA 5GROA 4BBSG 1PH8A 4G7ZC 2J7ZA 2W57A 2F0MA 2LY7A 5DEHA 3PW5A 2EYMA 2JQOA 1FJGH 2FLNA 1A3VA 2KA7A 3DM1A 1ZKOA 4KD4A 4DV4Q 4LMQD 4IQZA 4A3FH 4DUZH 2YZNA 5M5YB 3S1QB 4YCVA 1HPCA 2GLTA 3Q8RB 3CW2C 2R86A 1K83A 2K5DA 2F0PA 1OTCA 3OSOA 2MQHA 2D5DA 4F4YA 1TWHA 3OMCA 4EGJA 2J6TA 4IZ8A 4KY6A 1VQMA 4JI4H 1ZQ7A 1GD7A 1B44D 2WP8J 1J8IA 4MA0A 4K2KA 4ETSA 4JYAL 3J81E 5JPNC 3RAQA 4J8QA 2A6HD 1K83H 2R8HA 3KOJA 1NE3A 1IKLA 1F77A 1SBBB 3CAMA 5DLGA 5M5XH 1TA8A 1TXYA 1NSNS 4DAVA 4UCUA 4K8JA 4QCLA 3NE5B 2ASBA 3CCEA 1ZYRD 4N9TA 3PV0A 4LFCL 3RR5A 3NTIA 1W2BA 4B3ML 2NU6B 4A93B 1U4LA 1E24A 4IFDH 1E7ZA 4DU9A 1KHIA 2YYZA 1XMQL 5KFNA 5GAGC 4Y52H 4DR1Q 1JB7A 3PCOB 1MJEA 3MR5A 2JEBI 2R7ZB 1B04A 3CCVA 4JI5H 4FBTA 4UCTA 3GTMB 4AYBA 1EFID 1YJ9A 4ED7A 1S97A 3TIGA 2LXJA 2B2UA 5LYJF 1CHQD 2I46A 2NTSA 3WOEA 4NXMQ 5KFCA 1MI2A 3RF2A 2JYOA 5JPMC 4GS3A 4DAYA 1SNOA 2KEDA 4O4LF 4O3QA 2YL2A 3JSLA 3CCQA 3F8NA 2MO1A 3GP7A 4I7AA 3BAAA 4X62H 1XNRH 2JA6B 4ECXA 3PW0A 1FJGL 3PUWA 3CQZH 5C4XB 1HR0W 4WORA 2F3VA 1IW7C 2CVRA 2KOLA 3W2DA 3GILA 4DGZA 1BDOA 3OW7A 1PTOB 3E3XA 1EUCB 5C0XJ 2KJXA 1JX4A 3F2UA 2D0OA 1HTLD 1E4EB 1SFOB 2MNAA 1JE4A 3PUZA 4HMJA 4HR7B 4F4WA 3EVQA 4JI2Q 3KXYT 4HIKA 3UE0A 1I4RA 4MV8A 4O3RA 1KAWA 4XQQA 2JEFA 2VA3A 4EBCA 3K8AA 3SDZA 1GKHA 2BQUA 2K28A 1JE5A 1VS0A 4B9XA 1IOWA 5DQHA 4Q8EA 4TUYF 2Z6KA 2HD3A 3GTPB 4GKJL 3R8BA 3G71A 4LF9L 4C1NK 4A3CH 3HFZB 1WTPA 3GO5A 1S72A 1EY4A 1XWEA 2BQRA 1ET6A 1N34Q 2V4DA 5HGQA 2F3WA 4IFDG 3I56A 3AYHB 1Z9FA 4A3EH 1RIPA 4JI5Q 4HIMA 4Q43A 4F7XA 4OWTB 2IBKA 3E9IA 3D0FA 4FNFA 1STAA 3QWNA 4X66L 2W8KA 4IZOA 3CCMA 3T1YQ 1C30A 3KDFB 3K0YA 3PUVA 2UXCQ 2FLPA 1HNZQ 4A2BA 3JRWA 1YEZA 4DPGA 3LX0A 4DV2Q 1PFMA 2AQ1B 2Q8IB 5C4ZA 2W6MA 5JVLA 5LMNW 1I4PA 4O3PA 4IUQA 3GTQH 4KKSA 3G6VA 3GTLH 2R7NA 1AP0A 4MV9A 5EWEA 5L1KA 1K9MC 3ETJA 3NTKA 4TRDA 2B39A 2BOSA 1VF7A 4OIKA 5IT9E 1BOSA 1SMYD 4J9LA 4DR1L 5JEAH 1DYQA 2F0GA 4KJOA 2WAQG 2I8CA 1WTRA 3FHWA 2MO0A 4R8UB 3C3LA 1UE6A 2VPSA 4GOPB 4RHSA 2RHQB 4NW2A 4MV3A 4IUUA 1DD2A 4FXDA 2P5ZX 4DK0A 1H9SA 3J80E 1TAEA 3RBDA 3RB6A 1B3QA 2A74C 2BA1A 4IUVA 5AFWA 1XNQL 3M4PA 2FK2A 3Q6SA 2FPPB 2ASJA 4LF5H 3HOYG 4PV1C 1B2TA 2XN9C 4WRDA 1VQPA 4LFBQ 2HDLA 2ZT9C 4C1NI 2Y0SE 2AWNA 4LF6Q 2R92G 2UXBL 4XZ3B 1JDBB 2NUAB 5LMNH 1EWIA 4G4KA 1N32L 4DR4L 4XT3B 1D1IA 4LJZC 3T53B 2Y0SA 3ORRA 2W6OA 5KRUA 1ZXTA 1PRTF 1VQ7A 2YU9A 1Q8IA 5DM73 4KLKA 2J9GA 5IWAL 1HFGA 5E4WC 2R61A 2CH4W 4R8NA 1LT4D 2DIKA 1YNJC 4L5RC 3CD6A 4J15A 2F0FA 2CW8A 2HHHH 1HR0H 4JI6H 4E4TA 4YQWA 2AGOA 1ICFB 5KFLA 4Q5VA 2W6PA 3DWPA 2VY3A 2QEJC 1NR2A 2Z4HA 3T5HA 1M6VA 2R87A 1JOKA 5DLFA 4ME5A 1S4ZA 4K14A 4ZYSA 4OX9L 1HZBA 4DUYL 5KFXA 1ET9A 2DNEA 3RLNA 1DONA 3TQ1A 1PHJA 4ECVA 2PBZA 2YW2A 3K6OA 3GTKH 4OIJA 4RUAA 2F0LA 1GHJA 4ECSA 1RCVD 2W7PA 1JJCB 2L12A 2VB2X 5CMDA 4B3MH 1V1PB 5C5LA 3UDFA 2ZJPA 2UXBQ 3K5OA 4R1JA 1HA6A 3QOLA 4JI5L 2OTJA 4HNVA 2FMAA 3RLFA 1EU4A 3GIDA 3GTMA 1OXTA 3T1YH 1X54A 4X3UA 4OO1I 1TY0A 4NP5A 1VQLA 5C5MA 4JI3L 2IP4A 1SMYC 4IN3A 4IUPA 1N34L 4JI1Q 3KJOA 2F0JA 2B2TA 4YBZB 5ELCA 1BO0A 3MXGA 3GIMA 2N88A 2L9HA 4M8AA 5KIXA 4QIWA 4A3MB 4IPCA 2NVTB 4L1KA 3V4ZA 3MWYW 4OHJA 2L11A 3U9OA 1I94Q 3K57A 1TS3A 4FF2A 2OH2A 3I4NG 3V4SA 4RB2C 3HOZG 3L2PA 2HT1A 1D5ZC 3JSNA 2JEAI 1SE4A 3C2PA 1EYCA 1MBYA 1JMCA 2UU9H 4CDCC 3LGJA 4HCSA 3WWVA 1KJ8A 5FO7B 4BBRB 2FK3A 3EIVA 4BY1B 3IKJA 4MTEA 1CKOA 3TQTA 3PR5B 1JOOA 3KLSX 1R9TH 5LMNL 4RNOA 1I4XA 2RSNA 1VQFA 5CV5A 4IFDI 2NVYB 4J9RA 3M7GA 5M5WB 2ATLA 1ML0D 1ILQA 3HOYB 1XXGA 3RZDB 2V59A 2R3ZA 2M9VA 1SNQA 4Y7NH 2JEGA 4APMA 1N48A 4BY7B 3G48A 1IKMA 4ZAIA 3CRLC 2NB0A 3GTLB 3K59A 3PF4A 1N32Q 2I80A 1HTPA 1KNEA 4IJHA 3TP6A 4L6TB 4ECTA 3BQ0A 3IFTA 5FO8B 3M9MB 4JYAQ 3RV4A 3U4ZA 5K36G 3J7AK 1G51A 1M0TA 4H02A 2TMPA 3PIO3 5KG6A 4EEYA 2EPBA 2HHHQ 2ZDQA 1XJVA 4RKLA 3STBC 1G2SA 3GTMH 4RB3C 5ELNA 5JJLA 2KECA 2C22A 1RJQA 1B3AA 3QB3A 1F9QA 2WB1G 3MR2A 3VPDA 3I4MB 4QUFA 4JV0A 3GTGB 1PTOC 2FINB 2CZGA 4EYIB 2C28A 3K80C 1HQRD 1RHPA 3U50C 1PVOA 2AQ2B 3E5NA 3DXJC 3FDTA 3LWUA 1XMQQ 4XYOA 3OTOL 3PW7A 4PZ6A 2JA8B 1WOCA 1A63A 5KEEA 1WH2A 1F9SA 4POGA 1GVPA 4DV3H 1GUGA 4LK1C 3OUUA 1TWAB 2MFIA 1UWVA 2NN6I 1LTLA 1H9MA 4O2DA 4B3RL 5GONF 3J7AV 2W9BA 4JBWA 4MAMA 4E6IA 2Z4IA 2F3IA 3OOCA 1RK6A 4MV6A 4B3TH 1WCMH 1Z6HA 1VQNA 1BGWA 5KFDA 5IYDG 3MR6A 4DUYQ 3CRKC 1PA6A 2G9DA 1VQAA 1Y1VA 3G6YA 2K5QA 1NMFA 3HKZG 5CBEE 1UNNC 1IBKQ 2PZUA 2SNMA 2PI2A 2FHTA 5EQ0A 4C3IH 3LP8A 5F9NA 5JAVA 5FJ8G 2HIVA 3Q23A 4A3JB 1R4PB 1M7JA 1MZBA 5DGBA 3KF6B 1X32A 3NPPA 1BJTA 4UP9A 1K0RA 3H09A 1EHIA 1IOVA 2VUMB 4DV0L 3E0EA 3R93A 1EUDB 1Q86C 2ZM6Q 4X65Q 4LFAL 2UUBL 3EA6A 4XYLB 5LMUH 1KXLA 4Q8FA 1B8AA 4ZOLF 3BQ1A 4HJ8A 1HNZH 4DR7Q 2UVVA 4KHPL 1LTID 2Q2IA 4HSPA 3DEOA 5CV4A 3J81c 1RL2A 2AKWB 5IYCG 1E4GT 1C4QA 3GQBA 4EGVA 1WFQA 1X3PA 3B6YA 4ODGA 2XIWA 3CPWA 1I94L 3CC4A 2YZMA 4J0MA 4DNTB 2F4VL 3I2ZA 4NXNH 4JI6L 1A62A 4A3IB 1DOMA 1VQOA 2E2HB 2M05A 4P2CB 5T1IA 2ASLA 4DV6H 1HZ9A 2ZTCA 3RN5A 1AE3A 3S1MB 5C0XI 2PPBC 4A3GB 4J9PA 2A8VA 4RKBA 4XQNA 3J7AF 2IPKD 4Z9CB 4YHHL 1VQ5A 2CW0D 5JQWA 4UCVA 2JP1A 4TQUS 1MSGA 3J7ZC 3CMAA 4B9WA 2VQFQ 2UXCL 1G6ZA 1L1OC 3K3VA 1C3OA 4DV2L 1BXTA 4TSSA 1X65A 4RGOS 1ZEQX 2F0QA 1HJPA 3I3CA 3V96A 1LTSD 3VMMA 1K8MA 4LFAH 1KQSA 3LWBA 4AYBB 1PZID 3PIPA 1YNNC 1QCBD 4DV3L 1L1OB 3UQ8A 4X3TA 5L1LA 1QVFA 2R7FA 1V1OA 4PZ8A 3GIIA 2W9CB 2XVSA 3ERQA 3PMFA 1TWAA 3CCJA 1TS2A 5KFVA 4QW8A 3EQLC 2NZ1D 4QWAA 4A3DB 2V58A 2WAQE 2EYJA 3GTPA 4A3FB 4R4QA 3VR4A 4CJ2C 3H0GG 3RNUA 2HDMA 2XGQA 1TU2B 2QDBA 2F0IA 3OW2A 3T5KA 1GJXA 5T1GA 3QOJA 1KLUD 4YHHH 5BPFA 1B4OA 2L0CA 4F50A 4AIMA 4DNIA 1N33Q 2PMZB 2R7MA 4TV9F 3NXWA 5D65A 2RVLA 5K36H 2JXMB 3L9AX 3PUXA 1NMGA 4HR7A 4YWMA 3KLRA 3V05A 4DR6L 4UY8C 3F2DA 4DR1H 1CZGA 3TZUA 3T56B 3I4MH 4UP8A 2UUAH 3OWEB 1EZ8A 2XCAA 4LUZA 5ELOA 3BA9A 1YI2A 4B3RQ 3RN2A 3BVGA 3VYSA 3A5ZB 4EFEA 2WINB 5J3BA 1A3UA 1N9WA 3KUPA 3RZDH 3GDEA 1M4VA 2VZAA 3PVXA 1X55A 1I3QH 4FF4A 3GV6A 4IRCA 5JVDF 3CU7A 2KCTA 3EROA 1RYRA 2F0WA 4G3IA 3HZXA 5KNDA 5KNCA 2HVRA 5EKIA 2DN8A 3URYA 1AN7A 4IAJA 1I50B 1S0MA 3GQCA 3MR3A 2R93A 1DOKA 1V9PA 3QR8A 1U4MA 1G2TA 1IYUA 1XX8A 1JQYD 1O7LA 4UCRA 3VR2A 2ALYB 3GTGA 1MGSA 4L63B 5CAEB 4HNUA 3L3OC 3SHLA 3TDQA 1BKBA 1JICA 3KLWA 1F2YA 3MEFA 4G57A 2F0HA 4FS2A 1S0OA 1B1ZA 3FKIH 4O2AF 2C35B 3BJYA 1Y14B 1PH1A 1LLRD 1X9NA 4MNOA 3P20A 3M4OH 2AQ3B 4JUZA 4KHPH 1ESFA 3HOXH 4HTHA 4FYDA 3ICEA 1Q1BA 1KRTA 3JC66 4RCOA 3BYYB 2B8GA 5KFMA 3KF8A 2JA8H 2CQAA 4EVOA 4ECUA 3MXNB 3PW2A 4MTKA 5KG1A 1L1OA 4JI1L 2CQYA 3CCUA 4LH6A 5KFZA 5LMUQ 2ZM6H 1PYWD 2JEJA 3I8ZA 4RZQA 3CKIB 5EDWA 4B3SQ 3U9TA 2BDNA 1GLVA 2VQFL 3GV3A 3OUZA 1TS4A 1VQEA 3J80i 3LWEA 3K5LA 2W71A 4CKEA 2GVBA 2TSSA 1A15A 3WO0A 4DK1A 5K5PA 1EYZA 1Q12A 4A93H 2JA5H 4G7HC 4JI8Q 4TV8F 3PO2B 4AQYL 2AQ4A 4JI7H 4IPDA 3J80W 1V43A 4O2BF 2BE5C 3HB9A 2YRWA 1CQFA 4AYBG 4ALPA 3BZCA 5C0XG 5JEAJ 3CMEA 3I4NH 2SCUB 5I2YA 4BWGB 3TMEA 1QVCA 4APVA 4PZ7A 3NK9A 4M7EA 3T1HH 2B2VA 3CCLA 5ELFA 1I6UA 1EY7A 2Q2TA 1FD7D 4CJ1B 1T5EA 4ED1A 5KFUA 4LSAA 1JIHA 4OL7A 1YITA 5EWFA 1CQJB 1N33L 2E2HH 4KHVA 5KT2A 2HJWA 1YVCA 3S1MH 4YJ3F 3RAXA 2C00A 4DR6Q 4DK6C 4UCSA 2AWOA 4YY3L 2WB1E 2R8IA 2F0KA 4GN5A 3NQTA 3S1NB 3CC7A 5CV8A 1QWYA 3R3OA 3K5NA 2WAQA 3H4DA 1RD9D 3FKIA 3SK8A 2HIXA 5I47A 5BR8H 2YS7A 3ERSX 4UFZA 3OSPA 3M9NB 2IMWP 2IA6A 2HHHL 2A73B 4I7ZC 4GKKQ 5HBRB 3PZPA 4V0BA 3S1QH 4K0KL 3GTPH 1E3PA 2N3SA 2E5LH 4QWBA 4F4ZA 4J9QA 4R4OA 3GIKA 5CV7A 2E8GA 1I6HH 2OTLA 3MFHA 1HNWH 4JYAH 4H0LC 2F0SA 4CDEC 3DF7A 1W6JA 1Z2NX 1PLFA 2D62A 4NXML 1RF2D 4P72A 2R92B 2LMCB 1Q81C 1K83B 3NBHA 2K03A 1Y8OB 3P75A 3F1ZA 2VUMH 2E5LQ 4RWSC 1K1QA 4LFCH 3A74A 3GV8B 1FJGQ 4ED3A 1H9JA 5EBDA 4A3EG 3M7NA 4FF3A 2NYZD 3AQQA 1WD0A 3FPPA 1BF4A 4LF4L 1TKWB 3PR4A 2VUGA 5T14A 4EFBA 1ENAA 4JI3H 1LV9A 4YAJB 4P73A 4B3SL 1GO3E 4JI0L 2IX0A 2JEIA 3N42B 3KHHA 5C1OA 3AB9A 2VOBA 4A3BB 3MFGA 1Y1VG 4CDDC 4JI4L 1T36A 4JI1H 3ETHA 3PIOA 3HKZB 1J6QA 1VQ6A 1AFPA 4I50F 1IZ6A 4DV6L 2E2IB 4LF8H 3FKIG 4UP7A 3CVZA 1Q1EA 2WTFA 2UU9L 2A6HC 3T16A 1YJNA 4OO1H 5GADC 5IT9W 5BN5A 1XMOH 3M4YA 2DY7A 2VNUD 4DR7L 4KN7C 1H9KA 3SE7A 1IL8A 3VPCA 3DWQA 2BA0A 3OIPA 1ZYRC 4K5WA 5D1OB 4DR2H 5IYZF 2JA6A 2J6UA 4K5XA 3U9SA 3HGBA 2Q2HA 2R7ZA 1Y1WH 3S16B 1CTMA 4NDXA 1BNCA 3HP3A 1DOLA 5FLXW 4A3KB 2QK4A 1HHVA 4A3LG 1X6OA 1LTRD 2RDGA 1TWFH 3SXHA 4BA2I 3SK5A 5CA0F 2JA5B 1IYVA 3FKIB 3ONAB 1VQ8A 5C4JB 4A3DH 4LF7H 1Y8PB 2N49A 2KCCA 2LFNA 5EBCA 1F2MA 1S9FA 5IGCA 2A1AA 4DL6A 2SEBD 2NU8B 4TQSA 1A2TA 1TWGB 5L37A 4BY1H 3D4DA 2VS1A 4FU0A 3K5MA 5KFFA 1E1OA 5EAYA 3F2BA 3UDIA 2IW3A 4BBRG 4HN7A 1WYDA 4A76A 1XNQH 4GKKL 2DNCA 1JOQA 4ZUJA 1K28A 2XIGA 4ECQA 4JK1C 1J5EH 2ENBA 2EYOA 1IBLQ 2ID0A 4CGYB 3NENA 3BDOA 4R9WA 2B8FA 4AYBE 4Y7NB 5I4DA 1CFMA 2IHFA 3RZOH 3W5OA 1X56A 2Z1CA 2JA5G 2W6NA 1X3QA 1E22A 1J5EQ 4C5CA 2YRXA 4O42A 4YCUA 1SYXB 1BUVT 5IWAH 3RLOA 1JT8A 1GSAA 2VW9A 1HA5A 4U7CA 2UUCQ 1NNXA 4MHEA 2OQKA 3OYYA 5ELDA 1SNCA 4DV1L 4A3DG 5CGKA 2FMMA 2LS01 2R85A 2VB3X 1YJWA 2FLLA 2B2YC 1CUKA 1WTXA 1PH7A 4X64L 3JRXA 2DY8A 4ZK9B 2L1BA 4EQOA 4DR4Q 1CQIB 4CJ0B 4DR3H 1L0XB 2N78A 3CC2A 1RYSA 3LNNA 2OQ0A 3H3VH 1KAAA 2NVTH 3OHBA 5CBAE 3R5XA 3BG3A 2AGPA 4C3HH 1P8LA 1F9PA 3JAMi 1PRTB 5JOBA 5KFJA 1V51A 2UXCH 1SE8A 5KG0A 2R93G 1KRSA 2PYKA 2RQXA 4J9KA 2KHJA 1CA6A 2MJ8A 3NTHA 1VDZA 4LNQA 1I7LA 5E1FA 2ATWA 4YY3H 5D3IB 2A69C 5KG3A 3F2CA 1EIGA 