5C4XG

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4xG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c4xG01
1X3FA 1QUQB 4DK3C 1GO3E 3SGIA 3D0FA 1GM5A 3RZDH 1ASYA 2CCZA 4GKKL 3CCJA 3HOWH 3E0EA 1Z9FA 1C7YA 4X66L 4DR7L 1XPUA 4GN4B 1YHQA 1W3SA 2AWNA 2BH2A 2VNUD 5IYCG 2GN5A 1HNWQ 1HH2P 3BU2A 3TS2A 1SR3A 3HOUH 2Q2HA 2YTVA 3KDFB 2JA7G 2R7ZG 2CQOA 4DR1Q 3F1ZA 1MJEA 3HOVH 1PH1A 4HIOA 4AIMA 5IWAQ 4UY8C 3J80c 4NB3A 2NVQH 5LMUL 1K9MC 4A3MH 1YJNA 1Q82C 2JEAI 1Y1VH 1U5KA 1SE8A 5GAEC 1FJGQ 3G4SA 4LWCA 3PF5A 2JEBI 1Y14B 4LFCL 1EQQA 3HOYH 2E5LL 1PH5A 4LF4Q 2K5VA 4AQYL 2UUCL 1KD1C 4PG3A 4A3EG 3J80i 3GD7A 1IBLL 1OXSC 4LF7L 3H3VI 4A3JG 1Q86C 4JI8Q 1XNRQ 1HR0L 4GKJQ 4WJ3M 2PNHA 2QA4A 5ELOA 1RIPA 4DV4L 4GLAC 3PCOB 2WP8J 2ZJPA 4DUYQ 4HJAA 2JA5G 3NELA 2PMZE 5FLXc 4NXNQ 3A5ZB 2B63G 4A93H 1D8LA 1G51A 5GADC 2ES2A 1UEBA 3A5UA 3BZCA 2CWPA 1E1TA 2IT1A 4JI2Q 4UP7A 2UXCQ 5IP7G 4DV6L 1GVPA 3RLNA 3CQZH 1VQ8A 3PUVA 1L1OA 1CKMA 5GQOA 4QL5A 3CCVA 2OTJA 1J5EL 4A3CH 2Q2UA 4X64L 1SRUA 4LFAQ 5C0XJ 2VW9A 1VQKA 4DV2Q 1B70B 2A8VA 3HOWG 3HKZG 3GDEA 4P74A 4DR2Q 4JG2A 3L7ZC 3F2DA 2Y0SG 1M90C 4GNXC 5LMNL 3GTLH 3TRZA 4HIDA 5JJLA 1N9WA 4JI4L 4A3BG 3HOVG 2N3SA 3PV0A 4C3IH 1G6PA 1Y1WH 4TVAB 5K36G 5M3FH 2NVTH 2JJQA 3K8AA 1VQAA 1GD7A 4JYAQ 4LFBQ 2Z6KA 4DAMA 5C44G 1HZ9A 4A3KH 2YTYA 4IPDA 4QQBX 4DPGA 4DV7Q 1KXLA 2E2JH 1EQRA 4JI6L 3DM3A 4TQUS 1B8AA 4JBKA 4MNOA 4OX9L 5IP9G 3RR5A 1PH8A 3W5OA 4HIMA 1X3GA 3CAMA 5JEAG 4KHPQ 4YCWA 3M9BA 1YJ9A 4A93G 1NE3A 1YVCA 2KHIA 1LTLA 3PUXA 4YY3Q 3S17H 1VQ5A 3ULJA 3I4NH 4JBMA 4IFDI 3I4OA 1EFWA 1WCMH 1VQ4A 2A19A 1KIXA 2UUBQ 4JI0Q 4A3CG 1BKBA 4O2DA 4DR1L 4EX5A 2VUMG 4RG1A 4A76A 1K83H 4BBSH 3AFQA 5IT9c 3CPWA 3GTMH 2KHJA 3PO3G 1K0RA 3PO2H 1IBKQ 3AQQA 1NMGA 4C3HH 3Q8DA 2YYZA 2A1AA 2VQEQ 1SROA 4GNXA 1FJGL 4C3JH 5GAHC 4DV1Q 3T1YQ 2DGYA 3KF6B 2UXBQ 2I5MX 3FKIG 4YWMA 4DV0Q 1C9OA 4R1JA 4UP9A 1EIYB 2FXQA 2Q2IA 2B29A 1Y1WG 4JI8L 4GLXA 4GKJL 5C4XH 5AJ3Q 1XMQQ 3A74A 4A3FH 3ERSX 4O0AA 2I0QA 4DKAC 1C0AA 4DUYL 2JE6I 3NEMA 1IYJB 1TWFH 4NXNL 5J3BA 4A3KG 2F3IA 4LF8Q 2CWAA 5M5WH 2WB1G 4LUZA 4BBRG 2R92H 3GTGH 1VQCA 1N8RC 2UXCL 2K52A 5C0XG 1VQMA 3UE1A 2UU9Q 1T9HA 5IY0A 1KRTA 3W1GA 3RZOH 5DLQE 4Y52H 4GLVB 2R93G 1S3OA 1TWAH 4LFAL 3CCRA 1VQ9A 4DV2L 1NBWA 2AWOA 1FGUA 5FLMG 4BY1G 4DR2L 3I4NG 1K8GA 1NMFA 1BBUA 3KLWA 3S24A 1SLJA 1L1OC 1WCMG 2R6GA 1Q7YC 1E24A 4B3SQ 4OWWB 3AEVA 4LNQA 4DR4Q 4LF5Q 4HIKA 4BBSG 3PF4A 4A3DG 1UE1A 4R4QA 1L2FA 4QJFA 4B3RQ 1VQOA 4LFBL 4JYAL 3LGJA 2NN6I 4QIWE 1NY4A 1CKNA 1QVCA 1OXXK 3GO5A 1XPOA 1R9TH 1XMOQ 1PFSA 2QEXA 2UXDL 1HZBA 4JV5Q 3M85A 1CSQA 3ULPA 2AHOB 4DV7L 4DR5L 4BXXH 4R4IA 4DV5L 2UUAQ 3CCMA 2K5HA 4NXML 2E8GA 5IYDH 2E2HH 1JB7A 3F8TA 3U4ZA 4P71A 1OXVA 1YHAA 2Z6KC 3ICEA 3K80C 1NTGA 1QZHA 2I5HA 4IPHA 2WAQE 3PUYA 3I55A 3OW2A 3H3VH 5JJKA 2R92G 4DR6L 4X6AH 4YY3L 4DK6C 1KC8C 1NJIC 1H95A 1Q1BA 2C35B 4C2MH 1WI5A 3EIVA 2R93H 2UUBL 1X54A 5GAGC 2HHHQ 1FL0A 4DV3L 4JI0L 3DLLA 3ZJYC 3T1HL 4LF6Q 2EQSA 2EXDA 2N78A 3STBC 1JMCA 2N49A 1VQIA 4LUOA 2D0OA 4A3IH 1IBKL 2VQEL 1L1OB 1VQBA 2YU9H 3T1YL 3S2HH 2MO1A 4IOAA 4OO1I 3KYHC 5IYBH 2I5LX 2BH8A 2MQHA 1XTDA 4B3TL 5AJ3L 1XMQL 3UDGA 3HOXH 1ASZA 1A8VA 2WAQG 4YHHQ 4DAYB 4JI7Q 5H1SE 3HOUG 3G71A 2ZTCA 1VQHA 2VS1A 2QGQA 3FHWA 4BXXG 1YI2A 1P16A 1N33L 1PH2A 4IFDJ 3J7ZC 3I2ZA 1YZ6A 2JQOA 4PZ8A 3F2CA 5IYDG 3TS0A 1KAWA 1HJPA 2VQFL 2JA6H 4HJ8A 4A3MG 3OTOQ 1EOVA 3U58A 2UU9L 4K0KQ 5JJIA 1Y1VG 2V1CC 3NBHB 4KHZA 1XNQL 1LYLA 3CMEA 3HOYG 5C4JH 1BVSA 4YCUA 3KF8B 2WFWA 1PYSB 1HNXQ 2IY5B 4A3GH 2D62A 4GOPC 4OWXB 1IBMQ 3RNUA 2H5XA 2K5NA 1PH4A 4B3SL 3RLOA 1G291 4DR4L 1VQ7A 3H0GH 4LF5L 1Q12A 2MNAA 5BR8Q 3S1RH 4OONA 4X66Q 3STBD 2PQAB 3HKSA 1Q46A 2KCTA 3S16H 4BY7H 4P73A 4MTNA 3I7FA 3CCLA 5M5YH 4POGA 1XMOL 1YIJA 1HNWL 2KBNA 4IOCA 1YITA 2JA9A 4JV5L 1KQSA 5IYBG 2YTXA 5EAYA 5IWAL 2UUAL 2VY3A 2NVYH 1AE2A 4JI1Q 4IPCA 3CW2C 1XPRA 2E2IH 2OQ0A 3EBEA 3TEHB 4GNXB 1N32Q 3UDIA 1AH9A 1WFQA 3PIPA 3I4MH 2CFMA 1Q1EA 4LF4L 2E5LQ 3M3YH 4LF7Q 2OTLA 1TWGH 1YEZA 2LXJA 1AE3A 4AH6A 3CCUA 5C3EH 1XNRL 5M3FG 3H15A 1EWIA 1X6OA 4ME3A 2ZTDA 1YBYA 1X9NA 4ALPA 1EIFA 1HNZQ 1TWHH 4GN5A 4LF6L 2HIVA 4DNIA 2BA0A 3M4PA 4J15A 4A4IA 4JI2L 4GOPA 1PVOA 2OCEA 2PI2A 3BZKA 3CXCA 2N8NA 1OXTA 3B6YA 3AFPA 4JOIA 2DUDA 3L0OA 4Y7NH 2IX1A 1I3QH 2VL6A 4BA2I 2MO0A 2NZOA 3H0GG 2JA7H 2R7ZH 4JI5Q 4IFDG 1BBWA 2HIXA 3MXNB 1N34Q 4BY7G 2JA8H 3KJOA 3U4VA 1E3PA 2KENA 4YHHL 1A62A 2XTIA 4JI4Q 2HQLA 2AMCB 2MFIA 2F4VQ 2ZM6Q 3F2BA 4LUVA 2HT1A 4A3LH 3G48A 1SFOH 4A3EH 3KJPA 4X65Q 1JJ2A 4A3JH 2RF4A 4AYBE 1EUJA 3PO2G 3PIOA 3S1NH 3OTOL 4K0KL 2ATWA 3UDXA 4P72A 1CKNB 1SN8A 2B63H 1I50H 4NPSA 4OXPA 1UWVA 2K4KA 3NENA 5HY6A 3CC4A 3PGZA 3A0JA 2L15A 4KI0A 4QGUA 3K7UC 4POFA 5C4XG 5IP7H 4OX9Q 1E22A 5FJ8H 4A3FG 3GTJH 4JI3Q 1V43A 2R7DA 1UE5A 4JC0A 2K75A 1N36Q 1JJGA 1JJCB 1Q8KA 1VQEA 2LXKA 4PZ7A 2F52A 4YWLA 1Q81C 1QUQA 4HJ9A 4DR3Q 4L5QA 5HGQA 4GN3B 5BR8L 4JBWA 3PUZA 1TWCH 2GVAA 4R4CA 5JEAJ 2NVXH 5M3MH 4B3MQ 1MKHA 4DUZQ 1X3EA 1VS0A 1YNXA 3KDFA 3CC7A 1TXYA 4AYBG 3J81j 1OTCA 4A3BH 4UPAA 1LM0A 1FVIA 1PA6A 1VQ6A 1IZ6A 1D7QA 4X62Q 4XIGS 1I94Q 2JA8G 4JI1L 2AKWB 1JT8A 3HOZH 4GS3A 3TREA 3HKZE 1N32L 5C44H 5IE8A 4DV1L 2XGTA 1MJCA 4L5SA 2UXBL 3W1BA 1VQJA 2Y0SE 4IJLA 4DV0L 3VDYA 4A3LG 1B7YB 4UP8A 3CP0A 1VQFA 2NN6G 4EQ5A 2ZJQA 3CF5A 3GTOH 5IP9H 3K7AH 1IXRA 2PI2E 3K81C 3PSIA 4BA1I 3CCSA 1HNZL 3GTKH 2K14A 2K50A 4QY7A 4LF8L 2VZAA 4IO9A 1WOCA 1DGSA 4OWTB 1I5FA 5FJ8G 2BA1A 2LSSA 1J6QA 3K0XA 1QZGA 1PH6A 3KFUA 2JK8A 2OQKA 1KL9A 1PH3A 1K73C 1XJVA 1CKOA 1JE5A 4JCVE 1QVGA 3U50C 4YCVA 2VUMH 1CUKA 4JI5L 1M1KC 1N34L 3M4QA 4LF9Q 3JAMc 3S15H 3GTQH 3PO3H 1A0IA 1YHBA 1HZCA 1SMXA 3JC66 1U0LA 4JOIC 4KLKA 4FDBA 3RLFA 1WYDA 5M3MG 1V9PA 3UE0A 2F4VL 2ZM6L 3FKIH 4R4OA 4GKKQ 1S40A 3JAMi 2NZHA 4X65L 1WJJA 4IJHA 4DR7Q 1HZAA 4B3RL 2ZTEA 3HOZG 4A3IG 1QVFA 3WWVA 3CD6A 2IHFA 4OO1G 3M7NA 4PMWA 2Q2TA 5ELNA 3G6EA 3J7A5 2UXDQ 1LUZA 3CC2A 3S14H 4BBRH 2ALYB 4DR5Q 1E1OA 3J81c 1OXUA 1O7IA 4DV5Q 3I56A 2RCNA 4NXMQ 3ER0A 1K3RA 3HOXG 4JI3L 1PYBA 5M5XH 2R7FA 5LMUQ 4IPGA 2OWOA 3PUWA 1N36L 4L5RC 5C0XI 2ZJRA 4KHPL 2EIFA 4DR3L 2B3GA 2KCMA 4LFCQ 5GROA 1Z47A 3J81i 3CCEA 4AQYQ 2UUCQ 1IBLQ 1VQNA 4DR6Q 3UDFA 1X65A 1PH7A 2WB1E 2PQAA 3EN2A 5FLMH 1UE6A 1X56A 1HR0Q 4BY1H 2JA6G 3OYYA 4DV4Q 3S1MH 2ASBA 4B3ML 4DUZL 2HHHL 2ID0A 4HJ5A 4DV3Q 3T1HQ 3CPFA 1L0WA 1MIUA 1UE7A 2IX0A 4MZ9A 4A3GG 4APVA 4GOPB 4A3DH 1I6HH 4X62L 4LW1A 1I94L 4DV6Q 2IHEA 3GTPH 1KHIA 3ULLA 1VCIA 1V1QA 3KOJA 3BJUA 3FP9A 5IYCH 3AYHB 3KF6A 3L2PA 1J5EQ 1X55A 1EYGA 4X64Q 1HR0W 2GVBA 1KRSA 3RN2A 3RN5A 1PH9A 4A75A 4B3TQ 1A63A 3CMAA 3M4OH 4JBJA 1YJWA 2RHSB 3IRBA 4JI7L 5LMNQ 4YWKA 1CSPA 4PZ6A 3MEFA 3E9HA 1N33Q 1E7ZA 1P8LA 2YV5A 4RMFA 4HJ7A 3S1QH 2VQFQ 4R4TA 4XTCS 1IL2A 2Z0SA 2CKZB 2D0PA 1W2BA 1XNQQ 1VQGA 3HFZB 2JA5H 3I4MG 3D31A 4H02A 3E9IA 1HNXL 1PHJA 1VQLA 1VQPA 1IBML 5C3EG 1RL2A 4JI6Q 4LF9L 3S2DH 4P75A 3CCQA 1PV4A 1K8AC 1GKHA 5LMNW 1VQDA 4WJ4A 4L5TA 3TQYA 5E7NA 1S72A 2RHQB
chains in the Genus database with same CATH superfamily
1QUQB 3HXLA 1GM5A 1BOSA 3D6CA 3SGIA 3FKIA 5KFMA 2IBKA 3HOWH 1V1PB 2MGSA 3D4RA 3E0EA 5L1KA 5KGUA 4GN4B 1ILQA 4I7ZC 3QWNA 3NXWA 3KAKA 3MEHA 2YTVA 3HS0C 3KDFB 2R7ZG 1XMQH 4F50A 3F1ZA 3LX0A 2EJGC 3J80c 2L12A 4JV1A 3NQTA 4MIUA 1Q82C 4LF8H 3L4JA 1Y1VH 2HCCA 1SE8A 5GAEC 4FBUA 3G4SA 3PF5A 1EQQA 3I4MB 2K32A 1GHKA 1IBLL 5CV4A 4A3EG 5FO9B 3LP8A 4A3JG 1A15A 1Q86C 2AGPA 4DV4L 2F0NA 4EGJA 2WP8J 5L37A 4MV3A 4HJAA 5FLXW 2C2RA 5FLXc 1BXRA 1G51A 2X6GA 1E1TA 3VYTA 1H9SA 1UEAB 3SHLA 2VR1A 3H91A 1D6EC 1Y8OB 2F0TA 2DJFC 4QL5A 4DGZA 5KFSA 4KKSA 1I3QB 2FMCA 4WJWA 1IBKH 4MTKA 2Q2UA 3GIPA 2R7ZB 1F9SA 4X64L 2A8VA 2VW9A 2Z8LA 1S5ED 2K1BA 3VA7A 1QILA 4Q45A 4P74A 1XMOH 4JG2A 4YJ2F 2IP4A 2R7LA 2V4DA 2H4OA 4YR0A 4IRDA 1ICWA 1TWFA 5JJLA 4A3BG 1SFOB 3HOVG 4A3EB 5NUCA 4A3JB 5KT4A 5M3FH 1F9PA 4LFBQ 2JJQA 3K8AA 3BA8A 3GV3A 4ECRA 3A8IE 2WV6D 1K3BC 4QQBX 3BYTB 1ZQ7A 2E2JH 1TQOA 2M00A 1D2BA 3DM3A 4UCUA 4OX9L 2SCUB 5T1IA 3DMUA 1PH8A 4LF6H 2WINB 3CAMA 4IALA 1G2TA 2XCLA 1YJ9A 4YB8B 4C5AA 2XVSA 1NE3A 2EYOA 3HZXA 3D6WA 2R8GA 1AN7A 2FP4B 3PUXA 4YR2A 4OL7A 4BS9A 1VQ5A 1E4EB 5JJZA 1M8AA 2M9VA 4IFDI 1ZETA 1EFID 3NTHA 5D3DA 1EFWA 1KIXA 4JI0Q 3T5HA 3KBGA 4A3BB 4DF7A 2HVQA 5JQWA 2VUMG 1EY6A 4RG1A 3HOVB 4XZ3B 3AFQA 4RUCA 4YHHH 2IA6A 4J9SA 2AU0A 3GTMH 1I4XA 1K0RA 1SNQA 2E2HA 3AQQA 4C3HH 3WOEA 2CW0C 2PMZB 2RQXA 2VB3X 2B39A 4ZQ3A 1FJGL 4E6IA 3KF6B 1C9OA 1B6SA 2H1EA 2FXQA 2Q2IA 3L9AX 5KT3A 4K0KH 3HGBA 1SYBA 3VR6A 5C4XH 1XMQQ 1S10A 2QW7A 4A3FH 1C0AA 1TWFH 1LT6D 1S5BD 4NXNL 4LF8Q 2CWAA 3ETHA 2J0TD 4LUZA 4FS2A 4BBRG 2VPSA 5DLGA 4ECZA 5C0XG 1M6VA 3ORQA 2EXZA 5J22A 5J39A 1VQMA 3MA2B 1S97A 3SK6A 4L8JA 3BVGA 2VUMB 1NBWA 3AU7A 3MXNA 4BY1G 2B8GA 3S15B 4DR2L 1K8GA 3S24A 1B44D 1A6XA 1SLJA 1Q7YC 4EYHB 1E24A 2Z9HA 5KFLA 4LNQA 4N8FA 2IL8A 1L0XB 1V1OA 2P0AA 1UE1A 3MWMA 1L2FA 1EEFD 3TQTA 1E2VA 1NY4A 1CI3M 1CKNA 1XMOQ 1DZ1A 4EG0A 1BCPD 4ME5A 4BBRB 1C48A 3VR3A 4R4IA 5CAEB 2R61A 2E8GA 4YP3A 2E2HH 3F8TA 2SDFA 4IUNA 3N44B 1OXVA 2FJ2A 1WSCA 1WD1A 1QZHA 2I5HA 3WO1A 3N52A 3BQ1A 2FLPA 3OW2A 3GV8B 2R92G 3H0GA 3NWTA 3C0FB 4DK6C 1B2TA 1PTOC 1NJIC 4KJNA 4BY1B 1WI5A 2JP1A 4EVOA 2UUBL 4JV2A 4DV3L 4LF6Q 2PBZA 3V6JA 1HTLD 3MR2A 4JPBW 3QG1A 2N78A 1JMCA 4JI4H 1XWEA 3FRPB 2QF7A 5DG8A 1IBKL 3KLRA 2C9OA 5LOVF 4R7RA 2W71A 4OO1H 1VBGA 3BJYA 4UDUC 3RBDA 1QOHA 4IOAA 2EYHA 1EQTA 2F0QA 3HRZC 1W6JA 3JRWA 3E5NA 2FINB 1ASZA 4YHHQ 3M4OB 1TWHA 4CJ2C 2C2DA 3G71A 2ZTCA 2VS1A 3FHWA 4BXXG 2R92B 5COYA 3DXJC 4OX9H 2F0DA 4TQRA 3I2ZA 2Z4HA 4CC6A 1ZEQX 4HNTA 4KHPH 4K0KQ 3RV4A 1XNQL 4ULLA 1EUCB 1S0MA 4NLGA 2Q8RE 5C4JH 4FM9A 4ED6A 5J1ZA 4YCUA 3KF8B 2IY5B 4ECTA 1GUTA 4OWXB 1IL8A 3JAMW 3CHBD 3J80E 5FKAC 1EY8A 1RJQA 2FKLA 2LMCB 2RDHA 1DIKA 4DR4L 3H0GH 4LF5L 3MR5A 3RZDB 2EYLA 3S1RH 4OONA 2A5HA 3HKSA 3C1EA 3EFXD 1A2UA 4DAPA 4K2LA 3F8NA 2KBNA 3FMAA 5FLXE 1KQSA 3Q8QB 2UUAL 4LAAA 2DN8A 5BMVF 1B9NA 4IPCA 4NDXA 1T5XD 4KV6A 1DV1A 5EJWA 2ASJA 5LYJF 4GNXB 2ZXPA 1BNZA 1WFQA 1B04A 2CFMA 1Q1EA 4LF4L 1TWGH 1YEZA 2IPKD 3H15A 2F3WA 1X9NA 1ET6A 2B2UC 4C2MB 4ALPA 1TWHH 3DWAA 3OHAA 3C1FA 4HTHA 3NE5B 1Y8PB 1TS5A 1EIHA 1V51A 1LO5D 3BG3A 1SJHD 4JI2L 4HCSA 4EEYA 2HDMA 4EBCA 3AFPA 3CQZB 4IUTA 4RKBA 3HBLA 5EBCA 1IHZA 4K6LA 4Y7NH 2OH2A 4GKKH 4BA2I 5K2MA 2MO0A 2EDGA 2AQ1B 4IFDG 2RDGA 2P5ZX 3KLSA 2JA8H 1D5ZC 4ZCKA 2XTIA 4JI4Q 4MHEA 1ILPA 1U4PA 3T56B 3PIP3 2HT1A 2WIIB 3GIKA 1JOKA 2B8FA 2YZMA 4TV9F 4QWCA 5LMUH 4AYBE 1EUJA 1KBLA 3PO2G 3PIOA 4GC7A 3NSWA 2CW0D 4RCNA 3UDXA 1TAEA 4P72A 4ZLTF 2EYJA 1ZHSA 2LFNA 4NPSA 5KFWA 4OXPA 1UWVA 3PW7A 1MSGA 5HY6A 1CA6A 1HR0H 1S68A 5C3XA 4Q43A 3K7UC 4POFA 4DU9A 3U9TA 4OX9Q 3H4DA 4ECXA 4MTEA 4DV3H 1QNUA 4JC0A 4ZUIA 4KHPQ 3Q8SB 4YWLA 4G4KA 4NKLA 2SNSA 3MFHA 4C5BA 4JBWA 5KNDA 3H4BA 5IGGA 3G8CA 3E0JA 4N9PA 2GVAA 5KG1A 3A54A 4YR3A 2PPBC 1KLUD 1X3EA 1YNXA 5HV6A 3J81j 2EVBA 3WNZA 1S03G 5D3IB 1PA6A 1VQ6A 1TIID 2XNAC 1D7QA 4M8AA 1FKAH 5EKKA 4U7CA 1GYFA 1HFGA 4JI1L 2C28A 3PO2B 4GS3A 2YRXA 2B2WC 3KLSX 4RNOA 3VMMA 4NXNH 4L5SA 2UXBL 2DZDA 4A3LG 2KCCA 4WRDA 4UP8A 4EQPA 4QWEA 2EJMA 4RGMA 