4A3DG

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3dG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3dG01
1I5FA 3HOYH 3S1NH 5GROA 1CSPA 1EFWA 2I0QA 1GVPA 1QVCA 2BH8A 3BU2A 1L0WA 3SGIA 2VQEL 5FJ8G 2HHHQ 4DR7L 1XTDA 2VNUD 2VUMH 3S15H 2GVBA 5GAGC 5FLMG 3CF5A 2QA4A 2Z6KC 1X9NA 4DV4Q 4IPDA 2Q2IA 1YBYA 4C3JH 4C3HH 5LMUL 4A3GH 3PIOA 1OXVA 2CWAA 4A3BG 2UXDL 3OYYA 1IBMQ 1IBKL 3U58A 4YHHQ 3F2BA 4DR5Q 2NN6G 4A3KH 4LF4Q 1HZBA 3HOYG 2JQOA 4LFAL 1CSQA 1J6QA 5C0XJ 2RF4A 4A93G 2D0OA 4GLAC 2ALYB 4DV4L 1Q81C 3HOXH 4JI4Q 2ASBA 4J15A 1JMCA 1RL2A 4YCUA 4ME3A 1SRUA 4EX5A 4AH6A 1N34L 2VQEQ 2HHHL 3I2ZA 3LGJA 1QUQA 3JC66 1NJIC 1K9MC 1N33Q 4GKJQ 4PZ7A 2WAQG 5ELNA 4GS3A 3HKSA 3CCRA 3Q8DA 3NELA 1NY4A 3M4QA 4DV5L 5M5YH 3K81C 3NENA 2Y0SG 4P71A 3M9BA 2AWNA 4A3IG 3PO2H 4HIKA 1PFSA 3L7ZC 3NBHB 4A3MH 5M3FH 1VCIA 3EBEA 2R7ZG 3UE0A 4OWTB 2K50A 3ZJYC 2WAQE 4B3TL 4JI5L 1HZ9A 1U5KA 1XNQQ 2K52A 1FVIA 4QY7A 1N8RC 3PO3H 3E9HA 4A3JG 1AE2A 1J5EL 4GLVB 4JG2A 1WYDA 5EAYA 1LTLA 3PUXA 4IFDI 2QEXA 3DLLA 5M5WH 1XNRQ 3TS0A 5AJ3Q 2ZJRA 5LMNW 2JA8H 3GTOH 2H5XA 4JYAQ 2E5LL 4JV5L 1XMOL 1JJ2A 3U4ZA 4QQBX 2CFMA 3K7UC 2I5HA 4QIWE 2UXBL 4A75A 4DKAC 1EUJA 4A3JH 4NXMQ 4RG1A 3A5UA 1PH9A 3M85A 1CKMA 1YHAA 3GTKH 2N49A 1RIPA 1Y1VG 5M3MG 4BXXH 4LFCQ 3HOXG 3HOWH 2A1AA 1QZGA 2CCZA 1BBWA 2ZJQA 1EQRA 2IT1A 1Q8KA 4OX9L 1VS0A 2IX0A 3E0EA 1BVSA 3GTPH 3HOVG 1L1OC 4UP7A 3BZKA 5GAEC 1A8VA 4YHHL 5IY0A 2E8GA 1C0AA 5LMNL 4JI0L 2B63G 1Q46A 4DUYL 5C4XH 4YY3Q 1K83H 4A3GG 2OCEA 3S1RH 4BY1H 1Q7YC 1YHQA 3T1YQ 3AQQA 3M3YH 3S17H 1P16A 2WB1E 3CPFA 1PYSB 2R7DA 4DR6Q 2N3SA 1NMGA 4POFA 4A3EG 1VQBA 3KJPA 4OO1I 1SROA 3TREA 1MJEA 4LFBL 4DR4L 2JA5H 3RLFA 3KF6A 1E1OA 3GTGH 4JYAL 2AKWB 3GD7A 1C9OA 2AMCB 4DV1Q 4JI8L 4IFDJ 4A3LH 2NVYH 2ZM6Q 5BR8L 5DLQE 5FJ8H 1VQPA 1QVFA 1SN8A 4X64Q 1EIYB 2CKZB 2IHFA 1YI2A 3AEVA 1I94L 4DUZQ 2PQAA 4R4CA 5JEAG 5IP7H 4K0KL 3RZDH 2C35B 2UUAQ 1X55A 3EIVA 1L2FA 4A4IA 1Y1VH 4B3RQ 1MKHA 2I5MX 2JA5G 1X3FA 4JOIA 1O7IA 4PMWA 4DR2L 4DR3L 1G291 2UU9L 4B3ML 3F2DA 1Q1BA 3K7AH 4XTCS 4P75A 1B70B 5C3EG 3RR5A 4NXNQ 2FXQA 1HZCA 1HNWQ 1JJCB 1PH1A 1JJGA 1UWVA 1X56A 3HKZG 1N34Q 4WJ3M 4R4QA 1HNXQ 4DR3Q 2UU9Q 3JAMi 3K0XA 1KRTA 4B3MQ 4JI0Q 3M4OH 1Y14B 2YTXA 4IOAA 1GM5A 1WFQA 3FHWA 4R4TA 3S24A 1Z47A 2ES2A 3HOZG 2HQLA 5C0XI 4HJ7A 4L5SA 4B3RL 1FL0A 3GDEA 2UXCQ 4B3SQ 2ID0A 1FJGL 3CMEA 3CCQA 1IBML 4LF7Q 2VL6A 4JI7L 3M4PA 2NZHA 1OTCA 2PQAB 3U50C 5IYDH 2NVTH 4DV2L 4JI6Q 2Z6KA 3KYHC 1VQ4A 3G71A 3RZOH 1CKNA 4X62L 1K8AC 5JJKA 1QVGA 3TQYA 3S14H 3KDFB 1YIJA 1YJ9A 5JJIA 3PUYA 4XIGS 3PIPA 5GADC 3I56A 1OXUA 3STBD 3J81i 1IBLL 3H0GH 1TXYA 3PUZA 1HH2P 4BBSH 4HJ8A 3UDGA 2L15A 2F52A 1KXLA 5IWAL 2JA7H 2ZJPA 1V43A 5E7NA 1VQEA 1SMXA 2K4KA 4QL5A 3H0GG 4HJAA 1WJJA 3W5OA 1YHBA 1QZHA 1E1TA 2UUAL 4GOPA 2JA8G 4JBJA 1PYBA 4MTNA 1EQQA 4L5QA 4YWLA 4A93H 1K8GA 2F4VL 4R4OA 1UE7A 2KCTA 1VQGA 4DV7Q 1N36L 4B3TQ 4X62Q 1PVOA 3RN2A 1OXXK 2ZTEA 1TWGH 1SFOH 3W1GA 1OXSC 1EIFA 1SE8A 4JBKA 4A3BH 4AQYQ 4A3CG 4DV5Q 2R93G 4OX9Q 3HOZH 2F3IA 4A3IH 4LUZA 4P74A 3PO2G 4OONA 3DM3A 2OWOA 2VUMG 1FGUA 2IHEA 3H15A 2MO1A 3BZCA 2I5LX 3PSIA 1Y1WH 1VQ7A 1X65A 1YITA 1KQSA 3H3VH 3S2HH 4TQUS 4NXNL 3AFPA 4GNXB 3J80c 3T1YL 2MFIA 1HNWL 2XTIA 2RHQB 4OXPA 4KLKA 2HT1A 2IX1A 1VQMA 2V1CC 2UUBL 3ICEA 2VZAA 1OXTA 4L5RC 3CC4A 4OO1G 4HIOA 1XMOQ 5IP7G 1CUKA 2K5HA 4DR5L 3OTOL 3PF5A 3NEMA 2E2HH 4UPAA 1PH8A 3PV0A 4IOCA 2KBNA 3S16H 1KRSA 3UDXA 4DUZL 3S1QH 4A3EH 1X54A 3AFQA 1GKHA 5C44G 5JJLA 4AQYL 4DV3Q 2ATWA 1AH9A 1PHJA 3L2PA 2BA0A 3UDIA 5IYCG 2HIXA 3PCOB 4LFCL 2ZM6L 4LUOA 2K5VA 4LNQA 3HOUH 2B29A 2MO0A 1HJPA 4PG3A 1A63A 3F8TA 4PZ6A 4DV6Q 1E24A 1PH3A 1TWHH 4LF5Q 1YZ6A 3PUVA 4A3CH 4KHPQ 1BBUA 5IYCH 4R4IA 3KF6B 4BA1I 1EOVA 4AYBG 4NPSA 4YWMA 4GNXA 5IYBG 1G6PA 4GKJL 1HR0Q 1X3EA 1NTGA 4LF9L 2JJQA 2AHOB 4DV6L 5IWAQ 3CC7A 2NN6I 1W2BA 1EYGA 1D7QA 4FDBA 1D8LA 1WI5A 1Q12A 4LWCA 1XMQQ 1KL9A 2JA6G 1VQDA 4DK6C 5HGQA 1IBLQ 4GN4B 4DR6L 5C4XG 1XPUA 1VQJA 1B8AA 2CQOA 1NE3A 3AYHB 4O0AA 1K3RA 1N36Q 4OWWB 2B63H 4A3DH 4DV7L 4JI3L 3CCJA 2F4VQ 4LF6Q 3GTQH 2YV5A 4JI1Q 1VQLA 3I4OA 4DK3C 2UUCQ 4JI5Q 1I6HH 4HJ9A 1LUZA 2LXJA 5H1SE 1S40A 1KD1C 1IBKQ 4JI7Q 1BKBA 4LF7L 4BXXG 1JE5A 4JBWA 2GN5A 1FJGQ 3RN5A 1VQKA 3CCUA 1NMFA 4HIMA 4QJFA 4DR1L 1N33L 3W1BA 3B6YA 1JB7A 2R93H 4WJ4A 2Z0SA 1XMQL 4ALPA 1ASZA 3RNUA 4LF8Q 3UDFA 1PH5A 4EQ5A 4DPGA 4DR7Q 4MNOA 1LM0A 2KENA 4HJ5A 3KOJA 1Q82C 4IJHA 3CP0A 2DGYA 2B3GA 1VQOA 3TRZA 2K14A 3CCVA 2K75A 3L0OA 2OTLA 4A76A 3I55A 2NVQH 4Y52H 3TEHB 1KIXA 1UE1A 2EIFA 1M1KC 4R1JA 4B3SL 2JA9A 1A0IA 2WP8J 4BBRH 3GTJH 3CC2A 1AE3A 4K0KQ 4P72A 1I94Q 2KHIA 1S3OA 5IP9H 1MIUA 2MQHA 3ULLA 3JAMc 4H02A 5M3FG 4DV3L 1XNQL 4MZ9A 1V9PA 2JA6H 2ZTCA 3G48A 2JK8A 3CAMA 1PA6A 2PI2E 1KC8C 5M3MH 1V1QA 1YJNA 2QGQA 3ULJA 4X66L 3J81j 3F1ZA 4YCVA 2KCMA 2NZOA 3PGZA 4GN5A 1HR0L 2IY5B 1KHIA 3KLWA 4P73A 5GAHC 4A3LG 3K80C 1VQFA 4DV0Q 1PH4A 1TWFH 5C4JH 2DUDA 1M90C 3HOUG 1N32L 4IPGA 4AIMA 4JI4L 2OQKA 2YYZA 3CXCA 4C3IH 4KI0A 2VQFQ 3OW2A 4TVAB 3MEFA 1ASYA 1HZAA 1SR3A 2XGTA 3GO5A 2YTVA 4JCVE 4JI8Q 1G51A 5IYBH 5C3EH 1C7YA 2N8NA 3ER0A 1HNZQ 1DGSA 3BJUA 2GVAA 4AYBE 5LMNQ 4GKKQ 1PH2A 4GOPB 2R7ZH 1MJCA 2YTYA 4YWKA 2LSSA 5FLMH 4QGUA 1WCMH 4L5TA 4C2MH 1TWCH 2UUBQ 2PMZE 2YU9H 3WWVA 4X65Q 4DR1Q 3HOVH 1YNXA 1PH7A 5C44H 4A3FG 1XPOA 3CCLA 4NXML 4LF8L 3I4MG 1W3SA 1JT8A 4UP8A 4YY3L 1U0LA 4LUVA 1L1OB 3D0FA 2CWPA 1IL2A 3I4NH 1K73C 4JI2L 1WCMG 2A19A 3FKIG 1EWIA 5IT9c 2R7FA 1XNRL 2UXBQ 3U4VA 3CMAA 4GKKL 4JI1L 2UUCL 1YVCA 3I7FA 1HNZL 1XJVA 2EQSA 2E5LQ 4JV5Q 1E7ZA 2MNAA 4JBMA 2Q2TA 3I4MH 1Y1WG 4O2DA 4IPHA 3G6EA 1R9TH 4BA2I 3K8AA 1NBWA 3KJOA 4DAYB 4GLXA 2RHSB 4DV2Q 4JI6L 2Q2HA 3HFZB 3ERSX 2R92H 2KHJA 1PV4A 1UE6A 2OQ0A 3EN2A 1VQ6A 4DV0L 1HR0W 4LF9Q 4BY7G 1Z9FA 1X6OA 1QUQB 1I50H 3KF8B 3OTOQ 4GOPC 2AWOA 1S72A 4KHPL 4X66Q 1VQCA 2R6GA 3MXNB 3IRBA 3CW2C 1VQIA 1HNXL 3D31A 1L1OA 4DNIA 4OWXB 4JC0A 2E2IH 1LYLA 3S1MH 4GN3B 4IPCA 1E22A 2WB1G 4PZ8A 1VQ9A 4JI3Q 2Q2UA 4LF5L 4BY1G 1X3GA 1J5EQ 1YJWA 4DR2Q 2E2JH 2N78A 3A5ZB 3A74A 5J3BA 4GNXC 1VQHA 5BR8Q 4Y7NH 3VDYA 1GD7A 1VQAA 4DV1L 2ZTDA 4LF4L 2Y0SE 4RMFA 1CKNB 5C0XG 2LXKA 3CPWA 4POGA 2OTJA 5HY6A 3J7ZC 4KHZA 4LFAQ 3GTLH 1KAWA 2JEAI 5GQOA 4DAMA 1VQNA 1GO3E 3KFUA 4LFBQ 2VS1A 4X64L 4NB3A 3J80i 3FP9A 2HIVA 3RLNA 1WOCA 4JI2Q 2D0PA 5M5XH 1XPRA 1TWAH 5K36G 3HOWG 1PH6A 3F2CA 2EXDA 2UXDQ 5IYDG 5IP9G 2R92G 4A3KG 5ELOA 3CD6A 2VW9A 4X65L 4YCWA 3PO3G 3PUWA 3J7A5 3ULPA 4BBRG 4APVA 3CCSA 1Q1EA 1A62A 1CKOA 3TS2A 4LW1A 3CCEA 1N9WA 4BY7H 3KDFA 1YEZA 3PF4A 4UY8C 1UEBA 2JE6I 2PI2A 2RCNA 3A0JA 4UP9A 3STBC 5AJ3L 2D62A 3J81c 5JEAJ 3H3VI 3E9IA 2PNHA 4IJLA 1VQ8A 1SLJA 4LF6L 1I3QH 1K0RA 1Q86C 3CQZH 5IE8A 3T1HL 1IXRA 4IO9A 3HKZE 2WFWA 1IYJB 2VY3A 4JOIC 2K5NA 3M7NA 3G4SA 4A3FH 1E3PA 4DUYQ 2A8VA 2JA7G 5LMUQ 2BA1A 1IZ6A 4IFDG 3RLOA 2VQFL 1H95A 2JEBI 1UE5A 1VQ5A 3S2DH 4BBSG 1N32Q 4X6AH 4A3DG 1P8LA 5FLXc 4A3MG 4HIDA 3FKIH 3UE1A 3T1HQ 1B7YB 3GTMH 3I4NG 1T9HA 2BH2A 2NVXH 2UXCL 4DR4Q 3CCMA
chains in the Genus database with same CATH superfamily
1I5FA 2CQAA 5GROA 1F9PA 2I0QA 1B6RA 3SGIA 2K03A 2OEOA 3S15H 5L1LA 2GVBA 5GAGC 5FLMG 3CF5A 1IBMH 2X69A 4KKTA 2MHVA 4IPDA 4C3JH 4GZYC 5FD6A 3OSOA 2F0JA 1OXVA 2CWAA 2VUGA 5CC4A 4DUYH 1BNZA 2CH4W 1IBKL 2UUBH 2AGQA 4DR5Q 2NN6G 5EWEA 1O78A 5C0XJ 1TWGA 3C46A 4ED0A 1LABA 4J15A 3BZDB 4EGVA 2DY8A 4ME3A 1SRUA 3FMCA 2VQEQ 1XWEA 2NVXB 2Y0SB 5KG6A 3LGJA 4A3IB 1K9MC 4IFDH 2LS01 1N33Q 1I3QA 3MFIA 4IRDA 5KG0A 4DR4H 1R9TA 4EGJA 4GS3A 3NELA 5FO7B 4DV5L 2E76C 2O5JC 3NENA 2PCFB 3M9BA 2AWNA 1GSOA 1AW7A 1PFSA 4U68A 4HIKA 5IT9E 5M3FH 1T5XD 1U5KA 3WOEA 2E2JB 4DAPA 1CTMA 2K7VA 4X3SA 3E9HA 4A3JG 3KK7A 2SOBA 4GLVB 3H20A 3G7LA 1AFPA 3PUXA 3DLLA 3T5LA 3GTJA 1BXRA 4K6DA 3TS0A 2WB1B 5I6YA 3GTOH 4QW9A 2E5LL 4JV5L 1XMOL 2YS6A 1WTQA 3WDNA 3FEWX 4A75A 4DKAC 1EUJA 3M4IA 4RG1A 1PH9A 5KFEA 3R2IA 4BS9A 1YHAA 2JA5B 3GTKH 3FRPB 4JI7H 2W6MA 4LFCQ 2A1AA 1QZGA 1LT4D 2G9HD 3RV3A 4FS1A 1QJOA 2CCZA 1SMYC 3J80E 3S2DB 4ZRZA 2W7OA 1RDPD 2IX0A 1BVSA 3GTPH 4J9LA 2FJ2A 3HOVG 4IR9A 2MPMA 3BZKA 4RHSA 1LTRD 5GAEC 3K58A 4YBZB 5LMNL 3PW5A 4BBSB 4JI0L 1CK1A 4LH6A 1Q46A 3N43B 2BR0A 1K83H 4HAEA 4RFBA 3R5FA 2CVRA 3S1RH 1MGSA 1YHQA 2M9VA 3T1YQ 3M3YH 3QWNA 1B9NA 1KLUD 3K6OA 3BA8A 4RB3C 4OO1I 1MJEA 2M00A 1U4LA 3LMLA 4OIKA 4A3FB 3KF6A 5C3WA 3L4KA 4DV2H 5D1OB 3RFCA 1I6VC 1O7LA 1QVFA 3RF2A 2PNRC 1UC8A 1K28A 4H44C 5IGEA 1DOKA 2F0NA 2IHFA 3QG1A 4X64Q 4A93B 1I94L 3PW2A 1HNZH 4G7ZC 4L63B 4DUZQ 4K0KL 2UXBH 4DK1A 2UUAQ 4DV1H 5KG3A 3X3MA 5C4JB 3O13A 5T1IA 5KG5A 5LL6S 4B3RQ 1MKHA 2W9BB 3M9MB 3QOLA 1O7IA 2EY2A 2ICEC 4PMWA 2UU9L 4B3ML 4EYIB 3F2DA 1Q1BA 3GTLB 3K7AH 4XTCS 1QOHA 4P75A 5L37A 5C3EG 1U4MA 4NXNQ 4UCOA 2AQ1B 1JJGA 3GIDA 5T14A 1UWVA 4B9WA 3J80L 4MV3A 4EYHB 1HNXQ 4DR3Q 3JAMi 3KLRA 2YTXA 2FB9A 1WFQA 2IL8A 3FHWA 3GV3A 4R4TA 3S24A 2ES2A 2HQLA 3HOZG 2L9HA 1FL0A 2ID0A 5KFPA 5FK9C 1JIHA 2JEFA 4JI7L 2V4DA 3GV5B 2RQXA 2PQAB 3U50C 2WKDA 5G3LD 5IYDH 4DV2L 3TQ1A 2Z6KA 2KECA 3G71A 2DWCA 4X62L 1K8AC 2F0WA 3H3VC 1LT3D 3PIPA 4ZLTF 1FNUA 4LFCH 1SCUB 1W6JA 1CE8A 1TAEA 1BDOA 1ZYRC 1F9SA 4C3JB 1E4EB 5JVG3 1VQEA 1V4YA 2R7LA 4QL5A 4HJAA 2HVRA 1A3TA 2K1BA 1E1TA 3GV6A 2F0QA 3NWTA 4GOPA 3PO3B 5BPHA 4NW2A 5EPJA 1C8CA 1EQQA 4L5QA 1VBHA 1ZETA 1D5ZC 1E2WA 3NTIA 4YR3A 4EEQA 1PRTB 1G2SA 4IUQA 1OXXK 2A69D 1SFOH 3W1GA 4A3CG 2NVQB 4A3BH 1XMQH 2NBFA 4M8AA 5C4ZA 4OX9Q 3HOZH 1I7NA 1TWHB 1TY2A 5EWFA 1HR0H 2B2VC 1SYDA 3DM3A 1FGUA 2EYMA 3H15A 4I50F 1KNEA 2J4XA 2MO1A 3OWEB 4IN3A 3RB0A 1RTNA 2EDGA 1IOWA 4CGYB 2F0DA 1EWCA 4TQUS 3GV8B 4NXNL 3AFPA 4N9PA 4PNYA 5I2YA 1KTKA 4IUPA 4MAMA 3T5JA 4OL7A 2UUBL 2FMMA 3FPUB 1QCBD 3SR1A 3GTLA 4F4YA 2K5HA 4R8IA 3OTOL 2JXMB 3R93A 5D3DA 1PH8A 2HJWA 1PXUA 5M5WB 1QWYA 3UDXA 4DUZL 3S1QH 4ZOLF 2DPJA 4BY1B 4ZUJA 4AQYL 3BG3A 3HBLA 4YP3A 2F0OA 1D5XC 4FXDA 1Z2PX 4HNTA 3UDIA 4O3QA 3PCOB 2BQ3A 1UNNC 4LNQA 3HOUH 2B29A 4PG3A 5HV6A 2O4XA 4PZ6A 1PH3A 4LF5Q 1SNCA 4A3CH 4RZRA 3NBHA 1XXGA 4UDUC 4R4IA 2B2YA 1LT5D 3MAQA 3PIO3 3J81W 2EY6A 4GNXA 1I4RA 2XGPA 1VBGA 4GKJL 4ED6A 4MN3A 4O2AF 1RJPA 1J9OA 1W2BA 3DM1A 3RV4A 4FDBA 1B04A 2E2DC 1EU3A 3E5NA 1CHQD 3T16A 1IBLQ 1IL8A 1TWGB 3TMEA 2AQ4A 1VQJA 1B8AA 2CQOA 5ELCA 1N36Q 1EU4A 2FINB 3GQBA 2NYZD 3HZXA 3NP8A 3CCJA 1EUDB 2XWJB 4RKBA 1CZGA 1H9MA 4JI5Q 3GTKB 4I55F 1YNJD 1NR4A 2F03A 1KD1C 1BR9A 1DV2A 4JI7Q 3PR4A 1JE5A 4EFEA 2R8GA 3RN5A 4C56C 5LXTF 1NMFA 2FFKB 1I4PA 4QJFA 1JB7A 1B2TA 5KYLA 3RGZA 1VF5C 4RNNA 1ASZA 5DQIA 4DNTB 2WV6D 4Y7NB 4MNOA 2JYOA 2JA5A 3D8GA 5CYUA 4IJHA 3M3YB 1UAPA 3ERQA 3J7AF 3CCVA 5C44B 3L0OA 1I6UA 3IFDA 4RGOS 2NVQH 1JWMD 4Y52H 3D6CA 2JA9A 3CC2A 2YYAA 2RDJA 4K0KQ 4GC7A 4IRKA 4P72A 4YJ3F 2RKSA 2A5HA 2W6OA 1SE3A 5IP9H 5C5MA 2MQHA 3CQZB 3JAMc 4H02A 4E4TA 4X66H 1XNQL 2AU0A 1V9PA 3NXWA 2JA6H 1IKMA 5CA0F 5LYJF 2IWHA 1KC8C 5C5JA 2FPIB 3N52A 3ORQA 4B08A 4B9XA 5M5XB 1RJTA 1HR0L 3CKIB 4GN5A 3HOXB 2DNEA 1EOTA 4HR7A 4XYMB 1PH4A 3GTQA 1K83A 4B3SH 4AIMA 5KGUA 5LL6X 2OQKA 3MA2B 4C3IH 1JOOA 1ET6A 1HZAA 1AZPA 1KXLA 2L4NA 1TWCA 2FMAA 2AQ2B 4XX0B 2K28A 3ER0A 4ECTA 1HNZQ 4JVZA 1WD1A 5LMNQ 4MIUA 1AUVA 4Q45A 4DR3H 4LAAA 