3KXYT

Crystal structure of the exsc-exse complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
b'TEAVGHFEGRSVTRAAVRGEDRSSVAGLARWLARNVAGDPRSEQALQRLADGDGTPLEARTVRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exoenzyme S synthesis protein C
molecule tags Chaperone/transcription inhibitor
source organism Pseudomonas aeruginosa
publication title Analysis of the Crystal Structure of the ExsC.ExsE Complex Reveals Distinctive Binding Interactions of the Pseudomonas aeruginosa Type III Secretion Chaperone ExsC with ExsE and ExsD.
pubmed doi rcsb
total genus 11
structure length 65
sequence length 65
chains with identical sequence U, V, W, X, Y
ec nomenclature
pdb deposition date 2009-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF18286 T3SS_ExsE Type III secretion system ExsE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.370 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kxyT00
3KXYT
chains in the Genus database with same CATH superfamily
4ED8A 1PX2A 4R8UA 4JI0H 2FP4B 1VKZA 3PR4A 5BPFA 1S0NA 5KFEA 3Q2OA 5KG3A 3PR5B 2RGVA 3QFFA 2YW2A 1I7NA 4J9NA 1M0TA 3CVZA 1W96A 4JI5H 1IOWA 3HBLA 5KFHA 3RBDA 1O75A 4B3RH 2NVYA 3ORRA 2ZJTA 3K3PA 4BBSG 4LF9H 3N6XA 2XIGA 4HQ6A 2OLSA 4RAYA 2YS6A 3R5HA 3RBEA 3ORQA 1JXLA 4DUYH 1TWFA 5KG4A 2V4QA 3GTOA 2FJZA 2CW8A 5D1PA 2W6ZA 4BY1G 3G6YA 4ED3A 1S0OA 3BA8A 5DG7A 1WCMG 4C5CA 5KFWA 2OH2A 1RJPA 4O3PA 4WBNF 5KFFA 2WTFA 3G6VA 2AGOA 4BXXG 5LL6b 4JV5H 3WO1A 2YS7A 5DG9A 1M0WA 5KT3A 2JA5G 4JV2A 4IR9A 5IP7G 1V51A 3HOUG 3PN1A 2C2EA 4TV8F 5L1KA 5DQIA 1TAEA 4I4TF 3PW0A 1B04A 4JV0A 3T1YH 2ATLA 4PDBA 1B6SA 4O3NA 5L1JA 4LSAA 5FPOA 2FE3A 2FPIB 4BY7G 4IR1A 4F50A 2PBZA 2ZDQA 3H20A 5KFKA 4FM9A 1J5EH 4IRDA 4Q45A 2YU9A 3DF7A 5EWGA 5DQGA 4QW8A 3Q8QB 4EYHB 3PW2A 2BR0A 4DL3A 1L2ZA 3N41B 1TWGA 3KHLA 3U9TA 1XMQH 5JH7F 1WCMA 4MV9A 4Q44A 3Q8SB 2XCAA 4JI1H 4JI7H 1VAJA 1S97A 1JDEA 3PO2G 2JA5A 5KT2A 2YYAA 3GLKA 3J80W 2MCTA 2BQUA 5KT4A 4DV0H 4EG0A 5KFJA 3MWMA 1FKAH 2JEJA 4GKKH 1IOVA 2RF4A 4Q43A 3I4MG 4FS2A 3MJFA 1E4GT 3T5JA 3EYYA 5HBRB 2ASDA 2RDJA 4TQSA 4IHJF 1TA8A 3JRXA 4YR3A 1T36A 3BQ1A 1RK5A 3GTPA 2VUMG 2R6FA 4MV8A 4IAJA 4I7HA 3WO0A 4QWAA 1Y1WA 2R86A 3KTMA 5IT9W 1CQIB 3RGZA 3VPBA 5L1IA 1TWAA 4UCTA 3RB3A 3GILA 4DL4A 3WNZA 4B3TH 1GSHA 3JZIA 2W70A 4Y8VB 1M6VA 3H4DA 2NU9B 1P8LA 2V59A 4J9SA 4XYLB 4J9OA 3RUPA 4FBUA 4J0MA 1JLLB 4GC7A 1S03G 2HVSA 3N40P 4RU9A 4J9KA 2AGPA 2C35B 1DIKA 4MV6A 2CKZB 3KHGA 2W8KA 3KALA 4YR2A 1N34H 3TINA 3RTXA 1B6RA 2W6OA 2ZDHA 5KG2A 4QWBA 4A3FG 5C8YF 5H80A 4ECUA 3FKIA 2W6NA 3M4IA 