5C4XG

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/rna/dna
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4xG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c4xG01
4Y7NH 3L7ZC 3S14H 1HJPA 1PFSA 4JI6L 4JCVE 1L0WA 1MIUA 2GVBA 1B8AA 4JI5L 5IP9H 5GAHC 4MTNA 3I4MH 5H1SE 3KDFB 2ZM6L 2F3IA 3S1RH 4A3JH 4P73A 3J80c 5JJIA 3J81j 1PH1A 1HZAA 5GADC 2PQAA 1PH5A 2VQFQ 4A4IA 3CQZH 2A1AA 3E9HA 4JI2L 1Q8KA 1W2BA 3TS2A 1VQHA 1D7QA 1Q82C 1I94Q 4IPHA 4JI3L 3CAMA 2R92H 1NMGA 4GKKL 1CUKA 1EOVA 4FDBA 4YHHQ 1P8LA 3PUVA 5FLXc 4X64L 1KD1C 1CKOA 1M1KC 1BKBA 1HZBA 4TQUS 2ES2A 3G48A 5FLMH 3GO5A 4LF7Q 4JV5Q 1GVPA 1N33L 2JA7H 1FVIA 1IZ6A 4R4IA 4GNXB 4NXML 1MJEA 1X65A 3K81C 4A3FH 4DR7L 1N36L 1HR0L 2DUDA 1G291 5GQOA 3S15H 1OTCA 2UXBL 1EIFA 2UUAL 1N32L 4A3KG 5LMNL 4LFCL 4LFBL 2OTJA 3K80C 4IPCA 2CWAA 1IBKQ 2NZOA 3HOYH 2OCEA 3TRZA 1MJCA 2Z6KC 4DV3Q 3L0OA 1VQ7A 1HNWQ 4X66L 2HQLA 4BXXH 3I2ZA 4IJLA 4A3MH 1XMQL 1VS0A 1E24A 2R7FA 4DV4Q 4R4TA 3ZJYC 4AYBG 2LXKA 3ICEA 3D31A 2KHJA 4YY3Q 2BA0A 1TWAH 2VZAA 1ASZA 5C4XH 1SE8A 2V1CC 4B3MQ 1K0RA 3PIOA 5M3FH 2KHIA 2K14A 2UU9L 1VQ8A 5BR8Q 2E8GA 3S1MH 4DPGA 2QEXA 2PNHA 4PMWA 1L1OB 3W1GA 1N34Q 1T9HA 4DV5Q 1VQJA 5IY0A 2HHHQ 2ZJPA 4GKJQ 1PHJA 3S16H 1KHIA 5C44H 3HOXH 4OO1G 4L5TA 4JI0L 2ZJRA 1BBWA 2Z6KA 1Q46A 3B6YA 3H0GG 3CPFA 4OWXB 1J5EQ 4B3TQ 4OWWB 1XNQL 1SLJA 1UE5A 1JB7A 4LF6L 2IT1A 4JI8Q 1SN8A 3A0JA 2E2HH 2GN5A 4A3GG 4GN4B 1W3SA 3NEMA 4GOPB 3T1HQ 2KCTA 1FJGL 3FHWA 1VQEA 2D0PA 4AQYQ 4EQ5A 2CFMA 1VQ5A 1SR3A 3CC2A 5E7NA 5JJLA 1E22A 4ME3A 4DV2L 1BBUA 2I5LX 2RCNA 3G71A 2A8VA 3UDGA 1FGUA 2JA5G 2XGTA 1EUJA 3E0EA 3ERSX 4DR5L 4DR2Q 3T1YL 4OX9L 3ULPA 2R7ZG 4KLKA 2ATWA 4B3SL 1OXUA 4DR1L 5LMUL 2ZTEA 1K3RA 5EAYA 2E2IH 3AFQA 1X55A 4XTCS 2Z0SA 1SRUA 3STBD 3AEVA 4JBMA 3GDEA 2CKZB 1VCIA 1VQ4A 4LF4Q 1CKMA 3JC66 1KRTA 2XTIA 1NMFA 4KHPQ 1FL0A 1JJCB 4BA2I 3HOUG 4YCVA 4JI1Q 4A3KH 4QY7A 1SROA 4HJ7A 2F52A 3SGIA 1B70B 2N3SA 4IOAA 2MO1A 4WJ3M 2K4KA 2MO0A 1HNXL 1A8VA 1YBYA 1PH6A 3WWVA 1O7IA 1E1OA 5IWAL 4C3HH 1KXLA 2C35B 2PI2A 4POFA 4ALPA 3RZOH 1VQIA 4QL5A 1XTDA 2PI2E 4EX5A 4X65L 2VW9A 1N8RC 2UUBQ 4C3IH 1KL9A 3KFUA 4HIDA 4OO1I 1VQLA 1CSPA 2LSSA 4DUYL 2QA4A 4A3CG 1NBWA 3PGZA 2VNUD 5J3BA 3H3VI 4JBKA 2JEBI 4LF5L 1HH2P 4DV0Q 4OWTB 5C3EG 4DV1L 5IYDG 3RZDH 4R4OA 4KI0A 1WYDA 4DR4L 3GTOH 3H0GH 4JYAL 1RIPA 3H3VH 4A3DG 1OXVA 4MNOA 4O2DA 1Q7YC 3GTQH 2UXCQ 4PZ7A 4LFAQ 4DUZL 1X6OA 2NN6G 3TREA 4RG1A 2AHOB 4A3GH 4K0KQ 1Y1VG 2ZTDA 1K73C 2Y0SE 2AMCB 2R7DA 3F2CA 3HKZE 2JA8G 4JI7Q 5IYBG 4LUZA 1X54A 3LGJA 1YIJA 3CCJA 1PYSB 2Q2TA 1XMOL 3A5UA 4O0AA 3NENA 1LUZA 3I4NG 1UWVA 1N33Q 4IPGA 5M5XH 1P16A 2JA5H 1YNXA 3GTGH 1A63A 3CPWA 3CP0A 1BVSA 2K5HA 3H15A 5IP7G 4A3BH 4JI6Q 1Q81C 3HOZG 1OXTA 2R7ZH 3CCVA 3M4PA 4AH6A 3UE0A 3PUXA 4A3EG 2NVYH 1V9PA 3DM3A 4NB3A 4HJ8A 3PUWA 4JI5Q 2BH2A 4UP9A 1IBML 4B3RL 2I5HA 1G51A 1V43A 2JJQA 2ZM6Q 3KOJA 2VUMG 3NELA 4UP7A 3S2DH 1Z9FA 2WFWA 2KENA 4DV7L 3OW2A 2JK8A 2VS1A 4MZ9A 1K9MC 4JI4L 5JJKA 2YV5A 3HOWH 4X62L 1VQOA 3ULJA 2PMZE 3I4OA 4JI2Q 1HNZL 3GTMH 4Y52H 2WB1E 3HOUH 1PYBA 3MXNB 2ZJQA 4P72A 4DAYB 4IO9A 2D62A 3G4SA 4A75A 4JI3Q 5DLQE 3U4VA 2RHSB 3CC7A 4GKKQ 3D0FA 1YHQA 3CXCA 4WJ4A 3FKIG 4HJAA 4YWKA 2OQ0A 1NJIC 3PO2G 4B3ML 4X64Q 4DNIA 1LM0A 1QZGA 5GAEC 1EYGA 1Q1BA 2ZTCA 3J81i 1C7YA 1J6QA 2B63H 3M85A 4QQBX 1Q86C 1PH9A 4DV6L 4NXMQ 1YHAA 2OTLA 1EFWA 1N36Q 2EIFA 2RHQB 4LF8L 4GKJL 2JA9A 2UXBQ 2UUAQ 3GTJH 4RMFA 1N32Q 4LFCQ 4LFBQ 3F2DA 4A3CH 1HZCA 2N78A 4B3TL 3CW2C 1M90C 1N9WA 1AE2A 3K8AA 4DR6Q 1R9TH 4X66Q 5C3EH 4HIKA 5IYDH 2NN6I 3UDIA 3J81c 1XMQQ 2H5XA 2E5LQ 4X6AH 4A3DH 3JAMi 2MQHA 1U0LA 3UDXA 4JG2A 5C0XG 1QVCA 1E3PA 3U58A 1UE6A 3PUYA 3RLNA 1Y1VH 5IYCG 4P71A 2AWNA 4NPSA 5C4JH 2R93G 4OONA 2UU9Q 2JA8H 5IYBH 1CKNA 5AJ3L 1IBLL 1GKHA 4GS3A 1DGSA 2WAQE 5HGQA 4UY8C 1Q12A 1SFOH 4BY1G 3I4NH 3L2PA 2E2JH 2AWOA 4JC0A 2K75A 3GD7A 1CSQA 3HFZB 4J15A 4YWLA 4DR3L 3S24A 4JI0Q 2HT1A 1JE5A 1WI5A 3JAMc 2OQKA 4LNQA 1XNQQ 2YTXA 5IP7H 3HOZH 5M3MG 1Q1EA 4GN5A 2VQEQ 1XPOA 3AFPA 4A3EH 1GM5A 3VDYA 4LF6Q 2UXDL 4R4CA 3M4QA 3K0XA 1VQPA 3W5OA 1TXYA 3PV0A 4JI1L 5JEAG 1PH4A 2VUMH 3GTLH 2GVAA 1PA6A 1X3GA 1A62A 3CCRA 5HY6A 1JMCA 3MEFA 4R1JA 2YU9H 4A3LG 4BY7G 4UPAA 4A93G 2NVTH 3RLFA 2CWPA 1MKHA 4DR5Q 3F1ZA 3NBHB 3T1YQ 1EWIA 1PV4A 1TWCH 1JJ2A 4OX9Q 1L2FA 3FKIH 4LF9L 1X3EA 1QUQA 4B3SQ 3KJPA 1GD7A 3PO2H 5LMUQ 2NVQH 4APVA 3K7AH 4HJ5A 3KF8B 1YEZA 5FJ8G 4KHZA 5C44G 4H02A 1PH3A 4POGA 2JE6I 1XNRL 1H95A 1OXSC 4L5SA 3F8TA 3I7FA 5ELOA 2YTYA 1S40A 4LWCA 2EQSA 2UUCL 3HOYG 2F4VQ 4BBSH 4L5QA 5K36G 2IX1A 1I50H 3RNUA 1YVCA 4IOCA 3J7ZC 2YYZA 3OTOQ 3S1NH 2JA6G 3GTPH 1X3FA 4C3JH 2UXCL 1KAWA 4C2MH 2Q2IA 3BU2A 5C0XI 4GLVB 1HNXQ 1VQ9A 1LYLA 1U5KA 2VQFL 1EIYB 1I5FA 4NXNQ 5IWAQ 3CD6A 4OXPA 3PF4A 2RF4A 3IRBA 1I94L 4A76A 2JEAI 1WJJA 2K5VA 4TVAB 5IYCH 4X65Q 1C0AA 1SMXA 4IPDA 1XPRA 2ALYB 2Y0SG 4YHHL 2R93H 5GROA 3HKZG 5IT9c 3S2HH 4DUYQ 2HIXA 2IHFA 1S3OA 1UE7A 1VQCA 3EIVA 5M5YH 4DAMA 1VQNA 3PIPA 3PSIA 4LF5Q 2I0QA 2DGYA 4BY1H 3CCSA 4DV1Q 1PH2A 3CCLA 4LF7L 1IXRA 4JV5L 3TS0A 2VL6A 3CCEA 4DR4Q 4JYAQ 4BA1I 5M3MH 1GO3E 4DUZQ 3J7A5 3FP9A 5C0XJ 1IBKL 1E7ZA 4DV3L 1HNWL 1PH8A 2I5MX 4DV4L 4A3LH 3RR5A 4BY7H 4XIGS 1XMOQ 3GTKH 1CKNB 1KRSA 1JJGA 4A93H 3KF6B 1C9OA 3HOVG 1Z47A 2WB1G 3K7UC 3BZKA 4YY3L 2CQOA 3BZCA 3E9IA 1YZ6A 3PF5A 1Y1WG 1VQKA 1YHBA 4PZ6A 1XPUA 2R6GA 2OWOA 1QVFA 5BR8L 4P74A 4BBRG 3KLWA 1X9NA 4B3RQ 1IBMQ 1K8AC 3CCUA 4IFDG 4GN3B 4PG3A 4LW1A 3UDFA 3ER0A 4AIMA 5FJ8H 4DV5L 1N34L 1HR0Q 2HHHL 4DR7Q 3AYHB 4R4QA 3W1BA 4DV7Q 2BH8A 5JEAJ 1YJNA 5LMNQ 1PH7A 4JI4Q 4X62Q 4DR6L 4LUVA 2Q2HA 3TQYA 4AYBE 1J5EL 1HNZQ 4QIWE 2JQOA 3KDFA 4GNXC 4LUOA 1I3QH 1D8LA 4A3IG 1WCMG 4YWMA 4JI8L 2E5LL 2JA6H 1V1QA 2BA1A 3T1HL 3A5ZB 1VQMA 1YJWA 3PO3G 3A74A 3KYHC 4QJFA 4HIOA 4AQYL 2NZHA 2HIVA 4JBWA 3TEHB 1QUQB 1K83H 4IJHA 1VQBA 1NE3A 3U50C 2K5NA 3F2BA 2ID0A 3M4OH 1HZ9A 1JT8A 2KBNA 4DV6Q 3PUZA 3KF6A 3CCQA 4LF8Q 1A0IA 2IX0A 4DR2L 4JOIC 3RN2A 1YITA 2D0OA 2AKWB 1IYJB 1VQ6A 1HR0W 5IP9G 3I4MG 1AH9A 3G6EA 3U4ZA 3M3YH 5LMNW 2VQEL 4DKAC 2WAQG 1E1TA 5GAGC 4GNXA 4A3JG 3OYYA 4JBJA 4HIMA 3STBC 2N49A 4GLXA 1QVGA 1L1OC 4UP8A 1KC8C 3CF5A 4KHPL 4LF4L 1KQSA 1TWFH 2MNAA 3I55A 2ASBA 1S72A 1VQDA 2CCZA 3S1QH 2KCMA 4P75A 1B7YB 1TWGH 1FJGQ 1K8GA 2QGQA 2R92G 2NVXH 1KIXA 3CMEA 1OXXK 1VQAA 4DV2Q 5AJ3Q 1AE3A 1TWHH 1IBLQ 4GOPC 2VY3A 4A3BG 3DLLA 4L5RC 4JOIA 5FLMG 2B3GA 4BBSG 3RN5A 3HOVH 3CMAA 3ULLA 1X56A 4DR3Q 1VQGA 1Y1WH 2JA7G 2IHEA 5ELNA 4IFDI 4DR1Q 4A3FG 2UUBL 1RL2A 4QGUA 2LXJA 1XJVA 2IY5B 3S17H 2UXDQ 1L1OA 4BBRH 4DK3C 5M5WH 2F4VL 1UE1A 3HOWG 1Y14B 1G6PA 3I56A 3BJUA 2MFIA 1YI2A 1ASYA 2PQAB 2N8NA 3UE1A 1NTGA 3CCMA 4DV0L 3HKSA 3OTOL 4BXXG 4A3MG 3KJOA 4PZ8A 1I6HH 1VQFA 2K50A 4HJ9A 1YJ9A 2YTVA 3M7NA 2B29A 3M9BA 4LFAL 4GOPA 1WOCA 4A3IH 1UEBA 1WCMH 2FXQA 3AQQA 4NXNL 1PVOA 4YCWA 4K0KL 5C4XG 2EXDA 4YCUA 5M3FG 2A19A 3Q8DA 2B63G 1LTLA 4LF9Q 3RLOA 3PO3H 4JI7L 2WP8J 4DK6C 3PCOB 1QZHA 1EQQA 3CC4A 1NY4A 3J80i 1IL2A 1XNRQ 1EQRA 1WFQA 2K52A 5IE8A 3EBEA 2Q2UA 4IFDJ 2L15A 4GLAC 3EN2A 3HOXG 2UUCQ
chains in the Genus database with same CATH superfamily
5HV6A 3L7ZC 3R2IA 4N9TA 5DQHA 1JQYD 4ED6A 4AYBB 4O4IF 1B8AA 3EFXD 3JAME 4MTNA 1TS5A 4N8FA 1RTOA 3CVZA 4C3IB 4A3JH 2EYOA 3BVMA 3U9OA 2F0KA 3IKJA 1HZAA 2BQRA 4A4IA 5ELFA 4J8QA 2A1AA 1W2BA 1VQHA 1ILQA 1HTLD 2XNAC 5AFWA 3I70A 1TIID 3RZDB 3KHRA 1EFID 1NMGA 3GTOB 1CUKA 3GTQB 1ZQ7A 4YHHQ 3QFFA 1RJTA 2JEIA 1EUCB 1KD1C 2F3VA 4HSPA 3GIJA 2VUMA 3GTLA 3G48A 2YU9A 2EJFC 1E2ZA 5FLMH 4ECWA 1PFMA 3H6MA 5EDWA 1GVPA 4MV1A 2JA7H 5G3LD 1WTPA 4A3FH 4DR7L 1N36L 2DUDA 2RGVA 1OTCA 2SOBA 2UXBL 4OEMB 5J2UF 2HJWA 3GTGB 1TWCA 2ASDA 2CWAA 1IBKQ 1TKWB 4FBTA 4B9XA 1NR2A 1HQMC 2RA4A 5F2DA 3MWMA 3K3VA 4X66L 3WO1A 2VA2A 4BXXH 3I2ZA 4EBDA 1VS0A 2R7FA 3P20A 1RF2D 1Q8IA 4R4TA 2KOLA 4RUCA 1LT6D 3PW5A 3V6HA 4AYBG 2FLLA 4RKBA 1J9OA 3D31A 1GUGA 3MAQA 3S2DB 5KFNA 1H9SB 3BG5A 5C4XH 4C56C 3PIOA 3LX0A 2MPMA 4C3IG 3DUZA 2K14A 1HA6A 2E8GA 1V51A 1F2MA 5H80A 1A2TA 2F0OA 3KUPA 4PMWA 2F03A 3W1GA 2PW5A 5IY0A 3JZIA 5KEEA 4ZAIA 5C4HA 5C44H 4OO1G 4O4LF 1VKZA 3I72A 3B6YA 4OWXB 4B3TQ 4YR0A 1SJHD 3L9AX 1SLJA 4FXKC 1UE5A 1ZXTA 2IT1A 2QF7A 2KCTA 1FJGL 3UI2A 1SYBA 2F3WA 2HDLA 2FMAA 1N33H 1I6VC 3CC2A 2W6NA 2K04A 3QB3A 4ME3A 1S5CD 5F9NA 4TSSA 2I5LX 5C3EB 5FPRA 4JI6H 4A2AA 3QIAA 1BCPB 3E0EA 4XT1B 3KALA 4QB4A 3RV3A 4YAKB 4OX9L 3ULPA 5A2QW 4I50F 1ML0D 2IJ0A 2ZTEA 1WTOA 1Y1VB 1K3RA 4B08A 3GIMA 5C4JB 4JBMA 3GDEA 4DL7A 5J2TF 4DK0A 4KY7A 1VCIA 4U673 3RB3A 2C2EA 1CKMA 3JC66 1KRTA 1FL0A 3ORRA 1HUNA 1SMYD 1QNKA 3R93A 1GUWA 1G8ZD 4RB0A 4YCVA 4GKKH 2KECA 1G2SA 4HJ7A 2F52A 3E6ZX 1B70B 2XGQA 2EYFA 3HOZB 2E74C 2K4KA 2MO0A 3S9WA 1YBYA 1PH6A 5CYUA 3Q24A 1E1OA 4WD3A 5EGTA 2QK4A 1QWYA 4MTEA 2LKVA 4EBEA 2HUGA 2M2LA 5DNFA 2J6SA 2W9CA 4LFBH 4YP3A 4YIJA 1B1ZA 3ITPA 4C3IH 3DEOA 3VA7A 1PRTD 1PFNA 1T5XD 4HIDA 4I4TF 2JA6A 3RAXA 1VQLA 2F4IA 3M7GA 1STBA 1XMQH 5J3BA 5FOBB 3H3VI 4MV7A 5C3EG 2F0JA 4DV1L 3RZDH 4OO1H 4LAAA 3LWBA 1CHQD 3H40A 4DR4L 3K7AB 3GTOH 2V4RA 1RIPA 1OXVA 3GTQH 1Q7YC 3TDQA 4EFBA 3V6KA 4IURA 4RG1A 2AHOB 3A54A 4ZQIA 1Y1VG 1O7LA 2ZTDA 2AMCB 2IW3A 3HKZE 1I50B 5IYBG 1X54A 1YIJA 4RCOA 2SCUB 3TSSA 3GTPB 1D2BA 3A5UA 4O0AA 4JI0H 3SHLA 4C2MB 1N33Q 1EIHA 5D65A 2VQEH 3K5OA 1BNZA 3GTGH 2B2TC 2F0QA 3CPWA 3CP0A 3M9OB 3NBIA 4JI6Q 1Q81C 3HOZG 1HXYD 2RDGA 1RYSA 1IKMA 4AH6A 2WYOA 3PUXA 4LF4H 2FK2A 3BQ1A 1TS4A 2I5HA 1LTSD 1V43A 1TWHA 1BGWA 1Z2PX 5DG8A 3S2DH 3D4WA 3F2UA 4K5XA 4ZK9B 5DG9A 3MFHA 3OW2A 2PMZA 1K9MC 5JJKA 2YV5A 3MR5A 2NUAB 3M9NB 2BE5C 3I4OA 5CV4A 1HNZL 4DR5H 2BCOA 2GPSA 1PYBA 4LH7A 2UVRA 4P72A 4FU0A 1S0OA 3G4SA 1MBYA 2YRXA 4GKKQ 1C4QA 3ETHA 5KFZA 3IL8A 4WJ4A 5JQWA 2BOSA 4DA2A 2C9OA 2KA7A 2OQ0A 5I9PA 4B3ML 1JOKA 2GA4B 3DM1A 3J81i 1JCKB 4O4HF 4DFAA 4QWCA 4RNNA 4EQPA 1SDFA 5KFWA 3SEBA 4FF1A 1EY4A 1EFWA 4DU9A 4ME6A 4F8MA 5EKKA 1O75A 4LFBQ 4FXGC 1HZCA 1BBXC 1HNXH 3K8AA 4XYLB 3OWEB 4OELB 4ECSA 5C3EH 1XMQQ 4C1NI 3VPCA 2H5XA 5KG7A 3JAMi 4X65H 3C2PA 2MQHA 1HCZA 3U58A 3HOYB 2FP4B 5CORA 1K1SA 4GZYC 4DUYH 4RB2C 3RLNA 1Y1VH 3BVZA 5I2XA 2HGSA 5C4JH 2W6QA 2PO4A 4B9WA 5IYBH 4DAPA 1I3QB 1R4PB 4TV9F 5HGQA 1Q12A 3LP8A 4QWBA 4JYAH 3CQZA 4E4TA 1NUCA 4JC0A 1CSQA 5KKNB 2HQEA 4JI0Q 4KV6A 3PVXA 4LNQA 2YTXA 5KNDA 3HOZH 1LLRD 2VQEQ 1ENFA 2DPIA 2IBKA 3RMHA 1GM5A 4LF6Q 1XXGA 2RCFA 3M4QA 3K0XA 3RB0A 1EY9A 2CW0C 4V0BA 4HN7A 1RJQA 4JI1L 1XMOH 3J81L 3HKZB 4DXFA 1CQVA 1B2TA 2CWPA 4NMZA 2M05A 4DR5Q 3F1ZA 3C0FB 2KEEA 2L0CA 4J1MA 3VYSA 1EWIA 4Q0YA 4XYMB 4RUAA 3QOLA 1IKLA 1HR0H 3ND8A 3PR4A 3K7AH 3G6YA 2NVXB 1V1OA 2RQXA 4JI4H 1RHPA 1WD1A 1OXSC 2EDGA 4ECXA 2I87A 3JAML 3HOYG 1I50H 3BJYA 1EU3A 5LHY1 3GTPH 1DOLA 4BWGB 3G6VA 4UCRA 4U7CA 2F0HA 4M1UB 1KAWA 4C2MH 3BU2A 5C0XI 1HNXQ 1VQ9A 1SYXB 1FNUA 4IZ8A 1EIYB 2CQYA 5E3FA 2F0PA 2B2YC 4DNTB 5IGGA 1TR5A 4A76A 2K5VA 4X65Q 4F4XA 1CHPD 4HEDA 1XPRA 1BCPF 4RAUC 2O5IC 1R4QB 3HKZG 1PMRA 4DUYQ 4A3IB 1WCMB 1ESRA 3NBHA 3PIPA 2LMCB 2I0QA 2DGYA 1A3TA 4J9MA 1Y8PB 2VL6A 3E3XA 3KLSA 5LL6S 2IX3A 4JYAQ 4BA1I 2YW2A 1GO3E 4APMA 2I8CA 1EIGA 2NU7B 3I12A 4DV2H 1AFPA 3FP9A 5C0XJ 4NW2A 1KJQA 4I65A 1ONLA 3EVQA 