4A3DG

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3dG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3dG01
4X65Q 4PZ7A 3RLFA 2PMZE 1TXYA 1HJPA 2R7FA 5AJ3L 2GN5A 4HJ8A 1PH8A 5IP7H 2D62A 4KLKA 1N8RC 3HOZG 1QZGA 1OXSC 2K5NA 5M5YH 3PGZA 3TQYA 1GO3E 2KCTA 2Q2HA 1IBKQ 1PFSA 4X62Q 1IBLQ 1EFWA 4DV3L 4DR4Q 2VZAA 4DR1L 1CKNB 2K14A 1LUZA 3KOJA 4HJ5A 4AQYQ 1VQPA 2ZTDA 4BBSH 1YJ9A 2NZOA 1XNRL 2UUBL 4NXML 5IP7G 1X3EA 3PSIA 3VDYA 4DV2Q 1PHJA 1UE5A 4DR2L 4JOIA 4JV5Q 3NEMA 4P72A 3RR5A 5GQOA 1KAWA 5E7NA 1N34Q 4DR5L 4YY3Q 4DR3L 2NN6G 2CKZB 2IHFA 5FJ8H 2Q2IA 1PYBA 5HY6A 3RNUA 3S1QH 4BBSG 1EQRA 2KENA 4LF5L 1VQ8A 3DM3A 4BA2I 2AWNA 3K8AA 4DV6L 3KYHC 1X9NA 1I94L 4R4QA 3BZCA 5FJ8G 4X64Q 3J7A5 1RL2A 1SROA 4B3TQ 2N78A 2WB1E 5K36G 2NN6I 3CQZH 1VQMA 5IYCH 4A3GG 4ALPA 2E2IH 1B70B 3I7FA 4TQUS 2ZTEA 3CXCA 3U4ZA 3J81i 3STBD 5C0XJ 4UP9A 2I5MX 4IO9A 3CPWA 2XTIA 4R1JA 3BU2A 3JC66 3S2HH 2EXDA 4JI4Q 4K0KQ 4IFDJ 4A3JH 2NVXH 2YTVA 4LUZA 2YV5A 2WB1G 3E9HA 4UPAA 4GLVB 4GOPB 2DUDA 2YTYA 3M85A 1E1OA 3CW2C 3EIVA 1KD1C 2E5LL 3K7AH 1SFOH 3U50C 1VQ5A 4WJ4A 4GNXC 1VCIA 4OWTB 5C44H 3CC7A 4A3IH 2Q2UA 4A3JG 1CKNA 1EQQA 1QVGA 1EIFA 1CKMA 2MQHA 4MTNA 4P71A 4LNQA 4A3DG 1TWFH 4L5TA 3F2DA 3H3VH 1X56A 4HJ7A 4K0KL 2R92G 1FVIA 4YCUA 5C3EH 3JAMi 3G6EA 3GO5A 4HJAA 4QGUA 1I50H 4A3IG 2OQKA 4JI2Q 5C44G 3CCJA 3GTJH 3CMAA 1MKHA 4Y52H 4JC0A 2Z0SA 4AYBG 3PIOA 2JA5H 4LFBL 2BA1A 3ULJA 3T1YL 3J81c 1FL0A 3GTPH 3UDGA 2IHEA 3OYYA 3UDIA 3S16H 5IT9c 2OTLA 5C3EG 4LUOA 1YHAA 4R4CA 3KDFA 1XTDA 2K50A 3S24A 3HOUH 4KHPL 2GVBA 4DV5L 5IY0A 5ELNA 2AMCB 4BXXH 4PG3A 4H02A 4DPGA 4A3MH 4OO1I 1HNZQ 2BH8A 2UUCQ 2OTJA 1JJGA 1HR0Q 1N9WA 1PH6A 4A3BH 3RZDH 1CKOA 3H3VI 5IYDG 5GAGC 3HKZE 3GTOH 1XPOA 5H1SE 3ULPA 3HOXG 2E2HH 2E2JH 1UEBA 4JI5Q 4A3MG 4POGA 4DR7L 4DUZQ 2UXCL 2XGTA 4GN3B 2JQOA 4HIOA 4JBKA 2B3GA 2MFIA 2FXQA 2E8GA 1KQSA 4A3BG 1BKBA 4LF6L 1L0WA 3M7NA 3L7ZC 1I5FA 4GOPA 4LF9Q 3M4QA 1N33L 3OTOL 3DLLA 2VY3A 2WP8J 1I6HH 4IFDI 4GN4B 1YEZA 2LSSA 4PZ8A 3CAMA 1PV4A 1JT8A 1JJCB 1UE1A 3UDFA 3M3YH 4A3CH 3H15A 1Y1WH 3NELA 1Q12A 4JI6L 2VL6A 1S72A 5IWAL 1WCMH 1GM5A 3HOVG 4B3RQ 1G291 5DLQE 3CCQA 2K52A 1N32L 3A74A 1TWHH 1YNXA 5ELOA 4PMWA 1QVFA 4YHHQ 3CP0A 1SR3A 2ZJRA 1G6PA 5M3FH 4LFCL 2CWAA 4A3CG 3CCMA 3EN2A 4RG1A 3CCSA 1KRSA 3K7UC 4NXNL 4OX9L 2KCMA 1Y1WG 4JI7Q 1HNXQ 1O7IA 1BBUA 3HKSA 1XMOQ 1WCMG 3T1HL 4DR6Q 3GTLH 1WYDA 4P75A 4GKJQ 1E1TA 4DV0Q 4B3SQ 1VQGA 4DUYQ 4LF7Q 1PH2A 4HIKA 1TWCH 2VQFL 4DV1L 1VQ4A 4L5QA 4Y7NH 5M3FG 2UUAQ 2CWPA 1WJJA 2F3IA 4LF4Q 2JA7H 1T9HA 2QEXA 4JG2A 1J5EL 1WFQA 4B3SL 4IOCA 4TVAB 4X65L 4GLXA 1W2BA 4B3MQ 4JBWA 4LW1A 4A3KH 1LTLA 4QQBX 4A4IA 1PH9A 4IPHA 1XNQQ 3F8TA 1L2FA 4UP8A 1IBKL 1C0AA 4X62L 1IBLL 2B29A 2JA7G 1EWIA 1IL2A 4DR4L 4YWMA 2VNUD 4JBMA 4A3GH 1PVOA 2ID0A 3CCUA 5LMUQ 1JMCA 1L1OA 2HQLA 5IP9H 3KDFB 4AQYL 2F4VQ 4WJ3M 4JI1Q 4A3KG 3AQQA 1VQJA 4IPCA 5GAHC 4DV2L 4C2MH 2ALYB 1NTGA 1BBWA 2AHOB 4JV5L 3I55A 2UXBQ 1I3QH 2HHHQ 2NVYH 3CMEA 4AH6A 1LYLA 4LF8Q 1CUKA 5JJLA 1YVCA 3PV0A 2N3SA 3E9IA 4JI0Q 1N34L 3GTQH 4DV7Q 5IP9G 4YY3L 2CFMA 1K73C 2K75A 1B8AA 4DAMA 4DAYB 1V1QA 1HNWQ 3NENA 1SRUA 5LMNQ 1PA6A 2CCZA 4A3DH 1VQNA 2HIVA 2D0PA 1OXUA 3PCOB 1YITA 4LWCA 4EX5A 3FP9A 4X64L 2A8VA 1QVCA 4R4TA 5BR8Q 2R92H 4B3TL 2UXBL 1UWVA 1MJEA 4A93H 1VQCA 1HZ9A 4A3LH 5M5XH 3GTKH 3PUVA 1VQEA 3E0EA 4J15A 1RIPA 2UUAL 1Q1BA 2VS1A 2OQ0A 1M1KC 4GKKQ 3UE1A 3PUYA 3HOUG 4O0AA 4JI4L 1U0LA 4DV4Q 1Q81C 3I4OA 5FLMH 3HOWH 3HFZB 3GTGH 2ZM6Q 4A93G 3J7ZC 4A3LG 3TEHB 1IYJB 1EIYB 1MJCA 3AFPA 1FJGQ 3CCEA 3GTMH 2JEAI 1Q1EA 1VQFA 5M5WH 1NMFA 1VQDA 1GKHA 2AKWB 3PUZA 4GOPC 1NE3A 2N8NA 5FLMG 3HOWG 1PH4A 1IXRA 1LM0A 4QY7A 3CCRA 3PO2G 1KHIA 2Z6KA 2QGQA 4UY8C 5IYDH 4IPGA 3CD6A 2IT1A 4IOAA 2PQAA 3G4SA 3HOXH 2R93G 2JE6I 1AE2A 1VQLA 1YZ6A 3RLNA 1YJNA 4JI2L 5C4JH 4JI8Q 5JEAG 5M3MH 4FDBA 4OXPA 2V1CC 2NVQH 4A3EH 3A5ZB 3BZKA 2AWOA 1SLJA 2VQEQ 4JYAQ 1K0RA 3HOYG 1PH1A 4UP7A 3TS2A 1L1OB 5GADC 5GAEC 1N36Q 1XMQQ 1KL9A 3JAMc 1NMGA 1QUQB 3K81C 1HR0W 2JA8H 3HOVH 5M3MG 5IE8A 4A3EG 1UE6A 1HNZL 4YCVA 2Q2TA 2UUCL 3HKZG 4BA1I 4JI3Q 2UU9Q 2UXDQ 2PI2E 3F2BA 1HR0L 3CCVA 3H0GG 1Q82C 1VQIA 2OWOA 4C3IH 1G51A 2YTXA 3F2CA 3MEFA 3M4OH 3F1ZA 3PUWA 5IYBH 1KIXA 1AH9A 1VS0A 4JOIC 1R9TH 3FHWA 2JA8G 4JI5L 1EUJA 4X66Q 1Q86C 4DUZL 4JBJA 3PO3G 1BVSA 3AEVA 4LUVA 1U5KA 3U4VA 1X6OA 4R4OA 3EBEA 4A75A 5IYBG 5AJ3Q 4LF9L 2UXDL 1V9PA 3PF4A 1L1OC 3B6YA 3S15H 4YWKA 4MNOA 3LGJA 2KBNA 1HZCA 1P16A 1Q46A 4AIMA 3I4NH 3ER0A 2RHSB 1VQOA 4DV3Q 2B63H 2WFWA 4DR1Q 1D7QA 4IPDA 4B3RL 1E7ZA 1JB7A 2EQSA 4HIDA 1GVPA 1VQHA 4X66L 2KHIA 3CF5A 3I4MG 1XNRQ 2UUBQ 4NXMQ 1A0IA 2VUMH 4YHHL 4DR2Q 1ASYA 2OCEA 4A76A 2I5HA 2IX0A 3I4NG 1HNWL 2K5VA 2ZJPA 2C35B 4OWXB 2B63G 1H95A 4JI7L 1HNXL 4POFA 1KC8C 1Z9FA 4GS3A 1XMOL 4DR6L 1Q8KA 2RHQB 3M9BA 4DR5Q 1GD7A 4DR3Q 1CSQA 3RLOA 2ASBA 3TRZA 4DV0L 4GKJL 4QJFA 4DUYL 4LF7L 2QA4A 2VUMG 1FGUA 1X3FA 1VQ7A 4LF5Q 3KLWA 1OXTA 1IZ6A 4DV6Q 3PIPA 1A63A 2LXKA 1QUQA 4KHZA 3PF5A 1I94Q 4LF4L 2PQAB 1CSPA 3GDEA 3A0JA 4DK3C 1K8AC 1D8LA 1VQKA 2IY5B 1K83H 4B3ML 5HGQA 1XJVA 3UE0A 1ASZA 4O2DA 1WOCA 3K80C 4LFAQ 4L5SA 1XNQL 1QZHA 5GROA 1PH7A 2N49A 3FKIH 3PUXA 1E24A 3S14H 3GD7A 1UE7A 3ZJYC 5C4XH 2PI2A 4HJ9A 3K0XA 3STBC 1A62A 5JEAJ 2VW9A 5LMUL 3U58A 1K8GA 3TS0A 1NBWA 3S1RH 1C9OA 1X55A 1Z47A 4NB3A 2F4VL 3S17H 1W3SA 4JI1L 1PH3A 2JA9A 3A5UA 1Q7YC 4YCWA 4X6AH 3UDXA 4GNXB 2K5HA 4DNIA 1SN8A 3FKIG 1VQAA 2Z6KC 1EYGA 2HHHL 4GN5A 1NJIC 1OTCA 1OXXK 4PZ6A 2E5LQ 5C4XG 3KF6A 4LF8L 4NPSA 4YWLA 4JI0L 4LFAL 4DV7L 4BY1H 1X65A 1WI5A 5LMNW 2A19A 1YHQA 1V43A 1VQBA 1YBYA 4P74A 4BY7H 2ZJQA 1X54A 1EOVA 5LMNL 1IBMQ 2CQOA 2LXJA 3PO2H 4BBRH 3KJPA 2I0QA 3NBHB 4APVA 1KRTA 3D0FA 4L5RC 2ES2A 5IYCG 4BY1G 1S40A 2R93H 1OXVA 1XPUA 2Y0SE 3G48A 5BR8L 1KXLA 4XTCS 4LFBQ 2H5XA 4BY7G 1Y1VH 1J6QA 1C7YA 3T1YQ 2NVTH 2BH2A 4BBRG 4GKKL 3AFQA 5EAYA 1E3PA 2HT1A 4KHPQ 2RF4A 3W1BA 4AYBE 2MNAA 1AE3A 2MO0A 1P8LA 3D31A 3ULLA 3MXNB 4DV4L 3J81j 4DV5Q 1IBML 2Y0SG 3CCLA 3HOYH 3ICEA 4IJHA 2ZM6L 4DKAC 1Y1VG 4R4IA 4OO1G 2HIXA 1FJGL 2GVAA 1K3RA 1SMXA 1Y14B 1YHBA 2RCNA 4HIMA 1HH2P 3CPFA 1HZBA 3M4PA 2WAQE 3KJOA 4RMFA 3H0GH 3KF8B 2JA6H 2BA0A 4EQ5A 3L0OA 4GLAC 3RN5A 3J80i 1JJ2A 2I5LX 4XIGS 2JK8A 2NZHA 1DGSA 4DK6C 3OW2A 4DR7Q 2UXCQ 3I2ZA 4OWWB 2R6GA 4MZ9A 1M90C 3CC2A 4GNXA 4QIWE 3KFUA 4LF6Q 2IX1A 3S1MH 2MO1A 3PO3H 2EIFA 2F52A 2WAQG 3OTOQ 2JA5G 1N33Q 4A3FH 5C0XG 4OONA 4JI8L 2JA6G 3TREA 2YYZA 3RZOH 1XPRA 2ATWA 3G71A 5JJKA 1S3OA 4IFDG 1JE5A 2KHJA 2A1AA 3BJUA 1PYSB 4C3JH 2VQEL 1TWAH 1YJWA 1PH5A 4KI0A 1K9MC 1HZAA 1MIUA 4JI6Q 4JYAL 5JJIA 1VQ9A 5IWAQ 3Q8DA 4BXXG 3ERSX 1N32Q 1N36L 1XMQL 3S1NH 1SE8A 4A3FG 3W5OA 1B7YB 2ZTCA 1TWGH 4JCVE 2L15A 4LFCQ 3I4MH 5C0XI 4JI3L 4IJLA 2R7ZH 3AYHB 4QL5A 2UU9L 4OX9Q 4NXNQ 3S2DH 2JEBI 1YI2A 2PNHA 3KF6B 3T1HQ 4ME3A 3WWVA 5J3BA 3SGIA 2R7DA 2D0OA 2K4KA 3J80c 2YU9H 1E22A 3HOZH 4C3HH 2VQFQ 4DV1Q 5FLXc 1NY4A 3I56A 1VQ6A 2R7ZG 3L2PA 2DGYA 3W1GA 2JJQA 4P73A 1YIJA 1J5EQ 1A8VA 1X3GA 3RN2A 3CC4A 3IRBA
chains in the Genus database with same CATH superfamily
3SK6A 5AJ3L 3JAMW 1RJTA 3NHHA 1HJPA 2R7FA 4KD4A 2B8GA 2GN5A 3VYRA 4EQOA 2D62A 1W6JA 4ZQ3A 5IP7H 5CV8A 2K5DA 1N8RC 3QB3A 3HOZG 3QZ8A 5M5YH 4XT3B 3PGZA 3JAML 4FBUA 1GO3E 4B3MH 1IBKQ 5C1PA 5CMDA 4X62Q 5KG0A 3GV7B 3LP8A 4DR4Q 2PMZB 2K14A 3KOJA 2WAQA 1YJ9A 2UUBL 4BWGB 3O13A 3GTLB 5IP7G 2N55A 2RCFA 3PSIA 2B2WC 3KLRA 2O5IC 5KFCA 4DR2L 3RMHA 2XRQD 4JOIA 4DV6H 4P72A 1HUMA 3RR5A 5DG7A 1N34Q 1MGSA 2FINB 2CKZB 4UAIA 5EKLA 1VDZA 3CU7A 1EYAA 3GIJA 2R3ZA 1JCKB 2DPJA 2FB9A 5EKKA 4IUQA 3M9MB 4LFAH 4DV7H 2O2LD 3K8AA 3KYHC 5LL6X 4Q45A 2G9DA 5DM63 1I94L 4NMZA 1LTTD 1S9FA 2F0TA 2E2HA 3MTSA 5D14A 4X64Q 3J7A5 2N78A 2WB1E 4X3UA 1S0MA 3V05A 4H7BA 2G9HD 2XTIA 3CPWA 5KG2A 4R1JA 3BU2A 4CJ0B 4NKLA 1VAJA 4DXGA 4LUZA 2YV5A 4WFN3 4U6PA 2WB1G 4ZQIA 3H6MA 2VB3X 4GOPB 1EQTA 3T5LA 3ZYYX 1IBMH 3EIVA 1KD1C 3K58A 4RH6A 2F0DA 4A3JB 4KY7A 2R8GA 2ZM6H 1V1PB 3OPOA 5M9OA 2F4IA 1I6HH 2PMZA 4TV9F 3S9WA 3UQ8A 1CKMA 2MQHA 3T16A 4LSAA 1D5XC 4JPBW 1S5ED 1ZEQX 3GTLA 1VKZA 4HJ7A 2R92G 4PV1C 4YCUA 3FDSA 3GQCA 1B9MA 1GUNA 4Y8VB 3G6EA 3GO5A 2HDLA 1SE3A 4JC0A 2Z0SA 3PIOA 2JA5H 4LFBL 2K5QA 1LT4D 3T1YL 3D4RA 3BDLA 2PBZA 1FL0A 1FD7D 3UDGA 2IHEA 5KFPA 2MCTA 1I50B 3S16H 1S5DD 2OTLA 4I7AA 4OL7A 1YHAA 1AUXA 3HOUH 4FNFA 2JSOA 5IY0A 1WTXA 2QILA 4PG3A 4H02A 2CQYA 2FP4B 4KY6A 3VR5A 2UUCQ 2OTJA 4QW8A 1A6XA 4HCSA 1SXTA 4A3BH 4UCTA 1I4HA 1ENAA 2KJXA 5KFYA 1RODA 1GSHA 3HOXB 1KEEA 5IYDG 2F1MA 3HKZE 5GAGC 2FHTA 1XPOA 3NGDA 1LTGD 4JI5Q 2X69A 4DUZQ 3RZDB 2NVQB 2MFIA 2FXQA 4A3BG 4NW2A 2OH2A 3GTOB 2W9BA 3MXPA 4GOPA 1I5FA 3M4QA 2DNEA 2K28A 4CKBA 2WP8J 3I73A 4KJOA 4IFDI 1BR9A 4GN4B 1JE4A 2LSSA 3BVZA 1G2SA 3CAMA 3F8NA 5E4WC 3H15A 4JI6L 3PW0A 2VL6A 2EPBA 3H94A 1EWCA 1G291 3GILA 3VYTA 3A74A 4XQNA 4IZOA 3MC0B 4YHHQ 2QW7A 1Y1WB 3AMUA 4LFCL 2L55A 1BCPB 3V4ZA 2MP1A 4M8AA 3CCMA 3EN2A 4MV4A 2UUBH 2UVUA 5I47A 2ALZA 1NNXA 4CBVA 4J6HA 4KK7A 1UEAB 4DR2H 1PFMA 3TN2A 4LF7Q 1PH2A 1I50A 5I6YA 2VQFL 1VQ4A 2J7ZA 1B53A 4RFBA 4LF4Q 2F3IA 2A68D 1RHPA 2QEXA 1E4GT 3L9AX 4KD3A 4X65L 1IOWA 5I2YA 4JBWA 4LW1A 4A3KH 2R7KA 1LTLA 2V4QA 4Y7NB 1I94H 2P5ZX 4A4IA 5JOBA 4IPHA 5H80A 2W8KA 5GONF 2YRXA 1C0AA 3JSNA 5LMUQ 1JMCA 5IP9H 4Q8FA 1QNUA 2VPSA 4JI1Q 1GUSA 4A3KG 2WE6A 3AQQA 2BDNA 3GTOA 3ORQA 5EGTA 4JV5L 3MJFA 4JUZA 2UXBQ 3RIZA 3RJ0A 3SEBA 3CMEA 1D5MC 1LYLA 1SDFA 4AH6A 4HSVA 4F8MA 5JJLA 2N3SA 3E9IA 4JI0Q 3I70A 3GTQH 1CQJB 5IP9G 4YY3L 3FPPA 3EFXD 1PLFA 2ZJTA 1S5BD 2K75A 1B8AA 1I3QB 2H4OA 4Z9CB 2F0LA 1WTPA 5DLFA 2CCZA 3EYYA 1MBYA 2W6NA 1ICWA 1VQNA 2R8JA 4RUCA 2VA2A 5EDWA 2A74C 4ID6A 1OXUA 1PYWD 2EYLA 3PCOB 1YITA 4LWCA 4I55F 2NU7B 1QVCA 5BR8Q 4B3TL 4RKLA 3S1RB 2J9GA 5CAEB 1EU3A 1ZKOA 2WYOA 1HZ9A 2OXPA 3QO2A 2MGSA 2ZXOA 3GTKH 3TIGA 1VQEA 1TIID 5CYUA 3PUYA 5FPOA 4LFBH 2A6HD 1H9KA 1TS3A 1YNNC 1JOKA 3T1YH 3I4OA 4RGMA 5FLMH 3RD4A 5M5XB 3HOWH 1D2BA 2B63A 1JKJB 2A73B 4FF4A 5HBRB 2J6TA 1MJCA 1TY2A 1FJGQ 1Q90A 1PTOD 3V2TA 4MTDA 5BPHA 2FLPA 2CH4W 5M5WH 1AUVA 1STEA 4FBTA 4MTKA 3ND9A 4MAMA 3I4LA 5FLMG 3HOWG 1O80A 4ECYA 3GTMB 2QK4A 3CD6A 3G4SA 2R93G 1Q3LA 5CBEE 1YZ6A 3RLNA 5IGCA 5KT4A 4L63B 4DGZA 4JI2L 3QJYA 1JX4A 4C5CA 3HOYB 2AWOA 1SLJA 2VQEQ 5IGFA 4ZCKA 4HMJA 4JYAQ 1K0RA 3MWDA 3WNZA 1KBLA 4KN4C 1XMQQ 4CC5A 3J7AF 1EYZA 3HKZB 3UFXB 3HOVH 4JI6H 2R8IA 5NUCA 4O2AF 2JA6B 2UXDQ 4YP3A 2PI2E 3QR8A 1Q82C 4M9UA 5KG7A 1VQIA 2R87A 1T94A 3F2CA 5KFLA 3KLSX 2YU9B 1KIXA 1VS0A 2ZXPA 2SNSA 3RUZA 3PO3B 3NTHA 4FF1A 1II3A 1QWYA 3I3CA 1EZ8A 2WV6D 4LUVA 4KJNA 4RNOA 2AGOA 4FVMA 2VQFH 3K0YA 4KKUA 4A75A 4B3RH 3Q8PB 1IL8A 2OT2A 1L1OC 4RHRA 4EBCA 2HVSA 4YWKA 2EJGC 3LGJA 1P16A 1Q46A 1TWGB 1STBA 4X65H 4FS2A 2RHSB 4DV3Q 2W6PA 5A35A 1E7ZA 1JB7A 2EQSA 1VQHA 2W9AA 3I4MG 4NXMQ 1A0IA 2F0UA 4CC6A 4OEMB 4EGVA 4ZK9B 2YS6A 1DM0B 2EVBA 1XDNA 1HNWL 4DXFA 2C35B 4G7HC 4POFA 2NZ1D 2VUMB 2EYHA 3J7YW 3M9BA 4DR5Q 2ASLA 1S0NA 4TRDA 4JV5H 4ED1A 1KTKA 4DUYL 4J9MA 5K2MA 3RAQA 2RDJA 1VQ7A 1KDBA 2O4XA 4CDEC 3DM1A 1JORA 4YY3H 2FMAA 3FMAA 2LXKA 1EY4A 3K57A 1VQKA 1I4RA 2JA6A 4RB1A 1FGBD 2XRSD 2AUJD 3N6RA 2MUYA 4O2DA 2VXWA 1XNQL 3BA8A 1QZHA 