4A3DG

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3dG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3dG01
1B70B 1HZBA 3CCRA 4AQYL 1XPOA 1OXVA 2F3IA 1PYBA 3NEMA 4UP9A 1HNZQ 3J81j 3CCUA 4GNXA 3M9BA 3TS2A 1KQSA 4YCWA 4JI7Q 3OW2A 5GAEC 1JE5A 3MXNB 3B6YA 4LFAQ 3PIOA 4DV0L 4A3MG 4IPDA 4TVAB 4A75A 4LUOA 2N3SA 1YVCA 3I2ZA 4P75A 4JI1Q 4BA1I 4B3RQ 1PHJA 4C3HH 1JT8A 4IPGA 2NN6G 4R4QA 1XMOQ 2V1CC 2ES2A 1XMQQ 3RLFA 2UUCL 1QVGA 5H1SE 3BJUA 3AQQA 3STBD 4LF8Q 1PH6A 2PMZE 5J3BA 1HR0Q 4OX9Q 1K3RA 1X3EA 3IRBA 1E1TA 1G51A 2C35B 3M3YH 1QZGA 2R7FA 3T1HL 1BKBA 1WI5A 1HNXL 1G6PA 4JI4Q 2JEAI 3GTQH 1BVSA 2DGYA 1JJ2A 1U0LA 3UE1A 2B63H 4JYAL 4H02A 5M5WH 4QQBX 1KIXA 2UU9L 3A74A 2HHHQ 2MO1A 4GS3A 3HOXH 2R93G 1YHQA 4DR6L 1QUQB 3LGJA 4LF9Q 4A3JH 3GTPH 4BBSG 4C2MH 5BR8Q 2K75A 1Q82C 1VQOA 2ZM6L 1V9PA 1AE3A 5M3MG 4BXXH 4A3CG 1FVIA 5ELOA 5ELNA 2E2JH 1QZHA 1KHIA 1WFQA 2NVQH 2ALYB 2K50A 1XJVA 2VW9A 3FKIH 4DV4L 5IYDG 4A3LH 4MZ9A 1YITA 4APVA 4X65L 1PVOA 5C0XG 2JJQA 5JJLA 1N36L 4A93H 4JI8Q 1VQCA 4GKKQ 1A63A 5C44H 1EQQA 1KL9A 3CCLA 4NXNL 2VQFQ 1B7YB 5IYBH 4B3MQ 4MTNA 3PUZA 4A3GH 5LMNQ 1LUZA 1X54A 4GLVB 1FJGQ 3L2PA 3CMAA 4YWLA 1VQPA 2OWOA 1PH3A 1X3FA 3J80c 1Y1WH 1XNQQ 4NB3A 3HOXG 2I5HA 3U4VA 2D0OA 1YNXA 3JAMi 4IOCA 3S15H 2VQEQ 2ZTCA 3KF6A 2R92G 2UUAQ 3KDFA 1NE3A 1K0RA 2PQAB 4GLAC 2BH2A 4JI5Q 2VUMH 4HIOA 3TRZA 3H3VI 2VS1A 1VQ4A 4HJAA 2UXBL 4HJ5A 3H15A 3VDYA 2EQSA 2ZTEA 5IT9c 5GAHC 5M3FG 1L0WA 2A8VA 4OO1I 4A3IH 4NPSA 4R4TA 3BU2A 4DV6L 4A3EH 4A3BG 1LYLA 4DV2L 2FXQA 4DR4L 4PZ7A 4BA2I 3FP9A 1CKOA 5IP7H 1X55A 2Y0SE 4R4CA 2BA1A 1IBLQ 4A3DH 2WP8J 1YEZA 1I94Q 3PGZA 1HNWL 4DR3L 1I5FA 2PI2E 3L0OA 1MJEA 4LFCQ 4A3KG 4O0AA 2GN5A 4OONA 2EXDA 3GTOH 2KCTA 2YYZA 2L15A 3GO5A 4JOIC 1PH8A 3GTGH 4A3KH 4JV5Q 4B3SL 2ID0A 4GKJQ 2OQKA 1EIFA 3M4PA 4BBRG 4DV5L 3STBC 3EN2A 1IBMQ 1WCMG 2XTIA 3U50C 3HOVG 2HIXA 4YCUA 1T9HA 4AQYQ 1B8AA 3KOJA 4ALPA 4LF7L 2K5VA 3NELA 3KF8B 4GOPB 4JI2L 1GD7A 5FJ8G 2I0QA 3CW2C 2IX1A 1VCIA 1TWCH 1V1QA 2KCMA 2RCNA 2PI2A 3CCMA 3ER0A 4UP8A 4JI7L 2IHEA 4R4OA 4LFAL 2D62A 1K9MC 3KDFB 2WAQG 3F1ZA 4A3BH 4P72A 4B3RL 1VQHA 4JI1L 3RLOA 2JA8G 3K8AA 4WJ3M 1N34Q 2UXCQ 3S24A 4BY1G 2JA5G 2I5MX 2JEBI 1SRUA 2K52A 1K8GA 3WWVA 1MIUA 3G4SA 2YU9H 1VQBA 1DGSA 3AYHB 4DR7L 3FKIG 2RHQB 4DUZL 1VQGA 1NY4A 4A4IA 4PZ8A 1XTDA 3PV0A 2GVAA 3PSIA 2CFMA 4YWKA 1AE2A 1Y1WG 1JB7A 2VNUD 4A3JG 2E2IH 1VQAA 2Q2IA 2D0PA 2LSSA 3T1HQ 4C3IH 3K81C 4JI3L 4A3FG 2OTLA 1XNRL 3ULPA 3PUVA 5IP7G 1PH5A 4JI4L 2AWNA 3S16H 1GVPA 1TWAH 3RN5A 4A76A 1YJWA 2ATWA 3I4NG 1KAWA 1Z47A 2DUDA 4L5SA 1NBWA 4DUYQ 1I3QH 3J7ZC 3S1RH 3GD7A 3NENA 2UU9Q 5IYBG 2HHHL 3CCQA 4LF6Q 2JA6H 4DR6Q 3E9IA 1LTLA 4PMWA 1CSQA 1X56A 4GN3B 4LF9L 2BH8A 5BR8L 1X6OA 1PFSA 3TS0A 3GTMH 4R1JA 4HJ9A 4OWXB 3A0JA 1HZAA 4O2DA 2R92H 5JJKA 4DR2L 3M7NA 3I4MH 1VQEA 4P74A 4DV4Q 1NMGA 1CKNB 3K7AH 4X65Q 4LF4L 2NVTH 1VQLA 1PH4A 4K0KQ 1A0IA 4JI8L 2IY5B 4UP7A 1NTGA 3ULLA 3DLLA 4A3GG 4DK6C 1IBKQ 3AFQA 1YBYA 4NXNQ 1VQ6A 3MEFA 2NN6I 5LMUQ 3GTLH 4KHZA 2Q2HA 1X3GA 2VY3A 3UDXA 5LMNL 2N78A 3PF5A 1FJGL 2QGQA 4QGUA 1Q81C 2CCZA 4UY8C 1GKHA 3W1BA 3I4OA 3ULJA 4IFDJ 1C0AA 3CCEA 2Z0SA 1X9NA 4LF5Q 2UUBQ 2WFWA 3CPFA 1QVCA 3BZKA 1K73C 2A1AA 4L5QA 3T1YQ 4GOPA 3TREA 4HJ7A 4DR1Q 1A62A 4JOIA 2H5XA 4EQ5A 1HR0W 3I55A 4QIWE 2PQAA 3HKZG 1SROA 4L5TA 3CCVA 1D8LA 4A3FH 1EYGA 3I4NH 1KC8C 4BBSH 3CPWA 2F52A 2IHFA 3ICEA 1KRTA 2UXBQ 1KXLA 1Q12A 1J6QA 2KBNA 5GADC 4KI0A 3SGIA 2AMCB 1UE6A 1OTCA 4DV6Q 2OQ0A 5FLMH 4DR4Q 3HOUH 5C4XG 4DR5L 3CD6A 3J81c 5C4JH 5IP9H 1K8AC 4LWCA 1HJPA 1UEBA 4GN5A 1CKNA 4DK3C 2MFIA 1EIYB 2JQOA 1IBLL 2MQHA 4IOAA 2AKWB 3PO3G 4BY1H 1TWGH 2NZOA 4OXPA 4HIMA 4DR3Q 2JA6G 1PV4A 3AEVA 1HZ9A 3F8TA 2E5LQ 4LFCL 1R9TH 3OTOQ 1YI2A 3UDIA 3S14H 2BA0A 2KHIA 3BZCA 1N33L 4AIMA 4X62Q 1H95A 2I5LX 5IYCH 4JBKA 1VQ9A 4JV5L 3PCOB 3PUXA 4DV5Q 1IBML 4YHHQ 4BY7H 5GQOA 1TXYA 4YY3Q 3G6EA 2F4VL 4LF7Q 1OXSC 4A3MH 3ERSX 2NZHA 1IXRA 4JI2Q 4GNXC 3M85A 2B29A 5C3EH 1FGUA 4IFDI 3A5ZB 3PUYA 2R6GA 4YWMA 3TQYA 5IP9G 4X66Q 1PA6A 4JI6L 4JI0Q 4HIKA 1L1OB 1Q8KA 2K14A 1E7ZA 3H0GH 4DAMA 4JBMA 1EUJA 3UDFA 4DV7L 4DV1L 3J80i 1N32L 2HIVA 4POFA 1C9OA 1Z9FA 1N34L 4IJHA 3F2DA 4POGA 2UXCL 2WB1G 3JAMc 4A3DG 4X6AH 3CC4A 2UXDL 2QEXA 4P71A 4KHPL 4A3IG 1HH2P 4DAYB 4DR7Q 2K5HA 1X65A 2MO0A 1OXUA 4ME3A 4DUZQ 3E0EA 4B3TL 1L2FA 1JMCA 3KF6B 2R7ZG 5C44G 1VQNA 1Q1EA 2HQLA 1RIPA 3KLWA 1YIJA 4JI3Q 1XNRQ 3JC66 4LUZA 3FHWA 1D7QA 2CWAA 5JEAG 3HOVH 3CC7A 4HJ8A 4DV3Q 2WAQE 3RNUA 5JEAJ 4X64Q 1BBUA 5C3EG 5EAYA 2NVXH 4DUYL 1QVFA 3I56A 1UE7A 4LF6L 1TWHH 1VQIA 2EIFA 5C4XH 1VQMA 3DM3A 1XPUA 2LXKA 2MNAA 1IYJB 4J15A 1OXTA 2ZJQA 3PUWA 3HOZH 4Y52H 5IYCG 3KJOA 2CKZB 2OTJA 2N8NA 4DR2Q 1PH1A 3G71A 1J5EL 1YHAA 3RN2A 2IT1A 2JE6I 5AJ3Q 2Y0SG 1V43A 1E24A 2NVYH 3I7FA 4NXML 4WJ4A 3D31A 2YTYA 4LF4Q 1BBWA 1S40A 4K0KL 5HGQA 2RHSB 5IWAL 1SFOH 1KRSA 1MJCA 4MNOA 4A3LG 4LFBQ 3HOWH 5IY0A 3HOUG 4IPCA 1IBKL 4QL5A 5GAGC 1OXXK 1UE5A 4DNIA 5LMUL 1SN8A 5IYDH 4QY7A 2YV5A 3RZDH 3CMEA 2N49A 1WYDA 5FLMG 2A19A 5K36G 3M4QA 3L7ZC 4IFDG 1Q1BA 4A3CH 3UDGA 4GLXA 2K5NA 3KYHC 1EFWA 4LF5L 2UUBL 1SMXA 1HNZL 3KJPA 3T1YL 2JA7H 1N8RC 3K80C 1YHBA 3E9HA 4DPGA 1NMFA 4DR1L 3Q8DA 5GROA 1ASZA 2YTVA 2B63G 4RG1A 2Q2TA 4A93G 5DLQE 1MKHA 2Z6KC 2K4KA 3CF5A 2YTXA 3I4MG 5C0XI 4DV0Q 3W1GA 2JA5H 3S1MH 4GN4B 3UE0A 5LMNW 3S17H 3CP0A 4PG3A 4AYBG 1XMOL 3S1NH 1W3SA 2JA9A 4RMFA 4AH6A 1YJNA 3PIPA 4DR5Q 1XMQL 3W5OA 5M3MH 2UUCQ 3K0XA 4L5RC 5C0XJ 1L1OC 3KFUA 2VL6A 1Y14B 4IPHA 4YCVA 3A5UA 1U5KA 4LF8L 1JJGA 1HR0L 4P73A 1VQKA 4OX9L 4OWWB 3GTKH 2R93H 2JA7G 1AH9A 2E5LL 2KENA 3OTOL 2JK8A 1WCMH 1E22A 1VS0A 1HNXQ 3HKZE 4BBRH 4R4IA 3GTJH 4X62L 1N33Q 3PF4A 1GM5A 2AWOA 1CUKA 1Q46A 1VQJA 3TEHB 3S2DH 3K7UC 3F2CA 3CQZH 4JYAQ 1M1KC 1VQ7A 4TQUS 3RZOH 4YHHL 3HOWG 2VZAA 3S2HH 3HKSA 3GDEA 4FDBA 4AYBE 4YY3L 2F4VQ 2KHJA 4JBJA 1IZ6A 1QUQA 4JC0A 1SR3A 1ASYA 3J7A5 2ZM6Q 4JBWA 1KD1C 4X66L 2E8GA 4JI6Q 1LM0A 1E1OA 4JI0L 2PNHA 4XIGS 4OWTB 4A3EG 1FL0A 2E2HH 1O7IA 4XTCS 4DV7Q 4DV1Q 1K83H 3HOYH 3HOZG 3PO2G 1N32Q 2ZJPA 3EBEA 2QA4A 1Q7YC 1N36Q 3J81i 2UXDQ 4GKKL 2GVBA 3G48A 3H0GG 1I50H 4KHPQ 2HT1A 1EQRA 5HY6A 3U4ZA 1PYSB 4IO9A 3CC2A 5E7NA 3CCSA 1P16A 2VQFL 2AHOB 2ZJRA 1YZ6A 3ZJYC 4GOPC 1EWIA 4B3ML 4B3TQ 2ASBA 4KLKA 1SE8A 4DKAC 1P8LA 4LNQA 3HFZB 2XGTA 4BY7G 3F2BA 1TWFH 4UPAA 1UWVA 2B3GA 1XNQL 2LXJA 4DV3L 1GO3E 5M5YH 4X64L 5FJ8H 1PH9A 1M90C 4OO1G 2VQEL 1JJCB 2R7ZH 4C3JH 3M4OH 3CXCA 1VQDA 2OCEA 2UUAL 1S3OA 2WB1E 1I6HH 5JJIA 1N9WA 1CSPA 4JI5L 1UE1A 3H3VH 1Y1VH 1IL2A 1HZCA 2Z6KA 3CAMA 3D0FA 2IX0A 5FLXc 1C7YA 1WJJA 2VUMG 3EIVA 3OYYA 1S72A 1NJIC 3PO3H 1PH2A 4IJLA 1J5EQ 3S1QH 4Y7NH 1VQFA 1WOCA 1EOVA 4DV2Q 5AJ3L 1E3PA 4NXMQ 4LUVA 1VQ8A 3RR5A 2Q2UA 4BXXG 2ZTDA 1Y1VG 5IWAQ 4LFBL 2JA8H 1A8VA 1CKMA 2CWPA 1RL2A 1YJ9A 1I94L 1VQ5A 1HNWQ 4HIDA 3CCJA 1L1OA 1PH7A 3HOYG 3PO2H 5IE8A 5M3FH 5M5XH 1W2BA 2R7DA 3AFPA 4JCVE 4GNXB 1XPRA 2RF4A 4JG2A 4QJFA 4PZ6A 3RLNA 1Q86C 3U58A 4B3SQ 4GKJL 1G291 4LW1A 2CQOA 1SLJA 4EX5A 3NBHB
chains in the Genus database with same CATH superfamily
2R92B 3G8CA 4A3GB 3H91A 4R8NA 2VUGA 1FD7D 5L1LA 3TS2A 4KD3A 5EWEA 3OW2A 3MA2B 5GAEC 1JE5A 1G6ZA 3PIOA 1R9TB 4A75A 3TZUA 4JI1Q 1SBBB 4FBTA 4K5WA 4EQPA 3ERQA 3WO1A 5CV7A 3GTPA 5K36H 3TDQA 1HA6A 1RJTA 3RLFA 4PV1C 2NU9B 2UXDH 1QVGA 2D5DA 1CA6A 4OX9Q 4APMA 2EE1A 2PBZA 1M4VA 3IRBA 3V4SA 3PMFA 2C35B 4IALA 1PRTD 1QZGA 3TP6A 3H0GB 4RHRA 2FPGB 5I2XA 1CQFA 2KA7A 1B9MA 2NTSA 4HEDA 4A3DB 1HFGA 2RDGA 3BVMA 4J8QA 4XXEA 2PPBC 1JXLA 5LMUH 5M5WH 4K8IA 2HHHQ 1K28A 4Q0FA 3QZ8A 4MTKA 1YHQA 3T56B 2K28A 4G7ZC 3SVMA 4BBSG 1SJED 4LJZC 3M4OB 1Q82C 4MAMA 5HV6A 2ZM6L 5KG3A 1V9PA 3GIIA 2NUCA 3W3AA 1KHIA 2ALYB 4J0MA 1F9QA 4V190 3JRWA 4DV4L 4A3LH 1YITA 2BDNA 1G2SA 2JJQA 3L3OC 4H7BA 3DEPA 1Z2PX 4M9UA 4OL7A 4BBRB 4UDUC 4LF6H 2NN6H 2VR1A 1J9OA 3D8GA 1PLFA 3BQ1A 5JVDF 1LUZA 4HNVA 1ZEQX 4EEQA 4YWLA 4IUPA 1VQPA 2FK2A 1PFNA 2FHTA 2IJ0A 4HCEA 1X3FA 4F4XA 1KNAA 1XNQQ 5JPNC 4RGTA 2Z4IA 4AYBB 1NR4A 1YNXA 1X3PA 3NQTA 4CKEA 2VQDA 1AZPA 3KF6A 2N55A 2R92G 3GTQB 3GTOA 3KDFA 2BH2A 4JI5Q 1CQJB 3TRZA 1EY4A 1VQ4A 4Q45A 4HJ5A 2ZTEA 5CBAE 2RA4A 3TIGA 4OO1I 3BU2A 3I73A 4A3BG 3VR3A 5KFYA 4QWEA 1NNXA 1PTOH 1S97A 1UC8A 5L1KA 3HOWB 2B63B 2M9VA 2J9GA 3OW7A 1Z6HA 5IIFA 3PGZA 3RBEA 1SEBD 4DR3L 2EJGC 4K8JA 1IBMH 3L0OA 4OONA 2EXDA 4JOIC 2C2RA 4JI0H 2WKDA 2C2DA 1RJQA 4MV9A 1EIFA 4L8JA 3EN2A 3HOVG 4ECQA 1EU3A 4YCUA 3P75A 3TINA 1T9HA 1I94H 1B8AA 1VF5C 1WVLA 3G6JB 1SNDA 3S1MB 1JORA 1VCIA 1TWCH 2LFNA 2TMPA 4DV3H 1VDZA 2PI2A 1KBLA 4LFAL 2B8GA 3KDFB 2WAQG 5I6YA 1BGWA 4TQRA 4OGQC 4J9NA 3V6JA 4CKBA 3NTHA 3I70A 5KFMA 2UVWA 1K8OA 2JA8G 2KHSA 2P5ZX 3M9OB 3K8AA 2CW0C 4IWXA 1TVXA 2I5MX 5EWFA 5F9LA 4XT1B 4K6DA 1B9NA 1TS4A 3AYHB 3MZ5A 2RHQB 4DUZL 4A4IA 4PZ8A 1XTDA 3N42B 2JEGA 5CA1F 3PV0A 1N56A 2GVAA 3PSIA 1JB7A 1KLGD 4NXNH 2E2IH 2Q2IA 1AW7A 2D0PA 2LSSA 3T1HQ 1IKMA 1XNRL 2OH2A 2SDFA 3PUVA 2AWNA 2R92A 3OOCA 2ATWA 3C1FA 2DNEA 2HGSA 1LT6D 3P20A 1B44D 1I3QH 2XRSD 1RJRA 3GD7A 2JN4A 3GP7A 5IYBG 3CCQA 4DGZA 2HHHL 2JA6H 3BG5A 3RB0A 4PMWA 1LTLA 1CE8A 4LF9L 5JUMA 4ZUJA 2F1MA 1X6OA 2R85A 1ZQ7A 3K5NA 3TS0A 3Q8QB 1KDBA 3HXLA 2C22A 2AUKA 2R92H 4O2DA 2JA5A 4I7AA 2V9WA 4DR2L 2UU9H 4P74A 4DV4Q 4JI7H 1CKNB 4UCUA 4CC5A 4X65Q 2W7PA 1M0WA 3KBGA 2NVTH 4C3JB 1PH4A 3E5SA 1EY6A 3H4BA 4QIWB 3MR2A 2ICIA 1ET6A 4UP7A 1NTGA 4EBCA 5KG2A 3H0GA 4DK6C 3J7YW 1E4EB 5KIXA 3OSNA 1VQ6A 1AFPA 4G4KA 3SEBA 2CW0D 4ZUIA 3KXYT 2PQEA 3R2IA 3PF5A 2IBKA 1FJGL 5EBDA 2QGQA 1Q81C 4CHTB 2CCZA 3GTPB 5JOBA 4J6HA 3MXUA 1SE3A 4IURA 1X9NA 1TWCA 2UUBQ 3CPFA 3BZKA 1E2VA 3BDLA 5KGUA 2FK1A 1PZID 2RDJA 1LO5D 2K33A 1G91A 2YU9B 3HKZG 3RZDB 4O3SA 3CCVA 1SJHD 4ECYA 4NMZA 2VQEH 3BYYB 1B04A 3KAKA 4IWYA 2D9UA 4JK1C 4RGMA 1BCPB 4LFAH 4DV6Q 2B39A 2R87A 1DCZA 4LSXA 2E2HA 2PCFB 5C4XG 2BE5C 5A35A 4MA5A 4LWCA 4GN5A 1UEBA 2FFKB 2VA3A 1A2UA 4X65H 4IOAA 2JA6G 5CV6A 5KFCA 1HZ9A 2O4XA 4LFCL 1YI2A 1JOOA 1D5XC 2OLSA 4TUYF 4RWSC 4AIMA 4X62Q 2WTFA 5IYCH 4JBKA 2K1BA 1VQ9A 4MA0A 5BN4A 4FXGC 4KKSA 4JI1H 1IBML 1NCVA 4YP3A 4YHHQ 3RGXA 4BY7H 4YY3Q 1BCPD 3V05A 2M05A 4GNXC 1T36A 3K3VA 1N36H 5C3EH 5I2YA 1SE4A 3TQYA 2EOTA 5IP9G 1PA6A 4HIKA 1L1OB 4LF9H 2E74C 4WD3A 3A8JE 4YQWA 2ZDQA 1EUJA 3QR8A 3UDFA 4DF7A 1S5FD 1Z9FA 2F4IA 2MPMA 4IJHA 2L55A 4POGA 1HRJA 4A3DG 1Z2OX 1XNQH 4HMJA 2VB2X 4UHVA 1IYVA 3H94A 2QEXA 3QB3A 4RB0A 4R8UB 1EWHA 1HQRD 2MO0A 2J6SA 2G9DA 1L2FA 1AUVA 4MV8A 2R7ZG 2A6ED 1U4RA 3J7AF 1RODA 1OWTA 2WIIB 4RZQA 2ASLA 4DNTB 1XNRQ 3JC66 3GIJA 1ZKOA 5JEAG 4HJ8A 3K5MA 5C3EG 4EBEA 2NVXH 5TSSA 4DUYL 5BPHA 2OEOA 3LWEA 3I56A 4LF6L 3C3LA 5DQHA 5C4XH 5HGTA 1VQMA 3DM3A 1HHVA 4KKUA 1C3OA 2PMZA 1IYJB 3HOZH 3HB9A 4DV1H 5IYCG 3Q23A 3NXWA 2CKZB 2N8NA 2M2LA 2CH4A 3PO2B 5LA6F 3NUCA 2RBMA 1UAPA 3T4AC 1FGBD 2IT1A 3NWTA 2NVYH 2ZM6H 4WJ4A 3D31A 4GKKH 1S40A 2JA7B 4O3OA 2EJFC 1N48A 1MJCA 3G6XA 4L63B 4XT3B 1IBKL 3URYA 2PW7A 5GAGC 5LMUL 2A6HD 5M5WB 1SN8A 3FMCA 4ED3A 1GUSA 2YV5A 3CMEA 3V2TA 4ZHQF 5FLMG 4ZQIA 2WYOA 2FINB 3L7ZC 2B2TC 2B2TA 1D6EC 4A3CH 3UDGA 4DV2H 5KEEA 1TKWB 2K5NA 3V6HA 1EFWA 5FOBB 4C1NK 1STHA 1ESFA 3R2TA 2AQ3B 4YR3A 4DR1L 4DPGA 1B3QA 