3KXYT

Crystal structure of the exsc-exse complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
TEAVGHFEGRSVTRAAVRGEDRSSVAGLARWLARNVAGDPRSEQALQRLADGDGTPLEARTVRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the Crystal Structure of the ExsC.ExsE Complex Reveals Distinctive Binding Interactions of the Pseudomonas aeruginosa Type III Secretion Chaperone ExsC with ExsE and ExsD.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Chaperone/transcription inhibitor
molecule keywords Exoenzyme S synthesis protein C
total genus 11
structure length 65
sequence length 65
chains with identical sequence U, V, W, X, Y
ec nomenclature
pdb deposition date 2009-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF18286 T3SS_ExsE Type III secretion system ExsE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.370 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kxyT00
3KXYT
chains in the Genus database with same CATH superfamily
3PW0A 3RAQA 2R8KA 3GTLA 3WO0A 2VR1A 1ZQ7A 5DG9A 4O2BF 4KHPH 1I94H 1EUCB 4DV1H 1KJ8A 4ZQIA 2R92A 2DIKA 3OUZA 2GLTA 4RNNA 3QZ8A 2IP4A 1C30A 1DV1A 3UFXB 1KBLA 5KFBA 4J9LA 3VPBA 5EWFA 2FK2A 2HVSA 2RF4A 3QFFA 3N43B 3T1YH 2JA7A 1VAJA 3TINA 4AYBA 4ZI7F 4ME6A 5DGBA 1BXRA 3IN5A 2UUCH 3G6VA 4IR1A 1E4GT 4IHJF 4MA5A 4JI1H 5IYZF 3BAAA 4Q8FA 2FK1A 5KFGA 3J80W 4X62H 1Y1WA 4MV8A 3GQCA 1I7NA 5L1LA 4ECVA 5BPHA 1RK5A 1HNWH 2FP4B 2V59A 3PO3G 2W6PA 4QWDA 3BA9A 3I12A 4WD3A 5LA6F 4O3NA 4MV6A 5DLGA 4RU9A 3KHRA 1XMQH 4LF5H 1P8LA 1JKJB 4GKKH 1M7JA 1SCUB 3Q8QB 2BR0A 5F9NA 2W71A 2WB1A 4JI4H 3KHGA 5D1OB 1RYRA 4BBSG 4I55F 2UVUA 2XGQA 1M6VA 1KJIA 3PR5B 2DWCA 3R5HA 4MV9A 4O3RA 3F8NA 4DV2H 1S10A 4I50F 3U9TA 2XGPA 2NU9B 3MWEA 5KFCA 4IR9A 2YRWA 5EWEA 5DGAA 4LF6H 2FPIB 3LWBA 4Q43A 1B04A 5LMNH 3L2PA 4JUZA 4LFAH 2UXDH 4I4TF 2YRXA 5H80A 2JA5G 4GLXA 2YZGA 4ED7A 2VA3A 1A0IA 5D1OA 1OWTA 2FLPA 2WAQE 1FVIA 1S0NA 2VQDA 1FKAH 1UNNC 5KFAA 5F9LA 5KG7A 3H40A 4F4XA 1Z2NX 3V6JA 4JI7H 1TAEA 2UVRA 1I6UA 2QYZA 2PN1A 5KG2A 3PVXA 4ED8A 5L1IA 2W9CA 2YYAA 2V4QA 4ED2A 2BQRA 1Y1WG 2I87A 5JUMA 4ECUA 2ASDA 1TWGA 1S03G 4A3BG 5KFSA 3GILA 4UCTA 4IWXA 2MCTA 3EPIA 4EYHB 3VMMA 1AN7A 3DF7A 3MR5A 3PZPA 4TQSA 4B3SH 4NXMH 2CW7A 1KJJA 5KFKA 3N41B 5KFHA 2W8LA 3TIIA 2YL2A 3L4KA 3T5HA 4A3DG 3GLKA 2F4VH 3VPCA 4TV8F 2ASLA 3Q1KA 4A3IG 4E4TA 2FKLA 1R9TA 1GSOA 2FPGB 5CAEB 4R8UB 2J6SA 5KFYA 2W6ZA 5IT9W 4A3FG 5KKNB 5KFEA 4U7CA 4IWYA 3HB9A 1T36A 4Y8VB 4RNMA 2W6MA 4R8UA 1ZHSA 2XCLA 3GIIA 4EBEA 2R8HA 4F4YA 2DLNA 3GIQA 1GGOA 3T5LA 2JA6G 1GSAA 3G8CA 3U9SA 1J5EH 3J7AK 4IAJA 