5C4XG

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/rna/dna
total genus 28
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c4xG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c4xG01
1VS0A 3GTQH 4X65L 1X6OA 4YCVA 1HR0Q 4LF8L 1SMXA 4RG1A 1X56A 5HGQA 3I56A 1Q81C 4ALPA 1XMQL 3NEMA 1AH9A 2VQEQ 3EBEA 4GLXA 2KCTA 1PH1A 3CP0A 1NJIC 2UUCQ 2ASBA 1TWHH 4DV2L 2ZJQA 3GO5A 4PMWA 1TWAH 1LYLA 2E2JH 3I4NH 3RZDH 3G4SA 4JBWA 3PO2G 2YTVA 4DV6L 1VQ5A 4QL5A 4A93H 2KCMA 3I4MH 1SROA 4IFDJ 4YHHQ 4DV5Q 3VDYA 2GN5A 1N8RC 2UXDL 1TWGH 1X54A 1VQFA 3OW2A 1J6QA 3HOZG 4DR2L 4A3MH 1IZ6A 4BY7H 1KXLA 2PI2E 3E0EA 2JA8G 3ICEA 3TEHB 3T1HL 5LMNW 5BR8Q 1X3GA 4OWXB 3I4NG 3CCVA 4JV5Q 4JI0L 3FP9A 2IY5B 1NTGA 3CCUA 1VQNA 3H3VH 5FLMH 5GAHC 4L5QA 1BBWA 4A93G 3CXCA 3I4MG 2EQSA 1VQPA 1EIYB 1YHBA 4DV1Q 1K83H 2I5MX 2Q2HA 1Q1BA 1MJCA 1SRUA 3W5OA 2E5LL 5H1SE 4AQYQ 2QGQA 3BJUA 4JC0A 3K80C 1CSPA 4JI1Q 5IE8A 4R1JA 2JQOA 1GKHA 2N8NA 1OTCA 3KFUA 4DV7Q 4BY7G 4P75A 2LXJA 4DK6C 4X62Q 4WJ3M 5M5YH 5C4XG 2PQAB 2HIXA 4LFCQ 4DR1L 1D8LA 5C0XJ 1PFSA 3PIPA 3CC4A 1L0WA 2AMCB 1BBUA 5FLMG 4AIMA 3CCEA 3CCLA 2VQFL 3CD6A 4DR6Q 5JJKA 3GTOH 1E24A 3J80c 4WJ4A 3JAMc 1EFWA 3J7A5 4X66L 4C2MH 4AYBG 3KJOA 1X3FA 2Q2TA 3PUYA 1FJGL 3I4OA 1JT8A 1KD1C 2K52A 5M3MH 1YIJA 3F1ZA 1N36L 4JOIC 4JI6L 4MNOA 4LF4L 3GTLH 1N34Q 5J3BA 2VL6A 1YVCA 2R7ZH 4P71A 4KHPL 2F52A 3TQYA 1KRTA 5IWAL 1S3OA 3UE0A 3CCQA 2UU9L 4POGA 4GN5A 3T1YL 1XNQL 3M85A 1VQAA 4B3TL 2UXBQ 1HZAA 4YWLA 4DR7L 1W3SA 1FVIA 3S1NH 2JA6H 3S16H 1QVGA 1VQBA 2IX0A 2I5HA 3D0FA 1XMOQ 2AWNA 2Q2UA 4JI2L 1KAWA 3L0OA 1K73C 2NN6I 4JI8Q 2B63H 2ZM6L 1EUJA 3CQZH 3CMAA 4DUYL 2R7ZG 4GKKL 1L2FA 2YTXA 4YWMA 4DUZQ 1M1KC 1VQEA 3KF8B 2JE6I 3M4QA 4HJAA 1P8LA 2ZTCA 1XPUA 3UE1A 1JB7A 3PCOB 1CUKA 2JA6G 1BKBA 3GDEA 1Y1VG 3JC66 3RLFA 1R9TH 1UE5A 4YWKA 1A0IA 5AJ3L 3J81j 4YY3Q 5LMNQ 4LF5Q 4JI7Q 2UUBQ 4JOIA 2F4VQ 5HY6A 3U4ZA 1IBLL 1NMFA 4DAMA 4HIKA 2OTLA 2YV5A 4OX9Q 1LM0A 2B63G 3S17H 4B3RQ 3EIVA 3UDGA 1X9NA 2K5HA 2E2HH 1I5FA 1UE1A 4JI3Q 5LMUQ 3CPWA 2KBNA 4FDBA 2A1AA 4UPAA 4AH6A 3J81i 1CSQA 3KDFB 5E7NA 1PH8A 2K50A 3NELA 1N33L 1VQGA 2CFMA 3NBHB 2VUMH 2N3SA 1YI2A 1VQCA 3UDFA 4JG2A 2R7FA 2CKZB 3PGZA 4A3BH 1NE3A 1A62A 2GVAA 5C3EH 3G6EA 3M3YH 1OXSC 4A3GH 1E1OA 2PQAA 3PUVA 4B3SQ 4OONA 2WAQG 4NXNL 1UEBA 5C0XG 2K4KA 3A74A 3K7UC 5GQOA 1I3QH 2CWAA 2WP8J 1EYGA 1YEZA 2A8VA 1UWVA 4IOCA 4X65Q 1V43A 2A19A 3AYHB 1HZBA 2VUMG 3CCMA 4LF6L 3ZJYC 1XMQQ 3HOZH 4LUZA 2OWOA 3KJPA 4A3KH 1UE7A 4A3BG 4GKJQ 1OXVA 5C3EG 4A3GG 5IYDH 3AFQA 2KHIA 4XIGS 3PUWA 1B70B 4DV6Q 2KENA 4A3DH 1VQIA 4A3JG 4A4IA 1I94L 3ER0A 4APVA 5FJ8H 4BBRH 1WCMH 4GLVB 3J80i 4L5TA 1VQ6A 2UXDQ 4BXXG 5C4JH 4DV3L 4GS3A 1O7IA 3BZKA 3STBD 2R93H 4DR2Q 1KHIA 3CPFA 2OQKA 4BA1I 4JBJA 4A3KG 3PUZA 1YJ9A 4JI4L 5C4XH 2ZJPA 1RL2A 4DR3L 4JI0Q 3EN2A 5IYDG 4A3DG 2VQEL 3RR5A 4A76A 3CMEA 2HHHL 2YTYA 4LW1A 2C35B 2UUCL 1IYJB 2RF4A 1TXYA 1WCMG 4BBRG 5FJ8G 4DR5Q 1A63A 3A0JA 1YITA 1YJNA 2BH2A 4K0KL 2BA1A 2WFWA 2E5LQ 2UUAL 4JYAL 4A3FG 4IFDI 2AWOA 2R7DA 2R93G 2NZOA 3M9BA 1U5KA 1K0RA 2IHFA 2AHOB 5IYCH 4B3MQ 4BY1H 3OTOL 3CC2A 4DR1Q 2MO1A 4OWTB 4JCVE 5DLQE 2PI2A 1GM5A 1SN8A 4GNXC 1IBML 1RIPA 4A3CH 1M90C 1Z9FA 3BU2A 3WWVA 3ULPA 3I7FA 1QZHA 1PH7A 1JMCA 4QQBX 2MNAA 1WFQA 4DV4L 4HJ8A 3HFZB 3HOYH 3S2HH 2N49A 4R4CA 2JA9A 3J7ZC 1OXXK 4LFBL 2RCNA 3KDFA 3DM3A 2NVTH 1BVSA 1FJGQ 5IYCG 1GVPA 4BY1G 4JI5L 1N36Q 3G71A 4AQYL 3TS0A 3GTKH 3S14H 1E1TA 3U50C 1EQRA 1NBWA 2JEAI 1K9MC 1HZCA 4JI6Q 3TS2A 4OO1I 4KI0A 4RMFA 4UP7A 3TRZA 3GTPH 5C0XI 2VS1A 4A3CG 5IWAQ 4KHPQ 4LFCL 2UU9Q 3GTMH 3OYYA 3PUXA 4DV0Q 3T1YQ 3PF5A 1W2BA 4IO9A 4B3TQ 1ASYA 1TWFH 4DR7Q 2OQ0A 4DK3C 5GAEC 1Q82C 3AFPA 3HOYG 1HZ9A 1AE2A 3HOVH 1PYSB 4P73A 1PH9A 3MXNB 4JBKA 3H0GH 1L1OC 1MKHA 1Y1VH 3PV0A 5GROA 3RN2A 1B8AA 3ULLA 2R92H 1SE8A 4QY7A 4UP9A 3CC7A 3RZOH 4BA2I 4JI2Q 3RNUA 1EIFA 2NVYH 2ZTDA 4LUVA 4UY8C 1IBKL 1CKNB 4O0AA 2ZM6Q 4DUYQ 4GKKQ 5GAGC 3M4PA 4YCUA 4Y52H 3RN5A 2ES2A 5ELOA 1QVFA 1N34L 1XNRL 1UE6A 2ATWA 4R4TA 2I5LX 3F2BA 1VQ7A 1VQMA 4GN3B 3HOVG 1PYBA 1QZGA 1EQQA 1N32Q 1C0AA 5JJIA 3H0GG 3A5UA 4L5SA 5IP9G 5EAYA 2R92G 2UXBL 4GN4B 4QGUA 3PIOA 5IP7H 3L2PA 1IBLQ 2RHSB 3CCJA 1DGSA 4QIWE 1G291 3HKZG 1HNWL 1XTDA 4GOPC 3CCRA 1QVCA 4LF9L 4DAYB 2IHEA 3KF6B 3S24A 3HKZE 3S2DH 1WJJA 5M3FG 1VQ8A 4JBMA 1KRSA 5M5WH 4GLAC 2N78A 2E8GA 4R4IA 4EQ5A 1KQSA 4Y7NH 1Q46A 2LXKA 4DUZL 1WI5A 2ALYB 1N33Q 4X64L 1HNXL 3Q8DA 1V1QA 5ELNA 1N9WA 3NENA 4ME3A 5IP7G 3U58A 2UXCL 2OTJA 1QUQB 4DR4L 4P72A 2BA0A 5JJLA 4LF5L 4A3EG 3PF4A 4A75A 3H3VI 4JI7L 1YJWA 3S1QH 3UDXA 1JE5A 4NXNQ 2JEBI 4C3JH 1J5EL 1VQJA 4A3JH 1HNZL 1Q1EA 1VQLA 1I6HH 5JEAG 4BXXH 1Z47A 5M5XH 4A3IH 4LF6Q 4LF8Q 2WB1E 1IXRA 4GNXB 2JK8A 1E22A 4P74A 3G48A 4DV2Q 2Y0SE 1CKMA 4EX5A 4LFAL 4R4OA 1GD7A 4KLKA 2Z6KC 2KHJA 2MQHA 4LF7L 4DPGA 4NXML 3F8TA 4C3IH 3KLWA 4DV3Q 3JAMi 1Y14B 1YZ6A 3GTGH 3HOWG 3PO3G 4UP8A 3HOXH 4A3IG 2NZHA 1T9HA 4IJLA 4A3FH 2DUDA 3CF5A 2YYZA 4HIDA 3T1HQ 1MIUA 1IL2A 1KL9A 2RHQB 4NB3A 4DR3Q 1MJEA 4JI4Q 1VQDA 2LSSA 3ULJA 1HR0L 1EWIA 3D31A 1TWCH 1PVOA 4TQUS 2HHHQ 2JA7H 2CQOA 4GKJL 2XGTA 1CKNA 1L1OB 3K0XA 2B29A 3M7NA 1VQ9A 1FGUA 2Q2IA 4MZ9A 2NN6G 4K0KQ 2UUAQ 4JYAQ 3HOXG 4POFA 1PH5A 2PMZE 1Y1WH 3F2DA 1Q86C 4X6AH 3DLLA 4YHHL 2NVQH 3J81c 3OTOQ 3I55A 4DV5L 1K8GA 1SR3A 1GO3E 1PHJA 1H95A 2Z6KA 1ASZA 2JA7G 1IBMQ 1XPOA 4L5RC 5IYBH 2I0QA 1WOCA 2VQFQ 3SGIA 5BR8L 4IPCA 5JEAJ 5K36G 1A8VA 2H5XA 3KF6A 4IPGA 3CAMA 1WYDA 2L15A 3A5ZB 2EXDA 3E9HA 4OXPA 2OCEA 5GADC 4DV4Q 2XTIA 3F2CA 1E7ZA 3AQQA 3W1BA 2E2IH 4DR5L 4X66Q 3FKIH 1Y1WG 4QJFA 4GOPB 1Q7YC 4OWWB 4IOAA 2GVBA 4LFBQ 2D0PA 4A3LH 4DV1L 1X65A 4JI5Q 3AEVA 2VNUD 1VQHA 4KHZA 4A3MG 2IX1A 4JI1L 1FL0A 3B6YA 2ZJRA 4JV5L 2YU9H 1QUQA 2Z0SA 4PZ7A 3MEFA 4IPDA 4DV7L 4LF4Q 4HJ7A 5IY0A 1JJCB 5IYBG 2F3IA 4X62L 1C7YA 4B3ML 1PA6A 2JA8H 3STBC 1PH2A 1XNQQ 2HT1A 3GD7A 5C44H 3LGJA 2NVXH 1CKOA 1G51A 5IT9c 3HOUH 3FKIG 4DR6L 2D0OA 4LWCA 1XPRA 4A3LG 3E9IA 4PZ8A 2R6GA 3I2ZA 5IP9H 3S15H 1S72A 2BH8A 2DGYA 1SLJA 4GNXA 1IBKQ 4TVAB 3S1MH 2CCZA 4AYBE 1HR0W 2ID0A 2MFIA 1U0LA 1S40A 1VQKA 4HIMA 4BBSH 1LUZA 4XTCS 3W1GA 2JA5H 5C44G 1XNRQ 5M3FH 4LNQA 1D7QA 1X55A 4MTNA 3HOUG 2V1CC 1YBYA 1NY4A 1YNXA 1PH6A 2K14A 4DV0L 1G6PA 5AJ3Q 4H02A 1VCIA 2K5VA 4NPSA 3K7AH 4LUOA 3L7ZC 2JJQA 1XJVA 2K5NA 2VY3A 1HNWQ 1JJGA 2FXQA 4HJ9A 4LF9Q 4A3EH 5M3MG 1XMOL 4BBSG 2VZAA 2JA5G 1P16A 3IRBA 5FLXc 4C3HH 4IPHA 4HJ5A 4JI8L 1L1OA 2CWPA 4O2DA 4X64Q 4HIOA 1HNXQ 1C9OA 2EIFA 1PV4A 1JJ2A 2D62A 2HIVA 4YCWA 1K3RA 1EOVA 4IJHA 2UXCQ 3TREA 3H15A 4DR4Q 1N32L 3UDIA 2K75A 2PNHA 4IFDG 3RLOA 4YY3L 5LMNL 1I50H 2UUBL 3S1RH 2F4VL 1YHQA 3U4VA 3RLNA 1J5EQ 1PH4A 1NMGA 1X3EA 2ZTEA 3CCSA 1OXTA 2VW9A 1KIXA 1V9PA 1YHAA 1HNZQ 1LTLA 4OX9L 4B3RL 1HH2P 2QEXA 4J15A 3PO3H 3HOWH 3GTJH 1E3PA 2WB1G 4JI3L 4DKAC 5LMUL 3HKSA 1Q8KA 1SFOH 1Q12A 2Y0SG 4GOPA 3KYHC 2QA4A 4LFAQ 2MO0A 1KC8C 1VQ4A 4PG3A 3BZCA 2HQLA 3ERSX 1I94Q 3M4OH 1VQOA 4R4QA 4DNIA 3KOJA 4LF7Q 4NXMQ 1OXUA 4OO1G 3CW2C 3PO2H 4B3SL 1PH3A 4PZ6A 3FHWA 3K81C 3K8AA 1HJPA 2WAQE 1B7YB 3PSIA 1AE3A 1K8AC 2B3GA 2IT1A 2AKWB
chains in the Genus database with same CATH superfamily
2ZJTA 1VS0A 3GTQH 2XVSA 3KHRA 4KD4A 4GKJH 1HR0Q 5HGQA 2Q8IB 3I56A 5IT9W 3GIIA 4RA8A 4RAUC 5C5MA 2N55A 2VQEQ 4GLXA 1PH1A 2ASBA 2R84A 4QMGA 5F9NA 3X3NA 5CAEB 3RZDH 5BPHA 4JBWA 3H6MA 4EYHB 2B39A 4DV6L 2GPSA 1NR2A 1EU4A 4A93H 2G9HD 1AN8A 2F0KA 3HP3A 2GN5A 5JQWA 1J6QA 2LMCB 4A3MH 1IZ6A 1XX8A 5FPOA 1GOZA 2JA8G 1STAA 3HBLA 2FJZA 1LO5D 4DF7A 4OWXB 3CCVA 3V6HA 4JI0L 2FINB 3CCUA 3H3VH 2XD4A 1ULZA 2CVRA 3BQ0A 4EEQA 4DV1H 5FLMH 4EG0A 4L5QA 5IGBA 1W6JA 1KLUD 1PFMA 3A56A 4DV1Q 2KEEA 2E5LL 3PW5A 1Q3LA 1OTCA 3PF4A 1CSPA 4ED8A 2JSOA 4R1JA 2N8NA 3NQTA 3R23A 1ET9A 4DK6C 5C4XG 5M5YH 2PQAB 5LP6F 4DR1L 1D8LA 4B08A 4LH7A 2IWHA 2W6MA 4DU9A 2SNSA 1BBUA 4H7BA 4F4WA 4DL2A 1EY5A 4HSVA 1TWHA 3CQZB 4PV1C 1KJIA 4DL5A 3J7A5 2FK3A 4X66L 1QILA 4AYBG 1LTID 3KJOA 2WKDA 4ILWA 2Q2TA 5DQHA 4IURA 3GLKA 3K58A 1FJGL 3GIPA 5M3MH 1YIJA 1CQJB 4MV8A 3H20A 1TWGA 2FMAA 1LTGD 4J9NA 4MAMA 3RV4A 4MNOA 2K5QA 2VL6A 3TDQA 1YVCA 3Q22A 2R7ZH 4MV7A 5IWAL 1XNQL 1S3OA 3M4YA 3CCQA 2UU9L 5GONF 2ENBA 3OIPA 3TSSA 3EPGA 2WAQB 4YWLA 1EUCB 1LTAD 1CHQD 5L1KA 2I5HA 3D0FA 4CKBA 5IGFA 3G7LA 3UI2A 4JI8H 4FU0A 2VUMB 5KFUA 1T3NA 3L0OA 4OIKA 3QZ7A 5A2QL 1UNNC 2NN6I 4JI8Q 3GV7B 4DUYL 4RGTA 3AU7A 4GKKL 4DUZQ 4YWMA 3JSNA 4O2AF 1D5MC 1TKWB 1HHVA 4YBZB 3M4QA 4O3RA 3UE1A 3E0JA 5IT9E 4CGYB 1ICWA 2OT2A 2F4VH 3RUPA 2JA6G 3GDEA 4XQNA 4YWKA 4TRDA 5AJ3L 5KFQA 1BUVT 1AW7A 2F4VQ 3RJ0A 3N6XA 1IBLL 1SBBB 4EBCA 4ZKCB 1AZQA 2JYOA 1E0BA 1DOKA 1TR5A 1HFGA 3NTIA 5DM63 1WR2A 5JVG3 4ECSA 4FDBA 1JWUD 4UPAA 5E7NA 2G5DA 1Y69U 2K50A 3NELA 1I4PA 4RUAA 3MR6A 5C4JB 2RDFA 1WTWA 4C5CA 3ND8A 4KJOA 4JG2A 4JVZA 1JOKA 1KAAA 4A3BH 2GVAA 1A62A 5D3IB 3G6EA 4EVOA 3N43B 5DG8A 1E1OA 2PQAA 5JVH3 5EWFA 2E2DC 3E5SA 2XC9A 2AGQA 4NXNL 3A7LA 3BDLA 2W8LA 1YEZA 5HV6A 1UWVA 3R5FA 2MUYA 2KHSA 2RGVA 1V43A 3CQZA 1SYFA 3CCMA 4LF6L 4A2AA 1S5CD 2OWOA 4DV6H 1SDFA 2F0JA 3MJFA 4EGJA 5C3EG 5EQ0A 1JWSD 1EIGA 1F9SA 3LNNA 4DV6Q 1B70B 4A3DH 4APVA 5FJ8H 4BBRH 1S5DD 1F9QA 4DV3L 5L1IA 2XRQD 2R93H 4I50F 2WAQA 2DLNA 4JI0H 3C46A 2KJXA 2OQKA 4JBJA 4C5AA 2EYLA 5C4XH 4FM9A 4JI0Q 2NVTB 2FK1A 4O2BF 2VUMA 2E74C 3Q8SB 4RWSC 1QWYA 3RR5A 3CMEA 3M9OB 4J9OA 1DXMA 2NTSA 2E5LH 2DPJA 5KG4A 1WCMG 5M9OA 1V1OA 3PQIA 4EGQA 3TQTA 2X0SA 5DQIA 1YJNA 4ZRZA 2BA1A 2WFWA 4BS9A 2E5LQ 1CT1D 4IFDI 2R7DA 1ZQ7A 4DR1H 2EXZA 1GUWA 1K0RA 3HOVB 2KEDA 2AHOB 3H0GB 4YJ3F 3OTOL 2BQ3A 4DR1Q 4YB8B 5CYUA 2R92B 5IIFA 4OWTB 5DLQE 1LT5D 1IBML 2NVYB 1M90C 4X66H 3RTXA 2KA7A 2W6OA 3WWVA 3ULPA 3I7FA 1JMCA 1UNSA 2MNAA 4DV4L 1V51A 5KG5A 1FJGH 4CBVA 5M3FB 3S2HH 4IUVA 2RKSA 2FP4B 4LFBL 1Q90A 1BVSA 1FJGQ 5IYCG 4BY1G 1SNCA 2BE5C 5IWAH 3U50C 2UU9H 4Q8FA 3V2TA 4ED1A 5KFYA 1XNQH 1CHPD 4OO1I 3GILA 3W3AA 5C0XI 5IWAQ 1ENAA 2UU9Q 4UDUC 4G7HC 2F0HA 1M4VA 1BF4A 1TWFH 1U4PA 2OQ0A 4DK3C 4EQOA 3HOYG 3AFPA 2M05A 1TY2A 1PH9A 1I4RA 1DD2A 1L1OC 3PV0A 4QY7A 4DUYH 4GKKH 4UP9A 2Q8RE 4K6DA 4BA2I 1JKJB 3OWEB 2ZTDA 4UY8C 3NTKA 1SAPA 1IBKL 4DUYQ 4GKKQ 4YCUA 4F4XA 5EBCA 5JOBA 3S1QB 2R7KA 1QVFA 2A6HC 2NU7B 1AFPA 1NSNS 4GN3B 1PTOH 5JJIA 1EQQA 4ED7A 1IBLH 4L5SA 1QG7A 1T36A 2HQEA 4GN4B 1LABA 3L2PA 1IBLQ 4N8X1 1BCPF 2A5HA 4QIWE 1G291 2A74C 2LKVA 5L1JA 5KG0A 4FYDA 2IHEA 3NGDA 3HKZE 1SCUB 1L0XB 4IQZA 1T5XD 1VQ8A 1KRSA 2B8GA 4EGVA 2N78A 4R4IA 5CV7A 4EQ5A 1KQSA 3K5OA 2ICIA 1WI5A 2ALYB 3DEOA 2PZWA 4X64L 2J4XA 4C3IB 3U58A 2PMZB 5IP7G 3GTGB 1I6UA 3HOXB 4DR4L 3FRPB 4J9RA 4NXNH 4LF5L 4A3EG 4WJWA 3H40A 1YJWA 4Q43A 3H0GA 4BWSC 3UDXA 3D8GA 1EWHA 3BVGA 1LT4D 4NXNQ 2R92A 2ASJA 2K5WA 1WTQA 3UQ8A 4FBTA 1HNZL 2UVRA 4LF6H 2NVYA 1D1KA 4CDFC 3N6RA 3BVZA 4LF6Q 4X3UA 4DV2H 3E5NA 4XYMB 4LSXA 1IXRA 4K8IA 3U9SA 1E22A 3RV3A 1D5XC 5EJWA 4DV2Q 2HDMA 4R4OA 3FEWX 2C5CA 4WD3A 3WOFA 5LOVF 1GD7A 4DV3H 1ZHSA 1EY8A 1WD1A 3GV6A 4LF7L 2WACA 4MV9A 4TQRA 4DV3Q 2NN6H 4A3IG 1KNEA 2NZHA 2R87A 5LL6b 2DUDA 2K01A 2E2IB 2Z4IA 3FKIB 1IL2A 1KL9A 4DN4M 1GUGA 4NB3A 1MJEA 4FF1A 1VQDA 4XYOA 1O75A 1II3A 1VKZA 1VBHA 2KCNA 1TWCH 3D31A 1LT6D 3PMFA 2JA7H 1TS5A 3Q8QB 4FP5D 