4A3DG

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3dG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3dG01
3J80i 4YY3L 3RZOH 2RHQB 4LFAQ 1VQNA 5JEAJ 3LGJA 1B8AA 3K80C 5C44G 3OW2A 1E1OA 3AFQA 4X62L 3Q8DA 4X64Q 4DR4L 4A3GH 2QGQA 2NVQH 4X66Q 1HZBA 2JE6I 3PUYA 4JI1L 5M5XH 2VQEQ 4NXNQ 5LMUL 4DV6Q 1L1OC 2UXCQ 1VQMA 4IOCA 2ZTDA 3DLLA 1UEBA 4DAYB 1A8VA 4YCVA 3U50C 3S17H 2Z6KA 2V1CC 1YVCA 1HZCA 4DV0Q 2JA8G 4LFBQ 4A3EH 4JG2A 4IFDG 1KAWA 2CFMA 4DUZQ 2AWOA 1MKHA 2Q2HA 4POFA 2E2IH 4JI6Q 3PO3G 2ZJRA 4BY1G 2NZHA 4JI7L 1WI5A 1YEZA 2UUCL 1XMQQ 2ATWA 3F2DA 4A3BH 1N36L 1IL2A 3CCQA 2NN6G 4A3CG 4LFCQ 4LUVA 1VQPA 3CCEA 1OXSC 1TXYA 2C35B 1VQKA 4IPHA 1Z47A 5ELNA 2WB1E 3STBD 3D0FA 3CCRA 4DR2Q 5M5YH 1IXRA 2WP8J 2VQEL 1EQQA 1VQ8A 3HOYH 4GN4B 1XJVA 3HOUH 1EIFA 1L2FA 5IP9G 3UDXA 3HKZG 3HOXH 4HJ5A 5JJIA 4OXPA 4JI0Q 2NZOA 1EWIA 1YZ6A 4LF4Q 3ULPA 1XTDA 2D62A 1TWFH 4BA2I 3GTGH 4A3GG 3NBHB 1H95A 5JEAG 3W1BA 4P71A 3CP0A 3EBEA 1OXXK 3PGZA 2KBNA 3BZKA 1SE8A 4H02A 4GOPB 5H1SE 4HJ7A 1PHJA 4JI4Q 2JEAI 3GTLH 4AQYQ 1GD7A 1SROA 3BZCA 3G71A 4DUYL 2OCEA 1VQ6A 3B6YA 2MO0A 5GAEC 4A3EG 4TVAB 1Y1VG 5ELOA 3KOJA 1VQFA 1X54A 5IT9c 1X65A 4QGUA 4Y52H 1JJCB 4A3KH 4A3BG 2HIXA 5IYCH 4HIKA 1UE6A 3H3VI 4DV3L 1KIXA 4JYAL 1Q1EA 5IWAQ 4GKJL 1ASZA 4DV7L 3UDFA 1BKBA 2IT1A 2CWPA 4AYBE 3HOYG 2Z6KC 4R4CA 3HOUG 1T9HA 3HOXG 1XNRL 3RLNA 2MFIA 2PI2E 4JBWA 3CF5A 4GNXC 4HJ8A 1A62A 3FKIH 3CC4A 3AFPA 3J80c 1B7YB 3CAMA 3STBC 4DK6C 1OXVA 1HNXQ 3GDEA 4A3FH 4B3TL 2A8VA 1VQBA 3I7FA 4L5SA 4LW1A 3F2BA 2CWAA 2WB1G 4DNIA 5IE8A 3KLWA 1C7YA 2WAQG 1YHAA 1HZ9A 4OONA 1SLJA 4XIGS 4RG1A 3PUVA 1PH4A 1PFSA 1XMOQ 4IPCA 1BBUA 1QZGA 3AQQA 1VQJA 1FL0A 3NEMA 2A19A 2VQFL 2NVYH 3D31A 3U4VA 4NXML 2RF4A 2K5NA 5C3EH 1TWCH 4A3IG 1P8LA 1CKOA 1K0RA 3G4SA 4DR6Q 1GVPA 2UXDL 4A3KG 4Y7NH 1G6PA 1K9MC 2UU9L 5IYCG 4JI8Q 3RZDH 1UE5A 4BBSG 1X55A 4OX9L 1IBLQ 1SR3A 1A0IA 3KFUA 3L0OA 4IOAA 1OXTA 2K5HA 2LXJA 1QZHA 2JA6H 5GAHC 4R1JA 3J7ZC 3PF4A 3KJPA 1I94L 1N32Q 4A3JH 2YTYA 1E22A 4YWKA 4PG3A 4NB3A 4UP8A 1K3RA 5AJ3L 2BH2A 4EQ5A 3CW2C 4C3HH 4A3MH 1XMOL 1YJNA 3EIVA 1C0AA 1IBKQ 1YBYA 1PA6A 3M9BA 2N8NA 1WCMH 1EIYB 4B3MQ 2ZJPA 3HFZB 3T1HQ 5C0XG 1G51A 3A0JA 4YHHQ 2Y0SE 4BA1I 5M3MH 1OTCA 1UWVA 1BVSA 2R7ZG 3CPFA 2JA5H 1CSQA 2GN5A 1FJGL 4A93H 2F3IA 2HHHL 1X3EA 4GLAC 4LF8Q 3I4MH 1RIPA 3S15H 1MJEA 1IBLL 2KENA 2WFWA 4K0KQ 4L5QA 2JEBI 1Q7YC 1AE3A 1HZAA 1W2BA 5C3EG 2CCZA 2UUAQ 2BA0A 1NE3A 2R7DA 3W1GA 3KJOA 1HNZQ 1X3FA 4JV5Q 1HNWQ 3H0GH 4FDBA 2GVBA 1VQEA 4BBRH 4R4QA 2KCMA 2MNAA 1TWHH 1XPOA 2UXBL 3RN2A 3AYHB 1S72A 1N33Q 1YI2A 1Q86C 4KHZA 1MJCA 1YIJA 2UUBQ 1JMCA 2YV5A 4C3JH 4OO1I 3PIPA 4KI0A 2IHEA 2XGTA 1PV4A 4DV4Q 1VQ5A 2MO1A 2NVTH 2JA6G 1N9WA 3HOVH 4LFAL 3A5UA 2H5XA 4LF6Q 4APVA 4A3JG 3J7A5 3K0XA 3CC2A 4R4IA 4X64L 2I0QA 4JI5Q 4GLVB 4X66L 4DR5Q 4NPSA 3AEVA 1D8LA 4NXNL 4A3MG 1EOVA 3S1RH 1MIUA 4DV6L 2UXCL 1Y14B 4JCVE 4GKKQ 2OQKA 1WCMG 3ER0A 4JI2Q 3CPWA 1VQGA 4PZ6A 5M3FH 3GTPH 1VQIA 4YCWA 4DV0L 2CKZB 2ZTEA 4LFBL 3J81j 1CKNB 3FHWA 2I5HA 3M85A 1LTLA 5IYBH 1J5EQ 4DUZL 4B3RQ 2JA5G 5HGQA 4A93G 1S3OA 1KHIA 4JI6L 1NBWA 1Z9FA 1P16A 4TQUS 3I4MG 1WOCA 1EYGA 4HJAA 1N8RC 4DV5Q 1XMQL 4LNQA 4QY7A 2KHJA 4DV2Q 1I3QH 2PI2A 2Q2UA 1KL9A 4QJFA 4LFCL 4JC0A 1YITA 3FP9A 3KF6B 3ERSX 4R4OA 4IFDJ 2ES2A 3OTOQ 1QUQB 2CQOA 3H3VH 4DR2L 3K81C 4J15A 5LMNQ 3PF5A 3M7NA 3TEHB 5C4XH 3PSIA 4IJHA 1U0LA 3ULLA 3S1NH 4LF7Q 1Q8KA 3HKSA 2ASBA 1L1OB 4X65Q 3HOZH 4A76A 5BR8Q 1SMXA 4JI0L 1GM5A 4LF4L 2R92H 4JI3Q 3S16H 2OTJA 3S2DH 3KF8B 1CKNA 3NENA 4QIWE 4DR7Q 4IFDI 2PMZE 3PUXA 1VQ9A 3I4NH 1LUZA 4DV5L 4GOPA 1PH6A 2I5LX 1AH9A 4JI4L 1BBWA 1I6HH 4AQYL 1JJGA 3KF6A 1PYBA 2HQLA 1VQCA 1WYDA 4A3LH 2QEXA 3S1QH 5IYBG 1QUQA 1VQ7A 1V9PA 3GTKH 3U58A 1EQRA 2OWOA 3SGIA 1A63A 1NMFA 4A75A 1K83H 2AMCB 3CCLA 3CC7A 3CQZH 1PH1A 5DLQE 4IPDA 4POGA 1YJ9A 2YU9H 1L1OA 2D0PA 5GAGC 4QL5A 4X6AH 2AWNA 1M1KC 2IX1A 1C9OA 3TS2A 2F4VQ 1M90C 4HIDA 2K52A 3KDFB 5IWAL 1I50H 3HOWH 3I56A 1YNXA 2E5LQ 1Q82C 3TRZA 5C4XG 1V1QA 5GQOA 3GD7A 3GO5A 3HOZG 1LM0A 4LF5Q 2YYZA 2R92G 4KLKA 1PH3A 4LF9Q 1HNXL 5HY6A 1IBMQ 1HR0Q 3DM3A 3VDYA 3GTQH 2K14A 3GTJH 4KHPQ 1E3PA 4LWCA 3T1YQ 4RMFA 1YJWA 4YY3Q 3I4NG 1VS0A 3PUWA 4DR1Q 3GTMH 5GROA 2R7FA 5M5WH 3CMAA 1NJIC 2A1AA 1KXLA 2HIVA 3FKIG 2ZM6Q 1X9NA 2JA8H 2BH8A 4X62Q 1PH7A 3CCSA 4A3FG 2E8GA 1G291 3MXNB 1CKMA 4A3LG 2E2JH 3A74A 1Q1BA 3KDFA 4JI1Q 2N78A 4BY1H 5LMUQ 1RL2A 4A3DH 2JA7H 2L15A 4DR6L 1SRUA 3HKZE 4PZ7A 4AYBG 1KC8C 3UE1A 4A3CH 2IHFA 4JI8L 3K7UC 4LF5L 5C4JH 1X6OA 4IPGA 4MNOA 1KRTA 1OXUA 3I2ZA 4GNXB 1PH2A 2PNHA 3UDIA 2K4KA 4GOPC 3TS0A 4JI7Q 5IY0A 2VUMH 2NN6I 3GTOH 3HOWG 1QVFA 3I4OA 1N32L 1KRSA 1VQOA 1N36Q 2EXDA 5GADC 1B70B 3PO2H 4DR1L 5IP9H 4HJ9A 2B29A 1QVGA 1UE1A 1VQHA 3ZJYC 1SN8A 4HIOA 2YTXA 2ZM6L 4BY7H 1PH8A 1IBKL 3RNUA 3IRBA 4P72A 4B3ML 1CUKA 1JT8A 2ALYB 3UDGA 2ZTCA 5E7NA 3T1HL 4DV1Q 4OWWB 2K75A 4P73A 4YHHL 3BJUA 1N34Q 4JBJA 3E9IA 2NVXH 5JJKA 4P75A 5EAYA 2N49A 3J81c 2B63H 2AKWB 1E24A 4OWTB 3JAMi 2JJQA 4GNXA 4LF8L 2Q2TA 4PMWA 3ULJA 4K0KL 1XNQQ 1Y1VH 1NMGA 4L5RC 4BXXH 1PYSB 3F8TA 1IYJB 4YWMA 2UUAL 4A3DG 1HNZL 2JA7G 5M3MG 1LYLA 1HNWL 4JV5L 2JQOA 4GN5A 1JB7A 1WFQA 4C3IH 3F1ZA 1O7IA 4UP9A 3WWVA 4A4IA 4JOIA 4YCUA 4DUYQ 1N33L 3A5ZB 2UUBL 1AE2A 1VQAA 5FLXc 3L7ZC 4GS3A 3UE0A 3K7AH 2RHSB 3PV0A 1VQ4A 3E9HA 4DV4L 2IY5B 4QQBX 2VUMG 3I55A 3M4OH 2WAQE 2VW9A 4OO1G 2IX0A 4DV1L 2ZJQA 2B3GA 1HH2P 4LF6L 2I5MX 2Y0SG 4OWXB 3M4QA 4DR3Q 3H0GG 4UPAA 1N34L 4JI5L 4BBRG 1R9TH 1I5FA 3TQYA 4JBMA 3PO2G 4DR5L 3M4PA 2GVAA 4BY7G 1YHQA 4DV3Q 4PZ8A 4IJLA 4JYAQ 3W5OA 4GKJQ 1K73C 4JI2L 1E7ZA 1XNQL 3RLFA 4DV7Q 1XPRA 3HOVG 5IP7H 1NTGA 1HJPA 4ME3A 5FJ8H 2VY3A 5FLMH 1TWGH 2AHOB 1Y1WH 1KD1C 2E2HH 4B3SQ 4UY8C 1XNRQ 1W3SA 1J5EL 4ALPA 4B3RL 3M3YH 3S24A 3CD6A 5LMNW 3J81i 2B63G 5IYDH 3PUZA 4L5TA 4B3TQ 2R6GA 4WJ4A 2KHIA 2Q2IA 2OTLA 5JJLA 1SFOH 4UP7A 3TREA 1Q12A 2EIFA 4DV2L 1K8GA 1PVOA 4BXXG 5M3FG 1S40A 1VCIA 2KCTA 2EQSA 4LUOA 4A3IH 1FGUA 2DGYA 1L0WA 1IZ6A 2R93H 4DAMA 4AIMA 3MEFA 4DR3L 3OTOL 3H15A 2VZAA 2XTIA 4BBSH 1NY4A 3CMEA 2VQFQ 5LMNL 3RLOA 4NXMQ 1WJJA 2OQ0A 1E1TA 1EUJA 1PH9A 3EN2A 4LF7L 1U5KA 4GKKL 4X65L 1J6QA 3L2PA 5BR8L 2UXDQ 4IO9A 3PCOB 1PH5A 1GO3E 4JI3L 4HIMA 4DPGA 2UU9Q 4B3SL 4DR7L 2FXQA 3CCUA 2MQHA 3RN5A 1Q81C 1JJ2A 2D0OA 4DK3C 3U4ZA 5C0XJ 3PIOA 4OX9Q 4C2MH 3NELA 1X3GA 2BA1A 4YWLA 3S14H 3OYYA 1I94Q 2PQAB 2HT1A 1ASYA 4P74A 5IP7G 3ICEA 1CSPA 5FJ8G 1Y1WG 5FLMG 2YTVA 5C44H 4JOIC 4GLXA 1FVIA 5AJ3Q 2R7ZH 3CCMA 2ID0A 2JA9A 1X56A 1UE7A 3S2HH 1GKHA 5IYDG 1XPUA 5C0XI 4O0AA 3BU2A 2RCNA 3E0EA 4GN3B 3K8AA 3RR5A 4R4TA 1DGSA 4O2DA 2N3SA 4MZ9A 1JE5A 5J3BA 4DR4Q 3JAMc 2Z0SA 2LXKA 3CCVA 1HR0W 2R93G 3S1MH 4JBKA 2F4VL 2VL6A 4WJ3M 3KYHC 4XTCS 3G48A 3F2CA 2QA4A 4AH6A 4LUZA 1FJGQ 3PO3H 3CXCA 2HHHQ 4DKAC 1YHBA 2E5LL 2DUDA 3CCJA 2JK8A 4EX5A 1V43A 1KQSA 5K36G 2F52A 2K5VA 3G6EA 2PQAA 1VQDA 1K8AC 2VNUD 2VS1A 2K50A 1Q46A 4MTNA 4LF9L 1D7QA 1VQLA 1EFWA 3JC66 1IBML 1TWAH 1HR0L 2UXBQ 2LSSA 4KHPL 2UUCQ 1QVCA 3T1YL
chains in the Genus database with same CATH superfamily
3RZOH 2NWGA 2IX3A 2PCFB 2J9GA 3G6XA 3KLSX 1F9SA 4LFAQ 5IODA 5JEAJ 1E2WA 3RB3A 2HJWA 4IWYA 4NKLA 1W6JA 4GC7A 4DR6H 1E1OA 4X62L 4X64Q 5JVLA 2QGQA 2NVQH 5JEAH 4R7RA 2TMPA 1B9NA 5BN5A 5LMUL 4DV6Q 5ELFA 2UXCQ 2FLNA 3RIZA 3BABA 5KT4A 2L5TA 4O4IF 3NHHA 1A8VA 5KFAA 3KALA 1O7ZA 1O80A 4DK1A 4LFBQ 4U6PA 1KJQA 2Q2HA 5DAUA 3PO3G 4RNNA 2NZHA 5C3XA 4RCOA 5IT9W 3K5HA 4DA2A 4A3BH 1SYGA 2R7ZB 5L9XA 3A55A 4F7XA 2R3ZA 3BVGA 4A3CG 2FPPB 5KFJA 4R8IA 2QDBA 3LWUA 4LUVA 1VQPA 4YR0A 3K6OA 2B2TC 2B2VC 2L12A 2NVYB 4X64H 3STBD 2W6ZA 3CCRA 2DLNA 4DR2Q 1TWCB 3RBDA 4K5XA 2UXCH 1BR9A 1F9RA 2GLTA 4LF8H 4Y7NB 4C56C 1ENCA 2K5WA 3UDXA 4RH6A 5I9OA 1GOZA 3RAQA 4JI0Q 1LTTD 1HNZH 4C2MA 4LFBH 4JV5H 3M4YA 3GTGH 2JA6B 1SEBD 3TN2A 5JEAG 4YBZB 1BXRA 3QWNA 3PGZA 2NU6B 2EY1A 2AGOA 2KBNA 3MJFA 3VPDA 5CC4A 3NXWA 2W9BA 2A73B 4DV4H 4C3HB 4A3MB 3R5FA 1SROA 1V8QA 2B2UC 1VQ6A 2R7NA 2YW2A 4I50F 1BJTA 3J80L 1Y1VG 3H94A 1CA6A 1X54A 2RGVA 1V1PB 5IGCA 5KFDA 4A3BG 1GUWA 2JA5B 4R8UB 4J8QA 4ECQA 5JVDF 1GLVA 2WIIB 3URYA 5L1KA 2UVVA 1S97A 1Q1EA 4APMA 4EBCA 1KDAA 2C22A 2QKIC 4DV7L 2EYPA 2O4XA 3OMGA 3V2TA 2W6NA 1MSGA 4JV2A 2J0TD 4DLKA 1XNRL 1C8CA 5J39A 1Y8OB 2BDOA 1TS3A 2RDHA 1JOQA 1EUDB 3J7AF 4J9RA 2PBZA 3GDEA 3NTKA 3I7FA 2A8VA 1WCMA 3OTOH 3F2BA 2A6HD 3GQBA 4DNIA 4CJ0B 5C0XH 1T5XD 1BO0A 2W8LA 3GIPA 4LH6A 1HZ9A 2KEEA 4RAUC 4LF7H 3S1RB 4EFEA 4IPCA 1BBUA 1I4RA 1QZGA 4XDXA 2VUGA 5BR8H 1VQJA 2A19A 1PDQA 1QNUA 1ONLA 1STHA 1SMYC 5C3EH 4HMJA 4A3IG 3K0YA 2CH4W 3VR3A 4IALA 3G4SA 2UXDL 1WR2A 3DXJC 3QR8A 4QWCA 1PTOD 2E2IA 5KT5A 2F0LA 4ULLA 3RZDH 5C6AA 4BBSG 1A0IA 1OXTA 5KFMA 2QF7A 1D5ZC 4MIUA 4R1JA 3PF4A 4JV0A 1I94L 1N32Q 1DOKA 1EY5A 4A3JH 3K5NA 1K3RA 5AJ3L 2BH2A 4TV8F 2DN8A 1YJNA 3BYTB 1C0AA 5KG5A 1FKAH 3S1NB 2N8NA 1WCMH 3BVZA 3HFZB 5C0XG 5FK9C 1ZHQA 4BA1I 5KFNA 4V0BA 1UWVA 1BVSA 2FPGB 3PMFA 4ME6A 2OF1A 4MN3A 2WFWA 4IAJA 5ELDA 2MJ8A 2JEBI 3FKIB 1B3QA 5C3EG 1PRTF 5NUCA 2UUAQ 3M4IA 4YY3H 1X3FA 1CM9A 4OGQC 4FDBA 4BBRH 1RHPA 2K03A 1SBBB 4OL7A 2UXBL 3BDCA 1K83B 2ZM6H 4KHZA 4F4XA 3RFCA 2YV5A 5BN3A 4KI0A 3D6CA 3HOVH 2R92A 4LFAL 4A3JG 3C2PA 1PZJD 4X64L 4GLVB 3HOWB 4IRCA 3AEVA 3WOEA 1D8LA 2H4OA 1EOVA 4DV6L 2UXCL 4HCSA 5KFEA 4EGVA 3BA8A 1WCMG 5M3FH 4XQNA 4JI7H 5K5PA 1KLGD 3F8NA 2FLPA 4RA8A 1H9MA 2JSOA 4LFBL 1N36H 3GTKA 3GTJB 2B2YA 5KT3A 2XNAC 4CC6A 4XYLB 3RAXA 4QMGA 4KY6A 1N8RC 2WDTA 5M5WB 2KHJA 4TRDA 1I3QH 2IMWP 2MPMA 1YITA 1XTCD 3KF6B 3ERSX 4R4OA 4IFDJ 1H9SB 2CQOA 4O3NA 4DR2L 4E6IA 5KG7A 3K81C 4IUPA 1AN8A 4IFDH 5C4XH 4FXDA 2KJXA 4IZ8A 1U0LA 5E1FA 4DU9A 1Q8KA 1FGBD 5LOVF 1XNQH 3QB3A 5C4HA 4JI0L 1SMXA 1X32A 2R92H 4U7CA 3S16H 2C2EA 2OTJA 4HCEA 3KF8B 2R7KA 2XRQD 1HRJA 3C0FB 3UQ8A 3OMCA 3HGBA 3PUXA 1VKZA 2VB2X 4K8IA 5J2UF 2F0VA 2WKDA 1W96A 3Q8PB 1RD9D 1JIHA 5KG3A 2NTTA 3BA9A 1PYBA 2HQLA 1O7YA 4A3LH 2LS01 2QW7A 3S1QH 1QUQA 1IKLA 4NMZA 3GTKH 2NVTB 5A2QW 2P0AA 4J0MA 2JA7A 2W9AA 4UAIA 3C46A 3CCLA 1PH1A 4JYAH 1WTWA 4GKJH 2I8CA 2D0PA 4Q44A 5GAGC 4QL5A 5T1GA 2AWNA 5CBEE 4YB8B 2O5JC 5KGUA 1DONA 4ZOLF 4ZHQF 2VUMA 4JVZA 3GTOA 2J4XA 2NU9B 3RB0A 4LAAA 4I65A 3M9OB 1Q82C 3TRZA 1G2SA 5C4XG 1Q8IA 3H0GA 3LMLA 4LH7A 2YYZA 1ENAA 3GIIA 4MHEA 4ABNA 2R92G 2KCNA 3EVQA 5HY6A 5KG6A 1KJ9A 3BDLA 3CKIB 3VDYA 2K14A 1QE6A 1E3PA 4ZUIA 3T1YQ 1V51A 1QB5D 4RFBA 3E5SA 3PUWA 4DR1Q 3GTMH 5LL6X 1N48A 1KXLA 1M4VA 1STBA 4RHSA 2ASLA 1STAA 2EJMA 2V59A 2BH8A 1PH7A 3CCSA 3I73A 1G291 1CKMA 2B2WA 4A3LG 2UU9H 2E2JH 3A74A 1Q1BA 3KDFA 2N78A 1B44D 3MR2A 1TWGB 2JA7H 3I12A 1RK6A 1ILPA 3I90A 2FHTA 4WD3A 3UE1A 2IHFA 2EYOA 1Z7TA 5C4JH 4ILWA 1DD2A 4IPGA 4HNVA 1E2ZA 2BCOA 3MTSA 3I2ZA 4GNXB 2D5DA 1PH2A 2XN9C 4CKBA 5CMDA 4C1NK 2XSCA 1HFNA 3EYYA 2VUMH 5IY0A 5L1LA 3GTOH 1HFGA 4OEMB 3I4OA 1QVFA 1EY0A 1N32L 2EXDA 1R9TA 2PYKA 3PO2H 4HJ9A 1QVGA 2AQ4A 4KJNA 2IL8A 2RCFA 4ED1A 4HIOA 2ZM6L 4B9WA 4DR4H 1PXUA 1PH8A 3RNUA 2AUJD 4P72A 1EEFD 3MWMA 1DXMA 4J9QA 2X6LA 5IGGA 4DV1Q 2HHHH 1Y1WA 3BJUA 4MV9A 4UDUC 3VR5A 2NUAB 3GV3A 5JJKA 1CI3M 4P75A 5EBCA 4QCLA 1IW7D 4IUTA 3J81c 1QJOA 2AKWB 2D9UA 2JJQA 4PMWA 3GQCA 2XWBB 1NMGA 