4PWQA 1LABA 2A6HC 2YTVA 3PN1A 4RG1A 2Q2TA 2NU7B 4YIJA 3RTXA 3I4MG 2F0DA 3W1GA 1FJGH 4A3KB 1SNCA 1GHJA 5ELDA 1ENAA 2PNRC 3QWNA 2F0JA 2K01A 5FD6A 3S1NH 2JEJA 2B2VA 4U7CA 4L6TB 3PIPA 1HNXH 2YL2A 4L5RC 1XMQH 4C3HG 1IOVA 4RKBA 3A5UA 1F2YA 3VMMA 2ZXOA 5CB4F 1VQKA 3A7LA 5K5PA 2KENA 3OTOL 2JK8A 1E22A 1VS0A 3HKZE 4BBRH 1N33Q 3T53B 2QW7A 5IWAH 5DAUA 1WTVA 3TEHB 3S2DH 2LS01 1GGOA 4AYBE 3GIQA 1LT5D 2YRWA 2A6EC 2KHJA 2F4VQ 2F3WA 4UCSA 3I72A 3TBIB 2XVSA 4JC0A 2Q8RE 4LF4H 2Z4HA 1Y69U 1KD1C 1O75A 4JI6Q 3KHHA 4QUCA 1EWCA 1FNUA 4OWTB 2WINB 4A3EG 1FL0A 1ZYRC 2E2HH 4HR7A 4MTEA 5C1OA 4Q8FA 4XTCS 3PO2G 4DV1Q 3HOZG 1ULZA 2IL8A 4O4LF 4PMCA 1Q7YC 3DWQA 4JV2A 4KK7A 1WTQA 1QJOA 3G48A 4IRKA 3H0GG 3ONAB 5KG6A 2XRQD 3U4ZA 4IO9A 2ZJRA 1YZ6A 3ZJYC 3CKIB 3KLSA 4KLKA 1S10A 3TN2A 3BZDB 3GLKA 3Q8PB 1SSOA 1TWFB 1CT1D 4DR5H 5C3WA 3OTOH 2FLNA 2DNCA 4DV3L 4HSPA 4V0BA 1M90C 3RIZA 4HTHA 1SCUB 4C3JH 1BJTA 3CXCA 1VQDA 3GTQA 3D4RA 4DV0H 4IHJF 2EDGA 2OCEA 3K58A 2WB1E 2UUAL 5JJIA 1CSPA 3ND9A 4MV3A 1KDAA 1UE1A 5JH7F 4C3IG 4DR4H 5ELCA 2RQXA 1W93A 1WSCA 3CAMA 5FLXc 5KFRA 1QWYA 1S72A 3PO3H 2QF7A 1J5EQ 4IJLA 1I4GA 1EOVA 4N8FA 1ENCA 5KFEA 3MXGA 1VQ8A 2XCPA 4ILWA 4BXXG 3J7AK 4RB2C 1Y1VG 3ORRA 1YJ9A 1VQ5A 1HNWQ 5M5XB 2JSOA 4HIDA 2LY7A 3PO2H 3TSSA 5IE8A 1FKAH 1MSHA 1VMCA 4K5VA 2RF4A 4QJFA 3U58A 4GKJL 3EA6A 1D1KA 2C9OA 2CQOA 1KAAA 1JWMD 1HFNA 2O5IC 4G3IA 1K1SA 1JLLB 3CCRA 3IAYA 1LTAD 1LT3D 2BCOA 4R9WA 3CCUA 4IRDA 3ETJA 3M9BA 4J9SA 1V1OA 4RCNA 4YCWA 2A69D 4F88A 1D5ZC 2K03A 1TS3A 1Y1WA 3B6YA 3WOFA 2A68C 1N33H 4DV0L 2EYJA 5GONF 4FYDA 1RCVD 3I2ZA 4KJNA 1PK8A 1PHJA 4F87A 1K83A 1TWAB 1JT8A 3HOZB 1EIGA 2V1CC 3DF7A 4YR0A 1XMQQ 4ED1A 2NYZD 4JI3H 3DMUA 5H1SE 1QCBD 2XN9C 3AQQA 1PH6A 2PMZE 4DUYH 4DR3H 4C2MB 1K3RA 5IT9W 4ED0A 2XD4A 3T1HL 1WI5A 1E4FT 1WD0A 1G6PA 1R9TA 2N88A 4R8IA 1X3QA 1BF4A 1B3AA 4RNMA 1H9KA 1YNNC 3BG3A 1DOMA 5D65A 4H02A 5EPLA 4DAPA 1KIXA 1DZ1A 3VYTA 3SK8A 3A74A 4BY7B 2MO1A 3ETHA 2DLNA 4P2CB 2R8IA 3R3OA 3PO3B 5FD5A 1IHZA 1JICA 2K75A 3K0YA 3U9OA 5BR8Q 1B1ZA 1AE3A 5M3MG 4A3CG 2F0OA 4A2BA 5ELNA 4A3BB 1QZHA 3EPIA 4RFBA 4ZYSA 3BA8A 4KN4C 4YY3H 3PR4A 1XJVA 3MVVA 2VW9A 4BY1B 4MZ9A 3HBLA 4APVA 5C0XG 3K57A 5JJLA 1N36L 5KKNB 2YZNA 2XCAA 5CGKA 1KL9A 4WORA 3KHGA 5ISRA 2DWCA 2NU6B 2IA6A 2F0PA 5IYBH 3GTGB 4MTNA 5CAEB 3PUZA 2K5DA 1YNJC 1X54A 2A5HA 4GLVB 4LK1C 1RHPA 3CMAA 4C5CA 1EYCA 2OWOA 4ECZA 3J80c 3H20A 3OMGA 2XIWA 3N8DA 3U4VA 1EY8A 1EZ8A 1JWUD 3JAMi 3S15H 1Y8NB 1S4ZA 5G3LF 3QJYA 5DM63 2UUAQ 1NE3A 1F2MA 2PQAB 2R7NA 1JR0D 2NUAB 2BQUA 2VUMH 4HR7B 4HIOA 3H3VI 3HOXB 4HJAA 1R4PB 3I90A 3RB4A 4XDXA 1XDNA 3TQ1A 2NVYA 2A8VA 4A3IH 4FU0A 3N44B 1LYLA 4DV2L 1LLRD 2FXQA 2VXWA 2Q8TA 2PZTA 5KG5A 2WKCA 2B2YA 2H4OA 4J9PA 1CKOA 4R4CA 1CHQD 1EFID 1Q8IA 1TT2A 2BA1A 4FS2A 2R8JA 1YEZA 3BDOA 5HURA 5KFVA 3K3PA 5FO9B 2KJXA 4O0AA 1PX2A 1K1QA 2R82A 1EU4A 1S0MA 1E2ZA 3OWEB 3GTGH 4A3KH 2ID0A 2OQKA 4J9OA 3M4PA 5IOCA 4BBRG 3STBC 1I4QA 2VPQA 3S1NB 1A9XA 4B9XA 3KOJA 4LF7L 1TU2B 2K5VA 3NELA 1PRTB 5CORA 4DK1A 5FJ8G 1BUVT 3CW2C 2IX1A 3CCMA 4JI7L 4UP8A 3JRXA 1BOSA 4R4OA 2W71A 1YNND 4A3BH 4FS1A 4EEYA 1U9RA 3RLOA 1K83B 3OHXC 4WJ3M 4F4YA 1N34Q 2UXCQ 3S24A 2JA5G 4EYHB 4XZ3B 2J7ZA 2KCNA 5C6AA 4JUZA 4JV1A 5LL6X 3G4SA 2J6TA 1TQOA 4DR7L 2HHHH 4YAJB 1V4YA 1DOLA 1VQGA 3NBIA 4I65A 3M4YA 4DV6H 5C5LA 1WD1A 4I50F 3GIMA 1ICWA 2FMCA 1ML0D 4A3FG 1SYXB 1JOKA 3RMHA 1PH5A 4JI4L 2VUMB 1YJWA 3RN5A 4PQXA 4PNYA 1ICFB 1JDBB 1KAWA 1NBWA 2KOLA 3S1RH 1XTCD 4LF8H 4ME5A 2W6MA 5KT5A 2PN1A 4KY6A 1CSQA 4GN3B 2BH8A 1BCPF 5BR8L 1T94A 1AN7A 2J0TD 3KLSX 4IQZA 2L11A 4HJ9A 4OWXB 1S68A 1HZAA 5IGFA 5JJKA 1JB3A 3SDZA 5C8YF 3M7NA 4U6PA 2E2IA 4F4WA 1NMGA 5IGEA 2EJMA 1SMYD 2FK3A 2R7ZB 4K0KQ 1PTOB 3BA9A 1FR3A 3IKJA 4A3GG 4EG0A 2JXMB 1YBYA 3MEFA 2EZVA 5KNCA 3GTLH 2WB1A 5BPFA 2JA8B 1TIID 5F2DA 5LMNL 1UUPA 3HKZB 5EGTA 3SK4A 4CBVA 2SOBA 4UY8C 2R7KA 4A3JB 1NAPA 5CV9A 4IFDJ 3SK6A 2YRXA 1TWFA 3BVGA 1K73C 2ALZA 3DM1A 2DN8A 4L5QA 4HN7A 2HDMA 4GOPA 1HR0W 4DR1Q 3OHBA 2F03A 1O78A 3H40A 2PQAA 1EYZA 3HOYB 1GLVA 1H9RA 3FKIA 1XMOH 4A3FH 1DONA 1D8LA 4FF3A 4BBSH 1J5EH 3ICEA 2UXBQ 1E0BA 1J6QA 4KI0A 4XQNA 4HCSA 4DL2A 4RGNA 2OQ0A 4DK0A 5FLMH 1PFBA 4DR4Q 1ZXTA 4G57A 5C4JH 1QOHA 1O7YA 2RKSA 1CKNA 4B08A 2JQOA 2MQHA 5J39A 3BJYA 3NTKA 2CQAA 1PV4A 3AEVA 3S14H 3UDIA 3GTKB 4KY5A 4FP5D 2JA6A 1A3TA 1BXTA 3HRZC 3SXHA 5COYA 2MGSA 4JV5L 2A69C 4DAVA 4DV5Q 1V1PA 2HVQA 1CHPD 2FB9A 5GQOA 3HKZA 3I4MB 2F4VL 1OXSC 3QOJA 4EQOA 4A3MH 2YS7A 4ECTA 1IXRA 1MD2D 4JI2Q 2SNSA 2HUGA 2E75C 3PUYA 2R6GA 4FF4A 1KJ9A 3RGZA 2C2EA 4NXMH 4JI6L 2B2VC 5I6WA 3VR4A 2K14A 2Z6BA 2XSCA 3ORQA 3FDSA 2PVPA 3MWDA 2DPJA 4DV7L 1BBXC 1N32L 5DGAA 2HIVA 5AFWA 1EY0A 5IGDA 1N34L 2UXCL 4F8MA 2QILA 2K32A 1XXGA 3NK9A 3JAMc 4X6AH 3Q8RB 3CC4A 3J7AV 2XNAC 2HD3A 4KHPL 4RKLA 1HH2P 4DAYB 4TV9F 4A2AA 2DY7A 2K5HA 1X65A 3RB3A 3H6MA 1BR9A 4LMQD 4B3TL 3RD4A 2V4DA 4MV6A 3TQTA 1Q1EA 2HQLA 5M3MB 3KLWA 4JI3Q 1D7QA 4O1NA 3KHRA 3FHWA 2ZDGA 3HOVH 1FNWA 5JEAJ 5CR3A 1K0SA 5EAYA 5FLXW 4U673 3HG9A 3LNNA 4O4HF 1TWHH 2L12A 4YBZB 1G8ZD 3OHAA 1GSHA 2LXKA 3A8KE 4YJ3F 2ZJQA 2G5DA 4ZK9B 5C4JB 2RGRA 3MFYA 4N8X1 1EY5A 3HZXA 1NR2A 2E2DC 1YHAA 3ZYYX 3VYUA 2GPWA 4JI6H 5AJ3Q 4NXML 2K05A 2F0EA 3MFGA 1KC7A 3KK7A 1JQYD 5HGQA 2RHSB 5IWAL 1SFOH 2QK4A 5J22A 1RK5A 4IPCA 1SYEA 4KN7C 3RJ0A 1OXXK 5IYDH 5CV5A 5IYZF 4ETSA 3KF8A 2CW8A 1PZJD 3KHLA 1WYDA 2LMCB 2A19A 5K36G 1Q1BA 5IGGA 1W96A 4JI5H 4F7XA 4QCLA 4O42A 3E3XA 2MJ8A 3I8ZA 4LF5L 1IOWA 4CGYB 3T1YL 2JA7H 4B3RH 3E9HA 5KT4A 2B63G 1B4OA 5DLQE 2K4KA 2Z6KC 3X3NA 2IP4A 3FVQA 4DV0Q 5JVG3 2JA5H 3U9TA 4EGJA 4QWDA 4X3KA 4N9TA 3S17H 3E5NA 2GPSA 5A2QW 3Q0AA 5D3IB 4B3MH 5FK9C 5K2MA 3G6VA 1XMOL 4GC6A 4RMFA 1LV9A 1YJNA 2CVRA 3DWAA 1EEID 4ZAIA 5KG7A 3MXPA 5C0XJ 1L1OC 1WTRA 3KFUA 1GSOA 4ME6A 1U5KA 4Z9CB 3RV4A 4OX9L 2SEBD 1WCMH 4H44C 2NWGA 4R4IA 4X62L 3PF4A 1GM5A 1OO9B 5E4WC 2AWOA 2WE6A 1Q46A 1GSAA 3K7UC 3CQZH 2BR0A 4DV7H 3VPCA 1V51A 3S2HH 2QKIC 3FKIB 3GDEA 4FDBA 5KFOA 2IWHA 1EQVA 5KT3A 3MR6A 5KFGA 1I50B 4JBJA 5L1JA 1IZ6A 2WV6D 4NLGA 4HSVA 3C2PA 3FDTA 1SMYC 4JBWA 2VB3X 1JE4A 2E8GA 4JI0L 5D1OB 2ENBA 5C4ZA 2F0HA 2RDIA 2XGPA 4FF1A 4IUTA 1LTID 3HOYH 1K83H 1N32Q 4OX9H 3MAQA 1IKLA 4XQJA 2W6ZA 4K5XA 1EY7A 3TMEA 2F0QA 5DLFA 1PYSB 3CC2A 2FMAA 3CCSA 4IR1A 2VQFL 4GOPC 2EYOA 4B3ML 2ASBA 4DV5H 4IZOA 4ECRA 3ND8A 4RH6A 1LTTD 1SXTA 1P8LA 3TP7A 4LNQA 3HOUB 4BY7G 3A54A 1RKNA 3BDCA 4ECUA 1UWVA 2B3GA 1XNQL 1SNPA 2CZGA 1MI2A 1PH9A 4KTAA 2R7ZH 4XQQA 3M4OH 2J6UA 1MGSA 3JSLA 1WH2A 4J9QA 4KD4A 4JI5L 2F0GA 4ED2A 3H3VH 3P1HA 2YW2A 4ZKBB 1HZCA 2Z6KA 2IX0A 2IW3A 1RTOA 2FJ2A 1GUOA 1GUWA 1WOCA 3FPUB 5KFFA 4DAYA 3DEOA 4LUVA 4NXMQ 1F77A 2R93A 2XWBB 1TWHA 1CTMA 5IWAQ 4LF7H 2DJFC 2W70A 1RL2A 4UFZA 1LTBD 3EVQA 3NSWA 3RZOB 1L1OA 1PH7A 3HOYG 4FM9A 1SNMA 4JV0A 3EQLC 1RTNA 1DM0B 1Q86C 4B3SQ 1KTKA 2GA4B 1G291 2EY1A 4WJWA 3W2DA 4FBUA 5J2UF 4EX5A 1B70B 1HZBA 4AQYL 1OXVA 2HCIA 1S03G 3J81j 1VBGA 5JPMC 3H4DA 2W9CA 1KQSA 1I7NA 4JI2H 4JI7Q 2XGQA 2JA6B 3MXNB 1UEAB 4A93B 1D2BA 4KKTA 4LH7A 4LUOA 3GTMB 1YVCA 4B3RQ 4QMGA 4BA1I 4B3TH 4EVOA 1KEEA 1XMOQ 2ES2A 1BDOA 2JEFA 1BNZA 2F0VA 3STBD 4LF8Q 2PO4A 3D6WA 4KV6A 3E6ZX 1X3EA 5T1IA 2W9BB 3CRLC 1E1TA 1G51A 1T5EA 3C1EA 3M3YH 3MWYW 2R7FA 1SNOA 1JX4A 1HNXL 2EYPA 3R23A 2VPSA 1I3QA 3GTKA 4CJ1B 1JC7A 2AQ2B 5J1ZA 2AUJD 4JYAL 2F4VH 2UU9L 4GS3A 3HOXH 2R93G 1HPCA 4DR6L 1QUQB 3GTPH 4K0KH 1HA5A 2OXPA 4C2MH 1ET9A 1VQOA 4BXXH 4O2AF 2E2JH 2ZXRA 2F0NA 1WFQA 2NVQH 1I6HB 3J80W 2A73B 5JQWA 3I91A 3GV7B 2HCCA 1W6JA 1EOTA 1MZBA 4JI8Q 1VQCA 1A63A 1XNRH 2QDBA 1S5DD 1GUNA 1I6VC 4NXNL 1SDFA 5KX5F 3QOLA 2VQFQ 4B3MQ 3PZPA 1IBKH 2W6OA 5LMNQ 4RGOS 4EFBA 3I4NB 3I4LA 1SE2A 2EYFA 5C5MA 5FPOA 4OEMB 3S14B 2I5HA 3RAXA 2WAQB 2D0OA 2DY8A 1MHWC 4IOCA 2ZTCA 5FO8B 2W6QA 2BQRA 1Y8OB 4C5BA 1K0RA 1QE6A 4PDBA 4O3QA 5E3FA 5ELBA 4CJ2C 2UXBL 3H15A 5IT9E 2X69A 5IT9c 4J9KA 3P7JA 5GAHC 5M3FG 4NPSA 4R4TA 4A3EH 4PZ7A 3FP9A 3C0FB 3EROA 2Y0SE 5KG1A 1STAA 1IBLQ 2WP8J 1I94Q 1E4EA 3PW7A 4J1MA 1HNWL 1I5FA 2PI2E 5DG8A 1MJEA 5LHY1 2JEIA 2GN5A 1E2WA 2YYZA 2L15A 5KRUA 3MFHA 2R61A 1PH8A 4NKLA 3K5LA 1G2TA 4X66H 4JV5Q 5KNDA 4B3SL 1WTHA 4DV5L 1VAJA 3BABA 2HIXA 4QUFA 4DL3A 4JVZA 4GOPB 5F9NA 2R93B 1A6XA 1GD7A 3R8BA 2I0QA 2JA5B 2NVXB 2F0UA 2RCNA 3RF2A 3NP8A 3ER0A 3MHBA 1UNNC 1GJXA 1O80A 2D2CC 1K9MC 5EJWA 4RHSA 2ZXPA 5C4XB 1CS0A 4P72A 4C5AA 3BQ2A 3PVXA 4B3RL 4H13C 4JI1L 1JIHA 4DL4A 2UVUA 1QG7A 2C28A 2L9HA 4BY1G 2PZWA 1AN8A 2F0MA 3WWVA 5EWGA 2UVVA 2YU9H 5M3FB 1VQBA 1DGSA 3J81L 3I3CA 3M7GA 3NE5B 4DL6A 1I4RA 1NY4A 3S1RB 2EXZA 4YWKA 2AGQA 1Y1WG 4QWAA 4A3JG 2V4RA 1CQIB 3WNZA 1C4QA 4O3RA 4C3IH 2F0TA 2JYOA 2OTLA 3S16H 1H9SB 1GVPA 5D8DA 2DPIA 5DG7A 1Z47A 4DXFA 4DUYQ 4MHEA 1WTPA 3NENA 5T1GA 3E9IA 4FXDA 2ZT9C 3PQIA 2FP4B 1WCMB 4UAIA 3GIDA 2L1BA 3N41B 1PFSA 3GTMH 3RAQA 3A0JA 1TWAA 3HOVB 4AQYH 3IFDA 1GHKA 2E5LH 1VQEA 4Y8VB 4R7RA 3VYRA 1VMPA 1I4XA 2F0WA 3K7AH 2R8KA 2R8GA 1TWGB 5D14A 5KYIA 1LACA 5I9OA 1XYIA 3QIAA 5E4XA 4LF4L 3S17B 1A0IA 1AEXA 2IY5B 3M9MB 2KQ3A 3ULLA 3DLLA 1PDQA 3RFCA 5KFPA 1ENFA 3AFQA 3KUPA 4NXNQ 3PW0A 5C3XA 5KFBA 3HP3A 1LTSD 4KHZA 3RUZA 3OUZA 2AU0A 1X3GA 3UDXA 1HUNA 3KALA 3KLRA 3R5HA 1S0NA 3JAME 2AGPA 4TKOB 4OIKA 1WTOA 3W1BA 1TS2A 3I4OA 1C0AA 1TAEA 5HBRB 2KEEA 2Z0SA 3GILA 4LF5Q 1SYFA 2PZUA 2NB0A 1QVCA 1J8IA 3T1YQ 2B2WC 3TREA 1A62A 2UUBH 5EBCA 4ODGA 1Y1VB 3QO2A 2RGVA 4L5TA 1KLUD 1KC8C 5NUCA 3CPWA 2IHFA 1KXLA 1KRTA 4EGQA 1Q12A 2KBNA 5GADC 1RYSA 3SGIA 1SFOB 4OIJA 1PZKD 1PRTF 2AMCB 1QNUA 3HOUH 1EY9A 3BS1A 1S5ED 4DR5L 3J81c 5IP9H 1HJPA 1PMRA 2KVMA 5EPJA 1BNCA 1EIYB 2MFIA 1IBLL 1TY2A 2AKWB 4BY1H 1H9MA 1TWGH 4OXPA 3T5JA 1V8QA 3GTKH 1HR0H 1HCZA 2W9AA 1R9TH 2KHIA 3OSPA 1Y1WB 2K7VA 1SYCA 4G7OC 1DV2A 4C3JG 2I5LX 1TWHB 2MP1A 4OO1H 3PCOB 5EKIA 1BXRA 2X6LA 1S5CD 4RZRA 3G6EA 2C00A 2DIKA 1SYGA 3ERSX 2NZHA 3OIQA 3M85A 3T5HA 4X3UA 2NVXA 3A5ZB 1HUMA 2ASJA 4B9WA 2P0AA 1D5MC 3GTLA 1HQMC 5T14A 4ED6A 3VPBA 1E7ZA 3PIP3 4RUAA 3T1HH 1CA5A 1SYDA 4HMIA 2EY5A 4DV1L 1STEA 1DIKA 1C9OA 4DN4M 5FKAC 4P71A 4DR7Q 4BWSC 4N9PA 1OXUA 4Y7NB 5C3EB 3E0EA 1JCKB 3KF6B 4UCRA 4BWGB 3GTLB 4UCOA 1RIPA 1YIJA 4AYBA 2CWAA 3NWSA 3GV5B 3CC7A 3RNUA 2WAQE 1BBUA 5KFZA 5KFWA 1TA8A 5DQGA 2FPPB 5EDWA 1VQIA 1B2TA 1DXMA 2I8CA 4G7HC 4LSAA 3EPGA 1EL0A 1KJJA 1L0XB 1XPUA 4RAZA 2B2UA 2F0KA 3PR5B 4J15A 1OXTA 1F2LA 3PUWA 1TS5A 4Y52H 2IMWP 4IUUA 2HVRA 1KABA 1I6UA 1KDCA 4DR2Q 1CQVA 3G71A 3VA7A 1PH1A 1PXUA 2RDFA 3D3RA 1J5EL 1JKJB 4ED8A 2JE6I 1RD9D 2ZDHA 1V43A 1E24A 2F0FA 2IPKD 2YTYA 4JI8H 4K0KL 3QZ7A 3KBXA 2R7ZA 1KRSA 1L0YB 5EKLA 4C56C 3HOWH 3HOUG 2AGOA 4DNIA 4QY7A 5CV8A 3K59A 5E1FA 1U4PA 3V4ZA 2N49A 2FKLA 4QB4A 1STGA 4UCVA 1FYCA 3LWBA 5CC4A 3Q24A 3R5XA 4IFDG 5ELFA 3T16A 2W57A 1Y8PB 3D6CA 5D3DA 4GLXA 3M3YB 1SEIA 3R93A 4I55F 2UUBL 2V5AA 3G6YA 4EGVA 3K80C 1YHBA 3CQZB 1EZ1A 5KG4A 4IAJA 3Q8DA 4A93G 3EFXD 5EOYA 5C0XI 5DM73 3TIIA 1H9JA 2NVTB 5A2QE 3UE0A 2G9HD 2V4QA 5JJZA 3CP0A 4PG3A 4AYBG 3CHBD 2KCCA 5KFHA 3BYTB 4JPBW 1W3SA 2JA9A 4AH6A 2FE3A 5M3MH 2UUCQ 1A3UA 2VL6A 1U4LA 1Y14B 4IPHA 4YCVA 4LF8L 1JJGA 1HR0L 1NUCA 2E5LL 3Q2OA 1I4HA 4A3IB 3NBHA 1C8CA 1WCMA 3LWUA 