1VQCA 2EYLA 1CS0A 1JR0D 1OXUA 2FK1A 5CV6A 5TSSA 3GIQA 4PWQA 2NVYH 4DN4M 1AN8A 2R93H 3RIZA 5KT6A 4OX9Q 1SRUA 1QUQA 1O7ZA 2IWHA 1PH6A 2QYZA 2YZGA 4O4IF 5KFTA 2AUKA 1W96A 2VR1A 3A8IE 4P75A 2SNSA 4RGNA 3OWFA 3C1EA 3HOWB 3S1NH 1GGOA 1D7QA 5M3FG 2K01A 4QIWE 1EY5A 2F1MA 5IP7H 2FP4B 2OXPA 4RNMA 1YZ6A 1SN8A 1KEEA 2A68C 3DUZA 4ED8A 2YCHA 1I3QA 2E76C 4LH7A 3J81W 4DF7A 4GNXA 4DV7L 2NVQH 2EXZA 3GTJA 2JA7G 4NKLA 2Z6BA 4TKOB 2B2WC 5EJWA 4POFA 3W1BA 1FVIA 4QB4A 3K0XA 2BDOA 3O13A 1YIJA 2VUMG 4YAKB 1IYJB 2HGSA 3H0GA 2B2VC 5CA1F 2DLNA 1AEXA 1TQOA 1Q90A 3RFCA 4GNXC 3OTOH 2WFWA 2PI2E 4ABNA 2KHSA 4JI8L 1ZHSA 2ICIA 1OXXK 1STYA 3MFIA 3BA8A 2EJFC 1IBLL 1AW7A 4DV1H 1SXTA 1SDFA 4X62Q 1XNRQ 2RCFA 3AFQA 3P7JA 2GPSA 2VXWA 4HQ6A 2K33A 2IHEA 4HSVA 5I9PA 3Q8QB 2PQEA 3NSWA 3C46A 4DR5Q 2EJMA 2E2IA 3D31A 1TWAH 2IY5B 1JCKB 4DV5H 5JEAG 2F0UA 1U0LA 4GKKH 4LF5L 1KNAA 1EWCA 1VQGA 4AQYQ 1BCPB 1A3TA 1OXSC 2CWPA 1YHQA 1TS5A 2X0SA 1GUTA 4J9SA 2PNHA 1B53A 2KCNA 1EL0A 4NLGA 1X3FA 4ECYA 3ITPA 1QJOA 1LTBD 4C5BA 3HOUB 1XMOL 3VA7A 4ZQIA 3S14H 5FLXE 1CK1A 1PDQA 4DR7H 5IODA 1LACA 4A3MG 1J5EL 3UI2A 1XPRA 3ER0A 1S03G 4JV5H 4EBEA 2A5HA 4XQJA 1YHAA 4K2LA 1Q8KA 4LUOA 5COYA 1EYDA 4RMFA 1A2UA 1CSPA 3SEBA 4YY3Q 1EQQA 4JI8H 4GKJH 3G6EA 1X3GA 4BBSB 3NGDA 5C3WA 1AE2A 5M5WH 5IGEA 2NU9B 1RTOA 1AH9A 1K3RA 1VF5C 3GTKA 1KL9A 4O3NA 4LF7L 2K32A 5F2DA 5KFOA 3T1HQ 3BJUA 4BY7H 3CHBD 1EZ1A 5KFEA 4IUTA 2O5JC 4LWCA 1L0WA 1KDBA 3MWMA 4B3TQ 2B63B 5M3FH 3RGXA 5IYCH 3FRPB 4C3JG 2F0DA 3MVVA 3H15A 4ZHQF 3E0JA 4N8X1 1PH2A 4BY7G 4L5QA 1GYFA 2K4KA 4LMYA 1SYGA 5C5JA 2FJ2A 4DR2L 1CE8A 5KX5F 1D2BA 1LUZA 2RSOA 1C0AA 5DQGA 5AJ3L 3GTLA 2DPJA 3MTSA 3S15B 1GUSA 1I4GA 1DXMA 5J22A 4DV7Q 1JDEA 1FR3A 1I4QA 1Z2OX 4JI0H 1B50A 3WOFA 4DV5Q 4CDFC 2B2WA 4MV1A 4B3SH 4HJ5A 4FS1A 1HNXL 3M85A 4QF4A 1GUOA 4C3HG 4ED6A 4BWSC 2EE1A 3S2HH 2F03A 4EQ5A 2UXDQ 4J1MA 3BZKA 2XCPA 2E5LL 4NMZA 1U5KA 1KBLA 4FXGC 3BQ2A 2EJGC 4DAPA 2RBMA 3CCRA 2E75C 3I4LA 5L9XA 1NTGA 4ECWA 5HURA 5KFRA 2L15A 4JG2A 2K5NA 2JA7B 1L2FA 1IBML 2RF4A 4AH6A 5FK9C 5FLXc 4X65L 2V1CC 4IR1A 5IYBH 1SNDA 3FEWX 2NBFA 2PQAB 4XTCS 5BN4A 5M3MB 4KHPQ 4HYKA 2UVRA 2D0PA 1F9RA 5LP6F 1QB5D 1B70B 4A3KH 3M4OB 2MGSA 4JI0Q 1AZPA 3M9BA 1QNKA 3STBD 4X66Q 1VBHA 2ZXOA 3RV3A 3OPOA 2UUAQ 3QJYA 1C9OA 2FMCA 4C3HB 3T1YL 4PG3A 4MV7A 3OHAA 2W9BB 2RCNA 2DUDA 2J0TD 4ED0A 1E2WA 3A54A 5IP9G 3L4JA 4GC7A 3H0GH 1VQJA 3MFYA 2E2JB 4JV5Q 1PX2A 3HRZC 3A8KE 5KG7A 1K1SA 4K0KH 3FDSA 5EKLA 4YHHQ 2VPQA 2XSCA 3GTOH 2FKLA 4DR5L 4NXNL 3QZ7A 2QF7A 4OX9H 5KYLA 1TVXA 2DWCA 4DR3L 3NQIA 5C3EG 5IGBA 4GLAC 3I12A 3HOVG 1EY9A 5A35A 1VQKA 2RGRA 2DGYA 2IL8A 2A19A 3I73A 3D8GA 3I91A 1Y1WA 2UVWA 1JKJB 2VUMA 4DL5A 2F52A 3K7UC 1C7YA 4UCOA 2HQLA 5EKKA 3WDNA 4R4TA 1JB3A 3TP7A 5M5XB 2NZHA 1K73C 1KD1C 4OO1G 1CKNA 4L5SA 4CKCA 2EOTA 3K81C 5C8YF 4FBUA 4OEMB 1LT6D 1SEBD 1HXYD 3IRBA 5FD5A 1SFOH 3S17B 3PO3B 5IP9H 2Z0SA 3F8TA 1TIID 1R9TA 2B2YA 2FPGB 3TP5A 4ID6A 1QE6A 2XRSD 4A3IG 4LFBL 4K0KQ 3SR1A 1QZHA 3PSIA 1S5CD 1STHA 3CPFA 1CQVA 2DJGC 2LXKA 1DM0B 2K5VA 2NUCA 3KHLA 2W6QA 4A75A 3EBEA 4XX0B 4LFCQ 2JJQA 3MA2B 5KYIA 2RDHA 3PIP3 2F0NA 2F4VH 1ENFA 4JW0A 5EOYA 3DM3A 3HG9A 4X66H 1EU3A 3AFPA 2KBNA 5D14A 4DV5L 4B3TL 1IL2A 3CQZB 3WNZA 3H6MA 1GUNA 2E2HA 1FNUA 1U4PA 1LT5D 1STNA 2O2LD 5IGGA 2J4XA 4GLVB 3J81j 4RU9A 2QEXA 1LM0A 1TWHH 3KBGA 1O80A 3CP0A 2JA8G 1N8RC 1MKHA 4LUVA 1CM9A 3A0JA 2EYHA 3U58A 1WTWA 3T13A 4WJWA 5G3LF 3M3YH 5JJKA 3A7LA 4H7BA 3LMLA 2UXDH 5FJ8H 1WTOA 3HOWH 1GSHA 1BBWA 1JJGA 3SK6A 4DUZL 1M8AA 3S14B 1A6XA 3QZ8A 1O7IA 5FKAC 3IN5A 4A2AA 4A3FG 1PXUA 4DR6H 4PQXA 1FYCA 4DV6Q 4QWDA 3BDLA 3W1GA 4IFDJ 4RGMA 3VPBA 1SJED 2JN4A 4UHVA 3H20A 2NU7B 4JV1A 5IGDA 2JA5A 4MZ9A 5KGUA 1KC7A 3MXUA 5NUCA 5IIFA 3HXLA 2PZWA 1K8OA 1EY6A 3G6XA 3PW4A 2KVMA 2JA9A 2B63A 1V8QA 2V9WA 4PMWA 4LF9Q 3M9OB 4QGUA 2YU9B 1BBXC 1CKNB 1XDNA 5IGFA 4KTAA 2M2LA 2QDLA 5IE8A 4RG1A 2JE6I 4C2MH 4UAIA 5D8DA 4KY7A 2O4XA 2R6FA 3R5FA 5FPRA 1MHWC 5M3MH 1STEA 1R4QB 2AUJD 2K52A 3MJFA 1O78A 4A3MH 1X3EA 1EUJA 2EXDA 1WJJA 2Y0SB 2WDTA 4MV4A 1D6EC 5J2UF 1PTOF 2K75A 3RB0A 1UEBA 4PMBA 4X6AH 4RZRA 3RB4A 2R7DA 1AZQA 4RA8A 4DR3Q 3N52A 5J2TF 3BYTB 1TWCB 2FFKB 1II3A 3E9HA 1EQTA 1RODA 1CKMA 4KHZA 4X62L 1XNRL 1PYBA 2FB9A 3JAMc 1HNWL 2NVXB 3S2HB 4PDBA 2RDFA 1ULZA 4JOIA 5IT9L 3KJPA 3A7AB 4BY1G 3JAML 2MHVA 1VQBA 2CHBD 3SGIA 5KG5A 5KFGA 1EEFD 2XRQD 4U6PA 2R6GA 1D5XC 2E2DC 4EX5A 1PTOD 3V6JA 5CB4F 2AU0A 4M1UB 4EEQA 3TEHB 2R92H 4LF8Q 5HV6A 4O0AA 1TWFB 4BS9A 4ZRZA 5JVG3 3VYTA 2ZXPA 4JV2A 1B6SA 5JH7F 1CSQA 1A0IA 5EPKA 5EWGA 3FMAA 3L4KA 4FVMA 1QOHA 3TRZA 1SYDA 1BQQT 1FKAH 5GAHC 1XNQQ 3HOXG 3N43B 3PO2H 4I55F 2R7LA 1EOTA 4IHJF 3OTOQ 3TREA 4I4TF 5KFHA 4LAAA 2LSSA 3H0GB 5BR8Q 2JK8A 4KJNA 1XMOQ 2E2JH 2YTYA 1B6RA 1RDPD 1UE7A 3J81L 4EG0A 2NN6H 5DLQE 1PH9A 2GVAA 5LHY1 3PO2G 2DPIA 1HZAA 3UE1A 4LF7Q 1IBKL 4ECZA 2EY5A 2E2IH 1IBMH 3GLKA 1B9MA 4H13C 2NVYA 1SYBA 3DMUA 4IJLA 1QILA 2I07B 1FGBD 3I55A 3ULJA 1JJ2A 5KT5A 1MJCA 1PFNA 4FO2A 4O1NA 2XD4A 2JSOA 2UUBQ 2ZJTA 5LL6S 2XGPA 4DR2Q 3C0FB 4FM9A 1SLJA 4I65A 5AJ3Q 1E2VA 3HEJA 3RTXA 2WKCA 2CKZB 5G3LD 3S24A 4RB0A 5LOVF 4EQPA 5HY6A 1NR4A 1ASYA 4IWYA 4L5TA 2I5LX 1YNJD 3JAME 2NWGA 4ZKCB 3FVQA 2B2UC 3TP8A 2LKVA 3D6WA 4DL4A 4WJ4A 4PMCA 2B63G 1I94H 4P74A 1PRTD 3NWTA 1G291 1S0NA 5A2QE 1S40A 2ZJRA 1TWCA 5H1SE 4ME3A 3DEPA
chains in the Genus database with same CATH topology
1Y1VH 2N78A 4H02A 1KIXA 3CC2A 2OQ0A 2HHHQ 1HR0Q 1OXVA 2H5XA 2NVTH 3H3VH 1XJVA 2R7ZH 4A3LH 3STBC 4A3JH 3GTMH 5ELNA 1QZGA 5JJLA 4GN4B 2WB1G 4C3HH 1P8LA 1IBMQ 3HKSA 3JAMi 1EYGA 4JI3Q 5M3MG 2RHSB 3K80C 2YV5A 3U50C 1SE8A 1PVOA 1XPOA 1VQDA 1KRSA 2OCEA 4QL5A 2R93G 2KHJA 1XMQQ 2PMZE 2QA4A 4LNQA 1BBUA 1QUQB 3OTOL 2ATWA 2NN6G 4PZ6A 1SROA 4OONA 1EFWA 2UXDL 4DAYB 1M1KC 1HH2P 3F2CA 1VQCA 3GTGH 4JOIC 1OXUA 2ZJQA 1WOCA 1A63A 2NVYH 2R93H 2GN5A 4XIGS 1Q82C 2UUAL 4POGA 4OX9Q 1SRUA 1QUQA 1PH6A 1GVPA 4YWKA 3AEVA 2IT1A 4P75A 3J81i 1NJIC 2MFIA 1UWVA 2NN6I 4GN3B 1LTLA 4O2DA 4DV4L 3S1NH 5M3FG 4JI7Q 4B3RL 1D7QA 2CWAA 4MTNA 4JBWA 4QIWE 5IP7H 3T1HL 1T9HA 2F3IA 1YZ6A 1HNWQ 1SN8A 3M4QA 3PGZA 1WCMH 1VQNA 2FXQA 4NB3A 3ULPA 5IYDG 4DUYQ 4GNXA 4DV7L 1PA6A 2NVQH 1KC8C 1VQAA 2JA7G 3KF8B 1NMFA 2AHOB 3HKZG 4DAMA 3K7AH 2IX1A 1IBKQ 4POFA 3W1BA 2PI2A 1VQIA 1FVIA 5GQOA 4C3IH 4GNXB 1QVGA 3K0XA 4IOCA 5FJ8G 2HIVA 1YIJA 2VUMG 2UUCL 1K8GA 3PO2G 3KF6B 1IYJB 4UP9A 2BH8A 1G6PA 1K0RA 2JA6H 5LMNQ 5C4XH 4DV0L 3E0EA 2CCZA 4BBSH 4GNXC 3NELA 2WFWA 1Q86C 4BXXH 2ZM6Q 2PI2E 2KENA 4X65Q 3CXCA 2UUBL 4LFAL 4JI8L 1KXLA 1B8AA 4HJ8A 1N36Q 1OXXK 4JC0A 4DR7Q 4KHPL 1WI5A 5E7NA 5FLMG 2Q2IA 3J81c 2EIFA 1RL2A 2AKWB 5IYCG 1IBLL 1WFQA 4OXPA 4X62Q 1XNRQ 3B6YA 4BXXG 3AFQA 4A93G 3CPWA 2K50A 1I94L 3CC4A 5C4XG 2F4VL 2IHEA 3I2ZA 3UDGA 4IPHA 4JI6L 4DR5Q 1A62A 5C44G 3D31A 1TWAH 2IY5B 3BU2A 1VQOA 2CFMA 4A3BG 5JEAG 1UE1A 3HOUH 1P16A 1U0LA 1HZ9A 2ZTCA 4LF5L 3RN5A 1AE3A 5IYBG 1VQGA 2NZOA 5C4JH 1XTDA 2CWPA 1OXSC 5C0XI 4AQYQ 1YHQA 1VCIA 2B29A 2A8VA 4WJ3M 2Q2UA 2PNHA 5IY0A 4YHHL 1VQ5A 1X3FA 4A3IH 1PH3A 4A3GG 4TQUS 1XMOL 3S14H 3J7ZC 3CMAA 2VQFQ 2UXCL 3S2DH 1L1OC 4A3MG 1J5EL 1XPRA 3ER0A 4DV2L 1EQRA 4X64Q 1YHAA 1X65A 1Q8KA 4GOPA 1HJPA 4LUOA 4RMFA 2N8NA 2ZTDA 3EN2A 1CSPA 4YY3Q 4DK3C 1KQSA 1EQQA 2B3GA 4DV0Q 3L7ZC 3PIPA 3G6EA 1X3GA 4DV3L 4NXNQ 2BH2A 1L1OB 3U4VA 1AE2A 4DKAC 5M5WH 3HOVH 3DLLA 3H3VI 4JI2L 1QVFA 2R7FA 4PZ8A 2ES2A 2CQOA 1K3RA 1AH9A 3CCJA 1KL9A 4LF7L 5C44H 1VQ9A 1I50H 3PUYA 1GM5A 1LYLA 3T1HQ 3BJUA 4C3JH 1WCMG 5IT9c 4BY7H 1XPUA 4LWCA 2I5HA 2WAQE 1L0WA 5IP7G 4OWWB 5JJIA 4B3TQ 4R4QA 5M3FH 5GAEC 3H0GG 3RNUA 5GROA 5IYCH 1PH8A 4BBSG 4YCWA 3OW2A 3H15A 2JQOA 1PH2A 4BY7G 4L5QA 2K4KA 4DR4Q 4DR2L 4A3GH 4AIMA 4DNIA 1N33Q 1LUZA 1C0AA 4DV4Q 4A3FH 1BVSA 5AJ3L 3PUXA 1NMGA 4YCVA 4YWMA 4DV7Q 3CW2C 4DR6L 4JV5L 4UY8C 3F2DA 2F4VQ 1OTCA 3A5UA 2MQHA 4DV5Q 3I4MH 4UP8A 1TWCH 4HJ5A 1HNZL 4LUZA 5ELOA 1VQMA 1HNXL 4LFAQ 1YI2A 3M85A 1GD7A 4B3RQ 5IYDH 4GLXA 2WP8J 3RN2A 3A5ZB 5J3BA 3KFUA 4JYAL 1N9WA 3S2HH 3RZDH 4HIOA 2JA7H 3GDEA 2VZAA 1K83H 4EQ5A 2UXDQ 3BZKA 1X55A 1I3QH 2E5LL 1U5KA 3KOJA 1Z47A 1NE3A 4JBKA 2KCTA 4TVAB 3CAMA 3CCRA 1NTGA 5M5XH 1TXYA 2L15A 4JG2A 2K5NA 1FL0A 1L2FA 4LW1A 1IBML 2ASBA 1V1QA 2RF4A 3CCEA 4AH6A 3PV0A 4LFCL 3RR5A 4X65L 5FLXc 2V1CC 1W2BA 4B3ML 3PO3G 5IYBH 1E24A 2PQAB 4QY7A 4XTCS 1VQHA 1V9PA 2AMCB 4KHPQ 5K36G 1E7ZA 1KHIA 1MIUA 2D0PA 2YYZA 1XMQL 1SMXA 5GAGC 1B70B 4A3KH 2ALYB 4DR1Q 1JB7A 3HOZH 4JI0Q 4Y52H 3PCOB 1MJEA 3M9BA 1BKBA 2JEBI 2YTXA 3KLWA 3CCVA 3STBD 4X66Q 3MEFA 1YJ9A 3FP9A 3FKIH 2LXJA 2C35B 2UUAQ 1C9OA 1Y14B 3T1YL 1PH1A 4PG3A 1EIYB 4NXMQ 1X9NA 2RCNA 2DUDA 4MNOA 3M4OH 1SR3A 4IPGA 3HOXH 4GS3A 5IP9G 3ICEA 1Q46A 1Q1BA 3H0GH 1VQJA 1KRTA 1FGUA 3CCQA 3JC66 3VDYA 3PF5A 1E1TA 2MO1A 4LF6L 4JV5Q 2XGTA 2JA8H 3G4SA 1K8AC 2YTVA 4YHHQ 3PUWA 3CQZH 1FJGL 3GTOH 4HJAA 3MXNB 4DR5L 4NXNL 4DV3Q 1HR0W 1L1OA 4JI1L 3CCUA 4DR3L 5C3EG 5LMUQ 4GLAC 4LF8L 5IWAQ 1VQKA 3HOVG 2DGYA 2A19A 4BA1I 5C0XJ 1PFSA 2D0OA 2F52A 3K7UC 2EQSA 1C7YA 2MNAA 2HQLA 3PUZA 4B3SQ 4R4TA 1K73C 2NZHA 4JI2Q 2VQFL 1KD1C 4OO1G 1CKNA 4L5SA 3ZJYC 4HIKA 1VQEA 3K81C 3J80i 3UE0A 2GVBA 4A3CG 1KAWA 4IOAA 1Q12A 3K8AA 4A93H 2JA5H 3IRBA 1GKHA 4DUZQ 4JI8Q 1SFOH 1PV4A 5IP9H 4AQYL 2Z0SA 1JE5A 1VS0A 3F8TA 4JBJA 4IPDA 1H95A 1EIFA 1V43A 2Z6KA 5BR8L 4A3IG 4GKJL 4LFBL 4FDBA 3PSIA 3G71A 3CPFA 1QZHA 4K0KQ 4AYBG 4ALPA 4LF9L 2LXKA 