3KXYT

Crystal structure of the exsc-exse complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
TEAVGHFEGRSVTRAAVRGEDRSSVAGLARWLARNVAGDPRSEQALQRLADGDGTPLEARTVRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exoenzyme S synthesis protein C
publication title Analysis of the Crystal Structure of the ExsC.ExsE Complex Reveals Distinctive Binding Interactions of the Pseudomonas aeruginosa Type III Secretion Chaperone ExsC with ExsE and ExsD.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Chaperone/transcription inhibitor
total genus 11
structure length 65
sequence length 65
chains with identical sequence U, V, W, X, Y
ec nomenclature
pdb deposition date 2009-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF18286 T3SS_ExsE Type III secretion system ExsE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.370 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3kxyT00
3KXYT
chains in the Genus database with same CATH superfamily
1KBLA 3GILA 4LF6H 1BNCA 1SYXB 4JI0H 3FMAA 5KFVA 3HB9A 3OUZA 1Z2NX 2PBZA 5IP7G 2R8IA 3MR3A 2R7LA 1RJPA 4A3MG 3HOVG 2R8HA 4QWCA 3KHRA 3R23A 1KJQA 4DR4H 3QFFA 1JKJB 2ASJA 1I7LA 4UCTA 5CA0F 2VQDA 2ZDGA 1GSOA 1B6RA 2R8JA 1E4EB 3BG5A 3J81W 4TQRA 2V9WA 4R8UB 5L1JA 4O3NA 2HVRA 5DGBA 1VAJA 2UU9H 4YR2A 2FPGB 3JZIA 4GC7A 4UCRA 3TIGA 4A3CG 1RYRA 4DUYH 5KFHA 4J9RA 4FM9A 3V6KA 2J6UA 4DV5H 5C1OA 2FK2A 4A93G 3RAXA 1V9PA 2YCHA 5KFFA 3PW5A 5C5JA 2E2HA 1V4YA 4FS1A 4A3JG 2R82A 3BA9A 4EFBA 2I8CA 3E5NA 4AYBE 3J80W 1HNZH 4U7CA 5KG7A 4ZHQF 4YBZB 3BQ2A 4RB0A 2W57A 1VKZA 4NXMH 5KFMA 3M9OB 5KT5A 4ED1A 2HGSA 1K1QA 3N40P 4IWYA 2ZJTA 4DL4A 2NUAB 3LMLA 4RUAA 1P8LA 1PX2A 4ECQA 2DZDA 4FU0A 3KXYT 4ZOLF 4O2BF 2QK4A 4Y8VB 5DG9A 3GIPA 5KFDA 1S10A 1S97A 4TV9F 3GTQA 2W6NA 3OUUA 3RJ0A 4XX0B 3N41B 5KFRA 4MV9A 3G6YA 4QJFA 3ORRA 1JIHA 4UFZA 4BBRG 1M0TA 1WCMG 3K3VA 4EBEA 4A3FG 5KT2A 4U6PA 2VA2A 2VQEH 1XNQH 5D1OB 1TWGA 2JA7G 5L9XA 3LWBA 4DL5A 1EZ1A 3PW2A 3UFXB 1ZETA 3MFIA 2V58A 5BMVF 3OSPA 3H0GA 1SEIA 1IOWA 5H80A 1ZQ7A 5KFYA 1T94A 4EG0A 2R7ZG 4I4TF 2B63G 3GIQA 4IR1A 4B3RH 5KFAA 4QWEA 5KT4A 4YAKB 4AYBA 5IP9G 2W8LA 1I6UA 3QZ7A 2OH2A 3JRXA 5LMUH 4ECZA 5LP6F 5EDWA 3N8DA 2FE3A 4EEQA 4GC6A 3ETHA 4Q44A 2AU0A 1HR0H 1Y1VA 2IP4A 4M7EA 2RF4A 5KG5A 2C35B 3TQ1A 4TUYF 5KFPA 3U9SA 5HBRB 3L4JA 2R86A 4J9NA 1VS0A 1JX4A 4DV4H 1N36H 4FS2A 2JA5G 5IYZF 4J9PA 2W70A 2PMZE 4YB8B 1RJRA 5EWGA 2GPWA 4YJ2F 1IBLH 4DV3H 1S9FA 5KG0A 1Z2OX 4IRDA 2RDJA 2JEIA 5I47A 3MWDA 3N44B 1IBMH 5KFWA 3SI8A 5FLMG 1CQIB 4ECSA 2JEJA 5K2MA 3V6HA 2Q2TA 4YY3H 5FPRA 4K0KH 