4A3DG

Rna polymerase ii initial transcribing complex with a 6nt dna-rna hybrid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3dG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3dG01
1IBLL 3H3VH 4A3JH 3EIVA 2GVAA 4DUYQ 4DR7L 1S3OA 3G71A 5LMUL 5ELNA 3DM3A 1E1TA 1VQFA 4A3EG 1VQ6A 2IY5B 4UY8C 2AWNA 4WJ4A 3CXCA 4YCVA 4GLVB 4B3TQ 1AH9A 3RLNA 5FLMH 3HOYG 4GKJQ 5GROA 4WJ3M 2GN5A 4UP8A 2QGQA 3UDGA 1HR0W 2L15A 3DLLA 1X55A 5C4XH 1PYBA 2VY3A 3STBC 3VDYA 1GM5A 4GN5A 3K81C 3PGZA 4UPAA 2EXDA 2NZOA 3MXNB 3Q8DA 1A63A 3PUZA 2R6GA 5BR8L 2UUBL 2Q2IA 1JB7A 4GOPB 4L5QA 3GTGH 4ME3A 2UUAL 1CSPA 3EN2A 1LUZA 2OWOA 4DV2L 4ALPA 4LF8Q 5IYBH 4A75A 2JA5H 4LUVA 3AFPA 4H02A 5IP9G 1K9MC 3CC4A 4B3SQ 1IBKQ 2HQLA 2UXBQ 3PIPA 4OWWB 2MFIA 4IPGA 3A74A 4PZ8A 1WOCA 4YY3L 4UP7A 1KRSA 1VQIA 3GTQH 1SE8A 1Y14B 1AE2A 2ZJPA 4BBRG 3E0EA 1UE6A 1VQDA 2MNAA 2AKWB 2WAQE 4LF5L 1BKBA 1WYDA 4AH6A 3NBHB 4GOPC 1B70B 1KD1C 1VQMA 3M85A 1E7ZA 3FKIH 4BXXH 4OX9Q 2JA7G 2WB1E 3WWVA 1X56A 1N9WA 1YNXA 3GTOH 3U50C 3G6EA 1XNQQ 4A93H 3GDEA 2JA9A 4DV6Q 2VQFQ 1I6HH 3CCRA 2NN6I 4DR4L 3S1RH 4JI4L 2ALYB 3HKZE 4DV1L 1HZBA 4JI5Q 4LF4L 3HOZH 4A3KG 3F2CA 1Q46A 4A3BH 4POGA 3L7ZC 3S1MH 4X66L 1MJCA 3S17H 4JV5Q 3CW2C 1N34Q 4JI0L 5GAEC 3M4QA 5IY0A 2HT1A 2K52A 4IPDA 4B3RL 3GTMH 1CKNA 3J80c 4PZ7A 4X64L 3T1YQ 1XPOA 2EIFA 1NMGA 2I5HA 1QZGA 1B8AA 2JK8A 2NN6G 4AIMA 4FDBA 2PQAA 1X65A 3AQQA 2XTIA 1QUQA 2CWPA 3TS2A 3M7NA 2CKZB 4HJ7A 1IBML 4X6AH 3KDFA 3HOXH 1VQ4A 1IBLQ 5M5XH 2MO1A 1JE5A 3UDIA 4HIOA 1PHJA 3NEMA 2B29A 5HY6A 4DR7Q 1J6QA 5LMNW 1YJWA 5LMUQ 4DAYB 2NVXH 1WCMG 1QVGA 3W5OA 1IYJB 2CQOA 4JYAL 1Q12A 4GLAC 2I0QA 3M3YH 1V43A 4JI7L 1UEBA 2AHOB 2H5XA 4X62L 3NENA 4DR5Q 4KHPL 1FL0A 2UUCL 1SFOH 1JJGA 4HIKA 2AMCB 4HJAA 4A3MG 2RHSB 1A0IA 2OTJA 3CCSA 1JJCB 1Q1BA 3I4MH 2R7DA 4BBSG 4LFAL 4P71A 2UUBQ 3KJPA 1MIUA 5BR8Q 4AYBE 4A3IG 2UXCQ 4LFCL 2K4KA 5M3FG 2UUAQ 4GN4B 3ICEA 4DV2Q 4DR3L 2BH2A 3F1ZA 4JC0A 3K7AH 2YU9H 3K80C 2Q2HA 4IPHA 4JOIC 1HZ9A 3A5ZB 3NELA 1YBYA 1X3FA 4NPSA 5HGQA 1ASYA 5AJ3L 4JI8L 4YY3Q 1HZCA 4NXNL 2JEBI 2Y0SG 3F8TA 3PO3G 2K5NA 2XGTA 2YV5A 1YEZA 3PF5A 2PMZE 4LF5Q 2ZTCA 1IL2A 4QGUA 1VQNA 2IHFA 3J81c 3S1QH 4PZ6A 5IT9c 4KHZA 1SLJA 4R4IA 2K50A 5IE8A 4DR1L 1H95A 4DR4Q 1W2BA 1PFSA 5GQOA 3OTOL 2UU9L 4JI4Q 3PUYA 2KENA 4LF4Q 2HHHQ 4A3DG 3H0GG 1G51A 3HOVH 3RN5A 1KIXA 3S15H 4BY7G 4X66Q 4QIWE 4OWXB 3B6YA 2ZM6L 4LW1A 1L1OA 4DPGA 1Y1WH 1I3QH 1B7YB 3I7FA 4JI0Q 5JJKA 2D0OA 2N49A 4YWKA 1YHQA 4B3RQ 1KXLA 1E24A 1CSQA 2ZTEA 4BY1H 4X64Q 3AEVA 5M5WH 4A3LG 1HH2P 4IFDJ 1N32L 2E2JH 4HIMA 1XJVA 2RF4A 3TQYA 1OXXK 1MJEA 3BZKA 5M3MG 4DR5L 5C3EG 2WB1G 1Q1EA 3CCQA 1IBMQ 3S1NH 1Y1VG 3M4PA 3RNUA 1NJIC 1XNRL 1D8LA 5IP7H 1SRUA 4A3CH 4HJ9A 1YITA 4GOPA 4L5SA 4GNXB 2JA8H 4P75A 4P73A 2KBNA 2UXCL 1JT8A 2UXDL 3CCJA 4JYAQ 4DR2L 1YI2A 1K8AC 4A3GG 2R93G 2DGYA 1FGUA 3I4NH 3I4OA 2YTXA 1I5FA 4JI7Q 4X62Q 1A8VA 4KHPQ 1VQ5A 4APVA 4EX5A 1PVOA 2UUCQ 5IYDH 5FJ8G 3RLFA 4A3MH 3D31A 1EOVA 3H15A 3J80i 2Z6KC 1TWGH 3K8AA 3KF6B 4C3HH 1G6PA 4A3IH 2NZHA 3S2HH 4AQYL 2EQSA 4LFAQ 2MO0A 3EBEA 4JBJA 3CCMA 4LF9L 3PO2G 4LFCQ 3M9BA 4YHHL 1OXTA 4DR3Q 1OXUA 3RZOH 1XTDA 2R92G 4HJ5A 4C3JH 1EQRA 2JA6G 2N8NA 5C0XJ 2ID0A 3J7ZC 1R9TH 5AJ3Q 4JI8Q 3HOWG 4NXML 1QVCA 1CKOA 1K8GA 2F52A 3JAMc 5C44H 4NXNQ 3STBD 2B63G 2HHHL 2VUMG 2QA4A 1UE1A 3GD7A 1TWHH 1K73C 3OYYA 5IYCG 3JC66 1PH4A 1G291 4IO9A 3U58A 1XMQQ 3PV0A 3H3VI 3F2DA 4DV7L 1NY4A 2JQOA 1VS0A 3K0XA 4OWTB 4R1JA 5J3BA 3ULLA 4DR1Q 2KCMA 4DAMA 5JEAG 1K83H 4Y7NH 1YZ6A 3OTOQ 4XIGS 2E5LL 1S40A 2UU9Q 4X65L 1OXSC 4QL5A 4A3DH 4QQBX 3H0GH 3PUXA 4DK6C 2E2HH 4BY7H 2PI2A 1WI5A 2A19A 2R7ZG 4A76A 3K7UC 4JCVE 5LMNL 1VQKA 2ZM6Q 2IX0A 2R7FA 3GO5A 4OONA 1N8RC 4A3EH 1PH6A 1K3RA 2MQHA 3I55A 4DV3L 4A3JG 1Q7YC 1TWAH 3U4VA 1TWFH 1Z9FA 3KOJA 3HFZB 2OQ0A 5GAHC 4R4TA 1N32Q 1JMCA 4JBKA 2WP8J 2ES2A 3HOYH 1LTLA 4JG2A 4JOIA 1PH5A 1AE3A 1WFQA 1HNWL 1SN8A 1Z47A 4MZ9A 1Y1VH 3KFUA 2E8GA 3CPWA 2C35B 3J81i 1L0WA 4RMFA 1Q81C 4JI1L 3CPFA 4GLXA 1XNRQ 3HOUG 3KF8B 3UE0A 1PH3A 1PYSB 5FLMG 1N33L 1VQEA 3UDFA 4GN3B 1LM0A 1KAWA 2ASBA 3W1BA 1YHBA 4GS3A 1KHIA 4O2DA 1EWIA 4A3GH 2UXDQ 2R93H 5C4XG 4DR2Q 1PA6A 5IP9H 3E9HA 1TXYA 4EQ5A 4KI0A 3S14H 4XTCS 2YTVA 1V1QA 2RHQB 2JEAI 2VW9A 1GKHA 1XPRA 4QJFA 4BBRH 1K0RA 2IHEA 5IYBG 1U5KA 1YJ9A 2JA5G 5ELOA 4DK3C 2OQKA 1FJGQ 1E22A 1XMOL 2JA7H 4AQYQ 1XMQL 1HNZL 4LFBL 2NVYH 3PUWA 1HJPA 3GTJH 4LF9Q 5IWAL 4YHHQ 4GKKL 1HNXL 3SGIA 5M5YH 2IX1A 2KHIA 2E2IH 4BXXG 2PI2E 3FKIG 4RG1A 4C2MH 2ZJRA 3HOWH 1IZ6A 1HZAA 2LSSA 4NXMQ 4A3KH 2VUMH 2BA0A 4L5TA 2F4VL 3AFQA 4IJLA 3KYHC 1YIJA 1VQ9A 3IRBA 4TVAB 3A5UA 4IPCA 2CFMA 2A1AA 3CAMA 2LXKA 1I94Q 2OTLA 4IJHA 3RR5A 1KRTA 3HOZG 2V1CC 1MKHA 1OXVA 3ULPA 2IT1A 4DV7Q 1Q86C 1M90C 4BA1I 1QZHA 2NVQH 2CCZA 3TREA 1VCIA 2WAQG 1QVFA 3TS0A 5C0XI 1EYGA 2E5LQ 3PSIA 4X65Q 1HR0L 1VQCA 1BVSA 2I5MX 4JI3L 1EIFA 1PH2A 3FP9A 2Z6KA 4JBMA 1PH8A 3TRZA 2DUDA 3E9IA 4A3FG 4DUZL 4B3ML 4DV5L 5LMNQ 3S16H 1UE7A 3S2DH 4K0KL 1D7QA 3PF4A 1WCMH 3HOXG 3ER0A 4NB3A 4DV3Q 3HKZG 2RCNA 4LF7Q 3JAMi 4TQUS 5FLXc 4JI2L 1C0AA 2K14A 3CCEA 3GTKH 2Y0SE 3L2PA 4UP9A 1HNWQ 1L1OB 5C0XG 4DV0L 1X54A 3G48A 4A4IA 1X3GA 3KF6A 3HOUH 4GNXC 2F3IA 1XPUA 4JI1Q 4Y52H 4O0AA 1N33Q 3RLOA 1VQLA 3PCOB 4OO1I 1FJGL 5JJIA 4LF6L 4BBSH 2KHJA 5E7NA 1NBWA 3ZJYC 3PIOA 5M3FH 3OW2A 4QY7A 4LNQA 1L1OC 1A62A 1IXRA 1I50H 3I4MG 3W1GA 2Z0SA 3PO3H 2B3GA 2BA1A 1X9NA 3FHWA 4IOAA 1NTGA 1VQOA 2YTYA 1VQHA 3AYHB 1YJNA 1GVPA 3PUVA 4PG3A 4P74A 3S24A 3ULJA 4J15A 2LXJA 3CC2A 4OO1G 4DR6L 1CKMA 4DV4L 3A0JA 1XMOQ 2VZAA 1I94L 1VQGA 5C4JH 4R4OA 1HNZQ 4LFBQ 1Q82C 1N36L 5IWAQ 2GVBA 4R4QA 4DNIA 4GKKQ 4MTNA 2Q2UA 1HNXQ 3M4OH 3D0FA 1KL9A 1M1KC 3GTLH 2AWOA 1RL2A 4JI6L 4JBWA 1VQPA 4L5RC 4LUZA 4AYBG 3BZCA 3HKSA 3T1HL 2VQEQ 2F4VQ 2N3SA 1GD7A 1BBWA 3RZDH 1J5EL 2K5HA 2ZTDA 1LYLA 4MNOA 1WJJA 1V9PA 3RN2A 1PH9A 3HOVG 3BJUA 4DUYL 2NVTH 4A3LH 4LF7L 3CMEA 1C7YA 1YVCA 2WFWA 1Y1WG 2JJQA 2VS1A 1VQAA 1ASZA 5M3MH 4LWCA 1CUKA 5C3EH 2HIVA 3F2BA 3CQZH 1FVIA 4BY1G 1C9OA 2QEXA 1HR0Q 3BU2A 2A8VA 4JI3Q 1CKNB 4B3TL 4A3FH 4GKJL 4LUOA 1KQSA 4B3MQ 4DUZQ 4DKAC 4DV5Q 5DLQE 1EQQA 4K0KQ 1KC8C 3KJOA 2PQAB 4HIDA 2CWAA 1QUQB 5K36G 1NMFA 2YYZA 3CMAA 2KCTA 5IP7G 1PH7A 3ERSX 2JA8G 3KDFB 3GTPH 3U4ZA 4A3CG 1GO3E 1T9HA 4JI2Q 1S72A 4IFDI 2N78A 4DV0Q 1RIPA 4IOCA 2Q2TA 2ZJQA 5FJ8H 2JE6I 4B3SL 4LF8L 1W3SA 3UE1A 5JEAJ 4R4CA 1BBUA 1DGSA 1L2FA 4P72A 1P8LA 1IBKL 2ATWA 2I5LX 3I4NG 2UXBL 5EAYA 4C3IH 2PNHA 2K75A 4PMWA 3CC7A 4LF6Q 3TEHB 5IYDG 1SMXA 1EIYB 3PO2H 1EUJA 1P16A 1VQ8A 1YHAA 1PV4A 3J7A5 4KLKA 2R92H 1NE3A 3CF5A 4OX9L 2JA6H 1X6OA 2FXQA 4IFDG 1TWCH 1XNQL 1SR3A 4YWMA 3G4SA 4YCWA 4DV6L 2VQFL 5H1SE 2B63H 4BA2I 4A93G 4OXPA 3MEFA 2VQEL 2D0PA 5IYCH 1O7IA 1OTCA 2D62A 4DR6Q 3CD6A 4JI5L 1E1OA 1SROA 1Q8KA 2BH8A 4DV4Q 1VQ7A 1PH1A 5C44G 3L0OA 2VL6A 5GAGC 1E3PA 1U0LA 1N36Q 4A3BG 4JV5L 3J81j 1N34L 1X3EA 4POFA 4YWLA 1VQBA 3I2ZA 3T1YL 3I56A 3CP0A 4JI6Q 2HIXA 2VNUD 3CCLA 1EFWA 5GADC 1UE5A 3T1HQ 2K5VA 1UWVA 3KLWA 2OCEA 3CCVA 4GNXA 4HJ8A 2R7ZH 4YCUA 1J5EQ 3CCUA 1JJ2A 4DV1Q 5JJLA 3LGJA 1VQJA 3UDXA
chains in the Genus database with same CATH superfamily
3H3VH 1HNWH 5KT3A 1M0TA 3E5SA 3RGZA 2LS01 1K83B 2YCHA 4DUYQ 4DR7L 3HKZA 3G71A 4ECWA 5ELNA 3DM3A 1E1TA 1VQ6A 3JZIA 4ZUJA 1NCVA 1F9PA 4YCVA 4JV0A 1RDPD 3RLNA 5EBDA 1D5ZC 5GROA 2V4RA 2GN5A 4UP8A 1TWAB 1DOLA 1RODA 1I6VC 1TWFB 5K36H 2B2UC 1X55A 1PYBA 3STBC 3VDYA 4KKTA 4G7OC 1EZ6A 2MP1A 4WD3A 1Z2NX 4YIJA 1EUDB 1S10A 1CT1D 4KHVA 4GOPB 4L5QA 1RF2D 2EJMA 2UUAL 3NGDA 1ZETA 4DLKA 4LF8Q 4A75A 1XMQH 1YNNC 3BZDB 4LUVA 1HNZH 4LFBH 2JA6A 2V9WA 2UXBQ 4RB1A 2F4IA 5C5MA 2MFIA 4IPGA 4YY3L 3GTQH 4J9SA 1Y14B 3Q2OA 4DR1H 3QFFA 4BBRG 3LP8A 2JN4A 3BS1A 4IQZA 3N41B 2MNAA 1OWTA 2WAQE 3NSWA 4LF5L 4AH6A 3NBHB 1E7ZA 2CW0D 3K6OA 2JA7G 5KFRA 4BBRB 2XC9A 1N9WA 2VR1A 5KFGA 1STNA 2IJ0A 3U50C 3GDEA 4UCUA 1SNOA 1E4EB 4JK1C 3TP7A 4K5WA 2JA7B 5L37A 1A9XA 2NVYB 2YYAA 3HKZE 4DV1L 1VF5C 1HZBA 1SE4A 4JI5Q 2IX3A 1Q46A 4A3BH 2EJFC 4N8FA 3HP3A 3L7ZC 2ZXPA 5CV8A 1KLGD 3DEOA 3NWSA 3CW2C 4TSSA 3R5HA 4Q45A 3SHLA 3GIIA 4B3MH 1GSOA 2I5HA 4CBVA 4PQXA 2JK8A 3GILA 3MWEA 1I4RA 2FKLA 4JI2H 4KY5A 5A2QW 5JH7F 4XYOA 4U7CA 3NHHA 1PTOF 2A68D 1C30A 2C5CA 2PZUA 3ITPA 1JWUD 5LHY1 1JDEA 4DR7Q 4YR0A 1FD7D 2KHSA 1YJWA 4YJ3F 5LL6b 3T13A 1WCMG 4U68A 1FJGH 1IYJB 4JYAL 4DL2A 1JICA 4C1NI 2SNSA 2ASLA 2I0QA 2GPWA 5F9LA 1BCPB 3SE7A 2EJGC 3BQ2A 3VR3A 3T56B 2AHOB 3A8KE 1WCMB 5D8DA 3WO1A 1ZKOA 4YAJB 4HIKA 3LMLA 5DM63 4RUAA 2DIKA 4HJAA 3RD4A 1JOOA 2OTJA 1A6XA 1Q1BA 3K57A 2R7DA 1SJHD 4G7HC 1TY0A 4BBSG 2W6OA 1I4PA 3KJPA 2UUAQ 2WIIB 5CV4A 4GN4B 5M3FG 4DR3L 2G9DA 2BH2A 4K2LA 1I94H 3F1ZA 4M8AA 3ZYYX 2YU9H 4BBSB 2Q8TA 5AJ3L 5M3FB 4JI8L 4YY3Q 1W96A 2C28A 1TS3A 2XGTA 3PIP3 4O3NA 5KFIA 5FLXW 4R8UB 1YEZA 5CAEB 4LF5Q 5BPFA 1MI2A 4X65H 1AZPA 4FNFA 4RKBA 2HVSA 1TWHB 4QF4A 1DCZA 1PFSA 1EOTA 5GQOA 2UU9L 5KNDA 4NMZA 1WD0A 4DAVA 4TV9F 1K83A 1ZEQX 2ZM6L 1Y1WH 4MAMA 5KFOA 2Z4IA 4EYHB 1HUNA 1EYZA 3RZDB 3OHAA 2R8KA 4A3LG 1STBA 2B2TC 4NKLA 1TWAA 1TWFA 1XJVA 1SBBB 3P7JA 3SEBA 2XWBB 4TQSA 3TQYA 3BZKA 4O4IF 4DR5L 2WB1G 1BXRA 1Q1EA 1MD2D 4H0LC 3CCQA 3S1NH 3FMAA 1VF7A 3RNUA 1XNRL 5IP7H 1WTOA 4L5SA 4GOPA 2FK3A 2WB1B 4PWQA 1ILQA 2UXCL 4JYAQ 4DR2L 4A3GG 3RAXA 3A54A 3PQIA 1M0WA 1PX2A 3K5MA 1VAJA 2HQEA 3QOJA 2YU9A 3NBHA 1V1PB 5DLFA 3H15A 2FMMA 3J80i 1XNQH 2V5AA 1TWGH 3K8AA 1G6PA 1S5DD 3KAJA 5IOCA 2R8IA 4DV6H 3S2HH 2QYZA 1M8AA 4CGYB 4AQYL 2EQSA 2F4VH 2AQ3B 3EBEA 1E4EA 4YHHL 4DR3Q 3GIJA 4XX0B 2NVYA 2W6MA 5C0XJ 5BN4A 5J39A 2W7OA 5AJ3Q 3AB9A 4JI8Q 1Z2OX 1O78A 2O03A 4ULLA 1LTGD 1QVCA 2EYLA 2F52A 5DM73 1DM0B 3STBD 2B63G 2HHHL 3MR2A 1UE1A 2VQDA 1TWHH 4OGQC 3OYYA 3VYUA 2XIWA 3N52A 3JC66 4HSPA 1IHZA 4APMA 2ZXOA 1Q8IA 2B63B 3H3VI 4YP3A 1YNND 4OWTB 2KCMA 2MUYA 5JEAG 4Y7NH 1YZ6A 1GUGA 4XIGS 2UU9Q 1S40A 4EQPA 2FK2A 1A3TA 3M4IA 1CQVA 2PI2A 2A19A 4ED0A 2JEIA 4KY6A 5LMNL 2ZM6Q 3GO5A 5LA6F 2B2VA 1K3RA 2MQHA 4DV3L 4A3JG 3OUZA 4LMQD 1Z9FA 3BYTB 1MBYA 1WCMA 4R4TA 2F0VA 3TP5A 2YL2A 1JMCA 4V0BA 4JG2A 1PH5A 3NQIA 3Q6SA 5BPHA 4A3JB 5I6WA 3MFYA 2NU7B 3TP6A 1PRTF 4MZ9A 5KNCA 4QWAA 5BR8H 2UUBH 2C9OA 1Q81C 3CPFA 4GLXA 1XNRQ 3UE0A 1PH3A 3BA9A 3RV3A 1DOMA 5CV6A 4HR7B 3C3LA 1D5XC 1KAWA 3BJYA 3W1BA 4A3GH 5KFNA 3HZXA 4DR2Q 1PA6A 3H3VC 2KVMA 5IP9H 1EZ1A 1A3UA 3E9HA 4CJ2C 4KMUC 5IGBA 1BNCA 1B53A 2YTVA 2Q8RE 1KJ9A 1EWCA 1GKHA 5KX5F 1YJ9A 1K0RA 2IHEA 5IIFA 1U5KA 5IYBG 2JA5G 3QZ8A 2OQKA 4FP5D 2WE6A 3P1HA 5KG0A 4JW0A 5JVDF 2PW5A 4AQYQ 1TWHA 3Q22A 2JA5B 1J5EH 1F9RA 1XXGA 2K7VA 4YHHQ 4GKKL 1D2BA 5M5YH 1RJPA 1S9FA 4BXXG 2PI2E 4RG1A 1MHWC 4C2MH 2KCNA 3LX0A 1K0SA 3RV4A 2BA0A 2J0TD 3TMEA 1II3A 1YIJA 1DXMA 2L5TA 5KFEA 5ELFA 2EY2A 4IPCA 1SNMA 2A1AA 4FYDA 1HXYD 2O5JC 1H9JA 4X3UA 3HOZG 1MKHA 1I6HB 1OXVA 1JWMD 2IT1A 1M90C 3GLKA 5KFQA 1HA5A 3S1RB 1ILPA 2VB2X 1SEBD 2NN6H 2X6LA 2NVQH 3TREA 4DGZA 3PW5A 3HOZB 5E3FA 5KFTA 1H9SA 4O3PA 2B39A 2I5MX 5DGBA 3FP9A 1FR3A 2Z6KA 1G2TA 1JOQA 4G57A 2DUDA 2K5DA 5CR3A 4PMBA 5LMNQ 3GTMB 1S0NA 4DL5A 4JI7H 4X62H 3HOXG 4KHPH 4DV3Q 4LF7Q 3JAMi 2K14A 2CQYA 3N43B 1GXDC 3VYRA 3KBXA 3HOXB 4DV0L 5M5XB 1V1PA 4GC6A 2NYZD 3R93A 3TIGA 3NUCA 