1B9NA 3I4MB 4IQZA 5KFOA 4XIGS 1XMOQ 3MJFA 3KF6B 1SXTA 2I46A 2DIKA 1E4FT 3PF5A 2UXDH 1ICFB 3K5HA 1JORA 5IT9L 1KJJA 5BR8L 3KLWA 1EWCA 1S10A 1AW7A 3CCUA 3UDFA 5C5JA 4ZUJA 3DWQA 4DV5L 1HR0Q 2HHHL 3W1BA 4IUNA 2YS6A 4LMYA 4JI4Q 2AUJD 2Q2HA 2XCAA 1PZKD 3SK5A 3KDFA 1I3QH 4A3IG 1WCMG 4JI8L 4Q43A 3S15B 1VQMA 5KFPA 3FMAA 3A74A 4HIOA 1II3A 2HIVA 3TEHB 1QUQB 2XSCA 5LP6F 1YNJC 3T56B 3M4OH 1SE3A 1RK6A 3H0GA 1SNMA 3RN2A 1WR2A 1ET6A 2DNEA 1SNDA 3T4AC 2X6GA 1TWAB 3I4MG 3WOFA 2WDTA 1GYFA 5M3FB 2RVLA 2DLNA 2VQFH 4GNXA 1HRJA 4JBJA 4K2LA 1QVGA 1GGOA 4K14A 1KC8C 3CF5A 5FKAC 2G9HD 1I94H 2XRQD 2JA5A 4L1KA 1SMYC 1DM0B 5EKLA 3S16B 1F9SA 4EG0A 5JVLA 2KCMA 4X3UA 1K8GA 3PMFA 1U9RA 2OH2A 2RBMA 3MEHA 1KABA 2NVXH 2D5DA 4LMQD 4DV2Q 5KT7A 1PRTB 1AE3A 4XT3B 5L1LA 2FHTA 2VY3A 4LF7H 5FLXW 4JV5H 4RAYA 4JOIA 3SR1A 5C3WA 4BWSC 4HMIA 3ULLA 1X56A 4DR3Q 1VQGA 4RGMA 2V4DA 3K5NA 3TINA 5ELNA 1S4ZA 2Z1CA 1N56A 1GUSA 3RGXA 3A8IE 3BS1A 1L1OA 2KJXA 2UXDQ 1HNWH 2F4VL 2M00A 4EGVA 1G6ZA 2N8NA 3UE1A 4PV1C 2J0TD 3IAYA 3J7AF 4FS2A 3OTOL 3NTKA 5FO7B 1SNCA 3KJOA 4HYKA 4HNVA 3SK6A 4YY3H 2B63A 5LL6X 1SEBD 3BABA 2E2IB 3R2TA 2ZDQA 3M9BA 4GOPA 1WOCA 4A3IH 1WCMH 3CHBD 4Z9CB 1PVOA 2ICEC 4K0KL 3GTJA 3R5XA 2R61A 4YCUA 5M3FG 4O3PA 1GSHA 3RLOA 5IYZF 4JI7L 4CDEC 2OT2A 2WP8J 4GKJH 1QZHA 3N44B 3CC4A 4KK7A 2WINB 2RSOA 1O78A 2LFNA 1J5EH 4H7BA 1GUNA 4RCNA 3BDOA 2ASJA 1B33N 3MZ5A 1PFSA 4C3HB 2R7MA 4JCVE 2A6HD 3J81W 4JI5L 3T1HH 3I4MH 3HB9A 2QCPX 4DLKA 3ND9A 2ZM6L 2E75C 3SK8A 3R8BA 1KAAA 3J80c 1PTOC 2G5DA 1SFOA 5GADC 5I6YA 2VQFQ 4IUUA 2PQEA 4DK1A 4JI2L 4ECYA 1Q82C 1I94Q 4IPHA 4JI3L 2B2YA 5KRUA 4DL5A 2F0VA 4DL6A 2K28A 1RKNA 2V5AA 4FDBA 5EPJA 4MV4A 4LSAA 2ZDHA 4X64L 1CKOA 4XYOA 1HZBA 3JAMW 4A3GB 4Q8EA 2W6PA 2NU6B 3PW0A 4KHPH 2CW8A 1TVXA 3GO5A 2K03A 4LF7Q 4JV5Q 4ZLTF 5EWEA 4FNFA 3S15H 1LTTD 5GQOA 4TQSA 2UUAL 5IGEA 4RHRA 1N32L 5LMNL 2V59A 2XVSA 1F9QA 4IPCA 3TP5A 2OXPA 2A6ED 3FKIA 4OIKA 5KIXA 4QIWA 1HNWQ 1ZETA 4BBSB 2NVYB 4IJLA 3P1HA 1U4MA 2AGQA 3TN2A 1E24A 2AQ4A 2RKSA 3VR5A 1RJPA 4C3HG 2R8HA 1KNAA 4YY3Q 4QW9A 1TWAH 2V1CC 5D1OA 4KY6A 3AMUA 3X3NA 5M3FH 5KGUA 4G4KA 1VQ8A 1CFMA 1PXUA 2W70A 2D9UA 4KJNA 3VR3A 2AQ2B 3TMEA 1SYFA 4Q45A 1VQJA 2ZJPA 4GKJQ 3D8GA 3S16H 1EYZA 4LFAH 2Z6KA 3OHXC 1JKJB 3CPFA 3IFTA 3EJIA 1J5EQ 1DD2A 2GN5A 4A3GG 4GN4B 5LA6F 1W3SA 3G6JB 2CW7A 1X3QA 2XIWA 3T1HQ 4FF2A 1QE6A 2PW7A 1VQEA 2D0PA 2CFMA 4PQXA 3MXNA 3SE0A 4O2BF 5JJLA 1BBUA 4FO2A 4FF4A 4C5BA 5IT9W 1GXDC 3G71A 1ENCA 3UDGA 2A68D 2B8FA 3ERSX 3NP8A 2B2VA 1WTHA 3ORQA 1M6VA 4KLKA 2ATWA 1OXUA 3TZDA 4DR1L 4XXEA 5LMUL 3GTMA 2E2IH 3AFQA 4R8NA 2QKIC 5CAEB 4G3IA 4ED2A 4KN4C 4KHPQ 5KFJA 3VYTA 5D3DA 3Q8QB 4ED1A 4UHVA 2CW0D 5JVG3 4CKBA 2W71A 2N3SA 4IOAA 4KD3A 2MO1A 4EQOA 4WJ3M 3URYA 3J81E 4A3EB 2PBZA 1A8VA 5DM73 1MD2D 3OUZA 2W8KA 1BO0A 5L9XA 4JPBW 2W9BA 5IWAL 3QO2A 4C3HH 1EY6A 4YJ2F 1N36H 5C1OA 2UXBH 2AQ1B 3RFCA 2QEJC 4QL5A 2EY2A 1QG7A 2PI2E 4EX5A 4CDFC 5KFQA 1KL9A 2NVTB 3OW7A 1CK1A 4HR7A 4X66H 2QA4A 4A3CG 1NBWA 1EHIA 5CV7A 4ZYSA 2KEDA 2RDHA 2FK3A 4LF5L 1HH2P 2G9DA 5EJWA 3J7AV 2L1BA 4KI0A 3MVVA 4R4OA 1WYDA 5D8DA 1IOVA 2ZXRA 3H3VH 2A69D 4MNOA 4IHJF 2ATLA 4LFAQ 2DPJA 4Q8FA 3VPBA 4A3GH 1ULZA 2R7DA 4LUZA 1WTXA 4P2CB 5IIFA 3CCJA 2B8GA 3EA6A 3S1NB 1KLUD 3IN5A 1PRTF 4C3JB 3I8ZA 1F2ZA 1LUZA 1K0SA 2I80A 4ECUA 1TWFA 2W8LA 1P16A 2MP1A 1A63A 2IA6A 3CRLC 5TSSA 1AUVA 1TWGA 3M4PA 1F77A 4A3EG 4BBSH 2NVYH 4HJ8A 1IBML 1G51A 2JJQA 1JOQA 1OWTA 3KOJA 2R93B 2F0NA 2KENA 4DV7L 5EKIA 3WOEA 4X62L 2FMCA 2RDIA 4BY1B 4R8UB 4OX9H 4DAYB 2Q8IB 4FM9A 4CKEA 1SNQA 5L37A 1EYGA 3Q2OA 3QR8A 3BG3A 3VYRA 3DXJC 1T94A 4ED0A 1PH9A 4EYIB 2OTLA 2YZNA 1N36Q 2EIFA 4LF8L 4A93B 2JA9A 3JSLA 2UXBQ 4K8JA 5IT9E 2UVWA 1OO9B 4A3CH 4K5WA 4B3TL 3CW2C 1M90C 4C3JG 3JRXA 4X66Q 3Q22A 1GJXA 4J9LA 4RA8A 2NN6I 1AZQA 3T5HA 1SBBB 1JICA 2K5WA 4K6LA 3J80E 2FPPB 4EEQA 1U0LA 5C0XG 3QZ7A 1NNXA 1E4EA 4O2AF 5JH7F 3GIDA 1YNJD 2R93G 2O4XA 1CKNA 3IG0A 5CV6A 4DV1H 1ZYRD 2WAQE 4UY8C 1S5ED 4EEYA 4DR4H 4BY1G 4YBZB 2W7OA 2K75A 3GD7A 4LK1C 1B4OA 3HFZB 2HT1A 2PN1A 4L63B 1JE5A 1CQFA 2OQKA 3MXPA 1XPOA 3MTSA 4GN5A 3AFPA 3KTMA 2JSOA 4A3EH 3GTKA 4R4CA 1V1PA 2FE3A 4IALA 3W5OA 2XN9C 4MHEA 5BN5A 4CC6A 4DAVA 2NU8B 2PZTA 2GVAA 1PA6A 1A62A 1JMCA 1CS0A 4A2BA 3NQIA 5FO8B 2JA7A 1V8QA 4A93G 2NVTH 3JRWA 1TA8A 5C1PA 3GLKA 5KG2A 3V6JA 3NBHB 1DCZA 3HS0C 4OX9Q 4LF9L 1X3EA 1GD7A 2Z8LA 5T14A 1O80A 3EPGA 5L1JA 4ILWA 1IW7C 4APVA 4QW8A 3KF8B 5FJ8G 3WNZA 1XNRL 4NLGA 4EBCA 4KKUA 4L5SA 1H95A 1HNZH 2YTYA 2CH4W 4LWCA 2UUCL 2HVRA 5LL6b 2Z4IA 4RWSC 1G91A 1H9JA 5E4WC 2R7KA 3HOVB 1S5BD 3RNUA 4MTDA 1YVCA 2A6HC 1Y1WB 2ZXPA 3S1NH 1K83A 2R8GA 1BXRA 2O03A 4C3JH 1FR3A 5C3XA 4QWDA 5KFCA 2R8JA 4ECRA 5ELCA 2YL2A 1H9KA 3K59A 1I5FA 1STHA 2FLNA 2Y0SA 4OXPA 5FD5A 1EOTA 4Y8VB 1JIHA 3IRBA 3OUUA 2R8KA 1AN8A 2R3ZA 1I4HA 5C0XH 1JLLB 5KFIA 2JEAI 1WJJA 1I6HB 3QZ8A 2R93H 2ASLA 2KHSA 5D14A 2SDFA 1SSOA 1UE7A 1JE4A 3PSIA 4LF6H 4BY1H 3CCSA 3PO3B 4DV1Q 2SNMA 2C5CA 3CCLA 3TS0A 4DR4Q 1AEXA 5BMVF 1CTMA 3T51B 2NYZD 3S17B 3BA8A 4Y7NB 4UCUA 1PTOD 4YAJB 3UFXB 2A6EC 2WIIB 5KFAA 2HVSA 3NHHA 4DV3L 3TQ1A 2GLTA 5L1IA 1KJIA 4IWYA 5E4XA 2I5MX 4DV4L 2R6FA 2YZMA 5KFGA 2WAQB 4A93H 1L2ZA 5IGBA 3HOVG 1GUOA 3K7UC 3BZKA 1Y1WG 3E9IA 4XZ3B 1FKAH 1SNPA 3N8DA 2EYJA 4KKSA 1HFNA 1M8AA 2HDMA 4PZ6A 1XPUA 2R6GA 2OWOA 4FVMA 1CA6A 2R92B 5BN4A 2CZGA 3T5KA 1RCVD 5FJ8H 1N34L 1HTPA 3ER0A 2ALZA 2FFKB 3SE7A 2XWBB 3G6XA 4OIJA 3OSOA 4A3BB 4AYBA 1B53A 4ZQ3A 1PH7A 1BQQT 1HNZQ 4J0MA 4IUVA 3PZPA 4QIWE 1GLVA 4GNXC 1AZPA 2W7PA 4C5AA 4KJOA 3RGZA 5FD6A 1Z6HA 1V1QA 1DOKA 1PX2A 1YJWA 3PO3G 1D1IA 2EY1A 2KCCA 3KYHC 3HOWB 4QJFA 4AQYL 1J8IA 4K8IA 1EZ8A 2XCLA 3MFIA 2P0AA 1Y69U 2J6UA 1NE3A 2SEBD 3GTOA 1JT8A 2KBNA 1JDBB 3GTQA 2A68C 3CCQA 1TY0A 2M9VA 2IX0A 4DR2L 4JOIC 1LTAD 2D0OA 1IYJB 1VQ6A 3RAQA 1WSCA 2RDJA 5IP9G 4RU9A 2F0FA 3U4ZA 2I07B 2VQEL 2WAQG 1RTNA 4Q0FA 5I6WA 2B63B 4IUQA 2P5ZX 3OYYA 3BDLA 4HIMA 4GLXA 2N49A 3NWTA 1L1OC 4UP8A 4JVZA 4QUCA 5I4DA 4LF4L 1KQSA 1KBLA 3GTGA 3I55A 3AB9A 1WTWA 2MCTA 1B7YB 2R92G 2QGQA 4CDDC 5K5PA 1M0WA 1TY2A 1B9MA 1IHZA 1OXXK 2F0EA 4CGYB 4GOPC 3MWDA 4A3BG 5KFFA 2E2HB 1Z7TA 1WVLA 4L5RC 1H9SA 1EY7A 2B3GA 3SI8A 3HOVH 3CMAA 1DV1A 2C22A 1C30A 1Y1WH 4XX0B 5ELDA 4ULLA 1DV2A 4IFDI 2UUBL 2EYMA 5JVH3 4R7RA 1RL2A 3HRZC 2EE1A 1NR4A 4DK3C 3HOWG 1Y14B 1G6PA 3H94A 4OL7A 1X32A 2XCPA 3CCMA 3OMCA 4DV0L 3HKSA 4DXGA 3I3CA 4FYDA 4IUTA 2ENBA 1VMCA 2IWHA 1STEA 1I6HH 3L4KA 5KT6A 1VQFA 4V190 2IMWP 2KVMA 3U9SA 2A69C 3KHGA 3GV5B 1UEBA 3AQQA 5DGAA 1FNVA 5KFSA 5BR8H 3MC0B 4KY5A 2NWGA 4QF4A 2B63G 1VBHA 3PO3H 1QILA 4DV5H 2VQDA 2HHHH 2IP4A 1EYDA 3J80i 1IL2A 3M9MB 5DG7A 4IN3A 3TIGA 2VB2X 3EBEA 3DWPA 4IFDJ 4F4ZA 4GLAC 2A74C 4U68A 3S17H 4Y7NH 2F0MA 1KDAA 5C4ZA 2DWCA 4JI8H 1DZ1A 3V4ZA 3KK7A 5JJZA 3MXGA 4QIWB 1L0WA 2L4NA 5IP9H 5GAHC 1Y1VA 2VPSA 5H1SE 1DYQA 1RDPD 1K1QA 3RZOB 5JAVA 3G8CA 3HP3A 2WKCA 3J81j 1PH1A 3D6WA 5D1OB 3TS2A 1D7QA 1CM9A 5FO9B 2W9AA 2R92H 1RJRA 1I4XA 3I90A 4LH6A 2J6TA 1JR0D 4DR3H 5LMNH 5FLXc 1M1KC 5KG1A 1KTKA 1BKBA 1K28A 4TQUS 5CGKA 1EY5A 3UQ8A 3RUPA 2EY6A 4XQNA 5DM63 2OLSA 1HUMA 1I7LA 2F0SA 4RHSA 4NXML 4F87A 1X65A 5EWFA 5EWGA 4NKLA 4FP5D 1HR0L 2R85A 4RNMA 3RIZA 1SE2A 5M5XB 1CA5A 1T36A 1EQVA 1LABA 4LFCL 2OTJA 4CJ0B 2X6LA 1SEIA 2BDOA 3HOYH 3NK9A 1MJCA 2Z6KC 1VQ7A 2R7ZB 3W3AA 3J80L 2JN4A 2HQLA 1EY0A 4IRDA 2R82A 4RGOS 1F9RA 5NUCA 3OIPA 3FRPB 4HTHA 3ZJYC 3R5FA 1CT1D 3GV6A 2QW7A 4ECVA 2KHJA 3MHBA 1XWEA 2BA0A 2VZAA 1SE8A 2MGSA 1I50A 1K0RA 5KFRA 3CU7A 1SYCA 3GTMB 2KHIA 2K32A 4KKTA 2UU9L 3GTPA 5BR8Q 2L12A 4DPGA 2QEXA 2YYAA 1S68A 4C2MA 1ZYRC 1T9HA 4DV5Q 2B2VC 2HHHQ 3O13A 3KAKA 4S3SA 1PHJA 3V2TA 3VPDA 3VA5A 5KFEA 1MGSA 4IR1A 2UXCH 2O5JC 2ZJRA 1BBWA 1Q46A 4OWWB 1XNQL 4K5VA 4K0KH 3BZDB 1FGBD 1QJOA 1JB7A 4J9SA 4JI8Q 1SN8A 3A0JA 4JI7H 5HGTA 2E2HH 1JWUD 3NEMA 5KT5A 2EZVA 1T3NA 2BQUA 1GUTA 2JP1A 1VQ5A 1SR3A 5E7NA 1E22A 4DV2L 1DJRD 4J9OA 4ME5A 3WDNA 4R8IA 2A8VA 3E0JA 1A9XA 4E6IA 1T5EA 4JI5H 1LTRD 3T1YL 4A3DB 2R7ZG 3N40P 2HD3A 1Y8NB 4B3SL 2ZM6H 3RUZA 4O3NA 2KCNA 5ELEA 1M0TA 2Z0SA 1SRUA 2JA8B 3R5HA 3STBD 4JI2H 3AEVA 5CC4A 2KUMA 3MFYA 5KG0A 1VQ4A 4JI3H 2XTIA 1NMFA 1NSNS 3NPPA 1JJCB 1SYGA 2RGRA 3K3PA 5T1IA 2E2JB 2V9WA 3ETJA 5M9OA 3SGIA 5EOYA 1A2UA 5E1FA 5LXTF 4X64H 2F1MA 1F9PA 1CZWA 1UC9A 2WE6A 2AUKA 1O7IA 2V4QA 4C1NK 2VUMB 3GTLB 1PZJD 2YU9B 5DQGA 3PIO3 4POFA 3L3OC 5KNCA 2UUAH 1N32H 3RZOH 3R23A 1R9TA 2VW9A 1N8RC 1I3QA 3KFUA 1IW7D 5CV5A 1BCPD 1SJED 2A5HA 4N8X1 4DR6H 1CSPA 4JW0A 3BQ0A 2XD4A 3PGZA 4YJ3F 2VNUD 2JEFA 1PTOB 1A3UA 4F88A 1TWCB 2JEBI 3A7LA 5DLGA 3GIIA 1D5ZC 2E5LH 3PO2B 1B6SA 3H4BA 2AGPA 2K05A 4MN3A 2NVQB 3FDTA 2QYZA 4A3DG 2K1BA 2UXCQ 4PZ7A 4TKOB 4DUZL 1X6OA 4JV2A 2NN6G 3TREA 5CBAE 5C8YF 4K0KQ 4PDBA 2FMMA 5CMDA 3HKZA 2Y0SE 4HAEA 2JA8G 3MXUA 4PMCA 4JI7Q 3LGJA 2R86A 1PYSB 3M4YA 2BDNA 4ECZA 2BR0A 3NENA 2HCIA 1UWVA 4IPGA 5M5XH 3C1FA 1BVSA 3RTXA 2R7ZH 3BYTB 4UFZA 4JI5Q 5F9LA 2NVXA 1V9PA 1JB3A 2SNSA 3DM3A 3PUWA 5IGCA 4B3RL 1RYRA 1S97A 1TS2A 2Z6BA 2L11A 2ZM6Q 1SCUB 3OSNA 4GC7A 2VUMG 3NELA 4UP7A 1I6UA 2C2DA 3FPPA 1Z9FA 2FK1A 2MUYA 2WFWA 1A15A 2JK8A 2VS1A 2PZWA 1BXTA 2CVRA 1WTVA 1VQOA 5M5YB 3ULJA 2PMZE 4JI2Q 5CBEE 3GTMH 4Y52H 2ZJQA 2F0UA 4IO9A 2D62A 2EYLA 2K5DA 4A75A 4JI3Q 3CC7A 2YZGA 4UCSA 3GQBA 3DF7A 5LMUH 2QDLA 4WJWA 3N6RA 4HJAA 4M8AA 4YWKA 3MWYW 1NJIC 3PO2G 2EYHA 4X64Q 2PVPA 3TZUA 3N42B 1LM0A 4M9UA 3NTHA 4O3RA 3KBGA 2XIGA 2ZTCA 1C7YA 2YRWA 3Q0AA 3VR4A 3M85A 4J9NA 4RAZA 5G3LF 4DV6L 5KFUA 5A2QL 1YHAA 3J7YW 2DNCA 3GTKB 5IGDA 1V1PB 2RHQB 4GKJL 3Q8SB 2K01A 2UUAQ 1N32Q 5KT3A 1N9WA 2ZT9C 1AE2A 4QUFA 3OSPA 3EQLC 4DR6Q 4YB8B 5KT2A 4NXNH 5IWAH 3HEJA 4HIKA 3UDIA 3VR6A 2C2RA 2L9HA 1TS3A 2XWJB 2E5LQ 4X6AH 4A3DH 3E5NA 3I91A 4IUPA 1C3OA 3VMMA 3K5MA 2NN6H 1E3PA 3CRKC 3ERQA 4NPSA 1BUVT 1STGA 3PW2A 3V4SA 2JA8H 1MZBA 2W6OA 2W9CB 1I4RA 5AJ3L 1IBLL 1HHVA 2JA6B 1ICWA 2GPWA 1BR9A 3L2PA 2AWOA 2E2JH 4JV1A 4MV9A 4DGZA 3GIKA 1K83B 4H0LC 1XTCD 3TP8A 1Q1EA 5KFMA 3PW7A 3J80W 3VDYA 1S0MA 5KFKA 1CZGA 1VQPA 3N43B 1PDQA 5BPHA 3C1EA 5CA0F 1TXYA 3PV0A 1PH4A 2Y0SB 2VUMH 3GTLH 3VR2A 2V58A 2YU9H 1X3GA 3CCRA 3M3YB 5J39A 4JUZA 3RLFA 3BA9A 1IYVA 2ZJTA 1U4PA 1MKHA 1DXMA 1PTOH 4LJZC 3SDZA 1PV4A 1GHKA 1IBMH 1TWCH 2W6ZA 5KFHA 1L2FA 1QUQA 1EEID 3HBLA 3PO2H 4DR7H 5LMUQ 2NVQH 3H91A 4DV7H 4HJ5A 4KTAA 4POGA 3SXHA 4X62H 5JUMA 1W96A 3F8TA 1TWHB 1S40A 1FNWA 1TWAA 4L5QA 2PMZB 3CKIB 5K36G 4TQRA 5COYA 4DN4M 4RKLA 2JA6G 1X3FA 2X0SA 5CV9A 3SK4A 4BBRB 4TV8F 5M5WB 3C46A 3TP6A 4DL3A 4NXNQ 1JWSD 5IWAQ 4K2KA 3CD6A 4G7OC 2RF4A 5CA1F 4HQ6A 1LO5D 1ZHSA 4YR2A 4LF8H 2TSSA 2OF1A 2EJGC 1IYUA 1M4VA 1SMXA 4IPDA 2ALYB 2Y0SG 5JOBA 4EQNA 4YHHL 5GROA 1CE8A 3KLRA 4O42A 1EZ6A 4PWQA 3EIVA 5M5YH 4DAMA 4LF5Q 4CJ2C 4H13C 1IXRA 4FBUA 3U9TA 1ESFA 1FJGH 2NZ1D 4G57A 1Z2NX 1UEAB 3RB6A 2ZDGA 3S14B 1IBKL 4RNOA 4WRDA 1TQOA 2Z9HA 3GP7A 3K58A 1E7ZA 2WB1A 1CI3M 2E2IA 1ENAA 3GTKH 2ICIA 3OPOA 2QILA 3S1RB 5FK9C 1KNEA 2A73B 5KYLA 5DLFA 4IWXA 5KFBA 1W6JA 2NBFA 3CQZB 1YHBA 3NUCA 1BNCA 4YQWA 3PW4A 1BF4A 1QVFA 4ZOLF 4P74A 2Z4HA 4BBRG 3KHHA 1STAA 1IBMQ 2VR1A 4ABNA 1K8AC 4IFDG 4RGNA 3TP7A 4LW1A 3GV3A 5KFYA 1KDCA 