3W2DA 2FE3A 1EFID 5KKNB 1IYJB 3TDQA 2UUAL 1IOVA 2UUCH 2JA7G 5M3MG 1LYLA 4GN5A 1JB7A 4QIWA 4BWGB 2J6SA 1PZKD 3WWVA 5D14A 4A4IA 1MZBA 4JOIA 3I72A 4XQJA 4DUYQ 4YR3A 1MI2A 1V4YA 3OWFA 1PRTD 1VQAA 5FLXc 1VBGA 3DEOA 1PK8A 2L0CA 4PV1C 4F87A 1S0NA 2VUMG 5HBRB 2WAQE 4L63B 2VQEH 2EY5A 2B3GA 4RWSC 5FPRA 2NU8B 4DR3Q 3H0GG 1BNZA 3PO2G 1R9TH 1PVOA 1I5FA 3TQYA 2XGQA 1I4QA 1F9PA 3M4PA 4DV3Q 5J22A 3G8CA 1E4EA 2WE6A 3W5OA 3NSWA 4LK1C 1K73C 1XNQL 1E7ZA 2A5HA 1FR3A 3PN1A 1KD1C 1Y1WH 1XMQH 3GTQA 1S5ED 1S5FD 2K01A 3FRPB 5KG4A 3BQ0A 2C2RA 5IYDH 1HTPA 2YRWA 2R6GA 1IYVA 4UP7A 5CV5A 3TREA 2EIFA 4U673 1GHJA 4MV1A 1WD0A 2EQSA 3QOJA 1FGUA 4ZYSA 4A3GB 3P20A 4AIMA 4HMIA 4S3SA 4LF4H 1KNAA 1NY4A 1STGA 5KFBA 1SEIA 5K36H 1OO9B 2PQEA 3S17B 1TAEA 3K3VA 3J7YW 1J6QA 4WJWA 4RCNA 3I91A 2JN4A 1PH5A 1KC7A 1GO3E 5DM63 4MTEA 2E2IB 3JAML 1R4PB 5LL6b 1BGWA 2MQHA 3RN5A 3P75A 3PIOA 4XYOA 3U9TA 1SNOA 3I8ZA 1X3GA 3DUZA 4KMUC 2K6AA 2NYZD 1SYEA 1BQQT 4FP5D 1ASYA 2VNUD 3V6KA 4G4KA 1Y1WG 5C44H 1B6RA 1NAPA 3JRXA 1ESRA 1FVIA 4CHTB 1H9KA 2F0NA 2R7ZH 4DL7A 1X56A 3S2HH 4H7BA 1GKHA 5IYDG 1TA8A 1XPUA 3RR5A 3E0EA 4JPBW 3OWEB 1BOSA 1CQIB 3VYRA 1K0SA 1KNEA 4R4TA 3MZ5A 4QWBA 3T5HA 4XYQA 4MZ9A 2Z0SA 3CCVA 2VQDA 2WB1B 3G48A 4AH6A 2W71A 3CXCA 2WAQB 1RJRA 3WO0A 1HNXH 2VOBA 4ED6A 2YRXA 5K36G 3K57A 3G6EA 3N6XA 1STYA 1K8AC 4MTNA 1EFWA 2VPQA 2R6FA 2OXPA 2XCAA 3PW7A 4C1NI 1TY0A 1XMOH 2E75C 3T1YL 3J81E 3J80i 3MHBA 2QYZA 4UCVA 2EDGA 4U68A 3SE0A 1GUOA 4KN4C 4F8MA 3D4RA 5C44G 4DR4L 4HR7A 2NTSA 1IKMA 3FPUB 4JI8H 5M9OA 3M9NB 4NXNQ 4IOCA 1IBLH 1J8IA 1LO5D 2PZUA 1WTQA 1JR0D 5FLXE 1B6SA 3MFYA 5L37A 4TUYF 4YCVA 3GTLA 4O42A 5LP6F 1YNJC 3T5KA 2V1CC 1SE3A 1YVCA 3OW7A 4DV0Q 2JA8G 2IWHA 4IURA 2K5DA 5KFHA 4A3EH 2B8GA 1J9OA 3S14B 2CFMA 3NTIA 4DUZQ 4POFA 1EY8A 2ZJRA 1AN7A 2A68D 2UUCL 4HNUA 3HB9A 5CORA 2DJGC 1EY4A 4L6TB 2NN6G 1KJIA 1KBLA 2W57A 5KFCA 4MV3A 3MXGA 4K14A 3T1HH 3HEJA 2DZDA 5JUMA 4ED7A 4KN7C 1VQKA 4IPHA 5C5JA 1UC9A 5CV7A 2R8IA 3D0FA 4ETSA 3RGZA 2L55A 3GP7A 2Q8TA 2VQEL 3RMHA 4GN4B 3X3NA 1XJVA 1EIFA 1FNUA 5IT9L 3S9WA 3HOUH 4BS9A 4ZKBB 4DAYA 1V1OA 4OXPA 2YZNA 5KG2A 2NZOA 3ULPA 4FO2A 5KFSA 1HNWH 2D62A 4BA2I 4ZKCB 3W1BA 3KUPA 4KKSA 4WORA 3BJYA 3BZKA 1SE8A 4LMQD 3KHRA 1QILA 2PW5A 1PZID 4MA5A 4HJ7A 1DV2A 4JI4Q 3GTLH 4AQYQ 1AZPA 3BZCA 4DUYL 2FJZA 4MV4A 2OCEA 4LF6H 2MO0A 4A3EG 4TVAB 4JI5H 5ELOA 4DR5H 1D5XC 2M9VA 2KHSA 4QGUA 3BDOA 4Y52H 3MFGA 4L8JA 1K3BC 2YS7A 4A93B 1HCZA 4GKKH 2HIXA 1K28A 4YAKB 1PTOF 1GHKA 4DV3L 3NBHA 4O4HF 5IWAQ 4B3RH 3MC0B 3A8KE 3G7LA 3E5NA 2KOLA 5DNFA 4AYBE 1LABA 3HOUG 1L0XB 1T9HA 1TWHB 2MFIA 4GNXC 4DV2H 4HJ8A 1RKNA 1A62A 1H9JA 1S5DD 1B53A 3FKIH 1CA5A 2HD3A 3J80c 3L9AX 1SYDA 3STBC 3ZYYX 3GV8B 4MTKA 4L5SA 4LW1A 1L2ZA 1T5EA 4XYMB 4OIJA 2ICEC 3KLWA 1C7YA 4UCRA 2A69D 2SCUB 1SLJA 1TS5A 3I4LA 2OLSA 2I07B 4I7ZC 1FL0A 1EY7A 3CHBD 3D31A 3U4VA 2NBFA 2K7VA 4DR6Q 3IN5A 1Z2NX 5C5LA 1QG7A 1UE5A 5BPFA 1X55A 2K04A 3OSNA 3KFUA 5KIXA 2O5IC 4IOAA 3OHXC 2K5HA 2LXJA 2Z1CA 1EYCA 3A56A 4QUFA 3RUPA 3BQ2A 2HGSA 5GAHC 4RB2C 1HTLD 2F0SA 3KJPA 3HXLA 1Y8NB 3Q1KA 2F0WA 1E22A 4YWKA 1ZEQX 4PG3A 3TBIB 1PX2A 4J9LA 4EQ5A 3CW2C 1XMOL 1I4GA 3KBXA 1PA6A 3TQTA 3M9BA 3HOZB 2F4VH 1EIYB 2ZJPA 3A0JA 1RTNA 4O1NA 2E5LH 2VPSA 2VR1A 3GTGA 1PLFA 3NE5B 2QILA 2ASDA 2UVRA 2F1MA 4LF5H 2F3IA 5E4WC 4G3IA 5G3LF 3I4MH 4GLAC 3EA6A 4LF8Q 3K5OA 1RIPA 4LF9H 3S15H 1MJEA 1IBLL 4K0KQ 2A6HC 1DM0B 4L5QA 4FS1A 2F0UA 1HR0H 1PRTB 1AE3A 1IBMH 4ZUJA 2R7DA 3W1GA 1HNZQ 4A3FB 4JV5Q 2C00A 1EZ1A 1SNPA 1VQEA 4R4QA 2KCMA 2MNAA 1XPOA 2W70A 3GV7B 3RN2A 3AYHB 2W7PA 3FMAA 1F77A 1YI2A 1MJCA 1LLRD 3CQZB 1JQYD 1YIJA 4AYBB 2M05A 2W6PA 3G6YA 1Y69U 2YU9B 3PW5A 4DV4Q 2MO1A 1ZYRD 2NVTH 3LP8A 1N9WA 4JI1H 3TZUA 3SVMA 1PTOC 2DPJA 3IAYA 3K0XA 5KFPA 4HSVA 4R4IA 1SAPA 2WACA 2XVSA 4NPSA 2FMMA 3KTMA 4NXNL 2J6TA 3NQIA 1MIUA 1S10A 1HPCA 4JCVE 2NUCA 3VYUA 4N8X1 5KFRA 4K0KH 2OQKA 4PZ6A 1TS4A 4ECYA 2W9CB 4DV0L 1S4ZA 2QK4A 5F2DA 1CKNB 3GTQB 3M85A 1LTLA 2Z4HA 3LNNA 4DUZL 3PZPA 1JXLA 2G9DA 3I4MG 4Q43A 2BQRA 2PI2A 1KL9A 4NW2A 4QJFA 3N52A 2JA8B 4X3UA 4YAJB 4H0LC 1N34H 3OTOQ 1I50A 3H3VH 4A3DB 2JP1A 4J15A 3J80E 3M7NA 4HSPA 3PSIA 4IWXA 1K1SA 4GKKL 4LF7Q 2ASBA 3HKSA 1L1OB 1LTAD 3IFDA 2M2LA 5BR8Q 1TR5A 3LWEA 4X65Q 4A76A 2A74C 3S2DH 3VPBA 1EU4A 5LA6F 2PMZE 1EEID 4TV9F 4F4YA 1CZGA 1RYRA 3I4NH 4LJZC 4GOPA 2SNSA 2BR0A 1AH9A 4JI4L 1BBWA 4RKBA 1I6HH 1EZ8A 2Z4IA 3KLRA 4BY7B 4AQYL 3GIQA 3NPPA 4C3JB 2L4NA 1WH2A 3BAAA 1SNMA 3SDZA 4EG0A 3U58A 1A63A 1NMFA 4FF1A 2I46A 3DWQA 1O75A 4UFZA 5KFFA 3CC7A 5CGKA 5JPNC 2V4QA 5EKLA 5DLQE 2EY6A 2FLLA 4X65H 4QB4A 4RB0A 4YJ2F 4K6DA 5D8DA 4WBNF 4X6AH 2IX1A 1HXYD 3GTPB 5IWAL 1I50H 5CAEB 3I56A 2YZMA 3NGDA 1YNXA 3ND8A 3MXUA 5A2QL 2Y0SA 4CDCC 2AQ1B 4C3IB 3GD7A 1LM0A 2R82A 1SE2A 2B2YC 4KLKA 5IGEA 4RNMA 1SJED 1CT1D 1ILQA 3T13A 3QJYA 4B08A 2B2TA 2B2VA 1A3VA 3FMCA 2V5AA 4RMFA 1YJWA 4YY3Q 3I4NG 1VS0A 5D1PA 2VQFH 2NVXA 3N41B 1U4RA 2R7FA 5GROA 2PN1A 5HGTA 4NXMH 3DF7A 3H20A 2HVRA 2B63A 3AMUA 2ZM6Q 1X9NA 1X3PA 1LT4D 1STNA 4QWDA 4FNFA 4KKUA 3D6WA 4CDEC 4BY1H 1RL2A 4X3SA 4MTDA 4OX9H 2L15A 4DR6L 5JQWA 5EBDA 3M3YB 5EPLA 1JKJB 4LF5L 3HRZC 4M8AA 1OXUA 4R9WA 1B50A 5KEEA 5CA1F 1I3QA 4NLGA 2PNHA 3UDIA 4JI7Q 2F0OA 4OO1H 2DJFC 1N36Q 4O3OA 2LKVA 5IP9H 2JEGA 2B29A 3TZDA 5CR3A 2PMZB 1UE1A 1VQHA 1SN8A 2FINB 2YTXA 2L1BA 4J9KA 3T51B 3MXNA 3RUZA 3ETJA 1JT8A 1FJGH 2ALYB 1VMCA 4OIKA 5CYUA 2E2HA 2R86A 4JBJA 3SXHA 3JRWA 1IYUA 2NVXH 2I87A 4IR1A 5KT6A 4M7EA 2B63H 4LF8L 3JAMi 2D2CC 1SFOA 2Q2TA 4K0KL 1XNQQ 4L5RC 1SJHD 5KFXA 1WVLA 2EYHA 5KG0A 1O7LA 2C5CA 1HNZL 1WD1A 2R93A 4JV5L 4CGYB 5G3LD 3Q8QB 4KV6A 4DAPA 4YCUA 2KCCA 3A5ZB 1DV1A 3NBIA 3PW4A 3K7AH 2RHSB 4X66H 3E9HA 4DV4L 1TU2B 3OIQA 3I55A 4DNTB 3VMMA 1CK1A 4OO1G 3E6ZX 5C4ZA 1N34L 2Y0SG 4OWXB 4BBRG 3FDSA 3PO3B 2JYOA 2B2WC 3SHLA 4IJLA 3Q0AA 3RTXA 4JYAQ 1ET9A 1JLLB 4GKJQ 5DG8A 1AW7A 3HOVG 4JI6H 4RB1A 4EGQA 1JB3A 1JE4A 2AHOB 2E2HH 4UY8C 1S5CD 1TWAB 3HBLA 3IL8A 1Q3LA 2BOSA 2IJ0A 5EQ0A 4LFCH 3CD6A 3J81i 2B63G 3RZOB 3PUZA 3GTMA 4B3TQ 1QWYA 2F4IA 3V96A 4KD3A 4QWAA 4FBUA 1SFOH 4Q45A 2FK3A 1K8GA 2JEIA 5M3FG 4HN7A 3I3CA 1DIKA 3OIPA 2R93H 2C28A 2PPBC 3OTOL 1IW7C 4PMCA 1I7NA 4J9SA 1S5BD 2TSSA 1BXTA 1LV9A 1SNDA 2F0KA 4DNRB 4PWQA 2XCPA 1E1TA 1EUJA 3HP3A 4LF7L 4X65L 3V05A 5BR8L 4IO9A 3PCOB 2VA2A 1WTRA 2SDFA 4DPGA 2UU9Q 1XWEA 1Y1VB 2R8HA 3TQ1A 2IPKD 1PRTC 1Q81C 2CVRA 1JJ2A 4IFDG 4A3BB 4C5BA 3R5HA 1C4QA 4LSAA 4B3TH 3HKZA 3N42B 3S14H 4EFBA 4K2KA 2HT1A 4P74A 5KFKA 1CSPA 4JOIC 2AGQA 3ND9A 1JICA 1KTKA 1R4QB 3CCMA 2ID0A 1TY2A 1WTPA 5C0XI 4O0AA 4KY5A 4GN3B 5H80A 3K8AA 3T5LA 4KY7A 1DGSA 1FD7D 4DR4Q 3JAMc 2K28A 2LXKA 3VYSA 4X3TA 1HR0W 3GTGB 5E3FA 2R93G 4M9UA 3S1MH 3G6VA 1UNSA 3JZIA 2VL6A 4IUVA 3KYHC 4KJOA 2QA4A 2F03A 4XX0B 4LUZA 2XCLA 2K33A 2HHHQ 3ERQA 4EBEA 1B1ZA 2F0JA 2P5ZX 3G6JB 2KSWA 5KFVA 4DL3A 2IBKA 1I6UA 2JK8A 1JX4A 2K5VA 2PQAA 1CHQD 1GUSA 3KLSA 2VS1A 3VA7A 3BS1A 2EJGC 4A3IB 2B8FA 2IP4A 2LSSA 1S0OA 1D1IA 2UUCQ 2R87A 5LXTF 1WTHA 4YY3L 1F2MA 5KT7A 1QNKA 1DOLA 1PMRA 3TMEA 4BBSB 1K8OA 1B8AA 3K80C 1TWFA 3OW2A 3AFQA 3Q8DA 1HZBA 3PUYA 5CV9A 5M5XH 4XT3B 2VQEQ 2G5DA 3IFTA 1L1OC 5KNBA 1VQMA 5D1OA 2ZTDA 5JPMC 4NDXA 3DLLA 4XQQA 1UEBA 3U50C 2FP4B 1GGOA 5A35A 4A2AA 2Z6KA 5KFWA 2RSNA 4RGMA 4C2MB 4JG2A 1KAWA 2AWOA 1MKHA 1Q90A 3R2IA 4JI7L 1WI5A 3FDTA 1XMQQ 2ATWA 3R5XA 1IBKH 1N36L 1IL2A 3IG0A 3CCQA 5L1JA 2W9BB 4B3MH 2XIGA 3RF2A 4YHHH 3CCEA 1OXSC 3J7AK 2C35B 4HQ6A 4ECTA 2IA6A 2I80A 1Z47A 2HDMA 2WB1E 4ECUA 5C3EB 1VBHA 3VPCA 1JWUD 1HQRD 4JW0A 5ELBA 5M5YH 1GSHA 2WTFA 1EQQA 3HOYH 3T5JA 3A7LA 3HOXH 3GV6A 3HKZG 4HJ5A 4I4TF 5JJIA 1E4FT 1MBYA 4LF4Q 1EWIA 1YZ6A 1XTDA 5C8YF 1TWFH 4KD4A 1H95A 1UEAB 3KHGA 4P71A 3EBEA 1OXXK 4A3JB 2R85A 1RK5A 2UUBH 4H02A 1KJ8A 4MV7A 1ZXTA 2XIWA 1VF5C 2JXMB 4GOPB 2R7ZA 2QEJC 4FVMA 3K5MA 1XDNA 2HVQA 1GD7A 3G71A 4CKEA 2NVYA 1WCMB 1BNCA 5EJWA 3MR5A 3KOJA 1QOHA 5EKKA 1TWCA 4ZQ3A 5IT9c 1LTID 1EHIA 1X65A 5I2YA 3DWAA 4Q5VA 1JJCB 4A3KH 3CRKC 4HIKA 3H09A 1PTOB 4JI2H 1EOTA 4DXFA 4C5AA 1ML0D 2GA4B 1SNQA 1KIXA 4JYAL 5DQHA 2JA6A 1J5EH 2A68C 1AUXA 4GKJL 2KECA 4DXGA 2DNCA 3HOYG 4DV5H 4CKCA 1I7LA 3HOXG 1AZQA 3GLKA 3FEWX 3CC4A 1HNXQ 4DK6C 1G8ZD 3JAME 4A3FH 4Z9CB 4B3TL 5EZYF 1VQBA 2CW0D 1EU3A 5EWGA 2CWAA 5IE8A 1CFMA 3J7AV 2FB9A 2O03A 4J9OA 4FBTA 1V1PA 4JUZA 5LMNH 4OONA 1PFMA 1ICWA 4O2BF 1LT5D 4R8UA 2JA5A 4RG1A 3PUVA 1PH4A 1PFSA 2HDLA 1XMOQ 5EWFA 2PZTA 4JI3H 2NVYH 3MVVA 4DR7H 2FPIB 3QOLA 5IGFA 4ED0A 2E2DC 1TWCH 1L0YB 1CKOA 4A3KG 2K5QA 4Y7NH 3Q24A 1K9MC 2UU9L 1G6PA 2OT2A 4ECXA 1LTSD 4JI8Q 1S03G 3R93A 3QIAA 4ZLTF 1IBLQ 2OH2A 1I3QB 2JA6H 2KEDA 2HVSA 1FNWA 1DZ1A 2YTYA 4ID6A 4NB3A 4UP8A 3ORQA 1RJQA 4C3HH 4A3MH 2R8GA 3EIVA 5C4XB 5TSSA 2SOBA 3T1HQ 4KHVA 4DK0A 2R92B 1ZHSA 3S16B 4R8NA 3HS0C 2R7ZG 4H13C 2JA5H 2GN5A 4MV8A 4F4WA 2HHHL 3T4AC 4M1UB 2RA4A 2KENA 1UAPA 1Q7YC 1HZAA 2IW3A 1HQMC 2CCZA 4KHPH 1E2VA 4ODGA 5LL6S 2A69C 3KJOA 1HNWQ 1RJPA 3RB4A 3I70A 3S1QB 4TSSA 2AQ2B 3GTKB 5E4XA 3W3AA 1N33Q 3PIP3 1TS2A 2ZJTA 4X62H 1JOKA 4C3JH 2F0FA 2IHEA 3QO2A 1VQ5A 5KFZA 5I2XA 2JA6G 4OHJA 1E0BA 2NZ1D 5LMUH 4LF6Q 1DJRD 3KXYT 2I0QA 3A7AB 4JI5Q 2B39A 4DR5Q 5JVH3 1LTRD 5CV6A 4C3HG 1XXGA 4A3MG 3S1RH 3EJIA 3Q8RB 2YCHA 4GKKQ 1SCUB 1EY9A 3ER0A 3FKIA 4WRDA 3CPWA 2RSOA 5D65A 3GTPH 1VQIA 4YCWA 1G2TA 3JSLA 5IT9E 2EY2A 1HUNA 2ZTEA 3J81j 3UFXB 3FHWA 4HAEA 5IYBH 4B3RQ 2JA5G 5HGQA 1IOWA 5DEHA 1N33H 2W6QA 1Z9FA 4A2BA 1K83A 4KTAA 4HJAA 1EYGA 2FFKB 1XMQL 4QY7A 2QCPX 5AFWA 4DV2Q 1WTOA 2Q2UA 4FU0A 4DL4A 2RDIA 5HV6A 4JC0A 5JOBA 1CQVA 1CZWA 1JC7A 1Y8PB 4K8JA 1QUQB 2F0PA 4J9PA 5LYJF 2V4DA 2JA7B 5M3MB 5T14A 2FK1A 4QW9A 3N6RA 2A6ED 3ULLA 3S1NH 1NR4A 1RODA 5C4JB 4LF4L 3V6HA 3BG3A 1JDBB 4QIWE 3RBEA 3GTJA 1RDPD 3MAQA 3D4DA 1VQ9A 2VUMB 3E3XA 3GTOB 3Q2OA 3R3OA 2RGRA 1EQTA 3H0GB 5EGTA 1PH6A 4DV5L 3PO2B 4EEYA 1ZETA 1ZYRC 3MWYW 2Z9HA 1S0MA 3H3VC 5KX5F 2ZXPA 2O2LD 3BQ1A 4F50A 2ENBA 3NP8A 3TINA 3KF6A 3H4BA 1WYDA 2QEXA 5IYBG 1H9SA 1V9PA 1B3AA 1EQRA 3GIKA 5JJZA 3PW2A 1K83H 4IPDA 1YJ9A 4DV7H 1KDBA 1C9OA 4B3SH 1QCBD 1VMPA 2L9HA 2F4VQ 4HIDA 1SNCA 3KDFB 2DWCA 3HOWH 2E5LQ 2ASJA 1ICFB 5C5MA 2WINB 3AB9A 1ET6A 3GO5A 3TSSA 3C1EA 2XGPA 4LF5Q 3DWPA 1PH3A 4LF9Q 1HNXL 2WYOA 5GONF 1IBMQ 3PR5B 1HR0Q 1I6VC 3DM3A 5IIFA 4EEQA 3GTJH 2W6MA 4I7AA 4O3SA 3EPGA 2PW7A 1A6XA 1A9XA 4O3RA 1R9TB 5M5WH 3CMAA 2XC9A 2L11A 3FKIG 3J81W 4ED2A 1GSOA 4P2CB 1HUMA 4ECSA 2UXDH 3LX0A 2E8GA 3TP7A 1C3OA 2ZDGA 4JI1Q 2CW7A 1Y1WB 1LTGD 1SRUA 2KVMA 1DOMA 1EUCB 1I4PA 4RAYA 4A3CH 4JI8L 3K7UC 1M0TA 4J9NA 1I94H 4MNOA 1KRTA 2J7ZA 1UUPA 5FLXW 4J1MA 2XWJB 2XRSD 4QUCA 4GOPC 3TS0A 1SDFA 3HOWG 2NN6I 2EYMA 1D2BA 5FPOA 1KRSA 5GADC 3GIJA 3BG5A 4QIWB 1C30A 5KFGA 3BVMA 5CBAE 1VAJA 1IL8A 3NQTA 1RYSA 1CHPD 2ZXRA 2HUGA 3IRBA 1CUKA 3C1FA 1JDEA 3UDGA 2ZTCA 3D4WA 1NR2A 5E7NA 3T1HL 2K75A 1TWGA 1N34Q 4IRDA 5FO8B 4CJ1B 1TIID 4K5VA 5EAYA 4IUQA 3TP8A 1E24A 4OWTB 3MXPA 4GNXA 4RNOA 1E4EB 3ULJA 1Y1VH 4B9XA 2UVWA 4BXXH 2UXBH 4XT1B 4BWSC 3F8TA 4YWMA 5C44B 1HNWL 4PQXA 2MP1A 2F0EA 3S2HB 1CQFA 3AU7A 1BDOA 1N33L 4LMYA 3MFIA 3L4JA 4LFAH 1XYIA 3L7ZC 4GS3A 4JV1A 4PMBA 1VQ4A 3P1HA 1U4MA 4CDDC 1SSOA 2KA7A 