3BZCA 5C0XG 5JEAJ 3CMEA 2K5VA 3I4NH 3HFZB 4A3CH 3GO5A 4HIDA 1S72A 4APVA 1QVCA 4A75A 3EBEA 2VQEQ 4PZ7A 4LFCQ 2JJQA 1N34Q 3CCLA 1S3OA 5HGQA 2Q2TA 4IFDG 3I56A 3AYHB 3GD7A 1NY4A 3DM3A 1Z9FA 4KI0A 2Y0SG 1RIPA 1HZCA 2KBNA 3AFPA 4R4IA 4OWTB 4HIMA 4A3EH 4DV5L 4B3TL 3E9IA 3D0FA 1IL2A 4X66L 1IXRA 2R7ZG 3CCMA 1YITA 3T1YQ 1YHBA 3KDFB 3J81j 3PUVA 4GLVB 2OWOA 3HOYH 2UXCQ 1HNZQ 4QQBX 2QEXA 4HJ9A 1LM0A 1YEZA 1TWHH 1HNXQ 4DPGA 2E2HH 3CP0A 4QJFA 1N33L 2JA8G 1N8RC 1MKHA 4LUVA 4DV2Q 3A0JA 3U58A 5LMNW 2I5MX 1YVCA 3S1MH 3GTQH 4DR6Q 1Y1WG 4DK6C 3M3YH 2UU9Q 2AWOA 3GTLH 2B63H 5JJKA 4YY3L 2WB1E 5FJ8H 4GN5A 1K9MC 3HOWH 3CC7A 1BBWA 1JJGA 4A3BH 4DUZL 4HJ7A 5LMUL 2HIXA 1O7IA 3ERSX 4A3FG 2HHHL 1PH5A 4GKKQ 4DR1L 2I0QA 4DV6Q 4GKJQ 3S15H 3J80c 3GTPH 1E3PA 2N3SA 2WAQG 3S1QH 4K0KL 4IFDJ 3FHWA 3W1GA 2XTIA 2MO0A 4R4OA 1UE6A 1EOVA 4GOPB 2RHQB 2K14A 2E8GA 3NBHB 1I6HH 2OTLA 3TQYA 2Z6KC 4MZ9A 4IO9A 5FLMH 2D62A 4NXML 1M90C 2BA1A 1XNQL 4P72A 3M4PA 3KYHC 1Q81C 2JA9A 3HOYG 2K5HA 1VQPA 3F1ZA 2VUMH 1PYSB 2E5LQ 4LFBQ 2Y0SE 2AWNA 4PMWA 3KF6A 4LF9Q 4LF6Q 2R92G 2UXBL 4QGUA 3A74A 1CKNB 1EWIA 1FJGQ 4A3EG 5IE8A 4DR4L 1N32L 4RG1A 2JE6I 3HKZE 4C2MH 3HOUG 3M7NA 3AQQA 4JI7L 4LF4L 3GTJH 5M3MH 1VQ7A 2K52A 4KLKA 5IWAL 4P73A 4B3SL 1GO3E 1YNXA 4DV1Q 1X3EA 1EUJA 2EXDA 1WJJA 4A3MH 1HR0L 4JI0L 1I5FA 2IX0A 3TS0A 4L5RC 3CD6A 1TWGH 2K75A 4J15A 2NVXH 1UEBA 1Y1VG 4JI4L 4X6AH 2R7DA 4DR3Q 3PIOA 1J6QA 1VQ6A 1NBWA 1IZ6A 3E9HA 2VY3A 4DV6L 1CKMA 3KDFA 4KHZA 3FKIG 4X62L 4UP7A 1XNRL 1PYBA 3JAMc 4B3MQ 1Q1EA 1HNWL 2JA6G 4JCVE 2UU9L 4OX9L 1HZBA 4DUYL 4JOIA 5GADC 1YJNA 3RLNA 3KJPA 4A4IA 3HOWG 1PHJA 4BY1G 4GOPC 3SGIA 1VQBA 4YWLA 4P71A 2VQEL 3GTKH 3S16H 2R6GA 4EX5A 1JJCB 2VNUD 1N36L 4DR7L 2ZJPA 3TEHB 3UDFA 2R92H 2BA0A 2UXBQ 4R1JA 2KCMA 3I4OA 4LF8Q 4JI5L 3TS2A 2QGQA 2OTJA 4O0AA 3RLFA 1OXTA 2Q2HA 1Y1WH 1X54A 4OO1I 2YU9H 1CSQA 2PQAA 1VQ4A 1A0IA 3J7A5 1VQLA 4A3LG 1X6OA 4JI3L 3TRZA 4BA2I 1TWFH 3NEMA 1N34L 4JI1Q 3KJOA 3ULLA 5GAHC 1XNQQ 3HOXG 1DGSA 1Q7YC 1VQ8A 3PO2H 3S17H 2N49A 3PO3H 4A3DH 3OTOQ 3TREA 1UE5A 3I4MG 2A1AA 2ZTEA 3I7FA 4IPCA 4NPSA 2LSSA 5BR8Q 2E2JH 2JK8A 1XMOQ 1I94Q 2YTYA 4JI5Q 2ZM6L 4BY1H 1UE7A 2VS1A 3I4NG 5DLQE 1PH9A 2GVAA 1E1OA 5EAYA 3F2BA 3L2PA 3HOZG 3UDIA 1HZAA 4BBRG 4UPAA 3UE1A 4LF7Q 1IBKL 3CF5A 2HT1A 1WYDA 4R4CA 4A76A 2JEAI 2E2IH 1JMCA 4GKKL 5M5YH 4LF4Q 3LGJA 3WWVA 3EIVA 4IJLA 1A8VA 1YBYA 1CKOA 2ID0A 1IBLQ 3NENA 4AYBE 1R9TH 3I55A 5LMNL 3ULJA 4JI6Q 1W3SA 1JJ2A 1MJCA 3L0OA 1VQFA 4JBMA 4IFDI 2IHFA 4JI4Q 3RZOH 3W5OA 2UUBQ 1X56A 3Q8DA 4BBRH 3CCSA 4OWXB 4DR2Q 3S1RH 2JA5G 1E22A 1SLJA 2VL6A 1J5EQ 1ASZA 5AJ3Q 4YCUA 2CKZB 3S24A 4Y7NH 3RLOA 1JT8A 5HY6A 2VW9A 4A3KG 1ASYA 3G48A 4L5TA 2UUCQ 2I5LX 2OQKA 3OYYA 5C3EH 4DV1L 4A3DG 3PF4A 1PH4A 1N32Q 1YJWA 2B63G 4WJ4A 4IJHA 4P74A 1B7YB 1CUKA 1G291 1PH7A 4X64L 4A3JG 2KHIA 1S40A 3U4ZA 4JYAQ 1D8LA 2ZJRA 4LF5Q 3UDXA 5H1SE 1G51A 4ME3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V H;  2N78 A;  4H02 A;  1KIX A;  3CC2 A;  2OQ0 A;  2HHH Q;  1HR0 Q;  1OXV A;  2H5X A;  2NVT H;  3H3V H;  1XJV A;  2R7Z H;  4A3L H;  3STB C;  4A3J H;  3GTM H;  5ELN A;  1QZG A;  5JJL A;  4GN4 B;  2WB1 G;  4C3H H;  1P8L A;  1IBM Q;  3HKS A;  3JAM i;  1EYG A;  4JI3 Q;  5M3M G;  2RHS B;  3K80 C;  2YV5 A;  3U50 C;  1SE8 A;  1PVO A;  1XPO A;  1VQD A;  1KRS A;  2OCE A;  4QL5 A;  2R93 G;  2KHJ A;  1XMQ Q;  2PMZ E;  2QA4 A;  4LNQ A;  1BBU A;  1QUQ B;  3OTO L;  2ATW A;  2NN6 G;  4PZ6 A;  1SRO A;  4OON A;  1EFW A;  2UXD L;  4DAY B;  1M1K C;  1HH2 P;  3F2C A;  1VQC A;  3GTG H;  4JOI C;  1OXU A;  2ZJQ A;  1WOC A;  1A63 A;  2NVY H;  2R93 H;  2GN5 A;  4XIG S;  1Q82 C;  2UUA L;  4POG A;  4OX9 Q;  1SRU A;  1QUQ A;  1PH6 A;  1GVP A;  4YWK A;  3AEV A;  2IT1 A;  4P75 A;  3J81 i;  1NJI C;  2MFI A;  1UWV A;  2NN6 I;  4GN3 B;  1LTL A;  4O2D A;  4DV4 L;  3S1N H;  5M3F G;  4JI7 Q;  4B3R L;  1D7Q A;  2CWA A;  4MTN A;  4JBW A;  4QIW E;  5IP7 H;  3T1H L;  1T9H A;  2F3I A;  1YZ6 A;  1HNW Q;  1SN8 A;  3M4Q A;  3PGZ A;  1WCM H;  1VQN A;  2FXQ A;  4NB3 A;  3ULP A;  5IYD G;  4DUY Q;  4GNX A;  4DV7 L;  1PA6 A;  2NVQ H;  1KC8 C;  1VQA A;  2JA7 G;  3KF8 B;  1NMF A;  2AHO B;  3HKZ G;  4DAM A;  3K7A H;  2IX1 A;  1IBK Q;  4POF A;  3W1B A;  2PI2 A;  1VQI A;  1FVI A;  5GQO A;  4C3I H;  4GNX B;  1QVG A;  3K0X A;  4IOC A;  5FJ8 G;  2HIV A;  1YIJ A;  2VUM G;  2UUC L;  1K8G A;  3PO2 G;  3KF6 B;  1IYJ B;  4UP9 A;  2BH8 A;  1G6P A;  1K0R A;  2JA6 H;  5LMN Q;  5C4X H;  4DV0 L;  3E0E A;  2CCZ A;  4BBS H;  4GNX C;  3NEL A;  2WFW A;  1Q86 C;  4BXX H;  2ZM6 Q;  2PI2 E;  2KEN A;  4X65 Q;  3CXC A;  2UUB L;  4LFA L;  4JI8 L;  1KXL A;  1B8A A;  4HJ8 A;  1N36 Q;  1OXX K;  4JC0 A;  4DR7 Q;  4KHP L;  1WI5 A;  5E7N A;  5FLM G;  2Q2I A;  3J81 c;  2EIF A;  1RL2 A;  2AKW B;  5IYC G;  1IBL L;  1WFQ A;  4OXP A;  4X62 Q;  1XNR Q;  3B6Y A;  4BXX G;  3AFQ A;  4A93 G;  3CPW A;  2K50 A;  1I94 L;  3CC4 A;  5C4X G;  2F4V L;  2IHE A;  3I2Z A;  3UDG A;  4IPH A;  4JI6 L;  4DR5 Q;  1A62 A;  5C44 G;  3D31 A;  1TWA H;  2IY5 B;  3BU2 A;  1VQO A;  2CFM A;  4A3B G;  5JEA G;  1UE1 A;  3HOU H;  1P16 A;  1U0L A;  1HZ9 A;  2ZTC A;  4LF5 L;  3RN5 A;  1AE3 A;  5IYB G;  1VQG A;  2NZO A;  5C4J H;  1XTD A;  2CWP A;  1OXS C;  5C0X I;  4AQY Q;  1YHQ A;  1VCI A;  2B29 A;  2A8V A;  4WJ3 M;  2Q2U A;  2PNH A;  5IY0 A;  4YHH L;  1VQ5 A;  1X3F A;  4A3I H;  1PH3 A;  4A3G G;  4TQU S;  1XMO L;  3S14 H;  3J7Z C;  3CMA A;  2VQF Q;  2UXC L;  3S2D H;  1L1O C;  4A3M G;  1J5E L;  1XPR A;  3ER0 A;  4DV2 L;  1EQR A;  4X64 Q;  1YHA A;  1X65 A;  1Q8K A;  4GOP A;  1HJP A;  4LUO A;  4RMF A;  2N8N A;  2ZTD A;  3EN2 A;  1CSP A;  4YY3 Q;  4DK3 C;  1KQS A;  1EQQ A;  2B3G A;  4DV0 Q;  3L7Z C;  3PIP A;  3G6E A;  1X3G A;  4DV3 L;  4NXN Q;  2BH2 A;  1L1O B;  3U4V A;  1AE2 A;  4DKA C;  5M5W H;  3HOV H;  3DLL A;  3H3V I;  4JI2 L;  1QVF A;  2R7F A;  4PZ8 A;  2ES2 A;  2CQO A;  1K3R A;  1AH9 A;  3CCJ A;  1KL9 A;  4LF7 L;  5C44 H;  1VQ9 A;  1I50 H;  3PUY A;  1GM5 A;  1LYL A;  3T1H Q;  3BJU A;  4C3J H;  1WCM G;  5IT9 c;  4BY7 H;  1XPU A;  4LWC A;  2I5H A;  2WAQ E;  1L0W A;  5IP7 G;  4OWW B;  5JJI A;  4B3T Q;  4R4Q A;  5M3F H;  5GAE C;  3H0G G;  3RNU A;  5GRO A;  5IYC H;  1PH8 A;  4BBS G;  4YCW A;  3OW2 A;  3H15 A;  2JQO A;  1PH2 A;  4BY7 G;  4L5Q A;  2K4K A;  4DR4 Q;  4DR2 L;  4A3G H;  4AIM A;  4DNI A;  1N33 Q;  1LUZ A;  1C0A A;  4DV4 Q;  4A3F H;  1BVS A;  5AJ3 L;  3PUX A;  1NMG A;  4YCV A;  4YWM A;  4DV7 Q;  3CW2 C;  4DR6 L;  4JV5 L;  4UY8 C;  3F2D A;  2F4V Q;  1OTC A;  3A5U A;  2MQH A;  4DV5 Q;  3I4M H;  4UP8 A;  1TWC H;  4HJ5 A;  1HNZ L;  4LUZ A;  5ELO A;  1VQM A;  1HNX L;  4LFA Q;  1YI2 A;  3M85 A;  1GD7 A;  4B3R Q;  5IYD H;  4GLX A;  2WP8 J;  3RN2 A;  3A5Z B;  5J3B A;  3KFU A;  4JYA L;  1N9W A;  3S2H H;  3RZD H;  4HIO A;  2JA7 H;  3GDE A;  2VZA A;  1K83 H;  4EQ5 A;  2UXD Q;  3BZK A;  1X55 A;  1I3Q H;  2E5L L;  1U5K A;  3KOJ A;  1Z47 A;  1NE3 A;  4JBK A;  2KCT A;  4TVA B;  3CAM A;  3CCR A;  1NTG A;  5M5X H;  1TXY A;  2L15 A;  4JG2 A;  2K5N A;  1FL0 A;  1L2F A;  4LW1 A;  1IBM L;  2ASB A;  1V1Q A;  2RF4 A;  3CCE A;  4AH6 A;  3PV0 A;  4LFC L;  3RR5 A;  4X65 L;  5FLX c;  2V1C C;  1W2B A;  4B3M L;  3PO3 G;  5IYB H;  1E24 A;  2PQA B;  4QY7 A;  4XTC S;  1VQH A;  1V9P A;  2AMC B;  4KHP Q;  5K36 G;  1E7Z A;  1KHI A;  1MIU A;  2D0P A;  2YYZ A;  1XMQ L;  1SMX A;  5GAG C;  1B70 B;  4A3K H;  2ALY B;  4DR1 Q;  1JB7 A;  3HOZ H;  4JI0 Q;  4Y52 H;  3PCO B;  1MJE A;  3M9B A;  1BKB A;  2JEB I;  2YTX A;  3KLW A;  3CCV A;  3STB D;  4X66 Q;  3MEF A;  1YJ9 A;  3FP9 A;  3FKI H;  2LXJ A;  2C35 B;  2UUA Q;  1C9O A;  1Y14 B;  3T1Y L;  1PH1 A;  4PG3 A;  1EIY B;  4NXM Q;  1X9N A;  2RCN A;  2DUD A;  4MNO A;  3M4O H;  1SR3 A;  4IPG A;  3HOX H;  4GS3 A;  5IP9 G;  3ICE A;  1Q46 A;  1Q1B A;  3H0G H;  1VQJ A;  1KRT A;  1FGU A;  3CCQ A;  3JC6 6;  3VDY A;  3PF5 A;  1E1T A;  2MO1 A;  4LF6 L;  4JV5 Q;  2XGT A;  2JA8 H;  3G4S A;  1K8A C;  2YTV A;  4YHH Q;  3PUW A;  3CQZ H;  1FJG L;  3GTO H;  4HJA A;  3MXN B;  4DR5 L;  4NXN L;  4DV3 Q;  1HR0 W;  1L1O A;  4JI1 L;  3CCU A;  4DR3 L;  5C3E G;  5LMU Q;  4GLA C;  4LF8 L;  5IWA Q;  1VQK A;  3HOV G;  2DGY A;  2A19 A;  4BA1 I;  5C0X J;  1PFS A;  2D0O A;  2F52 A;  3K7U C;  2EQS A;  1C7Y A;  2MNA A;  2HQL A;  3PUZ A;  4B3S Q;  4R4T A;  1K73 C;  2NZH A;  4JI2 Q;  2VQF L;  1KD1 C;  4OO1 G;  1CKN A;  4L5S A;  3ZJY C;  4HIK A;  1VQE A;  3K81 C;  3J80 i;  3UE0 A;  2GVB A;  4A3C G;  1KAW A;  4IOA A;  1Q12 A;  3K8A A;  4A93 H;  2JA5 H;  3IRB A;  1GKH A;  4DUZ Q;  4JI8 Q;  1SFO H;  1PV4 A;  5IP9 H;  4AQY L;  2Z0S A;  1JE5 A;  1VS0 A;  3F8T A;  4JBJ A;  4IPD A;  1H95 A;  1EIF A;  1V43 A;  2Z6K A;  5BR8 L;  4A3I G;  4GKJ L;  4LFB L;  4FDB A;  3PSI A;  3G71 A;  3CPF A;  1QZH A;  4K0K Q;  4AYB G;  4ALP A;  4LF9 L;  2LXK A;  3BZC A;  5C0X G;  5JEA J;  3CME A;  2K5V A;  3I4N H;  3HFZ B;  4A3C H;  3GO5 A;  4HID A;  1S72 A;  4APV A;  1QVC A;  4A75 A;  3EBE A;  2VQE Q;  4PZ7 A;  4LFC Q;  2JJQ A;  1N34 Q;  3CCL A;  1S3O A;  5HGQ A;  2Q2T A;  4IFD G;  3I56 A;  3AYH B;  3GD7 A;  1NY4 A;  3DM3 A;  1Z9F A;  4KI0 A;  2Y0S G;  1RIP A;  1HZC A;  2KBN A;  3AFP A;  4R4I A;  4OWT B;  4HIM A;  4A3E H;  4DV5 L;  4B3T L;  3E9I A;  3D0F A;  1IL2 A;  4X66 L;  1IXR A;  2R7Z G;  3CCM