2JA5G

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja5G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja5G01
5ELNA 4GOPB 2JE6I 1I50H 4DV6Q 3E0EA 5HGQA 4QQBX 5C44G 3A74A 1B7YB 3F2CA 4XIGS 1I5FA 1X65A 4DV0Q 3H15A 3U58A 1VQKA 4B3SL 1K83H 2IX1A 1EIFA 3A5ZB 1H95A 4DV7L 5M3MG 4DV3Q 5GROA 2LXJA 3U50C 1CUKA 5C3EH 3CCUA 4AH6A 4DV4L 3U4ZA 3J80i 2PNHA 4DR6L 1K9MC 4GLVB 3S15H 2EXDA 3GTQH 4DR2L 4KI0A 1MJEA 4TQUS 3K7AH 1VQDA 3GD7A 4A76A 2VQEQ 3KJPA 3VDYA 2Q2HA 3BJUA 3CP0A 2NVYH 3FHWA 3CCLA 1PYBA 2VUMG 3HOZH 2KCMA 1HR0Q 4OONA 2DGYA 4HIDA 1SLJA 1L1OC 1VQCA 4L5RC 3NENA 4DR7Q 2WB1G 1HNWL 3CCEA 4JI3Q 3I7FA 5GAEC 4TVAB 5FJ8G 4IO9A 4A3IH 2A8VA 3PF5A 3PF4A 3PO3G 3J81c 3HOYH 2CQOA 3PUVA 1XMQL 5IE8A 2K14A 1IBLQ 3G71A 4R1JA 3HKSA 2AWNA 1YHQA 4GN4B 1VQOA 4NXML 3H3VH 4JV5Q 4A3JH 3ZJYC 3A5UA 1XNRL 4KLKA 1FVIA 2UXDL 1JT8A 4KHPL 2HQLA 1KQSA 3S14H 1YZ6A 4YCUA 3RNUA 4BBSG 1JB7A 4OWXB 1PH9A 1S40A 5IP9G 2RHSB 3M9BA 1WOCA 1HZBA 2CWAA 5M5WH 2F4VL 5IT9c 2R93G 1O7IA 4DNIA 2Z6KC 1QZHA 1V9PA 1EOVA 2IY5B 2ZJPA 1S72A 2Q2TA 5H1SE 2L15A 1Q46A 2MFIA 4RMFA 3K0XA 3NELA 2YYZA 1M90C 5JJLA 1QUQA 5EAYA 1KIXA 1Z9FA 2F4VQ 1C0AA 2MO0A 5IWAQ 2MQHA 4YHHQ 2NVTH 5LMUQ 1BVSA 3TREA 4LUVA 1N9WA 1VQLA 1TXYA 3M4PA 3PIOA 3I4MG 3I4NH 4A3GG 4BXXG 1WFQA 4R4OA 2NZOA 1NMFA 3UDIA 1AE3A 5IP9H 2ZJRA 2H5XA 2K75A 4Y52H 4WJ3M 4DPGA 1UE7A 1WCMH 1IBKL 2F52A 2ZTCA 1VQFA 2UUBL 4B3RL 4P75A 4EQ5A 3I2ZA 5AJ3L 2HIXA 4A3LH 4LF8L 4B3ML 3WWVA 1I94L 1S3OA 1VQEA 4K0KQ 1V43A 3HOVG 3HKZG 2I5MX 3FKIG 2JA9A 2R6GA 2WAQE 3L7ZC 4POFA 3GO5A 4X65L 5GAHC 1YI2A 1IBKQ 3CCSA 4BY1H 2OTJA 4WJ4A 2UUAL 1IXRA 2D62A 1LTLA 1HNXL 2ZJQA 4DKAC 4L5TA 1C7YA 4OO1I 1I3QH 2JQOA 3AYHB 4B3SQ 1YEZA 3AEVA 4IOAA 4OX9L 3KDFA 1VQ5A 2V1CC 4DV1L 2BH2A 2JK8A 2JA6G 1Y1WG 4BY1G 4DV7Q 4BBRH 3F1ZA 3JAMc 1K8AC 4APVA 3FP9A 1IL2A 4GN3B 2IHFA 4O2DA 2UU9Q 4JYAL 3RLNA 2OQKA 1X9NA 5FLMH 1PH3A 2MNAA 4GKKL 3J81j 2YU9H 1L1OA 4DV1Q 1Z47A 1Y1WH 3CC4A 4NXNL 4AYBE 4LF9L 3PO2G 1HZ9A 5IY0A 2R7FA 1K73C 3I4MH 4A3CH 4IFDJ 3BU2A 1CKNA 4YCVA 1U5KA 3T1HL 2UXDQ 4DV2Q 4DR6Q 3K81C 1HR0L 3G4SA 4LF7Q 1VQMA 1EFWA 2UXCL 5C44H 1PH4A 1GKHA 4A3KG 3NBHB 1PH2A 1K3RA 1X55A 1IBML 4J15A 1KHIA 1PA6A 2B29A 2PQAA 2YTVA 5LMNL 1N36L 5BR8Q 1KD1C 1IBLL 4DR7L 1XNRQ 3Q8DA 1Q1EA 1UEBA 1VQGA 2AMCB 2JEAI 3HOUH 1N33Q 1YNXA 4JI5L 5M5XH 1HJPA 1OXTA 3CC7A 3HOWH 4HJ5A 4JI2L 1XMQQ 4YHHL 4GS3A 1SMXA 3CCVA 2R7ZH 3L0OA 1VQIA 1E7ZA 4AYBG 4DR4Q 5C0XI 1OTCA 4UY8C 3S24A 2NN6G 3LGJA 2OTLA 4JI7Q 4LF5L 4KHZA 1EQQA 5JJKA 4H02A 3G6EA 1FGUA 4C3IH 1UE5A 2DUDA 1GD7A 4JI1L 4GLXA 2NVXH 3A0JA 4ME3A 3RZOH 1RIPA 1I6HH 3OTOQ 1DGSA 4DR4L 2LXKA 4X6AH 2VZAA 2E2IH 4JOIC 5IYCH 2WAQG 1KC8C 4UPAA 1Y1VG 1YJ9A 3EN2A 1HNXQ 4LUOA 4BA2I 4P72A 2ZM6L 1KRSA 1KL9A 1PH8A 4DV4Q 2E2JH 1E22A 4DR1L 2HHHL 2VW9A 1G291 4B3MQ 5C3EG 1C9OA 1PVOA 4PMWA 3HOVH 4LW1A 3CXCA 1N8RC 4YWKA 4LF6L 1HZAA 2UU9L 4DK3C 2N49A 4JYAQ 2E2HH 4BA1I 2D0PA 2Z0SA 3L2PA 1XMOQ 3IRBA 1VQ8A 1AH9A 1NMGA 1TWCH 1BBWA 3E9IA 4GLAC 4Y7NH 1ASZA 1JJGA 1X6OA 4R4TA 1MKHA 4UP8A 4DK6C 4YY3Q 4IOCA 1CKOA 1Q12A 1PH5A 3S1RH 4JCVE 3SGIA 2XTIA 3DM3A 3GTLH 1IYJB 3S17H 2K5HA 1J5EQ 3ICEA 3MEFA 5LMNW 4HIMA 2ATWA 1MIUA 3E9HA 3KF6B 1R9TH 1PH1A 2JA5G 1UE6A 3CPWA 4UP9A 4A3MH 1QVFA 1P16A 3HOXG 1Q1BA 4HIOA 4LFBL 5M3MH 1VQ4A 2B3GA 2GN5A 4X66Q 4HJ7A 3AFQA 3CC2A 2I5LX 1EUJA 4POGA 1FJGQ 3S1MH 3J80c 4A3KH 3CQZH 4IPGA 3CD6A 4QIWE 4JBJA 5M3FH 1QZGA 2CWPA 5GADC 2ES2A 4YWLA 2Q2UA 2VQEL 1KRTA 3M7NA 2RHQB 1KXLA 4LF7L 1TWAH 4HJAA 4BBSH 3S2DH 3UE1A 1OXSC 1WYDA 1X54A 1JJ2A 4DUZQ 2OCEA 2JA5H 4A3DG 2LSSA 4JI7L 4GOPA 2YTXA 5J3BA 4A93G 3PGZA 5BR8L 4JI0Q 1YHBA 4JI6L 4K0KL 3PCOB 1OXVA 3CAMA 1NE3A 3K8AA 4R4IA 5FJ8H 4X64L 4GOPC 4A3IG 4X62Q 2HT1A 5M3FG 4DUZL 4LUZA 4IPCA 3J7ZC 1NTGA 4LFAL 4JI2Q 3RR5A 2KHJA 4DR3L 4JI8L 4A3FH 1Q7YC 2ID0A 3CCQA 1HNWQ 1YVCA 4RG1A 3NEMA 1YITA 3UE0A 1HZCA 2KHIA 3AFPA 1BBUA 1UE1A 4JI4L 1GM5A 3W1BA 4PZ8A 3GTOH 5IYDG 1Q82C 1VQBA 4NXMQ 4C3HH 2ASBA 1AE2A 3OYYA 3PUZA 4HJ9A 4LFCQ 3UDGA 1W3SA 2R92G 3CCJA 5C4XG 1YBYA 3TS2A 2PMZE 4OXPA 1CKMA 4A3FG 1PYSB 2UUAQ 3TS0A 1LUZA 2ALYB 2Q2IA 3KYHC 4IFDI 4A75A 1I94Q 1Q81C 2CCZA 3F2BA 1N34Q 4OWWB 1XNQL 4PZ6A 3ULLA 1FL0A 1SN8A 1SR3A 3W5OA 1A62A 1HR0W 1P8LA 2K5NA 3J81i 1VS0A 3K80C 2WP8J 4HJ8A 4C2MH 2E5LQ 4A3BH 4DR2Q 2BA1A 2QEXA 1XTDA 1B70B 3ULPA 1QVCA 2MO1A 4P73A 4AIMA 1IZ6A 4DV3L 5E7NA 4A3EG 1G51A 4NB3A 4LF9Q 3B6YA 2NVQH 4B3TL 2E8GA 2XGTA 3CPFA 2NN6I 3PV0A 4YWMA 1CSPA 1YIJA 1XPRA 1PH6A 4DV5L 1W2BA 2B63G 1E24A 1EWIA 2BH8A 2I5HA 4A3CG 3JC66 4BY7H 1MJCA 3PSIA 3S16H 1KAWA 4JOIA 3GTJH 2Y0SE 3STBC 1PH7A 1VQ9A 3M3YH 4X66L 3J7A5 1J5EL 1L1OB 1LM0A 2D0OA 4GN5A 4P74A 4DR5Q 1PHJA 1FJGL 3T1HQ 1Q86C 3RN5A 3PO3H 5FLMG 4QL5A 5JEAJ 2Y0SG 3HOWG 1OXUA 1X3EA 4JBMA 2CFMA 1VQHA 1PV4A 3HOZG 3KOJA 1CKNB 2VNUD 1E1OA 1VQAA 2N3SA 4HIKA 2GVAA 2JA8G 3KF8B 3CW2C 4MZ9A 3JAMi 1VQPA 1VQ7A 4DR3Q 1WI5A 5JEAG 2F3IA 3KF6A 3ULJA 2UXCQ 1NBWA 2PI2A 1T9HA 1Y14B 1L0WA 4QGUA 4LF5Q 2UUCQ 2HIVA 1K8GA 1EQRA 1HH2P 2VL6A 5IP7H 1E3PA 4JI6Q 5IYBG 5C0XJ 3GTMH 4R4QA 2KBNA 1U0LA 2N78A 1EIYB 3OW2A 3EIVA 4LFAQ 1K0RA 2K52A 4UP7A 4DAYB 1QVGA 4JI3L 1GO3E 3KDFB 4LFCL 4GNXB 4JI5Q 3U4VA 2VUMH 4KHPQ 4JI0L 2JA8H 5DLQE 1WCMG 5IP7G 4XTCS 5IYCG 4GNXC 4OO1G 3TEHB 4JV5L 3H0GG 4LF8Q 3I4NG 2KCTA 4JI4Q 4BXXH 1A63A 1D8LA 1EYGA 2UXBL 5IYDH 2N8NA 1QUQB 3KLWA 4LF4L 1XNQQ 2CKZB 2OQ0A 4OWTB 3PUYA 5M5YH 3PUWA 4DAMA 1SFOH 3PUXA 3RLFA 2K5VA 4IPDA 3CMAA 2ZM6Q 3KFUA 1VQNA 1JE5A 5LMUL 2UXBQ 1SROA 2IHEA 2RCNA 3MXNB 1NJIC 2R7DA 3PIPA 2C35B 5C4JH 3F2DA 3S1QH 3ERSX 4YY3L 3FKIH 5GQOA 3TRZA 4FDBA 1YJNA 3HOUG 4LF6Q 4DUYQ 1JMCA 1PFSA 5K36G 1V1QA 3W1GA 3RZDH 2HHHQ 3CMEA 3I56A 4A3BG 2R93H 3OTOL 3D31A 3HKZE 3CCMA 1B8AA 4NXNQ 4GKJQ 2VQFQ 3HFZB 3RLOA 5C0XG 2K50A 2A19A 2AWOA 1BKBA 4QY7A 1XJVA 4X65Q 3M85A 4DUYL 4A3GH 2BA0A 3GTKH 4A4IA 2UUBQ 4QJFA 2PI2E 4B3RQ 4C3JH 1J6QA 2E5LL 3CCRA 2YTYA 3GTGH 4A3JG 3PO2H 2VQFL 3D0FA 4OX9Q 3S2HH 3T1YQ 2FXQA 1Q8KA 3BZKA 1IBMQ 1WJJA 4BY7G 2VY3A 4P71A 1N32Q 1OXXK 3HOXH 4L5SA 2EIFA 4IPHA 3H0GH 4DV5Q 4A3LG 4LFBQ 3GDEA 1E1TA 1TWGH 3EBEA 1LYLA 4BBRG 1XPUA 2K4KA 3KJOA 1L2FA 1N32L 1X3FA 1D7QA 2JA6H 2QGQA 3RN2A 4IFDG 1NY4A 5JJIA 5HY6A 2Z6KA 1Y1VH 4JG2A 2RF4A 3K7UC 4DR5L 1X56A 2NZHA 4GKKQ 4DV2L 1A0IA 4JI8Q 5IYBH 3M4OH 4JBWA 1XPOA 5LMNQ 1N36Q 3HOYG 3M4QA 1SRUA 3TQYA 1N33L 2IT1A 4IJHA 4JBKA 1SE8A 3UDXA 3DLLA 1GVPA 3CF5A 4AQYQ 1HNZL 4A3DH 5C4XH 3STBD 3AQQA 4X64Q 3I55A 4NPSA 3F8TA 2GVBA 3UDFA 2UUCL 3G48A 2VS1A 2JA7G 4EX5A 3BZCA 1CSQA 2WFWA 4IJLA 4MNOA 4JC0A 1YJWA 4DR1Q 2OWOA 2I0QA 4PG3A 4AQYL 1HNZQ 1JJCB 4R4CA 2QA4A 2WB1E 1RL2A 1VCIA 3GTPH 2PQAB 4LF4Q 4LNQA 1G6PA 2A1AA 4MTNA 4YCWA 5GAGC 1XMOL 1VQ6A 1UWVA 1M1KC 1A8VA 2B63H 4A3MG 1VQJA 5AJ3Q 4X62L 2EQSA 1YHAA 3H3VI 4GKJL 4PZ7A 2ZTDA 2R7ZG 1ASYA 2YV5A 1X3GA 4GNXA 2ZTEA 4O0AA 5FLXc 2KENA 4A3EH 2JA7H 1TWFH 2JJQA 4L5QA 4A93H 3ER0A 2JEBI 4DV6L 3S1NH 2R92H 4B3TQ 4JI1Q 4ALPA 4DV0L 1TWHH 2IX0A 4LWCA 5IWAL 3I4OA 5ELOA 2AKWB 1N34L 3T1YL 2AHOB
chains in the Genus database with same CATH superfamily
3MC0B 1EEID 4QQBX 1I50H 4F4XA 1B7YB 5CC4A 1I4PA 4DV0Q 2A69D 1RODA 1EIFA 2ZXPA 3BA9A 1H95A 5KKNB 4K2LA 1Q90A 1K3BC 5M3MG 4DV3Q 2V4QA 4BBSB 1KDAA 1CUKA 2EVBA 3TP6A 3U4ZA 3J80i 3BVGA 3GV6A 4X3SA 2PNHA 1D1IA 2R7KA 4DR2L 1MJEA 5IT9W 4TQUS 3BDLA 2VQEQ 3VDYA 2CW8A 4DAYA 3V6KA 1MZBA 5EWFA 3CCLA 5DG8A 2KCMA 4OONA 5KYLA 2DGYA 2E2HB 5KFZA 1L1OC 1HNWL 2WB1G 3Q8RB 3CCEA 2UU9H 2A6HC 3I7FA 5EZYF 4A3IH 4IO9A 2A8VA 5CV7A 1EU3A 3QO2A 1V1PB 3J81c 5T14A 2W9CA 4XYQA 3G71A 1YHQA 1M0WA 2AGOA 4B3SH 1XNRL 1LABA 3MWYW 4KD3A 3A56A 3RNUA 4YCUA 4FF2A 4OWXB 4OL7A 1TU2B 3ND8A 3M9BA 5CB4F 1WOCA 1TWAA 2PYKA 1HZBA 3T53B 1O7IA 1AZQA 5KFRA 1EOVA 5H1SE 4C5BA 1IBLH 3K0XA 4HEDA 5JJLA 3S2DB 3BDCA 2RDHA 5KG1A 3OSOA 4YJ2F 3GV8B 1N33H 5EPJA 3J7AV 1VQLA 3M4PA 5T1GA 2PCFB 3I4MG 4BXXG 1B04A 1WFQA 4FYDA 1E2WA 1D5MC 3MA2B 2K75A 1RJPA 3CQZB 4IRCA 3R5FA 5D1OA 4Q8FA 2F3WA 2UUBL 4B3RL 4P75A 1Z2NX 4UCVA 3I2ZA 5AJ3L 5KFYA 4LF8L 4OHJA 3VPDA 1XWEA 2R6GA 4C3IG 4RCNA 1QCBD 2WIIB 2ZDHA 4WJ4A 1ULZA 1VF7A 1YNNC 1SMYD 1HNXL 4R8UA 4J9RA 2KJXA 2UVUA 2JQOA 2JXMB 5IOCA 3AYHB 4B3SQ 1YEZA 2R7ZB 5F9NA 3PW2A 2D9UA 4OX9L 1BO0A 1V1OA 4ZAIA 1Y1WG 2OF1A 3JAMc 4APVA 3FP9A 4O2DA 1K0SA 2PZUA 2UU9Q 5J2TF 5KT2A 2FINB 4UCSA 1FNUA 5FLMH 1O7ZA 2MNAA 4ME5A 5JVH3 1PYWD 3LWUA 1DOMA 3OMGA 1ZKOA 4UFZA 3M9OB 2FFKB 4NXNL 4RAZA 2AQ2B 2DJFC 3BJYA 5IGBA 3VYUA 5IY0A 1Q3LA 1H9JA 3VR5A 1UC9A 5KNBA 2R7NA 1HR0L 3G4SA 5KFFA 3MR2A 1BNZA 1ENFA 2WKCA 1EFWA 2UXCL 2E2JB 1PH4A 4K8IA 2F0WA 2B29A 2PQAA 4YBZB 2F0UA 5LMNL 3I70A 4DLKA 2CQYA 1PK8A 2LKVA 4YAJB 4L63B 4EQPA 1Q1EA 2YZMA 1Q8IA 1YNXA 5CMDA 1SFOB 1OXTA 5IWAH 1ZYRC 2R92A 4F88A 1SNCA 4YHHL 4GS3A 4ECWA 3CCVA 4CDEC 4NW2A 3S1QB 1VAJA 3KALA 3S24A 4M7EA 4MV8A 1EWHA 4QIWB 2KCNA 1U9RA 2PW7A 2AGPA 4C3IH 5G3LD 2DUDA 3H09A 3SVMA 3SHLA 3I91A 4GLXA 1PTOB 2WACA 3A0JA 1B9NA 3MZ5A 4C3HG 2I07B 3P1HA 4LF8H 5C6AA 2XN9C 3HEJA 4K8JA 1Y1VG 2ZDGA 4KHPH 4BWSC 2JYOA 2HCIA 1SYEA 4S3SA 1Y8OB 3LWBA 1DOKA 2K01A 1STAA 2IJ0A 2HHHL 2VUMA 1G291 5LL6b 1PVOA 3MEHA 1WTVA 3E3XA 1SCUB 3NTIA 4LW1A 4LSXA 4BA1I 1AH9A 4FU0A 3H0GB 1BBWA 4Y7NH 5LYJF 4ODGA 1SE2A 5KYIA 1X6OA 4K5VA 5E4XA 3T13A 4DK6C 4IOCA 1PH5A 3DWPA 5LL6X 1Y8PB 2JN4A 1PRTC 3S17H 3RIZA 1BF4A 1NNXA 2K5HA 1J5EQ 5KFKA 3ICEA 1I7LA 3SK6A 5LMNW 4RFBA 1V1PA 5KFJA 3KF6B 2PMZA 3ITPA 3CPWA 3M4OB 1EY8A 4A3MH 1QVFA 3HOXG 4YR3A 4C56C 2B3GA 2GN5A 1WH2A 1KBLA 4POGA 2I5LX 1EUJA 1QG7A 4X3TA 4RB2C 3DXJC 4K5XA 4DAVA 3EYYA 4QIWE 2DIKA 1BCPC 1DIKA 1HTLD 3GLKA 5KGUA 5KFXA 1WVLA 4Q0FA 2K6AA 4IWYA 5KFSA 1KRTA 5EOYA 4WFN3 2W6QA 3GQCA 5EBCA 3MFHA 3HOWB 4B3TH 4XT3B 2R8GA 4I4TF 5FPOA 3GTQB 1FNVA 4C1NI 4JI7L 4RKLA 5J3BA 3GTGB 3PGZA 4JI0Q 3SI8A 3T5JA 1LO5D 4JI6L 2Z4IA 3CAMA 1IBLL 3K8AA 1BXRA 2NVYB 4GOPC 1TWCA 2J9GA 4O3OA 3FRPB 4LUZA 4O4HF 4GKJH 4LFAL 2VB3X 3RR5A 1CZWA 2MJ8A 3LX0A 1Q7YC 2CH4W 3HKZA 3RB4A 3IFDA 4Y8VB 1EYAA 1IHZA 2F0NA 5FO7B 3GTKB 1HZCA 2KHIA 1LTSD 4ULLA 3S1NB 4JI4L 4GC6A 4HNUA 2VOBA 5HV6A 1HXYD 1SBBB 2KECA 3R23A 1AE2A 3OYYA 3PUZA 5KFVA 1KDCA 3UDGA 1W3SA 5C1OA 3K57A 5IYZF 4ZHQF 2C2RA 2PMZE 2XWJB 4OXPA 1SEIA 1PYSB 5M5WB 1UNNC 1DXMA 2QK4A 3I12A 1LUZA 2O5IC 3KYHC 4J9MA 4IFDI 3CQZA 2PNRC 2CCZA 2WINB 1VMPA 5J22A 2MP1A 4RUAA 3FVQA 2CH4A 4ECZA 1S0NA 4UAIA 1A62A 1QE6A 1E2ZA 3J81i 1ONLA 2PN1A 4C2MH 2R8IA 1J9OA 2E5LQ 4A3BH 4GC7A 2BA1A 2QEXA 2A68C 3FDTA 4YB8B 1KAAA 1B70B 3PW4A 5EWEA 3RJ0A 2XC9A 4ZUIA 4RGTA 2MPMA 1T36A 1BUVT 1IZ6A 4DV1H 1IKLA 2NVQH 1HFGA 2NN6I 1YIJA 1SEBD 2W9BA 4IR1A 1K8OA 3K5HA 3GIJA 3JC66 4BY7H 1Z2OX 4A3IB 3L3OC 4I7AA 1Y8NB 1KAWA 4J8QA 4JOIA 2Y0SE 3STBC 1PH7A 3PR4A 4R9WA 3GIMA 2TSSA 4N8FA 1J5EL 3Q1KA 3S15B 1LM0A 4DR5Q 1PHJA 2KEDA 4C2MB 1Q86C 3ORQA 3NQIA 3T1HH 1GGOA 3KLSX 4DU9A 2HJWA 1KJJA 3RBDA 1VQHA 1EZ8A 3KOJA 1CKNB 3K58A 2VNUD 1D6EC 2N3SA 5CV4A 5K2MA 1PTOD 3KF8B 4QIWA 1VQPA 1STYA 1WI5A 2R82A 5IT9E 1VMCA 2F3IA 2BE5D 4JYAH 3E0JA 1KLGD 1L0WA 4KY6A 4ZYSA 1K8GA 1EQRA 1HH2P 2O4XA 5C0XJ 2JA5B 1EY7A 1U0LA 4YHHH 2M2LA 2F4VH 1K0RA 2K52A 3N41B 4JI3L 4GNXB 3QOLA 1I50B 5C3WA 3UI2A 4JI0L 5DLQE 3TZDA 3X3NA 