3CF5A 2QDLA 3GTOH 1XNQH 5IP9H 3CCSA 4R9WA 2CH4A 5C5LA 1CT1D 2BR0A 1GSAA 4QY7A 1GLVA 2Q8IB 4JI6H 5FPOA 4QWDA 2QYZA 2YZNA 2F0JA 2LSSA 2NZ1D 1QZGA 1I6VC 3RB3A 3W3AA 2DY8A 3K5OA 4DK0A 4ED3A 1CKOA 3R2TA 2JA7A 4K5XA 1CUKA 1U9RA 1N34L 1PTOD 3P1HA 1GXDC 3GTQH 5EGTA 4JOIC 4KLKA 2WKDA 1M7JA 2ZM6L 2UUAH 4Q0FA 4GKKQ 2EYMA 3T51B 3OSNA 3JAMi 1WJJA 4IJHA 4G7OC 3VPBA 1GUGA 1SYCA 3HOZG 4A3IG 1QVFA 1EY7A 3S1NB 5BN3A 4LF4H 3SEBA 2TMPA 3G6EA 1R9TB 1I50B 1I7LA 4R8IA 3RUZA 3R5XA 4JI8H 3S14H 1VMPA 3URYA 3MR3A 3OWFA 5FD5A 2EPBA 1CTMA 1KAAA 2IX3A 1CZGA 5LMUQ 1PYBA 3GTJA 2OWOA 4PNYA 3KALA 2EYPA 3HG9A 1LTGD 4LFCQ 4JI2H 2UXCH 2R93H 1Z47A 3CCEA 2UUCQ 3PN1A 1PH7A 3K5IA 5FLMH 1HR0Q 2F0WA 4ECSA 2JA6G 3OPOA 5I47A 2KEDA 5BPHA 4IRCA 3PW4A 2EY1A 4RGOS 4DV3Q 4DV2H 1B3AA 1JDBB 3BS1A 1I6HH 1MIUA 1UE7A 4A3DH 4MA5A 5CBAE 4ZAIA 4GOPB 4X62L 4DL5A 3GIJA 3HOZB 4A3IB 1TT2A 1VCIA 1V1QA 3FP9A 5IYCH 2YW2A 3CU7A 1RJPA 1NNXA 4JYAH 1F77A 4A3MG 5KG4A 1YJWA 5KG7A 4CGYB 5KFHA 4JI7L 3V6HA 4TUYF 1BR9A 1E7ZA 3FPPA 2JA6B 2A74C 4V190 2Z0SA 1W2BA 1XNQQ 1VQGA 3HFZB 5AFWA 2JYOA 4ZKBB 5KIXA 1PFNA 1A2TA 1VQLA 4JI6Q 5C3EG 3V05A 1PV4A 2WE6A 5C5JA 5LMNW 4WJ4A 4L5TA 2ENBA 1JOOA 1B33N 2FPIB 4DK3C 2WYOA 1SE2A 2XWBB 3CCJA 4DR7L 1TS4A 3BDLA 3MJFA 1A9XA 1YHQA 3S16B 1EHIA 2BH2A 3T1YH 1EY4A 2UXBH 3BU2A 4RH6A 2CQOA 3BDOA 5D1OA 3QOLA 1PH1A 4O4LF 4WFN3 4DL2A 3VYSA 1SYDA 4NB3A 5E1FA 2MUYA 4DK1A 4A3MH 2JEAI 1U5KA 4LWCA 3HOYH 2JEBI 1SNMA 4LF4Q 2QILA 2K5VA 4AQYL 4LF7L 1OXSC 1EZ1A 4JI8Q 5C3EB 4GKJQ 2PNHA 1O7ZA 3BDCA 5ELOA 4GLAC 3S1MB 1RK5A 3PCOB 1CFMA 4IZ8A 2ZJPA 2B63G 3NP8A 1PDQA 3NELA 1IKLA 3SXHA 4ILWA 5GADC 5J2UF 2HUGA 1UEBA 1GSHA 2CWPA 1JCKB 1T94A 1K83A 4JI2Q 5BN5A 1KNEA 4UP7A 1SBBB 2UXCQ 4Q0YA 1ULZA 1DOKA 3GTPA 2VA3A 3CCVA 4FO2A 2OTJA 5ELBA 1WD0A 3R23A 1EZ6A 2JSOA 3MFGA 4XT1B 1FNUA 3G6YA 5C0XJ 3HOWG 4ZQIA 4DV2Q 2F03A 3U9OA 3D8GA 4XQNA 4JV5H 1WTWA 4GNXC 1PX2A 1XTCD 4HIDA 5D65A 5EQ0A 4DL6A 5K36G 1CQJB 2NVTH 4JYAQ 2SNMA 4TRDA 3NHHA 2LY7A 3VPCA 1LTRD 1HZ9A 5JPNC 5KFXA 2B63B 2I87A 1KC7A 4A3KH 1KXLA 5KFRA 4JBKA 4MNOA 1HHVA 2ZXOA 3Q8PB 3V4ZA 1U4MA 4LJZC 2EOTA 4HIMA 1G8ZD 2X0SA 3Q1KA 3PW2A 2L1BA 1LTLA 3HOWB 4L63B 3S17H 1TWCB 3ULJA 4DL3A 2ZDQA 3I4NH 4JBMA 1EL0A 2VXWA 4DR1L 2RDJA 1GUOA 1K83H 4UHVA 4IHJF 4PDBA 4Q8FA 4JI7H 5IODA 2EE1A 5LL6X 2ASLA 2YYZA 1SROA 3IG0A 5GAHC 3T1YQ 1Y1VA 2DGYA 2J4XA 2UXBQ 2I5MX 3FKIG 1B53A 5C1OA 5KFEA 2NUAB 1EIYB 1EEID 4F4ZA 1BXTA 3K57A 1GJXA 1O7LA 5J2TF 1STEA 1DXMA 4X3TA 2YCHA 4J9NA 1OWTA 4DUYL 2JE6I 1IYJB 5J3BA 1XYIA 2HVSA 2BQ3A 5M5WH 3GTGH 4RAYA 4O1NA 1N8RC 5CA1F 5CV9A 2PQEA 2K52A 4OHJA 5IY0A 5BR8H 3RFCA 2A73B 3TDQA 3RZOH 4GC6A 4GLVB 1TWAH 1OO9B 4LFAL 3CCRA 1VQ9A 1PTOH 2AWOA 4XYLB 3KLWA 1BBUA 1CHPD 2FLLA 1MHWC 1L1OC 3IFDA 4APMA 4OWWB 4ED1A 5C6AA 2GLTA 4ZOLF 3FKIB 1K28A 2YL2A 4QJFA 1N32H 1VQOA 4C3HG 2NN6I 3P75A 4CDEC 4IUUA 1QWYA 1RJTA 3GO5A 1QVCA 4LF7H 1OXXK 1PFSA 3QIAA 4FYDA 5HBRB 1HZBA 4JV5Q 4EGQA 4DV7L 2F0HA 3K5LA 4QMGA 2I07B 5IYDH 3N8DA 1K1SA 2B2UA 5KFYA 1SXTA 1NTGA 1VMCA 2WAQE 3MFYA 3I55A 1HRJA 3K5HA 4L6TB 1FD7D 4B9XA 1PLFA 4YY3L 1YNJC 1H9MA 1NR4A 2OF1A 1RKNA 3EIVA 1X54A 2R7MA 4O3PA 4MV6A 5KFAA 4EYIB 3ZJYC 3T1HL 4I55F 2W9BA 1I4RA 2EXDA 3T53B 5JVG3 1H9SB 3PR4A 1HCZA 2NVYA 4N8X1 3Q2OA 3GTMA 3RAQA 4C3HB 2VQEL 1JXLA 2YU9H 2E2IA 3ITPA 4O42A 1BDOA 4X65H 1RODA 4ED7A 2AQ4A 2BH8A 3BVZA 2ZXRA 2DLNA 5AJ3L 5BN4A 3HOXH 3PR5B 3M9OB 2K01A 4JI7Q 1TWFB 3KBXA 3HOUG 1AZPA 1DD2A 2QDBA 1VQHA 3H3VC 4IFDJ 4J9LA 2F0IA 1P16A 1PH2A 1YZ6A 1K8MA 2D5DA 4DL7A 3S1QB 5KFFA 2VQFL 3KAJA 4KD4A 3TIGA 1KTKA 1BJTA 2UU9L 4DR3H 1DOLA 1KABA 2B2YA 2V1CC 4KHZA 2XGPA 4JK1C 3CMEA 3OHXC 4U6PA 4JW0A 4C1NK 4G7ZC 1Z2PX 4KN7C 3Q0AA 4AYBA 4A3GH 2HVRA 4QUCA 3NK9A 4GOPC 2KOLA 4B3MH 3RNUA 1WTXA 4DUZH 2NWGA 3MWYW 4DAVA 4QIWA 3DHQA 1PH4A 4B3SL 1C4QA 3RLOA 2NYZD 5KNBA 4IWXA 4M9UA 3LNNA 1I94H 2DNCA 5BR8Q 1G2SA 3QO2A 4DA2A 4DL4A 1HQMC 2KCTA 3QR8A 2EZVA 4MTNA 3MWEA 3I7FA 2B2WA 2EY6A 3I90A 4POGA 3SI8A 1YITA 3HOUB 1CE8A 3GIDA 1LTTD 3J81W 3C3LA 4ZHQF 3I91A 5IWAL 2NVYH 2NVQB 2E2HB 3MZ5A 1Z6HA 2E2IH 1N32Q 4MV4A 2YS6A 1ESRA 3I4MH 1W93A 3M3YH 2ASDA 4LF7Q 2OTLA 1L2ZA 3MXPA 5E4WC 5CV7A 4DNTB 1XNRL 2SOBA 4XT3B 1EWIA 1IYVA 2NVXA 4PV1C 2W8KA 1B9MA 3ORRA 4LF9H 2BA0A 1PVOA 4A4IA 2VQDA 2F1MA 3TMEA 2XCAA 1AZQA 4YQWA 1OXTA 1PZKD 3B6YA 3EJIA 4JOIA 2DUDA 5C5MA 1I3QH 1UNSA 2A69C 2VL6A 4RHRA 4FU0A 2E74C 3H0GG 2R7ZH 2BOSA 1VDZA 1BBWA 3MXNB 4HCEA 4ZRZA 3U4VA 3JAML 4CDCC 1Y8NB 2HQLA 2AMCB 5C4ZA 3F2BA 3E6ZX 1SFOH 1Y69U 1N48A 1DOMA 4A3EH 3ZYYX 1SE4A 4X65Q 3K0YA 3SK4A 1MGSA 1JJ2A 4A3JH 2RF4A 5FK9C 3OTOL 1F2YA 2ATWA 4RB3C 4QW9A 2DPIA 1CKNB 4J9RA 1B6RA 1IBLH 5C4JB 4KD3A 3JSLA 3NENA 5DAUA 3CC4A 3PGZA 5ELDA 3A55A 3A0JA 2L15A 2WKCA 1QG7A 4QGUA 4DV4H 3RGXA 1ZHQA 1E22A 1ENAA 1G91A 2R7DA 3T1HH 1AEXA 1Z2NX 1SYXB 1Q8KA 4EBDA 2LXKA 4FBTA 2F52A 4DR3Q 5FD6A 4ZI7F 3H0GB 4L5QA 2TSSA 3NBIA 3S1RB 3PUZA 4B9WA 2W7PA 5JEAJ 2NVXH 1X3PA 4RWSC 4B3MQ 1KJIA 1MKHA 4KY5A 4DUZQ 4X64H 2F3VA 1KDAA 2UVWA 1VS0A 3CC7A 2R8JA 4A3BH 1TA8A 2K5DA 1LM0A 4UPAA 1MI2A 1I94Q 2JA8G 3CKIB 2MHVA 3DUZA 3PIO3 3TINA 1E0BA 3UI2A 3Q6SA 5IGCA 2B2VA 1VQJA 4DV0L 2FK3A 1B7YB 3BABA 1TWGA 2VQFH 2NN6G 1SYFA 4EQ5A 3MHBA 3R5FA 1UNNC 3G6XA 2PI2E 1HNZL 5IIFA 2EJFC 4MV7A 2V9WA 3RB0A 5KG0A 2VZAA 4IO9A 4ZYSA 1WOCA 1Q8IA 1DGSA 1RYSA 1ESFA 4KTAA 4EFEA 4B08A 1J6QA 4F7XA 2JK8A 1PH3A 1K73C 1JE5A 3U50C 2VUMH 4JI5L 2DIKA 4FS1A 1YNJD 4LF9Q 3JAMc 4KK7A 3S15H 3P20A 2JA8B 5I6YA 5JAVA 4RAUC 5A2QW 3RLFA 4FDBA 1V9PA 4TSSA 3UE0A 4ED2A 3TP7A 2F4VL 4ID6A 4QW8A 4R4OA 5IWAH 3PW0A 5DM73 5CV5A 2NZHA 2ZTEA 1FJGH 5DQGA 3CD6A 2IHFA 5A35A 3M7NA 1UC8A 2Q2TA 5ELNA 2JA5A 3W2DA 4P2CB 3RB6A 4FF1A 1XNRH 4BBRH 3KK7A 3RTXA 3T5JA 1KDBA 3I56A 2RCNA 5LL6S 1FNWA 1K3RA 4JI3L 1JE4A 1JQYD 2R7FA 1FGBD 4IPGA 4NW2A 3PUWA 4XXEA 3A8JE 5M5XH 1N36L 2ZJRA 2ICIA 4X3SA 4MN3A 3J81i 3BVMA 3FPUB 1IBLQ 1F2MA 1ZYRC 3UDFA 4MTDA 5E3FA 1JWMD 2W7OA 3HKZA 4BY1H 3MTSA 4DV4Q 1RD9D 2ASBA 2PNRC 2Y0SA 4Y8VB 4H0LC 3T1HQ 1MBYA 1STHA 2A6HD 4DR2H 2NU9B 5KG6A 4A2AA 2L5TA 2W6OA 1KHIA 3ULLA 2XIGA 1S5FD 5CYUA 4XX0B 3S2HB 3L2PA 1R4QB 1PFMA 1X55A 1EYGA 4X64Q 1HR0W 1AUVA 1JR0D 3RN2A 3MFIA 4O3SA 3EPGA 4DXGA 3GTOA 3EVQA 1DM0B 3NTKA 3M4OH 4UCRA 4JBJA 2RHSB 2FB9A 3AMUA 3I8ZA 1CSPA 1ET9A 4HJ7A 4RMFA 5EWGA 2VQFQ 4R4TA 3MXGA 4XTCS 2K05A 2F4IA 3BQ0A 2JA5H 3H40A 4H02A 1GOZA 3E9IA 1HNXL 1HA6A 1IW7C 1VQPA 1IBML 1RL2A 2UUBH 3GTQA 3LMLA 3I4LA 3TQYA 5KFVA 1C8CA 3GTLA 1X3FA 1GO3E 1ASYA 2CCZA 3RZDH 3GP7A 3VYRA 1Z9FA 1C7YA 4X66L 1MSHA 1XPUA 5F2DA 2KSWA 3I72A 1Y1WA 2KQ3A 1W3SA 2AWNA 2M05A 3N40P 2VNUD 4DV0H 1S0NA 1SEBD 5IYCG 2GN5A 2A69D 1HH2P 3JZIA 3TS2A 1SR3A 2JA7G 2N55A 4ME6A 3S14B 2WB1A 3M7GA 2RGRA 4UY8C 4HIOA 5IWAQ 5IT9L 1HNZH 4NP5A 4YAJB 1K9MC 2YRWA 1EIGA 2ZDHA 1FJGQ 5KFKA 4H44C 3VR2A 1Y14B 1KDCA 1PH5A 2R93A 1KD1C 3GD7A 4HSPA 5KFQA 1XDNA 1XNRQ 1SNOA 4WJ3M 3GV6A 1JICA 3UQ8A 3DWPA 4LSXA 1WCMA 2DPJA 4NXNQ 2PMZE 4A93H 4U68A 2XSCA 1D8LA 2K7VA 2LS01 3OW7A 4CJ0B 3A5UA 5KFOA 5KFCA 3H20A 1SNCA 5F9NA 5IP7G 4DV6L 1GVPA 2O2LD 4X3UA 3RLNA 3CQZH 3PUVA 5D8DA 1L1OA 5JOBA 1CKMA 5GQOA 4DR4H 4LF5H 4RA8A 2F0LA 1J5EL 4A3CH 3ETJA 2JA7B 1VQKA 2FMMA 4EFBA 1B70B 4ECVA 1UAPA 3GDEA 3RGZA 4DR2Q 1KLGD 1LACA 2F0GA 2SEBD 3F2DA 4DAYA 3GTLH 1XXGA 5LMNL 1MZBA 2A68C 1IKMA 1IOVA 4KMUC 1YNND 2W6NA 1NAPA 2N3SA 3PV0A 3Q8RB 4C3IH 1Q3LA 1E2WA 1Y1WH 2HJWA 2NU7B 1Q90A 1VQAA 1GD7A 2R82A 3KHHA 1UUPA 4DAMA 5C44G 3NBHA 3J7AF 2BDOA 4ECUA 4IPDA 3R3OA 1HUNA 1EQRA 2R85A 4OEMB 4L1KA 4TQUS 1B8AA 2J6TA 3TSSA 4J9MA 2NBFA 3GTJB 1SCUB 3RR5A 4F4XA 5ELCA 3GIQA 2HQEA 2JXMB 1X3GA 5JEAG 4YCWA 5F9LA 2A6ED 2FK1A 5KG3A 2R84A 1E2ZA 4IFDH 1PYWD 3SDZA 4ABNA 2K04A 2WAQA 3I4OA 3OSPA 1WCMH 1VQ4A 2UUBQ 5I9OA 1I6UA 4ETSA 1CQFA 4IR9A 1BKBA 4O2DA 4EX5A 4BBSH 4A76A 2R8IA 5IT9W 1D5XC 5IT9c 3I70A 2Z6BA 1RDPD 3CPWA 2KHJA 4GZYC 3PO3G 4O2BF 5D14A 1IBKQ 3PO2H 1NMGA 4ZKCB 5T14A 5C44B 4C3JH 3T13A 3GV7B 1E4FT 4DV0Q 4R1JA 4I7HA 1EQVA 4UP9A 1WTRA 2B29A 1ICFB 4GLXA 2FPPB 2EY2A 3JAME 3A74A 3ERSX 3K7AB 4KJOA 4RZRA 2KHSA 1HNXH 1QCBD 4ODGA 3WDNA 4A3KG 4LH7A 2F3IA 1IBMH 2PVPA 3QFFA 1VQCA 4HNUA 4H7BA 1ONLA 5K5PA 5C1PA 2CQAA 1WVLA 2DNEA 5KEEA 4TV8F 1T9HA 2F0EA 1KRTA 2CW7A 3V2TA 3W1GA 5DLQE 4Y52H 1CS0A 4X66H 3IAYA 1S3OA 5EKIA 3SK5A 1ZYRD 3LWUA 1FGUA 4DLKA 4K2KA 3I4NG 2BE5C 3PO3B 4I7AA 3RIZA 4K5WA 1JB3A 1SJED 3AEVA 1WTVA 4DR4Q 4LF5Q 4R8UA 3PF4A 4JI1H 4CDDC 4HR7A 4R4QA 4JUZA 4LFBL 3LGJA 2CW8A 1R9TH 1XPOA 4A3KB 1EOTA 3FEWX 3ULPA 2AHOB 4DR5L 5D1OB 3N43B 2UUAQ 3CCMA 4NXML 5IYZF 3OIQA 1JB7A 3U4ZA 4P71A 1YHAA 2Z6KC 5EPKA 3SR1A 1GUNA 3ICEA 3K80C 4IPHA 2XWJB 2F0MA 3PUYA 4HSVA 5JJKA 3H3VH 1SNPA 2RDFA 3UFXB 2Z1CA 4KHVA 5LHY1 4X6AH 3S17B 3A7LA 2K5WA 2F0VA 2C35B 4XYMB 4XQQA 3I4NB 2OXPA 4RFBA 3VPDA 4FVMA 4K5VA 3DEOA 2Z4IA 5C4HA 2I8CA 1FL0A 4XQJA 4JI0L 1N34H 1QB5D 2EQSA 1B3QA 1K83B 5KRUA 1IW7D 4CKBA 1L0YB 1VQIA 3RJ0A 4LUOA 4A3IH 3GTPB 1VQBA 1W6KA 2ZM6H 2MO1A 3F2UA 4J9OA 2NU8B 4OO1I 1CQVA 3PQIA 2FFKB 4OIJA 2I5LX 5IYBH 1STAA 2PW5A 1XTDA 4B3TL 4FF2A 3SE0A 3UDGA 1XMQL 2EY5A 5FO7B 4RNNA 2AUJD 5H1SE 2QCPX 5M5WB 1N33L 3GTGA 3J7ZC 3F2CA 2JQOA 1VAJA 3MXUA 2VOBA 1SYEA 4C1NI 5IYDG 3TS0A 1KAWA 1HJPA 2EYFA 4M1UB 2JA6H 5ELFA 1Y1VG 3S9WA 3BZDB 4OELB 2XRQD 4ECQA 2WFWA 1A3UA 1HNXQ 1PZID 1TWAA 1PTOB 2D62A 1IBMQ 3S2DB 3BQ2A 3N41B 2IW3A 2ICEC 1AN8A 1SE3A 4MA0A 1G291 2JEGA 5E4XA 1VQ7A 1RJRA 4X62H 2J6UA 3R8BA 3GILA 2M2LA 4X66Q 2HDLA 3STBD 2PQAB 1GUSA 1Q46A 4BY7H 3S16H 2W6QA 5KT7A 2E76C 3CCLA 5M5YH 1EU4A 2J7ZA 1XMOL 1YIJA 1HNWL 2B63A 4O2AF 4IOCA 1HA5A 5EAYA 1FNVA 1AE2A 4IQZA 4JI1Q 5JVDF 4O4HF 2RA4A 2OQ0A 3TEHB 1Y1VB 5CV6A 5DNFA 1AH9A 1WTHA 2A68D 5M9OA 3RF2A 2R87A 4RHSA 1STYA 2LXJA 3RD4A 4EBEA 1Z7TA 4AH6A 4CKEA 5C3EH 3RBEA 5M3FG 1X6OA 2NUCA 2ZTDA 3I3CA 4ME3A 1YBYA 5FPRA 2AQ2B 3WOFA 5CC4A 4V0BA 4CC5A 4GN5A 4LF6L 2HIVA 4S3SA 1RF2D 2AQ3B 2QK4A 5DQIA 4YJ3F 2MPMA 3J7AV 4IWYA 3GQBA 2PI2A 3BZKA 1STBA 3U9SA 1KNAA 1RHPA 2YU9A 2IX1A 1U4LA 1JLLB 4LK1C 4RZQA 2NZOA 3PMFA 4DR7H 3K3VA 4Q8EA 3R93A 4ECWA 4YBZB 1ENCA 5KFNA 2HIXA 1N34Q 1CQIB 5KFPA 3KHRA 2OLSA 1E3PA 4YHHL 1PXUA 1LV9A 4PMBA 3GTKA 2O4XA 4DR5H 4CDFC 2MFIA 5KFUA 2ZM6Q 4UFZA 4NXMH 4KY7A 3KJPA 3D4DA 4MV8A 2O5IC 1FR3A 5M3FB 5IGEA 1WTQA 5DLFA 1JX4A 4K0KL 4IN3A 1SAPA 5LA6F 2XGQA 4DNRB 1BNCA 3NWSA 4AQYH 2B63H 1TKWB 2LKVA 3QZ8A 2K4KA 2E2JB 1M0WA 4A2BA 4KI0A 1VBHA 2W9CA 2R6FA 3J81L 5C4XG 5IT9E 5JVLA 4JVZA 5FJ8H 3K6OA 4A3FG 1UE5A 5LP6F 2K75A 2R86A 1JJCB 4MV9A 3L4KA 1QNKA 1QUQA 4HJ9A 5KT6A 1K1QA 4IURA 5HGQA 2NU6B 1SNDA 2XIWA 1V1PA 3G6JB 1CHQD 4J6HA 5L1LA 4J8QA 1TWCH 3X3NA 4QUFA 5I4DA 5M3MH 1HFNA 1TU2B 1JOQA 5KT5A 4LH6A 3KDFA 2W9BB 4AYBG 4B3TH 5CORA 1FVIA 4J9QA 4X62Q 3J80W 2NVYB 4XIGS 3GTMB 3TP8A 2AKWB 5K36H 2BE5D 2RSNA 3TREA 1GGOA 2E2IB 4DV1L 1N33H 1T36A 2XGTA 2C2EA 1MJCA 4KKTA 3A7AB 3M3YB 2G5DA 3VDYA 3T5LA 3BG5A 3GV5B 1SMYC 4EGVA 2FE3A 4K8JA 2O5JC 2GPSA 2ZJQA 4QWAA 3EPIA 1PRTB 5C4XB 4OGQC 4A3FB 1IXRA 3PSIA 3GTKH 2YS7A 4ED0A 2B2TC 2K50A 1HUMA 1JDEA 1KJ9A 3BA9A 4PMCA 2F0FA 1LLRD 2VPQA 1O80A 4OWTB 1I5FA 4KKUA 4OIKA 2HGSA 2BA1A 3K0XA 2J6SA 1RK6A 2ZJTA 5KFJA 3N42B 5DG7A 