4C56C 1GUTA 2F3IA 1XPUA 4QWEA 3RB0A 1AZQA 5JJIA 3G6JB 4GC7A 4NLGA 3SR1A 3KK7A 4F88A 1IXRA 2ASJA 1SFOB 4RB3C 2JEJA 2J4XA 1RTOA 3PO3H 3SK8A 4IOAA 3VPCA 1N34H 2BE5C 4XXEA 2YTYA 1XYIA 1C3OA 2IX1A 3ULJA 1CKMA 1SCUB 3D4RA 2VZAA 3K7AB 1BDOA 1N36L 3LWBA 4R4QA 4GKKQ 3P20A 2OEOA 3K5LA 1E0BA 1ZXTA 2AWOA 3BG3A 3SVMA 4FF1A 2EYMA 2KJXA 2ZJTA 4BS9A 1VQPA 5A2QL 3HKSA 4IAJA 2R82A 2N3SA 3BA8A 4DAYA 1JWSD 1BJTA 2W6NA 1FKAH 5IGEA 1V9PA 3HOVG 1K1QA 3ETHA 2NVTH 1HFGA 2CQAA 4R8NA 1YVCA 2A69C 4J6HA 1JXLA 1VQAA 2HJWA 1B2TA 2W71A 2X0SA 1CUKA 2HIVA 2L0CA 5ELCA 3HOVB 4BY1G 2QEXA 3S15B 1CQFA 1CKNB 4B3TL 4ECSA 2UXDH 4HR7A 2SDFA 2RCFA 1KQSA 2RKSA 1DOKA 2PNRC 1AFPA 4BY1B 4FBTA 2PQAB 1V51A 1L2ZA 1QUQB 2DY7A 2F0PA 2AQ1B 1UNNC 2R8JA 3CU7A 2R87A 3I90A 3U4ZA 2BR0A 4C1NK 1BXTA 3PR4A 4DV0Q 1RIPA 4TV8F 2JE6I 3M9MB 1EEFD 3D8GA 4CJ0B 1PTOC 1W3SA 3LWEA 1IBKL 5K5PA 2ATWA 2ZT9C 2YZGA 5EAYA 4PV1C 4C3IH 2JA5A 1ZQ7A 4PMWA 3CC7A 3TEHB 4KK7A 2RA4A 1EIYB 3PO2H 1E4GT 1YHAA 2CW8A 4C3HG 2R92H 2CVRA 2FXQA 1QCBD 2C2RA 4A3MB 3FEWX 1TS5A 5I9OA 5KFWA 1SR3A 4YWMA 3GIMA 1LT3D 4C3HB 2VQFL 4A93G 1U4MA 4OXPA 4XQNA 4B3RH 5IYCH 3HG9A 1OTCA 2D62A 3PMFA 5FK9C 2F0IA 2L9HA 2WTFA 2W9AA 1SROA 3L0OA 2E5LH 1N36Q 4ILWA 4JV5L 5KKNB 1TIID 2K32A 3R23A 2FE3A 3QOLA 4POFA 1TR5A 3MR6A 4XYMB 5KFFA 2OLSA 1ESRA 3X3MA 2KCCA 3GIPA 5GADC 2B2YA 5JVH3 4GNXA 1UWVA 3KLWA 3V2TA 3GTMA 1NR2A 4L8JA 3L4KA 5JJLA 5DAUA 2I46A 5CBEE 4M9UA 2KECA 2KOLA 1IBLL 5EWGA 2SNMA 3GV8B 1CQIB 2CH4A 1W6KA 5LOVF 1S3OA 4JI1H 4KKSA 2A6EC 3L4JA 4A3EG 2IY5B 2E2HB 3VA7A 5DEHA 5KYLA 3NK9A 2B8GA 3T5JA 4GLVB 4B3TQ 1AH9A 4A3EB 3IN5A 5JPNC 4DL4A 2L15A 4UHVA 5C4XH 2VY3A 3BG5A 2RDGA 1E2VA 3TINA 2NZOA 3Q8DA 1A63A 3PUZA 2R6GA 3R5XA 3GTGH 2Q2IA 3HEJA 2JSOA 3EN2A 1LUZA 4TUYF 4ALPA 1XMOH 2R92A 4H02A 1IBKQ 5IWAH 4YAKB 3J7AK 2C2DA 3A74A 1HFNA 4ED7A 1HNXH 1KRSA 5BN5A 2R93B 1SE8A 2PO4A 1UE6A 3CHBD 3E0EA 3TN2A 1VQDA 1T94A 2W9CB 1BKBA 1WYDA 1D1IA 1EY0A 5KT2A 3FKIH 2LMCB 5DGAA 3J7AF 1X56A 4A93H 3F8NA 1STEA 2KUMA 3FVQA 3I3CA 1XTCD 2VQFQ 3CCRA 2NN6I 4DR4L 3EPIA 2RDHA 2F1MA 4JI4L 2IW3A 2ALYB 4XYQA 2M9VA 3D4WA 2R85A 4A3KG 1ZHSA 2W7PA 2NWGA 2E2IB 4POGA 4EQOA 3S1MH 1HR0H 3FMCA 3S17H 4JV5Q 4JI3H 5J2TF 2VUMB 2KA7A 4A3KB 2PVPA 5IY0A 5L1KA 1D5MC 1F9SA 1CKNA 5EKKA 3J80c 4PZ7A 3G7LA 1J9OA 4X64L 1XPOA 4K0KH 2BE5D 3QB3A 3WOFA 2PQAA 2G9HD 1QUQA 2D5DA 1I3QB 1MSHA 1IBML 1IBLQ 4J9LA 2WKCA 5M5WB 3WO0A 3UDIA 3NEMA 2W57A 3DF7A 5FOBB 2EYHA 5LMNW 1CHQD 2NVXH 3KHLA 1QVGA 3GIDA 4ID6A 4I7ZC 3GTGA 1J8IA 3S2DB 5DG9A 5I2YA 2H5XA 2XCLA 2N55A 4F50A 1E2ZA 2RHSB 1A0IA 4KV6A 3GTKB 3CCSA 1Z2PX 2A69D 2DN8A 3CRKC 4A3IG 1MIUA 1QE6A 1PRTC 4LFCL 3HOUB 2O4XA 3ICEA 3VR2A 4DV4H 1SSOA 5E1FA 4JC0A 2MHVA 4IPHA 4JOIC 1HZ9A 1X3FA 5HGQA 2XIGA 5DNFA 4NXNL 1I50B 5L9XA 4KKUA 1X3PA 1EIGA 4IRCA 2ZTCA 2EY1A 3S9WA 1SYXB 4R7RA 4QWDA 4PZ6A 1LTTD 4DR1L 4DR4Q 2NTTA 1W2BA 4JPBW 2R7KA 2KQ3A 2R8HA 4DUYH 3OTOL 5EBCA 4JI4Q 1EY6A 3PUYA 3ND9A 1M4VA 2KENA 2F3WA 2VPSA 3RIZA 3M4OB 3BVMA 3SI8A 2YRXA 3BAAA 1ENFA 4DXFA 3RN5A 2H1EA 5FLXE 4ED6A 1K1SA 2RGVA 1L1OA 1I3QH 1B7YB 1U4PA 2D0OA 4OEMB 1YHQA 3JAML 4CHTB 2EY5A 1R4PB 2Z1CA 4X64Q 1Z7TA 5M5WH 5LP6F 1HH2P 3MA2B 4IFDJ 1N32L 4N9TA 2E2JH 2NVXA 4HIMA 3M9NB 5CA1F 4RAZA 1S03G 3VYTA 4ED3A 4ED8A 1OXXK 1MJEA 3RBDA 1A15A 2F0LA 5M3MG 4TRDA 1IBMQ 1O75A 4LMYA 1NJIC 3NE5B 5JVG3 1C4QA 4P75A 5M3MB 4YJ2F 1EL0A 2UXBH 1ICWA 4Q44A 1JT8A 4K5XA 1Y8PB 3SK5A 4IWXA 1ET9A 4XQJA 1EY5A 1PZID 1K8AC 2DGYA 4QB4A 3I4NH 4MA5A 3KHGA 5A35A 1D6EC 3I4OA 1K8MA 1B44D 3RF2A 3VA5A 1VQ5A 4APVA 5LL6S 2F0UA 2W9CA 3D31A 1N56A 4F4WA 4A3IH 2A6ED 4IFDH 3Q8QB 2VQEH 4L63B 4LFCQ 4JI5H 4DK0A 1XTDA 3QZ7A 1HA6A 2TSSA 4F7XA 2N8NA 2ID0A 2HVQA 1TT2A 3N8DA 3HOWG 2E2IA 4NXML 3GTJB 3TZUA 1AN7A 1CKOA 4NXNQ 3JAMc 5C44H 1U4LA 2IL8A 2QA4A 4RUCA 2NU6B 2EE1A 3HXLA 3JRWA 4RZRA 1KNAA 1PH4A 3BVGA 4IO9A 3HOWB 1XMQQ 1CFMA 4IZOA 4UCOA 3PV0A 4QWCA 4JV2A 1EFID 2JQOA 3PR5B 3ULLA 1I3QA 3Q0AA 4UFZA 4DR1Q 1R4QB 1O7YA 1PLFA 5DG7A 1K83H 2GA4B 2AUKA 3OTOQ 1TS2A 3DWAA 2IPKD 4DR7H 4X65L 4QQBX 1F9QA 3PUXA 4J9PA 1PXUA 4BWGB 3BYYB 1SYDA 1N8RC 5I4DA 5KT4A 2HCIA 1FNUA 1TWAH 1TWFH 3KOJA 3Q8RB 4H44C 4HEDA 1N32Q 2ES2A 1LTLA 4MV8A 1AE3A 1KDBA 3BABA 1BCPF 3GTKA 3CPWA 3J81i 1WTVA 2UUAH 1SXTA 3KF8B 1SNCA 5F2DA 5FLMG 1N33L 4MHEA 2X6GA 1VQEA 3J81W 2JEGA 3UDFA 5IT9W 4FS2A 1EZ8A 1KHIA 4YY3H 1EWIA 1EIHA 1JDBB 4DR6H 2AUJD 4X3SA 1TXYA 3TQ1A 4LF5H 1EYDA 4CKCA 1V1QA 1B04A 2F0JA 2JEAI 5KYIA 3MR5A 1XPRA 4QJFA 4BBRH 1LT4D 4DF7A 5KRUA 2AGPA 1FJGQ 5C4HA 2B2WC 2QCPX 3FPPA 4MV4A 2JA7H 2Z8LA 4R9WA 2NVYH 1HJPA 3GTJH 4DV1H 4FS1A 5KFYA 4K8JA 2KHIA 3I72A 5EPLA 3U9SA 4TQRA 3HOWH 4OELB 1IZ6A 1HZAA 4NXMQ 4KTAA 2F4VL 2VPQA 2EPBA 3AFQA 3UI2A 5KFDA 4RGNA 2NUAB 3MXUA 4TVAB 2FLLA 3GTOB 1AW7A 3CAMA 1I94Q 2OTLA 1PRTD 1S5ED 3DHQA 5IGGA 2VB3X 1UNSA 2PYKA 4IUTA 2CCZA 4YR2A 3HGBA 4CKEA 1VMPA 3TS0A 2HDLA 5CMDA 4X65Q 3VPBA 2K5QA 2F0NA 1ZHQA 2P0AA 4EFBA 3VPDA 4JBMA 4DV5L 2W6ZA 1UE7A 4RZQA 1WCMH 3ER0A 3T5HA 1GHKA 2XCAA 4O42A 1SEIA 2RCNA 2C2EA 4F4XA 3MAQA 2QDBA 4WORA 3A8JE 4QW8A 5C0XG 3G48A 4A4IA 1GUWA 3NXWA 5FO8B 1LTAD 3DWQA 1KDAA 4Y52H 1I7NA 1DYQA 1N33Q 3RLOA 3CKIB 4LF6L 4BBSH 3RTXA 4O4LF 2R61A 5E7NA 2E2DC 3J80W 3M3YB 3PIOA 5M3FH 4HN7A 2ZDHA 4JI8H 1L1OC 3V4SA 2JA7A 4B9XA 3I4MG 4RGTA 3H4DA 4FXDA 3GTJA 1AEXA 4FXKC 2F0GA 1DD2A 1VBHA 2XNAC 1X9NA 3FHWA 1B33N 3I4MB 1VQHA 3A56A 3AYHB 4IURA 1G91A 4P74A 4PG3A 4OO1G 3S24A 3T1YH 2LXJA 2WV6D 3PW4A 1TWCB 3A0JA 4R4OA 1Q82C 2UU9H 4DNIA 2QILA 3T5KA 1JOKA 2XN9C 3D0FA 3ETJA 3E3XA 1B4OA 1CZGA 1GYFA 4ECTA 3V05A 4FO2A 2ZM6H 4ECZA 4L5RC 3DWPA 5LMUH 2F4VQ 1GD7A 3RZDH 1J5EL 3S1QB 5C1OA 5CB4F 3BQ1A 5EKIA 1LYLA 4RH6A 4EGQA 4KJNA 2EZVA 3OIPA 1ESFA 2NTSA 1PH9A 3ORQA 1I4QA 3BJUA 4A3LH 1TA8A 4LF7L 1C7YA 4OHJA 1XNRH 1KABA 3EROA 2UVVA 4LWCA 1WH2A 1C9OA 1LTRD 2F3VA 3BU2A 4HTHA 1Q3LA 1ULZA 3I73A 5LXTF 2UXCH 1RJRA 1RCVD 2PMZB 4GKJL 4RAUC 4DR2H 2J9GA 4DV5Q 1SE2A 2RBMA 2RQXA 4HIDA 3RB4A 2DNCA 4C5BA 2ASDA 5IGFA 2KCTA 1PH7A 4A3CG 1UC8A 2JA8G 2K03A 3KLSX 2AQ2B 5L1JA 4IFDI 4EBEA 2N78A 4RGMA 2Q2TA 2ZJQA 2PQEA 4B3SL 2JA8B 1B50A 4R8UA 5IODA 4AQYH 2JYOA 1PDQA 1BBUA 1DGSA 1L2FA 4P72A 5JEAJ 4YHHH 1LO5D 4QIWB 1IYUA 2PNHA 2V59A 4LF6Q 2FLPA 4RFBA 5IYDG 3MFGA 1CTMA 2E74C 4DXGA 4QUCA 1VQ8A 3J7A5 3OOCA 4KLKA 4Q8FA 3GQCA 2HHHH 2ICEC 4OX9L 4I50F 1ET6A 1TWCH 3KAKA 4EGVA 3HBLA 3G4SA 4Q0FA 1RHPA 2LY7A 2B63H 1F77A 1TQOA 4BA2I 4JI0H 3GTOA 1WTWA 4Q0YA 3CD6A 2IMWP 1E1OA 2BH8A 1Q8KA 3RZOB 3PW2A 4O2BF 1JB3A 5GAGC 1MGSA 3AU7A 4EYIB 4E4TA 2SEBD 4G7ZC 2NU9B 4J9OA 1RYSA 1R9TB 5KG5A 3NTHA 1ZYRC 5JEAH 3J81j 1N34L 1E4FT 1VQBA 1BOSA 3IG0A 5KFJA 4DU9A 4QCLA 5LMNH 5EPKA 5EKLA 1CA5A 2JP1A 3CCVA 4DV3H 4HJ8A 2WB1A 1J5EQ 3CCUA 2XRQD 1TKWB 3TQTA 3K58A 1IKMA 5KT7A 4A3JH 4KD4A 1AUXA 4EFEA 3OWFA 4MTKA 3FRPB 1HCZA 3K5IA 4A3DB 4I55F 3H0GB 5JQWA 1GOZA 4UY8C 2AWNA 4WJ4A 3JAMW 1CK1A 4ZOLF 3CXCA 1JIHA 4JV1A 3DM1A 3HOYG 4GKJQ 4ECYA 3I91A 4WJ3M 1G6ZA 4MN3A 3UDGA 1I7LA 1I4XA 1WSCA 2FK1A 1GM5A 3HOYB 1HTPA 4UPAA 3SDZA 2EXDA 3PW0A 2YW2A 3MXNB 4K8IA 5C5JA 1QOHA 4ME3A 2OWOA 1CSPA 2FMAA 4DV2L 1SYCA 5IYBH 2JA5H 4B3SQ 3AFPA 4EQNA 1K9MC 1TWCA 3PIPA 1WD1A 1KEEA 4GKKH 3KLSA 4PZ8A 3A7AB 3TBIB 4UP7A 1S5CD 2B63A 2ZJPA 1SYGA 2AKWB 1AUVA 4GOPC 3S14B 2XVSA 3OW7A 2DZDA 1VQMA 4BXXH 2BDNA 4OX9Q 2KSWA 2WB1E 4KN4C 1YNXA 1EEID 1SYFA 5EDWA 2JA9A 3RUZA 4ZQ3A 1Z6HA 1B1ZA 4ZUIA 1I6HH 2PCFB 3S1RH 3C46A 3H6MA 3EPGA 2FFKB 5KFHA 4LF4L 3L9AX 1L0XB 3HOZH 1LTBD 4OL7A 3F2CA 2JEFA 3C2PA 4G3IA 4TKOB 4X66L 5BMVF 3PVXA 5EPJA 2G5DA 1N34Q 1ICFB 3M4QA 2HT1A 2K52A 4B3RL 3GTMH 3A7LA 3JSNA 5IGDA 2PMZA 2BOSA 4K6DA 5FPRA 3N6XA 2PPBC 2ENBA 4AIMA 1AN8A 3J7YW 1X65A 3AQQA 4JVZA 1KTKA 2CWPA 4HCSA 3J81L 4WBNF 2CKZB 4X6AH 5IT9L 1LACA 2BCOA 3HOXH 1VQ4A 5M5XH 4DV0H 2MO1A 1JE5A 4HIOA 5T1IA 5E4WC 3V96A 4EBDA 5L1IA 4ECQA 2B29A 5HY6A 4WRDA 4X3TA 1JORA 3N44B 2CQOA 4B08A 1Q12A 1SNDA 3S16B 3KLRA 3T51B 4HQ6A 1UEBA 3SK4A 3NENA 2UUCL 1U9RA 1SFOH 1JJGA 2YZMA 3W2DA 5FPOA 4DN4M 2AMCB 2R7MA 4CDDC 4A3MG 3G6XA 3GQBA 1JJCB 1KBLA 2O2LD 4LFAL 2VUGA 2B2VC 4YB8B 4R8IA 1BCPC 2K4KA 5T1GA 1GLVA 2NZ1D 3OSNA 4DV2Q 3K7AH 2YS6A 1EU3A 2Q2HA 3A5ZB 3NELA 2BQRA 1ASYA 4C3JG 3Q8PB 3T4AC 5J22A 1HZCA 2JEBI 2Y0SG 3F8TA 3MHBA 1R9TA 2RGRA 1F2ZA 1JE4A 1X32A 2PMZE 3MXPA 4LAAA 3PF5A 1I6UA 4C3JB 5C6AA 1VQNA 4XT1B 2Y0SB 2IHFA 3J81c 2OT2A 2CW7A 5M9OA 1PK8A 2V58A 5IT9c 1QJOA 4KHZA 1SLJA 4DFAA 2XGPA 4R4IA 2K50A 5IE8A 1DZ1A 1KJJA 1DJRD 4OIKA 4HMIA 2D9UA 4IALA 5KT5A 4Q8EA 1LABA 2FJZA 1RK6A 3OMGA 4LF4Q 1GJXA 2YZNA 5J2UF 1G51A 1NNXA 3HOVH 3GTLB 3S15H 4BY7G 4X66Q 4QIWE 3KUPA 4OWXB 4UCTA 4L6TB 4DPGA 2FINB 4B3TH 3K0YA 4RCNA 3I7FA 5JJKA 2N49A 3N6RA 4B3RQ 1CSQA 2ZTEA 5T14A 3NBIA 4BY1H 4BY7B 1NUCA 1O7ZA 1LT5D 4ZLTF 1K28A 4A2AA 3V6KA 4ZCKA 4DA2A 5C3EG 3X3NA 1Y1VG 2A74C 3J80L 5KFSA 2XCPA 3MXNA 1F2MA 1SRUA 5FO7B 4HJ9A 1YITA 2W6QA 1SFOA 4FBUA 4P73A 5C3EB 1ZYRD 3O13A 1KLUD 3CQZB 1S68A 1Y1VB 3I70A 3GV3A 3CCJA 4A3FB 3NTIA 1EQTA 3ERQA 2R93G 1FGUA 2IBKA 5GONF 1I5FA 4XYLB 2OF1A 4L1KA 1PVOA 1UEAB 2UUCQ 4E6IA 3GTPB 1EYCA 5FJ8G 4A3MH 5KFLA 4M1UB 2Z6KC 3KF6B 4C3HH 2VQFH 3RAQA 4FF3A 4LFAQ 3EYYA 3M4YA 1TU2B 4JBJA 3TZDA 4LF9L 4UCRA 1XWEA 1STHA 3M9BA 4FXGC 5F9NA 5EOYA 1C48A 4HJ5A 3EFXD 4C3JH 1EQRA 2JA6G 2W6PA 3J7ZC 3K5OA 1X3QA 4JV5H 1TVXA 5HBRB 1RTNA 2XWJB 4OIJA 2VUMG 1K73C 3HRZC 3GD7A 5EJWA 1ONLA 2JA6B 2YS7A 4MV3A 1DV2A 3GV5B 1G291 2QDLA 3U58A 5CA0F 1BF4A 2AQ4A 1BGWA 5D1PA 4DV7L 1NY4A 4DUZH 1EY4A 1K3BC 1IBLH 5J3BA 5ELBA 4DAMA 2PZTA 4MV1A 2SOBA 4HNUA 4QL5A 1SNPA 1IKLA 4DK6C 2E2HH 1CHPD 4BY7H 1WI5A 2R7ZG 2SCUB 4EG0A 4A76A 1FYCA 1GHJA 4MV7A 2F0HA 1RD9D 2A6HC 2QEJC 3E0JA 5HGTA 2IX0A 3K5NA 1VKZA 1EY7A 4A3EH 4CC5A 1ML0D 1UC9A 2R7ZB 3EVQA 3HFZB 3QWNA 4K14A 5GAHC 4EEQA 1V4YA 3T16A 2WKDA 4DNTB 2WP8J 3G8CA 5EWEA 3Q1KA 1HNWL 1WFQA 1SN8A 3OWEB 4J8QA 1Y1VH 2E8GA 2C35B 2C00A 4KN7C 4RMFA 3OIQA 5I2XA 4PNYA 5A2QE 3HOUG 3PZPA 2FB9A 5KFXA 3Q24A 1LT6D 1JKJB 2H4OA 1WTQA 4O2AF 4GN3B 2RDIA 2DLNA 2ASBA 1YHBA 4O2DA 2R93H 3G6VA 4CKBA 4DR5H 2L11A 4EQ5A 4KI0A 1BNZA 4XTCS 5DQGA 1EYAA 4ZRZA 1LV9A 1WTRA 3OPOA 4DNRB 4C5AA 3OUUA 2VW9A 4CC6A 3BDOA 2V4DA 5EGTA 1KC7A 4F4ZA 2K04A 2Y0SA 2L55A 1FNVA 4JI6H 3J81E 4RB2C 4DR4H 3T1HH 1XMQL 4RHRA 5IT9E 1HNZL 4LFBL 3PUWA 4LF9Q 3IFTA 5KFMA 4JI4H 5FD6A 1OO9B 3SGIA 5I9PA 1TAEA 3HB9A 4ECVA 5C5LA 2E2IH 2B2TA 3GTQB 1HHVA 4RNNA 5JJZA 2ZJRA 5KIXA 3GTLA 3BQ0A 2IWHA 3HS0C 4A3KH 2VUMH 4L5TA 5KG2A 4IJLA 3KYHC 1VQ9A 4X64H 1B3QA 2MGSA 5KNBA 3IKJA 3IRBA 3A5UA 4J9MA 2CFMA 2E2HA 2LXKA 3J7AV 1KRTA 1BCPD 5KFKA 1A3VA 4DV7Q 1IBMH 4O3OA 2UVRA 2GPSA 3M9OB 1VCIA 1JQYD 4BWSC 5KG7A 1EYGA 2D2CC 5EZYF 3KBGA 3WOEA 5D3IB 4A3BB 3H91A 1BVSA 1PH2A 1KJQA 1EIFA 1STGA 3TRZA 3KXYT 4ECXA 1Y1VA 3E9IA 4B3ML 4LF8H 3S2DH 4IUQA 5E4XA 4NB3A 1NR4A 2W9BB 2L1BA 1T36A 4JI2L 1C0AA 3CCEA 4KY7A 1RJTA 1W6JA 1TY2A 3GTPA 3GTKH 2Y0SE 4U6PA 4QW9A 2R93A 4UP9A 1HNWQ 3D3RA 1X54A 2KEEA 5I47A 1SYBA 2F0SA 3QO2A 3KF6A 3HOUH 2B2YC 4GNXC 4C5CA 3K5HA 4LFCH 4O3SA 3BDLA 2F0FA 1FJGL 2VA2A 3RFCA 2KHJA 1NBWA 1B9MA 4LNQA 4QY7A 2FLNA 4DL6A 4NXNH 4LSAA 1A62A 1I50H 3MWYW 1BQQT 3QR8A 2WYOA 5KFVA 3VR6A 2Z0SA 