3RB0A 3TEHB 4CDCC 4C5AA 1LTID 4ECYA 1I94H 3I90A 1A63A 5ELDA 1TA8A 5IYDH 2FPGB 3KLWA 1XNQQ 2FPIB 2ICEC 2B2TC 1ZETA 4OWTB 2HVRA 2CHBD 2NUCA 3PUXA 4IPDA 1LV9A 2FK3A 1VQNA 1RD9D 1JE5A 3CVZA 5BPHA 1NJIC 3F2DA 3ERSX 1OO9B 1CZGA 3FKIH 1D1KA 3TRZA 3A7AB 4DR3H 1YJNA 4EQOA 3HOUG 1JMCA 1I6HB 1S0OA 4OGQC 1PFSA 2N55A 5K36G 1IL8A 1U4PA 1V1QA 2DZDA 2HCCA 5KFPA 1SNMA 1RYRA 3T56B 1HRJA 4A3BG 4JI2H 3OTOL 3K5NA 3GTLA 1B8AA 2VQFQ 4PMBA 3JSLA 1L2ZA 2K50A 4X65Q 3M85A 2K28A 2BCOA 4DUYL 4A3GH 2V9WA 4A4IA 1Y1VB 4QJFA 1SAPA 3Q8SB 2GLTA 2WAQB 5EGTA 2E5LL 4YY3H 4EFEA 3FPPA 3OOCA 3CCRA 4A3JG 4J9SA 3S2HH 4C3HB 2ZT9C 4FNFA 3URYA 3T1YQ 1IBMQ 1M0TA 4BY7G 4JK1C 1UUPA 4RAYA 1TAEA 4O4IF 4L5SA 3J81E 1SE4A 5DG9A 3M9MB 3DEPA 3GDEA 1DM0B 1TWGH 2HUGA 1LYLA 3EBEA 4BBRG 5KFEA 3KJOA 1L2FA 3C2PA 2JA6H 4MTDA 1KC7A 2W6PA 4U673 4IUPA 2Z6KA 4DR5L 1X56A 2OT2A 2NZHA 2B2TA 3HB9A 5IYBH 4JBWA 3HOYG 1MI2A 1WTQA 2VUMB 3M4QA 2J7ZA 1S9FA 1J8IA 1K28A 2CW0D 3TQYA 4NKLA 1N33L 2FK1A 5BPFA 5CAEB 5LL6S 3GTGA 4C5CA 4EYIB 1GYFA 1HNZL 1F9PA 4IUNA 3T5HA 2EY5A 5I6WA 2JEGA 1E0BA 3G48A 4KKUA 4NP5A 4BS9A 5H80A 4B3MH 3BZCA 4EYHB 1STHA 2Z8LA 4PG3A 4AQYL 2QA4A 1FR3A 1VCIA 2AGQA 1S5DD 5FLXL 5GAGC 1XMOL 1M1KC 3L4KA 3RD4A 4A3MG 2VQDA 2WDTA 4X62L 2EYOA 3NTHA 4C3JG 1HUMA 1GUTA 1YHAA 3DWAA 3H3VI 2R7ZG 4DL5A 4HSPA 4O0AA 5FLXc 2MCTA 1SNQA 2JA7H 3QR8A 4L5QA 3KLRA 2RVLA 4IZOA 2R92H 4ALPA 4DV0L 4NLGA 1TY2A 4LWCA 1TWHH 1ZYRD 2HD3A 3CU7A 4C3JB 5ELOA 2AKWB 1N34L 1E4EB 4JV5H 2F0LA 2YYAA 4C2MA 4M8AA 1JB3A 5KNDA 4DV6Q 5HGQA 4QWDA 1R4QB 3F2CA 3A8IE 3D6WA 2O03A 4LF9H 3A5ZB 4ZCKA 2F0JA 3KF8A 5IGGA 4DV7L 4QW8A 2ASDA 2J6SA 2W9BB 5KG0A 5KNCA 2IL8A 2KEEA 5E4WC 4E4TA 3DUZA 2GPWA 1K9MC 3S2HB 4GLVB 3C46A 1GSOA 3N44B 3K7AH 1VQDA 3GD7A 4KY7A 4A76A 3I8ZA 2JEIA 3KJPA 2Q2HA 3EROA 4IUTA 3MAQA 1Z2PX 1AFPA 2VUMG 2ASLA 2P5ZX 4HIDA 4L5RC 5KFNA 3NENA 2EXZA 4JI3Q 4L8JA 3HXLA 2IWHA 5IGDA 5FLXW 3PF4A 4A2BA 3RGXA 3GTJA 5FD5A 2CQOA 3PUVA 1XMQL 3VYSA 3JZIA 4KD4A 2AUKA 1S03G 1GLVA 1WTPA 1ESFA 4KLKA 1B3QA 5I2YA 1WTOA 1JT8A 2HQLA 1KQSA 1UEAB 2KSWA 3M4YA 1PH9A 3PO2B 4ZI7F 1TVXA 3RV3A 2SNSA 4J6HA 5IP9G 5I4DA 4EG0A 4HMIA 4X62H 1L0YB 4JI8H 2Z6KC 3RMHA 1WD1A 5KFGA 2IY5B 1S72A 2Q2TA 2L15A 3Q6SA 3SDZA 2DWCA 3MJFA 1Q46A 2AUJD 2NWGA 4MV9A 4NXMH 2IPKD 2YYZA 2RDIA 4Q44A 2F4VQ 3D4RA 4YHHQ 1STNA 4RB1A 4A3BB 3TIGA 1JWUD 2K33A 5LMUH 1TXYA 3KUPA 3TZUA 1TR5A 4QUFA 3PIOA 3BVZA 3I4NH 1Y1VA 1ICWA 2W71A 5EKKA 4K5WA 3UDIA 4EGJA 3MHBA 4I50F 5C4JB 3A8KE 4C3IB 3S1MB 4MAMA 2QYZA 4DPGA 4KJOA 4FM9A 1EIGA 3HP3A 4KN4C 5IGFA 3Q22A 4EQ5A 3PIO3 1DZ1A 1AN8A 3PW0A 2E74C 5KFUA 4B3ML 5KRUA 2JEJA 2BQ3A 4E6IA 5NUCA 1S3OA 4K0KQ 4DL6A 2EOTA 3L7ZC 2DJGC 3P20A 4X65L 1YI2A 5ELBA 3CCSA 1W93A 2D62A 3GTLB 2R3ZA 2ZJQA 4DKAC 4DR5H 2W57A 5ISRA 2PBZA 3Q24A 2RKSA 4IOAA 3I4NB 2XCPA 1VQ5A 2BH2A 2JA6G 4NDXA 1RK6A 4BBRH 3F1ZA 1K8AC 2IHFA 4DV5H 1B33N 1SJED 3O13A 2XCAA 2YU9H 3TP5A 3NK9A 4DV1Q 1Y1WH 3V96A 3GIKA 2A6HD 3ONAB 5L37A 4X3UA 3DEOA 1HZ9A 4ETSA 3OUZA 2R7FA 4F4WA 3I4MH 4A3CH 1JKJB 2UXDQ 4DFAA 5C5JA 2FMCA 4CGYB 2DN8A 5C44H 3J80L 1UNSA 3NBHB 3S9WA 3R3OA 4J15A 2NVQB 1AUVA 3N40P 2RGVA 4JVZA 4V0BA 1N36L 5BR8Q 5KFLA 1EQVA 2E2DC 3D3RA 3JRWA 3Q8DA 1UEBA 2AMCB 3HOUH 5FK9C 3RF2A 2W7OA 3H4DA 1LTTD 3H4BA 1HJPA 4XQQA 3HOWH 1WD0A 1XMQQ 4JI2L 4I7HA 3MR3A 3EPIA 4EQNA 3L0OA 5KFMA 5EDWA 4UY8C 2OTLA 4ED2A 4NMZA 4JI1H 4JI7Q 4LF5L 3I73A 4KHZA 4DL4A 1E4EA 1UE5A 5M3MB 3HZXA 1I6HH 2MGSA 3WOEA 2NU8B 4J9NA 3RZOH 4HN7A 4TV9F 2LS01 4X6AH 3E6ZX 2E2IH 4JOIC 4J1MA 3HOUB 4JI0H 3EN2A 2F0GA 5CV6A 4P72A 2ZM6L 1B6SA 1KRSA 4YIJA 1PH8A 1AN7A 4GZYC 2FLPA 1E22A 2FMMA 2MUYA 3GIPA 1STBA 4MA0A 1C9OA 2G9DA 2VPSA 2OXPA 1EZ1A 3HOVH 1HZAA 2E2HH 2D0PA 2Z0SA 3T4AC 3E9IA 2W6NA 5M5XB 5CBAE 2ZXRA 4UP8A 4YY3Q 4K0KL 1Q12A 1CKOA 1KABA 3SGIA 2HQEA 1WR2A 3GTLH 3G7LA 2JEFA 5EWGA 3MFIA 2JA6A 1DYQA 2XWBB 1IW7D 2W6OA 2LFNA 1TWFA 3E9HA 2JA5G 1KJ9A 2V4RA 1ENCA 5A2QW 1P16A 3MFYA 2I80A 3FKIA 5M3MH 1VQ4A 4ZKCB 5FO8B 4HJ7A 1A3TA 3CC2A 1K8MA 1FJGQ 3CQZH 4IPGA 1WTXA 5L9XA 2DPIA 1VBHA 2C9OA 2ES2A 2Q2UA 4F7XA 3RB3A 1KNAA 4LF7L 1TWAH 4HJAA 4ZK9B 4BBSH 1E4GT 3S2DH 1BCPD 1ZEQX 1WSCA 3UE1A 1SNDA 1OXSC 5KFDA 2EPBA 2LSSA 5CYUA 1II3A 1QWYA 4IUUA 4GOPA 1KDBA 4A93G 3H3VC 1YHBA 1QNKA 2JSOA 1H9SB 3GIIA 5FJ8H 4X64L 1S5FD 4N9PA 3KAKA 1MBYA 4LSAA 3TDQA 2HT1A 3HOXB 4IPCA 2ICIA 3IN5A 2IW3A 2FJZA 2Y0SB 2BDNA 1DCZA 4DUZH 2ID0A 4EGQA 1HNWQ 1YVCA 4RG1A 3NEMA 3QG1A 1A2UA 3AFPA 1BBUA 5EJWA 4HYKA 3W1BA 1CI3M 4WD3A 1Q82C 3K5LA 3U9OA 1I7NA 3S14B 2XNAC 4FF3A 1ILPA 1XDNA 3CCJA 3TS2A 2K7VA 4X66H 3RZOB 2K04A 4PQXA 3T16A 3MTSA 1Q81C 1KNEA 1XNQL 1K1QA 1PX2A 2L11A 3ULLA 2L55A 1SN8A 2V59A 1P8LA 2K5NA 4HJ8A 1VS0A 2NN6H 3K80C 4IHJF 3M4IA 4LFAH 1RTNA 1XTDA 5FO9B 3ULPA 4LFBH 1TWHA 2DLNA 1A2TA 4LK1C 4DV3L 3TINA 4RGOS 3HRZC 4IUVA 1PRTB 1JDBB 2A68D 2XGTA 3PV0A 1F9QA 1MHWC 1LT5D 1CSPA 1XPRA 2B2YA 1PH6A 3GILA 4DV5L 3GIQA 2R86A 2NBFA 1NAPA 1SMYC 3D8GA 3IG0A 1MJCA 4F50A 2B39A 1RJQA 2LMCB 4QF4A 5BMVF 2F0MA 4X66L 4CC6A 1L1OB 2D0OA 2EJMA 2QCPX 2L1BA 3DHQA 3DM1A 4P2CB 3RN5A 5M9OA 3OTOH 3HOWG 1X3EA 3A8JE 3SXHA 5C0XH 1B9MA 1NSNS 2ATLA 1C48A 1BGWA 4C1NK 5BN3A 4HIKA 4HQ6A 2JA8G 3CW2C 3JAMi 5JEAG 2W9CB 3NBHA 5J39A 1A3VA 1NBWA 1T9HA 1Y14B 3IFTA 4LF5Q 5M5YB 3VMMA 1RDPD 2HIVA 5JVG3 4ZUJA 5EKIA 1E3PA 1PZJD 1B2TA 4R4QA 4ZQIA 2KBNA 2GA4B 5KG6A 1O78A 3HG9A 4QUCA 2R7ZA 1GO3E 4LFCL 4JI5Q 3U4VA 4PDBA 4IUQA 4RKBA 2C00A 1VKZA 5IP7G 1WCMG 4XTCS 5FLXE 4JV5L 4KJNA 3H0GG 1PZID 1N34H 4LF7H 1TWGA 1JX4A 3S16B 2N8NA 4LF4L 1S4ZA 2WV6D 5IIFA 2CKZB 4RGMA 3PUYA 3VYRA 5M5YH 1EL0A 4DAMA 4XDXA 1TY0A 2X6LA 3KFUA 2ZM6Q 2FP4B 1JORA 1C8CA 1SROA 2IHEA 4K6DA 5CV9A 2RCNA 1S68A 2R7DA 4YY3L 4XX0B 3VR4A 2Z6BA 2A69C 1VDZA 1ZHSA 3GTKA 4BWGB 4DUYQ 1XXGA 1HFNA 4DL2A 2R93H 3D31A 3U9SA 1JE4A 2VQEH 2AWOA 1XJVA 3AMUA 4TRDA 2R92B 2IMWP 1H9KA 4K6LA 3RTXA 5JVLA 2F0VA 3L9AX 1XX8A 5JJZA 3GTGH 1EUDB 1KJ8A 4MTKA 1STGA 1LLRD 2F0EA 3FMAA 3J81L 1Q8KA 3BZKA 4WBNF 4HAEA 1W6JA 4P71A 3D6CA 4DNTB 2HHHH 1OXXK 4F4ZA 3OHBA 4IPHA 3H0GH 4Y7NB 4DV5Q 2EZVA 4LFBQ 3BS1A 1GSHA 5KT5A 4J9QA 2DNEA 1E1TA 1XPUA 1WCMA 4FXGC 3LMLA 2Y0SA 2V5AA 2QGQA 2J4XA 2Z1CA 1NY4A 3OMCA 4FO2A 4RHSA 4CJ2C 4A93B 2CW0C 2FE3A 4JG2A 4HNVA 4DV2L 1RYSA 1PZKD 4AYBA 2QF7A 3M4OH 2L5TA 3VR2A 5LMNQ 1M7JA 3Q23A 4IRKA 3GTMA 2X69A 2H4OA 2IT1A 3BVMA 3W3AA 4IJHA 4A3KB 1SE8A 4Q8EA 4A2AA 2F0PA 1D5ZC 1GVPA 1EIHA 4AQYQ 3K59A 1CS0A 5C4XH 5F9LA 2HVQA 3AQQA 2XVSA 1I4QA 3VYTA 2MHVA 4CBVA 1Y1WB 4IFDH 1AUXA 4ED3A 2UXBH 3EFXD 2VS1A 3CKIB 3MWDA 4M9UA 4O3QA 2CVRA 4JC0A 4DR1Q 5DLGA 4RH6A 4ZLTF 2YW2A 4IZ8A 2WB1E 1RL2A 3GTPH 1IOWA 2BR0A 2PQAB 3MXGA 2ZDQA 5I6YA 2UXCH 1SYFA 1G6PA 3OSNA 5C44B 3QIAA 1A6XA 4MTNA 2YS7A 4JPBW 3BG5A 4ZOLF 4J9OA 2UVVA 3KK7A 5KFOA 1VQJA 3QJYA 4I7ZC 1GSAA 2R7MA 3TQ1A 3FDSA 4XYOA 3J81W 5D3DA 1X3GA 1BBXC 1B50A 2JJQA 4B9XA 2QILA 5KEEA 2GPSA 2JEBI 4DV6L 4A3GB 3AB9A 2J0TD 2SDFA 2F0TA 4JI6H 2IX0A 4OIKA 1KTKA 1A3UA 3I4OA 3N6XA 4DV4L 3IKJA 1GUGA 5KT7A 4GOPB 2F0HA 2JE6I 3E0EA 3K0YA 1AZPA 5C44G 1B1ZA 3M9NB 3A74A 1CT1D 1I5FA 1TS3A 1X65A 1FJGH 5D14A 4B3SL 2R93B 2R85A 4RCOA 3PR5B 4IR9A 4F8MA 5KG7A 2ZJTA 1K1SA 4ECSA 1PFNA 2LXJA 3U50C 1RCVD 2B8FA 2PQEA 4AH6A 1QNUA 3QWNA 4DR6L 1O80A 4FXDA 2YZGA 3Q0AA 4J9LA 4KV6A 2BQUA 4KI0A 2F0KA 2PO4A 4OO1H 2UVRA 1GUNA 3CP0A 3BJUA 4Q43A 3H0GA 3J7YW 3FHWA 2WB1B 2M9VA 4DL3A 1PYBA 4QMGA 5JAVA 3HOZH 4ZQ3A 2B2YC 1HR0Q 3V6JA 1SLJA 4J9PA 2R8KA 2KOLA 5FPRA 5GAEC 4TVAB 5FJ8G 3V2TA 3PF5A 4F87A 3HOYH 1T5EA 1K83A 2K14A 1ENAA 1IBLQ 4JV5Q 2AWNA 4NXML 3PO3B 3A5UA 2UXDL 2WE6A 3BG3A 3S14H 5IGEA 4BBSG 5LXTF 3MXNA 4FBUA 1TS5A 3BYTB 2HVSA 3W2DA 2F4VL 1ET9A 2R93G 4ABNA 4DNIA 4HCSA 1QZHA 4EEYA 1S5CD 4TSSA 1TWGB 2MFIA 3LNNA 4RMFA 5E1FA 4BY1B 5JH7F 1JR0D 1QUQA 5EAYA 5JOBA 1C0AA 1TIID 4O3NA 4HR7B 1BVSA 3TREA 4LUVA 1HQRD 3KHGA 4A3GG 2UUCH 4R4OA 5BR8H 1NMFA 1AE3A 5IP9H 1HTPA 2B2WA 2H5XA 4EBCA 4Y52H 4WJ3M 1WCMH 2F52A 2ZTCA 1VQFA 3HKZB 3BZDB 3NWTA 4TQSA 3ETJA 4U7CA 3WWVA 1VQEA 1V43A 3HOVG 2VPQA 1SNPA 4F4YA 2DPJA 4EBEA 2I5MX 3FKIG 2JA9A 4POFA 3QFFA 1IBKQ 4BY1H 5KG3A 4NXNH 4RNNA 1EY6A 1C7YA 2K32A 1I3QH 2NU7B 4IAJA 3RFCA 3AEVA 5F2DA 2L12A 2KUMA 1I50A 4RZRA 3OSPA 2NU9B 5DQIA 2V1CC 4DV1L 4DV0H 1D2BA 1EY4A 1Z6HA 4GN3B 3RLNA 3MR5A 2OQKA 1HQMC 1PH3A 3J81j 3HS0C 1F2MA 3CC4A 2JP1A 3D4DA 4RZQA 2JA7B 3PO2G 2NTSA 4IFDJ 1CKNA 1MGSA 1U5KA 5KFIA 4DV2Q 4H44C 4DR6Q 4FS2A 3K81C 2L4NA 1YNND 1GKHA 1PH2A 2VQFH 1K3RA 1RTOA 2Q8IB 3HOZB 1IBML 1XMOH 1PA6A 1PTOH 5DGAA 2YTVA 4LF4H 2RSNA 1EHIA 4XQJA 1KD1C 1XNRQ 1HNZH 1JWSD 5LHY1 2XGQA 1S10A 3CC7A 4HJ5A 5JQWA 4LJZC 4EEQA 2R7ZH 3PW7A 1EOTA 1RHPA 1E7ZA 1EY5A 1VQIA 1BCPF 1OTCA 3V05A 1C30A 1SJHD 4RAUC 2NN6G 4DK1A 3H94A 3NHHA 1EQQA 4RNMA 1T94A 4H02A 3BYYB 1XNQH 1GD7A 3C1FA 5ELCA 4ME3A 1RIPA 4DK0A 1DGSA 4DR4L 2M00A 2G5DA 4M1UB 3TP7A 3V4SA 2WAQG 2C2EA 4UPAA 1HUNA 1YJ9A 3S17B 4DR6H 4KMUC 4LUOA 4BA2I 5IT9L 4FBTA 1KL9A 2XD4A 4KN7C 5CA1F 4JV2A 5KFHA 4DV4Q 3OIPA 2E2JH 4JI3H 2B2VA 3K7AB 2VW9A 4MHEA 5C3EG 3L4JA 4R7RA 5AFWA 2IP4A 4PMWA 1ILQA 4LF6L 4YWKA 4JYAQ 2N49A 2NU6B 1XMOQ 1VQ8A 4ED8A 1B3AA 3RUZA 1ASZA 4DR2H 3F2UA 4R4TA 2WAQA 2VA2A 2UUBH 4B3RH 2XTIA 5L1JA 2R93A 1AEXA 3K3VA 4FF4A 1O7LA 4PWQA 1R9TH 2YZNA 4UP9A 3JAML 4UDUC 1Q1BA 1CFMA 1PFBA 3WDNA 4YR2A 5DG7A 2SCUB 3AFQA 3G6JB 4G3IA 3S1MH 4O3RA 3J80c 5JPNC 4LAAA 1ZQ7A 1PFMA 4A3KH 2BE5C 3F8NA 1X3QA 4JBJA 1QZGA 2R6FA 1F9RA 2CWPA 2K5DA 3RZDB 1IOVA 3A54A 5COYA 5GADC 3H20A 2VQEL 2NB0A 3M7NA 4RNOA 1YNJC 2R8HA 3NSWA 2OCEA 2JA5H 4A3DG 2NTTA 2YTXA 2NUAB 1JXLA 3PCOB 3KHHA 4JV1A 4R4IA 3BDOA 4HSVA 4DUZL 3J7ZC 4YJ3F 1NTGA 1JIHA 1HCZA 4A3FH 3CCQA 2YRWA 1YITA 3UE0A 1NCVA 1UE1A 1GM5A 5KFAA 1R9TB 3JSNA 2B2UC 5IYDG 1JQYD 3RAQA 3N43B 3LWEA 2ZM6H 1HA6A 4HJ9A 3G6VA 2F0SA 4LFCQ 2A6ED 1I4GA 4ED0A 2E2IA 4MV4A 1YBYA 1UAPA 1CKMA 4U6PA 5DLFA 2WB1A 3TS0A 3NE5B 4FF1A 1SDFA 2RBMA 2ALYB 2EY1A 3VPCA 5KT6A 3JAMW 4H7BA 4A3FB 4A75A 2IA6A 3X3MA 1N34Q 4OWWB 1CK1A 1FL0A 4TV8F 1SR3A 2RDGA 1HR0W 2QEJC 1FYCA 1ZXTA 3EQLC 3KBGA 4UHVA 5DQHA 5KFQA 4DR2Q 3GV3A 2WKDA 1QVCA 2MO1A 5I2XA 4P73A 4AIMA 1SXTA 3R2IA 2EYFA 1G51A 3B6YA 4B3TL 3R5HA 4YWMA 1M4VA 1T3NA 1SYBA 3M7GA 5KT4A 2IBKA 4AYBB 1IKMA 3NXWA 2I5HA 4A3CG 5I47A 1Z7TA 5L1IA 4HNTA 2XRQD 3PQIA 3J7A5 1LTRD 4P74A 4GN5A 4X65H 2I8CA 1GXDC 3ORRA 1SFOA 3PO3H 1BDOA 3GTPB 1U4LA 1OXUA 1Y1WA 2YS6A 1PV4A 2M05A 1VQAA 2K5QA 3K3PA 5D1OB 4JW0A 4MZ9A 1VQ7A 1MD2D 4DR3Q 1MSGA 2RA4A 5IGCA 2KCCA 3SEBA 3ULJA 3Q8QB 2UXCQ 3QB3A 3KBXA 2PI2A 4QGUA 1JWMD 2XSCA 2RCFA 4JI6Q 4PV1C 4DR1H 4TUYF 5IYBG 3JRXA 4WORA 2PZWA 4UCRA 4K14A 2SEBD 3OW2A 3GTOB 3RB6A 2G9HD 5HGTA 4LFAQ 1QVGA 2VA3A 2K5WA 3KDFB 1EFID 4WRDA 4KHPQ 1I6UA 1CHQD 1CTMA 5IYCG 2FLNA 3KLSA 4DF7A 4OO1G 4LMQD 4LF8Q 4I55F 3T1YL 3I4NG 4JI4Q 3K5IA 1XYIA 4QW9A 5FD6A 2PZTA 1BR9A 4G4KA 1CA5A 5DM63 3S1RB 3K5OA 5A2QE 2VB2X 3QZ7A 3RLFA 3G8CA 2QW7A 1G8ZD 5KFCA 2K5VA 3KXYT 3CMAA 5KG4A 3FPUB 4DN4M 5LMUL 2UXBQ 3TBIB 4KTAA 3PIPA 5C4JH 1OWTA 1AP0A 3BQ2A 4FDBA 3NBIA 4LF6Q 4DR7H 4FS1A 1JCKB 5KFBA 1CA6A 2CZGA 2BOSA 5KIXA 4PMCA 3CMEA 2HHHQ 3I56A 3ETHA 1N48A 4NXNQ 3HFZB 3RLOA 3SR1A 2A19A 4QY7A 1BKBA 1M8AA 2F0IA 