4YWKA 1XYIA 1N36H 3RIZA 1X3PA 4OO1H 4HCSA 4HNUA 2PMZE 4Q8EA 5JEAH 2XCPA 3FKIB 1YNJC 1PH7A 1EL0A 3GIIA 4FO2A 1GSAA 1PRTC 1U0LA 1TS4A 4A3KB 2A19A 2B2VA 1ZQ7A 2OLSA 1XNRL 2R7FA 4IUNA 3HEJA 4CKEA 3K59A 4GKKL 4JI1L 3T1YH 1C30A 4TUYF 5LA6F 2MNAA 3DHQA 4DL4A 2K5WA 3I8ZA 4IPHA 1R9TH 2PPBC 3K8AA 1NBWA 2IA6A 1B3AA 4JI6L 3IG0A 2XNAC 2R92H 1PV4A 2C00A 1UE6A 2OQ0A 1I6HB 1HRJA 4C3IG 3KHLA 1PZJD 3BQ0A 4HMJA 2WIIB 3V6KA 1QUQB 1I50H 2NVXA 4KHPL 4RCOA 3KHHA 4X66Q 1VQCA 1ZKOA 1S0NA 2PQEA 3DWAA 3S1MH 4O4HF 3WNZA 1EEID 4IPCA 4UCVA 2I80A 5KFMA 2WB1G 2JA6A 3BVMA 2Q2UA 1R4QB 2I87A 4LF5L 1RHPA 1VMPA 1YJWA 2HCCA 4IAJA 3Q2OA 4X62H 3A74A 4DN4M 5F9NA 4GNXC 5KFAA 2K5QA 4POGA 2OTJA 3CPWA 2CHBD 4KHZA 3GTLH 4QMGA 4X64L 4NB3A 2J6UA 2C2DA 3K5OA 4KHVA 1EZ1A 5K36G 2KVMA 2F1MA 3DF7A 4G4KA 1X32A 4CKCA 1A2UA 5IP9G 5A2QE 2R92G 2NN6H 5ELOA 2BQRA 3CD6A 4AYBB 4LF7H 4TSSA 3D4WA 4LFBH 3J7A5 4MV6A 1Q1EA 1CKOA 1STNA 3TS2A 1NNXA 2NB0A 4BY7H 3N42B 2RCNA 5IWAH 2PI2A 3K5NA 4NP5A 1SJHD 3H3VI 3E9IA 1V51A 4BWSC 1TS5A 4DR7H 1DZ1A 2LY7A 1I3QH 1K0RA 1Q86C 5IE8A 1GLVA 1IXRA 1IYJB 2WYOA 4LMQD 4A3FH 2UXCH 5KG2A 3VMMA 2BA1A 2VQFL 2L5TA 4DAYA 1UE5A 3F8NA 3S2DH 4IRCA 1P8LA 2I46A 4HIDA 5E1FA 3OHXC 3UE1A 4BWGB 3T1HQ 2UVVA 1B7YB 4P2CB 2RA4A 1KJ9A 2RBMA 4J9OA 4ZYSA 3GTQB 4CDFC 2UXCL 3C1FA 4NLGA 2Q8RE 4NKLA 2W7PA 3S1NH 4R8UA 3BU2A 5KFOA 4F50A 4EBDA 3OIPA 1LTGD 2NU9B 5JPMC 2QA4A 4MA0A 2Z6KC 5AFWA 2J6TA 2KUMA 4C3HH 1YBYA 4A3GH 1RF2D 1HXYD 3WO1A 2UXDL 1XX8A 3LP8A 5KKNB 2R92B 3QZ8A 1IHZA 1IBMQ 4YIJA 4DXFA 3U58A 1TWAB 4YHHQ 2YRXA 3HOYG 1A6XA 2JQOA 4LFAL 1J6QA 2RF4A 2YZGA 5CR3A 1Y8NB 3HOVB 1HUMA 1CHPD 1CZWA 2H1EA 5JVLA 5DGAA 1RL2A 4YCUA 4EX5A 1UNSA 3DEPA 1ML0D 2TMPA 3K5IA 1NJIC 3JC66 5EKIA 2K05A 4GKJQ 3MHBA 5KFWA 1FD7D 2WAQG 3OSNA 1TA8A 4XQNA 3M4QA 3FDTA 1NR2A 2Y0SG 4A3IG 2HDMA 2R85A 4EG0A 2B2YC 1SAPA 2BOSA 3NBHB 5DNFA 1AN7A 2R7ZG 4ECXA 3I73A 3KXYT 3ZJYC 3MR6A 4JI5L 2VXWA 1D2BA 4QY7A 1FVIA 3M4OB 4YY3H 1N8RC 3PO3H 4FYDA 3RBDA 5EAYA 3J7YW 3RUZA 2QEXA 4ZQ3A 4MV7A 1XNRQ 4U673 4C5BA 4JI6H 1BUVT 1JJ2A 4K0KH 2I5HA 4A3JH 4NXMQ 3BABA 3OMGA 4WFN3 1MD2D 4UHVA 3M85A 4Q44A 1PDQA 3I12A 2N49A 5M3MG 2O2LD 2Y0SA 3HOWH 1U9RA 3NTKA 4ZKCB 2CZGA 4R7RA 3T51B 4WD3A 2KEDA 3C2PA 2ZJQA 1EQRA 2IT1A 4OX9L 3JAMW 1BNCA 1JKJB 2E5LH 4JV5H 1L1OC 5F9LA 4ED1A 5T1GA 4YHHL 3HOZB 4L6TB 1NSNS 3OWFA 4K14A 3PMFA 3QOJA 2B63G 4DUYL 5C4XH 4RGMA 3HP3A 2OCEA 1STGA 1HUNA 3U9TA 2W6QA 1JOKA 4V190 3RGXA 3AQQA 4KJOA 2R7DA 4YHHH 2VB3X 1DCZA 2A6HC 2EOTA 1PFMA 1IYUA 4HSVA 1V8QA 1WCMA 1NMGA 1O75A 4EVOA 2QF7A 1SYXB 2DY7A 3KJPA 4FBUA 1SROA 5BMVF 4LFBL 1SNPA 4XYQA 4X65H 1F9QA 2AKWB 2AMCB 4A3LH 3EROA 5BR8L 3GIPA 3BYYB 2NU7B 3KAJA 4FF1A 3Q0AA 4O42A 1GYFA 3URYA 4EBEA 4ECWA 3D3RA 2PQAA 5JEAG 5IP7H 4DR1H 3VPCA 2C35B 5I6WA 2FPPB 3Q6SA 2J6SA 4OELB 3GTMA 3VYTA 4R8NA 4DNRB 1S5DD 2DJFC 3ITPA 3J7AV 2ATLA 1HZCA 1JJCB 1PH1A 4IQZA 1SJED 2I07B 4ED2A 1I3QB 4XXEA 1N34Q 3MXPA 2UU9Q 4B3MQ 3M4OH 4JI0Q 2DN8A 1JXLA 1GM5A 2BDOA 3S2HB 1I94H 1D5MC 4ECYA 1CQFA 3GDEA 1FJGL 2BQUA 3KHRA 1IBML 4LF7Q 2VL6A 4DV0H 2MGSA 1S5CD 2NZHA 4K2LA 4BY7B 1CS0A 2HVQA 1CKNA 4QIWB 5JJKA 2KQ3A 1SMYD 3TQYA 3CVZA 4XIGS 1M7JA 3ONAB 5CV7A 3GILA 1OXUA 1GUGA 2E74C 3PUZA 5EBDA 1LTBD 4LSAA 4AYBA 3BJYA 3HOWB 4C3HB 5CV8A 3K5MA 3H0GG 2GA4B 2JSOA 5CV5A 2JP1A 5C4HA 1SFOA 1QZHA 2UUAL 3LX0A 3SHLA 4ZKBB 3J81E 2AUJD 4XT1B 4A93H 1RODA 1UE7A 2KCTA 1U4PA 4KJNA 4B3TQ 2PMZA 2A6EC 1H9KA 2B2UC 4X62Q 4DL6A 2DLNA 2V5AA 1SNDA 4KD3A 1KLGD 2SDFA 1NUCA 3VA5A 4DV5Q 2F3IA 3EA6A 4EQOA 1TT2A 4A3IH 2AQ3B 3PO2G 4OONA 2QILA 2CW7A 4TQSA 3BZCA 3SK5A 5KIXA 1JICA 4XDXA 3PSIA 3H4BA 3DWPA 1X65A 3KLSA 1JB3A 4GNXB 2VR1A 2UUCH 1HNWL 4C1NK 4MTEA 2IX1A 5DQHA 1TKWB 5EKKA 3ICEA 5KT7A 1OXTA 4L5RC 1IBKH 2JEJA 4DR5L 2E2HH 3NEMA 3OHBA 4IOCA 2KBNA 2MCTA 2OF1A 3H0GA 3JRWA 4DF7A 1X54A 3AFQA 4EQPA 2LMCB 5C44G 1E0BA 3GTOB 2ATWA 1AH9A 1H9RA 3H0GB 4QB4A 5IYCG 1ESFA 3TBIB 3P7JA 2MO0A 3OHAA 1DJRD 4HSPA 4DV6Q 1TWHH 1YZ6A 2IMWP 4KHPQ 1Y1VB 3H91A 5ELBA 4BA1I 5L1IA 5ISRA 3A8KE 4G7OC 1HR0Q 1BCPD 3TQTA 3HKZB 2AHOB 2W57A 2NN6I 1D8LA 1FYCA 1WI5A 4TV8F 2SNMA 1Q12A 4LWCA 1XMQQ 1JORA 1KL9A 1GSHA 4DK6C 4JV2A 5HGQA 4DR6L 2XGQA 1ZYRD 3MJFA 2B63H 3S1MB 1K3RA 3RZOB 4LF6Q 3M9OB 3GTQH 2UUCQ 3E6ZX 4KY5A 3S14B 5HURA 1I6HH 1EY4A 3R3OA 3S1NB 2EPBA 3KALA 1BF4A 1DD2A 2LXJA 5H1SE 5KFIA 2K33A 1S40A 1IBKQ 5DGBA 4NXMH 4ECQA 2AGPA 4B3TH 1A3UA 3K3PA 3T5KA 1R9TB 4JBWA 2GN5A 4CBVA 1FJGQ 3IFTA 2W71A 2R92A 3CCUA 4HIMA 4LSXA 1N33L 3W1BA 2R93H 2E2IB 4WJ4A 2XIWA 4EGQA 1XMQL 4IUTA 4RAUC 4DV5H 2WTFA 1ICFB 3RNUA 1K8OA 3VR5A 4DPGA 1BJTA 3A8JE 1EYZA 1I50B 2KENA 3EQLC 2DGYA 4RUCA 2V4QA 1V1OA 3TEHB 4LF8H 4R1JA 1JC7A 1Z6HA 1A0IA 3GTJH 1AE3A 5CB4F 4RUAA 1WTOA 2AGOA 1VMCA 4YAJB 2MUYA 1S3OA 1UUPA 3Q1KA 2NTSA 2B2TA 4H0LC 1HNXH 3ULLA 3NGDA 4MZ9A 2YU9A 1O7YA 3G48A 1I4HA 1GUOA 2C5CA 2QGQA 3F1ZA 3PGZA 1KHIA 5GAHC 2R8IA 1VQFA 4DV0Q 4J9RA 1JOQA 4JI4H 2BDNA 5DM63 2R7MA 3BAAA 3SXHA 4A2AA 1TR5A 3CXCA 2HDLA 3HG9A 1DONA 2G9DA 3OW2A 3MEFA 1HHVA 5LP6F 4JI8Q 1G51A 5IYBH 5C3EH 1C7YA 4A3GB 3W3AA 5L9XA 1DGSA 4ECRA 3BJUA 2GVAA 1PYWD 4GKKQ 5C3XA 2UU9H 4J6HA 4B3MH 1MJCA 3GTPA 4JV1A 4L5TA 2FP4B 4ZK9B 3BDOA 1HFGA 2NTTA 2UUBQ 3V6JA 4DR1Q 1B44D 4EFBA 2JA8B 5C44H 4F7XA 1JT8A 4UP8A 4RCNA 4DR5H 3D0FA 3I4NH 1IL2A 4JI2L 2EYOA 3NE5B 2WACA 5KYIA 3FKIG 1ZHSA 2ZDHA 5KFFA 3U4VA 3VA7A 3CMAA 4FVMA 2PZUA 3J81L 4G57A 4PMBA 3I7FA 1HNZL 2RVLA 1EWHA 1Y1WG 4JUZA 4C1NI 4O2DA 4FNFA 1PRTF 4RNOA 1PMRA 2HHHH 3GTKA 2KHJA 2OXPA 5ELFA 3N6XA 1EY5A 3QZ7A 1QNKA 2IX3A 1OWTA 3A56A 3X3NA 1S72A 1JQYD 3MXNB 3IRBA 3CW2C 1VQIA 1KABA 1L1OA 4OWXB 3S17B 2ZDGA 4PZ8A 4XYOA 5I9OA 3BG5A 5KX5F 2F0SA 5CAEB 2E2JH 2FKLA 3DXJC 3ND8A 2N78A 1BBXC 3PQIA 3A5ZB 4QWDA 1VQHA 4TV9F 3NWSA 3VDYA 5KFDA 2KHSA 2ZTDA 4DV1L 3PIP3 3T53B 4UCUA 1MSGA 5HY6A 1L2ZA 4A3JB 4ABNA 5EJWA 2RCFA 4C5CA 2CH4A 1S10A 5KFNA 5KFTA 5M3MB 4KY6A 3TP6A 1M0TA 3J80i 1FGBD 2HIVA 3VYRA 4UCTA 1WOCA 4JI2Q 2DJGC 1SNQA 4LFAH 1LTAD 3KBGA 3HOYB 2EXDA 2UVUA 1WTXA 1UC9A 3TIIA 4WJWA 1H9JA 1JWUD 4KD4A 3LNNA 4HN7A 2RSNA 4RHRA 4YCWA 4QUCA 1GJXA 5KFQA 3PUWA 5K2MA 2EYLA 3GTPB 3CCSA 4O4IF 3SDZA 2B63B 4LW1A 3KHGA 1VF7A 1N9WA 2W9CA 1HA6A 3PF4A 4UP9A 2VPSA 3I4LA 5AJ3L 5C3EB 2F0UA 1JCKB 3Q8SB 1QNUA 4K2KA 5IGCA 2PNHA 5C4XB 1SLJA 3IKJA 4LF6L 4J8QA 2NUAB 4JI3Q 4IO9A 3HKZE 2WFWA 2VY3A 2F0HA 2O03A 4RNMA 5IGGA 2A8VA 3MXUA 1H95A 4IFDG 1TWAA 4IUVA 5E3FA 5A2QL 2JEBI 4JI5H 5D65A 4BBSG 1ZEQX 5FLXc 4A2BA 3QFFA 4RH6A 1NAPA 1SBBB 1T9HA 3MR3A 1F77A 1X3QA 1Z2OX 2V59A 2KSWA 2A6ED 3A8IE 3HGBA 5KG4A 5I47A 1GVPA 5ELDA 2BH8A 1PFNA 2HHHQ 4DR7L 2VA2A 5CV9A 3FKIA 4YQWA 2VNUD 2VUMH 4ECVA 1WCMB 1X9NA 4DUZH 2XIGA 3BA9A 4PQXA 2Q2IA 4MHEA 1A3VA 1FNVA 3OMCA 2ZXPA 1F2YA 1PLFA 3LWUA 2R3ZA 5IT9W 5CV4A 1C3OA 3JZIA 2J9GA 2VPQA 1BOSA 1CSQA 1YNND 2MJ8A 4A93G 2EY5A 2D0OA 4GLAC 5DM73 2JA7A 1AUXA 4K5VA 3OW7A 4DV4L 1PFBA 5KRUA 1Q81C 3HOXH 5EDWA 1GGOA 1JMCA 3PW4A 5M9OA 4C2MA 4RGNA 1N34L 2D5DA 5C0XH 1QUQA 3T13A 4PZ7A 5ELNA 2B2UA 3T56B 3HKSA 1JWSD 3T1HH 2DPIA 1NY4A 1V1PA 2FLLA 4RAZA 4IZOA 3PO2H 4A3MH 4N8FA 1VCIA 3EBEA 4DA2A 2AUKA 1XNQQ 4B3TL 1HZ9A 2KOLA 1PK8A 2B8FA 2K52A 3MFYA 5CMDA 1EZ8A 2Z4HA 2NVYA 4O2BF 1WTHA 1T36A 1AE2A 1J5EL 1WTWA 2LKVA 4ME6A 4DR2H 4FS2A 5CV6A 2R6FA 1LTLA 4IFDI 2PO4A 1N48A 3JRXA 2ZJRA 5LMNW 2H5XA 4JYAQ 4IWXA 5DLGA 5KT6A 2UXBL 4IALA 4QIWE 1J5EH 1S4ZA 1VAJA 3A5UA 3I90A 3QR8A 2VOBA 1QE6A 5FPOA 4KTAA 2CW0C 4F4WA 5F2DA 3AU7A 3KUPA 1RIPA 3MWYW 4CJ2C 2VQEH 4L8JA 1MI2A 4DU9A 4BXXH 3HOXG 1W93A 2W6ZA 2P5ZX 1EY0A 2W70A 1IKLA 2C2RA 4JW0A 1VS0A 3HS0C 4TKOB 2FK1A 4UFZA 1XNRH 4O3OA 1CM9A 5IY0A 2E8GA 1C0AA 3V96A 5EPLA 4YY3Q 3M7GA 4BY1H 3A55A 2A74C 5COYA 1O80A 2EJGC 1NCVA 5FLXL 1Q7YC 4J9PA 3NQIA 4DR6Q 2WB1E 3C1EA 1PYSB 5E4WC 2QYZA 4U6PA 1BXTA 1YNNC 3BQ1A 1KJIA 1B53A 4POFA 4A3EG 3HOUB 4LJZC 1VQBA 3GIQA 2C9OA 4X3KA 4PWQA 3TZUA 5KFGA 3TREA 4QW8A 2WKCA 3MC0B 2JA5H 1LO5D 2GPWA 3EPIA 1E1OA 3GTGH 2KA7A 4X3UA 2F0VA 4DV1Q 5A2QW 3OOCA 4QWAA 5DLQE 2IJ0A 5FJ8H 1VQPA 3RUPA 2FLPA 4Q43A 2UVWA 1N32H 5KG7A 4B3RH 3WO0A 5KT4A 2N55A 3GTOA 1PTOD 1DM0B 1X55A 3EIVA 1L2FA 4OGQC 4ZI7F 4FU0A 5L1KA 2A68D 1Y1VH 1LT6D 2I5MX 2VQFH 1D6EC 4O3PA 1TU2B 4A3BB 3TINA 2YZMA 4DV4H 1ENFA 4DL2A 1BCPF 4ID6A 3RR5A 3PO2B 3IL8A 1HNWQ 3MFGA 2G5DA 3EFXD 1LACA 1WTPA 2XCLA 1X56A 1KDBA 4WJ3M 2R93B 3KF8A 1Q8IA 2B2TC 5IT9L 1E2ZA 3N41B 1Y14B 2Q8TA 3TP7A 5FPRA 3TP5A 5KFSA 1Z47A 5KFJA 5C0XI 4L5SA 4B3SQ 1BO0A 1STHA 1CFMA 3I70A 5J1ZA 3CCQA 3M4PA 3H09A 2PMZB 1OTCA 4JI6Q 1ILQA 3Q24A 5IGBA 4J9QA 4Q8FA 1TIID 2Z4IA 3TP8A 3RZOH 2R82A 4J0MA 4OIJA 1QVGA 1IOVA 2WDTA 3S14H 3KDFB 1YJ9A 2EYPA 4LMYA 3PUYA 1S5ED 2SNSA 3NSWA 4K8IA 4JV0A 3I56A 3STBD 1IW7D 3J81i 1IBLL 3Q8PB 1TXYA 4BBSH 1HQRD 4CJ1B 3UDGA 1FKAH 2L15A 2F52A 3TIGA 5IWAL 2JA7H 2ZJPA 1V43A 4OEMB 1AN8A 4JK1C 3NBIA 1K1QA 1WJJA 3MWDA 2LFNA 4KMUC 3Q8RB 4JBJA 1DOMA 1SXTA 2A6HD 1MBYA 4K8JA 4YWLA 4GKJH 1K8GA 2F4VL 4R4OA 1N36L 5DG8A 2ICIA 3V4ZA 2ZTEA 3PW0A 3AMUA 3FVQA 1EIFA 1S0OA 4AQYQ 3SK6A 4KK7A 2R93G 2CQYA 5BR8H 4LUZA 2OH2A 2FK2A 3TDQA 2OWOA 2F0LA 4O1NA 2E2HA 5EWGA 4M9UA 5EPKA 2FJZA 4C3IB 1B3QA 3S2HH 4YR2A 1N33H 1GUSA 2MFIA 2XTIA 2RHQB 4OXPA 3A7LA 4HMIA 3HXLA 4KLKA 3RD4A 2V1CC 4H7BA 5IP7G 1C4QA 2EE1A 3PF5A 1G2TA 4UPAA 3PV0A 1QG7A 4I7AA 5C8YF 1KRSA 2HCIA 1I7LA 3S1RB 5JJLA 4ULLA 3R5HA 4ED8A 3SE0A 3GP7A 3V05A 3HRZC 1Z2NX 3BVZA 4LUOA 2UVRA 2K5VA 1HJPA 1CA6A 4R8UB 3N44B 4IHJF 3PUVA 2ASJA 2WINB 1BBUA 4IZ8A 5FKAC 5IYCH 1JR0D 1K1SA 2JEIA 1EOVA 1TS2A 4AYBG 2JA6B 4NPSA 4YWMA 1WR2A 2E2IA 1X3EA 1NTGA 3K7AB 4E6IA 4LF9L 2IW3A 2JJQA 1CT1D 2XSCA 5IWAQ 1EYGA 1JDBB 4DGZA 4WORA 2NU6B 4O0AA 1NE3A 2RDGA 1S68A 4A3DH 3R23A 4IWYA 1HQMC 1GOZA 2F4VQ 1R4PB 3I4OA 1M6VA 2BCOA 3TN2A 4HJ9A 1LUZA 4C5AA 3A54A 4PDBA 1RTOA 3QIAA 1BCPB 4DR1L 3GIKA 2Z0SA 2NVTB 4UCRA 1A2TA 2W8LA 4LF8Q 2W9BA 1PH5A 3GTGB 5C5LA 1DXMA 4HJ5A 2ZT9C 3KOJA 1Q82C 1Y1VA 2L12A 3CP0A 2ZXOA 1L0YB 2B3GA 1VQOA 4HQ6A 2K14A 2F4IA 4AQYH 2OTLA 1GUNA 3I55A 1KIXA 2EIFA 3NPPA 4B3SL 3RB4A 4ECUA 4N8X1 1D1KA 1XNQH 3HB9A 1I94Q 2KHIA 1JDEA 1H9SA 3W2DA 1RK5A 5M3FG 1WVLA 1Y1WB 2ZTCA 1PTOF 2JK8A 1PA6A 5M3MH 1SEIA 1II3A 1K8MA 3MR2A 4YCVA 2KCMA 2NZOA 2IY5B 3MZ5A 3EJIA 4KN7C 1OO9B 2WAQB 3KLWA 4P73A 5CGKA 3K80C 4RGTA 1M90C 2DUDA 1EY6A 3UI2A 3LWBA 1SNOA 1B4OA 4MTDA 4DV6H 4IPGA 3T5HA 1PZID 2YYZA 2VQFQ 3SK8A 4PMCA 2RDFA 1PTOB 4KI0A 2VUMB 4LF9H 4TVAB 4M7EA 3K0YA 1SR3A 2XGTA 4KY7A 3GO5A 2YTVA 4JCVE 5M5YB 2H4OA 1TVXA 4ED7A 5D3IB 2F0MA 1G8ZD 1N56A 1STYA 5D1OA 1PH2A 2R7ZH 4C3JG 2X6GA 5LMNH 1S0MA 4QGUA 1WCMH 1KDCA 3S16B 2EJMA 4LH7A 1TWCH 5KFCA 1RJRA 5I4DA 2YU9H 3J80W 3WWVA 3HOVH 1YNXA 3CU7A 1XPOA 4A3FG 3CCLA 4XT3B 1HTPA 4DK0A 4NXML 4LF8L 3MXNA 3KTMA 5LMUH 3C3LA 1SEBD 4YY3L 3G6JB 1L1OB 1SYGA 3G6XA 1S9FA 1O7ZA 3G6YA 2F0PA 4JI3H 2R7NA 1EWIA 1SE2A 5IT9c 1HA5A 2UXBQ 1G91A 2UUCL 5EQ0A 1S97A 1XJVA 2E5LQ 4JV5Q 2PW7A 1E7ZA 1TY0A 3TZDA 4RB0A 1IW7C 2QKIC 5I9PA 4BA2I 4FXKC 3G6EA 5JQWA 5KT5A 1CQIB 3KJOA 2XCAA 4DAYB 4GLXA 1EY8A 4DV2Q 2Q2HA 3KLSX 4UCSA 1S5BD 4JI8H 2KCCA 3H40A 1VQ6A 1Y8OB 4BY7G 1Z9FA 2R93A 1E2VA 1VDZA 2F0FA 5IODA 4GOPC 5GONF 1AP0A 1SYFA 2EVBA 