2PZUA 4DR7Q 1CQIB 1S9FA 1PTOF 4X3TA 4DV7Q 5JEAJ 3GIQA 1B50A 4I55F 4MA5A 4X62Q 4LUVA 4DNRB 1GSAA 2D2CC 1VF7A 3NSWA 5K36H 4LUOA 1V4YA 4LF9H 3H20A 4HMJA 2JA6H 2BA1A 1LTGD 1VBGA 1XNRH 4RH6A 2NZHA 4JBWA 2UUCH 3Q8PB 2UVVA 5EPLA 1K83H 2WV6D 2K5NA 3PN1A 1HZ9A 4A3MB 1HFGA 4UCOA 4LF8Q 1A0IA 1YITA 5ELBA 2AKWB 3TQTA 5CB4F 3J7AK 1AH9A 3PIP3 3G6EA 3M3YH 5LMNW 4CC5A 4H44C 4QCLA 1E1TA 3MFGA 3R3OA 4MIUA 1Z2OX 3STBC 3S1MB 2DZDA 3BQ2A 3P75A 1K3BC 2ASBA 3V05A 1S72A 1VQDA 2K33A 4IR9A 4NDXA 3HOXB 3G7LA 1FD7D 1FJGQ 3C3LA 3OIQA 5CR3A 3MWEA 4EVOA 2NVYA 2IL8A 1KIXA 3CMEA 2L5TA 2R7LA 2MHVA 1Q90A 1TWHH 1G2TA 3DLLA 2XC9A 3K5IA 3NTIA 4J6HA 4IRCA 3RN5A 4MTKA 5KFTA 5KG4A 4ED7A 1U4LA 2PYKA 4ZKCB 1XJVA 1BCPC 4DV3H 4BBRH 5M5WH 4TRDA 3I56A 3BJUA 1YI2A 3EPIA 4XYQA 4IFDH 4DV4H 1NTGA 3P7JA 4X3SA 1KJ9A 4DL4A 4XDXA 4A3MG 2VUGA 4PZ8A 2K50A 4HJ9A 2Q8RE 2YTVA 4B3MH 4CDCC 3HGBA 1EL0A 3FMCA 3QJYA 3E5SA 2F0TA 1S0NA 5GONF 2A19A 2JYOA 3Q8DA 1NCVA 1ET9A 4LF9Q 1N34H 4A3KB 4ZKBB 3QWNA 5KNBA 1MHWC 3PCOB 1NY4A 1S5DD 4EGQA 4G7HC 1XNRQ 1WFQA 3DWAA 2QDBA 4HCSA 2L15A 3NWSA 3EN2A 1K8MA 3HOXG 2UUCQ 2VB3X 2B2WA 4WORA 1N33L 4QQBX 3S14H 1HJPA 2VOBA 3MR6A 4JI6L 3I4LA 4EYHB 3HZXA 2W57A 1MIUA 2GVBA 5I9OA 5EZYF 4EGJA 1IOWA 3K5LA 3KDFB 4AQYH 3BYYB 4I7AA 2F3IA 3S1RH 4RGTA 4Q5VA 2FPGB 4P73A 5JJIA 3KBXA 2PQAA 1PH5A 3KXYT 3CQZH 4M7EA 3E9HA 1Q8KA 1CQJB 3GQCA 4DR2H 3CAMA 4UCTA 2NUCA 1WTRA 2JXMB 4GKKL 3H0GB 1EOVA 4Q44A 2FJZA 4O3QA 2FKLA 1P8LA 3PUVA 1BDOA 2C00A 1MSHA 2ES2A 4G7ZC 2HVQA 1UNNC 3V96A 2EYPA 1FVIA 1IZ6A 4R4IA 4GNXB 4JI1H 1MJEA 3K81C 5CV8A 1G291 1PLFA 3FEWX 1EIFA 2EOTA 4A3KG 4LFBL 2JA5B 2K7VA 3K80C 4X3KA 3LWUA 3SVMA 4PNYA 2NZOA 2F0LA 2OCEA 3TRZA 5KFDA 4DV3Q 1E2VA 3L0OA 1A6XA 1JDEA 4R9WA 4A3MH 1XMQL 4DV4Q 3GV8B 5KX5F 5IOCA 4L6TB 1AP0A 2N88A 3ICEA 2LXKA 2UUBH 3FVQA 2FLPA 4C5CA 2FJ2A 1ASZA 4B3MQ 2FPIB 1JOOA 3HOUB 5FLXL 3Q23A 3S1MH 4DV0H 1VF5C 1I4PA 4HSVA 2R8IA 2PNHA 1F2LA 1L1OB 5IODA 1N34Q 1KHIA 3HOXH 2J9GA 1ZHQA 4L5TA 4JI0L 3EROA 3QG1A 5A2QE 3H0GG 1KC7A 5JPMC 1S03G 4LF6L 1ZEQX 5T1GA 1HPCA 2R93A 5LOVF 3RV4A 4GOPB 1STYA 2EPBA 3OHBA 3GTJB 5I47A 3FHWA 4AQYQ 3RBEA 2LY7A 4EQ5A 4R8UA 4ECTA 4DAYA 3OMGA 5J22A 1R9TB 5D1PA 5LYJF 2RCNA 5HURA 2RSNA 1FGUA 1QOHA 2XGTA 2JA5G 4MA0A 1EUJA 1HQRD 4DR5L 5IGFA 4IZOA 4DR2Q 5KG5A 3TIIA 3LMLA 1D6EC 2CQAA 5EAYA 3M4OB 3BDCA 1X55A 1EY8A 5FPOA 4XTCS 3DHQA 4ZUIA 3Q6SA 2NTSA 3IFDA 4CBVA 3MR2A 2CKZB 4XQJA 4LF4Q 4WBNF 1X3PA 1SFOB 4BA2I 3I4NB 3OOCA 3HOUG 2W6MA 4JI1Q 4A3KH 4QY7A 1SROA 4F4YA 3PR5B 4RB1A 4FS1A 2EXZA 1EYAA 1HNXL 2RDFA 2WKDA 3GILA 3WWVA 4ED3A 4NXMH 1KXLA 2C35B 1DIKA 2PI2A 1LTBD 3RJ0A 4ALPA 4LFCH 1VQIA 4I7HA 2UUBQ 1XTDA 4LSXA 2B2UC 4X65L 1E2WA 4OO1I 1SE4A 1F2YA 2LSSA 4DUYL 5KFVA 1QNUA 1I4QA 1E0BA 2Q8TA 4JBKA 4DV0Q 2E2DC 3FKIB 4OWTB 5C5LA 1WTQA 4JV0A 5IYDG 3A8JE 1TU2B 1JC7A 1LT5D 3Q1KA 3H0GH 4JYAL 1DOMA 4O2DA 1EU4A 4N9PA 3BAAA 1KLGD 5J1ZA 2N55A 2UU9H 1K73C 4ID6A 4HNUA 3F2CA 1YNND 3BVGA 4MV6A 1IL8A 1H9RA 1VMPA 2Q2TA 2EY5A 4TUYF 1XMOL 4CHTB 3I4NG 1XNQH 2JA5H 1YNXA 2L55A 1XYIA 2K5HA 3H15A 5IP7G 4A3BH 3H4DA 2WACA 1I7NA 1OXTA 3CCVA 3W2DA 4K6DA 3UE0A 4KN7C 3KF8A 4NB3A 4J9QA 2BH2A 4UP9A 1D1KA 2X69A 1GHJA 5DEHA 3D6CA 2K6AA 4NP5A 2E76C 3S2HB 5HBRB 1UAPA 4QWAA 1B3QA 4MZ9A 4JI4L 3HOWH 1Y1WA 2WB1E 4F7XA 5C6AA 3HOUH 3MXNB 3T1YH 2JEJA 4O3OA 4OHJA 4UDUC 4B3SH 5DLQE 3U4VA 2RHSB 4RB3C 2F0IA 3D0FA 1YHQA 1PZID 5M3MB 3CXCA 3FKIG 2J4XA 3HXLA 4ZHQF 2B2TA 1EQTA 1C8CA 4DNIA 1QZGA 2F0GA 4DF7A 5GAEC 1Q1BA 4J9KA 1H9MA 3I73A 2F4VH 1EYCA 1J6QA 2B63H 3FPUB 4CKCA 1Q86C 4NXMQ 4BY7B 2NB0A 3OTOH 1JXLA 3M4IA 3T13A 3GTJH 4RMFA 4CJ1B 4LFCQ 5KT4A 4F4WA 3F2DA 2XGPA 2N78A 1LT3D 2DY8A 2H4OA 1R9TH 5IYDH 2OEOA 3J81c 1SNOA 3T5LA 1AN7A 1D5XC 3UDXA 4ZCKA 2YCHA 4JG2A 4U6PA 2W9BB 1QVCA 3D3RA 1PK8A 1UE6A 1Y8OB 3PUYA 1EZ1A 5IYCG 4P71A 2AWNA 1UC8A 4OONA 2UU9Q 5K2MA 1B44D 3Q8RB 3RD4A 2WAQA 1GKHA 4GS3A 3OWFA 1DGSA 4HR7B 1SFOH 3I4NH 1C0AA 4YWLA 4J15A 4DR3L 4DUZH 3S24A 4IRKA 2KSWA 1WI5A 3JAMc 1N48A 1XNQQ 4IAJA 5IP7H 5M3MG 2R92A 1O7YA 2UXDL 2F0WA 1B04A 2XRSD 5JEAG 1RK5A 5HY6A 3MEFA 4R1JA 3K6OA 4A3LG 4BY7G 1EUDB 2FB9A 2C28A 4L8JA 5BPFA 4UPAA 1S5FD 2VA3A 3KHLA 1JWMD 3WO0A 3D4RA 4I7ZC 1TWFB 3A55A 3T1YQ 1JJ2A 4MV3A 3ONAB 4B3RH 2TMPA 3FKIH 4B3SQ 3KLSX 3S1QB 2DJGC 3KJPA 4ED8A 1TWGB 4J9RA 2EVBA 4BS9A 3RBDA 1PRTC 5JPNC 1C48A 1YEZA 4KHZA 1PH3A 4H02A 1BJTA 2YS7A 2JE6I 5C5MA 1JX4A 5I2YA 4ECQA 3N6XA 3I7FA 5ELOA 4J9PA 2EQSA 2F4VQ 3PQIA 3NGDA 2J7ZA 4O1NA 3DMUA 1ZKOA 2IX1A 2R87A 2WB1B 4IOCA 1GSOA 3J7ZC 2YYZA 3OTOQ 4FF3A 2PCFB 1O7ZA 2UXCL 1W6KA 1NAPA 2Q2IA 4GLVB 4O3SA 1LYLA 1U5KA 2NTTA 4MAMA 3NQTA 2VQFL 3PF4A 1WH2A 4DV6H 1SYEA 4ODGA 1KEEA 2FINB 1I94L 2DJFC 2BQ3A 3D4DA 1B6RA 4TVAB 5IYCH 2B2UA 3EYYA 2E2HA 3JSNA 1EWHA 1LACA 3DEPA 5IT9c 3S2HH 3FDSA 1BOSA 2HIXA 2PNRC 2R7NA 3K57A 2IHFA 1S3OA 1VQCA 1VQNA 3A7AB 1RODA 3MR3A 3GV7B 1PH2A 4LF7L 4JV5L 1LV9A 3CCEA 5DQIA 5M3MH 4DL2A 1QB5D 4DUZQ 5KFXA 4WFN3 4QWEA 1Q3LA 3J7A5 1L0XB 2CHBD 2EJMA 2R84A 5EQ0A 1IBLH 1E4EB 2AQ3B 1HNWL 5JEAH 2MJ8A 5A35A 1PH8A 5KFLA 4A3LH 3RR5A 4BY7H 5DGBA 1CKNB 1KRSA 4OGQC 1JJGA 4FXDA 4RZRA 4YR3A 3OHAA 1C9OA 4A3JB 4RZQA 4DR1H 1Z47A 2WB1G 3KAJA 4YY3L 2CQOA 3BZCA 1YZ6A 3LWEA 4KHVA 1VQKA 5KG6A 2B39A 5L1KA 5EBCA 1ILPA 1RD9D 2JEGA 3HG9A 3ZYYX 4B3RQ 1X9NA 3H3VC 2O2LD 2AGOA 4GN3B 4PG3A 5ISRA 4AIMA 1SYDA 1UUPA 3F8NA 3RB4A 3AYHB 4R4QA 4JK1C 1WCMA 4HCEA 4QMGA 2BH8A 3TBIB 1A3VA 5LMNQ 1YJNA 4DR6L 4UCVA 2BE5D 4F50A 3TQYA 4AYBE 1J5EL 2ZXOA 2JQOA 4UAIA 2DY7A 1B3AA 1D8LA 2JA7B 4YWMA 3LNNA 1UNSA 1WD0A 1XX8A 2E5LL 4HNTA 4A3FB 1E4GT 3T5JA 3NE5B 3T1HL 5EPKA 3A5ZB 1D5MC 1HA5A 1PYWD 1VAJA 1XDNA 1PFBA 1KDBA 1FYCA 1GOZA 4IJHA 1VQBA 1QCBD 2KQ3A 4RFBA 3U50C 2ID0A 3F2BA 4ZI7F 4DV6Q 3PUZA 4LF5H 3K0YA 3KF6A 2H1EA 1MSGA 5EBDA 2UVUA 3A56A 3QOJA 1HR0W 5FLXE 4GC6A 1M7JA 5C4XB 4ETSA 4DKAC 5GAGC 4A3JG 1LT4D 4XQQA 3GIPA 1L0YB 3NXWA 2VPQA 4KHPL 1TWFH 2MNAA 1TAEA 2CH4A 2K5QA 4EFEA 2CCZA 5C44B 3S1QH 4P75A 1TWGH 4YHHH 2R7ZA 3L4JA 1K8OA 1SAPA 3N52A 5JVDF 1VQAA 2LS01 5AJ3Q 1TT2A 3A8KE 3H09A 1IBLQ 1DONA 3N41B 3AU7A 2F0DA 3MA2B 4PMBA 5FLMG 4BBSG 1EEFD 5KG3A 2JA7G 1MI2A 2HCCA 2AU0A 2IHEA 1U4RA 4DR1Q 4A3FG 5DAUA 1IBKH 4QGUA 2LXJA 2IY5B 1UE1A 2B2WC 1I4GA 2MFIA 1ASYA 2PQAB 1KJ8A 1W93A 4KMUC 3VYUA 1AUXA 4BXXG 2VXWA 1LTID 4KD4A 2DN8A 1YJ9A 3M7NA 2NU9B 2B29A 5D3IB 3RF2A 2WTFA 4LFAL 2FXQA 1VDZA 4NXNL 2PPBC 5C4XG 4YCWA 2EXDA 4MV8A 1LTLA 3T53B 1YNNC 4ZRZA 2IPKD 4DK6C 5BN3A 1EQQA 3X3MA 1STNA 1EQRA 2K52A 5IE8A 2Q2UA 3T16A 4B3TH 5KYIA 5C44G
chains in the Genus database with same CATH topology
4Y7NH 3L7ZC 3S14H 1HJPA 1PFSA 4JI6L 4JCVE 1L0WA 1MIUA 2GVBA 1B8AA 4JI5L 5IP9H 5GAHC 4MTNA 3I4MH 5H1SE 3KDFB 2ZM6L 2F3IA 3S1RH 4A3JH 4P73A 3J80c 5JJIA 3J81j 1PH1A 1HZAA 5GADC 2PQAA 1PH5A 2VQFQ 4A4IA 3CQZH 2A1AA 3E9HA 4JI2L 1Q8KA 1W2BA 3TS2A 1VQHA 1D7QA 1Q82C 1I94Q 4IPHA 4JI3L 3CAMA 2R92H 1NMGA 4GKKL 1CUKA 1EOVA 4FDBA 4YHHQ 1P8LA 3PUVA 5FLXc 4X64L 1KD1C 1CKOA 1M1KC 1BKBA 1HZBA 4TQUS 2ES2A 3G48A 5FLMH 3GO5A 4LF7Q 4JV5Q 1GVPA 1N33L 2JA7H 1FVIA 1IZ6A 4R4IA 4GNXB 4NXML 1MJEA 1X65A 3K81C 4A3FH 4DR7L 1N36L 1HR0L 2DUDA 1G291 5GQOA 3S15H 1OTCA 2UXBL 1EIFA 2UUAL 1N32L 4A3KG 5LMNL 4LFCL 4LFBL 2OTJA 3K80C 4IPCA 2CWAA 1IBKQ 2NZOA 3HOYH 2OCEA 3TRZA 1MJCA 2Z6KC 4DV3Q 3L0OA 1VQ7A 1HNWQ 4X66L 2HQLA 4BXXH 3I2ZA 4IJLA 4A3MH 1XMQL 1VS0A 1E24A 2R7FA 4DV4Q 4R4TA 3ZJYC 4AYBG 2LXKA 3ICEA 3D31A 2KHJA 4YY3Q 2BA0A 1TWAH 2VZAA 1ASZA 5C4XH 1SE8A 2V1CC 4B3MQ 1K0RA 3PIOA 5M3FH 2KHIA 2K14A 2UU9L 1VQ8A 5BR8Q 2E8GA 3S1MH 4DPGA 2QEXA 2PNHA 4PMWA 1L1OB 3W1GA 1N34Q 1T9HA 4DV5Q 1VQJA 5IY0A 2HHHQ 2ZJPA 4GKJQ 1PHJA 3S16H 1KHIA 5C44H 3HOXH 4OO1G 4L5TA 4JI0L 2ZJRA 1BBWA 2Z6KA 1Q46A 3B6YA 3H0GG 3CPFA 4OWXB 1J5EQ 4B3TQ 4OWWB 1XNQL 1SLJA 1UE5A 1JB7A 4LF6L 2IT1A 4JI8Q 1SN8A 3A0JA 2E2HH 2GN5A 4A3GG 4GN4B 1W3SA 3NEMA 4GOPB 3T1HQ 2KCTA 1FJGL 3FHWA 1VQEA 2D0PA 4AQYQ 4EQ5A 2CFMA 1VQ5A 1SR3A 3CC2A 5E7NA 5JJLA 1E22A 4ME3A 4DV2L 1BBUA 2I5LX 2RCNA 3G71A 2A8VA 3UDGA 1FGUA 2JA5G 2XGTA 1EUJA 3E0EA 3ERSX 4DR5L 4DR2Q 3T1YL 4OX9L 3ULPA 2R7ZG 4KLKA 2ATWA 4B3SL 1OXUA 4DR1L 5LMUL 2ZTEA 1K3RA 5EAYA 2E2IH 3AFQA 1X55A 4XTCS 2Z0SA 1SRUA 3STBD 3AEVA 4JBMA 3GDEA 2CKZB 1VCIA 1VQ4A 4LF4Q 1CKMA 3JC66 1KRTA 2XTIA 1NMFA 4KHPQ 1FL0A 1JJCB 4BA2I 3HOUG 4YCVA 4JI1Q 4A3KH 4QY7A 1SROA 4HJ7A 2F52A 3SGIA 1B70B 2N3SA 4IOAA 2MO1A 4WJ3M 2K4KA 2MO0A 1HNXL 1A8VA 1YBYA 1PH6A 3WWVA 1O7IA 1E1OA 5IWAL 4C3HH 1KXLA 2C35B 2PI2A 4POFA 4ALPA 3RZOH 1VQIA 4QL5A 1XTDA 2PI2E 4EX5A 4X65L 2VW9A 1N8RC 2UUBQ 4C3IH 1KL9A 3KFUA 4HIDA 4OO1I 1VQLA 1CSPA 2LSSA 4DUYL 2QA4A 4A3CG 1NBWA 3PGZA 2VNUD 5J3BA 3H3VI 4JBKA 2JEBI 4LF5L 1HH2P 4DV0Q 4OWTB 5C3EG 4DV1L 5IYDG 3RZDH 4R4OA 4KI0A 1WYDA 4DR4L 3GTOH 3H0GH 4JYAL 1RIPA 3H3VH 4A3DG 1OXVA 4MNOA 4O2DA 1Q7YC 3GTQH 2UXCQ 4PZ7A 4LFAQ 4DUZL 1X6OA 2NN6G 3TREA 4RG1A 2AHOB 4A3GH 4K0KQ 1Y1VG 2ZTDA 1K73C 2Y0SE 2AMCB 2R7DA 3F2CA 3HKZE 2JA8G 4JI7Q 5IYBG 4LUZA 1X54A 3LGJA 1YIJA 3CCJA 1PYSB 2Q2TA 1XMOL 3A5UA 4O0AA 3NENA 1LUZA 3I4NG 1UWVA 1N33Q 4IPGA 5M5XH 1P16A 2JA5H 1YNXA 3GTGH 1A63A 3CPWA 3CP0A 1BVSA 2K5HA 3H15A 5IP7G 4A3BH 4JI6Q 1Q81C 3HOZG 1OXTA 2R7ZH 3CCVA 3M4PA 4AH6A 3UE0A 3PUXA 4A3EG 2NVYH 1V9PA 3DM3A 4NB3A 4HJ8A 3PUWA 4JI5Q 2BH2A 4UP9A 1IBML 4B3RL 2I5HA 1G51A 1V43A 2JJQA 2ZM6Q 3KOJA 2VUMG 3NELA 4UP7A 3S2DH 1Z9FA 2WFWA 2KENA 4DV7L 3OW2A 2JK8A 2VS1A 4MZ9A 1K9MC 4JI4L 5JJKA 2YV5A 3HOWH 4X62L 1VQOA 3ULJA 2PMZE 3I4OA 4JI2Q 1HNZL 3GTMH 4Y52H 2WB1E 3HOUH 1PYBA 3MXNB 2ZJQA 4P72A 4DAYB 4IO9A 2D62A 3G4SA 4A75A 4JI3Q 5DLQE 3U4VA 2RHSB 3CC7A 4GKKQ 3D0FA 1YHQA 3CXCA 4WJ4A 3FKIG 4HJAA 4YWKA 2OQ0A 1NJIC 3PO2G 4B3ML 4X64Q 4DNIA 1LM0A 1QZGA 5GAEC 1EYGA 1Q1BA 2ZTCA 3J81i 1C7YA 1J6QA 2B63H 3M85A 4QQBX 1Q86C 1PH9A 4DV6L 4NXMQ 1YHAA 2OTLA 1EFWA 1N36Q 2EIFA 2RHQB 4LF8L 4GKJL 2JA9A 2UXBQ 2UUAQ 3GTJH 4RMFA 1N32Q 4LFCQ 4LFBQ 3F2DA 4A3CH 1HZCA 2N78A 4B3TL 3CW2C 1M90C 1N9WA 1AE2A 3K8AA 4DR6Q 1R9TH 4X66Q 5C3EH 4HIKA 5IYDH 2NN6I 3UDIA 3J81c 1XMQQ 2H5XA 2E5LQ 4X6AH 4A3DH 3JAMi 2MQHA 1U0LA 3UDXA 4JG2A 5C0XG 1QVCA 1E3PA 3U58A 1UE6A 3PUYA 3RLNA 1Y1VH 5IYCG 4P71A 2AWNA 4NPSA 5C4JH 2R93G 4OONA 2UU9Q 2JA8H 5IYBH 1CKNA 5AJ3L 1IBLL 1GKHA 4GS3A 1DGSA 2WAQE 5HGQA 4UY8C 1Q12A 1SFOH 4BY1G 3I4NH 3L2PA 2E2JH 2AWOA 4JC0A 2K75A 3GD7A 1CSQA 3HFZB 4J15A 4YWLA 4DR3L 3S24A 4JI0Q 2HT1A 1JE5A 1WI5A 3JAMc 2OQKA 4LNQA 1XNQQ 2YTXA 5IP7H 3HOZH 5M3MG 1Q1EA 4GN5A 2VQEQ 1XPOA 3AFPA 4A3EH 1GM5A 3VDYA 4LF6Q 2UXDL 4R4CA 3M4QA 3K0XA 1VQPA 3W5OA 1TXYA 3PV0A 4JI1L 5JEAG 1PH4A 2VUMH 3GTLH 2GVAA 1PA6A 1X3GA 1A62A 3CCRA 5HY6A 1JMCA 3MEFA 4R1JA 2YU9H 4A3LG 4BY7G 4UPAA 4A93G 2NVTH 3RLFA 2CWPA 1MKHA 4DR5Q 3F1ZA 3NBHB 3T1YQ 1EWIA 1PV4A 1TWCH 1JJ2A 4OX9Q 1L2FA 3FKIH 4LF9L 1X3EA 1QUQA 4B3SQ 3KJPA 1GD7A 3PO2H 5LMUQ 2NVQH 4APVA 3K7AH 4HJ5A 3KF8B 1YEZA 5FJ8G 4KHZA 5C44G 4H02A 1PH3A 4POGA 2JE6I 1XNRL 1H95A 1OXSC 4L5SA 3F8TA 3I7FA 5ELOA 2YTYA 1S40A 4LWCA 2EQSA 2UUCL 3HOYG 2F4VQ 4BBSH 4L5QA 5K36G 2IX1A 1I50H 3RNUA 1YVCA 4IOCA 3J7ZC 2YYZA 3OTOQ 3S1NH 2JA6G 3GTPH 1X3FA 4C3JH 2UXCL 1KAWA 4C2MH 2Q2IA 3BU2A 5C0XI 4GLVB 1HNXQ 1VQ9A 1LYLA 1U5KA 2VQFL 1EIYB 