2JA5G

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja5G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja5G01
3HKZE 3GDEA 2PNHA 4DV3L 4GOPB 2RHQB 1CUKA 3M85A 3UDXA 1VQAA 3DM3A 3G71A 3CW2C 4P74A 4GLAC 4LFAL 2AWNA 1WI5A 4IPHA 1HZAA 4LFCL 1XPRA 2ASBA 4LF5Q 4ME3A 1MIUA 2F3IA 1U5KA 3UE1A 4AIMA 2F52A 3CC2A 2N8NA 3ULLA 5C44G 1H95A 5C4JH 1Q86C 4JI7L 2ID0A 3H15A 2UXCL 2E2JH 4NXNL 3T1HQ 1K73C 1PH8A 1HR0L 1X6OA 4EX5A 2KENA 2Z6KC 4FDBA 3HOXH 4A3DG 2IX1A 3RLFA 2C35B 3J80i 3HOUH 1HNWQ 2HT1A 5ELNA 2KCMA 4BA1I 5FLMH 2K4KA 4HJ5A 4DR1L 5IP7H 1QVGA 1A63A 4YCWA 1EYGA 4DAYB 4A3FH 5IY0A 3NELA 1BVSA 4DV0L 2HHHL 4BXXH 3RZOH 4P73A 1P16A 4PZ7A 4YCUA 4C2MH 1Q1EA 2ZM6Q 1WCMG 4DR2Q 1MJEA 1K9MC 1IYJB 4DV7L 3S2HH 2UXDL 5GQOA 2UUBQ 2JJQA 2XGTA 4C3IH 2K75A 4IPCA 1VQ8A 4LFBL 3B6YA 1QVCA 3LGJA 3HOYG 4R4IA 4NB3A 4APVA 4A3MG 1YJ9A 2XTIA 1VQDA 3I7FA 1PVOA 5M3FH 3D31A 1XNQQ 1XMQQ 2CWPA 4HIKA 1Z9FA 1E1OA 4BY7H 2Z0SA 5GAHC 4LF9Q 4JI6L 3I2ZA 3GTLH 1JMCA 4GN4B 4DV4L 4DUZL 2NVXH 1PH4A 3BZKA 2UXBL 4YY3L 4QL5A 1C0AA 3D0FA 1N32L 4JI1L 2UXDQ 3HOVH 4H02A 5JJIA 3M4PA 3L2PA 4A3IH 4LUVA 3PF4A 3CMAA 2Z6KA 3M4QA 2E5LQ 1UWVA 3CF5A 4AQYL 3CCJA 1X3FA 4JI8L 5E7NA 1D8LA 1N36Q 2HQLA 2Q2IA 4KHPQ 2OQKA 4JYAL 1PA6A 5IT9c 3I4MH 1V43A 1HH2P 2AWOA 3PV0A 3J7ZC 2UU9Q 1OXSC 1IBLL 1FGUA 4IPGA 1D7QA 3AYHB 1VQCA 3K8AA 3PUVA 4JI3L 1GM5A 2ZJPA 2KHJA 4GNXB 2JA8H 3GTKH 3HKZG 1K0RA 3CC7A 1FJGQ 2VQFQ 5M3MH 4JI5Q 3L7ZC 4JBKA 1XPUA 3T1YL 4DR6L 3STBD 2NVYH 2N3SA 3WWVA 1IXRA 4JG2A 1UE6A 4GOPC 1IBMQ 4A3LH 3PUYA 1Q7YC 1SLJA 3J81c 1SRUA 1WJJA 4X64Q 1RIPA 4P72A 1QVFA 4J15A 2R6GA 3CAMA 3GO5A 4R4QA 3MEFA 3E9HA 1J5EL 3CQZH 2R93G 1HNXL 3TS0A 4DR3L 1IBKQ 2CCZA 2YTYA 4JI2L 3A0JA 1TXYA 3H0GH 4LF4Q 3PO2H 4OONA 5IYDG 1E1TA 2VS1A 4XIGS 4DV2L 2UUCQ 2ZTDA 4PZ8A 1NE3A 1VQHA 5IYBG 1KIXA 2PQAB 2B63G 2F4VL 4GKJL 4OO1I 4Y52H 3NEMA 1E3PA 2WAQE 4JI4L 4JV5L 2N78A 3K0XA 5C0XG 4DV1Q 4P75A 2R7FA 2VUMH 1LYLA 2IHEA 1C7YA 1EUJA 1VQBA 4DR4Q 4R4TA 2R7DA 4DR7Q 3S24A 1WFQA 4B3TL 5IP9H 2I0QA 1E7ZA 4X65L 1Q1BA 4DUYQ 4X6AH 1Y1WH 3I55A 1XNRL 3OW2A 1VQEA 2LXKA 4GS3A 1HNZQ 4QJFA 5M5YH 4QY7A 5C3EG 1M90C 1IZ6A 3GTGH 2ALYB 4LUOA 3CCQA 5GROA 3A5ZB 4GN3B 2K5HA 2UXBQ 2JA9A 3M3YH 3PO3G 2VZAA 5IYCG 4YWKA 3W5OA 4LF8L 2L15A 1AE2A 5GADC 1PYBA 1QZGA 4B3ML 1T9HA 5HGQA 1N34Q 1KL9A 1PH7A 1Q82C 3PF5A 4GOPA 4L5RC 1TWHH 2IY5B 4POFA 2K14A 5C44H 3KYHC 5FJ8H 3AEVA 1VQOA 1CKNB 4B3SL 1YBYA 4YHHL 4LF7L 2WB1E 1VQ4A 4LF6Q 3ICEA 4A3DH 1PHJA 3OTOQ 4OO1G 1NBWA 1VS0A 1Z47A 1OXTA 4X62Q 5LMNL 5BR8L 4JBWA 2IX0A 4HJ7A 5LMUL 3KF6B 2FXQA 2ZJQA 3U58A 2JA5G 4LWCA 4GKKQ 4OX9Q 2Y0SE 4MNOA 5C0XJ 1WCMH 2B3GA 3CCMA 2QA4A 1VQLA 1Y1VG 1VQNA 1G6PA 4JI0L 2IT1A 5IE8A 3I4NG 3GTJH 1KQSA 4GLVB 3HOYH 5C4XG 2GVBA 2VW9A 1L0WA 4A3MH 3UE0A 1EOVA 4KLKA 2VQEQ 3HFZB 4JI6Q 3W1BA 4JCVE 1YHBA 3GTQH 1Y14B 1PV4A 4IFDJ 4HJ9A 2YYZA 2K50A 1VQKA 1QUQB 1OXUA 4A3CG 4GNXC 1XMOQ 2MQHA 2N49A 1GO3E 2JA7G 2JK8A 4JI1Q 4IOCA 2VNUD 4K0KQ 1ASYA 3DLLA 1SN8A 1VCIA 4POGA 4X66Q 1G291 2KBNA 2LSSA 1NMFA 4DV5Q 1YJWA 1EQRA 2EQSA 2Q2HA 2V1CC 1YJNA 1K8AC 3NENA 4KHZA 3E9IA 4LF5L 4MZ9A 1JE5A 2Q2UA 3F8TA 3K7UC 4AQYQ 2I5LX 3PUXA 1X56A 3CCLA 3OYYA 5M5WH 1VQPA 5JEAJ 1YEZA 4O0AA 1I3QH 1HZ9A 3E0EA 3CD6A 2BH8A 3T1HL 4A3EG 3S14H 4A3BG 2D62A 2EXDA 4RG1A 4O2DA 2WAQG 1IBLQ 2R92G 1EWIA 4A93G 1PYSB 4DR5Q 3M4OH 1KD1C 1K8GA 4A3FG 3S1NH 4A3JG 1Q12A 1I94Q 2QGQA 1L2FA 2RHSB 3U4VA 4DKAC 1HR0W 1JT8A 3BU2A 2YTVA 4DR6Q 4GLXA 1WOCA 4DR2L 1YIJA 1TWFH 2YV5A 3NBHB 3F1ZA 3PIOA 4JBMA 1JJGA 1O7IA 2OTLA 4DPGA 5C0XI 1VQFA 1X65A 3J80c 3HOWG 1YI2A 1CKOA 1OXXK 3TQYA 3G48A 3JAMi 1PH3A 3GD7A 3CCSA 3G6EA 1FL0A 2EIFA 2BA1A 1W2BA 1LTLA 4GNXA 2GVAA 3ERSX 1XNQL 1TWCH 5GAGC 1XMQL 1N9WA 1YHAA 1B7YB 1NMGA 2H5XA 1MKHA 3M9BA 4A3KG 4MTNA 4LF9L 2R93H 2IHFA 3A74A 1S3OA 4B3RQ 4NXMQ 5IYDH 2JA6G 1LUZA 1SE8A 4JV5Q 2K5VA 3HOZH 5IYBH 4DK6C 3EBEA 4UY8C 2B63H 3CXCA 2E2IH 4P71A 4A3GG 3BJUA 4IO9A 1J6QA 4BY1G 1YHQA 2NVTH 1YVCA 4RMFA 4R1JA 2NN6G 2E5LL 4ALPA 2Y0SG 1ASZA 1RL2A 4OXPA 5AJ3Q 3KOJA 4KHPL 2OQ0A 2BA0A 5K36G 2PQAA 2NZOA 1VQMA 5C3EH 1CSPA 2UU9L 1N8RC 4DV3Q 1HJPA 2K5NA 3CP0A 4LW1A 5IYCH 1YITA 2YU9H 2BH2A 3J7A5 2OCEA 4DNIA 3K81C 4HJAA 1C9OA 4R4CA 1LM0A 4C3HH 2UUAL 3J81j 1FJGL 2VQFL 4LFAQ 4JI5L 4QQBX 4OWXB 4IFDG 1X9NA 2D0OA 4YHHQ 4LFCQ 1MJCA 3KDFB 4YWLA 1K3RA 3AFPA 4TVAB 1FVIA 1KRSA 2I5MX 1IBML 1V9PA 1A8VA 2QEXA 4HIMA 3PSIA 2E8GA 4X64L 3CPWA 1N33L 2AMCB 1VQ7A 4JI7Q 2ATWA 3EN2A 1JJCB 1L1OB 4NXNQ 2UXCQ 1HR0Q 2JA5H 1GVPA 1EIYB 2D0PA 1XTDA 1IBKL 4LF4L 2GN5A 2CQOA 1P8LA 1CKNA 3ZJYC 4DR1Q 5JEAG 5IWAL 2R7ZG 1Y1VH 3GTOH 4WJ3M 4L5SA 4GN5A 3PUZA 3KF8B 5J3BA 2JQOA 2AKWB 4DV0Q 2HHHQ 1GKHA 2ES2A 3I4NH 4DV1L 2KHIA 3M7NA 1E24A 1SROA 3KF6A 1I50H 5GAEC 3CCVA 3TREA 4DV7Q 3FKIG 1EQQA 4DR4L 3U4ZA 4AYBE 3PIPA 4UP8A 4BBSG 4DR7L 1PFSA 1UE7A 4DUYL 3HKSA 1UE5A 3S1MH 2RF4A 4A3CH 3CCRA 3UDGA 4JC0A 4BBRG 2JA7H 4LFBQ 1HNZL 1BBWA 1VQJA 3I4OA 3CC4A 1U0LA 1PH2A 4DV6L 3A5UA 1B70B 3KJPA 1SR3A 4DV4Q 4DUZQ 1K83H 1X55A 2NZHA 4C3JH 5EAYA 3EIVA 5H1SE 4YY3Q 1QUQA 1N34L 1N32Q 2E2HH 1B8AA 4L5TA 5FJ8G 1JB7A 2MO1A 5JJLA 2B29A 3CCEA 4JBJA 2HIVA 3SGIA 4A3EH 4A3BH 4BA2I 3AFQA 4LF6L 1CKMA 2PMZE 1KRTA 3Q8DA 1V1QA 2R92H 3OTOL 2YTXA 3CCUA 4A93H 1AH9A 2JEBI 3AQQA 4X62L 1HZBA 4JOIC 4JI8Q 4A3JH 3CPFA 4TQUS 3UDIA 3K7AH 2CWAA 4IPDA 4EQ5A 3S1RH 1EFWA 1E22A 3HOXG 4JYAQ 4GKKL 1PH9A 4QIWE 3HOUG 2ZJRA 5LMNW 4OX9L 3F2BA 3FHWA 3J81i 5FLMG 5IP7G 2JEAI 1R9TH 1HNWL 4JI3Q 3S17H 2HIXA 3HOWH 4UPAA 4A4IA 3RZDH 3RLOA 3ULJA 4BXXG 2OWOA 2NN6I 2ZTEA 4PG3A 5FLXc 3T1YQ 1SFOH 3F2CA 1KC8C 2VQEL 1KAWA 1M1KC 2ZM6L 2JE6I 3RNUA 1UE1A 4IJLA 3UDFA 2K52A 3GTMH 5DLQE 4A3KH 3STBC 1XPOA 2UUBL 1XMOL 2A1AA 1Q81C 1Q46A 3W1GA 4K0KL 3FP9A 1PH5A 1VQ5A 2JA6H 1A62A 5M3FG 1BBUA 2CFMA 1NY4A 4X66L 4HJ8A 4AH6A 4BY7G 1CSQA 4HIDA 5JJKA 1J5EQ 4KI0A 4DV5L 1G51A 1HNXQ 2OTJA 3IRBA 4DR3Q 1VQIA 4OWTB 4JI2Q 4A76A 2MFIA 4A3GH 3G4SA 4IFDI 3CMEA 4DV2Q 4UP9A 1XJVA 4BY1H 1VQ6A 1EIFA 2KCTA 4DK3C 4IJHA 2F4VQ 2A8VA 3HOVG 2WB1G 2AHOB 1L1OC 1YZ6A 3KLWA 3L0OA 4YCVA 4GKJQ 4JI4Q 3ULPA 1IL2A 3I56A 4A3IG 4JOIA 2MNAA 2A19A 1KHIA 2ZTCA 3KJOA 4NPSA 4B3TQ 1S72A 2PI2A 4X65Q 4DR5L 3PGZA 3H3VI 3MXNB 3S16H 3K80C 1W3SA 3TS2A 4AYBG 1I94L 1XNRQ 4WJ4A 2UUAQ 3RN5A 2CKZB 1N36L 4R4OA 3I4MG 2MO0A 1TWAH 1GD7A 4LNQA 1WYDA 1BKBA 4LF8Q 1KXLA 2I5HA 4DAMA 4B3MQ 2JA8G 1DGSA 1N33Q 2WFWA 2NVQH 5M3MG 4OWWB 1UEBA 4Y7NH 1PH6A 4YWMA 5HY6A 1VQ9A 5ELOA 1OTCA 2PI2E 2VL6A 3S2DH 3H3VH 4PMWA 4B3SQ 1AE3A 3RN2A 4LF7Q 4A3LG 3PUWA 1I5FA 1SMXA 3TRZA 3RR5A 5IWAQ 4IOAA 4A75A 3KDFA 4HIOA 2VY3A 3HOZG 1PH1A 4PZ6A 5LMNQ 3BZCA 5BR8Q 5M5XH 1JJ2A 4NXML 3KFUA 4B3RL 2R7ZH 4LUZA 3U50C 3JAMc 5LMUQ 3TEHB 2DGYA 3RLNA 1HZCA 1X3EA 3PO2G 3PO3H 1L1OA 2Q2TA 1X3GA 2WP8J 3H0GG 1S40A 4XTCS 4QGUA 1YNXA 3FKIH 4BBSH 3F2DA 1A0IA 4JI0Q 1Q8KA 1I6HH 3VDYA 2UUCL 1VQGA 3PCOB 2LXJA 3S15H 1NJIC 4BBRH 1QZHA 2VUMG 5AJ3L 3ER0A 1NTGA 3GTPH 4L5QA 2DUDA 1X54A 1TWGH 4UP7A 4DV6Q 5C4XH 3JC66 1OXVA 5IP9G 2RCNA 3S1QH 1Y1WG
chains in the Genus database with same CATH superfamily
3HKZE 2K1BA 1AN8A 1H9SB 2PNHA 5D1PA 5J39A 3I4MB 1CUKA 2QCPX 4EEQA 5DG9A 1VQAA 3NBIA 1E4FT 5DG7A 4JI6H 3I90A 4LFAL 2UXBH 5IIFA 1N32H 1MSGA 2LS01 5CMDA 4LF5Q 4K0KH 3J80L 4EQOA 4N9PA 1FR3A 2ALZA 2F0LA 5KYIA 3ETHA 1A2TA 2AU0A 2KCNA 1D6EC 3DHQA 3H15A 4XQNA 2E2JH 4PDBA 3QR8A 1HR0L 4AQYH 2KENA 4YJ3F 3HOXH 5L9XA 2NVQB 1E2VA 1UC9A 4YB8B 4L63B 3J80i 3OUUA 4S3SA 4BA1I 2EE1A 3CQZB 1EYCA 4YCWA 3PO2B 1EYGA 4DAVA 1W6JA 3V05A 3ORQA 4F4ZA 3RB6A 3AU7A 4G7ZC 2HHHL 4IHJF 5CV6A 5J22A 1EY6A 4YCUA 1MJEA 4MV3A 3LWBA 2M9VA 2JJQA 2R7ZA 5H80A 3DWPA 2VB3X 1VQ8A 4LFBL 1QVCA 2F0FA 4KK7A 1KNEA 4F4XA 2XTIA 1Y1WB 2OH2A 2JA5A 5F2DA 2E2DC 2UVRA 4FF3A 4HCEA 4BY7H 5GAHC 4HNVA 4ED8A 4O3OA 1GUOA 3D6CA 1JMCA 5K2MA 3T5LA 3IKJA 3BZKA 1EY0A 4YIJA 3M3YB 1EL0A 4QL5A 2AQ1B 4RHRA 1JORA 5KT2A 3J80W 3D4WA 3ETJA 4H02A 1QG7A 4RGTA 1JICA 1XX8A 1AN7A 4FXGC 3M4QA 5EWFA 2EVBA 2RKSA 2J6SA 5KFLA 5CV5A 1N36Q 2NBFA 3G7LA 1XNRH 1XTCD 3KALA 1S03G 4YBZB 4WRDA 4WORA 1QE6A 1IBLL 4FU0A 4IPGA 3AYHB 1VQCA 1GM5A 1STNA 4F88A 3GTKH 3MFIA 1FJGQ 2J4XA 2O4XA 3STBD 4DR6L 1Y8NB 2WAQA 3HZXA 1IXRA 4JG2A 1UE6A 4L6TB 1IBMQ 1SNPA 3E6ZX 1BOSA 1SE3A 1SRUA 4YAJB 4X64Q 3ERQA 3VR6A 4B3SH 4J15A 5KGUA 4G7HC 4MV9A 2M2LA 2F3WA 5LMNH 5BR8H 4CKEA 4IN3A 5DM73 3TS0A 2YTYA 4JI2L 3H0GH 4DV2L 2UXCH 3SVMA 3KK7A 1KJIA 4MV7A 2ZTDA 1F2LA 4PZ8A 4OO1I 3G6JB 3NEMA 3GTLB 2N78A 3A8IE 1ZETA 2R7FA 1AZQA 2GLTA 2IHEA 3RGXA 3GTMA 1EUJA 2F0HA 5DAUA 4DR4Q 4H0LC 3S24A 3K59A 1UC8A 3WDNA 2KEEA 2FINB 3GV7B 4I65A 2W70A 2WKCA 5C3EG 1M90C 3GTGH 3AMUA 3CCQA 1I4GA 2QF7A 2K5HA 3KF8A 1N56A 2VZAA 2B2UC 4DXGA 3W5OA 4LF8L 5EJWA 2L15A 2Y0SA 5HGQA 5DNFA 1PH7A 4ZLTF 1Q82C 1DM0B 2PQEA 3H91A 2WIIB 3I73A 5EPKA 5FLXL 5GONF 3KYHC 2IMWP 4O3QA 2VR1A 4DV4H 1O7LA 2AGQA 1VQOA 1PRTC 5I6WA 4YHHL 4LF7L 4ETSA 4JBWA 4ED1A 3SK8A 2NVYA 1WTRA 4MV1A 5KFQA 1TWAA 2FXQA 2HCCA 1KC7A 4GKKQ 5D65A 2F0WA 1M4VA 2K03A 5C0XJ 3CCMA 2B63B 2QA4A 3OHBA 2C9OA 3R8BA 1Y1VG 2R87A 1G6PA 4DR2H 4RU9A 3FDSA 2NVTB 3J7AV 5FO7B 4PWQA 2GVBA 5KFIA 4DAYA 5KT6A 1EOVA 2F0PA 4KLKA 3HFZB 4JI6Q 2E74C 5NUCA 4IFDJ 2ICEC 5D8DA 2FPGB 1OXUA 1Q8IA 1SYEA 4A3CG 2BQRA 1GO3E 1EQVA 3KLRA 1XMQH 5IT9W 4K0KQ 2B2UA 3RUZA 2L12A 3RTXA 3RIZA 2VUMA 4LJZC 3PO3B 5JUMA 4I7AA 3OHAA 2F0GA 4RWSC 2XIWA 4X66Q 2H1EA 2PZTA 2KBNA 2Q8IB 5KG3A 4DV5Q 2Q2HA 1YJNA 3ND8A 1E0BA 3OPOA 4C3HB 4LF5L 3I3CA 3QO2A 4MZ9A 5FLXW 3J80E 3R2TA 4AQYQ 1NR2A 3CCLA 5M5WH 4I7ZC 1BCPC 3D6WA 3H4BA 1YEZA 3E0EA 1S5BD 2BH8A 2E5LH 2D62A 2RDIA 5IOCA 1EWIA 5CORA 4A93G 1LTID 1Y69U 3K5IA 1N48A 1K8GA 3V4ZA 5EPLA 1B1ZA 2HCIA 2JA5B 4HTHA 2QGQA 3H94A 3M9OB 1B9NA 3BU2A 1BJTA 2VPQA 2HUGA 2K5WA 4GLXA 1KJJA 4X65H 2F0SA 1WTXA 2YV5A 1I4RA 1DD2A 3RJ0A 3TSSA 3PIP3 2OTLA 3I4NB 1C4QA 5KX5F 3PQIA 1X65A 3VYRA 4TV8F 2A73B 1CQIB 3CU7A 2HQEA 2WACA 3LP8A 1TWCH 5GAGC 4H7BA 2HDMA 2JA7B 2KECA 3MWDA 4L1KA 3M9BA 1N33H 2H5XA 2F0DA 1SYCA 1S3OA 4PQXA 4A3MB 4B3RQ 4NXMQ 2QDBA 1TIID 3K3VA 2ZJTA 5HURA 1K1SA 2O2LD 3EBEA 3CXCA 3MFGA 2OEOA 5KG1A 5JVDF 3MR3A 2E2HB 4BY1G 1YVCA 1G2SA 3IG0A 5KFJA 4DV1H 4A3EB 1KDCA 2FB9A 2WAQB 5K36G 3KOJA 3A54A 3QFFA 3DWAA 5FD6A 2NZOA 5C3EH 4A3JB 1CM9A 4LH6A 4JI0H 2B2TC 2IX3A 2CH4W 5E3FA 1HNZH 2ATLA 1N8RC 1HJPA 4IR1A 1YITA 4LW1A 4EGJA 2W57A 4HMIA 3EPGA 1CZGA 1EHIA 5KG7A 2K6AA 1LM0A 3PVXA 2UUAL 3J81j 1FJGL 3HP3A 1LT4D 3CVZA 3T5JA 1N34H 5KFCA 1D5MC 4ZCKA 4YWLA 1K3RA 3AFPA 1IBML 3HKZA 2WV6D 4ECSA 2E8GA 3CRKC 4X64L 3TP8A 2EY2A 1VQ7A 4JI7Q 3NXWA 2UXCQ 2HVSA 3I8ZA 4NXNQ 1BCPF 1JQYD 1EIYB 3MEHA 2D0PA 2GN5A 1P8LA 4F8MA 3RD4A 5DM63 2A6HD 5IWAL 2R7ZG 1Y1VH 2W7OA 4GN5A 3KF8B 5J3BA 4A3GB 1I4QA 2JQOA 4DV0Q 1HNWH 4KV6A 3M7NA 3I4LA 3CCVA 5GAEC 1EQQA 4DR4L 4AYBE 2FPIB 4TRDA 3SK4A 3RV4A 2B2TA 3S1MH 4A3CH 2PMZA 1GSAA 4BBRG 1EOTA 5JPNC 4F7XA 4QW8A 3S16B 4CJ0B 2ZM6H 2R7MA 1KNAA 2JEFA 1PH2A 2EJMA 2R86A 5FKAC 1GSHA 5AFWA 2Z1CA 3OOCA 4DUZQ 4DV4Q 1AUVA 1MD2D 1TWAB 4O1NA 1X55A 2NZHA 4ZHQF 1JX4A 5FJ8G 1JB7A 3PZPA 2MO1A 2XWJB 3RGZA 3EA6A 4QF4A 3CCEA 3SGIA 4IRKA 3NPPA 5CGKA 1HHVA 1HA6A 5I2XA 5L1JA 4A93H 3OSOA 3S2DB 4JI8Q 1ZHQA 5C3WA 