5C4XG

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/rna/dna
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4xG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c4xG01
4LUVA 3I4MH 4B3RQ 1QUQB 1V1QA 3BU2A 5EAYA 4YWKA 4A75A 1XMOQ 4NXML 4DR1L 3K8AA 1YJWA 4BA1I 1KXLA 1GD7A 3KLWA 3E0EA 4DR4Q 1CKOA 3S16H 1IYJB 4PMWA 4LWCA 1YVCA 3JAMi 4A3FH 4OXPA 5E7NA 1FJGQ 2D0PA 3A0JA 1OXXK 1B7YB 3AFPA 1Y1WH 4IFDJ 4DR3Q 1I3QH 1HNWQ 4DV3L 2VQEL 3FP9A 4EX5A 4DUZL 2UXDL 3G71A 4R4QA 1X6OA 2F4VQ 4A3EG 2D62A 1C0AA 5GQOA 4DR6L 4YY3Q 2NZOA 3EN2A 1XPRA 1V43A 1D8LA 4A3JH 4K0KL 1G51A 3PF5A 3PCOB 4A3KH 1HZBA 3CP0A 3CMAA 4DV4L 1VQEA 1J5EL 2ID0A 4X62L 4A93G 4BBRH 1Q7YC 1BKBA 1VQJA 4GOPA 1YIJA 4C3HH 1PH3A 1LTLA 3CMEA 1OXTA 5LMNQ 2B63H 3ICEA 4R4IA 5JEAJ 2KCTA 4UP9A 4P73A 4X66Q 5C0XI 5C0XG 1I6HH 4DNIA 4HJ9A 3RLFA 4YHHQ 3CQZH 3K80C 1XNRQ 2OQKA 1QUQA 1IBKL 1HR0L 2CKZB 4QGUA 4DAMA 1PH4A 4GKJQ 3UDXA 4GKKL 5C4JH 3PIPA 4OX9L 1A8VA 1PH7A 4QY7A 1U0LA 1I5FA 3L0OA 4TQUS 2CWAA 2Z0SA 4LFCL 1GM5A 4GLAC 3A5UA 4DV2L 1M1KC 2OWOA 4XIGS 4BY1H 3GTKH 5BR8L 1KRSA 4JI7Q 2K50A 2PI2A 5J3BA 1N32L 3H0GG 4LF5L 3J81c 3HOWH 3U58A 2UUAL 2JEAI 3CC7A 2RF4A 4LF7L 1X54A 2Q2UA 1VQCA 3L2PA 2IX0A 2RHQB 2UXBQ 2VL6A 1TWFH 1N36L 1EFWA 3I2ZA 4OWXB 1KQSA 3TS0A 5C0XJ 3ER0A 2IT1A 4GLVB 1FVIA 3J81i 2ZJPA 2B29A 5GROA 2Q2HA 4B3ML 1VQ9A 4A3MH 1SMXA 1HH2P 3CC2A 4O2DA 4UP8A 1VQ6A 3PUWA 2R7DA 4GS3A 4DKAC 5LMUQ 4JG2A 2GN5A 4A3FG 3BZKA 2WB1G 1P16A 1IBML 4JI2L 2R92H 2XGTA 2E5LQ 3M7NA 2E2IH 2MNAA 4YCWA 3S24A 3HOZG 1Z47A 4HIMA 2JA8G 4JCVE 1EIFA 3I7FA 3PUZA 2KCMA 1BVSA 3ZJYC 2B3GA 5IE8A 1HNZL 4NXMQ 3HOUG 3GDEA 2RHSB 1NBWA 4NB3A 4A3KG 1PHJA 1Q46A 2OTLA 4B3TL 4LW1A 3W5OA 4R1JA 1WOCA 2A1AA 4JBWA 4A3CG 1YBYA 1XPOA 4A3GG 1Z9FA 4PG3A 2PQAB 3S17H 1MJCA 4KLKA 2CFMA 2AWOA 2Q2IA 4DV3Q 2WB1E 4JI1L 4HJAA 2QEXA 4RG1A 2VQEQ 1TWGH 4H02A 4DUZQ 3E9HA 1JB7A 3D0FA 2UXDQ 1JJGA 2HQLA 1IBLL 1NE3A 2NVXH 1IXRA 3FKIG 2BH2A 4K0KQ 2EQSA 1MKHA 3F2CA 1VQDA 2E2HH 2JA6G 1Q1EA 5DLQE 2VZAA 4DV4Q 1J5EQ 1LUZA 4XTCS 3TREA 4X62Q 4HJ8A 1EIYB 2K4KA 1E3PA 2ASBA 2ZJQA 3GTMH 1Q82C 1WJJA 5IYCG 4JI4L 4DV0L 4POFA 2R6GA 2OCEA 4OONA 3PIOA 3S1QH 3S14H 3WWVA 3CCSA 4IFDI 4IFDG 3HOVG 4C3IH 4OWWB 2QGQA 1A62A 4A3BH 1VQHA 1VQ8A 1XMQL 3HOWG 3S1NH 1X65A 2BA1A 2D0OA 2N78A 2I0QA 3H3VI 2GVAA 3DM3A 3H0GH 1EOVA 2JA9A 3I4OA 1IBKQ 1UE1A 1HR0Q 4LUZA 2IX1A 4A3BG 1BBUA 4DV1L 5M5XH 2ZM6L 3TQYA 5FLXc 5HY6A 1E7ZA 1TWAH 4GKKQ 2JEBI 4OX9Q 4LFAQ 3ULLA 4HJ5A 1JMCA 4LFCQ 4IPDA 5M3MH 4DV2Q 1SRUA 5BR8Q 4DAYB 5C44G 4MZ9A 1QZHA 3DLLA 4LF5Q 1Q86C 5JEAG 3EBEA 2UUAQ 4P72A 5GAGC 1L1OB 2R92G 4LF7Q 5IP9G 1U5KA 2A19A 5GAEC 3AFQA 5FLMH 1MIUA 3CPWA 1SR3A 4NXNL 3W1GA 1QVCA 4POGA 2YTVA 4B3MQ 4JI5Q 1UE6A 3GD7A 2VQFL 4PZ6A 4IPHA 4UPAA 3STBC 5M5WH 4GNXA 2JA8H 3GTLH 3HOZH 1SROA 1NMGA 3PV0A 1YJ9A 4DPGA 3HOUH 3RZOH 1Q8KA 3LGJA 1EQRA 1Q12A 2N3SA 2JK8A 1IBMQ 4JI2Q 5IYDG 2UU9L 3CXCA 4A3CH 1MJEA 4QJFA 3J80c 1VQPA 2FXQA 1XPUA 1JJ2A 4A3GH 2UUCL 2WFWA 4BBSG 4DR2L 4QIWE 1HNZQ 1JE5A 1N34L 3F2BA 4B3TQ 5JJKA 4C2MH 2ZTDA 5JJIA 3IRBA 3J80i 4JOIA 3K7AH 2IHEA 3FKIH 3I55A 3T1YL 1X3GA 2YU9H 1VQ5A 4JI3L 3AEVA 2JA6H 1N8RC 1VQBA 3B6YA 4DV6L 2IHFA 3HKSA 3CCMA 2A8VA 2NVTH 4JI1Q 1I94L 4L5RC 5K36G 1TWCH 4L5SA 3J7A5 2ZTCA 4LUOA 2OQ0A 5IYCH 3S2DH 1IBLQ 3K0XA 1RIPA 1C9OA 3T1HL 1IL2A 3PUYA 5ELOA 4JI6L 1I50H 3HOVH 4A3LG 1KIXA 1NTGA 1B70B 1W3SA 1UEBA 5HGQA 2EXDA 1EWIA 2AHOB 1Y1VG 4B3SL 2CWPA 2VNUD 4O0AA 5C3EH 1PA6A 4X64L 4JI4Q 4DV0Q 3H3VH 1OTCA 5M3MG 1VQAA 3J81j 4UY8C 5M3FH 1X9NA 3UDIA 3M85A 2MQHA 3CF5A 4OWTB 1PH5A 1O7IA 2ES2A 2UXCL 4Y7NH 1XMQQ 5LMNW 2K5HA 4LF4L 2K5VA 5C44H 3GTGH 1VQMA 5IWAL 1GO3E 5FLMG 4GLXA 3S1RH 4DV1Q 2ZM6Q 1YNXA 1VQNA 3M3YH 4BA2I 2K5NA 5IP9H 3TEHB 3GTQH 3UE0A 4YCVA 2XTIA 1VQLA 4EQ5A 3UDFA 2AMCB 1QVGA 1HZ9A 4LFBL 2YYZA 1Q81C 1FJGL 3HOYH 1VQFA 4DR1Q 4BY7H 1VQKA 4JBJA 1WFQA 1FGUA 1S72A 1B8AA 5AJ3L 1UE5A 1RL2A 1G291 3KF6B 4NXNQ 2KENA 3MEFA 2VS1A 4TVAB 4AYBE 4A93H 4YWLA 5IYDH 1TXYA 4R4CA 3FHWA 1KL9A 2VQFQ 2DGYA 1TWHH 2LXJA 1VQGA 2K14A 4BBSH 3ULPA 1CKNB 1T9HA 3RN2A 1YITA 3CD6A 2AKWB 1L0WA 1PV4A 2JA7H 4DR6Q 3K7UC 5LMNL 1YHQA 3S2HH 3RR5A 2UU9Q 4LF9L 4HJ7A 3S15H 3HOXH 1W2BA 1VQ7A 3G6EA 2N49A 2C35B 2MFIA 3KDFB 3PUXA 4GNXC 2UUCQ 4DR5L 5IY0A 3RNUA 4IJLA 4HIKA 2GVBA 2JA5G 1WI5A 1XNRL 2K75A 3PO2G 2PI2E 2ZTEA 1K73C 1PFSA 4P75A 5GADC 1YHBA 3Q8DA 4MNOA 4HIOA 1K83H 3T1YQ 3RLNA 4A3DH 1X55A 5C3EG 1EYGA 3PO3G 4JI3Q 4DR7L 4A3LH 4NPSA 3NELA 2CQOA 4LF8L 1XNQL 2VUMG 1GVPA 5M3FG 4QQBX 3RLOA 1UWVA 1Y1VH 1I94Q 3OYYA 2NN6I 2NN6G 1SLJA 2Z6KA 1CSPA 4X6AH 4JOIC 3HKZE 3U50C 3T1HQ 1N33L 1Y14B 3S1MH 2PQAA 3CCEA 1N32Q 4JV5L 3ERSX 1HZAA 3CPFA 4A3DG 4X65L 1K8AC 1P8LA 4B3SQ 4IOAA 4LNQA 1EQQA 3UDGA 4X64Q 4DV7L 4ALPA 4DK3C 3F1ZA 4GOPB 3OW2A 1ASZA 3PSIA 3UE1A 4AQYL 1N36Q 1ASYA 4LF6L 4C3JH 1QZGA 3TRZA 3HOYG 2UXCQ 4A3IG 1L2FA 3U4ZA 4BY7G 1K9MC 2AWNA 3CCQA 3SGIA 3BJUA 1NY4A 4HIDA 5IWAQ 1PH9A 1K3RA 3AQQA 1VCIA 1A0IA 1KC8C 2I5LX 1HR0W 2R93G 1X3FA 1D7QA 2LSSA 2PMZE 3W1BA 4A4IA 1YI2A 1VQIA 2JQOA 2Y0SG 2R7FA 1HNXL 1A63A 4LFBQ 5ELNA 1SFOH 2JA7G 4R4TA 4YWMA 2F3IA 2ZJRA 3CCLA 4OO1I 3D31A 4P74A 2DUDA 4JI8L 3KJOA 1M90C 3F8TA 3HOXG 4OO1G 1G6PA 1OXUA 2HIXA 1AE2A 5AJ3Q 3I4NG 1YHAA 1K8GA 2OTJA 3HFZB 1YEZA 1CKMA 1YZ6A 2JJQA 3I56A 2HHHL 5IT9c 1GKHA 4UP7A 4BXXG 4AH6A 4DUYL 3A5ZB 1J6QA 1JJCB 3CW2C 3K81C 3KJPA 1HJPA 1L1OA 3CCJA 1QVFA 4KI0A 1PYSB 4KHPL 3VDYA 1Q1BA 2JA5H 1VQOA 3GTPH 1S3OA 2Y0SE 4AIMA 4DK6C 1PH1A 3PO2H 4IJHA 3NEMA 3RZDH 3OTOL 4JI0L 3F2DA 1PH2A 4LF9Q 5JJLA 4JYAQ 2WAQG 2R7ZG 3ULJA 2UUBL 1E24A 3PO3H 1S40A 4DR5Q 2H5XA 3A74A 2VUMH 4DV5L 2BH8A 5C4XG 1LYLA 2PNHA 4WJ3M 4YCUA 1FL0A 3M4OH 2HIVA 1XJVA 4LFAL 2IY5B 1JT8A 5IP7G 4LF8Q 1XNQQ 1E1OA 4AYBG 5M5YH 4P71A 3TS2A 4GN3B 1KD1C 4KHZA 4B3RL 2MO1A 1PYBA 2K52A 5IYBG 1XMOL 4RMFA 3PF4A 4Y52H 5FJ8H 2I5MX 3NBHB 3KOJA 1SE8A 1WCMH 2WAQE 1OXSC 1N9WA 3G48A 2KBNA 1N33Q 1E1TA 1UE7A 4ME3A 4IO9A 2E2JH 2NVQH 4IPGA 4DR4L 2V1CC 4JV5Q 4FDBA 2E8GA 1LM0A 4A3IH 3I4MG 4X65Q 3STBD 3G4SA 4DR3L 2Q2TA 1NMFA 2ALYB 1HNWL 4PZ7A 2Z6KC 1IZ6A 2LXKA 4JI5L 4DV7Q 2JE6I 2QA4A 1X56A 3PUVA 4MTNA 3CCRA 2F4VL 2I5HA 4AQYQ 1CUKA 1K0RA 4YY3L 4LF6Q 2N8NA 1EUJA 2KHIA 1AE3A 3U4VA 1Y1WG 2R93H 3BZCA 1PVOA 3GO5A 2YV5A 1PH8A 3KYHC 3AYHB 3NENA 3CC4A 2WP8J 3EIVA 1HZCA 1OXVA 4GN5A 2BA0A 4R4OA 4A3JG 4PZ8A 4L5QA 4J15A 2VY3A 4X66L 3JC66 1XTDA 1KHIA 3HKZG 1DGSA 3L7ZC 4A3EH 3I4NH 1AH9A 2EIFA 1KRTA 2YTXA 4GN4B 4DR2Q 1HNXQ 4BBRG 3GTOH 1VQ4A 4YHHL 1YJNA 1E22A 4IOCA 1N34Q 2ATWA 4BXXH 1KAWA 4A76A 1NJIC 3M9BA 3H15A 4JBKA 2B63G 4JI8Q 4GKJL 1C7YA 2NZHA 2HT1A 1H95A 4APVA 4JYAL 1PH6A 4DV6Q 1V9PA 1VS0A 2HHHQ 4L5TA 4JI7L 4DUYQ 1SN8A 2R7ZH 4JC0A 3CCUA 3CCVA 2RCNA 5GAHC 3MXNB 4KHPQ 2L15A 4GNXB 4JI6Q 4IPCA 3GTJH 3KF6A 4BY1G 2UXBL 5C4XH 3OTOQ 4JI0Q 3M4PA 1R9TH 4DR7Q 2YTYA 3M4QA 2KHJA 2UUBQ 1L1OC 2VW9A 5FJ8G 4QL5A 4WJ4A 1WYDA 2MO0A 3CAMA 1CSQA 1WCMG 3E9IA 3KF8B 1CKNA 5IP7H 3PGZA 5H1SE 4DV5Q 4GOPC 1X3EA 5IYBH 3RN5A 5LMUL 3J7ZC 1BBWA 2NVYH 2F52A 2E5LL 4LF4Q 3KDFA 2CCZA 4JBMA 3KFUA 3JAMc 4A3MG
chains in the Genus database with same CATH superfamily
1WTHA 3I4MH 1V1QA 1SE2A 5EAYA 2PN1A 3BJYA 5KT5A 4BA1I 2YZMA 5I2YA 1KXLA 5EKKA 1XDNA 1IYJB 2EY5A 4LWCA 4PMWA 1UC8A 1OXXK 1Y1WH 3CHBD 2LKVA 4XXEA 1B44D 4DUZL 2UXDL 3QO2A 3ONAB 3G71A 2D62A 1ZHQA 5GQOA 1E4EA 4YY3Q 1XPRA 3EN2A 2F3WA 5ISRA 4A3JH 3PF5A 1HZBA 1GJXA 2AQ1B 4BBRH 4JW0A 3VYRA 1H9MA 1BKBA 1HQRD 1VQJA 4LSAA 3GTPB 1ULZA 4IUNA 4R4IA 2KCTA 3E5SA 5C5MA 2B63B 3H4BA 1HNXH 4A2AA 1N34H 4HJ9A 5LL6b 3GTLA 2B2VC 1BUVT 2OQKA 2OH2A 1HR0L 4RZRA 1TY2A 3QIAA 2YZNA 4C3IG 1B33N 4R8IA 5I47A 1EWCA 1PH7A 2HHHH 2MJ8A 4TQUS 4LFCL 3HP3A 4DR7Q 2YL2A 4HNUA 4BY1H 4GLAC 1Z2NX 5KG2A 4DUYH 1F77A 1N32L 5M5YB 5EBDA 4TRDA 4LF5L 3A8IE 1EY6A 1VDZA 1PFNA 2JEAI 2ZJTA 1VQCA 4ECTA 3L2PA 5KFRA 4NKLA 4CHTB 2UUBH 2SDFA 1KJ8A 3HRZC 4GLVB 3J81i 3NGDA 3N8DA 4ZQ3A 3NE5B 4IHJF 2FLLA 1BJTA 1C8CA 3PUWA 2DIKA 4DKAC 1I50A 3OMCA 4JI2L 1ET6A 2K7VA 1EHIA 3DEOA 4QUCA 3HOZG 2VUMA 2QEJC 3PUZA 3I7FA 5J22A 2K1BA 3RUZA 3ZJYC 3N43B 3RBDA 1GYFA 2RHSB 1NBWA 4B3TL 3WOEA 1II3A 4LW1A 4JBWA 1YBYA 1WVLA 4WFN3 2V5AA 3CKIB 1Z9FA 4A3GG 3HZXA 1MJCA 2XRQD 4JI5H 2CFMA 1T94A 1HUNA 2Q2IA 1Y8OB 5DG8A 2IW3A 4A93H 2VQEQ 1TWGH 3RUPA 4YY3H 3D0FA 2DY7A 3I73A 4RU9A 4DL2A 5KFAA 1IXRA 5KFOA 3N6RA 1F2LA 1FKAH 2VZAA 1D1IA 1E3PA 1ZYRC 1Q82C 1GLVA 1WJJA 4POFA 2R6GA 4YR3A 2K5DA 3CCSA 5HBRB 5K36H 5KG6A 3NQTA 1TVXA 2ZXPA 4JVZA 4H13C 4A3BH 3QR8A 4WJWA 2EYPA 5L9XA 2I0QA 3S1NB 2FPPB 4ZLTF 1X3PA 1SNMA 1EOVA 3C1EA 1IBKQ 2IX1A 3H0GB 2BE5D 5KFSA 1RODA 1TWAH 5JVG3 2NVYB 1JMCA 4IPDA 4EBCA 2A73B 5C4ZA 1GGOA 1CTMA 3MVVA 1B6RA 4ED8A 1G2SA 3EBEA 4RA8A 5HGTA 1S5BD 2FINB 1MIUA 3C1FA 4A3FB 3MA2B 2XCLA 4POGA 2YTVA 2WAQA 2R7ZA 2PQEA 4M1UB 2R85A 2VQFL 3MXNA 3STBC 1G91A 4NMZA 4RNMA 5M5WB 2LMCB 1NMGA 5C6AA 3PV0A 3Q6SA 1Q12A 3HOUB 3RZOB 2JK8A 1IBMQ 3K58A 5IYDG 4TUYF 3KBXA 2KA7A 4A3CH 1R9TA 2M05A 4N9PA 5C3WA 1LACA 3D3RA 1C48A 1I4PA 4DR2L 4AYBA 1D5ZC 2XCPA 4IR9A 2JEJA 1AFPA 5JJKA 4ED0A 2QDLA 2ASDA 1L2ZA 1QWYA 2M00A 1LTSD 4JOIA 4K6DA 2IHEA 3FKIH 3I55A 1BGWA 3JRWA 3FEWX 1VQ5A 2NU9B 1EYZA 1B6SA 2JA6H 1EEFD 3RB4A 2VQEH 4DV6L 3J7YW 2A5HA 1KJ9A 2PZUA 1B53A 5K36G 2ZTCA 2O2LD 3GV7B 5IYCH 2J9GA 5JJZA 3T1HL 1IL2A 2YZGA 2J6TA 3PUYA 5ELOA 2ICIA 4JI6L 3EYYA 4MV3A 3GTKB 2O5JC 3HOVB 1NTGA 4XT3B 1W3SA 5HGQA 2EXDA 1EWIA 2R7KA 2VNUD 2WACA 4X64L 1SMYC 4PDBA 1UEAB 3J81j 4FO2A 3UDIA 4N9TA 3QB3A 4HR7B 3M85A 3ETJA 1TWFB 1PH5A 5KFZA 1O7IA 3BG3A 1ZXTA 5LMNW 3HKZA 3VYSA 2HUGA 2EJFC 1A6XA 4ECXA 2K32A 1IBKH 1K3BC 2FJ2A 4QF4A 2JA5A 3KK7A 3S1RB 1VQNA 2K5NA 5IP9H 1BCPF 5IGEA 5D65A 1Z7TA 3I8ZA 3MHBA 1QVGA 1Q81C 1FJGL 3CQZA 4FU0A 3MR5A 5I6YA 3G7LA 1VQKA 1T3NA 1WFQA 4J9MA 1SYFA 1B8AA 2XWBB 5AJ3L 3EPIA 1RL2A 1EY5A 4I7ZC 2AQ4A 3SK5A 4NXNQ 3DM1A 2KENA 3BYTB 4H0LC 3JAME 3PR4A 3MWYW 3OW7A 1XYIA 2PMZA 1SEIA 1K0SA 2ZDGA 1BCPB 3OUZA 1WCMA 3DUZA 4K14A 1DZ1A 2E74C 1TWHB 3ULPA 4DR6Q 1IBMH 2AKWB 2HD3A 3MAQA 3A55A 5LMNL 3EJIA 3S2HH 4RAZA 3I4LA 2QW7A 1SYGA 1F9PA 3F2UA 3GIQA 3J80W 4KKUA 1QNKA 4MTKA 2SEBD 1BQQT 3G6EA 2FPGB 3KDFB 1V1PB 3KAJA 3GTMB 5C4HA 4IJLA 4DXGA 5CA0F 4HIKA 2GVBA 2JA5G 1WI5A 3S1QB 1CQIB 4EYHB 4K5XA 2PYKA 4C3IB 4APMA 4P75A 5IT9E 5GADC 4ECYA 2VXWA 5AFWA 4ZOLF 1EOTA 1K83H 3GV8B 4F4WA 4FF3A 1IOWA 1D5XC 1LT6D 1F2YA 4NPSA 3NELA 2CQOA 1ENFA 4LF8L 1XNQL 3IKJA 3T5HA 1EIHA 4J9LA 1IL8A 3RLOA 1Y1VH 4RCOA 5E4XA 4FNFA 1I94Q 3OYYA 4RZQA 2NN6I 2BQRA 1SLJA 3BYYB 1CSPA 4O1NA 4TV8F 3U50C 1Y14B 4WRDA 5M3MB 3Q8RB 2EVBA 3FDTA 1E4EB 4JV5L 1U4MA 3S1MB 5L1KA 2SNMA 1K8AC 4DL4A 1EQQA 3UDGA 4M7EA 1JC7A 4DV7L 5EWEA 4DK3C 3OW2A 2NVXA 3UE1A 4AQYL 1N36Q 1ASYA 1HA6A 3DXJC 4C3JH 1BCPD 1Z6HA 4S3SA 1QZGA 4LF6L 2DLNA 4IWXA 3M9MB 1K9MC 3BDLA 3SGIA 1S0OA 2ZXRA 1CHQD 3AU7A 5EPKA 2C00A 4HIDA 3GTLB 1EUDB 2W57A 3SK4A 5KFWA 5DAUA 2FE3A 2NUAB 4YP3A 1VMCA 2CHBD 2R93G 1X3FA 3D6CA 2Q8TA 2JQOA 1O75A 4YWMA 1WSCA 4ZRZA 1B9MA 1MD2D 1T5EA 3D31A 3KJOA 4OO1I 3K3VA 4NXNH 2HIXA 1AE2A 3PW0A 3I4NG 1K8GA 1AUXA 3HFZB 4PV1C 2JJQA 5JVLA 2QKIC 4YR0A 2CQYA 4C1NK 4EVOA 4ME5A 3A5ZB 1JJCB 4Z9CB 3K81C 2V4QA 4DR6H 