1E4EA 4QWBA 2O03A 4RB1A 4R8UA 2DIKA 5C8YF 5J2UF 1Y14B 2V4RA 3RB4A 4B3SH 3J7AK 1GSAA 4J9OA 5F9NA 3PW4A 2HHHH 1EHIA 4YAJB 5KG6A 4UCVA 1R9TA 4JI8H 4BBSG 4CC5A 5FD6A 3RV4A 5JVDF 2UVUA 4DR6H 4J9QA 2R92G 1EUCB 4O3OA 3Q8QB 3HOXG 3Q2OA 4RZQA 4JI3H 2W7PA 4O4IF 1RK5A 4JI7H 2XIGA 1BGWA 3RAQA 4A3GG 4BXXG 1XDNA 5CAEB 2XCAA 2OLSA 2W6QA 2FJZA 5KFBA 4DL7A 5J2TF 4RU9A 1TWHA 3RUPA 2VOBA 2QYZA 1Y1WA 4XYMB 2XGQA 4RAYA 2UXCH 2M05A 3IG0A 3RFCA 3SE7A 3KHHA 4GLXA 2V59A 3K5HA 4UCSA 5LYJF 5LXTF 3M9NB 3WO0A 3IN5A 2YS7A 3BA8A 3RB3A 1ZHQA 3H4DA 2W9CA 2PMZA 4EEYA 2JA5A 4FBUA 4UCOA 4F4WA 4F4ZA 3VMMA 4EBCA 5KFJA 3JSLA 3GQCA 1XMOH 5D8DA 1S03G 2Y0SE 3C0FB 5IT9W 3L4KA 2BQUA 2J6SA 4WD3A 1T3NA 4JI2H 3F8NA 5C4XG 4M9UA 3T1YH 1RYSA 2ASDA 1FKAH 4JYAH 1K83A 4JV0A 3MFHA 5KFOA 4E4TA 4EBDA 1TA8A 2X0SA 2ASLA 4A3KG 3Q8SB 3RF2A 3CQZA 4DR7H 3QZ8A 4O4LF 4XZ3B 1Z2PX 2DPJA 2CW8A 4EGQA 2C2DA 1J5EH 1GO3E 4J9SA 4RZRA 1W93A 1JLLB 3PO3G 4ED0A 4O4HF 5D1OA 3R5FA 2R6FA 5KFXA 1V51A 3V4SA 2BQRA 4B3TH 3I4NG 5DQHA 3H4BA 3Q1KA 3RGZA 3MWMA 3MWEA 3V6JA 3GIMA 2OWOA 5JQWA 4DV0H 4MV6A 3GV5B 2W9CB 4BWSC 4B3MH 5DG7A 4YHHH 2YU9A 5HV6A 3HOUG 4ECYA 3MR6A 3OHBA 4EYIB 2BR0A 5JVLA 2ZDQA 3N42B 5KFSA 3EYYA 4X62H 5KT7A 3HOYG 4LH7A 1TWAA 5KX5F 3GTPA 1KJIA 1TAEA 1IBKH 1I7NA 2VQFH 4ECWA 3KAJA 4RAZA 2HVSA 1KJ9A 5KG1A 5CB4F 1GSHA 4QWDA 1S0OA 4FBTA 2UXDH 4ED3A 1XNRH 2Y0SA 1N34H 3WO1A 2YZNA 4IRCA 5T14A 4I50F 2C22A 2ATLA 4YR3A 4EFEA 4NXNH 3JAMW 2CKZB 3BJYA 4IRKA 4O3RA 3GTJA 3N43B 5KFLA 3VPCA 5FLXW 1EUDB 4L1KA 5KKNB 2W7OA 2HVQA 4BY1G 4GKKH 2YW2A 2DWCA 4O2AF 3OSNA 1X9NA 2AGOA 3HKZE 3RTXA 4DV6H 3MR5A 1OWTA 1T36A 5IYBG 1S68A 4TV8F 5LOVF 5KFNA 3T5HA 2WDTA 2P0AA 2VPQA 2UVWA 5BR8H 2C2RA 3BQ1A 1BJTA 2HJWA 4IWXA 2R7MA 3BABA 4HNVA 5FJ8G 2AGPA 4ZQIA 4JV5H 3Q8PB 2YZMA 4ECTA 2R8KA 4LFAH 3GTOA 3N6XA 2VUGA 4MV8A 4A2BA 3FKIG 3R5XA 1FJGH 5L1LA 2J6TA 1W96A 3PN1A 4RB2C 5DQGA 4A3DG 2VR1A 5LL6b 4Q43A 1XMQH 1WH2A 1O75A 2KSWA 3RB6A 5KFZA 3VPBA 2C28A 3KTMA 4IR9A 3T5KA 4IZOA 4F4XA 2FPIB 2JEFA 4J9KA 4PDBA 2R85A 2WAQE 4MAMA 3RIZA 2W9AA 4RNMA 5EOYA 4J9LA 1HNWH 1SFOA 5IYCG 1EYZA 1WCMA 3AYHB 4MV7A 5DG8A 4LF7H 1SCUB 3G6VA 5DLFA 4EGJA 2JA7A 2R8GA 5KFCA 4ME6A 4Q45A 1HNXH 2PN1A 2W6ZA 5DQIA 2Q2UA 4APMA 4G3IA 4YJ3F 3VPDA 1FVIA 1AUVA 4A3EG 2R7ZA 2B63A 1JXLA 1MZBA 3HKZA 1ZHSA 4HYKA 3GIJA 5KFGA 2R7KA 2XC9A 1B6SA 2UVRA 3I4MG 4ECVA 2R93G 2UUAH 2I80A 4X66H 2W9BB 4CC6A 5GONF 2YL2A 3R5HA 1ULZA 2NU6B 2RGVA 3CVZA 5BPFA 5JH7F 3G6XA 1N56A 2V5AA 2NVXA 4ED6A 5LA6F 3GLKA 2YYAA 3OTOH 4ED2A 4C5AA 2YS6A 2ALZA 2FLLA 3EPIA 3HXLA 2XD4A 5KG3A 5KFQA 4QW8A 1GYFA 