4H0LC 5KFJA 1S9FA 1IW7C 1CUKA 3HGBA 1CI3M 3VR5A 1VQJA 4IUQA 1N32H 3F2CA 1Q90A 4JYAQ 1VQ7A 4TQUS 3RZOH 4YHHL 3HOWG 4O3NA 3GQCA 5JAVA 1RYRA 2RVLA 4GC7A 4DR7H 5A2QL 3MXNA 4Q5VA 2EYMA 4DNRB 2F0LA 2YZGA 1RF2D 5BN3A 1A15A 1ASYA 1TWGA 2X6GA 3JAMW 2ZM6Q 3S15B 3J81W 3LX0A 4MV4A 1LM0A 2K6AA 4DL7A 2PNHA 4XIGS 1DV1A 5EQ0A 3H3VC 1AP0A 5JVLA 1B6SA 1CZGA 1K3BC 4KMUC 5H80A 1EIHA 2OF1A 2Z9HA 4DV7Q 1JWSD 5J2TF 3C46A 2ZJPA 3K7AB 3EBEA 3IFTA 2QA4A 3J81i 2I46A 3G7LA 2UXDQ 2DJGC 2GVBA 3OWFA 1GUGA 2HT1A 3PIO3 2HJWA 5HY6A 1E4GT 5L9XA 4M8AA 5E7NA 1GYFA 1P16A 2AHOB 1XX8A 3MR5A 1EWIA 3T5KA 1SE8A 1MBYA 3UQ8A 4ZCKA 3HFZB 4EYIB 2UVRA 4Q44A 4UPAA 1DJRD 2DZDA 4ECVA 1F2ZA 1GO3E 4X64L 1IYUA 1I3QB 2VA2A 5FJ8H 4QW9A 5L1IA 4DUZH 1VBHA 5DLGA 2SCUB 4E6IA 1TR5A 3TZDA 3E0JA 3A8IE 3F8NA 3D0FA 1ESRA 1BO0A 1WJJA 2VUMG 3EIVA 1I4PA 1NJIC 3SR1A 5L37A 3S1QH 1V1PB 2CH4W 1EUCB 4DV2Q 4R8UA 1KJIA 2HVSA 1E3PA 4C3IB 2E2IB 3RR5A 3D4DA 4ID6A 1A3VA 2F0IA 4LFBL 2JA8H 4FNFA 2WDTA 2CWPA 1I94L 1UC9A 2X0SA 5BN5A 1CZWA 2O5JC 1PTOD 4HYKA 5M3FH 4JCVE 1ZYRD 3M4IA 2A68D 4X62H 3NQIA 2TSSA 4LW1A 2R7LA 3VPDA 2BQ3A 2WAQA 1WTXA 3MJFA 5KFLA 1XPOA 3NEMA 2F3IA 1PYBA 4UP9A 1HNZQ 4GNXA 3HS0C 2QDLA 5KT7A 4TQSA 2NVYB 4GZYC 4LFAQ 1I50A 4LH6A 2ATLA 4JW0A 1QNKA 4A3MG 4M7EA 4IPDA 4TVAB 4TV8F 5M9OA 2N3SA 3MR3A 4P75A 4LMYA 3VR6A 2K5QA 4C3HH 2XCLA 4IPGA 1WTWA 3R5FA 2NN6G 4R4QA 4CJ0B 2UUCH 4NP5A 5FO7B 2R3ZA 2UUCL 2JP1A 1PTOF 3BJUA 5C1PA 4HAEA 1II3A 2B63A 5J3BA 1HR0Q 1L2ZA 2AQ4A 3K5OA 5KFUA 2MCTA 1BKBA 3FMAA 4JI4Q 2JEAI 3GTQH 1BVSA 4TRDA 2DGYA 1JJ2A 4O2BF 1U0LA 2ASDA 3UE1A 1R4QB 2A74C 2B63H 2W7OA 4QQBX 2UXBH 1PFMA 4K14A 3LGJA 4LF9Q 4A3JH 1RJPA 2E76C 3L4JA 2B2YC 1FVIA 5ELOA 3KAJA 5C5JA 3WO0A 1EYAA 3GV6A 4FXKC 3Q8SB 4YHHH 1YNJD 2K50A 3DHQA 2O03A 3FKIH 4MV1A 1AZQA 5IYDG 4YJ2F 1W6KA 3PW5A 4RCOA 4X65L 1PVOA 1T5XD 2Z1CA 5I9PA 2CQYA 4A93H 4S3SA 4GKKQ 4IRCA 5C44H 1EQQA 3N43B 2L5TA 3CCLA 1B7YB 2ICEC 2E2JB 5KNBA 4A3GH 1DYQA 4QW8A 2VOBA 3RBDA 1FJGQ 3L2PA 4RAUC 2I07B 5IGCA 1PH3A 2I80A 1Y1WH 4XYQA 3FEWX 3N6XA 4NB3A 3HOXG 3CQZA 4FF2A 1VKZA 2W8KA 1STYA 1HTLD 2VQEQ 5FLXE 3VR2A 3VA5A 1D1IA 2R7MA 4GLAC 3PW2A 1LT4D 4DA2A 1N34H 4DR6H 2VS1A 2UXCH 1VF7A 4TSSA 3VDYA 2EQSA 2Y0SA 4O3PA 4DXGA 2J4XA 3CRKC 1L0WA 2R6FA 4LF5H 2B2WA 4DV6L 1GUTA 1JOQA 4DR4L 2O2LD 2Z8LA 5ELEA 5BMVF 4DFAA 2KECA 4BA2I 2UUAH 5IP7H 3S2DB 3GIPA 1O7LA 1X55A 3OSOA 4A3DH 4RUCA 3RB6A 2NTTA 3O13A 4IN3A 1NSNS 5DNFA 4LFCQ 3A7AB 4KY7A 4A3KG 1STNA 3GTOH 2KCTA 3GO5A 1QILA 5EZYF 3NTIA 4K6LA 4GKJQ 4F50A 4DLKA 4QWBA 3GV3A 4IUVA 3SHLA 1IBMQ 1Y1VA 1WCMG 2XTIA 3U50C 5JEAH 4HNTA 4J9LA 4EBDA 4AQYQ 4ALPA 2Q8IB 3CVZA 3KF8B 5IGBA 4CDEC 4JI2L 3TP5A 3AB9A 1IW7D 1V1QA 2KCMA 4ZKCB 3EJIA 1T3NA 2IHEA 3GTOB 3IG0A 2D62A 4QF4A 1M0TA 3F1ZA 3OPOA 2XWJB 4DR1H 1SFOA 1VQHA 3QFFA 3GIKA 2C5CA 4M1UB 3JAML 2JEBI 1SRUA 2K52A 1K8GA 4A3FB 3RV3A 1MIUA 3JSNA 2PYKA 2BE5D 2RSNA 3FKIG 1B33N 4I7HA 1CFMA 2VNUD 3GTGA 2CFMA 5D1OA 1AE2A 5I47A 3A55A 1VQAA 5LL6S 3SK5A 3K81C 3MTSA 4JI3L 3ULPA 5IP7G 4EQNA 3S16B 2KEDA 1TWAH 4A76A 1UNSA 3I4NG 1F9PA 3NPPA 2DUDA 4L5SA 4F4ZA 3AMUA 2FLPA 1BQQT 4K2KA 2H1EA 3J7ZC 4LF6Q 2UU9Q 4DR6Q 1RK6A 1CK1A 1X56A 4YB8B 4Q43A 4O4IF 3N52A 4MN3A 1CM9A 2B8FA 4R1JA 2KSWA 5KG0A 1KJQA 2XIGA 3RUPA 2W8LA 3T5LA 5M5YB 3I4MH 3X3MA 4ECSA 1ZHSA 1STBA 1VQLA 1Z2NX 4JI8L 2JA7A 1IL8A 2K5WA 3Q6SA 1IBKQ 2VQFH 2NN6I 5LMUQ 2ZJTA 4IFDH 2Q2HA 4FVMA 2VY3A 3LMLA 4FO2A 1EYDA 3MWEA 2N78A 5KFAA 4HNUA 2EPBA 4QGUA 4RU9A 4ULLA 3M9NB 1O7ZA 3EYYA 3ITPA 3N40P 4ZQ3A 1GKHA 3J80L 2QCPX 3ULJA 3S1QB 4ECWA 3CCEA 2WFWA 1ILPA 4ECXA 2A1AA 5LYJF 4HJ7A 2IX3A 3T1YH 4JOIA 2H5XA 3T13A 4EQ5A 3I55A 4QIWE 4I7ZC 5DGBA 1Z7TA 1SROA 5D1PA 1EYGA 3I4NH 4CDFC 4I4TF 2F52A 4X3TA 3S2HB 4XYLB 2YCHA 1EEFD 4K2LA 1UE6A 3GQBA 1OTCA 4Q8EA 3CD6A 1K8AC 2XC9A 4DK3C 4XX0B 3MC0B 5KFXA 2EYLA 5LMNH 1KNEA 2FMMA 3PO3G 1EZ6A 2NZOA 2BDOA 4HIMA 4MIUA 4DR3Q 2W6PA 5CA0F 4DV4H 3F8TA 4LFCH 2E5LQ 3OTOQ 3OMCA 2BA0A 3BZCA 1N33L 1H95A 4OELB 3H09A 2EY6A 3PUXA 2E2HB 4XYMB 1ZHQA 2V59A 1TXYA 2R8HA 4LF7Q 3MFIA 2B29A 1B6RA 4YAKB 1FGUA 4IFDI 4GKJH 4YWMA 4X66Q 2M00A 5BR8H 4JI0Q 1Q8KA 1EQTA 3H0GH 2EYHA 3K6OA 4DAMA 2YU9A 4JBMA 2NVQB 3J80i 3GV8B 4POFA 4Q0YA 2PW5A 1IBLH 3F2DA 2WB1G 1GXDC 2UXDL 1MSGA 2RSOA 3D4WA 4A3IG 1QB5D 4DUZQ 4NDXA 4ME3A 1JMCA 3IN5A 5G3LD 5C44G 1VQNA 1X32A 4LUZA 2NZ1D 3UFXB 4DV3Q 4E4TA 4X64Q 4CDDC 5I4DA 1DOKA 2QYZA 1QVFA 2FPIB 1UE7A 4RNNA 2EIFA 5KFNA 3K5HA 4RAYA 3GTJA 2L0CA 5DG9A 3QG1A 2R86A 3L4KA 2MNAA 3NHHA 1TY0A 2CHBD 2YYAA 4JV5H 3DXJC 4J9RA 2NU8B 5KFDA 4C1NI 3OUUA 3KJOA 5CYUA 1F9SA 2OTJA 2AQ1B 5IODA 1BCPC 3RN2A 4KJOA 1B50A 2BOSA 3FPPA 2Y0SG 3I7FA 2V58A 3S9WA 4LF4Q 1BBWA 3J81E 5DQIA 4RB3C 4X3SA 3WOEA 1ONLA 4A3LG 4MNOA 4LFBQ 4EFEA 4QWCA 2MUYA 5KFTA 5IY0A 1LTGD 3V6KA 4ZI7F 1HXYD 1WR2A 1H9SA 4QL5A 5DEHA 1UE5A 5KFSA 1HNWH 2PMZB 4KHPH 3RZDH 3MEHA 2YZMA 3BAAA 3U9SA 1F9RA 3M4QA 2F0SA 4PMBA 3K5IA 3KYHC 4MV7A 3UI2A 1SMXA 1HNZL 3KJPA 4WBNF 3VYSA 1N8RC 3DWPA 1NMFA 3V96A 2HQEA 5FPRA 4KHVA 5GROA 1ASZA 3L9AX 3Q1KA 4J9MA 1DD2A 1RDPD 4A3MB 4CDCC 3CF5A 1MKHA 3NGDA 2YTXA 4IR9A 3S1MH 1XWEA 3DUZA 1I7LA 4ZOLF 4GN4B 5LMNW 3GTMA 5C0XH 1PTOC 3FRPB 1ZETA 2NBFA 1XMQL 4ABNA 4DR5Q 2YS6A 3W5OA 3K0XA 5CBEE 3TP8A 1GOZA 4WRDA 1TWCB 2Y0SB 4U68A 3SE0A 2EVBA 4OWWB 4P73A 5KT6A 4ZLTF 4C2MA 2R93H 2W9BA 2JA7G 3I12A 1AH9A 1EHIA 1HNXQ 3CU7A 5C44B 3GTJH 2L4NA 4CKCA 5KT2A 1ILQA 5KFQA 1PYWD 1M1KC 5KFIA 4QIWA 2VZAA 3A56A 3HKSA 4WFN3 1EUDB 2FJZA 4BBSB 4YY3L 2LKVA 4NW2A 1QUQA 4XYOA 4HQ6A 3J7A5 1SR3A 2K04A 1C48A 2I87A 4YR2A 2R84A 4B3SH 4X66L 3JZIA 1E1OA 3GTJB 4JI4H 3AU7A 1S5BD 4IZ8A 1M7JA 2OT2A 3PW4A 1FNVA 1O7IA 4JYAH 1LTRD 5CV4A 1N36Q 5LP6F 4GKKL 5KYLA 2WB1B 1I50H 4IUNA 4KHPQ 4ED7A 1EQRA 1U4MA 1SAPA 4ZRZA 5EKKA 4B3TQ 5C4HA 2QEJC 3SI8A 4C3HB 4LFBH 4DKAC 5KFKA 2XGTA 4L1KA 1PRTC 1TWFH 3F2BA 4MTDA 5JVH3 4DL5A 1SYBA 2RCFA 2W6NA 2LXJA 5M5YH 3BVZA 4OO1G 2VQEL 1JJCB 2W9CB 2FLLA 4BS9A 3F2UA 1HNZH 4RA8A 3OIPA 1S3OA 3IL8A 1I6HH 1JDEA 1N9WA 3KTMA 3T51B 2KUMA 1Y1VH 4OHJA 4LAAA 2CW7A 1Q3LA 5LOVF 1IL2A 1HTPA 4UCTA 5IT9L 3BQ0A 1C7YA 3OYYA 3LP8A 1PH2A 1SNQA 4Y7NH 3SE7A 1VQFA 4X64H 3J80E 2GLTA 2VUMA 5AJ3L 1K8MA 4A3EB 1B53A 4RB1A 1A2TA 2Q2UA 5LL6b 2HDLA 2ZTDA 5FLXL 2EY2A 3MWMA 1S0OA 1M8AA 1CKMA 1A8VA 3HEJA 4DU9A 5LXTF 5EPKA 2B2UC 4RNOA 1AUXA 3CCJA 2SNMA 2MHVA 1C30A 5M5XH 1W2BA 3WDNA 2R7DA 3AFPA 3Q22A 4GNXB 1XPRA 1KJ8A 4CC6A 5CMDA 4JG2A 4PZ6A 2F3VA 3RLNA 2RDHA 2WACA 1M6VA 3N6RA 1SLJA 3NBHB 4DR2H
chains in the Genus database with same CATH topology
1B70B 1HZBA 3CCRA 4AQYL 1XPOA 1OXVA 2F3IA 1PYBA 3NEMA 4UP9A 1HNZQ 3J81j 3CCUA 4GNXA 3M9BA 3TS2A 1KQSA 4YCWA 4JI7Q 3OW2A 5GAEC 1JE5A 3MXNB 3B6YA 4LFAQ 3PIOA 4DV0L 4A3MG 4IPDA 4TVAB 4A75A 4LUOA 2N3SA 1YVCA 3I2ZA 4P75A 4JI1Q 4BA1I 4B3RQ 1PHJA 4C3HH 1JT8A 4IPGA 2NN6G 4R4QA 1XMOQ 2V1CC 2ES2A 1XMQQ 3RLFA 2UUCL 1QVGA 5H1SE 3BJUA 3AQQA 3STBD 4LF8Q 1PH6A 2PMZE 5J3BA 1HR0Q 4OX9Q 1K3RA 1X3EA 3IRBA 1E1TA 1G51A 2C35B 3M3YH 1QZGA 2R7FA 3T1HL 1BKBA 1WI5A 1HNXL 1G6PA 4JI4Q 2JEAI 3GTQH 1BVSA 2DGYA 1JJ2A 1U0LA 3UE1A 2B63H 4JYAL 4H02A 5M5WH 4QQBX 1KIXA 2UU9L 3A74A 2HHHQ 2MO1A 4GS3A 3HOXH 2R93G 1YHQA 4DR6L 1QUQB 3LGJA 4LF9Q 4A3JH 3GTPH 4BBSG 4C2MH 5BR8Q 2K75A 1Q82C 1VQOA 2ZM6L 1V9PA 1AE3A 5M3MG 4BXXH 4A3CG 1FVIA 5ELOA 5ELNA 2E2JH 1QZHA 1KHIA 1WFQA 2NVQH 2ALYB 2K50A 1XJVA 2VW9A 3FKIH 4DV4L 5IYDG 4A3LH 4MZ9A 1YITA 4APVA 4X65L 1PVOA 5C0XG 2JJQA 5JJLA 1N36L 4A93H 4JI8Q 1VQCA 4GKKQ 1A63A 5C44H 1EQQA 1KL9A 3CCLA 4NXNL 2VQFQ 1B7YB 5IYBH 4B3MQ 4MTNA 3PUZA 4A3GH 5LMNQ 1LUZA 1X54A 4GLVB 1FJGQ 3L2PA 3CMAA 4YWLA 1VQPA 2OWOA 1PH3A 1X3FA 3J80c 1Y1WH 1XNQQ 4NB3A 3HOXG 2I5HA 3U4VA 2D0OA 1YNXA 3JAMi 4IOCA 3S15H 2VQEQ 2ZTCA 3KF6A 2R92G 2UUAQ 3KDFA 1NE3A 1K0RA 2PQAB 4GLAC 2BH2A 4JI5Q 2VUMH 4HIOA 3TRZA 3H3VI 2VS1A 1VQ4A 4HJAA 2UXBL 4HJ5A 3H15A 3VDYA 2EQSA 2ZTEA 5IT9c 5GAHC 5M3FG 1L0WA 2A8VA 4OO1I 4A3IH 4NPSA 4R4TA 3BU2A 4DV6L 4A3EH 4A3BG 1LYLA 4DV2L 2FXQA 4DR4L 4PZ7A 4BA2I 3FP9A 1CKOA 5IP7H 1X55A 2Y0SE 4R4CA 2BA1A 1IBLQ 4A3DH 2WP8J 1YEZA 1I94Q 3PGZA 1HNWL 4DR3L 1I5FA 2PI2E 3L0OA 1MJEA 4LFCQ 4A3KG 4O0AA 2GN5A 4OONA 2EXDA 3GTOH 2KCTA 2YYZA 2L15A 3GO5A 4JOIC 1PH8A 3GTGH 4A3KH 4JV5Q 4B3SL 2ID0A 4GKJQ 2OQKA 1EIFA 3M4PA 4BBRG 4DV5L 3STBC 3EN2A 1IBMQ 1WCMG 2XTIA 3U50C 3HOVG 2HIXA 4YCUA 1T9HA 4AQYQ 1B8AA 3KOJA 4ALPA 4LF7L 2K5VA 3NELA 3KF8B 4GOPB 4JI2L 1GD7A 5FJ8G 2I0QA 3CW2C 2IX1A 1VCIA 1TWCH 1V1QA 2KCMA 2RCNA 2PI2A 3CCMA 3ER0A 4UP8A 4JI7L 2IHEA 4R4OA 4LFAL 2D62A 1K9MC 3KDFB 2WAQG 3F1ZA 4A3BH 4P72A 4B3RL 1VQHA 4JI1L 3RLOA 2JA8G 3K8AA 4WJ3M 1N34Q 2UXCQ 3S24A 4BY1G 2JA5G 2I5MX 2JEBI 1SRUA 2K52A 1K8GA 3WWVA 1MIUA 3G4SA 2YU9H 1VQBA 1DGSA 3AYHB 4DR7L 3FKIG 2RHQB 4DUZL 1VQGA 1NY4A 4A4IA 4PZ8A 1XTDA 3PV0A 2GVAA 3PSIA 2CFMA 4YWKA 1AE2A 1Y1WG 1JB7A 2VNUD 4A3JG 2E2IH 1VQAA 2Q2IA 2D0PA 2LSSA 3T1HQ 4C3IH 3K81C 4JI3L 4A3FG 2OTLA 1XNRL 3ULPA 3PUVA 5IP7G 1PH5A 4JI4L 2AWNA 3S16H 1GVPA 1TWAH 3RN5A 4A76A 1YJWA 2ATWA 3I4NG 1KAWA 1Z47A 2DUDA 4L5SA 1NBWA 4DUYQ 1I3QH 3J7ZC 3S1RH 3GD7A 3NENA 2UU9Q 5IYBG 2HHHL 3CCQA 4LF6Q 2JA6H 4DR6Q 3E9IA 1LTLA 4PMWA 1CSQA 1X56A 4GN3B 4LF9L 2BH8A 5BR8L 1X6OA 1PFSA 3TS0A 3GTMH 4R1JA 4HJ9A 4OWXB 3A0JA 1HZAA 4O2DA 2R92H 5JJKA 4DR2L 3M7NA 3I4MH 1VQEA 4P74A 4DV4Q 1NMGA 1CKNB 3K7AH 4X65Q 4LF4L 2NVTH 1VQLA 1PH4A 4K0KQ 1A0IA 4JI8L 2IY5B 4UP7A 1NTGA 3ULLA 3DLLA 4A3GG 4DK6C 1IBKQ 3AFQA 1YBYA 4NXNQ 1VQ6A 3MEFA 2NN6I 5LMUQ 3GTLH 4KHZA 2Q2HA 1X3GA 2VY3A 3UDXA 5LMNL 2N78A 3PF5A 1FJGL 2QGQA 4QGUA 1Q81C 2CCZA 4UY8C 1GKHA 3W1BA 3I4OA 3ULJA 4IFDJ 1C0AA 3CCEA 2Z0SA 1X9NA 4LF5Q 2UUBQ 2WFWA 3CPFA 1QVCA 3BZKA 1K73C 2A1AA 4L5QA 3T1YQ 4GOPA 3TREA 4HJ7A 4DR1Q 1A62A 4JOIA 2H5XA 4EQ5A 1HR0W 3I55A 4QIWE 2PQAA 3HKZG 1SROA 4L5TA 3CCVA 1D8LA 4A3FH 1EYGA 3I4NH 1KC8C 4BBSH 3CPWA 2F52A 2IHFA 3ICEA 1KRTA 2UXBQ 1KXLA 1Q12A 1J6QA 2KBNA 5GADC 4KI0A 3SGIA 2AMCB 1UE6A 1OTCA 4DV6Q 2OQ0A 5FLMH 4DR4Q 3HOUH 5C4XG 4DR5L 3CD6A 3J81c 5C4JH 5IP9H 1K8AC 4LWCA 1HJPA 1UEBA 4GN5A 1CKNA 4DK3C 2MFIA 1EIYB 2JQOA 1IBLL 2MQHA 4IOAA 2AKWB 3PO3G 4BY1H 1TWGH 2NZOA 4OXPA 4HIMA 4DR3Q 2JA6G 1PV4A 3AEVA 1HZ9A 3F8TA 2E5LQ 4LFCL 1R9TH 3OTOQ 1YI2A 3UDIA 3S14H 2BA0A 2KHIA 3BZCA 1N33L 4AIMA 4X62Q 1H95A 2I5LX 5IYCH 4JBKA 1VQ9A 4JV5L 3PCOB 3PUXA 4DV5Q 1IBML 4YHHQ 4BY7H 5GQOA 1TXYA 4YY3Q 3G6EA 2F4VL 4LF7Q 1OXSC 4A3MH 3ERSX 2NZHA 1IXRA 4JI2Q 4GNXC 3M85A 2B29A 5C3EH 1FGUA 4IFDI 3A5ZB 3PUYA 2R6GA 4YWMA 3TQYA 5IP9G 4X66Q 1PA6A 4JI6L 4JI0Q 4HIKA 1L1OB 1Q8KA 2K14A 1E7ZA 3H0GH 4DAMA 4JBMA 1EUJA 3UDFA 4DV7L 4DV1L 3J80i 1N32L 2HIVA 4POFA 1C9OA 1Z9FA 1N34L 4IJHA 3F2DA 4POGA 2UXCL 2WB1G 3JAMc 4A3DG 4X6AH 3CC4A 2UXDL 2QEXA 4P71A 4KHPL 4A3IG 1HH2P 4DAYB 4DR7Q 2K5HA 1X65A 2MO0A 1OXUA 4ME3A 4DUZQ 3E0EA 4B3TL 1L2FA 1JMCA 3KF6B 2R7ZG 5C44G 1VQNA 1Q1EA 2HQLA 1RIPA 3KLWA 1YIJA 4JI3Q 1XNRQ 3JC66 4LUZA 3FHWA 1D7QA 2CWAA 5JEAG 3HOVH 3CC7A 4HJ8A 4DV3Q 2WAQE 3RNUA 5JEAJ 4X64Q 1BBUA 5C3EG 5EAYA 2NVXH 4DUYL 1QVFA 3I56A 1UE7A 4LF6L 1TWHH 1VQIA 2EIFA 5C4XH 1VQMA 3DM3A 1XPUA 2LXKA 2MNAA 1IYJB 4J15A 1OXTA 2ZJQA 3PUWA 3HOZH 4Y52H 5IYCG 3KJOA 2CKZB 2OTJA 2N8NA 4DR2Q 1PH1A 3G71A 