3KXYT

Crystal structure of the exsc-exse complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
TEAVGHFEGRSVTRAAVRGEDRSSVAGLARWLARNVAGDPRSEQALQRLADGDGTPLEARTVRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/transcription inhibitor
molecule keywords Exoenzyme S synthesis protein C
publication title Analysis of the Crystal Structure of the ExsC.ExsE Complex Reveals Distinctive Binding Interactions of the Pseudomonas aeruginosa Type III Secretion Chaperone ExsC with ExsE and ExsD.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 11
structure length 65
sequence length 65
chains with identical sequence U, V, W, X, Y
ec nomenclature
pdb deposition date 2009-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF18286 T3SS_ExsE Type III secretion system ExsE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.370 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kxyT00
3KXYT
chains in the Genus database with same CATH superfamily
1N48A 3GIKA 5FPRA 2VQDA 5KFSA 3MWMA 2V59A 2C2DA 1WH2A 5KFZA 3UQ8A 2GLTA 5L9XA 3HKZE 4O3OA 3H40A 2FB9A 2W8KA 1M0WA 2FP4B 4QW8A 3U9TA 2VR1A 4ZOLF 4IR9A 4DR1H 2KSWA 3RAQA 3MFHA 3L4KA 3R23A 4ZI7F 4A3MG 4LFBH 2XD4A 2NU8B 4HNTA 2R7KA 5KT5A 5KG5A 5FLMG 5KX5F 2VOBA 3M9NB 4X65H 4DL5A 2PVPA 4LF8H 4YAKB 1J5EH 1XDNA 4JI4H 3SE7A 1KJQA 1PX2A 1KEEA 2DIKA 2W71A 4RUCA 1HR0H 3MJFA 5IYZF 1XMOH 4YR0A 3HXLA 4MA5A 3KHRA 5JH7F 1EHIA 2Y0SA 5KFAA 4A3KG 4O4LF 4MV6A 3GIQA 1SCUB 2XCAA 2W9BA 4ECVA 4EFEA 1T3NA 4BXXG 4J9NA 2SCUB 4A2BA 4DL2A 1JDBB 4LMYA 3RGXA 4IRDA 1TWCA 1T94A 2R8HA 4EBDA 4BBSG 4ECYA 4DV6H 1TAEA 4WD3A 2YU9A 4EEQA 5KFFA 1L2ZA 2UXBH 2FPPB 4AYBE 5KT7A 5J2UF 5EWFA 3TQ1A 1RYRA 2ASLA 2IMWP 4HR7A 4UCRA 1P8LA 1IOVA 2V9WA 4NXNH 3OSPA 1JX4A 5LP6F 1I7LA 5FJ8G 1TWAA 2PN1A 4A3GG 3N8DA 4FM9A 1K1QA 4LSXA 2R86A 5KFCA 3R5FA 1TWFA 5L1KA 3BAAA 2FK1A 2VPSA 5C1OA 3GIMA 1Y14B 2WAQA 2FPGB 3T1YH 1UNNC 2RGVA 3LMLA 4XYMB 4ECUA 3RB3A 3FKIG 1SFOA 2F4VH 2UXCH 3GIJA 2WYOA 3OUUA 3V4ZA 4ED7A 2B63G 2HVSA 4DR6H 3KAJA 4ZHQF 4X66H 2UVWA 3GTJA 3T5JA 4BY7G 1CQIB 1EUCB 4G3IA 3GTLA 4JI7H 3FKIA 3PW4A 1A0IA 1EYZA 4O3NA 2JA6G 3KTMA 2IBKA 5KFGA 3I4MG 1HNWH 2B63A 3BQ1A 4F4ZA 2FLLA 4X64H 3G6VA 3HOUG 1FKAH 2DZDA 2I87A 2AU0A 1MZBA 4O4HF 3H4DA 2VA3A 4DV2H 4RB0A 2GPSA 4J0MA 4JV5H 2JA6A 4EGQA 1FJGH 4MAMA 2W70A 3WO1A 4DR2H 4IRKA 3LWBA 4A3LG 2VUGA 1JIHA 2RDJA 2FLNA 1S03G 3H3VH 2CW7A 4ETSA 2X0SA 3MWDA 3RB4A 5BPHA 3K5HA 2HHHH 4R7RA 3JRXA 4DUYH 3QZ7A 3MR6A 5JUMA 5EDWA 3H4BA 2Y0SE 4ECSA 2R8GA 5KFHA 2UUCH 3T5KA 2NVYA 1HNZH 4IWXA 2RF4A 2ZDQA 1S0OA 