4A3DG

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3dG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3dG01
3NENA 4GLXA 1VQLA 3T1HQ 2UXCL 4YHHQ 1N36L 5JEAG 1E24A 1I5FA 1N8RC 3HOWH 2NVYH 5JJIA 1EFWA 2OCEA 3HKSA 3F2DA 5M3FG 4X6AH 4KLKA 3M85A 2KCMA 1PH2A 2JA6G 1B70B 4YWMA 4JBMA 1G291 1K0RA 4TVAB 1XJVA 1GO3E 4LF6Q 2HQLA 5IP7H 1MIUA 2YTXA 4DV4L 3DLLA 4A3MG 4P71A 1WOCA 2VZAA 5LMNW 5IP9G 2UXCQ 1N9WA 2CFMA 4IOAA 1X3GA 4A3CH 4DUYL 3KJOA 3CCJA 2N8NA 5C0XG 1IBLL 1XTDA 2R7ZH 2GVAA 3NELA 2YV5A 3RLOA 4QQBX 4B3ML 4IO9A 4JI5Q 1E22A 2KHJA 4C2MH 4DV4Q 2K5VA 3OTOL 4GNXB 1YHBA 3HOWG 2NZOA 3I2ZA 3PUYA 5M3MH 4X62L 2KBNA 3K7AH 4DK6C 2NZHA 4P74A 5JEAJ 4DUYQ 1Q82C 2I5MX 2V1CC 3Q8DA 1VQKA 3JAMc 3WWVA 3UDGA 5IP7G 4DV5L 2I0QA 2DGYA 2GVBA 4OX9L 4A93H 4R1JA 3S1RH 2HIXA 3FHWA 2Q2HA 1VQPA 3OTOQ 4XTCS 4X62Q 4A3CG 4QY7A 3KOJA 1Q8KA 1JT8A 3S2DH 1YHQA 1VQDA 1QVGA 3K80C 1VQMA 4DV5Q 3FKIH 5IWAL 1TXYA 1NTGA 3CQZH 5C0XJ 4OX9Q 3EBEA 1HZBA 1X3EA 1CKMA 5M3MG 4OO1I 4LF9L 5FJ8H 3AEVA 3GDEA 1EQRA 4DV6L 3PF5A 1K8GA 4DR7L 4JI3L 5GADC 4LF8L 1OXXK 2UXDQ 4OONA 2XGTA 4UP7A 2Z0SA 3TQYA 4JBKA 3S16H 4OWXB 4A93G 1IXRA 1VCIA 4IJHA 2YU9H 2WFWA 4HIKA 1CKNB 4LF9Q 3G6EA 1PA6A 1VQ8A 3UDIA 2JE6I 4YWLA 3W5OA 4AYBG 4JBWA 4BY1H 3GTLH 4DR7Q 3HKZE 4JI3Q 4LF8Q 3RZOH 3ZJYC 3J7ZC 4BXXG 1JJ2A 1WFQA 4LFCQ 3FKIG 4OXPA 3PV0A 2AKWB 1SROA 1W3SA 5FJ8G 1G51A 1PFSA 1HZ9A 1QUQB 4UP8A 4JI1L 3CCSA 4HJ5A 3CP0A 1PH6A 1I94L 2NVXH 5IE8A 2EXDA 4QIWE 4GOPA 1HNWL 4YCWA 2Z6KA 4HJ9A 2UUBL 3PCOB 4LF7L 1JJGA 3AYHB 4DAMA 3AFQA 1VQGA 4HIOA 1TWAH 2IT1A 1X6OA 5C44H 3CC7A 3CCQA 4LFAL 1I6HH 3MEFA 1MJCA 2JJQA 1NMFA 1LTLA 4PMWA 4BY1G 4JI1Q 3I4NH 1I94Q 2YTVA 3KF6B 1PH3A 4EX5A 4DV3L 1XNRL 3PO3H 1VQBA 1HNWQ 2RHSB 4BA1I 2UUBQ 2VNUD 2VS1A 1YEZA 1C0AA 3BU2A 5BR8Q 4AIMA 4LF7Q 4IPHA 4LF5Q 2BA0A 1LUZA 3CCMA 2EQSA 1EIYB 4WJ4A 3S2HH 3GTQH 2K5NA 4YCVA 1KRTA 3M3YH 3S17H 4GNXC 4JOIC 4AQYL 1VQ6A 2JEBI 4MZ9A 3CPWA 2UUAQ 1HZAA 2K5HA 5GROA 3GTKH 4BY7H 2ZJQA 1KD1C 1OXSC 3VDYA 4KI0A 4JI7L 3G4SA 1XNRQ 4WJ3M 2B29A 1UE7A 1VQFA 4Y52H 5C44G 3KYHC 5ELOA 1FL0A 1SLJA 1LM0A 2PQAB 4LNQA 1KAWA 3I7FA 4AQYQ 1VQOA 3I4NG 2E2JH 3A5ZB 3PO3G 4KHZA 4X66L 1AH9A 3BZCA 2VY3A 5M5YH 3J81c 4JI7Q 1YIJA 4JI2L 2OTJA 1L0WA 2ZM6L 1LYLA 3HOXH 1KC8C 3TS2A 3IRBA 1D7QA 3J7A5 3RNUA 2CKZB 3BZKA 1SN8A 4IPGA 3PUZA 1Q1EA 1TWCH 5IYCH 4FDBA 4GKJQ 4GNXA 4JOIA 2HIVA 1XPRA 4HJAA 1PH9A 3F1ZA 1K3RA 4BY7G 4GN4B 4X66Q 2NN6G 2ID0A 1IBML 2MQHA 5H1SE 3STBD 2OWOA 1CKOA 4J15A 4JI2Q 1TWHH 1T9HA 4PG3A 2ZM6Q 3CD6A 3BJUA 4PZ6A 2HHHL 1BKBA 2CQOA 1N36Q 2ALYB 1L1OB 3LGJA 5DLQE 1YBYA 1PH1A 1A63A 5GAEC 1E1OA 1JJCB 2JK8A 3SGIA 1K9MC 1IBMQ 3UDFA 4JYAL 2R92H 1ASYA 3PUWA 5IYCG 2BH8A 1G6PA 2NN6I 1VQEA 1FJGL 3CPFA 2YYZA 4DR6L 4MTNA 4DV7L 1GKHA 1S72A 4B3RL 2B63H 4BBRH 1EYGA 4OO1G 4QGUA 4JI0L 5IY0A 1O7IA 2MO0A 4PZ7A 2IX0A 1IBLQ 2CCZA 4LFBL 2WAQG 2AHOB 3UE0A 4JYAQ 2A19A 2VQFL 4B3MQ 1NY4A 3CXCA 2QGQA 3M9BA 2Y0SG 2A1AA 2KHIA 1S3OA 1UE5A 1JMCA 3U50C 1OXUA 4JI4L 2UU9L 1VQHA 1FJGQ 2XTIA 4DR6Q 1KHIA 1CKNA 1L2FA 1YZ6A 4OWWB 2K50A 3S1QH 3J81i 1KQSA 1EOVA 1K73C 4POGA 4JI0Q 1OTCA 2R7ZG 4LFBQ 3I56A 1B8AA 4A75A 1MKHA 2VQFQ 1Y1WH 4JI6L 2I5HA 5M5WH 4GN5A 3S24A 3L2PA 4JC0A 2E2HH 3CCEA 5C4JH 2RHQB 5IT9c 2KENA 2B63G 1QUQA 3FP9A 4BBRG 4LF4L 3PO2H 1XMOL 1W2BA 1X56A 4AYBE 2HT1A 4O0AA 5E7NA 4DR5L 1NBWA 2AWOA 3E0EA 4JI6Q 5IWAQ 2VW9A 3GD7A 5C4XH 3PGZA 4HIDA 4JV5L 1PVOA 4DV1L 1U5KA 1Y14B 3I4OA 4DV6Q 1S40A 2WP8J 1QVFA 3S14H 3K81C 1M90C 1BBWA 2IHFA 3E9HA 4LF4Q 3I4MH 1XMOQ 5AJ3L 2QA4A 2F52A 3KF6A 2AMCB 4DR5Q 1QZHA 1Y1WG 3ERSX 2FXQA 1PH4A 4OWTB 1YI2A 1BVSA 3EN2A 2JA7H 4JV5Q 5M5XH 4DV1Q 1HNXL 1VQIA 2QEXA 5GAHC 2IHEA 2ZTDA 2PMZE 3PO2G 1HR0L 4DKAC 5AJ3Q 1JE5A 4JI8L 4QJFA 1NE3A 5GQOA 2F4VL 3AQQA 1X9NA 1OXTA 3F2CA 4A3FH 4DAYB 4DK3C 5C4XG 1P8LA 4UPAA 1RIPA 4A3JH 1JB7A 2PQAA 1E1TA 1HNXQ 1L1OC 4APVA 1Q1BA 4R4OA 4B3TL 1TWGH 3D0FA 4L5QA 2MNAA 1HR0Q 1I3QH 4DR2L 1A8VA 4H02A 4JI8Q 2JA8H 4POFA 2F4VQ 2ZTCA 4AH6A 5GAGC 1XPOA 1Q12A 1YNXA 3UDXA 2JA7G 1V9PA 1CSQA 1IL2A 3H3VI 3HFZB 3CCUA 1GM5A 4LFAQ 2ES2A 2K75A 4B3TQ 4BBSH 2MFIA 1GD7A 2IY5B 1SRUA 4ALPA 3A5UA 5EAYA 1I50H 4DV3Q 3ULJA 4R4TA 4DR2Q 4C3IH 3HOUH 4RG1A 1PYBA 2PI2A 4A3FG 4TQUS 1Y1VH 1OXVA 4DV2L 2JQOA 4P75A 2ASBA 4GN3B 1E3PA 4A3JG 4NPSA 1SFOH 4RMFA 1UE1A 1TWFH 3NBHB 4L5TA 5FLXc 1Q86C 4DR4L 5K36G 1L1OA 2RF4A 4UP9A 5JJKA 2Q2UA 2JA8G 1C9OA 2F3IA 1AE3A 4R4QA 4BA2I 1U0LA 4A4IA 4IOCA 4EQ5A 1HNZL 4DV2Q 4X65L 4A3DH 2D0OA 1VQ4A 3KLWA 3J80c 4DNIA 4DR4Q 3G48A 3M4PA 3M4OH 4C3HH 3GTOH 3HOUG 3I4MG 5IYDH 2B3GA 2D62A 4P73A 4C3JH 3G71A 3M7NA 2K4KA 3PUVA 1Y1VG 3GTJH 3ICEA 3HOZH 2ZJRA 1P16A 2D0PA 2NVTH 2R6GA 1HNZQ 4X65Q 2C35B 4A3IH 2A8VA 2LXJA 1HZCA 2JA9A 4L5SA 3GTMH 2MO1A 4A3EH 3H15A 1YHAA 1PH5A 4R4IA 3W1BA 2NVQH 3U4VA 3HOXG 2H5XA 3D31A 4HIMA 4PZ8A 2WAQE 5FLMH 3EIVA 2GN5A 1SR3A 3U58A 3OW2A 1J5EL 1QZGA 2Y0SE 1X55A 4IJLA 2HHHQ 4A3DG 3TEHB 3T1YL 4LUVA 3RN5A 2VUMH 1SE8A 4K0KL 1B7YB 4JI5L 4Y7NH 3ULLA 1VQAA 2YTYA 5IYDG 3A74A 1EQQA 3UE1A 1IYJB 1XMQL 4A3LH 4MNOA 3HOZG 3ER0A 2L15A 2R7DA 4DPGA 2WB1E 1EIFA 3GTGH 2AWNA 3STBC 4YCUA 3TREA 4A3IG 1J5EQ 3CC2A 3KF8B 1CSPA 4NXML 1EUJA 2Q2TA 3T1YQ 2R93H 4DV7Q 4A3EG 2K14A 3RN2A 4K0KQ 4DV0L 2LXKA 4B3RQ 1K8AC 3CAMA 4IPCA 3AFPA 4ME3A 2WB1G 1XMQQ 2R92G 5FLMG 1MJEA 1R9TH 1WCMH 3M4QA 2OQ0A 1BBUA 1VQJA 2JEAI 3I55A 4NXNL 4JI4Q 1J6QA 4NXMQ 3KJPA 3J80i 5J3BA 2UU9Q 2VUMG 3TRZA 1IBKL 2UUCL 3CW2C 4DV0Q 1Q7YC 4X64L 4DUZL 2PNHA 4A3LG 3H3VH 4GLVB 3U4ZA 5C0XI 3S1NH 5HGQA 5IYBH 3H0GH 3L0OA 4JG2A 3DM3A 5C3EH 4A3GH 2UXDL 2VL6A 1YVCA 4NXNQ 3HOYH 5HY6A 2JA5H 4BXXH 2R93G 1UEBA 1PV4A 1UE6A 4GS3A 1Q81C 1PYSB 1IBKQ 2UUCQ 1HH2P 2N3SA 4X64Q 3RR5A 4DUZQ 3KDFA 4O2DA 3CMAA 1FGUA 2R7FA 1YJ9A 2I5LX 4YY3L 1AE2A 1WCMG 1PH7A 1PH8A 2BH2A 1X3FA 4R4CA 2K52A 1XNQL 3S15H 2ATWA 2LSSA 4GLAC 4UY8C 1WYDA 4B3SL 4IFDG 4GOPC 1X54A 2VQEL 3CCLA 2Z6KC 4KHPL 4LFCL 1VS0A 2ZJPA 1N33L 1FVIA 3GTPH 1YITA 1KL9A 3CMEA 3L7ZC 3J81j 3K7UC 1M1KC 1A62A 4JCVE 1UWVA 3TS0A 3CC4A 1D8LA 4YY3Q 5IYBG 3H0GG 2E5LL 2UXBL 5LMUL 4A3GG 3GO5A 5C3EG 1XNQQ 3PIPA 2DUDA 4B3SQ 2JA5G 3HOYG 4KHPQ 2VQEQ 5ELNA 1IZ6A 1N33Q 4A3BH 4A76A 3KDFB 1Z9FA 4QL5A 3RLFA 4IFDI 2OTLA 1ASZA 1VQNA 4HJ8A 1N32L 2N78A 2Q2IA 2E8GA 3CF5A 2UXBQ 1RL2A 3HKZG 2E5LQ 5LMUQ 1H95A 3PUXA 4L5RC 3W1GA 1YJNA 1GVPA 1E7ZA 3HOVH 1N34L 3PF4A 3JAMi 1X65A 1Z47A 1WJJA 1K83H 5BR8L 4LF5L 4IFDJ 1EWIA 4NB3A 3B6YA 5LMNL 2RCNA 1N32Q 3ULPA 3PIOA 3F2BA 1YJWA 1KRSA 4LUOA 4P72A 2E2IH 2UUAL 3JC66 3S1MH 1V43A 1WI5A 3NEMA 4IPDA 4A3KH 1NMGA 1HJPA 1DGSA 4XIGS 1N34Q 1Q46A 4A3BG 3A0JA 3K8AA 4DR1L 5JJLA 5LMNQ 3CCVA 1NJIC 4DR3L 1A0IA 1VQ5A 2IX1A 4GKKL 2CWAA 3K0XA 4YWKA 3CCRA 2OQKA 4JBJA 5M3FH 4GOPB 2PI2E 1QVCA 1PHJA 1VQ7A 3HOVG 2CWPA 2JA6H 4BBSG 2KCTA 1VQ9A 4HJ7A 4LWCA 1C7YA 4DR1Q 3T1HL 2N49A 1HR0W 3KFUA 2BA1A 1CUKA 3OYYA 4YHHL 2ZTEA 4A3MH 4GKJL 4DR3Q 5IP9H 1XPUA 3PSIA 4A3KG 4GKKQ 3F8TA 1KXLA 1SMXA 2EIFA 4LW1A 1VQCA 3E9IA 3RLNA 3RZDH 1V1QA 4LF6L 4LUZA 1KIXA 3MXNB
chains in the Genus database with same CATH superfamily
1DJRD 4EEYA 2RBMA 3BDLA 4LFAH 1N8RC 2CH4W 2NVYH 3HKSA 3RBEA 4KLKA 2WTFA 1X3QA 3MXGA 2LFNA 3M85A 4DV3H 1EY4A 1YNNC 3N40P 1G291 1GO3E 1MIUA 2YTXA 3GQCA 2CW0C 4RB3C 3VR2A 2XVSA 4UCOA 1JOOA 1WOCA 5LMNW 3QB3A 1BGWA 3HRZC 2PNRC 2IBKA 2G9HD 4KN7C 5BN4A 4OEMB 4A3CH 4L1KA 1D5XC 1FNUA 4EG0A 4KY5A 4L6TB 1EYCA 2AU0A 4RGTA 1TWCB 2DY7A 4ME5A 1Z7TA 3RLOA 1JWMD 3K58A 1QCBD 3BVZA 2EYFA 4C2MH 1YHBA 3HOWG 5M3MH 5A2QL 2H4OA 4HMIA 2TSSA 4K14A 1PFMA 3K7AH 4X66H 3OWFA 4TRDA 1VQKA 3WWVA 2ZM6H 1VKZA 5IP7G 5EKKA 4DV5L 1VMCA 2DGYA 2R7LA 3PQIA 1JC7A 4G7HC 1VQPA 3MEHA 4LJZC 4IUNA 5CV9A 4MV9A 1HUMA 5D8DA 4AYBA 4X62Q 1IOVA 4XXEA 4QY7A 5L1IA 1Q8KA 2ZXOA 1U4PA 2R92B 1LTAD 1IBMH 3FKIA 3C46A 4O2AF 2WINB 4RWSC 2E2HA 3CQZH 4BWSC 3FVQA 4KY7A 2VUMB 2K6AA 3GILA 2HHHH 3HBLA 5EJWA 1EY0A 1CKMA 1DV1A 3QWNA 1HFNA 3AEVA 4A2AA 1XWEA 3NQTA 4ECWA 4DR7L 5I47A 4UP7A 3TQYA 3S16H 1TU2B 5CR3A 1HFGA 3OSOA 4A93G 4IN3A 3A55A 4UHVA 1AZPA 1YNJC 3R93A 4G7OC 4DV7H 4YWLA 4YJ3F 3HZXA 3W5OA 4JBWA 2ZDGA 4F87A 4JI0H 1M6VA 1ICWA 1JJ2A 4XX0B 3PZPA 3OHBA 3J7AF 5KFOA 2QF7A 2W9CB 3KBXA 5D65A 3C3LA 4I7HA 3PO2B 5LXTF 5KG0A 2NVXH 4O3NA 2GPSA 2B39A 5A2QW 2EE1A 1HA6A 4CC5A 5C4XB 1O7LA 2UUBL 5ELDA 5C3EB 1JJGA 1AFPA 2G5DA 2K04A 4HIOA 2KCCA 5CBEE 5I6YA 3CC7A 1PRTF 1GSOA 4O4IF 2X0SA 4LFAL 1I6HH 1SMYD 4K8JA 1TWGA 4QWCA 1NMFA 1LTLA 4C5AA 1I3QA 3I4NH 1I94Q 3KF6B 4F4XA 4EX5A 4DV3L 1VMPA 4RCNA 5TSSA 2IWHA 2XCPA 2R8HA 2VS1A 4J9PA 2DZDA 4XT1B 2BA0A 1LUZA 2AQ1B 4WJ4A 3VA7A 4ZQ3A 1F2YA 4PDBA 4DV1H 1KRTA 3S17H 4GNXC 4Q43A 1VQ6A 5DGBA 1F9SA 2HUGA 2ZXRA 4MZ9A 3CPWA 3GTKH 3TZDA 1I50A 3J7AK 3BAAA 1WTWA 1KD1C 3TP7A 5A35A 1CHPD 2FKLA 2NN6H 5KFIA 3FDTA 2B29A 3IAYA 3VR4A 3MR3A 3ONAB 4OELB 4Y52H 3R5XA 5C44G 3KYHC 2R87A 1SE2A 2PQAB 3NUCA 4LNQA 3D6CA 1E4FT 2MJ8A 2V59A 4TUYF 4X66L 1AH9A 2AGOA 3WOEA 3G6XA 2CW7A 5FKAC 3QG1A 4JI7Q 2ATLA 2DJFC 2ZM6L 3HOXH 1XX8A 3J7AV 5EOYA 3GV7B 4FM9A 1KNEA 4R8UB 5IYCH 3OIQA 4DK0A 1KJJA 4JOIA 2A68D 3RV3A 5K5PA 1PH9A 1VF7A 2CH4A 1S5ED 4BY7G 1B50A 2E2IB 4DR2H 2WAQA 1DXMA 1IBML 2PPBC 2A6HC 1CKOA 2B2TC 4J15A 4KD4A 1TWFB 3PW4A 2HHHL 1BKBA 1II3A 1QILA 2EY2A 2F03A 2AUJD 2AQ4A 1E1OA 3SGIA 4DNTB 3GV6A 4I4TF 1K9MC 4ULLA 4A3DB 4K2LA 2EJFC 1TIID 5CORA 1ASYA 2D2CC 2BH8A 1CHQD 2A6ED 2NN6I 4CKBA 1G6PA 3PW7A 1EZ8A 2B63A 4DV7L 1VDZA 1RTOA 3GTJB 2V5AA 4QCLA 4OO1G 2NYZD 4JI0L 4LFBL 3UE0A 3T4AC 4B3MQ 2FK1A 1EY9A 3RZDB 5KRUA 3M9BA 1Y8OB 1UE5A 3S9WA 1JMCA 5BPFA 1MD2D 3HGBA 2QCPX 4DR6Q 1L2FA 1CKNA 2OF1A 2PZWA 2YZGA 1YZ6A 2WB1B 4MV7A 2K50A 3J81i 1RHPA 1EOVA 1WCMA 2X6LA 3SXHA 3MXUA 3I56A 1B8AA 4A75A 1MKHA 2VQFQ 1PVOA 4GN5A 4ED6A 2EYPA 4YQWA 1STHA 5D3DA 2F0PA 5C4JH 3CCEA 2RHQB 3VYUA 1TAEA 1D5MC 1QUQA 3FP9A 4CJ1B 2JEFA 1XMOL 3TN2A 1X56A 1UC8A 1EIGA 2AWOA 1HHVA 2K1BA 3BA9A 2R93B 3GD7A 4X3SA 3PGZA 1J5EH 2JA5A 4DV1L 1U5KA 3H20A 2SDFA 1CTMA 4I65A 3K81C 5F9LA 2FLPA 2RA4A 5AJ3L 3HP3A 1S0NA 4PV1C 5J22A 1Y1WG 2F0WA 4IRDA 4JW0A 2PBZA 3EN2A 3GLKA 3SI8A 4NXMH 1EZ6A 1EHIA 2ZTDA 3S1NB 2R82A 5KFYA 1F2MA 3QIAA 5GQOA 2F4VL 3AQQA 1X9NA 1SAPA 2EOTA 4DAYB 4DK3C 5IGGA 2LY7A 1CFMA 2FE3A 5EWFA 4ECQA 4LAAA 1RIPA 3KLSX 4A3JH 2XNAC 1JB7A 1HNXQ 3I4MG 1DIKA 4APVA 1Q1BA 4R4OA 1IBKH 3D0FA 3UI2A 4DR2L 5FPRA 3HKZB 2A5HA 4EQPA 1QB5D 4ZKCB 5GAGC 3QZ7A 3I91A 1Q12A 2JA7G 1SEIA 5KFAA 4U6PA 5BPHA 2Z8LA 3CCUA 1JLLB 2IY5B 2H1EA 1RK6A 4ZI7F 3A5UA 3CRKC 1H9KA 3ULJA 3GTLB 1Y1VA 4C3IH 3K6OA 5I6WA 4A3FG 4TQUS 2FK2A 1N48A 4G4KA 2JQOA 4KHPH 1EU4A 4CJ0B 5J2UF 4RB2C 5C3WA 4M8AA 5FLXc 2DPJA 1L1OA 2RF4A 2JYOA 4NKLA 3MA2B 3J80W 5L1LA 4JPBW 1Z2PX 1G2TA 5JJKA 1C9OA 2F3IA 4EQOA 4UCRA 5LMUH 1U0LA 1STEA 3EJIA 5JVDF 2XC9A 4EYHB 1G8ZD 4OL7A 4IOCA 5KT6A 5KFVA 1VQ4A 5KT4A 1RJPA 3G48A 3BA8A 1G2SA 4F50A 4C3JH 2W7OA 1JQYD 5IGCA 1I94H 3SK4A 2XGQA 3JSLA 4NMZA 2NVTH 3I70A 3GTMH 2E75C 3IKJA 1CA5A 3MJFA 5M3FB 2NVYA 2NVQH 2R8KA 2H5XA 2JA6B 1V1OA 3U58A 1J5EL 1I4HA 1E2ZA 3RN5A 1B7YB 1KNAA 1JX4A 4Y7NH 4M7EA 4I7AA 1IYJB 3GIQA 1XMQL 3HOZG 2L15A 2R7DA 2F0SA 5KNDA 3GTGH 2C2EA 1KBLA 2DJGC 4A3IG 4NXML 4JI7H 1CSPA 3L3OC 1EUJA 2C9OA 