1O75A 5D1PA 1E24A 3S14H 4HJ9A 2HHHH 4B3TH 2FPPB 4K8JA 1C9OA 1WH2A 1WTHA 1Q7YC 1MHWC 3FKIB 4K5VA 4N8FA 1PK8A 2K5HA 3DMUA 3NTKA 1JB3A 1RCVD 1VQAA 2Z6KC 4ED8A 1OTCA 3S17B 2R84A 2E5LQ 1B6SA 4L1KA 4YWLA 1TWGA 1SYXB 3FEWX 4BY1H 1EFID 3OOCA 2V4RA 4HNUA 4ECRA 1VQBA 1X54A 1EOVA 1ZHQA 2L12A 2WKCA 1EEID 3MFGA 3R3OA 2E2IB 3VMMA 2K32A 3IL8A 4BY1G 2HGSA 3MWYW 1IYUA 1S40A 5KFSA 2Y0SE 4XTCS 1Y1VH 1PX2A 5K5PA 4JI2H 1Z2NX 1WVLA 1HQMC 4GKKL 5EAYA 1E3PA 2RF4A 1YNND 2CZGA 4RGOS 5EOYA 3D31A 5CC4A 4DV4L 3CCLA 2Y0SG 4HCEA 4HSPA 3SHLA 4IJHA 2F03A 2PZTA 3WO1A 1PTOF 1Y1VG 3QG1A 4AYBB 2GVAA 4HAEA 2ZDQA 5C3WA 1SMXA 2RCNA 1B33N 1D1IA 3EPGA 4H0LC 2I80A 2WAQE 4RMFA 3RN5A 4U7CA 3MR2A 1LABA 3J80i 1JJ2A 1BNZA 2HCIA 1A15A 2UXCQ 4TQRA 1LTRD 2R6GA 1KDAA 3K3VA 1M90C 5IODA 3PIO3 4LF6Q 2RGVA 5LOVF 2MO1A 3HXLA 3M9OB 2WAQG 2X6LA 3OTOQ 5C8YF 1PZID 1ENCA 1DOLA 2YYZA 1XPRA 4QIWB 2KHJA 3A54A 3NUCA 1TWAH 2XSCA 4A3FB 5L1IA 4BXXG 3ERSX 2RA4A 1GGOA 1N32Q 1N36L 2NYZD 3S1NH 1NR4A 2UVRA 2ZTCA 1O78A 2E2IA 1LO5D 3TQ1A 1PRTB 4YBZB 2ENBA 2L15A 5KKNB 3QZ7A 2UU9L 4NXNQ 4B08A 5KFIA 4FXDA 4Q44A 2EOTA 4RCOA 4J9SA 5J3BA 1SYEA 1FR3A 2NB0A 4DK1A 2YU9H 1HNWH 2R7ZB 1O7LA 1NY4A 3I56A 2YL2A 4IZ8A 4LK1C 3W1GA 1J5EQ 4DR1H 3CC4A 3GIDA 4PZ7A 4C3HB 2PMZE 1TXYA 4AYBA 3PR5B 4ZKBB 4HJ8A 3I91A 4KLKA 3K5OA 1R4QB 1TWHB 2TSSA 2KCTA 2Q2HA 1IBLQ 1EFWA 4DAVA 1ESRA 1Y69U 1XNQH 3A55A 1ML0D 1LUZA 4FXKC 4HJ5A 4QCLA 4AQYQ 3GTJA 4J8QA 4ZRZA 2NZOA 2L5TA 2WTFA 5E3FA 3MHBA 4DV2Q 1PHJA 3GV5B 2I87A 3NEMA 2AGPA 3E5NA 1KAWA 5E7NA 4QIWA 2RDGA 2HDMA 2Q2IA 1PYBA 3S1QH 5LP6F 2R7LA 5CA1F 1SE2A 2GLTA 1EQRA 4LF5L 5K36H 5KG1A 4BA2I 4F50A 2W57A 1JIHA 3VA7A 4DV6L 4MV9A 5A2QE 2CHBD 4ETSA 5KFNA 3K5HA 3LWEA 3OSNA 2DN8A 4A3GB 1RL2A 5K36G 3CQZH 5IYCH 2AQ4A 4J9KA 2XVSA 4RAZA 1B70B 4C2MB 2ZTEA 3D4DA 3U4ZA 2UUAQ 5C0XJ 4UP9A 2I5MX 5EPLA 2GPWA 2NVYB 3RB4A 3QFFA 3CKIB 4JI4Q 4K0KQ 4A3JH 2NVXH 3VYSA 2B2VC 4UPAA 4OIKA 4QWAA 2KEDA 5EWEA 4NDXA 4WD3A 3S2HB 5JVH3 3CW2C 4DV4H 1TWHA 1LTSD 4A3DB 1VQ5A 3PN1A 4WJ4A 4F4ZA 4O3SA 4GNXC 5DG9A 1VCIA 1F2ZA 5EPJA 4A3JG 4MTNA 4K6LA 5EQ0A 1G2TA 1RF2D 4RHSA 1TWFH 3EJIA 3K7AB 2ZT9C 1SFOB 4L5TA 3BQ1A 4ZKCB 3L4KA 5KFOA 3PW4A 5D3IB 3EVQA 3TBIB 1I50H 2OQKA 4DV5H 1MKHA 5T1IA 4Y52H 3BQ0A 1E2ZA 4LMQD 1AZPA 2BA1A 2WACA 3LWUA 3J81c 5JAVA 1FYCA 3GTPH 2Q8IB 5KFDA 2I07B 4IR1A 1I6UA 1SJED 2X6GA 4IFDH 3S24A 1S97A 3KDFA 1XTDA 4CJ2C 4I7HA 4WBNF 4ZAIA 2QDBA 2C2DA 4I4TF 2XD4A 1RK6A 2AMCB 1JOOA 2XWBB 2XC9A 1HNZQ 1JJGA 3RBEA 1N36H 1HR0Q 4B9XA 4YR3A 1NSNS 3RZDH 5LA6F 2C2EA 2CW8A 3H3VI 4C2MA 1CI3M 3GTOH 1I7NA 2UU9H 3D4WA 3OSOA 4QUFA 3NBIA 3HOXG 3IKJA 2NVYA 2ICEC 5C4JB 1IYVA 1FNUA 3R2TA 4DR7L 2XGTA 4EYIB 2JQOA 2E8GA 2SCUB 1BKBA 1L0WA 4CGYB 1T3NA 1PFNA 4LF9Q 1N33L 2E2JB 2V9WA 1SBBB 3P7JA 1IHZA 1YEZA 2W6ZA 1PV4A 2GPSA 2R8HA 4K6DA 1Y1WH 3NELA 1GYFA 2Q8TA 1S72A 5IWAL 1SNOA 2F0FA 5DLQE 2K52A 3NWSA 1YNXA 2PCFB 1QVFA 3M3YB 3R2IA 1G6PA 2E75C 1R9TB 2HVRA 3TMEA 1WCMB 1Z6HA 3CCSA 4OX9L 2VUGA 1KRSA 3K7UC 2BE5C 2K5WA 2KCMA 1Y1WG 4JI7Q 1HNXQ 3FPUB 3JRXA 3U9SA 1N48A 1XMOQ 1S10A 4GKJQ 2XIGA 3GTGA 1E1TA 1N56A 1MZBA 5M3FB 5BPFA 4HIKA 1JICA 3RV4A 1TWCH 4E6IA 4DV1L 4L5QA 4Y7NH 1UNSA 2JA7H 4RGTA 4LF5H 3I4NB 5HURA 4YIJA 4B3SL 4B3MQ 5I4DA 4R8NA 2DJFC 1PRTF 3TQTA 2QDLA 1J8IA 5CB4F 2FJZA 1BGWA 4XYMB 3V96A 2W6OA 3Q8SB 3HBLA 3A8KE 2JA7G 1EWIA 1BCPC 2HQEA 4JBMA 2ID0A 3X3MA 3M9NB 2EYPA 3R93A 3G6YA 3FDTA 4KN7C 2F4VQ 5LYJF 1N34H 3ND8A 1A2TA 1B9NA 1VQJA 2A6ED 2OF1A 2ZDGA 3OWEB 1B6RA 3L3OC 3J80L 2DY7A 1NTGA 5FPRA 3HG9A 1I3QH 2KEEA 4IHJF 1EY7A 3G6JB 5I9OA 4DV7Q 2CFMA 4PNYA 1I6VC 1KJIA 4GC7A 4UCSA 1QNKA 2KVMA 4EYHB 2LFNA 3PW7A 2EJMA 2BQRA 3RGXA 4LMYA 3FRPB 2HIVA 1CQFA 1R9TA 2W9BB 2RSNA 3OHXC 4XYQA 5KYLA 1HHVA 1WCMA 3OWFA 4EX5A 1AW7A 3FP9A 2A8VA 2R92H 2UXBL 2C9OA 1F77A 2R7NA 1CS0A 2B2YA 5M5XH 1M4VA 3V4SA 3PUVA 5FO7B 1EUCB 4ZHQF 2VS1A 2MJ8A 3UE1A 4QW9A 2CVRA 3TP7A 1ZQ7A 1F9RA 1EZ6A 1Q81C 3IG0A 3CVZA 1ONLA 2ZM6Q 3J7ZC 1EIYB 3W2DA 3AFPA 2XCPA 3CCEA 3GTMH 1VQFA 2J6SA 1NMFA 1GKHA 3PO2B 4C56C 5KFJA 1KJ8A 4QY7A 3CCRA 1KHIA 2FK1A 2QGQA 5IYDH 2IT1A 3VPCA 2YZMA 2PQAA 3KLSA 3Q23A 2F3WA 5IOCA 1STGA 4LJZC 2XWJB 4PMBA 1H9SA 4DR7H 4EBDA 2XIWA 4JI8Q 3EA6A 3MEHA 3HP3A 1ZYRC 2B2UC 2A5HA 2YS7A 1KJJA 1N33H 4NLGA 1EY0A 3Q8RB 2UUCH 3HOYG 1DOMA 4UP7A 3N52A 5M3MB 5GADC 5GAEC 3JAMc 1MSGA 1W6KA 1VMCA 3H0GB 3KBGA 5IWAH 4JI5H 2HCCA 5C5MA 1TY0A 1SNDA 1UE6A 1IW7C 4YCVA 2FMCA 3HKZG 5DNFA 4JI3Q 2DWCA 4P2CB 3F2BA 1W96A 3CCVA 2PW7A 5CR3A 2YTXA 4MV8A 1M0WA 3MEFA 4XZ3B 4XYOA 1WTOA 1AH9A 2PNRC 3S1MB 4OX9H 3FHWA 1SJHD 4R8IA 1E4FT 4X66Q 2Z4HA 4J9NA 4JBJA 3PO3G 3M4OB 4RKBA 3AEVA 3PR4A 1U5KA 1XTCD 4J9RA 4HQ6A 3U4VA 4XQJA 2YW2A 4R4OA 4DV1H 1HTLD 4DN4M 5AJ3Q 2UXDL 5KFVA 3PF4A 1T5EA 1G6ZA 3WO0A 1QJOA 2KCNA 1H9JA 1GLVA 2HD3A 5KT5A 2KBNA 4DAPA 4B3SH 4IUPA 4DK0A 2F0KA 3ER0A 3Q22A 1M7JA 2RDFA 4B3RL 1RD9D 4HIDA 3BG3A 2A69C 2KHIA 3S15B 1M0TA 1STYA 3TZUA 2UUBQ 2VUMH 2EY2A 2J4XA 2NTTA 3SE7A 3RBDA 2B63B 4DR2Q 3BABA 2OCEA 5L1JA 2I5HA 2IX0A 2BE5D 1RJPA 4OWXB 2HUGA 1H95A 2BOSA 4QWEA 2XN9C 2PO4A 4DR6L 1Q8KA 4G3IA 1GD7A 4N9TA 3RLOA 3J80E 2NTSA 4DV0L 4YAKB 3DWQA 3KF8A 1JWMD 4IUTA 4QJFA 2VUMG 1FGUA 1X3FA 4R9WA 4RNNA 1OXTA 4F7XA 2FK3A 4K8IA 1STAA 3PIPA 1I94Q 4JVZA 4DNTB 5M5YB 3H0GA 3A0JA 4DK3C 4IUUA 1F9PA 2DJGC 1K83H 5LMUH 2H1EA 2KA7A 3A7AB 4ED7A 4FP5D 3BAAA 4JI1H 3K80C 4L5SA 1D1KA 3FKIH 1BCPD 3ZJYC 2UXBH 1GHKA 1AN8A 3STBC 1A62A 5JEAJ 2VW9A 2MHVA 3ERQA 4I65A 3TS0A 3S17H 1Z47A 1F2YA 4NB3A 4ECZA 1W3SA 1U4LA 1PTOB 2JA9A 4N8X1 3SR1A 1VF5C 2FPIB 3FKIG 2B2TC 2HHHL 1TS2A 4LF8L 4ZLTF 4DLKA 4ILWA 3CHBD 4ULLA 3TDQA 4HN7A 2B2WA 5LMNW 4IRKA 4DL7A 1H9MA 3VR4A 1K3BC 4P74A 2Z8LA 2Z9HA 5LMNL 2LXJA 3RB3A 1U4RA 3KJPA 5LL6b 4WRDA 5IGBA 4APVA 2W6QA 4DL6A 1T5XD 3SXHA 2ES2A 3KXYT 2R93H 3G48A 5FOBB 3HB9A 4KKSA 1KXLA 3M4IA 1SNPA 1E4EB 3J7AK 1UAPA 3PQIA 4LFBQ 1C7YA 2YZGA 3T1YQ 3BYYB 4RZRA 2EYFA 4EEQA 2ICIA 5KNBA 4ECUA 2HT1A 5DEHA 4AYBE 2SNMA 3ETHA 2MO0A 1P8LA 2AUKA 3ULLA 3MXNB 4G7OC 3J81j 2NVTB 5KFUA 3V6JA 1JWUD 3ICEA 1TA8A 2C00A 2V4DA 1I6HB 5ELCA 2K1BA 1PZJD 2FFKB 4OO1G 2HIXA 1EUDB 4YQWA 2PQEA 1K3RA 3K5IA 4A2AA 1Y14B 1YHBA 4HIMA 3M4PA 1WTVA 3I72A 3SK4A 5DQGA 1C3OA 3T51B 4EBEA 5KG5A 2SOBA 4YJ2F 2NZHA 2EY1A 3H09A 1SNQA 3OW2A 4UCVA 3I2ZA 4OWWB 2QF7A 3E0JA 2JA5B 4QIWE 2JYOA 5C4ZA 2K04A 3S16B 4A3FH 2E74C 2AQ2B 3K5MA 4ECQA 2QEJC 4OONA 3IN5A 1JDEA 3HOUB 4R8UA 1ZYRD 3TREA 1KJ9A 3RZOH 2K05A 2A1AA 1PH5A 2UXDH 4C3JH 5IT9E 4JI6Q 5EPKA 2P0AA 2HJWA 3Q8DA 2E76C 2WB1A 4ZOLF 4DF7A 4A3FG 2IMWP 5CBAE 3KUPA 4O42A 1IW7D 4LFCQ 5C0XI 2R7ZH 3I4MH 3AYHB 4QL5A 4C3JG 2DY8A 3S2DH 1KC7A 1E4EA 4E4TA 3K3PA 3OUUA 3WWVA 3SGIA 2D0OA 3TINA 2JEGA 3GV8B 4C3HH 2VQFQ 1TS4A 4DR6H 2JN4A 2L1BA 1EWHA 3MXNA 4RCNA 3C46A 2R7ZG 4QWBA 1XYIA 1CT1D 2DGYA 5KGUA 3A56A 2R6FA 4MA0A 2W7PA 4DV0H 1A8VA 1EY5A 3GV6A 3IRBA 4X65Q 3RLFA 1DOKA 1PH8A 1QZGA 1FKAH 2K5NA 4C3HG 1S0OA 5C6AA 3TQYA 3UI2A 1PFSA 4ZYSA 4MV6A 3C2PA 4XXEA 1C30A 4DR1L 1CKNB 2C5CA 2VOBA 5CGKA 3C3LA 2A69D 1VQPA 4BBSH 2ZTDA 2JA5A 1XNRL 2JEJA 1I7LA 1X3EA 4RA8A 3JZIA 3N8DA 3VDYA 1ESFA 1BOSA 4JV5Q 2DNCA 4TV8F 1U9RA 5GQOA 5CA0F 4U68A 4YY3Q 5ELBA 4DR3L 4BBSG 3RNUA 1ET6A 1VMPA 5JUMA 1VQ8A 4LF8H 3DM3A 3GV3A 5JPMC 4O3RA 4TSSA 1X32A 2EYOA 4R4QA 2VQDA 1EIGA 2XGPA 4FF2A 5DAUA 4V190 3MZ5A 5LMNH 3BZCA 5A2QW 5ISRA 3MAQA 5E4XA 2BQ3A 3BVMA 4B3TQ 3OSPA 2NN6I 2PW5A 1VQMA 4A3GG 1EU4A 5A2QL 4JK1C 4IURA 4TQUS 3STBD 3KAJA 4Q0YA 1JQYD 1DJRD 3JC66 1WTQA 3S2HH 4IFDJ 2PN1A 2W70A 4EFEA 2CW7A 2EYMA 1EY6A 3E9HA 4GLVB 2BCOA 2DUDA 3BVGA 3OUZA 3PZPA 1E1OA 3H4BA 2QKIC 2JXMB 3K7AH 1SFOH 1HPCA 3G7LA 4OWTB 3DWPA 4FM9A 3CC7A 3R23A 1S03G 1CKNA 1EQQA 1EIFA 4A3DG 3OIPA 3VYUA 1UC9A 3H4DA 1F9SA 1GUWA 2ZXRA 1AFPA 2M05A 1KJQA 3F2DA 3H3VH 1X56A 4K0KL 4A3IB 5C44B 2JEIA 3JAMi 4HJAA 2YRWA 4JI2Q 5EZYF 3CMAA 3N44B 1EEFD 4BS9A 3GIKA 1ENFA 3HOWB 4MA5A 5C3EB 4EG0A 5CV9A 3PW2A 3OYYA 4UCOA 4EFBA 3KHHA 1JWSD 4LUOA 4KHPL 2V58A 3GTJB 4JW0A 5J1ZA 4IN3A 3JSLA 4DV5L 5CV7A 5M5WB 5ELNA 1EHIA 4BXXH 3A7LA 3KBXA 4OO1I 4IUNA 4QUCA 2XCLA 2EY6A 3NXWA 4A3MB 5G3LD 2DLNA 3SI8A 1XX8A 2E2JH 4LAAA 2E2HH 1UEBA 1F2LA 1VBGA 3EPIA 4POGA 3V6KA 2FK2A 3P75A 3E5SA 3H3VC 4GN3B 3GTQA 2PZUA 4JBKA 2B3GA 1KQSA 2FPGB 1KLUD 3M7NA 2F0NA 3DLLA 1N32H 3A8IE 4YJ3F 2VY3A 1B50A 4J0MA 1Y8NB 1DCZA 3E3XA 4PZ8A 4QMGA 3H40A 4ECWA 3MR5A 1JJCB 1BF4A 4DNRB 3M3YH 3HOVB 4HNTA 3RTXA 1WCMH 1GM5A 4TUYF 5KT6A 1ZHSA 5ELOA 5KEEA 1RJQA 5M3FH 1JR0D 2ZDHA 1SE4A 2R82A 4RG1A 1A3UA 1HNWQ 2IA6A 1XNRH 1H9RA 1I4QA 1MD2D 1O7IA 3HKSA 4IRDA 1WCMG 3T1HL 3GTLH 1WYDA 4P75A 4DUYQ 2OLSA 3U9OA 1SMYC 1NAPA 1B44D 2Z6BA 5M3FG 4DR3H 4ED3A 2SDFA 3CRKC 1WJJA 4K2LA 3TZDA 3VA5A 4ECTA 4JG2A 3WOEA 4I7ZC 1WFQA 1D5ZC 4IOCA 4GLXA 4V0BA 3RV3A 1W2BA 3N40P 1EZ1A 4UCRA 4QQBX 3I90A 1PH9A 1XNQQ 1L2FA 1IBKL 4X62L 4DR4L 4CHTB 3I12A 2KSWA 3CCUA 1L1OA 2HQLA 3KDFB 5DG8A 1XXGA 4O4HF 3RUPA 3NSWA 3URYA 1U4PA 4IPCA 4XDXA 5FLXW 2ALYB 1BBWA 2KQ3A 3I55A 5DM73 5FO9B 1HQRD 1K8MA 5FLXL 1SYFA 3NTIA 1Z7TA 1YVCA 3IAYA 1K0SA 1FNVA 2VPQA 1N34L 4N9PA 3PIP3 1GSAA 2TMPA 1TS5A 3NWTA 1DXMA 3T4AC 1CQVA 5J39A 1MI2A 3NENA 1SRUA 4ODGA 5KNCA 1D6EC 5JJZA 1YNJC 3MWEA 2F0WA 3ITPA 3BA9A 5IYZF 4X64L 4DFAA 1HFNA 3EQLC 4K0KH 2BR0A 3OW7A 1VQCA 5J2TF 4QF4A 4A3LH 1CZWA 4K2KA 4RAYA 4J15A 1Q1BA 2HVQA 2OQ0A 3JRWA 1M1KC 4GKKQ 1PXUA 1CM9A 2RSOA 4O0AA 4B9WA 2F0HA 2BQUA 1KNAA 4A93B 1U0LA 4DV4Q 1W93A 1GOZA 2EDGA 4KHPH 1WTRA 4A3LG 1IYJB 1F2MA 1B1ZA 1EY9A 4MV7A 3D6WA 1LT5D 4IWYA 1Q1EA 3KHGA 3MFHA 1VQDA 5T1GA 4HMIA 3GTGB 1JDBB 4GOPC 2AQ3B 1PH4A 3PO2G 2Z6KA 4UY8C 3C1EA 1SAPA 2RQXA 3NK9A 3HOXH 1Y1VB 3R5FA 2JE6I 5C4HA 4EVOA 3GIIA 3HZXA 1HA6A 3G8CA 4C5AA 5HV6A 4QWCA 5M3MH 4OXPA 4KMUC 2RKSA 2NVQH 4TQSA 4RZQA 1PFBA 5DQIA 2R8KA 3OMGA 4KV6A 3X3NA 3FMCA 4ED6A 1PH1A 3TS2A 1EY8A 4K5XA 1DYQA 1N36Q 3BYTB 1KL9A 4A3EB 4FU0A 4C5BA 1NMGA 1QUQB 3C0FB 5M3MG 1QCBD 5IE8A 2F0VA 2UUCL 3LNNA 2UU9Q 3H0GG 2OWOA 1G51A 3TP8A 1L2ZA 1JC7A 2JA8B 3M4OH 4EGJA 5IYBH 3J81E 1HRJA 4UHVA 3H91A 3N43B 2RGRA 4JI5L 2DPIA 5KX5F 1EUJA 4LH7A 5KT7A 3T1HH 3TP5A 4C3IB 4DUZL 1V51A 1BVSA 3A8JE 3NBHA 1I4GA 5BN5A 2NU6B 1R4PB 1X6OA 3NE5B 1JOQA 5C5LA 3EBEA 5IYBG 3U9TA 4F4XA 3R8BA 1BNCA 3DF7A 1Z2OX 1CZGA 3B6YA 2WKDA 4NP5A 3S15H 1B2TA 3S1NB 1TT2A 3Q2OA 2CH4A 1M8AA 5KIXA 3M7GA 1VQOA 2B63H 1D7QA 2WFWA 5KFAA 1LV9A 3SK8A 4YAJB 1GVPA 4X66L 3CF5A 1IBKH 1Y1VA 4X62H 2EE1A 4HTHA 1SEBD 2GA4B 2C22A 4DR4H 4YHHL 4O3PA 4J9PA 3DWAA 5KG4A 5D1OA 3K5NA 4A76A 1HCZA 1RK5A 2K5VA 4L6TB 2ZJPA 2B63G 1Y8PB 1M6VA 4CDDC 1TR5A 1BO0A 3TRZA 2D2CC 2ASBA 4LF7L 5EBDA 1SMYD 4LF5Q 1JLLB 5FLXE 2VB2X 3BJYA 3J80W 5C1OA 1SYDA 1I4XA 4DV6Q 1A63A 3KALA 5KFWA 1QUQA 4KHZA 4LF4L 3L4JA 5I6WA 2PQAB 4DU9A 1CSPA 2VR1A 1K8AC 1D8LA 1H9SB 1XJVA 1L0XB 2F4VH 1ASZA 2PZWA 1WOCA 4LFAQ 5GROA 1PTOH 3Q1KA 2AQ1B 3BZDB 2EXZA 1CE8A 1UE7A 4X64H 4RGNA 3K0XA 1A3TA 1GUOA 2XGQA 5LMUL 3MA2B 1C4QA 1NBWA 1X55A 2SEBD 3S1RH 4JI1L 4PMCA 1RJRA 2F0QA 1OWTA 1TWAA 3UDXA 4GNXB 3S1QB 5C4XB 2KHSA 4DNIA 3T5HA 1V1OA 1NJIC 1S4ZA 4ZUJA 4PZ6A 5EBCA 1G8ZD 3KF6A 4OELB 1X3QA 1BQQT 3K5LA 4NPSA 4JI0L 2LY7A 1RDPD 1X65A 3E6ZX 3RGZA 3HGBA 2A19A 