3KXYT

Crystal structure of the exsc-exse complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
TEAVGHFEGRSVTRAAVRGEDRSSVAGLARWLARNVAGDPRSEQALQRLADGDGTPLEARTVRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Crystal Structure of the ExsC.ExsE Complex Reveals Distinctive Binding Interactions of the Pseudomonas aeruginosa Type III Secretion Chaperone ExsC with ExsE and ExsD.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Chaperone/transcription inhibitor
molecule keywords Exoenzyme S synthesis protein C
total genus 11
structure length 65
sequence length 65
chains with identical sequence U, V, W, X, Y
ec nomenclature
pdb deposition date 2009-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF18286 T3SS_ExsE Type III secretion system ExsE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.370 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kxyT00
3KXYT
chains in the Genus database with same CATH superfamily
3R5HA 1T3NA 1SYXB 3OUUA 1K83A 1AN7A 2R8HA 2YW2A 2W8KA 3PW4A 4UFZA 4FBUA 4RAZA 3GILA 5FLMG 2E2IA 1DIKA 4RAYA 4DR2H 4IRCA 3BA8A 1N33H 4LFBH 3GTPA 3LMLA 3H0GG 3HXLA 4ECZA 5JVDF 4YAKB 3OUZA 3TQ1A 2W6OA 3CQZA 4HQ6A 1S9FA 4LF8H 3IG0A 1M7JA 4B3MH 3QZ7A 2OH2A 4A3MG 5KFPA 4DV6H 3JSNA 1Y1VG 5CA0F 1N56A 3FKIA 5KFEA 4RB1A 2JA6G 3KHHA 2XCAA 3MR5A 4DV3H 2VA3A 5KT7A 3ETJA 4WD3A 4NLGA 5BPFA 2R7LA 5FLXW 2R8IA 5C4XG 1E4GT 4DUYH 3I4MG 2WDTA 4XZ3B 3GIKA 1B6RA 2W9CB 5DG7A 3GQCA 1X9NA 4X65H 2F4VH 2ASLA 3T1HH 2QK4A 2YRWA 2R92A 3PR4A 4EBEA 2R7ZG 5CB4F 4UCRA 5IWAH 4A3IG 4M7EA 4B3SH 2V4RA 1BXRA 2R85A 5C1OA 5F9LA 4C5BA 4EBCA 1TWHA 3KXYT 3L4JA 1IOWA 1CS0A 3PZPA 1N36H 1XDNA 4JI5H 4LFAH 1EYZA 1AUVA 2XCLA 3PW2A 5KFKA 2RF4A 5KFYA 4GKKH 5KFLA 2RGRA 2W9AA 2JA7A 2YZNA 3MFHA 2W6PA 2W7PA 1ZQ7A 3M9MB 1R9TA 5KFZA 2JA8G 4PDBA 4B3TH 3RGXA 5DG8A 2UXBH 2JA6A 1VAJA 4MV6A 5IYCG 3J80W 4J9RA 4RB2C 4EEQA 2W9BB 4IZOA 2I80A 4BY1G 1W96A 3T1YH 4DR6H 5KFUA 1I7NA 3I12A 3BQ2A 1UNNC 4O3PA 4DR3H 4DL4A 2VR1A 1JXLA 3RFCA 4FBTA 4JI8H 5KFMA 3K3VA 5H80A 2JEJA 2Q2UA 3WO1A 4ED6A 3N40P 3N8DA 3TIGA 5KFXA 3L2PA 3KAKA 4TV9F 1E4FT 3CVZA 1MZBA 3RV3A 3MFIA 2VOBA 3K5HA 2XGQA 5KFWA 2C2EA 4PWQA 4YBZB 1SCUB 2YU9A 5D1OB 3Q2OA 4HYKA 2ATLA 2C35B 4F4XA 1KC7A 4ECQA 1L2ZA 1CE8A 2FK1A 4LF4H 2OLSA 2XGPA 5KFCA 2VA2A 4RZQA 2ASDA 4RB3C 2NU9B 1HNWH 2CW7A 2WB1A 2J9GA 4M9UA 3M4IA 5KX5F 5KG3A 2R93A 5KG6A 5IYZF 4MV8A 3GTKA 3HBLA 4Q44A 3HOXG 4ME6A 4A93G 2DLNA 4J9QA 2C2DA 3RB3A 4GLXA 4ECSA 5I47A 4MV7A 3MR6A 1I7LA 4IWXA 5KFNA 1M0TA 4ZHQF 3EPIA 3T5JA 4LSXA 3Q8SB 2BQ3A 4J9KA 1BJTA 