2C5CA 1I3QA 5KG5A 2F0KA 2R7ZA 2RCFA 2A6HC 4RGNA 4AYBB 4YCVA 1QVGA 4IZOA 4JV0A 1M1KC 5EKLA 4IR1A 2DJGC 4QWBA 1AUXA 5DGAA 4QIWB 1HNWH 4JI4L 1SMXA 3JC66 1U0LA 4H13C 4DR1H 1WYDA 3T4AC 2MJ8A 2KJXA 3FKIH 5KFZA 4HMJA 1SFOA 1HPCA 4DR7Q 3IN5A 1C3OA 2BQUA 2YZGA 4B3RL 4O3OA 3WWVA 4OO1G 1II3A 1STNA 2R3ZA 1X3QA 5DG9A 3CC2A 3RMHA 2RKSA 4DR5Q 1BGWA 3J81c 1OXUA 1TY2A 4NXMQ 3ER0A 4DUYH 4PQXA 4KHPL 1BCPF 4C56C 2B3GA 2KCMA 1VQNA 4AQYQ 1LTBD 2RVLA 1E4EA 3EN2A 4UCVA 2G9DA 1UE6A 1X56A 3L3OC 4HN7A 1HTPA 4KY6A 3OYYA 2NVXB 1KJQA 5CR3A 2HHHL 2XC9A 4LFAH 3E3XA 3CPFA 2CHBD 4HAEA 1L0WA 3H6MA 1D1IA 2IX0A 1K8OA 4LW1A 1V8QA 2VA2A 2PMZA 3KOJA 5KYIA 3BJUA 1H9JA 1RTNA 3H09A 3KF6A 4UAIA 5EDWA 4I50F 4FXGC 5IGDA 2UVUA 1M0TA 1SEIA 2K5QA 3KUPA 4IAJA 3RN5A 1KRSA 1PH9A 4B3TQ 1KJJA 2NTSA 1A63A 2JEIA 3CMAA 4XDXA 2UVVA 5CMDA 4DV7H 5A2QL 1EY5A 1LABA 3GLKA 4PZ6A 1N33Q 3OOCA 1P8LA 2YV5A 4F4YA 3S1QH 1S5DD 3M4IA 4C5CA 1BF4A 2K33A 2D0PA 1CZWA 2R8KA 1PZJD 3TQ1A 5G3LF 4YY3H 1H9RA 2L9HA 2VUMA 1JORA 4FNFA 4Q5VA 1UC9A 2L0CA 4P75A 4J0MA 1GKHA 4YAKB 2BQRA 3NTIA 2RHQB 1C30A 3K5MA 3D0FA 4GKKL 4IUQA 3V96A 4BWGB 1I4HA 4FXDA 1ML0D 1JIHA 2VQEH 2W6ZA 4DV1H 1VF7A 3A8KE 4UCSA 2NB0A 4HMIA 1HNWQ 3HOUH 2Q2HA 3GQCA 4DR1Q 1YNNC 2V58A 3RUPA 3HOVH 1MJEA 5EWEA 4AIMA 1A3TA 1DCZA 2NVQH 5HURA 5LMUL 5M5XB 1YJNA 4RU9A 4ED8A 1GHJA 1PK8A 4LFCL 2E5LL 1B50A 2UUCL 4LMQD 4PG3A 1TWGB 3OMGA 3J80i 3H3VI 5KFDA 2UU9H 1HR0L 1AW7A 2N88A 4EQNA 2QA4A 1RIPA 2W9AA 1GSOA 3QZ7A 1TWHB 4DUYQ 2JA5G 4RB2C 3NPPA 3A5ZB 3FVQA 2A6EC 2ES2A 3BZCA 4RKLA 3EROA 2AUKA 2IT1A 4LSAA 4B3SH 5KT2A 3M9MB 4CKCA 5BPFA 1G6ZA 1VQ8A 3J7YW 5D1PA 4Y7NB 5KKNB 3DEPA 2KVMA 1WTOA 4CJ1B 2V4RA 3HB9A 4B3RH 1SRUA 4LFAQ 1LT4D 2L55A 5CBEE 5FOBB 3K3PA 3CRKC 3HKZG 4FXKC 3R5HA 3C2PA 1A3VA 2PW7A 3L7ZC 2Y0SG 3JSNA 3QJYA 1M90C 3C46A 3FMCA 3TRZA 2F0UA 1LTSD 3HP3A 1N9WA 3TZUA 5G3LD 2R92A 1NSNS 1LT5D 4Z9CB 4RB1A 3OMCA 1G6PA 4TVAB 5CGKA 5JVH3 2K03A 1JC7A 1J8IA 2Z6KA 3WO0A 3MAQA 2JA5B 1LT3D 2YTYA 3KF8A 4DPGA 4DV7Q 1O7YA 1SMYD 4JI6L 1V4YA 3OUUA 1B1ZA 5C0XH 2FJZA 2HHHH 5IP9G 2DY7A 5T1GA 3W5OA 4O4IF 4J1MA 3EYYA 3M9BA 4A93G 2G9HD 1YVCA 2BDNA 2KHIA 2JEFA 4YY3Q 3BAAA 3NGDA 4F8MA 3HKZB 3OUZA 1NCVA 2Y0SB 2A19A 3I12A 4A3CG 4XYQA 3TP5A 1PFBA 1S9FA 2VB2X 2FMAA 2VUGA 1O75A 3Q8DA 3G6VA 2VQEQ 2A1AA 2RSOA 2K28A 1NR2A 1S4ZA 2L4NA 5EPLA 4GNXA 4DV1Q 1W96A 3PZPA 2DWCA 4YWMA 1N56A 1E4GT 4C3IG 1Y1WG 1EY9A 3OTOH 4JI8L 3MVVA 4GKJL 5AJ3Q 2HCIA 3GTOB 2V5AA 1B4OA 4O0AA 2I0QA 4DKAC 4C2MA 3NEMA 4U673 3RAXA 5I2XA 1RCVD 1I4QA 5CB4F 2W57A 4A93B 1X32A 2R92H 2WB1G 4G3IA 3D3RA 4HYKA 3FDSA 2V4QA 2UXCL 3O13A 2R8HA 4ZK9B 3SVMA 3CQZA 1SDFA 5DGBA 4IUPA 3UE1A 2IWHA 2UU9Q 5JH7F 4M7EA 4QB4A 3P7JA 1WTPA 1D1KA 2R93G 3BYYB 4DV2L 5FLMG 3J81E 3GTQB 4CHTB 1NMFA 2R6GA 1WCMG 4B3SQ 2PZUA 3GTLB 1VF5C 3QOJA 1QJOA 2D2CC 3N6RA 3MC0B 1PTOF 3T16A 4HIKA 2MP1A 4BBSG 4A3DG 3DF7A 2NN6H 4C3IB 1TR5A 3IL8A 1Y1WB 5GONF 4B3RQ 4QF4A 1PRTC 4JYAL 2KECA 1TY0A 3OWEB 4RUAA 3RB4A 2OT2A 4LFCH 2E2DC 2E5LH 4C3JG 4G7HC 4QIWE 1I7NA 2UUCH 4O3RA 2QEXA 1JWSD 1BCPB 2UXDL 1EUDB 1O78A 3Q24A 3M85A 1CSQA 2ZT9C 2WB1B 3I73A 4BXXH 5EWFA 4DV5L 1TS2A 4O3NA 2Q8TA 2K5HA 5KFIA 2PZWA 5KYLA 3CRLC 2B2YC 1TS3A 2BCOA 1NUCA 4DR6L 2R93B 4I4TF 4K6DA 1KC8C 1H95A 3NQIA 4F4WA 1Q1BA 3KHGA 1AFPA 2PO4A 4FF4A 4C2MH 2KCNA 1WCMB 5GAGC 2CQYA 2HHHQ 4E4TA 1GUWA 2JN4A 3LWEA 4ZUJA 3DLLA 4JI5H 1I6HB 4BBSB 1D5MC 4A3DB 1F9QA 3STBC 2N49A 3IFTA 5I9PA 4K8IA 2D0OA 3RV3A 1L1OB 1Z2OX 5TSSA 2F4VH 1BQQT 3SK8A 4C3JB 3T1YL 3S2HH 1RTOA 1H9KA 5H80A 3V6KA 2ALZA 3KYHC 4RCOA 4ECYA 1STGA 2E75C 2MQHA 3TBIB 2CZGA 4EEQA 2PN1A 2ZDGA 3GIMA 1TVXA 2YYAA 1A8VA 2WAQG 4DAYB 5I6WA 2AGOA 2KA7A 2QGQA 1BBXC 1YI2A 4JI3H 1T3NA 4PZ8A 1N36H 4BWSC 5JJIA 4HJ8A 5ELEA 3OTOQ 1EOVA 2FHTA 5IGBA 2I46A 3U58A 2F0SA 1SYGA 3NBHB 4DXFA 1KJ8A 5IGFA 1LYLA 2CH4W 2WACA 3HOYG 2PYKA 3VR5A 2O03A 1BVSA 3OIPA 2PCFB 1PYSB 2QEJC 1F2ZA 1JKJB 2H5XA 3HEJA 4HEDA 2K5NA 2PZTA 4K14A 2MCTA 2C00A 1Q12A 2MNAA 2RGVA 5CV8A 4FF3A 5EZYF 4WORA 2KEEA 4P73A 2WAQB 5DEHA 4J9KA 3M9NB 4NMZA 1R9TA 1I50A 5KNCA 4X3KA 4JV5L 2JA9A 1FYCA 4GKJH 5IYBG 2X69A 1CA5A 2W8LA 2YTXA 2F0OA 2VY3A 3ERQA 3EQLC 1DJRD 4MAMA 3CW2C 4UCOA 4WBNF 4A3MB 1XPRA 3Q22A 3EBEA 2B2TA 1EU3A 3UDIA 3PIPA 3HOYB 2E5LQ 5DM63 2CVRA 1AE3A 3CCUA 4TQSA 2AGQA 5L1IA 1DV2A 1EIFA 5HGTA 1HNZQ 3FDTA 5A2QE 2X6LA 4EQOA 4DNIA 4LMYA 5C3WA 3Q23A 3MR6A 3M4PA 4J15A 1PRTF 4GOPA 5L1JA 2OCEA 3CXCA 2N8NA 2D9UA 2HD3A 3L0OA 4RB0A 3D4WA 1IYUA 5JUMA 2JA7H 2W6MA 4PWQA 2C22A 5FO8B 4Q44A 4N9TA 4JI5Q 4BY7G 3KJOA 1EY0A 2KENA 3VR4A 5LL6b 1A62A 1S0OA 2UXDH 3X3MA 4MV1A 1VKZA 1XX8A 4DN4M 2B2VC 2F4VQ 4DV5H 4A3LH 1K0SA 4LUVA 2FPGB 4R8UB 3G48A 2IMWP 3TZDA 1WR2A 4HR7B 5KG2A 1I4GA 2NVTB 5KFGA 2KUMA 5ISRA 3OSOA 1EZ8A 3S1NH 5CA0F 2JA6A 3VYUA 4DR6H 1SN8A 1I50H 3A56A 4QCLA 2XN9C 5IP7H 1JWUD 3GTJH 4JI3Q 3EA6A 1V43A 4WD3A 1N36Q 2R7KA 1F9RA 1DONA 1QE6A 1VQEA 1JJGA 4PZ7A 1Q81C 4F87A 2XD4A 4GN3B 5BR8L 4DV6H 4O3QA 1I4PA 4BY7B 2XCPA 3M4YA 4R4CA 4YIJA 3JRXA 5M5YB 1J5EH 3TIIA 3VA5A 2XRSD 3IKJA 2F0PA 1OTCA 3K58A 1HQRD 1TXYA 2RBMA 1EWCA 2J9GA 1IZ6A 1WH2A 1EYCA 1JT8A 3HOZH 3KHLA 5LMNH 2UVRA 3HKZE 1N32L 3OHBA 5C44H 1KEEA 1U4RA 5IE8A 3AB9A 1MD2D 4IJLA 2Y0SE 3W1BA 1PMRA 3CP0A 1VQFA 2W6PA 3PVXA 1EWHA 1CK1A 1PRTD 2V59A 1LTID 3TN2A 3K7AH 3K81C 4BA1I 5JPMC 2K14A 5JEAH 1EYDA 1T5EA 4LF8L 3G7LA 3GTGB 2RDIA 4I65A 2WDTA 4TKOB 3ONAB 3QB3A 5FJ8G 4RGTA 1LTAD 5LXTF 1PH6A 1EYAA 3KFUA 1BUVT 2OQKA 1KL9A 3RZOB 3N6XA 3V4SA 1XJVA 4JCVE 1M4VA 1TWAB 4UCTA 4FP5D 4CBVA 3LWBA 1DYQA 3M4QA 3R2IA 1AP0A 3PO3H 1ZXTA 4F88A 3CVZA 1A0IA 1YHBA 1HZCA 5M3MG 1ENFA 1S40A 3NUCA 3DWQA 4X65L 3H94A 1SSOA 1HZAA 2FK2A 3ND8A 4J9PA 3SE7A 1EYZA 4PMWA 2FLNA 3J7AK 3J7A5 2UXDQ 1LUZA 2WTFA 5EBDA 3KXYT 4IRKA 2ALYB 2L11A 1E1OA 3ND9A 4KN4C 3TP6A 1BO0A 1O7IA 4DV5Q 3HOXG 1R4PB 3J80L 4L5RC 5C0XI 5KX5F 5L9XA 2EIFA 4DR3L 3E5SA 5GROA 4DR6Q 2NTTA 1CM9A 2ATLA 1X65A 2WB1E 2PQAA 1TWCA 3S1MH 1IOWA 4B3ML 4XYOA 5M3MB 4DUZL 3T5KA 2ID0A 4HJ5A 3K59A 2IJ0A 5FLXL 5KFBA 5I2YA 1RYRA 4MZ9A 4A3GG 4APVA 3DM1A 1I94L 4DV6Q 3MWDA 2IHEA 1ZKOA 3KTMA 3GTPH 3GIIA 4G57A 2YU9B 4RNMA 2W70A 5IOCA 2GA4B 3AYHB 5EOYA 3PW5A 1J5EQ 1BCPC 1F2LA 4LFBH 2K6AA 2GVBA 1S5CD 1J9OA 5KFTA 4A75A 3HOXB 3GTKB 4DFAA 3IRBA 2OEOA 5LMNQ 5EPJA 4YWKA 2R7NA 3MEFA 3E9HA 3K5NA 5C8YF 4RAZA 5DQHA 2GPWA 2QKIC 1IL2A 2CKZB 2I80A 3I4MG 3D31A 4R8NA 1PHJA 4HNVA 2W9CB 4HQ6A 4A3GB 3S2DH 4LF9L 3CCQA 1K8AC 4IUVA 1HXYD 4JI0H 1VQDA 5E7NA 1S72A 2JEJA
chains in the Genus database with same CATH topology
1X3FA 1QUQB 4DK3C 1GO3E 3SGIA 3D0FA 1GM5A 3RZDH 1ASYA 2CCZA 4GKKL 3CCJA 3HOWH 3E0EA 1Z9FA 1C7YA 4X66L 4DR7L 1XPUA 4GN4B 1YHQA 1W3SA 2AWNA 2BH2A 2VNUD 5IYCG 2GN5A 1HNWQ 1HH2P 3BU2A 3TS2A 1SR3A 3HOUH 2Q2HA 2YTVA 3KDFB 2JA7G 2R7ZG 2CQOA 4DR1Q 3F1ZA 1MJEA 3HOVH 1PH1A 4HIOA 4AIMA 5IWAQ 4UY8C 3J80c 4NB3A 2NVQH 5LMUL 1K9MC 4A3MH 1YJNA 1Q82C 2JEAI 1Y1VH 1U5KA 1SE8A 5GAEC 1FJGQ 3G4SA 4LWCA 3PF5A 2JEBI 1Y14B 4LFCL 1EQQA 3HOYH 2E5LL 1PH5A 4LF4Q 2K5VA 4AQYL 2UUCL 1KD1C 4PG3A 4A3EG 3J80i 3GD7A 1IBLL 1OXSC 4LF7L 3H3VI 4A3JG 1Q86C 4JI8Q 1XNRQ 1HR0L 4GKJQ 4WJ3M 2PNHA 2QA4A 5ELOA 1RIPA 4DV4L 4GLAC 3PCOB 2WP8J 2ZJPA 4DUYQ 4HJAA 2JA5G 3NELA 2PMZE 5FLXc 4NXNQ 3A5ZB 2B63G 4A93H 1D8LA 1G51A 5GADC 2ES2A 1UEBA 3A5UA 3BZCA 2CWPA 1E1TA 2IT1A 4JI2Q 4UP7A 2UXCQ 5IP7G 4DV6L 1GVPA 3RLNA 3CQZH 1VQ8A 3PUVA 1L1OA 1CKMA 5GQOA 4QL5A 3CCVA 2OTJA 1J5EL 4A3CH 2Q2UA 4X64L 1SRUA 4LFAQ 5C0XJ 2VW9A 1VQKA 4DV2Q 1B70B 2A8VA 3HOWG 3HKZG 3GDEA 4P74A 4DR2Q 4JG2A 3L7ZC 3F2DA 2Y0SG 1M90C 4GNXC 5LMNL 3GTLH 3TRZA 4HIDA 5JJLA 1N9WA 4JI4L 4A3BG 3HOVG 2N3SA 3PV0A 4C3IH 1G6PA 1Y1WH 4TVAB 5K36G 5M3FH 2NVTH 2JJQA 3K8AA 1VQAA 1GD7A 4JYAQ 4LFBQ 2Z6KA 4DAMA 5C44G 1HZ9A 4A3KH 2YTYA 4IPDA 4QQBX 4DPGA 4DV7Q 1KXLA 2E2JH 1EQRA 4JI6L 3DM3A 4TQUS 1B8AA 4JBKA 4MNOA 4OX9L 5IP9G 3RR5A 1PH8A 3W5OA 4HIMA 1X3GA 3CAMA 5JEAG 4KHPQ 4YCWA 3M9BA 1YJ9A 4A93G 1NE3A 1YVCA 2KHIA 1LTLA 3PUXA 4YY3Q 3S17H 1VQ5A 3ULJA 3I4NH 4JBMA 4IFDI 3I4OA 1EFWA 1WCMH 1VQ4A 2A19A 1KIXA 2UUBQ 4JI0Q 4A3CG 1BKBA 4O2DA 4DR1L 4EX5A 2VUMG 4RG1A 4A76A 1K83H 4BBSH 3AFQA 5IT9c 3CPWA 3GTMH 2KHJA 3PO3G 1K0RA 3PO2H 1IBKQ 3AQQA 1NMGA 4C3HH 3Q8DA 2YYZA 2A1AA 2VQEQ 1SROA 4GNXA 1FJGL 4C3JH 5GAHC 4DV1Q 3T1YQ 2DGYA 3KF6B 2UXBQ 2I5MX 3FKIG 4YWMA 4DV0Q 1C9OA 4R1JA 4UP9A 1EIYB 2FXQA 2Q2IA 2B29A 1Y1WG 4JI8L 4GLXA 4GKJL 5C4XH 5AJ3Q 1XMQQ 3A74A 4A3FH 3ERSX 4O0AA 2I0QA 4DKAC 1C0AA 4DUYL 2JE6I 3NEMA 1IYJB 1TWFH 4NXNL 5J3BA 4A3KG 2F3IA 4LF8Q 2CWAA 5M5WH 2WB1G 4LUZA 4BBRG 2R92H 3GTGH 1VQCA 1N8RC 2UXCL 2K52A 5C0XG 1VQMA 3UE1A 2UU9Q 1T9HA 5IY0A 1KRTA 3W1GA 3RZOH 5DLQE 4Y52H 4GLVB 2R93G 1S3OA 1TWAH 4LFAL 3CCRA 1VQ9A 4DV2L 1NBWA 2AWOA 1FGUA 5FLMG 4BY1G 4DR2L 3I4NG 1K8GA 1NMFA 1BBUA 3KLWA 3S24A 1SLJA 1L1OC 1WCMG 2R6GA 1Q7YC 1E24A 4B3SQ 4OWWB 3AEVA 4LNQA 4DR4Q 4LF5Q 4HIKA 4BBSG 3PF4A 4A3DG 1UE1A 4R4QA 1L2FA 4QJFA 4B3RQ 1VQOA 4LFBL 4JYAL 3LGJA 2NN6I 4QIWE 1NY4A 1CKNA 1QVCA 1OXXK 3GO5A 1XPOA 1R9TH 1XMOQ 1PFSA 2QEXA 2UXDL 1HZBA 4JV5Q 3M85A 1CSQA 3ULPA 2AHOB 4DV7L 4DR5L 4BXXH 4R4IA 4DV5L 2UUAQ 3CCMA 2K5HA 4NXML 2E8GA 5IYDH 2E2HH 1JB7A 3F8TA 3U4ZA 4P71A 1OXVA 1YHAA 2Z6KC 3ICEA 3K80C 1NTGA 1QZHA 2I5HA 4IPHA 2WAQE 3PUYA 3I55A 3OW2A 3H3VH 5JJKA 2R92G 4DR6L 4X6AH 4YY3L 4DK6C 1KC8C 1NJIC 1H95A 1Q1BA 2C35B 4C2MH 1WI5A 3EIVA 2R93H 2UUBL 1X54A 5GAGC 2HHHQ 1FL0A 4DV3L 4JI0L 3DLLA 3ZJYC 3T1HL 4LF6Q 2EQSA 2EXDA 2N78A 3STBC 1JMCA 2N49A 1VQIA 4LUOA 2D0OA 4A3IH 1IBKL 2VQEL 1L1OB 1VQBA 2YU9H 3T1YL 3S2HH 2MO1A 4IOAA 4OO1I 3KYHC 5IYBH 2I5LX 2BH8A 2MQHA 1XTDA 4B3TL 5AJ3L 1XMQL 3UDGA 3HOXH 1ASZA 1A8VA 2WAQG 4YHHQ 4DAYB 4JI7Q 5H1SE 3HOUG 3G71A 2ZTCA 1VQHA 2VS1A 2QGQA 3FHWA 4BXXG 1YI2A 1P16A 1N33L 1PH2A 4IFDJ 3J7ZC 3I2ZA 1YZ6A 2JQOA 4PZ8A 3F2CA 5IYDG 3TS0A 1KAWA 1HJPA 2VQFL 2JA6H 4HJ8A 4A3MG 3OTOQ 1EOVA 3U58A 2UU9L 4K0KQ 5JJIA 1Y1VG 2V1CC 3NBHB 4KHZA 1XNQL 1LYLA 3CMEA 3HOYG 5C4JH 1BVSA 4YCUA 3KF8B 2WFWA 1PYSB 1HNXQ 2IY5B 4A3GH 2D62A 4GOPC 4OWXB 1IBMQ 3RNUA 2H5XA 2K5NA 1PH4A 4B3SL 3RLOA 1G291 4DR4L 1VQ7A 3H0GH 4LF5L 1Q12A 2MNAA 5BR8Q 3S1RH 4OONA 4X66Q 3STBD 2PQAB 3HKSA 1Q46A 2KCTA 3S16H 4BY7H 4P73A 4MTNA 3I7FA 3CCLA 5M5YH 4POGA 1XMOL 1YIJA 1HNWL 2KBNA 4IOCA 1YITA 2JA9A 4JV5L 1KQSA 5IYBG 2YTXA 5EAYA 5IWAL 2UUAL 2VY3A 2NVYH 1AE2A 4JI1Q 4IPCA 3CW2C 1XPRA 2E2IH 2OQ0A 3EBEA 3TEHB 4GNXB 1N32Q 3UDIA 1AH9A 1WFQA 3PIPA 3I4MH 2CFMA 1Q1EA 4LF4L 2E5LQ 3M3YH 4LF7Q 2OTLA 1TWGH 1YEZA 2LXJA 1AE3A 4AH6A 3CCUA 5C3EH 1XNRL 5M3FG 3H15A 1EWIA 1X6OA 4ME3A 2ZTDA 1YBYA 1X9NA 4ALPA 1EIFA 1HNZQ 1TWHH 4GN5A 4LF6L 2HIVA 4DNIA 2BA0A 3M4PA 4J15A 4A4IA 4JI2L 4GOPA 1PVOA 2OCEA 2PI2A 3BZKA 3CXCA 2N8NA 1OXTA 3B6YA 3AFPA 4JOIA 2DUDA 3L0OA 4Y7NH 2IX1A 1I3QH 2VL6A 4BA2I 2MO0A 2NZOA 3H0GG 2JA7H 2R7ZH 4JI5Q 4IFDG 1BBWA 2HIXA 3MXNB 1N34Q 4BY7G 2JA8H 3KJOA 3U4VA 1E3PA 2KENA 4YHHL 1A62A 2XTIA 4JI4Q 2HQLA 2AMCB 2MFIA 2F4VQ 2ZM6Q 3F2BA 4LUVA 2HT1A 4A3LH 3G48A 1SFOH 4A3EH 3KJPA 4X65Q 1JJ2A 4A3JH 2RF4A 4AYBE 1EUJA 3PO2G 3PIOA 3S1NH 3OTOL 4K0KL 2ATWA 3UDXA 4P72A 1CKNB 1SN8A 2B63H 1I50H 4NPSA 4OXPA 1UWVA 2K4KA 3NENA 5HY6A 3CC4A 3PGZA 3A0JA 2L15A 