2F0OA 4OEMB 3WOFA 2EDGA 4CC5A 3PN1A 2E2HA 2FLLA 3K5MA 1J6QA 2YTYA 5BN4A 4Z9CB 4MIUA 2FXQA 5GONF 1S0MA 1PTOF 3HOXH 5HURA 4OELB 2EIFA 3CRLC 2Q8RE 3EA6A 1TWCB 2NVYA 2HDMA 1RK5A 4A3LG 1Y69U 5JEAH 4XZ3B 2D2CC 4N8X1 2EYHA 5L1KA 2K4KA 3KAJA 3QZ8A 1N32L 3NQTA 1X3FA 3NUCA 1D7QA 1O7YA 1N56A 1WTHA 3RN2A 4IFDG 1G91A 3A7LA 4CDFC 1ICFB 5JJIA 1Y1VH 1A9XA 2RF4A 3K7UC 1BJTA 2FB9A 2VXWA 4GKKQ 1A0IA 1I3QB 3TP8A 1N36Q 1SNOA 5JPMC 4IN3A 3D4WA 2W6ZA 2DY8A 3GP7A 4JUZA 1E4FT 2J6UA 3GIDA 3J7AF 3J7AK 1F2ZA 4B08A 4A3DH 1SYXB 1IW7C 3STBD 1LT4D 2EE1A 5C1PA 2UVWA 3I55A 4JI5H 4NPSA 1VBGA 2GVBA 2JA6B 2JA7G 1GHJA 4K2KA 1BNCA 4UCUA 2WFWA 4MV7A 1YJWA 4B9WA 2A5HA 2OWOA 2I0QA 1DV1A 1JJCB 4RU9A 4Q5VA 1HR0H 4LF5H 3NTKA 1JC7A 2NVXA 1S5ED 4CJ1B 4LNQA 1FGBD 3A55A 4CKBA 1VQ6A 4XT1B 1A8VA 1TS2A 5D8DA 2E2IB 2EQSA 1FKAH 4GKJL 4PZ7A 5CV5A 2PW5A 1ASYA 2EY6A 3RAXA 3MFGA 2ZTEA 1C3OA 2KENA 1TWFH 3ER0A 1N36H 3M3YB 4GKKH 4JI7H 4B3TQ 2H1EA 4JI1Q 3OUUA 4DNRB 2W8LA 5FOBB 1B6RA 3KHLA 3PVXA 5C5LA 2WYOA 4UCOA 5ELNA 4A3MB 1PLFA 3MXUA 4ED1A 4XIGS 5KFWA 4O1NA 3BAAA 4DV7H 3H15A 3U58A 1VQKA 3JAME 1K83H 1G6ZA 1RJRA 2VR1A 2IX1A 1GOZA 4G57A 1GUWA 5EQ0A 3U9TA 2F0DA 4QB4A 2RSOA 5GROA 1TWFB 1WTRA 2ZXOA 5DQGA 3KHRA 3R8BA 3PZPA 2ENBA 5C3EH 3P75A 3CCUA 2C2DA 2R8JA 1JOKA 1EY0A 3PW5A 3S15H 2EXDA 5IODA 3GTQH 3GTOA 1YNJD 3BQ1A 5I9OA 2NVYH 1TS4A 1DOLA 2P0AA 3OPOA 4FVMA 4YR0A 4X3KA 1VQCA 4DR7Q 4LF6H 3PO3G 4EFBA 4YP3A 5IE8A 2OEOA 4R1JA 3HKSA 3H3VH 4GN4B 1HPCA 1HA5A 2Z9HA 1VQOA 4A3JH 2NVTB 3ZJYC 4O4LF 4AQYH 2W9AA 3VPBA 4J0MA 1FVIA 1U4MA 4KHPL 2JA5A 1YZ6A 1V4YA 1JB7A 1EQTA 1PRTF 1S40A 1M6VA 2RHSB 1XTCD 2D5DA 5A2QL 2L0CA 3FEWX 2CWAA 5M5WH 1GUOA 4V190 4EBDA 5IT9c 4JI4H 2KHSA 4YQWA 4ECQA 1G2SA 1JOOA 1RF2D 1V9PA 4KKTA 2ZJPA 3DF7A 3EVQA 2YU9B 3GV7B 3NELA 1ML0D 4XQNA 1I4XA 1M90C 3NGDA 1KIXA 1Z9FA 3EPGA 2MO0A 2V4DA 2MQHA 5IWAQ 4N9TA 5LMUQ 2NVTH 3LP8A 1H9SA 1N9WA 4UCTA 4YAKB 4IRDA 3GTPA 1HNWH 4DAPA 1JOQA 2NZOA 4O3SA 2ZJRA 4X64H 3QOJA 1UE7A 2KA7A 3ND9A 1IBKL 2OH2A 2FK2A 3GQBA 2HIXA 4A3LH 4RA8A 3T5LA 1B53A 1I94L 4RGNA 3NWSA 3HKZG 2RDJA 1BCPB 2WAQE 5GAHC 2OTJA 3GO5A 3SE7A 2UUAL 1IXRA 1TWHB 1LTLA 3N52A 3H40A 3I4MB 4L5TA 4OO1I 4HTHA 3J80E 3KDFA 4QWAA 1GUSA 2JK8A 5CBEE 4DUYH 4BY1G 4DV7Q 5BN5A 4H0LC 1IL2A 5T1IA 1W6KA 4JYAL 2R84A 5C4ZA 1X9NA 3T51B 4XYMB 4GKKL 3GTQA 2W70A 2B2VC 1AW7A 3E5SA 3OHXC 1L1OA 1I6VC 1Z47A 4FP5D 2KVMA 2RDFA 1X32A 1R4PB 1CQJB 2BQRA 4AYBE 4LF9L 1V8QA 3HOYB 4KHVA 4XXEA 2EYLA 3RV4A 1VF5C 1K73C 3BU2A 4YCVA 5DNFA 3T1HL 2YL2A 4CDDC 2QDLA 3NPPA 4LF7Q 2V58A 1VQMA 3DWQA 1LT3D 3IL8A 1CQVA 1EZ6A 4BBRB 4A3KG 2B8GA 1X55A 3R2TA 3ZYYX 1KHIA 2NVXB 1R9TA 4LMYA 4ZKBB 4DR7L 1E2VA 2FHTA 1QB5D 1SE3A 1VQGA 2JEAI 4J9KA 4BY7B 4LFCH 1N33Q 4JI5L 5M5XH 4QWBA 4H13C 4DV6H 4RB0A 4A3JB 4L6TB 1SMXA 5KG2A 3TN2A 1BOSA 4L1KA 2ASJA 2A73B 4AYBG 4DR4Q 5C0XI 2J6TA 2CQAA 3LGJA 3Q8PB 1STEA 3PMFA 2B63A 4MN3A 5JJKA 5LP6F 3G6EA 1FGUA 4KY5A 1TQOA 2X0SA 5HBRB 4JI1L 4G7ZC 2NVXH 5JVDF 2EYPA 5DEHA 3OTOQ 2LXKA 3WO0A 2VZAA 5IYCH 1KC8C 1KJIA 2UXDH 4QCLA 1HNXQ 2R61A 4OIJA 1TWAB 1LT6D 2XIWA 3ERQA 2F03A 2YCHA 5ELFA 2A6EC 4DR1L 1I3QA 5K5PA 4B3MQ 3BQ0A 1N8RC 3CXCA 4MV6A 2UU9L 4EGVA 4DK3C 2R7LA 4KKSA 3CHBD 1NR2A 1U4RA 1PRTD 3L2PA 1IYVA 3I4LA 3IRBA 2FKLA 1NMGA 1TWCH 2QDBA 4PNYA 4GLAC 1PXUA 4DL7A 1JJGA 1ESRA 2FPPB 4ECUA 1MKHA 2XIGA 3S1RH 2DY7A 4JCVE 1C4QA 3DM3A 5D1PA 1IYJB 3MVVA 3GTJB 3MEFA 4HIMA 2ATWA 1MIUA 4IWXA 4DV3H 1JDEA 4CKCA 1PH1A 5DAUA 1UE6A 4LFBL 4HIOA 2EY2A 1EY9A 2E75C 4X66Q 1DD2A 1EYDA 2AQ4A 1WCMB 3CD6A 5ELEA 4G7HC 1A15A 5C4HA 2B2UA 2XRSD 4FXKC 5M3FH 3IAYA 4QWEA 4A3DB 3KTMA 4YWLA 2A74C 1B44D 2RHQB 1KXLA 4O3PA 4HMJA 4LH7A 4DV4H 3T1YH 2LY7A 4KK7A 1WYDA 1X54A 3CRKC 4CJ0B 3TMEA 2O2LD 4DUZQ 1JJ2A 3GTMB 1F2YA 5CR3A 3MWEA 1KLUD 4ED6A 2PVPA 5C5MA 2XCLA 5BR8L 2FMAA 2AQ3B 4K0KH 1GHKA 1OXVA 1B4OA 1NE3A 4A3IG 2JA8B 2YRXA 1H9RA 4X62Q 5M3FG 4RUCA 2I46A 4JI2Q 4ME6A 1I4RA 1QILA 2KHJA 4DR3L 4JI8L 2UUAH 1BQQT 1RKNA 3BA8A 5EKLA 3V6HA 3AU7A 1EWCA 2K1BA 2Q8TA 4PZ8A 4RWSC 3GTOH 2K05A 1VQBA 4NXMQ 4EVOA 2R87A 4C3HH 2ASBA 1LTGD 3FMCA 2R92G 5C4XG 1NUCA 2UUAQ 4A3FG 4IALA 3I3CA 2Q2IA 3BABA 1L0XB 2DNCA 4ID6A 1I94Q 1X3PA 3F2BA 4DXFA 5J2UF 5DGBA 4PZ6A 1CQFA 3G6YA 3T5KA 1CM9A 3W5OA 2KQ3A 3MR6A 2WP8J 5KT3A 3HGBA 3C0FB 1BXTA 1EUCB 3J80W 4ECRA 2W8KA 3TQTA 5LOVF 3R5XA 1LTAD 1SYCA 4R8NA 1MSHA 5E7NA 1PDQA 4NB3A 4A3EG 4LF9Q 2E8GA 3CPFA 2EYJA 3VA5A 4ECXA 1N32H 1CE8A 3N8DA 1WTWA 1W2BA 2B63G 1E24A 1EWIA 4OX9H 2BH8A 3PSIA 1SSOA 4U68A 3S16H 5CGKA 1TT2A 4CHTB 3GTJH 2F3VA 1VQ9A 2FJ2A 3GV5B 3M3YH 2PPBC 5L1LA 1T5XD 1FJGL 3C1EA 3T1HQ 1JLLB 5FLMG 1LACA 3C3LA 3H91A 4QL5A 2N88A 2Y0SG 5JEAJ 2W6MA 1IBKH 3EJIA 4JBMA 2CFMA 3R93A 2O5JC 4ECVA 3HOZG 4O2BF 1E1OA 3TSSA 4RB3C 2GVAA 5G3LF 4I65A 1W96A 5KX5F 1K83B 4RHRA 1HHVA 2PMZB 3KF6A 3MWMA 1DJRD 1PTOC 1XMQH 4MV1A 2UUCQ 4MA5A 3SK4A 5IP7H 2VL6A 4Q0YA 5TSSA 3GTMH 2N78A 1EIYB 2CW7A 2VUGA 3Q2OA 3OW7A 3EIVA 5A35A 4UP7A 2E5LH 4DAYB 2VUMH 1HNXH 3V4ZA 4ZRZA 2JA8H 4JV0A 2AU0A 4GNXC 1EEFD 4XYLB 2KCTA 3VA7A 4BXXH 3VR3A 2B63B 5LA6F 1D8LA 1EYGA 2UXBL 1UC8A 1QUQB 2ALZA 5K36H 3N42B 2OQ0A 3PUWA 4A3EB 5C3EB 1SFOH 3E5NA 2JA7A 3SK5A 4ED7A 1FD7D 5EPKA 2TMPA 5CORA 1GJXA 4DR4H 3NP8A 3UFXB 3SK8A 2F4IA 3MXNB 3S1QH 1IYUA 1ET6A 1H9MA 2C35B 1S5BD 5J1ZA 4IURA 4CKEA 2OLSA 1F2LA 3OIQA 5GQOA 5I9PA 1V51A 3OHAA 2Z4HA 5D3IB 2SOBA 3W1GA 3RZDH 3G6XA 2I87A 2YU9A 1EYCA 1QJOA 4DGZA 1IBMH 4R8UB 3HKZE 4O42A 3CCMA 4GKJQ 1NR4A 2F0QA 5C0XG 5D65A 5C4XB 4HR7A 4MTEA 2BA0A 3GTKH 1DV2A 2HGSA 5CV8A 2IX3A 2PI2E 2UUBQ 4B3RQ 2WTFA 4C3JH 2F0FA 2NYZD 2F1MA 3PO2H 2VQFL 3D0FA 4OX9Q 4TQRA 2B2WC 5DM73 1WJJA 2VY3A 1N32Q 4MV3A 2RQXA 1F9SA 2E76C 3MXPA 4O2AF 3RUPA 4WJWA 3SE0A 4QWCA 4ILWA 3HBLA 4ECTA 2AQ1B 5KG5A 5M3FB 1DONA 2BDOA 5CA0F 3N6RA 5C8YF 1F77A 1EU4A 5HY6A 2W7PA 4DXGA 4HCEA 2K03A 1ZHQA 2EJFC 4R8IA 4JI8Q 4TKOB 1XPOA 1G2TA 5EBDA 1J5EH 5EPLA 1SRUA 4LH6A 3WNZA 2C22A 4JBKA 4Q45A 3UDXA 2EYMA 3K6OA 3DLLA 3VR6A 3CF5A 2EJGC 3H6MA 1I4HA 1QOHA 4X64Q 3F8TA 3I72A 2QKIC 3UDFA 2UUCL 1KEEA 4EX5A 1CHPD 5JUMA 2XGPA 1CSQA 4IJLA 4MNOA 1RJTA 5E3FA 2RGRA 1HNZQ 1XNRH 4R4CA 1S97A 2C28A 3DMUA 2X6GA 3PIP3 4LF4Q 4G7OC 3FKIB 3TIIA 2A1AA 3OWFA 2SNMA 4YCWA 3HOVB 1UWVA 1SYGA 5FKAC 2B63H 3P7JA 5KFTA 5C3XA 4DA2A 5AJ3Q 3RBEA 1O75A 1PMRA 1D5XC 2ZTDA 4DV2H 1SYDA 2YV5A 4GNXA 1CQIB 4A3EH 1JICA 4A93H 1KJQA 4IQZA 1TKWB 3S1NH 3WO1A 4APMA 5LMNH 1EYZA 1LTBD 1FNWA 3RGZA 2C5CA 3UQ8A 3OWEB 2L9HA 5IWAL 2HDLA 2NZ1D 2AHOB
chains in the Genus database with same CATH topology
5ELNA 4GOPB 2JE6I 1I50H 4DV6Q 3E0EA 5HGQA 4QQBX 5C44G 3A74A 1B7YB 3F2CA 4XIGS 1I5FA 1X65A 4DV0Q 3H15A 3U58A 1VQKA 4B3SL 1K83H 2IX1A 1EIFA 3A5ZB 1H95A 4DV7L 5M3MG 4DV3Q 5GROA 2LXJA 3U50C 1CUKA 5C3EH 3CCUA 4AH6A 4DV4L 3U4ZA 3J80i 2PNHA 4DR6L 1K9MC 4GLVB 3S15H 2EXDA 3GTQH 4DR2L 4KI0A 1MJEA 4TQUS 3K7AH 1VQDA 3GD7A 4A76A 2VQEQ 3KJPA 3VDYA 2Q2HA 3BJUA 3CP0A 2NVYH 3FHWA 3CCLA 1PYBA 2VUMG 3HOZH 2KCMA 1HR0Q 4OONA 2DGYA 4HIDA 1SLJA 1L1OC 1VQCA 4L5RC 3NENA 4DR7Q 2WB1G 1HNWL 3CCEA 4JI3Q 3I7FA 5GAEC 4TVAB 5FJ8G 4IO9A 4A3IH 2A8VA 3PF5A 3PF4A 3PO3G 3J81c 3HOYH 2CQOA 3PUVA 1XMQL 5IE8A 2K14A 1IBLQ 3G71A 4R1JA 3HKSA 2AWNA 1YHQA 4GN4B 1VQOA 4NXML 3H3VH 4JV5Q 4A3JH 3ZJYC 3A5UA 1XNRL 4KLKA 1FVIA 2UXDL 1JT8A 4KHPL 2HQLA 1KQSA 3S14H 1YZ6A 4YCUA 3RNUA 4BBSG 1JB7A 4OWXB 1PH9A 1S40A 5IP9G 2RHSB 3M9BA 1WOCA 1HZBA 2CWAA 5M5WH 2F4VL 5IT9c 2R93G 1O7IA 4DNIA 2Z6KC 1QZHA 1V9PA 1EOVA 2IY5B 2ZJPA 1S72A 2Q2TA 5H1SE 2L15A 1Q46A 2MFIA 4RMFA 3K0XA 3NELA 2YYZA 1M90C 5JJLA 1QUQA 5EAYA 1KIXA 1Z9FA 2F4VQ 1C0AA 2MO0A 5IWAQ 2MQHA 4YHHQ 2NVTH 5LMUQ 1BVSA 3TREA 4LUVA 1N9WA 1VQLA 1TXYA 3M4PA 3PIOA 3I4MG 3I4NH 4A3GG 4BXXG 1WFQA 4R4OA 2NZOA 1NMFA 3UDIA 1AE3A 5IP9H 2ZJRA 2H5XA 2K75A 4Y52H 4WJ3M 4DPGA 1UE7A 1WCMH 1IBKL 2F52A 2ZTCA 1VQFA 2UUBL 4B3RL 4P75A 4EQ5A 3I2ZA 5AJ3L 2HIXA 4A3LH 4LF8L 4B3ML 3WWVA 1I94L 1S3OA 1VQEA 4K0KQ 1V43A 3HOVG 3HKZG 2I5MX 3FKIG 2JA9A 2R6GA 2WAQE 3L7ZC 4POFA 3GO5A 4X65L 5GAHC 1YI2A 1IBKQ 3CCSA 4BY1H 2OTJA 4WJ4A 2UUAL 1IXRA 2D62A 1LTLA 1HNXL 2ZJQA 4DKAC 4L5TA 1C7YA 4OO1I 1I3QH 2JQOA 3AYHB 4B3SQ 1YEZA 3AEVA 4IOAA 4OX9L 3KDFA 1VQ5A 2V1CC 4DV1L 2BH2A 2JK8A 2JA6G 1Y1WG 4BY1G 4DV7Q 4BBRH 3F1ZA 3JAMc 1K8AC 4APVA 3FP9A 1IL2A 4GN3B 2IHFA 4O2DA 2UU9Q 4JYAL 3RLNA 2OQKA 1X9NA 5FLMH 1PH3A 2MNAA 4GKKL 3J81j 2YU9H 1L1OA 4DV1Q 1Z47A 1Y1WH 3CC4A 4NXNL 4AYBE 4LF9L 3PO2G 1HZ9A 5IY0A 2R7FA 1K73C 3I4MH 4A3CH 4IFDJ 3BU2A 1CKNA 4YCVA 1U5KA 3T1HL 2UXDQ 4DV2Q 4DR6Q 3K81C 1HR0L 3G4SA 4LF7Q 1VQMA 1EFWA 2UXCL 5C44H 1PH4A 1GKHA 4A3KG 3NBHB 1PH2A 1K3RA 1X55A 1IBML 4J15A 1KHIA 1PA6A 2B29A 2PQAA 2YTVA 5LMNL 1N36L 5BR8Q 1KD1C 1IBLL 4DR7L 1XNRQ 3Q8DA 1Q1EA 1UEBA 1VQGA 2AMCB 2JEAI 3HOUH 1N33Q 1YNXA 4JI5L 5M5XH 1HJPA 1OXTA 3CC7A 3HOWH 4HJ5A 4JI2L 1XMQQ 4YHHL 4GS3A 1SMXA 3CCVA 2R7ZH 3L0OA 1VQIA 1E7ZA 4AYBG 4DR4Q 5C0XI 1OTCA 4UY8C 3S24A 2NN6G 3LGJA 2OTLA 4JI7Q 4LF5L 4KHZA 1EQQA 5JJKA 4H02A 3G6EA 1FGUA 4C3IH 1UE5A 2DUDA 1GD7A 4JI1L 4GLXA 2NVXH 3A0JA 4ME3A 3RZOH 1RIPA 1I6HH 3OTOQ 1DGSA 4DR4L 2LXKA 4X6AH 2VZAA 2E2IH 4JOIC 5IYCH 2WAQG 1KC8C 4UPAA 1Y1VG 1YJ9A 3EN2A 1HNXQ 4LUOA 4BA2I 4P72A 2ZM6L 1KRSA 1KL9A 1PH8A 4DV4Q 2E2JH 1E22A 4DR1L 2HHHL 2VW9A 1G291 4B3MQ 5C3EG 1C9OA 1PVOA 4PMWA 3HOVH 4LW1A 3CXCA 1N8RC 4YWKA 4LF6L 1HZAA 2UU9L 4DK3C 2N49A 4JYAQ 2E2HH 4BA1I 2D0PA 2Z0SA 3L2PA 1XMOQ 3IRBA 1VQ8A 1AH9A 1NMGA 1TWCH 1BBWA 3E9IA 4GLAC 4Y7NH 1ASZA 1JJGA 1X6OA 4R4TA 1MKHA 4UP8A 4DK6C 4YY3Q 4IOCA 1CKOA 1Q12A 1PH5A 3S1RH 4JCVE 3SGIA 2XTIA 3DM3A 3GTLH 1IYJB 3S17H 2K5HA 1J5EQ 3ICEA 3MEFA 5LMNW 4HIMA 2ATWA 1MIUA 3E9HA 3KF6B 1R9TH 1PH1A 2JA5G 1UE6A 3CPWA 4UP9A 4A3MH 1QVFA 1P16A 3HOXG 1Q1BA 4HIOA 4LFBL 5M3MH 1VQ4A 2B3GA 2GN5A 4X66Q 4HJ7A 3AFQA 3CC2A 2I5LX 1EUJA 4POGA 1FJGQ 3S1MH 3J80c 4A3KH 3CQZH 4IPGA 3CD6A 4QIWE 4JBJA 5M3FH 1QZGA 2CWPA 5GADC 2ES2A 4YWLA 2Q2UA 2VQEL 1KRTA 3M7NA 2RHQB 1KXLA 4LF7L 1TWAH 4HJAA 4BBSH 3S2DH 3UE1A 1OXSC 1WYDA 1X54A 1JJ2A 4DUZQ 2OCEA 2JA5H 4A3DG 2LSSA 4JI7L 4GOPA 2YTXA 5J3BA 4A93G 3PGZA 5BR8L 4JI0Q 1YHBA 4JI6L 4K0KL 3PCOB 1OXVA 3CAMA 1NE3A 3K8AA 4R4IA 5FJ8H 4X64L 4GOPC 4A3IG 4X62Q 2HT1A 5M3FG 4DUZL 4LUZA 4IPCA 3J7ZC 1NTGA 4LFAL 4JI2Q 3RR5A 2KHJA 4DR3L 4JI8L 4A3FH 1Q7YC 2ID0A 3CCQA 1HNWQ 1YVCA 4RG1A 3NEMA 1YITA 3UE0A 1HZCA 2KHIA 3AFPA 1BBUA 1UE1A 4JI4L 1GM5A 3W1BA 4PZ8A 3GTOH 5IYDG 1Q82C 1VQBA 4NXMQ 4C3HH 2ASBA 1AE2A 3OYYA 3PUZA 4HJ9A 4LFCQ 3UDGA 1W3SA 2R92G 3CCJA 5C4XG 1YBYA 3TS2A 2PMZE 4OXPA 1CKMA 4A3FG 1PYSB 2UUAQ 3TS0A 1LUZA 2ALYB 2Q2IA 3KYHC 4IFDI 4A75A 1I94Q 1Q81C 2CCZA 3F2BA 1N34Q 4OWWB 1XNQL 4PZ6A 3ULLA 1FL0A 1SN8A 1SR3A 3W5OA 1A62A 1HR0W 1P8LA 2K5NA 3J81i 1VS0A 3K80C 2WP8J 4HJ8A 4C2MH 2E5LQ 4A3BH 4DR2Q 2BA1A 2QEXA 1XTDA 1B70B 3ULPA 1QVCA 2MO1A 4P73A 4AIMA 1IZ6A 4DV3L 5E7NA 4A3EG 1G51A 4NB3A 4LF9Q 3B6YA 2NVQH 4B3TL 2E8GA 2XGTA 3CPFA 2NN6I 3PV0A 4YWMA 1CSPA 1YIJA 1XPRA 1PH6A 4DV5L 1W2BA 2B63G 1E24A 1EWIA 2BH8A 2I5HA 4A3CG 3JC66 4BY7H 1MJCA 3PSIA 3S16H 1KAWA 4JOIA 3GTJH 2Y0SE 3STBC 1PH7A 1VQ9A 3M3YH 4X66L 3J7A5 1J5EL 1L1OB 1LM0A 2D0OA 4GN5A 4P74A 4DR5Q 1PHJA 1FJGL 3T1HQ 1Q86C 3RN5A 3PO3H 5FLMG 4QL5A 5JEAJ 2Y0SG 3HOWG 1OXUA 1X3EA 4JBMA 2CFMA 1VQHA 1PV4A 3HOZG 3KOJA 1CKNB 2VNUD 1E1OA 1VQAA 2N3SA 4HIKA 2GVAA 2JA8G 3KF8B 3CW2C 4MZ9A 3JAMi 1VQPA 1VQ7A 4DR3Q 1WI5A 5JEAG 2F3IA 3KF6A 3ULJA 2UXCQ 1NBWA 2PI2A 1T9HA 1Y14B 1L0WA 4QGUA 4LF5Q 2UUCQ 2HIVA 1K8GA 1EQRA 1HH2P 2VL6A 5IP7H 1E3PA 4JI6Q 5IYBG 5C0XJ 3GTMH 4R4QA 2KBNA 1U0LA 2N78A 1EIYB 3OW2A 3EIVA 4LFAQ 1K0RA 2K52A 4UP7A 4DAYB 1QVGA 4JI3L 1GO3E 3KDFB 4LFCL 4GNXB 4JI5Q 3U4VA 2VUMH 4KHPQ 4JI0L 2JA8H 5DLQE 1WCMG 5IP7G 4XTCS 5IYCG 4GNXC 4OO1G 3TEHB 4JV5L 3H0GG 4LF8Q 3I4NG 2KCTA 4JI4Q 4BXXH 1A63A 1D8LA 1EYGA 2UXBL 5IYDH 2N8NA 1QUQB 3KLWA 4LF4L 1XNQQ 2CKZB 2OQ0A 4OWTB 3PUYA 5M5YH 3PUWA 4DAMA 1SFOH 3PUXA 3RLFA 2K5VA 4IPDA 3CMAA 2ZM6Q 3KFUA 1VQNA 1JE5A 5LMUL 2UXBQ 1SROA 2IHEA 2RCNA 3MXNB 1NJIC 2R7DA 3PIPA 2C35B 5C4JH 3F2DA 3S1QH 3ERSX 4YY3L 3FKIH 5GQOA 3TRZA 4FDBA 1YJNA 3HOUG 4LF6Q 4DUYQ 1JMCA 1PFSA 5K36G 1V1QA 3W1GA 3RZDH 2HHHQ 3CMEA 3I56A 4A3BG 2R93H 3OTOL 3D31A 3HKZE 3CCMA 1B8AA 4NXNQ 4GKJQ 2VQFQ 3HFZB 3RLOA 5C0XG 2K50A 2A19A 2AWOA 1BKBA 4QY7A 1XJVA 4X65Q 3M85A 4DUYL 4A3GH 2BA0A 3GTKH 4A4IA 2UUBQ 4QJFA 2PI2E 4B3RQ 4C3JH 1J6QA 2E5LL 3CCRA 2YTYA 3GTGH 4A3JG 3PO2H 2VQFL 3D0FA 4OX9Q 3S2HH 3T1YQ 2FXQA 1Q8KA 3BZKA 1IBMQ 1WJJA 4BY7G 2VY3A 4P71A 1N32Q 1OXXK 3HOXH 4L5SA 2EIFA 4IPHA 3H0GH 4DV5Q 4A3LG 4LFBQ 3GDEA 1E1TA 1TWGH 3EBEA 1LYLA 4BBRG 1XPUA 2K4KA 3KJOA 1L2FA 1N32L 1X3FA 1D7QA 2JA6H 2QGQA 3RN2A 4IFDG 1NY4A 5JJIA 5HY6A 2Z6KA 1Y1VH 4JG2A 2RF4A 3K7UC 4DR5L 1X56A 2NZHA 4GKKQ 4DV2L 1A0IA 4JI8Q 5IYBH 3M4OH 4JBWA 1XPOA 5LMNQ 1N36Q 3HOYG 3M4QA 1SRUA 3TQYA 1N33L 2IT1A 4IJHA 4JBKA 1SE8A 3UDXA 3DLLA 1GVPA 3CF5A 4AQYQ 1HNZL 4A3DH 5C4XH 3STBD 3AQQA 4X64Q 3I55A 4NPSA 3F8TA 2GVBA 3UDFA 2UUCL 3G48A 2VS1A 2JA7G 4EX5A 3BZCA 1CSQA 2WFWA 4IJLA 4MNOA 4JC0A 1YJWA 4DR1Q 2OWOA 2I0QA 4PG3A 4AQYL 1HNZQ 1JJCB 4R4CA 2QA4A 2WB1E 1RL2A 1VCIA 3GTPH 2PQAB 4LF4Q 4LNQA 1G6PA 2A1AA 4MTNA 4YCWA 5GAGC 1XMOL 1VQ6A 1UWVA 1M1KC 1A8VA 2B63H 4A3MG 1VQJA 5AJ3Q 4X62L 2EQSA 1YHAA 3H3VI 4GKJL 4PZ7A 2ZTDA 2R7ZG 1ASYA 2YV5A 1X3GA 4GNXA 2ZTEA 4O0AA 5FLXc 2KENA 4A3EH 2JA7H 1TWFH 2JJQA 4L5QA 4A93H 3ER0A 2JEBI 4DV6L 3S1NH 2R92H 4B3TQ 4JI1Q 4ALPA 4DV0L 1TWHH 2IX0A 4LWCA 5IWAL 3I4OA 5ELOA 2AKWB 1N34L 3T1YL 2AHOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELN A;  4GOP B;  2JE6 I;  1I50 H;  4DV6 Q;  3E0E A;  5HGQ A;  4QQB X;  5C44 G;  3A74 A;  1B7Y B;  3F2C A;  4XIG S;  1I5F A;  1X65 A;  4DV0 Q;  3H15 A;  3U58 A;  1VQK A;  4B3S L;  1K83 H;  2IX1 A;  1EIF A;  3A5Z B;  1H95 A;  4DV7 L;  5M3M G;  4DV3 Q;  5GRO A;  2LXJ A;  3U50 C;  1CUK A;  5C3E H;  3CCU A;  4AH6 A;  4DV4 L;  3U4Z A;  3J80 i;  2PNH A;  4DR6 L;  1K9M C;  4GLV B;  3S15 H;  2EXD A;  3GTQ H;  4DR2 L;  4KI0 A;  1MJE A;  4TQU S;  3K7A H;  1VQD A;  3GD7 A;  4A76 A;  2VQE Q;  3KJP A;  3VDY A;  2Q2H A;  3BJU A;  3CP0 A;  2NVY H;  3FHW A;  3CCL A;  1PYB A;  2VUM G;  3HOZ H;  2KCM A;  1HR0 Q;  4OON A;  2DGY A;  4HID A;  1SLJ A;  1L1O C;  1VQC A;  4L5R C;  3NEN A;  4DR7 Q;  2WB1 G;  1HNW L;  3CCE A;  4JI3 Q;  3I7F A;  5GAE C;  4TVA B;  5FJ8 G;  4IO9 A;  4A3I H;  2A8V A;  3PF5 A;  3PF4 A;  3PO3 G;  3J81 c;  3HOY H;  2CQO A;  3PUV A;  1XMQ L;  5IE8 A;  2K14 A;  1IBL Q;  3G71 A;  4R1J A;  3HKS A;  2AWN A;  1YHQ A;  4GN4 B;  1VQO A;  4NXM L;  3H3V H;  4JV5 Q;  4A3J H;  3ZJY C;  3A5U A;  1XNR L;  4KLK A;  1FVI A;  2UXD L;  1JT8 A;  4KHP L;  2HQL A;  1KQS A;  3S14 H;  1YZ6 A;  4YCU A;  3RNU A;  4BBS G;  1JB7 A;  4OWX B;  1PH9 A;  1S40 A;  5IP9 G;  2RHS B;  3M9B A;  1WOC A;  1HZB A;  2CWA A;  5M5W H;  2F4V L;  5IT9 c;  2R93 G;  1O7I A;  4DNI A;  2Z6K C;  1QZH A;  1V9P A;  1EOV A;  2IY5 B;  2ZJP A;  1S72 A;  2Q2T A;  5H1S E;  2L15 A;  1Q46 A;  2MFI A;  4RMF A;  3K0X A;  3NEL A;  2YYZ A;  1M90 C;  5JJL A;  1QUQ A;  5EAY A;  1KIX A;  1Z9F A;  2F4V Q;  1C0A A;  2MO0 A;  5IWA Q;  2MQH A;  4YHH Q;  2NVT H;  5LMU Q;  1BVS A;  3TRE A;  4LUV A;  1N9W A;  1VQL A;  1TXY A;  3M4P A;  3PIO A;  3I4M G;  3I4N H;  4A3G G;  4BXX G;  1WFQ A;  4R4O A;  2NZO A;  1NMF A;  3UDI A;  1AE3 A;  5IP9 H;  2ZJR A;  2H5X A;  2K75 A;  4Y52 H;  4WJ3 M;  4DPG A;  1UE7 A;  1WCM H;  1IBK L;  2F52 A;  2ZTC A;  1VQF A;  2UUB L;  4B3R L;  4P75 A;  4EQ5 A;  3I2Z A;  5AJ3 L;  2HIX A;  4A3L H;  4LF8 L;  4B3M L;  3WWV A;  1I94 L;  1S3O A;  1VQE A;  4K0K Q;  1V43 A;  3HOV G;  3HKZ G;  2I5M X;  3FKI G;  2JA9 A;  2R6G A;  2WAQ E;  3L7Z C;  4POF A;  3GO5 A;  4X65 L;  5GAH C;  1YI2 A;  1IBK Q;  3CCS A;  4BY1 H;  2OTJ A;  4WJ4 A;  2UUA L;  1IXR A;  2D62 A;  1LTL A;  1HNX L;  2ZJQ A;  4DKA C;  4L5T A;  1C7Y A;  4OO1 I;  1I3Q H;  2JQO A;  3AYH B;  4B3S Q;  1YEZ A;  3AEV A;  4IOA A;  4OX9 L;  3KDF A;  1VQ5 A;  2V1C C;  4DV1 L;  2BH2 A;  2JK8 A;  2JA6 G;  1Y1W G;  4BY1 G;  4DV7 Q;  4BBR H;  3F1Z A;  3JAM c;  1K8A C;  4APV A;  3FP9 A;  1IL2 A;  4GN3 B;  2IHF A;  4O2D A;  2UU9 Q;  4JYA L;  3RLN A;  2OQK A;  1X9N A;  5FLM H;  1PH3 A;  2MNA A;  4GKK L;  3J81 j;  2YU9 H;  1L1O A;  4DV1 Q;  1Z47 A;  1Y1W H;  3CC4 A;  4NXN L;  4AYB E;  4LF9 L;  3PO2 G;  1HZ9 A;  5IY0 A;  2R7F A;  1K73 C;  3I4M H;  4A3C H;  4IFD J;  3BU2 A;  1CKN A;  4YCV A;  1U5K A;  3T1H L;  2UXD Q;  4DV2 Q;  4DR6 Q;  3K81 C;  1HR0 L;  3G4S A;  4LF7 Q;  1VQM A;  1EFW A;  2UXC L;  5C44 H;  1PH4 A;  1GKH A;  4A3K G;  3NBH B;  1PH2 A;  1K3R A;  1X55 A;  1IBM L;  4J15 A;  1KHI A;  1PA6 A;  2B29 A;  2PQA A;  2YTV A;  5LMN L;  1N36 L;  5BR8 Q;  1KD1 C;  1IBL L;  4DR7 L;  1XNR Q;  3Q8D A;  1Q1E A;  1UEB A;  1VQG A;  2AMC B;  2JEA I;  3HOU H;  1N33 Q;  1YNX A;  4JI5 L;  5M5X H;  1HJP A;  1OXT A;  3CC7 A;  3HOW H;  4HJ5 A;  4JI2 L;  1XMQ Q;  4YHH L;  4GS3 A;  1SMX A;  3CCV A;  2R7Z H;  3L0O A;  1VQI A;  1E7Z A;  4AYB G;  4DR4 Q;  5C0X I;  1OTC A;  4UY8 C;  3S24 A;  2NN6 G;  3LGJ A;  2OTL A;  4JI7 Q;  4LF5 L;  4KHZ A;  1EQQ A;  5JJK A;  4H02 A;  3G6E A;  1FGU A;  4C3I H;  1UE5 A;  2DUD A;  1GD7 A;  4JI1 L;  4GLX A;  2NVX H;  3A0J A;  4ME3 A;  3RZO H;  1RIP A;  1I6H H;  3OTO Q;  1DGS A;  4DR4 L;  2LXK A;  4X6A H;  2VZA A;  2E2I H;  4JOI C;  5IYC H;  2WAQ G;  1KC8 C;  4UPA A;  1Y1V G;  1YJ9 A;  3EN2 A;  1HNX Q;  4LUO A;  4BA2 I;  4P72 A;  2ZM6 L;  1KRS A;  1KL9 A;  1PH8 A;  4DV4 Q;  2E2J H;  1E22 A;  4DR1 L;  2HHH L;  2VW9 A;  1G29 1;  4B3M Q;  5C3E G;  1C9O A;  1PVO A;  4PMW A;  3HOV H;  4LW1 A;  3CXC A;  1N8R C;  4YWK A;  4LF6 L;  1HZA A;  2UU9 L;  4DK3 C;  2N49 A;  4JYA Q;  2E2H H;  4BA1 I;  2D0P A;  2Z0S A;  3L2P A;  1XMO Q;  3IRB A;  1VQ8 A;  1AH9 A;  1NMG A;  1TWC H;  1BBW A;  3E9I A;  4GLA C;  4Y7N H;  1ASZ A;  1JJG A;  1X6O A;  4R4T A;  1MKH A;  4UP8 A;  4DK6 C;  4YY3 Q;  4IOC A;  1CKO A;  1Q12 A;  1PH5 A;  3S1R H;  4JCV E;  3SGI A;  2XTI A;  3DM3 A;  3GTL H;  1IYJ B;  3S17 H;  2K5H A;  1J5E Q;  3ICE A;  3MEF A;  5LMN W;  4HIM A;  2ATW A;  1MIU A;  3E9H A;  3KF6 B;  1R9T H;  1PH1 A;  2JA5 G;  1UE6 A;  3CPW A;  4UP9 A;  4A3M H;  1QVF A;  1P16 A;  3HOX G;  1Q1B A;  4HIO A;  4LFB L;  5M3M H;  1VQ4 A;  2B3G A;  2GN5 A;  4X66 Q;  4HJ7 A;  3AFQ A;  3CC2 A;  2I5L X;  1EUJ A;  4POG A;  1FJG Q;  3S1M H;  3J80 c;  4A3K H;  3CQZ H;  4IPG A;  3CD6 A;  4QIW E;  4JBJ A;  5M3F H;  1QZG A;  2CWP A;  5GAD C;  2ES2 A;  4YWL A;  2Q2U A;  2VQE L;  1KRT A;  3M7N A;  2RHQ B;  1KXL A;  4LF7 L;  1TWA H;  4HJA A;  4BBS H;  3S2D H;  3UE1 A;  1OXS C;  1WYD A;  1X54 A;  1JJ2 A;  4DUZ Q;  2OCE A;  2JA5 H;  4A3D G;  2LSS A;  4JI7 L;  4GOP A;  2YTX A;  5J3B A;  4A93 G;  3PGZ A;  5BR8 L;  4JI0 Q;  1YHB A;  4JI6 L;  4K0K L;  3PCO B;  1OXV A;  3CAM A;  1NE3 A;  3K8A A;  4R4I A;  5FJ8 H;  4X64 L;  4GOP C;  4A3I G;  4X62 Q;  2HT1 A;  5M3F G;  4DUZ L;  4LUZ A;  4IPC A;  3J7Z C;  1NTG A;  4LFA L;  4JI2 Q;  3RR5 A;  2KHJ A;  4DR3 L;  4JI8 L;  4A3F H;  1Q7Y C;  2ID0 A;  3CCQ A;  1HNW Q;  1YVC A;  4RG1 A;  3NEM A;  1YIT A;  3UE0 A;  1HZC A;  2KHI A;  3AFP A;  1BBU A;  1UE1 A;  4JI4 L;  1GM5 A;  3W1B A;  4PZ8 A;  3GTO H;  5IYD G;  1Q82 C;  1VQB A;  4NXM Q;  4C3H H;  2ASB A;  1AE2 A;  3OYY A;  3PUZ A;  4HJ9 A;  4LFC Q;  3UDG A;  1W3S A;  2R92 G;  3CCJ A;  5C4X G;  1YBY A;  3TS2 A;  2PMZ E;  4OXP A;  1CKM A;  4A3F G;  1PYS B;  2UUA Q;  3TS0 A;  1LUZ A;  2ALY B;  2Q2I A;  3KYH C;  4IFD I;  4A75 A;  1I94 Q;  1Q81 C;  2CCZ A;  3F2B A;  1N34 Q;  4OWW B;  1XNQ L;  4PZ6 A;  3ULL A;  1FL0 A;  1SN8 A;  1SR3 A;  3W5O A;  1A62 A;  1HR0 W;  1P8L A;  2K5N A;  3J81 i;  1VS0 A;  3K80 C;  2WP8 J;  4HJ8 A;  4C2M H;  2E5L Q;  4A3B H;  4DR2 Q;  2BA1 A;  2QEX A;  1XTD A;  1B70 B;  3ULP A;  1QVC A;  2MO1 A;  4P73 A;  4AIM A;  1IZ6 A;  4DV3 L;  5E7N A;  4A3E G;  1G51 A;  4NB3 A;  4LF9 Q;  3B6Y A;  2NVQ H;  4B3T L;  2E8G A;  2XGT A;  3CPF A;  2NN6 I;  3PV0 A;  4YWM A;  1CSP A;  1YIJ A;  1XPR A;  1PH6 A;  4DV5 L;  1W2B A;  2B63 G;  1E24 A;  1EWI A;  2BH8 A;  2I5H A;  4A3C G;  3JC6 6;  4BY7 H;  1MJC A;  3PSI A;  3S16 H;  1KAW A;  4JOI A;  3GTJ H;  2Y0S E;  3STB C;  1PH7 A;  1VQ9 A;  3M3Y H;  4X66 L;  3J7A 5;  1J5E L;  1L1O B;  1LM0 A;  2D0O A;  4GN5 A;  4P74 A;  4DR5 Q;  1PHJ A;  1FJG L;  3T1H Q;  1Q86 C;  3RN5 A;  3PO3 H;  5FLM G;  4QL5 A;  5JEA J;  2Y0S G;  3HOW G;  1OXU A;  1X3E A;  4JBM A;  2CFM A;  1VQH A;  1PV4 A;  3HOZ G;  3KOJ A;  1CKN B;  2VNU D;  1E1O A;  1VQA A;  2N3S A;  4HIK A;  2GVA A;  2JA8 G;  3KF8 B;  3CW2 C;  4MZ9 A;  3JAM i;  1VQP A;  1VQ7 A;  4DR3 Q;  1WI5 A;  5JEA G;  2F3I A;  3KF6 A;  3ULJ A;  2UXC Q;  1NBW A;  2PI2 A;  1T9H A;  1Y14 B;  1L0W A;  4QGU A;  4LF5 Q;  2UUC Q;  2HIV A;  1K8G A;  1EQR A;  1HH2 P;  2VL6 A;  5IP7 H;  1E3P A;  4JI6 Q;  5IYB G;  5C0X J;  3GTM H;  4R4Q A;  2KBN A;  1U0L A;  2N78 A;  1EIY B;  3OW2 A;  3EIV A;  4LFA Q;  1K0R A;  2K52 A;  4UP7 A;  4DAY B;  1QVG A;  4JI3 L;  1GO3 E;  3KDF B;  4LFC L;  4GNX B;  4JI5 Q;  3U4V A;  2VUM H;  4KHP Q;  4JI0 L;  2JA8 H;  5DLQ E;  1WCM G;  5IP7 G;  4XTC S;  5IYC G;  4GNX C;  4OO1 G;  3TEH B;  4JV5 L;  3H0G G;  4LF8 Q;  3I4N G;  2KCT A;  4JI4 Q;  4BXX H;  1A63 A;  1D8L A;  1EYG A;  2UXB L;  5IYD H;  2N8N A;  1QUQ B;  3KLW A;  4LF4 L;  1XNQ Q;  2CKZ B;  2OQ0 A;  4OWT B;  3PUY A;  5M5Y H;  3PUW A;  4DAM A;  1SFO H;  3PUX A;  3RLF A;  2K5V A;  4IPD A;  3CMA A;  2ZM6 Q;  3KFU A;  1VQN A;  1JE5 A;  5LMU L;  2UXB Q;  1SRO A;  2IHE A;  2RCN A;  3MXN B;  1NJI C;  2R7D A;  3PIP A;  2C35 B;  5C4J H;  3F2D A;  3S1Q H;  3ERS X;  4YY3 L;  3FKI H;  5GQO A;  3TRZ A;  4FDB A;  1YJN A;  3HOU G;  4LF6 Q;  4DUY Q;  1JMC A;  1PFS A;  5K36 G;  1V1Q A;  3W1G A;  3RZD H;  2HHH Q;  3CME A;  3I56 A;  4A3B G;  2R93 H;  3OTO L;  3D31 A;  3HKZ E;  3CCM A;  1B8A A;  4NXN Q;  4GKJ Q;  2VQF Q;  3HFZ B;  3RLO A;  5C0X G;  2K50 A;  2A19 A;  2AWO A;  1BKB A;  4QY7 A;  1XJV A;  4X65 Q;  3M85 A;  4DUY L;  4A3G H;  2BA0 A;  3GTK H;  4A4I A;  2UUB Q;  4QJF A;  2PI2 E;  4B3R Q;  4C3J H;  1J6Q A;  2E5L L;  3CCR A;  2YTY A;  3GTG H;  4A3J G;  3PO2 H;  2VQF L;  3D0F A;  4OX9 Q;  3S2H H;  3T1Y Q;  2FXQ A;  1Q8K A;  3BZK A;  1IBM Q;  1WJJ A;  4BY7 G;  2VY3 A;  4P71 A;  1N32 Q;  1OXX K;  3HOX H;  4L5S A;  2EIF A;  4IPH A;  3H0G H;  4DV5 Q;  4A3L G;  4LFB Q;  3GDE A;  1E1T A;  1TWG H;  3EBE A;  1LYL A;  4BBR G;  1XPU A;  2K4K A;  3KJO A;  1L2F A;  1N32 L;  1X3F A;  1D7Q A;  2JA6 H;  2QGQ A;  3RN2 A;  4IFD G;  1NY4 A;  5JJI A;  5HY6 A;  2Z6K A;  1Y1V H;  4JG2 A;  2RF4 A;  3K7U C;  4DR5 L;  1X56 A;  2NZH A;  4GKK Q;  4DV2 L;  1A0I A;  4JI8 Q;  5IYB H;  3M4O H;  4JBW A;  1XPO A;  5LMN Q;  1N36 Q;  3HOY G;  3M4Q A;  1SRU A;  3TQY A;  1N33 L;  2IT1 A;  4IJH A;  4JBK A;  1SE8 A;  3UDX A;  3DLL A;  1GVP A;  3CF5 A;  4AQY Q;  1HNZ L;  4A3D H;  5C4X H;  3STB D;  3AQQ A;  4X64 Q;  3I55 A;  4NPS A;  3F8T A;  2GVB A;  3UDF A;  2UUC L;  3G48 A;  2VS1 A;  2JA7 G;  4EX5 A;  3BZC A;  1CSQ A;  2WFW A;  4IJL A;  4MNO A;  4JC0 A;  1YJW A;  4DR1 Q;  2OWO A;  2I0Q A;  4PG3 A;  4AQY L;  1HNZ Q;  1JJC B;  4R4C A;  2QA4 A;  2WB1 E;  1RL2 A;  1VCI A;  3GTP H;  2PQA B;  4LF4 Q;  4LNQ A;  1G6P A;  2A1A A;  4MTN A;  4YCW A;  5GAG C;  1XMO L;  1VQ6 A;  1UWV A;  1M1K C;  1A8V A;  2B63 H;  4A3M G;  1VQJ A;  5AJ3 Q;  4X62 L;  2EQS A;  1YHA A;  3H3V I;  4GKJ L;  4PZ7 A;  2ZTD A;  2R7Z G;  1ASY A;  2YV5 A;  1X3G A;  4GNX A;  2ZTE A;  4O0A A;  5FLX c;  2KEN A;  4A3E H;  2JA7 H;  1TWF H;  2JJQ A;  4L5Q A;  4A93 H;  3ER0 A;  2JEB I;  4DV6 L;  3S1N H;  2R92 H;  4B3T Q;  4JI1 Q;  4ALP A;  4DV0 L;  1TWH H;  2IX0 A;  4LWC A;  5IWA L;  3I4O A;  5ELO A;  2AKW B;  1N34 L;  3T1Y L;  2AHO B; 