1I5FA 4NXNQ 5IWAQ 3CD6A 4OXPA 3PF4A 2RF4A 3IRBA 1I94L 4A76A 2JEAI 1WJJA 2K5VA 4TVAB 5IYCH 4X65Q 1C0AA 1SMXA 4IPDA 1XPRA 2ALYB 2Y0SG 4YHHL 2R93H 5GROA 3HKZG 5IT9c 3S2HH 4DUYQ 2HIXA 2IHFA 1S3OA 1UE7A 1VQCA 3EIVA 5M5YH 4DAMA 1VQNA 3PIPA 3PSIA 4LF5Q 2I0QA 2DGYA 4BY1H 3CCSA 4DV1Q 1PH2A 3CCLA 4LF7L 1IXRA 4JV5L 3TS0A 2VL6A 3CCEA 4DR4Q 4JYAQ 4BA1I 5M3MH 1GO3E 4DUZQ 3J7A5 3FP9A 5C0XJ 1IBKL 1E7ZA 4DV3L 1HNWL 1PH8A 2I5MX 4DV4L 4A3LH 3RR5A 4BY7H 4XIGS 1XMOQ 3GTKH 1CKNB 1KRSA 1JJGA 4A93H 3KF6B 1C9OA 3HOVG 1Z47A 2WB1G 3K7UC 3BZKA 4YY3L 2CQOA 3BZCA 3E9IA 1YZ6A 3PF5A 1Y1WG 1VQKA 1YHBA 4PZ6A 1XPUA 2R6GA 2OWOA 1QVFA 5BR8L 4P74A 4BBRG 3KLWA 1X9NA 4B3RQ 1IBMQ 1K8AC 3CCUA 4IFDG 4GN3B 4PG3A 4LW1A 3UDFA 3ER0A 4AIMA 5FJ8H 4DV5L 1N34L 1HR0Q 2HHHL 4DR7Q 3AYHB 4R4QA 3W1BA 4DV7Q 2BH8A 5JEAJ 1YJNA 5LMNQ 1PH7A 4JI4Q 4X62Q 4DR6L 4LUVA 2Q2HA 3TQYA 4AYBE 1J5EL 1HNZQ 4QIWE 2JQOA 3KDFA 4GNXC 4LUOA 1I3QH 1D8LA 4A3IG 1WCMG 4YWMA 4JI8L 2E5LL 2JA6H 1V1QA 2BA1A 3T1HL 3A5ZB 1VQMA 1YJWA 3PO3G 3A74A 3KYHC 4QJFA 4HIOA 4AQYL 2NZHA 2HIVA 4JBWA 3TEHB 1QUQB 1K83H 4IJHA 1VQBA 1NE3A 3U50C 2K5NA 3F2BA 2ID0A 3M4OH 1HZ9A 1JT8A 2KBNA 4DV6Q 3PUZA 3KF6A 3CCQA 4LF8Q 1A0IA 2IX0A 4DR2L 4JOIC 3RN2A 1YITA 2D0OA 2AKWB 1IYJB 1VQ6A 1HR0W 5IP9G 3I4MG 1AH9A 3G6EA 3U4ZA 3M3YH 5LMNW 2VQEL 4DKAC 2WAQG 1E1TA 5GAGC 4GNXA 4A3JG 3OYYA 4JBJA 4HIMA 3STBC 2N49A 4GLXA 1QVGA 1L1OC 4UP8A 1KC8C 3CF5A 4KHPL 4LF4L 1KQSA 1TWFH 2MNAA 3I55A 2ASBA 1S72A 1VQDA 2CCZA 3S1QH 2KCMA 4P75A 1B7YB 1TWGH 1FJGQ 1K8GA 2QGQA 2R92G 2NVXH 1KIXA 3CMEA 1OXXK 1VQAA 4DV2Q 5AJ3Q 1AE3A 1TWHH 1IBLQ 4GOPC 2VY3A 4A3BG 3DLLA 4L5RC 4JOIA 5FLMG 2B3GA 4BBSG 3RN5A 3HOVH 3CMAA 3ULLA 1X56A 4DR3Q 1VQGA 1Y1WH 2JA7G 2IHEA 5ELNA 4IFDI 4DR1Q 4A3FG 2UUBL 1RL2A 4QGUA 2LXJA 1XJVA 2IY5B 3S17H 2UXDQ 1L1OA 4BBRH 4DK3C 5M5WH 2F4VL 1UE1A 3HOWG 1Y14B 1G6PA 3I56A 3BJUA 2MFIA 1YI2A 1ASYA 2PQAB 2N8NA 3UE1A 1NTGA 3CCMA 4DV0L 3HKSA 3OTOL 4BXXG 4A3MG 3KJOA 4PZ8A 1I6HH 1VQFA 2K50A 4HJ9A 1YJ9A 2YTVA 3M7NA 2B29A 3M9BA 4LFAL 4GOPA 1WOCA 4A3IH 1UEBA 1WCMH 2FXQA 3AQQA 4NXNL 1PVOA 4YCWA 4K0KL 5C4XG 2EXDA 4YCUA 5M3FG 2A19A 3Q8DA 2B63G 1LTLA 4LF9Q 3RLOA 3PO3H 4JI7L 2WP8J 4DK6C 3PCOB 1QZHA 1EQQA 3CC4A 1NY4A 3J80i 1IL2A 1XNRQ 1EQRA 1WFQA 2K52A 5IE8A 3EBEA 2Q2UA 4IFDJ 2L15A 4GLAC 3EN2A 3HOXG 2UUCQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7N H;  3L7Z C;  3S14 H;  1HJP A;  1PFS A;  4JI6 L;  4JCV E;  1L0W A;  1MIU A;  2GVB A;  1B8A A;  4JI5 L;  5IP9 H;  5GAH C;  4MTN A;  3I4M H;  5H1S E;  3KDF B;  2ZM6 L;  2F3I A;  3S1R H;  4A3J H;  4P73 A;  3J80 c;  5JJI A;  3J81 j;  1PH1 A;  1HZA A;  5GAD C;  2PQA A;  1PH5 A;  2VQF Q;  4A4I A;  3CQZ H;  2A1A A;  3E9H A;  4JI2 L;  1Q8K A;  1W2B A;  3TS2 A;  1VQH A;  1D7Q A;  1Q82 C;  1I94 Q;  4IPH A;  4JI3 L;  3CAM A;  2R92 H;  1NMG A;  4GKK L;  1CUK A;  1EOV A;  4FDB A;  4YHH Q;  1P8L A;  3PUV A;  5FLX c;  4X64 L;  1KD1 C;  1CKO A;  1M1K C;  1BKB A;  1HZB A;  4TQU S;  2ES2 A;  3G48 A;  5FLM H;  3GO5 A;  4LF7 Q;  4JV5 Q;  1GVP A;  1N33 L;  2JA7 H;  1FVI A;  1IZ6 A;  4R4I A;  4GNX B;  4NXM L;  1MJE A;  1X65 A;  3K81 C;  4A3F H;  4DR7 L;  1N36 L;  1HR0 L;  2DUD A;  1G29 1;  5GQO A;  3S15 H;  1OTC A;  2UXB L;  1EIF A;  2UUA L;  1N32 L;  4A3K G;  5LMN L;  4LFC L;  4LFB L;  2OTJ A;  3K80 C;  4IPC A;  2CWA A;  1IBK Q;  2NZO A;  3HOY H;  2OCE A;  3TRZ A;  1MJC A;  2Z6K C;  4DV3 Q;  3L0O A;  1VQ7 A;  1HNW Q;  4X66 L;  2HQL A;  4BXX H;  3I2Z A;  4IJL A;  4A3M H;  1XMQ L;  1VS0 A;  1E24 A;  2R7F A;  4DV4 Q;  4R4T A;  3ZJY C;  4AYB G;  2LXK A;  3ICE A;  3D31 A;  2KHJ A;  4YY3 Q;  2BA0 A;  1TWA H;  2VZA A;  1ASZ A;  5C4X H;  1SE8 A;  2V1C C;  4B3M Q;  1K0R A;  3PIO A;  5M3F H;  2KHI A;  2K14 A;  2UU9 L;  1VQ8 A;  5BR8 Q;  2E8G A;  3S1M H;  4DPG A;  2QEX A;  2PNH A;  4PMW A;  1L1O B;  3W1G A;  1N34 Q;  1T9H A;  4DV5 Q;  1VQJ A;  5IY0 A;  2HHH Q;  2ZJP A;  4GKJ Q;  1PHJ A;  3S16 H;  1KHI A;  5C44 H;  3HOX H;  4OO1 G;  4L5T A;  4JI0 L;  2ZJR A;  1BBW A;  2Z6K A;  1Q46 A;  3B6Y A;  3H0G G;  3CPF A;  4OWX B;  1J5E Q;  4B3T Q;  4OWW B;  1XNQ L;  1SLJ A;  1UE5 A;  1JB7 A;  4LF6 L;  2IT1 A;  4JI8 Q;  1SN8 A;  3A0J A;  2E2H H;  2GN5 A;  4A3G G;  4GN4 B;  1W3S A;  3NEM A;  4GOP B;  3T1H Q;  2KCT A;  1FJG L;  3FHW A;  1VQE A;  2D0P A;  4AQY Q;  4EQ5 A;  2CFM A;  1VQ5 A;  1SR3 A;  3CC2 A;  5E7N A;  5JJL A;  1E22 A;  4ME3 A;  4DV2 L;  1BBU A;  2I5L X;  2RCN A;  3G71 A;  2A8V A;  3UDG A;  1FGU A;  2JA5 G;  2XGT A;  1EUJ A;  3E0E A;  3ERS X;  4DR5 L;  4DR2 Q;  3T1Y L;  4OX9 L;  3ULP A;  2R7Z G;  4KLK A;  2ATW A;  4B3S L;  1OXU A;  4DR1 L;  5LMU L;  2ZTE A;  1K3R A;  5EAY A;  2E2I H;  3AFQ A;  1X55 A;  4XTC S;  2Z0S A;  1SRU A;  3STB D;  3AEV A;  4JBM A;  3GDE A;  2CKZ B;  1VCI A;  1VQ4 A;  4LF4 Q;  1CKM A;  3JC6 6;  1KRT A;  2XTI A;  1NMF A;  4KHP Q;  1FL0 A;  1JJC B;  4BA2 I;  3HOU G;  4YCV A;  4JI1 Q;  4A3K H;  4QY7 A;  1SRO A;  4HJ7 A;  2F52 A;  3SGI A;  1B70 B;  2N3S A;  4IOA A;  2MO1 A;  4WJ3 M;  2K4K A;  2MO0 A;  1HNX L;  1A8V A;  1YBY A;  1PH6 A;  3WWV A;  1O7I A;  1E1O A;  5IWA L;  4C3H H;  1KXL A;  2C35 B;  2PI2 A;  4POF A;  4ALP A;  3RZO H;  1VQI A;  4QL5 A;  1XTD A;  2PI2 E;  4EX5 A;  4X65 L;  2VW9 A;  1N8R C;  2UUB Q;  4C3I H;  1KL9 A;  3KFU A;  4HID A;  4OO1 I;  1VQL A;  1CSP A;  2LSS A;  4DUY L;  2QA4 A;  4A3C G;  1NBW A;  3PGZ A;  2VNU D;  5J3B A;  3H3V I;  4JBK A;  2JEB I;  4LF5 L;  1HH2 P;  4DV0 Q;  4OWT B;  5C3E G;  4DV1 L;  5IYD G;  3RZD H;  4R4O A;  4KI0 A;  1WYD A;  4DR4 L;  3GTO H;  3H0G H;  4JYA L;  1RIP A;  3H3V H;  4A3D G;  1OXV A;  4MNO A;  4O2D A;  1Q7Y C;  3GTQ H;  2UXC Q;  4PZ7 A;  4LFA Q;  4DUZ L;  1X6O A;  2NN6 G;  3TRE A;  4RG1 A;  2AHO B;  4A3G H;  4K0K Q;  1Y1V G;  2ZTD A;  1K73 C;  2Y0S E;  2AMC B;  2R7D A;  3F2C A;  3HKZ E;  2JA8 G;  4JI7 Q;  5IYB G;  4LUZ A;  1X54 A;  3LGJ A;  1YIJ A;  3CCJ A;  1PYS B;  2Q2T A;  1XMO L;  3A5U A;  4O0A A;  3NEN A;  1LUZ A;  3I4N G;  1UWV A;  1N33 Q;  4IPG A;  5M5X H;  1P16 A;  2JA5 H;  1YNX A;  3GTG H;  1A63 A;  3CPW A;  3CP0 A;  1BVS A;  2K5H A;  3H15 A;  5IP7 G;  4A3B H;  4JI6 Q;  1Q81 C;  3HOZ G;  1OXT A;  2R7Z H;  3CCV A;  3M4P A;  4AH6 A;  3UE0 A;  3PUX A;  4A3E G;  2NVY H;  1V9P A;  3DM3 A;  4NB3 A;  4HJ8 A;  3PUW A;  4JI5 Q;  2BH2 A;  4UP9 A;  1IBM L;  4B3R L;  2I5H A;  1G51 A;  1V43 A;  2JJQ A;  2ZM6 Q;  3KOJ A;  2VUM G;  3NEL A;  4UP7 A;  3S2D H;  1Z9F A;  2WFW A;  2KEN A;  4DV7 L;  3OW2 A;  2JK8 A;  2VS1 A;  4MZ9 A;  1K9M C;  4JI4 L;  5JJK A;  2YV5 A;  3HOW H;  4X62 L;  1VQO A;  3ULJ A;  2PMZ E;  3I4O A;  4JI2 Q;  1HNZ L;  3GTM H;  4Y52 H;  2WB1 E;  3HOU H;  1PYB A;  3MXN B;  2ZJQ A;  4P72 A;  4DAY B;  4IO9 A;  2D62 A;  3G4S A;  4A75 A;  4JI3 Q;  5DLQ E;  3U4V A;  2RHS B;  3CC7 A;  4GKK Q;  3D0F A;  1YHQ A;  3CXC A;  4WJ4 A;  3FKI G;  4HJA A;  4YWK A;  2OQ0 A;  1NJI C;  3PO2 G;  4B3M L;  4X64 Q;  4DNI A;  1LM0 A;  1QZG A;  5GAE C;  1EYG A;  1Q1B A;  2ZTC A;  3J81 i;  1C7Y A;  1J6Q A;  2B63 H;  3M85 A;  4QQB X;  1Q86 C;  1PH9 A;  4DV6 L;  4NXM Q;  1YHA A;  2OTL A;  1EFW A;  1N36 Q;  2EIF A;  2RHQ B;  4LF8 L;  4GKJ L;  2JA9 A;  2UXB Q;  2UUA Q;  3GTJ H;  4RMF A;  1N32 Q;  4LFC Q;  4LFB Q;  3F2D A;  4A3C H;  1HZC A;  2N78 A;  4B3T L;  3CW2 C;  1M90 C;  1N9W A;  1AE2 A;  3K8A A;  4DR6 Q;  1R9T H;  4X66 Q;  5C3E H;  4HIK A;  5IYD H;  2NN6 I;  3UDI A;  3J81 c;  1XMQ Q;  2H5X A;  2E5L Q;  4X6A H;  4A3D H;  3JAM i;  2MQH A;  1U0L A;  3UDX A;  4JG2 A;  5C0X G;  1QVC A;  1E3P A;  3U58 A;  1UE6 A;  3PUY A;  3RLN A;  1Y1V H;  5IYC G;  4P71 A;  2AWN A;  4NPS A;  5C4J H;  2R93 G;  4OON A;  2UU9 Q;  2JA8 H;  5IYB H;  1CKN A;  5AJ3 L;  1IBL L;  1GKH A;  4GS3 A;  1DGS A;  2WAQ E;  5HGQ A;  4UY8 C;  1Q12 A;  1SFO H;  4BY1 G;  3I4N H;  3L2P A;  2E2J H;  2AWO A;  4JC0 A;  2K75 A;  3GD7 A;  1CSQ A;  3HFZ B;  4J15 A;  4YWL A;  4DR3 L;  3S24 A;  4JI0 Q;  2HT1 A;  1JE5 A;  1WI5 A;  3JAM c;  2OQK A;  4LNQ A;  1XNQ Q;  2YTX A;  5IP7 H;  3HOZ H;  5M3M G;  1Q1E A;  4GN5 A;  2VQE Q;  1XPO A;  3AFP A;  4A3E H;  1GM5 A;  3VDY A;  4LF6 Q;  2UXD L;  4R4C A;  3M4Q A;  3K0X A;  1VQP A;  3W5O A;  1TXY A;  3PV0 A;  4JI1 L;  5JEA G;  1PH4 A;  2VUM H;  3GTL H;  2GVA A;  1PA6 A;  1X3G A;  1A62 A;  3CCR A;  5HY6 A;  1JMC A;  3MEF A;  4R1J A;  2YU9 H;  4A3L G;  4BY7 G;  4UPA A;  4A93 G;  2NVT H;  3RLF A;  2CWP A;  1MKH A;  4DR5 Q;  3F1Z A;  3NBH B;  3T1Y Q;  1EWI A;  1PV4 A;  1TWC H;  1JJ2 A;  4OX9 Q;  1L2F A;  3FKI H;  4LF9 L;  1X3E A;  1QUQ A;  4B3S Q;  3KJP A;  1GD7 A;  3PO2 H;  5LMU Q;  2NVQ H;  4APV A;  3K7A H;  4HJ5 A;  3KF8 B;  1YEZ A;  5FJ8 G;  4KHZ A;  5C44 G;  4H02 A;  1PH3 A;  4POG A;  2JE6 I;  1XNR L;  1H95 A;  1OXS C;  4L5S A;  3F8T A;  3I7F A;  5ELO A;  2YTY A;  1S40 A;  4LWC A;  2EQS A;  2UUC L;  3HOY G;  2F4V Q;  4BBS H;  4L5Q A;  5K36 G;  2IX1 A;  1I50 H;  3RNU A;  1YVC A;  4IOC A;  3J7Z C;  2YYZ A;  3OTO Q;  3S1N H;  2JA6 G;  3GTP H;  1X3F A;  4C3J H;  2UXC L;  1KAW A;  4C2M H;  2Q2I A;  3BU2 A;  5C0X I;  4GLV B;  1HNX Q;  1VQ9 A;  1LYL A;  1U5K A;  2VQF L;  1EIY B;  1I5F A;  4NXN Q;  5IWA Q;  3CD6 A;  4OXP A;  3PF4 A;  2RF4 A;  3IRB A;  1I94 L;  4A76 A;  2JEA I;  1WJJ A;  2K5V A;  4TVA B;  5IYC H;  4X65 Q;  1C0A A;  1SMX A;  4IPD A;  1XPR A;  2ALY B;  2Y0S G;  4YHH L;  2R93 H;  5GRO A;  3HKZ G;  5IT9 c;  3S2H H;  4DUY Q;  2HIX A;  2IHF A;  1S3O A;  1UE7 A;  1VQC A;  3EIV A;  5M5Y H;  4DAM A;  1VQN A;  3PIP A;  3PSI A;  4LF5 Q;  2I0Q A;  2DGY A;  4BY1 H;  3CCS A;  4DV1 Q;  1PH2 A;  3CCL A;  4LF7 L;  1IXR A;  4JV5 L;  3TS0 A;  2VL6 A;  3CCE A;  4DR4 Q;  4JYA Q;  4BA1 I;  5M3M H;  1GO3 E;  4DUZ Q;  3J7A 5;  3FP9 A;  5C0X J;  1IBK L;  1E7Z A;  4DV3 L;  1HNW L;  1PH8 A;  2I5M X;  4DV4 L;  4A3L H;  3RR5 A;  4BY7 H;  4XIG S;  1XMO Q;  3GTK H;  1CKN B;  1KRS A;  1JJG A;  4A93 H;  3KF6 B;  1C9O A;  3HOV G;  1Z47 A;  2WB1 G;  3K7U C;  3BZK A;  4YY3 L;  2CQO A;  3BZC A;  3E9I A;  1YZ6 A;  3PF5 A;  1Y1W G;  1VQK A;  1YHB A;  4PZ6 A;  1XPU A;  2R6G A;  2OWO A;  1QVF A;  5BR8 L;  4P74 A;  4BBR G;  3KLW A;  1X9N A;  4B3R Q;  1IBM Q;  1K8A C;  3CCU A;  4IFD G;  4GN3 B;  4PG3 A;  4LW1 A;  3UDF A;  3ER0 A;  4AIM A;  5FJ8 H;  4DV5 L;  1N34 L;  1HR0 Q;  2HHH L;  4DR7 Q;  3AYH B;  4R4Q A;  3W1B A;  4DV7 Q;  2BH8 A;  5JEA J;  1YJN A;  5LMN Q;  1PH7 A;  4JI4 Q;  4X62 Q;  4DR6 L;  4LUV A;  2Q2H A;  3TQY A;  4AYB E;  1J5E L;  1HNZ Q;  4QIW E;  2JQO A;  3KDF A;  4GNX C;  4LUO A;  1I3Q H;  1D8L A;  4A3I G;  1WCM G;  4YWM A;  4JI8 L;  2E5L L;  2JA6 H;  1V1Q A;  2BA1 A;  3T1H L;  3A5Z B;  1VQM A;  1YJW A;  3PO3 G;  3A74 A;  3KYH C;  4QJF A;  4HIO A;  4AQY L;  2NZH A;  2HIV A;  4JBW A;  3TEH B;  1QUQ B;  1K83 H;  4IJH A;  1VQB A;  1NE3 A;  3U50 C;  2K5N A;  3F2B A;  2ID0 A;  3M4O H;  1HZ9 A;  1JT8 A;  2KBN A;  4DV6 Q;  3PUZ A;  3KF6 A;  3CCQ A;  4LF8 Q;  1A0I A;  2IX0 A;  4DR2 L;  4JOI C;  3RN2 A;  1YIT A;  2D0O A;  2AKW B;  1IYJ B;  1VQ6 A;  1HR0 W;  5IP9 G;  3I4M G;  1AH9 A;  3G6E A;  3U4Z A;  3M3Y H;  5LMN W;  2VQE L;  4DKA C;  2WAQ G;  1E1T A;  5GAG C;  4GNX A;  4A3J G;  3OYY A;  4JBJ A;  4HIM A;  3STB C;  2N49 A;  4GLX A;  1QVG A;  1L1O C;  4UP8 A;  1KC8 C;  3CF5 A;  4KHP L;  4LF4 L;  1KQS A;  1TWF H;  2MNA A;  3I55 A;  2ASB A;  1S72 A;  1VQD A;  2CCZ A;  3S1Q H;  2KCM A;  4P75 A;  1B7Y B;  1TWG H;  1FJG Q;  1K8G A;  2QGQ A;  2R92 G;  2NVX H;  1KIX A;  3CME A;  1OXX K;  1VQA A;  4DV2 Q;  5AJ3 Q;  1AE3 A;  1TWH H;  1IBL Q;  4GOP C;  2VY3 A;  4A3B G;  3DLL A;  4L5R C;  4JOI A;  5FLM G;  2B3G A;  4BBS G;  3RN5 A;  3HOV H;  3CMA A;  3ULL A;  1X56 A;  4DR3 Q;  1VQG A;  1Y1W H;  2JA7 G;  2IHE A;  5ELN A;  4IFD I;  4DR1 Q;  4A3F G;  2UUB L;  1RL2 A;  4QGU A;  2LXJ A;  1XJV A;  2IY5 B;  3S17 H;  2UXD Q;  1L1O A;  4BBR H;  4DK3 C;  5M5W H;  2F4V L;  1UE1 A;  3HOW G;  1Y14 B;  1G6P A;  3I56 A;  3BJU A;  2MFI A;  1YI2 A;  1ASY A;  2PQA B;  2N8N A;  3UE1 A;  1NTG A;  3CCM A;  4DV0 L;  3HKS A;  3OTO L;  4BXX G;  4A3M G;  3KJO A;  4PZ8 A;  1I6H H;  1VQF A;  2K50 A;  4HJ9 A;  1YJ9 A;  2YTV A;  3M7N A;  2B29 A;  3M9B A;  4LFA L;  4GOP A;  1WOC A;  4A3I H;  1UEB A;  1WCM H;  2FXQ A;  3AQQ A;  4NXN L;  1PVO A;  4YCW A;  4K0K L;  5C4X G;  2EXD A;  4YCU A;  5M3F G;  2A19 A;  3Q8D A;  2B63 G;  1LTL A;  4LF9 Q;  3RLO A;  3PO3 H;  4JI7 L;  2WP8 J;  4DK6 C;  3PCO B;  1QZH A;  1EQQ A;  3CC4 A;  1NY4 A;  3J80 i;  1IL2 A;  1XNR Q;  1EQR A;  1WFQ A;  2K52 A;  5IE8 A;  3EBE A;  2Q2U A;  4IFD J;  2L15 A;  4GLA C;  3EN2 A;  3HOX G;  2UUC Q; 