1J5EL 1YHAA 3RN2A 2IT1A 2JE6I 5AJ3Q 2Y0SG 1V43A 1E24A 2NVYH 3I7FA 4NXML 4WJ4A 3D31A 2YTYA 4LF4Q 1BBWA 1S40A 4K0KL 5HGQA 2RHSB 5IWAL 1SFOH 1KRSA 1MJCA 4MNOA 4A3LG 4LFBQ 3HOWH 5IY0A 3HOUG 4IPCA 1IBKL 4QL5A 5GAGC 1OXXK 1UE5A 4DNIA 5LMUL 1SN8A 5IYDH 4QY7A 2YV5A 3RZDH 3CMEA 2N49A 1WYDA 5FLMG 2A19A 5K36G 3M4QA 3L7ZC 4IFDG 1Q1BA 4A3CH 3UDGA 4GLXA 2K5NA 3KYHC 1EFWA 4LF5L 2UUBL 1SMXA 1HNZL 3KJPA 3T1YL 2JA7H 1N8RC 3K80C 1YHBA 3E9HA 4DPGA 1NMFA 4DR1L 3Q8DA 5GROA 1ASZA 2YTVA 2B63G 4RG1A 2Q2TA 4A93G 5DLQE 1MKHA 2Z6KC 2K4KA 3CF5A 2YTXA 3I4MG 5C0XI 4DV0Q 3W1GA 2JA5H 3S1MH 4GN4B 3UE0A 5LMNW 3S17H 3CP0A 4PG3A 4AYBG 1XMOL 3S1NH 1W3SA 2JA9A 4RMFA 4AH6A 1YJNA 3PIPA 4DR5Q 1XMQL 3W5OA 5M3MH 2UUCQ 3K0XA 4L5RC 5C0XJ 1L1OC 3KFUA 2VL6A 1Y14B 4IPHA 4YCVA 3A5UA 1U5KA 4LF8L 1JJGA 1HR0L 4P73A 1VQKA 4OX9L 4OWWB 3GTKH 2R93H 2JA7G 1AH9A 2E5LL 2KENA 3OTOL 2JK8A 1WCMH 1E22A 1VS0A 1HNXQ 3HKZE 4BBRH 4R4IA 3GTJH 4X62L 1N33Q 3PF4A 1GM5A 2AWOA 1CUKA 1Q46A 1VQJA 3TEHB 3S2DH 3K7UC 3F2CA 3CQZH 4JYAQ 1M1KC 1VQ7A 4TQUS 3RZOH 4YHHL 3HOWG 2VZAA 3S2HH 3HKSA 3GDEA 4FDBA 4AYBE 4YY3L 2F4VQ 2KHJA 4JBJA 1IZ6A 1QUQA 4JC0A 1SR3A 1ASYA 3J7A5 2ZM6Q 4JBWA 1KD1C 4X66L 2E8GA 4JI6Q 1LM0A 1E1OA 4JI0L 2PNHA 4XIGS 4OWTB 4A3EG 1FL0A 2E2HH 1O7IA 4XTCS 4DV7Q 4DV1Q 1K83H 3HOYH 3HOZG 3PO2G 1N32Q 2ZJPA 3EBEA 2QA4A 1Q7YC 1N36Q 3J81i 2UXDQ 4GKKL 2GVBA 3G48A 3H0GG 1I50H 4KHPQ 2HT1A 1EQRA 5HY6A 3U4ZA 1PYSB 4IO9A 3CC2A 5E7NA 3CCSA 1P16A 2VQFL 2AHOB 2ZJRA 1YZ6A 3ZJYC 4GOPC 1EWIA 4B3ML 4B3TQ 2ASBA 4KLKA 1SE8A 4DKAC 1P8LA 4LNQA 3HFZB 2XGTA 4BY7G 3F2BA 1TWFH 4UPAA 1UWVA 2B3GA 1XNQL 2LXJA 4DV3L 1GO3E 5M5YH 4X64L 5FJ8H 1PH9A 1M90C 4OO1G 2VQEL 1JJCB 2R7ZH 4C3JH 3M4OH 3CXCA 1VQDA 2OCEA 2UUAL 1S3OA 2WB1E 1I6HH 5JJIA 1N9WA 1CSPA 4JI5L 1UE1A 3H3VH 1Y1VH 1IL2A 1HZCA 2Z6KA 3CAMA 3D0FA 2IX0A 5FLXc 1C7YA 1WJJA 2VUMG 3EIVA 3OYYA 1S72A 1NJIC 3PO3H 1PH2A 4IJLA 1J5EQ 3S1QH 4Y7NH 1VQFA 1WOCA 1EOVA 4DV2Q 5AJ3L 1E3PA 4NXMQ 4LUVA 1VQ8A 3RR5A 2Q2UA 4BXXG 2ZTDA 1Y1VG 5IWAQ 4LFBL 2JA8H 1A8VA 1CKMA 2CWPA 1RL2A 1YJ9A 1I94L 1VQ5A 1HNWQ 4HIDA 3CCJA 1L1OA 1PH7A 3HOYG 3PO2H 5IE8A 5M3FH 5M5XH 1W2BA 2R7DA 3AFPA 4JCVE 4GNXB 1XPRA 2RF4A 4JG2A 4QJFA 4PZ6A 3RLNA 1Q86C 3U58A 4B3SQ 4GKJL 1G291 4LW1A 2CQOA 1SLJA 4EX5A 3NBHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B70 B;  1HZB A;  3CCR A;  4AQY L;  1XPO A;  1OXV A;  2F3I A;  1PYB A;  3NEM A;  4UP9 A;  1HNZ Q;  3J81 j;  3CCU A;  4GNX A;  3M9B A;  3TS2 A;  1KQS A;  4YCW A;  4JI7 Q;  3OW2 A;  5GAE C;  1JE5 A;  3MXN B;  3B6Y A;  4LFA Q;  3PIO A;  4DV0 L;  4A3M G;  4IPD A;  4TVA B;  4A75 A;  4LUO A;  2N3S A;  1YVC A;  3I2Z A;  4P75 A;  4JI1 Q;  4BA1 I;  4B3R Q;  1PHJ A;  4C3H H;  1JT8 A;  4IPG A;  2NN6 G;  4R4Q A;  1XMO Q;  2V1C C;  2ES2 A;  1XMQ Q;  3RLF A;  2UUC L;  1QVG A;  5H1S E;  3BJU A;  3AQQ A;  3STB D;  4LF8 Q;  1PH6 A;  2PMZ E;  5J3B A;  1HR0 Q;  4OX9 Q;  1K3R A;  1X3E A;  3IRB A;  1E1T A;  1G51 A;  2C35 B;  3M3Y H;  1QZG A;  2R7F A;  3T1H L;  1BKB A;  1WI5 A;  1HNX L;  1G6P A;  4JI4 Q;  2JEA I;  3GTQ H;  1BVS A;  2DGY A;  1JJ2 A;  1U0L A;  3UE1 A;  2B63 H;  4JYA L;  4H02 A;  5M5W H;  4QQB X;  1KIX A;  2UU9 L;  3A74 A;  2HHH Q;  2MO1 A;  4GS3 A;  3HOX H;  2R93 G;  1YHQ A;  4DR6 L;  1QUQ B;  3LGJ A;  4LF9 Q;  4A3J H;  3GTP H;  4BBS G;  4C2M H;  5BR8 Q;  2K75 A;  1Q82 C;  1VQO A;  2ZM6 L;  1V9P A;  1AE3 A;  5M3M G;  4BXX H;  4A3C G;  1FVI A;  5ELO A;  5ELN A;  2E2J H;  1QZH A;  1KHI A;  1WFQ A;  2NVQ H;  2ALY B;  2K50 A;  1XJV A;  2VW9 A;  3FKI H;  4DV4 L;  5IYD G;  4A3L H;  4MZ9 A;  1YIT A;  4APV A;  4X65 L;  1PVO A;  5C0X G;  2JJQ A;  5JJL A;  1N36 L;  4A93 H;  4JI8 Q;  1VQC A;  4GKK Q;  1A63 A;  5C44 H;  1EQQ A;  1KL9 A;  3CCL A;  4NXN L;  2VQF Q;  1B7Y B;  5IYB H;  4B3M Q;  4MTN A;  3PUZ A;  4A3G H;  5LMN Q;  1LUZ A;  1X54 A;  4GLV B;  1FJG Q;  3L2P A;  3CMA A;  4YWL A;  1VQP A;  2OWO A;  1PH3 A;  1X3F A;  3J80 c;  1Y1W H;  1XNQ Q;  4NB3 A;  3HOX G;  2I5H A;  3U4V A;  2D0O A;  1YNX A;  3JAM i;  4IOC A;  3S15 H;  2VQE Q;  2ZTC A;  3KF6 A;  2R92 G;  2UUA Q;  3KDF A;  1NE3 A;  1K0R A;  2PQA B;  4GLA C;  2BH2 A;  4JI5 Q;  2VUM H;  4HIO A;  3TRZ A;  3H3V I;  2VS1 A;  1VQ4 A;  4HJA A;  2UXB L;  4HJ5 A;  3H15 A;  3VDY A;  2EQS A;  2ZTE A;  5IT9 c;  5GAH C;  5M3F G;  1L0W A;  2A8V A;  4OO1 I;  4A3I H;  4NPS A;  4R4T A;  3BU2 A;  4DV6 L;  4A3E H;  4A3B G;  1LYL A;  4DV2 L;  2FXQ A;  4DR4 L;  4PZ7 A;  4BA2 I;  3FP9 A;  1CKO A;  5IP7 H;  1X55 A;  2Y0S E;  4R4C A;  2BA1 A;  1IBL Q;  4A3D H;  2WP8 J;  1YEZ A;  1I94 Q;  3PGZ A;  1HNW L;  4DR3 L;  1I5F A;  2PI2 E;  3L0O A;  1MJE A;  4LFC Q;  4A3K G;  4O0A A;  2GN5 A;  4OON A;  2EXD A;  3GTO H;  2KCT A;  2YYZ A;  2L15 A;  3GO5 A;  4JOI C;  1PH8 A;  3GTG H;  4A3K H;  4JV5 Q;  4B3S L;  2ID0 A;  4GKJ Q;  2OQK A;  1EIF A;  3M4P A;  4BBR G;  4DV5 L;  3STB C;  3EN2 A;  1IBM Q;  1WCM G;  2XTI A;  3U50 C;  3HOV G;  2HIX A;  4YCU A;  1T9H A;  4AQY Q;  1B8A A;  3KOJ A;  4ALP A;  4LF7 L;  2K5V A;  3NEL A;  3KF8 B;  4GOP B;  4JI2 L;  1GD7 A;  5FJ8 G;  2I0Q A;  3CW2 C;  2IX1 A;  1VCI A;  1TWC H;  1V1Q A;  2KCM A;  2RCN A;  2PI2 A;  3CCM A;  3ER0 A;  4UP8 A;  4JI7 L;  2IHE A;  4R4O A;  4LFA L;  2D62 A;  1K9M C;  3KDF B;  2WAQ G;  3F1Z A;  4A3B H;  4P72 A;  4B3R L;  1VQH A;  4JI1 L;  3RLO A;  2JA8 G;  3K8A A;  4WJ3 M;  1N34 Q;  2UXC Q;  3S24 A;  4BY1 G;  2JA5 G;  2I5M X;  2JEB I;  1SRU A;  2K52 A;  1K8G A;  3WWV A;  1MIU A;  3G4S A;  2YU9 H;  1VQB A;  1DGS A;  3AYH B;  4DR7 L;  3FKI G;  2RHQ B;  4DUZ L;  1VQG A;  1NY4 A;  4A4I A;  4PZ8 A;  1XTD A;  3PV0 A;  2GVA A;  3PSI A;  2CFM A;  4YWK A;  1AE2 A;  1Y1W G;  1JB7 A;  2VNU D;  4A3J G;  2E2I H;  1VQA A;  2Q2I A;  2D0P A;  2LSS A;  3T1H Q;  4C3I H;  3K81 C;  4JI3 L;  4A3F G;  2OTL A;  1XNR L;  3ULP A;  3PUV A;  5IP7 G;  1PH5 A;  4JI4 L;  2AWN A;  3S16 H;  1GVP A;  1TWA H;  3RN5 A;  4A76 A;  1YJW A;  2ATW A;  3I4N G;  1KAW A;  1Z47 A;  2DUD A;  4L5S A;  1NBW A;  4DUY Q;  1I3Q H;  3J7Z C;  3S1R H;  3GD7 A;  3NEN A;  2UU9 Q;  5IYB G;  2HHH L;  3CCQ A;  4LF6 Q;  2JA6 H;  4DR6 Q;  3E9I A;  1LTL A;  4PMW A;  1CSQ A;  1X56 A;  4GN3 B;  4LF9 L;  2BH8 A;  5BR8 L;  1X6O A;  1PFS A;  3TS0 A;  3GTM H;  4R1J A;  4HJ9 A;  4OWX B;  3A0J A;  1HZA A;  4O2D A;  2R92 H;  5JJK A;  4DR2 L;  3M7N A;  3I4M H;  1VQE A;  4P74 A;  4DV4 Q;  1NMG A;  1CKN B;  3K7A H;  4X65 Q;  4LF4 L;  2NVT H;  1VQL A;  1PH4 A;  4K0K Q;  1A0I A;  4JI8 L;  2IY5 B;  4UP7 A;  1NTG A;  3ULL A;  3DLL A;  4A3G G;  4DK6 C;  1IBK Q;  3AFQ A;  1YBY A;  4NXN Q;  1VQ6 A;  3MEF A;  2NN6 I;  5LMU Q;  3GTL H;  4KHZ A;  2Q2H A;  1X3G A;  2VY3 A;  3UDX A;  5LMN L;  2N78 A;  3PF5 A;  1FJG L;  2QGQ A;  4QGU A;  1Q81 C;  2CCZ A;  4UY8 C;  1GKH A;  3W1B A;  3I4O A;  3ULJ A;  4IFD J;  1C0A A;  3CCE A;  2Z0S A;  1X9N A;  4LF5 Q;  2UUB Q;  2WFW A;  3CPF A;  1QVC A;  3BZK A;  1K73 C;  2A1A A;  4L5Q A;  3T1Y Q;  4GOP A;  3TRE A;  4HJ7 A;  4DR1 Q;  1A62 A;  4JOI A;  2H5X A;  4EQ5 A;  1HR0 W;  3I55 A;  4QIW E;  2PQA A;  3HKZ G;  1SRO A;  4L5T A;  3CCV A;  1D8L A;  4A3F H;  1EYG A;  3I4N H;  1KC8 C;  4BBS H;  3CPW A;  2F52 A;  2IHF A;  3ICE A;  1KRT A;  2UXB Q;  1KXL A;  1Q12 A;  1J6Q A;  2KBN A;  5GAD C;  4KI0 A;  3SGI A;  2AMC B;  1UE6 A;  1OTC A;  4DV6 Q;  2OQ0 A;  5FLM H;  4DR4 Q;  3HOU H;  5C4X G;  4DR5 L;  3CD6 A;  3J81 c;  5C4J H;  5IP9 H;  1K8A C;  4LWC A;  1HJP A;  1UEB A;  4GN5 A;  1CKN A;  4DK3 C;  2MFI A;  1EIY B;  2JQO A;  1IBL L;  2MQH A;  4IOA A;  2AKW B;  3PO3 G;  4BY1 H;  1TWG H;  2NZO A;  4OXP A;  4HIM A;  4DR3 Q;  2JA6 G;  1PV4 A;  3AEV A;  1HZ9 A;  3F8T A;  2E5L Q;  4LFC L;  1R9T H;  3OTO Q;  1YI2 A;  3UDI A;  3S14 H;  2BA0 A;  2KHI A;  3BZC A;  1N33 L;  4AIM A;  4X62 Q;  1H95 A;  2I5L X;  5IYC H;  4JBK A;  1VQ9 A;  4JV5 L;  3PCO B;  3PUX A;  4DV5 Q;  1IBM L;  4YHH Q;  4BY7 H;  5GQO A;  1TXY A;  4YY3 Q;  3G6E A;  2F4V L;  4LF7 Q;  1OXS C;  4A3M H;  3ERS X;  2NZH A;  1IXR A;  4JI2 Q;  4GNX C;  3M85 A;  2B29 A;  5C3E H;  1FGU A;  4IFD I;  3A5Z B;  3PUY A;  2R6G A;  4YWM A;  3TQY A;  5IP9 G;  4X66 Q;  1PA6 A;  4JI6 L;  4JI0 Q;  4HIK A;  1L1O B;  1Q8K A;  2K14 A;  1E7Z A;  3H0G H;  4DAM A;  4JBM A;  1EUJ A;  3UDF A;  4DV7 L;  4DV1 L;  3J80 i;  1N32 L;  2HIV A;  4POF A;  1C9O A;  1Z9F A;  1N34 L;  4IJH A;  3F2D A;  4POG A;  2UXC L;  2WB1 G;  3JAM c;  4A3D G;  4X6A H;  3CC4 A;  2UXD L;  2QEX A;  4P71 A;  4KHP L;  4A3I G;  1HH2 P;  4DAY B;  4DR7 Q;  2K5H A;  1X65 A;  2MO0 A;  1OXU A;  4ME3 A;  4DUZ Q;  3E0E A;  4B3T L;  1L2F A;  1JMC A;  3KF6 B;  2R7Z G;  5C44 G;  1VQN A;  1Q1E A;  2HQL A;  1RIP A;  3KLW A;  1YIJ A;  4JI3 Q;  1XNR Q;  3JC6 6;  4LUZ A;  3FHW A;  1D7Q A;  2CWA A;  5JEA G;  3HOV H;  3CC7 A;  4HJ8 A;  4DV3 Q;  2WAQ E;  3RNU A;  5JEA J;  4X64 Q;  1BBU A;  5C3E G;  5EAY A;  2NVX H;  4DUY L;  1QVF A;  3I56 A;  1UE7 A;  4LF6 L;  1TWH H;  1VQI A;  2EIF A;  5C4X H;  1VQM A;  3DM3 A;  1XPU A;  2LXK A;  2MNA A;  1IYJ B;  4J15 A;  1OXT A;  2ZJQ A;  3PUW A;  3HOZ H;  4Y52 H;  5IYC G;  3KJO A;  2CKZ B;  2OTJ A;  2N8N A;  4DR2 Q;  1PH1 A;  3G71 A;  1J5E L;  1YHA A;  3RN2 A;  2IT1 A;  2JE6 I;  5AJ3 Q;  2Y0S G;  1V43 A;  1E24 A;  2NVY H;  3I7F A;  4NXM L;  4WJ4 A;  3D31 A;  2YTY A;  4LF4 Q;  1BBW A;  1S40 A;  4K0K L;  5HGQ A;  2RHS B;  5IWA L;  1SFO H;  1KRS A;  1MJC A;  4MNO A;  4A3L G;  4LFB Q;  3HOW H;  5IY0 A;  3HOU G;  4IPC A;  1IBK L;  4QL5 A;  5GAG C;  1OXX K;  1UE5 A;  4DNI A;  5LMU L;  1SN8 A;  5IYD H;  4QY7 A;  2YV5 A;  3RZD H;  3CME A;  2N49 A;  1WYD A;  5FLM G;  2A19 A;  5K36 G;  3M4Q A;  3L7Z C;  4IFD G;  1Q1B A;  4A3C H;  3UDG A;  4GLX A;  2K5N A;  3KYH C;  1EFW A;  4LF5 L;  2UUB L;  1SMX A;  1HNZ L;  3KJP A;  3T1Y L;  2JA7 H;  1N8R C;  3K80 C;  1YHB A;  3E9H A;  4DPG A;  1NMF A;  4DR1 L;  3Q8D A;  5GRO A;  1ASZ A;  2YTV A;  2B63 G;  4RG1 A;  2Q2T A;  4A93 G;  5DLQ E;  1MKH A;  2Z6K C;  2K4K A;  3CF5 A;  2YTX A;  3I4M G;  5C0X I;  4DV0 Q;  3W1G A;  2JA5 H;  3S1M H;  4GN4 B;  3UE0 A;  5LMN W;  3S17 H;  3CP0 A;  4PG3 A;  4AYB G;  1XMO L;  3S1N H;  1W3S A;  2JA9 A;  4RMF A;  4AH6 A;  1YJN A;  3PIP A;  4DR5 Q;  1XMQ L;  3W5O A;  5M3M H;  2UUC Q;  3K0X A;  4L5R C;  5C0X J;  1L1O C;  3KFU A;  2VL6 A;  1Y14 B;  4IPH A;  4YCV A;  3A5U A;  1U5K A;  4LF8 L;  1JJG A;  1HR0 L;  4P73 A;  1VQK A;  4OX9 L;  4OWW B;  3GTK H;  2R93 H;  2JA7 G;  1AH9 A;  2E5L L;  2KEN A;  3OTO L;  2JK8 A;  1WCM H;  1E22 A;  1VS0 A;  1HNX Q;  3HKZ E;  4BBR H;  4R4I A;  3GTJ H;  4X62 L;  1N33 Q;  3PF4 A;  1GM5 A;  2AWO A;  1CUK A;  1Q46 A;  1VQJ A;  3TEH B;  3S2D H;  3K7U C;  3F2C A;  3CQZ H;  4JYA Q;  1M1K C;  1VQ7 A;  4TQU S;  3RZO H;  4YHH L;  3HOW G;  2VZA A;  3S2H H;  3HKS A;  3GDE A;  4FDB A;  4AYB E;  4YY3 L;  2F4V Q;  2KHJ A;  4JBJ A;  1IZ6 A;  1QUQ A;  4JC0 A;  1SR3 A;  1ASY A;  3J7A 5;  2ZM6 Q;  4JBW A;  1KD1 C;  4X66 L;  2E8G A;  4JI6 Q;  1LM0 A;  1E1O A;  4JI0 L;  2PNH A;  4XIG S;  4OWT B;  4A3E G;  1FL0 A;  2E2H H;  1O7I A;  4XTC S;  4DV7 Q;  4DV1 Q;  1K83 H;  3HOY H;  3HOZ G;  3PO2 G;  1N32 Q;  2ZJP A;  3EBE A;  2QA4 A;  1Q7Y C;  1N36 Q;  3J81 i;  2UXD Q;  4GKK L;  2GVB A;  3G48 A;  3H0G G;  1I50 H;  4KHP Q;  2HT1 A;  1EQR A;  5HY6 A;  3U4Z A;  1PYS B;  4IO9 A;  3CC2 A;  5E7N A;  3CCS A;  1P16 A;  2VQF L;  2AHO B;  2ZJR A;  1YZ6 A;  3ZJY C;  4GOP C;  1EWI A;  4B3M L;  4B3T Q;  2ASB A;  4KLK A;  1SE8 A;  4DKA C;  1P8L A;  4LNQ A;  3HFZ B;  2XGT A;  4BY7 G;  3F2B A;  1TWF H;  4UPA A;  1UWV A;  2B3G A;  1XNQ L;  2LXJ A;  4DV3 L;  1GO3 E;  5M5Y H;  4X64 L;  5FJ8 H;  1PH9 A;  1M90 C;  4OO1 G;  2VQE L;  1JJC B;  2R7Z H;  4C3J H;  3M4O H;  3CXC A;  1VQD A;  2OCE A;  2UUA L;  1S3O A;  2WB1 E;  1I6H H;  5JJI A;  1N9W A;  1CSP A;  4JI5 L;  1UE1 A;  3H3V H;  1Y1V H;  1IL2 A;  1HZC A;  2Z6K A;  3CAM A;  3D0F A;  2IX0 A;  5FLX c;  1C7Y A;  1WJJ A;  2VUM G;  3EIV A;  3OYY A;  1S72 A;  1NJI C;  3PO3 H;  1PH2 A;  4IJL A;  1J5E Q;  3S1Q H;  4Y7N H;  1VQF A;  1WOC A;  1EOV A;  4DV2 Q;  5AJ3 L;  1E3P A;  4NXM Q;  4LUV A;  1VQ8 A;  3RR5 A;  2Q2U A;  4BXX G;  2ZTD A;  1Y1V G;  5IWA Q;  4LFB L;  2JA8 H;  1A8V A;  1CKM A;  2CWP A;  1RL2 A;  1YJ9 A;  1I94 L;  1VQ5 A;  1HNW Q;  4HID A;  3CCJ A;  1L1O A;  1PH7 A;  3HOY G;  3PO2 H;  5IE8 A;  5M3F H;  5M5X H;  1W2B A;  2R7D A;  3AFP A;  4JCV E;  4GNX B;  1XPR A;  2RF4 A;  4JG2 A;  4QJF A;  4PZ6 A;  3RLN A;  1Q86 C;  3U58 A;  4B3S Q;  4GKJ L;  1G29 1;  4LW1 A;  2CQO A;  1SLJ A;  4EX5 A;  3NBH B; 