2Q2TA 2MCTA 2L9HA 2K14A 4C2MA 1GHJA 4K0KQ 4EEQA 2F0FA 3T51B 3OIPA 3I72A 1SXTA 1K8AC 3BQ1A 3G7LA 3DWQA 1MJEA 3OSNA 2M00A 2K05A 2NUCA 3M4QA 2QK4A 3I55A 2UU9Q 5J3BA 2VA3A 3SK6A 1IBKL 1SJED 4LMYA 3EYYA 5HGQA 3VYRA 3H0GH 3D6WA 1O7YA 2VL6A 5FPOA 3ORRA 3P20A 4BXXH 2I07B 1F9RA 2EYJA 4GS3A 1ZYRC 3GQBA 4R8NA 1PMRA 1HTLD 2N3SA 4DUZQ 4R8IA 2C28A 3CMAA 1DD2A 1YJ9A 2I5LX 4YY3L 1AE2A 1WCMG 4RKLA 1PH7A 4XT3B 4K6DA 2ATWA 4GLAC 3S1RB 4KHPL 3CCLA 5KT3A 2ZJPA 2BE5C 2D9UA 2B2VC 1E0BA 4B3MH 1RKNA 3GTPH 3CMEA 1SJHD 3L7ZC 2WV6D 2F3WA 3K7UC 4AYBB 2F0NA 4MHEA 3LMLA 4DR6H 2MHVA 2C22A 2KOLA 5IYBG 5LMUL 4MA0A 2I80A 4Y8VB 3FKIB 4HAEA 2DUDA 3PIPA 1ZKOA 4B3SQ 2JA5G 3V6KA 4H13C 5ELNA 5F2DA 3GV3A 4A76A 3K59A 2DPIA 3KDFB 3MZ5A 4OGQC 1T36A 3L9AX 2OTLA 2V9WA 4HJ8A 4KHVA 1C4QA 2NU6B 2KJXA 2R8IA 1K1SA 5EBCA 3RB0A 2F0OA 2J6UA 1AZQA 1X65A 2FFKB 1Z47A 4F8MA 1K83H 1QNUA 3A8IE 2FPPB 5J39A 5JVH3 3I4MB 1N32Q 3MFHA 3F2BA 3F2UA 4P72A 2WDTA 4WBNF 1BDOA 3VR5A 1V43A 4IPDA 3DF7A 2DN8A 5KNCA 1HJPA 1TR5A 3DM1A 4FF2A 1CS0A 4Q0YA 5KG1A 1ZXTA 2KCNA 4A3BG 5KFFA 5JJLA 2PZTA 1I7LA 4KJOA 3N42B 3GTKA 3C1FA 2R6FA 3K0XA 1XTCD 3Q22A 1D5ZC 5FLXE 5KX5F 3ORQA 1EEFD 3HOVG 1QVCA 1CQIB 1QWYA 1M8AA 1XYIA 4RZRA 2HJWA 3MWMA 2N88A 3I4LA 2FPIB 2L11A 1HR0W 1TWGB 4XQNA 3PO3B 1STYA 1I3QB 1SYCA 4TKOB 1HNXH 5FO8B 1HUNA 2DNCA 3K5HA 4MV6A 2EIFA 2ASDA 3E9IA 1B6SA 1K8MA 5KFGA 3VPCA 4LF6L 1V1QA 5C0XH 1KDAA 1KLGD 1KIXA 3Q8QB 1LT5D 3GTOH 3NENA 5E4WC 1VQLA 4X3UA 3T1HQ 2UXCL 3BS1A 1E24A 1I50B 2ICEC 5KFKA 2OCEA 2CZGA 4Q45A 3QJYA 2KCMA 4ILWA 4YWMA 2BCOA 3IFDA 1XJVA 5CYUA 3LWEA 2E2JB 4A3MG 5IP9G 1B44D 3DWPA 5GONF 1SBBB 5KFMA 1X3GA 4DUYL 5EPJA 1CE8A 4TV9F 2R7ZA 1TA8A 4MA5A 3CCJA 2N8NA 3CKIB 4FXDA 4RUCA 1F9QA 3NELA 2YV5A 4B3ML 4IO9A 4HNVA 1TKWB 1E22A 5LHY1 4DV4Q 3OTOL 2L55A 2R7MA 2W6NA 4DK6C 2WAQB 4FS1A 4JI2H 3Q0AA 1RTNA 3UDGA 1JICA 2B8FA 1GOZA 1LTGD 1DYQA 1B04A 3BQ0A 4J1MA 2BOSA 5IT9E 4A3CG 1JT8A 5AFWA 1PTOH 4I7ZC 3CU7A 1YHQA 1TS5A 1ESFA 1QVGA 3K80C 2EXZA 3BG5A 1V1PA 1JWUD 1PLFA 1NTGA 1TXYA 1U4MA 5DM63 3EBEA 4OX9Q 3ND9A 3RAXA 2B63B 4BBRB 5M3MG 4DAPA 5FOBB 3BVMA 5EGTA 1A15A 5DG9A 5FLXL 1K8GA 5LL6S 4LF8L 3VA5A 2UXDQ 4DA2A 2XGTA 2Z0SA 1L0YB 4JBKA 5LA6F 4OWXB 3R23A 5JH7F 1LT3D 1IXRA 3P75A 3IN5A 1PK8A 2YU9H 3K3VA 4HIKA 1CKNB 4LF9Q 3G6EA 5E4XA 5DQIA 4BY1H 3A7AB 4JI3Q 3RZOH 1WCMB 3J7ZC 1A6XA 3X3NA 3EQLC 5HBRB 3EVQA 1W3SA 4PMCA 3P1HA 2L12A 1PZID 1BOSA 2UU9H 1PFSA 1QUQB 3LWUA 4HJ5A 1PH6A 1SYXB 3GV8B 4GOPA 4YCWA 1I4PA 3PCOB 4LF7L 1TWAA 4DAMA 1WVLA 5KG6A 2JA5B 1VQGA 2XIWA 2A73B 1X6OA 2VUGA 3CCQA 2XSCA 3OOCA 2W6OA 3MEFA 4PMWA 4JI1Q 3U9TA 2FJ2A 2YTVA 1PH3A 2J6TA 2W6QA 4CJ2C 4DUZH 2FINB 3IG0A 1HNWQ 2FPGB 2R86A 2VNUD 1BUVT 4DNRB 1C0AA 5KFEA 3BU2A 4AIMA 4LF5Q 1EIYB 3MXNA 4YCVA 4AQYL 4ECYA 5KG7A 4PMBA 5GROA 1FKAH 5FLXW 1XNRQ 4MTDA 5D14A 4IUQA 3J81W 1UE7A 1VQFA 2XWJB 2PCFB 2XCLA 5ELOA 2GA4B 2EYOA 2EYLA 1LM0A 1KAWA 1VQOA 5ELCA 3I4NG 2JA8B 4ZYSA 4KHZA 5IODA 3A54A 3J7YW 4JI8H 1SMYC 3R3OA 5J2TF 1YIJA 4JI2L 2OTJA 3HOVB 1L0WA 3FPUB 1KC8C 5EPKA 1WTQA 3E6ZX 3RNUA 1XDNA 4IPGA 3V4ZA 4RB1A 4DL4A 1TWCH 4FDBA 2L5TA 4YIJA 2L0CA 3F1ZA 4F4YA 4G3IA 1Y1VB 3GIJA 2NN6G 3I73A 2F0MA 1TWHH 1T9HA 3CD6A 3BJUA 1Y8PB 4PZ6A 1WTPA 3GTMA 3ZYYX 3HG9A 2CQOA 1L1OB 3LGJA 4M1UB 1YBYA 1PH1A 1K1QA 2PYKA 3KBGA 1B33N 1SNOA 2O03A 1JIHA 4G57A 5HV6A 3ETJA 5C5JA 4JYAL 4IUPA 3NSWA 4L63B 2R92H 3M4OB 5IYCG 4C3HB 4HTHA 1PX2A 4ECXA 4DR4H 1KJQA 2YYZA 2QW7A 1U4RA 4A3MB 3H3VC 1S72A 5COYA 3SK8A 4B9WA 4HNTA 1EYGA 4DLKA 1I6UA 1O7IA 2A68C 1IBLQ 1CI3M 2IX0A 2CCZA 1JKJB 2YL2A 2AHOB 3Q8SB 4A2BA 3CXCA 1BCPF 2Y0SG 2KHIA 4CBVA 4X65H 2IX3A 2UU9L 1FJGQ 4HCSA 4C1NI 4TQRA 2W9AA 1BF4A 5IT9W 2NVYB 3N6RA 1KQSA 2R7ZG 4HN7A 4IZOA 1Y1WA 2QDLA 1S5BD 3L2PA 1FGBD 2SCUB 3PR5B 2MGSA 5KG5A 1NR2A 3PO2H 5NUCA 2A6EC 1W2BA 2DWCA 2RDFA 4O0AA 2CQYA 4YR2A 3V6HA 4FVMA 4JI6Q 5IWAQ 3PIO3 2IJ0A 2VW9A 5C4XH 2X69A 3CVZA 3K0YA 2K01A 4C2MB 1Y14B 3BDCA 3I4OA 4DV6Q 2WP8J 3KK7A 1S40A 5DQGA 3MWDA 4LF4Q 4UCSA 5KYLA 2V4RA 2NWGA 3Q1KA 4J8QA 3M9MB 2AMCB 2Z4IA 1PXUA 4DR5Q 2JA7A 2VXWA 1OO9B 2RDGA 1ET6A 1YI2A 3QR8A 1GUNA 4JV5Q 1EY8A 2HCIA 1A2UA 3X3MA 2E74C 5GAHC 2R7KA 2PMZE 4X3KA 5C6AA 4RFBA 2OEOA 5E3FA 4A3GB 1JE5A 1SNDA 4JI8L 2WYOA 4O1NA 3RAQA 2YCHA 3RBDA 1OXTA 2EVBA 1A2TA 4NXNH 2BDOA 3IL8A 3RIZA 1TY2A 1W93A 5G3LF 1GGOA 4OX9H 3OHXC 5K36H 4E6IA 4B08A 3SEBA 1HXYD 2MNAA 1HR0Q 4RNMA 4KMUC 3VR6A 4CDEC 5LYJF 1C3OA 4ECRA 1VBGA 2ZTCA 1RCVD 4N8FA 3S16B 4QWBA 2UXDH 1IL2A 3H3VI 3HFZB 4TV8F 4ECVA 1K83A 2ES2A 2NU7B 4B3TQ 1KDCA 5LL6X 3SVMA 5EAYA 1CA6A 3HOUH 5KFRA 4RG1A 4ME6A 1B6RA 5KFBA 5C1PA 1XNQH 1IW7D 1SFOA 3VMMA 4KV6A 1E3PA 2EYMA 4A3JG 4DR4L 1T5XD 1TWFH 1ONLA 3NTKA 2XRQD 5FK9C 2BQRA 3AU7A 1KLUD 4UP9A 3M4IA 1JWSD 3OPOA 2UXBH 4R4QA 4FF1A 1YNND 1AP0A 5EQ0A 1TT2A 1LTID 4A4IA 1B2TA 4ZKBB 4DL5A 4DV2Q 2CW0D 1NAPA 4X65L 2D0OA 4A3DH 5JVLA 4YP3A 1S03G 1NCVA 2MUYA 3TP5A 1GXDC 2R61A 4C3IG 4Q5VA 4A3KB 2B3GA 4P73A 3M7NA 1S0OA 3GTJH 4JI1H 4B9XA 2FMCA 5EZYF 1P16A 4NP5A 2R6GA 2F0IA 1HNZQ 1HNWH 2C35B 1ENFA 1D6EC 2JA9A 3SR1A 3S17B 4LF5H 4A3EH 4V190 4ZUJA 3H15A 3GTKB 2FMMA 3BYYB 4H7BA 1WSCA 3NWTA 3W1BA 4JV1A 3D31A 5KFPA 4HIMA 1CZGA 1DCZA 5FLMH 5L1JA 5D1PA 3DMUA 3OW2A 1XNRH 2Y0SE 3NTIA 2RCFA 4MV1A 1S97A 4Q8EA 1VF5C 2FJZA 2B2WC 3KAJA 1JR0D 4K8IA 1DONA 4C3JG 3UE1A 4A3LH 1GUSA 2ZT9C 1VAJA 4GKKH 5CC4A 2WB1E 4FXKC 3QO2A 2AWNA 3OUUA 3STBC 2QEJC 4APMA 3T1YQ 2R93H 3MR2A 5C8YF 3HOWB 1GHKA 2LXKA 3NBIA 4B3RQ 4PQXA 1GLVA 2FB9A 1MSHA 1R9TA 1FNVA 3MFYA 1M0WA 2Z6BA 4K2KA 1VQJA 1G91A 3ITPA 4NXNL 4IFDH 3KJPA 1ZHQA 3TRZA 2Q8IB 4MV3A 4DV0Q 1ULZA 4GLVB 3NTHA 1TS3A 3DXJC 3U4ZA 3S1NH 1LTTD 3D4RA 4ETSA 2R7ZB 1SYGA 3NQIA 1NNXA 4UCTA 4JG2A 2BQ3A 2UXDL 1TQOA 1YVCA 3HOYH 5HY6A 3VPDA 1UEBA 1UE6A 3ND8A 1PYSB 2WIIB 2UUCQ 4X64Q 4O2DA 3GIDA 2R7FA 4IRKA 2YZNA 4R7RA 1X3FA 2K52A 1XNQL 4YAKB 1ESRA 4A93B 4GOPC 1X54A 1IBLH 5JPNC 1SYBA 4HYKA 5EKLA 2RDIA 2XD4A 2YU9A 3V6JA 1KL9A 3V4SA 2MPMA 3J81j 4KD3A 2YRXA 1M1KC 1A62A 4JCVE 4Z9CB 3S2DB 1UC9A 3TS0A 3CC4A 4X62H 2UXBL 3H0GG 2DIKA 4EBEA 4IRCA 2KVMA 1AUXA 5KT7A 2NTSA 2VQEQ 1V1PB 1N33Q 4GC7A 4XYMB 3NXWA 4PNYA 4J9SA 4IFDI 5KFWA 4XQJA 2E5LQ 4WORA 1YJNA 1GVPA 1E7ZA 5KEEA 4H0LC 3PF4A 4IURA 1EEID 3JAMi 1FR3A 4UFZA 1ZHSA 4LF5L 5IWAH 2HGSA 2RSNA 3B6YA 2P0AA 1STAA 3VR3A 3DEOA 4HEDA 1SNPA 4RHSA 3PIOA 1YJWA 2FP4B 2W71A 4DV6H 3QZ8A 1WI5A 2DY8A 3NEMA 4U68A 3TP8A 5CAEB 4RU9A 5KG3A 1W6JA 1N34Q 5CV5A 3MR5A 4UDUC 3T5JA 1EL0A 5I9OA 2W7PA 3L4KA 5LMNQ 1DOMA 4J9RA 3CCVA 1NJIC 2J9GA 1A0IA 2IX1A 5JEAH 4GKKL 2A6HD 3BZDB 4GOPB 2OQKA 5M3FH 3NPPA 1U9RA 2C00A 2JA6H 1TWAB 2W6MA 1BCPD 4BBSG 4O4LF 5C44B 2PZUA 5T1GA 2KCTA 5KYIA 4KK7A 1VQ9A 4LWCA 1C7YA 3K5IA 4DR1Q 2M2LA 4MAMA 2ZTEA 2A69C 4DR3Q 5C1OA 4ZAIA 1S68A 1H9RA 1KJ8A 2I46A 1HR0H 4PWQA 1CZWA 1SMXA 3E3XA 3S2HB 1PDQA 2PVPA 2J7ZA 3VPBA 3KF8A 3MXNB 4RUAA 3RJ0A 3OMCA 2JSOA 3MVVA 4BY7B 4N9PA 4YHHQ 1I5FA 5JJIA 2M9VA 3U9SA 4J9OA 3F2DA 3EFXD 4X6AH 1BQQT 4JV2A 3SHLA 1IYUA 1PH2A 1TWHA 4JBMA 4G7ZC 4MN3A 3IFTA 1SE4A 4P71A 5CV6A 2F0VA 3WO0A 3OUZA 1R4PB 3M9OB 5CGKA 5C0XG 1IBLL 3PN1A 1XTDA 2VA2A 2GVAA 3O13A 4QQBX 4JI5Q 4DN4M 4DV2H 2K5VA 2R8JA 1IOWA 3RD4A 3PUYA 4X62L 4QF4A 2BR0A 2NZHA 4ZK9B 4OHJA 5CV8A 2I5MX 2V1CC 3Q8DA 5BMVF 3JAMc 1PRTD 4FYDA 1MZBA 4R1JA 1SNMA 3S1RH 1O7ZA 2HIXA 3GTMB 4DL7A 5KFUA 1HNZH 2P5ZX 2VPQA 1PTOF 1J8IA 2RDJA 4XTCS 4V0BA 2NVQB 3KOJA 4TSSA 4ZCKA 4RAUC 3EPGA 2R3ZA 1VQDA 4DL2A 1HRJA 4FNFA 3CQZA 5DLGA 2Q8TA 4OIJA 4DV5Q 3FKIH 5IWAL 5C0XJ 1WTVA 2B8GA 1HZBA 4Y7NB 4OO1I 4O3SA 5FJ8H 1EQRA 4DV6L 2QDBA 4MTEA 1DM0B 5GADC 1OXXK 4OONA 1Q90A 3QFFA 1W96A 4RCOA 1VCIA 1GUGA 4RH6A 1QJOA 2PMZA 3AB9A 2WFWA 1BNZA 3S1QB 3MWEA 3T1YH 2JXMB 1PA6A 3UDIA 4B3RH 3TQ1A 1Y1WB 4DR7Q 1F77A 5M5WB 1UUPA 2E2HB 4LFCQ 3UQ8A 4OXPA 2VQFH 3PV0A 5KFQA 2AKWB 1SROA 1N56A 2NVXA 5FO7B 5IGBA 2IA6A 3H4DA 1HZ9A 2F0GA 3CCSA 2XCAA 4ABNA 1I94L 2EXDA 4QIWE 4HJ9A 3C2PA 3AYHB 4FF3A 1I4RA 3BG3A 2XIGA 4IUVA 3S14B 2KSWA 3P7JA 1L2ZA 4RGNA 2RGVA 2YW2A 4YBZB 1MJCA 4RA8A 5L1KA 3T13A 1PZKD 4BY1G 4F4ZA 1LT4D 2E76C 2NBFA 4X64H 4ED2A 3PO3H 2F1MA 2VR1A 2RHSB 2JA7B 2UUBQ 5I4DA 2A74C 3K3PA 1SNQA 2W57A 3CCMA 2EQSA 4QB4A 3GTQH 1IKLA 3M3YH 4IAJA 1GYFA 4JOIC 1CM9A 2UUAQ 4F4WA 2R8GA 1HZAA 1T3NA 4HR7A 4EGJA 4C5BA 1A9XA 4A3FB 5HURA 2ZJQA 3VDYA 4JI7L 4RNOA 3G4SA 1SYEA 4WJ3M 2K5QA 5EWEA 3A56A 1RJQA 3TIGA 3RB3A 1FL0A 4KTAA 1SLJA 2VQEH 3OMGA 3HB9A 4EFEA 1N33H 3I90A 1J9OA 2E2JH 3A5ZB 3BJYA 3MHBA 4XYLB 3BZCA 2VY3A 4X3TA 5M5YH 1HQMC 2Z4HA 4IR9A 1H9MA 1LYLA 1EWHA 2YYAA 3IRBA 4FBTA 3J7A5 2UVUA 1K83B 2CKZB 4BBSB 1RJTA 4K6LA 2HD3A 3MFIA 3PUZA 1Q1EA 5KFCA 1LLRD 1EFID 4GNXA 4GKJQ 2HIVA 4HJAA 1K3RA 2JEGA 4GN4B 4EGVA 3FMAA 4X66Q 3N6XA 1TVXA 2MQHA 5H1SE 3Q8PB 1E2WA 2ZM6Q 1SFOB 2Y0SA 3K57A 1LACA 1JOKA 2IPKD 1N36Q 5KFJA 2ALYB 3GIIA 5DLQE 1B53A 2EPBA 2HVSA 3M7GA 3EA6A 3KHLA 1EQTA 1DOLA 5GAEC 1JJCB 2JK8A 5LMNH 1BO0A 2WB1A 2QYZA 1IBMQ 3UDFA 4DAVA 2K5WA 3H91A 2AUKA 1S10A 3R5HA 1ML0D 3CPFA 1HA5A 4DR6L 4C1NK 3ETHA 1S5DD 1GKHA 2WKCA 5KFHA 4DR1H 4B3RL 2B63H 3HOZB 4BBRH 4NDXA 2F0HA 4QGUA 3LP8A 5IY0A 2MO0A 3NHHA 3CRLC 4KJNA 1SEBD 2V4DA 4A3IB 2VQFL 1Q8IA 2D5DA 4O42A 1ZYRD 1S3OA 3U50C 1OXUA 4P2CB 2XTIA 3KLRA 1KHIA 3JAME 4ECUA 3D4WA 3D8GA 3TQTA 4OWWB 4J9MA 1MI2A 4POGA 4JI0Q 4LFBQ 4JVZA 1Z2OX 1C30A 2KEDA 2BE5D 1BR9A 1I4QA 5J1ZA 3RTXA 2Z9HA 4WD3A 5FD5A 4L8JA 4QW8A 3M4YA 2EY6A 1JOQA 5KFNA 4RGMA 5E7NA 1B3QA 1NBWA 3E0EA 1EUDB 1V8QA 1EUCB 5E1FA 5DGAA 4HIDA 5JQWA 4FO2A 1EZ1A 4O3RA 1BXRA 2L4NA 4DF7A 4J9QA 1QVFA 3SE7A 4QWAA 4K0KH 4JI5H 2PN1A 1BBWA 3E9HA 4LH6A 1R9TB 1XMOQ 5D1OA 2F52A 4Q0FA 4EGQA 2XWBB 3ERSX 2FXQA 2IP4A 3N8DA 1UNSA 1S4ZA 4OWTB 3VYTA 3SE0A 1BVSA 3NK9A 4O2BF 5M5XH 4DV1Q 1HNXL 2PW7A 2QEXA 2IHEA 3PO2G 2LKVA 2UVVA 5AJ3Q 1I7NA 1NE3A 5KNBA 3F2CA 5C4XG 4Q44A 1KDBA 1C8CA 3DUZA 2KA7A 4XZ3B 1ENCA 4C5CA 2UVWA 4NW2A 1HQRD 1L1OC 5IIFA 2R84A 4L5QA 3S15B 1JORA 1D1KA 1A8VA 1I4XA 2JA8H 2F4VQ 3RGXA 1ILPA 1XPOA 1WH2A 2ZDQA 1YNXA 3V05A 1CSQA 5KG4A 1JE4A 2MFIA 1GD7A 3TMEA 5C4HA 1SRUA 4ALPA 4E4TA 1ENAA 4R4TA 4DR2Q 4BY1B 3RZOB 3K5NA 1PYBA 2ZDHA 1Y1VH 1OXVA 2SNMA 4A3BB 4DXFA 2ZJTA 4B3SH 2ASBA 4GN3B 4LFCH 1S0MA 5EPLA 1Q86C 3JAML 5K36G 5CV4A 1GUWA 4RHRA 2O5IC 1IKMA 5HGTA 4ECTA 5CA0F 3WO1A 2Q2UA 2V58A 2JN4A 2W8KA 4CC6A 2EJGC 4BA2I 1KC7A 5T1IA 1JXLA 3LX0A 4K5XA 1K8OA 4EQ5A 5ELBA 3R2TA 1B9MA 4DK1A 1Q3LA 3C1EA 3J80c 2FK3A 1PTOD 4ID6A 3S1MB 3M4OH 2EDGA 4C3HH 1G6ZA 3N44B 3HOUG 1N32H 5IYDH 3G71A 2K4KA 2KUMA 5JPMC 1B1ZA 3ICEA 2ZJRA 2D0PA 2AGPA 4CDCC 5L9XA 1QNKA 4CKEA 3BQ2A 1FD7D 2EY5A 4L5SA 3JSNA 1IW7C 2MO1A 2EJMA 3OSPA 3V2TA 1YHAA 2YS7A 4R4IA 3JRWA 3N41B 1EWCA 3HOXG 4XDXA 4R9WA 2UUAH 4PZ8A 1L0XB 1RODA 3RUZA 2GN5A 4U673 2K33A 4A3DG 3R8BA 1FNWA 1X55A 4IJLA 4I55F 5LL6b 4LUVA 2VUMH 4K0KL 4JI5L 4DGZA 4J9KA 1VQAA 2SNSA 4CDDC 2RDHA 3GTGA 4MNOA 4O3QA 1B4OA 1J5EQ 1T94A 3KF8B 2C2RA 1LTBD 1F2LA 1T5EA 1JB3A 4A3EG 1WD1A 5KFZA 3JAMW 5DM73 3T1HH 4IPCA 4ME3A 4GKJH 2K03A 2WB1G 2O2LD 1XMQQ 2K32A 5FLMG 1TWHB 2JEAI 3Q23A 4J9NA 4JI4Q 1J6QA 4NXMQ 3HS0C 1GUOA 3OW7A 2RVLA 2JP1A 3MTSA 1V51A 4UCVA 1Q7YC 1C48A 2QKIC 4DUZL 5EKIA 4A3LG 1LO5D 