2IA6A 1A0IA 5KFTA 3RGXA 4QW9A 2I87A 3DF7A 3Q8RB 3KHLA 1PK8A 1B04A 5L1IA 3GTGA 1IOVA 4RNNA 4DR5H 4MV1A 4LFBH 2YZGA 3GIDA 4ECXA 2UXBH 2WAQA 3JRWA 4GKJH 2UUCH 5KT3A 5D1PA 4C2MA 3ORQA 2C00A 4J0MA 4C5CA 2NU9B 4JV2A 4LF5H 4C5BA 2JA6G 5DGAA 2VUMG 3U9TA 4JI1H 1I3QA 4I55F 4DR1H 4DV7H 1E4GT 4O3PA 4A3BG 1UNNC 1M0WA 2W6MA 4XYLB 1KC7A 1B33N 3ETJA 4DR3H 1N48A 3HBLA 3KALA 2VA3A 2R92A 3PW7A 3KAKA 3M4IA 1M6VA 2W8KA 2IMWP 3H0GG 2V4QA 3PZPA 1C3OA 4X65H 4DL6A 3PVXA 5BPHA 3T1HH 4JV1A 4OX9H 4RUCA 4I7HA 4JUZA 2C2EA 1VBHA 4MV4A 3T5JA 4DL3A 1L2ZA 4X64H 3RBDA 2DLNA 3TIIA 2R93A 1AUXA 1S0NA 2GPSA 4Q8EA 4QIWE 3TQTA 1Y1VG 4LF8H 3G8CA 4LH6A 1KEEA 4JI4H 3UQ8A 2RDIA 2XGPA 2F4VH 4MA0A 4DLKA 3FDSA 3K5IA 3RV3A 1JDBB 1UC8A 3PW0A 2DPIA 5KG2A 3PO2G 4MA5A 3JSNA 2RGRA 4DR2H 2FLPA 4BY7G 1KJJA 1S0MA 3LP8A 3OHAA 3T5LA 2R84A 3GV8B 2J9GA 1BXRA 4F4YA 3BAAA 4YP3A 2FKLA 2XCLA 2JEGA 1UC9A 5LMNH 3PR4A 2SCUB 4HQ6A 2AQ4A 4LSXA 5KT6A 5EWEA 5FPOA 1DV1A 2CW7A 5FD5A 3TINA 4WBNF 5C3EG 4EYHB 1I94H 2JA6A 2VUMA 4MV3A 1N32H 2R87A 3GIKA 2YRXA 3PR5B 1WR2A 4A3IG 4DV2H 5A2QW 5EZYF 4TQSA 2XCPA 2NU8B 5KFUA 3MJFA 3V4ZA 2FB9A 4LMYA 2JA8G 4RB3C 4QWAA 2UUBH 2WB1E 2MCTA 2E5LH 2ZM6H 2R7NA 4Q0YA 2PVPA 4ED8A 1N33H 3NGDA 5DLGA 2W71A 3MR2A 4QIWA 3GIIA 2CQYA 4RNOA 1K1SA 2W9BA 1JDEA 1VBGA 3K3PA 3GV7B 4JI5H 1CS0A 3HOZG 4ETSA 1Y1WG 5KFIA 3H20A 4ECUA 4IAJA 2CZGA 3L2PA 3GTLA 4YR0A 3EPGA 4HNUA 4Q8FA 4ZI7F 4NLGA 1WSCA 2VPSA 2AGQA 4IHJF 5C44G 4YQWA 2WYOA 3KHGA 3RB0A 5KFKA 4O3QA 1CQJB 3H3VH 4DV1H 4ECRA 2FP4B 5IWAH 3H40A 5CA1F 1CE8A 1TWCA 2UVVA 2NVYA 4HR7A 4MTDA 1GGOA 3GTKA 4ED7A 1E4FT 2WE6A 4MTEA 2NU7B 2ZDHA 1DIKA 2GLTA 3I12A 4O3SA 1AN7A 2W6OA 1I50A 2IBKA 4KHPH 4AQYH 1A9XA 2YRWA 2FPPB 1M7JA 4LSAA 4R7RA 5KG4A 4LF4H 5JUMA 4F50A 1RJQA 2FK3A 3BQ0A 4A2AA 5F9LA 1RK6A 3GTMA 2E2IA 2WTFA 2FMAA 2BQ3A 5IYDG 5L1KA 4DUZH 1GLVA 5KFEA 4DL2A 3M9MB 1TWFA 4LFCH 3HOWG 2FLNA 1DV2A 4HNTA 4PWQA 2WB1A 1DGSA 1KJ8A 3WNZA 4LF9H 4JI6H 4A3LG 5EWFA 3RBEA 2FK1A 4J9MA 3FKIA 4UCUA 1C30A 5C1PA 2W6PA
chains in the Genus database with same CATH topology
1Z2OX 2HVQA 4X65H 4LF6H 1SYXB 4JI0H 4GKKH 3FMAA 3N44B 3T1HH 1IBMH 4OX9H 1Z2NX 4I7HA 2Q2TA 1L2ZA 4X64H 1X9NA 4YY3H 5FPRA 4K0KH 3RTXA 4DV6H 2O03A 4RB1A 1S68A 4DR4H 2WDTA 4B3SH 4LF8H 4LH6A 4JI4H 3J7AK 4UCTA 5BR8H 3UQ8A 1BJTA 2HHHH 2F4VH 3J81W 4JI8H 3BABA 4UCVA 4CC5A 5FD6A 2HVRA 4JV5H 4LFAH 3JSNA 2UU9H 2RGRA 4DR2H 4DR6H 3N6XA 2VUGA 4UCRA 4A2BA 4RZQA 4DUYH 4JI3H 1FJGH 4FM9A 4DV5H 4JI7H 2XIGA 1V9PA 1BGWA 2YCHA 3PN1A 3BAAA 4RB2C 1XDNA 5LL6b 1XMQH 1WH2A 1O75A 2KSWA 5LMNH 2VOBA 4LSXA 3BA9A 5FPOA 