A;  1YIT A;  3T1Y Q;  1YHB A;  3KDF B;  3J81 j;  3PUV A;  4GLV B;  2OWO A;  3HOY H;  2UXC Q;  1HNZ Q;  4QQB X;  2QEX A;  4HJ9 A;  1LM0 A;  1YEZ A;  1TWH H;  1HNX Q;  4DPG A;  2E2H H;  3CP0 A;  4QJF A;  1N33 L;  2JA8 G;  1N8R C;  1MKH A;  4LUV A;  4DV2 Q;  3A0J A;  3U58 A;  5LMN W;  2I5M X;  1YVC A;  3S1M H;  3GTQ H;  4DR6 Q;  1Y1W G;  4DK6 C;  3M3Y H;  2UU9 Q;  2AWO A;  3GTL H;  2B63 H;  5JJK A;  4YY3 L;  2WB1 E;  5FJ8 H;  4GN5 A;  1K9M C;  3HOW H;  3CC7 A;  1BBW A;  1JJG A;  4A3B H;  4DUZ L;  4HJ7 A;  5LMU L;  2HIX A;  1O7I A;  3ERS X;  4A3F G;  2HHH L;  1PH5 A;  4GKK Q;  4DR1 L;  2I0Q A;  4DV6 Q;  4GKJ Q;  3S15 H;  3J80 c;  3GTP H;  1E3P A;  2N3S A;  2WAQ G;  3S1Q H;  4K0K L;  4IFD J;  3FHW A;  3W1G A;  2XTI A;  2MO0 A;  4R4O A;  1UE6 A;  1EOV A;  4GOP B;  2RHQ B;  2K14 A;  2E8G A;  3NBH B;  1I6H H;  2OTL A;  3TQY A;  2Z6K C;  4MZ9 A;  4IO9 A;  5FLM H;  2D62 A;  4NXM L;  1M90 C;  2BA1 A;  1XNQ L;  4P72 A;  3M4P A;  3KYH C;  1Q81 C;  2JA9 A;  3HOY G;  2K5H A;  1VQP A;  3F1Z A;  2VUM H;  1PYS B;  2E5L Q;  4LFB Q;  2Y0S E;  2AWN A;  4PMW A;  3KF6 A;  4LF9 Q;  4LF6 Q;  2R92 G;  2UXB L;  4QGU A;  3A74 A;  1CKN B;  1EWI A;  1FJG Q;  4A3E G;  5IE8 A;  4DR4 L;  1N32 L;  4RG1 A;  2JE6 I;  3HKZ E;  4C2M H;  3HOU G;  3M7N A;  3AQQ A;  4JI7 L;  4LF4 L;  3GTJ H;  5M3M H;  1VQ7 A;  2K52 A;  4KLK A;  5IWA L;  4P73 A;  4B3S L;  1GO3 E;  1YNX A;  4DV1 Q;  1X3E A;  1EUJ A;  2EXD A;  1WJJ A;  4A3M H;  1HR0 L;  4JI0 L;  1I5F A;  2IX0 A;  3TS0 A;  4L5R C;  3CD6 A;  1TWG H;  2K75 A;  4J15 A;  2NVX H;  1UEB A;  1Y1V G;  4JI4 L;  4X6A H;  2R7D A;  4DR3 Q;  3PIO A;  1J6Q A;  1VQ6 A;  1NBW A;  1IZ6 A;  3E9H A;  2VY3 A;  4DV6 L;  1CKM A;  3KDF A;  4KHZ A;  3FKI G;  4X62 L;  4UP7 A;  1XNR L;  1PYB A;  3JAM c;  4B3M Q;  1Q1E A;  1HNW L;  2JA6 G;  4JCV E;  2UU9 L;  4OX9 L;  1HZB A;  4DUY L;  4JOI A;  5GAD C;  1YJN A;  3RLN A;  3KJP A;  4A4I A;  3HOW G;  1PHJ A;  4BY1 G;  4GOP C;  3SGI A;  1VQB A;  4YWL A;  4P71 A;  2VQE L;  3GTK H;  3S16 H;  2R6G A;  4EX5 A;  1JJC B;  2VNU D;  1N36 L;  4DR7 L;  2ZJP A;  3TEH B;  3UDF A;  2R92 H;  2BA0 A;  2UXB Q;  4R1J A;  2KCM A;  3I4O A;  4LF8 Q;  4JI5 L;  3TS2 A;  2QGQ A;  2OTJ A;  4O0A A;  3RLF A;  1OXT A;  2Q2H A;  1Y1W H;  1X54 A;  4OO1 I;  2YU9 H;  1CSQ A;  2PQA A;  1VQ4 A;  1A0I A;  3J7A 5;  1VQL A;  4A3L G;  1X6O A;  4JI3 L;  3TRZ A;  4BA2 I;  1TWF H;  3NEM A;  1N34 L;  4JI1 Q;  3KJO A;  3ULL A;  5GAH C;  1XNQ Q;  3HOX G;  1DGS A;  1Q7Y C;  1VQ8 A;  3PO2 H;  3S17 H;  2N49 A;  3PO3 H;  4A3D H;  3OTO Q;  3TRE A;  1UE5 A;  3I4M G;  2A1A A;  2ZTE A;  3I7F A;  4IPC A;  4NPS A;  2LSS A;  5BR8 Q;  2E2J H;  2JK8 A;  1XMO Q;  1I94 Q;  2YTY A;  4JI5 Q;  2ZM6 L;  4BY1 H;  1UE7 A;  2VS1 A;  3I4N G;  5DLQ E;  1PH9 A;  2GVA A;  1E1O A;  5EAY A;  3F2B A;  3L2P A;  3HOZ G;  3UDI A;  1HZA A;  4BBR G;  4UPA A;  3UE1 A;  4LF7 Q;  1IBK L;  3CF5 A;  2HT1 A;  1WYD A;  4R4C A;  4A76 A;  2JEA I;  2E2I H;  1JMC A;  4GKK L;  5M5Y H;  4LF4 Q;  3LGJ A;  3WWV A;  3EIV A;  4IJL A;  1A8V A;  1YBY A;  1CKO A;  2ID0 A;  1IBL Q;  3NEN A;  4AYB E;  1R9T H;  3I55 A;  5LMN L;  3ULJ A;  4JI6 Q;  1W3S A;  1JJ2 A;  1MJC A;  3L0O A;  1VQF A;  4JBM A;  4IFD I;  2IHF A;  4JI4 Q;  3RZO H;  3W5O A;  2UUB Q;  1X56 A;  3Q8D A;  4BBR H;  3CCS A;  4OWX B;  4DR2 Q;  3S1R H;  2JA5 G;  1E22 A;  1SLJ A;  2VL6 A;  1J5E Q;  1ASZ A;  5AJ3 Q;  4YCU A;  2CKZ B;  3S24 A;  4Y7N H;  3RLO A;  1JT8 A;  5HY6 A;  2VW9 A;  4A3K G;  1ASY A;  3G48 A;  4L5T A;  2UUC Q;  2I5L X;  2OQK A;  3OYY A;  5C3E H;  4DV1 L;  4A3D G;  3PF4 A;  1PH4 A;  1N32 Q;  1YJW A;  2B63 G;  4WJ4 A;  4IJH A;  4P74 A;  1B7Y B;  1CUK A;  1G29 1;  1PH7 A;  4X64 L;  4A3J G;  2KHI A;  1S40 A;  3U4Z A;  4JYA Q;  1D8L A;  2ZJR A;  4LF5 Q;  3UDX A;  5H1S E;  1G51 A;  4ME3 A; 
#chains in the Genus database with same CATH topology
 1KIX A;  3CQZ A;  5KFQ A;  1OXV A;  3HS0 C;  4A3L H;  4A3J H;  3H3V C;  2PCF B;  4GN4 B;  2R8G A;  2GA4 B;  1E2Z A;  2QKI C;  2YS6 A;  3X3M A;  1IBM Q;  3HKS A;  4JI3 Q;  5M3M G;  4CBV A;  3DWA A;  2RHS B;  1S10 A;  4DR4 H;  2YV5 A;  5C6A A;  1JWU D;  4QL5 A;  1LTT D;  2OCE A;  3BDC A;  1XPO A;  5FPO A;  4HED A;  4DL3 A;  2PMZ E;  1BBU A;  3AU7 A;  4OGQ C;  2UXD L;  1EFW A;  2P0A A;  4ZQ3 A;  1LTA D;  4DAY B;  1M1K C;  4F4X A;  4JOI C;  2HUG A;  3GTO B;  2RDJ A;  2ZJQ A;  1IW7 D;  5COR A;  4FF1 A;  5I6Y A;  2NTT A;  4XIG S;  2UUA L;  1UC8 A;  4DV4 H;  1WCM B;  4YWK A;  2ALZ A;  1YNN D;  3AEV A;  3Q8P B;  4F8M A;  1TY2 A;  2KUM A;  3J81 i;  4DV4 L;  1EZ6 A;  3BVZ A;  5CV9 A;  1CA5 A;  4DXF A;  4JI7 Q;  1MD2 D;  2V4Q A;  2CWA A;  3A56 A;  1HNW Q;  1SE2 A;  2O03 A;  2F0O A;  4WFN 3;  2FXQ A;  4NB3 A;  1F2Z A;  3ULP A;  5I9O A;  1L0Y B;  3RD4 A;  2VQD A;  2R8K A;  4NXM H;  2AHO B;  2L55 A;  4C2M A;  3QO2 A;  3K7A H;  1FNW A;  4F87 A;  4DV7 H;  4RAZ A;  4RCN A;  1I6V C;  2C2R A;  3WO1 A;  1O75 A;  1HCZ A;  2WB1 A;  3A55 A;  1K8G A;  2RKS A;  1U4R A;  1Y69 U;  1G6P A;  3TZD A;  2JA6 H;  3IG0 A;  5LMN Q;  3MWE A;  2X6L A;  1RJP A;  2R82 A;  4LF6 H;  3NEL A;  1XTC D;  3CXC A;  4HAE A;  1LO5 D;  1N36 Q;  3TBI B;  3J80 L;  1O7Y A;  5FLM G;  1GUW A;  2EIF A;  1E0B A;  1S68 A;  3H4B A;  2QCP X;  3H91 A;  4ZUI A;  2IX3 A;  5DG8 A;  4OXP A;  3R5H A;  4N8F A;  1VMC A;  1CHP D;  4KV6 A;  1A9X A;  1H9R A;  4IPH A;  4XT1 B;  1UEA B;  4ILW A;  5C44 G;  5ISR A;  3V2T A;  2EY1 A;  2CFM A;  3KBX A;  4FXK C;  4K5V A;  4KD3 A;  1UE1 A;  3HOU H;  1DIK A;  2NVX A;  2SDF A;  3IAY A;  5C4J H;  4DUY H;  1KDC A;  3M4I A;  1VCI A;  2B29 A;  3BVM A;  3M3Y B;  4DL7 A;  2Q2U A;  2HCI A;  1HQM C;  1N33 H;  2XNA C;  3NP8 A;  4OEL B;  4A3I H;  3HKZ A;  4RNN A;  2B2T C;  3OMG A;  2JA7 A;  1MSH A;  3OHX C;  3VYU A;  2C5C A;  3S2D H;  1PMR A;  4YIJ A;  3I70 A;  4M9U A;  4HNT A;  1ZET A;  1KLG D;  3PN1 A;  4KKT A;  1TWF A;  1EQR A;  1RJT A;  1SAP A;  1EY8 A;  4X64 Q;  4GOP A;  4AQY H;  4S3S A;  3MHB A;  2RA4 A;  3D6C A;  4MA5 A;  3TIN A;  3OSN A;  2ZTD A;  3EN2 A;  3ND9 A;  5J39 A;  4DK3 C;  2B3G A;  3L7Z C;  1W6K A;  1SJH D;  2D2C C;  2BH2 A;  2WII B;  4IUR A;  5M9O A;  3RZO B;  3MEH A;  3HOV H;  1OO9 B;  5JUM A;  3E6Z X;  3BS1 A;  1OWT A;  1K0S A;  3RUZ A;  2ES2 A;  5M3F B;  1H9S B;  1VQ9 A;  1I50 H;  3PUY A;  1GOZ A;  1J9O A;  1LYL A;  4C3J H;  1WCM G;  2Z9H A;  4RB1 A;  1SCU B;  5EZY F;  2MCT A;  3Q2O A;  1JOR A;  5GAE C;  5DNF A;  2KQ3 A;  4YCW A;  3D4R A;  2VQF H;  4R8U A;  1PZK D;  1N32 H;  1NCV A;  4ZKB B;  4A3G H;  1TWG A;  3N6X A;  4QWE A;  2R8J A;  4YR2 A;  1BVS A;  1V4Y A;  4C3I G;  5KFW A;  3G6J B;  3RJ0 A;  4JV5 L;  2F4V Q;  3H40 A;  3A5U A;  5KKN B;  4DNR B;  1KJQ A;  4IAL A;  3VA5 A;  1TWC H;  2EY6 A;  1HNZ L;  3G7L A;  1JWM D;  2OLS A;  4LFA Q;  1BNZ A;  5IYD H;  2WYO A;  4GLX A;  4IUN A;  1I7N A;  3EPG A;  3KFU A;  4KN4 C;  1C8C A;  3E5S A;  4HIO A;  2JA7 H;  1PTO H;  3GV5 B;  3JZI A;  1SYC A;  3H94 A;  3N40 P;  1Z47 A;  2PW7 A;  3MZ5 A;  3Q1K A;  5KNB A;  4JBK A;  2C2E A;  4TVA B;  2R93 B;  1QG7 A;  2PN1 A;  4X64 H;  1FL0 A;  4LW1 A;  1V1Q A;  5KT4 A;  1Q3L A;  4ZLT F;  4Q44 A;  3BG5 A;  5KFB A;  4U67 3;  4QY7 A;  1VQH A;  2AMC B;  2CW0 C;  3RMH A;  5DGA A;  1MIU A;  2QW7 A;  1SMX A;  2OF1 A;  3HOZ H;  3SE0 A;  2D9U A;  1STB A;  4EGQ A;  2YTX A;  3KK7 A;  1I50 A;  5E3F A;  3FP9 A;  2K5W A;  3T4A C;  1EIY B;  3K58 A;  3KTM A;  2XCL A;  3EFX D;  1SR3 A;  2WAC A;  4IPG A;  2F0T A;  3KAL A;  3MXN A;  5LA6 F;  3MXP A;  3N8D A;  1Q46 A;  1ESR A;  3VDY A;  4X3K A;  1FGU A;  1CT1 D;  5I6W A;  3PF5 A;  1E1T A;  1KTK A;  4LF6 L;  2XGT A;  1RKN A;  3ZYY X;  4A3E B;  1F2L A;  1KAB A;  3G4S A;  1K8A C;  1KJ9 A;  2YTV A;  3TN2 A;  3K5H A;  4YP3 A;  1D5M C;  4HJA A;  4DV3 Q;  3OIQ A;  2EY2 A;  3HOX B;  1WSC A;  4YR3 A;  5LL6 X;  1JLL B;  4EYH B;  1VKZ A;  2KSW A;  4FP5 D;  4LF8 L;  2C9O A;  5IWA Q;  3JAM W;  5KFP A;  1I3Q B;  4BA1 I;  1ONL A;  2BCO A;  1PFS A;  1IBK H;  3Q0A A;  1IHZ A;  1ZHQ A;  2EQS A;  2A6E D;  4DXG A;  5BPH A;  5A2Q L;  4EQN A;  3ZJY C;  2MUY A;  1RK5 A;  4A3C G;  4IOA A;  1M0W A;  4DUZ Q;  1PV4 A;  3I4N B;  3K7A B;  4YJ2 F;  4JBJ A;  2K04 A;  1T3N A;  5KFI A;  1H95 A;  1EIF A;  4U68 A;  5BR8 L;  2V5A A;  4FDB A;  1PRT C;  2FPI B;  5LL6 b;  2X6G A;  4WBN F;  2PO4 A;  1EEI D;  3FMC A;  4HID A;  5CR3 A;  1I6H B;  2VQE Q;  4MN3 A;  1KJJ A;  4O4H F;  5H80 A;  3GV7 B;  3RBE A;  2W6Z A;  1S3O A;  3V6K A;  2PVP A;  1SE3 A;  4DR5 H;  3GD7 A;  1NY4 A;  4KI0 A;  2G9H D;  2X69 A;  2Y0S G;  1HZC A;  4R4I A;  4V19 0;  4IR9 A;  2AGQ A;  2QIL A;  1HRJ A;  3KLS A;  5KFY A;  3IL8 A;  1IXR A;  4N9P A;  2R7Z G;  2YYA A;  3IFD A;  2L5T A;  1YHB A;  3NHH A;  3BZD B;  5FO9 B;  3HOY H;  2OWO A;  4QQB X;  1PZJ D;  5C4H A;  4HJ9 A;  4B08 A;  1HNX Q;  4QJF A;  2I87 A;  1UUP A;  3UFX B;  5L1J A;  4RHR A;  4ME6 A;  3TSS A;  1E4F T;  2BR0 A;  2I5M X;  5C3E B;  1Y1W G;  3QG1 A;  2UU9 Q;  4RUC A;  2B63 H;  4LF4 H;  3FPU B;  4A3B H;  3KAK A;  3N44 B;  1U9R A;  4HJ7 A;  3SI8 A;  5LMU L;  3S2D B;  1Y8N B;  1TR5 A;  1BCP D;  2F0E A;  4CHT B;  4ED2 A;  1Y1V B;  1PH5 A;  2K6A A;  4ZCK A;  2ZXR A;  2I0Q A;  4GKJ Q;  2EYP A;  3J80 c;  3S15 H;  1EIH A;  3EPI A;  5K2M A;  