2JA5G

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja5G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja5G01
2ZM6L 2UUBL 3M4PA 1PYSB 3UDGA 3KJOA 4HJ5A 2E2JH 4A3IH 1Q7YC 2Q2UA 2PMZE 5FJ8G 1SLJA 3CXCA 1A63A 1BKBA 2H5XA 5HY6A 5IYCH 1EFWA 4LF6L 1FJGL 4BA2I 5JJLA 1FVIA 4DUYQ 5GAHC 1T9HA 5IYCG 3H15A 1PH8A 1YHQA 1DGSA 2ASBA 3S1MH 1K3RA 4FDBA 1X3FA 1E3PA 2ALYB 2IT1A 5J3BA 4DAMA 3M3YH 3AEVA 3STBC 3I2ZA 4B3SL 3J7ZC 2UXCL 2F52A 2BH8A 3KF6A 1U0LA 1V9PA 3KYHC 1CSPA 3NBHB 4PG3A 2RF4A 5IYBH 4YHHQ 1NY4A 4DV0Q 4A3DH 5E7NA 4DUZQ 3H0GH 2HHHQ 3FKIG 1G291 4TQUS 5IT9c 1PH6A 1HR0Q 2YTVA 2A19A 4DV0L 3UDXA 1ASYA 1KXLA 1SR3A 1I6HH 1E22A 3CPFA 3RLFA 2VY3A 5FLXc 2YU9H 4LF6Q 1FJGQ 4JI3Q 1XJVA 4DUYL 4ME3A 3GDEA 3TS0A 2Q2IA 4IFDG 2R92H 4DNIA 3TS2A 3G71A 1SROA 3G4SA 1M1KC 3OTOQ 4LF4Q 4LFCL 2Z6KA 2UXDQ 1VQGA 1SN8A 4YWLA 1Q82C 2ATWA 1IBML 3OTOL 2YV5A 2KENA 4PZ8A 4R4OA 5IP7H 4QJFA 1VQKA 2MNAA 4AQYQ 1YHAA 4JCVE 1N34L 2OCEA 4JI1L 2E2HH 4X65Q 3ULPA 4JBMA 2IHFA 4GKJL 5AJ3Q 4X6AH 4JC0A 3CC2A 1JJ2A 1PFSA 4JI4Q 4DR4L 2IX0A 3BZKA 2BA0A 4DV2Q 1PH9A 5AJ3L 3HOZG 3G48A 2D0OA 5IYDH 1NE3A 2PI2E 4MZ9A 1VQ5A 2YTXA 1VQPA 2MFIA 2EXDA 3ZJYC 4LF5L 3F2CA 1HJPA 1I50H 3E9HA 1A8VA 1E7ZA 5JEAJ 1GD7A 1KAWA 3GTJH 4NXNQ 1VQJA 1Q1BA 1N33Q 3RNUA 4B3RQ 2V1CC 4JI2L 4YY3L 1KL9A 4R4IA 4X66L 4GNXA 1N34Q 1IXRA 2CKZB 4WJ3M 4R4QA 3TEHB 1U5KA 2QGQA 4X65L 5LMNW 1X65A 2XGTA 3TQYA 4YY3Q 4IFDJ 4OXPA 3CAMA 1QVCA 1N36Q 4DUZL 5M3FH 1HR0L 1IBLQ 1YZ6A 2YYZA 1QZGA 4JI7L 4NB3A 4HIMA 4A75A 1OXVA 2ZJPA 1K8GA 3F2DA 2I5MX 1SE8A 4OX9Q 5JJIA 3RLOA 3BU2A 1XPRA 4OO1G 4X62Q 2HIXA 1PV4A 4OX9L 2ES2A 1VQIA 5HGQA 1I3QH 4AYBE 4KHPQ 1HH2P 5FLMH 3HOXG 4B3RL 1X9NA 2WFWA 2UUAQ 3W1BA 3PUZA 4JI5L 5C3EG 2NVYH 4C2MH 2YTYA 2Z6KC 4DV1L 1VQNA 4DR5L 2MO1A 5C3EH 3PO2H 4B3ML 4B3TQ 1Z47A 2D0PA 3D0FA 3K7UC 5JEAG 1IL2A 4IOAA 1N36L 4Y52H 2ZTDA 3GTOH 3KLWA 2AWOA 1KHIA 4A3MH 1OXXK 3KF6B 1QVFA 3GTMH 1A62A 4LF8L 4LF7L 4WJ4A 1OXTA 3J81c 4JYAL 3HFZB 1YJWA 2EQSA 4A3BH 3NELA 3CCMA 5IWAQ 3S2DH 2CCZA 1TWGH 4DR5Q 2HIVA 2NN6G 4OWXB 3E9IA 3PV0A 4LUVA 3DLLA 1PA6A 4HJ9A 4QGUA 2UU9Q 2UXBQ 3JAMi 1WJJA 4LF5Q 5GQOA 4JI8Q 4JI6Q 1EYGA 1VQDA 3U4VA 2R93H 1L1OC 2JE6I 2LSSA 5GROA 1HZBA 4RG1A 4L5QA 3FHWA 1CUKA 4IO9A 3T1HQ 3T1YL 3M7NA 2R93G 4JG2A 3CCLA 3WWVA 2B3GA 2Y0SG 2KCTA 4DR7Q 1NMFA 2E2IH 3KDFB 1YJNA 2JA8H 1M90C 5EAYA 4DR4Q 3AYHB 2IY5B 4A76A 3PUYA 1K9MC 2HQLA 4LF8Q 1I5FA 3FP9A 1BBWA 4DR2L 2B63G 2K5HA 3K7AH 2JEBI 2B63H 1X3GA 1VQ4A 3UDIA 4A3GG 2VUMG 2WB1G 4JI0Q 4HJ8A 2VZAA 2ID0A 1JJGA 1GM5A 4UY8C 2JK8A 1W3SA 1VS0A 2VL6A 3CP0A 4NXNL 3AFPA 4BA1I 5LMNL 1Q8KA 4KI0A 2KHIA 2N3SA 1XMOQ 5GADC 1EUJA 1VQ8A 1MJCA 1UE6A 2OQ0A 3A0JA 2QA4A 1E1TA 5ELOA 4BBSG 1VQFA 2E5LL 1XNQQ 3I4NG 1MKHA 4A3KH 4DV1Q 3HKZG 4IPGA 1KIXA 1FL0A 2N49A 1LTLA 2ZTEA 1IBLL 3RN2A 1IYJB 1J5EL 4KLKA 3HKSA 4DV7L 3GTLH 1EIFA 2JA5H 2BH2A 2K50A 1K83H 4A3IG 1J5EQ 3S1QH 5FJ8H 3CMEA 1N9WA 4L5RC 4APVA 1JMCA 3HKZE 1JB7A 3Q8DA 4R1JA 1MIUA 4IOCA 3ICEA 1HNXQ 5C0XG 5M5YH 4GOPA 2CWPA 3K81C 3I4MH 1BVSA 1AH9A 1D8LA 1K0RA 1VQAA 2NN6I 4LWCA 3W5OA 5M5XH 2L15A 2AWNA 4L5TA 2E5LQ 3J80i 4DR1L 3PF5A 2LXKA 3J81j 4JI8L 4BY1G 1I94L 4NPSA 3G6EA 4LFBQ 4A93G 4QY7A 3JC66 3F8TA 4LFBL 3I56A 1N32L 4A3EG 4IFDI 1Q12A 2XTIA 3GTKH 3FKIH 4A3EH 3KJPA 4JBWA 4DV6Q 2JA7H 2F3IA 4JOIC 4GKKQ 2A1AA 2DUDA 4LW1A 1GVPA 1HNXL 3EBEA 4IJLA 4HIKA 3MEFA 3PGZA 2UUCL 3PO2G 3I7FA 3S1RH 2K5VA 1S72A 3OYYA 4A3CH 4YWMA 1VQMA 4QIWE 2R92G 3T1HL 4C3JH 4IPDA 4A3CG 2JA6H 2GN5A 4NXMQ 1SRUA 1NMGA 4R4TA 3CCVA 3CC7A 1IBKQ 1JJCB 3PSIA 1YITA 1LYLA 4GLVB 1VQ6A 1KQSA 3LGJA 4IPHA 5IP7G 3BJUA 1C7YA 2R7FA 3SGIA 2HT1A 4JV5Q 1WFQA 3HOYH 4BXXG 5C44G 1VQCA 1VQ9A 3PCOB 4DV6L 3CW2C 4L5SA 1GKHA 4YCUA 1VQOA 2K5NA 3STBD 4DR3Q 4JI3L 3ER0A 3JAMc 4GOPB 3TREA 1PYBA 4HJAA 4JBJA 5IYDG 4HJ7A 2VW9A 1PH3A 1VQHA 2CWAA 4RMFA 1L0WA 1EWIA 1IBMQ 1PVOA 5C0XI 3MXNB 4YHHL 1B70B 4JI5Q 4A4IA 4HIOA 4AYBG 3CCRA 3RZOH 4B3SQ 3VDYA 1PH2A 4A3JH 1UWVA 2JA9A 4A3GH 4YCVA 4GLXA 2KCMA 4DKAC 4JOIA 3L2PA 1G6PA 1TWAH 5C4XH 4OO1I 5C4XG 4LF4L 2B29A 1EQQA 4J15A 1HNZL 1C0AA 4KHPL 3M4OH 2VQEQ 4R4CA 1VQ7A 2CFMA 4DV4Q 1KD1C 1NJIC 3HOWH 4BBSH 3U58A 4K0KQ 2IX1A 2R7ZH 1EQRA 2LXJA 3HOVH 4A3KG 3CCJA 3CCQA 3PO3H 2R7ZG 2RHSB 2PQAB 2AMCB 1EIYB 3HOVG 3PO3G 5GAGC 2AHOB 4A3LH 3T1YQ 2ZJRA 4GOPC 1FGUA 4LNQA 3S17H 2RCNA 1HZ9A 4X64Q 5BR8L 3K80C 1X56A 4JBKA 2JEAI 3KDFA 3ERSX 1MJEA 1E1OA 1XNRL 2I0QA 1HNWQ 5BR8Q 2VQFQ 1QUQA 4GKJQ 1X3EA 1YI2A 4UP8A 5IWAL 3A5UA 4AH6A 1SFOH 2OTLA 2DGYA 3U4ZA 4BY7H 3CCSA 4DV2L 2MQHA 4A3MG 2VQEL 4DR6Q 4BY7G 3IRBA 1Q86C 1YJ9A 1A0IA 1X54A 2K75A 1R9TH 2PI2A 4AIMA 4X62L 1TWFH 2N78A 3PIPA 5IYBG 4A3DG 3I4OA 2Q2TA 1D7QA 4POFA 1UE5A 1XMQL 2RHQB 2IHEA 1L2FA 1YBYA 2K4KA 1PHJA 2GVBA 1UE7A 3TRZA 2MO0A 3H0GG 4JI2Q 1WCMG 2JJQA 3I55A 4DR2Q 1HNWL 3AFQA 4MTNA 2JA8G 4JV5L 1Y14B 4GN3B 2NZHA 4QL5A 1YVCA 1WOCA 5IP9H 4JI0L 1CKNA 4LF7Q 4LUOA 4DR6L 5IP9G 1HZCA 1TWHH 3GO5A 1S3OA 4JI7Q 4DAYB 4QQBX 1V43A 4P73A 4PZ6A 1G51A 1K8AC 3L0OA 2UUAL 1KRSA 4C3IH 1CKNB 1QZHA 3UE0A 4UP9A 2UU9L 3S16H 1XTDA 1XMQQ 3E0EA 4H02A 4B3TL 4B3MQ 4A3FG 2VUMH 5IE8A 2UXCQ 3F1ZA 1TWCH 4OWWB 3CPWA 1SMXA 1TXYA 4A3FH 1GO3E 3PUVA 1PH1A 4YCWA 1PH5A 2I5HA 1PH7A 1V1QA 3H3VI 2OQKA 2Y0SE 3BZCA 4PMWA 5C44H 1VQLA 4BBRH 3K0XA 4UP7A 5M3MH 2ZJQA 4POGA 4GNXB 3M9BA 1Y1VG 4BBRG 5M3MG 3HOZH 1XPOA 4P72A 1PH4A 3ULLA 3GTPH 3ULJA 4DV3Q 1HR0W 3CMAA 1XNRQ 2Q2HA 2GVAA 2FXQA 4XIGS 1J6QA 4DV3L 2JA5G 3GTGH 1JE5A 1OTCA 3J81i 5ELNA 3OW2A 1E24A 1WYDA 4JI6L 4GKKL 1AE3A 2A8VA 3J7A5 5JJKA 1NTGA 1YNXA 2UXBL 1EOVA 2E8GA 4MNOA 3I4MG 2KBNA 4A3JG 4DR7L 4OONA 2D62A 1QVGA 2NVTH 4TVAB 1Q81C 1K73C 1N33L 4NXML 1CSQA 4X64L 4IJHA 4PZ7A 4DPGA 1S40A 3UE1A 1YEZA 2VS1A 3CCUA 3F2BA 2EIFA 1KC8C 2VQFL 4A93H 4BY1H 5IY0A 3U50C 5LMUL 2R7DA 4GN4B 1OXUA 2NZOA 1KRTA 3AQQA 4DV7Q 4LFAQ 3HOXH 1VQEA 1Q46A 1X55A 1N8RC 2F4VQ 2JQOA 3DM3A 1XMOL 1Z9FA 4C3HH 4A3LG 1X6OA 1C9OA 2CQOA 2K52A 3L7ZC 3A5ZB 2JA7G 4P75A 4LF9L 3S1NH 2VNUD 3EIVA 2KHJA 3D31A 4EQ5A 1OXSC 4LF9Q 5H1SE 1WI5A 3H3VH 1XNQL 2I5LX 2JA6G 1Q1EA 4GS3A 2PNHA 1BBUA 4A3BG 1N32Q 4LFAL 1B8AA 5K36G 1YIJA 1O7IA 1UEBA 4GN5A 1IZ6A 2F4VL 5DLQE 3KOJA 3RN5A 1RL2A 3HOUH 4LUZA 3HOYG 1Y1WG 4UPAA 3S15H 4EX5A 3CF5A 4BXXH 4JYAQ 5LMNQ 3RZDH 1CKOA 1LM0A 4Y7NH 3UDFA 3M85A 2ZTCA 1Y1WH 2K14A 3EN2A 4GLAC 4LFCQ 4K0KL 2UXDL 1WCMH 1QUQB 5GAEC 1I94Q 3S2HH 1HZAA 2WP8J 4AQYL 1JT8A 4DV5Q 3W1GA 3A74A 4XTCS 4YWKA 4KHZA 3J80c 4DR1Q 3GD7A 3CC4A 1VQBA 4DK6C 3CD6A 4DV5L 3KF8B 4P74A 1P8LA 3RR5A 2PQAA 2WAQE 3S14H 3PUXA 2WAQG 1HNZQ 3PUWA 4P71A 2UUCQ 4OWTB 1NBWA 1B7YB 3NENA 1L1OA 3RLNA 4DV4L 4ALPA 3CCEA 5LMUQ 2OTJA 3M4QA 2N8NA 4O0AA 4O2DA 5C0XJ 1W2BA 4DR3L 5M3FG 1ASZA 4HIDA 2Z0SA 3B6YA 4GNXC 1L1OB 3NEMA 3HOWG 3S24A 3GTQH 2BA1A 1VCIA 1UE1A 1RIPA 2WB1E 5C4JH 3HOUG 1P16A 3K8AA 4DK3C 1YHBA 2AKWB 2R6GA 2OWOA 2NVXH 4JI1Q 1H95A 2NVQH 3I4NH 5M5WH 1Y1VH 2QEXA 4IPCA 3CQZH 3PIOA 3KFUA 4X66Q 3PF4A 1CKMA 5FLMG 4JI4L 2ZM6Q 2UUBQ 1IBKL 1AE2A 1LUZA 1XPUA 2HHHL 2C35B
chains in the Genus database with same CATH superfamily