2EJGC 1L1OB 1WTOA 5H80A 4QWEA 3ORRA 1XYIA 1NUCA 3OTOH 2BOSA 3BA8A 4IUNA 3HOUB 4X6AH 2NVQH 3OTOQ 3I55A 4DV5L 2MP1A 4JW0A 2VPSA 1IBMH 3T13A 1SR3A 1GO3E 1H95A 4CDDC 1Y8NB 4QIWB 1ASZA 2WV6D 1IBMQ 1S9FA 4DV4H 4GZYC 2DPIA 2PNRC 5BR8L 4IPCA 5K36G 3MA2B 4LFBH 3E9HA 4DV4Q 2R7NA 5C8YF 5GADC 2W7PA 5IYZF 1Y1WG 4QJFA 4LFBQ 2D0PA 1W93A 3D4RA 3P7JA 1X65A 2OEOA 4FVMA 1CFMA 5D3DA 4LF4H 4KHZA 2A6HD 2PMZA 3GTGA 2B2YA 2ZJRA 1BXTA 1VBGA 4PZ7A 4DV7L 4IPDA 4LF4Q 4HJ7A 5IY0A 4B3ML 2I8CA 1C7YA 1H9JA 1QOHA 3STBC 1PH2A 3GD7A 1YNJC 5IGCA 3GV3A 4IALA 5IT9c 3NPPA 5CV6A 2PBZA 3J7AF 1CK1A 3DXJC 3OSOA 4LWCA 4G7ZC 1IBKH 3F2UA 2R6GA 3I2ZA 1CTMA 4PZ8A 3FDSA 2BH8A 5I2YA 3J7YW 4KKTA 3KAJA 1IBKQ 4FS2A 3S1MH 2FK2A 4AYBE 4CC6A 2MFIA 2JA5H 5C44G 2CW0D 1H9KA 1X55A 2AQ1B 2EYMA 1YBYA 1STNA 1YNXA 2J0TD 4H02A 3I4LA 2P5ZX 4F50A 3T53B 2J6TA 4LUOA 3I91A 3L7ZC 3GTJB 4V190 4YR0A 5IT9L 1XJVA 3VR5A 1K8OA 2RDJA 2E2IA 4A3EH 4ZUJA 3FKIA 1H9MA 1XTCD 3TQ1A 2DN8A 4ECYA 1S0MA 3TMEA 4BBSG 4X64H 5EPKA 1P16A 3IRBA 1FYCA 2BDOA 5E1FA 3MC0B 3M4OB 4QWDA 1L1OA 4DR4H 4X64Q 3GIKA 1SMYD 1PV4A 1JJ2A 4LF5H 3HB9A 4YCWA 2XGQA 2MGSA 1BCPD 3TREA 1EZ8A 2DIKA 4DR4Q 1N32L 2F0WA 3VYUA 1B1ZA 1D5ZC 3UDIA 3MFYA 3RLOA 2DY8A 2VA2A 5I9OA 4YY3L 3SHLA 1JCKB 1HNZH 1YHQA 1TAEA 2CQYA 2K33A 3IL8A 1O7ZA 1V8QA 5CMDA 4O4HF 2F0OA 2J9GA 1X3EA 1KIXA 1HNZQ 2VW9A 4OX9L 2JA8B 3K0YA 2F0EA 1C4QA 4B3RL 2DWCA 2L4NA 1E3PA 2PYKA 1Q8KA 1SFOH 1G2TA 1N48A 2Y0SG 2W6ZA 4KV6A 5CV5A 3A8IE 5EKLA 4LF7H 5KFEA 2HQLA 3D6WA 1K3BC 2F3WA 4IZOA 4IN3A 4XQQA 4EQNA 3HRZC 4LF7Q 3CW2C 4JPBW 4L1KA 3K3PA 3K81C 3N41B 4TUYF 2RGRA 1HJPA 1K8AC 2IT1A 1SYXB 1S5FD 1F77A 4YCVA 4LF8L 1SMXA 4RG1A 1X56A 1Q81C 2VQDA 2XWBB 5KFWA 3EBEA 1NJIC 3M9NB 1I4XA 4AYBB 2ZJQA 3GO5A 4Y8VB 4M7EA 1TWAH 2BQUA 1F9PA 5K36H 1SXTA 3RBEA 1G91A 4I4TF 4YJ2F 1KJ8A 4DV5H 2W6NA 4HNVA 2KVMA 2KCMA 1TS4A 4DAVA 4ED0A 1SROA 4K2KA 2CHBD 4DV5Q 3VDYA 4IRDA 3GTOB 1X54A 2W8KA 5BR8H 3HOZG 3GTJA 3PVXA 4DXGA 1KEEA 4RKBA 4C2MB 5JPNC 5BR8Q 1X3GA 2F0GA 5AFWA 3OHBA 3FP9A 1NTGA 3P20A 5JUMA 1BBWA 5E4WC 1PRTF 3V05A 5I6WA 2EQSA 1VQPA 4A93G 3BDOA 4EEYA 1FNWA 1K83H 4DV7H 3DWQA 4B3MH 3VMMA 5H1SE 2RVLA 2B2WC 4AQYQ 3MFGA 1ET6A 3V6JA 2JQOA 3CKIB 5KG7A 4DV7Q 2BDNA 2V4RA 2JA6B 4RKLA 4HR7B 1TY0A 1TQOA 2ASDA 2K6AA 4IR9A 1WH2A 1BGWA 1GUSA 2ASLA 3PIPA 4RB0A 3CC4A 4RZQA 4R8UB 5FLMG 2AMCB 3VR2A 4AIMA 4WFN3 3CCEA 2VQFL 5JJKA 3J7AV 4NLGA 1E24A 1A6XA 1K1QA 2DZDA 3J80c 1E4EB 3MXPA 2C22A 1CZGA 1KDBA 2R7LA 4ZAIA 2NU8B 3PUYA 1N34H 4QWCA 1KD1C 1V4YA 5L9XA 4K2LA 1TIID 1JXLA 2W9BB 1SJED 3GTLH 1N34Q 5J3BA 1RJPA 4P71A 1ESFA 1KRTA 3TQYA 3X3MA 3S17B 4GN5A 1EZ6A 3GP7A 3M85A 3T1YL 1JIHA 4UCVA 4V0BA 2XWJB 1FVIA 3S1NH 3S16H 1QVGA 1PRTC 2H4OA 1U4LA 2I46A 3HGBA 2AWNA 2KECA 2Z6BA 3J80L 2Q2UA 4JI2L 1KAWA 1K73C 2B63H 2R7ZG 4AYBA 2EYFA 4JV1A 3M3YB 1M1KC 5C3EB 1VQEA 4ED2A 4IUQA 1VAJA 1X3PA 4YY3H 3VR6A 1EEFD 1CUKA 4KK7A 3RBDA 1Y1VG 1R9TH 3J81j 5FO7B 1A0IA 1B9NA 3HG9A 4KY6A 4YY3Q 3BQ1A 4OX9H 4JOIA 3GTOA 4B3RH 4DAMA 4HIKA 2CQAA 2OTLA 1MI2A 2YV5A 4OX9Q 4O3OA 4B3RQ 1X9NA 1UC9A 2O5IC 4DL6A 3HS0C 2E2HH 3CPWA 4RCNA 2F0IA 1Z6HA 3OMGA 2RSNA 1CSQA 4Q8EA 1WCMB 3EQLC 1N33L 2CFMA 1DV1A 4DK1A 5BMVF 1VQCA 1EY9A 2JEIA 4R9WA 3K5HA 4ECXA 3PGZA 2JA6A 4X3SA 4A3GH 4HR7A 4HQ6A 2BR0A 2AQ2B 3ZYYX 4I7HA 4H13C 4NKLA 1GSOA 2K4KA 3A74A 4R8UA 4LF8H 3K7UC 1I3QH 1RTOA 2A8VA 3L4JA 3NE5B 1RODA 2YZMA 1IW7D 5COYA 3JSLA 3R2TA 2Z9HA 2HDLA 1G6ZA 3HOZH 4LUZA 1E4EA 3TBIB 2Z4HA 4A3KH 4A3BG 1MSGA 4GKJQ 2R8HA 3TP6A 4MHEA 2O2LD 5IYDH 3JAMW 5KT4A 4BY1B 4QWBA 2KENA 2IBKA 2W9BA 3DWPA 1STHA 2VA3A 3WOEA 1HPCA 2RSOA 1VQ6A 4BXXG 1B9MA 2W7OA 3BZKA 4FO2A 1LTRD 4PMCA 4X3KA 4PMBA 3C0FB 2Z1CA 3HOYB 3KLRA 1ZXTA 1YJ9A 3VYTA 2GPWA 1F2LA 4YAKB 5EKKA 4DR5H 4A3DG 3S14B 2HHHL 2YTYA 4LW1A 2UUCL 1HTPA 1PRTB 2RF4A 5FJ8G 4BBRG 4DR5Q 3GTPB 4YR3A 1YITA 4K0KL 2R93G 1IYUA 3PW7A 3SK4A 3M9BA 2KQ3A 1U5KA 5KFGA 1C8CA 4U673 3SDZA 2IHFA 1AP0A 4ZCKA 2V4DA 3SK6A 5CBEE 3K5LA 4LK1C 2HJWA 3KBXA 1GM5A 1SE4A 1SN8A 4GNXC 2W70A 1RIPA 4A3CH 2B2TA 3VYSA 4MV1A 3PZPA 3K5NA 4F4YA 4LJZC 4QQBX 4IUTA 4YP3A 2SNMA 3J7ZC 1DIKA 2P0AA 1WCMA 2F0QA 3W2DA 1PMRA 4DL4A 1F9RA 4HTHA 3TS0A 3GTKH 1EQRA 1M0WA 3R3OA 1HZCA 4J8QA 3VR4A 4KKUA 3TS2A 3T1YH 5I47A 4UP7A 3TRZA 4K6LA 1SNPA 4LFCL 3GTMH 1V1PB 3T1YQ 4HAEA 3R93A 1ASYA 2B2WA 2R85A 5GAEC 3T5LA 3G6XA 1HZ9A 1AE2A 1PYSB 4P73A 2VB2X 2YL2A 3MXNB 1Y1VH 4Y7NB 4JI2H 4ECTA 1B8AA 3ULLA 2EY5A 5HGTA 1SE8A 2F1MA 2K1BA 5CGKA 3S9WA 3RZOH 4JI2Q 3RUZA 1SNDA 1B44D 3M7GA 3M4PA 1KJJA 3P75A 3MFHA 3WNZA 3KLSA 4B9XA 2C9OA 2YS7A 4C3JB 2C2EA 1XNRL 2R8IA 2ALZA 3FMCA 4R4TA 2YZGA 3DWAA 3QB3A 4RFBA 4A3JB 2RQXA 3A5UA 1I6HB 5IP9G 1BBXC 4XQJA 2UXBL 4QGUA 1HFNA 3JAME 4XT1B 2WDTA 1YNNC 4A3IB 3CCJA 1DGSA 3P1HA 1PDQA 1QVCA 3K57A 1GXDC 3KF6B 3T4AC 3S2DH 1DOMA 1EZ1A 1N33H 4ZQIA 5M5WH 4GLAC 1NNXA 1I7NA 2E8GA 4QWAA 1Q46A 4YR2A 2LXKA 5JEAH 4DA2A 1N33Q 3GTPA 4OEMB 1HNXL 1I6VC 1V1QA 1N9WA 3NENA 5HURA 3SE7A 2OTJA 1QUQB 5IGEA 4A3FB 2BA0A 1B6RA 3ORQA 5A35A 4A75A 1FNUA 4QUFA 4JI7L 4O4LF 2UVWA 4RB1A 1HTLD 2D9UA 4RGMA 4TSSA 5D14A 4I7ZC 1JE5A 1SE2A 4M9UA 2FFKB 4C3HG 4O42A 2BCOA 3SR1A 1EWCA 3NWSA 1RJTA 4BXXH 1HUNA 2PZUA 5M5XH 5CORA 2MCTA 2B2UC 5KFFA 4NP5A 4GNXB 1Y1WB 4P74A 3BAAA 2NTTA 2Y0SE 2XIGA 1G2SA 4FF4A 2HVSA 4XXEA 4Q0YA 2G9DA 2K05A 4HCEA 4ZK9B 1LTTD 3PO3G 1MGSA 3HOWG 1V1PA 3JAMi 2CZGA 2R82A 4M8AA 3MXNA 3KBGA 3R8BA 2RHQB 1JR0D 2HHHH 2UUCH 2VPQA 2LSSA 1H9RA 4KD3A 2NYZD 3E6ZX 1G8ZD 1NR4A 3SI8A 4TQUS 2V58A 2NBFA 2HHHQ 2B2YC 3GIMA 4K0KH 1PLFA 3ONAB 2KUMA 2XGTA 1EIHA 3K0XA 1VQ9A 4J9QA 2Q2IA 2NN6G 4K0KQ 4CKEA 5C44B 4EBEA 1ZETA 2A6EC 1PH5A 2PMZE 1Q86C 2L11A 2RA4A 1ICFB 5KT2A 4RB3C 2IW3A 3S15B 2Z6KA 2JA7G 3KALA 1LLRD 4L5RC 3ERQA 5IYBH 1WOCA 3KF6A 4ODGA 4OXPA 4BBSB 2YRWA 3F2CA 3AQQA 3W1BA 5D1OB 4X66Q 2YCHA 2EY2A 2R3ZA 4IAJA 1Q7YC 4Z9CB 4FF3A 3I12A 3VPBA 2GVBA 4E4TA 5CC4A 3GIJA 2VNUD 1VQHA 1SYBA 2OH2A 4LFCH 1JE4A 2XCAA 3B6YA 3K7AB 3URYA 1GSAA 2YU9H 1QUQA 2A68C 3MEFA 4RAYA 1JJCB 2PPBC 2F3IA 4M1UB 4GC6A 1JDBB 1XNQQ 2EYOA 1MBYA 4ME6A 2W57A 3LGJA 3OHXC 2NVXH 1AUXA 1WD0A 4JUZA 3UFXB 5C4HA 5LXTF 3CRKC 4U6PA 3E9IA 5IP9H 1U9RA 4RH6A 1SYCA 1S5ED 5C6AA 4O4IF 1SEBD 3PR4A 5BN4A 4GNXA 3J81E 1TVXA 5FPRA 2Y0SB 3BG5A 1Y1WA 3TZDA 1XNRH 4G7OC 5KFVA 2ID0A 3TP7A 1B4OA 2R8KA 1U0LA 1S40A 4MTEA 4HIMA 1LUZA 1I50B 2EOTA 4RNMA 2ATLA 1EYZA 1XNRQ 1D7QA 2UXBH 5J2TF 3QFFA 1PH6A 1HQMC 3PR5B 5KFHA 5EWEA 4DV0L 3QWNA 5AJ3Q 4NPSA 1S0OA 3QOLA 3U9OA 4C5BA 1FGBD 3MXUA 3RB3A 1S10A 5KFZA 1EY0A 4Q44A 2UVUA 2EPBA 2JA5G 1HNXH 3NXWA 4C3HH 4IPHA 3EA6A 4HJ5A 2QF7A 3QG1A 4HIOA 1HNXQ 1IL8A 2EIFA 1O78A 1K3RA 4JI7H 2DY7A 1QNKA 1EL0A 2PNHA 4IFDG 4ZI7F 1S0NA 4QF4A 3GTQB 3RGZA 2UUBL 3S1RH 5ELFA 2K32A 5D65A 1HA6A 5LYJF 3U4VA 4K5WA 1SEIA 1PH4A 5KFKA 1NMGA 3CCSA 2RDHA 3TIIA 1HH2P 3N52A 3PO3H 3HOWH 3RZDB 3OSPA 2WB1G 4S3SA 5KFIA 4DKAC 3DEPA 5LMUL 3HKSA 1WTVA 5D1OA 4A93B 3T5HA 3KYHC 1J8IA 2MO0A 1KC8C 4IHJF 1M7JA 4A3MB 4LMYA 2L0CA 4J9KA 4K5VA 3CHBD 4R4QA 3RB0A 1OXUA 4OO1G 2JEGA 2F0TA 5BN5A 2MHVA 3PO2H 3JRXA 5FLXE 4B3SL 1O80A 3EVQA 2UVVA 5KKNB 3PSIA 3H4DA 2CW8A 1AE3A 3K5MA 2B3GA 1SJHD 2F0FA 2AKWB 4X65L 3GV5B 1X6OA 1KNAA 4TV9F 1XMQL 3NEMA 4C1NI 1A2UA 1RKNA 3CP0A 1TWHH 1GUNA 2Y0SA 4O3SA 1RCVD 2XSCA 2E2JH 2F0VA 3I4NH 2FKLA 3G4SA 5M5YB 4Q45A 2YTVA 1STGA 2BE5D 4XDXA 1VQ5A 1I50A 2BQRA 2B2UA 4QL5A 5KGUA 3I4MH 4RHSA 4IFDJ 1AZPA 1NAPA 1QCBD 1N8RC 1TWGH 3V6KA 1VQFA 1Y8OB 4BY7H 2ICEC 2PI2E 3SVMA 2SCUB 3T1HL 5L37A 5LMNW 5C1OA 3PIO3 5KRUA 2C00A 5EBDA 2IY5B 4J9SA 4NMZA 5M3MB 1FR3A 3LWBA 4F88A 4LH6A 5TSSA 3CXCA 2CW7A 5KT7A 2R7ZB 5C3XA 2QDLA 2I5MX 2Q2HA 1Q1BA 4CDCC 1MJCA 4A2BA 2QGQA 4JC0A 3H15A 2QDBA 3K80C 5IE8A 5DLGA 5DLFA 4I65A 3KFUA 1JLLB 4RGOS 2LXJA 5ELCA 5CA0F 1I3QA 1X3QA 4WJ3M 1Z2NX 4G3IA 2HIXA 3GTQA 5ISRA 5C0XJ 3CCLA 2IJ0A 3MWMA 4WJ4A 3JAMc 1EFWA 3C1EA 1L0YB 2V9WA 4ZQ3A 4JV0A 5J22A 1GYFA 2A69C 1I7LA 4HSPA 1SNOA 5IOCA 1RJQA 4ZUIA 3F1ZA 5I6YA 5CB4F 4JOIC 4DV0H 4KY5A 3SK5A 4XX0B 4JI6L 1B33N 1O7YA 2DJFC 1RYRA 3BZDB 4UCOA 1CQFA 2ATWA 3OUUA 1S4ZA 1BNCA 2Q8TA 4DR7L 4RB2C 1VQBA 2I80A 1TU2B 4IFDH 2F0NA 2WKCA 3TINA 3JAML 3E3XA 4KKSA 3PW0A 4ZYSA 2ZM6L 3CQZH 2F03A 4A3BB 2YTXA 4FXDA 4HJAA 3K3VA 3L3OC 1P8LA 2ZTCA 1XPUA 4ABNA 1JB7A 4DFAA 2J7ZA 2UUBH 3PCOB 1BKBA 4KTAA 2EDGA 2CCZA 3JC66 3RLFA 1UE5A 4LF5Q 1HA5A 3C2PA 4RU9A 4EBDA 2UUBQ 3OPOA 2WINB 5A2QE 3G8CA 5KFMA 3LX0A 4ECQA 5LMUH 4ECZA 1LM0A 2B63G 1PTOC 3EIVA 3UDGA 1EFID 4ZLTF 1SYDA 2K5HA 4OO1H 5JVLA 3RAXA 1I5FA 5C0XH 5LMUQ 1NCVA 4A3DB 2KBNA 1FD7D 2A1AA 4KN4C 4N9PA 1Z7TA 3HEJA 4BBRB 1ZYRC 2R7ZA 4IUPA 3GTMA 5FO9B 1VQGA 3NBHB 2VUMH 2K04A 2EY1A 4HCSA 1VDZA 3I8ZA 2R93B 4B3SH 2R7FA 5E4XA 2CKZB 1NE3A 5KFJA 1Y1VA 1OXSC 1RYSA 3PUVA 2GLTA 3H94A 5C4XB 4B3SQ 1RTNA 1UEBA 4MV6A 1PZKD 4X65H 3IN5A 3NTHA 1SE3A 3LWEA 2CWAA 2WP8J 1EYGA 4N9TA 1XMQH 4IOCA 4X65Q 3VPCA 2A19A 1HZBA 2V59A 4R8IA 3ZJYC 1XMQQ 5KFAA 1UE7A 3OUZA 5C1PA 4A3GG 2WIIB 5K2MA 4XIGS 2KHIA 4YAJB 3PUWA 4RNOA 1I94L 1EQTA 3ER0A 4ECVA 4L5TA 3TN2A 2HVQA 4CJ1B 2B2TC 3T56B 3D3RA 5C4JH 2OF1A 1O7IA 3STBD 3GIQA 3MWEA 4O1NA 1YNJD 1RDPD 3SK8A 1KHIA 4QCLA 1KBLA 3J7AK 4ZHQF 3A55A 1A3UA 3S2HB 1B2TA 1CZWA 4A3KG 1PYWD 2F0UA 3PUZA 1SSOA 4DR3L 3MWYW 5FK9C 2ZJPA 4JI4L 3EN2A 5IYDG 5EZYF 5DG7A 2VQEL 4F87A 2YS6A 1AEXA 2IL8A 3RMHA 1TXYA 2A69D 2LS01 1A15A 5LL6X 2RDGA 3A0JA 2R61A 1TA8A 2BH2A 1WTRA 1IOVA 1B04A 1KJQA 3FMAA 2UUAL 1ILQA 4JYAL 4QW9A 2W9CB 1TWFB 2LFNA 4FF2A 4OIJA 4B3MQ 2F4IA 2MO1A 5LA6F 4FNFA 2EYJA 2PI2A 3H09A 4KJNA 1E2ZA 1LTBD 3BU2A 1GUOA 2PO4A 1PH7A 2NUCA 1QZHA 5FOBB 1CQIB 3HFZB 1H9SB 2N49A 4ZKBB 1JX4A 1OXXK 1PTOB 1DOLA 2RCNA 3DM3A 2NVTH 3PW2A 4JI6H 1GVPA 4JI5L 3NBHA 3IAYA 2VUGA 1E1TA 1KDCA 1RJRA 3MXGA 4JI6Q 2R93A 4KI0A 4HNTA 4DR7H 4A3CG 1WSCA 1KABA 3OYYA 3PUXA 4PQXA 3OW7A 3PF5A 1W2BA 4G4KA 4DGZA 4DR7Q 3HOVH 2C2RA 3H0GH 4I7AA 4PNYA 2R92H 2O4XA 3Q23A 1RD9D 2ZM6H 3CC7A 1LTSD 1Z2OX 2NVYH 4LUVA 1CQVA 3RFCA 1B50A 2OXPA 2ZM6Q 3TP5A 1SYEA 4Y52H 3MZ5A 1RF2D 2ES2A 2A73B 2QK4A 1N32H 3A54A 3R2IA 5CV9A 2AGOA 2I5LX 1C0AA 2PW5A 1N32Q 5E3FA 1QZGA 2XIWA 2E76C 2ZXPA 3IKJA 4L63B 3Q2OA 2RHSB 2F0DA 5JVDF 4ME5A 1HNWL 3HKZG 5EOYA 5DEHA 1XTDA 4LF9L 3CCRA 2YZNA 4DAYB 1DYQA 2DJGC 1STBA 1A9XA 4LMQD 4JBMA 5KG6A 3H91A 1DCZA 3IFTA 3EJIA 4DUZL 4ME3A 1RK5A 5EDWA 4DLKA 1F2YA 2W9CA 4MN3A 1QB5D 5FKAC 5KIXA 1TWFA 2PN1A 5JJLA 1KJ9A 2V5AA 2PVPA 3N44B 5KFLA 1WTXA 3S1QH 1ZHQA 5KFTA 2I87A 1K8MA 1J5EL 2XCLA 1TWCB 2JN4A 3OIQA 2JA7B 5JEAG 5FO8B 4LF8Q 1H9SA 1B53A 2WB1E 4RUCA 2JK8A 1I94H 3G48A 3TP8A 5FD5A 4EX5A 1C48A 2X6LA 4LFAL 1JICA 4QW8A 2NVQB 4F4ZA 2DNEA 3LWUA 5KG2A 2ZDHA 2M9VA 2Z6KC 2MQHA 3WO1A 2R8JA 3F8TA 4C3IH 3KLWA 4IWXA 1Y14B 1YZ6A 3GTGH 2FB9A 4UP8A 3HOXH 2H1EA 4DR3H 4JI4H 1T9HA 3MVVA 4RNNA 3MR3A 4YQWA 2YYZA 4HIDA 2VQEH 1MIUA 4JI4Q 2FHTA 4DR3Q 1CI3M 3PW4A 4DXFA 3ULJA 1EWIA 3A8KE 5CR3A 3C1FA 1WVLA 2UUAH 3N40P 4JYAH 3BS1A 3KHHA 3BYYB 3M7NA 1FGUA 4GC7A 5KT6A 2UUAQ 1U4MA 4JYAQ 1GHJA 5EPJA 4POFA 3QO2A 3T16A 1RHPA 3F2DA 3Q6SA 2EJMA 1K1SA 4YHHL 1S03G 3EYYA 1QNUA 4F7XA 5LHY1 1E2WA 5F9LA 2VQFH 2PQEA 3KTMA 1EYAA 2AQ4A 1PRTD 5G3LF 4CJ0B 4R8NA 2I0QA 4EQPA 2VQFQ 3SGIA 