2XVSA 4ZUJA 4ZK9B 4KI0A 5KFDA 4FF4A 1Q1BA 1I4GA 1VQOA 1S3OA 3GTPH 3BZDB 3PO2H 4JUZA 3Q8QB 1I50B 3RD4A 2WB1A 2EPBA 5I6WA 1DV1A 2XIGA 1QCBD 5JJLA 5KG1A 2C5CA 1DJRD 3G8CA 2VB3X 3PO3B 2VUMB 3RF2A 4DK1A 2Z9HA 5CMDA 3RB0A 4O3PA 1SNPA 2IX3A 2W6NA 1SNQA 1D1KA 4PNYA 4YCUA 4K2KA 3CRLC 4NLGA 1M0TA 3NK9A 3OIPA 3M4OB 3HXLA 5FOBB 3HEJA 1JLLB 4X3UA 1I94H 5M5YH 4P71A 3TS2A 1XMOL 4RMFA 3OSNA 3KOJA 4C2MA 1EY4A 2WAQE 1I6VC 1OXSC 3G48A 3L4KA 2CW0D 4FF1A 1N33Q 3MFHA 1BO0A 1E1TA 1UE7A 2K33A 4RAUC 4I7HA 2F3VA 4FDBA 2E2JB 1LM0A 4A3IH 2B2WA 1HNWL 3PIO3 4EQPA 4CKCA 2Z6KC 2DWCA 2B2YA 3I70A 3PUVA 2FFKB 2F4VL 5JQWA 3MXUA 1K0RA 2EDGA 1SYBA 1EUJA 1GUOA 2PNRC 4PMBA 2W6QA 1LTAD 4EGVA 3BZCA 2GA4B 1VMPA 5IIFA 2K6AA 1PH8A 3CU7A 3NENA 1K1SA 4EGQA 1RCVD 1HZCA 1E2VA 1FNVA 4EFBA 2C28A 4MA0A 4J9QA 4PZ8A 2D5DA 4ETSA 4ED6A 4L5QA 3U9OA 1SCUB 3L7ZC 2B8FA 1QILA 1KRTA 4GN4B 2YS6A 2NYZD 1WTRA 1E22A 1K28A 4BXXH 3GTGA 1KAWA 4ODGA 2B63G 4JI8Q 4XQJA 3BQ1A 2ATLA 2NZHA 2R8JA 4JYAL 1Z2PX 4CDCC 1PH6A 1GXDC 2OF1A 2JN4A 3S9WA 1E2WA 3T5JA 2ALZA 1GSHA 4U7CA 2L0CA 5KFNA 2WAQB 2R7ZB 3MXNB 4OIJA 4FS1A 1IW7D 1RKNA 4IQZA 1S03G 3KF6A 4N8X1 2UXBL 3OTOQ 4JI0Q 2WKCA 1CA6A 5C4XB 2C2RA 3CRKC 1R9TB 3PW5A 4E6IA 5IP7H 5DQGA 1CKNA 1KNEA 3NPPA 3PGZA 4DV5Q 5IYZF 2JEIA 4AYBB 1T36A 1ICFB 4K5VA 5LL6S 5LMUL 1BBWA 2NVYH 4LF4Q 5BPFA 4HYKA 4JBMA 3GQBA 5LP6F 4XQQA 4OWWB 5E3FA 3C0FB 4OELB 4B3RQ 4IRDA 2FLPA 1QUQB 1DXMA 4A75A 3AB9A 4DR1L 1N33H 4MV1A 3U9TA 5I9OA 5FD5A 1G6ZA 2QYZA 1GD7A 3BA9A 5CORA 4DR4Q 1YVCA 4A3FH 3S16B 2D0PA 3AFPA 2CW0C 4G7OC 4DR3Q 3MFIA 3RTXA 1I3QH 1GUSA 2W6ZA 5A2QL 3FP9A 4O4IF 5HURA 4R4QA 1X6OA 3NTIA 1PRTF 2W7PA 3L4JA 3TP7A 4K0KL 3R5HA 1G51A 2OXPA 3T13A 1KABA 1S4ZA 1J5EL 1VQEA 3HKZB 1Q8IA 2AUKA 1Q7YC 2BOSA 4GOPA 1YIJA 4C3HH 1PH3A 1LTLA 4R7RA 3CMEA 1OXTA 2A68C 2JA5B 5IGBA 5JEAJ 4R8UA 1AW7A 4X66Q 5C0XG 2W6MA 5IGDA 2FKLA 4ECZA 3H3VC 3K80C 4JI8H 3NXWA 1XNRQ 2NU8B 2XNAC 1PRTB 4CBVA 2CKZB 4QGUA 4DAMA 3MTSA 4EG0A 2J7ZA 4GKKL 3PIPA 1S68A 2HCIA 5DLGA 3SI8A 1A8VA 4RFBA 4QY7A 3L0OA 1I5FA 4Q43A 4DV2L 5J1ZA 3GTKH 5BR8L 2EJMA 1H9SB 2K50A 2PI2A 3DWQA 4KJNA 3H0GG 4EGJA 2IPKD 3J81c 3T53B 2PMZB 2UUAL 2RF4A 1X54A 1WCMB 3OTOH 4JI0H 1G8ZD 4KY6A 1QG7A 2IX0A 2RHQB 2YU9A 2O5IC 2VL6A 1TWFH 3SE7A 4MV6A 1IYVA 3TS0A 5C0XJ 4O3OA 3ER0A 2NTTA 4DV5H 4KV6A 1TWCA 2WV6D 5FLXE 4B3ML 1VQ9A 2EYJA 4A3MH 1SMXA 2EE1A 1HH2P 4QMGA 1NAPA 5CV6A 3CC2A 4O2DA 1FR3A 3EQLC 2DNEA 4GS3A 4A3FG 1BBXC 4LFAH 4JG2A 4LSXA 3BZKA 1P16A 2XGTA 3M7GA 2E75C 5KFUA 3KTMA 4DA2A 3JAMW 3M7NA 4RGNA 4B3RH 2BDNA 1H9KA 2PW7A 2Q8RE 2JA8G 5KFJA 4CKBA 1BVSA 1DM0B 1CZWA 2BDOA 1HNZL 3HOUG 2YW2A 3GDEA 4NB3A 4DR4H 4DL6A 3W5OA 4EEYA 1PRTD 4O2AF 3I4NB 1XPOA 4DR3H 4PG3A 3GTOB 2FJZA 4K2LA 2WB1E 5F9NA 5L1LA 2Z4IA 4CDEC 4DNRB 4DUZQ 5DQIA 2UXDQ 3GP7A 5KT6A 1JJGA 4QCLA 1IBLL 1PTOC 5IODA 1NE3A 3GTQA 1LT4D 3F2CA 4YIJA 2E2HH 5DLQE 3LP8A 1LUZA 4XTCS 3TREA 3TMEA 3TP8A 1EIYB 1PZJD 2K4KA 2W70A 3TQ1A 2ASBA 2ZJQA 3GTMH 4G3IA 4JI4L 3WNZA 2CVRA 2AQ2B 4ED7A 3S1QH 1I4XA 5D14A 4X66H 3S14H 3I90A 3WWVA 3NWSA 4IFDI 2R86A 3HOVG 4C3IH 3JAML 4FS2A 3BS1A 1MSGA 5EKIA 1CQJB 2JXMB 1A62A 1VQHA 4EBDA 1I6UA 1XNRH 1X65A 2D0OA 1U4LA 3I91A 3K0YA 4H44C 2GVAA 2C22A 2JA9A 1HR0Q 2D9UA 4LUZA 4EQOA 3JSNA 3TQYA 1E7ZA 5M5XB 2JEBI 3C3LA 4LFCQ 5M3MH 5DNFA 3GILA 3RBEA 2J6UA 3PW2A 5G3LD 2CH4W 2EYHA 1LLRD 4LF5Q 2RSOA 1Q86C 4G7ZC 4ECSA 4P72A 3NQIA 5IT9L 4C56C 3N6XA 2A19A 1F9RA 1RTNA 2RSNA 1KJJA 4DXFA 2XGQA 3CPWA 3T4AC 1DD2A 2WB1B 4ZQIA 1RHPA 4HMIA 3VPBA 2VA2A 4KHVA 4JI5Q 2AGOA 3GD7A 4QWEA 4UPAA 4X3SA 3HOZH 2K05A 3GTLH 2F1MA 4DPGA 3MWDA 3UQ8A 3LGJA 1EQRA 2XCAA 1TY0A 4HNTA 2DN8A 4JI2Q 2RDHA 4A3KB 2UU9L 3CXCA 2DZDA 1VQPA 2FXQA 5E4WC 5DM73 4A3GH 1W96A 4TSSA 2WDTA 2UUCL 2WFWA 4BBSG 2W9CA 2KSWA 1N34L 1SNCA 4B3TQ 2A6ED 4C2MB 4RKBA 5JJIA 3K7AH 1X3GA 5KG4A 3AEVA 1N8RC 1PRTC 1VQBA 3B6YA 2V58A 1RK6A 2IHFA 3NSWA 4DUZH 1RYRA 2NVTH 2UXDH 3M4YA 1X32A 4N8FA 5FO7B 4F88A 3JZIA 2OQ0A 5C4JB 3S2DH 1LO5D 1L0XB 2V4DA 1DOLA 1EWHA 5JAVA 2PCFB 3JRXA 1I50H 4A3LG 1OO9B 1KIXA 2F0LA 1I7NA 1B70B 4RB3C 2FLNA 1Y1WA 4B3SL 3BAAA 3H3VH 5M3MG 1RJTA 2XSCA 2KUMA 1B04A 3CF5A 3V4SA 2K28A 4KN4C 1ZQ7A 4HAEA 2UXCL 4Y7NH 5FKAC 2ZXOA 2A69D 4Y8VB 1O7YA 1HR0H 2EYOA 1PZKD 5IWAL 4GLXA 1AUVA 3GTGB 1S10A 4LFCH 1SDFA 5KT7A 4RB0A 1DYQA 4BA2I 3KALA 2B2TC 3M3YB 1N32H 4YJ3F 3UE0A 1XXGA 4YCVA 2IJ0A 4LF5H 4EQ5A 2DPIA 2PVPA 1HZ9A 2X69A 2YYZA 5CBEE 1VQFA 3V6KA 2CH4A 2GLTA 2E2DC 2VA3A 1S72A 2F0VA 2YS7A 1V8QA 4DL3A 5KRUA 3KF6B 4TVAB 5IYDH 3S17B 1AEXA 3BVZA 1WTQA 1TXYA 1KL9A 2VQFQ 2DGYA 1EY7A 3A7AB 5T1IA 2VQDA 2YCHA 1CKNB 1T9HA 3RN2A 3CD6A 1SYDA 5DG9A 4JI2H 1PV4A 4RAYA 2JEGA 2WIIB 4U673 2FMAA 3K7UC 3H09A 1ET9A 4LF9L 4RUCA 5J2TF 1T5XD 2CZGA 1A9XA 4EQNA 1EEID 3E3XA 4GNXC 2X6LA 1E0BA 4DR5L 3RNUA 4B3TH 1KJIA 4ECUA 1PXUA 2K75A 1CS0A 2PI2E 1K8MA 2ZTEA 1AZPA 1PFSA 2DNCA 3T5LA 1YHBA 4MNOA 3EA6A 1PTOH 2MHVA 1HQMC 3RLNA 3V6JA 4KD4A 1SSOA 3PO3G 2K5QA 4DR7L 5E1FA 2A6EC 3MFYA 2G5DA 2VUMG 3OIQA 4QQBX 2AUJD 1SEBD 2MP1A 1KC7A 2R8GA 3IFTA 5J39A 4FXGC 2QF7A 2KECA 3KLRA 3T1HQ 3IN5A 1Y8NB 2PQAA 3CCEA 1CE8A 4CJ2C 4MN3A 1ML0D 3SK6A 4X65L 2V9WA 2Q8IB 4F50A 4UCSA 3VR4A 4X64Q 1TWGA 3F1ZA 4GOPB 1LTID 3TRZA 4R8UB 2KVMA 4KMUC 1EZ1A 1E2ZA 3GIDA 3KXYT 2AWNA 3CCQA 3TZUA 1NY4A 2JA8B 2GPSA 1I7LA 5KG5A 1SXTA 4ED1A 2F0NA 3AQQA 2C9OA 1VCIA 4O42A 1KC8C 2I5LX 1RF2D 2LSSA 3MJFA 2B2UA 3P1HA 1YI2A 2XD4A 1DONA 1SFOH 4R4TA 2F0HA 2ZJRA 1VBHA 1G6PA 3PMFA 1TWAA 1OXUA 5AJ3Q 3OUUA 4WBNF 4FBTA 2YU9B 4FYDA 2UVRA 1CKMA 4DAYA 4X3KA 1UC9A 1K1QA 2C2DA 2VQFH 1WTWA 4UP7A 1H9RA 3ZYYX 1WTPA 3CW2C 1HJPA 1L1OA 4QWAA 1ONLA 1TWCB 1QVFA 3OOCA 4KHPL 1JOQA 3VDYA 2JA5H 1JKJB 4DK6C 4AIMA 2JEFA 3NEMA 3F2DA 1PH2A 5NUCA 3RZDB 2WAQG 4DR2H 2F0GA 3ULJA 2R7ZG 4MTDA 1E24A 5KKNB 1N48A 1S40A 4Q8EA 2I46A 1KLGD 2G9HD 5C3EB 2F0FA 1A3TA 5M3FB 4ZKCB 3OWFA 5C4XG 1LYLA 1M6VA 2W9AA 2PNHA 4WJ3M 5CA1F 1QOHA 2HIVA 4DNTB 1XJVA 4DV6H 3QOJA 4LF8Q 1XNQQ 1E1OA 4AYBG 5FLXW 2M9VA 2FHTA 2XIWA 1MBYA 1TT2A 2MO1A 1F2ZA 2XRSD 5IYBG 4PWQA 3T1HH 4DAPA 1B9NA 2WE6A 1WCMH 4JI6H 1N9WA 2BE5C 2KBNA 4I65A 4ZCKA 3GTQB 3FKIA 3D8GA 4JV5Q 2V1CC 5CV5A 1D2BA 2JA6A 2W8KA 4X64H 3T51B 5LHY1 5LYJF 1JDEA 2CW7A 2LXKA 4DV7Q 1STHA 3D4WA 3CCRA 4AQYQ 1CUKA 4LF6Q 4G4KA 2N8NA 2KHSA 1AE3A 2ENBA 3U4VA 2R93H 5BMVF 2G9DA 3GIMA 1M4VA 4XQNA 5CV8A 4BBSB 1GHJA 2B2VA 1OXVA 5KFKA 1LT3D 2EYLA 1S5ED 2VY3A 1KHIA 3HKZG 3I4NH 1DOKA 2K03A 1FJGH 1DOMA 2EIFA 5FLXL 4FXDA 4J8QA 1EU4A 3GTOH 2ZT9C 1IYUA 4YHHL 5KFFA 1PZID 4IOCA 2ATWA 4ZKBB 4P2CB 2R7LA 1NJIC 4JBKA 3WDNA 4XZ3B 5KNBA 4RHRA 4GKJL 4LMYA 5KIXA 2R92A 3ERQA 4LAAA 3R93A 1EIGA 2SOBA 2VOBA 2IL8A 2D2CC 3AMUA 5D8DA 2E2IA 2W71A 2F0QA 3KHRA 1VF7A 3QWNA 2FB9A 2I87A 5M9OA 3N40P 4JI7L 1I4QA 5F9LA 4JC0A 3CCUA 3NUCA 2RCNA 2L15A 3IL8A 4X3TA 1KAAA 3GTJH 5KFEA 3Q8PB 5KFVA 2TMPA 1YNJD 1KDBA 5EPJA 3RAQA 2KHJA 4QL5A 3CAMA 5DEHA 1CSQA 1WCMG 3PVXA 3J80L 4GOPC 5FO8B 1X3EA 4C5BA 2W9CB 2WYOA 5CV7A 3RN5A 4J9RA 4GC7A 2OLSA 5CC4A 4LF8H 1XNQH 2E5LL 5KFMA 1A2UA 5CR3A 3KFUA 4O3SA 3SHLA 3I4MB 4YWKA 5CYUA 1XMOQ 4NXML 1JORA 3K8AA 4HEDA 1NCVA 2RGVA 4JV5H 3OHXC 1K83A 4EBEA 2OEOA 2R8KA 2L5TA 1MI2A 4IFDJ 3GV3A 1I4RA 4DV7H 1Y1WB 1HNWQ 4DV3L 1Y1VA 2SCUB 2RQXA 4EX5A 4AQYH 4LF6H 2NZ1D 3MXPA 2K01A 2F4VQ 2JP1A 4DR6L 2K5WA 1C0AA 2NZOA 1D8LA 3K57A 4FBUA 3ITPA 3PCOB 4A3KH 1LABA 4L6TB 3CP0A 3BABA 3MR3A 4DV4L 4X62L 1SNOA 2YYAA 2WTFA 1CQVA 1TA8A 2L4NA 4DK0A 2FPIB 2B63H 1F2MA 3PR5B 4JV2A 2V59A 4P73A 1B1ZA 5TSSA 4M8AA 1SYCA 1STEA 4XDXA 4BWGB 4DNIA 3KHHA 3NTKA 1HPCA 2RA4A 4MHEA 4XT1B 3SEBA 1TQOA 3GLKA 3GIJA 5C4JH 4OX9L 1NUCA 1U0LA 4JYAQ 1K8OA 1Q3LA 2CWAA 2Z0SA 3A5UA 1VAJA 3KUPA 4F8MA 4BY1B 4EFEA 3Q24A 3K6OA 1KRSA 5D3DA 3H4DA 3FVQA 1DIKA 2HJWA 5KYIA 3QJYA 2PZWA 2NB0A 4LF7L 3U9SA 4JV1A 3W3AA 3TP5A 1EZ6A 4KTAA 2UXBQ 5A35A 1I4HA 1N36L 1EFWA 4OWXB 1KQSA 3A8JE 4DGZA 3E5NA 3FMAA 4MV7A 2B29A 5GROA 2Q2HA 4PQXA 2F4IA 4B9XA 1WTXA 1O7ZA 5KFLA 3H94A 1EYDA 4UP8A 1VQ6A 3GTPA 2KJXA 2R7DA 5LMUQ 5JEAH 3NWTA 2WB1G 3ND9A 1ESRA 5L37A 1EY0A 1BCPC 3G6YA 3K5OA 2MNAA 4YCWA 1BR9A 2NUCA 2RKSA 3S24A 1SNDA 1Z47A 1SYXB 1XMOH 4JCVE 1EIFA 1F9QA 2HVQA 3TINA 2PBZA 2B3GA 3HGBA 3RB6A 4LH7A 1RDPD 1UAPA 3VR3A 4A3KG 2DY8A 3D4RA 1PHJA 2OTLA 3MR6A 4R1JA 1WOCA 2A1AA 4C5AA 3I3CA 1RK5A 4A3EB 4FM9A 4F4YA 5I9PA 5BN4A 1HNWH 2PQAB 3S17H 4Q8FA 1WTOA 4KLKA 2AWOA 5ELCA 4JI1L 3NBHA 1JB7A 2QEXA 4RG1A 2F4VH 4H02A 3E9HA 1ZHSA 4A93B 3FDSA 1TWGB 4MA5A 4K0KQ 1O80A 1MKHA 2O4XA 1VQDA 4IUQA 3TN2A 5C0XH 1J5EQ 3NHHA 4IR1A 4EYIB 2HVSA 1HCZA 2WKDA 3MXGA 4DU9A 2PO4A 4DV0L 3A54A 3WO1A 1F9SA 2R3ZA 2OCEA 1HXYD 1BDOA 2HDLA 3G6JB 2RDJA 1TU2B 1HRJA 3R2IA 1E4FT 3EVQA 1HA5A 1XMQL 3TIGA 1D6EC 3S1NH 4A3BB 2N78A 1STYA 3KLSX 2Y0SA 3H3VI 5L1IA 3DM3A 3H0GH 3QOLA 2JA7A 1UE1A 4HMJA 1BBUA 3GV6A 4DV1L 2ZM6L 4JYAH 1CFMA 2DJGC 4GKKQ 5HY6A 5KFXA 4HCSA 4CC6A 4LFAQ 1TWAB 1BNZA 2A6HD 4DV2Q 5L1JA 1SRUA 5BR8Q 4DAYB 5C44G 3J81W 1QZHA 3Q2OA 3DLLA 5EBCA 3MEHA 5IGFA 1RTOA 5JEAG 2UUAQ 2W9BA 5EZYF 5GAGC 5D1OA 1L1OB 2UXBH 4R9WA 3V2TA 2FK3A 1XTCD 3RFCA 5DLFA 1LTBD 3M4IA 1JOKA 3W1GA 4QWBA 1QE6A 4Q0FA 2VPSA 4ED3A 1KJQA 3V6HA 1EUCB 3PW4A 4J6HA 4B3MQ 4GC6A 1JX4A 4PZ6A 4IPHA 5M5WH 2JA8H 5LMUH 4Q0YA 3HOUH 3RZOH 2N3SA 1O7LA 2WINB 4J1MA 1MJEA 4QJFA 1V1OA 4RUAA 1XPUA 2E76C 1H9JA 3KF8A 3J7AF 5ELEA 2C2EA 4QIWE 1HNZQ 1JE5A 3F2BA 1NSNS 3TP6A 5DGAA 4PMCA 5KFGA 1MHWC 4IAJA 2ZTDA 1I6HB 3IRBA 3J80i 3T1YL 2YU9H 4HNVA 3I12A 4UCOA 3FKIB 4JI3L 4ABNA 3CQZB 4G7HC 3HKSA 2A8VA 2JA6B 1JB3A 3T5KA 3VYTA 5LOVF 3SR1A 1OWTA 5D1PA 1TWCH 4F87A 4LUOA 4JV0A 4NW2A 4K0KH 1IBLQ 1RIPA 3UFXB 1J5EH 3HOVH 3V05A 1GUWA 2AHOB 3FMCA 1I3QA 1EQTA 3HOWB 2CWPA 1BXTA 4TV9F 4ECWA 4FVMA 5C3EH 1PA6A 3MFGA 4JI4Q 1OTCA 1VQAA 5M3FH 1X9NA 1PMRA 3DHQA 2MQHA 4OWTB 1IW7C 1FGBD 1LTTD 5G3LF 2NN6H 2ES2A 2AGQA 5FD6A 4I55F 1KDCA 5C1PA 4LF4L 2K5VA 1YNND 1VQMA 3LMLA 4GKKH 3S1RH 1GO3E 1WD0A 1YNXA 1RYSA 1LTRD 5KT4A 4J9PA 4DV2H 2MGSA 3TZDA 4M9UA 5LXTF 2R92B 4CJ0B 1FNUA 5BR8H 3TEHB 3GTQH 1JOOA 5KT2A 2E2IB 1U9RA 4IZ8A 5DGBA 2UUAH 4LFBL 2A6HC 3OWEB 4JBJA 4KKSA 1FGUA 1WR2A 1CT1D 1BXRA 2DJFC 1UE5A 2RCFA 3D6WA 4B3MH 2VS1A 3FPUB 2F0TA 4L8JA 3FHWA 1TWHH 4UAIA 5C1OA 1VQGA 2K14A 4BBSH 2RDIA 5BN5A 1YITA 4J9NA 1ILQA 4F4ZA 1GSAA 2NVXB 2BCOA 5KEEA 1SBBB 4ILWA 3BVMA 5ELFA 1S5DD 4ECRA 3RIZA 2UU9Q 1PLFA 4HJ7A 1W2BA 1C30A 4ME6A 1VQ7A 1KDAA 2N49A 2MFIA 3Q23A 1HNZH 2UUCQ 1NR2A 3LNNA 5IY0A 3M9OB 1UNSA 1XNRL 4UDUC 5ELBA 1M0WA 1HTPA 3Q8DA 4HIOA 4XYLB 1X55A 5KG0A 5C3EG 4A3LH 2R82A 2A74C 5M3FG 4DL7A 1C3OA 3ETHA 1IBLH 2I8CA 5JVDF 1Y1VB 2NN6G 3PQIA 2Z6KA 5KGUA 2L55A 4JOIC 2QILA 3S1MH 1N32Q 3ERSX 3CPFA 1C4QA 3BVGA 4JI4H 4B3SQ 3PZPA 4IRCA 2UVUA 2FP4B 3BQ2A 2F03A 1SJED 5EPLA 4L1KA 4B9WA 5IGGA 3PSIA 2UXCQ 4C3JB 3U4ZA 3J7AK 2E2HA 2F0EA 3H20A 1S9FA 3GQCA 3GTMA 3PIP3 5IWAQ 1PH9A 1S0NA 2EZVA 1YNNC 2BQ3A 5KNDA 3RGXA 1HR0W 4EEQA 5BPHA 3IG0A 1VQIA 1A63A 4RNOA 2P5ZX 1HNXL 5ELNA 2PZTA 3HG9A 3VR2A 2F3IA 3CCLA 1PK8A 3FRPB 4P74A 2DUDA 1M90C 4OO1G 1EL0A 3F8TA 4E4TA 3Q8SB 4MIUA 1YHAA 2OTJA 2P0AA 1YEZA 1PFMA 1YZ6A 3I56A 5HV6A 1FD7D 2HHHL 3URYA 3A7LA 5IT9c 5KYLA 5IOCA 1ZYRD 4DUYL 1NNXA 1J6QA 