4LK1C 3E5NA 2A5HA 2CH4W 4Y8VB 1NTGA 2J6UA 4WJWA 4CDEC 4CDCC 1YJNA 4RHSA 2I8CA 2VUMA 4HNTA 4DR6L 3CVZA 3TP8A 4V190 3NP8A 1I94L 1VQGA 1HNZQ 4LFBQ 3RB6A 3OTOH 1GUNA 3J80E 2YU9B 4A2BA 3N40P 2DJFC 2PZWA 2Q2UA 3M4OH 5LYJF 2DWCA 2K01A 4Q5VA 3ONAB 2UVWA 1A2UA 1RL2A 1WVLA 3BVZA 3RJ0A 1FNWA 4JBWA 4ETSA 4AYBG 4RGOS 3BZCA 2Q8IB 3A55A 2VQEQ 1CQJB 4QWBA 3GV7B 3DMUA 2Z6BA 4F4YA 2FMCA 2RSNA 1N32H 2R7ZA 2K5HA 4PDBA 4AYBB 1H9RA 1WJJA 4K5VA 4X3KA 1EWHA 3CMEA 3FDSA 1Y1WG 4ME6A 4EVOA 5KT6A 1ASZA 2M05A 5M3MH 1S97A 2LKVA 3F2BA 3I12A 2XGQA 4FM9A 2RVLA 3RMHA 1HUMA 3W3AA 1Y1WB 3I8ZA 5CGKA 2XSCA 1PTOB 4B3MQ 5DLQE 3KJOA 2CWAA 5COYA 2YYZA 3CMAA 3OMCA 5IP7G 3ERSX 3KDFB 2OXPA 1GO3E 1T9HA 4JI2Q 4ABNA 3UFXB 3S1NB 4F8MA 1I50A 4IOCA 2K05A 3R8BA 2F0OA 2K33A 2WDTA 5KFZA 2I5LX 2R7NA 2A6HD 4ED1A 3VYSA 4WFN3 1SMXA 4ZKBB 1EUJA 3GTQA 3R5FA 1CM9A 1EU4A 4NXMH 2RDFA 3CF5A 3KALA 3QIAA 1D1KA 5JAVA 2R86A 3PN1A 3NWTA 2RDJA 3WNZA 1XNQL 1S0MA 4J9KA 1TWGB 4YCWA 4DV6L 3Q23A 3E6ZX 4IRDA 4O1NA 3S2HB 3MEFA 2D0PA 2F03A 1Q90A 4DR6Q 1TS4A 1EY9A 1QNUA 1VQ7A 3U9OA 2VL6A 3KTMA 1E3PA 4K6LA 1JCKB 4P2CB 5H80A 4EGJA 3M7GA 3H09A 3I2ZA 4I7HA 3T1YL 1BR9A 3I56A 1MSGA 2HIXA 1WR2A 1EFWA 1UE5A 4GZYC 3LNNA 4F87A 2AGQA 4JYAH 1JJ2A 4DV1Q 3GP7A 3LGJA 4MV6A 1VQJA 2W9BA 1BBXC 1U4RA 3PW7A 4K2KA 4RB0A 1EY8A 1AP0A 1RYRA 1PFBA 4IWYA 3GIKA 3EIVA 2GVAA 3A8IE 4Y7NB 1HTLD 5LMUL 1PTOH 1N33H 1LTID 1VQFA 3CRLC 1XX8A 1EQVA 4S3SA 2J6TA 2V4QA 4XQQA 1T5EA 2JXMB 5FLMH 2PBZA 2F0EA 4DR3H 4B9WA 2QGQA 1HR0W 4J9NA 3DLLA 1H9SB 4QMGA 2BQUA 4GN5A 3K81C 3PGZA 2UUBL 5BR8L 4IUNA 1JB7A 1SMYC 4ECRA 1LLRD 3KHHA 1KJIA 2EYPA 3JAME 3CC4A 5IP9G 1DIKA 2HQLA 3BDCA 2E75C 5CC4A 4OWWB 4LH6A 1GSAA 1WOCA 4A3GB 1VQIA 1AE2A 1STYA 2OH2A 1B70B 2ZDQA 4HYKA 1KD1C 4MTDA 3M85A 4MA0A 3WWVA 3H94A 4J1MA 4IUVA 3GTOH 5CORA 3G6EA 1XNQQ 5IYZF 5KFCA 4DV6Q 4MV9A 1E2WA 2TMPA 4AYBA 1QB5D 2CHBD 1QILA 3DUZA 4EEYA 3H4BA 4LJZC 3IFDA 5M5YB 4C2MB 1CE8A 1MJCA 2HCCA 4IRKA 4IR1A 4JI0L 2F0DA 5GAEC 1SJED 2EDGA 4IPDA 4ZKCB 5KFUA 1Y1WA 4DV5H 3T1YQ 2EIFA 1NMGA 1SE3A 3KF8A 2VXWA 1B8AA 4XDXA 1QZGA 2NN6G 4IN3A 4YR3A 4FDBA 2XTIA 5C1PA 2VOBA 1M6VA 5ELEA 3Q8SB 3TS2A 3M7NA 4HJ7A 4I4TF 5G3LD 3KDFA 2KEDA 1NAPA 2NVQB 1CI3M 5KG6A 4I7AA 1JR0D 5IGCA 1PHJA 1J6QA 1NSNS 1QG7A 4DAYB 5LMUQ 2FPGB 5C0XH 3RBEA 3W5OA 4LF6H 4GLAC 2AU0A 3M3YH 1PRTB 1G2SA 1V43A 4UAIA 1SDFA 3SE0A 3K59A 4JI7L 4RKLA 2DPIA 4X62L 4DR5Q 5HURA 4KHPL 1GGOA 1FL0A 1CZWA 3AMUA 5FKAC 5KGUA 1LTSD 1O7LA 3MVVA 2L12A 2EOTA 2HVRA 1K8OA 5CV9A 4U673 3I4MH 5FD5A 1SYEA 2BDOA 4P71A 2UUBQ 5BR8Q 2UXCQ 4AYBE 1TWGA 3MTSA 3H20A 2J6SA 1KNEA 1ENAA 3EA6A 1S4ZA 3K80C 1G8ZD 1IW7C 1YBYA 4NPSA 4OO1H 3MWMA 1RKNA 1T5XD 3DXJC 1RK5A 3PO3G 5JUMA 1GUSA 1SAPA 2K5NA 1B3AA 2QW7A 2YV5A 2R3ZA 1YNJC 4H13C 2WINB 1IL2A 4QGUA 3T5LA 3PO3B 2F0QA 1JLLB 3S1QH 1XDNA 2K1BA 3SK6A 4MTEA 4IR9A 2MPMA 4ZYSA 1S5FD 1MZBA 1H95A 5D65A 1ENCA 4LF7H 1UUPA 5I6YA 2HHHQ 4A3DG 3H0GG 5KG1A 2XRSD 4NW2A 1KIXA 2BQ3A 4YBZB 3B6YA 4LW1A 3R2IA 1STAA 2PW7A 2F0WA 2L4NA 3I4LA 4XT3B 4JI0Q 4YWKA 1KXLA 2C22A 4GKJH 2CZGA 1E24A 1I4GA 1I4HA 3URYA 3AEVA 2ZDGA 4O3RA 2RF4A 4O3QA 4UDUC 5KG4A 2ICIA 2NVTB 3M4PA 4RAYA 1D8LA 3SXHA 4A3CH 2JA8H 4B3SH 4GNXB 3RUPA 2VA3A 3R2TA 2AGOA 4HAEA 2KBNA 2K5WA 2NBFA 4G4KA 2UXDL 1H9MA 2MJ8A 2M00A 5D1OB 5G3LF 1YI2A 2HD3A 3RGXA 4JI7Q 2YTXA 4RNOA 5ELDA 1JX4A 4X62Q 3MFIA 1A8VA 4KHPQ 1HPCA 4EX5A 5IYDH 4OX9H 4CDFC 3RLFA 1V1OA 1EOVA 1EHIA 2MCTA 3IL8A 3U9TA 2DJGC 2UVUA 4C3IG 1CA6A 3TSSA 5C3WA 2NZHA 4IUUA 5JOBA 1PFMA 2MO0A 3V6JA 3CCMA 3PO2G 2EYJA 1OXTA 1OXUA 3RZOH 4C3IB 3V6HA 4FU0A 3WDNA 2R92G 2A73B 1GSHA 3PO2B 1R9TH 3EQLC 5KFPA 4C2MA 3KHRA 1JC7A 2FPIB 1K8GA 2R6FA 3QJYA 2R92B 5C8YF 2WACA 4YQWA 5IYCG 5TSSA 5CYUA 3FPUB 3K3VA 1W93A 1SMYD 4N8X1 3F2DA 2I87A 1WTHA 1VS0A 3K0XA 2W8LA 4R1JA 5JVLA 3R3OA 2N88A 2IP4A 1IOWA 2E5LL 1DONA 4A3DH 2FP4B 1OXSC 3H0GH 4ME5A 3IAYA 4LSXA 3NQTA 3K7UC 4JCVE 2K6AA 1T3NA 1VQKA 1V8QA 3UQ8A 2R7FA 4OONA 1PH6A 1PZKD 3I55A 1PMRA 1Q7YC 3U4VA 2FPPB 4J9QA 1VDZA 4HNVA 1IOVA 4ZAIA 2OQ0A 4UCVA 4RU9A 4QIWA 4JBKA 3HOYH 4JOIA 1C8CA 1Z47A 3KFUA 1L0WA 4JI1L 4DV2H 1PYSB 3OHXC 4NDXA 3JRXA 2FJ2A 1IYVA 1LM0A 3NTKA 5C4XG 4GS3A 4I65A 2UXDQ 4RCOA 3VR5A 1F2LA 3H40A 1A2TA 3S14H 1HRJA 1N36H 5C4XB 2RHQB 4O4HF 2RSOA 2DPJA 2J7ZA 5ELOA 5FLXL 4DK3C 4J9RA 3GTGB 5ISRA 1FGBD 3N42B 4Z9CB 1E22A 1XMOL 3JSLA 2P5ZX 5KFAA 5IWAL 2PN1A 4LF4H 3MZ5A 1HNXL 2HGSA 3FKIG 4X66H 3MXGA 2R8GA 5C4JB 2LSSA 2W8KA 4RWSC 4HCEA 2B2UA 4IZ8A 2LFNA 3FKIB 4FF2A 3C1EA 3F2UA 3H0GA 4A93B 4IJHA 3RR5A 2V1CC 3TIIA 3ULPA 4Q43A 1Q86C 1B6RA 4BA1I 2F0MA 2K28A 4DK1A 1QZHA 4KJOA 2R7LA 2WAQG 1M7JA 1IW7D 1VMCA 5C3XA 1QVFA 5C0XI 1S0OA 2E5LQ 3PSIA 1HR0L 3S1MB 1VQCA 4JI3L 4FF4A 3S17B 2DY8A 2WAQB 1O80A 1Y8NB 1YNJD 4A3FG 1PH8A 3ND8A 4DUZL 1D7QA 3S16H 4K0KL 2NU8B 3DEPA 5D1OA 3D6CA 3PF4A 1IBKH 4KD3A 3D4DA 3HKZG 2UUCH 4RNMA 1KAAA 5DQIA 4HSVA 4TQUS 5FLXc 5CBAE 1SNQA 1Y69U 3MC0B 2O5IC 2CW0C 2IA6A 3L2PA 1L1OB 2XD4A 3HKZB 4HMJA 4EBCA 3VR4A 1X3GA 2E76C 4ZK9B 4LFAH 1BO0A 3G6YA 4JI1Q 2YRWA 4O0AA 2NVXB 1VQLA 3PCOB 4OO1I 4ED2A 4XZ3B 5L1LA 5EWFA 3ZJYC 3OW2A 5J1ZA 2EXZA 5D3DA 3OSPA 1IL8A 2Z4HA 3MJFA 1RJQA 2Z9HA 3W1GA 3GV6A 5KG3A 2HDMA 2W70A 5CV5A 2NB0A 4N9PA 1QNKA 4ODGA 2B3GA 2BA1A 1H9KA 5JPMC 3FDTA 1VQOA 5AFWA 3CC2A 1GVPA 2DNEA 3PUVA 4J15A 5FO9B 2EYOA 3OHBA 1HQRD 1KDCA 4DV4L 1XMOQ 5C4JH 5IWAQ 1QWYA 2A68C 2GVBA 4MTNA 3NPPA 1HNXQ 1KL9A 4MIUA 1M1KC 5HV6A 1F2YA 3GTLH 4M7EA 2GLTA 4NP5A 3D6WA 1S5BD 3ORRA 4JI6L 4QUFA 4LUZA 3T1HL 4DAPA 1BBWA 5K2MA 2F0TA 4J0MA 2ZXRA 4H7BA 5KEEA 1PZJD 1WTXA 2ZTDA 5DQHA 5EQ0A 4PMCA 4MNOA 1B6SA 3RN2A 4LH7A 4DUYL 2ALZA 2WFWA 2JJQA 2VS1A 5CV7A 1UAPA 1BUVT 3RB3A 5C3EH 3CQZH 1FVIA 5LL6X 1HR0Q 2A8VA 4JI3Q 3C0FB 5NUCA 4A3FH 1PFNA 3C1FA 4LUOA 3MFHA 2I07B 2B2WA 4DUZQ 2B8FA 4DKAC 4FVMA 1EQQA 4K0KQ 2EY6A 5D14A 1KC8C 1VBGA 3P75A 4ZHQF 5K36G 2I80A 1Y8OB 1NMFA 5C4ZA 2E2JB 2F0KA 3GTPH 3TDQA 1S72A 3MWDA 4UCSA 4IHJF 1WTPA 1GUOA 2X69A 3T53B 4LF8L 5FJ8H 4JUZA 3UE1A 4R4CA 4LF9H 3I4NG 2UXBL 1P8LA 2EVBA 3QG1A 3MR3A 3V4ZA 2K75A 5BN3A 4ECUA 1DV1A 3VMMA 3K3PA 3LWUA 1EUCB 4DL3A 3I4NB 1P16A 5DLGA 2QK4A 4RA8A 1PV4A 1NE3A 2JA6H 1X6OA 2M2LA 3PIO3 4IFDG 1N48A 3FKIA 4ZQIA 2QF7A 5H1SE 3GIQA 4A3IB 5DG8A 2VQEL 4DV7H 2QKIC 1O7IA 4CJ1B 1CS0A 4JI5L 4ZI7F 1L0YB 4DV4Q 1KJ8A 4DL7A 1PH1A 5C44G 4IUPA 1U0LA 4A3BG 3OSOA 5KFBA 1X3EA 4YWLA 5C44B 3L3OC 2HUGA 3MEHA 2FHTA 1PYWD 1PTOD 2R84A 3CP0A 4JI6Q 2WAQA 2NUCA 2VNUD 3CCLA 1B9NA 2K5VA 3T1HQ 2R7ZH 2OCEA 2EYFA 4YCUA 3CQZA 1HQMC 2ATLA 3UDXA 3EJIA
chains in the Genus database with same CATH topology
1IBLL 3H3VH 4A3JH 3EIVA 2GVAA 4DUYQ 4DR7L 1S3OA 3G71A 5LMUL 5ELNA 3DM3A 1E1TA 1VQFA 4A3EG 1VQ6A 2IY5B 4UY8C 2AWNA 4WJ4A 3CXCA 4YCVA 4GLVB 4B3TQ 1AH9A 3RLNA 5FLMH 3HOYG 4GKJQ 5GROA 4WJ3M 2GN5A 4UP8A 2QGQA 3UDGA 1HR0W 2L15A 3DLLA 1X55A 5C4XH 1PYBA 2VY3A 3STBC 3VDYA 1GM5A 4GN5A 3K81C 3PGZA 4UPAA 2EXDA 2NZOA 3MXNB 3Q8DA 1A63A 3PUZA 2R6GA 5BR8L 2UUBL 2Q2IA 1JB7A 4GOPB 4L5QA 3GTGH 4ME3A 2UUAL 1CSPA 3EN2A 1LUZA 2OWOA 4DV2L 4ALPA 4LF8Q 5IYBH 4A75A 2JA5H 4LUVA 3AFPA 4H02A 5IP9G 1K9MC 3CC4A 4B3SQ 1IBKQ 2HQLA 2UXBQ 3PIPA 4OWWB 2MFIA 4IPGA 3A74A 4PZ8A 1WOCA 4YY3L 4UP7A 1KRSA 1VQIA 3GTQH 1SE8A 1Y14B 1AE2A 2ZJPA 4BBRG 3E0EA 1UE6A 1VQDA 2MNAA 2AKWB 2WAQE 4LF5L 1BKBA 1WYDA 4AH6A 3NBHB 4GOPC 1B70B 1KD1C 1VQMA 3M85A 1E7ZA 3FKIH 4BXXH 4OX9Q 2JA7G 2WB1E 3WWVA 1X56A 1N9WA 1YNXA 3GTOH 3U50C 3G6EA 1XNQQ 4A93H 3GDEA 2JA9A 4DV6Q 2VQFQ 1I6HH 3CCRA 2NN6I 4DR4L 3S1RH 4JI4L 2ALYB 3HKZE 4DV1L 1HZBA 4JI5Q 4LF4L 3HOZH 4A3KG 3F2CA 1Q46A 4A3BH 4POGA 3L7ZC 3S1MH 4X66L 1MJCA 3S17H 4JV5Q 3CW2C 1N34Q 4JI0L 5GAEC 3M4QA 5IY0A 2HT1A 2K52A 4IPDA 4B3RL 3GTMH 1CKNA 3J80c 4PZ7A 4X64L 3T1YQ 1XPOA 2EIFA 1NMGA 2I5HA 1QZGA 1B8AA 2JK8A 2NN6G 4AIMA 4FDBA 2PQAA 1X65A 3AQQA 2XTIA 1QUQA 2CWPA 3TS2A 3M7NA 2CKZB 4HJ7A 1IBML 4X6AH 3KDFA 3HOXH 1VQ4A 1IBLQ 5M5XH 2MO1A 1JE5A 3UDIA 4HIOA 1PHJA 3NEMA 2B29A 5HY6A 4DR7Q 1J6QA 5LMNW 1YJWA 5LMUQ 4DAYB 2NVXH 1WCMG 1QVGA 3W5OA 1IYJB 2CQOA 4JYAL 1Q12A 4GLAC 2I0QA 3M3YH 1V43A 4JI7L 1UEBA 2AHOB 2H5XA 4X62L 3NENA 4DR5Q 4KHPL 1FL0A 2UUCL 1SFOH 1JJGA 4HIKA 2AMCB 4HJAA 4A3MG 2RHSB 1A0IA 2OTJA 3CCSA 1JJCB 1Q1BA 3I4MH 2R7DA 4BBSG 4LFAL 4P71A 2UUBQ 3KJPA 1MIUA 5BR8Q 4AYBE 4A3IG 2UXCQ 4LFCL 2K4KA 5M3FG 2UUAQ 4GN4B 3ICEA 4DV2Q 4DR3L 2BH2A 3F1ZA 4JC0A 3K7AH 2YU9H 3K80C 2Q2HA 4IPHA 4JOIC 1HZ9A 3A5ZB 3NELA 1YBYA 1X3FA 4NPSA 5HGQA 1ASYA 5AJ3L 4JI8L 4YY3Q 1HZCA 4NXNL 2JEBI 2Y0SG 3F8TA 3PO3G 2K5NA 2XGTA 2YV5A 1YEZA 3PF5A 2PMZE 4LF5Q 2ZTCA 1IL2A 4QGUA 1VQNA 2IHFA 3J81c 3S1QH 4PZ6A 5IT9c 4KHZA 1SLJA 4R4IA 2K50A 5IE8A 4DR1L 1H95A 4DR4Q 1W2BA 1PFSA 5GQOA 3OTOL 2UU9L 4JI4Q 3PUYA 2KENA 4LF4Q 2HHHQ 4A3DG 3H0GG 1G51A 3HOVH 3RN5A 1KIXA 3S15H 4BY7G 4X66Q 4QIWE 4OWXB 3B6YA 2ZM6L 4LW1A 1L1OA 4DPGA 1Y1WH 1I3QH 1B7YB 3I7FA 4JI0Q 5JJKA 2D0OA 2N49A 4YWKA 1YHQA 4B3RQ 1KXLA 1E24A 1CSQA 2ZTEA 4BY1H 4X64Q 3AEVA 5M5WH 4A3LG 1HH2P 4IFDJ 1N32L 2E2JH 4HIMA 1XJVA 2RF4A 3TQYA 1OXXK 1MJEA 3BZKA 5M3MG 4DR5L 5C3EG 2WB1G 1Q1EA 3CCQA 1IBMQ 3S1NH 1Y1VG 3M4PA 3RNUA 1NJIC 1XNRL 1D8LA 5IP7H 1SRUA 4A3CH 4HJ9A 1YITA 4GOPA 4L5SA 4GNXB 2JA8H 4P75A 4P73A 2KBNA 2UXCL 1JT8A 2UXDL 3CCJA 4JYAQ 4DR2L 1YI2A 1K8AC 4A3GG 2R93G 2DGYA 1FGUA 3I4NH 3I4OA 2YTXA 1I5FA 4JI7Q 4X62Q 1A8VA 4KHPQ 1VQ5A 4APVA 4EX5A 1PVOA 2UUCQ 5IYDH 5FJ8G 3RLFA 4A3MH 3D31A 1EOVA 3H15A 3J80i 2Z6KC 1TWGH 3K8AA 3KF6B 4C3HH 1G6PA 4A3IH 2NZHA 3S2HH 4AQYL 2EQSA 4LFAQ 2MO0A 3EBEA 4JBJA 3CCMA 4LF9L 3PO2G 4LFCQ 3M9BA 4YHHL 1OXTA 4DR3Q 1OXUA 3RZOH 1XTDA 2R92G 4HJ5A 4C3JH 1EQRA 2JA6G 2N8NA 5C0XJ 2ID0A 3J7ZC 1R9TH 5AJ3Q 4JI8Q 3HOWG 4NXML 1QVCA 1CKOA 1K8GA 2F52A 3JAMc 5C44H 4NXNQ 3STBD 2B63G 2HHHL 2VUMG 2QA4A 1UE1A 3GD7A 1TWHH 1K73C 3OYYA 5IYCG 3JC66 1PH4A 1G291 4IO9A 3U58A 1XMQQ 3PV0A 3H3VI 3F2DA 4DV7L 1NY4A 2JQOA 1VS0A 3K0XA 4OWTB 4R1JA 5J3BA 3ULLA 4DR1Q 2KCMA 4DAMA 5JEAG 1K83H 4Y7NH 1YZ6A 3OTOQ 4XIGS 2E5LL 1S40A 2UU9Q 4X65L 1OXSC 4QL5A 4A3DH 4QQBX 3H0GH 3PUXA 4DK6C 2E2HH 4BY7H 2PI2A 1WI5A 2A19A 2R7ZG 4A76A 3K7UC 4JCVE 5LMNL 1VQKA 2ZM6Q 2IX0A 2R7FA 3GO5A 4OONA 1N8RC 4A3EH 1PH6A 1K3RA 2MQHA 3I55A 4DV3L 4A3JG 1Q7YC 1TWAH 3U4VA 1TWFH 1Z9FA 3KOJA 3HFZB 2OQ0A 5GAHC 4R4TA 1N32Q 1JMCA 4JBKA 2WP8J 2ES2A 3HOYH 1LTLA 4JG2A 4JOIA 1PH5A 1AE3A 1WFQA 1HNWL 1SN8A 1Z47A 4MZ9A 1Y1VH 3KFUA 2E8GA 3CPWA 2C35B 3J81i 1L0WA 4RMFA 1Q81C 4JI1L 3CPFA 4GLXA 1XNRQ 3HOUG 3KF8B 3UE0A 1PH3A 1PYSB 5FLMG 1N33L 1VQEA 3UDFA 4GN3B 1LM0A 1KAWA 2ASBA 3W1BA 1YHBA 4GS3A 1KHIA 4O2DA 1EWIA 4A3GH 2UXDQ 2R93H 5C4XG 4DR2Q 1PA6A 5IP9H 3E9HA 1TXYA 4EQ5A 4KI0A 3S14H 4XTCS 2YTVA 1V1QA 2RHQB 2JEAI 2VW9A 1GKHA 1XPRA 4QJFA 4BBRH 1K0RA 2IHEA 5IYBG 1U5KA 1YJ9A 2JA5G 5ELOA 4DK3C 2OQKA 1FJGQ 1E22A 1XMOL 2JA7H 4AQYQ 1XMQL 1HNZL 4LFBL 2NVYH 3PUWA 1HJPA 3GTJH 4LF9Q 5IWAL 4YHHQ 4GKKL 1HNXL 3SGIA 5M5YH 2IX1A 2KHIA 2E2IH 4BXXG 2PI2E 3FKIG 4RG1A 4C2MH 2ZJRA 3HOWH 1IZ6A 1HZAA 2LSSA 4NXMQ 4A3KH 2VUMH 2BA0A 4L5TA 2F4VL 3AFQA 4IJLA 3KYHC 1YIJA 1VQ9A 3IRBA 4TVAB 3A5UA 4IPCA 2CFMA 2A1AA 3CAMA 2LXKA 1I94Q 2OTLA 4IJHA 3RR5A 1KRTA 3HOZG 2V1CC 1MKHA 1OXVA 3ULPA 2IT1A 4DV7Q 1Q86C 1M90C 