4KI0A 4QGUA 3K7UC 4POFA 5C4XG 5IP7H 4OX9Q 1E22A 5FJ8H 4A3FG 3GTJH 4JI3Q 1V43A 2R7DA 1UE5A 4JC0A 2K75A 1N36Q 1JJGA 1JJCB 1Q8KA 1VQEA 2LXKA 4PZ7A 2F52A 4YWLA 1Q81C 1QUQA 4HJ9A 4DR3Q 4L5QA 5HGQA 4GN3B 5BR8L 4JBWA 3PUZA 1TWCH 2GVAA 4R4CA 5JEAJ 2NVXH 5M3MH 4B3MQ 1MKHA 4DUZQ 1X3EA 1VS0A 1YNXA 3KDFA 3CC7A 1TXYA 4AYBG 3J81j 1OTCA 4A3BH 4UPAA 1LM0A 1FVIA 1PA6A 1VQ6A 1IZ6A 1D7QA 4X62Q 4XIGS 1I94Q 2JA8G 4JI1L 2AKWB 1JT8A 3HOZH 4GS3A 3TREA 3HKZE 1N32L 5C44H 5IE8A 4DV1L 2XGTA 1MJCA 4L5SA 2UXBL 3W1BA 1VQJA 2Y0SE 4IJLA 4DV0L 3VDYA 4A3LG 1B7YB 4UP8A 3CP0A 1VQFA 2NN6G 4EQ5A 2ZJQA 3CF5A 3GTOH 5IP9H 3K7AH 1IXRA 2PI2E 3K81C 3PSIA 4BA1I 3CCSA 1HNZL 3GTKH 2K14A 2K50A 4QY7A 4LF8L 2VZAA 4IO9A 1WOCA 1DGSA 4OWTB 1I5FA 5FJ8G 2BA1A 2LSSA 1J6QA 3K0XA 1QZGA 1PH6A 3KFUA 2JK8A 2OQKA 1KL9A 1PH3A 1K73C 1XJVA 1CKOA 1JE5A 4JCVE 1QVGA 3U50C 4YCVA 2VUMH 1CUKA 4JI5L 1M1KC 1N34L 3M4QA 4LF9Q 3JAMc 3S15H 3GTQH 3PO3H 1A0IA 1YHBA 1HZCA 1SMXA 3JC66 1U0LA 4JOIC 4KLKA 4FDBA 3RLFA 1WYDA 5M3MG 1V9PA 3UE0A 2F4VL 2ZM6L 3FKIH 4R4OA 4GKKQ 1S40A 3JAMi 2NZHA 4X65L 1WJJA 4IJHA 4DR7Q 1HZAA 4B3RL 2ZTEA 3HOZG 4A3IG 1QVFA 3WWVA 3CD6A 2IHFA 4OO1G 3M7NA 4PMWA 2Q2TA 5ELNA 3G6EA 3J7A5 2UXDQ 1LUZA 3CC2A 3S14H 4BBRH 2ALYB 4DR5Q 1E1OA 3J81c 1OXUA 1O7IA 4DV5Q 3I56A 2RCNA 4NXMQ 3ER0A 1K3RA 3HOXG 4JI3L 1PYBA 5M5XH 2R7FA 5LMUQ 4IPGA 2OWOA 3PUWA 1N36L 4L5RC 5C0XI 2ZJRA 4KHPL 2EIFA 4DR3L 2B3GA 2KCMA 4LFCQ 5GROA 1Z47A 3J81i 3CCEA 4AQYQ 2UUCQ 1IBLQ 1VQNA 4DR6Q 3UDFA 1X65A 1PH7A 2WB1E 2PQAA 3EN2A 5FLMH 1UE6A 1X56A 1HR0Q 4BY1H 2JA6G 3OYYA 4DV4Q 3S1MH 2ASBA 4B3ML 4DUZL 2HHHL 2ID0A 4HJ5A 4DV3Q 3T1HQ 3CPFA 1L0WA 1MIUA 1UE7A 2IX0A 4MZ9A 4A3GG 4APVA 4GOPB 4A3DH 1I6HH 4X62L 4LW1A 1I94L 4DV6Q 2IHEA 3GTPH 1KHIA 3ULLA 1VCIA 1V1QA 3KOJA 3BJUA 3FP9A 5IYCH 3AYHB 3KF6A 3L2PA 1J5EQ 1X55A 1EYGA 4X64Q 1HR0W 2GVBA 1KRSA 3RN2A 3RN5A 1PH9A 4A75A 4B3TQ 1A63A 3CMAA 3M4OH 4JBJA 1YJWA 2RHSB 3IRBA 4JI7L 5LMNQ 4YWKA 1CSPA 4PZ6A 3MEFA 3E9HA 1N33Q 1E7ZA 1P8LA 2YV5A 4RMFA 4HJ7A 3S1QH 2VQFQ 4R4TA 4XTCS 1IL2A 2Z0SA 2CKZB 2D0PA 1W2BA 1XNQQ 1VQGA 3HFZB 2JA5H 3I4MG 3D31A 4H02A 3E9IA 1HNXL 1PHJA 1VQLA 1VQPA 1IBML 5C3EG 1RL2A 4JI6Q 4LF9L 3S2DH 4P75A 3CCQA 1PV4A 1K8AC 1GKHA 5LMNW 1VQDA 4WJ4A 4L5TA 3TQYA 5E7NA 1S72A 2RHQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3F A;  1QUQ B;  4DK3 C;  1GO3 E;  3SGI A;  3D0F A;  1GM5 A;  3RZD H;  1ASY A;  2CCZ A;  4GKK L;  3CCJ A;  3HOW H;  3E0E A;  1Z9F A;  1C7Y A;  4X66 L;  4DR7 L;  1XPU A;  4GN4 B;  1YHQ A;  1W3S A;  2AWN A;  2BH2 A;  2VNU D;  5IYC G;  2GN5 A;  1HNW Q;  1HH2 P;  3BU2 A;  3TS2 A;  1SR3 A;  3HOU H;  2Q2H A;  2YTV A;  3KDF B;  2JA7 G;  2R7Z G;  2CQO A;  4DR1 Q;  3F1Z A;  1MJE A;  3HOV H;  1PH1 A;  4HIO A;  4AIM A;  5IWA Q;  4UY8 C;  3J80 c;  4NB3 A;  2NVQ H;  5LMU L;  1K9M C;  4A3M H;  1YJN A;  1Q82 C;  2JEA I;  1Y1V H;  1U5K A;  1SE8 A;  5GAE C;  1FJG Q;  3G4S A;  4LWC A;  3PF5 A;  2JEB I;  1Y14 B;  4LFC L;  1EQQ A;  3HOY H;  2E5L L;  1PH5 A;  4LF4 Q;  2K5V A;  4AQY L;  2UUC L;  1KD1 C;  4PG3 A;  4A3E G;  3J80 i;  3GD7 A;  1IBL L;  1OXS C;  4LF7 L;  3H3V I;  4A3J G;  1Q86 C;  4JI8 Q;  1XNR Q;  1HR0 L;  4GKJ Q;  4WJ3 M;  2PNH A;  2QA4 A;  5ELO A;  1RIP A;  4DV4 L;  4GLA C;  3PCO B;  2WP8 J;  2ZJP A;  4DUY Q;  4HJA A;  2JA5 G;  3NEL A;  2PMZ E;  5FLX c;  4NXN Q;  3A5Z B;  2B63 G;  4A93 H;  1D8L A;  1G51 A;  5GAD C;  2ES2 A;  1UEB A;  3A5U A;  3BZC A;  2CWP A;  1E1T A;  2IT1 A;  4JI2 Q;  4UP7 A;  2UXC Q;  5IP7 G;  4DV6 L;  1GVP A;  3RLN A;  3CQZ H;  1VQ8 A;  3PUV A;  1L1O A;  1CKM A;  5GQO A;  4QL5 A;  3CCV A;  2OTJ A;  1J5E L;  4A3C H;  2Q2U A;  4X64 L;  1SRU A;  4LFA Q;  5C0X J;  2VW9 A;  1VQK A;  4DV2 Q;  1B70 B;  2A8V A;  3HOW G;  3HKZ G;  3GDE A;  4P74 A;  4DR2 Q;  4JG2 A;  3L7Z C;  3F2D A;  2Y0S G;  1M90 C;  4GNX C;  5LMN L;  3GTL H;  3TRZ A;  4HID A;  5JJL A;  1N9W A;  4JI4 L;  4A3B G;  3HOV G;  2N3S A;  3PV0 A;  4C3I H;  1G6P A;  1Y1W H;  4TVA B;  5K36 G;  5M3F H;  2NVT H;  2JJQ A;  3K8A A;  1VQA A;  1GD7 A;  4JYA Q;  4LFB Q;  2Z6K A;  4DAM A;  5C44 G;  1HZ9 A;  4A3K H;  2YTY A;  4IPD A;  4QQB X;  4DPG A;  4DV7 Q;  1KXL A;  2E2J H;  1EQR A;  4JI6 L;  3DM3 A;  4TQU S;  1B8A A;  4JBK A;  4MNO A;  4OX9 L;  5IP9 G;  3RR5 A;  1PH8 A;  3W5O A;  4HIM A;  1X3G A;  3CAM A;  5JEA G;  4KHP Q;  4YCW A;  3M9B A;  1YJ9 A;  4A93 G;  1NE3 A;  1YVC A;  2KHI A;  1LTL A;  3PUX A;  4YY3 Q;  3S17 H;  1VQ5 A;  3ULJ A;  3I4N H;  4JBM A;  4IFD I;  3I4O A;  1EFW A;  1WCM H;  1VQ4 A;  2A19 A;  1KIX A;  2UUB Q;  4JI0 Q;  4A3C G;  1BKB A;  4O2D A;  4DR1 L;  4EX5 A;  2VUM G;  4RG1 A;  4A76 A;  1K83 H;  4BBS H;  3AFQ A;  5IT9 c;  3CPW A;  3GTM H;  2KHJ A;  3PO3 G;  1K0R A;  3PO2 H;  1IBK Q;  3AQQ A;  1NMG A;  4C3H H;  3Q8D A;  2YYZ A;  2A1A A;  2VQE Q;  1SRO A;  4GNX A;  1FJG L;  4C3J H;  5GAH C;  4DV1 Q;  3T1Y Q;  2DGY A;  3KF6 B;  2UXB Q;  2I5M X;  3FKI G;  4YWM A;  4DV0 Q;  1C9O A;  4R1J A;  4UP9 A;  1EIY B;  2FXQ A;  2Q2I A;  2B29 A;  1Y1W G;  4JI8 L;  4GLX A;  4GKJ L;  5C4X H;  5AJ3 Q;  1XMQ Q;  3A74 A;  4A3F H;  3ERS X;  4O0A A;  2I0Q A;  4DKA C;  1C0A A;  4DUY L;  2JE6 I;  3NEM A;  1IYJ B;  1TWF H;  4NXN L;  5J3B A;  4A3K G;  2F3I A;  4LF8 Q;  2CWA A;  5M5W H;  2WB1 G;  4LUZ A;  4BBR G;  2R92 H;  3GTG H;  1VQC A;  1N8R C;  2UXC L;  2K52 A;  5C0X G;  1VQM A;  3UE1 A;  2UU9 Q;  1T9H A;  5IY0 A;  1KRT A;  3W1G A;  3RZO H;  5DLQ E;  4Y52 H;  4GLV B;  2R93 G;  1S3O A;  1TWA H;  4LFA L;  3CCR A;  1VQ9 A;  4DV2 L;  1NBW A;  2AWO A;  1FGU A;  5FLM G;  4BY1 G;  4DR2 L;  3I4N G;  1K8G A;  1NMF A;  1BBU A;  3KLW A;  3S24 A;  1SLJ A;  1L1O C;  1WCM G;  2R6G A;  1Q7Y C;  1E24 A;  4B3S Q;  4OWW B;  3AEV A;  4LNQ A;  4DR4 Q;  4LF5 Q;  4HIK A;  4BBS G;  3PF4 A;  4A3D G;  1UE1 A;  4R4Q A;  1L2F A;  4QJF A;  4B3R Q;  1VQO A;  4LFB L;  4JYA L;  3LGJ A;  2NN6 I;  4QIW E;  1NY4 A;  1CKN A;  1QVC A;  1OXX K;  3GO5 A;  1XPO A;  1R9T H;  1XMO Q;  1PFS A;  2QEX A;  2UXD L;  1HZB A;  4JV5 Q;  3M85 A;  1CSQ A;  3ULP A;  2AHO B;  4DV7 L;  4DR5 L;  4BXX H;  4R4I A;  4DV5 L;  2UUA Q;  3CCM A;  2K5H A;  4NXM L;  2E8G A;  5IYD H;  2E2H H;  1JB7 A;  3F8T A;  3U4Z A;  4P71 A;  1OXV A;  1YHA A;  2Z6K C;  3ICE A;  3K80 C;  1NTG A;  1QZH A;  2I5H A;  4IPH A;  2WAQ E;  3PUY A;  3I55 A;  3OW2 A;  3H3V H;  5JJK A;  2R92 G;  4DR6 L;  4X6A H;  4YY3 L;  4DK6 C;  1KC8 C;  1NJI C;  1H95 A;  1Q1B A;  2C35 B;  4C2M H;  1WI5 A;  3EIV A;  2R93 H;  2UUB L;  1X54 A;  5GAG C;  2HHH Q;  1FL0 A;  4DV3 L;  4JI0 L;  3DLL A;  3ZJY C;  3T1H L;  4LF6 Q;  2EQS A;  2EXD A;  2N78 A;  3STB C;  1JMC A;  2N49 A;  1VQI A;  4LUO A;  2D0O A;  4A3I H;  1IBK L;  2VQE L;  1L1O B;  1VQB A;  2YU9 H;  3T1Y L;  3S2H H;  2MO1 A;  4IOA A;  4OO1 I;  3KYH C;  5IYB H;  2I5L X;  2BH8 A;  2MQH A;  1XTD A;  4B3T L;  5AJ3 L;  1XMQ L;  3UDG A;  3HOX H;  1ASZ A;  1A8V A;  2WAQ G;  4YHH Q;  4DAY B;  4JI7 Q;  5H1S E;  3HOU G;  3G71 A;  2ZTC A;  1VQH A;  2VS1 A;  2QGQ A;  3FHW A;  4BXX G;  1YI2 A;  1P16 A;  1N33 L;  1PH2 A;  4IFD J;  3J7Z C;  3I2Z A;  1YZ6 A;  2JQO A;  4PZ8 A;  3F2C A;  5IYD G;  3TS0 A;  1KAW A;  1HJP A;  2VQF L;  2JA6 H;  4HJ8 A;  4A3M G;  3OTO Q;  1EOV A;  3U58 A;  2UU9 L;  4K0K Q;  5JJI A;  1Y1V G;  2V1C C;  3NBH B;  4KHZ A;  1XNQ L;  1LYL A;  3CME A;  3HOY G;  5C4J H;  1BVS A;  4YCU A;  3KF8 B;  2WFW A;  1PYS B;  1HNX Q;  2IY5 B;  4A3G H;  2D62 A;  4GOP C;  4OWX B;  1IBM Q;  3RNU A;  2H5X A;  2K5N A;  1PH4 A;  4B3S L;  3RLO A;  1G29 1;  4DR4 L;  1VQ7 A;  3H0G H;  4LF5 L;  1Q12 A;  2MNA A;  5BR8 Q;  3S1R H;  4OON A;  4X66 Q;  3STB D;  2PQA B;  3HKS A;  1Q46 A;  2KCT A;  3S16 H;  4BY7 H;  4P73 A;  4MTN A;  3I7F A;  3CCL A;  5M5Y H;  4POG A;  1XMO L;  1YIJ A;  1HNW L;  2KBN A;  4IOC A;  1YIT A;  2JA9 A;  4JV5 L;  1KQS A;  5IYB G;  2YTX A;  5EAY A;  5IWA L;  2UUA L;  2VY3 A;  2NVY H;  1AE2 A;  4JI1 Q;  4IPC A;  3CW2 C;  1XPR A;  2E2I H;  2OQ0 A;  3EBE A;  3TEH B;  4GNX B;  1N32 Q;  3UDI A;  1AH9 A;  1WFQ A;  3PIP A;  3I4M H;  2CFM A;  1Q1E A;  4LF4 L;  2E5L Q;  3M3Y H;  4LF7 Q;  2OTL A;  1TWG H;  1YEZ A;  2LXJ A;  1AE3 A;  4AH6 A;  3CCU A;  5C3E H;  1XNR L;  5M3F G;  3H15 A;  1EWI A;  1X6O A;  4ME3 A;  2ZTD A;  1YBY A;  1X9N A;  4ALP A;  1EIF A;  1HNZ Q;  1TWH H;  4GN5 A;  4LF6 L;  2HIV A;  4DNI A;  2BA0 A;  3M4P A;  4J15 A;  4A4I A;  4JI2 L;  4GOP A;  1PVO A;  2OCE A;  2PI2 A;  3BZK A;  3CXC A;  2N8N A;  1OXT A;  3B6Y A;  3AFP A;  4JOI A;  2DUD A;  3L0O A;  4Y7N H;  2IX1 A;  1I3Q H;  2VL6 A;  4BA2 I;  2MO0 A;  2NZO A;  3H0G G;  2JA7 H;  2R7Z H;  4JI5 Q;  4IFD G;  1BBW A;  2HIX A;  3MXN B;  1N34 Q;  4BY7 G;  2JA8 H;  3KJO A;  3U4V A;  1E3P A;  2KEN A;  4YHH L;  1A62 A;  2XTI A;  4JI4 Q;  2HQL A;  2AMC B;  2MFI A;  2F4V Q;  2ZM6 Q;  3F2B A;  4LUV A;  2HT1 A;  4A3L H;  3G48 A;  1SFO H;  4A3E H;  3KJP A;  4X65 Q;  1JJ2 A;  4A3J H;  2RF4 A;  4AYB E;  1EUJ A;  3PO2 G;  3PIO A;  3S1N H;  3OTO L;  4K0K L;  2ATW A;  3UDX A;  4P72 A;  1CKN B;  1SN8 A;  2B63 H;  1I50 H;  4NPS A;  4OXP A;  1UWV A;  2K4K A;  3NEN A;  5HY6 A;  3CC4 A;  3PGZ A;  3A0J A;  2L15 A;  4KI0 A;  4QGU A;  3K7U C;  4POF A;  5C4X G;  5IP7 H;  4OX9 Q;  1E22 A;  5FJ8 H;  4A3F G;  3GTJ H;  4JI3 Q;  1V43 A;  2R7D A;  1UE5 A;  4JC0 A;  2K75 A;  1N36 Q;  1JJG A;  1JJC B;  1Q8K A;  1VQE A;  2LXK A;  4PZ7 A;  2F52 A;  4YWL A;  1Q81 C;  1QUQ A;  4HJ9 A;  4DR3 Q;  4L5Q A;  5HGQ A;  4GN3 B;  5BR8 L;  4JBW A;  3PUZ A;  1TWC H;  2GVA A;  4R4C A;  5JEA J;  2NVX H;  5M3M H;  4B3M Q;  1MKH A;  4DUZ Q;  1X3E A;  1VS0 A;  1YNX A;  3KDF A;  3CC7 A;  1TXY A;  4AYB G;  3J81 j;  1OTC A;  4A3B H;  4UPA A;  1LM0 A;  1FVI A;  1PA6 A;  1VQ6 A;  1IZ6 A;  1D7Q A;  4X62 Q;  4XIG S;  1I94 Q;  2JA8 G;  4JI1 L;  2AKW B;  1JT8 A;  3HOZ H;  4GS3 A;  3TRE A;  3HKZ E;  1N32 L;  5C44 H;  5IE8 A;  4DV1 L;  2XGT A;  1MJC A;  4L5S A;  2UXB L;  3W1B A;  1VQJ A;  2Y0S E;  4IJL A;  4DV0 L;  3VDY A;  4A3L G;  1B7Y B;  4UP8 A;  3CP0 A;  1VQF A;  2NN6 G;  4EQ5 A;  2ZJQ A;  3CF5 A;  3GTO H;  5IP9 H;  3K7A H;  1IXR A;  2PI2 E;  3K81 C;  3PSI A;  4BA1 I;  3CCS A;  1HNZ L;  3GTK H;  2K14 A;  2K50 A;  4QY7 A;  4LF8 L;  2VZA A;  4IO9 A;  1WOC A;  1DGS A;  4OWT B;  1I5F A;  5FJ8 G;  2BA1 A;  2LSS A;  1J6Q A;  3K0X A;  1QZG A;  1PH6 A;  3KFU A;  2JK8 A;  2OQK A;  1KL9 A;  1PH3 A;  1K73 C;  1XJV A;  1CKO A;  1JE5 A;  4JCV E;  1QVG A;  3U50 C;  4YCV A;  2VUM H;  1CUK A;  4JI5 L;  1M1K C;  1N34 L;  3M4Q A;  4LF9 Q;  3JAM c;  3S15 H;  3GTQ H;  3PO3 H;  1A0I A;  1YHB A;  1HZC A;  1SMX A;  3JC6 6;  1U0L A;  4JOI C;  4KLK A;  4FDB A;  3RLF A;  1WYD A;  5M3M G;  1V9P A;  3UE0 A;  2F4V L;  2ZM6 L;  3FKI H;  4R4O A;  4GKK Q;  1S40 A;  3JAM i;  2NZH A;  4X65 L;  1WJJ A;  4IJH A;  4DR7 Q;  1HZA A;  4B3R L;  2ZTE A;  3HOZ G;  4A3I G;  1QVF A;  3WWV A;  3CD6 A;  2IHF A;  4OO1 G;  3M7N A;  4PMW A;  2Q2T A;  5ELN A;  3G6E A;  3J7A 5;  2UXD Q;  1LUZ A;  3CC2 A;  3S14 H;  4BBR H;  2ALY B;  4DR5 Q;  1E1O A;  3J81 c;  1OXU A;  1O7I A;  4DV5 Q;  3I56 A;  2RCN A;  4NXM Q;  3ER0 A;  1K3R A;  3HOX G;  4JI3 L;  1PYB A;  5M5X H;  2R7F A;  5LMU Q;  4IPG A;  2OWO A;  3PUW A;  1N36 L;  4L5R C;  5C0X I;  2ZJR A;  4KHP L;  2EIF A;  4DR3 L;  2B3G A;  2KCM A;  4LFC Q;  5GRO A;  1Z47 A;  3J81 i;  3CCE A;  4AQY Q;  2UUC Q;  1IBL Q;  1VQN A;  4DR6 Q;  3UDF A;  1X65 A;  1PH7 A;  2WB1 E;  2PQA A;  3EN2 A;  5FLM H;  1UE6 A;  1X56 A;  1HR0 Q;  4BY1 H;  2JA6 G;  3OYY A;  4DV4 Q;  3S1M H;  2ASB A;  4B3M L;  4DUZ L;  2HHH L;  2ID0 A;  4HJ5 A;  4DV3 Q;  3T1H Q;  3CPF A;  1L0W A;  1MIU A;  1UE7 A;  2IX0 A;  4MZ9 A;  4A3G G;  4APV A;  4GOP B;  4A3D H;  1I6H H;  4X62 L;  4LW1 A;  1I94 L;  4DV6 Q;  2IHE A;  3GTP H;  1KHI A;  3ULL A;  1VCI A;  1V1Q A;  3KOJ A;  3BJU A;  3FP9 A;  5IYC H;  3AYH B;  3KF6 A;  3L2P A;  1J5E Q;  1X55 A;  1EYG A;  4X64 Q;  1HR0 W;  2GVB A;  1KRS A;  3RN2 A;  3RN5 A;  1PH9 A;  4A75 A;  4B3T Q;  1A63 A;  3CMA A;  3M4O H;  4JBJ A;  1YJW A;  2RHS B;  3IRB A;  4JI7 L;  5LMN Q;  4YWK A;  1CSP A;  4PZ6 A;  3MEF A;  3E9H A;  1N33 Q;  1E7Z A;  1P8L A;  2YV5 A;  4RMF A;  4HJ7 A;  3S1Q H;  2VQF Q;  4R4T A;  4XTC S;  1IL2 A;  2Z0S A;  2CKZ B;  2D0P A;  1W2B A;  1XNQ Q;  1VQG A;  3HFZ B;  2JA5 H;  3I4M G;  3D31 A;  4H02 A;  3E9I A;  1HNX L;  1PHJ A;  1VQL A;  1VQP A;  1IBM L;  5C3E G;  1RL2 A;  4JI6 Q;  4LF9 L;  3S2D H;  4P75 A;  3CCQ A;  1PV4 A;  1K8A C;  1GKH A;  5LMN W;  1VQD A;  4WJ4 A;  4L5T A;  3TQY A;  5E7N A;  1S72 A;  2RHQ B; 