1U4RA 1HNXL 2N88A 3D31A 1SSOA 3RB3A 2O5IC 4K5WA 1E4EA 4GN3B 1E22A 2A69C 1VQ9A 5L1JA 4BY1G 1S03G 1X3GA 1J5EQ 3CQZA 2FMCA 3RZDB 3IAYA 3S15B 4LF4L 5BR8Q 4Y7NH 2DIKA 1VQAA 1RJQA 2Y0SE 5C0XG 1CKNB 1W96A 4QIWA 3RB6A 4HNVA 1EQVA 5CA1F 4KN4C 5JUMA 4QWBA 2D2CC 1KAWA 2JEAI 3VYUA 2NVYB 4DAMA 2K01A 4LFBQ 4FBTA 1GUTA 2VS1A 5KNBA 4DL3A 3RLNA 2ZXRA 2XD4A 2D0PA 2RGRA 1TWAH 4Q0FA 4DXGA 3OPOA 5IYDG 2JN4A 1B6SA 2JEGA 1BQQT 4U7CA 2VW9A 4I7HA 3PO3G 3QJYA 1KBLA 4QWCA 3ZYYX 4FXGC 1F2ZA 5KG1A 3R2TA 3KDFA 4KKSA 4UY8C 1UEBA 3A0JA 2VQDA 5C1PA 2D62A 1ET9A 1IYVA 2RDIA 3CQZH 5KNCA 1EYAA 3M7NA 3JSLA 4JOIC 1Y1WA 2K5NA 3G4SA 2HVSA 2W6PA 1E3PA 4G7HC 5EGTA 5DEHA 4ZCKA 1QILA 1IZ6A 4F88A 3RLOA 1Q3LA 5DAUA 1HPCA 4HCEA 4A3DG 1A15A 1MHWC 2XWBB 3KBXA 4A3MG 3EPGA 3VYSA 4J9MA 3GTMH 3JAME 3ORRA 2BH2A 2NVXH 5KFXA 1RYSA 2VA3A 4DR4Q 1KJJA 1S5FD 1JX4A 5TSSA 3HOYH 4TRDA 4C2MB 1CSPA 3H6MA 1EFWA 1QVCA 4GKKH 1DOLA 2VQEL 1L0WA 4MV9A 5KEEA 5FJ8G 5KFHA 1XTDA 5J39A 4MV8A 1GHJA 2FK3A 1RK6A 2QK4A 1CQJB 3WOFA 5EKLA 1T94A 2E75C 4DV4Q 5LMUL 3PIOA 2ENBA 4A3BG 2YCHA 1WTVA 3OYYA 2W6NA 3F2BA 4J1MA 4A3KH 1UEAB 2R61A 1HZBA 1PZKD 4ODGA 4LF4Q 3I4MB 3L3OC 1I4QA 2ALYB 2BE5D 2MP1A 1B50A 3KAKA 4JI4Q 2F3WA 2ASBA 4BBRB 3SEBA 4AH6A 2HHHL 3HKZA 3GTGA 3MXGA 3U9SA 3I2ZA 2SEBD 3OSPA 2J7ZA 1PTOH 3CCRA 3Q8DA 3MTSA 5HGTA 3MFHA 3QO2A 1F9RA 5M5YH 3K81C 1KEEA 4P71A 2JA7B 3L7ZC 3U9OA 1RCVD 1GUWA 3UE0A 1RD9D 2K50A 3DWQA 2WAQE 4OWTB 4DAVA 2I8CA 2FE3A 4ED3A 4IR1A 4YAKB 1Y69U 4JG2A 2FPGB 1WYDA 3JAML 3UFXB 3P20A 3M4YA 5IYZF 5M5WH 2YS7A 3SVMA 5AJ3Q 2JA8H 5IIFA 1KNAA 5JVDF 1LV9A 4Z9CB 4XQJA 3U4ZA 2B8GA 2CFMA 3K7UC 4QQBX 1KDAA 1I50A 1SNMA 2W8KA 2C28A 2EXZA 2NUCA 3F2UA 4K5XA 1A9XA 2QEJC 1CKMA 2EY1A 1EYCA 4DFAA 3ETJA 4ZHQF 3VPBA 1Y1VG 4N9TA 2QW7A 3DEOA 3C0FB 1CI3M 3RJ0A 1LTSD 4ETSA 1BBWA 2QDBA 5DLFA 1Q8KA 2GPSA 3I72A 2V9WA 1ULZA 3E0EA 4HTHA 1I4GA 2R7ZA 2PZTA 4UP7A 1HFNA 4RB2C 1A8VA 3VR4A 5JVH3 2K04A 3PR5B 4LF4H 3G6VA 4DL5A 2TSSA 1G6ZA 4XZ3B 2EYHA 3FDSA 4A3GG 3SK4A 5I2XA 1EZ6A 1P16A 3S17H 3CPFA 5JJZA 4RA8A 2E2HB 2N3SA 2ASDA 1TQOA 4DLKA 1IBLH 2BE5C 2K32A 1KAAA 3CRLC 4MTKA 4RB1A 2XC9A 3VPDA 5IOCA 4DR4L 5EOYA 5KFLA 2R8JA 2QDLA 3RLFA 5IGDA 1SE4A 2R8HA 4JYAL 3GD7A 2GLTA 1C9OA 4IFDJ 4JI8L 1Z7TA 2NVYH 2ZM6Q 3L4JA 4FM9A 1I4XA 4F4ZA 1XTCD 1SN8A 1EIYB 2CKZB 1YI2A 3AEVA 2OT2A 4IUUA 4R4CA 5CORA 3NQTA 2X0SA 3GQCA 3H4DA 1XMOH 3RZDH 4APMA 4A4IA 3CHBD 2QCPX 4F8MA 3OIQA 3TSSA 3IN5A 4KV6A 3M9NB 2JA5G 1X3FA 1M4VA 2K5DA 4JOIA 4DR2L 4DR3L 1G291 2ZJTA 5D14A 1V1PB 1B70B 2PBZA 4UAIA 2XN9C 2FXQA 3A7AB 4I7ZC 3S9WA 3R8BA 1SDFA 3HKZG 4NDXA 2IP4A 4R4QA 1C48A 1F2LA 3K0XA 4M1UB 1KRTA 3RMHA 5BN5A 1CA5A 4IOAA 5K36H 1WH2A 4B3RL 4I65A 4HJ7A 2UXCQ 4F87A 5KFZA 4EBCA 3R5XA 1ONLA 4KKUA 3MWMA 3CMEA 1TWHA 4R9WA 5BPFA 4ZAIA 3K5LA 4TQRA 4MV1A 2SCUB 1E4FT 2NVTH 5JOBA 2ZDQA 4YB8B 4JYAH 3KYHC 1VKZA 1VQ4A 3V2TA 4Q5VA 4I4TF 3DUZA 1BCPC 5J2TF 1PX2A 2K6AA 2F0IA 1YIJA 1GXDC 4FF2A 3VR3A 5JJIA 4O3NA 5GADC 3OUUA 5KFUA 4EEYA 3H0GH 1HH2P 4HJ8A 3MEHA 3JSNA 1TS3A 5D1PA 1STBA 5E7NA 4RAYA 1SMXA 1SYCA 2K4KA 4QUFA 2R87A 2F0KA 4CC6A 4F4XA 5EBCA 3W5OA 3J7AK 2B2WC 1YHBA 5LHY1 2YW2A 4RKLA 2JA8G 4ILWA 1PYBA 4MTNA 3GTJB 5IGFA 3Q8QB 1WTRA 5G3LF 4DV7Q 1VQGA 3PVXA 1LLRD 3I3CA 5CBAE 3RN2A 1PVOA 1TWGH 4JBKA 1OXSC 1SE8A 2EJFC 2M2LA 3D6WA 3V6HA 5H80A 1EQTA 5FLXE 4CJ0B 2CW8A 1N34H 4P74A 2Q8IB 2WE6A 3E5SA 2VUMG 1K83B 2IHEA 4X3TA 1ICWA 2I5LX 2NWGA 1Y1WH 2RDHA 1VQ7A 1KQSA 1YITA 3H3VH 2WAQA 2W9CB 1QB5D 4LF5H 2B63A 1PTOC 2RGVA 3K3VA 3J80c 3T1YL 4JI1H 1K0SA 1EIGA 3SE7A 2Z6BA 1HCZA 2YU9B 2HUGA 2HT1A 2ASLA 3H94A 1VQMA 4OO1G 2VZAA 3CC4A 4HIOA 1BGWA 1XMOQ 1CUKA 2X6LA 5JPNC 3PN1A 2R7ZB 3PW7A 1TWFB 5ELEA 3S16H 1EUCB 1DV1A 1LTID 5KFBA 2EYJA 4A3EH 5K5PA 1EFID 1GKHA 1ZXTA 4DV3Q 3Q22A 4H13C 5FLXW 2KJXA 3EYYA 1PHJA 3L2PA 2BA0A 3GIJA 5DG7A 2HIXA 3BDLA 4LFCL 4KHPH 1TWCB 2ZM6L 1ENCA 2VB2X 2PN1A 1A63A 4QWEA 3K5HA 4X64H 3F8TA 2L1BA 5NUCA 1E24A 5LL6b 2A73B 3KF6B 3T4AC 5IYBG 1G6PA 1AZQA 5FOBB 1D7QA 4DV6L 3CC7A 2XRQD 3FPPA 5DG9A 2JA6G 1VQDA 2WB1A 1KC7A 1KJQA 3BVGA 4GN4B 5C4XG 3N8DA 1XPUA 3AYHB 4DV3H 4OWWB 4ZUIA 4JI3L 4DV7L 2V58A 4DR6H 2YV5A 4JI1Q 1VQLA 3I91A 4DK3C 2DZDA 2HGSA 5FD5A 1ILPA 2UXDH 2KEEA 4WRDA 4ZQIA 1BKBA 4LF7L 1Y8PB 4BXXG 2YRWA 4DV7H 5DQGA 4CKBA 1VQKA 2R86A 2FHTA 5D8DA 2EZVA 2RSOA 5LOVF 2IBKA 3B6YA 1L0XB 2PYKA 4ALPA 1EHIA 1MZBA 3UDFA 3BQ2A 3G8CA 5KT3A 4EQ5A 4DR7Q 1LM0A 2Z9HA 1D1IA 1EYDA 5J22A 1EY9A 1Q90A 2J0TD 3E0JA 3TRZA 2R84A 2B39A 4CDEC 2K75A 4A76A 1H9SB 3VR6A 3ETHA 1UE1A 1M1KC 1STAA 4EQNA 4BBRH 2WP8J 3OTOH 2D9UA 3L9AX 4PV1C 3LWEA 3Q23A 4RU9A 1MSHA 2V4RA 3E3XA 5C6AA 1JLLB 3NTHA 2F3VA 2F4VH 1MIUA 4DV3L 1HTLD 5KFKA 1TWFA 1SFOB 4RWSC 1EIHA 1B1ZA 1EEFD 4QCLA 4J9SA 2L0CA 4ECZA 3CAMA 2PI2E 2F0GA 4FP5D 4WBNF 1V1QA 4CDDC 1YJNA 3ULJA 2NZ1D 4JI0H 4X66L 3J81j 5M3FB 4DL7A 4XQQA 3OUZA 1STEA 3RAXA 2L55A 4A3LG 1TWFH 5C4JH 4A3DB 1K3BC 5KT2A 4A3EB 3HOUG 1N32L 2M05A 4JI4L 4GC6A 1WD0A 4L1KA 2A68C 2Z8LA 1ASYA 4CHTB 5KFVA 4ECSA 2HQEA 2N8NA 3NK9A 3V4SA 5FO8B 1DIKA 4AYBE 2B2WA 5JH7F 3P75A 4S3SA 4GOPB 3QB3A 2YTYA 4C3HG 2LSSA 5FLMH 4JPBW 2XRSD 4C2MH 3D4RA 4X65Q 5BN4A 4FF3A 2NU8B 1ESRA 1ENAA 3DMUA 3NHHA 3RBEA 1RYRA 3GTMB 3I4MG 3GLKA 2F0TA 1W3SA 4QF4A 1E4GT 3UQ8A 5J2UF 1DYQA 3GV7B 4OHJA 4LUVA 3NUCA 2YZNA 4XYLB 2DNCA 2CWPA 5JAVA 1K73C 1WCMG 4IURA 4NMZA 1B33N 4V0BA 1JE4A 3RAQA 1YVCA 2EQSA 3N40P 3D4DA 4JBMA 2R8KA 3CRKC 2Q2TA 3I4MH 3GIMA 4Y8VB 3EVQA 4J9KA 2ZM6H 2C22A 5FO9B 2RHSB 1F2MA 2VUMA 3HFZB 3ERSX 1EY7A 1FR3A 3N6RA 3EN2A 4DV0L 1J8IA 1KJ8A 1CQVA 1HR0W 4LF9Q 1W6KA 3MWEA 1GHKA 1X6OA 4CC5A 1SYEA 3KF8B 3OTOQ 2KCNA 5BN3A 3SI8A 5KFRA 2AWOA 4RZQA 4A3MB 2R6GA 4ME5A 4FF4A 4O3RA 4DNIA 1B9MA 2E2IH 4JC0A 1LYLA 3P1HA 4OX9H 2YL2A 4MA5A 5E4XA 3ND9A 2ALZA 3FMAA 2C2EA 4YR0A 3I4NB 4DR2Q 4HYKA 3PZPA 4MV4A 1M0WA 2EYFA 5J3BA 1GD7A 2L11A 4RMFA 3BDCA 2LXKA 3AB9A 2PZWA 3J7ZC 4LFAQ 2XVSA 1FJGH 5GQOA 3KFUA 1VQNA 1GO3E 4G3IA 3MVVA 1SYBA 4HEDA 3FP9A 1WSCA 5HBRB 4J9NA 1XPRA 1LTTD 5M5XH 1XDNA 5C1OA 4K6LA 3HOWG 1PH6A 3K57A 3F2CA 1AEXA 3VR2A 3S1QB 2UXDQ 2PW5A 2FLNA 1RKNA 4A3KG 4JI2H 2HD3A 4X65L 3ULPA 4BBRG 2P0AA 4APVA 1A62A 5A35A 4O4LF 1T5EA 3CCEA 1T3NA 1YEZA 4LF6H 3BS1A 2JE6I 4CDCC 3STBC 3RTXA 3J81c 5JEAJ 1M8AA 4IJLA 1VQ8A 1HNWH 2W9AA 4NXNH 2UUAH 3T1HL 1PRTD 4LK1C 3BYTB 5KFYA 4DUYQ 2JA7G 4Q0YA 5LMUQ 4O3SA 2Z1CA 5CBEE 2PVPA 1VQ5A 1N32Q 4X6AH 2F0EA 3FKIH 2CW0D 4HR7B 1FNWA 3I4NG 4YJ2F 5EZYF 2R7KA 2IPKD 5KNDA 1ZHQA 3MR5A 3CCMA
chains in the Genus database with same CATH topology
1I5FA 3HOYH 3S1NH 5GROA 1CSPA 1EFWA 2I0QA 1GVPA 1QVCA 2BH8A 3BU2A 1L0WA 3SGIA 2VQEL 5FJ8G 2HHHQ 4DR7L 1XTDA 2VNUD 2VUMH 3S15H 2GVBA 5GAGC 5FLMG 3CF5A 2QA4A 2Z6KC 1X9NA 4DV4Q 4IPDA 2Q2IA 1YBYA 4C3JH 4C3HH 5LMUL 4A3GH 3PIOA 1OXVA 2CWAA 4A3BG 2UXDL 3OYYA 1IBMQ 1IBKL 3U58A 4YHHQ 3F2BA 4DR5Q 2NN6G 4A3KH 4LF4Q 1HZBA 3HOYG 2JQOA 4LFAL 1CSQA 1J6QA 5C0XJ 2RF4A 4A93G 2D0OA 4GLAC 2ALYB 4DV4L 1Q81C 3HOXH 4JI4Q 2ASBA 4J15A 1JMCA 1RL2A 4YCUA 4ME3A 1SRUA 4EX5A 4AH6A 1N34L 2VQEQ 2HHHL 3I2ZA 3LGJA 1QUQA 3JC66 1NJIC 1K9MC 1N33Q 4GKJQ 4PZ7A 2WAQG 5ELNA 4GS3A 3HKSA 3CCRA 3Q8DA 3NELA 1NY4A 3M4QA 4DV5L 5M5YH 3K81C 3NENA 2Y0SG 4P71A 3M9BA 2AWNA 4A3IG 3PO2H 4HIKA 1PFSA 3L7ZC 3NBHB 4A3MH 5M3FH 1VCIA 3EBEA 2R7ZG 3UE0A 4OWTB 2K50A 3ZJYC 2WAQE 4B3TL 4JI5L 1HZ9A 1U5KA 1XNQQ 2K52A 1FVIA 4QY7A 1N8RC 3PO3H 3E9HA 4A3JG 1AE2A 1J5EL 4GLVB 4JG2A 1WYDA 5EAYA 1LTLA 3PUXA 4IFDI 2QEXA 3DLLA 5M5WH 1XNRQ 3TS0A 5AJ3Q 2ZJRA 5LMNW 2JA8H 3GTOH 2H5XA 4JYAQ 2E5LL 4JV5L 1XMOL 1JJ2A 3U4ZA 4QQBX 2CFMA 3K7UC 2I5HA 4QIWE 2UXBL 4A75A 4DKAC 1EUJA 4A3JH 4NXMQ 4RG1A 3A5UA 1PH9A 3M85A 1CKMA 1YHAA 3GTKH 2N49A 1RIPA 1Y1VG 5M3MG 4BXXH 4LFCQ 3HOXG 3HOWH 2A1AA 1QZGA 2CCZA 1BBWA 2ZJQA 1EQRA 2IT1A 1Q8KA 4OX9L 1VS0A 2IX0A 3E0EA 1BVSA 3GTPH 3HOVG 1L1OC 4UP7A 3BZKA 5GAEC 1A8VA 4YHHL 5IY0A 2E8GA 1C0AA 5LMNL 4JI0L 2B63G 1Q46A 4DUYL 5C4XH 4YY3Q 1K83H 4A3GG 2OCEA 3S1RH 4BY1H 1Q7YC 1YHQA 3T1YQ 3AQQA 3M3YH 3S17H 1P16A 2WB1E 3CPFA 1PYSB 2R7DA 4DR6Q 2N3SA 1NMGA 4POFA 4A3EG 1VQBA 3KJPA 4OO1I 1SROA 3TREA 1MJEA 4LFBL 4DR4L 2JA5H 3RLFA 3KF6A 1E1OA 3GTGH 4JYAL 2AKWB 3GD7A 1C9OA 2AMCB 4DV1Q 4JI8L 4IFDJ 4A3LH 2NVYH 2ZM6Q 5BR8L 5DLQE 5FJ8H 1VQPA 1QVFA 1SN8A 4X64Q 1EIYB 2CKZB 2IHFA 1YI2A 3AEVA 1I94L 4DUZQ 2PQAA 4R4CA 5JEAG 5IP7H 4K0KL 3RZDH 2C35B 2UUAQ 1X55A 3EIVA 1L2FA 4A4IA 1Y1VH 4B3RQ 1MKHA 2I5MX 2JA5G 1X3FA 4JOIA 1O7IA 4PMWA 4DR2L 4DR3L 1G291 2UU9L 4B3ML 3F2DA 1Q1BA 3K7AH 4XTCS 4P75A 1B70B 5C3EG 3RR5A 4NXNQ 2FXQA 1HZCA 1HNWQ 1JJCB 1PH1A 1JJGA 1UWVA 1X56A 3HKZG 1N34Q 4WJ3M 4R4QA 1HNXQ 4DR3Q 2UU9Q 3JAMi 3K0XA 1KRTA 4B3MQ 4JI0Q 3M4OH 1Y14B 2YTXA 4IOAA 1GM5A 1WFQA 3FHWA 4R4TA 3S24A 1Z47A 2ES2A 3HOZG 2HQLA 5C0XI 4HJ7A 4L5SA 4B3RL 1FL0A 3GDEA 2UXCQ 4B3SQ 2ID0A 1FJGL 3CMEA 3CCQA 1IBML 4LF7Q 2VL6A 4JI7L 3M4PA 2NZHA 1OTCA 2PQAB 3U50C 5IYDH 2NVTH 4DV2L 4JI6Q 2Z6KA 3KYHC 1VQ4A 3G71A 3RZOH 1CKNA 4X62L 1K8AC 5JJKA 1QVGA 3TQYA 3S14H 3KDFB 1YIJA 1YJ9A 5JJIA 3PUYA 4XIGS 3PIPA 5GADC 3I56A 1OXUA 3STBD 3J81i 1IBLL 3H0GH 1TXYA 3PUZA 1HH2P 4BBSH 4HJ8A 3UDGA 2L15A 2F52A 1KXLA 5IWAL 2JA7H 2ZJPA 1V43A 5E7NA 1VQEA 1SMXA 2K4KA 4QL5A 3H0GG 4HJAA 1WJJA 3W5OA 1YHBA 1QZHA 1E1TA 2UUAL 4GOPA 2JA8G 4JBJA 1PYBA 4MTNA 1EQQA 4L5QA 4YWLA 4A93H 1K8GA 2F4VL 4R4OA 1UE7A 2KCTA 1VQGA 4DV7Q 1N36L 4B3TQ 4X62Q 1PVOA 3RN2A 1OXXK 2ZTEA 1TWGH 1SFOH 3W1GA 1OXSC 1EIFA 1SE8A 4JBKA 4A3BH 4AQYQ 4A3CG 4DV5Q 2R93G 4OX9Q 3HOZH 2F3IA 4A3IH 4LUZA 4P74A 3PO2G 4OONA 3DM3A 2OWOA 2VUMG 1FGUA 2IHEA 3H15A 2MO1A 3BZCA 2I5LX 3PSIA 1Y1WH 1VQ7A 1X65A 1YITA 1KQSA 3H3VH 3S2HH 4TQUS 4NXNL 3AFPA 4GNXB 3J80c 3T1YL 2MFIA 1HNWL 2XTIA 2RHQB 4OXPA 4KLKA 2HT1A 2IX1A 1VQMA 2V1CC 2UUBL 3ICEA 2VZAA 1OXTA 4L5RC 3CC4A 4OO1G 4HIOA 1XMOQ 5IP7G 1CUKA 2K5HA 4DR5L 3OTOL 3PF5A 3NEMA 2E2HH 4UPAA 1PH8A 3PV0A 4IOCA 2KBNA 3S16H 1KRSA 3UDXA 4DUZL 3S1QH 4A3EH 1X54A 3AFQA 1GKHA 5C44G 5JJLA 4AQYL 4DV3Q 2ATWA 1AH9A 1PHJA 3L2PA 2BA0A 3UDIA 5IYCG 2HIXA 3PCOB 4LFCL 2ZM6L 4LUOA 2K5VA 4LNQA 3HOUH 2B29A 2MO0A 1HJPA 4PG3A 1A63A 3F8TA 4PZ6A 4DV6Q 1E24A 1PH3A 1TWHH 4LF5Q 1YZ6A 3PUVA 4A3CH 4KHPQ 1BBUA 5IYCH 4R4IA 3KF6B 4BA1I 1EOVA 4AYBG 4NPSA 4YWMA 4GNXA 5IYBG 1G6PA 4GKJL 1HR0Q 1X3EA 1NTGA 4LF9L 2JJQA 2AHOB 4DV6L 5IWAQ 3CC7A 2NN6I 1W2BA 1EYGA 1D7QA 4FDBA 1D8LA 1WI5A 1Q12A 4LWCA 1XMQQ 1KL9A 2JA6G 1VQDA 4DK6C 5HGQA 1IBLQ 4GN4B 4DR6L 5C4XG 1XPUA 1VQJA 1B8AA 2CQOA 1NE3A 3AYHB 4O0AA 1K3RA 1N36Q 4OWWB 2B63H 4A3DH 4DV7L 4JI3L 3CCJA 2F4VQ 4LF6Q 3GTQH 2YV5A 4JI1Q 1VQLA 3I4OA 4DK3C 2UUCQ 4JI5Q 1I6HH 4HJ9A 1LUZA 2LXJA 5H1SE 1S40A 1KD1C 1IBKQ 4JI7Q 1BKBA 4LF7L 4BXXG 1JE5A 4JBWA 2GN5A 1FJGQ 3RN5A 1VQKA 3CCUA 1NMFA 4HIMA 4QJFA 4DR1L 1N33L 3W1BA 3B6YA 1JB7A 2R93H 4WJ4A 2Z0SA 1XMQL 4ALPA 1ASZA 3RNUA 4LF8Q 3UDFA 1PH5A 4EQ5A 4DPGA 4DR7Q 4MNOA 1LM0A 2KENA 4HJ5A 3KOJA 1Q82C 4IJHA 3CP0A 2DGYA 2B3GA 1VQOA 3TRZA 2K14A 3CCVA 2K75A 3L0OA 2OTLA 4A76A 3I55A 2NVQH 4Y52H 3TEHB 1KIXA 1UE1A 2EIFA 1M1KC 4R1JA 4B3SL 2JA9A 1A0IA 2WP8J 4BBRH 3GTJH 3CC2A 1AE3A 4K0KQ 4P72A 1I94Q 2KHIA 1S3OA 5IP9H 1MIUA 2MQHA 3ULLA 3JAMc 4H02A 5M3FG 4DV3L 1XNQL 4MZ9A 1V9PA 