2HCCA 1MZBA 1PYSB 4XYMB 2UU9H 2Y0SE 4IJHA 4RGTA 2ZDQA 4MV9A 3PO2B 4LF9Q 4K8IA 1JXLA 2UUCH 1JQYD 2UUBL 2NBFA 3PO3H 1CA5A 4DR5Q 2H5XA 3A74A 4IUPA 2VUMH 2BH8A 2HGSA 2EYFA 2EY6A 3BA8A 3H91A 3M4OH 1RJPA 4NDXA 4G57A 3RV4A 2O03A 1HFGA 5C44B 1A15A 1Y69U 4KJOA 2NU6B 2R87A 4GN3B 1KD1C 3VA5A 3R23A 1PYBA 3PF4A 5FJ8H 2I5MX 3NBHB 4HTHA 1R4PB 1TS4A 2N55A 4ME3A 1CZGA 4IO9A 2E2JH 4B3SH 2E8GA 4K8JA 3I4MG 4X65Q 4V190 3STBD 3G4SA 4A3IB 3HOYB 2R7NA 2Q2TA 4BY7B 1NMFA 2ALYB 1EY8A 4PZ7A 5J2UF 1IZ6A 4JI5L 1FNWA 3GIIA 2ICEC 2JE6I 1M8AA 4ZYSA 2QA4A 4UFZA 4MTNA 2UXCH 2I5HA 4YY3L 3VPCA 1Y1WG 4MTEA 4KK7A 4NP5A 3SVMA 5JPNC 3JSLA 4I4TF 2YV5A 4DLKA 5IWAH 3P20A 5KNCA 1NR4A 1ILPA 2Y0SB 5KFBA 3G6XA 3KYHC 2JA7B 3CC4A 2WP8J 5LA6F 3RAXA 2BA0A 4A3JG 4RGOS 3S15B 3HOXB 4IRKA 5IGCA 2YRWA 3K5NA 4A3EH 4HSVA 4DL5A 2YTXA 4DR2Q 1JDBB 4BBRG 5FO9B 3EPGA 3LWUA 1YJNA 4O3RA 2L12A 4CC5A 4LK1C 1Y8PB 1MGSA 2NU7B 2W9BB 1KNAA 2Z6BA 2R6FA 4CDFC 5D1OB 1C7YA 1CQFA 2HT1A 4APVA 3T16A 1PYWD 3K5MA 3OHAA 2KCNA 4A3DB 5KG7A 2F0IA 4CGYB 4DV6Q 1V9PA 5EJWA 3DWAA 3HS0C 4L5TA 5I4DA 5K5PA 2DPJA 5JOBA 1SMYD 4HCEA 2R7ZH 4KKTA 4KHPQ 2L11A 4JI6Q 3BG5A 4LF9H 2ASLA 2IBKA 4RKLA 4BY1G 5JVH3 5C4XH 1V51A 4HN7A 3KHGA 2AU0A 1SYEA 1TR5A 3M4PA 5D3IB 1R9TH 2KEEA 2YTYA 2W8LA 4DR5H 2IA6A 1TKWB 4F4XA 1U4PA 4WJ4A 5FJ8G 3E9IA 3KF8B 2J0TD 4DFAA 4RGMA 2Z4HA 5H1SE 3HBLA 3NBIA 4K5WA 5IYBH 4RB2C 3J7ZC 4YAJB 5KFTA 4DR7H 4R8NA 3QZ7A 5A2QE 3J81E 1J8IA 4C5CA 1X3QA 2J6SA 3PN1A 3G6VA 4LUVA 4QWDA 2A69C 2KOLA 1HTLD 3BU2A 4KD3A 5H80A 1YJWA 4FP5D 2RDGA 2F0PA 3QG1A 3KLWA 1IOVA 4CJ1B 3MWEA 3E0EA 1VBGA 4X65H 1CKOA 3S16H 4XX0B 1JWSD 3JAMi 1FJGQ 4OXPA 5E7NA 3A0JA 1B4OA 3E6ZX 1B7YB 4IZOA 2RVLA 2F0WA 1I3QB 2VQEL 1R4QB 5JUMA 4TKOB 2FK1A 4A3EG 2F0JA 3H40A 3OPOA 1V43A 5F2DA 2AGPA 5KFYA 2B2WC 4LH6A 3CMAA 2ID0A 2ASJA 2EOTA 3M9NB 3WOFA 4A93G 3SK8A 2B2YC 1GUTA 2M2LA 3SXHA 4U6PA 5FPRA 5LMNQ 4C3HB 3ICEA 4XYOA 5C5LA 4UP9A 5C0XI 1I6HH 2EYMA 3KBGA 4RH6A 5FPOA 3RLFA 4YHHQ 3CQZH 3VA7A 4UCTA 1QUQA 1IBKL 1PH4A 4GKJQ 3UDXA 3I72A 1GM5A 4A3BG 2UVVA 1M1KC 2OWOA 2JYOA 4XIGS 1QNUA 2B39A 4IFDH 4JI7Q 5J3BA 5K2MA 2F0UA 1SFOA 2LFNA 4KHPH 1TS3A 3U58A 3HOWH 3CC7A 2Q2UA 5FK9C 3RJ0A 3P7JA 2NVQB 4ZUIA 4TQSA 3I2ZA 2VR1A 2XN9C 2IT1A 1FVIA 2ZJPA 2AQ3B 1HFNA 2XWJB 4A3MB 5KFPA 2MPMA 4YQWA 2IP4A 4JK1C 2GN5A 1IBML 2R92H 1AN7A 2E5LQ 2E2IH 1XWEA 4IUVA 5GONF 3OHBA 4HIMA 2KCMA 3NP8A 3EFXD 5IE8A 4NXMQ 4FF2A 1VKZA 4QW9A 1Q46A 1W93A 4A3CG 2KCCA 5EKLA 3KAKA 2F0DA 3V96A 4UCUA 1JCKB 1H9SA 4U68A 1A3VA 1EU3A 4DV3Q 4HJAA 1U4RA 5DG7A 5CBAE 3BDOA 2HQLA 3P75A 2X0SA 2NVXH 4QIWA 3FKIG 2BH2A 4YAKB 2EQSA 3R2TA 2JA6G 4ED2A 1Q1EA 2L9HA 3BQ0A 2W6PA 1SE4A 4DV4Q 2E2HB 4HJ8A 4X62Q 1ICWA 4RNNA 4UCRA 1QJOA 5LMNH 5IYCG 2X6GA 3L9AX 5EOYA 4OONA 3PIOA 4IURA 4KY5A 5CB4F 4ECQA 2LY7A 4IFDG 3S14B 2F0SA 2QGQA 3N44B 5EWFA 3J7AV 1VQ8A 2B2TA 1M7JA 3HOWG 3HB9A 4YHHH 2R93A 2BA1A 2EJGC 4ECVA 4GKJH 1ZKOA 1LT5D 3I4OA 3CVZA 2NTSA 5M5XH 1LV9A 4Q45A 5FLXc 4OX9Q 1JWMD 1KTKA 3H6MA 3ULLA 5BN3A 4HJ5A 3C46A 1S97A 3RB3A 4JI7H 1TS2A 4YBZB 3MR2A 3GTOA 1J9OA 4MZ9A 2HDMA 4IUUA 5EQ0A 1XX8A 3ORQA 2R92G 4LF7Q 5IP9G 1U5KA 4C1NI 3TIIA 5GAEC 4DN4M 4UCVA 3ND8A 3AFQA 3D4DA 5FLMH 1Q90A 3IAYA 1SR3A 4NXNL 1BOSA 2FMCA 1QVCA 2BR0A 1UE6A 1ENAA 2RDFA 4GNXA 3A56A 3HOZB 1SROA 1YJ9A 1Q8KA 2E5LH 4GZYC 3GTJA 2FMMA 1TAEA 1CI3M 3BDCA 4A3JB 2MUYA 2LS01 3J80c 2N88A 1JJ2A 4KY7A 1HUMA 4HQ6A 5C3XA 3DWPA 4BBRB 4A3GB 3GV5B 4NXMH 5CGKA 2F0KA 1HHVA 4ULLA 3VPDA 4C2MH 1PFBA 4FXKC 1WTVA 2HQEA 1CK1A 3R5XA 1EFID 3K7AB 4DV3H 3DF7A 3CCMA 1AZQA 2J4XA 4JI1Q 1I94L 4L5RC 3MWMA 2F0OA 4L5SA 3J7A5 2NVTB 3K0XA 3S2DB 1C9OA 3K59A 1AN8A 4DV4H 4X62H 3TDQA 1V4YA 3Q1KA 1UEBA 5I2XA 1Y1VG 3R5FA 1JIHA 4IN3A 2R8IA 4QUFA 3K5HA 1S0MA 4O0AA 4V0BA 1PX2A 2V4RA 1W6KA 4OGQC 4K6LA 4DV0Q 4UY8C 4MV4A 3A8KE 3OSPA 4B08A 2H1EA 1ZEQX 1ENCA 1XMQQ 1SJHD 1JICA 1YNJC 4IWYA 2K5HA 3L3OC 4Y7NB 4TQRA 5C44H 1SAPA 3GTGH 2NWGA 5FLMG 4OX9H 5EDWA 4DV1Q 2ZM6Q 3N42B 2B63A 4C3JG 3M3YH 5JPMC 2IMWP 1MSHA 1L0YB 4BS9A 2XTIA 3VYUA 3FPPA 1VQLA 3UDFA 2AMCB 5DQHA 3HOYH 4DR1Q 4LF7H 4BY7H 1GOZA 2JSOA 1GHKA 1WH2A 1N36H 1VF5C 2VB2X 1JR0D 4O4HF 1G291 3MEFA 4AYBE 3PW7A 4YWLA 1B50A 1UUPA 4R4CA 4YR2A 2LXJA 1S5FD 2A68D 1GUNA 1PTOF 1JE4A 3SDZA 4XYQA 1BF4A 4RB1A 3RMHA 1L0WA 2JA7H 1YHQA 2QCPX 3LWEA 3K5IA 3RR5A 2FK2A 3S15H 3HOXH 2K04A 2C35B 2L1BA 3PUXA 3NTHA 1STBA 3TSSA 1EZ8A 3PO2G 1RJQA 3KLSA 1K73C 2SNSA 1RJRA 2HVRA 4YB8B 3T1YQ 3EROA 4A3DH 1PTOB 1EYGA 4JI3Q 1Z2OX 1STAA 4JI1H 1GUGA 3MC0B 4MAMA 1GVPA 3ORRA 2GPWA 4QB4A 1UWVA 2OT2A 1IKMA 1TIID 1DV2A 1UNNC 3DMUA 4X6AH 5C8YF 3HKZE 1N33L 3E0JA 2KQ3A 4QW8A 5A2QW 2R84A 4O4LF 2TSSA 1HZAA 3V4ZA 3GIKA 4WORA 4BWSC 4DV0H 1P8LA 4IOAA 2R61A 4LNQA 4ALPA 2VUGA 4DF7A 1ASZA 1XMQH 2RBMA 2KEDA 2RGRA 2B8GA 4JPBW 3HOYG 2I80A 4A3IG 1L2FA 4I7AA 4BY7G 4ZHQF 5KFHA 2MCTA 3K5LA 3BJUA 5KFQA 1EQVA 4ZI7F 4DV1H 2ZM6H 1B3AA 4HSPA 2EXZA 3O13A 1K3RA 4CKEA 2QDBA 1A0IA 1AP0A 3SE0A 1EYAA 1D7QA 2ZDHA 2PMZE 4RWSC 3W1BA 4A4IA 4DR1H 2Y0SG 2R7FA 4LFBQ 4J9SA 2JA7G 1KLUD 3RGZA 3H0GA 1SFOB 1QB5D 1PTOD 2Z1CA 4JI8L 3Q0AA 4YJ2F 1GSOA 2NVYA 3HOXG 3Q22A 5KX5F 2H4OA 3J81L 4IUTA 1RD9D 4ZAIA 4H7BA 4OL7A 3WO0A 3N52A 1GKHA 4RHSA 4BXXG 4O2BF 4AH6A 3KJPA 2W7OA 3CCJA 3KHLA 2R8HA 4ID6A 5KFCA 1FYCA 4A3DG 1CM9A 1CHPD 1PH1A 1PDQA 3RZDH 3OTOL 4JI0L 3DEPA 1E4GT 3TBIB 4DAVA 3TQTA 4J9KA 4I50F 1SE3A 5ELDA 5KFIA 4DV5L 5T1GA 3T1YH 3LWBA 5LL6X 5CV9A 4JI3H 1FL0A 3VMMA 4LFAL 2EY2A 2YRXA 3RV3A 5KT3A 4LJZC 4UHVA 2IY5B 1JT8A 5IP7G 2CQAA 2VPQA 4B3RL 5C5JA 4KHZA 4QWCA 2K52A 4Y52H 3GIPA 4WD3A 2XGPA 4L63B 1SE8A 3W2DA 4IALA 4QIWB 2NVQH 1STGA 1STNA 4DR4L 4IPGA 1N56A 3N41B 3MZ5A 1WD1A 1DCZA 1IHZA 2IWHA 4DR3L 5COYA 1A3UA 1X56A 2I07B 4OIKA 4J0MA 1EYCA 3GTKA 2R7MA 3X3MA 1IKLA 4LF4H 2KHIA 3R8BA 2XC9A 5DM63 1EY9A 1PVOA 5EWGA 1TS5A 4O3NA 3GO5A 3OSOA 2R93B 5T14A 4OEMB 5EGTA 3AYHB 4HR7A 3LX0A 1TWFA 3EIVA 4GN5A 4OO1H 4R4OA 3UI2A 3S2HB 4LMQD 4J15A 4X66L 3JC66 4LFBH 1XTDA 1AH9A 1DGSA 4O3QA 1KBLA 1HNXQ 2PPBC 3F8NA 1VQ4A 4A2BA 3QZ8A 1B3QA 1N34Q 4C3HG 1BNCA 2F0MA 4A76A 3M9BA 3H15A 1D5MC 4F7XA 1H95A 1K83B 2B2UC 3J80E 1ESFA 4OHJA 2QK4A 1LTGD 5IT9W 1VS0A 4Q5VA 4CDDC 2HHHQ 3T56B 1G2TA 3X3NA 3C2PA 4DUYQ 2BQUA 1SN8A 1JWUD 3VR6A 3CCVA 5GAHC 1W6JA 1A2TA 4MV8A 2EY1A 1O78A 4GNXB 4IPCA 3VR5A 3IFDA 1KEEA 4Q44A 4KN7C 3GTJB 4RCNA 3K3PA 4J9OA 1B2TA 3M4QA 2UUBQ 1L1OC 2VW9A 1ZETA 1WYDA 2MO0A 1TWHA 2CW8A 2W6OA 2Z8LA 3QFFA 5JH7F 2UVWA 1S5CD 5KG3A 2PW5A 3OMGA 3R3OA 5CV4A 2F52A 5CAEB 3KDFA 1V1PA 2CCZA 3JAMc 4A3MG
chains in the Genus database with same CATH topology
4LUVA 3I4MH 4B3RQ 1QUQB 1V1QA 3BU2A 5EAYA 4YWKA 4A75A 1XMOQ 4NXML 4DR1L 3K8AA 1YJWA 4BA1I 1KXLA 1GD7A 3KLWA 3E0EA 4DR4Q 1CKOA 3S16H 1IYJB 4PMWA 4LWCA 1YVCA 3JAMi 4A3FH 4OXPA 5E7NA 1FJGQ 2D0PA 3A0JA 1OXXK 1B7YB 3AFPA 1Y1WH 4IFDJ 4DR3Q 1I3QH 1HNWQ 4DV3L 2VQEL 3FP9A 4EX5A 4DUZL 2UXDL 3G71A 4R4QA 1X6OA 2F4VQ 4A3EG 2D62A 1C0AA 5GQOA 4DR6L 4YY3Q 2NZOA 3EN2A 1XPRA 1V43A 1D8LA 4A3JH 4K0KL 1G51A 3PF5A 3PCOB 4A3KH 1HZBA 3CP0A 3CMAA 4DV4L 1VQEA 1J5EL 2ID0A 4X62L 4A93G 4BBRH 1Q7YC 1BKBA 1VQJA 4GOPA 1YIJA 4C3HH 1PH3A 1LTLA 3CMEA 1OXTA 5LMNQ 2B63H 3ICEA 4R4IA 5JEAJ 2KCTA 4UP9A 4P73A 4X66Q 5C0XI 5C0XG 1I6HH 4DNIA 4HJ9A 3RLFA 4YHHQ 3CQZH 3K80C 1XNRQ 2OQKA 1QUQA 1IBKL 1HR0L 2CKZB 4QGUA 4DAMA 1PH4A 4GKJQ 3UDXA 4GKKL 5C4JH 3PIPA 4OX9L 1A8VA 1PH7A 4QY7A 1U0LA 1I5FA 3L0OA 4TQUS 2CWAA 2Z0SA 4LFCL 1GM5A 4GLAC 3A5UA 4DV2L 1M1KC 2OWOA 4XIGS 4BY1H 3GTKH 5BR8L 1KRSA 4JI7Q 2K50A 2PI2A 5J3BA 1N32L 3H0GG 4LF5L 3J81c 3HOWH 3U58A 2UUAL 2JEAI 3CC7A 2RF4A 4LF7L 1X54A 2Q2UA 1VQCA 3L2PA 2IX0A 2RHQB 2UXBQ 2VL6A 1TWFH 1N36L 1EFWA 3I2ZA 4OWXB 1KQSA 3TS0A 5C0XJ 3ER0A 2IT1A 4GLVB 1FVIA 3J81i 2ZJPA 2B29A 5GROA 2Q2HA 4B3ML 1VQ9A 4A3MH 1SMXA 1HH2P 3CC2A 4O2DA 4UP8A 1VQ6A 3PUWA 2R7DA 4GS3A 4DKAC 5LMUQ 4JG2A 2GN5A 4A3FG 3BZKA 2WB1G 1P16A 1IBML 4JI2L 2R92H 2XGTA 2E5LQ 3M7NA 2E2IH 2MNAA 4YCWA 3S24A 3HOZG 1Z47A 4HIMA 2JA8G 4JCVE 1EIFA 3I7FA 3PUZA 2KCMA 1BVSA 3ZJYC 2B3GA 5IE8A 1HNZL 4NXMQ 3HOUG 3GDEA 2RHSB 1NBWA 4NB3A 4A3KG 1PHJA 1Q46A 2OTLA 4B3TL 4LW1A 3W5OA 4R1JA 1WOCA 2A1AA 4JBWA 4A3CG 1YBYA 1XPOA 4A3GG 1Z9FA 4PG3A 2PQAB 3S17H 1MJCA 4KLKA 2CFMA 2AWOA 2Q2IA 4DV3Q 2WB1E 4JI1L 4HJAA 2QEXA 4RG1A 2VQEQ 1TWGH 4H02A 4DUZQ 3E9HA 1JB7A 3D0FA 2UXDQ 1JJGA 2HQLA 1IBLL 1NE3A 2NVXH 1IXRA 3FKIG 2BH2A 4K0KQ 2EQSA 1MKHA 3F2CA 1VQDA 2E2HH 2JA6G 1Q1EA 5DLQE 2VZAA 4DV4Q 1J5EQ 1LUZA 4XTCS 3TREA 4X62Q 4HJ8A 1EIYB 2K4KA 1E3PA 2ASBA 2ZJQA 3GTMH 1Q82C 1WJJA 5IYCG 4JI4L 4DV0L 4POFA 2R6GA 2OCEA 4OONA 3PIOA 3S1QH 3S14H 3WWVA 3CCSA 4IFDI 4IFDG 3HOVG 4C3IH 4OWWB 2QGQA 1A62A 4A3BH 1VQHA 1VQ8A 1XMQL 3HOWG 3S1NH 1X65A 2BA1A 2D0OA 2N78A 2I0QA 3H3VI 2GVAA 3DM3A 3H0GH 1EOVA 2JA9A 3I4OA 1IBKQ 1UE1A 1HR0Q 4LUZA 2IX1A 4A3BG 1BBUA 4DV1L 5M5XH 2ZM6L 3TQYA 5FLXc 5HY6A 1E7ZA 1TWAH 4GKKQ 2JEBI 4OX9Q 4LFAQ 3ULLA 4HJ5A 1JMCA 4LFCQ 4IPDA 5M3MH 4DV2Q 1SRUA 5BR8Q 4DAYB 5C44G 4MZ9A 1QZHA 3DLLA 4LF5Q 1Q86C 5JEAG 3EBEA 2UUAQ 4P72A 5GAGC 1L1OB 2R92G 4LF7Q 5IP9G 1U5KA 2A19A 5GAEC 3AFQA 5FLMH 1MIUA 3CPWA 1SR3A 4NXNL 3W1GA 1QVCA 4POGA 2YTVA 4B3MQ 4JI5Q 1UE6A 3GD7A 2VQFL 4PZ6A 4IPHA 4UPAA 3STBC 5M5WH 4GNXA 2JA8H 3GTLH 3HOZH 1SROA 1NMGA 3PV0A 1YJ9A 4DPGA 3HOUH 3RZOH 1Q8KA 3LGJA 1EQRA 1Q12A 2N3SA 2JK8A 1IBMQ 4JI2Q 5IYDG 2UU9L 3CXCA 4A3CH 1MJEA 4QJFA 3J80c 1VQPA 2FXQA 1XPUA 1JJ2A 4A3GH 2UUCL 2WFWA 4BBSG 4DR2L 4QIWE 1HNZQ 1JE5A 1N34L 3F2BA 4B3TQ 5JJKA 4C2MH 2ZTDA 5JJIA 3IRBA 3J80i 4JOIA 3K7AH 2IHEA 3FKIH 3I55A 3T1YL 1X3GA 2YU9H 1VQ5A 4JI3L 3AEVA 2JA6H 1N8RC 1VQBA 3B6YA 4DV6L 2IHFA 3HKSA 3CCMA 2A8VA 2NVTH 4JI1Q 1I94L 4L5RC 5K36G 1TWCH 4L5SA 3J7A5 2ZTCA 4LUOA 2OQ0A 5IYCH 3S2DH 1IBLQ 3K0XA 1RIPA 1C9OA 3T1HL 1IL2A 3PUYA 5ELOA 4JI6L 1I50H 3HOVH 4A3LG 1KIXA 1NTGA 1B70B 1W3SA 1UEBA 5HGQA 2EXDA 1EWIA 2AHOB 1Y1VG 4B3SL 2CWPA 2VNUD 4O0AA 5C3EH 1PA6A 4X64L 4JI4Q 4DV0Q 3H3VH 1OTCA 5M3MG 1VQAA 3J81j 4UY8C 5M3FH 1X9NA 3UDIA 3M85A 2MQHA 3CF5A 4OWTB 1PH5A 1O7IA 2ES2A 2UXCL 4Y7NH 1XMQQ 5LMNW 2K5HA 4LF4L 2K5VA 5C44H 3GTGH 1VQMA 5IWAL 1GO3E 5FLMG 4GLXA 3S1RH 4DV1Q 2ZM6Q 1YNXA 1VQNA 3M3YH 4BA2I 2K5NA 5IP9H 3TEHB 3GTQH 3UE0A 4YCVA 2XTIA 1VQLA 4EQ5A 3UDFA 2AMCB 1QVGA 1HZ9A 4LFBL 2YYZA 1Q81C 1FJGL 3HOYH 1VQFA 4DR1Q 4BY7H 1VQKA 4JBJA 1WFQA 1FGUA 1S72A 1B8AA 5AJ3L 1UE5A 1RL2A 1G291 3KF6B 4NXNQ 2KENA 3MEFA 2VS1A 4TVAB 4AYBE 4A93H 4YWLA 5IYDH 1TXYA 4R4CA 3FHWA 1KL9A 2VQFQ 2DGYA 1TWHH 2LXJA 1VQGA 2K14A 4BBSH 3ULPA 1CKNB 1T9HA 3RN2A 1YITA 3CD6A 2AKWB 1L0WA 1PV4A 2JA7H 4DR6Q 3K7UC 5LMNL 1YHQA 3S2HH 3RR5A 2UU9Q 4LF9L 4HJ7A 3S15H 3HOXH 1W2BA 1VQ7A 3G6EA 2N49A 2C35B 2MFIA 3KDFB 3PUXA 4GNXC 2UUCQ 4DR5L 5IY0A 3RNUA 4IJLA 4HIKA 2GVBA 2JA5G 1WI5A 1XNRL 2K75A 3PO2G 2PI2E 2ZTEA 1K73C 1PFSA 4P75A 5GADC 1YHBA 3Q8DA 4MNOA 4HIOA 1K83H 3T1YQ 3RLNA 4A3DH 1X55A 5C3EG 1EYGA 3PO3G 4JI3Q 4DR7L 4A3LH 4NPSA 3NELA 2CQOA 4LF8L 1XNQL 2VUMG 1GVPA 5M3FG 4QQBX 3RLOA 1UWVA 1Y1VH 1I94Q 3OYYA 2NN6I 2NN6G 1SLJA 2Z6KA 1CSPA 4X6AH 4JOIC 3HKZE 3U50C 3T1HQ 1N33L 1Y14B 3S1MH 2PQAA 3CCEA 1N32Q 4JV5L 3ERSX 1HZAA 3CPFA 4A3DG 4X65L 1K8AC 1P8LA 4B3SQ 4IOAA 4LNQA 1EQQA 3UDGA 