4QQBX 2IY5B 1GSAA 1BCPF 2ATLA 2VW9A 3ONAB 1JOOA 1F9QA 3OSOA 2IX0A 5DLGA 5EPKA 4DV6H 1HH2P 4LF6L 3ETHA 1PYWD 3SK8A 4JI5L 4JBMA 4DR5L 2GVAA 1W6KA 2GPWA 4PZ8A 2RVLA 2ZDQA 2LY7A 3A8JE 1KEEA 2PZWA 5F9LA 1LACA 2JEJA 4ME3A 1TWGH 4RGNA 2MHVA 4B3RL 1ULZA 5COYA 3S24A 5LMNW 4L5TA 1LT6D 4WJ4A 2KHIA 2Q2IA 2LMCB 2OTLA 4F4ZA 1XX8A 2K1BA 4DV2L 4TQRA 4BXXG 4DR2H 4ZCKA 1VCIA 4A3IH 1I4HA 5C1PA 2DGYA 3HZXA 5F9NA 5KFOA 1IZ6A 2F0IA 3R8BA 4DAMA 1F2LA 2CQYA 4EVOA 1EWCA 2VZAA 2XTIA 4RUAA 4JI0H 2BQ3A 3N40P 4BBSH 3OOCA 2EOTA 1NUCA 3CMEA 2VQFQ 1DCZA 5FD6A 4NXMQ 3KBGA 3UI2A 1PH9A 4GC6A 1U5KA 5K2MA 3L2PA 4H44C 1WTVA 1Z2PX 4A3EB 3Q23A 4EYIB 4HIMA 4B3SL 2Q8RE 5IGBA 3PVXA 4YR2A 4OX9Q 5DM73 1NSNS 5C0XJ 2RDFA 2F0TA 4EGJA 4C2MH 3NELA 2BA1A 2R7LA 4YWLA 1KJJA 3SK5A 3OYYA 5A2QE 3M7GA 2YTVA 4GLXA 2JEFA 1TQOA 4IQZA 3M4OB 4UCOA 2JA9A 1UE7A 3HOUB 5BMVF 3BU2A 2RCNA 3MWEA 1M8AA 1N56A 4O2DA 2N3SA 1JE5A 4I55F 4CBVA 4HR7B 1YNNC 3MEHA 2EJFC 2HCCA 1HA6A 4ECZA 2F0QA 2F4VL 5KYIA 4WJ3M 1FJGQ 3F2CA 1GXDC 3VA5A 3U9OA 1HHVA 4DKAC 2M00A 2E5LL 2AGPA 1KABA 2DUDA 4TQSA 1RTOA 1KQSA 4QW8A 3GTLB 3LWBA 3EFXD 2YS6A 4QF4A 4LF9L 1D7QA 5L1IA 1SYCA 1VQLA 4FF4A 3JSNA 3JC66 4UCSA 5KFTA 3TP5A 1IBML 1HR0L 5EWEA 2B2UA 1UC8A 4DAVA 1BCPC 1B4OA 5FO7B 2RHQB 2RDGA 2MCTA 1PFNA 2EXZA 1VQNA 1SYBA 3LGJA 2N55A 4A3GH 4CDFC 4X66Q 2WB1A 2F0DA 5JAVA 2JE6I 3CRLC 4JI1L 5CV8A 1JCKB 1EQVA 1PTOH 1C48A 2WAQA 2K32A 5KFQA 3ITPA 4DAYB 4EBDA 1U4LA 3S17H 3RV4A 1S9FA 1HZCA 1CQJB 1N32H 3WNZA 2LFNA 4OELB 1EIHA 2F3VA 2E2IH 4MAMA 4JI6Q 4FF2A 4BY1G 1JORA 1YEZA 2F0MA 3T56B 3VR6A 3F2DA 5KFLA 4HEDA 5DQGA 4LFCQ 1OWTA 1D1KA 4N8FA 1TXYA 4IRKA 5ELNA 1M7JA 5I47A 1IXRA 2EE1A 2F0HA 2WP8J 1VQ8A 1FNVA 3SI8A 1L2FA 5IP9G 3V4ZA 3O13A 3Q6SA 5CB4F 2EZVA 2UUAH 5C3WA 3KAKA 1GUGA 3J80W 2G9HD 2EPBA 4A3GG 3D8GA 3NBHB 1B04A 3Q8SB 3K58A 4ZRZA 5KNCA 4JK1C 1SMYD 1JWSD 3CP0A 4MA0A 1KLUD 2KUMA 3SK6A 5KRUA 3X3MA 5KYLA 2W6OA 2J6UA 1YNND 5J1ZA 5H1SE 1PHJA 2JEAI 1A2TA 1D5MC 1RCVD 5IOCA 3B6YA 5GAEC 1SXTA 3C3LA 2C2DA 2OEOA 3SK4A 1VQFA 4KKTA 3OHAA 2NVQB 1M0WA 3BZDB 2EYJA 4IUUA 5IYCH 3I4MB 1UE6A 1TKWB 3OPOA 3H3VI 3S15B 1ZQ7A 1BCPD 3MWDA 2UVUA 2E76C 1IHZA 1TVXA 1ASZA 3UDFA 1BKBA 2IT1A 1PFBA 3NTHA 2CWPA 1GJXA 1U9RA 2Z6KC 4R4CA 3RD4A 3RLNA 2PI2E 4JBWA 3CF5A 3EQLC 3AFPA 3GIDA 1B7YB 3CAMA 3V6JA 1OXVA 4K5WA 4UHVA 2WB1G 4G57A 2WAQG 1YHAA 2CHBD 3WOFA 3V4SA 4XIGS 3OHBA 5EOYA 3T16A 5EPJA 4RAZA 3AQQA 4EQNA 3NEMA 2AUKA 2VQFL 4ECRA 4NXML 2RF4A 2K5NA 4J6HA 1P8LA 1K0RA 4CC5A 3EPIA 1GVPA 1S68A 4QWEA 5DGAA 3E0JA 1TWHA 5IYCG 4LSXA 2V4RA 4OX9L 2R84A 1SR3A 3L0OA 5CA0F 5KNDA 1QZHA 2MUYA 2ZT9C 3J7ZC 2X6GA 2PVPA 4C5CA 4ECWA 4YIJA 4FM9A 4RGOS 5I4DA 2FJ2A 4XZ3B 1EYDA 1O78A 2NB0A 3OUUA 1IBKQ 4HNTA 1YBYA 2CW8A 4B3MQ 3N43B 1G51A 4YHHQ 3S2DB 2Y0SE 5M3MH 2V58A 1EWHA 2FKLA 1OTCA 3PR4A 2ZXOA 3CPFA 1CSQA 5I6WA 4K2LA 4G7HC 3DEPA 1FJGL 4A93H 3I4NB 1X3EA 2CZGA 2CW0C 5FKAC 2XD4A 1MHWC 2AQ3B 3VYTA 4IR9A 1I6HB 1W2BA 4IUNA 2BA0A 1NE3A 3T1YH 1B9MA 5DQIA 3PW0A 4RGTA 1D6EC 4DR1H 3H0GH 2GVBA 4EYHB 1KAAA 1EIGA 1TWHH 2BQUA 4FF3A 1S72A 2YZGA 2F0GA 1Q86C 2UUBQ 1JMCA 4OO1I 2DNEA 3PIPA 4DFAA 1PV4A 2XGTA 2EYFA 1LT3D 1EYZA 4X3KA 4ED8A 1MSHA 3A5UA 2H5XA 4APVA 3J7A5 5J2TF 5DLFA 3CC2A 1I50B 4X66L 2HCIA 5DGBA 1HA5A 1Y14B 4I7HA 3A54A 1A15A 4Y8VB 3RZDB 2QDLA 2Z6BA 4JI2Q 4L1KA 1VQGA 3GIMA 3P7JA 4PNYA 2CKZB 1T3NA 2I5HA 1NCVA 4RZRA 2ICIA 1J5EQ 4A93G 1S3OA 1KHIA 4JI6L 1MD2D 1NBWA 3NWSA 1P16A 4TQUS 3M9MB 1WOCA 3CQZA 4DV5Q 4AYBA 4LNQA 2X69A 2YU9A 1EL0A 4Q8FA 4LFCL 2H1EA 3MA2B 4DV1H 4F88A 3FP9A 2ES2A 5BPHA 1BUVT 1VF7A 4BY1B 2F3WA 4RB3C 4RKLA 2VB3X 1AP0A 5LMNQ 3PF5A 1K1QA 4YP3A 3TEHB 2W7OA 5DG7A 4IJHA 4O3PA 3HOZH 1RJTA 1MGSA 4DN4M 1GM5A 2W9CA 4HYKA 4JI3Q 1CKNA 3NENA 4DR7Q 4IFDI 1EYAA 1G91A 4DUYH 1DYQA 2Y0SB 2RKSA 1LUZA 4BBRB 4FS2A 3NWTA 2DY8A 2I5LX 4ZQIA 4RU9A 3ORRA 2YYAA 3GILA 1JJGA 3K5IA 4FXKC 4PDBA 2DPIA 1VQCA 1A3UA 4DR3H 4N9TA 4IZOA 1VQ7A 3HOVB 2OWOA 3NK9A 3SGIA 4A75A 3TIGA 2AMCB 4DV3H 1X3QA 2RBMA 3CQZH 2NVXB 3DHQA 4POGA 1WTXA 4FXGC 2YU9H 1L1OA 2EYLA 2B63B 1I4XA 4IHJF 1M1KC 2CH4A 3TS2A 2V9WA 1M90C 2E74C 2K52A 5I6YA 5M3FB 1WSCA 4O4LF 1GUNA 5T1IA 4ZAIA 1V1QA 5GQOA 4ME5A 4ZI7F 3HOZG 1U4PA 1F2YA 3K5LA 1ENFA 3K7AB 3GTQH 3CU7A 4KHPQ 3KHLA 1EZ6A 4LWCA 5BN4A 2A6EC 1W93A 1CTMA 4MV6A 3H91A 1NJIC 4G7OC 2A1AA 5JVG3 4O2AF 2HIVA 4IN3A 4Q8EA 2PNRC 2JA8H 1Z6HA 4X62Q 4A3FG 3MXNB 3SE7A 3MFHA 3QG1A 3OSPA 1B33N 3GTPA 1GYFA 3H6MA 4ZK9B 5LMUQ 3QFFA 4A3DH 2E2HB 3HKZE 4PZ7A 3SR1A 4EQOA 4AYBG 1A2UA 5JH7F 5DG9A 2NN6H 4NP5A 1KC8C 3Q22A 4DL5A 4WFN3 1X6OA 1G6ZA 4DL6A 3RV3A 1VDZA 1SFOB 3J81L 2BDNA 3HG9A 2K4KA 5KFUA 2GPSA 1GUTA 2R93B 1VQOA 4XXEA 1B70B 5I9PA 4DR1L 2YL2A 3ZJYC 3KHHA 3RGXA 4BY7H 2N88A 2RQXA 1IBKL 5IYZF 4B3ML 3D3RA 5FLXL 2R61A 4OWWB 2WKCA 4YHHL 4P73A 2Z8LA 2HQEA 3T53B 2X0SA 3MR6A 3E9IA 3DMUA 3TP6A 3K59A 2N49A 3KAJA 4V190 1PYSB 2ALZA 2BE5C 4A3DG 4Q0FA 2KQ3A 2JQOA 1UNNC 4DL2A 1FYCA 1WFQA 5FO9B 4C3IH 3F1ZA 4HTHA 2MGSA 1O7IA 3IKJA 4UP9A 2PMZA 2EVBA 1SYFA 5HURA 1NNXA 1K8MA 5EDWA 3GTMB 2UUBL 3RB6A 1AE2A 3WDNA 4YQWA 3UE0A 3PV0A 3DM1A 5EKIA 1BCPB 3U9SA 3M4OH 4NXNH 3FVQA 1II3A 4DV1L 3FPPA 2ZJQA 3L3OC 1AUVA 2I5MX 3S1MB 3K3PA 3M4QA 5ELCA 4UPAA 2E2JB 2C9OA 1AFPA 3L4KA 2R7MA 4BY7G 4DV0H 1YHQA 4Q0YA 5KFIA 4C3JG 2RDJA 2PO4A 3R2TA 1M6VA 2DY7A 3MR3A 4DUZH 5IGDA 4JI2L 2R8KA 3RLFA 4DV7Q 1XPRA 5IP7H 1NTGA 1HJPA 5FJ8H 2VY3A 5FLMH 4B3SQ 5KFYA 3EROA 1XNRQ 4UCUA 1W3SA 1J5EL 4ALPA 3M3YH 2SNMA 4J9MA 1CS0A 4N9PA 3GV5B 1KDCA 3HKZB 4FYDA 5JJLA 2FMCA 4E4TA 1Q12A 5ELEA 3KK7A 3A8IE 1S40A 5KT2A 2AU0A 2KCTA 2VXWA 4LUOA 1F2ZA 3VR4A 1L0WA 1BF4A 1ZKOA 3JAMW 5CV4A 3OUZA 2VA3A 4DR3L 3MEFA 4C3IG 3H15A 5FD5A 5M5XB 1B2TA 1A3TA 3CVZA 5LMNL 3RLOA 4DF7A 1WJJA 2OQ0A 3WO1A 5LHY1 3EN2A 1ESFA 4ED3A 2UXDQ 3KF8A 1AEXA 4JI3L 2FK2A 1XNRH 1TWAA 4DR7L 3TIIA 3BYYB 3VR2A 1E4GT 4JI4H 2FXQA 3PIO3 2K05A 3SEBA 3CCUA 4CJ2C 4AQYH 2D0OA 1SE4A 3U4ZA 4DK3C 4TKOB 3R23A 4YJ3F 2CQAA 4GZYC 4K6LA 2SEBD 1I94Q 2PQAB 3F2UA 3ICEA 5IP7G 1SYXB 1YNJD 5FJ8G 5FLMG 3NUCA 4EQPA 5FOBB 3H40A 5AJ3Q 5M5YB 2DIKA 5KG1A 1TT2A 2W8KA 4DGZA 2BE5D 3HOYB 4UCTA 3PQIA 1H9RA 1CE8A 1STEA 3HOXB 4ECVA 1T36A 5ISRA 3N8DA 2ZDHA 5IWAH 3QZ8A 4O3QA 5J3BA 1TWFB 5D3IB 4RZQA 1JWMD 1Y1VA 3QZ7A 4JBKA 4XTCS 1BBXC 3PO3H 3RJ0A 4RUCA 3N44B 1YHBA 2NU7B 5D1OB 3CCJA 3H4DA 4EX5A 1V43A 4RHRA 2F52A 1EY6A 4G7ZC 4KK7A 1LTBD 1VQDA 1RF2D 2K50A 1Q46A 2R8JA 1Z2OX 2WV6D 2FMAA 1TWAH 2UXBQ 2Q8IB 5C1OA 1T94A 4KHPL 1QVCA 5D3DA 4A3KB
chains in the Genus database with same CATH topology
3J80i 4YY3L 3RZOH 2RHQB 4LFAQ 1VQNA 5JEAJ 3LGJA 1B8AA 3K80C 5C44G 3OW2A 1E1OA 3AFQA 4X62L 3Q8DA 4X64Q 4DR4L 4A3GH 2QGQA 2NVQH 4X66Q 1HZBA 2JE6I 3PUYA 4JI1L 5M5XH 2VQEQ 4NXNQ 5LMUL 4DV6Q 1L1OC 2UXCQ 1VQMA 4IOCA 2ZTDA 3DLLA 1UEBA 4DAYB 1A8VA 4YCVA 3U50C 3S17H 2Z6KA 2V1CC 1YVCA 1HZCA 4DV0Q 2JA8G 4LFBQ 4A3EH 4JG2A 4IFDG 1KAWA 2CFMA 4DUZQ 2AWOA 1MKHA 2Q2HA 4POFA 2E2IH 4JI6Q 3PO3G 2ZJRA 4BY1G 2NZHA 4JI7L 1WI5A 1YEZA 2UUCL 1XMQQ 2ATWA 3F2DA 4A3BH 1N36L 1IL2A 3CCQA 2NN6G 4A3CG 4LFCQ 4LUVA 1VQPA 3CCEA 1OXSC 1TXYA 2C35B 1VQKA 4IPHA 1Z47A 5ELNA 2WB1E 3STBD 3D0FA 3CCRA 4DR2Q 5M5YH 1IXRA 2WP8J 2VQEL 1EQQA 1VQ8A 3HOYH 4GN4B 1XJVA 3HOUH 1EIFA 1L2FA 5IP9G 3UDXA 3HKZG 3HOXH 4HJ5A 5JJIA 4OXPA 4JI0Q 2NZOA 1EWIA 1YZ6A 4LF4Q 3ULPA 1XTDA 2D62A 1TWFH 4BA2I 3GTGH 4A3GG 3NBHB 1H95A 5JEAG 3W1BA 4P71A 3CP0A 3EBEA 1OXXK 3PGZA 2KBNA 3BZKA 1SE8A 4H02A 4GOPB 5H1SE 4HJ7A 1PHJA 4JI4Q 2JEAI 3GTLH 4AQYQ 1GD7A 1SROA 3BZCA 3G71A 4DUYL 2OCEA 1VQ6A 3B6YA 2MO0A 5GAEC 4A3EG 4TVAB 1Y1VG 5ELOA 3KOJA 1VQFA 1X54A 5IT9c 1X65A 4QGUA 4Y52H 1JJCB 4A3KH 4A3BG 2HIXA 5IYCH 4HIKA 1UE6A 3H3VI 4DV3L 1KIXA 4JYAL 1Q1EA 5IWAQ 4GKJL 1ASZA 4DV7L 3UDFA 1BKBA 2IT1A 2CWPA 4AYBE 3HOYG 2Z6KC 4R4CA 3HOUG 1T9HA 3HOXG 1XNRL 3RLNA 2MFIA 2PI2E 4JBWA 3CF5A 4GNXC 4HJ8A 1A62A 3FKIH 3CC4A 3AFPA 3J80c 1B7YB 3CAMA 3STBC 4DK6C 1OXVA 1HNXQ 3GDEA 4A3FH 4B3TL 2A8VA 1VQBA 3I7FA 4L5SA 4LW1A 3F2BA 2CWAA 2WB1G 4DNIA 5IE8A 3KLWA 1C7YA 2WAQG 1YHAA 1HZ9A 4OONA 1SLJA 4XIGS 4RG1A 3PUVA 1PH4A 1PFSA 1XMOQ 4IPCA 1BBUA 1QZGA 3AQQA 1VQJA 1FL0A 3NEMA 2A19A 2VQFL 2NVYH 3D31A 3U4VA 4NXML 2RF4A 2K5NA 5C3EH 1TWCH 4A3IG 1P8LA 1CKOA 1K0RA 3G4SA 4DR6Q 1GVPA 2UXDL 4A3KG 4Y7NH 1G6PA 1K9MC 2UU9L 5IYCG 4JI8Q 3RZDH 1UE5A 4BBSG 1X55A 4OX9L 1IBLQ 1SR3A 1A0IA 3KFUA 3L0OA 4IOAA 1OXTA 2K5HA 2LXJA 1QZHA 2JA6H 5GAHC 4R1JA 3J7ZC 3PF4A 3KJPA 1I94L 1N32Q 4A3JH 2YTYA 1E22A 4YWKA 4PG3A 4NB3A 4UP8A 1K3RA 5AJ3L 2BH2A 4EQ5A 3CW2C 4C3HH 4A3MH 1XMOL 1YJNA 3EIVA 1C0AA 1IBKQ 1YBYA 1PA6A 3M9BA 2N8NA 1WCMH 1EIYB 4B3MQ 2ZJPA 3HFZB 3T1HQ 5C0XG 1G51A 3A0JA 4YHHQ 2Y0SE 4BA1I 5M3MH 1OTCA 1UWVA 1BVSA 2R7ZG 3CPFA 2JA5H 1CSQA 2GN5A 1FJGL 4A93H 2F3IA 2HHHL 1X3EA 4GLAC 4LF8Q 3I4MH 1RIPA 3S15H 1MJEA 1IBLL 2KENA 2WFWA 4K0KQ 4L5QA 2JEBI 1Q7YC 1AE3A 1HZAA 1W2BA 5C3EG 2CCZA 2UUAQ 2BA0A 1NE3A 2R7DA 3W1GA 3KJOA 1HNZQ 1X3FA 4JV5Q 1HNWQ 3H0GH 4FDBA 2GVBA 1VQEA 4BBRH 4R4QA 2KCMA 2MNAA 1TWHH 1XPOA 2UXBL 3RN2A 3AYHB 1S72A 1N33Q 1YI2A 1Q86C 4KHZA 1MJCA 1YIJA 2UUBQ 1JMCA 2YV5A 4C3JH 4OO1I 3PIPA 4KI0A 2IHEA 2XGTA 1PV4A 4DV4Q 1VQ5A 2MO1A 2NVTH 2JA6G 1N9WA 3HOVH 4LFAL 3A5UA 2H5XA 4LF6Q 4APVA 4A3JG 3J7A5 3K0XA 3CC2A 4R4IA 4X64L 2I0QA 4JI5Q 4GLVB 4X66L 4DR5Q 4NPSA 3AEVA 1D8LA 4NXNL 4A3MG 1EOVA 3S1RH 1MIUA 4DV6L 2UXCL 1Y14B 4JCVE 4GKKQ 2OQKA 1WCMG 3ER0A 4JI2Q 3CPWA 1VQGA 4PZ6A 5M3FH 3GTPH 1VQIA 4YCWA 4DV0L 2CKZB 2ZTEA 4LFBL 3J81j 1CKNB 3FHWA 2I5HA 3M85A 1LTLA 5IYBH 1J5EQ 4DUZL 4B3RQ 2JA5G 5HGQA 4A93G 1S3OA 1KHIA 4JI6L 1NBWA 1Z9FA 1P16A 4TQUS 3I4MG 1WOCA 1EYGA 4HJAA 1N8RC 4DV5Q 1XMQL 4LNQA 4QY7A 2KHJA 4DV2Q 1I3QH 2PI2A 2Q2UA 1KL9A 4QJFA 4LFCL 4JC0A 1YITA 3FP9A 3KF6B 3ERSX 4R4OA 4IFDJ 2ES2A 3OTOQ 1QUQB 2CQOA 3H3VH 4DR2L 3K81C 4J15A 5LMNQ 3PF5A 3M7NA 3TEHB 5C4XH 3PSIA 4IJHA 1U0LA 3ULLA 3S1NH 4LF7Q 1Q8KA 3HKSA 2ASBA 1L1OB 4X65Q 3HOZH 4A76A 5BR8Q 1SMXA 4JI0L 1GM5A 4LF4L 2R92H 4JI3Q 3S16H 2OTJA 3S2DH 3KF8B 1CKNA 3NENA 4QIWE 4DR7Q 4IFDI 2PMZE 3PUXA 1VQ9A 3I4NH 1LUZA 4DV5L 4GOPA 1PH6A 2I5LX 1AH9A 4JI4L 1BBWA 1I6HH 4AQYL 1JJGA 3KF6A 1PYBA 2HQLA 1VQCA 1WYDA 4A3LH 2QEXA 3S1QH 5IYBG 1QUQA 1VQ7A 1V9PA 3GTKH 3U58A 1EQRA 2OWOA 3SGIA 1A63A 1NMFA 4A75A 1K83H 2AMCB 3CCLA 3CC7A 3CQZH 1PH1A 5DLQE 4IPDA 4POGA 1YJ9A 2YU9H 1L1OA 2D0PA 5GAGC 4QL5A 4X6AH 2AWNA 1M1KC 2IX1A 1C9OA 3TS2A 2F4VQ 1M90C 4HIDA 2K52A 3KDFB 5IWAL 1I50H 3HOWH 3I56A 1YNXA 2E5LQ 1Q82C 3TRZA 5C4XG 1V1QA 5GQOA 3GD7A 3GO5A 3HOZG 1LM0A 4LF5Q 2YYZA 2R92G 4KLKA 1PH3A 4LF9Q 1HNXL 5HY6A 1IBMQ 1HR0Q 3DM3A 3VDYA 3GTQH 2K14A 3GTJH 4KHPQ 1E3PA 4LWCA 3T1YQ 4RMFA 1YJWA 4YY3Q 3I4NG 1VS0A 3PUWA 4DR1Q 3GTMH 5GROA 2R7FA 5M5WH 3CMAA 1NJIC 2A1AA 1KXLA 2HIVA 3FKIG 2ZM6Q 1X9NA 2JA8H 2BH8A 4X62Q 1PH7A 3CCSA 4A3FG 2E8GA 1G291 3MXNB 1CKMA 4A3LG 2E2JH 3A74A 1Q1BA 3KDFA 4JI1Q 2N78A 4BY1H 5LMUQ 1RL2A 4A3DH 2JA7H 2L15A 4DR6L 1SRUA 3HKZE 4PZ7A 4AYBG 1KC8C 3UE1A 4A3CH 2IHFA 4JI8L 3K7UC 4LF5L 5C4JH 1X6OA 4IPGA 4MNOA 1KRTA 1OXUA 3I2ZA 4GNXB 1PH2A 2PNHA 3UDIA 2K4KA 4GOPC 3TS0A 4JI7Q 5IY0A 2VUMH 2NN6I 3GTOH 3HOWG 1QVFA 3I4OA 1N32L 1KRSA 1VQOA 1N36Q 2EXDA 5GADC 1B70B 3PO2H 4DR1L 5IP9H 