#chains in the Genus database with same CATH topology
 5HV6 A;  3L7Z C;  3R2I A;  4N9T A;  5DQH A;  1JQY D;  4ED6 A;  4AYB B;  4O4I F;  1B8A A;  3EFX D;  3JAM E;  4MTN A;  1TS5 A;  4N8F A;  1RTO A;  3CVZ A;  4C3I B;  4A3J H;  2EYO A;  3BVM A;  3U9O A;  2F0K A;  3IKJ A;  1HZA A;  2BQR A;  4A4I A;  5ELF A;  4J8Q A;  2A1A A;  1W2B A;  1VQH A;  1ILQ A;  1HTL D;  2XNA C;  5AFW A;  3I70 A;  1TII D;  3RZD B;  3KHR A;  1EFI D;  1NMG A;  3GTO B;  1CUK A;  3GTQ B;  1ZQ7 A;  4YHH Q;  3QFF A;  1RJT A;  2JEI A;  1EUC B;  1KD1 C;  2F3V A;  4HSP A;  3GIJ A;  2VUM A;  3GTL A;  3G48 A;  2YU9 A;  2EJF C;  1E2Z A;  5FLM H;  4ECW A;  1PFM A;  3H6M A;  5EDW A;  1GVP A;  4MV1 A;  2JA7 H;  5G3L D;  1WTP A;  4A3F H;  4DR7 L;  1N36 L;  2DUD A;  2RGV A;  1OTC A;  2SOB A;  2UXB L;  4OEM B;  5J2U F;  2HJW A;  3GTG B;  1TWC A;  2ASD A;  2CWA A;  1IBK Q;  1TKW B;  4FBT A;  4B9X A;  1NR2 A;  1HQM C;  2RA4 A;  5F2D A;  3MWM A;  3K3V A;  4X66 L;  3WO1 A;  2VA2 A;  4BXX H;  3I2Z A;  4EBD A;  1VS0 A;  2R7F A;  3P20 A;  1RF2 D;  1Q8I A;  4R4T A;  2KOL A;  4RUC A;  1LT6 D;  3PW5 A;  3V6H A;  4AYB G;  2FLL A;  4RKB A;  1J9O A;  3D31 A;  1GUG A;  3MAQ A;  3S2D B;  5KFN A;  1H9S B;  3BG5 A;  5C4X H;  4C56 C;  3PIO A;  3LX0 A;  2MPM A;  4C3I G;  3DUZ A;  2K14 A;  1HA6 A;  2E8G A;  1V51 A;  1F2M A;  5H80 A;  1A2T A;  2F0O A;  3KUP A;  4PMW A;  2F03 A;  3W1G A;  2PW5 A;  5IY0 A;  3JZI A;  5KEE A;  4ZAI A;  5C4H A;  5C44 H;  4OO1 G;  4O4L F;  1VKZ A;  3I72 A;  3B6Y A;  4OWX B;  4B3T Q;  4YR0 A;  1SJH D;  3L9A X;  1SLJ A;  4FXK C;  1UE5 A;  1ZXT A;  2IT1 A;  2QF7 A;  2KCT A;  1FJG L;  3UI2 A;  1SYB A;  2F3W A;  2HDL A;  2FMA A;  1N33 H;  1I6V C;  3CC2 A;  2W6N A;  2K04 A;  3QB3 A;  4ME3 A;  1S5C D;  5F9N A;  4TSS A;  2I5L X;  5C3E B;  5FPR A;  4JI6 H;  4A2A A;  3QIA A;  1BCP B;  3E0E A;  4XT1 B;  3KAL A;  4QB4 A;  3RV3 A;  4YAK B;  4OX9 L;  3ULP A;  5A2Q W;  4I50 F;  1ML0 D;  2IJ0 A;  2ZTE A;  1WTO A;  1Y1V B;  1K3R A;  4B08 A;  3GIM A;  5C4J B;  4JBM A;  3GDE A;  4DL7 A;  5J2T F;  4DK0 A;  4KY7 A;  1VCI A;  4U67 3;  3RB3 A;  2C2E A;  1CKM A;  3JC6 6;  1KRT A;  1FL0 A;  3ORR A;  1HUN A;  1SMY D;  1QNK A;  3R93 A;  1GUW A;  1G8Z D;  4RB0 A;  4YCV A;  4GKK H;  2KEC A;  1G2S A;  4HJ7 A;  2F52 A;  3E6Z X;  1B70 B;  2XGQ A;  2EYF A;  3HOZ B;  2E74 C;  2K4K A;  2MO0 A;  3S9W A;  1YBY A;  1PH6 A;  5CYU A;  3Q24 A;  1E1O A;  4WD3 A;  5EGT A;  2QK4 A;  1QWY A;  4MTE A;  2LKV A;  4EBE A;  2HUG A;  2M2L A;  5DNF A;  2J6S A;  2W9C A;  4LFB H;  4YP3 A;  4YIJ A;  1B1Z A;  3ITP A;  4C3I H;  3DEO A;  3VA7 A;  1PRT D;  1PFN A;  1T5X D;  4HID A;  4I4T F;  2JA6 A;  3RAX A;  1VQL A;  2F4I A;  3M7G A;  1STB A;  1XMQ H;  5J3B A;  5FOB B;  3H3V I;  4MV7 A;  5C3E G;  2F0J A;  4DV1 L;  3RZD H;  4OO1 H;  4LAA A;  3LWB A;  1CHQ D;  3H40 A;  4DR4 L;  3K7A B;  3GTO H;  2V4R A;  1RIP A;  1OXV A;  3GTQ H;  1Q7Y C;  3TDQ A;  4EFB A;  3V6K A;  4IUR A;  4RG1 A;  2AHO B;  3A54 A;  4ZQI A;  1Y1V G;  1O7L A;  2ZTD A;  2AMC B;  2IW3 A;  3HKZ E;  1I50 B;  5IYB G;  1X54 A;  1YIJ A;  4RCO A;  2SCU B;  3TSS A;  3GTP B;  1D2B A;  3A5U A;  4O0A A;  4JI0 H;  3SHL A;  4C2M B;  1N33 Q;  1EIH A;  5D65 A;  2VQE H;  3K5O A;  1BNZ A;  3GTG H;  2B2T C;  2F0Q A;  3CPW A;  3CP0 A;  3M9O B;  3NBI A;  4JI6 Q;  1Q81 C;  3HOZ G;  1HXY D;  2RDG A;  1RYS A;  1IKM A;  4AH6 A;  2WYO A;  3PUX A;  4LF4 H;  2FK2 A;  3BQ1 A;  1TS4 A;  2I5H A;  1LTS D;  1V43 A;  1TWH A;  1BGW A;  1Z2P X;  5DG8 A;  3S2D H;  3D4W A;  3F2U A;  4K5X A;  4ZK9 B;  5DG9 A;  3MFH A;  3OW2 A;  2PMZ A;  1K9M C;  5JJK A;  2YV5 A;  3MR5 A;  2NUA B;  3M9N B;  2BE5 C;  3I4O A;  5CV4 A;  1HNZ L;  4DR5 H;  2BCO A;  2GPS A;  1PYB A;  4LH7 A;  2UVR A;  4P72 A;  4FU0 A;  1S0O A;  3G4S A;  1MBY A;  2YRX A;  4GKK Q;  1C4Q A;  3ETH A;  5KFZ A;  3IL8 A;  4WJ4 A;  5JQW A;  2BOS A;  4DA2 A;  2C9O A;  2KA7 A;  2OQ0 A;  5I9P A;  4B3M L;  1JOK A;  2GA4 B;  3DM1 A;  3J81 i;  1JCK B;  4O4H F;  4DFA A;  4QWC A;  4RNN A;  4EQP A;  1SDF A;  5KFW A;  3SEB A;  4FF1 A;  1EY4 A;  1EFW A;  4DU9 A;  4ME6 A;  4F8M A;  5EKK A;  1O75 A;  4LFB Q;  4FXG C;  1HZC A;  1BBX C;  1HNX H;  3K8A A;  4XYL B;  3OWE B;  4OEL B;  4ECS A;  5C3E H;  1XMQ Q;  4C1N I;  3VPC A;  2H5X A;  5KG7 A;  3JAM i;  4X65 H;  3C2P A;  2MQH A;  1HCZ A;  3U58 A;  3HOY B;  2FP4 B;  5COR A;  1K1S A;  4GZY C;  4DUY H;  4RB2 C;  3RLN A;  1Y1V H;  3BVZ A;  5I2X A;  2HGS A;  5C4J H;  2W6Q A;  2PO4 A;  4B9W A;  5IYB H;  4DAP A;  1I3Q B;  1R4P B;  4TV9 F;  5HGQ A;  1Q12 A;  3LP8 A;  4QWB A;  4JYA H;  3CQZ A;  4E4T A;  1NUC A;  4JC0 A;  1CSQ A;  5KKN B;  2HQE A;  4JI0 Q;  4KV6 A;  3PVX A;  4LNQ A;  2YTX A;  5KND A;  3HOZ H;  1LLR D;  2VQE Q;  1ENF A;  2DPI A;  2IBK A;  3RMH A;  1GM5 A;  4LF6 Q;  1XXG A;  2RCF A;  3M4Q A;  3K0X A;  3RB0 A;  1EY9 A;  2CW0 C;  4V0B A;  4HN7 A;  1RJQ A;  4JI1 L;  1XMO H;  3J81 L;  3HKZ B;  4DXF A;  1CQV A;  1B2T A;  2CWP A;  4NMZ A;  2M05 A;  4DR5 Q;  3F1Z A;  3C0F B;  2KEE A;  2L0C A;  4J1M A;  3VYS A;  1EWI A;  4Q0Y A;  4XYM B;  4RUA A;  3QOL A;  1IKL A;  1HR0 H;  3ND8 A;  3PR4 A;  3K7A H;  3G6Y A;  2NVX B;  1V1O A;  2RQX A;  4JI4 H;  1RHP A;  1WD1 A;  1OXS C;  2EDG A;  4ECX A;  2I87 A;  3JAM L;  3HOY G;  1I50 H;  3BJY A;  1EU3 A;  5LHY 1;  3GTP H;  1DOL A;  4BWG B;  3G6V A;  4UCR A;  4U7C A;  2F0H A;  4M1U B;  1KAW A;  4C2M H;  3BU2 A;  5C0X I;  1HNX Q;  1VQ9 A;  1SYX B;  1FNU A;  4IZ8 A;  1EIY B;  2CQY A;  5E3F A;  2F0P A;  2B2Y C;  4DNT B;  5IGG A;  1TR5 A;  4A76 A;  2K5V A;  4X65 Q;  4F4X A;  1CHP D;  4HED A;  1XPR A;  1BCP F;  4RAU C;  2O5I C;  1R4Q B;  3HKZ G;  1PMR A;  4DUY Q;  4A3I B;  1WCM B;  1ESR A;  3NBH A;  3PIP A;  2LMC B;  2I0Q A;  2DGY A;  1A3T A;  4J9M A;  1Y8P B;  2VL6 A;  3E3X A;  3KLS A;  5LL6 S;  2IX3 A;  4JYA Q;  4BA1 I;  2YW2 A;  1GO3 E;  4APM A;  2I8C A;  1EIG A;  2NU7 B;  3I12 A;  4DV2 H;  1AFP A;  3FP9 A;  5C0X J;  4NW2 A;  1KJQ A;  4I65 A;  1ONL A;  3EVQ A;  1B9N A;  3I4M B;  4IQZ A;  5KFO A;  4XIG S;  1XMO Q;  3MJF A;  3KF6 B;  1SXT A;  2I46 A;  2DIK A;  1E4F T;  3PF5 A;  2UXD H;  1ICF B;  3K5H A;  1JOR A;  5IT9 L;  1KJJ A;  5BR8 L;  3KLW A;  1EWC A;  1S10 A;  1AW7 A;  3CCU A;  3UDF A;  5C5J A;  4ZUJ A;  3DWQ A;  4DV5 L;  1HR0 Q;  2HHH L;  3W1B A;  4IUN A;  2YS6 A;  4LMY A;  4JI4 Q;  2AUJ D;  2Q2H A;  2XCA A;  1PZK D;  3SK5 A;  3KDF A;  1I3Q H;  4A3I G;  1WCM G;  4JI8 L;  4Q43 A;  3S15 B;  1VQM A;  5KFP A;  3FMA A;  3A74 A;  4HIO A;  1II3 A;  2HIV A;  3TEH B;  1QUQ B;  2XSC A;  5LP6 F;  1YNJ C;  3T56 B;  3M4O H;  1SE3 A;  1RK6 A;  3H0G A;  1SNM A;  3RN2 A;  1WR2 A;  1ET6 A;  2DNE A;  1SND A;  3T4A C;  2X6G A;  1TWA B;  3I4M G;  3WOF A;  2WDT A;  1GYF A;  5M3F B;  2RVL A;  2DLN A;  2VQF H;  4GNX A;  1HRJ A;  4JBJ A;  4K2L A;  1QVG A;  1GGO A;  4K14 A;  1KC8 C;  3CF5 A;  5FKA C;  2G9H D;  1I94 H;  2XRQ D;  2JA5 A;  4L1K A;  1SMY C;  1DM0 B;  5EKL A;  3S16 B;  1F9S A;  4EG0 A;  5JVL A;  2KCM A;  4X3U A;  1K8G A;  3PMF A;  1U9R A;  2OH2 A;  2RBM A;  3MEH A;  1KAB A;  2NVX H;  2D5D A;  4LMQ D;  4DV2 Q;  5KT7 A;  1PRT B;  1AE3 A;  4XT3 B;  5L1L A;  2FHT A;  2VY3 A;  4LF7 H;  5FLX W;  4JV5 H;  4RAY A;  4JOI A;  3SR1 A;  5C3W A;  4BWS C;  4HMI A;  3ULL A;  1X56 A;  4DR3 Q;  1VQG A;  4RGM A;  2V4D A;  3K5N A;  3TIN A;  5ELN A;  1S4Z A;  2Z1C A;  1N56 A;  1GUS A;  3RGX A;  3A8I E;  3BS1 A;  1L1O A;  2KJX A;  2UXD Q;  1HNW H;  2F4V L;  2M00 A;  4EGV A;  1G6Z A;  2N8N A;  3UE1 A;  4PV1 C;  2J0T D;  3IAY A;  3J7A F;  4FS2 A;  3OTO L;  3NTK A;  5FO7 B;  1SNC A;  3KJO A;  4HYK A;  4HNV A;  3SK6 A;  4YY3 H;  2B63 A;  5LL6 X;  1SEB D;  3BAB A;  2E2I B;  3R2T A;  2ZDQ A;  3M9B A;  4GOP A;  1WOC A;  4A3I H;  1WCM H;  3CHB D;  4Z9C B;  1PVO A;  2ICE C;  4K0K L;  3GTJ A;  3R5X A;  2R61 A;  4YCU A;  5M3F G;  4O3P A;  1GSH A;  3RLO A;  5IYZ F;  4JI7 L;  4CDE C;  2OT2 A;  2WP8 J;  4GKJ H;  1QZH A;  3N44 B;  3CC4 A;  4KK7 A;  2WIN B;  2RSO A;  1O78 A;  2LFN A;  1J5E H;  4H7B A;  1GUN A;  4RCN A;  3BDO A;  2ASJ A;  1B33 N;  3MZ5 A;  1PFS A;  4C3H B;  2R7M A;  4JCV E;  2A6H D;  3J81 W;  4JI5 L;  3T1H H;  3I4M H;  3HB9 A;  2QCP X;  4DLK A;  3ND9 A;  2ZM6 L;  2E75 C;  3SK8 A;  3R8B A;  1KAA A;  3J80 c;  1PTO C;  2G5D A;  1SFO A;  5GAD C;  5I6Y A;  2VQF Q;  4IUU A;  2PQE A;  4DK1 A;  4JI2 L;  4ECY A;  1Q82 C;  1I94 Q;  4IPH A;  4JI3 L;  2B2Y A;  5KRU A;  4DL5 A;  2F0V A;  4DL6 A;  2K28 A;  1RKN A;  2V5A A;  4FDB A;  5EPJ A;  4MV4 A;  4LSA A;  2ZDH A;  4X64 L;  1CKO A;  4XYO A;  1HZB A;  3JAM W;  4A3G B;  4Q8E A;  2W6P A;  2NU6 B;  3PW0 A;  4KHP H;  2CW8 A;  1TVX A;  3GO5 A;  2K03 A;  4LF7 Q;  4JV5 Q;  4ZLT F;  5EWE A;  4FNF A;  3S15 H;  1LTT D;  5GQO A;  4TQS A;  2UUA L;  5IGE A;  4RHR A;  1N32 L;  5LMN L;  2V59 A;  2XVS A;  1F9Q A;  4IPC A;  3TP5 A;  2OXP A;  2A6E D;  3FKI A;  4OIK A;  5KIX A;  4QIW A;  1HNW Q;  1ZET A;  4BBS B;  2NVY B;  4IJL A;  3P1H A;  1U4M A;  2AGQ A;  3TN2 A;  1E24 A;  2AQ4 A;  2RKS A;  3VR5 A;  1RJP A;  4C3H G;  2R8H A;  1KNA A;  4YY3 Q;  4QW9 A;  1TWA H;  2V1C C;  5D1O A;  4KY6 A;  3AMU A;  3X3N A;  5M3F H;  5KGU A;  4G4K A;  1VQ8 A;  1CFM A;  1PXU A;  2W70 A;  2D9U A;  4KJN A;  3VR3 A;  2AQ2 B;  3TME A;  1SYF A;  4Q45 A;  1VQJ A;  2ZJP A;  4GKJ Q;  3D8G A;  3S16 H;  1EYZ A;  4LFA H;  2Z6K A;  3OHX C;  1JKJ B;  3CPF A;  3IFT A;  3EJI A;  1J5E Q;  1DD2 A;  2GN5 A;  4A3G G;  4GN4 B;  5LA6 F;  1W3S A;  3G6J