4RUAA 2EZVA 4FYDA 1V43A 2JP1A 3T53B 4G57A 1IBMQ 2CQOA 3HRZC 2A6HC 3CQZB 3GIQA 2M9VA 1YNJD 4O1NA 2I0QA 4APMA 5IIFA 2YU9A 1KRTA 4QWDA 1CHPD 4HNVA 4BY7B 3RF2A 3LWBA 5BR8L 4EQPA 1PTOC 3T5JA 4BBRB 2NVXB 2NVTH 1J6QA 2QCPX 3PW5A 2KUMA 4RAUC 2EJFC 3SK5A 3AFQA 4TKOB 5EWGA 1AE3A 5KFZA 4K5WA 3VR3A 4C1NI 3HOYH 1CQIB 3VR2A 2R85A 4DKAC 1FJGL 1TWFB 1HH2P 1QG7A 3CPFA 1HZBA 2X0SA 3TIIA 1HFGA 2B2VA 3KJOA 1SCUB 5C0XH 3KF8B 4IRCA 2JA6H 4YR0A 1S5FD 2BA0A 3L0OA 1MSHA 3QOJA 4JI8H 2I5LX 2B39A 1DGSA 4DK6C 4DR7Q 1S68A 5CV5A 3HEJA 4MZ9A 2L0CA 2RBMA 5TSSA 5BN4A 3CC2A 4GNXA 2IWHA 4HR7B 4EQNA 2IX1A 3GTPB 2IPKD 3PO3H 2EIFA 2JA5G 1N33Q 4DUZH 1V4YA 4S3SA 4Q5VA 3VPBA 5C0XG 1UC8A 2JA6G 4IWXA 1ZXTA 3G6XA 1QILA 3FVQA 5JJKA 3RB0A 2FLLA 2J6UA 1JE5A 1ILQA 3BJUA 3D6CA 2VQEL 1LLRD 1YJWA 1K9MC 3HOUG 3KTMA 4KI0A 4JYAL 1HZAA 1MIUA 4JI3H 1VQ9A 5IWAQ 2UVVA 3DEOA 3CQZA 3LX0A 4XYLB 1XMQL 1SE8A 1WD1A 5IT9W 1B7YB 1GHJA 1TWGH 4JCVE 1V8QA 5EKIA 3ORRA 4YR2A 4M1UB 3T5KA 1GJXA 4X66H 2F0JA 5IT9L 4OX9Q 1ZETA 2FJ2A 2JEBI 1BUVT 1EL0A 5KFEA 2PNHA 3KAKA 4YHHH 2NVXA 4ME3A 1V1PA 1LTBD 2K4KA 3J80c 4IR9A 4DV1Q 1DV1A 3L2PA 5CV6A 3JAME 1HA5A 1DIKA 2F0GA 4LF7H 3MXUA 4GC6A 4P73A 1YIJA 2IL8A 4IUVA 4B3SQ 3VPDA 3HOZB 5HGTA 1TWFA 4LF4H 2K01A 5FO8B 5F9LA 5KFTA 1OXSC 3VR6A 5KT2A 5L1KA 2DZDA 4DV3L 2VZAA 3WDNA 5COYA 2NN6H 1E2WA 2KECA 4PDBA 2F3VA 4NXML 1SNCA 4HR7A 3TSSA 3GTPA 2F0EA 1KAAA 1UE5A 2B8FA 3QIAA 5L37A 1TWCB 1S5CD 1AN7A 5L9XA 3HS0C 2G5DA 2JA7B 4DR5L 1PZKD 2NN6G 5IGDA 1EIHA 2IHFA 5FJ8H 5HY6A 4Q8EA 2KENA 3SE0A 2W9CB 4JI0H 2AWNA 4ME5A 1X9NA 4M7EA 3V6HA 5KG6A 4RB2C 2IP4A 1TQOA 2K6AA 5ELEA 2F0SA 4OIJA 3CRLC 5E1FA 5FJ8G 3TP6A 1SROA 1A2UA 2D9UA 2RVLA 4R8UB 3MFIA 5KFFA 5F2DA 4ALPA 2E2IH 4WJWA 2RDIA 3I7FA 5KG3A 2F0OA 3CXCA 3J81i 4IO9A 2FE3A 5BR8H 4LSXA 3R5XA 1X3PA 2OEOA 2WB1B 3PMFA 2EXDA 2YTVA 2R7MA 1Y1WA 4JV0A 4MN3A 5KNDA 2YTYA 3MXGA 1Q8IA 3QOLA 5IGEA 3M85A 2E5LL 5KFGA 3U50C 4DA2A 4C1NK 4OO1H 4A3IH 5C44H 1RTOA 2Q2UA 1ILPA 1FJGH 1QVGA 2O03A 4RNMA 4P71A 4CKEA 4LNQA 2W6MA 1RTNA 2R92B 4ZUIA 3WOFA 4ED0A 2Q8RE 3GLKA 1FVIA 4PWQA 4J1MA 5C3EH 2W8LA 1TWCA 2Z4IA 4QGUA 1SYBA 4A3IG 5C44G 2K03A 3CCJA 3GTJH 2JA7A 2WIIB 1ICFB 4AYBG 2R61A 2C28A 3ULJA 1L0YB 2W9CA 2IX3A 3UDIA 4FO2A 4UDUC 5IT9c 4KHVA 1HXYD 5C3EG 4R4CA 1WD0A 2O5JC 2K50A 3OHBA 2GVBA 5D8DA 2VQEH 4OGQC 1PMRA 1AZQA 4JYAH 1O7ZA 5LHY1 4X3SA 4IQZA 4A3MH 4DPGA 1TAEA 2BH8A 1XMQH 1B04A 1N9WA 3K59A 1PH6A 4IALA 1E0BA 1CKOA 3KHLA 2N88A 1CFMA 5KFKA 3PVXA 5H1SE 3ULPA 1I3QA 4A3MG 4A3BB 2UXCL 2VA3A 2FLNA 4HIOA 4LF6L 1K8OA 1RYSA 3L7ZC 1QE6A 1AP0A 2UVWA 5CORA 3OTOL 2NUCA 4FS1A 4EGQA 3AB9A 5JH7F 4RU9A 1JT8A 1LACA 1UE1A 3UDFA 2E2DC 4A3CH 4RB3C 2ATLA 4LFCH 1DZ1A 1Q12A 3NQTA 2R92A 2CQAA 4B3RQ 3HOVG 3CCQA 4DL5A 1N32L 3EROA 2B2UA 1TWHH 4PMWA 3DXJC 4DV3H 2LS01 3CP0A 3AU7A 1SR3A 2ZJRA 4MV3A 2CWAA 1ET9A 1B3AA 4A3CG 4RB0A 4NXNL 3KK7A 4F4YA 4JV2A 1QB5D 4NXMH 1OO9B 1BBUA 2NUAB 4DR6Q 1PRTC 5D65A 4DV0Q 1VQGA 1J9OA 3OHAA 1BDOA 1C8CA 3GTMA 4DR5H 2CWPA 3MR3A 2L11A 1T9HA 1FNWA 1J5EL 4KTAA 5JQWA 4TVAB 4MHEA 2WDTA 3M4YA 1TVXA 3F8TA 3DHQA 3OIQA 4UP8A 3NP8A 1IBLL 3T56B 2B29A 2R86A 1IL2A 3GIPA 4YWMA 2VNUD 4A3KB 4A3GH 1PVOA 5JVDF 5L1LA 1VBHA 2PVPA 5DLGA 4AQYL 4WJ3M 2YZNA 2LMCB 1GUTA 5ELFA 3HKZA 5GAHC 3MR6A 4DV2L 4C2MH 3BG5A 4O3OA 4G7ZC 2AHOB 2HHHQ 5C5JA 2NVYH 1VF7A 1DV2A 4LF8Q 4F87A 1CUKA 3PV0A 1BCPF 5J22A 3Q24A 5BMVF 3RAXA 1ULZA 2I46A 5IGGA 1B4OA 1K73C 5LL6S 1K83B 4DAMA 4DAYB 2E5LH 3NQIA 4H44C 3RB6A 2EYJA 1V1QA 2Z1CA 4U673 1PA6A 5LMNQ 1B3QA 4FXGC 3GTQB 1LT6D 4A3DH 3C1FA 3KHRA 4X3TA 1SSOA 4ECVA 2D0PA 2PYKA 4RWSC 1SNMA 2V5AA 1K1QA 5JPNC 1I4PA 2WINB 5BN3A 4HEDA 5I2XA 1CA6A 4R4TA 1G91A 1LT3D 3QWNA 1UWVA 1MJEA 4A93H 4IAJA 2V59A 4KY5A 3E0EA 1RIPA 2UUAL 1IKLA 4DL2A 1EYCA 4JI4L 4I50F 2C2RA 1EQVA 3GTKB 3HFZB 3GTGH 4O3NA 4A93G 4A2BA 3TEHB 5T14A 1C48A 2JEAI 2VUMA 2AKWB 3PUZA 2EY5A 1NE3A 5JEAH 2N8NA 2ASDA 5F9NA 2IBKA 4QB4A 1IXRA 1LM0A 2B2TA 2R93B 1HTPA 3F2UA 4Q0FA 2W71A 1GSOA 1BXTA 4IPGA 5KFRA 4IOAA 1RYRA 1DONA 4J9QA 1SYCA 1AE2A 4ED2A 3J7AV 1VQLA 5CV4A 2UXCH 1YJNA 5C4JH 5JEAG 4FDBA 2V1CC 4LF6H 4A3EH 4F4WA 2CW0C 3A5ZB 1NUCA 3BZKA 1XWEA 2AU0A 3OTOH 1K83A 4DAYA 4J9OA 5FD6A 5KFQA 2F0PA 1L1OB 4DL4A 4G4KA 2AGQA 4Q43A 1QOHA 1F9QA 3FKIA 3MWMA 3K81C 3GQBA 1HR0W 2JA8H 3G6VA 1BXRA 3RFCA 4O4LF 3SDZA 4A3EG 1HNZL 2Q2TA 5LXTF 4BA1I 1HR0L 3H20A 1WR2A 4C3IH 2YYAA 2RDHA 3ETJA 3F1ZA 3PUWA 5EWFA 5KFBA 4JOIC 1R9TH 4NXNH 3D3RA 2JA8G 2NWGA 2FKLA 3J81W 1Q86C 1STHA 3RZOB 3Q6SA 3GTKA 2L4NA 3BDCA 5KFHA 4EEYA 4C3IG 4UCUA 4BWSC 3J81L 4C3JB 4LF9L 1V9PA 4CJ1B 5J2UF 3ONAB 1J5EH 4YB8B 4MNOA 1HZCA 4AIMA 4F88A 3I4NH 1IOVA 3SVMA 4DR1Q 4X3KA 3I4MB 4IPDA 4OHJA 2R93A 1NCVA 2NU8B 5KFMA 3S2DB 4XT1B 1IBLH 1XNRQ 3N42B 4DUYH 1TU2B 2FMMA 2BDOA 2M2LA 1ASYA 4FF3A 5I9PA 4AQYH 3I4NG 2J0TD 3BDOA 4JI7L 1HNXL 1KC8C 1CTMA 1Z9FA 4GS3A 1XMOL 2RHQB 4DV2H 1PRTD 4DR3Q 4GKJL 1CSQA 3N41B 1LTID 1SEIA 5KFXA 3P1HA 2QA4A 2W7OA 2IJ0A 3KLWA 4ZI7F 3T13A 1IZ6A 1KABA 3PF5A 3R5HA 4DL3A 1BBXC 4LH6A 5DQHA 1JXLA 2B2YC 3GDEA 5AFWA 2A6EC 2IY5B 5KT3A 1E2VA 4B3ML 4CDFC 3BS1A 1BJTA 5HGQA 2KOLA 1K28A 3UE0A 4BBSB 4CDCC 5DGAA 1UUPA 1PH7A 1AEXA 1TKWB 2N49A 3PUXA 1GUGA 3GD7A 3OMCA 5C4XH 2PI2A 1U4MA 3U58A 5FD5A 1K8GA 1KLGD 2F4VL 1PH3A 3A5UA 1PDQA 3DUZA 2UUAH 4YCWA 3S14B 4X6AH 1EYDA 1KNEA 1SN8A 3Q8QB 3GIMA 4K14A 4JI4H 1EYGA 2DIKA 4GN5A 1OXXK 5C4XG 3GP7A 1WSCA 1EOTA 3I8ZA 4WORA 4LFAL 4DV7L 4L8JA 5FKAC 2ASJA 1WI5A 2K33A 2R7ZA 1YHQA 4J9LA 1A9XA 4BY7H 1YBYA 1NR2A 2ZJQA 2KCCA 2IW3A 3PO2H 4BBRH 4BY1B 4MTEA 3MVVA 3NBHB 1WTWA 4ECXA 2XCAA 4GKKH 3D0FA 4L5RC 5IYCG 1OXVA 4ECSA 1XPUA 1IKMA 4CKCA 4MV1A 2H5XA 4BY7G 2BH2A 1GXDC 5FK9C 4BBRG 1HUNA 3NPPA 2Y0SB 4KHPQ 3W1BA 2MNAA 5C3XA 1RKNA 4XQQA 1IBML 4DV5Q 2NU9B 1DD2A 2ZM6L 5JVLA 5D1OB 4R4IA 5JVG3 1Z2PX 1HNZH 3H0GH 3N6XA 1HR0H 1SYGA 4EQ5A 4GLAC 4H13C 4XIGS 2JK8A 2NBFA 4MIUA 4PQXA 1K1SA 1O7YA 4O4IF 3IFTA 5EJWA 4HYKA 2WAQB 3DEPA 5KYIA 2XNAC 5ELDA 2MPMA 3KFUA 4ME6A 3S1MH 2F52A 2K7VA 3W3AA 2M00A 4JV1A 4JI8L 2F0MA 5G3LF 3BQ2A 2ATWA 3G71A 2CW0D 1S3OA 4IFDG 3Q0AA 4LF9H 1PYSB 1CK1A 3D8GA 5KRUA 4GZYC 5JJIA 2F0IA 2LKVA 3K6OA 1UNNC 2I8CA 1CHQD 4O2BF 3W5OA 2JEFA 3IFDA 4ABNA 4XX0B 1TWAB 2QYZA 4JI3L 4IJLA 5D3DA 2PPBC 2E2HB 1STNA 5DGBA 1YI2A 3KF6B 4KKTA 3T1HQ 1KDCA 2L9HA 2D5DA 2R7DA 4UFZA 1A3VA 1E22A 3HOZH 4O3QA 2Y0SA 4JI7H 1HNXH 2YCHA 1Y8OB 1XMOH 3MFYA 5FLXc 1VQ6A 1SFOA 4GKJH 1T36A 1LTAD 3P20A 1CA5A 4R7RA 2A68C 2JJQA 1X3GA 3LMLA 3RN2A
chains in the Genus database with same CATH topology
4X65Q 4PZ7A 3RLFA 2PMZE 1TXYA 1HJPA 2R7FA 5AJ3L 2GN5A 4HJ8A 1PH8A 5IP7H 2D62A 4KLKA 1N8RC 3HOZG 1QZGA 1OXSC 2K5NA 5M5YH 3PGZA 3TQYA 1GO3E 2KCTA 2Q2HA 1IBKQ 1PFSA 4X62Q 1IBLQ 1EFWA 4DV3L 4DR4Q 2VZAA 4DR1L 1CKNB 2K14A 1LUZA 3KOJA 4HJ5A 4AQYQ 1VQPA 2ZTDA 4BBSH 1YJ9A 2NZOA 1XNRL 2UUBL 4NXML 5IP7G 1X3EA 3PSIA 3VDYA 4DV2Q 1PHJA 1UE5A 4DR2L 4JOIA 4JV5Q 3NEMA 4P72A 3RR5A 5GQOA 1KAWA 5E7NA 1N34Q 4DR5L 4YY3Q 4DR3L 2NN6G 2CKZB 2IHFA 5FJ8H 2Q2IA 1PYBA 5HY6A 3RNUA 3S1QH 4BBSG 1EQRA 2KENA 4LF5L 1VQ8A 3DM3A 4BA2I 2AWNA 3K8AA 4DV6L 3KYHC 1X9NA 1I94L 4R4QA 3BZCA 5FJ8G 4X64Q 3J7A5 1RL2A 1SROA 4B3TQ 2N78A 2WB1E 5K36G 2NN6I 3CQZH 1VQMA 5IYCH 4A3GG 4ALPA 2E2IH 1B70B 3I7FA 4TQUS 2ZTEA 3CXCA 3U4ZA 3J81i 3STBD 5C0XJ 4UP9A 2I5MX 4IO9A 3CPWA 2XTIA 4R1JA 3BU2A 3JC66 3S2HH 2EXDA 4JI4Q 4K0KQ 4IFDJ 4A3JH 2NVXH 2YTVA 4LUZA 2YV5A 2WB1G 3E9HA 4UPAA 4GLVB 4GOPB 2DUDA 2YTYA 3M85A 1E1OA 3CW2C 3EIVA 1KD1C 2E5LL 3K7AH 1SFOH 3U50C 1VQ5A 4WJ4A 4GNXC 1VCIA 4OWTB 5C44H 3CC7A 4A3IH 2Q2UA 4A3JG 1CKNA 1EQQA 1QVGA 1EIFA 1CKMA 2MQHA 4MTNA 4P71A 4LNQA 4A3DG 1TWFH 4L5TA 3F2DA 3H3VH 1X56A 4HJ7A 4K0KL 2R92G 1FVIA 4YCUA 5C3EH 3JAMi 3G6EA 3GO5A 4HJAA 4QGUA 1I50H 4A3IG 2OQKA 4JI2Q 5C44G 3CCJA 3GTJH 3CMAA 1MKHA 4Y52H 4JC0A 2Z0SA 4AYBG 3PIOA 2JA5H 4LFBL 2BA1A 3ULJA 3T1YL 3J81c 1FL0A 3GTPH 3UDGA 2IHEA 3OYYA 3UDIA 3S16H 5IT9c 2OTLA 5C3EG 4LUOA 1YHAA 4R4CA 3KDFA 1XTDA 2K50A 3S24A 3HOUH 4KHPL 2GVBA 4DV5L 5IY0A 5ELNA 2AMCB 4BXXH 4PG3A 4H02A 4DPGA 4A3MH 4OO1I 1HNZQ 2BH8A 2UUCQ 2OTJA 1JJGA 1HR0Q 1N9WA 1PH6A 4A3BH 3RZDH 1CKOA 3H3VI 5IYDG 5GAGC 3HKZE 3GTOH 1XPOA 5H1SE 3ULPA 3HOXG 2E2HH 2E2JH 1UEBA 4JI5Q 4A3MG 4POGA 4DR7L 4DUZQ 2UXCL 2XGTA 4GN3B 2JQOA 4HIOA 4JBKA 2B3GA 2MFIA 2FXQA 2E8GA 1KQSA 4A3BG 1BKBA 4LF6L 1L0WA 3M7NA 3L7ZC 1I5FA 4GOPA 4LF9Q 3M4QA 1N33L 3OTOL 3DLLA 2VY3A 2WP8J 1I6HH 4IFDI 4GN4B 1YEZA 2LSSA 4PZ8A 3CAMA 1PV4A 1JT8A 1JJCB 1UE1A 3UDFA 3M3YH 4A3CH 3H15A 1Y1WH 3NELA 1Q12A 4JI6L 2VL6A 1S72A 5IWAL 1WCMH 1GM5A 3HOVG 4B3RQ 1G291 5DLQE 3CCQA 2K52A 1N32L 3A74A 1TWHH 1YNXA 5ELOA 4PMWA 1QVFA 4YHHQ 3CP0A 1SR3A 2ZJRA 1G6PA 5M3FH 4LFCL 2CWAA 4A3CG 3CCMA 3EN2A 4RG1A 3CCSA 1KRSA 3K7UC 4NXNL 4OX9L 2KCMA 1Y1WG 4JI7Q 1HNXQ 1O7IA 1BBUA 3HKSA 1XMOQ 1WCMG 3T1HL 4DR6Q 3GTLH 1WYDA 4P75A 4GKJQ 1E1TA 4DV0Q 4B3SQ 1VQGA 4DUYQ 4LF7Q 1PH2A 4HIKA 1TWCH 2VQFL 4DV1L 1VQ4A 4L5QA 4Y7NH 5M3FG 2UUAQ 2CWPA 1WJJA 2F3IA 4LF4Q 2JA7H 1T9HA 2QEXA 4JG2A 1J5EL 1WFQA 4B3SL 4IOCA 4TVAB 4X65L 4GLXA 1W2BA 4B3MQ 4JBWA 4LW1A 4A3KH 1LTLA 4QQBX 4A4IA 1PH9A 4IPHA 1XNQQ 3F8TA 1L2FA 4UP8A 1IBKL 1C0AA 4X62L 1IBLL 2B29A 2JA7G 1EWIA 1IL2A 4DR4L 4YWMA 2VNUD 4JBMA 4A3GH 1PVOA 2ID0A 3CCUA 5LMUQ 1JMCA 1L1OA 2HQLA 5IP9H 3KDFB 4AQYL 2F4VQ 4WJ3M 4JI1Q 4A3KG 3AQQA 1VQJA 4IPCA 5GAHC 4DV2L 4C2MH 2ALYB 1NTGA 1BBWA 2AHOB 4JV5L 3I55A 2UXBQ 1I3QH 2HHHQ 2NVYH 3CMEA 4AH6A 1LYLA 4LF8Q 1CUKA 5JJLA 1YVCA 3PV0A 2N3SA 3E9IA 4JI0Q 1N34L 3GTQH 4DV7Q 5IP9G 4YY3L 2CFMA 1K73C 2K75A 1B8AA 4DAMA 4DAYB 1V1QA 1HNWQ 3NENA 1SRUA 5LMNQ 1PA6A 2CCZA 4A3DH 1VQNA 2HIVA 2D0PA 1OXUA 3PCOB 1YITA 4LWCA 4EX5A 3FP9A 4X64L 2A8VA 1QVCA 4R4TA 5BR8Q 2R92H 4B3TL 2UXBL 1UWVA 1MJEA 4A93H 1VQCA 1HZ9A 4A3LH 5M5XH 3GTKH 3PUVA 1VQEA 3E0EA 4J15A 1RIPA 2UUAL 1Q1BA 2VS1A 2OQ0A 1M1KC 4GKKQ 3UE1A 3PUYA 3HOUG 4O0AA 4JI4L 1U0LA 4DV4Q 1Q81C 3I4OA 5FLMH 3HOWH 3HFZB 3GTGH 2ZM6Q 4A93G 3J7ZC 4A3LG 3TEHB 1IYJB 1EIYB 1MJCA 3AFPA 1FJGQ 3CCEA 3GTMH 2JEAI 1Q1EA 1VQFA 5M5WH 1NMFA 1VQDA 1GKHA 2AKWB 3PUZA 4GOPC 1NE3A 2N8NA 5FLMG 3HOWG 1PH4A 1IXRA 1LM0A 4QY7A 3CCRA 3PO2G 1KHIA 2Z6KA 2QGQA 4UY8C 5IYDH 4IPGA 3CD6A 2IT1A 4IOAA 2PQAA 3G4SA 3HOXH 2R93G 2JE6I 1AE2A 1VQLA 1YZ6A 3RLNA 1YJNA 4JI2L 5C4JH 4JI8Q 5JEAG 5M3MH 4FDBA 4OXPA 2V1CC 2NVQH 4A3EH 3A5ZB 3BZKA 2AWOA 1SLJA 2VQEQ 4JYAQ 1K0RA 3HOYG 1PH1A 4UP7A 3TS2A 1L1OB 5GADC 5GAEC 1N36Q 1XMQQ 1KL9A 3JAMc 1NMGA 1QUQB 3K81C 1HR0W 2JA8H 3HOVH 5M3MG 5IE8A 4A3EG 1UE6A 1HNZL 4YCVA 2Q2TA 2UUCL 3HKZG 4BA1I 4JI3Q 2UU9Q 2UXDQ 2PI2E 3F2BA 1HR0L 3CCVA 3H0GG 1Q82C 1VQIA 2OWOA 4C3IH 1G51A 2YTXA 3F2CA 3MEFA 3M4OH 3F1ZA 3PUWA 5IYBH 1KIXA 1AH9A 1VS0A 4JOIC 1R9TH 3FHWA 2JA8G 4JI5L 1EUJA 4X66Q 1Q86C 4DUZL 4JBJA 3PO3G 1BVSA 3AEVA 4LUVA 1U5KA 3U4VA 1X6OA 4R4OA 3EBEA 4A75A 5IYBG 5AJ3Q 4LF9L 2UXDL 1V9PA 3PF4A 1L1OC 3B6YA 3S15H 4YWKA 4MNOA 3LGJA 2KBNA 1HZCA 1P16A 1Q46A 4AIMA 3I4NH 3ER0A 2RHSB 1VQOA 4DV3Q 2B63H 2WFWA 4DR1Q 1D7QA 4IPDA 4B3RL 1E7ZA 1JB7A 2EQSA 4HIDA 1GVPA 1VQHA 4X66L 2KHIA 3CF5A 3I4MG 1XNRQ 2UUBQ 4NXMQ 1A0IA 2VUMH 4YHHL 4DR2Q 1ASYA 2OCEA 4A76A 2I5HA 2IX0A 3I4NG 1HNWL 2K5VA 2ZJPA 