3V6HA 4JI3H 4A3BG 5C44G 2NVYA 3HB9A 3RAQA 2R7NA 1S68A 4YB8B 5KKNB 4IR9A 3JAMW 2XIGA 1Y14B 5KFFA 3GIIA 4IRKA 4YR0A 2BQRA 2V9WA 3KALA 4TQSA 5L1JA 2FLPA 4IRDA 4F4ZA 2CZGA 4U6PA 3M9NB 3I4NG 3GLKA 1P8LA 3EYYA 4HNVA 3GTMA 5C3EG 2IP4A 4E4TA 5LA6F 1TWGA 5L9XA 4LF9H 1WCMA 2FPGB 4JI2H 5FD6A 3BQ1A 1T36A 4ZI7F 1IOVA 3U9SA 5DQGA 4ED0A 4IHJF 4XYMB 3HOYG 2C28A 3FDSA 4MV9A 2ZM6H 2VUMA 3OHBA 4ECXA 4RNOA 3L4KA 4A3KG 3PW5A 5C8YF 3RUPA 3MR2A 1C30A 5KT3A 5KFGA 4ED1A 1B33N 1M0WA 4EFEA 3JRXA 1RJQA 5FJ8G 2HVSA 1VBHA 4OX9H 2YS7A 1WSCA 4I55F 4O2BF 2NUAB 2W8LA 3T5LA 4QIWE 3R5FA 2JA5G 3RIZA 2NVXA 2AQ4A 4A3EG 4XX0B 5KG7A 3MWMA 2R87A 4YJ2F 4EGQA 5BR8H 5EDWA 1RK6A 4R7RA 4HNUA 5KT4A 4YHHH 2RDJA 4J9NA 1M6VA 2AGQA 1XNQH 2JEFA 1GO3E 4QW9A 3T5HA 2CW8A 2UUCH 3JZIA 1RYSA 3J81W 4DR1H 4O4HF 4A2BA 5IT9W 4I7HA 2YZGA 4C5CA 1Y1WG 2J6SA 1B04A 2VQDA 3J7AK 1W93A 3RTXA 3H4DA 2VUMG 4ED3A 4Q43A 3GIMA 2PBZA 3LP8A 4NXMH 2AGPA 5KFHA 5T14A 2UVWA 4FM9A 4TUYF 1IBKH 1XMQH 3BQ0A 4CC6A 4X64H 4FS2A 5EWGA 2V5AA 4ECYA 4AQYH 3OTOH 1PK8A 3RGZA 4DL6A 1OWTA 2ZDHA 3H0GA 2UVRA 1S0MA 4JV1A 4RZRA 5KFBA 3TQTA 3RV4A 2Y0SA 1DV1A 2R8GA 4DV2H 3N44B 1GYFA 4GKJH 2W9CA 4YR3A 3RB4A 5KG2A 4EG0A 2DPIA 1S03G 4ECRA 3VPDA 3R5XA 3BA9A 1Y1WA 5BPHA 4DV7H 1FKAH 3VMMA 2W6MA 3SE7A 5JVLA 1V9PA 3SI8A 1GSAA 2PMZA 4EFBA 2CQYA 4K0KH 4JUZA 2DIKA 3Q8RB 2HHHH 3H40A 2JEGA 4YY3H 4WBNF 2I87A 5DLFA 4LF5H 4JV5H 2W70A 1I6UA 5IYDG 1C3OA 1AUXA 1ULZA 1TWAA 2P0AA 2W71A 4O3RA 2WE6A 4EYHB 3PW0A 3WO0A 1EUCB 4F4WA 1B6SA 1TWCA 2UU9H 2MCTA 3GTJA 3G6YA 5JH7F 2FLNA 3V4ZA 4EGJA 1TWFA 1V4YA 2W6NA 4A3FG 5GONF 5EWEA 4LFCH 4O4LF 2VQEH 5K2MA 4XYLB 1Z2PX 3K3PA 2XC9A 4EEYA 3HOZG 4ECTA 2R7KA 2R93G 4ED8A 4JI4H 4G3IA 2YZMA 5LMNH 4LMYA 1J5EH 1JLLB 3FKIG 3ORQA 2V59A 2NU6B 2YYAA 4Q0YA 1K1SA 3BABA 1VS0A 4L1KA 5KFQA 2RGVA 2R92G 4MA0A 1CQIB 1O75A 2FPIB 4YP3A 1BGWA 5D1PA 5D1OA 2FK3A 4MV4A 4JI7H 4BY7G 4LH7A 4O3SA 1DGSA 3RB0A 3V6JA 3VPBA 3Q8QB 4J9SA 3H4BA 1IBMH 3N6XA 4DR4H 2FE3A 1S10A 4ETSA 3GV5B 2VUGA 2XD4A 3PO3G 3HKZE 4DV5H 3HKZA 1JIHA 1Y1VA 2Y0SE 3MJFA 5FPRA 2AGOA 4BBSG 1JX4A 1IBLH 1S0OA 5IP9G 3Q1KA 1UC9A 2R8JA 5KT6A 4O4IF 2I8CA 2R8KA 3V6KA 3RJ0A 2WAQA 3R23A 2BQUA 5HV6A 2PVPA 3K5IA 3GV7B 2E5LH 2YCHA 2X0SA 4C2MA 4CC5A 3NGDA 4IR1A 5KFVA 5KG1A 1KBLA 4QWAA 4UCTA 1HR0H 2B63A 1CQJB 4R8UA 4RUCA 4C5AA 2FK2A 2UVUA 4JI6H 4QWDA 2B63G 2HGSA 4YQWA 4UCUA 1WCMG 4DV4H 1N32H 4FS1A 3WNZA 3PW7A 5KFAA 1GSOA 5JUMA 2C22A 2V58A 3AYHB 2ASJA 2ZDQA 5KFDA 4DLKA 3MWDA 4DL3A 1KJQA 1KEEA 4DUZH 3ORRA 5KT2A 1FJGH 3OHAA 4JI0H 1BNCA 2DZDA 2R6FA 3GIDA 5LMUH 3RBDA 5KFSA 4LF7H 2NU8B 