2EYF A;  5KFS A;  2PNR C;  2XTI A;  2IJ0 A;  1UAP A;  5KG4 A;  1EOV A;  2DZD A;  1SFO A;  2K14 A;  3NWS A;  3NBH B;  3TQY A;  3GTK B;  2Z6K C;  4IO9 A;  1L2Z A;  4XYQ A;  2W7O A;  2WKD A;  1VAJ A;  3HOV B;  1RJR A;  3GIJ A;  5FLM H;  3NUC A;  3P1H A;  2OEO A;  1M90 C;  1G91 A;  1CI3 M;  3KYH C;  2K5H A;  4DFA A;  2A6E C;  1PYS B;  4ULL A;  2W8L A;  3K3P A;  5KT3 A;  3KF6 A;  4RAY A;  4K8I A;  4C5A A;  4Y8V B;  5DQI A;  2K05 A;  1ICW A;  2CH4 A;  2W9A A;  2UUB H;  1XMQ H;  3HKZ E;  3HOU G;  1SSO A;  4JI7 L;  3Q22 A;  3GTJ H;  5JJZ A;  1CZW A;  2ASD A;  1KDA A;  5EPL A;  1YNX A;  4DV1 Q;  3HOZ B;  1DV1 A;  1HR0 L;  4KMU C;  1I5F A;  3X3N A;  5CYU A;  3TS0 A;  1TWG H;  2NVX H;  2EVB A;  1HNX H;  1EY0 A;  1EYA A;  2V4R A;  4JI2 H;  1NBW A;  5HGT A;  3KDF A;  4C3I B;  1WR2 A;  3MAQ A;  5F9L A;  1SNP A;  1SYE A;  4Q45 A;  2UXB H;  3V6H A;  4HMI A;  4B3M Q;  1HFN A;  2JA6 G;  4JCV E;  4GZY C;  1Z7T A;  4A4I A;  3HOW G;  3J7Y W;  1HUN A;  4GOP C;  4J6H A;  5D1O A;  4YWL A;  2VQE L;  4P71 A;  2K7V A;  5J1Z A;  1TT2 A;  3MWD A;  4H44 C;  4XYM B;  3S16 H;  2RDI A;  1N36 L;  1DJR D;  2H1E A;  4MTD A;  1ILP A;  2KCM A;  3I4O A;  4K6L A;  3TS2 A;  1LTG D;  2QGQ A;  2KEE A;  4C56 C;  2Q8T A;  2A69 D;  3S9W A;  2YU9 H;  1IBL H;  1SEI A;  1RTN A;  3VR6 A;  2PQA A;  1VQ4 A;  4LSX A;  4IRK A;  3J7A 5;  1JXL A;  4DA2 A;  3KHG A;  2M00 A;  4C2M B;  5C44 B;  1VMP A;  3NEM A;  5A2Q W;  3ULL A;  1Y1W B;  2W9C A;  1DGS A;  1Q7Y C;  3S17 H;  3PO3 H;  3GTO A;  4WD3 A;  2WB1 B;  1AUX A;  1UE5 A;  2ZDH A;  3I4M G;  4NPS A;  2ZTE A;  3I7F A;  1G8Z D;  4DLK A;  2FE3 A;  1WCM A;  2HVS A;  2A68 D;  4HCE A;  2ZM6 L;  3GIP A;  5I2X A;  4R8I A;  1I4H A;  2W70 A;  3PO3 G;  1STG A;  4J9O A;  1NAP A;  4X3S A;  1WTV A;  5C3X A;  4UPA A;  4ZI7 F;  3CF5 A;  4KKU A;  4R4C A;  5DAU A;  5M5Y H;  4LF4 Q;  5C1P A;  3T5L A;  4TQR A;  5E4X A;  3T5J A;  5C0X H;  2GPW A;  4QMG A;  1ENC A;  2PMZ A;  4DV2 H;  1A8V A;  1YBY A;  3I72 A;  4CKB A;  4JI6 Q;  5BMV F;  1W3S A;  1BCP F;  3L0O A;  2ZDG A;  4JBM A;  1UC9 A;  4JI4 Q;  3Q8D A;  4BBR H;  3CCS A;  4OWX B;  3S1R H;  2N55 A;  2PW5 A;  4JPB W;  4EBD A;  2VL6 A;  1ASZ A;  4G7O C;  1TWH B;  1R9T B;  1PK8 A;  4LF9 H;  3Q8S B;  4A3K G;  2EZV A;  2ICE C;  5C3E H;  2EDG A;  4KK7 A;  5DM6 3;  1N34 H;  2L4N A;  1C48 A;  2G5D A;  5DG7 A;  1PH4 A;  5D1P A;  4F88 A;  3AMU A;  5JVH 3;  4K6D A;  3EYY A;  1B7Y B;  2BQ3 A;  4O3S A;  3PQI A;  2HQE A;  3I90 A;  4A3J G;  2KHI A;  1D8L A;  4LF5 Q;  3UDX A;  4QWC A;  2UVU A;  4MIU A;  5D3D A;  5LXT F;  1Y1V H;  2RGV A;  1HR0 Q;  5KFK A;  2H5X A;  3VYR A;  2R7Z H;  3QIA A;  3RB3 A;  2DJF C;  1QZG A;  1K3B C;  3KHR A;  1SNM A;  2PZT A;  4I7H A;  1EYG A;  2Z8L A;  1LT3 D;  3Q24 A;  1Z2P X;  1UNS A;  1VQD A;  3VR5 A;  3KAJ A;  4DV0 H;  2QA4 A;  1DCZ A;  1QUQ B;  2NN6 G;  1SRO A;  4OON A;  5ELB A;  1GXD C;  1HH2 P;  3GTG H;  3SVM A;  3D4W A;  4IWX A;  1GSO A;  5L1I A;  2WE6 A;  4QIW B;  3VR3 A;  2HVQ A;  1LAB A;  4QW9 A;  2R7K A;  2GN5 A;  5FD6 A;  1Q82 C;  4LFB H;  4DL2 A;  1QNU A;  4RGT A;  4YB8 B;  2O5I C;  3C1F A;  2IT1 A;  3NBI A;  2F0V A;  3A8J E;  4GN3 B;  1NJI C;  4CC6 A;  1V1P A;  3GTJ B;  4MTN A;  3T1H L;  1T9H A;  5FLX L;  3R2I A;  3M4Q A;  3PGZ A;  5FOB B;  4B3R H;  3GTQ A;  3ORQ A;  2MPM A;  1KC8 C;  3ND8 A;  4RFB A;  3KF8 B;  2F4I A;  3HBL A;  3TII A;  1XYI A;  4DAM A;  4KY5 A;  2IX1 A;  4QUC A;  1SYF A;  3RGZ A;  1VQI A;  5GQO A;  4GNX B;  1QVG A;  3K5I A;  4IOC A;  4GC6 A;  2BE5 D;  2HCC A;  2UUC L;  2CW7 A;  4J9M A;  2C2D A;  2FJZ A;  2BH8 A;  2MP1 A;  5CC4 A;  4R7R A;  2XWJ B;  4XDX A;  1WTH A;  1S5D D;  5C4X H;  2CCZ A;  4JVZ A;  4BBS H;  4BXX H;  1B33 N;  2KEN A;  2WV6 D;  3D3R A;  4O3O A;  4JC0 A;  4XXE A;  1WI5 A;  5E7N A;  5KG2 A;  5DG9 A;  4ECR A;  1T94 A;  3SK4 A;  1EWH A;  2XWB B;  4Q0Y A;  4CC5 A;  3BAB A;  1JC7 A;  4BXX G;  5IOC A;  2K1B A;  4A93 G;  1PFB A;  2K50 A;  5C4X G;  5EGT A;  3UDG A;  1T5X D;  2E74 C;  3BU2 A;  4A3B G;  1WD1 A;  4IRD A;  5ELE A;  1P16 A;  3N41 B;  5IYB G;  2NZO A;  5EPJ A;  1VBG A;  1XTD A;  5KT7 A;  4YR0 A;  1JWS D;  3RUP A;  4WJ3 M;  2UUC H;  5IY0 A;  3DHQ A;  1PH3 A;  2WAQ B;  3QFF A;  3N6R A;  2NVQ B;  4A3G G;  2H4O A;  4UDU C;  4Q0F A;  2VQE H;  1S5B D;  3R23 A;  1BCP C;  3T51 B;  1N36 H;  2VA2 A;  1S5F D;  1FNV A;  1WTQ A;  1NUC A;  3EJI A;  1BXR A;  3W3A A;  1DV2 A;  2N8N A;  1D1K A;  1N56 A;  5BN3 A;  1W93 A;  1EQV A;  1BR9 A;  1HUM A;  4PNY A;  4DV0 Q;  1AUV A;  4NXN Q;  4C3J B;  3U4V A;  2R92 A;  4DKA C;  1B9N A;  3DLL A;  4JI2 L;  3H3V I;  3S1R B;  3G8C A;  2CQO A;  2XC9 A;  3MC0 B;  1KJI A;  5C44 H;  1GM5 A;  5KFA A;  4J9N A;  1GHK A;  5IT9 c;  2Q8R E;  1DZ1 A;  1E4E A;  2R84 A;  2SOB A;  4RAU C;  4RH6 A;  1S5E D;  1XPU A;  4L8J A;  2I5H A;  3GTQ B;  4X65 H;  2J6S A;  5IP7 G;  4OWW B;  5JJI A;  1WVL A;  2OT2 A;  3R2T A;  5GRO A;  4BBS G;  1PH8 A;  4G7Z C;  2J7Z A;  2W57 A;  2F0M A;  2LY7 A;  5DEH A;  3PW5 A;  2EYM A;  2JQO A;  1FJG H;  2FLN A;  1A3V A;  2KA7 A;  3DM1 A;  1ZKO A;  4KD4 A;  4DV4 Q;  4LMQ D;  4IQZ A;  4A3F H;  4DUZ H;  2YZN A;  5M5Y B;  3S1Q B;  4YCV A;  1HPC A;  2GLT A;  3Q8R B;  3CW2 C;  2R86 A;  1K83 A;  2K5D A;  2F0P A;  1OTC A;  3OSO A;  2MQH A;  2D5D A;  4F4Y A;  1TWH A;  3OMC A;  4EGJ A;  2J6T A;  4IZ8 A;  4KY6 A;  1VQM A;  4JI4 H;  1ZQ7 A;  1GD7 A;  1B44 D;  2WP8 J;  1J8I A;  4MA0 A;  4K2K A;  4ETS A;  4JYA L;  3J81 E;  5JPN C;  3RAQ A;  4J8Q A;  2A6H D;  1K83 H;  2R8H A;  3KOJ A;  1NE3 A;  1IKL A;  1F77 A;  1SBB B;  3CAM A;  5DLG A;  5M5X H;  1TA8 A;  1TXY A;  1NSN S;  4DAV A;  4UCU A;  4K8J A;  4QCL A;  3NE5 B;  2ASB A;  3CCE A;  1ZYR D;  4N9T A;  3PV0 A;  4LFC L;  3RR5 A;  3NTI A;  1W2B A;  4B3M L;  2NU6 B;  4A93 B;  1U4L A;  1E24 A;  4IFD H;  1E7Z A;  4DU9 A;  1KHI A;  2YYZ A;  1XMQ L;  5KFN A;  5GAG C;  4Y52 H;  4DR1 Q;  1JB7 A;  3PCO B;  1MJE A;  3MR5 A;  2JEB I;  2R7Z B;  1B04 A;  3CCV A;  4JI5 H;  4FBT A;  4UCT A;  3GTM B;  4AYB A;  1EFI D;  1YJ9 A;  4ED7 A;  1S97 A;  3TIG A;  2LXJ A;  2B2U A;  5LYJ F;  1CHQ D;  2I46 A;  2NTS A;  3WOE A;  4NXM Q;  5KFC A;  1MI2 A;  3RF2 A;  2JYO A;  5JPM C;  4GS3 A;  4DAY A;  1SNO A;  2KED A;  4O4L F;  4O3Q A;  2YL2 A;  3JSL A;  3CCQ A;  3F8N A;  2MO1 A;  3GP7 A;  4I7A A;  3BAA A;  4X62 H;  1XNR H;  2JA6 B;  4ECX A;  3PW0 A;  1FJG L;  3PUW A;  3CQZ H;  5C4X B;  1HR0 W;  4WOR A;  2F3V A;  1IW7 C;  2CVR A;  2KOL A;  3W2D A;  3GIL A;  4DGZ A;  1BDO A;  3OW7 A;  1PTO B;  3E3X A;  1EUC B;  5C0X J;  2KJX A;  1JX4 A;  3F2U A;  2D0O A;  1HTL D;  1E4E B;  1SFO B;  2MNA A;  1JE4 A;  3PUZ A;  4HMJ A;  4HR7 B;  4F4W A;  3EVQ A;  4JI2 Q;  3KXY T;  4HIK A;  3UE0 A;  1I4R A;  4MV8 A;  4O3R A;  1KAW A;  4XQQ A;  2JEF A;  2VA3 A;  4EBC A;  3K8A A;  3SDZ A;  1GKH A;  2BQU A;  2K28 A;  1JE5 A;  1VS0 A;  4B9X A;  1IOW A;  5DQH A;  4Q8E A;  4TUY F;  2Z6K A;  2HD3 A;  3GTP B;  4GKJ L;  3R8B A;  3G71 A;  4LF9 L;  4C1N K;  4A3C H;  3HFZ B;  1WTP A;  3GO5 A;  1S72 A;  1EY4 A;  1XWE A;  2BQR A;  1ET6 A;  1N34 Q;  2V4D A;  5HGQ A;  2F3W A;  4IFD G;  3I56 A;  3AYH B;  1Z9F A;  4A3E H;  1RIP A;  4JI5 Q;  4HIM A;  4Q43 A;  4F7X A;  4OWT B;  2IBK A;  3E9I A;  3D0F A;  4FNF A;  1STA A;  3QWN A;  4X66 L;  2W8K A;  4IZO A;  3CCM A;  3T1Y Q;  1C30 A;  3KDF B;  3K0Y A;  3PUV A;  2UXC Q;  2FLP A;  1HNZ Q;  4A2B A;  3JRW A;  1YEZ A;  4DPG A;  3LX0 A;  4DV2 Q;  1PFM A;  2AQ1 B;  2Q8I B;  5C4Z A;  2W6M A;  5JVL A;  5LMN W;  1I4P A;  4O3P A;  4IUQ A;  3GTQ H;  4KKS A;  3G6V A;  3GTL H;  2R7N A;  1AP0 A;  4MV9 A;  5EWE A;  5L1K A;  1K9M C;  3ETJ A;  3NTK A;  4TRD A;  2B39 A;  2BOS A;  1VF7 A;  4OIK A;  5IT9 E;  1BOS A;  1SMY D;  4J9L A;  4DR1 L;  5JEA H;  1DYQ A;  2F0G A;  4KJO A;  2WAQ G;  2I8C A;  1WTR A;  3FHW A;  2MO0 A;  4R8U B;  3C3L A;  1UE6 A;  2VPS A;  4GOP B;  4RHS A;  2RHQ B;  4NW2 A;  4MV3 A;  4IUU A;  1DD2 A;  4FXD A;  2P5Z X;  4DK0 A;  1H9S A;  3J80 E;  1TAE A;  3RBD A;  3RB6 A;  1B3Q A;  2A74 C;  2BA1 A;  4IUV A;  5AFW A;  1XNQ L;  3M4P A;  2FK2 A;  3Q6S A;  2FPP B;  2ASJ A;  4LF5 H;  3HOY G;  4PV1 C;  1B2T A;  2XN9 C;  4WRD A;  1VQP A;  4LFB Q;  2HDL A;  2ZT9 C;  4C1N I;  2Y0S E;  2AWN A;  4LF6 Q;  2R92 G;  2UXB L;  4XZ3 B;  1JDB B;  2NUA B;  5LMN H;  1EWI A;  4G4K A;  1N32 L;  4DR4 L;  4XT3 B;  1D1I A;  4LJZ C;  3T53 B;  2Y0S A;  3ORR A;  2W6O A;  5KRU A;  1ZXT A;  1PRT F;  1VQ7 A;  2YU9 A;  1Q8I A;  5DM7 3;  4KLK A;  2J9G A;  5IWA L;  1HFG A;  5E4W C;  2R61 A;  2CH4 W;  4R8N A;  1LT4 D;  2DIK A;  1YNJ C;  4L5R C;  3CD6 A;  4J15 A;  2F0F A;  2CW8 A;  2HHH H;  1HR0 H;  4JI6 H;  4E4T A;  4YQW A;  2AGO A;  1ICF B;  5KFL A;  4Q5V A;  2W6P A;  3DWP A;  2VY3 A;  2QEJ C;  1NR2 A;  2Z4H A;  3T5H A;  1M6V A;  2R87 A;  1JOK A;  5DLF A;  4ME5 A;  1S4Z A;  4K14 A;  4ZYS A;  4OX9 L;  1HZB A;  4DUY L;  5KFX A;  1ET9 A;  2DNE A;  3RLN A;  1DON A;  3TQ1 A;  1PHJ A;  4ECV A;  2PBZ A;  2YW2 A;  3K6O A;  3GTK H;  4OIJ A;  4RUA A;  2F0L A;  1GHJ A;  4ECS A;  1RCV D;  2W7P A;  1JJC B;  2L12 A;  2VB2 X;  5CMD A;  4B3M H;  1V1P B;  5C5L A;  3UDF A;  2ZJP A;  2UXB Q;  3K5O A;  4R1J A;  1HA6 A;  3QOL A;  4JI5 L;  2OTJ A;  4HNV A;  2FMA A;  3RLF A;  1EU4 