2C35B 4OWXB 2B63G 1H95A 4JI7L 1HNXL 4POFA 1KC8C 1Z9FA 4GS3A 1XMOL 4DR6L 1Q8KA 2RHQB 3M9BA 4DR5Q 1GD7A 4DR3Q 1CSQA 3RLOA 2ASBA 3TRZA 4DV0L 4GKJL 4QJFA 4DUYL 4LF7L 2QA4A 2VUMG 1FGUA 1X3FA 1VQ7A 4LF5Q 3KLWA 1OXTA 1IZ6A 4DV6Q 3PIPA 1A63A 2LXKA 1QUQA 4KHZA 3PF5A 1I94Q 4LF4L 2PQAB 1CSPA 3GDEA 3A0JA 4DK3C 1K8AC 1D8LA 1VQKA 2IY5B 1K83H 4B3ML 5HGQA 1XJVA 3UE0A 1ASZA 4O2DA 1WOCA 3K80C 4LFAQ 4L5SA 1XNQL 1QZHA 5GROA 1PH7A 2N49A 3FKIH 3PUXA 1E24A 3S14H 3GD7A 1UE7A 3ZJYC 5C4XH 2PI2A 4HJ9A 3K0XA 3STBC 1A62A 5JEAJ 2VW9A 5LMUL 3U58A 1K8GA 3TS0A 1NBWA 3S1RH 1C9OA 1X55A 1Z47A 4NB3A 2F4VL 3S17H 1W3SA 4JI1L 1PH3A 2JA9A 3A5UA 1Q7YC 4YCWA 4X6AH 3UDXA 4GNXB 2K5HA 4DNIA 1SN8A 3FKIG 1VQAA 2Z6KC 1EYGA 2HHHL 4GN5A 1NJIC 1OTCA 1OXXK 4PZ6A 2E5LQ 5C4XG 3KF6A 4LF8L 4NPSA 4YWLA 4JI0L 4LFAL 4DV7L 4BY1H 1X65A 1WI5A 5LMNW 2A19A 1YHQA 1V43A 1VQBA 1YBYA 4P74A 4BY7H 2ZJQA 1X54A 1EOVA 5LMNL 1IBMQ 2CQOA 2LXJA 3PO2H 4BBRH 3KJPA 2I0QA 3NBHB 4APVA 1KRTA 3D0FA 4L5RC 2ES2A 5IYCG 4BY1G 1S40A 2R93H 1OXVA 1XPUA 2Y0SE 3G48A 5BR8L 1KXLA 4XTCS 4LFBQ 2H5XA 4BY7G 1Y1VH 1J6QA 1C7YA 3T1YQ 2NVTH 2BH2A 4BBRG 4GKKL 3AFQA 5EAYA 1E3PA 2HT1A 4KHPQ 2RF4A 3W1BA 4AYBE 2MNAA 1AE3A 2MO0A 1P8LA 3D31A 3ULLA 3MXNB 4DV4L 3J81j 4DV5Q 1IBML 2Y0SG 3CCLA 3HOYH 3ICEA 4IJHA 2ZM6L 4DKAC 1Y1VG 4R4IA 4OO1G 2HIXA 1FJGL 2GVAA 1K3RA 1SMXA 1Y14B 1YHBA 2RCNA 4HIMA 1HH2P 3CPFA 1HZBA 3M4PA 2WAQE 3KJOA 4RMFA 3H0GH 3KF8B 2JA6H 2BA0A 4EQ5A 3L0OA 4GLAC 3RN5A 3J80i 1JJ2A 2I5LX 4XIGS 2JK8A 2NZHA 1DGSA 4DK6C 3OW2A 4DR7Q 2UXCQ 3I2ZA 4OWWB 2R6GA 4MZ9A 1M90C 3CC2A 4GNXA 4QIWE 3KFUA 4LF6Q 2IX1A 3S1MH 2MO1A 3PO3H 2EIFA 2F52A 2WAQG 3OTOQ 2JA5G 1N33Q 4A3FH 5C0XG 4OONA 4JI8L 2JA6G 3TREA 2YYZA 3RZOH 1XPRA 2ATWA 3G71A 5JJKA 1S3OA 4IFDG 1JE5A 2KHJA 2A1AA 3BJUA 1PYSB 4C3JH 2VQEL 1TWAH 1YJWA 1PH5A 4KI0A 1K9MC 1HZAA 1MIUA 4JI6Q 4JYAL 5JJIA 1VQ9A 5IWAQ 3Q8DA 4BXXG 3ERSX 1N32Q 1N36L 1XMQL 3S1NH 1SE8A 4A3FG 3W5OA 1B7YB 2ZTCA 1TWGH 4JCVE 2L15A 4LFCQ 3I4MH 5C0XI 4JI3L 4IJLA 2R7ZH 3AYHB 4QL5A 2UU9L 4OX9Q 4NXNQ 3S2DH 2JEBI 1YI2A 2PNHA 3KF6B 3T1HQ 4ME3A 3WWVA 5J3BA 3SGIA 2R7DA 2D0OA 2K4KA 3J80c 2YU9H 1E22A 3HOZH 4C3HH 2VQFQ 4DV1Q 5FLXc 1NY4A 3I56A 1VQ6A 2R7ZG 3L2PA 2DGYA 3W1GA 2JJQA 4P73A 1YIJA 1J5EQ 1A8VA 1X3GA 3RN2A 3CC4A 3IRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 Q;  4PZ7 A;  3RLF A;  2PMZ E;  1TXY A;  1HJP A;  2R7F A;  5AJ3 L;  2GN5 A;  4HJ8 A;  1PH8 A;  5IP7 H;  2D62 A;  4KLK A;  1N8R C;  3HOZ G;  1QZG A;  1OXS C;  2K5N A;  5M5Y H;  3PGZ A;  3TQY A;  1GO3 E;  2KCT A;  2Q2H A;  1IBK Q;  1PFS A;  4X62 Q;  1IBL Q;  1EFW A;  4DV3 L;  4DR4 Q;  2VZA A;  4DR1 L;  1CKN B;  2K14 A;  1LUZ A;  3KOJ A;  4HJ5 A;  4AQY Q;  1VQP A;  2ZTD A;  4BBS H;  1YJ9 A;  2NZO A;  1XNR L;  2UUB L;  4NXM L;  5IP7 G;  1X3E A;  3PSI A;  3VDY A;  4DV2 Q;  1PHJ A;  1UE5 A;  4DR2 L;  4JOI A;  4JV5 Q;  3NEM A;  4P72 A;  3RR5 A;  5GQO A;  1KAW A;  5E7N A;  1N34 Q;  4DR5 L;  4YY3 Q;  4DR3 L;  2NN6 G;  2CKZ B;  2IHF A;  5FJ8 H;  2Q2I A;  1PYB A;  5HY6 A;  3RNU A;  3S1Q H;  4BBS G;  1EQR A;  2KEN A;  4LF5 L;  1VQ8 A;  3DM3 A;  4BA2 I;  2AWN A;  3K8A A;  4DV6 L;  3KYH C;  1X9N A;  1I94 L;  4R4Q A;  3BZC A;  5FJ8 G;  4X64 Q;  3J7A 5;  1RL2 A;  1SRO A;  4B3T Q;  2N78 A;  2WB1 E;  5K36 G;  2NN6 I;  3CQZ H;  1VQM A;  5IYC H;  4A3G G;  4ALP A;  2E2I H;  1B70 B;  3I7F A;  4TQU S;  2ZTE A;  3CXC A;  3U4Z A;  3J81 i;  3STB D;  5C0X J;  4UP9 A;  2I5M X;  4IO9 A;  3CPW A;  2XTI A;  4R1J A;  3BU2 A;  3JC6 6;  3S2H H;  2EXD A;  4JI4 Q;  4K0K Q;  4IFD J;  4A3J H;  2NVX H;  2YTV A;  4LUZ A;  2YV5 A;  2WB1 G;  3E9H A;  4UPA A;  4GLV B;  4GOP B;  2DUD A;  2YTY A;  3M85 A;  1E1O A;  3CW2 C;  3EIV A;  1KD1 C;  2E5L L;  3K7A H;  1SFO H;  3U50 C;  1VQ5 A;  4WJ4 A;  4GNX C;  1VCI A;  4OWT B;  5C44 H;  3CC7 A;  4A3I H;  2Q2U A;  4A3J G;  1CKN A;  1EQQ A;  1QVG A;  1EIF A;  1CKM A;  2MQH A;  4MTN A;  4P71 A;  4LNQ A;  4A3D G;  1TWF H;  4L5T A;  3F2D A;  3H3V H;  1X56 A;  4HJ7 A;  4K0K L;  2R92 G;  1FVI A;  4YCU A;  5C3E H;  3JAM i;  3G6E A;  3GO5 A;  4HJA A;  4QGU A;  1I50 H;  4A3I G;  2OQK A;  4JI2 Q;  5C44 G;  3CCJ A;  3GTJ H;  3CMA A;  1MKH A;  4Y52 H;  4JC0 A;  2Z0S A;  4AYB G;  3PIO A;  2JA5 H;  4LFB L;  2BA1 A;  3ULJ A;  3T1Y L;  3J81 c;  1FL0 A;  3GTP H;  3UDG A;  2IHE A;  3OYY A;  3UDI A;  3S16 H;  5IT9 c;  2OTL A;  5C3E G;  4LUO A;  1YHA A;  4R4C A;  3KDF A;  1XTD A;  2K50 A;  3S24 A;  3HOU H;  4KHP L;  2GVB A;  4DV5 L;  5IY0 A;  5ELN A;  2AMC B;  4BXX H;  4PG3 A;  4H02 A;  4DPG A;  4A3M H;  4OO1 I;  1HNZ Q;  2BH8 A;  2UUC Q;  2OTJ A;  1JJG A;  1HR0 Q;  1N9W A;  1PH6 A;  4A3B H;  3RZD H;  1CKO A;  3H3V I;  5IYD G;  5GAG C;  3HKZ E;  3GTO H;  1XPO A;  5H1S E;  3ULP A;  3HOX G;  2E2H H;  2E2J H;  1UEB A;  4JI5 Q;  4A3M G;  4POG A;  4DR7 L;  4DUZ Q;  2UXC L;  2XGT A;  4GN3 B;  2JQO A;  4HIO A;  4JBK A;  2B3G A;  2MFI A;  2FXQ A;  2E8G A;  1KQS A;  4A3B G;  1BKB A;  4LF6 L;  1L0W A;  3M7N A;  3L7Z C;  1I5F A;  4GOP A;  4LF9 Q;  3M4Q A;  1N33 L;  3OTO L;  3DLL A;  2VY3 A;  2WP8 J;  1I6H H;  4IFD I;  4GN4 B;  1YEZ A;  2LSS A;  4PZ8 A;  3CAM A;  1PV4 A;  1JT8 A;  1JJC B;  1UE1 A;  3UDF A;  3M3Y H;  4A3C H;  3H15 A;  1Y1W H;  3NEL A;  1Q12 A;  4JI6 L;  2VL6 A;  1S72 A;  5IWA L;  1WCM H;  1GM5 A;  3HOV G;  4B3R Q;  1G29 1;  5DLQ E;  3CCQ A;  2K52 A;  1N32 L;  3A74 A;  1TWH H;  1YNX A;  5ELO A;  4PMW A;  1QVF A;  4YHH Q;  3CP0 A;  1SR3 A;  2ZJR A;  1G6P A;  5M3F H;  4LFC L;  2CWA A;  4A3C G;  3CCM A;  3EN2 A;  4RG1 A;  3CCS A;  1KRS A;  3K7U C;  4NXN L;  4OX9 L;  2KCM A;  1Y1W G;  4JI7 Q;  1HNX Q;  1O7I A;  1BBU A;  3HKS A;  1XMO Q;  1WCM G;  3T1H L;  4DR6 Q;  3GTL H;  1WYD A;  4P75 A;  4GKJ Q;  1E1T A;  4DV0 Q;  4B3S Q;  1VQG A;  4DUY Q;  4LF7 Q;  1PH2 A;  4HIK A;  1TWC H;  2VQF L;  4DV1 L;  1VQ4 A;  4L5Q A;  4Y7N H;  5M3F G;  2UUA Q;  2CWP A;  1WJJ A;  2F3I A;  4LF4 Q;  2JA7 H;  1T9H A;  2QEX A;  4JG2 A;  1J5E L;  1WFQ A;  4B3S L;  4IOC A;  4TVA B;  4X65 L;  4GLX A;  1W2B A;  4B3M Q;  4JBW A;  4LW1 A;  4A3K H;  1LTL A;  4QQB X;  4A4I A;  1PH9 A;  4IPH A;  1XNQ Q;  3F8T A;  1L2F A;  4UP8 A;  1IBK L;  1C0A A;  4X62 L;  1IBL L;  2B29 A;  2JA7 G;  1EWI A;  1IL2 A;  4DR4 L;  4YWM A;  2VNU D;  4JBM A;  4A3G H;  1PVO A;  2ID0 A;  3CCU A;  5LMU Q;  1JMC A;  1L1O A;  2HQL A;  5IP9 H;  3KDF B;  4AQY L;  2F4V Q;  4WJ3 M;  4JI1 Q;  4A3K G;  3AQQ A;  1VQJ A;  4IPC A;  5GAH C;  4DV2 L;  4C2M H;  2ALY B;  1NTG A;  1BBW A;  2AHO B;  4JV5 L;  3I55 A;  2UXB Q;  1I3Q H;  2HHH Q;  2NVY H;  3CME A;  4AH6 A;  1LYL A;  4LF8 Q;  1CUK A;  5JJL A;  1YVC A;  3PV0 A;  2N3S A;  3E9I A;  4JI0 Q;  1N34 L;  3GTQ H;  4DV7 Q;  5IP9 G;  4YY3 L;  2CFM A;  1K73 C;  2K75 A;  1B8A A;  4DAM A;  4DAY B;  1V1Q A;  1HNW Q;  3NEN A;  1SRU A;  5LMN Q;  1PA6 A;  2CCZ A;  4A3D H;  1VQN A;  2HIV A;  2D0P A;  1OXU A;  3PCO B;  1YIT A;  4LWC A;  4EX5 A;  3FP9 A;  4X64 L;  2A8V A;  1QVC A;  4R4T A;  5BR8 Q;  2R92 H;  4B3T L;  2UXB L;  1UWV A;  1MJE A;  4A93 H;  1VQC A;  1HZ9 A;  4A3L H;  5M5X H;  3GTK H;  3PUV A;  1VQE A;  3E0E A;  4J15 A;  1RIP A;  2UUA L;  1Q1B A;  2VS1 A;  2OQ0 A;  1M1K C;  4GKK Q;  3UE1 A;  3PUY A;  3HOU G;  4O0A A;  4JI4 L;  1U0L A;  4DV4 Q;  1Q81 C;  3I4O A;  5FLM H;  3HOW H;  3HFZ B;  3GTG H;  2ZM6 Q;  4A93 G;  3J7Z C;  4A3L G;  3TEH B;  1IYJ B;  1EIY B;  1MJC A;  3AFP A;  1FJG Q;  3CCE A;  3GTM H;  2JEA I;  1Q1E A;  1VQF A;  5M5W H;  1NMF A;  1VQD A;  1GKH A;  2AKW B;  3PUZ A;  4GOP C;  1NE3 A;  2N8N A;  5FLM G;  3HOW G;  1PH4 A;  1IXR A;  1LM0 A;  4QY7 A;  3CCR A;  3PO2 G;  1KHI A;  2Z6K A;  2QGQ A;  4UY8 C;  5IYD H;  4IPG A;  3CD6 A;  2IT1 A;  4IOA A;  2PQA A;  3G4S A;  3HOX H;  2R93 G;  2JE6 I;  1AE2 A;  1VQL A;  1YZ6 A;  3RLN A;  1YJN A;  4JI2 L;  5C4J H;  4JI8 Q;  5JEA G;  5M3M H;  4FDB A;  4OXP A;  2V1C C;  2NVQ H;  4A3E H;  3A5Z B;  3BZK A;  2AWO A;  1SLJ A;  2VQE Q;  4JYA Q;  1K0R A;  3HOY G;  1PH1 A;  4UP7 A;  3TS2 A;  1L1O B;  5GAD C;  5GAE C;  1N36 Q;  1XMQ Q;  1KL9 A;  3JAM c;  1NMG A;  1QUQ B;  3K81 C;  1HR0 W;  2JA8 H;  3HOV H;  5M3M G;  5IE8 A;  4A3E G;  1UE6 A;  1HNZ L;  4YCV A;  2Q2T A;  2UUC L;  3HKZ G;  4BA1 I;  4JI3 Q;  2UU9 Q;  2UXD Q;  2PI2 E;  3F2B A;  1HR0 L;  3CCV A;  3H0G G;  1Q82 C;  1VQI A;  2OWO A;  4C3I H;  1G51 A;  2YTX A;  3F2C A;  3MEF A;  3M4O H;  3F1Z A;  3PUW A;  5IYB H;  1KIX A;  1AH9 A;  1VS0 A;  4JOI C;  1R9T H;  3FHW A;  2JA8 G;  4JI5 L;  1EUJ A;  4X66 Q;  1Q86 C;  4DUZ L;  4JBJ A;  3PO3 G;  1BVS A;  3AEV A;  4LUV A;  1U5K A;  3U4V A;  1X6O A;  4R4O A;  3EBE A;  4A75 A;  5IYB G;  5AJ3 Q;  4LF9 L;  2UXD L;  1V9P A;  3PF4 A;  1L1O C;  3B6Y A;  3S15 H;  4YWK A;  4MNO A;  3LGJ A;  2KBN A;  1HZC A;  1P16 A;  1Q46 A;  4AIM A;  3I4N H;  3ER0 A;  2RHS B;  1VQO A;  4DV3 Q;  2B63 H;  2WFW A;  4DR1 Q;  1D7Q A;  4IPD A;  4B3R L;  1E7Z A;  1JB7 A;  2EQS A;  4HID A;  1GVP A;  1VQH A;  4X66 L;  2KHI A;  3CF5 A;  3I4M G;  1XNR Q;  2UUB Q;  4NXM Q;  1A0I A;  2VUM H;  4YHH L;  4DR2 Q;  1ASY A;  2OCE A;  4A76 A;  2I5H A;  2IX0 A;  3I4N G;  1HNW L;  2K5V A;  2ZJP A;  2C35 B;  4OWX B;  2B63 G;  1H95 A;  4JI7 L;  1HNX L;  4POF A;  1KC8 C;  1Z9F A;  4GS3 A;  1XMO L;  4DR6 L;  1Q8K A;  2RHQ B;  3M9B A;  4DR5 Q;  1GD7 A;  4DR3 Q;  1CSQ A;  3RLO A;  2ASB A;  3TRZ A;  4DV0 L;  4GKJ L;  4QJF A;  4DUY L;  4LF7 L;  2QA4 A;  2VUM G;  1FGU A;  1X3F A;  1VQ7 A;  4LF5 Q;  3KLW A;  1OXT A;  1IZ6 A;  4DV6 Q;  3PIP A;  1A63 A;  2LXK A;  1QUQ A;  4KHZ A;  3PF5 A;  1I94 Q;  4LF4 L;  2PQA B;  1CSP A;  3GDE A;  3A0J A;  4DK3 C;  1K8A C;  1D8L A;  1VQK A;  2IY5 B;  1K83 H;  4B3M L;  5HGQ A;  1XJV A;  3UE0 A;  1ASZ A;  4O2D A;  1WOC A;  3K80 C;  4LFA Q;  4L5S A;  1XNQ L;  1QZH A;  5GRO A;  1PH7 A;  2N49 A;  3FKI H;  3PUX A;  1E24 A;  3S14 H;  3GD7 A;  1UE7 A;  3ZJY C;  5C4X H;  2PI2 A;  4HJ9 A;  3K0X A;  3STB C;  1A62 A;  5JEA J;  2VW9 A;  5LMU L;  3U58 A;  1K8G A;  3TS0 A;  1NBW A;  3S1R H;  1C9O A;  1X55 A;  1Z47 A;  4NB3 A;  2F4V L;  3S17 H;  1W3S A;  4JI1 L;  1PH3 A;  2JA9 A;  3A5U A;  1Q7Y C;  4YCW A;  4X6A H;  3UDX A;  4GNX B;  2K5H A;  4DNI A;  1SN8 A;  3FKI G;  1VQA A;  2Z6K C;  1EYG A;  2HHH L;  4GN5 A;  1NJI C;  1OTC A;  1OXX K;  4PZ6 A;  2E5L Q;  5C4X G;  3KF6 A;  4LF8 L;  4NPS A;  4YWL A;  4JI0 L;  4LFA L;  4DV7 L;  4BY1 H;  1X65 A;  1WI5 A;  5LMN W;  2A19 A;  1YHQ A;  1V43 A;  1VQB A;  1YBY A;  4P74 A;  4BY7 H;  2ZJQ A;  1X54 A;  1EOV A;  5LMN L;  1IBM Q;  2CQO A;  2LXJ A;  3PO2 H;  4BBR H;  3KJP A;  2I0Q A;  3NBH B;  4APV A;  1KRT A;  3D0F A;  4L5R C;  2ES2 A;  5IYC G;  4BY1 G;  1S40 A;  2R93 H;  1OXV A;  1XPU A;  2Y0S E;  3G48 A;  5BR8 L;  1KXL A;  4XTC S;  4LFB Q;  2H5X A;  4BY7 G;  1Y1V H;  1J6Q A;  1C7Y A;  3T1Y Q;  2NVT H;  2BH2 A;  4BBR G;  4GKK L;  3AFQ A;  5EAY A;  1E3P A;  2HT1 A;  4KHP Q;  2RF4 A;  3W1B A;  4AYB E;  2MNA A;  1AE3 A;  2MO0 A;  1P8L A;  3D31 A;  3ULL A;  3MXN B;  4DV4 L;  3J81 j;  4DV5 Q;  1IBM L;  2Y0S G;  3CCL A;  3HOY H;  3ICE A;  4IJH A;  2ZM6 L;  4DKA C;  1Y1V G;  4R4I A;  4OO1 G;  2HIX A;  1FJG L;  2GVA A;  1K3R A;  1SMX A;  1Y14 B;  1YHB A;  2RCN A;  4HIM A;  1HH2 P;  3CPF A;  1HZB A;  3M4P A;  2WAQ E;  3KJO A;  4RMF A;  3H0G H;  3KF8 B;  2JA6 H;  2BA0 A;  4EQ5 A;  3L0O A;  4GLA C;  3RN5 A;  3J80 i;  1JJ2 A;  2I5L X;  4XIG S;  2JK8 A;  2NZH A;  1DGS A;  4DK6 C;  3OW2 A;  4DR7 Q;  2UXC Q;  3I2Z A;  4OWW B;  2R6G A;  4MZ9 A;  1M90 C;  3CC2 A;  4GNX A;  4QIW E;  3KFU A;  4LF6 Q;  2IX1 A;  3S1M H;  2MO1 A;  3PO3 H;  2EIF A;  2F52 A;  2WAQ G;  3OTO Q;  2JA5 G;  1N33 Q;  4A3F H;  5C0X G;  4OON A;  4JI8 L;  2JA6 G;  3TRE A;  2YYZ A;  3RZO H;  1XPR A;  2ATW A;  3G71 A;  5JJK A;  1S3O A;  4IFD G;  1JE5 A;  2KHJ A;  2A1A A;  3BJU A;  1PYS B;  4C3J H;  2VQE L;  1TWA H;  1YJW A;  1PH5 A;  4KI0 A;  1K9M C;  1HZA A;  1MIU A;  4JI6 Q;  4JYA L;  5JJI A;  1VQ9 A;  5IWA Q;  3Q8D A;  4BXX G;  3ERS X;  1N32 Q;  1N36 L;  1XMQ L;  3S1N H;  1SE8 A;  4A3F G;  3W5O A;  1B7Y B;  2ZTC A;  1TWG H;  4JCV E;  2L15 A;  4LFC Q;  3I4M H;  5C0X I;  4JI3 L;  4IJL A;  2R7Z H;  3AYH B;  4QL5 A;  2UU9 L;  4OX9 Q;  4NXN Q;  3S2D H;  2JEB I;  1YI2 A;  2PNH A;  3KF6 B;  3T1H Q;  4ME3 A;  3WWV A;  5J3B A;  3SGI A;  2R7D A;  2D0O A;  2K4K A;  3J80 c;  2YU9 H;  1E22 A;  3HOZ H;  4C3H H;  2VQF Q;  4DV1 Q;  5FLX c;  1NY4 A;  3I56 A;  1VQ6 A;  2R7Z G;  3L2P A;  2DGY A;  3W1G A;  2JJQ A;  4P73 A;  1YIJ A;  1J5E Q;  1A8V A;  1X3G A;  3RN2 A;  3CC4 A;  3IRB A; 