3S1MB 5JEAJ 4DAYA 1F2ZA 4IPGA 3TIGA 1T5EA 1WYDA 2L15A 2EXDA 2JA5B 2XTIA 4JI5H 4N8FA 2E2IH 5KFDA 3FKIH 4A3LH 2X6GA 3BQ2A 3T5JA 4JI5Q 2AQ3B 4UAIA 3AEVA 1PX2A 1SYGA 2IX1A 4RAZA 4JI1L 1FL0A 2L9HA 4JV5L 4DL7A 2Z0SA 1GSHA 4OGQC 5IYBG 4X62L 1I4QA 1E4GT 1CE8A 1ML0D 4A3EB 1PA6A 3CVZA 2EE1A 4EFEA 1B3AA 2EYPA 2I07B 4K8JA 3MTSA 2AU0A 1CKOA 3HOUH 1TWCA 4FS1A 5T1IA 2JA7A 2VB3X 4DR6L 2QW7A 3V4ZA 2D0OA 1XPRA 5L1LA 2WB1B 2DGYA 1U4RA 2JEJA 4CDEC 2DNCA 1SLJA 4TVAB 4IUUA 4ECWA 2EZVA 1HR0W 2OLSA 4UFZA 3W1GA 1ZKOA 3EFXD 1EUDB 1K0SA 5EWGA 4LNQA 2V1CC 2NB0A 2O5JC 1VMCA 5KEEA 4G57A 1W96A 1HNWH 4LF9H 2AUKA 3C3LA 3H4BA 1D6EC 3HZXA 2VY3A 2MJ8A 1SFOB 1HNWQ 2FXQA 4HJ9A 4LF9Q 2R86A 1R4QB 2QKIC 1CS0A 1XMOL 1TS2A 4MV3A 4DUZH 3GIDA 2D2CC 2MPMA 3AMUA 3G6VA 4RZRA 1J9OA 2VOBA 4O2DA 3NQIA 4HN7A 2HIVA 1EOVA 4IJHA 4LSAA 2K75A 3OWFA 4UCUA 1JQYD 3WO0A 1J5EH 5DG9A 1E2VA 5LMNL 3GQCA 1R4PB 5DGAA 1JORA 1J5EQ 4WRDA 1OXTA 1V9PA 3J81W 1LTLA 5KFOA 1HXYD 4P2CB 2QEXA 1BNZA 1TWAB 1GJXA 3GTJH 4JI3L 3QIAA 4OHJA 3K59A 4LFAH 2JA5A 3R5HA 3ND9A 1Q12A 4MIUA 1VF5C 4C1NK 4LFAQ 2AGPA 3I73A 4PG3A 2FE3A 3BZCA 1VF7A 3K5IA 3SXHA 2IP4A 2W71A 1EEID 3M4OH 5KT3A 4U7CA 1VQOA 3KOJA 2FPIB 2NU6B 5T1GA 3BABA 3G6JB 5EKIA 1PH3A 1VMPA 5IGGA 3EPIA 3K8AA 4JK1C 5I4DA 4OELB 1JB3A 5EGTA 1Y8PB 2IA6A 2FPPB 1EY7A 4IWYA 1K83B 4ALPA 2WB1A 1AH9A 3MR2A 2JA8H 2KCTA 4YIJA 2UUCQ 2WE6A 3J80W 4DV2L 2JEFA 4UCRA 4PMWA 1LYLA 4MA0A 5J1ZA 3KHLA 4J9PA 3PO2G 4HNUA 1O7LA 4YHHH 2W6PA 3EROA 1L2ZA 1AN7A 3NHHA 1KTKA 4YHHQ 2UXDL 2RBMA 3OW2A 4APMA 3RIZA 4DR2L 4UHVA 1KXLA 5JJZA 3E0EA 5C4ZA 3ICEA 1XDNA 1BDOA 3DUZA 3TEHB 3IG0A 3KXYT 1SFOA 3A8JE 3I4NG 2NU9B 2B2VC 5I9PA 1VQNA 2Z8LA 5GAHC 3I4MG 1EIYB 3GTLB 5KX5F 5EPLA 4JI1H 4JV5H 1YHBA 5KFSA 1SRUA 3W5OA 2HT1A 3RD4A 4X62H 4HMJA 5FLXW 3BJUA 4JI1Q 4JV5Q 4DL3A 1GKHA 4BY7G 5G3LD 3H3VC 1AUVA 4P75A 3S1NB 3S16B 2C2DA 3RAQA 4X62Q 3RGXA 4LFCQ 4DR6H 5KYLA 1PFSA 5DAUA 1YNND 2K03A 1L0WA 5KYIA 3CD6A 3OOCA 5T14A 4DR6Q 2B63B 3GTOH 1TWAA 1ILPA 2ZT9C 2QYZA 2HUGA 2L12A 5CV4A 4XT3B 4C2MH 1D2BA 1SNMA 3FPUB 2YW2A 4O3QA 1X3FA 1JDEA 1R9TB 3I4OA 1JT8A 2K52A 1N36L 4TV8F 4TQSA 1CM9A 2HD3A 2TSSA 4LF4L 2CH4A 3DF7A 4NW2A 4KHPL 2F52A 4Q0FA 4NDXA 3UE0A 4POGA 2XN9C 4ECRA 3I90A 1BQQT 1VQAA 4B3TL 2UXBQ 2E2HB 1HZAA 1XMOH 1W3SA 2JA6H 4MTDA 1TT2A 2IX0A 3U9TA 4XZ3B 2JXMB 1XMOQ 3M9MB 2KCCA 5C5JA 1K83A 5KFNA 1S5BD 3NK9A 3K6OA 3Q8PB 3KHGA 1EUJA 2EJFC 3CMAA 4XYQA 1L2FA 4A3GB 3QJYA 3KF8B 2JE6I 5LMNH 1XXGA 3NP8A 4JV2A 5KNBA 2F0MA 1I3QB 3CRLC 3J80E 1UC8A 5LMNQ 5F2DA 4JI7Q 5HY6A 3U4ZA 1NMFA 3HOZB 4JI3H 2K5DA 3S17H 4A3KB 2XRSD 3AB9A 3JRWA 2C28A 3MHBA 1UE1A 4JI3Q 2M00A 3WDNA 1EYCA 3V96A 4AH6A 3J81i 3D6CA 3GTLA 3KDFB 1PH8A 4DNRB 2PCFB 3RB4A 2N3SA 4UCTA 1YI2A 2CW0C 4L6TB 4CHTB 3UDFA 2A6ED 4QB4A 1IHZA 5JPMC 4WORA 3M3YH 5C3EH 2R6FA 1PZJD 4OONA 2WAQG 1E4FT 5C0XG 5J2UF 5GQOA 3N42B 2FLNA 2B63A 3AYHB 2VUMG 5CV8A 3I72A 2YRXA 1M6VA 3KJPA 2IPKD 1OXVA 1QJOA 1R9TA 1SMYC 3AFQA 4C3JG 3QOJA 1BCPC 2XNAC 5A2QW 1VQIA 3KLSX 4A4IA 4A3JG 2UXDH 4J9LA 2A68D 5KFBA 2KOLA 1WCMH 4GLVB 3J80i 1PK8A 4DR2H 2K28A 5D1PA 3OHAA 1FNVA 2UXDQ 5CBAE 1W6KA 4GS3A 5KT5A 1D1IA 4O3NA 2E2HA 4DR2Q 1OWTA 3CPFA 4BA1I 1I4GA 2N88A 1RL2A 3SEBA 4B9WA 4A76A 3GTKB 3LP8A 1EOTA 2C35B 1ENFA 1IYJB 3GQBA 5DM73 1A63A 2VR1A 1ESRA 4H0LC 3MR5A 3GTMB 2J6SA 3KF8A 4RGNA 2ZDGA 2GA4B 2JP1A 4ED3A 4U68A 1FKAH 4A3FG 2AWOA 2SEBD 3F8NA 2NZOA 4DNTB 1GUTA 5KFCA 2WTFA 2NZ1D 5IYCH 4BY1H 1Y1VB 3O13A 3QR8A 3CC2A 1EHIA 4ECUA 4ID6A 3RB6A 3BYTB 2FLLA 4JCVE 3RZOB 1GHKA 3HKZB 1Z9FA 2YYAA 1Q8IA 3I3CA 3QZ8A 5FD6A 2QEJC 2V4QA 1S68A 3Q24A 1WFQA 4HJ8A 3HOYH 1N36H 4R4CA 5LL6S 3VR3A 2JA9A 4RCOA 1K28A 3KDFA 5JAVA 3V4SA 1PTOF 1JWMD 4C56C 3G71A 4AQYL 1N36Q 2B2VA 3S14H 4KHPH 3MEHA 1T94A 1NBWA 2JEAI 3T51B 1K9MC 4EYIB 1HCZA 1N56A 4B3TH 1C3OA 4RMFA 3GTPH 4KHPQ 2VS1A 1WTHA 5HBRB 1PXUA 3BG3A 4DV0Q 2FPGB 1DONA 4IO9A 4B3TQ 2L5TA 4F8MA 1B3QA 5KNDA 3ETHA 3S2DB 2W6QA 1Q82C 5DQGA 3PN1A 2W9AA 5M5WB 1M0TA 2R7MA 1RK6A 4CJ2C 4JBKA 3MWDA 1MKHA 5GROA 3RN2A 4I55F 1GGOA 3OMCA 3RNUA 5DNFA 1EIFA 1S97A 4K5XA 2ZXOA 1CKNB 4O0AA 5GAGC 3RN5A 2F3VA 4EFBA 4PDBA 5ELOA 4IRCA 1N34L 1UE6A 1VQ7A 3F2BA 1VQMA 2VXWA 5J39A 1PYBA 3HOVG 1IYVA 4KY7A 1F2MA 3H0GG 5KFRA 5EAYA 2R92G 1EQVA 3PIOA 1STYA 1BCPB 2EYHA 5IP7H 2FJ2A 1PZID 1UEAB 4X3TA 5M5XB 1A3TA 3FPPA 2RDIA 2EVBA 1PFNA 5C5LA 4GOPC 2QILA 1LV9A 1BJTA 1DM0B 4O3PA 3S24A 1WJJA 5M3FG 3BVMA 3Q0AA 3GTKA 1I4HA 4Y7NH 1HRJA 4CKCA 2PW7A 3KUPA 2SDFA 4KN7C 1HQRD 3Q8DA 3KAKA 5ELNA 4HMIA 2UXCL 2XGPA 3MFIA 3NWTA 4P72A 4TKOB 5KFXA 3KK7A 3H3VI 3DM1A 1ZEQX 4QUCA 4PWQA 2F0LA 3DHQA 5IODA 2JEBI 4C3JH 4QIWA 1VQJA 1SNQA 4A3JH 1Q1EA 1VQLA 3BA9A 2RCFA 1I6HH 2FLPA 3HKZA 3PIP3 5KG1A 1EY6A 2M2LA 4CC5A 2ZDQA 1Z47A 4R7RA 4J0MA 4A3IH 1B6SA 4IR1A 3D4WA 1CKMA 3GV8B 2NWGA 4UCSA 4J1MA 4KLKA 3VYRA 4ULLA 4KMUC 1XWEA 2KHJA 2PZTA 4DPGA 4NXML 5K5PA 2FMCA 3T1HH 2X69A 4J9MA 4A3FH 4IJLA 3CF5A 1X32A 3L4KA 3T1HQ 3G6YA 2SOBA 4E6IA 1HR0L 3Q8RB 1KDAA 1PVOA 2HGSA 2CQOA 4OL7A 2YU9B 4GKJL 1CKNA 5JH7F 2B29A 3BJYA 4C3IG 1PFBA 4MZ9A 4FXGC 5ELDA 1MD2D 5NUCA 4BWGB 4LAAA 3HOXG 3JZIA 5CA1F 1JOOA 2IMWP 2NVXB 1Y1WH 4HYKA 2R8GA 3IFDA 3DLLA 3J81c 2D5DA 1K8GA 4MA5A 1Z2PX 5KFPA 1PHJA 5ELEA 1DJRD 3BDCA 1XPOA 3VA5A 1M8AA 1GLVA 1A8VA 2H5XA 1IW7C 3CAMA 3A5ZB 3NUCA 2K7VA 2OCEA 3FVQA 1A2TA 1ENCA 1C30A 1E7ZA 2WYOA 4AQYH 4DR5L 2XCPA 1CA6A 1ONLA 4GOPB 4OWWB 4IOAA 4DV1L 2EY6A 4A3MG 3M4IA 1MZBA 1A3VA 1BOSA 4ED6A 3J81L 1CA5A 2NUAB 3Q1KA 3CU7A 5C44H 4RHRA 1G51A 4HEDA 3FKIG 4C3HB 1PTOD 4A3LG 1EYDA 3S15H 1IKLA 1S72A 1BR9A 2LY7A 1MSHA 2IX3A 1ZYRD 1VQKA 4BBSH 1MHWC 3NSWA 4XTCS 3S1RB 3HXLA 4K14A 5M3FH 2AUJD 4MTNA 3HOUG 1NY4A 2K14A 1G6PA 3R5XA 1WTPA 3DMUA 1BO0A 1VCIA 2K5VA 2ZXRA 4Q5VA 3T5KA 1KLGD 5I2XA 3K7AH 3PO3B 3HOWB 1HUMA 2JJQA 1LT3D 2K5NA 3ITPA 2TMPA 2O03A 3OSNA 2HCIA 1JJGA 4ETSA 4KHVA 3A7AB 5DGBA 2E75C 5IGDA 1OO9B 5M3MG 1LACA 3NBIA 5C3WA 2VZAA 1EU3A 3RF2A 5FLXc 2F0SA 1KC7A 2UXCH 2CH4W 3SE0A 4JI8L 2YU9A 5KNCA 2CWPA 1UUPA 4IZ8A 2HVRA 3D4DA 1C9OA 2D62A 2UXCQ 2FMMA 3PO2B 4J6HA 4ZOLF 1IOWA 4MTKA 2NVXA 1DZ1A 3FDTA 2B8FA 5D8DA 1I50H 2F4VL 3RLNA 2ZTEA 2QCPX 3ETJA 4C2MA 1YHAA 4FXKC 1TWHB 1STEA 2L55A 1JOQA 4J15A 2E2JB 4DK0A 3I4NB 2KSWA 3VA7A 5BN3A 5FLXL 2L1BA 4XYLB 3I70A 3I4MB 4GOPA 2QA4A 1TS3A 3VPDA 3TZUA 1EY4A 3L9AX 1VQ4A 1TWGB 1DV2A 4MV4A 5KG3A 3MAQA 1UAPA 4L8JA 4NXMH 3ERSX 1I94Q 4BY7B 1QE6A 2J6UA 3N8DA 4DNIA 4WBNF 3LMLA 4H44C 2HCCA 4NXMQ 4IRKA 5ELBA 4PZ6A 2F0PA 4FBUA 3FHWA 2WAQE 4DAPA 1B7YB 5BPFA 1HR0H 1BXRA 1IKMA 1JC7A
chains in the Genus database with same CATH topology
1VS0A 3GTQH 4X65L 1X6OA 4YCVA 1HR0Q 4LF8L 1SMXA 4RG1A 1X56A 5HGQA 3I56A 1Q81C 4ALPA 1XMQL 3NEMA 1AH9A 2VQEQ 3EBEA 4GLXA 2KCTA 1PH1A 3CP0A 1NJIC 2UUCQ 2ASBA 1TWHH 4DV2L 2ZJQA 3GO5A 4PMWA 1TWAH 1LYLA 2E2JH 3I4NH 3RZDH 3G4SA 4JBWA 3PO2G 2YTVA 4DV6L 1VQ5A 4QL5A 4A93H 2KCMA 3I4MH 1SROA 4IFDJ 4YHHQ 4DV5Q 3VDYA 2GN5A 1N8RC 2UXDL 1TWGH 1X54A 1VQFA 3OW2A 1J6QA 3HOZG 4DR2L 4A3MH 1IZ6A 4BY7H 1KXLA 2PI2E 3E0EA 2JA8G 3ICEA 3TEHB 3T1HL 5LMNW 5BR8Q 1X3GA 4OWXB 3I4NG 3CCVA 4JV5Q 4JI0L 3FP9A 2IY5B 1NTGA 3CCUA 1VQNA 3H3VH 5FLMH 5GAHC 4L5QA 1BBWA 4A93G 3CXCA 3I4MG 2EQSA 1VQPA 1EIYB 1YHBA 4DV1Q 1K83H 2I5MX 2Q2HA 1Q1BA 1MJCA 1SRUA 3W5OA 2E5LL 5H1SE 4AQYQ 2QGQA 3BJUA 4JC0A 3K80C 1CSPA 4JI1Q 5IE8A 4R1JA 2JQOA 1GKHA 2N8NA 1OTCA 3KFUA 4DV7Q 4BY7G 4P75A 2LXJA 4DK6C 4X62Q 4WJ3M 5M5YH 5C4XG 2PQAB 2HIXA 4LFCQ 4DR1L 1D8LA 5C0XJ 1PFSA 3PIPA 3CC4A 1L0WA 2AMCB 1BBUA 5FLMG 4AIMA 3CCEA 3CCLA 2VQFL 3CD6A 4DR6Q 5JJKA 3GTOH 1E24A 3J80c 4WJ4A 3JAMc 1EFWA 3J7A5 4X66L 4C2MH 4AYBG 3KJOA 1X3FA 2Q2TA 3PUYA 1FJGL 3I4OA 1JT8A 1KD1C 2K52A 5M3MH 1YIJA 3F1ZA 1N36L 4JOIC 4JI6L 4MNOA 4LF4L 3GTLH 1N34Q 5J3BA 2VL6A 1YVCA 2R7ZH 4P71A 4KHPL 2F52A 3TQYA 1KRTA 5IWAL 1S3OA 3UE0A 3CCQA 2UU9L 4POGA 4GN5A 3T1YL 1XNQL 3M85A 1VQAA 4B3TL 2UXBQ 1HZAA 4YWLA 4DR7L 1W3SA 1FVIA 3S1NH 2JA6H 3S16H 1QVGA 1VQBA 2IX0A 2I5HA 3D0FA 1XMOQ 2AWNA 2Q2UA 4JI2L 1KAWA 3L0OA 1K73C 2NN6I 4JI8Q 2B63H 2ZM6L 1EUJA 3CQZH 3CMAA 4DUYL 2R7ZG 4GKKL 1L2FA 2YTXA 4YWMA 4DUZQ 1M1KC 1VQEA 3KF8B 2JE6I 3M4QA 4HJAA 1P8LA 2ZTCA 1XPUA 3UE1A 1JB7A 3PCOB 1CUKA 2JA6G 1BKBA 3GDEA 1Y1VG 3JC66 3RLFA 1R9TH 1UE5A 4YWKA 1A0IA 5AJ3L 3J81j 4YY3Q 5LMNQ 4LF5Q 4JI7Q 2UUBQ 4JOIA 2F4VQ 5HY6A 3U4ZA 1IBLL 1NMFA 4DAMA 4HIKA 2OTLA 2YV5A 4OX9Q 1LM0A 2B63G 3S17H 4B3RQ 3EIVA 3UDGA 1X9NA 2K5HA 2E2HH 1I5FA 1UE1A 4JI3Q 5LMUQ 3CPWA 2KBNA 4FDBA 2A1AA 4UPAA 4AH6A 3J81i 1CSQA 3KDFB 5E7NA 1PH8A 2K50A 3NELA 1N33L 1VQGA 2CFMA 3NBHB 2VUMH 2N3SA 1YI2A 1VQCA 3UDFA 4JG2A 2R7FA 2CKZB 3PGZA 4A3BH 1NE3A 1A62A 2GVAA 5C3EH 3G6EA 3M3YH 1OXSC 4A3GH 1E1OA 2PQAA 3PUVA 4B3SQ 4OONA 2WAQG 4NXNL 1UEBA 5C0XG 2K4KA 3A74A 3K7UC 5GQOA 1I3QH 2CWAA 2WP8J 1EYGA 1YEZA 2A8VA 1UWVA 4IOCA 4X65Q 1V43A 2A19A 3AYHB 1HZBA 2VUMG 3CCMA 4LF6L 3ZJYC 1XMQQ 3HOZH 4LUZA 2OWOA 3KJPA 4A3KH 1UE7A 4A3BG 4GKJQ 1OXVA 5C3EG 4A3GG 5IYDH 3AFQA 2KHIA 4XIGS 3PUWA 1B70B 4DV6Q 2KENA 4A3DH 1VQIA 4A3JG 4A4IA 1I94L 3ER0A 4APVA 5FJ8H 4BBRH 1WCMH 4GLVB 3J80i 4L5TA 1VQ6A 2UXDQ 4BXXG 5C4JH 4DV3L 4GS3A 1O7IA 3BZKA 3STBD 2R93H 4DR2Q 1KHIA 3CPFA 2OQKA 4BA1I 4JBJA 4A3KG 3PUZA 1YJ9A 4JI4L 5C4XH 2ZJPA 1RL2A 4DR3L 4JI0Q 3EN2A 5IYDG 4A3DG 2VQEL 3RR5A 4A76A 3CMEA 2HHHL 2YTYA 4LW1A 2C35B 2UUCL 1IYJB 2RF4A 1TXYA 1WCMG 4BBRG 5FJ8G 4DR5Q 1A63A 3A0JA 1YITA 1YJNA 2BH2A 4K0KL 2BA1A 2WFWA 2E5LQ 2UUAL 4JYAL 4A3FG 4IFDI 2AWOA 2R7DA 2R93G 2NZOA 3M9BA 1U5KA 1K0RA 2IHFA 2AHOB 5IYCH 4B3MQ 4BY1H 3OTOL 3CC2A 4DR1Q 2MO1A 4OWTB 4JCVE 5DLQE 2PI2A 1GM5A 1SN8A 4GNXC 1IBML 1RIPA 4A3CH 1M90C 1Z9FA 3BU2A 3WWVA 3ULPA 3I7FA 1QZHA 1PH7A 1JMCA 4QQBX 2MNAA 1WFQA 4DV4L 4HJ8A 3HFZB 3HOYH 3S2HH 2N49A 4R4CA 2JA9A 3J7ZC 1OXXK 4LFBL 2RCNA 3KDFA 3DM3A 2NVTH 1BVSA 1FJGQ 5IYCG 1GVPA 4BY1G 4JI5L 1N36Q 3G71A 4AQYL 3TS0A 3GTKH 3S14H 1E1TA 3U50C 1EQRA 1NBWA 2JEAI 1K9MC 1HZCA 4JI6Q 3TS2A 4OO1I 4KI0A 4RMFA 4UP7A 3TRZA 3GTPH 5C0XI 2VS1A 4A3CG 5IWAQ 4KHPQ 4LFCL 2UU9Q 3GTMH 3OYYA 3PUXA 4DV0Q 3T1YQ 3PF5A 1W2BA 4IO9A 4B3TQ 1ASYA 1TWFH 4DR7Q 2OQ0A 4DK3C 5GAEC 1Q82C 3AFPA 3HOYG 1HZ9A 1AE2A 3HOVH 1PYSB 4P73A 1PH9A 3MXNB 4JBKA 3H0GH 1L1OC 1MKHA 1Y1VH 3PV0A 5GROA 3RN2A 1B8AA 3ULLA 2R92H 1SE8A 4QY7A 4UP9A 3CC7A 3RZOH 4BA2I 4JI2Q 3RNUA 1EIFA 2NVYH 2ZTDA 4LUVA 4UY8C 1IBKL 1CKNB 4O0AA 2ZM6Q 4DUYQ 4GKKQ 5GAGC 3M4PA 4YCUA 4Y52H 3RN5A 2ES2A 5ELOA 1QVFA 1N34L 1XNRL 1UE6A 2ATWA 4R4TA 2I5LX 3F2BA 1VQ7A 1VQMA 4GN3B 3HOVG 1PYBA 1QZGA 1EQQA 1N32Q 1C0AA 5JJIA 3H0GG 3A5UA 4L5SA 5IP9G 5EAYA 2R92G 2UXBL 4GN4B 4QGUA 3PIOA 5IP7H 3L2PA 1IBLQ 2RHSB 3CCJA 1DGSA 4QIWE 1G291 3HKZG 1HNWL 1XTDA 4GOPC 3CCRA 1QVCA 4LF9L 4DAYB 2IHEA 3KF6B 3S24A 3HKZE 3S2DH 1WJJA 5M3FG 1VQ8A 4JBMA 1KRSA 5M5WH 4GLAC 2N78A 2E8GA 4R4IA 4EQ5A 1KQSA 4Y7NH 1Q46A 2LXKA 4DUZL 1WI5A 2ALYB 1N33Q 4X64L 1HNXL 3Q8DA 1V1QA 5ELNA 1N9WA 3NENA 4ME3A 5IP7G 3U58A 2UXCL 2OTJA 1QUQB 4DR4L 4P72A 2BA0A 5JJLA 4LF5L 4A3EG 3PF4A 4A75A 3H3VI 4JI7L 1YJWA 3S1QH 3UDXA 1JE5A 4NXNQ 2JEBI 4C3JH 1J5EL 1VQJA 4A3JH 1HNZL 1Q1EA 1VQLA 1I6HH 5JEAG 4BXXH 1Z47A 5M5XH 4A3IH 4LF6Q 4LF8Q 2WB1E 1IXRA 4GNXB 2JK8A 1E22A 4P74A 3G48A 4DV2Q 