2XGQA 1Z2NX 4MTEA 5KFIA 4TQRA 2HVRA 3HOWG 1GSOA 5LMUH 2YL2A 2C22A 2JA8G 1E4EB 4YAJB 3ORQA 3OHBA 1EZ1A 5KT4A 2WB1A 5A2QW 2W6OA 4DLKA 4Q8FA 1IBMH 4LH7A 4UFZA 4QWEA 4BY1G 3MWEA 4DR3H 2QYZA 5KT6A 2E2IA 2C00A 2YRXA 2VQFH 4O3PA 2J6SA 4JYAH 3RTXA 2MCTA 3N44B 3G8CA 3RJ0A 4QJFA 5KFTA 4YBZB 5EOYA 5KFKA 3TIIA 1KBLA 3VPDA 1ULZA 1N34H 1RK6A 4FBTA 4C5BA 3Q8PB 4PDBA 1K1SA 5D1PA 4QIWE 5C44G 3OTOH 3TQTA 4JV0A 2QK4A 5KFPA 3PR4A 4RNOA 3GIIA 2W9CB 4ECTA 4A3DG 4A93G 2UVRA 3AYHB 4QWCA 3PN1A 4DV1H 4A3IG 1B33N 3M9MB 2R7MA 2V4RA 1W93A 2W6PA 3KHLA 3V6HA 2C2EA 1CS0A 1KC7A 4TV8F 4GC6A 2BR0A 3N43B 1ZHQA 4R8UA 3VPBA 1EUDB 2WDTA 4BBRG 5KT3A 4MV7A 3Q1KA 1UC9A 3JZIA 4YJ3F 3UFXB 5KKNB 3F8NA 2AGQA 5CB4F 4UCUA 3TIGA 2PMZA 3BQ0A 3ETJA 2JEFA 5JVLA 4JI1H 4JI8H 2FLPA 3BA9A 2C2RA 4O4IF 1S9FA 2YYAA 3GLKA 2JA7G 1IBLH 2R8KA 4RZQA 3N6XA 1DIKA 3V4SA 3PW2A 4RU9A 2J9GA 3KHHA 3GTPA 4RUAA 4F4YA 2IA6A 3GILA 2R7ZG 2E2HA 1E4GT 5HBRB 2UU9H 1VKZA 1AN7A 4EGJA 1GLVA 4ME6A 1TA8A 3WO0A 1ZHSA 1A9XA 4U6PA 5J2TF 2W7OA 2JA7A 3U9SA 2AQ4A 4Y8VB 5DQHA 5KFDA 2V5AA 3HOXG 4EBCA 2E5LH 2W6MA 2R7ZA 4LSAA 3GV7B 4L1KA 3CVZA 5DGBA 3FMAA 2V4QA 1C3OA 2UVUA 3RB6A 1K83A 4MV3A 3Q2OA 4GC7A 5BPFA 2WTFA 3ORRA 4ED0A 1KJ8A 2FE3A 1RJRA 4M7EA 2VUMG 3CQZA 1T36A 4E4TA 1KJ9A 3FDSA 2R82A 2R84A 1B6RA 3RBDA 4MA0A 4MV8A 5CA0F 1JKJB 5KG6A 1VAJA 5IP9G 2ASDA 2FPIB 4K0KH 2VUMA 5K2MA 4FS2A 3BJYA 2CZGA 2RGRA 3MR5A 2VA2A 1IOWA 2AGOA 4DV7H 4JI2H 1I7NA 2ZM6H 3HOZG 1VBHA 4ECQA 2ASJA 3BA8A 1S10A 3GTMA 1RK5A 2R6FA 2JA5G 4LF7H 5KFLA 2R7NA 2OWOA 5C1PA 5KG7A 5BMVF 3HBLA 4RB3C 4HNUA 3GV5B 3RIZA 5CAEB 4A3CG 3IG0A 1E4FT 4JUZA 4QWAA 2XC9A 4UCVA 4QW9A 1JXLA 4DV5H 4J9RA 3J81W 2JA5A 3ETHA 4DUZH 5IYCG 1XNQH 1B6SA 3PO2G 2DLNA 2XIGA 3K3PA 4C2MA 4DR5H 1DGSA 3SI8A 2W6NA 5F9NA 4MV4A 4O3RA 5C3EG 4I4TF 3JSLA 4O2BF 5KFMA 2IP4A 3IN5A 2W9BB 5KFRA 1AUVA 4PWQA 2R85A 2W9CA 5LXTF 4FU0A 3N40P 5JVDF 4DR7H 4ZQIA 3HKZA 4MV9A 4Q0YA 3G6XA 3GTKA 2Q2TA 4ECWA 2W9AA 1V51A 3KAKA 1CQJB 2M05A 1R9TA 1B04A 3G6YA 1O75A 2FK2A 5LYJF 4QWBA 3MR3A 4B3SH 4O2AF 4DL6A 3GTOA 2ATLA 2Q2UA 2ZDGA 4EG0A 5KFQA 2R8IA 4F50A 4J9SA 5L1IA 4IHJF 2W57A 4NXMH 2UUBH 1S0NA 3I12A 2UVVA 2WAQE 5T14A 4TQSA 4A3FG 2NVXA 2FMAA 4J9KA 5LOVF 4FBUA 5DLFA 4JI3H 5KG3A 1CE8A 3LP8A 5IYDG 3JSNA 4ECRA 1OWTA 1GSHA 2P0AA 1WSCA 4APMA 1W96A 5FLXW 3Q8SB 3OHAA 3R5XA 1Z2PX 3H20A 4X62H 4AYBA 4GLXA 1FVIA 2YS7A 5KFVA 4CC5A 5KFBA 5IP7G 3RGZA 3T5HA 5D1OB 1GGOA 2VPQA 2ALZA 5EWEA 5KG1A 4YB8B 1V9PA 4ED1A 4Q43A 4XYLB 3KXYT 3EPIA 4JI5H 5KFJA 4DV4H 4FS1A 1BXRA 3OUZA 1N56A 1XNRH 3J80W 3KALA 4EYHB 1M6VA 5DQGA 4IZOA 3HOYG 