3H3VH 1N36H 3H0GA 3URYA 1RJRA 1LT6D 4CGYB 3L0OA 4A3GH 5C3EH 2DNEA 2WKDA 1KABA 2R93G 2OT2A 1B9NA 4DFAA 1IYVA 5M3MB 3R2IA 1IBKQ 4DV4H 3K7AB 3A8JE 3RR5A 3G6JB 3KDFA 3DWAA 1FGUA 4XYQA 4ED7A 2MP1A 4YJ2F 1OWTA 1O80A 5BN3A 4UY8C 4B3SL 4F7XA 4IFDG 5JJZA 3GTPA 4LFCL 1FVIA 2VB2X 1YITA 1RYRA 1E4EA 2TMPA 1WR2A 4RAZA 2HVRA 3NGDA 2AGQA 5K2MA 1IL8A 4QIWA 1D8LA 4YY3Q 3WOFA 3CQZB 2HCCA 3HOYG 4EFBA 3KHGA 4KHPQ 4LFBH 1IZ6A 4CKCA 1BXTA 3DEPA 5CA1F 3NBHA 4IZ8A 1EY6A 1F9PA 1Z9FA 4KN4C 4QL5A 3RLFA 1ASZA 1N32L 2RKSA 2N78A 2XRSD 1VBHA 2Q2IA 2E8GA 5EDWA 3KLSA 2Z1CA 5KFLA 1RL2A 3HKZG 3U9OA 5LMUQ 1H95A 1ICFB 3W1GA 3H6MA 4BS9A 2IW3A 3LWBA 1WJJA 5CMDA 2B2VA 3LNNA 3UFXB 3MWYW 4IFDJ 5DG7A 1EWIA 4NB3A 2JEJA 2PMZB 1BJTA 2RCNA 1HTPA 3ULPA 4LF9H 1PFNA 2X6GA 2E2IH 2UUAL 3JC66 4JI3H 2OLSA 4A3KH 1XMOH 1NMGA 4XIGS 1Q46A 3GTQA 2NVXB 3A0JA 3K8AA 4QW9A 1CQFA 5LP6F 1O78A 3CCRA 4JBJA 1PHJA 4DL3A 2PI2E 1EY5A 5L37A 4HJ7A 1I6HB 3H09A 4KY6A 3T1HL 2N49A 2ZXPA 3KFUA 3I4NB 3L4JA 4GKJL 1XPUA 2QILA 4MV4A 3W2DA 3PSIA 3TIIA 3F8TA 3J80E 2F0DA 3K5LA 4EBCA 5CBAE 3GTOA 3RLNA 3RZDH 2F4VH 1WD0A 1I4GA 4GLXA 1KJ9A 5ELEA 1ET9A 1N36L 5JEAG 1AUVA 4HR7B 3HOWH 3HOUB 1EFWA 2F0KA 4MV8A 3ERQA 5M3FG 3OHAA 2JA6G 1B70B 3Q6SA 3FRPB 2EY1A 1RF2D 1K0RA 4LF6Q 4TVAB 4RAYA 2AQ2B 2HQLA 5IP7H 4DV4L 3FEWX 2KEEA 1CT1D 3DLLA 1BCPC 2VZAA 2UXCQ 1K0SA 1N9WA 2F0UA 1NR4A 2CFMA 5JAVA 5JOBA 4IOAA 3HOXB 5C5LA 4UCUA 1GSAA 3KJOA 4QUCA 3N52A 2F0TA 2LS01 4UAIA 2R7ZH 4LSAA 1K3BC 2KHJA 4FXGC 5M9OA 1V4YA 4GNXB 3RV4A 2HDMA 2NZOA 1GUTA 3I2ZA 3AMUA 3PMFA 2KBNA 2KHSA 4P74A 5JEAJ 4DUYQ 1Q82C 1MBYA 3WDNA 1AN8A 4IHJF 4IR1A 2Y0SB 5DAUA 2ALZA 1YNJD 5T14A 2I0QA 5ISRA 2GVBA 4EQNA 4OX9L 4A93H 2DLNA 4ZUIA 3FHWA 2Q2HA 5KG2A 4A3EB 3OTOQ 2OH2A 3PIP3 2CVRA 5DG8A 3G6YA 3S2DH 3MXPA 3RF2A 3T5HA 5JVG3 1WTXA 1VQMA 5LOVF 1R4QB 1LTRD 3TDQA 1X3EA 5DEHA 4LF9L 3GDEA 3TZUA 3PF5A 1KJIA 2NZ1D 3H94A 4JI3L 4QWDA 3T56B 1H9SA 4GC6A 1UEAB 5KFDA 5KT5A 1I6VC 1MHWC 1BCPB 3GIKA 4IJHA 2VOBA 2B2YA 1FJGH 3JZIA 1PRTC 5EBDA 1VQ8A 2JE6I 3J80L 3PVXA 4AYBG 1EOTA 3GTLH 2VQDA 2HQEA 3HKZE 4LF8Q 5H80A 3ZJYC 4BXXG 1XMQH 1WFQA 4LH7A 5C4JB 3FKIG 3SDZA 3FDSA 4DL6A 1HPCA 3RGZA 3GP7A 2W9BA 3QOLA 2ASJA 4JI4H 2C5CA 5FJ8G 4NLGA 1G51A 4UP8A 4JI1L 2ENBA 3SK5A 1Y8NB 3CP0A 4FU0A 2F0JA 5IE8A 1PYWD 2BDNA 1HNWL 1CK1A 2Z6KA 4MTKA 4JI6H 3AFQA 3HOYB 1TWAH 2IT1A 5C44H 2FLNA 5KGUA 1S9FA 1X32A 2NTTA 2JJQA 4IQZA 4LF4H 5D1OB 3VYSA 2N55A 1XNRL 5DLFA 1VQBA 4DR5H 1SE3A 5DNFA 4BA1I 1AN7A 1YEZA 1S5FD 5BR8Q 4LF7Q 4IPHA 4OIKA 3S2HH 2PW5A 4JV5H 2K5NA 3EROA 1QOHA 4RZQA 1CQJB 1EQVA 2JEBI 1LABA 2B2UA 2K5HA 4BY7H 4KKUA 2V4QA 1OXSC 4KI0A 4LMQD 1SNCA 1ZQ7A 4YY3H 1RDPD 3KTMA 3QOJA 4A3JB 1PFBA 1M4VA 1Y69U 5KT2A 4WRDA 1PRTB 4Q8FA 1DZ1A 2Q8RE 3I7FA 4AQYQ 2O5JC 4XYOA 4QUFA 1U4LA 3KUPA 3PO3G 2FLLA 2R85A 1DV2A 3J81c 4ODGA 1D7QA 4ECZA 3TS2A 3I12A 2UVRA 1TWCA 5BN5A 1UAPA 3BZKA 1SN8A 2KECA 4ED0A 3HXLA 4B3TH 4C3IB 3MC0B 1XPRA 1MSGA 2RSOA 1A3UA 4EVOA 4HNUA 4EYIB 2ID0A 2SOBA 3PW2A 2OWOA 4OO1H 4ZOLF 3STBD 2BQUA 4JI2Q 4PG3A 5F9NA 3A7LA 2RQXA 1AW7A 4ZRZA 2CQAA 5FD6A 1A63A 4IWYA 1RD9D 1IHZA 1KEEA 4YAJB 3FPPA 1GJXA 2R92A 3RB4A 2SEBD 3G8CA 3PUWA 2CHBD 1VQEA 2VUMA 1FJGL 2GLTA 2EZVA 4EBDA 4C3JB 4MTNA 3T5LA 2GPWA 4N8X1 4QWEA 2IMWP 3Q24A 4IWXA 4PZ7A 2NVTB 5KFTA 2WAQG 2YRWA 4JYAQ 2A19A 2J4XA 3NP8A 1NY4A 2OXPA 5CB4F 4HQ6A 2QGQA 4ZLTF 4ZQIA 2A1AA 2FHTA 5G3LD 4JI4L 2K7VA 2NU8B 1VQHA 4N9TA 2F3VA 5C3XA 5IGEA 3MFGA 3S1QH 1K73C 1OTCA 3W3AA 1EYDA 4JI6L 3I3CA 1W6KA 1Y1WH 1TS4A 1EIHA 2I5HA 2K5DA 3S24A 5M5WH 3H40A 2W9CA 4JC0A 2E2HH 1PZJD 1EYZA 4LF6H 3FMCA 5IT9c 2KENA 4JK1C 2B63G 4LF4L 3WNZA 4BBRG 5C5MA 3GTGB 4AYBE 1EYAA 4KKTA 2HT1A 4IALA 5KFXA 1ZEQX 4DR5L 4F88A 2UXCH 3D4DA 3T53B 5D3IB 3NWSA 4H44C 4JV5L 4FBUA 1FYCA 3RFCA 3PW5A 1H9JA 1WTOA 2F0QA 2KQ3A 1M90C 3I4MH 3S14H 2IHFA 3KXYT 2QA4A 3D3RA 3KF6A 2RGRA 3TP6A 3DHQA 1QZHA 3E5SA 2YZMA 1BNCA 1KAAA 1PH4A 4DUYH 3TINA 4YB8B 2JA7H 4HMJA 1KTKA 5ELFA 1VQIA 3NE5B 4DV0H 1HR0L 4DKAC 3H0GB 3OTOH 4I50F 4QJFA 3BYTB 4YR3A 4A3FH 5IYZF 1P8LA 3Q2OA 3I8ZA 4UPAA 4B3TL 2PQAA 1E1TA 5DQHA 2UUCH 1SYDA 1TWGH 1I3QH 2W70A 4H02A 4BWGB 4JI8Q 2I87A 4POFA 2PO4A 4AH6A 3RB6A 3K5MA 3UDXA 1LTSD 3BVGA 1V9PA 4K5WA 3GTPB 2NUAB 4ED1A 4ECSA 4HSVA 1X3PA 1GM5A 4LFAQ 4ED3A 4R8UA 2W6ZA 2K75A 2A69D 4BBSH 1E4EB 2WE6A 1BBXC 1I50H 4DV3Q 4QIWB 2E2IA 2PI2A 3HEJA 4LF8H 4DV2L 4P75A 1TWFA 1TY0A 1TS2A 2JEIA 3C0FB 4NPSA 1WTRA 4RMFA 1UE1A 3NBHB 1SFOH 4L5TA 1UNNC 3KHHA 1STGA 2JA8G 2C2DA 1AE3A 2E5LH 2I8CA 1K28A 1HNZL 2HDLA 1D1IA 3KLWA 3J81E 4DNIA 4DR4Q 3M4PA 1A3TA 1CQVA 4S3SA 3GTJA 4XQQA 2D62A 5C4ZA 3PUVA 1Y1VG 4LSXA 3HOZH 4J0MA 1NSNS 3KALA 3F8NA 2YS6A 2F0LA 4RNNA 1XXGA 4CDFC 1N34H 4WFN3 4X65Q 4A3IH 3GTQB 2A8VA 2XN9C 5BR8H 2LXJA 1HZCA 3M3YB 4LF7H 3BABA 1ZETA 1RYSA 4FS2A 1PH5A 3H4BA 3U4VA 1JDBB 2WAQE 3EPIA 3EIVA 4ED8A 5KKNB 4CHTB 1SR3A 1S5CD 4LK1C 2HHHQ 1QZGA 1RK5A 2NB0A 3TEHB 3T1YL 3RUPA 3R5FA 3PR4A 1SE8A 2HVQA 4C3HG 1STNA 3ULLA 2YTYA 5IYDG 1QE6A 2L1BA 2WACA 3A74A 1EQQA 3G6VA 4DR3H 2ASLA 2NU9B 5M5YB 1PTOC 2B2TA 4AQYH 3ER0A 4DPGA 5IGDA 1EIFA 2F4IA 3GTOB 2R93A 4YCUA 3TREA 5FO9B 3CC2A 1JDEA 3V96A 4J6HA 4DV7Q 3GV5B 2PQEA 3RN2A 3PW0A 4DV0L 5KFSA 3RMHA 2CW8A 3OWEB 1D2BA 1E2VA 3CAMA 4YHHH 3AFPA 2LMCB 3N43B 2R92G 3TBIB 5IGFA 1R9TH 1WCMH 2OQ0A 1BBUA 4IUUA 5CV7A 1AEXA 1WTHA 3J80i 5IOCA 2VUMG 4JUZA 4U7CA 4J9LA 1M0TA 2UUCL 3Q8RB 2B2WA 3CW2C 2B2YC 4X64L 2PNHA 5C0XI 1SSOA 5IYBH 4IUTA 3JRXA 3DM3A 4DAYA 4M9UA 3KHRA 5KIXA 1DOKA 1MGSA 4NXNQ 4HCEA 2JA5H 4C56C 4RB0A 1PV4A 1Q81C 4QMGA 2EYHA 3T5KA 1HH2P 1SDFA 4WJWA 2R7NA 3HKZA 2BH2A 2G9DA 1PH8A 4HSPA 4R4CA 3S15H 2FMAA 3GIPA 2LSSA 2J0TD 3MR6A 1WYDA 2VQEL 2XGPA 1M7JA 2Z6KC 1N33L 1VS0A 1B3AA 3J81L 4JYAH 3E0JA 5I2YA 3BDOA 2VPSA 5I9PA 1SCUB 1PTOB 1HCZA 3T16A 2W8LA 4GZYC 1UWVA 3GTLA 4DU9A 3K5OA 2E5LL 2VB3X 4A3GG 3GO5A 5C3EG 5JUMA 2AQ3B 1XNQQ 3M9NB 4DV5H 4A3BH 4FF4A 1EU3A 1VQNA 2M05A 5A2QE 3CF5A 2B2UC 4FP5D 2UXBQ 1GSHA 1H9SB 2O4XA 3PUXA 4L5RC 3HOVH 1N34L 1NUCA 2YU9B 3KAKA 1Z2NX 5BR8L 2ICIA 5LMNL 2E2DC 3MAQA 4RKBA 1KRSA 4LUOA 3S1MH 2J6SA 4DR7H 4ZHQF 4KKSA 1QG7A 1DGSA 4MIUA 4O4HF 1JCKB 4K5VA 5M5XB 2IL8A 2W9BB 4DR1L 4YR0A 1ILQA 4RGOS 4DR3L 3GIMA 1VQ5A 2CWAA 1SYFA 4YWKA 4DXGA 2JA6A 2W6PA 1VQ7A 1EY7A 4O3OA 2CWPA 3CHBD 1F2ZA 1STBA 1E4GT 2BA1A 1CUKA 1LV9A 3OYYA 4YHHL 4A3MH 4O3PA 5I2XA 2F0EA 5IP9H 3E5NA 4JV0A 5IT9L 4A3KG 4GKKQ 1KXLA 2K28A 3TSSA 4TQSA 4LW1A 1VQCA 5EWGA 2UUBH 1O75A 1A3VA 1Z6HA 4LUZA 3A8KE
chains in the Genus database with same CATH topology
3NENA 4GLXA 1VQLA 3T1HQ 2UXCL 4YHHQ 1N36L 5JEAG 1E24A 1I5FA 1N8RC 3HOWH 2NVYH 5JJIA 1EFWA 2OCEA 3HKSA 3F2DA 5M3FG 4X6AH 4KLKA 3M85A 2KCMA 1PH2A 2JA6G 1B70B 4YWMA 4JBMA 1G291 1K0RA 4TVAB 1XJVA 1GO3E 4LF6Q 2HQLA 5IP7H 1MIUA 2YTXA 4DV4L 3DLLA 4A3MG 4P71A 1WOCA 2VZAA 5LMNW 5IP9G 2UXCQ 1N9WA 2CFMA 4IOAA 1X3GA 4A3CH 4DUYL 3KJOA 3CCJA 2N8NA 5C0XG 1IBLL 1XTDA 2R7ZH 2GVAA 3NELA 2YV5A 3RLOA 4QQBX 4B3ML 4IO9A 4JI5Q 1E22A 2KHJA 4C2MH 4DV4Q 2K5VA 3OTOL 4GNXB 1YHBA 3HOWG 2NZOA 3I2ZA 3PUYA 5M3MH 4X62L 2KBNA 3K7AH 4DK6C 2NZHA 4P74A 5JEAJ 4DUYQ 1Q82C 2I5MX 2V1CC 3Q8DA 1VQKA 3JAMc 3WWVA 3UDGA 5IP7G 4DV5L 2I0QA 2DGYA 2GVBA 4OX9L 4A93H 4R1JA 3S1RH 2HIXA 3FHWA 2Q2HA 1VQPA 3OTOQ 4XTCS 4X62Q 4A3CG 4QY7A 3KOJA 1Q8KA 1JT8A 3S2DH 1YHQA 1VQDA 1QVGA 3K80C 1VQMA 4DV5Q 3FKIH 5IWAL 1TXYA 1NTGA 3CQZH 5C0XJ 4OX9Q 3EBEA 1HZBA 1X3EA 1CKMA 5M3MG 4OO1I 4LF9L 5FJ8H 3AEVA 3GDEA 1EQRA 4DV6L 3PF5A 1K8GA 4DR7L 4JI3L 5GADC 4LF8L 1OXXK 2UXDQ 4OONA 2XGTA 4UP7A 2Z0SA 3TQYA 4JBKA 3S16H 4OWXB 4A93G 1IXRA 1VCIA 4IJHA 2YU9H 2WFWA 4HIKA 1CKNB 4LF9Q 3G6EA 1PA6A 1VQ8A 3UDIA 2JE6I 4YWLA 3W5OA 4AYBG 4JBWA 4BY1H 3GTLH 4DR7Q 3HKZE 4JI3Q 4LF8Q 3RZOH 3ZJYC 3J7ZC 4BXXG 1JJ2A 1WFQA 4LFCQ 3FKIG 4OXPA 3PV0A 2AKWB 1SROA 1W3SA 5FJ8G 1G51A 1PFSA 1HZ9A 1QUQB 4UP8A 4JI1L 3CCSA 4HJ5A 3CP0A 1PH6A 1I94L 2NVXH 5IE8A 2EXDA 4QIWE 4GOPA 1HNWL 4YCWA 2Z6KA 4HJ9A 2UUBL 3PCOB 4LF7L 1JJGA 3AYHB 4DAMA 3AFQA 1VQGA 4HIOA 1TWAH 2IT1A 1X6OA 5C44H 3CC7A 3CCQA 4LFAL 1I6HH 3MEFA 1MJCA 2JJQA 1NMFA 1LTLA 4PMWA 4BY1G 4JI1Q 3I4NH 1I94Q 2YTVA 3KF6B 1PH3A 4EX5A 4DV3L 1XNRL 3PO3H 1VQBA 1HNWQ 2RHSB 4BA1I 2UUBQ 2VNUD 2VS1A 1YEZA 1C0AA 3BU2A 5BR8Q 4AIMA 4LF7Q 4IPHA 4LF5Q 2BA0A 1LUZA 3CCMA 2EQSA 1EIYB 4WJ4A 3S2HH 3GTQH 2K5NA 4YCVA 1KRTA 3M3YH 3S17H 4GNXC 4JOIC 4AQYL 1VQ6A 2JEBI 4MZ9A 3CPWA 2UUAQ 1HZAA 2K5HA 5GROA 3GTKH 4BY7H 2ZJQA 1KD1C 1OXSC 3VDYA 4KI0A 4JI7L 3G4SA 1XNRQ 4WJ3M 2B29A 1UE7A 1VQFA 4Y52H 5C44G 3KYHC 5ELOA 1FL0A 1SLJA 1LM0A 2PQAB 4LNQA 1KAWA 3I7FA 4AQYQ 1VQOA 3I4NG 2E2JH 3A5ZB 3PO3G 4KHZA 4X66L 1AH9A 3BZCA 2VY3A 5M5YH 3J81c 4JI7Q 1YIJA 4JI2L 2OTJA 1L0WA 2ZM6L 1LYLA 3HOXH 1KC8C 3TS2A 3IRBA 1D7QA 3J7A5 3RNUA 2CKZB 3BZKA 1SN8A 4IPGA 3PUZA 1Q1EA 1TWCH 5IYCH 4FDBA 4GKJQ 4GNXA 4JOIA 2HIVA 1XPRA 4HJAA 1PH9A 3F1ZA 1K3RA 4BY7G 4GN4B 4X66Q 2NN6G 2ID0A 1IBML 2MQHA 5H1SE 3STBD 2OWOA 1CKOA 4J15A 4JI2Q 1TWHH 1T9HA 4PG3A 2ZM6Q 3CD6A 3BJUA 4PZ6A 2HHHL 1BKBA 2CQOA 1N36Q 2ALYB 1L1OB 3LGJA 5DLQE 1YBYA 1PH1A 1A63A 5GAEC 1E1OA 1JJCB 2JK8A 3SGIA 1K9MC 1IBMQ 3UDFA 4JYAL 2R92H 1ASYA 3PUWA 5IYCG 2BH8A 1G6PA 2NN6I 1VQEA 1FJGL 3CPFA 2YYZA 4DR6L 4MTNA 4DV7L 1GKHA 1S72A 4B3RL 2B63H 4BBRH 1EYGA 4OO1G 4QGUA 4JI0L 5IY0A 1O7IA 2MO0A 4PZ7A 2IX0A 1IBLQ 2CCZA 4LFBL 2WAQG 2AHOB 3UE0A 4JYAQ 2A19A 2VQFL 4B3MQ 1NY4A 3CXCA 2QGQA 3M9BA 2Y0SG 2A1AA 2KHIA 1S3OA 1UE5A 1JMCA 3U50C 1OXUA 4JI4L 2UU9L 1VQHA 1FJGQ 2XTIA 4DR6Q 1KHIA 1CKNA 1L2FA 1YZ6A 4OWWB 2K50A 3S1QH 3J81i 1KQSA 1EOVA 1K73C 4POGA 4JI0Q 1OTCA 2R7ZG 4LFBQ 3I56A 1B8AA 4A75A 1MKHA 2VQFQ 1Y1WH 4JI6L 2I5HA 5M5WH 4GN5A 3S24A 3L2PA 4JC0A 2E2HH 3CCEA 5C4JH 2RHQB 5IT9c 2KENA 2B63G 1QUQA 3FP9A 4BBRG 4LF4L 3PO2H 1XMOL 1W2BA 1X56A 4AYBE 2HT1A 4O0AA 5E7NA 4DR5L 1NBWA 2AWOA 3E0EA 4JI6Q 5IWAQ 2VW9A 3GD7A 5C4XH 3PGZA 4HIDA 4JV5L 1PVOA 4DV1L 1U5KA 1Y14B 3I4OA 4DV6Q 1S40A 2WP8J 1QVFA 3S14H 3K81C 1M90C 1BBWA 2IHFA 3E9HA 4LF4Q 3I4MH 1XMOQ 5AJ3L 2QA4A 2F52A 3KF6A 2AMCB 4DR5Q 1QZHA 1Y1WG 3ERSX 2FXQA 1PH4A 4OWTB 1YI2A 1BVSA 3EN2A 2JA7H 4JV5Q 5M5XH 4DV1Q 1HNXL 1VQIA 2QEXA 5GAHC 2IHEA 2ZTDA 2PMZE 3PO2G 1HR0L 4DKAC 5AJ3Q 1JE5A 4JI8L 4QJFA 1NE3A 5GQOA 2F4VL 3AQQA 1X9NA 1OXTA 3F2CA 4A3FH 4DAYB 4DK3C 5C4XG 1P8LA 4UPAA 1RIPA 4A3JH 1JB7A 2PQAA 1E1TA 1HNXQ 1L1OC 4APVA 1Q1BA 4R4OA 4B3TL 1TWGH 3D0FA 4L5QA 2MNAA 1HR0Q 1I3QH 4DR2L 1A8VA 4H02A 4JI8Q 2JA8H 4POFA 2F4VQ 2ZTCA 4AH6A 5GAGC 1XPOA 1Q12A 1YNXA 3UDXA 2JA7G 1V9PA 1CSQA 1IL2A 3H3VI 3HFZB 3CCUA 1GM5A 4LFAQ 2ES2A 2K75A 4B3TQ 4BBSH 2MFIA 1GD7A 2IY5B 1SRUA 4ALPA 3A5UA 5EAYA 1I50H 4DV3Q 3ULJA 4R4TA 4DR2Q 4C3IH 3HOUH 4RG1A 1PYBA 2PI2A 4A3FG 4TQUS 1Y1VH 1OXVA 4DV2L 2JQOA 4P75A 2ASBA 4GN3B 1E3PA 4A3JG 4NPSA 1SFOH 4RMFA 1UE1A 1TWFH 3NBHB 4L5TA 5FLXc 1Q86C 4DR4L 5K36G 1L1OA 2RF4A 4UP9A 5JJKA 2Q2UA 2JA8G 1C9OA 2F3IA 1AE3A 4R4QA 4BA2I 1U0LA 4A4IA 4IOCA 4EQ5A 1HNZL 4DV2Q 4X65L 4A3DH 2D0OA 1VQ4A 3KLWA 3J80c 4DNIA 4DR4Q 3G48A 3M4PA 3M4OH 4C3HH 3GTOH 3HOUG 3I4MG 5IYDH 2B3GA 2D62A 4P73A 4C3JH 3G71A 3M7NA 2K4KA 3PUVA 1Y1VG 3GTJH 3ICEA 3HOZH 2ZJRA 1P16A 2D0PA 2NVTH 2R6GA 1HNZQ 4X65Q 2C35B 4A3IH 2A8VA 2LXJA 