2Y0SE 1CKMA 4EX5A 4LFAL 4R4OA 1GD7A 4KLKA 2Z6KC 2KHJA 2MQHA 4LF7L 4DPGA 4NXML 3F8TA 4C3IH 3KLWA 4DV3Q 3JAMi 1Y14B 1YZ6A 3GTGH 3HOWG 3PO3G 4UP8A 3HOXH 4A3IG 2NZHA 1T9HA 4IJLA 4A3FH 2DUDA 3CF5A 2YYZA 4HIDA 3T1HQ 1MIUA 1IL2A 1KL9A 2RHQB 4NB3A 4DR3Q 1MJEA 4JI4Q 1VQDA 2LSSA 3ULJA 1HR0L 1EWIA 3D31A 1TWCH 1PVOA 4TQUS 2HHHQ 2JA7H 2CQOA 4GKJL 2XGTA 1CKNA 1L1OB 3K0XA 2B29A 3M7NA 1VQ9A 1FGUA 2Q2IA 4MZ9A 2NN6G 4K0KQ 2UUAQ 4JYAQ 3HOXG 4POFA 1PH5A 2PMZE 1Y1WH 3F2DA 1Q86C 4X6AH 3DLLA 4YHHL 2NVQH 3J81c 3OTOQ 3I55A 4DV5L 1K8GA 1SR3A 1GO3E 1PHJA 1H95A 2Z6KA 1ASZA 2JA7G 1IBMQ 1XPOA 4L5RC 5IYBH 2I0QA 1WOCA 2VQFQ 3SGIA 5BR8L 4IPCA 5JEAJ 5K36G 1A8VA 2H5XA 3KF6A 4IPGA 3CAMA 1WYDA 2L15A 3A5ZB 2EXDA 3E9HA 4OXPA 2OCEA 5GADC 4DV4Q 2XTIA 3F2CA 1E7ZA 3AQQA 3W1BA 2E2IH 4DR5L 4X66Q 3FKIH 1Y1WG 4QJFA 4GOPB 1Q7YC 4OWWB 4IOAA 2GVBA 4LFBQ 2D0PA 4A3LH 4DV1L 1X65A 4JI5Q 3AEVA 2VNUD 1VQHA 4KHZA 4A3MG 2IX1A 4JI1L 1FL0A 3B6YA 2ZJRA 4JV5L 2YU9H 1QUQA 2Z0SA 4PZ7A 3MEFA 4IPDA 4DV7L 4LF4Q 4HJ7A 5IY0A 1JJCB 5IYBG 2F3IA 4X62L 1C7YA 4B3ML 1PA6A 2JA8H 3STBC 1PH2A 1XNQQ 2HT1A 3GD7A 5C44H 3LGJA 2NVXH 1CKOA 1G51A 5IT9c 3HOUH 3FKIG 4DR6L 2D0OA 4LWCA 1XPRA 4A3LG 3E9IA 4PZ8A 2R6GA 3I2ZA 5IP9H 3S15H 1S72A 2BH8A 2DGYA 1SLJA 4GNXA 1IBKQ 4TVAB 3S1MH 2CCZA 4AYBE 1HR0W 2ID0A 2MFIA 1U0LA 1S40A 1VQKA 4HIMA 4BBSH 1LUZA 4XTCS 3W1GA 2JA5H 5C44G 1XNRQ 5M3FH 4LNQA 1D7QA 1X55A 4MTNA 3HOUG 2V1CC 1YBYA 1NY4A 1YNXA 1PH6A 2K14A 4DV0L 1G6PA 5AJ3Q 4H02A 1VCIA 2K5VA 4NPSA 3K7AH 4LUOA 3L7ZC 2JJQA 1XJVA 2K5NA 2VY3A 1HNWQ 1JJGA 2FXQA 4HJ9A 4LF9Q 4A3EH 5M3MG 1XMOL 4BBSG 2VZAA 2JA5G 1P16A 3IRBA 5FLXc 4C3HH 4IPHA 4HJ5A 4JI8L 1L1OA 2CWPA 4O2DA 4X64Q 4HIOA 1HNXQ 1C9OA 2EIFA 1PV4A 1JJ2A 2D62A 2HIVA 4YCWA 1K3RA 1EOVA 4IJHA 2UXCQ 3TREA 3H15A 4DR4Q 1N32L 3UDIA 2K75A 2PNHA 4IFDG 3RLOA 4YY3L 5LMNL 1I50H 2UUBL 3S1RH 2F4VL 1YHQA 3U4VA 3RLNA 1J5EQ 1PH4A 1NMGA 1X3EA 2ZTEA 3CCSA 1OXTA 2VW9A 1KIXA 1V9PA 1YHAA 1HNZQ 1LTLA 4OX9L 4B3RL 1HH2P 2QEXA 4J15A 3PO3H 3HOWH 3GTJH 1E3PA 2WB1G 4JI3L 4DKAC 5LMUL 3HKSA 1Q8KA 1SFOH 1Q12A 2Y0SG 4GOPA 3KYHC 2QA4A 4LFAQ 2MO0A 1KC8C 1VQ4A 4PG3A 3BZCA 2HQLA 3ERSX 1I94Q 3M4OH 1VQOA 4R4QA 4DNIA 3KOJA 4LF7Q 4NXMQ 1OXUA 4OO1G 3CW2C 3PO2H 4B3SL 1PH3A 4PZ6A 3FHWA 3K81C 3K8AA 1HJPA 2WAQE 1B7YB 3PSIA 1AE3A 1K8AC 2B3GA 2IT1A 2AKWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VS0 A;  3GTQ H;  4X65 L;  1X6O A;  4YCV A;  1HR0 Q;  4LF8 L;  1SMX A;  4RG1 A;  1X56 A;  5HGQ A;  3I56 A;  1Q81 C;  4ALP A;  1XMQ L;  3NEM A;  1AH9 A;  2VQE Q;  3EBE A;  4GLX A;  2KCT A;  1PH1 A;  3CP0 A;  1NJI C;  2UUC Q;  2ASB A;  1TWH H;  4DV2 L;  2ZJQ A;  3GO5 A;  4PMW A;  1TWA H;  1LYL A;  2E2J H;  3I4N H;  3RZD H;  3G4S A;  4JBW A;  3PO2 G;  2YTV A;  4DV6 L;  1VQ5 A;  4QL5 A;  4A93 H;  2KCM A;  3I4M H;  1SRO A;  4IFD J;  4YHH Q;  4DV5 Q;  3VDY A;  2GN5 A;  1N8R C;  2UXD L;  1TWG H;  1X54 A;  1VQF A;  3OW2 A;  1J6Q A;  3HOZ G;  4DR2 L;  4A3M H;  1IZ6 A;  4BY7 H;  1KXL A;  2PI2 E;  3E0E A;  2JA8 G;  3ICE A;  3TEH B;  3T1H L;  5LMN W;  5BR8 Q;  1X3G A;  4OWX B;  3I4N G;  3CCV A;  4JV5 Q;  4JI0 L;  3FP9 A;  2IY5 B;  1NTG A;  3CCU A;  1VQN A;  3H3V H;  5FLM H;  5GAH C;  4L5Q A;  1BBW A;  4A93 G;  3CXC A;  3I4M G;  2EQS A;  1VQP A;  1EIY B;  1YHB A;  4DV1 Q;  1K83 H;  2I5M X;  2Q2H A;  1Q1B A;  1MJC A;  1SRU A;  3W5O A;  2E5L L;  5H1S E;  4AQY Q;  2QGQ A;  3BJU A;  4JC0 A;  3K80 C;  1CSP A;  4JI1 Q;  5IE8 A;  4R1J A;  2JQO A;  1GKH A;  2N8N A;  1OTC A;  3KFU A;  4DV7 Q;  4BY7 G;  4P75 A;  2LXJ A;  4DK6 C;  4X62 Q;  4WJ3 M;  5M5Y H;  5C4X G;  2PQA B;  2HIX A;  4LFC Q;  4DR1 L;  1D8L A;  5C0X J;  1PFS A;  3PIP A;  3CC4 A;  1L0W A;  2AMC B;  1BBU A;  5FLM G;  4AIM A;  3CCE A;  3CCL A;  2VQF L;  3CD6 A;  4DR6 Q;  5JJK A;  3GTO H;  1E24 A;  3J80 c;  4WJ4 A;  3JAM c;  1EFW A;  3J7A 5;  4X66 L;  4C2M H;  4AYB G;  3KJO A;  1X3F A;  2Q2T A;  3PUY A;  1FJG L;  3I4O A;  1JT8 A;  1KD1 C;  2K52 A;  5M3M H;  1YIJ A;  3F1Z A;  1N36 L;  4JOI C;  4JI6 L;  4MNO A;  4LF4 L;  3GTL H;  1N34 Q;  5J3B A;  2VL6 A;  1YVC A;  2R7Z H;  4P71 A;  4KHP L;  2F52 A;  3TQY A;  1KRT A;  5IWA L;  1S3O A;  3UE0 A;  3CCQ A;  2UU9 L;  4POG A;  4GN5 A;  3T1Y L;  1XNQ L;  3M85 A;  1VQA A;  4B3T L;  2UXB Q;  1HZA A;  4YWL A;  4DR7 L;  1W3S A;  1FVI A;  3S1N H;  2JA6 H;  3S16 H;  1QVG A;  1VQB A;  2IX0 A;  2I5H A;  3D0F A;  1XMO Q;  2AWN A;  2Q2U A;  4JI2 L;  1KAW A;  3L0O A;  1K73 C;  2NN6 I;  4JI8 Q;  2B63 H;  2ZM6 L;  1EUJ A;  3CQZ H;  3CMA A;  4DUY L;  2R7Z G;  4GKK L;  1L2F A;  2YTX A;  4YWM A;  4DUZ Q;  1M1K C;  1VQE A;  3KF8 B;  2JE6 I;  3M4Q A;  4HJA A;  1P8L A;  2ZTC A;  1XPU A;  3UE1 A;  1JB7 A;  3PCO B;  1CUK A;  2JA6 G;  1BKB A;  3GDE A;  1Y1V G;  3JC6 6;  3RLF A;  1R9T H;  1UE5 A;  4YWK A;  1A0I A;  5AJ3 L;  3J81 j;  4YY3 Q;  5LMN Q;  4LF5 Q;  4JI7 Q;  2UUB Q;  4JOI A;  2F4V Q;  5HY6 A;  3U4Z A;  1IBL L;  1NMF A;  4DAM A;  4HIK A;  2OTL A;  2YV5 A;  4OX9 Q;  1LM0 A;  2B63 G;  3S17 H;  4B3R Q;  3EIV A;  3UDG A;  1X9N A;  2K5H A;  2E2H H;  1I5F A;  1UE1 A;  4JI3 Q;  5LMU Q;  3CPW A;  2KBN A;  4FDB A;  2A1A A;  4UPA A;  4AH6 A;  3J81 i;  1CSQ A;  3KDF B;  5E7N A;  1PH8 A;  2K50 A;  3NEL A;  1N33 L;  1VQG A;  2CFM A;  3NBH B;  2VUM H;  2N3S A;  1YI2 A;  1VQC A;  3UDF A;  4JG2 A;  2R7F A;  2CKZ B;  3PGZ A;  4A3B H;  1NE3 A;  1A62 A;  2GVA A;  5C3E H;  3G6E A;  3M3Y H;  1OXS C;  4A3G H;  1E1O A;  2PQA A;  3PUV A;  4B3S Q;  4OON A;  2WAQ G;  4NXN L;  1UEB A;  5C0X G;  2K4K A;  3A74 A;  3K7U C;  5GQO A;  1I3Q H;  2CWA A;  2WP8 J;  1EYG A;  1YEZ A;  2A8V A;  1UWV A;  4IOC A;  4X65 Q;  1V43 A;  2A19 A;  3AYH B;  1HZB A;  2VUM G;  3CCM A;  4LF6 L;  3ZJY C;  1XMQ Q;  3HOZ H;  4LUZ A;  2OWO A;  3KJP A;  4A3K H;  1UE7 A;  4A3B G;  4GKJ Q;  1OXV A;  5C3E G;  4A3G G;  5IYD H;  3AFQ A;  2KHI A;  4XIG S;  3PUW A;  1B70 B;  4DV6 Q;  2KEN A;  4A3D H;  1VQI A;  4A3J G;  4A4I A;  1I94 L;  3ER0 A;  4APV A;  5FJ8 H;  4BBR H;  1WCM H;  4GLV B;  3J80 i;  4L5T A;  1VQ6 A;  2UXD Q;  4BXX G;  5C4J H;  4DV3 L;  4GS3 A;  1O7I A;  3BZK A;  3STB D;  2R93 H;  4DR2 Q;  1KHI A;  3CPF A;  2OQK A;  4BA1 I;  4JBJ A;  4A3K G;  3PUZ A;  1YJ9 A;  4JI4 L;  5C4X H;  2ZJP A;  1RL2 A;  4DR3 L;  4JI0 Q;  3EN2 A;  5IYD G;  4A3D G;  2VQE L;  3RR5 A;  4A76 A;  3CME A;  2HHH L;  2YTY A;  4LW1 A;  2C35 B;  2UUC L;  1IYJ B;  2RF4 A;  1TXY A;  1WCM G;  4BBR G;  5FJ8 G;  4DR5 Q;  1A63 A;  3A0J A;  1YIT A;  1YJN A;  2BH2 A;  4K0K L;  2BA1 A;  2WFW A;  2E5L Q;  2UUA L;  4JYA L;  4A3F G;  4IFD I;  2AWO A;  2R7D A;  2R93 G;  2NZO A;  3M9B A;  1U5K A;  1K0R A;  2IHF A;  2AHO B;  5IYC H;  4B3M Q;  4BY1 H;  3OTO L;  3CC2 A;  4DR1 Q;  2MO1 A;  4OWT B;  4JCV E;  5DLQ E;  2PI2 A;  1GM5 A;  1SN8 A;  4GNX C;  1IBM L;  1RIP A;  4A3C H;  1M90 C;  1Z9F A;  3BU2 A;  3WWV A;  3ULP A;  3I7F A;  1QZH A;  1PH7 A;  1JMC A;  4QQB X;  2MNA A;  1WFQ A;  4DV4 L;  4HJ8 A;  3HFZ B;  3HOY H;  3S2H H;  2N49 A;  4R4C A;  2JA9 A;  3J7Z C;  1OXX K;  4LFB L;  2RCN A;  3KDF A;  3DM3 A;  2NVT H;  1BVS A;  1FJG Q;  5IYC G;  1GVP A;  4BY1 G;  4JI5 L;  1N36 Q;  3G71 A;  4AQY L;  3TS0 A;  3GTK H;  3S14 H;  1E1T A;  3U50 C;  1EQR A;  1NBW A;  2JEA I;  1K9M C;  1HZC A;  4JI6 Q;  3TS2 A;  4OO1 I;  4KI0 A;  4RMF A;  4UP7 A;  3TRZ A;  3GTP H;  5C0X I;  2VS1 A;  4A3C G;  5IWA Q;  4KHP Q;  4LFC L;  2UU9 Q;  3GTM H;  3OYY A;  3PUX A;  4DV0 Q;  3T1Y Q;  3PF5 A;  1W2B A;  4IO9 A;  4B3T Q;  1ASY A;  1TWF H;  4DR7 Q;  2OQ0 A;  4DK3 C;  5GAE C;  1Q82 C;  3AFP A;  3HOY G;  1HZ9 A;  1AE2 A;  3HOV H;  1PYS B;  4P73 A;  1PH9 A;  3MXN B;  4JBK A;  3H0G H;  1L1O C;  1MKH A;  1Y1V H;  3PV0 A;  5GRO A;  3RN2 A;  1B8A A;  3ULL A;  2R92 H;  1SE8 A;  4QY7 A;  4UP9 A;  3CC7 A;  3RZO H;  4BA2 I;  4JI2 Q;  3RNU A;  1EIF A;  2NVY H;  2ZTD A;  4LUV A;  4UY8 C;  1IBK L;  1CKN B;  4O0A A;  2ZM6 Q;  4DUY Q;  4GKK Q;  5GAG C;  3M4P A;  4YCU A;  4Y52 H;  3RN5 A;  2ES2 A;  5ELO A;  1QVF A;  1N34 L;  1XNR L;  1UE6 A;  2ATW A;  4R4T A;  2I5L X;  3F2B A;  1VQ7 A;  1VQM A;  4GN3 B;  3HOV G;  1PYB A;  1QZG A;  1EQQ A;  1N32 Q;  1C0A A;  5JJI A;  3H0G G;  3A5U A;  4L5S A;  5IP9 G;  5EAY A;  2R92 G;  2UXB L;  4GN4 B;  4QGU A;  3PIO A;  5IP7 H;  3L2P A;  1IBL Q;  2RHS B;  3CCJ A;  1DGS A;  4QIW E;  1G29 1;  3HKZ G;  1HNW L;  1XTD A;  4GOP C;  3CCR A;  1QVC A;  4LF9 L;  4DAY B;  2IHE A;  3KF6 B;  3S24 A;  3HKZ E;  3S2D H;  1WJJ A;  5M3F G;  1VQ8 A;  4JBM A;  1KRS A;  5M5W H;  4GLA C;  2N78 A;  2E8G A;  4R4I A;  4EQ5 A;  1KQS A;  4Y7N H;  1Q46 A;  2LXK A;  4DUZ L;  1WI5 A;  2ALY B;  1N33 Q;  4X64 L;  1HNX L;  3Q8D A;  1V1Q A;  5ELN A;  1N9W A;  3NEN A;  4ME3 A;  5IP7 G;  3U58 A;  2UXC L;  2OTJ A;  1QUQ B;  4DR4 L;  4P72 A;  2BA0 A;  5JJL A;  4LF5 L;  4A3E G;  3PF4 A;  4A75 A;  3H3V I;  4JI7 L;  1YJW A;  3S1Q H;  3UDX A;  1JE5 A;  4NXN Q;  2JEB I;  4C3J H;  1J5E L;  1VQJ A;  4A3J H;  1HNZ L;  1Q1E A;  1VQL A;  1I6H H;  5JEA G;  4BXX H;  1Z47 A;  5M5X H;  4A3I H;  4LF6 Q;  4LF8 Q;  2WB1 E;  1IXR A;  4GNX B;  2JK8 A;  1E22 A;  4P74 A;  3G48 A;  4DV2 Q;  2Y0S E;  1CKM A;  4EX5 A;  4LFA L;  4R4O A;  1GD7 A;  4KLK A;  2Z6K C;  2KHJ A;  2MQH A;  4LF7 L;  4DPG A;  4NXM L;  3F8T A;  4C3I H;  3KLW A;  4DV3 Q;  3JAM i;  1Y14 B;  1YZ6 A;  3GTG H;  3HOW G;  3PO3 G;  4UP8 A;  3HOX H;  4A3I G;  2NZH A;  1T9H A;  4IJL A;  4A3F H;  2DUD A;  3CF5 A;  2YYZ A;  4HID A;  3T1H Q;  1MIU A;  1IL2 A;  1KL9 A;  2RHQ B;  4NB3 A;  4DR3 Q;  1MJE A;  4JI4 Q;  1VQD A;  2LSS A;  3ULJ A;  1HR0 L;  1EWI A;  3D31 A;  1TWC H;  1PVO A;  4TQU S;  2HHH Q;  2JA7 H;  2CQO A;  4GKJ L;  2XGT A;  1CKN A;  1L1O B;  3K0X A;  2B29 A;  3M7N A;  1VQ9 A;  1FGU A;  2Q2I A;  4MZ9 A;  2NN6 G;  4K0K Q;  2UUA Q;  4JYA Q;  3HOX G;  4POF A;  1PH5 A;  2PMZ E;  1Y1W H;  3F2D A;  1Q86 C;  4X6A H;  3DLL A;  4YHH L;  2NVQ H;  3J81 c;  3OTO Q;  3I55 A;  4DV5 L;  1K8G A;  1SR3 A;  1GO3 E;  1PHJ A;  1H95 A;  2Z6K A;  1ASZ A;  2JA7 G;  1IBM Q;  1XPO A;  4L5R C;  5IYB H;  2I0Q A;  1WOC A;  2VQF Q;  3SGI A;  5BR8 L;  4IPC A;  5JEA J;  5K36 G;  1A8V A;  2H5X A;  3KF6 A;  4IPG A;  3CAM A;  1WYD A;  2L15 A;  3A5Z B;  2EXD A;  3E9H A;  4OXP A;  2OCE A;  5GAD C;  4DV4 Q;  2XTI A;  3F2C A;  1E7Z A;  3AQQ A;  3W1B A;  2E2I H;  4DR5 L;  4X66 Q;  3FKI H;  1Y1W G;  4QJF A;  4GOP B;  1Q7Y C;  4OWW B;  4IOA A;  2GVB A;  4LFB Q;  2D0P A;  4A3L H;  4DV1 L;  1X65 A;  4JI5 Q;  3AEV A;  2VNU D;  1VQH A;  4KHZ A;  4A3M G;  2IX1 A;  4JI1 L;  1FL0 A;  3B6Y A;  2ZJR A;  4JV5 L;  2YU9 H;  1QUQ A;  2Z0S A;  4PZ7 A;  3MEF A;  4IPD A;  4DV7 L;  4LF4 Q;  4HJ7 A;  5IY0 A;  1JJC B;  5IYB G;  2F3I A;  4X62 L;  1C7Y A;  4B3M L;  1PA6 A;  2JA8 H;  3STB C;  1PH2 A;  1XNQ Q;  2HT1 A;  3GD7 A;  5C44 H;  3LGJ A;  2NVX H;  1CKO A;  1G51 A;  5IT9 c;  3HOU H;  3FKI G;  4DR6 L;  2D0O A;  4LWC A;  1XPR A;  4A3L G;  3E9I A;  4PZ8 A;  2R6G A;  3I2Z A;  5IP9 H;  3S15 H;  1S72 A;  2BH8 A;  2DGY A;  1SLJ A;  4GNX A;  1IBK Q;  4TVA B;  3S1M H;  2CCZ A;  4AYB E;  1HR0 W;  2ID0 A;  2MFI A;  1U0L A;  1S40 A;  1VQK A;  4HIM A;  4BBS H;  1LUZ A;  4XTC S;  3W1G A;  2JA5 H;  5C44 G;  1XNR Q;  5M3F H;  4LNQ A;  1D7Q A;  1X55 A;  4MTN A;  3HOU G;  2V1C C;  1YBY A;  1NY4 A;  1YNX A;  1PH6 A;  2K14 A;  4DV0 L;  1G6P A;  5AJ3 Q;  4H02 A;  1VCI A;  2K5V A;  4NPS A;  3K7A H;  4LUO A;  3L7Z C;  2JJQ A;  1XJV A;  2K5N A;  2VY3 A;  1HNW Q;  1JJG A;  2FXQ A;  4HJ9 A;  4LF9 Q;  4A3E H;  5M3M G;  1XMO L;  4BBS G;  2VZA A;  2JA5 G;  1P16 A;  3IRB A;  5FLX c;  4C3H H;  4IPH A;  4HJ5 A;  4JI8 L;  1L1O A;  2CWP A;  4O2D A;  4X64 Q;  4HIO A;  1HNX Q;  1C9O A;  2EIF A;  1PV4 A;  1JJ2 A;  2D62 A;  2HIV A;  4YCW A;  1K3R A;  1EOV A;  4IJH A;  2UXC Q;  3TRE A;  3H15 A;  4DR4 Q;  1N32 L;  3UDI A;  2K75 A;  2PNH A;  4IFD G;  3RLO A;  4YY3 L;  5LMN L;  1I50 H;  2UUB L;  3S1R H;  2F4V L;  1YHQ A;  3U4V A;  3RLN A;  1J5E Q;  1PH4 A;  1NMG A;  1X3E A;  2ZTE A;  3CCS A;  1OXT A;  2VW9 A;  1KIX A;  1V9P A;  1YHA A;  1HNZ Q;  1LTL A;  4OX9 L;  4B3R L;  1HH2 P;  2QEX A;  4J15 A;  3PO3 H;  3HOW H;  3GTJ H;  1E3P A;  2WB1 G;  4JI3 L;  4DKA C;  5LMU L;  3HKS A;  1Q8K A;  1SFO H;  1Q12 A;  2Y0S G;  4GOP A;  3KYH C;  2QA4 A;  4LFA Q;  2MO0 A;  1KC8 C;  1VQ4 A;  4PG3 A;  3BZC A;  2HQL A;  3ERS X;  1I94 Q;  3M4O H;  1VQO A;  4R4Q A;  4DNI A;  3KOJ A;  4LF7 Q;  4NXM Q;  1OXU A;  4OO1 G;  3CW2 C;  3PO2 H;  4B3S L;  1PH3 A;  4PZ6 A;  3FHW A;  3K81 C;  3K8A A;  1HJP A;  2WAQ E;  1B7Y B;  3PSI A;  1AE3 A;  1K8A C;  2B3G A;  2IT1 A;  2AKW B; 