#chains in the Genus database with same CATH topology
 3SK6 A;  5AJ3 L;  3JAM W;  1RJT A;  3NHH A;  1HJP A;  2R7F A;  4KD4 A;  2B8G A;  2GN5 A;  3VYR A;  4EQO A;  2D62 A;  1W6J A;  4ZQ3 A;  5IP7 H;  5CV8 A;  2K5D A;  1N8R C;  3QB3 A;  3HOZ G;  3QZ8 A;  5M5Y H;  4XT3 B;  3PGZ A;  3JAM L;  4FBU A;  1GO3 E;  4B3M H;  1IBK Q;  5C1P A;  5CMD A;  4X62 Q;  5KG0 A;  3GV7 B;  3LP8 A;  4DR4 Q;  2PMZ B;  2K14 A;  3KOJ A;  2WAQ A;  1YJ9 A;  2UUB L;  4BWG B;  3O13 A;  3GTL B;  5IP7 G;  2N55 A;  2RCF A;  3PSI A;  2B2W C;  3KLR A;  2O5I C;  5KFC A;  4DR2 L;  3RMH A;  2XRQ D;  4JOI A;  4DV6 H;  4P72 A;  1HUM A;  3RR5 A;  5DG7 A;  1N34 Q;  1MGS A;  2FIN B;  2CKZ B;  4UAI A;  5EKL A;  1VDZ A;  3CU7 A;  1EYA A;  3GIJ A;  2R3Z A;  1JCK B;  2DPJ A;  2FB9 A;  5EKK A;  4IUQ A;  3M9M B;  4LFA H;  4DV7 H;  2O2L D;  3K8A A;  3KYH C;  5LL6 X;  4Q45 A;  2G9D A;  5DM6 3;  1I94 L;  4NMZ A;  1LTT D;  1S9F A;  2F0T A;  2E2H A;  3MTS A;  5D14 A;  4X64 Q;  3J7A 5;  2N78 A;  2WB1 E;  4X3U A;  1S0M A;  3V05 A;  4H7B A;  2G9H D;  2XTI A;  3CPW A;  5KG2 A;  4R1J A;  3BU2 A;  4CJ0 B;  4NKL A;  1VAJ A;  4DXG A;  4LUZ A;  2YV5 A;  4WFN 3;  4U6P A;  2WB1 G;  4ZQI A;  3H6M A;  2VB3 X;  4GOP B;  1EQT A;  3T5L A;  3ZYY X;  1IBM H;  3EIV A;  1KD1 C;  3K58 A;  4RH6 A;  2F0D A;  4A3J B;  4KY7 A;  2R8G A;  2ZM6 H;  1V1P B;  3OPO A;  5M9O A;  2F4I A;  1I6H H;  2PMZ A;  4TV9 F;  3S9W A;  3UQ8 A;  1CKM A;  2MQH A;  3T16 A;  4LSA A;  1D5X C;  4JPB W;  1S5E D;  1ZEQ X;  3GTL A;  1VKZ A;  4HJ7 A;  2R92 G;  4PV1 C;  4YCU A;  3FDS A;  3GQC A;  1B9M A;  1GUN A;  4Y8V B;  3G6E A;  3GO5 A;  2HDL A;  1SE3 A;  4JC0 A;  2Z0S A;  3PIO A;  2JA5 H;  4LFB L;  2K5Q A;  1LT4 D;  3T1Y L;  3D4R A;  3BDL A;  2PBZ A;  1FL0 A;  1FD7 D;  3UDG A;  2IHE A;  5KFP A;  2MCT A;  1I50 B;  3S16 H;  1S5D D;  2OTL A;  4I7A A;  4OL7 A;  1YHA A;  1AUX A;  3HOU H;  4FNF A;  2JSO A;  5IY0 A;  1WTX A;  2QIL A;  4PG3 A;  4H02 A;  2CQY A;  2FP4 B;  4KY6 A;  3VR5 A;  2UUC Q;  2OTJ A;  4QW8 A;  1A6X A;  4HCS A;  1SXT A;  4A3B H;  4UCT A;  1I4H A;  1ENA A;  2KJX A;  5KFY A;  1ROD A;  1GSH A;  3HOX B;  1KEE A;  5IYD G;  2F1M A;  3HKZ E;  5GAG C;  2FHT A;  1XPO A;  3NGD A;  1LTG D;  4JI5 Q;  2X69 A;  4DUZ Q;  3RZD B;  2NVQ B;  2MFI A;  2FXQ A;  4A3B G;  4NW2 A;  2OH2 A;  3GTO B;  2W9B A;  3MXP A;  4GOP A;  1I5F A;  3M4Q A;  2DNE A;  2K28 A;  4CKB A;  2WP8 J;  3I73 A;  4KJO A;  4IFD I;  1BR9 A;  4GN4 B;  1JE4 A;  2LSS A;  3BVZ A;  1G2S A;  3CAM A;  3F8N A;  5E4W C;  3H15 A;  4JI6 L;  3PW0 A;  2VL6 A;  2EPB A;  3H94 A;  1EWC A;  1G29 1;  3GIL A;  3VYT A;  3A74 A;  4XQN A;  4IZO A;  3MC0 B;  4YHH Q;  2QW7 A;  1Y1W B;  3AMU A;  4LFC L;  2L55 A;  1BCP B;  3V4Z A;  2MP1 A;  4M8A A;  3CCM A;  3EN2 A;  4MV4 A;  2UUB H;  2UVU A;  5I47 A;  2ALZ A;  1NNX A;  4CBV A;  4J6H A;  4KK7 A;  1UEA B;  4DR2 H;  1PFM A;  3TN2 A;  4LF7 Q;  1PH2 A;  1I50 A;  5I6Y A;  2VQF L;  1VQ4 A;  2J7Z A;  1B53 A;  4RFB A;  4LF4 Q;  2F3I A;  2A68 D;  1RHP A;  2QEX A;  1E4G T;  3L9A X;  4KD3 A;  4X65 L;  1IOW A;  5I2Y A;  4JBW A;  4LW1 A;  4A3K H;  2R7K A;  1LTL A;  2V4Q A;  4Y7N B;  1I94 H;  2P5Z X;  4A4I A;  5JOB A;  4IPH A;  5H80 A;  2W8K A;  5GON F;  2YRX A;  1C0A A;  3JSN A;  5LMU Q;  1JMC A;  5IP9 H;  4Q8F A;  1QNU A;  2VPS A;  4JI1 Q;  1GUS A;  4A3K G;  2WE6 A;  3AQQ A;  2BDN A;  3GTO A;  3ORQ A;  5EGT A;  4JV5 L;  3MJF A;  4JUZ A;  2UXB Q;  3RIZ A;  3RJ0 A;  3SEB A;  3CME A;  1D5M C;  1LYL A;  1SDF A;  4AH6 A;  4HSV A;  4F8M A;  5JJL A;  2N3S A;  3E9I A;  4JI0 Q;  3I70 A;  3GTQ H;  1CQJ B;  5IP9 G;  4YY3 L;  3FPP A;  3EFX D;  1PLF A;  2ZJT A;  1S5B D;  2K75 A;  1B8A A;  1I3Q B;  2H4O A;  4Z9C B;  2F0L A;  1WTP A;  5DLF A;  2CCZ A;  3EYY A;  1MBY A;  2W6N A;  1ICW A;  1VQN A;  2R8J A;  4RUC A;  2VA2 A;  5EDW A;  2A74 C;  4ID6 A;  1OXU A;  1PYW D;  2EYL A;  3PCO B;  1YIT A;  4LWC A;  4I55 F;  2NU7 B;  1QVC A;  5BR8 Q;  4B3T L;  4RKL A;  3S1R B;  2J9G A;  5CAE B;  1EU3 A;  1ZKO A;  2WYO A;  1HZ9 A;  2OXP A;  3QO2 A;  2MGS A;  2ZXO A;  3GTK H;  3TIG A;  1VQE A;  1TII D;  5CYU A;  3PUY A;  5FPO A;  4LFB H;  2A6H D;  1H9K A;  1TS3 A;  1YNN C;  1JOK A;  3T1Y H;  3I4O A;  4RGM A;  5FLM H;  3RD4 A;  5M5X B;  3HOW H;  1D2B A;  2B63 A;  1JKJ B;  2A73 B;  4FF4 A;  5HBR B;  2J6T A;  1MJC A;  1TY2 A;  1FJG Q;  1Q90 A;  1PTO D;  3V2T A;  4MTD A;  5BPH A;  2FLP A;  2CH4 W;  5M5W H;  1AUV A;  1STE A;  4FBT A;  4MTK A;  3ND9 A;  4MAM A;  3I4L A;  5FLM G;  3HOW G;  1O80 A;  4ECY A;  3GTM B;  2QK4 A;  3CD6 A;  3G4S A;  2R93 G;  1Q3L A;  5CBE E;  1YZ6 A;  3RLN A;  5IGC A;  5KT4 A;  4L63 B;  4DGZ A;  4JI2 L;  3QJY A;  1JX4 A;  4C5C A;  3HOY B;  2AWO A;  1SLJ A;  2VQE Q;  5IGF A;  4ZCK A;  4HMJ A;  4JYA Q;  1K0R A;  3MWD A;  3WNZ A;  1KBL A;  4KN4 C;  1XMQ Q;  4CC5 A;  3J7A F;  1EYZ A;  3HKZ B;  3UFX B;  3HOV H;  4JI6 H;  2R8I A;  5NUC A;  4O2A F;  2JA6 B;  2UXD Q;  4YP3 A;  2PI2 E;  3QR8 A;  1Q82 C;  4M9U A;  5KG7 A;  1VQI A;  2R87 A;  1T94 A;  3F2C A;  5KFL A;  3KLS X;  2YU9 B;  1KIX A;  1VS0 A;  2ZXP A;  2SNS A;  3RUZ A;  3PO3 B;  3NTH A;  4FF1 A;  1II3 A;  1QWY A;  3I3C A;  1EZ8 A;  2WV6 D;  4LUV A;  4KJN A;  4RNO A;  2AGO A;  4FVM A;  2VQF H;  3K0Y A;  4KKU A;  4A75 A;  4B3R H;  3Q8P B;  1IL8 A;  2OT2 A;  1L1O C;  4RHR A;  4EBC A;  2HVS A;  4YWK A;  2EJG C;  3LGJ A;  1P16 A;  1Q46 A;  1TWG B;  1STB A;  4X65 H;  4FS2 A;  2RHS B;  4DV3 Q;  2W6P A;  5A35 A;  1E7Z A;  1JB7 A;  2EQS A;  1VQH A;  2W9A A;  3I4M G;  4NXM Q;  1A0I A;  2F0U A;  4CC6 A;  4OEM B;  4EGV A;  4ZK9 B;  2YS6 A;  1DM0 B;  2EVB A;  1XDN A;  1HNW L;  4DXF A;  2C35 B;  4G7H C;  4POF A;  2NZ1 D;  2VUM B;  2EYH A;  3J7Y W;  3M9B A;  4DR5 Q;  2ASL A;  1S0N A;  4TRD A;  4JV5 H;  4ED1 A;  1KTK A;  4DUY L;  4J9M A;  5K2M A;  3RAQ A;  2RDJ A;  1VQ7 A;  1KDB A;  2O4X A;  4CDE C;  3DM1 A;  1JOR A;  4YY3 H;  2FMA A;  3FMA A;  2LXK A;  1EY4 A;  3K57 A;  1VQK A;  1I4R A;  2JA6 A;  4RB1 A;  1FGB D;  2XRS D;  2AUJ D;  3N6R A;  2MUY A;  4O2D A;  2VXW A;  1XNQ L;  3BA8 A;  1QZH A;  1O75 A;  5D1P A;  1E24 A;  3S14 H;  4HJ9 A;  2HHH H;  4B3T H;  2FPP B;  4K8J A;  1C9O A;  1WH2 A;  1WTH A;  1Q7Y C;  1MHW C;  3FKI B;  4K5V A;  4N8F A;  1PK8 A;  2K5H A;  3DMU A;  3NTK A;  1JB3 A;  1RCV D;  1VQA A;  2Z6K C;  4ED8 A;  1OTC A;  3S17 B;  2R84 A;  2E5L Q;  1B6S A;  4L1K A;  4YWL A;  1TWG A;  1SYX B;  3FEW X;  4BY1 H;  1EFI D;  3OOC A;  2V4R A;  4HNU A;  4ECR A;  1VQB A;  1X54 A;  1EOV A;  1ZHQ A;  2L12 A;  2WKC A;  1EEI D;  3MFG A;  3R3O A;  2E2I B;  3VMM A;  2K32 A;  3IL8 A;  4BY1 G;  2HGS A;  3MWY W;  1IYU A;  1S40 A;  5KFS A;  2Y0S E;  4XTC S;  1Y1V H;  1PX2 A;  5K5P A;  4JI2 H;  1Z2N X;  1WVL A;  1HQM C;  4GKK L;  5EAY A;  1E3P A;  2RF4 A;  1YNN D;  2CZG A;  4RGO S;  5EOY A;  3D31 A;  5CC4 A;  4DV4 L;  3CCL A;  2Y0S G;  4HCE A;  4HSP A;  3SHL A;  4IJH A;  2F03 A;  2PZT A;  3WO1 A;  1PTO F;  1Y1V G;  3QG1 A;  4AYB B;  2GVA A;  4HAE A;  2ZDQ A;  5C3W A;  1SMX A;  2RCN A;  1B33 N;  1D1I A;  3EPG A;  4H0L C;  2I80 A;  2WAQ E;  4RMF A;  3RN5 A;  4U7C A;  3MR2 A;  1LAB A;  3J80 i;  1JJ2 A;  1BNZ A;  2HCI A;  1A15 A;  2UXC Q;  4TQR A;  1LTR D;  2R6G A;  1KDA A;  3K3V A;  1M90 C;  5IOD A;  3PIO 3;  4LF6 Q;  2RGV A;  5LOV F;  2MO1 A;  3HXL A;  3M9O B;  2WAQ G;  2X6L A;  3OTO Q;  5C8Y F;  1PZI D;  1ENC A;  1DOL A;  2YYZ A;  1XPR A;  4QIW B;  2KHJ A;  3A54 A;  3NUC A;  1TWA H;  2XSC A;  4A3F B;  5L1I A;  4BXX G;  3ERS X;  2RA4 A;  1GGO A;  1N32 Q;  1N36 L;  2NYZ D;  3S1N H;  1NR4 A;  2UVR A;  2ZTC A;  1O78 A;  2E2I A;  1LO5 D;  3TQ1 A;  1PRT B;  4YBZ B;  2ENB A;  2L15 A;  5KKN B;  3QZ7 A;  2UU9 L;  4NXN Q;  4B08 A;  5KFI A;  4FXD A;  4Q44 A;  2EOT A;  4RCO A;  4J9S A;  5J3B A;  1SYE A;  1FR3 A;  2NB0 A;  4DK1 A;  2YU9 H;  1HNW H;  2R7Z B;  1O7L A;  1NY4 A;  3I56 A;  2YL2 A;  4IZ8 A;  4LK1 C;  3W1G A;  1J5E Q;  4DR1 H;  3CC4 A;  3GID A;  4PZ7 A;  4C3H B;  2PMZ E;  1TXY A;  4AYB A;  3PR5 B;  4ZKB B;  4HJ8 A;  3I91 A;  4KLK A;  3K5O A;  1R4Q B;  1TWH B;  2TSS A;  2KCT A;  2Q2H A;  1IBL Q;  1EFW A;  4DAV A;  1ESR A;  1Y69 U;  1XNQ H;  3A55 A;  1ML0 D;  1LUZ A;  4FXK C;  4HJ5 A;  4QCL A;  4AQY Q;  3GTJ A;  4J8Q A;  4ZRZ A;  2NZO A;  2L5T A;  2WTF A;  5E3F A;  3MHB A;  4DV2 Q;  1PHJ A;  3GV5 B;  2I87 A;  3NEM A;  2AGP A;  3E5N A;  1KAW A;  5E7N A;  4QIW A;  2RDG A;  2HDM A;  2Q2I A;  1PYB A;  3S1Q H;  5LP6 F;  2R7L A;  5CA1 F;  1SE2 A;  2GLT A;  1EQR A;  4LF5 L;  5K36 H;  5KG1 A;  4BA2 I;  4F50 A;  2W57 A;  1JIH A;  3VA7 A;  4DV6 L;  4MV9 A;  5A2Q E;  2CHB D;  4ETS A;  5KFN A;  3K5H A;  3LWE A;  3OSN A;  2DN8 A;  4A3G B;  1RL2 A;  5K36 G;  3CQZ H;  5IYC H;  2AQ4 A;  4J9K A;  2XVS A;  4RAZ A;  1B70 B;  4C2M B;  2ZTE A;  3D4D A;  3U4Z A;  2UUA Q;  5C0X J;  4UP9 A;  2I5M X;  5EPL A;  2GPW A;  2NVY B;  3RB4 A;  3QFF A;  3CKI B;  4JI4 Q;  4K0K Q;  4A3J H;  2NVX H;  3VYS A;  2B2V C;  4UPA A;  4OIK A;  4QWA A;  2KED A;  5EWE A;  4NDX A;  4WD3 A;  3S2H B;  5JVH 3;  3CW2 C;  4DV4 H;  1TWH A;  1LTS D;  4A3D B;  1VQ5 A;  3PN1 A;  4WJ4 A;  4F4Z A;  4O3S A;  4GNX C;  5DG9 A;  1VCI A;  1F2Z A;  5EPJ A;  4A3J G;  4MTN A;  4K6L A;  5EQ0 A;  1G2T A;  1RF2 D;  4RHS A;  1TWF H;  3EJI A;  3K7A B;  2ZT9 C;  1SFO B;  4L5T A;  3BQ1 A;  4ZKC B;  3L4K A;  5KFO A;  3PW4 A;  5D3I B;  3EVQ A;  3TBI B;  1I50 H;  2OQK A;  4DV5 H;  1MKH A;  5T1I A;  4Y52 H;  3BQ0 A;  1E2Z A;  4LMQ D;  1AZP A;  2BA1 A;  2WAC A;  3LWU A;  3J81 