5C4XG

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4xG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c4xG01
3HOZG 3EN2A 2WB1E 3S1RH 2UU9Q 2D0PA 5IP9H 4AQYQ 3S15H 2YTVA 1EIYB 1Q7YC 1VQJA 4A3DG 1SLJA 3B6YA 1PH6A 4DR7L 3K0XA 4B3SQ 3F2DA 1FL0A 4A75A 3K7UC 5AJ3L 3VDYA 1N32Q 1MJEA 1A0IA 2K14A 2K75A 2Q2UA 3K80C 3HOUH 2ZM6L 1PH5A 4JBWA 4LF5Q 1XMQQ 3J81c 3I56A 3RZDH 4JI6Q 1NMFA 4JI3L 4DUYQ 5IYBH 1QUQB 3TS2A 1GD7A 4A3CH 1E1OA 4Y7NH 2XGTA 2A1AA 4A3MG 4LFBQ 5C0XG 4A3BH 2UXBQ 1H95A 1AE3A 2R7ZG 1CUKA 4JCVE 4L5QA 1VQ4A 1VCIA 1X3FA 1G51A 3D0FA 4X66Q 2E2HH 2NZOA 1BKBA 4B3MQ 5M3MH 4JYAQ 3TEHB 4HJ5A 4GKKL 1TWAH 5M5XH 3HOXH 3M4OH 4A3FG 3I4OA 1YHAA 1KIXA 4JBKA 5C3EH 2N78A 4DR2Q 2NVTH 3W1GA 3H3VH 1TWFH 1HZAA 2MQHA 1YVCA 3NBHB 1VQOA 5GAHC 4GOPA 2D62A 1YIJA 1HR0L 4RMFA 3ICEA 4HJ8A 2ES2A 2I0QA 2ZJPA 3PUXA 5LMNQ 1Y1WH 2OTJA 1L1OB 5IP7H 5FLMH 1QZGA 4LFAQ 4R4IA 3PIPA 3PGZA 4R4QA 4JI5Q 3H3VI 2PQAB 2K5HA 4BBRH 1PV4A 3ER0A 3S16H 3IRBA 1OXUA 3PUYA 1T9HA 2WAQG 3Q8DA 4GLAC 4B3TL 2JA8G 3CMAA 1K0RA 4POFA 2LXJA 2D0OA 3GTGH 4OO1I 3CQZH 3FKIH 4A3EH 1I3QH 4DR3Q 1X56A 2OTLA 2WFWA 4DR4L 1OXXK 5LMUL 3U4VA 4JI4Q 2WP8J 4YCUA 5C0XJ 4LF8Q 1FJGQ 1VQNA 1Q46A 4GKJQ 2NN6G 5JJIA 3F8TA 1O7IA 2IHEA 1MKHA 1GKHA 4YY3L 3CCLA 1PH7A 2AKWB 5JEAJ 4DV6L 4JBMA 2VS1A 2L15A 3HKZE 4A3JG 2VQEQ 5M5YH 1KAWA 4DR6Q 2YU9H 1K3RA 1PYSB 3KYHC 4KLKA 4BXXG 1X6OA 3KF8B 4P71A 1IZ6A 2VW9A 1N34L 3TREA 4DV6Q 2RHSB 3KJPA 4GN3B 4WJ3M 4C3HH 1PA6A 3DM3A 5GAEC 4PZ8A 3CC7A 1QZHA 3CD6A 3LGJA 2ZTDA 1PH8A 5ELNA 3T1HL 4LW1A 4IPGA 4KI0A 3GTLH 1W3SA 2UXCL 3AYHB 1HJPA 1I50H 3A74A 2QEXA 3PF4A 4PMWA 2UXBL 3FKIG 1UWVA 1IBML 4HIDA 1KRSA 1AE2A 3D31A 1B8AA 3L2PA 4DV7Q 4GLXA 4DV2L 4GNXC 3GTJH 4HIMA 3M85A 1CKOA 3TS0A 4X6AH 3BZKA 1C9OA 4OX9Q 3EIVA 4MNOA 1UEBA 2IY5B 1UE5A 3ULLA 2MNAA 4JI1L 5IE8A 4TVAB 2FXQA 2HHHL 4A3LH 1GVPA 3NENA 1C0AA 2PI2A 3G71A 2K5VA 1DGSA 5JJKA 3M3YH 4GNXA 1NY4A 1ASYA 4YCWA 4JI0Q 3S2HH 5IYDG 1XMOQ 4B3SL 1S72A 1I6HH 2HIVA 4IPCA 2NVQH 2CWAA 1VQMA 1G6PA 1VQBA 5IT9c 3ERSX 4DR1L 3H0GH 3JAMc 4DKAC 1GO3E 4LFAL 4X62L 2VL6A 1N34Q 5BR8Q 2PNHA 3CCSA 2BA0A 1E1TA 4OX9L 3CC4A 2B29A 5M3MG 2N3SA 3J80c 1IBLQ 4OWTB 1HNZQ 3GTOH 5C4JH 2HT1A 4P75A 3K81C 4DNIA 1E7ZA 3CCRA 3W1BA 1IYJB 3GD7A 3M4QA 5C4XH 1VQ9A 2JA6G 4IFDJ 1PHJA 1X3EA 3CC2A 3CCQA 3KF6A 1BBUA 1A8VA 4X65Q 5FLXc 4JBJA 3RNUA 3PO2G 4YHHL 4LUVA 5IYBG 2CWPA 3E0EA 4DV3L 4JYAL 3T1YQ 2RHQB 3PUWA 2AWNA 2IT1A 1UE6A 2V1CC 2KENA 4JI2Q 2ATWA 4DR4Q 4BBRG 4GOPB 1XPUA 1Q12A 4IPHA 4JC0A 3RLFA 3CPFA 3GDEA 5FLMG 3J7A5 3CPWA 4HJAA 3NELA 5HGQA 4DV1L 1W2BA 1TWCH 4J15A 4C3JH 5IP9G 4DV0Q 4JI3Q 3UDFA 2UXCQ 4AIMA 2K4KA 3CXCA 3G4SA 1M90C 1G291 2VQEL 4JI8L 1TWHH 2PMZE 1E22A 2Q2IA 2AMCB 5C3EG 4NXNQ 1EYGA 4LFBL 4KHPQ 4BY1G 4POGA 4A3FH 1NBWA 1V1QA 5M5WH 1YZ6A 1MJCA 2KCMA 4R4CA 4YCVA 1VQ5A 4QQBX 1PH3A 3AQQA 2PQAA 4DPGA 1I5FA 5M3FH 4XIGS 3W5OA 1YNXA 4DV5Q 2NVXH 2NVYH 2VY3A 1I94Q 5FJ8G 1X3GA 2IX1A 4GKKQ 3TQYA 2EIFA 2RCNA 4H02A 4DR5Q 2CFMA 3ULPA 4UY8C 4PG3A 1YJWA 4JI8Q 2ASBA 4A3CG 2WB1G 1VQ8A 4LF7L 2YTYA 1A62A 5E7NA 1EQRA 2UU9L 1JMCA 4FDBA 3KDFA 1VQCA 1E24A 3EBEA 3A5UA 4DUYL 2YYZA 3BU2A 2VUMG 3U50C 3GTKH 1PYBA 1Y1VH 3J81i 3OYYA 1RIPA 3RN2A 1SR3A 2E2JH 4LUOA 2AWOA 2KHJA 1XMQL 1QVCA 1PH9A 4JI2L 4LF5L 1YITA 2JEAI 1PH1A 1N33Q 4WJ4A 2RF4A 3UDXA 3E9IA 4DR7Q 2ZJQA 5GROA 3J80i 4YWKA 1VQHA 3S17H 2UUBL 1QUQA 1XMOL 3FP9A 3S1MH 3E9HA 1B7YB 5M3FG 2CCZA 4OONA 4LFCQ 1Q1EA 2JQOA 1SE8A 1Y14B 4RG1A 1SN8A 1CKNB 3CCJA 1XNRQ 2XTIA 4A93G 4DK6C 1YJNA 4IJHA 1WCMH 1Q82C 1VS0A 4LUZA 1HNWQ 1VQ6A 4QY7A 4JG2A 5IYCH 1QVGA 1HZ9A 2K5NA 4AYBG 3KJOA 3CCMA 4O0AA 4IFDI 2Y0SG 3OTOQ 2ZM6Q 2OCEA 1YBYA 4IOCA 4DR5L 4A3IG 1SMXA 2QA4A 3PUZA 1VQ7A 4LF6L 1KL9A 3UDGA 3PV0A 3BJUA 2VUMH 1N32L 1HH2P 2Z6KC 4YHHQ 1K8GA 4A3GG 4X65L 3CMEA 2E8GA 1V9PA 1BVSA 2ALYB 3T1HQ 4L5RC 4OWWB 1L1OA 3I4NH 4P72A 1M1KC 3S14H 4YWMA 3RR5A 4JOIA 4BY7H 3RLOA 4O2DA 2JA5H 4KHPL 2BH8A 2JA6H 4JI6L 4NXNL 5HY6A 2VQFL 1WJJA 4QGUA 5FJ8H 5GAGC 5K36G 4IO9A 4YWLA 2A8VA 4BA1I 3OW2A 1CKNA 1D8LA 2UUAL 4IPDA 1I94L 3I2ZA 2OQKA 1CSQA 3HOVG 4L5SA 4JV5L 1LYLA 4EX5A 3H0GG 3BZCA 4TQUS 4AQYL 1EWIA 4YY3Q 4BY1H 3DLLA 2F52A 3STBD 1PVOA 4ALPA 5GADC 4DAMA 3S24A 3CP0A 2UUCQ 5H1SE 1YJ9A 5IYDH 1HNZL 4DK3C 3F2BA 4DV3Q 3S2DH 3AFPA 2C35B 1XNQL 2BA1A 4BA2I 2JA7H 2UXDQ 4UP7A 2NN6I 1B70B 2E5LQ 2R6GA 2WAQE 2NZHA 4LFCL 3SGIA 2B63H 4DV1Q 3AEVA 4AH6A 3J7ZC 4DUZL 2BH2A 1L2FA 1RL2A 4JI5L 4R4OA 1HR0W 1XPOA 1IBLL 4B3RQ 1VQEA 2ZTEA 4OXPA 1WYDA 1P8LA 5JEAG 4PZ7A 3PO2H 1QVFA 2R93H 2OWOA 4X62Q 4LF8L 1FJGL 4P74A 2LSSA 5C4XG 4C2MH 1WI5A 3AFQA 1HZCA 1VQFA 3UE0A 1OXVA 1V43A 3TRZA 4DV7L 3CCEA 4QL5A 4DUZQ 5EAYA 1VQGA 2QGQA 1E3PA 2E2IH 1VQKA 4JI1Q 4QJFA 1HNXQ 3I4MG 4KHZA 4UPAA 4P73A 5LMNL 4C3IH 1K8AC 1JB7A 1D7QA 1EIFA 1VQLA 4K0KQ 1IBKQ 2IHFA 1EOVA 1VQIA 5ELOA 3RLNA 3U4ZA 4A3JH 3CCVA 2DGYA 3G6EA 1IL2A 3CAMA 3F2CA 4A3LG 1VQPA 1C7YA 3KDFB 4A3KG 2N49A 2KHIA 5C0XI 1CKMA 2F3IA 2AHOB 1KD1C 4JI4L 4K0KL 1JJCB 1X54A 2JK8A 2EXDA 3K7AH 4GN5A 5IWAL 4EQ5A 4B3ML 1WFQA 1PH2A 4LF6Q 4LF9Q 1KQSA 2Y0SE 3PF5A 5JJLA 1HNXL 4HIKA 3PO3G 3PCOB 3HOWH 3ULJA 1AH9A 2JA9A 2VQFQ 1CSPA 3HOWG 4NPSA 2VZAA 4DV2Q 3KF6B 3M7NA 3M9BA 3PO3H 1IBKL 1N8RC 3S1QH 2MFIA 3MXNB 1J5EQ 2JA8H 1NTGA 2CKZB 4OWXB 1Z9FA 3A0JA 4A76A 3HKZG 4GKJL 4QIWE 1NMGA 4IJLA 4DAYB 3KFUA 4HJ9A 4A3KH 3GTQH 5IP7G 2JA7G 1EQQA 1VQAA 3ZJYC 1X65A 2GVBA 1OTCA 1XTDA 4MTNA 4GS3A 3HOYH 1K83H 1JJ2A 3K8AA 1ASZA 3FHWA 4LF4Q 4B3TQ 1KC8C 3UE1A 4JV5Q 3UDIA 3L0OA 4BXXH 1IXRA 2F4VQ 1SROA 2I5MX 1N36L 3G48A 3CF5A 4JI7L 3I4MH 1X9NA 1J6QA 1JE5A 4GN4B 5LMUQ 2E5LL 2IX0A 4X66L 4NXMQ 3JC66 2Z6KA 5DLQE 4LWCA 1BBWA 2K50A 5BR8L 5GQOA 4B3RL 1JJGA 2EQSA 4DR6L 2F4VL 1IBMQ 1TXYA 4LF4L 4A3MH 1S3OA 2UUBQ 3RZOH 4BY7G 4A4IA 5IWAQ 3M4PA 2R93G 1HR0Q 5IY0A 4A3EG 3RN5A 1YI2A 2K52A 2GVAA 1PH4A 4DV4L 4DR3L 4A3GH 2GN5A 1KHIA 2MO0A 3H15A 4R4TA 3PUVA 4A3IH 1U0LA 2H5XA 1J5EL 1YHBA 2B63G 1FVIA 1Y1WG 4UP9A 2HQLA 1SRUA 5J3BA 4A3DH 1LM0A 1N9WA 2YTXA 4L5TA 4UP8A 1TWGH 1Q81C 1A63A 1Q8KA 1KRTA 3STBC 3HOZH 2PI2E 1K9MC 4PZ6A 4A93H 2A19A 1X55A 2N8NA 1JT8A 2ZJRA 4HIOA 2I5HA 2Q2TA 3OTOL 3HOXG 2UUCL 3HOVH 1U5KA 4DR2L 3U58A 1VQDA 4DV5L 2R92G 2Z0SA 3HFZB 3L7ZC 2I5LX 4MZ9A 1L0WA 2HIXA 2ZTCA 1PFSA 1N33L 1P16A 2UUAQ 2R7ZH 4GOPC 4A3BG 3F1ZA 3T1YL 3NEMA 5AJ3Q 5C44G 2JA5G 1SFOH 2VNUD 4HJ7A 3I7FA 2KCTA 1LUZA 5LMNW 2Q2HA 3I4NG 1UE1A 1Y1VG 4GLVB 1HNWL 3S1NH 4X64Q 1FGUA 2ID0A 4AYBE 4LF7Q 1R9TH 2OQ0A 1NJIC 1XNQQ 1YEZA 4OO1G 2UXDL 3PIOA 2JJQA 3I55A 1S40A 2JEBI 3MEFA 3KOJA 3HOUG 2JE6I 3A5ZB 1XJVA 4ME3A 1K73C 3CW2C 4DV4Q 4IOAA 1YHQA 5IYCG 4Y52H 2R7DA 4DR1Q 5C44H 1HZBA 1Q1BA 1OXSC 3HKSA 4NB3A 1N36Q 4JI7Q 1WCMG 1Z47A 4JOIC 1EFWA 1MIUA 1EUJA 3WWVA 3HOYG 3KLWA 2MO1A 2KBNA 1KXLA 1WOCA 2CQOA 2DUDA 1L1OC 3JAMi 4X64L 3GO5A 1UE7A 2B3GA 1Q86C 1NE3A 4R1JA 4JI0L 4BBSH 2R92H 4LNQA 4IFDG 2YV5A 3J81j 1OXTA 2R7FA 3GTPH 2HHHQ 1LTLA 1XNRL 4BBSG 2LXKA 3PSIA 1XPRA 3GTMH 3CCUA 4XTCS 4DV0L 4GNXB 4LF9L 4NXML 1GM5A 4APVA
chains in the Genus database with same CATH superfamily
4FXDA 3HOZG 3N40P 2MJ8A 4J8QA 4H44C 1PXUA 5ELFA 1EIYB 1Q7YC 1VQJA 3CKIB 1SLJA 3RF2A 1HTPA 3F2DA 1K0SA 1N32Q 1A0IA 1D1IA 1SYBA 2K14A 2Q2UA 1DJRD 5D1OB 5JAVA 3HKZA 3J81c 2QF7A 3S14B 5KEEA 3JSNA 2XNAC 2Q8IB 1NMFA 4IURA 2UUBH 3GLKA 3H94A 4C5CA 4Y7NH 2XGTA 1HR0H 5EPKA 5C0XG 5E4WC 2ASJA 1BCPD 3BYTB 1CUKA 4JCVE 3JRXA 3TP5A 1MGSA 4X66Q 4J6HA 5LMUH 1S9FA 2H4OA 4B3MQ 5M3MH 2YS6A 4QWBA 4GKKL 3N52A 2XVSA 5M5XH 5KNCA 1WTVA 2B2TA 4ED3A 2R7KA 4A3FG 1TWAB 1WD0A 4JBKA 1GGOA 5FKAC 3Q8SB 2XWBB 4DR2Q 4I65A 2V59A 4X66H 3H6MA 1J8IA 4C3JG 4GC6A 4B3RH 4RMFA 3D4DA 2ES2A 3GTPA 2OTJA 3N44B 1AZQA 2I46A 3I4LA 4JI5Q 3RGXA 2K5HA 2X6LA 2W9AA 3IRBA 2ZDHA 2LS01 4RGMA 2PZUA 2B63A 2LXJA 1T5XD 2HQEA 4HNVA 3QZ7A 3CQZH 4A3EH 1SYGA 1ZYRC 1E4FT 1QILA 2K7VA 5KNDA 4DR4L 5L9XA 4CDCC 4ZUJA 2A73B 2WP8J 3H09A 4MA5A 5C0XJ 4F50A 4LF8Q 1SAPA 2NN6G 5JJIA 1O7IA 3P20A 3PIP3 4YY3L 4LH7A 5A2QE 3S1RB 3T5KA 2AKWB 2CW0D 3QIAA 3QWNA 1ONLA 4TV9F 4A3JG 1H9SB 1WR2A 1KAWA 1A6XA 4NLGA 4QB4A 5CA0F 4DL7A 1K3RA 2F0NA 2Z4HA 4KLKA 3VR4A 3SK4A 4BXXG 1X6OA 3KF8B 4FVMA 1IZ6A 2Q8TA 1N34L 4C3IG 4F4WA 4RB2C 4WJ3M 3MZ5A 1PA6A 1JIHA 1V8QA 3Q23A 5DG9A 5KYLA 3LGJA 4EEQA 1ILPA 2ZTDA 5ELNA 3T1HL 4O3PA 4IPGA 4YIJA 4X3KA 4G7ZC 3IFTA 4GZYC 1I50H 5J2TF 3A74A 1K1SA 1SJHD 4JV1A 4A3DB 3D4WA 4DV7Q 4GLXA 4DV2L 1EFID 2YRWA 3M85A 2R6FA 4LF4H 5ISRA 3MWEA 1I6UA 1C9OA 4OX9Q 1SEIA 2IY5B 1NCVA 1UE5A 2KQ3A 2VB2X 5JVG3 4TVAB 4IR1A 1I4GA 2F0VA 2Z1CA 3G71A 1IOWA 2K5VA 5JJKA 4APMA 1ASYA 1NY4A 3S2HH 3SDZA 4B3SL 4RZRA 4IPCA 4R8NA 2UVWA 3QB3A 4KY6A 3ERSX 1CHPD 2VL6A 2PNHA 2BA0A 4OX9L 1ENAA 2B29A 4B3TH 3HOUB 4OWTB 2PN1A 2HT1A 1EY4A 4P2CB 3K81C 4DNIA 5C1OA 4XYQA 3M4QA 1X3EA 3CCQA 5FLXE 3A7AB 1BBUA 4DGZA 4DV3L 5IYBG 2F0MA 5CORA 5EBDA 4A3GB 1G91A 3T1YQ 3KHHA 3G7LA 3PUWA 2AWNA 2IT1A 3DMUA 3Q2OA 4DV1H 4FF1A 3GV3A 4Q0FA 2RA4A 2Z6BA 2YZNA 4NXNH 2J9GA 3DUZA 4KHPH 3GDEA 5FLMG 2R86A 1ZQ7A 5L1IA 2M05A 3H4DA 3PVXA 3N43B 2F0UA 3NELA 5T1IA 5T14A 5HGQA 4DV1L 4DV0Q 4C3JH 5IP9G 2K4KA 3CXCA 4JI8L 5CR3A 3SEBA 2DN8A 2V58A 4NXNQ 1EYGA 4LFBL 4KHPQ 2M2LA 4QUCA 4POGA 1NBWA 4DNRB 1TWHB 2KCMA 1MJCA 4YCVA 4XIGS 1YNXA 4HAEA 2RDJA 1KTKA 2NVYH 4BY1B 5FJ8G 2EJGC 3DM1A 3OPOA 4QF4A 4IZ8A 3J7AV 3ULPA 4PG3A 1AUXA 1YJWA 4JI8Q 2HJWA 3MWMA 1PFBA 4WJWA 3EPGA 3NBHA 1O7YA 1YNNC 2YTYA 1A62A 5E7NA 1EQRA 1KJIA 1WTHA 3PIO3 3LWBA 1KLUD 3V6JA 3EBEA 3LP8A 1SSOA 4RNMA 4IRCA 5C4XB 3U50C 4O2BF 1RIPA 4JI8H 1S5BD 2E2JH 2AWOA 4YQWA 3MTSA 4TRDA 4LF5L 5CV6A 1PH1A 3UDXA 4O3NA 3E9IA 4EQNA 5KG1A 5IGFA 4CDDC 4ED6A 5DEHA 3E9HA 2IWHA 2FMCA 3QR8A 2R7ZB 3NSWA 4RG1A 4JI7H 1SXTA 1IKLA 1GUWA 1K3BC 4N8X1 1A3UA 2TMPA 2XTIA 1LTAD 4A93G 1MHWC 5C8YF 2E2IB 1GHKA 1LTID 1WTPA 1Q82C 5KFRA 1SNDA 4UHVA 1VQ6A 3HG9A 1QVGA 3RFCA 1SMYD 4AYBG 1N34H 3RD4A 2OCEA 4A3IG 4LF9L 1NR4A 1ESRA 2EYPA 1N32L 2AQ1B 1K8GA 1F2YA 1KLGD 2E2JB 3I4NH 5EOYA 3HEJA 2R93A 3JSLA 3NK9A 3RUPA 5HY6A 4FO2A 1WJJA 4QGUA 3U9OA 5G3LD 2XCAA 4ULLA 4YWLA 1HFGA 4O2AF 3AMUA 2B2YA 2RCFA 1IYVA 1I94L 2A74C 1BQQT 1PTOH 3VYTA 2SNMA 3E5SA 3H40A 2YYAA 4EGJA 1Z2NX 2ZXPA 4LFAH 1PVOA 2B8GA 4DAMA 1UC9A 5H1SE 4L8JA 3BABA 4K14A 2ASDA 4QW8A 4DK3C 2PCFB 3HRZC 4IUQA 4GC7A 3GIDA 1JCKB 2BA1A 4IUUA 2GA4B 4DLKA 1BNCA 3AEVA 3J7ZC 3HZXA 4DUZL 1K28A 1L2FA 3FKIB 1RL2A 4GKKH 1XPOA 2M9VA 5G3LF 3K7AB 2EYMA 1P8LA 5JEAG 1TVXA 2OWOA 1TIID 4X62Q 4LF8L 4P74A 3OW7A 1Q3LA 2IJ0A 5C3XA 2SOBA 1VBGA 3F2UA 3AFQA 2RGVA 1VQFA 3UE0A 5DLFA 4MTDA 5DGBA 1V43A 1OWTA 4MTKA 4IRKA 4K8IA 5EAYA 1VQGA 1O7LA 2N55A 4EQPA 2E2IH 1D5MC 1PK8A 2ZJTA 3BAAA 3ORRA 4JI1Q 1JWMD 3I4MG 3PW7A 4GKJH 4OIKA 1JB7A 1AEXA 4F4XA 5KFLA 1O80A 4KK7A 4K5VA 3BZDB 3I8ZA 2IHFA 3U4ZA 3RLNA 2ALZA 2J6UA 1I6VC 3F2CA 2CQYA 3V96A 1PZJD 1KD1C 2AHOB 4B3ML 1WFQA 2Z4IA 3I72A 3GIQA 4K2LA 3PF5A 1HA5A 5KG0A 1M6VA 4J9OA 3DWAA 1D5XC 2DJFC 1CSPA 3VR6A 1M4VA 3JAML 4DR1H 1BCPF 1S03G 3BYYB 3S1QH 2MFIA 2JA8H 2CZGA 3R5XA 1NTGA 3GIKA 4JVZA 4IUTA 3HKZG 4GKJL 4IJLA 2MHVA 4IRDA 4HJ9A 3GTQH 5IP7G 3R93A 1EQQA 2PPBC 1OTCA 3ONAB 2K5DA 4DF7A 5FOBB 1K83H 3FHWA 1KC8C 3UE1A 1CHQD 1HCZA 1LABA 