#chains in the Genus database with same CATH topology
 1QUQ B;  3HXL A;  1GM5 A;  1BOS A;  3D6C A;  3SGI A;  3FKI A;  5KFM A;  2IBK A;  3HOW H;  1V1P B;  2MGS A;  3D4R A;  3E0E A;  5L1K A;  5KGU A;  4GN4 B;  1ILQ A;  4I7Z C;  3QWN A;  3NXW A;  3KAK A;  3MEH A;  2YTV A;  3HS0 C;  3KDF B;  2R7Z G;  1XMQ H;  4F50 A;  3F1Z A;  3LX0 A;  2EJG C;  3J80 c;  2L12 A;  4JV1 A;  3NQT A;  4MIU A;  1Q82 C;  4LF8 H;  3L4J A;  1Y1V H;  2HCC A;  1SE8 A;  5GAE C;  4FBU A;  3G4S A;  3PF5 A;  1EQQ A;  3I4M B;  2K32 A;  1GHK A;  1IBL L;  5CV4 A;  4A3E G;  5FO9 B;  3LP8 A;  4A3J G;  1A15 A;  1Q86 C;  2AGP A;  4DV4 L;  2F0N A;  4EGJ A;  2WP8 J;  5L37 A;  4MV3 A;  4HJA A;  5FLX W;  2C2R A;  5FLX c;  1BXR A;  1G51 A;  2X6G A;  1E1T A;  3VYT A;  1H9S A;  1UEA B;  3SHL A;  2VR1 A;  3H91 A;  1D6E C;  1Y8O B;  2F0T A;  2DJF C;  4QL5 A;  4DGZ A;  5KFS A;  4KKS A;  1I3Q B;  2FMC A;  4WJW A;  1IBK H;  4MTK A;  2Q2U A;  3GIP A;  2R7Z B;  1F9S A;  4X64 L;  2A8V A;  2VW9 A;  2Z8L A;  1S5E D;  2K1B A;  3VA7 A;  1QIL A;  4Q45 A;  4P74 A;  1XMO H;  4JG2 A;  4YJ2 F;  2IP4 A;  2R7L A;  2V4D A;  2H4O A;  4YR0 A;  4IRD A;  1ICW A;  1TWF A;  5JJL A;  4A3B G;  1SFO B;  3HOV G;  4A3E B;  5NUC A;  4A3J B;  5KT4 A;  5M3F H;  1F9P A;  4LFB Q;  2JJQ A;  3K8A A;  3BA8 A;  3GV3 A;  4ECR A;  3A8I E;  2WV6 D;  1K3B C;  4QQB X;  3BYT B;  1ZQ7 A;  2E2J H;  1TQO A;  2M00 A;  1D2B A;  3DM3 A;  4UCU A;  4OX9 L;  2SCU B;  5T1I A;  3DMU A;  1PH8 A;  4LF6 H;  2WIN B;  3CAM A;  4IAL A;  1G2T A;  2XCL A;  1YJ9 A;  4YB8 B;  4C5A A;  2XVS A;  1NE3 A;  2EYO A;  3HZX A;  3D6W A;  2R8G A;  1AN7 A;  2FP4 B;  3PUX A;  4YR2 A;  4OL7 A;  4BS9 A;  1VQ5 A;  1E4E B;  5JJZ A;  1M8A A;  2M9V A;  4IFD I;  1ZET A;  1EFI D;  3NTH A;  5D3D A;  1EFW A;  1KIX A;  4JI0 Q;  3T5H A;  3KBG A;  4A3B B;  4DF7 A;  2HVQ A;  5JQW A;  2VUM G;  1EY6 A;  4RG1 A;  3HOV B;  4XZ3 B;  3AFQ A;  4RUC A;  4YHH H;  2IA6 A;  4J9S A;  2AU0 A;  3GTM H;  1I4X A;  1K0R A;  1SNQ A;  2E2H A;  3AQQ A;  4C3H H;  3WOE A;  2CW0 C;  2PMZ B;  2RQX A;  2VB3 X;  2B39 A;  4ZQ3 A;  1FJG L;  4E6I A;  3KF6 B;  1C9O A;  1B6S A;  2H1E A;  2FXQ A;  2Q2I A;  3L9A X;  5KT3 A;  4K0K H;  3HGB A;  1SYB A;  3VR6 A;  5C4X H;  1XMQ Q;  1S10 A;  2QW7 A;  4A3F H;  1C0A A;  1TWF H;  1LT6 D;  1S5B D;  4NXN L;  4LF8 Q;  2CWA A;  3ETH A;  2J0T D;  4LUZ A;  4FS2 A;  4BBR G;  2VPS A;  5DLG A;  4ECZ A;  5C0X G;  1M6V A;  3ORQ A;  2EXZ A;  5J22 A;  5J39 A;  1VQM A;  3MA2 B;  1S97 A;  3SK6 A;  4L8J A;  3BVG A;  2VUM B;  1NBW A;  3AU7 A;  3MXN A;  4BY1 G;  2B8G A;  3S15 B;  4DR2 L;  1K8G A;  3S24 A;  1B44 D;  1A6X A;  1SLJ A;  1Q7Y C;  4EYH B;  1E24 A;  2Z9H A;  5KFL A;  4LNQ A;  4N8F A;  2IL8 A;  1L0X B;  1V1O A;  2P0A A;  1UE1 A;  3MWM A;  1L2F A;  1EEF D;  3TQT A;  1E2V A;  1NY4 A;  1CI3 M;  1CKN A;  1XMO Q;  1DZ1 A;  4EG0 A;  1BCP D;  4ME5 A;  4BBR B;  1C48 A;  3VR3 A;  4R4I A;  5CAE B;  2R61 A;  2E8G A;  4YP3 A;  2E2H H;  3F8T A;  2SDF A;  4IUN A;  3N44 B;  1OXV A;  2FJ2 A;  1WSC A;  1WD1 A;  1QZH A;  2I5H A;  3WO1 A;  3N52 A;  3BQ1 A;  2FLP A;  3OW2 A;  3GV8 B;  2R92 G;  3H0G A;  3NWT A;  3C0F B;  4DK6 C;  1B2T A;  1PTO C;  1NJI C;  4KJN A;  4BY1 B;  1WI5 A;  2JP1 A;  4EVO A;  2UUB L;  4JV2 A;  4DV3 L;  4LF6 Q;  2PBZ A;  3V6J A;  1HTL D;  3MR2 A;  4JPB W;  3QG1 A;  2N78 A;  1JMC A;  4JI4 H;  1XWE A;  3FRP B;  2QF7 A;  5DG8 A;  1IBK L;  3KLR A;  2C9O A;  5LOV F;  4R7R A;  2W71 A;  4OO1 H;  1VBG A;  3BJY A;  4UDU C;  3RBD A;  1QOH A;  4IOA A;  2EYH A;  1EQT A;  2F0Q A;  3HRZ C;  1W6J A;  3JRW A;  3E5N A;  2FIN B;  1ASZ A;  4YHH Q;  3M4O B;  1TWH A;  4CJ2 C;  2C2D A;  3G71 A;  2ZTC A;  2VS1 A;  3FHW A;  4BXX G;  2R92 B;  5COY A;  3DXJ C;  4OX9 H;  2F0D A;  4TQR A;  3I2Z A;  2Z4H A;  4CC6 A;  1ZEQ X;  4HNT A;  4KHP H;  4K0K Q;  3RV4 A;  1XNQ L;  4ULL A;  1EUC B;  1S0M A;  4NLG A;  2Q8R E;  5C4J H;  4FM9 A;  4ED6 A;  5J1Z A;  4YCU A;  3KF8 B;  2IY5 B;  4ECT A;  1GUT A;  4OWX B;  1IL8 A;  3JAM W;  3CHB D;  3J80 E;  5FKA C;  1EY8 A;  1RJQ A;  2FKL A;  2LMC B;  2RDH A;  1DIK A;  4DR4 L;  3H0G H;  4LF5 L;  3MR5 A;  3RZD B;  2EYL A;  3S1R H;  4OON A;  2A5H A;  3HKS A;  3C1E A;  3EFX D;  1A2U A;  4DAP A;  4K2L A;  3F8N A;  2KBN A;  3FMA A;  5FLX E;  1KQS A;  3Q8Q B;  2UUA L;  4LAA A;  2DN8 A;  5BMV F;  1B9N A;  4IPC A;  4NDX A;  1T5X D;  4KV6 A;  1DV1 A;  5EJW A;  2ASJ A;  5LYJ F;  4GNX B;  2ZXP A;  1BNZ A;  1WFQ A;  1B04 A;  2CFM A;  1Q1E A;  4LF4 L;  1TWG H;  1YEZ A;  2IPK D;  3H15 A;  2F3W A;  1X9N A;  1ET6 A;  2B2U C;  4C2M B;  4ALP A;  1TWH H;  3DWA A;  3OHA A;  3C1F A;  4HTH A;  3NE5 B;  1Y8P B;  1TS5 A;  1EIH A;  1V51 A;  1LO5 D;  3BG3 A;  1SJH D;  4JI2 L;  4HCS A;  4EEY A;  2HDM A;  4EBC A;  3AFP A;  3CQZ B;  4IUT A;  4RKB A;  3HBL A;  5EBC A;  1IHZ A;  4K6L A;  4Y7N H;  2OH2 A;  4GKK H;  4BA2 I;  5K2M A;  2MO0 A;  2EDG A;  2AQ1 B;  4IFD G;  2RDG A;  2P5Z X;  3KLS A;  2JA8 H;  1D5Z C;  4ZCK A;  2XTI A;  4JI4 Q;  4MHE A;  1ILP A;  1U4P A;  3T56 B;  3PIP 3;  2HT1 A;  2WII B;  3GIK A;  1JOK A;  2B8F A;  2YZM A;  4TV9 F;  4QWC A;  5LMU H;  4AYB E;  1EUJ A;  1KBL A;  3PO2 G;  3PIO A;  4GC7 A;  3NSW A;  2CW0 D;  4RCN A;  3UDX A;  1TAE A;  4P72 A;  4ZLT F;  2EYJ A;  1ZHS A;  2LFN A;  4NPS A;  5KFW A;  4OXP A;  1UWV A;  3PW7 A;  1MSG A;  5HY6 A;  1CA6 A;  1HR0 H;  1S68 A;  5C3X A;  4Q43 A;  3K7U C;  4POF A;  4DU9 A;  3U9T A;  4OX9 Q;  3H4D A;  4ECX A;  4MTE A;  4DV3 H;  1QNU A;  4JC0 A;  4ZUI A;  4KHP Q;  3Q8S B;  4YWL A;  4G4K A;  4NKL A;  2SNS A;  3MFH A;  4C5B A;  4JBW A;  5KND A;  3H4B A;  5IGG A;  3G8C A;  3E0J A;  4N9P A;  2GVA A;  5KG1 A;  3A54 A;  4YR3 A;  2PPB C;  1KLU D;  1X3E A;  1YNX A;  5HV6 A;  3J81 j;  2EVB A;  3WNZ A;  1S03 G;  5D3I B;  1PA6 A;  1VQ6 A;  1TII D;  2XNA C;  1D7Q A;  4M8A A;  1FKA H;  5EKK A;  4U7C A;  1GYF A;  1HFG A;  4JI1 L;  2C28 A;  3PO2 B;  4GS3 A;  2YRX A;  2B2W C;  3KLS X;  4RNO A;  3VMM A;  4NXN H;  4L5S A;  2UXB L;  2DZD A;  4A3L G;  2KCC A;  4WRD A;  4UP8 A;  4EQP A;  4QWE A;  2EJM A;  4RGM A;  3CF5 A;  2QDL A;  3GTO H;  1XNQ H;  5IP9 H;  3CCS A;  4R9W A;  2CH4 A;  5C5L A;  1CT1 D;  2BR0 A;  1GSA A;  4QY7 A;  1GLV A;  2Q8I B;  4JI6 H;  5FPO A;  4QWD A;  2QYZ A;  2YZN A;  2F0J A;  2LSS A;  2NZ1 D;  1QZG A;  1I6V C;  3RB3 A;  3W3A A;  2DY8 A;  3K5O A;  4DK0 A;  4ED3 A;  1CKO A;  3R2T A;  2JA7 A;  4K5X A;  1CUK A;  1U9R A;  1N34 L;  1PTO D;  3P1H A;  1GXD C;  3GTQ H;  5EGT A;  4JOI C;  4KLK A;  2WKD A;  1M7J A;  2ZM6 L;  2UUA H;  4Q0F A;  4GKK Q;  2EYM A;  3T51 B;  3OSN A;  3JAM i;  1WJJ A;  4IJH A;  4G7O C;  3VPB A;  1GUG A;  1SYC A;  3HOZ G;  4A3I G;  1QVF A;  1EY7 A;  3S1N B;  5BN3 A;  4LF4 H;  3SEB A;  2TMP A;  3G6E A;  1R9T B;  1I50 B;  1I7L A;  4R8I A;  3RUZ A;  3R5X A;  4JI8 H;  3S14 H;  1VMP A;  3URY A;  3MR3 A;  3OWF A;  5FD5 A;  2EPB A;  1CTM A;  1KAA A;  2IX3 A;  1CZG A;  5LMU Q;  1PYB A;  3GTJ A;  2OWO A;  4PNY A;  3KAL A;  2EYP A;  3HG9 A;  1LTG D;  4LFC Q;  4JI2 H;  2UXC H;  2R93 H;  1Z47 A;  3CCE A;  2UUC Q;  3PN1 A;  1PH7 A;  3K5I A;  5FLM H;  1HR0 Q;  2F0W A;  4ECS A;  2JA6 G;  3OPO A;  5I47 A;  2KED A;  5BPH A;  4IRC A;  3PW4 A;  2EY1 A;  4RGO S;  4DV3 Q;  4DV2 H;  1B3A A;  1JDB B;  3BS1 A;  1I6H H;  1MIU A;  1UE7 A;  4A3D H;  4MA5 A;  5CBA E;  4ZAI A;  4GOP B;  4X62 L;  4DL5 A;  3GIJ A;  3HOZ B;  4A3I B;  1TT2 A;  1VCI A;  1V1Q A;  3FP9 A;  5IYC H;  2YW2 A;  3CU7 A;  1RJP A;  1NNX A;  4JYA H;  1F77 A;  4A3M G;  5KG4 A;  1YJW A;  5KG7 A;  4CGY B;  5KFH A;  4JI7 L;  3V6H A;  4TUY F;  1BR9 A;  1E7Z A;  3FPP A;  2JA6 B;  2A74 C;  4V19 0;  2Z0S A;  1W2B A;  1XNQ Q;  1VQG A;  3HFZ B;  5AFW A;  2JYO A;  4ZKB B;  5KIX A;  1PFN A;  1A2T A;  1VQL A;  4JI6 Q;  5C3E G;  3V05 A;  1PV4 A;  2WE6 A;  5C5J A;  5LMN W;  4WJ4 A;  4L5T A;  2ENB A;  1JOO A;  1B33 N;  2FPI B;  4DK3 C;  2WYO A;  1SE2 A;  2XWB B;  3CCJ A;  4DR7 L;  1TS4 A;  3BDL A;  3MJF A;  1A9X A;  1YHQ A;  3S16 B;  1EHI A;  2BH2 A;  3T1Y H;  1EY4 A;  2UXB H;  3BU2 A;  4RH6 A;  2CQO A;  3BDO A;  5D1O A;  3QOL A;  1PH1 A;  4O4L F;  4WFN 3;  4DL2 A;  3VYS A;  1SYD A;  4NB3 A;  5E1F A;  2MUY A;  4DK1 A;  4A3M H;  2JEA I;  1U5K A;  4LWC A;  3HOY H;  2JEB I;  1SNM A;  4LF4 Q;  2QIL A;  2K5V A;  4AQY L;  4LF7 L;  1OXS C;  1EZ1 A;  4JI8 Q;  5C3E B;  4GKJ Q;  2PNH A;  1O7Z A;  3BDC A;  5ELO A;  4GLA C;  3S1M B;  1RK5 A;  3PCO B;  1CFM A;  4IZ8 A;  2ZJP A;  2B63 G;  3NP8 A;  1PDQ A;  3NEL A;  1IKL A;  3SXH A;  4ILW A;  5GAD C;  5J2U F;  2HUG A;  1UEB A;  1GSH A;  2CWP A;  1JCK B;  1T94 A;  1K83 A;  4JI2 Q;  5BN5 A;  1KNE A;  4UP7 A;  1SBB B;  2UXC Q;  4Q0Y A;  1ULZ A;  1DOK A;  3GTP A;  2VA3 A;  3CCV A;  4FO2 A;  2OTJ A;  5ELB A;  1WD0 A;  3R23 A;  1EZ6 A;  2JSO A;  3MFG A;  4XT1 B;  1FNU A;  3G6Y A;  5C0X J;  3HOW G;  4ZQI A;  4DV2 Q;  2F03 A;  3U9O A;  3D8G A;  4XQN A;  4JV5 H;  1WTW A;  4GNX C;  1PX2 A;  1XTC D;  4HID A;  5D65 A;  5EQ0 A;  4DL6 A;  5K36 G;  1CQJ B;  2NVT H;  4JYA Q;  2SNM A;  4TRD A;  3NHH A;  2LY7 A;  3VPC A;  1LTR D;  1HZ9 A;  5JPN C;  5KFX A;  2B63 B;  2I87 A;  1KC7 A;  4A3K H;  1KXL A;  5KFR A;  4JBK A;  4MNO A;  1HHV A;  2ZXO A;  3Q8P B;  3V4Z A;  1U4M A;  4LJZ C;  2EOT A;  4HIM A;  1G8Z D;  2X0S A;  3Q1K A;  3PW2 A;  2L1B A;  1LTL A;  3HOW B;  4L63 B;  3S17 H;  1TWC B;  3ULJ A;  4DL3 A;  2ZDQ A;  3I4N H;  4JBM A;  1EL0 A;  2VXW A;  4DR1 L;  2RDJ A;  1GUO A;  1K83 H;  4UHV A;  4IHJ F;  4PDB A;  4Q8F A;  