5K5PA 2F0QA 3M4PA 5KFNA 3UDGA 4HJ5A 1A63A 1A15A 4A3IH 1Q7YC 5KFGA 1H9MA 1S4ZA 4QUCA 2H5XA 5DG7A 1DV1A 1FVIA 3VPDA 3P75A 5M5WB 1YHQA 2HHHH 1K3RA 4FDBA 1TA8A 4IRCA 1ZQ7A 2AQ1B 1KAAA 2IT1A 5J3BA 5T1IA 2Q8IB 4DGZA 3M3YH 4Q5VA 2F52A 2W9CB 3PW4A 3ND9A 1U0LA 3KYHC 4K2KA 5KFUA 4DV0Q 1BCPF 4DR4H 3HOYB 1GSHA 5IT9c 1IYVA 3GIQA 5DQIA 3DM1A 3RUZA 3BYYB 4NKLA 3CPFA 3RLFA 2VY3A 2HUGA 4C3HG 1Q3LA 4C1NK 3H3VC 5L1LA 2Z4HA 5KT7A 3GDEA 1K1SA 1TAEA 1TWCA 1DM0B 3G4SA 1M1KC 3KALA 2PYKA 1QG7A 5KFHA 2UXDQ 4AYBB 4YWLA 4ZKCB 1XMOH 5KFXA 1BXTA 1RJTA 2NB0A 3OTOL 1GUWA 4QJFA 2MNAA 4AQYQ 5M3MB 3QFFA 1HHVA 3GTPA 2C5CA 3N44B 1EEFD 2QEJC 1CE8A 4DV0H 3SVMA 3EPIA 5AJ3Q 4Q44A 1JJ2A 5I2YA 2GPWA 3GP7A 2IX0A 5EPLA 4IN3A 5KG4A 4M1UB 1MGSA 5AJ3L 5E3FA 2AQ4A 1NE3A 5EKLA 3QOJA 1RK6A 2RDGA 4MZ9A 4DL4A 4GZYC 1EHIA 2KEEA 1CQVA 1I50H 3S1RB 4ZK9B 2KUMA 3GTJH 5L1IA 1PFBA 1Q1BA 1N33Q 2LMCB 3WNZA 5CA1F 1KL9A 3N52A 4R4IA 1ZYRD 2YYAA 2JA8B 2CKZB 4R4QA 1KBLA 2QGQA 4X65L 4CBVA 1X65A 5JVG3 4G4KA 1WCMB 5KT3A 2MCTA 2Q8TA 2ICIA 1II3A 3CAMA 2NU8B 1PRTF 1V1PA 5LA6F 4B3RH 3HOXB 4IWXA 4J9RA 1IBLQ 1S5ED 1RCVD 4NB3A 1HNZH 4CGYB 4OX9Q 5LMUH 1XPRA 4G3IA 4X62Q 1PV4A 1AUVA 1I4GA 4OX9L 5HGQA 4TV8F 2B63A 1HH2P 3FDTA 3HOXG 4UCRA 4HNUA 1X9NA 3W1BA 5KKNB 2NVYH 1DYQA 2Z6KC 2NBFA 4FNFA 5C3EH 4B3TQ 3KAKA 2FLLA 4DR7H 3NUCA 3K7UC 5JEAG 5A2QE 1KJQA 1UNNC 2AWOA 1KHIA 4A3MH 1IYUA 2ASJA 3KF6B 3LP8A 1L2ZA 1B33N 1I3QB 3S15B 1CHQD 3J81c 1YJWA 5DGAA 1TWGH 1NR4A 2F0OA 5ISRA 1C48A 4X62H 1PA6A 2A5HA 4HJ9A 1FD7D 1U4LA 3MTSA 3IAYA 3MA2B 4DXGA 1RHPA 1DIKA 2R7LA 1CA6A 1VQDA 1EYGA 3NPPA 1L1OC 3Q8QB 4MV8A 4IO9A 2B2VC 1S5CD 4KY6A 5FO8B 3T1HQ 2ZXRA 3DEOA 2F03A 1EQTA 4FO2A 4KKTA 1I4RA 2JA8H 1BO0A 3OSOA 3F2UA 4DR4Q 1A3UA 1SNDA 1K9MC 4IFDH 3FPUB 3I4MB 1BBWA 4DR2L 3K7AH 1UUPA 1VBGA 1VQ4A 1DJRD 3T16A 1SSOA 2QW7A 2VUMG 1PTOH 2VZAA 3I4LA 1G8ZD 3BVZA 4XYOA 5C3WA 4UY8C 2B8FA 1EFID 2Z9HA 1Q8KA 4Z9CB 4IUUA 2N3SA 1XMOQ 2B2YC 1EUJA 2IW3A 3Q23A 1MJCA 3GTOA 4WORA 4A3BB 4CKEA 3I4NG 3SK4A 3CVZA 4J9SA 3OW7A 5M9OA 4DV1Q 2XVSA 5J2TF 3HKZG 1RTNA 1FL0A 1OO9B 2EYPA 2N49A 1CQJB 2NVYA 3D4DA 3VMMA 3HP3A 5LHY1 2FINB 4XDXA 4ZAIA 4ILWA 3GTLH 1CTMA 3CRLC 4UCUA 4IHJF 3RB4A 3HG9A 4GKKH 2K33A 1JMCA 3HKZE 1M0TA 4IOCA 5EWEA 4F4YA 4DN4M 1AH9A 1D8LA 2RDFA 5IYZF 4J9KA 4CJ1B 5CC4A 3PF5A 2UVUA 4BY1G 1I94L 1HTPA 4QY7A 3H40A 3VPCA 3F8TA 2OT2A 3I56A 4OO1H 4ED0A 4A3EG 2EY6A 1NUCA 2K05A 2XTIA 3GTKH 2FK2A 3RJ0A 1TWGB 4GKKQ 2DUDA 5IT9E 4TV9F 3U9TA 1KNAA 1HNXL 4A3IB 4KMUC 2K5VA 2AGQA 4LJZC 1SE2A 1IBMH 1CHPD 3T1HL 4MV4A 4ECWA 5DEHA 4C3IG 3CC7A 5KFZA 3PSIA 2UVRA 1AEXA 2KEDA 2JA5A 3RZDB 5IT9W 1C7YA 2R7FA 5EKIA 5I9PA 1SAPA 5KT5A 3HOYH 1VQCA 3PCOB 2R93A 4L5SA 3BA8A 4RGNA 4KY5A 1A2TA 2NVTB 1PTOB 2NWGA 4DR3Q 1WTVA 1EY5A 3K5IA 3N40P 3TREA 4PNYA 3K3VA 4B3SH 4HJ7A 2L0CA 1ENAA 1EWIA 1HFNA 5C4HA 1IBMQ 1PVOA 4M7EA 5K2MA 3TZDA 1HUMA 1A6XA 5D1PA 5KG1A 4L63B 4ID6A 4B9XA 3GTMA 3NTIA 3ETHA 3H4BA 3QIAA 5L1JA 1UWVA 4NP5A 2JA9A 2JEIA 4A3GH 4YCVA 4DKAC 3L2PA 3I90A 5KX5F 1R4QB 2J6UA 3NQIA 1BF4A 1BGWA 4KHPL 3M4OH 5I4DA 4R4CA 3HOWH 1STNA 1Y1WB 1G6ZA 2B2UA 3ORRA 2FPPB 2IX1A 2R7ZH 3V4SA 2O5JC 2EJFC 1EL0A 4A3JB 2RDIA 3PO3G 3G6YA 5GAGC 2G5DA 3BDLA 2SDFA 4JW0A 3QZ8A 4JI2H 3QR8A 4RA8A 3E3XA 3GTQA 3HEJA 3S17H 1AUXA 4EFEA 5LOVF 2DPJA 5FK9C 2JEAI 3N6RA 1XNRL 4EBEA 2I0QA 1HNWQ 2VQFQ 4GKJQ 2R92B 1JXLA 3A5UA 3AU7A 1XDNA 3U4ZA 4BY7H 4RCNA 2VQEL 4A3MG 3KBGA 1JOKA 2K75A 2EYOA 1R9TH 4AIMA 1TWFH 2N78A 5K36H 1XMQH 5E4XA 3I4OA 1TIID 5NUCA 4POFA 4HR7A 1OWTA 1L2FA 1YBYA 2BOSA 5I9OA 4JUZA 2BQRA 2GLTA 3DWAA 2F4VH 3S16B 1PFMA 2K01A 3M7GA 4DR2Q 5LP6F 5EGTA 3VA7A 4MTDA 4MTNA 2M00A 3AFQA 1O80A 2NZHA 1YVCA 4WRDA 4MIUA 4LUOA 1S0NA 2EYFA 2W6QA 4CKCA 2HVQA 5JPNC 2F0IA 1SYGA 5EKKA 1XMQQ 3NTHA 1T36A 1N32H 4B3MQ 3GTGB 3F1ZA 1SMXA 5EWFA 1FNVA 3T13A 4XQNA 3C1FA 3OMCA 2I5HA 3H3VI 3ND8A 4IUVA 2C2RA 4PMWA 2HJWA 4QWEA 2I07B 5M3FB 4UP7A 1JC7A 3FKIA 1Y1VG 3FPPA 5M3MG 3HOZH 2CZGA 3ULLA 4YB8B 3T5LA 2EVBA 3CMAA 1ICFB 5FOBB 4HSPA 2Q2HA 2FXQA 4YR0A 5DLFA 1F9QA 3K5LA 4DV3L 2JA5G 4ZI7F 1ICWA 3KTMA 2A6HC 3J81i 5ELNA 3RUPA 4JI6L 2XIWA 3GV3A 5FD5A 1VMCA 3J7A5 3NE5B 2K04A 4MNOA 1XNRH 1CZWA 1HFGA 4DR5H 5DQGA 5C4ZA 1TT2A 5LL6S 2FPIB 3MWMA 1UC9A 1W93A 3F2BA 4RAYA 1O7ZA 2FK1A 4A93H 3PIP3 1KJIA 1AN8A 4BY1H 3U50C 1OXUA 1STHA 2CH4W 1MD2D 4DXFA 1ILPA 1BNZA 4DV7Q 1CT1D 1W6KA 5LMNH 1ILQA 3DM3A 3T5JA 4A3LG 2IMWP 4XYQA 2A6ED 2RCFA 3S1NH 4XX0B 2KHJA 5EDWA 3J7AF 4FS2A 5KFAA 2EZVA 5CR3A 2Y0SB 2E2JB 2JA6G 2JSOA 4EGJA 3NBHA 3H4DA 2MJ8A 2MP1A 5D14A 5FKAC 4A3BG 4O4HF 5DG8A 1B8AA 2UXCH 1YIJA 1O7IA 4M9UA 1D1KA 4GN5A 1UEBA 1S68A 4LFAH 1SBBB 5HURA 3HOUH 1KTKA 4LUZA 3HOYG 3CF5A 1PRTD 3PR4A 1CKOA 1G2SA 4N8FA 4Y7NH 2R93H 2ZTCA 4LMYA 2K32A 4LFCQ 1GHKA 2XC9A 2WDTA 2C28A 4FBUA 3MXPA 4FXGC 1J8IA 5GAEC 2HCCA 3V6HA 4LF6H 1N34H 3S2HH 2PQEA 3CHBD 2EJGC 3EJIA 3A8KE 2A68D 1JT8A 2VUMA 3W1GA 1GLVA 1YNJC 1K83B 1Q90A 1VQBA 5DQHA 1N36H 3D4WA 1P8LA 4I65A 5DNFA 1IL8A 4IZOA 2WAQG 1EY4A 3PUWA 4OWTB 3NENA 1L1OA 3DMUA 1EY8A 1W2BA 1XTCD 2RDHA 4GNXC 3FDSA 3NEMA 3SK6A 2YRWA 2W8KA 4J9LA 2V58A 3GV5B 5C4JH 2F4IA 2XGQA 3PN1A 4ED6A 1PMRA 2AKWB 4C56C 5KFRA 2NVQH 1T5XD 1XYIA 1Y8OB 3PIOA 3CQZH 1D5ZC 1UNSA 4G57A 3GTMB 3MAQA 4JI4L 2EY1A 2B2TA 3OUZA 4DV5H 4RH6A 1K83A 2B2UC 2VUMB 5JPMC 3LWEA 2E2JH 5CB4F 3T5HA 5C3EB 1FJGH 2PMZE 2NUCA 4X66H 1XXGA 5FLXW 1FJGL 4ED8A 4DUYQ 1T9HA 5IYCG 4YHHH 1BQQT 4EGQA 1DGSA 3BA9A 4EVOA 5FLXL 3SE7A 1E3PA 1LT6D 2ALYB 3NTKA 5CORA 3STBC 1ZYRC 3HOWB 2R61A 2W6NA 1EEID 1M8AA 3KF6A 1V9PA 1PZID 1CSPA 3NBHB 4IUTA 4DR5Q 4JI3H 1S03G 4PV1C 3H0GH 2HHHQ 3JZIA 1BCPC 1HR0Q 1PH6A 2XCPA 3GIKA 4LF8H 2YTVA 1TS3A 3KUPA 2XN9C 3R5XA 2UUAH 1KXLA 1SR3A 1TWHB 3S9WA 1E22A 5L37A 4QUFA 2YU9H 1S0MA 4JV1A 4JI0H 2R92H 4DNIA 3N41B 5JUMA 5KFWA 3GTLA 3OTOQ 2AGPA 4LFCL 3N43B 2JXMB 1SN8A 2ATWA 3SK8A 2F0TA 2EDGA 5C6AA 4QIWB 1AP0A 1EZ1A 4PZ8A 4U68A 1EZ8A 2DY7A 2BDOA 4JCVE 1EUCB 1N34L 2J4XA 1ULZA 2E2HH 2NU6B 1QNUA 4JC0A 4RAZA 1HR0H 1PFSA 2IBKA 5FO9B 1DOKA 2PBZA 4EG0A 4DV2Q 5IYDH 5C3XA 3H91A 4HMJA 2QDBA 2XWJB 1VQ5A 1VQPA 2MFIA 3ZJYC 4YP3A 4LF5L 3F2CA 2LFNA 5JEAJ 1E7ZA 1QE6A 1SYBA 3E9HA 1SEIA 4YY3H 4NXNQ 1ZXTA 3PQIA 5KT2A 2JYOA 5JVDF 1VDZA 4K14A 4E6IA 1RYSA 4UCTA 1IXRA 2QDLA 4FF2A 2KVMA 3TEHB 4WJ3M 2YZMA 3A8JE 2W71A 1TWAA 3BQ2A 4IR9A 4I7HA 3FKIB 4IFDJ 1TQOA 5D65A 1QVCA 3NP8A 4RWSC 5M3FH 1LT5D 5G3LD 1PLFA 4Q0FA 3VYUA 5CAEB 1SE8A 1M0WA 5JJIA 3RLOA 4B3TH 4OO1G 2UU9H 3K3PA 2ES2A 1VQIA 3FEWX 1T3NA 2KHSA 5FLMH 3RV4A 5D3IB 4B3RL 5BN5A 4NXNH 4JI5L 4IQZA 1IKLA 3ZYYX 1CQIB 1KDAA 1EQVA 4DR5L 2MO1A 4I50F 2D0PA 2B2YA 5CV9A 2FJZA 3QG1A 1K8OA 4EYIB 1IL2A 1PFNA 4Y52H 5JEAH 4HSVA 1EIGA 1OXXK 4MTKA 3N6XA 2C2DA 1DOLA 4LF7L 4WJ4A 3MXNA 1RJRA 2HCIA 3MR6A 4RU9A 2N55A 4HR7B 2K6AA 3NELA 5IWAQ 1HXYD 4QB4A 2CCZA 1GJXA 2HIVA 3HKZB 5EPKA 4CDFC 3MVVA 1D7QA 2QYZA 3E9IA 3PV0A 1TY0A 1NR2A 2Z1CA 4OL7A 4KJNA 1D2BA 4HCEA 4JI8Q 1FYCA 5IIFA 2JE6I 2UVVA 3T1YL 4L5QA 2ASDA 1CUKA 5EPJA 3A7AB 5D1OA 1KC7A 1DCZA 2KCTA 2F3WA 2E2IH 3KDFB 4YAJB 2MGSA 2IY5B 3R8BA 3PUYA 5BMVF 2F0FA 2HQLA 4LF8Q 2DPIA 3FP9A 2K5HA 2B63B 1PDQA 2JEBI 3KHRA 3H09A 4JI0Q 4Y8VB 3SHLA 2J0TD 4NXNL 3AFPA 1KJJA 5DG9A 5GADC 4PMBA 1VQ8A 1JQYD 4JI8H 1E1TA 4BBSG 1G2TA 3TINA 5LL6X 4N9TA 3MC0B 3G6JB 5BPHA 3M4OB 1TR5A 4BY7B 3C3LA 1G91A 1LV9A 1GUSA 3NXWA 4FBTA 1IBLL 5D3DA 3RN2A 3J7AK 1J5EL 1F2LA 4KLKA 5KNBA 4DV7L 3H6MA 1B3AA 1EIFA 3FVQA 2BH2A 2KSWA 1K83H 1J5EQ 1JE4A 3CMEA 1N9WA 4L5RC 5KEEA 2BE5D 2XRSD 1C30A 2UVWA 1RODA 1JB7A 3R2IA 4H7BA 1MIUA 4IURA 5L1KA 5COYA 2D9UA 2CWPA 4Y7NB 3I4MH 2PNRC 2R93B 1VQAA 3H0GA 4FP5D 5BN4A 2NN6I 2E5LQ 2L15A 2AWNA 1B44D 4L5TA 1E2WA 1IKMA 1DXMA 2VB3X 4JI8L 4NPSA 5C4XB 3OHAA 2VA2A 1N32L 4CDDC 1ML0D 4IFDI 1U4PA 1Q12A 1SE3A 1TWCB 2A1AA 5KFCA 3HS0C 1GVPA 2XNAC 3OMGA 1V51A 3EBEA 4DL2A 3PGZA 3PO2G 1F2YA 3L4JA 1S72A 5F2DA 4MV6A 1TWGA 2R92G 2DNCA 5GONF 4C3JH 2L5TA 1EY7A 4R7RA 2GN5A 1SRUA 4R4TA 3UI2A 1YITA 2R7ZA 1CM9A 1KQSA 3V96A 2B2TC 3OOCA 1WD0A 1IOVA 1FKAH 1EUDB 1X3PA 4ZQ3A 4ETSA 3MR2A 3OSPA 1N48A 1E2ZA 3OUUA 4ABNA 2VB2X 2HT1A 1B9MA 1CK1A 3H0GB 5ELEA 3TBIB 5D1OB 1EU3A 1GOZA 4I55F 1GKHA 5CGKA 1TY2A 1D6EC 4JI3L 1LABA 2VQEH 2R8JA 5DLGA 2GA4B 4HJAA 5IYDG 5FPOA 3HKZA 1VQHA 2F1MA 2YCHA 5C5MA 4F87A 3M4IA 4KJOA 2DJFC 2NU9B 4YHHL 3MXNB 4A4IA 4EQNA 2BQ3A 4IUPA 4AYBG 1A3VA 3LMLA 3RZOH 3K6OA 