2JA6H 2ZTCA 3G48A 2JK8A 3CAMA 1PA6A 2PI2E 1KC8C 5M3MH 1V1QA 1YJNA 2QGQA 3ULJA 4X66L 3J81j 3F1ZA 4YCVA 2KCMA 2NZOA 3PGZA 4GN5A 1HR0L 2IY5B 1KHIA 3KLWA 4P73A 5GAHC 4A3LG 3K80C 1VQFA 4DV0Q 1PH4A 1TWFH 5C4JH 2DUDA 1M90C 3HOUG 1N32L 4IPGA 4AIMA 4JI4L 2OQKA 2YYZA 3CXCA 4C3IH 4KI0A 2VQFQ 3OW2A 4TVAB 3MEFA 1ASYA 1HZAA 1SR3A 2XGTA 3GO5A 2YTVA 4JCVE 4JI8Q 1G51A 5IYBH 5C3EH 1C7YA 2N8NA 3ER0A 1HNZQ 1DGSA 3BJUA 2GVAA 4AYBE 5LMNQ 4GKKQ 1PH2A 4GOPB 2R7ZH 1MJCA 2YTYA 4YWKA 2LSSA 5FLMH 4QGUA 1WCMH 4L5TA 4C2MH 1TWCH 2UUBQ 2PMZE 2YU9H 3WWVA 4X65Q 4DR1Q 3HOVH 1YNXA 1PH7A 5C44H 4A3FG 1XPOA 3CCLA 4NXML 4LF8L 3I4MG 1W3SA 1JT8A 4UP8A 4YY3L 1U0LA 4LUVA 1L1OB 3D0FA 2CWPA 1IL2A 3I4NH 1K73C 4JI2L 1WCMG 2A19A 3FKIG 1EWIA 5IT9c 2R7FA 1XNRL 2UXBQ 3U4VA 3CMAA 4GKKL 4JI1L 2UUCL 1YVCA 3I7FA 1HNZL 1XJVA 2EQSA 2E5LQ 4JV5Q 1E7ZA 2MNAA 4JBMA 2Q2TA 3I4MH 1Y1WG 4O2DA 4IPHA 3G6EA 1R9TH 4BA2I 3K8AA 1NBWA 3KJOA 4DAYB 4GLXA 2RHSB 4DV2Q 4JI6L 2Q2HA 3HFZB 3ERSX 2R92H 2KHJA 1PV4A 1UE6A 2OQ0A 3EN2A 1VQ6A 4DV0L 1HR0W 4LF9Q 4BY7G 1Z9FA 1X6OA 1QUQB 1I50H 3KF8B 3OTOQ 4GOPC 2AWOA 1S72A 4KHPL 4X66Q 1VQCA 2R6GA 3MXNB 3IRBA 3CW2C 1VQIA 1HNXL 3D31A 1L1OA 4DNIA 4OWXB 4JC0A 2E2IH 1LYLA 3S1MH 4GN3B 4IPCA 1E22A 2WB1G 4PZ8A 1VQ9A 4JI3Q 2Q2UA 4LF5L 4BY1G 1X3GA 1J5EQ 1YJWA 4DR2Q 2E2JH 2N78A 3A5ZB 3A74A 5J3BA 4GNXC 1VQHA 5BR8Q 4Y7NH 3VDYA 1GD7A 1VQAA 4DV1L 2ZTDA 4LF4L 2Y0SE 4RMFA 1CKNB 5C0XG 2LXKA 3CPWA 4POGA 2OTJA 5HY6A 3J7ZC 4KHZA 4LFAQ 3GTLH 1KAWA 2JEAI 5GQOA 4DAMA 1VQNA 1GO3E 3KFUA 4LFBQ 2VS1A 4X64L 4NB3A 3J80i 3FP9A 2HIVA 3RLNA 1WOCA 4JI2Q 2D0PA 5M5XH 1XPRA 1TWAH 5K36G 3HOWG 1PH6A 3F2CA 2EXDA 2UXDQ 5IYDG 5IP9G 2R92G 4A3KG 5ELOA 3CD6A 2VW9A 4X65L 4YCWA 3PO3G 3PUWA 3J7A5 3ULPA 4BBRG 4APVA 3CCSA 1Q1EA 1A62A 1CKOA 3TS2A 4LW1A 3CCEA 1N9WA 4BY7H 3KDFA 1YEZA 3PF4A 4UY8C 1UEBA 2JE6I 2PI2A 2RCNA 3A0JA 4UP9A 3STBC 5AJ3L 2D62A 3J81c 5JEAJ 3H3VI 3E9IA 2PNHA 4IJLA 1VQ8A 1SLJA 4LF6L 1I3QH 1K0RA 1Q86C 3CQZH 5IE8A 3T1HL 1IXRA 4IO9A 3HKZE 2WFWA 1IYJB 2VY3A 4JOIC 2K5NA 3M7NA 3G4SA 4A3FH 1E3PA 4DUYQ 2A8VA 2JA7G 5LMUQ 2BA1A 1IZ6A 4IFDG 3RLOA 2VQFL 1H95A 2JEBI 1UE5A 1VQ5A 3S2DH 4BBSG 1N32Q 4X6AH 4A3DG 1P8LA 5FLXc 4A3MG 4HIDA 3FKIH 3UE1A 3T1HQ 1B7YB 3GTMH 3I4NG 1T9HA 2BH2A 2NVXH 2UXCL 4DR4Q 3CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5F A;  3HOY H;  3S1N H;  5GRO A;  1CSP A;  1EFW A;  2I0Q A;  1GVP A;  1QVC A;  2BH8 A;  3BU2 A;  1L0W A;  3SGI A;  2VQE L;  5FJ8 G;  2HHH Q;  4DR7 L;  1XTD A;  2VNU D;  2VUM H;  3S15 H;  2GVB A;  5GAG C;  5FLM G;  3CF5 A;  2QA4 A;  2Z6K C;  1X9N A;  4DV4 Q;  4IPD A;  2Q2I A;  1YBY A;  4C3J H;  4C3H H;  5LMU L;  4A3G H;  3PIO A;  1OXV A;  2CWA A;  4A3B G;  2UXD L;  3OYY A;  1IBM Q;  1IBK L;  3U58 A;  4YHH Q;  3F2B A;  4DR5 Q;  2NN6 G;  4A3K H;  4LF4 Q;  1HZB A;  3HOY G;  2JQO A;  4LFA L;  1CSQ A;  1J6Q A;  5C0X J;  2RF4 A;  4A93 G;  2D0O A;  4GLA C;  2ALY B;  4DV4 L;  1Q81 C;  3HOX H;  4JI4 Q;  2ASB A;  4J15 A;  1JMC A;  1RL2 A;  4YCU A;  4ME3 A;  1SRU A;  4EX5 A;  4AH6 A;  1N34 L;  2VQE Q;  2HHH L;  3I2Z A;  3LGJ A;  1QUQ A;  3JC6 6;  1NJI C;  1K9M C;  1N33 Q;  4GKJ Q;  4PZ7 A;  2WAQ G;  5ELN A;  4GS3 A;  3HKS A;  3CCR A;  3Q8D A;  3NEL A;  1NY4 A;  3M4Q A;  4DV5 L;  5M5Y H;  3K81 C;  3NEN A;  2Y0S G;  4P71 A;  3M9B A;  2AWN A;  4A3I G;  3PO2 H;  4HIK A;  1PFS A;  3L7Z C;  3NBH B;  4A3M H;  5M3F H;  1VCI A;  3EBE A;  2R7Z G;  3UE0 A;  4OWT B;  2K50 A;  3ZJY C;  2WAQ E;  4B3T L;  4JI5 L;  1HZ9 A;  1U5K A;  1XNQ Q;  2K52 A;  1FVI A;  4QY7 A;  1N8R C;  3PO3 H;  3E9H A;  4A3J G;  1AE2 A;  1J5E L;  4GLV B;  4JG2 A;  1WYD A;  5EAY A;  1LTL A;  3PUX A;  4IFD I;  2QEX A;  3DLL A;  5M5W H;  1XNR Q;  3TS0 A;  5AJ3 Q;  2ZJR A;  5LMN W;  2JA8 H;  3GTO H;  2H5X A;  4JYA Q;  2E5L L;  4JV5 L;  1XMO L;  1JJ2 A;  3U4Z A;  4QQB X;  2CFM A;  3K7U C;  2I5H A;  4QIW E;  2UXB L;  4A75 A;  4DKA C;  1EUJ A;  4A3J H;  4NXM Q;  4RG1 A;  3A5U A;  1PH9 A;  3M85 A;  1CKM A;  1YHA A;  3GTK H;  2N49 A;  1RIP A;  1Y1V G;  5M3M G;  4BXX H;  4LFC Q;  3HOX G;  3HOW H;  2A1A A;  1QZG A;  2CCZ A;  1BBW A;  2ZJQ A;  1EQR A;  2IT1 A;  1Q8K A;  4OX9 L;  1VS0 A;  2IX0 A;  3E0E A;  1BVS A;  3GTP H;  3HOV G;  1L1O C;  4UP7 A;  3BZK A;  5GAE C;  1A8V A;  4YHH L;  5IY0 A;  2E8G A;  1C0A A;  5LMN L;  4JI0 L;  2B63 G;  1Q46 A;  4DUY L;  5C4X H;  4YY3 Q;  1K83 H;  4A3G G;  2OCE A;  3S1R H;  4BY1 H;  1Q7Y C;  1YHQ A;  3T1Y Q;  3AQQ A;  3M3Y H;  3S17 H;  1P16 A;  2WB1 E;  3CPF A;  1PYS B;  2R7D A;  4DR6 Q;  2N3S A;  1NMG A;  4POF A;  4A3E G;  1VQB A;  3KJP A;  4OO1 I;  1SRO A;  3TRE A;  1MJE A;  4LFB L;  4DR4 L;  2JA5 H;  3RLF A;  3KF6 A;  1E1O A;  3GTG H;  4JYA L;  2AKW B;  3GD7 A;  1C9O A;  2AMC B;  4DV1 Q;  4JI8 L;  4IFD J;  4A3L H;  2NVY H;  2ZM6 Q;  5BR8 L;  5DLQ E;  5FJ8 H;  1VQP A;  1QVF A;  1SN8 A;  4X64 Q;  1EIY B;  2CKZ B;  2IHF A;  1YI2 A;  3AEV A;  1I94 L;  4DUZ Q;  2PQA A;  4R4C A;  5JEA G;  5IP7 H;  4K0K L;  3RZD H;  2C35 B;  2UUA Q;  1X55 A;  3EIV A;  1L2F A;  4A4I A;  1Y1V H;  4B3R Q;  1MKH A;  2I5M X;  2JA5 G;  1X3F A;  4JOI A;  1O7I A;  4PMW A;  4DR2 L;  4DR3 L;  1G29 1;  2UU9 L;  4B3M L;  3F2D A;  1Q1B A;  3K7A H;  4XTC S;  4P75 A;  1B70 B;  5C3E G;  3RR5 A;  4NXN Q;  2FXQ A;  1HZC A;  1HNW Q;  1JJC B;  1PH1 A;  1JJG A;  1UWV A;  1X56 A;  3HKZ G;  1N34 Q;  4WJ3 M;  4R4Q A;  1HNX Q;  4DR3 Q;  2UU9 Q;  3JAM i;  3K0X A;  1KRT A;  4B3M Q;  4JI0 Q;  3M4O H;  1Y14 B;  2YTX A;  4IOA A;  1GM5 A;  1WFQ A;  3FHW A;  4R4T A;  3S24 A;  1Z47 A;  2ES2 A;  3HOZ G;  2HQL A;  5C0X I;  4HJ7 A;  4L5S A;  4B3R L;  1FL0 A;  3GDE A;  2UXC Q;  4B3S Q;  2ID0 A;  1FJG L;  3CME A;  3CCQ A;  1IBM L;  4LF7 Q;  2VL6 A;  4JI7 L;  3M4P A;  2NZH A;  1OTC A;  2PQA B;  3U50 C;  5IYD H;  2NVT H;  4DV2 L;  4JI6 Q;  2Z6K A;  3KYH C;  1VQ4 A;  3G71 A;  3RZO H;  1CKN A;  4X62 L;  1K8A C;  5JJK A;  1QVG A;  3TQY A;  3S14 H;  3KDF B;  1YIJ A;  1YJ9 A;  5JJI A;  3PUY A;  4XIG S;  3PIP A;  5GAD C;  3I56 A;  1OXU A;  3STB D;  3J81 i;  1IBL L;  3H0G H;  1TXY A;  3PUZ A;  1HH2 P;  4BBS H;  4HJ8 A;  3UDG A;  2L15 A;  2F52 A;  1KXL A;  5IWA L;  2JA7 H;  2ZJP A;  1V43 A;  5E7N A;  1VQE A;  1SMX A;  2K4K A;  4QL5 A;  3H0G G;  4HJA A;  1WJJ A;  3W5O A;  1YHB A;  1QZH A;  1E1T A;  2UUA L;  4GOP A;  2JA8 G;  4JBJ A;  1PYB A;  4MTN A;  1EQQ A;  4L5Q A;  4YWL A;  4A93 H;  1K8G A;  2F4V L;  4R4O A;  1UE7 A;  2KCT A;  1VQG A;  4DV7 Q;  1N36 L;  4B3T Q;  4X62 Q;  1PVO A;  3RN2 A;  1OXX K;  2ZTE A;  1TWG H;  1SFO H;  3W1G A;  1OXS C;  1EIF A;  1SE8 A;  4JBK A;  4A3B H;  4AQY Q;  4A3C G;  4DV5 Q;  2R93 G;  4OX9 Q;  3HOZ H;  2F3I A;  4A3I H;  4LUZ A;  4P74 A;  3PO2 G;  4OON A;  3DM3 A;  2OWO A;  2VUM G;  1FGU A;  2IHE A;  3H15 A;  2MO1 A;  3BZC A;  2I5L X;  3PSI A;  1Y1W H;  1VQ7 A;  1X65 A;  1YIT A;  1KQS A;  3H3V H;  3S2H H;  4TQU S;  4NXN L;  3AFP A;  4GNX B;  3J80 c;  3T1Y L;  2MFI A;  1HNW L;  2XTI A;  2RHQ B;  4OXP A;  4KLK A;  2HT1 A;  2IX1 A;  1VQM A;  2V1C C;  2UUB L;  3ICE A;  2VZA A;  1OXT A;  4L5R C;  3CC4 A;  4OO1 G;  4HIO A;  1XMO Q;  5IP7 G;  1CUK A;  2K5H A;  4DR5 L;  3OTO L;  3PF5 A;  3NEM A;  2E2H H;  4UPA A;  1PH8 A;  3PV0 A;  4IOC A;  2KBN A;  3S16 H;  1KRS A;  3UDX A;  4DUZ L;  3S1Q H;  4A3E H;  1X54 A;  3AFQ A;  1GKH A;  5C44 G;  5JJL A;  4AQY L;  4DV3 Q;  2ATW A;  1AH9 A;  1PHJ A;  3L2P A;  2BA0 A;  3UDI A;  5IYC G;  2HIX A;  3PCO B;  4LFC L;  2ZM6 L;  4LUO A;  2K5V A;  4LNQ A;  3HOU H;  2B29 A;  2MO0 A;  1HJP A;  4PG3 A;  1A63 A;  3F8T A;  4PZ6 A;  4DV6 Q;  1E24 A;  1PH3 A;  1TWH H;  4LF5 Q;  1YZ6 A;  3PUV A;  4A3C H;  4KHP Q;  1BBU A;  5IYC H;  4R4I A;  3KF6 B;  4BA1 I;  1EOV A;  4AYB G;  4NPS A;  4YWM A;  4GNX A;  5IYB G;  1G6P A;  4GKJ L;  1HR0 Q;  1X3E A;  1NTG A;  4LF9 L;  2JJQ A;  2AHO B;  4DV6 L;  5IWA Q;  3CC7 A;  2NN6 I;  1W2B A;  1EYG A;  1D7Q A;  4FDB A;  1D8L A;  1WI5 A;  1Q12 A;  4LWC A;  1XMQ Q;  1KL9 A;  2JA6 G;  1VQD A;  4DK6 C;  5HGQ A;  1IBL Q;  4GN4 B;  4DR6 L;  5C4X G;  1XPU A;  1VQJ A;  1B8A A;  2CQO A;  1NE3 A;  3AYH B;  4O0A A;  1K3R A;  1N36 Q;  4OWW B;  2B63 H;  4A3D H;  4DV7 L;  4JI3 L;  3CCJ A;  2F4V Q;  4LF6 Q;  3GTQ H;  2YV5 A;  4JI1 Q;  1VQL A;  3I4O A;  4DK3 C;  2UUC Q;  4JI5 Q;  1I6H H;  4HJ9 A;  1LUZ A;  2LXJ A;  5H1S E;  1S40 A;  1KD1 C;  1IBK Q;  4JI7 Q;  1BKB A;  4LF7 L;  4BXX G;  1JE5 A;  4JBW A;  2GN5 A;  1FJG Q;  3RN5 A;  1VQK A;  3CCU A;  1NMF A;  4HIM A;  4QJF A;  4DR1 L;  1N33 L;  3W1B A;  3B6Y A;  1JB7 A;  2R93 H;  4WJ4 A;  2Z0S A;  1XMQ L;  4ALP A;  1ASZ A;  3RNU A;  4LF8 Q;  3UDF A;  1PH5 A;  4EQ5 A;  4DPG A;  4DR7 Q;  4MNO A;  1LM0 A;  2KEN A;  4HJ5 A;  3KOJ A;  1Q82 C;  4IJH A;  3CP0 A;  2DGY A;  2B3G A;  1VQO A;  3TRZ A;  2K14 A;  3CCV A;  2K75 A;  3L0O A;  2OTL A;  4A76 A;  3I55 A;  2NVQ H;  4Y52 H;  3TEH B;  1KIX A;  1UE1 A;  2EIF A;  1M1K C;  4R1J A;  4B3S L;  2JA9 A;  1A0I A;  2WP8 J;  4BBR H;  3GTJ H;  3CC2 A;  1AE3 A;  4K0K Q;  4P72 A;  1I94 Q;  2KHI A;  1S3O A;  5IP9 H;  1MIU A;  2MQH A;  3ULL A;  3JAM c;  4H02 A;  5M3F G;  4DV3 L;  1XNQ L;  4MZ9 A;  1V9P A;  2JA6 H;  2ZTC A;  3G48 A;  2JK8 A;  3CAM A;  1PA6 A;  2PI2 E;  1KC8 C;  5M3M H;  1V1Q A;  1YJN A;  2QGQ A;  3ULJ A;  4X66 L;  3J81 j;  3F1Z A;  4YCV A;  2KCM A;  2NZO A;  3PGZ A;  4GN5 A;  1HR0 L;  2IY5 B;  1KHI A;  3KLW A;  4P73 A;  5GAH C;  4A3L G;  3K80 C;  1VQF A;  4DV0 Q;  1PH4 A;  1TWF H;  5C4J H;  2DUD A;  1M90 C;  3HOU G;  1N32 L;  4IPG A;  4AIM A;  4JI4 L;  2OQK A;  2YYZ A;  3CXC A;  4C3I H;  4KI0 A;  2VQF Q;  3OW2 A;  4TVA B;  3MEF A;  1ASY A;  1HZA A;  1SR3 A;  2XGT A;  3GO5 A;  2YTV A;  4JCV E;  4JI8 Q;  1G51 A;  5IYB H;  5C3E H;  1C7Y A;  2N8N A;  3ER0 A;  1HNZ Q;  1DGS A;  3BJU A;  2GVA A;  4AYB E;  5LMN Q;  4GKK Q;  1PH2 A;  4GOP B;  2R7Z H;  1MJC A;  2YTY A;  4YWK A;  2LSS A;  5FLM H;  4QGU A;  1WCM H;  4L5T A;  4C2M H;  1TWC H;  2UUB Q;  2PMZ E;  2YU9 H;  3WWV A;  4X65 Q;  4DR1 Q;  3HOV H;  1YNX A;  1PH7 A;  5C44 H;  4A3F G;  1XPO A;  3CCL A;  4NXM L;  4LF8 L;  3I4M G;  1W3S A;  1JT8 A;  4UP8 A;  4YY3 L;  1U0L A;  4LUV A;  1L1O B;  3D0F A;  2CWP A;  1IL2 A;  3I4N H;  1K73 C;  4JI2 L;  1WCM G;  2A19 A;  3FKI G;  1EWI A;  5IT9 c;  2R7F A;  1XNR L;  2UXB Q;  3U4V A;  3CMA A;  4GKK L;  4JI1 L;  2UUC L;  1YVC A;  3I7F A;  1HNZ L;  1XJV A;  2EQS A;  2E5L Q;  4JV5 Q;  1E7Z A;  2MNA A;  4JBM A;  2Q2T A;  3I4M H;  1Y1W G;  4O2D A;  4IPH A;  3G6E A;  1R9T H;  4BA2 I;  3K8A A;  1NBW A;  3KJO A;  4DAY B;  4GLX A;  2RHS B;  4DV2 Q;  4JI6 L;  2Q2H A;  3HFZ B;  3ERS X;  2R92 H;  2KHJ A;  1PV4 A;  1UE6 A;  2OQ0 A;  3EN2 A;  1VQ6 A;  4DV0 L;  1HR0 W;  4LF9 Q;  4BY7 G;  1Z9F A;  1X6O A;  1QUQ B;  1I50 H;  3KF8 B;  3OTO Q;  4GOP C;  2AWO A;  1S72 A;  4KHP L;  4X66 Q;  1VQC A;  2R6G A;  3MXN B;  3IRB A;  3CW2 C;  1VQI A;  1HNX L;  3D31 A;  1L1O A;  4DNI A;  4OWX B;  4JC0 A;  2E2I H;  1LYL A;  3S1M H;  4GN3 B;  4IPC A;  1E22 A;  2WB1 G;  4PZ8 A;  1VQ9 A;  4JI3 Q;  2Q2U A;  4LF5 L;  4BY1 G;  1X3G A;  1J5E Q;  1YJW A;  4DR2 Q;  2E2J H;  2N78 A;  3A5Z B;  3A74 A;  5J3B A;  4GNX C;  1VQH A;  5BR8 Q;  4Y7N H;  3VDY A;  1GD7 A;  1VQA A;  4DV1 L;  2ZTD A;  4LF4 L;  2Y0S E;  4RMF A;  1CKN B;  5C0X G;  2LXK A;  3CPW A;  4POG A;  2OTJ A;  5HY6 A;  3J7Z C;  4KHZ A;  4LFA Q;  3GTL H;  1KAW A;  2JEA I;  5GQO A;  4DAM A;  1VQN A;  1GO3 E;  3KFU A;  4LFB Q;  2VS1 A;  4X64 L;  4NB3 A;  3J80 i;  3FP9 A;  2HIV A;  3RLN A;  1WOC A;  4JI2 Q;  2D0P A;  5M5X H;  1XPR A;  1TWA H;  5K36 G;  3HOW G;  1PH6 A;  3F2C A;  2EXD A;  2UXD Q;  5IYD G;  5IP9 G;  2R92 G;  4A3K G;  5ELO A;  3CD6 A;  2VW9 A;  4X65 L;  4YCW A;  3PO3 G;  3PUW A;  3J7A 5;  3ULP A;  4BBR G;  4APV A;  3CCS A;  1Q1E A;  1A62 A;  1CKO A;  3TS2 A;  4LW1 A;  3CCE A;  1N9W A;  4BY7 H;  3KDF A;  1YEZ A;  3PF4 A;  4UY8 C;  1UEB A;  2JE6 I;  2PI2 A;  2RCN A;  3A0J A;  4UP9 A;  3STB C;  5AJ3 L;  2D62 A;  3J81 c;  5JEA J;  3H3V I;  3E9I A;  2PNH A;  4IJL A;  1VQ8 A;  1SLJ A;  4LF6 L;  1I3Q H;  1K0R A;  1Q86 C;  3CQZ H;  5IE8 A;  3T1H L;  1IXR A;  4IO9 A;  3HKZ E;  2WFW A;  1IYJ B;  2VY3 A;  4JOI C;  2K5N A;  3M7N A;  3G4S A;  4A3F H;  1E3P A;  4DUY Q;  2A8V A;  2JA7 G;  5LMU Q;  2BA1 A;  1IZ6 A;  4IFD G;  3RLO A;  2VQF L;  1H95 A;  2JEB I;  1UE5 A;  1VQ5 A;  3S2D H;  4BBS G;  1N32 Q;  4X6A H;  4A3D G;  1P8L A;  5FLX c;  4A3M G;  4HID A;  3FKI H;  3UE1 A;  3T1H Q;  1B7Y B;  3GTM H;  3I4N G;  1T9H A;  2BH2 A;  2NVX H;  2UXC L;  4DR4 Q;  3CCM A; 