4HJ9A 2B29A 1QVGA 1UE1A 1VQHA 3ZJYC 1SN8A 4HIOA 2YTXA 2ZM6L 4BY7H 1PH8A 1IBKL 3RNUA 3IRBA 4P72A 4B3ML 1CUKA 1JT8A 2ALYB 3UDGA 2ZTCA 5E7NA 3T1HL 4DV1Q 4OWWB 2K75A 4P73A 4YHHL 3BJUA 1N34Q 4JBJA 3E9IA 2NVXH 5JJKA 4P75A 5EAYA 2N49A 3J81c 2B63H 2AKWB 1E24A 4OWTB 3JAMi 2JJQA 4GNXA 4LF8L 2Q2TA 4PMWA 3ULJA 4K0KL 1XNQQ 1Y1VH 1NMGA 4L5RC 4BXXH 1PYSB 3F8TA 1IYJB 4YWMA 2UUAL 4A3DG 1HNZL 2JA7G 5M3MG 1LYLA 1HNWL 4JV5L 2JQOA 4GN5A 1JB7A 1WFQA 4C3IH 3F1ZA 1O7IA 4UP9A 3WWVA 4A4IA 4JOIA 4YCUA 4DUYQ 1N33L 3A5ZB 2UUBL 1AE2A 1VQAA 5FLXc 3L7ZC 4GS3A 3UE0A 3K7AH 2RHSB 3PV0A 1VQ4A 3E9HA 4DV4L 2IY5B 4QQBX 2VUMG 3I55A 3M4OH 2WAQE 2VW9A 4OO1G 2IX0A 4DV1L 2ZJQA 2B3GA 1HH2P 4LF6L 2I5MX 2Y0SG 4OWXB 3M4QA 4DR3Q 3H0GG 4UPAA 1N34L 4JI5L 4BBRG 1R9TH 1I5FA 3TQYA 4JBMA 3PO2G 4DR5L 3M4PA 2GVAA 4BY7G 1YHQA 4DV3Q 4PZ8A 4IJLA 4JYAQ 3W5OA 4GKJQ 1K73C 4JI2L 1E7ZA 1XNQL 3RLFA 4DV7Q 1XPRA 3HOVG 5IP7H 1NTGA 1HJPA 4ME3A 5FJ8H 2VY3A 5FLMH 1TWGH 2AHOB 1Y1WH 1KD1C 2E2HH 4B3SQ 4UY8C 1XNRQ 1W3SA 1J5EL 4ALPA 4B3RL 3M3YH 3S24A 3CD6A 5LMNW 3J81i 2B63G 5IYDH 3PUZA 4L5TA 4B3TQ 2R6GA 4WJ4A 2KHIA 2Q2IA 2OTLA 5JJLA 1SFOH 4UP7A 3TREA 1Q12A 2EIFA 4DV2L 1K8GA 1PVOA 4BXXG 5M3FG 1S40A 1VCIA 2KCTA 2EQSA 4LUOA 4A3IH 1FGUA 2DGYA 1L0WA 1IZ6A 2R93H 4DAMA 4AIMA 3MEFA 4DR3L 3OTOL 3H15A 2VZAA 2XTIA 4BBSH 1NY4A 3CMEA 2VQFQ 5LMNL 3RLOA 4NXMQ 1WJJA 2OQ0A 1E1TA 1EUJA 1PH9A 3EN2A 4LF7L 1U5KA 4GKKL 4X65L 1J6QA 3L2PA 5BR8L 2UXDQ 4IO9A 3PCOB 1PH5A 1GO3E 4JI3L 4HIMA 4DPGA 2UU9Q 4B3SL 4DR7L 2FXQA 3CCUA 2MQHA 3RN5A 1Q81C 1JJ2A 2D0OA 4DK3C 3U4ZA 5C0XJ 3PIOA 4OX9Q 4C2MH 3NELA 1X3GA 2BA1A 4YWLA 3S14H 3OYYA 1I94Q 2PQAB 2HT1A 1ASYA 4P74A 5IP7G 3ICEA 1CSPA 5FJ8G 1Y1WG 5FLMG 2YTVA 5C44H 4JOIC 4GLXA 1FVIA 5AJ3Q 2R7ZH 3CCMA 2ID0A 2JA9A 1X56A 1UE7A 3S2HH 1GKHA 5IYDG 1XPUA 5C0XI 4O0AA 3BU2A 2RCNA 3E0EA 4GN3B 3K8AA 3RR5A 4R4TA 1DGSA 4O2DA 2N3SA 4MZ9A 1JE5A 5J3BA 4DR4Q 3JAMc 2Z0SA 2LXKA 3CCVA 1HR0W 2R93G 3S1MH 4JBKA 2F4VL 2VL6A 4WJ3M 3KYHC 4XTCS 3G48A 3F2CA 2QA4A 4AH6A 4LUZA 1FJGQ 3PO3H 3CXCA 2HHHQ 4DKAC 1YHBA 2E5LL 2DUDA 3CCJA 2JK8A 4EX5A 1V43A 1KQSA 5K36G 2F52A 2K5VA 3G6EA 2PQAA 1VQDA 1K8AC 2VNUD 2VS1A 2K50A 1Q46A 4MTNA 4LF9L 1D7QA 1VQLA 1EFWA 3JC66 1IBML 1TWAH 1HR0L 2UXBQ 2LSSA 4KHPL 2UUCQ 1QVCA 3T1YL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 i;  4YY3 L;  3RZO H;  2RHQ B;  4LFA Q;  1VQN A;  5JEA J;  3LGJ A;  1B8A A;  3K80 C;  5C44 G;  3OW2 A;  1E1O A;  3AFQ A;  4X62 L;  3Q8D A;  4X64 Q;  4DR4 L;  4A3G H;  2QGQ A;  2NVQ H;  4X66 Q;  1HZB A;  2JE6 I;  3PUY A;  4JI1 L;  5M5X H;  2VQE Q;  4NXN Q;  5LMU L;  4DV6 Q;  1L1O C;  2UXC Q;  1VQM A;  4IOC A;  2ZTD A;  3DLL A;  1UEB A;  4DAY B;  1A8V A;  4YCV A;  3U50 C;  3S17 H;  2Z6K A;  2V1C C;  1YVC A;  1HZC A;  4DV0 Q;  2JA8 G;  4LFB Q;  4A3E H;  4JG2 A;  4IFD G;  1KAW A;  2CFM A;  4DUZ Q;  2AWO A;  1MKH A;  2Q2H A;  4POF A;  2E2I H;  4JI6 Q;  3PO3 G;  2ZJR A;  4BY1 G;  2NZH A;  4JI7 L;  1WI5 A;  1YEZ A;  2UUC L;  1XMQ Q;  2ATW A;  3F2D A;  4A3B H;  1N36 L;  1IL2 A;  3CCQ A;  2NN6 G;  4A3C G;  4LFC Q;  4LUV A;  1VQP A;  3CCE A;  1OXS C;  1TXY A;  2C35 B;  1VQK A;  4IPH A;  1Z47 A;  5ELN A;  2WB1 E;  3STB D;  3D0F A;  3CCR A;  4DR2 Q;  5M5Y H;  1IXR A;  2WP8 J;  2VQE L;  1EQQ A;  1VQ8 A;  3HOY H;  4GN4 B;  1XJV A;  3HOU H;  1EIF A;  1L2F A;  5IP9 G;  3UDX A;  3HKZ G;  3HOX H;  4HJ5 A;  5JJI A;  4OXP A;  4JI0 Q;  2NZO A;  1EWI A;  1YZ6 A;  4LF4 Q;  3ULP A;  1XTD A;  2D62 A;  1TWF H;  4BA2 I;  3GTG H;  4A3G G;  3NBH B;  1H95 A;  5JEA G;  3W1B A;  4P71 A;  3CP0 A;  3EBE A;  1OXX K;  3PGZ A;  2KBN A;  3BZK A;  1SE8 A;  4H02 A;  4GOP B;  5H1S E;  4HJ7 A;  1PHJ A;  4JI4 Q;  2JEA I;  3GTL H;  4AQY Q;  1GD7 A;  1SRO A;  3BZC A;  3G71 A;  4DUY L;  2OCE A;  1VQ6 A;  3B6Y A;  2MO0 A;  5GAE C;  4A3E G;  4TVA B;  1Y1V G;  5ELO A;  3KOJ A;  1VQF A;  1X54 A;  5IT9 c;  1X65 A;  4QGU A;  4Y52 H;  1JJC B;  4A3K H;  4A3B G;  2HIX A;  5IYC H;  4HIK A;  1UE6 A;  3H3V I;  4DV3 L;  1KIX A;  4JYA L;  1Q1E A;  5IWA Q;  4GKJ L;  1ASZ A;  4DV7 L;  3UDF A;  1BKB A;  2IT1 A;  2CWP A;  4AYB E;  3HOY G;  2Z6K C;  4R4C A;  3HOU G;  1T9H A;  3HOX G;  1XNR L;  3RLN A;  2MFI A;  2PI2 E;  4JBW A;  3CF5 A;  4GNX C;  4HJ8 A;  1A62 A;  3FKI H;  3CC4 A;  3AFP A;  3J80 c;  1B7Y B;  3CAM A;  3STB C;  4DK6 C;  1OXV A;  1HNX Q;  3GDE A;  4A3F H;  4B3T L;  2A8V A;  1VQB A;  3I7F A;  4L5S A;  4LW1 A;  3F2B A;  2CWA A;  2WB1 G;  4DNI A;  5IE8 A;  3KLW A;  1C7Y A;  2WAQ G;  1YHA A;  1HZ9 A;  4OON A;  1SLJ A;  4XIG S;  4RG1 A;  3PUV A;  1PH4 A;  1PFS A;  1XMO Q;  4IPC A;  1BBU A;  1QZG A;  3AQQ A;  1VQJ A;  1FL0 A;  3NEM A;  2A19 A;  2VQF L;  2NVY H;  3D31 A;  3U4V A;  4NXM L;  2RF4 A;  2K5N A;  5C3E H;  1TWC H;  4A3I G;  1P8L A;  1CKO A;  1K0R A;  3G4S A;  4DR6 Q;  1GVP A;  2UXD L;  4A3K G;  4Y7N H;  1G6P A;  1K9M C;  2UU9 L;  5IYC G;  4JI8 Q;  3RZD H;  1UE5 A;  4BBS G;  1X55 A;  4OX9 L;  1IBL Q;  1SR3 A;  1A0I A;  3KFU A;  3L0O A;  4IOA A;  1OXT A;  2K5H A;  2LXJ A;  1QZH A;  2JA6 H;  5GAH C;  4R1J A;  3J7Z C;  3PF4 A;  3KJP A;  1I94 L;  1N32 Q;  4A3J H;  2YTY A;  1E22 A;  4YWK A;  4PG3 A;  4NB3 A;  4UP8 A;  1K3R A;  5AJ3 L;  2BH2 A;  4EQ5 A;  3CW2 C;  4C3H H;  4A3M H;  1XMO L;  1YJN A;  3EIV A;  1C0A A;  1IBK Q;  1YBY A;  1PA6 A;  3M9B A;  2N8N A;  1WCM H;  1EIY B;  4B3M Q;  2ZJP A;  3HFZ B;  3T1H Q;  5C0X G;  1G51 A;  3A0J A;  4YHH Q;  2Y0S E;  4BA1 I;  5M3M H;  1OTC A;  1UWV A;  1BVS A;  2R7Z G;  3CPF A;  2JA5 H;  1CSQ A;  2GN5 A;  1FJG L;  4A93 H;  2F3I A;  2HHH L;  1X3E A;  4GLA C;  4LF8 Q;  3I4M H;  1RIP A;  3S15 H;  1MJE A;  1IBL L;  2KEN A;  2WFW A;  4K0K Q;  4L5Q A;  2JEB I;  1Q7Y C;  1AE3 A;  1HZA A;  1W2B A;  5C3E G;  2CCZ A;  2UUA Q;  2BA0 A;  1NE3 A;  2R7D A;  3W1G A;  3KJO A;  1HNZ Q;  1X3F A;  4JV5 Q;  1HNW Q;  3H0G H;  4FDB A;  2GVB A;  1VQE A;  4BBR H;  4R4Q A;  2KCM A;  2MNA A;  1TWH H;  1XPO A;  2UXB L;  3RN2 A;  3AYH B;  1S72 A;  1N33 Q;  1YI2 A;  1Q86 C;  4KHZ A;  1MJC A;  1YIJ A;  2UUB Q;  1JMC A;  2YV5 A;  4C3J H;  4OO1 I;  3PIP A;  4KI0 A;  2IHE A;  2XGT A;  1PV4 A;  4DV4 Q;  1VQ5 A;  2MO1 A;  2NVT H;  2JA6 G;  1N9W A;  3HOV H;  4LFA L;  3A5U A;  2H5X A;  4LF6 Q;  4APV A;  4A3J G;  3J7A 5;  3K0X A;  3CC2 A;  4R4I A;  4X64 L;  2I0Q A;  4JI5 Q;  4GLV B;  4X66 L;  4DR5 Q;  4NPS A;  3AEV A;  1D8L A;  4NXN L;  4A3M G;  1EOV A;  3S1R H;  1MIU A;  4DV6 L;  2UXC L;  1Y14 B;  4JCV E;  4GKK Q;  2OQK A;  1WCM G;  3ER0 A;  4JI2 Q;  3CPW A;  1VQG A;  4PZ6 A;  5M3F H;  3GTP H;  1VQI A;  4YCW A;  4DV0 L;  2CKZ B;  2ZTE A;  4LFB L;  3J81 j;  1CKN B;  3FHW A;  2I5H A;  3M85 A;  1LTL A;  5IYB H;  1J5E Q;  4DUZ L;  4B3R Q;  2JA5 G;  5HGQ A;  4A93 G;  1S3O A;  1KHI A;  4JI6 L;  1NBW A;  1Z9F A;  1P16 A;  4TQU S;  3I4M G;  1WOC A;  1EYG A;  4HJA A;  1N8R C;  4DV5 Q;  1XMQ L;  4LNQ A;  4QY7 A;  2KHJ A;  4DV2 Q;  1I3Q H;  2PI2 A;  2Q2U A;  1KL9 A;  4QJF A;  4LFC L;  4JC0 A;  1YIT A;  3FP9 A;  3KF6 B;  3ERS X;  4R4O A;  4IFD J;  2ES2 A;  3OTO Q;  1QUQ B;  2CQO A;  3H3V H;  4DR2 L;  3K81 C;  4J15 A;  5LMN Q;  3PF5 A;  3M7N A;  3TEH B;  5C4X H;  3PSI A;  4IJH A;  1U0L A;  3ULL A;  3S1N H;  4LF7 Q;  1Q8K A;  3HKS A;  2ASB A;  1L1O B;  4X65 Q;  3HOZ H;  4A76 A;  5BR8 Q;  1SMX A;  4JI0 L;  1GM5 A;  4LF4 L;  2R92 H;  4JI3 Q;  3S16 H;  2OTJ A;  3S2D H;  3KF8 B;  1CKN A;  3NEN A;  4QIW E;  4DR7 Q;  4IFD I;  2PMZ E;  3PUX A;  1VQ9 A;  3I4N H;  1LUZ A;  4DV5 L;  4GOP A;  1PH6 A;  2I5L X;  1AH9 A;  4JI4 L;  1BBW A;  1I6H H;  4AQY L;  1JJG A;  3KF6 A;  1PYB A;  2HQL A;  1VQC A;  1WYD A;  4A3L H;  2QEX A;  3S1Q H;  5IYB G;  1QUQ A;  1VQ7 A;  1V9P A;  3GTK H;  3U58 A;  1EQR A;  2OWO A;  3SGI A;  1A63 A;  1NMF A;  4A75 A;  1K83 H;  2AMC B;  3CCL A;  3CC7 A;  3CQZ H;  1PH1 A;  5DLQ E;  4IPD A;  4POG A;  1YJ9 A;  2YU9 H;  1L1O A;  2D0P A;  5GAG C;  4QL5 A;  4X6A H;  2AWN A;  1M1K C;  2IX1 A;  1C9O A;  3TS2 A;  2F4V Q;  1M90 C;  4HID A;  2K52 A;  3KDF B;  5IWA L;  1I50 H;  3HOW H;  3I56 A;  1YNX A;  2E5L Q;  1Q82 C;  3TRZ A;  5C4X G;  1V1Q A;  5GQO A;  3GD7 A;  3GO5 A;  3HOZ G;  1LM0 A;  4LF5 Q;  2YYZ A;  2R92 G;  4KLK A;  1PH3 A;  4LF9 Q;  1HNX L;  5HY6 A;  1IBM Q;  1HR0 Q;  3DM3 A;  3VDY A;  3GTQ H;  2K14 A;  3GTJ H;  4KHP Q;  1E3P A;  4LWC A;  3T1Y Q;  4RMF A;  1YJW A;  4YY3 Q;  3I4N G;  1VS0 A;  3PUW A;  4DR1 Q;  3GTM H;  5GRO A;  2R7F A;  5M5W H;  3CMA A;  1NJI C;  2A1A A;  1KXL A;  2HIV A;  3FKI G;  2ZM6 Q;  1X9N A;  2JA8 H;  2BH8 A;  4X62 Q;  1PH7 A;  3CCS A;  4A3F G;  2E8G A;  1G29 1;  3MXN B;  1CKM A;  4A3L G;  2E2J H;  3A74 A;  1Q1B A;  3KDF A;  4JI1 Q;  2N78 A;  4BY1 H;  5LMU Q;  1RL2 A;  4A3D H;  2JA7 H;  2L15 A;  4DR6 L;  1SRU A;  3HKZ E;  4PZ7 A;  4AYB G;  1KC8 C;  3UE1 A;  4A3C H;  2IHF A;  4JI8 L;  3K7U C;  4LF5 L;  5C4J H;  1X6O A;  4IPG A;  4MNO A;  1KRT A;  1OXU A;  3I2Z A;  4GNX B;  1PH2 A;  2PNH A;  3UDI A;  2K4K A;  4GOP C;  3TS0 A;  4JI7 Q;  5IY0 A;  2VUM H;  2NN6 I;  3GTO H;  3HOW G;  1QVF A;  3I4O A;  1N32 L;  1KRS A;  1VQO A;  1N36 Q;  2EXD A;  5GAD C;  1B70 B;  3PO2 H;  4DR1 L;  5IP9 H;  4HJ9 A;  2B29 A;  1QVG A;  1UE1 A;  1VQH A;  3ZJY C;  1SN8 A;  4HIO A;  2YTX A;  2ZM6 L;  4BY7 H;  1PH8 A;  1IBK L;  3RNU A;  3IRB A;  4P72 A;  4B3M L;  1CUK A;  1JT8 A;  2ALY B;  3UDG A;  2ZTC A;  5E7N A;  3T1H L;  4DV1 Q;  4OWW B;  2K75 A;  4P73 A;  4YHH L;  3BJU A;  1N34 Q;  4JBJ A;  3E9I A;  2NVX H;  5JJK A;  4P75 A;  5EAY A;  2N49 A;  3J81 c;  2B63 H;  2AKW B;  1E24 A;  4OWT B;  3JAM i;  2JJQ A;  4GNX A;  4LF8 L;  2Q2T A;  4PMW A;  3ULJ A;  4K0K L;  1XNQ Q;  1Y1V H;  1NMG A;  4L5R C;  4BXX H;  1PYS B;  3F8T A;  1IYJ B;  4YWM A;  2UUA L;  4A3D G;  1HNZ L;  2JA7 G;  5M3M G;  1LYL A;  1HNW L;  4JV5 L;  2JQO A;  4GN5 A;  1JB7 A;  1WFQ A;  4C3I H;  3F1Z A;  1O7I A;  4UP9 A;  3WWV A;  4A4I A;  4JOI A;  4YCU A;  4DUY Q;  1N33 L;  3A5Z B;  2UUB L;  1AE2 A;  1VQA A;  5FLX c;  3L7Z C;  4GS3 A;  3UE0 A;  3K7A H;  2RHS B;  3PV0 A;  1VQ4 A;  3E9H A;  4DV4 L;  2IY5 B;  4QQB X;  2VUM G;  3I55 A;  3M4O H;  2WAQ E;  2VW9 A;  4OO1 G;  2IX0 A;  4DV1 L;  2ZJQ A;  2B3G A;  1HH2 P;  4LF6 L;  2I5M X;  2Y0S G;  4OWX B;  3M4Q A;  4DR3 Q;  3H0G G;  4UPA A;  1N34 L;  4JI5 L;  4BBR G;  1R9T H;  1I5F A;  3TQY A;  4JBM A;  3PO2 G;  4DR5 L;  3M4P A;  2GVA A;  4BY7 G;  1YHQ A;  4DV3 Q;  4PZ8 A;  4IJL A;  4JYA Q;  3W5O A;  4GKJ Q;  1K73 C;  4JI2 L;  1E7Z A;  1XNQ L;  3RLF A;  4DV7 Q;  1XPR A;  3HOV G;  5IP7 H;  1NTG A;  1HJP A;  4ME3 A;  5FJ8 H;  2VY3 A;  5FLM H;  1TWG H;  2AHO B;  1Y1W H;  1KD1 C;  2E2H H;  4B3S Q;  4UY8 C;  1XNR Q;  1W3S A;  1J5E L;  4ALP A;  4B3R L;  3M3Y H;  3S24 A;  3CD6 A;  5LMN W;  3J81 i;  2B63 G;  5IYD H;  3PUZ A;  4L5T A;  4B3T Q;  2R6G A;  4WJ4 A;  2KHI A;  2Q2I A;  2OTL A;  5JJL A;  1SFO H;  4UP7 A;  3TRE A;  1Q12 A;  2EIF A;  4DV2 L;  1K8G A;  1PVO A;  4BXX G;  5M3F G;  1S40 A;  1VCI A;  2KCT A;  2EQS A;  4LUO A;  4A3I H;  1FGU A;  2DGY A;  1L0W A;  1IZ6 A;  2R93 H;  4DAM A;  4AIM A;  3MEF A;  4DR3 L;  3OTO L;  3H15 A;  2VZA A;  2XTI A;  4BBS H;  1NY4 A;  3CME A;  2VQF Q;  5LMN L;  3RLO A;  4NXM Q;  1WJJ A;  2OQ0 A;  1E1T A;  1EUJ A;  1PH9 A;  3EN2 A;  4LF7 L;  1U5K A;  4GKK L;  4X65 L;  1J6Q A;  3L2P A;  5BR8 L;  2UXD Q;  4IO9 A;  3PCO B;  1PH5 A;  1GO3 E;  4JI3 L;  4HIM A;  4DPG A;  2UU9 Q;  4B3S L;  4DR7 L;  2FXQ A;  3CCU A;  2MQH A;  3RN5 A;  1Q81 C;  1JJ2 A;  2D0O A;  4DK3 C;  3U4Z A;  5C0X J;  3PIO A;  4OX9 Q;  4C2M H;  3NEL A;  1X3G A;  2BA1 A;  4YWL A;  3S14 H;  3OYY A;  1I94 Q;  2PQA B;  2HT1 A;  1ASY A;  4P74 A;  5IP7 G;  3ICE A;  1CSP A;  5FJ8 G;  1Y1W G;  5FLM G;  2YTV A;  5C44 H;  4JOI C;  4GLX A;  1FVI A;  5AJ3 Q;  2R7Z H;  3CCM A;  2ID0 A;  2JA9 A;  1X56 A;  1UE7 A;  3S2H H;  1GKH A;  5IYD G;  1XPU A;  5C0X I;  4O0A A;  3BU2 A;  2RCN A;  3E0E A;  4GN3 B;  3K8A A;  3RR5 A;  4R4T A;  1DGS A;  4O2D A;  2N3S A;  4MZ9 A;  1JE5 A;  5J3B A;  4DR4 Q;  3JAM c;  2Z0S A;  2LXK A;  3CCV A;  1HR0 W;  2R93 G;  3S1M H;  4JBK A;  2F4V L;  2VL6 A;  4WJ3 M;  3KYH C;  4XTC S;  3G48 A;  3F2C A;  2QA4 A;  4AH6 A;  4LUZ A;  1FJG Q;  3PO3 H;  3CXC A;  2HHH Q;  4DKA C;  1YHB A;  2E5L L;  2DUD A;  3CCJ A;  2JK8 A;  4EX5 A;  1V43 A;  1KQS A;  5K36 G;  2F52 A;  2K5V A;  3G6E A;  2PQA A;  1VQD A;  1K8A C;  2VNU D;  2VS1 A;  2K50 A;  1Q46 A;  4MTN A;  4LF9 L;  1D7Q A;  1VQL A;  1EFW A;  3JC6 6;  1IBM L;  1TWA H;  1HR0 L;  2UXB Q;  2LSS A;  4KHP L;  2UUC Q;  1QVC A;  3T1Y L; 