5JVLA 4ED1A 4YR0A 4NXNH 1Y1VG 4I50F 3V4SA 3BQ0A 4J9MA 1UC9A 5C4XG 5C44G 3RF2A 4DR5H 4ECXA 1I7LA 3NGDA 3GIJA 2UVRA 5KFMA 4A3GG 3J7AK 3OSNA 3PW4A 4UCVA 3MR5A 4A3MG 1V4YA 4RNMA 3KAJA 5KT5A 3G8CA 2J9GA 5I47A 4YY3H 5KFVA 5FPRA 4F4XA 1S10A 5JVDF 3MFIA 1IBMH 1RK6A 5DGBA 1JIHA 5LMUH 2GPWA 4DL7A 3M9MB 2P0AA 2JEFA 2W9CB 4MTEA 4C2MA 3EPIA 2FLPA 3RV3A 1A0IA 4M9UA 5JQWA 2PMZE 2PMZA 5KFCA 2J6SA 2ZDGA 3K3VA 3TIGA 2ZM6H 2UVWA 3GTQA 4YB8B 5KFOA 5KT7A 2JEGA 1XMOH 1PK8A 1FJGH 2VOBA 2KSWA 2WB1E 2WB1A 4ECVA 2W9BB 5DG8A 2YZNA 2J6TA 4X62H 4O4LF 4EEYA 2W6QA 2R93G 4DR3H 4IWXA 3OSPA 2VA3A 1EYZA 4ZHQF 4Q0YA 1S0MA 1VBGA 4UFZA 1ULZA 3E5NA 2FB9A 4UCRA 4ECTA 2Q2TA 3F8NA 2VQDA 3IN5A 4DR4H 1OWTA 2VPQA 2X0SA 5J2TF 4M7EA 5J2UF 4HYKA 4O3SA 4TUYF 5KFLA 2R7NA 2V5AA 5GONF 4A3CG 3JAMW 5CA1F 3RJ0A 4DV6H 4LF4H 4O3QA 4LF8H 2R7ZA 4A3KG 5D1OB 1EUCB 3FDSA 3HKZE 3HKZA 4MV4A 2NUAB 4F4YA 4EBDA 3TIIA 3OUUA 1KBLA 2RGRA 1C3OA 1T94A 3GTJA 4YQWA 4R8UB 2UU9H 2FPGB 1UC8A 3RGXA 3KHHA 2R7LA 5DLFA 5A2QW 5KFQA 4EFEA 4DV7H 3PW7A 2QYZA 1A9XA 3HB9A 4EBEA 5C1PA 5F9NA 3MR6A 1KJ9A 4EYIB 5EWFA 5KFZA 2DPJA 3TQ1A 4XYMB 4HNTA 2R7ZG 1R9TA 3VPDA 4I55F 3GV5B 2IP4A 2DLNA 2HVQA 4ECWA 2C22A 2AU0A 2HHHH 3GIMA 5KFGA 4X65H 4EGQA 4Q8EA 2NU8B 4LF7H 4AYBE 4AYBA 5DLGA 3AYHB 4QJFA 3GIQA 2AGQA 5LOVF 2O03A 4O3OA 3H4BA 3N8DA 3KHRA 2R8GA 3HOXG 1Z2PX 3BABA 5KFDA 3QZ8A 5FLXW 2AQ4A 3H0GA 2HVRA 3GIIA 4UCUA 1WSCA 2FLNA 4YAJB 3TQTA 5KKNB 2BQ3A 2JEIA 2W6MA 3V4ZA 1GSOA 1S9FA 2IA6A 3M9OB 1RYRA 1N36H 3H40A 3RB6A 4LFAH 1ZQ7A 3RIZA 5KFBA 3MR2A 4DV3H 3OHBA 1VS0A 2C28A 4RB2C 1DV1A 2XGQA 3M9NB 4B3MH 5DGAA 5BMVF 2JA8G 1GLVA 5KG0A 2JA7G 2UXBH 1BJTA 1K1SA 4LH7A 5FJ8G 4JUZA 4DR7H 3RB0A 5CA0F 3GQCA 4GLXA 5IP9G 2R7MA 4MA5A 2F4VH 1T3NA 3GIDA 2W7PA 1VBHA 4O4IF 4JI3H 4GKJH 5FD6A 4FBTA 3RAQA 2C2DA 1CS0A 2M05A 3Q8RB 3R23A 4ETSA 1N32H 3LP8A 5JUMA 2FPPB 3PZPA 3MFHA 1N33H 5KG7A 4IWYA 5IYBG 4O3RA 4O2AF 3U9SA 1TWHA 3HOZG 2E2IA 4JYAH 4ED7A 3C0FB 4ZI7F 2YCHA 3OUZA 1I94H 2R84A 4QWEA 3N42B 4A3LG 5K2MA 2YL2A 4DLKA 1ZHQA 5T14A 3RV4A 1S68A 1JKJB 1HNXH 2UUCH 5LP6F 2YZMA 5LA6F 4ED6A 3V6HA 3BAAA 3GIPA 3T5LA 3LWBA 5CB4F 5BR8H 4TQRA 4DR2H 1DV2A 5KFNA 5KFRA 4QIWE 4QIWA 4X64H 4X66H 4J9LA 3K5IA 4CC6A 3GTGA 1BXRA 2W7OA 3I4NG 3RB4A 4MTDA 2PN1A 5KFXA 4RNNA 4MV3A 4YHHH 3L4KA 4RB1A 5C3EG 4MA0A 4HNVA 4DL6A 2VUMA 2R92A 5IWAH 1Y1WG 4CC5A 4HNUA 3RFCA 4MAMA 4HR7A 4TV9F 1IBLH 1HR0H 3HXLA 2DZDA 4C5BA 3H0GG 5FD5A 1XDNA 5D1OA 4DL2A 2V9WA 4MV7A 1UNNC 3L2PA 2FKLA 2BQRA 4G3IA 5KFUA 3GV7B 4ECQA 4YJ3F 4XX0B 5KFYA 3JSNA 3GIKA 2JA7A 5BPHA 5IYDG 3V6JA 5KFAA 4DL5A 4RNOA 2R8JA 