1K1QA 4AYBA 4J9PA 4RNMA 4DL7A 2PMZE 2W9BA 4JV2A 1EZ1A 4DV1H 3KHRA 2FB9A 2W6ZA 2VPSA 4QW8A 4A2AA 4ZOLF 4J0MA 4I50F 5KG4A 4QWCA 2NU7B 1E4EB 3EPGA 2Q2TA 4A3LG 4KHPH 1V51A 1N34H 1KJIA 3G8CA 5KFTA 5KFIA 2DWCA 2FPPB 1RJPA 2WYOA 2IA6A 4QWEA 3UFXB 2E2HA 2XCPA 4U7CA 4TV8F 5J2UF 3GTLA 5J2TF 3GTQA 3RAXA 4FU0A 3KHGA 3PN1A 2HVRA 3U9TA 4JI1H 3Q8PB 3TIIA 3T5KA 5CA1F 4HR7A 4QIWA 1FVIA 2ZJTA 2JA5A 2UUAH 3H20A 5C1PA 4X66H 4AYBE 3FMAA 2YS6A 3QFFA 4MTEA 1JDEA 5DG9A 5A2QW 3DF7A 5L1LA 4EYIB 4GC6A 4IAJA 4Q8FA 5L1KA 2HVQA 5HBRB 5LOVF 4O3OA 2GPSA 2KSWA 2WB1E 2VQFH 4O3QA 2GLTA 1WH2A 4F4YA 2JA7G 5DLGA 4LSAA 1Z2NX 4ZQIA 4DV0H 5F9NA 5KG5A 4MV1A 1GSHA 4MA5A 2SCUB 1S0NA 1I94H 4LH6A 3UQ8A 4JV0A 3GV8B 2IBKA 2FJZA 2VPQA 3MR3A 2FMAA 5KFRA 1PX2A 2OWOA 2CKZB 2YRXA 1EHIA 3LWBA 5EWFA 4MV3A 4RB0A 5KFOA 5KT5A 5DGBA 4BWSC 4Y8VB 2GPWA 3N41B 5L1IA 1TAEA 2IMWP 2JEIA 2ALZA 3BAAA 1KJ9A 5C5JA 3M9OB 1JDBB 3QZ8A 4R8UB 3KAJA 3IN5A 1E4EA 3PR5B 1A9XA 4DL2A 3PVXA 1XNRH 2UXCH 1EUDB 3JSLA 4GC7A 1WR2A 3GTOA 5FD5A 5LYJF 5D8DA 1SEIA 4BBRG 2W6QA 4UCVA 3C0FB 2R86A 4TQRA 4JYAH 3N42B 4Q45A 2FLLA 3GIQA 2M05A 4DR7H 3BJYA 5EZYF 4ECUA 4A3JG 2DPJA 3KTMA 5BMVF 2C2RA 1N48A 4YR2A 1RYRA 1ZETA 1Z2OX 4Q8EA 4NXNH 3HOWG 3E5NA 2FKLA 5EOYA 4ED2A 3N43B 1HNZH 4HNTA 2UUBH 5IP7G 2R84A 2FP4B 4LF6H 4ECVA 4EBDA 4X62H 3GIPA 4ED7A 3JRWA 1ZHSA 2UXDH 3RF2A 2R7MA 2V4QA 1JKJB 4RUAA 2W57A 3OSPA 3H3VH 1VBGA 1RJRA 4UCSA 4DL5A 1RK5A 1ZHQA 3MWEA 1SFOA 3HOUG 4RU9A 5FPOA 4J9MA 2RDIA 1HNXH 4YAJB 3BG5A 5IYBG 4J9OA 3KHLA 3G6XA 5DGAA 2J6UA 4O2AF 1I3QA 1DV2A 5KFJA 1KJ8A 1GLVA 2J6TA 4B3RH 4BXXG 1A0IA 2PN1A 3V4SA 1T94A 1TA8A 4YJ3F 2HJWA 5LP6F 3RBEA 4DR5H 5LXTF 4A3DG 3HOVG 3TINA 5LL6b 2BR0A 3ETHA 4I4TF 1VKZA 5CAEB 2QYZA 5KG0A 1S97A 3RB6A 1KJJA 4J9LA 4MAMA 5DQIA 3GIJA 4A3GG 5DQHA 4QJFA 2O03A 2AU0A 4QWBA 4UCOA 4O3NA 3VPCA 2UVVA 3G6VA 2WAQE 3GTGA 2YL2A 4ECWA 2WTFA 4F50A 4MTDA 2R82A 1XMOH 5JQWA 4A3CG 4RNNA 3F8NA 2ZDGA 1I50A 3PO2G 4IWYA 4APMA 3OSNA 2W7OA 2R7ZA 1UC8A 2C00A 1GGOA
chains in the Genus database with same CATH topology
1SYXB 1M0TA 1AN7A 2HVQA 4LFCH 4LSXA 2VQEH 2KSWA 1Z2PX 2VQFH 1BJTA 4UFZA 4JI3H 1WH2A 4RAZA 4RAYA 4LSAA 4DR2H 1Z2NX 3BA8A 4JI4H 1N33H 5LMNH 4DV0H 1S68A 4LFBH 3LMLA 3JAMW 3HXLA 4LMYA 1J5EH 2XIGA 1I94H 4LH6A 3UQ8A 4LF8H 4Q0YA 3IG0A 3BABA 3KALA 4B3MH 1VS0A 2RGVA 1P8LA 4DV6H 3EYYA 3JSNA 1O75A 2OWOA 1BGWA 1GYFA 5D1PA 5D1OA 4RB0A 4LF9H 4JI2H 4BWSC 5FD6A 3N41B 4RB1A 1TAEA 3BAAA 4JI7H 4MV9A 4LH7A 2ZM6H 1DGSA 4DV3H 3KAJA 3L4KA 2UXCH 1XNRH 1IBMH 3N6XA 5FLXW 4DR4H 2FE3A 3JSLA 4ETSA 1E4GT 1M0WA 2VUGA 5FD5A 