4BA1I 1QZHA 2NVQH 2CCZA 3TREA 1VCIA 2WAQG 1QVFA 3TS0A 5C0XI 1EYGA 2E5LQ 3PSIA 4X65Q 1HR0L 1VQCA 1BVSA 2I5MX 4JI3L 1EIFA 1PH2A 3FP9A 2Z6KA 4JBMA 1PH8A 3TRZA 2DUDA 3E9IA 4A3FG 4DUZL 4B3ML 4DV5L 5LMNQ 3S16H 1UE7A 3S2DH 4K0KL 1D7QA 3PF4A 1WCMH 3HOXG 3ER0A 4NB3A 4DV3Q 3HKZG 2RCNA 4LF7Q 3JAMi 4TQUS 5FLXc 4JI2L 1C0AA 2K14A 3CCEA 3GTKH 2Y0SE 3L2PA 4UP9A 1HNWQ 1L1OB 5C0XG 4DV0L 1X54A 3G48A 4A4IA 1X3GA 3KF6A 3HOUH 4GNXC 2F3IA 1XPUA 4JI1Q 4Y52H 4O0AA 1N33Q 3RLOA 1VQLA 3PCOB 4OO1I 1FJGL 5JJIA 4LF6L 4BBSH 2KHJA 5E7NA 1NBWA 3ZJYC 3PIOA 5M3FH 3OW2A 4QY7A 4LNQA 1L1OC 1A62A 1IXRA 1I50H 3I4MG 3W1GA 2Z0SA 3PO3H 2B3GA 2BA1A 1X9NA 3FHWA 4IOAA 1NTGA 1VQOA 2YTYA 1VQHA 3AYHB 1YJNA 1GVPA 3PUVA 4PG3A 4P74A 3S24A 3ULJA 4J15A 2LXJA 3CC2A 4OO1G 4DR6L 1CKMA 4DV4L 3A0JA 1XMOQ 2VZAA 1I94L 1VQGA 5C4JH 4R4OA 1HNZQ 4LFBQ 1Q82C 1N36L 5IWAQ 2GVBA 4R4QA 4DNIA 4GKKQ 4MTNA 2Q2UA 1HNXQ 3M4OH 3D0FA 1KL9A 1M1KC 3GTLH 2AWOA 1RL2A 4JI6L 4JBWA 1VQPA 4L5RC 4LUZA 4AYBG 3BZCA 3HKSA 3T1HL 2VQEQ 2F4VQ 2N3SA 1GD7A 1BBWA 3RZDH 1J5EL 2K5HA 2ZTDA 1LYLA 4MNOA 1WJJA 1V9PA 3RN2A 1PH9A 3HOVG 3BJUA 4DUYL 2NVTH 4A3LH 4LF7L 3CMEA 1C7YA 1YVCA 2WFWA 1Y1WG 2JJQA 2VS1A 1VQAA 1ASZA 5M3MH 4LWCA 1CUKA 5C3EH 2HIVA 3F2BA 3CQZH 1FVIA 4BY1G 1C9OA 2QEXA 1HR0Q 3BU2A 2A8VA 4JI3Q 1CKNB 4B3TL 4A3FH 4GKJL 4LUOA 1KQSA 4B3MQ 4DUZQ 4DKAC 4DV5Q 5DLQE 1EQQA 4K0KQ 1KC8C 3KJOA 2PQAB 4HIDA 2CWAA 1QUQB 5K36G 1NMFA 2YYZA 3CMAA 2KCTA 5IP7G 1PH7A 3ERSX 2JA8G 3KDFB 3GTPH 3U4ZA 4A3CG 1GO3E 1T9HA 4JI2Q 1S72A 4IFDI 2N78A 4DV0Q 1RIPA 4IOCA 2Q2TA 2ZJQA 5FJ8H 2JE6I 4B3SL 4LF8L 1W3SA 3UE1A 5JEAJ 4R4CA 1BBUA 1DGSA 1L2FA 4P72A 1P8LA 1IBKL 2ATWA 2I5LX 3I4NG 2UXBL 5EAYA 4C3IH 2PNHA 2K75A 4PMWA 3CC7A 4LF6Q 3TEHB 5IYDG 1SMXA 1EIYB 3PO2H 1EUJA 1P16A 1VQ8A 1YHAA 1PV4A 3J7A5 4KLKA 2R92H 1NE3A 3CF5A 4OX9L 2JA6H 1X6OA 2FXQA 4IFDG 1TWCH 1XNQL 1SR3A 4YWMA 3G4SA 4YCWA 4DV6L 2VQFL 5H1SE 2B63H 4BA2I 4A93G 4OXPA 3MEFA 2VQEL 2D0PA 5IYCH 1O7IA 1OTCA 2D62A 4DR6Q 3CD6A 4JI5L 1E1OA 1SROA 1Q8KA 2BH8A 4DV4Q 1VQ7A 1PH1A 5C44G 3L0OA 2VL6A 5GAGC 1E3PA 1U0LA 1N36Q 4A3BG 4JV5L 3J81j 1N34L 1X3EA 4POFA 4YWLA 1VQBA 3I2ZA 3T1YL 3I56A 3CP0A 4JI6Q 2HIXA 2VNUD 3CCLA 1EFWA 5GADC 1UE5A 3T1HQ 2K5VA 1UWVA 3KLWA 2OCEA 3CCVA 4GNXA 4HJ8A 2R7ZH 4YCUA 1J5EQ 3CCUA 1JJ2A 4DV1Q 5JJLA 3LGJA 1VQJA 3UDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL L;  3H3V H;  4A3J H;  3EIV A;  2GVA A;  4DUY Q;  4DR7 L;  1S3O A;  3G71 A;  5LMU L;  5ELN A;  3DM3 A;  1E1T A;  1VQF A;  4A3E G;  1VQ6 A;  2IY5 B;  4UY8 C;  2AWN A;  4WJ4 A;  3CXC A;  4YCV A;  4GLV B;  4B3T Q;  1AH9 A;  3RLN A;  5FLM H;  3HOY G;  4GKJ Q;  5GRO A;  4WJ3 M;  2GN5 A;  4UP8 A;  2QGQ A;  3UDG A;  1HR0 W;  2L15 A;  3DLL A;  1X55 A;  5C4X H;  1PYB A;  2VY3 A;  3STB C;  3VDY A;  1GM5 A;  4GN5 A;  3K81 C;  3PGZ A;  4UPA A;  2EXD A;  2NZO A;  3MXN B;  3Q8D A;  1A63 A;  3PUZ A;  2R6G A;  5BR8 L;  2UUB L;  2Q2I A;  1JB7 A;  4GOP B;  4L5Q A;  3GTG H;  4ME3 A;  2UUA L;  1CSP A;  3EN2 A;  1LUZ A;  2OWO A;  4DV2 L;  4ALP A;  4LF8 Q;  5IYB H;  4A75 A;  2JA5 H;  4LUV A;  3AFP A;  4H02 A;  5IP9 G;  1K9M C;  3CC4 A;  4B3S Q;  1IBK Q;  2HQL A;  2UXB Q;  3PIP A;  4OWW B;  2MFI A;  4IPG A;  3A74 A;  4PZ8 A;  1WOC A;  4YY3 L;  4UP7 A;  1KRS A;  1VQI A;  3GTQ H;  1SE8 A;  1Y14 B;  1AE2 A;  2ZJP A;  4BBR G;  3E0E A;  1UE6 A;  1VQD A;  2MNA A;  2AKW B;  2WAQ E;  4LF5 L;  1BKB A;  1WYD A;  4AH6 A;  3NBH B;  4GOP C;  1B70 B;  1KD1 C;  1VQM A;  3M85 A;  1E7Z A;  3FKI H;  4BXX H;  4OX9 Q;  2JA7 G;  2WB1 E;  3WWV A;  1X56 A;  1N9W A;  1YNX A;  3GTO H;  3U50 C;  3G6E A;  1XNQ Q;  4A93 H;  3GDE A;  2JA9 A;  4DV6 Q;  2VQF Q;  1I6H H;  3CCR A;  2NN6 I;  4DR4 L;  3S1R H;  4JI4 L;  2ALY B;  3HKZ E;  4DV1 L;  1HZB A;  4JI5 Q;  4LF4 L;  3HOZ H;  4A3K G;  3F2C A;  1Q46 A;  4A3B H;  4POG A;  3L7Z C;  3S1M H;  4X66 L;  1MJC A;  3S17 H;  4JV5 Q;  3CW2 C;  1N34 Q;  4JI0 L;  5GAE C;  3M4Q A;  5IY0 A;  2HT1 A;  2K52 A;  4IPD A;  4B3R L;  3GTM H;  1CKN A;  3J80 c;  4PZ7 A;  4X64 L;  3T1Y Q;  1XPO A;  2EIF A;  1NMG A;  2I5H A;  1QZG A;  1B8A A;  2JK8 A;  2NN6 G;  4AIM A;  4FDB A;  2PQA A;  1X65 A;  3AQQ A;  2XTI A;  1QUQ A;  2CWP A;  3TS2 A;  3M7N A;  2CKZ B;  4HJ7 A;  1IBM L;  4X6A H;  3KDF A;  3HOX H;  1VQ4 A;  1IBL Q;  5M5X H;  2MO1 A;  1JE5 A;  3UDI A;  4HIO A;  1PHJ A;  3NEM A;  2B29 A;  5HY6 A;  4DR7 Q;  1J6Q A;  5LMN W;  1YJW A;  5LMU Q;  4DAY B;  2NVX H;  1WCM G;  1QVG A;  3W5O A;  1IYJ B;  2CQO A;  4JYA L;  1Q12 A;  4GLA C;  2I0Q A;  3M3Y H;  1V43 A;  4JI7 L;  1UEB A;  2AHO B;  2H5X A;  4X62 L;  3NEN A;  4DR5 Q;  4KHP L;  1FL0 A;  2UUC L;  1SFO H;  1JJG A;  4HIK A;  2AMC B;  4HJA A;  4A3M G;  2RHS B;  1A0I A;  2OTJ A;  3CCS A;  1JJC B;  1Q1B A;  3I4M H;  2R7D A;  4BBS G;  4LFA L;  4P71 A;  2UUB Q;  3KJP A;  1MIU A;  5BR8 Q;  4AYB E;  4A3I G;  2UXC Q;  4LFC L;  2K4K A;  5M3F G;  2UUA Q;  4GN4 B;  3ICE A;  4DV2 Q;  4DR3 L;  2BH2 A;  3F1Z A;  4JC0 A;  3K7A H;  2YU9 H;  3K80 C;  2Q2H A;  4IPH A;  4JOI C;  1HZ9 A;  3A5Z B;  3NEL A;  1YBY A;  1X3F A;  4NPS A;  5HGQ A;  1ASY A;  5AJ3 L;  4JI8 L;  4YY3 Q;  1HZC A;  4NXN L;  2JEB I;  2Y0S G;  3F8T A;  3PO3 G;  2K5N A;  2XGT A;  2YV5 A;  1YEZ A;  3PF5 A;  2PMZ E;  4LF5 Q;  2ZTC A;  1IL2 A;  4QGU A;  1VQN A;  2IHF A;  3J81 c;  3S1Q H;  4PZ6 A;  5IT9 c;  4KHZ A;  1SLJ A;  4R4I A;  2K50 A;  5IE8 A;  4DR1 L;  1H95 A;  4DR4 Q;  1W2B A;  1PFS A;  5GQO A;  3OTO L;  2UU9 L;  4JI4 Q;  3PUY A;  2KEN A;  4LF4 Q;  2HHH Q;  4A3D G;  3H0G G;  1G51 A;  3HOV H;  3RN5 A;  1KIX A;  3S15 H;  4BY7 G;  4X66 Q;  4QIW E;  4OWX B;  3B6Y A;  2ZM6 L;  4LW1 A;  1L1O A;  4DPG A;  1Y1W H;  1I3Q H;  1B7Y B;  3I7F A;  4JI0 Q;  5JJK A;  2D0O A;  2N49 A;  4YWK A;  1YHQ A;  4B3R Q;  1KXL A;  1E24 A;  1CSQ A;  2ZTE A;  4BY1 H;  4X64 Q;  3AEV A;  5M5W H;  4A3L G;  1HH2 P;  4IFD J;  1N32 L;  2E2J H;  4HIM A;  1XJV A;  2RF4 A;  3TQY A;  1OXX K;  1MJE A;  3BZK A;  5M3M G;  4DR5 L;  5C3E G;  2WB1 G;  1Q1E A;  3CCQ A;  1IBM Q;  3S1N H;  1Y1V G;  3M4P A;  3RNU A;  1NJI C;  1XNR L;  1D8L A;  5IP7 H;  1SRU A;  4A3C H;  4HJ9 A;  1YIT A;  4GOP A;  4L5S A;  4GNX B;  2JA8 H;  4P75 A;  4P73 A;  2KBN A;  2UXC L;  1JT8 A;  2UXD L;  3CCJ A;  4JYA Q;  4DR2 L;  1YI2 A;  1K8A C;  4A3G G;  2R93 G;  2DGY A;  1FGU A;  3I4N H;  3I4O A;  2YTX A;  1I5F A;  4JI7 Q;  4X62 Q;  1A8V A;  4KHP Q;  1VQ5 A;  4APV A;  4EX5 A;  1PVO A;  2UUC Q;  5IYD H;  5FJ8 G;  3RLF A;  4A3M H;  3D31 A;  1EOV A;  3H15 A;  3J80 i;  2Z6K C;  1TWG H;  3K8A A;  3KF6 B;  4C3H H;  1G6P A;  4A3I H;  2NZH A;  3S2H H;  4AQY L;  2EQS A;  4LFA Q;  2MO0 A;  3EBE A;  4JBJ A;  3CCM A;  4LF9 L;  3PO2 G;  4LFC Q;  3M9B A;  4YHH L;  1OXT A;  4DR3 Q;  1OXU A;  3RZO H;  1XTD A;  2R92 G;  4HJ5 A;  4C3J H;  1EQR A;  2JA6 G;  2N8N A;  5C0X J;  2ID0 A;  3J7Z C;  1R9T H;  5AJ3 Q;  4JI8 Q;  3HOW G;  4NXM L;  1QVC A;  1CKO A;  1K8G A;  2F52 A;  3JAM c;  5C44 H;  4NXN Q;  3STB D;  2B63 G;  2HHH L;  2VUM G;  2QA4 A;  1UE1 A;  3GD7 A;  1TWH H;  1K73 C;  3OYY A;  5IYC G;  3JC6 6;  1PH4 A;  1G29 1;  4IO9 A;  3U58 A;  1XMQ Q;  3PV0 A;  3H3V I;  3F2D A;  4DV7 L;  1NY4 A;  2JQO A;  1VS0 A;  3K0X A;  4OWT B;  4R1J A;  5J3B A;  3ULL A;  4DR1 Q;  2KCM A;  4DAM A;  5JEA G;  1K83 H;  4Y7N H;  1YZ6 A;  3OTO Q;  4XIG S;  2E5L L;  1S40 A;  2UU9 Q;  4X65 L;  1OXS C;  4QL5 A;  4A3D H;  4QQB X;  3H0G H;  3PUX A;  4DK6 C;  2E2H H;  4BY7 H;  2PI2 A;  1WI5 A;  2A19 A;  2R7Z G;  4A76 A;  3K7U C;  4JCV E;  5LMN L;  1VQK A;  2ZM6 Q;  2IX0 A;  2R7F A;  3GO5 A;  4OON A;  1N8R C;  4A3E H;  1PH6 A;  1K3R A;  2MQH A;  3I55 A;  4DV3 L;  4A3J G;  1Q7Y C;  1TWA H;  3U4V A;  1TWF H;  1Z9F A;  3KOJ A;  3HFZ B;  2OQ0 A;  5GAH C;  4R4T A;  1N32 Q;  1JMC A;  4JBK A;  2WP8 J;  2ES2 A;  3HOY H;  1LTL A;  4JG2 A;  4JOI A;  1PH5 A;  1AE3 A;  1WFQ A;  1HNW L;  1SN8 A;  1Z47 A;  4MZ9 A;  1Y1V H;  3KFU A;  2E8G A;  3CPW A;  2C35 B;  3J81 i;  1L0W A;  4RMF A;  1Q81 C;  4JI1 L;  3CPF A;  4GLX A;  1XNR Q;  3HOU G;  3KF8 B;  3UE0 A;  1PH3 A;  1PYS B;  5FLM G;  1N33 L;  1VQE A;  3UDF A;  4GN3 B;  1LM0 A;  1KAW A;  2ASB A;  3W1B A;  1YHB A;  4GS3 A;  1KHI A;  4O2D A;  1EWI A;  4A3G H;  2UXD Q;  2R93 H;  5C4X G;  4DR2 Q;  1PA6 A;  5IP9 H;  3E9H A;  1TXY A;  4EQ5 A;  4KI0 A;  3S14 H;  4XTC S;  2YTV A;  1V1Q A;  2RHQ B;  2JEA I;  2VW9 A;  1GKH A;  1XPR A;  4QJF A;  4BBR H;  1K0R A;  2IHE A;  5IYB G;  1U5K A;  1YJ9 A;  2JA5 G;  5ELO A;  4DK3 C;  2OQK A;  1FJG Q;  1E22 A;  1XMO L;  2JA7 H;  4AQY Q;  1XMQ L;  1HNZ L;  4LFB L;  2NVY H;  3PUW A;  1HJP A;  3GTJ H;  4LF9 Q;  5IWA L;  4YHH Q;  4GKK L;  1HNX L;  3SGI A;  5M5Y H;  2IX1 A;  2KHI A;  2E2I H;  4BXX G;  2PI2 E;  3FKI G;  4RG1 A;  4C2M H;  2ZJR A;  3HOW H;  1IZ6 A;  1HZA A;  2LSS A;  4NXM Q;  4A3K H;  2VUM H;  2BA0 A;  4L5T A;  2F4V L;  3AFQ A;  4IJL A;  3KYH C;  1YIJ A;  1VQ9 A;  3IRB A;  4TVA B;  3A5U A;  4IPC A;  2CFM A;  2A1A A;  3CAM A;  2LXK A;  1I94 Q;  2OTL A;  4IJH A;  3RR5 A;  1KRT A;  3HOZ G;  2V1C C;  1MKH A;  1OXV A;  3ULP A;  2IT1 A;  4DV7 Q;  1Q86 C;  1M90 C;  4BA1 I;  1QZH A;  2NVQ H;  2CCZ A;  3TRE A;  1VCI A;  2WAQ G;  1QVF A;  3TS0 A;  5C0X I;  1EYG A;  2E5L Q;  3PSI A;  4X65 Q;  1HR0 L;  1VQC A;  1BVS A;  2I5M X;  4JI3 L;  1EIF A;  1PH2 A;  3FP9 A;  2Z6K A;  4JBM A;  1PH8 A;  3TRZ A;  2DUD A;  3E9I A;  4A3F G;  4DUZ L;  4B3M L;  4DV5 L;  5LMN Q;  3S16 H;  1UE7 A;  3S2D H;  4K0K L;  1D7Q A;  3PF4 A;  1WCM H;  3HOX G;  3ER0 A;  4NB3 A;  4DV3 Q;  3HKZ G;  2RCN A;  4LF7 Q;  3JAM i;  4TQU S;  5FLX c;  4JI2 L;  1C0A A;  2K14 A;  3CCE A;  3GTK H;  2Y0S E;  3L2P A;  4UP9 A;  1HNW Q;  1L1O B;  5C0X G;  4DV0 L;  1X54 A;  3G48 A;  4A4I A;  1X3G A;  3KF6 A;  3HOU H;  4GNX C;  2F3I A;  1XPU A;  4JI1 Q;  4Y52 H;  4O0A A;  1N33 Q;  3RLO A;  1VQL A;  3PCO B;  4OO1 I;  1FJG L;  5JJI A;  4LF6 L;  4BBS H;  2KHJ A;  5E7N A;  1NBW A;  3ZJY C;  3PIO A;  5M3F H;  3OW2 A;  4QY7 A;  4LNQ A;  1L1O C;  1A62 A;  1IXR A;  1I50 H;  3I4M G;  3W1G A;  2Z0S A;  3PO3 H;  2B3G A;  2BA1 A;  1X9N A;  3FHW A;  4IOA A;  1NTG A;  1VQO A;  2YTY A;  1VQH A;  3AYH B;  1YJN A;  1GVP A;  3PUV A;  4PG3 A;  4P74 A;  3S24 A;  3ULJ A;  4J15 A;  2LXJ A;  3CC2 A;  4OO1 G;  4DR6 L;  1CKM A;  4DV4 L;  3A0J A;  1XMO Q;  2VZA A;  1I94 L;  1VQG A;  5C4J H;  4R4O A;  1HNZ Q;  4LFB Q;  1Q82 C;  1N36 L;  5IWA Q;  2GVB A;  4R4Q A;  4DNI A;  4GKK Q;  4MTN A;  2Q2U A;  1HNX Q;  3M4O H;  3D0F A;  1KL9 A;  1M1K C;  3GTL H;  2AWO A;  1RL2 A;  4JI6 L;  4JBW A;  1VQP A;  4L5R C;  4LUZ A;  4AYB G;  3BZC A;  3HKS A;  3T1H L;  2VQE Q;  2F4V Q;  2N3S A;  1GD7 A;  1BBW A;  3RZD H;  1J5E L;  2K5H A;  2ZTD A;  1LYL A;  4MNO A;  1WJJ A;  1V9P A;  3RN2 A;  1PH9 A;  3HOV G;  3BJU A;  4DUY L;  2NVT H;  4A3L H;  4LF7 L;  3CME A;  1C7Y A;  1YVC A;  2WFW A;  1Y1W G;  2JJQ A;  2VS1 A;  1VQA A;  1ASZ A;  5M3M H;  4LWC A;  1CUK A;  5C3E H;  2HIV A;  3F2B A;  3CQZ H;  1FVI A;  4BY1 G;  1C9O A;  2QEX A;  1HR0 Q;  3BU2 A;  2A8V A;  4JI3 Q;  1CKN B;  4B3T L;  4A3F H;  4GKJ L;  4LUO A;  1KQS A;  4B3M Q;  4DUZ Q;  4DKA C;  4DV5 Q;  5DLQ E;  1EQQ A;  4K0K Q;  1KC8 C;  3KJO A;  2PQA B;  4HID A;  2CWA A;  1QUQ B;  5K36 G;  1NMF A;  2YYZ A;  3CMA A;  2KCT A;  5IP7 G;  1PH7 A;  3ERS X;  2JA8 G;  3KDF B;  3GTP H;  3U4Z A;  4A3C G;  1GO3 E;  1T9H A;  4JI2 Q;  1S72 A;  4IFD I;  2N78 A;  4DV0 Q;  1RIP A;  4IOC A;  2Q2T A;  2ZJQ A;  5FJ8 H;  2JE6 I;  4B3S L;  4LF8 L;  1W3S A;  3UE1 A;  5JEA J;  4R4C A;  1BBU A;  1DGS A;  1L2F A;  4P72 A;  1P8L A;  1IBK L;  2ATW A;  2I5L X;  3I4N G;  2UXB L;  5EAY A;  4C3I H;  2PNH A;  2K75 A;  4PMW A;  3CC7 A;  4LF6 Q;  3TEH B;  5IYD G;  1SMX A;  1EIY B;  3PO2 H;  1EUJ A;  1P16 A;  1VQ8 A;  1YHA A;  1PV4 A;  3J7A 5;  4KLK A;  2R92 H;  1NE3 A;  3CF5 A;  4OX9 L;  2JA6 H;  1X6O A;  2FXQ A;  4IFD G;  1TWC H;  1XNQ L;  1SR3 A;  4YWM A;  3G4S A;  4YCW A;  4DV6 L;  2VQF L;  5H1S E;  2B63 H;  4BA2 I;  4A93 G;  4OXP A;  3MEF A;  2VQE L;  2D0P A;  5IYC H;  1O7I A;  1OTC A;  2D62 A;  4DR6 Q;  3CD6 A;  4JI5 L;  1E1O A;  1SRO A;  1Q8K A;  2BH8 A;  4DV4 Q;  1VQ7 A;  1PH1 A;  5C44 G;  3L0O A;  2VL6 A;  5GAG C;  1E3P A;  1U0L A;  1N36 Q;  4A3B G;  4JV5 L;  3J81 j;  1N34 L;  1X3E A;  4POF A;  4YWL A;  1VQB A;  3I2Z A;  3T1Y L;  3I56 A;  3CP0 A;  4JI6 Q;  2HIX A;  2VNU D;  3CCL A;  1EFW A;  5GAD C;  1UE5 A;  3T1H Q;  2K5V A;  1UWV A;  3KLW A;  2OCE A;  3CCV A;  4GNX A;  4HJ8 A;  2R7Z H;  4YCU A;  1J5E Q;  3CCU A;  1JJ2 A;  4DV1 Q;  5JJL A;  3LGJ A;  1VQJ A;  3UDX A; 