1HZCA 2JA9A 4L5SA 3GTMH 2MO1A 4A3EH 3H15A 1YHAA 1PH5A 4R4IA 3W1BA 2NVQH 3U4VA 3HOXG 2H5XA 3D31A 4HIMA 4PZ8A 2WAQE 5FLMH 3EIVA 2GN5A 1SR3A 3U58A 3OW2A 1J5EL 1QZGA 2Y0SE 1X55A 4IJLA 2HHHQ 4A3DG 3TEHB 3T1YL 4LUVA 3RN5A 2VUMH 1SE8A 4K0KL 1B7YB 4JI5L 4Y7NH 3ULLA 1VQAA 2YTYA 5IYDG 3A74A 1EQQA 3UE1A 1IYJB 1XMQL 4A3LH 4MNOA 3HOZG 3ER0A 2L15A 2R7DA 4DPGA 2WB1E 1EIFA 3GTGH 2AWNA 3STBC 4YCUA 3TREA 4A3IG 1J5EQ 3CC2A 3KF8B 1CSPA 4NXML 1EUJA 2Q2TA 3T1YQ 2R93H 4DV7Q 4A3EG 2K14A 3RN2A 4K0KQ 4DV0L 2LXKA 4B3RQ 1K8AC 3CAMA 4IPCA 3AFPA 4ME3A 2WB1G 1XMQQ 2R92G 5FLMG 1MJEA 1R9TH 1WCMH 3M4QA 2OQ0A 1BBUA 1VQJA 2JEAI 3I55A 4NXNL 4JI4Q 1J6QA 4NXMQ 3KJPA 3J80i 5J3BA 2UU9Q 2VUMG 3TRZA 1IBKL 2UUCL 3CW2C 4DV0Q 1Q7YC 4X64L 4DUZL 2PNHA 4A3LG 3H3VH 4GLVB 3U4ZA 5C0XI 3S1NH 5HGQA 5IYBH 3H0GH 3L0OA 4JG2A 3DM3A 5C3EH 4A3GH 2UXDL 2VL6A 1YVCA 4NXNQ 3HOYH 5HY6A 2JA5H 4BXXH 2R93G 1UEBA 1PV4A 1UE6A 4GS3A 1Q81C 1PYSB 1IBKQ 2UUCQ 1HH2P 2N3SA 4X64Q 3RR5A 4DUZQ 3KDFA 4O2DA 3CMAA 1FGUA 2R7FA 1YJ9A 2I5LX 4YY3L 1AE2A 1WCMG 1PH7A 1PH8A 2BH2A 1X3FA 4R4CA 2K52A 1XNQL 3S15H 2ATWA 2LSSA 4GLAC 4UY8C 1WYDA 4B3SL 4IFDG 4GOPC 1X54A 2VQEL 3CCLA 2Z6KC 4KHPL 4LFCL 1VS0A 2ZJPA 1N33L 1FVIA 3GTPH 1YITA 1KL9A 3CMEA 3L7ZC 3J81j 3K7UC 1M1KC 1A62A 4JCVE 1UWVA 3TS0A 3CC4A 1D8LA 4YY3Q 5IYBG 3H0GG 2E5LL 2UXBL 5LMUL 4A3GG 3GO5A 5C3EG 1XNQQ 3PIPA 2DUDA 4B3SQ 2JA5G 3HOYG 4KHPQ 2VQEQ 5ELNA 1IZ6A 1N33Q 4A3BH 4A76A 3KDFB 1Z9FA 4QL5A 3RLFA 4IFDI 2OTLA 1ASZA 1VQNA 4HJ8A 1N32L 2N78A 2Q2IA 2E8GA 3CF5A 2UXBQ 1RL2A 3HKZG 2E5LQ 5LMUQ 1H95A 3PUXA 4L5RC 3W1GA 1YJNA 1GVPA 1E7ZA 3HOVH 1N34L 3PF4A 3JAMi 1X65A 1Z47A 1WJJA 1K83H 5BR8L 4LF5L 4IFDJ 1EWIA 4NB3A 3B6YA 5LMNL 2RCNA 1N32Q 3ULPA 3PIOA 3F2BA 1YJWA 1KRSA 4LUOA 4P72A 2E2IH 2UUAL 3JC66 3S1MH 1V43A 1WI5A 3NEMA 4IPDA 4A3KH 1NMGA 1HJPA 1DGSA 4XIGS 1N34Q 1Q46A 4A3BG 3A0JA 3K8AA 4DR1L 5JJLA 5LMNQ 3CCVA 1NJIC 4DR3L 1A0IA 1VQ5A 2IX1A 4GKKL 2CWAA 3K0XA 4YWKA 3CCRA 2OQKA 4JBJA 5M3FH 4GOPB 2PI2E 1QVCA 1PHJA 1VQ7A 3HOVG 2CWPA 2JA6H 4BBSG 2KCTA 1VQ9A 4HJ7A 4LWCA 1C7YA 4DR1Q 3T1HL 2N49A 1HR0W 3KFUA 2BA1A 1CUKA 3OYYA 4YHHL 2ZTEA 4A3MH 4GKJL 4DR3Q 5IP9H 1XPUA 3PSIA 4A3KG 4GKKQ 3F8TA 1KXLA 1SMXA 2EIFA 4LW1A 1VQCA 3E9IA 3RLNA 3RZDH 1V1QA 4LF6L 4LUZA 1KIXA 3MXNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEN A;  4GLX A;  1VQL A;  3T1H Q;  2UXC L;  4YHH Q;  1N36 L;  5JEA G;  1E24 A;  1I5F A;  1N8R C;  3HOW H;  2NVY H;  5JJI A;  1EFW A;  2OCE A;  3HKS A;  3F2D A;  5M3F G;  4X6A H;  4KLK A;  3M85 A;  2KCM A;  1PH2 A;  2JA6 G;  1B70 B;  4YWM A;  4JBM A;  1G29 1;  1K0R A;  4TVA B;  1XJV A;  1GO3 E;  4LF6 Q;  2HQL A;  5IP7 H;  1MIU A;  2YTX A;  4DV4 L;  3DLL A;  4A3M G;  4P71 A;  1WOC A;  2VZA A;  5LMN W;  5IP9 G;  2UXC Q;  1N9W A;  2CFM A;  4IOA A;  1X3G A;  4A3C H;  4DUY L;  3KJO A;  3CCJ A;  2N8N A;  5C0X G;  1IBL L;  1XTD A;  2R7Z H;  2GVA A;  3NEL A;  2YV5 A;  3RLO A;  4QQB X;  4B3M L;  4IO9 A;  4JI5 Q;  1E22 A;  2KHJ A;  4C2M H;  4DV4 Q;  2K5V A;  3OTO L;  4GNX B;  1YHB A;  3HOW G;  2NZO A;  3I2Z A;  3PUY A;  5M3M H;  4X62 L;  2KBN A;  3K7A H;  4DK6 C;  2NZH A;  4P74 A;  5JEA J;  4DUY Q;  1Q82 C;  2I5M X;  2V1C C;  3Q8D A;  1VQK A;  3JAM c;  3WWV A;  3UDG A;  5IP7 G;  4DV5 L;  2I0Q A;  2DGY A;  2GVB A;  4OX9 L;  4A93 H;  4R1J A;  3S1R H;  2HIX A;  3FHW A;  2Q2H A;  1VQP A;  3OTO Q;  4XTC S;  4X62 Q;  4A3C G;  4QY7 A;  3KOJ A;  1Q8K A;  1JT8 A;  3S2D H;  1YHQ A;  1VQD A;  1QVG A;  3K80 C;  1VQM A;  4DV5 Q;  3FKI H;  5IWA L;  1TXY A;  1NTG A;  3CQZ H;  5C0X J;  4OX9 Q;  3EBE A;  1HZB A;  1X3E A;  1CKM A;  5M3M G;  4OO1 I;  4LF9 L;  5FJ8 H;  3AEV A;  3GDE A;  1EQR A;  4DV6 L;  3PF5 A;  1K8G A;  4DR7 L;  4JI3 L;  5GAD C;  4LF8 L;  1OXX K;  2UXD Q;  4OON A;  2XGT A;  4UP7 A;  2Z0S A;  3TQY A;  4JBK A;  3S16 H;  4OWX B;  4A93 G;  1IXR A;  1VCI A;  4IJH A;  2YU9 H;  2WFW A;  4HIK A;  1CKN B;  4LF9 Q;  3G6E A;  1PA6 A;  1VQ8 A;  3UDI A;  2JE6 I;  4YWL A;  3W5O A;  4AYB G;  4JBW A;  4BY1 H;  3GTL H;  4DR7 Q;  3HKZ E;  4JI3 Q;  4LF8 Q;  3RZO H;  3ZJY C;  3J7Z C;  4BXX G;  1JJ2 A;  1WFQ A;  4LFC Q;  3FKI G;  4OXP A;  3PV0 A;  2AKW B;  1SRO A;  1W3S A;  5FJ8 G;  1G51 A;  1PFS A;  1HZ9 A;  1QUQ B;  4UP8 A;  4JI1 L;  3CCS A;  4HJ5 A;  3CP0 A;  1PH6 A;  1I94 L;  2NVX H;  5IE8 A;  2EXD A;  4QIW E;  4GOP A;  1HNW L;  4YCW A;  2Z6K A;  4HJ9 A;  2UUB L;  3PCO B;  4LF7 L;  1JJG A;  3AYH B;  4DAM A;  3AFQ A;  1VQG A;  4HIO A;  1TWA H;  2IT1 A;  1X6O A;  5C44 H;  3CC7 A;  3CCQ A;  4LFA L;  1I6H H;  3MEF A;  1MJC A;  2JJQ A;  1NMF A;  1LTL A;  4PMW A;  4BY1 G;  4JI1 Q;  3I4N H;  1I94 Q;  2YTV A;  3KF6 B;  1PH3 A;  4EX5 A;  4DV3 L;  1XNR L;  3PO3 H;  1VQB A;  1HNW Q;  2RHS B;  4BA1 I;  2UUB Q;  2VNU D;  2VS1 A;  1YEZ A;  1C0A A;  3BU2 A;  5BR8 Q;  4AIM A;  4LF7 Q;  4IPH A;  4LF5 Q;  2BA0 A;  1LUZ A;  3CCM A;  2EQS A;  1EIY B;  4WJ4 A;  3S2H H;  3GTQ H;  2K5N A;  4YCV A;  1KRT A;  3M3Y H;  3S17 H;  4GNX C;  4JOI C;  4AQY L;  1VQ6 A;  2JEB I;  4MZ9 A;  3CPW A;  2UUA Q;  1HZA A;  2K5H A;  5GRO A;  3GTK H;  4BY7 H;  2ZJQ A;  1KD1 C;  1OXS C;  3VDY A;  4KI0 A;  4JI7 L;  3G4S A;  1XNR Q;  4WJ3 M;  2B29 A;  1UE7 A;  1VQF A;  4Y52 H;  5C44 G;  3KYH C;  5ELO A;  1FL0 A;  1SLJ A;  1LM0 A;  2PQA B;  4LNQ A;  1KAW A;  3I7F A;  4AQY Q;  1VQO A;  3I4N G;  2E2J H;  3A5Z B;  3PO3 G;  4KHZ A;  4X66 L;  1AH9 A;  3BZC A;  2VY3 A;  5M5Y H;  3J81 c;  4JI7 Q;  1YIJ A;  4JI2 L;  2OTJ A;  1L0W A;  2ZM6 L;  1LYL A;  3HOX H;  1KC8 C;  3TS2 A;  3IRB A;  1D7Q A;  3J7A 5;  3RNU A;  2CKZ B;  3BZK A;  1SN8 A;  4IPG A;  3PUZ A;  1Q1E A;  1TWC H;  5IYC H;  4FDB A;  4GKJ Q;  4GNX A;  4JOI A;  2HIV A;  1XPR A;  4HJA A;  1PH9 A;  3F1Z A;  1K3R A;  4BY7 G;  4GN4 B;  4X66 Q;  2NN6 G;  2ID0 A;  1IBM L;  2MQH A;  5H1S E;  3STB D;  2OWO A;  1CKO A;  4J15 A;  4JI2 Q;  1TWH H;  1T9H A;  4PG3 A;  2ZM6 Q;  3CD6 A;  3BJU A;  4PZ6 A;  2HHH L;  1BKB A;  2CQO A;  1N36 Q;  2ALY B;  1L1O B;  3LGJ A;  5DLQ E;  1YBY A;  1PH1 A;  1A63 A;  5GAE C;  1E1O A;  1JJC B;  2JK8 A;  3SGI A;  1K9M C;  1IBM Q;  3UDF A;  4JYA L;  2R92 H;  1ASY A;  3PUW A;  5IYC G;  2BH8 A;  1G6P A;  2NN6 I;  1VQE A;  1FJG L;  3CPF A;  2YYZ A;  4DR6 L;  4MTN A;  4DV7 L;  1GKH A;  1S72 A;  4B3R L;  2B63 H;  4BBR H;  1EYG A;  4OO1 G;  4QGU A;  4JI0 L;  5IY0 A;  1O7I A;  2MO0 A;  4PZ7 A;  2IX0 A;  1IBL Q;  2CCZ A;  4LFB L;  2WAQ G;  2AHO B;  3UE0 A;  4JYA Q;  2A19 A;  2VQF L;  4B3M Q;  1NY4 A;  3CXC A;  2QGQ A;  3M9B A;  2Y0S G;  2A1A A;  2KHI A;  1S3O A;  1UE5 A;  1JMC A;  3U50 C;  1OXU A;  4JI4 L;  2UU9 L;  1VQH A;  1FJG Q;  2XTI A;  4DR6 Q;  1KHI A;  1CKN A;  1L2F A;  1YZ6 A;  4OWW B;  2K50 A;  3S1Q H;  3J81 i;  1KQS A;  1EOV A;  1K73 C;  4POG A;  4JI0 Q;  1OTC A;  2R7Z G;  4LFB Q;  3I56 A;  1B8A A;  4A75 A;  1MKH A;  2VQF Q;  1Y1W H;  4JI6 L;  2I5H A;  5M5W H;  4GN5 A;  3S24 A;  3L2P A;  4JC0 A;  2E2H H;  3CCE A;  5C4J H;  2RHQ B;  5IT9 c;  2KEN A;  2B63 G;  1QUQ A;  3FP9 A;  4BBR G;  4LF4 L;  3PO2 H;  1XMO L;  1W2B A;  1X56 A;  4AYB E;  2HT1 A;  4O0A A;  5E7N A;  4DR5 L;  1NBW A;  2AWO A;  3E0E A;  4JI6 Q;  5IWA Q;  2VW9 A;  3GD7 A;  5C4X H;  3PGZ A;  4HID A;  4JV5 L;  1PVO A;  4DV1 L;  1U5K A;  1Y14 B;  3I4O A;  4DV6 Q;  1S40 A;  2WP8 J;  1QVF A;  3S14 H;  3K81 C;  1M90 C;  1BBW A;  2IHF A;  3E9H A;  4LF4 Q;  3I4M H;  1XMO Q;  5AJ3 L;  2QA4 A;  2F52 A;  3KF6 A;  2AMC B;  4DR5 Q;  1QZH A;  1Y1W G;  3ERS X;  2FXQ A;  1PH4 A;  4OWT B;  1YI2 A;  1BVS A;  3EN2 A;  2JA7 H;  4JV5 Q;  5M5X H;  4DV1 Q;  1HNX L;  1VQI A;  2QEX A;  5GAH C;  2IHE A;  2ZTD A;  2PMZ E;  3PO2 G;  1HR0 L;  4DKA C;  5AJ3 Q;  1JE5 A;  4JI8 L;  4QJF A;  1NE3 A;  5GQO A;  2F4V L;  3AQQ A;  1X9N A;  1OXT A;  3F2C A;  4A3F H;  4DAY B;  4DK3 C;  5C4X G;  1P8L A;  4UPA A;  1RIP A;  4A3J H;  1JB7 A;  2PQA A;  1E1T A;  1HNX Q;  1L1O C;  4APV A;  1Q1B A;  4R4O A;  4B3T L;  1TWG H;  3D0F A;  4L5Q A;  2MNA A;  1HR0 Q;  1I3Q H;  4DR2 L;  1A8V A;  4H02 A;  4JI8 Q;  2JA8 H;  4POF A;  2F4V Q;  2ZTC A;  4AH6 A;  5GAG C;  1XPO A;  1Q12 A;  1YNX A;  3UDX A;  2JA7 G;  1V9P A;  1CSQ A;  1IL2 A;  3H3V I;  3HFZ B;  3CCU A;  1GM5 A;  4LFA Q;  2ES2 A;  2K75 A;  4B3T Q;  4BBS H;  2MFI A;  1GD7 A;  2IY5 B;  1SRU A;  4ALP A;  3A5U A;  5EAY A;  1I50 H;  4DV3 Q;  3ULJ A;  4R4T A;  4DR2 Q;  4C3I H;  3HOU H;  4RG1 A;  1PYB A;  2PI2 A;  4A3F G;  4TQU S;  1Y1V H;  1OXV A;  4DV2 L;  2JQO A;  4P75 A;  2ASB A;  4GN3 B;  1E3P A;  4A3J G;  4NPS A;  1SFO H;  4RMF A;  1UE1 A;  1TWF H;  3NBH B;  4L5T A;  5FLX c;  1Q86 C;  4DR4 L;  5K36 G;  1L1O A;  2RF4 A;  4UP9 A;  5JJK A;  2Q2U A;  2JA8 G;  1C9O A;  2F3I A;  1AE3 A;  4R4Q A;  4BA2 I;  1U0L A;  4A4I A;  4IOC A;  4EQ5 A;  1HNZ L;  4DV2 Q;  4X65 L;  4A3D H;  2D0O A;  1VQ4 A;  3KLW A;  3J80 c;  4DNI A;  4DR4 Q;  3G48 A;  3M4P A;  3M4O H;  4C3H H;  3GTO H;  3HOU G;  3I4M G;  5IYD H;  2B3G A;  2D62 A;  4P73 A;  4C3J H;  3G71 A;  3M7N A;  2K4K A;  3PUV A;  1Y1V G;  3GTJ H;  3ICE A;  3HOZ H;  2ZJR A;  1P16 A;  2D0P A;  2NVT H;  2R6G A;  1HNZ Q;  4X65 Q;  2C35 B;  4A3I H;  2A8V A;  2LXJ A;  1HZC A;  2JA9 A;  4L5S A;  3GTM H;  2MO1 A;  4A3E H;  3H15 A;  1YHA A;  1PH5 A;  4R4I A;  3W1B A;  2NVQ H;  3U4V A;  3HOX G;  2H5X A;  3D31 A;  4HIM A;  4PZ8 A;  2WAQ E;  5FLM H;  3EIV A;  2GN5 A;  1SR3 A;  3U58 A;  3OW2 A;  1J5E L;  1QZG A;  2Y0S E;  1X55 A;  4IJL A;  2HHH Q;  4A3D G;  3TEH B;  3T1Y L;  4LUV A;  3RN5 A;  2VUM H;  1SE8 A;  4K0K L;  1B7Y B;  4JI5 L;  4Y7N H;  3ULL A;  1VQA A;  2YTY A;  5IYD G;  3A74 A;  1EQQ A;  3UE1 A;  1IYJ B;  1XMQ L;  4A3L H;  4MNO A;  3HOZ G;  3ER0 A;  2L15 A;  2R7D A;  4DPG A;  2WB1 E;  1EIF A;  3GTG H;  2AWN A;  3STB C;  4YCU A;  3TRE A;  4A3I G;  1J5E Q;  3CC2 A;  3KF8 B;  1CSP A;  4NXM L;  1EUJ A;  2Q2T A;  3T1Y Q;  2R93 H;  4DV7 Q;  4A3E G;  2K14 A;  3RN2 A;  4K0K Q;  4DV0 L;  2LXK A;  4B3R Q;  1K8A C;  3CAM A;  4IPC A;  3AFP A;  4ME3 A;  2WB1 G;  1XMQ Q;  2R92 G;  5FLM G;  1MJE A;  1R9T H;  1WCM H;  3M4Q A;  2OQ0 A;  1BBU A;  1VQJ A;  2JEA I;  3I55 A;  4NXN L;  4JI4 Q;  1J6Q A;  4NXM Q;  3KJP A;  3J80 i;  5J3B A;  2UU9 Q;  2VUM G;  3TRZ A;  1IBK L;  2UUC L;  3CW2 C;  4DV0 Q;  1Q7Y C;  4X64 L;  4DUZ L;  2PNH A;  4A3L G;  3H3V H;  4GLV B;  3U4Z A;  5C0X I;  3S1N H;  5HGQ A;  5IYB H;  3H0G H;  3L0O A;  4JG2 A;  3DM3 A;  5C3E H;  4A3G H;  2UXD L;  2VL6 A;  1YVC A;  4NXN Q;  3HOY H;  5HY6 A;  2JA5 H;  4BXX H;  2R93 G;  1UEB A;  1PV4 A;  1UE6 A;  4GS3 A;  1Q81 C;  1PYS B;  1IBK Q;  2UUC Q;  1HH2 P;  2N3S A;  4X64 Q;  3RR5 A;  4DUZ Q;  3KDF A;  4O2D A;  3CMA A;  1FGU A;  2R7F A;  1YJ9 A;  2I5L X;  4YY3 L;  1AE2 A;  1WCM G;  1PH7 A;  1PH8 A;  2BH2 A;  1X3F A;  4R4C A;  2K52 A;  1XNQ L;  3S15 H;  2ATW A;  2LSS A;  4GLA C;  4UY8 C;  1WYD A;  4B3S L;  4IFD G;  4GOP C;  1X54 A;  2VQE L;  3CCL A;  2Z6K C;  4KHP L;  4LFC L;  1VS0 A;  2ZJP A;  1N33 L;  1FVI A;  3GTP H;  1YIT A;  1KL9 A;  3CME A;  3L7Z C;  3J81 j;  3K7U C;  1M1K C;  1A62 A;  4JCV E;  1UWV A;  3TS0 A;  3CC4 A;  1D8L A;  4YY3 Q;  5IYB G;  3H0G G;  2E5L L;  2UXB L;  5LMU L;  4A3G G;  3GO5 A;  5C3E G;  1XNQ Q;  3PIP A;  2DUD A;  4B3S Q;  2JA5 G;  3HOY G;  4KHP Q;  2VQE Q;  5ELN A;  1IZ6 A;  1N33 Q;  4A3B H;  4A76 A;  3KDF B;  1Z9F A;  4QL5 A;  3RLF A;  4IFD I;  2OTL A;  1ASZ A;  1VQN A;  4HJ8 A;  1N32 L;  2N78 A;  2Q2I A;  2E8G A;  3CF5 A;  2UXB Q;  1RL2 A;  3HKZ G;  2E5L Q;  5LMU Q;  1H95 A;  3PUX A;  4L5R C;  3W1G A;  1YJN A;  1GVP A;  1E7Z A;  3HOV H;  1N34 L;  3PF4 A;  3JAM i;  1X65 A;  1Z47 A;  1WJJ A;  1K83 H;  5BR8 L;  4LF5 L;  4IFD J;  1EWI A;  4NB3 A;  3B6Y A;  5LMN L;  2RCN A;  1N32 Q;  3ULP A;  3PIO A;  3F2B A;  1YJW A;  1KRS A;  4LUO A;  4P72 A;  2E2I H;  2UUA L;  3JC6 6;  3S1M H;  1V43 A;  1WI5 A;  3NEM A;  4IPD A;  4A3K H;  1NMG A;  1HJP A;  1DGS A;  4XIG S;  1N34 Q;  1Q46 A;  4A3B G;  3A0J A;  3K8A A;  4DR1 L;  5JJL A;  5LMN Q;  3CCV A;  1NJI C;  4DR3 L;  1A0I A;  1VQ5 A;  2IX1 A;  4GKK L;  2CWA A;  3K0X A;  4YWK A;  3CCR A;  2OQK A;  4JBJ A;  5M3F H;  4GOP B;  2PI2 E;  1QVC A;  1PHJ A;  1VQ7 A;  3HOV G;  2CWP A;  2JA6 H;  4BBS G;  2KCT A;  1VQ9 A;  4HJ7 A;  4LWC A;  1C7Y A;  4DR1 Q;  3T1H L;  2N49 A;  1HR0 W;  3KFU A;  2BA1 A;  1CUK A;  3OYY A;  4YHH L;  2ZTE A;  4A3M H;  4GKJ L;  4DR3 Q;  5IP9 H;  1XPU A;  3PSI A;  4A3K G;  4GKK Q;  3F8T A;  1KXL A;  1SMX A;  2EIF A;  4LW1 A;  1VQC A;  3E9I A;  3RLN A;  3RZD H;  1V1Q A;  4LF6 L;  4LUZ A;  1KIX A;  3MXN B; 