#chains in the Genus database with same CATH topology
 1I5F A;  2CQA A;  5GRO A;  1F9P A;  2I0Q A;  1B6R A;  3SGI A;  2K03 A;  2OEO A;  3S15 H;  5L1L A;  2GVB A;  5GAG C;  5FLM G;  3CF5 A;  1IBM H;  2X69 A;  4KKT A;  2MHV A;  4IPD A;  4C3J H;  4GZY C;  5FD6 A;  3OSO A;  2F0J A;  1OXV A;  2CWA A;  2VUG A;  5CC4 A;  4DUY H;  1BNZ A;  2CH4 W;  1IBK L;  2UUB H;  2AGQ A;  4DR5 Q;  2NN6 G;  5EWE A;  1O78 A;  5C0X J;  1TWG A;  3C46 A;  4ED0 A;  1LAB A;  4J15 A;  3BZD B;  4EGV A;  2DY8 A;  4ME3 A;  1SRU A;  3FMC A;  2VQE Q;  1XWE A;  2NVX B;  2Y0S B;  5KG6 A;  3LGJ A;  4A3I B;  1K9M C;  4IFD H;  2LS0 1;  1N33 Q;  1I3Q A;  3MFI A;  4IRD A;  5KG0 A;  4DR4 H;  1R9T A;  4EGJ A;  4GS3 A;  3NEL A;  5FO7 B;  4DV5 L;  2E76 C;  2O5J C;  3NEN A;  2PCF B;  3M9B A;  2AWN A;  1GSO A;  1AW7 A;  1PFS A;  4U68 A;  4HIK A;  5IT9 E;  5M3F H;  1T5X D;  1U5K A;  3WOE A;  2E2J B;  4DAP A;  1CTM A;  2K7V A;  4X3S A;  3E9H A;  4A3J G;  3KK7 A;  2SOB A;  4GLV B;  3H20 A;  3G7L A;  1AFP A;  3PUX A;  3DLL A;  3T5L A;  3GTJ A;  1BXR A;  4K6D A;  3TS0 A;  2WB1 B;  5I6Y A;  3GTO H;  4QW9 A;  2E5L L;  4JV5 L;  1XMO L;  2YS6 A;  1WTQ A;  3WDN A;  3FEW X;  4A75 A;  4DKA C;  1EUJ A;  3M4I A;  4RG1 A;  1PH9 A;  5KFE A;  3R2I A;  4BS9 A;  1YHA A;  2JA5 B;  3GTK H;  3FRP B;  4JI7 H;  2W6M A;  4LFC Q;  2A1A A;  1QZG A;  1LT4 D;  2G9H D;  3RV3 A;  4FS1 A;  1QJO A;  2CCZ A;  1SMY C;  3J80 E;  3S2D B;  4ZRZ A;  2W7O A;  1RDP D;  2IX0 A;  1BVS A;  3GTP H;  4J9L A;  2FJ2 A;  3HOV G;  4IR9 A;  2MPM A;  3BZK A;  4RHS A;  1LTR D;  5GAE C;  3K58 A;  4YBZ B;  5LMN L;  3PW5 A;  4BBS B;  4JI0 L;  1CK1 A;  4LH6 A;  1Q46 A;  3N43 B;  2BR0 A;  1K83 H;  4HAE A;  4RFB A;  3R5F A;  2CVR A;  3S1R H;  1MGS A;  1YHQ A;  2M9V A;  3T1Y Q;  3M3Y H;  3QWN A;  1B9N A;  1KLU D;  3K6O A;  3BA8 A;  4RB3 C;  4OO1 I;  1MJE A;  2M00 A;  1U4L A;  3LML A;  4OIK A;  4A3F B;  3KF6 A;  5C3W A;  3L4K A;  4DV2 H;  5D1O B;  3RFC A;  1I6V C;  1O7L A;  1QVF A;  3RF2 A;  2PNR C;  1UC8 A;  1K28 A;  4H44 C;  5IGE A;  1DOK A;  2F0N A;  2IHF A;  3QG1 A;  4X64 Q;  4A93 B;  1I94 L;  3PW2 A;  1HNZ H;  4G7Z C;  4L63 B;  4DUZ Q;  4K0K L;  2UXB H;  4DK1 A;  2UUA Q;  4DV1 H;  5KG3 A;  3X3M A;  5C4J B;  3O13 A;  5T1I A;  5KG5 A;  5LL6 S;  4B3R Q;  1MKH A;  2W9B B;  3M9M B;  3QOL A;  1O7I A;  2EY2 A;  2ICE C;  4PMW A;  2UU9 L;  4B3M L;  4EYI B;  3F2D A;  1Q1B A;  3GTL B;  3K7A H;  4XTC S;  1QOH A;  4P75 A;  5L37 A;  5C3E G;  1U4M A;  4NXN Q;  4UCO A;  2AQ1 B;  1JJG A;  3GID A;  5T14 A;  1UWV A;  4B9W A;  3J80 L;  4MV3 A;  4EYH B;  1HNX Q;  4DR3 Q;  3JAM i;  3KLR A;  2YTX A;  2FB9 A;  1WFQ A;  2IL8 A;  3FHW A;  3GV3 A;  4R4T A;  3S24 A;  2ES2 A;  2HQL A;  3HOZ G;  2L9H A;  1FL0 A;  2ID0 A;  5KFP A;  5FK9 C;  1JIH A;  2JEF A;  4JI7 L;  2V4D A;  3GV5 B;  2RQX A;  2PQA B;  3U50 C;  2WKD A;  5G3L D;  5IYD H;  4DV2 L;  3TQ1 A;  2Z6K A;  2KEC A;  3G71 A;  2DWC A;  4X62 L;  1K8A C;  2F0W A;  3H3V C;  1LT3 D;  3PIP A;  4ZLT F;  1FNU A;  4LFC H;  1SCU B;  1W6J A;  1CE8 A;  1TAE A;  1BDO A;  1ZYR C;  1F9S A;  4C3J B;  1E4E B;  5JVG 3;  1VQE A;  1V4Y A;  2R7L A;  4QL5 A;  4HJA A;  2HVR A;  1A3T A;  2K1B A;  1E1T A;  3GV6 A;  2F0Q A;  3NWT A;  4GOP A;  3PO3 B;  5BPH A;  4NW2 A;  5EPJ A;  1C8C A;  1EQQ A;  4L5Q A;  1VBH A;  1ZET A;  1D5Z C;  1E2W A;  3NTI A;  4YR3 A;  4EEQ A;  1PRT B;  1G2S A;  4IUQ A;  1OXX K;  2A69 D;  1SFO H;  3W1G A;  4A3C G;  2NVQ B;  4A3B H;  1XMQ H;  2NBF A;  4M8A A;  5C4Z A;  4OX9 Q;  3HOZ H;  1I7N A;  1TWH B;  1TY2 A;  5EWF A;  1HR0 H;  2B2V C;  1SYD A;  3DM3 A;  1FGU A;  2EYM A;  3H15 A;  4I50 F;  1KNE A;  2J4X A;  2MO1 A;  3OWE B;  4IN3 A;  3RB0 A;  1RTN A;  2EDG A;  1IOW A;  4CGY B;  2F0D A;  1EWC A;  4TQU S;  3GV8 B;  4NXN L;  3AFP A;  4N9P A;  4PNY A;  5I2Y A;  1KTK A;  4IUP A;  4MAM A;  3T5J A;  4OL7 A;  2UUB L;  2FMM A;  3FPU B;  1QCB D;  3SR1 A;  3GTL A;  4F4Y A;  2K5H A;  4R8I A;  3OTO L;  2JXM B;  3R93 A;  5D3D A;  1PH8 A;  2HJW A;  1PXU A;  5M5W B;  1QWY A;  3UDX A;  4DUZ L;  3S1Q H;  4ZOL F;  2DPJ A;  4BY1 B;  4ZUJ A;  4AQY L;  3BG3 A;  3HBL A;  4YP3 A;  2F0O A;  1D5X C;  4FXD A;  1Z2P X;  4HNT A;  3UDI A;  4O3Q A;  3PCO B;  2BQ3 A;  1UNN C;  4LNQ A;  3HOU H;  2B29 A;  4PG3 A;  5HV6 A;  2O4X A;  4PZ6 A;  1PH3 A;  4LF5 Q;  1SNC A;  4A3C H;  4RZR A;  3NBH A;  1XXG A;  4UDU C;  4R4I A;  2B2Y A;  1LT5 D;  3MAQ A;  3PIO 3;  3J81 W;  2EY6 A;  4GNX A;  1I4R A;  2XGP A;  1VBG A;  4GKJ L;  4ED6 A;  4MN3 A;  4O2A F;  1RJP A;  1J9O A;  1W2B A;  3DM1 A;  3RV4 A;  4FDB A;  1B04 A;  2E2D C;  1EU3 A;  3E5N A;  1CHQ D;  3T16 A;  1IBL Q;  1IL8 A;  1TWG B;  3TME A;  2AQ4 A;  1VQJ A;  1B8A A;  2CQO A;  5ELC A;  1N36 Q;  1EU4 A;  2FIN B;  3GQB A;  2NYZ D;  3HZX A;  3NP8 A;  3CCJ A;  1EUD B;  2XWJ B;  4RKB A;  1CZG A;  1H9M A;  4JI5 Q;  3GTK B;  4I55 F;  1YNJ D;  1NR4 A;  2F03 A;  1KD1 C;  1BR9 A;  1DV2 A;  4JI7 Q;  3PR4 A;  1JE5 A;  4EFE A;  2R8G A;  3RN5 A;  4C56 C;  5LXT F;  1NMF A;  2FFK B;  1I4P A;  4QJF A;  1JB7 A;  1B2T A;  5KYL A;  3RGZ A;  1VF5 C;  4RNN A;  1ASZ A;  5DQI A;  4DNT B;  2WV6 D;  4Y7N B;  4MNO A;  2JYO A;  2JA5 A;  3D8G A;  5CYU A;  4IJH A;  3M3Y B;  1UAP A;  3ERQ A;  3J7A F;  3CCV A;  5C44 B;  3L0O A;  1I6U A;  3IFD A;  4RGO S;  2NVQ H;  1JWM D;  4Y52 H;  3D6C A;  2JA9 A;  3CC2 A;  2YYA A;  2RDJ A;  4K0K Q;  4GC7 A;  4IRK A;  4P72 A;  4YJ3 F;  2RKS A;  2A5H A;  2W6O A;  1SE3 A;  5IP9 H;  5C5M A;  2MQH A;  3CQZ B;  3JAM c;  4H02 A;  4E4T A;  4X66 H;  1XNQ L;  2AU0 A;  1V9P A;  3NXW A;  2JA6 H;  1IKM A;  5CA0 F;  5LYJ F;  2IWH A;  1KC8 C;  5C5J A;  2FPI B;  3N52 A;  3ORQ A;  4B08 A;  4B9X A;  5M5X B;  1RJT A;  1HR0 L;  3CKI B;  4GN5 A;  3HOX B;  2DNE A;  1EOT A;  4HR7 A;  4XYM B;  1PH4 A;  3GTQ A;  1K83 A;  4B3S H;  4AIM A;  5KGU A;  5LL6 X;  2OQK A;  3MA2 B;  4C3I H;  1JOO A;  1ET6 A;  1HZA A;  1AZP A;  1KXL A;  2L4N A;  1TWC A;  2FMA A;  2AQ2 B;  4XX0 B;  2K28 A;  3ER0 A;  4ECT A;  1HNZ Q;  4JVZ A;  1WD1 A;  5LMN Q;  4MIU A;  1AUV A;  4Q45 A;  4DR3 H;  4LAA A;  4YWK A;  1XYI A;  1N36 H;  3RIZ A;  1X3P A;  4OO1 H;  4HCS A;  4HNU A;  2PMZ E;  4Q8E A;  5JEA H;  2XCP A;  3FKI B;  1YNJ C;  1PH7 A;  1EL0 A;  3GII A;  4FO2 A;  1GSA A;  1PRT C;  1U0L A;  1TS4 A;  4A3K B;  2A19 A;  2B2V A;  1ZQ7 A;  2OLS A;  1XNR L;  2R7F A;  4IUN A;  3HEJ A;  4CKE A;  3K59 A;  4GKK L;  4JI1 L;  3T1Y H;  1C30 A;  4TUY F;  5LA6 F;  2MNA A;  3DHQ A;  4DL4 A;  2K5W A;  3I8Z A;  4IPH A;  1R9T H;  2PPB C;  3K8A A;  1NBW A;  2IA6 A;  1B3A A;  4JI6 L;  3IG0 A;  2XNA C;  2R92 H;  1PV4 A;  2C00 A;  1UE6 A;  2OQ0 A;  1I6H B;  1HRJ A;  4C3I G;  3KHL A;  1PZJ D;  3BQ0 A;  4HMJ A;  2WII B;  3V6K A;  1QUQ B;  1I50 H;  2NVX A;  4KHP L;  4RCO A;  3KHH A;  4X66 Q;  1VQC A;  1ZKO A;  1S0N A;  2PQE A;  3DWA A;  3S1M H;  4O4H F;  3WNZ A;  1EEI D;  4IPC A;  4UCV A;  2I80 A;  5KFM A;  2WB1 G;  2JA6 A;  3BVM A;  2Q2U A;  1R4Q B;  2I87 A;  4LF5 L;  1RHP A;  1VMP A;  1YJW A;  2HCC A;  4IAJ A;  3Q2O A;  4X62 H;  3A74 A;  4DN4 M;  5F9N A;  4GNX C;  5KFA A;  2K5Q A;  4POG A;  2OTJ A;  3CPW A;  2CHB D;  4KHZ A;  3GTL H;  4QMG A;  4X64 L;  4NB3 A;  2J6U A;  2C2D A;  3K5O A;  4KHV A;  1EZ1 A;  5K36 G;  2KVM A;  2F1M A;  3DF7 A;  4G4K A;  1X32 A;  4CKC A;  1A2U A;  5IP9 G;  5A2Q E;  2R92 G;  2NN6 H;  5ELO A;  2BQR A;  3CD6 A;  4AYB B;  4LF7 H;  4TSS A;  3D4W A;  4LFB H;  3J7A 5;  4MV6 A;  1Q1E A;  1CKO A;  1STN A;  3TS2 A;  1NNX A;  2NB0 A;  4BY7 H;  3N42 B;  2RCN A;  5IWA H;  2PI2 A;  3K5N A;  4NP5 A;  1SJH D;  3H3V I;  3E9I A;  1V51 A;  4BWS C;  1TS5 A;  4DR7 H;  1DZ1 A;  2LY7 A;  1I3Q H;  1K0R A;  1Q86 C;  5IE8 A;  1GLV A;  1IXR A;  1IYJ B;  2WYO A;  4LMQ D;  4A3F H;  2UXC H;  5KG2 A;  3VMM A;  2BA1 A;  2VQF L;  2L5T A;  4DAY A;  1UE5 A;  3F8N A;  3S2D H;  4IRC A;  1P8L A;  2I46 A;  4HID A;  5E1F A;  3OHX C;  3UE1 A;  4BWG B;  3T1H Q;  2UVV A;  1B7Y B;  4P2C B;  2RA4 A;  1KJ9 A;  2RBM A;  4J9O A;  4ZYS A;  3GTQ B;  4CDF C;  2UXC L;  3C1F A;  4NLG A;  2Q8R E;  4NKL A;  2W7P A;  3S1N H;  4R8U A;  3BU2 A;  5KFO A;  4F50 A;  4EBD A;  3OIP A;  1LTG D;  2NU9 B;  5JPM C;  2QA4 A;  4MA0 A;  2Z6K C;  5AFW A;  2J6T A;  2KUM A;  4C3H H;  1YBY A;  4A3G H;  1RF2 D;  1HXY D;  3WO1 A;  2UXD L;  1XX8 A;  3LP8 A;  5KKN B;  2R92 B;  3QZ8 A;  1IHZ A;  1IBM Q;  4YIJ A;  4DXF A;  3U58 A;  1TWA B;  4YHH Q;  2YRX A;  3HOY G;  1A6X A;  2JQO A;  4LFA L;  1J6Q A;  2RF4 A;  2YZG A;  5CR3 A;  1Y8N B;  3HOV B;  1HUM A;  1CHP D;  1CZW A;  2H1E A;  5JVL A;  5DGA A;  1RL2 A;  4YCU A;  4EX5 A;  1UNS A;  3DEP A;  1ML0 D;  2TMP A;  3K5I A;  1NJI C;  3JC6 6;  5EKI A;  2K05 A;  4GKJ Q;  3MHB A;  5KFW A;  1FD7 D;  2WAQ G;  3OSN A;  1TA8 A;  4XQN A;  3M4Q A;  3FDT A;  1NR2 A;  2Y0S G;  4A3I G;  2HDM A;  2R85 A;  4EG0 A;  2B2Y C;  1SAP A;  2BOS A;  3NBH B;  5DNF A;  1AN7 A;  2R7Z G;  4ECX A;  3I73 A;  3KXY T;  3ZJY C;  3MR6 A;  4JI5 L;  2VXW A;  1D2B A;  4QY7 A;  1FVI A;  3M4O B;  4YY3 H;  1N8R C;  3PO3 H;  4FYD A;  3RBD A;  5EAY A;  3J7Y W;  3RUZ A;  2QEX A;  4ZQ3 A;  4MV7 A;  1XNR Q;  4U67 3;  4C5B A;  4JI6 H;  1BUV T;  1JJ2 A;  4K0K H;  2I5H A;  4A3J H;  4NXM Q;  3BAB A;  3OMG A;  4WFN 3;  1MD2 D;  4UHV A;  3M85 A;  4Q44 A;  1PDQ A;  3I12 A;  2N49 A;  5M3M G;  2O2L D;  2Y0S A;  3HOW H;  1U9R A;  3NTK A;  4ZKC B;  2CZG A;  4R7R A;  3T51 B;  4WD3 A;  2KED A;  3C2P A;  2ZJQ A;  1EQR A;  2IT1 A;  4OX9 L;  3JAM W;  1BNC A;  1JKJ B;  2E5L H;  