4F4WA 3FMAA 3K7AH 2CWAA 1EFWA 5EOYA 4JYAQ 3O13A 5FO8B 1I94H 4GKKL 4CC5A 1PH9A 1PX2A 3HOUG 1L0XB 3F2BA 3FMCA 1B2TA 5FLMG 1JWMD 4JI3Q 1EYDA 4A4IA 4C56C 4BBSB 2IW3A 1J8IA 1GGOA 3T1YQ 1SFOH 4IRCA 1EU3A 4C3IG 4ZI7F 3GTPB 3R5HA 2UUBL 4EYIB 2SNMA 5C4XB 1Q81C 1Q46A 4K0KL 1PH5A 1BXRA 1Z2PX 4O4HF 2FHTA 3FDTA 2J6TA 4X66L 4HJ8A 3Q8RB 4OIKA 1J5EQ 4DV5L 2OTJA 4ME5A 4DR3Q 2WINB 3CMEA 4BY1H 1XJVA 1VQ6A 2YCHA 3C1EA 2KHSA 4IJHA 1PFMA 2SEBD 4IR9A 1IL2A 2BQ3A 3I56A 5K36H 2MNAA 4RH6A 3DEOA 3EFXD 3IFTA 2PO4A 3SR1A 2E2JB 4X65Q 3RFCA 3H3VI 3K80C 3HOXB 2G9DA 4WJ4A 4ID6A 4JPBW 4XZ3B 5ELEA 3RN5A 2CKZB 4WFN3 4R4OA 2AUJD 5IGGA 2MO0A 4F87A 2XRQD 1HTLD 1OO9B 3C46A 4DAMA 4TQSA 4IWYA 1N33Q 2A5HA 4V190 4YWMA 5HY6A 5ELOA 1MGSA 2PI2E 1JLLB 4A3LG 1V1PB 2EYFA 1RTNA 1LT6D 1SMXA 2EZVA 4IOAA 4A75A 4TKOB 4HIOA 3HOZG 5D1OA 3URYA 4B3RL 4NXML 3KFUA 4BY7B 3MR5A 1KDAA 2MPMA 2R7ZH 3U50C 3JAMc 3Q24A 1Q90A 5JOBA 1JOQA 4N9TA 5KG2A 4ABNA 4DLKA 1BNZA 3E0JA 2Q2TA 2WB1B 2YYAA 1YNXA 1IKMA 3H3VC 2JA6A 3TN2A 2B39A 2X6GA 4JI0Q 2J0TD 1Q8KA 5KFMA 2PW7A 4J9NA 3PCOB 4ZKCB 5EWEA 3S15H 4BBRH 2VUMG 3ER0A 4LK1C 2EJGC 5CB4F 1OXVA 5IP9G 5KRUA 3TQTA 2PVPA 1VMPA 3K5NA 3RAXA 2VPSA 4EEYA 4IALA 3CW2C 3NWTA 3MWMA 1CFMA 4P74A 5BPFA 3GTKB 4J9QA 1EWHA 4JI1H 1HA5A 5KT3A 4TUYF 4ME3A 2YZNA 1MIUA 2F3IA 3BG5A 1IHZA 1ENCA 1U5KA 4AIMA 2CVRA 1BGWA 3WNZA 3Q6SA 3EJIA 3CC2A 4PMCA 4JI7L 2L1BA 2ID0A 2UXCL 3I91A 4NXNL 3MXPA 4DN4M 1X6OA 1E4EB 4FDBA 4A3DG 4N8FA 2IX1A 3RLFA 4IAJA 2ZDQA 4I50F 3GILA 3HOUH 1HNWQ 2HT1A 5FLMH 1QVGA 1A63A 3TINA 2QK4A 4J9RA 5K5PA 1JWUD 3H0GB 4KD4A 4A3FH 3L9AX 4UHVA 5IY0A 2FLPA 1PMRA 4DV0L 3A7LA 3RZOH 2NU9B 2ZM6Q 1IYJB 4JUZA 2AQ3B 2F0QA 5GQOA 2CHBD 1EEID 4C3IH 5KT5A 2EXZA 2L0CA 4NDXA 1NR4A 2K28A 3FVQA 4NB3A 4APVA 2FMMA 3DEPA 5KG5A 1XNQQ 3KHHA 3FKIA 4HIKA 3GTGB 4GN4B 4DV4L 4DUZL 1PXUA 1GUWA 3OHXC 1BBXC 1PH4A 2DJFC 2R8IA 3N42B 1C0AA 1M8AA 4ZQIA 4DL4A 1K28A 5DLFA 1K8MA 4CDFC 2SOBA 1SBBB 3L4JA 5KT4A 3M4PA 3OWEB 4O2AF 4GKJH 3PF4A 1EYAA 1JE4A 1Z2OX 4JI4H 5G3LF 4JV5H 3R5FA 3GIIA 4YR3A 2BQUA 4J8QA 3JRWA 4JI8L 4JV2A 1D8LA 4B3TH 2HQLA 2Q2IA 4KMUC 4EFBA 5CV4A 1A9XA 1SYGA 4JYAL 1SNDA 4X3UA 3PV0A 1HH2P 2AWOA 2ZXPA 2LY7A 1QWYA 2UU9Q 3MWYW 1G2TA 5JVLA 2K5QA 1STHA 2CQYA 5KNCA 3K8AA 4JI3L 1SE2A 1PTOD 3HKZG 3E5SA 3CC7A 2VQFQ 3T53B 4B3MH 4JBKA 1EFID 1XPUA 3T1YL 2F0EA 2NVYH 2JN4A 4HAEA 3GIMA 1WVLA 5I9OA 4GOPC 4A3LH 4KKSA 1SLJA 1FD7D 1Q7YC 1B6SA 3DMUA 5DQGA 2HVRA 1QVFA 1PK8A 5C5JA 5KFAA 4BWGB 5KFZA 4C2MA 2R6GA 1FNUA 3GO5A 4R4QA 2VA3A 3A8JE 1ULZA 3BA9A 2NWGA 4JW0A 1J5EL 5KFGA 2R93G 3N41B 2YL2A 4XYLB 4DR3L 4LF4Q 4EG0A 5LMUH 3A0JA 2NB0A 4OONA 1E1TA 2XC9A 3WOFA 4F4YA 4EVOA 2PQAB 1SFOA 4WBNF 4U7CA 2H4OA 4P75A 2VUMH 2NVXA 1HFNA 3Q8SB 4XXEA 1WTVA 2R7DA 4DR7Q 1GHKA 3VR3A 2IWHA 5IP9H 2RSNA 1GUTA 1E7ZA 4X65L 2I0QA 3HOVB 1S68A 4FF1A 4G7OC 3AB9A 3MR2A 4KKTA 1VQEA 4FVMA 4QJFA 5C4ZA 2ASLA 2B2VC 2VQDA 1LT5D 2N55A 5F9NA 2JA9A 3LWEA 4YWKA 5KG4A 4AYBA 1QZGA 1KABA 4Q43A 4HSPA 1T9HA 5ELCA 1RHPA 4L5RC 4GOPA 2IY5B 3RMHA 4POFA 3HRZC 5LL6b 1S0MA 2LKVA 1CKNB 4YY3H 4IRDA 3ICEA 2WB1E 4A3DH 3GQBA 1UNSA 5M3MB 1PHJA 3OTOQ 1TWCB 5JVG3 3T1HH 1OXTA 3LNNA 4X62Q 1S5FD 1ZQ7A 5E1FA 4K2KA 2JEGA 3KF6B 3MVVA 2FLNA 4DL5A 4MIUA 4LWCA 1DJRD 4MNOA 2B3GA 2X6LA 1VQLA 5E4WC 3FPUB 5KNDA 3RUPA 4JI0L 4QB4A 3TIGA 4YP3A 3VMMA 3NTHA 1KQSA 5IT9L 2VW9A 2W9CA 1A3UA 2W71A 2VQEQ 2GPWA 3GIDA 3T13A 5KFNA 4JCVE 2K50A 2P5ZX 2B2VA 1BQQT 1EIGA 1VQKA 1DXMA 5C3EB 4GNXC 1XMOQ 2N49A 1SNMA 3UQ8A 4JI1Q 2VNUD 2TSSA 1I4HA 4TSSA 1EU4A 4O3RA 4FXDA 5EBCA 2LSSA 4ECQA 1YJWA 2FK2A 3NENA 2F0UA 3K7UC 4C3JG 2I5LX 4M7EA 5DQIA 4CJ2C 2K7VA 3PUXA 4YAKB 4ECRA 1VQPA 2DPIA 4R8UB 1I3QH 4H44C 4MN3A 3X3NA 2RBMA 2FLLA 1I7LA 4A3BG 4XQJA 3M9MB 4R7RA 4DNRB 4RG1A 1B33N 3LWUA 2R92G 2P0AA 1PYSB 4DR5Q 3M4OH 4KHPH 3WO1A 1SAPA 3S1NH 1AFPA 2RDGA 1L2FA 3U4VA 3JAML 1HR0W 4YR2A 2YTVA 1PTOC 3G6XA 1S0OA 3OMGA 1Y1VB 1TS2A 3BDOA 1I4XA 1JJGA 3GP7A 1O7IA 4DPGA 5C0XI 1J9OA 5C3XA 4JI5H 3JAMi 4G4KA 1PH3A 1U4LA 5FPRA 2W9BB 3MXNA 4GNXA 2CH4A 2GVAA 1WCMA 1F9SA 5EQ0A 4J6HA 1XNQL 3S1MB 2DZDA 4LSAA 1CI3M 2KUMA 3JZIA 4MTNA 2R93H 2F0KA 5T1IA 2R7KA 3GTJA 1SMYD 1WTOA 2JA6G 1SE8A 4HCSA 2YRWA 2R7LA 3GTQB 4JV5Q 3W2DA 2K5VA 1IBKH 4UY8C 2E2IH 4KHVA 4ZRZA 3NQTA 1HFGA 1EQTA 3D3RA 2RVLA 3TP7A 5C1PA 2ZDHA 4RUAA 4Q45A 4FBTA 4RMFA 3K5MA 2C2RA 1XWEA 5KFEA 3MAQA 1CA5A 4UCRA 1RL2A 4OXPA 5KT7A 3HBLA 3DUZA 3HEJA 1SXTA 2OQ0A 4A93B 4DUYH 2XCAA 2C00A 4ED2A 3ITPA 3NWSA 3JAMW 3SK5A 2UU9L 3OSPA 4Q8FA 3E3XA 4XDXA 4DV3Q 2K5NA 3CP0A 1JKJB 4TV9F 3TP5A 2D2CC 1L0YB 3BVZA 2W7PA 2PYKA 4KD3A 3PR5B 2W6ZA 4J9MA 4Q5VA 2VQFL 2B8GA 4OWXB 3V6HA 2I07B 3K5LA 4LFCQ 1MJCA 4ED0A 4APMA 4KY7A 3PW4A 5DGBA 4Q8EA 1QNUA 4HR7B 3F2UA 1TR5A 1S97A 1F2YA 5LA6F 4KKUA 1TWFA 2ATWA 1YNJD 4M8AA 3VYTA 1YNND 1G91A 1R4PB 1XTDA 4LF4L 3OIPA 3VR2A 4QCLA 4DR1Q 1W96A 4WJ3M 2NUAB 4OX9H 4ECYA 3PUZA 4ODGA 4RKLA 2ES2A 4BY1B 2KHIA 1SROA 2UXDQ 4DV7Q 3FKIG 3FEWX 3U4ZA 4K5VA 4DR7L 1PFSA 1STYA 1UE7A 1FNWA 2RF4A 1F77A 1VBHA 4LSXA 2NU6B 4BS9A 1AUXA 1U0LA 2QKIC 5D14A 4DV6L 3A5UA 1Y8PB 3KJPA 2PZWA 1SR3A 1NNXA 4QIWA 1K83H 2WKDA 2UXBQ 4C3JH 4YY3Q 2L55A 5H1SE 2FFKB 1QUQA 1N32Q 4A2AA 2UVVA 5I4DA 2I87A 4L5TA 3SI8A 2FJZA 1U9RA 4OHJA 2YU9A 5JJLA 5EWGA 4XYOA 1LV9A 4JBJA 4A3BH 4LMYA 2R92H 3OTOL 2YTXA 3CCUA 3KLSX 1WTWA 3A56A 2JEBI 4X62L 1HZBA 2RDFA 4JOIC 2WYOA 4MTEA 3M9NB 3BQ2A 3CPFA 4IPDA 4EQ5A 3TBIB 5ELFA 1F9RA 2G5DA 1EZ1A 1EY7A 2BOSA 2R7ZB 2D5DA 1G6ZA 5KFPA 3FHWA 4FF2A 4JV0A 3V4SA 1BDOA 5KFOA 3RZDH 3ULJA 4BXXG 5IT9E 2ASDA 1M0WA 1M7JA 3OSNA 1KC8C 2VQEL 1M1KC 1X3QA 1EUDB 3GIQA 3S15B 4BBRB 3GTOA 3STBC 1XMOL 2A1AA 1K1QA 2K05A 2R8JA 3OW7A 1F2MA 4FP5D 4J1MA 4B08A 2AQ4A 1SEBD 4EQNA 3OWFA 5EKKA 2JA6H 5M3FG 3BAAA 1SMYC 2RCFA 5KFRA 1I50A 4RFBA 1TKWB 4AH6A 1CSQA 4HIDA 5ISRA 1R4QB 3HG9A 2ZXOA 2MFIA 3DXJC 3G4SA 4UP9A 1EIFA 1PRTF 4QUFA 2J9GA 3P20A 4DK3C 4KN7C 3L0OA 1L1OC 4MV4A 4A3IG 3G6VA 4JOIA 2BR0A 2KSWA 2CW0D 1KHIA 2UUCH 1XXGA 3KJOA 3TZDA 5KFYA 4DR5L 5DG8A 3MXNB 5C5LA 2QYZA 4AYBG 3JAME 1XNRQ 3RF2A 1IW7D 2F0MA 3HOUB 1IKLA 5ELBA 1N36L 1SYFA 1VAJA 1MBYA 4A3FB 3D4RA 3JSLA 1WYDA 1BKBA 2OT2A 3GV8B 2W6QA 2I5HA 4CKCA 3RZOB 2MCTA 2JA8G 4QUCA 1DGSA 1IOWA 2NVQH 1I3QA 4OWWB 1UEBA 4HQ6A 5KFDA 1KAAA 4C3IB 4OL7A 5C8YF 3K3PA 1CTMA 1KJQA 2J7ZA 1SE4A 1VQ9A 3RB4A 2ZXRA 3MFHA 1YNJC 1OTCA 4Q44A 3GV6A 4B3SQ 3H3VH 1KLGD 3RN2A 3PUWA 1H9KA 1S5DD 3GQCA 3TRZA 5KG6A 1VBGA 1YNNC 3KDFA 1S5ED 5LMNQ 5M5XH 5BR8Q 5KKNB 4XYMB 4U6PA 2A6ED 4QMGA 3VPBA 3GTMB 3RLNA 5CA1F 1HZCA 4MA0A 4O3PA 2YZGA 3NSWA 1L1OA 1X3GA 2WP8J 3BZDB 4QGUA 5FPOA 3FKIH 4A2BA 2FK1A 2HHHH 2W6NA 4DL2A 1A0IA 4M1UB 3VDYA 1EWCA 2LXJA 2O5IC 1ZYRD 4L5QA 4ECZA 1TWGH 4UP7A 2R93A 4LFBH 2F4IA 3JC66 3M7GA 1C48A 2Y0SB 3VYSA 4O3SA 3GDEA 4DV3L 4HSVA 2RHQB 3M85A 4MHEA 2E2IA 3G71A 1GOZA 4GLAC 5KFTA 2AWNA 4P2CB 4FYDA 4IPHA 1SNOA 1HZAA 4DA2A 4LFCL 1QB5D 5DEHA 1CE8A 1IL8A 1LTGD 2NVYB 3EQLC 3UE1A 2R8GA 2Q8TA 3T51B 3ULLA 5C44G 1Q86C 1U4RA 2DNCA 3T4AC 4MTKA 4EX5A 1E4GT 2FKLA 2C35B 3P7JA 2K32A 2IP4A 5IYZF 3Q1KA 3T5KA 2KCMA 3QIAA 4DR1L 2K4KA 4HJ5A 5HBRB 2JP1A 5C5MA 4DAYB 4J9OA 5D3IB 1F2ZA 1DIKA 1IBLH 1ICFB 3NELA 1BVSA 4BXXH 5FO9B 2KQ3A 4DR2Q 1T94A 4C2MH 1Q1EA 1K9MC 1WCMG 3S2HH 2UXDL 4DV7L 1MZBA 1S4ZA 2XGTA 3KAJA 2RDHA 2VUMB 1EY4A 4DR6H 2K75A 3LGJA 3HOYG 3QZ7A 1RYSA 4A3MG 4J9SA 3I7FA 2KEDA 5M3FH 1XMQQ 1Z9FA 2Z6BA 1E1OA 1IOVA 2Z0SA 2IBKA 4JI6L 1PRTB 2M00A 3I2ZA 3GTLH 1HUNA 5COYA 2NVXH 1JOKA 2UXBL 4YY3L 4FM9A 1N32L 2X0SA 5IODA 2HGSA 4JI2H 4X3KA 3A55A 4DV2H 4RKBA 5T1GA 1B3QA 5JJIA 4A3IH 4K5WA 3CMAA 3K5HA 4CDCC 3MFYA 2E5LQ 1UWVA 4AQYL 3EROA 3CCJA 4A3DB 1NUCA 5LL6X 2DLNA 1A2UA 1IW7C 1I6VC 5IT9c 4ECUA 1JOOA 1V43A 3LMLA 4O3NA 1K83A 3J7AF 1OXSC 1FGUA 3J7YW 2B2WC 3PUVA 4IZOA 4DNTB 1EYZA 2JA8H 4OELB 4LF8H 3MTSA 1HUMA 4F50A 4DGZA 2PZUA 2N3SA 3WWVA 2R92A 1NCVA 1Z7TA 2WE6A 5LP6F 2QDLA 3J81c 1GJXA 2NU8B 4MTDA 3U9TA 1WJJA 3EYYA 1RIPA 4P72A 5FK9C 3H20A 4YHHH 4LF7H 1BCPB 3MEFA 5CYUA 5CV8A 3E9HA 4I7HA 2XCPA 1CQFA 1LLRD 1LT3D 1G8ZD 5IYDG 4UCUA 2VS1A 4XIGS 2AGPA 4ULLA 2UUCQ 5C1OA 1ZKOA 2EY1A 1KIXA 1WTHA 1HTPA 4Y52H 2WAQE 2A6HC 1HCZA 3K0XA 5C0XG 3NP8A 4DV1Q 4E4TA 1X32A 1LYLA 3M4IA 4Q0YA 1ZYRC 1VQBA 2VOBA 1SCUB 4ECXA 4QWAA 4CHTB 2R8HA 3R3OA 3I55A 1XNRL 1D5XC 2LXKA 5T14A 4XX0B 1HNZQ 3M4OB 5M5YH 1ILPA 4J9LA 4QY7A 4DL6A 2B2WA 1IZ6A 2X69A 3S1NB 2ALYB 3NUCA 5KFKA 5L1KA 4IUTA 2F1MA 2A68D 3HKZB 1SNCA 2KOLA 3SK6A 1N34Q 1KL9A 3KHGA 3H40A 1U4MA 1H9SA 2LFNA 4OEMB 1F9QA 3PF5A 1TWHH 5EBDA 3BJYA 4LF5H 2XVSA 5C44H 2I8CA 5IGCA 2BDOA 5L1IA 5FJ8H 3AEVA 4B3SL 3NE5B 2R6FA 4OO1G 1NBWA 1VS0A 4UAIA 5LMNL 5KFXA 5BR8L 2ASJA 2IX0A 4HJ7A 2R93B 3T16A 4K6LA 2WTFA 2ZJQA 3U58A 5EGTA 5LHY1 2Y0SE 1WCMH 2PMZB 2E2IB 2IT1A 3V2TA 2V59A 3CQZA 3GTJH 4GLVB 3HOYH 5C4XG 4A3MH 3UE0A 3S9WA 4H13C 2XGPA 4R8NA 5L37A 1Y14B 1PV4A 1C8CA 4HJ9A 4ZUIA 4O42A 5KFVA 2JK8A 4IOCA 4KTAA 3DLLA 1SN8A 1VCIA 4RNMA 4POGA 1G291 4ED3A 1NMFA 3RBEA 1K8AC 2EQSA 3E9IA 3UI2A 1JE5A 1MSHA 1X56A 2HVQA 2K33A 1PTOH 2QW7A 3OYYA 2HDLA 3PN1A 1HNXH 1TWGA 4O0AA 2V4RA 4ME6A 1JXLA 4QWBA 3RB3A 4WJWA 1S5CD 3S14H 3P75A 2EXDA 2NTTA 4O2DA 1VF5C 1IBLQ 2XRSD 2F4VH 2GA4B 1KD1C 1I94Q 5KFFA 2DN8A 2RHSB 4KN4C 5FD5A 1JT8A 2RA4A 4HN7A 2A69D 4DR6Q 1WOCA 2PW5A 3MWEA 3BA8A 2VB2X 4DR2L 1YIJA 1TWFH 4JBMA 3F1ZA 1ZXTA 3BABA 3GIJA 1BF4A 4GC7A 2O03A 2KCCA 2UUAH 4FO2A 2R8KA 1SJED 1FJGH 2Z8LA 3FPPA 2CQAA 3NQIA 4EGVA 1YI2A 3HOWG 1OXXK 2XNAC 3TQYA 5HV6A 3GD7A 1UEAB 2W6MA 1KBLA 1FL0A 4KY5A 1LTLA 2F03A 4J9KA 3G6YA 1XMQL 4X64H 1N9WA 4FS1A 1B7YB 1LTSD 1MKHA 5I9PA 4A3KG 2VXWA 2IHFA 1ET6A 3GLKA 5IYDH 1LUZA 2KVMA 1UAPA 2EYHA 2F0TA 4LH7A 3HOZH 1I6UA 2MUYA 4DK6C 1NSNS 1B9MA 4C3JB 1T36A 1DOKA 5IWAH 1Z2NX 5C0XH 3IL8A 4IQZA 4IO9A 4R1JA 5KFUA 2E5LL 4ALPA 3C2PA 4DR4H 2F3VA 5AJ3Q 1D5ZC 4K2LA 4K8IA 1STAA 1STBA 3QOJA 3QOLA 4B9WA 3VA7A 1VQMA 4UFZA 3Q8QB 3SHLA 5M5WB 4ECVA 1U4PA 3GTLA 1CSPA 4IWXA 4YJ2F 1Y8OB 2YU9H 2IPKD 1LACA 2BH2A 5DQHA 2A68C 2OCEA 2DY7A 4DNIA 3K81C 3ORRA 4HJAA 2EY5A 4MV6A 3V6JA 2MP1A 3JSNA 4NW2A 2ICIA 3TP6A 4QQBX 3VPCA 1X9NA 4YHHQ 3GV5B 3A7AB 3RZDB 5D1OB 3MA2B 3N6XA 4TVAB 1FVIA 1KRSA 1SYBA 2I5MX 4EBDA 2PNRC 1A8VA 4HIMA 3KAKA 4OO1H 3M4YA 1N33L 3I12A 1LTTD 3EN2A 5KEEA 5CC4A 4FF4A 3TIIA 3N8DA 2JA6B 1W93A 1EZ8A 1RD9D 1B04A 2CQOA 3ZJYC 5JEAG 3GTOH 4GKKH 1CQJB 1T5EA 1T3NA 2AKWB 2XWBB 4DV1L 2VA2A 4OGQC 4PNYA 1E24A 4WD3A 1I50H 3R5XA 5I2YA 3TREA 1QILA 3KBGA 3PIPA 4YR0A 4UP8A 4E6IA 1GLVA 3P1HA 1RJRA 4TQRA 1TS4A 1JDEA 5EKLA 1PYWD 2B63A 3CCRA 2JYOA 1ESRA 3PW7A 1HNZL 1BBWA 5KFWA 4DAPA 2UUBH 3I4OA 5CV7A 3CC4A 1PZJD 5EZYF 1B70B 1D2BA 4QWDA 3EVQA 4NLGA 4X66H 4DV5H 1N34L 5EAYA 3EIVA 1V8QA 2DY8A 1PRTD 1BR9A 4LF9H 3PMFA 5JPMC 2B29A 2XSCA 5DLGA 1IYVA 2HIVA 4BA2I 3AFQA 4O4IF 1CKMA 2PMZE 3J81L 3Q8DA 3TMEA 1M6VA 1EZ6A 1GUNA 4HNUA 4TQUS 2F0JA 3S1RH 5EKIA 1E22A 5M5XB 2A69C 2Z4HA 3N44B 2ZJRA 1RJPA 4X3SA 1HXYD 3J81i 2HJWA 2YRXA 5JH7F 5EPJA 5IP7G 1R9TH 1HNWL 1TWHA 3S17H 2HIXA 3KUPA 2L9HA 5FOBB 3HOWH 2FMAA 3QB3A 3FKIB 4ZKBB 1II3A 2OWOA 2NN6I 2ZTEA 4V0BA 4DK0A 3VA5A 5KIXA 4DF7A 3F2CA 3MHBA 2ZM6L 2OXPA 3Q2OA 5BN5A 2FP4B 4KY6A 1H9JA 