4JI7 H;  5IOD A;  2EE1 A;  5LL6 X;  2ASL A;  2YYZ A;  1SRO A;  3IG0 A;  5GAH C;  3T1Y Q;  1Y1V A;  2DGY A;  2J4X A;  2UXB Q;  2I5M X;  3FKI G;  1B53 A;  5C1O A;  5KFE A;  2NUA B;  1EIY B;  1EEI D;  4F4Z A;  1BXT A;  3K57 A;  1GJX A;  1O7L A;  5J2T F;  1STE A;  1DXM A;  4X3T A;  2YCH A;  4J9N A;  1OWT A;  4DUY L;  2JE6 I;  1IYJ B;  5J3B A;  1XYI A;  2HVS A;  2BQ3 A;  5M5W H;  3GTG H;  4RAY A;  4O1N A;  1N8R C;  5CA1 F;  5CV9 A;  2PQE A;  2K52 A;  4OHJ A;  5IY0 A;  5BR8 H;  3RFC A;  2A73 B;  3TDQ A;  3RZO H;  4GC6 A;  4GLV B;  1TWA H;  1OO9 B;  4LFA L;  3CCR A;  1VQ9 A;  1PTO H;  2AWO A;  4XYL B;  3KLW A;  1BBU A;  1CHP D;  2FLL A;  1MHW C;  1L1O C;  3IFD A;  4APM A;  4OWW B;  4ED1 A;  5C6A A;  2GLT A;  4ZOL F;  3FKI B;  1K28 A;  2YL2 A;  4QJF A;  1N32 H;  1VQO A;  4C3H G;  2NN6 I;  3P75 A;  4CDE C;  4IUU A;  1QWY A;  1RJT A;  3GO5 A;  1QVC A;  4LF7 H;  1OXX K;  1PFS A;  3QIA A;  4FYD A;  5HBR B;  1HZB A;  4JV5 Q;  4EGQ A;  4DV7 L;  2F0H A;  3K5L A;  4QMG A;  2I07 B;  5IYD H;  3N8D A;  1K1S A;  2B2U A;  5KFY A;  1SXT A;  1NTG A;  1VMC A;  2WAQ E;  3MFY A;  3I55 A;  1HRJ A;  3K5H A;  4L6T B;  1FD7 D;  4B9X A;  1PLF A;  4YY3 L;  1YNJ C;  1H9M A;  1NR4 A;  2OF1 A;  1RKN A;  3EIV A;  1X54 A;  2R7M A;  4O3P A;  4MV6 A;  5KFA A;  4EYI B;  3ZJY C;  3T1H L;  4I55 F;  2W9B A;  1I4R A;  2EXD A;  3T53 B;  5JVG 3;  1H9S B;  3PR4 A;  1HCZ A;  2NVY A;  4N8X 1;  3Q2O A;  3GTM A;  3RAQ A;  4C3H B;  2VQE L;  1JXL A;  2YU9 H;  2E2I A;  3ITP A;  4O42 A;  1BDO A;  4X65 H;  1ROD A;  4ED7 A;  2AQ4 A;  2BH8 A;  3BVZ A;  2ZXR A;  2DLN A;  5AJ3 L;  5BN4 A;  3HOX H;  3PR5 B;  3M9O B;  2K01 A;  4JI7 Q;  1TWF B;  3KBX A;  3HOU G;  1AZP A;  1DD2 A;  2QDB A;  1VQH A;  3H3V C;  4IFD J;  4J9L A;  2F0I A;  1P16 A;  1PH2 A;  1YZ6 A;  1K8M A;  2D5D A;  4DL7 A;  3S1Q B;  5KFF A;  2VQF L;  3KAJ A;  4KD4 A;  3TIG A;  1KTK A;  1BJT A;  2UU9 L;  4DR3 H;  1DOL A;  1KAB A;  2B2Y A;  2V1C C;  4KHZ A;  2XGP A;  4JK1 C;  3CME A;  3OHX C;  4U6P A;  4JW0 A;  4C1N K;  4G7Z C;  1Z2P X;  4KN7 C;  3Q0A A;  4AYB A;  4A3G H;  2HVR A;  4QUC A;  3NK9 A;  4GOP C;  2KOL A;  4B3M H;  3RNU A;  1WTX A;  4DUZ H;  2NWG A;  3MWY W;  4DAV A;  4QIW A;  3DHQ A;  1PH4 A;  4B3S L;  1C4Q A;  3RLO A;  2NYZ D;  5KNB A;  4IWX A;  4M9U A;  3LNN A;  1I94 H;  2DNC A;  5BR8 Q;  1G2S A;  3QO2 A;  4DA2 A;  4DL4 A;  1HQM C;  2KCT A;  3QR8 A;  2EZV A;  4MTN A;  3MWE A;  3I7F A;  2B2W A;  2EY6 A;  3I90 A;  4POG A;  3SI8 A;  1YIT A;  3HOU B;  1CE8 A;  3GID A;  1LTT D;  3J81 W;  3C3L A;  4ZHQ F;  3I91 A;  5IWA L;  2NVY H;  2NVQ B;  2E2H B;  3MZ5 A;  1Z6H A;  2E2I H;  1N32 Q;  4MV4 A;  2YS6 A;  1ESR A;  3I4M H;  1W93 A;  3M3Y H;  2ASD A;  4LF7 Q;  2OTL A;  1L2Z A;  3MXP A;  5E4W C;  5CV7 A;  4DNT B;  1XNR L;  2SOB A;  4XT3 B;  1EWI A;  1IYV A;  2NVX A;  4PV1 C;  2W8K A;  1B9M A;  3ORR A;  4LF9 H;  2BA0 A;  1PVO A;  4A4I A;  2VQD A;  2F1M A;  3TME A;  2XCA A;  1AZQ A;  4YQW A;  1OXT A;  1PZK D;  3B6Y A;  3EJI A;  4JOI A;  2DUD A;  5C5M A;  1I3Q H;  1UNS A;  2A69 C;  2VL6 A;  4RHR A;  4FU0 A;  2E74 C;  3H0G G;  2R7Z H;  2BOS A;  1VDZ A;  1BBW A;  3MXN B;  4HCE A;  4ZRZ A;  3U4V A;  3JAM L;  4CDC C;  1Y8N B;  2HQL A;  2AMC B;  5C4Z A;  3F2B A;  3E6Z X;  1SFO H;  1Y69 U;  1N48 A;  1DOM A;  4A3E H;  3ZYY X;  1SE4 A;  4X65 Q;  3K0Y A;  3SK4 A;  1MGS A;  1JJ2 A;  4A3J H;  2RF4 A;  5FK9 C;  3OTO L;  1F2Y A;  2ATW A;  4RB3 C;  4QW9 A;  2DPI A;  1CKN B;  4J9R A;  1B6R A;  1IBL H;  5C4J B;  4KD3 A;  3JSL A;  3NEN A;  5DAU A;  3CC4 A;  3PGZ A;  5ELD A;  3A55 A;  3A0J A;  2L15 A;  2WKC A;  1QG7 A;  4QGU A;  4DV4 H;  3RGX A;  1ZHQ A;  1E22 A;  1ENA A;  1G91 A;  2R7D A;  3T1H H;  1AEX A;  1Z2N X;  1SYX B;  1Q8K A;  4EBD A;  2LXK A;  4FBT A;  2F52 A;  4DR3 Q;  5FD6 A;  4ZI7 F;  3H0G B;  4L5Q A;  2TSS A;  3NBI A;  3S1R B;  3PUZ A;  4B9W A;  2W7P A;  5JEA J;  2NVX H;  1X3P A;  4RWS C;  4B3M Q;  1KJI A;  1MKH A;  4KY5 A;  4DUZ Q;  4X64 H;  2F3V A;  1KDA A;  2UVW A;  1VS0 A;  3CC7 A;  2R8J A;  4A3B H;  1TA8 A;  2K5D A;  1LM0 A;  4UPA A;  1MI2 A;  1I94 Q;  2JA8 G;  3CKI B;  2MHV A;  3DUZ A;  3PIO 3;  3TIN A;  1E0B A;  3UI2 A;  3Q6S A;  5IGC A;  2B2V A;  1VQJ A;  4DV0 L;  2FK3 A;  1B7Y B;  3BAB A;  1TWG A;  2VQF H;  2NN6 G;  1SYF A;  4EQ5 A;  3MHB A;  3R5F A;  1UNN C;  3G6X A;  2PI2 E;  1HNZ L;  5IIF A;  2EJF C;  4MV7 A;  2V9W A;  3RB0 A;  5KG0 A;  2VZA A;  4IO9 A;  4ZYS A;  1WOC A;  1Q8I A;  1DGS A;  1RYS A;  1ESF A;  4KTA A;  4EFE A;  4B08 A;  1J6Q A;  4F7X A;  2JK8 A;  1PH3 A;  1K73 C;  1JE5 A;  3U50 C;  2VUM H;  4JI5 L;  2DIK A;  4FS1 A;  1YNJ D;  4LF9 Q;  3JAM c;  4KK7 A;  3S15 H;  3P20 A;  2JA8 B;  5I6Y A;  5JAV A;  4RAU C;  5A2Q W;  3RLF A;  4FDB A;  1V9P A;  4TSS A;  3UE0 A;  4ED2 A;  3TP7 A;  2F4V L;  4ID6 A;  4QW8 A;  4R4O A;  5IWA H;  3PW0 A;  5DM7 3;  5CV5 A;  2NZH A;  2ZTE A;  1FJG H;  5DQG A;  3CD6 A;  2IHF A;  5A35 A;  3M7N A;  1UC8 A;  2Q2T A;  5ELN A;  2JA5 A;  3W2D A;  4P2C B;  3RB6 A;  4FF1 A;  1XNR H;  4BBR H;  3KK7 A;  3RTX A;  3T5J A;  1KDB A;  3I56 A;  2RCN A;  5LL6 S;  1FNW A;  1K3R A;  4JI3 L;  1JE4 A;  1JQY D;  2R7F A;  1FGB D;  4IPG A;  4NW2 A;  3PUW A;  4XXE A;  3A8J E;  5M5X H;  1N36 L;  2ZJR A;  2ICI A;  4X3S A;  4MN3 A;  3J81 i;  3BVM A;  3FPU B;  1IBL Q;  1F2M A;  1ZYR C;  3UDF A;  4MTD A;  5E3F A;  1JWM D;  2W7O A;  3HKZ A;  4BY1 H;  3MTS A;  4DV4 Q;  1RD9 D;  2ASB A;  2PNR C;  2Y0S A;  4Y8V B;  4H0L C;  3T1H Q;  1MBY A;  1STH A;  2A6H D;  4DR2 H;  2NU9 B;  5KG6 A;  4A2A A;  2L5T A;  2W6O A;  1KHI A;  3ULL A;  2XIG A;  1S5F D;  5CYU A;  4XX0 B;  3S2H B;  3L2P A;  1R4Q B;  1PFM A;  1X55 A;  1EYG A;  4X64 Q;  1HR0 W;  1AUV A;  1JR0 D;  3RN2 A;  3MFI A;  4O3S A;  3EPG A;  4DXG A;  3GTO A;  3EVQ A;  1DM0 B;  3NTK A;  3M4O H;  4UCR A;  4JBJ A;  2RHS B;  2FB9 A;  3AMU A;  3I8Z A;  1CSP A;  1ET9 A;  4HJ7 A;  4RMF A;  5EWG A;  2VQF Q;  4R4T A;  3MXG A;  4XTC S;  2K05 A;  2F4I A;  3BQ0 A;  2JA5 H;  3H40 A;  4H02 A;  1GOZ A;  3E9I A;  1HNX L;  1HA6 A;  1IW7 C;  1VQP A;  1IBM L;  1RL2 A;  2UUB H;  3GTQ A;  3LML A;  3I4L A;  3TQY A;  5KFV A;  1C8C A;  3GTL A;  1X3F A;  1GO3 E;  1ASY A;  2CCZ A;  3RZD H;  3GP7 A;  3VYR A;  1Z9F A;  1C7Y A;  4X66 L;  1MSH A;  1XPU A;  5F2D A;  2KSW A;  3I72 A;  1Y1W A;  2KQ3 A;  1W3S A;  2AWN A;  2M05 A;  3N40 P;  2VNU D;  4DV0 H;  1S0N A;  1SEB D;  5IYC G;  2GN5 A;  2A69 D;  1HH2 P;  3JZI A;  3TS2 A;  1SR3 A;  2JA7 G;  2N55 A;  4ME6 A;  3S14 B;  2WB1 A;  3M7G A;  2RGR A;  4UY8 C;  4HIO A;  5IWA Q;  5IT9 L;  1HNZ H;  4NP5 A;  4YAJ B;  1K9M C;  2YRW A;  1EIG A;  2ZDH A;  1FJG Q;  5KFK A;  4H44 C;  3VR2 A;  1Y14 B;  1KDC A;  1PH5 A;  2R93 A;  1KD1 C;  3GD7 A;  4HSP A;  5KFQ A;  1XDN A;  1XNR Q;  1SNO A;  4WJ3 M;  3GV6 A;  1JIC A;  3UQ8 A;  3DWP A;  4LSX A;  1WCM A;  2DPJ A;  4NXN Q;  2PMZ E;  4A93 H;  4U68 A;  2XSC A;  1D8L A;  2K7V A;  2LS0 1;  3OW7 A;  4CJ0 B;  3A5U A;  5KFO A;  5KFC A;  3H20 A;  1SNC A;  5F9N A;  5IP7 G;  4DV6 L;  1GVP A;  2O2L D;  4X3U A;  3RLN A;  3CQZ H;  3PUV A;  5D8D A;  1L1O A;  5JOB A;  1CKM A;  5GQO A;  4DR4 H;  4LF5 H;  4RA8 A;  2F0L A;  1J5E L;  4A3C H;  3ETJ A;  2JA7 B;  1VQK A;  2FMM A;  4EFB A;  1B70 B;  4ECV A;  1UAP A;  3GDE A;  3RGZ A;  4DR2 Q;  1KLG D;  1LAC A;  2F0G A;  2SEB D;  3F2D A;  4DAY A;  3GTL H;  1XXG A;  5LMN L;  1MZB A;  2A68 C;  1IKM A;  1IOV A;  4KMU C;  1YNN D;  2W6N A;  1NAP A;  2N3S A;  3PV0 A;  3Q8R B;  4C3I H;  1Q3L A;  1E2W A;  1Y1W H;  2HJW A;  2NU7 B;  1Q90 A;  1VQA A;  1GD7 A;  2R82 A;  3KHH A;  1UUP A;  4DAM A;  5C44 G;  3NBH A;  3J7A F;  2BDO A;  4ECU A;  4IPD A;  3R3O A;  1HUN A;  1EQR A;  2R85 A;  4OEM B;  4L1K A;  4TQU S;  1B8A A;  2J6T A;  3TSS A;  4J9M A;  2NBF A;  3GTJ B;  1SCU B;  3RR5 A;  4F4X A;  5ELC A;  3GIQ A;  2HQE A;  2JXM B;  1X3G A;  5JEA G;  4YCW A;  5F9L A;  2A6E D;  2FK1 A;  5KG3 A;  2R84 A;  1E2Z A;  4IFD H;  1PYW D;  3SDZ A;  4ABN A;  2K04 A;  2WAQ A;  3I4O A;  3OSP A;  1WCM H;  1VQ4 A;  2UUB Q;  5I9O A;  1I6U A;  4ETS A;  1CQF A;  4IR9 A;  1BKB A;  4O2D A;  4EX5 A;  4BBS H;  4A76 A;  2R8I A;  5IT9 W;  1D5X C;  5IT9 c;  3I70 A;  2Z6B A;  1RDP D;  3CPW A;  2KHJ A;  4GZY C;  3PO3 G;  4O2B F;  5D14 A;  1IBK Q;  3PO2 H;  1NMG A;  4ZKC B;  5T14 A;  5C44 B;  4C3J H;  3T13 A;  3GV7 B;  1E4F T;  4DV0 Q;  4R1J A;  4I7H A;  1EQV A;  4UP9 A;  1WTR A;  2B29 A;  1ICF B;  4GLX A;  2FPP B;  2EY2 A;  3JAM E;  3A74 A;  3ERS X;  3K7A B;  4KJO A;  4RZR A;  2KHS A;  1HNX H;  1QCB D;  4ODG A;  3WDN A;  4A3K G;  4LH7 A;  2F3I A;  1IBM H;  2PVP A;  3QFF A;  1VQC A;  4HNU A;  4H7B A;  1ONL A;  5K5P A;  5C1P A;  2CQA A;  1WVL A;  2DNE A;  5KEE A;  4TV8 F;  1T9H A;  2F0E A;  1KRT A;  2CW7 A;  3V2T A;  3W1G A;  5DLQ E;  4Y52 H;  1CS0 A;  4X66 H;  3IAY A;  1S3O A;  5EKI A;  3SK5 A;  1ZYR D;  3LWU A;  1FGU A;  4DLK A;  4K2K A;  3I4N G;  2BE5 C;  3PO3 B;  4I7A A;  3RIZ A;  4K5W A;  1JB3 A;  1SJE D;  3AEV A;  1WTV A;  4DR4 Q;  4LF5 Q;  4R8U A;  3PF4 A;  4JI1 H;  4CDD C;  4HR7 A;  4R4Q A;  4JUZ A;  4LFB L;  3LGJ A;  2CW8 A;  1R9T H;  1XPO A;  4A3K B;  1EOT A;  3FEW X;  3ULP A;  2AHO B;  4DR5 L;  5D1O B;  3N43 B;  2UUA Q;  3CCM A;  4NXM L;  5IYZ F;  3OIQ A;  1JB7 A;  3U4Z A;  4P71 A;  1YHA A;  2Z6K C;  5EPK A;  3SR1 A;  1GUN A;  3ICE A;  3K80 C;  4IPH A;  2XWJ B;  2F0M A;  3PUY A;  4HSV A;  5JJK A;  3H3V H;  1SNP A;  2RDF A;  3UFX B;  2Z1C A;  4KHV A;  5LHY 1;  4X6A H;  3S17 B;  3A7L A;  2K5W A;  2F0V A;  2C35 B;  4XYM B;  4XQQ A;  3I4N B;  2OXP A;  4RFB A;  3VPD A;  4FVM A;  4K5V A;  3DEO A;  2Z4I A;  5C4H A;  2I8C A;  1FL0 A;  4XQJ A;  4JI0 L;  1N34 H;  1QB5 D;  2EQS A;  1B3Q A;  1K83 B;  5KRU A;  1IW7 D;  4CKB A;  1L0Y B;  1VQI A;  3RJ0 A;  4LUO A;  4A3I H;  3GTP B;  1VQB A;  1W6K A;  2ZM6 H;  2MO1 A;  3F2U A;  4J9O A;  2NU8 B;  4OO1 I;  1CQV A;  3PQI A;  2FFK B;  4OIJ A;  2I5L X;  5IYB H;  1STA A;  2PW5 A;  1XTD A;  4B3T L;  4FF2 A;  3SE0 A;  3UDG A;  1XMQ L;  2EY5 A;  5FO7 B;  4RNN A;  2AUJ D;  5H1S E;  2QCP X;  5M5W B;  1N33 L;  3GTG A;  3J7Z C;  3F2C A;  2JQO A;  1VAJ A;  3MXU A;  2VOB A;  1SYE A;  4C1N I;  5IYD G;  3TS0 A;  1KAW A;  1HJP A;  2EYF A;  4M1U B;  2JA6 H;  5ELF A;  1Y1V G;  3S9W A;  3BZD B;  4OEL B;  2XRQ D;  4ECQ A;  2WFW A;  1A3U A;  1HNX Q;  1PZI D;  1TWA A;  1PTO B;  2D62 A;  1IBM Q;  3S2D B;  3BQ2 A;  3N41 B;  2IW3 A;  2ICE C;  1AN8 A;  1SE3 A;  4MA0 A;  1G29 1;  2JEG A;  5E4X A;  1VQ7 A;  1RJR A;  4X62 H;  2J6U A;  3R8B A;  3GIL A;  2M2L A;  4X66 Q;  2HDL A;  3STB D;  2PQA B;  1GUS A;  1Q46 A;  4BY7 H;  3S16 H;  2W6Q A;  5KT7 A;  2E76 C;  3CCL A;  5M5Y H;  1EU4 A;  2J7Z A;  1XMO L;  1YIJ A;  1HNW L;  2B63 A;  4O2A F;  4IOC A;  1HA5 A;  5EAY A;  1FNV A;  1AE2 A;  4IQZ A;  4JI1 Q;  5JVD F;  4O4H F;  2RA4 A;  2OQ0 A;  3TEH B;  1Y1V B;  5CV6 A;  5DNF A;  1AH9 A;  1WTH A;  2A68 D;  5M9O A;  3RF2 A;  2R87 A;  4RHS A;  1STY A;  2LXJ A;  3RD4 A;  4EBE A;  1Z7T A;  