2WDTA 4EFEA 4DUYH 4DV5H 1X9NA 4X65H 1SEIA 5FPRA 4UCVA 2HVSA 3T1HH 4OX9H 1IBLH 3C0FB 2F4VH 4JYAH 3N42B 4UCRA 5IWAH 4DR7H 3RIZA 3RJ0A 4B3SH 4M7EA 2E5LH 3MWMA 5BR8H 2YCHA 4R7RA 4YHHH 1XNQH 3KXYT 3L4JA 1N36H 4JI5H 4LFAH 1XDNA 1Z2OX 4CC5A 4NXNH 2CW8A 2UUCH 4UCTA 5EOYA 1HR0H 3J81W 4GKKH 2RGRA 3N43B 4JI6H 4DR1H 1HNZH 4A2BA 2HGSA 5IT9W 4I7HA 4UCUA 4DV4H 1N32H 2UUBH 4PDBA 1B04A 4B3TH 3J7AK 3RTXA 3RGXA 4LF6H 4X62H 2UXBH 4NXMH 3J80W 3T1YH 1ZHSA 4RB2C 4EEQA 4DUZH 3RF2A 1XMQH 4DR6H 1FJGH 2UXDH 4FM9A 2W57A 4JI0H 1IBKH 4CC6A 4X64H 5LMUH 4DR3H 4UCSA 1ZHQA 4AQYH 3OTOH 3RGZA 4JI8H 4LF7H 5FPOA 1HNXH 3K3VA 2Q2UA 4DV2H 3N44B 4DV1H 4GKJH 3N40P 4B3RH 3L2PA 2VPSA 1A0IA 4A2AA 3KAKA 4J0MA 2Q2TA 1E4FT 1TA8A 3CVZA 1MZBA 1S03G 4KHPH 2VOBA 4DR5H 1N34H 3BA9A 5LL6b 4DV7H 1FKAH 2WYOA 5D1OB 1V9PA 4EFBA 1L2ZA 4K0KH 4LF4H 2HHHH 2O03A 4RZQA 4UCOA 3PN1A 4RB3C 4YY3H 2HVRA 4JI1H 1HNWH 2CW7A 4JV5H 4LF5H 4MTDA 3M4IA 1I6UA 1XMOH 1FVIA 2ZJTA 2WE6A 3F8NA 2UUAH 3H20A 4X66H 3FMAA 4MTEA 4APMA 2UU9H 2MCTA 5A2QW 3DF7A 4GLXA 4IAJA 4MV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXY T; 
#chains in the Genus database with same CATH topology
 3R5H A;  1T3N A;  1SYX B;  3OUU A;  1K83 A;  1AN7 A;  2R8H A;  2YW2 A;  2W8K A;  3PW4 A;  4UFZ A;  4FBU A;  4RAZ A;  3GIL A;  5FLM G;  2E2I A;  1DIK A;  4RAY A;  4DR2 H;  4IRC A;  3BA8 A;  1N33 H;  4LFB H;  3GTP A;  3LML A;  3H0G G;  3HXL A;  4ECZ A;  5JVD F;  4YAK B;  3OUZ A;  3TQ1 A;  2W6O A;  3CQZ A;  4HQ6 A;  1S9F A;  4LF8 H;  3IG0 A;  1M7J A;  4B3M H;  3QZ7 A;  2OH2 A;  4A3M G;  5KFP A;  4DV6 H;  3JSN A;  1Y1V G;  5CA0 F;  1N56 A;  3FKI A;  5KFE A;  4RB1 A;  2JA6 G;  3KHH A;  2XCA A;  3MR5 A;  4DV3 H;  2VA3 A;  5KT7 A;  3ETJ A;  4WD3 A;  4NLG A;  5BPF A;  2R7L A;  5FLX W;  2R8I A;  5C4X G;  1E4G T;  4DUY H;  3I4M G;  2WDT A;  4XZ3 B;  3GIK A;  1B6R A;  2W9C B;  5DG7 A;  3GQC A;  1X9N A;  4X65 H;  2F4V H;  2ASL A;  3T1H H;  2QK4 A;  2YRW A;  2R92 A;  3PR4 A;  4EBE A;  2R7Z G;  5CB4 F;  4UCR A;  5IWA H;  4A3I G;  4M7E A;  4B3S H;  2V4R A;  1BXR A;  2R85 A;  5C1O A;  5F9L A;  4C5B A;  4EBC A;  1TWH A;  3KXY T;  3L4J A;  1IOW A;  1CS0 A;  3PZP A;  1N36 H;  1XDN A;  4JI5 H;  4LFA H;  1EYZ A;  1AUV A;  2XCL A;  3PW2 A;  5KFK A;  2RF4 A;  5KFY A;  4GKK H;  5KFL A;  2RGR A;  2W9A A;  2JA7 A;  2YZN A;  3MFH A;  2W6P A;  2W7P A;  1ZQ7 A;  3M9M B;  1R9T A;  5KFZ A;  2JA8 G;  4PDB A;  4B3T H;  3RGX A;  5DG8 A;  2UXB H;  2JA6 A;  1VAJ A;  4MV6 A;  5IYC G;  3J80 W;  4J9R A;  4RB2 C;  4EEQ A;  2W9B B;  4IZO A;  2I80 A;  4BY1 G;  