3UDFA 2K52A 4RUCA 5DLQE 4ECTA 4A3KH 1TWGB 1XPOA 3MXUA 1SNQA 1UNNC 2IL8A 4CC6A 4K6DA 3C3LA 2C2DA 3W1GA 4IUPA 3FP9A 1QNKA 1VQ5A 1A62A 4PV1C 3K58A 1BBUA 2CFMA 2CZGA 4EGQA 3T5HA 4B3RH 5JJKA 4NXMH 3N52A 1HNXQ 3IRBA 4OWTB 5F9LA 1BCPD 2JA7A 4IFDI 3KBXA 3C0FB 2F4VQ 2A8VA 3HOVG 4GKJQ 3KLWA 1YZ6A 5CBEE 3TZUA 4JI4Q 3J81W 1QOHA 2A19A 2J6UA 5A35A 3TQ1A 2YZMA 4B3TQ 3ND9A 1S72A 2PI2A 2E2HA 1PDQA 1I94L 2UUAQ 4ECWA 3I4MG 2L11A 3FRPB 3BDCA 1GD7A 3KHRA 4LNQA 4NMZA 3K7AB 1MI2A 4B3MQ 1ENFA 3VPDA 1D1IA 4C2MB 3S2HB 2NTSA 5M3MG 5DGAA 4Y7NH 1PH6A 3U9OA 3K0YA 4PMWA 1AE3A 4Q0FA 4FNFA 1C3OA 4JI7H 4CJ1B 2UVUA 3RR5A 5IWAQ 5M3FB 1DV1A 4NXNH 1SFOB 3BZCA 1JJ2A 1DYQA 5JEAH 4LUZA 2G9HD 5LMUQ 2V4DA 3TEHB 3VR5A 2NVXB 3Q8PB 1TAEA 4LF6H 1GXDC 1MHWC 3PO2G 1K8OA 1S40A 1GUGA 2E75C 1A3VA 4XTCS 4DV0H 1ESFA 3SXHA 4C5CA 4A3IB 1I6HH 5M9OA 2EJFC 5IGEA 2PCFB 1O7ZA 2JSOA 3R93A 1S0NA 5AJ3L 1EY5A 1NTGA 1K3BC 5C6AA 4MA5A 3U9SA 4AYBB 4GC6A 1CK1A 1PTOF 3S1QH 2RDJA 2O5JC 1Y1WG 3BQ1A 1I7NA 3L4KA 1NAPA 4GOPB 1ML0D 1RDPD 3KHLA 2PPBC 2YW2A 2W8KA 1LO5D 3UDXA 3DM3A 5LYJF 5TSSA 2V5AA 4DUZH 1TQOA 1WI5A 1STGA 2D9UA 2JA8B 1JIHA 3V96A 2K04A 1XPRA 2ASBA 1DZ1A 4QWCA 2F52A 2R3ZA 2N8NA 1H95A 3DM1A 2FPPB 3NTKA 5C4JH 3N6RA 3T1HQ 1K73C 1PH8A 2Z6KC 3K5OA 4JI8H 4K14A 1PZID 2BE5D 4RZRA 3BVMA 5ELNA 4JYAH 1RKNA 5IP7H 1K0SA 2FJ2A 1XDNA 2W9CB 1TS3A 3IFDA 3VR4A 3SEBA 1H9MA 5A2QL 4P73A 1P16A 4PZ7A 4JI3H 4FXKC 3QZ8A 1S9FA 3A8KE 3IN5A 4I4TF 2UUBQ 5BPHA 3T1YH 1FNVA 3D8GA 4IPCA 3H09A 4U673 3B6YA 2PN1A 3ONAB 4R4IA 3V6KA 4R9WA 5LL6S 1YJ9A 1VQDA 1WD1A 5CAEB 1PVOA 1TS5A 3D31A 2W9AA 2CWPA 3CKIB 2W8LA 2N88A 5M5YB 4LF9Q 1B6RA 1VKZA 4DU9A 1O78A 3N43B 2DPJA 4Z9CB 2DJGC 3NBHA 2CW7A 1J5EH 3GTPA 3D0FA 2Q8RE 4DR3H 4JI1L 4Y8VB 3HOVH 2DIKA 1ICWA 2WDTA 3TDQA 4KJNA 3L2PA 1TWHB 4LUVA 1ET9A 3K57A 5C44B 1AZPA 4RB2C 3J81E 1FGBD 1CHPD 4ZOLF 3UFXB 2Z6KA 4OIJA 3CF5A 4J0MA 2HD3A 1X3FA 5E7NA 3H4DA 4KHPQ 2OQKA 4G57A 2NYZD 1BXTA 1PA6A 2V9WA 2V4QA 3I4MH 4LMQD 1CS0A 3J7ZC 4DXFA 1X3PA 1D7QA 2UVWA 5A2QW 2ZJPA 2KHJA 4GNXB 3R2IA 1WCMB 1K0RA 4IUNA 4U68A 5M3MH 4JI5Q 3L7ZC 3OUZA 2XIGA 1RODA 3GTJB 3BQ0A 3HOYB 3PUYA 1VF7A 3DF7A 1O80A 4ZQ3A 3RBDA 1FYCA 3MC0B 4LFAH 1C30A 1DONA 1DOLA 5JJZA 3CAMA 2MGSA 2L5TA 4MAMA 2XN9C 3CQZH 1HNXL 2IA6A 1CHQD 1R9TA 2CCZA 1IBKQ 3PO2H 2NU7B 1TXYA 2YS7A 2EYJA 1V1PA 4DK1A 1HR0H 1NE3A 4RAZA 1VQHA 2V58A 5IYBG 2F4VL 4GKJL 2B63G 1B53A 1E3PA 2F0NA 2B2YC 4JI4L 4JV5L 1PTOB 1C7YA 4NKLA 1E2WA 2YS6A 4R4TA 5E4XA 4B3TL 1WFQA 3SE0A 4X6AH 4DUYQ 2FE3A 1Q1BA 3S14B 1Y1WH 2WB1A 5BMVF 3OW2A 4RNOA 2MJ8A 4GS3A 1WD0A 1UUPA 4RCOA 4LUOA 5GROA 3A5ZB 4GN3B 3M3YH 4RAYA 1WTPA 3PO3G 5IYCG 1B50A 1AE2A 5GADC 1PYBA 2EDGA 4B3ML 1TWFB 4CDDC 2EY6A 4C3HG 1RTOA 1IYUA 1RK5A 2K14A 3HGBA 2XD4A 4RA8A 2DNEA 4L8JA 2JEIA 1YBYA 3KXYT 1VQ4A 5D3DA 4LF6Q 3GTKA 1AW7A 2K5DA 4C5BA 1Z47A 4O4LF 3MZ5A 2BE5C 5G3LD 5LMUL 1SDFA 1I4PA 3HS0C 2JA5G 1SEIA 1DOMA 4BWSC 1OWTA 4OX9Q 1ENAA 1E2ZA 5CR3A 3HOZB 1FKAH 2B2YA 1O75A 1QJOA 2JXMB 1E4EA 4DFAA 3F8NA 4C5AA 3LX0A 1VQNA 2EYOA 4JVZA 5IE8A 3I4NG 4EFEA 1L0WA 3Q23A 2XCLA 3GIPA 3H0GA 5BN3A 3W1BA 4QIWB 1YHBA 3GTQH 1VMCA 5HGTA 2YYZA 1WSCA 1QUQB 1XNQH 2MQHA 2JA7G 5J2TF 3WO0A 3K6OA 1EY8A 4NP5A 3PR4A 1ASYA 5FLXE 4RGOS 2YU9B 2QEJC 1SYDA 4HNTA 2W6OA 1CT1D 1EEFD 1EQRA 2V1CC 5J2UF 2I80A 4RB0A 4KHZA 1B3AA 2TMPA 1GSOA 2Q2UA 5KG0A 3F8TA 5CBAE 1JDBB 1V1OA 2IJ0A 5IGBA 3IAYA 3GTGA 4ZYSA 1DV2A 1L2ZA 5JEAJ 3JRXA 1EY9A 3H6MA 1HZ9A 3CD6A 2EOTA 3BYYB 2LMCB 3T1HL 4A3EG 4K5XA 3N40P 2WAQG 1ILQA 5KFSA 3BDLA 2CW0C 2L4NA 4A3FG 4A3JG 1Q12A 3QG1A 3J7AK 2NUCA 4KJOA 4DKAC 4UCSA 2UU9H 3BG3A 2BDNA 2KJXA 2R82A 5A2QE 3GTOB 4CDEC 5CV9A 3PIOA 3NBHB 1SJHD 4K8JA 2VQFH 3EPIA 1VQFA 3J80c 5I47A 4JK1C 1I50B 1CKOA 2C2EA 3G48A 2EYMA 4MV8A 4I55F 3CCSA 3G6EA 1W2BA 2EIFA 2BA1A 1STEA 4HEDA 3ERSX 1KEEA 5KFBA 2DWCA 1YHAA 1NMGA 4ZAIA 3SE7A 4LF9L 5JQWA 4J9PA 3A74A 3NK9A 1SYXB 4EBEA 4FS2A 3PW2A 1A15A 1CQVA 3T56B 5LXTF 4LF4H 3WOEA 4HYKA 1M0TA 5IYBH 2B63H 1GUSA 2JEJA 2A6EC 4P71A 3MR6A 4A3GG 3BJUA 1J6QA 1YHQA 2NVTH 1LTAD 1B44D 2NN6G 3RAQA 4FBUA 2Y0SG 1HRJA 1ASZA 4DR7H 3E5NA 1H9RA 3R23A 4KHPL 3BS1A 2BA0A 2PQAA 1EUCB 2FK3A 2ZDGA 3S1RB 2KA7A 1I3QB 3PO3H 4ED7A 5IYCH 1RF2D 3J7A5 1C9OA 4DV6H 3NTIA 4R4CA 4C3HH 3NHHA 4RCNA 1R9TB 4LFAQ 4JI5L 3S17B 4IFDG 3HOWB 1BO0A 4O2BF 2D0OA 1V4YA 4G3IA 5KYLA 1WH2A 1HPCA 1RJTA 3BVGA 3D4DA 3KDFB 3ZYYX 1A3TA 3I72A 3Q22A 5JVH3 4GZYC 2QILA 4XYQA 2RGVA 1V9PA 1ZEQX 2QEXA 3PSIA 4UDUC 1RYRA 1Q3LA 3CPWA 2AMCB 2R61A 4X3TA 2Z9HA 4A3KB 2E76C 1JJCB 1L1OB 4IUVA 2R84A 3OTOH 3KLSA 4CBVA 1HR0Q 1AEXA 4X62H 1BNCA 2JA5H 1GVPA 1QCBD 5J1ZA 2AQ2B 1SSOA 1IBKL 1TU2B 5I6YA 1CKNA 4RZQA 1PFBA 4QWEA 1B4OA 3GIKA 4RNNA 4L5SA 1TWCA 2CW8A 2HHHQ 2RQXA 1GKHA 3I4NH 3HXLA 1JWSD 4C1NI 3KF6A 2EPBA 1AP0A 2RGRA 2OF1A 4BBSG 2W6PA 3KTMA 3PW5A 1KDBA 5LOVF 3CHBD 1EIHA 4DUYL 3HKSA 1UE5A 5KNBA 1JC7A 1ZHSA 3C1FA 1WTQA 2VQEH 4LFBQ 3UDGA 4JC0A 2JA7H 2PBZA 4ILWA 1VQJA 1XMOH 5JAVA 2K01A 5BN4A 2M05A 4IUQA 1LTRD 1PZKD 4QW9A 1PLFA 4YQWA 5EDWA 2E2HH 1B8AA 1W6KA 1V51A 3RV3A 2F0OA 4A3EH 1Y1WA 4CKBA 3L3OC 4Y7NB 4LF6L 1KRTA 1V1QA 4UCTA 4HMJA 4N8X1 1AH9A 4XT3B 5IGFA 1KJ8A 3AQQA 4R8IA 2VUGA 4A3JH 3UDIA 1BUVT 2F0VA 2F0IA 4DR5H 4RHSA 3HOXG 2R85A 4R8UA 4QIWE 4OX9L 5LMNW 4ZUJA 1N36H 2SNSA 2JEAI 4EBCA 1PFNA 3HB9A 4UPAA 3PW0A 2A74C 3RLOA 5IGDA 1TY0A 4PG3A 4IUUA 5FLXc 1I6HB 1KAWA 2EYLA 2MHVA 2JE6I 3RNUA 1Y1VA 1UE1A 4IJLA 4LAAA 5KFHA 3GTMH 2C5CA 1CA6A 3MJFA 2Z4IA 1RCVD 3S1QB 1KJ9A 1TVXA 1ONLA 4IZ8A 4RGMA 4RB3C 3RB0A 1CZWA 4RGNA 1S10A 1NY4A 1IBMH 4BY7G 1KLUD 2W9BA 4KI0A 1G51A 4DL7A 1VQIA 4A76A 4JI2Q 1Z6HA 4A3GH 5CA0F 1WR2A 4DV2Q 4DL3A 2KCTA 5C4HA 1KTKA 2NN6H 4B9XA 2WB1G 2AHOB 4YCVA 4EQPA 1TY2A 2AGOA 3ULPA 3GTQA 1K83B 1RJQA 2ZTCA 3I70A 5C4JB 4NPSA 2SCUB 3S16H 2GPSA 3PGZA 2ZT9C 3Q0AA 1W3SA 3TS2A 4PMBA 1T5XD 3DWQA 4M9UA 4A3BB 2NZ1D 3NGDA 2ENBA 4C1NK 1XYIA 2R92B 4DV3H 1D1KA 1TWAH 3VYUA 1LABA 4IFDH 2BCOA 4LF8Q 1KXLA 3GV3A 4ZK9B 3SDZA 5L1LA 2WFWA 4LFCH 2I46A 2B8FA 3CRLC 3W3AA 4UCOA 3QWNA 4IURA 1O7YA 2VL6A 4XT1B 3S2DH 4LF7Q 1RK6A 2C22A 1I5FA 4RAUC 3OIQA 1F9PA 3X3MA 2VY3A 1PH1A 4PZ6A 4HR7A 4EYHB 1GHJA 3QJYA 2R7NA 4UCVA 3G8CA 2DGYA 2RSOA 4DR1H 2C28A 1X3EA 3MXGA 2FMCA 1LTBD 3H0GG 1A6XA 1DCZA 2SDFA 4XQQA 4BBSH 3F2DA 4JV1A 1VDZA 1HQMC 2XGQA 1TA8A 2EYPA 1HQRD 3BYTB 3OMCA 4RB1A 2UUCL 2UXDH 1VQGA 4DV7H 1JB3A 1NJIC 1QZHA 3GTPH 2DUDA 2AUKA 1X54A 2OLSA 1TT2A 1JR0D 4DV6Q 3PIO3 4ED6A 5ELDA 5C4XH 1GYFA 2RCNA 4CGYB 1JCKB
chains in the Genus database with same CATH topology
3HKZE 3GDEA 2PNHA 4DV3L 4GOPB 2RHQB 1CUKA 3M85A 3UDXA 1VQAA 3DM3A 3G71A 3CW2C 4P74A 4GLAC 4LFAL 2AWNA 1WI5A 4IPHA 1HZAA 4LFCL 1XPRA 2ASBA 4LF5Q 4ME3A 1MIUA 2F3IA 1U5KA 3UE1A 4AIMA 2F52A 3CC2A 2N8NA 3ULLA 5C44G 1H95A 5C4JH 1Q86C 4JI7L 2ID0A 3H15A 2UXCL 2E2JH 4NXNL 3T1HQ 1K73C 1PH8A 1HR0L 1X6OA 4EX5A 2KENA 2Z6KC 4FDBA 3HOXH 4A3DG 2IX1A 3RLFA 2C35B 3J80i 3HOUH 1HNWQ 2HT1A 5ELNA 2KCMA 4BA1I 5FLMH 2K4KA 4HJ5A 4DR1L 5IP7H 1QVGA 1A63A 4YCWA 1EYGA 4DAYB 4A3FH 5IY0A 3NELA 1BVSA 4DV0L 2HHHL 4BXXH 3RZOH 4P73A 1P16A 4PZ7A 4YCUA 4C2MH 1Q1EA 2ZM6Q 1WCMG 4DR2Q 1MJEA 1K9MC 1IYJB 4DV7L 3S2HH 2UXDL 5GQOA 2UUBQ 2JJQA 2XGTA 4C3IH 2K75A 4IPCA 1VQ8A 4LFBL 3B6YA 1QVCA 3LGJA 3HOYG 4R4IA 4NB3A 4APVA 4A3MG 1YJ9A 2XTIA 1VQDA 3I7FA 1PVOA 5M3FH 3D31A 1XNQQ 1XMQQ 2CWPA 4HIKA 1Z9FA 1E1OA 4BY7H 2Z0SA 5GAHC 4LF9Q 4JI6L 3I2ZA 3GTLH 1JMCA 4GN4B 4DV4L 4DUZL 2NVXH 1PH4A 3BZKA 2UXBL 4YY3L 4QL5A 1C0AA 3D0FA 1N32L 4JI1L 2UXDQ 3HOVH 4H02A 5JJIA 3M4PA 3L2PA 4A3IH 4LUVA 3PF4A 3CMAA 2Z6KA 3M4QA 2E5LQ 1UWVA 3CF5A 4AQYL 3CCJA 1X3FA 4JI8L 5E7NA 1D8LA 1N36Q 2HQLA 2Q2IA 4KHPQ 2OQKA 4JYAL 1PA6A 5IT9c 3I4MH 1V43A 1HH2P 2AWOA 3PV0A 3J7ZC 2UU9Q 1OXSC 1IBLL 1FGUA 4IPGA 1D7QA 3AYHB 1VQCA 3K8AA 3PUVA 4JI3L 1GM5A 2ZJPA 2KHJA 4GNXB 2JA8H 3GTKH 3HKZG 1K0RA 3CC7A 1FJGQ 2VQFQ 5M3MH 4JI5Q 3L7ZC 4JBKA 1XPUA 3T1YL 4DR6L 3STBD 2NVYH 2N3SA 3WWVA 1IXRA 4JG2A 1UE6A 4GOPC 1IBMQ 4A3LH 3PUYA 1Q7YC 1SLJA 3J81c 1SRUA 1WJJA 4X64Q 1RIPA 4P72A 1QVFA 4J15A 2R6GA 3CAMA 3GO5A 4R4QA 3MEFA 3E9HA 1J5EL 3CQZH 2R93G 1HNXL 3TS0A 4DR3L 1IBKQ 2CCZA 2YTYA 4JI2L 3A0JA 1TXYA 3H0GH 4LF4Q 3PO2H 4OONA 5IYDG 1E1TA 2VS1A 4XIGS 4DV2L 2UUCQ 2ZTDA 4PZ8A 1NE3A 1VQHA 5IYBG 1KIXA 2PQAB 2B63G 2F4VL 4GKJL 4OO1I 4Y52H 3NEMA 1E3PA 2WAQE 4JI4L 4JV5L 2N78A 3K0XA 5C0XG 4DV1Q 4P75A 2R7FA 2VUMH 1LYLA 2IHEA 1C7YA 1EUJA 1VQBA 4DR4Q 4R4TA 2R7DA 4DR7Q 3S24A 1WFQA 4B3TL 5IP9H 2I0QA 1E7ZA 4X65L 1Q1BA 4DUYQ 4X6AH 1Y1WH 3I55A 1XNRL 3OW2A 1VQEA 2LXKA 4GS3A 1HNZQ 4QJFA 5M5YH 4QY7A 5C3EG 1M90C 1IZ6A 3GTGH 2ALYB 4LUOA 3CCQA 5GROA 3A5ZB 4GN3B 2K5HA 2UXBQ 2JA9A 3M3YH 3PO3G 2VZAA 5IYCG 4YWKA 3W5OA 4LF8L 2L15A 1AE2A 5GADC 1PYBA 1QZGA 4B3ML 1T9HA 5HGQA 1N34Q 1KL9A 1PH7A 1Q82C 3PF5A 4GOPA 4L5RC 1TWHH 2IY5B 4POFA 2K14A 5C44H 3KYHC 5FJ8H 3AEVA 1VQOA 1CKNB 4B3SL 1YBYA 4YHHL 4LF7L 2WB1E 1VQ4A 4LF6Q 3ICEA 4A3DH 1PHJA 3OTOQ 4OO1G 1NBWA 1VS0A 1Z47A 1OXTA 4X62Q 5LMNL 5BR8L 4JBWA 2IX0A 4HJ7A 5LMUL 3KF6B 2FXQA 2ZJQA 3U58A 2JA5G 4LWCA 4GKKQ 4OX9Q 2Y0SE 4MNOA 5C0XJ 1WCMH 2B3GA 3CCMA 2QA4A 1VQLA 1Y1VG 1VQNA 1G6PA 4JI0L 2IT1A 5IE8A 3I4NG 3GTJH 1KQSA 4GLVB 3HOYH 5C4XG 2GVBA 2VW9A 1L0WA 4A3MH 3UE0A 1EOVA 4KLKA 2VQEQ 3HFZB 4JI6Q 3W1BA 4JCVE 1YHBA 3GTQH 1Y14B 1PV4A 4IFDJ 4HJ9A 2YYZA 2K50A 1VQKA 1QUQB 1OXUA 4A3CG 4GNXC 1XMOQ 2MQHA 2N49A 1GO3E 2JA7G 2JK8A 4JI1Q 4IOCA 2VNUD 4K0KQ 1ASYA 3DLLA 1SN8A 1VCIA 4POGA 4X66Q 1G291 2KBNA 2LSSA 1NMFA 4DV5Q 1YJWA 1EQRA 2EQSA 2Q2HA 2V1CC 1YJNA 1K8AC 3NENA 4KHZA 3E9IA 4LF5L 4MZ9A 1JE5A 2Q2UA 3F8TA 3K7UC 4AQYQ 2I5LX 3PUXA 1X56A 3CCLA 3OYYA 5M5WH 1VQPA 5JEAJ 1YEZA 4O0AA 1I3QH 1HZ9A 3E0EA 3CD6A 2BH8A 3T1HL 4A3EG 3S14H 4A3BG 2D62A 2EXDA 4RG1A 4O2DA 2WAQG 1IBLQ 2R92G 1EWIA 4A93G 1PYSB 4DR5Q 3M4OH 1KD1C 1K8GA 4A3FG 3S1NH 4A3JG 1Q12A 1I94Q 2QGQA 1L2FA 2RHSB 3U4VA 4DKAC 1HR0W 1JT8A 3BU2A 2YTVA 4DR6Q 4GLXA 1WOCA 4DR2L 1YIJA 1TWFH 2YV5A 3NBHB 3F1ZA 3PIOA 4JBMA 1JJGA 1O7IA 2OTLA 4DPGA 5C0XI 1VQFA 1X65A 3J80c 3HOWG 1YI2A 1CKOA 1OXXK 3TQYA 3G48A 3JAMi 1PH3A 3GD7A 3CCSA 3G6EA 1FL0A 2EIFA 2BA1A 1W2BA 1LTLA 4GNXA 2GVAA 3ERSX 1XNQL 1TWCH 5GAGC 1XMQL 1N9WA 1YHAA 1B7YB 1NMGA 2H5XA 1MKHA 3M9BA 4A3KG 4MTNA 4LF9L 2R93H 2IHFA 3A74A 1S3OA 4B3RQ 4NXMQ 5IYDH 2JA6G 1LUZA 1SE8A 4JV5Q 2K5VA 3HOZH 5IYBH 4DK6C 3EBEA 4UY8C 2B63H 3CXCA 2E2IH 4P71A 4A3GG 3BJUA 4IO9A 1J6QA 4BY1G 1YHQA 2NVTH 1YVCA 4RMFA 4R1JA 2NN6G 2E5LL 4ALPA 2Y0SG 1ASZA 1RL2A 4OXPA 5AJ3Q 3KOJA 4KHPL 2OQ0A 2BA0A 5K36G 2PQAA 2NZOA 1VQMA 5C3EH 1CSPA 2UU9L 1N8RC 4DV3Q 1HJPA 2K5NA 3CP0A 4LW1A 5IYCH 1YITA 2YU9H 2BH2A 3J7A5 2OCEA 4DNIA 3K81C 4HJAA 1C9OA 4R4CA 1LM0A 4C3HH 2UUAL 3J81j 1FJGL 2VQFL 4LFAQ 4JI5L 4QQBX 4OWXB 4IFDG 1X9NA 2D0OA 4YHHQ 4LFCQ 1MJCA 3KDFB 4YWLA 1K3RA 3AFPA 4TVAB 1FVIA 1KRSA 2I5MX 1IBML 1V9PA 1A8VA 2QEXA 4HIMA 3PSIA 2E8GA 4X64L 3CPWA 1N33L 2AMCB 1VQ7A 4JI7Q 2ATWA 3EN2A 1JJCB 1L1OB 4NXNQ 2UXCQ 1HR0Q 2JA5H 1GVPA 1EIYB 2D0PA 1XTDA 1IBKL 4LF4L 2GN5A 2CQOA 1P8LA 1CKNA 3ZJYC 4DR1Q 5JEAG 5IWAL 2R7ZG 1Y1VH 3GTOH 4WJ3M 4L5SA 4GN5A 3PUZA 3KF8B 5J3BA 2JQOA 2AKWB 4DV0Q 2HHHQ 1GKHA 2ES2A 3I4NH 4DV1L 2KHIA 3M7NA 1E24A 