#chains in the Genus database with same CATH topology
 2R92 B;  3G8C A;  4A3G B;  3H91 A;  4R8N A;  2VUG A;  1FD7 D;  5L1L A;  3TS2 A;  4KD3 A;  5EWE A;  3OW2 A;  3MA2 B;  5GAE C;  1JE5 A;  1G6Z A;  3PIO A;  1R9T B;  4A75 A;  3TZU A;  4JI1 Q;  1SBB B;  4FBT A;  4K5W A;  4EQP A;  3ERQ A;  3WO1 A;  5CV7 A;  3GTP A;  5K36 H;  3TDQ A;  1HA6 A;  1RJT A;  3RLF A;  4PV1 C;  2NU9 B;  2UXD H;  1QVG A;  2D5D A;  1CA6 A;  4OX9 Q;  4APM A;  2EE1 A;  2PBZ A;  1M4V A;  3IRB A;  3V4S A;  3PMF A;  2C35 B;  4IAL A;  1PRT D;  1QZG A;  3TP6 A;  3H0G B;  4RHR A;  2FPG B;  5I2X A;  1CQF A;  2KA7 A;  1B9M A;  2NTS A;  4HED A;  4A3D B;  1HFG A;  2RDG A;  3BVM A;  4J8Q A;  4XXE A;  2PPB C;  1JXL A;  5LMU H;  5M5W H;  4K8I A;  2HHH Q;  1K28 A;  4Q0F A;  3QZ8 A;  4MTK A;  1YHQ A;  3T56 B;  2K28 A;  4G7Z C;  3SVM A;  4BBS G;  1SJE D;  4LJZ C;  3M4O B;  1Q82 C;  4MAM A;  5HV6 A;  2ZM6 L;  5KG3 A;  1V9P A;  3GII A;  2NUC A;  3W3A A;  1KHI A;  2ALY B;  4J0M A;  1F9Q A;  4V19 0;  3JRW A;  4DV4 L;  4A3L H;  1YIT A;  2BDN A;  1G2S A;  2JJQ A;  3L3O C;  4H7B A;  3DEP A;  1Z2P X;  4M9U A;  4OL7 A;  4BBR B;  4UDU C;  4LF6 H;  2NN6 H;  2VR1 A;  1J9O A;  3D8G A;  1PLF A;  3BQ1 A;  5JVD F;  1LUZ A;  4HNV A;  1ZEQ X;  4EEQ A;  4YWL A;  4IUP A;  1VQP A;  2FK2 A;  1PFN A;  2FHT A;  2IJ0 A;  4HCE A;  1X3F A;  4F4X A;  1KNA A;  1XNQ Q;  5JPN C;  4RGT A;  2Z4I A;  4AYB B;  1NR4 A;  1YNX A;  1X3P A;  3NQT A;  4CKE A;  2VQD A;  1AZP A;  3KF6 A;  2N55 A;  2R92 G;  3GTQ B;  3GTO A;  3KDF A;  2BH2 A;  4JI5 Q;  1CQJ B;  3TRZ A;  1EY4 A;  1VQ4 A;  4Q45 A;  4HJ5 A;  2ZTE A;  5CBA E;  2RA4 A;  3TIG A;  4OO1 I;  3BU2 A;  3I73 A;  4A3B G;  3VR3 A;  5KFY A;  4QWE A;  1NNX A;  1PTO H;  1S97 A;  1UC8 A;  5L1K A;  3HOW B;  2B63 B;  2M9V A;  2J9G A;  3OW7 A;  1Z6H A;  5IIF A;  3PGZ A;  3RBE A;  1SEB D;  4DR3 L;  2EJG C;  4K8J A;  1IBM H;  3L0O A;  4OON A;  2EXD A;  4JOI C;  2C2R A;  4JI0 H;  2WKD A;  2C2D A;  1RJQ A;  4MV9 A;  1EIF A;  4L8J A;  3EN2 A;  3HOV G;  4ECQ A;  1EU3 A;  4YCU A;  3P75 A;  3TIN A;  1T9H A;  1I94 H;  1B8A A;  1VF5 C;  1WVL A;  3G6J B;  1SND A;  3S1M B;  1JOR A;  1VCI A;  1TWC H;  2LFN A;  2TMP A;  4DV3 H;  1VDZ A;  2PI2 A;  1KBL A;  4LFA L;  2B8G A;  3KDF B;  2WAQ G;  5I6Y A;  1BGW A;  4TQR A;  4OGQ C;  4J9N A;  3V6J A;  4CKB A;  3NTH A;  3I70 A;  5KFM A;  2UVW A;  1K8O A;  2JA8 G;  2KHS A;  2P5Z X;  3M9O B;  3K8A A;  2CW0 C;  4IWX A;  1TVX A;  2I5M X;  5EWF A;  5F9L A;  4XT1 B;  4K6D A;  1B9N A;  1TS4 A;  3AYH B;  3MZ5 A;  2RHQ B;  4DUZ L;  4A4I A;  4PZ8 A;  1XTD A;  3N42 B;  2JEG A;  5CA1 F;  3PV0 A;  1N56 A;  2GVA A;  3PSI A;  1JB7 A;  1KLG D;  4NXN H;  2E2I H;  2Q2I A;  1AW7 A;  2D0P A;  2LSS A;  3T1H Q;  1IKM A;  1XNR L;  2OH2 A;  2SDF A;  3PUV A;  2AWN A;  2R92 A;  3OOC A;  2ATW A;  3C1F A;  2DNE A;  2HGS A;  1LT6 D;  3P20 A;  1B44 D;  1I3Q H;  2XRS D;  1RJR A;  3GD7 A;  2JN4 A;  3GP7 A;  5IYB G;  3CCQ A;  4DGZ A;  2HHH L;  2JA6 H;  3BG5 A;  3RB0 A;  4PMW A;  1LTL A;  1CE8 A;  4LF9 L;  5JUM A;  4ZUJ A;  2F1M A;  1X6O A;  2R85 A;  1ZQ7 A;  3K5N A;  3TS0 A;  3Q8Q B;  1KDB A;  3HXL A;  2C22 A;  2AUK A;  2R92 H;  4O2D A;  2JA5 A;  4I7A A;  2V9W A;  4DR2 L;  2UU9 H;  4P74 A;  4DV4 Q;  4JI7 H;  1CKN B;  4UCU A;  4CC5 A;  4X65 Q;  2W7P A;  1M0W A;  3KBG A;  2NVT H;  4C3J B;  1PH4 A;  3E5S A;  1EY6 A;  3H4B A;  4QIW B;  3MR2 A;  2ICI A;  1ET6 A;  4UP7 A;  1NTG A;  4EBC A;  5KG2 A;  3H0G A;  4DK6 C;  3J7Y W;  1E4E B;  5KIX A;  3OSN A;  1VQ6 A;  1AFP A;  4G4K A;  3SEB A;  2CW0 D;  4ZUI A;  3KXY T;  2PQE A;  3R2I A;  3PF5 A;  2IBK A;  1FJG L;  5EBD A;  2QGQ A;  1Q81 C;  4CHT B;  2CCZ A;  3GTP B;  5JOB A;  4J6H A;  3MXU A;  1SE3 A;  4IUR A;  1X9N A;  1TWC A;  2UUB Q;  3CPF A;  3BZK A;  1E2V A;  3BDL A;  5KGU A;  2FK1 A;  1PZI D;  2RDJ A;  1LO5 D;  2K33 A;  1G91 A;  2YU9 B;  3HKZ G;  3RZD B;  4O3S A;  3CCV A;  1SJH D;  4ECY A;  4NMZ A;  2VQE H;  3BYY B;  1B04 A;  3KAK A;  4IWY A;  2D9U A;  4JK1 C;  4RGM A;  1BCP B;  4LFA H;  4DV6 Q;  2B39 A;  2R87 A;  1DCZ A;  4LSX A;  2E2H A;  2PCF B;  5C4X G;  2BE5 C;  5A35 A;  4MA5 A;  4LWC A;  4GN5 A;  1UEB A;  2FFK B;  2VA3 A;  1A2U A;  4X65 H;  4IOA A;  2JA6 G;  5CV6 A;  5KFC A;  1HZ9 A;  2O4X A;  4LFC L;  1YI2 A;  1JOO A;  1D5X C;  2OLS A;  4TUY F;  4RWS C;  4AIM A;  4X62 Q;  2WTF A;  5IYC H;  4JBK A;  2K1B A;  1VQ9 A;  4MA0 A;  5BN4 A;  4FXG C;  4KKS A;  4JI1 H;  1IBM L;  1NCV A;  4YP3 A;  4YHH Q;  3RGX A;  4BY7 H;  4YY3 Q;  1BCP D;  3V05 A;  2M05 A;  4GNX C;  1T36 A;  3K3V A;  1N36 H;  5C3E H;  5I2Y A;  1SE4 A;  3TQY A;  2EOT A;  5IP9 G;  1PA6 A;  4HIK A;  1L1O B;  4LF9 H;  2E74 C;  4WD3 A;  3A8J E;  4YQW A;  2ZDQ A;  1EUJ A;  3QR8 A;  3UDF A;  4DF7 A;  1S5F D;  1Z9F A;  2F4I A;  2MPM A;  4IJH A;  2L55 A;  4POG A;  1HRJ A;  4A3D G;  1Z2O X;  1XNQ H;  4HMJ A;  2VB2 X;  4UHV A;  1IYV A;  3H94 A;  2QEX A;  3QB3 A;  4RB0 A;  4R8U B;  1EWH A;  1HQR D;  2MO0 A;  2J6S A;  2G9D A;  1L2F A;  1AUV A;  4MV8 A;  2R7Z G;  2A6E D;  1U4R A;  3J7A F;  1ROD A;  1OWT A;  2WII B;  4RZQ A;  2ASL A;  4DNT B;  1XNR Q;  3JC6 6;  3GIJ A;  1ZKO A;  5JEA G;  4HJ8 A;  3K5M A;  5C3E G;  4EBE A;  2NVX H;  5TSS A;  4DUY L;  5BPH A;  2OEO A;  3LWE A;  3I56 A;  4LF6 L;  3C3L A;  5DQH A;  5C4X H;  5HGT A;  1VQM A;  3DM3 A;  1HHV A;  4KKU A;  1C3O A;  2PMZ A;  1IYJ B;  3HOZ H;  3HB9 A;  4DV1 H;  5IYC G;  3Q23 A;  3NXW A;  2CKZ B;  2N8N A;  2M2L A;  2CH4 A;  3PO2 B;  5LA6 F;  3NUC A;  2RBM A;  1UAP A;  3T4A C;  1FGB D;  2IT1 A;  3NWT A;  2NVY H;  2ZM6 H;  4WJ4 A;  3D31 A;  4GKK H;  1S40 A;  2JA7 B;  4O3O A;  2EJF C;  1N48 A;  1MJC A;  3G6X A;  4L63 B;  4XT3 B;  1IBK L;  3URY A;  2PW7 A;  5GAG C;  5LMU L;  2A6H D;  5M5W B;  1SN8 A;  3FMC A;  4ED3 A;  1GUS A;  2YV5 A;  3CME A;  3V2T A;  4ZHQ F;  5FLM G;  4ZQI A;  2WYO A;  2FIN B;  3L7Z C;  2B2T C;  2B2T A;  1D6E C;  4A3C H;  3UDG A;  4DV2 H;  5KEE A;  1TKW B;  2K5N A;  3V6H A;  1EFW A;  5FOB B;  4C1N K;  1STH A;  1ESF A;  3R2T A;  2AQ3 B;  4YR3 A;  4DR1 L;  4DPG A;  1B3Q A;  4PWQ A;  1LAB A;  2A6H C;  2YTV A;  3PN1 A;  4RG1 A;  2Q2T A;  2NU7 B;  4YIJ A;  3RTX A;  3I4M G;  2F0D A;  3W1G A;  1FJG H;  4A3K B;  1SNC A;  1GHJ A;  5ELD A;  1ENA A;  2PNR C;  3QWN A;  2F0J A;  2K01 A;  5FD6 A;  3S1N H;  2JEJ A;  2B2V A;  4U7C A;  4L6T B;  3PIP A;  1HNX H;  2YL2 A;  4L5R C;  1XMQ H;  4C3H G;  1IOV A;  4RKB A;  3A5U A;  1F2Y A;  3VMM A;  2ZXO A;  5CB4 F;  1VQK A;  3A7L A;  5K5P A;  2KEN A;  3OTO L;  2JK8 A;  1E22 A;  1VS0 A;  3HKZ E;  4BBR H;  1N33 Q;  3T53 B;  2QW7 A;  5IWA H;  5DAU A;  1WTV A;  3TEH B;  3S2D H;  2LS0 1;  1GGO A;  4AYB E;  3GIQ A;  1LT5 D;  2YRW A;  2A6E C;  2KHJ A;  2F4V Q;  2F3W A;  4UCS A;  3I72 A;  3TBI B;  2XVS A;  4JC0 A;  2Q8R E;  4LF4 H;  2Z4H A;  1Y69 U;  1KD1 C;  1O75 A;  4JI6 Q;  3KHH A;  4QUC A;  1EWC A;  1FNU A;  4OWT B;  2WIN B;  4A3E G;  1FL0 A;  1ZYR C;  2E2H H;  4HR7 A;  4MTE A;  5C1O A;  4Q8F A;  4XTC S;  3PO2 G;  4DV1 Q;  3HOZ G;  1ULZ A;  2IL8 A;  4O4L F;  4PMC A;  1Q7Y C;  3DWQ A;  4JV2 A;  4KK7 A;  1WTQ A;  1QJO A;  3G48 A;  4IRK A;  3H0G G;  3ONA B;  5KG6 A;  2XRQ D;  3U4Z A;  4IO9 A;  2ZJR A;  1YZ6 A;  3ZJY C;  3CKI B;  3KLS A;  4KLK A;  1S10 A;  3TN2 A;  3BZD B;  3GLK A;  3Q8P B;  1SSO A;  1TWF B;  1CT1 D;  4DR5 H;  5C3W A;  3OTO H;  2FLN A;  2DNC A;  4DV3 L;  4HSP A;  4V0B A;  1M90 C;  3RIZ A;  4HTH A;  1SCU B;  4C3J H;  1BJT A;  3CXC A;  1VQD A;  3GTQ A;  3D4R A;  4DV0 H;  4IHJ F;  2EDG A;  2OCE A;  3K58 A;  2WB1 E;  2UUA L;  5JJI A;  1CSP A;  3ND9 A;  4MV3 A;  1KDA A;  1UE1 A;  5JH7 F;  4C3I G;  4DR4 H;  5ELC A;  2RQX A;  1W93 A;  1WSC A;  3CAM A;  5FLX c;  5KFR A;  1QWY A;  1S72 A;  3PO3 H;  2QF7 A;  1J5E Q;  4IJL A;  1I4G A;  1EOV A;  4N8F A;  1ENC A;  5KFE A;  3MXG A;  1VQ8 A;  2XCP A;  4ILW A;  4BXX G;  3J7A K;  4RB2 C;  1Y1V G;  3ORR A;  1YJ9 A;  1VQ5 A;  1HNW Q;  5M5X B;  2JSO A;  4HID A;  2LY7 A;  3PO2 H;  3TSS A;  5IE8 A;  1FKA H;  1MSH A;  1VMC A;  4K5V A;  2RF4 A;  4QJF A;  3U58 A;  4GKJ L;  3EA6 A;  1D1K A;  2C9O A;  2CQO A;  1KAA A;  1JWM D;  1HFN A;  2O5I C;  4G3I A;  1K1S A;  1JLL B;  3CCR A;  3IAY A;  1LTA D;  1LT3 D;  2BCO A;  4R9W A;  3CCU A;  4IRD A;  3ETJ A;  3M9B A;  4J9S A;  1V1O A;  4RCN A;  4YCW A;  2A69 D;  4F88 A;  1D5Z C;  2K03 A;  1TS3 A;  1Y1W A;  3B6Y A;  3WOF A;  2A68 C;  1N33 H;  4DV0 L;  2EYJ A;  5GON F;  4FYD A;  1RCV D;  3I2Z A;  4KJN A;  1PK8 A;  1PHJ A;  4F87 A;  1K83 A;  1TWA B;  1JT8 A;  3HOZ B;  1EIG A;  2V1C C;  3DF7 A;  4YR0 A;  1XMQ Q;  4ED1 A;  2NYZ D;  4JI3 H;  3DMU A;  5H1S E;  1QCB D;  2XN9 C;  3AQQ A;  1PH6 A;  2PMZ E;  4DUY H;  4DR3 H;  4C2M B;  1K3R A;  5IT9 W;  4ED0 A;  2XD4 A;  3T1H L;  1WI5 A;  1E4F T;  1WD0 A;  1G6P A;  1R9T A;  2N88 A;  4R8I A;  1X3Q A;  1BF4 A;  1B3A A;  4RNM A;  1H9K A;  1YNN C;  3BG3 A;  1DOM A;  5D65 A;  4H02 A;  5EPL A;  4DAP A;  1KIX A;  1DZ1 A;  3VYT A;  3SK8 A;  3A74 A;  4BY7 B;  2MO1 A;  3ETH A;  2DLN A;  4P2C B;  2R8I A;  3R3O A;  3PO3 B;  5FD5 A;  1IHZ A;  1JIC A;  2K75 A;  3K0Y A;  3U9O A;  5BR8 Q;  1B1Z A;  1AE3 A;  5M3M G;  4A3C G;  2F0O A;  4A2B A;  5ELN A;  4A3B B;  1QZH A;  3EPI A;  4RFB A;  4ZYS A;  3BA8 A;  4KN4 C;  4YY3 H;  3PR4 A;  1XJV A;  3MVV A;  2VW9 A;  4BY1 B;  4MZ9 A;  3HBL A;  4APV A;  5C0X G;  3K57 A;  5JJL A;  1N36 L;  5KKN B;  2YZN A;  2XCA A;  5CGK A;  1KL9 A;  4WOR A;  3KHG A;  5ISR A;  2DWC A;  2NU6 B;  2IA6 A;  2F0P A;  