1LACA 3L0OA 3J7AF 2YL2A 5KFVA 3NGDA 3V4SA 1STGA 1SROA 1X9NA 1BCPC 1U4RA 4G7OC 4S3SA 5DLQE 2JA5B 1XWEA 1JJGA 4E4TA 4CHTB 2F4VL 5J2UF 4HN7A 3K59A 2UUCH 2F0WA 2XN9C 2UUBQ 3VPBA 4A4IA 5KFMA 4BBRB 3S16B 3M4PA 1HR0Q 5IY0A 3DXJC 5D14A 1D5ZC 1YI2A 2K52A 2BQ3A 3VR3A 1EY9A 3T56B 4DV4L 5EWFA 5BPHA 5A2QL 1ZHSA 2AUKA 4KHVA 3PUVA 1J5EL 4A2BA 5LHY1 2RDGA 5C3EB 1TA8A 4ECXA 1PFNA 1SRUA 4YAKB 3K5OA 4DL4A 4DR2H 1TWCB 5CGKA 1K9MC 1I94H 4A93H 2N8NA 2ZJRA 4ME6A 2I5HA 4ZAIA 2Q2TA 3U58A 1VQDA 3U9TA 2CH4A 4IFDH 3T53B 3KAKA 1FYCA 2L5TA 2J6TA 2C9OA 4O4IF 5K36H 1P16A 4MTEA 4GOPC 4A3BG 3E0JA 3TQTA 3Q6SA 4O4HF 1GYFA 4CBVA 4NMZA 4HJ7A 1LUZA 1M7JA 1Y1VG 3QJYA 2AQ2B 4AYBE 3EJIA 3W3AA 1ENCA 1AUVA 2NWGA 3A5ZB 2W8LA 4ECQA 1JKJB 1XJVA 2O5JC 4DUZH 4IOAA 1JICA 4I7ZC 1G2SA 1BXRA 4Y52H 5KFKA 5C44H 2A68D 1I6HB 1FKAH 3PW5A 4NB3A 1E0BA 3P75A 1Z47A 2KA7A 3VYUA 5EQ0A 4A3EB 4C3HB 2ICEC 1BR9A 3GV8B 4HCEA 5KFZA 3NXWA 4JI0L 1Q86C 2XIWA 1S0OA 2ENBA 2HHHQ 1KAAA 3NWTA 4FXKC 5JH7F 1S5CD 3CCUA 1TS4A 2F0OA 1L2ZA 1XYIA 1DIKA 3R8BA 1JOOA 5KG5A 1NUCA 4NXML 4APVA 3HOYH 1HUMA 2K6AA 1M0TA 4KKSA 4XYOA 4WBNF 4AQYQ 3S15H 4A3DG 3LWUA 4CDFC 3N8DA 3B6YA 3Q0AA 3K0XA 1I4PA 1FL0A 1ZEQX 2BQUA 3M4OB 1GUOA 2K75A 1CK1A 3K80C 1ET9A 2ZM6L 1PH5A 4LF5Q 3IN5A 2CH4W 2UXBH 2R7ZA 1G8ZD 5KT3A 2JP1A 5IYBH 3PZPA 3N42B 1QUQB 3G6VA 1GD7A 4A3CH 1JX4A 5IWAH 2ZM6H 3L3OC 3RB4A 5FPRA 5FO7B 4LFBQ 5I9PA 1QOHA 1KJJA 3NBIA 2UXBQ 3Q24A 1X3FA 1G51A 3NTKA 1SYEA 3OUZA 2PZTA 2OEOA 3N6XA 4EQOA 4HJ5A 2F3WA 3OUUA 2IW3A 2W70A 1IW7C 3K57A 2KECA 3I4OA 5KFFA 1YHAA 2E5LH 1C48A 2N78A 2K33A 2V4DA 5IT9W 1HZAA 2WAQA 3NBHB 4GOPA 2D62A 1Y1WH 1L1OB 4ZK9B 5IP7H 1QZGA 1S0MA 3BVZA 4CJ2C 3PGZA 1HQMC 3PIPA 2WE6A 4G3IA 4RU9A 4BBRH 3S16H 3K3VA 3PW0A 3K0YA 1PTOD 1QWYA 4B3TL 4DV3H 3CMAA 1K0RA 4OO1I 1AZPA 3P1HA 1X56A 2WFWA 2X6GA 1E4EB 1OXXK 3U4VA 4JI4Q 4WORA 2V4QA 5DM73 1QG7A 4I50F 3M9OB 2B2VA 4FP5D 1UUPA 4CKCA 3H4BA 4DV6L 4JBMA 4I7HA 4CJ0B 2L15A 3HKZE 4JK1C 5M5YH 4DR6Q 1TS3A 2YU9H 3C46A 1PYSB 1SFOA 5BN5A 1EYDA 3KYHC 1S5DD 4ZI7F 5A2QW 4O1NA 1I7LA 3JRWA 2ATLA 2HVSA 4R9WA 4DV6Q 2RHSB 2X69A 4LF9H 2SNSA 3IG0A 2BQRA 1NR2A 1PH8A 4LW1A 4Q43A 3NPPA 5L1KA 1BCPB 5KT6A 4NW2A 1E2WA 2NN6H 3K5IA 2QKIC 2K32A 5J39A 3GTLH 4HSVA 5IIFA 5FO8B 2R8KA 2VQDA 1HJPA 1K8MA 3FKIG 1EIHA 3D31A 1B8AA 1S4ZA 4B08A 1WCMA 3OTOH 3TDQA 2CW8A 3HB9A 1F9SA 2B2TC 1CKOA 2C5CA 3PQIA 2J0TD 2KHSA 1PLFA 4MNOA 1UEBA 2EZVA 2MNAA 5IGDA 3J80W 2XGQA 2F4VH 2FXQA 4BBSB 4A3LH 1GVPA 3NENA 2PW5A 3MAQA 1R9TB 3CQZA 2FE3A 3PMFA 1GSHA 3M3YH 4C3HG 1EEFD 4O42A 4YCWA 4GNXA 3L4KA 1IBLH 4U7CA 2F0SA 1I6HH 4XYLB 2NVQH 1I4HA 2NTSA 4ECVA 5I6WA 1IL8A 3KK7A 4TKOB 3H0GH 4C2MA 4QW9A 3GIIA 1N34Q 4KN4C 1SBBB 1LLRD 4LK1C 1SE4A 3CCSA 4B3SH 3CRLC 1IBLQ 3K58A 1CZGA 3GTOH 4I7AA 3OSPA 1E7ZA 2F0FA 3DEPA 2RDHA 4ECTA 2B39A 3GD7A 5C4XH 3MR6A 2TSSA 3CC2A 5I2XA 1A8VA 5FLXc 4JBJA 3RNUA 1WTWA 1GUNA 2XD4A 2EPBA 2RSOA 4DR4Q 4GOPB 1KC7A 1LTRD 2LKVA 4JC0A 2XSCA 3RLFA 2R8JA 2R7LA 2W57A 2NU9B 1B50A 1W2BA 1TWCH 4YR0A 3UDFA 2UXCQ 4AIMA 5DNFA 3G4SA 1Q8IA 1M90C 4DV5H 2B8FA 3AU7A 4DFAA 2G9DA 1WTOA 4QWEA 2WKDA 5I4DA 4BY1G 4A3KB 2W6ZA 3DHQA 1YZ6A 3R5HA 1PRTD 4DK0A 4EVOA 2WB1A 2VQEH 5D3IB 1KDCA 2B63B 2I07B 4LMQD 4DV5Q 3ND9A 5KGUA 1HNXH 1X3GA 4GKKQ 2EIFA 3OWEB 1CTMA 3I4MB 4DR5Q 2CFMA 2VPQA 1IBKH 2CVRA 1T94A 2ASBA 1A2TA 3SVMA 5KG4A 1PRTB 3GTQA 2UVUA 1BBXC 3CVZA 1RHPA 3MXGA 3LWEA 5FPOA 1MD2D 3TSSA 4FF4A 4RWSC 4IN3A 3A5UA 4F4ZA 2XIGA 3BU2A 1Y1VH 3OYYA 1Y8OB 4H7BA 1SR3A 1H9MA 2KHJA 1PH9A 4WJ4A 1PRTF 1SMYC 1UNNC 4MV9A 2J6SA 4RGTA 5GROA 1XNRH 4IUVA 3T4AC 1X3PA 1QUQA 3FP9A 4DN4M 4OONA 3CHBD 2JA7A 3HKZB 3T51B 3C2PA 1U4MA 1CKNB 1XNRQ 1Y8NB 3GTKA 4QWDA 2AGOA 5KFAA 5M5XB 4Q8FA 3N41B 3TBIB 5CV7A 1VS0A 3R23A 1HNWQ 4QY7A 5IYCH 1HZ9A 2EYLA 2K5NA 3FDTA 4O0AA 4IFDI 4N8FA 2NZ1D 1LT3D 1F77A 2VUMH 3PUZA 4LF6L 1KL9A 3UDGA 3BJUA 1HNZH 4YHHQ 4A3GG 4X65L 1IBMH 2UVRA 1V9PA 3T1HQ 4L5RC 2F0EA 2NVXA 1L1OA 1EZ1A 3J7AK 4AYBA 1M1KC 4QCLA 2QK4A 3RBEA 1N32H 4YWMA 3RR5A 4EG0A 4JOIA 4QUFA 4O2DA 1XMOH 2BH8A 4JI6L 1I4XA 2F03A 4RB3C 2VQFL 1Z6HA 5FJ8H 4RNOA 4DL2A 4BA1I 1QB5D 2F0GA 4PQXA 3BDOA 3Q8PB 2DPIA 1CKNA 5KT4A 3I2ZA 2OQKA 4KKTA 1STEA 3HS0C 3J81W 1D6EC 4EX5A 2E2HA 3BZCA 4TQUS 4YY3Q 2WAQB 3DLLA 1B2TA 3STBD 4ALPA 5GADC 4RFBA 1B9NA 3CP0A 2UUCQ 1C30A 1UAPA 1RD9D 1IW7D 1HNZL 5DQGA 3S2DH 2DWCA 1GXDC 3D6CA 2JA7H 1RK6A 3BA8A 3KLRA 2NN6I 1B70B 5M3FB 3VPCA 5A35A 1IOVA 1EYCA 2A6HC 2PYKA 1FJGH 5I2YA 2BH2A 3RIZA 3CQZB 5C4HA 4JI5L 4R4OA 1HR0W 4LSAA 5KG6A 1MI2A 4B3RQ 4LJZC 2FJZA 1VQEA 1STNA 2ZTEA 4OXPA 5CYUA 5CC4A 2W71A 3DF7A 4OHJA 3KHGA 3K5NA 1C3OA 4J9LA 2BE5D 1QVFA 2R93H 3ND8A 1KNAA 1YNJC 1FJGL 4O3RA 2NBFA 4JI5H 3CRKC 1BJTA 3A55A 3WO1A 2O4XA 2RDIA 4YR3A 1OXVA 4MIUA 3MFIA 3WOEA 4ABNA 2QYZA 2W9BA 3CCEA 2QGQA 3JAME 1WTXA 2AQ4A 4XZ3B 1Z2OX 3D3RA 4QJFA 4KHZA 2F0TA 1EIFA 4A3JB 1PMRA 2X0SA 4PDBA 1VQIA 3I4NB 4LFCH 1CT1D 5C6AA 1LTBD 4MN3A 4RAZA 3CCVA 5F2DA 3G6EA 1IL2A 4A3LG 2PVPA 4ED8A 4IWYA 3RAXA 2MUYA 3KALA 3T5JA 5C0XI 2GPWA 3FVQA 2F3IA 5M5WB 4K0KL 5LOVF 4EQ5A 4LF6Q 4AYBB 5JJLA 3S1MB 1HNXL 4HIKA 3HOWH 3ULJA 4TUYF 4J1MA 2VQFQ 3HOWG 5EKIA 2VZAA 2NB0A 2KJXA 3M7NA 2PBZA 5CAEB 1IBKL 1N8RC 4HQ6A 5KFTA 3MXNB 1F9QA 4OWXB 1BGWA 2FP4B 3A0JA 1BF4A 1HQRD 1NMGA 4DAYB 5DLGA 1VQAA 3ZJYC 1V1OA 4ID6A 2A6ED 4MTNA 1ASZA 3V2TA 4CJ1B 3IAYA 4C2MB 4LF4Q 4U673 2DNCA 5IGBA 3UDIA 2DY8A 4BS9A 5H80A 2KEEA 2WTFA 1ZXTA 1LTSD 2I5MX 3G48A 5LMUQ 4GN4B 2IX0A 3TN2A 4B3MH 3JC66 4HSPA 1XDNA 4UAIA 4LWCA 2K50A 5KFIA 4ECZA 2OT2A 5GQOA 2EQSA 4DR6L 1SNPA 1R9TA 1SNQA 2HVQA 2R85A 3E3XA 5E1FA 4LF4L 2C22A 5IT9E 4BY7G 5IWAQ 1EUCB 2R93G 5KFOA 1ESFA 1AP0A 1RTNA 5KT7A 3PR4A 1DYQA 2GVAA 1MSGA 4RGNA 2W6PA 4DXFA 4FYDA 2GN5A 1TWFB 4R4TA 3H15A 3H20A 1T3NA 2B63G 1YHBA 1FVIA 4UP9A 2HQLA 1WTRA 1I4RA 5J3BA 5D1OA 5CBAE 3C1FA 1Q8KA 1KRTA 4YB8B 3GQCA 4EYHB 3GTLA 2PI2E 4RHSA 1EOTA 3GQBA 3EPIA 1JT8A 1GLVA 3NTHA 4RKLA 4O3QA 3OTOL 2JA5A 2FMAA 1U5KA 3C1EA 2KVMA 4DV5L 2R92G 2NVTB 4JUZA 4KY5A 3L7ZC 3R2TA 1PFSA 5DM63 1R4QB 3F1ZA 4YR2A 2YW2A 5AJ3Q 1SFOH 1TKWB 4RAYA 2VUGA 4JI4H 5KFHA 2R92A 1TQOA 5LMNW 1E4GT 3I4NG 1UE1A 1JB3A 1EZ8A 1SNMA 1ZYRD 4C5BA 3MFYA 4KD3A 3QOLA 2W7OA 5CV8A 2OQ0A 4QMGA 3VA5A 1R9TH 1NJIC 1XNQQ 2UXDL 2JJQA 4Q5VA 5KFQA 4HYKA 4CKBA 1S40A 3KHRA 4RGOS 3KOJA 1EYZA 2JE6I 1K73C 3VA7A 3CW2C 1YHQA 3GTLB 4DR6H 4MV1A 4JW0A 3BS1A 1N36Q 1Q1BA 3HKSA 4RCNA 5TSSA 1CM9A 2W6NA 1EFWA 3KLWA 2MO1A 3LX0A 2CQOA 3MR3A 1L1OC 3JAMi 2KOLA 1UE7A 2C2RA 1PRTC 4R1JA 5I9OA 1VAJA 2R92H 4LNQA 1QE6A 2YV5A 4EYIB 1RJRA 4ZHQF 2R7FA 3EQLC 4C3JB 5EKLA 1K1QA 4EGVA 4RZQA 4DV0L 4GNXB 2YS7A 5KT2A 2A68C 3EN2A 2WB1E 1HRJA 3S1RH 2UU9Q 2D0PA 4A3FB 5IP9H 4WRDA 4RB0A 1AN8A 5KYIA 4G7HC 4ECYA 1PH6A 4ECRA 4DR7L 2FB9A 4A75A 3K7UC 5AJ3L 2W9BB 3HOUH 4JBWA 2FKLA 3I56A 2EY5A 4JI6Q 5LL6X 4JI3L 4V190 2OLSA 1NSNS 3TS2A 2MPMA 1E1OA 2A1AA 5D1PA 3VMMA 5EJWA 3T1YH 2K05A 1AE3A 2R7ZG 5ELDA 3D0FA 4Q8EA 3GV6A 1BKBA 2K01A 1PZID 1TWAH 3KF8A 3HOXH 3H3VC 3M4OH 4R8UB 1T36A 3I73A 4XXEA 1KIXA 3LNNA 4EFEA 1H9SA 5KFYA 1F2LA 4FXGC 1TWFH 2MQHA 2A5HA 4LSXA 5GAHC 1W6KA 1YIJA 2FLPA 2C28A 2I0QA 3ZYYX 5LMNQ 1L0XB 2QCPX 1L0YB 1CQIB 1R4PB 4LFAQ 4R4IA 1TY2A 3H3VI 4C1NK 1CS0A 2KUMA 4UCRA 2PQAB 2IA6A 3TMEA 1PV4A 3ER0A 1OXUA 2UUAH 3PUYA 3Q8DA 2WAQG 4GLAC 2JA8G 1JWSD 4Q44A 5L1LA 3C3LA 2D0OA 2NUAB 2OTLA 4ECSA 1XXGA 5LMUL 2UXCH 4YCUA 1O7ZA 2IP4A 1VQNA 1Q46A 2ZDQA 3A7LA 1S5FD 3F8TA 4C56C 2IHEA 1MKHA 1B3AA 1PTOC 1XX8A 2YZGA 2VPSA 3TZUA 2EXZA 4K0KH 5JEAJ 4EEYA 2VS1A 1SEBD 2VQEQ 3BVGA 3GTMB 3UQ8A 3I70A 4P71A 1FD7D 4IUNA 3TREA 5FK9C 3GP7A 3GTJA 2BCOA 4GN3B 2F0IA 1BO0A 3HOYB 1HPCA 3OSOA 2EYOA 1EL0A 4B9WA 5T1GA 1EZ6A 5BN3A 4KI0A 1W3SA 2UXCL 2W6QA 5JUMA 3AYHB 3J7YW 1EU4A 3C0FB 3PF4A 4PMWA 2UXBL 5DQHA 1IBML 1KDBA 2P5ZX 4HIDA 1KRSA 1AE2A 4Q0YA 1N56A 4GNXC 4X6AH 3BZKA 3J80L 1XMQH 2XRQD 2ZXRA 5M3MB 5CV5A 1TAEA 4MV6A 2HHHL 1C0AA 2PI2A 1IKMA 3FKIA 4JI0Q 1IHZA 5KG7A 2YZMA 4DU9A 2CW0C 1S72A 4Y7NB 5DG7A 2CWAA 4TQSA 2M00A 3A8IE 1VQMA 3A8KE 1CQJB 1VQBA 5IT9c 1UEAB 4DKAC 1GO3E 2AQ3B 4FNFA 2RGRA 2JA6A 5BR8Q 3VYSA 2E75C 4R8IA 3CC4A 3W2DA 1AN7A 1I3QA 1A2UA 2N3SA 4FU0A 2HD3A 1HNZQ 5LXTF 4P75A 1WSCA 2AGPA 3CCRA 1VQ9A 2DY7A 2JA6G 1U9RA 1PHJA 2EVBA 2E2IA 2BDNA 1SYDA 4KMUC 2GPSA 1HXYD 4XQNA 4X65Q 1VMCA 2NU8B 4YHHL 4LUVA 1B4OA 2CWPA 3E0EA 4JYAL 3GTJB 3KTMA 4UCOA 2RHQB 2N88A 5EGTA 2ATWA 4JI2Q 2KENA 4BBRG 3GIJA 4UCVA 4KTAA 4IPHA 4LAAA 2B2VC 5LYJF 3GTMA 1HA6A 3J7A5 4A3MB 4HJAA 2CQAA 4ZKBB 4X65H 2BR0A 2W9CA 1WH2A 4J15A 4JI2H 4U68A 1G291 4F4YA 3NWSA 4DNTB 2LFNA 2VQEL 1E22A 4J9KA 2IL8A 1RJQA 2B2UC 1V1QA 2L55A 5M9OA 5HV6A 5BN4A 1VQ5A 1O75A 2O03A 5KG3A 1MZBA 1I5FA 2NVXH 5LA6F 1I94Q 1TS5A 1QNKA 2RCNA 4H02A 3G8CA 5C0XH 3G6XA 2VUMA 2F4IA 2WB1G 3KXYT 4DV4H 4XYMB 2F0HA 2HDLA 4O3SA 4LF7L 4CC5A 4XDXA 2A69D 3MA2B 4FDBA 3KDFA 3HOWB 1AFPA 1VQCA 3OHBA 3GTOA 1JC7A 1TR5A 3P7JA 4DUYL 3PO3B 3WOFA 3EROA 2VUMG 3GTKH 1PYBA 3SE7A 2F0KA 3RN2A 3QFFA 4LUOA 3T16A 2HCCA 3D6WA 1XMQL 4JI2L 2FPGB 2JEAI 1N33Q 2RF4A 3S1QB 4LH6A 2FLNA 1BOSA 2IX3A 3ERQA 3MJFA 4YWKA 1VQHA 2UUBL 1RJTA 1XMOL 2MGSA 1B7YB 5M3FG 4LFCQ 1Q1EA 3OMCA 1SE8A 3MWDA 1Y14B 1CQVA 2EY6A 4BWGB 3I12A 5ELCA 4JV0A 5JPNC 1SN8A 2HCIA 2DPJA 1S0NA 1XTCD 1KEEA 4RA8A 1YJNA 1WCMH 4I55F 3GIMA 1MSHA 3DWPA 1GSOA 4LUZA 5KFNA 3CCMA 2K03A 5DGAA 2VR1A 3TZDA 2Y0SG 5KIXA 4DV7H 4DR5L 4G57A 1SMXA 2QA4A 3SXHA 3D8GA 1PZKD 3J81L 1SE2A 2Z6KC 4JPBW 2XCLA 4UDUC 2ALYB 1PYWD 1RF2D 5NUCA 4RH6A 1F2MA 3EA6A 3TP8A 4BY7H 2JA6H 2I8CA 1PTOF 4DK1A 4ED1A 4J9NA 3LMLA 5IYZF 1U4PA 3OW2A 3GTKB 1OO9B 2VOBA 2F0QA 2UUAL 4IPDA 1TWCA 1JOQA 3HOVG 4L5SA 4JV5L 1LYLA 2KEDA 2UXDH 4E6IA 4FF3A 3H0GG 4AQYL 4BY1H 1M0WA 1EWIA 4HMIA 1DV1A 3FPUB 1TWFA 2F52A 5E4XA 4MAMA 5BPFA 1JDEA 1YJ9A 3NP8A 3V05A 3F2BA 1LT6D 5EWGA 3SHLA 1XNQL 1FGBD 4BA2I 2UXDQ 3H0GA 2QW7A 2E5LQ 2R6GA 2WAQE 3SGIA 1EWHA 4DV1Q 4AH6A 4ZYSA 4LF8H 3J80E 1KJ8A 1B44D 1IBLL 2BDOA 5F9LA 4F87A 2L11A 2QILA 1EY8A 4DV0H 1I7NA 1DOLA 1A3VA 2LSSA 5EDWA 4C2MH 1B9MA 2A6HD 3J81E 3BDLA 3FRPB 4UFZA 4Z9CB 4DL5A 1EWCA 4NKLA 1A9XA 4QL5A 5D3DA 3FPPA 4DUZQ 4KJNA 1EY5A 3I91A 2K28A 3TP6A 4F7XA 4UPAA 2H1EA 1UNSA 4DAYA 1KABA 5LMNL 4C3IH 1K8AC 1D7QA 2FK3A 2R61A 1V4YA 1VF5C 3BVMA 3BG5A 1Y1VB 3N6RA 5ELOA 1GOZA 1PDQA 3CU7A 2OXPA 3FMCA 2DGYA 3UFXB 2D5DA 3CAMA 2HHHH 4A3KG 2N49A 5D65A 1ULZA 2KHIA 5C5JA 1CKMA 4EBDA 4JI4L 2JA7B 1JJCB 1X54A 2JK8A 5CBEE 2EXDA 4K6LA 4DV6H 5IWAL 2F0LA 5ELBA 5CMDA 3KLSX 1KQSA 4LF9Q 1UC8A 4A3IB 3R5FA 3V4ZA 3OSNA 4ED0A 2JEJA 4DAPA 4AQYH 3T5LA 3RB6A 3BQ1A 4DV2Q 5JEAH 1FNVA 3PO3H 3M9BA 4XT1B 3RB3A 1HUNA 5JVLA 1J5EQ 2IPKD 2AU0A 1FR3A 5IGEA 2Z9HA 1CA5A 4IZOA 1Z9FA 2RVLA 1Z2PX 4A76A 5KT5A 4TV8F 3SK8A 3HXLA 1JE4A 4A3KH 4F88A 2JA7G 3V6KA 4DV2H 1X65A 2GVBA 2R8GA 1S5ED 1XTDA 3S17B 1J5EH 1JJ2A 3K8AA 5FD5A 2YRXA 4B3TQ 3KHLA 5C5MA 2W9CB 4BXXH 3RAQA 2VB3X 4IQZA 1IXRA 2F4VQ 4JI7L 1ZHQA 2EOTA 2DNEA 1J6QA 1JE5A 2ZT9C 3EFXD 2E5LL 2EJMA 2NVYB 2Z6KA 4L63B 2A6EC 1BBWA 2PW7A 3NTIA 5CV4A 5C44B 5KFUA 2F0PA 3Q8QB 4ZLTF 1K83B 4ZRZA 4M1UB 2K5QA 1QCBD 5JJZA 1TWHA 2KSWA 4A3MH 4ED7A 1NAPA 1S3OA 3RZOH 1EU3A 2PQEA 4NDXA 4R8UA 5KFBA 