1W96 A;  3T1Y H;  4DR6 H;  5KFU A;  1I7N A;  3I12 A;  3BQ2 A;  1UNN C;  4O3P A;  4DR3 H;  4DL4 A;  2VR1 A;  1JXL A;  3RFC A;  4FBT A;  4JI8 H;  5KFM A;  3K3V A;  5H80 A;  2JEJ A;  2Q2U A;  3WO1 A;  4ED6 A;  3N40 P;  3N8D A;  3TIG A;  5KFX A;  3L2P A;  3KAK A;  4TV9 F;  1E4F T;  3CVZ A;  1MZB A;  3RV3 A;  3MFI A;  2VOB A;  3K5H A;  2XGQ A;  5KFW A;  2C2E A;  4PWQ A;  4YBZ B;  1SCU B;  2YU9 A;  5D1O B;  3Q2O A;  4HYK A;  2ATL A;  2C35 B;  4F4X A;  1KC7 A;  4ECQ A;  1L2Z A;  1CE8 A;  2FK1 A;  4LF4 H;  2OLS A;  2XGP A;  5KFC A;  2VA2 A;  4RZQ A;  2ASD A;  4RB3 C;  2NU9 B;  1HNW H;  2CW7 A;  2WB1 A;  2J9G A;  4M9U A;  3M4I A;  5KX5 F;  5KG3 A;  2R93 A;  5KG6 A;  5IYZ F;  4MV8 A;  3GTK A;  3HBL A;  4Q44 A;  3HOX G;  4ME6 A;  4A93 G;  2DLN A;  4J9Q A;  2C2D A;  3RB3 A;  4GLX A;  4ECS A;  5I47 A;  4MV7 A;  3MR6 A;  1I7L A;  4IWX A;  5KFN A;  1M0T A;  4ZHQ F;  3EPI A;  3T5J A;  4LSX A;  3Q8S B;  2BQ3 A;  4J9K A;  1BJT A;  3V6H A;  4JI3 H;  4A3B G;  5C44 G;  2NVY A;  3HB9 A;  3RAQ A;  2R7N A;  1S68 A;  4YB8 B;  5KKN B;  4IR9 A;  3JAM W;  2XIG A;  1Y14 B;  5KFF A;  3GII A;  4IRK A;  4YR0 A;  2BQR A;  2V9W A;  3KAL A;  4TQS A;  5L1J A;  2FLP A;  4IRD A;  4F4Z A;  2CZG A;  4U6P A;  3M9N B;  3I4N G;  3GLK A;  1P8L A;  3EYY A;  4HNV A;  3GTM A;  5C3E G;  2IP4 A;  4E4T A;  5LA6 F;  1TWG A;  5L9X A;  4LF9 H;  1WCM A;  2FPG B;  4JI2 H;  5FD6 A;  3BQ1 A;  1T36 A;  4ZI7 F;  1IOV A;  3U9S A;  5DQG A;  4ED0 A;  4IHJ F;  4XYM B;  3HOY G;  2C28 A;  3FDS A;  4MV9 A;  2ZM6 H;  2VUM A;  3OHB A;  4ECX A;  4RNO A;  3L4K A;  4A3K G;  3PW5 A;  5C8Y F;  3RUP A;  3MR2 A;  1C30 A;  5KT3 A;  5KFG A;  4ED1 A;  1B33 N;  1M0W A;  4EFE A;  3JRX A;  1RJQ A;  5FJ8 G;  2HVS A;  1VBH A;  4OX9 H;  2YS7 A;  1WSC A;  4I55 F;  4O2B F;  2NUA B;  2W8L A;  3T5L A;  4QIW E;  3R5F A;  2JA5 G;  3RIZ A;  2NVX A;  2AQ4 A;  4A3E G;  4XX0 B;  5KG7 A;  3MWM A;  2R87 A;  4YJ2 F;  4EGQ A;  5BR8 H;  5EDW A;  1RK6 A;  4R7R A;  4HNU A;  5KT4 A;  4YHH H;  2RDJ A;  4J9N A;  1M6V A;  2AGQ A;  1XNQ H;  2JEF A;  1GO3 E;  4QW9 A;  3T5H A;  2CW8 A;  2UUC H;  3JZI A;  1RYS A;  3J81 W;  4DR1 H;  4O4H F;  4A2B A;  5IT9 W;  4I7H A;  2YZG A;  4C5C A;  1Y1W G;  2J6S A;  1B04 A;  2VQD A;  3J7A K;  1W93 A;  3RTX A;  3H4D A;  2VUM G;  4ED3 A;  4Q43 A;  3GIM A;  2PBZ A;  3LP8 A;  4NXM H;  2AGP A;  5KFH A;  5T14 A;  2UVW A;  4FM9 A;  4TUY F;  1IBK H;  1XMQ H;  3BQ0 A;  4CC6 A;  4X64 H;  4FS2 A;  5EWG A;  2V5A A;  4ECY A;  4AQY H;  3OTO H;  1PK8 A;  3RGZ A;  4DL6 A;  1OWT A;  2ZDH A;  3H0G A;  