5IYB H;  3GTG B;  4MTN A;  5CAE B;  3PUZ A;  2K5D A;  1YNJ C;  1X54 A;  2A5H A;  4GLV B;  4LK1 C;  1RHP A;  3CMA A;  4C5C A;  1EYC A;  2OWO A;  4ECZ A;  3J80 c;  3H20 A;  3OMG A;  2XIW A;  3N8D A;  3U4V A;  1EY8 A;  1EZ8 A;  1JWU D;  3JAM i;  3S15 H;  1Y8N B;  1S4Z A;  5G3L F;  3QJY A;  5DM6 3;  2UUA Q;  1NE3 A;  1F2M A;  2PQA B;  2R7N A;  1JR0 D;  2NUA B;  2BQU A;  2VUM H;  4HR7 B;  4HIO A;  3H3V I;  3HOX B;  4HJA A;  1R4P B;  3I90 A;  3RB4 A;  4XDX A;  1XDN A;  3TQ1 A;  2NVY A;  2A8V A;  4A3I H;  4FU0 A;  3N44 B;  1LYL A;  4DV2 L;  1LLR D;  2FXQ A;  2VXW A;  2Q8T A;  2PZT A;  5KG5 A;  2WKC A;  2B2Y A;  2H4O A;  4J9P A;  1CKO A;  4R4C A;  1CHQ D;  1EFI D;  1Q8I A;  1TT2 A;  2BA1 A;  4FS2 A;  2R8J A;  1YEZ A;  3BDO A;  5HUR A;  5KFV A;  3K3P A;  5FO9 B;  2KJX A;  4O0A A;  1PX2 A;  1K1Q A;  2R82 A;  1EU4 A;  1S0M A;  1E2Z A;  3OWE B;  3GTG H;  4A3K H;  2ID0 A;  2OQK A;  4J9O A;  3M4P A;  5IOC A;  4BBR G;  3STB C;  1I4Q A;  2VPQ A;  3S1N B;  1A9X A;  4B9X A;  3KOJ A;  4LF7 L;  1TU2 B;  2K5V A;  3NEL A;  1PRT B;  5COR A;  4DK1 A;  5FJ8 G;  1BUV T;  3CW2 C;  2IX1 A;  3CCM A;  4JI7 L;  4UP8 A;  3JRX A;  1BOS A;  4R4O A;  2W71 A;  1YNN D;  4A3B H;  4FS1 A;  4EEY A;  1U9R A;  3RLO A;  1K83 B;  3OHX C;  4WJ3 M;  4F4Y A;  1N34 Q;  2UXC Q;  3S24 A;  2JA5 G;  4EYH B;  4XZ3 B;  2J7Z A;  2KCN A;  5C6A A;  4JUZ A;  4JV1 A;  5LL6 X;  3G4S A;  2J6T A;  1TQO A;  4DR7 L;  2HHH H;  4YAJ B;  1V4Y A;  1DOL A;  1VQG A;  3NBI A;  4I65 A;  3M4Y A;  4DV6 H;  5C5L A;  1WD1 A;  4I50 F;  3GIM A;  1ICW A;  2FMC A;  1ML0 D;  4A3F G;  1SYX B;  1JOK A;  3RMH A;  1PH5 A;  4JI4 L;  2VUM B;  1YJW A;  3RN5 A;  4PQX A;  4PNY A;  1ICF B;  1JDB B;  1KAW A;  1NBW A;  2KOL A;  3S1R H;  1XTC D;  4LF8 H;  4ME5 A;  2W6M A;  5KT5 A;  2PN1 A;  4KY6 A;  1CSQ A;  4GN3 B;  2BH8 A;  1BCP F;  5BR8 L;  1T94 A;  1AN7 A;  2J0T D;  3KLS X;  4IQZ A;  2L11 A;  4HJ9 A;  4OWX B;  1S68 A;  1HZA A;  5IGF A;  5JJK A;  1JB3 A;  3SDZ A;  5C8Y F;  3M7N A;  4U6P A;  2E2I A;  4F4W A;  1NMG A;  5IGE A;  2EJM A;  1SMY D;  2FK3 A;  2R7Z B;  4K0K Q;  1PTO B;  3BA9 A;  1FR3 A;  3IKJ A;  4A3G G;  4EG0 A;  2JXM B;  1YBY A;  3MEF A;  2EZV A;  5KNC A;  3GTL H;  2WB1 A;  5BPF A;  2JA8 B;  1TII D;  5F2D A;  5LMN L;  1UUP A;  3HKZ B;  5EGT A;  3SK4 A;  4CBV A;  2SOB A;  4UY8 C;  2R7K A;  4A3J B;  1NAP A;  5CV9 A;  4IFD J;  3SK6 A;  2YRX A;  1TWF A;  3BVG A;  1K73 C;  2ALZ A;  3DM1 A;  2DN8 A;  4L5Q A;  4HN7 A;  2HDM A;  4GOP A;  1HR0 W;  4DR1 Q;  3OHB A;  2F03 A;  1O78 A;  3H40 A;  2PQA A;  1EYZ A;  3HOY B;  1GLV A;  1H9R A;  3FKI A;  1XMO H;  4A3F H;  1DON A;  1D8L A;  4FF3 A;  4BBS H;  1J5E H;  3ICE A;  2UXB Q;  1E0B A;  1J6Q A;  4KI0 A;  4XQN A;  4HCS A;  4DL2 A;  4RGN A;  2OQ0 A;  4DK0 A;  5FLM H;  1PFB A;  4DR4 Q;  1ZXT A;  4G57 A;  5C4J H;  1QOH A;  1O7Y A;  2RKS A;  1CKN A;  4B08 A;  2JQO A;  2MQH A;  5J39 A;  3BJY A;  3NTK A;  2CQA A;  1PV4 A;  3AEV A;  3S14 H;  3UDI A;  3GTK B;  4KY5 A;  4FP5 D;  2JA6 A;  1A3T A;  1BXT A;  3HRZ C;  3SXH A;  5COY A;  2MGS A;  4JV5 L;  2A69 C;  4DAV A;  4DV5 Q;  1V1P A;  2HVQ A;  1CHP D;  2FB9 A;  5GQO A;  3HKZ A;  3I4M B;  2F4V L;  1OXS C;  3QOJ A;  4EQO A;  4A3M H;  2YS7 A;  4ECT A;  1IXR A;  1MD2 D;  4JI2 Q;  2SNS A;  2HUG A;  2E75 C;  3PUY A;  2R6G A;  4FF4 A;  1KJ9 A;  3RGZ A;  2C2E A;  4NXM H;  4JI6 L;  2B2V C;  5I6W A;  3VR4 A;  2K14 A;  2Z6B A;  2XSC A;  3ORQ A;  3FDS A;  2PVP A;  3MWD A;  2DPJ A;  4DV7 L;  1BBX C;  1N32 L;  5DGA A;  2HIV A;  5AFW A;  1EY0 A;  5IGD A;  1N34 L;  2UXC L;  4F8M A;  2QIL A;  2K32 A;  1XXG A;  3NK9 A;  3JAM c;  4X6A H;  3Q8R B;  3CC4 A;  3J7A V;  2XNA C;  2HD3 A;  4KHP L;  4RKL A;  1HH2 P;  4DAY B;  4TV9 F;  4A2A A;  2DY7 A;  2K5H A;  1X65 A;  3RB3 A;  3H6M A;  1BR9 A;  4LMQ D;  4B3T L;  3RD4 A;  2V4D A;  4MV6 A;  3TQT A;  1Q1E A;  2HQL A;  5M3M B;  3KLW A;  4JI3 Q;  1D7Q A;  4O1N A;  3KHR A;  3FHW A;  2ZDG A;  3HOV H;  1FNW A;  5JEA J;  5CR3 A;  1K0S A;  5EAY A;  5FLX W;  4U67 3;  3HG9 A;  3LNN A;  4O4H F;  1TWH H;  2L12 A;  4YBZ B;  1G8Z D;  3OHA A;  1GSH A;  2LXK A;  3A8K E;  4YJ3 F;  2ZJQ A;  2G5D A;  4ZK9 B;  5C4J B;  2RGR A;  3MFY A;  4N8X 1;  1EY5 A;  3HZX A;  1NR2 A;  2E2D C;  1YHA A;  3ZYY X;  3VYU A;  2GPW A;  4JI6 H;  5AJ3 Q;  4NXM L;  2K05 A;  2F0E A;  3MFG A;  1KC7 A;  3KK7 A;  1JQY D;  5HGQ A;  2RHS B;  5IWA L;  1SFO H;  2QK4 A;  5J22 A;  1RK5 A;  4IPC A;  1SYE A;  4KN7 C;  3RJ0 A;  1OXX K;  5IYD H;  5CV5 A;  5IYZ F;  4ETS A;  3KF8 A;  2CW8 A;  1PZJ D;  3KHL A;  1WYD A;  2LMC B;  2A19 A;  5K36 G;  1Q1B A;  5IGG A;  1W96 A;  4JI5 H;  4F7X A;  4QCL A;  4O42 A;  3E3X A;  2MJ8 A;  3I8Z A;  4LF5 L;  1IOW A;  4CGY B;  3T1Y L;  2JA7 H;  4B3R H;  3E9H A;  5KT4 A;  2B63 G;  1B4O A;  5DLQ E;  2K4K A;  2Z6K C;  3X3N A;  2IP4 A;  3FVQ A;  4DV0 Q;  5JVG 3;  2JA5 H;  3U9T A;  4EGJ A;  4QWD A;  4X3K A;  4N9T A;  3S17 H;  3E5N A;  2GPS A;  5A2Q W;  3Q0A A;  5D3I B;  4B3M H;  5FK9 C;  5K2M A;  3G6V A;  1XMO L;  4GC6 A;  4RMF A;  1LV9 A;  1YJN A;  2CVR A;  3DWA A;  1EEI D;  4ZAI A;  5KG7 A;  3MXP A;  5C0X J;  1L1O C;  1WTR A;  3KFU A;  1GSO A;  4ME6 A;  1U5K A;  4Z9C B;  3RV4 A;  4OX9 L;  2SEB D;  1WCM H;  4H44 C;  2NWG A;  4R4I A;  4X62 L;  3PF4 A;  1GM5 A;  1OO9 B;  5E4W C;  2AWO A;  2WE6 A;  1Q46 A;  1GSA A;  3K7U C;  3CQZ H;  2BR0 A;  4DV7 H;  3VPC A;  1V51 A;  3S2H H;  2QKI C;  3FKI B;  3GDE A;  4FDB A;  5KFO A;  2IWH A;  1EQV A;  5KT3 A;  3MR6 A;  5KFG A;  1I50 B;  4JBJ A;  5L1J A;  1IZ6 A;  2WV6 D;  4NLG A;  4HSV A;  3C2P A;  3FDT A;  1SMY C;  4JBW A;  2VB3 X;  1JE4 A;  2E8G A;  4JI0 L;  5D1O B;  2ENB A;  5C4Z A;  2F0H A;  2RDI A;  2XGP A;  4FF1 A;  4IUT A;  1LTI D;  3HOY H;  1K83 H;  1N32 Q;  4OX9 H;  3MAQ A;  1IKL A;  4XQJ A;  2W6Z A;  4K5X A;  1EY7 A;  3TME A;  2F0Q A;  5DLF A;  1PYS B;  3CC2 A;  2FMA A;  3CCS A;  4IR1 A;  2VQF L;  4GOP C;  2EYO A;  4B3M L;  2ASB A;  4DV5 H;  4IZO A;  4ECR A;  3ND8 A;  4RH6 A;  1LTT D;  1SXT A;  1P8L A;  3TP7 A;  4LNQ A;  3HOU B;  4BY7 G;  3A54 A;  1RKN A;  3BDC A;  4ECU A;  1UWV A;  2B3G A;  1XNQ L;  1SNP A;  2CZG A;  1MI2 A;  1PH9 A;  4KTA A;  2R7Z H;  4XQQ A;  3M4O H;  2J6U A;  1MGS A;  3JSL A;  1WH2 A;  4J9Q A;  4KD4 A;  4JI5 L;  2F0G A;  4ED2 A;  3H3V H;  3P1H A;  2YW2 A;  4ZKB B;  1HZC A;  2Z6K A;  2IX0 A;  2IW3 A;  1RTO A;  2FJ2 A;  1GUO A;  1GUW A;  1WOC A;  3FPU B;  5KFF A;  4DAY A;  3DEO A;  4LUV A;  4NXM Q;  1F77 A;  2R93 A;  2XWB B;  1TWH A;  1CTM A;  5IWA Q;  4LF7 H;  2DJF C;  2W70 A;  1RL2 A;  4UFZ A;  1LTB D;  3EVQ A;  3NSW A;  3RZO B;  1L1O A;  1PH7 A;  3HOY G;  4FM9 A;  1SNM A;  4JV0 A;  3EQL C;  1RTN A;  1DM0 B;  1Q86 C;  4B3S Q;  1KTK A;  2GA4 B;  1G29 1;  2EY1 A;  4WJW A;  3W2D A;  4FBU A;  5J2U F;  4EX5 A;  1B70 B;  1HZB A;  4AQY L;  1OXV A;  2HCI A;  1S03 G;  3J81 j;  1VBG A;  5JPM C;  3H4D A;  2W9C A;  1KQS A;  1I7N A;  4JI2 H;  4JI7 Q;  2XGQ A;  2JA6 B;  3MXN B;  1UEA B;  4A93 B;  1D2B A;  4KKT A;  4LH7 A;  4LUO A;  3GTM B;  1YVC A;  4B3R Q;  4QMG A;  4BA1 I;  4B3T H;  4EVO A;  1KEE A;  1XMO Q;  2ES2 A;  1BDO A;  2JEF A;  1BNZ A;  2F0V A;  3STB D;  4LF8 Q;  2PO4 A;  3D6W A;  4KV6 A;  3E6Z X;  1X3E A;  5T1I A;  2W9B B;  3CRL C;  1E1T A;  1G51 A;  1T5E A;  3C1E A;  3M3Y H;  3MWY W;  2R7F A;  1SNO A;  1JX4 A;  1HNX L;  2EYP A;  3R23 A;  2VPS A;  1I3Q A;  3GTK A;  4CJ1 B;  1JC7 A;  2AQ2 B;  5J1Z A;  2AUJ D;  4JYA L;  2F4V H;  2UU9 L;  4GS3 A;  3HOX H;  2R93 G;  1HPC A;  4DR6 L;  1QUQ B;  3GTP H;  4K0K H;  1HA5 A;  2OXP A;  4C2M H;  1ET9 A;  1VQO A;  4BXX H;  4O2A F;  2E2J H;  2ZXR A;  2F0N A;  1WFQ A;  2NVQ H;  1I6H B;  3J80 W;  2A73 B;  5JQW A;  3I91 A;  3GV7 B;  2HCC A;  1W6J A;  1EOT A;  1MZB A;  4JI8 Q;  1VQC A;  1A63 A;  1XNR H;  2QDB A;  1S5D D;  1GUN A;  1I6V C;  4NXN L;  1SDF A;  5KX5 F;  3QOL A;  2VQF Q;  4B3M Q;  3PZP A;  1IBK H;  2W6O A;  5LMN Q;  4RGO S;  4EFB A;  3I4N B;  3I4L A;  1SE2 A;  2EYF A;  5C5M A;  5FPO A;  4OEM B;  3S14 B;  2I5H A;  3RAX A;  2WAQ B;  2D0O A;  2DY8 A;  1MHW C;  4IOC A;  2ZTC A;  5FO8 B;  2W6Q A;  2BQR A;  1Y8O B;  4C5B A;  1K0R A;  1QE6 A;  4PDB A;  4O3Q A;  5E3F A;  5ELB A;  4CJ2 C;  2UXB L;  3H15 A;  5IT9 E;  2X69 A;  5IT9 c;  4J9K A;  3P7J A;  5GAH C;  5M3F G;  4NPS A;  4R4T A;  4A3E H;  4PZ7 A;  3FP9 A;  3C0F B;  3ERO A;  2Y0S E;  5KG1 A;  1STA A;  1IBL Q;  2WP8 J;  1I94 Q;  1E4E A;  3PW7 A;  4J1M A;  1HNW L;  1I5F A;  2PI2 E;  5DG8 A;  1MJE A;  5LHY 1;  2JEI A;  2GN5 A;  1E2W A;  2YYZ A;  2L15 A;  5KRU A;  3MFH A;  2R61 A;  1PH8 A;  4NKL A;  3K5L A;  1G2T A;  4X66 H;  4JV5 Q;  5KND A;  4B3S L;  1WTH A;  4DV5 L;  1VAJ A;  3BAB A;  2HIX A;  4QUF A;  4DL3 A;  4JVZ A;  4GOP B;  5F9N A;  2R93 B;  1A6X A;  1GD7 A;  3R8B A;  2I0Q A;  2JA5 B;  2NVX B;  2F0U A;  2RCN A;  3RF2 A;  3NP8 A;  3ER0 A;  3MHB A;  1UNN C;  1GJX A;  1O80 A;  2D2C C;  1K9M C;  5EJW A;  4RHS A;  2ZXP A;  5C4X B;  1CS0 A;  4P72 A;  4C5A A;  3BQ2 A;  3PVX A;  4B3R L;  4H13 C;  4JI1 L;  1JIH A;  4DL4 A;  2UVU A;  1QG7 A;  2C28 A;  2L9H A;  4BY1 G;  2PZW A;  1AN8 A;  2F0M A;  3WWV A;  5EWG A;  2UVV A;  2YU9 H;  5M3F B;  1VQB A;  1DGS A;  3J81 L;  3I3C A;  3M7G A;  3NE5 B;  4DL6 A;  1I4R A;  1NY4 A;  3S1R B;  2EXZ A;  4YWK A;  2AGQ A;  1Y1W G;  4QWA A;  4A3J G;  2V4R A;  1CQI B;  3WNZ A;  1C4Q A;  4O3R A;  4C3I H;  2F0T A;  2JYO A;  2OTL A;  3S16 H;  1H9S B;  1GVP A;  5D8D A;  2DPI A;  5DG7 A;  1Z47 A;  4DXF A;  4DUY Q;  4MHE A;  1WTP A;  3NEN A;  5T1G A;  3E9I A;  4FXD A;  2ZT9 C;  3PQI A;  2FP4 B;  1WCM B;  4UAI A;  3GID A;  2L1B A;  3N41 B;  1PFS A;  3GTM H;  3RAQ A;  3A0J A;  1TWA A;  3HOV B;  4AQY H;  3IFD A;  1GHK A;  2E5L H;  1VQE A;  4Y8V B;  4R7R A;  3VYR A;  1VMP A;  1I4X A;  2F0W A;  3K7A H;  2R8K A;  2R8G A;  1TWG B;  5D14 A;  5KYI A;  1LAC A;  5I9O A;  1XYI A;  3QIA A;  5E4X A;  4LF4 L;  3S17 B;  1A0I A;  1AEX A;  2IY5 B;  3M9M B;  2KQ3 A;  3ULL A;  3DLL A;  1PDQ A;  3RFC A;  5KFP A;  1ENF A;  3AFQ A;  3KUP A;  4NXN Q;  3PW0 A;  5C3X A;  5KFB A;  3HP3 A;  1LTS D;  4KHZ A;  3RUZ A;  3OUZ A;  2AU0 A;  1X3G A;  3UDX A;  1HUN A;  3KAL A;  3KLR A;  3R5H A;  1S0N A;  3JAM E;  2AGP A;  4TKO B;  4OIK A;  1WTO A;  3W1B A;  1TS2 A;  3I4O A;  1C0A A;  1TAE A;  5HBR B;  2KEE A;  2Z0S A;  3GIL A;  4LF5 Q;  1SYF A;  2PZU A;  2NB0 A;  1QVC A;  1J8I A;  3T1Y Q;  2B2W C;  3TRE A;  1A62 A;  2UUB H;  5EBC A;  4ODG A;  1Y1V B;  3QO2 A;  2RGV A;  4L5T A;  1KLU D;  1KC8 C;  5NUC A;  3CPW A;  2IHF A;  1KXL A;  1KRT A;  4EGQ A;  1Q12 A;  2KBN A;  5GAD C;  1RYS A;  3SGI A;  1SFO B;  4OIJ A;  1PZK D;  1PRT F;  2AMC B;  1QNU A;  3HOU H;  1EY9 A;  3BS1 A;  1S5E D;  4DR5 L;  3J81 c;  5IP9 H;  1HJP A;  1PMR A;  2KVM A;  5EPJ A;  1BNC A;  1EIY B;  2MFI A;  1IBL L;  1TY2 A;  2AKW B;  4BY1 H;  1H9M A;  1TWG H;  4OXP A;  3T5J A;  1V8Q A;  3GTK H;  1HR0 H;  1HCZ A;  2W9A A;  1R9T H;  2KHI A;  3OSP A;  1Y1W B;  2K7V A;  1SYC A;  4G7O C;  