c;  5JAV A;  1FYC A;  3GTP H;  2Q8I B;  5KFD A;  2I07 B;  4IR1 A;  1I6U A;  1SJE D;  2X6G A;  4IFD H;  3S24 A;  1S97 A;  3KDF A;  1XTD A;  4CJ2 C;  4I7H A;  4WBN F;  4ZAI A;  2QDB A;  2C2D A;  4I4T F;  2XD4 A;  1RK6 A;  2AMC B;  1JOO A;  2XWB B;  2XC9 A;  1HNZ Q;  1JJG A;  3RBE A;  1N36 H;  1HR0 Q;  4B9X A;  4YR3 A;  1NSN S;  3RZD H;  5LA6 F;  2C2E A;  2CW8 A;  3H3V I;  4C2M A;  1CI3 M;  3GTO H;  1I7N A;  2UU9 H;  3D4W A;  3OSO A;  4QUF A;  3NBI A;  3HOX G;  3IKJ A;  2NVY A;  2ICE C;  5C4J B;  1IYV A;  1FNU A;  3R2T A;  4DR7 L;  2XGT A;  4EYI B;  2JQO A;  2E8G A;  2SCU B;  1BKB A;  1L0W A;  4CGY B;  1T3N A;  1PFN A;  4LF9 Q;  1N33 L;  2E2J B;  2V9W A;  1SBB B;  3P7J A;  1IHZ A;  1YEZ A;  2W6Z A;  1PV4 A;  2GPS A;  2R8H A;  4K6D A;  1Y1W H;  3NEL A;  1GYF A;  2Q8T A;  1S72 A;  5IWA L;  1SNO A;  2F0F A;  5DLQ E;  2K52 A;  3NWS A;  1YNX A;  2PCF B;  1QVF A;  3M3Y B;  3R2I A;  1G6P A;  2E75 C;  1R9T B;  2HVR A;  3TME A;  1WCM B;  1Z6H A;  3CCS A;  4OX9 L;  2VUG A;  1KRS A;  3K7U C;  2BE5 C;  2K5W A;  2KCM A;  1Y1W G;  4JI7 Q;  1HNX Q;  3FPU B;  3JRX A;  3U9S A;  1N48 A;  1XMO Q;  1S10 A;  4GKJ Q;  2XIG A;  3GTG A;  1E1T A;  1N56 A;  1MZB A;  5M3F B;  5BPF A;  4HIK A;  1JIC A;  3RV4 A;  1TWC H;  4E6I A;  4DV1 L;  4L5Q A;  4Y7N H;  1UNS A;  2JA7 H;  4RGT A;  4LF5 H;  3I4N B;  5HUR A;  4YIJ A;  4B3S L;  4B3M Q;  5I4D A;  4R8N A;  2DJF C;  1PRT F;  3TQT A;  2QDL A;  1J8I A;  5CB4 F;  2FJZ A;  1BGW A;  4XYM B;  3V96 A;  2W6O A;  3Q8S B;  3HBL A;  3A8K E;  2JA7 G;  1EWI A;  1BCP C;  2HQE A;  4JBM A;  2ID0 A;  3X3M A;  3M9N B;  2EYP A;  3R93 A;  3G6Y A;  3FDT A;  4KN7 C;  2F4V Q;  5LYJ F;  1N34 H;  3ND8 A;  1A2T A;  1B9N A;  1VQJ A;  2A6E D;  2OF1 A;  2ZDG A;  3OWE B;  1B6R A;  3L3O C;  3J80 L;  2DY7 A;  1NTG A;  5FPR A;  3HG9 A;  1I3Q H;  2KEE A;  4IHJ F;  1EY7 A;  3G6J B;  5I9O A;  4DV7 Q;  2CFM A;  4PNY A;  1I6V C;  1KJI A;  4GC7 A;  4UCS A;  1QNK A;  2KVM A;  4EYH B;  2LFN A;  3PW7 A;  2EJM A;  2BQR A;  3RGX A;  4LMY A;  3FRP B;  2HIV A;  1CQF A;  1R9T A;  2W9B B;  2RSN A;  3OHX C;  4XYQ A;  5KYL A;  1HHV A;  1WCM A;  3OWF A;  4EX5 A;  1AW7 A;  3FP9 A;  2A8V A;  2R92 H;  2UXB L;  2C9O A;  1F77 A;  2R7N A;  1CS0 A;  2B2Y A;  5M5X H;  1M4V A;  3V4S A;  3PUV A;  5FO7 B;  1EUC B;  4ZHQ F;  2VS1 A;  2MJ8 A;  3UE1 A;  4QW9 A;  2CVR A;  3TP7 A;  1ZQ7 A;  1F9R A;  1EZ6 A;  1Q81 C;  3IG0 A;  3CVZ A;  1ONL A;  2ZM6 Q;  3J7Z C;  1EIY B;  3W2D A;  3AFP A;  2XCP A;  3CCE A;  3GTM H;  1VQF A;  2J6S A;  1NMF A;  1GKH A;  3PO2 B;  4C56 C;  5KFJ A;  1KJ8 A;  4QY7 A;  3CCR A;  1KHI A;  2FK1 A;  2QGQ A;  5IYD H;  2IT1 A;  3VPC A;  2YZM A;  2PQA A;  3KLS A;  3Q23 A;  2F3W A;  5IOC A;  1STG A;  4LJZ C;  2XWJ B;  4PMB A;  1H9S A;  4DR7 H;  4EBD A;  2XIW A;  4JI8 Q;  3EA6 A;  3MEH A;  3HP3 A;  1ZYR C;  2B2U C;  2A5H A;  2YS7 A;  1KJJ A;  1N33 H;  4NLG A;  1EY0 A;  3Q8R B;  2UUC H;  3HOY G;  1DOM A;  4UP7 A;  3N52 A;  5M3M B;  5GAD C;  5GAE C;  3JAM c;  1MSG A;  1W6K A;  1VMC A;  3H0G B;  3KBG A;  5IWA H;  4JI5 H;  2HCC A;  5C5M A;  1TY0 A;  1SND A;  1UE6 A;  1IW7 C;  4YCV A;  2FMC A;  3HKZ G;  5DNF A;  4JI3 Q;  2DWC A;  4P2C B;  3F2B A;  1W96 A;  3CCV A;  2PW7 A;  5CR3 A;  2YTX A;  4MV8 A;  1M0W A;  3MEF A;  4XZ3 B;  4XYO A;  1WTO A;  1AH9 A;  2PNR C;  3S1M B;  4OX9 H;  3FHW A;  1SJH D;  4R8I A;  1E4F T;  4X66 Q;  2Z4H A;  4J9N A;  4JBJ A;  3PO3 G;  3M4O B;  4RKB A;  3AEV A;  3PR4 A;  1U5K A;  1XTC D;  4J9R A;  4HQ6 A;  3U4V A;  4XQJ A;  2YW2 A;  4R4O A;  4DV1 H;  1HTL D;  4DN4 M;  5AJ3 Q;  2UXD L;  5KFV A;  3PF4 A;  1T5E A;  1G6Z A;  3WO0 A;  1QJO A;  2KCN A;  1H9J A;  1GLV A;  2HD3 A;  5KT5 A;  2KBN A;  4DAP A;  4B3S H;  4IUP A;  4DK0 A;  2F0K A;  3ER0 A;  3Q22 A;  1M7J A;  2RDF A;  4B3R L;  1RD9 D;  4HID A;  3BG3 A;  2A69 C;  2KHI A;  3S15 B;  1M0T A;  1STY A;  3TZU A;  2UUB Q;  2VUM H;  2EY2 A;  2J4X A;  2NTT A;  3SE7 A;  3RBD A;  2B63 B;  4DR2 Q;  3BAB A;  2OCE A;  5L1J A;  2I5H A;  2IX0 A;  2BE5 D;  1RJP A;  4OWX B;  2HUG A;  1H95 A;  2BOS A;  4QWE A;  2XN9 C;  2PO4 A;  4DR6 L;  1Q8K A;  4G3I A;  1GD7 A;  4N9T A;  3RLO A;  3J80 E;  2NTS A;  4DV0 L;  4YAK B;  3DWQ A;  3KF8 A;  1JWM D;  4IUT A;  4QJF A;  2VUM G;  1FGU A;  1X3F A;  4R9W A;  4RNN A;  1OXT A;  4F7X A;  2FK3 A;  4K8I A;  1STA A;  3PIP A;  1I94 Q;  4JVZ A;  4DNT B;  5M5Y B;  3H0G A;  3A0J A;  4DK3 C;  4IUU A;  1F9P A;  2DJG C;  1K83 H;  5LMU H;  2H1E A;  2KA7 A;  3A7A B;  4ED7 A;  4FP5 D;  3BAA A;  4JI1 H;  3K80 C;  4L5S A;  1D1K A;  3FKI H;  1BCP D;  3ZJY C;  2UXB H;  1GHK A;  1AN8 A;  3STB C;  1A62 A;  5JEA J;  2VW9 A;  2MHV A;  3ERQ A;  4I65 A;  3TS0 A;  3S17 H;  1Z47 A;  1F2Y A;  4NB3 A;  4ECZ A;  1W3S A;  1U4L A;  1PTO B;  2JA9 A;  4N8X 1;  3SR1 A;  1VF5 C;  2FPI B;  3FKI G;  2B2T C;  2HHH L;  1TS2 A;  4LF8 L;  4ZLT F;  4DLK A;  4ILW A;  3CHB D;  4ULL A;  3TDQ A;  4HN7 A;  2B2W A;  5LMN W;  4IRK A;  4DL7 A;  1H9M A;  3VR4 A;  1K3B C;  4P74 A;  2Z8L A;  2Z9H A;  5LMN L;  2LXJ A;  3RB3 A;  1U4R A;  3KJP A;  5LL6 b;  4WRD A;  5IGB A;  4APV A;  2W6Q A;  4DL6 A;  1T5X D;  3SXH A;  2ES2 A;  3KXY T;  2R93 H;  3G48 A;  5FOB B;  3HB9 A;  4KKS A;  1KXL A;  3M4I A;  1SNP A;  1E4E B;  3J7A K;  1UAP A;  3PQI A;  4LFB Q;  1C7Y A;  2YZG A;  3T1Y Q;  3BYY B;  4RZR A;  2EYF A;  4EEQ A;  2ICI A;  5KNB A;  4ECU A;  2HT1 A;  5DEH A;  4AYB E;  2SNM A;  3ETH A;  2MO0 A;  1P8L A;  2AUK A;  3ULL A;  3MXN B;  4G7O C;  3J81 j;  2NVT B;  5KFU A;  3V6J A;  1JWU D;  3ICE A;  1TA8 A;  2C00 A;  2V4D A;  1I6H B;  5ELC A;  2K1B A;  1PZJ D;  2FFK B;  4OO1 G;  2HIX A;  1EUD B;  4YQW A;  2PQE A;  1K3R A;  3K5I A;  4A2A A;  1Y14 B;  1YHB A;  4HIM A;  3M4P A;  1WTV A;  3I72 A;  3SK4 A;  5DQG A;  1C3O A;  3T51 B;  4EBE A;  5KG5 A;  2SOB A;  4YJ2 F;  2NZH A;  2EY1 A;  3H09 A;  1SNQ A;  3OW2 A;  4UCV A;  3I2Z A;  4OWW B;  2QF7 A;  3E0J A;  2JA5 B;  4QIW E;  2JYO A;  5C4Z A;  2K04 A;  3S16 B;  4A3F H;  2E74 C;  2AQ2 B;  3K5M A;  4ECQ A;  2QEJ C;  4OON A;  3IN5 A;  1JDE A;  3HOU B;  4R8U A;  1ZYR D;  3TRE A;  1KJ9 A;  3RZO H;  2K05 A;  2A1A A;  1PH5 A;  2UXD H;  4C3J H;  5IT9 E;  4JI6 Q;  5EPK A;  2P0A A;  2HJW A;  3Q8D A;  2E76 C;  2WB1 A;  4ZOL F;  4DF7 A;  4A3F G;  2IMW P;  5CBA E;  3KUP A;  4O42 A;  1IW7 D;  4LFC Q;  5C0X I;  2R7Z H;  3I4M H;  3AYH B;  4QL5 A;  4C3J G;  2DY8 A;  3S2D H;  1KC7 A;  1E4E A;  4E4T A;  3K3P A;  3OUU A;  3WWV A;  3SGI A;  2D0O A;  3TIN A;  2JEG A;  3GV8 B;  4C3H H;  2VQF Q;  1TS4 A;  4DR6 H;  2JN4 A;  2L1B A;  1EWH A;  3MXN A;  4RCN A;  3C46 A;  2R7Z G;  4QWB A;  1XYI A;  1CT1 D;  2DGY A;  5KGU A;  3A56 A;  2R6F A;  4MA0 A;  2W7P A;  4DV0 H;  1A8V A;  1EY5 A;  3GV6 A;  3IRB A;  4X65 Q;  3RLF A;  1DOK A;  1PH8 A;  1QZG A;  1FKA H;  2K5N A;  4C3H G;  1S0O A;  5C6A A;  3TQY A;  3UI2 A;  1PFS A;  4ZYS A;  4MV6 A;  3C2P A;  4XXE A;  1C30 A;  4DR1 L;  1CKN B;  2C5C A;  2VOB A;  5CGK A;  3C3L A;  2A69 D;  1VQP A;  4BBS H;  2ZTD A;  2JA5 A;  1XNR L;  2JEJ A;  1I7L A;  1X3E A;  4RA8 A;  3JZI A;  3N8D A;  3VDY A;  1ESF A;  1BOS A;  4JV5 Q;  2DNC A;  4TV8 F;  1U9R A;  5GQO A;  5CA0 F;  4U68 A;  4YY3 Q;  5ELB A;  4DR3 L;  4BBS G;  3RNU A;  1ET6 A;  1VMP A;  5JUM A;  1VQ8 A;  4LF8 H;  3DM3 A;  3GV3 A;  5JPM C;  4O3R A;  4TSS A;  1X32 A;  2EYO A;  4R4Q A;  2VQD A;  1EIG A;  2XGP A;  4FF2 A;  5DAU A;  4V19 0;  3MZ5 A;  5LMN H;  3BZC A;  5A2Q W;  5ISR A;  3MAQ A;  5E4X A;  2BQ3 A;  3BVM A;  4B3T Q;  3OSP A;  2NN6 I;  2PW5 A;  1VQM A;  4A3G G;  1EU4 A;  5A2Q L;  4JK1 C;  4IUR A;  4TQU S;  3STB D;  3KAJ A;  4Q0Y A;  1JQY D;  1DJR D;  3JC6 6;  1WTQ A;  3S2H H;  4IFD J;  2PN1 A;  2W70 A;  4EFE A;  2CW7 A;  2EYM A;  1EY6 A;  3E9H A;  4GLV B;  2BCO A;  2DUD A;  3BVG A;  3OUZ A;  3PZP A;  1E1O A;  3H4B A;  2QKI C;  2JXM B;  3K7A H;  1SFO H;  1HPC A;  3G7L A;  4OWT B;  3DWP A;  4FM9 A;  3CC7 A;  3R23 A;  1S03 G;  1CKN A;  1EQQ A;  1EIF A;  4A3D G;  3OIP A;  3VYU A;  1UC9 A;  3H4D A;  1F9S A;  1GUW A;  2ZXR A;  1AFP A;  2M05 A;  1KJQ A;  3F2D A;  3H3V H;  1X56 A;  4K0K L;  4A3I B;  5C44 B;  2JEI A;  3JAM i;  4HJA A;  2YRW A;  4JI2 Q;  5EZY F;  3CMA A;  3N44 B;  1EEF D;  4BS9 A;  3GIK A;  1ENF A;  3HOW B;  4MA5 A;  5C3E B;  4EG0 A;  5CV9 A;  3PW2 A;  3OYY A;  4UCO A;  4EFB A;  3KHH A;  1JWS D;  4LUO A;  4KHP L;  2V58 A;  3GTJ B;  4JW0 A;  5J1Z A;  4IN3 A;  3JSL A;  4DV5 L;  5CV7 A;  5M5W B;  5ELN A;  1EHI A;  4BXX H;  3A7L A;  3KBX A;  4OO1 I;  4IUN A;  4QUC A;  2XCL A;  2EY6 A;  3NXW A;  4A3M B;  5G3L D;  2DLN A;  3SI8 A;  1XX8 A;  2E2J H;  4LAA A;  2E2H H;  1UEB A;  1F2L A;  1VBG A;  3EPI A;  4POG A;  3V6K A;  2FK2 A;  3P75 A;  3E5S A;  3H3V C;  4GN3 B;  3GTQ A;  2PZU A;  4JBK A;  2B3G A;  1KQS A;  2FPG B;  1KLU D;  3M7N A;  2F0N A;  3DLL A;  1N32 H;  3A8I E;  4YJ3 F;  2VY3 A;  1B50 A;  4J0M A;  1Y8N B;  1DCZ A;  3E3X A;  4PZ8 A;  4QMG A;  3H40 A;  4ECW A;  3MR5 A;  1JJC B;  1BF4 A;  4DNR B;  3M3Y H;  3HOV B;  4HNT A;  3RTX A;  1WCM H;  1GM5 A;  4TUY F;  5KT6 A;  1ZHS A;  5ELO A;  5KEE A;  1RJQ A;  5M3F H;  1JR0 D;  2ZDH A;  1SE4 A;  2R82 A;  4RG1 A;  1A3U A;  1HNW Q;  2IA6 A;  1XNR H;  1H9R A;  1I4Q A;  1MD2 D;  1O7I A;  3HKS A;  4IRD A;  1WCM G;  3T1H L;  3GTL H;  1WYD A;  4P75 A;  4DUY Q;  2OLS A;  3U9O A;  1SMY C;  1NAP A;  1B44 D;  2Z6B A;  5M3F G;  4DR3 H;  4ED3 A;  2SDF A;  3CRK C;  1WJJ A;  4K2L A;  3TZD A;  3VA5 A;  4ECT A;  4JG2 A;  3WOE A;  4I7Z C;  1WFQ A;  1D5Z C;  4IOC A;  4GLX A;  4V0B A;  3RV3 A;  1W2B A;  3N40 P;  1EZ1 A;  4UCR A;  4QQB X;  3I90 A;  1PH9 A;  1XNQ Q;  1L2F A;  1IBK L;  4X62 L;  4DR4 L;  4CHT B;  3I12 A;  2KSW A;  3CCU A;  1L1O A;  2HQL A;  3KDF B;  5DG8 A;  1XXG A;  4O4H F;  3RUP A;  3NSW A;  3URY A;  1U4P A;  4IPC A;  4XDX A;  5FLX W;  2ALY B;  1BBW A;  2KQ3 A;  3I55 A;  5DM7 3;  5FO9 B;  1HQR D;  1K8M A;  5FLX L;  1SYF A;  3NTI A;  1Z7T A;  1YVC A;  3IAY A;  1K0S A;  1FNV A;  2VPQ A;  1N34 L;  4N9P A;  3PIP 3;  1GSA A;  2TMP A;  1TS5 A;  3NWT A;  1DXM A;  3T4A C;  1CQV A;  5J39 A;  1MI2 A;  3NEN A;  1SRU A;  4ODG A;  5KNC A;  1D6E C;  5JJZ A;  1YNJ C;  3MWE A;  2F0W A;  3ITP A;  3BA9 A;  5IYZ F;  4X64 L;  4DFA A;  1HFN A;  3EQL C;  4K0K H;  2BR0 A;  3OW7 A;  1VQC A;  5J2T F;  4QF4 A;  4A3L H;  1CZW A;  4K2K A;  4RAY A;  4J15 A;  1Q1B A;  2HVQ A;  2OQ0 A;  3JRW A;  1M1K C;  4GKK Q;  1PXU A;  1CM9 A;  2RSO A;  4O0A A;  4B9W A;  2F0H A;  2BQU A;  1KNA A;  4A93 B;  1U0L A;  4DV4 Q;  1W93 A;  1GOZ A;  2EDG A;  4KHP H;  1WTR A;  4A3L G;  1IYJ B;  1F2M A;  1B1Z A;  1EY9 A;  4MV7 A;  3D6W A;  1LT5 D;  4IWY A;  1Q1E A;  3KHG A;  3MFH A;  1VQD A;  5T1G A;  4HMI A;  3GTG B;  1JDB B;  4GOP C;  2AQ3 B;  1PH4 A;  3PO2 G;  2Z6K A;  4UY8 C;  3C1E A;  1SAP A;  2RQX A;  3NK9 A;  3HOX H;  1Y1V B;  3R5F A;  2JE6 I;  5C4H A;  4EVO A;  3GII A;  3HZX A;  1HA6 A;  3G8C A;  4C5A A;  5HV6 A;  4QWC A;  5M3M H;  4OXP A;  4KMU C;  2RKS A;  2NVQ H;  4TQS A;  