#chains in the Genus database with same CATH topology
 3RZO H;  2NWG A;  2IX3 A;  2PCF B;  2J9G A;  3G6X A;  3KLS X;  1F9S A;  4LFA Q;  5IOD A;  5JEA J;  1E2W A;  3RB3 A;  2HJW A;  4IWY A;  4NKL A;  1W6J A;  4GC7 A;  4DR6 H;  1E1O A;  4X62 L;  4X64 Q;  5JVL A;  2QGQ A;  2NVQ H;  5JEA H;  4R7R A;  2TMP A;  1B9N A;  5BN5 A;  5LMU L;  4DV6 Q;  5ELF A;  2UXC Q;  2FLN A;  3RIZ A;  3BAB A;  5KT4 A;  2L5T A;  4O4I F;  3NHH A;  1A8V A;  5KFA A;  3KAL A;  1O7Z A;  1O80 A;  4DK1 A;  4LFB Q;  4U6P A;  1KJQ A;  2Q2H A;  5DAU A;  3PO3 G;  4RNN A;  2NZH A;  5C3X A;  4RCO A;  5IT9 W;  3K5H A;  4DA2 A;  4A3B H;  1SYG A;  2R7Z B;  5L9X A;  3A55 A;  4F7X A;  2R3Z A;  3BVG A;  4A3C G;  2FPP B;  5KFJ A;  4R8I A;  2QDB A;  3LWU A;  4LUV A;  1VQP A;  4YR0 A;  3K6O A;  2B2T C;  2B2V C;  2L12 A;  2NVY B;  4X64 H;  3STB D;  2W6Z A;  3CCR A;  2DLN A;  4DR2 Q;  1TWC B;  3RBD A;  4K5X A;  2UXC H;  1BR9 A;  1F9R A;  2GLT A;  4LF8 H;  4Y7N B;  4C56 C;  1ENC A;  2K5W A;  3UDX A;  4RH6 A;  5I9O A;  1GOZ A;  3RAQ A;  4JI0 Q;  1LTT D;  1HNZ H;  4C2M A;  4LFB H;  4JV5 H;  3M4Y A;  3GTG H;  2JA6 B;  1SEB D;  3TN2 A;  5JEA G;  4YBZ B;  1BXR A;  3QWN A;  3PGZ A;  2NU6 B;  2EY1 A;  2AGO A;  2KBN A;  3MJF A;  3VPD A;  5CC4 A;  3NXW A;  2W9B A;  2A73 B;  4DV4 H;  4C3H B;  4A3M B;  3R5F A;  1SRO A;  1V8Q A;  2B2U C;  1VQ6 A;  2R7N A;  2YW2 A;  4I50 F;  1BJT A;  3J80 L;  1Y1V G;  3H94 A;  1CA6 A;  1X54 A;  2RGV A;  1V1P B;  5IGC A;  5KFD A;  4A3B G;  1GUW A;  2JA5 B;  4R8U B;  4J8Q A;  4ECQ A;  5JVD F;  1GLV A;  2WII B;  3URY A;  5L1K A;  2UVV A;  1S97 A;  1Q1E A;  4APM A;  4EBC A;  1KDA A;  2C22 A;  2QKI C;  4DV7 L;  2EYP A;  2O4X A;  3OMG A;  3V2T A;  2W6N A;  1MSG A;  4JV2 A;  2J0T D;  4DLK A;  1XNR L;  1C8C A;  5J39 A;  1Y8O B;  2BDO A;  1TS3 A;  2RDH A;  1JOQ A;  1EUD B;  3J7A F;  4J9R A;  2PBZ A;  3GDE A;  3NTK A;  3I7F A;  2A8V A;  1WCM A;  3OTO H;  3F2B A;  2A6H D;  3GQB A;  4DNI A;  4CJ0 B;  5C0X H;  1T5X D;  1BO0 A;  2W8L A;  3GIP A;  4LH6 A;  1HZ9 A;  2KEE A;  4RAU C;  4LF7 H;  3S1R B;  4EFE A;  4IPC A;  1BBU A;  1I4R A;  1QZG A;  4XDX A;  2VUG A;  5BR8 H;  1VQJ A;  2A19 A;  1PDQ A;  1QNU A;  1ONL A;  1STH A;  1SMY C;  5C3E H;  4HMJ A;  4A3I G;  3K0Y A;  2CH4 W;  3VR3 A;  4IAL A;  3G4S A;  2UXD L;  1WR2 A;  3DXJ C;  3QR8 A;  4QWC A;  1PTO D;  2E2I A;  5KT5 A;  2F0L A;  4ULL A;  3RZD H;  5C6A A;  4BBS G;  1A0I A;  1OXT A;  5KFM A;  2QF7 A;  1D5Z C;  4MIU A;  4R1J A;  3PF4 A;  4JV0 A;  1I94 L;  1N32 Q;  1DOK A;  1EY5 A;  4A3J H;  3K5N A;  1K3R A;  5AJ3 L;  2BH2 A;  4TV8 F;  2DN8 A;  1YJN A;  3BYT B;  1C0A A;  5KG5 A;  1FKA H;  3S1N B;  2N8N A;  1WCM H;  3BVZ A;  3HFZ B;  5C0X G;  5FK9 C;  1ZHQ A;  4BA1 I;  5KFN A;  4V0B A;  1UWV A;  1BVS A;  2FPG B;  3PMF A;  4ME6 A;  2OF1 A;  4MN3 A;  2WFW A;  4IAJ A;  5ELD A;  2MJ8 A;  2JEB I;  3FKI B;  1B3Q A;  5C3E G;  1PRT F;  5NUC A;  2UUA Q;  3M4I A;  4YY3 H;  1X3F A;  1CM9 A;  4OGQ C;  4FDB A;  4BBR H;  1RHP A;  2K03 A;  1SBB B;  4OL7 A;  2UXB L;  3BDC A;  1K83 B;  2ZM6 H;  4KHZ A;  4F4X A;  3RFC A;  2YV5 A;  5BN3 A;  4KI0 A;  3D6C A;  3HOV H;  2R92 A;  4LFA L;  4A3J G;  3C2P A;  1PZJ D;  4X64 L;  4GLV B;  3HOW B;  4IRC A;  3AEV A;  3WOE A;  1D8L A;  2H4O A;  1EOV A;  4DV6 L;  2UXC L;  4HCS A;  5KFE A;  4EGV A;  3BA8 A;  1WCM G;  5M3F H;  4XQN A;  4JI7 H;  5K5P A;  1KLG D;  3F8N A;  2FLP A;  4RA8 A;  1H9M A;  2JSO A;  4LFB L;  1N36 H;  3GTK A;  3GTJ B;  2B2Y A;  5KT3 A;  2XNA C;  4CC6 A;  4XYL B;  3RAX A;  4QMG A;  4KY6 A;  1N8R C;  2WDT A;  5M5W B;  2KHJ A;  4TRD A;  1I3Q H;  2IMW P;  2MPM A;  1YIT A;  1XTC D;  3KF6 B;  3ERS X;  4R4O A;  4IFD J;  1H9S B;  2CQO A;  4O3N A;  4DR2 L;  4E6I A;  5KG7 A;  3K81 C;  4IUP A;  1AN8 A;  4IFD H;  5C4X H;  4FXD A;  2KJX A;  4IZ8 A;  1U0L A;  5E1F A;  4DU9 A;  1Q8K A;  1FGB D;  5LOV F;  1XNQ H;  3QB3 A;  5C4H A;  4JI0 L;  1SMX A;  1X32 A;  2R92 H;  4U7C A;  3S16 H;  2C2E A;  2OTJ A;  4HCE A;  3KF8 B;  2R7K A;  2XRQ D;  1HRJ A;  3C0F B;  3UQ8 A;  3OMC A;  3HGB A;  3PUX A;  1VKZ A;  2VB2 X;  4K8I A;  5J2U F;  2F0V A;  2WKD A;  1W96 A;  3Q8P B;  1RD9 D;  1JIH A;  5KG3 A;  2NTT A;  3BA9 A;  1PYB A;  2HQL A;  1O7Y A;  4A3L H;  2LS0 1;  2QW7 A;  3S1Q H;  1QUQ A;  1IKL A;  4NMZ A;  3GTK H;  2NVT B;  5A2Q W;  2P0A A;  4J0M A;  2JA7 A;  2W9A A;  4UAI A;  3C46 A;  3CCL A;  1PH1 A;  4JYA H;  1WTW A;  4GKJ H;  2I8C A;  2D0P A;  4Q44 A;  5GAG C;  4QL5 A;  5T1G A;  2AWN A;  5CBE E;  4YB8 B;  2O5J C;  5KGU A;  1DON A;  4ZOL F;  4ZHQ F;  2VUM A;  4JVZ A;  3GTO A;  2J4X A;  2NU9 B;  3RB0 A;  4LAA A;  4I65 A;  3M9O B;  1Q82 C;  3TRZ A;  1G2S A;  5C4X G;  1Q8I A;  3H0G A;  3LML A;  4LH7 A;  2YYZ A;  1ENA A;  3GII A;  4MHE A;  4ABN A;  2R92 G;  2KCN A;  3EVQ A;  5HY6 A;  5KG6 A;  1KJ9 A;  3BDL A;  3CKI B;  3VDY A;  2K14 A;  1QE6 A;  1E3P A;  4ZUI A;  3T1Y Q;  1V51 A;  1QB5 D;  4RFB A;  3E5S A;  3PUW A;  4DR1 Q;  3GTM H;  5LL6 X;  1N48 A;  1KXL A;  1M4V A;  1STB A;  4RHS A;  2ASL A;  1STA A;  2EJM A;  2V59 A;  2BH8 A;  1PH7 A;  3CCS A;  3I73 A;  1G29 1;  1CKM A;  2B2W A;  4A3L G;  2UU9 H;  2E2J H;  3A74 A;  1Q1B A;  3KDF A;  2N78 A;  1B44 D;  3MR2 A;  1TWG B;  2JA7 H;  3I12 A;  1RK6 A;  1ILP A;  3I90 A;  2FHT A;  4WD3 A;  3UE1 A;  2IHF A;  2EYO A;  1Z7T A;  5C4J H;  4ILW A;  1DD2 A;  4IPG A;  4HNV A;  1E2Z A;  2BCO A;  3MTS A;  3I2Z A;  4GNX B;  2D5D A;  1PH2 A;  2XN9 C;  4CKB A;  5CMD A;  4C1N K;  2XSC A;  1HFN A;  3EYY A;  2VUM H;  5IY0 A;  5L1L A;  3GTO H;  1HFG A;  4OEM B;  3I4O A;  1QVF A;  1EY0 A;  1N32 L;  2EXD A;  1R9T A;  2PYK A;  3PO2 H;  4HJ9 A;  1QVG A;  2AQ4 A;  4KJN A;  2IL8 A;  2RCF A;  4ED1 A;  4HIO A;  2ZM6 L;  4B9W A;  4DR4 H;  1PXU A;  1PH8 A;  3RNU A;  2AUJ D;  4P72 A;  1EEF D;  3MWM A;  1DXM A;  4J9Q A;  2X6L A;  5IGG A;  4DV1 Q;  2HHH H;  1Y1W A;  3BJU A;  4MV9 A;  4UDU C;  3VR5 A;  2NUA B;  3GV3 A;  5JJK A;  1CI3 M;  4P75 A;  5EBC A;  4QCL A;  1IW7 D;  4IUT A;  3J81 c;  1QJO A;  2AKW B;  2D9U A;  2JJQ A;  4PMW A;  3GQC A;  2XWB B;  1NMG A;  3W2D A;  2FE3 A;  1EFI D;  5KKN B;  1IYJ B;  3TDQ A;  2UUA L;  1IOV A;  2UUC H;  2JA7 G;  5M3M G;  1LYL A;  4GN5 A;  1JB7 A;  4QIW A;  4BWG B;  2J6S A;  1PZK D;  3WWV A;  5D14 A;  4A4I A;  1MZB A;  4JOI A;  3I72 A;  4XQJ A;  4DUY Q;  4YR3 A;  1MI2 A;  1V4Y A;  3OWF A;  1PRT D;  1VQA A;  5FLX c;  1VBG A;  3DEO A;  1PK8 A;  2L0C A;  4PV1 C;  4F87 A;  1S0N A;  2VUM G;  5HBR B;  2WAQ E;  4L63 B;  2VQE H;  2EY5 A;  2B3G A;  4RWS C;  5FPR A;  2NU8 B;  4DR3 Q;  3H0G G;  1BNZ A;  3PO2 G;  1R9T H;  1PVO A;  1I5F A;  3TQY A;  2XGQ A;  1I4Q A;  1F9P A;  3M4P A;  4DV3 Q;  5J22 A;  3G8C A;  1E4E A;  2WE6 A;  3W5O A;  3NSW A;  4LK1 C;  1K73 C;  1XNQ L;  1E7Z A;  2A5H A;  1FR3 A;  3PN1 A;  1KD1 C;  1Y1W H;  1XMQ H;  3GTQ A;  1S5E D;  1S5F D;  2K01 A;  3FRP B;  5KG4 A;  3BQ0 A;  2C2R A;  5IYD H;  1HTP A;  2YRW A;  2R6G A;  1IYV A;  4UP7 A;  5CV5 A;  3TRE A;  2EIF A;  4U67 3;  1GHJ A;  4MV1 A;  1WD0 A;  2EQS A;  3QOJ A;  1FGU A;  4ZYS A;  4A3G B;  3P20 A;  4AIM A;  4HMI A;  4S3S A;  4LF4 H;  1KNA A;  1NY4 A;  1STG A;  5KFB A;  1SEI A;  5K36 H;  1OO9 B;  2PQE A;  3S17 B;  1TAE A;  3K3V A;  3J7Y W;  1J6Q A;  4WJW A;  4RCN A;  3I91 A;  2JN4 A;  1PH5 A;  1KC7 A;  1GO3 E;  5DM6 3;  4MTE A;  2E2I B;  3JAM L;  1R4P B;  5LL6 b;  1BGW A;  2MQH A;  3RN5 A;  3P75 A;  3PIO A;  4XYO A;  3U9T A;  1SNO A;  3I8Z A;  1X3G A;  3DUZ A;  4KMU C;  2K6A A;  2NYZ D;  1SYE A;  1BQQ T;  4FP5 D;  1ASY A;  2VNU D;  3V6K A;  4G4K A;  1Y1W G;  5C44 H;  1B6R A;  1NAP A;  3JRX A;  1ESR A;  1FVI A;  4CHT B;  1H9K A;  2F0N A;  2R7Z H;  4DL7 A;  1X56 A;  3S2H H;  4H7B A;  1GKH A;  5IYD G;  1TA8 A;  1XPU A;  3RR5 A;  3E0E A;  4JPB W;  3OWE B;  1BOS A;  1CQI B;  3VYR A;  1K0S A;  1KNE A;  4R4T A;  3MZ5 A;  4QWB A;  3T5H A;  4XYQ A;  4MZ9 A;  2Z0S A;  3CCV A;  2VQD A;  2WB1 B;  3G48 A;  4AH6 A;  2W71 A;  3CXC A;  2WAQ B;  1RJR A;  3WO0 A;  1HNX H;  2VOB A;  4ED6 A;  2YRX A;  5K36 G;  3K57 A;  3G6E A;  3N6X A;  1STY A;  1K8A C;  4MTN A;  1EFW A;  2VPQ A;  2R6F A;  2OXP A;  2XCA A;  3PW7 A;  4C1N I;  1TY0 A;  1XMO H;  2E75 C;  3T1Y L;  3J81 E;  3J80 i;  3MHB A;  2QYZ A;  4UCV A;  2EDG A;  4U68 A;  3SE0 A;  1GUO A;  4KN4 C;  4F8M A;  3D4R A;  5C44 G;  4DR4 L;  4HR7 A;  2NTS A;  1IKM A;  3FPU B;  4JI8 H;  5M9O A;  3M9N B;  4NXN Q;  4IOC A;  1IBL H;  1J8I A;  1LO5 D;  2PZU A;  1WTQ A;  1JR0 D;  5FLX E;  1B6S A;  3MFY A;  5L37 A;  4TUY F;  4YCV A;  3GTL A;  4O42 A;  5LP6 F;  1YNJ C;  3T5K A;  2V1C C;  1SE3 A;  1YVC A;  3OW7 A;  4DV0 Q;  2JA8 G;  2IWH A;  4IUR A;  2K5D A;  5KFH A;  4A3E H;  2B8G A;  1J9O A;  3S14 B;  2CFM A;  3NTI A;  4DUZ Q;  4POF A;  1EY8 A;  2ZJR A;  1AN7 A;  2A68 D;  2UUC L;  4HNU A;  3HB9 A;  5COR A;  2DJG C;  1EY4 A;  4L6T B;  2NN6 G;  1KJI A;  1KBL A;  2W57 A;  5KFC A;  4MV3 A;  3MXG A;  4K14 A;  3T1H H;  3HEJ A;  2DZD A;  5JUM A;  4ED7 A;  4KN7 C;  1VQK A;  4IPH A;  5C5J A;  1UC9 A;  5CV7 A;  2R8I A;  3D0F A;  4ETS A;  3RGZ A;  2L55 A;  3GP7 A;  2Q8T A;  2VQE L;  3RMH A;  4GN4 B;  3X3N A;  1XJV A;  1EIF A;  1FNU A;  5IT9 L;  3S9W A;  3HOU H;  4BS9 A;  4ZKB B;  4DAY A;  1V1O A;  4OXP A;  2YZN A;  5KG2 A;  2NZO A;  3ULP A;  4FO2 A;  5KFS A;  1HNW H;  2D62 A;  4BA2 I;  4ZKC B;  3W1B A;  3KUP A;  4KKS A;  4WOR A;  3BJY A;  3BZK A;  1SE8 A;  4LMQ D;  3KHR A;  1QIL A;  2PW5 A;  1PZI D;  4MA5 A;  4HJ7 A;  1DV2 A;  4JI4 Q;  3GTL H;  4AQY