4LF5H 4LFBH 1Y14B 3FKIG 4R7RA 2Y0SE 2Y0SA 2ASLA 1N48A 1Y1VA 5EZYF 5L1LA 2R8KA 5EWEA 3LMLA 4DV2H 3CQZA 2W9AA 5KG5A 2NVXA 1Z2OX 2IMWP 3HOWG 3VPCA 1DGSA 4YJ2F 5CAEB 4LF6H 3UQ8A 4RAZA 2NU6B 1BNCA 1BGWA 4JI4H 4K0KH 4IRCA 4RB3C 2HGSA 4DUZH 5D8DA 4C5AA 2C00A 5IYZF 1XNQH 3H3VH 4B3SH 1HNWH 3J81W 4ZQIA 3BQ2A 2DPIA 1XNRH 5DQHA 4WD3A 1AN7A 3RAXA 4A2BA 3BG5A 3R5FA 5KFPA 2CQYA 1E4EA 2UVVA 1WH2A 4XZ3B 2E2HA 3I12A 4FS1A 2YZGA 5HV6A 1SFOA 2R82A 2WAQE 2WAQA 2VQEH 2QK4A 5C1OA 3PW5A 1W93A 5EOYA 2VPSA 2B63G 1I3QA 4F4ZA 4J9QA 1AUVA 2RDIA 2JA6A 2ASJA 3N44B 5LMNH 4AQYH 2CZGA 3MR3A 4EFBA 3SI8A 4QWDA 3IG0A 3OTOH 3PVXA 4JI8H 3HOYG 2IBKA 3N43B 2GLTA 2R7KA 4LH6A 2ALZA 4RUCA 3EPGA 1TWCA 2I80A 4FU0A 2SCUB 3JSLA 2W8LA 4OX9H 2R92G 4LMYA 2DIKA 3ETJA 1JX4A 4O4HF 2I87A 3OHAA 1ZETA 2WYOA 4IZOA 4QW9A 2VQFH 3FMAA 4ZOLF 4UCSA 1X9NA 2VA2A 3GTMA 2B63A 2FK1A 1M7JA 3BJYA 2CW7A 4ECZA 4A3EG 2R85A 1N56A 3HOVG 1E4FT 2UXDH 4DR1H 4JI6H 3V6KA 3JRWA 2XD4A 3KXYT 1K83A 2R87A 4BBRG 4ME6A 4A3IG 3QZ7A 2VR1A 2V58A 2VUGA 2GPSA 4ECRA 1EHIA 4U7CA 4GC6A 4ED2A 1B33N 1K1QA 4YAKB 4A3DG 4A2AA 1RJQA 2WDTA 1GYFA 2E5LH 4RZQA 4YBZB 1GGOA 3MWDA 2OWOA 2FMAA 4JI2H 1FVIA 4QWCA 2UUAH 4J9RA 1SCUB 4L1KA 5KX5F 2YRXA 4A3BG 5KG1A 4YP3A 5LYJF 2DWCA 4APMA 4ECSA 4E4TA 1IBKH 2FK3A 3GV8B 3PO3G 2NU7B 4JV1A 3GTKA 2XC9A 1RYSA 1KJ8A 2R8IA 4BWSC 5KFIA 4NLGA 5KFTA 4DR6H 2R93A 1SEIA 1EZ1A 3MWEA 3VMMA 4EEQA 4RZRA 1CE8A 4EGJA 2PVPA 2WE6A 5IYCG 1E4EB 1KJJA 4UCOA 5KT6A 5FLMG 4LSXA 3T1HH 4LFCH 1HNZH 4Q8FA 2R8HA 3ETHA 2XCLA 2W9CA 3T5HA 2UVUA 1AUXA 2C2RA 1I50A 4NXMH 1MZBA 2XGPA 5LXTF 4RUAA 4DV1H 1C30A 1GO3E 3UFXB 2JA6G 4DV5H 4ECYA 4EBCA 1KEEA 1KJIA 4ED0A 2HJWA 2W9BA 3Q8PB 2YRWA 5KFSA 4U6PA 3T5KA 5EDWA 5F9LA 2FLLA 2UXCH 5L9XA 4A93G 3K5HA 2V4RA 4IRKA 2W57A 3BA9A 4DV4H 2I8CA 3SE7A 1V9PA 2FK2A 4O2BF 1KJQA 3R5XA 4F4WA 2W6PA 2W71A 3G6XA 5KG6A 2UUBH 4J9PA 1I6UA 1EUDB 1JDBB 3GTLA 3KAKA 5C5JA 2XCPA 3L4JA 1CQJB 2Q2UA 4KHPH 4A3JG 1RJRA 1GSAA 4PWQA 4MV1A 1Z2NX 3Q1KA 1ZHSA 1KC7A 4RB0A 2J6UA 1SYXB 1WR2A
chains in the Genus database with same CATH topology
5EOYA 4JI0H 2VPSA 1BJTA 2UXBH 4LH7A 3RF2A 3N44B 5LMNH 4DR5H 4DR7H 4AQYH 4GLXA 4EFBA 3J7AK 3IG0A 3OTOH 4UCVA 4JI8H 2RGVA 2F4VH 3N43B 4JI3H 3KAJA 4GKJH 4LH6A 5FD6A 1M0TA 3CVZA 5FPRA 4YY3H 4JI5H 1O75A 4B3RH 4ETSA 1IBMH 1N32H 2ZJTA 3JSLA 5LMUH 1N33H 4OX9H 4LF9H 4LMYA 3N6XA 2XIGA 4RAYA 2WYOA 2VQFH 3FMAA 4MTEA 4JYAH 4UCSA 4DUYH 1A0IA 1X9NA 3C0FB 2YCHA 2CW7A 2CW8A 5D1PA 1I94H 3K3VA 3N42B 2ZM6H 3BA8A 1ZHQA 1E4FT 2UXDH 1XMOH 1FJGH 1HNXH 1S68A 2VOBA 2KSWA 4DR1H 2UUCH 4JI6H 4JV5H 5LL6b 