1SROA 3KF6A 1I50H 5GAEC 3CCVA 3TREA 4DV7Q 3FKIG 1EQQA 4DR4L 3U4ZA 4AYBE 3PIPA 4UP8A 4BBSG 4DR7L 1PFSA 1UE7A 4DUYL 3HKSA 1UE5A 3S1MH 2RF4A 4A3CH 3CCRA 3UDGA 4JC0A 4BBRG 2JA7H 4LFBQ 1HNZL 1BBWA 1VQJA 3I4OA 3CC4A 1U0LA 1PH2A 4DV6L 3A5UA 1B70B 3KJPA 1SR3A 4DV4Q 4DUZQ 1K83H 1X55A 2NZHA 4C3JH 5EAYA 3EIVA 5H1SE 4YY3Q 1QUQA 1N34L 1N32Q 2E2HH 1B8AA 4L5TA 5FJ8G 1JB7A 2MO1A 5JJLA 2B29A 3CCEA 4JBJA 2HIVA 3SGIA 4A3EH 4A3BH 4BA2I 3AFQA 4LF6L 1CKMA 2PMZE 1KRTA 3Q8DA 1V1QA 2R92H 3OTOL 2YTXA 3CCUA 4A93H 1AH9A 2JEBI 3AQQA 4X62L 1HZBA 4JOIC 4JI8Q 4A3JH 3CPFA 4TQUS 3UDIA 3K7AH 2CWAA 4IPDA 4EQ5A 3S1RH 1EFWA 1E22A 3HOXG 4JYAQ 4GKKL 1PH9A 4QIWE 3HOUG 2ZJRA 5LMNW 4OX9L 3F2BA 3FHWA 3J81i 5FLMG 5IP7G 2JEAI 1R9TH 1HNWL 4JI3Q 3S17H 2HIXA 3HOWH 4UPAA 4A4IA 3RZDH 3RLOA 3ULJA 4BXXG 2OWOA 2NN6I 2ZTEA 4PG3A 5FLXc 3T1YQ 1SFOH 3F2CA 1KC8C 2VQEL 1KAWA 1M1KC 2ZM6L 2JE6I 3RNUA 1UE1A 4IJLA 3UDFA 2K52A 3GTMH 5DLQE 4A3KH 3STBC 1XPOA 2UUBL 1XMOL 2A1AA 1Q81C 1Q46A 3W1GA 4K0KL 3FP9A 1PH5A 1VQ5A 2JA6H 1A62A 5M3FG 1BBUA 2CFMA 1NY4A 4X66L 4HJ8A 4AH6A 4BY7G 1CSQA 4HIDA 5JJKA 1J5EQ 4KI0A 4DV5L 1G51A 1HNXQ 2OTJA 3IRBA 4DR3Q 1VQIA 4OWTB 4JI2Q 4A76A 2MFIA 4A3GH 3G4SA 4IFDI 3CMEA 4DV2Q 4UP9A 1XJVA 4BY1H 1VQ6A 1EIFA 2KCTA 4DK3C 4IJHA 2F4VQ 2A8VA 3HOVG 2WB1G 2AHOB 1L1OC 1YZ6A 3KLWA 3L0OA 4YCVA 4GKJQ 4JI4Q 3ULPA 1IL2A 3I56A 4A3IG 4JOIA 2MNAA 2A19A 1KHIA 2ZTCA 3KJOA 4NPSA 4B3TQ 1S72A 2PI2A 4X65Q 4DR5L 3PGZA 3H3VI 3MXNB 3S16H 3K80C 1W3SA 3TS2A 4AYBG 1I94L 1XNRQ 4WJ4A 2UUAQ 3RN5A 2CKZB 1N36L 4R4OA 3I4MG 2MO0A 1TWAH 1GD7A 4LNQA 1WYDA 1BKBA 4LF8Q 1KXLA 2I5HA 4DAMA 4B3MQ 2JA8G 1DGSA 1N33Q 2WFWA 2NVQH 5M3MG 4OWWB 1UEBA 4Y7NH 1PH6A 4YWMA 5HY6A 1VQ9A 5ELOA 1OTCA 2PI2E 2VL6A 3S2DH 3H3VH 4PMWA 4B3SQ 1AE3A 3RN2A 4LF7Q 4A3LG 3PUWA 1I5FA 1SMXA 3TRZA 3RR5A 5IWAQ 4IOAA 4A75A 3KDFA 4HIOA 2VY3A 3HOZG 1PH1A 4PZ6A 5LMNQ 3BZCA 5BR8Q 5M5XH 1JJ2A 4NXML 3KFUA 4B3RL 2R7ZH 4LUZA 3U50C 3JAMc 5LMUQ 3TEHB 2DGYA 3RLNA 1HZCA 1X3EA 3PO2G 3PO3H 1L1OA 2Q2TA 1X3GA 2WP8J 3H0GG 1S40A 4XTCS 4QGUA 1YNXA 3FKIH 4BBSH 3F2DA 1A0IA 4JI0Q 1Q8KA 1I6HH 3VDYA 2UUCL 1VQGA 3PCOB 2LXJA 3S15H 1NJIC 4BBRH 1QZHA 2VUMG 5AJ3L 3ER0A 1NTGA 3GTPH 4L5QA 2DUDA 1X54A 1TWGH 4UP7A 4DV6Q 5C4XH 3JC66 1OXVA 5IP9G 2RCNA 3S1QH 1Y1WG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ E;  3GDE A;  2PNH A;  4DV3 L;  4GOP B;  2RHQ B;  1CUK A;  3M85 A;  3UDX A;  1VQA A;  3DM3 A;  3G71 A;  3CW2 C;  4P74 A;  4GLA C;  4LFA L;  2AWN A;  1WI5 A;  4IPH A;  1HZA A;  4LFC L;  1XPR A;  2ASB A;  4LF5 Q;  4ME3 A;  1MIU A;  2F3I A;  1U5K A;  3UE1 A;  4AIM A;  2F52 A;  3CC2 A;  2N8N A;  3ULL A;  5C44 G;  1H95 A;  5C4J H;  1Q86 C;  4JI7 L;  2ID0 A;  3H15 A;  2UXC L;  2E2J H;  4NXN L;  3T1H Q;  1K73 C;  1PH8 A;  1HR0 L;  1X6O A;  4EX5 A;  2KEN A;  2Z6K C;  4FDB A;  3HOX H;  4A3D G;  2IX1 A;  3RLF A;  2C35 B;  3J80 i;  3HOU H;  1HNW Q;  2HT1 A;  5ELN A;  2KCM A;  4BA1 I;  5FLM H;  2K4K A;  4HJ5 A;  4DR1 L;  5IP7 H;  1QVG A;  1A63 A;  4YCW A;  1EYG A;  4DAY B;  4A3F H;  5IY0 A;  3NEL A;  1BVS A;  4DV0 L;  2HHH L;  4BXX H;  3RZO H;  4P73 A;  1P16 A;  4PZ7 A;  4YCU A;  4C2M H;  1Q1E A;  2ZM6 Q;  1WCM G;  4DR2 Q;  1MJE A;  1K9M C;  1IYJ B;  4DV7 L;  3S2H H;  2UXD L;  5GQO A;  2UUB Q;  2JJQ A;  2XGT A;  4C3I H;  2K75 A;  4IPC A;  1VQ8 A;  4LFB L;  3B6Y A;  1QVC A;  3LGJ A;  3HOY G;  4R4I A;  4NB3 A;  4APV A;  4A3M G;  1YJ9 A;  2XTI A;  1VQD A;  3I7F A;  1PVO A;  5M3F H;  3D31 A;  1XNQ Q;  1XMQ Q;  2CWP A;  4HIK A;  1Z9F A;  1E1O A;  4BY7 H;  2Z0S A;  5GAH C;  4LF9 Q;  4JI6 L;  3I2Z A;  3GTL H;  1JMC A;  4GN4 B;  4DV4 L;  4DUZ L;  2NVX H;  1PH4 A;  3BZK A;  2UXB L;  4YY3 L;  4QL5 A;  1C0A A;  3D0F A;  1N32 L;  4JI1 L;  2UXD Q;  3HOV H;  4H02 A;  5JJI A;  3M4P A;  3L2P A;  4A3I H;  4LUV A;  3PF4 A;  3CMA A;  2Z6K A;  3M4Q A;  2E5L Q;  1UWV A;  3CF5 A;  4AQY L;  3CCJ A;  1X3F A;  4JI8 L;  5E7N A;  1D8L A;  1N36 Q;  2HQL A;  2Q2I A;  4KHP Q;  2OQK A;  4JYA L;  1PA6 A;  5IT9 c;  3I4M H;  1V43 A;  1HH2 P;  2AWO A;  3PV0 A;  3J7Z C;  2UU9 Q;  1OXS C;  1IBL L;  1FGU A;  4IPG A;  1D7Q A;  3AYH B;  1VQC A;  3K8A A;  3PUV A;  4JI3 L;  1GM5 A;  2ZJP A;  2KHJ A;  4GNX B;  2JA8 H;  3GTK H;  3HKZ G;  1K0R A;  3CC7 A;  1FJG Q;  2VQF Q;  5M3M H;  4JI5 Q;  3L7Z C;  4JBK A;  1XPU A;  3T1Y L;  4DR6 L;  3STB D;  2NVY H;  2N3S A;  3WWV A;  1IXR A;  4JG2 A;  1UE6 A;  4GOP C;  1IBM Q;  4A3L H;  3PUY A;  1Q7Y C;  1SLJ A;  3J81 c;  1SRU A;  1WJJ A;  4X64 Q;  1RIP A;  4P72 A;  1QVF A;  4J15 A;  2R6G A;  3CAM A;  3GO5 A;  4R4Q A;  3MEF A;  3E9H A;  1J5E L;  3CQZ H;  2R93 G;  1HNX L;  3TS0 A;  4DR3 L;  1IBK Q;  2CCZ A;  2YTY A;  4JI2 L;  3A0J A;  1TXY A;  3H0G H;  4LF4 Q;  3PO2 H;  4OON A;  5IYD G;  1E1T A;  2VS1 A;  4XIG S;  4DV2 L;  2UUC Q;  2ZTD A;  4PZ8 A;  1NE3 A;  1VQH A;  5IYB G;  1KIX A;  2PQA B;  2B63 G;  2F4V L;  4GKJ L;  4OO1 I;  4Y52 H;  3NEM A;  1E3P A;  2WAQ E;  4JI4 L;  4JV5 L;  2N78 A;  3K0X A;  5C0X G;  4DV1 Q;  4P75 A;  2R7F A;  2VUM H;  1LYL A;  2IHE A;  1C7Y A;  1EUJ A;  1VQB A;  4DR4 Q;  4R4T A;  2R7D A;  4DR7 Q;  3S24 A;  1WFQ A;  4B3T L;  5IP9 H;  2I0Q A;  1E7Z A;  4X65 L;  1Q1B A;  4DUY Q;  4X6A H;  1Y1W H;  3I55 A;  1XNR L;  3OW2 A;  1VQE A;  2LXK A;  4GS3 A;  1HNZ Q;  4QJF A;  5M5Y H;  4QY7 A;  5C3E G;  1M90 C;  1IZ6 A;  3GTG H;  2ALY B;  4LUO A;  3CCQ A;  5GRO A;  3A5Z B;  4GN3 B;  2K5H A;  2UXB Q;  2JA9 A;  3M3Y H;  3PO3 G;  2VZA A;  5IYC G;  4YWK A;  3W5O A;  4LF8 L;  2L15 A;  1AE2 A;  5GAD C;  1PYB A;  1QZG A;  4B3M L;  1T9H A;  5HGQ A;  1N34 Q;  1KL9 A;  1PH7 A;  1Q82 C;  3PF5 A;  4GOP A;  4L5R C;  1TWH H;  2IY5 B;  4POF A;  2K14 A;  5C44 H;  3KYH C;  5FJ8 H;  3AEV A;  1VQO A;  1CKN B;  4B3S L;  1YBY A;  4YHH L;  4LF7 L;  2WB1 E;  1VQ4 A;  4LF6 Q;  3ICE A;  4A3D H;  1PHJ A;  3OTO Q;  4OO1 G;  1NBW A;  1VS0 A;  1Z47 A;  1OXT A;  4X62 Q;  5LMN L;  5BR8 L;  4JBW A;  2IX0 A;  4HJ7 A;  5LMU L;  3KF6 B;  2FXQ A;  2ZJQ A;  3U58 A;  2JA5 G;  4LWC A;  4GKK Q;  4OX9 Q;  2Y0S E;  4MNO A;  5C0X J;  1WCM H;  2B3G A;  3CCM A;  2QA4 A;  1VQL A;  1Y1V G;  1VQN A;  1G6P A;  4JI0 L;  2IT1 A;  5IE8 A;  3I4N G;  3GTJ H;  1KQS A;  4GLV B;  3HOY H;  5C4X G;  2GVB A;  2VW9 A;  1L0W A;  4A3M H;  3UE0 A;  1EOV A;  4KLK A;  2VQE Q;  3HFZ B;  4JI6 Q;  3W1B A;  4JCV E;  1YHB A;  3GTQ H;  1Y14 B;  1PV4 A;  4IFD J;  4HJ9 A;  2YYZ A;  2K50 A;  1VQK A;  1QUQ B;  1OXU A;  4A3C G;  4GNX C;  1XMO Q;  2MQH A;  2N49 A;  1GO3 E;  2JA7 G;  2JK8 A;  4JI1 Q;  4IOC A;  2VNU D;  4K0K Q;  1ASY A;  3DLL A;  1SN8 A;  1VCI A;  4POG A;  4X66 Q;  1G29 1;  2KBN A;  2LSS A;  1NMF A;  4DV5 Q;  1YJW A;  1EQR A;  2EQS A;  2Q2H A;  2V1C C;  1YJN A;  1K8A C;  3NEN A;  4KHZ A;  3E9I A;  4LF5 L;  4MZ9 A;  1JE5 A;  2Q2U A;  3F8T A;  3K7U C;  4AQY Q;  2I5L X;  3PUX A;  1X56 A;  3CCL A;  3OYY A;  5M5W H;  1VQP A;  5JEA J;  1YEZ A;  4O0A A;  1I3Q H;  1HZ9 A;  3E0E A;  3CD6 A;  2BH8 A;  3T1H L;  4A3E G;  3S14 H;  4A3B G;  2D62 A;  2EXD A;  4RG1 A;  4O2D A;  2WAQ G;  1IBL Q;  2R92 G;  1EWI A;  4A93 G;  1PYS B;  4DR5 Q;  3M4O H;  1KD1 C;  1K8G A;  4A3F G;  3S1N H;  4A3J G;  1Q12 A;  1I94 Q;  2QGQ A;  1L2F A;  2RHS B;  3U4V A;  4DKA C;  1HR0 W;  1JT8 A;  3BU2 A;  2YTV A;  4DR6 Q;  4GLX A;  1WOC A;  4DR2 L;  1YIJ A;  1TWF H;  2YV5 A;  3NBH B;  3F1Z A;  3PIO A;  4JBM A;  1JJG A;  1O7I A;  2OTL A;  4DPG A;  5C0X I;  1VQF A;  1X65 A;  3J80 c;  3HOW G;  1YI2 A;  1CKO A;  1OXX K;  3TQY A;  3G48 A;  3JAM i;  1PH3 A;  3GD7 A;  3CCS A;  3G6E A;  1FL0 A;  2EIF A;  2BA1 A;  1W2B A;  1LTL A;  4GNX A;  2GVA A;  3ERS X;  1XNQ L;  1TWC H;  5GAG C;  1XMQ L;  1N9W A;  1YHA A;  1B7Y B;  1NMG A;  2H5X A;  1MKH A;  3M9B A;  4A3K G;  4MTN A;  4LF9 L;  2R93 H;  2IHF A;  3A74 A;  1S3O A;  4B3R Q;  4NXM Q;  5IYD H;  2JA6 G;  1LUZ A;  1SE8 A;  4JV5 Q;  2K5V A;  3HOZ H;  5IYB H;  4DK6 C;  3EBE A;  4UY8 C;  2B63 H;  3CXC A;  2E2I H;  4P71 A;  4A3G G;  3BJU A;  4IO9 A;  1J6Q A;  4BY1 G;  1YHQ A;  2NVT H;  1YVC A;  4RMF A;  4R1J A;  2NN6 G;  2E5L L;  4ALP A;  2Y0S G;  1ASZ A;  1RL2 A;  4OXP A;  5AJ3 Q;  3KOJ A;  4KHP L;  2OQ0 A;  2BA0 A;  5K36 G;  2PQA A;  2NZO A;  1VQM A;  5C3E H;  1CSP A;  2UU9 L;  1N8R C;  4DV3 Q;  1HJP A;  2K5N A;  3CP0 A;  4LW1 A;  5IYC H;  1YIT A;  2YU9 H;  2BH2 A;  3J7A 5;  2OCE A;  4DNI A;  3K81 C;  4HJA A;  1C9O A;  4R4C A;  1LM0 A;  4C3H H;  2UUA L;  3J81 j;  1FJG L;  2VQF L;  4LFA Q;  4JI5 L;  4QQB X;  4OWX B;  4IFD G;  1X9N A;  2D0O A;  4YHH Q;  4LFC Q;  1MJC A;  3KDF B;  4YWL A;  1K3R A;  3AFP A;  4TVA B;  1FVI A;  1KRS A;  2I5M X;  1IBM L;  1V9P A;  1A8V A;  2QEX A;  4HIM A;  3PSI A;  2E8G A;  4X64 L;  3CPW A;  1N33 L;  2AMC B;  1VQ7 A;  4JI7 Q;  2ATW A;  3EN2 A;  1JJC B;  1L1O B;  4NXN Q;  2UXC Q;  1HR0 Q;  2JA5 H;  1GVP A;  1EIY B;  2D0P A;  1XTD A;  1IBK L;  4LF4 L;  2GN5 A;  2CQO A;  1P8L A;  1CKN A;  3ZJY C;  4DR1 Q;  5JEA G;  5IWA L;  2R7Z G;  1Y1V H;  3GTO H;  4WJ3 M;  4L5S A;  4GN5 A;  3PUZ A;  3KF8 B;  5J3B A;  2JQO A;  2AKW B;  4DV0 Q;  2HHH Q;  1GKH A;  2ES2 A;  3I4N H;  4DV1 L;  2KHI A;  3M7N A;  1E24 A;  1SRO A;  3KF6 A;  1I50 H;  5GAE C;  3CCV A;  3TRE A;  4DV7 Q;  3FKI G;  1EQQ A;  4DR4 L;  3U4Z A;  4AYB E;  3PIP A;  4UP8 A;  4BBS G;  4DR7 L;  1PFS A;  1UE7 A;  4DUY L;  3HKS A;  1UE5 A;  3S1M H;  2RF4 A;  4A3C H;  3CCR A;  3UDG A;  4JC0 A;  4BBR G;  2JA7 H;  4LFB Q;  1HNZ L;  1BBW A;  1VQJ A;  3I4O A;  3CC4 A;  1U0L A;  1PH2 A;  4DV6 L;  3A5U A;  1B70 B;  3KJP A;  1SR3 A;  4DV4 Q;  4DUZ Q;  1K83 H;  1X55 A;  2NZH A;  4C3J H;  5EAY A;  3EIV A;  5H1S E;  4YY3 Q;  1QUQ A;  1N34 L;  1N32 Q;  2E2H H;  1B8A A;  4L5T A;  5FJ8 G;  1JB7 A;  2MO1 A;  5JJL A;  2B29 A;  3CCE A;  4JBJ A;  2HIV A;  3SGI A;  4A3E H;  4A3B H;  4BA2 I;  3AFQ A;  4LF6 L;  1CKM A;  2PMZ E;  1KRT A;  3Q8D A;  1V1Q A;  2R92 H;  3OTO L;  2YTX A;  3CCU A;  4A93 H;  1AH9 A;  2JEB I;  3AQQ A;  4X62 L;  1HZB A;  4JOI C;  4JI8 Q;  4A3J H;  3CPF A;  4TQU S;  3UDI A;  3K7A H;  2CWA A;  4IPD A;  4EQ5 A;  3S1R H;  1EFW A;  1E22 A;  3HOX G;  4JYA Q;  4GKK L;  1PH9 A;  4QIW E;  3HOU G;  2ZJR A;  5LMN W;  4OX9 L;  3F2B A;  3FHW A;  3J81 i;  5FLM G;  5IP7 G;  2JEA I;  1R9T H;  1HNW L;  4JI3 Q;  3S17 H;  2HIX A;  3HOW H;  4UPA A;  4A4I A;  3RZD H;  3RLO A;  3ULJ A;  4BXX G;  2OWO A;  2NN6 I;  2ZTE A;  4PG3 A;  5FLX c;  3T1Y Q;  1SFO H;  3F2C A;  1KC8 C;  2VQE L;  1KAW A;  1M1K C;  2ZM6 L;  2JE6 I;  3RNU A;  1UE1 A;  4IJL A;  3UDF A;  2K52 A;  3GTM H;  5DLQ E;  4A3K H;  3STB C;  1XPO A;  2UUB L;  1XMO L;  2A1A A;  1Q81 C;  1Q46 A;  3W1G A;  4K0K L;  3FP9 A;  1PH5 A;  1VQ5 A;  2JA6 H;  1A62 A;  5M3F G;  1BBU A;  2CFM A;  1NY4 A;  4X66 L;  4HJ8 A;  4AH6 A;  4BY7 G;  1CSQ A;  4HID A;  5JJK A;  1J5E Q;  4KI0 A;  4DV5 L;  1G51 A;  1HNX Q;  2OTJ A;  3IRB A;  4DR3 Q;  1VQI A;  4OWT B;  4JI2 Q;  4A76 A;  2MFI A;  4A3G H;  3G4S A;  4IFD I;  3CME A;  4DV2 Q;  4UP9 A;  1XJV A;  4BY1 H;  1VQ6 A;  1EIF A;  2KCT A;  4DK3 C;  4IJH A;  2F4V Q;  2A8V A;  3HOV G;  2WB1 G;  2AHO B;  1L1O C;  1YZ6 A;  3KLW A;  3L0O A;  4YCV A;  4GKJ Q;  4JI4 Q;  3ULP A;  1IL2 A;  3I56 A;  4A3I G;  4JOI A;  2MNA A;  2A19 A;  1KHI A;  2ZTC A;  3KJO A;  4NPS A;  4B3T Q;  1S72 A;  2PI2 A;  4X65 Q;  4DR5 L;  3PGZ A;  3H3V I;  3MXN B;  3S16 H;  3K80 C;  1W3S A;  3TS2 A;  4AYB G;  1I94 L;  1XNR Q;  4WJ4 A;  2UUA Q;  3RN5 A;  2CKZ B;  1N36 L;  4R4O A;  3I4M G;  2MO0 A;  1TWA H;  1GD7 A;  4LNQ A;  1WYD A;  1BKB A;  4LF8 Q;  1KXL A;  2I5H A;  4DAM A;  4B3M Q;  2JA8 G;  1DGS A;  1N33 Q;  2WFW A;  2NVQ H;  5M3M G;  4OWW B;  1UEB A;  4Y7N H;  1PH6 A;  4YWM A;  5HY6 A;  1VQ9 A;  5ELO A;  1OTC A;  2PI2 E;  2VL6 A;  3S2D H;  3H3V H;  4PMW A;  4B3S Q;  1AE3 A;  3RN2 A;  4LF7 Q;  4A3L G;  3PUW A;  1I5F A;  1SMX A;  3TRZ A;  3RR5 A;  5IWA Q;  4IOA A;  4A75 A;  3KDF A;  4HIO A;  2VY3 A;  3HOZ G;  1PH1 A;  4PZ6 A;  5LMN Q;  3BZC A;  5BR8 Q;  5M5X H;  1JJ2 A;  4NXM L;  3KFU A;  4B3R L;  2R7Z H;  4LUZ A;  3U50 C;  3JAM c;  5LMU Q;  3TEH B;  2DGY A;  3RLN A;  1HZC A;  1X3E A;  3PO2 G;  3PO3 H;  1L1O A;  2Q2T A;  1X3G A;  2WP8 J;  3H0G G;  1S40 A;  4XTC S;  4QGU A;  1YNX A;  3FKI H;  4BBS H;  3F2D A;  1A0I A;  4JI0 Q;  1Q8K A;  1I6H H;  3VDY A;  2UUC L;  1VQG A;  3PCO B;  2LXJ A;  3S15 H;  1NJI C;  4BBR H;  1QZH A;  2VUM G;  5AJ3 L;  3ER0 A;  1NTG A;  3GTP H;  4L5Q A;  2DUD A;  1X54 A;  1TWG H;  4UP7 A;  4DV6 Q;  5C4X H;  3JC6 6;  1OXV A;  5IP9 G;  2RCN A;  3S1Q H;  1Y1W G; 
