3KXYT

Crystal structure of the exsc-exse complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
TEAVGHFEGRSVTRAAVRGEDRSSVAGLARWLARNVAGDPRSEQALQRLADGDGTPLEARTVRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exoenzyme S synthesis protein C
publication title Analysis of the Crystal Structure of the ExsC.ExsE Complex Reveals Distinctive Binding Interactions of the Pseudomonas aeruginosa Type III Secretion Chaperone ExsC with ExsE and ExsD.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Chaperone/transcription inhibitor
total genus 11
structure length 65
sequence length 65
chains with identical sequence U, V, W, X, Y
ec nomenclature
pdb deposition date 2009-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF18286 T3SS_ExsE Type III secretion system ExsE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.370 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kxyT00
3KXYT
chains in the Genus database with same CATH superfamily
3G6XA 5KFPA 3QZ8A 5KKNB 3GQCA 3EPIA 4XYMB 4YBZB 1P8LA 2R84A 2FK1A 1OWTA 4IRKA 2R7ZA 2UVUA 4EYHB 4A2AA 5IP7G 2XCAA 3RTXA 5L1JA 2R86A 1KJQA 3HOZG 4YJ2F 2VA3A 4O2BF 4A3MG 1Z2PX 4KHPH 2PBZA 4RNNA 2R6FA 4RU9A 4JI5H 1M0WA 4LSXA 4FS2A 3PW5A 3PW7A 4RB0A 4J9OA 1I50A 2RDJA 3H0GG 3QZ7A 5KT4A 2BR0A 5EWFA 3FDSA 5LYJF 1XDNA 5EWEA 2JA7G 3GIJA 5LP6F 2ATLA 2DPIA 2R92G 2Y0SE 4MAMA 4IRCA 4Q0YA 5DLGA 2E2HA 3N41B 1S03G 3E5NA 4DUYH 4I50F 1W96A 2JA7A 4UCRA 1RYRA 2NU8B 2JA6A 2YRWA 2NVXA 2NU6B 2QK4A 1T36A 5KT2A 1GSOA 5LA6F 2ZDHA 4LFCH 3UFXB 1RJRA 1S68A 1TA8A 2W70A 4MV9A 4RUAA 2R8HA 3GIQA 2NUAB 2W6NA 3WO0A 1N32H 2V58A 3JSNA 2YS6A 3N43B 4BBRG 4ED7A 2AGOA 4CC5A 1JIHA 3RGXA 5KG7A 3GV8B 3RAXA 4LF6H 2GPWA 4LSAA 4DUZH 4A2BA 3BA9A 5D8DA 3MJFA 3KHGA 1SCUB 2HVSA 4BBSG 4Y8VB 5FD6A 4LF8H 5KFSA 2R8KA 5KFAA 4DLKA 2ZM6H 4A3JG 4XZ3B 2XGPA 1WSCA 3RUPA 3V6HA 5KFFA 5L1KA 3TIIA 1GO3E 1KJ9A 2C22A 5C4XG 3H4BA 4MA0A 5JQWA 2PMZA 5F9NA 5KG0A 2BQUA 4RB2C 3MWDA 1BGWA 4JI8H 4O3RA 5EZYF 5JVDF 3T5HA 5DLFA 3L4KA 2WB1A 3IG0A 4JI6H 4DR7H 4R8UB 4BY1G 5IYDG 2NVYA 1E4EB 3SI8A 3HXLA 3ORRA 3KALA 4YJ3F 4EEYA 3MR3A 3GTOA 5JUMA 4R7RA 4X65H 3OSNA 2V4RA 4MV3A 4DV6H 5LXTF 3K3PA 2JEFA 2AU0A 3G8CA 3Q1KA 4J9NA 1TWHA 5EDWA 4ED3A 5IYBG 2X0SA 1KBLA 1BNCA 1KJIA 3GTGA 4JI7H 4RUCA 4LF7H 5DGAA 4UCTA 1FVIA 3MR2A 1HNWH 4L1KA 1V4YA 2YZMA 3OHAA 2UVWA 3N8DA 4Q8EA 5KFXA 3GIPA 5KFTA 4JV1A 2YS7A 1GLVA 3K5IA 1DV1A 4QIWA 2E2IA 4F4XA 4ECRA 4UCVA 5KFJA 2OWOA 2DLNA 2O03A 5KFUA 2BQRA 4MV4A 1SFOA 1JDEA 4HQ6A 3IN5A 4ED1A 1UC9A 2NU7B 3BQ0A 4GC7A 4GC6A 1N56A 2UUAH 3OTOH 