#chains in the Genus database with same CATH topology
 1DJR D;  4EEY A;  2RBM A;  3BDL A;  4LFA H;  1N8R C;  2CH4 W;  2NVY H;  3HKS A;  3RBE A;  4KLK A;  2WTF A;  1X3Q A;  3MXG A;  2LFN A;  3M85 A;  4DV3 H;  1EY4 A;  1YNN C;  3N40 P;  1G29 1;  1GO3 E;  1MIU A;  2YTX A;  3GQC A;  2CW0 C;  4RB3 C;  3VR2 A;  2XVS A;  4UCO A;  1JOO A;  1WOC A;  5LMN W;  3QB3 A;  1BGW A;  3HRZ C;  2PNR C;  2IBK A;  2G9H D;  4KN7 C;  5BN4 A;  4OEM B;  4A3C H;  4L1K A;  1D5X C;  1FNU A;  4EG0 A;  4KY5 A;  4L6T B;  1EYC A;  2AU0 A;  4RGT A;  1TWC B;  2DY7 A;  4ME5 A;  1Z7T A;  3RLO A;  1JWM D;  3K58 A;  1QCB D;  3BVZ A;  2EYF A;  4C2M H;  1YHB A;  3HOW G;  5M3M H;  5A2Q L;  2H4O A;  4HMI A;  2TSS A;  4K14 A;  1PFM A;  3K7A H;  4X66 H;  3OWF A;  4TRD A;  1VQK A;  3WWV A;  2ZM6 H;  1VKZ A;  5IP7 G;  5EKK A;  4DV5 L;  1VMC A;  2DGY A;  2R7L A;  3PQI A;  1JC7 A;  4G7H C;  1VQP A;  3MEH A;  4LJZ C;  4IUN A;  5CV9 A;  4MV9 A;  1HUM A;  5D8D A;  4AYB A;  4X62 Q;  1IOV A;  4XXE A;  4QY7 A;  5L1I A;  1Q8K A;  2ZXO A;  1U4P A;  2R92 B;  1LTA D;  1IBM H;  3FKI A;  3C46 A;  4O2A F;  2WIN B;  4RWS C;  2E2H A;  3CQZ H;  4BWS C;  3FVQ A;  4KY7 A;  2VUM B;  2K6A A;  3GIL A;  2HHH H;  3HBL A;  5EJW A;  1EY0 A;  1CKM A;  1DV1 A;  3QWN A;  1HFN A;  3AEV A;  4A2A A;  1XWE A;  3NQT A;  4ECW A;  4DR7 L;  5I47 A;  4UP7 A;  3TQY A;  3S16 H;  1TU2 B;  5CR3 A;  1HFG A;  3OSO A;  4A93 G;  4IN3 A;  3A55 A;  4UHV A;  1AZP A;  1YNJ C;  3R93 A;  4G7O C;  4DV7 H;  4YWL A;  4YJ3 F;  3HZX A;  3W5O A;  4JBW A;  2ZDG A;  4F87 A;  4JI0 H;  1M6V A;  1ICW A;  1JJ2 A;  4XX0 B;  3PZP A;  3OHB A;  3J7A F;  5KFO A;  2QF7 A;  2W9C B;  3KBX A;  5D65 A;  3C3L A;  4I7H A;  3PO2 B;  5LXT F;  5KG0 A;  2NVX H;  4O3N A;  2GPS A;  2B39 A;  5A2Q W;  2EE1 A;  1HA6 A;  4CC5 A;  5C4X B;  1O7L A;  2UUB L;  5ELD A;  5C3E B;  1JJG A;  1AFP A;  2G5D A;  2K04 A;  4HIO A;  2KCC A;  5CBE E;  5I6Y A;  3CC7 A;  1PRT F;  1GSO A;  4O4I F;  2X0S A;  4LFA L;  1I6H H;  1SMY D;  4K8J A;  1TWG A;  4QWC A;  1NMF A;  1LTL A;  4C5A A;  1I3Q A;  3I4N H;  1I94 Q;  3KF6 B;  4F4X A;  4EX5 A;  4DV3 L;  1VMP A;  4RCN A;  5TSS A;  2IWH A;  2XCP A;  2R8H A;  2VS1 A;  4J9P A;  2DZD A;  4XT1 B;  2BA0 A;  1LUZ A;  2AQ1 B;  4WJ4 A;  3VA7 A;  4ZQ3 A;  1F2Y A;  4PDB A;  4DV1 H;  1KRT A;  3S17 H;  4GNX C;  4Q43 A;  1VQ6 A;  5DGB A;  1F9S A;  2HUG A;  2ZXR A;  4MZ9 A;  3CPW A;  3GTK H;  3TZD A;  1I50 A;  3J7A K;  3BAA A;  1WTW A;  1KD1 C;  3TP7 A;  5A35 A;  1CHP D;  2FKL A;  2NN6 H;  5KFI A;  3FDT A;  2B29 A;  3IAY A;  3VR4 A;  3MR3 A;  3ONA B;  4OEL B;  4Y52 H;  3R5X A;  5C44 G;  3KYH C;  2R87 A;  1SE2 A;  2PQA B;  3NUC A;  4LNQ A;  3D6C A;  1E4F T;  2MJ8 A;  2V59 A;  4TUY F;  4X66 L;  1AH9 A;  2AGO A;  3WOE A;  3G6X A;  2CW7 A;  5FKA C;  3QG1 A;  4JI7 Q;  2ATL A;  2DJF C;  2ZM6 L;  3HOX H;  1XX8 A;  3J7A V;  5EOY A;  3GV7 B;  4FM9 A;  1KNE A;  4R8U B;  5IYC H;  3OIQ A;  4DK0 A;  1KJJ A;  4JOI A;  2A68 D;  3RV3 A;  5K5P A;  1PH9 A;  1VF7 A;  2CH4 A;  1S5E D;  4BY7 G;  1B50 A;  2E2I B;  4DR2 H;  2WAQ A;  1DXM A;  1IBM L;  2PPB C;  2A6H C;  1CKO A;  2B2T C;  4J15 A;  4KD4 A;  1TWF B;  3PW4 A;  2HHH L;  1BKB A;  1II3 A;  1QIL A;  2EY2 A;  2F03 A;  2AUJ D;  2AQ4 A;  1E1O A;  3SGI A;  4DNT B;  3GV6 A;  4I4T F;  1K9M C;  4ULL A;  4A3D B;  4K2L A;  2EJF C;  1TII D;  5COR A;  1ASY A;  2D2C C;  2BH8 A;  1CHQ D;  2A6E D;  2NN6 I;  4CKB A;  1G6P A;  3PW7 A;  1EZ8 A;  2B63 A;  4DV7 L;  1VDZ A;  1RTO A;  3GTJ B;  2V5A A;  4QCL A;  4OO1 G;  2NYZ D;  4JI0 L;  4LFB L;  3UE0 A;  3T4A C;  4B3M Q;  2FK1 A;  1EY9 A;  3RZD B;  5KRU A;  3M9B A;  1Y8O B;  1UE5 A;  3S9W A;  1JMC A;  5BPF A;  1MD2 D;  3HGB A;  2QCP X;  4DR6 Q;  1L2F A;  1CKN A;  2OF1 A;  2PZW A;  2YZG A;  1YZ6 A;  2WB1 B;  4MV7 A;  2K50 A;  3J81 i;  1RHP A;  1EOV A;  1WCM A;  2X6L A;  3SXH A;  3MXU A;  3I56 A;  1B8A A;  4A75 A;  1MKH A;  2VQF Q;  1PVO A;  4GN5 A;  4ED6 A;  2EYP A;  4YQW A;  1STH A;  5D3D A;  2F0P A;  5C4J H;  3CCE A;  2RHQ B;  3VYU A;  1TAE A;  1D5M C;  1QUQ A;  3FP9 A;  4CJ1 B;  2JEF A;  1XMO L;  3TN2 A;  1X56 A;  1UC8 A;  1EIG A;  2AWO A;  1HHV A;  2K1B A;  3BA9 A;  2R93 B;  3GD7 A;  4X3S A;  3PGZ A;  1J5E H;  2JA5 A;  4DV1 L;  1U5K A;  3H20 A;  2SDF A;  1CTM A;  4I65 A;  3K81 C;  5F9L A;  2FLP A;  2RA4 A;  5AJ3 L;  3HP3 A;  1S0N A;  4PV1 C;  5J22 A;  1Y1W G;  2F0W A;  4IRD A;  4JW0 A;  2PBZ A;  3EN2 A;  3GLK A;  3SI8 A;  4NXM H;  1EZ6 A;  1EHI A;  2ZTD A;  3S1N B;  2R82 A;  5KFY A;  1F2M A;  3QIA A;  5GQO A;  2F4V L;  3AQQ A;  1X9N A;  1SAP A;  2EOT A;  4DAY B;  4DK3 C;  5IGG A;  2LY7 A;  1CFM A;  2FE3 A;  5EWF A;  4ECQ A;  4LAA A;  1RIP A;  3KLS X;  4A3J H;  2XNA C;  1JB7 A;  1HNX Q;  3I4M G;  1DIK A;  4APV A;  1Q1B A;  4R4O A;  1IBK H;  3D0F A;  3UI2 A;  4DR2 L;  5FPR A;  3HKZ B;  2A5H A;  4EQP A;  1QB5 D;  4ZKC B;  5GAG C;  3QZ7 A;  3I91 A;  1Q12 A;  2JA7 G;  1SEI A;  5KFA A;  4U6P A;  5BPH A;  2Z8L A;  3CCU A;  1JLL B;  2IY5 B;  2H1E A;  1RK6 A;  4ZI7 F;  3A5U A;  3CRK C;  1H9K A;  3ULJ A;  3GTL B;  1Y1V A;  4C3I H;  3K6O A;  5I6W A;  4A3F G;  4TQU S;  2FK2 A;  1N48 A;  4G4K A;  2JQO A;  4KHP H;  1EU4 A;  4CJ0 B;  5J2U F;  4RB2 C;  5C3W A;  4M8A A;  5FLX c;  2DPJ A;  1L1O A;  2RF4 A;  2JYO A;  4NKL A;  3MA2 B;  3J80 W;  5L1L A;  4JPB W;  1Z2P X;  1G2T A;  5JJK A;  1C9O A;  2F3I A;  4EQO A;  4UCR A;  5LMU H;  1U0L A;  1STE A;  3EJI A;  5JVD F;  2XC9 A;  4EYH B;  1G8Z D;  4OL7 A;  4IOC A;  5KT6 A;  5KFV A;  1VQ4 A;  5KT4 A;  1RJP A;  3G48 A;  3BA8 A;  1G2S A;  4F50 A;  4C3J H;  2W7O A;  1JQY D;  5IGC A;  1I94 H;  3SK4 A;  2XGQ A;  3JSL A;  4NMZ A;  2NVT H;  3I70 A;  3GTM H;  2E75 C;  3IKJ A;  1CA5 A;  3MJF A;  5M3F B;  2NVY A;  2NVQ H;  2R8K A;  2H5X A;  2JA6 B;  1V1O A;  3U58 A;  1J5E L;  1I4H A;  1E2Z A;  3RN5 A;  1B7Y B;  1KNA A;  1JX4 A;  4Y7N H;  4M7E A;  4I7A A;  1IYJ B;  3GIQ A;  1XMQ L;  3HOZ G;  2L15 A;  2R7D A;  2F0S A;  5KND A;  3GTG H;  2C2E A;  1KBL A;  2DJG C;  4A3I G;  4NXM L;  4JI7 H;  1CSP A;  3L3O C;  1EUJ A;  2C9O A;  2Q2T A;  2MCT A;  2L9H A;  2K14 A;  4C2M A;  1GHJ A;  4K0K Q;  4EEQ A;  2F0F A;  3T51 B;  3OIP A;  3I72 A;  1SXT A;  1K8A C;  3BQ1 A;  3G7L A;  3DWQ A;  1MJE A;  3OSN A;  2M00 A;  2K05 A;  2NUC A;  3M4Q A;  2QK4 A;  3I55 A;  2UU9 Q;  5J3B A;  2VA3 A;  3SK6 A;  1IBK L;  1SJE D;  4LMY A;  3EYY A;  5HGQ A;  3VYR A;  3H0G H;  3D6W A;  1O7Y A;  2VL6 A;  5FPO A;  3ORR A;  3P20 A;  4BXX H;  2I07 B;  1F9R A;  2EYJ A;  4GS3 A;  1ZYR C;  3GQB A;  4R8N A;  1PMR A;  1HTL D;  2N3S A;  4DUZ Q;  4R8I A;  2C28 A;  3CMA A;  1DD2 A;  1YJ9 A;  2I5L X;  4YY3 L;  1AE2 A;  1WCM G;  4RKL A;  1PH7 A;  4XT3 B;  4K6D A;  2ATW A;  4GLA C;  3S1R B;  4KHP L;  3CCL A;  5KT3 A;  2ZJP A;  2BE5 C;  2D9U A;  2B2V C;  1E0B A;  4B3M H;  1RKN A;  3GTP H;  3CME A;  1SJH D;  3L7Z C;  2WV6 D;  2F3W A;  3K7U C;  4AYB B;  2F0N A;  4MHE A;  3LML A;  4DR6 H;  2MHV A;  2C22 A;  2KOL A;  5IYB G;  5LMU L;  4MA0 A;  2I80 A;  4Y8V B;  3FKI B;  4HAE A;  2DUD A;  3PIP A;  1ZKO A;  4B3S Q;  2JA5 G;  3V6K A;  4H13 C;  5ELN A;  5F2D A;  3GV3 A;  4A76 A;  3K59 A;  2DPI A;  3KDF B;  3MZ5 A;  4OGQ C;  1T36 A;  3L9A X;  2OTL A;  2V9W A;  4HJ8 A;  4KHV A;  1C4Q A;  2NU6 B;  2KJX A;  2R8I A;  1K1S A;  5EBC A;  3RB0 A;  2F0O A;  2J6U A;  1AZQ A;  1X65 A;  2FFK B;  1Z47 A;  4F8M A;  1K83 H;  1QNU A;  3A8I E;  2FPP B;  5J39 A;  5JVH 3;  3I4M B;  1N32 Q;  3MFH A;  3F2B A;  3F2U A;  4P72 A;  2WDT A;  4WBN F;  1BDO A;  3VR5 A;  1V43 A;  4IPD A;  3DF7 A;  2DN8 A;  5KNC A;  1HJP A;  1TR5 A;  3DM1 A;  4FF2 A;  1CS0 A;  4Q0Y A;  5KG1 A;  1ZXT A;  2KCN A;  4A3B G;  5KFF A;  5JJL A;  2PZT A;  1I7L A;  4KJO A;  3N42 B;  3GTK A;  3C1F A;  2R6F A;  3K0X A;  1XTC D;  3Q22 A;  1D5Z C;  5FLX E;  5KX5 F;  3ORQ A;  1EEF D;  3HOV G;  1QVC A;  1CQI B;  1QWY A;  1M8A A;  1XYI A;  4RZR A;  2HJW A;  3MWM A;  2N88 A;  3I4L A;  2FPI B;  2L11 A;  1HR0 W;  1TWG B;  4XQN A;  3PO3 B;  1STY A;  1I3Q B;  1SYC A;  4TKO B;  1HNX H;  5FO8 B;  1HUN A;  2DNC A;  3K5H A;  4MV6 A;  2EIF A;  2ASD A;  3E9I A;  1B6S A;  1K8M A;  5KFG A;  3VPC A;  4LF6 L;  1V1Q A;  5C0X H;  1KDA A;  1KLG D;  1KIX A;  3Q8Q B;  1LT5 D;  3GTO H;  3NEN A;  5E4W C;  1VQL A;  4X3U A;  3T1H Q;  2UXC L;  3BS1 A;  1E24 A;  1I50 B;  2ICE C;  5KFK A;  2OCE A;  2CZG A;  4Q45 A;  3QJY A;  2KCM A;  4ILW A;  4YWM A;  2BCO A;  3IFD A;  1XJV A;  5CYU A;  3LWE A;  2E2J B;  4A3M G;  5IP9 G;  1B44 D;  3DWP A;  5GON F;  1SBB B;  5KFM A;  1X3G A;  4DUY L;  5EPJ A;  1CE8 A;  4TV9 F;  2R7Z A;  1TA8 A;  4MA5 A;  3CCJ A;  2N8N A;  3CKI B;  4FXD A;  4RUC A;  1F9Q A;  3NEL A;  2YV5 A;  4B3M L;  4IO9 A;  4HNV A;  1TKW B;  1E22 A;  5LHY 1;  4DV4 Q;  3OTO L;  2L55 A;  2R7M A;  2W6N A;  4DK6 C;  2WAQ B;  4FS1 A;  4JI2 H;  3Q0A A;  1RTN A;  3UDG A;  1JIC A;  2B8F A;  1GOZ A;  1LTG D;  1DYQ A;  1B04 A;  3BQ0 A;  4J1M A;  2BOS A;  5IT9 E;  4A3C G;  1JT8 A;  5AFW A;  1PTO H;  4I7Z C;  3CU7 A;  1YHQ A;  1TS5 A;  1ESF A;  1QVG A;  3K80 C;  2EXZ A;  3BG5 A;  1V1P A;  1JWU D;  1PLF A;  1NTG A;  1TXY A;  1U4M A;  5DM6 3;  3EBE A;  4OX9 Q;  3ND9 A;  3RAX A;  2B63 B;  4BBR B;  5M3M G;  4DAP A;  5FOB B;  3BVM A;  5EGT A;  1A15 A;  5DG9 A;  5FLX L;  1K8G A;  5LL6 S;  4LF8 L;  3VA5 A;  2UXD Q;  4DA2 A;  2XGT A;  2Z0S A;  1L0Y B;  4JBK A;  5LA6 F;  4OWX B;  3R23 A;  5JH7 F;  1LT3 D;  1IXR A;  3P75 A;  3IN5 A;  1PK8 A;  2YU9 H;  3K3V A;  4HIK A;  1CKN B;  