2UVR A;  1S0M A;  4JV1 A;  4RZR A;  5KFB A;  3TQT A;  3RV4 A;  2Y0S A;  1DV1 A;  2R8G A;  4DV2 H;  3N44 B;  1GYF A;  4GKJ H;  2W9C A;  4YR3 A;  3RB4 A;  5KG2 A;  4EG0 A;  2DPI A;  1S03 G;  4ECR A;  3VPD A;  3R5X A;  3BA9 A;  1Y1W A;  5BPH A;  4DV7 H;  1FKA H;  3VMM A;  2W6M A;  3SE7 A;  5JVL A;  1V9P A;  3SI8 A;  1GSA A;  2PMZ A;  4EFB A;  2CQY A;  4K0K H;  4JUZ A;  2DIK A;  3Q8R B;  2HHH H;  3H40 A;  2JEG A;  4YY3 H;  4WBN F;  2I87 A;  5DLF A;  4LF5 H;  4JV5 H;  2W70 A;  1I6U A;  5IYD G;  1C3O A;  1AUX A;  1ULZ A;  1TWA A;  2P0A A;  2W71 A;  4O3R A;  2WE6 A;  4EYH B;  3PW0 A;  3WO0 A;  1EUC B;  4F4W A;  1B6S A;  1TWC A;  2UU9 H;  2MCT A;  3GTJ A;  3G6Y A;  5JH7 F;  2FLN A;  3V4Z A;  4EGJ A;  1TWF A;  1V4Y A;  2W6N A;  4A3F G;  5GON F;  5EWE A;  4LFC H;  4O4L F;  2VQE H;  5K2M A;  4XYL B;  1Z2P X;  3K3P A;  2XC9 A;  4EEY A;  3HOZ G;  4ECT A;  2R7K A;  2R93 G;  4ED8 A;  4JI4 H;  4G3I A;  2YZM A;  5LMN H;  4LMY A;  1J5E H;  1JLL B;  3FKI G;  3ORQ A;  2V59 A;  2NU6 B;  2YYA A;  4Q0Y A;  1K1S A;  3BAB A;  1VS0 A;  4L1K A;  5KFQ A;  2RGV A;  2R92 G;  4MA0 A;  1CQI B;  1O75 A;  2FPI B;  4YP3 A;  1BGW A;  5D1P A;  5D1O A;  2FK3 A;  4MV4 A;  4JI7 H;  4BY7 G;  4LH7 A;  4O3S A;  1DGS A;  3RB0 A;  3V6J A;  3VPB A;  3Q8Q B;  4J9S A;  3H4B A;  1IBM H;  3N6X A;  4DR4 H;  2FE3 A;  1S10 A;  4ETS A;  3GV5 B;  2VUG A;  2XD4 A;  3PO3 G;  3HKZ E;  4DV5 H;  3HKZ A;  1JIH A;  1Y1V A;  2Y0S E;  3MJF A;  5FPR A;  2AGO A;  4BBS G;  1JX4 A;  1IBL H;  1S0O A;  5IP9 G;  3Q1K A;  1UC9 A;  2R8J A;  5KT6 A;  4O4I F;  2I8C A;  2R8K A;  3V6K A;  3RJ0 A;  2WAQ A;  3R23 A;  2BQU A;  5HV6 A;  2PVP A;  3K5I A;  3GV7 B;  2E5L H;  2YCH A;  2X0S A;  4C2M A;  4CC5 A;  3NGD A;  4IR1 A;  5KFV A;  5KG1 A;  1KBL A;  4QWA A;  4UCT A;  1HR0 H;  2B63 A;  1CQJ B;  4R8U A;  4RUC A;  4C5A A;  2FK2 A;  2UVU A;  4JI6 H;  4QWD A;  2B63 G;  2HGS A;  4YQW A;  4UCU A;  1WCM G;  4DV4 H;  1N32 H;  4FS1 A;  3WNZ A;  3PW7 A;  5KFA A;  1GSO A;  5JUM A;  2C22 A;  2V58 A;  3AYH B;  2ASJ A;  2ZDQ A;  5KFD A;  4DLK A;  3MWD A;  4DL3 A;  1KJQ A;  1KEE A;  4DUZ H;  3ORR A;  5KT2 A;  1FJG H;  3OHA A;  4JI0 H;  1BNC A;  2DZD A;  2R6F A;  3GID A;  5LMU H;  3RBD A;  5KFS A;  4LF7 H;  2NU8 B;  1K1Q A;  4AYB A;  4J9P A;  4RNM A;  4DL7 A;  2PMZ E;  2W9B A;  4JV2 A;  1EZ1 A;  4DV1 H;  3KHR A;  2FB9 A;  2W6Z A;  2VPS A;  4QW8 A;  4A2A A;  4ZOL F;  4J0M A;  4I50 F;  5KG4 A;  4QWC A;  2NU7 B;  1E4E B;  3EPG A;  2Q2T A;  4A3L G;  4KHP H;  1V51 A;  1N34 H;  1KJI A;  3G8C A;  5KFT A;  5KFI A;  