2CW7A 5FD5A 4RAYA 4EFBA 3J80W 3RIZA 3IG0A 4GLXA 1I94H 1HNZH 4PDBA 2UXCH 5EOYA 4UCSA 1N32H 1HNWH 3BA8A 4MV7A 1ZHQA 4DV2H 5A2QW 4LF7H 4RB0A 2W57A 4UCOA 4NXMH 1XMOH 3JSLA 1HNXH 2HGSA 4LMYA 3N40P 4RB3C 1S03G 2UUBH 3C0FB 5IT9W 2Q2UA 3L4KA 4APMA 2MCTA 2E5LH 2ZJTA 4JI2H 3F8NA 3LMLA 1FVIA 4Q0YA 2ZM6H 1P8LA 1N33H 1FKAH 3T1YH 1MZBA 4JYAH 3KXYT 1ZHSA 1TA8A 3RF2A 4DR7H 4JI5H 1Z2PX 2UUAH 2CW8A 4ETSA 3RJ0A 1J5EH 3H20A 4X66H 4IAJA 4CC6A 3L2PA 3N41B 4MV9A 5D1OA 4B3TH 2VPSA 2RGVA 4UFZA 3CVZA 1M0TA 3K3VA 2WYOA 4DV1H 2VQEH 1XNQH 3RGZA 3MWMA 3OTOH 5D1OB 5IWAH 3HXLA 2OWOA 4MTDA 1GYFA 4DV0H 1A0IA 4BWSC 3RGXA 1E4FT 3DF7A 4B3MH 2WE6A 4MTEA 1SEIA 1B04A 4YHHH 4DR5H 4B3RH 4LFBH 1AN7A 2UXBH 4KHPH 4AQYH 1I6UA 4GKJH 3N42B 2UUCH 3EYYA 4X62H 4R7RA 5D1PA 4LH7A 4LSAA 5LMUH 4LF4H 1TAEA 4J0MA 1IBKH 4A2AA 2FE3A 4LF5H 4EEQA 2VQFH 2HVSA 3KAJA 4RAZA 1HR0H 4M7EA 4JI1H 4DUZH 2UXDH 3L4JA 1N34H 4LFCH 1VS0A 4DR1H 4DV4H 1E4GT 4DV7H 1N36H 1XNRH 1M0WA 1DGSA 4LF9H 4EFEA 4JI6H 4DR3H 3JAMW 4NXNH 3KALA 3N43B 3KAKA 4UCUA 3M4IA 1IBLH 5FLXW 4DV3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXY T; 
#chains in the Genus database with same CATH topology
 1KBL A;  3GIL A;  4LF6 H;  1BNC A;  1SYX B;  4JI0 H;  3FMA A;  5KFV A;  3HB9 A;  3OUZ A;  1Z2N X;  2PBZ A;  5IP7 G;  2R8I A;  3MR3 A;  2R7L A;  1RJP A;  4A3M G;  3HOV G;  2R8H A;  4QWC A;  3KHR A;  3R23 A;  1KJQ A;  4DR4 H;  3QFF A;  1JKJ B;  2ASJ A;  1I7L A;  4UCT A;  5CA0 F;  2VQD A;  2ZDG A;  1GSO A;  1B6R A;  2R8J A;  1E4E B;  3BG5 A;  3J81 W;  4TQR A;  2V9W A;  4R8U B;  5L1J A;  4O3N A;  2HVR A;  5DGB A;  1VAJ A;  2UU9 H;  4YR2 A;  2FPG B;  3JZI A;  4GC7 A;  4UCR A;  3TIG A;  4A3C G;  1RYR A;  4DUY H;  5KFH A;  4J9R A;  4FM9 A;  3V6K A;  2J6U A;  4DV5 H;  5C1O A;  2FK2 A;  4A93 G;  3RAX A;  1V9P A;  2YCH A;  5KFF A;  3PW5 A;  5C5J A;  2E2H A;  1V4Y A;  4FS1 A;  4A3J G;  2R82 A;  3BA9 A;  4EFB A;  2I8C A;  3E5N A;  4AYB E;  3J80 W;  1HNZ H;  4U7C A;  5KG7 A;  4ZHQ F;  4YBZ B;  3BQ2 A;  4RB0 A;  2W57 A;  1VKZ A;  4NXM H;  5KFM A;  3M9O B;  5KT5 A;  4ED1 A;  2HGS A;  1K1Q A;  3N40 P;  4IWY A;  2ZJT A;  4DL4 A;  2NUA B;  3LML A;  4RUA A;  1P8L A;  1PX2 A;  4ECQ A;  2DZD A;  4FU0 A;  3KXY T;  4ZOL F;  4O2B F;  2QK4 A;  4Y8V B;  5DG9 A;  3GIP A;  5KFD A;  1S10 A;  1S97 A;  4TV9 F;  3GTQ A;  2W6N A;  3OUU A;  3RJ0 A;  4XX0 B;  3N41 B;  5KFR A;  4MV9 A;  3G6Y A;  4QJF A;  3ORR A;  1JIH A;  4UFZ A;  4BBR G;  1M0T A;  1WCM G;  3K3V A;  4EBE A;  4A3F G;  5KT2 A;  4U6P A;  2VA2 A;  2VQE H;  1XNQ H;  5D1O B;  1TWG A;  