4LF9 Q;  3G6E A;  5E4X A;  5DQI A;  4BY1 H;  3A7A B;  4JI3 Q;  3RZO H;  1WCM B;  3J7Z C;  1A6X A;  3X3N A;  3EQL C;  5HBR B;  3EVQ A;  1W3S A;  4PMC A;  3P1H A;  2L12 A;  1PZI D;  1BOS A;  2UU9 H;  1PFS A;  1QUQ B;  3LWU A;  4HJ5 A;  1PH6 A;  1SYX B;  3GV8 B;  4GOP A;  4YCW A;  1I4P A;  3PCO B;  4LF7 L;  1TWA A;  4DAM A;  1WVL A;  5KG6 A;  2JA5 B;  1VQG A;  2XIW A;  2A73 B;  1X6O A;  2VUG A;  3CCQ A;  2XSC A;  3OOC A;  2W6O A;  3MEF A;  4PMW A;  4JI1 Q;  3U9T A;  2FJ2 A;  2YTV A;  1PH3 A;  2J6T A;  2W6Q A;  4CJ2 C;  4DUZ H;  2FIN B;  3IG0 A;  1HNW Q;  2FPG B;  2R86 A;  2VNU D;  1BUV T;  4DNR B;  1C0A A;  5KFE A;  3BU2 A;  4AIM A;  4LF5 Q;  1EIY B;  3MXN A;  4YCV A;  4AQY L;  4ECY A;  5KG7 A;  4PMB A;  5GRO A;  1FKA H;  5FLX W;  1XNR Q;  4MTD A;  5D14 A;  4IUQ A;  3J81 W;  1UE7 A;  1VQF A;  2XWJ B;  2PCF B;  2XCL A;  5ELO A;  2GA4 B;  2EYO A;  2EYL A;  1LM0 A;  1KAW A;  1VQO A;  5ELC A;  3I4N G;  2JA8 B;  4ZYS A;  4KHZ A;  5IOD A;  3A54 A;  3J7Y W;  4JI8 H;  1SMY C;  3R3O A;  5J2T F;  1YIJ A;  4JI2 L;  2OTJ A;  3HOV B;  1L0W A;  3FPU B;  1KC8 C;  5EPK A;  1WTQ A;  3E6Z X;  3RNU A;  1XDN A;  4IPG A;  3V4Z A;  4RB1 A;  4DL4 A;  1TWC H;  4FDB A;  2L5T A;  4YIJ A;  2L0C A;  3F1Z A;  4F4Y A;  4G3I A;  1Y1V B;  3GIJ A;  2NN6 G;  3I73 A;  2F0M A;  1TWH H;  1T9H A;  3CD6 A;  3BJU A;  1Y8P B;  4PZ6 A;  1WTP A;  3GTM A;  3ZYY X;  3HG9 A;  2CQO A;  1L1O B;  3LGJ A;  4M1U B;  1YBY A;  1PH1 A;  1K1Q A;  2PYK A;  3KBG A;  1B33 N;  1SNO A;  2O03 A;  1JIH A;  4G57 A;  5HV6 A;  3ETJ A;  5C5J A;  4JYA L;  4IUP A;  3NSW A;  4L63 B;  2R92 H;  3M4O B;  5IYC G;  4C3H B;  4HTH A;  1PX2 A;  4ECX A;  4DR4 H;  1KJQ A;  2YYZ A;  2QW7 A;  1U4R A;  4A3M B;  3H3V C;  1S72 A;  5COY A;  3SK8 A;  4B9W A;  4HNT A;  1EYG A;  4DLK A;  1I6U A;  1O7I A;  2A68 C;  1IBL Q;  1CI3 M;  2IX0 A;  2CCZ A;  1JKJ B;  2YL2 A;  2AHO B;  3Q8S B;  4A2B A;  3CXC A;  1BCP F;  2Y0S G;  2KHI A;  4CBV A;  4X65 H;  2IX3 A;  2UU9 L;  1FJG Q;  4HCS A;  4C1N I;  4TQR A;  2W9A A;  1BF4 A;  5IT9 W;  2NVY B;  3N6R A;  1KQS A;  2R7Z G;  4HN7 A;  4IZO A;  1Y1W A;  2QDL A;  1S5B D;  3L2P A;  1FGB D;  2SCU B;  3PR5 B;  2MGS A;  5KG5 A;  1NR2 A;  3PO2 H;  5NUC A;  2A6E C;  1W2B A;  2DWC A;  2RDF A;  4O0A A;  2CQY A;  4YR2 A;  3V6H A;  4FVM A;  4JI6 Q;  5IWA Q;  3PIO 3;  2IJ0 A;  2VW9 A;  5C4X H;  2X69 A;  3CVZ A;  3K0Y A;  2K01 A;  4C2M B;  1Y14 B;  3BDC A;  3I4O A;  4DV6 Q;  2WP8 J;  3KK7 A;  1S40 A;  5DQG A;  3MWD A;  4LF4 Q;  4UCS A;  5KYL A;  2V4R A;  2NWG A;  3Q1K A;  4J8Q A;  3M9M B;  2AMC B;  2Z4I A;  1PXU A;  4DR5 Q;  2JA7 A;  2VXW A;  1OO9 B;  2RDG A;  1ET6 A;  1YI2 A;  3QR8 A;  1GUN A;  4JV5 Q;  1EY8 A;  2HCI A;  1A2U A;  3X3M A;  2E74 C;  5GAH C;  2R7K A;  2PMZ E;  4X3K A;  5C6A A;  4RFB A;  2OEO A;  5E3F A;  4A3G B;  1JE5 A;  1SND A;  4JI8 L;  2WYO A;  4O1N A;  3RAQ A;  2YCH A;  3RBD A;  1OXT A;  2EVB A;  1A2T A;  4NXN H;  2BDO A;  3IL8 A;  3RIZ A;  1TY2 A;  1W93 A;  5G3L F;  1GGO A;  4OX9 H;  3OHX C;  5K36 H;  4E6I A;  4B08 A;  3SEB A;  1HXY D;  2MNA A;  1HR0 Q;  4RNM A;  4KMU C;  3VR6 A;  4CDE C;  5LYJ F;  1C3O A;  4ECR A;  1VBG A;  2ZTC A;  1RCV D;  4N8F A;  3S16 B;  4QWB A;  2UXD H;  1IL2 A;  3H3V I;  3HFZ B;  4TV8 F;  4ECV A;  1K83 A;  2ES2 A;  2NU7 B;  4B3T Q;  1KDC A;  5LL6 X;  3SVM A;  5EAY A;  1CA6 A;  3HOU H;  5KFR A;  4RG1 A;  4ME6 A;  1B6R A;  5KFB A;  5C1P A;  1XNQ H;  1IW7 D;  1SFO A;  3VMM A;  4KV6 A;  1E3P A;  2EYM A;  4A3J G;  4DR4 L;  1T5X D;  1TWF H;  1ONL A;  3NTK A;  2XRQ D;  5FK9 C;  2BQR A;  3AU7 A;  1KLU D;  4UP9 A;  3M4I A;  1JWS D;  3OPO A;  2UXB H;  4R4Q A;  4FF1 A;  1YNN D;  1AP0 A;  5EQ0 A;  1TT2 A;  1LTI D;  4A4I A;  1B2T A;  4ZKB B;  4DL5 A;  4DV2 Q;  2CW0 D;  1NAP A;  4X65 L;  2D0O A;  4A3D H;  5JVL A;  4YP3 A;  1S03 G;  1NCV A;  2MUY A;  3TP5 A;  1GXD C;  2R61 A;  4C3I G;  4Q5V A;  4A3K B;  2B3G A;  4P73 A;  3M7N A;  1S0O A;  3GTJ H;  4JI1 H;  4B9X A;  2FMC A;  5EZY F;  1P16 A;  4NP5 A;  2R6G A;  2F0I A;  1HNZ Q;  1HNW H;  2C35 B;  1ENF A;  1D6E C;  2JA9 A;  3SR1 A;  3S17 B;  4LF5 H;  4A3E H;  4V19 0;  4ZUJ A;  3H15 A;  3GTK B;  2FMM A;  3BYY B;  4H7B A;  1WSC A;  3NWT A;  3W1B A;  4JV1 A;  3D31 A;  5KFP A;  4HIM A;  1CZG A;  1DCZ A;  5FLM H;  5L1J A;  5D1P A;  3DMU A;  3OW2 A;  1XNR H;  2Y0S E;  3NTI A;  2RCF A;  4MV1 A;  1S97 A;  4Q8E A;  1VF5 C;  2FJZ A;  2B2W C;  3KAJ A;  1JR0 D;  4K8I A;  1DON A;  4C3J G;  3UE1 A;  4A3L H;  1GUS A;  2ZT9 C;  1VAJ A;  4GKK H;  5CC4 A;  2WB1 E;  4FXK C;  3QO2 A;  2AWN A;  3OUU A;  3STB C;  2QEJ C;  4APM A;  3T1Y Q;  2R93 H;  3MR2 A;  5C8Y F;  3HOW B;  1GHK A;  2LXK A;  3NBI A;  4B3R Q;  4PQX A;  1GLV A;  2FB9 A;  1MSH A;  1R9T A;  1FNV A;  3MFY A;  1M0W A;  2Z6B A;  4K2K A;  1VQJ A;  1G91 A;  3ITP A;  4NXN L;  4IFD H;  3KJP A;  1ZHQ A;  3TRZ A;  2Q8I B;  4MV3 A;  4DV0 Q;  1ULZ A;  4GLV B;  3NTH A;  1TS3 A;  3DXJ C;  3U4Z A;  3S1N H;  1LTT D;  3D4R A;  4ETS A;  2R7Z B;  1SYG A;  3NQI A;  1NNX A;  4UCT A;  4JG2 A;  2BQ3 A;  2UXD L;  1TQO A;  1YVC A;  3HOY H;  5HY6 A;  3VPD A;  1UEB A;  1UE6 A;  3ND8 A;  1PYS B;  2WII B;  2UUC Q;  4X64 Q;  4O2D A;  3GID A;  2R7F A;  4IRK A;  2YZN A;  4R7R A;  1X3F A;  2K52 A;  1XNQ L;  4YAK B;  1ESR A;  4A93 B;  4GOP C;  1X54 A;  1IBL H;  5JPN C;  1SYB A;  4HYK A;  5EKL A;  2RDI A;  2XD4 A;  2YU9 A;  3V6J A;  1KL9 A;  3V4S A;  2MPM A;  3J81 j;  4KD3 A;  2YRX A;  1M1K C;  1A62 A;  4JCV E;  4Z9C B;  3S2D B;  1UC9 A;  3TS0 A;  3CC4 A;  4X62 H;  2UXB L;  3H0G G;  2DIK A;  4EBE A;  4IRC A;  2KVM A;  1AUX A;  5KT7 A;  2NTS A;  2VQE Q;  1V1P B;  1N33 Q;  4GC7 A;  4XYM B;  3NXW A;  4PNY A;  4J9S A;  4IFD I;  5KFW A;  4XQJ A;  2E5L Q;  4WOR A;  1YJN A;  1GVP A;  1E7Z A;  5KEE A;  4H0L C;  3PF4 A;  4IUR A;  1EEI D;  3JAM i;  1FR3 A;  4UFZ A;  1ZHS A;  4LF5 L;  5IWA H;  2HGS A;  2RSN A;  3B6Y A;  2P0A A;  1STA A;  3VR3 A;  3DEO A;  4HED A;  1SNP A;  4RHS A;  3PIO A;  1YJW A;  2FP4 B;  2W71 A;  4DV6 H;  3QZ8 A;  1WI5 A;  2DY8 A;  3NEM A;  4U68 A;  3TP8 A;  5CAE B;  4RU9 A;  5KG3 A;  1W6J A;  1N34 Q;  5CV5 A;  3MR5 A;  4UDU C;  3T5J A;  1EL0 A;  5I9O A;  2W7P A;  3L4K A;  5LMN Q;  1DOM A;  4J9R A;  3CCV A;  1NJI C;  2J9G A;  1A0I A;  2IX1 A;  5JEA H;  4GKK L;  2A6H D;  3BZD B;  4GOP B;  2OQK A;  5M3F H;  3NPP A;  1U9R A;  2C00 A;  2JA6 H;  1TWA B;  2W6M A;  1BCP D;  4BBS G;  4O4L F;  5C44 B;  2PZU A;  5T1G A;  2KCT A;  5KYI A;  4KK7 A;  1VQ9 A;  4LWC A;  1C7Y A;  3K5I A;  4DR1 Q;  2M2L A;  4MAM A;  2ZTE A;  2A69 C;  4DR3 Q;  5C1O A;  4ZAI A;  1S68 A;  1H9R A;  1KJ8 A;  2I46 A;  1HR0 H;  4PWQ A;  1CZW A;  1SMX A;  3E3X A;  3S2H B;  1PDQ A;  2PVP A;  2J7Z A;  3VPB A;  3KF8 A;  3MXN B;  4RUA A;  3RJ0 A;  3OMC A;  2JSO A;  3MVV A;  4BY7 B;  4N9P A;  4YHH Q;  1I5F A;  5JJI A;  2M9V A;  3U9S A;  4J9O A;  3F2D A;  3EFX D;  4X6A H;  1BQQ T;  4JV2 A;  3SHL A;  1IYU A;  1PH2 A;  1TWH A;  4JBM A;  4G7Z C;  4MN3 A;  3IFT A;  1SE4 A;  4P71 A;  5CV6 A;  2F0V A;  3WO0 A;  3OUZ A;  1R4P B;  3M9O B;  5CGK A;  5C0X G;  1IBL L;  3PN1 A;  1XTD A;  2VA2 A;  2GVA A;  3O13 A;  4QQB X;  4JI5 Q;  4DN4 M;  4DV2 H;  2K5V A;  2R8J A;  1IOW A;  3RD4 A;  3PUY A;  4X62 L;  4QF4 A;  2BR0 A;  2NZH A;  4ZK9 B;  4OHJ A;  5CV8 A;  2I5M X;  2V1C C;  3Q8D A;  5BMV F;  3JAM c;  1PRT D;  4FYD A;  1MZB A;  4R1J A;  1SNM A;  3S1R H;  1O7Z A;  2HIX A;  3GTM B;  4DL7 A;  5KFU A;  1HNZ H;  2P5Z X;  2VPQ A;  1PTO F;  1J8I A;  2RDJ A;  4XTC S;  4V0B A;  2NVQ B;  3KOJ A;  4TSS A;  4ZCK A;  4RAU C;  3EPG A;  2R3Z A;  1VQD A;  4DL2 A;  1HRJ A;  4FNF A;  3CQZ A;  5DLG A;  2Q8T A;  4OIJ A;  4DV5 Q;  3FKI H;  5IWA L;  5C0X J;  1WTV A;  2B8G A;  1HZB A;  4Y7N B;  4OO1 I;  4O3S A;  5FJ8 H;  1EQR A;  4DV6 L;  2QDB A;  4MTE A;  1DM0 B;  5GAD C;  1OXX K;  4OON A;  1Q90 A;  3QFF A;  1W96 A;  4RCO A;  1VCI A;  1GUG A;  4RH6 A;  1QJO A;  2PMZ A;  3AB9 A;  2WFW A;  1BNZ A;  3S1Q B;  3MWE A;  3T1Y H;  2JXM B;  1PA6 A;  3UDI A;  4B3R H;  3TQ1 A;  1Y1W B;  4DR7 Q;  1F77 A;  5M5W B;  1UUP A;  2E2H B;  4LFC Q;  3UQ8 A;  4OXP A;  2VQF H;  3PV0 A;  5KFQ A;  2AKW B;  1SRO A;  1N56 A;  2NVX A;  5FO7 B;  5IGB A;  2IA6 A;  3H4D A;  1HZ9 A;  2F0G A;  3CCS A;  2XCA A;  4ABN A;  1I94 L;  2EXD A;  4QIW E;  4HJ9 A;  3C2P A;  3AYH B;  4FF3 A;  1I4R A;  3BG3 A;  2XIG A;  4IUV A;  3S14 B;  2KSW A;  3P7J A;  1L2Z A;  4RGN A;  2RGV A;  2YW2 A;  4YBZ B;  1MJC A;  4RA8 A;  5L1K A;  3T13 A;  1PZK D;  4BY1 G;  4F4Z A;  1LT4 D;  2E76 C;  2NBF A;  4X64 H;  4ED2 A;  3PO3 H;  2F1M A;  2VR1 A;  2RHS B;  2JA7 B;  2UUB Q;  5I4D A;  2A74 C;  3K3P A;  1SNQ A;  2W57 A;  3CCM A;  2EQS A;  4QB4 A;  3GTQ H;  1IKL A;  3M3Y H;  4IAJ A;  1GYF A;  4JOI C;  1CM9 A;  2UUA Q;  4F4W A;  2R8G A;  1HZA A;  1T3N A;  4HR7 A;  4EGJ A;  4C5B A;  1A9X A;  4A3F B;  5HUR A;  2ZJQ A;  3VDY A;  4JI7 L;  4RNO A;  3G4S A;  1SYE A;  4WJ3 M;  2K5Q A;  5EWE A;  3A56 A;  1RJQ A;  3TIG A;  3RB3 A;  1FL0 A;  4KTA A;  1SLJ A;  2VQE H;  3OMG A;  3HB9 A;  4EFE A;  1N33 H;  3I90 A;  1J9O A;  2E2J H;  3A5Z B;  3BJY A;  3MHB A;  4XYL B;  3BZC A;  2VY3 A;  4X3T A;  5M5Y H;  1HQM C;  2Z4H A;  4IR9 A;  1H9M A;  1LYL A;  1EWH A;  2YYA A;  3IRB A;  4FBT A;  3J7A 5;  2UVU A;  1K83 B;  2CKZ B;  4BBS B;  1RJT A;  4K6L A;  2HD3 A;  3MFI A;  3PUZ A;  1Q1E A;  5KFC A;  1LLR D;  1EFI D;  4GNX A;  4GKJ Q;  2HIV A;  4HJA A;  1K3R A;  2JEG A;  4GN4 B;  4EGV A;  3FMA A;  4X66 Q;  3N6X A;  1TVX A;  2MQH A;  5H1S E;  3Q8P B;  1E2W A;  2ZM6 Q;  1SFO B;  2Y0S A;  3K57 A;  1LAC A;  1JOK A;  2IPK D;  1N36 Q;  5KFJ A;  2ALY B;  3GII A;  5DLQ E;  1B53 A;  2EPB A;  2HVS A;  3M7G A;  3EA6 A;  3KHL A;  1EQT A;  1DOL A;  5GAE C;  1JJC B;  2JK8 A;  5LMN H;  1BO0 A;  2WB1 A;  2QYZ A;  1IBM Q;  3UDF A;  4DAV A;  2K5W A;  3H91 A;  2AUK A;  1S10 A;  3R5H A;  1ML0 D;  3CPF A;  1HA5 A;  4DR6 L;  4C1N K;  3ETH A;  1S5D D;  1GKH A;  2WKC A;  5KFH A;  4DR1 H;  4B3R L;  2B63 H;  3HOZ B;  4BBR H;  4NDX A;  2F0H A;  4QGU A;  3LP8 A;  5IY0 A;  2MO0 A;  3NHH A;  3CRL C;  4KJN A;  1SEB D;  2V4D A;  4A3I B;  2VQF L;  1Q8I A;  2D5D A;  4O42 A;  1ZYR D;  1S3O A;  3U50 C;  1OXU A;  4P2C B;  2XTI A;  3KLR A;  1KHI A;  3JAM E;  4ECU A;  3D4W A;  3D8G A;  3TQT A;  4OWW B;  4J9M A;  1MI2 A;  4POG A;  4JI0 Q;  4LFB Q;  4JVZ A;  1Z2O X;  1C30 A;  2KED A;  2BE5 D;  1BR9 A;  1I4Q A;  5J1Z A;  3RTX A;  2Z9H A;  4WD3 A;  5FD5 A;  4L8J A;  4QW8 A;  3M4Y A;  2EY6 A;  1JOQ A;  5KFN A;  4RGM A;  5E7N A;  1B3Q A;  1NBW A;  3E0E A;  1EUD B;  1V8Q A;  1EUC B;  5E1F A;  5DGA A;  4HID A;  5JQW A;  4FO2 A;  1EZ1 A;  4O3R A;  1BXR A;  2L4N A;  4DF7 A;  4J9Q A;  1QVF A;  3SE7 A;  4QWA A;  4K0K H;  4JI5 H;  2PN1 A;  1BBW A;  3E9H A;  4LH6 A;  1R9T B;  1XMO Q;  5D1O A;  2F52 A;  4Q0F A;  4EGQ A;  2XWB B;  3ERS X;  2FXQ A;  2IP4 A;  3N8D A;  1UNS A;  1S4Z A;  4OWT B;  3VYT A;  3SE0 A;  1BVS A;  3NK9 A;  4O2B F;  5M5X H;  4DV1 Q;  1HNX L;  2PW7 A;  