2AGPA 3GIPA 5KFEA 5IT9W 1GYFA 2R8JA 1N33H 1KJIA 2YS6A 3BABA 3PO3G 4UCSA 4HNVA 3MFIA 4MTDA 3PW0A 4XZ3B 4O3QA 1S0MA 5F9LA 1WR2A 1SYXB 5DLGA 5KG2A 2YRWA 3RB0A 5CA1F 4F4XA 3JRWA 4J9PA 4WBNF 2UUAH 2O03A 3I4NG 2WE6A 4EFBA 2WB1E 2I8CA 5I47A 4DV3H 4LF6H 3HB9A 1N32H 2VQEH 3R5HA 4Q44A 4YHHH 1JDEA 4LH6A 1DV1A 5EZYF 3MR2A 5LMNH 4EYIB 1S97A 4U7CA 3TINA 4LFAH 5HV6A 4ED6A 5C8YF 5C5JA 4IWYA 4JV1A 4RB1A 4B3TH 5L1JA 3N41B 2OLSA 4TUYF 4QWDA 5DGAA 1I6UA 4TV9F 2NU9B 4YQWA 5KFWA 3M4IA 5KT2A 2YZGA 3EPGA 4HYKA 3Q8RB 1I94H 4J9OA 1HNXH 5KFNA 2NUAB 3HOVG 2UXDH 2R93G 3T1HH 2C35B 2W7PA 5IYBG 4JI6H 3GTGA 2J6TA 4RB2C 2FK3A 5BR8H 4BWSC 4R8UB 1RYSA 1DV2A 2FJZA 4YJ2F 1E4EA 1XMQH 4O3SA 5D8DA 1RJPA 2R92G 3RFCA 3KHGA 4B3RH 2R93A 4DR4H 5DG8A 3RV3A 3EYYA 1AUXA 2ZDHA 3PR5B 3L4JA 2W8LA 3RUPA 4YY3H 1M0TA 2R7LA 5C4XG 1PK8A 3E5NA 2PMZE 5FPOA 5GONF 2GPWA 2BQUA 4RAYA 2XCLA 2R92A 1M7JA 2V58A 1BJTA 3OSNA 1BNCA 2ZJTA 2CKZB 4A3EG 2C28A 2R87A 1S68A 5EWGA 2XCPA 1I50A 5KFOA 5L1LA 4DL4A 5LL6b 4ED2A 1Y1WG 3N42B 2DWCA 1N36H 4AQYH 4QIWA 4B3MH 4J9MA 2BQ3A 1C30A 4LF9H 3GIDA 3K3VA 4M9UA 4MV1A 4LFCH 5JQWA 3GTQA 1TWGA 2RDIA 4DL3A 2JEIA 4LF5H 2NU7B 3M9OB 4A3JG 3DF7A 4C5CA 3V6KA 3PW5A 5KFYA 4YP3A 1Y1WA 1I3QA 3VMMA 1Y1VG 5IWAH 5KG0A 3GQCA 5KFUA 4IRCA 2HJWA 2DPJA 1SEIA 4RZRA 1ZQ7A 2YZNA 4UCOA 4UCTA 4ED3A 2DPIA 4JI0H 4LF4H 5D1OA 1ZETA 4IR1A 5DQIA 1GSAA 3J7AK 5FD5A 1Y1VA 5FD6A 5KFXA 4YR3A 1V4YA 2NU6B 1JLLB 4I50F 4GKJH 2FKLA 4EBEA 3L2PA 2W6ZA 4EEYA 1BGWA 2CW8A 4GKKH 4I55F 4I7HA 4RAZA 3K5IA 4Q45A 4IAJA 4ECXA 2HGSA 1WCMG 2YW2A 3BQ2A 1IBKH 2CQYA 3RBEA 3H0GG 2YCHA 3QZ8A 1TWHA 4YR2A 3PZPA 4RNMA 4Q8EA 4C5AA 4DL7A 4ECZA 5DG7A 5DG9A 4A2AA 4CC6A 1WCMA 4JV2A 3T5LA 3Q8QB 3NGDA 4OX9H 3PW7A 2OH2A 3BG5A 1Z2OX 5H80A 1UC8A 4DV0H 4KHPH 1RJQA 2YZMA 2W6QA 3H0GA 4J9LA 2XGPA 3GV8B 3RV4A 2J6UA 4NLGA 4HQ6A 1X9NA 2JEJA 3PVXA 3RAXA 4RNNA 3WNZA 1VS0A 4XX0B 3VPCA 4ED8A 2BQRA 5KG4A 2I80A 1VBGA 2HVQA 5LA6F 2PBZA 3V6JA 2JEGA 3QFFA 3JAMW 1KJJA 3C0FB 4F4WA 4J9QA 1GO3E 4A3BG 3RF2A
chains in the Genus database with same CATH topology
3RIZA 5FPRA 3IG0A 1E4FT 4UCVA 3MWMA 4RB1A 4DV5H 4B3TH 1WH2A 3N41B 3UQ8A 3J81W 5A2QW 1I6UA 4GKKH 3M4IA 1HNXH 1IBMH 4LH7A 1I94H 4DUZH 1XNQH 4UFZA 1M0WA 2XIGA 4DR3H 2UXDH 4DR5H 1DGSA 4DR1H 3T1HH 2KSWA 2VQFH 4JI6H 4RB2C 3L4KA 4JYAH 3JSLA 5BR8H 3RTXA 4BWSC 2MCTA 3N44B 3RJ0A 4LFBH 5EOYA 1XMQH 3N40P 2VOBA 4LF8H 4X65H 4DR7H 4B3RH 4MV9A 4Q0YA 1XDNA 1N34H 1J5EH 4JI4H 2Q2TA 4DR4H 4PDBA 3EYYA 5D1PA 3L4JA 4YY3H 3KAKA 1M0TA 3OTOH 1B04A 1HR0H 5FPOA 1O75A 1XMOH 3PN1A 3HXLA 4RAYA 4DV1H 1BJTA 4B3SH 2ZJTA 