4RB3C 3L4JA 5C4XG 1BJTA 5CA1F 5KFOA 1WH2A 4DUYH 4UCUA 3N6XA 3M9OB 4JV0A 3T5JA 2UVVA 4NXNH 4TV9F 4ECWA 3T5KA 4DR3H 1JDEA 4DL2A 3R23A 1BGWA 2JEFA 4JI8H 3BJYA 1JDBB 3OUUA 1SEIA 3PR4A 4YAKB 1RK6A 1Z2OX 4DL3A 5IP9G 1K83A 3OHBA 1O75A 5EOYA 4DLKA 4RZQA 3G6YA 3Q8RB 2DPIA 3JSLA 1S97A 4J9MA 2BQUA 2R87A 3RB6A 2NU6B 4LF4H 2IA6A 4ECXA 2JA8G 2ZJTA 1VS0A 1ZHQA 1A9XA 1X9NA 1EHIA 2Q2TA 2VUGA 5KFFA 4A3KG 4ECZA 4FS2A 4YHHH 1E4FT 4ECRA 3KAJA 4JV1A 2CZGA 2WYOA 3RV3A 5KFMA 1CS0A 3JRWA 4GC7A 3GTKA 1VKZA 3Q2OA 5KFNA 4J9OA 5FD5A 5KFIA 3RGZA 1Y14B 5K2MA 3KTMA 3I4MG 4J9NA 1L2ZA 2C35B 2HGSA 5J2TF 4L1KA 2OH2A 3JSNA 3KAKA 3SI8A 1ULZA 3MFHA 3HOYG 3N44B 4GC6A 4FU0A 2I8CA 4YQWA 4LFCH 2PVPA 1XNRH 2W6OA 3HOVG 4X66H 3MFIA 1T3NA 3N8DA 3ETJA 4JI2H 5KFRA 5KG0A 2C00A 2UUAH 3H4BA 2ATLA 3GTGA 2AU0A 4B3MH 4DR6H 2W70A 3FDSA 4APMA 3FKIA 5J2UF 1Y1VA 2W6QA 3C0FB 1WSCA 2VPSA 3MWDA 3MWMA 5BPFA 3JAMW 1ZETA 4LFBH 1DV2A 2R84A 2WDTA 4PWQA 4AQYH 5KFWA 4BY1G 2V4RA 5GONF 2J9GA 5LXTF 4ZOLF 3K5HA 4HQ6A 1I50A 3BQ0A 5C8YF 4FS1A 5KFTA 2KSWA 3Q8SB 2C28A 5D1PA 4O4LF 4O4IF 3OHAA 4DR1H 2GPWA 5EZYF 4DV0H 2W6NA 2R7KA 5CA0F 2RDJA 4IRDA 2NU8B 1Z2PX 2R6FA 2JEGA 4EEQA 3MR2A 1HR0H 2RGRA 4PDBA 2R7ZA 1CQIB 2J6UA 3PW2A 2AGOA 2UVWA 1N34H 4YBZB 1E4EA 4HR7A 4TQRA 1N32H 2CQYA 4JV5H 1Y1VG 4Q45A 2C2EA 2OWOA 5KFLA 4QW8A 2C22A 2FJZA 5KFQA 4DV5H 1RJQA 3KHLA 1B33N 4RB0A 4ED1A 5EDWA 4A3CG 4IZOA 3EYYA 3V4SA 1JLLB 3RF2A 4K0KH 1S0MA 4EYIB 2YCHA 2W7OA 2XIGA 4DL6A 3RJ0A 4B3TH 4CC5A 5LP6F 3H20A 4J9SA 2WAQA 1HNZH 1IBLH 4C5CA 1FJGH 4A3JG 4DL7A 2W7PA 1IBKH 2V58A 2YZMA 3RB0A 4EEYA 2UXBH 1M0WA 1WCMA 2SCUB 1N48A 5KG1A 2CW8A 3H0GA 3LP8A 1TWCA 4A2AA 3M4IA 5KG4A 1CQJB 1KC7A 3V4ZA 4EGJA 4RB1A 3MJFA 4O4HF 4TUYF 4MTEA 3RGXA 1W96A 4LF8H 4XYLB 5KT7A 3BQ1A 1XDNA 3RIZA 5KT3A 2JEIA 1BNCA 5KFJA 2R8JA 3OSNA 5IYCG 5JH7F 5HV6A 5KT6A 3J81W 4JI0H 4JV2A 2FE3A 5KT2A 4AYBE 5LL6b 4A3EG 2AGPA 3HKZE 5KG5A 1SFOA 4A3GG 2V9WA 1AUXA 4ECTA 5EWGA 2ZM6H 4QWEA 4C2MA 3JRXA 4HNUA 4BY7G 2FPPB 1EYZA 2DZDA 3GV8B 1S9FA 4NLGA 3HOWG 3SE7A 3PW4A 4QW9A 3GTPA 2ZDHA 5DLFA 3TIGA 4ECQA 4O3PA 3RV4A 2B63A 1JXLA 1GYFA 2HVQA 4UCSA 1TWAA 4O3SA 3I4NG 3GTMA 5C3EG 2V5AA 2YZNA 4WBNF 3HBLA 2W9BA 3K3PA 5KX5F 1PX2A 5I47A 3K5IA 3GIKA 3PW5A 3ORRA 4RZRA 3HOZG 3GIDA 2NUAB 1GSHA 1SYXB 1I3QA 1AUVA 5HBRB 3KHHA 3RBDA 3RAXA 2RDIA 3M9NB 3BG5A 5JQWA 1UC9A 4RNOA 4MV7A 4RAZA 2R86A 2DPJA 3PO2G 2OLSA 3GIMA 2NVYA 4JI6H 3BQ2A 3KXYT 4DV7H 5DQIA 5FD6A 4MV4A 1XNQH 2C2DA 4DV6H 4G3IA 4IRKA 2FK3A 3HOUG 3FKIG 4EFEA 4MTDA 5L9XA 4LH7A 2W9AA 3FMAA 5C5JA 3BABA 3N42B 3N40P 3RFCA 1B6SA 5IWAH 