#chains in the Genus database with same CATH topology
 3MC0 B;  1EEI D;  4QQB X;  1I50 H;  4F4X A;  1B7Y B;  5CC4 A;  1I4P A;  4DV0 Q;  2A69 D;  1ROD A;  1EIF A;  2ZXP A;  3BA9 A;  1H95 A;  5KKN B;  4K2L A;  1Q90 A;  1K3B C;  5M3M G;  4DV3 Q;  2V4Q A;  4BBS B;  1KDA A;  1CUK A;  2EVB A;  3TP6 A;  3U4Z A;  3J80 i;  3BVG A;  3GV6 A;  4X3S A;  2PNH A;  1D1I A;  2R7K A;  4DR2 L;  1MJE A;  5IT9 W;  4TQU S;  3BDL A;  2VQE Q;  3VDY A;  2CW8 A;  4DAY A;  3V6K A;  1MZB A;  5EWF A;  3CCL A;  5DG8 A;  2KCM A;  4OON A;  5KYL A;  2DGY A;  2E2H B;  5KFZ A;  1L1O C;  1HNW L;  2WB1 G;  3Q8R B;  3CCE A;  2UU9 H;  2A6H C;  3I7F A;  5EZY F;  4A3I H;  4IO9 A;  2A8V A;  5CV7 A;  1EU3 A;  3QO2 A;  1V1P B;  3J81 c;  5T14 A;  2W9C A;  4XYQ A;  3G71 A;  1YHQ A;  1M0W A;  2AGO A;  4B3S H;  1XNR L;  1LAB A;  3MWY W;  4KD3 A;  3A56 A;  3RNU A;  4YCU A;  4FF2 A;  4OWX B;  4OL7 A;  1TU2 B;  3ND8 A;  3M9B A;  5CB4 F;  1WOC A;  1TWA A;  2PYK A;  1HZB A;  3T53 B;  1O7I A;  1AZQ A;  5KFR A;  1EOV A;  5H1S E;  4C5B A;  1IBL H;  3K0X A;  4HED A;  5JJL A;  3S2D B;  3BDC A;  2RDH A;  5KG1 A;  3OSO A;  4YJ2 F;  3GV8 B;  1N33 H;  5EPJ A;  3J7A V;  1VQL A;  3M4P A;  5T1G A;  2PCF B;  3I4M G;  4BXX G;  1B04 A;  1WFQ A;  4FYD A;  1E2W A;  1D5M C;  3MA2 B;  2K75 A;  1RJP A;  3CQZ B;  4IRC A;  3R5F A;  5D1O A;  4Q8F A;  2F3W A;  2UUB L;  4B3R L;  4P75 A;  1Z2N X;  4UCV A;  3I2Z A;  5AJ3 L;  5KFY A;  4LF8 L;  4OHJ A;  3VPD A;  1XWE A;  2R6G A;  4C3I G;  4RCN A;  1QCB D;  2WII B;  2ZDH A;  4WJ4 A;  1ULZ A;  1VF7 A;  1YNN C;  1SMY D;  1HNX L;  4R8U A;  4J9R A;  2KJX A;  2UVU A;  2JQO A;  2JXM B;  5IOC A;  3AYH B;  4B3S Q;  1YEZ A;  2R7Z B;  5F9N A;  3PW2 A;  2D9U A;  4OX9 L;  1BO0 A;  1V1O A;  4ZAI A;  1Y1W G;  2OF1 A;  3JAM c;  4APV A;  3FP9 A;  4O2D A;  1K0S A;  2PZU A;  2UU9 Q;  5J2T F;  5KT2 A;  2FIN B;  4UCS A;  1FNU A;  5FLM H;  1O7Z A;  2MNA A;  4ME5 A;  5JVH 3;  1PYW D;  3LWU A;  1DOM A;  3OMG A;  1ZKO A;  4UFZ A;  3M9O B;  2FFK B;  4NXN L;  4RAZ A;  2AQ2 B;  2DJF C;  3BJY A;  5IGB A;  3VYU A;  5IY0 A;  1Q3L A;  1H9J A;  3VR5 A;  1UC9 A;  5KNB A;  2R7N A;  1HR0 L;  3G4S A;  5KFF A;  3MR2 A;  1BNZ A;  1ENF A;  2WKC A;  1EFW A;  2UXC L;  2E2J B;  1PH4 A;  4K8I A;  2F0W A;  2B29 A;  2PQA A;  4YBZ B;  2F0U A;  5LMN L;  3I70 A;  4DLK A;  2CQY A;  1PK8 A;  2LKV A;  4YAJ B;  4L63 B;  4EQP A;  1Q1E A;  2YZM A;  1Q8I A;  1YNX A;  5CMD A;  1SFO B;  1OXT A;  5IWA H;  1ZYR C;  2R92 A;  4F88 A;  1SNC A;  4YHH L;  4GS3 A;  4ECW A;  3CCV A;  4CDE C;  4NW2 A;  3S1Q B;  1VAJ A;  3KAL A;  3S24 A;  4M7E A;  4MV8 A;  1EWH A;  4QIW B;  2KCN A;  1U9R A;  2PW7 A;  2AGP A;  4C3I H;  5G3L D;  2DUD A;  3H09 A;  3SVM A;  3SHL A;  3I91 A;  4GLX A;  1PTO B;  2WAC A;  3A0J A;  1B9N A;  3MZ5 A;  4C3H G;  2I07 B;  3P1H A;  4LF8 H;  5C6A A;  2XN9 C;  3HEJ A;  4K8J A;  1Y1V G;  2ZDG A;  4KHP H;  4BWS C;  2JYO A;  2HCI A;  1SYE A;  4S3S A;  1Y8O B;  3LWB A;  1DOK A;  2K01 A;  1STA A;  2IJ0 A;  2HHH L;  2VUM A;  1G29 1;  5LL6 b;  1PVO A;  3MEH A;  1WTV A;  3E3X A;  1SCU B;  3NTI A;  4LW1 A;  4LSX A;  4BA1 I;  1AH9 A;  4FU0 A;  3H0G B;  1BBW A;  4Y7N H;  5LYJ F;  4ODG A;  1SE2 A;  5KYI A;  1X6O A;  4K5V A;  5E4X A;  3T13 A;  4DK6 C;  4IOC A;  1PH5 A;  3DWP A;  5LL6 X;  1Y8P B;  2JN4 A;  1PRT C;  3S17 H;  3RIZ A;  1BF4 A;  1NNX A;  2K5H A;  1J5E Q;  5KFK A;  3ICE A;  1I7L A;  3SK6 A;  5LMN W;  4RFB A;  1V1P A;  5KFJ A;  3KF6 B;  2PMZ A;  3ITP A;  3CPW A;  3M4O B;  1EY8 A;  4A3M H;  1QVF A;  3HOX G;  4YR3 A;  4C56 C;  2B3G A;  2GN5 A;  1WH2 A;  1KBL A;  4POG A;  2I5L X;  1EUJ A;  1QG7 A;  4X3T A;  4RB2 C;  3DXJ C;  4K5X A;  4DAV A;  3EYY A;  4QIW E;  2DIK A;  1BCP C;  1DIK A;  1HTL D;  3GLK A;  5KGU A;  5KFX A;  1WVL A;  4Q0F A;  2K6A A;  4IWY A;  5KFS A;  1KRT A;  5EOY A;  4WFN 3;  2W6Q A;  3GQC A;  5EBC A;  3MFH A;  3HOW B;  4B3T H;  4XT3 B;  2R8G A;  4I4T F;  5FPO A;  3GTQ B;  1FNV A;  4C1N I;  4JI7 L;  4RKL A;  5J3B A;  3GTG B;  3PGZ A;  4JI0 Q;  3SI8 A;  3T5J A;  1LO5 D;  4JI6 L;  2Z4I A;  3CAM A;  1IBL L;  3K8A A;  1BXR A;  2NVY B;  4GOP C;  1TWC A;  2J9G A;  4O3O A;  3FRP B;  4LUZ A;  4O4H F;  4GKJ H;  4LFA L;  2VB3 X;  3RR5 A;  1CZW A;  2MJ8 A;  3LX0 A;  1Q7Y C;  2CH4 W;  3HKZ A;  3RB4 A;  3IFD A;  4Y8V B;  1EYA A;  1IHZ A;  2F0N A;  5FO7 B;  3GTK B;  1HZC A;  2KHI A;  1LTS D;  4ULL A;  3S1N B;  4JI4 L;  4GC6 A;  4HNU A;  2VOB A;  5HV6 A;  1HXY D;  1SBB B;  2KEC A;  3R23 A;  1AE2 A;  3OYY A;  3PUZ A;  5KFV A;  1KDC A;  3UDG A;  1W3S A;  5C1O A;  3K57 A;  5IYZ F;  4ZHQ F;  2C2R A;  2PMZ E;  2XWJ B;  4OXP A;  1SEI A;  1PYS B;  5M5W B;  1UNN C;  1DXM A;  2QK4 A;  3I12 A;  1LUZ A;  2O5I C;  3KYH C;  4J9M A;  4IFD I;  3CQZ A;  2PNR C;  2CCZ A;  2WIN B;  1VMP A;  5J22 A;  2MP1 A;  4RUA A;  3FVQ A;  2CH4 A;  4ECZ A;  1S0N A;  4UAI A;  1A62 A;  1QE6 A;  1E2Z A;  3J81 i;  1ONL A;  2PN1 A;  4C2M H;  2R8I A;  1J9O A;  2E5L Q;  4A3B H;  4GC7 A;  2BA1 A;  2QEX A;  2A68 C;  3FDT A;  4YB8 B;  1KAA A;  1B70 B;  3PW4 A;  5EWE A;  3RJ0 A;  2XC9 A;  4ZUI A;  4RGT A;  2MPM A;  1T36 A;  1BUV T;  1IZ6 A;  4DV1 H;  1IKL A;  2NVQ H;  1HFG A;  2NN6 I;  1YIJ A;  1SEB D;  2W9B A;  4IR1 A;  1K8O A;  3K5H A;  3GIJ A;  3JC6 6;  4BY7 H;  1Z2O X;  4A3I B;  3L3O C;  4I7A A;  1Y8N B;  1KAW A;  4J8Q A;  4JOI A;  2Y0S E;  3STB C;  1PH7 A;  3PR4 A;  4R9W A;  3GIM A;  2TSS A;  4N8F A;  1J5E L;  3Q1K A;  3S15 B;  1LM0 A;  4DR5 Q;  1PHJ A;  2KED A;  4C2M B;  1Q86 C;  3ORQ A;  3NQI A;  3T1H H;  1GGO A;  3KLS X;  4DU9 A;  2HJW A;  1KJJ A;  3RBD A;  1VQH A;  1EZ8 A;  3KOJ A;  1CKN B;  3K58 A;  2VNU D;  1D6E C;  2N3S A;  5CV4 A;  5K2M A;  1PTO D;  3KF8 B;  4QIW A;  1VQP A;  1STY A;  1WI5 A;  2R82 A;  5IT9 E;  1VMC A;  2F3I A;  2BE5 D;  4JYA H;  3E0J A;  1KLG D;  1L0W A;  4KY6 A;  4ZYS A;  1K8G A;  1EQR A;  1HH2 P;  2O4X A;  5C0X J;  2JA5 B;  1EY7 A;  1U0L A;  4YHH H;  2M2L A;  2F4V H;  1K0R A;  2K52 A;  3N41 B;  4JI3 L;  4GNX B;  3QOL A;  1I50 B;  5C3W A;  3UI2 A;  4JI0 L;  5DLQ E;  3TZD A;  3X3N A;  3RB0 A;  3TEH B;  4CDC C;  4C5A A;  1LTI D;  4ECY A;  1I94 H;  3I90 A;  1A63 A;  5ELD A;  1TA8 A;  5IYD H;  2FPG B;  3KLW A;  1XNQ Q;  2FPI B;  2ICE C;  2B2T C;  1ZET A;  4OWT B;  2HVR A;  2CHB D;  2NUC A;  3PUX A;  4IPD A;  1LV9 A;  2FK3 A;  1VQN A;  1RD9 D;  1JE5 A;  3CVZ A;  5BPH A;  1NJI C;  3F2D A;  3ERS X;  1OO9 B;  1CZG A;  3FKI H;  1D1K A;  3TRZ A;  3A7A B;  4DR3 H;  1YJN A;  4EQO A;  3HOU G;  1JMC A;  1I6H B;  1S0O A;  4OGQ C;  1PFS A;  2N55 A;  5K36 G;  1IL8 A;  1U4P A;  1V1Q A;  2DZD A;  2HCC A;  5KFP A;  1SNM A;  1RYR A;  3T56 B;  1HRJ A;  4A3B G;  4JI2 H;  3OTO L;  3K5N A;  3GTL A;  1B8A A;  2VQF Q;  4PMB A;  3JSL A;  1L2Z A;  2K50 A;  4X65 Q;  3M85 A;  2K28 A;  2BCO A;  4DUY L;  4A3G H;  2V9W A;  4A4I A;  1Y1V B;  4QJF A;  1SAP A;  3Q8S B;  2GLT A;  2WAQ B;  5EGT A;  2E5L L;  4YY3 H;  4EFE A;  3FPP A;  3OOC A;  3CCR A;  4A3J G;  4J9S A;  3S2H H;  4C3H B;  2ZT9 C;  4FNF A;  3URY A;  3T1Y Q;  1IBM Q;  1M0T A;  4BY7 G;  4JK1 C;  1UUP A;  4RAY A;  1TAE A;  4O4I F;  4L5S A;  3J81 E;  1SE4 A;  5DG9 A;  3M9M B;  3DEP A;  3GDE A;  1DM0 B;  1TWG H;  2HUG A;  1LYL A;  3EBE A;  4BBR G;  5KFE A;  3KJO A;  1L2F A;  3C2P A;  2JA6 H;  4MTD A;  1KC7 A;  2W6P A;  4U67 3;  4IUP A;  2Z6K A;  4DR5 L;  1X56 A;  2OT2 A;  2NZH A;  2B2T A;  3HB9 A;  5IYB H;  4JBW A;  3HOY G;  1MI2 A;  1WTQ A;  2VUM B;  3M4Q A;  2J7Z A;  1S9F A;  1J8I A;  1K28 A;  2CW0 D;  3TQY A;  4NKL A;  1N33 L;  2FK1 A;  5BPF A;  5CAE B;  5LL6 S;  3GTG A;  4C5C A;  4EYI B;  1GYF A;  1HNZ L;  1F9P A;  4IUN A;  3T5H A;  2EY5 A;  5I6W A;  2JEG A;  1E0B A;  3G48 A;  4KKU A;  4NP5 A;  4BS9 A;  5H80 A;  4B3M H;  3BZC A;  4EYH B;  1STH A;  2Z8L A;  4PG3 A;  4AQY L;  2QA4 A;  1FR3 A;  1VCI A;  2AGQ A;  1S5D D;  5FLX L;  5GAG C;  1XMO L;  1M1K C;  3L4K A;  3RD4 A;  4A3M G;  2VQD A;  2WDT A;  4X62 L;  2EYO A;  3NTH A;  4C3J G;  1HUM A;  1GUT A;  1YHA A;  3DWA A;  3H3V I;  2R7Z G;  4DL5 A;  4HSP A;  4O0A A;  5FLX c;  2MCT A;  1SNQ A;  2JA7 H;  3QR8 A;  4L5Q A;  3KLR A;  2RVL A;  4IZO A;  2R92 H;  4ALP A;  4DV0 L;  4NLG A;  1TY2 A;  4LWC A;  1TWH H;  1ZYR D;  2HD3 A;  3CU7 A;  4C3J B;  5ELO A;  2AKW B;  1N34 L;  1E4E B;  4JV5 H;  2F0L A;  2YYA A;  4C2M A;  4M8A A;  1JB3 A;  5KND A;  4DV6 Q;  5HGQ A;  4QWD A;  1R4Q B;  3F2C A;  3A8I E;  3D6W A;  2O03 A;  4LF9 H;  3A5Z B;  4ZCK A;  2F0J A;  3KF8 A;  5IGG A;  4DV7 L;  4QW8 A;  2ASD A;  2J6S A;  2W9B B;  5KG0 A;  5KNC A;  2IL8 A;  2KEE A;  5E4W C;  4E4T A;  3DUZ A;  2GPW A;  1K9M C;  3S2H B;  4GLV B;  3C46 A;  1GSO A;  3N44 B;  3K7A H;  1VQD A;  3GD7 A;  4KY7 A;  4A76 A;  3I8Z A;  2JEI A;  3KJP A;  2Q2H A;  3ERO A;  4IUT A;  3MAQ A;  1Z2P X;  1AFP A;  2VUM G;  2ASL A;  2P5Z X;  4HID A;  4L5R C;  5KFN A;  3NEN A;  2EXZ A;  4JI3 Q;  4L8J A;  3HXL A;  2IWH A;  5IGD A;  5FLX W;  3PF4 A;  4A2B A;  3RGX A;  3GTJ A;  5FD5 A;  2CQO A;  3PUV A;  1XMQ L;  3VYS A;  3JZI A;  4KD4 A;  2AUK A;  1S03 G;  1GLV A;  1WTP A;  1ESF A;  4KLK A;  1B3Q A;  5I2Y A;  1WTO A;  1JT8 A;  2HQL A;  1KQS A;  1UEA B;  2KSW A;  3M4Y A;  1PH9 A;  3PO2 B;  4ZI7 F;  1TVX A;  3RV3 A;  2SNS A;  4J6H A;  5IP9 G;  5I4D A;  4EG0 A;  4HMI A;  4X62 H;  1L0Y B;  4JI8 H;  2Z6K C;  3RMH A;  1WD1 A;  5KFG A;  2IY5 B;  1S72 A;  2Q2T A;  2L15 A;  3Q6S A;  3SDZ A;  2DWC A;  3MJF A;  1Q46 A;  2AUJ D;  2NWG A;  4MV9 A;  4NXM H;  2IPK D;  2YYZ A;  