2Q2UA 3N43B 1S68A 1ZHQA 4EFEA 2WDTA 5LL6b 3N42B 4A2BA 4LMYA 4MV7A 3RGXA 4AQYH 1N36H 4B3MH 4LF9H 3F8NA 3K3VA 4UCUA 2W57A 4LFCH 4NXMH 4DV6H 2UUBH 1TAEA 4EEQA 4LF5H 1L2ZA 3DF7A 2UXBH 4JI1H 4JI8H 4UCRA 5IWAH 1P8LA 3BA9A 4NXNH 4JI3H 1IBLH 4RZQA 3N6XA 1SEIA 3JSNA 4UCOA 4UCTA 4FM9A 4JI0H 4LSXA 4RB3C 4LF4H 5D1OA 4APMA 1E4GT 3BAAA 2VPSA 2UU9H 5FLXW 3J7AK 1AN7A 5FD5A 3H20A 1Z2PX 4X62H 5FD6A 4GLXA 3T1YH 1TA8A 2RGVA 1ZHSA 3LMLA 2F4VH 2UXCH 1FVIA 4CC5A 2WYOA 3RGZA 2HVSA 5D1OB 2E5LH 4LSAA 4DR6H 4GKJH 3KAJA 4X66H 3CVZA 3L2PA 3FMAA 1BGWA 2CW8A 4I7HA 4RAZA 1V9PA 4IAJA 2HGSA 3KXYT 4JI7H 4JI5H 1A0IA 4DV4H 1IBKH 1XNRH 3J80W 3KALA 1HNWH 2FE3A 2YCHA 4X64H 1FKAH 4M7EA 1MZBA 4A2AA 4CC6A 5IT9W 4DV2H 1GYFA 4RB0A 1N33H 4J0MA 4OX9H 3BABA 4JV5H 1FJGH 4DR2H 1Z2OX 4KHPH 2VUGA 4UCSA 4DV0H 4MTDA 1S03G 2CW7A 4ETSA 4K0KH 1SYXB 1X9NA 2HHHH 4R7RA 4DUYH 2RGRA 2UUAH 1VS0A 2O03A 4DV7H 4JI2H 2ZM6H 2UUCH 2WE6A 4EFBA 4DV3H 4LF6H 3BA8A 1HNZH 2HVQA 1N32H 2VQEH 5LMNH 1Z2NX 4MTEA 3JAMW 4LH6A 4YHHH 3C0FB 4LF7H 2HVRA 2OWOA 5LMUH 3RF2A 4LFAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXY T; 
#chains in the Genus database with same CATH topology
 1N48 A;  3GIK A;  5FPR A;  2VQD A;  5KFS A;  3MWM A;  2V59 A;  2C2D A;  1WH2 A;  5KFZ A;  3UQ8 A;  2GLT A;  5L9X A;  3HKZ E;  4O3O A;  3H40 A;  2FB9 A;  2W8K A;  1M0W A;  2FP4 B;  4QW8 A;  3U9T A;  2VR1 A;  4ZOL F;  4IR9 A;  4DR1 H;  2KSW A;  3RAQ A;  3MFH A;  3L4K A;  3R23 A;  4ZI7 F;  4A3M G;  4LFB H;  2XD4 A;  2NU8 B;  4HNT A;  2R7K A;  5KT5 A;  5KG5 A;  5FLM G;  5KX5 F;  2VOB A;  3M9N B;  4X65 H;  4DL5 A;  2PVP A;  4LF8 H;  4YAK B;  1J5E H;  1XDN A;  4JI4 H;  3SE7 A;  1KJQ A;  1PX2 A;  1KEE A;  2DIK A;  2W71 A;  4RUC A;  1HR0 H;  3MJF A;  5IYZ F;  1XMO H;  4YR0 A;  3HXL A;  4MA5 A;  3KHR A;  5JH7 F;  1EHI A;  2Y0S A;  5KFA A;  4A3K G;  4O4L F;  4MV6 A;  3GIQ A;  1SCU B;  2XCA A;  2W9B A;  4ECV A;  4EFE A;  1T3N A;  4BXX G;  4J9N A;  2SCU B;  4A2B A;  4DL2 A;  1JDB B;  4LMY A;  3RGX A;  4IRD A;  1TWC A;  1T94 A;  2R8H A;  4EBD A;  4BBS G;  4ECY A;  4DV6 H;  1TAE A;  4WD3 A;  2YU9 A;  4EEQ A;  5KFF A;  1L2Z A;  2UXB H;  2FPP B;  4AYB E;  5KT7 A;  5J2U F;  5EWF A;  3TQ1 A;  1RYR A;  2ASL A;  2IMW P;  4HR7 A;  4UCR A;  1P8L A;  1IOV A;  2V9W A;  4NXN H;  3OSP A;  1JX4 A;  5LP6 F;  1I7L A;  5FJ8 G;  1TWA A;  2PN1 A;  4A3G G;  3N8D A;  4FM9 A;  1K1Q A;  4LSX A;  2R86 A;  5KFC A;  3R5F A;  1TWF A;  5L1K A;  3BAA A;  2FK1 A;  2VPS A;  5C1O A;  3GIM A;  1Y14 B;  2WAQ A;  2FPG B;  3T1Y H;  1UNN C;  2RGV A;  3LML A;  4XYM