#chains in the Genus database with same CATH topology
 3H3V H;  1HNW H;  5KT3 A;  1M0T A;  3E5S A;  3RGZ A;  2LS0 1;  1K83 B;  2YCH A;  4DUY Q;  4DR7 L;  3HKZ A;  3G71 A;  4ECW A;  5ELN A;  3DM3 A;  1E1T A;  1VQ6 A;  3JZI A;  4ZUJ A;  1NCV A;  1F9P A;  4YCV A;  4JV0 A;  1RDP D;  3RLN A;  5EBD A;  1D5Z C;  5GRO A;  2V4R A;  2GN5 A;  4UP8 A;  1TWA B;  1DOL A;  1ROD A;  1I6V C;  1TWF B;  5K36 H;  2B2U C;  1X55 A;  1PYB A;  3STB C;  3VDY A;  4KKT A;  4G7O C;  1EZ6 A;  2MP1 A;  4WD3 A;  1Z2N X;  4YIJ A;  1EUD B;  1S10 A;  1CT1 D;  4KHV A;  4GOP B;  4L5Q A;  1RF2 D;  2EJM A;  2UUA L;  3NGD A;  1ZET A;  4DLK A;  4LF8 Q;  4A75 A;  1XMQ H;  1YNN C;  3BZD B;  4LUV A;  1HNZ H;  4LFB H;  2JA6 A;  2V9W A;  2UXB Q;  4RB1 A;  2F4I A;  5C5M A;  2MFI A;  4IPG A;  4YY3 L;  3GTQ H;  4J9S A;  1Y14 B;  3Q2O A;  4DR1 H;  3QFF A;  4BBR G;  3LP8 A;  2JN4 A;  3BS1 A;  4IQZ A;  3N41 B;  2MNA A;  1OWT A;  2WAQ E;  3NSW A;  4LF5 L;  4AH6 A;  3NBH B;  1E7Z A;  2CW0 D;  3K6O A;  2JA7 G;  5KFR A;  4BBR B;  2XC9 A;  1N9W A;  2VR1 A;  5KFG A;  1STN A;  2IJ0 A;  3U50 C;  3GDE A;  4UCU A;  1SNO A;  1E4E B;  4JK1 C;  3TP7 A;  4K5W A;  2JA7 B;  5L37 A;  1A9X A;  2NVY B;  2YYA A;  3HKZ E;  4DV1 L;  1VF5 C;  1HZB A;  1SE4 A;  4JI5 Q;  2IX3 A;  1Q46 A;  4A3B H;  2EJF C;  4N8F A;  3HP3 A;  3L7Z C;  2ZXP A;  5CV8 A;  1KLG D;  3DEO A;  3NWS A;  3CW2 C;  4TSS A;  3R5H A;  4Q45 A;  3SHL A;  3GII A;  4B3M H;  1GSO A;  2I5H A;  4CBV A;  4PQX A;  2JK8 A;  3GIL A;  3MWE A;  1I4R A;  2FKL A;  4JI2 H;  4KY5 A;  5A2Q W;  5JH7 F;  4XYO A;  4U7C A;  3NHH A;  1PTO F;  2A68 D;  1C30 A;  2C5C A;  2PZU A;  3ITP A;  1JWU D;  5LHY 1;  1JDE A;  4DR7 Q;  4YR0 A;  1FD7 D;  2KHS A;  1YJW A;  4YJ3 F;  5LL6 b;  3T13 A;  1WCM G;  4U68 A;  1FJG H;  1IYJ B;  4JYA L;  4DL2 A;  1JIC A;  4C1N I;  2SNS A;  2ASL A;  2I0Q A;  2GPW A;  5F9L A;  1BCP B;  3SE7 A;  2EJG C;  3BQ2 A;  3VR3 A;  3T56 B;  2AHO B;  3A8K E;  1WCM B;  5D8D A;  3WO1 A;  1ZKO A;  4YAJ B;  4HIK A;  3LML A;  5DM6 3;  4RUA A;  2DIK A;  4HJA A;  3RD4 A;  1JOO A;  2OTJ A;  1A6X A;  1Q1B A;  3K57 A;  2R7D A;  1SJH D;  4G7H C;  1TY0 A;  4BBS G;  2W6O A;  1I4P A;  3KJP A;  2UUA Q;  2WII B;  5CV4 A;  4GN4 B;  5M3F G;  4DR3 L;  2G9D A;  2BH2 A;  4K2L A;  1I94 H;  3F1Z A;  4M8A A;  3ZYY X;  2YU9 H;  4BBS B;  2Q8T A;  5AJ3 L;  5M3F B;  4JI8 L;  4YY3 Q;  1W96 A;  2C28 A;  1TS3 A;  2XGT A;  3PIP 3;  4O3N A;  5KFI A;  5FLX W;  4R8U B;  1YEZ A;  5CAE B;  4LF5 Q;  5BPF A;  1MI2 A;  4X65 H;  1AZP A;  4FNF A;  4RKB A;  2HVS A;  1TWH B;  4QF4 A;  1DCZ A;  1PFS A;  1EOT A;  5GQO A;  2UU9 L;  5KND A;  4NMZ A;  1WD0 A;  4DAV A;  4TV9 F;  1K83 A;  1ZEQ X;  2ZM6 L;  1Y1W H;  4MAM A;  5KFO A;  2Z4I A;  4EYH B;  1HUN A;  1EYZ A;  3RZD B;  3OHA A;  2R8K A;  4A3L G;  1STB A;  2B2T C;  4NKL A;  1TWA A;  1TWF A;  1XJV A;  1SBB B;  3P7J A;  3SEB A;  2XWB B;  4TQS A;  3TQY A;  3BZK A;  4O4I F;  4DR5 L;  2WB1 G;  1BXR A;  1Q1E A;  1MD2 D;  4H0L C;  3CCQ A;  3S1N H;  3FMA A;  1VF7 A;  3RNU A;  1XNR L;  5IP7 H;  1WTO A;  4L5S A;  4GOP A;  2FK3 A;  2WB1 B;  4PWQ A;  1ILQ A;  2UXC L;  4JYA Q;  4DR2 L;  4A3G G;  3RAX A;  3A54 A;  3PQI A;  1M0W A;  1PX2 A;  3K5M A;  1VAJ A;  2HQE A;  3QOJ A;  2YU9 A;  3NBH A;  1V1P B;  5DLF A;  3H15 A;  2FMM A;  3J80 i;  1XNQ H;  2V5A A;  1TWG H;  3K8A A;  1G6P A;  1S5D D;  3KAJ A;  5IOC A;  2R8I A;  4DV6 H;  3S2H H;  2QYZ A;  1M8A A;  4CGY B;  4AQY L;  2EQS A;  2F4V H;  2AQ3 B;  3EBE A;  1E4E A;  4YHH L;  4DR3 Q;  3GIJ A;  4XX0 B;  2NVY A;  2W6M A;  5C0X J;  5BN4 A;  5J39 A;  2W7O A;  5AJ3 Q;  3AB9 A;  4JI8 Q;  1Z2O X;  1O78 A;  2O03 A;  4ULL A;  1LTG D;  1QVC A;  2EYL A;  2F52 A;  5DM7 3;  1DM0 B;  3STB D;  2B63 G;  2HHH L;  3MR2 A;  1UE1 A;  2VQD A;  1TWH H;  4OGQ C;  3OYY A;  3VYU A;  2XIW A;  3N52 A;  3JC6 6;  4HSP A;  1IHZ A;  4APM A;  2ZXO A;  1Q8I A;  2B63 B;  3H3V I;  4YP3 A;  1YNN D;  4OWT B;  2KCM A;  2MUY A;  5JEA G;  4Y7N H;  1YZ6 A;  1GUG A;  4XIG S;  2UU9 Q;  1S40 A;  4EQP A;  2FK2 A;  1A3T A;  3M4I A;  1CQV A;  2PI2 A;  2A19 A;  4ED0 A;  2JEI A;  4KY6 A;  5LMN L;  2ZM6 Q;  3GO5 A;  5LA6 F;  2B2V A;  1K3R A;  2MQH A;  4DV3 L;  4A3J G;  3OUZ A;  4LMQ D;  1Z9F A;  3BYT B;  1MBY A;  1WCM A;  4R4T A;  2F0V A;  3TP5 A;  2YL2 A;  1JMC A;  4V0B A;  4JG2 A;  1PH5 A;  3NQI A;  3Q6S A;  5BPH A;  4A3J B;  5I6W A;  3MFY A;  2NU7 B;  3TP6 A;  1PRT F;  4MZ9 A;  5KNC A;  4QWA A;  5BR8 H;  2UUB H;  2C9O A;  1Q81 C;  3CPF A;  4GLX A;  1XNR Q;  3UE0 A;  1PH3 A;  3BA9 A;  3RV3 A;  1DOM A;  5CV6 A;  4HR7 B;  3C3L A;  1D5X C;  1KAW A;  3BJY A;  3W1B A;  4A3G H;  5KFN A;  3HZX A;  4DR2 Q;  1PA6 A;  3H3V C;  2KVM A;  5IP9 H;  1EZ1 A;  1A3U A;  3E9H A;  4CJ2 C;  4KMU C;  5IGB A;  1BNC A;  1B53 A;  2YTV A;  2Q8R E;  1KJ9 A;  1EWC A;  1GKH A;  5KX5 F;  1YJ9 A;  1K0R A;  2IHE A;  5IIF A;  1U5K A;  5IYB G;  2JA5 G;  3QZ8 A;  2OQK A;  4FP5 D;  2WE6 A;  3P1H A;  5KG0 A;  4JW0 A;  5JVD F;  2PW5 A;  4AQY Q;  1TWH A;  3Q22 A;  2JA5 B;  1J5E H;  1F9R A;  1XXG A;  2K7V A;  4YHH Q;  4GKK L;  1D2B A;  5M5Y H;  1RJP A;  1S9F A;  4BXX G;  2PI2 E;  4RG1 A;  1MHW C;  4C2M H;  2KCN A;  3LX0 A;  1K0S A;  3RV4 A;  2BA0 A;  2J0T D;  3TME A;  1II3 A;  1YIJ A;  1DXM A;  2L5T A;  5KFE A;  5ELF A;  2EY2 A;  4IPC A;  1SNM A;  2A1A A;  4FYD A;  1HXY D;  2O5J C;  1H9J A;  4X3U A;  3HOZ G;  1MKH A;  1I6H B;  1OXV A;  1JWM D;  2IT1 A;  1M90 C;  3GLK A;  5KFQ A;  1HA5 A;  3S1R B;  1ILP A;  2VB2 X;  1SEB D;  2NN6 H;  2X6L A;  2NVQ H;  3TRE A;  4DGZ A;  3PW5 A;  3HOZ B;  5E3F A;  5KFT A;  1H9S A;  4O3P A;  2B39 A;  2I5M X;  5DGB A;  3FP9 A;  1FR3 A;  2Z6K A;  1G2T A;  1JOQ A;  4G57 A;  2DUD A;  2K5D A;  5CR3 A;  4PMB A;  5LMN Q;  3GTM B;  1S0N A;  4DL5 A;  4JI7 H;  4X62 H;  3HOX G;  4KHP H;  4DV3 Q;  4LF7 Q;  3JAM i;  2K14 A;  2CQY A;  3N43 B;  1GXD C;  3VYR A;  3KBX A;  3HOX B;  4DV0 L;  5M5X B;  1V1P A;  4GC6 A;  2NYZ D;  3R93 A;  3TIG A;  3NUC A;  4C56 C;  1GUT A;  2F3I A;  1XPU A;  4QWE A;  3RB0 A;  1AZQ A;  5JJI A;  3G6J B;  4GC7 A;  4NLG A;  3SR1 A;  3KK7 A;  4F88 A;  1IXR A;  2ASJ A;  1SFO B;  4RB3 C;  2JEJ A;  2J4X A;  1RTO A;  3PO3 H;  3SK8 A;  4IOA A;  3VPC A;  1N34 H;  2BE5 C;  4XXE A;  2YTY A;  1XYI A;  1C3O A;  2IX1 A;  3ULJ A;  1CKM A;  1SCU B;  3D4R A;  2VZA A;  3K7A B;  1BDO A;  1N36 L;  3LWB A;  4R4Q A;  4GKK Q;  3P20 A;  2OEO A;  3K5L A;  1E0B A;  1ZXT A;  2AWO A;  3BG3 A;  3SVM A;  4FF1 A;  2EYM A;  2KJX A;  2ZJT A;  4BS9 A;  1VQP A;  5A2Q L;  3HKS A;  4IAJ A;  2R82 A;  2N3S A;  3BA8 A;  4DAY A;  1JWS D;  1BJT A;  2W6N A;  1FKA H;  5IGE A;  1V9P A;  3HOV G;  1K1Q A;  3ETH A;  2NVT H;  1HFG A;  2CQA A;  4R8N A;  1YVC A;  2A69 C;  4J6H A;  1JXL A;  1VQA A;  2HJW A;  1B2T A;  2W71 A;  2X0S A;  1CUK A;  2HIV A;  2L0C A;  5ELC A;  3HOV B;  4BY1 G;  2QEX A;  3S15 B;  1CQF A;  1CKN B;  4B3T L;  4ECS A;  2UXD H;  4HR7 A;  2SDF A;  2RCF A;  1KQS A;  2RKS A;  1DOK A;  2PNR C;  1AFP A;  4BY1 B;  4FBT A;  2PQA B;  1V51 A;  1L2Z A;  1QUQ B;  2DY7 A;  2F0P A;  2AQ1 B;  1UNN C;  2R8J A;  3CU7 A;  2R87 A;  3I90 A;  3U4Z A;  2BR0 A;  4C1N K;  1BXT A;  3PR4 A;  4DV0 Q;  1RIP A;  4TV8 F;  2JE6 I;  3M9M B;  1EEF D;  3D8G A;  4CJ0 B;  1PTO C;  1W3S A;  3LWE A;  1IBK L;  5K5P A;  2ATW A;  2ZT9 C;  2YZG A;  5EAY A;  4PV1 C;  4C3I H;  2JA5 A;  1ZQ7 A;  4PMW A;  3CC7 A;  3TEH B;  4KK7 A;  2RA4 A;  1EIY B;  3PO2 H;  1E4G T;  1YHA A;  2CW8 A;  4C3H G;  2R92 H;  2CVR A;  2FXQ A;  1QCB D;  2C2R A;  4A3M B;  3FEW X;  1TS5 A;  5I9O A;  5KFW A;  1SR3 A;  4YWM A;  3GIM A;  1LT3 D;  4C3H B;  2VQF L;  4A93 G;  1U4M A;  4OXP A;  4XQN A;  4B3R H;  5IYC H;  3HG9 A;  1OTC A;  2D62 A;  3PMF A;  5FK9 C;  2F0I A;  2L9H A;  2WTF A;  2W9A A;  1SRO A;  3L0O A;  2E5L H;  1N36 Q;  4ILW A;  4JV5 L;  5KKN B;  1TII D;  2K32 A;  3R23 A;  2FE3 A;  3QOL A;  4POF A;  1TR5 A;  3MR6 A;  4XYM B;  5KFF A;  2OLS A;  1ESR A;  3X3M A;  2KCC A;  3GIP A;  5GAD C;  2B2Y A;  5JVH 3;  4GNX A;  1UWV A;  3KLW A;  3V2T A;  3GTM A;  1NR2 A;  4L8J A;  3L4K A;  5JJL A;  5DAU A;  2I46 A;  5CBE E;  4M9U A;  2KEC A;  2KOL A;  1IBL L;  5EWG A;  2SNM A;  3GV8 B;  1CQI B;  2CH4 A;  1W6K A;  5LOV F;  1S3O A;  4JI1 H;  4KKS A;  2A6E C;  3L4J A;  4A3E G;  2IY5 B;  2E2H B;  3VA7 A;  5DEH A;  5KYL A;  3NK9 A;  2B8G A;  3T5J A;  4GLV B;  4B3T Q;  1AH9 A;  4A3E B;  3IN5 A;  5JPN C;  4DL4 A;  2L15 A;  4UHV A;  5C4X H;  2VY3 A;  3BG5 A;  2RDG A;  1E2V A;  3TIN A;  2NZO A;  3Q8D A;  1A63 A;  3PUZ A;  2R6G A;  3R5X A;  3GTG H;  2Q2I A;  3HEJ A;  2JSO A;  3EN2 A;  1LUZ A;  4TUY F;  4ALP A;  1XMO H;  2R92 A;  4H02 A;  1IBK Q;  5IWA H;  4YAK B;  3J7A K;  2C2D A;  3A74 A;  1HFN A;  4ED7 A;  1HNX H;  1KRS A;  5BN5 A;  2R93 B;  1SE8 A;  2PO4 A;  1UE6 A;  3CHB D;  3E0E A;  3TN2 A;  1VQD A;  1T94 A;  2W9C B;  1BKB A;  1WYD A;  1D1I A;  1EY0 A;  5KT2 A;  3FKI H;  2LMC B;  5DGA A;  3J7A F;  1X56 A;  4A93 H;  3F8N A;  1STE A;  2KUM A;  3FVQ A;  3I3C A;  1XTC D;  2VQF Q;  3CCR A;  2NN6 I;  4DR4 L;  3EPI A;  2RDH A;  2F1M A;  4JI4 L;  2IW3 A;  2ALY B;  4XYQ A;  2M9V A;  3D4W A;  2R85 A;  4A3K G;  1ZHS A;  2W7P A;  2NWG A;  2E2I B;  4POG A;  4EQO A;  3S1M H;  1HR0 H;  3FMC A;  3S17 H;  4JV5 Q;  4JI3 H;  5J2T F;  2VUM B;  2KA7 A;  4A3K B;  2PVP A;  5IY0 A;  5L1K A;  1D5M C;  1F9S A;  1CKN A;  5EKK A;  3J80 c;  4PZ7 A;  3G7L A;  1J9O A;  4X64 L;  1XPO A;  4K0K H;  2BE5 D;  3QB3 A;  3WOF