4AH6 A;  4CKE A;  5C3E H;  3RBE A;  5M3F G;  1X6O A;  2NUC A;  2ZTD A;  3I3C A;  4ME3 A;  1YBY A;  5FPR A;  2AQ2 B;  3WOF A;  5CC4 A;  4V0B A;  4CC5 A;  4GN5 A;  4LF6 L;  2HIV A;  4S3S A;  1RF2 D;  2AQ3 B;  2QK4 A;  5DQI A;  4YJ3 F;  2MPM A;  3J7A V;  4IWY A;  3GQB A;  2PI2 A;  3BZK A;  1STB A;  3U9S A;  1KNA A;  1RHP A;  2YU9 A;  2IX1 A;  1U4L A;  1JLL B;  4LK1 C;  4RZQ A;  2NZO A;  3PMF A;  4DR7 H;  3K3V A;  4Q8E A;  3R93 A;  4ECW A;  4YBZ B;  1ENC A;  5KFN A;  2HIX A;  1N34 Q;  1CQI B;  5KFP A;  3KHR A;  2OLS A;  1E3P A;  4YHH L;  1PXU A;  1LV9 A;  4PMB A;  3GTK A;  2O4X A;  4DR5 H;  4CDF C;  2MFI A;  5KFU A;  2ZM6 Q;  4UFZ A;  4NXM H;  4KY7 A;  3KJP A;  3D4D A;  4MV8 A;  2O5I C;  1FR3 A;  5M3F B;  5IGE A;  1WTQ A;  5DLF A;  1JX4 A;  4K0K L;  4IN3 A;  1SAP A;  5LA6 F;  2XGQ A;  4DNR B;  1BNC A;  3NWS A;  4AQY H;  2B63 H;  1TKW B;  2LKV A;  3QZ8 A;  2K4K A;  2E2J B;  1M0W A;  4A2B A;  4KI0 A;  1VBH A;  2W9C A;  2R6F A;  3J81 L;  5C4X G;  5IT9 E;  5JVL A;  4JVZ A;  5FJ8 H;  3K6O A;  4A3F G;  1UE5 A;  5LP6 F;  2K75 A;  2R86 A;  1JJC B;  4MV9 A;  3L4K A;  1QNK A;  1QUQ A;  4HJ9 A;  5KT6 A;  1K1Q A;  4IUR A;  5HGQ A;  2NU6 B;  1SND A;  2XIW A;  1V1P A;  3G6J B;  1CHQ D;  4J6H A;  5L1L A;  4J8Q A;  1TWC H;  3X3N A;  4QUF A;  5I4D A;  5M3M H;  1HFN A;  1TU2 B;  1JOQ A;  5KT5 A;  4LH6 A;  3KDF A;  2W9B B;  4AYB G;  4B3T H;  5COR A;  1FVI A;  4J9Q A;  4X62 Q;  3J80 W;  2NVY B;  4XIG S;  3GTM B;  3TP8 A;  2AKW B;  5K36 H;  2BE5 D;  2RSN A;  3TRE A;  1GGO A;  2E2I B;  4DV1 L;  1N33 H;  1T36 A;  2XGT A;  2C2E A;  1MJC A;  4KKT A;  3A7A B;  3M3Y B;  2G5D A;  3VDY A;  3T5L A;  3BG5 A;  3GV5 B;  1SMY C;  4EGV A;  2FE3 A;  4K8J A;  2O5J C;  2GPS A;  2ZJQ A;  4QWA A;  3EPI A;  1PRT B;  5C4X B;  4OGQ C;  4A3F B;  1IXR A;  3PSI A;  3GTK H;  2YS7 A;  4ED0 A;  2B2T C;  2K50 A;  1HUM A;  1JDE A;  1KJ9 A;  3BA9 A;  4PMC A;  2F0F A;  1LLR D;  2VPQ A;  1O80 A;  4OWT B;  1I5F A;  4KKU A;  4OIK A;  2HGS A;  2BA1 A;  3K0X A;  2J6S A;  1RK6 A;  2ZJT A;  5KFJ A;  3N42 B;  5DG7 A;  2C5C A;  1I3Q A;  5KG5 A;  2F0K A;  2R7Z A;  2RCF A;  2A6H C;  4RGN A;  4AYB B;  4YCV A;  1QVG A;  4IZO A;  4JV0 A;  1M1K C;  5EKL A;  4IR1 A;  2DJG C;  4QWB A;  1AUX A;  5DGA A;  4QIW B;  1HNW H;  4JI4 L;  1SMX A;  3JC6 6;  1U0L A;  4H13 C;  4DR1 H;  1WYD A;  3T4A C;  2MJ8 A;  2KJX A;  3FKI H;  5KFZ A;  4HMJ A;  1SFO A;  1HPC A;  4DR7 Q;  3IN5 A;  1C3O A;  2BQU A;  2YZG A;  4B3R L;  4O3O A;  3WWV A;  4OO1 G;  1II3 A;  1STN A;  2R3Z A;  1X3Q A;  5DG9 A;  3CC2 A;  3RMH A;  2RKS A;  4DR5 Q;  1BGW A;  3J81 c;  1OXU A;  1TY2 A;  4NXM Q;  3ER0 A;  4DUY H;  4PQX A;  4KHP L;  1BCP F;  4C56 C;  2B3G A;  2KCM A;  1VQN A;  4AQY Q;  1LTB D;  2RVL A;  1E4E A;  3EN2 A;  4UCV A;  2G9D A;  1UE6 A;  1X56 A;  3L3O C;  4HN7 A;  1HTP A;  4KY6 A;  3OYY A;  2NVX B;  1KJQ A;  5CR3 A;  2HHH L;  2XC9 A;  4LFA H;  3E3X A;  3CPF A;  2CHB D;  4HAE A;  1L0W A;  3H6M A;  1D1I A;  2IX0 A;  1K8O A;  4LW1 A;  1V8Q A;  2VA2 A;  2PMZ A;  3KOJ A;  5KYI A;  3BJU A;  1H9J A;  1RTN A;  3H09 A;  3KF6 A;  4UAI A;  5EDW A;  4I50 F;  4FXG C;  5IGD A;  2UVU A;  1M0T A;  1SEI A;  2K5Q A;  3KUP A;  4IAJ A;  3RN5 A;  1KRS A;  1PH9 A;  4B3T Q;  1KJJ A;  2NTS A;  1A63 A;  2JEI A;  3CMA A;  4XDX A;  2UVV A;  5CMD A;  4DV7 H;  5A2Q L;  1EY5 A;  1LAB A;  3GLK A;  4PZ6 A;  1N33 Q;  3OOC A;  1P8L A;  2YV5 A;  4F4Y A;  3S1Q H;  1S5D D;  3M4I A;  4C5C A;  1BF4 A;  2K33 A;  2D0P A;  1CZW A;  2R8K A;  1PZJ D;  3TQ1 A;  5G3L F;  4YY3 H;  1H9R A;  2L9H A;  2VUM A;  1JOR A;  4FNF A;  4Q5V A;  1UC9 A;  2L0C A;  4P75 A;  4J0M A;  1GKH A;  4YAK B;  2BQR A;  3NTI A;  2RHQ B;  1C30 A;  3K5M A;  3D0F A;  4GKK L;  4IUQ A;  3V96 A;  4BWG B;  1I4H A;  4FXD A;  1ML0 D;  1JIH A;  2VQE H;  2W6Z A;  4DV1 H;  1VF7 A;  3A8K E;  4UCS A;  2NB0 A;  4HMI A;  1HNW Q;  3HOU H;  2Q2H A;  3GQC A;  4DR1 Q;  1YNN C;  2V58 A;  3RUP A;  3HOV H;  1MJE A;  5EWE A;  4AIM A;  1A3T A;  1DCZ A;  2NVQ H;  5HUR A;  5LMU L;  5M5X B;  1YJN A;  4RU9 A;  4ED8 A;  1GHJ A;  1PK8 A;  4LFC L;  2E5L L;  1B50 A;  2UUC L;  4LMQ D;  4PG3 A;  1TWG B;  3OMG A;  3J80 i;  3H3V I;  5KFD A;  2UU9 H;  1HR0 L;  1AW7 A;  2N88 A;  4EQN A;  2QA4 A;  1RIP A;  2W9A A;  1GSO A;  3QZ7 A;  1TWH B;  4DUY Q;  2JA5 G;  4RB2 C;  3NPP A;  3A5Z B;  3FVQ A;  2A6E C;  2ES2 A;  3BZC A;  4RKL A;  3ERO A;  2AUK A;  2IT1 A;  4LSA A;  4B3S H;  5KT2 A;  3M9M B;  4CKC A;  5BPF A;  1G6Z A;  1VQ8 A;  3J7Y W;  5D1P A;  4Y7N B;  5KKN B;  3DEP A;  2KVM A;  1WTO A;  4CJ1 B;  2V4R A;  3HB9 A;  4B3R H;  1SRU A;  4LFA Q;  1LT4 D;  2L55 A;  5CBE E;  5FOB B;  3K3P A;  3CRK C;  3HKZ G;  4FXK C;  3R5H A;  3C2P A;  1A3V A;  2PW7 A;  3L7Z C;  2Y0S G;  3JSN A;  3QJY A;  1M90 C;  3C46 A;  3FMC A;  3TRZ A;  2F0U A;  1LTS D;  3HP3 A;  1N9W A;  3TZU A;  5G3L D;  2R92 A;  1NSN S;  1LT5 D;  4Z9C B;  4RB1 A;  3OMC A;  1G6P A;  4TVA B;  5CGK A;  5JVH 3;  2K03 A;  1JC7 A;  1J8I A;  2Z6K A;  3WO0 A;  3MAQ A;  2JA5 B;  1LT3 D;  2YTY A;  3KF8 A;  4DPG A;  4DV7 Q;  1O7Y A;  1SMY D;  4JI6 L;  1V4Y A;  3OUU A;  1B1Z A;  5C0X H;  2FJZ A;  2HHH H;  5IP9 G;  2DY7 A;  5T1G A;  3W5O A;  4O4I F;  4J1M A;  3EYY A;  3M9B A;  4A93 G;  2G9H D;  1YVC A;  2BDN A;  2KHI A;  2JEF A;  4YY3 Q;  3BAA A;  3NGD A;  4F8M A;  3HKZ B;  3OUZ A;  1NCV A;  2Y0S B;  2A19 A;  3I12 A;  4A3C G;  4XYQ A;  3TP5 A;  1PFB A;  1S9F A;  2VB2 X;  2FMA A;  2VUG A;  1O75 A;  3Q8D A;  3G6V A;  2VQE Q;  2A1A A;  2RSO A;  2K28 A;  1NR2 A;  1S4Z A;  2L4N A;  5EPL A;  4GNX A;  4DV1 Q;  1W96 A;  3PZP A;  2DWC A;  4YWM A;  1N56 A;  1E4G T;  4C3I G;  1Y1W G;  1EY9 A;  3OTO H;  4JI8 L;  3MVV A;  4GKJ L;  5AJ3 Q;  2HCI A;  3GTO B;  2V5A A;  1B4O A;  4O0A A;  2I0Q A;  4DKA C;  4C2M A;  3NEM A;  4U67 3;  3RAX A;  5I2X A;  1RCV D;  1I4Q A;  5CB4 F;  2W57 A;  4A93 B;  1X32 A;  2R92 H;  2WB1 G;  4G3I A;  3D3R A;  4HYK A;  3FDS A;  2V4Q A;  2UXC L;  3O13 A;  2R8H A;  4ZK9 B;  3SVM A;  3CQZ A;  1SDF A;  5DGB A;  4IUP A;  3UE1 A;  2IWH A;  2UU9 Q;  5JH7 F;  4M7E A;  4QB4 A;  3P7J A;  1WTP A;  1D1K A;  2R93 G;  3BYY B;  4DV2 L;  5FLM G;  3J81 E;  3GTQ B;  4CHT B;  1NMF A;  2R6G A;  1WCM G;  4B3S Q;  2PZU A;  3GTL B;  1VF5 C;  3QOJ A;  1QJO A;  2D2C C;  3N6R A;  3MC0 B;  1PTO F;  3T16 A;  4HIK A;  2MP1 A;  4BBS G;  4A3D G;  3DF7 A;  2NN6 H;  4C3I B;  1TR5 A;  3IL8 A;  1Y1W B;  5GON F;  4B3R Q;  4QF4 A;  1PRT C;  4JYA L;  2KEC A;  1TY0 A;  3OWE B;  4RUA A;  3RB4 A;  2OT2 A;  4LFC H;  2E2D C;  2E5L H;  4C3J G;  4G7H C;  4QIW E;  1I7N A;  2UUC H;  4O3R A;  2QEX A;  1JWS D;  1BCP B;  2UXD L;  1EUD B;  1O78 A;  3Q24 A;  3M85 A;  1CSQ A;  2ZT9 C;  2WB1 B;  3I73 A;  4BXX H;  5EWF A;  4DV5 L;  1TS2 A;  4O3N A;  2Q8T A;  2K5H A;  5KFI A;  2PZW A;  5KYL A;  3CRL C;  2B2Y C;  1TS3 A;  2BCO A;  1NUC A;  4DR6 L;  2R93 B;  4I4T F;  4K6D A;  1KC8 C;  1H95 A;  3NQI A;  4F4W A;  1Q1B A;  3KHG A;  1AFP A;  2PO4 A;  4FF4 A;  4C2M H;  2KCN A;  1WCM B;  5GAG C;  2CQY A;  2HHH Q;  4E4T A;  1GUW A;  2JN4 A;  3LWE A;  4ZUJ A;  3DLL A;  4JI5 H;  1I6H B;  4BBS B;  1D5M C;  4A3D B;  1F9Q A;  3STB C;  2N49 A;  3IFT A;  5I9P A;  4K8I A;  2D0O A;  3RV3 A;  1L1O B;  1Z2O X;  5TSS A;  2F4V H;  1BQQ T;  3SK8 A;  4C3J B;  3T1Y L;  3S2H H;  1RTO A;  1H9K A;  5H80 A;  3V6K A;  2ALZ A;  3KYH C;  4RCO A;  4ECY A;  1STG A;  2E75 C;  2MQH A;  3TBI B;  2CZG A;  4EEQ A;  2PN1 A;  2ZDG A;  3GIM A;  1TVX A;  2YYA A;  1A8V A;  2WAQ G;  4DAY B;  5I6W A;  2AGO A;  2KA7 A;  2QGQ A;  1BBX C;  1YI2 A;  4JI3 H;  1T3N A;  4PZ8 A;  1N36 H;  4BWS C;  5JJI A;  4HJ8 A;  5ELE A;  3OTO Q;  1EOV A;  2FHT A;  5IGB A;  2I46 A;  3U58 A;  2F0S A;  1SYG A;  3NBH B;  4DXF A;  1KJ8 A;  5IGF A;  1LYL A;  2CH4 W;  2WAC A;  3HOY G;  2PYK A;  3VR5 A;  2O03 A;  1BVS A;  3OIP A;  2PCF B;  1PYS B;  2QEJ C;  1F2Z A;  1JKJ B;  2H5X A;  3HEJ A;  4HED A;  2K5N A;  2PZT A;  4K14 A;  2MCT A;  2C00 A;  1Q12 A;  2MNA A;  2RGV A;  5CV8 A;  4FF3 A;  5EZY F;  4WOR A;  2KEE A;  4P73 A;  2WAQ B;  5DEH A;  4J9K A;  3M9N B;  4NMZ A;  1R9T A;  1I50 A;  5KNC A;  4X3K A;  4JV5 L;  2JA9 A;  1FYC A;  4GKJ H;  5IYB G;  2X69 A;  1CA5 A;  2W8L A;  2YTX A;  2F0O A;  2VY3 A;  3ERQ A;  3EQL C;  1DJR D;  4MAM A;  3CW2 C;  4UCO A;  4WBN F;  4A3M B;  1XPR A;  3Q22 A;  3EBE A;  2B2T A;  1EU3 A;  3UDI A;  3PIP A;  3HOY B;  2E5L Q;  5DM6 3;  2CVR A;  1AE3 A;  3CCU A;  4TQS A;  2AGQ A;  5L1I A;  1DV2 A;  1EIF A;  5HGT A;  1HNZ Q;  3FDT A;  5A2Q E;  2X6L A;  4EQO A;  4DNI A;  4LMY A;  5C3W A;  3Q23 A;  3MR6 A;  3M4P A;  4J15 A;  1PRT F;  4GOP A;  5L1J A;  2OCE A;  3CXC A;  2N8N A;  2D9U A;  2HD3 A;  3L0O A;  4RB0 A;  3D4W A;  1IYU A;  5JUM A;  2JA7 H;  2W6M A;  4PWQ A;  2C22 A;  5FO8 B;  4Q44 A;  4N9T A;  4JI5 Q;  4BY7 G;  3KJO A;  1EY0 A;  2KEN A;  3VR4 A;  5LL6 b;  1A62 A;  1S0O A;  2UXD H;  3X3M A;  4MV1 A;  1VKZ A;  1XX8 A;  4DN4 M;  2B2V C;  2F4V Q;  4DV5 H;  4A3L H;  1K0S A;  4LUV A;  2FPG B;  4R8U B;  3G48 A;  2IMW P;  3TZD A;  1WR2 A;  4HR7 B;  5KG2 A;  1I4G A;  2NVT B;  5KFG A;  2KUM A;  5ISR A;  3OSO A;  1EZ8 A;  3S1N H;  5CA0 F;  2JA6 A;  3VYU A;  4DR6 H;  1SN8 A;  1I50 H;  3A56 A;  4QCL A;  2XN9 C;  5IP7 H;  1JWU D;  3GTJ H;  4JI3 Q;  3EA6 A;  1V43 A;  4WD3 A;  1N36 Q;  2R7K A;  1F9R A;  1DON A;  1QE6 A;  1VQE A;  1JJG A;  4PZ7 A;  1Q81 C;  4F87 A;  2XD4 A;  4GN3 B;  5BR8 L;  4DV6 H;  4O3Q A;  1I4P A;  4BY7 B;  2XCP A;  3M4Y A;  4R4C A;  4YIJ A;  3JRX A;  5M5Y B;  1J5E H;  3TII A;  3VA5 A;  2XRS D;  3IKJ A;  2F0P A;  1OTC A;  3K58 A;  1HQR D;  1TXY A;  2RBM A;  1EWC A;  2J9G A;  1IZ6 A;  1WH2 A;  1EYC A;  1JT8 A;  3HOZ H;  3KHL A;  5LMN H;  2UVR A;  3HKZ E;  1N32 L;  3OHB A;  5C44 H;  1KEE A;  1U4R A;  5IE8 A;  3AB9 A;  1MD2 D;  4IJL A;  2Y0S E;  3W1B A;  1PMR A;  3CP0 A;  1VQF A;  2W6P A;  3PVX A;  1EWH A;  1CK1 A;  1PRT D;  2V59 A;  1LTI D;  3TN2 A;  3K7A H;  3K81 C;  4BA1 I;  5JPM C;  2K14 A;  5JEA H;  1EYD A;  1T5E A;  4LF8 L;  3G7L A;  3GTG B;  2RDI A;  4I65 A;  2WDT A;  4TKO B;  3ONA B;  3QB3 A;  5FJ8 G;  4RGT A;  1LTA D;  5LXT F;  1PH6 A;  1EYA A;  3KFU A;  1BUV T;  2OQK A;  1KL9 A;  3RZO B;  3N6X A;  3V4S A;  1XJV A;  4JCV E;  1M4V A;  1TWA B;  4UCT A;  4FP5 D;  4CBV A;  3LWB A;  1DYQ A;  3M4Q A;  3R2I A;  1AP0 A;  3PO3 H;  1ZXT A;  4F88 A;  3CVZ A;  1A0I A;  1YHB A;  1HZC A;  5M3M G;  1ENF A;  1S40 A;  3NUC A;  3DWQ A;  4X65 L;  3H94 A;  1SSO A;  1HZA A;  2FK2 A;  3ND8 A;  4J9P A;  3SE7 A;  1EYZ A;  4PMW A;  2FLN A;  3J7A K;  3J7A 5;  2UXD Q;  1LUZ A;  2WTF A;  5EBD A;  3KXY T;  4IRK A;  2ALY B;  2L11 A;  1E1O A;  3ND9 A;  4KN4 C;  3TP6 A;  1BO0 A;  1O7I A;  4DV5 Q;  3HOX G;  1R4P B;  3J80 L;  4L5R C;  5C0X I;  5KX5 F;  5L9X A;  2EIF A;  4DR3 L;  3E5S A;  5GRO A;  4DR6 Q;  2NTT A;  1CM9 A;  2ATL A;  1X65 A;  2WB1 E;  2PQA A;  1TWC A;  3S1M H;  1IOW A;  4B3M L;  4XYO A;  5M3M B;  4DUZ L;  3T5K A;  2ID0 A;  4HJ5 A;  3K59 A;  2IJ0 A;  5FLX L;  5KFB A;  5I2Y A;  1RYR A;  4MZ9 A;  4A3G G;  4APV A;  3DM1 A;  1I94 L;  4DV6 Q;  3MWD A;  2IHE A;  1ZKO A;  3KTM A;  3GTP H;  3GII A;  4G57 A;  2YU9 B;  4RNM A;  2W70 A;  5IOC A;  2GA4 B;  3AYH B;  5EOY A;  3PW5 A;  1J5E Q;  1BCP C;  1F2L A;  4LFB H;  2K6A A;  2GVB A;  1S5C D;  1J9O A;  5KFT A;  4A75 A;  3HOX B;  3GTK B;  4DFA A;  3IRB A;  2OEO A;  5LMN Q;  5EPJ A;  4YWK A;  2R7N A;  3MEF A;  3E9H A;  3K5N A;  5C8Y F;  4RAZ A;  5DQH A;  2GPW A;  2QKI C;  1IL2 A;  2CKZ B;  2I80 A;  3I4M G;  3D31 A;  4R8N A;  1PHJ A;  4HNV A;  2W9C B;  4HQ6 A;  4A3G B;  3S2D H;  4LF9 L;  3CCQ A;  1K8A C;  4IUV A;  1HXY D;  4JI0 H;  1VQD A;  5E7N A;  1S72 A;  2JEJ A; 