B;  4ECU A;  3RB3 A;  3FKI G;  1SFO A;  2F4V H;  2UXC H;  3GIJ A;  2WYO A;  3OUU A;  3V4Z A;  4ED7 A;  2B63 G;  2HVS A;  4DR6 H;  3KAJ A;  4ZHQ F;  4X66 H;  2UVW A;  3GTJ A;  3T5J A;  4BY7 G;  1CQI B;  1EUC B;  4G3I A;  3GTL A;  4JI7 H;  3FKI A;  3PW4 A;  1A0I A;  1EYZ A;  4O3N A;  2JA6 G;  3KTM A;  2IBK A;  5KFG A;  3I4M G;  1HNW H;  2B63 A;  3BQ1 A;  4F4Z A;  2FLL A;  4X64 H;  3G6V A;  3HOU G;  1FKA H;  2DZD A;  2I87 A;  2AU0 A;  1MZB A;  4O4H F;  3H4D A;  2VA3 A;  4DV2 H;  4RB0 A;  2GPS A;  4J0M A;  4JV5 H;  2JA6 A;  4EGQ A;  1FJG H;  4MAM A;  2W70 A;  3WO1 A;  4DR2 H;  4IRK A;  3LWB A;  4A3L G;  2VUG A;  1JIH A;  2RDJ A;  2FLN A;  1S03 G;  3H3V H;  2CW7 A;  4ETS A;  2X0S A;  3MWD A;  3RB4 A;  5BPH A;  3K5H A;  2HHH H;  4R7R A;  3JRX A;  4DUY H;  3QZ7 A;  3MR6 A;  5JUM A;  5EDW A;  3H4B A;  2Y0S E;  4ECS A;  2R8G A;  5KFH A;  2UUC H;  3T5K A;  2NVY A;  1HNZ H;  4IWX A;  2RF4 A;  2ZDQ A;  1S0O A;  2XGQ A;  1Z2N X;  4MTE A;  5KFI A;  4TQR A;  2HVR A;  3HOW G;  1GSO A;  5LMU H;  2YL2 A;  2C22 A;  2JA8 G;  1E4E B;  4YAJ B;  3ORQ A;  3OHB A;  1EZ1 A;  5KT4 A;  2WB1 A;  5A2Q W;  2W6O A;  4DLK A;  4Q8F A;  1IBM H;  4LH7 A;  4UFZ A;  4QWE A;  4BY1 G;  3MWE A;  4DR3 H;  2QYZ A;  5KT6 A;  2E2I A;  2C00 A;  2YRX A;  2VQF H;  4O3P A;  2J6S A;  4JYA H;  3RTX A;  2MCT A;  3N44 B;  3G8C A;  3RJ0 A;  4QJF A;  5KFT A;  4YBZ B;  5EOY A;  5KFK A;  3TII A;  1KBL A;  3VPD A;  1ULZ A;  1N34 H;  1RK6 A;  4FBT A;  4C5B A;  3Q8P B;  4PDB A;  1K1S A;  5D1P A;  4QIW E;  5C44 G;  3OTO H;  3TQT A;  4JV0 A;  2QK4 A;  5KFP A;  3PR4 A;  4RNO A;  3GII A;  2W9C B;  4ECT A;  4A3D G;  4A93 G;  2UVR A;  3AYH B;  4QWC A;  3PN1 A;  4DV1 H;  4A3I G;  1B33 N;  3M9M B;  2R7M A;  2V4R A;  1W93 A;  2W6P A;  3KHL A;  3V6H A;  2C2E A;  1CS0 A;  1KC7 A;  4TV8 F;  4GC6 A;  2BR0 A;  3N43 B;  1ZHQ A;  4R8U A;  3VPB A;  1EUD B;  2WDT A;  4BBR G;  5KT3 A;  4MV7 A;  3Q1K A;  1UC9 A;  3JZI A;  4YJ3 F;  3UFX B;  5KKN B;  3F8N A;  2AGQ A;  5CB4 F;  4UCU A;  3TIG A;  2PMZ A;  3BQ0 A;  3ETJ A;  2JEF A;  5JVL A;  4JI1 H;  4JI8 H;  2FLP A;  3BA9 A;  2C2R A;  4O4I F;  1S9F A;  2YYA A;  3GLK A;  2JA7 G;  1IBL H;  2R8K A;  4RZQ A;  3N6X A;  1DIK A;  3V4S A;  3PW2 A;  4RU9 A;  2J9G A;  3KHH A;  3GTP A;  4RUA A;  4F4Y A;  2IA6 A;  3GIL A;  2R7Z G;  2E2H A;  1E4G T;  5HBR B;  2UU9 H;  1VKZ A;  1AN7 A;  4EGJ A;  1GLV A;  4ME6 A;  1TA8 A;  3WO0 A;  1ZHS A;  1A9X A;  4U6P A;  5J2T F;  2W7O A;  2JA7 A;  3U9S A;  2AQ4 A;  4Y8V B;  5DQH A;  5KFD A;  2V5A A;  3HOX G;  4EBC A;  2E5L