5KFDA 2WTFA 3R5XA 1N56A 4YP3A 5C1PA 3V6KA 2CKZB 4Q0YA 5IYDG 4F50A 3RBEA 4FM9A 2BQ3A 5BMVF 2FMAA 5FJ8G 3BA8A 2JA6A 4YAJB 2R7LA 4XZ3B 3GIPA 4FBTA 1K1QA 3GTJA 2JA7G 4YR3A 4O3QA 2VOBA 1DGSA 2FB9A 5FLXW 2R7MA 2R92G 2O03A 2J6TA 4B3RH 2W57A 3QZ7A 4M9UA 4QWBA 4A93G 2VA2A 4LMYA 5DG7A 4UCRA 3GTOA 4EBCA 3H0GG 2E5LH 4DR2H 4RUAA 1TWHA 2PMZE 2UU9H 1GLVA 2E2HA 4YB8B 5L1KA 3H3VH 2YS6A 5DQHA 3ETHA 1K1SA 1W93A 1UC8A 4OX9H 4ED6A 4Q44A 1T94A 2IBKA 4GKJH 1CE8A 2UXCH 2P0AA 4LSXA 3RB4A 3HOXG 4LF9H 1IBMH 1S0OA 4F4ZA 4DUZH 4ED3A 2AQ4A 5L1JA 2HVRA 5C1OA 5KFPA 4QJFA 4C5AA 3M9MB 4DR4H 2HHHH 2VQEH 4F4WA 2C2RA 1IOVA 3UQ8A 4QWCA 1E4EB 5BR8H 2NU7B 2ZDGA 4UFZA 5CB4F 2ALZA 1MZBA 4HNTA 1S68A 5KG6A 4YR2A 3RB3A 2JA5A 1VBGA 4LH6A 2QK4A 3R5FA 2Y0SE 3CQZA 2GPSA 2PBZA 2ASJA 4RB2C 2VQFH 4DL4A 2RGVA 4ECYA 1N36H 2JEJA 4A2BA 1XMOH 3JZIA 2YS7A 3GIJA 5KFXA 2WB1E 1N33H 3HKZA 3TQTA 3EPGA 5KFVA 4J0MA 4HNVA 4M7EA 2HJWA 1TWFA 4ETSA 3RUPA 4BXXG 4DR5H 4MA0A 2E2IA 1KEEA 2X0SA 1WCMG 1EUDB 4MV1A 4X65H 5C44G 2PMZA 4JI5H 2B63G 2VUMG 2NVXA 3VPDA 1KJQA 4IRCA 1RJRA 5FPRA 5JVLA 2AGQA 2XCAA 2W9BB 4BBRG 4BWSC 3KALA 2R8GA 1JIHA 2R7NA 4JYAH 2WE6A 4RAYA 5KG3A 4YY3H 4YJ3F 2VUMA 1KJ9A 4UCVA 1IOWA 1B6RA 3LMLA 1V9PA 5FLMG 1RYSA 3GV5B 1GO3E 3H4DA 5KFUA 4RUCA 1WR2A 5KT5A 4U6PA 2XC9A 4ECSA 3PN1A 3OSPA 2UUBH 4HYKA 2R7ZG 3V6HA 1DIKA 4XYMB 5FPOA 4EG0A 4EFBA 3NGDA 1C3OA 3GTQA 4DL5A 3Q8PB 4LSAA 4DV4H 2Y0SA 4R7RA 4ZHQF 1RJPA 4MAMA 4CC6A 3GV7B 3E5NA 2XCPA 4X64H 3WNZA 4YR0A 3IG0A 3ORQA 5D8DA 2YU9A 3CVZA 4UCOA 2FLNA 1EZ1A 1I7LA 3HXLA 2VPQA 2M05A 2ZDQA 3RTXA 2XD4A 5KT4A 4LF7H 2R93A 3TQ1A 4C5BA 5KFZA 4J9PA 4DR7H 3T1HH 2I80A 5JVDF 4DV3H 4QWAA 2IMWP 1HNXH 5DQGA 1JX4A 2Q2UA 1VBHA 4QIWA 5DG8A 3MR3A 2FLLA 1V51A 4O2AF 4EGQA 5LYJF 3MR6A 2R8IA 4J9QA 4J9KA 3K3VA 3AYHB 4EBDA 3G6XA 3WO1A 4A3LG 2R93G 5IP7G 1PK8A 2YW2A 5LMUH 2W9CB 4J9RA 2R85A 5A2QW 1TA8A 3OTOH 4MV3A 5T14A 4A3MG 4YJ2F 2R82A 3PW7A 4JI3H 5LOVF 2W8KA 1V4YA 4FBUA 1M0TA 4O3OA 4ED0A 4XX0B 4QIWE 4I7HA 4Q8EA 5IYBG
chains in the Genus database with same CATH topology
1WH2A 4A2AA 4RB1A 3M4IA 4DUYH 4UCUA 3N6XA 2HVRA 4MTEA 3RGXA 4LF8H 4NXNH 4DR4H 2HHHH 4KHPH 1I94H 2VQEH 4DV1H 4DR3H 1BGWA 1XDNA 3RIZA 3UQ8A 4JI8H 5BR8H 2HVSA 1SEIA 4UFZA 3J81W 3N43B 3T1YH 1MZBA 1Z2OX 4JI0H 1S68A 2UUCH 2FE3A 1O75A 4LH6A 5EOYA 1E4GT 4RZQA 5LL6b 3JSLA 4JI1H 3BAAA 4RB2C 2VQFH 4LF4H 2RGVA 3J80W 2ZJTA 4X62H 1VS0A 1ZHQA 1X9NA 4A2BA 1N36H 2ZM6H 1HNWH 1XMOH 2Q2TA 2VUGA 4YHHH 1E4FT 1N33H 3KAJA 3BA9A 2WYOA 1XMQH 4J0MA 4LF5H 4M7EA 4GKKH 1P8LA 4ETSA 1GYFA 4DR5H 2HVQA 4UCSA 4JI4H 5FD5A 3RGZA 