4JV5 H;  1L1O C;  5F9L A;  4ED1 A;  5T1G A;  4YHH L;  3HOZ B;  4L6T B;  1NSN S;  3OWF A;  4K14 A;  3PMF A;  3QOJ A;  2B63 G;  4DUY L;  5C4X H;  4RGM A;  3HP3 A;  2OCE A;  1STG A;  1HUN A;  3U9T A;  2W6Q A;  1JOK A;  4V19 0;  3RGX A;  3AQQ A;  4KJO A;  2R7D A;  4YHH H;  2VB3 X;  1DCZ A;  2A6H C;  2EOT A;  1PFM A;  1IYU A;  4HSV A;  1V8Q A;  1WCM A;  1NMG A;  1O75 A;  4EVO A;  2QF7 A;  1SYX B;  2DY7 A;  3KJP A;  4FBU A;  1SRO A;  5BMV F;  4LFB L;  1SNP A;  4XYQ A;  4X65 H;  1F9Q A;  2AKW B;  2AMC B;  4A3L H;  3ERO A;  5BR8 L;  3GIP A;  3BYY B;  2NU7 B;  3KAJ A;  4FF1 A;  3Q0A A;  4O42 A;  1GYF A;  3URY A;  4EBE A;  4ECW A;  3D3R A;  2PQA A;  5JEA G;  5IP7 H;  4DR1 H;  3VPC A;  2C35 B;  5I6W A;  2FPP B;  3Q6S A;  2J6S A;  4OEL B;  3GTM A;  3VYT A;  4R8N A;  4DNR B;  1S5D D;  2DJF C;  3ITP A;  3J7A V;  2ATL A;  1HZC A;  1JJC B;  1PH1 A;  4IQZ A;  1SJE D;  2I07 B;  4ED2 A;  1I3Q B;  4XXE A;  1N34 Q;  3MXP A;  2UU9 Q;  4B3M Q;  3M4O H;  4JI0 Q;  2DN8 A;  1JXL A;  1GM5 A;  2BDO A;  3S2H B;  1I94 H;  1D5M C;  4ECY A;  1CQF A;  3GDE A;  1FJG L;  2BQU A;  3KHR A;  1IBM L;  4LF7 Q;  2VL6 A;  4DV0 H;  2MGS A;  1S5C D;  2NZH A;  4K2L A;  4BY7 B;  1CS0 A;  2HVQ A;  1CKN A;  4QIW B;  5JJK A;  2KQ3 A;  1SMY D;  3TQY A;  3CVZ A;  4XIG S;  1M7J A;  3ONA B;  5CV7 A;  3GIL A;  1OXU A;  1GUG A;  2E74 C;  3PUZ A;  5EBD A;  1LTB D;  4LSA A;  4AYB A;  3BJY A;  3HOW B;  4C3H B;  5CV8 A;  3K5M A;  3H0G G;  2GA4 B;  2JSO A;  5CV5 A;  2JP1 A;  5C4H A;  1SFO A;  1QZH A;  2UUA L;  3LX0 A;  3SHL A;  4ZKB B;  3J81 E;  2AUJ D;  4XT1 B;  4A93 H;  1ROD A;  1UE7 A;  2KCT A;  1U4P A;  4KJN A;  4B3T Q;  2PMZ A;  2A6E C;  1H9K A;  2B2U C;  4X62 Q;  4DL6 A;  2DLN A;  2V5A A;  1SND A;  4KD3 A;  1KLG D;  2SDF A;  1NUC A;  3VA5 A;  4DV5 Q;  2F3I A;  3EA6 A;  4EQO A;  1TT2 A;  4A3I H;  2AQ3 B;  3PO2 G;  4OON A;  2QIL A;  2CW7 A;  4TQS A;  3BZC A;  3SK5 A;  5KIX A;  1JIC A;  4XDX A;  3PSI A;  3H4B A;  3DWP A;  1X65 A;  3KLS A;  1JB3 A;  4GNX B;  2VR1 A;  2UUC H;  1HNW L;  4C1N K;  4MTE A;  2IX1 A;  5DQH A;  1TKW B;  5EKK A;  3ICE A;  5KT7 A;  1OXT A;  4L5R C;  1IBK H;  2JEJ A;  4DR5 L;  2E2H H;  3NEM A;  3OHB A;  4IOC A;  2KBN A;  2MCT A;  2OF1 A;  3H0G A;  3JRW A;  4DF7 A;  1X54 A;  3AFQ A;  4EQP A;  2LMC B;  5C44 G;  1E0B A;  3GTO B;  2ATW A;  1AH9 A;  1H9R A;  3H0G B;  4QB4 A;  5IYC G;  1ESF A;  3TBI B;  3P7J A;  2MO0 A;  3OHA A;  1DJR D;  4HSP A;  4DV6 Q;  1TWH H;  1YZ6 A;  2IMW P;  4KHP Q;  1Y1V B;  3H91 A;  5ELB A;  4BA1 I;  5L1I A;  5ISR A;  3A8K E;  4G7O C;  1HR0 Q;  1BCP D;  3TQT A;  3HKZ B;  2AHO B;  2W57 A;  2NN6 I;  1D8L A;  1FYC A;  1WI5 A;  4TV8 F;  2SNM A;  1Q12 A;  4LWC A;  1XMQ Q;  1JOR A;  1KL9 A;  1GSH A;  4DK6 C;  4JV2 A;  5HGQ A;  4DR6 L;  2XGQ A;  1ZYR D;  3MJF A;  2B63 H;  3S1M B;  1K3R A;  3RZO B;  4LF6 Q;  3M9O B;  3GTQ H;  2UUC Q;  3E6Z X;  4KY5 A;  3S14 B;  5HUR A;  1I6H H;  1EY4 A;  3R3O A;  3S1N B;  2EPB A;  3KAL A;  1BF4 A;  1DD2 A;  2LXJ A;  5H1S E;  5KFI A;  2K33 A;  1S40 A;  1IBK Q;  5DGB A;  4NXM H;  4ECQ A;  2AGP A;  4B3T H;  1A3U A;  3K3P A;  3T5K A;  1R9T B;  4JBW A;  2GN5 A;  4CBV A;  1FJG Q;  3IFT A;  2W71 A;  2R92 A;  3CCU A;  4HIM A;  4LSX A;  1N33 L;  3W1B A;  2R93 H;  2E2I B;  4WJ4 A;  2XIW A;  4EGQ A;  1XMQ L;  4IUT A;  4RAU C;  4DV5 H;  2WTF A;  1ICF B;  3RNU A;  1K8O A;  3VR5 A;  4DPG A;  1BJT A;  3A8J E;  1EYZ A;  1I50 B;  2KEN A;  3EQL C;  2DGY A;  4RUC A;  2V4Q A;  1V1O A;  3TEH B;  4LF8 H;  4R1J A;  1JC7 A;  1Z6H A;  1A0I A;  3GTJ H;  1AE3 A;  5CB4 F;  4RUA A;  1WTO A;  2AGO A;  1VMC A;  4YAJ B;  2MUY A;  1S3O A;  1UUP A;  3Q1K A;  2NTS A;  2B2T A;  4H0L C;  1HNX H;  3ULL A;  3NGD A;  4MZ9 A;  2YU9 A;  1O7Y A;  3G48 A;  1I4H A;  1GUO A;  2C5C A;  2QGQ A;  3F1Z A;  3PGZ A;  1KHI A;  5GAH C;  2R8I A;  1VQF A;  4DV0 Q;  4J9R A;  1JOQ A;  4JI4 H;  2BDN A;  5DM6 3;  2R7M A;  3BAA A;  3SXH A;  4A2A A;  1TR5 A;  3CXC A;  2HDL A;  3HG9 A;  1DON A;  2G9D A;  3OW2 A;  3MEF A;  1HHV A;  5LP6 F;  4JI8 Q;  1G51 A;  5IYB H;  5C3E H;  1C7Y A;  4A3G B;  3W3A A;  5L9X A;  1DGS A;  4ECR A;  3BJU A;  2GVA A;  1PYW D;  4GKK Q;  5C3X A;  2UU9 H;  4J6H A;  4B3M H;  1MJC A;  3GTP A;  4JV1 A;  4L5T A;  2FP4 B;  4ZK9 B;  3BDO A;  1HFG A;  2NTT A;  2UUB Q;  3V6J A;  4DR1 Q;  1B44 D;  4EFB A;  2JA8 B;  5C44 H;  4F7X A;  1JT8 A;  4UP8 A;  4RCN A;  4DR5 H;  3D0F A;  3I4N H;  1IL2 A;  4JI2 L;  2EYO A;  3NE5 B;  2WAC A;  5KYI A;  3FKI G;  1ZHS A;  2ZDH A;  5KFF A;  3U4V A;  3VA7 A;  3CMA A;  4FVM A;  2PZU A;  3J81 L;  4G57 A;  4PMB A;  3I7F A;  1HNZ L;  2RVL A;  1EWH A;  1Y1W G;  4JUZ A;  4C1N I;  4O2D A;  4FNF A;  1PRT F;  4RNO A;  1PMR A;  2HHH H;  3GTK A;  2KHJ A;  2OXP A;  5ELF A;  3N6X A;  1EY5 A;  3QZ7 A;  1QNK A;  2IX3 A;  1OWT A;  3A56 A;  3X3N A;  1S72 A;  1JQY D;  3MXN B;  3IRB A;  3CW2 C;  1VQI A;  1KAB A;  1L1O A;  4OWX B;  3S17 B;  2ZDG A;  4PZ8 A;  4XYO A;  5I9O A;  3BG5 A;  5KX5 F;  2F0S A;  5CAE B;  2E2J H;  2FKL A;  3DXJ C;  3ND8 A;  2N78 A;  1BBX C;  3PQI A;  3A5Z B;  4QWD A;  1VQH A;  4TV9 F;  3NWS A;  3VDY A;  5KFD A;  2KHS A;  2ZTD A;  4DV1 L;  3PIP 3;  3T53 B;  4UCU A;  1MSG A;  5HY6 A;  1L2Z A;  4A3J B;  4ABN A;  5EJW A;  2RCF A;  4C5C A;  2CH4 A;  1S10 A;  5KFN A;  5KFT A;  5M3M B;  4KY6 A;  3TP6 A;  1M0T A;  3J80 i;  1FGB D;  2HIV A;  3VYR A;  4UCT A;  1WOC A;  4JI2 Q;  2DJG C;  1SNQ A;  4LFA H;  1LTA D;  3KBG A;  3HOY B;  2EXD A;  2UVU A;  1WTX A;  1UC9 A;  3TII A;  4WJW A;  1H9J A;  1JWU D;  4KD4 A;  3LNN A;  4HN7 A;  2RSN A;  4RHR A;  4YCW A;  4QUC A;  1GJX A;  5KFQ A;  3PUW A;  5K2M A;  2EYL A;  3GTP B;  3CCS A;  4O4I F;  3SDZ A;  2B63 B;  4LW1 A;  3KHG A;  1VF7 A;  1N9W A;  2W9C A;  1HA6 A;  3PF4 A;  4UP9 A;  2VPS A;  3I4L A;  5AJ3 L;  5C3E B;  2F0U A;  1JCK B;  3Q8S B;  1QNU A;  4K2K A;  5IGC A;  2PNH A;  5C4X B;  1SLJ A;  3IKJ A;  4LF6 L;  4J8Q A;  2NUA B;  4JI3 Q;  4IO9 A;  3HKZ E;  2WFW A;  2VY3 A;  2F0H A;  2O03 A;  4RNM A;  5IGG A;  2A8V A;  3MXU A;  1H95 A;  4IFD G;  1TWA A;  4IUV A;  5E3F A;  5A2Q L;  2JEB I;  4JI5 H;  5D65 A;  4BBS G;  1ZEQ X;  5FLX c;  4A2B A;  3QFF A;  4RH6 A;  1NAP A;  1SBB B;  1T9H A;  3MR3 A;  1F77 A;  1X3Q A;  1Z2O X;  2V59 A;  2KSW A;  2A6E D;  3A8I E;  3HGB A;  5KG4 A;  5I47 A;  1GVP A;  5ELD A;  2BH8 A;  1PFN A;  2HHH Q;  4DR7 L;  2VA2 A;  5CV9 A;  3FKI A;  4YQW A;  2VNU D;  2VUM H;  4ECV A;  1WCM B;  1X9N A;  4DUZ H;  2XIG A;  3BA9 A;  4PQX A;  2Q2I A;  4MHE A;  1A3V A;  1FNV A;  3OMC A;  2ZXP A;  1F2Y A;  1PLF A;  3LWU A;  2R3Z A;  5IT9 W;  5CV4 A;  1C3O A;  3JZI A;  2J9G A;  2VPQ A;  1BOS A;  1CSQ A;  1YNN D;  2MJ8 A;  4A93 G;  2EY5 A;  2D0O A;  4GLA C;  5DM7 3;  2JA7 A;  1AUX A;  4K5V A;  3OW7 A;  4DV4 L;  1PFB A;  5KRU A;  1Q81 C;  3HOX H;  5EDW A;  1GGO A;  1JMC A;  3PW4 A;  5M9O A;  4C2M A;  4RGN A;  1N34 L;  2D5D A;  5C0X H;  1QUQ A;  3T13 A;  4PZ7 A;  5ELN A;  2B2U A;  3T56 B;  3HKS A;  1JWS D;  3T1H H;  2DPI A;  1NY4 A;  1V1P A;  2FLL A;  4RAZ A;  4IZO A;  3PO2 H;  4A3M H;  4N8F A;  1VCI A;  3EBE A;  4DA2 A;  2AUK A;  1XNQ Q;  4B3T L;  1HZ9 A;  2KOL A;  1PK8 A;  2B8F A;  2K52 A;  3MFY A;  5CMD A;  1EZ8 A;  2Z4H A;  2NVY A;  4O2B F;  1WTH A;  1T36 A;  1AE2 A;  1J5E L;  1WTW A;  2LKV A;  4ME6 A;  4DR2 H;  4FS2 A;  5CV6 A;  2R6F A;  1LTL A;  4IFD I;  2PO4 A;  1N48 A;  3JRX A;  2ZJR A;  5LMN W;  2H5X A;  4JYA Q;  4IWX A;  5DLG A;  5KT6 A;  2UXB L;  4IAL A;  4QIW E;  1J5E H;  1S4Z A;  1VAJ A;  3A5U A;  3I90 A;  3QR8 A;  2VOB A;  1QE6 A;  5FPO A;  4KTA A;  2CW0 C;  4F4W A;  5F2D A;  3AU7 A;  3KUP A;  1RIP A;  3MWY W;  4CJ2 C;  2VQE H;  4L8J A;  1MI2 A;  4DU9 A;  4BXX H;  3HOX G;  1W93 A;  2W6Z A;  2P5Z X;  1EY0 A;  2W70 A;  1IKL A;  2C2R A;  4JW0 A;  1VS0 A;  3HS0 C;  4TKO B;  2FK1 A;  4UFZ A;  1XNR H;  4O3O A;  1CM9 A;  5IY0 A;  2E8G A;  1C0A A;  3V96 A;  5EPL A;  4YY3 Q;  3M7G A;  4BY1 H;  3A55 A;  2A74 C;  5COY A;  1O80 A;  2EJG C;  1NCV A;  5FLX L;  1Q7Y C;  4J9P A;  3NQI A;  4DR6 Q;  2WB1 E;  3C1E A;  1PYS B;  5E4W C;  2QYZ A;  4U6P A;  1BXT A;  1YNN C;  3BQ1 A;  1KJI A;  1B53 A;  4POF A;  4A3E G;  3HOU B;  4LJZ C;  1VQB A;  3GIQ A;  2C9O A;  4X3K A;  4PWQ A;  3TZU A;  5KFG A;  3TRE A;  4QW8 A;  2WKC A;  3MC0 B;  2JA5 H;  1LO5 D;  2GPW A;  3EPI A;  1E1O A;  3GTG H;  2KA7 A;  4X3U A;  2F0V A;  4DV1 Q;  5A2Q W;  3OOC A;  4QWA A;  5DLQ E;  2IJ0 A;  5FJ8 H;  1VQP A;  3RUP A;  2FLP A;  4Q43 A;  2UVW A;  1N32 H;  5KG7 A;  4B3R H;  3WO0 A;  5KT4 A;  2N55 A;  3GTO A;  1PTO D;  1DM0 B;  1X55 A;  3EIV A;  1L2F A;  4OGQ C;  4ZI7 F;  4FU0 A;  5L1K A;  2A68 D;  1Y1V H;  1LT6 D;  2I5M X;  2VQF H;  1D6E C;  4O3P A;  1TU2 B;  4A3B B;  3TIN A;  2YZM A;  4DV4 H;  1ENF A;  4DL2 A;  1BCP F;  4ID6 A;  3RR5 A;  3PO2 B;  3IL8 A;  1HNW Q;  3MFG A;  2G5D A;  3EFX D;  1LAC A;  1WTP A;  2XCL A;  1X56 A;  1KDB A;  4WJ3 M;  2R93 B;  3KF8 A;  1Q8I A;  2B2T C;  5IT9 L;  1E2Z A;  3N41 B;  1Y14 B;  2Q8T A;  3TP7 A;  5FPR A;  3TP5 A;  5KFS A;  1Z47 A;  5KFJ A;  5C0X I;  4L5S A;  4B3S Q;  1BO0 A;  1STH A;  1CFM A;  3I70 A;  5J1Z A;  3CCQ A;  3M4P A;  3H09 A;  2PMZ B;  1OTC A;  4JI6 Q;  1ILQ A;  3Q24 A;  5IGB A;  4J9Q A;  4Q8F A;  1TII D;  2Z4I A;  3TP8 A;  3RZO H;  2R82 A;  4J0M A;  4OIJ A;  1QVG A;  1IOV A;  2WDT A;  3S14 H;  3KDF B;  1YJ9 A;  2EYP A;  4LMY A;  3PUY A;  1S5E D;  2SNS A;  3NSW A;  4K8I A;  4JV0 A;  3I56 A;  3STB D;  1IW7 D;  3J81 i;  1IBL L;  3Q8P B;  1TXY A;  4BBS H;  1HQR D;  4CJ1 B;  3UDG A;  1FKA H;  2L15 A;  2F52 A;  3TIG A;  5IWA L;  2JA7 H;  2ZJP A;  1V43 A;  4OEM B;  1AN8 A;  4JK1 C;  3NBI A;  1K1Q A;  1WJJ A;  3MWD A;  2LFN A;  4KMU C;  3Q8R B;  4JBJ A;  1DOM A;  1SXT A;  2A6H D;  1MBY A;  4K8J A;  4YWL A;  4GKJ H;  1K8G A;  2F4V L;  4R4O A;  1N36 L;  5DG8 A;  2ICI A;  3V4Z A;  2ZTE A;  3PW0 A;  3AMU A;  3FVQ A;  1EIF A;  1S0O A;  4AQY Q;  3SK6 A;  4KK7 A;  2R93 G;  2CQY A;  5BR8 H;  4LUZ A;  2OH2 A;  2FK2 A;  3TDQ A;  2OWO A;  2F0L A;  4O1N A;  2E2H A;  5EWG A;  4M9U A;  5EPK A;  2FJZ A;  4C3I B;  1B3Q A;  3S2H H;  4YR2 A;  1N33 H;  1GUS A;  2MFI A;  2XTI A;  2RHQ B;  4OXP A;  3A7L A;  4HMI A;  3HXL A;  4KLK A;  3RD4 A;  2V1C C;  4H7B A;  5IP7 G;  1C4Q A;  2EE1 A;  3PF5 A;  1G2T A;  4UPA A;  3PV0 A;  1QG7 A;  4I7A A;  5C8Y F;  1KRS A;  2HCI A;  1I7L A;  3S1R B;  5JJL A;  4ULL A;  3R5H A;  4ED8 A;  3SE0 A;  3GP7 A;  3V05 A;  3HRZ C;  1Z2N X;  3BVZ A;  4LUO A;  2UVR A;  2K5V A;  1HJP A;  1CA6 A;  4R8U B;  3N44 B;  4IHJ F;  3PUV A;  2ASJ A;  2WIN B;  1BBU A;  4IZ8 A;  5FKA C;  5IYC H;  1JR0 D;  1K1S A;  2JEI A;  1EOV A;  1TS2 A;  4AYB G;  2JA6 B;  4NPS A;  4YWM A;  1WR2 A;  2E2I A;  1X3E A;  1NTG A;  3K7A B;  4E6I A;  4LF9 L;  2IW3 A;  2JJQ A;  1CT1 D;  2XSC A;  5IWA Q;  1EYG A;  1JDB B;  4DGZ A;  4WOR A;  2NU6 B;  4O0A A;  1NE3 A;  2RDG A;  1S68 A;  4A3D H;  3R23 A;  4IWY A;  1HQM C;  1GOZ A;  2F4V Q;  1R4P B;  3I4O A;  1M6V A;  2BCO A;  