A;  3GID A;  3GTM A;  1OXT A;  3T1Y H;  1X54 A;  4X3U A;  4OO1 I;  1TY0 A;  4NP5 A;  1VQL A;  5C5M A;  4JI3 L;  2IP4 A;  1SMY C;  4IN3 A;  4IUP A;  1N34 L;  4JI1 Q;  3KJO A;  2F0J A;  2B2T A;  4YBZ B;  5ELC A;  1BO0 A;  3MXG A;  3GIM A;  2N88 A;  2L9H A;  4M8A A;  5KIX A;  4QIW A;  4A3M B;  4IPC A;  2NVT B;  4L1K A;  3V4Z A;  3MWY W;  4OHJ A;  2L11 A;  3U9O A;  1I94 Q;  3K57 A;  1TS3 A;  4FF2 A;  2OH2 A;  3I4N G;  3V4S A;  4RB2 C;  3HOZ G;  3L2P A;  2HT1 A;  1D5Z C;  3JSN A;  2JEA I;  1SE4 A;  3C2P A;  1EYC A;  1MBY A;  1JMC A;  2UU9 H;  4CDC C;  3LGJ A;  4HCS A;  3WWV A;  1KJ8 A;  5FO7 B;  4BBR B;  2FK3 A;  3EIV A;  4BY1 B;  3IKJ A;  4MTE A;  1CKO A;  3TQT A;  3PR5 B;  1JOO A;  3KLS X;  1R9T H;  5LMN L;  4RNO A;  1I4X A;  2RSN A;  1VQF A;  5CV5 A;  4IFD I;  2NVY B;  4J9R A;  3M7G A;  5M5W B;  2ATL A;  1ML0 D;  1ILQ A;  3HOY B;  1XXG A;  3RZD B;  2V59 A;  2R3Z A;  2M9V A;  1SNQ A;  4Y7N H;  2JEG A;  4APM A;  1N48 A;  4BY7 B;  3G48 A;  1IKM A;  4ZAI A;  3CRL C;  2NB0 A;  3GTL B;  3K59 A;  3PF4 A;  1N32 Q;  2I80 A;  1HTP A;  1KNE A;  4IJH A;  3TP6 A;  4L6T B;  4ECT A;  3BQ0 A;  3IFT A;  5FO8 B;  3M9M B;  4JYA Q;  3RV4 A;  3U4Z A;  5K36 G;  3J7A K;  1G51 A;  1M0T A;  4H02 A;  2TMP A;  3PIO 3;  5KG6 A;  4EEY A;  2EPB A;  2HHH Q;  2ZDQ A;  1XJV A;  4RKL A;  3STB C;  1G2S A;  3GTM H;  4RB3 C;  5ELN A;  5JJL A;  2KEC A;  2C22 A;  1RJQ A;  1B3A A;  3QB3 A;  1F9Q A;  2WB1 G;  3MR2 A;  3VPD A;  3I4M B;  4QUF A;  4JV0 A;  3GTG B;  1PTO C;  2FIN B;  2CZG A;  4EYI B;  2C28 A;  3K80 C;  1HQR D;  1RHP A;  3U50 C;  1PVO A;  2AQ2 B;  3E5N A;  3DXJ C;  3FDT A;  3LWU A;  1XMQ Q;  4XYO A;  3OTO L;  3PW7 A;  4PZ6 A;  2JA8 B;  1WOC A;  1A63 A;  5KEE A;  1WH2 A;  1F9S A;  4POG A;  1GVP A;  4DV3 H;  1GUG A;  4LK1 C;  3OUU A;  1TWA B;  2MFI A;  1UWV A;  2NN6 I;  1LTL A;  1H9M A;  4O2D A;  4B3R L;  5GON F;  3J7A V;  2W9B A;  4JBW A;  4MAM A;  4E6I A;  2Z4I A;  2F3I A;  3OOC A;  1RK6 A;  4MV6 A;  4B3T H;  1WCM H;  1Z6H A;  1VQN A;  1BGW A;  5KFD A;  5IYD G;  3MR6 A;  4DUY Q;  3CRK C;  1PA6 A;  2G9D A;  1VQA A;  1Y1V A;  3G6Y A;  2K5Q A;  1NMF A;  3HKZ G;  5CBE E;  1UNN C;  1IBK Q;  2PZU A;  2SNM A;  2PI2 A;  2FHT A;  5EQ0 A;  4C3I H;  3LP8 A;  5F9N A;  5JAV A;  5FJ8 G;  2HIV A;  3Q23 A;  4A3J B;  1R4P B;  1M7J A;  1MZB A;  5DGB A;  3KF6 B;  1X32 A;  3NPP A;  1BJT A;  4UP9 A;  1K0R A;  3H09 A;  1EHI A;  1IOV A;  2VUM B;  4DV0 L;  3E0E A;  3R93 A;  1EUD B;  1Q86 C;  2ZM6 Q;  4X65 Q;  4LFA L;  2UUB L;  3EA6 A;  4XYL B;  5LMU H;  1KXL A;  4Q8F A;  1B8A A;  4ZOL F;  3BQ1 A;  4HJ8 A;  1HNZ H;  4DR7 Q;  2UVV A;  4KHP L;  1LTI D;  2Q2I A;  4HSP A;  3DEO A;  5CV4 A;  3J81 c;  1RL2 A;  2AKW B;  5IYC G;  1E4G T;  1C4Q A;  3GQB A;  4EGV A;  1WFQ A;  1X3P A;  3B6Y A;  4ODG A;  2XIW A;  3CPW A;  1I94 L;  3CC4 A;  2YZM A;  4J0M A;  4DNT B;  2F4V L;  3I2Z A;  4NXN H;  4JI6 L;  1A62 A;  4A3I B;  1DOM A;  1VQO A;  2E2H B;  2M05 A;  4P2C B;  5T1I A;  2ASL A;  4DV6 H;  1HZ9 A;  2ZTC A;  3RN5 A;  1AE3 A;  3S1M B;  5C0X I;  2PPB C;  4A3G B;  4J9P A;  2A8V A;  4RKB A;  4XQN A;  3J7A F;  2IPK D;  4Z9C B;  4YHH L;  1VQ5 A;  2CW0 D;  5JQW A;  4UCV A;  2JP1 A;  4TQU S;  1MSG A;  3J7Z C;  3CMA A;  4B9W A;  2VQF Q;  2UXC L;  1G6Z A;  1L1O C;  3K3V A;  1C3O A;  4DV2 L;  1BXT A;  4TSS A;  1X65 A;  4RGO S;  1ZEQ X;  2F0Q A;  1HJP A;  3I3C A;  3V96 A;  1LTS D;  3VMM A;  1K8M A;  4LFA H;  1KQS A;  3LWB A;  4AYB B;  1PZI D;  3PIP A;  1YNN C;  1QCB D;  4DV3 L;  1L1O B;  3UQ8 A;  4X3T A;  5L1L A;  1QVF A;  2R7F A;  1V1O A;  4PZ8 A;  3GII A;  2W9C B;  2XVS A;  3ERQ A;  3PMF A;  1TWA A;  3CCJ A;  1TS2 A;  5KFV A;  4QW8 A;  3EQL C;  2NZ1 D;  4QWA A;  4A3D B;  2V58 A;  2WAQ E;  2EYJ A;  3GTP A;  4A3F B;  4R4Q A;  3VR4 A;  4CJ2 C;  3H0G G;  3RNU A;  2HDM A;  2XGQ A;  1TU2 B;  2QDB A;  2F0I A;  3OW2 A;  3T5K A;  1GJX A;  5T1G A;  3QOJ A;  1KLU D;  4YHH H;  5BPF A;  1B4O A;  2L0C A;  4F50 A;  4AIM A;  4DNI A;  1N33 Q;  2PMZ B;  2R7M A;  4TV9 F;  3NXW A;  5D65 A;  2RVL A;  5K36 H;  2JXM B;  3L9A X;  3PUX A;  1NMG A;  4HR7 A;  4YWM A;  3KLR A;  3V05 A;  4DR6 L;  4UY8 C;  3F2D A;  4DR1 H;  1CZG A;  3TZU A;  3T56 B;  3I4M H;  4UP8 A;  2UUA H;  3OWE B;  1EZ8 A;  2XCA A;  4LUZ A;  5ELO A;  3BA9 A;  1YI2 A;  4B3R Q;  3RN2 A;  3BVG A;  3VYS A;  3A5Z B;  4EFE A;  2WIN B;  5J3B A;  1A3U A;  1N9W A;  3KUP A;  3RZD H;  3GDE A;  1M4V A;  2VZA A;  3PVX A;  1X55 A;  1I3Q H;  4FF4 A;  3GV6 A;  4IRC A;  5JVD F;  3CU7 A;  2KCT A;  3ERO A;  1RYR A;  2F0W A;  4G3I A;  3HZX A;  5KND A;  5KNC A;  2HVR A;  5EKI A;  2DN8 A;  3URY A;  1AN7 A;  4IAJ A;  1I50 B;  1S0M A;  3GQC A;  3MR3 A;  2R93 A;  1DOK A;  1V9P A;  3QR8 A;  1U4M A;  1G2T A;  1IYU A;  1XX8 A;  1JQY D;  1O7L A;  4UCR A;  3VR2 A;  2ALY B;  3GTG A;  1MGS A;  4L63 B;  5CAE B;  4HNU A;  3L3O C;  3SHL A;  3TDQ A;  1BKB A;  1JIC A;  3KLW A;  1F2Y A;  3MEF A;  4G57 A;  2F0H A;  4FS2 A;  1S0O A;  1B1Z A;  3FKI H;  4O2A F;  2C35 B;  3BJY A;  1Y14 B;  1PH1 A;  1LLR D;  1X9N A;  4MNO A;  3P20 A;  3M4O H;  2AQ3 B;  4JUZ A;  4KHP H;  1ESF A;  3HOX H;  4HTH A;  4FYD A;  3ICE A;  1Q1B A;  1KRT A;  3JC6 6;  4RCO A;  3BYY B;  2B8G A;  5KFM A;  3KF8 A;  2JA8 H;  2CQA A;  4EVO A;  4ECU A;  3MXN B;  3PW2 A;  4MTK A;  5KG1 A;  1L1O A;  4JI1 L;  2CQY A;  3CCU A;  4LH6 A;  5KFZ A;  5LMU Q;  2ZM6 H;  1PYW D;  2JEJ A;  3I8Z A;  4RZQ A;  3CKI B;  5EDW A;  4B3S Q;  3U9T A;  2BDN A;  1GLV A;  2VQF L;  3GV3 A;  3OUZ A;  1TS4 A;  1VQE A;  3J80 i;  3LWE A;  3K5L A;  2W71 A;  4CKE A;  2GVB A;  2TSS A;  1A15 A;  3WO0 A;  4DK1 A;  5K5P A;  1EYZ A;  1Q12 A;  4A93 H;  2JA5 H;  4G7H C;  4JI8 Q;  4TV8 F;  3PO2 B;  4AQY L;  2AQ4 A;  4JI7 H;  4IPD A;  3J80 W;  1V43 A;  4O2B F;  2BE5 C;  3HB9 A;  2YRW A;  1CQF A;  4AYB G;  4ALP A;  3BZC A;  5C0X G;  5JEA J;  3CME A;  3I4N H;  2SCU B;  5I2Y A;  4BWG B;  3TME A;  1QVC A;  4APV A;  4PZ7 A;  3NK9 A;  4M7E A;  3T1H H;  2B2V A;  3CCL A;  5ELF A;  1I6U A;  1EY7 A;  2Q2T A;  1FD7 D;  4CJ1 B;  1T5E A;  4ED1 A;  5KFU A;  4LSA A;  1JIH A;  4OL7 A;  1YIT A;  5EWF A;  1CQJ B;  1N33 L;  2E2H H;  4KHV A;  5KT2 A;  2HJW A;  1YVC A;  3S1M H;  4YJ3 F;  3RAX A;  2C00 A;  4DR6 Q;  4DK6 C;  4UCS A;  2AWO A;  4YY3 L;  2WB1 E;  2R8I A;  2F0K A;  4GN5 A;  3NQT A;  3S1N B;  3CC7 A;  5CV8 A;  1QWY A;  3R3O A;  3K5N A;  2WAQ A;  3H4D A;  1RD9 D;  3FKI A;  3SK8 A;  2HIX A;  5I47 A;  5BR8 H;  2YS7 A;  3ERS X;  4UFZ A;  3OSP A;  3M9N B;  2IMW P;  2IA6 A;  2HHH L;  2A73 B;  4I7Z C;  4GKK Q;  5HBR B;  3PZP A;  4V0B A;  3S1Q H;  4K0K L;  3GTP H;  1E3P A;  2N3S A;  2E5L H;  4QWB A;  4F4Z A;  4J9Q A;  4R4O A;  3GIK A;  5CV7 A;  2E8G A;  1I6H H;  2OTL A;  3MFH A;  1HNW H;  4JYA H;  4H0L C;  2F0S A;  4CDE C;  3DF7 A;  1W6J A;  1Z2N X;  1PLF A;  2D62 A;  4NXM L;  1RF2 D;  4P72 A;  2R92 B;  2LMC B;  1Q81 C;  1K83 B;  3NBH A;  2K03 A;  1Y8O B;  3P75 A;  3F1Z A;  2VUM H;  2E5L Q;  4RWS C;  1K1Q A;  4LFC H;  3A74 A;  3GV8 B;  1FJG Q;  4ED3 A;  1H9J A;  5EBD A;  4A3E G;  3M7N A;  4FF3 A;  2NYZ D;  3AQQ A;  1WD0 A;  3FPP A;  1BF4 A;  4LF4 L;  1TKW B;  3PR4 A;  2VUG A;  5T14 A;  4EFB A;  1ENA A;  4JI3 H;  1LV9 A;  4YAJ B;  4P73 A;  4B3S L;  1GO3 E;  4JI0 L;  2IX0 A;  2JEI A;  3N42 B;  3KHH A;  5C1O A;  3AB9 A;  2VOB A;  4A3B B;  3MFG A;  1Y1V G;  4CDD C;  4JI4 L;  1T36 A;  4JI1 H;  3ETH A;  3PIO A;  3HKZ B;  1J6Q A;  1VQ6 A;  1AFP A;  4I50 F;  1IZ6 A;  4DV6 L;  2E2I B;  4LF8 H;  3FKI G;  4UP7 A;  3CVZ A;  1Q1E A;  2WTF A;  2UU9 L;  2A6H C;  3T16 A;  1YJN A;  4OO1 H;  5GAD C;  5IT9 W;  5BN5 A;  1XMO H;  3M4Y A;  2DY7 A;  2VNU D;  4DR7 L;  4KN7 C;  1H9K A;  3SE7 A;  1IL8 A;  3VPC A;  3DWQ A;  2BA0 A;  3OIP A;  1ZYR C;  4K5W A;  5D1O B;  4DR2 H;  5IYZ F;  2JA6 A;  2J6U A;  4K5X A;  3U9S A;  3HGB A;  2Q2H A;  2R7Z A;  1Y1W H;  3S16 B;  1CTM A;  4NDX A;  1BNC A;  3HP3 A;  1DOL A;  5FLX W;  4A3K B;  2QK4 A;  1HHV A;  4A3L G;  1X6O A;  1LTR D;  2RDG A;  1TWF H;  3SXH A;  4BA2 I;  3SK5 A;  5CA0 F;  2JA5 B;  1IYV A;  3FKI B;  3ONA B;  1VQ8 A;  5C4J B;  4A3D H;  4LF7 H;  1Y8P B;  2N49 A;  2KCC A;  2LFN A;  5EBC A;  1F2M A;  1S9F A;  5IGC A;  2A1A A;  4DL6 A;  2SEB D;  2NU8 B;  4TQS A;  1A2T A;  1TWG B;  5L37 A;  4BY1 H;  3D4D A;  2VS1 A;  4FU0 A;  3K5M A;  5KFF A;  1E1O A;  5EAY A;  3F2B A;  3UDI A;  2IW3 A;  4BBR G;  4HN7 A;  1WYD A;  4A76 A;  1XNQ H;  4GKK L;  2DNC A;  1JOQ A;  4ZUJ A;  1K28 A;  2XIG A;  4ECQ A;  4JK1 C;  1J5E H;  2ENB A;  2EYO A;  1IBL Q;  2ID0 A;  4CGY B;  3NEN A;  3BDO A;  4R9W A;  2B8F A;  4AYB E;  4Y7N B;  5I4D A;  1CFM A;  2IHF A;  3RZO H;  3W5O A;  1X56 A;  2Z1C A;  2JA5 G;  2W6N A;  1X3Q A;  1E22 A;  1J5E Q;  4C5C A;  2YRX A;  4O42 A;  4YCU A;  1SYX B;  1BUV T;  5IWA H;  3RLO A;  1JT8 A;  1GSA A;  2VW9 A;  1HA5 A;  4U7C A;  2UUC Q;  1NNX A;  4MHE A;  2OQK A;  3OYY A;  5ELD A;  1SNC A;  4DV1 L;  4A3D G;  5CGK A;  2FMM A;  2LS0 1;  2R85 A;  2VB3 X;  1YJW A;  2FLL A;  2B2Y C;  1CUK A;  1WTX A;  1PH7 A;  4X64 L;  3JRX A;  2DY8 A;  4ZK9 B;  2L1B A;  4EQO A;  4DR4 Q;  1CQI B;  4CJ0 B;  4DR3 H;  1L0X B;  2N78 A;  3CC2 A;  1RYS A;  3LNN A;  2OQ0 A;  3H3V H;  1KAA A;  2NVT H;  3OHB A;  5CBA E;  3R5X A;  3BG3 A;  2AGP