3KXYT 4X62H 3BAAA 1M0WA 4DR3H 4DR2H 5BR8H 2VUGA 3PN1A 4X64H 4X66H 4Q0YA 1TAEA 4UFZA 4CC6A 1B04A 3T1YH 4PDBA 4UCRA 4LSAA 4MTDA 4A2AA 2Q2TA 2WDTA 3F8NA 2FE3A 5FPOA 1GYFA 2E5LH 4RZQA 4YHHH 4M7EA 4FM9A 3H20A 1J5EH 2OWOA 4JI2H 1FVIA 4RB1A 3L4KA 2UUAH 3DF7A 1L2ZA 3JAMW 3RJ0A 4DV6H 4LF4H 3N41B 4APMA 4LF8H 5IWAH 4CC5A 1IBKH 5D1OB 1XMQH 1IBLH 4MV9A 1HR0H 3HXLA 4JI1H 4JI7H 5FD5A 1XDNA 5D1OA 4MV7A 4BWSC 3L2PA 2RGRA 4DR6H 1SEIA 3J80W 4EEQA 2UU9H 2MCTA 3RGXA 2WE6A 4UCOA 4DV0H 3T1HH 1FKAH 3MWMA 4LSXA 4LFCH 5A2QW 1HNZH 4GKKH 1I6UA 4EFEA 4DV7H 1E4GT 3EYYA 4NXMH 1MZBA 1TA8A 4DV1H 3JSNA 4DV5H 4IAJA 4I7HA 4LF5H 4LFBH 4R7RA 5IT9W 3RGZA 4UCTA 2HVQA 2HHHH 4B3TH 4X65H 3LMLA 4DV2H 4LF7H 2UXCH 1Z2OX 2W57A 3BA9A 4DV4H 1P8LA 1V9PA 1DGSA 2O03A 4J0MA 4LF6H 3UQ8A 4RAZA 1Z2PX 3BABA 1S03G 2HVRA 5FLXW 2UUBH 1BGWA 3N40P 2HVSA 4JI4H 4DR4H 4K0KH 4RB3C 2HGSA 4UCUA 4DUZH 1XNQH 3KAKA 3KALA 3L4JA 2Q2UA 4B3SH 1HNWH 4KHPH 3J81W 1XNRH 1N34H 1N36H 1AN7A 4A2BA 3RTXA 4LFAH 3RIZA 4DV3H 1WH2A 1Z2NX 1ZHSA 4NXNH 1VS0A 3M4IA 4RB0A 4RB2C 1SYXB 4B3MH 2VQEH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXY T; 
#chains in the Genus database with same CATH topology
 4ED8 A;  1PX2 A;  4R8U A;  4JI0 H;  2FP4 B;  1VKZ A;  3PR4 A;  5BPF A;  1S0N A;  5KFE A;  3Q2O A;  5KG3 A;  3PR5 B;  2RGV A;  3QFF A;  2YW2 A;  1I7N A;  4J9N A;  1M0T A;  3CVZ A;  1W96 A;  4JI5 H;  1IOW A;  3HBL A;  5KFH A;  3RBD A;  1O75 A;  4B3R H;  2NVY A;  3ORR A;  2ZJT A;  3K3P A;  4BBS G;  4LF9 H;  3N6X A;  2XIG A;  4HQ6 A;  2OLS A;  4RAY A;  2YS6 A;  3R5H A;  3RBE A;  3ORQ A;  1JXL A;  4DUY H;  1TWF A;  5KG4 A;  2V4Q A;  3GTO A;  2FJZ A;  2CW8 A;  5D1P A;  2W6Z A;  4BY1 G;  3G6Y A;  4ED3 A;  1S0O A;  3BA8 A;  5DG7 A;  1WCM G;  4C5C A;  5KFW A;  2OH2 A;  1RJP A;  4O3P A;  4WBN F;  5KFF A;  2WTF A;  3G6V A;  2AGO A;  4BXX G;  5LL6 b;  4JV5 H;  3WO1 A;  2YS7 A;  5DG9 A;  1M0W A;  5KT3 A;  2JA5 G;  4JV2 A;  4IR9 A;  5IP7 G;  1V51 A;  3HOU G;  3PN1 A;  2C2E A;  4TV8 F;  5L1K A;  5DQI A;  1TAE A;  4I4T F;  3PW0 A;  1B04 A;  4JV0 A;  3T1Y H;  2ATL A;  4PDB A;  1B6S A;  4O3N A;  5L1J A;  4LSA A;  5FPO A;  2FE3 A;  2FPI B;  4BY7 G;  4IR1 A;  4F50 A;  2PBZ A;  2ZDQ A;  3H20 A;  5KFK A;  4FM9 A;  1J5E H;  4IRD A;  4Q45 A;  2YU9 A;  3DF7 A;  5EWG A;  5DQG A;  4QW8 A;  3Q8Q B;  4EYH B;  3PW2 A;  2BR0 A;  4DL3 A;  1L2Z A;  3N41 B;  1TWG A;  3KHL A;  3U9T A;  1XMQ H;  5JH7 F;  1WCM A;  4MV9 A;  4Q44 A;  3Q8S B;  2XCA A;  4JI1 H;  4JI7 H;  1VAJ A;  1S97 A;  1JDE A;  3PO2 G;  2JA5 A;  5KT2 A;  2YYA A;  3GLK A;  3J80 