1SYXB 3BAAA 3PW2A 1EUCB 3GIKA 3TQ1A 5CB4F 3LWBA 4RNOA 2JA8G 4HR7A 2JEIA 4MTEA 4ED8A 1E4EA 4YQWA 2W7OA 4K0KH 3LMLA 1EHIA 3K5HA 4YR3A 5BR8H 3GV7B 5HBRB 2DPJA 3GIIA 4B3SH 2VOBA 5I47A 4EBCA 3RV3A 3MWMA 1B04A 1KJJA 4YY3H 4B3TH 5KFCA 1EYZA 1B6RA 5EOYA 2RGVA 4RAZA 2WAQA 3GILA 3MFHA 1S9FA 2UU9H 5KFYA 2J6SA 1JX4A 3H20A 1WR2A 2NU9B 5KG3A 4RB1A 4JI3H 4IR1A 5DQGA 2GPSA 3MR6A 4AYBA 4J9LA 1XMOH 2XGQA 1VAJA 4DR3H 1ZQ7A 2FP4B 4QW8A 4DR1H 3T5LA 3HOYG 2HHHH 5L1IA 2VA2A 2FPPB 4BY7G 5KFOA 5FPOA 4GKKH 5JH7F 4Q8FA 3Q8QB 3C0FB 3HKZA 4CC6A 4ECYA 3RFCA 4PDBA 4JYAH 2FE3A 3RGZA 2YZNA 1TWCA 3GLKA 2WTFA 3ETJA 4ZI7F 4ME6A 3NGDA 4O4IF 2R8IA 2I87A 4LF5H 1B6SA 1ZHQA 2W9CA 2CQYA 5DGBA 3VPCA 3H40A 4BXXG 2B63A 5FLMG 3TINA 1N48A 4JI1H 4ECSA 2CW8A 4HNVA 1N36H 4A3GG 2WDTA 3JRWA 4O3PA 4MTDA 4QWDA 3Q8PB 5HV6A 3BJYA 4DV7H 2JA6G 2IBKA 3I4NG 2W6OA 3BQ2A 1JXLA 4J9RA 2YRXA 1S0MA 3G6YA 3GTJA 5C5JA 5KFIA 5IP9G 4F4WA 5FLXW 2W8KA 3PO2G 4I55F 2FPGB 4O4HF 4BWSC 5KG4A 2C2DA 2PN1A 2W9BB 4ED0A 3PR5B 3G6VA 4JV0A 4IRDA 1GSAA 5JVLA 2XIGA 4O3NA 4DV2H 3PZPA 4Q45A 3PR4A 3PVXA 4A3CG 5KT7A 2W57A 3T5KA 4HNUA 1S97A 1TAEA 3GTLA 1WCMG 4EYIB 2FK2A 4HNTA 1X9NA 3N6XA 2Q2UA 1M0TA 4WBNF 4C2MA 3CQZA 1XMQH 4EFBA 4RB3C 4UCOA 5C8YF 2UVVA 1WCMA 4B3RH 4C5BA 1S0OA 2QYZA 4ECUA 2C2RA 4JI4H 1AN7A 4DL6A 2UXCH 2Y0SA 4IZOA 4EBDA 3HOXG 4FU0A 3JAMW 4FBUA 2VUMA 2C2EA 4X66H 5KX5F 1CQJB 3Q8RB 3RB3A 2GLTA 2C00A 2RDIA 5H80A 3TIGA 4ECTA 3V6JA 3QFFA 4RZRA 2W6PA 2SCUB 4O2AF 4J9QA 2VUGA 3T5JA 1CS0A 1DGSA 4WD3A 2CW7A 4A3FG 3GIDA 4GLXA 3R5XA 3EYYA 1M7JA 2ASLA 2W9BA 3V6KA 3T1HH 3OUZA 5FD5A 3UQ8A 4TQRA 4EGJA 3OHBA 3I4MG 1CE8A 5KG6A 1S0NA 2UXDH 4ED2A 5D1PA 4DL5A 4IWXA 2YYAA 4ZOLF 5KFHA 2W7PA 1Z2NX 1KJ8A 3RAQA 2FPIB 1HNXH 4IR9A 4F4ZA 2FMAA 2W71A 4UCUA 2CZGA 5DQIA 4U6PA 1ZHSA 5D1OA 4ECWA 1L2ZA 1VBHA 4J9PA 5KFBA 2FKLA 1W93A 3Q2OA 1A9XA 4C5CA 3J80W 4RAYA 5J2UF 3I12A 1S10A 4JI0H 3RBEA 4YHHH 2IA6A 4LMYA 2OH2A 3ORQA 3OUUA 1J5EH 5LOVF 3N42B 5KT3A 3M9NB 1IOVA 2M05A 5C44G 5CA1F 1E4FT 1JKJB 3BABA 4ETSA 3L2PA 5L1LA 3KXYT 3VPBA 1BJTA 1EZ1A 1K1SA 5F9LA 4ZQIA 2W6MA 3BA8A 2JEJA 3FMAA 4UFZA 4DR6H 3RB6A 4YR2A 2W9CB 4ECQA 4JV2A 3BQ1A 4QWCA 1HNZH 3GIMA 1PK8A 2VQDA 1IBKH 1I7NA 4A3EG 2R87A 2C28A 1RK6A 4YAJB 3PN1A 5C1OA 5DQHA 4X64H 4QWEA 2W6ZA 4DV1H 3KTMA 4UCSA 5J2TF 3PW0A 1IOWA 4TV9F 1K83A 3FKIA 1EUDB 3K3VA 4J9MA 3ETHA 3U9SA 2RF4A 3GV5B 1RYSA 2W8LA 2AQ4A 4IWYA 1I94H 4HYKA 4X62H 1T94A 2RGRA 1UNNC 2DZDA 1C30A 1Z2OX 4LF9H 4YR0A 2FJZA 2HGSA 3V4ZA 2AGPA 5IYZF 4M7EA 5CA0F 3WNZA 3GTMA 3RIZA 5A2QW 4DR4H 2B63G 1XNQH 4EEQA 1HR0H 4XX0B 4TQSA 1RJPA 