A;  2PQA A;  2G9H D;  1QUQ A;  2D5D A;  1I3Q B;  1MSH A;  1IBM L;  1IBL Q;  4J9L A;  2WKC A;  5M5W B;  3WO0 A;  3UDI A;  3NEM A;  2W57 A;  3DF7 A;  5FOB B;  2EYH A;  5LMN W;  1CHQ D;  2NVX H;  3KHL A;  1QVG A;  3GID A;  4ID6 A;  4I7Z C;  3GTG A;  1J8I A;  3S2D B;  5DG9 A;  5I2Y A;  2H5X A;  2XCL A;  2N55 A;  4F50 A;  1E2Z A;  2RHS B;  1A0I A;  4KV6 A;  3GTK B;  3CCS A;  1Z2P X;  2A69 D;  2DN8 A;  3CRK C;  4A3I G;  1MIU A;  1QE6 A;  1PRT C;  4LFC L;  3HOU B;  2O4X A;  3ICE A;  3VR2 A;  4DV4 H;  1SSO A;  5E1F A;  4JC0 A;  2MHV A;  4IPH A;  4JOI C;  1HZ9 A;  1X3F A;  5HGQ A;  2XIG A;  5DNF A;  4NXN L;  1I50 B;  5L9X A;  4KKU A;  1X3P A;  1EIG A;  4IRC A;  2ZTC A;  2EY1 A;  3S9W A;  1SYX B;  4R7R A;  4QWD A;  4PZ6 A;  1LTT D;  4DR1 L;  4DR4 Q;  2NTT A;  1W2B A;  4JPB W;  2R7K A;  2KQ3 A;  2R8H A;  4DUY H;  3OTO L;  5EBC A;  4JI4 Q;  1EY6 A;  3PUY A;  3ND9 A;  1M4V A;  2KEN A;  2F3W A;  2VPS A;  3RIZ A;  3M4O B;  3BVM A;  3SI8 A;  2YRX A;  3BAA A;  1ENF A;  4DXF A;  3RN5 A;  2H1E A;  5FLX E;  4ED6 A;  1K1S A;  2RGV A;  1L1O A;  1I3Q H;  1B7Y B;  1U4P A;  2D0O A;  4OEM B;  1YHQ A;  3JAM L;  4CHT B;  2EY5 A;  1R4P B;  2Z1C A;  4X64 Q;  1Z7T A;  5M5W H;  5LP6 F;  1HH2 P;  3MA2 B;  4IFD J;  1N32 L;  4N9T A;  2E2J H;  2NVX A;  4HIM A;  3M9N B;  5CA1 F;  4RAZ A;  1S03 G;  3VYT A;  4ED3 A;  4ED8 A;  1OXX K;  1MJE A;  3RBD A;  1A15 A;  2F0L A;  5M3M G;  4TRD A;  1IBM Q;  1O75 A;  4LMY A;  1NJI C;  3NE5 B;  5JVG 3;  1C4Q A;  4P75 A;  5M3M B;  4YJ2 F;  1EL0 A;  2UXB H;  1ICW A;  4Q44 A;  1JT8 A;  4K5X A;  1Y8P B;  3SK5 A;  4IWX A;  1ET9 A;  4XQJ A;  1EY5 A;  1PZI D;  1K8A C;  2DGY A;  4QB4 A;  3I4N H;  4MA5 A;  3KHG A;  5A35 A;  1D6E C;  3I4O A;  1K8M A;  1B44 D;  3RF2 A;  3VA5 A;  1VQ5 A;  4APV A;  5LL6 S;  2F0U A;  2W9C A;  3D31 A;  1N56 A;  4F4W A;  4A3I H;  2A6E D;  4IFD H;  3Q8Q B;  2VQE H;  4L63 B;  4LFC Q;  4JI5 H;  4DK0 A;  1XTD A;  3QZ7 A;  1HA6 A;  2TSS A;  4F7X A;  2N8N A;  2ID0 A;  2HVQ A;  1TT2 A;  3N8D A;  3HOW G;  2E2I A;  4NXM L;  3GTJ B;  3TZU A;  1AN7 A;  1CKO A;  4NXN Q;  3JAM c;  5C44 H;  1U4L A;  2IL8 A;  2QA4 A;  4RUC A;  2NU6 B;  2EE1 A;  3HXL A;  3JRW A;  4RZR A;  1KNA A;  1PH4 A;  3BVG A;  4IO9 A;  3HOW B;  1XMQ Q;  1CFM A;  4IZO A;  4UCO A;  3PV0 A;  4QWC A;  4JV2 A;  1EFI D;  2JQO A;  3PR5 B;  3ULL A;  1I3Q A;  3Q0A A;  4UFZ A;  4DR1 Q;  1R4Q B;  1O7Y A;  1PLF A;  5DG7 A;  1K83 H;  2GA4 B;  2AUK A;  3OTO Q;  1TS2 A;  3DWA A;  2IPK D;  4DR7 H;  4X65 L;  4QQB X;  1F9Q A;  3PUX A;  4J9P A;  1PXU A;  4BWG B;  3BYY B;  1SYD A;  1N8R C;  5I4D A;  5KT4 A;  2HCI A;  1FNU A;  1TWA H;  1TWF H;  3KOJ A;  3Q8R B;  4H44 C;  4HED A;  1N32 Q;  2ES2 A;  1LTL A;  4MV8 A;  1AE3 A;  1KDB A;  3BAB A;  1BCP F;  3GTK A;  3CPW A;  3J81 i;  1WTV A;  2UUA H;  1SXT A;  3KF8 B;  1SNC A;  5F2D A;  5FLM G;  1N33 L;  4MHE A;  2X6G A;  1VQE A;  3J81 W;  2JEG A;  3UDF A;  5IT9 W;  4FS2 A;  1EZ8 A;  1KHI A;  4YY3 H;  1EWI A;  1EIH A;  1JDB B;  4DR6 H;  2AUJ D;  4X3S A;  1TXY A;  3TQ1 A;  4LF5 H;  1EYD A;  4CKC A;  1V1Q A;  1B04 A;  2F0J A;  2JEA I;  5KYI A;  3MR5 A;  1XPR A;  4QJF A;  4BBR H;  1LT4 D;  4DF7 A;  5KRU A;  2AGP A;  1FJG Q;  5C4H A;  2B2W C;  2QCP X;  3FPP A;  4MV4 A;  2JA7 H;  2Z8L A;  4R9W A;  2NVY H;  1HJP A;  3GTJ H;  4DV1 H;  4FS1 A;  5KFY A;  4K8J A;  2KHI A;  3I72 A;  5EPL A;  3U9S A;  4TQR A;  3HOW H;  4OEL B;  1IZ6 A;  1HZA A;  4NXM Q;  4KTA A;  2F4V L;  2VPQ A;  2EPB A;  3AFQ A;  3UI2 A;  5KFD A;  4RGN A;  2NUA B;  3MXU A;  4TVA B;  2FLL A;  3GTO B;  1AW7 A;  3CAM A;  1I94 Q;  2OTL A;  1PRT D;  1S5E D;  3DHQ A;  5IGG A;  2VB3 X;  1UNS A;  2PYK A;  4IUT A;  2CCZ A;  4YR2 A;  3HGB A;  4CKE A;  1VMP A;  3TS0 A;  2HDL A;  5CMD A;  4X65 Q;  3VPB A;  2K5Q A;  2F0N A;  1ZHQ A;  2P0A A;  4EFB A;  3VPD A;  4JBM A;  4DV5 L;  2W6Z A;  1UE7 A;  4RZQ A;  1WCM H;  3ER0 A;  3T5H A;  1GHK A;  2XCA A;  4O42 A;  1SEI A;  2RCN A;  2C2E A;  4F4X A;  3MAQ A;  2QDB A;  4WOR A;  3A8J E;  4QW8 A;  5C0X G;  3G48 A;  4A4I A;  1GUW A;  3NXW A;  5FO8 B;  1LTA D;  3DWQ A;  1KDA A;  4Y52 H;  1I7N A;  1DYQ A;  1N33 Q;  3RLO A;  3CKI B;  4LF6 L;  4BBS H;  3RTX A;  4O4L F;  2R61 A;  5E7N A;  2E2D C;  3J80 W;  3M3Y B;  3PIO A;  5M3F H;  4HN7 A;  2ZDH A;  4JI8 H;  1L1O C;  3V4S A;  2JA7 A;  4B9X A;  3I4M G;  4RGT A;  3H4D A;  4FXD A;  3GTJ A;  1AEX A;  4FXK C;  2F0G A;  1DD2 A;  1VBH A;  2XNA C;  1X9N A;  3FHW A;  1B33 N;  3I4M B;  1VQH A;  3A56 A;  3AYH B;  4IUR A;  1G91 A;  4P74 A;  4PG3 A;  4OO1 G;  3S24 A;  3T1Y H;  2LXJ A;  2WV6 D;  3PW4 A;  1TWC B;  3A0J A;  4R4O A;  1Q82 C;  2UU9 H;  4DNI A;  2QIL A;  3T5K A;  1JOK A;  2XN9 C;  3D0F A;  3ETJ A;  3E3X A;  1B4O A;  1CZG A;  1GYF A;  4ECT A;  3V05 A;  4FO2 A;  2ZM6 H;  4ECZ A;  4L5R C;  3DWP A;  5LMU H;  2F4V Q;  1GD7 A;  3RZD H;  1J5E L;  3S1Q B;  5C1O A;  5CB4 F;  3BQ1 A;  5EKI A;  1LYL A;  4RH6 A;  4EGQ A;  4KJN A;  2EZV A;  3OIP A;  1ESF A;  2NTS A;  1PH9 A;  3ORQ A;  1I4Q A;  3BJU A;  4A3L H;  1TA8 A;  4LF7 L;  1C7Y A;  4OHJ A;  1XNR H;  1KAB A;  3ERO A;  2UVV A;  4LWC A;  1WH2 A;  1C9O A;  1LTR D;  2F3V A;  3BU2 A;  4HTH A;  1Q3L A;  1ULZ A;  3I73 A;  5LXT F;  2UXC H;  1RJR A;  1RCV D;  2PMZ B;  4GKJ L;  4RAU C;  4DR2 H;  2J9G A;  4DV5 Q;  1SE2 A;  2RBM A;  2RQX A;  4HID A;  3RB4 A;  2DNC A;  4C5B A;  2ASD A;  5IGF A;  2KCT A;  1PH7 A;  4A3C G;  1UC8 A;  2JA8 G;  2K03 A;  3KLS X;  2AQ2 B;  5L1J A;  4IFD I;  4EBE A;  2N78 A;  4RGM A;  2Q2T A;  2ZJQ A;  2PQE A;  4B3S L;  2JA8 B;  1B50 A;  4R8U A;  5IOD A;  4AQY H;  2JYO A;  1PDQ A;  1BBU A;  1DGS A;  1L2F A;  4P72 A;  5JEA J;  4YHH H;  1LO5 D;  4QIW B;  1IYU A;  2PNH A;  2V59 A;  4LF6 Q;  2FLP A;  4RFB A;  5IYD G;  3MFG A;  1CTM A;  2E74 C;  4DXG A;  4QUC A;  1VQ8 A;  3J7A 5;  3OOC A;  4KLK A;  4Q8F A;  3GQC A;  2HHH H;  2ICE C;  4OX9 L;  4I50 F;  1ET6 A;  1TWC H;  3KAK A;  4EGV A;  3HBL A;  3G4S A;  4Q0F A;  1RHP A;  2LY7 A;  2B63 H;  1F77 A;  1TQO A;  4BA2 I;  4JI0 H;  3GTO A;  1WTW A;  4Q0Y A;  3CD6 A;  2IMW P;  1E1O A;  2BH8 A;  1Q8K A;  3RZO B;  3PW2 A;  4O2B F;  1JB3 A;  5GAG C;  1MGS A;  3AU7 A;  4EYI B;  4E4T A;  2SEB D;  4G7Z C;  2NU9 B;  4J9O A;  1RYS A;  1R9T B;  5KG5 A;  3NTH A;  1ZYR C;  5JEA H;  3J81 j;  1N34 L;  1E4F T;  1VQB A;  1BOS A;  3IG0 A;  5KFJ A;  4DU9 A;  4QCL A;  5LMN H;  5EPK A;  5EKL A;  1CA5 A;  2JP1 A;  3CCV A;  4DV3 H;  4HJ8 A;  2WB1 A;  1J5E Q;  3CCU A;  2XRQ D;  1TKW B;  3TQT A;  3K58 A;  1IKM A;  5KT7 A;  4A3J H;  4KD4 A;  1AUX A;  4EFE A;  3OWF A;  4MTK A;  3FRP B;  1HCZ A;  3K5I A;  4A3D B;  4I55 F;  3H0G B;  5JQW A;  1GOZ A;  4UY8 C;  2AWN A;  4WJ4 A;  3JAM W;  1CK1 A;  4ZOL F;  3CXC A;  1JIH A;  4JV1 A;  3DM1 A;  3HOY G;  4GKJ Q;  4ECY A;  3I91 A;  4WJ3 M;  1G6Z A;  4MN3 A;  3UDG A;  1I7L A;  1I4X A;  1WSC A;  2FK1 A;  1GM5 A;  3HOY B;  1HTP A;  4UPA A;  3SDZ A;  2EXD A;  3PW0 A;  2YW2 A;  3MXN B;  4K8I A;  5C5J A;  1QOH A;  4ME3 A;  2OWO A;  1CSP A;  2FMA A;  4DV2 L;  1SYC A;  5IYB H;  2JA5 H;  4B3S Q;  3AFP A;  4EQN A;  1K9M C;  1TWC A;  3PIP A;  1WD1 A;  1KEE A;  4GKK H;  3KLS A;  4PZ8 A;  3A7A B;  3TBI B;  4UP7 A;  1S5C D;  2B63 A;  2ZJP A;  1SYG A;  2AKW B;  1AUV A;  4GOP C;  3S14 B;  2XVS A;  3OW7 A;  2DZD A;  1VQM A;  4BXX H;  2BDN A;  4OX9 Q;  2KSW A;  2WB1 E;  4KN4 C;  1YNX A;  1EEI D;  1SYF A;  5EDW A;  2JA9 A;  3RUZ A;  4ZQ3 A;  1Z6H A;  1B1Z A;  4ZUI A;  1I6H H;  2PCF B;  3S1R H;  3C46 A;  3H6M A;  3EPG A;  2FFK B;  5KFH A;  4LF4 L;  3L9A X;  1L0X B;  3HOZ H;  1LTB D;  4OL7 A;  3F2C A;  2JEF A;  3C2P A;  4G3I A;  4TKO B;  4X66 L;  5BMV F;  3PVX A;  5EPJ A;  2G5D A;  1N34 Q;  1ICF B;  3M4Q A;  2HT1 A;  2K52 A;  4B3R L;  3GTM H;  3A7L A;  3JSN A;  5IGD A;  2PMZ A;  2BOS A;  4K6D A;  5FPR A;  3N6X A;  2PPB C;  2ENB A;  4AIM A;  1AN8 A;  3J7Y W;  1X65 A;  3AQQ A;  4JVZ A;  1KTK A;  2CWP A;  4HCS A;  3J81 L;  4WBN F;  2CKZ B;  4X6A H;  5IT9 L;  1LAC A;  2BCO A;  3HOX H;  1VQ4 A;  5M5X H;  4DV0 H;  2MO1 A;  1JE5 A;  4HIO A;  5T1I A;  5E4W C;  3V96 A;  4EBD A;  5L1I A;  4ECQ A;  2B29 A;  5HY6 A;  4WRD A;  4X3T A;  1JOR A;  3N44 B;  2CQO A;  4B08 A;  1Q12 A;  1SND A;  3S16 B;  3KLR A;  3T51 B;  4HQ6 A;  1UEB A;  3SK4 A;  3NEN A;  2UUC L;  1U9R A;  1SFO H;  1JJG A;  2YZM A;  3W2D A;  5FPO A;  4DN4 M;  2AMC B;  2R7M A;  4CDD C;  4A3M G;  3G6X A;  3GQB A;  1JJC B;  1KBL A;  2O2L D;  4LFA L;  2VUG A;  2B2V C;  4YB8 B;  4R8I A;  1BCP C;  2K4K A;  5T1G A;  1GLV A;  2NZ1 D;  3OSN A;  4DV2 Q;  3K7A H;  2YS6 A;  1EU3 A;  2Q2H A;  3A5Z B;  3NEL A;  2BQR A;  1ASY A;  4C3J G;  3Q8P B;  3T4A C;  5J22 A;  1HZC A;  2JEB I;  2Y0S G;  3F8T A;  3MHB A;  1R9T A;  2RGR A;  1F2Z A;  1JE4 A;  1X32 A;  2PMZ E;  3MXP A;  4LAA A;  3PF5 A;  1I6U A;  4C3J B;  5C6A A;  1VQN A;  4XT1 B;  2Y0S B;  2IHF A;  3J81 c;  2OT2 A;  2CW7 A;  5M9O A;  1PK8 A;  2V58 A;  5IT9 c;  1QJO A;  4KHZ A;  1SLJ A;  4DFA A;  2XGP A;  4R4I A;  2K50 A;  5IE8 A;  1DZ1 A;  1KJJ A;  1DJR D;  4OIK A;  4HMI A;  2D9U A;  4IAL A;  5KT5 A;  4Q8E A;  1LAB A;  2FJZ A;  1RK6 A;  3OMG A;  4LF4 Q;  1GJX A;  2YZN A;  5J2U F;  1G51 A;  1NNX A;  3HOV H;  3GTL B;  3S15 H;  4BY7 G;  4X66 Q;  4QIW E;  3KUP A;  4OWX B;  4UCT A;  4L6T B;  4DPG A;  2FIN B;  4B3T H;  3K0Y A;  4RCN A;  3I7F A;  5JJK A;  2N49 A;  3N6R A;  4B3R Q;  1CSQ A;  2ZTE A;  5T14 A;  3NBI A;  4BY1 H;  4BY7 B;  1NUC A;  1O7Z A;  1LT5 D;  4ZLT F;  1K28 A;  4A2A A;  3V6K A;  4ZCK A;  4DA2 A;  5C3E G;  3X3N A;  1Y1V G;  2A74 C;  3J80 L;  5KFS A;  2XCP A;  3MXN A;  1F2M A;  1SRU A;  5FO7 B;  4HJ9 A;  1YIT A;  2W6Q A;  1SFO A;  4FBU A;  4P73 A;  5C3E B;  1ZYR D;  3O13 A;  1KLU D;  3CQZ B;  1S68 A;  1Y1V B;  3I70 A;  3GV3 A;  3CCJ A;  4A3F B;  3NTI A;  1EQT A;  3ERQ A;  2R93 G;  1FGU A;  2IBK A;  5GON F;  1I5F A;  4XYL B;  2OF1 A;  4L1K A;  1PVO A;  1UEA B;  2UUC Q;  4E6I A;  3GTP B;  1EYC A;  5FJ8 G;  4A3M H;  5KFL A;  4M1U B;  2Z6K C;  3KF6 B;  4C3H H;  2VQF H;  3RAQ A;  4FF3 A;  4LFA Q;  3EYY A;  3M4Y A;  1TU2 B;  4JBJ A;  3TZD A;  4LF9 L;  4UCR A;  1XWE A;  1STH A;  3M9B A;  4FXG C;  5F9N A;  5EOY A;  1C48 A;  4HJ5 A;  3EFX D;  4C3J H;  1EQR A;  2JA6 G;  2W6P A;  3J7Z C;  3K5O A;  1X3Q A;  4JV5 H;  1TVX A;  5HBR B;  1RTN A;  2XWJ B;  4OIJ A;  2VUM G;  1K73 C;  3HRZ C;  3GD7 A;  5EJW A;  1ONL A;  2JA6 B;  2YS7 A;  4MV3 A;  1DV2 A;  3GV5 B;  1G29 1;  2QDL A;  3U58 A;  5CA0 F;  1BF4 A;  2AQ4 A;  1BGW A;  5D1P A;  4DV7 L;  1NY4 A;  4DUZ H;  1EY4 A;  1K3B C;  1IBL H;  5J3B A;  5ELB A;  4DAM A;  2PZT A;  4MV1 A;  2SOB A;  4HNU A;  4QL5 A;  1SNP A;  1IKL A;  4DK6 C;  2E2H H;  1CHP D;  4BY7 H;  1WI5 A;  2R7Z G;  2SCU B;  4EG0 A;  4A76 A;  1FYC A;  1GHJ A;  4MV7 A;  2F0H A;  1RD9 D;  2A6H C;  2QEJ C;  3E0J A;  5HGT A;  2IX0 A;  3K5N A;  1VKZ A;  1EY7 A;  4A3E H;  4CC5 A;  1ML0 D;  1UC9 A;  2R7Z B;  3EVQ A;  3HFZ B;  3QWN A;  4K14 A;  5GAH C;  4EEQ A;  1V4Y A;  3T16 A;  2WKD A;  