4RZQ A;  1PFB A;  5DQI A;  2R8K A;  3OMG A;  4KV6 A;  3X3N A;  3FMC A;  4ED6 A;  1PH1 A;  3TS2 A;  1EY8 A;  4K5X A;  1DYQ A;  1N36 Q;  3BYT B;  1KL9 A;  4A3E B;  4FU0 A;  4C5B A;  1NMG A;  1QUQ B;  3C0F B;  5M3M G;  1QCB D;  5IE8 A;  2F0V A;  2UUC L;  3LNN A;  2UU9 Q;  3H0G G;  2OWO A;  1G51 A;  3TP8 A;  1L2Z A;  1JC7 A;  2JA8 B;  3M4O H;  4EGJ A;  5IYB H;  3J81 E;  1HRJ A;  4UHV A;  3H91 A;  3N43 B;  2RGR A;  4JI5 L;  2DPI A;  5KX5 F;  1EUJ A;  4LH7 A;  5KT7 A;  3T1H H;  3TP5 A;  4C3I B;  4DUZ L;  1V51 A;  1BVS A;  3A8J E;  3NBH A;  1I4G A;  5BN5 A;  2NU6 B;  1R4P B;  1X6O A;  3NE5 B;  1JOQ A;  5C5L A;  3EBE A;  5IYB G;  3U9T A;  4F4X A;  3R8B A;  1BNC A;  3DF7 A;  1Z2O X;  1CZG A;  3B6Y A;  2WKD A;  4NP5 A;  3S15 H;  1B2T A;  3S1N B;  1TT2 A;  3Q2O A;  2CH4 A;  1M8A A;  5KIX A;  3M7G A;  1VQO A;  2B63 H;  1D7Q A;  2WFW A;  5KFA A;  1LV9 A;  3SK8 A;  4YAJ B;  1GVP A;  4X66 L;  3CF5 A;  1IBK H;  1Y1V A;  4X62 H;  2EE1 A;  4HTH A;  1SEB D;  2GA4 B;  2C22 A;  4DR4 H;  4YHH L;  4O3P A;  4J9P A;  3DWA A;  5KG4 A;  5D1O A;  3K5N A;  4A76 A;  1HCZ A;  1RK5 A;  2K5V A;  4L6T B;  2ZJP A;  2B63 G;  1Y8P B;  1M6V A;  4CDD C;  1TR5 A;  1BO0 A;  3TRZ A;  2D2C C;  2ASB A;  4LF7 L;  5EBD A;  1SMY D;  4LF5 Q;  1JLL B;  5FLX E;  2VB2 X;  3BJY A;  3J80 W;  5C1O A;  1SYD A;  1I4X A;  4DV6 Q;  1A63 A;  3KAL A;  5KFW A;  1QUQ A;  4KHZ A;  4LF4 L;  3L4J A;  5I6W A;  2PQA B;  4DU9 A;  1CSP A;  2VR1 A;  1K8A C;  1D8L A;  1H9S B;  1XJV A;  1L0X B;  2F4V H;  1ASZ A;  2PZW A;  1WOC A;  4LFA Q;  5GRO A;  1PTO H;  3Q1K A;  2AQ1 B;  3BZD B;  2EXZ A;  1CE8 A;  1UE7 A;  4X64 H;  4RGN A;  3K0X A;  1A3T A;  1GUO A;  2XGQ A;  5LMU L;  3MA2 B;  1C4Q A;  1NBW A;  1X55 A;  2SEB D;  3S1R H;  4JI1 L;  4PMC A;  1RJR A;  2F0Q A;  1OWT A;  1TWA A;  3UDX A;  4GNX B;  3S1Q B;  5C4X B;  2KHS A;  4DNI A;  3T5H A;  1V1O A;  1NJI C;  1S4Z A;  4ZUJ A;  4PZ6 A;  5EBC A;  1G8Z D;  3KF6 A;  4OEL B;  1X3Q A;  1BQQ T;  3K5L A;  4NPS A;  4JI0 L;  2LY7 A;  1RDP D;  1X65 A;  3E6Z X;  3RGZ A;  3HGB A;  2A19 A;  4RUA A;  2EZV A;  4FYD A;  1V43 A;  2JP1 A;  3T53 B;  4G57 A;  1IBM Q;  2CQO A;  3HRZ C;  2A6H C;  3CQZ B;  3GIQ A;  2M9V A;  1YNJ D;  4O1N A;  2I0Q A;  4APM A;  5IIF A;  2YU9 A;  1KRT A;  4QWD A;  1CHP D;  4HNV A;  4BY7 B;  3RF2 A;  3LWB A;  5BR8 L;  4EQP A;  1PTO C;  3T5J A;  4BBR B;  2NVX B;  2NVT H;  1J6Q A;  2QCP X;  3PW5 A;  2KUM A;  4RAU C;  2EJF C;  3SK5 A;  3AFQ A;  4TKO B;  5EWG A;  1AE3 A;  5KFZ A;  4K5W A;  3VR3 A;  4C1N I;  3HOY H;  1CQI B;  3VR2 A;  2R85 A;  4DKA C;  1FJG L;  1TWF B;  1HH2 P;  1QG7 A;  3CPF A;  1HZB A;  2X0S A;  3TII A;  1HFG A;  2B2V A;  3KJO A;  1SCU B;  5C0X H;  3KF8 B;  4IRC A;  2JA6 H;  4YR0 A;  1S5F D;  2BA0 A;  3L0O A;  1MSH A;  3QOJ A;  4JI8 H;  2I5L X;  2B39 A;  1DGS A;  4DK6 C;  4DR7 Q;  1S68 A;  5CV5 A;  3HEJ A;  4MZ9 A;  2L0C A;  2RBM A;  5TSS A;  5BN4 A;  3CC2 A;  4GNX A;  2IWH A;  4HR7 B;  4EQN A;  2IX1 A;  3GTP B;  2IPK D;  3PO3 H;  2EIF A;  2JA5 G;  1N33 Q;  4DUZ H;  1V4Y A;  4S3S A;  4Q5V A;  3VPB A;  5C0X G;  1UC8 A;  2JA6 G;  4IWX A;  1ZXT A;  3G6X A;  1QIL A;  3FVQ A;  5JJK A;  3RB0 A;  2FLL A;  2J6U A;  1JE5 A;  1ILQ A;  3BJU A;  3D6C A;  2VQE L;  1LLR D;  1YJW A;  1K9M C;  3HOU G;  3KTM A;  4KI0 A;  4JYA L;  1HZA A;  1MIU A;  4JI3 H;  1VQ9 A;  5IWA Q;  2UVV A;  3DEO A;  3CQZ A;  3LX0 A;  4XYL B;  1XMQ L;  1SE8 A;  1WD1 A;  5IT9 W;  1B7Y B;  1GHJ A;  1TWG H;  4JCV E;  1V8Q A;  5EKI A;  3ORR A;  4YR2 A;  4M1U B;  3T5K A;  1GJX A;  4X66 H;  2F0J A;  5IT9 L;  4OX9 Q;  1ZET A;  2FJ2 A;  2JEB I;  1BUV T;  1EL0 A;  5KFE A;  2PNH A;  3KAK A;  4YHH H;  2NVX A;  4ME3 A;  1V1P A;  1LTB D;  2K4K A;  3J80 c;  4IR9 A;  4DV1 Q;  1DV1 A;  3L2P A;  5CV6 A;  3JAM E;  1HA5 A;  1DIK A;  2F0G A;  4LF7 H;  3MXU A;  4GC6 A;  4P73 A;  1YIJ A;  2IL8 A;  4IUV A;  4B3S Q;  3VPD A;  3HOZ B;  5HGT A;  1TWF A;  4LF4 H;  2K01 A;  5FO8 B;  5F9L A;  5KFT A;  1OXS C;  3VR6 A;  5KT2 A;  5L1K A;  2DZD A;  4DV3 L;  2VZA A;  3WDN A;  5COY A;  2NN6 H;  1E2W A;  2KEC A;  4PDB A;  2F3V A;  4NXM L;  1SNC A;  4HR7 A;  3TSS A;  3GTP A;  2F0E A;  1KAA A;  1UE5 A;  2B8F A;  3QIA A;  5L37 A;  1TWC B;  1S5C D;  1AN7 A;  5L9X A;  3HS0 C;  2G5D A;  2JA7 B;  4DR5 L;  1PZK D;  2NN6 G;  5IGD A;  1EIH A;  2IHF A;  5FJ8 H;  5HY6 A;  4Q8E A;  2KEN A;  3SE0 A;  2W9C B;  4JI0 H;  2AWN A;  4ME5 A;  1X9N A;  4M7E A;  3V6H A;  5KG6 A;  4RB2 C;  2IP4 A;  1TQO A;  2K6A A;  5ELE A;  2F0S A;  4OIJ A;  3CRL C;  5E1F A;  5FJ8 G;  3TP6 A;  1SRO A;  1A2U A;  2D9U A;  2RVL A;  4R8U B;  3MFI A;  5KFF A;  5F2D A;  4ALP A;  2E2I H;  4WJW A;  2RDI A;  3I7F A;  5KG3 A;  2F0O A;  3CXC A;  3J81 i;  4IO9 A;  2FE3 A;  5BR8 H;  4LSX A;  3R5X A;  1X3P A;  2OEO A;  2WB1 B;  3PMF A;  2EXD A;  2YTV A;  2R7M A;  1Y1W A;  4JV0 A;  4MN3 A;  5KND A;  2YTY A;  3MXG A;  1Q8I A;  3QOL A;  5IGE A;  3M85 A;  2E5L L;  5KFG A;  3U50 C;  4DA2 A;  4C1N K;  4OO1 H;  4A3I H;  5C44 H;  1RTO A;  2Q2U A;  1ILP A;  1FJG H;  1QVG A;  2O03 A;  4RNM A;  4P71 A;  4CKE A;  4LNQ A;  2W6M A;  1RTN A;  2R92 B;  4ZUI A;  3WOF A;  4ED0 A;  2Q8R E;  3GLK A;  1FVI A;  4PWQ A;  4J1M A;  5C3E H;  2W8L A;  1TWC A;  2Z4I A;  4QGU A;  1SYB A;  4A3I G;  5C44 G;  2K03 A;  3CCJ A;  3GTJ H;  2JA7 A;  2WII B;  1ICF B;  4AYB G;  2R61 A;  2C28 A;  3ULJ A;  1L0Y B;  2W9C A;  2IX3 A;  3UDI A;  4FO2 A;  4UDU C;  5IT9 c;  4KHV A;  1HXY D;  5C3E G;  4R4C A;  1WD0 A;  2O5J C;  2K50 A;  3OHB A;  2GVB A;  5D8D A;  2VQE H;  4OGQ C;  1PMR A;  1AZQ A;  4JYA H;  1O7Z A;  5LHY 1;  4X3S A;  4IQZ A;  4A3M H;  4DPG A;  1TAE A;  2BH8 A;  1XMQ H;  1B04 A;  1N9W A;  3K59 A;  1PH6 A;  4IAL A;  1E0B A;  1CKO A;  3KHL A;  2N88 A;  1CFM A;  5KFK A;  3PVX A;  5H1S E;  3ULP A;  1I3Q A;  4A3M G;  4A3B B;  2UXC L;  2VA3 A;  2FLN A;  4HIO A;  4LF6 L;  1K8O A;  1RYS A;  3L7Z C;  1QE6 A;  1AP0 A;  2UVW A;  5COR A;  3OTO L;  2NUC A;  4FS1 A;  4EGQ A;  3AB9 A;  5JH7 F;  4RU9 A;  1JT8 A;  1LAC A;  1UE1 A;  3UDF A;  2E2D C;  4A3C H;  4RB3 C;  2ATL A;  4LFC H;  1DZ1 A;  1Q12 A;  3NQT A;  2R92 A;  2CQA A;  4B3R Q;  3HOV G;  3CCQ A;  4DL5 A;  1N32 L;  3ERO A;  2B2U A;  1TWH H;  4PMW A;  3DXJ C;  4DV3 H;  2LS0 1;  3CP0 A;  3AU7 A;  1SR3 A;  2ZJR A;  4MV3 A;  2CWA A;  1ET9 A;  1B3A A;  4A3C G;  4RB0 A;  4NXN L;  3KK7 A;  4F4Y A;  4JV2 A;  1QB5 D;  4NXM H;  1OO9 B;  1BBU A;  2NUA B;  4DR6 Q;  1PRT C;  5D65 A;  4DV0 Q;  1VQG A;  1J9O A;  3OHA A;  1BDO A;  1C8C A;  3GTM A;  4DR5 H;  2CWP A;  3MR3 A;  2L11 A;  1T9H A;  1FNW A;  1J5E L;  4KTA A;  5JQW A;  4TVA B;  4MHE A;  2WDT A;  3M4Y A;  1TVX A;  3F8T A;  3DHQ A;  3OIQ A;  4UP8 A;  3NP8 A;  1IBL L;  3T56 B;  2B29 A;  2R86 A;  1IL2 A;  3GIP A;  4YWM A;  2VNU D;  4A3K B;  4A3G H;  1PVO A;  5JVD F;  5L1L A;  1VBH A;  2PVP A;  5DLG A;  4AQY L;  4WJ3 M;  2YZN A;  2LMC B;  1GUT A;  5ELF A;  3HKZ A;  5GAH C;  3MR6 A;  4DV2 L;  4C2M H;  3BG5 A;  4O3O A;  4G7Z C;  2AHO B;  2HHH Q;  5C5J A;  2NVY H;  1VF7 A;  1DV2 A;  4LF8 Q;  4F87 A;  1CUK A;  3PV0 A;  1BCP F;  5J22 A;  3Q24 A;  5BMV F;  3RAX A;  1ULZ A;  2I46 A;  5IGG A;  1B4O A;  1K73 C;  5LL6 S;  1K83 B;  4DAM A;  4DAY B;  2E5L H;  3NQI A;  4H44 C;  3RB6 A;  2EYJ A;  1V1Q A;  2Z1C A;  4U67 3;  1PA6 A;  5LMN Q;  1B3Q A;  4FXG C;  3GTQ B;  1LT6 D;  4A3D H;  3C1F A;  3KHR A;  4X3T A;  1SSO A;  4ECV A;  2D0P A;  2PYK A;  4RWS C;  1SNM A;  2V5A A;  1K1Q A;  5JPN C;  1I4P A;  2WIN B;  5BN3 A;  4HED A;  5I2X A;  1CA6 A;  4R4T A;  1G91 A;  1LT3 D;  3QWN A;  1UWV A;  1MJE A;  4A93 H;  4IAJ A;  2V59 A;  4KY5 A;  3E0E A;  1RIP A;  2UUA L;  1IKL A;  4DL2 A;  1EYC A;  4JI4 L;  4I50 F;  2C2R A;  1EQV A;  3GTK B;  3HFZ B;  3GTG H;  4O3N A;  4A93 G;  4A2B A;  3TEH B;  5T14 A;  1C48 A;  2JEA I;  2VUM A;  2AKW B;  3PUZ A;  2EY5 A;  1NE3 A;  5JEA H;  2N8N A;  2ASD A;  5F9N A;  2IBK A;  4QB4 A;  1IXR A;  1LM0 A;  2B2T A;  2R93 B;  1HTP A;  3F2U A;  4Q0F A;  2W71 A;  1GSO A;  1BXT A;  4IPG A;  5KFR A;  4IOA A;  1RYR A;  1DON A;  4J9Q A;  1SYC A;  1AE2 A;  4ED2 A;  3J7A V;  1VQL A;  5CV4 A;  2UXC H;  1YJN A;  5C4J H;  5JEA G;  4FDB A;  2V1C C;  4LF6 H;  4A3E H;  4F4W A;  2CW0 C;  3A5Z B;  1NUC A;  3BZK A;  1XWE A;  2AU0 A;  3OTO H;  1K83 A;  4DAY A;  4J9O A;  5FD6 A;  5KFQ A;  2F0P A;  1L1O B;  4DL4 A;  4G4K A;  2AGQ A;  4Q43 A;  1QOH A;  1F9Q A;  3FKI A;  3MWM A;  3K81 C;  3GQB A;  1HR0 W;  2JA8 H;  3G6V A;  1BXR A;  3RFC A;  4O4L F;  3SDZ A;  4A3E G;  1HNZ L;  2Q2T A;  5LXT F;  4BA1 I;  1HR0 L;  3H20 A;  1WR2 A;  4C3I H;  2YYA A;  2RDH A;  3ETJ A;  3F1Z A;  3PUW A;  5EWF A;  5KFB A;  4JOI C;  1R9T H;  4NXN H;  3D3R A;  2JA8 G;  2NWG A;  2FKL A;  3J81 W;  1Q86 C;  1STH A;  3RZO B;  3Q6S A;  3GTK A;  2L4N A;  3BDC A;  5KFH A;  4EEY A;  4C3I G;  4UCU A;  4BWS C;  3J81 L;  4C3J B;  4LF9 L;  1V9P A;  4CJ1 B;  5J2U F;  3ONA B;  1J5E H;  4YB8 B;  4MNO A;  1HZC A;  4AIM A;  4F88 A;  3I4N H;  1IOV A;  3SVM A;  4DR1 Q;  4X3K A;  3I4M B;  4IPD A;  4OHJ A;  2R93 A;  1NCV A;  2NU8 B;  5KFM A;  3S2D B;  4XT1 B;  1IBL H;  1XNR Q;  3N42 B;  4DUY H;  1TU2 B;  2FMM A;  2BDO A;  2M2L A;  1ASY A;  4FF3 A;  5I9P A;  4AQY H;  3I4N G;  2J0T D;  3BDO A;  4JI7 L;  1HNX L;  1KC8 C;  1CTM A;  1Z9F A;  4GS3 A;  1XMO L;  2RHQ B;  4DV2 H;  1PRT D;  4DR3 Q;  4GKJ L;  1CSQ A;  3N41 B;  1LTI D;  1SEI A;  5KFX A;  3P1H A;  2QA4 A;  2W7O A;  2IJ0 A;  3KLW A;  4ZI7 F;  3T13 A;  1IZ6 A;  1KAB A;  3PF5 A;  3R5H A;  4DL3 A;  1BBX C;  4LH6 A;  5DQH A;  1JXL A;  2B2Y C;  3GDE A;  5AFW A;  2A6E C;  2IY5 B;  5KT3 A;  1E2V A;  4B3M L;  4CDF C;  3BS1 A;  1BJT A;  5HGQ A;  2KOL A;  1K28 A;  3UE0 A;  4BBS B;  4CDC C;  5DGA A;  1UUP A;  1PH7 A;  1AEX A;  1TKW B;  2N49 A;  3PUX A;  1GUG A;  3GD7 A;  3OMC A;  5C4X H;  2PI2 A;  1U4M A;  3U58 A;  5FD5 A;  1K8G A;  1KLG D;  2F4V L;  1PH3 A;  3A5U A;  1PDQ A;  3DUZ A;  2UUA H;  4YCW A;  3S14 B;  4X6A H;  1EYD A;  1KNE A;  1SN8 A;  3Q8Q B;  3GIM A;  4K14 A;  4JI4 H;  1EYG A;  2DIK A;  4GN5 A;  1OXX K;  5C4X G;  3GP7 A;  1WSC A;  1EOT A;  3I8Z A;  4WOR A;  4LFA L;  4DV7 L;  4L8J A;  5FKA C;  2ASJ A;  1WI5 A;  2K33 A;  2R7Z A;  1YHQ A;  4J9L A;  1A9X A;  4BY7 H;  1YBY A;  1NR2 A;  2ZJQ A;  2KCC A;  2IW3 A;  3PO2 H;  4BBR H;  4BY1 B;  4MTE A;  3MVV A;  3NBH B;  1WTW A;  4ECX A;  2XCA A;  4GKK H;  3D0F A;  4L5R C;  5IYC G;  1OXV A;  4ECS A;  1XPU A;  1IKM A;  4CKC A;  4MV1 A;  2H5X A;  4BY7 G;  2BH2 A;  1GXD C;  5FK9 C;  4BBR G;  1HUN A;  3NPP A;  2Y0S B;  4KHP Q;  3W1B A;  2MNA A;  5C3X A;  1RKN A;  4XQQ A;  1IBM L;  4DV5 Q;  2NU9 B;  1DD2 A;  2ZM6 L;  5JVL A;  5D1O B;  4R4I A;  5JVG 3;  1Z2P X;  1HNZ H;  3H0G H;  3N6X A;  1HR0 H;  1SYG A;  4EQ5 A;  4GLA C;  4H13 C;  4XIG S;  2JK8 A;  2NBF A;  4MIU A;  4PQX A;  1K1S A;  1O7Y A;  4O4I F;  3IFT A;  5EJW A;  4HYK A;  2WAQ B;  3DEP A;  5KYI A;  2XNA C;  5ELD A;  2MPM A;  3KFU A;  4ME6 A;  3S1M H;  2F52 A;  2K7V A;  3W3A A;  2M00 A;  4JV1 A;  4JI8 L;  2F0M A;  5G3L F;  3BQ2 A;  2ATW A;  3G71 A;  2CW0 D;  1S3O A;  4IFD G;  3Q0A A;  4LF9 H;  1PYS B;  1CK1 A;  3D8G A;  5KRU A;  4GZY C;  5JJI A;  2F0I A;  2LKV A;  3K6O A;  1UNN C;  2I8C A;  1CHQ D;  4O2B F;  3W5O A;  2JEF A;  3IFD A;  4ABN A;  4XX0 B;  1TWA B;  2QYZ A;  4JI3 L;  4IJL A;  5D3D A;  2PPB C;  2E2H B;  1STN A;  5DGB A;  1YI2 A;  3KF6 B;  4KKT A;  3T1H Q;  1KDC A;  2L9H A;  2D5D A;  2R7D A;  4UFZ A;  1A3V A;  1E22 A;  3HOZ H;  4O3Q A;  2Y0S A;  4JI7 H;  1HNX H;  2YCH A;  1Y8O B;  1XMO H;  3MFY A;  5FLX c;  1VQ6 A;  1SFO A;  4GKJ H;  1T36 A;  1LTA D;  3P20 A;  1CA5 A;  4R7R A;  2A68 C;  2JJQ A;  1X3G A;  3LML A;  3RN2 A; 