4X65H 1L2ZA 5D1OB 4JI5H 2HGSA 3JSNA 3KAKA 3N44B 4MV9A 5FPRA 3F8NA 4DV2H 1SYXB 4LFCH 1XNRH 4BWSC 3KALA 4X66H 4LF6H 1B04A 5LMNH 4MV7A 3L2PA 4RAZA 4JI2H 4JYAH 4LFAH 2UXDH 4RB3C 2WE6A 2UUAH 4RAYA 4YY3H 4GLXA 4DR6H 4B3MH 1A0IA 4UCVA 3LMLA 5D1OA 3KXYT 1V9PA 4DV7H 4APMA 4JI6H 5FD6A 1FVIA 1XNQH 3C0FB 2VPSA 4PDBA 4LFBH 3MWMA 4DV6H 3JAMW 1FKAH 2WDTA 4MTDA 4EFEA 4AQYH 1Z2NX 3PN1A 4JI7H 1TAEA 4LH7A 2UUBH 1I6UA 3FMAA 5FPOA 3BABA 3N42B 3N40P 4EFBA 5IWAH 2KSWA 4DV4H 5D1PA 4LSAA 4R7RA 4DR1H 1S03G 4Q0YA 4DV0H 4FM9A 4CC6A 3BA8A 4X64H 4UCTA 1Z2PX 3IG0A 4EEQA 1HR0H 3CVZA 4UCOA 2MCTA 2RGRA 3HXLA 1AN7A 3RTXA 3L4JA 2VOBA 1DGSA 3DF7A 1N34H 5FLXW 4B3SH 4LF7H 4NXMH 2O03A 2CW7A 4JV5H 4B3RH 3N41B 1N32H 2OWOA 2W57A 3T1HH 4DR7H 3L4KA 4DUZH 4DV3H 4DV5H 2F4VH 4LMYA 4RB0A 4UCRA 1HNXH 2Q2UA 2E5LH 3EYYA 4DR2H 2UU9H 3RF2A 4K0KH 5IT9W 3K3VA 2YCHA 2XIGA 4B3TH 3RJ0A 4CC5A 1HNZH 3H20A 1ZHSA 1IBLH 5LMUH 1FJGH 5A2QW 1TA8A 3OTOH 1IBKH 4JI3H 4OX9H 4GKJH 2UXBH 1M0WA 1J5EH 2UXCH 4LSXA 1M0TA 4IAJA 4LF9H 3J7AK 1IBMH 4I7HA 2CW8A 1BJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXY T; 
#chains in the Genus database with same CATH topology
 3PW0 A;  3RAQ A;  2R8K A;  3GTL A;  3WO0 A;  2VR1 A;  1ZQ7 A;  5DG9 A;  4O2B F;  4KHP H;  1I94 H;  1EUC B;  4DV1 H;  1KJ8 A;  4ZQI A;  2R92 A;  2DIK A;  3OUZ A;  2GLT A;  4RNN A;  3QZ8 A;  2IP4 A;  1C30 A;  1DV1 A;  3UFX B;  1KBL A;  5KFB A;  4J9L A;  3VPB A;  5EWF A;  2FK2 A;  2HVS A;  2RF4 A;  3QFF A;  3N43 B;  3T1Y H;  2JA7 A;  1VAJ A;  3TIN A;  4AYB A;  4ZI7 F;  4ME6 A;  5DGB A;  1BXR A;  3IN5 A;  2UUC H;  3G6V A;  4IR1 A;  1E4G T;  4IHJ F;  4MA5 A;  4JI1 H;  5IYZ F;  3BAA A;  4Q8F A;  2FK1 A;  5KFG A;  3J80 W;  4X62 H;  1Y1W A;  4MV8 A;  3GQC A;  1I7N A;  5L1L A;  4ECV A;  5BPH A;  1RK5 A;  1HNW H;  2FP4 B;  2V59 A;  3PO3 G;  2W6P A;  4QWD A;  3BA9 A;  3I12 A;  4WD3 A;  5LA6 F;  4O3N A;  4MV6 A;  5DLG A;  4RU9 A;  3KHR A;  1XMQ H;  4LF5 H;  1P8L A;  1JKJ B;  4GKK H;  1M7J A;  1SCU B;  3Q8Q B;  2BR0 A;  5F9N A;  2W71 A;  2WB1 A;  4JI4 H;  3KHG A;  5D1O B;  1RYR A;  4BBS G;  4I55 F;  2UVU A;  2XGQ A;  1M6V A;  1KJI A;  3PR5 B;  2DWC A;  3R5H A;  4MV9 A;  4O3R A;  3F8N A;  4DV2 H;  1S10 A;  4I50 F;  3U9T A;  2XGP A;  2NU9 B;  3MWE A;  5KFC A;  4IR9 A;  2YRW A;  5EWE A;  5DGA A;  4LF6 H;  2FPI B;  3LWB A;  4Q43 A;  1B04 A;  5LMN H;  3L2P A;  4JUZ A;  4LFA H;  2UXD H;  4I4T F;  2YRX A;  5H80 A;  2JA5 G;  4GLX A;  2YZG A;  4ED7 A;  2VA3 A;  1A0I A;  5D1O A;  1OWT A;  2FLP A;  2WAQ E;  1FVI A;  1S0N A;  2VQD A;  1FKA H;  