2KCNA 1RDPD 4R8IA 1CI3M 2KECA 1A9XA 5BR8H 3K58A 1K8MA 4GLXA 1HNXH 1E4FT 2XRQD 2CW8A 2DZDA 2Z8LA 4MTEA 3GTJB 5C4XH 2W6OA 4OO1I 3Q24A 4UCSA 4LF4L 1SYFA 1ET6A 5KG2A 4DL6A 2CQAA 1TS2A 3MEHA 2VQEQ 5JVH3 1A3TA 4MV9A 4DAYA 1Q8IA 2A69C 2AMCB 1EIYB 3HOVG 2YW2A 4DR6H 1B1ZA 1NNXA 2FJ2A 1EWCA 2W57A 5F9NA 4J9MA 2ZJRA 3BJYA 3S1QB 1GUGA 2RCNA 5BR8L 4J9PA 5ELFA 1X56A 3JAME 1CS0A 2QILA 2O03A 2R86A 4C3IB 3JSLA 1ZKOA 5BR8Q 1QUQA 2P5ZX 1EYDA 1HQRD 5IWAL 1XWEA 3QO2A 2DGYA 2OTLA 2CHBD 3JAMW 2MQHA 3W3AA 3ERQA 4DR6Q 1SJED 1FNWA 1X54A 3L4KA 1BCPB 2F0DA 4V190 4NMZA 3PIPA 1SEBD 2O4XA 4A3DG 5C8YF 1EY6A 1KNEA 2Q2TA 1UE5A 3H20A 2O5IC 2RHQB 2O2LD 3RBEA 3HBLA 2GVBA 3MR3A 3MXUA 2V9WA 1BR9A 3MHBA 1STEA 4GN3B 1Z6HA 3RAQA 4B3MH 4DF7A 5IP9H 4JI0L 1CKNA 4DK1A 3A56A 2R85A 2VR1A 2A68C 4QQBX 1EYCA 4PZ6A 2WTFA 2L11A 3CRKC 2R7KA 1G51A 3IFDA 3L0OA 1K8AC 2UUAL 2ZDQA 5KFFA 5CV5A 3S16H 3PW0A 4WD3A 2XD4A 3L9AX 2VUMH 4A3FG 5IE8A 2UXCQ 1S0OA 3CPWA 3E0JA 2NZ1D 4XT1B 4YCWA 4JI7H 5KT4A 2Y0SE 5C44H 3GV8B 5BN3A 4DA2A 1VQLA 5CV7A 4BBRH 4Q0YA 1WTPA 3M9BA 1HUNA 2OLSA 3ULJA 4DV3Q 4ED2A 1TWFA 3LWUA 1XNRQ 3R2TA 3GIMA 3EVQA 1PTOF 1LO5D 1J6QA 5JOBA 2L4NA 3GTGH 4IR1A 4IRKA 1OTCA 3J80W 4GKKL 3OW2A 4F4WA 4K5XA 4RHSA 4MAMA 5JJKA 4UFZA 2E75C 5C0XH 4RAUC 1EOVA 1F2ZA 4NW2A 4A3JG 4DR7L 4OONA 4DAPA 2F3VA 1Q81C 1K73C 4DV7H 2E74C 1S40A 4IJHA 4FXKC 4PZ7A 4F50A 1YEZA 2PO4A 3GTPB 3CCUA 4H13C 2VQFL 4PDBA 1KLGD 3GTGA 1EYAA 2F0NA 5LMUL 2R7DA 4KKSA 4B08A 3TSSA 2W70A 4RKLA 5EOYA 3D6CA 3I12A 3R23A 4ZUIA 5LYJF 1X55A 5I6YA 1N8RC 4C3HH 4U6PA 4FU0A 5BPFA 4DR2H 4EYHB 3TQ1A 1ZETA 2K52A 3A5ZB 1I7LA 3VPBA 5FO7B 2M9VA 2RSNA 3LX0A 5I6WA 2WAQA 2YZNA 5KFYA 3QOLA 3H3VH 2F0MA 4EQPA 3PO2B 2Z4IA 5DM63 3MFYA 4DL5A 3I3CA 1BBUA 3ITPA 4LFAL 1NAPA 4OIJA 3FRPB 1MZBA 2C9OA 2F4VL 3RN5A 2ZJTA 4JYAQ 1Y1WG 4UPAA 1JIHA 5KFKA 4A93B 3RZDH 4BBSB 2B2WA 3M85A 2GPSA 4GLAC 3EN2A 4UAIA 4B9WA 4FF4A 1WCMH 4RNOA 1SNPA 3TP8A 2C22A 2WP8J 1JOQA 1KEEA 2XSCA 4MN3A 5T1GA 2R7NA 4LMQD 2ZM6H 2UUBH 2DIKA 3OTOH 3A74A 3GD7A 2JA6A 2FKLA 3CD6A 1BDOA 3CU7A 1JDBB 3EFXD 1IBLH 2VXWA 3S14H 1U9RA 3P20A 4K5VA 4A3EB 1LTSD 4OX9H 1SNQA 3CCEA 5LMUQ 2OTJA 4LSAA 2UUCL 2N8NA 2M05A 4HIDA 3B6YA 1EY0A 1E4GT 1L1OB 3S24A 1VCIA 2X0SA 1RIPA 1STAA 2WB1E 1C8CA 2UUCH 1P16A 2NVXH 4JI1Q 2RQXA 3I4NH 3U9OA 3GILA 2FLNA 4U7CA 2QEXA 3KFUA 4X66Q 1SYDA 1CKMA 5FLMG 3KF8A 4QWDA 3BABA 4O2AF 4ED3A 2ZM6Q 2UUBQ 2R84A 4HNTA 4ZOLF 4DR1H 1LUZA 1XPUA 4XQQA 2HHHL 2ZM6L 2UUBL 1PYSB 4XYMB 2Q2UA 4X3UA 4DV3H 4OEMB 5FJ8G 2H1EA 3CXCA 1EIHA 3SR1A 4ME5A 3MFHA 1BKBA 2D5DA 2VOBA 4BA2I 2K28A 2RBMA 3V05A 2IA6A 3RBDA 3H15A 4UCOA 1JWUD 3P1HA 2ASBA 3S1MH 4LF5H 4YQWA 4DAMA 3AEVA 1X3QA 1EOTA 3I2ZA 4B3SL 5IGDA 1O7LA 4JV2A 1RD9D 4HQ6A 2BH8A 3RAXA 4A3DH 2Y0SA 4YHHQ 1LT3D 1NY4A 3MFGA 4DUZQ 2R8KA 3M4YA 3FKIG 1G291 1SJHD 4TQUS 4RUCA 2A19A 1SYXB 2WINB 5J39A 5FLXE 1I6HH 3VR5A 2ZXPA 5FLXc 4LF6Q 4X3KA 2L55A 4DAVA 1XJVA 1NCVA 4JI3Q 4ME3A 1S10A 3TS0A 2Q2IA 4IFDG 3TS2A 2V4DA 2EE1A 1O75A 1SROA 4O3PA 3F8NA 4NLGA 3GV6A 4LF4Q 4EBDA 2Z6KA 1VQGA 1Q82C 1IBML 3RIZA 2YV5A 4FM9A 5IP7H 1AW7A 4CDCC 3BQ1A 5E4WC 2BDNA 3AMUA 4EEYA 1GUTA 4JI1L 4X65Q 1JOOA 4IZ8A 3CC2A 4JI4Q 3BZKA 3IL8A 1JKJB 2BA0A 1PH9A 1K1QA 3HOZG 3G48A 2D0OA 1SFOB 3TDQA 1CQFA 3JRWA 2W9AA 5IGCA 1JB3A 4TSSA 3BVMA 2YTXA 1JORA 1ZHQA 4O2BF 2EXDA 1A8VA 4JYAH 5D8DA 1D5MC 1KAWA 3QB3A 3BS1A 2IJ0A 1GHJA 1SYEA 2F0VA 3KLSA 4RNNA 4JI2L 4YY3L 2HGSA 4X66L 4ZLTF 4GC7A 3HRZC 2I46A 1LTID 4YY3Q 1F2MA 2FMCA 2WKCA 5CV8A 2EYLA 4TRDA 4JI4H 4KHPH 1HR0L 1PTOC 1VF5C 1D1IA 2X6LA 2YYZA 1QZGA 5C44B 4JI7L 5DM73 3G6XA 4J9NA 4A75A 1OXVA 2ZJPA 4RB2C 4ECYA 3F2DA 2I5MX 1Y1VB 5JQWA 2FMMA 5JVLA 2VUGA 1ESRA 4AYBE 3NGDA 4KY7A 5C1PA 2WFWA 2UUAQ 1QILA 5C3EG 4C2MH 4NXMH 1N33H 1VQNA 3VA5A 3MWYW 3MWEA 4B3ML 2CW0C 4HN7A 1JDEA 4IOAA 1S5FD 4ZRZA 1N36L 1C4QA 4O1NA 3KLWA 1Y8NB 4K8JA 1QVFA 1A62A 4LF8L 3X3NA 2W6PA 3HOUB 1U4RA 3HFZB 4MA5A 4ECQA 3CCMA 3QZ7A 2RGRA 5KG5A 3JAML 3JAMi 1SFOA 4LF5Q 4JI6Q 1HCZA 1DV2A 3U4VA 3DXJC 3GIIA 4RB3C 3M7NA 4KD3A 1XNQH 3OHXC 5JAVA 2R93G 5IWAH 3CCLA 3WWVA 2B3GA 2Y0SG 4FS1A 4DR7Q 1NMFA 3T53B 1B2TA 4U673 3WOEA 4A76A 2NTTA 1I5FA 1WH2A 4XZ3B 1EU4A 2B63G 1EYZA 4EQOA 3OPOA 3RMHA 1X3GA 3S2HB 1BJTA 3RZOB 2WV6D 4QIWA 4A3GG 3GTLB 2JN4A 2B8GA 4HJ8A 4RB1A 2ID0A 3Q22A 1GM5A 3CP0A 1LTAD 1H9RA 1W3SA 1I6UA 1FNUA 2NVQB 4K6LA 5LMNL 4KI0A 4OELB 1JWMD 1UE6A 2OQ0A 5AFWA 5KFEA 5HBRB 4O3RA 2NUAB 2E5LL 4O3SA 1XNQQ 2CW0D 4G7HC 1VKZA 1GUOA 1MKHA 2WACA 4X64H 4YJ2F 4IPGA 3A7LA 1LTLA 2ZTEA 4DNTB 4QWBA 1IYJB 1R9TB 3HKSA 3D3RA 2JP1A 4A3IG 2PZTA 1J9OA 3S1QH 5KT6A 4CJ2C 3WDNA 3S14B 2K1BA 3Q8DA 4R1JA 4HYKA 1H9JA 1HNXQ 2W6MA 3MFIA 1BVSA 4TKOB 3W5OA 4PWQA 3N42B 4KN4C 3J81j 3TMEA 3BQ0A 2CQYA 5KFMA 4LFBQ 4A2AA 3BG5A 3JC66 4LFBL 2K5QA 1M4VA 1LACA 1PZJD 4M8AA 4DNRB 5KFJA 5KFQA 4ECSA 4A3EH 3KJPA 2YRXA 1Y1WA 2F3IA 1YNNC 4IJLA 4HIKA 1IW7C 3MEFA 3EPGA 1I50B 1R4PB 2F0HA 3S1RH 3N8DA 1I4HA 3OYYA 4A3CH 2WE6A 3V2TA 4CDEC 4QIWE 1ENCA 3CKIB 3I91A 1RJPA 4JV5H 3G6VA 4JVZA 3MR5A 4NXMQ 3EA6A 4C3JG 4V0BA 1IBKQ 4Q45A 2TMPA 3BYTB 3G8CA 1S97A 4GLVB 1VQ6A 2ZT9C 5IP7G 3BJUA 3PMFA 3GTKB 4E4TA 3DWPA 1EZ6A 3HOVB 1K0SA 5CBEE 4DV6L 3CW2C 1HA5A 1TVXA 2K5NA 1VQOA 4K5WA 3JAMc 5G3LF 4A3MB 4GOPB 4J9OA 1PYBA 4RGOS 1UEAB 4QW8A 1PH3A 3TQTA 2CWAA 1STYA 4RZQA 4ECVA 1ESFA 1Y69U 2R87A 2SNSA 4JI6H 3FMCA 5C0XI 1ZEQX 1B70B 2NVYB 4C5AA 4XXEA 3WO0A 1T5EA 1VF7A 2X69A 3CCRA 1J5EH 4TQRA 2K7VA 3LNNA 1B3QA 4ECUA 4DL7A 1PRTB 2AGOA 3V4ZA 2L1BA 2PPBC 2KCMA 3MZ5A 4FVMA 5CBAE 1HRJA 1TS4A 5C4XG 3UFXB 1JLLB 2B29A 3SDZA 4J15A 1HNZL 1JWSD 4C2MA 2VA3A 2CFMA 3CQZA 1NJIC 3U58A 4K0KQ 3GIDA 2F0SA 2LXJA 1B9NA 4A3KG 3CCQA 3PO3H 2G9DA 2R7ZG 2XIGA 4IAJA 2PQAB 4R8NA 5FD6A 5KG7A 2E2IA 2AHOB 4A3LH 4A2BA 2KCCA 4QCLA 4GOPC 3QJYA 4I7AA 5C5JA 4LNQA 4F88A 4DV4H 3Q8RB 4X64Q 1U4MA 4P2CB 2FPGB 4JBKA 1I7NA 3ERSX 2K03A 1GGOA 1E1OA 1Z7TA 2C00A 4F4XA 1X3EA 1YI2A 4YAKB 4UP8A 2PMZB 4RUAA 1SFOH 3T1YH 4YR3A 4A3KB 3CCSA 4DV2L 4EFBA 2NTSA 4BY7G 1Q86C 3VR6A 2PI2A 2SEBD 1N56A 5C4JB 4RCOA 1TWFB 4K0KH 5IYBG 3K5NA 5KFIA 1XMQL 1LLRD 2K4KA 3M9OB 2V4QA 3SI8A 5CMDA 3VR3A 2A6HD 4LF7H 4Q8FA 2MO0A 3H0GG 4OGQC 2OF1A 3QWNA 4JI2Q 1WCMG 3M3YB 5EZYF 3EQLC 4C1NI 3AB9A 2FK3A 2PW7A 5KFVA 3LWBA 5M5YB 4G7OC 2JA8G 2EYHA 3D8GA 4QL5A 1B6RA 5I2XA 1LT4D 4QMGA 4LK1C 1HZCA 5IP9G 4JI5H 4JI7Q 3BDOA 5J1ZA 1B04A 1V43A 4APMA 2HQEA 3CQZB 1KRSA 4C3IH 1B53A 1CKNB 1QZHA 3UE0A 4UP9A 3HGBA 2UU9L 1XTDA 1B6SA 2QK4A 5J2UF 3E0EA 1UAPA 4H02A 4XQJA 4B3TL 3A55A 1BCPD 1TXYA 3R5FA 4DL3A 3PUVA 1PH5A 2OQKA 3BZCA 1I4XA 3A54A 4EEQA 5M3MH 4POGA 1FR3A 2NVXB 4ZQIA 3BZDB 3K0YA 4P72A 1XPOA 1PH4A 1YNND 1I94H 3X3MA 1MSHA 2F0UA 2W9BB 3T51B 2W9CA 1KJ8A 3K5HA 4CHTB 1V8QA 2JEJA 2B2WC 3TN2A 2J6TA 2FFKB 4HAEA 3UQ8A 1E24A 1WYDA 4J8QA 3Q8SB 4J1MA 2BR0A 1NTGA 2XWBB 3D6WA 1YNXA 2E8GA 2D62A 3BAAA 1QVGA 2F0PA 1RK5A 2A69D 4DPGA 3UE1A 3GTKA 2VS1A 1CFMA 4RHRA 2EIFA 2SNMA 4BY1B 2BE5C 5IY0A 3Q2OA 4O4IF 3S2DB 1F9RA 4IRDA 3AQQA 4TUYF 2W6ZA 5J22A 4LFAQ 4A3DB 3HOXH 2FE3A 1WTWA 4A3GB 5FPRA 1TS5A 3OIPA 1QJOA 4ECZA 4L1KA 1X6OA 5A2QW 4EBCA 4LFCH 3L7ZC 3S1NB 3M9MB 1EWHA 4P75A 1WD1A 1XX8A 2VNUD 3TP7A 1GXDC 4LF9Q 2VPSA 4RNMA 1V1OA 1HNWH 4HTHA 4H44C 4CJ0B 5DLQE 3KOJA 5ELCA 5IGEA 3R5HA 3GLKA 2D2CC 3S15H 3NBIA 5CV4A 4EX5A 1H9SB 5LMNQ 3HOUG 1LM0A 2OH2A 1Y1WH 1PX2A 1GYFA 3GV7B 2UXDL 3E6ZX 1I6VC 4BWSC 2K5WA 4K2LA 3NWSA 4AQYL 4FF1A 4DV5Q 4LF9H 5KFOA 4KHZA 1Z2NX 4DK6C 5KRUA 2CW7A 2JA5B 4DV5L 4C5BA 2PQAA 2WAQE 4DLKA 1X32A 3Q6SA 3VYTA 2UUCQ 1NBWA 3RFCA 1O78A 1D5XC 3EYYA 1STGA 4PQXA 4WJWA 4O0AA 2EOTA 4O2DA 1ASZA 1AZQA 5M3FG 5KFSA 2HVSA 1HA6A 1VBHA 5KFDA 3HOWG 1SYCA 2LS01 3GTQH 1UE1A 2J7ZA 1KDBA 1HQMC 3I73A 5M5WH 1Y1VH 