#chains in the Genus database with same CATH topology
 3HKZ E;  2K1B A;  1AN8 A;  1H9S B;  2PNH A;  5D1P A;  5J39 A;  3I4M B;  1CUK A;  2QCP X;  4EEQ A;  5DG9 A;  1VQA A;  3NBI A;  1E4F T;  5DG7 A;  4JI6 H;  3I90 A;  4LFA L;  2UXB H;  5IIF A;  1N32 H;  1MSG A;  2LS0 1;  5CMD A;  4LF5 Q;  4K0K H;  3J80 L;  4EQO A;  4N9P A;  1FR3 A;  2ALZ A;  2F0L A;  5KYI A;  3ETH A;  1A2T A;  2AU0 A;  2KCN A;  1D6E C;  3DHQ A;  3H15 A;  4XQN A;  2E2J H;  4PDB A;  3QR8 A;  1HR0 L;  4AQY H;  2KEN A;  4YJ3 F;  3HOX H;  5L9X A;  2NVQ B;  1E2V A;  1UC9 A;  4YB8 B;  4L63 B;  3J80 i;  3OUU A;  4S3S A;  4BA1 I;  2EE1 A;  3CQZ B;  1EYC A;  4YCW A;  3PO2 B;  1EYG A;  4DAV A;  1W6J A;  3V05 A;  3ORQ A;  4F4Z A;  3RB6 A;  3AU7 A;  4G7Z C;  2HHH L;  4IHJ F;  5CV6 A;  5J22 A;  1EY6 A;  4YCU A;  1MJE A;  4MV3 A;  3LWB A;  2M9V A;  2JJQ A;  2R7Z A;  5H80 A;  3DWP A;  2VB3 X;  1VQ8 A;  4LFB L;  1QVC A;  2F0F A;  4KK7 A;  1KNE A;  4F4X A;  2XTI A;  1Y1W B;  2OH2 A;  2JA5 A;  5F2D A;  2E2D C;  2UVR A;  4FF3 A;  4HCE A;  4BY7 H;  5GAH C;  4HNV A;  4ED8 A;  4O3O A;  1GUO A;  3D6C A;  1JMC A;  5K2M A;  3T5L A;  3IKJ A;  3BZK A;  1EY0 A;  4YIJ A;  3M3Y B;  1EL0 A;  4QL5 A;  2AQ1 B;  4RHR A;  1JOR A;  5KT2 A;  3J80 W;  3D4W A;  3ETJ A;  4H02 A;  1QG7 A;  4RGT A;  1JIC A;  1XX8 A;  1AN7 A;  4FXG C;  3M4Q A;  5EWF A;  2EVB A;  2RKS A;  2J6S A;  5KFL A;  5CV5 A;  1N36 Q;  2NBF A;  3G7L A;  1XNR H;  1XTC D;  3KAL A;  1S03 G;  4YBZ B;  4WRD A;  4WOR A;  1QE6 A;  1IBL L;  4FU0 A;  4IPG A;  3AYH B;  1VQC A;  1GM5 A;  1STN A;  4F88 A;  3GTK H;  3MFI A;  1FJG Q;  2J4X A;  2O4X A;  3STB D;  4DR6 L;  1Y8N B;  2WAQ A;  3HZX A;  1IXR A;  4JG2 A;  1UE6 A;  4L6T B;  1IBM Q;  1SNP A;  3E6Z X;  1BOS A;  1SE3 A;  1SRU A;  4YAJ B;  4X64 Q;  3ERQ A;  3VR6 A;  4B3S H;  4J15 A;  5KGU A;  4G7H C;  4MV9 A;  2M2L A;  2F3W A;  5LMN H;  5BR8 H;  4CKE A;  4IN3 A;  5DM7 3;  3TS0 A;  2YTY A;  4JI2 L;  3H0G H;  4DV2 L;  2UXC H;  3SVM A;  3KK7 A;  1KJI A;  4MV7 A;  2ZTD A;  1F2L A;  4PZ8 A;  4OO1 I;  3G6J B;  3NEM A;  3GTL B;  2N78 A;  3A8I E;  1ZET A;  2R7F A;  1AZQ A;  2GLT A;  2IHE A;  3RGX A;  3GTM A;  1EUJ A;  2F0H A;  5DAU A;  4DR4 Q;  4H0L C;  3S24 A;  3K59 A;  1UC8 A;  3WDN A;  2KEE A;  2FIN B;  3GV7 B;  4I65 A;  2W70 A;  2WKC A;  5C3E G;  1M90 C;  3GTG H;  3AMU A;  3CCQ A;  1I4G A;  2QF7 A;  2K5H A;  3KF8 A;  1N56 A;  2VZA A;  2B2U C;  4DXG A;  3W5O A;  4LF8 L;  5EJW A;  2L15 A;  2Y0S A;  5HGQ A;  5DNF A;  1PH7 A;  4ZLT F;  1Q82 C;  1DM0 B;  2PQE A;  3H91 A;  2WII B;  3I73 A;  5EPK A;  5FLX L;  5GON F;  3KYH C;  2IMW P;  4O3Q A;  2VR1 A;  4DV4 H;  1O7L A;  2AGQ A;  1VQO A;  1PRT C;  5I6W A;  4YHH L;  4LF7 L;  4ETS A;  4JBW A;  4ED1 A;  3SK8 A;  2NVY A;  1WTR A;  4MV1 A;  5KFQ A;  1TWA A;  2FXQ A;  2HCC A;  1KC7 A;  4GKK Q;  5D65 A;  2F0W A;  1M4V A;  2K03 A;  5C0X J;  3CCM A;  2B63 B;  2QA4 A;  3OHB A;  2C9O A;  3R8B A;  1Y1V G;  2R87 A;  1G6P A;  4DR2 H;  4RU9 A;  3FDS A;  2NVT B;  3J7A V;  5FO7 B;  4PWQ A;  2GVB A;  5KFI A;  4DAY A;  5KT6 A;  1EOV A;  2F0P A;  4KLK A;  3HFZ B;  4JI6 Q;  2E74 C;  5NUC A;  4IFD J;  2ICE C;  5D8D A;  2FPG B;  1OXU A;  1Q8I A;  1SYE A;  4A3C G;  2BQR A;  1GO3 E;  1EQV A;  3KLR A;  1XMQ H;  5IT9 W;  4K0K Q;  2B2U A;  3RUZ A;  2L12 A;  3RTX A;  3RIZ A;  2VUM A;  4LJZ C;  3PO3 B;  5JUM A;  4I7A A;  3OHA A;  2F0G A;  4RWS C;  2XIW A;  4X66 Q;  2H1E A;  2PZT A;  2KBN A;  2Q8I B;  5KG3 A;  4DV5 Q;  2Q2H A;  1YJN A;  3ND8 A;  1E0B A;  3OPO A;  4C3H B;  4LF5 L;  3I3C A;  3QO2 A;  4MZ9 A;  5FLX W;  3J80 E;  3R2T A;  4AQY Q;  1NR2 A;  3CCL A;  5M5W H;  4I7Z C;  1BCP C;  3D6W A;  3H4B A;  1YEZ A;  3E0E A;  1S5B D;  2BH8 A;  2E5L H;  2D62 A;  2RDI A;  5IOC A;  1EWI A;  5COR A;  4A93 G;  1LTI D;  1Y69 U;  3K5I A;  1N48 A;  1K8G A;  3V4Z A;  5EPL A;  1B1Z A;  2HCI A;  2JA5 B;  4HTH A;  2QGQ A;  3H94 A;  3M9O B;  1B9N A;  3BU2 A;  1BJT A;  2VPQ A;  2HUG A;  2K5W A;  4GLX A;  1KJJ A;  4X65 H;  2F0S A;  1WTX A;  2YV5 A;  1I4R A;  1DD2 A;  3RJ0 A;  3TSS A;  3PIP 3;  2OTL A;  3I4N B;  1C4Q A;  5KX5 F;  3PQI A;  1X65 A;  3VYR A;  4TV8 F;  2A73 B;  1CQI B;  3CU7 A;  2HQE A;  2WAC A;  3LP8 A;  1TWC H;  5GAG C;  4H7B A;  2HDM A;  2JA7 B;  2KEC A;  3MWD A;  4L1K A;  3M9B A;  1N33 H;  2H5X A;  2F0D A;  1SYC A;  1S3O A;  4PQX A;  4A3M B;  4B3R Q;  4NXM Q;  2QDB A;  1TII D;  3K3V A;  2ZJT A;  5HUR A;  1K1S A;  2O2L D;  3EBE A;  3CXC A;  3MFG A;  2OEO A;  5KG1 A;  5JVD F;  3MR3 A;  2E2H B;  4BY1 G;  1YVC A;  1G2S A;  3IG0 A;  5KFJ A;  4DV1 H;  4A3E B;  1KDC A;  2FB9 A;  2WAQ B;  5K36 G;  3KOJ A;  3A54 A;  3QFF A;  3DWA A;  5FD6 A;  2NZO A;  5C3E H;  4A3J B;  1CM9 A;  4LH6 A;  4JI0 H;  2B2T C;  2IX3 A;  2CH4 W;  5E3F A;  1HNZ H;  2ATL A;  1N8R C;  1HJP A;  4IR1 A;  1YIT A;  4LW1 A;  4EGJ A;  2W57 A;  4HMI A;  3EPG A;  1CZG A;  1EHI A;  5KG7 A;  2K6A A;  1LM0 A;  3PVX A;  2UUA L;  3J81 j;  1FJG L;  3HP3 A;  1LT4 D;  3CVZ A;  3T5J A;  1N34 H;  5KFC A;  1D5M C;  4ZCK A;  4YWL A;  1K3R A;  3AFP A;  1IBM L;  3HKZ A;  2WV6 D;  4ECS A;  2E8G A;  3CRK C;  4X64 L;  3TP8 A;  2EY2 A;  1VQ7 A;  4JI7 Q;  3NXW A;  2UXC Q;  2HVS A;  3I8Z A;  4NXN Q;  1BCP F;  1JQY D;  1EIY B;  3MEH A;  2D0P A;  2GN5 A;  1P8L A;  4F8M A;  3RD4 A;  5DM6 3;  2A6H D;  5IWA L;  2R7Z G;  1Y1V H;  2W7O A;  4GN5 A;  3KF8 B;  5J3B A;  4A3G B;  1I4Q A;  2JQO A;  4DV0 Q;  1HNW H;  4KV6 A;  3M7N A;  3I4L A;  3CCV A;  5GAE C;  1EQQ A;  4DR4 L;  4AYB E;  2FPI B;  4TRD A;  3SK4 A;  3RV4 A;  2B2T A;  3S1M H;  4A3C H;  2PMZ A;  1GSA A;  4BBR G;  1EOT A;  5JPN C;  4F7X A;  4QW8 A;  3S16 B;  4CJ0 B;  2ZM6 H;  2R7M A;  1KNA A;  2JEF A;  1PH2 A;  2EJM A;  2R86 A;  5FKA C;  1GSH A;  5AFW A;  2Z1C A;  3OOC A;  4DUZ Q;  4DV4 Q;  1AUV A;  1MD2 D;  1TWA B;  4O1N A;  1X55 A;  2NZH A;  4ZHQ F;  1JX4 A;  5FJ8 G;  1JB7 A;  3PZP A;  2MO1 A;  2XWJ B;  3RGZ A;  3EA6 A;  4QF4 A;  3CCE A;  3SGI A;  4IRK A;  3NPP A;  5CGK A;  1HHV A;  1HA6 A;  5I2X A;  5L1J A;  4A93 H;  3OSO A;  3S2D B;  4JI8 Q;  1ZHQ A;  5C3W A;  4F4W A;  3FMA A;  3K7A H;  2CWA A;  1EFW A;  5EOY A;  4JYA Q;  3O13 A;  5FO8 B;  1I94 H;  4GKK L;  4CC5 A;  1PH9 A;  1PX2 A;  3HOU G;  1L0X B;  3F2B A;  3FMC A;  1B2T A;  5FLM G;  1JWM D;  4JI3 Q;  1EYD A;  4A4I A;  4C56 C;  4BBS B;  2IW3 A;  1J8I A;  1GGO A;  3T1Y Q;  1SFO H;  4IRC A;  1EU3 A;  4C3I G;  4ZI7 F;  3GTP B;  3R5H A;  2UUB L;  4EYI B;  2SNM A;  5C4X B;  1Q81 C;  1Q46 A;  4K0K L;  1PH5 A;  1BXR A;  1Z2P X;  4O4H F;  2FHT A;  3FDT A;  2J6T A;  4X66 L;  4HJ8 A;  3Q8R B;  4OIK A;  1J5E Q;  4DV5 L;  2OTJ A;  4ME5 A;  4DR3 Q;  2WIN B;  3CME A;  4BY1 H;  1XJV A;  1VQ6 A;  2YCH A;  3C1E A;  2KHS A;  4IJH A;  1PFM A;  2SEB D;  4IR9 A;  1IL2 A;  2BQ3 A;  3I56 A;  5K36 H;  2MNA A;  4RH6 A;  3DEO A;  3EFX D;  3IFT A;  2PO4 A;  3SR1 A;  2E2J B;  4X65 Q;  3RFC A;  3H3V I;  3K80 C;  3HOX B;  2G9D A;  4WJ4 A;  4ID6 A;  4JPB W;  4XZ3 B;  5ELE A;  3RN5 A;  2CKZ B;  4WFN 3;  4R4O A;  2AUJ D;  5IGG A;  2MO0 A;  4F87 A;  2XRQ D;  1HTL D;  1OO9 B;  3C46 A;  4DAM A;  4TQS A;  4IWY A;  1N33 Q;  2A5H A;  4V19 0;  4YWM A;  5HY6 A;  5ELO A;  1MGS A;  2PI2 E;  1JLL B;  4A3L G;  1V1P B;  2EYF A;  1RTN A;  1LT6 D;  1SMX A;  2EZV A;  4IOA A;  4A75 A;  4TKO B;  4HIO A;  3HOZ G;  5D1O A;  3URY A;  4B3R L;  4NXM L;  3KFU A;  4BY7 B;  3MR5 A;  1KDA A;  2MPM A;  2R7Z H;  3U50 C;  3JAM c;  3Q24 A;  1Q90 A;  5JOB A;  1JOQ A;  4N9T A;  5KG2 A;  4ABN A;  4DLK A;  1BNZ A;  3E0J A;  2Q2T A;  2WB1 B;  2YYA A;  1YNX A;  1IKM A;  3H3V C;  2JA6 A;  3TN2 A;  2B39 A;  2X6G A;  4JI0 Q;  2J0T D;  1Q8K A;  5KFM A;  2PW7 A;  4J9N A;  3PCO B;  4ZKC B;  5EWE A;  3S15 H;  4BBR H;  2VUM G;  3ER0 A;  4LK1 C;  2EJG C;  5CB4 F;  1OXV A;  5IP9 G;  5KRU A;  3TQT A;  2PVP A;  1VMP A;  3K5N A;  3RAX A;  2VPS A;  4EEY A;  4IAL A;  3CW2 C;  3NWT A;  3MWM A;  1CFM A;  4P74 A;  5BPF A;  3GTK B;  4J9Q A;  1EWH A;  4JI1 H;  1HA5 A;  5KT3 A;  4TUY F;  4ME3 A;  2YZN A;  1MIU A;  2F3I A;  3BG5 A;  1IHZ A;  1ENC A;  1U5K A;  4AIM A;  2CVR A;  1BGW A;  3WNZ A;  3Q6S A;  3EJI A;  3CC2 A;  4PMC A;  4JI7 L;  2L1B A;  2ID0 A;  2UXC L;  3I91 A;  4NXN L;  3MXP A;  4DN4 M;  1X6O A;  1E4E B;  4FDB A;  4A3D G;  4N8F A;  2IX1 A;  3RLF A;  4IAJ A;  2ZDQ A;  4I50 F;  3GIL A;  3HOU H;  1HNW Q;  2HT1 A;  5FLM H;  1QVG A;  1A63 A;  3TIN A;  2QK4 A;  4J9R A;  5K5P A;  1JWU D;  3H0G B;  4KD4 A;  4A3F H;  3L9A X;  4UHV A;  5IY0 A;  2FLP A;  1PMR A;  4DV0 L;  3A7L A;  3RZO H;  2NU9 B;  2ZM6 Q;  1IYJ B;  4JUZ A;  2AQ3 B;  2F0Q A;  5GQO A;  2CHB D;  1EEI D;  4C3I H;  5KT5 A;  2EXZ A;  2L0C A;  4NDX A;  1NR4 A;  2K28 A;  3FVQ A;  4NB3 A;  4APV A;  2FMM A;  3DEP A;  5KG5 A;  1XNQ Q;  3KHH A;  3FKI A;  4HIK A;  3GTG B;  4GN4 B;  4DV4 L;  4DUZ L;  1PXU A;  1GUW A;  3OHX C;  1BBX C;  1PH4 A;  2DJF C;  2R8I A;  3N42 B;  1C0A A;  1M8A A;  4ZQI A;  4DL4 A;  1K28 A;  5DLF A;  1K8M A;  4CDF C;  2SOB A;  1SBB B;  3L4J A;  5KT4 A;  3M4P A;  3OWE B;  4O2A F;  4GKJ H;  3PF4 A;  1EYA A;  1JE4 A;  1Z2O X;  4JI4 H;  5G3L F;  4JV5 H;  3R5F A;  3GII A;  4YR3 A;  2BQU A;  4J8Q A;  3JRW A;  4JI8 L;  4JV2 A;  1D8L A;  4B3T H;  2HQL A;  2Q2I A;  4KMU C;  4EFB A;  5CV4 A;  1A9X A;  1SYG A;  4JYA L;  1SND A;  4X3U A;  3PV0 A;  1HH2 P;  2AWO A;  2ZXP A;  2LY7 A;  1QWY A;  2UU9 Q;  3MWY W;  1G2T A;  5JVL A;  2K5Q A;  1STH A;  2CQY A;  5KNC A;  3K8A A;  4JI3 L;  1SE2 A;  1PTO D;  3HKZ G;  3E5S A;  3CC7 