#chains in the Genus database with same CATH homology
 1X3F A;  1QUQ B;  4DK3 C;  1GO3 E;  3SGI A;  3D0F A;  1GM5 A;  3RZD H;  1ASY A;  2CCZ A;  4GKK L;  3CCJ A;  3HOW H;  3E0E A;  1Z9F A;  1C7Y A;  4X66 L;  4DR7 L;  1XPU A;  4GN4 B;  1YHQ A;  1W3S A;  2AWN A;  2BH2 A;  2VNU D;  5IYC G;  2GN5 A;  1HNW Q;  1HH2 P;  3BU2 A;  3TS2 A;  1SR3 A;  3HOU H;  2Q2H A;  2YTV A;  3KDF B;  2JA7 G;  2R7Z G;  2CQO A;  4DR1 Q;  3F1Z A;  1MJE A;  3HOV H;  1PH1 A;  4HIO A;  4AIM A;  5IWA Q;  4UY8 C;  3J80 c;  4NB3 A;  2NVQ H;  5LMU L;  1K9M C;  4A3M H;  1YJN A;  1Q82 C;  2JEA I;  1Y1V H;  1U5K A;  1SE8 A;  5GAE C;  1FJG Q;  3G4S A;  4LWC A;  3PF5 A;  2JEB I;  1Y14 B;  4LFC L;  1EQQ A;  3HOY H;  2E5L L;  1PH5 A;  4LF4 Q;  2K5V A;  4AQY L;  2UUC L;  1KD1 C;  4PG3 A;  4A3E G;  3J80 i;  3GD7 A;  1IBL L;  1OXS C;  4LF7 L;  3H3V I;  4A3J G;  1Q86 C;  4JI8 Q;  1XNR Q;  1HR0 L;  4GKJ Q;  4WJ3 M;  2PNH A;  2QA4 A;  5ELO A;  1RIP A;  4DV4 L;  4GLA C;  3PCO B;  2WP8 J;  2ZJP A;  4DUY Q;  4HJA A;  2JA5 G;  3NEL A;  2PMZ E;  5FLX c;  4NXN Q;  3A5Z B;  2B63 G;  4A93 H;  1D8L A;  1G51 A;  5GAD C;  2ES2 A;  1UEB A;  3A5U A;  3BZC A;  2CWP A;  1E1T A;  2IT1 A;  4JI2 Q;  4UP7 A;  2UXC Q;  5IP7 G;  4DV6 L;  1GVP A;  3RLN A;  3CQZ H;  1VQ8 A;  3PUV A;  1L1O A;  1CKM A;  5GQO A;  4QL5 A;  3CCV A;  2OTJ A;  1J5E L;  4A3C H;  2Q2U A;  4X64 L;  1SRU A;  4LFA Q;  5C0X J;  2VW9 A;  1VQK A;  4DV2 Q;  1B70 B;  2A8V A;  3HOW G;  3HKZ G;  3GDE A;  4P74 A;  4DR2 Q;  4JG2 A;  3L7Z C;  3F2D A;  2Y0S G;  1M90 C;  4GNX C;  5LMN L;  3GTL H;  3TRZ A;  4HID A;  5JJL A;  1N9W A;  4JI4 L;  4A3B G;  3HOV G;  2N3S A;  3PV0 A;  4C3I H;  1G6P A;  1Y1W H;  4TVA B;  5K36 G;  5M3F H;  2NVT H;  2JJQ A;  3K8A A;  1VQA A;  1GD7 A;  4JYA Q;  4LFB Q;  2Z6K A;  4DAM A;  5C44 G;  1HZ9 A;  4A3K H;  2YTY A;  4IPD A;  4QQB X;  4DPG A;  4DV7 Q;  1KXL A;  2E2J H;  1EQR A;  4JI6 L;  3DM3 A;  4TQU S;  1B8A A;  4JBK A;  4MNO A;  4OX9 L;  5IP9 G;  3RR5 A;  1PH8 A;  3W5O A;  4HIM A;  1X3G A;  3CAM A;  5JEA G;  4KHP Q;  4YCW A;  3M9B A;  1YJ9 A;  4A93 G;  1NE3 A;  1YVC A;  2KHI A;  1LTL A;  3PUX A;  4YY3 Q;  3S17 H;  1VQ5 A;  3ULJ A;  3I4N H;  4JBM A;  4IFD I;  3I4O A;  1EFW A;  1WCM H;  1VQ4 A;  2A19 A;  1KIX A;  2UUB Q;  4JI0 Q;  4A3C G;  1BKB A;  4O2D A;  4DR1 L;  4EX5 A;  2VUM G;  4RG1 A;  4A76 A;  1K83 H;  4BBS H;  3AFQ A;  5IT9 c;  3CPW A;  3GTM H;  2KHJ A;  3PO3 G;  1K0R A;  3PO2 H;  1IBK Q;  3AQQ A;  1NMG A;  4C3H H;  3Q8D A;  2YYZ A;  2A1A A;  2VQE Q;  1SRO A;  4GNX A;  1FJG L;  4C3J H;  5GAH C;  4DV1 Q;  3T1Y Q;  2DGY A;  3KF6 B;  2UXB Q;  2I5M X;  3FKI G;  4YWM A;  4DV0 Q;  1C9O A;  4R1J A;  4UP9 A;  1EIY B;  2FXQ A;  2Q2I A;  2B29 A;  1Y1W G;  4JI8 L;  4GLX A;  4GKJ L;  5C4X H;  5AJ3 Q;  1XMQ Q;  3A74 A;  4A3F H;  3ERS X;  4O0A A;  2I0Q A;  4DKA C;  1C0A A;  4DUY L;  2JE6 I;  3NEM A;  1IYJ B;  1TWF H;  4NXN L;  5J3B A;  4A3K G;  2F3I A;  4LF8 Q;  2CWA A;  5M5W H;  2WB1 G;  4LUZ A;  4BBR G;  2R92 H;  3GTG H;  1VQC A;  1N8R C;  2UXC L;  2K52 A;  5C0X G;  1VQM A;  3UE1 A;  2UU9 Q;  1T9H A;  5IY0 A;  1KRT A;  3W1G A;  3RZO H;  5DLQ E;  4Y52 H;  4GLV B;  2R93 G;  1S3O A;  1TWA H;  4LFA L;  3CCR A;  1VQ9 A;  4DV2 L;  1NBW A;  2AWO A;  1FGU A;  5FLM G;  4BY1 G;  4DR2 L;  3I4N G;  1K8G A;  1NMF A;  1BBU A;  3KLW A;  3S24 A;  1SLJ A;  1L1O C;  1WCM G;  2R6G A;  1Q7Y C;  1E24 A;  4B3S Q;  4OWW B;  3AEV A;  4LNQ A;  4DR4 Q;  4LF5 Q;  4HIK A;  4BBS G;  3PF4 A;  4A3D G;  1UE1 A;  4R4Q A;  1L2F A;  4QJF A;  4B3R Q;  1VQO A;  4LFB L;  4JYA L;  3LGJ A;  2NN6 I;  4QIW E;  1NY4 A;  1CKN A;  1QVC A;  1OXX K;  3GO5 A;  1XPO A;  1R9T H;  1XMO Q;  1PFS A;  2QEX A;  2UXD L;  1HZB A;  4JV5 Q;  3M85 A;  1CSQ A;  3ULP A;  2AHO B;  4DV7 L;  4DR5 L;  4BXX H;  4R4I A;  4DV5 L;  2UUA Q;  3CCM A;  2K5H A;  4NXM L;  2E8G A;  5IYD H;  2E2H H;  1JB7 A;  3F8T A;  3U4Z A;  4P71 A;  1OXV A;  1YHA A;  2Z6K C;  3ICE A;  3K80 C;  1NTG A;  1QZH A;  2I5H A;  4IPH A;  2WAQ E;  3PUY A;  3I55 A;  3OW2 A;  3H3V H;  5JJK A;  2R92 G;  4DR6 L;  4X6A H;  4YY3 L;  4DK6 C;  1KC8 C;  1NJI C;  1H95 A;  1Q1B A;  2C35 B;  4C2M H;  1WI5 A;  3EIV A;  2R93 H;  2UUB L;  1X54 A;  5GAG C;  2HHH Q;  1FL0 A;  4DV3 L;  4JI0 L;  3DLL A;  3ZJY C;  3T1H L;  4LF6 Q;  2EQS A;  2EXD A;  2N78 A;  3STB C;  1JMC A;  2N49 A;  1VQI A;  4LUO A;  2D0O A;  4A3I H;  1IBK L;  2VQE L;  1L1O B;  1VQB A;  2YU9 H;  3T1Y L;  3S2H H;  2MO1 A;  4IOA A;  4OO1 I;  3KYH C;  5IYB H;  2I5L X;  2BH8 A;  2MQH A;  1XTD A;  4B3T L;  5AJ3 L;  1XMQ L;  3UDG A;  3HOX H;  1ASZ A;  1A8V A;  2WAQ G;  4YHH Q;  4DAY B;  4JI7 Q;  5H1S E;  3HOU G;  3G71 A;  2ZTC A;  1VQH A;  2VS1 A;  2QGQ A;  3FHW A;  4BXX G;  1YI2 A;  1P16 A;  1N33 L;  1PH2 A;  4IFD J;  3J7Z C;  3I2Z A;  1YZ6 A;  2JQO A;  4PZ8 A;  3F2C A;  5IYD G;  3TS0 A;  1KAW A;  1HJP A;  2VQF L;  2JA6 H;  4HJ8 A;  4A3M G;  3OTO Q;  1EOV A;  3U58 A;  2UU9 L;  4K0K Q;  5JJI A;  1Y1V G;  2V1C C;  3NBH B;  4KHZ A;  1XNQ L;  1LYL A;  3CME A;  3HOY G;  5C4J H;  1BVS A;  4YCU A;  3KF8 B;  2WFW A;  1PYS B;  1HNX Q;  2IY5 B;  4A3G H;  2D62 A;  4GOP C;  4OWX B;  1IBM Q;  3RNU A;  2H5X A;  2K5N A;  1PH4 A;  4B3S L;  3RLO A;  1G29 1;  4DR4 L;  1VQ7 A;  3H0G H;  4LF5 L;  1Q12 A;  2MNA A;  5BR8 Q;  3S1R H;  4OON A;  4X66 Q;  3STB D;  2PQA B;  3HKS A;  1Q46 A;  2KCT A;  3S16 H;  4BY7 H;  4P73 A;  4MTN A;  3I7F A;  3CCL A;  5M5Y H;  4POG A;  1XMO L;  1YIJ A;  1HNW L;  2KBN A;  4IOC A;  1YIT A;  2JA9 A;  4JV5 L;  1KQS A;  5IYB G;  2YTX A;  5EAY A;  5IWA L;  2UUA L;  2VY3 A;  2NVY H;  1AE2 A;  4JI1 Q;  4IPC A;  3CW2 C;  1XPR A;  2E2I H;  2OQ0 A;  3EBE A;  3TEH B;  4GNX B;  1N32 Q;  3UDI A;  1AH9 A;  1WFQ A;  3PIP A;  3I4M H;  2CFM A;  1Q1E A;  4LF4 L;  2E5L Q;  3M3Y H;  4LF7 Q;  2OTL A;  1TWG H;  1YEZ A;  2LXJ A;  1AE3 A;  4AH6 A;  3CCU A;  5C3E H;  1XNR L;  5M3F G;  3H15 A;  1EWI A;  1X6O A;  4ME3 A;  2ZTD A;  1YBY A;  1X9N A;  4ALP A;  1EIF A;  1HNZ Q;  1TWH H;  4GN5 A;  4LF6 L;  2HIV A;  4DNI A;  2BA0 A;  3M4P A;  4J15 A;  4A4I A;  4JI2 L;  4GOP A;  1PVO A;  2OCE A;  2PI2 A;  3BZK A;  3CXC A;  2N8N A;  1OXT A;  3B6Y A;  3AFP A;  4JOI A;  2DUD A;  3L0O A;  4Y7N H;  2IX1 A;  1I3Q H;  2VL6 A;  4BA2 I;  2MO0 A;  2NZO A;  3H0G G;  2JA7 H;  2R7Z H;  4JI5 Q;  4IFD G;  1BBW A;  2HIX A;  3MXN B;  1N34 Q;  4BY7 G;  2JA8 H;  3KJO A;  3U4V A;  1E3P A;  2KEN A;  4YHH L;  1A62 A;  2XTI A;  4JI4 Q;  2HQL A;  2AMC B;  2MFI A;  2F4V Q;  2ZM6 Q;  3F2B A;  4LUV A;  2HT1 A;  4A3L H;  3G48 A;  1SFO H;  4A3E H;  3KJP A;  4X65 Q;  1JJ2 A;  4A3J H;  2RF4 A;  4AYB E;  1EUJ A;  3PO2 G;  3PIO A;  3S1N H;  3OTO L;  4K0K L;  2ATW A;  3UDX A;  4P72 A;  1CKN B;  1SN8 A;  2B63 H;  1I50 H;  4NPS A;  4OXP A;  1UWV A;  2K4K A;  3NEN A;  5HY6 A;  3CC4 A;  3PGZ A;  3A0J A;  2L15 A;  4KI0 A;  4QGU A;  3K7U C;  4POF A;  5C4X G;  5IP7 H;  4OX9 Q;  1E22 A;  5FJ8 H;  4A3F G;  3GTJ H;  4JI3 Q;  1V43 A;  2R7D A;  1UE5 A;  4JC0 A;  2K75 A;  1N36 Q;  1JJG A;  1JJC B;  1Q8K A;  1VQE A;  2LXK A;  4PZ7 A;  2F52 A;  4YWL A;  1Q81 C;  1QUQ A;  4HJ9 A;  4DR3 Q;  4L5Q A;  5HGQ A;  4GN3 B;  5BR8 L;  4JBW A;  3PUZ A;  1TWC H;  2GVA A;  4R4C A;  5JEA J;  2NVX H;  5M3M H;  4B3M Q;  1MKH A;  4DUZ Q;  1X3E A;  1VS0 A;  1YNX A;  3KDF A;  3CC7 A;  1TXY A;  4AYB G;  3J81 j;  1OTC A;  4A3B H;  4UPA A;  1LM0 A;  1FVI A;  1PA6 A;  1VQ6 A;  1IZ6 A;  1D7Q A;  4X62 Q;  4XIG S;  1I94 Q;  2JA8 G;  4JI1 L;  2AKW B;  1JT8 A;  3HOZ H;  4GS3 A;  3TRE A;  3HKZ E;  1N32 L;  5C44 H;  5IE8 A;  4DV1 L;  2XGT A;  1MJC A;  4L5S A;  2UXB L;  3W1B A;  1VQJ A;  2Y0S E;  4IJL A;  4DV0 L;  3VDY A;  4A3L G;  1B7Y B;  4UP8 A;  3CP0 A;  1VQF A;  2NN6 G;  4EQ5 A;  2ZJQ A;  3CF5 A;  3GTO H;  5IP9 H;  3K7A H;  1IXR A;  2PI2 E;  3K81 C;  3PSI A;  4BA1 I;  3CCS A;  1HNZ L;  3GTK H;  2K14 A;  2K50 A;  4QY7 A;  4LF8 L;  2VZA A;  4IO9 A;  1WOC A;  1DGS A;  4OWT B;  1I5F A;  5FJ8 G;  2BA1 A;  2LSS A;  1J6Q A;  3K0X A;  1QZG A;  1PH6 A;  3KFU A;  2JK8 A;  2OQK A;  1KL9 A;  1PH3 A;  1K73 C;  1XJV A;  1CKO A;  1JE5 A;  4JCV E;  1QVG A;  3U50 C;  4YCV A;  2VUM H;  1CUK A;  4JI5 L;  1M1K C;  1N34 L;  3M4Q A;  4LF9 Q;  3JAM c;  3S15 H;  3GTQ H;  3PO3 H;  1A0I A;  1YHB A;  1HZC A;  1SMX A;  3JC6 6;  1U0L A;  4JOI C;  4KLK A;  4FDB A;  3RLF A;  1WYD A;  5M3M G;  1V9P A;  3UE0 A;  2F4V L;  2ZM6 L;  3FKI H;  4R4O A;  4GKK Q;  1S40 A;  3JAM i;  2NZH A;  4X65 L;  1WJJ A;  4IJH A;  4DR7 Q;  1HZA A;  4B3R L;  2ZTE A;  3HOZ G;  4A3I G;  1QVF A;  3WWV A;  3CD6 A;  2IHF A;  4OO1 G;  3M7N A;  4PMW A;  2Q2T A;  5ELN A;  3G6E A;  3J7A 5;  2UXD Q;  1LUZ A;  3CC2 A;  3S14 H;  4BBR H;  2ALY B;  4DR5 Q;  1E1O A;  3J81 c;  1OXU A;  1O7I A;  4DV5 Q;  3I56 A;  2RCN A;  4NXM Q;  3ER0 A;  1K3R A;  3HOX G;  4JI3 L;  1PYB A;  5M5X H;  2R7F A;  5LMU Q;  4IPG A;  2OWO A;  3PUW A;  1N36 L;  4L5R C;  5C0X I;  2ZJR A;  4KHP L;  2EIF A;  4DR3 L;  2B3G A;  2KCM A;  4LFC Q;  5GRO A;  1Z47 A;  3J81 i;  3CCE A;  4AQY Q;  2UUC Q;  1IBL Q;  1VQN A;  4DR6 Q;  3UDF A;  1X65 A;  1PH7 A;  2WB1 E;  2PQA A;  3EN2 A;  5FLM H;  1UE6 A;  1X56 A;  1HR0 Q;  4BY1 H;  2JA6 G;  3OYY A;  4DV4 Q;  3S1M H;  2ASB A;  4B3M L;  4DUZ L;  2HHH L;  2ID0 A;  4HJ5 A;  4DV3 Q;  3T1H Q;  3CPF A;  1L0W A;  1MIU A;  1UE7 A;  2IX0 A;  4MZ9 A;  4A3G G;  4APV A;  4GOP B;  4A3D H;  1I6H H;  4X62 L;  4LW1 A;  1I94 L;  4DV6 Q;  2IHE A;  3GTP H;  1KHI A;  3ULL A;  1VCI A;  1V1Q A;  3KOJ A;  3BJU A;  3FP9 A;  5IYC H;  3AYH B;  3KF6 A;  3L2P A;  1J5E Q;  1X55 A;  1EYG A;  4X64 Q;  1HR0 W;  2GVB A;  1KRS A;  3RN2 A;  3RN5 A;  1PH9 A;  4A75 A;  4B3T Q;  1A63 A;  3CMA A;  3M4O H;  4JBJ A;  1YJW A;  2RHS B;  3IRB A;  4JI7 L;  5LMN Q;  4YWK A;  1CSP A;  4PZ6 A;  3MEF A;  3E9H A;  1N33 Q;  1E7Z A;  1P8L A;  2YV5 A;  4RMF A;  4HJ7 A;  3S1Q H;  2VQF Q;  4R4T A;  4XTC S;  1IL2 A;  2Z0S A;  2CKZ B;  2D0P A;  1W2B A;  1XNQ Q;  1VQG A;  3HFZ B;  2JA5 H;  3I4M G;  3D31 A;  4H02 A;  3E9I A;  1HNX L;  1PHJ A;  1VQL A;  1VQP A;  1IBM L;  5C3E G;  1RL2 A;  4JI6 Q;  4LF9 L;  3S2D H;  4P75 A;  3CCQ A;  1PV4 A;  1K8A C;  1GKH A;  5LMN W;  1VQD A;  4WJ4 A;  4L5T A;  3TQY A;  5E7N A;  1S72 A;  2RHQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...