2E2DC 2I87A 1KLUD 4DU9A 5A35A 2V4RA 5EBCA 4CC6A 3IFTA 2YL2A 2C35B 5H80A 2V5AA 3T4AC 2Z6BA 4IWYA 4YIJA 1JICA 4XYLB 3KJOA 1SCUB 4RKBA 1KABA 3SEBA 3RGXA 4ED7A 1SLJA 5KG3A 3DEPA 5HY6A 1EFWA 5IYCH 4LF6L 5JJLA 2ZDHA 5GAHC 4BWGB 5HGTA 1Y8PB 1PH8A 4UHVA 1E0BA 1X3FA 4Q43A 1WTOA 1W96A 3HXLA 3J7ZC 2UXCL 3E5NA 4JK1C 5IT9L 2RDJA 5IYBH 4PG3A 2RF4A 1T94A 5E7NA 2QF7A 2R8IA 4X3TA 4OHJA 4L8JA 4DV0L 2FLPA 3GTOB 3UDXA 4ZKBB 1ASYA 2WAQB 4ED1A 2JEFA 2QCPX 1ET9A 5EJWA 3S1MB 4R9WA 1JR0D 1FJGQ 4DUYL 1K3BC 3G71A 3J80E 4O3NA 4DUYH 2DLNA 4I4TF 2L12A 1WTXA 2LY7A 2IX3A 1Z2OX 4ODGA 3Q0AA 2KENA 3PO3B 1RJQA 5L9XA 4J6HA 4R4OA 1VQKA 1E2VA 2NYZD 4BBRB 1WVLA 1LTRD 1YHAA 2EYMA 3DF7A 2OCEA 4LH7A 1DOMA 2ZDGA 3ULPA 4JBMA 2UXDH 2IHFA 4GKJL 4IUQA 3URYA 2FP4B 4X6AH 4DR4L 3PVXA 4ULLA 5CV6A 2ICEC 2ZXOA 2KQ3A 4J0MA 3T5KA 2PI2E 2PW5A 4X65H 3OIQA 1HJPA 3OWFA 3WO1A 1GD7A 3KBXA 1VQJA 4O3OA 3RNUA 4B3RQ 2E2HA 2V1CC 3IN5A 1I3QA 4GNXA 1LTGD 1N34Q 5LL6b 2W9BA 3O13A 4QWCA 1U5KA 3NK9A 5LMNW 3TQYA 2XGTA 3J80L 2YS7A 2NVXA 5EBDA 2OXPA 3PZPA 4OXPA 3RB3A 2E76C 1N36Q 2MHVA 4IUNA 5CYUA 5EQ0A 4KV6A 4DUZL 3SXHA 4CKBA 1YZ6A 3RF2A 4HIMA 5KIXA 5KFLA 1K8GA 1I4QA 2WB1A 3BU2A 4TQSA 5KYLA 2HIXA 2A6EC 3G7LA 4KKUA 2A73B 4KK7A 3PR5B 2F0JA 1I3QH 2EYJA 4KHPQ 2PN1A 4F8MA 2EPBA 3PUZA 2HD3A 2YTYA 1C3OA 4DV1L 2R7MA 1BOSA 5M5XB 3PO2H 4R8UB 4QWAA 4EGVA 4F7XA 1Z47A 1SNOA 4K6DA 1AFPA 2IL8A 3D0FA 4ME6A 1ONLA 1PZKD 1RF2D 2ZTDA 3GTOH 4JV0A 4ZCKA 3S17B 2R6FA 3GTMH 5KFTA 3J7YW 1VAJA 4ECTA 1OXTA 1SXTA 4N9PA 4JYAL 3W2DA 2V59A 4A3BH 2EQSA 1DONA 5ELDA 3S2DH 2BQUA 2AQ3B 2FHTA 2NN6G 3EROA 3MXGA 4LUVA 4OWXB 3DLLA 4QGUA 2UU9Q 2UXBQ 1ZHSA 4FYDA 4ECRA 1WJJA 5KG6A 5GQOA 4UDUC 5DGBA 1PK8A 2LSSA 3FMAA 5GROA 1HZBA 4RG1A 1WR2A 3FHWA 4O3QA 4IALA 4JG2A 2FMAA 1YJNA 4WFN3 3PW7A 1M90C 5EAYA 4R8UA 2PCFB 3AYHB 4HCSA 5F9LA 2SOBA 3BDCA 3RGZA 4DK0A 2JA7B 1IBKH 1SMYC 2B63H 2WIIB 4N8X1 3UDIA 2WB1G 2OEOA 3NHHA 1Y1VA 1JJGA 4DV1H 2JK8A 3HB9A 1VS0A 2VL6A 2I80A 3I4NB 4BA1I 3IKJA 4F4ZA 2KHIA 1TWHA 1VMPA 4RGTA 3A0JA 1YNJD 2QA4A 5ELOA 1VQFA 2PZWA 4DR3H 4HNVA 1WTRA 4YBZB 3GTJA 3IG0A 4O42A 4A3KH 4LH6A 3TP6A 1KIXA 1RYRA 4BS9A 3J81W 1SNCA 1JX4A 2ALZA 4DV2H 2JA5H 3P7JA 2K50A 1RKNA 2YU9B 5FJ8H 4RZRA 4APVA 5EWGA 3DWQA 3NWTA 2EJMA 3ICEA 4CC5A 2FB9A 2H4OA 5C0XG 5M5YH 4XT3B 4GOPA 3K81C 3I8ZA 2RGVA 1K0RA 1B50A 1QB5D 4LWCA 5M5XH 3J80i 4DR1L 2LXKA 5TSSA 4HMIA 3GTQB 5I47A 3G6EA 3E5SA 4A93G 5T14A 4QW9A 4QF4A 2XCLA 2XCAA 3GIPA 3K57A 4UCVA 1I50A 3FKIH 4JBWA 4DV6Q 1EY9A 1IOWA 3BG3A 2G9HD 2JA7H 1GSAA 3T1HH 2LKVA 4JOIC 4H0LC 3GQCA 3DUZA 4LW1A 1O7YA 3I7FA 1LTBD 4YWMA 5KNCA 1VQMA 1BBXC 3WOFA 4FF3A 4A3CG 4IPDA 2DNEA 1WTQA 2JA6H 2IWHA 1NMGA 3CCVA 4DFAA 2C2EA 1JJCB 2XGPA 3ETJA 3U9SA 3BVGA 1LYLA 2YS6A 3LGJA 4IPHA 2J6SA 2EY5A 1SNMA 2NU7B 1M6VA 3SGIA 3SK5A 4JV5Q 1WFQA 4BXXG 5C44G 1VQ9A 4YJ3F 3KXYT 3GQBA 2AUJD 4YCUA 1HPCA 2I8CA 2HVRA 3STBD 4DV6H 3ER0A 2TSSA 2R3ZA 1H9SA 4JBJA 4OIKA 4C3JB 3K5MA 2DWCA 2VW9A 1S5DD 2YU9A 2UXBH 1L0WA 4RMFA 1STBA 1AZPA 1K28A 4JI5Q 2VQDA 4HIOA 1R9TA 2F0KA 1PXUA 3V6KA 5IOCA 2X6GA 4B3SQ 1KDCA 3VDYA 1I4PA 1PH2A 4A3JH 4KN7C 3RB6A 3ORQA 1BNCA 3NSWA 4LSXA 5KG0A 4JOIA 1G6PA 3TIIA 4C3HB 1TWAH 3KHHA 2HDMA 3R3OA 3R93A 5IGBA 2J9GA 1EQQA 2RKSA 3J7AV 3VR4A 1C0AA 5A2QL 4WBNF 1VQ7A 4DV4Q 1QWYA 1KD1C 4BBSH 4LFBH 3I72A 1EQRA 2EY2A 3KLSX 3HOVH 3CCJA 2WB1B 2PZUA 2RHSB 2JA7A 4C5CA 1V4YA 2VQFH 5KFPA 1LTTD 5CA0F 4S3SA 2PVPA 3T1YQ 1V1PB 1FGUA 3OSNA 1HZ9A 3K80C 1SMYD 3VYRA 3KDFA 4MHEA 1MJEA 2K5DA 1S5BD 4PMCA 1E4EA 2W7OA 4FXDA 3C1EA 1F9PA 4AH6A 3K5OA 3IRBA 1YJ9A 1A0IA 2KOLA 4HEDA 4X62L 2RSOA 2N88A 1ENFA 1S9FA 4RGMA 4GKJH 2IHEA 1TKWB 1PHJA 1IW7D 2NN6H 2WKDA 2E5LH 2Q8RE 1DD2A 3KLRA 1UE7A 4KD4A 3TRZA 2IPKD 4YR2A 3PIO3 3T56B 2JJQA 1QOHA 3I55A 3K59A 4JPBW 5KYIA 2B39A 4NDXA 1MBYA 2WYOA 1HNWL 4JV5L 2M2LA 1CZGA 1WSCA 1Y14B 5LXTF 2JEGA 3DHQA 3TIGA 1WOCA 1PRTC 3C2PA 4LF7Q 4DR6L 3JRXA 1TWHH 3GO5A 1S3OA 2ATLA 4DAYB 4I7ZC 4P73A 4AYBA 2IP4A 1W6JA 5KFBA 1RTOA 5HV6A 1KJ9A 1TWCH 1AN7A 4OWWB 4A3FH 1GO3E 1L0XB 1L0YB 4L6TB 3RD4A 1PH1A 2KA7A 1PH7A 1V1QA 2RVLA 4G7ZC 1GSOA 2CVRA 1BUVT 3K0XA 2ZJQA 4GNXB 4BBRG 2E2HB 2QKIC 1TWAB 1SDFA 3TZUA 3GTPH 1HR0W 1DZ1A 2BCOA 2GVAA 2F0LA 3Q1KA 4XIGS 4ZUJA 4RFBA 1JE5A 1MHWC 4MV3A 3L3OC 5E1FA 1AE3A 2A8VA 4MA0A 2R92A 2UXBL 4X3SA 3J81L 3I4MG 2KBNA 3M9NB 4J9QA 2PMZA 3KAJA 4ZHQF 2NVTH 3OWEB 4TVAB 3PW2A 1UC8A 3NQTA 1N33L 4NXML 1CSQA 3ONAB 4X64L 2A74C 1QCBD 1I6HB 1E4EB 3RB0A 1B4OA 4GC6A 3GIJA 2RA4A 1KC8C 1CA5A 2R7ZB 3Q8PB 4GN4B 2NZOA 2AQ2B 1KRTA 1MI2A 5JH7F 1QNKA 4MV7A 5ELBA 1H9KA 3D4RA 1VQEA 2ENBA 1Q46A 2F4VQ 2R8GA 4LF4H 2JQOA 1XMOL 3SE0A 5JJZA 1Z9FA 4O4LF 4MV1A 1C9OA 2CQOA 2JA7G 4LF9L 5DAUA 3RV3A 3EIVA 4AQYH 3C0FB 3D31A 4EQ5A 1OXSC 5IGGA 1BXRA 1WCMA 1MSGA 1PTOD 3A8IE 3K7AB 4KTAA 1WI5A 3TP5A 5H1SE 2VPQA 1TU2B 1XNQL 2I5LX 1Q1EA 4GS3A 1HTLD 3J81E 2PNHA 1N32Q 1A2UA 2B2VA 5K36G 2YZGA 3VR2A 1F77A 2CH4A 1IZ6A 4KHVA 2L9HA 3KK7A 3V6JA 1RL2A 2AUKA 5IGFA 3MJFA 4BXXH 4Q8EA 3VYSA 2KJXA 3UDFA 4ECXA 2K14A 4K0KL 2MPMA 1QUQB 3HZXA 1M7JA 2R82A 5KNDA 4JI1H 4A3FB 1I94Q 2SCUB 3JSNA 3KHLA 2AU0A 1HZAA 2F0WA 1SE4A 1F9SA 3KHGA 3MWDA 1IHZA 4ZYSA 4YWKA 4XTCS 4DR1Q 3CC4A 3J80c 2P0AA 4K8IA 5KGUA 5C5LA 3KF8B 4P74A 2MUYA 2E2IB 3RR5A 2ASLA 3PUXA 1HNZQ 2F0GA 4P71A 1B7YB 3OHBA 3C46A 5IODA 5C1OA 3RLNA 4DV4L 4ALPA 1PYWD 3M4QA 2W7PA 4C2MB 2DJGC 5C0XJ 4DR3L 3PW5A 1FGBD 2Z0SA 3RTXA 4LAAA 1JCKB 2EXZA 2R8HA 1NSNS 2BA1A 2W8LA 2F0EA 3HOZB 3K8AA 4DK3C 2OWOA 1YHBA 2R6GA 1H95A 4RB0A 3I70A 4IPCA 2DN8A 2JA6B 3PF4A 2DY8A 4DUZH 1WTHA 1IBKL 1AE2A 3H94A 1Z2PX 1GUNA 2HDLA
chains in the Genus database with same CATH topology
2ZM6L 2UUBL 3M4PA 1PYSB 3UDGA 3KJOA 4HJ5A 2E2JH 4A3IH 1Q7YC 2Q2UA 2PMZE 5FJ8G 1SLJA 3CXCA 1A63A 1BKBA 2H5XA 5HY6A 5IYCH 1EFWA 4LF6L 1FJGL 4BA2I 5JJLA 1FVIA 4DUYQ 5GAHC 1T9HA 5IYCG 3H15A 1PH8A 1YHQA 1DGSA 2ASBA 3S1MH 1K3RA 4FDBA 1X3FA 1E3PA 2ALYB 2IT1A 5J3BA 4DAMA 3M3YH 3AEVA 3STBC 3I2ZA 4B3SL 3J7ZC 2UXCL 2F52A 2BH8A 3KF6A 1U0LA 1V9PA 3KYHC 1CSPA 3NBHB 4PG3A 2RF4A 5IYBH 4YHHQ 1NY4A 4DV0Q 4A3DH 5E7NA 4DUZQ 3H0GH 2HHHQ 3FKIG 1G291 4TQUS 5IT9c 1PH6A 1HR0Q 2YTVA 2A19A 4DV0L 3UDXA 1ASYA 1KXLA 1SR3A 1I6HH 1E22A 3CPFA 3RLFA 2VY3A 5FLXc 2YU9H 4LF6Q 1FJGQ 4JI3Q 1XJVA 4DUYL 4ME3A 3GDEA 3TS0A 2Q2IA 4IFDG 2R92H 4DNIA 3TS2A 3G71A 1SROA 3G4SA 1M1KC 3OTOQ 4LF4Q 4LFCL 2Z6KA 2UXDQ 1VQGA 1SN8A 4YWLA 1Q82C 2ATWA 1IBML 3OTOL 2YV5A 2KENA 4PZ8A 4R4OA 5IP7H 4QJFA 1VQKA 2MNAA 4AQYQ 1YHAA 4JCVE 1N34L 2OCEA 4JI1L 2E2HH 4X65Q 3ULPA 4JBMA 2IHFA 4GKJL 5AJ3Q 4X6AH 4JC0A 3CC2A 1JJ2A 1PFSA 4JI4Q 4DR4L 2IX0A 3BZKA 2BA0A 4DV2Q 1PH9A 5AJ3L 3HOZG 3G48A 2D0OA 5IYDH 1NE3A 2PI2E 4MZ9A 1VQ5A 2YTXA 1VQPA 2MFIA 2EXDA 3ZJYC 4LF5L 3F2CA 1HJPA 1I50H 3E9HA 1A8VA 1E7ZA 5JEAJ 1GD7A 1KAWA 3GTJH 4NXNQ 1VQJA 1Q1BA 1N33Q 3RNUA 4B3RQ 2V1CC 4JI2L 4YY3L 1KL9A 4R4IA 4X66L 4GNXA 1N34Q 1IXRA 2CKZB 4WJ3M 4R4QA 3TEHB 1U5KA 2QGQA 4X65L 5LMNW 1X65A 2XGTA 3TQYA 4YY3Q 4IFDJ 4OXPA 3CAMA 1QVCA 1N36Q 4DUZL 5M3FH 1HR0L 1IBLQ 1YZ6A 2YYZA 1QZGA 4JI7L 4NB3A 4HIMA 4A75A 1OXVA 2ZJPA 1K8GA 3F2DA 2I5MX 1SE8A 4OX9Q 5JJIA 3RLOA 3BU2A 1XPRA 4OO1G 4X62Q 2HIXA 1PV4A 4OX9L 2ES2A 1VQIA 5HGQA 1I3QH 4AYBE 4KHPQ 1HH2P 5FLMH 3HOXG 4B3RL 1X9NA 2WFWA 2UUAQ 3W1BA 3PUZA 4JI5L 5C3EG 2NVYH 4C2MH 2YTYA 2Z6KC 4DV1L 1VQNA 4DR5L 2MO1A 5C3EH 3PO2H 4B3ML 4B3TQ 1Z47A 2D0PA 3D0FA 3K7UC 5JEAG 1IL2A 4IOAA 1N36L 4Y52H 2ZTDA 3GTOH 3KLWA 2AWOA 1KHIA 4A3MH 1OXXK 3KF6B 1QVFA 3GTMH 1A62A 4LF8L 4LF7L 4WJ4A 1OXTA 3J81c 4JYAL 3HFZB 1YJWA 2EQSA 4A3BH 3NELA 3CCMA 5IWAQ 3S2DH 2CCZA 1TWGH 4DR5Q 2HIVA 2NN6G 4OWXB 3E9IA 3PV0A 4LUVA 3DLLA 1PA6A 4HJ9A 4QGUA 2UU9Q 2UXBQ 3JAMi 1WJJA 4LF5Q 5GQOA 4JI8Q 4JI6Q 1EYGA 1VQDA 