A;  2VQF Q;  3T53 B;  4B3M H;  4JBK A;  1EFI D;  1XPU A;  3T1Y L;  2F0E A;  2NVY H;  2JN4 A;  4HAE A;  3GIM A;  1WVL A;  5I9O A;  4GOP C;  4A3L H;  4KKS A;  1SLJ A;  1FD7 D;  1Q7Y C;  1B6S A;  3DMU A;  5DQG A;  2HVR A;  1QVF A;  1PK8 A;  5C5J A;  5KFA A;  4BWG B;  5KFZ A;  4C2M A;  2R6G A;  1FNU A;  3GO5 A;  4R4Q A;  2VA3 A;  3A8J E;  1ULZ A;  3BA9 A;  2NWG A;  4JW0 A;  1J5E L;  5KFG A;  2R93 G;  3N41 B;  2YL2 A;  4XYL B;  4DR3 L;  4LF4 Q;  4EG0 A;  5LMU H;  3A0J A;  2NB0 A;  4OON A;  1E1T A;  2XC9 A;  3WOF A;  4F4Y A;  4EVO A;  2PQA B;  1SFO A;  4WBN F;  4U7C A;  2H4O A;  4P75 A;  2VUM H;  2NVX A;  1HFN A;  3Q8S B;  4XXE A;  1WTV A;  2R7D A;  4DR7 Q;  1GHK A;  3VR3 A;  2IWH A;  5IP9 H;  2RSN A;  1GUT A;  1E7Z A;  4X65 L;  2I0Q A;  3HOV B;  1S68 A;  4FF1 A;  4G7O C;  3AB9 A;  3MR2 A;  4KKT A;  1VQE A;  4FVM A;  4QJF A;  5C4Z A;  2ASL A;  2B2V C;  2VQD A;  1LT5 D;  2N55 A;  5F9N A;  2JA9 A;  3LWE A;  4YWK A;  5KG4 A;  4AYB A;  1QZG A;  1KAB A;  4Q43 A;  4HSP A;  1T9H A;  5ELC A;  1RHP A;  4L5R C;  4GOP A;  2IY5 B;  3RMH A;  4POF A;  3HRZ C;  5LL6 b;  1S0M A;  2LKV A;  1CKN B;  4YY3 H;  4IRD A;  3ICE A;  2WB1 E;  4A3D H;  3GQB A;  1UNS A;  5M3M B;  1PHJ A;  3OTO Q;  1TWC B;  5JVG 3;  3T1H H;  1OXT A;  3LNN A;  4X62 Q;  1S5F D;  1ZQ7 A;  5E1F A;  4K2K A;  2JEG A;  3KF6 B;  3MVV A;  2FLN A;  4DL5 A;  4MIU A;  4LWC A;  1DJR D;  4MNO A;  2B3G A;  2X6L A;  1VQL A;  5E4W C;  3FPU B;  5KND A;  3RUP A;  4JI0 L;  4QB4 A;  3TIG A;  4YP3 A;  3VMM A;  3NTH A;  1KQS A;  5IT9 L;  2VW9 A;  2W9C A;  1A3U A;  2W71 A;  2VQE Q;  2GPW A;  3GID A;  3T13 A;  5KFN A;  4JCV E;  2K50 A;  2P5Z X;  2B2V A;  1BQQ T;  1EIG A;  1VQK A;  1DXM A;  5C3E B;  4GNX C;  1XMO Q;  2N49 A;  1SNM A;  3UQ8 A;  4JI1 Q;  2VNU D;  2TSS A;  1I4H A;  4TSS A;  1EU4 A;  4O3R A;  4FXD A;  5EBC A;  2LSS A;  4ECQ A;  1YJW A;  2FK2 A;  3NEN A;  2F0U A;  3K7U C;  4C3J G;  2I5L X;  4M7E A;  5DQI A;  4CJ2 C;  2K7V A;  3PUX A;  4YAK B;  4ECR A;  1VQP A;  2DPI A;  4R8U B;  1I3Q H;  4H44 C;  4MN3 A;  3X3N A;  2RBM A;  2FLL A;  1I7L A;  4A3B G;  4XQJ A;  3M9M B;  4R7R A;  4DNR B;  4RG1 A;  1B33 N;  3LWU A;  2R92 G;  2P0A A;  1PYS B;  4DR5 Q;  3M4O H;  4KHP H;  3WO1 A;  1SAP A;  3S1N H;  1AFP A;  2RDG A;  1L2F A;  3U4V A;  3JAM L;  1HR0 W;  4YR2 A;  2YTV A;  1PTO C;  3G6X A;  1S0O A;  3OMG A;  1Y1V B;  1TS2 A;  3BDO A;  1I4X A;  1JJG A;  3GP7 A;  1O7I A;  4DPG A;  5C0X I;  1J9O A;  5C3X A;  4JI5 H;  3JAM i;  4G4K A;  1PH3 A;  1U4L A;  5FPR A;  2W9B B;  3MXN A;  4GNX A;  2CH4 A;  2GVA A;  1WCM A;  1F9S A;  5EQ0 A;  4J6H A;  1XNQ L;  3S1M B;  2DZD A;  4LSA A;  1CI3 M;  2KUM A;  3JZI A;  4MTN A;  2R93 H;  2F0K A;  5T1I A;  2R7K A;  3GTJ A;  1SMY D;  1WTO A;  2JA6 G;  1SE8 A;  4HCS A;  2YRW A;  2R7L A;  3GTQ B;  4JV5 Q;  3W2D A;  2K5V A;  1IBK H;  4UY8 C;  2E2I H;  4KHV A;  4ZRZ A;  3NQT A;  1HFG A;  1EQT A;  3D3R A;  2RVL A;  3TP7 A;  5C1P A;  2ZDH A;  4RUA A;  4Q45 A;  4FBT A;  4RMF A;  3K5M A;  2C2R A;  1XWE A;  5KFE A;  3MAQ A;  1CA5 A;  4UCR A;  1RL2 A;  4OXP A;  5KT7 A;  3HBL A;  3DUZ A;  3HEJ A;  1SXT A;  2OQ0 A;  4A93 B;  4DUY H;  2XCA A;  2C00 A;  4ED2 A;  3ITP A;  3NWS A;  3JAM W;  3SK5 A;  2UU9 L;  3OSP A;  4Q8F A;  3E3X A;  4XDX A;  4DV3 Q;  2K5N A;  3CP0 A;  1JKJ B;  4TV9 F;  3TP5 A;  2D2C C;  1L0Y B;  3BVZ A;  2W7P A;  2PYK A;  4KD3 A;  3PR5 B;  2W6Z A;  4J9M A;  4Q5V A;  2VQF L;  2B8G A;  4OWX B;  3V6H A;  2I07 B;  3K5L A;  4LFC Q;  1MJC A;  4ED0 A;  4APM A;  4KY7 A;  3PW4 A;  5DGB A;  4Q8E A;  1QNU A;  4HR7 B;  3F2U A;  1TR5 A;  1S97 A;  1F2Y A;  5LA6 F;  4KKU A;  1TWF A;  2ATW A;  1YNJ D;  4M8A A;  3VYT A;  1YNN D;  1G91 A;  1R4P B;  1XTD A;  4LF4 L;  3OIP A;  3VR2 A;  4QCL A;  4DR1 Q;  1W96 A;  4WJ3 M;  2NUA B;  4OX9 H;  4ECY A;  3PUZ A;  4ODG A;  4RKL A;  2ES2 A;  4BY1 B;  2KHI A;  1SRO A;  2UXD Q;  4DV7 Q;  3FKI G;  3FEW X;  3U4Z A;  4K5V A;  4DR7 L;  1PFS A;  1STY A;  1UE7 A;  1FNW A;  2RF4 A;  1F77 A;  1VBH A;  4LSX A;  2NU6 B;  4BS9 A;  1AUX A;  1U0L A;  2QKI C;  5D14 A;  4DV6 L;  3A5U A;  1Y8P B;  3KJP A;  2PZW A;  1SR3 A;  1NNX A;  4QIW A;  1K83 H;  2WKD A;  2UXB Q;  4C3J H;  4YY3 Q;  2L55 A;  5H1S E;  2FFK B;  1QUQ A;  1N32 Q;  4A2A A;  2UVV A;  5I4D A;  2I87 A;  4L5T A;  3SI8 A;  2FJZ A;  1U9R A;  4OHJ A;  2YU9 A;  5JJL A;  5EWG A;  4XYO A;  1LV9 A;  4JBJ A;  4A3B H;  4LMY A;  2R92 H;  3OTO L;  2YTX A;  3CCU A;  3KLS X;  1WTW A;  3A56 A;  2JEB I;  4X62 L;  1HZB A;  2RDF A;  4JOI C;  2WYO A;  4MTE A;  3M9N B;  3BQ2 A;  3CPF A;  4IPD A;  4EQ5 A;  3TBI B;  5ELF A;  1F9R A;  2G5D A;  1EZ1 A;  1EY7 A;  2BOS A;  2R7Z B;  2D5D A;  1G6Z A;  5KFP A;  3FHW A;  4FF2 A;  4JV0 A;  3V4S A;  1BDO A;  5KFO A;  3RZD H;  3ULJ A;  4BXX G;  5IT9 E;  2ASD A;  1M0W A;  1M7J A;  3OSN A;  1KC8 C;  2VQE L;  1M1K C;  1X3Q A;  1EUD B;  3GIQ A;  3S15 B;  4BBR B;  3GTO A;  3STB C;  1XMO L;  2A1A A;  1K1Q A;  2K05 A;  2R8J A;  3OW7 A;  1F2M A;  4FP5 D;  4J1M A;  4B08 A;  2AQ4 A;  1SEB D;  4EQN A;  3OWF A;  5EKK A;  2JA6 H;  5M3F G;  3BAA A;  1SMY C;  2RCF A;  5KFR A;  1I50 A;  4RFB A;  1TKW B;  4AH6 A;  1CSQ A;  4HID A;  5ISR A;  1R4Q B;  3HG9 A;  2ZXO A;  2MFI A;  3DXJ C;  3G4S A;  4UP9 A;  1EIF A;  1PRT F;  4QUF A;  2J9G A;  3P20 A;  4DK3 C;  4KN7 C;  3L0O A;  1L1O C;  4MV4 A;  4A3I G;  3G6V A;  4JOI A;  2BR0 A;  2KSW A;  2CW0 D;  1KHI A;  2UUC H;  1XXG A;  3KJO A;  3TZD A;  5KFY A;  4DR5 L;  5DG8 A;  3MXN B;  5C5L A;  2QYZ A;  4AYB G;  3JAM E;  1XNR Q;  3RF2 A;  1IW7 D;  2F0M A;  3HOU B;  1IKL A;  5ELB A;  1N36 L;  1SYF A;  1VAJ A;  1MBY A;  4A3F B;  3D4R A;  3JSL A;  1WYD A;  1BKB A;  2OT2 A;  3GV8 B;  2W6Q A;  2I5H A;  4CKC A;  3RZO B;  2MCT A;  2JA8 G;  4QUC A;  1DGS A;  1IOW A;  2NVQ H;  1I3Q A;  4OWW B;  1UEB A;  4HQ6 A;  5KFD A;  1KAA A;  4C3I B;  4OL7 A;  5C8Y F;  3K3P A;  1CTM A;  1KJQ A;  2J7Z A;  1SE4 A;  1VQ9 A;  3RB4 A;  2ZXR A;  3MFH A;  1YNJ C;  1OTC A;  4Q44 A;  3GV6 A;  4B3S Q;  3H3V H;  1KLG D;  3RN2 A;  3PUW A;  1H9K A;  1S5D D;  3GQC A;  3TRZ A;  5KG6 A;  1VBG A;  1YNN C;  3KDF A;  1S5E D;  5LMN Q;  5M5X H;  5BR8 Q;  5KKN B;  4XYM B;  4U6P A;  2A6E D;  4QMG A;  3VPB A;  3GTM B;  3RLN A;  5CA1 F;  1HZC A;  4MA0 A;  4O3P A;  2YZG A;  3NSW A;  1L1O A;  1X3G A;  2WP8 J;  3BZD B;  4QGU A;  5FPO A;  3FKI H;  4A2B A;  2FK1 A;  2HHH H;  2W6N A;  4DL2 A;  1A0I A;  4M1U B;  3VDY A;  1EWC A;  2LXJ A;  2O5I C;  1ZYR D;  4L5Q A;  4ECZ A;  1TWG H;  4UP7 A;  2R93 A;  4LFB H;  2F4I A;  3JC6 6;  3M7G A;  1C48 A;  2Y0S B;  3VYS A;  4O3S A;  3GDE A;  4DV3 L;  4HSV A;  2RHQ B;  3M85 A;  4MHE A;  2E2I A;  3G71 A;  1GOZ A;  4GLA C;  5KFT A;  2AWN A;  4P2C B;  4FYD A;  4IPH A;  1SNO A;  1HZA A;  4DA2 A;  4LFC L;  1QB5 D;  5DEH A;  1CE8 A;  1IL8 A;  1LTG D;  2NVY B;  3EQL C;  3UE1 A;  2R8G A;  2Q8T A;  3T51 B;  3ULL A;  5C44 G;  1Q86 C;  1U4R A;  2DNC A;  3T4A C;  4MTK A;  4EX5 A;  1E4G T;  2FKL A;  2C35 B;  3P7J A;  2K32 A;  2IP4 A;  5IYZ F;  3Q1K A;  3T5K A;  2KCM A;  3QIA A;  4DR1 L;  2K4K A;  4HJ5 A;  5HBR B;  2JP1 A;  5C5M A;  4DAY B;  4J9O A;  5D3I B;  1F2Z A;  1DIK A;  1IBL H;  1ICF B;  3NEL A;  1BVS A;  4BXX H;  5FO9 B;  2KQ3 A;  4DR2 Q;  1T94 A;  4C2M H;  1Q1E A;  1K9M C;  1WCM G;  3S2H H;  2UXD L;  4DV7 L;  1MZB A;  1S4Z A;  2XGT A;  3KAJ A;  2RDH A;  2VUM B;  1EY4 A;  4DR6 H;  2K75 A;  3LGJ A;  3HOY G;  3QZ7 A;  1RYS A;  4A3M G;  4J9S A;  3I7F A;  2KED A;  5M3F H;  1XMQ Q;  1Z9F A;  2Z6B A;  1E1O A;  1IOV A;  2Z0S A;  2IBK A;  4JI6 L;  1PRT B;  2M00 A;  3I2Z A;  3GTL H;  1HUN A;  5COY A;  2NVX H;  1JOK A;  2UXB L;  4YY3 L;  4FM9 A;  1N32 L;  2X0S A;  5IOD A;  2HGS A;  4JI2 H;  4X3K A;  3A55 A;  4DV2 H;  4RKB A;  5T1G A;  1B3Q A;  5JJI A;  4A3I H;  4K5W A;  3CMA A;  3K5H A;  4CDC C;  3MFY A;  2E5L Q;  1UWV A;  4AQY L;  3ERO A;  3CCJ A;  4A3D B;  1NUC A;  5LL6 X;  2DLN A;  1A2U A;  1IW7 C;  1I6V C;  5IT9 c;  4ECU A;  1JOO A;  1V43 A;  3LML A;  4O3N A;  1K83 A;  3J7A F;  1OXS C;  1FGU A;  3J7Y W;  2B2W C;  3PUV A;  4IZO A;  4DNT B;  1EYZ A;  2JA8 H;  4OEL B;  4LF8 H;  3MTS A;  1HUM A;  4F50 A;  4DGZ A;  2PZU A;  2N3S A;  3WWV A;  2R92 A;  1NCV A;  1Z7T A;  2WE6 A;  5LP6 F;  2QDL A;  3J81 c;  1GJX A;  2NU8 B;  4MTD A;  3U9T A;  1WJJ A;  3EYY A;  1RIP A;  4P72 A;  5FK9 C;  3H20 A;  4YHH H;  4LF7 H;  1BCP B;  3MEF A;  5CYU A;  5CV8 A;  3E9H A;  4I7H A;  2XCP A;  1CQF A;  1LLR D;  1LT3 D;  1G8Z D;  5IYD G;  4UCU A;  2VS1 A;  4XIG S;  2AGP A;  4ULL A;  2UUC Q;  5C1O A;  1ZKO A;  2EY1 A;  1KIX A;  1WTH A;  1HTP A;  4Y52 H;  2WAQ E;  2A6H C;  1HCZ A;  3K0X A;  5C0X G;  3NP8 A;  4DV1 Q;  4E4T A;  1X32 A;  1LYL A;  3M4I A;  4Q0Y A;  1ZYR C;  1VQB A;  2VOB A;  1SCU B;  4ECX A;  4QWA A;  4CHT B;  2R8H A;  3R3O A;  3I55 A;  1XNR L;  1D5X C;  2LXK A;  5T14 A;  4XX0 B;  1HNZ Q;  3M4O B;  5M5Y H;  1ILP A;  4J9L A;  4QY7 A;  4DL6 A;  2B2W A;  1IZ6 A;  2X69 A;  3S1N B;  2ALY B;  3NUC A;  5KFK A;  5L1K A;  4IUT A;  2F1M A;  2A68 D;  3HKZ B;  1SNC A;  2KOL A;  3SK6 A;  1N34 Q;  1KL9 A;  3KHG A;  3H40 A;  1U4M A;  1H9S A;  2LFN A;  4OEM B;  1F9Q A;  3PF5 A;  1TWH H;  5EBD A;  3BJY A;  4LF5 H;  2XVS A;  5C44 H;  2I8C A;  5IGC A;  2BDO A;  5L1I A;  5FJ8 H;  3AEV A;  4B3S L;  3NE5 B;  2R6F A;  4OO1 G;  1NBW A;  1VS0 A;  4UAI A;  5LMN L;  5KFX A;  5BR8 L;  2ASJ A;  2IX0 A;  4HJ7 A;  2R93 B;  3T16 A;  4K6L A;  2WTF A;  2ZJQ A;  3U58 A;  5EGT A;  5LHY 1;  2Y0S E;  1WCM H;  2PMZ B;  2E2I B;  2IT1 A;  3V2T A;  2V59 A;  3CQZ A;  3GTJ H;  4GLV B;  3HOY H;  5C4X G;  4A3M H;  3UE0 A;  3S9W A;  4H13 C;  2XGP A;  4R8N A;  5L37 A;  1Y14 B;  1PV4 A;  1C8C A;  4HJ9 A;  4ZUI A;  4O42 A;  5KFV A;  2JK8 A;  4IOC A;  4KTA A;  3DLL A;  1SN8 A;  1VCI A;  4RNM A;  4POG A;  1G29 1;  4ED3 A;  1NMF A;  3RBE A;  1K8A C;  2EQS A;  3E9I A;  3UI2 A;  1JE5 A;  1MSH A;  1X56 A;  2HVQ A;  2K33 A;  1PTO H;  2QW7 A;  3OYY A;  2HDL A;  3PN1 A;  1HNX H;  1TWG A;  4O0A A;  2V4R A;  4ME6 A;  1JXL A;  4QWB A;  3RB3 A;  4WJW A;  1S5C D;  3S14 H;  3P75 A;  2EXD A;  2NTT A;  4O2D A;  1VF5 C;  1IBL Q;  2XRS D;  2F4V H;  2GA4 B;  1KD1 C;  1I94 Q;  5KFF A;  2DN8 A;  2RHS B;  4KN4 C;  5FD5 A;  1JT8 A;  2RA4 A;  4HN7 A;  2A69 D;  4DR6 Q;  1WOC A;  2PW5 A;  3MWE A;  3BA8 A;  2VB2 X;  4DR2 L;  1YIJ A;  1TWF H;  4JBM A;  3F1Z A;  1ZXT A;  3BAB A;  3GIJ A;  1BF4 A;  4GC7 A;  2O03 A;  2KCC A;  2UUA H;  4FO2 A;  2R8K A;  1SJE D;  1FJG H;  2Z8L A;  3FPP A;  2CQA A;  3NQI A;  4EGV A;  1YI2 A;  3HOW G;  1OXX K;  2XNA C;  3TQY A;  5HV6 A;  3GD7 A;  1UEA B;  2W6M A;  1KBL A;  1FL0 A;  4KY5 A;  1LTL A;  2F03 A;  4J9K A;  3G6Y A;  1XMQ L;  4X64 H;  1N9W A;  4FS1 A;  1B7Y B;  1LTS D;  1MKH A;  5I9P A;  4A3K G;  2VXW A;  2IHF A;  1ET6 A;  3GLK A;  5IYD H;  1LUZ A;  2KVM A;  1UAP A;  2EYH A;  2F0T A;  4LH7 A;  3HOZ H;  1I6U A;  2MUY A;  4DK6 C;  1NSN S;  1B9M A;  4C3J B;  1T36 A;  1DOK A;  5IWA H;  1Z2N X;  5C0X H;  