2JA7 G;  5L9X A;  3LWB A;  4DL5 A;  1EZ1 A;  3PW2 A;  3UFX B;  1ZET A;  3MFI A;  2V58 A;  5BMV F;  3OSP A;  3H0G A;  1SEI A;  1IOW A;  5H80 A;  1ZQ7 A;  5KFY A;  1T94 A;  4EG0 A;  2R7Z G;  4I4T F;  2B63 G;  3GIQ A;  4IR1 A;  4B3R H;  5KFA A;  4QWE A;  5KT4 A;  4YAK B;  4AYB A;  5IP9 G;  2W8L A;  1I6U A;  3QZ7 A;  2OH2 A;  3JRX A;  5LMU H;  4ECZ A;  5LP6 F;  5EDW A;  3N8D A;  2FE3 A;  4EEQ A;  4GC6 A;  3ETH A;  4Q44 A;  2AU0 A;  1HR0 H;  1Y1V A;  2IP4 A;  4M7E A;  2RF4 A;  5KG5 A;  2C35 B;  3TQ1 A;  4TUY F;  5KFP A;  3U9S A;  5HBR B;  3L4J A;  2R86 A;  4J9N A;  1VS0 A;  1JX4 A;  4DV4 H;  1N36 H;  4FS2 A;  2JA5 G;  5IYZ F;  4J9P A;  2W70 A;  2PMZ E;  4YB8 B;  1RJR A;  5EWG A;  2GPW A;  4YJ2 F;  1IBL H;  4DV3 H;  1S9F A;  5KG0 A;  1Z2O X;  4IRD A;  2RDJ A;  2JEI A;  5I47 A;  3MWD A;  3N44 B;  1IBM H;  5KFW A;  3SI8 A;  5FLM G;  1CQI B;  4ECS A;  2JEJ A;  5K2M A;  3V6H A;  2Q2T A;  4YY3 H;  5FPR A;  4K0K H;  1E4E A;  4QWB A;  2O03 A;  4RB1 A;  4R8U A;  2DIK A;  5C8Y F;  5J2U F;  1Y14 B;  2V4R A;  3RB4 A;  4B3S H;  3J7A K;  1GSA A;  4J9O A;  5F9N A;  3PW4 A;  2HHH H;  1EHI A;  4YAJ B;  5KG6 A;  4UCV A;  1R9T A;  4JI8 H;  4BBS G;  4CC5 A;  5FD6 A;  3RV4 A;  5JVD F;  2UVU A;  4DR6 H;  4J9Q A;  2R92 G;  1EUC B;  4O3O A;  3Q8Q B;  3HOX G;  3Q2O A;  4RZQ A;  4JI3 H;  2W7P A;  4O4I F;  1RK5 A;  4JI7 H;  2XIG A;  1BGW A;  3RAQ A;  4A3G G;  4BXX G;  1XDN A;  5CAE B;  2XCA A;  2OLS A;  2W6Q A;  2FJZ A;  5KFB A;  4DL7 A;  5J2T F;  4RU9 A;  1TWH A;  3RUP A;  2VOB A;  2QYZ A;  1Y1W A;  4XYM B;  2XGQ A;  4RAY A;  2UXC H;  2M05 A;  3IG0 A;  3RFC A;  3SE7 A;  3KHH A;  4GLX A;  2V59 A;  3K5H A;  4UCS A;  5LYJ F;  5LXT F;  3M9N B;  3WO0 A;  3IN5 A;  2YS7 A;  3BA8 A;  3RB3 A;  1ZHQ A;  3H4D A;  2W9C A;  2PMZ A;  4EEY A;  2JA5 A;  4FBU A;  4UCO A;  4F4W A;  4F4Z A;  3VMM A;  4EBC A;  5KFJ A;  3JSL A;  3GQC A;  1XMO H;  5D8D A;  1S03 G;  2Y0S E;  3C0F B;  5IT9 W;  3L4K A;  2BQU A;  2J6S A;  4WD3 A;  1T3N A;  4JI2 H;  3F8N A;  5C4X G;  4M9U A;  3T1Y H;  1RYS A;  2ASD A;  1FKA H;  4JYA H;  1K83 A;  4JV0 A;  3MFH A;  5KFO A;  4E4T A;  4EBD A;  1TA8 A;  2X0S A;  2ASL A;  4A3K G;  3Q8S B;  3RF2 A;  3CQZ A;  4DR7 H;  3QZ8 A;  4O4L F;  4XZ3 B;  1Z2P X;  2DPJ A;  2CW8 A;  4EGQ A;  2C2D A;  1J5E H;  1GO3 E;  4J9S A;  4RZR A;  1W93 A;  1JLL B;  3PO3 G;  4ED0 A;  4O4H F;  5D1O A;  3R5F A;  2R6F A;  5KFX A;  1V51 A;  3V4S A;  2BQR A;  4B3T H;  3I4N G;  5DQH A;  3H4B A;  3Q1K A;  3RGZ A;  3MWM A;  3MWE A;  3V6J A;  3GIM A;  2OWO A;  5JQW A;  4DV0 H;  4MV6 