3U4VA 2R93H 1L1OC 2JE6I 2LSSA 5GROA 1HZBA 4RG1A 4L5QA 3FHWA 1CUKA 4IO9A 3T1HQ 3T1YL 3M7NA 2R93G 4JG2A 3CCLA 3WWVA 2B3GA 2Y0SG 2KCTA 4DR7Q 1NMFA 2E2IH 3KDFB 1YJNA 2JA8H 1M90C 5EAYA 4DR4Q 3AYHB 2IY5B 4A76A 3PUYA 1K9MC 2HQLA 4LF8Q 1I5FA 3FP9A 1BBWA 4DR2L 2B63G 2K5HA 3K7AH 2JEBI 2B63H 1X3GA 1VQ4A 3UDIA 4A3GG 2VUMG 2WB1G 4JI0Q 4HJ8A 2VZAA 2ID0A 1JJGA 1GM5A 4UY8C 2JK8A 1W3SA 1VS0A 2VL6A 3CP0A 4NXNL 3AFPA 4BA1I 5LMNL 1Q8KA 4KI0A 2KHIA 2N3SA 1XMOQ 5GADC 1EUJA 1VQ8A 1MJCA 1UE6A 2OQ0A 3A0JA 2QA4A 1E1TA 5ELOA 4BBSG 1VQFA 2E5LL 1XNQQ 3I4NG 1MKHA 4A3KH 4DV1Q 3HKZG 4IPGA 1KIXA 1FL0A 2N49A 1LTLA 2ZTEA 1IBLL 3RN2A 1IYJB 1J5EL 4KLKA 3HKSA 4DV7L 3GTLH 1EIFA 2JA5H 2BH2A 2K50A 1K83H 4A3IG 1J5EQ 3S1QH 5FJ8H 3CMEA 1N9WA 4L5RC 4APVA 1JMCA 3HKZE 1JB7A 3Q8DA 4R1JA 1MIUA 4IOCA 3ICEA 1HNXQ 5C0XG 5M5YH 4GOPA 2CWPA 3K81C 3I4MH 1BVSA 1AH9A 1D8LA 1K0RA 1VQAA 2NN6I 4LWCA 3W5OA 5M5XH 2L15A 2AWNA 4L5TA 2E5LQ 3J80i 4DR1L 3PF5A 2LXKA 3J81j 4JI8L 4BY1G 1I94L 4NPSA 3G6EA 4LFBQ 4A93G 4QY7A 3JC66 3F8TA 4LFBL 3I56A 1N32L 4A3EG 4IFDI 1Q12A 2XTIA 3GTKH 3FKIH 4A3EH 3KJPA 4JBWA 4DV6Q 2JA7H 2F3IA 4JOIC 4GKKQ 2A1AA 2DUDA 4LW1A 1GVPA 1HNXL 3EBEA 4IJLA 4HIKA 3MEFA 3PGZA 2UUCL 3PO2G 3I7FA 3S1RH 2K5VA 1S72A 3OYYA 4A3CH 4YWMA 1VQMA 4QIWE 2R92G 3T1HL 4C3JH 4IPDA 4A3CG 2JA6H 2GN5A 4NXMQ 1SRUA 1NMGA 4R4TA 3CCVA 3CC7A 1IBKQ 1JJCB 3PSIA 1YITA 1LYLA 4GLVB 1VQ6A 1KQSA 3LGJA 4IPHA 5IP7G 3BJUA 1C7YA 2R7FA 3SGIA 2HT1A 4JV5Q 1WFQA 3HOYH 4BXXG 5C44G 1VQCA 1VQ9A 3PCOB 4DV6L 3CW2C 4L5SA 1GKHA 4YCUA 1VQOA 2K5NA 3STBD 4DR3Q 4JI3L 3ER0A 3JAMc 4GOPB 3TREA 1PYBA 4HJAA 4JBJA 5IYDG 4HJ7A 2VW9A 1PH3A 1VQHA 2CWAA 4RMFA 1L0WA 1EWIA 1IBMQ 1PVOA 5C0XI 3MXNB 4YHHL 1B70B 4JI5Q 4A4IA 4HIOA 4AYBG 3CCRA 3RZOH 4B3SQ 3VDYA 1PH2A 4A3JH 1UWVA 2JA9A 4A3GH 4YCVA 4GLXA 2KCMA 4DKAC 4JOIA 3L2PA 1G6PA 1TWAH 5C4XH 4OO1I 5C4XG 4LF4L 2B29A 1EQQA 4J15A 1HNZL 1C0AA 4KHPL 3M4OH 2VQEQ 4R4CA 1VQ7A 2CFMA 4DV4Q 1KD1C 1NJIC 3HOWH 4BBSH 3U58A 4K0KQ 2IX1A 2R7ZH 1EQRA 2LXJA 3HOVH 4A3KG 3CCJA 3CCQA 3PO3H 2R7ZG 2RHSB 2PQAB 2AMCB 1EIYB 3HOVG 3PO3G 5GAGC 2AHOB 4A3LH 3T1YQ 2ZJRA 4GOPC 1FGUA 4LNQA 3S17H 2RCNA 1HZ9A 4X64Q 5BR8L 3K80C 1X56A 4JBKA 2JEAI 3KDFA 3ERSX 1MJEA 1E1OA 1XNRL 2I0QA 1HNWQ 5BR8Q 2VQFQ 1QUQA 4GKJQ 1X3EA 1YI2A 4UP8A 5IWAL 3A5UA 4AH6A 1SFOH 2OTLA 2DGYA 3U4ZA 4BY7H 3CCSA 4DV2L 2MQHA 4A3MG 2VQEL 4DR6Q 4BY7G 3IRBA 1Q86C 1YJ9A 1A0IA 1X54A 2K75A 1R9TH 2PI2A 4AIMA 4X62L 1TWFH 2N78A 3PIPA 5IYBG 4A3DG 3I4OA 2Q2TA 1D7QA 4POFA 1UE5A 1XMQL 2RHQB 2IHEA 1L2FA 1YBYA 2K4KA 1PHJA 2GVBA 1UE7A 3TRZA 2MO0A 3H0GG 4JI2Q 1WCMG 2JJQA 3I55A 4DR2Q 1HNWL 3AFQA 4MTNA 2JA8G 4JV5L 1Y14B 4GN3B 2NZHA 4QL5A 1YVCA 1WOCA 5IP9H 4JI0L 1CKNA 4LF7Q 4LUOA 4DR6L 5IP9G 1HZCA 1TWHH 3GO5A 1S3OA 4JI7Q 4DAYB 4QQBX 1V43A 4P73A 4PZ6A 1G51A 1K8AC 3L0OA 2UUAL 1KRSA 4C3IH 1CKNB 1QZHA 3UE0A 4UP9A 2UU9L 3S16H 1XTDA 1XMQQ 3E0EA 4H02A 4B3TL 4B3MQ 4A3FG 2VUMH 5IE8A 2UXCQ 3F1ZA 1TWCH 4OWWB 3CPWA 1SMXA 1TXYA 4A3FH 1GO3E 3PUVA 1PH1A 4YCWA 1PH5A 2I5HA 1PH7A 1V1QA 3H3VI 2OQKA 2Y0SE 3BZCA 4PMWA 5C44H 1VQLA 4BBRH 3K0XA 4UP7A 5M3MH 2ZJQA 4POGA 4GNXB 3M9BA 1Y1VG 4BBRG 5M3MG 3HOZH 1XPOA 4P72A 1PH4A 3ULLA 3GTPH 3ULJA 4DV3Q 1HR0W 3CMAA 1XNRQ 2Q2HA 2GVAA 2FXQA 4XIGS 1J6QA 4DV3L 2JA5G 3GTGH 1JE5A 1OTCA 3J81i 5ELNA 3OW2A 1E24A 1WYDA 4JI6L 4GKKL 1AE3A 2A8VA 3J7A5 5JJKA 1NTGA 1YNXA 2UXBL 1EOVA 2E8GA 4MNOA 3I4MG 2KBNA 4A3JG 4DR7L 4OONA 2D62A 1QVGA 2NVTH 4TVAB 1Q81C 1K73C 1N33L 4NXML 1CSQA 4X64L 4IJHA 4PZ7A 4DPGA 1S40A 3UE1A 1YEZA 2VS1A 3CCUA 3F2BA 2EIFA 1KC8C 2VQFL 4A93H 4BY1H 5IY0A 3U50C 5LMUL 2R7DA 4GN4B 1OXUA 2NZOA 1KRTA 3AQQA 4DV7Q 4LFAQ 3HOXH 1VQEA 1Q46A 1X55A 1N8RC 2F4VQ 2JQOA 3DM3A 1XMOL 1Z9FA 4C3HH 4A3LG 1X6OA 1C9OA 2CQOA 2K52A 3L7ZC 3A5ZB 2JA7G 4P75A 4LF9L 3S1NH 2VNUD 3EIVA 2KHJA 3D31A 4EQ5A 1OXSC 4LF9Q 5H1SE 1WI5A 3H3VH 1XNQL 2I5LX 2JA6G 1Q1EA 4GS3A 2PNHA 1BBUA 4A3BG 1N32Q 4LFAL 1B8AA 5K36G 1YIJA 1O7IA 1UEBA 4GN5A 1IZ6A 2F4VL 5DLQE 3KOJA 3RN5A 1RL2A 3HOUH 4LUZA 3HOYG 1Y1WG 4UPAA 3S15H 4EX5A 3CF5A 4BXXH 4JYAQ 5LMNQ 3RZDH 1CKOA 1LM0A 4Y7NH 3UDFA 3M85A 2ZTCA 1Y1WH 2K14A 3EN2A 4GLAC 4LFCQ 4K0KL 2UXDL 1WCMH 1QUQB 5GAEC 1I94Q 3S2HH 1HZAA 2WP8J 4AQYL 1JT8A 4DV5Q 3W1GA 3A74A 4XTCS 4YWKA 4KHZA 3J80c 4DR1Q 3GD7A 3CC4A 1VQBA 4DK6C 3CD6A 4DV5L 3KF8B 4P74A 1P8LA 3RR5A 2PQAA 2WAQE 3S14H 3PUXA 2WAQG 1HNZQ 3PUWA 4P71A 2UUCQ 4OWTB 1NBWA 1B7YB 3NENA 1L1OA 3RLNA 4DV4L 4ALPA 3CCEA 5LMUQ 2OTJA 3M4QA 2N8NA 4O0AA 4O2DA 5C0XJ 1W2BA 4DR3L 5M3FG 1ASZA 4HIDA 2Z0SA 3B6YA 4GNXC 1L1OB 3NEMA 3HOWG 3S24A 3GTQH 2BA1A 1VCIA 1UE1A 1RIPA 2WB1E 5C4JH 3HOUG 1P16A 3K8AA 4DK3C 1YHBA 2AKWB 2R6GA 2OWOA 2NVXH 4JI1Q 1H95A 2NVQH 3I4NH 5M5WH 1Y1VH 2QEXA 4IPCA 3CQZH 3PIOA 3KFUA 4X66Q 3PF4A 1CKMA 5FLMG 4JI4L 2ZM6Q 2UUBQ 1IBKL 1AE2A 1LUZA 1XPUA 2HHHL 2C35B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 L;  2UUB L;  3M4P A;  1PYS B;  3UDG A;  3KJO A;  4HJ5 A;  2E2J H;  4A3I H;  1Q7Y C;  2Q2U A;  2PMZ E;  5FJ8 G;  1SLJ A;  3CXC A;  1A63 A;  1BKB A;  2H5X A;  5HY6 A;  5IYC H;  1EFW A;  4LF6 L;  1FJG L;  4BA2 I;  5JJL A;  1FVI A;  4DUY Q;  5GAH C;  1T9H A;  5IYC G;  3H15 A;  1PH8 A;  1YHQ A;  1DGS A;  2ASB A;  3S1M H;  1K3R A;  4FDB A;  1X3F A;  1E3P A;  2ALY B;  2IT1 A;  5J3B A;  4DAM A;  3M3Y H;  3AEV A;  3STB C;  3I2Z A;  4B3S L;  3J7Z C;  2UXC L;  2F52 A;  2BH8 A;  3KF6 A;  1U0L A;  1V9P A;  3KYH C;  1CSP A;  3NBH B;  4PG3 A;  2RF4 A;  5IYB H;  4YHH Q;  1NY4 A;  4DV0 Q;  4A3D H;  5E7N A;  4DUZ Q;  3H0G H;  2HHH Q;  3FKI G;  1G29 1;  4TQU S;  5IT9 c;  1PH6 A;  1HR0 Q;  2YTV A;  2A19 A;  4DV0 L;  3UDX A;  1ASY A;  1KXL A;  1SR3 A;  1I6H H;  1E22 A;  3CPF A;  3RLF A;  2VY3 A;  5FLX c;  2YU9 H;  4LF6 Q;  1FJG Q;  4JI3 Q;  1XJV A;  4DUY L;  4ME3 A;  3GDE A;  3TS0 A;  2Q2I A;  4IFD G;  2R92 H;  4DNI A;  3TS2 A;  3G71 A;  1SRO A;  3G4S A;  1M1K C;  3OTO Q;  4LF4 Q;  4LFC L;  2Z6K A;  2UXD Q;  1VQG A;  1SN8 A;  4YWL A;  1Q82 C;  2ATW A;  1IBM L;  3OTO L;  2YV5 A;  2KEN A;  4PZ8 A;  4R4O A;  5IP7 H;  4QJF A;  1VQK A;  2MNA A;  4AQY Q;  1YHA A;  4JCV E;  1N34 L;  2OCE A;  4JI1 L;  2E2H H;  4X65 Q;  3ULP A;  4JBM A;  2IHF A;  4GKJ L;  5AJ3 Q;  4X6A H;  4JC0 A;  3CC2 A;  1JJ2 A;  1PFS A;  4JI4 Q;  4DR4 L;  2IX0 A;  3BZK A;  2BA0 A;  4DV2 Q;  1PH9 A;  5AJ3 L;  3HOZ G;  3G48 A;  2D0O A;  5IYD H;  1NE3 A;  2PI2 E;  4MZ9 A;  1VQ5 A;  2YTX A;  1VQP A;  2MFI A;  2EXD A;  3ZJY C;  4LF5 L;  3F2C A;  1HJP A;  1I50 H;  3E9H A;  1A8V A;  1E7Z A;  5JEA J;  1GD7 A;  1KAW A;  3GTJ H;  4NXN Q;  1VQJ A;  1Q1B A;  1N33 Q;  3RNU A;  4B3R Q;  2V1C C;  4JI2 L;  4YY3 L;  1KL9 A;  4R4I A;  4X66 L;  4GNX A;  1N34 Q;  1IXR A;  2CKZ B;  4WJ3 M;  4R4Q A;  3TEH B;  1U5K A;  2QGQ A;  4X65 L;  5LMN W;  1X65 A;  2XGT A;  3TQY A;  4YY3 Q;  4IFD J;  4OXP A;  3CAM A;  1QVC A;  1N36 Q;  4DUZ L;  5M3F H;  1HR0 L;  1IBL Q;  1YZ6 A;  2YYZ A;  1QZG A;  4JI7 L;  4NB3 A;  4HIM A;  4A75 A;  1OXV A;  2ZJP A;  1K8G A;  3F2D A;  2I5M X;  1SE8 A;  4OX9 Q;  5JJI A;  3RLO A;  3BU2 A;  1XPR A;  4OO1 G;  4X62 Q;  2HIX A;  1PV4 A;  4OX9 L;  2ES2 A;  1VQI A;  5HGQ A;  1I3Q H;  4AYB E;  4KHP Q;  1HH2 P;  5FLM H;  3HOX G;  4B3R L;  1X9N A;  2WFW A;  2UUA Q;  3W1B A;  3PUZ A;  4JI5 L;  5C3E G;  2NVY H;  4C2M H;  2YTY A;  2Z6K C;  4DV1 L;  1VQN A;  4DR5 L;  2MO1 A;  5C3E H;  3PO2 H;  4B3M L;  4B3T Q;  1Z47 A;  2D0P A;  3D0F A;  3K7U C;  5JEA G;  1IL2 A;  4IOA A;  1N36 L;  4Y52 H;  2ZTD A;  3GTO H;  3KLW A;  2AWO A;  1KHI A;  4A3M H;  1OXX K;  3KF6 B;  1QVF A;  3GTM H;  1A62 A;  4LF8 L;  4LF7 L;  4WJ4 A;  1OXT A;  3J81 c;  4JYA L;  3HFZ B;  1YJW A;  2EQS A;  4A3B H;  3NEL A;  3CCM A;  5IWA