A;  4C3H H;  1P8L A;  1F9P A;  3JAM i;  1PRT B;  5JOB A;  5KFJ A;  1V51 A;  2UXC H;  1SE8 A;  5KG0 A;  2R93 G;  1KRS A;  2PYK A;  2RQX A;  4J9K A;  2KHJ A;  1CA6 A;  2MJ8 A;  3NTH A;  1VDZ A;  4LNQ A;  1I7L A;  5E1F A;  2ATW A;  4YY3 H;  5D3I B;  2A69 C;  5KG3 A;  3F2C A;  1EIG A;  1VQC A;  2EYL A;  1CS0 A;  1JR0 D;  1OXU A;  2FK1 A;  5CV6 A;  5TSS A;  3GIQ A;  4PWQ A;  2NVY H;  4DN4 M;  1AN8 A;  2R93 H;  3RIZ A;  5KT6 A;  4OX9 Q;  1SRU A;  1QUQ A;  1O7Z A;  2IWH A;  1PH6 A;  2QYZ A;  2YZG A;  4O4I F;  5KFT A;  2AUK A;  1W96 A;  2VR1 A;  3A8I E;  4P75 A;  2SNS A;  4RGN A;  3OWF A;  3C1E A;  3HOW B;  3S1N H;  1GGO A;  1D7Q A;  5M3F G;  2K01 A;  4QIW E;  1EY5 A;  2F1M A;  5IP7 H;  2FP4 B;  2OXP A;  4RNM A;  1YZ6 A;  1SN8 A;  1KEE A;  2A68 C;  3DUZ A;  4ED8 A;  2YCH A;  1I3Q A;  2E76 C;  4LH7 A;  3J81 W;  4DF7 A;  4GNX A;  4DV7 L;  2NVQ H;  2EXZ A;  3GTJ A;  2JA7 G;  4NKL A;  2Z6B A;  4TKO B;  2B2W C;  5EJW A;  4POF A;  3W1B A;  1FVI A;  4QB4 A;  3K0X A;  2BDO A;  3O13 A;  1YIJ A;  2VUM G;  4YAK B;  1IYJ B;  2HGS A;  3H0G A;  2B2V C;  5CA1 F;  2DLN A;  1AEX A;  1TQO A;  1Q90 A;  3RFC A;  4GNX C;  3OTO H;  2WFW A;  2PI2 E;  4ABN A;  2KHS A;  4JI8 L;  1ZHS A;  2ICI A;  1OXX K;  1STY A;  3MFI A;  3BA8 A;  2EJF C;  1IBL L;  1AW7 A;  4DV1 H;  1SXT A;  1SDF A;  4X62 Q;  1XNR Q;  2RCF A;  3AFQ A;  3P7J A;  2GPS A;  2VXW A;  4HQ6 A;  2K33 A;  2IHE A;  4HSV A;  5I9P A;  3Q8Q B;  2PQE A;  3NSW A;  3C46 A;  4DR5 Q;  2EJM A;  2E2I A;  3D31 A;  1TWA H;  2IY5 B;  1JCK B;  4DV5 H;  5JEA G;  2F0U A;  1U0L A;  4GKK H;  4LF5 L;  1KNA A;  1EWC A;  1VQG A;  4AQY Q;  1BCP B;  1A3T A;  1OXS C;  2CWP A;  1YHQ A;  1TS5 A;  2X0S A;  1GUT A;  4J9S A;  2PNH A;  1B53 A;  2KCN A;  1EL0 A;  4NLG A;  1X3F A;  4ECY A;  3ITP A;  1QJO A;  1LTB D;  4C5B A;  3HOU B;  1XMO L;  3VA7 A;  4ZQI A;  3S14 H;  5FLX E;  1CK1 A;  1PDQ A;  4DR7 H;  5IOD A;  1LAC A;  4A3M G;  1J5E L;  3UI2 A;  1XPR A;  3ER0 A;  1S03 G;  4JV5 H;  4EBE A;  2A5H A;  4XQJ A;  1YHA A;  4K2L A;  1Q8K A;  4LUO A;  5COY A;  1EYD A;  4RMF A;  1A2U A;  1CSP A;  3SEB A;  4YY3 Q;  1EQQ A;  4JI8 H;  4GKJ H;  3G6E A;  1X3G A;  4BBS B;  3NGD A;  5C3W A;  1AE2 A;  5M5W H;  5IGE A;  2NU9 B;  1RTO A;  1AH9 A;  1K3R A;  1VF5 C;  3GTK A;  1KL9 A;  4O3N A;  4LF7 L;  2K32 A;  5F2D A;  5KFO A;  3T1H Q;  3BJU A;  4BY7 H;  3CHB D;  1EZ1 A;  5KFE A;  4IUT A;  2O5J C;  4LWC A;  1L0W A;  1KDB A;  3MWM A;  4B3T Q;  2B63 B;  5M3F H;  3RGX A;  5IYC H;  3FRP B;  4C3J G;  2F0D A;  3MVV A;  3H15 A;  4ZHQ F;  3E0J A;  4N8X 1;  1PH2 A;  4BY7 G;  4L5Q A;  1GYF A;  2K4K A;  4LMY A;  1SYG A;  5C5J A;  2FJ2 A;  4DR2 L;  1CE8 A;  5KX5 F;  1D2B A;  1LUZ A;  2RSO A;  1C0A A;  5DQG A;  5AJ3 L;  3GTL A;  2DPJ A;  3MTS A;  3S15 B;  1GUS A;  1I4G A;  1DXM A;  5J22 A;  4DV7 Q;  1JDE A;  1FR3 A;  1I4Q A;  1Z2O X;  4JI0 H;  1B50 A;  3WOF A;  4DV5 Q;  4CDF C;  2B2W A;  4MV1 A;  4B3S H;  4HJ5 A;  4FS1 A;  1HNX L;  3M85 A;  4QF4 A;  1GUO A;  4C3H G;  4ED6 A;  4BWS C;  2EE1 A;  3S2H H;  2F03 A;  4EQ5 A;  2UXD Q;  4J1M A;  3BZK A;  2XCP A;  2E5L L;  4NMZ A;  1U5K A;  1KBL A;  4FXG C;  3BQ2 A;  2EJG C;  4DAP A;  2RBM A;  3CCR A;  2E75 C;  3I4L A;  5L9X A;  1NTG A;  4ECW A;  5HUR A;  5KFR A;  2L15 A;  4JG2 A;  2K5N A;  2JA7 B;  1L2F A;  1IBM L;  2RF4 A;  4AH6 A;  5FK9 C;  5FLX c;  4X65 L;  2V1C C;  4IR1 A;  5IYB H;  1SND A;  3FEW X;  2NBF A;  2PQA B;  4XTC S;  5BN4 A;  5M3M B;  4KHP Q;  4HYK A;  2UVR A;  2D0P A;  1F9R A;  5LP6 F;  1QB5 D;  1B70 B;  4A3K H;  3M4O B;  2MGS A;  4JI0 Q;  1AZP A;  3M9B A;  1QNK A;  3STB D;  4X66 Q;  1VBH A;  2ZXO A;  3RV3 A;  3OPO A;  2UUA Q;  3QJY A;  1C9O A;  2FMC A;  4C3H B;  3T1Y L;  4PG3 A;  4MV7 A;  3OHA A;  2W9B B;  2RCN A;  2DUD A;  2J0T D;  4ED0 A;  1E2W A;  3A54 A;  5IP9 G;  3L4J A;  4GC7 A;  3H0G H;  1VQJ A;  3MFY A;  2E2J B;  4JV5 Q;  1PX2 A;  3HRZ C;  3A8K E;  5KG7 A;  1K1S A;  4K0K H;  3FDS A;  5EKL A;  4YHH Q;  2VPQ A;  2XSC A;  3GTO H;  2FKL A;  4DR5 L;  4NXN L;  3QZ7 A;  2QF7 A;  4OX9 H;  5KYL A;  1TVX A;  2DWC A;  4DR3 L;  3NQI A;  5C3E G;  5IGB A;  4GLA C;  3I12 A;  3HOV G;  1EY9 A;  5A35 A;  1VQK A;  2RGR A;  2DGY A;  2IL8 A;  2A19 A;  3I73 A;  3D8G A;  3I91 A;  1Y1W A;  2UVW A;  1JKJ B;  2VUM A;  4DL5 A;  2F52 A;  3K7U C;  1C7Y A;  4UCO A;  2HQL A;  5EKK A;  3WDN A;  4R4T A;  1JB3 A;  3TP7 A;  5M5X B;  2NZH A;  1K73 C;  1KD1 C;  4OO1 G;  1CKN A;  4L5S A;  4CKC A;  2EOT A;  3K81 C;  5C8Y F;  4FBU A;  4OEM B;  1LT6 D;  1SEB D;  1HXY D;  3IRB A;  5FD5 A;  1SFO H;  3S17 B;  3PO3 B;  5IP9 H;  2Z0S A;  3F8T A;  1TII D;  1R9T A;  2B2Y A;  2FPG B;  3TP5 A;  4ID6 A;  1QE6 A;  2XRS D;  4A3I G;  4LFB L;  4K0K Q;  3SR1 A;  1QZH A;  3PSI A;  1S5C D;  1STH A;  3CPF A;  1CQV A;  2DJG C;  2LXK A;  1DM0 B;  2K5V A;  2NUC A;  3KHL A;  2W6Q A;  4A75 A;  3EBE A;  4XX0 B;  4LFC Q;  2JJQ A;  3MA2 B;  5KYI A;  2RDH A;  3PIP 3;  2F0N A;  2F4V H;  1ENF A;  4JW0 A;  5EOY A;  3DM3 A;  3HG9 A;  4X66 H;  1EU3 A;  3AFP A;  2KBN A;  5D14 A;  4DV5 L;  4B3T L;  1IL2 A;  3CQZ B;  3WNZ A;  3H6M A;  1GUN A;  2E2H A;  1FNU A;  1U4P A;  1LT5 D;  1STN A;  2O2L D;  5IGG A;  2J4X A;  4GLV B;  3J81 j;  4RU9 A;  2QEX A;  1LM0 A;  1TWH H;  3KBG A;  1O80 A;  3CP0 A;  2JA8 G;  1N8R C;  1MKH A;  4LUV A;  1CM9 A;  3A0J A;  2EYH A;  3U58 A;  1WTW A;  3T13 A;  4WJW A;  5G3L F;  3M3Y H;  5JJK A;  3A7L A;  4H7B A;  3LML A;  2UXD H;  5FJ8 H;  1WTO A;  3HOW H;  1GSH A;  1BBW A;  1JJG A;  3SK6 A;  4DUZ L;  1M8A A;  3S14 B;  1A6X A;  3QZ8 A;  1O7I A;  5FKA C;  3IN5 A;  4A2A A;  4A3F G;  1PXU A;  4DR6 H;  4PQX A;  1FYC A;  4DV6 Q;  4QWD A;  3BDL A;  3W1G A;  4IFD J;  4RGM A;  3VPB A;  1SJE D;  2JN4 A;  4UHV A;  3H20 A;  2NU7 B;  4JV1 A;  5IGD A;  2JA5 A;  4MZ9 A;  5KGU A;  1KC7 A;  3MXU A;  5NUC A;  5IIF A;  3HXL A;  2PZW A;  1K8O A;  1EY6 A;  3G6X A;  3PW4 A;  2KVM A;  2JA9 A;  2B63 A;  1V8Q A;  2V9W A;  4PMW A;  4LF9 Q;  3M9O B;  4QGU A;  2YU9 B;  1BBX C;  1CKN B;  1XDN A;  5IGF A;  4KTA A;  2M2L A;  2QDL A;  5IE8 A;  4RG1 A;  2JE6 I;  4C2M H;  4UAI A;  5D8D A;  4KY7 A;  2O4X A;  2R6F A;  3R5F A;  5FPR A;  1MHW C;  5M3M H;  1STE A;  1R4Q B;  2AUJ D;  2K52 A;  3MJF A;  1O78 A;  4A3M H;  1X3E A;  1EUJ A;  2EXD A;  1WJJ A;  2Y0S B;  2WDT A;  4MV4 A;  1D6E C;  5J2U F;  1PTO F;  2K75 A;  3RB0 A;  1UEB A;  4PMB A;  4X6A H;  4RZR A;  3RB4 A;  2R7D A;  1AZQ A;  4RA8 A;  4DR3 Q;  3N52 A;  5J2T F;  3BYT B;  1TWC B;  2FFK B;  1II3 A;  3E9H A;  1EQT A;  1ROD A;  1CKM A;  4KHZ A;  4X62 L;  1XNR L;  1PYB A;  2FB9 A;  3JAM c;  1HNW L;  2NVX B;  3S2H B;  4PDB A;  2RDF A;  1ULZ A;  4JOI A;  5IT9 L;  3KJP A;  3A7A B;  4BY1 G;  3JAM L;  2MHV A;  1VQB A;  2CHB D;  3SGI A;  5KG5 A;  5KFG A;  1EEF D;  2XRQ D;  4U6P A;  2R6G A;  1D5X C;  2E2D C;  4EX5 A;  1PTO D;  3V6J A;  5CB4 F;  2AU0 A;  4M1U B;  4EEQ A;  3TEH B;  2R92 H;  4LF8 Q;  5HV6 A;  4O0A A;  1TWF B;  4BS9 A;  4ZRZ A;  5JVG 3;  3VYT A;  2ZXP A;  4JV2 A;  1B6S A;  5JH7 F;  1CSQ A;  1A0I A;  5EPK A;  5EWG A;  3FMA A;  3L4K A;  4FVM A;  1QOH A;  3TRZ A;  1SYD A;  1BQQ T;  1FKA H;  5GAH C;  1XNQ Q;  3HOX G;  3N43 B;  3PO2 H;  4I55 F;  2R7L A;  1EOT A;  4IHJ F;  3OTO Q;  3TRE A;  4I4T F;  5KFH A;  4LAA A;  2LSS A;  3H0G B;  5BR8 Q;  2JK8 A;  4KJN A;  1XMO Q;  2E2J H;  2YTY A;  1B6R A;  1RDP D;  1UE7 A;  3J81 L;  4EG0 A;  2NN6 H;  5DLQ E;  1PH9 A;  2GVA A;  5LHY 1;  3PO2 G;  2DPI A;  1HZA A;  3UE1 A;  4LF7 Q;  1IBK L;  4ECZ A;  2EY5 A;  2E2I H;  1IBM H;  3GLK A;  1B9M A;  4H13 C;  2NVY A;  1SYB A;  3DMU A;  4IJL A;  1QIL A;  2I07 B;  1FGB D;  3I55 A;  3ULJ A;  1JJ2 A;  5KT5 A;  1MJC A;  1PFN A;  4FO2 A;  4O1N A;  2XD4 A;  2JSO A;  2UUB Q;  2ZJT A;  5LL6 S;  2XGP A;  4DR2 Q;  3C0F B;  4FM9 A;  1SLJ A;  4I65 A;  5AJ3 Q;  1E2V A;  3HEJ A;  3RTX A;  2WKC A;  2CKZ B;  5G3L D;  3S24 A;  4RB0 A;  5LOV F;  4EQP A;  5HY6 A;  1NR4 A;  1ASY A;  4IWY A;  4L5T A;  2I5L X;  1YNJ D;  3JAM E;  2NWG A;  4ZKC B;  3FVQ A;  2B2U C;  3TP8 A;  2LKV A;  3D6W A;  4DL4 A;  4WJ4 A;  4PMC A;  2B63 G;  1I94 H;  4P74 A;  1PRT D;  3NWT A;  1G29 1;  1S0N A;  5A2Q E;  1S40 A;  2ZJR A;  1TWC A;  5H1S E;  4ME3 A;  3DEP A; 
#chains in the Genus database with same CATH homology