2QEX A;  2IHE A;  3PO2 G;  2LKV A;  2UVV A;  5AJ3 Q;  1I7N A;  1NE3 A;  5KNB A;  3F2C A;  5C4X G;  4Q44 A;  1KDB A;  1C8C A;  3DUZ A;  2KA7 A;  4XZ3 B;  1ENC A;  4C5C A;  2UVW A;  4NW2 A;  1HQR D;  1L1O C;  5IIF A;  2R84 A;  4L5Q A;  3S15 B;  1JOR A;  1D1K A;  1A8V A;  1I4X A;  2JA8 H;  2F4V Q;  3RGX A;  1ILP A;  1XPO A;  1WH2 A;  2ZDQ A;  1YNX A;  3V05 A;  1CSQ A;  5KG4 A;  1JE4 A;  2MFI A;  1GD7 A;  3TME A;  5C4H A;  1SRU A;  4ALP A;  4E4T A;  1ENA A;  4R4T A;  4DR2 Q;  4BY1 B;  3RZO B;  3K5N A;  1PYB A;  2ZDH A;  1Y1V H;  1OXV A;  2SNM A;  4A3B B;  4DXF A;  2ZJT A;  4B3S H;  2ASB A;  4GN3 B;  4LFC H;  1S0M A;  5EPL A;  1Q86 C;  3JAM L;  5K36 G;  5CV4 A;  1GUW A;  4RHR A;  2O5I C;  1IKM A;  5HGT A;  4ECT A;  5CA0 F;  3WO1 A;  2Q2U A;  2V58 A;  2JN4 A;  2W8K A;  4CC6 A;  2EJG C;  4BA2 I;  1KC7 A;  5T1I A;  1JXL A;  3LX0 A;  4K5X A;  1K8O A;  4EQ5 A;  5ELB A;  3R2T A;  1B9M A;  4DK1 A;  1Q3L A;  3C1E A;  3J80 c;  2FK3 A;  1PTO D;  4ID6 A;  3S1M B;  3M4O H;  2EDG A;  4C3H H;  1G6Z A;  3N44 B;  3HOU G;  1N32 H;  5IYD H;  3G71 A;  2K4K A;  2KUM A;  5JPM C;  1B1Z A;  3ICE A;  2ZJR A;  2D0P A;  2AGP A;  4CDC C;  5L9X A;  1QNK A;  4CKE A;  3BQ2 A;  1FD7 D;  2EY5 A;  4L5S A;  3JSN A;  1IW7 C;  2MO1 A;  2EJM A;  3OSP A;  3V2T A;  1YHA A;  2YS7 A;  4R4I A;  3JRW A;  3N41 B;  1EWC A;  3HOX G;  4XDX A;  4R9W A;  2UUA H;  4PZ8 A;  1L0X B;  1ROD A;  3RUZ A;  2GN5 A;  4U67 3;  2K33 A;  4A3D G;  3R8B A;  1FNW A;  1X55 A;  4IJL A;  4I55 F;  5LL6 b;  4LUV A;  2VUM H;  4K0K L;  4JI5 L;  4DGZ A;  4J9K A;  1VQA A;  2SNS A;  4CDD C;  2RDH A;  3GTG A;  4MNO A;  4O3Q A;  1B4O A;  1J5E Q;  1T94 A;  3KF8 B;  2C2R A;  1LTB D;  1F2L A;  1T5E A;  1JB3 A;  4A3E G;  1WD1 A;  5KFZ A;  3JAM W;  5DM7 3;  3T1H H;  4IPC A;  4ME3 A;  4GKJ H;  2K03 A;  2WB1 G;  2O2L D;  1XMQ Q;  2K32 A;  5FLM G;  1TWH B;  2JEA I;  3Q23 A;  4J9N A;  4JI4 Q;  1J6Q A;  4NXM Q;  3HS0 C;  1GUO A;  3OW7 A;  2RVL A;  2JP1 A;  3MTS A;  1V51 A;  4UCV A;  1Q7Y C;  1C48 A;  2QKI C;  4DUZ L;  5EKI A;  4A3L G;  1LO5 D;  3H3V H;  1N36 H;  3H0G A;  3URY A;  1RJR A;  1LT6 D;  4CGY B;  3L0O A;  4A3G H;  5C3E H;  2DNE A;  2WKD A;  1KAB A;  2R93 G;  2OT2 A;  1B9N A;  4DFA A;  1IYV A;  5M3M B;  3R2I A;  1IBK Q;  4DV4 H;  3K7A B;  3A8J E;  3RR5 A;  3G6J B;  3KDF A;  3DWA A;  1FGU A;  4XYQ A;  4ED7 A;  2MP1 A;  4YJ2 F;  1OWT A;  1O80 A;  5BN3 A;  4UY8 C;  4B3S L;  4F7X A;  4IFD G;  5JJZ A;  3GTP A;  4LFC L;  1FVI A;  2VB2 X;  1YIT A;  1RYR A;  1E4E A;  2TMP A;  1WR2 A;  4RAZ A;  2HVR A;  3NGD A;  2AGQ A;  5K2M A;  1IL8 A;  4QIW A;  1D8L A;  4YY3 Q;  3WOF A;  3CQZ B;  2HCC A;  3HOY G;  4EFB A;  3KHG A;  4KHP Q;  4LFB H;  1IZ6 A;  4CKC A;  1BXT A;  3DEP A;  5CA1 F;  3NBH A;  4IZ8 A;  1EY6 A;  1F9P A;  1Z9F A;  4KN4 C;  4QL5 A;  3RLF A;  1ASZ A;  1N32 L;  2RKS A;  2N78 A;  2XRS D;  1VBH A;  2Q2I A;  2E8G A;  5EDW A;  3KLS A;  2Z1C A;  5KFL A;  1RL2 A;  3HKZ G;  3U9O A;  5LMU Q;  1H95 A;  1ICF B;  3W1G A;  3H6M A;  4BS9 A;  2IW3 A;  3LWB A;  1WJJ A;  5CMD A;  2B2V A;  3LNN A;  3UFX B;  3MWY W;  4IFD J;  5DG7 A;  1EWI A;  4NB3 A;  2JEJ A;  2PMZ B;  1BJT A;  2RCN A;  1HTP A;  3ULP A;  4LF9 H;  1PFN A;  2X6G A;  2E2I H;  2UUA L;  3JC6 6;  4JI3 H;  2OLS A;  4A3K H;  1XMO H;  1NMG A;  4XIG S;  1Q46 A;  3GTQ A;  2NVX B;  3A0J A;  3K8A A;  4QW9 A;  1CQF A;  5LP6 F;  1O78 A;  3CCR A;  4JBJ A;  1PHJ A;  4DL3 A;  2PI2 E;  1EY5 A;  5L37 A;  4HJ7 A;  1I6H B;  3H09 A;  4KY6 A;  3T1H L;  2N49 A;  2ZXP A;  3KFU A;  3I4N B;  3L4J A;  4GKJ L;  1XPU A;  2QIL A;  4MV4 A;  3W2D A;  3PSI A;  3TII A;  3F8T A;  3J80 E;  2F0D A;  3K5L A;  4EBC A;  5CBA E;  3GTO A;  3RLN A;  3RZD H;  2F4V H;  1WD0 A;  1I4G A;  4GLX A;  1KJ9 A;  5ELE A;  1ET9 A;  1N36 L;  5JEA G;  1AUV A;  4HR7 B;  3HOW H;  3HOU B;  1EFW A;  2F0K A;  4MV8 A;  3ERQ A;  5M3F G;  3OHA A;  2JA6 G;  1B70 B;  3Q6S A;  3FRP B;  2EY1 A;  1RF2 D;  1K0R A;  4LF6 Q;  4TVA B;  4RAY A;  2AQ2 B;  2HQL A;  5IP7 H;  4DV4 L;  3FEW X;  2KEE A;  1CT1 D;  3DLL A;  1BCP C;  2VZA A;  2UXC Q;  1K0S A;  1N9W A;  2F0U A;  1NR4 A;  2CFM A;  5JAV A;  5JOB A;  4IOA A;  3HOX B;  5C5L A;  4UCU A;  1GSA A;  3KJO A;  4QUC A;  3N52 A;  2F0T A;  2LS0 1;  4UAI A;  2R7Z H;  4LSA A;  1K3B C;  2KHJ A;  4FXG C;  5M9O A;  1V4Y A;  4GNX B;  3RV4 A;  2HDM A;  2NZO A;  1GUT A;  3I2Z A;  3AMU A;  3PMF A;  2KBN A;  2KHS A;  4P74 A;  5JEA J;  4DUY Q;  1Q82 C;  1MBY A;  3WDN A;  1AN8 A;  4IHJ F;  4IR1 A;  2Y0S B;  5DAU A;  2ALZ A;  1YNJ D;  5T14 A;  2I0Q A;  5ISR A;  2GVB A;  4EQN A;  4OX9 L;  4A93 H;  2DLN A;  4ZUI A;  3FHW A;  2Q2H A;  5KG2 A;  4A3E B;  3OTO Q;  2OH2 A;  3PIP 3;  2CVR A;  5DG8 A;  3G6Y A;  3S2D H;  3MXP A;  3RF2 A;  3T5H A;  5JVG 3;  1WTX A;  1VQM A;  5LOV F;  1R4Q B;  1LTR D;  3TDQ A;  1X3E A;  5DEH A;  4LF9 L;  3GDE A;  3TZU A;  3PF5 A;  1KJI A;  2NZ1 D;  3H94 A;  4JI3 L;  4QWD A;  3T56 B;  1H9S A;  4GC6 A;  1UEA B;  5KFD A;  5KT5 A;  1I6V C;  1MHW C;  1BCP B;  3GIK A;  4IJH A;  2VOB A;  2B2Y A;  1FJG H;  3JZI A;  1PRT C;  5EBD A;  1VQ8 A;  2JE6 I;  3J80 L;  3PVX A;  4AYB G;  1EOT A;  3GTL H;  2VQD A;  2HQE A;  3HKZ E;  4LF8 Q;  5H80 A;  3ZJY C;  4BXX G;  1XMQ H;  1WFQ A;  4LH7 A;  5C4J B;  3FKI G;  3SDZ A;  3FDS A;  4DL6 A;  1HPC A;  3RGZ A;  3GP7 A;  2W9B A;  3QOL A;  2ASJ A;  4JI4 H;  2C5C A;  5FJ8 G;  4NLG A;  1G51 A;  4UP8 A;  4JI1 L;  2ENB A;  3SK5 A;  1Y8N B;  3CP0 A;  4FU0 A;  2F0J A;  5IE8 A;  1PYW D;  2BDN A;  1HNW L;  1CK1 A;  2Z6K A;  4MTK A;  4JI6 H;  3AFQ A;  3HOY B;  1TWA H;  2IT1 A;  5C44 H;  2FLN A;  5KGU A;  1S9F A;  1X32 A;  2NTT A;  2JJQ A;  4IQZ A;  4LF4 H;  5D1O B;  3VYS A;  2N55 A;  1XNR L;  5DLF A;  1VQB A;  4DR5 H;  1SE3 A;  5DNF A;  4BA1 I;  1AN7 A;  1YEZ A;  1S5F D;  5BR8 Q;  4LF7 Q;  4IPH A;  4OIK A;  3S2H H;  2PW5 A;  4JV5 H;  2K5N A;  3ERO A;  1QOH A;  4RZQ A;  1CQJ B;  1EQV A;  2JEB I;  1LAB A;  2B2U A;  2K5H A;  4BY7 H;  4KKU A;  2V4Q A;  1OXS C;  4KI0 A;  4LMQ D;  1SNC A;  1ZQ7 A;  4YY3 H;  1RDP D;  3KTM A;  3QOJ A;  4A3J B;  1PFB A;  1M4V A;  1Y69 U;  5KT2 A;  4WRD A;  1PRT B;  4Q8F A;  1DZ1 A;  2Q8R E;  3I7F A;  4AQY Q;  2O5J C;  4XYO A;  4QUF A;  1U4L A;  3KUP A;  3PO3 G;  2FLL A;  2R85 A;  1DV2 A;  3J81 c;  4ODG A;  1D7Q A;  4ECZ A;  3TS2 A;  3I12 A;  2UVR A;  1TWC A;  5BN5 A;  1UAP A;  3BZK A;  1SN8 A;  2KEC A;  4ED0 A;  3HXL A;  4B3T H;  4C3I B;  3MC0 B;  1XPR A;  1MSG A;  2RSO A;  1A3U A;  4EVO A;  4HNU A;  4EYI B;  2ID0 A;  2SOB A;  3PW2 A;  2OWO A;  4OO1 H;  4ZOL F;  3STB D;  2BQU A;  4JI2 Q;  4PG3 A;  5F9N A;  3A7L A;  2RQX A;  1AW7 A;  4ZRZ A;  2CQA A;  5FD6 A;  1A63 A;  4IWY A;  1RD9 D;  1IHZ A;  1KEE A;  4YAJ B;  3FPP A;  1GJX A;  2R92 A;  3RB4 A;  2SEB D;  3G8C A;  3PUW A;  2CHB D;  1VQE A;  2VUM A;  1FJG L;  2GLT A;  2EZV A;  4EBD A;  4C3J B;  4MTN A;  3T5L A;  2GPW A;  4N8X 1;  4QWE A;  2IMW P;  3Q24 A;  4IWX A;  4PZ7 A;  2NVT B;  5KFT A;  2WAQ G;  2YRW A;  4JYA Q;  2A19 A;  2J4X A;  3NP8 A;  1NY4 A;  2OXP A;  5CB4 F;  4HQ6 A;  2QGQ A;  4ZLT F;  4ZQI A;  2A1A A;  2FHT A;  5G3L D;  4JI4 L;  2K7V A;  2NU8 B;  1VQH A;  4N9T A;  2F3V A;  5C3X A;  5IGE A;  3MFG A;  3S1Q H;  1K73 C;  1OTC A;  3W3A A;  1EYD A;  4JI6 L;  3I3C A;  1W6K A;  1Y1W H;  1TS4 A;  1EIH A;  2I5H A;  2K5D A;  3S24 A;  5M5W H;  3H40 A;  2W9C A;  4JC0 A;  2E2H H;  1PZJ D;  1EYZ A;  4LF6 H;  3FMC A;  5IT9 c;  2KEN A;  4JK1 C;  2B63 G;  4LF4 L;  3WNZ A;  4BBR G;  5C5M A;  3GTG B;  4AYB E;  1EYA A;  4KKT A;  2HT1 A;  4IAL A;  5KFX A;  1ZEQ X;  4DR5 L;  4F88 A;  2UXC H;  3D4D A;  3T53 B;  5D3I B;  3NWS A;  4H44 C;  4JV5 L;  4FBU A;  1FYC A;  3RFC A;  3PW5 A;  1H9J A;  1WTO A;  2F0Q A;  2KQ3 A;  1M90 C;  3I4M H;  3S14 H;  2IHF A;  3KXY T;  2QA4 A;  3D3R A;  3KF6 A;  2RGR A;  3TP6 A;  3DHQ A;  1QZH A;  3E5S A;  2YZM A;  1BNC A;  1KAA A;  1PH4 A;  4DUY H;  3TIN A;  4YB8 B;  2JA7 H;  4HMJ A;  1KTK A;  5ELF A;  1VQI A;  3NE5 B;  4DV0 H;  1HR0 L;  4DKA C;  3H0G B;  3OTO H;  4I50 F;  4QJF A;  3BYT B;  4YR3 A;  4A3F H;  5IYZ F;  1P8L A;  3Q2O A;  3I8Z A;  4UPA A;  4B3T L;  2PQA A;  1E1T A;  5DQH A;  2UUC H;  1SYD A;  1TWG H;  1I3Q H;  2W70 A;  4H02 A;  4BWG B;  4JI8 Q;  2I87 A;  4POF A;  2PO4 A;  4AH6 A;  3RB6 A;  3K5M A;  3UDX A;  1LTS D;  3BVG A;  1V9P A;  4K5W A;  3GTP B;  2NUA B;  4ED1 A;  4ECS A;  4HSV A;  1X3P A;  1GM5 A;  4LFA Q;  4ED3 A;  4R8U A;  2W6Z A;  2K75 A;  2A69 D;  4BBS H;  1E4E B;  2WE6 A;  1BBX C;  1I50 H;  4DV3 Q;  4QIW B;  2E2I A;  2PI2 A;  3HEJ A;  4LF8 H;  4DV2 L;  4P75 A;  1TWF A;  1TY0 A;  1TS2 A;  2JEI A;  3C0F B;  4NPS A;  1WTR A;  4RMF A;  1UE1 A;  3NBH B;  1SFO H;  4L5T A;  1UNN C;  3KHH A;  1STG A;  2JA8 G;  2C2D A;  1AE3 A;  2E5L H;  2I8C A;  1K28 A;  1HNZ L;  2HDL A;  1D1I A;  3KLW A;  3J81 E;  4DNI A;  4DR4 Q;  3M4P A;  1A3T A;  1CQV A;  4S3S A;  3GTJ A;  4XQQ A;  2D62 A;  5C4Z A;  3PUV A;  1Y1V G;  4LSX A;  3HOZ H;  4J0M A;  1NSN S;  3KAL A;  3F8N A;  2YS6 A;  2F0L A;  4RNN A;  1XXG A;  4CDF C;  1N34 H;  4WFN 3;  4X65 Q;  4A3I H;  3GTQ B;  2A8V A;  2XN9 C;  5BR8 H;  2LXJ A;  1HZC A;  3M3Y B;  4LF7 H;  3BAB A;  1ZET A;  1RYS A;  4FS2 A;  1PH5 A;  3H4B A;  3U4V A;  1JDB B;  2WAQ E;  3EPI A;  3EIV A;  4ED8 A;  5KKN B;  4CHT B;  1SR3 A;  1S5C D;  4LK1 C;  2HHH Q;  1QZG A;  1RK5 A;  2NB0 A;  3TEH B;  3T1Y L;  3RUP A;  3R5F A;  3PR4 A;  1SE8 A;  2HVQ A;  4C3H G;  1STN A;  3ULL A;  2YTY A;  5IYD G;  1QE6 A;  2L1B A;  2WAC A;  3A74 A;  1EQQ A;  3G6V A;  4DR3 H;  2ASL A;  2NU9 B;  5M5Y B;  1PTO C;  2B2T A;  4AQY H;  3ER0 A;  4DPG A;  5IGD A;  1EIF A;  2F4I A;  3GTO B;  2R93 A;  4YCU A;  3TRE A;  5FO9 B;  3CC2 A;  1JDE A;  3V96 A;  4J6H A;  4DV7 Q;  3GV5 B;  2PQE A;  3RN2 A;  3PW0 A;  4DV0 L;  5KFS A;  3RMH A;  2CW8 A;  3OWE B;  1D2B A;  1E2V A;  3CAM A;  4YHH H;  3AFP A;  2LMC B;  3N43 B;  2R92 G;  3TBI B;  5IGF A;  1R9T H;  1WCM H;  2OQ0 A;  1BBU A;  4IUU A;  5CV7 A;  1AEX A;  1WTH A;  3J80 i;  5IOC A;  2VUM G;  4JUZ A;  4U7C A;  4J9L A;  1M0T A;  2UUC L;  3Q8R B;  2B2W A;  3CW2 C;  2B2Y C;  4X64 L;  2PNH A;  5C0X I;  1SSO A;  5IYB H;  4IUT A;  3JRX A;  3DM3 A;  4DAY A;  4M9U A;  3KHR A;  5KIX A;  1DOK A;  1MGS A;  4NXN Q;  4HCE A;  2JA5 H;  4C56 C;  4RB0 A;  1PV4 A;  1Q81 C;  4QMG A;  2EYH A;  3T5K A;  1HH2 P;  1SDF A;  4WJW A;  2R7N A;  3HKZ A;  2BH2 A;  2G9D A;  1PH8 A;  4HSP A;  4R4C A;  3S15 H;  2FMA A;  3GIP A;  2LSS A;  2J0T D;  3MR6 A;  1WYD A;  2VQE L;  2XGP A;  1M7J A;  2Z6K C;  1N33 L;  1VS0 A;  1B3A A;  3J81 L;  4JYA H;  3E0J A;  5I2Y A;  3BDO A;  2VPS A;  5I9P A;  1SCU B;  1PTO B;  1HCZ A;  3T16 A;  2W8L A;  4GZY C;  1UWV A;  3GTL A;  4DU9 A;  3K5O A;  2E5L L;  2VB3 X;  4A3G G;  3GO5 A;  5C3E G;  5JUM A;  2AQ3 B;  1XNQ Q;  3M9N B;  4DV5 H;  4A3B H;  4FF4 A;  1EU3 A;  1VQN A;  2M05 A;  5A2Q E;  3CF5 A;  2B2U C;  4FP5 D;  2UXB Q;  1GSH A;  1H9S B;  2O4X A;  3PUX A;  4L5R C;  3HOV H;  1N34 L;  1NUC A;  2YU9 B;  3KAK A;  1Z2N X;  5BR8 L;  2ICI A;  5LMN L;  2E2D C;  3MAQ A;  4RKB A;  1KRS A;  4LUO A;  3S1M H;  2J6S A;  4DR7 H;  4ZHQ F;  4KKS A;  1QG7 A;  1DGS A;  4MIU A;  4O4H F;  1JCK B;  4K5V A;  5M5X B;  2IL8 A;  2W9B B;  4DR1 L;  4YR0 A;  1ILQ A;  4RGO S;  4DR3 L;  3GIM A;  1VQ5 A;  2CWA A;  1SYF A;  4YWK A;  4DXG A;  2JA6 A;  2W6P A;  1VQ7 A;  1EY7 A;  4O3O A;  2CWP A;  3CHB D;  1F2Z A;  1STB A;  1E4G T;  2BA1 A;  1CUK A;  1LV9 A;  3OYY A;  4YHH L;  4A3M H;  4O3P A;  5I2X A;  2F0E A;  5IP9 H;  3E5N A;  4JV0 A;  5IT9 L;  4A3K G;  4GKK Q;  1KXL A;  2K28 A;  3TSS A;  4TQS A;  4LW1 A;  1VQC A;  5EWG A;  2UUB H;  1O75 A;  1A3V A;  1Z6H A;  4LUZ A;  3A8K E; 