5KG2A 1I7LA 2ZDGA 4IAJA 1VKZA 3KAKA 2VPQA 1I3QA 4DV4H 4EG0A 5KFDA 1FKAH 4QWBA 2UUBH 3RBDA 4M9UA 1I6UA 2FLNA 1XNRH 2V4QA 4EBEA 5KG1A 1B33N 1V9PA 2MCTA 3VMMA 2AGQA 2HJWA 4PWQA 5FJ8G 3RB0A 1GSHA 3CVZA 3KAJA 2ZDQA 2WYOA 2V59A 4ZHQF 3MR5A 1ZETA 4C5AA 2F4VH 2R7LA 3MWEA 2P0AA 4QW9A 2XCPA 3N44B 3JSLA 2VQFH 3R23A 4DL7A 2YZGA 1WH2A 5L9XA 5KFWA 2J6TA 3EPGA 2XCLA 4MV6A 4AQYH 1RK5A 4JUZA 4ECVA 4LFAH 5KT5A 3H0GA 4QWAA 4JV5H 2IP4A 5D1OB 4EFEA 4Q43A 2JA5G 2UUCH 2VUMG 3KHRA 2FK3A 2PMZE 2VQEH 1A0IA 3GTPA 3T1YH 4O3QA 1AUXA 1BXRA 4EGQA 5KG5A 2R92A 4IHJF 2JA5A 5T14A 2CKZB 2J9GA 5KFKA 3KHHA 3VPDA 4ECZA 2WB1E 5GONF 2I8CA 5BPHA 2W9AA 2ALZA 2YCHA 3HOVG 1GGOA 1Y14B 1JLLB 5DG7A 2FB9A 3HBLA 5KFQA 4I4TF 4F50A 2BQ3A 4A93G 5C1PA 2R7MA 4LH7A 4MA5A 4APMA 4A3IG 2FLLA 2XC9A 1PX2A 2ZJTA 1T3NA 3HB9A 5LMUH 2IMWP 1DV2A 1C3OA 1KC7A 5BPFA 3RV4A 4J0MA 4LFBH 4MV1A 1Y1WG 3R5HA 4FBTA 2ASJA 5CAEB 2OLSA 5KFEA 1TWAA 4RZQA 2HVQA 3SE7A 5KT6A 2XD4A 4G3IA 1O75A 1IBLH 5KFNA 2C35B 1JDBB 3M9MB 1IBMH 2R8GA 2R85A 4NXNH 1Y1VG 1MZBA 4DL2A 4DV5H 5KFZA 1Y1WA 3AYHB 4I7HA 1M6VA 1K1QA 4U7CA 4QIWE 5K2MA 4DL3A 2J6UA 4FM9A 1Y1VA 2R7KA 4TV8F 1GYFA 1RJQA 3J81W 4FS1A 2FLPA 2WE6A 3BG5A 5LMNH 2E5LH 1N33H 4J9KA 3F8NA 2DWCA 2PVPA 2W6QA 4O3OA 3HOWG 3GTKA 2YU9A 4DL4A 4DR2H 4NXMH 2HVRA 2I80A 4DV3H 3DF7A 3Q8SB 3KHLA 5EWGA 3MFIA 1UC8A 1FJGH 1TWGA 3U9TA 1VS0A 1E4GT 4YB8B 3WO1A 4E4TA 4YP3A 3GTQA 3JZIA 3FKIG 1CQIB 2WAQE 2YL2A 3M4IA 5KFLA 2Q2TA 4NLGA 3LP8A 4F4YA 3RJ0A 4ED6A 2JEGA 4YAKB 5IT9W 5KFMA 4J9SA 3RB4A 2R8JA 2UXBH 5IYCG 3J7AK 4A3LG 2ASDA 2V5AA 4AYBE 3L4JA 3H3VH 4GKJH 4RNMA 1SEIA 1N34H 5KFRA 4A3BG 3R5FA 4ECXA 2R82A 2R7NA 2YW2A 5C3EG 3TQTA 2KSWA 3HKZE 4JI2H 3PO3G 4MV8A 4XYLB 5LL6b 3V4SA 2UVRA 3PW4A 4A3KG 3HOUG 2V9WA 4R8UA 4LH6A 1KEEA 2DIKA 5DG9A 4QJFA 4O3SA 4B3MH 4LF4H 5FPRA 1VBGA 4MV7A 4O4LF 1TWFA 2VR1A 3RF2A 5BMVF 4DR5H 2R93G 5KFGA 1R9TA 1AUVA 3JRXA 4DV0H 1V51A 3N40P 1DIKA 5KFVA 4A3DG 3H4DA 4OX9H 3OSPA 4TUYF 3M9OB 4Q44A 5IWAH 2R7ZG 2R93A 2VPSA 1ULZA 5DG8A
chains in the Genus database with same CATH topology
3EYYA 4UCVA 2OWOA 2O03A 4LFAH 3T1HH 4JV5H 5FD5A 4EFEA 5D1OB 1P8LA 2UUCH 3UQ8A 2UXDH 2VQEH 5D1PA 4A2AA 2UUAH 1A0IA 3RTXA 3T1YH 1Z2NX 1SYXB 3BAAA 3OTOH 1Z2PX 1HNXH 4KHPH 4UCUA 4MTEA 1ZHSA 5D1OA 1L2ZA 4JI5H 1M0WA 3LMLA 4LSXA 3J80W 4K0KH 2YCHA 4RAYA 4RB0A 5BR8H 4JI0H 4B3SH 2VOBA 4YHHH 3MWMA 1B04A 4LH7A 4YY3H 4APMA 4B3TH 4LMYA 5EOYA 2RGVA 1J5EH 4RAZA 3N42B 1XDNA 2ZJTA 5LMUH 2UU9H 1E4FT 3BABA 4ETSA 4J0MA 3L2PA 3H20A 3KXYT 4Q0YA 1BJTA 3N41B 4RB1A 4JI3H 1S03G 4LFBH 3BA8A 4DUYH 3FMAA 4UFZA 1XMOH 