#chains in the Genus database with same CATH topology
 2ZJT A;  1VS0 A;  3GTQ H;  2XVS A;  3KHR A;  4KD4 A;  4GKJ H;  1HR0 Q;  5HGQ A;  2Q8I B;  3I56 A;  5IT9 W;  3GII A;  4RA8 A;  4RAU C;  5C5M A;  2N55 A;  2VQE Q;  4GLX A;  1PH1 A;  2ASB A;  2R84 A;  4QMG A;  5F9N A;  3X3N A;  5CAE B;  3RZD H;  5BPH A;  4JBW A;  3H6M A;  4EYH B;  2B39 A;  4DV6 L;  2GPS A;  1NR2 A;  1EU4 A;  4A93 H;  2G9H D;  1AN8 A;  2F0K A;  3HP3 A;  2GN5 A;  5JQW A;  1J6Q A;  2LMC B;  4A3M H;  1IZ6 A;  1XX8 A;  5FPO A;  1GOZ A;  2JA8 G;  1STA A;  3HBL A;  2FJZ A;  1LO5 D;  4DF7 A;  4OWX B;  3CCV A;  3V6H A;  4JI0 L;  2FIN B;  3CCU A;  3H3V H;  2XD4 A;  1ULZ A;  2CVR A;  3BQ0 A;  4EEQ A;  4DV1 H;  5FLM H;  4EG0 A;  4L5Q A;  5IGB A;  1W6J A;  1KLU D;  1PFM A;  3A56 A;  4DV1 Q;  2KEE A;  2E5L L;  3PW5 A;  1Q3L A;  1OTC A;  3PF4 A;  1CSP A;  4ED8 A;  2JSO A;  4R1J A;  2N8N A;  3NQT A;  3R23 A;  1ET9 A;  4DK6 C;  5C4X G;  5M5Y H;  2PQA B;  5LP6 F;  4DR1 L;  1D8L A;  4B08 A;  4LH7 A;  2IWH A;  2W6M A;  4DU9 A;  2SNS A;  1BBU A;  4H7B A;  4F4W A;  4DL2 A;  1EY5 A;  4HSV A;  1TWH A;  3CQZ B;  4PV1 C;  1KJI A;  4DL5 A;  3J7A 5;  2FK3 A;  4X66 L;  1QIL A;  4AYB G;  1LTI D;  3KJO A;  2WKD A;  4ILW A;  2Q2T A;  5DQH A;  4IUR A;  3GLK A;  3K58 A;  1FJG L;  3GIP A;  5M3M H;  1YIJ A;  1CQJ B;  4MV8 A;  3H20 A;  1TWG A;  2FMA A;  1LTG D;  4J9N A;  4MAM A;  3RV4 A;  4MNO A;  2K5Q A;  2VL6 A;  3TDQ A;  1YVC A;  3Q22 A;  2R7Z H;  4MV7 A;  5IWA L;  1XNQ L;  1S3O A;  3M4Y A;  3CCQ A;  2UU9 L;  5GON F;  2ENB A;  3OIP A;  3TSS A;  3EPG A;  2WAQ B;  4YWL A;  1EUC B;  1LTA D;  1CHQ D;  5L1K A;  2I5H A;  3D0F A;  4CKB A;  5IGF A;  3G7L A;  3UI2 A;  4JI8 H;  4FU0 A;  2VUM B;  5KFU A;  1T3N A;  3L0O A;  4OIK A;  3QZ7 A;  5A2Q L;  1UNN C;  2NN6 I;  4JI8 Q;  3GV7 B;  4DUY L;  4RGT A;  3AU7 A;  4GKK L;  4DUZ Q;  4YWM A;  3JSN A;  4O2A F;  1D5M C;  1TKW B;  1HHV A;  4YBZ B;  3M4Q A;  4O3R A;  3UE1 A;  3E0J A;  5IT9 E;  4CGY B;  1ICW A;  2OT2 A;  2F4V H;  3RUP A;  2JA6 G;  3GDE A;  4XQN A;  4YWK A;  4TRD A;  5AJ3 L;  5KFQ A;  1BUV T;  1AW7 A;  2F4V Q;  3RJ0 A;  3N6X A;  1IBL L;  1SBB B;  4EBC A;  4ZKC B;  1AZQ A;  2JYO A;  1E0B A;  1DOK A;  1TR5 A;  1HFG A;  3NTI A;  5DM6 3;  1WR2 A;  5JVG 3;  4ECS A;  4FDB A;  1JWU D;  4UPA A;  5E7N A;  2G5D A;  1Y69 U;  2K50 A;  3NEL A;  1I4P A;  4RUA A;  3MR6 A;  5C4J B;  2RDF A;  1WTW A;  4C5C A;  3ND8 A;  4KJO A;  4JG2 A;  4JVZ A;  1JOK A;  1KAA A;  4A3B H;  2GVA A;  1A62 A;  5D3I B;  3G6E A;  4EVO A;  3N43 B;  5DG8 A;  1E1O A;  2PQA A;  5JVH 3;  5EWF A;  2E2D C;  3E5S A;  2XC9 A;  2AGQ A;  4NXN L;  3A7L A;  3BDL A;  2W8L A;  1YEZ A;  5HV6 A;  1UWV A;  3R5F A;  2MUY A;  2KHS A;  2RGV A;  1V43 A;  3CQZ A;  1SYF A;  3CCM A;  4LF6 L;  4A2A A;  1S5C D;  2OWO A;  4DV6 H;  1SDF A;  2F0J A;  3MJF A;  4EGJ A;  5C3E G;  5EQ0 A;  1JWS D;  1EIG A;  1F9S A;  3LNN A;  4DV6 Q;  1B70 B;  4A3D H;  4APV A;  5FJ8 H;  4BBR H;  1S5D D;  1F9Q A;  4DV3 L;  5L1I A;  2XRQ D;  2R93 H;  4I50 F;  2WAQ A;  2DLN A;  4JI0 H;  3C46 A;  2KJX A;  2OQK A;  4JBJ A;  4C5A A;  2EYL A;  5C4X H;  4FM9 A;  4JI0 Q;  2NVT B;  2FK1 A;  4O2B F;  2VUM A;  2E74 C;  3Q8S B;  4RWS C;  1QWY A;  3RR5 A;  3CME A;  3M9O B;  4J9O A;  1DXM A;  2NTS A;  2E5L H;  2DPJ A;  5KG4 A;  1WCM G;  5M9O A;  1V1O A;  3PQI A;  4EGQ A;  3TQT A;  2X0S A;  5DQI A;  1YJN A;  4ZRZ A;  2BA1 A;  2WFW A;  4BS9 A;  2E5L Q;  1CT1 D;  4IFD I;  2R7D A;  1ZQ7 A;  4DR1 H;  2EXZ A;  1GUW A;  1K0R A;  3HOV B;  2KED A;  2AHO B;  3H0G B;  4YJ3 F;  3OTO L;  2BQ3 A;  4DR1 Q;  4YB8 B;  5CYU A;  2R92 B;  5IIF A;  4OWT B;  5DLQ E;  1LT5 D;  1IBM L;  2NVY B;  1M90 C;  4X66 H;  3RTX A;  2KA7 A;  2W6O A;  3WWV A;  3ULP A;  3I7F A;  1JMC A;  1UNS A;  2MNA A;  4DV4 L;  1V51 A;  5KG5 A;  1FJG H;  4CBV A;  5M3F B;  3S2H H;  4IUV A;  2RKS A;  2FP4 B;  4LFB L;  1Q90 A;  1BVS A;  1FJG Q;  5IYC G;  4BY1 G;  1SNC A;  2BE5 C;  5IWA H;  3U50 C;  2UU9 H;  4Q8F A;  3V2T A;  4ED1 A;  5KFY A;  1XNQ H;  1CHP D;  4OO1 I;  3GIL A;  3W3A A;  5C0X I;  5IWA Q;  1ENA A;  2UU9 Q;  4UDU C;  4G7H C;  2F0H A;  1M4V A;  1BF4 A;  1TWF H;  1U4P A;  2OQ0 A;  4DK3 C;  4EQO A;  3HOY G;  3AFP A;  2M05 A;  1TY2 A;  1PH9 A;  1I4R A;  1DD2 A;  1L1O C;  3PV0 A;  4QY7 A;  4DUY H;  4GKK H;  4UP9 A;  2Q8R E;  4K6D A;  4BA2 I;  1JKJ B;  3OWE B;  2ZTD A;  4UY8 C;  3NTK A;  1SAP A;  1IBK L;  4DUY Q;  4GKK Q;  4YCU A;  4F4X A;  5EBC A;  5JOB A;  3S1Q B;  2R7K A;  1QVF A;  2A6H C;  2NU7 B;  1AFP A;  1NSN S;  4GN3 B;  1PTO H;  5JJI A;  1EQQ A;  4ED7 A;  1IBL H;  4L5S A;  1QG7 A;  1T36 A;  2HQE A;  4GN4 B;  1LAB A;  3L2P A;  1IBL Q;  4N8X 1;  1BCP F;  2A5H A;  4QIW E;  1G29 1;  2A74 C;  2LKV A;  5L1J A;  5KG0 A;  4FYD A;  2IHE A;  3NGD A;  3HKZ E;  1SCU B;  1L0X B;  4IQZ A;  1T5X D;  1VQ8 A;  1KRS A;  2B8G A;  4EGV A;  2N78 A;  4R4I A;  5CV7 A;  4EQ5 A;  1KQS A;  3K5O A;  2ICI A;  1WI5 A;  2ALY B;  3DEO A;  2PZW A;  4X64 L;  2J4X A;  4C3I B;  3U58 A;  2PMZ B;  5IP7 G;  3GTG B;  1I6U A;  3HOX B;  4DR4 L;  3FRP B;  4J9R A;  4NXN H;  4LF5 L;  4A3E G;  4WJW A;  3H40 A;  1YJW A;  4Q43 A;  3H0G A;  4BWS C;  3UDX A;  3D8G A;  1EWH A;  3BVG A;  1LT4 D;  4NXN Q;  2R92 A;  2ASJ A;  2K5W A;  1WTQ A;  3UQ8 A;  4FBT A;  1HNZ L;  2UVR A;  4LF6 H;  2NVY A;  1D1K A;  4CDF C;  3N6R A;  3BVZ A;  4LF6 Q;  4X3U A;  4DV2 H;  3E5N A;  4XYM B;  4LSX A;  1IXR A;  4K8I A;  3U9S A;  1E22 A;  3RV3 A;  1D5X C;  5EJW A;  4DV2 Q;  2HDM A;  4R4O A;  3FEW X;  2C5C A;  4WD3 A;  3WOF A;  5LOV F;  1GD7 A;  4DV3 H;  1ZHS A;  1EY8 A;  1WD1 A;  3GV6 A;  4LF7 L;  2WAC A;  4MV9 A;  4TQR A;  4DV3 Q;  2NN6 H;  4A3I G;  1KNE A;  2NZH A;  2R87 A;  5LL6 b;  2DUD A;  2K01 A;  2E2I B;  2Z4I A;  3FKI B;  1IL2 A;  1KL9 A;  4DN4 M;  1GUG A;  4NB3 A;  1MJE A;  4FF1 A;  1VQD A;  4XYO A;  1O75 A;  1II3 A;  1VKZ A;  1VBH A;  2KCN A;  1TWC H;  3D31 A;  1LT6 D;  3PMF A;  2JA7 H;  1TS5 A;  3Q8Q B;  4FP5 D;  2EJG C;  1L1O B;  1WTO A;  5H80 A;  4QWE A;  3ORR A;  1XYI A;  1NUC A;  3OTO H;  2BOS A;  3BA8 A;  4IUN A;  3HOU B;  4X6A H;  2NVQ H;  3OTO Q;  3I55 A;  4DV5 L;  2MP1 A;  4JW0 A;  2VPS A;  1IBM H;  3T13 A;  1SR3 A;  1GO3 E;  1H95 A;  4CDD C;  1Y8N B;  4QIW B;  1ASZ A;  2WV6 D;  1IBM Q;  1S9F A;  4DV4 H;  4GZY C;  2DPI A;  2PNR C;  5BR8 L;  4IPC A;  5K36 G;  3MA2 B;  4LFB H;  3E9H A;  4DV4 Q;  2R7N A;  5C8Y F;  5GAD C;  2W7P A;  5IYZ F;  1Y1W G;  4QJF A;  4LFB Q;  2D0P A;  1W93 A;  3D4R A;  3P7J A;  1X65 A;  2OEO A;  4FVM A;  1CFM A;  5D3D A;  4LF4 H;  4KHZ A;  2A6H D;  2PMZ A;  3GTG A;  2B2Y A;  2ZJR A;  1BXT A;  1VBG A;  4PZ7 A;  4DV7 L;  4IPD A;  4LF4 Q;  4HJ7 A;  5IY0 A;  4B3M L;  2I8C A;  1C7Y A;  1H9J A;  1QOH A;  3STB C;  1PH2 A;  3GD7 A;  1YNJ C;  5IGC A;  3GV3 A;  4IAL A;  5IT9 c;  3NPP A;  5CV6 A;  2PBZ A;  3J7A F;  1CK1 A;  3DXJ C;  3OSO A;  4LWC A;  4G7Z C;  1IBK H;  3F2U A;  2R6G A;  3I2Z A;  1CTM A;  4PZ8 A;  3FDS A;  2BH8 A;  5I2Y A;  3J7Y W;  4KKT A;  3KAJ A;  1IBK Q;  4FS2 A;  3S1M H;  2FK2 A;  4AYB E;  4CC6 A;  2MFI A;  2JA5 H;  5C44 G;  2CW0 D;  1H9K A;  1X55 A;  2AQ1 B;  2EYM A;  1YBY A;  1STN A;  1YNX A;  2J0T D;  4H02 A;  3I4L A;  2P5Z X;  4F50 A;  3T53 B;  2J6T A;  4LUO A;  3I91 A;  3L7Z C;  3GTJ B;  4V19 0;  4YR0 A;  5IT9 L;  1XJV A;  3VR5 A;  1K8O A;  2RDJ A;  2E2I A;  4A3E H;  4ZUJ A;  3FKI A;  1H9M A;  1XTC D;  3TQ1 A;  2DN8 A;  4ECY A;  1S0M A;  3TME A;  4BBS G;  4X64 H;  5EPK A;  1P16 A;  3IRB A;  1FYC A;  2BDO A;  5E1F A;  3MC0 B;  3M4O B;  4QWD A;  1L1O A;  4DR4 H;  4X64 Q;  3GIK A;  1SMY D;  1PV4 A;  1JJ2 A;  4LF5 H;  3HB9 A;  4YCW A;  2XGQ A;  2MGS A;  1BCP D;  3TRE A;  1EZ8 A;  2DIK A;  4DR4 Q;  1N32 L;  2F0W A;  3VYU A;  1B1Z A;  1D5Z C;  3UDI A;  3MFY A;  3RLO A;  2DY8 A;  2VA2 A;  5I9O A;  4YY3 L;  3SHL A;  1JCK B;  1HNZ H;  1YHQ A;  1TAE A;  2CQY A;  2K33 A;  3IL8 A;  1O7Z A;  1V8Q A;  5CMD A;  4O4H F;  2F0O A;  2J9G A;  1X3E A;  1KIX A;  1HNZ Q;  2VW9 A;  4OX9 L;  2JA8 B;  3K0Y A;  2F0E A;  1C4Q A;  4B3R L;  2DWC A;  2L4N A;  1E3P A;  2PYK A;  1Q8K A;  1SFO H;  1G2T A;  1N48 A;  2Y0S G;  2W6Z A;  4KV6 A;  5CV5 A;  3A8I E;  5EKL A;  4LF7 H;  5KFE A;  2HQL A;  3D6W A;  1K3B C;  2F3W A;  4IZO A;  4IN3 A;  4XQQ A;  4EQN A;  3HRZ C;  4LF7 Q;  3CW2 C;  4JPB W;  4L1K A;  3K3P A;  3K81 C;  3N41 B;  4TUY F;  2RGR A;  1HJP A;  1K8A C;  2IT1 A;  1SYX B;  1S5F D;  1F77 A;  4YCV A;  4LF8 L;  1SMX A;  4RG1 A;  1X56 A;  1Q81 C;  2VQD A;  2XWB B;  5KFW A;  3EBE A;  1NJI C;  3M9N B;  1I4X A;  4AYB B;  2ZJQ A;  3GO5 A;  4Y8V B;  4M7E A;  1TWA H;  2BQU A;  1F9P A;  5K36 H;  1SXT A;  3RBE A;  1G91 A;  4I4T F;  4YJ2 F;  1KJ8 A;  4DV5 H;  2W6N A;  4HNV A;  2KVM A;  2KCM A;  1TS4 A;  4DAV A;  4ED0 A;  1SRO A;  4K2K A;  2CHB D;  4DV5 Q;  3VDY A;  4IRD A;  3GTO B;  1X54 A;  2W8K A;  5BR8 H;  3HOZ G;  3GTJ A;  3PVX A;  4DXG A;  1KEE A;  4RKB A;  4C2M B;  5JPN C;  5BR8 Q;  1X3G A;  2F0G A;  5AFW A;  3OHB A;  3FP9 A;  1NTG A;  3P20 A;  5JUM A;  1BBW A;  5E4W C;  1PRT F;  3V05 A;  5I6W A;  2EQS A;  1VQP A;  4A93 G;  3BDO A;  4EEY A;  1FNW A;  1K83 H;  4DV7 H;  3DWQ A;  4B3M H;  3VMM A;  5H1S E;  2RVL A;  2B2W C;  4AQY Q;  3MFG A;  1ET6 A;  3V6J A;  2JQO A;  3CKI B;  5KG7 A;  4DV7 Q;  2BDN A;  2V4R A;  2JA6 B;  4RKL A;  4HR7 B;  1TY0 A;  1TQO A;  2ASD A;  2K6A A;  4IR9 A;  1WH2 A;  1BGW A;  1GUS A;  2ASL A;  3PIP A;  4RB0 A;  3CC4 A;  4RZQ A;  4R8U B;  