1Y1WA 2NTTA 1JORA 5FO9B 2G9HD 3R2IA 1RYRA 1WD1A 5JVH3 1STYA 4OEMB 4A3GH 2J7ZA 4JV2A 3BQ2A 4HTHA 5EKKA 1SYXB 4HNUA 4A3IH 3U9SA 3M4IA 1Y1WG 2NU7B 4HNTA 1NNXA 3MXUA 2EYFA 4IWXA 4A3DH 4UP8A 5C5LA 2YCHA 1Q81C 1A63A 3BQ0A 5KFGA 3HOZH 1G2TA 4WD3A 2RDFA 4X3UA 4FS2A 1RODA 4PZ6A 2A19A 1DV2A 1PX2A 2MCTA 4Y8VB 4HIOA 3OIPA 3RJ0A 4FS1A 3HOVH 5LMNH 3PR5B 2FJ2A 5AFWA 4DR2L 1K8OA 2ZDGA 2Z0SA 3L9AX 2I5LX 4ED2A 1L0WA 1JXLA 4J9MA 4QIWB 4K2KA 2EYJA 2FLLA 2PZWA 1E2ZA 2UUAQ 1GJXA 2R7ZH 4J9QA 3HOXB 1KBLA 3T1YL 1B1ZA 1JQYD 3RZDB 5CA1F 5C44G 3NQTA 2JA5G 1B33N 4IAJA 4MV8A 1B6SA 2C00A 3F8NA 3I7FA 2W7PA 2HVRA 2Q2HA 1BDOA 4GLVB 3D4RA 3TP7A 4M9UA 3S1NH 5D8DA 3L4JA 1FGUA 3SE0A 1DCZA 1YEZA 3I55A 2B2YC 1YNND 2JEBI 2K1BA 3OOCA 4DR5H 3HOUG 5JPMC 1EY6A 1BUVT 2DLNA 2A69C 1LTGD 1DD2A 3FDSA 1LO5D 5IYCG 3ETJA 5KFXA 3WNZA 4IR9A 4JI1H 4JI7Q 2E74C 2NU6B 4ZQIA 3WWVA 1SCUB 1SYCA 2J4XA 2KBNA 1KXLA 2DUDA 3MFHA 2W6OA 1U4LA 2B3GA 3GO5A 4PNYA 1NE3A 4BBSH 4EBEA 4FF2A 2OH2A 1OXTA 3GTPH 2F0JA 3PSIA 2NVXB 5M5YB 3T5HA 3BG3A 2JEGA 2D9UA 2CHBD 2W6MA 3VPDA 1Y8PB 4KV6A 4JV5H 3OHXC 2R84A 2YTVA 3A54A 4DUYH 2E76C 2HGSA 4B3SQ 3S1NB 1RTOA 3NUCA 3VDYA 1MJEA 4OIJA 2VA3A 5CV9A 2DZDA 2L4NA 3OHAA 1XMQQ 3GTGB 3PN1A 1EQVA 2JSOA 3RZDH 2FK1A 2EYHA 4Q45A 3H0GB 4DUYQ 1W96A 5GONF 2JEIA 1TWGB 1TT2A 4JI0H 2SEBD 4A3MG 4I4TF 2GLTA 4A3BH 4ILWA 2C2DA 1H95A 1E4EA 5KFCA 4L5QA 2C2EA 1VQ4A 3T1HH 1VCIA 1WTQA 1KNEA 4XQJA 2E2HH 2NZOA 5KKNB 4JYAQ 3TEHB 1V51A 3PW4A 4KN7C 5C3EH 4M7EA 1H9RA 5I6YA 1JLLB 2NVTH 1KDAA 3W1GA 4NP5A 3ORQA 3H3VH 1O78A 3OWFA 1YVCA 1VQOA 1HR0L 3TINA 1M8AA 3ICEA 1S97A 4HJ8A 3OMGA 4CKEA 2ZJPA 3PUXA 3GTGA 2NUCA 2LMCB 5FLMH 4PWQA 2R3ZA 4V0BA 3DWQA 4R4QA 4C5AA 3WO0A 5L37A 3G6YA 3V6HA 1SDFA 1T9HA 2B2UA 5F9NA 4POFA 4EFBA 3GTGH 3FKIH 4QWCA 1I3QH 4DR3Q 1F9PA 4KJOA 2FPIB 1CFMA 2PMZA 2NVQB 2FPPB 3MR5A 2BE5C 1T5EA 2JEFA 1FJGQ 3NQIA 2LY7A 4GKJQ 1VMPA 3GTPB 2ICIA 3X3MA 1GKHA 3CCLA 1PH7A 4EGQA 4LMYA 1ZETA 1X3QA 1VKZA 1HTLD 5KFWA 5COYA 1STAA 4CDEC 1A15A 3FMAA 3M9NB 4A3BB 5LL6b 1V1PA 1C8CA 4DL3A 5EPLA 2VW9A 4J9RA 1DOMA 2WACA 3RMHA 3KJPA 4C3HH 4HR7A 3DM3A 5GAEC 4PZ8A 3CC7A 1QZHA 3CD6A 4ETSA 5FLXW 5K2MA 2O2LD 1A3TA 1FNUA 4M8AA 2DJGC 1I3QB 1Y69U 2IMWP 2QDBA 1SNOA 3FEWX 1HFNA 1TWGA 2QEXA 1GUTA 1UWVA 3M9MB 1SJED 2R7NA 3L2PA 3Q8RB 3GTJH 5J1ZA 4HIMA 3TS0A 3KLSA 5C4ZA 4XX0B 5HURA 4YHHH 3EIVA 1BXTA 1LV9A 1S68A 3Q1KA 3ULLA 3PW2A 4JI1L 3A56A 5IE8A 1SFOB 1KJ9A 5IGCA 2VQFH 1V1PB 2QDLA 1TS2A 1DGSA 2SDFA 3SI8A 3KBGA 2V5AA 5IYDG 1XMOQ 2R93B 2HIVA 1B3QA 3M4YA 1G6PA 2JN4A 2O5IC 3OIQA 4DR1L 3JAMc 4LFAL 4A93B 4X62L 1TU2B 2ASLA 1E1TA 1MBYA 4XQQA 4MV3A 4QWAA 5M3MG 2F0DA 4TSSA 3J80c 4U6PA 4X3SA 5IOCA 4LF5H 2PMZB 5C4JH 2E2DC 1Y1WB 3W1BA 1IYJB 5L1JA 5ELEA 3QO2A 4IFDJ 1STBA 3KF6A 3PO2G 1II3A 2FFKB 2W8KA 2FMMA 4RUCA 1UE6A 2V1CC 5DAUA 3VR5A 2NVYA 2L0CA 1XPUA 2F3VA 1Q12A 3CPFA 3HOVB 3KAJA 4O3OA 4DAVA 4L1KA 3CPWA 3K5MA 1TWAA 3IKJA 3E6ZX 4JI3Q 2VA2A 4K5XA 5E3FA 1TWHH 2OF1A 2PMZE 2Q2IA 2AMCB 5C3EG 4J0MA 2JYOA 2V9WA 5KFDA 1D2BA 3GTQB 1EHIA 4G4KA 4A3FH 3K5HA 4A2AA 5M5WH 4R4CA 4QQBX 1STHA 1PH3A 3AQQA 4OGQC 2L12A 4JI3H 2PQAA 3K6OA 4DPGA 5M3FH 1I4QA 3W5OA 5C1PA 1AW7A 2VY3A 4WFN3 2IX1A 4YP3A 1SNCA 3TQYA 3IFDA 4DXGA 2WKCA 4FBUA 4UY8C 1ZKOA 4MV7A 3AB9A 2AUJD 4ODGA 4A3CG 3GV5B 4ECUA 1VQ8A 2EDGA 2UU9L 3X3NA 1JMCA 1GSAA 2Z8LA 5IT9L 4K5WA 1E24A 4DR7H 2YYZA 3G6JB 1SE3A 2EY2A 4LF6H 3J81i 3QOJA 3RV3A 4X3TA 3TIIA 5KFEA 1VDZA 1RKNA 2K5WA 4DA2A 2I80A 1QVCA 2FHTA 2R8HA 1YITA 5DG8A 4DR7Q 2ZJQA 3J80i 3PO2B 4HCSA 1XNQH 1B04A 5JQWA 3S17H 3S9WA 4OX9H 3S1MH 2EE1A 2CCZA 1CA6A 2CW7A 2JQOA 4MHEA 1FNWA 2VXWA 2VUMB 1N36H 4N9TA 3S2HB 4K8JA 2Y0SA 3CCJA 1S10A 2JA8B 4FBTA 1JWUD 2EY1A 4TQRA 1RK5A 2PO4A 4CGYB 4DK6C 4IJHA 2Q8RE 4PMCA 1KJQA 1JOKA 3Q22A 3T13A 1JDBB 4JG2A 2YU9A 4O4LF 1LT4D 3KJOA 3SR1A 1I50A 2R82A 3OTOQ 2ZM6Q 1VQ7A 4UCSA 1YBYA 4IOCA 1DZ1A 2R7MA 3BA9A 1ML0D 4LFBH 3PV0A 1HH2P 4OO1H 4KD4A 3CMEA 2E8GA 1RDPD 1BVSA 4OWWB 5KX5F 4P72A 3S14H 3IL8A 5IODA 1PFMA 3RLOA 2JA5H 3JAMW 4KHPL 3GV7B 3HOZB 1Z7TA 3VYRA 4NXNL 5KNBA 4UCUA 2XGPA 4C1NI 5GAGC 5K36G 2G5DA 4IO9A 1ICWA 3SK6A 2A8VA 3TQ1A 1H9JA 2MP1A 5KRUA 4MV4A 2FINB 2Y0SB 4RAUC 1D8LA 3ETHA 4H0LC 4IALA 1CSQA 3NE5B 4RNNA 4R7RA 3EVQA 1CE8A 3S24A 5EZYF 5I47A 1F2ZA 5BMVF 2PNRC 5IYDH 4OELB 2WDTA 4DV3Q 1SYFA 3RZOB 1HHVA 3AFPA 5LP6F 5C4JB 2C35B 4HEDA 2JA6B 3KUPA 5JOBA 4UP7A 2B63H 2B2WA 2NZHA 2WV6D 4LFCL 4IHJF 4DR4H 2D2CC 4HR7B 1W93A 2NYZD 1WYDA 2KCCA 1RYSA 1D1KA 1H9KA 4PZ7A 3PO2H 3E5NA 3HGBA 3O13A 2R8IA 3M3YB 5C4XG 4ME5A 2RQXA 1WI5A 2WYOA 4ZUIA 1Q90A 1HZCA 1WCMB 4ZOLF 4PMBA 3TRZA 4DV7L 1RCVD 1E3PA 1EQTA 1VQKA 5EWEA 3MXPA 1HNXQ 3RGZA 4IUPA 3K3PA 4P73A 4UCTA 1ENFA 3ITPA 2JXMB 4MA0A 1VQLA 1LTTD 4K0KQ 1IBKQ 4HMJA 4B9XA 1EOVA 3R3OA 5IGGA 5KFSA 5DQIA 3MC0B 4A3JH 3GTOB 3BJYA 3NHHA 1X32A 1VQPA 3KDFB 1C7YA 4OL7A 4RCOA 2AGQA 1G6ZA 3K7AH 4GN5A 2SCUB 1PH2A 2Y0SE 3EYYA 3VR2A 2UU9H 4ZKCB 3PO3G 3PCOB 1AH9A 2JA9A 1GUSA 4NPSA 3KF6B 4H13C 3HP3A 4C3IB 2R87A 3QZ8A 2CKZB 3UI2A 2WB1B 4RHRA 3RV4A 4QIWE 1YNJD 3KFUA 3RBDA 3TIGA 4JI6H 4YBZB 3MVVA 1VF7A 4GS3A 3HBLA 5JVDF 3M7GA 3MEHA 5FLXL 4JV5Q 2P0AA 3URYA 1DM0B 2F1MA 1N36L 3I4MH 2RSNA 3CF5A 3S2DB 4RB1A 1ET6A 2I87A 4YJ3F 4X66L 2XC9A 4NXMQ 3WDNA 3I90A 5FD6A 2UVVA 1EY0A 3RUZA 5BR8L 3RB0A 4BY7B 1E2VA 4B3RL 1W6JA 3MWYW 4RUAA 4J9PA 3SK5A 1N48A 5J22A 1IBMQ 1TXYA 3MHBA 4L6TB 1RJPA 1VBHA 5BR8H 3GILA 4NXMH 2HUGA 2IBKA 4A3EG 1CQFA 5EBCA 5HBRB 3RN5A 4ZCKA 5EPJA 1TY0A 4F8MA 2RBMA 1PH4A 4ECWA 2DIKA 4DR3L 4DL6A 1EY7A 1KHIA 1PTOB 2MO0A 3DEOA 4K6DA 1U0LA 2H5XA 4JYAH 2ZXOA 1EYAA 5C3WA 2L1BA 3K5LA 1QNUA 1GHJA 4RKBA 4YJ2F 1LM0A 1N9WA 2YTXA 4L5TA 4X62H 1ICFB 1TWGH 4YY3H 1EUDB 2WINB 3STBC 4YAJB 3I3CA 1X55A 1K83A 3MFGA 3H91A 4KY7A 2KCNA 1DOKA 4XT3B 1CZWA 1LT5D 3HOXG 2UUCL 2XCPA 1B53A 2L9HA 2XRSD 2EJFC 3HFZB 3A8JE 1WVLA 2B2WC 4MZ9A 1EIGA 1DXMA 2HIXA 2ZTCA 3BDCA 4ZQ3A 1QJOA 1N33L 3S15B 5KFPA 5KFJA 4X64H 4LF7H 1DONA 3MXNA 1F9RA 3NEMA 2BOSA 4N9PA 4KKUA 5K5PA 4DR3H 2VNUD 2KCTA 2YU9B 1HNWL 3KBXA 5HGTA 4X64Q 4EBCA 4PV1C 2ID0A 4LF7Q 3MR2A 1I50B 2WIIB 4OO1G 3PIOA 1CI3M 3MEFA 4J9SA 2E2HB 2FK2A 4ME3A 2K04A 4DV4Q 2RKSA 4FM9A 1EEID 3QG1A 1Y1VA 2V4RA 2R7DA 4DR1Q 1HZBA 1GUGA 1OXSC 1BNZA 1WCMG 4JOIC 1JR0D 3GIPA 1MIUA 1EUJA 3HOYG 2R92B 2HDMA 4CC6A 1WOCA 1IYUA 2QEJC 2XWJB 1C4QA 4X64L 5CB4F 4IFDG 5LL6S 1HNWH 3J81j 1N33H 1ILQA 1LTLA 1XNRL 4QIWA 4BBSG 2LXKA 3RTXA 1XPRA 3GTMH 5KG2A 1B6RA 4XTCS 4BWSC 1GM5A 1J9OA 3JZIA
chains in the Genus database with same CATH topology
3HOZG 3EN2A 2WB1E 3S1RH 2UU9Q 2D0PA 5IP9H 4AQYQ 3S15H 2YTVA 1EIYB 1Q7YC 1VQJA 4A3DG 1SLJA 3B6YA 1PH6A 4DR7L 3K0XA 4B3SQ 3F2DA 1FL0A 4A75A 3K7UC 5AJ3L 3VDYA 1N32Q 1MJEA 1A0IA 2K14A 2K75A 2Q2UA 3K80C 3HOUH 2ZM6L 1PH5A 4JBWA 4LF5Q 1XMQQ 3J81c 3I56A 3RZDH 4JI6Q 1NMFA 4JI3L 4DUYQ 5IYBH 1QUQB 3TS2A 1GD7A 4A3CH 1E1OA 4Y7NH 2XGTA 2A1AA 4A3MG 4LFBQ 5C0XG 4A3BH 2UXBQ 1H95A 1AE3A 2R7ZG 1CUKA 4JCVE 4L5QA 1VQ4A 1VCIA 1X3FA 1G51A 3D0FA 4X66Q 2E2HH 2NZOA 1BKBA 4B3MQ 5M3MH 4JYAQ 3TEHB 4HJ5A 4GKKL 1TWAH 5M5XH 3HOXH 3M4OH 4A3FG 3I4OA 1YHAA 1KIXA 4JBKA 5C3EH 2N78A 4DR2Q 2NVTH 3W1GA 3H3VH 1TWFH 1HZAA 2MQHA 1YVCA 3NBHB 1VQOA 5GAHC 4GOPA 2D62A 1YIJA 1HR0L 4RMFA 3ICEA 4HJ8A 2ES2A 2I0QA 2ZJPA 3PUXA 5LMNQ 1Y1WH 2OTJA 1L1OB 5IP7H 5FLMH 1QZGA 4LFAQ 4R4IA 3PIPA 3PGZA 4R4QA 4JI5Q 3H3VI 2PQAB 2K5HA 4BBRH 1PV4A 3ER0A 3S16H 3IRBA 1OXUA 3PUYA 1T9HA 2WAQG 3Q8DA 4GLAC 4B3TL 2JA8G 3CMAA 1K0RA 4POFA 2LXJA 2D0OA 3GTGH 4OO1I 3CQZH 3FKIH 4A3EH 1I3QH 4DR3Q 1X56A 2OTLA 2WFWA 4DR4L 1OXXK 5LMUL 3U4VA 4JI4Q 2WP8J 4YCUA 5C0XJ 4LF8Q 1FJGQ 1VQNA 1Q46A 4GKJQ 2NN6G 5JJIA 3F8TA 1O7IA 2IHEA 1MKHA 1GKHA 4YY3L 3CCLA 1PH7A 2AKWB 5JEAJ 4DV6L 4JBMA 2VS1A 2L15A 3HKZE 4A3JG 2VQEQ 5M5YH 1KAWA 4DR6Q 2YU9H 1K3RA 1PYSB 3KYHC 4KLKA 4BXXG 1X6OA 3KF8B 4P71A 1IZ6A 2VW9A 1N34L 3TREA 4DV6Q 2RHSB 3KJPA 4GN3B 4WJ3M 4C3HH 1PA6A 3DM3A 5GAEC 4PZ8A 3CC7A 1QZHA 3CD6A 3LGJA 2ZTDA 1PH8A 5ELNA 3T1HL 4LW1A 4IPGA 4KI0A 3GTLH 1W3SA 2UXCL 3AYHB 1HJPA 1I50H 3A74A 2QEXA 3PF4A 4PMWA 2UXBL 3FKIG 1UWVA 1IBML 4HIDA 1KRSA 1AE2A 3D31A 1B8AA 3L2PA 4DV7Q 4GLXA 4DV2L 4GNXC 3GTJH 4HIMA 3M85A 1CKOA 3TS0A 4X6AH 3BZKA 1C9OA 4OX9Q 3EIVA 4MNOA 1UEBA 2IY5B 1UE5A 3ULLA 2MNAA 4JI1L 5IE8A 4TVAB 2FXQA 2HHHL 4A3LH 1GVPA 3NENA 1C0AA 2PI2A 3G71A 2K5VA 1DGSA 5JJKA 3M3YH 4GNXA 1NY4A 1ASYA 4YCWA 4JI0Q 3S2HH 5IYDG 1XMOQ 4B3SL 1S72A 1I6HH 2HIVA 4IPCA 2NVQH 2CWAA 1VQMA 1G6PA 1VQBA 5IT9c 3ERSX 4DR1L 3H0GH 3JAMc 4DKAC 1GO3E 4LFAL 4X62L 2VL6A 1N34Q 5BR8Q 2PNHA 3CCSA 2BA0A 1E1TA 4OX9L 3CC4A 2B29A 5M3MG 2N3SA 3J80c 1IBLQ 4OWTB 1HNZQ 3GTOH 5C4JH 2HT1A 4P75A 3K81C 4DNIA 1E7ZA 3CCRA 3W1BA 1IYJB 3GD7A 3M4QA 5C4XH 1VQ9A 2JA6G 4IFDJ 1PHJA 1X3EA 3CC2A 3CCQA 3KF6A 1BBUA 1A8VA 4X65Q 5FLXc 4JBJA 3RNUA 3PO2G 4YHHL 4LUVA 5IYBG 2CWPA 3E0EA 4DV3L 4JYAL 3T1YQ 2RHQB 3PUWA 2AWNA 2IT1A 1UE6A 2V1CC 2KENA 4JI2Q 2ATWA 4DR4Q 4BBRG 4GOPB 1XPUA 1Q12A 4IPHA 4JC0A 3RLFA 3CPFA 3GDEA 5FLMG 3J7A5 3CPWA 4HJAA 3NELA 5HGQA 4DV1L 1W2BA 1TWCH 4J15A 4C3JH 5IP9G 4DV0Q 4JI3Q 3UDFA 2UXCQ 4AIMA 2K4KA 3CXCA 3G4SA 1M90C 1G291 2VQEL 4JI8L 1TWHH 2PMZE 1E22A 2Q2IA 2AMCB 5C3EG 4NXNQ 1EYGA 4LFBL 4KHPQ 4BY1G 4POGA 4A3FH 1NBWA 1V1QA 5M5WH 1YZ6A 1MJCA 2KCMA 4R4CA 4YCVA 1VQ5A 4QQBX 1PH3A 3AQQA 2PQAA 4DPGA 1I5FA 5M3FH 4XIGS 3W5OA 1YNXA 4DV5Q 2NVXH 2NVYH 2VY3A 1I94Q 5FJ8G 1X3GA 2IX1A 4GKKQ 3TQYA 2EIFA 2RCNA 4H02A 4DR5Q 2CFMA 3ULPA 4UY8C 4PG3A 1YJWA 4JI8Q 2ASBA 4A3CG 2WB1G 1VQ8A 4LF7L 2YTYA 1A62A 5E7NA 1EQRA 2UU9L 1JMCA 4FDBA 3KDFA 1VQCA 1E24A 3EBEA 3A5UA 4DUYL 2YYZA 3BU2A 2VUMG 3U50C 3GTKH 1PYBA 1Y1VH 3J81i 3OYYA 1RIPA 3RN2A 1SR3A 2E2JH 4LUOA 2AWOA 2KHJA 1XMQL 1QVCA 1PH9A 4JI2L 4LF5L 1YITA 2JEAI 1PH1A 1N33Q 4WJ4A 2RF4A 3UDXA 3E9IA 4DR7Q 2ZJQA 5GROA 3J80i 4YWKA 1VQHA 3S17H 2UUBL 1QUQA 1XMOL 3FP9A 3S1MH 3E9HA 1B7YB 5M3FG 2CCZA 4OONA 4LFCQ 1Q1EA 2JQOA 1SE8A 1Y14B 4RG1A 1SN8A 1CKNB 3CCJA 1XNRQ 2XTIA 4A93G 4DK6C 1YJNA 4IJHA 1WCMH 1Q82C 1VS0A 4LUZA 1HNWQ 1VQ6A 4QY7A 4JG2A 5IYCH 1QVGA 1HZ9A 2K5NA 4AYBG 3KJOA 3CCMA 4O0AA 4IFDI 2Y0SG 3OTOQ 2ZM6Q 2OCEA 1YBYA 4IOCA 4DR5L 4A3IG 1SMXA 2QA4A 3PUZA 1VQ7A 4LF6L 1KL9A 3UDGA 3PV0A 3BJUA 2VUMH 1N32L 1HH2P 2Z6KC 4YHHQ 1K8GA 4A3GG 4X65L 3CMEA 2E8GA 1V9PA 1BVSA 2ALYB 3T1HQ 4L5RC 4OWWB 1L1OA 3I4NH 4P72A 1M1KC 3S14H 4YWMA 3RR5A 4JOIA 4BY7H 3RLOA 4O2DA 2JA5H 4KHPL 2BH8A 2JA6H 4JI6L 4NXNL 5HY6A 2VQFL 1WJJA 4QGUA 5FJ8H 5GAGC 5K36G 4IO9A 4YWLA 2A8VA 4BA1I 3OW2A 1CKNA 1D8LA 2UUAL 4IPDA 1I94L 3I2ZA 2OQKA 1CSQA 3HOVG 4L5SA 4JV5L 1LYLA 4EX5A 3H0GG 3BZCA 4TQUS 4AQYL 1EWIA 4YY3Q 4BY1H 3DLLA 2F52A 3STBD 1PVOA 4ALPA 5GADC 4DAMA 3S24A 3CP0A 2UUCQ 5H1SE 1YJ9A 5IYDH 1HNZL 4DK3C 3F2BA 4DV3Q 3S2DH 3AFPA 2C35B 1XNQL 2BA1A 4BA2I 2JA7H 2UXDQ 4UP7A 2NN6I 1B70B 2E5LQ 2R6GA 2WAQE 2NZHA 4LFCL 3SGIA 2B63H 4DV1Q 3AEVA 4AH6A 3J7ZC 4DUZL 2BH2A 1L2FA 1RL2A 4JI5L 4R4OA 1HR0W 1XPOA 1IBLL 4B3RQ 1VQEA 2ZTEA 4OXPA 1WYDA 1P8LA 5JEAG 4PZ7A 3PO2H 1QVFA 2R93H 2OWOA 4X62Q 4LF8L 1FJGL 4P74A 2LSSA 5C4XG 4C2MH 1WI5A 3AFQA 1HZCA 1VQFA 3UE0A 1OXVA 1V43A 3TRZA 4DV7L 3CCEA 4QL5A 4DUZQ 5EAYA 1VQGA 2QGQA 1E3PA 2E2IH 1VQKA 4JI1Q 4QJFA 1HNXQ 3I4MG 4KHZA 4UPAA 4P73A 5LMNL 4C3IH 1K8AC 1JB7A 1D7QA 1EIFA 1VQLA 4K0KQ 1IBKQ 2IHFA 1EOVA 1VQIA 5ELOA 3RLNA 3U4ZA 4A3JH 3CCVA 2DGYA 3G6EA 1IL2A 3CAMA 3F2CA 4A3LG 1VQPA 1C7YA 3KDFB 4A3KG 2N49A 2KHIA 5C0XI 1CKMA 2F3IA 2AHOB 1KD1C 4JI4L 4K0KL 1JJCB 1X54A 2JK8A 2EXDA 3K7AH 4GN5A 5IWAL 4EQ5A 4B3ML 1WFQA 1PH2A 4LF6Q 4LF9Q 1KQSA 2Y0SE 3PF5A 5JJLA 1HNXL 4HIKA 3PO3G 3PCOB 3HOWH 3ULJA 1AH9A 2JA9A 2VQFQ 1CSPA 3HOWG 4NPSA 2VZAA 4DV2Q 3KF6B 3M7NA 3M9BA 3PO3H 1IBKL 1N8RC 3S1QH 2MFIA 3MXNB 1J5EQ 2JA8H 1NTGA 2CKZB 4OWXB 1Z9FA 3A0JA 4A76A 3HKZG 4GKJL 4QIWE 1NMGA 4IJLA 4DAYB 3KFUA 4HJ9A 4A3KH 3GTQH 5IP7G 2JA7G 1EQQA 1VQAA 3ZJYC 1X65A 2GVBA 1OTCA 1XTDA 4MTNA 4GS3A 3HOYH 1K83H 1JJ2A 3K8AA 1ASZA 3FHWA 4LF4Q 4B3TQ 1KC8C 3UE1A 4JV5Q 3UDIA 3L0OA 4BXXH 1IXRA 2F4VQ 1SROA 2I5MX 1N36L 3G48A 3CF5A 4JI7L 3I4MH 1X9NA 1J6QA 1JE5A 4GN4B 5LMUQ 2E5LL 2IX0A 4X66L 4NXMQ 3JC66 2Z6KA 5DLQE 4LWCA 1BBWA 2K50A 5BR8L 5GQOA 4B3RL 1JJGA 2EQSA 4DR6L 2F4VL 1IBMQ 1TXYA 4LF4L 4A3MH 1S3OA 2UUBQ 3RZOH 4BY7G 4A4IA 5IWAQ 3M4PA 2R93G 1HR0Q 5IY0A 4A3EG 3RN5A 1YI2A 2K52A 2GVAA 1PH4A 4DV4L 4DR3L 4A3GH 2GN5A 1KHIA 2MO0A 3H15A 4R4TA 3PUVA 4A3IH 1U0LA 2H5XA 1J5EL 1YHBA 2B63G 1FVIA 1Y1WG 4UP9A 2HQLA 1SRUA 5J3BA 4A3DH 1LM0A 1N9WA 2YTXA 4L5TA 4UP8A 1TWGH 1Q81C 1A63A 1Q8KA 1KRTA 3STBC 3HOZH 2PI2E 1K9MC 4PZ6A 4A93H 2A19A 1X55A 2N8NA 1JT8A 2ZJRA 4HIOA 2I5HA 2Q2TA 3OTOL 3HOXG 2UUCL 3HOVH 1U5KA 4DR2L 3U58A 1VQDA 4DV5L 2R92G 2Z0SA 3HFZB 3L7ZC 2I5LX 4MZ9A 1L0WA 2HIXA 2ZTCA 1PFSA 1N33L 1P16A 2UUAQ 2R7ZH 4GOPC 4A3BG 3F1ZA 3T1YL 3NEMA 5AJ3Q 5C44G 2JA5G 1SFOH 2VNUD 4HJ7A 3I7FA 2KCTA 1LUZA 5LMNW 2Q2HA 3I4NG 1UE1A 1Y1VG 4GLVB 1HNWL 3S1NH 4X64Q 1FGUA 2ID0A 4AYBE 4LF7Q 1R9TH 2OQ0A 1NJIC 1XNQQ 1YEZA 4OO1G 2UXDL 3PIOA 2JJQA 3I55A 1S40A 2JEBI 3MEFA 3KOJA 3HOUG 2JE6I 3A5ZB 1XJVA 4ME3A 1K73C 3CW2C 4DV4Q 4IOAA 1YHQA 5IYCG 4Y52H 2R7DA 4DR1Q 5C44H 1HZBA 1Q1BA 1OXSC 3HKSA 4NB3A 1N36Q 4JI7Q 1WCMG 1Z47A 4JOIC 1EFWA 1MIUA 1EUJA 3WWVA 3HOYG 3KLWA 2MO1A 2KBNA 1KXLA 1WOCA 2CQOA 2DUDA 1L1OC 3JAMi 4X64L 3GO5A 1UE7A 2B3GA 1Q86C 1NE3A 4R1JA 4JI0L 4BBSH 2R92H 4LNQA 4IFDG 2YV5A 3J81j 1OXTA 2R7FA 3GTPH 2HHHQ 1LTLA 1XNRL 4BBSG 2LXKA 3PSIA 1XPRA 3GTMH 3CCUA 4XTCS 4DV0L 4GNXB 4LF9L 4NXML 1GM5A 4APVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ G;  3EN2 A;  2WB1 E;  3S1R H;  2UU9 Q;  2D0P A;  5IP9 H;  4AQY Q;  3S15 H;  2YTV A;  1EIY B;  1Q7Y C;  1VQJ A;  4A3D G;  1SLJ A;  3B6Y A;  1PH6 A;  4DR7 L;  3K0X A;  4B3S Q;  3F2D A;  1FL0 A;  4A75 A;  3K7U C;  5AJ3 L;  3VDY A;  1N32 Q;  1MJE A;  1A0I A;  2K14 A;  2K75 A;  2Q2U A;  3K80 C;  3HOU H;  2ZM6 L;  1PH5 A;  4JBW A;  4LF5 Q;  1XMQ Q;  3J81 c;  3I56 A;  3RZD H;  4JI6 Q;  1NMF A;  4JI3 L;  4DUY Q;  5IYB H;  1QUQ B;  3TS2 A;  1GD7 A;  4A3C H;  1E1O A;  4Y7N H;  2XGT A;  2A1A A;  4A3M G;  4LFB Q;  5C0X G;  4A3B H;  2UXB Q;  1H95 A;  1AE3 A;  2R7Z G;  1CUK A;  4JCV E;  4L5Q A;  1VQ4 A;  1VCI A;  1X3F A;  1G51 A;  3D0F A;  4X66 Q;  2E2H H;  2NZO A;  1BKB A;  4B3M Q;  5M3M H;  4JYA Q;  3TEH B;  4HJ5 A;  4GKK L;  1TWA H;  5M5X H;  3HOX H;  3M4O H;  4A3F G;  3I4O A;  1YHA A;  1KIX A;  4JBK A;  5C3E H;  2N78 A;  4DR2 Q;  2NVT H;  3W1G A;  3H3V H;  1TWF H;  1HZA A;  2MQH A;  1YVC A;  3NBH B;  1VQO A;  5GAH C;  4GOP A;  2D62 A;  1YIJ A;  1HR0 L;  4RMF A;  3ICE A;  4HJ8 A;  2ES2 A;  2I0Q A;  2ZJP A;  3PUX A;  5LMN Q;  1Y1W H;  2OTJ A;  1L1O B;  5IP7 H;  5FLM H;  1QZG A;  4LFA Q;  4R4I A;  3PIP A;  3PGZ A;  4R4Q A;  4JI5 Q;  3H3V I;  2PQA B;  2K5H A;  4BBR H;  1PV4 A;  3ER0 A;  3S16 H;  3IRB A;  1OXU A;  3PUY A;  1T9H A;  2WAQ G;  3Q8D A;  4GLA C;  4B3T L;  2JA8 G;  3CMA A;  1K0R A;  4POF A;  2LXJ A;  2D0O A;  3GTG H;  4OO1 I;  3CQZ H;  3FKI H;  4A3E H;  1I3Q H;  4DR3 Q;  1X56 A;  2OTL A;  2WFW A;  4DR4 L;  1OXX K;  5LMU L;  3U4V A;  4JI4 Q;  2WP8 J;  4YCU A;  5C0X J;  4LF8 Q;  1FJG Q;  1VQN A;  1Q46 A;  4GKJ Q;  2NN6 G;  5JJI A;  3F8T A;  1O7I A;  2IHE A;  1MKH A;  1GKH A;  4YY3 L;  3CCL A;  1PH7 A;  2AKW B;  5JEA J;  4DV6 L;  4JBM A;  2VS1 A;  2L15 A;  3HKZ E;  4A3J G;  2VQE Q;  5M5Y H;  1KAW A;  4DR6 Q;  2YU9 H;  1K3R A;  1PYS B;  3KYH C;  4KLK A;  4BXX G;  1X6O A;  3KF8 B;  4P71 A;  1IZ6 A;  2VW9 A;  1N34 L;  3TRE A;  4DV6 Q;  2RHS B;  3KJP A;  4GN3 B;  4WJ3 M;  4C3H H;  1PA6 A;  3DM3 A;  5GAE C;  4PZ8 A;  3CC7 A;  1QZH A;  3CD6 A;  3LGJ A;  2ZTD A;  1PH8 A;  5ELN A;  3T1H L;  4LW1 A;  4IPG A;  4KI0 A;  3GTL H;  1W3S A;  2UXC L;  3AYH B;  1HJP A;  1I50 H;  3A74 A;  2QEX A;  3PF4 A;  4PMW A;  2UXB L;  3FKI G;  1UWV A;  1IBM L;  4HID A;  1KRS A;  1AE2 A;  3D31 A;  1B8A A;  3L2P A;  4DV7 Q;  4GLX A;  4DV2 L;  4GNX C;  3GTJ H;  4HIM A;  3M85 A;  1CKO A;  3TS0 A;  4X6A H;  3BZK A;  1C9O A;  4OX9 Q;  3EIV A;  4MNO A;  1UEB A;  2IY5 B;  1UE5 A;  3ULL A;  2MNA A;  4JI1 L;  5IE8 A;  4TVA B;  2FXQ A;  2HHH L;  4A3L H;  1GVP A;  3NEN A;  1C0A A;  2PI2 A;  3G71 A;  2K5V A;  1DGS A;  5JJK A;  3M3Y H;  4GNX A;  1NY4 A;  1ASY A;  4YCW A;  4JI0 Q;  3S2H H;  5IYD G;  1XMO Q;  4B3S L;  1S72 A;  1I6H H;  2HIV A;  4IPC A;  2NVQ H;  2CWA A;  1VQM A;  1G6P A;  1VQB A;  5IT9 c;  3ERS X;  4DR1 L;  3H0G H;  3JAM c;  4DKA C;  1GO3 E;  4LFA L;  4X62 L;  2VL6 A;  1N34 Q;  5BR8 Q;  2PNH A;  3CCS A;  2BA0 A;  1E1T A;  4OX9 L;  3CC4 A;  2B29 A;  5M3M G;  2N3S A;  3J80 c;  1IBL Q;  4OWT B;  1HNZ Q;  3GTO H;  5C4J H;  2HT1 A;  4P75 A;  3K81 C;  4DNI A;  1E7Z A;  3CCR A;  3W1B A;  1IYJ B;  3GD7 A;  3M4Q A;  5C4X H;  1VQ9 A;  2JA6 G;  4IFD J;  1PHJ A;  1X3E A;  3CC2 A;  3CCQ A;  3KF6 A;  1BBU A;  1A8V A;  4X65 Q;  5FLX c;  4JBJ A;  3RNU A;  3PO2 G;  4YHH L;  4LUV A;  5IYB G;  2CWP A;  3E0E A;  4DV3 L;  4JYA L;  3T1Y Q;  2RHQ B;  3PUW A;  2AWN A;  2IT1 A;  1UE6 A;  2V1C C;  2KEN A;  4JI2 Q;  2ATW A;  4DR4 Q;  4BBR G;  4GOP B;  1XPU A;  1Q12 A;  4IPH A;  4JC0 A;  3RLF A;  3CPF A;  3GDE A;  5FLM G;  3J7A 5;  3CPW A;  4HJA A;  3NEL A;  5HGQ A;  4DV1 L;  1W2B A;  1TWC H;  4J15 A;  4C3J H;  5IP9 G;  4DV0 Q;  4JI3 Q;  3UDF A;  2UXC Q;  4AIM A;  2K4K A;  3CXC A;  3G4S A;  1M90 C;  1G29 1;  2VQE L;  4JI8 L;  1TWH H;  2PMZ E;  1E22 A;  2Q2I A;  2AMC B;  5C3E G;  4NXN Q;  1EYG A;  4LFB L;  4KHP Q;  4BY1 G;  4POG A;  4A3F H;  1NBW A;  1V1Q A;  5M5W H;  1YZ6 A;  1MJC A;  2KCM A;  4R4C A;  4YCV A;  1VQ5 A;  4QQB X;  1PH3 A;  3AQQ A;  2PQA A;  4DPG A;  1I5F A;  5M3F H;  4XIG S;  3W5O A;  1YNX A;  4DV5 Q;  2NVX H;  2NVY H;  2VY3 A;  1I94 Q;  5FJ8 G;  1X3G A;  2IX1 A;  4GKK Q;  3TQY A;  2EIF A;  2RCN A;  4H02 A;  4DR5 Q;  2CFM A;  3ULP A;  4UY8 C;  4PG3 A;  1YJW A;  4JI8 Q;  2ASB A;  4A3C G;  2WB1 G;  1VQ8 A;  4LF7 L;  2YTY A;  1A62 A;  5E7N A;  1EQR A;  2UU9 L;  1JMC A;  4FDB A;  3KDF A;  1VQC A;  1E24 A;  3EBE A;  3A5U A;  4DUY L;  2YYZ A;  3BU2 A;  2VUM G;  3U50 C;  3GTK H;  1PYB A;  1Y1V H;  3J81 i;  3OYY A;  1RIP A;  3RN2 A;  1SR3 A;  2E2J H;  4LUO A;  2AWO A;  2KHJ A;  1XMQ L;  1QVC A;  1PH9 A;  4JI2 L;  4LF5 L;  1YIT A;  2JEA I;  1PH1 A;  1N33 Q;  4WJ4 A;  2RF4 A;  3UDX A;  3E9I A;  4DR7 Q;  2ZJQ A;  5GRO A;  3J80 i;  4YWK A;  1VQH A;  3S17 H;  2UUB L;  1QUQ A;  1XMO L;  3FP9 A;  3S1M H;  3E9H A;  1B7Y B;  5M3F G;  2CCZ A;  4OON A;  4LFC Q;  1Q1E A;  2JQO A;  1SE8 A;  1Y14 B;  4RG1 A;  1SN8 A;  1CKN B;  3CCJ A;  1XNR Q;  2XTI A;  4A93 G;  4DK6 C;  1YJN A;  4IJH A;  1WCM H;  1Q82 C;  1VS0 A;  4LUZ A;  1HNW Q;  1VQ6 A;  4QY7 A;  4JG2 A;  5IYC H;  1QVG A;  1HZ9 A;  2K5N A;  4AYB G;  3KJO A;  3CCM A;  4O0A A;  4IFD I;  2Y0S G;  3OTO Q;  2ZM6 Q;  2OCE A;  1YBY A;  4IOC A;  4DR5 L;  4A3I G;  1SMX A;  2QA4 A;  3PUZ A;  1VQ7 A;  4LF6 L;  1KL9 A;  3UDG A;  3PV0 A;  3BJU A;  2VUM H;  1N32 L;  1HH2 P;  2Z6K C;  4YHH Q;  1K8G A;  4A3G G;  4X65 L;  3CME A;  2E8G A;  1V9P A;  1BVS A;  2ALY B;  3T1H Q;  4L5R C;  4OWW B;  1L1O A;  3I4N H;  4P72 A;  1M1K C;  3S14 H;  4YWM A;  3RR5 A;  4JOI A;  4BY7 H;  3RLO A;  4O2D A;  2JA5 H;  4KHP L;  2BH8 A;  2JA6 H;  4JI6 L;  4NXN L;  5HY6 A;  2VQF L;  1WJJ A;  4QGU A;  5FJ8 H;  5GAG C;  5K36 G;  4IO9 A;  4YWL A;  2A8V A;  4BA1 I;  3OW2 A;  1CKN A;  1D8L A;  2UUA L;  4IPD A;  1I94 L;  3I2Z A;  2OQK A;  1CSQ A;  3HOV G;  4L5S A;  4JV5 L;  1LYL A;  4EX5 A;  3H0G G;  3BZC A;  4TQU S;  4AQY L;  1EWI A;  4YY3 Q;  4BY1 H;  3DLL A;  2F52 A;  3STB D;  1PVO A;  4ALP A;  5GAD C;  4DAM A;  3S24 A;  3CP0 A;  2UUC Q;  5H1S E;  1YJ9 A;  5IYD H;  1HNZ L;  4DK3 C;  3F2B A;  4DV3 Q;  3S2D H;  3AFP A;  2C35 B;  1XNQ L;  2BA1 A;  4BA2 I;  2JA7 H;  2UXD Q;  4UP7 A;  2NN6 I;  1B70 B;  2E5L Q;  2R6G A;  2WAQ E;  2NZH A;  4LFC L;  3SGI A;  2B63 H;  4DV1 Q;  3AEV A;  4AH6 A;  3J7Z C;  4DUZ L;  2BH2 A;  1L2F A;  1RL2 A;  4JI5 L;  4R4O A;  1HR0 W;  1XPO A;  1IBL L;  4B3R Q;  1VQE A;  2ZTE A;  4OXP A;  1WYD A;  1P8L A;  5JEA G;  4PZ7 A;  3PO2 H;  1QVF A;  2R93 H;  2OWO A;  4X62 Q;  4LF8 L;  1FJG L;  4P74 A;  2LSS A;  5C4X G;  4C2M H;  1WI5 A;  3AFQ A;  1HZC A;  1VQF A;  3UE0 A;  1OXV A;  1V43 A;  3TRZ A;  4DV7 L;  3CCE A;  4QL5 A;  4DUZ Q;  5EAY A;  1VQG A;  2QGQ A;  1E3P A;  2E2I H;  1VQK A;  4JI1 Q;  4QJF A;  1HNX Q;  3I4M G;  4KHZ A;  4UPA A;  4P73 A;  5LMN L;  4C3I H;  1K8A C;  1JB7 A;  1D7Q A;  1EIF A;  1VQL A;  4K0K Q;  1IBK Q;  2IHF A;  1EOV A;  1VQI A;  5ELO A;  3RLN A;  3U4Z A;  4A3J H;  3CCV A;  2DGY A;  3G6E A;  1IL2 A;  3CAM A;  3F2C A;  4A3L G;  1VQP A;  1C7Y A;  3KDF B;  4A3K G;  2N49 A;  2KHI A;  5C0X I;  1CKM A;  2F3I A;  2AHO B;  1KD1 C;  4JI4 L;  4K0K L;  1JJC B;  1X54 A;  2JK8 A;  2EXD A;  3K7A H;  4GN5 A;  5IWA L;  4EQ5 A;  4B3M L;  1WFQ A;  1PH2 A;  4LF6 Q;  4LF9 Q;  1KQS A;  2Y0S E;  3PF5 A;  5JJL A;  1HNX L;  4HIK A;  3PO3 G;  3PCO B;  3HOW H;  3ULJ A;  1AH9 A;  2JA9 A;  2VQF Q;  1CSP A;  3HOW G;  4NPS A;  2VZA A;  4DV2 Q;  3KF6 B;  3M7N A;  3M9B A;  3PO3 H;  1IBK L;  1N8R C;  3S1Q H;  2MFI A;  3MXN B;  1J5E Q;  2JA8 H;  1NTG A;  2CKZ B;  4OWX B;  1Z9F A;  3A0J A;  4A76 A;  3HKZ G;  4GKJ L;  4QIW E;  1NMG A;  4IJL A;  4DAY B;  3KFU A;  4HJ9 A;  4A3K H;  3GTQ H;  5IP7 G;  2JA7 G;  1EQQ A;  1VQA A;  3ZJY C;  1X65 A;  2GVB A;  1OTC A;  1XTD A;  4MTN A;  4GS3 A;  3HOY H;  1K83 H;  1JJ2 A;  3K8A A;  1ASZ A;  3FHW A;  4LF4 Q;  4B3T Q;  1KC8 C;  3UE1 A;  4JV5 Q;  3UDI A;  3L0O A;  4BXX H;  1IXR A;  2F4V Q;  1SRO A;  2I5M X;  1N36 L;  3G48 A;  3CF5 A;  4JI7 L;  3I4M H;  1X9N A;  1J6Q A;  1JE5 A;  4GN4 B;  5LMU Q;  2E5L L;  2IX0 A;  4X66 L;  4NXM Q;  3JC6 6;  2Z6K A;  5DLQ E;  4LWC A;  1BBW A;  2K50 A;  5BR8 L;  5GQO A;  4B3R L;  1JJG A;  2EQS A;  4DR6 L;  2F4V L;  1IBM Q;  1TXY A;  4LF4 L;  4A3M H;  1S3O A;  2UUB Q;  3RZO H;  4BY7 G;  4A4I A;  5IWA Q;  3M4P A;  2R93 G;  1HR0 Q;  5IY0 A;  4A3E G;  3RN5 A;  1YI2 A;  2K52 A;  2GVA A;  1PH4 A;  4DV4 L;  4DR3 L;  4A3G H;  2GN5 A;  1KHI A;  2MO0 A;  3H15 A;  4R4T A;  3PUV A;  4A3I H;  1U0L A;  2H5X A;  1J5E L;  1YHB A;  2B63 G;  1FVI A;  1Y1W G;  4UP9 A;  2HQL A;  1SRU A;  5J3B A;  4A3D H;  1LM0 A;  1N9W A;  2YTX A;  4L5T A;  4UP8 A;  1TWG H;  1Q81 C;  1A63 A;  1Q8K A;  1KRT A;  3STB C;  3HOZ H;  2PI2 E;  1K9M C;  4PZ6 A;  4A93 H;  2A19 A;  1X55 A;  2N8N A;  1JT8 A;  2ZJR A;  4HIO A;  2I5H A;  2Q2T A;  3OTO L;  3HOX G;  2UUC L;  3HOV H;  1U5K A;  4DR2 L;  3U58 A;  1VQD A;  4DV5 L;  2R92 G;  2Z0S A;  3HFZ B;  3L7Z C;  2I5L X;  4MZ9 A;  1L0W A;  2HIX A;  2ZTC A;  1PFS A;  1N33 L;  1P16 A;  2UUA Q;  2R7Z H;  4GOP C;  4A3B G;  3F1Z A;  3T1Y L;  3NEM A;  5AJ3 Q;  5C44 G;  2JA5 G;  1SFO H;  2VNU D;  4HJ7 A;  3I7F A;  2KCT A;  1LUZ A;  5LMN W;  2Q2H A;  3I4N G;  1UE1 A;  1Y1V G;  4GLV B;  1HNW L;  3S1N H;  4X64 Q;  1FGU A;  2ID0 A;  4AYB E;  4LF7 Q;  1R9T H;  2OQ0 A;  1NJI C;  1XNQ Q;  1YEZ A;  4OO1 G;  2UXD L;  3PIO A;  2JJQ A;  3I55 A;  1S40 A;  2JEB I;  3MEF A;  3KOJ A;  3HOU G;  2JE6 I;  3A5Z B;  1XJV A;  4ME3 A;  1K73 C;  3CW2 C;  4DV4 Q;  4IOA A;  1YHQ A;  5IYC G;  4Y52 H;  2R7D A;  4DR1 Q;  5C44 H;  1HZB A;  1Q1B A;  1OXS C;  3HKS A;  4NB3 A;  1N36 Q;  4JI7 Q;  1WCM G;  1Z47 A;  4JOI C;  1EFW A;  1MIU A;  1EUJ A;  3WWV A;  3HOY G;  3KLW A;  2MO1 A;  2KBN A;  1KXL A;  1WOC A;  2CQO A;  2DUD A;  1L1O C;  3JAM i;  4X64 L;  3GO5 A;  1UE7 A;  2B3G A;  1Q86 C;  1NE3 A;  4R1J A;  4JI0 L;  4BBS H;  2R92 H;  4LNQ A;  4IFD G;  2YV5 A;  3J81 j;  1OXT A;  2R7F A;  3GTP H;  2HHH Q;  1LTL A;  1XNR L;  4BBS G;  2LXK A;  3PSI A;  1XPR A;  3GTM H;  3CCU A;  4XTC S;  4DV0 L;  4GNX B;  4LF9 L;  4NXM L;  1GM5 A;  4APV A; 