2DWC A;  2FPP B;  1RJP A;  2WYO A;  2IA6 A;  4QWE A;  3UFX B;  2E2H A;  2XCP A;  4U7C A;  4TV8 F;  5J2U F;  3GTL A;  5J2T F;  3GTQ A;  3RAX A;  4FU0 A;  3KHG A;  3PN1 A;  2HVR A;  3U9T A;  4JI1 H;  3Q8P B;  3TII A;  3T5K A;  5CA1 F;  4HR7 A;  4QIW A;  1FVI A;  2ZJT A;  2JA5 A;  2UUA H;  3H20 A;  5C1P A;  4X66 H;  4AYB E;  3FMA A;  2YS6 A;  3QFF A;  4MTE A;  1JDE A;  5DG9 A;  5A2Q W;  3DF7 A;  5L1L A;  4EYI B;  4GC6 A;  4IAJ A;  4Q8F A;  5L1K A;  2HVQ A;  5HBR B;  5LOV F;  4O3O A;  2GPS A;  2KSW A;  2WB1 E;  2VQF H;  4O3Q A;  2GLT A;  1WH2 A;  4F4Y A;  2JA7 G;  5DLG A;  4LSA A;  1Z2N X;  4ZQI A;  4DV0 H;  5F9N A;  5KG5 A;  4MV1 A;  1GSH A;  4MA5 A;  2SCU B;  1S0N A;  1I94 H;  4LH6 A;  3UQ8 A;  4JV0 A;  3GV8 B;  2IBK A;  2FJZ A;  2VPQ A;  3MR3 A;  2FMA A;  5KFR A;  1PX2 A;  2OWO A;  2CKZ B;  2YRX A;  1EHI A;  3LWB A;  5EWF A;  4MV3 A;  4RB0 A;  5KFO A;  5KT5 A;  5DGB A;  4BWS C;  4Y8V B;  2GPW A;  3N41 B;  5L1I A;  1TAE A;  2IMW P;  2JEI A;  2ALZ A;  3BAA A;  1KJ9 A;  5C5J A;  3M9O B;  1JDB B;  3QZ8 A;  4R8U B;  3KAJ A;  3IN5 A;  1E4E A;  3PR5 B;  1A9X A;  4DL2 A;  3PVX A;  1XNR H;  2UXC H;  1EUD B;  3JSL A;  4GC7 A;  1WR2 A;  3GTO A;  5FD5 A;  5LYJ F;  5D8D A;  1SEI A;  4BBR G;  2W6Q A;  4UCV A;  3C0F B;  2R86 A;  4TQR A;  4JYA H;  3N42 B;  4Q45 A;  2FLL A;  3GIQ A;  2M05 A;  4DR7 H;  3BJY A;  5EZY F;  4ECU A;  4A3J G;  2DPJ A;  3KTM A;  5BMV F;  2C2R A;  1N48 A;  4YR2 A;  1RYR A;  1ZET A;  1Z2O X;  4Q8E A;  4NXN H;  3HOW G;  3E5N A;  2FKL A;  5EOY A;  4ED2 A;  3N43 B;  1HNZ H;  4HNT A;  2UUB H;  5IP7 G;  2R84 A;  2FP4 B;  4LF6 H;  4ECV A;  4EBD A;  4X62 H;  3GIP A;  4ED7 A;  3JRW A;  1ZHS A;  2UXD H;  3RF2 A;  2R7M A;  2V4Q A;  1JKJ B;  4RUA A;  2W57 A;  3OSP A;  3H3V H;  1VBG A;  1RJR A;  4UCS A;  4DL5 A;  1RK5 A;  1ZHQ A;  3MWE A;  1SFO A;  3HOU G;  4RU9 A;  5FPO A;  4J9M A;  2RDI A;  1HNX H;  4YAJ B;  3BG5 A;  5IYB G;  4J9O A;  3KHL A;  3G6X A;  5DGA A;  2J6U A;  4O2A F;  1I3Q A;  1DV2 A;  5KFJ A;  1KJ8 A;  1GLV A;  2J6T A;  4B3R H;  4BXX G;  1A0I A;  2PN1 A;  3V4S A;  1T94 A;  1TA8 A;  4YJ3 F;  2HJW A;  5LP6 F;  3RBE A;  4DR5 H;  5LXT F;  4A3D G;  3HOV G;  3TIN A;  5LL6 b;  2BR0 A;  3ETH A;  4I4T F;  1VKZ A;  5CAE B;  2QYZ A;  5KG0 A;  1S97 A;  3RB6 A;  1KJJ A;  4J9L A;  4MAM A;  5DQI A;  3GIJ A;  4A3G G;  5DQH A;  4QJF A;  2O03 A;  2AU0 A;  4QWB A;  4UCO A;  4O3N A;  3VPC A;  2UVV A;  3G6V A;  2WAQ E;  3GTG A;  2YL2 A;  4ECW A;  2WTF A;  4F50 A;  4MTD A;  2R82 A;  1XMO H;  5JQW A;  4A3C G;  4RNN A;  3F8N A;  2ZDG A;  1I50 A;  3PO2 G;  4IWY A;  4APM A;  3OSN A;  2W7O A;  2R7Z A;  1UC8 A;  2C00 A;  1GGO A; 