4RZQA 4DR3H 2HVQA 4UCRA 4DR6H 1O75A 4DR1H 1IBLH 2HHHH 1IBMH 1HNZH 5FPOA 4GKKH 4NXNH 1MZBA 1IBKH 3C0FB 4DV5H 4CC6A 4I7HA 4PDBA 4JYAH 2FE3A 3RGZA 4LFCH 1S68A 1TA8A 3PN1A 4X64H 4FM9A 4MV9A 4DV1H 4LF5H 1ZHQA 4UCSA 3JSNA 1N32H 3N43B 1GYFA 3J81W 4CC5A 3RGXA 4JI1H 3K3VA 2WE6A 2CW8A 5LMNH 1N36H 2E5LH 4LF6H 3F8NA 4LSAA 2WDTA 4DUZH 4MTDA 1N33H 4A2BA 4DV7H 3BA9A 2HVSA 4DR2H 4NXMH 5FD6A 1I94H 4LF8H 4X62H 2HVRA 2RGRA 2ZM6H 1Z2OX 4DV3H 4LF9H 3DF7A 2HGSA 5FLXW 1FJGH 4BWSC 4M7EA 1VS0A 1E4GT 3RIZA 5A2QW 4DR4H 2XIGA 4RB2C 4DV2H 3M4IA 4AQYH 1XNQH 4EEQA 2Q2TA 1BGWA 1HR0H 4JI8H 3RJ0A 2W57A 1TAEA 2UXBH 1X9NA 3J7AK 3N6XA 4IAJA 3L4KA 1M0TA 3IG0A 3L4JA 2Q2UA 4JI6H 4DR7H 4GKJH 3KAKA 1SEIA 4DV4H 1N34H 1XMQH 1FKAH 2UUBH 4EFBA 4RB3C 3HXLA 4UCOA 3KALA 4B3RH 1I6UA 1XNRH 2KSWA 4R7RA 4JI2H 4X65H 4DV6H 5LL6b 1V9PA 2MCTA 4JI4H 1AN7A 2UXCH 4LH6A 3JAMW 3KAJA 3CVZA 4X66H 4B3MH 2WYOA 4LF4H 5FPRA 4MV7A 3RF2A 4DR5H 5IT9W 4JI7H 2F4VH 4LF7H 4UCTA 1FVIA 4DV0H 3N40P 1HNWH 3N44B 2VUGA 3JSLA 2VQFH 4OX9H 1DGSA 1WH2A 2CW7A 5IWAH 4GLXA 2VPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXY T; 
#chains in the Genus database with same CATH topology
 3G6X A;  5KFP A;  3QZ8 A;  5KKN B;  3GQC A;  3EPI A;  4XYM B;  4YBZ B;  1P8L A;  2R84 A;  2FK1 A;  1OWT A;  4IRK A;  2R7Z A;  2UVU A;  4EYH B;  4A2A A;  5IP7 G;  2XCA A;  3RTX A;  5L1J A;  2R86 A;  1KJQ A;  3HOZ G;  4YJ2 F;  2VA3 A;  4O2B F;  4A3M G;  1Z2P X;  4KHP H;  2PBZ A;  4RNN A;  2R6F A;  4RU9 A;  4JI5 H;  1M0W A;  4LSX A;  4FS2 A;  3PW5 A;  3PW7 A;  4RB0 A;  4J9O A;  1I50 A;  2RDJ A;  3H0G G;  3QZ7 A;  5KT4 A;  2BR0 A;  5EWF A;  3FDS A;  5LYJ F;  1XDN A;  5EWE A;  2JA7 G;  3GIJ A;  5LP6 F;  2ATL A;  2DPI A;  2R92 G;  2Y0S E;  4MAM A;  4IRC A;  4Q0Y A;  5DLG A;  2E2H A;  3N41 B;  1S03 G;  3E5N A;  4DUY H;  4I50 F;  1W96 A;  2JA7 A;  4UCR A;  1RYR A;  2NU8 B;  2JA6 A;  2YRW A;  2NVX A;  2NU6 B;  2QK4 A;  1T36 A;  5KT2 A;  1GSO A;  5LA6 F;  2ZDH A;  4LFC H;  3UFX B;  1RJR A;  1S68 A;  1TA8 A;  2W70 A;  4MV9 A;  4RUA A;  2R8H A;  3GIQ A;  2NUA B;  2W6N A;  3WO0 A;  1N32 H;  2V58 A;  3JSN A;  2YS6 A;  3N43 B;  4BBR G;  4ED7 A;  2AGO A;  4CC5 A;  1JIH A;  3RGX A;  5KG7 A;  3GV8 B;  3RAX A;  4LF6 H;  2GPW A;  4LSA A;  4DUZ H;  4A2B A;  3BA9 A;  5D8D A;  3MJF A;  3KHG A;  1SCU B;  2HVS A;  4BBS G;  4Y8V B;  5FD6 A;  4LF8 H;  5KFS A;  2R8K A;  5KFA A;  4DLK A;  2ZM6 H;  4A3J G;  4XZ3 B;  2XGP A;  1WSC A;  3RUP A;  3V6H A;  5KFF A;  5L1K A;  3TII A;  1GO3 E;  1KJ9 A;  2C22 A;  5C4X G;  3H4B A;  4MA0 A;  5JQW A;  2PMZ A;  5F9N A;  5KG0 A;  2BQU A;  4RB2 C;  3MWD A;  1BGW A;  4JI8 H;  4O3R A;  5EZY F;  5JVD F;  3T5H A;  5DLF A;  3L4K A;  2WB1 A;  3IG0 A;  4JI6 H;  4DR7 H;  4R8U B;  4BY1 G;  5IYD G;  2NVY A;  1E4E B;  3SI8 A;  3HXL A;  3ORR A;  3KAL A;  4YJ3 F;  4EEY A;  3MR3 A;  3GTO A;  5JUM A;  4R7R A;  4X65 H;  3OSN A;  2V4R A;  4MV3 A;  4DV6 H;  5LXT F;  3K3P A;  2JEF A;  2AU0 A;  3G8C A;  3Q1K A;  4J9N A;  1TWH A;  5EDW A;  4ED3 A;  5IYB G;  2X0S A;  1KBL A;  1BNC A;  1KJI A;  3GTG A;  4JI7 H;  4RUC A;  4LF7 H;  5DGA A;  4UCT A;  1FVI A;  3MR2 A;  1HNW H;  4L1K A;  1V4Y A;  2YZM A;  3OHA A;  2UVW A;  3N8D A;  4Q8E A;  5KFX A;  3GIP A;  5KFT A;  4JV1 A;  2YS7 A;  1GLV A;  3K5I A;  1DV1 A;  4QIW A;  2E2I A;  4F4X A;  4ECR A;  4UCV A;  5KFJ A;  2OWO A;  2DLN A;  2O03 A;  5KFU A;  2BQR A;  4MV4 A;  1SFO A;  1JDE A;  4HQ6 A;  3IN5 A;  4ED1 A;  1UC9 A;  2NU7 B;  3BQ0 A;  4GC7 A;  4GC6 A;  1N56 A;  2UUA H;  3OTO H;  1SYX B;  3BAA A;  3PW2 A;  1EUC B;  3GIK A;  3TQ1 A;  5CB4 F;  3LWB A;  4RNO A;  2JA8 G;  4HR7 A;  2JEI A;  4MTE A;  4ED8 A;  1E4E A;  4YQW A;  2W7O A;  4K0K H;  3LML A;  1EHI A;  3K5H A;  4YR3 A;  5BR8 H;  3GV7 B;  5HBR B;  2DPJ A;  3GII A;  4B3S H;  2VOB A;  5I47 A;  4EBC A;  3RV3 A;  3MWM A;  1B04 A;  1KJJ A;  4YY3 H;  4B3T H;  5KFC A;  1EYZ A;  1B6R A;  5EOY A;  2RGV A;  4RAZ A;  2WAQ A;  3GIL A;  3MFH A;  1S9F A;  2UU9 H;  5KFY A;  2J6S A;  1JX4 A;  3H20 A;  1WR2 A;  2NU9 B;  5KG3 A;  4RB1 A;  4JI3 H;  4IR1 A;  5DQG A;  2GPS A;  3MR6 A;  4AYB A;  4J9L A;  1XMO H;  2XGQ A;  1VAJ A;  4DR3 H;  1ZQ7 A;  2FP4 B;  4QW8 A;  4DR1 H;  3T5L A;  3HOY G;  2HHH H;  5L1I A;  2VA2 A;  2FPP B;  4BY7 G;  5KFO A;  5FPO A;  4GKK H;  5JH7 F;  4Q8F A;  3Q8Q B;  3C0F B;  3HKZ A;  4CC6 A;  4ECY A;  3RFC A;  4PDB A;  4JYA H;  2FE3 A;  3RGZ A;  2YZN A;  1TWC A;  3GLK A;  2WTF A;  3ETJ A;  4ZI7 F;  4ME6 A;  3NGD A;  4O4I F;  2R8I A;  2I87 A;  4LF5 H;  1B6S A;  1ZHQ A;  2W9C A;  2CQY A;  5DGB A;  3VPC A;  3H40 A;  4BXX G;  2B63 A;  5FLM G;  3TIN A;  1N48 A;  4JI1 H;  4ECS A;  2CW8 A;  4HNV A;  1N36 H;  4A3G G;  2WDT A;  3JRW A;  4O3P A;  4MTD A;  4QWD A;  3Q8P B;  5HV6 A;  3BJY A;  4DV7 H;  2JA6 G;  2IBK A;  3I4N G;  2W6O A;  3BQ2 A;  1JXL A;  4J9R A;  2YRX A;  1S0M A;  3G6Y A;  3GTJ A;  5C5J A;  5KFI A;  5IP9 G;  4F4W A;  5FLX W;  2W8K A;  3PO2 G;  4I55 F;  2FPG B;  4O4H F;  4BWS C;  5KG4 A;  2C2D A;  2PN1 A;  2W9B B;  4ED0 A;  3PR5 B;  3G6V A;  4JV0 A;  4IRD A;  1GSA A;  5JVL A;  2XIG A;  4O3N A;  4DV2 H;  3PZP A;  4Q45 A;  3PR4 A;  3PVX