#chains in the Genus database with same CATH topology
 4FXD A;  3HOZ G;  3N40 P;  2MJ8 A;  4J8Q A;  4H44 C;  1PXU A;  5ELF A;  1EIY B;  1Q7Y C;  1VQJ A;  3CKI B;  1SLJ A;  3RF2 A;  1HTP A;  3F2D A;  1K0S A;  1N32 Q;  1A0I A;  1D1I A;  1SYB A;  2K14 A;  2Q2U A;  1DJR D;  5D1O B;  5JAV A;  3HKZ A;  3J81 c;  2QF7 A;  3S14 B;  5KEE A;  3JSN A;  2XNA C;  2Q8I B;  1NMF A;  4IUR A;  2UUB H;  3GLK A;  3H94 A;  4C5C A;  4Y7N H;  2XGT A;  1HR0 H;  5EPK A;  5C0X G;  5E4W C;  2ASJ A;  1BCP D;  3BYT B;  1CUK A;  4JCV E;  3JRX A;  3TP5 A;  1MGS A;  4X66 Q;  4J6H A;  5LMU H;  1S9F A;  2H4O A;  4B3M Q;  5M3M H;  2YS6 A;  4QWB A;  4GKK L;  3N52 A;  2XVS A;  5M5X H;  5KNC A;  1WTV A;  2B2T A;  4ED3 A;  2R7K A;  4A3F G;  1TWA B;  1WD0 A;  4JBK A;  1GGO A;  5FKA C;  3Q8S B;  2XWB B;  4DR2 Q;  4I65 A;  2V59 A;  4X66 H;  3H6M A;  1J8I A;  4C3J G;  4GC6 A;  4B3R H;  4RMF A;  3D4D A;  2ES2 A;  3GTP A;  2OTJ A;  3N44 B;  1AZQ A;  2I46 A;  3I4L A;  4JI5 Q;  3RGX A;  2K5H A;  2X6L A;  2W9A A;  3IRB A;  2ZDH A;  2LS0 1;  4RGM A;  2PZU A;  2B63 A;  2LXJ A;  1T5X D;  2HQE A;  4HNV A;  3QZ7 A;  3CQZ H;  4A3E H;  1SYG A;  1ZYR C;  1E4F T;  1QIL A;  2K7V A;  5KND A;  4DR4 L;  5L9X A;  4CDC C;  4ZUJ A;  2A73 B;  2WP8 J;  3H09 A;  4MA5 A;  5C0X J;  4F50 A;  4LF8 Q;  1SAP A;  2NN6 G;  5JJI A;  1O7I A;  3P20 A;  3PIP 3;  4YY3 L;  4LH7 A;  5A2Q E;  3S1R B;  3T5K A;  2AKW B;  2CW0 D;  3QIA A;  3QWN A;  1ONL A;  4TV9 F;  4A3J G;  1H9S B;  1WR2 A;  1KAW A;  1A6X A;  4NLG A;  4QB4 A;  5CA0 F;  4DL7 A;  1K3R A;  2F0N A;  2Z4H A;  4KLK A;  3VR4 A;  3SK4 A;  4BXX G;  1X6O A;  3KF8 B;  4FVM A;  1IZ6 A;  2Q8T A;  1N34 L;  4C3I G;  4F4W A;  4RB2 C;  4WJ3 M;  3MZ5 A;  1PA6 A;  1JIH A;  1V8Q A;  3Q23 A;  5DG9 A;  5KYL A;  3LGJ A;  4EEQ A;  1ILP A;  2ZTD A;  5ELN A;  3T1H L;  4O3P A;  4IPG A;  4YIJ A;  4X3K A;  4G7Z C;  3IFT A;  4GZY C;  1I50 H;  5J2T F;  3A74 A;  1K1S A;  1SJH D;  4JV1 A;  4A3D B;  3D4W A;  4DV7 Q;  4GLX A;  4DV2 L;  1EFI D;  2YRW A;  3M85 A;  2R6F A;  4LF4 H;  5ISR A;  3MWE A;  1I6U A;  1C9O A;  4OX9 Q;  1SEI A;  2IY5 B;  1NCV A;  1UE5 A;  2KQ3 A;  2VB2 X;  5JVG 3;  4TVA B;  4IR1 A;  1I4G A;  2F0V A;  2Z1C A;  3G71 A;  1IOW A;  2K5V A;  5JJK A;  4APM A;  1ASY A;  1NY4 A;  3S2H H;  3SDZ A;  4B3S L;  4RZR A;  4IPC A;  4R8N A;  2UVW A;  3QB3 A;  4KY6 A;  3ERS X;  1CHP D;  2VL6 A;  2PNH A;  2BA0 A;  4OX9 L;  1ENA A;  2B29 A;  4B3T H;  3HOU B;  4OWT B;  2PN1 A;  2HT1 A;  1EY4 A;  4P2C B;  3K81 C;  4DNI A;  5C1O A;  4XYQ A;  3M4Q A;  1X3E A;  3CCQ A;  5FLX E;  3A7A B;  1BBU A;  4DGZ A;  4DV3 L;  5IYB G;  2F0M A;  5COR A;  5EBD A;  4A3G B;  1G91 A;  3T1Y Q;  3KHH A;  3G7L A;  3PUW A;  2AWN A;  2IT1 A;  3DMU A;  3Q2O A;  4DV1 H;  4FF1 A;  3GV3 A;  4Q0F A;  2RA4 A;  2Z6B A;  2YZN A;  4NXN H;  2J9G A;  3DUZ A;  4KHP H;  3GDE A;  5FLM G;  2R86 A;  1ZQ7 A;  5L1I A;  2M05 A;  3H4D A;  3PVX A;  3N43 B;  2F0U A;  3NEL A;  5T1I A;  5T14 A;  5HGQ A;  4DV1 L;  4DV0 Q;  4C3J H;  5IP9 G;  2K4K A;  3CXC A;  4JI8 L;  5CR3 A;  3SEB A;  2DN8 A;  2V58 A;  4NXN Q;  1EYG A;  4LFB L;  4KHP Q;  2M2L A;  4QUC A;  4POG A;  1NBW A;  4DNR B;  1TWH B;  2KCM A;  1MJC A;  4YCV A;  4XIG S;  1YNX A;  4HAE A;  2RDJ A;  1KTK A;  2NVY H;  4BY1 B;  5FJ8 G;  2EJG C;  3DM1 A;  3OPO A;  4QF4 A;  4IZ8 A;  3J7A V;  3ULP A;  4PG3 A;  1AUX A;  1YJW A;  4JI8 Q;  2HJW A;  3MWM A;  1PFB A;  4WJW A;  3EPG A;  3NBH A;  1O7Y A;  1YNN C;  2YTY A;  1A62 A;  5E7N A;  1EQR A;  1KJI A;  1WTH A;  3PIO 3;  3LWB A;  1KLU D;  3V6J A;  3EBE A;  3LP8 A;  1SSO A;  4RNM A;  4IRC A;  5C4X B;  3U50 C;  4O2B F;  1RIP A;  4JI8 H;  1S5B D;  2E2J H;  2AWO A;  4YQW A;  3MTS A;  4TRD A;  4LF5 L;  5CV6 A;  1PH1 A;  3UDX A;  4O3N A;  3E9I A;  4EQN A;  5KG1 A;  5IGF A;  4CDD C;  4ED6 A;  5DEH A;  3E9H A;  2IWH A;  2FMC A;  3QR8 A;  2R7Z B;  3NSW A;  4RG1 A;  4JI7 H;  1SXT A;  1IKL A;  1GUW A;  1K3B C;  4N8X 1;  1A3U A;  2TMP A;  2XTI A;  1LTA D;  4A93 G;  1MHW C;  5C8Y F;  2E2I B;  1GHK A;  1LTI D;  1WTP A;  1Q82 C;  5KFR A;  1SND A;  4UHV A;  1VQ6 A;  3HG9 A;  1QVG A;  3RFC A;  1SMY D;  4AYB G;  1N34 H;  3RD4 A;  2OCE A;  4A3I G;  4LF9 L;  1NR4 A;  1ESR A;  2EYP A;  1N32 L;  2AQ1 B;  1K8G A;  1F2Y A;  1KLG D;  2E2J B;  3I4N H;  5EOY A;  3HEJ A;  2R93 A;  3JSL A;  3NK9 A;  3RUP A;  5HY6 A;  4FO2 A;  1WJJ A;  4QGU A;  3U9O A;  5G3L D;  2XCA A;  4ULL A;  4YWL A;  1HFG A;  4O2A F;  3AMU A;  2B2Y A;  2RCF A;  1IYV A;  1I94 L;  2A74 C;  1BQQ T;  1PTO H;  3VYT A;  2SNM A;  3E5S A;  3H40 A;  2YYA A;  4EGJ A;  1Z2N X;  2ZXP A;  4LFA H;  1PVO A;  2B8G A;  4DAM A;  1UC9 A;  5H1S E;  4L8J A;  3BAB A;  4K14 A;  2ASD A;  4QW8 A;  4DK3 C;  2PCF B;  3HRZ C;  4IUQ A;  4GC7 A;  3GID A;  1JCK B;  2BA1 A;  4IUU A;  2GA4 B;  4DLK A;  1BNC A;  3AEV A;  3J7Z C;  3HZX A;  4DUZ L;  1K28 A;  1L2F A;  3FKI B;  1RL2 A;  4GKK H;  1XPO A;  2M9V A;  5G3L F;  3K7A B;  2EYM A;  1P8L A;  5JEA G;  1TVX A;  2OWO A;  1TII D;  4X62 Q;  4LF8 L;  4P74 A;  3OW7 A;  1Q3L A;  2IJ0 A;  5C3X A;  2SOB A;  1VBG A;  3F2U A;  3AFQ A;  2RGV A;  1VQF A;  3UE0 A;  5DLF A;  4MTD A;  5DGB A;  1V43 A;  1OWT A;  4MTK A;  4IRK A;  4K8I A;  5EAY A;  1VQG A;  1O7L A;  2N55 A;  4EQP A;  2E2I H;  1D5M C;  1PK8 A;  2ZJT A;  3BAA A;  3ORR A;  4JI1 Q;  1JWM D;  3I4M G;  3PW7 A;  4GKJ H;  4OIK A;  1JB7 A;  1AEX A;  4F4X A;  5KFL A;  1O80 A;  4KK7 A;  4K5V A;  3BZD B;  3I8Z A;  2IHF A;  3U4Z A;  3RLN A;  2ALZ A;  2J6U A;  1I6V C;  3F2C A;  2CQY A;  3V96 A;  1PZJ D;  1KD1 C;  2AHO B;  4B3M L;  1WFQ A;  2Z4I A;  3I72 A;  3GIQ A;  4K2L A;  3PF5 A;  1HA5 A;  5KG0 A;  1M6V A;  4J9O A;  3DWA A;  1D5X C;  2DJF C;  1CSP A;  3VR6 A;  1M4V A;  3JAM L;  4DR1 H;  1BCP F;  1S03 G;  3BYY B;  3S1Q H;  2MFI A;  2JA8 H;  2CZG A;  3R5X A;  1NTG A;  3GIK A;  4JVZ A;  4IUT A;  3HKZ G;  4GKJ L;  4IJL A;  2MHV A;  4IRD A;  4HJ9 A;  3GTQ H;  5IP7 G;  3R93 A;  1EQQ A;  2PPB C;  1OTC A;  3ONA B;  2K5D A;  4DF7 A;  5FOB B;  1K83 H;  3FHW A;  1KC8 C;  3UE1 A;  1CHQ D;  1HCZ A;  1LAB A;  1LAC A;  3L0O A;  3J7A F;  2YL2 A;  5KFV A;  3NGD A;  3V4S A;  1STG A;  1SRO A;  1X9N A;  1BCP C;  1U4R A;  4G7O C;  4S3S A;  5DLQ E;  2JA5 B;  1XWE A;  1JJG A;  4E4T A;  4CHT B;  2F4V L;  5J2U F;  4HN7 A;  3K59 A;  2UUC H;  2F0W A;  2XN9 C;  2UUB Q;  3VPB A;  4A4I A;  5KFM A;  4BBR B;  3S16 B;  3M4P A;  1HR0 Q;  5IY0 A;  3DXJ C;  5D14 A;  1D5Z C;  1YI2 A;  2K52 A;  2BQ3 A;  3VR3 A;  1EY9 A;  3T56 B;  4DV4 L;  5EWF A;  5BPH A;  5A2Q L;  1ZHS A;  2AUK A;  4KHV A;  3PUV A;  1J5E L;  4A2B A;  5LHY 1;  2RDG A;  5C3E B;  1TA8 A;  4ECX A;  1PFN A;  1SRU A;  4YAK B;  3K5O A;  4DL4 A;  4DR2 H;  1TWC B;  5CGK A;  1K9M C;  1I94 H;  4A93 H;  2N8N A;  2ZJR A;  4ME6 A;  2I5H A;  4ZAI A;  2Q2T A;  3U58 A;  1VQD A;  3U9T A;  2CH4 A;  4IFD H;  3T53 B;  3KAK A;  1FYC A;  2L5T A;  2J6T A;  2C9O A;  4O4I F;  5K36 H;  1P16 A;  4MTE A;  4GOP C;  4A3B G;  3E0J A;  3TQT A;  3Q6S A;  4O4H F;  1GYF A;  4CBV A;  4NMZ A;  4HJ7 A;  1LUZ A;  1M7J A;  1Y1V G;  3QJY A;  2AQ2 B;  4AYB E;  3EJI A;  3W3A A;  1ENC A;  1AUV A;  2NWG A;  3A5Z B;  2W8L A;  4ECQ A;  1JKJ B;  1XJV A;  2O5J C;  4DUZ H;  4IOA A;  1JIC A;  4I7Z C;  1G2S A;  1BXR A;  4Y52 H;  5KFK A;  5C44 H;  2A68 D;  1I6H B;  1FKA H;  3PW5 A;  4NB3 A;  1E0B A;  3P75 A;  1Z47 A;  2KA7 A;  3VYU A;  5EQ0 A;  4A3E B;  4C3H B;  2ICE C;  1BR9 A;  3GV8 B;  4HCE A;  5KFZ A;  3NXW A;  4JI0 L;  1Q86 C;  2XIW A;  1S0O A;  2ENB A;  2HHH Q;  1KAA A;  3NWT A;  4FXK C;  5JH7 F;  1S5C D;  3CCU A;  1TS4 A;  2F0O A;  1L2Z A;  1XYI A;  1DIK A;  3R8B A;  1JOO A;  5KG5 A;  1NUC A;  4NXM L;  4APV A;  3HOY H;  1HUM A;  2K6A A;  1M0T A;  4KKS A;  4XYO A;  4WBN F;  4AQY Q;  3S15 H;  4A3D G;  3LWU A;  4CDF C;  3N8D A;  3B6Y A;  3Q0A A;  3K0X A;  1I4P A;  1FL0 A;  1ZEQ X;  2BQU A;  3M4O B;  1GUO A;  2K75 A;  1CK1 A;  3K80 C;  1ET9 A;  2ZM6 L;  1PH5 A;  4LF5 Q;  3IN5 A;  2CH4 W;  2UXB H;  2R7Z A;  1G8Z D;  5KT3 A;  2JP1 A;  5IYB H;  3PZP A;  3N42 B;  1QUQ B;  3G6V A;  1GD7 A;  4A3C H;  1JX4 A;  5IWA H;  2ZM6 H;  3L3O C;  3RB4 A;  5FPR A;  5FO7 B;  4LFB Q;  5I9P A;  1QOH A;  1KJJ A;  3NBI A;  2UXB Q;  3Q24 A;  1X3F A;  1G51 A;  3NTK A;  1SYE A;  3OUZ A;  2PZT A;  2OEO A;  3N6X A;  4EQO A;  4HJ5 A;  2F3W A;  3OUU A;  2IW3 A;  2W70 A;  1IW7 C;  3K57 A;  2KEC A;  3I4O A;  5KFF A;  1YHA A;  2E5L H;  1C48 A;  2N78 A;  2K33 A;  2V4D A;  5IT9 W;  1HZA A;  2WAQ A;  3NBH B;  4GOP A;  2D62 A;  1Y1W H;  1L1O B;  4ZK9 B;  5IP7 H;  1QZG A;  1S0M A;  3BVZ A;  4CJ2 C;  3PGZ A;  1HQM C;  3PIP A;  2WE6 A;  4G3I A;  4RU9 A;  4BBR H;  3S16 H;  3K3V A;  3PW0 A;  3K0Y A;  1PTO D;  1QWY A;  4B3T L;  4DV3 H;  3CMA A;  1K0R A;  4OO1 I;  1AZP A;  3P1H A;  1X56 A;  2WFW A;  2X6G A;  1E4E B;  1OXX K;  3U4V A;  4JI4 Q;  4WOR A;  2V4Q A;  5DM7 3;  1QG7 A;  4I50 F;  3M9O B;  2B2V A;  4FP5 D;  1UUP A;  4CKC A;  3H4B A;  4DV6 L;  4JBM A;  4I7H A;  4CJ0 B;  2L15 A;  3HKZ E;  4JK1 C;  5M5Y H;  4DR6 Q;  1TS3 A;  2YU9 H;  3C46 A;  1PYS B;  1SFO A;  5BN5 A;  1EYD A;  3KYH C;  1S5D D;  4ZI7 F;  5A2Q W;  4O1N A;  1I7L A;  3JRW A;  2ATL A;  2HVS A;  4R9W A;  4DV6 Q;  2RHS B;  2X69 A;  4LF9 H;  2SNS A;  3IG0 A;  2BQR A;  1NR2 A;  1PH8 A;  4LW1 A;  4Q43 A;  3NPP A;  5L1K A;  1BCP B;  5KT6 A;  4NW2 A;  1E2W A;  2NN6 H;  3K5I A;  2QKI C;  2K32 A;  5J39 A;  3GTL H;  4HSV A;  5IIF A;  5FO8 B;  2R8K A;  2VQD A;  1HJP A;  1K8M A;  3FKI G;  1EIH