4X64Q 4DV7L 4ALPA 4DK3C 3F1ZA 4GOPB 3OW2A 1ASZA 3PSIA 3UE1A 4AQYL 1N36Q 1ASYA 4LF6L 4C3JH 1QZGA 3TRZA 3HOYG 2UXCQ 4A3IG 1L2FA 3U4ZA 4BY7G 1K9MC 2AWNA 3CCQA 3SGIA 3BJUA 1NY4A 4HIDA 5IWAQ 1PH9A 1K3RA 3AQQA 1VCIA 1A0IA 1KC8C 2I5LX 1HR0W 2R93G 1X3FA 1D7QA 2LSSA 2PMZE 3W1BA 4A4IA 1YI2A 1VQIA 2JQOA 2Y0SG 2R7FA 1HNXL 1A63A 4LFBQ 5ELNA 1SFOH 2JA7G 4R4TA 4YWMA 2F3IA 2ZJRA 3CCLA 4OO1I 3D31A 4P74A 2DUDA 4JI8L 3KJOA 1M90C 3F8TA 3HOXG 4OO1G 1G6PA 1OXUA 2HIXA 1AE2A 5AJ3Q 3I4NG 1YHAA 1K8GA 2OTJA 3HFZB 1YEZA 1CKMA 1YZ6A 2JJQA 3I56A 2HHHL 5IT9c 1GKHA 4UP7A 4BXXG 4AH6A 4DUYL 3A5ZB 1J6QA 1JJCB 3CW2C 3K81C 3KJPA 1HJPA 1L1OA 3CCJA 1QVFA 4KI0A 1PYSB 4KHPL 3VDYA 1Q1BA 2JA5H 1VQOA 3GTPH 1S3OA 2Y0SE 4AIMA 4DK6C 1PH1A 3PO2H 4IJHA 3NEMA 3RZDH 3OTOL 4JI0L 3F2DA 1PH2A 4LF9Q 5JJLA 4JYAQ 2WAQG 2R7ZG 3ULJA 2UUBL 1E24A 3PO3H 1S40A 4DR5Q 2H5XA 3A74A 2VUMH 4DV5L 2BH8A 5C4XG 1LYLA 2PNHA 4WJ3M 4YCUA 1FL0A 3M4OH 2HIVA 1XJVA 4LFAL 2IY5B 1JT8A 5IP7G 4LF8Q 1XNQQ 1E1OA 4AYBG 5M5YH 4P71A 3TS2A 4GN3B 1KD1C 4KHZA 4B3RL 2MO1A 1PYBA 2K52A 5IYBG 1XMOL 4RMFA 3PF4A 4Y52H 5FJ8H 2I5MX 3NBHB 3KOJA 1SE8A 1WCMH 2WAQE 1OXSC 1N9WA 3G48A 2KBNA 1N33Q 1E1TA 1UE7A 4ME3A 4IO9A 2E2JH 2NVQH 4IPGA 4DR4L 2V1CC 4JV5Q 4FDBA 2E8GA 1LM0A 4A3IH 3I4MG 4X65Q 3STBD 3G4SA 4DR3L 2Q2TA 1NMFA 2ALYB 1HNWL 4PZ7A 2Z6KC 1IZ6A 2LXKA 4JI5L 4DV7Q 2JE6I 2QA4A 1X56A 3PUVA 4MTNA 3CCRA 2F4VL 2I5HA 4AQYQ 1CUKA 1K0RA 4YY3L 4LF6Q 2N8NA 1EUJA 2KHIA 1AE3A 3U4VA 1Y1WG 2R93H 3BZCA 1PVOA 3GO5A 2YV5A 1PH8A 3KYHC 3AYHB 3NENA 3CC4A 2WP8J 3EIVA 1HZCA 1OXVA 4GN5A 2BA0A 4R4OA 4A3JG 4PZ8A 4L5QA 4J15A 2VY3A 4X66L 3JC66 1XTDA 1KHIA 3HKZG 1DGSA 3L7ZC 4A3EH 3I4NH 1AH9A 2EIFA 1KRTA 2YTXA 4GN4B 4DR2Q 1HNXQ 4BBRG 3GTOH 1VQ4A 4YHHL 1YJNA 1E22A 4IOCA 1N34Q 2ATWA 4BXXH 1KAWA 4A76A 1NJIC 3M9BA 3H15A 4JBKA 2B63G 4JI8Q 4GKJL 1C7YA 2NZHA 2HT1A 1H95A 4APVA 4JYAL 1PH6A 4DV6Q 1V9PA 1VS0A 2HHHQ 4L5TA 4JI7L 4DUYQ 1SN8A 2R7ZH 4JC0A 3CCUA 3CCVA 2RCNA 5GAHC 3MXNB 4KHPQ 2L15A 4GNXB 4JI6Q 4IPCA 3GTJH 3KF6A 4BY1G 2UXBL 5C4XH 3OTOQ 4JI0Q 3M4PA 1R9TH 4DR7Q 2YTYA 3M4QA 2KHJA 2UUBQ 1L1OC 2VW9A 5FJ8G 4QL5A 4WJ4A 1WYDA 2MO0A 3CAMA 1CSQA 1WCMG 3E9IA 3KF8B 1CKNA 5IP7H 3PGZA 5H1SE 4DV5Q 4GOPC 1X3EA 5IYBH 3RN5A 5LMUL 3J7ZC 1BBWA 2NVYH 2F52A 2E5LL 4LF4Q 3KDFA 2CCZA 4JBMA 3KFUA 3JAMc 4A3MG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LUV A;  3I4M H;  4B3R Q;  1QUQ B;  1V1Q A;  3BU2 A;  5EAY A;  4YWK A;  4A75 A;  1XMO Q;  4NXM L;  4DR1 L;  3K8A A;  1YJW A;  4BA1 I;  1KXL A;  1GD7 A;  3KLW A;  3E0E A;  4DR4 Q;  1CKO A;  3S16 H;  1IYJ B;  4PMW A;  4LWC A;  1YVC A;  3JAM i;  4A3F H;  4OXP A;  5E7N A;  1FJG Q;  2D0P A;  3A0J A;  1OXX K;  1B7Y B;  3AFP A;  1Y1W H;  4IFD J;  4DR3 Q;  1I3Q H;  1HNW Q;  4DV3 L;  2VQE L;  3FP9 A;  4EX5 A;  4DUZ L;  2UXD L;  3G71 A;  4R4Q A;  1X6O A;  2F4V Q;  4A3E G;  2D62 A;  1C0A A;  5GQO A;  4DR6 L;  4YY3 Q;  2NZO A;  3EN2 A;  1XPR A;  1V43 A;  1D8L A;  4A3J H;  4K0K L;  1G51 A;  3PF5 A;  3PCO B;  4A3K H;  1HZB A;  3CP0 A;  3CMA A;  4DV4 L;  1VQE A;  1J5E L;  2ID0 A;  4X62 L;  4A93 G;  4BBR H;  1Q7Y C;  1BKB A;  1VQJ A;  4GOP A;  1YIJ A;  4C3H H;  1PH3 A;  1LTL A;  3CME A;  1OXT A;  5LMN Q;  2B63 H;  3ICE A;  4R4I A;  5JEA J;  2KCT A;  4UP9 A;  4P73 A;  4X66 Q;  5C0X I;  5C0X G;  1I6H H;  4DNI A;  4HJ9 A;  3RLF A;  4YHH Q;  3CQZ H;  3K80 C;  1XNR Q;  2OQK A;  1QUQ A;  1IBK L;  1HR0 L;  2CKZ B;  4QGU A;  4DAM A;  1PH4 A;  4GKJ Q;  3UDX A;  4GKK L;  5C4J H;  3PIP A;  4OX9 L;  1A8V A;  1PH7 A;  4QY7 A;  1U0L A;  1I5F A;  3L0O A;  4TQU S;  2CWA A;  2Z0S A;  4LFC L;  1GM5 A;  4GLA C;  3A5U A;  4DV2 L;  1M1K C;  2OWO A;  4XIG S;  4BY1 H;  3GTK H;  5BR8 L;  1KRS A;  4JI7 Q;  2K50 A;  2PI2 A;  5J3B A;  1N32 L;  3H0G G;  4LF5 L;  3J81 c;  3HOW H;  3U58 A;  2UUA L;  2JEA I;  3CC7 A;  2RF4 A;  4LF7 L;  1X54 A;  2Q2U A;  1VQC A;  3L2P A;  2IX0 A;  2RHQ B;  2UXB Q;  2VL6 A;  1TWF H;  1N36 L;  1EFW A;  3I2Z A;  4OWX B;  1KQS A;  3TS0 A;  5C0X J;  3ER0 A;  2IT1 A;  4GLV B;  1FVI A;  3J81 i;  2ZJP A;  2B29 A;  5GRO A;  2Q2H A;  4B3M L;  1VQ9 A;  4A3M H;  1SMX A;  1HH2 P;  3CC2 A;  4O2D A;  4UP8 A;  1VQ6 A;  3PUW A;  2R7D A;  4GS3 A;  4DKA C;  5LMU Q;  4JG2 A;  2GN5 A;  4A3F G;  3BZK A;  2WB1 G;  1P16 A;  1IBM L;  4JI2 L;  2R92 H;  2XGT A;  2E5L Q;  3M7N A;  2E2I H;  2MNA A;  4YCW A;  3S24 A;  3HOZ G;  1Z47 A;  4HIM A;  2JA8 G;  4JCV E;  1EIF A;  3I7F A;  3PUZ A;  2KCM A;  1BVS A;  3ZJY C;  2B3G A;  5IE8 A;  1HNZ L;  4NXM Q;  3HOU G;  3GDE A;  2RHS B;  1NBW A;  4NB3 A;  4A3K G;  1PHJ A;  1Q46 A;  2OTL A;  4B3T L;  4LW1 A;  3W5O A;  4R1J A;  1WOC A;  2A1A A;  4JBW A;  4A3C G;  1YBY A;  1XPO A;  4A3G G;  1Z9F A;  4PG3 A;  2PQA B;  3S17 H;  1MJC A;  4KLK A;  2CFM A;  2AWO A;  2Q2I A;  4DV3 Q;  2WB1 E;  4JI1 L;  4HJA A;  2QEX A;  4RG1 A;  2VQE Q;  1TWG H;  4H02 A;  4DUZ Q;  3E9H A;  1JB7 A;  3D0F A;  2UXD Q;  1JJG A;  2HQL A;  1IBL L;  1NE3 A;  2NVX H;  1IXR A;  3FKI G;  2BH2 A;  4K0K Q;  2EQS A;  1MKH A;  3F2C A;  1VQD A;  2E2H H;  2JA6 G;  1Q1E A;  5DLQ E;  2VZA A;  4DV4 Q;  1J5E Q;  1LUZ A;  4XTC S;  3TRE A;  4X62 Q;  4HJ8 A;  1EIY B;  2K4K A;  1E3P A;  2ASB A;  2ZJQ A;  3GTM H;  1Q82 C;  1WJJ A;  5IYC G;  4JI4 L;  4DV0 L;  4POF A;  2R6G A;  2OCE A;  4OON A;  3PIO A;  3S1Q H;  3S14 H;  3WWV A;  3CCS A;  4IFD I;  4IFD G;  3HOV G;  4C3I H;  4OWW B;  2QGQ A;  1A62 A;  4A3B H;  1VQH A;  1VQ8 A;  1XMQ L;  3HOW G;  3S1N H;  1X65 A;  2BA1 A;  2D0O A;  2N78 A;  2I0Q A;  3H3V I;  2GVA A;  3DM3 A;  3H0G H;  1EOV A;  2JA9 A;  3I4O A;  1IBK Q;  1UE1 A;  1HR0 Q;  4LUZ A;  2IX1 A;  4A3B G;  1BBU A;  4DV1 L;  5M5X H;  2ZM6 L;  3TQY A;  5FLX c;  5HY6 A;  1E7Z A;  1TWA H;  4GKK Q;  2JEB I;  4OX9 Q;  4LFA Q;  3ULL A;  4HJ5 A;  1JMC A;  4LFC Q;  4IPD A;  5M3M H;  4DV2 Q;  1SRU A;  5BR8 Q;  4DAY B;  5C44 G;  4MZ9 A;  1QZH A;  3DLL A;  4LF5 Q;  1Q86 C;  5JEA G;  3EBE A;  2UUA Q;  4P72 A;  5GAG C;  1L1O B;  2R92 G;  4LF7 Q;  5IP9 G;  1U5K A;  2A19 A;  5GAE C;  3AFQ A;  5FLM H;  1MIU A;  3CPW A;  1SR3 A;  4NXN L;  3W1G A;  1QVC A;  4POG A;  2YTV A;  4B3M Q;  4JI5 Q;  1UE6 A;  3GD7 A;  2VQF L;  4PZ6 A;  4IPH A;  4UPA A;  3STB C;  5M5W H;  4GNX A;  2JA8 H;  3GTL H;  3HOZ H;  1SRO A;  1NMG A;  3PV0 A;  1YJ9 A;  4DPG A;  3HOU H;  3RZO H;  1Q8K A;  3LGJ A;  1EQR A;  1Q12 A;  2N3S A;  2JK8 A;  1IBM Q;  4JI2 Q;  5IYD G;  2UU9 L;  3CXC A;  4A3C H;  1MJE A;  4QJF A;  3J80 c;  1VQP A;  2FXQ A;  1XPU A;  1JJ2 A;  4A3G H;  2UUC L;  2WFW A;  4BBS G;  4DR2 L;  4QIW E;  1HNZ Q;  1JE5 A;  1N34 L;  3F2B A;  4B3T Q;  5JJK A;  4C2M H;  2ZTD A;  5JJI A;  3IRB A;  3J80 i;  4JOI A;  3K7A H;  2IHE A;  3FKI H;  3I55 A;  3T1Y L;  1X3G A;  2YU9 H;  1VQ5 A;  4JI3 L;  3AEV A;  2JA6 H;  1N8R C;  1VQB A;  3B6Y A;  4DV6 L;  2IHF A;  3HKS A;  3CCM A;  2A8V A;  2NVT H;  4JI1 Q;  1I94 L;  4L5R C;  5K36 G;  1TWC H;  4L5S A;  3J7A 5;  2ZTC A;  4LUO A;  2OQ0 A;  5IYC H;  3S2D H;  1IBL Q;  3K0X A;  1RIP A;  1C9O A;  3T1H L;  1IL2 A;  3PUY A;  5ELO A;  4JI6 L;  1I50 H;  3HOV H;  4A3L G;  1KIX A;  1NTG A;  1B70 B;  1W3S A;  1UEB A;  5HGQ A;  2EXD A;  1EWI A;  2AHO B;  1Y1V G;  4B3S L;  2CWP A;  2VNU D;  4O0A A;  5C3E H;  1PA6 A;  4X64 L;  4JI4 Q;  4DV0 Q;  3H3V H;  1OTC A;  5M3M G;  1VQA A;  3J81 j;  4UY8 C;  5M3F H;  1X9N A;  3UDI A;  3M85 A;  2MQH A;  3CF5 A;  4OWT B;  1PH5 A;  1O7I A;  2ES2 A;  2UXC L;  4Y7N H;  1XMQ Q;  5LMN W;  2K5H A;  4LF4 L;  2K5V A;  5C44 H;  3GTG H;  1VQM A;  5IWA L;  1GO3 E;  5FLM G;  4GLX A;  3S1R H;  4DV1 Q;  2ZM6 Q;  1YNX A;  1VQN A;  3M3Y H;  4BA2 I;  2K5N A;  5IP9 H;  3TEH B;  3GTQ H;  3UE0 A;  4YCV A;  2XTI A;  1VQL A;  4EQ5 A;  3UDF A;  2AMC B;  1QVG A;  1HZ9 A;  4LFB L;  2YYZ A;  1Q81 C;  1FJG L;  3HOY H;  1VQF A;  4DR1 Q;  4BY7 H;  1VQK A;  4JBJ A;  1WFQ A;  1FGU A;  1S72 A;  1B8A A;  5AJ3 L;  1UE5 A;  1RL2 A;  1G29 1;  3KF6 B;  4NXN Q;  2KEN A;  3MEF A;  2VS1 A;  4TVA B;  4AYB E;  4A93 H;  4YWL A;  5IYD H;  1TXY A;  4R4C A;  3FHW A;  1KL9 A;  2VQF Q;  2DGY A;  1TWH H;  2LXJ A;  1VQG A;  2K14 A;  4BBS H;  3ULP A;  1CKN B;  1T9H A;  3RN2 A;  1YIT A;  3CD6 A;  2AKW B;  1L0W A;  1PV4 A;  2JA7 H;  4DR6 Q;  3K7U C;  5LMN L;  1YHQ A;  3S2H H;  3RR5 A;  2UU9 Q;  4LF9 L;  4HJ7 A;  3S15 H;  3HOX H;  1W2B A;  1VQ7 A;  3G6E A;  2N49 A;  2C35 B;  2MFI A;  3KDF B;  3PUX A;  4GNX C;  2UUC Q;  4DR5 L;  5IY0 A;  3RNU A;  4IJL A;  4HIK A;  2GVB A;  2JA5 G;  1WI5 A;  1XNR L;  2K75 A;  3PO2 G;  2PI2 E;  2ZTE A;  1K73 C;  1PFS A;  4P75 A;  5GAD C;  1YHB A;  3Q8D A;  4MNO A;  4HIO A;  1K83 H;  3T1Y Q;  3RLN A;  4A3D H;  1X55 A;  5C3E G;  1EYG A;  3PO3 G;  4JI3 Q;  4DR7 L;  4A3L H;  4NPS A;  3NEL A;  2CQO A;  4LF8 L;  1XNQ L;  2VUM G;  1GVP A;  5M3F G;  4QQB X;  3RLO A;  1UWV A;  1Y1V H;  1I94 Q;  3OYY A;  2NN6 I;  2NN6 G;  1SLJ A;  2Z6K A;  1CSP A;  4X6A H;  4JOI C;  3HKZ E;  3U50 C;  3T1H Q;  1N33 L;  1Y14 B;  3S1M H;  2PQA A;  3CCE A;  1N32 Q;  4JV5 L;  3ERS X;  1HZA A;  3CPF A;  4A3D G;  4X65 L;  1K8A C;  1P8L A;  4B3S Q;  4IOA A;  4LNQ A;  1EQQ A;  3UDG A;  4X64 Q;  4DV7 L;  4ALP A;  4DK3 C;  3F1Z A;  4GOP B;  3OW2 A;  1ASZ A;  3PSI A;  3UE1 A;  4AQY L;  1N36 Q;  1ASY A;  4LF6 L;  4C3J H;  1QZG A;  3TRZ A;  3HOY G;  2UXC Q;  4A3I G;  1L2F A;  3U4Z A;  4BY7 G;  1K9M C;  2AWN A;  3CCQ A;  3SGI A;  3BJU A;  1NY4 A;  4HID A;  5IWA Q;  1PH9 A;  1K3R A;  3AQQ A;  1VCI A;  1A0I A;  1KC8 C;  2I5L X;  1HR0 W;  2R93 G;  1X3F A;  1D7Q A;  2LSS A;  2PMZ E;  3W1B A;  4A4I A;  1YI2 A;  1VQI A;  2JQO A;  2Y0S G;  2R7F A;  1HNX L;  1A63 A;  4LFB Q;  5ELN A;  1SFO H;  2JA7 G;  4R4T A;  4YWM A;  2F3I A;  2ZJR A;  3CCL A;  4OO1 I;  3D31 A;  4P74 A;  2DUD A;  4JI8 L;  3KJO A;  1M90 C;  3F8T A;  3HOX G;  4OO1 G;  1G6P A;  1OXU A;  2HIX A;  1AE2 A;  5AJ3 Q;  3I4N G;  1YHA A;  1K8G A;  2OTJ A;  3HFZ B;  1YEZ A;  1CKM A;  1YZ6 A;  2JJQ A;  3I56 A;  2HHH L;  5IT9 c;  1GKH A;  4UP7 A;  4BXX G;  4AH6 A;  4DUY L;  3A5Z B;  1J6Q A;  1JJC B;  3CW2 C;  3K81 C;  3KJP A;  1HJP A;  1L1O A;  3CCJ A;  1QVF A;  4KI0 A;  1PYS B;  4KHP L;  3VDY A;  1Q1B A;  2JA5 H;  1VQO A;  3GTP H;  1S3O A;  2Y0S E;  4AIM A;  4DK6 C;  1PH1 A;  3PO2 H;  4IJH A;  3NEM A;  3RZD H;  3OTO L;  4JI0 L;  3F2D A;  1PH2 A;  4LF9 Q;  5JJL A;  4JYA Q;  2WAQ G;  2R7Z G;  3ULJ A;  2UUB L;  1E24 A;  3PO3 H;  1S40 A;  4DR5 Q;  2H5X A;  3A74 A;  2VUM H;  4DV5 L;  2BH8 A;  5C4X G;  1LYL A;  2PNH A;  4WJ3 M;  4YCU A;  1FL0 A;  3M4O H;  2HIV A;  1XJV A;  4LFA L;  2IY5 B;  1JT8 A;  5IP7 G;  4LF8 Q;  1XNQ Q;  1E1O A;  4AYB G;  5M5Y H;  4P71 A;  3TS2 A;  4GN3 B;  1KD1 C;  4KHZ A;  4B3R L;  2MO1 A;  1PYB A;  2K52 A;  5IYB G;  1XMO L;  4RMF A;  3PF4 A;  4Y52 H;  5FJ8 H;  2I5M X;  3NBH B;  3KOJ A;  1SE8 A;  1WCM H;  2WAQ E;  1OXS C;  1N9W A;  3G48 A;  2KBN A;  1N33 Q;  1E1T A;  1UE7 A;  4ME3 A;  4IO9 A;  2E2J H;  2NVQ H;  4IPG A;  4DR4 L;  2V1C C;  4JV5 Q;  4FDB A;  2E8G A;  1LM0 A;  4A3I H;  3I4M G;  4X65 Q;  3STB D;  3G4S A;  4DR3 L;  2Q2T A;  1NMF A;  2ALY B;  1HNW L;  4PZ7 A;  2Z6K C;  1IZ6 A;  2LXK A;  4JI5 L;  4DV7 Q;  2JE6 I;  2QA4 A;  1X56 A;  3PUV A;  4MTN A;  3CCR A;  2F4V L;  2I5H A;  4AQY Q;  1CUK A;  1K0R A;  4YY3 L;  4LF6 Q;  2N8N A;  1EUJ A;  2KHI A;  1AE3 A;  3U4V A;  1Y1W G;  2R93 H;  3BZC A;  1PVO A;  3GO5 A;  2YV5 A;  1PH8 A;  3KYH C;  3AYH B;  3NEN A;  3CC4 A;  2WP8 J;  3EIV A;  1HZC A;  1OXV A;  4GN5 A;  2BA0 A;  4R4O A;  4A3J G;  4PZ8 A;  4L5Q A;  4J15 A;  2VY3 A;  4X66 L;  3JC6 6;  1XTD A;  1KHI A;  3HKZ G;  1DGS A;  3L7Z C;  4A3E H;  3I4N H;  1AH9 A;  2EIF A;  1KRT A;  2YTX A;  4GN4 B;  4DR2 Q;  1HNX Q;  4BBR G;  3GTO H;  1VQ4 A;  4YHH L;  1YJN A;  1E22 A;  4IOC A;  1N34 Q;  2ATW A;  4BXX H;  1KAW A;  4A76 A;  1NJI C;  3M9B A;  3H15 A;  4JBK A;  2B63 G;  4JI8 Q;  4GKJ L;  1C7Y A;  2NZH A;  2HT1 A;  1H95 A;  4APV A;  4JYA L;  1PH6 A;  4DV6 Q;  1V9P A;  1VS0 A;  2HHH Q;  4L5T A;  4JI7 L;  4DUY Q;  1SN8 A;  2R7Z H;  4JC0 A;  3CCU A;  3CCV A;  2RCN A;  5GAH C;  3MXN B;  4KHP Q;  2L15 A;  4GNX B;  4JI6 Q;  4IPC A;  3GTJ H;  3KF6 A;  4BY1 G;  2UXB L;  5C4X H;  3OTO Q;  4JI0 Q;  3M4P A;  1R9T H;  4DR7 Q;  2YTY A;  3M4Q A;  2KHJ A;  2UUB Q;  1L1O C;  2VW9 A;  5FJ8 G;  4QL5 A;  4WJ4 A;  1WYD A;  2MO0 A;  3CAM A;  1CSQ A;  1WCM G;  3E9I A;  3KF8 B;  1CKN A;  5IP7 H;  3PGZ A;  5H1S E;  4DV5 Q;  4GOP C;  1X3E A;  5IYB H;  3RN5 A;  5LMU L;  3J7Z C;  1BBW A;  2NVY H;  2F52 A;  2E5L L;  4LF4 Q;  3KDF A;  2CCZ A;  4JBM A;  3KFU A;  3JAM c;  4A3M G; 