#chains in the Genus database with same CATH homology
 4X65 Q;  4PZ7 A;  3RLF A;  2PMZ E;  1TXY A;  1HJP A;  2R7F A;  5AJ3 L;  2GN5 A;  4HJ8 A;  1PH8 A;  5IP7 H;  2D62 A;  4KLK A;  1N8R C;  3HOZ G;  1QZG A;  1OXS C;  2K5N A;  5M5Y H;  3PGZ A;  3TQY A;  1GO3 E;  2KCT A;  2Q2H A;  1IBK Q;  1PFS A;  4X62 Q;  1IBL Q;  1EFW A;  4DV3 L;  4DR4 Q;  2VZA A;  4DR1 L;  1CKN B;  2K14 A;  1LUZ A;  3KOJ A;  4HJ5 A;  4AQY Q;  1VQP A;  2ZTD A;  4BBS H;  1YJ9 A;  2NZO A;  1XNR L;  2UUB L;  4NXM L;  5IP7 G;  1X3E A;  3PSI A;  3VDY A;  4DV2 Q;  1PHJ A;  1UE5 A;  4DR2 L;  4JOI A;  4JV5 Q;  3NEM A;  4P72 A;  3RR5 A;  5GQO A;  1KAW A;  5E7N A;  1N34 Q;  4DR5 L;  4YY3 Q;  4DR3 L;  2NN6 G;  2CKZ B;  2IHF A;  5FJ8 H;  2Q2I A;  1PYB A;  5HY6 A;  3RNU A;  3S1Q H;  4BBS G;  1EQR A;  2KEN A;  4LF5 L;  1VQ8 A;  3DM3 A;  4BA2 I;  2AWN A;  3K8A A;  4DV6 L;  3KYH C;  1X9N A;  1I94 L;  4R4Q A;  3BZC A;  5FJ8 G;  4X64 Q;  3J7A 5;  1RL2 A;  1SRO A;  4B3T Q;  2N78 A;  2WB1 E;  5K36 G;  2NN6 I;  3CQZ H;  1VQM A;  5IYC H;  4A3G G;  4ALP A;  2E2I H;  1B70 B;  3I7F A;  4TQU S;  2ZTE A;  3CXC A;  3U4Z A;  3J81 i;  3STB D;  5C0X J;  4UP9 A;  2I5M X;  4IO9 A;  3CPW A;  2XTI A;  4R1J A;  3BU2 A;  3JC6 6;  3S2H H;  2EXD A;  4JI4 Q;  4K0K Q;  4IFD J;  4A3J H;  2NVX H;  2YTV A;  4LUZ A;  2YV5 A;  2WB1 G;  3E9H A;  4UPA A;  4GLV B;  4GOP B;  2DUD A;  2YTY A;  3M85 A;  1E1O A;  3CW2 C;  3EIV A;  1KD1 C;  2E5L L;  3K7A H;  1SFO H;  3U50 C;  1VQ5 A;  4WJ4 A;  4GNX C;  1VCI A;  4OWT B;  5C44 H;  3CC7 A;  4A3I H;  2Q2U A;  4A3J G;  1CKN A;  1EQQ A;  1QVG A;  1EIF A;  1CKM A;  2MQH A;  4MTN A;  4P71 A;  4LNQ A;  4A3D G;  1TWF H;  4L5T A;  3F2D A;  3H3V H;  1X56 A;  4HJ7 A;  4K0K L;  2R92 G;  1FVI A;  4YCU A;  5C3E H;  3JAM i;  3G6E A;  3GO5 A;  4HJA A;  4QGU A;  1I50 H;  4A3I G;  2OQK A;  4JI2 Q;  5C44 G;  3CCJ A;  3GTJ H;  3CMA A;  1MKH A;  4Y52 H;  4JC0 A;  2Z0S A;  4AYB G;  3PIO A;  2JA5 H;  4LFB L;  2BA1 A;  3ULJ A;  3T1Y L;  3J81 c;  1FL0 A;  3GTP H;  3UDG A;  2IHE A;  3OYY A;  3UDI A;  3S16 H;  5IT9 c;  2OTL A;  5C3E G;  4LUO A;  1YHA A;  4R4C A;  3KDF A;  1XTD A;  2K50 A;  3S24 A;  3HOU H;  4KHP L;  2GVB A;  4DV5 L;  5IY0 A;  5ELN A;  2AMC B;  4BXX H;  4PG3 A;  4H02 A;  4DPG A;  4A3M H;  4OO1 I;  1HNZ Q;  2BH8 A;  2UUC Q;  2OTJ A;  1JJG A;  1HR0 Q;  1N9W A;  1PH6 A;  4A3B H;  3RZD H;  1CKO A;  3H3V I;  5IYD G;  5GAG C;  3HKZ E;  3GTO H;  1XPO A;  5H1S E;  3ULP A;  3HOX G;  2E2H H;  2E2J H;  1UEB A;  4JI5 Q;  4A3M G;  4POG A;  4DR7 L;  4DUZ Q;  2UXC L;  2XGT A;  4GN3 B;  2JQO A;  4HIO A;  4JBK A;  2B3G A;  2MFI A;  2FXQ A;  2E8G A;  1KQS A;  4A3B G;  1BKB A;  4LF6 L;  1L0W A;  3M7N A;  3L7Z C;  1I5F A;  4GOP A;  4LF9 Q;  3M4Q A;  1N33 L;  3OTO L;  3DLL A;  2VY3 A;  2WP8 J;  1I6H H;  4IFD I;  4GN4 B;  1YEZ A;  2LSS A;  4PZ8 A;  3CAM A;  1PV4 A;  1JT8 A;  1JJC B;  1UE1 A;  3UDF A;  3M3Y H;  4A3C H;  3H15 A;  1Y1W H;  3NEL A;  1Q12 A;  4JI6 L;  2VL6 A;  1S72 A;  5IWA L;  1WCM H;  1GM5 A;  3HOV G;  4B3R Q;  1G29 1;  5DLQ E;  3CCQ A;  2K52 A;  1N32 L;  3A74 A;  1TWH H;  1YNX A;  5ELO A;  4PMW A;  1QVF A;  4YHH Q;  3CP0 A;  1SR3 A;  2ZJR A;  1G6P A;  5M3F H;  4LFC L;  2CWA A;  4A3C G;  3CCM A;  3EN2 A;  4RG1 A;  3CCS A;  1KRS A;  3K7U C;  4NXN L;  4OX9 L;  2KCM A;  1Y1W G;  4JI7 Q;  1HNX Q;  1O7I A;  1BBU A;  3HKS A;  1XMO Q;  1WCM G;  3T1H L;  4DR6 Q;  3GTL H;  1WYD A;  4P75 A;  4GKJ Q;  1E1T A;  4DV0 Q;  4B3S Q;  1VQG A;  4DUY Q;  4LF7 Q;  1PH2 A;  4HIK A;  1TWC H;  2VQF L;  4DV1 L;  1VQ4 A;  4L5Q A;  4Y7N H;  5M3F G;  2UUA Q;  2CWP A;  1WJJ A;  2F3I A;  4LF4 Q;  2JA7 H;  1T9H A;  2QEX A;  4JG2 A;  1J5E L;  1WFQ A;  4B3S L;  4IOC A;  4TVA B;  4X65 L;  4GLX A;  1W2B A;  4B3M Q;  4JBW A;  4LW1 A;  4A3K H;  1LTL A;  4QQB X;  4A4I A;  1PH9 A;  4IPH A;  1XNQ Q;  3F8T A;  1L2F A;  4UP8 A;  1IBK L;  1C0A A;  4X62 L;  1IBL L;  2B29 A;  2JA7 G;  1EWI A;  1IL2 A;  4DR4 L;  4YWM A;  2VNU D;  4JBM A;  4A3G H;  1PVO A;  2ID0 A;  3CCU A;  5LMU Q;  1JMC A;  1L1O A;  2HQL A;  5IP9 H;  3KDF B;  4AQY L;  2F4V Q;  4WJ3 M;  4JI1 Q;  4A3K G;  3AQQ A;  1VQJ A;  4IPC A;  5GAH C;  4DV2 L;  4C2M H;  2ALY B;  1NTG A;  1BBW A;  2AHO B;  4JV5 L;  3I55 A;  2UXB Q;  1I3Q H;  2HHH Q;  2NVY H;  3CME A;  4AH6 A;  1LYL A;  4LF8 Q;  1CUK A;  5JJL A;  1YVC A;  3PV0 A;  2N3S A;  3E9I A;  4JI0 Q;  1N34 L;  3GTQ H;  4DV7 Q;  5IP9 G;  4YY3 L;  2CFM A;  1K73 C;  2K75 A;  1B8A A;  4DAM A;  4DAY B;  1V1Q A;  1HNW Q;  3NEN A;  1SRU A;  5LMN Q;  1PA6 A;  2CCZ A;  4A3D H;  1VQN A;  2HIV A;  2D0P A;  1OXU A;  3PCO B;  1YIT A;  4LWC A;  4EX5 A;  3FP9 A;  4X64 L;  2A8V A;  1QVC A;  4R4T A;  5BR8 Q;  2R92 H;  4B3T L;  2UXB L;  1UWV A;  1MJE A;  4A93 H;  1VQC A;  1HZ9 A;  4A3L H;  5M5X H;  3GTK H;  3PUV A;  1VQE A;  3E0E A;  4J15 A;  1RIP A;  2UUA L;  1Q1B A;  2VS1 A;  2OQ0 A;  1M1K C;  4GKK Q;  3UE1 A;  3PUY A;  3HOU G;  4O0A A;  4JI4 L;  1U0L A;  4DV4 Q;  1Q81 C;  3I4O A;  5FLM H;  3HOW H;  3HFZ B;  3GTG H;  2ZM6 Q;  4A93 G;  3J7Z C;  4A3L G;  3TEH B;  1IYJ B;  1EIY B;  1MJC A;  3AFP A;  1FJG Q;  3CCE A;  3GTM H;  2JEA I;  1Q1E A;  1VQF A;  5M5W H;  1NMF A;  1VQD A;  1GKH A;  2AKW B;  3PUZ A;  4GOP C;  1NE3 A;  2N8N A;  5FLM G;  3HOW G;  1PH4 A;  1IXR A;  1LM0 A;  4QY7 A;  3CCR A;  3PO2 G;  1KHI A;  2Z6K A;  2QGQ A;  4UY8 C;  5IYD H;  4IPG A;  3CD6 A;  2IT1 A;  4IOA A;  2PQA A;  3G4S A;  3HOX H;  2R93 G;  2JE6 I;  1AE2 A;  1VQL A;  1YZ6 A;  3RLN A;  1YJN A;  4JI2 L;  5C4J H;  4JI8 Q;  5JEA G;  5M3M H;  4FDB A;  4OXP A;  2V1C C;  2NVQ H;  4A3E H;  3A5Z B;  3BZK A;  2AWO A;  1SLJ A;  2VQE Q;  4JYA Q;  1K0R A;  3HOY G;  1PH1 A;  4UP7 A;  3TS2 A;  1L1O B;  5GAD C;  5GAE C;  1N36 Q;  1XMQ Q;  1KL9 A;  3JAM c;  1NMG A;  1QUQ B;  3K81 C;  1HR0 W;  2JA8 H;  3HOV H;  5M3M G;  5IE8 A;  4A3E G;  1UE6 A;  1HNZ L;  4YCV A;  2Q2T A;  2UUC L;  3HKZ G;  4BA1 I;  4JI3 Q;  2UU9 Q;  2UXD Q;  2PI2 E;  3F2B A;  1HR0 L;  3CCV A;  3H0G G;  1Q82 C;  1VQI A;  2OWO A;  4C3I H;  1G51 A;  2YTX A;  3F2C A;  3MEF A;  3M4O H;  3F1Z A;  3PUW A;  5IYB H;  1KIX A;  1AH9 A;  1VS0 A;  4JOI C;  1R9T H;  3FHW A;  2JA8 G;  4JI5 L;  1EUJ A;  4X66 Q;  1Q86 C;  4DUZ L;  4JBJ A;  3PO3 G;  1BVS A;  3AEV A;  4LUV A;  1U5K A;  3U4V A;  1X6O A;  4R4O A;  3EBE A;  4A75 A;  5IYB G;  5AJ3 Q;  4LF9 L;  2UXD L;  1V9P A;  3PF4 A;  1L1O C;  3B6Y A;  3S15 H;  4YWK A;  4MNO A;  3LGJ A;  2KBN A;  1HZC A;  1P16 A;  1Q46 A;  4AIM A;  3I4N H;  3ER0 A;  2RHS B;  1VQO A;  4DV3 Q;  2B63 H;  2WFW A;  4DR1 Q;  1D7Q A;  4IPD A;  4B3R L;  1E7Z A;  1JB7 A;  2EQS A;  4HID A;  1GVP A;  1VQH A;  4X66 L;  2KHI A;  3CF5 A;  3I4M G;  1XNR Q;  2UUB Q;  4NXM Q;  1A0I A;  2VUM H;  4YHH L;  4DR2 Q;  1ASY A;  2OCE A;  4A76 A;  2I5H A;  2IX0 A;  3I4N G;  1HNW L;  2K5V A;  2ZJP A;  2C35 B;  4OWX B;  2B63 G;  1H95 A;  4JI7 L;  1HNX L;  4POF A;  1KC8 C;  1Z9F A;  4GS3 A;  1XMO L;  4DR6 L;  1Q8K A;  2RHQ B;  3M9B A;  4DR5 Q;  1GD7 A;  4DR3 Q;  1CSQ A;  3RLO A;  2ASB A;  3TRZ A;  4DV0 L;  4GKJ L;  4QJF A;  4DUY L;  4LF7 L;  2QA4 A;  2VUM G;  1FGU A;  1X3F A;  1VQ7 A;  4LF5 Q;  3KLW A;  1OXT A;  1IZ6 A;  4DV6 Q;  3PIP A;  1A63 A;  2LXK A;  1QUQ A;  4KHZ A;  3PF5 A;  1I94 Q;  4LF4 L;  2PQA B;  1CSP A;  3GDE A;  3A0J A;  4DK3 C;  1K8A C;  1D8L A;  1VQK A;  2IY5 B;  1K83 H;  4B3M L;  5HGQ A;  1XJV A;  3UE0 A;  1ASZ A;  4O2D A;  1WOC A;  3K80 C;  4LFA Q;  4L5S A;  1XNQ L;  1QZH A;  5GRO A;  1PH7 A;  2N49 A;  3FKI H;  3PUX A;  1E24 A;  3S14 H;  3GD7 A;  1UE7 A;  3ZJY C;  5C4X H;  2PI2 A;  4HJ9 A;  3K0X A;  3STB C;  1A62 A;  5JEA J;  2VW9 A;  5LMU L;  3U58 A;  1K8G A;  3TS0 A;  1NBW A;  3S1R H;  1C9O A;  1X55 A;  1Z47 A;  4NB3 A;  2F4V L;  3S17 H;  1W3S A;  4JI1 L;  1PH3 A;  2JA9 A;  3A5U A;  1Q7Y C;  4YCW A;  4X6A H;  3UDX A;  4GNX B;  2K5H A;  4DNI A;  1SN8 A;  3FKI G;  1VQA A;  2Z6K C;  1EYG A;  2HHH L;  4GN5 A;  1NJI C;  1OTC A;  1OXX K;  4PZ6 A;  2E5L Q;  5C4X G;  3KF6 A;  4LF8 L;  4NPS A;  4YWL A;  4JI0 L;  4LFA L;  4DV7 L;  4BY1 H;  1X65 A;  1WI5 A;  5LMN W;  2A19 A;  1YHQ A;  1V43 A;  1VQB A;  1YBY A;  4P74 A;  4BY7 H;  2ZJQ A;  1X54 A;  1EOV A;  5LMN L;  1IBM Q;  2CQO A;  2LXJ A;  3PO2 H;  4BBR H;  3KJP A;  2I0Q A;  3NBH B;  4APV A;  1KRT A;  3D0F A;  4L5R C;  2ES2 A;  5IYC G;  4BY1 G;  1S40 A;  2R93 H;  1OXV A;  1XPU A;  2Y0S E;  3G48 A;  5BR8 L;  1KXL A;  4XTC S;  4LFB Q;  2H5X A;  4BY7 G;  1Y1V H;  1J6Q A;  1C7Y A;  3T1Y Q;  2NVT H;  2BH2 A;  4BBR G;  4GKK L;  3AFQ A;  5EAY A;  1E3P A;  2HT1 A;  4KHP Q;  2RF4 A;  3W1B A;  4AYB E;  2MNA A;  1AE3 A;  2MO0 A;  1P8L A;  3D31 A;  3ULL A;  3MXN B;  4DV4 L;  3J81 j;  4DV5 Q;  1IBM L;  2Y0S G;  3CCL A;  3HOY H;  3ICE A;  4IJH A;  2ZM6 L;  4DKA C;  1Y1V G;  4R4I A;  4OO1 G;  2HIX A;  1FJG L;  2GVA A;  1K3R A;  1SMX A;  1Y14 B;  1YHB A;  2RCN A;  4HIM A;  1HH2 P;  3CPF A;  1HZB A;  3M4P A;  2WAQ E;  3KJO A;  4RMF A;  3H0G H;  3KF8 B;  2JA6 H;  2BA0 A;  4EQ5 A;  3L0O A;  4GLA C;  3RN5 A;  3J80 i;  1JJ2 A;  2I5L X;  4XIG S;  2JK8 A;  2NZH A;  1DGS A;  4DK6 C;  3OW2 A;  4DR7 Q;  2UXC Q;  3I2Z A;  4OWW B;  2R6G A;  4MZ9 A;  1M90 C;  3CC2 A;  4GNX A;  4QIW E;  3KFU A;  4LF6 Q;  2IX1 A;  3S1M H;  2MO1 A;  3PO3 H;  2EIF A;  2F52 A;  2WAQ G;  3OTO Q;  2JA5 G;  1N33 Q;  4A3F H;  5C0X G;  4OON A;  4JI8 L;  2JA6 G;  3TRE A;  2YYZ A;  3RZO H;  1XPR A;  2ATW A;  3G71 A;  5JJK A;  1S3O A;  4IFD G;  1JE5 A;  2KHJ A;  2A1A A;  3BJU A;  1PYS B;  4C3J H;  2VQE L;  1TWA H;  1YJW A;  1PH5 A;  4KI0 A;  1K9M C;  1HZA A;  1MIU A;  4JI6 Q;  4JYA L;  5JJI A;  1VQ9 A;  5IWA Q;  3Q8D A;  4BXX G;  3ERS X;  1N32 Q;  1N36 L;  1XMQ L;  3S1N H;  1SE8 A;  4A3F G;  3W5O A;  1B7Y B;  2ZTC A;  1TWG H;  4JCV E;  2L15 A;  4LFC Q;  3I4M H;  5C0X I;  4JI3 L;  4IJL A;  2R7Z H;  3AYH B;  4QL5 A;  2UU9 L;  4OX9 Q;  4NXN Q;  3S2D H;  2JEB I;  1YI2 A;  2PNH A;  3KF6 B;  3T1H Q;  4ME3 A;  3WWV A;  5J3B A;  3SGI A;  2R7D A;  2D0O A;  2K4K A;  3J80 c;  2YU9 H;  1E22 A;  3HOZ H;  4C3H H;  2VQF Q;  4DV1 Q;  5FLX c;  1NY4 A;  3I56 A;  1VQ6 A;  2R7Z G;  3L2P A;  2DGY A;  3W1G A;  2JJQ A;  4P73 A;  1YIJ A;  1J5E Q;  1A8V A;  1X3G A;  3RN2 A;  3CC4 A;  3IRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...