2RDI A;  4Q44 A;  2F4V Q;  3D4R A;  4YHH Q;  1STN A;  4RB1 A;  4A3B B;  3TIG A;  1JWU D;  2K33 A;  5LMU H;  1TXY A;  3KUP A;  3TZU A;  1TR5 A;  4QUF A;  3PIO A;  3BVZ A;  3I4N H;  1Y1V A;  1ICW A;  2W71 A;  5EKK A;  4K5W A;  3UDI A;  4EGJ A;  3MHB A;  4I50 F;  5C4J B;  3A8K E;  4C3I B;  3S1M B;  4MAM A;  2QYZ A;  4DPG A;  4KJO A;  4FM9 A;  1EIG A;  3HP3 A;  4KN4 C;  5IGF A;  3Q22 A;  4EQ5 A;  3PIO 3;  1DZ1 A;  1AN8 A;  3PW0 A;  2E74 C;  5KFU A;  4B3M L;  5KRU A;  2JEJ A;  2BQ3 A;  4E6I A;  5NUC A;  1S3O A;  4K0K Q;  4DL6 A;  2EOT A;  3L7Z C;  2DJG C;  3P20 A;  4X65 L;  1YI2 A;  5ELB A;  3CCS A;  1W93 A;  2D62 A;  3GTL B;  2R3Z A;  2ZJQ A;  4DKA C;  4DR5 H;  2W57 A;  5ISR A;  2PBZ A;  3Q24 A;  2RKS A;  4IOA A;  3I4N B;  2XCP A;  1VQ5 A;  2BH2 A;  2JA6 G;  4NDX A;  1RK6 A;  4BBR H;  3F1Z A;  1K8A C;  2IHF A;  4DV5 H;  1B33 N;  1SJE D;  3O13 A;  2XCA A;  2YU9 H;  3TP5 A;  3NK9 A;  4DV1 Q;  1Y1W H;  3V96 A;  3GIK A;  2A6H D;  3ONA B;  5L37 A;  4X3U A;  3DEO A;  1HZ9 A;  4ETS A;  3OUZ A;  2R7F A;  4F4W A;  3I4M H;  4A3C H;  1JKJ B;  2UXD Q;  4DFA A;  5C5J A;  2FMC A;  4CGY B;  2DN8 A;  5C44 H;  3J80 L;  1UNS A;  3NBH B;  3S9W A;  3R3O A;  4J15 A;  2NVQ B;  1AUV A;  3N40 P;  2RGV A;  4JVZ A;  4V0B A;  1N36 L;  5BR8 Q;  5KFL A;  1EQV A;  2E2D C;  3D3R A;  3JRW A;  3Q8D A;  1UEB A;  2AMC B;  3HOU H;  5FK9 C;  3RF2 A;  2W7O A;  3H4D A;  1LTT D;  3H4B A;  1HJP A;  4XQQ A;  3HOW H;  1WD0 A;  1XMQ Q;  4JI2 L;  4I7H A;  3MR3 A;  3EPI A;  4EQN A;  3L0O A;  5KFM A;  5EDW A;  4UY8 C;  2OTL A;  4ED2 A;  4NMZ A;  4JI1 H;  4JI7 Q;  4LF5 L;  3I73 A;  4KHZ A;  4DL4 A;  1E4E A;  1UE5 A;  5M3M B;  3HZX A;  1I6H H;  2MGS A;  3WOE A;  2NU8 B;  4J9N A;  3RZO H;  4HN7 A;  4TV9 F;  2LS0 1;  4X6A H;  3E6Z X;  2E2I H;  4JOI C;  4J1M A;  3HOU B;  4JI0 H;  3EN2 A;  2F0G A;  5CV6 A;  4P72 A;  2ZM6 L;  1B6S A;  1KRS A;  4YIJ A;  1PH8 A;  1AN7 A;  4GZY C;  2FLP A;  1E22 A;  2FMM A;  2MUY A;  3GIP A;  1STB A;  4MA0 A;  1C9O A;  2G9D A;  2VPS A;  2OXP A;  1EZ1 A;  3HOV H;  1HZA A;  2E2H H;  2D0P A;  2Z0S A;  3T4A C;  3E9I A;  2W6N A;  5M5X B;  5CBA E;  2ZXR A;  4UP8 A;  4YY3 Q;  4K0K L;  1Q12 A;  1CKO A;  1KAB A;  3SGI A;  2HQE A;  1WR2 A;  3GTL H;  3G7L A;  2JEF A;  5EWG A;  3MFI A;  2JA6 A;  1DYQ A;  2XWB B;  1IW7 D;  2W6O A;  2LFN A;  1TWF A;  3E9H A;  2JA5 G;  1KJ9 A;  2V4R A;  1ENC A;  5A2Q W;  1P16 A;  3MFY A;  2I80 A;  3FKI A;  5M3M H;  1VQ4 A;  4ZKC B;  5FO8 B;  4HJ7 A;  1A3T A;  3CC2 A;  1K8M A;  1FJG Q;  3CQZ H;  4IPG A;  1WTX A;  5L9X A;  2DPI A;  1VBH A;  2C9O A;  2ES2 A;  2Q2U A;  4F7X A;  3RB3 A;  1KNA A;  4LF7 L;  1TWA H;  4HJA A;  4ZK9 B;  4BBS H;  1E4G T;  3S2D H;  1BCP D;  1ZEQ X;  1WSC A;  3UE1 A;  1SND A;  1OXS C;  5KFD A;  2EPB A;  2LSS A;  5CYU A;  1II3 A;  1QWY A;  4IUU A;  4GOP A;  1KDB A;  4A93 G;  3H3V C;  1YHB A;  1QNK A;  2JSO A;  1H9S B;  3GII A;  5FJ8 H;  4X64 L;  1S5F D;  4N9P A;  3KAK A;  1MBY A;  4LSA A;  3TDQ A;  2HT1 A;  3HOX B;  4IPC A;  2ICI A;  3IN5 A;  2IW3 A;  2FJZ A;  2Y0S B;  2BDN A;  1DCZ A;  4DUZ H;  2ID0 A;  4EGQ A;  1HNW Q;  1YVC A;  4RG1 A;  3NEM A;  3QG1 A;  1A2U A;  3AFP A;  1BBU A;  5EJW A;  4HYK A;  3W1B A;  1CI3 M;  4WD3 A;  1Q82 C;  3K5L A;  3U9O A;  1I7N A;  3S14 B;  2XNA C;  4FF3 A;  1ILP A;  1XDN A;  3CCJ A;  3TS2 A;  2K7V A;  4X66 H;  3RZO B;  2K04 A;  4PQX A;  3T16 A;  3MTS A;  1Q81 C;  1KNE A;  1XNQ L;  1K1Q A;  1PX2 A;  2L11 A;  3ULL A;  2L55 A;  1SN8 A;  2V59 A;  1P8L A;  2K5N A;  4HJ8 A;  1VS0 A;  2NN6 H;  3K80 C;  4IHJ F;  3M4I A;  4LFA H;  1RTN A;  1XTD A;  5FO9 B;  3ULP A;  4LFB H;  1TWH A;  2DLN A;  1A2T A;  4LK1 C;  4DV3 L;  3TIN A;  4RGO S;  3HRZ C;  4IUV A;  1PRT B;  1JDB B;  2A68 D;  2XGT A;  3PV0 A;  1F9Q A;  1MHW C;  1LT5 D;  1CSP A;  1XPR A;  2B2Y A;  1PH6 A;  3GIL A;  4DV5 L;  3GIQ A;  2R86 A;  2NBF A;  1NAP A;  1SMY C;  3D8G A;  3IG0 A;  1MJC A;  4F50 A;  2B39 A;  1RJQ A;  2LMC B;  4QF4 A;  5BMV F;  2F0M A;  4X66 L;  4CC6 A;  1L1O B;  2D0O A;  2EJM A;  2QCP X;  2L1B A;  3DHQ A;  3DM1 A;  4P2C B;  3RN5 A;  5M9O A;  3OTO H;  3HOW G;  1X3E A;  3A8J E;  3SXH A;  5C0X H;  1B9M A;  1NSN S;  2ATL A;  1C48 A;  1BGW A;  4C1N K;  5BN3 A;  4HIK A;  4HQ6 A;  2JA8 G;  3CW2 C;  3JAM i;  5JEA G;  2W9C B;  3NBH A;  5J39 A;  1A3V A;  1NBW A;  1T9H A;  1Y14 B;  3IFT A;  4LF5 Q;  5M5Y B;  3VMM A;  1RDP D;  2HIV A;  5JVG 3;  4ZUJ A;  5EKI A;  1E3P A;  1PZJ D;  1B2T A;  4R4Q A;  4ZQI A;  2KBN A;  2GA4 B;  5KG6 A;  1O78 A;  3HG9 A;  4QUC A;  2R7Z A;  1GO3 E;  4LFC L;  4JI5 Q;  3U4V A;  4PDB A;  4IUQ A;  4RKB A;  2C00 A;  1VKZ A;  5IP7 G;  1WCM G;  4XTC S;  5FLX E;  4JV5 L;  4KJN A;  3H0G G;  1PZI D;  1N34 H;  4LF7 H;  1TWG A;  1JX4 A;  3S16 B;  2N8N A;  4LF4 L;  1S4Z A;  2WV6 D;  5IIF A;  2CKZ B;  4RGM A;  3PUY A;  3VYR A;  5M5Y H;  1EL0 A;  4DAM A;  4XDX A;  1TY0 A;  2X6L A;  3KFU A;  2ZM6 Q;  2FP4 B;  1JOR A;  1C8C A;  1SRO A;  2IHE A;  4K6D A;  5CV9 A;  2RCN A;  1S68 A;  2R7D A;  4YY3 L;  4XX0 B;  3VR4 A;  2Z6B A;  2A69 C;  1VDZ A;  1ZHS A;  3GTK A;  4BWG B;  4DUY Q;  1XXG A;  1HFN A;  4DL2 A;  2R93 H;  3D31 A;  3U9S A;  1JE4 A;  2VQE H;  2AWO A;  1XJV A;  3AMU A;  4TRD A;  2R92 B;  2IMW P;  1H9K A;  4K6L A;  3RTX A;  5JVL A;  2F0V A;  3L9A X;  1XX8 A;  5JJZ A;  3GTG H;  1EUD B;  1KJ8 A;  4MTK A;  1STG A;  1LLR D;  2F0E A;  3FMA A;  3J81 L;  1Q8K A;  3BZK A;  4WBN F;  4HAE A;  1W6J A;  4P71 A;  3D6C A;  4DNT B;  2HHH H;  1OXX K;  4F4Z A;  3OHB A;  4IPH A;  3H0G H;  4Y7N B;  4DV5 Q;  2EZV A;  4LFB Q;  3BS1 A;  1GSH A;  5KT5 A;  4J9Q A;  2DNE A;  1E1T A;  1XPU A;  1WCM A;  4FXG C;  3LML A;  2Y0S A;  2V5A A;  2QGQ A;  2J4X A;  2Z1C A;  1NY4 A;  3OMC A;  4FO2 A;  4RHS A;  4CJ2 C;  4A93 B;  2CW0 C;  2FE3 A;  4JG2 A;  4HNV A;  4DV2 L;  1RYS A;  1PZK D;  4AYB A;  2QF7 A;  3M4O H;  2L5T A;  3VR2 A;  5LMN Q;  1M7J A;  3Q23 A;  4IRK A;  3GTM A;  2X69 A;  2H4O A;  2IT1 A;  3BVM A;  3W3A A;  4IJH A;  4A3K B;  1SE8 A;  4Q8E A;  4A2A A;  2F0P A;  1D5Z C;  1GVP A;  1EIH A;  4AQY Q;  3K59 A;  1CS0 A;  5C4X H;  5F9L A;  2HVQ A;  3AQQ A;  2XVS A;  1I4Q A;  3VYT A;  2MHV A;  4CBV A;  1Y1W B;  4IFD H;  1AUX A;  4ED3 A;  2UXB H;  3EFX D;  2VS1 A;  3CKI B;  3MWD A;  4M9U A;  4O3Q A;  2CVR A;  4JC0 A;  4DR1 Q;  5DLG A;  4RH6 A;  4ZLT F;  2YW2 A;  4IZ8 A;  2WB1 E;  1RL2 A;  3GTP H;  1IOW A;  2BR0 A;  2PQA B;  3MXG A;  2ZDQ A;  5I6Y A;  2UXC H;  1SYF A;  1G6P A;  3OSN A;  5C44 B;  3QIA A;  1A6X A;  4MTN A;  2YS7 A;  4JPB W;  3BG5 A;  4ZOL F;  4J9O A;  2UVV A;  3KK7 A;  5KFO A;  1VQJ A;  3QJY A;  4I7Z C;  1GSA A;  2R7M A;  3TQ1 A;  3FDS A;  4XYO A;  3J81 W;  5D3D A;  1X3G A;  1BBX C;  1B50 A;  2JJQ A;  4B9X A;  2QIL A;  5KEE A;  2GPS A;  2JEB I;  4DV6 L;  4A3G B;  3AB9 A;  2J0T D;  2SDF A;  2F0T A;  4JI6 H;  2IX0 A;  4OIK A;  1KTK A;  1A3U A;  3I4O A;  3N6X A;  4DV4 L;  3IKJ A;  1GUG A;  5KT7 A;  4GOP B;  2F0H A;  2JE6 I;  3E0E A;  3K0Y A;  1AZP A;  5C44 G;  1B1Z A;  3M9N B;  3A74 A;  1CT1 D;  1I5F A;  1TS3 A;  1X65 A;  1FJG H;  5D14 A;  4B3S L;  2R93 B;  2R85 A;  4RCO A;  3PR5 B;  4IR9 A;  4F8M A;  5KG7 A;  2ZJT A;  1K1S A;  4ECS A;  1PFN A;  2LXJ A;  3U50 C;  1RCV D;  2B8F A;  2PQE A;  4AH6 A;  1QNU A;  3QWN A;  4DR6 L;  1O80 A;  4FXD A;  2YZG A;  3Q0A A;  4J9L A;  4KV6 A;  2BQU A;  4KI0 A;  2F0K A;  2PO4 A;  4OO1 H;  2UVR A;  1GUN A;  3CP0 A;  3BJU A;  4Q43 A;  3H0G A;  3J7Y W;  3FHW A;  2WB1 B;  2M9V A;  4DL3 A;  1PYB A;  4QMG A;  5JAV A;  3HOZ H;  4ZQ3 A;  2B2Y C;  1HR0 Q;  3V6J A;  1SLJ A;  4J9P A;  2R8K A;  2KOL A;  5FPR A;  5GAE C;  4TVA B;  5FJ8 G;  3V2T A;  3PF5 A;  4F87 A;  3HOY H;  1T5E A;  1K83 A;  2K14 A;  1ENA A;  1IBL Q;  4JV5 Q;  2AWN A;  4NXM L;  3PO3 B;  3A5U A;  2UXD L;  2WE6 A;  3BG3 A;  3S14 H;  5IGE A;  4BBS G;  5LXT F;  3MXN A;  4FBU A;  1TS5 A;  3BYT B;  2HVS A;  3W2D A;  2F4V L;  1ET9 A;  2R93 G;  4ABN A;  4DNI A;  4HCS A;  1QZH A;  4EEY A;  1S5C D;  4TSS A;  1TWG B;  2MFI A;  3LNN A;  4RMF A;  5E1F A;  4BY1 B;  5JH7 F;  1JR0 D;  1QUQ A;  5EAY A;  5JOB A;  1C0A A;  1TII D;  4O3N A;  4HR7 B;  1BVS A;  3TRE A;  4LUV A;  1HQR D;  3KHG A;  4A3G G;  2UUC H;  4R4O A;  5BR8 H;  1NMF A;  1AE3 A;  5IP9 H;  1HTP A;  2B2W A;  2H5X A;  4EBC A;  4Y52 H;  4WJ3 M;  1WCM H;  2F52 A;  2ZTC A;  1VQF A;  3HKZ B;  3BZD B;  3NWT A;  4TQS A;  3ETJ A;  4U7C A;  3WWV A;  1VQE A;  1V43 A;  3HOV G;  2VPQ A;  1SNP A;  4F4Y A;  2DPJ A;  4EBE A;  2I5M X;  3FKI G;  2JA9 A;  4POF A;  3QFF A;  1IBK Q;  4BY1 H;  5KG3 A;  4NXN H;  4RNN A;  1EY6 A;  1C7Y A;  2K32 A;  1I3Q H;  2NU7 B;  4IAJ A;  3RFC A;  3AEV A;  5F2D A;  2L12 A;  2KUM A;  1I50 A;  4RZR A;  3OSP A;  2NU9 B;  5DQI A;  2V1C C;  4DV1 L;  4DV0 H;  1D2B A;  1EY4 A;  1Z6H A;  4GN3 B;  3RLN A;  3MR5 A;  2OQK A;  1HQM C;  1PH3 A;  3J81 j;  3HS0 C;  1F2M A;  3CC4 A;  2JP1 A;  3D4D A;  4RZQ A;  2JA7 B;  3PO2 G;  2NTS A;  4IFD J;  1CKN A;  1MGS A;  1U5K A;  5KFI A;  4DV2 Q;  4H44 C;  4DR6 Q;  4FS2 A;  3K81 C;  2L4N A;  1YNN D;  1GKH A;  1PH2 A;  2VQF H;  1K3R A;  1RTO A;  2Q8I B;  3HOZ B;  1IBM L;  1XMO H;  1PA6 A;  1PTO H;  5DGA A;  2YTV A;  4LF4 H;  2RSN A;  1EHI A;  4XQJ A;  1KD1 C;  1XNR Q;  1HNZ H;  1JWS D;  5LHY 1;  2XGQ A;  1S10 A;  3CC7 A;  4HJ5 A;  5JQW A;  4LJZ C;  4EEQ A;  2R7Z H;  3PW7 A;  1EOT A;  1RHP A;  1E7Z A;  1EY5 A;  1VQI A;  1BCP F;  1OTC A;  3V05 A;  1C30 A;  1SJH D;  4RAU C;  2NN6 G;  4DK1 A;  3H94 A;  3NHH A;  1EQQ A;  4RNM A;  1T94 A;  4H02 A;  3BYY B;  1XNQ H;  1GD7 A;  3C1F A;  5ELC A;  4ME3 A;  1RIP A;  4DK0 A;  1DGS A;  4DR4 L;  2M00 A;  2G5D A;  4M1U B;  3TP7 A;  3V4S A;  2WAQ G;  2C2E A;  4UPA A;  1HUN A;  1YJ9 A;  3S17 B;  4DR6 H;  4KMU C;  4LUO A;  4BA2 I;  5IT9 L;  4FBT A;  1KL9 A;  2XD4 A;  4KN7 C;  5CA1 F;  4JV2 A;  5KFH A;  4DV4 Q;  3OIP A;  2E2J H;  4JI3 H;  2B2V A;  3K7A B;  2VW9 A;  4MHE A;  5C3E G;  3L4J A;  4R7R A;  5AFW A;  2IP4 A;  4PMW A;  1ILQ A;  4LF6 L;  4YWK A;  4JYA Q;  2N49 A;  2NU6 B;  1XMO Q;  1VQ8 A;  4ED8 A;  1B3A A;  3RUZ A;  1ASZ A;  4DR2 H;  3F2U A;  4R4T A;  2WAQ A;  2VA2 A;  2UUB H;  4B3R H;  2XTI A;  5L1J A;  2R93 A;  1AEX A;  3K3V A;  4FF4 A;  1O7L A;  4PWQ A;  1R9T H;  2YZN A;  4UP9 A;  3JAM L;  4UDU C;  1Q1B A;  1CFM A;  1PFB A;  3WDN A;  4YR2 A;  5DG7 A;  2SCU B;  3AFQ A;  3G6J B;  4G3I A;  3S1M H;  4O3R A;  3J80 c;  5JPN C;  4LAA A;  1ZQ7 A;  1PFM A;  4A3K H;  2BE5 C;  3F8N A;  1X3Q A;  4JBJ A;  1QZG A;  2R6F A;  1F9R A;  2CWP A;  2K5D A;  3RZD B;  1IOV A;  3A54 A;  5COY A;  5GAD C;  3H20 A;  2VQE L;  2NB0 A;  3M7N A;  4RNO A;  1YNJ C;  2R8H A;  3NSW A;  2OCE A;  2JA5 H;  4A3D G;  2NTT A;  2YTX A;  2NUA B;  1JXL A;  3PCO B;  3KHH A;  4JV1 A;  4R4I A;  3BDO A;  4HSV A;  4DUZ L;  3J7Z C;  4YJ3 F;  1NTG A;  1JIH A;  1HCZ A;  4A3F H;  3CCQ A;  2YRW A;  1YIT A;  3UE0 A;  1NCV A;  1UE1 A;  1GM5 A;  5KFA A;  1R9T B;  3JSN A;  2B2U C;  5IYD G;  1JQY D;  3RAQ A;  3N43 B;  3LWE A;  