Q;  1AZP A;  3BZC A;  4DUY L;  2FJZ A;  4MV4 A;  2OCE A;  4LF6 H;  2MO0 A;  4A3E G;  4TVA B;  4JI5 H;  5ELO A;  4DR5 H;  1D5X C;  2M9V A;  2KHS A;  4QGU A;  3BDO A;  4Y52 H;  3MFG A;  4L8J A;  1K3B C;  2YS7 A;  4A93 B;  1HCZ A;  4GKK H;  2HIX A;  1K28 A;  4YAK B;  1PTO F;  1GHK A;  4DV3 L;  3NBH A;  4O4H F;  5IWA Q;  4B3R H;  3MC0 B;  3A8K E;  3G7L A;  3E5N A;  2KOL A;  5DNF A;  4AYB E;  1LAB A;  3HOU G;  1L0X B;  1T9H A;  1TWH B;  2MFI A;  4GNX C;  4DV2 H;  4HJ8 A;  1RKN A;  1A62 A;  1H9J A;  1S5D D;  1B53 A;  3FKI H;  1CA5 A;  2HD3 A;  3J80 c;  3L9A X;  1SYD A;  3STB C;  3ZYY X;  3GV8 B;  4MTK A;  4L5S A;  4LW1 A;  1L2Z A;  1T5E A;  4XYM B;  4OIJ A;  2ICE C;  3KLW A;  1C7Y A;  4UCR A;  2A69 D;  2SCU B;  1SLJ A;  1TS5 A;  3I4L A;  2OLS A;  2I07 B;  4I7Z C;  1FL0 A;  1EY7 A;  3CHB D;  3D31 A;  3U4V A;  2NBF A;  2K7V A;  4DR6 Q;  3IN5 A;  1Z2N X;  5C5L A;  1QG7 A;  1UE5 A;  5BPF A;  1X55 A;  2K04 A;  3OSN A;  3KFU A;  5KIX A;  2O5I C;  4IOA A;  3OHX C;  2K5H A;  2LXJ A;  2Z1C A;  1EYC A;  3A56 A;  4QUF A;  3RUP A;  3BQ2 A;  2HGS A;  5GAH C;  4RB2 C;  1HTL D;  2F0S A;  3KJP A;  3HXL A;  1Y8N B;  3Q1K A;  2F0W A;  1E22 A;  4YWK A;  1ZEQ X;  4PG3 A;  3TBI B;  1PX2 A;  4J9L A;  4EQ5 A;  3CW2 C;  1XMO L;  1I4G A;  3KBX A;  1PA6 A;  3TQT A;  3M9B A;  3HOZ B;  2F4V H;  1EIY B;  2ZJP A;  3A0J A;  1RTN A;  4O1N A;  2E5L H;  2VPS A;  2VR1 A;  3GTG A;  1PLF A;  3NE5 B;  2QIL A;  2ASD A;  2UVR A;  2F1M A;  4LF5 H;  2F3I A;  5E4W C;  4G3I A;  5G3L F;  3I4M H;  4GLA C;  3EA6 A;  4LF8 Q;  3K5O A;  1RIP A;  4LF9 H;  3S15 H;  1MJE A;  1IBL L;  4K0K Q;  2A6H C;  1DM0 B;  4L5Q A;  4FS1 A;  2F0U A;  1HR0 H;  1PRT B;  1AE3 A;  1IBM H;  4ZUJ A;  2R7D A;  3W1G A;  1HNZ Q;  4A3F B;  4JV5 Q;  2C00 A;  1EZ1 A;  1SNP A;  1VQE A;  4R4Q A;  2KCM A;  2MNA A;  1XPO A;  2W70 A;  3GV7 B;  3RN2 A;  3AYH B;  2W7P A;  3FMA A;  1F77 A;  1YI2 A;  1MJC A;  1LLR D;  3CQZ B;  1JQY D;  1YIJ A;  4AYB B;  2M05 A;  2W6P A;  3G6Y A;  1Y69 U;  2YU9 B;  3PW5 A;  4DV4 Q;  2MO1 A;  1ZYR D;  2NVT H;  3LP8 A;  1N9W A;  4JI1 H;  3TZU A;  3SVM A;  1PTO C;  2DPJ A;  3IAY A;  3K0X A;  5KFP A;  4HSV A;  4R4I A;  1SAP A;  2WAC A;  2XVS A;  4NPS A;  2FMM A;  3KTM A;  4NXN L;  2J6T A;  3NQI A;  1MIU A;  1S10 A;  1HPC A;  4JCV E;  2NUC A;  3VYU A;  4N8X 1;  5KFR A;  4K0K H;  2OQK A;  4PZ6 A;  1TS4 A;  4ECY A;  2W9C B;  4DV0 L;  1S4Z A;  2QK4 A;  5F2D A;  1CKN B;  3GTQ B;  3M85 A;  1LTL A;  2Z4H A;  3LNN A;  4DUZ L;  3PZP A;  1JXL A;  2G9D A;  3I4M G;  4Q43 A;  2BQR A;  2PI2 A;  1KL9 A;  4NW2 A;  4QJF A;  3N52 A;  2JA8 B;  4X3U A;  4YAJ B;  4H0L C;  1N34 H;  3OTO Q;  1I50 A;  3H3V H;  4A3D B;  2JP1 A;  4J15 A;  3J80 E;  3M7N A;  4HSP A;  3PSI A;  4IWX A;  1K1S A;  4GKK L;  4LF7 Q;  2ASB A;  3HKS A;  1L1O B;  1LTA D;  3IFD A;  2M2L A;  5BR8 Q;  1TR5 A;  3LWE A;  4X65 Q;  4A76 A;  2A74 C;  3S2D H;  3VPB A;  1EU4 A;  5LA6 F;  2PMZ E;  1EEI D;  4TV9 F;  4F4Y A;  1CZG A;  1RYR A;  3I4N H;  4LJZ C;  4GOP A;  2SNS A;  2BR0 A;  1AH9 A;  4JI4 L;  1BBW A;  4RKB A;  1I6H H;  1EZ8 A;  2Z4I A;  3KLR A;  4BY7 B;  4AQY L;  3GIQ A;  3NPP A;  4C3J B;  2L4N A;  1WH2 A;  3BAA A;  1SNM A;  3SDZ A;  4EG0 A;  3U58 A;  1A63 A;  1NMF A;  4FF1 A;  2I46 A;  3DWQ A;  1O75 A;  4UFZ A;  5KFF A;  3CC7 A;  5CGK A;  5JPN C;  2V4Q A;  5EKL A;  5DLQ E;  2EY6 A;  2FLL A;  4X65 H;  4QB4 A;  4RB0 A;  4YJ2 F;  4K6D A;  5D8D A;  4WBN F;  4X6A H;  2IX1 A;  1HXY D;  3GTP B;  5IWA L;  1I50 H;  5CAE B;  3I56 A;  2YZM A;  3NGD A;  1YNX A;  3ND8 A;  3MXU A;  5A2Q L;  2Y0S A;  4CDC C;  2AQ1 B;  4C3I B;  3GD7 A;  1LM0 A;  2R82 A;  1SE2 A;  2B2Y C;  4KLK A;  5IGE A;  4RNM A;  1SJE D;  1CT1 D;  1ILQ A;  3T13 A;  3QJY A;  4B08 A;  2B2T A;  2B2V A;  1A3V A;  3FMC A;  2V5A A;  4RMF A;  1YJW A;  4YY3 Q;  3I4N G;  1VS0 A;  5D1P A;  2VQF H;  2NVX A;  3N41 B;  1U4R A;  2R7F A;  5GRO A;  2PN1 A;  5HGT A;  4NXM H;  3DF7 A;  3H20 A;  2HVR A;  2B63 A;  3AMU A;  2ZM6 Q;  1X9N A;  1X3P A;  1LT4 D;  1STN A;  4QWD A;  4FNF A;  4KKU A;  3D6W A;  4CDE C;  4BY1 H;  1RL2 A;  4X3S A;  4MTD A;  4OX9 H;  2L15 A;  4DR6 L;  5JQW A;  5EBD A;  3M3Y B;  5EPL A;  1JKJ B;  4LF5 L;  3HRZ C;  4M8A A;  1OXU A;  4R9W A;  1B50 A;  5KEE A;  5CA1 F;  1I3Q A;  4NLG A;  2PNH A;  3UDI A;  4JI7 Q;  2F0O A;  4OO1 H;  2DJF C;  1N36 Q;  4O3O A;  2LKV A;  5IP9 H;  2JEG A;  2B29 A;  3TZD A;  5CR3 A;  2PMZ B;  1UE1 A;  1VQH A;  1SN8 A;  2FIN B;  2YTX A;  2L1B A;  4J9K A;  3T51 B;  3MXN A;  3RUZ A;  3ETJ A;  1JT8 A;  1FJG H;  2ALY B;  1VMC A;  4OIK A;  5CYU A;  2E2H A;  2R86 A;  4JBJ A;  3SXH A;  3JRW A;  1IYU A;  2NVX H;  2I87 A;  4IR1 A;  5KT6 A;  4M7E A;  2B63 H;  4LF8 L;  3JAM i;  2D2C C;  1SFO A;  2Q2T A;  4K0K L;  1XNQ Q;  4L5R C;  1SJH D;  5KFX A;  1WVL A;  2EYH A;  5KG0 A;  1O7L A;  2C5C A;  1HNZ L;  1WD1 A;  2R93 A;  4JV5 L;  4CGY B;  5G3L D;  3Q8Q B;  4KV6 A;  4DAP A;  4YCU A;  2KCC A;  3A5Z B;  1DV1 A;  3NBI A;  3PW4 A;  3K7A H;  2RHS B;  4X66 H;  3E9H A;  4DV4 L;  1TU2 B;  3OIQ A;  3I55 A;  4DNT B;  3VMM A;  1CK1 A;  4OO1 G;  3E6Z X;  5C4Z A;  1N34 L;  2Y0S G;  4OWX B;  4BBR G;  3FDS A;  3PO3 B;  2JYO A;  2B2W C;  3SHL A;  4IJL A;  3Q0A A;  3RTX A;  4JYA Q;  1ET9 A;  1JLL B;  4GKJ Q;  5DG8 A;  1AW7 A;  3HOV G;  4JI6 H;  4RB1 A;  4EGQ A;  1JB3 A;  1JE4 A;  2AHO B;  2E2H H;  4UY8 C;  1S5C D;  1TWA B;  3HBL A;  3IL8 A;  1Q3L A;  2BOS A;  2IJ0 A;  5EQ0 A;  4LFC H;  3CD6 A;  3J81 i;  2B63 G;  3RZO B;  3PUZ A;  3GTM A;  4B3T Q;  1QWY A;  2F4I A;  3V96 A;  4KD3 A;  4QWA A;  4FBU A;  1SFO H;  4Q45 A;  2FK3 A;  1K8G A;  2JEI A;  5M3F G;  4HN7 A;  3I3C A;  1DIK A;  3OIP A;  2R93 H;  2C28 A;  2PPB C;  3OTO L;  1IW7 C;  4PMC A;  1I7N A;  4J9S A;  1S5B D;  2TSS A;  1BXT A;  1LV9 A;  1SND A;  2F0K A;  4DNR B;  4PWQ A;  2XCP A;  1E1T A;  1EUJ A;  3HP3 A;  4LF7 L;  4X65 L;  3V05 A;  5BR8 L;  4IO9 A;  3PCO B;  2VA2 A;  1WTR A;  2SDF A;  4DPG A;  2UU9 Q;  1XWE A;  1Y1V B;  2R8H A;  3TQ1 A;  2IPK D;  1PRT C;  1Q81 C;  2CVR A;  1JJ2 A;  4IFD G;  4A3B B;  4C5B A;  3R5H A;  1C4Q A;  4LSA A;  4B3T H;  3HKZ A;  3N42 B;  3S14 H;  4EFB A;  4K2K A;  2HT1 A;  4P74 A;  5KFK A;  1CSP A;  4JOI C;  2AGQ A;  3ND9 A;  1JIC A;  1KTK A;  1R4Q B;  3CCM A;  2ID0 A;  1TY2 A;  1WTP A;  5C0X I;  4O0A A;  4KY5 A;  4GN3 B;  5H80 A;  3K8A A;  3T5L A;  4KY7 A;  1DGS A;  1FD7 D;  4DR4 Q;  3JAM c;  2K28 A;  2LXK A;  3VYS A;  4X3T A;  1HR0 W;  3GTG B;  5E3F A;  2R93 G;  4M9U A;  3S1M H;  3G6V A;  1UNS A;  3JZI A;  2VL6 A;  4IUV A;  3KYH C;  4KJO A;  2QA4 A;  2F03 A;  4XX0 B;  4LUZ A;  2XCL A;  2K33 A;  2HHH Q;  3ERQ A;  4EBE A;  1B1Z A;  2F0J A;  2P5Z X;  3G6J B;  2KSW A;  5KFV A;  4DL3 A;  2IBK A;  1I6U A;  2JK8 A;  1JX4 A;  2K5V A;  2PQA A;  1CHQ D;  1GUS A;  3KLS A;  2VS1 A;  3VA7 A;  3BS1 A;  2EJG C;  4A3I B;  2B8F A;  2IP4 A;  2LSS A;  1S0O A;  1D1I A;  2UUC Q;  2R87 A;  5LXT F;  1WTH A;  4YY3 L;  1F2M A;  5KT7 A;  1QNK A;  1DOL A;  1PMR A;  3TME A;  4BBS B;  1K8O A;  1B8A A;  3K80 C;  1TWF A;  3OW2 A;  3AFQ A;  3Q8D A;  1HZB A;  3PUY A;  5CV9 A;  5M5X H;  4XT3 B;  2VQE Q;  2G5D A;  3IFT A;  1L1O C;  5KNB A;  1VQM A;  5D1O A;  2ZTD A;  5JPM C;  4NDX A;  3DLL A;  4XQQ A;  1UEB A;  3U50 C;  2FP4 B;  1GGO A;  5A35 A;  4A2A A;  2Z6K A;  5KFW A;  2RSN A;  4RGM A;  4C2M B;  4JG2 A;  1KAW A;  2AWO A;  1MKH A;  1Q90 A;  3R2I A;  4JI7 L;  1WI5 A;  3FDT A;  1XMQ Q;  2ATW A;  3R5X A;  1IBK H;  1N36 L;  1IL2 A;  3IG0 A;  3CCQ A;  5L1J A;  2W9B B;  4B3M H;  2XIG A;  3RF2 A;  4YHH H;  3CCE A;  1OXS C;  3J7A K;  2C35 B;  4HQ6 A;  4ECT A;  2IA6 A;  2I80 A;  1Z47 A;  2HDM A;  2WB1 E;  4ECU A;  5C3E B;  1VBH A;  3VPC A;  1JWU D;  1HQR D;  4JW0 A;  5ELB A;  5M5Y H;  1GSH A;  2WTF A;  1EQQ A;  3HOY H;  3T5J A;  3A7L A;  3HOX H;  3GV6 A;  3HKZ G;  4HJ5 A;  4I4T F;  5JJI A;  1E4F T;  1MBY A;  4LF4 Q;  1EWI A;  1YZ6 A;  1XTD A;  5C8Y F;  1TWF H;  4KD4 A;  1H95 A;  1UEA B;  3KHG A;  4P71 A;  3EBE A;  1OXX K;  4A3J B;  2R85 A;  1RK5 A;  2UUB H;  4H02 A;  1KJ8 A;  4MV7 A;  1ZXT A;  2XIW A;  1VF5 C;  2JXM B;  4GOP B;  2R7Z A;  2QEJ C;  4FVM A;  3K5M A;  1XDN A;  2HVQ A;  1GD7 A;  3G71 A;  4CKE A;  2NVY A;  1WCM B;  1BNC A;  5EJW A;  3MR5 A;  3KOJ A;  1QOH A;  5EKK A;  1TWC A;  4ZQ3 A;  5IT9 c;  1LTI D;  1EHI A;  1X65 A;  5I2Y A;  3DWA A;  4Q5V A;  1JJC B;  4A3K H;  3CRK C;  4HIK A;  3H09 A;  1PTO B;  4JI2 H;  1EOT A;  4DXF A;  4C5A A;  1ML0 D;  2GA4 B;  1SNQ A;  1KIX A;  4JYA L;  5DQH A;  2JA6 A;  1J5E H;  2A68 C;  1AUX A;  4GKJ L;  2KEC A;  4DXG A;  2DNC A;  3HOY G;  4DV5 H;  4CKC A;  1I7L A;  3HOX G;  1AZQ A;  3GLK A;  3FEW X;  3CC4 A;  1HNX Q;  4DK6 C;  1G8Z D;  3JAM E;  4A3F H;  4Z9C B;  4B3T L;  5EZY F;  1VQB A;  2CW0 D;  1EU3 A;  5EWG A;  2CWA A;  5IE8 A;  1CFM A;  3J7A V;  2FB9 A;  2O03 A;  4J9O A;  4FBT A;  1V1P A;  4JUZ A;  5LMN H;  4OON A;  1PFM A;  1ICW A;  4O2B F;  1LT5 D;  4R8U A;  2JA5 A;  4RG1 A;  3PUV A;  1PH4 A;  1PFS A;  2HDL A;  1XMO Q;  5EWF A;  2PZT A;  4JI3 H;  2NVY H;  3MVV A;  4DR7 H;  2FPI B;  3QOL A;  5IGF A;  4ED0 A;  2E2D C;  1TWC H;  1L0Y B;  1CKO A;  4A3K G;  2K5Q A;  4Y7N H;  3Q24 A;  1K9M C;  2UU9 L;  1G6P A;  2OT2 A;  4ECX A;  1LTS D;  4JI8 Q;  1S03 G;  3R93 A;  3QIA A;  4ZLT F;  1IBL Q;  2OH2 A;  1I3Q B;  2JA6 H;  2KED A;  2HVS A;  1FNW A;  1DZ1 A;  2YTY A;  4ID6 A;  4NB3 A;  4UP8 A;  3ORQ A;  1RJQ A;  4C3H H;  4A3M H;  2R8G A;  3EIV A;  5C4X B;  5TSS A;  2SOB A;  3T1H Q;  4KHV A;  4DK0 A;  2R92 B;  1ZHS A;  3S16 B;  4R8N A;  3HS0 C;  2R7Z G;  4H13 C;  2JA5 H;  2GN5 A;  4MV8 A;  4F4W A;  2HHH L;  3T4A C;  4M1U B;  2RA4 A;  2KEN A;  1UAP A;  1Q7Y C;  1HZA A;  2IW3 A;  1HQM C;  2CCZ A;  4KHP H;  1E2V A;  4ODG A;  5LL6 S;  2A69 C;  3KJO A;  1HNW Q;  1RJP A;  3RB4 A;  3I70 A;  3S1Q B;  4TSS A;  2AQ2 B;  3GTK B;  5E4X A;  3W3A A;  1N33 Q;  3PIP 3;  1TS2 A;  2ZJT A;  4X62 H;  1JOK A;  4C3J H;  2F0F A;  2IHE A;  3QO2 A;  1VQ5 A;  5KFZ A;  5I2X A;  2JA6 G;  4OHJ A;  1E0B A;  2NZ1 D;  5LMU H;  4LF6 Q;  1DJR D;  3KXY T;  2I0Q A;  3A7A B;  4JI5 Q;  2B39 A;  4DR5 Q;  5JVH 3;  1LTR D;  5CV6 A;  4C3H G;  1XXG A;  4A3M G;  3S1R H;  3EJI A;  3Q8R B;  2YCH A;  4GKK Q;  1SCU B;  1EY9 A;  3ER0 A;  3FKI A;  4WRD A;  3CPW A;  2RSO A;  5D65 A;  3GTP H;  1VQI A;  4YCW A;  1G2T A;  3JSL A;  5IT9 E;  2EY2 A;  1HUN A;  2ZTE A;  3J81 j;  3UFX B;  3FHW A;  4HAE A;  5IYB H;  4B3R Q;  2JA5 G;  5HGQ A;  1IOW A;  5DEH A;  1N33 H;  2W6Q A;  1Z9F A;  4A2B A;  1K83 A;  4KTA A;  4HJA A;  1EYG A;  2FFK B;  1XMQ L;  4QY7 A;  2QCP X;  5AFW A;  4DV2 Q;  1WTO A;  2Q2U A;  4FU0 A;  4DL4 A;  2RDI A;  5HV6 A;  4JC0 A;  5JOB A;  1CQV A;  1CZW A;  1JC7 A;  1Y8P B;  4K8J A;  1QUQ B;  2F0P A;  4J9P A;  5LYJ F;  2V4D A;  2JA7 B;  5M3M B;  5T14 A;  2FK1 A;  4QW9 A;  3N6R A;  2A6E D;  3ULL A;  3S1N H;  1NR4 A;  1ROD A;  5C4J B;  4LF4 L;  3V6H A;  3BG3 A;  1JDB B;  4QIW E;  3RBE A;  3GTJ A;  1RDP D;  3MAQ A;  3D4D A;  1VQ9 A;  2VUM B;  3E3X A;  3GTO B;  3Q2O A;  3R3O A;  2RGR A;  1EQT A;  3H0G B;  5EGT A;  1PH6 A;  4DV5 L;  3PO2 B;  4EEY A;  1ZET A;  1ZYR C;  3MWY W;  2Z9H A;  1S0M A;  3H3V C;  5KX5 F;  2ZXP A;  2O2L D;  3BQ1 A;  4F50 A;  2ENB A;  3NP8 A;  3TIN A;  3KF6 A;  3H4B A;  1WYD A;  2QEX A;  5IYB G;  1H9S A;  1V9P A;  1B3A A;  1EQR A;  3GIK A;  5JJZ A;  3PW2 A;  1K83 H;  4IPD A;  1YJ9 A;  4DV7 H;  1KDB A;  1C9O A;  4B3S H;  1QCB D;  1VMP A;  2L9H A;  2F4V Q;  4HID A;  1SNC A;  3KDF B;  2DWC A;  3HOW H;  2E5L Q;  2ASJ A;  1ICF B;  5C5M A;  2WIN B;  3AB9 A;  1ET6 A;  3GO5 A;  3TSS A;  3C1E A;  2XGP A;  4LF5 Q;  3DWP A;  1PH3 A;  4LF9 Q;  1HNX L;  2WYO A;  5GON F;  1IBM Q;  3PR5 B;  1HR0 Q;  1I6V C;  3DM3 A;  5IIF A;  4EEQ A;  3GTJ H;  2W6M A;  4I7A A;  4O3S A;  3EPG A;  2PW7 A;  1A6X A;  1A9X A;  4O3R A;  1R9T B;  5M5W H;  3CMA A;  2XC9 A;  2L11 A;  3FKI G;  3J81 W;  4ED2 A;  1GSO A;  4P2C B;  1HUM A;  4ECS A;  2UXD H;  3LX0 A;  2E8G A;  3TP7 A;  1C3O A;  2ZDG A;  4JI1 Q;  2CW7 A;  1Y1W B;  1LTG D;  1SRU A;  2KVM A;  1DOM A;  1EUC B;  1I4P A;  4RAY A;  4A3C H;  4JI8 L;  3K7U C;  1M0T A;  4J9N A;  1I94 H;  4MNO A;  1KRT A;  2J7Z A;  1UUP A;  5FLX W;  4J1M A;  2XWJ B;  2XRS D;  4QUC A;  4GOP C;  3TS0 A;  1SDF A;  3HOW G;  2NN6 I;  2EYM A;  1D2B A;  5FPO A;  1KRS A;  5GAD C;  3GIJ A;  3BG5 A;  4QIW B;  1C30 A;  5KFG A;  3BVM A;  5CBA E;  1VAJ A;  1IL8 A;  3NQT A;  1RYS A;  1CHP D;  2ZXR A;  2HUG A;  3IRB A;  1CUK A;  3C1F A;  1JDE A;  3UDG A;  2ZTC A;  3D4W A;  1NR2 A;  5E7N A;  3T1H L;  2K75 A;  1TWG A;  1N34 Q;  4IRD A;  5FO8 B;  4CJ1 B;  1TII D;  4K5V A;  5EAY A;  4IUQ A;  3TP8 A;  1E24 A;  4OWT B;  3MXP A;  4GNX A;  4RNO A;  1E4E B;  3ULJ A;  1Y1V H;  4B9X A;  2UVW A;  4BXX H;  2UXB H;  4XT1 B;  4BWS C;  3F8T A;  4YWM A;  5C44 B;  1HNW L;  4PQX A;  2MP1 A;  2F0E A;  3S2H B;  1CQF A;  3AU7 A;  1BDO A;  1N33 L;  4LMY A;  3MFI A;  3L4J A;  4LFA H;  1XYI A;  3L7Z C;  4GS3 A;  4JV1 A;  4PMB A;  1VQ4 A;  3P1H A;  1U4M A;  4CDD C;  1SSO A;  2KA7 A;  4QQB X;  2IY5 B;  1GSA A;  1BCP F;  2ATL A;  2VW9 A;  3ONA B;  1JOO A;  1F9Q A;  3OSO A;  2IX0 A;  5DLG A;  5EPK A;  4DV6 H;  1HH2 P;  4LF6 L;  3ETH A;  1PYW D;  3SK8 A;  4JI5 L;  4JBM A;  4DR5 L;  2GVA A;  1W6K A;  2GPW A;  4PZ8 A;  2RVL A;  2ZDQ A;  2LY7 A;  3A8J E;  1KEE A;  2PZW A;  5F9L A;  1LAC A;  2JEJ A;  4ME3 A;  1TWG H;  4RGN A;  2MHV A;  4B3R L;  1ULZ A;  5COY A;  3S24 A;  5LMN W;  4L5T A;  1LT6 D;  4WJ4 A;  2KHI A;  2Q2I A;  2LMC B;  2OTL A;  4F4Z A;  1XX8 A;  2K1B A;  4DV2 L;  4TQR A;  4BXX G;  4DR2 H;  4ZCK A;  1VCI A;  4A3I H;  1I4H A;  5C1P A;  2DGY A;  3HZX A;  5F9N A;  5KFO A;  1IZ6 A;  2F0I A;  3R8B A;  4DAM A;  1F2L A;  2CQY A;  4EVO A;  1EWC A;  2VZA A;  2XTI A;  4RUA A;  4JI0 H;  2BQ3 A;  3N40 P;  4BBS H;  3OOC A;  2EOT A;  1NUC A;  3CME A;  2VQF Q;  1DCZ A;  5FD6 A;  4NXM Q;  3KBG A;  3UI2 A;  1PH9 A;  4GC6 A;  1U5K A;  5K2M A;  3L2P A;  4H44 C;  1WTV A;  1Z2P X;  4A3E B;  3Q23 A;  4EYI B;  4HIM A;  4B3S L;  2Q8R E;  5IGB A;  3PVX A;  4YR2 A;  4OX9 Q;  5DM7 3;  1NSN S;  5C0X J;  2RDF A;  2F0T A;  4EGJ A;  4C2M H;  3NEL A;  2BA1 A;  2R7L A;  4YWL A;  1KJJ A;  3SK5 A;  3OYY A;  5A2Q E;  3M7G A;  2YTV A;  4GLX A;  2JEF A;  1TQO A;  4IQZ A;  3M4O B;  4UCO A;  2JA9 A;  1UE7 A;  3HOU B;  5BMV F;  3BU2 A;  2RCN A;  3MWE A;  1M8A A;  1N56 A;  4O2D A;  2N3S A;  1JE5 A;  4I55 F;  4CBV A;  4HR7 B;  1YNN C;  3MEH A;  2EJF C;  2HCC A;  1HA6 A;  4ECZ A;  2F0Q A;  2F4V L;  5KYI A;  4WJ3 M;  1FJG Q;  3F2C A;  1GXD C;  3VA5 A;  3U9O A;  1HHV A;  4DKA C;  2M00 A;  2E5L L;  2AGP A;  1KAB A;  2DUD A;  4TQS A;  1RTO A;  1KQS A;  4QW8 A;  3GTL B;  3LWB A;  3EFX D;  2YS6 A;  4QF4 A;  4LF9 L;  1D7Q A;  5L1I A;  1SYC A;  1VQL A;  4FF4 A;  3JSN A;  3JC6 6;  4UCS A;  5KFT A;  3TP5 A;  1IBM L;  1HR0 L;  5EWE A;  2B2U A;  1UC8 A;  4DAV A;  1BCP C;  1B4O A;  5FO7 B;  2RHQ B;  2RDG A;  2MCT A;  1PFN A;  2EXZ A;  1VQN A;  1SYB A;  3LGJ A;  2N55 A;  4A3G H;  4CDF C;  4X66 Q;  2WB1 A;  2F0D A;  5JAV A;  2JE6 I;  3CRL C;  4JI1 L;  5CV8 A;  1JCK B;  1EQV A;  1PTO H;  1C48 A;  2WAQ A;  2K32 A;  5KFQ A;  3ITP A;  4DAY B;  4EBD A;  1U4L A;  3S17 H;  3RV4 A;  1S9F A;  1HZC A;  1CQJ B;  1N32 H;  3WNZ A;  2LFN A;  4OEL B;  1EIH A;  2F3V A;  2E2I H;  4MAM A;  4JI6 Q;  4FF2 A;  4BY1 G;  1JOR A;  1YEZ A;  2F0M A;  3T56 B;  3VR6 A;  3F2D A;  5KFL A;  4HED A;  5DQG A;  4LFC Q;  1OWT A;  1D1K A;  4N8F A;  1TXY A;  4IRK A;  5ELN A;  1M7J A;  5I47 A;  1IXR A;  2EE1 A;  2F0H A;  2WP8 J;  1VQ8 A;  1FNV A;  3SI8 A;  1L2F A;  5IP9 G;  3V4Z A;  3O13 A;  3Q6S A;  5CB4 F;  2EZV A;  2UUA H;  5C3W A;  3KAK A;  1GUG A;  3J80 W;  2G9H D;  2EPB A;  4A3G G;  3D8G A;  3NBH B;  1B04 A;  3Q8S B;  3K58 A;  4ZRZ A;  5KNC A;  4JK1 C;  1SMY D;  1JWS D;  3CP0 A;  4MA0 A;  1KLU D;  2KUM A;  3SK6 A;  5KRU A;  3X3M A;  5KYL A;  2W6O A;  2J6U A;  1YNN D;  5J1Z A;  5H1S E;  1PHJ A;  2JEA I;  1A2T A;  1D5M C;  1RCV D;  5IOC A;  3B6Y A;  5GAE C;  1SXT A;  3C3L A;  2C2D A;  2OEO A;  3SK4 A;  1VQF A;  4KKT A;  3OHA A;  2NVQ B;  1M0W A;  3BZD B;  2EYJ A;  4IUU A;  5IYC H;  3I4M B;  1UE6 A;  1TKW B;  3OPO A;  3H3V I;  3S15 B;  1ZQ7 A;  1BCP D;  3MWD A;  2UVU A;  2E76 C;  1IHZ A;  1TVX A;  1ASZ A;  3UDF A;  1BKB A;  2IT1 A;  1PFB A;  3NTH A;  2CWP A;  1GJX A;  1U9R A;  2Z6K C;  4R4C A;  3RD4 A;  3RLN A;  2PI2 E;  4JBW A;  3CF5 A;  3EQL C;  3AFP A;  3GID A;  1B7Y B;  3CAM A;  3V6J A;  1OXV A;  4K5W A;  4UHV A;  2WB1 G;  4G57 A;  2WAQ G;  1YHA A;  2CHB D;  3WOF A;  3V4S A;  4XIG S;  3OHB A;  5EOY A;  3T16 A;  5EPJ A;  4RAZ A;  3AQQ A;  4EQN A;  3NEM A;  2AUK A;  2VQF L;  4ECR A;  4NXM L;  2RF4 A;  2K5N A;  4J6H A;  1P8L A;  1K0R A;  4CC5 A;  3EPI A;  1GVP A;  1S68 A;  4QWE A;  5DGA A;  3E0J A;  1TWH A;  5IYC G;  4LSX A;  2V4R A;  4OX9 L;  2R84 A;  1SR3 A;  3L0O A;  5CA0 F;  5KND A;  1QZH A;  2MUY A;  2ZT9 C;  3J7Z C;  2X6G A;  2PVP A;  4C5C A;  4ECW A;  4YIJ A;  4FM9 A;  4RGO S;  5I4D A;  2FJ2 A;  4XZ3 B;  1EYD A;  1O78 A;  2NB0 A;  3OUU A;  1IBK Q;  4HNT A;  1YBY A;  2CW8 A;  4B3M Q;  3N43 B;  1G51 A;  4YHH Q;  3S2D B;  2Y0S E;  5M3M H;  2V58 A;  1EWH A;  2FKL A;  1OTC A;  3PR4 A;  2ZXO A;  3CPF A;  1CSQ A;  5I6W A;  4K2L A;  4G7H C;  3DEP A;  1FJG L;  4A93 H;  3I4N B;  1X3E A;  2CZG A;  2CW0 C;  5FKA C;  2XD4 A;  1MHW C;  2AQ3 B;  3VYT A;  4IR9 A;  1I6H B;  1W2B A;  4IUN A;  2BA0 A;  1NE3 A;  3T1Y H;  1B9M A;  5DQI A;  3PW0 A;  4RGT A;  1D6E C;  4DR1 H;  3H0G H;  2GVB A;  4EYH B;  1KAA A;  1EIG A;  1TWH H;  2BQU A;  4FF3 A;  1S72 A;  2YZG A;  2F0G A;  1Q86 C;  2UUB Q;  1JMC A;  4OO1 I;  2DNE A;  3PIP A;  4DFA A;  1PV4 A;  2XGT A;  2EYF A;  1LT3 D;  1EYZ A;  4X3K A;  4ED8 A;  1MSH A;  3A5U A;  2H5X A;  4APV A;  3J7A 5;  5J2T F;  5DLF A;  3CC2 A;  1I50 B;  4X66 L;  2HCI A;  5DGB A;  1HA5 A;  1Y14 B;  4I7H A;  3A54 A;  1A15 A;  4Y8V B;  3RZD B;  2QDL A;  2Z6B A;  4JI2 Q;  4L1K A;  1VQG A;  3GIM A;  3P7J A;  4PNY A;  2CKZ B;  1T3N A;  2I5H A;  1NCV A;  4RZR A;  2ICI A;  1J5E Q;  4A93 G;  1S3O A;  1KHI A;  4JI6 L;  1MD2 D;  1NBW A;  3NWS A;  1P16 A;  4TQU S;  3M9M B;  1WOC A;  3CQZ A;  4DV5 Q;  4AYB A;  4LNQ A;  2X69 A;  2YU9 A;  1EL0 A;  4Q8F A;  4LFC L;  2H1E A;  3MA2 B;  4DV1 H;  4F88 A;  3FP9 A;  2ES2 A;  5BPH A;  1BUV T;  1VF7 A;  4BY1 B;  2F3W A;  4RB3 C;  4RKL A;  2VB3 X;  1AP0 A;  5LMN Q;  3PF5 A;  1K1Q A;  4YP3 A;  3TEH B;  2W7O A;  5DG7 A;  4IJH A;  4O3P A;  3HOZ H;  1RJT A;  1MGS A;  4DN4 M;  1GM5 A;  2W9C A;  4HYK A;  4JI3 Q;  1CKN A;  3NEN A;  4DR7 Q;  4IFD I;  1EYA A;  1G91 A;  4DUY H;  1DYQ A;  2Y0S B;  2RKS A;  1LUZ A;  4BBR B;  4FS2 A;  3NWT A;  2DY8 A;  2I5L X;  4ZQI A;  4RU9 A;  3ORR A;  2YYA A;  3GIL A;  1JJG A;  3K5I A;  4FXK C;  4PDB A;  2DPI A;  1VQC A;  1A3U A;  4DR3 H;  4N9T A;  4IZO A;  1VQ7 A;  3HOV B;  2OWO A;  3NK9 A;  3SGI A;  4A75 A;  3TIG A;  2AMC B;  4DV3 H;  1X3Q A;  2RBM A;  3CQZ H;  2NVX B;  3DHQ A;  4POG A;  1WTX A;  4FXG C;  2YU9 H;  1L1O A;  2EYL A;  2B63 B;  1I4X A;  4IHJ F;  1M1K C;  2CH4 A;  3TS2 A;  2V9W A;  1M90 C;  2E74 C;  2K52 A;  5I6Y A;  5M3F B;  1WSC A;  4O4L F;  1GUN A;  5T1I A;  4ZAI A;  1V1Q A;  5GQO A;  4ME5 A;  4ZI7 F;  3HOZ G;  1U4P A;  1F2Y A;  3K5L A;  1ENF A;  3K7A B;  3GTQ H;  3CU7 A;  4KHP Q;  3KHL A;  1EZ6 A;  4LWC A;  5BN4 A;  2A6E C;  1W93 A;  1CTM A;  4MV6 A;  3H91 A;  1NJI C;  4G7O C;  2A1A A;  5JVG 3;  4O2A F;  2HIV A;  4IN3 A;  4Q8E A;  2PNR C;  2JA8 H;  1Z6H A;  4X62 Q;  4A3F G;  3MXN B;  3SE7 A;  3MFH A;  3QG1 A;  3OSP A;  1B33 N;  3GTP A;  1GYF A;  3H6M A;  4ZK9 B;  5LMU Q;  3QFF A;  4A3D H;  2E2H B;  3HKZ E;  4PZ7 A;  3SR1 A;  4EQO A;  4AYB G;  1A2U A;  5JH7 F;  5DG9 A;  2NN6 H;  4NP5 A;  1KC8 C;  3Q22 A;  4DL5 A;  4WFN 3;  1X6O A;  1G6Z A;  4DL6 A;  3RV3 A;  1VDZ A;  1SFO B;  3J81 L;  2BDN A;  3HG9 A;  2K4K A;  5KFU A;  2GPS A;  1GUT A;  2R93 B;  1VQO A;  4XXE A;  1B70 B;  5I9P A;  4DR1 L;  2YL2 A;  3ZJY C;  3KHH A;  3RGX A;  4BY7 H;  2N88 A;  2RQX A;  1IBK L;  5IYZ F;  4B3M L;  3D3R A;  5FLX L;  2R61 A;  4OWW B;  2WKC A;  4YHH L;  4P73 A;  2Z8L A;  2HQE A;  3T53 B;  2X0S A;  3MR6 A;  3E9I A;  3DMU A;  3TP6 A;  3K59 A;  2N49 A;  3KAJ A;  4V19 0;  1PYS B;  2ALZ A;  2BE5 C;  4A3D G;  4Q0F A;  2KQ3 A;  2JQO A;  1UNN C;  4DL2 A;  1FYC A;  1WFQ A;  5FO9 B;  4C3I H;  3F1Z A;  4HTH A;  2MGS A;  1O7I A;  3IKJ A;  4UP9 A;  2PMZ A;  2EVB A;  1SYF A;  5HUR A;  1NNX A;  1K8M A;  5EDW A;  3GTM B;  2UUB L;  3RB6 A;  1AE2 A;  3WDN A;  4YQW A;  3UE0 A;  3PV0 A;  3DM1 A;  5EKI A;  1BCP B;  3U9S A;  3M4O H;  4NXN H;  3FVQ A;  1II3 A;  4DV1 L;  3FPP A;  2ZJQ A;  3L3O C;  1AUV A;  2I5M X;  3S1M B;  3K3P A;  3M4Q A;  5ELC A;  4UPA A;  2E2J B;  2C9O A;  1AFP A;  3L4K A;  2R7M A;  4BY7 G;  4DV0 H;  1YHQ A;  4Q0Y A;  5KFI A;  4C3J G;  2RDJ A;  2PO4 A;  3R2T A;  1M6V A;  2DY7 A;  3MR3 A;  4DUZ H;  5IGD A;  4JI2 L;  2R8K A;  3RLF A;  4DV7 Q;  1XPR A;  5IP7 H;  1NTG A;  1HJP A;  5FJ8 H;  2VY3 A;  5FLM H;  4B3S Q;  5KFY A;  3ERO A;  1XNR Q;  4UCU A;  1W3S A;  1J5E L;  4ALP A;  3M3Y H;  2SNM A;  4J9M A;  1CS0 A;  4N9P A;  3GV5 B;  1KDC A;  3HKZ B;  4FYD A;  5JJL A;  2FMC A;  4E4T A;  1Q12 A;  5ELE A;  3KK7 A;  3A8I E;  1S40 A;  5KT2 A;  2AU0 A;  2KCT A;  2VXW A;  4LUO A;  1F2Z A;  3VR4 A;  1L0W A;  1BF4 A;  1ZKO A;  3JAM W;  5CV4 A;  3OUZ A;  2VA3 A;  4DR3 L;  3MEF A;  4C3I G;  3H15 A;  5FD5 A;  5M5X B;  1B2T A;  1A3T A;  3CVZ A;  5LMN L;  3RLO A;  4DF7 A;  1WJJ A;  2OQ0 A;  3WO1 A;  5LHY 1;  3EN2 A;  1ESF A;  4ED3 A;  2UXD Q;  3KF8 A;  1AEX A;  4JI3 L;  2FK2 A;  1XNR H;  1TWA A;  4DR7 L;  3TII A;  3BYY B;  3VR2 A;  1E4G T;  4JI4 H;  2FXQ A;  3PIO 3;  2K05 A;  3SEB A;  3CCU A;  4CJ2 C;  4AQY H;  2D0O A;  1SE4 A;  3U4Z A;  4DK3 C;  4TKO B;  3R23 A;  4YJ3 F;  2CQA A;  4GZY C;  4K6L A;  2SEB D;  1I94 Q;  2PQA B;  3F2U A;  3ICE A;  5IP7 G;  1SYX B;  1YNJ D;  5FJ8 G;  5FLM G;  3NUC A;  4EQP A;  5FOB B;  3H40 A;  5AJ3 Q;  5M5Y B;  2DIK A;  5KG1 A;  1TT2 A;  2W8K A;  4DGZ A;  2BE5 D;  3HOY B;  4UCT A;  3PQI A;  1H9R A;  1CE8 A;  1STE A;  3HOX B;  4ECV A;  1T36 A;  5ISR A;  3N8D A;  2ZDH A;  5IWA H;  3QZ8 A;  4O3Q A;  5J3B A;  1TWF B;  5D3I B;  4RZQ A;  1JWM D;  1Y1V A;  3QZ7 A;  4JBK A;  4XTC S;  1BBX C;  3PO3 H;  3RJ0 A;  4RUC A;  3N44 B;  1YHB A;  2NU7 B;  5D1O B;  3CCJ A;  3H4D A;  4EX5 A;  1V43 A;  4RHR A;  2F52 A;  1EY6 A;  4G7Z C;  4KK7 A;  1LTB D;  1VQD A;  1RF2 D;  2K50 A;  1Q46 A;  2R8J A;  1Z2O X;  2WV6 D;  2FMA A;  1TWA H;  2UXB Q;  2Q8I B;  5C1O A;  1T94 A;  4KHP L;  1QVC A;  5D3D A;  4A3K B; 