H;  2W6M A;  2R7Z A;  4LSA A;  3GV7 B;  4L1K A;  3CVZ A;  5DGB A;  3FMA A;  2V4Q A;  1C3O A;  2UVU A;  3RB6 A;  1K83 A;  4MV3 A;  3Q2O A;  4GC7 A;  5BPF A;  2WTF A;  3ORR A;  4ED0 A;  1KJ8 A;  2FE3 A;  1RJR A;  4M7E A;  2VUM G;  3CQZ A;  1T36 A;  4E4T A;  1KJ9 A;  3FDS A;  2R82 A;  2R84 A;  1B6R A;  3RBD A;  4MA0 A;  4MV8 A;  5CA0 F;  1JKJ B;  5KG6 A;  1VAJ A;  5IP9 G;  2ASD A;  2FPI B;  4K0K H;  2VUM A;  5K2M A;  4FS2 A;  3BJY A;  2CZG A;  2RGR A;  3MR5 A;  2VA2 A;  1IOW A;  2AGO A;  4DV7 H;  4JI2 H;  1I7N A;  2ZM6 H;  3HOZ G;  1VBH A;  4ECQ A;  2ASJ A;  3BA8 A;  1S10 A;  3GTM A;  1RK5 A;  2R6F A;  2JA5 G;  4LF7 H;  5KFL A;  2R7N A;  2OWO A;  5C1P A;  5KG7 A;  5BMV F;  3HBL A;  4RB3 C;  4HNU A;  3GV5 B;  3RIZ A;  5CAE B;  4A3C G;  3IG0 A;  1E4F T;  4JUZ A;  4QWA A;  2XC9 A;  4UCV A;  4QW9 A;  1JXL A;  4DV5 H;  4J9R A;  3J81 W;  2JA5 A;  3ETH A;  4DUZ H;  5IYC G;  1XNQ H;  1B6S A;  3PO2 G;  2DLN A;  2XIG A;  3K3P A;  4C2M A;  4DR5 H;  1DGS A;  3SI8 A;  2W6N A;  5F9N A;  4MV4 A;  4O3R A;  5C3E G;  4I4T F;  3JSL A;  4O2B F;  5KFM A;  2IP4 A;  3IN5 A;  2W9B B;  5KFR A;  1AUV A;  4PWQ A;  2R85 A;  2W9C A;  5LXT F;  4FU0 A;  3N40 P;  5JVD F;  4DR7 H;  4ZQI A;  3HKZ A;  4MV9 A;  4Q0Y A;  3G6X A;  3GTK A;  2Q2T A;  4ECW A;  2W9A A;  1V51 A;  3KAK A;  1CQJ B;  2M05 A;  1R9T A;  1B04 A;  3G6Y A;  1O75 A;  2FK2 A;  5LYJ F;  4QWB A;  3MR3 A;  4B3S H;  4O2A F;  4DL6 A;  3GTO A;  2ATL A;  2Q2U A;  2ZDG A;  4EG0 A;  5KFQ A;  2R8I A;  4F50 A;  4J9S A;  5L1I A;  4IHJ F;  2W57 A;  4NXM H;  2UUB H;  1S0N A;  3I12 A;  2UVV A;  2WAQ E;  5T14 A;  4TQS A;  4A3F G;  2NVX A;  2FMA A;  4J9K A;  5LOV F;  4FBU A;  5DLF A;  4JI3 H;  5KG3 A;  1CE8 A;  3LP8 A;  5IYD G;  3JSN A;  4ECR A;  1OWT A;  1GSH A;  2P0A A;  1WSC A;  4APM A;  1W96 A;  5FLX W;  3Q8S B;  3OHA A;  3R5X A;  1Z2P X;  3H20 A;  4X62 H;  4AYB A;  4GLX A;  1FVI A;  2YS7 A;  5KFV A;  4CC5 A;  5KFB A;  5IP7 G;  3RGZ A;  3T5H A;  5D1O B;  1GGO A;  2VPQ A;  2ALZ A;  5EWE A;  5KG1 A;  4YB8 B;  1V9P A;  4ED1 A;  4Q43 A;  4XYL B;  3KXY T;  3EPI A;  4JI5 H;  5KFJ A;  4DV4 H;  4FS1 A;  1BXR A;  3OUZ A;  1N56 A;  1XNR H;  3J80 W;  3KAL A;  4EYH B;  1M6V A;  5DQG A;  4IZO A;  3HOY G;  2AGP A;  3GIP A;  5KFE A;  5IT9 W;  1GYF A;  2R8J A;  1N33 H;  1KJI A;  2YS6 A;  3BAB A;  3PO3 G;  4UCS A;  4HNV A;  3MFI A;  4MTD A;  3PW0 A;  4XZ3 B;  4O3Q A;  1S0M A;  5F9L A;  1WR2 A;  1SYX B;  5DLG A;  5KG2 A;  2YRW A;  3RB0 A;  5CA1 F;  4F4X A;  3JRW A;  4J9P A;  4WBN F;  2UUA H;  2O03 A;  3I4N G;  2WE6 