1DV2 A;  4C3J G;  2I5L X;  1TWH B;  2MP1 A;  4OO1 H;  3PCO B;  5EKI A;  1BXR A;  2X6L A;  1S5C D;  4RZR A;  3G6E A;  2C00 A;  2DIK A;  1SYG A;  3ERS X;  2NZH A;  3OIQ A;  3M85 A;  3T5H A;  4X3U A;  2NVX A;  3A5Z B;  1HUM A;  2ASJ A;  4B9W A;  2P0A A;  1D5M C;  3GTL A;  1HQM C;  5T14 A;  4ED6 A;  3VPB A;  1E7Z A;  3PIP 3;  4RUA A;  3T1H H;  1CA5 A;  1SYD A;  4HMI A;  2EY5 A;  4DV1 L;  1STE A;  1DIK A;  1C9O A;  4DN4 M;  5FKA C;  4P71 A;  4DR7 Q;  4BWS C;  4N9P A;  1OXU A;  4Y7N B;  5C3E B;  3E0E A;  1JCK B;  3KF6 B;  4UCR A;  4BWG B;  3GTL B;  4UCO A;  1RIP A;  1YIJ A;  4AYB A;  2CWA A;  3NWS A;  3GV5 B;  3CC7 A;  3RNU A;  2WAQ E;  1BBU A;  5KFZ A;  5KFW A;  1TA8 A;  5DQG A;  2FPP B;  5EDW A;  1VQI A;  1B2T A;  1DXM A;  2I8C A;  4G7H C;  4LSA A;  3EPG A;  1EL0 A;  1KJJ A;  1L0X B;  1XPU A;  4RAZ A;  2B2U A;  2F0K A;  3PR5 B;  4J15 A;  1OXT A;  1F2L A;  3PUW A;  1TS5 A;  4Y52 H;  2IMW P;  4IUU A;  2HVR A;  1KAB A;  1I6U A;  1KDC A;  4DR2 Q;  1CQV A;  3G71 A;  3VA7 A;  1PH1 A;  1PXU A;  2RDF A;  3D3R A;  1J5E L;  1JKJ B;  4ED8 A;  2JE6 I;  1RD9 D;  2ZDH A;  1V43 A;  1E24 A;  2F0F A;  2IPK D;  2YTY A;  4JI8 H;  4K0K L;  3QZ7 A;  3KBX A;  2R7Z A;  1KRS A;  1L0Y B;  5EKL A;  4C56 C;  3HOW H;  3HOU G;  2AGO A;  4DNI A;  4QY7 A;  5CV8 A;  3K59 A;  5E1F A;  1U4P A;  3V4Z A;  2N49 A;  2FKL A;  4QB4 A;  1STG A;  4UCV A;  1FYC A;  3LWB A;  5CC4 A;  3Q24 A;  3R5X A;  4IFD G;  5ELF A;  3T16 A;  2W57 A;  1Y8P B;  3D6C A;  5D3D A;  4GLX A;  3M3Y B;  1SEI A;  3R93 A;  4I55 F;  2UUB L;  2V5A A;  3G6Y A;  4EGV A;  3K80 C;  1YHB A;  3CQZ B;  1EZ1 A;  5KG4 A;  4IAJ A;  3Q8D A;  4A93 G;  3EFX D;  5EOY A;  5C0X I;  5DM7 3;  3TII A;  1H9J A;  2NVT B;  5A2Q E;  3UE0 A;  2G9H D;  2V4Q A;  5JJZ A;  3CP0 A;  4PG3 A;  4AYB G;  3CHB D;  2KCC A;  5KFH A;  3BYT B;  4JPB W;  1W3S A;  2JA9 A;  4AH6 A;  2FE3 A;  5M3M H;  2UUC Q;  1A3U A;  2VL6 A;  1U4L A;  1Y14 B;  4IPH A;  4YCV A;  4LF8 L;  1JJG A;  1HR0 L;  1NUC A;  2E5L L;  3Q2O A;  1I4H A;  4A3I B;  3NBH A;  1C8C A;  1WCM A;  3LWU A;  4H0L C;  5KFJ A;  1S9F A;  1IW7 C;  1CUK A;  3HGB A;  1CI3 M;  3VR5 A;  1VQJ A;  4IUQ A;  1N32 H;  3F2C A;  1Q90 A;  4JYA Q;  1VQ7 A;  4TQU S;  3RZO H;  4YHH L;  3HOW G;  4O3N A;  3GQC A;  5JAV A;  1RYR A;  2RVL A;  4GC7 A;  4DR7 H;  5A2Q L;  3MXN A;  4Q5V A;  2EYM A;  4DNR B;  2F0L A;  2YZG A;  1RF2 D;  5BN3 A;  1A15 A;  1ASY A;  1TWG A;  2X6G A;  3JAM W;  2ZM6 Q;  3S15 B;  3J81 W;  3LX0 A;  4MV4 A;  1LM0 A;  2K6A A;  4DL7 A;  2PNH A;  4XIG S;  1DV1 A;  5EQ0 A;  3H3V C;  1AP0 A;  5JVL A;  1B6S A;  1CZG A;  1K3B C;  4KMU C;  5H80 A;  1EIH A;  2OF1 A;  2Z9H A;  4DV7 Q;  1JWS D;  5J2T F;  3C46 A;  2ZJP A;  3K7A B;  3EBE A;  3IFT A;  2QA4 A;  3J81 i;  2I46 A;  3G7L A;  2UXD Q;  2DJG C;  2GVB A;  3OWF A;  1GUG A;  2HT1 A;  3PIO 3;  2HJW A;  5HY6 A;  1E4G T;  5L9X A;  4M8A A;  5E7N A;  1GYF A;  1P16 A;  2AHO B;  1XX8 A;  3MR5 A;  1EWI A;  3T5K A;  1SE8 A;  1MBY A;  3UQ8 A;  4ZCK A;  3HFZ B;  4EYI B;  2UVR A;  4Q44 A;  4UPA A;  1DJR D;  2DZD A;  4ECV A;  1F2Z A;  1GO3 E;  4X64 L;  1IYU A;  1I3Q B;  2VA2 A;  5FJ8 H;  4QW9 A;  5L1I A;  4DUZ H;  1VBH A;  5DLG A;  2SCU B;  4E6I A;  1TR5 A;  3TZD A;  3E0J A;  3A8I E;  3F8N A;  3D0F A;  1ESR A;  1BO0 A;  1WJJ A;  2VUM G;  3EIV A;  1I4P A;  1NJI C;  3SR1 A;  5L37 A;  3S1Q H;  1V1P B;  2CH4 W;  1EUC B;  4DV2 Q;  4R8U A;  1KJI A;  2HVS A;  1E3P A;  4C3I B;  2E2I B;  3RR5 A;  3D4D A;  4ID6 A;  1A3V A;  2F0I A;  4LFB L;  2JA8 H;  4FNF A;  2WDT A;  2CWP A;  1I94 L;  1UC9 A;  2X0S A;  5BN5 A;  1CZW A;  2O5J C;  1PTO D;  4HYK A;  5M3F H;  4JCV E;  1ZYR D;  3M4I A;  2A68 D;  4X62 H;  3NQI A;  2TSS A;  4LW1 A;  2R7L A;  3VPD A;  2BQ3 A;  2WAQ A;  1WTX A;  3MJF A;  5KFL A;  1XPO A;  3NEM A;  2F3I A;  1PYB A;  4UP9 A;  1HNZ Q;  4GNX A;  3HS0 C;  2QDL A;  5KT7 A;  4TQS A;  2NVY B;  4GZY C;  4LFA Q;  1I50 A;  4LH6 A;  2ATL A;  4JW0 A;  1QNK A;  4A3M G;  4M7E A;  4IPD A;  4TVA B;  4TV8 F;  5M9O A;  2N3S A;  3MR3 A;  4P75 A;  4LMY A;  3VR6 A;  2K5Q A;  4C3H H;  2XCL A;  4IPG A;  1WTW A;  3R5F A;  2NN6 G;  4R4Q A;  4CJ0 B;  2UUC H;  4NP5 A;  5FO7 B;  2R3Z A;  2UUC L;  2JP1 A;  1PTO F;  3BJU A;  5C1P A;  4HAE A;  1II3 A;  2B63 A;  5J3B A;  1HR0 Q;  1L2Z A;  2AQ4 A;  3K5O A;  5KFU A;  2MCT A;  1BKB A;  3FMA A;  4JI4 Q;  2JEA I;  3GTQ H;  1BVS A;  4TRD A;  2DGY A;  1JJ2 A;  4O2B F;  1U0L A;  2ASD A;  3UE1 A;  1R4Q B;  2A74 C;  2B63 H;  2W7O A;  4QQB X;  2UXB H;  1PFM A;  4K14 A;  3LGJ A;  4LF9 Q;  4A3J H;  1RJP A;  2E76 C;  3L4J A;  2B2Y C;  1FVI A;  5ELO A;  3KAJ A;  5C5J A;  3WO0 A;  1EYA A;  3GV6 A;  4FXK C;  3Q8S B;  4YHH H;  1YNJ D;  2K50 A;  3DHQ A;  2O03 A;  3FKI H;  4MV1 A;  1AZQ A;  5IYD G;  4YJ2 F;  1W6K A;  3PW5 A;  4RCO A;  4X65 L;  1PVO A;  1T5X D;  2Z1C A;  5I9P A;  2CQY A;  4A93 H;  4S3S A;  4GKK Q;  4IRC A;  5C44 H;  1EQQ A;  3N43 B;  2L5T A;  3CCL A;  1B7Y B;  2ICE C;  2E2J B;  5KNB A;  4A3G H;  1DYQ A;  4QW8 A;  2VOB A;  3RBD A;  1FJG Q;  3L2P A;  4RAU C;  2I07 B;  5IGC A;  1PH3 A;  2I80 A;  1Y1W H;  4XYQ A;  3FEW X;  3N6X A;  4NB3 A;  3HOX G;  3CQZ A;  4FF2 A;  1VKZ A;  2W8K A;  1STY A;  1HTL D;  2VQE Q;  5FLX E;  3VR2 A;  3VA5 A;  1D1I A;  2R7M A;  4GLA C;  3PW2 A;  1LT4 D;  4DA2 A;  1N34 H;  4DR6 H;  2VS1 A;  2UXC H;  1VF7 A;  4TSS A;  3VDY A;  2EQS A;  2Y0S A;  4O3P A;  4DXG A;  2J4X A;  3CRK C;  1L0W A;  2R6F A;  4LF5 H;  2B2W A;  4DV6 L;  1GUT A;  1JOQ A;  4DR4 L;  2O2L D;  2Z8L A;  5ELE A;  5BMV F;  4DFA A;  2KEC A;  4BA2 I;  2UUA H;  5IP7 H;  3S2D B;  3GIP A;  1O7L A;  1X55 A;  3OSO A;  4A3D H;  4RUC A;  3RB6 A;  2NTT A;  3O13 A;  4IN3 A;  1NSN S;  5DNF A;  4LFC Q;  3A7A B;  4KY7 A;  4A3K G;  1STN A;  3GTO H;  2KCT A;  3GO5 A;  1QIL A;  5EZY F;  3NTI A;  4K6L A;  4GKJ Q;  4F50 A;  4DLK A;  4QWB A;  3GV3 A;  4IUV A;  3SHL A;  1IBM Q;  1Y1V A;  1WCM G;  2XTI A;  3U50 C;  5JEA H;  4HNT A;  4J9L A;  4EBD A;  4AQY Q;  4ALP A;  2Q8I B;  3CVZ A;  3KF8 B;  5IGB A;  4CDE C;  4JI2 L;  3TP5 A;  3AB9 A;  1IW7 D;  1V1Q A;  2KCM A;  4ZKC B;  3EJI A;  1T3N A;  2IHE A;  3GTO B;  3IG0 A;  2D62 A;  4QF4 A;  1M0T A;  3F1Z A;  3OPO A;  2XWJ B;  4DR1 H;  1SFO A;  1VQH A;  3QFF A;  3GIK A;  2C5C A;  4M1U B;  3JAM L;  2JEB I;  1SRU A;  2K52 A;  1K8G A;  4A3F B;  3RV3 A;  1MIU A;  3JSN A;  2PYK A;  2BE5 D;  2RSN A;  3FKI G;  1B33 N;  4I7H A;  1CFM A;  2VNU D;  3GTG A;  2CFM A;  5D1O A;  1AE2 A;  5I47 A;  3A55 A;  1VQA A;  5LL6 S;  3SK5 A;  3K81 C;  3MTS A;  4JI3 L;  3ULP A;  5IP7 G;  4EQN A;  3S16 B;  2KED A;  1TWA H;  4A76 A;  1UNS A;  3I4N G;  1F9P A;  3NPP A;  2DUD A;  4L5S A;  4F4Z A;  3AMU A;  2FLP A;  1BQQ T;  4K2K A;  2H1E A;  3J7Z C;  4LF6 Q;  2UU9 Q;  4DR6 Q;  1RK6 A;  1CK1 A;  1X56 A;  4YB8 B;  4Q43 A;  4O4I F;  3N52 A;  4MN3 A;  1CM9 A;  2B8F A;  4R1J A;  2KSW A;  5KG0 A;  1KJQ A;  2XIG A;  3RUP A;  2W8L A;  3T5L A;  5M5Y B;  3I4M H;  3X3M A;  4ECS A;  1ZHS A;  1STB A;  1VQL A;  1Z2N X;  4JI8 L;  2JA7 A;  1IL8 A;  2K5W A;  3Q6S A;  1IBK Q;  2VQF H;  2NN6 I;  5LMU Q;  2ZJT A;  4IFD H;  2Q2H A;  4FVM A;  2VY3 A;  3LML A;  4FO2 A;  1EYD A;  3MWE A;  2N78 A;  5KFA A;  4HNU A;  2EPB A;  4QGU A;  4RU9 A;  4ULL A;  3M9N B;  1O7Z A;  3EYY A;  3ITP A;  3N40 P;  4ZQ3 A;  1GKH A;  3J80 L;  2QCP X;  3ULJ A;  3S1Q B;  4ECW A;  3CCE A;  2WFW A;  1ILP A;  4ECX A;  2A1A A;  5LYJ F;  4HJ7 A;  2IX3 A;  3T1Y H;  4JOI A;  2H5X A;  3T13 A;  4EQ5 A;  3I55 A;  4QIW E;  4I7Z C;  5DGB A;  1Z7T A;  1SRO A;  5D1P A;  1EYG A;  3I4N H;  4CDF C;  4I4T F;  2F52 A;  4X3T A;  3S2H B;  4XYL B;  2YCH A;  1EEF D;  4K2L A;  1UE6 A;  3GQB A;  1OTC A;  4Q8E A;  3CD6 A;  1K8A C;  2XC9 A;  4DK3 C;  4XX0 B;  3MC0 B;  5KFX A;  2EYL A;  5LMN H;  1KNE A;  2FMM A;  3PO3 G;  1EZ6 A;  2NZO A;  2BDO A;  4HIM A;  4MIU A;  4DR3 Q;  2W6P A;  5CA0 F;  4DV4 H;  3F8T A;  4LFC H;  2E5L Q;  3OTO Q;  3OMC A;  2BA0 A;  3BZC A;  1N33 L;  1H95 A;  4OEL B;  3H09 A;  2EY6 A;  3PUX A;  2E2H B;  4XYM B;  1ZHQ A;  2V59 A;  1TXY A;  2R8H A;  4LF7 Q;  3MFI A;  2B29 A;  1B6R A;  4YAK B;  1FGU A;  4IFD I;  4GKJ H;  4YWM A;  4X66 Q;  2M00 A;  5BR8 H;  4JI0 Q;  1Q8K A;  1EQT A;  3H0G H;  2EYH A;  3K6O A;  4DAM A;  2YU9 A;  4JBM A;  2NVQ B;  3J80 i;  3GV8 B;  4POF A;  4Q0Y A;  2PW5 A;  1IBL H;  3F2D A;  2WB1 G;  1GXD C;  2UXD L;  1MSG A;  2RSO A;  3D4W A;  4A3I G;  1QB5 D;  4DUZ Q;  4NDX A;  4ME3 A;  1JMC A;  3IN5 A;  5G3L D;  5C44 G;  1VQN A;  1X32 A;  4LUZ A;  2NZ1 D;  3UFX B;  4DV3 Q;  4E4T A;  4X64 Q;  4CDD C;  5I4D A;  1DOK A;  2QYZ A;  1QVF A;  2FPI B;  1UE7 A;  4RNN A;  2EIF A;  5KFN A;  3K5H A;  4RAY A;  3GTJ A;  2L0C A;  5DG9 A;  3QG1 A;  2R86 A;  3L4K A;  2MNA A;  3NHH A;  1TY0 A;  2CHB D;  2YYA A;  4JV5 H;  3DXJ C;  4J9R A;  2NU8 B;  5KFD A;  4C1N I;  3OUU A;  3KJO A;  5CYU A;  1F9S A;  2OTJ A;  2AQ1 B;  5IOD A;  1BCP C;  3RN2 A;  4KJO A;  1B50 A;  2BOS A;  3FPP A;  2Y0S G;  3I7F A;  2V58 A;  3S9W A;  4LF4 Q;  1BBW A;  3J81 E;  5DQI A;  4RB3 C;  4X3S A;  3WOE A;  1ONL A;  4A3L G;  4MNO A;  4LFB Q;  4EFE A;  4QWC A;  2MUY A;  5KFT A;  5IY0 A;  1LTG D;  3V6K A;  4ZI7 F;  1HXY D;  1WR2 A;  1H9S A;  4QL5 A;  5DEH A;  1UE5 A;  5KFS A;  1HNW H;  2PMZ B;  4KHP H;  3RZD H;  3MEH A;  2YZM A;  3BAA A;  3U9S A;  1F9R A;  3M4Q A;  2F0S A;  4PMB A;  3K5I A;  3KYH C;  4MV7 A;  3UI2 A;  1SMX A;  1HNZ L;  3KJP A;  4WBN F;  3VYS A;  1N8R C;  3DWP A;  1NMF A;  3V96 A;  2HQE A;  5FPR A;  4KHV A;  5GRO A;  1ASZ A;  3L9A X;  3Q1K A;  4J9M A;  1DD2 A;  1RDP D;  4A3M B;  4CDC C;  3CF5 A;  1MKH A;  3NGD A;  2YTX A;  4IR9 A;  3S1M H;  1XWE A;  3DUZ A;  1I7L A;  4ZOL F;  4GN4 B;  5LMN W;  3GTM A;  5C0X H;  1PTO C;  3FRP B;  1ZET A;  2NBF A;  1XMQ L;  4ABN A;  4DR5 Q;  2YS6 A;  3W5O A;  3K0X A;  5CBE E;  3TP8 A;  1GOZ A;  4WRD A;  1TWC B;  2Y0S B;  4U68 A;  3SE0 A;  2EVB A;  4OWW B;  4P73 A;  5KT6 A;  4ZLT F;  4C2M A;  2R93 H;  2W9B A;  2JA7 G;  3I12 A;  1AH9 A;  1EHI A;  1HNX Q;  3CU7 A;  5C44 B;  3GTJ H;  2L4N A;  4CKC A;  5KT2 A;  1ILQ A;  5KFQ A;  1PYW D;  1M1K C;  5KFI A;  4QIW A;  2VZA A;  3A56 A;  3HKS A;  4WFN 3;  1EUD B;  2FJZ A;  4BBS B;  4YY3 L;  2LKV A;  4NW2 A;  1QUQ A;  4XYO A;  4HQ6 A;  3J7A 5;  1SR3 A;  2K04 A;  1C48 A;  2I87 A;  4YR2 A;  2R84 A;  4B3S H;  4X66 L;  3JZI A;  1E1O A;  3GTJ B;  4JI4 H;  3AU7 A;  1S5B D;  4IZ8 A;  1M7J A;  2OT2 A;  3PW4 A;  1FNV A;  1O7I A;  4JYA H;  1LTR D;  5CV4 A;  1N36 Q;  5LP6 F;  4GKK L;  5KYL A;  2WB1 B;  1I50 H;  4IUN A;  4KHP Q;  4ED7 A;  1EQR A;  1U4M A;  1SAP A;  4ZRZ A;  5EKK A;  4B3T Q;  5C4H A;  2QEJ C;  3SI8 A;  4C3H B;  4LFB H;  4DKA C;  5KFK A;  2XGT A;  4L1K A;  1PRT C;  1TWF H;  3F2B A;  4MTD A;  5JVH 3;  4DL5 A;  1SYB A;  2RCF A;  2W6N A;  2LXJ A;  5M5Y H;  3BVZ A;  4OO1 G;  2VQE L;  1JJC B;  2W9C B;  2FLL A;  4BS9 A;  3F2U A;  1HNZ H;  4RA8 A;  3OIP A;  1S3O A;  3IL8 A;  1I6H H;  1JDE A;  1N9W A;  3KTM A;  3T51 B;  2KUM A;  1Y1V H;  4OHJ A;  4LAA A;  2CW7 A;  1Q3L A;  5LOV F;  1IL2 A;  1HTP A;  4UCT A;  5IT9 L;  3BQ0 A;  1C7Y A;  3OYY A;  3LP8 A;  1PH2 A;  1SNQ A;  4Y7N H;  3SE7 A;  1VQF A;  4X64 H;  3J80 E;  2GLT A;  2VUM A;  5AJ3 L;  1K8M A;  4A3E B;  1B53 A;  4RB1 A;  1A2T A;  2Q2U A;  5LL6 b;  2HDL A;  2ZTD A;  5FLX L;  2EY2 A;  3MWM A;  1S0O A;  1M8A A;  1CKM A;  1A8V A;  3HEJ A;  4DU9 A;  5LXT F;  5EPK A;  2B2U C;  4RNO A;  1AUX A;  3CCJ A;  2SNM A;  2MHV A;  1C30 A;  5M5X H;  1W2B A;  3WDN A;  2R7D A;  3AFP A;  3Q22 A;  4GNX B;  1XPR A;  1KJ8 A;  4CC6 A;  5CMD A;  4JG2 A;  4PZ6 A;  2F3V A;  3RLN A;  2RDH A;  2WAC A;  1M6V A;  3N6R A;  1SLJ A;  3NBH B;  4DR2 H; 