4DNT B;  2WP8 J;  3G8C A;  5EWE A;  3Q1K A;  1HNW L;  1WFQ A;  1SN8 A;  3OWE B;  4J8Q A;  1Y1V H;  2E8G A;  2C35 B;  2C00 A;  4KN7 C;  4RMF A;  3OIQ A;  5I2X A;  4PNY A;  5A2Q E;  3HOU G;  3PZP A;  2FB9 A;  5KFX A;  3Q24 A;  1LT6 D;  1JKJ B;  2H4O A;  1WTQ A;  4O2A F;  4GN3 B;  2RDI A;  2DLN A;  2ASB A;  1YHB A;  4O2D A;  2R93 H;  3G6V A;  4CKB A;  4DR5 H;  2L11 A;  4EQ5 A;  4KI0 A;  1BNZ A;  4XTC S;  5DQG A;  1EYA A;  4ZRZ A;  1LV9 A;  1WTR A;  3OPO A;  4DNR B;  4C5A A;  3OUU A;  2VW9 A;  4CC6 A;  3BDO A;  2V4D A;  5EGT A;  1KC7 A;  4F4Z A;  2K04 A;  2Y0S A;  2L55 A;  1FNV A;  4JI6 H;  3J81 E;  4RB2 C;  4DR4 H;  3T1H H;  1XMQ L;  4RHR A;  5IT9 E;  1HNZ L;  4LFB L;  3PUW A;  4LF9 Q;  3IFT A;  5KFM A;  4JI4 H;  5FD6 A;  1OO9 B;  3SGI A;  5I9P A;  1TAE A;  3HB9 A;  4ECV A;  5C5L A;  2E2I H;  2B2T A;  3GTQ B;  1HHV A;  4RNN A;  5JJZ A;  2ZJR A;  5KIX A;  3GTL A;  3BQ0 A;  2IWH A;  3HS0 C;  4A3K H;  2VUM H;  4L5T A;  5KG2 A;  4IJL A;  3KYH C;  1VQ9 A;  4X64 H;  1B3Q A;  2MGS A;  5KNB A;  3IKJ A;  3IRB A;  3A5U A;  4J9M A;  2CFM A;  2E2H A;  2LXK A;  3J7A V;  1KRT A;  1BCP D;  5KFK A;  1A3V A;  4DV7 Q;  1IBM H;  4O3O A;  2UVR A;  2GPS A;  3M9O B;  1VCI A;  1JQY D;  4BWS C;  5KG7 A;  1EYG A;  2D2C C;  5EZY F;  3KBG A;  3WOE A;  5D3I B;  4A3B B;  3H91 A;  1BVS A;  1PH2 A;  1KJQ A;  1EIF A;  1STG A;  3TRZ A;  3KXY T;  4ECX A;  1Y1V A;  3E9I A;  4B3M L;  4LF8 H;  3S2D H;  4IUQ A;  5E4X A;  4NB3 A;  1NR4 A;  2W9B B;  2L1B A;  1T36 A;  4JI2 L;  1C0A A;  3CCE A;  4KY7 A;  1RJT A;  1W6J A;  1TY2 A;  3GTP A;  3GTK H;  2Y0S E;  4U6P A;  4QW9 A;  2R93 A;  4UP9 A;  1HNW Q;  3D3R A;  1X54 A;  2KEE A;  5I47 A;  1SYB A;  2F0S A;  3QO2 A;  3KF6 A;  3HOU H;  2B2Y C;  4GNX C;  4C5C A;  3K5H A;  4LFC H;  4O3S A;  3BDL A;  2F0F A;  1FJG L;  2VA2 A;  3RFC A;  2KHJ A;  1NBW A;  1B9M A;  4LNQ A;  4QY7 A;  2FLN A;  4DL6 A;  4NXN H;  4LSA A;  1A62 A;  1I50 H;  3MWY W;  1BQQ T;  3QR8 A;  2WYO A;  5KFV A;  3VR6 A;  2Z0S A;  4LK1 C;  3E5N A;  2A5H A;  2CH4 W;  4Y8V B;  1NTG A;  2J6U A;  4WJW A;  4CDE C;  4CDC C;  1YJN A;  4RHS A;  2I8C A;  2VUM A;  4HNT A;  4DR6 L;  3CVZ A;  3TP8 A;  4V19 0;  3NP8 A;  1I94 L;  1VQG A;  1HNZ Q;  4LFB Q;  3RB6 A;  3OTO H;  1GUN A;  3J80 E;  2YU9 B;  4A2B A;  3N40 P;  2DJF C;  2PZW A;  2Q2U A;  3M4O H;  5LYJ F;  2DWC A;  2K01 A;  4Q5V A;  3ONA B;  2UVW A;  1A2U A;  1RL2 A;  1WVL A;  3BVZ A;  3RJ0 A;  1FNW A;  4JBW A;  4ETS A;  4AYB G;  4RGO S;  3BZC A;  2Q8I B;  3A55 A;  2VQE Q;  1CQJ B;  4QWB A;  3GV7 B;  3DMU A;  2Z6B A;  4F4Y A;  2FMC A;  2RSN A;  1N32 H;  2R7Z A;  2K5H A;  4PDB A;  4AYB B;  1H9R A;  1WJJ A;  4K5V A;  4X3K A;  1EWH A;  3CME A;  3FDS A;  1Y1W G;  4ME6 A;  4EVO A;  5KT6 A;  1ASZ A;  2M05 A;  5M3M H;  1S97 A;  2LKV A;  3F2B A;  3I12 A;  2XGQ A;  4FM9 A;  2RVL A;  3RMH A;  1HUM A;  3W3A A;  1Y1W B;  3I8Z A;  5CGK A;  2XSC A;  1PTO B;  4B3M Q;  5DLQ E;  3KJO A;  2CWA A;  5COY A;  2YYZ A;  3CMA A;  3OMC A;  5IP7 G;  3ERS X;  3KDF B;  2OXP A;  1GO3 E;  1T9H A;  4JI2 Q;  4ABN A;  3UFX B;  3S1N B;  4F8M A;  1I50 A;  4IOC A;  2K05 A;  3R8B A;  2F0O A;  2K33 A;  2WDT A;  5KFZ A;  2I5L X;  2R7N A;  2A6H D;  4ED1 A;  3VYS A;  4WFN 3;  1SMX A;  4ZKB B;  1EUJ A;  3GTQ A;  3R5F A;  1CM9 A;  1EU4 A;  4NXM H;  2RDF A;  3CF5 A;  3KAL A;  3QIA A;  1D1K A;  5JAV A;  2R86 A;  3PN1 A;  3NWT A;  2RDJ A;  3WNZ A;  1XNQ L;  1S0M A;  4J9K A;  1TWG B;  4YCW A;  4DV6 L;  3Q23 A;  3E6Z X;  4IRD A;  4O1N A;  3S2H B;  3MEF A;  2D0P A;  2F03 A;  1Q90 A;  4DR6 Q;  1TS4 A;  1EY9 A;  1QNU A;  1VQ7 A;  3U9O A;  2VL6 A;  3KTM A;  1E3P A;  4K6L A;  1JCK B;  4P2C B;  5H80 A;  4EGJ A;  3M7G A;  3H09 A;  3I2Z A;  4I7H A;  3T1Y L;  1BR9 A;  3I56 A;  1MSG A;  2HIX A;  1WR2 A;  1EFW A;  1UE5 A;  4GZY C;  3LNN A;  4F87 A;  2AGQ A;  4JYA H;  1JJ2 A;  4DV1 Q;  3GP7 A;  3LGJ A;  4MV6 A;  1VQJ A;  2W9B A;  1BBX C;  1U4R A;  3PW7 A;  4K2K A;  4RB0 A;  1EY8 A;  1AP0 A;  1RYR A;  1PFB A;  4IWY A;  3GIK A;  3EIV A;  2GVA A;  3A8I E;  4Y7N B;  1HTL D;  5LMU L;  1PTO H;  1N33 H;  1LTI D;  1VQF A;  3CRL C;  1XX8 A;  1EQV A;  4S3S A;  2J6T A;  2V4Q A;  4XQQ A;  1T5E A;  2JXM B;  5FLM H;  2PBZ A;  2F0E A;  4DR3 H;  4B9W A;  2QGQ A;  1HR0 W;  4J9N A;  3DLL A;  1H9S B;  4QMG A;  2BQU A;  4GN5 A;  3K81 C;  3PGZ A;  2UUB L;  5BR8 L;  4IUN A;  1JB7 A;  1SMY C;  4ECR A;  1LLR D;  3KHH A;  1KJI A;  2EYP A;  3JAM E;  3CC4 A;  5IP9 G;  1DIK A;  2HQL A;  3BDC A;  2E75 C;  5CC4 A;  4OWW B;  4LH6 A;  1GSA A;  1WOC A;  4A3G B;  1VQI A;  1AE2 A;  1STY A;  2OH2 A;  1B70 B;  2ZDQ A;  4HYK A;  1KD1 C;  4MTD A;  3M85 A;  4MA0 A;  3WWV A;  3H94 A;  4J1M A;  4IUV A;  3GTO H;  5COR A;  3G6E A;  1XNQ Q;  5IYZ F;  5KFC A;  4DV6 Q;  4MV9 A;  1E2W A;  2TMP A;  4AYB A;  1QB5 D;  2CHB D;  1QIL A;  3DUZ A;  4EEY A;  3H4B A;  4LJZ C;  3IFD A;  5M5Y B;  4C2M B;  1CE8 A;  1MJC A;  2HCC A;  4IRK A;  4IR1 A;  4JI0 L;  2F0D A;  5GAE C;  1SJE D;  2EDG A;  4IPD A;  4ZKC B;  5KFU A;  1Y1W A;  4DV5 H;  3T1Y Q;  2EIF A;  1NMG A;  1SE3 A;  3KF8 A;  2VXW A;  1B8A A;  4XDX A;  1QZG A;  2NN6 G;  4IN3 A;  4YR3 A;  4FDB A;  2XTI A;  5C1P A;  2VOB A;  1M6V A;  5ELE A;  3Q8S B;  3TS2 A;  3M7N A;  4HJ7 A;  4I4T F;  5G3L D;  3KDF A;  2KED A;  1NAP A;  2NVQ B;  1CI3 M;  5KG6 A;  4I7A A;  1JR0 D;  5IGC A;  1PHJ A;  1J6Q A;  1NSN S;  1QG7 A;  4DAY B;  5LMU Q;  2FPG B;  5C0X H;  3RBE A;  3W5O A;  4LF6 H;  4GLA C;  2AU0 A;  3M3Y H;  1PRT B;  1G2S A;  1V43 A;  4UAI A;  1SDF A;  3SE0 A;  3K59 A;  4JI7 L;  4RKL A;  2DPI A;  4X62 L;  4DR5 Q;  5HUR A;  4KHP L;  1GGO A;  1FL0 A;  1CZW A;  3AMU A;  5FKA C;  5KGU A;  1LTS D;  1O7L A;  3MVV A;  2L12 A;  2EOT A;  2HVR A;  1K8O A;  5CV9 A;  4U67 3;  3I4M H;  5FD5 A;  1SYE A;  2BDO A;  4P71 A;  2UUB Q;  5BR8 Q;  2UXC Q;  4AYB E;  1TWG A;  3MTS A;  3H20 A;  2J6S A;  1KNE A;  1ENA A;  3EA6 A;  1S4Z A;  3K80 C;  1G8Z D;  1IW7 C;  1YBY A;  4NPS A;  4OO1 H;  3MWM A;  1RKN A;  1T5X D;  3DXJ C;  1RK5 A;  3PO3 G;  5JUM A;  1GUS A;  1SAP A;  2K5N A;  1B3A A;  2QW7 A;  2YV5 A;  2R3Z A;  1YNJ C;  4H13 C;  2WIN B;  1IL2 A;  4QGU A;  3T5L A;  3PO3 B;  2F0Q A;  1JLL B;  3S1Q H;  1XDN A;  2K1B A;  3SK6 A;  4MTE A;  4IR9 A;  2MPM A;  4ZYS A;  1S5F D;  1MZB A;  1H95 A;  5D65 A;  1ENC A;  4LF7 H;  1UUP A;  5I6Y A;  2HHH Q;  4A3D G;  3H0G G;  5KG1 A;  2XRS D;  4NW2 A;  1KIX A;  2BQ3 A;  4YBZ B;  3B6Y A;  4LW1 A;  3R2I A;  1STA A;  2PW7 A;  2F0W A;  2L4N A;  3I4L A;  4XT3 B;  4JI0 Q;  4YWK A;  1KXL A;  2C22 A;  4GKJ H;  2CZG A;  1E24 A;  1I4G A;  1I4H A;  3URY A;  3AEV A;  2ZDG A;  4O3R A;  2RF4 A;  4O3Q A;  4UDU C;  5KG4 A;  2ICI A;  2NVT B;  3M4P A;  4RAY A;  1D8L A;  3SXH A;  4A3C H;  2JA8 H;  4B3S H;  4GNX B;  3RUP A;  2VA3 A;  3R2T A;  2AGO A;  4HAE A;  2KBN A;  2K5W A;  2NBF A;  4G4K A;  2UXD L;  1H9M A;  2MJ8 A;  2M00 A;  5D1O B;  5G3L F;  1YI2 A;  2HD3 A;  3RGX A;  4JI7 Q;  2YTX A;  4RNO A;  5ELD A;  1JX4 A;  4X62 Q;  3MFI A;  1A8V A;  4KHP Q;  1HPC A;  4EX5 A;  5IYD H;  4OX9 H;  4CDF C;  3RLF A;  1V1O A;  1EOV A;  1EHI A;  2MCT A;  3IL8 A;  3U9T A;  2DJG C;  2UVU A;  4C3I G;  1CA6 A;  3TSS A;  5C3W A;  2NZH A;  4IUU A;  5JOB A;  1PFM A;  2MO0 A;  3V6J A;  3CCM A;  3PO2 G;  2EYJ A;  1OXT A;  1OXU A;  3RZO H;  4C3I B;  3V6H A;  4FU0 A;  3WDN A;  2R92 G;  2A73 B;  1GSH A;  3PO2 B;  1R9T H;  3EQL C;  5KFP A;  4C2M A;  3KHR A;  1JC7 A;  2FPI B;  1K8G A;  2R6F A;  3QJY A;  2R92 B;  5C8Y F;  2WAC A;  4YQW A;  5IYC G;  5TSS A;  5CYU A;  3FPU B;  3K3V A;  1W93 A;  1SMY D;  4N8X 1;  3F2D A;  2I87 A;  1WTH A;  1VS0 A;  3K0X A;  2W8L A;  4R1J A;  5JVL A;  3R3O A;  2N88 A;  2IP4 A;  1IOW A;  2E5L L;  1DON A;  4A3D H;  2FP4 B;  1OXS C;  3H0G H;  4ME5 A;  3IAY A;  4LSX A;  3NQT A;  3K7U C;  4JCV E;  2K6A A;  1T3N A;  1VQK A;  1V8Q A;  3UQ8 A;  2R7F A;  4OON A;  1PH6 A;  1PZK D;  3I55 A;  1PMR A;  1Q7Y C;  3U4V A;  2FPP B;  4J9Q A;  1VDZ A;  4HNV A;  1IOV A;  4ZAI A;  2OQ0 A;  4UCV A;  4RU9 A;  4QIW A;  4JBK A;  3HOY H;  4JOI A;  1C8C A;  1Z47 A;  3KFU A;  1L0W A;  4JI1 L;  4DV2 H;  1PYS B;  3OHX C;  4NDX A;  3JRX A;  2FJ2 A;  1IYV A;  1LM0 A;  3NTK A;  5C4X G;  4GS3 A;  4I65 A;  2UXD Q;  4RCO A;  3VR5 A;  1F2L A;  3H40 A;  1A2T A;  3S14 H;  1HRJ A;  1N36 H;  5C4X B;  2RHQ B;  4O4H F;  2RSO A;  2DPJ A;  2J7Z A;  5ELO A;  5FLX L;  4DK3 C;  4J9R A;  3GTG B;  5ISR A;  1FGB D;  3N42 B;  4Z9C B;  1E22 A;  1XMO L;  3JSL A;  2P5Z X;  5KFA A;  5IWA L;  2PN1 A;  4LF4 H;  3MZ5 A;  1HNX L;  2HGS A;  3FKI G;  4X66 H;  3MXG A;  2R8G A;  5C4J B;  2LSS A;  2W8K A;  4RWS C;  4HCE A;  2B2U A;  4IZ8 A;  2LFN A;  3FKI B;  4FF2 A;  3C1E A;  3F2U A;  3H0G A;  4A93 B;  4IJH A;  3RR5 A;  2V1C C;  3TII A;  3ULP A;  4Q43 A;  1Q86 C;  1B6R A;  4BA1 I;  2F0M A;  2K28 A;  4DK1 A;  1QZH A;  4KJO A;  2R7L A;  2WAQ G;  1M7J A;  1IW7 D;  1VMC A;  5C3X A;  1QVF A;  5C0X I;  1S0O A;  2E5L Q;  3PSI A;  1HR0 L;  3S1M B;  1VQC A;  4JI3 L;  4FF4 A;  3S17 B;  2DY8 A;  2WAQ B;  1O80 A;  1Y8N B;  1YNJ D;  4A3F G;  1PH8 A;  3ND8 A;  4DUZ L;  1D7Q A;  3S16 H;  4K0K L;  2NU8 B;  3DEP A;  5D1O A;  3D6C A;  3PF4 A;  1IBK H;  4KD3 A;  3D4D A;  3HKZ G;  2UUC H;  4RNM A;  1KAA A;  5DQI A;  4HSV A;  4TQU S;  5FLX c;  5CBA E;  1SNQ A;  1Y69 U;  3MC0 B;  2O5I C;  2CW0 C;  2IA6 A;  3L2P A;  1L1O B;  2XD4 A;  3HKZ B;  4HMJ A;  4EBC A;  3VR4 A;  1X3G A;  2E76 C;  4ZK9 B;  4LFA H;  1BO0 A;  3G6Y A;  4JI1 Q;  2YRW A;  4O0A A;  2NVX B;  1VQL A;  3PCO B;  4OO1 I;  4ED2 A;  4XZ3 B;  5L1L A;  5EWF A;  3ZJY C;  3OW2 A;  5J1Z A;  2EXZ A;  5D3D A;  3OSP A;  1IL8 A;  2Z4H A;  3MJF A;  1RJQ A;  2Z9H A;  3W1G A;  3GV6 A;  5KG3 A;  2HDM A;  2W70 A;  5CV5 A;  2NB0 A;  4N9P A;  1QNK A;  4ODG A;  2B3G A;  2BA1 A;  1H9K A;  5JPM C;  3FDT A;  1VQO A;  5AFW A;  3CC2 A;  1GVP A;  2DNE A;  3PUV A;  4J15 A;  5FO9 B;  2EYO A;  3OHB A;  1HQR D;  1KDC A;  4DV4 L;  1XMO Q;  5C4J H;  5IWA Q;  1QWY A;  2A68 C;  2GVB A;  4MTN A;  3NPP A;  1HNX Q;  1KL9 A;  4MIU A;  1M1K C;  5HV6 A;  1F2Y A;  3GTL H;  4M7E A;  2GLT A;  4NP5 A;  3D6W A;  1S5B D;  3ORR A;  4JI6 L;  4QUF A;  4LUZ A;  3T1H L;  4DAP A;  1BBW A;  5K2M A;  2F0T A;  4J0M A;  2ZXR A;  4H7B A;  5KEE A;  1PZJ D;  1WTX A;  2ZTD A;  5DQH A;  5EQ0 A;  4PMC A;  4MNO A;  1B6S A;  3RN2 A;  4LH7 A;  4DUY L;  2ALZ A;  2WFW A;  2JJQ A;  2VS1 A;  5CV7 A;  1UAP A;  1BUV T;  3RB3 A;  5C3E H;  3CQZ H;  1FVI A;  5LL6 X;  1HR0 Q;  2A8V A;  4JI3 Q;  3C0F B;  5NUC A;  4A3F H;  1PFN A;  3C1F A;  4LUO A;  3MFH A;  2I07 B;  2B2W A;  4DUZ Q;  2B8F A;  4DKA C;  4FVM A;  1EQQ A;  4K0K Q;  2EY6 A;  5D14 A;  1KC8 C;  1VBG A;  3P75 A;  4ZHQ F;  5K36 G;  2I80 A;  1Y8O B;  1NMF A;  5C4Z A;  2E2J B;  2F0K A;  3GTP H;  3TDQ A;  1S72 A;  3MWD A;  4UCS A;  4IHJ F;  1WTP A;  1GUO A;  2X69 A;  3T53 B;  4LF8 L;  5FJ8 H;  4JUZ A;  3UE1 A;  4R4C A;  4LF9 H;  3I4N G;  2UXB L;  1P8L A;  2EVB A;  3QG1 A;  3MR3 A;  3V4Z A;  2K75 A;  5BN3 A;  4ECU A;  1DV1 A;  3VMM A;  3K3P A;  3LWU A;  1EUC B;  4DL3 A;  3I4N B;  1P16 A;  5DLG A;  2QK4 A;  4RA8 A;  1PV4 A;  1NE3 A;  2JA6 H;  1X6O A;  2M2L A;  3PIO 3;  4IFD G;  1N48 A;  3FKI A;  4ZQI A;  2QF7 A;  5H1S E;  3GIQ A;  4A3I B;  5DG8 A;  2VQE L;  4DV7 H;  2QKI C;  1O7I A;  4CJ1 B;  1CS0 A;  4JI5 L;  4ZI7 F;  1L0Y B;  4DV4 Q;  1KJ8 A;  4DL7 A;  1PH1 A;  5C44 G;  4IUP A;  1U0L A;  4A3B G;  3OSO A;  5KFB A;  1X3E A;  4YWL A;  5C44 B;  3L3O C;  2HUG A;  3MEH A;  2FHT A;  1PYW D;  1PTO D;  2R84 A;  3CP0 A;  4JI6 Q;  2WAQ A;  2NUC A;  2VNU D;  3CCL A;  1B9N A;  2K5V A;  3T1H Q;  2R7Z H;  2OCE A;  2EYF A;  4YCU A;  3CQZ A;  1HQM C;  2ATL A;  3UDX A;  3EJI A; 