B;  2CW7 A;  1X3Q A;  2XIW A;  3T1H Q;  4FF2 A;  1QE6 A;  2PW7 A;  1VQE A;  2D0P A;  2CFM A;  4PQX A;  3MXN A;  3SE0 A;  4O2B F;  5JJL A;  1BBU A;  4FO2 A;  4FF4 A;  4C5B A;  5IT9 W;  1GXD C;  3G71 A;  1ENC A;  3UDG A;  2A68 D;  2B8F A;  3ERS X;  3NP8 A;  2B2V A;  1WTH A;  3ORQ A;  1M6V A;  4KLK A;  2ATW A;  1OXU A;  3TZD A;  4DR1 L;  4XXE A;  5LMU L;  3GTM A;  2E2I H;  3AFQ A;  4R8N A;  2QKI C;  5CAE B;  4G3I A;  4ED2 A;  4KN4 C;  4KHP Q;  5KFJ A;  3VYT A;  5D3D A;  3Q8Q B;  4ED1 A;  4UHV A;  2CW0 D;  5JVG 3;  4CKB A;  2W71 A;  2N3S A;  4IOA A;  4KD3 A;  2MO1 A;  4EQO A;  4WJ3 M;  3URY A;  3J81 E;  4A3E B;  2PBZ A;  1A8V A;  5DM7 3;  1MD2 D;  3OUZ A;  2W8K A;  1BO0 A;  5L9X A;  4JPB W;  2W9B A;  5IWA L;  3QO2 A;  4C3H H;  1EY6 A;  4YJ2 F;  1N36 H;  5C1O A;  2UXB H;  2AQ1 B;  3RFC A;  2QEJ C;  4QL5 A;  2EY2 A;  1QG7 A;  2PI2 E;  4EX5 A;  4CDF C;  5KFQ A;  1KL9 A;  2NVT B;  3OW7 A;  1CK1 A;  4HR7 A;  4X66 H;  2QA4 A;  4A3C G;  1NBW A;  1EHI A;  5CV7 A;  4ZYS A;  2KED A;  2RDH A;  2FK3 A;  4LF5 L;  1HH2 P;  2G9D A;  5EJW A;  3J7A V;  2L1B A;  4KI0 A;  3MVV A;  4R4O A;  1WYD A;  5D8D A;  1IOV A;  2ZXR A;  3H3V H;  2A69 D;  4MNO A;  4IHJ F;  2ATL A;  4LFA Q;  2DPJ A;  4Q8F A;  3VPB A;  4A3G H;  1ULZ A;  2R7D A;  4LUZ A;  1WTX A;  4P2C B;  5IIF A;  3CCJ A;  2B8G A;  3EA6 A;  3S1N B;  1KLU D;  3IN5 A;  1PRT F;  4C3J B;  3I8Z A;  1F2Z A;  1LUZ A;  1K0S A;  2I80 A;  4ECU A;  1TWF A;  2W8L A;  1P16 A;  2MP1 A;  1A63 A;  2IA6 A;  3CRL C;  5TSS A;  1AUV A;  1TWG A;  3M4P A;  1F77 A;  4A3E G;  4BBS H;  2NVY H;  4HJ8 A;  1IBM L;  1G51 A;  2JJQ A;  1JOQ A;  1OWT A;  3KOJ A;  2R93 B;  2F0N A;  2KEN A;  4DV7 L;  5EKI A;  3WOE A;  4X62 L;  2FMC A;  2RDI A;  4BY1 B;  4R8U B;  4OX9 H;  4DAY B;  2Q8I B;  4FM9 A;  4CKE A;  1SNQ A;  5L37 A;  1EYG A;  3Q2O A;  3QR8 A;  3BG3 A;  3VYR A;  3DXJ C;  1T94 A;  4ED0 A;  1PH9 A;  4EYI B;  2OTL A;  2YZN A;  1N36 Q;  2EIF A;  4LF8 L;  4A93 B;  2JA9 A;  3JSL A;  2UXB Q;  4K8J A;  5IT9 E;  2UVW A;  1OO9 B;  4A3C H;  4K5W A;  4B3T L;  3CW2 C;  1M90 C;  4C3J G;  3JRX A;  4X66 Q;  3Q22 A;  1GJX A;  4J9L A;  4RA8 A;  2NN6 I;  1AZQ A;  3T5H A;  1SBB B;  1JIC A;  2K5W A;  4K6L A;  3J80 E;  2FPP B;  4EEQ A;  1U0L A;  5C0X G;  3QZ7 A;  1NNX A;  1E4E A;  4O2A F;  5JH7 F;  3GID A;  1YNJ D;  2R93 G;  2O4X A;  1CKN A;  3IG0 A;  5CV6 A;  4DV1 H;  1ZYR D;  2WAQ E;  4UY8 C;  1S5E D;  4EEY A;  4DR4 H;  4BY1 G;  4YBZ B;  2W7O A;  2K75 A;  3GD7 A;  4LK1 C;  1B4O A;  3HFZ B;  2HT1 A;  2PN1 A;  4L63 B;  1JE5 A;  1CQF A;  2OQK A;  3MXP A;  1XPO A;  3MTS A;  4GN5 A;  3AFP A;  3KTM A;  2JSO A;  4A3E H;  3GTK A;  4R4C A;  1V1P A;  2FE3 A;  4IAL A;  3W5O A;  2XN9 C;  4MHE A;  5BN5 A;  4CC6 A;  4DAV A;  2NU8 B;  2PZT A;  2GVA A;  1PA6 A;  1A62 A;  1JMC A;  1CS0 A;  4A2B A;  3NQI A;  5FO8 B;  2JA7 A;  1V8Q A;  4A93 G;  2NVT H;  3JRW A;  1TA8 A;  5C1P A;  3GLK A;  5KG2 A;  3V6J A;  3NBH B;  1DCZ A;  3HS0 C;  4OX9 Q;  4LF9 L;  1X3E A;  1GD7 A;  2Z8L A;  5T14 A;  1O80 A;  3EPG A;  5L1J A;  4ILW A;  1IW7 C;  4APV A;  4QW8 A;  3KF8 B;  5FJ8 G;  3WNZ A;  1XNR L;  4NLG A;  4EBC A;  4KKU A;  4L5S A;  1H95 A;  1HNZ H;  2YTY A;  2CH4 W;  4LWC A;  2UUC L;  2HVR A;  5LL6 b;  2Z4I A;  4RWS C;  1G91 A;  1H9J A;  5E4W C;  2R7K A;  3HOV B;  1S5B D;  3RNU A;  4MTD A;  1YVC A;  2A6H C;  1Y1W B;  2ZXP A;  3S1N H;  1K83 A;  2R8G A;  1BXR A;  2O03 A;  4C3J H;  1FR3 A;  5C3X A;  4QWD A;  5KFC A;  2R8J A;  4ECR A;  5ELC A;  2YL2 A;  1H9K A;  3K59 A;  1I5F A;  1STH A;  2FLN A;  2Y0S A;  4OXP A;  5FD5 A;  1EOT A;  4Y8V B;  1JIH A;  3IRB A;  3OUU A;  2R8K A;  1AN8 A;  2R3Z A;  1I4H A;  5C0X H;  1JLL B;  5KFI A;  2JEA I;  1WJJ A;  1I6H B;  3QZ8 A;  2R93 H;  2ASL A;  2KHS A;  5D14 A;  2SDF A;  1SSO A;  1UE7 A;  1JE4 A;  3PSI A;  4LF6 H;  4BY1 H;  3CCS A;  3PO3 B;  4DV1 Q;  2SNM A;  2C5C A;  3CCL A;  3TS0 A;  4DR4 Q;  1AEX A;  5BMV F;  1CTM A;  3T51 B;  2NYZ D;  3S17 B;  3BA8 A;  4Y7N B;  4UCU A;  1PTO D;  4YAJ B;  3UFX B;  2A6E C;  2WII B;  5KFA A;  2HVS A;  3NHH A;  4DV3 L;  3TQ1 A;  2GLT A;  5L1I A;  1KJI A;  4IWY A;  5E4X A;  2I5M X;  4DV4 L;  2R6F A;  2YZM A;  5KFG A;  2WAQ B;  4A93 H;  1L2Z A;  5IGB A;  3HOV G;  1GUO A;  3K7U C;  3BZK A;  1Y1W G;  3E9I A;  4XZ3 B;  1FKA H;  1SNP A;  3N8D A;  2EYJ A;  4KKS A;  1HFN A;  1M8A A;  2HDM A;  4PZ6 A;  1XPU A;  2R6G A;  2OWO A;  4FVM A;  1CA6 A;  2R92 B;  5BN4 A;  2CZG A;  3T5K A;  1RCV D;  5FJ8 H;  1N34 L;  1HTP A;  3ER0 A;  2ALZ A;  2FFK B;  3SE7 A;  2XWB B;  3G6X A;  4OIJ A;  3OSO A;  4A3B B;  4AYB A;  1B53 A;  4ZQ3 A;  1PH7 A;  1BQQ T;  1HNZ Q;  4J0M A;  4IUV A;  3PZP A;  4QIW E;  1GLV A;  4GNX C;  1AZP A;  2W7P A;  4C5A A;  4KJO A;  3RGZ A;  5FD6 A;  1Z6H A;  1V1Q A;  1DOK A;  1PX2 A;  1YJW A;  3PO3 G;  1D1I A;  2EY1 A;  2KCC A;  3KYH C;  3HOW B;  4QJF A;  4AQY L;  1J8I A;  4K8I A;  1EZ8 A;  2XCL A;  3MFI A;  2P0A A;  1Y69 U;  2J6U A;  1NE3 A;  2SEB D;  3GTO A;  1JT8 A;  2KBN A;  1JDB B;  3GTQ A;  2A68 C;  3CCQ A;  1TY0 A;  2M9V A;  2IX0 A;  4DR2 L;  4JOI C;  1LTA D;  2D0O A;  1IYJ B;  1VQ6 A;  3RAQ A;  1WSC A;  2RDJ A;  5IP9 G;  4RU9 A;  2F0F A;  3U4Z A;  2I07 B;  2VQE L;  2WAQ G;  1RTN A;  4Q0F A;  5I6W A;  2B63 B;  4IUQ A;  2P5Z X;  3OYY A;  3BDL A;  4HIM A;  4GLX A;  2N49 A;  3NWT A;  1L1O C;  4UP8 A;  4JVZ A;  4QUC A;  5I4D A;  4LF4 L;  1KQS A;  1KBL A;  3GTG A;  3I55 A;  3AB9 A;  1WTW A;  2MCT A;  1B7Y B;  2R92 G;  2QGQ A;  4CDD C;  5K5P A;  1M0W A;  1TY2 A;  1B9M A;  1IHZ A;  1OXX K;  2F0E A;  4CGY B;  4GOP C;  3MWD A;  4A3B G;  5KFF A;  2E2H B;  1Z7T A;  1WVL A;  4L5R C;  1H9S A;  1EY7 A;  2B3G A;  3SI8 A;  3HOV H;  3CMA A;  1DV1 A;  2C22 A;  1C30 A;  1Y1W H;  4XX0 B;  5ELD A;  4ULL A;  1DV2 A;  4IFD I;  2UUB L;  2EYM A;  5JVH 3;  4R7R A;  1RL2 A;  3HRZ C;  2EE1 A;  1NR4 A;  4DK3 C;  3HOW G;  1Y14 B;  1G6P A;  3H94 A;  4OL7 A;  1X32 A;  2XCP A;  3CCM A;  3OMC A;  4DV0 L;  3HKS A;  4DXG A;  3I3C A;  4FYD A;  4IUT A;  2ENB A;  1VMC A;  2IWH A;  1STE A;  1I6H H;  3L4K A;  5KT6 A;  1VQF A;  4V19 0;  2IMW P;  2KVM A;  3U9S A;  2A69 C;  3KHG A;  3GV5 B;  1UEB A;  3AQQ A;  5DGA A;  1FNV A;  5KFS A;  5BR8 H;  3MC0 B;  4KY5 A;  2NWG A;  4QF4 A;  2B63 G;  1VBH A;  3PO3 H;  1QIL A;  4DV5 H;  2VQD A;  2HHH H;  2IP4 A;  1EYD A;  3J80 i;  1IL2 A;  3M9M B;  5DG7 A;  4IN3 A;  3TIG A;  2VB2 X;  3EBE A;  3DWP A;  4IFD J;  4F4Z A;  4GLA C;  2A74 C;  4U68 A;  3S17 H;  4Y7N H;  2F0M A;  1KDA A;  5C4Z A;  2DWC A;  4JI8 H;  1DZ1 A;  3V4Z A;  3KK7 A;  5JJZ A;  3MXG A;  4QIW B;  1L0W A;  2L4N A;  5IP9 H;  5GAH C;  1Y1V A;  2VPS A;  5H1S E;  1DYQ A;  1RDP D;  1K1Q A;  3RZO B;  5JAV A;  3G8C A;  3HP3 A;  2WKC A;  3J81 j;  1PH1 A;  3D6W A;  5D1O B;  3TS2 A;  1D7Q A;  1CM9 A;  5FO9 B;  2W9A A;  2R92 H;  1RJR A;  1I4X A;  3I90 A;  4LH6 A;  2J6T A;  1JR0 D;  4DR3 H;  5LMN H;  5FLX c;  1M1K C;  5KG1 A;  1KTK A;  1BKB A;  1K28 A;  4TQU S;  5CGK A;  1EY5 A;  3UQ8 A;  3RUP A;  2EY6 A;  4XQN A;  5DM6 3;  2OLS A;  1HUM A;  1I7L A;  2F0S A;  4RHS A;  4NXM L;  4F87 A;  1X65 A;  5EWF A;  5EWG A;  4NKL A;  4FP5 D;  1HR0 L;  2R85 A;  4RNM A;  3RIZ A;  1SE2 A;  5M5X B;  1CA5 A;  1T36 A;  1EQV A;  1LAB A;  4LFC L;  2OTJ A;  4CJ0 B;  2X6L A;  1SEI A;  2BDO A;  3HOY H;  3NK9 A;  1MJC A;  2Z6K C;  1VQ7 A;  2R7Z B;  3W3A A;  3J80 L;  2JN4 A;  2HQL A;  1EY0 A;  4IRD A;  2R82 A;  4RGO S;  1F9R A;  5NUC A;  3OIP A;  3FRP B;  4HTH A;  3ZJY C;  3R5F A;  1CT1 D;  3GV6 A;  2QW7 A;  4ECV A;  2KHJ A;  3MHB A;  1XWE A;  2BA0 A;  2VZA A;  1SE8 A;  2MGS A;  1I50 A;  1K0R A;  5KFR A;  3CU7 A;  1SYC A;  3GTM B;  2KHI A;  2K32 A;  4KKT A;  2UU9 L;  3GTP A;  5BR8 Q;  2L12 A;  4DPG A;  2QEX A;  2YYA A;  1S68 A;  4C2M A;  1ZYR C;  1T9H A;  4DV5 Q;  2B2V C;  2HHH Q;  3O13 A;  3KAK A;  4S3S A;  1PHJ A;  3V2T A;  3VPD A;  3VA5 A;  5KFE A;  1MGS A;  4IR1 A;  2UXC H;  2O5J C;  2ZJR A;  1BBW A;  1Q46 A;  4OWW B;  1XNQ L;  4K5V A;  4K0K H;  3BZD B;  1FGB D;  1QJO A;  1JB7 A;  4J9S A;  4JI8 Q;  1SN8 A;  3A0J A;  4JI7 H;  5HGT A;  2E2H H;  1JWU D;  3NEM A;  5KT5 A;  2EZV A;  1T3N A;  2BQU A;  1GUT A;  2JP1 A;  1VQ5 A;  1SR3 A;  5E7N A;  1E22 A;  4DV2 L;  1DJR D;  4J9O A;  4ME5 A;  3WDN A;  4R8I A;  2A8V A;  3E0J A;  1A9X A;  4E6I A;  1T5E A;  4JI5 H;  1LTR D;  3T1Y L;  4A3D B;  2R7Z G;  3N40 P;  2HD3 A;  1Y8N B;  4B3S L;  2ZM6 H;  3RUZ A;  4O3N A;  2KCN A;  5ELE A;  1M0T A;  2Z0S A;  1SRU A;  2JA8 B;  3R5H A;  3STB D;  4JI2 H;  3AEV A;  5CC4 A;  2KUM A;  3MFY A;  5KG0 A;  1VQ4 A;  4JI3 H;  2XTI A;  1NMF A;  1NSN S;  3NPP A;  1JJC B;  1SYG A;  2RGR A;  3K3P A;  5T1I A;  2E2J B;  2V9W A;  3ETJ A;  5M9O A;  3SGI A;  5EOY A;  1A2U A;  5E1F A;  5LXT F;  4X64 H;  2F1M A;  1F9P A;  1CZW A;  1UC9 A;  2WE6 A;  2AUK A;  1O7I A;  2V4Q A;  4C1N K;  2VUM B;  3GTL B;  1PZJ D;  2YU9 B;  5DQG A;  3PIO 3;  4POF A;  3L3O C;  5KNC A;  2UUA H;  1N32 H;  3RZO H;  3R23 A;  1R9T A;  2VW9 A;  1N8R C;  1I3Q A;  3KFU A;  1IW7 D;  5CV5 A;  1BCP D;  1SJE D;  2A5H A;  4N8X 1;  4DR6 H;  1CSP A;  4JW0 A;  3BQ0 A;  2XD4 A;  3PGZ A;  4YJ3 F;  2VNU D;  2JEF A;  1PTO B;  1A3U A;  4F88 A;  1TWC B;  2JEB I;  3A7L A;  5DLG A;  3GII A;  1D5Z C;  2E5L H;  3PO2 B;  1B6S A;  3H4B A;  2AGP A;  2K05 A;  4MN3 A;  2NVQ B;  3FDT A;  2QYZ A;  4A3D G;  2K1B A;  2UXC Q;  4PZ7 A;  4TKO B;  4DUZ L;  1X6O A;  4JV2 A;  2NN6 G;  3TRE A;  5CBA E;  5C8Y F;  4K0K Q;  4PDB A;  2FMM A;  5CMD A;  3HKZ A;  2Y0S E;  4HAE A;  2JA8 G;  3MXU A;  4PMC A;  4JI7 Q;  3LGJ A;  2R86 A;  1PYS B;  3M4Y A;  2BDN A;  4ECZ A;  2BR0 A;  3NEN A;  2HCI A;  1UWV A;  4IPG A;  5M5X H;  3C1F A;  1BVS A;  3RTX A;  2R7Z H;  3BYT B;  4UFZ A;  4JI5 Q;  5F9L A;  2NVX A;  1V9P A;  1JB3 A;  2SNS A;  3DM3 A;  3PUW A;  5IGC A;  4B3R L;  1RYR A;  1S97 A;  1TS2 A;  2Z6B A;  2L11 A;  2ZM6 Q;  1SCU B;  3OSN A;  4GC7 A;  2VUM G;  3NEL A;  4UP7 A;  1I6U A;  2C2D A;  3FPP A;  1Z9F A;  2FK1 A;  2MUY A;  2WFW A;  1A15 A;  2JK8 A;  2VS1 A;  2PZW A;  1BXT A;  2CVR A;  1WTV A;  1VQO A;  5M5Y B;  3ULJ A;  2PMZ E;  4JI2 Q;  5CBE E;  3GTM H;  4Y52 H;  2ZJQ A;  2F0U A;  4IO9 A;  2D62 A;  2EYL A;  2K5D A;  4A75 A;  4JI3 Q;  3CC7 A;  2YZG A;  4UCS A;  3GQB A;  3DF7 A;  5LMU H;  2QDL A;  4WJW A;  3N6R A;  4HJA A;  4M8A A;  4YWK A;  3MWY W;  1NJI C;  3PO2 G;  2EYH A;  4X64 Q;  2PVP A;  3TZU A;  3N42 B;  1LM0 A;  4M9U A;  3NTH A;  4O3R A;  3KBG A;  2XIG A;  2ZTC A;  1C7Y A;  2YRW A;  3Q0A A;  3VR4 A;  3M85 A;  4J9N A;  4RAZ A;  5G3L F;  4DV6 L;  5KFU A;  5A2Q L;  1YHA A;  3J7Y W;  2DNC A;  3GTK B;  5IGD A;  1V1P B;  2RHQ B;  4GKJ L;  3Q8S B;  2K01 A;  2UUA Q;  1N32 Q;  5KT3 A;  1N9W A;  2ZT9 C;  1AE2 A;  4QUF A;  3OSP A;  3EQL C;  4DR6 Q;  4YB8 B;  5KT2 A;  4NXN H;  5IWA H;  3HEJ A;  4HIK A;  3UDI A;  3VR6 A;  2C2R A;  2L9H A;  1TS3 A;  2XWJ B;  2E5L Q;  4X6A H;  4A3D H;  3E5N A;  3I91 A;  4IUP A;  1C3O A;  3VMM A;  3K5M A;  2NN6 H;  1E3P A;  3CRK