#chains in the Genus database with same CATH homology
 1SYX B;  1M0T A;  1AN7 A;  2HVQ A;  4LFC H;  4LSX A;  2VQE H;  2KSW A;  1Z2P X;  2VQF H;  1BJT A;  4UFZ A;  4JI3 H;  1WH2 A;  4RAZ A;  4RAY A;  4LSA A;  4DR2 H;  1Z2N X;  3BA8 A;  4JI4 H;  1N33 H;  5LMN H;  4DV0 H;  1S68 A;  4LFB H;  3LML A;  3JAM W;  3HXL A;  4LMY A;  1J5E H;  2XIG A;  1I94 H;  4LH6 A;  3UQ8 A;  4LF8 H;  4Q0Y A;  3IG0 A;  3BAB A;  3KAL A;  4B3M H;  1VS0 A;  2RGV A;  1P8L A;  4DV6 H;  3EYY A;  3JSN A;  1O75 A;  2OWO A;  1BGW A;  1GYF A;  5D1P A;  5D1O A;  4RB0 A;  4LF9 H;  4JI2 H;  4BWS C;  5FD6 A;  3N41 B;  4RB1 A;  1TAE A;  3BAA A;  4JI7 H;  4MV9 A;  4LH7 A;  2ZM6 H;  1DGS A;  4DV3 H;  3KAJ A;  3L4K A;  2UXC H;  1XNR H;  1IBM H;  3N6X A;  5FLX W;  4DR4 H;  2FE3 A;  3JSL A;  4ETS A;  1E4G T;  1M0W A;  2VUG A;  5FD5 A;  2WDT A;  4EFE A;  4DUY H;  4DV5 H;  1X9N A;  4X65 H;  1SEI A;  5FPR A;  4UCV A;  2HVS A;  3T1H H;  4OX9 H;  1IBL H;  3C0F B;  2F4V H;  4JYA H;  3N42 B;  4UCR A;  5IWA H;  4DR7 H;  3RIZ A;  3RJ0 A;  4B3S H;  4M7E A;  2E5L H;  3MWM A;  5BR8 H;  2YCH A;  4R7R A;  4YHH H;  1XNQ H;  3KXY T;  3L4J A;  1N36 H;  4JI5 H;  4LFA H;  1XDN A;  1Z2O X;  4CC5 A;  4NXN H;  2CW8 A;  2UUC H;  4UCT A;  5EOY A;  1HR0 H;  3J81 W;  4GKK H;  2RGR A;  3N43 B;  4JI6 H;  4DR1 H;  1HNZ H;  4A2B A;  2HGS A;  5IT9 W;  4I7H A;  4UCU A;  4DV4 H;  1N32 H;  2UUB H;  4PDB A;  1B04 A;  4B3T H;  3J7A K;  3RTX A;  3RGX A;  4LF6 H;  4X62 H;  2UXB H;  4NXM H;  3J80 W;  3T1Y H;  1ZHS A;  4RB2 C;  4EEQ A;  4DUZ H;  3RF2 A;  1XMQ H;  4DR6 H;  1FJG H;  2UXD H;  4FM9 A;  2W57 A;  4JI0 H;  1IBK H;  4CC6 A;  4X64 H;  5LMU H;  4DR3 H;  4UCS A;  1ZHQ A;  4AQY H;  3OTO H;  3RGZ A;  4JI8 H;  4LF7 H;  5FPO A;  1HNX H;  3K3V A;  2Q2U A;  4DV2 H;  3N44 B;  4DV1 H;  4GKJ H;  3N40 P;  4B3R H;  3L2P A;  2VPS A;  1A0I A;  4A2A A;  3KAK A;  4J0M A;  2Q2T A;  1E4F T;  1TA8 A;  3CVZ A;  1MZB A;  1S03 G;  4KHP H;  2VOB A;  4DR5 H;  1N34 H;  3BA9 A;  5LL6 b;  4DV7 H;  1FKA H;  2WYO A;  5D1O B;  1V9P A;  4EFB A;  1L2Z A;  4K0K H;  4LF4 H;  2HHH H;  2O03 A;  4RZQ A;  4UCO A;  3PN1 A;  4RB3 C;  4YY3 H;  2HVR A;  4JI1 H;  1HNW H;  2CW7 A;  4JV5 H;  4LF5 H;  4MTD A;  3M4I A;  1I6U A;  1XMO H;  1FVI A;  2ZJT A;  2WE6 A;  3F8N A;  2UUA H;  3H20 A;  4X66 H;  3FMA A;  4MTE A;  4APM A;  2UU9 H;  2MCT A;  5A2Q W;  3DF7 A;  4GLX A;  4IAJ A;  4MV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...