1UNN C;  5KFA A;  5F9L A;  5KG7 A;  3H40 A;  4F4X A;  1Z2N X;  3V6J A;  4JI7 H;  1TAE A;  2UVR A;  1I6U A;  2QYZ A;  2PN1 A;  5KG2 A;  3PVX A;  4ED8 A;  5L1I A;  2W9C A;  2YYA A;  2V4Q A;  4ED2 A;  2BQR A;  1Y1W G;  2I87 A;  5JUM A;  4ECU A;  2ASD A;  1TWG A;  1S03 G;  4A3B G;  5KFS A;  3GIL A;  4UCT A;  4IWX A;  2MCT A;  3EPI A;  4EYH B;  3VMM A;  1AN7 A;  3DF7 A;  3MR5 A;  3PZP A;  4TQS A;  4B3S H;  4NXM H;  2CW7 A;  1KJJ A;  5KFK A;  3N41 B;  5KFH A;  2W8L A;  3TII A;  2YL2 A;  3L4K A;  3T5H A;  4A3D G;  3GLK A;  2F4V H;  3VPC A;  4TV8 F;  2ASL A;  3Q1K A;  4A3I G;  4E4T A;  2FKL A;  1R9T A;  1GSO A;  2FPG B;  5CAE B;  4R8U B;  2J6S A;  5KFY A;  2W6Z A;  5IT9 W;  4A3F G;  5KKN B;  5KFE A;  4U7C A;  4IWY A;  3HB9 A;  1T36 A;  4Y8V B;  4RNM A;  2W6M A;  4R8U A;  1ZHS A;  2XCL A;  3GII A;  4EBE A;  2R8H A;  4F4Y A;  2DLN A;  3GIQ A;  1GGO A;  3T5L A;  2JA6 G;  1GSA A;  3G8C A;  3U9S A;  1J5E H;  3J7A K;  4IAJ A;  4RB3 C;  3L4J A;  5C4X G;  1BJT A;  5CA1 F;  5KFO A;  1WH2 A;  4DUY H;  4UCU A;  3N6X A;  3M9O B;  4JV0 A;  3T5J A;  2UVV A;  4NXN H;  4TV9 F;  4ECW A;  3T5K A;  4DR3 H;  1JDE A;  4DL2 A;  3R23 A;  1BGW A;  2JEF A;  4JI8 H;  3BJY A;  1JDB B;  3OUU A;  1SEI A;  3PR4 A;  4YAK B;  1RK6 A;  1Z2O X;  4DL3 A;  5IP9 G;  1K83 A;  3OHB A;  1O75 A;  5EOY A;  4DLK A;  4RZQ A;  3G6Y A;  3Q8R B;  2DPI A;  3JSL A;  1S97 A;  4J9M A;  2BQU A;  2R87 A;  3RB6 A;  2NU6 B;  4LF4 H;  2IA6 A;  4ECX A;  2JA8 G;  2ZJT A;  1VS0 A;  1ZHQ A;  1A9X A;  1X9N A;  1EHI A;  2Q2T A;  2VUG A;  5KFF A;  4A3K G;  4ECZ A;  4FS2 A;  4YHH H;  1E4F T;  4ECR A;  3KAJ A;  4JV1 A;  2CZG A;  2WYO A;  3RV3 A;  5KFM A;  1CS0 A;  3JRW A;  4GC7 A;  3GTK A;  1VKZ A;  3Q2O A;  5KFN A;  4J9O A;  5FD5 A;  5KFI A;  3RGZ A;  1Y14 B;  5K2M A;  3KTM A;  3I4M G;  4J9N A;  1L2Z A;  2C35 B;  2HGS A;  5J2T F;  4L1K A;  2OH2 A;  3JSN A;  3KAK A;  3SI8 A;  1ULZ A;  3MFH A;  3HOY G;  3N44 B;  4GC6 A;  4FU0 A;  2I8C A;  4YQW A;  4LFC H;  2PVP A;  1XNR H;  2W6O A;  3HOV G;  4X66 H;  3MFI A;  1T3N A;  3N8D A;  3ETJ A;  4JI2 H;  5KFR A;  5KG0 A;  2C00 A;  2UUA H;  3H4B A;  2ATL A;  3GTG A;  2AU0 A;  4B3M H;  4DR6 H;  2W70 A;  3FDS A;  4APM A;  3FKI A;  5J2U F;  1Y1V A;  2W6Q A;  3C0F B;  1WSC A;  2VPS A;  3MWD A;  3MWM A;  5BPF A;  3JAM W;  1ZET A;  4LFB H;  1DV2 A;  2R84 A;  2WDT A;  4PWQ A;  4AQY H;  5KFW A;  4BY1 G;  2V4R A;  5GON F;  2J9G A;  5LXT F;  4ZOL F;  3K5H A;  4HQ6 A;  1I50 A;  3BQ0 A;  5C8Y F;  4FS1 A;  5KFT A;  2KSW A;  3Q8S B;  2C28 A;  5D1P A;  4O4L F;  