W;  2MCT A;  2BQU A;  5KT4 A;  4DV0 H;  4EG0 A;  5KFJ A;  3MWM A;  1FKA H;  2JEJ A;  4GKK H;  1IOV A;  2RF4 A;  4Q43 A;  3I4M G;  4FS2 A;  3MJF A;  1E4G T;  3T5J A;  3EYY A;  5HBR B;  2ASD A;  2RDJ A;  4TQS A;  4IHJ F;  1TA8 A;  3JRX A;  4YR3 A;  1T36 A;  3BQ1 A;  1RK5 A;  3GTP A;  2VUM G;  2R6F A;  4MV8 A;  4IAJ A;  4I7H A;  3WO0 A;  4QWA A;  1Y1W A;  2R86 A;  3KTM A;  5IT9 W;  1CQI B;  3RGZ A;  3VPB A;  5L1I A;  1TWA A;  4UCT A;  3RB3 A;  3GIL A;  4DL4 A;  3WNZ A;  4B3T H;  1GSH A;  3JZI A;  2W70 A;  4Y8V B;  1M6V A;  3H4D A;  2NU9 B;  1P8L A;  2V59 A;  4J9S A;  4XYL B;  4J9O A;  3RUP A;  4FBU A;  4J0M A;  1JLL B;  4GC7 A;  1S03 G;  2HVS A;  3N40 P;  4RU9 A;  4J9K A;  2AGP A;  2C35 B;  1DIK A;  4MV6 A;  2CKZ B;  3KHG A;  2W8K A;  3KAL A;  4YR2 A;  1N34 H;  3TIN A;  3RTX A;  1B6R A;  2W6O A;  2ZDH A;  5KG2 A;  4QWB A;  4A3F G;  5C8Y F;  5H80 A;  4ECU A;  3FKI A;  2W6N A;  3M4I A;  5JVL A;  4ED1 A;  4YR0 A;  4NXN H;  1Y1V G;  4I50 F;  3V4S A;  3BQ0 A;  4J9M A;  1UC9 A;  5C4X G;  5C44 G;  3RF2 A;  4DR5 H;  4ECX A;  1I7L A;  3NGD A;  3GIJ A;  2UVR A;  5KFM A;  4A3G G;  3J7A K;  3OSN A;  3PW4 A;  4UCV A;  3MR5 A;  4A3M G;  1V4Y A;  4RNM A;  3KAJ A;  5KT5 A;  3G8C A;  2J9G A;  5I47 A;  4YY3 H;  5KFV A;  5FPR A;  4F4X A;  1S10 A;  5JVD F;  3MFI A;  1IBM H;  1RK6 A;  5DGB A;  1JIH A;  5LMU H;  2GPW A;  4DL7 A;  3M9M B;  2P0A A;  2JEF A;  2W9C B;  4MTE A;  4C2M A;  3EPI A;  2FLP A;  3RV3 A;  1A0I A;  4M9U A;  5JQW A;  2PMZ E;  2PMZ A;  5KFC A;  2J6S A;  2ZDG A;  3K3V A;  3TIG A;  2ZM6 H;  2UVW A;  3GTQ A;  4YB8 B;  5KFO A;  5KT7 A;  2JEG A;  1XMO H;  1PK8 A;  1FJG H;  2VOB A;  2KSW A;  2WB1 E;  2WB1 A;  4ECV A;  2W9B B;  5DG8 A;  2YZN A;  2J6T A;  4X62 H;  4O4L F;  4EEY A;  2W6Q A;  2R93 G;  4DR3 H;  4IWX A;  3OSP A;  2VA3 A;  1EYZ A;  4ZHQ F;  4Q0Y A;  1S0M A;  1VBG A;  4UFZ A;  1ULZ A;  3E5N A;  2FB9 A;  4UCR A;  4ECT A;  2Q2T A;  3F8N A;  2VQD A;  3IN5 A;  4DR4 H;  1OWT A;  2VPQ A;  2X0S A;  5J2T F;  4M7E A;  5J2U F;  4HYK A;  4O3S A;  4TUY F;  5KFL A;  2R7N A;  2V5A A;  5GON F;  4A3C G;  3JAM W;  5CA1 F;  3RJ0 A;  4DV6 H;  4LF4 H;  4O3Q A;  4LF8 H;  2R7Z A;  4A3K G;  5D1O B;  1EUC B;  3FDS A;  3HKZ E;  3HKZ A;  4MV4 A;  2NUA B;  4F4Y A;  4EBD A;  3TII A;  3OUU A;  1KBL A;  2RGR A;  1C3O A;  1T94 A;  3GTJ A;  4YQW A;  4R8U B;  2UU9 H;  2FPG B;  1UC8 A;  3RGX A;  3KHH A;  2R7L A;  5DLF A;  5A2Q W;  5KFQ A;  4EFE A;  4DV7 H;  3PW7 A;  2QYZ A;  1A9X A;  3HB9 A;  4EBE A;  5C1P A;  5F9N A;  3MR6 A;  1KJ9 A;  4EYI B;  5EWF