C;  3ERQ A;  4NPS A;  1BUV T;  1STG A;  3PW2 A;  3V4S A;  2JA8 H;  1MZB A;  2W6O A;  2W9C B;  1I4R A;  5AJ3 L;  1IBL L;  1HHV A;  2JA6 B;  1ICW A;  2GPW A;  1BR9 A;  3L2P A;  2AWO A;  2E2J H;  4JV1 A;  4MV9 A;  4DGZ A;  3GIK A;  1K83 B;  4H0L C;  1XTC D;  3TP8 A;  1Q1E A;  5KFM A;  3PW7 A;  3J80 W;  3VDY A;  1S0M A;  5KFK A;  1CZG A;  1VQP A;  3N43 B;  1PDQ A;  5BPH A;  3C1E A;  5CA0 F;  1TXY A;  3PV0 A;  1PH4 A;  2Y0S B;  2VUM H;  3GTL H;  3VR2 A;  2V58 A;  2YU9 H;  1X3G A;  3CCR A;  3M3Y B;  5J39 A;  4JUZ A;  3RLF A;  3BA9 A;  1IYV A;  2ZJT A;  1U4P A;  1MKH A;  1DXM A;  1PTO H;  4LJZ C;  3SDZ A;  1PV4 A;  1GHK A;  1IBM H;  1TWC H;  2W6Z A;  5KFH A;  1L2F A;  1QUQ A;  1EEI D;  3HBL A;  3PO2 H;  4DR7 H;  5LMU Q;  2NVQ H;  3H91 A;  4DV7 H;  4HJ5 A;  4KTA A;  4POG A;  3SXH A;  4X62 H;  5JUM A;  1W96 A;  3F8T A;  1TWH B;  1S40 A;  1FNW A;  1TWA A;  4L5Q A;  2PMZ B;  3CKI B;  5K36 G;  4TQR A;  5COY A;  4DN4 M;  4RKL A;  2JA6 G;  1X3F A;  2X0S A;  5CV9 A;  3SK4 A;  4BBR B;  4TV8 F;  5M5W B;  3C46 A;  3TP6 A;  4DL3 A;  4NXN Q;  1JWS D;  5IWA Q;  4K2K A;  3CD6 A;  4G7O C;  2RF4 A;  5CA1 F;  4HQ6 A;  1LO5 D;  1ZHS A;  4YR2 A;  4LF8 H;  2TSS A;  2OF1 A;  2EJG C;  1IYU A;  1M4V A;  1SMX A;  4IPD A;  2ALY B;  2Y0S G;  5JOB A;  4EQN A;  4YHH L;  5GRO A;  1CE8 A;  3KLR A;  4O42 A;  1EZ6 A;  4PWQ A;  3EIV A;  5M5Y H;  4DAM A;  4LF5 Q;  4CJ2 C;  4H13 C;  1IXR A;  4FBU A;  3U9T A;  1ESF A;  1FJG H;  2NZ1 D;  4G57 A;  1Z2N X;  1UEA B;  3RB6 A;  2ZDG A;  3S14 B;  1IBK L;  4RNO A;  4WRD A;  1TQO A;  2Z9H A;  3GP7 A;  3K58 A;  1E7Z A;  2WB1 A;  1CI3 M;  2E2I A;  1ENA A;  3GTK H;  2ICI A;  3OPO A;  2QIL A;  3S1R B;  5FK9 C;  1KNE A;  2A73 B;  5KYL A;  5DLF A;  4IWX A;  5KFB A;  1W6J A;  2NBF A;  3CQZ B;  1YHB A;  3NUC A;  1BNC A;  4YQW A;  3PW4 A;  1BF4 A;  1QVF A;  4ZOL F;  4P74 A;  2Z4H A;  4BBR G;  3KHH A;  1STA A;  1IBM Q;  2VR1 A;  4ABN A;  1K8A C;  4IFD G;  4RGN A;  3TP7 A;  4LW1 A;  3GV3 A;  5KFY A;  1KDC A;  2PZU A;  4DR7 Q;  1CQI B;  1S9F A;  1PTO F;  4X3T A;  4DV7 Q;  5JEA J;  3GIQ A;  1B50 A;  4I55 F;  4MA5 A;  4X62 Q;  4LUV A;  4DNR B;  1GSA A;  2D2C C;  1VF7 A;  3NSW A;  5K36 H;  4LUO A;  1V4Y A;  4LF9 H;  3H20 A;  4HMJ A;  2JA6 H;  2BA1 A;  1LTG D;  1VBG A;  1XNR H;  4RH6 A;  2NZH A;  4JBW A;  2UUC H;  3Q8P B;  2UVV A;  5EPL A;  1K83 H;  2WV6 D;  2K5N A;  3PN1 A;  1HZ9 A;  4A3M B;  1HFG A;  4UCO A;  4LF8 Q;  1A0I A;  1YIT A;  5ELB A;  2AKW B;  3TQT A;  5CB4 F;  3J7A K;  1AH9 A;  3PIP 3;  3G6E A;  3M3Y H;  5LMN W;  4CC5 A;  4H44 C;  4QCL A;  1E1T A;  3MFG A;  3R3O A;  4MIU A;  1Z2O X;  3STB C;  3S1M B;  2DZD A;  3BQ2 A;  3P75 A;  1K3B C;  2ASB A;  3V05 A;  1S72 A;  1VQD A;  2K33 A;  4IR9 A;  4NDX A;  3HOX B;  3G7L A;  1FD7 D;  1FJG Q;  3C3L A;  3OIQ A;  5CR3 A;  3MWE A;  4EVO A;  2NVY A;  2IL8 A;  1KIX A;  3CME A;  2L5T A;  2R7L A;  2MHV A;  1Q90 A;  1TWH H;  1G2T A;  3DLL A;  2XC9 A;  3K5I A;  3NTI A;  4J6H A;  4IRC A;  3RN5 A;  4MTK A;  5KFT A;  5KG4 A;  4ED7 A;  1U4L A;  2PYK A;  4ZKC B;  1XJV A;  1BCP C;  4DV3 H;  4BBR H;  5M5W H;  4TRD A;  3I56 A;  3BJU A;  1YI2 A;  3EPI A;  4XYQ A;  4IFD H;  4DV4 H;  1NTG A;  3P7J A;  4X3S A;  1KJ9 A;  4DL4 A;  4XDX A;  4A3M G;  2VUG A;  4PZ8 A;  2K50 A;  4HJ9 A;  2Q8R E;  2YTV A;  4B3M H;  4CDC C;  3HGB A;  1EL0 A;  3FMC A;  3QJY A;  3E5S A;  2F0T A;  1S0N A;  5GON F;  2A19 A;  2JYO A;  3Q8D A;  1NCV A;  1ET9 A;  4LF9 Q;  1N34 H;  4A3K B;  4ZKB B;  3QWN A;  5KNB A;  1MHW C;  3PCO B;  1NY4 A;  1S5D D;  4EGQ A;  4G7H C;  1XNR Q;  1WFQ A;  3DWA A;  2QDB A;  4HCS A;  2L15 A;  3NWS A;  3EN2 A;  1K8M A;  3HOX G;  2UUC Q;  2VB3 X;  2B2W A;  4WOR A;  1N33 L;  4QQB X;  3S14 H;  1HJP A;  2VOB A;  3MR6 A;  4JI6 L;  3I4L A;  4EYH B;  3HZX A;  2W57 A;  1MIU A;  2GVB A;  5I9O A;  5EZY F;  4EGJ A;  1IOW A;  3K5L A;  3KDF B;  4AQY H;  3BYY B;  4I7A A;  2F3I A;  3S1R H;  4RGT A;  4Q5V A;  2FPG B;  4P73 A;  5JJI A;  3KBX A;  2PQA A;  1PH5 A;  3KXY T;  3CQZ H;  4M7E A;  3E9H A;  1Q8K A;  1CQJ B;  3GQC A;  4DR2 H;  3CAM A;  4UCT A;  2NUC A;  1WTR A;  2JXM B;  4GKK L;  3H0G B;  1EOV A;  4Q44 A;  2FJZ A;  4O3Q A;  2FKL A;  1P8L A;  3PUV A;  1BDO A;  2C00 A;  1MSH A;  2ES2 A;  4G7Z C;  2HVQ A;  1UNN C;  3V96 A;  2EYP A;  1FVI A;  1IZ6 A;  4R4I A;  4GNX B;  4JI1 H;  1MJE A;  3K81 C;  5CV8 A;  1G29 1;  1PLF A;  3FEW X;  1EIF A;  2EOT A;  4A3K G;  4LFB L;  2JA5 B;  2K7V A;  3K80 C;  4X3K A;  3LWU A;  3SVM A;  4PNY A;  2NZO A;  2F0L A;  2OCE A;  3TRZ A;  5KFD A;  4DV3 Q;  1E2V A;  3L0O A;  1A6X A;  1JDE A;  4R9W A;  4A3M H;  1XMQ L;  4DV4 Q;  3GV8 B;  5KX5 F;  5IOC A;  4L6T B;  1AP0 A;  2N88 A;  3ICE A;  2LXK A;  2UUB H;  3FVQ A;  2FLP A;  4C5C A;  2FJ2 A;  1ASZ A;  4B3M Q;  2FPI B;  1JOO A;  3HOU B;  5FLX L;  3Q23 A;  3S1M H;  4DV0 H;  1VF5 C;  1I4P A;  4HSV A;  2R8I A;  2PNH A;  1F2L A;  1L1O B;  5IOD A;  1N34 Q;  1KHI A;  3HOX H;  2J9G A;  1ZHQ A;  4L5T A;  4JI0 L;  3ERO A;  3QG1 A;  5A2Q E;  3H0G G;  1KC7 A;  5JPM C;  1S03 G;  4LF6 L;  1ZEQ X;  5T1G A;  1HPC A;  2R93 A;  5LOV F;  3RV4 A;  4GOP B;  1STY A;  2EPB A;  3OHB A;  3GTJ B;  5I47 A;  3FHW A;  4AQY Q;  3RBE A;  2LY7 A;  4EQ5 A;  4R8U A;  4ECT A;  4DAY A;  3OMG A;  5J22 A;  1R9T B;  5D1P A;  5LYJ F;  2RCN A;  5HUR A;  2RSN A;  1FGU A;  1QOH A;  2XGT A;  2JA5 G;  4MA0 A;  1EUJ A;  1HQR D;  4DR5 L;  5IGF A;  4IZO A;  4DR2 Q;  5KG5 A;  3TII A;  3LML A;  1D6E C;  2CQA A;  5EAY A;  3M4O B;  3BDC A;  1X55 A;  1EY8 A;  5FPO A;  4XTC S;  3DHQ A;  4ZUI A;  3Q6S A;  2NTS A;  3IFD A;  4CBV A;  3MR2 A;  2CKZ B;  4XQJ A;  4LF4 Q;  4WBN F;  1X3P A;  1SFO B;  4BA2 I;  3I4N B;  3OOC A;  3HOU G;  2W6M A;  4JI1 Q;  4A3K H;  4QY7 A;  1SRO A;  4F4Y A;  3PR5 B;  4RB1 A;  4FS1 A;  2EXZ A;  1EYA A;  1HNX L;  2RDF A;  2WKD A;  3GIL A;  3WWV A;  4ED3 A;  4NXM H;  1KXL A;  2C35 B;  1DIK A;  2PI2 A;  1LTB D;  3RJ0 A;  4ALP A;  4LFC H;  1VQI A;  4I7H A;  2UUB Q;  1XTD A;  4LSX A;  2B2U C;  4X65 L;  1E2W A;  4OO1 I;  1SE4 A;  1F2Y A;  2LSS A;  4DUY L;  5KFV A;  1QNU A;  1I4Q A;  1E0B A;  2Q8T A;  4JBK A;  4DV0 Q;  2E2D C;  3FKI B;  4OWT B;  5C5L A;  1WTQ A;  4JV0 A;  5IYD G;  3A8J E;  1TU2 B;  1JC7 A;  1LT5 D;  3Q1K A;  3H0G H;  4JYA L;  1DOM A;  4O2D A;  1EU4 A;  4N9P A;  3BAA A;  1KLG D;  5J1Z A;  2N55 A;  2UU9 H;  1K73 C;  4ID6 A;  4HNU A;  3F2C A;  1YNN D;  3BVG A;  4MV6 A;  1IL8 A;  1H9R A;  1VMP A;  2Q2T A;  2EY5 A;  4TUY F;  1XMO L;  4CHT B;  3I4N G;  1XNQ H;  2JA5 H;  1YNX A;  2L55 A;  1XYI A;  2K5H A;  3H15 A;  5IP7 G;  4A3B H;  3H4D A;  2WAC A;  1I7N A;  1OXT A;  3CCV A;  3W2D A;  4K6D A;  3UE0 A;  4KN7 C;  3KF8 A;  4NB3 A;  4J9Q A;  2BH2 A;  4UP9 A;  1D1K A;  2X69 A;  1GHJ A;  5DEH A;  3D6C A;  2K6A A;  4NP5 A;  2E76 C;  3S2H B;  5HBR B;  1UAP A;  4QWA A;  1B3Q A;  4MZ9 A;  4JI4 L;  3HOW H;  1Y1W A;  2WB1 E;  4F7X A;  5C6A A;  3HOU H;  3MXN B;  3T1Y H;  2JEJ A;  4O3O A;  4OHJ A;  4UDU C;  4B3S H;  5DLQ E;  3U4V A;  2RHS B;  4RB3 C;  2F0I A;  3D0F A;  1YHQ A;  1PZI D;  5M3M B;  3CXC A;  3FKI G;  2J4X A;  3HXL A;  4ZHQ F;  2B2T A;  1EQT A;  1C8C A;  4DNI A;  1QZG A;  2F0G A;  4DF7 A;  5GAE C;  1Q1B A;  4J9K A;  1H9M A;  3I73 A;  2F4V H;  1EYC A;  1J6Q A;  2B63 H;  3FPU B;  4CKC A;  1Q86 C;  4NXM Q;  4BY7 B;  2NB0 A;  3OTO H;  1JXL A;  3M4I A;  3T13 A;  3GTJ H;  4RMF A;  4CJ1 B;  4LFC Q;  5KT4 A;  4F4W A;  3F2D A;  2XGP A;  2N78 A;  1LT3 D;  2DY8 A;  2H4O A;  1R9T H;  5IYD H;  2OEO A;  3J81 c;  1SNO A;  3T5L A;  1AN7 A;  1D5X C;  3UDX A;  4ZCK A;  2YCH A;  4JG2 A;  4U6P A;  2W9B B;  1QVC A;  3D3R A;  1PK8 A;  1UE6 A;  1Y8O B;  3PUY A;  1EZ1 A;  5IYC G;  4P71 A;  2AWN A;  1UC8 A;  4OON A;  2UU9 Q;  5K2M A;  1B44 D;  3Q8R B;  3RD4 A;  2WAQ A;  1GKH A;  4GS3 A;  3OWF A;  1DGS A;  4HR7 B;  1SFO H;  3I4N H;  1C0A A;  4YWL A;  4J15 A;  4DR3 L;  4DUZ H;  3S24 A;  4IRK A;  2KSW A;  1WI5 A;  3JAM c;  1N48 A;  1XNQ Q;  4IAJ A;  5IP7 H;  5M3M G;  2R92 A;  1O7Y A;  2UXD L;  2F0W A;  1B04 A;  2XRS D;  5JEA G;  1RK5 A;  5HY6 A;  3MEF A;  4R1J A;  3K6O A;  4A3L G;  4BY7 G;  1EUD B;  2FB9 A;  2C28 A;  4L8J A;  5BPF A;  4UPA A;  1S5F D;  2VA3 A;  3KHL A;  1JWM D;  3WO0 A;  3D4R A;  4I7Z C;  1TWF B;  3A55 A;  3T1Y Q;  1JJ2 A;  4MV3 A;  3ONA B;  4B3R H;  2TMP A;  3FKI H;  4B3S Q;  3KLS X;  3S1Q B;  2DJG C;  3KJP A;  4ED8 A;  1TWG B;  4J9R A;  2EVB A;  4BS9 A;  3RBD A;  1PRT C;  5JPN C;  1C48 A;  1YEZ A;  4KHZ A;  1PH3 A;  4H02 A;  1BJT A;  2YS7 A;  2JE6 I;  5C5M A;  1JX4 A;  5I2Y A;  4ECQ A;  3N6X A;  3I7F A;  5ELO A;  4J9P A;  2EQS A;  2F4V Q;  3PQI A;  3NGD A;  2J7Z A;  4O1N A;  3DMU A;  1ZKO A;  2IX1 A;  2R87 A;  2WB1 B;  4IOC A;  1GSO A;  3J7Z C;  2YYZ A;  3OTO Q;  4FF3 A;  2PCF B;  1O7Z A;  2UXC L;  1W6K A;  1NAP A;  2Q2I A;  4GLV B;  4O3S A;  1LYL A;  1U5K A;  2NTT A;  4MAM A;  3NQT A;  2VQF L;  3PF4 A;  1WH2 A;  4DV6 H;  1SYE A;  4ODG A;  1KEE A;  2FIN B;  1I94 L;  2DJF C;  2BQ3 A;  3D4D A;  1B6R A;  4TVA B;  5IYC H;  2B2U A;  3EYY A;  2E2H A;  3JSN A;  1EWH A;  1LAC A;  3DEP A;  5IT9 c;  3S2H H;  3FDS A;  1BOS A;  2HIX A;  2PNR C;  2R7N A;  3K57 A;  2IHF A;  1S3O A;  1VQC A;  1VQN A;  3A7A B;  1ROD A;  3MR3 A;  3GV7 B;  1PH2 A;  4LF7 L;  4JV5 L;  1LV9 A;  3CCE A;  5DQI A;  5M3M H;  4DL2 A;  1QB5 D;  4DUZ Q;  5KFX A;  4WFN 3;  4QWE A;  1Q3L A;  3J7A 5;  1L0X B;  2CHB D;  2EJM A;  2R84 A;  5EQ0 A;  1IBL H;  1E4E B;  2AQ3 B;  1HNW L;  5JEA H;  2MJ8 A;  5A35 A;  1PH8 A;  5KFL A;  4A3L H;  3RR5 A;  4BY7 H;  5DGB A;  1CKN B;  1KRS A;  4OGQ C;  1JJG A;  4FXD A;  4RZR A;  4YR3 A;  3OHA A;  1C9O A;  4A3J B;  4RZQ A;  4DR1 H;  1Z47 A;  2WB1 G;  3KAJ A;  4YY3 L;  2CQO A;  3BZC A;  1YZ6 A;  3LWE A;  4KHV A;  1VQK A;  5KG6 A;  2B39 A;  5L1K A;  5EBC A;  1ILP A;  1RD9 D;  2JEG A;  3HG9 A;  3ZYY X;  4B3R Q;  1X9N A;  3H3V C;  2O2L D;  2AGO A;  4GN3 B;  4PG3 A;  5ISR A;  4AIM A;  1SYD A;  1UUP A;  3F8N A;  3RB4 A;  3AYH B;  4R4Q A;  4JK1 C;  1WCM A;  4HCE A;  4QMG A;  2BH8 A;  3TBI B;  1A3V A;  5LMN Q;  1YJN A;  4DR6 L;  4UCV A;  2BE5 D;  4F50 A;  3TQY A;  4AYB E;  1J5E L;  2ZXO A;  2JQO A;  4UAI A;  2DY7 A;  1B3A A;  1D8L A;  2JA7 B;  4YWM A;  3LNN A;  1UNS A;  1WD0 A;  1XX8 A;  2E5L L;  4HNT A;  4A3F B;  1E4G T;  3T5J A;  3NE5 B;  3T1H L;  5EPK A;  3A5Z B;  1D5M C;  1HA5 A;  1PYW D;  1VAJ A;  1XDN A;  1PFB A;  1KDB A;  1FYC A;  1GOZ A;  4IJH A;  1VQB A;  1QCB D;  2KQ3 A;  4RFB A;  3U50 C;  2ID0 A;  3F2B A;  4ZI7 F;  4DV6 Q;  3PUZ A;  4LF5 H;  3K0Y A;  3KF6 A;  2H1E A;  1MSG A;  5EBD A;  2UVU A;  3A56 A;  3QOJ A;  1HR0 W;  5FLX E;  4GC6 A;  1M7J A;  5C4X B;  4ETS A;  4DKA C;  5GAG C;  4A3J G;  1LT4 D;  4XQQ A;  3GIP A;  1L0Y B;  3NXW A;  2VPQ A;  4KHP L;  1TWF H;  2MNA A;  1TAE A;  2CH4 A;  2K5Q A;  4EFE A;  2CCZ A;  5C44 B;  3S1Q H;  4P75 A;  1TWG H;  4YHH H;  2R7Z A;  3L4J A;  1K8O A;  1SAP A;  3N52 A;  5JVD F;  1VQA A;  2LS0 1;  5AJ3 Q;  1TT2 A;  3A8K E;  3H09 A;  1IBL Q;  1DON A;  3N41 B;  3AU7 A;  2F0D A;  3MA2 B;  4PMB A;  5FLM G;  4BBS G;  1EEF D;  5KG3 A;  2JA7 G;  1MI2 A;  2HCC A;  2AU0 A;  2IHE A;  1U4R A;  4DR1 Q;  4A3F G;  5DAU A;  1IBK H;  4QGU A;  2LXJ A;  2IY5 B;  1UE1 A;  2B2W C;  1I4G A;  2MFI A;  1ASY A;  2PQA B;  1KJ8 A;  1W93 A;  4KMU C;  3VYU A;  1AUX A;  4BXX G;  2VXW A;  1LTI D;  4KD4 A;  2DN8 A;  1YJ9 A;  3M7N A;  2NU9 B;  2B29 A;  5D3I B;  3RF2 A;  2WTF A;  4LFA L;  2FXQ A;  1VDZ A;  4NXN L;  2PPB C;  5C4X G;  4YCW A;  2EXD A;  4MV8 A;  1LTL A;  3T53 B;  1YNN C;  4ZRZ A;  2IPK D;  4DK6 C;  5BN3 A;  1EQQ A;  3X3M A;  1STN A;  1EQR A;  2K52 A;  5IE8 A;  2Q2U A;  3T16 A;  4B3T H;  5KYI A;  5C44 G; 