A;  3D31 A;  1B8A A;  1S4Z A;  4B08 A;  1WCM A;  3OTO H;  3TDQ A;  2CW8 A;  3HB9 A;  1F9S A;  2B2T C;  1CKO A;  2C5C A;  3PQI A;  2J0T D;  2KHS A;  1PLF A;  4MNO A;  1UEB A;  2EZV A;  2MNA A;  5IGD A;  3J80 W;  2XGQ A;  2F4V H;  2FXQ A;  4BBS B;  4A3L H;  1GVP A;  3NEN A;  2PW5 A;  3MAQ A;  1R9T B;  3CQZ A;  2FE3 A;  3PMF A;  1GSH A;  3M3Y H;  4C3H G;  1EEF D;  4O42 A;  4YCW A;  4GNX A;  3L4K A;  1IBL H;  4U7C A;  2F0S A;  1I6H H;  4XYL B;  2NVQ H;  1I4H A;  2NTS A;  4ECV A;  5I6W A;  1IL8 A;  3KK7 A;  4TKO B;  3H0G H;  4C2M A;  4QW9 A;  3GII A;  1N34 Q;  4KN4 C;  1SBB B;  1LLR D;  4LK1 C;  1SE4 A;  3CCS A;  4B3S H;  3CRL C;  1IBL Q;  3K58 A;  1CZG A;  3GTO H;  4I7A A;  3OSP A;  1E7Z A;  2F0F A;  3DEP A;  2RDH A;  4ECT A;  2B39 A;  3GD7 A;  5C4X H;  3MR6 A;  2TSS A;  3CC2 A;  5I2X A;  1A8V A;  5FLX c;  4JBJ A;  3RNU A;  1WTW A;  1GUN A;  2XD4 A;  2EPB A;  2RSO A;  4DR4 Q;  4GOP B;  1KC7 A;  1LTR D;  2LKV A;  4JC0 A;  2XSC A;  3RLF A;  2R8J A;  2R7L A;  2W57 A;  2NU9 B;  1B50 A;  1W2B A;  1TWC H;  4YR0 A;  3UDF A;  2UXC Q;  4AIM A;  5DNF A;  3G4S A;  1Q8I A;  1M90 C;  4DV5 H;  2B8F A;  3AU7 A;  4DFA A;  2G9D A;  1WTO A;  4QWE A;  2WKD A;  5I4D A;  4BY1 G;  4A3K B;  2W6Z A;  3DHQ A;  1YZ6 A;  3R5H A;  1PRT D;  4DK0 A;  4EVO A;  2WB1 A;  2VQE H;  5D3I B;  1KDC A;  2B63 B;  2I07 B;  4LMQ D;  4DV5 Q;  3ND9 A;  5KGU A;  1HNX H;  1X3G A;  4GKK Q;  2EIF A;  3OWE B;  1CTM A;  3I4M B;  4DR5 Q;  2CFM A;  2VPQ A;  1IBK H;  2CVR A;  1T94 A;  2ASB A;  1A2T A;  3SVM A;  5KG4 A;  1PRT B;  3GTQ A;  2UVU A;  1BBX C;  3CVZ A;  1RHP A;  3MXG A;  3LWE A;  5FPO A;  1MD2 D;  3TSS A;  4FF4 A;  4RWS C;  4IN3 A;  3A5U A;  4F4Z A;  2XIG A;  3BU2 A;  1Y1V H;  3OYY A;  1Y8O B;  4H7B A;  1SR3 A;  1H9M A;  2KHJ A;  1PH9 A;  4WJ4 A;  1PRT F;  1SMY C;  1UNN C;  4MV9 A;  2J6S A;  4RGT A;  5GRO A;  1XNR H;  4IUV A;  3T4A C;  1X3P A;  1QUQ A;  3FP9 A;  4DN4 M;  4OON A;  3CHB D;  2JA7 A;  3HKZ B;  3T51 B;  3C2P A;  1U4M A;  1CKN B;  1XNR Q;  1Y8N B;  3GTK A;  4QWD A;  2AGO A;  5KFA A;  5M5X B;  4Q8F A;  3N41 B;  3TBI B;  5CV7 A;  1VS0 A;  3R23 A;  1HNW Q;  4QY7 A;  5IYC H;  1HZ9 A;  2EYL A;  2K5N A;  3FDT A;  4O0A A;  4IFD I;  4N8F A;  2NZ1 D;  1LT3 D;  1F77 A;  2VUM H;  3PUZ A;  4LF6 L;  1KL9 A;  3UDG A;  3BJU A;  1HNZ H;  4YHH Q;  4A3G G;  4X65 L;  1IBM H;  2UVR A;  1V9P A;  3T1H Q;  4L5R C;  2F0E A;  2NVX A;  1L1O A;  1EZ1 A;  3J7A K;  4AYB A;  1M1K C;  4QCL A;  2QK4 A;  3RBE A;  1N32 H;  4YWM A;  3RR5 A;  4EG0 A;  4JOI A;  4QUF A;  4O2D A;  1XMO H;  2BH8 A;  4JI6 L;  1I4X A;  2F03 A;  4RB3 C;  2VQF L;  1Z6H A;  5FJ8 H;  4RNO A;  4DL2 A;  4BA1 I;  1QB5 D;  2F0G A;  4PQX A;  3BDO A;  3Q8P B;  2DPI A;  1CKN A;  5KT4 A;  3I2Z A;  2OQK A;  4KKT A;  1STE A;  3HS0 C;  3J81 W;  1D6E C;  4EX5 A;  2E2H A;  3BZC A;  4TQU S;  4YY3 Q;  2WAQ B;  3DLL A;  1B2T A;  3STB D;  4ALP A;  5GAD C;  4RFB A;  1B9N A;  3CP0 A;  2UUC Q;  1C30 A;  1UAP A;  1RD9 D;  1IW7 D;  1HNZ L;  5DQG A;  3S2D H;  2DWC A;  1GXD C;  3D6C A;  2JA7 H;  1RK6 A;  3BA8 A;  3KLR A;  2NN6 I;  1B70 B;  5M3F B;  3VPC A;  5A35 A;  1IOV A;  1EYC A;  2A6H C;  2PYK A;  1FJG H;  5I2Y A;  2BH2 A;  3RIZ A;  3CQZ B;  5C4H A;  4JI5 L;  4R4O A;  1HR0 W;  4LSA A;  5KG6 A;  1MI2 A;  4B3R Q;  4LJZ C;  2FJZ A;  1VQE A;  1STN A;  2ZTE A;  4OXP A;  5CYU A;  5CC4 A;  2W71 A;  3DF7 A;  4OHJ A;  3KHG A;  3K5N A;  1C3O A;  4J9L A;  2BE5 D;  1QVF A;  2R93 H;  3ND8 A;  1KNA A;  1YNJ C;  1FJG L;  4O3R A;  2NBF A;  4JI5 H;  3CRK C;  1BJT A;  3A55 A;  3WO1 A;  2O4X A;  2RDI A;  4YR3 A;  1OXV A;  4MIU A;  3MFI A;  3WOE A;  4ABN A;  2QYZ A;  2W9B A;  3CCE A;  2QGQ A;  3JAM E;  1WTX A;  2AQ4 A;  4XZ3 B;  1Z2O X;  3D3R A;  4QJF A;  4KHZ A;  2F0T A;  1EIF A;  4A3J B;  1PMR A;  2X0S A;  4PDB A;  1VQI A;  3I4N B;  4LFC H;  1CT1 D;  5C6A A;  1LTB D;  4MN3 A;  4RAZ A;  3CCV A;  5F2D A;  3G6E A;  1IL2 A;  4A3L G;  2PVP A;  4ED8 A;  4IWY A;  3RAX A;  2MUY A;  3KAL A;  3T5J A;  5C0X I;  2GPW A;  3FVQ A;  2F3I A;  5M5W B;  4K0K L;  5LOV F;  4EQ5 A;  4LF6 Q;  4AYB B;  5JJL A;  3S1M B;  1HNX L;  4HIK A;  3HOW H;  3ULJ A;  4TUY F;  4J1M A;  2VQF Q;  3HOW G;  5EKI A;  2VZA A;  2NB0 A;  2KJX A;  3M7N A;  2PBZ A;  5CAE B;  1IBK L;  1N8R C;  4HQ6 A;  5KFT A;  3MXN B;  1F9Q A;  4OWX B;  1BGW A;  2FP4 B;  3A0J A;  1BF4 A;  1HQR D;  1NMG A;  4DAY B;  5DLG A;  1VQA A;  3ZJY C;  1V1O A;  4ID6 A;  2A6E D;  4MTN A;  1ASZ A;  3V2T A;  4CJ1 B;  3IAY A;  4C2M B;  4LF4 Q;  4U67 3;  2DNC A;  5IGB A;  3UDI A;  2DY8 A;  4BS9 A;  5H80 A;  2KEE A;  2WTF A;  1ZXT A;  1LTS D;  2I5M X;  3G48 A;  5LMU Q;  4GN4 B;  2IX0 A;  3TN2 A;  4B3M H;  3JC6 6;  4HSP A;  1XDN A;  4UAI A;  4LWC A;  2K50 A;  5KFI A;  4ECZ A;  2OT2 A;  5GQO A;  2EQS A;  4DR6 L;  1SNP A;  1R9T A;  1SNQ A;  2HVQ A;  2R85 A;  3E3X A;  5E1F A;  4LF4 L;  2C22 A;  5IT9 E;  4BY7 G;  5IWA Q;  1EUC B;  2R93 G;  5KFO A;  1ESF A;  1AP0 A;  1RTN A;  5KT7 A;  3PR4 A;  1DYQ A;  2GVA A;  1MSG A;  4RGN A;  2W6P A;  4DXF A;  4FYD A;  2GN5 A;  1TWF B;  4R4T A;  3H15 A;  3H20 A;  1T3N A;  2B63 G;  1YHB A;  1FVI A;  4UP9 A;  2HQL A;  1WTR A;  1I4R A;  5J3B A;  5D1O A;  5CBA E;  3C1F A;  1Q8K A;  1KRT A;  4YB8 B;  3GQC A;  4EYH B;  3GTL A;  2PI2 E;  4RHS A;  1EOT A;  3GQB A;  3EPI A;  1JT8 A;  1GLV A;  3NTH A;  4RKL A;  4O3Q A;  3OTO L;  2JA5 A;  2FMA A;  1U5K A;  3C1E A;  2KVM A;  4DV5 L;  2R92 G;  2NVT B;  4JUZ A;  4KY5 A;  3L7Z C;  3R2T A;  1PFS A;  5DM6 3;  1R4Q B;  3F1Z A;  4YR2 A;  2YW2 A;  5AJ3 Q;  1SFO H;  1TKW B;  4RAY A;  2VUG A;  4JI4 H;  5KFH A;  2R92 A;  1TQO A;  5LMN W;  1E4G T;  3I4N G;  1UE1 A;  1JB3 A;  1EZ8 A;  1SNM A;  1ZYR D;  4C5B A;  3MFY A;  4KD3 A;  3QOL A;  2W7O A;  5CV8 A;  2OQ0 A;  4QMG A;  3VA5 A;  1R9T H;  1NJI C;  1XNQ Q;  2UXD L;  2JJQ A;  4Q5V A;  5KFQ A;  4HYK A;  4CKB A;  1S40 A;  3KHR A;  4RGO S;  3KOJ A;  1EYZ A;  2JE6 I;  1K73 C;  3VA7 A;  3CW2 C;  1YHQ A;  3GTL B;  4DR6 H;  4MV1 A;  4JW0 A;  3BS1 A;  1N36 Q;  1Q1B A;  3HKS A;  4RCN A;  5TSS A;  1CM9 A;  2W6N A;  1EFW A;  3KLW A;  2MO1 A;  3LX0 A;  2CQO A;  3MR3 A;  1L1O C;  3JAM i;  2KOL A;  1UE7 A;  2C2R A;  1PRT C;  4R1J A;  5I9O A;  1VAJ A;  2R92 H;  4LNQ A;  1QE6 A;  2YV5 A;  4EYI B;  1RJR A;  4ZHQ F;  2R7F A;  3EQL C;  4C3J B;  5EKL A;  1K1Q A;  4EGV A;  4RZQ A;  4DV0 L;  4GNX B;  2YS7 A;  5KT2 A;  2A68 C;  3EN2 A;  2WB1 E;  1HRJ A;  3S1R H;  2UU9 Q;  2D0P A;  4A3F B;  5IP9 H;  4WRD A;  4RB0 A;  1AN8 A;  5KYI A;  4G7H C;  4ECY A;  1PH6 A;  4ECR A;  4DR7 L;  2FB9 A;  4A75 A;  3K7U C;  5AJ3 L;  2W9B B;  3HOU H;  4JBW A;  2FKL A;  3I56 A;  2EY5 A;  4JI6 Q;  5LL6 X;  4JI3 L;  4V19 0;  2OLS A;  1NSN S;  3TS2 A;  2MPM A;  1E1O A;  2A1A A;  5D1P A;  3VMM A;  5EJW A;  3T1Y H;  2K05 A;  1AE3 A;  2R7Z G;  5ELD A;  3D0F A;  4Q8E A;  3GV6 A;  1BKB A;  2K01 A;  1PZI D;  1TWA H;  3KF8 A;  3HOX H;  3H3V C;  3M4O H;  4R8U B;  1T36 A;  3I73 A;  4XXE A;  1KIX A;  3LNN A;  4EFE A;  1H9S A;  5KFY A;  1F2L A;  4FXG C;  1TWF H;  2MQH A;  2A5H A;  4LSX A;  5GAH C;  1W6K A;  1YIJ A;  2FLP A;  2C28 A;  2I0Q A;  3ZYY X;  5LMN Q;  1L0X B;  2QCP X;  1L0Y B;  1CQI B;  1R4P B;  4LFA Q;  4R4I A;  1TY2 A;  3H3V I;  4C1N K;  1CS0 A;  2KUM A;  4UCR A;  2PQA B;  2IA6 A;  3TME A;  1PV4 A;  3ER0 A;  1OXU A;  2UUA H;  3PUY A;  3Q8D A;  2WAQ G;  4GLA C;  2JA8 G;  1JWS D;  4Q44 A;  5L1L A;  3C3L A;  2D0O A;  2NUA B;  2OTL A;  4ECS A;  1XXG A;  5LMU L;  2UXC H;  4YCU A;  1O7Z A;  2IP4 A;  1VQN A;  1Q46 A;  2ZDQ A;  3A7L A;  1S5F D;  3F8T A;  4C56 C;  2IHE A;  1MKH A;  1B3A A;  1PTO C;  1XX8 A;  2YZG A;  2VPS A;  3TZU A;  2EXZ A;  4K0K H;  5JEA J;  4EEY A;  2VS1 A;  1SEB D;  2VQE Q;  3BVG A;  3GTM B;  3UQ8 A;  3I70 A;  4P71 A;  1FD7 D;  4IUN A;  3TRE A;  5FK9 C;  3GP7 A;  3GTJ A;  2BCO A;  4GN3 B;  2F0I A;  1BO0 A;  3HOY B;  1HPC A;  3OSO A;  2EYO A;  1EL0 A;  4B9W A;  5T1G A;  1EZ6 A;  5BN3 A;  4KI0 A;  1W3S A;  2UXC L;  2W6Q A;  5JUM A;  3AYH B;  3J7Y W;  1EU4 A;  3C0F B;  3PF4 A;  4PMW A;  2UXB L;  5DQH A;  1IBM L;  1KDB A;  2P5Z X;  4HID A;  1KRS A;  1AE2 A;  4Q0Y A;  1N56 A;  4GNX C;  4X6A H;  3BZK A;  3J80 L;  1XMQ H;  2XRQ D;  2ZXR A;  5M3M B;  5CV5 A;  1TAE A;  4MV6 A;  2HHH L;  1C0A A;  2PI2 A;  1IKM A;  3FKI A;  4JI0 Q;  1IHZ A;  5KG7 A;  2YZM A;  4DU9 A;  2CW0 C;  1S72 A;  4Y7N B;  5DG7 A;  2CWA A;  4TQS A;  2M00 A;  3A8I E;  1VQM A;  3A8K E;  1CQJ B;  1VQB A;  5IT9 c;  1UEA B;  4DKA C;  1GO3 E;  2AQ3 B;  4FNF A;  2RGR A;  2JA6 A;  5BR8 Q;  3VYS A;  2E75 C;  4R8I A;  3CC4 A;  3W2D A;  1AN7 A;  1I3Q A;  1A2U A;  2N3S A;  4FU0 A;  2HD3 A;  1HNZ Q;  5LXT F;  4P75 A;  1WSC A;  2AGP A;  3CCR A;  1VQ9 A;  2DY7 A;  2JA6 G;  1U9R A;  1PHJ A;  2EVB A;  2E2I A;  2BDN A;  1SYD A;  4KMU C;  2GPS A;  1HXY D;  4XQN A;  4X65 Q;  1VMC A;  2NU8 B;  4YHH L;  4LUV A;  1B4O A;  2CWP A;  3E0E A;  4JYA L;  3GTJ B;  3KTM A;  4UCO A;  2RHQ B;  2N88 A;  5EGT A;  2ATW A;  4JI2 Q;  2KEN A;  4BBR G;  3GIJ A;  4UCV A;  4KTA A;  4IPH A;  4LAA A;  2B2V C;  5LYJ F;  3GTM A;  1HA6 A;  3J7A 5;  4A3M B;  4HJA A;  2CQA A;  4ZKB B;  4X65 H;  2BR0 A;  2W9C A;  1WH2 A;  4J15 A;  4JI2 H;  4U68 A;  1G29 1;  4F4Y A;  3NWS A;  4DNT B;  2LFN A;  2VQE L;  1E22 A;  4J9K A;  2IL8 A;  1RJQ A;  2B2U C;  1V1Q A;  2L55 A;  5M9O A;  5HV6 A;  5BN4 A;  1VQ5 A;  1O75 A;  2O03 A;  5KG3 A;  1MZB A;  1I5F A;  2NVX H;  5LA6 F;  1I94 Q;  1TS5 A;  1QNK A;  2RCN A;  4H02 A;  3G8C A;  5C0X H;  3G6X A;  2VUM A;  2F4I A;  2WB1 G;  3KXY T;  4DV4 H;  4XYM B;  2F0H A;  2HDL A;  4O3S A;  4LF7 L;  4CC5 A;  4XDX A;  2A69 D;  3MA2 B;  4FDB A;  3KDF A;  3HOW B;  1AFP A;  1VQC A;  3OHB A;  3GTO A;  1JC7 A;  1TR5 A;  3P7J A;  4DUY L;  3PO3 B;  3WOF A;  3ERO A;  2VUM G;  3GTK H;  1PYB A;  3SE7 A;  2F0K A;  3RN2 A;  3QFF A;  4LUO A;  3T16 A;  2HCC A;  3D6W A;  1XMQ L;  4JI2 L;  2FPG B;  2JEA I;  1N33 Q;  2RF4 A;  3S1Q B;  4LH6 A;  2FLN A;  1BOS A;  2IX3 A;  3ERQ A;  3MJF A;  4YWK A;  1VQH A;  2UUB L;  1RJT A;  1XMO L;  2MGS A;  1B7Y B;  5M3F G;  4LFC Q;  1Q1E A;  3OMC A;  1SE8 A;  3MWD A;  1Y14 B;  1CQV A;  2EY6 A;  4BWG B;  3I12 A;  5ELC A;  4JV0 A;  5JPN C;  1SN8 A;  2HCI A;  2DPJ A;  1S0N A;  1XTC D;  1KEE A;  4RA8 A;  1YJN A;  1WCM H;  4I55 F;  3GIM A;  1MSH A;  3DWP A;  1GSO A;  4LUZ A;  5KFN A;  3CCM A;  2K03 A;  5DGA A;  2VR1 A;  3TZD A;  2Y0S G;  5KIX A;  4DV7 H;  4DR5 L;  4G57 A;  1SMX A;  2QA4 A;  3SXH A;  3D8G A;  1PZK D;  3J81 L;  1SE2 A;  2Z6K C;  4JPB W;  2XCL A;  4UDU C;  2ALY B;  1PYW D;  1RF2 D;  5NUC A;  4RH6 A;  1F2M A;  3EA6 A;  3TP8 A;  4BY7 H;  2JA6 H;  2I8C A;  1PTO F;  4DK1 A;  4ED1 A;  4J9N A;  3LML A;  5IYZ F;  1U4P A;  3OW2 A;  3GTK B;  1OO9 B;  2VOB A;  2F0Q A;  2UUA L;  4IPD A;  1TWC A;  1JOQ A;  3HOV G;  4L5S A;  4JV5 L;  1LYL A;  2KED A;  2UXD H;  4E6I A;  4FF3 A;  3H0G G;  4AQY L;  4BY1 H;  1M0W A;  1EWI A;  4HMI A;  1DV1 A;  3FPU B;  1TWF A;  2F52 A;  