#chains in the Genus database with same CATH homology
 1IBL L;  3H3V H;  4A3J H;  3EIV A;  2GVA A;  4DUY Q;  4DR7 L;  1S3O A;  3G71 A;  5LMU L;  5ELN A;  3DM3 A;  1E1T A;  1VQF A;  4A3E G;  1VQ6 A;  2IY5 B;  4UY8 C;  2AWN A;  4WJ4 A;  3CXC A;  4YCV A;  4GLV B;  4B3T Q;  1AH9 A;  3RLN A;  5FLM H;  3HOY G;  4GKJ Q;  5GRO A;  4WJ3 M;  2GN5 A;  4UP8 A;  2QGQ A;  3UDG A;  1HR0 W;  2L15 A;  3DLL A;  1X55 A;  5C4X H;  1PYB A;  2VY3 A;  3STB C;  3VDY A;  1GM5 A;  4GN5 A;  3K81 C;  3PGZ A;  4UPA A;  2EXD A;  2NZO A;  3MXN B;  3Q8D A;  1A63 A;  3PUZ A;  2R6G A;  5BR8 L;  2UUB L;  2Q2I A;  1JB7 A;  4GOP B;  4L5Q A;  3GTG H;  4ME3 A;  2UUA L;  1CSP A;  3EN2 A;  1LUZ A;  2OWO A;  4DV2 L;  4ALP A;  4LF8 Q;  5IYB H;  4A75 A;  2JA5 H;  4LUV A;  3AFP A;  4H02 A;  5IP9 G;  1K9M C;  3CC4 A;  4B3S Q;  1IBK Q;  2HQL A;  2UXB Q;  3PIP A;  4OWW B;  2MFI A;  4IPG A;  3A74 A;  4PZ8 A;  1WOC A;  4YY3 L;  4UP7 A;  1KRS A;  1VQI A;  3GTQ H;  1SE8 A;  1Y14 B;  1AE2 A;  2ZJP A;  4BBR G;  3E0E A;  1UE6 A;  1VQD A;  2MNA A;  2AKW B;  2WAQ E;  4LF5 L;  1BKB A;  1WYD A;  4AH6 A;  3NBH B;  4GOP C;  1B70 B;  1KD1 C;  1VQM A;  3M85 A;  1E7Z A;  3FKI H;  4BXX H;  4OX9 Q;  2JA7 G;  2WB1 E;  3WWV A;  1X56 A;  1N9W A;  1YNX A;  3GTO H;  3U50 C;  3G6E A;  1XNQ Q;  4A93 H;  3GDE A;  2JA9 A;  4DV6 Q;  2VQF Q;  1I6H H;  3CCR A;  2NN6 I;  4DR4 L;  3S1R H;  4JI4 L;  2ALY B;  3HKZ E;  4DV1 L;  1HZB A;  4JI5 Q;  4LF4 L;  3HOZ H;  4A3K G;  3F2C A;  1Q46 A;  4A3B H;  4POG A;  3L7Z C;  3S1M H;  4X66 L;  1MJC A;  3S17 H;  4JV5 Q;  3CW2 C;  1N34 Q;  4JI0 L;  5GAE C;  3M4Q A;  5IY0 A;  2HT1 A;  2K52 A;  4IPD A;  4B3R L;  3GTM H;  1CKN A;  3J80 c;  4PZ7 A;  4X64 L;  3T1Y Q;  1XPO A;  2EIF A;  1NMG A;  2I5H A;  1QZG A;  1B8A A;  2JK8 A;  2NN6 G;  4AIM A;  4FDB A;  2PQA A;  1X65 A;  3AQQ A;  2XTI A;  1QUQ A;  2CWP A;  3TS2 A;  3M7N A;  2CKZ B;  4HJ7 A;  1IBM L;  4X6A H;  3KDF A;  3HOX H;  1VQ4 A;  1IBL Q;  5M5X H;  2MO1 A;  1JE5 A;  3UDI A;  4HIO A;  1PHJ A;  3NEM A;  2B29 A;  5HY6 A;  4DR7 Q;  1J6Q A;  5LMN W;  1YJW A;  5LMU Q;  4DAY B;  2NVX H;  1WCM G;  1QVG A;  3W5O A;  1IYJ B;  2CQO A;  4JYA L;  1Q12 A;  4GLA C;  2I0Q A;  3M3Y H;  1V43 A;  4JI7 L;  1UEB A;  2AHO B;  2H5X A;  4X62 L;  3NEN A;  4DR5 Q;  4KHP L;  1FL0 A;  2UUC L;  1SFO H;  1JJG A;  4HIK A;  2AMC B;  4HJA A;  4A3M G;  2RHS B;  1A0I A;  2OTJ A;  3CCS A;  1JJC B;  1Q1B A;  3I4M H;  2R7D A;  4BBS G;  4LFA L;  4P71 A;  2UUB Q;  3KJP A;  1MIU A;  5BR8 Q;  4AYB E;  4A3I G;  2UXC Q;  4LFC L;  2K4K A;  5M3F G;  2UUA Q;  4GN4 B;  3ICE A;  4DV2 Q;  4DR3 L;  2BH2 A;  3F1Z A;  4JC0 A;  3K7A H;  2YU9 H;  3K80 C;  2Q2H A;  4IPH A;  4JOI C;  1HZ9 A;  3A5Z B;  3NEL A;  1YBY A;  1X3F A;  4NPS A;  5HGQ A;  1ASY A;  5AJ3 L;  4JI8 L;  4YY3 Q;  1HZC A;  4NXN L;  2JEB I;  2Y0S G;  3F8T A;  3PO3 G;  2K5N A;  2XGT A;  2YV5 A;  1YEZ A;  3PF5 A;  2PMZ E;  4LF5 Q;  2ZTC A;  1IL2 A;  4QGU A;  1VQN A;  2IHF A;  3J81 c;  3S1Q H;  4PZ6 A;  5IT9 c;  4KHZ A;  1SLJ A;  4R4I A;  2K50 A;  5IE8 A;  4DR1 L;  1H95 A;  4DR4 Q;  1W2B A;  1PFS A;  5GQO A;  3OTO L;  2UU9 L;  4JI4 Q;  3PUY A;  2KEN A;  4LF4 Q;  2HHH Q;  4A3D G;  3H0G G;  1G51 A;  3HOV H;  3RN5 A;  1KIX A;  3S15 H;  4BY7 G;  4X66 Q;  4QIW E;  4OWX B;  3B6Y A;  2ZM6 L;  4LW1 A;  1L1O A;  4DPG A;  1Y1W H;  1I3Q H;  1B7Y B;  3I7F A;  4JI0 Q;  5JJK A;  2D0O A;  2N49 A;  4YWK A;  1YHQ A;  4B3R Q;  1KXL A;  1E24 A;  1CSQ A;  2ZTE A;  4BY1 H;  4X64 Q;  3AEV A;  5M5W H;  4A3L G;  1HH2 P;  4IFD J;  1N32 L;  2E2J H;  4HIM A;  1XJV A;  2RF4 A;  3TQY A;  1OXX K;  1MJE A;  3BZK A;  5M3M G;  4DR5 L;  5C3E G;  2WB1 G;  1Q1E A;  3CCQ A;  1IBM Q;  3S1N H;  1Y1V G;  3M4P A;  3RNU A;  1NJI C;  1XNR L;  1D8L A;  5IP7 H;  1SRU A;  4A3C H;  4HJ9 A;  1YIT A;  4GOP A;  4L5S A;  4GNX B;  2JA8 H;  4P75 A;  4P73 A;  2KBN A;  2UXC L;  1JT8 A;  2UXD L;  3CCJ A;  4JYA Q;  4DR2 L;  1YI2 A;  1K8A C;  4A3G G;  2R93 G;  2DGY A;  1FGU A;  3I4N H;  3I4O A;  2YTX A;  1I5F A;  4JI7 Q;  4X62 Q;  1A8V A;  4KHP Q;  1VQ5 A;  4APV A;  4EX5 A;  1PVO A;  2UUC Q;  5IYD H;  5FJ8 G;  3RLF A;  4A3M H;  3D31 A;  1EOV A;  3H15 A;  3J80 i;  2Z6K C;  1TWG H;  3K8A A;  3KF6 B;  4C3H H;  1G6P A;  4A3I H;  2NZH A;  3S2H H;  4AQY L;  2EQS A;  4LFA Q;  2MO0 A;  3EBE A;  4JBJ A;  3CCM A;  4LF9 L;  3PO2 G;  4LFC Q;  3M9B A;  4YHH L;  1OXT A;  4DR3 Q;  1OXU A;  3RZO H;  1XTD A;  2R92 G;  4HJ5 A;  4C3J H;  1EQR A;  2JA6 G;  2N8N A;  5C0X J;  2ID0 A;  3J7Z C;  1R9T H;  5AJ3 Q;  4JI8 Q;  3HOW G;  4NXM L;  1QVC A;  1CKO A;  1K8G A;  2F52 A;  3JAM c;  5C44 H;  4NXN Q;  3STB D;  2B63 G;  2HHH L;  2VUM G;  2QA4 A;  1UE1 A;  3GD7 A;  1TWH H;  1K73 C;  3OYY A;  5IYC G;  3JC6 6;  1PH4 A;  1G29 1;  4IO9 A;  3U58 A;  1XMQ Q;  3PV0 A;  3H3V I;  3F2D A;  4DV7 L;  1NY4 A;  2JQO A;  1VS0 A;  3K0X A;  4OWT B;  4R1J A;  5J3B A;  3ULL A;  4DR1 Q;  2KCM A;  4DAM A;  5JEA G;  1K83 H;  4Y7N H;  1YZ6 A;  3OTO Q;  4XIG S;  2E5L L;  1S40 A;  2UU9 Q;  4X65 L;  1OXS C;  4QL5 A;  4A3D H;  4QQB X;  3H0G H;  3PUX A;  4DK6 C;  2E2H H;  4BY7 H;  2PI2 A;  1WI5 A;  2A19 A;  2R7Z G;  4A76 A;  3K7U C;  4JCV E;  5LMN L;  1VQK A;  2ZM6 Q;  2IX0 A;  2R7F A;  3GO5 A;  4OON A;  1N8R C;  4A3E H;  1PH6 A;  1K3R A;  2MQH A;  3I55 A;  4DV3 L;  4A3J G;  1Q7Y C;  1TWA H;  3U4V A;  1TWF H;  1Z9F A;  3KOJ A;  3HFZ B;  2OQ0 A;  5GAH C;  4R4T A;  1N32 Q;  1JMC A;  4JBK A;  2WP8 J;  2ES2 A;  3HOY H;  1LTL A;  4JG2 A;  4JOI A;  1PH5 A;  1AE3 A;  1WFQ A;  1HNW L;  1SN8 A;  1Z47 A;  4MZ9 A;  1Y1V H;  3KFU A;  2E8G A;  3CPW A;  2C35 B;  3J81 i;  1L0W A;  4RMF A;  1Q81 C;  4JI1 L;  3CPF A;  4GLX A;  1XNR Q;  3HOU G;  3KF8 B;  3UE0 A;  1PH3 A;  1PYS B;  5FLM G;  1N33 L;  1VQE A;  3UDF A;  4GN3 B;  1LM0 A;  1KAW A;  2ASB A;  3W1B A;  1YHB A;  4GS3 A;  1KHI A;  4O2D A;  1EWI A;  4A3G H;  2UXD Q;  2R93 H;  5C4X G;  4DR2 Q;  1PA6 A;  5IP9 H;  3E9H A;  1TXY A;  4EQ5 A;  4KI0 A;  3S14 H;  4XTC S;  2YTV A;  1V1Q A;  2RHQ B;  2JEA I;  2VW9 A;  1GKH A;  1XPR A;  4QJF A;  4BBR H;  1K0R A;  2IHE A;  5IYB G;  1U5K A;  1YJ9 A;  2JA5 G;  5ELO A;  4DK3 C;  2OQK A;  1FJG Q;  1E22 A;  1XMO L;  2JA7 H;  4AQY Q;  1XMQ L;  1HNZ L;  4LFB L;  2NVY H;  3PUW A;  1HJP A;  3GTJ H;  4LF9 Q;  5IWA L;  4YHH Q;  4GKK L;  1HNX L;  3SGI A;  5M5Y H;  2IX1 A;  2KHI A;  2E2I H;  4BXX G;  2PI2 E;  3FKI G;  4RG1 A;  4C2M H;  2ZJR A;  3HOW H;  1IZ6 A;  1HZA A;  2LSS A;  4NXM Q;  4A3K H;  2VUM H;  2BA0 A;  4L5T A;  2F4V L;  3AFQ A;  4IJL A;  3KYH C;  1YIJ A;  1VQ9 A;  3IRB A;  4TVA B;  3A5U A;  4IPC A;  2CFM A;  2A1A A;  3CAM A;  2LXK A;  1I94 Q;  2OTL A;  4IJH A;  3RR5 A;  1KRT A;  3HOZ G;  2V1C C;  1MKH A;  1OXV A;  3ULP A;  2IT1 A;  4DV7 Q;  1Q86 C;  1M90 C;  4BA1 I;  1QZH A;  2NVQ H;  2CCZ A;  3TRE A;  1VCI A;  2WAQ G;  1QVF A;  3TS0 A;  5C0X I;  1EYG A;  2E5L Q;  3PSI A;  4X65 Q;  1HR0 L;  1VQC A;  1BVS A;  2I5M X;  4JI3 L;  1EIF A;  1PH2 A;  3FP9 A;  2Z6K A;  4JBM A;  1PH8 A;  3TRZ A;  2DUD A;  3E9I A;  4A3F G;  4DUZ L;  4B3M L;  4DV5 L;  5LMN Q;  3S16 H;  1UE7 A;  3S2D H;  4K0K L;  1D7Q A;  3PF4 A;  1WCM H;  3HOX G;  3ER0 A;  4NB3 A;  4DV3 Q;  3HKZ G;  2RCN A;  4LF7 Q;  3JAM i;  4TQU S;  5FLX c;  4JI2 L;  1C0A A;  2K14 A;  3CCE A;  3GTK H;  2Y0S E;  3L2P A;  4UP9 A;  1HNW Q;  1L1O B;  5C0X G;  4DV0 L;  1X54 A;  3G48 A;  4A4I A;  1X3G A;  3KF6 A;  3HOU H;  4GNX C;  2F3I A;  1XPU A;  4JI1 Q;  4Y52 H;  4O0A A;  1N33 Q;  3RLO A;  1VQL A;  3PCO B;  4OO1 I;  1FJG L;  5JJI A;  4LF6 L;  4BBS H;  2KHJ A;  5E7N A;  1NBW A;  3ZJY C;  3PIO A;  5M3F H;  3OW2 A;  4QY7 A;  4LNQ A;  1L1O C;  1A62 A;  1IXR A;  1I50 H;  3I4M G;  3W1G A;  2Z0S A;  3PO3 H;  2B3G A;  2BA1 A;  1X9N A;  3FHW A;  4IOA A;  1NTG A;  1VQO A;  2YTY A;  1VQH A;  3AYH B;  1YJN A;  1GVP A;  3PUV A;  4PG3 A;  4P74 A;  3S24 A;  3ULJ A;  4J15 A;  2LXJ A;  3CC2 A;  4OO1 G;  4DR6 L;  1CKM A;  4DV4 L;  3A0J A;  1XMO Q;  2VZA A;  1I94 L;  1VQG A;  5C4J H;  4R4O A;  1HNZ Q;  4LFB Q;  1Q82 C;  1N36 L;  5IWA Q;  2GVB A;  4R4Q A;  4DNI A;  4GKK Q;  4MTN A;  2Q2U A;  1HNX Q;  3M4O H;  3D0F A;  1KL9 A;  1M1K C;  3GTL H;  2AWO A;  1RL2 A;  4JI6 L;  4JBW A;  1VQP A;  4L5R C;  4LUZ A;  4AYB G;  3BZC A;  3HKS A;  3T1H L;  2VQE Q;  2F4V Q;  2N3S A;  1GD7 A;  1BBW A;  3RZD H;  1J5E L;  2K5H A;  2ZTD A;  1LYL A;  4MNO A;  1WJJ A;  1V9P A;  3RN2 A;  1PH9 A;  3HOV G;  3BJU A;  4DUY L;  2NVT H;  4A3L H;  4LF7 L;  3CME A;  1C7Y A;  1YVC A;  2WFW A;  1Y1W G;  2JJQ A;  2VS1 A;  1VQA A;  1ASZ A;  5M3M H;  4LWC A;  1CUK A;  5C3E H;  2HIV A;  3F2B A;  3CQZ H;  1FVI A;  4BY1 G;  1C9O A;  2QEX A;  1HR0 Q;  3BU2 A;  2A8V A;  4JI3 Q;  1CKN B;  4B3T L;  4A3F H;  4GKJ L;  4LUO A;  1KQS A;  4B3M Q;  4DUZ Q;  4DKA C;  4DV5 Q;  5DLQ E;  1EQQ A;  4K0K Q;  1KC8 C;  3KJO A;  2PQA B;  4HID A;  2CWA A;  1QUQ B;  5K36 G;  1NMF A;  2YYZ A;  3CMA A;  2KCT A;  5IP7 G;  1PH7 A;  3ERS X;  2JA8 G;  3KDF B;  3GTP H;  3U4Z A;  4A3C G;  1GO3 E;  1T9H A;  4JI2 Q;  1S72 A;  4IFD I;  2N78 A;  4DV0 Q;  1RIP A;  4IOC A;  2Q2T A;  2ZJQ A;  5FJ8 H;  2JE6 I;  4B3S L;  4LF8 L;  1W3S A;  3UE1 A;  5JEA J;  4R4C A;  1BBU A;  1DGS A;  1L2F A;  4P72 A;  1P8L A;  1IBK L;  2ATW A;  2I5L X;  3I4N G;  2UXB L;  5EAY A;  4C3I H;  2PNH A;  2K75 A;  4PMW A;  3CC7 A;  4LF6 Q;  3TEH B;  5IYD G;  1SMX A;  1EIY B;  3PO2 H;  1EUJ A;  1P16 A;  1VQ8 A;  1YHA A;  1PV4 A;  3J7A 5;  4KLK A;  2R92 H;  1NE3 A;  3CF5 A;  4OX9 L;  2JA6 H;  1X6O A;  2FXQ A;  4IFD G;  1TWC H;  1XNQ L;  1SR3 A;  4YWM A;  3G4S A;  4YCW A;  4DV6 L;  2VQF L;  5H1S E;  2B63 H;  4BA2 I;  4A93 G;  4OXP A;  3MEF A;  2VQE L;  2D0P A;  5IYC H;  1O7I A;  1OTC A;  2D62 A;  4DR6 Q;  3CD6 A;  4JI5 L;  1E1O A;  1SRO A;  1Q8K A;  2BH8 A;  4DV4 Q;  1VQ7 A;  1PH1 A;  5C44 G;  3L0O A;  2VL6 A;  5GAG C;  1E3P A;  1U0L A;  1N36 Q;  4A3B G;  4JV5 L;  3J81 j;  1N34 L;  1X3E A;  4POF A;  4YWL A;  1VQB A;  3I2Z A;  3T1Y L;  3I56 A;  3CP0 A;  4JI6 Q;  2HIX A;  2VNU D;  3CCL A;  1EFW A;  5GAD C;  1UE5 A;  3T1H Q;  2K5V A;  1UWV A;  3KLW A;  2OCE A;  3CCV A;  4GNX A;  4HJ8 A;  2R7Z H;  4YCU A;  1J5E Q;  3CCU A;  1JJ2 A;  4DV1 Q;  5JJL A;  3LGJ A;  1VQJ A;  3UDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...