5FLM G;  2AMC B;  3VR2 A;  4AIM A;  4WFN 3;  3CCE A;  2VQF L;  5JJK A;  3J7A V;  4NLG A;  1E24 A;  1A6X A;  1K1Q A;  2DZD A;  3J80 c;  1E4E B;  3MXP A;  2C22 A;  1CZG A;  1KDB A;  2R7L A;  4ZAI A;  2NU8 B;  3PUY A;  1N34 H;  4QWC A;  1KD1 C;  1V4Y A;  5L9X A;  4K2L A;  1TII D;  1JXL A;  2W9B B;  1SJE D;  3GTL H;  1N34 Q;  5J3B A;  1RJP A;  4P71 A;  1ESF A;  1KRT A;  3TQY A;  3X3M A;  3S17 B;  4GN5 A;  1EZ6 A;  3GP7 A;  3M85 A;  3T1Y L;  1JIH A;  4UCV A;  4V0B A;  2XWJ B;  1FVI A;  3S1N H;  3S16 H;  1QVG A;  1PRT C;  2H4O A;  1U4L A;  2I46 A;  3HGB A;  2AWN A;  2KEC A;  2Z6B A;  3J80 L;  2Q2U A;  4JI2 L;  1KAW A;  1K73 C;  2B63 H;  2R7Z G;  4AYB A;  2EYF A;  4JV1 A;  3M3Y B;  1M1K C;  5C3E B;  1VQE A;  4ED2 A;  4IUQ A;  1VAJ A;  1X3P A;  4YY3 H;  3VR6 A;  1EEF D;  1CUK A;  4KK7 A;  3RBD A;  1Y1V G;  1R9T H;  3J81 j;  5FO7 B;  1A0I A;  1B9N A;  3HG9 A;  4KY6 A;  4YY3 Q;  3BQ1 A;  4OX9 H;  4JOI A;  3GTO A;  4B3R H;  4DAM A;  4HIK A;  2CQA A;  2OTL A;  1MI2 A;  2YV5 A;  4OX9 Q;  4O3O A;  4B3R Q;  1X9N A;  1UC9 A;  2O5I C;  4DL6 A;  3HS0 C;  2E2H H;  3CPW A;  4RCN A;  2F0I A;  1Z6H A;  3OMG A;  2RSN A;  1CSQ A;  4Q8E A;  1WCM B;  3EQL C;  1N33 L;  2CFM A;  1DV1 A;  4DK1 A;  5BMV F;  1VQC A;  1EY9 A;  2JEI A;  4R9W A;  3K5H A;  4ECX A;  3PGZ A;  2JA6 A;  4X3S A;  4A3G H;  4HR7 A;  4HQ6 A;  2BR0 A;  2AQ2 B;  3ZYY X;  4I7H A;  4H13 C;  4NKL A;  1GSO A;  2K4K A;  3A74 A;  4R8U A;  4LF8 H;  3K7U C;  1I3Q H;  1RTO A;  2A8V A;  3L4J A;  3NE5 B;  1ROD A;  2YZM A;  1IW7 D;  5COY A;  3JSL A;  3R2T A;  2Z9H A;  2HDL A;  1G6Z A;  3HOZ H;  4LUZ A;  1E4E A;  3TBI B;  2Z4H A;  4A3K H;  4A3B G;  1MSG A;  4GKJ Q;  2R8H A;  3TP6 A;  4MHE A;  2O2L D;  5IYD H;  3JAM W;  5KT4 A;  4BY1 B;  4QWB A;  2KEN A;  2IBK A;  2W9B A;  3DWP A;  1STH A;  2VA3 A;  3WOE A;  1HPC A;  2RSO A;  1VQ6 A;  4BXX G;  1B9M A;  2W7O A;  3BZK A;  4FO2 A;  1LTR D;  4PMC A;  4X3K A;  4PMB A;  3C0F B;  2Z1C A;  3HOY B;  3KLR A;  1ZXT A;  1YJ9 A;  3VYT A;  2GPW A;  1F2L A;  4YAK B;  5EKK A;  4DR5 H;  4A3D G;  3S14 B;  2HHH L;  2YTY A;  4LW1 A;  2UUC L;  1HTP A;  1PRT B;  2RF4 A;  5FJ8 G;  4BBR G;  4DR5 Q;  3GTP B;  4YR3 A;  1YIT A;  4K0K L;  2R93 G;  1IYU A;  3PW7 A;  3SK4 A;  3M9B A;  2KQ3 A;  1U5K A;  5KFG A;  1C8C A;  4U67 3;  3SDZ A;  2IHF A;  1AP0 A;  4ZCK A;  2V4D A;  3SK6 A;  5CBE E;  3K5L A;  4LK1 C;  2HJW A;  3KBX A;  1GM5 A;  1SE4 A;  1SN8 A;  4GNX C;  2W70 A;  1RIP A;  4A3C H;  2B2T A;  3VYS A;  4MV1 A;  3PZP A;  3K5N A;  4F4Y A;  4LJZ C;  4QQB X;  4IUT A;  4YP3 A;  2SNM A;  3J7Z C;  1DIK A;  2P0A A;  1WCM A;  2F0Q A;  3W2D A;  1PMR A;  4DL4 A;  1F9R A;  4HTH A;  3TS0 A;  3GTK H;  1EQR A;  1M0W A;  3R3O A;  1HZC A;  4J8Q A;  3VR4 A;  4KKU A;  3TS2 A;  3T1Y H;  5I47 A;  4UP7 A;  3TRZ A;  4K6L A;  1SNP A;  4LFC L;  3GTM H;  1V1P B;  3T1Y Q;  4HAE A;  3R93 A;  1ASY A;  2B2W A;  2R85 A;  5GAE C;  3T5L A;  3G6X A;  1HZ9 A;  1AE2 A;  1PYS B;  4P73 A;  2VB2 X;  2YL2 A;  3MXN B;  1Y1V H;  4Y7N B;  4JI2 H;  4ECT A;  1B8A A;  3ULL A;  2EY5 A;  5HGT A;  1SE8 A;  2F1M A;  2K1B A;  5CGK A;  3S9W A;  3RZO H;  4JI2 Q;  3RUZ A;  1SND A;  1B44 D;  3M7G A;  3M4P A;  1KJJ A;  3P75 A;  3MFH A;  3WNZ A;  3KLS A;  4B9X A;  2C9O A;  2YS7 A;  4C3J B;  2C2E A;  1XNR L;  2R8I A;  2ALZ A;  3FMC A;  4R4T A;  2YZG A;  3DWA A;  3QB3 A;  4RFB A;  4A3J B;  2RQX A;  3A5U A;  1I6H B;  5IP9 G;  1BBX C;  4XQJ A;  2UXB L;  4QGU A;  1HFN A;  3JAM E;  4XT1 B;  2WDT A;  1YNN C;  4A3I B;  3CCJ A;  1DGS A;  3P1H A;  1PDQ A;  1QVC A;  3K57 A;  1GXD C;  3KF6 B;  3T4A C;  3S2D H;  1DOM A;  1EZ1 A;  1N33 H;  4ZQI A;  5M5W H;  4GLA C;  1NNX A;  1I7N A;  2E8G A;  4QWA A;  1Q46 A;  4YR2 A;  2LXK A;  5JEA H;  4DA2 A;  1N33 Q;  3GTP A;  4OEM B;  1HNX L;  1I6V C;  1V1Q A;  1N9W A;  3NEN A;  5HUR A;  3SE7 A;  2OTJ A;  1QUQ B;  5IGE A;  4A3F B;  2BA0 A;  1B6R A;  3ORQ A;  5A35 A;  4A75 A;  1FNU A;  4QUF A;  4JI7 L;  4O4L F;  2UVW A;  4RB1 A;  1HTL D;  2D9U A;  4RGM A;  4TSS A;  5D14 A;  4I7Z C;  1JE5 A;  1SE2 A;  4M9U A;  2FFK B;  4C3H G;  4O42 A;  2BCO A;  3SR1 A;  1EWC A;  3NWS A;  1RJT A;  4BXX H;  1HUN A;  2PZU A;  5M5X H;  5COR A;  2MCT A;  2B2U C;  5KFF A;  4NP5 A;  4GNX B;  1Y1W B;  4P74 A;  3BAA A;  2NTT A;  2Y0S E;  2XIG A;  1G2S A;  4FF4 A;  2HVS A;  4XXE A;  4Q0Y A;  2G9D A;  2K05 A;  4HCE A;  4ZK9 B;  1LTT D;  3PO3 G;  1MGS A;  3HOW G;  1V1P A;  3JAM i;  2CZG A;  2R82 A;  4M8A A;  3MXN A;  3KBG A;  3R8B A;  2RHQ B;  1JR0 D;  2HHH H;  2UUC H;  2VPQ A;  2LSS A;  1H9R A;  4KD3 A;  2NYZ D;  3E6Z X;  1G8Z D;  1NR4 A;  3SI8 A;  4TQU S;  2V58 A;  2NBF A;  2HHH Q;  2B2Y C;  3GIM A;  4K0K H;  1PLF A;  3ONA B;  2KUM A;  2XGT A;  1EIH A;  3K0X A;  1VQ9 A;  4J9Q A;  2Q2I A;  2NN6 G;  4K0K Q;  4CKE A;  5C44 B;  4EBE A;  1ZET A;  2A6E C;  1PH5 A;  2PMZ E;  1Q86 C;  2L11 A;  2RA4 A;  1ICF B;  5KT2 A;  4RB3 C;  2IW3 A;  3S15 B;  2Z6K A;  2JA7 G;  3KAL A;  1LLR D;  4L5R C;  3ERQ A;  5IYB H;  1WOC A;  3KF6 A;  4ODG A;  4OXP A;  4BBS B;  2YRW A;  3F2C A;  3AQQ A;  3W1B A;  5D1O B;  4X66 Q;  2YCH A;  2EY2 A;  2R3Z A;  4IAJ A;  1Q7Y C;  4Z9C B;  4FF3 A;  3I12 A;  3VPB A;  2GVB A;  4E4T A;  5CC4 A;  3GIJ A;  2VNU D;  1VQH A;  1SYB A;  2OH2 A;  4LFC H;  1JE4 A;  2XCA A;  3B6Y A;  3K7A B;  3URY A;  1GSA A;  2YU9 H;  1QUQ A;  2A68 C;  3MEF A;  4RAY A;  1JJC B;  2PPB C;  2F3I A;  4M1U B;  4GC6 A;  1JDB B;  1XNQ Q;  2EYO A;  1MBY A;  4ME6 A;  2W57 A;  3LGJ A;  3OHX C;  2NVX H;  1AUX A;  1WD0 A;  4JUZ A;  3UFX B;  5C4H A;  5LXT F;  3CRK C;  4U6P A;  3E9I A;  5IP9 H;  1U9R A;  4RH6 A;  1SYC A;  1S5E D;  5C6A A;  4O4I F;  1SEB D;  3PR4 A;  5BN4 A;  4GNX A;  3J81 E;  1TVX A;  5FPR A;  2Y0S B;  3BG5 A;  1Y1W A;  3TZD A;  1XNR H;  4G7O C;  5KFV A;  2ID0 A;  3TP7 A;  1B4O A;  2R8K A;  1U0L A;  1S40 A;  4MTE A;  4HIM A;  1LUZ A;  1I50 B;  2EOT A;  4RNM A;  2ATL A;  1EYZ A;  1XNR Q;  1D7Q A;  2UXB H;  5J2T F;  3QFF A;  1PH6 A;  1HQM C;  3PR5 B;  5KFH A;  5EWE A;  4DV0 L;  3QWN A;  5AJ3 Q;  4NPS A;  1S0O A;  3QOL A;  3U9O A;  4C5B A;  1FGB D;  3MXU A;  3RB3 A;  1S10 A;  5KFZ A;  1EY0 A;  4Q44 A;  2UVU A;  2EPB A;  2JA5 G;  1HNX H;  3NXW A;  4C3H H;  4IPH A;  3EA6 A;  4HJ5 A;  2QF7 A;  3QG1 A;  4HIO A;  1HNX Q;  1IL8 A;  2EIF A;  1O78 A;  1K3R A;  4JI7 H;  2DY7 A;  1QNK A;  1EL0 A;  2PNH A;  4IFD G;  4ZI7 F;  1S0N A;  4QF4 A;  3GTQ B;  3RGZ A;  2UUB L;  3S1R H;  5ELF A;  2K32 A;  5D65 A;  1HA6 A;  5LYJ F;  3U4V A;  4K5W A;  1SEI A;  1PH4 A;  5KFK A;  1NMG A;  3CCS A;  2RDH A;  3TII A;  1HH2 P;  3N52 A;  3PO3 H;  3HOW H;  3RZD B;  3OSP A;  2WB1 G;  4S3S A;  5KFI A;  4DKA C;  3DEP A;  5LMU L;  3HKS A;  1WTV A;  5D1O A;  4A93 B;  3T5H A;  3KYH C;  1J8I A;  2MO0 A;  1KC8 C;  4IHJ F;  1M7J A;  4A3M B;  4LMY A;  2L0C A;  4J9K A;  4K5V A;  3CHB D;  4R4Q A;  3RB0 A;  1OXU A;  4OO1 G;  2JEG A;  2F0T A;  5BN5 A;  2MHV A;  3PO2 H;  3JRX A;  5FLX E;  4B3S L;  1O80 A;  3EVQ A;  2UVV A;  5KKN B;  3PSI A;  3H4D A;  2CW8 A;  1AE3 A;  3K5M A;  2B3G A;  1SJH D;  2F0F A;  2AKW B;  4X65 L;  3GV5 B;  1X6O A;  1KNA A;  4TV9 F;  1XMQ L;  3NEM A;  4C1N I;  1A2U A;  1RKN A;  3CP0 A;  1TWH H;  1GUN A;  2Y0S A;  4O3S A;  1RCV D;  2XSC A;  2E2J H;  2F0V A;  3I4N H;  2FKL A;  3G4S A;  5M5Y B;  4Q45 A;  2YTV A;  1STG A;  2BE5 D;  4XDX A;  1VQ5 A;  1I50 A;  2BQR A;  2B2U A;  4QL5 A;  5KGU A;  3I4M H;  4RHS A;  4IFD J;  1AZP A;  1NAP A;  1QCB D;  1N8R C;  1TWG H;  3V6K A;  1VQF A;  1Y8O B;  4BY7 H;  2ICE C;  2PI2 E;  3SVM A;  2SCU B;  3T1H L;  5L37 A;  5LMN W;  5C1O A;  3PIO 3;  5KRU A;  2C00 A;  5EBD A;  2IY5 B;  4J9S A;  4NMZ A;  5M3M B;  1FR3 A;  3LWB A;  4F88 A;  4LH6 A;  5TSS A;  3CXC A;  2CW7 A;  5KT7 A;  2R7Z B;  5C3X A;  2QDL A;  2I5M X;  2Q2H A;  1Q1B A;  4CDC C;  1MJC A;  4A2B A;  2QGQ A;  4JC0 A;  3H15 A;  2QDB A;  3K80 C;  5IE8 A;  5DLG A;  5DLF A;  4I65 A;  3KFU A;  1JLL B;  4RGO S;  2LXJ A;  5ELC A;  5CA0 F;  1I3Q A;  1X3Q A;  4WJ3 M;  1Z2N X;  4G3I A;  2HIX A;  3GTQ A;  5ISR A;  5C0X J;  3CCL A;  2IJ0 A;  3MWM A;  4WJ4 A;  3JAM c;  1EFW A;  3C1E A;  1L0Y B;  2V9W A;  4ZQ3 A;  4JV0 A;  5J22 A;  1GYF A;  2A69 C;  1I7L A;  4HSP A;  1SNO A;  5IOC A;  1RJQ A;  4ZUI A;  3F1Z A;  5I6Y A;  5CB4 F;  4JOI C;  4DV0 H;  4KY5 A;  3SK5 A;  4XX0 B;  4JI6 L;  1B33 N;  1O7Y A;  2DJF C;  1RYR A;  3BZD B;  4UCO A;  1CQF A;  2ATW A;  3OUU A;  1S4Z A;  1BNC A;  2Q8T A;  4DR7 L;  4RB2 C;  1VQB A;  2I80 A;  1TU2 B;  4IFD H;  2F0N A;  2WKC A;  3TIN A;  3JAM L;  3E3X A;  4KKS A;  3PW0 A;  4ZYS A;  2ZM6 L;  3CQZ H;  2F03 A;  4A3B B;  2YTX A;  4FXD A;  4HJA A;  3K3V A;  3L3O C;  1P8L A;  2ZTC A;  1XPU A;  4ABN A;  1JB7 A;  4DFA A;  2J7Z A;  2UUB H;  3PCO B;  1BKB A;  4KTA A;  2EDG A;  2CCZ A;  3JC6 6;  3RLF A;  1UE5 A;  4LF5 Q;  1HA5 A;  3C2P A;  4RU9 A;  4EBD A;  2UUB Q;  3OPO A;  2WIN B;  5A2Q E;  3G8C A;  5KFM A;  3LX0 A;  4ECQ A;  5LMU H;  4ECZ A;  1LM0 A;  2B63 G;  1PTO C;  3EIV A;  3UDG A;  1EFI D;  4ZLT F;  1SYD A;  2K5H A;  4OO1 H;  5JVL A;  3RAX A;  1I5F A;  5C0X H;  5LMU Q;  1NCV A;  4A3D B;  2KBN A;  1FD7 D;  2A1A A;  4KN4 C;  4N9P A;  1Z7T A;  3HEJ A;  4BBR B;  1ZYR C;  2R7Z A;  4IUP A;  3GTM A;  5FO9 B;  1VQG A;  3NBH B;  2VUM H;  2K04 A;  2EY1 A;  4HCS A;  1VDZ A;  3I8Z A;  2R93 B;  4B3S H;  2R7F A;  5E4X A;  2CKZ B;  1NE3 A;  5KFJ A;  1Y1V A;  1OXS C;  1RYS A;  3PUV A;  2GLT A;  3H94 A;  5C4X B;  4B3S Q;  1RTN A;  1UEB A;  4MV6 A;  1PZK D;  4X65 H;  3IN5 A;  3NTH A;  1SE3 A;  3LWE A;  2CWA A;  2WP8 J;  1EYG A;  4N9T A;  1XMQ H;  4IOC A;  4X65 Q;  3VPC A;  2A19 A;  1HZB A;  2V59 A;  4R8I A;  3ZJY C;  1XMQ Q;  5KFA A;  1UE7 A;  3OUZ A;  5C1P A;  4A3G G;  2WII B;  5K2M A;  4XIG S;  2KHI A;  4YAJ B;  3PUW A;  4RNO A;  1I94 L;  1EQT A;  3ER0 A;  4ECV A;  4L5T A;  3TN2 A;  2HVQ A;  4CJ1 B;  2B2T C;  3T56 B;  3D3R A;  5C4J H;  2OF1 A;  1O7I A;  3STB D;  3GIQ A;  3MWE A;  4O1N A;  1YNJ D;  1RDP D;  3SK8 A;  1KHI A;  4QCL A;  1KBL A;  3J7A K;  4ZHQ F;  3A55 A;  1A3U A;  3S2H B;  1B2T A;  1CZW A;  4A3K G;  1PYW D;  2F0U A;  3PUZ A;  1SSO A;  4DR3 L;  3MWY W;  5FK9 C;  2ZJP A;  4JI4 L;  3EN2 A;  5IYD G;  5EZY F;  5DG7 A;  2VQE L;  4F87 A;  2YS6 A;  1AEX A;  2IL8 A;  3RMH A;  1TXY A;  2A69 D;  2LS0 1;  1A15 A;  5LL6 X;  2RDG A;  3A0J A;  2R61 A;  1TA8 A;  2BH2 A;  1WTR A;  1IOV A;  1B04 A;  1KJQ A;  3FMA A;  2UUA L;  1ILQ A;  4JYA L;  4QW9 A;  2W9C B;  1TWF B;  2LFN A;  4FF2 A;  4OIJ A;  4B3M Q;  2F4I A;  2MO1 A;  5LA6 F;  4FNF A;  2EYJ A;  2PI2 A;  3H09 A;  4KJN A;  1E2Z A;  1LTB D;  3BU2 A;  1GUO A;  2PO4 A;  1PH7 A;  2NUC A;  1QZH A;  5FOB B;  1CQI B;  3HFZ B;  1H9S B;  2N49 A;  4ZKB B;  1JX4 A;  1OXX K;  1PTO B;  1DOL A;  2RCN A;  3DM3 A;  2NVT H;  3PW2 A;  4JI6 H;  1GVP A;  4JI5 L;  3NBH A;  3IAY A;  2VUG A;  1E1T A;  1KDC A;  1RJR A;  3MXG A;  4JI6 Q;  2R93 A;  4KI0 A;  4HNT A;  4DR7 H;  4A3C G;  1WSC A;  1KAB A;  3OYY A;  3PUX A;  4PQX A;  