A;  3GV5 B;  2W9C B;  4BWS C;  4B3M H;  5DG7 A;  4YHH H;  2YU9 A;  5HV6 A;  3HOU G;  4ECY A;  3MR6 A;  3OHB A;  4EYI B;  2BR0 A;  5JVL A;  2ZDQ A;  3N42 B;  5KFS A;  3EYY A;  4X62 H;  5KT7 A;  3HOY G;  4LH7 A;  1TWA A;  5KX5 F;  3GTP A;  1KJI A;  1TAE A;  1IBK H;  1I7N A;  2VQF H;  4ECW A;  3KAJ A;  4RAZ A;  2HVS A;  1KJ9 A;  5KG1 A;  5CB4 F;  1GSH A;  4QWD A;  1S0O A;  4FBT A;  2UXD H;  4ED3 A;  1XNR H;  2Y0S A;  1N34 H;  3WO1 A;  2YZN A;  4IRC A;  5T14 A;  4I50 F;  2C22 A;  2ATL A;  4YR3 A;  4EFE A;  4NXN H;  3JAM W;  2CKZ B;  3BJY A;  4IRK A;  4O3R A;  3GTJ A;  3N43 B;  5KFL A;  3VPC A;  5FLX W;  1EUD B;  4L1K A;  5KKN B;  2W7O A;  2HVQ A;  4BY1 G;  4GKK H;  2YW2 A;  2DWC A;  4O2A F;  3OSN A;  1X9N A;  2AGO A;  3HKZ E;  3RTX A;  4DV6 H;  3MR5 A;  1OWT A;  1T36 A;  5IYB G;  1S68 A;  4TV8 F;  5LOV F;  5KFN A;  3T5H A;  2WDT A;  2P0A A;  2VPQ A;  2UVW A;  5BR8 H;  2C2R A;  3BQ1 A;  1BJT A;  2HJW A;  4IWX A;  2R7M A;  3BAB A;  4HNV A;  5FJ8 G;  2AGP A;  4ZQI A;  4JV5 H;  3Q8P B;  2YZM A;  4ECT A;  2R8K A;  4LFA H;  3GTO A;  3N6X A;  2VUG A;  4MV8 A;  4A2B A;  3FKI G;  3R5X A;  1FJG H;  5L1L A;  2J6T A;  1W96 A;  3PN1 A;  4RB2 C;  5DQG A;  4A3D G;  2VR1 A;  5LL6 b;  4Q43 A;  1XMQ H;  1WH2 A;  1O75 A;  2KSW A;  3RB6 A;  5KFZ A;  3VPB A;  2C28 A;  3KTM A;  4IR9 A;  3T5K A;  4IZO A;  4F4X A;  2FPI B;  2JEF A;  4J9K A;  4PDB A;  2R85 A;  2WAQ E;  4MAM A;  3RIZ A;  2W9A A;  4RNM A;  5EOY A;  4J9L A;  1HNW H;  1SFO A;  5IYC G;  1EYZ A;  1WCM A;  3AYH B;  4MV7 A;  5DG8 A;  4LF7 H;  1SCU B;  3G6V A;  5DLF A;  4EGJ A;  2JA7 A;  2R8G A;  5KFC A;  4ME6 A;  4Q45 A;  1HNX H;  2PN1 A;  2W6Z A;  5DQI A;  2Q2U A;  4APM A;  4G3I A;  4YJ3 F;  3VPD A;  1FVI A;  1AUV A;  4A3E G;  2R7Z A;  2B63 A;  1JXL A;  1MZB A;  3HKZ A;  1ZHS A;  4HYK A;  3GIJ A;  5KFG A;  2R7K A;  2XC9 A;  1B6S A;  2UVR A;  3I4M G;  4ECV A;  2R93 G;  2UUA H;  2I80 A;  4X66 H;  2W9B B;  4CC6 A;  5GON F;  2YL2 A;  3R5H A;  1ULZ A;  2NU6 B;  2RGV A;  3CVZ A;  5BPF A;  5JH7 F;  3G6X A;  1N56 A;  2V5A A;  2NVX A;  4ED6 A;  5LA6 F;  3GLK A;  2YYA A;  3OTO H;  4ED2 A;  4C5A A;  2YS6 A;  2ALZ A;  2FLL A;  3EPI A;  3HXL A;  2XD4 A;  5KG3 A;  5KFQ A;  4QW8 A;  1GYF A;  2IA6 A;  1A0I A;  5KFT A;  3RGX A;  4QW9 A;  2I87 A;  3DF7 A;  3Q8R B;  3KHL A;  1PK8 A;  1B04 A;  5L1I A;  3GTG A;  1IOV A;  4RNN A;  4DR5 H;  4MV1 A;  4LFB H;  2YZG A;  3GID A;  4ECX A;  2UXB H;  2WAQ A;  3JRW A;  4GKJ H;  2UUC H;  5KT3 A;  5D1P A;  4C2M A;  3ORQ A;  2C00 A;  4J0M A;  4C5C A;  2NU9 B;  4JV2 