2ZM6 H;  1HA6 A;  4HJ9 A;  3G6V A;  2F0S A;  4LFC Q;  2A6E D;  1I4G A;  4ED0 A;  2E2I A;  4MV4 A;  1YBY A;  1UAP A;  1CKM A;  4U6P A;  5DLF A;  2WB1 A;  3TS0 A;  3NE5 B;  4FF1 A;  1SDF A;  2RBM A;  2ALY B;  2EY1 A;  3VPC A;  5KT6 A;  3JAM W;  4H7B A;  4A3F B;  4A75 A;  2IA6 A;  3X3M A;  1N34 Q;  4OWW B;  1CK1 A;  1FL0 A;  4TV8 F;  1SR3 A;  2RDG A;  1HR0 W;  2QEJ C;  1FYC A;  1ZXT A;  3EQL C;  3KBG A;  4UHV A;  5DQH A;  5KFQ A;  4DR2 Q;  3GV3 A;  2WKD A;  1QVC A;  2MO1 A;  5I2X A;  4P73 A;  4AIM A;  1SXT A;  3R2I A;  2EYF A;  1G51 A;  3B6Y A;  4B3T L;  3R5H A;  4YWM A;  1M4V A;  1T3N A;  1SYB A;  3M7G A;  5KT4 A;  2IBK A;  4AYB B;  1IKM A;  3NXW A;  2I5H A;  4A3C G;  5I47 A;  1Z7T A;  5L1I A;  4HNT A;  2XRQ D;  3PQI A;  3J7A 5;  1LTR D;  4P74 A;  4GN5 A;  4X65 H;  2I8C A;  1GXD C;  3ORR A;  1SFO A;  3PO3 H;  1BDO A;  3GTP B;  1U4L A;  1OXU A;  1Y1W A;  2YS6 A;  1PV4 A;  2M05 A;  1VQA A;  2K5Q A;  3K3P A;  5D1O B;  4JW0 A;  4MZ9 A;  1VQ7 A;  1MD2 D;  4DR3 Q;  1MSG A;  2RA4 A;  5IGC A;  2KCC A;  3SEB A;  3ULJ A;  3Q8Q B;  2UXC Q;  3QB3 A;  3KBX A;  2PI2 A;  4QGU A;  1JWM D;  2XSC A;  2RCF A;  4JI6 Q;  4PV1 C;  4DR1 H;  4TUY F;  5IYB G;  3JRX A;  4WOR A;  2PZW A;  4UCR A;  4K14 A;  2SEB D;  3OW2 A;  3GTO B;  3RB6 A;  2G9H D;  5HGT A;  4LFA Q;  1QVG A;  2VA3 A;  2K5W A;  3KDF B;  1EFI D;  4WRD A;  4KHP Q;  1I6U A;  1CHQ D;  1CTM A;  5IYC G;  2FLN A;  3KLS A;  4DF7 A;  4OO1 G;  4LMQ D;  4LF8 Q;  4I55 F;  3T1Y L;  3I4N G;  4JI4 Q;  3K5I A;  1XYI A;  4QW9 A;  5FD6 A;  2PZT A;  1BR9 A;  4G4K A;  1CA5 A;  5DM6 3;  3S1R B;  3K5O A;  5A2Q E;  2VB2 X;  3QZ7 A;  3RLF A;  3G8C A;  2QW7 A;  1G8Z D;  5KFC A;  2K5V A;  3KXY T;  3CMA A;  5KG4 A;  3FPU B;  4DN4 M;  5LMU L;  2UXB Q;  3TBI B;  4KTA A;  3PIP A;  5C4J H;  1OWT A;  1AP0 A;  3BQ2 A;  4FDB A;  3NBI A;  4LF6 Q;  4DR7 H;  4FS1 A;  1JCK B;  5KFB A;  1CA6 A;  2CZG A;  2BOS A;  5KIX A;  4PMC A;  3CME A;  2HHH Q;  3I56 A;  3ETH A;  1N48 A;  4NXN Q;  3HFZ B;  3RLO A;  3SR1 A;  2A19 A;  4QY7 A;  1BKB A;  1M8A A;  2F0I A;  2F0O A;  4OEM B;  3WOF A;  2EDG A;  4CC5 A;  3PN1 A;  2E2H A;  2FLL A;  3K5M A;  1J6Q A;  2YTY A;  5BN4 A;  4Z9C B;  4MIU A;  2FXQ A;  5GON F;  1S0M A;  1PTO F;  3HOX H;  5HUR A;  4OEL B;  2EIF A;  3CRL C;  2Q8R E;  3EA6 A;  1TWC B;  2NVY A;  2HDM A;  1RK5 A;  4A3L G;  1Y69 U;  5JEA H;  4XZ3 B;  2D2C C;  4N8X 1;  2EYH A;  5L1K A;  2K4K A;  3KAJ A;  3QZ8 A;  1N32 L;  3NQT A;  1X3F A;  3NUC A;  1D7Q A;  1O7Y A;  1N56 A;  1WTH A;  3RN2 A;  4IFD G;  1G91 A;  3A7L A;  4CDF C;  1ICF B;  5JJI A;  1Y1V H;  1A9X A;  2RF4 A;  3K7U C;  1BJT A;  2FB9 A;  2VXW A;  4GKK Q;  1A0I A;  1I3Q B;  3TP8 A;  1N36 Q;  1SNO A;  5JPM C;  4IN3 A;  3D4W A;  2W6Z A;  2DY8 A;  3GP7 A;  4JUZ A;  1E4F T;  2J6U A;  3GID A;  3J7A F;  3J7A K;  1F2Z A;  4B08 A;  4A3D H;  1SYX B;  1IW7 C;  3STB D;  1LT4 D;  2EE1 A;  5C1P A;  2UVW A;  3I55 A;  4JI5 H;  4NPS A;  1VBG A;  2GVB A;  2JA6 B;  2JA7 G;  1GHJ A;  4K2K A;  1BNC A;  4UCU A;  2WFW A;  4MV7 A;  1YJW A;  4B9W A;  2A5H A;  2OWO A;  2I0Q A;  1DV1 A;  1JJC B;  4RU9 A;  4Q5V A;  1HR0 H;  4LF5 H;  3NTK A;  1JC7 A;  2NVX A;  1S5E D;  4CJ1 B;  4LNQ A;  1FGB D;  3A55 A;  4CKB A;  1VQ6 A;  4XT1 B;  1A8V A;  1TS2 A;  5D8D A;  2E2I B;  2EQS A;  1FKA H;  4GKJ L;  4PZ7 A;  5CV5 A;  2PW5 A;  1ASY A;  2EY6 A;  3RAX A;  3MFG A;  2ZTE A;  1C3O A;  2KEN A;  1TWF H;  3ER0 A;  1N36 H;  3M3Y B;  4GKK H;  4JI7 H;  4B3T Q;  2H1E A;  4JI1 Q;  3OUU A;  4DNR B;  2W8L A;  5FOB B;  1B6R A;  3KHL A;  3PVX A;  5C5L A;  2WYO A;  4UCO A;  5ELN A;  4A3M B;  1PLF A;  3MXU A;  4ED1 A;  4XIG S;  5KFW A;  4O1N A;  3BAA A;  4DV7 H;  3H15 A;  3U58 A;  1VQK A;  3JAM E;  1K83 H;  1G6Z A;  1RJR A;  2VR1 A;  2IX1 A;  1GOZ A;  4G57 A;  1GUW A;  5EQ0 A;  3U9T A;  2F0D A;  4QB4 A;  2RSO A;  5GRO A;  1TWF B;  1WTR A;  2ZXO A;  5DQG A;  3KHR A;  3R8B A;  3PZP A;  2ENB A;  5C3E H;  3P75 A;  3CCU A;  2C2D A;  2R8J A;  1JOK A;  1EY0 A;  3PW5 A;  3S15 H;  2EXD A;  5IOD A;  3GTQ H;  3GTO A;  1YNJ D;  3BQ1 A;  5I9O A;  2NVY H;  1TS4 A;  1DOL A;  2P0A A;  3OPO A;  4FVM A;  4YR0 A;  4X3K A;  1VQC A;  4DR7 Q;  4LF6 H;  3PO3 G;  4EFB A;  4YP3 A;  5IE8 A;  2OEO A;  4R1J A;  3HKS A;  3H3V H;  4GN4 B;  1HPC A;  1HA5 A;  2Z9H A;  1VQO A;  4A3J H;  2NVT B;  3ZJY C;  4O4L F;  4AQY H;  2W9A A;  3VPB A;  4J0M A;  1FVI A;  1U4M A;  4KHP L;  2JA5 A;  1YZ6 A;  1V4Y A;  1JB7 A;  1EQT A;  1PRT F;  1S40 A;  1M6V A;  2RHS B;  1XTC D;  2D5D A;  5A2Q L;  2L0C A;  3FEW X;  2CWA A;  5M5W H;  1GUO A;  4V19 0;  4EBD A;  5IT9 c;  4JI4 H;  2KHS A;  4YQW A;  4ECQ A;  1G2S A;  1JOO A;  1RF2 D;  1V9P A;  4KKT A;  2ZJP A;  3DF7 A;  3EVQ A;  2YU9 B;  3GV7 B;  3NEL A;  1ML0 D;  4XQN A;  1I4X A;  1M90 C;  3NGD A;  1KIX A;  1Z9F A;  3EPG A;  2MO0 A;  2V4D A;  2MQH A;  5IWA Q;  4N9T A;  5LMU Q;  2NVT H;  3LP8 A;  1H9S A;  1N9W A;  4UCT A;  4YAK B;  4IRD A;  3GTP A;  1HNW H;  4DAP A;  1JOQ A;  2NZO A;  4O3S A;  2ZJR A;  4X64 H;  3QOJ A;  1UE7 A;  2KA7 A;  3ND9 A;  1IBK L;  2OH2 A;  2FK2 A;  3GQB A;  2HIX A;  4A3L H;  4RA8 A;  3T5L A;  1B53 A;  1I94 L;  4RGN A;  3NWS A;  3HKZ G;  2RDJ A;  1BCP B;  2WAQ E;  5GAH C;  2OTJ A;  3GO5 A;  3SE7 A;  2UUA L;  1IXR A;  1TWH B;  1LTL A;  3N52 A;  3H40 A;  3I4M B;  4L5T A;  4OO1 I;  4HTH A;  3J80 E;  3KDF A;  4QWA A;  1GUS A;  2JK8 A;  5CBE E;  4DUY H;  4BY1 G;  4DV7 Q;  5BN5 A;  4H0L C;  1IL2 A;  5T1I A;  1W6K A;  4JYA L;  2R84 A;  5C4Z A;  1X9N A;  3T51 B;  4XYM B;  4GKK L;  3GTQ A;  2W70 A;  2B2V C;  1AW7 A;  3E5S A;  3OHX C;  1L1O A;  1I6V C;  1Z47 A;  4FP5 D;  2KVM A;  2RDF A;  1X32 A;  1R4P B;  1CQJ B;  2BQR A;  4AYB E;  4LF9 L;  1V8Q A;  3HOY B;  4KHV A;  4XXE A;  2EYL A;  3RV4 A;  1VF5 C;  1K73 C;  3BU2 A;  4YCV A;  5DNF A;  3T1H L;  2YL2 A;  4CDD C;  2QDL A;  3NPP A;  4LF7 Q;  2V58 A;  1VQM A;  3DWQ A;  1LT3 D;  3IL8 A;  1CQV A;  1EZ6 A;  4BBR B;  4A3K G;  2B8G A;  1X55 A;  3R2T A;  3ZYY X;  1KHI A;  2NVX B;  1R9T A;  4LMY A;  4ZKB B;  4DR7 L;  1E2V A;  2FHT A;  1QB5 D;  1SE3 A;  1VQG A;  2JEA I;  4J9K A;  4BY7 B;  4LFC H;  1N33 Q;  4JI5 L;  5M5X H;  4QWB A;  4H13 C;  4DV6 H;  4RB0 A;  4A3J B;  4L6T B;  1SMX A;  5KG2 A;  3TN2 A;  1BOS A;  4L1K A;  2ASJ A;  2A73 B;  4AYB G;  4DR4 Q;  5C0X I;  2J6T A;  2CQA A;  3LGJ A;  3Q8P B;  1STE A;  3PMF A;  2B63 A;  4MN3 A;  5JJK A;  5LP6 F;  3G6E A;  1FGU A;  4KY5 A;  1TQO A;  2X0S A;  5HBR B;  4JI1 L;  4G7Z C;  2NVX H;  5JVD F;  2EYP A;  5DEH A;  3OTO Q;  2LXK A;  3WO0 A;  2VZA A;  5IYC H;  1KC8 C;  1KJI A;  2UXD H;  4QCL A;  1HNX Q;  2R61 A;  4OIJ A;  1TWA B;  1LT6 D;  2XIW A;  3ERQ A;  2F03 A;  2YCH A;  5ELF A;  2A6E C;  4DR1 L;  1I3Q A;  5K5P A;  4B3M Q;  3BQ0 A;  1N8R C;  3CXC A;  4MV6 A;  2UU9 L;  4EGV A;  4DK3 C;  2R7L A;  4KKS A;  3CHB D;  1NR2 A;  1U4R A;  1PRT D;  3L2P A;  1IYV A;  3I4L A;  3IRB A;  2FKL A;  1NMG A;  1TWC H;  2QDB A;  4PNY A;  4GLA C;  1PXU A;  4DL7 A;  1JJG A;  1ESR A;  2FPP B;  4ECU A;  1MKH A;  2XIG A;  3S1R H;  2DY7 A;  4JCV E;  1C4Q A;  3DM3 A;  5D1P A;  1IYJ B;  3MVV A;  3GTJ B;  3MEF A;  4HIM A;  2ATW A;  1MIU A;  4IWX A;  4DV3 H;  1JDE A;  4CKC A;  1PH1 A;  5DAU A;  1UE6 A;  4LFB L;  4HIO A;  2EY2 A;  1EY9 A;  2E75 C;  4X66 Q;  1DD2 A;  1EYD A;  2AQ4 A;  1WCM B;  3CD6 A;  5ELE A;  4G7H C;  1A15 A;  5C4H A;  2B2U A;  2XRS D;  4FXK C;  5M3F H;  3IAY A;  4QWE A;  4A3D B;  3KTM A;  4YWL A;  2A74 C;  1B44 D;  2RHQ B;  1KXL A;  4O3P A;  4HMJ A;  4LH7 A;  4DV4 H;  3T1Y H;  2LY7 A;  4KK7 A;  1WYD A;  1X54 A;  3CRK C;  4CJ0 B;  3TME A;  2O2L D;  4DUZ Q;  1JJ2 A;  3GTM B;  1F2Y A;  5CR3 A;  3MWE A;  1KLU D;  4ED6 A;  2PVP A;  5C5M A;  2XCL A;  5BR8 L;  2FMA A;  2AQ3 B;  4K0K H;  1GHK A;  1OXV A;  1B4O A;  1NE3 A;  4A3I G;  2JA8 B;  2YRX A;  1H9R A;  4X62 Q;  5M3F G;  4RUC A;  2I46 A;  4JI2 Q;  4ME6 A;  1I4R A;  1QIL A;  2KHJ A;  4DR3 L;  4JI8 L;  2UUA H;  1BQQ T;  1RKN A;  3BA8 A;  5EKL A;  3V6H A;  3AU7 A;  1EWC A;  2K1B A;  2Q8T A;  4PZ8 A;  4RWS C;  3GTO H;  2K05 A;  1VQB A;  4NXM Q;  4EVO A;  2R87 A;  4C3H H;  2ASB A;  1LTG D;  3FMC A;  2R92 G;  5C4X G;  1NUC A;  2UUA Q;  4A3F G;  4IAL A;  3I3C A;  2Q2I A;  3BAB A;  1L0X B;  2DNC A;  4ID6 A;  1I94 Q;  1X3P A;  3F2B A;  4DXF A;  5J2U F;  5DGB A;  4PZ6 A;  1CQF A;  3G6Y A;  3T5K A;  1CM9 A;  3W5O A;  2KQ3 A;  3MR6 A;  2WP8 J;  5KT3 A;  3HGB A;  3C0F B;  1BXT A;  1EUC B;  3J80 W;  4ECR A;  2W8K A;  3TQT A;  5LOV F;  3R5X A;  1LTA D;  1SYC A;  4R8N A;  1MSH A;  5E7N A;  1PDQ A;  4NB3 A;  4A3E G;  4LF9 Q;  2E8G A;  3CPF A;  2EYJ A;  3VA5 A;  4ECX A;  1N32 H;  1CE8 A;  3N8D A;  1WTW A;  1W2B A;  2B63 G;  1E24 A;  1EWI A;  4OX9 H;  2BH8 A;  3PSI A;  1SSO A;  4U68 A;  3S16 H;  5CGK A;  1TT2 A;  4CHT B;  3GTJ H;  2F3V A;  1VQ9 A;  2FJ2 A;  3GV5 B;  3M3Y H;  2PPB C;  5L1L A;  1T5X D;  1FJG L;  3C1E A;  3T1H Q;  1JLL B;  5FLM G;  1LAC A;  3C3L A;  3H91 A;  4QL5 A;  2N88 A;  2Y0S G;  5JEA J;  2W6M A;  1IBK H;  3EJI A;  4JBM A;  2CFM A;  3R93 A;  2O5J C;  4ECV A;  3HOZ G;  4O2B F;  1E1O A;  3TSS A;  4RB3 C;  2GVA A;  5G3L F;  4I65 A;  1W96 A;  5KX5 F;  1K83 B;  4RHR A;  1HHV A;  2PMZ B;  3KF6 A;  3MWM A;  1DJR D;  1PTO C;  1XMQ H;  4MV1 A;  2UUC Q;  4MA5 A;  3SK4 A;  5IP7 H;  2VL6 A;  4Q0Y A;  5TSS A;  3GTM H;  2N78 A;  1EIY B;  2CW7 A;  2VUG A;  3Q2O A;  3OW7 A;  3EIV A;  5A35 A;  4UP7 A;  2E5L H;  4DAY B;  2VUM H;  1HNX H;  3V4Z A;  4ZRZ A;  2JA8 H;  4JV0 A;  2AU0 A;  4GNX C;  1EEF D;  4XYL B;  2KCT A;  3VA7 A;  4BXX H;  3VR3 A;  2B63 B;  5LA6 F;  1D8L A;  1EYG A;  2UXB L;  1UC8 A;  1QUQ B;  2ALZ A;  5K36 H;  3N42 B;  2OQ0 A;  3PUW A;  4A3E B;  5C3E B;  1SFO H;  3E5N A;  2JA7 A;  3SK5 A;  4ED7 A;  1FD7 D;  5EPK A;  2TMP A;  5COR A;  1GJX A;  4DR4 H;  3NP8 A;  3UFX B;  3SK8 A;  2F4I A;  3MXN B;  3S1Q H;  1IYU A;  1ET6 A;  1H9M A;  2C35 B;  1S5B D;  5J1Z A;  4IUR A;  4CKE A;  2OLS A;  1F2L A;  3OIQ A;  5GQO A;  5I9P A;  1V51 A;  3OHA A;  2Z4H A;  5D3I B;  2SOB A;  3W1G A;  3RZD H;  3G6X A;  2I87 A;  2YU9 A;  1EYC A;  1QJO A;  4DGZ A;  1IBM H;  4R8U B;  3HKZ E;  4O42 A;  3CCM A;  4GKJ Q;  1NR4 A;  2F0Q A;  5C0X G;  5D65 A;  5C4X B;  4HR7 A;  4MTE A;  2BA0 A;  3GTK H;  1DV2 A;  2HGS A;  5CV8 A;  2IX3 A;  2PI2 E;  2UUB Q;  4B3R Q;  2WTF A;  4C3J H;  2F0F A;  2NYZ D;  2F1M A;  3PO2 H;  2VQF L;  3D0F A;  4OX9 Q;  4TQR A;  2B2W C;  5DM7 3;  1WJJ A;  2VY3 A;  1N32 Q;  4MV3 A;  2RQX A;  1F9S A;  2E76 C;  3MXP A;  4O2A F;  3RUP A;  4WJW A;  3SE0 A;  4QWC A;  4ILW A;  3HBL A;  4ECT A;  2AQ1 B;  5KG5 A;  5M3F B;  1DON A;  2BDO A;  5CA0 F;  3N6R A;  5C8Y F;  1F77 A;  1EU4 A;  5HY6 A;  2W7P A;  4DXG A;  4HCE A;  2K03 A;  1ZHQ A;  2EJF C;  4R8I A;  4JI8 Q;  4TKO B;  1XPO A;  1G2T A;  5EBD A;  1J5E H;  5EPL A;  1SRU A;  4LH6 A;  3WNZ A;  2C22 A;  4JBK A;  4Q45 A;  3UDX A;  2EYM A;  3K6O A;  3DLL A;  3VR6 A;  3CF5 A;  2EJG C;  3H6M A;  1I4H A;  1QOH A;  4X64 Q;  3F8T A;  3I72 A;  2QKI C;  3UDF A;  2UUC L;  1KEE A;  4EX5 A;  1CHP D;  5JUM A;  2XGP A;  1CSQ A;  4IJL A;  4MNO A;  1RJT A;  5E3F A;  2RGR A;  1HNZ Q;  1XNR H;  4R4C A;  1S97 A;  2C28 A;  3DMU A;  2X6G A;  3PIP 3;  4LF4 Q;  4G7O C;  3FKI B;  3TII A;  2A1A A;  3OWF A;  2SNM A;  4YCW A;  3HOV B;  1UWV A;  1SYG A;  5FKA C;  2B63 H;  3P7J A;  5KFT A;  5C3X A;  4DA2 A;  5AJ3 Q;  3RBE A;  1O75 A;  1PMR A;  1D5X C;  2ZTD A;  4DV2 H;  1SYD A;  2YV5 A;  4GNX A;  1CQI B;  4A3E H;  1JIC A;  4A93 H;  1KJQ A;  4IQZ A;  1TKW B;  3S1N H;  3WO1 A;  4APM A;  5LMN H;  1EYZ A;  1LTB D;  1FNW A;  3RGZ A;  2C5C A;  3UQ8 A;  3OWE B;  2L9H A;  5IWA L;  2HDL A;  2NZ1 D;  2AHO B; 