#chains in the Genus database with same CATH topology
 1WTH A;  3I4M H;  1V1Q A;  1SE2 A;  5EAY A;  2PN1 A;  3BJY A;  5KT5 A;  4BA1 I;  2YZM A;  5I2Y A;  1KXL A;  5EKK A;  1XDN A;  1IYJ B;  2EY5 A;  4LWC A;  4PMW A;  1UC8 A;  1OXX K;  1Y1W H;  3CHB D;  2LKV A;  4XXE A;  1B44 D;  4DUZ L;  2UXD L;  3QO2 A;  3ONA B;  3G71 A;  2D62 A;  1ZHQ A;  5GQO A;  1E4E A;  4YY3 Q;  1XPR A;  3EN2 A;  2F3W A;  5ISR A;  4A3J H;  3PF5 A;  1HZB A;  1GJX A;  2AQ1 B;  4BBR H;  4JW0 A;  3VYR A;  1H9M A;  1BKB A;  1HQR D;  1VQJ A;  4LSA A;  3GTP B;  1ULZ A;  4IUN A;  4R4I A;  2KCT A;  3E5S A;  5C5M A;  2B63 B;  3H4B A;  1HNX H;  4A2A A;  1N34 H;  4HJ9 A;  5LL6 b;  3GTL A;  2B2V C;  1BUV T;  2OQK A;  2OH2 A;  1HR0 L;  4RZR A;  1TY2 A;  3QIA A;  2YZN A;  4C3I G;  1B33 N;  4R8I A;  5I47 A;  1EWC A;  1PH7 A;  2HHH H;  2MJ8 A;  4TQU S;  4LFC L;  3HP3 A;  4DR7 Q;  2YL2 A;  4HNU A;  4BY1 H;  4GLA C;  1Z2N X;  5KG2 A;  4DUY H;  1F77 A;  1N32 L;  5M5Y B;  5EBD A;  4TRD A;  4LF5 L;  3A8I E;  1EY6 A;  1VDZ A;  1PFN A;  2JEA I;  2ZJT A;  1VQC A;  4ECT A;  3L2P A;  5KFR A;  4NKL A;  4CHT B;  2UUB H;  2SDF A;  1KJ8 A;  3HRZ C;  4GLV B;  3J81 i;  3NGD A;  3N8D A;  4ZQ3 A;  3NE5 B;  4IHJ F;  2FLL A;  1BJT A;  1C8C A;  3PUW A;  2DIK A;  4DKA C;  1I50 A;  3OMC A;  4JI2 L;  1ET6 A;  2K7V A;  1EHI A;  3DEO A;  4QUC A;  3HOZ G;  2VUM A;  2QEJ C;  3PUZ A;  3I7F A;  5J22 A;  2K1B A;  3RUZ A;  3ZJY C;  3N43 B;  3RBD A;  1GYF A;  2RHS B;  1NBW A;  4B3T L;  3WOE A;  1II3 A;  4LW1 A;  4JBW A;  1YBY A;  1WVL A;  4WFN 3;  2V5A A;  3CKI B;  1Z9F A;  4A3G G;  3HZX A;  1MJC A;  2XRQ D;  4JI5 H;  2CFM A;  1T94 A;  1HUN A;  2Q2I A;  1Y8O B;  5DG8 A;  2IW3 A;  4A93 H;  2VQE Q;  1TWG H;  3RUP A;  4YY3 H;  3D0F A;  2DY7 A;  3I73 A;  4RU9 A;  4DL2 A;  5KFA A;  1IXR A;  5KFO A;  3N6R A;  1F2L A;  1FKA H;  2VZA A;  1D1I A;  1E3P A;  1ZYR C;  1Q82 C;  1GLV A;  1WJJ A;  4POF A;  2R6G A;  4YR3 A;  2K5D A;  3CCS A;  5HBR B;  5K36 H;  5KG6 A;  3NQT A;  1TVX A;  2ZXP A;  4JVZ A;  4H13 C;  4A3B H;  3QR8 A;  4WJW A;  2EYP A;  5L9X A;  2I0Q A;  3S1N B;  2FPP B;  4ZLT F;  1X3P A;  1SNM A;  1EOV A;  3C1E A;  1IBK Q;  2IX1 A;  3H0G B;  2BE5 D;  5KFS A;  1ROD A;  1TWA H;  5JVG 3;  2NVY B;  1JMC A;  4IPD A;  4EBC A;  2A73 B;  5C4Z A;  1GGO A;  1CTM A;  3MVV A;  1B6R A;  4ED8 A;  1G2S A;  3EBE A;  4RA8 A;  5HGT A;  1S5B D;  2FIN B;  1MIU A;  3C1F A;  4A3F B;  3MA2 B;  2XCL A;  4POG A;  2YTV A;  2WAQ A;  2R7Z A;  2PQE A;  4M1U B;  2R85 A;  2VQF L;  3MXN A;  3STB C;  1G91 A;  4NMZ A;  4RNM A;  5M5W B;  2LMC B;  1NMG A;  5C6A A;  3PV0 A;  3Q6S A;  1Q12 A;  3HOU B;  3RZO B;  2JK8 A;  1IBM Q;  3K58 A;  5IYD G;  4TUY F;  3KBX A;  2KA7 A;  4A3C H;  1R9T A;  2M05 A;  4N9P A;  5C3W A;  1LAC A;  3D3R A;  1C48 A;  1I4P A;  4DR2 L;  4AYB A;  1D5Z C;  2XCP A;  4IR9 A;  2JEJ A;  1AFP A;  5JJK A;  4ED0 A;  2QDL A;  2ASD A;  1L2Z A;  1QWY A;  2M00 A;  1LTS D;  4JOI A;  4K6D A;  2IHE A;  3FKI H;  3I55 A;  1BGW A;  3JRW A;  3FEW X;  1VQ5 A;  2NU9 B;  1EYZ A;  1B6S A;  2JA6 H;  1EEF D;  3RB4 A;  2VQE H;  4DV6 L;  3J7Y W;  2A5H A;  1KJ9 A;  2PZU A;  1B53 A;  5K36 G;  2ZTC A;  2O2L D;  3GV7 B;  5IYC H;  2J9G A;  5JJZ A;  3T1H L;  1IL2 A;  2YZG A;  2J6T A;  3PUY A;  5ELO A;  2ICI A;  4JI6 L;  3EYY A;  4MV3 A;  3GTK B;  2O5J C;  3HOV B;  1NTG A;  4XT3 B;  1W3S A;  5HGQ A;  2EXD A;  1EWI A;  2R7K A;  2VNU D;  2WAC A;  4X64 L;  1SMY C;  4PDB A;  1UEA B;  3J81 j;  4FO2 A;  3UDI A;  4N9T A;  3QB3 A;  4HR7 B;  3M85 A;  3ETJ A;  1TWF B;  1PH5 A;  5KFZ A;  1O7I A;  3BG3 A;  1ZXT A;  5LMN W;  3HKZ A;  3VYS A;  2HUG A;  2EJF C;  1A6X A;  4ECX A;  2K32 A;  1IBK H;  1K3B C;  2FJ2 A;  4QF4 A;  2JA5 A;  3KK7 A;  3S1R B;  1VQN A;  2K5N A;  5IP9 H;  1BCP F;  5IGE A;  5D65 A;  1Z7T A;  3I8Z A;  3MHB A;  1QVG A;  1Q81 C;  1FJG L;  3CQZ A;  4FU0 A;  3MR5 A;  5I6Y A;  3G7L A;  1VQK A;  1T3N A;  1WFQ A;  4J9M A;  1SYF A;  1B8A A;  2XWB B;  5AJ3 L;  3EPI A;  1RL2 A;  1EY5 A;  4I7Z C;  2AQ4 A;  3SK5 A;  4NXN Q;  3DM1 A;  2KEN A;  3BYT B;  4H0L C;  3JAM E;  3PR4 A;  3MWY W;  3OW7 A;  1XYI A;  2PMZ A;  1SEI A;  1K0S A;  2ZDG A;  1BCP B;  3OUZ A;  1WCM A;  3DUZ A;  4K14 A;  1DZ1 A;  2E74 C;  1TWH B;  3ULP A;  4DR6 Q;  1IBM H;  2AKW B;  2HD3 A;  3MAQ A;  3A55 A;  5LMN L;  3EJI A;  3S2H H;  4RAZ A;  3I4L A;  2QW7 A;  1SYG A;  1F9P A;  3F2U A;  3GIQ A;  3J80 W;  4KKU A;  1QNK A;  4MTK A;  2SEB D;  1BQQ T;  3G6E A;  2FPG B;  3KDF B;  1V1P B;  3KAJ A;  3GTM B;  5C4H A;  4IJL A;  4DXG A;  5CA0 F;  4HIK A;  2GVB A;  2JA5 G;  1WI5 A;  3S1Q B;  1CQI B;  4EYH B;  4K5X A;  2PYK A;  4C3I B;  4APM A;  4P75 A;  5IT9 E;  5GAD C;  4ECY A;  2VXW A;  5AFW A;  4ZOL F;  1EOT A;  1K83 H;  3GV8 B;  4F4W A;  4FF3 A;  1IOW A;  1D5X C;  1LT6 D;  1F2Y A;  4NPS A;  3NEL A;  2CQO A;  1ENF A;  4LF8 L;  1XNQ L;  3IKJ A;  3T5H A;  1EIH A;  4J9L A;  1IL8 A;  3RLO A;  1Y1V H;  4RCO A;  5E4X A;  4FNF A;  1I94 Q;  3OYY A;  4RZQ A;  2NN6 I;  2BQR A;  1SLJ A;  3BYY B;  1CSP A;  4O1N A;  4TV8 F;  3U50 C;  1Y14 B;  4WRD A;  5M3M B;  3Q8R B;  2EVB A;  3FDT A;  1E4E B;  4JV5 L;  1U4M A;  3S1M B;  5L1K A;  2SNM A;  1K8A C;  4DL4 A;  1EQQ A;  3UDG A;  4M7E A;  1JC7 A;  4DV7 L;  5EWE A;  4DK3 C;  3OW2 A;  2NVX A;  3UE1 A;  4AQY L;  1N36 Q;  1ASY A;  1HA6 A;  3DXJ C;  4C3J H;  1BCP D;  1Z6H A;  4S3S A;  1QZG A;  4LF6 L;  2DLN A;  4IWX A;  3M9M B;  1K9M C;  3BDL A;  3SGI A;  1S0O A;  2ZXR A;  1CHQ D;  3AU7 A;  5EPK A;  2C00 A;  4HID A;  3GTL B;  1EUD B;  2W57 A;  3SK4 A;  5KFW A;  5DAU A;  2FE3 A;  2NUA B;  4YP3 A;  1VMC A;  2CHB D;  2R93 G;  1X3F A;  3D6C A;  2Q8T A;  2JQO A;  1O75 A;  4YWM A;  1WSC A;  4ZRZ A;  1B9M A;  1MD2 D;  1T5E A;  3D31 A;  3KJO A;  4OO1 I;  3K3V A;  4NXN H;  2HIX A;  1AE2 A;  3PW0 A;  3I4N G;  1K8G A;  1AUX A;  3HFZ B;  4PV1 C;  2JJQ A;  5JVL A;  2QKI C;  4YR0 A;  2CQY A;  4C1N K;  4EVO A;  4ME5 A;  3A5Z B;  1JJC B;  4Z9C B;  3K81 C;  2V4Q A;  4DR6 H;  2XVS A;  4ZUJ A;  4ZK9 B;  4KI0 A;  5KFD A;  4FF4 A;  1Q1B A;  1I4G A;  1VQO A;  1S3O A;  3GTP H;  3BZD B;  3PO2 H;  4JUZ A;  3Q8Q B;  1I50 B;  3RD4 A;  2WB1 A;  2EPB A;  5I6W A;  1DV1 A;  2XIG A;  1QCB D;  5JJL A;  5KG1 A;  2C5C A;  1DJR D;  3G8C A;  2VB3 X;  3PO3 B;  2VUM B;  3RF2 A;  4DK1 A;  2Z9H A;  5CMD A;  3RB0 A;  4O3P A;  1SNP A;  2IX3 A;  2W6N A;  1SNQ A;  1D1K A;  4PNY A;  4YCU A;  4K2K A;  3CRL C;  4NLG A;  1M0T A;  3NK9 A;  3OIP A;  3M4O B;  3HXL A;  5FOB B;  3HEJ A;  1JLL B;  4X3U A;  1I94 H;  5M5Y H;  4P71 A;  3TS2 A;  1XMO L;  4RMF A;  3OSN A;  3KOJ A;  4C2M A;  1EY4 A;  2WAQ E;  1I6V C;  1OXS C;  3G48 A;  3L4K A;  2CW0 D;  4FF1 A;  1N33 Q;  3MFH A;  1BO0 A;  1E1T A;  1UE7 A;  2K33 A;  4RAU C;  4I7H A;  2F3V A;  4FDB A;  2E2J B;  1LM0 A;  4A3I H;  2B2W A;  1HNW L;  3PIO 3;  4EQP A;  4CKC A;  2Z6K C;  2DWC A;  2B2Y A;  3I70 A;  3PUV A;  2FFK B;  2F4V L;  5JQW A;  3MXU A;  1K0R A;  2EDG A;  1SYB A;  1EUJ A;  1GUO A;  2PNR C;  4PMB A;  2W6Q A;  1LTA D;  4EGV A;  3BZC A;  2GA4 B;  1VMP A;  5IIF A;  2K6A A;  1PH8 A;  3CU7 A;  3NEN A;  1K1S A;  4EGQ A;  1RCV D;  1HZC A;  1E2V A;  1FNV A;  4EFB A;  2C28 A;  4MA0 A;  4J9Q A;  4PZ8 A;  2D5D A;  4ETS A;  4ED6 A;  4L5Q A;  3U9O A;  1SCU B;  3L7Z C;  2B8F A;  1QIL A;  1KRT A;  4GN4 B;  2YS6 A;  2NYZ D;  1WTR A;  1E22 A;  1K28 A;  4BXX H;  3GTG A;  1KAW A;  4ODG A;  2B63 G;  4JI8 Q;  4XQJ A;  3BQ1 A;  2ATL A;  2NZH A;  2R8J A;  4JYA L;  1Z2P X;  4CDC C;  1PH6 A;  1GXD C;  2OF1 A;  2JN4 A;  3S9W A;  1E2W A;  3T5J A;  2ALZ A;  1GSH A;  4U7C A;  2L0C A;  5KFN A;  2WAQ B;  2R7Z B;  3MXN B;  4OIJ A;  4FS1 A;  1IW7 D;  1RKN A;  4IQZ A;  1S03 G;  3KF6 A;  4N8X 1;  2UXB L;  3OTO Q;  4JI0 Q;  2WKC A;  1CA6 A;  5C4X B;  2C2R A;  3CRK C;  1R9T B;  3PW5 A;  4E6I A;  5IP7 H;  5DQG A;  1CKN A;  1KNE A;  3NPP A;  3PGZ A;  4DV5 Q;  5IYZ F;  2JEI A;  4AYB B;  1T36 A;  1ICF B;  4K5V A;  5LL6 S;  5LMU L;  1BBW A;  2NVY H;  4LF4 Q;  5BPF A;  4HYK A;  4JBM A;  3GQB A;  5LP6 F;  4XQQ A;  4OWW B;  5E3F A;  3C0F B;  4OEL B;  4B3R Q;  4IRD A;  2FLP A;  1QUQ B;  1DXM A;  4A75 A;  3AB9 A;  4DR1 L;  1N33 H;  4MV1 A;  3U9T A;  5I9O A;  5FD5 A;  1G6Z A;  2QYZ A;  1GD7 A;  3BA9 A;  5COR A;  4DR4 Q;  1YVC A;  4A3F H;  3S16 B;  2D0P A;  3AFP A;  2CW0 C;  4G7O C;  4DR3 Q;  3MFI A;  3RTX A;  1I3Q H;  1GUS A;  2W6Z A;  5A2Q L;  3FP9 A;  4O4I F;  5HUR A;  4R4Q A;  1X6O A;  3NTI A;  1PRT F;  2W7P A;  3L4J A;  3TP7 A;  4K0K L;  3R5H A;  1G51 A;  2OXP A;  3T13 A;  1KAB A;  1S4Z A;  1J5E L;  1VQE A;  3HKZ B;  1Q8I A;  2AUK A;  1Q7Y C;  2BOS A;  4GOP A;  1YIJ A;  4C3H H;  1PH3 A;  1LTL A;  4R7R A;  3CME A;  1OXT A;  2A68 C;  2JA5 B;  5IGB A;  5JEA J;  4R8U A;  1AW7 A;  4X66 Q;  5C0X G;  2W6M A;  5IGD A;  2FKL A;  4ECZ A;  3H3V C;  3K80 C;  4JI8 H;  3NXW A;  1XNR Q;  2NU8 B;  2XNA C;  1PRT B;  4CBV A;  2CKZ B;  4QGU A;  4DAM A;  3MTS A;  4EG0 A;  2J7Z A;  4GKK L;  3PIP A;  1S68 A;  2HCI A;  5DLG A;  3SI8 A;  1A8V A;  4RFB A;  4QY7 A;  3L0O A;  1I5F A;  4Q43 A;  4DV2 L;  5J1Z A;  3GTK H;  5BR8 L;  2EJM A;  1H9S B;  2K50 A;  2PI2 A;  3DWQ A;  4KJN A;  3H0G G;  4EGJ A;  2IPK D;  3J81 c;  3T53 B;  2PMZ B;  2UUA L;  2RF4 A;  1X54 A;  1WCM B;  3OTO H;  4JI0 H;  1G8Z D;  4KY6 A;  1QG7 A;  2IX0 A;  2RHQ B;  2YU9 A;  2O5I C;  2VL6 A;  1TWF H;  3SE7 A;  4MV6 A;  1IYV A;  3TS0 A;  5C0X J;  4O3O A;  3ER0 A;  2NTT A;  4DV5 H;  4KV6 A;  1TWC A;  2WV6 