3OW7 A;  3PF5 A;  1W2B A;  4G4K A;  4DGZ A;  4DR7 Q;  3HOV H;  2C2R A;  3H0G H;  4I7A A;  4PNY A;  2R92 H;  2O4X A;  3Q23 A;  1RD9 D;  2ZM6 H;  3CC7 A;  1LTS D;  1Z2O X;  2NVY H;  4LUV A;  1CQV A;  3RFC A;  1B50 A;  2OXP A;  2ZM6 Q;  3TP5 A;  1SYE A;  4Y52 H;  3MZ5 A;  1RF2 D;  2ES2 A;  2A73 B;  2QK4 A;  1N32 H;  3A54 A;  3R2I A;  5CV9 A;  2AGO A;  2I5L X;  1C0A A;  2PW5 A;  1N32 Q;  5E3F A;  1QZG A;  2XIW A;  2E76 C;  2ZXP A;  3IKJ A;  4L63 B;  3Q2O A;  2RHS B;  2F0D A;  5JVD F;  4ME5 A;  1HNW L;  3HKZ G;  5EOY A;  5DEH A;  1XTD A;  4LF9 L;  3CCR A;  2YZN A;  4DAY B;  1DYQ A;  2DJG C;  1STB A;  1A9X A;  4LMQ D;  4JBM A;  5KG6 A;  3H91 A;  1DCZ A;  3IFT A;  3EJI A;  4DUZ L;  4ME3 A;  1RK5 A;  5EDW A;  4DLK A;  1F2Y A;  2W9C A;  4MN3 A;  1QB5 D;  5FKA C;  5KIX A;  1TWF A;  2PN1 A;  5JJL A;  1KJ9 A;  2V5A A;  2PVP A;  3N44 B;  5KFL A;  1WTX A;  3S1Q H;  1ZHQ A;  5KFT A;  2I87 A;  1K8M A;  1J5E L;  2XCL A;  1TWC B;  2JN4 A;  3OIQ A;  2JA7 B;  5JEA G;  5FO8 B;  4LF8 Q;  1H9S A;  1B53 A;  2WB1 E;  4RUC A;  2JK8 A;  1I94 H;  3G48 A;  3TP8 A;  5FD5 A;  4EX5 A;  1C48 A;  2X6L A;  4LFA L;  1JIC A;  4QW8 A;  2NVQ B;  4F4Z A;  2DNE A;  3LWU A;  5KG2 A;  2ZDH A;  2M9V A;  2Z6K C;  2MQH A;  3WO1 A;  2R8J A;  3F8T A;  4C3I H;  3KLW A;  4IWX A;  1Y14 B;  1YZ6 A;  3GTG H;  2FB9 A;  4UP8 A;  3HOX H;  2H1E A;  4DR3 H;  4JI4 H;  1T9H A;  3MVV A;  4RNN A;  3MR3 A;  4YQW A;  2YYZ A;  4HID A;  2VQE H;  1MIU A;  4JI4 Q;  2FHT A;  4DR3 Q;  1CI3 M;  3PW4 A;  4DXF A;  3ULJ A;  1EWI A;  3A8K E;  5CR3 A;  3C1F A;  1WVL A;  2UUA H;  3N40 P;  4JYA H;  3BS1 A;  3KHH A;  3BYY B;  3M7N A;  1FGU A;  4GC7 A;  5KT6 A;  2UUA Q;  1U4M A;  4JYA Q;  1GHJ A;  5EPJ A;  4POF A;  3QO2 A;  3T16 A;  1RHP A;  3F2D A;  3Q6S A;  2EJM A;  1K1S A;  4YHH L;  1S03 G;  3EYY A;  1QNU A;  4F7X A;  5LHY 1;  1E2W A;  5F9L A;  2VQF H;  2PQE A;  3KTM A;  1EYA A;  2AQ4 A;  1PRT D;  5G3L F;  4CJ0 B;  4R8N A;  2I0Q A;  4EQP A;  2VQF Q;  3SGI A;  3S1M B;  5JEA J;  4DAY A;  1F2Z A;  4IPG A;  3TIG A;  1T5E A;  1WYD A;  2L15 A;  2EXD A;  2JA5 B;  2XTI A;  4JI5 H;  4N8F A;  2E2I H;  5KFD A;  3FKI H;  4A3L H;  2X6G A;  3BQ2 A;  3T5J A;  4JI5 Q;  2AQ3 B;  4UAI A;  3AEV A;  1PX2 A;  1SYG A;  2IX1 A;  4RAZ A;  4JI1 L;  1FL0 A;  2L9H A;  4JV5 L;  4DL7 A;  2Z0S A;  1GSH A;  4OGQ C;  5IYB G;  4X62 L;  1I4Q A;  1E4G T;  1CE8 A;  1ML0 D;  4A3E B;  1PA6 A;  3CVZ A;  2EE1 A;  4EFE A;  1B3A A;  2EYP A;  2I07 B;  4K8J A;  3MTS A;  2AU0 A;  1CKO A;  3HOU H;  1TWC A;  4FS1 A;  5T1I A;  2JA7 A;  2VB3 X;  4DR6 L;  2QW7 A;  3V4Z A;  2D0O A;  1XPR A;  5L1L A;  2WB1 B;  2DGY A;  1U4R A;  2JEJ A;  4CDE C;  2DNC A;  1SLJ A;  4TVA B;  4IUU A;  4ECW A;  2EZV A;  1HR0 W;  2OLS A;  4UFZ A;  3W1G A;  1ZKO A;  3EFX D;  1EUD B;  1K0S A;  5EWG A;  4LNQ A;  2V1C C;  2NB0 A;  2O5J C;  1VMC A;  5KEE A;  4G57 A;  1W96 A;  1HNW H;  4LF9 H;  2AUK A;  3C3L A;  3H4B A;  1D6E C;  3HZX A;  2VY3 A;  2MJ8 A;  1SFO B;  1HNW Q;  2FXQ A;  4HJ9 A;  4LF9 Q;  2R86 A;  1R4Q B;  2QKI C;  1CS0 A;  1XMO L;  1TS2 A;  4MV3 A;  4DUZ H;  3GID A;  2D2C C;  2MPM A;  3AMU A;  3G6V A;  4RZR A;  1J9O A;  2VOB A;  4O2D A;  3NQI A;  4HN7 A;  2HIV A;  1EOV A;  4IJH A;  4LSA A;  2K75 A;  3OWF A;  4UCU A;  1JQY D;  3WO0 A;  1J5E H;  5DG9 A;  1E2V A;  5LMN L;  3GQC A;  1R4P B;  5DGA A;  1JOR A;  1J5E Q;  4WRD A;  1OXT A;  1V9P A;  3J81 W;  1LTL A;  5KFO A;  1HXY D;  4P2C B;  2QEX A;  1BNZ A;  1TWA B;  1GJX A;  3GTJ H;  4JI3 L;  3QIA A;  4OHJ A;  3K59 A;  4LFA H;  2JA5 A;  3R5H A;  3ND9 A;  1Q12 A;  4MIU A;  1VF5 C;  4C1N K;  4LFA Q;  2AGP A;  3I73 A;  4PG3 A;  2FE3 A;  3BZC A;  1VF7 A;  3K5I A;  3SXH A;  2IP4 A;  2W71 A;  1EEI D;  3M4O H;  5KT3 A;  4U7C A;  1VQO A;  3KOJ A;  2FPI B;  2NU6 B;  5T1G A;  3BAB A;  3G6J B;  5EKI A;  1PH3 A;  1VMP A;  5IGG A;  3EPI A;  3K8A A;  4JK1 C;  5I4D A;  4OEL B;  1JB3 A;  5EGT A;  1Y8P B;  2IA6 A;  2FPP B;  1EY7 A;  4IWY A;  1K83 B;  4ALP A;  2WB1 A;  1AH9 A;  3MR2 A;  2JA8 H;  2KCT A;  4YIJ A;  2UUC Q;  2WE6 A;  3J80 W;  4DV2 L;  2JEF A;  4UCR A;  4PMW A;  1LYL A;  4MA0 A;  5J1Z A;  3KHL A;  4J9P A;  3PO2 G;  4HNU A;  1O7L A;  4YHH H;  2W6P A;  3ERO A;  1L2Z A;  1AN7 A;  3NHH A;  1KTK A;  4YHH Q;  2UXD L;  2RBM A;  3OW2 A;  4APM A;  3RIZ A;  4DR2 L;  4UHV A;  1KXL A;  5JJZ A;  3E0E A;  5C4Z A;  3ICE A;  1XDN A;  1BDO A;  3DUZ A;  3TEH B;  3IG0 A;  3KXY T;  1SFO A;  3A8J E;  3I4N G;  2NU9 B;  2B2V C;  5I9P A;  1VQN A;  2Z8L A;  5GAH C;  3I4M G;  1EIY B;  3GTL B;  5KX5 F;  5EPL A;  4JI1 H;  4JV5 H;  1YHB A;  5KFS A;  1SRU A;  3W5O A;  2HT1 A;  3RD4 A;  4X62 H;  4HMJ A;  5FLX W;  3BJU A;  4JI1 Q;  4JV5 Q;  4DL3 A;  1GKH A;  4BY7 G;  5G3L D;  3H3V C;  1AUV A;  4P75 A;  3S1N B;  3S16 B;  2C2D A;  3RAQ A;  4X62 Q;  3RGX A;  4LFC Q;  4DR6 H;  5KYL A;  1PFS A;  5DAU A;  1YNN D;  2K03 A;  1L0W A;  5KYI A;  3CD6 A;  3OOC A;  5T14 A;  4DR6 Q;  2B63 B;  3GTO H;  1TWA A;  1ILP A;  2ZT9 C;  2QYZ A;  2HUG A;  2L12 A;  5CV4 A;  4XT3 B;  4C2M H;  1D2B A;  1SNM A;  3FPU B;  2YW2 A;  4O3Q A;  1X3F A;  1JDE A;  1R9T B;  3I4O A;  1JT8 A;  2K52 A;  1N36 L;  4TV8 F;  4TQS A;  1CM9 A;  2HD3 A;  2TSS A;  4LF4 L;  2CH4 A;  3DF7 A;  4NW2 A;  4KHP L;  2F52 A;  4Q0F A;  4NDX A;  3UE0 A;  4POG A;  2XN9 C;  4ECR A;  3I90 A;  1BQQ T;  1VQA A;  4B3T L;  2UXB Q;  2E2H B;  1HZA A;  1XMO H;  1W3S A;  2JA6 H;  4MTD A;  1TT2 A;  2IX0 A;  3U9T A;  4XZ3 B;  2JXM B;  1XMO Q;  3M9M B;  2KCC A;  5C5J A;  1K83 A;  5KFN A;  1S5B D;  3NK9 A;  3K6O A;  3Q8P B;  3KHG A;  1EUJ A;  2EJF C;  3CMA A;  4XYQ A;  1L2F A;  4A3G B;  3QJY A;  3KF8 B;  2JE6 I;  5LMN H;  1XXG A;  3NP8 A;  4JV2 A;  5KNB A;  2F0M A;  1I3Q B;  3CRL C;  3J80 E;  1UC8 A;  5LMN Q;  5F2D A;  4JI7 Q;  5HY6 A;  3U4Z A;  1NMF A;  3HOZ B;  4JI3 H;  2K5D A;  3S17 H;  4A3K B;  2XRS D;  3AB9 A;  3JRW A;  2C28 A;  3MHB A;  1UE1 A;  4JI3 Q;  2M00 A;  3WDN A;  1EYC A;  3V96 A;  4AH6 A;  3J81 i;  3D6C A;  3GTL A;  3KDF B;  1PH8 A;  4DNR B;  2PCF B;  3RB4 A;  2N3S A;  4UCT A;  1YI2 A;  2CW0 C;  4L6T B;  4CHT B;  3UDF A;  2A6E D;  4QB4 A;  1IHZ A;  5JPM C;  4WOR A;  3M3Y H;  5C3E H;  2R6F A;  1PZJ D;  4OON A;  2WAQ G;  1E4F T;  5C0X G;  5J2U F;  5GQO A;  3N42 B;  2FLN A;  2B63 A;  3AYH B;  2VUM G;  5CV8 A;  3I72 A;  2YRX A;  1M6V A;  3KJP A;  2IPK D;  1OXV A;  1QJO A;  1R9T A;  1SMY C;  3AFQ A;  4C3J G;  3QOJ A;  1BCP C;  2XNA C;  5A2Q W;  1VQI A;  3KLS X;  4A4I A;  4A3J G;  2UXD H;  4J9L A;  2A68 D;  5KFB A;  2KOL A;  1WCM H;  4GLV B;  3J80 i;  1PK8 A;  4DR2 H;  2K28 A;  5D1P A;  3OHA A;  1FNV A;  2UXD Q;  5CBA E;  1W6K A;  4GS3 A;  5KT5 A;  1D1I A;  4O3N A;  2E2H A;  4DR2 Q;  1OWT A;  3CPF A;  4BA1 I;  1I4G A;  2N88 A;  1RL2 A;  3SEB A;  4B9W A;  4A76 A;  3GTK B;  3LP8 A;  1EOT A;  2C35 B;  1ENF A;  1IYJ B;  3GQB A;  5DM7 3;  1A63 A;  2VR1 A;  1ESR A;  4H0L C;  3MR5 A;  3GTM B;  2J6S A;  3KF8 A;  4RGN A;  2ZDG A;  2GA4 B;  2JP1 A;  4ED3 A;  4U68 A;  1FKA H;  4A3F G;  2AWO A;  2SEB D;  3F8N A;  2NZO A;  4DNT B;  1GUT A;  5KFC A;  2WTF A;  2NZ1 D;  5IYC H;  4BY1 H;  1Y1V B;  3O13 A;  3QR8 A;  3CC2 A;  1EHI A;  4ECU A;  4ID6 A;  3RB6 A;  3BYT B;  2FLL A;  4JCV E;  3RZO B;  1GHK A;  3HKZ B;  1Z9F A;  2YYA A;  1Q8I A;  3I3C A;  3QZ8 A;  5FD6 A;  2QEJ C;  2V4Q A;  1S68 A;  3Q24 A;  1WFQ A;  4HJ8 A;  3HOY H;  1N36 H;  4R4C A;  5LL6 S;  3VR3 A;  2JA9 A;  4RCO A;  1K28 A;  3KDF A;  5JAV A;  3V4S A;  1PTO F;  1JWM D;  4C56 C;  3G71 A;  4AQY L;  1N36 Q;  2B2V A;  3S14 H;  4KHP H;  3MEH A;  1T94 A;  1NBW A;  2JEA I;  3T51 B;  1K9M C;  4EYI B;  1HCZ A;  1N56 A;  4B3T H;  1C3O A;  4RMF A;  3GTP H;  4KHP Q;  2VS1 A;  1WTH A;  5HBR B;  1PXU A;  3BG3 A;  4DV0 Q;  2FPG B;  1DON A;  4IO9 A;  4B3T Q;  2L5T A;  4F8M A;  1B3Q A;  5KND A;  3ETH A;  3S2D B;  2W6Q A;  1Q82 C;  5DQG A;  3PN1 A;  2W9A A;  5M5W B;  1M0T A;  2R7M A;  1RK6 A;  4CJ2 C;  4JBK A;  3MWD A;  1MKH A;  5GRO A;  3RN2 A;  4I55 F;  1GGO A;  3OMC A;  3RNU A;  5DNF A;  1EIF A;  1S97 A;  4K5X A;  2ZXO A;  1CKN B;  4O0A A;  5GAG C;  3RN5 A;  2F3V A;  4EFB A;  4PDB A;  5ELO A;  4IRC A;  1N34 L;  1UE6 A;  1VQ7 A;  3F2B A;  1VQM A;  2VXW A;  5J39 A;  1PYB A;  3HOV G;  1IYV A;  4KY7 A;  1F2M A;  3H0G G;  5KFR A;  5EAY A;  2R92 G;  1EQV A;  3PIO A;  1STY A;  1BCP B;  2EYH A;  5IP7 H;  2FJ2 A;  1PZI D;  1UEA B;  4X3T A;  5M5X B;  1A3T A;  3FPP A;  2RDI A;  2EVB A;  1PFN A;  5C5L A;  4GOP C;  2QIL A;  1LV9 A;  1BJT A;  1DM0 B;  4O3P A;  3S24 A;  1WJJ A;  5M3F G;  3BVM A;  3Q0A A;  3GTK A;  1I4H A;  4Y7N H;  1HRJ A;  4CKC A;  2PW7 A;  3KUP A;  2SDF A;  4KN7 C;  1HQR D;  3Q8D A;  3KAK A;  5ELN A;  4HMI A;  2UXC L;  2XGP A;  3MFI A;  3NWT A;  4P72 A;  4TKO B;  5KFX A;  3KK7 A;  3H3V I;  3DM1 A;  1ZEQ X;  4QUC A;  4PWQ A;  2F0L A;  3DHQ A;  5IOD A;  2JEB I;  4C3J H;  4QIW A;  1VQJ A;  1SNQ A;  4A3J H;  1Q1E A;  1VQL A;  3BA9 A;  2RCF A;  1I6H H;  2FLP A;  3HKZ A;  3PIP 3;  5KG1 A;  1EY6 A;  2M2L A;  4CC5 A;  2ZDQ A;  1Z47 A;  4R7R A;  4J0M A;  4A3I H;  1B6S A;  4IR1 A;  3D4W A;  1CKM A;  3GV8 B;  2NWG A;  4UCS A;  4J1M A;  4KLK A;  3VYR A;  4ULL A;  4KMU C;  1XWE A;  2KHJ A;  2PZT A;  4DPG A;  4NXM L;  5K5P A;  2FMC A;  3T1H H;  2X69 A;  4J9M A;  4A3F H;  4IJL A;  3CF5 A;  1X32 A;  3L4K A;  3T1H Q;  3G6Y A;  2SOB A;  4E6I A;  1HR0 L;  3Q8R B;  1KDA A;  1PVO A;  2HGS A;  2CQO A;  4OL7 A;  2YU9 B;  4GKJ L;  1CKN A;  5JH7 F;  2B29 A;  3BJY A;  4C3I G;  1PFB A;  4MZ9 A;  4FXG C;  5ELD A;  1MD2 D;  5NUC A;  4BWG B;  4LAA A;  3HOX G;  3JZI A;  5CA1 F;  1JOO A;  2IMW P;  2NVX B;  1Y1W H;  4HYK A;  2R8G A;  3IFD A;  3DLL A;  3J81 c;  2D5D A;  1K8G A;  4MA5 A;  1Z2P X;  5KFP A;  1PHJ A;  5ELE A;  1DJR D;  3BDC A;  1XPO A;  3VA5 A;  1M8A A;  1GLV A;  1A8V A;  2H5X A;  1IW7 C;  3CAM A;  3A5Z B;  3NUC A;  2K7V A;  2OCE A;  3FVQ A;  1A2T A;  1ENC A;  1C30 A;  1E7Z A;  2WYO A;  4AQY H;  4DR5 L;  2XCP A;  1CA6 A;  1ONL A;  4GOP B;  4OWW B;  4IOA A;  4DV1 L;  2EY6 A;  4A3M G;  3M4I A;  1MZB A;  1A3V A;  1BOS A;  4ED6 A;  3J81 L;  1CA5 A;  2NUA B;  3Q1K A;  3CU7 A;  5C44 H;  4RHR A;  1G51 A;  4HED A;  3FKI G;  4C3H B;  1PTO D;  4A3L G;  1EYD A;  3S15 H;  1IKL A;  1S72 A;  1BR9 A;  2LY7 A;  1MSH A;  2IX3 A;  1ZYR D;  1VQK A;  4BBS H;  1MHW C;  3NSW A;  4XTC S;  3S1R B;  3HXL A;  4K14 A;  5M3F H;  2AUJ D;  4MTN A;  3HOU G;  1NY4 A;  2K14 A;  1G6P A;  3R5X A;  1WTP A;  3DMU A;  1BO0 A;  1VCI A;  2K5V A;  2ZXR A;  4Q5V A;  3T5K A;  1KLG D;  5I2X A;  3K7A H;  3PO3 B;  3HOW B;  1HUM A;  2JJQ A;  1LT3 D;  2K5N A;  3ITP A;  2TMP A;  2O03 A;  3OSN A;  2HCI A;  1JJG A;  4ETS A;  4KHV A;  3A7A B;  5DGB A;  2E75 C;  5IGD A;  1OO9 B;  5M3M G;  1LAC A;  3NBI A;  5C3W A;  2VZA A;  1EU3 A;  3RF2 A;  5FLX c;  2F0S A;  1KC7 A;  2UXC H;  2CH4 W;  3SE0 A;  4JI8 L;  2YU9 A;  5KNC A;  2CWP A;  1UUP A;  4IZ8 A;  2HVR A;  3D4D A;  1C9O A;  2D62 A;  2UXC Q;  2FMM A;  3PO2 B;  4J6H A;  4ZOL F;  1IOW A;  4MTK A;  2NVX A;  1DZ1 A;  3FDT A;  2B8F A;  5D8D A;  1I50 H;  2F4V L;  3RLN A;  2ZTE A;  2QCP X;  3ETJ A;  4C2M A;  1YHA A;  4FXK C;  1TWH B;  1STE A;  2L55 A;  1JOQ A;  4J15 A;  2E2J B;  4DK0 A;  3I4N B;  2KSW A;  3VA7 A;  5BN3 A;  5FLX L;  2L1B A;  4XYL B;  3I70 A;  3I4M B;  4GOP A;  2QA4 A;  1TS3 A;  3VPD A;  3TZU A;  1EY4 A;  3L9A X;  1VQ4 A;  1TWG B;  1DV2 A;  4MV4 A;  5KG3 A;  3MAQ A;  1UAP A;  4L8J A;  4NXM H;  3ERS X;  1I94 Q;  4BY7 B;  1QE6 A;  2J6U A;  3N8D A;  4DNI A;  4WBN F;  3LML A;  4H44 C;  2HCC A;  4NXM Q;  4IRK A;  5ELB A;  4PZ6 A;  2F0P A;  4FBU A;  3FHW A;  2WAQ E;  4DAP A;  1B7Y B;  5BPF A;  1HR0 H;  1BXR A;  1IKM A;  1JC7 A; 