4O4I F;  3OHA A;  4DR1 H;  2GPW A;  5EZY F;  4DV0 H;  2W6N A;  2R7K A;  5CA0 F;  2RDJ A;  4IRD A;  2NU8 B;  1Z2P X;  2R6F A;  2JEG A;  4EEQ A;  3MR2 A;  1HR0 H;  2RGR A;  4PDB A;  2R7Z A;  1CQI B;  2J6U A;  3PW2 A;  2AGO A;  2UVW A;  1N34 H;  4YBZ B;  1E4E A;  4HR7 A;  4TQR A;  1N32 H;  2CQY A;  4JV5 H;  1Y1V G;  4Q45 A;  2C2E A;  2OWO A;  5KFL A;  4QW8 A;  2C22 A;  2FJZ A;  5KFQ A;  4DV5 H;  1RJQ A;  3KHL A;  1B33 N;  4RB0 A;  4ED1 A;  5EDW A;  4A3C G;  4IZO A;  3EYY A;  3V4S A;  1JLL B;  3RF2 A;  4K0K H;  1S0M A;  4EYI B;  2YCH A;  2W7O A;  2XIG A;  4DL6 A;  3RJ0 A;  4B3T H;  4CC5 A;  5LP6 F;  3H20 A;  4J9S A;  2WAQ A;  1HNZ H;  1IBL H;  4C5C A;  1FJG H;  4A3J G;  4DL7 A;  2W7P A;  1IBK H;  2V58 A;  2YZM A;  3RB0 A;  4EEY A;  2UXB H;  1M0W A;  1WCM A;  2SCU B;  1N48 A;  5KG1 A;  2CW8 A;  3H0G A;  3LP8 A;  1TWC A;  4A2A A;  3M4I A;  5KG4 A;  1CQJ B;  1KC7 A;  3V4Z A;  4EGJ A;  4RB1 A;  3MJF A;  4O4H F;  4TUY F;  4MTE A;  3RGX A;  1W96 A;  4LF8 H;  4XYL B;  5KT7 A;  3BQ1 A;  1XDN A;  3RIZ A;  5KT3 A;  2JEI A;  1BNC A;  5KFJ A;  2R8J A;  3OSN A;  5IYC G;  5JH7 F;  5HV6 A;  5KT6 A;  3J81 W;  4JI0 H;  4JV2 A;  2FE3 A;  5KT2 A;  4AYB E;  5LL6 b;  4A3E G;  2AGP A;  3HKZ E;  5KG5 A;  1SFO A;  4A3G G;  2V9W A;  1AUX A;  4ECT A;  5EWG A;  2ZM6 H;  4QWE A;  4C2M A;  3JRX A;  4HNU A;  4BY7 G;  2FPP B;  1EYZ A;  2DZD A;  3GV8 B;  1S9F A;  4NLG A;  3HOW G;  3SE7 A;  3PW4 A;  4QW9 A;  3GTP A;  2ZDH A;  5DLF A;  3TIG A;  4ECQ A;  4O3P A;  3RV4 A;  2B63 A;  1JXL A;  1GYF A;  2HVQ A;  4UCS A;  1TWA A;  4O3S A;  3I4N G;  3GTM A;  5C3E G;  2V5A A;  2YZN A;  4WBN F;  3HBL A;  2W9B A;  3K3P A;  5KX5 F;  1PX2 A;  5I47 A;  3K5I A;  3GIK A;  3PW5 A;  3ORR A;  4RZR A;  3HOZ G;  3GID A;  2NUA B;  1GSH A;  1SYX B;  1I3Q A;  1AUV A;  5HBR B;  3KHH A;  3RBD A;  3RAX A;  2RDI A;  3M9N B;  3BG5 A;  5JQW A;  1UC9 A;  4RNO A;  4MV7 A;  4RAZ A;  2R86 A;  2DPJ A;  3PO2 G;  2OLS A;  3GIM A;  2NVY A;  4JI6 H;  3BQ2 A;  3KXY T;  4DV7 H;  5DQI A;  5FD6 A;  4MV4 A;  1XNQ H;  2C2D A;  4DV6 H;  4G3I A;  4IRK A;  2FK3 A;  3HOU G;  3FKI G;  4EFE A;  4MTD A;  5L9X A;  4LH7 A;  2W9A A;  3FMA A;  5C5J A;  3BAB A;  3N42 B;  3N40 P;  3RFC A;  1B6S A;  5IWA H;  5KFD A;  2WTF A;  3R5X A;  1N56 A;  4YP3 A;  5C1P A;  3V6K A;  2CKZ B;  4Q0Y A;  5IYD G;  4F50 A;  3RBE A;  4FM9 A;  2BQ3 A;  5BMV F;  2FMA A;  5FJ8 G;  3BA8 A;  2JA6 A;  4YAJ B;  2R7L A;  4XZ3 B;  3GIP A;  4FBT A;  1K1Q A;  3GTJ A;  2JA7 G;  4YR3 A;  4O3Q A;  2VOB A;  1DGS A;  2FB9 A;  5FLX W;  2R7M A;  