#chains in the Genus database with same CATH homology
 1B70 B;  1HZB A;  3CCR A;  4AQY L;  1XPO A;  1OXV A;  2F3I A;  1PYB A;  3NEM A;  4UP9 A;  1HNZ Q;  3J81 j;  3CCU A;  4GNX A;  3M9B A;  3TS2 A;  1KQS A;  4YCW A;  4JI7 Q;  3OW2 A;  5GAE C;  1JE5 A;  3MXN B;  3B6Y A;  4LFA Q;  3PIO A;  4DV0 L;  4A3M G;  4IPD A;  4TVA B;  4A75 A;  4LUO A;  2N3S A;  1YVC A;  3I2Z A;  4P75 A;  4JI1 Q;  4BA1 I;  4B3R Q;  1PHJ A;  4C3H H;  1JT8 A;  4IPG A;  2NN6 G;  4R4Q A;  1XMO Q;  2V1C C;  2ES2 A;  1XMQ Q;  3RLF A;  2UUC L;  1QVG A;  5H1S E;  3BJU A;  3AQQ A;  3STB D;  4LF8 Q;  1PH6 A;  2PMZ E;  5J3B A;  1HR0 Q;  4OX9 Q;  1K3R A;  1X3E A;  3IRB A;  1E1T A;  1G51 A;  2C35 B;  3M3Y H;  1QZG A;  2R7F A;  3T1H L;  1BKB A;  1WI5 A;  1HNX L;  1G6P A;  4JI4 Q;  2JEA I;  3GTQ H;  1BVS A;  2DGY A;  1JJ2 A;  1U0L A;  3UE1 A;  2B63 H;  4JYA L;  4H02 A;  5M5W H;  4QQB X;  1KIX A;  2UU9 L;  3A74 A;  2HHH Q;  2MO1 A;  4GS3 A;  3HOX H;  2R93 G;  1YHQ A;  4DR6 L;  1QUQ B;  3LGJ A;  4LF9 Q;  4A3J H;  3GTP H;  4BBS G;  4C2M H;  5BR8 Q;  2K75 A;  1Q82 C;  1VQO A;  2ZM6 L;  1V9P A;  1AE3 A;  5M3M G;  4BXX H;  4A3C G;  1FVI A;  5ELO A;  5ELN A;  2E2J H;  1QZH A;  1KHI A;  1WFQ A;  2NVQ H;  2ALY B;  2K50 A;  1XJV A;  2VW9 A;  3FKI H;  4DV4 L;  5IYD G;  4A3L H;  4MZ9 A;  1YIT A;  4APV A;  4X65 L;  1PVO A;  5C0X G;  2JJQ A;  5JJL A;  1N36 L;  4A93 H;  4JI8 Q;  1VQC A;  4GKK Q;  1A63 A;  5C44 H;  1EQQ A;  1KL9 A;  3CCL A;  4NXN L;  2VQF Q;  1B7Y B;  5IYB H;  4B3M Q;  4MTN A;  3PUZ A;  4A3G H;  5LMN Q;  1LUZ A;  1X54 A;  4GLV B;  1FJG Q;  3L2P A;  3CMA A;  4YWL A;  1VQP A;  2OWO A;  1PH3 A;  1X3F A;  3J80 c;  1Y1W H;  1XNQ Q;  4NB3 A;  3HOX G;  2I5H A;  3U4V A;  2D0O A;  1YNX A;  3JAM i;  4IOC A;  3S15 H;  2VQE Q;  2ZTC A;  3KF6 A;  2R92 G;  2UUA Q;  3KDF A;  1NE3 A;  1K0R A;  2PQA B;  4GLA C;  2BH2 A;  4JI5 Q;  2VUM H;  4HIO A;  3TRZ A;  3H3V I;  2VS1 A;  1VQ4 A;  4HJA A;  2UXB L;  4HJ5 A;  3H15 A;  3VDY A;  2EQS A;  2ZTE A;  5IT9 c;  5GAH C;  5M3F G;  1L0W A;  2A8V A;  4OO1 I;  4A3I H;  4NPS A;  4R4T A;  3BU2 A;  4DV6 L;  4A3E H;  4A3B G;  1LYL A;  4DV2 L;  2FXQ A;  4DR4 L;  4PZ7 A;  4BA2 I;  3FP9 A;  1CKO A;  5IP7 H;  1X55 A;  2Y0S E;  4R4C A;  2BA1 A;  1IBL Q;  4A3D H;  2WP8 J;  1YEZ A;  1I94 Q;  3PGZ A;  1HNW L;  4DR3 L;  1I5F A;  2PI2 E;  3L0O A;  1MJE A;  4LFC Q;  4A3K G;  4O0A A;  2GN5 A;  4OON A;  2EXD A;  3GTO H;  2KCT A;  2YYZ A;  2L15 A;  3GO5 A;  4JOI C;  1PH8 A;  3GTG H;  4A3K H;  4JV5 Q;  4B3S L;  2ID0 A;  4GKJ Q;  2OQK A;  1EIF A;  3M4P A;  4BBR G;  4DV5 L;  3STB C;  3EN2 A;  1IBM Q;  1WCM G;  2XTI A;  3U50 C;  3HOV G;  2HIX A;  4YCU A;  1T9H A;  4AQY Q;  1B8A A;  3KOJ A;  4ALP A;  4LF7 L;  2K5V A;  3NEL A;  3KF8 B;  4GOP B;  4JI2 L;  1GD7 A;  5FJ8 G;  2I0Q A;  3CW2 C;  2IX1 A;  1VCI A;  1TWC H;  1V1Q A;  2KCM A;  2RCN A;  2PI2 A;  3CCM A;  3ER0 A;  4UP8 A;  4JI7 L;  2IHE A;  4R4O A;  4LFA L;  2D62 A;  1K9M C;  3KDF B;  2WAQ G;  3F1Z A;  4A3B H;  4P72 A;  4B3R L;  1VQH A;  4JI1 L;  3RLO A;  2JA8 G;  3K8A A;  4WJ3 M;  1N34 Q;  2UXC Q;  3S24 A;  4BY1 G;  2JA5 G;  2I5M X;  2JEB I;  1SRU A;  2K52 A;  1K8G A;  3WWV A;  1MIU A;  3G4S A;  2YU9 H;  1VQB A;  1DGS A;  3AYH B;  4DR7 L;  3FKI G;  2RHQ B;  4DUZ L;  1VQG A;  1NY4 A;  4A4I A;  4PZ8 A;  1XTD A;  3PV0 A;  2GVA A;  3PSI A;  2CFM A;  4YWK A;  1AE2 A;  1Y1W G;  1JB7 A;  2VNU D;  4A3J G;  2E2I H;  1VQA A;  2Q2I A;  2D0P A;  2LSS A;  3T1H Q;  4C3I H;  3K81 C;  4JI3 L;  4A3F G;  2OTL A;  1XNR L;  3ULP A;  3PUV A;  5IP7 G;  1PH5 A;  4JI4 L;  2AWN A;  3S16 H;  1GVP A;  1TWA H;  3RN5 A;  4A76 A;  1YJW A;  2ATW A;  3I4N G;  1KAW A;  1Z47 A;  2DUD A;  4L5S A;  1NBW A;  4DUY Q;  1I3Q H;  3J7Z C;  3S1R H;  3GD7 A;  3NEN A;  2UU9 Q;  5IYB G;  2HHH L;  3CCQ A;  4LF6 Q;  2JA6 H;  4DR6 Q;  3E9I A;  1LTL A;  4PMW A;  1CSQ A;  1X56 A;  4GN3 B;  4LF9 L;  2BH8 A;  5BR8 L;  1X6O A;  1PFS A;  3TS0 A;  3GTM H;  4R1J A;  4HJ9 A;  4OWX B;  3A0J A;  1HZA A;  4O2D A;  2R92 H;  5JJK A;  4DR2 L;  3M7N A;  3I4M H;  1VQE A;  4P74 A;  4DV4 Q;  1NMG A;  1CKN B;  3K7A H;  4X65 Q;  4LF4 L;  2NVT H;  1VQL A;  1PH4 A;  4K0K Q;  1A0I A;  4JI8 L;  2IY5 B;  4UP7 A;  1NTG A;  3ULL A;  3DLL A;  4A3G G;  4DK6 C;  1IBK Q;  3AFQ A;  1YBY A;  4NXN Q;  1VQ6 A;  3MEF A;  2NN6 I;  5LMU Q;  3GTL H;  4KHZ A;  2Q2H A;  1X3G A;  2VY3 A;  3UDX A;  5LMN L;  2N78 A;  3PF5 A;  1FJG L;  2QGQ A;  4QGU A;  1Q81 C;  2CCZ A;  4UY8 C;  1GKH A;  3W1B A;  3I4O A;  3ULJ A;  4IFD J;  1C0A A;  3CCE A;  2Z0S A;  1X9N A;  4LF5 Q;  2UUB Q;  2WFW A;  3CPF A;  1QVC A;  3BZK A;  1K73 C;  2A1A A;  4L5Q A;  3T1Y Q;  4GOP A;  3TRE A;  4HJ7 A;  4DR1 Q;  1A62 A;  4JOI A;  2H5X A;  4EQ5 A;  1HR0 W;  3I55 A;  4QIW E;  2PQA A;  3HKZ G;  1SRO A;  4L5T A;  3CCV A;  1D8L A;  4A3F H;  1EYG A;  3I4N H;  1KC8 C;  4BBS H;  3CPW A;  2F52 A;  2IHF A;  3ICE A;  1KRT A;  2UXB Q;  1KXL A;  1Q12 A;  1J6Q A;  2KBN A;  5GAD C;  4KI0 A;  3SGI A;  2AMC B;  1UE6 A;  1OTC A;  4DV6 Q;  2OQ0 A;  5FLM H;  4DR4 Q;  3HOU H;  5C4X G;  4DR5 L;  3CD6 A;  3J81 c;  5C4J H;  5IP9 H;  1K8A C;  4LWC A;  1HJP A;  1UEB A;  4GN5 A;  1CKN A;  4DK3 C;  2MFI A;  1EIY B;  2JQO A;  1IBL L;  2MQH A;  4IOA A;  2AKW B;  3PO3 G;  4BY1 H;  1TWG H;  2NZO A;  4OXP A;  4HIM A;  4DR3 Q;  2JA6 G;  1PV4 A;  3AEV A;  1HZ9 A;  3F8T A;  2E5L Q;  4LFC L;  1R9T H;  3OTO Q;  1YI2 A;  3UDI A;  3S14 H;  2BA0 A;  2KHI A;  3BZC A;  1N33 L;  4AIM A;  4X62 Q;  1H95 A;  2I5L X;  5IYC H;  4JBK A;  1VQ9 A;  4JV5 L;  3PCO B;  3PUX A;  4DV5 Q;  1IBM L;  4YHH Q;  4BY7 H;  5GQO A;  1TXY A;  4YY3 Q;  3G6E A;  2F4V L;  4LF7 Q;  1OXS C;  4A3M H;  3ERS X;  2NZH A;  1IXR A;  4JI2 Q;  4GNX C;  3M85 A;  2B29 A;  5C3E H;  1FGU A;  4IFD I;  3A5Z B;  3PUY A;  2R6G A;  4YWM A;  3TQY A;  5IP9 G;  4X66 Q;  1PA6 A;  4JI6 L;  4JI0 Q;  4HIK A;  1L1O B;  1Q8K A;  2K14 A;  1E7Z A;  3H0G H;  4DAM A;  4JBM A;  1EUJ A;  3UDF A;  4DV7 L;  4DV1 L;  3J80 i;  1N32 L;  2HIV A;  4POF A;  1C9O A;  1Z9F A;  1N34 L;  4IJH A;  3F2D A;  4POG A;  2UXC L;  2WB1 G;  3JAM c;  4A3D G;  4X6A H;  3CC4 A;  2UXD L;  2QEX A;  4P71 A;  4KHP L;  4A3I G;  1HH2 P;  4DAY B;  4DR7 Q;  2K5H A;  1X65 A;  2MO0 A;  1OXU A;  4ME3 A;  4DUZ Q;  3E0E A;  4B3T L;  1L2F A;  1JMC A;  3KF6 B;  2R7Z G;  5C44 G;  1VQN A;  1Q1E A;  2HQL A;  1RIP A;  3KLW A;  1YIJ A;  4JI3 Q;  1XNR Q;  3JC6 6;  4LUZ A;  3FHW A;  1D7Q A;  2CWA A;  5JEA G;  3HOV H;  3CC7 A;  4HJ8 A;  4DV3 Q;  2WAQ E;  3RNU A;  5JEA J;  4X64 Q;  1BBU A;  5C3E G;  5EAY A;  2NVX H;  4DUY L;  1QVF A;  3I56 A;  1UE7 A;  4LF6 L;  1TWH H;  1VQI A;  2EIF A;  5C4X H;  1VQM A;  3DM3 A;  1XPU A;  2LXK A;  2MNA A;  1IYJ B;  4J15 A;  1OXT A;  2ZJQ A;  3PUW A;  3HOZ H;  4Y52 H;  5IYC G;  3KJO A;  2CKZ B;  2OTJ A;  2N8N A;  4DR2 Q;  1PH1 A;  3G71 A;  1J5E L;  1YHA A;  3RN2 A;  2IT1 A;  2JE6 I;  5AJ3 Q;  2Y0S G;  1V43 A;  1E24 A;  2NVY H;  3I7F A;  4NXM L;  4WJ4 A;  3D31 A;  2YTY A;  4LF4 Q;  1BBW A;  1S40 A;  4K0K L;  5HGQ A;  2RHS B;  5IWA L;  1SFO H;  1KRS A;  1MJC A;  4MNO A;  4A3L G;  4LFB Q;  3HOW H;  5IY0 A;  3HOU G;  4IPC A;  1IBK L;  4QL5 A;  5GAG C;  1OXX K;  1UE5 A;  4DNI A;  5LMU L;  1SN8 A;  5IYD H;  4QY7 A;  2YV5 A;  3RZD H;  3CME A;  2N49 A;  1WYD A;  5FLM G;  2A19 A;  5K36 G;  3M4Q A;  3L7Z C;  4IFD G;  1Q1B A;  4A3C H;  3UDG A;  4GLX A;  2K5N A;  3KYH C;  1EFW A;  4LF5 L;  2UUB L;  1SMX A;  1HNZ L;  3KJP A;  3T1Y L;  2JA7 H;  1N8R C;  3K80 C;  1YHB A;  3E9H A;  4DPG A;  1NMF A;  4DR1 L;  3Q8D A;  5GRO A;  1ASZ A;  2YTV A;  2B63 G;  4RG1 A;  2Q2T A;  4A93 G;  5DLQ E;  1MKH A;  2Z6K C;  2K4K A;  3CF5 A;  2YTX A;  3I4M G;  5C0X I;  4DV0 Q;  3W1G A;  2JA5 H;  3S1M H;  4GN4 B;  3UE0 A;  5LMN W;  3S17 H;  3CP0 A;  4PG3 A;  4AYB G;  1XMO L;  3S1N H;  1W3S A;  2JA9 A;  4RMF A;  4AH6 A;  1YJN A;  3PIP A;  4DR5 Q;  1XMQ L;  3W5O A;  5M3M H;  2UUC Q;  3K0X A;  4L5R C;  5C0X J;  1L1O C;  3KFU A;  2VL6 A;  1Y14 B;  4IPH A;  4YCV A;  3A5U A;  1U5K A;  4LF8 L;  1JJG A;  1HR0 L;  4P73 A;  1VQK A;  4OX9 L;  4OWW B;  3GTK H;  2R93 H;  2JA7 G;  1AH9 A;  2E5L L;  2KEN A;  3OTO L;  2JK8 A;  1WCM H;  1E22 A;  1VS0 A;  1HNX Q;  3HKZ E;  4BBR H;  4R4I A;  3GTJ H;  4X62 L;  1N33 Q;  3PF4 A;  1GM5 A;  2AWO A;  1CUK A;  1Q46 A;  1VQJ A;  3TEH B;  3S2D H;  3K7U C;  3F2C A;  3CQZ H;  4JYA Q;  1M1K C;  1VQ7 A;  4TQU S;  3RZO H;  4YHH L;  3HOW G;  2VZA A;  3S2H H;  3HKS A;  3GDE A;  4FDB A;  4AYB E;  4YY3 L;  2F4V Q;  2KHJ A;  4JBJ A;  1IZ6 A;  1QUQ A;  4JC0 A;  1SR3 A;  1ASY A;  3J7A 5;  2ZM6 Q;  4JBW A;  1KD1 C;  4X66 L;  2E8G A;  4JI6 Q;  1LM0 A;  1E1O A;  4JI0 L;  2PNH A;  4XIG S;  4OWT B;  4A3E G;  1FL0 A;  2E2H H;  1O7I A;  4XTC S;  4DV7 Q;  4DV1 Q;  1K83 H;  3HOY H;  3HOZ G;  3PO2 G;  1N32 Q;  2ZJP A;  3EBE A;  2QA4 A;  1Q7Y C;  1N36 Q;  3J81 i;  2UXD Q;  4GKK L;  2GVB A;  3G48 A;  3H0G G;  1I50 H;  4KHP Q;  2HT1 A;  1EQR A;  5HY6 A;  3U4Z A;  1PYS B;  4IO9 A;  3CC2 A;  5E7N A;  3CCS A;  1P16 A;  2VQF L;  2AHO B;  2ZJR A;  1YZ6 A;  3ZJY C;  4GOP C;  1EWI A;  4B3M L;  4B3T Q;  2ASB A;  4KLK A;  1SE8 A;  4DKA C;  1P8L A;  4LNQ A;  3HFZ B;  2XGT A;  4BY7 G;  3F2B A;  1TWF H;  4UPA A;  1UWV A;  2B3G A;  1XNQ L;  2LXJ A;  4DV3 L;  1GO3 E;  5M5Y H;  4X64 L;  5FJ8 H;  1PH9 A;  1M90 C;  4OO1 G;  2VQE L;  1JJC B;  2R7Z H;  4C3J H;  3M4O H;  3CXC A;  1VQD A;  2OCE A;  2UUA L;  1S3O A;  2WB1 E;  1I6H H;  5JJI A;  1N9W A;  1CSP A;  4JI5 L;  1UE1 A;  3H3V H;  1Y1V H;  1IL2 A;  1HZC A;  2Z6K A;  3CAM A;  3D0F A;  2IX0 A;  5FLX c;  1C7Y A;  1WJJ A;  2VUM G;  3EIV A;  3OYY A;  1S72 A;  1NJI C;  3PO3 H;  1PH2 A;  4IJL A;  1J5E Q;  3S1Q H;  4Y7N H;  1VQF A;  1WOC A;  1EOV A;  4DV2 Q;  5AJ3 L;  1E3P A;  4NXM Q;  4LUV A;  1VQ8 A;  3RR5 A;  2Q2U A;  4BXX G;  2ZTD A;  1Y1V G;  5IWA Q;  4LFB L;  2JA8 H;  1A8V A;  1CKM A;  2CWP A;  1RL2 A;  1YJ9 A;  1I94 L;  1VQ5 A;  1HNW Q;  4HID A;  3CCJ A;  1L1O A;  1PH7 A;  3HOY G;  3PO2 H;  5IE8 A;  5M3F H;  5M5X H;  1W2B A;  2R7D A;  3AFP A;  4JCV E;  4GNX B;  1XPR A;  2RF4 A;  4JG2 A;  4QJF A;  4PZ6 A;  3RLN A;  1Q86 C;  3U58 A;  4B3S Q;  4GKJ L;  1G29 1;  4LW1 A;  2CQO A;  1SLJ A;  4EX5 A;  3NBH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...