A;  4A3C G;  5KT7 A;  2W57 A;  3T5K A;  4HNU A;  1S97 A;  1TAE A;  3GTL A;  1WCM G;  4EYI B;  2FK2 A;  4HNT A;  1X9N A;  3N6X A;  2Q2U A;  1M0T A;  4WBN F;  4C2M A;  3CQZ A;  1XMQ H;  4EFB A;  4RB3 C;  4UCO A;  5C8Y F;  2UVV A;  1WCM A;  4B3R H;  4C5B A;  1S0O A;  2QYZ A;  4ECU A;  2C2R A;  4JI4 H;  1AN7 A;  4DL6 A;  2UXC H;  2Y0S A;  4IZO A;  4EBD A;  3HOX G;  4FU0 A;  3JAM W;  4FBU A;  2VUM A;  2C2E A;  4X66 H;  5KX5 F;  1CQJ B;  3Q8R B;  3RB3 A;  2GLT A;  2C00 A;  2RDI A;  5H80 A;  3TIG A;  4ECT A;  3V6J A;  3QFF A;  4RZR A;  2W6P A;  2SCU B;  4O2A F;  4J9Q A;  2VUG A;  3T5J A;  1CS0 A;  1DGS A;  4WD3 A;  2CW7 A;  4A3F G;  3GID A;  4GLX A;  3R5X A;  3EYY A;  1M7J A;  2ASL A;  2W9B A;  3V6K A;  3T1H H;  3OUZ A;  5FD5 A;  3UQ8 A;  4TQR A;  4EGJ A;  3OHB A;  3I4M G;  1CE8 A;  5KG6 A;  1S0N A;  2UXD H;  4ED2 A;  5D1P A;  4DL5 A;  4IWX A;  2YYA A;  4ZOL F;  5KFH A;  2W7P A;  1Z2N X;  1KJ8 A;  3RAQ A;  2FPI B;  1HNX H;  4IR9 A;  4F4Z A;  2FMA A;  2W71 A;  4UCU A;  2CZG A;  5DQI A;  4U6P A;  1ZHS A;  5D1O A;  4ECW A;  1L2Z A;  1VBH A;  4J9P A;  5KFB A;  2FKL A;  1W93 A;  3Q2O A;  1A9X A;  4C5C A;  3J80 W;  4RAY A;  5J2U F;  3I12 A;  1S10 A;  4JI0 H;  3RBE A;  4YHH H;  2IA6 A;  4LMY A;  2OH2 A;  3ORQ A;  3OUU A;  1J5E H;  5LOV F;  3N42 B;  5KT3 A;  3M9N B;  1IOV A;  2M05 A;  5C44 G;  5CA1 F;  1E4F T;  1JKJ B;  3BAB A;  4ETS A;  3L2P A;  5L1L A;  3KXY T;  3VPB A;  1BJT A;  1EZ1 A;  1K1S A;  5F9L A;  4ZQI A;  2W6M A;  3BA8 A;  2JEJ A;  3FMA A;  4UFZ A;  4DR6 H;  3RB6 A;  4YR2 A;  2W9C B;  4ECQ A;  4JV2 A;  3BQ1 A;  4QWC A;  1HNZ H;  3GIM A;  1PK8 A;  2VQD A;  1IBK H;  1I7N A;  4A3E G;  2R87 A;  2C28 A;  1RK6 A;  4YAJ B;  3PN1 A;  5C1O A;  5DQH A;  4X64 H;  4QWE A;  2W6Z A;  4DV1 H;  3KTM A;  4UCS A;  5J2T F;  3PW0 A;  1IOW A;  4TV9 F;  1K83 A;  3FKI A;  1EUD B;  3K3V A;  4J9M A;  3ETH A;  3U9S A;  2RF4 A;  3GV5 B;  1RYS A;  2W8L A;  2AQ4 A;  4IWY A;  1I94 H;  4HYK A;  4X62 H;  1T94 A;  2RGR A;  1UNN C;  2DZD A;  1C30 A;  1Z2O X;  4LF9 H;  4YR0 A;  2FJZ A;  2HGS A;  3V4Z A;  2AGP A;  5IYZ F;  4M7E A;  5CA0 F;  3WNZ A;  3GTM A;  3RIZ A;  5A2Q W;  4DR4 H;  2B63 G;  1XNQ H;  4EEQ A;  1HR0 H;  4XX0 B;  4TQS A;  1RJP A;  5KG2 A;  1I7L A;  2ZDG A;  4IAJ A;  1VKZ A;  3KAK A;  2VPQ A;  1I3Q A;  4DV4 H;  4EG0 A;  5KFD A;  1FKA H;  4QWB A;  2UUB H;  3RBD A;  4M9U A;  1I6U A;  2FLN A;  1XNR H;  2V4Q A;  4EBE A;  5KG1 A;  1B33 N;  1V9P A;  2MCT A;  3VMM A;  2AGQ A;  2HJW A;  4PWQ A;  5FJ8 G;  3RB0 A;  1GSH A;  3CVZ A;  3KAJ A;  2ZDQ A;  2WYO A;  2V59 A;  4ZHQ F;  3MR5 A;  1ZET A;  4C5A A;  2F4V H;  2R7L A;  3MWE A;  2P0A A;  4QW9 A;  2XCP A;  3N44 B;  3JSL A;  2VQF H;  3R23 A;  4DL7 A;  2YZG A;  1WH2 A;  5L9X A;  5KFW A;  2J6T A;  3EPG A;  2XCL A;  4MV6 A;  4AQY H;  1RK5 A;  4JUZ A;  4ECV A;  4LFA H;  5KT5 A;  3H0G A;  4QWA A;  4JV5 H;  2IP4 A;  5D1O B;  4EFE A;  4Q43 A;  2JA5 G;  2UUC H;  2VUM G;  3KHR A;  2FK3 A;  2PMZ E;  2VQE H;  1A0I A;  3GTP A;  3T1Y H;  4O3Q A;  1AUX A;  1BXR A;  4EGQ A;  5KG5 A;  2R92 A;  4IHJ F;  2JA5 A;  5T14 A;  2CKZ B;  2J9G A;  5KFK A;  3KHH A;  3VPD A;  4ECZ A;  2WB1 E;  5GON F;  2I8C A;  5BPH A;  2W9A A;  2ALZ A;  2YCH A;  3HOV G;  1GGO A;  1Y14 B;  1JLL B;  5DG7 A;  2FB9 A;  3HBL A;  5KFQ A;  4I4T F;  4F50 A;  2BQ3 A;  4A93 G;  5C1P A;  2R7M A;  4LH7 A;  4MA5 A;  4APM A;  4A3I G;  2FLL A;  2XC9 A;  1PX2 A;  2ZJT A;  1T3N A;  3HB9 A;  5LMU H;  2IMW P;  1DV2 A;  1C3O A;  1KC7 A;  5BPF A;  3RV4 A;  4J0M A;  4LFB H;  4MV1 A;  1Y1W G;  3R5H A;  4FBT A;  2ASJ A;  5CAE B;  2OLS A;  5KFE A;  1TWA A;  4RZQ A;  2HVQ A;  3SE7 A;  5KT6 A;  2XD4 A;  4G3I A;  1O75 A;  1IBL H;  5KFN A;  2C35 B;  1JDB B;  3M9M B;  1IBM H;  2R8G A;  2R85 A;  4NXN H;  1Y1V G;  1MZB A;  4DL2 A;  4DV5 H;  5KFZ A;  1Y1W A;  3AYH B;  4I7H A;  1M6V A;  1K1Q A;  4U7C A;  4QIW E;  5K2M A;  4DL3 A;  2J6U A;  4FM9 A;  1Y1V A;  2R7K A;  4TV8 F;  1GYF A;  1RJQ A;  3J81 W;  4FS1 A;  2FLP A;  2WE6 A;  3BG5 A;  5LMN H;  2E5L H;  1N33 H;  4J9K A;  3F8N A;  2DWC A;  2PVP A;  2W6Q A;  4O3O A;  3HOW G;  3GTK A;  2YU9 A;  4DL4 A;  4DR2 H;  4NXM H;  2HVR A;  2I80 A;  4DV3 H;  3DF7 A;  3Q8S B;  3KHL A;  5EWG A;  3MFI A;  1UC8 A;  1FJG H;  1TWG A;  3U9T A;  1VS0 A;  1E4G T;  4YB8 B;  3WO1 A;  4E4T A;  4YP3 A;  3GTQ A;  3JZI A;  3FKI G;  1CQI B;  2WAQ E;  2YL2 A;  3M4I A;  5KFL A;  2Q2T A;  4NLG A;  3LP8 A;  4F4Y A;  3RJ0 A;  4ED6 A;  2JEG A;  4YAK B;  5IT9 W;  5KFM A;  4J9S A;  3RB4 A;  2R8J A;  2UXB H;  5IYC G;  3J7A K;  4A3L G;  2ASD A;  2V5A A;  4AYB E;  3L4J A;  3H3V H;  4GKJ H;  4RNM A;  1SEI A;  1N34 H;  5KFR A;  4A3B G;  3R5F A;  4ECX A;  2R82 A;  2R7N A;  2YW2 A;  5C3E G;  3TQT A;  2KSW A;  3HKZ E;  4JI2 H;  3PO3 G;  4MV8 A;  4XYL B;  5LL6 b;  3V4S A;  2UVR A;  3PW4 A;  4A3K G;  3HOU G;  2V9W A;  4R8U A;  4LH6 A;  1KEE A;  2DIK A;  5DG9 A;  4QJF A;  4O3S A;  4B3M H;  4LF4 H;  5FPR A;  1VBG A;  4MV7 A;  4O4L F;  1TWF A;  2VR1 A;  3RF2 A;  5BMV F;  4DR5 H;  2R93 G;  5KFG A;  1R9T A;  1AUV A;  3JRX A;  4DV0 H;  1V51 A;  3N40 P;  1DIK A;  5KFV A;  4A3D G;  3H4D A;  4OX9 H;  3OSP A;  4TUY F;  3M9O B;  4Q44 A;  5IWA H;  2R7Z G;  2R93 A;  2VPS A;  1ULZ A;  5DG8 A; 