A;  4LF5 H;  4C5B A;  2JA6 G;  5DGA A;  2VUM G;  3U9T A;  4JI1 H;  1I3Q A;  4I55 F;  4DR1 H;  4DV7 H;  1E4G T;  4O3P A;  4A3B G;  1UNN C;  1M0W A;  2W6M A;  4XYL B;  1KC7 A;  1B33 N;  3ETJ A;  4DR3 H;  1N48 A;  3HBL A;  3KAL A;  2VA3 A;  2R92 A;  3PW7 A;  3KAK A;  3M4I A;  1M6V A;  2W8K A;  2IMW P;  3H0G G;  2V4Q A;  3PZP A;  1C3O A;  4X65 H;  4DL6 A;  3PVX A;  5BPH A;  3T1H H;  4JV1 A;  4OX9 H;  4RUC A;  4I7H A;  4JUZ A;  2C2E A;  1VBH A;  4MV4 A;  3T5J A;  4DL3 A;  1L2Z A;  4X64 H;  3RBD A;  2DLN A;  3TII A;  2R93 A;  1AUX A;  1S0N A;  2GPS A;  4Q8E A;  4QIW E;  3TQT A;  1Y1V G;  4LF8 H;  3G8C A;  4LH6 A;  1KEE A;  4JI4 H;  3UQ8 A;  2RDI A;  2XGP A;  2F4V H;  4MA0 A;  4DLK A;  3FDS A;  3K5I A;  3RV3 A;  1JDB B;  1UC8 A;  3PW0 A;  2DPI A;  5KG2 A;  3PO2 G;  4MA5 A;  3JSN A;  2RGR A;  4DR2 H;  2FLP A;  4BY7 G;  1KJJ A;  1S0M A;  3LP8 A;  3OHA A;  3T5L A;  2R84 A;  3GV8 B;  2J9G A;  1BXR A;  4F4Y A;  3BAA A;  4YP3 A;  2FKL A;  2XCL A;  2JEG A;  1UC9 A;  5LMN H;  3PR4 A;  2SCU B;  4HQ6 A;  2AQ4 A;  4LSX A;  5KT6 A;  5EWE A;  5FPO A;  1DV1 A;  2CW7 A;  5FD5 A;  3TIN A;  4WBN F;  5C3E G;  4EYH B;  1I94 H;  2JA6 A;  2VUM A;  4MV3 A;  1N32 H;  2R87 A;  3GIK A;  2YRX A;  3PR5 B;  1WR2 A;  4A3I G;  4DV2 H;  5A2Q W;  5EZY F;  4TQS A;  2XCP A;  2NU8 B;  5KFU A;  3MJF A;  3V4Z A;  2FB9 A;  4LMY A;  2JA8 G;  4RB3 C;  4QWA A;  2UUB H;  2WB1 E;  2MCT A;  2E5L H;  2ZM6 H;  2R7N A;  4Q0Y A;  2PVP A;  4ED8 A;  1N33 H;  3NGD A;  5DLG A;  2W71 A;  3MR2 A;  4QIW A;  3GII A;  2CQY A;  4RNO A;  1K1S A;  2W9B A;  1JDE A;  1VBG A;  3K3P A;  3GV7 B;  4JI5 H;  1CS0 A;  3HOZ G;  4ETS A;  1Y1W G;  5KFI A;  3H20 A;  4ECU A;  4IAJ A;  2CZG A;  3L2P A;  3GTL A;  4YR0 A;  3EPG A;  4HNU A;  4Q8F A;  4ZI7 F;  4NLG A;  1WSC A;  2VPS A;  2AGQ A;  4IHJ F;  5C44 G;  4YQW A;  2WYO A;  3KHG A;  3RB0 A;  5KFK A;  4O3Q A;  1CQJ B;  3H3V H;  4DV1 H;  4ECR A;  2FP4 B;  5IWA H;  3H40 A;  5CA1 F;  1CE8 A;  1TWC A;  2UVV A;  2NVY A;  4HR7 A;  4MTD A;  1GGO A;  3GTK A;  4ED7 A;  1E4F T;  2WE6 A;  4MTE A;  2NU7 B;  2ZDH A;  1DIK A;  2GLT A;  3I12 A;  4O3S A;  1AN7 A;  2W6O A;  1I50 A;  2IBK A;  4KHP H;  4AQY H;  1A9X A;  2YRW A;  2FPP B;  1M7J A;  4LSA A;  4R7R A;  5KG4 A;  4LF4 H;  5JUM A;  4F50 A;  1RJQ A;  2FK3 A;  3BQ0 A;  4A2A A;  5F9L A;  1RK6 A;  3GTM A;  2E2I A;  2WTF A;  2FMA A;  2BQ3 A;  5IYD G;  5L1K A;  4DUZ H;  1GLV A;  5KFE A;  4DL2 A;  3M9M B;  1TWF A;  4LFC H;  3HOW G;  2FLN A;  1DV2 A;  4HNT A;  4PWQ A;  2WB1 A;  1DGS A;  1KJ8 A;  3WNZ A;  4LF9 H;  4JI6 H;  4A3L G;  5EWF A;  3RBE A;  2FK1 A;  4J9M A;  3FKI A;  4UCU A;  1C30 A;  5C1P A;  2W6P A; 