#chains in the Genus database with same CATH homology
 3J80 i;  4YY3 L;  3RZO H;  2RHQ B;  4LFA Q;  1VQN A;  5JEA J;  3LGJ A;  1B8A A;  3K80 C;  5C44 G;  3OW2 A;  1E1O A;  3AFQ A;  4X62 L;  3Q8D A;  4X64 Q;  4DR4 L;  4A3G H;  2QGQ A;  2NVQ H;  4X66 Q;  1HZB A;  2JE6 I;  3PUY A;  4JI1 L;  5M5X H;  2VQE Q;  4NXN Q;  5LMU L;  4DV6 Q;  1L1O C;  2UXC Q;  1VQM A;  4IOC A;  2ZTD A;  3DLL A;  1UEB A;  4DAY B;  1A8V A;  4YCV A;  3U50 C;  3S17 H;  2Z6K A;  2V1C C;  1YVC A;  1HZC A;  4DV0 Q;  2JA8 G;  4LFB Q;  4A3E H;  4JG2 A;  4IFD G;  1KAW A;  2CFM A;  4DUZ Q;  2AWO A;  1MKH A;  2Q2H A;  4POF A;  2E2I H;  4JI6 Q;  3PO3 G;  2ZJR A;  4BY1 G;  2NZH A;  4JI7 L;  1WI5 A;  1YEZ A;  2UUC L;  1XMQ Q;  2ATW A;  3F2D A;  4A3B H;  1N36 L;  1IL2 A;  3CCQ A;  2NN6 G;  4A3C G;  4LFC Q;  4LUV A;  1VQP A;  3CCE A;  1OXS C;  1TXY A;  2C35 B;  1VQK A;  4IPH A;  1Z47 A;  5ELN A;  2WB1 E;  3STB D;  3D0F A;  3CCR A;  4DR2 Q;  5M5Y H;  1IXR A;  2WP8 J;  2VQE L;  1EQQ A;  1VQ8 A;  3HOY H;  4GN4 B;  1XJV A;  3HOU H;  1EIF A;  1L2F A;  5IP9 G;  3UDX A;  3HKZ G;  3HOX H;  4HJ5 A;  5JJI A;  4OXP A;  4JI0 Q;  2NZO A;  1EWI A;  1YZ6 A;  4LF4 Q;  3ULP A;  1XTD A;  2D62 A;  1TWF H;  4BA2 I;  3GTG H;  4A3G G;  3NBH B;  1H95 A;  5JEA G;  3W1B A;  4P71 A;  3CP0 A;  3EBE A;  1OXX K;  3PGZ A;  2KBN A;  3BZK A;  1SE8 A;  4H02 A;  4GOP B;  5H1S E;  4HJ7 A;  1PHJ A;  4JI4 Q;  2JEA I;  3GTL H;  4AQY Q;  1GD7 A;  1SRO A;  3BZC A;  3G71 A;  4DUY L;  2OCE A;  1VQ6 A;  3B6Y A;  2MO0 A;  5GAE C;  4A3E G;  4TVA B;  1Y1V G;  5ELO A;  3KOJ A;  1VQF A;  1X54 A;  5IT9 c;  1X65 A;  4QGU A;  4Y52 H;  1JJC B;  4A3K H;  4A3B G;  2HIX A;  5IYC H;  4HIK A;  1UE6 A;  3H3V I;  4DV3 L;  1KIX A;  4JYA L;  1Q1E A;  5IWA Q;  4GKJ L;  1ASZ A;  4DV7 L;  3UDF A;  1BKB A;  2IT1 A;  2CWP A;  4AYB E;  3HOY G;  2Z6K C;  4R4C A;  3HOU G;  1T9H A;  3HOX G;  1XNR L;  3RLN A;  2MFI A;  2PI2 E;  4JBW A;  3CF5 A;  4GNX C;  4HJ8 A;  1A62 A;  3FKI H;  3CC4 A;  3AFP A;  3J80 c;  1B7Y B;  3CAM A;  3STB C;  4DK6 C;  1OXV A;  1HNX Q;  3GDE A;  4A3F H;  4B3T L;  2A8V A;  1VQB A;  3I7F A;  4L5S A;  4LW1 A;  3F2B A;  2CWA A;  2WB1 G;  4DNI A;  5IE8 A;  3KLW A;  1C7Y A;  2WAQ G;  1YHA A;  1HZ9 A;  4OON A;  1SLJ A;  4XIG S;  4RG1 A;  3PUV A;  1PH4 A;  1PFS A;  1XMO Q;  4IPC A;  1BBU A;  1QZG A;  3AQQ A;  1VQJ A;  1FL0 A;  3NEM A;  2A19 A;  2VQF L;  2NVY H;  3D31 A;  3U4V A;  4NXM L;  2RF4 A;  2K5N A;  5C3E H;  1TWC H;  4A3I G;  1P8L A;  1CKO A;  1K0R A;  3G4S A;  4DR6 Q;  1GVP A;  2UXD L;  4A3K G;  4Y7N H;  1G6P A;  1K9M C;  2UU9 L;  5IYC G;  4JI8 Q;  3RZD H;  1UE5 A;  4BBS G;  1X55 A;  4OX9 L;  1IBL Q;  1SR3 A;  1A0I A;  3KFU A;  3L0O A;  4IOA A;  1OXT A;  2K5H A;  2LXJ A;  1QZH A;  2JA6 H;  5GAH C;  4R1J A;  3J7Z C;  3PF4 A;  3KJP A;  1I94 L;  1N32 Q;  4A3J H;  2YTY A;  1E22 A;  4YWK A;  4PG3 A;  4NB3 A;  4UP8 A;  1K3R A;  5AJ3 L;  2BH2 A;  4EQ5 A;  3CW2 C;  4C3H H;  4A3M H;  1XMO L;  1YJN A;  3EIV A;  1C0A A;  1IBK Q;  1YBY A;  1PA6 A;  3M9B A;  2N8N A;  1WCM H;  1EIY B;  4B3M Q;  2ZJP A;  3HFZ B;  3T1H Q;  5C0X G;  1G51 A;  3A0J A;  4YHH Q;  2Y0S E;  4BA1 I;  5M3M H;  1OTC A;  1UWV A;  1BVS A;  2R7Z G;  3CPF A;  2JA5 H;  1CSQ A;  2GN5 A;  1FJG L;  4A93 H;  2F3I A;  2HHH L;  1X3E A;  4GLA C;  4LF8 Q;  3I4M H;  1RIP A;  3S15 H;  1MJE A;  1IBL L;  2KEN A;  2WFW A;  4K0K Q;  4L5Q A;  2JEB I;  1Q7Y C;  1AE3 A;  1HZA A;  1W2B A;  5C3E G;  2CCZ A;  2UUA Q;  2BA0 A;  1NE3 A;  2R7D A;  3W1G A;  3KJO A;  1HNZ Q;  1X3F A;  4JV5 Q;  1HNW Q;  3H0G H;  4FDB A;  2GVB A;  1VQE A;  4BBR H;  4R4Q A;  2KCM A;  2MNA A;  1TWH H;  1XPO A;  2UXB L;  3RN2 A;  3AYH B;  1S72 A;  1N33 Q;  1YI2 A;  1Q86 C;  4KHZ A;  1MJC A;  1YIJ A;  2UUB Q;  1JMC A;  2YV5 A;  4C3J H;  4OO1 I;  3PIP A;  4KI0 A;  2IHE A;  2XGT A;  1PV4 A;  4DV4 Q;  1VQ5 A;  2MO1 A;  2NVT H;  2JA6 G;  1N9W A;  3HOV H;  4LFA L;  3A5U A;  2H5X A;  4LF6 Q;  4APV A;  4A3J G;  3J7A 5;  3K0X A;  3CC2 A;  4R4I A;  4X64 L;  2I0Q A;  4JI5 Q;  4GLV B;  4X66 L;  4DR5 Q;  4NPS A;  3AEV A;  1D8L A;  4NXN L;  4A3M G;  1EOV A;  3S1R H;  1MIU A;  4DV6 L;  2UXC L;  1Y14 B;  4JCV E;  4GKK Q;  2OQK A;  1WCM G;  3ER0 A;  4JI2 Q;  3CPW A;  1VQG A;  4PZ6 A;  5M3F H;  3GTP H;  1VQI A;  4YCW A;  4DV0 L;  2CKZ B;  2ZTE A;  4LFB L;  3J81 j;  1CKN B;  3FHW A;  2I5H A;  3M85 A;  1LTL A;  5IYB H;  1J5E Q;  4DUZ L;  4B3R Q;  2JA5 G;  5HGQ A;  4A93 G;  1S3O A;  1KHI A;  4JI6 L;  1NBW A;  1Z9F A;  1P16 A;  4TQU S;  3I4M G;  1WOC A;  1EYG A;  4HJA A;  1N8R C;  4DV5 Q;  1XMQ L;  4LNQ A;  4QY7 A;  2KHJ A;  4DV2 Q;  1I3Q H;  2PI2 A;  2Q2U A;  1KL9 A;  4QJF A;  4LFC L;  4JC0 A;  1YIT A;  3FP9 A;  3KF6 B;  3ERS X;  4R4O A;  4IFD J;  2ES2 A;  3OTO Q;  1QUQ B;  2CQO A;  3H3V H;  4DR2 L;  3K81 C;  4J15 A;  5LMN Q;  3PF5 A;  3M7N A;  3TEH B;  5C4X H;  3PSI A;  4IJH A;  1U0L A;  3ULL A;  3S1N H;  4LF7 Q;  1Q8K A;  3HKS A;  2ASB A;  1L1O B;  4X65 Q;  3HOZ H;  4A76 A;  5BR8 Q;  1SMX A;  4JI0 L;  1GM5 A;  4LF4 L;  2R92 H;  4JI3 Q;  3S16 H;  2OTJ A;  3S2D H;  3KF8 B;  1CKN A;  3NEN A;  4QIW E;  4DR7 Q;  4IFD I;  2PMZ E;  3PUX A;  1VQ9 A;  3I4N H;  1LUZ A;  4DV5 L;  4GOP A;  1PH6 A;  2I5L X;  1AH9 A;  4JI4 L;  1BBW A;  1I6H H;  4AQY L;  1JJG A;  3KF6 A;  1PYB A;  2HQL A;  1VQC A;  1WYD A;  4A3L H;  2QEX A;  3S1Q H;  5IYB G;  1QUQ A;  1VQ7 A;  1V9P A;  3GTK H;  3U58 A;  1EQR A;  2OWO A;  3SGI A;  1A63 A;  1NMF A;  4A75 A;  1K83 H;  2AMC B;  3CCL A;  3CC7 A;  3CQZ H;  1PH1 A;  5DLQ E;  4IPD A;  4POG A;  1YJ9 A;  2YU9 H;  1L1O A;  2D0P A;  5GAG C;  4QL5 A;  4X6A H;  2AWN A;  1M1K C;  2IX1 A;  1C9O A;  3TS2 A;  2F4V Q;  1M90 C;  4HID A;  2K52 A;  3KDF B;  5IWA L;  1I50 H;  3HOW H;  3I56 A;  1YNX A;  2E5L Q;  1Q82 C;  3TRZ A;  5C4X G;  1V1Q A;  5GQO A;  3GD7 A;  3GO5 A;  3HOZ G;  1LM0 A;  4LF5 Q;  2YYZ A;  2R92 G;  4KLK A;  1PH3 A;  4LF9 Q;  1HNX L;  5HY6 A;  1IBM Q;  1HR0 Q;  3DM3 A;  3VDY A;  3GTQ H;  2K14 A;  3GTJ H;  4KHP Q;  1E3P A;  4LWC A;  3T1Y Q;  4RMF A;  1YJW A;  4YY3 Q;  3I4N G;  1VS0 A;  3PUW A;  4DR1 Q;  3GTM H;  5GRO A;  2R7F A;  5M5W H;  3CMA A;  1NJI C;  2A1A A;  1KXL A;  2HIV A;  3FKI G;  2ZM6 Q;  1X9N A;  2JA8 H;  2BH8 A;  4X62 Q;  1PH7 A;  3CCS A;  4A3F G;  2E8G A;  1G29 1;  3MXN B;  1CKM A;  4A3L G;  2E2J H;  3A74 A;  1Q1B A;  3KDF A;  4JI1 Q;  2N78 A;  4BY1 H;  5LMU Q;  1RL2 A;  4A3D H;  2JA7 H;  2L15 A;  4DR6 L;  1SRU A;  3HKZ E;  4PZ7 A;  4AYB G;  1KC8 C;  3UE1 A;  4A3C H;  2IHF A;  4JI8 L;  3K7U C;  4LF5 L;  5C4J H;  1X6O A;  4IPG A;  4MNO A;  1KRT A;  1OXU A;  3I2Z A;  4GNX B;  1PH2 A;  2PNH A;  3UDI A;  2K4K A;  4GOP C;  3TS0 A;  4JI7 Q;  5IY0 A;  2VUM H;  2NN6 I;  3GTO H;  3HOW G;  1QVF A;  3I4O A;  1N32 L;  1KRS A;  1VQO A;  1N36 Q;  2EXD A;  5GAD C;  1B70 B;  3PO2 H;  4DR1 L;  5IP9 H;  4HJ9 A;  2B29 A;  1QVG A;  1UE1 A;  1VQH A;  3ZJY C;  1SN8 A;  4HIO A;  2YTX A;  2ZM6 L;  4BY7 H;  1PH8 A;  1IBK L;  3RNU A;  3IRB A;  4P72 A;  4B3M L;  1CUK A;  1JT8 A;  2ALY B;  3UDG A;  2ZTC A;  5E7N A;  3T1H L;  4DV1 Q;  4OWW B;  2K75 A;  4P73 A;  4YHH L;  3BJU A;  1N34 Q;  4JBJ A;  3E9I A;  2NVX H;  5JJK A;  4P75 A;  5EAY A;  2N49 A;  3J81 c;  2B63 H;  2AKW B;  1E24 A;  4OWT B;  3JAM i;  2JJQ A;  4GNX A;  4LF8 L;  2Q2T A;  4PMW A;  3ULJ A;  4K0K L;  1XNQ Q;  1Y1V H;  1NMG A;  4L5R C;  4BXX H;  1PYS B;  3F8T A;  1IYJ B;  4YWM A;  2UUA L;  4A3D G;  1HNZ L;  2JA7 G;  5M3M G;  1LYL A;  1HNW L;  4JV5 L;  2JQO A;  4GN5 A;  1JB7 A;  1WFQ A;  4C3I H;  3F1Z A;  1O7I A;  4UP9 A;  3WWV A;  4A4I A;  4JOI A;  4YCU A;  4DUY Q;  1N33 L;  3A5Z B;  2UUB L;  1AE2 A;  1VQA A;  5FLX c;  3L7Z C;  4GS3 A;  3UE0 A;  3K7A H;  2RHS B;  3PV0 A;  1VQ4 A;  3E9H A;  4DV4 L;  2IY5 B;  4QQB X;  2VUM G;  3I55 A;  3M4O H;  2WAQ E;  2VW9 A;  4OO1 G;  2IX0 A;  4DV1 L;  2ZJQ A;  2B3G A;  1HH2 P;  4LF6 L;  2I5M X;  2Y0S G;  4OWX B;  3M4Q A;  4DR3 Q;  3H0G G;  4UPA A;  1N34 L;  4JI5 L;  4BBR G;  1R9T H;  1I5F A;  3TQY A;  4JBM A;  3PO2 G;  4DR5 L;  3M4P A;  2GVA A;  4BY7 G;  1YHQ A;  4DV3 Q;  4PZ8 A;  4IJL A;  4JYA Q;  3W5O A;  4GKJ Q;  1K73 C;  4JI2 L;  1E7Z A;  1XNQ L;  3RLF A;  4DV7 Q;  1XPR A;  3HOV G;  5IP7 H;  1NTG A;  1HJP A;  4ME3 A;  5FJ8 H;  2VY3 A;  5FLM H;  1TWG H;  2AHO B;  1Y1W H;  1KD1 C;  2E2H H;  4B3S Q;  4UY8 C;  1XNR Q;  1W3S A;  1J5E L;  4ALP A;  4B3R L;  3M3Y H;  3S24 A;  3CD6 A;  5LMN W;  3J81 i;  2B63 G;  5IYD H;  3PUZ A;  4L5T A;  4B3T Q;  2R6G A;  4WJ4 A;  2KHI A;  2Q2I A;  2OTL A;  5JJL A;  1SFO H;  4UP7 A;  3TRE A;  1Q12 A;  2EIF A;  4DV2 L;  1K8G A;  1PVO A;  4BXX G;  5M3F G;  1S40 A;  1VCI A;  2KCT A;  2EQS A;  4LUO A;  4A3I H;  1FGU A;  2DGY A;  1L0W A;  1IZ6 A;  2R93 H;  4DAM A;  4AIM A;  3MEF A;  4DR3 L;  3OTO L;  3H15 A;  2VZA A;  2XTI A;  4BBS H;  1NY4 A;  3CME A;  2VQF Q;  5LMN L;  3RLO A;  4NXM Q;  1WJJ A;  2OQ0 A;  1E1T A;  1EUJ A;  1PH9 A;  3EN2 A;  4LF7 L;  1U5K A;  4GKK L;  4X65 L;  1J6Q A;  3L2P A;  5BR8 L;  2UXD Q;  4IO9 A;  3PCO B;  1PH5 A;  1GO3 E;  4JI3 L;  4HIM A;  4DPG A;  2UU9 Q;  4B3S L;  4DR7 L;  2FXQ A;  3CCU A;  2MQH A;  3RN5 A;  1Q81 C;  1JJ2 A;  2D0O A;  4DK3 C;  3U4Z A;  5C0X J;  3PIO A;  4OX9 Q;  4C2M H;  3NEL A;  1X3G A;  2BA1 A;  4YWL A;  3S14 H;  3OYY A;  1I94 Q;  2PQA B;  2HT1 A;  1ASY A;  4P74 A;  5IP7 G;  3ICE A;  1CSP A;  5FJ8 G;  1Y1W G;  5FLM G;  2YTV A;  5C44 H;  4JOI C;  4GLX A;  1FVI A;  5AJ3 Q;  2R7Z H;  3CCM A;  2ID0 A;  2JA9 A;  1X56 A;  1UE7 A;  3S2H H;  1GKH A;  5IYD G;  1XPU A;  5C0X I;  4O0A A;  3BU2 A;  2RCN A;  3E0E A;  4GN3 B;  3K8A A;  3RR5 A;  4R4T A;  1DGS A;  4O2D A;  2N3S A;  4MZ9 A;  1JE5 A;  5J3B A;  4DR4 Q;  3JAM c;  2Z0S A;  2LXK A;  3CCV A;  1HR0 W;  2R93 G;  3S1M H;  4JBK A;  2F4V L;  2VL6 A;  4WJ3 M;  3KYH C;  4XTC S;  3G48 A;  3F2C A;  2QA4 A;  4AH6 A;  4LUZ A;  1FJG Q;  3PO3 H;  3CXC A;  2HHH Q;  4DKA C;  1YHB A;  2E5L L;  2DUD A;  3CCJ A;  2JK8 A;  4EX5 A;  1V43 A;  1KQS A;  5K36 G;  2F52 A;  2K5V A;  3G6E A;  2PQA A;  1VQD A;  1K8A C;  2VNU D;  2VS1 A;  2K50 A;  1Q46 A;  4MTN A;  4LF9 L;  1D7Q A;  1VQL A;  1EFW A;  3JC6 6;  1IBM L;  1TWA H;  1HR0 L;  2UXB Q;  2LSS A;  4KHP L;  2UUC Q;  1QVC A;  3T1Y L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...