A;  5KFZ A;  2DPJ A;  3TQ1 A;  4XYM B;  4HNT A;  2R7Z G;  1R9T A;  3VPD A;  4I55 F;  3GV5 B;  2IP4 A;  2DLN A;  2HVQ A;  4ECW A;  2C22 A;  2AU0 A;  2HHH H;  3GIM A;  5KFG A;  4X65 H;  4EGQ A;  4Q8E A;  2NU8 B;  4LF7 H;  4AYB E;  4AYB A;  5DLG A;  3AYH B;  4QJF A;  3GIQ A;  2AGQ A;  5LOV F;  2O03 A;  4O3O A;  3H4B A;  3N8D A;  3KHR A;  2R8G A;  3HOX G;  1Z2P X;  3BAB A;  5KFD A;  3QZ8 A;  5FLX W;  2AQ4 A;  3H0G A;  2HVR A;  3GII A;  4UCU A;  1WSC A;  2FLN A;  4YAJ B;  3TQT A;  5KKN B;  2BQ3 A;  2JEI A;  2W6M A;  3V4Z A;  1GSO A;  1S9F A;  2IA6 A;  3M9O B;  1RYR A;  1N36 H;  3H40 A;  3RB6 A;  4LFA H;  1ZQ7 A;  3RIZ A;  5KFB A;  3MR2 A;  4DV3 H;  3OHB A;  1VS0 A;  2C28 A;  4RB2 C;  1DV1 A;  2XGQ A;  3M9N B;  4B3M H;  5DGA A;  5BMV F;  2JA8 G;  1GLV A;  5KG0 A;  2JA7 G;  2UXB H;  1BJT A;  1K1S A;  4LH7 A;  5FJ8 G;  4JUZ A;  4DR7 H;  3RB0 A;  5CA0 F;  3GQC A;  4GLX A;  5IP9 G;  2R7M A;  4MA5 A;  2F4V H;  1T3N A;  3GID A;  2W7P A;  1VBH A;  4O4I F;  4JI3 H;  4GKJ H;  5FD6 A;  4FBT A;  3RAQ A;  2C2D A;  1CS0 A;  2M05 A;  3Q8R B;  3R23 A;  4ETS A;  1N32 H;  3LP8 A;  5JUM A;  2FPP B;  3PZP A;  3MFH A;  1N33 H;  5KG7 A;  4IWY A;  5IYB G;  4O3R A;  4O2A F;  3U9S A;  1TWH A;  3HOZ G;  2E2I A;  4JYA H;  4ED7 A;  3C0F B;  4ZI7 F;  2YCH A;  3OUZ A;  1I94 H;  2R84 A;  4QWE A;  3N42 B;  4A3L G;  5K2M A;  2YL2 A;  4DLK A;  1ZHQ A;  5T14 A;  3RV4 A;  1S68 A;  1JKJ B;  1HNX H;  2UUC H;  5LP6 F;  2YZM A;  5LA6 F;  4ED6 A;  3V6H A;  3BAA A;  3GIP A;  3T5L A;  3LWB A;  5CB4 F;  5BR8 H;  4TQR A;  4DR2 H;  1DV2 A;  5KFN A;  5KFR A;  4QIW E;  4QIW A;  4X64 H;  4X66 H;  4J9L A;  3K5I A;  4CC6 A;  3GTG A;  1BXR A;  2W7O A;  3I4N G;  3RB4 A;  4MTD A;  2PN1 A;  5KFX A;  4RNN A;  4MV3 A;  4YHH H;  3L4K A;  4RB1 A;  5C3E G;  4MA0 A;  4HNV A;  4DL6 A;  2VUM A;  2R92 A;  5IWA H;  1Y1W G;  4CC5 A;  4HNU A;  3RFC A;  4MAM A;  4HR7 A;  4TV9 F;  1IBL H;  1HR0 H;  3HXL A;  2DZD A;  4C5B A;  3H0G G;  5FD5 A;  1XDN A;  5D1O A;  4DL2 A;  2V9W A;  4MV7 A;  1UNN C;  3L2P A;  2FKL A;  2BQR A;  4G3I A;  5KFU A;  3GV7 B;  4ECQ A;  4YJ3 F;  4XX0 B;  5KFY A;  3JSN A;  3GIK A;  2JA7 A;  5BPH A;  5IYD G;  3V6J A;  5KFA A;  4DL5 A;  4RNO A;  2R8J A;  4LF5 H;  4LFB H;  1Y14 B;  3FKI G;  4R7R A;  2Y0S E;  2Y0S A;  2ASL A;  1N48 A;  1Y1V A;  5EZY F;  5L1L A;  2R8K A;  5EWE A;  3LML A;  4DV2 H;  3CQZ A;  2W9A A;  5KG5 A;  2NVX A;  1Z2O X;  2IMW P;  3HOW G;  3VPC A;  1DGS A;  4YJ2 F;  5CAE B;  4LF6 H;  3UQ8 A;  4RAZ A;  2NU6 B;  1BNC A;  1BGW A;  4JI4 H;  4K0K H;  4IRC A;  