3TN2 A;  4HJ9 A;  1LUZ A;  4C5A A;  3A54 A;  4PDB A;  1RTO A;  3QIA A;  1BCP B;  4DR1 L;  3GIK A;  2Z0S A;  2NVT B;  4UCR A;  1A2T A;  2W8L A;  4LF8 Q;  2W9B A;  1PH5 A;  3GTG B;  5C5L A;  1DXM A;  4HJ5 A;  2ZT9 C;  3KOJ A;  1Q82 C;  1Y1V A;  2L12 A;  3CP0 A;  2ZXO A;  1L0Y B;  2B3G A;  1VQO A;  4HQ6 A;  2K14 A;  2F4I A;  4AQY H;  2OTL A;  1GUN A;  3I55 A;  1KIX A;  2EIF A;  3NPP A;  4B3S L;  3RB4 A;  4ECU A;  4N8X 1;  1D1K A;  1XNQ H;  3HB9 A;  1I94 Q;  2KHI A;  1JDE A;  1H9S A;  3W2D A;  1RK5 A;  5M3F G;  1WVL A;  1Y1W B;  2ZTC A;  1PTO F;  2JK8 A;  1PA6 A;  5M3M H;  1SEI A;  1II3 A;  1K8M A;  3MR2 A;  4YCV A;  2KCM A;  2NZO A;  2IY5 B;  3MZ5 A;  3EJI A;  4KN7 C;  1OO9 B;  2WAQ B;  3KLW A;  4P73 A;  5CGK A;  3K80 C;  4RGT A;  1M90 C;  2DUD A;  1EY6 A;  3UI2 A;  3LWB A;  1SNO A;  1B4O A;  4MTD A;  4DV6 H;  4IPG A;  3T5H A;  1PZI D;  2YYZ A;  2VQF Q;  3SK8 A;  4PMC A;  2RDF A;  1PTO B;  4KI0 A;  2VUM B;  4LF9 H;  4TVA B;  4M7E A;  3K0Y A;  1SR3 A;  2XGT A;  4KY7 A;  3GO5 A;  2YTV A;  4JCV E;  5M5Y B;  2H4O A;  1TVX A;  4ED7 A;  5D3I B;  2F0M A;  1G8Z D;  1N56 A;  1STY A;  5D1O A;  1PH2 A;  2R7Z H;  4C3J G;  2X6G A;  5LMN H;  1S0M A;  4QGU A;  1WCM H;  1KDC A;  3S16 B;  2EJM A;  4LH7 A;  1TWC H;  5KFC A;  1RJR A;  5I4D A;  2YU9 H;  3J80 W;  3WWV A;  3HOV H;  1YNX A;  3CU7 A;  1XPO A;  4A3F G;  3CCL A;  4XT3 B;  1HTP A;  4DK0 A;  4NXM L;  4LF8 L;  3MXN A;  3KTM A;  5LMU H;  3C3L A;  1SEB D;  4YY3 L;  3G6J B;  1L1O B;  1SYG A;  3G6X A;  1S9F A;  1O7Z A;  3G6Y A;  2F0P A;  4JI3 H;  2R7N A;  1EWI A;  1SE2 A;  5IT9 c;  1HA5 A;  2UXB Q;  1G91 A;  2UUC L;  5EQ0 A;  1S97 A;  1XJV A;  2E5L Q;  4JV5 Q;  2PW7 A;  1E7Z A;  1TY0 A;  3TZD A;  4RB0 A;  1IW7 C;  2QKI C;  5I9P A;  4BA2 I;  4FXK C;  3G6E A;  5JQW A;  5KT5 A;  1CQI B;  3KJO A;  2XCA A;  4DAY B;  4GLX A;  1EY8 A;  4DV2 Q;  2Q2H A;  3KLS X;  4UCS A;  1S5B D;  4JI8 H;  2KCC A;  3H40 A;  1VQ6 A;  1Y8O B;  4BY7 G;  1Z9F A;  2R93 A;  1E2V A;  1VDZ A;  2F0F A;  5IOD A;  4GOP C;  5GON F;  1AP0 A;  1SYF A;  2EVB A;  1U4R A;  1HNX L;  2N88 A;  3D31 A;  1SSO A;  3RB3 A;  2O5I C;  4K5W A;  1E4E A;  4GN3 B;  1E22 A;  2A69 C;  1VQ9 A;  5L1J A;  4BY1 G;  1S03 G;  1X3G A;  1J5E Q;  3CQZ A;  2FMC A;  3RZD B;  3IAY A;  3S15 B;  4LF4 L;  5BR8 Q;  4Y7N H;  2DIK A;  1VQA A;  1RJQ A;  2Y0S E;  5C0X G;  1CKN B;  1W96 A;  4QIW A;  3RB6 A;  4HNV A;  1EQV A;  5CA1 F;  4KN4 C;  5JUM A;  4QWB A;  2D2C C;  1KAW A;  2JEA I;  3VYU A;  2NVY B;  4DAM A;  2K01 A;  4LFB Q;  4FBT A;  1GUT A;  2VS1 A;  5KNB A;  4DL3 A;  3RLN A;  2ZXR A;  2XD4 A;  2D0P A;  2RGR A;  1TWA H;  4Q0F A;  4DXG A;  3OPO A;  5IYD G;  2JN4 A;  1B6S A;  2JEG A;  1BQQ T;  4U7C A;  2VW9 A;  4I7H A;  3PO3 G;  3QJY A;  1KBL A;  4QWC A;  3ZYY X;  4FXG C;  1F2Z A;  5KG1 A;  3R2T A;  3KDF A;  4KKS A;  4UY8 C;  1UEB A;  3A0J A;  2VQD A;  5C1P A;  2D62 A;  1ET9 A;  1IYV A;  2RDI A;  3CQZ H;  5KNC A;  1EYA A;  3M7N A;  3JSL A;  4JOI C;  1Y1W A;  2K5N A;  3G4S A;  2HVS A;  2W6P A;  1E3P A;  4G7H C;  5EGT A;  5DEH A;  4ZCK A;  1QIL A;  1IZ6 A;  4F88 A;  3RLO A;  1Q3L A;  5DAU A;  1HPC A;  4HCE A;  4A3D G;  1A15 A;  1MHW C;  2XWB B;  3KBX A;  4A3M G;  3EPG A;  3VYS A;  4J9M A;  3GTM H;  3JAM E;  3ORR A;  2BH2 A;  2NVX H;  5KFX A;  1RYS A;  2VA3 A;  4DR4 Q;  1KJJ A;  1S5F D;  1JX4 A;  5TSS A;  3HOY H;  4TRD A;  4C2M B;  1CSP A;  3H6M A;  1EFW A;  1QVC A;  4GKK H;  1DOL A;  2VQE L;  1L0W A;  4MV9 A;  5KEE A;  5FJ8 G;  5KFH A;  1XTD A;  5J39 A;  4MV8 A;  1GHJ A;  2FK3 A;  1RK6 A;  2QK4 A;  1CQJ B;  3WOF A;  5EKL A;  1T94 A;  2E75 C;  4DV4 Q;  5LMU L;  3PIO A;  2ENB A;  4A3B G;  2YCH A;  1WTV A;  3OYY A;  2W6N A;  3F2B A;  4J1M A;  4A3K H;  1UEA B;  2R61 A;  1HZB A;  1PZK D;  4ODG A;  4LF4 Q;  3I4M B;  3L3O C;  1I4Q A;  2ALY B;  2BE5 D;  2MP1 A;  1B50 A;  3KAK A;  4JI4 Q;  2F3W A;  2ASB A;  4BBR B;  3SEB A;  4AH6 A;  2HHH L;  3HKZ A;  3GTG A;  3MXG A;  3U9S A;  3I2Z A;  2SEB D;  3OSP A;  2J7Z A;  1PTO H;  3CCR A;  3Q8D A;  3MTS A;  5HGT A;  3MFH A;  3QO2 A;  1F9R A;  5M5Y H;  3K81 C;  1KEE A;  4P71 A;  2JA7 B;  3L7Z C;  3U9O A;  1RCV D;  1GUW A;  3UE0 A;  1RD9 D;  2K50 A;  3DWQ A;  2WAQ E;  4OWT B;  4DAV A;  2I8C A;  2FE3 A;  4ED3 A;  4IR1 A;  4YAK B;  1Y69 U;  4JG2 A;  2FPG B;  1WYD A;  3JAM L;  3UFX B;  3P20 A;  3M4Y A;  5IYZ F;  5M5W H;  2YS7 A;  3SVM A;  5AJ3 Q;  2JA8 H;  5IIF A;  1KNA A;  5JVD F;  1LV9 A;  4Z9C B;  4XQJ A;  3U4Z A;  2B8G A;  2CFM A;  3K7U C;  4QQB X;  1KDA A;  1I50 A;  1SNM A;  2W8K A;  2C28 A;  2EXZ A;  2NUC A;  3F2U A;  4K5X A;  1A9X A;  2QEJ C;  1CKM A;  2EY1 A;  1EYC A;  4DFA A;  3ETJ A;  4ZHQ F;  3VPB A;  1Y1V G;  4N9T A;  2QW7 A;  3DEO A;  3C0F B;  1CI3 M;  3RJ0 A;  1LTS D;  4ETS A;  1BBW A;  2QDB A;  5DLF A;  1Q8K A;  2GPS A;  3I72 A;  2V9W A;  1ULZ A;  3E0E A;  4HTH A;  1I4G A;  2R7Z A;  2PZT A;  4UP7 A;  1HFN A;  4RB2 C;  1A8V A;  3VR4 A;  5JVH 3;  2K04 A;  3PR5 B;  4LF4 H;  3G6V A;  4DL5 A;  2TSS A;  1G6Z A;  4XZ3 B;  2EYH A;  3FDS A;  4A3G G;  3SK4 A;  5I2X A;  1EZ6 A;  1P16 A;  3S17 H;  3CPF A;  5JJZ A;  4RA8 A;  2E2H B;  2N3S A;  2ASD A;  1TQO A;  4DLK A;  1IBL H;  2BE5 C;  2K32 A;  1KAA A;  3CRL C;  4MTK A;  4RB1 A;  2XC9 A;  3VPD A;  5IOC A;  4DR4 L;  5EOY A;  5KFL A;  2R8J A;  2QDL A;  3RLF A;  5IGD A;  1SE4 A;  2R8H A;  4JYA L;  3GD7 A;  2GLT A;  1C9O A;  4IFD J;  4JI8 L;  1Z7T A;  2NVY H;  2ZM6 Q;  3L4J A;  4FM9 A;  1I4X A;  4F4Z A;  1XTC D;  1SN8 A;  1EIY B;  2CKZ B;  1YI2 A;  3AEV A;  2OT2 A;  4IUU A;  4R4C A;  5COR A;  3NQT A;  2X0S A;  3GQC A;  3H4D A;  1XMO H;  3RZD H;  4APM A;  4A4I A;  3CHB D;  2QCP X;  4F8M A;  3OIQ A;  3TSS A;  3IN5 A;  4KV6 A;  3M9N B;  2JA5 G;  1X3F A;  1M4V A;  2K5D A;  4JOI A;  4DR2 L;  4DR3 L;  1G29 1;  2ZJT A;  5D14 A;  1V1P B;  1B70 B;  2PBZ A;  4UAI A;  2XN9 C;  2FXQ A;  3A7A B;  4I7Z C;  3S9W A;  3R8B A;  1SDF A;  3HKZ G;  4NDX A;  2IP4 A;  4R4Q A;  1C48 A;  1F2L A;  3K0X A;  4M1U B;  1KRT A;  3RMH A;  5BN5 A;  1CA5 A;  4IOA A;  5K36 H;  1WH2 A;  4B3R L;  4I65 A;  4HJ7 A;  2UXC Q;  4F87 A;  5KFZ A;  4EBC A;  3R5X A;  1ONL A;  4KKU A;  3MWM A;  3CME A;  1TWH A;  4R9W A;  5BPF A;  4ZAI A;  3K5L A;  4TQR A;  4MV1 A;  2SCU B;  1E4F T;  2NVT H;  5JOB A;  2ZDQ A;  4YB8 B;  4JYA H;  3KYH C;  1VKZ A;  1VQ4 A;  3V2T A;  4Q5V A;  4I4T F;  3DUZ A;  1BCP C;  5J2T F;  1PX2 A;  2K6A A;  2F0I A;  1YIJ A;  1GXD C;  4FF2 A;  3VR3 A;  5JJI A;  4O3N A;  5GAD C;  3OUU A;  5KFU A;  4EEY A;  3H0G H;  1HH2 P;  4HJ8 A;  3MEH A;  3JSN A;  1TS3 A;  5D1P A;  1STB A;  5E7N A;  4RAY A;  1SMX A;  1SYC A;  2K4K A;  4QUF A;  2R87 A;  2F0K A;  4CC6 A;  4F4X A;  5EBC A;  3W5O A;  3J7A K;  2B2W C;  1YHB A;  5LHY 1;  2YW2 A;  4RKL A;  2JA8 G;  4ILW A;  1PYB A;  4MTN A;  3GTJ B;  5IGF A;  3Q8Q B;  1WTR A;  5G3L F;  4DV7 Q;  1VQG A;  3PVX A;  1LLR D;  3I3C A;  5CBA E;  3RN2 A;  1PVO A;  1TWG H;  4JBK A;  1OXS C;  1SE8 A;  2EJF C;  2M2L A;  3D6W A;  3V6H A;  5H80 A;  1EQT A;  5FLX E;  4CJ0 B;  2CW8 A;  1N34 H;  4P74 A;  2Q8I B;  2WE6 A;  3E5S A;  2VUM G;  1K83 B;  2IHE A;  4X3T A;  1ICW A;  2I5L X;  2NWG A;  1Y1W H;  2RDH A;  1VQ7 A;  1KQS A;  1YIT A;  3H3V H;  2WAQ A;  2W9C B;  1QB5 D;  4LF5 H;  2B63 A;  1PTO C;  2RGV A;  3K3V A;  3J80 c;  3T1Y L;  4JI1 H;  1K0S A;  1EIG A;  3SE7 A;  2Z6B A;  1HCZ A;  2YU9 B;  2HUG A;  2HT1 A;  2ASL A;  3H94 A;  1VQM A;  4OO1 G;  2VZA A;  3CC4 A;  4HIO A;  1BGW A;  1XMO Q;  1CUK A;  2X6L A;  5JPN C;  3PN1 A;  2R7Z B;  3PW7 A;  1TWF B;  5ELE A;  3S16 H;  1EUC B;  1DV1 A;  1LTI D;  5KFB A;  2EYJ A;  4A3E H;  5K5P A;  1EFI D;  1GKH A;  1ZXT A;  4DV3 Q;  3Q22 A;  4H13 C;  5FLX W;  2KJX A;  3EYY A;  1PHJ A;  3L2P A;  2BA0 A;  3GIJ A;  5DG7 A;  2HIX A;  3BDL A;  4LFC L;  4KHP H;  1TWC B;  2ZM6 L;  1ENC A;  2VB2 X;  2PN1 A;  1A63 A;  4QWE A;  3K5H A;  4X64 H;  3F8T A;  2L1B A;  5NUC A;  1E24 A;  5LL6 b;  2A73 B;  3KF6 B;  3T4A C;  5IYB G;  1G6P A;  1AZQ A;  5FOB B;  1D7Q A;  4DV6 L;  3CC7 A;  2XRQ D;  3FPP A;  5DG9 A;  2JA6 G;  1VQD A;  2WB1 A;  1KC7 A;  1KJQ A;  3BVG A;  4GN4 B;  5C4X G;  3N8D A;  1XPU A;  3AYH B;  4DV3 H;  4OWW B;  4ZUI A;  4JI3 L;  4DV7 L;  2V58 A;  4DR6 H;  2YV5 A;  4JI1 Q;  1VQL A;  3I91 A;  4DK3 C;  2DZD A;  2HGS A;  5FD5 A;  1ILP A;  2UXD H;  2KEE A;  4WRD A;  4ZQI A;  1BKB A;  4LF7 L;  1Y8P B;  4BXX G;  2YRW A;  4DV7 H;  5DQG A;  4CKB A;  1VQK A;  2R86 A;  2FHT A;  5D8D A;  2EZV A;  2RSO A;  5LOV F;  2IBK A;  3B6Y A;  1L0X B;  2PYK A;  4ALP A;  1EHI A;  1MZB A;  3UDF A;  3BQ2 A;  3G8C A;  5KT3 A;  4EQ5 A;  4DR7 Q;  1LM0 A;  2Z9H A;  1D1I A;  1EYD A;  5J22 A;  1EY9 A;  1Q90 A;  2J0T D;  3E0J A;  3TRZ A;  2R84 A;  2B39 A;  4CDE C;  2K75 A;  4A76 A;  1H9S B;  3VR6 A;  3ETH A;  1UE1 A;  1M1K C;  1STA A;  4EQN A;  4BBR H;  2WP8 J;  3OTO H;  2D9U A;  3L9A X;  4PV1 C;  3LWE A;  3Q23 A;  4RU9 A;  1MSH A;  2V4R A;  3E3X A;  5C6A A;  1JLL B;  3NTH A;  2F3V A;  2F4V H;  1MIU A;  4DV3 L;  1HTL D;  5KFK A;  1TWF A;  1SFO B;  4RWS C;  1EIH A;  1B1Z A;  1EEF D;  4QCL A;  4J9S A;  2L0C A;  4ECZ A;  3CAM A;  2PI2 E;  2F0G A;  4FP5 D;  4WBN F;  1V1Q A;  4CDD C;  1YJN A;  3ULJ A;  2NZ1 D;  4JI0 H;  4X66 L;  3J81 j;  5M3F B;  4DL7 A;  4XQQ A;  3OUZ A;  1STE A;  3RAX A;  2L55 A;  4A3L G;  1TWF H;  5C4J H;  4A3D B;  1K3B C;  5KT2 A;  4A3E B;  3HOU G;  1N32 L;  2M05 A;  4JI4 L;  4GC6 A;  1WD0 A;  4L1K A;  2A68 C;  2Z8L A;  1ASY A;  4CHT B;  5KFV A;  4ECS A;  2HQE A;  2N8N A;  3NK9 A;  3V4S A;  5FO8 B;  1DIK A;  4AYB E;  2B2W A;  5JH7 F;  3P75 A;  4S3S A;  4GOP B;  3QB3 A;  2YTY A;  4C3H G;  2LSS A;  5FLM H;  4JPB W;  2XRS D;  4C2M H;  3D4R A;  4X65 Q;  5BN4 A;  4FF3 A;  2NU8 B;  1ESR A;  1ENA A;  3DMU A;  3NHH A;  3RBE A;  1RYR A;  3GTM B;  3I4M G;  3GLK A;  2F0T A;  1W3S A;  4QF4 A;  1E4G T;  3UQ8 A;  5J2U F;  1DYQ A;  3GV7 B;  4OHJ A;  4LUV A;  3NUC A;  2YZN A;  4XYL B;  2DNC A;  2CWP A;  5JAV A;  1K73 C;  1WCM G;  4IUR A;  4NMZ A;  1B33 N;  4V0B A;  1JE4 A;  3RAQ A;  1YVC A;  2EQS A;  3N40 P;  3D4D A;  4JBM A;  2R8K A;  3CRK C;  2Q2T A;  3I4M H;  3GIM A;  4Y8V B;  3EVQ A;  4J9K A;  2ZM6 H;  2C22 A;  5FO9 B;  2RHS B;  1F2M A;  2VUM A;  3HFZ B;  3ERS X;  1EY7 A;  1FR3 A;  3N6R A;  3EN2 A;  4DV0 L;  1J8I A;  1KJ8 A;  1CQV A;  1HR0 W;  4LF9 Q;  1W6K A;  3MWE A;  1GHK A;  1X6O A;  4CC5 A;  1SYE A;  3KF8 B;  3OTO Q;  2KCN A;  5BN3 A;  3SI8 A;  5KFR A;  2AWO A;  4RZQ A;  4A3M B;  2R6G A;  4ME5 A;  4FF4 A;  4O3R A;  4DNI A;  1B9M A;  2E2I H;  4JC0 A;  1LYL A;  3P1H A;  4OX9 H;  2YL2 A;  4MA5 A;  5E4X A;  3ND9 A;  2ALZ A;  3FMA A;  2C2E A;  4YR0 A;  3I4N B;  4DR2 Q;  4HYK A;  3PZP A;  4MV4 A;  1M0W A;  2EYF A;  5J3B A;  1GD7 A;  2L11 A;  4RMF A;  3BDC A;  2LXK A;  3AB9 A;  2PZW A;  3J7Z C;  4LFA Q;  2XVS A;  1FJG H;  5GQO A;  3KFU A;  1VQN A;  1GO3 E;  4G3I A;  3MVV A;  1SYB A;  4HED A;  3FP9 A;  1WSC A;  5HBR B;  4J9N A;  1XPR A;  1LTT D;  5M5X H;  1XDN A;  5C1O A;  4K6L A;  3HOW G;  1PH6 A;  3K57 A;  3F2C A;  1AEX A;  3VR2 A;  3S1Q B;  2UXD Q;  2PW5 A;  2FLN A;  1RKN A;  4A3K G;  4JI2 H;  2HD3 A;  4X65 L;  3ULP A;  4BBR G;  2P0A A;  4APV A;  1A62 A;  5A35 A;  4O4L F;  1T5E A;  3CCE A;  1T3N A;  1YEZ A;  4LF6 H;  3BS1 A;  2JE6 I;  4CDC C;  3STB C;  3RTX A;  3J81 c;  5JEA J;  1M8A A;  4IJL A;  1VQ8 A;  1HNW H;  2W9A A;  4NXN H;  2UUA H;  3T1H L;  1PRT D;  4LK1 C;  3BYT B;  5KFY A;  4DUY Q;  2JA7 G;  4Q0Y A;  5LMU Q;  4O3S A;  2Z1C A;  5CBE E;  2PVP A;  1VQ5 A;  1N32 Q;  4X6A H;  2F0E A;  3FKI H;  2CW0 D;  4HR7 B;  1FNW A;  3I4N G;  4YJ2 F;  5EZY F;  2R7K A;  2IPK D;  5KND A;  1ZHQ A;  3MR5 A;  3CCM A; 