2R92 G;  2O03 A;  2J6T A;  4B3R H;  2W57 A;  3QZ7 A;  4M9U A;  4QWB A;  4A93 G;  2VA2 A;  4LMY A;  5DG7 A;  4UCR A;  3GTO A;  4EBC A;  3H0G G;  2E5L H;  4DR2 H;  4RUA A;  1TWH A;  2PMZ E;  2UU9 H;  1GLV A;  2E2H A;  4YB8 B;  5L1K A;  3H3V H;  2YS6 A;  5DQH A;  3ETH A;  1K1S A;  1W93 A;  1UC8 A;  4OX9 H;  4ED6 A;  4Q44 A;  1T94 A;  2IBK A;  4GKJ H;  1CE8 A;  2UXC H;  2P0A A;  4LSX A;  3RB4 A;  3HOX G;  4LF9 H;  1IBM H;  1S0O A;  4F4Z A;  4DUZ H;  4ED3 A;  2AQ4 A;  5L1J A;  2HVR A;  5C1O A;  5KFP A;  4QJF A;  4C5A A;  3M9M B;  4DR4 H;  2HHH H;  2VQE H;  4F4W A;  2C2R A;  1IOV A;  3UQ8 A;  4QWC A;  1E4E B;  5BR8 H;  2NU7 B;  2ZDG A;  4UFZ A;  5CB4 F;  2ALZ A;  1MZB A;  4HNT A;  1S68 A;  5KG6 A;  4YR2 A;  3RB3 A;  2JA5 A;  1VBG A;  4LH6 A;  2QK4 A;  3R5F A;  2Y0S E;  3CQZ A;  2GPS A;  2PBZ A;  2ASJ A;  4RB2 C;  2VQF H;  4DL4 A;  2RGV A;  4ECY A;  1N36 H;  2JEJ A;  4A2B A;  1XMO H;  3JZI A;  2YS7 A;  3GIJ A;  5KFX A;  2WB1 E;  1N33 H;  3HKZ A;  3TQT A;  3EPG A;  5KFV A;  4J0M A;  4HNV A;  4M7E A;  2HJW A;  1TWF A;  4ETS A;  3RUP A;  4BXX G;  4DR5 H;  4MA0 A;  2E2I A;  1KEE A;  2X0S A;  1WCM G;  1EUD B;  4MV1 A;  4X65 H;  5C44 G;  2PMZ A;  4JI5 H;  2B63 G;  2VUM G;  2NVX A;  3VPD A;  1KJQ A;  4IRC A;  1RJR A;  5FPR A;  5JVL A;  2AGQ A;  2XCA A;  2W9B B;  4BBR G;  4BWS C;  3KAL A;  2R8G A;  1JIH A;  2R7N A;  4JYA H;  2WE6 A;  4RAY A;  5KG3 A;  4YY3 H;  4YJ3 F;  2VUM A;  1KJ9 A;  4UCV A;  1IOW A;  1B6R A;  3LML A;  1V9P A;  5FLM G;  1RYS A;  3GV5 B;  1GO3 E;  3H4D A;  5KFU A;  4RUC A;  1WR2 A;  5KT5 A;  4U6P A;  2XC9 A;  4ECS A;  3PN1 A;  3OSP A;  2UUB H;  4HYK A;  2R7Z G;  3V6H A;  1DIK A;  4XYM B;  5FPO A;  4EG0 A;  4EFB A;  3NGD A;  1C3O A;  3GTQ A;  4DL5 A;  3Q8P B;  4LSA A;  4DV4 H;  2Y0S A;  4R7R A;  4ZHQ F;  1RJP A;  4MAM A;  4CC6 A;  3GV7 B;  3E5N A;  2XCP A;  4X64 H;  3WNZ A;  4YR0 A;  3IG0 A;  3ORQ A;  5D8D A;  2YU9 A;  3CVZ A;  4UCO A;  2FLN A;  1EZ1 A;  1I7L A;  3HXL A;  2VPQ A;  2M05 A;  2ZDQ A;  3RTX A;  2XD4 A;  5KT4 A;  4LF7 H;  2R93 A;  3TQ1 A;  4C5B A;  5KFZ A;  4J9P A;  4DR7 H;  3T1H H;  2I80 A;  5JVD F;  4DV3 H;  4QWA A;  2IMW P;  1HNX H;  5DQG A;  1JX4 A;  2Q2U A;  1VBH A;  4QIW A;  5DG8 A;  3MR3 A;  2FLL A;  1V51 A;  4O2A F;  4EGQ A;  5LYJ F;  3MR6 A;  2R8I A;  4J9Q A;  4J9K A;  3K3V A;  3AYH B;  4EBD A;  3G6X A;  3WO1 A;  4A3L G;  2R93 G;  5IP7 G;  1PK8 A;  2YW2 A;  5LMU H;  2W9C B;  4J9R A;  2R85 A;  5A2Q W;  1TA8 A;  3OTO H;  4MV3 A;  5T14 A;  4A3M G;  4YJ2 F;  2R82 A;  3PW7 A;  4JI3 H;  5LOV F;  2W8K A;  1V4Y A;  4FBU A;  1M0T A;  4O3O A;  4ED0 A;  4XX0 B;  4QIW E;  4I7H A;  4Q8E A;  5IYB G; 