D;  5FLX E;  4B3M L;  1VQ9 A;  2EYJ A;  4A3M H;  1SMX A;  2EE1 A;  1HH2 P;  4QMG A;  1NAP A;  5CV6 A;  3CC2 A;  4O2D A;  1FR3 A;  3EQL C;  2DNE A;  4GS3 A;  4A3F G;  1BBX C;  4LFA H;  4JG2 A;  4LSX A;  3BZK A;  1P16 A;  2XGT A;  3M7G A;  2E75 C;  5KFU A;  3KTM A;  4DA2 A;  3JAM W;  3M7N A;  4RGN A;  4B3R H;  2BDN A;  1H9K A;  2PW7 A;  2Q8R E;  2JA8 G;  5KFJ A;  4CKB A;  1BVS A;  1DM0 B;  1CZW A;  2BDO A;  1HNZ L;  3HOU G;  2YW2 A;  3GDE A;  4NB3 A;  4DR4 H;  4DL6 A;  3W5O A;  4EEY A;  1PRT D;  4O2A F;  3I4N B;  1XPO A;  4DR3 H;  4PG3 A;  3GTO B;  2FJZ A;  4K2L A;  2WB1 E;  5F9N A;  5L1L A;  2Z4I A;  4CDE C;  4DNR B;  4DUZ Q;  5DQI A;  2UXD Q;  3GP7 A;  5KT6 A;  1JJG A;  4QCL A;  1IBL L;  1PTO C;  5IOD A;  1NE3 A;  3GTQ A;  1LT4 D;  3F2C A;  4YIJ A;  2E2H H;  5DLQ E;  3LP8 A;  1LUZ A;  4XTC S;  3TRE A;  3TME A;  3TP8 A;  1EIY B;  1PZJ D;  2K4K A;  2W70 A;  3TQ1 A;  2ASB A;  2ZJQ A;  3GTM H;  4G3I A;  4JI4 L;  3WNZ A;  2CVR A;  2AQ2 B;  4ED7 A;  3S1Q H;  1I4X A;  5D14 A;  4X66 H;  3S14 H;  3I90 A;  3WWV A;  3NWS A;  4IFD I;  2R86 A;  3HOV G;  4C3I H;  3JAM L;  4FS2 A;  3BS1 A;  1MSG A;  5EKI A;  1CQJ B;  2JXM B;  1A62 A;  1VQH A;  4EBD A;  1I6U A;  1XNR H;  1X65 A;  2D0O A;  1U4L A;  3I91 A;  3K0Y A;  4H44 C;  2GVA A;  2C22 A;  2JA9 A;  1HR0 Q;  2D9U A;  4LUZ A;  4EQO A;  3JSN A;  3TQY A;  1E7Z A;  5M5X B;  2JEB I;  3C3L A;  4LFC Q;  5M3M H;  5DNF A;  3GIL A;  3RBE A;  2J6U A;  3PW2 A;  5G3L D;  2CH4 W;  2EYH A;  1LLR D;  4LF5 Q;  2RSO A;  1Q86 C;  4G7Z C;  4ECS A;  4P72 A;  3NQI A;  5IT9 L;  4C56 C;  3N6X A;  2A19 A;  1F9R A;  1RTN A;  2RSN A;  1KJJ A;  4DXF A;  2XGQ A;  3CPW A;  3T4A C;  1DD2 A;  2WB1 B;  4ZQI A;  1RHP A;  4HMI A;  3VPB A;  2VA2 A;  4KHV A;  4JI5 Q;  2AGO A;  3GD7 A;  4QWE A;  4UPA A;  4X3S A;  3HOZ H;  2K05 A;  3GTL H;  2F1M A;  4DPG A;  3MWD A;  3UQ8 A;  3LGJ A;  1EQR A;  2XCA A;  1TY0 A;  4HNT A;  2DN8 A;  4JI2 Q;  2RDH A;  4A3K B;  2UU9 L;  3CXC A;  2DZD A;  1VQP A;  2FXQ A;  5E4W C;  5DM7 3;  4A3G H;  1W96 A;  4TSS A;  2WDT A;  2UUC L;  2WFW A;  4BBS G;  2W9C A;  2KSW A;  1N34 L;  1SNC A;  4B3T Q;  2A6E D;  4C2M B;  4RKB A;  5JJI A;  3K7A H;  1X3G A;  5KG4 A;  3AEV A;  1N8R C;  1PRT C;  1VQB A;  3B6Y A;  2V58 A;  1RK6 A;  2IHF A;  3NSW A;  4DUZ H;  1RYR A;  2NVT H;  2UXD H;  3M4Y A;  1X32 A;  4N8F A;  5FO7 B;  4F88 A;  3JZI A;  2OQ0 A;  5C4J B;  3S2D H;  1LO5 D;  1L0X B;  2V4D A;  1DOL A;  1EWH A;  5JAV A;  2PCF B;  3JRX A;  1I50 H;  4A3L G;  1OO9 B;  1KIX A;  2F0L A;  1I7N A;  1B70 B;  4RB3 C;  2FLN A;  1Y1W A;  4B3S L;  3BAA A;  3H3V H;  5M3M G;  1RJT A;  2XSC A;  2KUM A;  1B04 A;  3CF5 A;  3V4S A;  2K28 A;  4KN4 C;  1ZQ7 A;  4HAE A;  2UXC L;  4Y7N H;  5FKA C;  2ZXO A;  2A69 D;  4Y8V B;  1O7Y A;  1HR0 H;  2EYO A;  1PZK D;  5IWA L;  4GLX A;  1AUV A;  3GTG B;  1S10 A;  4LFC H;  1SDF A;  5KT7 A;  4RB0 A;  1DYQ A;  4BA2 I;  3KAL A;  2B2T C;  3M3Y B;  1N32 H;  4YJ3 F;  3UE0 A;  1XXG A;  4YCV A;  2IJ0 A;  4LF5 H;  4EQ5 A;  2DPI A;  2PVP A;  1HZ9 A;  2X69 A;  2YYZ A;  5CBE E;  1VQF A;  3V6K A;  2CH4 A;  2GLT A;  2E2D C;  2VA3 A;  1S72 A;  2F0V A;  2YS7 A;  1V8Q A;  4DL3 A;  5KRU A;  3KF6 B;  4TVA B;  5IYD H;  3S17 B;  1AEX A;  3BVZ A;  1WTQ A;  1TXY A;  1KL9 A;  2VQF Q;  2DGY A;  1EY7 A;  3A7A B;  5T1I A;  2VQD A;  2YCH A;  1CKN B;  1T9H A;  3RN2 A;  3CD6 A;  1SYD A;  5DG9 A;  4JI2 H;  1PV4 A;  4RAY A;  2JEG A;  2WII B;  4U67 3;  2FMA A;  3K7U C;  3H09 A;  1ET9 A;  4LF9 L;  4RUC A;  5J2T F;  1T5X D;  2CZG A;  1A9X A;  4EQN A;  1EEI D;  3E3X A;  4GNX C;  2X6L A;  1E0B A;  4DR5 L;  3RNU A;  4B3T H;  1KJI A;  4ECU A;  1PXU A;  2K75 A;  1CS0 A;  2PI2 E;  1K8M A;  2ZTE A;  1AZP A;  1PFS A;  2DNC A;  3T5L A;  1YHB A;  4MNO A;  3EA6 A;  1PTO H;  2MHV A;  1HQM C;  3RLN A;  3V6J A;  4KD4 A;  1SSO A;  3PO3 G;  2K5Q A;  4DR7 L;  5E1F A;  2A6E C;  3MFY A;  2G5D A;  2VUM G;  3OIQ A;  4QQB X;  2AUJ D;  1SEB D;  2MP1 A;  1KC7 A;  2R8G A;  3IFT A;  5J39 A;  4FXG C;  2QF7 A;  2KEC A;  3KLR A;  3T1H Q;  3IN5 A;  1Y8N B;  2PQA A;  3CCE A;  1CE8 A;  4CJ2 C;  4MN3 A;  1ML0 D;  3SK6 A;  4X65 L;  2V9W A;  2Q8I B;  4F50 A;  4UCS A;  3VR4 A;  4X64 Q;  1TWG A;  3F1Z A;  4GOP B;  1LTI D;  3TRZ A;  4R8U B;  2KVM A;  4KMU C;  1EZ1 A;  1E2Z A;  3GID A;  3KXY T;  2AWN A;  3CCQ A;  3TZU A;  1NY4 A;  2JA8 B;  2GPS A;  1I7L A;  5KG5 A;  1SXT A;  4ED1 A;  2F0N A;  3AQQ A;  2C9O A;  1VCI A;  4O42 A;  1KC8 C;  2I5L X;  1RF2 D;  2LSS A;  3MJF A;  2B2U A;  3P1H A;  1YI2 A;  2XD4 A;  1DON A;  1SFO H;  4R4T A;  2F0H A;  2ZJR A;  1VBH A;  1G6P A;  3PMF A;  1TWA A;  1OXU A;  5AJ3 Q;  3OUU A;  4WBN F;  4FBT A;  2YU9 B;  4FYD A;  2UVR A;  1CKM A;  4DAY A;  4X3K A;  1UC9 A;  1K1Q A;  2C2D A;  2VQF H;  1WTW A;  4UP7 A;  1H9R A;  3ZYY X;  1WTP A;  3CW2 C;  1HJP A;  1L1O A;  4QWA A;  1ONL A;  1TWC B;  1QVF A;  3OOC A;  4KHP L;  1JOQ A;  3VDY A;  2JA5 H;  1JKJ B;  4DK6 C;  4AIM A;  2JEF A;  3NEM A;  3F2D A;  1PH2 A;  5NUC A;  3RZD B;  2WAQ G;  4DR2 H;  2F0G A;  3ULJ A;  2R7Z G;  4MTD A;  1E24 A;  5KKN B;  1N48 A;  1S40 A;  4Q8E A;  2I46 A;  1KLG D;  2G9H D;  5C3E B;  2F0F A;  1A3T A;  5M3F B;  4ZKC B;  3OWF A;  5C4X G;  1LYL A;  1M6V A;  2W9A A;  2PNH A;  4WJ3 M;  5CA1 F;  1QOH A;  2HIV A;  4DNT B;  1XJV A;  4DV6 H;  3QOJ A;  4LF8 Q;  1XNQ Q;  1E1O A;  4AYB G;  5FLX W;  2M9V A;  2FHT A;  2XIW A;  1MBY A;  1TT2 A;  2MO1 A;  1F2Z A;  2XRS D;  5IYB G;  4PWQ A;  3T1H H;  4DAP A;  1B9N A;  2WE6 A;  1WCM H;  4JI6 H;  1N9W A;  2BE5 C;  2KBN A;  4I65 A;  4ZCK A;  3GTQ B;  3FKI A;  3D8G A;  4JV5 Q;  2V1C C;  5CV5 A;  1D2B A;  2JA6 A;  2W8K A;  4X64 H;  3T51 B;  5LHY 1;  5LYJ F;  1JDE A;  2CW7 A;  2LXK A;  4DV7 Q;  1STH A;  3D4W A;  3CCR A;  4AQY Q;  1CUK A;  4LF6 Q;  4G4K A;  2N8N A;  2KHS A;  1AE3 A;  2ENB A;  3U4V A;  2R93 H;  5BMV F;  2G9D A;  3GIM A;  1M4V A;  4XQN A;  5CV8 A;  4BBS B;  1GHJ A;  2B2V A;  1OXV A;  5KFK A;  1LT3 D;  2EYL A;  1S5E D;  2VY3 A;  1KHI A;  3HKZ G;  3I4N H;  1DOK A;  2K03 A;  1FJG H;  1DOM A;  2EIF A;  5FLX L;  4FXD A;  4J8Q A;  1EU4 A;  3GTO H;  2ZT9 C;  1IYU A;  4YHH L;  5KFF A;  1PZI D;  4IOC A;  2ATW A;  4ZKB B;  4P2C B;  2R7L A;  1NJI C;  4JBK A;  3WDN A;  4XZ3 B;  5KNB A;  4RHR A;  4GKJ L;  4LMY A;  5KIX A;  2R92 A;  3ERQ A;  4LAA A;  3R93 A;  1EIG A;  2SOB A;  2VOB A;  2IL8 A;  2D2C C;  3AMU A;  5D8D A;  2E2I A;  2W71 A;  2F0Q A;  3KHR A;  1VF7 A;  3QWN A;  2FB9 A;  2I87 A;  5M9O A;  3N40 P;  4JI7 L;  1I4Q A;  5F9L A;  4JC0 A;  3CCU A;  3NUC A;  2RCN A;  2L15 A;  3IL8 A;  4X3T A;  1KAA A;  3GTJ H;  5KFE A;  3Q8P B;  5KFV A;  2TMP A;  1YNJ D;  1KDB A;  5EPJ A;  3RAQ A;  2KHJ A;  4QL5 A;  3CAM A;  5DEH A;  1CSQ A;  1WCM G;  3PVX A;  3J80 L;  4GOP C;  5FO8 B;  1X3E A;  4C5B A;  2W9C B;  2WYO A;  5CV7 A;  3RN5 A;  4J9R A;  4GC7 A;  2OLS A;  5CC4 A;  4LF8 H;  1XNQ H;  2E5L L;  5KFM A;  1A2U A;  5CR3 A;  3KFU A;  4O3S A;  3SHL A;  3I4M B;  4YWK A;  5CYU A;  1XMO Q;  4NXM L;  1JOR A;  3K8A A;  4HED A;  1NCV A;  2RGV A;  4JV5 H;  3OHX C;  1K83 A;  4EBE A;  2OEO A;  2R8K A;  2L5T A;  1MI2 A;  4IFD J;  3GV3 A;  1I4R A;  4DV7 H;  1Y1W B;  1HNW Q;  4DV3 L;  1Y1V A;  2SCU B;  2RQX A;  4EX5 A;  4AQY H;  4LF6 H;  2NZ1 D;  3MXP A;  2K01 A;  2F4V Q;  2JP1 A;  4DR6 L;  2K5W A;  1C0A A;  2NZO A;  1D8L A;  3K57 A;  4FBU A;  3ITP A;  3PCO B;  4A3K H;  1LAB A;  4L6T B;  3CP0 A;  3BAB A;  3MR3 A;  4DV4 L;  4X62 L;  1SNO A;  2YYA A;  2WTF A;  1CQV A;  1TA8 A;  2L4N A;  4DK0 A;  2FPI B;  2B63 H;  1F2M A;  3PR5 B;  4JV2 A;  2V59 A;  4P73 A;  1B1Z A;  5TSS A;  4M8A A;  1SYC A;  1STE A;  4XDX A;  4BWG B;  4DNI A;  3KHH A;  3NTK A;  1HPC A;  2RA4 A;  4MHE A;  4XT1 B;  3SEB A;  1TQO A;  3GLK A;  3GIJ A;  5C4J H;  4OX9 L;  1NUC A;  1U0L A;  4JYA Q;  1K8O A;  1Q3L A;  2CWA A;  2Z0S A;  3A5U A;  1VAJ A;  3KUP A;  4F8M A;  4BY1 B;  4EFE A;  3Q24 A;  3K6O A;  1KRS A;  5D3D A;  3H4D A;  3FVQ A;  1DIK A;  2HJW A;  5KYI A;  3QJY A;  2PZW A;  2NB0 A;  4LF7 L;  3U9S A;  4JV1 A;  3W3A A;  3TP5 A;  1EZ6 A;  4KTA A;  2UXB Q;  5A35 A;  1I4H A;  1N36 L;  1EFW A;  4OWX B;  1KQS A;  3A8J E;  4DGZ A;  3E5N A;  3FMA A;  4MV7 A;  2B29 A;  5GRO A;  2Q2H A;  4PQX A;  2F4I A;  4B9X A;  1WTX A;  1O7Z A;  5KFL A;  3H94 A;  1EYD A;  4UP8 A;  1VQ6 A;  3GTP A;  2KJX A;  2R7D A;  5LMU Q;  5JEA H;  3NWT A;  2WB1 G;  3ND9 A;  1ESR A;  5L37 A;  1EY0 A;  1BCP C;  3G6Y A;  3K5O A;  2MNA A;  4YCW A;  1BR9 A;  2NUC A;  2RKS A;  3S24 A;  1SND A;  1Z47 A;  1SYX B;  1XMO H;  4JCV E;  1EIF A;  1F9Q A;  2HVQ A;  3TIN A;  2PBZ A;  2B3G A;  3HGB A;  3RB6 A;  4LH7 A;  1RDP D;  1UAP A;  3VR3 A;  4A3K G;  2DY8 A;  3D4R A;  1PHJ A;  2OTL A;  3MR6 A;  4R1J A;  1WOC A;  2A1A A;  4C5A A;  3I3C A;  1RK5 A;  4A3E B;  4FM9 A;  4F4Y A;  5I9P A;  5BN4 A;  1HNW H;  2PQA B;  3S17 H;  4Q8F A;  1WTO A;  4KLK A;  2AWO A;  5ELC A;  4JI1 L;  3NBH A;  1JB7 A;  2QEX A;  4RG1 A;  2F4V H;  4H02 A;  3E9H A;  1ZHS A;  4A93 B;  3FDS A;  1TWG B;  4MA5 A;  4K0K Q;  1O80 A;  1MKH A;  2O4X A;  1VQD A;  4IUQ A;  3TN2 A;  5C0X H;  1J5E Q;  3NHH A;  4IR1 A;  4EYI B;  2HVS A;  1HCZ A;  2WKD A;  3MXG A;  4DU9 A;  2PO4 A;  4DV0 L;  3A54 A;  3WO1 A;  1F9S A;  2R3Z A;  2OCE A;  1HXY D;  1BDO A;  2HDL A;  3G6J B;  2RDJ A;  1TU2 B;  1HRJ A;  3R2I A;  1E4F T;  3EVQ A;  1HA5 A;  1XMQ L;  3TIG A;  1D6E C;  3S1N H;  4A3B B;  2N78 A;  1STY A;  3KLS X;  2Y0S A;  3H3V I;  5L1I A;  3DM3 A;  3H0G H;  3QOL A;  2JA7 A;  1UE1 A;  4HMJ A;  1BBU A;  3GV6 A;  4DV1 L;  2ZM6 L;  4JYA H;  1CFM A;  2DJG C;  4GKK Q;  5HY6 A;  5KFX A;  4HCS A;  4CC6 A;  4LFA Q;  1TWA B;  1BNZ A;  2A6H D;  4DV2 Q;  5L1J A;  1SRU A;  5BR8 Q;  4DAY B;  5C44 G;  3J81 W;  1QZH A;  3Q2O A;  3DLL A;  5EBC A;  3MEH A;  5IGF A;  1RTO A;  5JEA G;  2UUA Q;  2W9B A;  5EZY F;  5GAG C;  5D1O A;  1L1O B;  2UXB H;  4R9W A;  3V2T A;  2FK3 A;  1XTC D;  3RFC A;  5DLF A;  1LTB D;  3M4I A;  1JOK A;  3W1G A;  4QWB A;  1QE6 A;  4Q0F A;  2VPS A;  4ED3 A;  1KJQ A;  3V6H A;  1EUC B;  3PW4 A;  4J6H A;  4B3M Q;  4GC6 A;  1JX4 A;  4PZ6 A;  4IPH A;  5M5W H;  2JA8 H;  5LMU H;  4Q0Y A;  3HOU H;  3RZO H;  2N3S A;  1O7L A;  2WIN B;  4J1M A;  1MJE A;  4QJF A;  1V1O A;  4RUA A;  1XPU A;  2E76 C;  1H9J A;  3KF8 A;  3J7A F;  5ELE A;  2C2E A;  4QIW E;  1HNZ Q;  1JE5 A;  3F2B A;  1NSN S;  3TP6 A;  5DGA A;  4PMC A;  5KFG A;  1MHW C;  4IAJ A;  2ZTD A;  1I6H B;  3IRB A;  3J80 i;  3T1Y L;  2YU9 H;  4HNV A;  3I12 A;  4UCO A;  3FKI B;  4JI3 L;  4ABN A;  3CQZ B;  4G7H C;  3HKS A;  2A8V A;  2JA6 B;  1JB3 A;  3T5K A;  3VYT A;  5LOV F;  3SR1 A;  1OWT A;  5D1P A;  1TWC H;  4F87 A;  4LUO A;  4JV0 A;  4NW2 A;  4K0K H;  1IBL Q;  1RIP A;  3UFX B;  1J5E H;  3HOV H;  3V05 A;  1GUW A;  2AHO B;  3FMC A;  1I3Q A;  1EQT A;  3HOW B;  2CWP A;  1BXT A;  4TV9 F;  4ECW A;  4FVM A;  5C3E H;  1PA6 A;  3MFG A;  4JI4 Q;  1OTC A;  1VQA A;  5M3F H;  1X9N A;  1PMR A;  3DHQ A;  2MQH A;  4OWT B;  1IW7 C;  1FGB D;  1LTT D;  5G3L F;  2NN6 H;  2ES2 A;  2AGQ A;  5FD6 A;  4I55 F;  1KDC A;  5C1P A;  4LF4 L;  2K5V A;  1YNN D;  1VQM A;  3LML A;  4GKK H;  3S1R H;  1GO3 E;  1WD0 A;  1YNX A;  1RYS A;  1LTR D;  5KT4 A;  4J9P A;  4DV2 H;  2MGS A;  3TZD A;  4M9U A;  5LXT F;  2R92 B;  4CJ0 B;  1FNU A;  5BR8 H;  3TEH B;  3GTQ H;  1JOO A;  5KT2 A;  2E2I B;  1U9R A;  4IZ8 A;  5DGB A;  2UUA H;  4LFB L;  2A6H C;  3OWE B;  4JBJ A;  4KKS A;  1FGU A;  1WR2 A;  1CT1 D;  1BXR A;  2DJF C;  1UE5 A;  2RCF A;  3D6W A;  4B3M H;  2VS1 A;  3FPU B;  2F0T A;  4L8J A;  3FHW A;  1TWH H;  4UAI A;  5C1O A;  1VQG A;  2K14 A;  4BBS H;  2RDI A;  5BN5 A;  1YIT A;  4J9N A;  1ILQ A;  4F4Z A;  1GSA A;  2NVX B;  2BCO A;  5KEE A;  1SBB B;  4ILW A;  3BVM A;  5ELF A;  1S5D D;  4ECR A;  3RIZ A;  2UU9 Q;  1PLF A;  4HJ7 A;  1W2B A;  1C30 A;  4ME6 A;  1VQ7 A;  1KDA A;  2N49 A;  2MFI A;  3Q23 A;  1HNZ H;  2UUC Q;  1NR2 A;  3LNN A;  5IY0 A;  3M9O B;  1UNS A;  1XNR L;  4UDU C;  5ELB A;  1M0W A;  1HTP A;  3Q8D A;  4HIO A;  4XYL B;  1X55 A;  5KG0 A;  5C3E G;  4A3L H;  2R82 A;  2A74 C;  5M3F G;  4DL7 A;  1C3O A;  3ETH A;  1IBL H;  2I8C A;  5JVD F;  1Y1V B;  2NN6 G;  3PQI A;  2Z6K A;  5KGU A;  2L55 A;  4JOI C;  2QIL A;  3S1M H;  1N32 Q;  3ERS X;  3CPF A;  1C4Q A;  3BVG A;  4JI4 H;  4B3S Q;  3PZP A;  4IRC A;  2UVU A;  2FP4 B;  3BQ2 A;  2F03 A;  1SJE D;  5EPL A;  4L1K A;  4B9W A;  5IGG A;  3PSI A;  2UXC Q;  4C3J B;  3U4Z A;  3J7A K;  2E2H A;  2F0E A;  3H20 A;  1S9F A;  3GQC A;  3GTM A;  3PIP 3;  5IWA Q;  1PH9 A;  1S0N A;  2EZV A;  1YNN C;  2BQ3 A;  5KND A;  3RGX A;  1HR0 W;  4EEQ A;  5BPH A;  3IG0 A;  1VQI A;  1A63 A;  4RNO A;  2P5Z X;  1HNX L;  5ELN A;  2PZT A;  3HG9 A;  3VR2 A;  2F3I A;  3CCL A;  1PK8 A;  3FRP B;  4P74 A;  2DUD A;  1M90 C;  4OO1 G;  1EL0 A;  3F8T A;  4E4T A;  3Q8S B;  4MIU A;  1YHA A;  2OTJ A;  2P0A A;  1YEZ A;  1PFM A;  1YZ6 A;  3I56 A;  5HV6 A;  1FD7 D;  2HHH L;  3URY A;  3A7L A;  5IT9 c;  5KYL A;  5IOC A;  1ZYR D;  4DUY L;  1NNX A;  1J6Q A;  2HCC A;  1MZB A;  1PYS B;  4XYM B;  2UU9 H;  2Y0S E;  4IJH A;  4RGT A;  2ZDQ A;  4MV9 A;  3PO2 B;  4LF9 Q;  4K8I A;  1JXL A;  2UUC H;  1JQY D;  2UUB L;  2NBF A;  3PO3 H;  1CA5 A;  4DR5 Q;  2H5X A;  3A74 A;  4IUP A;  2VUM H;  2BH8 A;  2HGS A;  2EYF A;  2EY6 A;  3BA8 A;  3H91 A;  3M4O H;  1RJP A;  4NDX A;  4G57 A;  3RV4 A;  2O03 A;  1HFG A;  5C44 B;  1A15 A;  1Y69 U;  4KJO A;  2NU6 B;  2R87 A;  4GN3 B;  1KD1 C;  3VA5 A;  3R23 A;  1PYB A;  3PF4 A;  5FJ8 H;  2I5M X;  3NBH B;  4HTH A;  1R4P B;  1TS4 A;  2N55 A;  4ME3 A;  1CZG A;  4IO9 A;  2E2J H;  4B3S H;  2E8G A;  4K8J A;  3I4M G;  4X65 Q;  4V19 0;  3STB D;  3G4S A;  4A3I B;  3HOY B;  2R7N A;  2Q2T A;  4BY7 B;  1NMF A;  2ALY B;  1EY8 A;  4PZ7 A;  5J2U F;  1IZ6 A;  4JI5 L;  1FNW A;  3GII A;  2ICE C;  2JE6 I;  1M8A A;  4ZYS A;  2QA4 A;  4UFZ A;  4MTN A;  2UXC H;  2I5H A;  4YY3 L;  3VPC A;  1Y1W G;  4MTE A;  4KK7 A;  4NP5 A;  3SVM A;  5JPN C;  3JSL A;  4I4T F;  2YV5 A;  4DLK A;  5IWA H;  3P20 A;  5KNC A;  1NR4 A;  1ILP A;  2Y0S B;  5KFB A;  3G6X A;  3KYH C;  2JA7 B;  3CC4 A;  2WP8 J;  5LA6 F;  3RAX A;  2BA0 A;  4A3J G;  4RGO S;  3S15 B;  3HOX B;  4IRK A;  5IGC A;  2YRW A;  3K5N A;  4A3E H;  4HSV A;  4DL5 A;  2YTX A;  4DR2 Q;  1JDB B;  4BBR G;  5FO9 B;  3EPG A;  3LWU A;  1YJN A;  4O3R A;  2L12 A;  4CC5 A;  4LK1 C;  1Y8P B;  1MGS A;  2NU7 B;  2W9B B;  1KNA A;  2Z6B A;  2R6F A;  4CDF C;  5D1O B;  1C7Y A;  1CQF A;  2HT1 A;  4APV A;  3T16 A;  1PYW D;  3K5M A;  3OHA A;  2KCN A;  4A3D B;  5KG7 A;  2F0I A;  4CGY B;  4DV6 Q;  1V9P A;  5EJW A;  3DWA A;  3HS0 C;  4L5T A;  5I4D A;  5K5P A;  2DPJ A;  5JOB A;  1SMY D;  4HCE A;  2R7Z H;  4KKT A;  4KHP Q;  2L11 A;  4JI6 Q;  3BG5 A;  4LF9 H;  2ASL A;  2IBK A;  4RKL A;  4BY1 G;  5JVH 3;  5C4X H;  1V51 A;  4HN7 A;  3KHG A;  2AU0 A;  1SYE A;  1TR5 A;  3M4P A;  5D3I B;  1R9T H;  2KEE A;  2YTY A;  2W8L A;  4DR5 H;  2IA6 A;  1TKW B;  4F4X A;  1U4P A;  4WJ4 A;  5FJ8 G;  3E9I A;  3KF8 B;  2J0T D;  4DFA A;  4RGM A;  2Z4H A;  5H1S E;  3HBL A;  3NBI A;  4K5W A;  5IYB H;  4RB2 C;  3J7Z C;  4YAJ B;  5KFT A;  4DR7 H;  4R8N A;  3QZ7 A;  5A2Q E;  3J81 E;  1J8I A;  4C5C A;  1X3Q A;  2J6S A;  3PN1 A;  3G6V A;  4LUV A;  4QWD A;  2A69 C;  2KOL A;  1HTL D;  3BU2 A;  4KD3 A;  5H80 A;  1YJW A;  4FP5 D;  2RDG A;  2F0P A;  3QG1 A;  3KLW A;  1IOV A;  4CJ1 B;  3MWE A;  3E0E A;  1VBG A;  4X65 H;  1CKO A;  3S16 H;  4XX0 B;  1JWS D;  3JAM i;  1FJG Q;  4OXP A;  5E7N A;  3A0J A;  1B4O A;  3E6Z X;  1B7Y B;  4IZO A;  2RVL A;  2F0W A;  1I3Q B;  2VQE L;  1R4Q B;  5JUM A;  4TKO B;  2FK1 A;  4A3E G;  2F0J A;  3H40 A;  3OPO A;  1V43 A;  5F2D A;  2AGP A;  5KFY A;  2B2W C;  4LH6 A;  3CMA A;  2ID0 A;  2ASJ A;  2EOT A;  3M9N B;  3WOF A;  4A93 G;  3SK8 A;  2B2Y C;  1GUT A;  2M2L A;  3SXH A;  4U6P A;  5FPR A;  5LMN Q;  4C3H B;  3ICE A;  4XYO A;  5C5L A;  4UP9 A;  5C0X I;  1I6H H;  2EYM A;  3KBG A;  4RH6 A;  5FPO A;  3RLF A;  4YHH Q;  3CQZ H;  3VA7 A;  4UCT A;  1QUQ A;  1IBK L;  1PH4 A;  4GKJ Q;  3UDX A;  3I72 A;  1GM5 A;  4A3B G;  2UVV A;  1M1K C;  2OWO A;  2JYO A;  4XIG S;  1QNU A;  2B39 A;  4IFD H;  4JI7 Q;  5J3B A;  5K2M A;  2F0U A;  1SFO A;  2LFN A;  4KHP H;  1TS3 A;  3U58 A;  3HOW H;  3CC7 A;  2Q2U A;  5FK9 C;  3RJ0 A;  3P7J A;  2NVQ B;  4ZUI A;  4TQS A;  3I2Z A;  2VR1 A;  2XN9 C;  2IT1 A;  1FVI A;  2ZJP A;  2AQ3 B;  1HFN A;  2XWJ B;  4A3M B;  5KFP A;  2MPM A;  4YQW A;  2IP4 A;  4JK1 C;  2GN5 A;  1IBM L;  2R92 H;  1AN7 A;  2E5L Q;  2E2I H;  1XWE A;  4IUV A;  5GON F;  3OHB A;  4HIM A;  2KCM A;  3NP8 A;  3EFX D;  5IE8 A;  4NXM Q;  4FF2 A;  1VKZ A;  4QW9 A;  1Q46 A;  1W93 A;  4A3C G;  2KCC A;  5EKL A;  3KAK A;  2F0D A;  3V96 A;  4UCU A;  1JCK B;  1H9S A;  4U68 A;  1A3V A;  1EU3 A;  4DV3 Q;  4HJA A;  1U4R A;  5DG7 A;  5CBA E;  3BDO A;  2HQL A;  3P75 A;  2X0S A;  2NVX H;  4QIW A;  3FKI G;  2BH2 A;  4YAK B;  2EQS A;  3R2T A;  2JA6 G;  4ED2 A;  1Q1E A;  2L9H A;  3BQ0 A;  2W6P A;  1SE4 A;  4DV4 Q;  2E2H B;  4HJ8 A;  4X62 Q;  1ICW A;  4RNN A;  4UCR A;  1QJO A;  5LMN H;  5IYC G;  2X6G A;  3L9A X;  5EOY A;  4OON A;  3PIO A;  4IUR A;  4KY5 A;  5CB4 F;  4ECQ A;  2LY7 A;  4IFD G;  3S14 B;  2F0S A;  2QGQ A;  3N44 B;  5EWF A;  3J7A V;  1VQ8 A;  2B2T A;  1M7J A;  3HOW G;  3HB9 A;  4YHH H;  2R93 A;  2BA1 A;  2EJG C;  4ECV A;  4GKJ H;  1ZKO A;  1LT5 D;  3I4O A;  3CVZ A;  2NTS A;  5M5X H;  1LV9 A;  4Q45 A;  5FLX c;  4OX9 Q;  1JWM D;  1KTK A;  3H6M A;  3ULL A;  5BN3 A;  4HJ5 A;  3C46 A;  1S97 A;  3RB3 A;  4JI7 H;  1TS2 A;  4YBZ B;  3MR2 A;  3GTO A;  1J9O A;  4MZ9 A;  2HDM A;  4IUU A;  5EQ0 A;  1XX8 A;  3ORQ A;  2R92 G;  4LF7 Q;  5IP9 G;  1U5K A;  4C1N I;  3TII A;  5GAE C;  4DN4 M;  4UCV A;  3ND8 A;  3AFQ A;  3D4D A;  5FLM H;  1Q90 A;  3IAY A;  1SR3 A;  4NXN L;  1BOS A;  2FMC A;  1QVC A;  2BR0 A;  1UE6 A;  1ENA A;  2RDF A;  4GNX A;  3A56 A;  3HOZ B;  1SRO A;  1YJ9 A;  1Q8K A;  2E5L H;  4GZY C;  3GTJ A;  2FMM A;  1TAE A;  1CI3 M;  3BDC A;  4A3J B;  2MUY A;  2LS0 1;  3J80 c;  2N88 A;  1JJ2 A;  4KY7 A;  1HUM A;  4HQ6 A;  5C3X A;  3DWP A;  4BBR B;  4A3G B;  3GV5 B;  4NXM H;  5CGK A;  2F0K A;  1HHV A;  4ULL A;  3VPD A;  4C2M H;  1PFB A;  4FXK C;  1WTV A;  2HQE A;  1CK1 A;  3R5X A;  1EFI D;  3K7A B;  4DV3 H;  3DF7 A;  3CCM A;  1AZQ A;  2J4X A;  4JI1 Q;  1I94 L;  4L5R C;  3MWM A;  2F0O A;  4L5S A;  3J7A 5;  2NVT B;  3K0X A;  3S2D B;  1C9O A;  3K59 A;  1AN8 A;  4DV4 H;  4X62 H;  3TDQ A;  1V4Y A;  3Q1K A;  1UEB A;  5I2X A;  1Y1V G;  3R5F A;  1JIH A;  4IN3 A;  2R8I A;  4QUF A;  3K5H A;  1S0M A;  4O0A A;  4V0B A;  1PX2 A;  2V4R A;  1W6K A;  4OGQ C;  4K6L A;  4DV0 Q;  4UY8 C;  4MV4 A;  3A8K E;  3OSP A;  4B08 A;  2H1E A;  1ZEQ X;  1ENC A;  1XMQ Q;  1SJH D;  1JIC A;  1YNJ C;  4IWY A;  2K5H A;  3L3O C;  4Y7N B;  4TQR A;  5C44 H;  1SAP A;  3GTG H;  2NWG A;  5FLM G;  4OX9 H;  5EDW A;  4DV1 Q;  2ZM6 Q;  3N42 B;  2B63 A;  4C3J G;  3M3Y H;  5JPM C;  2IMW P;  1MSH A;  1L0Y B;  4BS9 A;  2XTI A;  3VYU A;  3FPP A;  1VQL A;  3UDF A;  2AMC B;  5DQH A;  3HOY H;  4DR1 Q;  4LF7 H;  4BY7 H;  1GOZ A;  2JSO A;  1GHK A;  1WH2 A;  1N36 H;  1VF5 C;  2VB2 X;  1JR0 D;  4O4H F;  1G29 1;  3MEF A;  4AYB E;  3PW7 A;  4YWL A;  1B50 A;  1UUP A;  4R4C A;  4YR2 A;  2LXJ A;  1S5F D;  2A68 D;  1GUN A;  1PTO F;  1JE4 A;  3SDZ A;  4XYQ A;  1BF4 A;  4RB1 A;  3RMH A;  1L0W A;  2JA7 H;  1YHQ A;  2QCP X;  3LWE A;  3K5I A;  3RR5 A;  2FK2 A;  3S15 H;  3HOX H;  2K04 A;  2C35 B;  2L1B A;  3PUX A;  3NTH A;  1STB A;  3TSS A;  1EZ8 A;  3PO2 G;  1RJQ A;  3KLS A;  1K73 C;  2SNS A;  1RJR A;  2HVR A;  4YB8 B;  3T1Y Q;  3ERO A;  4A3D H;  1PTO B;  1EYG A;  4JI3 Q;  1Z2O X;  1STA A;  4JI1 H;  1GUG A;  3MC0 B;  4MAM A;  1GVP A;  3ORR A;  2GPW A;  4QB4 A;  1UWV A;  2OT2 A;  1IKM A;  1TII D;  1DV2 A;  1UNN C;  3DMU A;  4X6A H;  5C8Y F;  3HKZ E;  1N33 L;  3E0J A;  2KQ3 A;  4QW8 A;  5A2Q W;  2R84 A;  4O4L F;  2TSS A;  1HZA A;  3V4Z A;  3GIK A;  4WOR A;  4BWS C;  4DV0 H;  1P8L A;  4IOA A;  2R61 A;  4LNQ A;  4ALP A;  2VUG A;  4DF7 A;  1ASZ A;  1XMQ H;  2RBM A;  2KED A;  2RGR A;  2B8G A;  4JPB W;  3HOY G;  2I80 A;  4A3I G;  1L2F A;  4I7A A;  4BY7 G;  4ZHQ F;  5KFH A;  2MCT A;  3K5L A;  3BJU A;  5KFQ A;  1EQV A;  4ZI7 F;  4DV1 H;  2ZM6 H;  1B3A A;  4HSP A;  2EXZ A;  3O13 A;  1K3R A;  4CKE A;  2QDB A;  1A0I A;  1AP0 A;  3SE0 A;  1EYA A;  1D7Q A;  2ZDH A;  2PMZ E;  4RWS C;  3W1B A;  4A4I A;  4DR1 H;  2Y0S G;  2R7F A;  4LFB Q;  4J9S A;  2JA7 G;  1KLU D;  3RGZ A;  3H0G A;  1SFO B;  1QB5 D;  1PTO D;  2Z1C A;  4JI8 L;  3Q0A A;  4YJ2 F;  1GSO A;  2NVY A;  3HOX G;  3Q22 A;  5KX5 F;  2H4O A;  3J81 L;  4IUT A;  1RD9 D;  4ZAI A;  4H7B A;  4OL7 A;  3WO0 A;  3N52 A;  1GKH A;  4RHS A;  4BXX G;  4O2B F;  4AH6 A;  3KJP A;  2W7O A;  3CCJ A;  3KHL A;  2R8H A;  4ID6 A;  5KFC A;  1FYC A;  4A3D G;  1CM9 A;  1CHP D;  1PH1 A;  1PDQ A;  3RZD H;  3OTO L;  4JI0 L;  3DEP A;  1E4G T;  3TBI B;  4DAV A;  3TQT A;  4J9K A;  4I50 F;  1SE3 A;  5ELD A;  5KFI A;  4DV5 L;  5T1G A;  3T1Y H;  3LWB A;  5LL6 X;  5CV9 A;  4JI3 H;  1FL0 A;  3VMM A;  4LFA L;  2EY2 A;  2YRX A;  3RV3 A;  5KT3 A;  4LJZ C;  4UHV A;  2IY5 B;  1JT8 A;  5IP7 G;  2CQA A;  2VPQ A;  4B3R L;  5C5J A;  4KHZ A;  4QWC A;  2K52 A;  4Y52 H;  3GIP A;  4WD3 A;  2XGP A;  4L63 B;  1SE8 A;  3W2D A;  4IAL A;  4QIW B;  2NVQ H;  1STG A;  1STN A;  4DR4 L;  4IPG A;  1N56 A;  3N41 B;  3MZ5 A;  1WD1 A;  1DCZ A;  1IHZ A;  2IWH A;  4DR3 L;  5COY A;  1A3U A;  1X56 A;  2I07 B;  4OIK A;  4J0M A;  1EYC A;  3GTK A;  2R7M A;  3X3M A;  1IKL A;  4LF4 H;  2KHI A;  3R8B A;  2XC9 A;  5DM6 3;  1EY9 A;  1PVO A;  5EWG A;  1TS5 A;  4O3N A;  3GO5 A;  3OSO A;  2R93 B;  5T14 A;  4OEM B;  5EGT A;  3AYH B;  4HR7 A;  3LX0 A;  1TWF A;  3EIV A;  4GN5 A;  4OO1 H;  4R4O A;  3UI2 A;  3S2H B;  4LMQ D;  4J15 A;  4X66 L;  3JC6 6;  4LFB H;  1XTD A;  1AH9 A;  1DGS A;  4O3Q A;  1KBL A;  1HNX Q;  2PPB C;  3F8N A;  1VQ4 A;  4A2B A;  3QZ8 A;  1B3Q A;  1N34 Q;  4C3H G;  1BNC A;  2F0M A;  4A76 A;  3M9B A;  3H15 A;  1D5M C;  4F7X A;  1H95 A;  1K83 B;  2B2U C;  3J80 E;  1ESF A;  4OHJ A;  2QK4 A;  1LTG D;  5IT9 W;  1VS0 A;  4Q5V A;  4CDD C;  2HHH Q;  3T56 B;  1G2T A;  3X3N A;  3C2P A;  4DUY Q;  2BQU A;  1SN8 A;  1JWU D;  3VR6 A;  3CCV A;  5GAH C;  1W6J A;  1A2T A;  4MV8 A;  2EY1 A;  1O78 A;  4GNX B;  4IPC A;  3VR5 A;  3IFD A;  1KEE A;  4Q44 A;  4KN7 C;  3GTJ B;  4RCN A;  3K3P A;  4J9O A;  1B2T A;  3M4Q A;  2UUB Q;  1L1O C;  2VW9 A;  1ZET A;  1WYD A;  2MO0 A;  1TWH A;  2CW8 A;  2W6O A;  2Z8L A;  3QFF A;  5JH7 F;  2UVW A;  1S5C D;  5KG3 A;  2PW5 A;  3OMG A;  3R3O A;  5CV4 A;  2F52 A;  5CAE B;  3KDF A;  1V1P A;  2CCZ A;  3JAM c;  4A3M G; 