Q;  3S2D H;  2CCZ A;  1TWG H;  4DR5 Q;  2HIV A;  2NN6 G;  4OWX B;  3E9I A;  3PV0 A;  4LUV A;  3DLL A;  1PA6 A;  4HJ9 A;  4QGU A;  2UU9 Q;  2UXB Q;  3JAM i;  1WJJ A;  4LF5 Q;  5GQO A;  4JI8 Q;  4JI6 Q;  1EYG A;  1VQD A;  3U4V A;  2R93 H;  1L1O C;  2JE6 I;  2LSS A;  5GRO A;  1HZB A;  4RG1 A;  4L5Q A;  3FHW A;  1CUK A;  4IO9 A;  3T1H Q;  3T1Y L;  3M7N A;  2R93 G;  4JG2 A;  3CCL A;  3WWV A;  2B3G A;  2Y0S G;  2KCT A;  4DR7 Q;  1NMF A;  2E2I H;  3KDF B;  1YJN A;  2JA8 H;  1M90 C;  5EAY A;  4DR4 Q;  3AYH B;  2IY5 B;  4A76 A;  3PUY A;  1K9M C;  2HQL A;  4LF8 Q;  1I5F A;  3FP9 A;  1BBW A;  4DR2 L;  2B63 G;  2K5H A;  3K7A H;  2JEB I;  2B63 H;  1X3G A;  1VQ4 A;  3UDI A;  4A3G G;  2VUM G;  2WB1 G;  4JI0 Q;  4HJ8 A;  2VZA A;  2ID0 A;  1JJG A;  1GM5 A;  4UY8 C;  2JK8 A;  1W3S A;  1VS0 A;  2VL6 A;  3CP0 A;  4NXN L;  3AFP A;  4BA1 I;  5LMN L;  1Q8K A;  4KI0 A;  2KHI A;  2N3S A;  1XMO Q;  5GAD C;  1EUJ A;  1VQ8 A;  1MJC A;  1UE6 A;  2OQ0 A;  3A0J A;  2QA4 A;  1E1T A;  5ELO A;  4BBS G;  1VQF A;  2E5L L;  1XNQ Q;  3I4N G;  1MKH A;  4A3K H;  4DV1 Q;  3HKZ G;  4IPG A;  1KIX A;  1FL0 A;  2N49 A;  1LTL A;  2ZTE A;  1IBL L;  3RN2 A;  1IYJ B;  1J5E L;  4KLK A;  3HKS A;  4DV7 L;  3GTL H;  1EIF A;  2JA5 H;  2BH2 A;  2K50 A;  1K83 H;  4A3I G;  1J5E Q;  3S1Q H;  5FJ8 H;  3CME A;  1N9W A;  4L5R C;  4APV A;  1JMC A;  3HKZ E;  1JB7 A;  3Q8D A;  4R1J A;  1MIU A;  4IOC A;  3ICE A;  1HNX Q;  5C0X G;  5M5Y H;  4GOP A;  2CWP A;  3K81 C;  3I4M H;  1BVS A;  1AH9 A;  1D8L A;  1K0R A;  1VQA A;  2NN6 I;  4LWC A;  3W5O A;  5M5X H;  2L15 A;  2AWN A;  4L5T A;  2E5L Q;  3J80 i;  4DR1 L;  3PF5 A;  2LXK A;  3J81 j;  4JI8 L;  4BY1 G;  1I94 L;  4NPS A;  3G6E A;  4LFB Q;  4A93 G;  4QY7 A;  3JC6 6;  3F8T A;  4LFB L;  3I56 A;  1N32 L;  4A3E G;  4IFD I;  1Q12 A;  2XTI A;  3GTK H;  3FKI H;  4A3E H;  3KJP A;  4JBW A;  4DV6 Q;  2JA7 H;  2F3I A;  4JOI C;  4GKK Q;  2A1A A;  2DUD A;  4LW1 A;  1GVP A;  1HNX L;  3EBE A;  4IJL A;  4HIK A;  3MEF A;  3PGZ A;  2UUC L;  3PO2 G;  3I7F A;  3S1R H;  2K5V A;  1S72 A;  3OYY A;  4A3C H;  4YWM A;  1VQM A;  4QIW E;  2R92 G;  3T1H L;  4C3J H;  4IPD A;  4A3C G;  2JA6 H;  2GN5 A;  4NXM Q;  1SRU A;  1NMG A;  4R4T A;  3CCV A;  3CC7 A;  1IBK Q;  1JJC B;  3PSI A;  1YIT A;  1LYL A;  4GLV B;  1VQ6 A;  1KQS A;  3LGJ A;  4IPH A;  5IP7 G;  3BJU A;  1C7Y A;  2R7F A;  3SGI A;  2HT1 A;  4JV5 Q;  1WFQ A;  3HOY H;  4BXX G;  5C44 G;  1VQC A;  1VQ9 A;  3PCO B;  4DV6 L;  3CW2 C;  4L5S A;  1GKH A;  4YCU A;  1VQO A;  2K5N A;  3STB D;  4DR3 Q;  4JI3 L;  3ER0 A;  3JAM c;  4GOP B;  3TRE A;  1PYB A;  4HJA A;  4JBJ A;  5IYD G;  4HJ7 A;  2VW9 A;  1PH3 A;  1VQH A;  2CWA A;  4RMF A;  1L0W A;  1EWI A;  1IBM Q;  1PVO A;  5C0X I;  3MXN B;  4YHH L;  1B70 B;  4JI5 Q;  4A4I A;  4HIO A;  4AYB G;  3CCR A;  3RZO H;  4B3S Q;  3VDY A;  1PH2 A;  4A3J H;  1UWV A;  2JA9 A;  4A3G H;  4YCV A;  4GLX A;  2KCM A;  4DKA C;  4JOI A;  3L2P A;  1G6P A;  1TWA H;  5C4X H;  4OO1 I;  5C4X G;  4LF4 L;  2B29 A;  1EQQ A;  4J15 A;  1HNZ L;  1C0A A;  4KHP L;  3M4O H;  2VQE Q;  4R4C A;  1VQ7 A;  2CFM A;  4DV4 Q;  1KD1 C;  1NJI C;  3HOW H;  4BBS H;  3U58 A;  4K0K Q;  2IX1 A;  2R7Z H;  1EQR A;  2LXJ A;  3HOV H;  4A3K G;  3CCJ A;  3CCQ A;  3PO3 H;  2R7Z G;  2RHS B;  2PQA B;  2AMC B;  1EIY B;  3HOV G;  3PO3 G;  5GAG C;  2AHO B;  4A3L H;  3T1Y Q;  2ZJR A;  4GOP C;  1FGU A;  4LNQ A;  3S17 H;  2RCN A;  1HZ9 A;  4X64 Q;  5BR8 L;  3K80 C;  1X56 A;  4JBK A;  2JEA I;  3KDF A;  3ERS X;  1MJE A;  1E1O A;  1XNR L;  2I0Q A;  1HNW Q;  5BR8 Q;  2VQF Q;  1QUQ A;  4GKJ Q;  1X3E A;  1YI2 A;  4UP8 A;  5IWA L;  3A5U A;  4AH6 A;  1SFO H;  2OTL A;  2DGY A;  3U4Z A;  4BY7 H;  3CCS A;  4DV2 L;  2MQH A;  4A3M G;  2VQE L;  4DR6 Q;  4BY7 G;  3IRB A;  1Q86 C;  1YJ9 A;  1A0I A;  1X54 A;  2K75 A;  1R9T H;  2PI2 A;  4AIM A;  4X62 L;  1TWF H;  2N78 A;  3PIP A;  5IYB G;  4A3D G;  3I4O A;  2Q2T A;  1D7Q A;  4POF A;  1UE5 A;  1XMQ L;  2RHQ B;  2IHE A;  1L2F A;  1YBY A;  2K4K A;  1PHJ A;  2GVB A;  1UE7 A;  3TRZ A;  2MO0 A;  3H0G G;  4JI2 Q;  1WCM G;  2JJQ A;  3I55 A;  4DR2 Q;  1HNW L;  3AFQ A;  4MTN A;  2JA8 G;  4JV5 L;  1Y14 B;  4GN3 B;  2NZH A;  4QL5 A;  1YVC A;  1WOC A;  5IP9 H;  4JI0 L;  1CKN A;  4LF7 Q;  4LUO A;  4DR6 L;  5IP9 G;  1HZC A;  1TWH H;  3GO5 A;  1S3O A;  4JI7 Q;  4DAY B;  4QQB X;  1V43 A;  4P73 A;  4PZ6 A;  1G51 A;  1K8A C;  3L0O A;  2UUA L;  1KRS A;  4C3I H;  1CKN B;  1QZH A;  3UE0 A;  4UP9 A;  2UU9 L;  3S16 H;  1XTD A;  1XMQ Q;  3E0E A;  4H02 A;  4B3T L;  4B3M Q;  4A3F G;  2VUM H;  5IE8 A;  2UXC Q;  3F1Z A;  1TWC H;  4OWW B;  3CPW A;  1SMX A;  1TXY A;  4A3F H;  1GO3 E;  3PUV A;  1PH1 A;  4YCW A;  1PH5 A;  2I5H A;  1PH7 A;  1V1Q A;  3H3V I;  2OQK A;  2Y0S E;  3BZC A;  4PMW A;  5C44 H;  1VQL A;  4BBR H;  3K0X A;  4UP7 A;  5M3M H;  2ZJQ A;  4POG A;  4GNX B;  3M9B A;  1Y1V G;  4BBR G;  5M3M G;  3HOZ H;  1XPO A;  4P72 A;  1PH4 A;  3ULL A;  3GTP H;  3ULJ A;  4DV3 Q;  1HR0 W;  3CMA A;  1XNR Q;  2Q2H A;  2GVA A;  2FXQ A;  4XIG S;  1J6Q A;  4DV3 L;  2JA5 G;  3GTG H;  1JE5 A;  1OTC A;  3J81 i;  5ELN A;  3OW2 A;  1E24 A;  1WYD A;  4JI6 L;  4GKK L;  1AE3 A;  2A8V A;  3J7A 5;  5JJK A;  1NTG A;  1YNX A;  2UXB L;  1EOV A;  2E8G A;  4MNO A;  3I4M G;  2KBN A;  4A3J G;  4DR7 L;  4OON A;  2D62 A;  1QVG A;  2NVT H;  4TVA B;  1Q81 C;  1K73 C;  1N33 L;  4NXM L;  1CSQ A;  4X64 L;  4IJH A;  4PZ7 A;  4DPG A;  1S40 A;  3UE1 A;  1YEZ A;  2VS1 A;  3CCU A;  3F2B A;  2EIF A;  1KC8 C;  2VQF L;  4A93 H;  4BY1 H;  5IY0 A;  3U50 C;  5LMU L;  2R7D A;  4GN4 B;  1OXU A;  2NZO A;  1KRT A;  3AQQ A;  4DV7 Q;  4LFA Q;  3HOX H;  1VQE A;  1Q46 A;  1X55 A;  1N8R C;  2F4V Q;  2JQO A;  3DM3 A;  1XMO L;  1Z9F A;  4C3H H;  4A3L G;  1X6O A;  1C9O A;  2CQO A;  2K52 A;  3L7Z C;  3A5Z B;  2JA7 G;  4P75 A;  4LF9 L;  3S1N H;  2VNU D;  3EIV A;  2KHJ A;  3D31 A;  4EQ5 A;  1OXS C;  4LF9 Q;  5H1S E;  1WI5 A;  3H3V H;  1XNQ L;  2I5L X;  2JA6 G;  1Q1E A;  4GS3 A;  2PNH A;  1BBU A;  4A3B G;  1N32 Q;  4LFA L;  1B8A A;  5K36 G;  1YIJ A;  1O7I A;  1UEB A;  4GN5 A;  1IZ6 A;  2F4V L;  5DLQ E;  3KOJ A;  3RN5 A;  1RL2 A;  3HOU H;  4LUZ A;  3HOY G;  1Y1W G;  4UPA A;  3S15 H;  4EX5 A;  3CF5 A;  4BXX H;  4JYA Q;  5LMN Q;  3RZD H;  1CKO A;  1LM0 A;  4Y7N H;  3UDF A;  3M85 A;  2ZTC A;  1Y1W H;  2K14 A;  3EN2 A;  4GLA C;  4LFC Q;  4K0K L;  2UXD L;  1WCM H;  1QUQ B;  5GAE C;  1I94 Q;  3S2H H;  1HZA A;  2WP8 J;  4AQY L;  1JT8 A;  4DV5 Q;  3W1G A;  3A74 A;  4XTC S;  4YWK A;  4KHZ A;  3J80 c;  4DR1 Q;  3GD7 A;  3CC4 A;  1VQB A;  4DK6 C;  3CD6 A;  4DV5 L;  3KF8 B;  4P74 A;  1P8L A;  3RR5 A;  2PQA A;  2WAQ E;  3S14 H;  3PUX A;  2WAQ G;  1HNZ Q;  3PUW A;  4P71 A;  2UUC Q;  4OWT B;  1NBW A;  1B7Y B;  3NEN A;  1L1O A;  3RLN A;  4DV4 L;  4ALP A;  3CCE A;  5LMU Q;  2OTJ A;  3M4Q A;  2N8N A;  4O0A A;  4O2D A;  5C0X J;  1W2B A;  4DR3 L;  5M3F G;  1ASZ A;  4HID A;  2Z0S A;  3B6Y A;  4GNX C;  1L1O B;  3NEM A;  3HOW G;  3S24 A;  3GTQ H;  2BA1 A;  1VCI A;  1UE1 A;  1RIP A;  2WB1 E;  5C4J H;  3HOU G;  1P16 A;  3K8A A;  4DK3 C;  1YHB A;  2AKW B;  2R6G A;  2OWO A;  2NVX H;  4JI1 Q;  1H95 A;  2NVQ H;  3I4N H;  5M5W H;  1Y1V H;  2QEX A;  4IPC A;  3CQZ H;  3PIO A;  3KFU A;  4X66 Q;  3PF4 A;  1CKM A;  5FLM G;  4JI4 L;  2ZM6 Q;  2UUB Q;  1IBK L;  1AE2 A;  1LUZ A;  1XPU A;  2HHH L;  2C35 B; 
#chains in the Genus database with same CATH topology