3IL8 A;  4IQZ A;  4IO9 A;  4R1J A;  5KFU A;  2E5L L;  4ALP A;  3C2P A;  4DR4 H;  2F3V A;  5AJ3 Q;  1D5Z C;  4K2L A;  4K8I A;  1STA A;  1STB A;  3QOJ A;  3QOL A;  4B9W A;  3VA7 A;  1VQM A;  4UFZ A;  3Q8Q B;  3SHL A;  5M5W B;  4ECV A;  1U4P A;  3GTL A;  1CSP A;  4IWX A;  4YJ2 F;  1Y8O B;  2YU9 H;  2IPK D;  1LAC A;  2BH2 A;  5DQH A;  2A68 C;  2OCE A;  2DY7 A;  4DNI A;  3K81 C;  3ORR A;  4HJA A;  2EY5 A;  4MV6 A;  3V6J A;  2MP1 A;  3JSN A;  4NW2 A;  2ICI A;  3TP6 A;  4QQB X;  3VPC A;  1X9N A;  4YHH Q;  3GV5 B;  3A7A B;  3RZD B;  5D1O B;  3MA2 B;  3N6X A;  4TVA B;  1FVI A;  1KRS A;  1SYB A;  2I5M X;  4EBD A;  2PNR C;  1A8V A;  4HIM A;  3KAK A;  4OO1 H;  3M4Y A;  1N33 L;  3I12 A;  1LTT D;  3EN2 A;  5KEE A;  5CC4 A;  4FF4 A;  3TII A;  3N8D A;  2JA6 B;  1W93 A;  1EZ8 A;  1RD9 D;  1B04 A;  2CQO A;  3ZJY C;  5JEA G;  3GTO H;  4GKK H;  1CQJ B;  1T5E A;  1T3N A;  2AKW B;  2XWB B;  4DV1 L;  2VA2 A;  4OGQ C;  4PNY A;  1E24 A;  4WD3 A;  1I50 H;  3R5X A;  5I2Y A;  3TRE A;  1QIL A;  3KBG A;  3PIP A;  4YR0 A;  4UP8 A;  4E6I A;  1GLV A;  3P1H A;  1RJR A;  4TQR A;  1TS4 A;  1JDE A;  5EKL A;  1PYW D;  2B63 A;  3CCR A;  2JYO A;  1ESR A;  3PW7 A;  1HNZ L;  1BBW A;  5KFW A;  4DAP A;  2UUB H;  3I4O A;  5CV7 A;  3CC4 A;  1PZJ D;  5EZY F;  1B70 B;  1D2B A;  4QWD A;  3EVQ A;  4NLG A;  4X66 H;  4DV5 H;  1N34 L;  5EAY A;  3EIV A;  1V8Q A;  2DY8 A;  1PRT D;  1BR9 A;  4LF9 H;  3PMF A;  5JPM C;  2B29 A;  2XSC A;  5DLG A;  1IYV A;  2HIV A;  4BA2 I;  3AFQ A;  4O4I F;  1CKM A;  2PMZ E;  3J81 L;  3Q8D A;  3TME A;  1M6V A;  1EZ6 A;  1GUN A;  4HNU A;  4TQU S;  2F0J A;  3S1R H;  5EKI A;  1E22 A;  5M5X B;  2A69 C;  2Z4H A;  3N44 B;  2ZJR A;  1RJP A;  4X3S A;  1HXY D;  3J81 i;  2HJW A;  2YRX A;  5JH7 F;  5EPJ A;  5IP7 G;  1R9T H;  1HNW L;  1TWH A;  3S17 H;  2HIX A;  3KUP A;  2L9H A;  5FOB B;  3HOW H;  2FMA A;  3QB3 A;  3FKI B;  4ZKB B;  1II3 A;  2OWO A;  2NN6 I;  2ZTE A;  4V0B A;  4DK0 A;  3VA5 A;  5KIX A;  4DF7 A;  3F2C A;  3MHB A;  2ZM6 L;  2OXP A;  3Q2O A;  5BN5 A;  2FP4 B;  4KY6 A;  1H9J A;  3UDF A;  2K52 A;  4RUC A;  5DLQ E;  4ECT A;  4A3K H;  1TWG B;  1XPO A;  3MXU A;  1SNQ A;  1UNN C;  2IL8 A;  4CC6 A;  4K6D A;  3C3L A;  2C2D A;  3W1G A;  4IUP A;  3FP9 A;  1QNK A;  1VQ5 A;  1A62 A;  4PV1 C;  3K58 A;  1BBU A;  2CFM A;  2CZG A;  4EGQ A;  3T5H A;  4B3R H;  5JJK A;  4NXM H;  3N52 A;  1HNX Q;  3IRB A;  4OWT B;  5F9L A;  1BCP D;  2JA7 A;  4IFD I;  3KBX A;  3C0F B;  2F4V Q;  2A8V A;  3HOV G;  4GKJ Q;  3KLW A;  1YZ6 A;  5CBE E;  3TZU A;  4JI4 Q;  3J81 W;  1QOH A;  2A19 A;  2J6U A;  5A35 A;  3TQ1 A;  2YZM A;  4B3T Q;  3ND9 A;  1S72 A;  2PI2 A;  2E2H A;  1PDQ A;  1I94 L;  2UUA Q;  4ECW A;  3I4M G;  2L11 A;  3FRP B;  3BDC A;  1GD7 A;  3KHR A;  4LNQ A;  4NMZ A;  3K7A B;  1MI2 A;  4B3M Q;  1ENF A;  3VPD A;  1D1I A;  4C2M B;  3S2H B;  2NTS A;  5M3M G;  5DGA A;  4Y7N H;  1PH6 A;  3U9O A;  3K0Y A;  4PMW A;  1AE3 A;  4Q0F A;  4FNF A;  1C3O A;  4JI7 H;  4CJ1 B;  2UVU A;  3RR5 A;  5IWA Q;  5M3F B;  1DV1 A;  4NXN H;  1SFO B;  3BZC A;  1JJ2 A;  1DYQ A;  5JEA H;  4LUZ A;  2G9H D;  5LMU Q;  2V4D A;  3TEH B;  3VR5 A;  2NVX B;  3Q8P B;  1TAE A;  4LF6 H;  1GXD C;  1MHW C;  3PO2 G;  1K8O A;  1S40 A;  1GUG A;  2E75 C;  1A3V A;  4XTC S;  4DV0 H;  1ESF A;  3SXH A;  4C5C A;  4A3I B;  1I6H H;  5M9O A;  2EJF C;  5IGE A;  2PCF B;  1O7Z A;  2JSO A;  3R93 A;  1S0N A;  5AJ3 L;  1EY5 A;  1NTG A;  1K3B C;  5C6A A;  4MA5 A;  3U9S A;  4AYB B;  4GC6 A;  1CK1 A;  1PTO F;  3S1Q H;  2RDJ A;  2O5J C;  1Y1W G;  3BQ1 A;  1I7N A;  3L4K A;  1NAP A;  4GOP B;  1ML0 D;  1RDP D;  3KHL A;  2PPB C;  2YW2 A;  2W8K A;  1LO5 D;  3UDX A;  3DM3 A;  5LYJ F;  5TSS A;  2V5A A;  4DUZ H;  1TQO A;  1WI5 A;  1STG A;  2D9U A;  2JA8 B;  1JIH A;  3V96 A;  2K04 A;  1XPR A;  2ASB A;  1DZ1 A;  4QWC A;  2F52 A;  2R3Z A;  2N8N A;  1H95 A;  3DM1 A;  2FPP B;  3NTK A;  5C4J H;  3N6R A;  3T1H Q;  1K73 C;  1PH8 A;  2Z6K C;  3K5O A;  4JI8 H;  4K14 A;  1PZI D;  2BE5 D;  4RZR A;  3BVM A;  5ELN A;  4JYA H;  1RKN A;  5IP7 H;  1K0S A;  2FJ2 A;  1XDN A;  2W9C B;  1TS3 A;  3IFD A;  3VR4 A;  3SEB A;  1H9M A;  5A2Q L;  4P73 A;  1P16 A;  4PZ7 A;  4JI3 H;  4FXK C;  3QZ8 A;  1S9F A;  3A8K E;  3IN5 A;  4I4T F;  2UUB Q;  5BPH A;  3T1Y H;  1FNV A;  3D8G A;  4IPC A;  3H09 A;  4U67 3;  3B6Y A;  2PN1 A;  3ONA B;  4R4I A;  3V6K A;  4R9W A;  5LL6 S;  1YJ9 A;  1VQD A;  1WD1 A;  5CAE B;  1PVO A;  1TS5 A;  3D31 A;  2W9A A;  2CWP A;  3CKI B;  2W8L A;  2N88 A;  5M5Y B;  4LF9 Q;  1B6R A;  1VKZ A;  4DU9 A;  1O78 A;  3N43 B;  2DPJ A;  4Z9C B;  2DJG C;  3NBH A;  2CW7 A;  1J5E H;  3GTP A;  3D0F A;  2Q8R E;  4DR3 H;  4JI1 L;  4Y8V B;  3HOV H;  2DIK A;  1ICW A;  2WDT A;  3TDQ A;  4KJN A;  3L2P A;  1TWH B;  4LUV A;  1ET9 A;  3K57 A;  5C44 B;  1AZP A;  4RB2 C;  3J81 E;  1FGB D;  1CHP D;  4ZOL F;  3UFX B;  2Z6K A;  4OIJ A;  3CF5 A;  4J0M A;  2HD3 A;  1X3F A;  5E7N A;  3H4D A;  4KHP Q;  2OQK A;  4G57 A;  2NYZ D;  1BXT A;  1PA6 A;  2V9W A;  2V4Q A;  3I4M H;  4LMQ D;  1CS0 A;  3J7Z C;  4DXF A;  1X3P A;  1D7Q A;  2UVW A;  5A2Q W;  2ZJP A;  2KHJ A;  4GNX B;  3R2I A;  1WCM B;  1K0R A;  4IUN A;  4U68 A;  5M3M H;  4JI5 Q;  3L7Z C;  3OUZ A;  2XIG A;  1ROD A;  3GTJ B;  3BQ0 A;  3HOY B;  3PUY A;  1VF7 A;  3DF7 A;  1O80 A;  4ZQ3 A;  3RBD A;  1FYC A;  3MC0 B;  4LFA H;  1C30 A;  1DON A;  1DOL A;  5JJZ A;  3CAM A;  2MGS A;  2L5T A;  4MAM A;  2XN9 C;  3CQZ H;  1HNX L;  2IA6 A;  1CHQ D;  1R9T A;  2CCZ A;  1IBK Q;  3PO2 H;  2NU7 B;  1TXY A;  2YS7 A;  2EYJ A;  1V1P A;  4DK1 A;  1HR0 H;  1NE3 A;  4RAZ A;  1VQH A;  2V58 A;  5IYB G;  2F4V L;  4GKJ L;  2B63 G;  1B53 A;  1E3P A;  2F0N A;  2B2Y C;  4JI4 L;  4JV5 L;  1PTO B;  1C7Y A;  4NKL A;  1E2W A;  2YS6 A;  4R4T A;  5E4X A;  4B3T L;  1WFQ A;  3SE0 A;  4X6A H;  4DUY Q;  2FE3 A;  1Q1B A;  3S14 B;  1Y1W H;  2WB1 A;  5BMV F;  3OW2 A;  4RNO A;  2MJ8 A;  4GS3 A;  1WD0 A;  1UUP A;  4RCO A;  4LUO A;  5GRO A;  3A5Z B;  4GN3 B;  3M3Y H;  4RAY A;  1WTP A;  3PO3 G;  5IYC G;  1B50 A;  1AE2 A;  5GAD C;  1PYB A;  2EDG A;  4B3M L;  1TWF B;  4CDD C;  2EY6 A;  4C3H G;  1RTO A;  1IYU A;  1RK5 A;  2K14 A;  3HGB A;  2XD4 A;  4RA8 A;  2DNE A;  4L8J A;  2JEI A;  1YBY A;  3KXY T;  1VQ4 A;  5D3D A;  4LF6 Q;  3GTK A;  1AW7 A;  2K5D A;  4C5B A;  1Z47 A;  4O4L F;  3MZ5 A;  2BE5 C;  5G3L D;  5LMU L;  1SDF A;  1I4P A;  3HS0 C;  2JA5 G;  1SEI A;  1DOM A;  4BWS C;  1OWT A;  4OX9 Q;  1ENA A;  1E2Z A;  5CR3 A;  3HOZ B;  1FKA H;  2B2Y A;  1O75 A;  1QJO A;  2JXM B;  1E4E A;  4DFA A;  3F8N A;  4C5A A;  3LX0 A;  1VQN A;  2EYO A;  4JVZ A;  5IE8 A;  3I4N G;  4EFE A;  1L0W A;  3Q23 A;  2XCL A;  3GIP A;  3H0G A;  5BN3 A;  3W1B A;  4QIW B;  1YHB A;  3GTQ H;  1VMC A;  5HGT A;  2YYZ A;  1WSC A;  1QUQ B;  1XNQ H;  2MQH A;  2JA7 G;  5J2T F;  3WO0 A;  3K6O A;  1EY8 A;  4NP5 A;  3PR4 A;  1ASY A;  5FLX E;  4RGO S;  2YU9 B;  2QEJ C;  1SYD A;  4HNT A;  2W6O A;  1CT1 D;  1EEF D;  1EQR A;  2V1C C;  5J2U F;  2I80 A;  4RB0 A;  4KHZ A;  1B3A A;  2TMP A;  1GSO A;  2Q2U A;  5KG0 A;  3F8T A;  5CBA E;  1JDB B;  1V1O A;  2IJ0 A;  5IGB A;  3IAY A;  3GTG A;  4ZYS A;  1DV2 A;  1L2Z A;  5JEA J;  3JRX A;  1EY9 A;  3H6M A;  1HZ9 A;  3CD6 A;  2EOT A;  3BYY B;  2LMC B;  3T1H L;  4A3E G;  4K5X A;  3N40 P;  2WAQ G;  1ILQ A;  5KFS A;  3BDL A;  2CW0 C;  2L4N A;  4A3F G;  4A3J G;  1Q12 A;  3QG1 A;  3J7A K;  2NUC A;  4KJO A;  4DKA C;  4UCS A;  2UU9 H;  3BG3 A;  2BDN A;  2KJX A;  2R82 A;  5A2Q E;  3GTO B;  4CDE C;  5CV9 A;  3PIO A;  3NBH B;  1SJH D;  4K8J A;  2VQF H;  3EPI A;  1VQF A;  3J80 c;  5I47 A;  4JK1 C;  1I50 B;  1CKO A;  2C2E A;  3G48 A;  2EYM A;  4MV8 A;  4I55 F;  3CCS A;  3G6E A;  1W2B A;  2EIF A;  2BA1 A;  1STE A;  4HED A;  3ERS X;  1KEE A;  5KFB A;  2DWC A;  1YHA A;  1NMG A;  4ZAI A;  3SE7 A;  4LF9 L;  5JQW A;  4J9P A;  3A74 A;  3NK9 A;  1SYX B;  4EBE A;  4FS2 A;  3PW2 A;  1A15 A;  1CQV A;  3T56 B;  5LXT F;  4LF4 H;  3WOE A;  4HYK A;  1M0T A;  5IYB H;  2B63 H;  1GUS A;  2JEJ A;  2A6E C;  4P71 A;  3MR6 A;  4A3G G;  3BJU A;  1J6Q A;  1YHQ A;  2NVT H;  1LTA D;  1B44 D;  2NN6 G;  3RAQ A;  4FBU A;  2Y0S G;  1HRJ A;  1ASZ A;  4DR7 H;  3E5N A;  1H9R A;  3R23 A;  4KHP L;  3BS1 A;  2BA0 A;  2PQA A;  1EUC B;  2FK3 A;  2ZDG A;  3S1R B;  2KA7 A;  1I3Q B;  3PO3 H;  4ED7 A;  5IYC H;  1RF2 D;  3J7A 5;  1C9O A;  4DV6 H;  3NTI A;  4R4C A;  4C3H H;  3NHH A;  4RCN A;  1R9T B;  4LFA Q;  4JI5 L;  3S17 B;  4IFD G;  3HOW B;  1BO0 A;  4O2B F;  2D0O A;  1V4Y A;  4G3I A;  5KYL A;  1WH2 A;  1HPC A;  1RJT A;  3BVG A;  3D4D A;  3KDF B;  3ZYY X;  1A3T A;  3I72 A;  3Q22 A;  5JVH 3;  4GZY C;  2QIL A;  4XYQ A;  2RGV A;  1V9P A;  1ZEQ X;  2QEX A;  3PSI A;  4UDU C;  1RYR A;  1Q3L A;  3CPW A;  2AMC B;  2R61 A;  4X3T A;  2Z9H A;  4A3K B;  2E76 C;  1JJC B;  1L1O B;  4IUV A;  2R84 A;  3OTO H;  3KLS A;  4CBV A;  1HR0 Q;  1AEX A;  4X62 H;  1BNC A;  2JA5 H;  1GVP A;  1QCB D;  5J1Z A;  2AQ2 B;  1SSO A;  1IBK L;  1TU2 B;  5I6Y A;  1CKN A;  4RZQ A;  1PFB A;  4QWE A;  1B4O A;  3GIK A;  4RNN A;  4L5S A;  1TWC A;  2CW8 A;  2HHH Q;  2RQX A;  1GKH A;  3I4N H;  3HXL A;  1JWS D;  4C1N I;  3KF6 A;  2EPB A;  1AP0 A;  2RGR A;  2OF1 A;  4BBS G;  2W6P A;  3KTM A;  3PW5 A;  1KDB A;  5LOV F;  3CHB D;  1EIH A;  4DUY L;  3HKS A;  1UE5 A;  5KNB A;  1JC7 A;  1ZHS A;  3C1F A;  1WTQ A;  2VQE H;  4LFB Q;  3UDG A;  4JC0 A;  2JA7 H;  2PBZ A;  4ILW A;  1VQJ A;  1XMO H;  5JAV A;  2K01 A;  5BN4 A;  2M05 A;  4IUQ A;  1LTR D;  1PZK D;  4QW9 A;  1PLF A;  4YQW A;  5EDW A;  2E2H H;  1B8A A;  1W6K A;  1V51 A;  3RV3 A;  2F0O A;  4A3E H;  1Y1W A;  4CKB A;  3L3O C;  4Y7N B;  4LF6 L;  1KRT A;  1V1Q A;  4UCT A;  4HMJ A;  4N8X 1;  1AH9 A;  4XT3 B;  5IGF A;  1KJ8 A;  3AQQ A;  4R8I A;  2VUG A;  4A3J H;  3UDI A;  1BUV T;  2F0V A;  2F0I A;  4DR5 H;  4RHS A;  3HOX G;  2R85 A;  4R8U A;  4QIW E;  4OX9 L;  5LMN W;  4ZUJ A;  1N36 H;  2SNS A;  2JEA I;  4EBC A;  1PFN A;  3HB9 A;  4UPA A;  3PW0 A;  2A74 C;  3RLO A;  5IGD A;  1TY0 A;  4PG3 A;  4IUU A;  5FLX c;  1I6H B;  1KAW A;  2EYL A;  2MHV A;  2JE6 I;  3RNU A;  1Y1V A;  1UE1 A;  4IJL A;  4LAA A;  5KFH A;  3GTM H;  2C5C A;  1CA6 A;  3MJF A;  2Z4I A;  1RCV D;  3S1Q B;  1KJ9 A;  1TVX A;  1ONL A;  4IZ8 A;  4RGM A;  4RB3 C;  3RB0 A;  1CZW A;  4RGN A;  1S10 A;  1NY4 A;  1IBM H;  4BY7 G;  1KLU D;  2W9B A;  4KI0 A;  1G51 A;  4DL7 A;  1VQI A;  4A76 A;  4JI2 Q;  1Z6H A;  4A3G H;  5CA0 F;  1WR2 A;  4DV2 Q;  4DL3 A;  2KCT A;  5C4H A;  1KTK A;  2NN6 H;  4B9X A;  2WB1 G;  2AHO B;  4YCV A;  4EQP A;  1TY2 A;  2AGO A;  3ULP A;  3GTQ A;  1K83 B;  1RJQ A;  2ZTC A;  3I70 A;  5C4J B;  4NPS A;  2SCU B;  3S16 H;  2GPS A;  3PGZ A;  2ZT9 C;  3Q0A A;  1W3S A;  3TS2 A;  4PMB A;  1T5X D;  3DWQ A;  4M9U A;  4A3B B;  2NZ1 D;  3NGD A;  2ENB A;  4C1N K;  1XYI A;  2R92 B;  4DV3 H;  1D1K A;  1TWA H;  3VYU A;  1LAB A;  4IFD H;  2BCO A;  4LF8 Q;  1KXL A;  3GV3 A;  4ZK9 B;  3SDZ A;  5L1L A;  2WFW A;  4LFC H;  2I46 A;  2B8F A;  3CRL C;  3W3A A;  4UCO A;  3QWN A;  4IUR A;  1O7Y A;  2VL6 A;  4XT1 B;  3S2D H;  4LF7 Q;  1RK6 A;  2C22 A;  1I5F A;  4RAU C;  3OIQ A;  1F9P A;  3X3M A;  2VY3 A;  1PH1 A;  4PZ6 A;  4HR7 A;  4EYH B;  1GHJ A;  3QJY A;  2R7N A;  4UCV A;  3G8C A;  2DGY A;  2RSO A;  4DR1 H;  2C28 A;  1X3E A;  3MXG A;  2FMC A;  1LTB D;  3H0G G;  1A6X A;  1DCZ A;  2SDF A;  4XQQ A;  4BBS H;  3F2D A;  4JV1 A;  1VDZ A;  1HQM C;  2XGQ A;  1TA8 A;  2EYP A;  1HQR D;  3BYT B;  3OMC A;  4RB1 A;  2UUC L;  2UXD H;  1VQG A;  4DV7 H;  1JB3 A;  1NJI C;  1QZH A;  3GTP H;  2DUD A;  2AUK A;  1X54 A;  2OLS A;  1TT2 A;  1JR0 D;  4DV6 Q;  3PIO 3;  4ED6 A;  5ELD A;  5C4X H;  1GYF A;  2RCN A;  4CGY B;  1JCK B; 
#chains in the Genus database with same CATH homology
 3HKZ E;  3GDE A;  2PNH A;  4DV3 L;  4GOP B;  2RHQ B;  1CUK A;  3M85 A;  3UDX A;  1VQA A;  3DM3 A;  3G71 A;  3CW2 C;  4P74 A;  4GLA C;  4LFA L;  2AWN A;  1WI5 A;  4IPH A;  1HZA A;  4LFC L;  1XPR A;  2ASB A;  4LF5 Q;  4ME3 A;  1MIU A;  2F3I A;  1U5K A;  3UE1 A;  4AIM A;  2F52 A;  3CC2 A;  2N8N A;  3ULL A;  5C44 G;  1H95 A;  5C4J H;  1Q86 C;  4JI7 L;  2ID0 A;  3H15 A;  2UXC L;  2E2J H;  4NXN L;  3T1H Q;  1K73 C;  1PH8 A;  1HR0 L;  1X6O A;  4EX5 A;  2KEN A;  2Z6K C;  4FDB A;  3HOX H;  4A3D G;  2IX1 A;  3RLF A;  2C35 B;  3J80 i;  3HOU H;  1HNW Q;  2HT1 A;  5ELN A;  2KCM A;  4BA1 I;  5FLM H;  2K4K A;  4HJ5 A;  4DR1 L;  5IP7 H;  1QVG A;  1A63 A;  4YCW A;  1EYG A;  4DAY B;  4A3F H;  5IY0 A;  3NEL A;  1BVS A;  4DV0 L;  2HHH L;  4BXX H;  3RZO H;  4P73 A;  1P16 A;  4PZ7 A;  4YCU A;  4C2M H;  1Q1E A;  2ZM6 Q;  1WCM G;  4DR2 Q;  1MJE A;  1K9M C;  1IYJ B;  4DV7 L;  3S2H H;  2UXD L;  5GQO A;  2UUB Q;  2JJQ A;  2XGT A;  4C3I H;  2K75 A;  4IPC A;  1VQ8 A;  4LFB L;  3B6Y A;  1QVC A;  3LGJ A;  3HOY G;  4R4I A;  4NB3 A;  4APV A;  4A3M G;  1YJ9 A;  2XTI A;  1VQD A;  3I7F A;  1PVO A;  5M3F H;  3D31 A;  1XNQ Q;  1XMQ Q;  2CWP A;  4HIK A;  1Z9F A;  1E1O A;  4BY7 H;  2Z0S A;  5GAH C;  4LF9 Q;  4JI6 L;  3I2Z A;  3GTL H;  1JMC A;  4GN4 B;  4DV4 L;  4DUZ L;  2NVX H;  1PH4 A;  3BZK A;  2UXB L;  4YY3 L;  4QL5 A;  1C0A A;  3D0F A;  1N32 L;  4JI1 L;  2UXD Q;  3HOV H;  4H02 A;  5JJI A;  3M4P A;  3L2P A;  4A3I H;  4LUV A;  3PF4 A;  3CMA A;  2Z6K A;  3M4Q A;  2E5L Q;  1UWV A;  3CF5 A;  4AQY L;  3CCJ A;  1X3F A;  4JI8 L;  5E7N A;  1D8L A;  1N36 Q;  2HQL A;  2Q2I A;  4KHP Q;  2OQK A;  4JYA L;  1PA6 A;  5IT9 c;  3I4M H;  1V43 A;  1HH2 P;  2AWO A;  3PV0 A;  3J7Z C;  2UU9 Q;  1OXS C;  1IBL L;  1FGU A;  4IPG A;  1D7Q A;  3AYH B;  1VQC A;  3K8A A;  3PUV A;  4JI3 L;  1GM5 A;  2ZJP A;  2KHJ A;  4GNX B;  2JA8 H;  3GTK H;  3HKZ G;  1K0R A;  3CC7 A;  1FJG Q;  2VQF Q;  5M3M H;  4JI5 Q;  3L7Z C;  4JBK A;  1XPU A;  3T1Y L;  4DR6 L;  3STB D;  2NVY H;  2N3S A;  3WWV A;  1IXR A;  4JG2 A;  1UE6 A;  4GOP C;  1IBM Q;  4A3L H;  3PUY A;  1Q7Y C;  1SLJ A;  3J81 c;  1SRU A;  1WJJ A;  4X64 Q;  1RIP A;  4P72 A;  1QVF A;  4J15 A;  2R6G A;  3CAM A;  3GO5 A;  4R4Q A;  3MEF A;  3E9H A;  1J5E L;  3CQZ H;  2R93 G;  1HNX L;  3TS0 A;  4DR3 L;  1IBK Q;  2CCZ A;  2YTY A;  4JI2 L;  3A0J A;  1TXY A;  3H0G H;  4LF4 Q;  3PO2 H;  4OON A;  5IYD G;  1E1T A;  2VS1 A;  4XIG S;  4DV2 L;  2UUC Q;  2ZTD A;  4PZ8 A;  1NE3 A;  1VQH A;  5IYB G;  1KIX A;  2PQA B;  2B63 G;  2F4V L;  4GKJ L;  4OO1 I;  4Y52 H;  3NEM A;  1E3P A;  2WAQ E;  4JI4 L;  4JV5 L;  2N78 A;  3K0X A;  5C0X G;  4DV1 Q;  4P75 A;  2R7F A;  2VUM H;  1LYL A;  2IHE A;  1C7Y A;  1EUJ A;  1VQB A;  4DR4 Q;  4R4T A;  2R7D A;  4DR7 Q;  3S24 A;  1WFQ A;  4B3T L;  5IP9 H;  2I0Q A;  1E7Z A;  4X65 L;  1Q1B A;  4DUY Q;  4X6A H;  1Y1W H;  3I55 A;  1XNR L;  3OW2 A;  1VQE A;  2LXK A;  4GS3 A;  1HNZ Q;  4QJF A;  5M5Y H;  4QY7 A;  5C3E G;  1M90 C;  1IZ6 A;  3GTG H;  2ALY B;  4LUO A;  3CCQ A;  5GRO A;  3A5Z B;  4GN3 B;  2K5H A;  2UXB Q;  2JA9 A;  3M3Y H;  3PO3 G;  2VZA A;  5IYC G;  4YWK A;  3W5O A;  4LF8 L;  2L15 A;  1AE2 A;  5GAD C;  1PYB A;  1QZG A;  4B3M L;  1T9H A;  5HGQ A;  1N34 Q;  1KL9 A;  1PH7 A;  1Q82 C;  3PF5 A;  4GOP A;  4L5R C;  1TWH H;  2IY5 B;  4POF A;  2K14 A;  5C44 H;  3KYH C;  5FJ8 H;  3AEV A;  1VQO A;  1CKN B;  4B3S L;  1YBY A;  4YHH L;  4LF7 L;  2WB1 E;  1VQ4 A;  4LF6 Q;  3ICE A;  4A3D H;  1PHJ A;  3OTO Q;  4OO1 G;  1NBW A;  1VS0 A;  1Z47 A;  1OXT A;  4X62 Q;  5LMN L;  5BR8 L;  4JBW A;  2IX0 A;  4HJ7 A;  5LMU L;  3KF6 B;  2FXQ A;  2ZJQ A;  3U58 A;  2JA5 G;  4LWC A;  4GKK Q;  4OX9 Q;  2Y0S E;  4MNO A;  5C0X J;  1WCM H;  2B3G A;  3CCM A;  2QA4 A;  1VQL A;  1Y1V G;  1VQN A;  1G6P A;  4JI0 L;  2IT1 A;  5IE8 A;  3I4N G;  3GTJ H;  1KQS A;  4GLV B;  3HOY H;  5C4X G;  2GVB A;  2VW9 A;  1L0W A;  4A3M H;  3UE0 A;  1EOV A;  4KLK A;  2VQE Q;  3HFZ B;  4JI6 Q;  3W1B A;  4JCV E;  1YHB A;  3GTQ H;  1Y14 B;  1PV4 A;  4IFD J;  4HJ9 A;  2YYZ A;  2K50 A;  1VQK A;  1QUQ B;  1OXU A;  4A3C G;  4GNX C;  1XMO Q;  2MQH A;  2N49 A;  1GO3 E;  2JA7 G;  2JK8 A;  4JI1 Q;  4IOC A;  2VNU D;  4K0K Q;  1ASY A;  3DLL A;  1SN8 A;  1VCI A;  4POG A;  4X66 Q;  1G29 1;  2KBN A;  2LSS A;  1NMF A;  4DV5 Q;  1YJW A;  1EQR A;  2EQS A;  2Q2H A;  2V1C C;  1YJN A;  1K8A C;  3NEN A;  4KHZ A;  3E9I A;  4LF5 L;  4MZ9 A;  1JE5 A;  2Q2U A;  3F8T A;  3K7U C;  4AQY Q;  2I5L X;  3PUX A;  1X56 A;  3CCL A;  3OYY A;  5M5W H;  1VQP A;  5JEA J;  1YEZ A;  4O0A A;  1I3Q H;  1HZ9 A;  3E0E A;  3CD6 A;  2BH8 A;  3T1H L;  4A3E G;  3S14 H;  4A3B G;  2D62 A;  2EXD A;  4RG1 A;  4O2D A;  2WAQ G;  1IBL Q;  2R92 G;  1EWI A;  4A93 G;  1PYS B;  4DR5 Q;  3M4O H;  1KD1 C;  1K8G A;  4A3F G;  3S1N H;  4A3J G;  1Q12 A;  1I94 Q;  2QGQ A;  1L2F A;  2RHS B;  3U4V A;  4DKA C;  1HR0 W;  1JT8 A;  3BU2 A;  2YTV A;  4DR6 Q;  4GLX A;  1WOC A;  4DR2 L;  1YIJ A;  1TWF H;  2YV5 A;  3NBH B;  3F1Z A;  3PIO A;  4JBM A;  1JJG A;  1O7I A;  2OTL A;  4DPG A;  5C0X I;  1VQF A;  1X65 A;  3J80 c;  3HOW G;  1YI2 A;  1CKO A;  1OXX K;  3TQY A;  3G48 A;  3JAM i;  1PH3 A;  3GD7 A;  3CCS A;  3G6E A;  1FL0 A;  2EIF A;  2BA1 A;  1W2B A;  1LTL A;  4GNX A;  2GVA A;  3ERS X;  1XNQ L;  1TWC H;  5GAG C;  1XMQ L;  1N9W A;  1YHA A;  1B7Y B;  1NMG A;  2H5X A;  1MKH A;  3M9B A;  4A3K G;  4MTN A;  4LF9 L;  2R93 H;  2IHF A;  3A74 A;  1S3O A;  4B3R Q;  4NXM Q;  5IYD H;  2JA6 G;  1LUZ A;  1SE8 A;  4JV5 Q;  2K5V A;  3HOZ H;  5IYB H;  4DK6 C;  3EBE A;  4UY8 C;  2B63 H;  3CXC A;  2E2I H;  4P71 A;  4A3G G;  3BJU A;  4IO9 A;  1J6Q A;  4BY1 G;  1YHQ A;  2NVT H;  1YVC A;  4RMF A;  4R1J A;  2NN6 G;  2E5L L;  4ALP A;  2Y0S G;  1ASZ A;  1RL2 A;  4OXP A;  5AJ3 Q;  3KOJ A;  4KHP L;  2OQ0 A;  2BA0 A;  5K36 G;  2PQA A;  2NZO A;  1VQM A;  5C3E H;  1CSP A;  2UU9 L;  1N8R C;  4DV3 Q;  1HJP A;  2K5N A;  3CP0 A;  4LW1 A;  5IYC H;  1YIT A;  2YU9 H;  2BH2 A;  3J7A 5;  2OCE A;  4DNI A;  3K81 C;  4HJA A;  1C9O A;  4R4C A;  1LM0 A;  4C3H H;  2UUA L;  3J81 j;  1FJG L;  2VQF L;  4LFA Q;  4JI5 L;  4QQB X;  4OWX B;  4IFD G;  1X9N A;  2D0O A;  4YHH Q;  4LFC Q;  1MJC A;  3KDF B;  4YWL A;  1K3R A;  3AFP A;  4TVA B;  1FVI A;  1KRS A;  2I5M X;  1IBM L;  1V9P A;  1A8V A;  2QEX A;  4HIM A;  3PSI A;  2E8G A;  4X64 L;  3CPW A;  1N33 L;  2AMC B;  1VQ7 A;  4JI7 Q;  2ATW A;  3EN2 A;  1JJC B;  1L1O B;  4NXN Q;  2UXC Q;  1HR0 Q;  2JA5 H;  1GVP A;  1EIY B;  2D0P A;  1XTD A;  1IBK L;  4LF4 L;  2GN5 A;  2CQO A;  1P8L A;  1CKN A;  3ZJY C;  4DR1 Q;  5JEA G;  5IWA L;  2R7Z G;  1Y1V H;  3GTO H;  4WJ3 M;  4L5S A;  4GN5 A;  3PUZ A;  3KF8 B;  5J3B A;  2JQO A;  2AKW B;  4DV0 Q;  2HHH Q;  1GKH A;  2ES2 A;  3I4N H;  4DV1 L;  2KHI A;  3M7N A;  1E24 A;  1SRO A;  3KF6 A;  1I50 H;  5GAE C;  3CCV A;  3TRE A;  4DV7 Q;  3FKI G;  1EQQ A;  4DR4 L;  3U4Z A;  4AYB E;  3PIP A;  4UP8 A;  4BBS G;  4DR7 L;  1PFS A;  1UE7 A;  4DUY L;  3HKS A;  1UE5 A;  3S1M H;  2RF4 A;  4A3C H;  3CCR A;  3UDG A;  4JC0 A;  4BBR G;  2JA7 H;  4LFB Q;  1HNZ L;  1BBW A;  1VQJ A;  3I4O A;  3CC4 A;  1U0L A;  1PH2 A;  4DV6 L;  3A5U A;  1B70 B;  3KJP A;  1SR3 A;  4DV4 Q;  4DUZ Q;  1K83 H;  1X55 A;  2NZH A;  4C3J H;  5EAY A;  3EIV A;  5H1S E;  4YY3 Q;  1QUQ A;  1N34 L;  1N32 Q;  2E2H H;  1B8A A;  4L5T A;  5FJ8 G;  1JB7 A;  2MO1 A;  5JJL A;  2B29 A;  3CCE A;  4JBJ A;  2HIV A;  3SGI A;  4A3E H;  4A3B H;  4BA2 I;  3AFQ A;  4LF6 L;  1CKM A;  2PMZ E;  1KRT A;  3Q8D A;  1V1Q A;  2R92 H;  3OTO L;  2YTX A;  3CCU A;  4A93 H;  1AH9 A;  2JEB I;  3AQQ A;  4X62 L;  1HZB A;  4JOI C;  4JI8 Q;  4A3J H;  3CPF A;  4TQU S;  3UDI A;  3K7A H;  2CWA A;  4IPD A;  4EQ5 A;  3S1R H;  1EFW A;  1E22 A;  3HOX G;  4JYA Q;  4GKK L;  1PH9 A;  4QIW E;  3HOU G;  2ZJR A;  5LMN W;  4OX9 L;  3F2B A;  3FHW A;  3J81 i;  5FLM G;  5IP7 G;  2JEA I;  1R9T H;  1HNW L;  4JI3 Q;  3S17 H;  2HIX A;  3HOW H;  4UPA A;  4A4I A;  3RZD H;  3RLO A;  3ULJ A;  4BXX G;  2OWO A;  2NN6 I;  2ZTE A;  4PG3 A;  5FLX c;  3T1Y Q;  1SFO H;  3F2C A;  1KC8 C;  2VQE L;  1KAW A;  1M1K C;  2ZM6 L;  2JE6 I;  3RNU A;  1UE1 A;  4IJL A;  3UDF A;  2K52 A;  3GTM H;  5DLQ E;  4A3K H;  3STB C;  1XPO A;  2UUB L;  1XMO L;  2A1A A;  1Q81 C;  1Q46 A;  3W1G A;  4K0K L;  3FP9 A;  1PH5 A;  1VQ5 A;  2JA6 H;  1A62 A;  5M3F G;  1BBU A;  2CFM A;  1NY4 A;  4X66 L;  4HJ8 A;  4AH6 A;  4BY7 G;  1CSQ A;  4HID A;  5JJK A;  1J5E Q;  4KI0 A;  4DV5 L;  1G51 A;  1HNX Q;  2OTJ A;  3IRB A;  4DR3 Q;  1VQI A;  4OWT B;  4JI2 Q;  4A76 A;  2MFI A;  4A3G H;  3G4S A;  4IFD I;  3CME A;  4DV2 Q;  4UP9 A;  1XJV A;  4BY1 H;  1VQ6 A;  1EIF A;  2KCT A;  4DK3 C;  4IJH A;  2F4V Q;  2A8V A;  3HOV G;  2WB1 G;  2AHO B;  1L1O C;  1YZ6 A;  3KLW A;  3L0O A;  4YCV A;  4GKJ Q;  4JI4 Q;  3ULP A;  1IL2 A;  3I56 A;  4A3I G;  4JOI A;  2MNA A;  2A19 A;  1KHI A;  2ZTC A;  3KJO A;  4NPS A;  4B3T Q;  1S72 A;  2PI2 A;  4X65 Q;  4DR5 L;  3PGZ A;  3H3V I;  3MXN B;  3S16 H;  3K80 C;  1W3S A;  3TS2 A;  4AYB G;  1I94 L;  1XNR Q;  4WJ4 A;  2UUA Q;  3RN5 A;  2CKZ B;  1N36 L;  4R4O A;  3I4M G;  2MO0 A;  1TWA H;  1GD7 A;  4LNQ A;  1WYD A;  1BKB A;  4LF8 Q;  1KXL A;  2I5H A;  4DAM A;  4B3M Q;  2JA8 G;  1DGS A;  1N33 Q;  2WFW A;  2NVQ H;  5M3M G;  4OWW B;  1UEB A;  4Y7N H;  1PH6 A;  4YWM A;  5HY6 A;  1VQ9 A;  5ELO A;  1OTC A;  2PI2 E;  2VL6 A;  3S2D H;  3H3V H;  4PMW A;  4B3S Q;  1AE3 A;  3RN2 A;  4LF7 Q;  4A3L G;  3PUW A;  1I5F A;  1SMX A;  3TRZ A;  3RR5 A;  5IWA Q;  4IOA A;  4A75 A;  3KDF A;  4HIO A;  2VY3 A;  3HOZ G;  1PH1 A;  4PZ6 A;  5LMN Q;  3BZC A;  5BR8 Q;  5M5X H;  1JJ2 A;  4NXM L;  3KFU A;  4B3R L;  2R7Z H;  4LUZ A;  3U50 C;  3JAM c;  5LMU Q;  3TEH B;  2DGY A;  3RLN A;  1HZC A;  1X3E A;  3PO2 G;  3PO3 H;  1L1O A;  2Q2T A;  1X3G A;  2WP8 J;  3H0G G;  1S40 A;  4XTC S;  4QGU A;  1YNX A;  3FKI H;  4BBS H;  3F2D A;  1A0I A;  4JI0 Q;  1Q8K A;  1I6H H;  3VDY A;  2UUC L;  1VQG A;  3PCO B;  2LXJ A;  3S15 H;  1NJI C;  4BBR H;  1QZH A;  2VUM G;  5AJ3 L;  3ER0 A;  1NTG A;  3GTP H;  4L5Q A;  2DUD A;  1X54 A;  1TWG H;  4UP7 A;  4DV6 Q;  5C4X H;  3JC6 6;  1OXV A;  5IP9 G;  2RCN A;  3S1Q H;  1Y1W G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...