#chains in the Genus database with same CATH homology
 4LUV A;  3I4M H;  4B3R Q;  1QUQ B;  1V1Q A;  3BU2 A;  5EAY A;  4YWK A;  4A75 A;  1XMO Q;  4NXM L;  4DR1 L;  3K8A A;  1YJW A;  4BA1 I;  1KXL A;  1GD7 A;  3KLW A;  3E0E A;  4DR4 Q;  1CKO A;  3S16 H;  1IYJ B;  4PMW A;  4LWC A;  1YVC A;  3JAM i;  4A3F H;  4OXP A;  5E7N A;  1FJG Q;  2D0P A;  3A0J A;  1OXX K;  1B7Y B;  3AFP A;  1Y1W H;  4IFD J;  4DR3 Q;  1I3Q H;  1HNW Q;  4DV3 L;  2VQE L;  3FP9 A;  4EX5 A;  4DUZ L;  2UXD L;  3G71 A;  4R4Q A;  1X6O A;  2F4V Q;  4A3E G;  2D62 A;  1C0A A;  5GQO A;  4DR6 L;  4YY3 Q;  2NZO A;  3EN2 A;  1XPR A;  1V43 A;  1D8L A;  4A3J H;  4K0K L;  1G51 A;  3PF5 A;  3PCO B;  4A3K H;  1HZB A;  3CP0 A;  3CMA A;  4DV4 L;  1VQE A;  1J5E L;  2ID0 A;  4X62 L;  4A93 G;  4BBR H;  1Q7Y C;  1BKB A;  1VQJ A;  4GOP A;  1YIJ A;  4C3H H;  1PH3 A;  1LTL A;  3CME A;  1OXT A;  5LMN Q;  2B63 H;  3ICE A;  4R4I A;  5JEA J;  2KCT A;  4UP9 A;  4P73 A;  4X66 Q;  5C0X I;  5C0X G;  1I6H H;  4DNI A;  4HJ9 A;  3RLF A;  4YHH Q;  3CQZ H;  3K80 C;  1XNR Q;  2OQK A;  1QUQ A;  1IBK L;  1HR0 L;  2CKZ B;  4QGU A;  4DAM A;  1PH4 A;  4GKJ Q;  3UDX A;  4GKK L;  5C4J H;  3PIP A;  4OX9 L;  1A8V A;  1PH7 A;  4QY7 A;  1U0L A;  1I5F A;  3L0O A;  4TQU S;  2CWA A;  2Z0S A;  4LFC L;  1GM5 A;  4GLA C;  3A5U A;  4DV2 L;  1M1K C;  2OWO A;  4XIG S;  4BY1 H;  3GTK H;  5BR8 L;  1KRS A;  4JI7 Q;  2K50 A;  2PI2 A;  5J3B A;  1N32 L;  3H0G G;  4LF5 L;  3J81 c;  3HOW H;  3U58 A;  2UUA L;  2JEA I;  3CC7 A;  2RF4 A;  4LF7 L;  1X54 A;  2Q2U A;  1VQC A;  3L2P A;  2IX0 A;  2RHQ B;  2UXB Q;  2VL6 A;  1TWF H;  1N36 L;  1EFW A;  3I2Z A;  4OWX B;  1KQS A;  3TS0 A;  5C0X J;  3ER0 A;  2IT1 A;  4GLV B;  1FVI A;  3J81 i;  2ZJP A;  2B29 A;  5GRO A;  2Q2H A;  4B3M L;  1VQ9 A;  4A3M H;  1SMX A;  1HH2 P;  3CC2 A;  4O2D A;  4UP8 A;  1VQ6 A;  3PUW A;  2R7D A;  4GS3 A;  4DKA C;  5LMU Q;  4JG2 A;  2GN5 A;  4A3F G;  3BZK A;  2WB1 G;  1P16 A;  1IBM L;  4JI2 L;  2R92 H;  2XGT A;  2E5L Q;  3M7N A;  2E2I H;  2MNA A;  4YCW A;  3S24 A;  3HOZ G;  1Z47 A;  4HIM A;  2JA8 G;  4JCV E;  1EIF A;  3I7F A;  3PUZ A;  2KCM A;  1BVS A;  3ZJY C;  2B3G A;  5IE8 A;  1HNZ L;  4NXM Q;  3HOU G;  3GDE A;  2RHS B;  1NBW A;  4NB3 A;  4A3K G;  1PHJ A;  1Q46 A;  2OTL A;  4B3T L;  4LW1 A;  3W5O A;  4R1J A;  1WOC A;  2A1A A;  4JBW A;  4A3C G;  1YBY A;  1XPO A;  4A3G G;  1Z9F A;  4PG3 A;  2PQA B;  3S17 H;  1MJC A;  4KLK A;  2CFM A;  2AWO A;  2Q2I A;  4DV3 Q;  2WB1 E;  4JI1 L;  4HJA A;  2QEX A;  4RG1 A;  2VQE Q;  1TWG H;  4H02 A;  4DUZ Q;  3E9H A;  1JB7 A;  3D0F A;  2UXD Q;  1JJG A;  2HQL A;  1IBL L;  1NE3 A;  2NVX H;  1IXR A;  3FKI G;  2BH2 A;  4K0K Q;  2EQS A;  1MKH A;  3F2C A;  1VQD A;  2E2H H;  2JA6 G;  1Q1E A;  5DLQ E;  2VZA A;  4DV4 Q;  1J5E Q;  1LUZ A;  4XTC S;  3TRE A;  4X62 Q;  4HJ8 A;  1EIY B;  2K4K A;  1E3P A;  2ASB A;  2ZJQ A;  3GTM H;  1Q82 C;  1WJJ A;  5IYC G;  4JI4 L;  4DV0 L;  4POF A;  2R6G A;  2OCE A;  4OON A;  3PIO A;  3S1Q H;  3S14 H;  3WWV A;  3CCS A;  4IFD I;  4IFD G;  3HOV G;  4C3I H;  4OWW B;  2QGQ A;  1A62 A;  4A3B H;  1VQH A;  1VQ8 A;  1XMQ L;  3HOW G;  3S1N H;  1X65 A;  2BA1 A;  2D0O A;  2N78 A;  2I0Q A;  3H3V I;  2GVA A;  3DM3 A;  3H0G H;  1EOV A;  2JA9 A;  3I4O A;  1IBK Q;  1UE1 A;  1HR0 Q;  4LUZ A;  2IX1 A;  4A3B G;  1BBU A;  4DV1 L;  5M5X H;  2ZM6 L;  3TQY A;  5FLX c;  5HY6 A;  1E7Z A;  1TWA H;  4GKK Q;  2JEB I;  4OX9 Q;  4LFA Q;  3ULL A;  4HJ5 A;  1JMC A;  4LFC Q;  4IPD A;  5M3M H;  4DV2 Q;  1SRU A;  5BR8 Q;  4DAY B;  5C44 G;  4MZ9 A;  1QZH A;  3DLL A;  4LF5 Q;  1Q86 C;  5JEA G;  3EBE A;  2UUA Q;  4P72 A;  5GAG C;  1L1O B;  2R92 G;  4LF7 Q;  5IP9 G;  1U5K A;  2A19 A;  5GAE C;  3AFQ A;  5FLM H;  1MIU A;  3CPW A;  1SR3 A;  4NXN L;  3W1G A;  1QVC A;  4POG A;  2YTV A;  4B3M Q;  4JI5 Q;  1UE6 A;  3GD7 A;  2VQF L;  4PZ6 A;  4IPH A;  4UPA A;  3STB C;  5M5W H;  4GNX A;  2JA8 H;  3GTL H;  3HOZ H;  1SRO A;  1NMG A;  3PV0 A;  1YJ9 A;  4DPG A;  3HOU H;  3RZO H;  1Q8K A;  3LGJ A;  1EQR A;  1Q12 A;  2N3S A;  2JK8 A;  1IBM Q;  4JI2 Q;  5IYD G;  2UU9 L;  3CXC A;  4A3C H;  1MJE A;  4QJF A;  3J80 c;  1VQP A;  2FXQ A;  1XPU A;  1JJ2 A;  4A3G H;  2UUC L;  2WFW A;  4BBS G;  4DR2 L;  4QIW E;  1HNZ Q;  1JE5 A;  1N34 L;  3F2B A;  4B3T Q;  5JJK A;  4C2M H;  2ZTD A;  5JJI A;  3IRB A;  3J80 i;  4JOI A;  3K7A H;  2IHE A;  3FKI H;  3I55 A;  3T1Y L;  1X3G A;  2YU9 H;  1VQ5 A;  4JI3 L;  3AEV A;  2JA6 H;  1N8R C;  1VQB A;  3B6Y A;  4DV6 L;  2IHF A;  3HKS A;  3CCM A;  2A8V A;  2NVT H;  4JI1 Q;  1I94 L;  4L5R C;  5K36 G;  1TWC H;  4L5S A;  3J7A 5;  2ZTC A;  4LUO A;  2OQ0 A;  5IYC H;  3S2D H;  1IBL Q;  3K0X A;  1RIP A;  1C9O A;  3T1H L;  1IL2 A;  3PUY A;  5ELO A;  4JI6 L;  1I50 H;  3HOV H;  4A3L G;  1KIX A;  1NTG A;  1B70 B;  1W3S A;  1UEB A;  5HGQ A;  2EXD A;  1EWI A;  2AHO B;  1Y1V G;  4B3S L;  2CWP A;  2VNU D;  4O0A A;  5C3E H;  1PA6 A;  4X64 L;  4JI4 Q;  4DV0 Q;  3H3V H;  1OTC A;  5M3M G;  1VQA A;  3J81 j;  4UY8 C;  5M3F H;  1X9N A;  3UDI A;  3M85 A;  2MQH A;  3CF5 A;  4OWT B;  1PH5 A;  1O7I A;  2ES2 A;  2UXC L;  4Y7N H;  1XMQ Q;  5LMN W;  2K5H A;  4LF4 L;  2K5V A;  5C44 H;  3GTG H;  1VQM A;  5IWA L;  1GO3 E;  5FLM G;  4GLX A;  3S1R H;  4DV1 Q;  2ZM6 Q;  1YNX A;  1VQN A;  3M3Y H;  4BA2 I;  2K5N A;  5IP9 H;  3TEH B;  3GTQ H;  3UE0 A;  4YCV A;  2XTI A;  1VQL A;  4EQ5 A;  3UDF A;  2AMC B;  1QVG A;  1HZ9 A;  4LFB L;  2YYZ A;  1Q81 C;  1FJG L;  3HOY H;  1VQF A;  4DR1 Q;  4BY7 H;  1VQK A;  4JBJ A;  1WFQ A;  1FGU A;  1S72 A;  1B8A A;  5AJ3 L;  1UE5 A;  1RL2 A;  1G29 1;  3KF6 B;  4NXN Q;  2KEN A;  3MEF A;  2VS1 A;  4TVA B;  4AYB E;  4A93 H;  4YWL A;  5IYD H;  1TXY A;  4R4C A;  3FHW A;  1KL9 A;  2VQF Q;  2DGY A;  1TWH H;  2LXJ A;  1VQG A;  2K14 A;  4BBS H;  3ULP A;  1CKN B;  1T9H A;  3RN2 A;  1YIT A;  3CD6 A;  2AKW B;  1L0W A;  1PV4 A;  2JA7 H;  4DR6 Q;  3K7U C;  5LMN L;  1YHQ A;  3S2H H;  3RR5 A;  2UU9 Q;  4LF9 L;  4HJ7 A;  3S15 H;  3HOX H;  1W2B A;  1VQ7 A;  3G6E A;  2N49 A;  2C35 B;  2MFI A;  3KDF B;  3PUX A;  4GNX C;  2UUC Q;  4DR5 L;  5IY0 A;  3RNU A;  4IJL A;  4HIK A;  2GVB A;  2JA5 G;  1WI5 A;  1XNR L;  2K75 A;  3PO2 G;  2PI2 E;  2ZTE A;  1K73 C;  1PFS A;  4P75 A;  5GAD C;  1YHB A;  3Q8D A;  4MNO A;  4HIO A;  1K83 H;  3T1Y Q;  3RLN A;  4A3D H;  1X55 A;  5C3E G;  1EYG A;  3PO3 G;  4JI3 Q;  4DR7 L;  4A3L H;  4NPS A;  3NEL A;  2CQO A;  4LF8 L;  1XNQ L;  2VUM G;  1GVP A;  5M3F G;  4QQB X;  3RLO A;  1UWV A;  1Y1V H;  1I94 Q;  3OYY A;  2NN6 I;  2NN6 G;  1SLJ A;  2Z6K A;  1CSP A;  4X6A H;  4JOI C;  3HKZ E;  3U50 C;  3T1H Q;  1N33 L;  1Y14 B;  3S1M H;  2PQA A;  3CCE A;  1N32 Q;  4JV5 L;  3ERS X;  1HZA A;  3CPF A;  4A3D G;  4X65 L;  1K8A C;  1P8L A;  4B3S Q;  4IOA A;  4LNQ A;  1EQQ A;  3UDG A;  4X64 Q;  4DV7 L;  4ALP A;  4DK3 C;  3F1Z A;  4GOP B;  3OW2 A;  1ASZ A;  3PSI A;  3UE1 A;  4AQY L;  1N36 Q;  1ASY A;  4LF6 L;  4C3J H;  1QZG A;  3TRZ A;  3HOY G;  2UXC Q;  4A3I G;  1L2F A;  3U4Z A;  4BY7 G;  1K9M C;  2AWN A;  3CCQ A;  3SGI A;  3BJU A;  1NY4 A;  4HID A;  5IWA Q;  1PH9 A;  1K3R A;  3AQQ A;  1VCI A;  1A0I A;  1KC8 C;  2I5L X;  1HR0 W;  2R93 G;  1X3F A;  1D7Q A;  2LSS A;  2PMZ E;  3W1B A;  4A4I A;  1YI2 A;  1VQI A;  2JQO A;  2Y0S G;  2R7F A;  1HNX L;  1A63 A;  4LFB Q;  5ELN A;  1SFO H;  2JA7 G;  4R4T A;  4YWM A;  2F3I A;  2ZJR A;  3CCL A;  4OO1 I;  3D31 A;  4P74 A;  2DUD A;  4JI8 L;  3KJO A;  1M90 C;  3F8T A;  3HOX G;  4OO1 G;  1G6P A;  1OXU A;  2HIX A;  1AE2 A;  5AJ3 Q;  3I4N G;  1YHA A;  1K8G A;  2OTJ A;  3HFZ B;  1YEZ A;  1CKM A;  1YZ6 A;  2JJQ A;  3I56 A;  2HHH L;  5IT9 c;  1GKH A;  4UP7 A;  4BXX G;  4AH6 A;  4DUY L;  3A5Z B;  1J6Q A;  1JJC B;  3CW2 C;  3K81 C;  3KJP A;  1HJP A;  1L1O A;  3CCJ A;  1QVF A;  4KI0 A;  1PYS B;  4KHP L;  3VDY A;  1Q1B A;  2JA5 H;  1VQO A;  3GTP H;  1S3O A;  2Y0S E;  4AIM A;  4DK6 C;  1PH1 A;  3PO2 H;  4IJH A;  3NEM A;  3RZD H;  3OTO L;  4JI0 L;  3F2D A;  1PH2 A;  4LF9 Q;  5JJL A;  4JYA Q;  2WAQ G;  2R7Z G;  3ULJ A;  2UUB L;  1E24 A;  3PO3 H;  1S40 A;  4DR5 Q;  2H5X A;  3A74 A;  2VUM H;  4DV5 L;  2BH8 A;  5C4X G;  1LYL A;  2PNH A;  4WJ3 M;  4YCU A;  1FL0 A;  3M4O H;  2HIV A;  1XJV A;  4LFA L;  2IY5 B;  1JT8 A;  5IP7 G;  4LF8 Q;  1XNQ Q;  1E1O A;  4AYB G;  5M5Y H;  4P71 A;  3TS2 A;  4GN3 B;  1KD1 C;  4KHZ A;  4B3R L;  2MO1 A;  1PYB A;  2K52 A;  5IYB G;  1XMO L;  4RMF A;  3PF4 A;  4Y52 H;  5FJ8 H;  2I5M X;  3NBH B;  3KOJ A;  1SE8 A;  1WCM H;  2WAQ E;  1OXS C;  1N9W A;  3G48 A;  2KBN A;  1N33 Q;  1E1T A;  1UE7 A;  4ME3 A;  4IO9 A;  2E2J H;  2NVQ H;  4IPG A;  4DR4 L;  2V1C C;  4JV5 Q;  4FDB A;  2E8G A;  1LM0 A;  4A3I H;  3I4M G;  4X65 Q;  3STB D;  3G4S A;  4DR3 L;  2Q2T A;  1NMF A;  2ALY B;  1HNW L;  4PZ7 A;  2Z6K C;  1IZ6 A;  2LXK A;  4JI5 L;  4DV7 Q;  2JE6 I;  2QA4 A;  1X56 A;  3PUV A;  4MTN A;  3CCR A;  2F4V L;  2I5H A;  4AQY Q;  1CUK A;  1K0R A;  4YY3 L;  4LF6 Q;  2N8N A;  1EUJ A;  2KHI A;  1AE3 A;  3U4V A;  1Y1W G;  2R93 H;  3BZC A;  1PVO A;  3GO5 A;  2YV5 A;  1PH8 A;  3KYH C;  3AYH B;  3NEN A;  3CC4 A;  2WP8 J;  3EIV A;  1HZC A;  1OXV A;  4GN5 A;  2BA0 A;  4R4O A;  4A3J G;  4PZ8 A;  4L5Q A;  4J15 A;  2VY3 A;  4X66 L;  3JC6 6;  1XTD A;  1KHI A;  3HKZ G;  1DGS A;  3L7Z C;  4A3E H;  3I4N H;  1AH9 A;  2EIF A;  1KRT A;  2YTX A;  4GN4 B;  4DR2 Q;  1HNX Q;  4BBR G;  3GTO H;  1VQ4 A;  4YHH L;  1YJN A;  1E22 A;  4IOC A;  1N34 Q;  2ATW A;  4BXX H;  1KAW A;  4A76 A;  1NJI C;  3M9B A;  3H15 A;  4JBK A;  2B63 G;  4JI8 Q;  4GKJ L;  1C7Y A;  2NZH A;  2HT1 A;  1H95 A;  4APV A;  4JYA L;  1PH6 A;  4DV6 Q;  1V9P A;  1VS0 A;  2HHH Q;  4L5T A;  4JI7 L;  4DUY Q;  1SN8 A;  2R7Z H;  4JC0 A;  3CCU A;  3CCV A;  2RCN A;  5GAH C;  3MXN B;  4KHP Q;  2L15 A;  4GNX B;  4JI6 Q;  4IPC A;  3GTJ H;  3KF6 A;  4BY1 G;  2UXB L;  5C4X H;  3OTO Q;  4JI0 Q;  3M4P A;  1R9T H;  4DR7 Q;  2YTY A;  3M4Q A;  2KHJ A;  2UUB Q;  1L1O C;  2VW9 A;  5FJ8 G;  4QL5 A;  4WJ4 A;  1WYD A;  2MO0 A;  3CAM A;  1CSQ A;  1WCM G;  3E9I A;  3KF8 B;  1CKN A;  5IP7 H;  3PGZ A;  5H1S E;  4DV5 Q;  4GOP C;  1X3E A;  5IYB H;  3RN5 A;  5LMU L;  3J7Z C;  1BBW A;  2NVY H;  2F52 A;  2E5L L;  4LF4 Q;  3KDF A;  2CCZ A;  4JBM A;  3KFU A;  3JAM c;  4A3M G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...