5E4X A;  4MAM A;  5BPF A;  1JDE A;  1YJ9 A;  3NP8 A;  3V05 A;  3F2B A;  1LT6 D;  5EWG A;  3SHL A;  1XNQ L;  1FGB D;  4BA2 I;  2UXD Q;  3H0G A;  2QW7 A;  2E5L Q;  2R6G A;  2WAQ E;  3SGI A;  1EWH A;  4DV1 Q;  4AH6 A;  4ZYS A;  4LF8 H;  3J80 E;  1KJ8 A;  1B44 D;  1IBL L;  2BDO A;  5F9L A;  4F87 A;  2L11 A;  2QIL A;  1EY8 A;  4DV0 H;  1I7N A;  1DOL A;  1A3V A;  2LSS A;  5EDW A;  4C2M H;  1B9M A;  2A6H D;  3J81 E;  3BDL A;  3FRP B;  4UFZ A;  4Z9C B;  4DL5 A;  1EWC A;  4NKL A;  1A9X A;  4QL5 A;  5D3D A;  3FPP A;  4DUZ Q;  4KJN A;  1EY5 A;  3I91 A;  2K28 A;  3TP6 A;  4F7X A;  4UPA A;  2H1E A;  1UNS A;  4DAY A;  1KAB A;  5LMN L;  4C3I H;  1K8A C;  1D7Q A;  2FK3 A;  2R61 A;  1V4Y A;  1VF5 C;  3BVM A;  3BG5 A;  1Y1V B;  3N6R A;  5ELO A;  1GOZ A;  1PDQ A;  3CU7 A;  2OXP A;  3FMC A;  2DGY A;  3UFX B;  2D5D A;  3CAM A;  2HHH H;  4A3K G;  2N49 A;  5D65 A;  1ULZ A;  2KHI A;  5C5J A;  1CKM A;  4EBD A;  4JI4 L;  2JA7 B;  1JJC B;  1X54 A;  2JK8 A;  5CBE E;  2EXD A;  4K6L A;  4DV6 H;  5IWA L;  2F0L A;  5ELB A;  5CMD A;  3KLS X;  1KQS A;  4LF9 Q;  1UC8 A;  4A3I B;  3R5F A;  3V4Z A;  3OSN A;  4ED0 A;  2JEJ A;  4DAP A;  4AQY H;  3T5L A;  3RB6 A;  3BQ1 A;  4DV2 Q;  5JEA H;  1FNV A;  3PO3 H;  3M9B A;  4XT1 B;  3RB3 A;  1HUN A;  5JVL A;  1J5E Q;  2IPK D;  2AU0 A;  1FR3 A;  5IGE A;  2Z9H A;  1CA5 A;  4IZO A;  1Z9F A;  2RVL A;  1Z2P X;  4A76 A;  5KT5 A;  4TV8 F;  3SK8 A;  3HXL A;  1JE4 A;  4A3K H;  4F88 A;  2JA7 G;  3V6K A;  4DV2 H;  1X65 A;  2GVB A;  2R8G A;  1S5E D;  1XTD A;  3S17 B;  1J5E H;  1JJ2 A;  3K8A A;  5FD5 A;  2YRX A;  4B3T Q;  3KHL A;  5C5M A;  2W9C B;  4BXX H;  3RAQ A;  2VB3 X;  4IQZ A;  1IXR A;  2F4V Q;  4JI7 L;  1ZHQ A;  2EOT A;  2DNE A;  1J6Q A;  1JE5 A;  2ZT9 C;  3EFX D;  2E5L L;  2EJM A;  2NVY B;  2Z6K A;  4L63 B;  2A6E C;  1BBW A;  2PW7 A;  3NTI A;  5CV4 A;  5C44 B;  5KFU A;  2F0P A;  3Q8Q B;  4ZLT F;  1K83 B;  4ZRZ A;  4M1U B;  2K5Q A;  1QCB D;  5JJZ A;  1TWH A;  2KSW A;  4A3M H;  4ED7 A;  1NAP A;  1S3O A;  3RZO H;  1EU3 A;  2PQE A;  4NDX A;  4R8U A;  5KFB A;  1Y1W A;  2NTT A;  1JOR A;  5FO9 B;  2G9H D;  3R2I A;  1RYR A;  1WD1 A;  5JVH 3;  1STY A;  4OEM B;  4A3G H;  2J7Z A;  4JV2 A;  3BQ2 A;  4HTH A;  5EKK A;  1SYX B;  4HNU A;  4A3I H;  3U9S A;  3M4I A;  1Y1W G;  2NU7 B;  4HNT A;  1NNX A;  3MXU A;  2EYF A;  4IWX A;  4A3D H;  4UP8 A;  5C5L A;  2YCH A;  1Q81 C;  1A63 A;  3BQ0 A;  5KFG A;  3HOZ H;  1G2T A;  4WD3 A;  2RDF A;  4X3U A;  4FS2 A;  1ROD A;  4PZ6 A;  2A19 A;  1DV2 A;  1PX2 A;  2MCT A;  4Y8V B;  4HIO A;  3OIP A;  3RJ0 A;  4FS1 A;  3HOV H;  5LMN H;  3PR5 B;  2FJ2 A;  5AFW A;  4DR2 L;  1K8O A;  2ZDG A;  2Z0S A;  3L9A X;  2I5L X;  4ED2 A;  1L0W A;  1JXL A;  4J9M A;  4QIW B;  4K2K A;  2EYJ A;  2FLL A;  2PZW A;  1E2Z A;  2UUA Q;  1GJX A;  2R7Z H;  4J9Q A;  3HOX B;  1KBL A;  3T1Y L;  1B1Z A;  1JQY D;  3RZD B;  5CA1 F;  5C44 G;  3NQT A;  2JA5 G;  1B33 N;  4IAJ A;  4MV8 A;  1B6S A;  2C00 A;  3F8N A;  3I7F A;  2W7P A;  2HVR A;  2Q2H A;  1BDO A;  4GLV B;  3D4R A;  3TP7 A;  4M9U A;  3S1N H;  5D8D A;  3L4J A;  1FGU A;  3SE0 A;  1DCZ A;  1YEZ A;  3I55 A;  2B2Y C;  1YNN D;  2JEB I;  2K1B A;  3OOC A;  4DR5 H;  3HOU G;  5JPM C;  1EY6 A;  1BUV T;  2DLN A;  2A69 C;  1LTG D;  1DD2 A;  3FDS A;  1LO5 D;  5IYC G;  3ETJ A;  5KFX A;  3WNZ A;  4IR9 A;  4JI1 H;  4JI7 Q;  2E74 C;  2NU6 B;  4ZQI A;  3WWV A;  1SCU B;  1SYC A;  2J4X A;  2KBN A;  1KXL A;  2DUD A;  3MFH A;  2W6O A;  1U4L A;  2B3G A;  3GO5 A;  4PNY A;  1NE3 A;  4BBS H;  4EBE A;  4FF2 A;  2OH2 A;  1OXT A;  3GTP H;  2F0J A;  3PSI A;  2NVX B;  5M5Y B;  3T5H A;  3BG3 A;  2JEG A;  2D9U A;  2CHB D;  2W6M A;  3VPD A;  1Y8P B;  4KV6 A;  4JV5 H;  3OHX C;  2R84 A;  2YTV A;  3A54 A;  4DUY H;  2E76 C;  2HGS A;  4B3S Q;  3S1N B;  1RTO A;  3NUC A;  3VDY A;  1MJE A;  4OIJ A;  2VA3 A;  5CV9 A;  2DZD A;  2L4N A;  3OHA A;  1XMQ Q;  3GTG B;  3PN1 A;  1EQV A;  2JSO A;  3RZD H;  2FK1 A;  2EYH A;  4Q45 A;  3H0G B;  4DUY Q;  1W96 A;  5GON F;  2JEI A;  1TWG B;  1TT2 A;  4JI0 H;  2SEB D;  4A3M G;  4I4T F;  2GLT A;  4A3B H;  4ILW A;  2C2D A;  1H95 A;  1E4E A;  5KFC A;  4L5Q A;  2C2E A;  1VQ4 A;  3T1H H;  1VCI A;  1WTQ A;  1KNE A;  4XQJ A;  2E2H H;  2NZO A;  5KKN B;  4JYA Q;  3TEH B;  1V51 A;  3PW4 A;  4KN7 C;  5C3E H;  4M7E A;  1H9R A;  5I6Y A;  1JLL B;  2NVT H;  1KDA A;  3W1G A;  4NP5 A;  3ORQ A;  3H3V H;  1O78 A;  3OWF A;  1YVC A;  1VQO A;  1HR0 L;  3TIN A;  1M8A A;  3ICE A;  1S97 A;  4HJ8 A;  3OMG A;  4CKE A;  2ZJP A;  3PUX A;  3GTG A;  2NUC A;  2LMC B;  5FLM H;  4PWQ A;  2R3Z A;  4V0B A;  3DWQ A;  4R4Q A;  4C5A A;  3WO0 A;  5L37 A;  3G6Y A;  3V6H A;  1SDF A;  1T9H A;  2B2U A;  5F9N A;  4POF A;  4EFB A;  3GTG H;  3FKI H;  4QWC A;  1I3Q H;  4DR3 Q;  1F9P A;  4KJO A;  2FPI B;  1CFM A;  2PMZ A;  2NVQ B;  2FPP B;  3MR5 A;  2BE5 C;  1T5E A;  2JEF A;  1FJG Q;  3NQI A;  2LY7 A;  4GKJ Q;  1VMP A;  3GTP B;  2ICI A;  3X3M A;  1GKH A;  3CCL A;  1PH7 A;  4EGQ A;  4LMY A;  1ZET A;  1X3Q A;  1VKZ A;  1HTL D;  5KFW A;  5COY A;  1STA A;  4CDE C;  1A15 A;  3FMA A;  3M9N B;  4A3B B;  5LL6 b;  1V1P A;  1C8C A;  4DL3 A;  5EPL A;  2VW9 A;  4J9R A;  1DOM A;  2WAC A;  3RMH A;  3KJP A;  4C3H H;  4HR7 A;  3DM3 A;  5GAE C;  4PZ8 A;  3CC7 A;  1QZH A;  3CD6 A;  4ETS A;  5FLX W;  5K2M A;  2O2L D;  1A3T A;  1FNU A;  4M8A A;  2DJG C;  1I3Q B;  1Y69 U;  2IMW P;  2QDB A;  1SNO A;  3FEW X;  1HFN A;  1TWG A;  2QEX A;  1GUT A;  1UWV A;  3M9M B;  1SJE D;  2R7N A;  3L2P A;  3Q8R B;  3GTJ H;  5J1Z A;  4HIM A;  3TS0 A;  3KLS A;  5C4Z A;  4XX0 B;  5HUR A;  4YHH H;  3EIV A;  1BXT A;  1LV9 A;  1S68 A;  3Q1K A;  3ULL A;  3PW2 A;  4JI1 L;  3A56 A;  5IE8 A;  1SFO B;  1KJ9 A;  5IGC A;  2VQF H;  1V1P B;  2QDL A;  1TS2 A;  1DGS A;  2SDF A;  3SI8 A;  3KBG A;  2V5A A;  5IYD G;  1XMO Q;  2R93 B;  2HIV A;  1B3Q A;  3M4Y A;  1G6P A;  2JN4 A;  2O5I C;  3OIQ A;  4DR1 L;  3JAM c;  4LFA L;  4A93 B;  4X62 L;  1TU2 B;  2ASL A;  1E1T A;  1MBY A;  4XQQ A;  4MV3 A;  4QWA A;  5M3M G;  2F0D A;  4TSS A;  3J80 c;  4U6P A;  4X3S A;  5IOC A;  4LF5 H;  2PMZ B;  5C4J H;  2E2D C;  1Y1W B;  3W1B A;  1IYJ B;  5L1J A;  5ELE A;  3QO2 A;  4IFD J;  1STB A;  3KF6 A;  3PO2 G;  1II3 A;  2FFK B;  2W8K A;  2FMM A;  4RUC A;  1UE6 A;  2V1C C;  5DAU A;  3VR5 A;  2NVY A;  2L0C A;  1XPU A;  2F3V A;  1Q12 A;  3CPF A;  3HOV B;  3KAJ A;  4O3O A;  4DAV A;  4L1K A;  3CPW A;  3K5M A;  1TWA A;  3IKJ A;  3E6Z X;  4JI3 Q;  2VA2 A;  4K5X A;  5E3F A;  1TWH H;  2OF1 A;  2PMZ E;  2Q2I A;  2AMC B;  5C3E G;  4J0M A;  2JYO A;  2V9W A;  5KFD A;  1D2B A;  3GTQ B;  1EHI A;  4G4K A;  4A3F H;  3K5H A;  4A2A A;  5M5W H;  4R4C A;  4QQB X;  1STH A;  1PH3 A;  3AQQ A;  4OGQ C;  2L12 A;  4JI3 H;  2PQA A;  3K6O A;  4DPG A;  5M3F H;  1I4Q A;  3W5O A;  5C1P A;  1AW7 A;  2VY3 A;  4WFN 3;  2IX1 A;  4YP3 A;  1SNC A;  3TQY A;  3IFD A;  4DXG A;  2WKC A;  4FBU A;  4UY8 C;  1ZKO A;  4MV7 A;  3AB9 A;  2AUJ D;  4ODG A;  4A3C G;  3GV5 B;  4ECU A;  1VQ8 A;  2EDG A;  2UU9 L;  3X3N A;  1JMC A;  1GSA A;  2Z8L A;  5IT9 L;  4K5W A;  1E24 A;  4DR7 H;  2YYZ A;  3G6J B;  1SE3 A;  2EY2 A;  4LF6 H;  3J81 i;  3QOJ A;  3RV3 A;  4X3T A;  3TII A;  5KFE A;  1VDZ A;  1RKN A;  2K5W A;  4DA2 A;  2I80 A;  1QVC A;  2FHT A;  2R8H A;  1YIT A;  5DG8 A;  4DR7 Q;  2ZJQ A;  3J80 i;  3PO2 B;  4HCS A;  1XNQ H;  1B04 A;  5JQW A;  3S17 H;  3S9W A;  4OX9 H;  3S1M H;  2EE1 A;  2CCZ A;  1CA6 A;  2CW7 A;  2JQO A;  4MHE A;  1FNW A;  2VXW A;  2VUM B;  1N36 H;  4N9T A;  3S2H B;  4K8J A;  2Y0S A;  3CCJ A;  1S10 A;  2JA8 B;  4FBT A;  1JWU D;  2EY1 A;  4TQR A;  1RK5 A;  2PO4 A;  4CGY B;  4DK6 C;  4IJH A;  2Q8R E;  4PMC A;  1KJQ A;  1JOK A;  3Q22 A;  3T13 A;  1JDB B;  4JG2 A;  2YU9 A;  4O4L F;  1LT4 D;  3KJO A;  3SR1 A;  1I50 A;  2R82 A;  3OTO Q;  2ZM6 Q;  1VQ7 A;  4UCS A;  1YBY A;  4IOC A;  1DZ1 A;  2R7M A;  3BA9 A;  1ML0 D;  4LFB H;  3PV0 A;  1HH2 P;  4OO1 H;  4KD4 A;  3CME A;  2E8G A;  1RDP D;  1BVS A;  4OWW B;  5KX5 F;  4P72 A;  3S14 H;  3IL8 A;  5IOD A;  1PFM A;  3RLO A;  2JA5 H;  3JAM W;  4KHP L;  3GV7 B;  3HOZ B;  1Z7T A;  3VYR A;  4NXN L;  5KNB A;  4UCU A;  2XGP A;  4C1N I;  5GAG C;  5K36 G;  2G5D A;  4IO9 A;  1ICW A;  3SK6 A;  2A8V A;  3TQ1 A;  1H9J A;  2MP1 A;  5KRU A;  4MV4 A;  2FIN B;  2Y0S B;  4RAU C;  1D8L A;  3ETH A;  4H0L C;  4IAL A;  1CSQ A;  3NE5 B;  4RNN A;  4R7R A;  3EVQ A;  1CE8 A;  3S24 A;  5EZY F;  5I47 A;  1F2Z A;  5BMV F;  2PNR C;  5IYD H;  4OEL B;  2WDT A;  4DV3 Q;  1SYF A;  3RZO B;  1HHV A;  3AFP A;  5LP6 F;  5C4J B;  2C35 B;  4HED A;  2JA6 B;  3KUP A;  5JOB A;  4UP7 A;  2B63 H;  2B2W A;  2NZH A;  2WV6 D;  4LFC L;  4IHJ F;  4DR4 H;  2D2C C;  4HR7 B;  1W93 A;  2NYZ D;  1WYD A;  2KCC A;  1RYS A;  1D1K A;  1H9K A;  4PZ7 A;  3PO2 H;  3E5N A;  3HGB A;  3O13 A;  2R8I A;  3M3Y B;  5C4X G;  4ME5 A;  2RQX A;  1WI5 A;  2WYO A;  4ZUI A;  1Q90 A;  1HZC A;  1WCM B;  4ZOL F;  4PMB A;  3TRZ A;  4DV7 L;  1RCV D;  1E3P A;  1EQT A;  1VQK A;  5EWE A;  3MXP A;  1HNX Q;  3RGZ A;  4IUP A;  3K3P A;  4P73 A;  4UCT A;  1ENF A;  3ITP A;  2JXM B;  4MA0 A;  1VQL A;  1LTT D;  4K0K Q;  1IBK Q;  4HMJ A;  4B9X A;  1EOV A;  3R3O A;  5IGG A;  5KFS A;  5DQI A;  3MC0 B;  4A3J H;  3GTO B;  3BJY A;  3NHH A;  1X32 A;  1VQP A;  3KDF B;  1C7Y A;  4OL7 A;  4RCO A;  2AGQ A;  1G6Z A;  3K7A H;  4GN5 A;  2SCU B;  1PH2 A;  2Y0S E;  3EYY A;  3VR2 A;  2UU9 H;  4ZKC B;  3PO3 G;  3PCO B;  1AH9 A;  2JA9 A;  1GUS A;  4NPS A;  3KF6 B;  4H13 C;  3HP3 A;  4C3I B;  2R87 A;  3QZ8 A;  2CKZ B;  3UI2 A;  2WB1 B;  4RHR A;  3RV4 A;  4QIW E;  1YNJ D;  3KFU A;  3RBD A;  3TIG A;  4JI6 H;  4YBZ B;  3MVV A;  1VF7 A;  4GS3 A;  3HBL A;  5JVD F;  3M7G A;  3MEH A;  5FLX L;  4JV5 Q;  2P0A A;  3URY A;  1DM0 B;  2F1M A;  1N36 L;  3I4M H;  2RSN A;  3CF5 A;  3S2D B;  4RB1 A;  1ET6 A;  2I87 A;  4YJ3 F;  4X66 L;  2XC9 A;  4NXM Q;  3WDN A;  3I90 A;  5FD6 A;  2UVV A;  1EY0 A;  3RUZ A;  5BR8 L;  3RB0 A;  4BY7 B;  1E2V A;  4B3R L;  1W6J A;  3MWY W;  4RUA A;  4J9P A;  3SK5 A;  1N48 A;  5J22 A;  1IBM Q;  1TXY A;  3MHB A;  4L6T B;  1RJP A;  1VBH A;  5BR8 H;  3GIL A;  4NXM H;  2HUG A;  2IBK A;  4A3E G;  1CQF A;  5EBC A;  5HBR B;  3RN5 A;  4ZCK A;  5EPJ A;  1TY0 A;  4F8M A;  2RBM A;  1PH4 A;  4ECW A;  2DIK A;  4DR3 L;  4DL6 A;  1EY7 A;  1KHI A;  1PTO B;  2MO0 A;  3DEO A;  4K6D A;  1U0L A;  2H5X A;  4JYA H;  2ZXO A;  1EYA A;  5C3W A;  2L1B A;  3K5L A;  1QNU A;  1GHJ A;  4RKB A;  4YJ2 F;  1LM0 A;  1N9W A;  2YTX A;  4L5T A;  4X62 H;  1ICF B;  1TWG H;  4YY3 H;  1EUD B;  2WIN B;  3STB C;  4YAJ B;  3I3C A;  1X55 A;  1K83 A;  3MFG A;  3H91 A;  4KY7 A;  2KCN A;  1DOK A;  4XT3 B;  1CZW A;  1LT5 D;  3HOX G;  2UUC L;  2XCP A;  1B53 A;  2L9H A;  2XRS D;  2EJF C;  3HFZ B;  3A8J E;  1WVL A;  2B2W C;  4MZ9 A;  1EIG A;  1DXM A;  2HIX A;  2ZTC A;  3BDC A;  4ZQ3 A;  1QJO A;  1N33 L;  3S15 B;  5KFP A;  5KFJ A;  4X64 H;  4LF7 H;  1DON A;  3MXN A;  1F9R A;  3NEM A;  2BOS A;  4N9P A;  4KKU A;  5K5P A;  4DR3 H;  2VNU D;  2KCT A;  2YU9 B;  1HNW L;  3KBX A;  5HGT A;  4X64 Q;  4EBC A;  4PV1 C;  2ID0 A;  4LF7 Q;  3MR2 A;  1I50 B;  2WII B;  4OO1 G;  3PIO A;  1CI3 M;  3MEF A;  4J9S A;  2E2H B;  2FK2 A;  4ME3 A;  2K04 A;  4DV4 Q;  2RKS A;  4FM9 A;  1EEI D;  3QG1 A;  1Y1V A;  2V4R A;  2R7D A;  4DR1 Q;  1HZB A;  1GUG A;  1OXS C;  1BNZ A;  1WCM G;  4JOI C;  1JR0 D;  3GIP A;  1MIU A;  1EUJ A;  3HOY G;  2R92 B;  2HDM A;  4CC6 A;  1WOC A;  1IYU A;  2QEJ C;  2XWJ B;  1C4Q A;  4X64 L;  5CB4 F;  4IFD G;  5LL6 S;  1HNW H;  3J81 j;  1N33 H;  1ILQ A;  1LTL A;  1XNR L;  4QIW A;  4BBS G;  2LXK A;  3RTX A;  1XPR A;  3GTM H;  5KG2 A;  1B6R A;  4XTC S;  4BWS C;  1GM5 A;  1J9O A;  3JZI A; 