4RB3 C;  2HGS A;  4DUZ H;  5D8D A;  4C5A A;  2C00 A;  5IYZ F;  1XNQ H;  3H3V H;  4B3S H;  1HNW H;  3J81 W;  4ZQI A;  3BQ2 A;  2DPI A;  1XNR H;  5DQH A;  4WD3 A;  1AN7 A;  3RAX A;  4A2B A;  3BG5 A;  3R5F A;  5KFP A;  2CQY A;  1E4E A;  2UVV A;  1WH2 A;  4XZ3 B;  2E2H A;  3I12 A;  4FS1 A;  2YZG A;  5HV6 A;  1SFO A;  2R82 A;  2WAQ E;  2WAQ A;  2VQE H;  2QK4 A;  5C1O A;  3PW5 A;  1W93 A;  5EOY A;  2VPS A;  2B63 G;  1I3Q A;  4F4Z A;  4J9Q A;  1AUV A;  2RDI A;  2JA6 A;  2ASJ A;  3N44 B;  5LMN H;  4AQY H;  2CZG A;  3MR3 A;  4EFB A;  3SI8 A;  4QWD A;  3IG0 A;  3OTO H;  3PVX A;  4JI8 H;  3HOY G;  2IBK A;  3N43 B;  2GLT A;  2R7K A;  4LH6 A;  2ALZ A;  4RUC A;  3EPG A;  1TWC A;  2I80 A;  4FU0 A;  2SCU B;  3JSL A;  2W8L A;  4OX9 H;  2R92 G;  4LMY A;  2DIK A;  3ETJ A;  1JX4 A;  4O4H F;  2I87 A;  3OHA A;  1ZET A;  2WYO A;  4IZO A;  4QW9 A;  2VQF H;  3FMA A;  4ZOL F;  4UCS A;  1X9N A;  2VA2 A;  3GTM A;  2B63 A;  2FK1 A;  1M7J A;  3BJY A;  2CW7 A;  4ECZ A;  4A3E G;  2R85 A;  1N56 A;  3HOV G;  1E4F T;  2UXD H;  4DR1 H;  4JI6 H;  3V6K A;  3JRW A;  2XD4 A;  3KXY T;  1K83 A;  2R87 A;  4BBR G;  4ME6 A;  4A3I G;  3QZ7 A;  2VR1 A;  2V58 A;  2VUG A;  2GPS A;  4ECR A;  1EHI A;  4U7C A;  4GC6 A;  4ED2 A;  1B33 N;  1K1Q A;  4YAK B;  4A3D G;  4A2A A;  1RJQ A;  2WDT A;  1GYF A;  2E5L H;  4RZQ A;  4YBZ B;  1GGO A;  3MWD A;  2OWO A;  2FMA A;  4JI2 H;  1FVI A;  4QWC A;  2UUA H;  4J9R A;  1SCU B;  4L1K A;  5KX5 F;  2YRX A;  4A3B G;  5KG1 A;  4YP3 A;  5LYJ F;  2DWC A;  4APM A;  4ECS A;  4E4T A;  1IBK H;  2FK3 A;  3GV8 B;  3PO3 G;  2NU7 B;  4JV1 A;  3GTK A;  2XC9 A;  1RYS A;  1KJ8 A;  2R8I A;  4BWS C;  5KFI A;  4NLG A;  5KFT A;  4DR6 H;  2R93 A;  1SEI A;  1EZ1 A;  3MWE A;  3VMM A;  4EEQ A;  4RZR A;  1CE8 A;  4EGJ A;  2PVP A;  2WE6 A;  5IYC G;  1E4E B;  1KJJ A;  4UCO A;  5KT6 A;  5FLM G;  4LSX A;  3T1H H;  4LFC H;  1HNZ H;  4Q8F A;  2R8H A;  3ETH A;  2XCL A;  2W9C A;  3T5H A;  2UVU A;  1AUX A;  2C2R A;  1I50 A;  4NXM H;  1MZB A;  2XGP A;  5LXT F;  4RUA A;  4DV1 H;  1C30 A;  1GO3 E;  3UFX B;  2JA6 G;  4DV5 H;  4ECY A;  4EBC A;  1KEE A;  1KJI A;  4ED0 A;  2HJW A;  2W9B A;  3Q8P B;  2YRW A;  5KFS A;  4U6P A;  3T5K A;  5EDW A;  5F9L A;  2FLL A;  2UXC H;  5L9X A;  4A93 G;  3K5H A;  2V4R A;  4IRK A;  2W57 A;  3BA9 A;  4DV4 H;  2I8C A;  3SE7 A;  1V9P A;  2FK2 A;  4O2B F;  1KJQ A;  3R5X A;  4F4W A;  2W6P A;  2W71 A;  3G6X A;  5KG6 A;  2UUB H;  4J9P A;  1I6U A;  1EUD B;  1JDB B;  3GTL A;  3KAK A;  5C5J A;  2XCP A;  3L4J A;  1CQJ B;  2Q2U A;  4KHP H;  4A3J G;  1RJR A;  1GSA A;  4PWQ A;  4MV1 A;  1Z2N X;  3Q1K A;  1ZHS A;  1KC7 A;  4RB0 A;  2J6U A;  1SYX B;  1WR2 A; 