#chains in the Genus database with same CATH homology
 5ELN A;  4GOP B;  2JE6 I;  1I50 H;  4DV6 Q;  3E0E A;  5HGQ A;  4QQB X;  5C44 G;  3A74 A;  1B7Y B;  3F2C A;  4XIG S;  1I5F A;  1X65 A;  4DV0 Q;  3H15 A;  3U58 A;  1VQK A;  4B3S L;  1K83 H;  2IX1 A;  1EIF A;  3A5Z B;  1H95 A;  4DV7 L;  5M3M G;  4DV3 Q;  5GRO A;  2LXJ A;  3U50 C;  1CUK A;  5C3E H;  3CCU A;  4AH6 A;  4DV4 L;  3U4Z A;  3J80 i;  2PNH A;  4DR6 L;  1K9M C;  4GLV B;  3S15 H;  2EXD A;  3GTQ H;  4DR2 L;  4KI0 A;  1MJE A;  4TQU S;  3K7A H;  1VQD A;  3GD7 A;  4A76 A;  2VQE Q;  3KJP A;  3VDY A;  2Q2H A;  3BJU A;  3CP0 A;  2NVY H;  3FHW A;  3CCL A;  1PYB A;  2VUM G;  3HOZ H;  2KCM A;  1HR0 Q;  4OON A;  2DGY A;  4HID A;  1SLJ A;  1L1O C;  1VQC A;  4L5R C;  3NEN A;  4DR7 Q;  2WB1 G;  1HNW L;  3CCE A;  4JI3 Q;  3I7F A;  5GAE C;  4TVA B;  5FJ8 G;  4IO9 A;  4A3I H;  2A8V A;  3PF5 A;  3PF4 A;  3PO3 G;  3J81 c;  3HOY H;  2CQO A;  3PUV A;  1XMQ L;  5IE8 A;  2K14 A;  1IBL Q;  3G71 A;  4R1J A;  3HKS A;  2AWN A;  1YHQ A;  4GN4 B;  1VQO A;  4NXM L;  3H3V H;  4JV5 Q;  4A3J H;  3ZJY C;  3A5U A;  1XNR L;  4KLK A;  1FVI A;  2UXD L;  1JT8 A;  4KHP L;  2HQL A;  1KQS A;  3S14 H;  1YZ6 A;  4YCU A;  3RNU A;  4BBS G;  1JB7 A;  4OWX B;  1PH9 A;  1S40 A;  5IP9 G;  2RHS B;  3M9B A;  1WOC A;  1HZB A;  2CWA A;  5M5W H;  2F4V L;  5IT9 c;  2R93 G;  1O7I A;  4DNI A;  2Z6K C;  1QZH A;  1V9P A;  1EOV A;  2IY5 B;  2ZJP A;  1S72 A;  2Q2T A;  5H1S E;  2L15 A;  1Q46 A;  2MFI A;  4RMF A;  3K0X A;  3NEL A;  2YYZ A;  1M90 C;  5JJL A;  1QUQ A;  5EAY A;  1KIX A;  1Z9F A;  2F4V Q;  1C0A A;  2MO0 A;  5IWA Q;  2MQH A;  4YHH Q;  2NVT H;  5LMU Q;  1BVS A;  3TRE A;  4LUV A;  1N9W A;  1VQL A;  1TXY A;  3M4P A;  3PIO A;  3I4M G;  3I4N H;  4A3G G;  4BXX G;  1WFQ A;  4R4O A;  2NZO A;  1NMF A;  3UDI A;  1AE3 A;  5IP9 H;  2ZJR A;  2H5X A;  2K75 A;  4Y52 H;  4WJ3 M;  4DPG A;  1UE7 A;  1WCM H;  1IBK L;  2F52 A;  2ZTC A;  1VQF A;  2UUB L;  4B3R L;  4P75 A;  4EQ5 A;  3I2Z A;  5AJ3 L;  2HIX A;  4A3L H;  4LF8 L;  4B3M L;  3WWV A;  1I94 L;  1S3O A;  1VQE A;  4K0K Q;  1V43 A;  3HOV G;  3HKZ G;  2I5M X;  3FKI G;  2JA9 A;  2R6G A;  2WAQ E;  3L7Z C;  4POF A;  3GO5 A;  4X65 L;  5GAH C;  1YI2 A;  1IBK Q;  3CCS A;  4BY1 H;  2OTJ A;  4WJ4 A;  2UUA L;  1IXR A;  2D62 A;  1LTL A;  1HNX L;  2ZJQ A;  4DKA C;  4L5T A;  1C7Y A;  4OO1 I;  1I3Q H;  2JQO A;  3AYH B;  4B3S Q;  1YEZ A;  3AEV A;  4IOA A;  4OX9 L;  3KDF A;  1VQ5 A;  2V1C C;  4DV1 L;  2BH2 A;  2JK8 A;  2JA6 G;  1Y1W G;  4BY1 G;  4DV7 Q;  4BBR H;  3F1Z A;  3JAM c;  1K8A C;  4APV A;  3FP9 A;  1IL2 A;  4GN3 B;  2IHF A;  4O2D A;  2UU9 Q;  4JYA L;  3RLN A;  2OQK A;  1X9N A;  5FLM H;  1PH3 A;  2MNA A;  4GKK L;  3J81 j;  2YU9 H;  1L1O A;  4DV1 Q;  1Z47 A;  1Y1W H;  3CC4 A;  4NXN L;  4AYB E;  4LF9 L;  3PO2 G;  1HZ9 A;  5IY0 A;  2R7F A;  1K73 C;  3I4M H;  4A3C H;  4IFD J;  3BU2 A;  1CKN A;  4YCV A;  1U5K A;  3T1H L;  2UXD Q;  4DV2 Q;  4DR6 Q;  3K81 C;  1HR0 L;  3G4S A;  4LF7 Q;  1VQM A;  1EFW A;  2UXC L;  5C44 H;  1PH4 A;  1GKH A;  4A3K G;  3NBH B;  1PH2 A;  1K3R A;  1X55 A;  1IBM L;  4J15 A;  1KHI A;  1PA6 A;  2B29 A;  2PQA A;  2YTV A;  5LMN L;  1N36 L;  5BR8 Q;  1KD1 C;  1IBL L;  4DR7 L;  1XNR Q;  3Q8D A;  1Q1E A;  1UEB A;  1VQG A;  2AMC B;  2JEA I;  3HOU H;  1N33 Q;  1YNX A;  4JI5 L;  5M5X H;  1HJP A;  1OXT A;  3CC7 A;  3HOW H;  4HJ5 A;  4JI2 L;  1XMQ Q;  4YHH L;  4GS3 A;  1SMX A;  3CCV A;  2R7Z H;  3L0O A;  1VQI A;  1E7Z A;  4AYB G;  4DR4 Q;  5C0X I;  1OTC A;  4UY8 C;  3S24 A;  2NN6 G;  3LGJ A;  2OTL A;  4JI7 Q;  4LF5 L;  4KHZ A;  1EQQ A;  5JJK A;  4H02 A;  3G6E A;  1FGU A;  4C3I H;  1UE5 A;  2DUD A;  1GD7 A;  4JI1 L;  4GLX A;  2NVX H;  3A0J A;  4ME3 A;  3RZO H;  1RIP A;  1I6H H;  3OTO Q;  1DGS A;  4DR4 L;  2LXK A;  4X6A H;  2VZA A;  2E2I H;  4JOI C;  5IYC H;  2WAQ G;  1KC8 C;  4UPA A;  1Y1V G;  1YJ9 A;  3EN2 A;  1HNX Q;  4LUO A;  4BA2 I;  4P72 A;  2ZM6 L;  1KRS A;  1KL9 A;  1PH8 A;  4DV4 Q;  2E2J H;  1E22 A;  4DR1 L;  2HHH L;  2VW9 A;  1G29 1;  4B3M Q;  5C3E G;  1C9O A;  1PVO A;  4PMW A;  3HOV H;  4LW1 A;  3CXC A;  1N8R C;  4YWK A;  4LF6 L;  1HZA A;  2UU9 L;  4DK3 C;  2N49 A;  4JYA Q;  2E2H H;  4BA1 I;  2D0P A;  2Z0S A;  3L2P A;  1XMO Q;  3IRB A;  1VQ8 A;  1AH9 A;  1NMG A;  1TWC H;  1BBW A;  3E9I A;  4GLA C;  4Y7N H;  1ASZ A;  1JJG A;  1X6O A;  4R4T A;  1MKH A;  4UP8 A;  4DK6 C;  4YY3 Q;  4IOC A;  1CKO A;  1Q12 A;  1PH5 A;  3S1R H;  4JCV E;  3SGI A;  2XTI A;  3DM3 A;  3GTL H;  1IYJ B;  3S17 H;  2K5H A;  1J5E Q;  3ICE A;  3MEF A;  5LMN W;  4HIM A;  2ATW A;  1MIU A;  3E9H A;  3KF6 B;  1R9T H;  1PH1 A;  2JA5 G;  1UE6 A;  3CPW A;  4UP9 A;  4A3M H;  1QVF A;  1P16 A;  3HOX G;  1Q1B A;  4HIO A;  4LFB L;  5M3M H;  1VQ4 A;  2B3G A;  2GN5 A;  4X66 Q;  4HJ7 A;  3AFQ A;  3CC2 A;  2I5L X;  1EUJ A;  4POG A;  1FJG Q;  3S1M H;  3J80 c;  4A3K H;  3CQZ H;  4IPG A;  3CD6 A;  4QIW E;  4JBJ A;  5M3F H;  1QZG A;  2CWP A;  5GAD C;  2ES2 A;  4YWL A;  2Q2U A;  2VQE L;  1KRT A;  3M7N A;  2RHQ B;  1KXL A;  4LF7 L;  1TWA H;  4HJA A;  4BBS H;  3S2D H;  3UE1 A;  1OXS C;  1WYD A;  1X54 A;  1JJ2 A;  4DUZ Q;  2OCE A;  2JA5 H;  4A3D G;  2LSS A;  4JI7 L;  4GOP A;  2YTX A;  5J3B A;  4A93 G;  3PGZ A;  5BR8 L;  4JI0 Q;  1YHB A;  4JI6 L;  4K0K L;  3PCO B;  1OXV A;  3CAM A;  1NE3 A;  3K8A A;  4R4I A;  5FJ8 H;  4X64 L;  4GOP C;  4A3I G;  4X62 Q;  2HT1 A;  5M3F G;  4DUZ L;  4LUZ A;  4IPC A;  3J7Z C;  1NTG A;  4LFA L;  4JI2 Q;  3RR5 A;  2KHJ A;  4DR3 L;  4JI8 L;  4A3F H;  1Q7Y C;  2ID0 A;  3CCQ A;  1HNW Q;  1YVC A;  4RG1 A;  3NEM A;  1YIT A;  3UE0 A;  1HZC A;  2KHI A;  3AFP A;  1BBU A;  1UE1 A;  4JI4 L;  1GM5 A;  3W1B A;  4PZ8 A;  3GTO H;  5IYD G;  1Q82 C;  1VQB A;  4NXM Q;  4C3H H;  2ASB A;  1AE2 A;  3OYY A;  3PUZ A;  4HJ9 A;  4LFC Q;  3UDG A;  1W3S A;  2R92 G;  3CCJ A;  5C4X G;  1YBY A;  3TS2 A;  2PMZ E;  4OXP A;  1CKM A;  4A3F G;  1PYS B;  2UUA Q;  3TS0 A;  1LUZ A;  2ALY B;  2Q2I A;  3KYH C;  4IFD I;  4A75 A;  1I94 Q;  1Q81 C;  2CCZ A;  3F2B A;  1N34 Q;  4OWW B;  1XNQ L;  4PZ6 A;  3ULL A;  1FL0 A;  1SN8 A;  1SR3 A;  3W5O A;  1A62 A;  1HR0 W;  1P8L A;  2K5N A;  3J81 i;  1VS0 A;  3K80 C;  2WP8 J;  4HJ8 A;  4C2M H;  2E5L Q;  4A3B H;  4DR2 Q;  2BA1 A;  2QEX A;  1XTD A;  1B70 B;  3ULP A;  1QVC A;  2MO1 A;  4P73 A;  4AIM A;  1IZ6 A;  4DV3 L;  5E7N A;  4A3E G;  1G51 A;  4NB3 A;  4LF9 Q;  3B6Y A;  2NVQ H;  4B3T L;  2E8G A;  2XGT A;  3CPF A;  2NN6 I;  3PV0 A;  4YWM A;  1CSP A;  1YIJ A;  1XPR A;  1PH6 A;  4DV5 L;  1W2B A;  2B63 G;  1E24 A;  1EWI A;  2BH8 A;  2I5H A;  4A3C G;  3JC6 6;  4BY7 H;  1MJC A;  3PSI A;  3S16 H;  1KAW A;  4JOI A;  3GTJ H;  2Y0S E;  3STB C;  1PH7 A;  1VQ9 A;  3M3Y H;  4X66 L;  3J7A 5;  1J5E L;  1L1O B;  1LM0 A;  2D0O A;  4GN5 A;  4P74 A;  4DR5 Q;  1PHJ A;  1FJG L;  3T1H Q;  1Q86 C;  3RN5 A;  3PO3 H;  5FLM G;  4QL5 A;  5JEA J;  2Y0S G;  3HOW G;  1OXU A;  1X3E A;  4JBM A;  2CFM A;  1VQH A;  1PV4 A;  3HOZ G;  3KOJ A;  1CKN B;  2VNU D;  1E1O A;  1VQA A;  2N3S A;  4HIK A;  2GVA A;  2JA8 G;  3KF8 B;  3CW2 C;  4MZ9 A;  3JAM i;  1VQP A;  1VQ7 A;  4DR3 Q;  1WI5 A;  5JEA G;  2F3I A;  3KF6 A;  3ULJ A;  2UXC Q;  1NBW A;  2PI2 A;  1T9H A;  1Y14 B;  1L0W A;  4QGU A;  4LF5 Q;  2UUC Q;  2HIV A;  1K8G A;  1EQR A;  1HH2 P;  2VL6 A;  5IP7 H;  1E3P A;  4JI6 Q;  5IYB G;  5C0X J;  3GTM H;  4R4Q A;  2KBN A;  1U0L A;  2N78 A;  1EIY B;  3OW2 A;  3EIV A;  4LFA Q;  1K0R A;  2K52 A;  4UP7 A;  4DAY B;  1QVG A;  4JI3 L;  1GO3 E;  3KDF B;  4LFC L;  4GNX B;  4JI5 Q;  3U4V A;  2VUM H;  4KHP Q;  4JI0 L;  2JA8 H;  5DLQ E;  1WCM G;  5IP7 G;  4XTC S;  5IYC G;  4GNX C;  4OO1 G;  3TEH B;  4JV5 L;  3H0G G;  4LF8 Q;  3I4N G;  2KCT A;  4JI4 Q;  4BXX H;  1A63 A;  1D8L A;  1EYG A;  2UXB L;  5IYD H;  2N8N A;  1QUQ B;  3KLW A;  4LF4 L;  1XNQ Q;  2CKZ B;  2OQ0 A;  4OWT B;  3PUY A;  5M5Y H;  3PUW A;  4DAM A;  1SFO H;  3PUX A;  3RLF A;  2K5V A;  4IPD A;  3CMA A;  2ZM6 Q;  3KFU A;  1VQN A;  1JE5 A;  5LMU L;  2UXB Q;  1SRO A;  2IHE A;  2RCN A;  3MXN B;  1NJI C;  2R7D A;  3PIP A;  2C35 B;  5C4J H;  3F2D A;  3S1Q H;  3ERS X;  4YY3 L;  3FKI H;  5GQO A;  3TRZ A;  4FDB A;  1YJN A;  3HOU G;  4LF6 Q;  4DUY Q;  1JMC A;  1PFS A;  5K36 G;  1V1Q A;  3W1G A;  3RZD H;  2HHH Q;  3CME A;  3I56 A;  4A3B G;  2R93 H;  3OTO L;  3D31 A;  3HKZ E;  3CCM A;  1B8A A;  4NXN Q;  4GKJ Q;  2VQF Q;  3HFZ B;  3RLO A;  5C0X G;  2K50 A;  2A19 A;  2AWO A;  1BKB A;  4QY7 A;  1XJV A;  4X65 Q;  3M85 A;  4DUY L;  4A3G H;  2BA0 A;  3GTK H;  4A4I A;  2UUB Q;  4QJF A;  2PI2 E;  4B3R Q;  4C3J H;  1J6Q A;  2E5L L;  3CCR A;  2YTY A;  3GTG H;  4A3J G;  3PO2 H;  2VQF L;  3D0F A;  4OX9 Q;  3S2H H;  3T1Y Q;  2FXQ A;  1Q8K A;  3BZK A;  1IBM Q;  1WJJ A;  4BY7 G;  2VY3 A;  4P71 A;  1N32 Q;  1OXX K;  3HOX H;  4L5S A;  2EIF A;  4IPH A;  3H0G H;  4DV5 Q;  4A3L G;  4LFB Q;  3GDE A;  1E1T A;  1TWG H;  3EBE A;  1LYL A;  4BBR G;  1XPU A;  2K4K A;  3KJO A;  1L2F A;  1N32 L;  1X3F A;  1D7Q A;  2JA6 H;  2QGQ A;  3RN2 A;  4IFD G;  1NY4 A;  5JJI A;  5HY6 A;  2Z6K A;  1Y1V H;  4JG2 A;  2RF4 A;  3K7U C;  4DR5 L;  1X56 A;  2NZH A;  4GKK Q;  4DV2 L;  1A0I A;  4JI8 Q;  5IYB H;  3M4O H;  4JBW A;  1XPO A;  5LMN Q;  1N36 Q;  3HOY G;  3M4Q A;  1SRU A;  3TQY A;  1N33 L;  2IT1 A;  4IJH A;  4JBK A;  1SE8 A;  3UDX A;  3DLL A;  1GVP A;  3CF5 A;  4AQY Q;  1HNZ L;  4A3D H;  5C4X H;  3STB D;  3AQQ A;  4X64 Q;  3I55 A;  4NPS A;  3F8T A;  2GVB A;  3UDF A;  2UUC L;  3G48 A;  2VS1 A;  2JA7 G;  4EX5 A;  3BZC A;  1CSQ A;  2WFW A;  4IJL A;  4MNO A;  4JC0 A;  1YJW A;  4DR1 Q;  2OWO A;  2I0Q A;  4PG3 A;  4AQY L;  1HNZ Q;  1JJC B;  4R4C A;  2QA4 A;  2WB1 E;  1RL2 A;  1VCI A;  3GTP H;  2PQA B;  4LF4 Q;  4LNQ A;  1G6P A;  2A1A A;  4MTN A;  4YCW A;  5GAG C;  1XMO L;  1VQ6 A;  1UWV A;  1M1K C;  1A8V A;  2B63 H;  4A3M G;  1VQJ A;  5AJ3 Q;  4X62 L;  2EQS A;  1YHA A;  3H3V I;  4GKJ L;  4PZ7 A;  2ZTD A;  2R7Z G;  1ASY A;  2YV5 A;  1X3G A;  4GNX A;  2ZTE A;  4O0A A;  5FLX c;  2KEN A;  4A3E H;  2JA7 H;  1TWF H;  2JJQ A;  4L5Q A;  4A93 H;  3ER0 A;  2JEB I;  4DV6 L;  3S1N H;  2R92 H;  4B3T Q;  4JI1 Q;  4ALP A;  4DV0 L;  1TWH H;  2IX0 A;  4LWC A;  5IWA L;  3I4O A;  5ELO A;  2AKW B;  1N34 L;  3T1Y L;  2AHO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...