#chains in the Genus database with same CATH homology
 1Z2O X;  2HVQ A;  4X65 H;  4LF6 H;  1SYX B;  4JI0 H;  4GKK H;  3FMA A;  3N44 B;  3T1H H;  1IBM H;  4OX9 H;  1Z2N X;  4I7H A;  2Q2T A;  1L2Z A;  4X64 H;  1X9N A;  4YY3 H;  5FPR A;  4K0K H;  3RTX A;  4DV6 H;  2O03 A;  4RB1 A;  1S68 A;  4DR4 H;  2WDT A;  4B3S H;  4LF8 H;  4LH6 A;  4JI4 H;  3J7A K;  4UCT A;  5BR8 H;  3UQ8 A;  1BJT A;  2HHH H;  2F4V H;  3J81 W;  4JI8 H;  3BAB A;  4UCV A;  4CC5 A;  5FD6 A;  2HVR A;  4JV5 H;  4LFA H;  3JSN A;  2UU9 H;  2RGR A;  4DR2 H;  4DR6 H;  3N6X A;  2VUG A;  4UCR A;  4A2B A;  4RZQ A;  4DUY H;  4JI3 H;  1FJG H;  4FM9 A;  4DV5 H;  4JI7 H;  2XIG A;  1V9P A;  1BGW A;  2YCH A;  3PN1 A;  3BAA A;  4RB2 C;  1XDN A;  5LL6 b;  1XMQ H;  1WH2 A;  1O75 A;  2KSW A;  5LMN H;  2VOB A;  4LSX A;  3BA9 A;  5FPO A;  2CW7 A;  5FD5 A;  4RAY A;  4EFB A;  3J80 W;  3RIZ A;  3IG0 A;  4GLX A;  1I94 H;  1HNZ H;  4PDB A;  2UXC H;  5EOY A;  4UCS A;  1N32 H;  1HNW H;  3BA8 A;  4MV7 A;  1ZHQ A;  4DV2 H;  5A2Q W;  4LF7 H;  4RB0 A;  2W57 A;  4UCO A;  4NXM H;  1XMO H;  3JSL A;  1HNX H;  2HGS A;  4LMY A;  3N40 P;  4RB3 C;  1S03 G;  2UUB H;  3C0F B;  5IT9 W;  2Q2U A;  3L4K A;  4APM A;  2MCT A;  2E5L H;  2ZJT A;  4JI2 H;  3F8N A;  3LML A;  1FVI A;  4Q0Y A;  2ZM6 H;  1P8L A;  1N33 H;  1FKA H;  3T1Y H;  1MZB A;  4JYA H;  3KXY T;  1ZHS A;  1TA8 A;  3RF2 A;  4DR7 H;  4JI5 H;  1Z2P X;  2UUA H;  2CW8 A;  4ETS A;  3RJ0 A;  1J5E H;  3H20 A;  4X66 H;  4IAJ A;  4CC6 A;  3L2P A;  3N41 B;  4MV9 A;  5D1O A;  4B3T H;  2VPS A;  2RGV A;  4UFZ A;  3CVZ A;  1M0T A;  3K3V A;  2WYO A;  4DV1 H;  2VQE H;  1XNQ H;  3RGZ A;  3MWM A;  3OTO H;  5D1O B;  5IWA H;  3HXL A;  2OWO A;  4MTD A;  1GYF A;  4DV0 H;  1A0I A;  4BWS C;  3RGX A;  1E4F T;  3DF7 A;  4B3M H;  2WE6 A;  4MTE A;  1SEI A;  1B04 A;  4YHH H;  4DR5 H;  4B3R H;  4LFB H;  1AN7 A;  2UXB H;  4KHP H;  4AQY H;  1I6U A;  4GKJ H;  3N42 B;  2UUC H;  3EYY A;  4X62 H;  4R7R A;  5D1P A;  4LH7 A;  4LSA A;  5LMU H;  4LF4 H;  1TAE A;  4J0M A;  1IBK H;  4A2A A;  2FE3 A;  4LF5 H;  4EEQ A;  2VQF H;  2HVS A;  3KAJ A;  4RAZ A;  1HR0 H;  4M7E A;  4JI1 H;  4DUZ H;  2UXD H;  3L4J A;  1N34 H;  4LFC H;  1VS0 A;  4DR1 H;  4DV4 H;  1E4G T;  4DV7 H;  1N36 H;  1XNR H;  1M0W A;  1DGS A;  4LF9 H;  4EFE A;  4JI6 H;  4DR3 H;  3JAM W;  4NXN H;  3KAL A;  3N43 B;  3KAK A;  4UCU A;  3M4I A;  1IBL H;  5FLX W;  4DV3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...