A;  4EFB A;  2WB1 E;  2I8C A;  5I47 A;  4DV3 H;  4LF6 H;  3HB9 A;  1N32 H;  2VQE H;  3R5H A;  4Q44 A;  4YHH H;  1JDE A;  4LH6 A;  1DV1 A;  5EZY F;  3MR2 A;  5LMN H;  4EYI B;  1S97 A;  4U7C A;  3TIN A;  4LFA H;  5HV6 A;  4ED6 A;  5C8Y F;  5C5J A;  4IWY A;  4JV1 A;  4RB1 A;  4B3T H;  5L1J A;  3N41 B;  2OLS A;  4TUY F;  4QWD A;  5DGA A;  1I6U A;  4TV9 F;  2NU9 B;  4YQW A;  5KFW A;  3M4I A;  5KT2 A;  2YZG A;  3EPG A;  4HYK A;  3Q8R B;  1I94 H;  4J9O A;  1HNX H;  5KFN A;  2NUA B;  3HOV G;  2UXD H;  2R93 G;  3T1H H;  2C35 B;  2W7P A;  5IYB G;  4JI6 H;  3GTG A;  2J6T A;  4RB2 C;  2FK3 A;  5BR8 H;  4BWS C;  4R8U B;  1RYS A;  1DV2 A;  2FJZ A;  4YJ2 F;  1E4E A;  1XMQ H;  4O3S A;  5D8D A;  1RJP A;  2R92 G;  3RFC A;  3KHG A;  4B3R H;  2R93 A;  4DR4 H;  5DG8 A;  3RV3 A;  3EYY A;  1AUX A;  2ZDH A;  3PR5 B;  3L4J A;  2W8L A;  3RUP A;  4YY3 H;  1M0T A;  2R7L A;  5C4X G;  1PK8 A;  3E5N A;  2PMZ E;  5FPO A;  5GON F;  2GPW A;  2BQU A;  4RAY A;  2XCL A;  2R92 A;  1M7J A;  2V58 A;  1BJT A;  3OSN A;  1BNC A;  2ZJT A;  2CKZ B;  4A3E G;  2C28 A;  2R87 A;  1S68 A;  5EWG A;  2XCP A;  1I50 A;  5KFO A;  5L1L A;  4DL4 A;  5LL6 b;  4ED2 A;  1Y1W G;  3N42 B;  2DWC A;  1N36 H;  4AQY H;  4QIW A;  4B3M H;  4J9M A;  2BQ3 A;  1C30 A;  4LF9 H;  3GID A;  3K3V A;  4M9U A;  4MV1 A;  4LFC H;  5JQW A;  3GTQ A;  1TWG A;  2RDI A;  4DL3 A;  2JEI A;  4LF5 H;  2NU7 B;  3M9O B;  4A3J G;  3DF7 A;  4C5C A;  3V6K A;  3PW5 A;  5KFY A;  4YP3 A;  1Y1W A;  1I3Q A;  3VMM A;  1Y1V G;  5IWA H;  5KG0 A;  3GQC A;  5KFU A;  4IRC A;  2HJW A;  2DPJ A;  1SEI A;  4RZR A;  1ZQ7 A;  2YZN A;  4UCO A;  4UCT A;  4ED3 A;  2DPI A;  4JI0 H;  4LF4 H;  5D1O A;  1ZET A;  4IR1 A;  5DQI A;  1GSA A;  3J7A K;  5FD5 A;  1Y1V A;  5FD6 A;  5KFX A;  4YR3 A;  1V4Y A;  2NU6 B;  1JLL B;  4I50 F;  4GKJ H;  2FKL A;  4EBE A;  3L2P A;  2W6Z A;  4EEY A;  1BGW A;  2CW8 A;  4GKK H;  4I55 F;  4I7H A;  4RAZ A;  3K5I A;  4Q45 A;  4IAJ A;  4ECX A;  2HGS A;  1WCM G;  2YW2 A;  3BQ2 A;  1IBK H;  2CQY A;  3RBE A;  3H0G G;  2YCH A;  3QZ8 A;  1TWH A;  4YR2 A;  3PZP A;  4RNM A;  4Q8E A;  4C5A A;  4DL7 A;  4ECZ A;  5DG7 A;  5DG9 A;  4A2A A;  4CC6 A;  1WCM A;  4JV2 A;  3T5L A;  3Q8Q B;  3NGD A;  4OX9 H;  3PW7 A;  2OH2 A;  3BG5 A;  1Z2O X;  5H80 A;  1UC8 A;  4DV0 H;  4KHP H;  1RJQ A;  2YZM A;  2W6Q A;  3H0G A;  4J9L A;  2XGP A;  3GV8 B;  3RV4 A;  2J6U A;  4NLG A;  4HQ6 A;  1X9N A;  2JEJ A;  3PVX A;  3RAX A;  4RNN A;  3WNZ A;  1VS0 A;  4XX0 B;  3VPC A;  4ED8 A;  2BQR A;  5KG4 A;  2I80 A;  1VBG A;  2HVQ A;  5LA6 F;  2PBZ A;  3V6J A;  2JEG A;  3QFF A;  3JAM W;  1KJJ A;  3C0F B;  4F4W A;  4J9Q A;  1GO3 E;  4A3B G;  3RF2 A; 