 1Y1V H;  2N78 A;  4H02 A;  1KIX A;  3CC2 A;  2OQ0 A;  2HHH Q;  1HR0 Q;  1OXV A;  2H5X A;  2NVT H;  3H3V H;  1XJV A;  2R7Z H;  4A3L H;  3STB C;  4A3J H;  3GTM H;  5ELN A;  1QZG A;  5JJL A;  4GN4 B;  2WB1 G;  4C3H H;  1P8L A;  1IBM Q;  3HKS A;  3JAM i;  1EYG A;  4JI3 Q;  5M3M G;  2RHS B;  3K80 C;  2YV5 A;  3U50 C;  1SE8 A;  1PVO A;  1XPO A;  1VQD A;  1KRS A;  2OCE A;  4QL5 A;  2R93 G;  2KHJ A;  1XMQ Q;  2PMZ E;  2QA4 A;  4LNQ A;  1BBU A;  1QUQ B;  3OTO L;  2ATW A;  2NN6 G;  4PZ6 A;  1SRO A;  4OON A;  1EFW A;  2UXD L;  4DAY B;  1M1K C;  1HH2 P;  3F2C A;  1VQC A;  3GTG H;  4JOI C;  1OXU A;  2ZJQ A;  1WOC A;  1A63 A;  2NVY H;  2R93 H;  2GN5 A;  4XIG S;  1Q82 C;  2UUA L;  4POG A;  4OX9 Q;  1SRU A;  1QUQ A;  1PH6 A;  1GVP A;  4YWK A;  3AEV A;  2IT1 A;  4P75 A;  3J81 i;  1NJI C;  2MFI A;  1UWV A;  2NN6 I;  4GN3 B;  1LTL A;  4O2D A;  4DV4 L;  3S1N H;  5M3F G;  4JI7 Q;  4B3R L;  1D7Q A;  2CWA A;  4MTN A;  4JBW A;  4QIW E;  5IP7 H;  3T1H L;  1T9H A;  2F3I A;  1YZ6 A;  1HNW Q;  1SN8 A;  3M4Q A;  3PGZ A;  1WCM H;  1VQN A;  2FXQ A;  4NB3 A;  3ULP A;  5IYD G;  4DUY Q;  4GNX A;  4DV7 L;  1PA6 A;  2NVQ H;  1KC8 C;  1VQA A;  2JA7 G;  3KF8 B;  1NMF A;  2AHO B;  3HKZ G;  4DAM A;  3K7A H;  2IX1 A;  1IBK Q;  4POF A;  3W1B A;  2PI2 A;  1VQI A;  1FVI A;  5GQO A;  4C3I H;  4GNX B;  1QVG A;  3K0X A;  4IOC A;  5FJ8 G;  2HIV A;  1YIJ A;  2VUM G;  2UUC L;  1K8G A;  3PO2 G;  3KF6 B;  1IYJ B;  4UP9 A;  2BH8 A;  1G6P A;  1K0R A;  2JA6 H;  5LMN Q;  5C4X H;  4DV0 L;  3E0E A;  2CCZ A;  4BBS H;  4GNX C;  3NEL A;  2WFW A;  1Q86 C;  4BXX H;  2ZM6 Q;  2PI2 E;  2KEN A;  4X65 Q;  3CXC A;  2UUB L;  4LFA L;  4JI8 L;  1KXL A;  1B8A A;  4HJ8 A;  1N36 Q;  1OXX K;  4JC0 A;  4DR7 Q;  4KHP L;  1WI5 A;  5E7N A;  5FLM G;  2Q2I A;  3J81 c;  2EIF A;  1RL2 A;  2AKW B;  5IYC G;  1IBL L;  1WFQ A;  4OXP A;  4X62 Q;  1XNR Q;  3B6Y A;  4BXX G;  3AFQ A;  4A93 G;  3CPW A;  2K50 A;  1I94 L;  3CC4 A;  5C4X G;  2F4V L;  2IHE A;  3I2Z A;  3UDG A;  4IPH A;  4JI6 L;  4DR5 Q;  1A62 A;  5C44 G;  3D31 A;  1TWA H;  2IY5 B;  3BU2 A;  1VQO A;  2CFM A;  4A3B G;  5JEA G;  1UE1 A;  3HOU H;  1P16 A;  1U0L A;  1HZ9 A;  2ZTC A;  4LF5 L;  3RN5 A;  1AE3 A;  5IYB G;  1VQG A;  2NZO A;  5C4J H;  1XTD A;  2CWP A;  1OXS C;  5C0X I;  4AQY Q;  1YHQ A;  1VCI A;  2B29 A;  2A8V A;  4WJ3 M;  2Q2U A;  2PNH A;  5IY0 A;  4YHH L;  1VQ5 A;  1X3F A;  4A3I H;  1PH3 A;  4A3G G;  4TQU S;  1XMO L;  3S14 H;  3J7Z C;  3CMA A;  2VQF Q;  2UXC L;  3S2D H;  1L1O C;  4A3M G;  1J5E L;  1XPR A;  3ER0 A;  4DV2 L;  1EQR A;  4X64 Q;  1YHA A;  1X65 A;  1Q8K A;  4GOP A;  1HJP A;  4LUO A;  4RMF A;  2N8N A;  2ZTD A;  3EN2 A;  1CSP A;  4YY3 Q;  4DK3 C;  1KQS A;  1EQQ A;  2B3G A;  4DV0 Q;  3L7Z C;  3PIP A;  3G6E A;  1X3G A;  4DV3 L;  4NXN Q;  2BH2 A;  1L1O B;  3U4V A;  1AE2 A;  4DKA C;  5M5W H;  3HOV H;  3DLL A;  3H3V I;  4JI2 L;  1QVF A;  2R7F A;  4PZ8 A;  2ES2 A;  2CQO A;  1K3R A;  1AH9 A;  3CCJ A;  1KL9 A;  4LF7 L;  5C44 H;  1VQ9 A;  1I50 H;  3PUY A;  1GM5 A;  1LYL A;  3T1H Q;  3BJU A;  4C3J H;  1WCM G;  5IT9 c;  4BY7 H;  1XPU A;  4LWC A;  2I5H A;  2WAQ E;  1L0W A;  5IP7 G;  4OWW B;  5JJI A;  4B3T Q;  4R4Q A;  5M3F H;  5GAE C;  3H0G G;  3RNU A;  5GRO A;  5IYC H;  1PH8 A;  4BBS G;  4YCW A;  3OW2 A;  3H15 A;  2JQO A;  1PH2 A;  4BY7 G;  4L5Q A;  2K4K A;  4DR4 Q;  4DR2 L;  4A3G H;  4AIM A;  4DNI A;  1N33 Q;  1LUZ A;  1C0A A;  4DV4 Q;  4A3F H;  1BVS A;  5AJ3 L;  3PUX A;  1NMG A;  4YCV A;  4YWM A;  4DV7 Q;  3CW2 C;  4DR6 L;  4JV5 L;  4UY8 C;  3F2D A;  2F4V Q;  1OTC A;  3A5U A;  2MQH A;  4DV5 Q;  3I4M H;  4UP8 A;  1TWC H;  4HJ5 A;  1HNZ L;  4LUZ A;  5ELO A;  1VQM A;  1HNX L;  4LFA Q;  1YI2 A;  3M85 A;  1GD7 A;  4B3R Q;  5IYD H;  4GLX A;  2WP8 J;  3RN2 A;  3A5Z B;  5J3B A;  3KFU A;  4JYA L;  1N9W A;  3S2H H;  3RZD H;  4HIO A;  2JA7 H;  3GDE A;  2VZA A;  1K83 H;  4EQ5 A;  2UXD Q;  3BZK A;  1X55 A;  1I3Q H;  2E5L L;  1U5K A;  3KOJ A;  1Z47 A;  1NE3 A;  4JBK A;  2KCT A;  4TVA B;  3CAM A;  3CCR A;  1NTG A;  5M5X H;  1TXY A;  2L15 A;  4JG2 A;  2K5N A;  1FL0 A;  1L2F A;  4LW1 A;  1IBM L;  2ASB A;  1V1Q A;  2RF4 A;  3CCE A;  4AH6 A;  3PV0 A;  4LFC L;  3RR5 A;  4X65 L;  5FLX c;  2V1C C;  1W2B A;  4B3M L;  3PO3 G;  5IYB H;  1E24 A;  2PQA B;  4QY7 A;  4XTC S;  1VQH A;  1V9P A;  2AMC B;  4KHP Q;  5K36 G;  1E7Z A;  1KHI A;  1MIU A;  2D0P A;  2YYZ A;  1XMQ L;  1SMX A;  5GAG C;  1B70 B;  4A3K H;  2ALY B;  4DR1 Q;  1JB7 A;  3HOZ H;  4JI0 Q;  4Y52 H;  3PCO B;  1MJE A;  3M9B A;  1BKB A;  2JEB I;  2YTX A;  3KLW A;  3CCV A;  3STB D;  4X66 Q;  3MEF A;  1YJ9 A;  3FP9 A;  3FKI H;  2LXJ A;  2C35 B;  2UUA Q;  1C9O A;  1Y14 B;  3T1Y L;  1PH1 A;  4PG3 A;  1EIY B;  4NXM Q;  1X9N A;  2RCN A;  2DUD A;  4MNO A;  3M4O H;  1SR3 A;  4IPG A;  3HOX H;  4GS3 A;  5IP9 G;  3ICE A;  1Q46 A;  1Q1B A;  3H0G H;  1VQJ A;  1KRT A;  1FGU A;  3CCQ A;  3JC6 6;  3VDY A;  3PF5 A;  1E1T A;  2MO1 A;  4LF6 L;  4JV5 Q;  2XGT A;  2JA8 H;  3G4S A;  1K8A C;  2YTV A;  4YHH Q;  3PUW A;  3CQZ H;  1FJG L;  3GTO H;  4HJA A;  3MXN B;  4DR5 L;  4NXN L;  4DV3 Q;  1HR0 W;  1L1O A;  4JI1 L;  3CCU A;  4DR3 L;  5C3E G;  5LMU Q;  4GLA C;  4LF8 L;  5IWA Q;  1VQK A;  3HOV G;  2DGY A;  2A19 A;  4BA1 I;  5C0X J;  1PFS A;  2D0O A;  2F52 A;  3K7U C;  2EQS A;  1C7Y A;  2MNA A;  2HQL A;  3PUZ A;  4B3S Q;  4R4T A;  1K73 C;  2NZH A;  4JI2 Q;  2VQF L;  1KD1 C;  4OO1 G;  1CKN A;  4L5S A;  3ZJY C;  4HIK A;  1VQE A;  3K81 C;  3J80 i;  3UE0 A;  2GVB A;  4A3C G;  1KAW A;  4IOA A;  1Q12 A;  3K8A A;  4A93 H;  2JA5 H;  3IRB A;  1GKH A;  4DUZ Q;  4JI8 Q;  1SFO H;  1PV4 A;  5IP9 H;  4AQY L;  2Z0S A;  1JE5 A;  1VS0 A;  3F8T A;  4JBJ A;  4IPD A;  1H95 A;  1EIF A;  1V43 A;  2Z6K A;  5BR8 L;  4A3I G;  4GKJ L;  4LFB L;  4FDB A;  3PSI A;  3G71 A;  3CPF A;  1QZH A;  4K0K Q;  4AYB G;  4ALP A;  4LF9 L;  2LXK A;  3BZC A;  5C0X G;  5JEA J;  3CME A;  2K5V A;  3I4N H;  3HFZ B;  4A3C H;  3GO5 A;  4HID A;  1S72 A;  4APV A;  1QVC A;  4A75 A;  3EBE A;  2VQE Q;  4PZ7 A;  4LFC Q;  2JJQ A;  1N34 Q;  3CCL A;  1S3O A;  5HGQ A;  2Q2T A;  4IFD G;  3I56 A;  3AYH B;  3GD7 A;  1NY4 A;  3DM3 A;  1Z9F A;  4KI0 A;  2Y0S G;  1RIP A;  1HZC A;  2KBN A;  3AFP A;  4R4I A;  4OWT B;  4HIM A;  4A3E H;  4DV5 L;  4B3T L;  3E9I A;  3D0F A;  1IL2 A;  4X66 L;  1IXR A;  2R7Z G;  3CCM A;  1YIT A;  3T1Y Q;  1YHB A;  3KDF B;  3J81 j;  3PUV A;  4GLV B;  2OWO A;  3HOY H;  2UXC Q;  1HNZ Q;  4QQB X;  2QEX A;  4HJ9 A;  1LM0 A;  1YEZ A;  1TWH H;  1HNX Q;  4DPG A;  2E2H H;  3CP0 A;  4QJF A;  1N33 L;  2JA8 G;  1N8R C;  1MKH A;  4LUV A;  4DV2 Q;  3A0J A;  3U58 A;  5LMN W;  2I5M X;  1YVC A;  3S1M H;  3GTQ H;  4DR6 Q;  1Y1W G;  4DK6 C;  3M3Y H;  2UU9 Q;  2AWO A;  3GTL H;  2B63 H;  5JJK A;  4YY3 L;  2WB1 E;  5FJ8 H;  4GN5 A;  1K9M C;  3HOW H;  3CC7 A;  1BBW A;  1JJG A;  4A3B H;  4DUZ L;  4HJ7 A;  5LMU L;  2HIX A;  1O7I A;  3ERS X;  4A3F G;  2HHH L;  1PH5 A;  4GKK Q;  4DR1 L;  2I0Q A;  4DV6 Q;  4GKJ Q;  3S15 H;  3J80 c;  3GTP H;  1E3P A;  2N3S A;  2WAQ G;  3S1Q H;  4K0K L;  4IFD J;  3FHW A;  3W1G A;  2XTI A;  2MO0 A;  4R4O A;  1UE6 A;  1EOV A;  4GOP B;  2RHQ B;  2K14 A;  2E8G A;  3NBH B;  1I6H H;  2OTL A;  3TQY A;  2Z6K C;  4MZ9 A;  4IO9 A;  5FLM H;  2D62 A;  4NXM L;  1M90 C;  2BA1 A;  1XNQ L;  4P72 A;  3M4P A;  3KYH C;  1Q81 C;  2JA9 A;  3HOY G;  2K5H A;  1VQP A;  3F1Z A;  2VUM H;  1PYS B;  2E5L Q;  4LFB Q;  2Y0S E;  2AWN A;  4PMW A;  3KF6 A;  4LF9 Q;  4LF6 Q;  2R92 G;  2UXB L;  4QGU A;  3A74 A;  1CKN B;  1EWI A;  1FJG Q;  4A3E G;  5IE8 A;  4DR4 L;  1N32 L;  4RG1 A;  2JE6 I;  3HKZ E;  4C2M H;  3HOU G;  3M7N A;  3AQQ A;  4JI7 L;  4LF4 L;  3GTJ H;  5M3M H;  1VQ7 A;  2K52 A;  4KLK A;  5IWA L;  4P73 A;  4B3S L;  1GO3 E;  1YNX A;  4DV1 Q;  1X3E A;  1EUJ A;  2EXD A;  1WJJ A;  4A3M H;  1HR0 L;  4JI0 L;  1I5F A;  2IX0 A;  3TS0 A;  4L5R C;  3CD6 A;  1TWG H;  2K75 A;  4J15 A;  2NVX H;  1UEB A;  1Y1V G;  4JI4 L;  4X6A H;  2R7D A;  4DR3 Q;  3PIO A;  1J6Q A;  1VQ6 A;  1NBW A;  1IZ6 A;  3E9H A;  2VY3 A;  4DV6 L;  1CKM A;  3KDF A;  4KHZ A;  3FKI G;  4X62 L;  4UP7 A;  1XNR L;  1PYB A;  3JAM c;  4B3M Q;  1Q1E A;  1HNW L;  2JA6 G;  4JCV E;  2UU9 L;  4OX9 L;  1HZB A;  4DUY L;  4JOI A;  5GAD C;  1YJN A;  3RLN A;  3KJP A;  4A4I A;  3HOW G;  1PHJ A;  4BY1 G;  4GOP C;  3SGI A;  1VQB A;  4YWL A;  4P71 A;  2VQE L;  3GTK H;  3S16 H;  2R6G A;  4EX5 A;  1JJC B;  2VNU D;  1N36 L;  4DR7 L;  2ZJP A;  3TEH B;  3UDF A;  2R92 H;  2BA0 A;  2UXB Q;  4R1J A;  2KCM A;  3I4O A;  4LF8 Q;  4JI5 L;  3TS2 A;  2QGQ A;  2OTJ A;  4O0A A;  3RLF A;  1OXT A;  2Q2H A;  1Y1W H;  1X54 A;  4OO1 I;  2YU9 H;  1CSQ A;  2PQA A;  1VQ4 A;  1A0I A;  3J7A 5;  1VQL A;  4A3L G;  1X6O A;  4JI3 L;  3TRZ A;  4BA2 I;  1TWF H;  3NEM A;  1N34 L;  4JI1 Q;  3KJO A;  3ULL A;  5GAH C;  1XNQ Q;  3HOX G;  1DGS A;  1Q7Y C;  1VQ8 A;  3PO2 H;  3S17 H;  2N49 A;  3PO3 H;  4A3D H;  3OTO Q;  3TRE A;  1UE5 A;  3I4M G;  2A1A A;  2ZTE A;  3I7F A;  4IPC A;  4NPS A;  2LSS A;  5BR8 Q;  2E2J H;  2JK8 A;  1XMO Q;  1I94 Q;  2YTY A;  4JI5 Q;  2ZM6 L;  4BY1 H;  1UE7 A;  2VS1 A;  3I4N G;  5DLQ E;  1PH9 A;  2GVA A;  1E1O A;  5EAY A;  3F2B A;  3L2P A;  3HOZ G;  3UDI A;  1HZA A;  4BBR G;  4UPA A;  3UE1 A;  4LF7 Q;  1IBK L;  3CF5 A;  2HT1 A;  1WYD A;  4R4C A;  4A76 A;  2JEA I;  2E2I H;  1JMC A;  4GKK L;  5M5Y H;  4LF4 Q;  3LGJ A;  3WWV A;  3EIV A;  4IJL A;  1A8V A;  1YBY A;  1CKO A;  2ID0 A;  1IBL Q;  3NEN A;  4AYB E;  1R9T H;  3I55 A;  5LMN L;  3ULJ A;  4JI6 Q;  1W3S A;  1JJ2 A;  1MJC A;  3L0O A;  1VQF A;  4JBM A;  4IFD I;  2IHF A;  4JI4 Q;  3RZO H;  3W5O A;  2UUB Q;  1X56 A;  3Q8D A;  4BBR H;  3CCS A;  4OWX B;  4DR2 Q;  3S1R H;  2JA5 G;  1E22 A;  1SLJ A;  2VL6 A;  1J5E Q;  1ASZ A;  5AJ3 Q;  4YCU A;  2CKZ B;  3S24 A;  4Y7N H;  3RLO A;  1JT8 A;  5HY6 A;  2VW9 A;  4A3K G;  1ASY A;  3G48 A;  4L5T A;  2UUC Q;  2I5L X;  2OQK A;  3OYY A;  5C3E H;  4DV1 L;  4A3D G;  3PF4 A;  1PH4 A;  1N32 Q;  1YJW A;  2B63 G;  4WJ4 A;  4IJH A;  4P74 A;  1B7Y B;  1CUK A;  1G29 1;  1PH7 A;  4X64 L;  4A3J G;  2KHI A;  1S40 A;  3U4Z A;  4JYA Q;  1D8L A;  2ZJR A;  4LF5 Q;  3UDX A;  5H1S E;  1G51 A;  4ME3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...