#chains in the Genus database with same CATH homology
 1WH2 A;  4A2A A;  4RB1 A;  3M4I A;  4DUY H;  4UCU A;  3N6X A;  2HVR A;  4MTE A;  3RGX A;  4LF8 H;  4NXN H;  4DR4 H;  2HHH H;  4KHP H;  1I94 H;  2VQE H;  4DV1 H;  4DR3 H;  1BGW A;  1XDN A;  3RIZ A;  3UQ8 A;  4JI8 H;  5BR8 H;  2HVS A;  1SEI A;  4UFZ A;  3J81 W;  3N43 B;  3T1Y H;  1MZB A;  1Z2O X;  4JI0 H;  1S68 A;  2UUC H;  2FE3 A;  1O75 A;  4LH6 A;  5EOY A;  1E4G T;  4RZQ A;  5LL6 b;  3JSL A;  4JI1 H;  3BAA A;  4RB2 C;  2VQF H;  4LF4 H;  2RGV A;  3J80 W;  2ZJT A;  4X62 H;  1VS0 A;  1ZHQ A;  1X9N A;  4A2B A;  1N36 H;  2ZM6 H;  1HNW H;  1XMO H;  2Q2T A;  2VUG A;  4YHH H;  1E4F T;  1N33 H;  3KAJ A;  3BA9 A;  2WYO A;  1XMQ H;  4J0M A;  4LF5 H;  4M7E A;  4GKK H;  1P8L A;  4ETS A;  1GYF A;  4DR5 H;  2HVQ A;  4UCS A;  4JI4 H;  5FD5 A;  3RGZ A;  4X65 H;  1L2Z A;  5D1O B;  4JI5 H;  2HGS A;  3JSN A;  3KAK A;  3N44 B;  4MV9 A;  5FPR A;  3F8N A;  4DV2 H;  1SYX B;  4LFC H;  1XNR H;  4BWS C;  3KAL A;  4X66 H;  4LF6 H;  1B04 A;  5LMN H;  4MV7 A;  3L2P A;  4RAZ A;  4JI2 H;  4JYA H;  4LFA H;  2UXD H;  4RB3 C;  2WE6 A;  2UUA H;  4RAY A;  4YY3 H;  4GLX A;  4DR6 H;  4B3M H;  1A0I A;  4UCV A;  3LML A;  5D1O A;  3KXY T;  1V9P A;  4DV7 H;  4APM A;  4JI6 H;  5FD6 A;  1FVI A;  1XNQ H;  3C0F B;  2VPS A;  4PDB A;  4LFB H;  3MWM A;  4DV6 H;  3JAM W;  1FKA H;  2WDT A;  4MTD A;  4EFE A;  4AQY H;  1Z2N X;  3PN1 A;  4JI7 H;  1TAE A;  4LH7 A;  2UUB H;  1I6U A;  3FMA A;  5FPO A;  3BAB A;  3N42 B;  3N40 P;  4EFB A;  5IWA H;  2KSW A;  4DV4 H;  5D1P A;  4LSA A;  4R7R A;  4DR1 H;  1S03 G;  4Q0Y A;  4DV0 H;  4FM9 A;  4CC6 A;  3BA8 A;  4X64 H;  4UCT A;  1Z2P X;  3IG0 A;  4EEQ A;  1HR0 H;  3CVZ A;  4UCO A;  2MCT A;  2RGR A;  3HXL A;  1AN7 A;  3RTX A;  3L4J A;  2VOB A;  1DGS A;  3DF7 A;  1N34 H;  5FLX W;  4B3S H;  4LF7 H;  4NXM H;  2O03 A;  2CW7 A;  4JV5 H;  4B3R H;  3N41 B;  1N32 H;  2OWO A;  2W57 A;  3T1H H;  4DR7 H;  3L4K A;  4DUZ H;  4DV3 H;  4DV5 H;  2F4V H;  4LMY A;  4RB0 A;  4UCR A;  1HNX H;  2Q2U A;  2E5L H;  3EYY A;  4DR2 H;  2UU9 H;  3RF2 A;  4K0K H;  5IT9 W;  3K3V A;  2YCH A;  2XIG A;  4B3T H;  3RJ0 A;  4CC5 A;  1HNZ H;  3H20 A;  1ZHS A;  1IBL H;  5LMU H;  1FJG H;  5A2Q W;  1TA8 A;  3OTO H;  1IBK H;  4JI3 H;  4OX9 H;  4GKJ H;  2UXB H;  1M0W A;  1J5E H;  2UXC H;  4LSX A;  1M0T A;  4IAJ A;  4LF9 H;  3J7A K;  1IBM H;  4I7H A;  2CW8 A;  1BJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...