#chains in the Genus database with same CATH homology
 3RIZ A;  5FPR A;  3IG0 A;  1E4F T;  4UCV A;  3MWM A;  4RB1 A;  4DV5 H;  4B3T H;  1WH2 A;  3N41 B;  3UQ8 A;  3J81 W;  5A2Q W;  1I6U A;  4GKK H;  3M4I A;  1HNX H;  1IBM H;  4LH7 A;  1I94 H;  4DUZ H;  1XNQ H;  4UFZ A;  1M0W A;  2XIG A;  4DR3 H;  2UXD H;  4DR5 H;  1DGS A;  4DR1 H;  3T1H H;  2KSW A;  2VQF H;  4JI6 H;  4RB2 C;  3L4K A;  4JYA H;  3JSL A;  5BR8 H;  3RTX A;  4BWS C;  2MCT A;  3N44 B;  3RJ0 A;  4LFB H;  5EOY A;  1XMQ H;  3N40 P;  2VOB A;  4LF8 H;  4X65 H;  4DR7 H;  4B3R H;  4MV9 A;  4Q0Y A;  1XDN A;  1N34 H;  1J5E H;  4JI4 H;  2Q2T A;  4DR4 H;  4PDB A;  3EYY A;  5D1P A;  3L4J A;  4YY3 H;  3KAK A;  1M0T A;  3OTO H;  1B04 A;  1HR0 H;  5FPO A;  1O75 A;  1XMO H;  3PN1 A;  3HXL A;  4RAY A;  4DV1 H;  1BJT A;  4B3S H;  2ZJT A;  2Q2U A;  3N43 B;  1S68 A;  1ZHQ A;  4EFE A;  2WDT A;  5LL6 b;  3N42 B;  4A2B A;  4LMY A;  4MV7 A;  3RGX A;  4AQY H;  1N36 H;  4B3M H;  4LF9 H;  3F8N A;  3K3V A;  4UCU A;  2W57 A;  4LFC H;  4NXM H;  4DV6 H;  2UUB H;  1TAE A;  4EEQ A;  4LF5 H;  1L2Z A;  3DF7 A;  2UXB H;  4JI1 H;  4JI8 H;  4UCR A;  5IWA H;  1P8L A;  3BA9 A;  4NXN H;  4JI3 H;  1IBL H;  4RZQ A;  3N6X A;  1SEI A;  3JSN A;  4UCO A;  4UCT A;  4FM9 A;  4JI0 H;  4LSX A;  4RB3 C;  4LF4 H;  5D1O A;  4APM A;  1E4G T;  3BAA A;  2VPS A;  2UU9 H;  5FLX W;  3J7A K;  1AN7 A;  5FD5 A;  3H20 A;  1Z2P X;  4X62 H;  5FD6 A;  4GLX A;  3T1Y H;  1TA8 A;  2RGV A;  1ZHS A;  3LML A;  2F4V H;  2UXC H;  1FVI A;  4CC5 A;  2WYO A;  3RGZ A;  2HVS A;  5D1O B;  2E5L H;  4LSA A;  4DR6 H;  4GKJ H;  3KAJ A;  4X66 H;  3CVZ A;  3L2P A;  3FMA A;  1BGW A;  2CW8 A;  4I7H A;  4RAZ A;  1V9P A;  4IAJ A;  2HGS A;  3KXY T;  4JI7 H;  4JI5 H;  1A0I A;  4DV4 H;  1IBK H;  1XNR H;  3J80 W;  3KAL A;  1HNW H;  2FE3 A;  2YCH A;  4X64 H;  1FKA H;  4M7E A;  1MZB A;  4A2A A;  4CC6 A;  5IT9 W;  4DV2 H;  1GYF A;  4RB0 A;  1N33 H;  4J0M A;  4OX9 H;  3BAB A;  4JV5 H;  1FJG H;  4DR2 H;  1Z2O X;  4KHP H;  2VUG A;  4UCS A;  4DV0 H;  4MTD A;  1S03 G;  2CW7 A;  4ETS A;  4K0K H;  1SYX B;  1X9N A;  2HHH H;  4R7R A;  4DUY H;  2RGR A;  2UUA H;  1VS0 A;  2O03 A;  4DV7 H;  4JI2 H;  2ZM6 H;  2UUC H;  2WE6 A;  4EFB A;  4DV3 H;  4LF6 H;  3BA8 A;  1HNZ H;  2HVQ A;  1N32 H;  2VQE H;  5LMN H;  1Z2N X;  4MTE A;  3JAM W;  4LH6 A;  4YHH H;  3C0F B;  4LF7 H;  2HVR A;  2OWO A;  5LMU H;  3RF2 A;  4LFA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...