#chains in the Genus database with same CATH homology
 4Y7N H;  3L7Z C;  3S14 H;  1HJP A;  1PFS A;  4JI6 L;  4JCV E;  1L0W A;  1MIU A;  2GVB A;  1B8A A;  4JI5 L;  5IP9 H;  5GAH C;  4MTN A;  3I4M H;  5H1S E;  3KDF B;  2ZM6 L;  2F3I A;  3S1R H;  4A3J H;  4P73 A;  3J80 c;  5JJI A;  3J81 j;  1PH1 A;  1HZA A;  5GAD C;  2PQA A;  1PH5 A;  2VQF Q;  4A4I A;  3CQZ H;  2A1A A;  3E9H A;  4JI2 L;  1Q8K A;  1W2B A;  3TS2 A;  1VQH A;  1D7Q A;  1Q82 C;  1I94 Q;  4IPH A;  4JI3 L;  3CAM A;  2R92 H;  1NMG A;  4GKK L;  1CUK A;  1EOV A;  4FDB A;  4YHH Q;  1P8L A;  3PUV A;  5FLX c;  4X64 L;  1KD1 C;  1CKO A;  1M1K C;  1BKB A;  1HZB A;  4TQU S;  2ES2 A;  3G48 A;  5FLM H;  3GO5 A;  4LF7 Q;  4JV5 Q;  1GVP A;  1N33 L;  2JA7 H;  1FVI A;  1IZ6 A;  4R4I A;  4GNX B;  4NXM L;  1MJE A;  1X65 A;  3K81 C;  4A3F H;  4DR7 L;  1N36 L;  1HR0 L;  2DUD A;  1G29 1;  5GQO A;  3S15 H;  1OTC A;  2UXB L;  1EIF A;  2UUA L;  1N32 L;  4A3K G;  5LMN L;  4LFC L;  4LFB L;  2OTJ A;  3K80 C;  4IPC A;  2CWA A;  1IBK Q;  2NZO A;  3HOY H;  2OCE A;  3TRZ A;  1MJC A;  2Z6K C;  4DV3 Q;  3L0O A;  1VQ7 A;  1HNW Q;  4X66 L;  2HQL A;  4BXX H;  3I2Z A;  4IJL A;  4A3M H;  1XMQ L;  1VS0 A;  1E24 A;  2R7F A;  4DV4 Q;  4R4T A;  3ZJY C;  4AYB G;  2LXK A;  3ICE A;  3D31 A;  2KHJ A;  4YY3 Q;  2BA0 A;  1TWA H;  2VZA A;  1ASZ A;  5C4X H;  1SE8 A;  2V1C C;  4B3M Q;  1K0R A;  3PIO A;  5M3F H;  2KHI A;  2K14 A;  2UU9 L;  1VQ8 A;  5BR8 Q;  2E8G A;  3S1M H;  4DPG A;  2QEX A;  2PNH A;  4PMW A;  1L1O B;  3W1G A;  1N34 Q;  1T9H A;  4DV5 Q;  1VQJ A;  5IY0 A;  2HHH Q;  2ZJP A;  4GKJ Q;  1PHJ A;  3S16 H;  1KHI A;  5C44 H;  3HOX H;  4OO1 G;  4L5T A;  4JI0 L;  2ZJR A;  1BBW A;  2Z6K A;  1Q46 A;  3B6Y A;  3H0G G;  3CPF A;  4OWX B;  1J5E Q;  4B3T Q;  4OWW B;  1XNQ L;  1SLJ A;  1UE5 A;  1JB7 A;  4LF6 L;  2IT1 A;  4JI8 Q;  1SN8 A;  3A0J A;  2E2H H;  2GN5 A;  4A3G G;  4GN4 B;  1W3S A;  3NEM A;  4GOP B;  3T1H Q;  2KCT A;  1FJG L;  3FHW A;  1VQE A;  2D0P A;  4AQY Q;  4EQ5 A;  2CFM A;  1VQ5 A;  1SR3 A;  3CC2 A;  5E7N A;  5JJL A;  1E22 A;  4ME3 A;  4DV2 L;  1BBU A;  2I5L X;  2RCN A;  3G71 A;  2A8V A;  3UDG A;  1FGU A;  2JA5 G;  2XGT A;  1EUJ A;  3E0E A;  3ERS X;  4DR5 L;  4DR2 Q;  3T1Y L;  4OX9 L;  3ULP A;  2R7Z G;  4KLK A;  2ATW A;  4B3S L;  1OXU A;  4DR1 L;  5LMU L;  2ZTE A;  1K3R A;  5EAY A;  2E2I H;  3AFQ A;  1X55 A;  4XTC S;  2Z0S A;  1SRU A;  3STB D;  3AEV A;  4JBM A;  3GDE A;  2CKZ B;  1VCI A;  1VQ4 A;  4LF4 Q;  1CKM A;  3JC6 6;  1KRT A;  2XTI A;  1NMF A;  4KHP Q;  1FL0 A;  1JJC B;  4BA2 I;  3HOU G;  4YCV A;  4JI1 Q;  4A3K H;  4QY7 A;  1SRO A;  4HJ7 A;  2F52 A;  3SGI A;  1B70 B;  2N3S A;  4IOA A;  2MO1 A;  4WJ3 M;  2K4K A;  2MO0 A;  1HNX L;  1A8V A;  1YBY A;  1PH6 A;  3WWV A;  1O7I A;  1E1O A;  5IWA L;  4C3H H;  1KXL A;  2C35 B;  2PI2 A;  4POF A;  4ALP A;  3RZO H;  1VQI A;  4QL5 A;  1XTD A;  2PI2 E;  4EX5 A;  4X65 L;  2VW9 A;  1N8R C;  2UUB Q;  4C3I H;  1KL9 A;  3KFU A;  4HID A;  4OO1 I;  1VQL A;  1CSP A;  2LSS A;  4DUY L;  2QA4 A;  4A3C G;  1NBW A;  3PGZ A;  2VNU D;  5J3B A;  3H3V I;  4JBK A;  2JEB I;  4LF5 L;  1HH2 P;  4DV0 Q;  4OWT B;  5C3E G;  4DV1 L;  5IYD G;  3RZD H;  4R4O A;  4KI0 A;  1WYD A;  4DR4 L;  3GTO H;  3H0G H;  4JYA L;  1RIP A;  3H3V H;  4A3D G;  1OXV A;  4MNO A;  4O2D A;  1Q7Y C;  3GTQ H;  2UXC Q;  4PZ7 A;  4LFA Q;  4DUZ L;  1X6O A;  2NN6 G;  3TRE A;  4RG1 A;  2AHO B;  4A3G H;  4K0K Q;  1Y1V G;  2ZTD A;  1K73 C;  2Y0S E;  2AMC B;  2R7D A;  3F2C A;  3HKZ E;  2JA8 G;  4JI7 Q;  5IYB G;  4LUZ A;  1X54 A;  3LGJ A;  1YIJ A;  3CCJ A;  1PYS B;  2Q2T A;  1XMO L;  3A5U A;  4O0A A;  3NEN A;  1LUZ A;  3I4N G;  1UWV A;  1N33 Q;  4IPG A;  5M5X H;  1P16 A;  2JA5 H;  1YNX A;  3GTG H;  1A63 A;  3CPW A;  3CP0 A;  1BVS A;  2K5H A;  3H15 A;  5IP7 G;  4A3B H;  4JI6 Q;  1Q81 C;  3HOZ G;  1OXT A;  2R7Z H;  3CCV A;  3M4P A;  4AH6 A;  3UE0 A;  3PUX A;  4A3E G;  2NVY H;  1V9P A;  3DM3 A;  4NB3 A;  4HJ8 A;  3PUW A;  4JI5 Q;  2BH2 A;  4UP9 A;  1IBM L;  4B3R L;  2I5H A;  1G51 A;  1V43 A;  2JJQ A;  2ZM6 Q;  3KOJ A;  2VUM G;  3NEL A;  4UP7 A;  3S2D H;  1Z9F A;  2WFW A;  2KEN A;  4DV7 L;  3OW2 A;  2JK8 A;  2VS1 A;  4MZ9 A;  1K9M C;  4JI4 L;  5JJK A;  2YV5 A;  3HOW H;  4X62 L;  1VQO A;  3ULJ A;  2PMZ E;  3I4O A;  4JI2 Q;  1HNZ L;  3GTM H;  4Y52 H;  2WB1 E;  3HOU H;  1PYB A;  3MXN B;  2ZJQ A;  4P72 A;  4DAY B;  4IO9 A;  2D62 A;  3G4S A;  4A75 A;  4JI3 Q;  5DLQ E;  3U4V A;  2RHS B;  3CC7 A;  4GKK Q;  3D0F A;  1YHQ A;  3CXC A;  4WJ4 A;  3FKI G;  4HJA A;  4YWK A;  2OQ0 A;  1NJI C;  3PO2 G;  4B3M L;  4X64 Q;  4DNI A;  1LM0 A;  1QZG A;  5GAE C;  1EYG A;  1Q1B A;  2ZTC A;  3J81 i;  1C7Y A;  1J6Q A;  2B63 H;  3M85 A;  4QQB X;  1Q86 C;  1PH9 A;  4DV6 L;  4NXM Q;  1YHA A;  2OTL A;  1EFW A;  1N36 Q;  2EIF A;  2RHQ B;  4LF8 L;  4GKJ L;  2JA9 A;  2UXB Q;  2UUA Q;  3GTJ H;  4RMF A;  1N32 Q;  4LFC Q;  4LFB Q;  3F2D A;  4A3C H;  1HZC A;  2N78 A;  4B3T L;  3CW2 C;  1M90 C;  1N9W A;  1AE2 A;  3K8A A;  4DR6 Q;  1R9T H;  4X66 Q;  5C3E H;  4HIK A;  5IYD H;  2NN6 I;  3UDI A;  3J81 c;  1XMQ Q;  2H5X A;  2E5L Q;  4X6A H;  4A3D H;  3JAM i;  2MQH A;  1U0L A;  3UDX A;  4JG2 A;  5C0X G;  1QVC A;  1E3P A;  3U58 A;  1UE6 A;  3PUY A;  3RLN A;  1Y1V H;  5IYC G;  4P71 A;  2AWN A;  4NPS A;  5C4J H;  2R93 G;  4OON A;  2UU9 Q;  2JA8 H;  5IYB H;  1CKN A;  5AJ3 L;  1IBL L;  1GKH A;  4GS3 A;  1DGS A;  2WAQ E;  5HGQ A;  4UY8 C;  1Q12 A;  1SFO H;  4BY1 G;  3I4N H;  3L2P A;  2E2J H;  2AWO A;  4JC0 A;  2K75 A;  3GD7 A;  1CSQ A;  3HFZ B;  4J15 A;  4YWL A;  4DR3 L;  3S24 A;  4JI0 Q;  2HT1 A;  1JE5 A;  1WI5 A;  3JAM c;  2OQK A;  4LNQ A;  1XNQ Q;  2YTX A;  5IP7 H;  3HOZ H;  5M3M G;  1Q1E A;  4GN5 A;  2VQE Q;  1XPO A;  3AFP A;  4A3E H;  1GM5 A;  3VDY A;  4LF6 Q;  2UXD L;  4R4C A;  3M4Q A;  3K0X A;  1VQP A;  3W5O A;  1TXY A;  3PV0 A;  4JI1 L;  5JEA G;  1PH4 A;  2VUM H;  3GTL H;  2GVA A;  1PA6 A;  1X3G A;  1A62 A;  3CCR A;  5HY6 A;  1JMC A;  3MEF A;  4R1J A;  2YU9 H;  4A3L G;  4BY7 G;  4UPA A;  4A93 G;  2NVT H;  3RLF A;  2CWP A;  1MKH A;  4DR5 Q;  3F1Z A;  3NBH B;  3T1Y Q;  1EWI A;  1PV4 A;  1TWC H;  1JJ2 A;  4OX9 Q;  1L2F A;  3FKI H;  4LF9 L;  1X3E A;  1QUQ A;  4B3S Q;  3KJP A;  1GD7 A;  3PO2 H;  5LMU Q;  2NVQ H;  4APV A;  3K7A H;  4HJ5 A;  3KF8 B;  1YEZ A;  5FJ8 G;  4KHZ A;  5C44 G;  4H02 A;  1PH3 A;  4POG A;  2JE6 I;  1XNR L;  1H95 A;  1OXS C;  4L5S A;  3F8T A;  3I7F A;  5ELO A;  2YTY A;  1S40 A;  4LWC A;  2EQS A;  2UUC L;  3HOY G;  2F4V Q;  4BBS H;  4L5Q A;  5K36 G;  2IX1 A;  1I50 H;  3RNU A;  1YVC A;  4IOC A;  3J7Z C;  2YYZ A;  3OTO Q;  3S1N H;  2JA6 G;  3GTP H;  1X3F A;  4C3J H;  2UXC L;  1KAW A;  4C2M H;  2Q2I A;  3BU2 A;  5C0X I;  4GLV B;  1HNX Q;  1VQ9 A;  1LYL A;  1U5K A;  2VQF L;  1EIY B;  1I5F A;  4NXN Q;  5IWA Q;  3CD6 A;  4OXP A;  3PF4 A;  2RF4 A;  3IRB A;  1I94 L;  4A76 A;  2JEA I;  1WJJ A;  2K5V A;  4TVA B;  5IYC H;  4X65 Q;  1C0A A;  1SMX A;  4IPD A;  1XPR A;  2ALY B;  2Y0S G;  4YHH L;  2R93 H;  5GRO A;  3HKZ G;  5IT9 c;  3S2H H;  4DUY Q;  2HIX A;  2IHF A;  1S3O A;  1UE7 A;  1VQC A;  3EIV A;  5M5Y H;  4DAM A;  1VQN A;  3PIP A;  3PSI A;  4LF5 Q;  2I0Q A;  2DGY A;  4BY1 H;  3CCS A;  4DV1 Q;  1PH2 A;  3CCL A;  4LF7 L;  1IXR A;  4JV5 L;  3TS0 A;  2VL6 A;  3CCE A;  4DR4 Q;  4JYA Q;  4BA1 I;  5M3M H;  1GO3 E;  4DUZ Q;  3J7A 5;  3FP9 A;  5C0X J;  1IBK L;  1E7Z A;  4DV3 L;  1HNW L;  1PH8 A;  2I5M X;  4DV4 L;  4A3L H;  3RR5 A;  4BY7 H;  4XIG S;  1XMO Q;  3GTK H;  1CKN B;  1KRS A;  1JJG A;  4A93 H;  3KF6 B;  1C9O A;  3HOV G;  1Z47 A;  2WB1 G;  3K7U C;  3BZK A;  4YY3 L;  2CQO A;  3BZC A;  3E9I A;  1YZ6 A;  3PF5 A;  1Y1W G;  1VQK A;  1YHB A;  4PZ6 A;  1XPU A;  2R6G A;  2OWO A;  1QVF A;  5BR8 L;  4P74 A;  4BBR G;  3KLW A;  1X9N A;  4B3R Q;  1IBM Q;  1K8A C;  3CCU A;  4IFD G;  4GN3 B;  4PG3 A;  4LW1 A;  3UDF A;  3ER0 A;  4AIM A;  5FJ8 H;  4DV5 L;  1N34 L;  1HR0 Q;  2HHH L;  4DR7 Q;  3AYH B;  4R4Q A;  3W1B A;  4DV7 Q;  2BH8 A;  5JEA J;  1YJN A;  5LMN Q;  1PH7 A;  4JI4 Q;  4X62 Q;  4DR6 L;  4LUV A;  2Q2H A;  3TQY A;  4AYB E;  1J5E L;  1HNZ Q;  4QIW E;  2JQO A;  3KDF A;  4GNX C;  4LUO A;  1I3Q H;  1D8L A;  4A3I G;  1WCM G;  4YWM A;  4JI8 L;  2E5L L;  2JA6 H;  1V1Q A;  2BA1 A;  3T1H L;  3A5Z B;  1VQM A;  1YJW A;  3PO3 G;  3A74 A;  3KYH C;  4QJF A;  4HIO A;  4AQY L;  2NZH A;  2HIV A;  4JBW A;  3TEH B;  1QUQ B;  1K83 H;  4IJH A;  1VQB A;  1NE3 A;  3U50 C;  2K5N A;  3F2B A;  2ID0 A;  3M4O H;  1HZ9 A;  1JT8 A;  2KBN A;  4DV6 Q;  3PUZ A;  3KF6 A;  3CCQ A;  4LF8 Q;  1A0I A;  2IX0 A;  4DR2 L;  4JOI C;  3RN2 A;  1YIT A;  2D0O A;  2AKW B;  1IYJ B;  1VQ6 A;  1HR0 W;  5IP9 G;  3I4M G;  1AH9 A;  3G6E A;  3U4Z A;  3M3Y H;  5LMN W;  2VQE L;  4DKA C;  2WAQ G;  1E1T A;  5GAG C;  4GNX A;  4A3J G;  3OYY A;  4JBJ A;  4HIM A;  3STB C;  2N49 A;  4GLX A;  1QVG A;  1L1O C;  4UP8 A;  1KC8 C;  3CF5 A;  4KHP L;  4LF4 L;  1KQS A;  1TWF H;  2MNA A;  3I55 A;  2ASB A;  1S72 A;  1VQD A;  2CCZ A;  3S1Q H;  2KCM A;  4P75 A;  1B7Y B;  1TWG H;  1FJG Q;  1K8G A;  2QGQ A;  2R92 G;  2NVX H;  1KIX A;  3CME A;  1OXX K;  1VQA A;  4DV2 Q;  5AJ3 Q;  1AE3 A;  1TWH H;  1IBL Q;  4GOP C;  2VY3 A;  4A3B G;  3DLL A;  4L5R C;  4JOI A;  5FLM G;  2B3G A;  4BBS G;  3RN5 A;  3HOV H;  3CMA A;  3ULL A;  1X56 A;  4DR3 Q;  1VQG A;  1Y1W H;  2JA7 G;  2IHE A;  5ELN A;  4IFD I;  4DR1 Q;  4A3F G;  2UUB L;  1RL2 A;  4QGU A;  2LXJ A;  1XJV A;  2IY5 B;  3S17 H;  2UXD Q;  1L1O A;  4BBR H;  4DK3 C;  5M5W H;  2F4V L;  1UE1 A;  3HOW G;  1Y14 B;  1G6P A;  3I56 A;  3BJU A;  2MFI A;  1YI2 A;  1ASY A;  2PQA B;  2N8N A;  3UE1 A;  1NTG A;  3CCM A;  4DV0 L;  3HKS A;  3OTO L;  4BXX G;  4A3M G;  3KJO A;  4PZ8 A;  1I6H H;  1VQF A;  2K50 A;  4HJ9 A;  1YJ9 A;  2YTV A;  3M7N A;  2B29 A;  3M9B A;  4LFA L;  4GOP A;  1WOC A;  4A3I H;  1UEB A;  1WCM H;  2FXQ A;  3AQQ A;  4NXN L;  1PVO A;  4YCW A;  4K0K L;  5C4X G;  2EXD A;  4YCU A;  5M3F G;  2A19 A;  3Q8D A;  2B63 G;  1LTL A;  4LF9 Q;  3RLO A;  3PO3 H;  4JI7 L;  2WP8 J;  4DK6 C;  3PCO B;  1QZH A;  1EQQ A;  3CC4 A;  1NY4 A;  3J80 i;  1IL2 A;  1XNR Q;  1EQR A;  1WFQ A;  2K52 A;  5IE8 A;  3EBE A;  2Q2U A;  4IFD J;  2L15 A;  4GLA C;  3EN2 A;  3HOX G;  2UUC Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...