#chains in the Genus database with same CATH homology
 1I5F A;  3HOY H;  3S1N H;  5GRO A;  1CSP A;  1EFW A;  2I0Q A;  1GVP A;  1QVC A;  2BH8 A;  3BU2 A;  1L0W A;  3SGI A;  2VQE L;  5FJ8 G;  2HHH Q;  4DR7 L;  1XTD A;  2VNU D;  2VUM H;  3S15 H;  2GVB A;  5GAG C;  5FLM G;  3CF5 A;  2QA4 A;  2Z6K C;  1X9N A;  4DV4 Q;  4IPD A;  2Q2I A;  1YBY A;  4C3J H;  4C3H H;  5LMU L;  4A3G H;  3PIO A;  1OXV A;  2CWA A;  4A3B G;  2UXD L;  3OYY A;  1IBM Q;  1IBK L;  3U58 A;  4YHH Q;  3F2B A;  4DR5 Q;  2NN6 G;  4A3K H;  4LF4 Q;  1HZB A;  3HOY G;  2JQO A;  4LFA L;  1CSQ A;  1J6Q A;  5C0X J;  2RF4 A;  4A93 G;  2D0O A;  4GLA C;  2ALY B;  4DV4 L;  1Q81 C;  3HOX H;  4JI4 Q;  2ASB A;  4J15 A;  1JMC A;  1RL2 A;  4YCU A;  4ME3 A;  1SRU A;  4EX5 A;  4AH6 A;  1N34 L;  2VQE Q;  2HHH L;  3I2Z A;  3LGJ A;  1QUQ A;  3JC6 6;  1NJI C;  1K9M C;  1N33 Q;  4GKJ Q;  4PZ7 A;  2WAQ G;  5ELN A;  4GS3 A;  3HKS A;  3CCR A;  3Q8D A;  3NEL A;  1NY4 A;  3M4Q A;  4DV5 L;  5M5Y H;  3K81 C;  3NEN A;  2Y0S G;  4P71 A;  3M9B A;  2AWN A;  4A3I G;  3PO2 H;  4HIK A;  1PFS A;  3L7Z C;  3NBH B;  4A3M H;  5M3F H;  1VCI A;  3EBE A;  2R7Z G;  3UE0 A;  4OWT B;  2K50 A;  3ZJY C;  2WAQ E;  4B3T L;  4JI5 L;  1HZ9 A;  1U5K A;  1XNQ Q;  2K52 A;  1FVI A;  4QY7 A;  1N8R C;  3PO3 H;  3E9H A;  4A3J G;  1AE2 A;  1J5E L;  4GLV B;  4JG2 A;  1WYD A;  5EAY A;  1LTL A;  3PUX A;  4IFD I;  2QEX A;  3DLL A;  5M5W H;  1XNR Q;  3TS0 A;  5AJ3 Q;  2ZJR A;  5LMN W;  2JA8 H;  3GTO H;  2H5X A;  4JYA Q;  2E5L L;  4JV5 L;  1XMO L;  1JJ2 A;  3U4Z A;  4QQB X;  2CFM A;  3K7U C;  2I5H A;  4QIW E;  2UXB L;  4A75 A;  4DKA C;  1EUJ A;  4A3J H;  4NXM Q;  4RG1 A;  3A5U A;  1PH9 A;  3M85 A;  1CKM A;  1YHA A;  3GTK H;  2N49 A;  1RIP A;  1Y1V G;  5M3M G;  4BXX H;  4LFC Q;  3HOX G;  3HOW H;  2A1A A;  1QZG A;  2CCZ A;  1BBW A;  2ZJQ A;  1EQR A;  2IT1 A;  1Q8K A;  4OX9 L;  1VS0 A;  2IX0 A;  3E0E A;  1BVS A;  3GTP H;  3HOV G;  1L1O C;  4UP7 A;  3BZK A;  5GAE C;  1A8V A;  4YHH L;  5IY0 A;  2E8G A;  1C0A A;  5LMN L;  4JI0 L;  2B63 G;  1Q46 A;  4DUY L;  5C4X H;  4YY3 Q;  1K83 H;  4A3G G;  2OCE A;  3S1R H;  4BY1 H;  1Q7Y C;  1YHQ A;  3T1Y Q;  3AQQ A;  3M3Y H;  3S17 H;  1P16 A;  2WB1 E;  3CPF A;  1PYS B;  2R7D A;  4DR6 Q;  2N3S A;  1NMG A;  4POF A;  4A3E G;  1VQB A;  3KJP A;  4OO1 I;  1SRO A;  3TRE A;  1MJE A;  4LFB L;  4DR4 L;  2JA5 H;  3RLF A;  3KF6 A;  1E1O A;  3GTG H;  4JYA L;  2AKW B;  3GD7 A;  1C9O A;  2AMC B;  4DV1 Q;  4JI8 L;  4IFD J;  4A3L H;  2NVY H;  2ZM6 Q;  5BR8 L;  5DLQ E;  5FJ8 H;  1VQP A;  1QVF A;  1SN8 A;  4X64 Q;  1EIY B;  2CKZ B;  2IHF A;  1YI2 A;  3AEV A;  1I94 L;  4DUZ Q;  2PQA A;  4R4C A;  5JEA G;  5IP7 H;  4K0K L;  3RZD H;  2C35 B;  2UUA Q;  1X55 A;  3EIV A;  1L2F A;  4A4I A;  1Y1V H;  4B3R Q;  1MKH A;  2I5M X;  2JA5 G;  1X3F A;  4JOI A;  1O7I A;  4PMW A;  4DR2 L;  4DR3 L;  1G29 1;  2UU9 L;  4B3M L;  3F2D A;  1Q1B A;  3K7A H;  4XTC S;  4P75 A;  1B70 B;  5C3E G;  3RR5 A;  4NXN Q;  2FXQ A;  1HZC A;  1HNW Q;  1JJC B;  1PH1 A;  1JJG A;  1UWV A;  1X56 A;  3HKZ G;  1N34 Q;  4WJ3 M;  4R4Q A;  1HNX Q;  4DR3 Q;  2UU9 Q;  3JAM i;  3K0X A;  1KRT A;  4B3M Q;  4JI0 Q;  3M4O H;  1Y14 B;  2YTX A;  4IOA A;  1GM5 A;  1WFQ A;  3FHW A;  4R4T A;  3S24 A;  1Z47 A;  2ES2 A;  3HOZ G;  2HQL A;  5C0X I;  4HJ7 A;  4L5S A;  4B3R L;  1FL0 A;  3GDE A;  2UXC Q;  4B3S Q;  2ID0 A;  1FJG L;  3CME A;  3CCQ A;  1IBM L;  4LF7 Q;  2VL6 A;  4JI7 L;  3M4P A;  2NZH A;  1OTC A;  2PQA B;  3U50 C;  5IYD H;  2NVT H;  4DV2 L;  4JI6 Q;  2Z6K A;  3KYH C;  1VQ4 A;  3G71 A;  3RZO H;  1CKN A;  4X62 L;  1K8A C;  5JJK A;  1QVG A;  3TQY A;  3S14 H;  3KDF B;  1YIJ A;  1YJ9 A;  5JJI A;  3PUY A;  4XIG S;  3PIP A;  5GAD C;  3I56 A;  1OXU A;  3STB D;  3J81 i;  1IBL L;  3H0G H;  1TXY A;  3PUZ A;  1HH2 P;  4BBS H;  4HJ8 A;  3UDG A;  2L15 A;  2F52 A;  1KXL A;  5IWA L;  2JA7 H;  2ZJP A;  1V43 A;  5E7N A;  1VQE A;  1SMX A;  2K4K A;  4QL5 A;  3H0G G;  4HJA A;  1WJJ A;  3W5O A;  1YHB A;  1QZH A;  1E1T A;  2UUA L;  4GOP A;  2JA8 G;  4JBJ A;  1PYB A;  4MTN A;  1EQQ A;  4L5Q A;  4YWL A;  4A93 H;  1K8G A;  2F4V L;  4R4O A;  1UE7 A;  2KCT A;  1VQG A;  4DV7 Q;  1N36 L;  4B3T Q;  4X62 Q;  1PVO A;  3RN2 A;  1OXX K;  2ZTE A;  1TWG H;  1SFO H;  3W1G A;  1OXS C;  1EIF A;  1SE8 A;  4JBK A;  4A3B H;  4AQY Q;  4A3C G;  4DV5 Q;  2R93 G;  4OX9 Q;  3HOZ H;  2F3I A;  4A3I H;  4LUZ A;  4P74 A;  3PO2 G;  4OON A;  3DM3 A;  2OWO A;  2VUM G;  1FGU A;  2IHE A;  3H15 A;  2MO1 A;  3BZC A;  2I5L X;  3PSI A;  1Y1W H;  1VQ7 A;  1X65 A;  1YIT A;  1KQS A;  3H3V H;  3S2H H;  4TQU S;  4NXN L;  3AFP A;  4GNX B;  3J80 c;  3T1Y L;  2MFI A;  1HNW L;  2XTI A;  2RHQ B;  4OXP A;  4KLK A;  2HT1 A;  2IX1 A;  1VQM A;  2V1C C;  2UUB L;  3ICE A;  2VZA A;  1OXT A;  4L5R C;  3CC4 A;  4OO1 G;  4HIO A;  1XMO Q;  5IP7 G;  1CUK A;  2K5H A;  4DR5 L;  3OTO L;  3PF5 A;  3NEM A;  2E2H H;  4UPA A;  1PH8 A;  3PV0 A;  4IOC A;  2KBN A;  3S16 H;  1KRS A;  3UDX A;  4DUZ L;  3S1Q H;  4A3E H;  1X54 A;  3AFQ A;  1GKH A;  5C44 G;  5JJL A;  4AQY L;  4DV3 Q;  2ATW A;  1AH9 A;  1PHJ A;  3L2P A;  2BA0 A;  3UDI A;  5IYC G;  2HIX A;  3PCO B;  4LFC L;  2ZM6 L;  4LUO A;  2K5V A;  4LNQ A;  3HOU H;  2B29 A;  2MO0 A;  1HJP A;  4PG3 A;  1A63 A;  3F8T A;  4PZ6 A;  4DV6 Q;  1E24 A;  1PH3 A;  1TWH H;  4LF5 Q;  1YZ6 A;  3PUV A;  4A3C H;  4KHP Q;  1BBU A;  5IYC H;  4R4I A;  3KF6 B;  4BA1 I;  1EOV A;  4AYB G;  4NPS A;  4YWM A;  4GNX A;  5IYB G;  1G6P A;  4GKJ L;  1HR0 Q;  1X3E A;  1NTG A;  4LF9 L;  2JJQ A;  2AHO B;  4DV6 L;  5IWA Q;  3CC7 A;  2NN6 I;  1W2B A;  1EYG A;  1D7Q A;  4FDB A;  1D8L A;  1WI5 A;  1Q12 A;  4LWC A;  1XMQ Q;  1KL9 A;  2JA6 G;  1VQD A;  4DK6 C;  5HGQ A;  1IBL Q;  4GN4 B;  4DR6 L;  5C4X G;  1XPU A;  1VQJ A;  1B8A A;  2CQO A;  1NE3 A;  3AYH B;  4O0A A;  1K3R A;  1N36 Q;  4OWW B;  2B63 H;  4A3D H;  4DV7 L;  4JI3 L;  3CCJ A;  2F4V Q;  4LF6 Q;  3GTQ H;  2YV5 A;  4JI1 Q;  1VQL A;  3I4O A;  4DK3 C;  2UUC Q;  4JI5 Q;  1I6H H;  4HJ9 A;  1LUZ A;  2LXJ A;  5H1S E;  1S40 A;  1KD1 C;  1IBK Q;  4JI7 Q;  1BKB A;  4LF7 L;  4BXX G;  1JE5 A;  4JBW A;  2GN5 A;  1FJG Q;  3RN5 A;  1VQK A;  3CCU A;  1NMF A;  4HIM A;  4QJF A;  4DR1 L;  1N33 L;  3W1B A;  3B6Y A;  1JB7 A;  2R93 H;  4WJ4 A;  2Z0S A;  1XMQ L;  4ALP A;  1ASZ A;  3RNU A;  4LF8 Q;  3UDF A;  1PH5 A;  4EQ5 A;  4DPG A;  4DR7 Q;  4MNO A;  1LM0 A;  2KEN A;  4HJ5 A;  3KOJ A;  1Q82 C;  4IJH A;  3CP0 A;  2DGY A;  2B3G A;  1VQO A;  3TRZ A;  2K14 A;  3CCV A;  2K75 A;  3L0O A;  2OTL A;  4A76 A;  3I55 A;  2NVQ H;  4Y52 H;  3TEH B;  1KIX A;  1UE1 A;  2EIF A;  1M1K C;  4R1J A;  4B3S L;  2JA9 A;  1A0I A;  2WP8 J;  4BBR H;  3GTJ H;  3CC2 A;  1AE3 A;  4K0K Q;  4P72 A;  1I94 Q;  2KHI A;  1S3O A;  5IP9 H;  1MIU A;  2MQH A;  3ULL A;  3JAM c;  4H02 A;  5M3F G;  4DV3 L;  1XNQ L;  4MZ9 A;  1V9P A;  2JA6 H;  2ZTC A;  3G48 A;  2JK8 A;  3CAM A;  1PA6 A;  2PI2 E;  1KC8 C;  5M3M H;  1V1Q A;  1YJN A;  2QGQ A;  3ULJ A;  4X66 L;  3J81 j;  3F1Z A;  4YCV A;  2KCM A;  2NZO A;  3PGZ A;  4GN5 A;  1HR0 L;  2IY5 B;  1KHI A;  3KLW A;  4P73 A;  5GAH C;  4A3L G;  3K80 C;  1VQF A;  4DV0 Q;  1PH4 A;  1TWF H;  5C4J H;  2DUD A;  1M90 C;  3HOU G;  1N32 L;  4IPG A;  4AIM A;  4JI4 L;  2OQK A;  2YYZ A;  3CXC A;  4C3I H;  4KI0 A;  2VQF Q;  3OW2 A;  4TVA B;  3MEF A;  1ASY A;  1HZA A;  1SR3 A;  2XGT A;  3GO5 A;  2YTV A;  4JCV E;  4JI8 Q;  1G51 A;  5IYB H;  5C3E H;  1C7Y A;  2N8N A;  3ER0 A;  1HNZ Q;  1DGS A;  3BJU A;  2GVA A;  4AYB E;  5LMN Q;  4GKK Q;  1PH2 A;  4GOP B;  2R7Z H;  1MJC A;  2YTY A;  4YWK A;  2LSS A;  5FLM H;  4QGU A;  1WCM H;  4L5T A;  4C2M H;  1TWC H;  2UUB Q;  2PMZ E;  2YU9 H;  3WWV A;  4X65 Q;  4DR1 Q;  3HOV H;  1YNX A;  1PH7 A;  5C44 H;  4A3F G;  1XPO A;  3CCL A;  4NXM L;  4LF8 L;  3I4M G;  1W3S A;  1JT8 A;  4UP8 A;  4YY3 L;  1U0L A;  4LUV A;  1L1O B;  3D0F A;  2CWP A;  1IL2 A;  3I4N H;  1K73 C;  4JI2 L;  1WCM G;  2A19 A;  3FKI G;  1EWI A;  5IT9 c;  2R7F A;  1XNR L;  2UXB Q;  3U4V A;  3CMA A;  4GKK L;  4JI1 L;  2UUC L;  1YVC A;  3I7F A;  1HNZ L;  1XJV A;  2EQS A;  2E5L Q;  4JV5 Q;  1E7Z A;  2MNA A;  4JBM A;  2Q2T A;  3I4M H;  1Y1W G;  4O2D A;  4IPH A;  3G6E A;  1R9T H;  4BA2 I;  3K8A A;  1NBW A;  3KJO A;  4DAY B;  4GLX A;  2RHS B;  4DV2 Q;  4JI6 L;  2Q2H A;  3HFZ B;  3ERS X;  2R92 H;  2KHJ A;  1PV4 A;  1UE6 A;  2OQ0 A;  3EN2 A;  1VQ6 A;  4DV0 L;  1HR0 W;  4LF9 Q;  4BY7 G;  1Z9F A;  1X6O A;  1QUQ B;  1I50 H;  3KF8 B;  3OTO Q;  4GOP C;  2AWO A;  1S72 A;  4KHP L;  4X66 Q;  1VQC A;  2R6G A;  3MXN B;  3IRB A;  3CW2 C;  1VQI A;  1HNX L;  3D31 A;  1L1O A;  4DNI A;  4OWX B;  4JC0 A;  2E2I H;  1LYL A;  3S1M H;  4GN3 B;  4IPC A;  1E22 A;  2WB1 G;  4PZ8 A;  1VQ9 A;  4JI3 Q;  2Q2U A;  4LF5 L;  4BY1 G;  1X3G A;  1J5E Q;  1YJW A;  4DR2 Q;  2E2J H;  2N78 A;  3A5Z B;  3A74 A;  5J3B A;  4GNX C;  1VQH A;  5BR8 Q;  4Y7N H;  3VDY A;  1GD7 A;  1VQA A;  4DV1 L;  2ZTD A;  4LF4 L;  2Y0S E;  4RMF A;  1CKN B;  5C0X G;  2LXK A;  3CPW A;  4POG A;  2OTJ A;  5HY6 A;  3J7Z C;  4KHZ A;  4LFA Q;  3GTL H;  1KAW A;  2JEA I;  5GQO A;  4DAM A;  1VQN A;  1GO3 E;  3KFU A;  4LFB Q;  2VS1 A;  4X64 L;  4NB3 A;  3J80 i;  3FP9 A;  2HIV A;  3RLN A;  1WOC A;  4JI2 Q;  2D0P A;  5M5X H;  1XPR A;  1TWA H;  5K36 G;  3HOW G;  1PH6 A;  3F2C A;  2EXD A;  2UXD Q;  5IYD G;  5IP9 G;  2R92 G;  4A3K G;  5ELO A;  3CD6 A;  2VW9 A;  4X65 L;  4YCW A;  3PO3 G;  3PUW A;  3J7A 5;  3ULP A;  4BBR G;  4APV A;  3CCS A;  1Q1E A;  1A62 A;  1CKO A;  3TS2 A;  4LW1 A;  3CCE A;  1N9W A;  4BY7 H;  3KDF A;  1YEZ A;  3PF4 A;  4UY8 C;  1UEB A;  2JE6 I;  2PI2 A;  2RCN A;  3A0J A;  4UP9 A;  3STB C;  5AJ3 L;  2D62 A;  3J81 c;  5JEA J;  3H3V I;  3E9I A;  2PNH A;  4IJL A;  1VQ8 A;  1SLJ A;  4LF6 L;  1I3Q H;  1K0R A;  1Q86 C;  3CQZ H;  5IE8 A;  3T1H L;  1IXR A;  4IO9 A;  3HKZ E;  2WFW A;  1IYJ B;  2VY3 A;  4JOI C;  2K5N A;  3M7N A;  3G4S A;  4A3F H;  1E3P A;  4DUY Q;  2A8V A;  2JA7 G;  5LMU Q;  2BA1 A;  1IZ6 A;  4IFD G;  3RLO A;  2VQF L;  1H95 A;  2JEB I;  1UE5 A;  1VQ5 A;  3S2D H;  4BBS G;  1N32 Q;  4X6A H;  4A3D G;  1P8L A;  5FLX c;  4A3M G;  4HID A;  3FKI H;  3UE1 A;  3T1H Q;  1B7Y B;  3GTM H;  3I4N G;  1T9H A;  2BH2 A;  2NVX H;  2UXC L;  4DR4 Q;  3CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...