#chains in the Genus database with same CATH homology
 3EYY A;  4UCV A;  2OWO A;  2O03 A;  4LFA H;  3T1H H;  4JV5 H;  5FD5 A;  4EFE A;  5D1O B;  1P8L A;  2UUC H;  3UQ8 A;  2UXD H;  2VQE H;  5D1P A;  4A2A A;  2UUA H;  1A0I A;  3RTX A;  3T1Y H;  1Z2N X;  1SYX B;  3BAA A;  3OTO H;  1Z2P X;  1HNX H;  4KHP H;  4UCU A;  4MTE A;  1ZHS A;  5D1O A;  1L2Z A;  4JI5 H;  1M0W A;  3LML A;  4LSX A;  3J80 W;  4K0K H;  2YCH A;  4RAY A;  4RB0 A;  5BR8 H;  4JI0 H;  4B3S H;  2VOB A;  4YHH H;  3MWM A;  1B04 A;  4LH7 A;  4YY3 H;  4APM A;  4B3T H;  4LMY A;  5EOY A;  2RGV A;  1J5E H;  4RAZ A;  3N42 B;  1XDN A;  2ZJT A;  5LMU H;  2UU9 H;  1E4F T;  3BAB A;  4ETS A;  4J0M A;  3L2P A;  3H20 A;  3KXY T;  4Q0Y A;  1BJT A;  3N41 B;  4RB1 A;  4JI3 H;  1S03 G;  4LFB H;  3BA8 A;  4DUY H;  3FMA A;  4UFZ A;  1XMO H;  4RZQ A;  4DR3 H;  2HVQ A;  4UCR A;  4DR6 H;  1O75 A;  4DR1 H;  1IBL H;  2HHH H;  1IBM H;  1HNZ H;  5FPO A;  4GKK H;  4NXN H;  1MZB A;  1IBK H;  3C0F B;  4DV5 H;  4CC6 A;  4I7H A;  4PDB A;  4JYA H;  2FE3 A;  3RGZ A;  4LFC H;  1S68 A;  1TA8 A;  3PN1 A;  4X64 H;  4FM9 A;  4MV9 A;  4DV1 H;  4LF5 H;  1ZHQ A;  4UCS A;  3JSN A;  1N32 H;  3N43 B;  1GYF A;  3J81 W;  4CC5 A;  3RGX A;  4JI1 H;  3K3V A;  2WE6 A;  2CW8 A;  5LMN H;  1N36 H;  2E5L H;  4LF6 H;  3F8N A;  4LSA A;  2WDT A;  4DUZ H;  4MTD A;  1N33 H;  4A2B A;  4DV7 H;  3BA9 A;  2HVS A;  4DR2 H;  4NXM H;  5FD6 A;  1I94 H;  4LF8 H;  4X62 H;  2HVR A;  2RGR A;  2ZM6 H;  1Z2O X;  4DV3 H;  4LF9 H;  3DF7 A;  2HGS A;  5FLX W;  1FJG H;  4BWS C;  4M7E A;  1VS0 A;  1E4G T;  3RIZ A;  5A2Q W;  4DR4 H;  2XIG A;  4RB2 C;  4DV2 H;  3M4I A;  4AQY H;  1XNQ H;  4EEQ A;  2Q2T A;  1BGW A;  1HR0 H;  4JI8 H;  3RJ0 A;  2W57 A;  1TAE A;  2UXB H;  1X9N A;  3J7A K;  3N6X A;  4IAJ A;  3L4K A;  1M0T A;  3IG0 A;  3L4J A;  2Q2U A;  4JI6 H;  4DR7 H;  4GKJ H;  3KAK A;  1SEI A;  4DV4 H;  1N34 H;  1XMQ H;  1FKA H;  2UUB H;  4EFB A;  4RB3 C;  3HXL A;  4UCO A;  3KAL A;  4B3R H;  1I6U A;  1XNR H;  2KSW A;  4R7R A;  4JI2 H;  4X65 H;  4DV6 H;  5LL6 b;  1V9P A;  2MCT A;  4JI4 H;  1AN7 A;  2UXC H;  4LH6 A;  3JAM W;  3KAJ A;  3CVZ A;  4X66 H;  4B3M H;  2WYO A;  4LF4 H;  5FPR A;  4MV7 A;  3RF2 A;  4DR5 H;  5IT9 W;  4JI7 H;  2F4V H;  4LF7 H;  4UCT A;  1FVI A;  4DV0 H;  3N40 P;  1HNW H;  3N44 B;  2VUG A;  3JSL A;  2VQF H;  4OX9 H;  1DGS A;  1WH2 A;  2CW7 A;  5IWA H;  4GLX A;  2VPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...