#chains in the Genus database with same CATH homology
 5EOY A;  4JI0 H;  2VPS A;  1BJT A;  2UXB H;  4LH7 A;  3RF2 A;  3N44 B;  5LMN H;  4DR5 H;  4DR7 H;  4AQY H;  4GLX A;  4EFB A;  3J7A K;  3IG0 A;  3OTO H;  4UCV A;  4JI8 H;  2RGV A;  2F4V H;  3N43 B;  4JI3 H;  3KAJ A;  4GKJ H;  4LH6 A;  5FD6 A;  1M0T A;  3CVZ A;  5FPR A;  4YY3 H;  4JI5 H;  1O75 A;  4B3R H;  4ETS A;  1IBM H;  1N32 H;  2ZJT A;  3JSL A;  5LMU H;  1N33 H;  4OX9 H;  4LF9 H;  4LMY A;  3N6X A;  2XIG A;  4RAY A;  2WYO A;  2VQF H;  3FMA A;  4MTE A;  4JYA H;  4UCS A;  4DUY H;  1A0I A;  1X9N A;  3C0F B;  2YCH A;  2CW7 A;  2CW8 A;  5D1P A;  1I94 H;  3K3V A;  3N42 B;  2ZM6 H;  3BA8 A;  1ZHQ A;  1E4F T;  2UXD H;  1XMO H;  1FJG H;  1HNX H;  1S68 A;  2VOB A;  2KSW A;  4DR1 H;  2UUC H;  4JI6 H;  4JV5 H;  5LL6 b;  3KXY T;  4X62 H;  3BAA A;  1M0W A;  4DR3 H;  4DR2 H;  5BR8 H;  2VUG A;  3PN1 A;  4X64 H;  4X66 H;  4Q0Y A;  1TAE A;  4UFZ A;  4CC6 A;  1B04 A;  3T1Y H;  4PDB A;  4UCR A;  4LSA A;  4MTD A;  4A2A A;  2Q2T A;  2WDT A;  3F8N A;  2FE3 A;  5FPO A;  1GYF A;  2E5L H;  4RZQ A;  4YHH H;  4M7E A;  4FM9 A;  3H20 A;  1J5E H;  2OWO A;  4JI2 H;  1FVI A;  4RB1 A;  3L4K A;  2UUA H;  3DF7 A;  1L2Z A;  3JAM W;  3RJ0 A;  4DV6 H;  4LF4 H;  3N41 B;  4APM A;  4LF8 H;  5IWA H;  4CC5 A;  1IBK H;  5D1O B;  1XMQ H;  1IBL H;  4MV9 A;  1HR0 H;  3HXL A;  4JI1 H;  4JI7 H;  5FD5 A;  1XDN A;  5D1O A;  4MV7 A;  4BWS C;  3L2P A;  2RGR A;  4DR6 H;  1SEI A;  3J80 W;  4EEQ A;  2UU9 H;  2MCT A;  3RGX A;  2WE6 A;  4UCO A;  4DV0 H;  3T1H H;  1FKA H;  3MWM A;  4LSX A;  4LFC H;  5A2Q W;  1HNZ H;  4GKK H;  1I6U A;  4EFE A;  4DV7 H;  1E4G T;  3EYY A;  4NXM H;  1MZB A;  1TA8 A;  4DV1 H;  3JSN A;  4DV5 H;  4IAJ A;  4I7H A;  4LF5 H;  4LFB H;  4R7R A;  5IT9 W;  3RGZ A;  4UCT A;  2HVQ A;  2HHH H;  4B3T H;  4X65 H;  3LML A;  4DV2 H;  4LF7 H;  2UXC H;  1Z2O X;  2W57 A;  3BA9 A;  4DV4 H;  1P8L A;  1V9P A;  1DGS A;  2O03 A;  4J0M A;  4LF6 H;  3UQ8 A;  4RAZ A;  1Z2P X;  3BAB A;  1S03 G;  2HVR A;  5FLX W;  2UUB H;  1BGW A;  3N40 P;  2HVS A;  4JI4 H;  4DR4 H;  4K0K H;  4RB3 C;  2HGS A;  4UCU A;  4DUZ H;  1XNQ H;  3KAK A;  3KAL A;  3L4J A;  2Q2U A;  4B3S H;  1HNW H;  4KHP H;  3J81 W;  1XNR H;  1N34 H;  1N36 H;  1AN7 A;  4A2B A;  3RTX A;  4LFA H;  3RIZ A;  4DV3 H;  1WH2 A;  1Z2N X;  1ZHS A;  4NXN H;  1VS0 A;  3M4I A;  4RB0 A;  4RB2 C;  1SYX B;  4B3M H;  2VQE H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...