#chains in the Genus database with same CATH homology
 3HOZ G;  3EN2 A;  2WB1 E;  3S1R H;  2UU9 Q;  2D0P A;  5IP9 H;  4AQY Q;  3S15 H;  2YTV A;  1EIY B;  1Q7Y C;  1VQJ A;  4A3D G;  1SLJ A;  3B6Y A;  1PH6 A;  4DR7 L;  3K0X A;  4B3S Q;  3F2D A;  1FL0 A;  4A75 A;  3K7U C;  5AJ3 L;  3VDY A;  1N32 Q;  1MJE A;  1A0I A;  2K14 A;  2K75 A;  2Q2U A;  3K80 C;  3HOU H;  2ZM6 L;  1PH5 A;  4JBW A;  4LF5 Q;  1XMQ Q;  3J81 c;  3I56 A;  3RZD H;  4JI6 Q;  1NMF A;  4JI3 L;  4DUY Q;  5IYB H;  1QUQ B;  3TS2 A;  1GD7 A;  4A3C H;  1E1O A;  4Y7N H;  2XGT A;  2A1A A;  4A3M G;  4LFB Q;  5C0X G;  4A3B H;  2UXB Q;  1H95 A;  1AE3 A;  2R7Z G;  1CUK A;  4JCV E;  4L5Q A;  1VQ4 A;  1VCI A;  1X3F A;  1G51 A;  3D0F A;  4X66 Q;  2E2H H;  2NZO A;  1BKB A;  4B3M Q;  5M3M H;  4JYA Q;  3TEH B;  4HJ5 A;  4GKK L;  1TWA H;  5M5X H;  3HOX H;  3M4O H;  4A3F G;  3I4O A;  1YHA A;  1KIX A;  4JBK A;  5C3E H;  2N78 A;  4DR2 Q;  2NVT H;  3W1G A;  3H3V H;  1TWF H;  1HZA A;  2MQH A;  1YVC A;  3NBH B;  1VQO A;  5GAH C;  4GOP A;  2D62 A;  1YIJ A;  1HR0 L;  4RMF A;  3ICE A;  4HJ8 A;  2ES2 A;  2I0Q A;  2ZJP A;  3PUX A;  5LMN Q;  1Y1W H;  2OTJ A;  1L1O B;  5IP7 H;  5FLM H;  1QZG A;  4LFA Q;  4R4I A;  3PIP A;  3PGZ A;  4R4Q A;  4JI5 Q;  3H3V I;  2PQA B;  2K5H A;  4BBR H;  1PV4 A;  3ER0 A;  3S16 H;  3IRB A;  1OXU A;  3PUY A;  1T9H A;  2WAQ G;  3Q8D A;  4GLA C;  4B3T L;  2JA8 G;  3CMA A;  1K0R A;  4POF A;  2LXJ A;  2D0O A;  3GTG H;  4OO1 I;  3CQZ H;  3FKI H;  4A3E H;  1I3Q H;  4DR3 Q;  1X56 A;  2OTL A;  2WFW A;  4DR4 L;  1OXX K;  5LMU L;  3U4V A;  4JI4 Q;  2WP8 J;  4YCU A;  5C0X J;  4LF8 Q;  1FJG Q;  1VQN A;  1Q46 A;  4GKJ Q;  2NN6 G;  5JJI A;  3F8T A;  1O7I A;  2IHE A;  1MKH A;  1GKH A;  4YY3 L;  3CCL A;  1PH7 A;  2AKW B;  5JEA J;  4DV6 L;  4JBM A;  2VS1 A;  2L15 A;  3HKZ E;  4A3J G;  2VQE Q;  5M5Y H;  1KAW A;  4DR6 Q;  2YU9 H;  1K3R A;  1PYS B;  3KYH C;  4KLK A;  4BXX G;  1X6O A;  3KF8 B;  4P71 A;  1IZ6 A;  2VW9 A;  1N34 L;  3TRE A;  4DV6 Q;  2RHS B;  3KJP A;  4GN3 B;  4WJ3 M;  4C3H H;  1PA6 A;  3DM3 A;  5GAE C;  4PZ8 A;  3CC7 A;  1QZH A;  3CD6 A;  3LGJ A;  2ZTD A;  1PH8 A;  5ELN A;  3T1H L;  4LW1 A;  4IPG A;  4KI0 A;  3GTL H;  1W3S A;  2UXC L;  3AYH B;  1HJP A;  1I50 H;  3A74 A;  2QEX A;  3PF4 A;  4PMW A;  2UXB L;  3FKI G;  1UWV A;  1IBM L;  4HID A;  1KRS A;  1AE2 A;  3D31 A;  1B8A A;  3L2P A;  4DV7 Q;  4GLX A;  4DV2 L;  4GNX C;  3GTJ H;  4HIM A;  3M85 A;  1CKO A;  3TS0 A;  4X6A H;  3BZK A;  1C9O A;  4OX9 Q;  3EIV A;  4MNO A;  1UEB A;  2IY5 B;  1UE5 A;  3ULL A;  2MNA A;  4JI1 L;  5IE8 A;  4TVA B;  2FXQ A;  2HHH L;  4A3L H;  1GVP A;  3NEN A;  1C0A A;  2PI2 A;  3G71 A;  2K5V A;  1DGS A;  5JJK A;  3M3Y H;  4GNX A;  1NY4 A;  1ASY A;  4YCW A;  4JI0 Q;  3S2H H;  5IYD G;  1XMO Q;  4B3S L;  1S72 A;  1I6H H;  2HIV A;  4IPC A;  2NVQ H;  2CWA A;  1VQM A;  1G6P A;  1VQB A;  5IT9 c;  3ERS X;  4DR1 L;  3H0G H;  3JAM c;  4DKA C;  1GO3 E;  4LFA L;  4X62 L;  2VL6 A;  1N34 Q;  5BR8 Q;  2PNH A;  3CCS A;  2BA0 A;  1E1T A;  4OX9 L;  3CC4 A;  2B29 A;  5M3M G;  2N3S A;  3J80 c;  1IBL Q;  4OWT B;  1HNZ Q;  3GTO H;  5C4J H;  2HT1 A;  4P75 A;  3K81 C;  4DNI A;  1E7Z A;  3CCR A;  3W1B A;  1IYJ B;  3GD7 A;  3M4Q A;  5C4X H;  1VQ9 A;  2JA6 G;  4IFD J;  1PHJ A;  1X3E A;  3CC2 A;  3CCQ A;  3KF6 A;  1BBU A;  1A8V A;  4X65 Q;  5FLX c;  4JBJ A;  3RNU A;  3PO2 G;  4YHH L;  4LUV A;  5IYB G;  2CWP A;  3E0E A;  4DV3 L;  4JYA L;  3T1Y Q;  2RHQ B;  3PUW A;  2AWN A;  2IT1 A;  1UE6 A;  2V1C C;  2KEN A;  4JI2 Q;  2ATW A;  4DR4 Q;  4BBR G;  4GOP B;  1XPU A;  1Q12 A;  4IPH A;  4JC0 A;  3RLF A;  3CPF A;  3GDE A;  5FLM G;  3J7A 5;  3CPW A;  4HJA A;  3NEL A;  5HGQ A;  4DV1 L;  1W2B A;  1TWC H;  4J15 A;  4C3J H;  5IP9 G;  4DV0 Q;  4JI3 Q;  3UDF A;  2UXC Q;  4AIM A;  2K4K A;  3CXC A;  3G4S A;  1M90 C;  1G29 1;  2VQE L;  4JI8 L;  1TWH H;  2PMZ E;  1E22 A;  2Q2I A;  2AMC B;  5C3E G;  4NXN Q;  1EYG A;  4LFB L;  4KHP Q;  4BY1 G;  4POG A;  4A3F H;  1NBW A;  1V1Q A;  5M5W H;  1YZ6 A;  1MJC A;  2KCM A;  4R4C A;  4YCV A;  1VQ5 A;  4QQB X;  1PH3 A;  3AQQ A;  2PQA A;  4DPG A;  1I5F A;  5M3F H;  4XIG S;  3W5O A;  1YNX A;  4DV5 Q;  2NVX H;  2NVY H;  2VY3 A;  1I94 Q;  5FJ8 G;  1X3G A;  2IX1 A;  4GKK Q;  3TQY A;  2EIF A;  2RCN A;  4H02 A;  4DR5 Q;  2CFM A;  3ULP A;  4UY8 C;  4PG3 A;  1YJW A;  4JI8 Q;  2ASB A;  4A3C G;  2WB1 G;  1VQ8 A;  4LF7 L;  2YTY A;  1A62 A;  5E7N A;  1EQR A;  2UU9 L;  1JMC A;  4FDB A;  3KDF A;  1VQC A;  1E24 A;  3EBE A;  3A5U A;  4DUY L;  2YYZ A;  3BU2 A;  2VUM G;  3U50 C;  3GTK H;  1PYB A;  1Y1V H;  3J81 i;  3OYY A;  1RIP A;  3RN2 A;  1SR3 A;  2E2J H;  4LUO A;  2AWO A;  2KHJ A;  1XMQ L;  1QVC A;  1PH9 A;  4JI2 L;  4LF5 L;  1YIT A;  2JEA I;  1PH1 A;  1N33 Q;  4WJ4 A;  2RF4 A;  3UDX A;  3E9I A;  4DR7 Q;  2ZJQ A;  5GRO A;  3J80 i;  4YWK A;  1VQH A;  3S17 H;  2UUB L;  1QUQ A;  1XMO L;  3FP9 A;  3S1M H;  3E9H A;  1B7Y B;  5M3F G;  2CCZ A;  4OON A;  4LFC Q;  1Q1E A;  2JQO A;  1SE8 A;  1Y14 B;  4RG1 A;  1SN8 A;  1CKN B;  3CCJ A;  1XNR Q;  2XTI A;  4A93 G;  4DK6 C;  1YJN A;  4IJH A;  1WCM H;  1Q82 C;  1VS0 A;  4LUZ A;  1HNW Q;  1VQ6 A;  4QY7 A;  4JG2 A;  5IYC H;  1QVG A;  1HZ9 A;  2K5N A;  4AYB G;  3KJO A;  3CCM A;  4O0A A;  4IFD I;  2Y0S G;  3OTO Q;  2ZM6 Q;  2OCE A;  1YBY A;  4IOC A;  4DR5 L;  4A3I G;  1SMX A;  2QA4 A;  3PUZ A;  1VQ7 A;  4LF6 L;  1KL9 A;  3UDG A;  3PV0 A;  3BJU A;  2VUM H;  1N32 L;  1HH2 P;  2Z6K C;  4YHH Q;  1K8G A;  4A3G G;  4X65 L;  3CME A;  2E8G A;  1V9P A;  1BVS A;  2ALY B;  3T1H Q;  4L5R C;  4OWW B;  1L1O A;  3I4N H;  4P72 A;  1M1K C;  3S14 H;  4YWM A;  3RR5 A;  4JOI A;  4BY7 H;  3RLO A;  4O2D A;  2JA5 H;  4KHP L;  2BH8 A;  2JA6 H;  4JI6 L;  4NXN L;  5HY6 A;  2VQF L;  1WJJ A;  4QGU A;  5FJ8 H;  5GAG C;  5K36 G;  4IO9 A;  4YWL A;  2A8V A;  4BA1 I;  3OW2 A;  1CKN A;  1D8L A;  2UUA L;  4IPD A;  1I94 L;  3I2Z A;  2OQK A;  1CSQ A;  3HOV G;  4L5S A;  4JV5 L;  1LYL A;  4EX5 A;  3H0G G;  3BZC A;  4TQU S;  4AQY L;  1EWI A;  4YY3 Q;  4BY1 H;  3DLL A;  2F52 A;  3STB D;  1PVO A;  4ALP A;  5GAD C;  4DAM A;  3S24 A;  3CP0 A;  2UUC Q;  5H1S E;  1YJ9 A;  5IYD H;  1HNZ L;  4DK3 C;  3F2B A;  4DV3 Q;  3S2D H;  3AFP A;  2C35 B;  1XNQ L;  2BA1 A;  4BA2 I;  2JA7 H;  2UXD Q;  4UP7 A;  2NN6 I;  1B70 B;  2E5L Q;  2R6G A;  2WAQ E;  2NZH A;  4LFC L;  3SGI A;  2B63 H;  4DV1 Q;  3AEV A;  4AH6 A;  3J7Z C;  4DUZ L;  2BH2 A;  1L2F A;  1RL2 A;  4JI5 L;  4R4O A;  1HR0 W;  1XPO A;  1IBL L;  4B3R Q;  1VQE A;  2ZTE A;  4OXP A;  1WYD A;  1P8L A;  5JEA G;  4PZ7 A;  3PO2 H;  1QVF A;  2R93 H;  2OWO A;  4X62 Q;  4LF8 L;  1FJG L;  4P74 A;  2LSS A;  5C4X G;  4C2M H;  1WI5 A;  3AFQ A;  1HZC A;  1VQF A;  3UE0 A;  1OXV A;  1V43 A;  3TRZ A;  4DV7 L;  3CCE A;  4QL5 A;  4DUZ Q;  5EAY A;  1VQG A;  2QGQ A;  1E3P A;  2E2I H;  1VQK A;  4JI1 Q;  4QJF A;  1HNX Q;  3I4M G;  4KHZ A;  4UPA A;  4P73 A;  5LMN L;  4C3I H;  1K8A C;  1JB7 A;  1D7Q A;  1EIF A;  1VQL A;  4K0K Q;  1IBK Q;  2IHF A;  1EOV A;  1VQI A;  5ELO A;  3RLN A;  3U4Z A;  4A3J H;  3CCV A;  2DGY A;  3G6E A;  1IL2 A;  3CAM A;  3F2C A;  4A3L G;  1VQP A;  1C7Y A;  3KDF B;  4A3K G;  2N49 A;  2KHI A;  5C0X I;  1CKM A;  2F3I A;  2AHO B;  1KD1 C;  4JI4 L;  4K0K L;  1JJC B;  1X54 A;  2JK8 A;  2EXD A;  3K7A H;  4GN5 A;  5IWA L;  4EQ5 A;  4B3M L;  1WFQ A;  1PH2 A;  4LF6 Q;  4LF9 Q;  1KQS A;  2Y0S E;  3PF5 A;  5JJL A;  1HNX L;  4HIK A;  3PO3 G;  3PCO B;  3HOW H;  3ULJ A;  1AH9 A;  2JA9 A;  2VQF Q;  1CSP A;  3HOW G;  4NPS A;  2VZA A;  4DV2 Q;  3KF6 B;  3M7N A;  3M9B A;  3PO3 H;  1IBK L;  1N8R C;  3S1Q H;  2MFI A;  3MXN B;  1J5E Q;  2JA8 H;  1NTG A;  2CKZ B;  4OWX B;  1Z9F A;  3A0J A;  4A76 A;  3HKZ G;  4GKJ L;  4QIW E;  1NMG A;  4IJL A;  4DAY B;  3KFU A;  4HJ9 A;  4A3K H;  3GTQ H;  5IP7 G;  2JA7 G;  1EQQ A;  1VQA A;  3ZJY C;  1X65 A;  2GVB A;  1OTC A;  1XTD A;  4MTN A;  4GS3 A;  3HOY H;  1K83 H;  1JJ2 A;  3K8A A;  1ASZ A;  3FHW A;  4LF4 Q;  4B3T Q;  1KC8 C;  3UE1 A;  4JV5 Q;  3UDI A;  3L0O A;  4BXX H;  1IXR A;  2F4V Q;  1SRO A;  2I5M X;  1N36 L;  3G48 A;  3CF5 A;  4JI7 L;  3I4M H;  1X9N A;  1J6Q A;  1JE5 A;  4GN4 B;  5LMU Q;  2E5L L;  2IX0 A;  4X66 L;  4NXM Q;  3JC6 6;  2Z6K A;  5DLQ E;  4LWC A;  1BBW A;  2K50 A;  5BR8 L;  5GQO A;  4B3R L;  1JJG A;  2EQS A;  4DR6 L;  2F4V L;  1IBM Q;  1TXY A;  4LF4 L;  4A3M H;  1S3O A;  2UUB Q;  3RZO H;  4BY7 G;  4A4I A;  5IWA Q;  3M4P A;  2R93 G;  1HR0 Q;  5IY0 A;  4A3E G;  3RN5 A;  1YI2 A;  2K52 A;  2GVA A;  1PH4 A;  4DV4 L;  4DR3 L;  4A3G H;  2GN5 A;  1KHI A;  2MO0 A;  3H15 A;  4R4T A;  3PUV A;  4A3I H;  1U0L A;  2H5X A;  1J5E L;  1YHB A;  2B63 G;  1FVI A;  1Y1W G;  4UP9 A;  2HQL A;  1SRU A;  5J3B A;  4A3D H;  1LM0 A;  1N9W A;  2YTX A;  4L5T A;  4UP8 A;  1TWG H;  1Q81 C;  1A63 A;  1Q8K A;  1KRT A;  3STB C;  3HOZ H;  2PI2 E;  1K9M C;  4PZ6 A;  4A93 H;  2A19 A;  1X55 A;  2N8N A;  1JT8 A;  2ZJR A;  4HIO A;  2I5H A;  2Q2T A;  3OTO L;  3HOX G;  2UUC L;  3HOV H;  1U5K A;  4DR2 L;  3U58 A;  1VQD A;  4DV5 L;  2R92 G;  2Z0S A;  3HFZ B;  3L7Z C;  2I5L X;  4MZ9 A;  1L0W A;  2HIX A;  2ZTC A;  1PFS A;  1N33 L;  1P16 A;  2UUA Q;  2R7Z H;  4GOP C;  4A3B G;  3F1Z A;  3T1Y L;  3NEM A;  5AJ3 Q;  5C44 G;  2JA5 G;  1SFO H;  2VNU D;  4HJ7 A;  3I7F A;  2KCT A;  1LUZ A;  5LMN W;  2Q2H A;  3I4N G;  1UE1 A;  1Y1V G;  4GLV B;  1HNW L;  3S1N H;  4X64 Q;  1FGU A;  2ID0 A;  4AYB E;  4LF7 Q;  1R9T H;  2OQ0 A;  1NJI C;  1XNQ Q;  1YEZ A;  4OO1 G;  2UXD L;  3PIO A;  2JJQ A;  3I55 A;  1S40 A;  2JEB I;  3MEF A;  3KOJ A;  3HOU G;  2JE6 I;  3A5Z B;  1XJV A;  4ME3 A;  1K73 C;  3CW2 C;  4DV4 Q;  4IOA A;  1YHQ A;  5IYC G;  4Y52 H;  2R7D A;  4DR1 Q;  5C44 H;  1HZB A;  1Q1B A;  1OXS C;  3HKS A;  4NB3 A;  1N36 Q;  4JI7 Q;  1WCM G;  1Z47 A;  4JOI C;  1EFW A;  1MIU A;  1EUJ A;  3WWV A;  3HOY G;  3KLW A;  2MO1 A;  2KBN A;  1KXL A;  1WOC A;  2CQO A;  2DUD A;  1L1O C;  3JAM i;  4X64 L;  3GO5 A;  1UE7 A;  2B3G A;  1Q86 C;  1NE3 A;  4R1J A;  4JI0 L;  4BBS H;  2R92 H;  4LNQ A;  4IFD G;  2YV5 A;  3J81 j;  1OXT A;  2R7F A;  3GTP H;  2HHH Q;  1LTL A;  1XNR L;  4BBS G;  2LXK A;  3PSI A;  1XPR A;  3GTM H;  3CCU A;  4XTC S;  4DV0 L;  4GNX B;  4LF9 L;  4NXM L;  1GM5 A;  4APV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...