#chains in the Genus database with same CATH homology
 3NEN A;  4GLX A;  1VQL A;  3T1H Q;  2UXC L;  4YHH Q;  1N36 L;  5JEA G;  1E24 A;  1I5F A;  1N8R C;  3HOW H;  2NVY H;  5JJI A;  1EFW A;  2OCE A;  3HKS A;  3F2D A;  5M3F G;  4X6A H;  4KLK A;  3M85 A;  2KCM A;  1PH2 A;  2JA6 G;  1B70 B;  4YWM A;  4JBM A;  1G29 1;  1K0R A;  4TVA B;  1XJV A;  1GO3 E;  4LF6 Q;  2HQL A;  5IP7 H;  1MIU A;  2YTX A;  4DV4 L;  3DLL A;  4A3M G;  4P71 A;  1WOC A;  2VZA A;  5LMN W;  5IP9 G;  2UXC Q;  1N9W A;  2CFM A;  4IOA A;  1X3G A;  4A3C H;  4DUY L;  3KJO A;  3CCJ A;  2N8N A;  5C0X G;  1IBL L;  1XTD A;  2R7Z H;  2GVA A;  3NEL A;  2YV5 A;  3RLO A;  4QQB X;  4B3M L;  4IO9 A;  4JI5 Q;  1E22 A;  2KHJ A;  4C2M H;  4DV4 Q;  2K5V A;  3OTO L;  4GNX B;  1YHB A;  3HOW G;  2NZO A;  3I2Z A;  3PUY A;  5M3M H;  4X62 L;  2KBN A;  3K7A H;  4DK6 C;  2NZH A;  4P74 A;  5JEA J;  4DUY Q;  1Q82 C;  2I5M X;  2V1C C;  3Q8D A;  1VQK A;  3JAM c;  3WWV A;  3UDG A;  5IP7 G;  4DV5 L;  2I0Q A;  2DGY A;  2GVB A;  4OX9 L;  4A93 H;  4R1J A;  3S1R H;  2HIX A;  3FHW A;  2Q2H A;  1VQP A;  3OTO Q;  4XTC S;  4X62 Q;  4A3C G;  4QY7 A;  3KOJ A;  1Q8K A;  1JT8 A;  3S2D H;  1YHQ A;  1VQD A;  1QVG A;  3K80 C;  1VQM A;  4DV5 Q;  3FKI H;  5IWA L;  1TXY A;  1NTG A;  3CQZ H;  5C0X J;  4OX9 Q;  3EBE A;  1HZB A;  1X3E A;  1CKM A;  5M3M G;  4OO1 I;  4LF9 L;  5FJ8 H;  3AEV A;  3GDE A;  1EQR A;  4DV6 L;  3PF5 A;  1K8G A;  4DR7 L;  4JI3 L;  5GAD C;  4LF8 L;  1OXX K;  2UXD Q;  4OON A;  2XGT A;  4UP7 A;  2Z0S A;  3TQY A;  4JBK A;  3S16 H;  4OWX B;  4A93 G;  1IXR A;  1VCI A;  4IJH A;  2YU9 H;  2WFW A;  4HIK A;  1CKN B;  4LF9 Q;  3G6E A;  1PA6 A;  1VQ8 A;  3UDI A;  2JE6 I;  4YWL A;  3W5O A;  4AYB G;  4JBW A;  4BY1 H;  3GTL H;  4DR7 Q;  3HKZ E;  4JI3 Q;  4LF8 Q;  3RZO H;  3ZJY C;  3J7Z C;  4BXX G;  1JJ2 A;  1WFQ A;  4LFC Q;  3FKI G;  4OXP A;  3PV0 A;  2AKW B;  1SRO A;  1W3S A;  5FJ8 G;  1G51 A;  1PFS A;  1HZ9 A;  1QUQ B;  4UP8 A;  4JI1 L;  3CCS A;  4HJ5 A;  3CP0 A;  1PH6 A;  1I94 L;  2NVX H;  5IE8 A;  2EXD A;  4QIW E;  4GOP A;  1HNW L;  4YCW A;  2Z6K A;  4HJ9 A;  2UUB L;  3PCO B;  4LF7 L;  1JJG A;  3AYH B;  4DAM A;  3AFQ A;  1VQG A;  4HIO A;  1TWA H;  2IT1 A;  1X6O A;  5C44 H;  3CC7 A;  3CCQ A;  4LFA L;  1I6H H;  3MEF A;  1MJC A;  2JJQ A;  1NMF A;  1LTL A;  4PMW A;  4BY1 G;  4JI1 Q;  3I4N H;  1I94 Q;  2YTV A;  3KF6 B;  1PH3 A;  4EX5 A;  4DV3 L;  1XNR L;  3PO3 H;  1VQB A;  1HNW Q;  2RHS B;  4BA1 I;  2UUB Q;  2VNU D;  2VS1 A;  1YEZ A;  1C0A A;  3BU2 A;  5BR8 Q;  4AIM A;  4LF7 Q;  4IPH A;  4LF5 Q;  2BA0 A;  1LUZ A;  3CCM A;  2EQS A;  1EIY B;  4WJ4 A;  3S2H H;  3GTQ H;  2K5N A;  4YCV A;  1KRT A;  3M3Y H;  3S17 H;  4GNX C;  4JOI C;  4AQY L;  1VQ6 A;  2JEB I;  4MZ9 A;  3CPW A;  2UUA Q;  1HZA A;  2K5H A;  5GRO A;  3GTK H;  4BY7 H;  2ZJQ A;  1KD1 C;  1OXS C;  3VDY A;  4KI0 A;  4JI7 L;  3G4S A;  1XNR Q;  4WJ3 M;  2B29 A;  1UE7 A;  1VQF A;  4Y52 H;  5C44 G;  3KYH C;  5ELO A;  1FL0 A;  1SLJ A;  1LM0 A;  2PQA B;  4LNQ A;  1KAW A;  3I7F A;  4AQY Q;  1VQO A;  3I4N G;  2E2J H;  3A5Z B;  3PO3 G;  4KHZ A;  4X66 L;  1AH9 A;  3BZC A;  2VY3 A;  5M5Y H;  3J81 c;  4JI7 Q;  1YIJ A;  4JI2 L;  2OTJ A;  1L0W A;  2ZM6 L;  1LYL A;  3HOX H;  1KC8 C;  3TS2 A;  3IRB A;  1D7Q A;  3J7A 5;  3RNU A;  2CKZ B;  3BZK A;  1SN8 A;  4IPG A;  3PUZ A;  1Q1E A;  1TWC H;  5IYC H;  4FDB A;  4GKJ Q;  4GNX A;  4JOI A;  2HIV A;  1XPR A;  4HJA A;  1PH9 A;  3F1Z A;  1K3R A;  4BY7 G;  4GN4 B;  4X66 Q;  2NN6 G;  2ID0 A;  1IBM L;  2MQH A;  5H1S E;  3STB D;  2OWO A;  1CKO A;  4J15 A;  4JI2 Q;  1TWH H;  1T9H A;  4PG3 A;  2ZM6 Q;  3CD6 A;  3BJU A;  4PZ6 A;  2HHH L;  1BKB A;  2CQO A;  1N36 Q;  2ALY B;  1L1O B;  3LGJ A;  5DLQ E;  1YBY A;  1PH1 A;  1A63 A;  5GAE C;  1E1O A;  1JJC B;  2JK8 A;  3SGI A;  1K9M C;  1IBM Q;  3UDF A;  4JYA L;  2R92 H;  1ASY A;  3PUW A;  5IYC G;  2BH8 A;  1G6P A;  2NN6 I;  1VQE A;  1FJG L;  3CPF A;  2YYZ A;  4DR6 L;  4MTN A;  4DV7 L;  1GKH A;  1S72 A;  4B3R L;  2B63 H;  4BBR H;  1EYG A;  4OO1 G;  4QGU A;  4JI0 L;  5IY0 A;  1O7I A;  2MO0 A;  4PZ7 A;  2IX0 A;  1IBL Q;  2CCZ A;  4LFB L;  2WAQ G;  2AHO B;  3UE0 A;  4JYA Q;  2A19 A;  2VQF L;  4B3M Q;  1NY4 A;  3CXC A;  2QGQ A;  3M9B A;  2Y0S G;  2A1A A;  2KHI A;  1S3O A;  1UE5 A;  1JMC A;  3U50 C;  1OXU A;  4JI4 L;  2UU9 L;  1VQH A;  1FJG Q;  2XTI A;  4DR6 Q;  1KHI A;  1CKN A;  1L2F A;  1YZ6 A;  4OWW B;  2K50 A;  3S1Q H;  3J81 i;  1KQS A;  1EOV A;  1K73 C;  4POG A;  4JI0 Q;  1OTC A;  2R7Z G;  4LFB Q;  3I56 A;  1B8A A;  4A75 A;  1MKH A;  2VQF Q;  1Y1W H;  4JI6 L;  2I5H A;  5M5W H;  4GN5 A;  3S24 A;  3L2P A;  4JC0 A;  2E2H H;  3CCE A;  5C4J H;  2RHQ B;  5IT9 c;  2KEN A;  2B63 G;  1QUQ A;  3FP9 A;  4BBR G;  4LF4 L;  3PO2 H;  1XMO L;  1W2B A;  1X56 A;  4AYB E;  2HT1 A;  4O0A A;  5E7N A;  4DR5 L;  1NBW A;  2AWO A;  3E0E A;  4JI6 Q;  5IWA Q;  2VW9 A;  3GD7 A;  5C4X H;  3PGZ A;  4HID A;  4JV5 L;  1PVO A;  4DV1 L;  1U5K A;  1Y14 B;  3I4O A;  4DV6 Q;  1S40 A;  2WP8 J;  1QVF A;  3S14 H;  3K81 C;  1M90 C;  1BBW A;  2IHF A;  3E9H A;  4LF4 Q;  3I4M H;  1XMO Q;  5AJ3 L;  2QA4 A;  2F52 A;  3KF6 A;  2AMC B;  4DR5 Q;  1QZH A;  1Y1W G;  3ERS X;  2FXQ A;  1PH4 A;  4OWT B;  1YI2 A;  1BVS A;  3EN2 A;  2JA7 H;  4JV5 Q;  5M5X H;  4DV1 Q;  1HNX L;  1VQI A;  2QEX A;  5GAH C;  2IHE A;  2ZTD A;  2PMZ E;  3PO2 G;  1HR0 L;  4DKA C;  5AJ3 Q;  1JE5 A;  4JI8 L;  4QJF A;  1NE3 A;  5GQO A;  2F4V L;  3AQQ A;  1X9N A;  1OXT A;  3F2C A;  4A3F H;  4DAY B;  4DK3 C;  5C4X G;  1P8L A;  4UPA A;  1RIP A;  4A3J H;  1JB7 A;  2PQA A;  1E1T A;  1HNX Q;  1L1O C;  4APV A;  1Q1B A;  4R4O A;  4B3T L;  1TWG H;  3D0F A;  4L5Q A;  2MNA A;  1HR0 Q;  1I3Q H;  4DR2 L;  1A8V A;  4H02 A;  4JI8 Q;  2JA8 H;  4POF A;  2F4V Q;  2ZTC A;  4AH6 A;  5GAG C;  1XPO A;  1Q12 A;  1YNX A;  3UDX A;  2JA7 G;  1V9P A;  1CSQ A;  1IL2 A;  3H3V I;  3HFZ B;  3CCU A;  1GM5 A;  4LFA Q;  2ES2 A;  2K75 A;  4B3T Q;  4BBS H;  2MFI A;  1GD7 A;  2IY5 B;  1SRU A;  4ALP A;  3A5U A;  5EAY A;  1I50 H;  4DV3 Q;  3ULJ A;  4R4T A;  4DR2 Q;  4C3I H;  3HOU H;  4RG1 A;  1PYB A;  2PI2 A;  4A3F G;  4TQU S;  1Y1V H;  1OXV A;  4DV2 L;  2JQO A;  4P75 A;  2ASB A;  4GN3 B;  1E3P A;  4A3J G;  4NPS A;  1SFO H;  4RMF A;  1UE1 A;  1TWF H;  3NBH B;  4L5T A;  5FLX c;  1Q86 C;  4DR4 L;  5K36 G;  1L1O A;  2RF4 A;  4UP9 A;  5JJK A;  2Q2U A;  2JA8 G;  1C9O A;  2F3I A;  1AE3 A;  4R4Q A;  4BA2 I;  1U0L A;  4A4I A;  4IOC A;  4EQ5 A;  1HNZ L;  4DV2 Q;  4X65 L;  4A3D H;  2D0O A;  1VQ4 A;  3KLW A;  3J80 c;  4DNI A;  4DR4 Q;  3G48 A;  3M4P A;  3M4O H;  4C3H H;  3GTO H;  3HOU G;  3I4M G;  5IYD H;  2B3G A;  2D62 A;  4P73 A;  4C3J H;  3G71 A;  3M7N A;  2K4K A;  3PUV A;  1Y1V G;  3GTJ H;  3ICE A;  3HOZ H;  2ZJR A;  1P16 A;  2D0P A;  2NVT H;  2R6G A;  1HNZ Q;  4X65 Q;  2C35 B;  4A3I H;  2A8V A;  2LXJ A;  1HZC A;  2JA9 A;  4L5S A;  3GTM H;  2MO1 A;  4A3E H;  3H15 A;  1YHA A;  1PH5 A;  4R4I A;  3W1B A;  2NVQ H;  3U4V A;  3HOX G;  2H5X A;  3D31 A;  4HIM A;  4PZ8 A;  2WAQ E;  5FLM H;  3EIV A;  2GN5 A;  1SR3 A;  3U58 A;  3OW2 A;  1J5E L;  1QZG A;  2Y0S E;  1X55 A;  4IJL A;  2HHH Q;  4A3D G;  3TEH B;  3T1Y L;  4LUV A;  3RN5 A;  2VUM H;  1SE8 A;  4K0K L;  1B7Y B;  4JI5 L;  4Y7N H;  3ULL A;  1VQA A;  2YTY A;  5IYD G;  3A74 A;  1EQQ A;  3UE1 A;  1IYJ B;  1XMQ L;  4A3L H;  4MNO A;  3HOZ G;  3ER0 A;  2L15 A;  2R7D A;  4DPG A;  2WB1 E;  1EIF A;  3GTG H;  2AWN A;  3STB C;  4YCU A;  3TRE A;  4A3I G;  1J5E Q;  3CC2 A;  3KF8 B;  1CSP A;  4NXM L;  1EUJ A;  2Q2T A;  3T1Y Q;  2R93 H;  4DV7 Q;  4A3E G;  2K14 A;  3RN2 A;  4K0K Q;  4DV0 L;  2LXK A;  4B3R Q;  1K8A C;  3CAM A;  4IPC A;  3AFP A;  4ME3 A;  2WB1 G;  1XMQ Q;  2R92 G;  5FLM G;  1MJE A;  1R9T H;  1WCM H;  3M4Q A;  2OQ0 A;  1BBU A;  1VQJ A;  2JEA I;  3I55 A;  4NXN L;  4JI4 Q;  1J6Q A;  4NXM Q;  3KJP A;  3J80 i;  5J3B A;  2UU9 Q;  2VUM G;  3TRZ A;  1IBK L;  2UUC L;  3CW2 C;  4DV0 Q;  1Q7Y C;  4X64 L;  4DUZ L;  2PNH A;  4A3L G;  3H3V H;  4GLV B;  3U4Z A;  5C0X I;  3S1N H;  5HGQ A;  5IYB H;  3H0G H;  3L0O A;  4JG2 A;  3DM3 A;  5C3E H;  4A3G H;  2UXD L;  2VL6 A;  1YVC A;  4NXN Q;  3HOY H;  5HY6 A;  2JA5 H;  4BXX H;  2R93 G;  1UEB A;  1PV4 A;  1UE6 A;  4GS3 A;  1Q81 C;  1PYS B;  1IBK Q;  2UUC Q;  1HH2 P;  2N3S A;  4X64 Q;  3RR5 A;  4DUZ Q;  3KDF A;  4O2D A;  3CMA A;  1FGU A;  2R7F A;  1YJ9 A;  2I5L X;  4YY3 L;  1AE2 A;  1WCM G;  1PH7 A;  1PH8 A;  2BH2 A;  1X3F A;  4R4C A;  2K52 A;  1XNQ L;  3S15 H;  2ATW A;  2LSS A;  4GLA C;  4UY8 C;  1WYD A;  4B3S L;  4IFD G;  4GOP C;  1X54 A;  2VQE L;  3CCL A;  2Z6K C;  4KHP L;  4LFC L;  1VS0 A;  2ZJP A;  1N33 L;  1FVI A;  3GTP H;  1YIT A;  1KL9 A;  3CME A;  3L7Z C;  3J81 j;  3K7U C;  1M1K C;  1A62 A;  4JCV E;  1UWV A;  3TS0 A;  3CC4 A;  1D8L A;  4YY3 Q;  5IYB G;  3H0G G;  2E5L L;  2UXB L;  5LMU L;  4A3G G;  3GO5 A;  5C3E G;  1XNQ Q;  3PIP A;  2DUD A;  4B3S Q;  2JA5 G;  3HOY G;  4KHP Q;  2VQE Q;  5ELN A;  1IZ6 A;  1N33 Q;  4A3B H;  4A76 A;  3KDF B;  1Z9F A;  4QL5 A;  3RLF A;  4IFD I;  2OTL A;  1ASZ A;  1VQN A;  4HJ8 A;  1N32 L;  2N78 A;  2Q2I A;  2E8G A;  3CF5 A;  2UXB Q;  1RL2 A;  3HKZ G;  2E5L Q;  5LMU Q;  1H95 A;  3PUX A;  4L5R C;  3W1G A;  1YJN A;  1GVP A;  1E7Z A;  3HOV H;  1N34 L;  3PF4 A;  3JAM i;  1X65 A;  1Z47 A;  1WJJ A;  1K83 H;  5BR8 L;  4LF5 L;  4IFD J;  1EWI A;  4NB3 A;  3B6Y A;  5LMN L;  2RCN A;  1N32 Q;  3ULP A;  3PIO A;  3F2B A;  1YJW A;  1KRS A;  4LUO A;  4P72 A;  2E2I H;  2UUA L;  3JC6 6;  3S1M H;  1V43 A;  1WI5 A;  3NEM A;  4IPD A;  4A3K H;  1NMG A;  1HJP A;  1DGS A;  4XIG S;  1N34 Q;  1Q46 A;  4A3B G;  3A0J A;  3K8A A;  4DR1 L;  5JJL A;  5LMN Q;  3CCV A;  1NJI C;  4DR3 L;  1A0I A;  1VQ5 A;  2IX1 A;  4GKK L;  2CWA A;  3K0X A;  4YWK A;  3CCR A;  2OQK A;  4JBJ A;  5M3F H;  4GOP B;  2PI2 E;  1QVC A;  1PHJ A;  1VQ7 A;  3HOV G;  2CWP A;  2JA6 H;  4BBS G;  2KCT A;  1VQ9 A;  4HJ7 A;  4LWC A;  1C7Y A;  4DR1 Q;  3T1H L;  2N49 A;  1HR0 W;  3KFU A;  2BA1 A;  1CUK A;  3OYY A;  4YHH L;  2ZTE A;  4A3M H;  4GKJ L;  4DR3 Q;  5IP9 H;  1XPU A;  3PSI A;  4A3K G;  4GKK Q;  3F8T A;  1KXL A;  1SMX A;  2EIF A;  4LW1 A;  1VQC A;  3E9I A;  3RLN A;  3RZD H;  1V1Q A;  4LF6 L;  4LUZ A;  1KIX A;  3MXN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...