#chains in the Genus database with same CATH homology
 1VS0 A;  3GTQ H;  4X65 L;  1X6O A;  4YCV A;  1HR0 Q;  4LF8 L;  1SMX A;  4RG1 A;  1X56 A;  5HGQ A;  3I56 A;  1Q81 C;  4ALP A;  1XMQ L;  3NEM A;  1AH9 A;  2VQE Q;  3EBE A;  4GLX A;  2KCT A;  1PH1 A;  3CP0 A;  1NJI C;  2UUC Q;  2ASB A;  1TWH H;  4DV2 L;  2ZJQ A;  3GO5 A;  4PMW A;  1TWA H;  1LYL A;  2E2J H;  3I4N H;  3RZD H;  3G4S A;  4JBW A;  3PO2 G;  2YTV A;  4DV6 L;  1VQ5 A;  4QL5 A;  4A93 H;  2KCM A;  3I4M H;  1SRO A;  4IFD J;  4YHH Q;  4DV5 Q;  3VDY A;  2GN5 A;  1N8R C;  2UXD L;  1TWG H;  1X54 A;  1VQF A;  3OW2 A;  1J6Q A;  3HOZ G;  4DR2 L;  4A3M H;  1IZ6 A;  4BY7 H;  1KXL A;  2PI2 E;  3E0E A;  2JA8 G;  3ICE A;  3TEH B;  3T1H L;  5LMN W;  5BR8 Q;  1X3G A;  4OWX B;  3I4N G;  3CCV A;  4JV5 Q;  4JI0 L;  3FP9 A;  2IY5 B;  1NTG A;  3CCU A;  1VQN A;  3H3V H;  5FLM H;  5GAH C;  4L5Q A;  1BBW A;  4A93 G;  3CXC A;  3I4M G;  2EQS A;  1VQP A;  1EIY B;  1YHB A;  4DV1 Q;  1K83 H;  2I5M X;  2Q2H A;  1Q1B A;  1MJC A;  1SRU A;  3W5O A;  2E5L L;  5H1S E;  4AQY Q;  2QGQ A;  3BJU A;  4JC0 A;  3K80 C;  1CSP A;  4JI1 Q;  5IE8 A;  4R1J A;  2JQO A;  1GKH A;  2N8N A;  1OTC A;  3KFU A;  4DV7 Q;  4BY7 G;  4P75 A;  2LXJ A;  4DK6 C;  4X62 Q;  4WJ3 M;  5M5Y H;  5C4X G;  2PQA B;  2HIX A;  4LFC Q;  4DR1 L;  1D8L A;  5C0X J;  1PFS A;  3PIP A;  3CC4 A;  1L0W A;  2AMC B;  1BBU A;  5FLM G;  4AIM A;  3CCE A;  3CCL A;  2VQF L;  3CD6 A;  4DR6 Q;  5JJK A;  3GTO H;  1E24 A;  3J80 c;  4WJ4 A;  3JAM c;  1EFW A;  3J7A 5;  4X66 L;  4C2M H;  4AYB G;  3KJO A;  1X3F A;  2Q2T A;  3PUY A;  1FJG L;  3I4O A;  1JT8 A;  1KD1 C;  2K52 A;  5M3M H;  1YIJ A;  3F1Z A;  1N36 L;  4JOI C;  4JI6 L;  4MNO A;  4LF4 L;  3GTL H;  1N34 Q;  5J3B A;  2VL6 A;  1YVC A;  2R7Z H;  4P71 A;  4KHP L;  2F52 A;  3TQY A;  1KRT A;  5IWA L;  1S3O A;  3UE0 A;  3CCQ A;  2UU9 L;  4POG A;  4GN5 A;  3T1Y L;  1XNQ L;  3M85 A;  1VQA A;  4B3T L;  2UXB Q;  1HZA A;  4YWL A;  4DR7 L;  1W3S A;  1FVI A;  3S1N H;  2JA6 H;  3S16 H;  1QVG A;  1VQB A;  2IX0 A;  2I5H A;  3D0F A;  1XMO Q;  2AWN A;  2Q2U A;  4JI2 L;  1KAW A;  3L0O A;  1K73 C;  2NN6 I;  4JI8 Q;  2B63 H;  2ZM6 L;  1EUJ A;  3CQZ H;  3CMA A;  4DUY L;  2R7Z G;  4GKK L;  1L2F A;  2YTX A;  4YWM A;  4DUZ Q;  1M1K C;  1VQE A;  3KF8 B;  2JE6 I;  3M4Q A;  4HJA A;  1P8L A;  2ZTC A;  1XPU A;  3UE1 A;  1JB7 A;  3PCO B;  1CUK A;  2JA6 G;  1BKB A;  3GDE A;  1Y1V G;  3JC6 6;  3RLF A;  1R9T H;  1UE5 A;  4YWK A;  1A0I A;  5AJ3 L;  3J81 j;  4YY3 Q;  5LMN Q;  4LF5 Q;  4JI7 Q;  2UUB Q;  4JOI A;  2F4V Q;  5HY6 A;  3U4Z A;  1IBL L;  1NMF A;  4DAM A;  4HIK A;  2OTL A;  2YV5 A;  4OX9 Q;  1LM0 A;  2B63 G;  3S17 H;  4B3R Q;  3EIV A;  3UDG A;  1X9N A;  2K5H A;  2E2H H;  1I5F A;  1UE1 A;  4JI3 Q;  5LMU Q;  3CPW A;  2KBN A;  4FDB A;  2A1A A;  4UPA A;  4AH6 A;  3J81 i;  1CSQ A;  3KDF B;  5E7N A;  1PH8 A;  2K50 A;  3NEL A;  1N33 L;  1VQG A;  2CFM A;  3NBH B;  2VUM H;  2N3S A;  1YI2 A;  1VQC A;  3UDF A;  4JG2 A;  2R7F A;  2CKZ B;  3PGZ A;  4A3B H;  1NE3 A;  1A62 A;  2GVA A;  5C3E H;  3G6E A;  3M3Y H;  1OXS C;  4A3G H;  1E1O A;  2PQA A;  3PUV A;  4B3S Q;  4OON A;  2WAQ G;  4NXN L;  1UEB A;  5C0X G;  2K4K A;  3A74 A;  3K7U C;  5GQO A;  1I3Q H;  2CWA A;  2WP8 J;  1EYG A;  1YEZ A;  2A8V A;  1UWV A;  4IOC A;  4X65 Q;  1V43 A;  2A19 A;  3AYH B;  1HZB A;  2VUM G;  3CCM A;  4LF6 L;  3ZJY C;  1XMQ Q;  3HOZ H;  4LUZ A;  2OWO A;  3KJP A;  4A3K H;  1UE7 A;  4A3B G;  4GKJ Q;  1OXV A;  5C3E G;  4A3G G;  5IYD H;  3AFQ A;  2KHI A;  4XIG S;  3PUW A;  1B70 B;  4DV6 Q;  2KEN A;  4A3D H;  1VQI A;  4A3J G;  4A4I A;  1I94 L;  3ER0 A;  4APV A;  5FJ8 H;  4BBR H;  1WCM H;  4GLV B;  3J80 i;  4L5T A;  1VQ6 A;  2UXD Q;  4BXX G;  5C4J H;  4DV3 L;  4GS3 A;  1O7I A;  3BZK A;  3STB D;  2R93 H;  4DR2 Q;  1KHI A;  3CPF A;  2OQK A;  4BA1 I;  4JBJ A;  4A3K G;  3PUZ A;  1YJ9 A;  4JI4 L;  5C4X H;  2ZJP A;  1RL2 A;  4DR3 L;  4JI0 Q;  3EN2 A;  5IYD G;  4A3D G;  2VQE L;  3RR5 A;  4A76 A;  3CME A;  2HHH L;  2YTY A;  4LW1 A;  2C35 B;  2UUC L;  1IYJ B;  2RF4 A;  1TXY A;  1WCM G;  4BBR G;  5FJ8 G;  4DR5 Q;  1A63 A;  3A0J A;  1YIT A;  1YJN A;  2BH2 A;  4K0K L;  2BA1 A;  2WFW A;  2E5L Q;  2UUA L;  4JYA L;  4A3F G;  4IFD I;  2AWO A;  2R7D A;  2R93 G;  2NZO A;  3M9B A;  1U5K A;  1K0R A;  2IHF A;  2AHO B;  5IYC H;  4B3M Q;  4BY1 H;  3OTO L;  3CC2 A;  4DR1 Q;  2MO1 A;  4OWT B;  4JCV E;  5DLQ E;  2PI2 A;  1GM5 A;  1SN8 A;  4GNX C;  1IBM L;  1RIP A;  4A3C H;  1M90 C;  1Z9F A;  3BU2 A;  3WWV A;  3ULP A;  3I7F A;  1QZH A;  1PH7 A;  1JMC A;  4QQB X;  2MNA A;  1WFQ A;  4DV4 L;  4HJ8 A;  3HFZ B;  3HOY H;  3S2H H;  2N49 A;  4R4C A;  2JA9 A;  3J7Z C;  1OXX K;  4LFB L;  2RCN A;  3KDF A;  3DM3 A;  2NVT H;  1BVS A;  1FJG Q;  5IYC G;  1GVP A;  4BY1 G;  4JI5 L;  1N36 Q;  3G71 A;  4AQY L;  3TS0 A;  3GTK H;  3S14 H;  1E1T A;  3U50 C;  1EQR A;  1NBW A;  2JEA I;  1K9M C;  1HZC A;  4JI6 Q;  3TS2 A;  4OO1 I;  4KI0 A;  4RMF A;  4UP7 A;  3TRZ A;  3GTP H;  5C0X I;  2VS1 A;  4A3C G;  5IWA Q;  4KHP Q;  4LFC L;  2UU9 Q;  3GTM H;  3OYY A;  3PUX A;  4DV0 Q;  3T1Y Q;  3PF5 A;  1W2B A;  4IO9 A;  4B3T Q;  1ASY A;  1TWF H;  4DR7 Q;  2OQ0 A;  4DK3 C;  5GAE C;  1Q82 C;  3AFP A;  3HOY G;  1HZ9 A;  1AE2 A;  3HOV H;  1PYS B;  4P73 A;  1PH9 A;  3MXN B;  4JBK A;  3H0G H;  1L1O C;  1MKH A;  1Y1V H;  3PV0 A;  5GRO A;  3RN2 A;  1B8A A;  3ULL A;  2R92 H;  1SE8 A;  4QY7 A;  4UP9 A;  3CC7 A;  3RZO H;  4BA2 I;  4JI2 Q;  3RNU A;  1EIF A;  2NVY H;  2ZTD A;  4LUV A;  4UY8 C;  1IBK L;  1CKN B;  4O0A A;  2ZM6 Q;  4DUY Q;  4GKK Q;  5GAG C;  3M4P A;  4YCU A;  4Y52 H;  3RN5 A;  2ES2 A;  5ELO A;  1QVF A;  1N34 L;  1XNR L;  1UE6 A;  2ATW A;  4R4T A;  2I5L X;  3F2B A;  1VQ7 A;  1VQM A;  4GN3 B;  3HOV G;  1PYB A;  1QZG A;  1EQQ A;  1N32 Q;  1C0A A;  5JJI A;  3H0G G;  3A5U A;  4L5S A;  5IP9 G;  5EAY A;  2R92 G;  2UXB L;  4GN4 B;  4QGU A;  3PIO A;  5IP7 H;  3L2P A;  1IBL Q;  2RHS B;  3CCJ A;  1DGS A;  4QIW E;  1G29 1;  3HKZ G;  1HNW L;  1XTD A;  4GOP C;  3CCR A;  1QVC A;  4LF9 L;  4DAY B;  2IHE A;  3KF6 B;  3S24 A;  3HKZ E;  3S2D H;  1WJJ A;  5M3F G;  1VQ8 A;  4JBM A;  1KRS A;  5M5W H;  4GLA C;  2N78 A;  2E8G A;  4R4I A;  4EQ5 A;  1KQS A;  4Y7N H;  1Q46 A;  2LXK A;  4DUZ L;  1WI5 A;  2ALY B;  1N33 Q;  4X64 L;  1HNX L;  3Q8D A;  1V1Q A;  5ELN A;  1N9W A;  3NEN A;  4ME3 A;  5IP7 G;  3U58 A;  2UXC L;  2OTJ A;  1QUQ B;  4DR4 L;  4P72 A;  2BA0 A;  5JJL A;  4LF5 L;  4A3E G;  3PF4 A;  4A75 A;  3H3V I;  4JI7 L;  1YJW A;  3S1Q H;  3UDX A;  1JE5 A;  4NXN Q;  2JEB I;  4C3J H;  1J5E L;  1VQJ A;  4A3J H;  1HNZ L;  1Q1E A;  1VQL A;  1I6H H;  5JEA G;  4BXX H;  1Z47 A;  5M5X H;  4A3I H;  4LF6 Q;  4LF8 Q;  2WB1 E;  1IXR A;  4GNX B;  2JK8 A;  1E22 A;  4P74 A;  3G48 A;  4DV2 Q;  2Y0S E;  1CKM A;  4EX5 A;  4LFA L;  4R4O A;  1GD7 A;  4KLK A;  2Z6K C;  2KHJ A;  2MQH A;  4LF7 L;  4DPG A;  4NXM L;  3F8T A;  4C3I H;  3KLW A;  4DV3 Q;  3JAM i;  1Y14 B;  1YZ6 A;  3GTG H;  3HOW G;  3PO3 G;  4UP8 A;  3HOX H;  4A3I G;  2NZH A;  1T9H A;  4IJL A;  4A3F H;  2DUD A;  3CF5 A;  2YYZ A;  4HID A;  3T1H Q;  1MIU A;  1IL2 A;  1KL9 A;  2RHQ B;  4NB3 A;  4DR3 Q;  1MJE A;  4JI4 Q;  1VQD A;  2LSS A;  3ULJ A;  1HR0 L;  1EWI A;  3D31 A;  1TWC H;  1PVO A;  4TQU S;  2HHH Q;  2JA7 H;  2CQO A;  4GKJ L;  2XGT A;  1CKN A;  1L1O B;  3K0X A;  2B29 A;  3M7N A;  1VQ9 A;  1FGU A;  2Q2I A;  4MZ9 A;  2NN6 G;  4K0K Q;  2UUA Q;  4JYA Q;  3HOX G;  4POF A;  1PH5 A;  2PMZ E;  1Y1W H;  3F2D A;  1Q86 C;  4X6A H;  3DLL A;  4YHH L;  2NVQ H;  3J81 c;  3OTO Q;  3I55 A;  4DV5 L;  1K8G A;  1SR3 A;  1GO3 E;  1PHJ A;  1H95 A;  2Z6K A;  1ASZ A;  2JA7 G;  1IBM Q;  1XPO A;  4L5R C;  5IYB H;  2I0Q A;  1WOC A;  2VQF Q;  3SGI A;  5BR8 L;  4IPC A;  5JEA J;  5K36 G;  1A8V A;  2H5X A;  3KF6 A;  4IPG A;  3CAM A;  1WYD A;  2L15 A;  3A5Z B;  2EXD A;  3E9H A;  4OXP A;  2OCE A;  5GAD C;  4DV4 Q;  2XTI A;  3F2C A;  1E7Z A;  3AQQ A;  3W1B A;  2E2I H;  4DR5 L;  4X66 Q;  3FKI H;  1Y1W G;  4QJF A;  4GOP B;  1Q7Y C;  4OWW B;  4IOA A;  2GVB A;  4LFB Q;  2D0P A;  4A3L H;  4DV1 L;  1X65 A;  4JI5 Q;  3AEV A;  2VNU D;  1VQH A;  4KHZ A;  4A3M G;  2IX1 A;  4JI1 L;  1FL0 A;  3B6Y A;  2ZJR A;  4JV5 L;  2YU9 H;  1QUQ A;  2Z0S A;  4PZ7 A;  3MEF A;  4IPD A;  4DV7 L;  4LF4 Q;  4HJ7 A;  5IY0 A;  1JJC B;  5IYB G;  2F3I A;  4X62 L;  1C7Y A;  4B3M L;  1PA6 A;  2JA8 H;  3STB C;  1PH2 A;  1XNQ Q;  2HT1 A;  3GD7 A;  5C44 H;  3LGJ A;  2NVX H;  1CKO A;  1G51 A;  5IT9 c;  3HOU H;  3FKI G;  4DR6 L;  2D0O A;  4LWC A;  1XPR A;  4A3L G;  3E9I A;  4PZ8 A;  2R6G A;  3I2Z A;  5IP9 H;  3S15 H;  1S72 A;  2BH8 A;  2DGY A;  1SLJ A;  4GNX A;  1IBK Q;  4TVA B;  3S1M H;  2CCZ A;  4AYB E;  1HR0 W;  2ID0 A;  2MFI A;  1U0L A;  1S40 A;  1VQK A;  4HIM A;  4BBS H;  1LUZ A;  4XTC S;  3W1G A;  2JA5 H;  5C44 G;  1XNR Q;  5M3F H;  4LNQ A;  1D7Q A;  1X55 A;  4MTN A;  3HOU G;  2V1C C;  1YBY A;  1NY4 A;  1YNX A;  1PH6 A;  2K14 A;  4DV0 L;  1G6P A;  5AJ3 Q;  4H02 A;  1VCI A;  2K5V A;  4NPS A;  3K7A H;  4LUO A;  3L7Z C;  2JJQ A;  1XJV A;  2K5N A;  2VY3 A;  1HNW Q;  1JJG A;  2FXQ A;  4HJ9 A;  4LF9 Q;  4A3E H;  5M3M G;  1XMO L;  4BBS G;  2VZA A;  2JA5 G;  1P16 A;  3IRB A;  5FLX c;  4C3H H;  4IPH A;  4HJ5 A;  4JI8 L;  1L1O A;  2CWP A;  4O2D A;  4X64 Q;  4HIO A;  1HNX Q;  1C9O A;  2EIF A;  1PV4 A;  1JJ2 A;  2D62 A;  2HIV A;  4YCW A;  1K3R A;  1EOV A;  4IJH A;  2UXC Q;  3TRE A;  3H15 A;  4DR4 Q;  1N32 L;  3UDI A;  2K75 A;  2PNH A;  4IFD G;  3RLO A;  4YY3 L;  5LMN L;  1I50 H;  2UUB L;  3S1R H;  2F4V L;  1YHQ A;  3U4V A;  3RLN A;  1J5E Q;  1PH4 A;  1NMG A;  1X3E A;  2ZTE A;  3CCS A;  1OXT A;  2VW9 A;  1KIX A;  1V9P A;  1YHA A;  1HNZ Q;  1LTL A;  4OX9 L;  4B3R L;  1HH2 P;  2QEX A;  4J15 A;  3PO3 H;  3HOW H;  3GTJ H;  1E3P A;  2WB1 G;  4JI3 L;  4DKA C;  5LMU L;  3HKS A;  1Q8K A;  1SFO H;  1Q12 A;  2Y0S G;  4GOP A;  3KYH C;  2QA4 A;  4LFA Q;  2MO0 A;  1KC8 C;  1VQ4 A;  4PG3 A;  3BZC A;  2HQL A;  3ERS X;  1I94 Q;  3M4O H;  1VQO A;  4R4Q A;  4DNI A;  3KOJ A;  4LF7 Q;  4NXM Q;  1OXU A;  4OO1 G;  3CW2 C;  3PO2 H;  4B3S L;  1PH3 A;  4PZ6 A;  3FHW A;  3K81 C;  3K8A A;  1HJP A;  2WAQ E;  1B7Y B;  3PSI A;  1AE3 A;  1K8A C;  2B3G A;  2IT1 A;  2AKW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...