 5K5P A;  2F0Q A;  3M4P A;  5KFN A;  3UDG A;  4HJ5 A;  1A63 A;  1A15 A;  4A3I H;  1Q7Y C;  5KFG A;  1H9M A;  1S4Z A;  4QUC A;  2H5X A;  5DG7 A;  1DV1 A;  1FVI A;  3VPD A;  3P75 A;  5M5W B;  1YHQ A;  2HHH H;  1K3R A;  4FDB A;  1TA8 A;  4IRC A;  1ZQ7 A;  2AQ1 B;  1KAA A;  2IT1 A;  5J3B A;  5T1I A;  2Q8I B;  4DGZ A;  3M3Y H;  4Q5V A;  2F52 A;  2W9C B;  3PW4 A;  3ND9 A;  1U0L A;  3KYH C;  4K2K A;  5KFU A;  4DV0 Q;  1BCP F;  4DR4 H;  3HOY B;  1GSH A;  5IT9 c;  1IYV A;  3GIQ A;  5DQI A;  3DM1 A;  3RUZ A;  3BYY B;  4NKL A;  3CPF A;  3RLF A;  2VY3 A;  2HUG A;  4C3H G;  1Q3L A;  4C1N K;  3H3V C;  5L1L A;  2Z4H A;  5KT7 A;  3GDE A;  1K1S A;  1TAE A;  1TWC A;  1DM0 B;  3G4S A;  1M1K C;  3KAL A;  2PYK A;  1QG7 A;  5KFH A;  2UXD Q;  4AYB B;  4YWL A;  4ZKC B;  1XMO H;  5KFX A;  1BXT A;  1RJT A;  2NB0 A;  3OTO L;  1GUW A;  4QJF A;  2MNA A;  4AQY Q;  5M3M B;  3QFF A;  1HHV A;  3GTP A;  2C5C A;  3N44 B;  1EEF D;  2QEJ C;  1CE8 A;  4DV0 H;  3SVM A;  3EPI A;  5AJ3 Q;  4Q44 A;  1JJ2 A;  5I2Y A;  2GPW A;  3GP7 A;  2IX0 A;  5EPL A;  4IN3 A;  5KG4 A;  4M1U B;  1MGS A;  5AJ3 L;  5E3F A;  2AQ4 A;  1NE3 A;  5EKL A;  3QOJ A;  1RK6 A;  2RDG A;  4MZ9 A;  4DL4 A;  4GZY C;  1EHI A;  2KEE A;  1CQV A;  1I50 H;  3S1R B;  4ZK9 B;  2KUM A;  3GTJ H;  5L1I A;  1PFB A;  1Q1B A;  1N33 Q;  2LMC B;  3WNZ A;  5CA1 F;  1KL9 A;  3N52 A;  4R4I A;  1ZYR D;  2YYA A;  2JA8 B;  2CKZ B;  4R4Q A;  1KBL A;  2QGQ A;  4X65 L;  4CBV A;  1X65 A;  5JVG 3;  4G4K A;  1WCM B;  5KT3 A;  2MCT A;  2Q8T A;  2ICI A;  1II3 A;  3CAM A;  2NU8 B;  1PRT F;  1V1P A;  5LA6 F;  4B3R H;  3HOX B;  4IWX A;  4J9R A;  1IBL Q;  1S5E D;  1RCV D;  4NB3 A;  1HNZ H;  4CGY B;  4OX9 Q;  5LMU H;  1XPR A;  4G3I A;  4X62 Q;  1PV4 A;  1AUV A;  1I4G A;  4OX9 L;  5HGQ A;  4TV8 F;  2B63 A;  1HH2 P;  3FDT A;  3HOX G;  4UCR A;  4HNU A;  1X9N A;  3W1B A;  5KKN B;  2NVY H;  1DYQ A;  2Z6K C;  2NBF A;  4FNF A;  5C3E H;  4B3T Q;  3KAK A;  2FLL A;  4DR7 H;  3NUC A;  3K7U C;  5JEA G;  5A2Q E;  1KJQ A;  1UNN C;  2AWO A;  1KHI A;  4A3M H;  1IYU A;  2ASJ A;  3KF6 B;  3LP8 A;  1L2Z A;  1B33 N;  1I3Q B;  3S15 B;  1CHQ D;  3J81 c;  1YJW A;  5DGA A;  1TWG H;  1NR4 A;  2F0O A;  5ISR A;  1C48 A;  4X62 H;  1PA6 A;  2A5H A;  4HJ9 A;  1FD7 D;  1U4L A;  3MTS A;  3IAY A;  3MA2 B;  4DXG A;  1RHP A;  1DIK A;  2R7L A;  1CA6 A;  1VQD A;  1EYG A;  3NPP A;  1L1O C;  3Q8Q B;  4MV8 A;  4IO9 A;  2B2V C;  1S5C D;  4KY6 A;  5FO8 B;  3T1H Q;  2ZXR A;  3DEO A;  2F03 A;  1EQT A;  4FO2 A;  4KKT A;  1I4R A;  2JA8 H;  1BO0 A;  3OSO A;  3F2U A;  4DR4 Q;  1A3U A;  1SND A;  1K9M C;  4IFD H;  3FPU B;  3I4M B;  1BBW A;  4DR2 L;  3K7A H;  1UUP A;  1VBG A;  1VQ4 A;  1DJR D;  3T16 A;  1SSO A;  2QW7 A;  2VUM G;  1PTO H;  2VZA A;  3I4L A;  1G8Z D;  3BVZ A;  4XYO A;  5C3W A;  4UY8 C;  2B8F A;  1EFI D;  2Z9H A;  1Q8K A;  4Z9C B;  4IUU A;  2N3S A;  1XMO Q;  2B2Y C;  1EUJ A;  2IW3 A;  3Q23 A;  1MJC A;  3GTO A;  4WOR A;  4A3B B;  4CKE A;  3I4N G;  3SK4 A;  3CVZ A;  4J9S A;  3OW7 A;  5M9O A;  4DV1 Q;  2XVS A;  5J2T F;  3HKZ G;  1RTN A;  1FL0 A;  1OO9 B;  2EYP A;  2N49 A;  1CQJ B;  2NVY A;  3D4D A;  3VMM A;  3HP3 A;  5LHY 1;  2FIN B;  4XDX A;  4ZAI A;  4ILW A;  3GTL H;  1CTM A;  3CRL C;  4UCU A;  4IHJ F;  3RB4 A;  3HG9 A;  4GKK H;  2K33 A;  1JMC A;  3HKZ E;  1M0T A;  4IOC A;  5EWE A;  4F4Y A;  4DN4 M;  1AH9 A;  1D8L A;  2RDF A;  5IYZ F;  4J9K A;  4CJ1 B;  5CC4 A;  3PF5 A;  2UVU A;  4BY1 G;  1I94 L;  1HTP A;  4QY7 A;  3H40 A;  3VPC A;  3F8T A;  2OT2 A;  3I56 A;  4OO1 H;  4ED0 A;  4A3E G;  2EY6 A;  1NUC A;  2K05 A;  2XTI A;  3GTK H;  2FK2 A;  3RJ0 A;  1TWG B;  4GKK Q;  2DUD A;  5IT9 E;  4TV9 F;  3U9T A;  1KNA A;  1HNX L;  4A3I B;  4KMU C;  2K5V A;  2AGQ A;  4LJZ C;  1SE2 A;  1IBM H;  1CHP D;  3T1H L;  4MV4 A;  4ECW A;  5DEH A;  4C3I G;  3CC7 A;  5KFZ A;  3PSI A;  2UVR A;  1AEX A;  2KED A;  2JA5 A;  3RZD B;  5IT9 W;  1C7Y A;  2R7F A;  5EKI A;  5I9P A;  1SAP A;  5KT5 A;  3HOY H;  1VQC A;  3PCO B;  2R93 A;  4L5S A;  3BA8 A;  4RGN A;  4KY5 A;  1A2T A;  2NVT B;  1PTO B;  2NWG A;  4DR3 Q;  1WTV A;  1EY5 A;  3K5I A;  3N40 P;  3TRE A;  4PNY A;  3K3V A;  4B3S H;  4HJ7 A;  2L0C A;  1ENA A;  1EWI A;  1HFN A;  5C4H A;  1IBM Q;  1PVO A;  4M7E A;  5K2M A;  3TZD A;  1HUM A;  1A6X A;  5D1P A;  5KG1 A;  4L63 B;  4ID6 A;  4B9X A;  3GTM A;  3NTI A;  3ETH A;  3H4B A;  3QIA A;  5L1J A;  1UWV A;  4NP5 A;  2JA9 A;  2JEI A;  4A3G H;  4YCV A;  4DKA C;  3L2P A;  3I90 A;  5KX5 F;  1R4Q B;  2J6U A;  3NQI A;  1BF4 A;  1BGW A;  4KHP L;  3M4O H;  5I4D A;  4R4C A;  3HOW H;  1STN A;  1Y1W B;  1G6Z A;  2B2U A;  3ORR A;  2FPP B;  2IX1 A;  2R7Z H;  3V4S A;  2O5J C;  2EJF C;  1EL0 A;  4A3J B;  2RDI A;  3PO3 G;  3G6Y A;  5GAG C;  2G5D A;  3BDL A;  2SDF A;  4JW0 A;  3QZ8 A;  4JI2 H;  3QR8 A;  4RA8 A;  3E3X A;  3GTQ A;  3HEJ A;  3S17 H;  1AUX A;  4EFE A;  5LOV F;  2DPJ A;  5FK9 C;  2JEA I;  3N6R A;  1XNR L;  4EBE A;  2I0Q A;  1HNW Q;  2VQF Q;  4GKJ Q;  2R92 B;  1JXL A;  3A5U A;  3AU7 A;  1XDN A;  3U4Z A;  4BY7 H;  4RCN A;  2VQE L;  4A3M G;  3KBG A;  1JOK A;  2K75 A;  2EYO A;  1R9T H;  4AIM A;  1TWF H;  2N78 A;  5K36 H;  1XMQ H;  5E4X A;  3I4O A;  1TII D;  5NUC A;  4POF A;  4HR7 A;  1OWT A;  1L2F A;  1YBY A;  2BOS A;  5I9O A;  4JUZ A;  2BQR A;  2GLT A;  3DWA A;  2F4V H;  3S16 B;  1PFM A;  2K01 A;  3M7G A;  4DR2 Q;  5LP6 F;  5EGT A;  3VA7 A;  4MTD A;  4MTN A;  2M00 A;  3AFQ A;  1O80 A;  2NZH A;  1YVC A;  4WRD A;  4MIU A;  4LUO A;  1S0N A;  2EYF A;  2W6Q A;  4CKC A;  2HVQ A;  5JPN C;  2F0I A;  1SYG A;  5EKK A;  1XMQ Q;  3NTH A;  1T36 A;  1N32 H;  4B3M Q;  3GTG B;  3F1Z A;  1SMX A;  5EWF A;  1FNV A;  3T13 A;  4XQN A;  3C1F A;  3OMC A;  2I5H A;  3H3V I;  3ND8 A;  4IUV A;  2C2R A;  4PMW A;  2HJW A;  4QWE A;  2I07 B;  5M3F B;  4UP7 A;  1JC7 A;  3FKI A;  1Y1V G;  3FPP A;  5M3M G;  3HOZ H;  2CZG A;  3ULL A;  4YB8 B;  3T5L A;  2EVB A;  3CMA A;  1ICF B;  5FOB B;  4HSP A;  2Q2H A;  2FXQ A;  4YR0 A;  5DLF A;  1F9Q A;  3K5L A;  4DV3 L;  2JA5 G;  4ZI7 F;  1ICW A;  3KTM A;  2A6H C;  3J81 i;  5ELN A;  3RUP A;  4JI6 L;  2XIW A;  3GV3 A;  5FD5 A;  1VMC A;  3J7A 5;  3NE5 B;  2K04 A;  4MNO A;  1XNR H;  1CZW A;  1HFG A;  4DR5 H;  5DQG A;  5C4Z A;  1TT2 A;  5LL6 S;  2FPI B;  3MWM A;  1UC9 A;  1W93 A;  3F2B A;  4RAY A;  1O7Z A;  2FK1 A;  4A93 H;  3PIP 3;  1KJI A;  1AN8 A;  4BY1 H;  3U50 C;  1OXU A;  1STH A;  2CH4 W;  1MD2 D;  4DXF A;  1ILP A;  1BNZ A;  4DV7 Q;  1CT1 D;  1W6K A;  5LMN H;  1ILQ A;  3DM3 A;  3T5J A;  4A3L G;  2IMW P;  4XYQ A;  2A6E D;  2RCF A;  3S1N H;  4XX0 B;  2KHJ A;  5EDW A;  3J7A F;  4FS2 A;  5KFA A;  2EZV A;  5CR3 A;  2Y0S B;  2E2J B;  2JA6 G;  2JSO A;  4EGJ A;  3NBH A;  3H4D A;  2MJ8 A;  2MP1 A;  5D14 A;  5FKA C;  4A3B G;  4O4H F;  5DG8 A;  1B8A A;  2UXC H;  1YIJ A;  1O7I A;  4M9U A;  1D1K A;  4GN5 A;  1UEB A;  1S68 A;  4LFA H;  1SBB B;  5HUR A;  3HOU H;  1KTK A;  4LUZ A;  3HOY G;  3CF5 A;  1PRT D;  3PR4 A;  1CKO A;  1G2S A;  4N8F A;  4Y7N H;  2R93 H;  2ZTC A;  4LMY A;  2K32 A;  4LFC Q;  1GHK A;  2XC9 A;  2WDT A;  2C28 A;  4FBU A;  3MXP A;  4FXG C;  1J8I A;  5GAE C;  2HCC A;  3V6H A;  4LF6 H;  1N34 H;  3S2H H;  2PQE A;  3CHB D;  2EJG C;  3EJI A;  3A8K E;  2A68 D;  1JT8 A;  2VUM A;  3W1G A;  1GLV A;  1YNJ C;  1K83 B;  1Q90 A;  1VQB A;  5DQH A;  1N36 H;  3D4W A;  1P8L A;  4I65 A;  5DNF A;  1IL8 A;  4IZO A;  2WAQ G;  1EY4 A;  3PUW A;  4OWT B;  3NEN A;  1L1O A;  3DMU A;  1EY8 A;  1W2B A;  1XTC D;  2RDH A;  4GNX C;  3FDS A;  3NEM A;  3SK6 A;  2YRW A;  2W8K A;  4J9L A;  2V58 A;  3GV5 B;  5C4J H;  2F4I A;  2XGQ A;  3PN1 A;  4ED6 A;  1PMR A;  2AKW B;  4C56 C;  5KFR A;  2NVQ H;  1T5X D;  1XYI A;  1Y8O B;  3PIO A;  3CQZ H;  1D5Z C;  1UNS A;  4G57 A;  3GTM B;  3MAQ A;  4JI4 L;  2EY1 A;  2B2T A;  3OUZ A;  4DV5 H;  4RH6 A;  1K83 A;  2B2U C;  2VUM B;  5JPM C;  3LWE A;  2E2J H;  5CB4 F;  3T5H A;  5C3E B;  1FJG H;  2PMZ E;  2NUC A;  4X66 H;  1XXG A;  5FLX W;  1FJG L;  4ED8 A;  4DUY Q;  1T9H A;  5IYC G;  4YHH H;  1BQQ T;  4EGQ A;  1DGS A;  3BA9 A;  4EVO A;  5FLX L;  3SE7 A;  1E3P A;  1LT6 D;  2ALY B;  3NTK A;  5COR A;  3STB C;  1ZYR C;  3HOW B;  2R61 A;  2W6N A;  1EEI D;  1M8A A;  3KF6 A;  1V9P A;  1PZI D;  1CSP A;  3NBH B;  4IUT A;  4DR5 Q;  4JI3 H;  1S03 G;  4PV1 C;  3H0G H;  2HHH Q;  3JZI A;  1BCP C;  1HR0 Q;  1PH6 A;  2XCP A;  3GIK A;  4LF8 H;  2YTV A;  1TS3 A;  3KUP A;  2XN9 C;  3R5X A;  2UUA H;  1KXL A;  1SR3 A;  1TWH B;  3S9W A;  1E22 A;  5L37 A;  4QUF A;  2YU9 H;  1S0M A;  4JV1 A;  4JI0 H;  2R92 H;  4DNI A;  3N41 B;  5JUM A;  5KFW A;  3GTL A;  3OTO Q;  2AGP A;  4LFC L;  3N43 B;  2JXM B;  1SN8 A;  2ATW A;  3SK8 A;  2F0T A;  2EDG A;  5C6A A;  4QIW B;  1AP0 A;  1EZ1 A;  4PZ8 A;  4U68 A;  1EZ8 A;  2DY7 A;  2BDO A;  4JCV E;  1EUC B;  1N34 L;  2J4X A;  1ULZ A;  2E2H H;  2NU6 B;  1QNU A;  4JC0 A;  4RAZ A;  1HR0 H;  1PFS A;  2IBK A;  5FO9 B;  1DOK A;  2PBZ A;  4EG0 A;  4DV2 Q;  5IYD H;  5C3X A;  3H91 A;  4HMJ A;  2QDB A;  2XWJ B;  1VQ5 A;  1VQP A;  2MFI A;  3ZJY C;  4YP3 A;  4LF5 L;  3F2C A;  2LFN A;  5JEA J;  1E7Z A;  1QE6 A;  1SYB A;  3E9H A;  1SEI A;  4YY3 H;  4NXN Q;  1ZXT A;  3PQI A;  5KT2 A;  2JYO A;  5JVD F;  1VDZ A;  4K14 A;  4E6I A;  1RYS A;  4UCT A;  1IXR A;  2QDL A;  4FF2 A;  2KVM A;  3TEH B;  4WJ3 M;  2YZM A;  3A8J E;  2W71 A;  1TWA A;  3BQ2 A;  4IR9 A;  4I7H A;  3FKI B;  4IFD J;  1TQO A;  5D65 A;  1QVC A;  3NP8 A;  4RWS C;  5M3F H;  1LT5 D;  5G3L D;  1PLF A;  4Q0F A;  3VYU A;  5CAE B;  1SE8 A;  1M0W A;  5JJI A;  3RLO A;  4B3T H;  4OO1 G;  2UU9 H;  3K3P A;  2ES2 A;  1VQI A;  3FEW X;  1T3N A;  2KHS A;  5FLM H;  3RV4 A;  5D3I B;  4B3R L;  5BN5 A;  4NXN H;  4JI5 L;  4IQZ A;  1IKL A;  3ZYY X;  1CQI B;  1KDA A;  1EQV A;  4DR5 L;  2MO1 A;  4I50 F;  2D0P A;  2B2Y A;  5CV9 A;  2FJZ A;  3QG1 A;  1K8O A;  4EYI B;  1IL2 A;  1PFN A;  4Y52 H;  5JEA H;  4HSV A;  1EIG A;  1OXX K;  4MTK A;  3N6X A;  2C2D A;  1DOL A;  4LF7 L;  4WJ4 A;  3MXN A;  1RJR A;  2HCI A;  3MR6 A;  4RU9 A;  2N55 A;  4HR7 B;  2K6A A;  3NEL A;  5IWA Q;  1HXY D;  4QB4 A;  2CCZ A;  1GJX A;  2HIV A;  3HKZ B;  5EPK A;  4CDF C;  3MVV A;  1D7Q A;  2QYZ A;  3E9I A;  3PV0 A;  1TY0 A;  1NR2 A;  2Z1C A;  4OL7 A;  4KJN A;  1D2B A;  4HCE A;  4JI8 Q;  1FYC A;  5IIF A;  2JE6 I;  2UVV A;  3T1Y L;  4L5Q A;  2ASD A;  1CUK A;  5EPJ A;  3A7A B;  5D1O A;  1KC7 A;  1DCZ A;  2KCT A;  2F3W A;  2E2I H;  3KDF B;  4YAJ B;  2MGS A;  2IY5 B;  3R8B A;  3PUY A;  5BMV F;  2F0F A;  2HQL A;  4LF8 Q;  2DPI A;  3FP9 A;  2K5H A;  2B63 B;  1PDQ A;  2JEB I;  3KHR A;  3H09 A;  4JI0 Q;  4Y8V B;  3SHL A;  2J0T D;  4NXN L;  3AFP A;  1KJJ A;  5DG9 A;  5GAD C;  4PMB A;  1VQ8 A;  1JQY D;  4JI8 H;  1E1T A;  4BBS G;  1G2T A;  3TIN A;  5LL6 X;  4N9T A;  3MC0 B;  3G6J B;  5BPH A;  3M4O B;  1TR5 A;  4BY7 B;  3C3L A;  1G91 A;  1LV9 A;  1GUS A;  3NXW A;  4FBT A;  1IBL L;  5D3D A;  3RN2 A;  3J7A K;  1J5E L;  1F2L A;  4KLK A;  5KNB A;  4DV7 L;  3H6M A;  1B3A A;  1EIF A;  3FVQ A;  2BH2 A;  2KSW A;  1K83 H;  1J5E Q;  1JE4 A;  3CME A;  1N9W A;  4L5R C;  5KEE A;  2BE5 D;  2XRS D;  1C30 A;  2UVW A;  1ROD A;  1JB7 A;  3R2I A;  4H7B A;  1MIU A;  4IUR A;  5L1K A;  5COY A;  2D9U A;  2CWP A;  4Y7N B;  3I4M H;  2PNR C;  2R93 B;  1VQA A;  3H0G A;  4FP5 D;  5BN4 A;  2NN6 I;  2E5L Q;  2L15 A;  2AWN A;  1B44 D;  4L5T A;  1E2W A;  1IKM A;  1DXM A;  2VB3 X;  4JI8 L;  4NPS A;  5C4X B;  3OHA A;  2VA2 A;  1N32 L;  4CDD C;  1ML0 D;  4IFD I;  1U4P A;  1Q12 A;  1SE3 A;  1TWC B;  2A1A A;  5KFC A;  3HS0 C;  1GVP A;  2XNA C;  3OMG A;  1V51 A;  3EBE A;  4DL2 A;  3PGZ A;  3PO2 G;  1F2Y A;  3L4J A;  1S72 A;  5F2D A;  4MV6 A;  1TWG A;  2R92 G;  2DNC A;  5GON F;  4C3J H;  2L5T A;  1EY7 A;  4R7R A;  2GN5 A;  1SRU A;  4R4T A;  3UI2 A;  1YIT A;  2R7Z A;  1CM9 A;  1KQS A;  3V96 A;  2B2T C;  3OOC A;  1WD0 A;  1IOV A;  1FKA H;  1EUD B;  1X3P A;  4ZQ3 A;  4ETS A;  3MR2 A;  3OSP A;  1N48 A;  1E2Z A;  3OUU A;  4ABN A;  2VB2 X;  2HT1 A;  1B9M A;  1CK1 A;  3H0G B;  5ELE A;  3TBI B;  5D1O B;  1EU3 A;  1GOZ A;  4I55 F;  1GKH A;  5CGK A;  1TY2 A;  1D6E C;  4JI3 L;  1LAB A;  2VQE H;  2R8J A;  5DLG A;  2GA4 B;  4HJA A;  5IYD G;  5FPO A;  3HKZ A;  1VQH A;  2F1M A;  2YCH A;  5C5M A;  4F87 A;  3M4I A;  4KJO A;  2DJF C;  2NU9 B;  4YHH L;  3MXN B;  4A4I A;  4EQN A;  2BQ3 A;  4IUP A;  4AYB G;  1A3V A;  3LML A;  3RZO H;  3K6O A;  2KCN A;  1RDP D;  4R8I A;  1CI3 M;  2KEC A;  1A9X A;  5BR8 H;  3K58 A;  1K8M A;  4GLX A;  1HNX H;  1E4F T;  2XRQ D;  2CW8 A;  2DZD A;  2Z8L A;  4MTE A;  3GTJ B;  5C4X H;  2W6O A;  4OO1 I;  3Q24 A;  4UCS A;  4LF4 L;  1SYF A;  1ET6 A;  5KG2 A;  4DL6 A;  2CQA A;  1TS2 A;  3MEH A;  2VQE Q;  5JVH 3;  1A3T A;  4MV9 A;  4DAY A;  1Q8I A;  2A69 C;  2AMC B;  1EIY B;  3HOV G;  2YW2 A;  4DR6 H;  1B1Z A;  1NNX A;  2FJ2 A;  1EWC A;  2W57 A;  5F9N A;  4J9M A;  2ZJR A;  3BJY A;  3S1Q B;  1GUG A;  2RCN A;  5BR8 L;  4J9P A;  5ELF A;  1X56 A;  3JAM E;  1CS0 A;  2QIL A;  2O03 A;  2R86 A;  4C3I B;  3JSL A;  1ZKO A;  5BR8 Q;  1QUQ A;  2P5Z X;  1EYD A;  1HQR D;  5IWA L;  1XWE A;  3QO2 A;  2DGY A;  2OTL A;  2CHB D;  3JAM W;  2MQH A;  3W3A A;  3ERQ A;  4DR6 Q;  1SJE D;  1FNW A;  1X54 A;  3L4K A;  1BCP B;  2F0D A;  4V19 0;  4NMZ A;  3PIP A;  1SEB D;  2O4X A;  4A3D G;  5C8Y F;  1EY6 A;  1KNE A;  2Q2T A;  1UE5 A;  3H20 A;  2O5I C;  2RHQ B;  2O2L D;  3RBE A;  3HBL A;  2GVB A;  3MR3 A;  3MXU A;  2V9W A;  1BR9 A;  3MHB A;  1STE A;  4GN3 B;  1Z6H A;  3RAQ A;  4B3M H;  4DF7 A;  5IP9 H;  4JI0 L;  1CKN A;  4DK1 A;  3A56 A;  2R85 A;  2VR1 A;  2A68 C;  4QQB X;  1EYC A;  4PZ6 A;  2WTF A;  2L11 A;  3CRK C;  2R7K A;  1G51 A;  3IFD A;  3L0O A;  1K8A C;  2UUA L;  2ZDQ A;  5KFF A;  5CV5 A;  3S16 H;  3PW0 A;  4WD3 A;  2XD4 A;  3L9A X;  2VUM H;  4A3F G;  5IE8 A;  2UXC Q;  1S0O A;  3CPW A;  3E0J A;  2NZ1 D;  4XT1 B;  4YCW A;  4JI7 H;  5KT4 A;  2Y0S E;  5C44 H;  3GV8 B;  5BN3 A;  4DA2 A;  1VQL A;  5CV7 A;  4BBR H;  4Q0Y A;  1WTP A;  3M9B A;  1HUN A;  2OLS A;  3ULJ A;  4DV3 Q;  4ED2 A;  1TWF A;  3LWU A;  1XNR Q;  3R2T A;  3GIM A;  3EVQ A;  1PTO F;  1LO5 D;  1J6Q A;  5JOB A;  2L4N A;  3GTG H;  4IR1 A;  4IRK A;  1OTC A;  3J80 W;  4GKK L;  3OW2 A;  4F4W A;  4K5X A;  4RHS A;  4MAM A;  5JJK A;  4UFZ A;  2E75 C;  5C0X H;  4RAU C;  1EOV A;  1F2Z A;  4NW2 A;  4A3J G;  4DR7 L;  4OON A;  4DAP A;  2F3V A;  1Q81 C;  1K73 C;  4DV7 H;  2E74 C;  1S40 A;  4IJH A;  4FXK C;  4PZ7 A;  4F50 A;  1YEZ A;  2PO4 A;  3GTP B;  3CCU A;  4H13 C;  2VQF L;  4PDB A;  1KLG D;  3GTG A;  1EYA A;  2F0N A;  5LMU L;  2R7D A;  4KKS A;  4B08 A;  3TSS A;  2W70 A;  4RKL A;  5EOY A;  3D6C A;  3I12 A;  3R23 A;  4ZUI A;  5LYJ F;  1X55 A;  5I6Y A;  1N8R C;  4C3H H;  4U6P A;  4FU0 A;  5BPF A;  4DR2 H;  4EYH B;  3TQ1 A;  1ZET A;  2K52 A;  3A5Z B;  1I7L A;  3VPB A;  5FO7 B;  2M9V A;  2RSN A;  3LX0 A;  5I6W A;  2WAQ A;  2YZN A;  5KFY A;  3QOL A;  3H3V H;  2F0M A;  4EQP A;  3PO2 B;  2Z4I A;  5DM6 3;  3MFY A;  4DL5 A;  3I3C A;  1BBU A;  3ITP A;  4LFA L;  1NAP A;  4OIJ A;  3FRP B;  1MZB A;  2C9O A;  2F4V L;  3RN5 A;  2ZJT A;  4JYA Q;  1Y1W G;  4UPA A;  1JIH A;  5KFK A;  4A93 B;  3RZD H;  4BBS B;  2B2W A;  3M85 A;  2GPS A;  4GLA C;  3EN2 A;  4UAI A;  4B9W A;  4FF4 A;  1WCM H;  4RNO A;  1SNP A;  3TP8 A;  2C22 A;  2WP8 J;  1JOQ A;  1KEE A;  2XSC A;  4MN3 A;  5T1G A;  2R7N A;  4LMQ D;  2ZM6 H;  2UUB H;  2DIK A;  3OTO H;  3A74 A;  3GD7 A;  2JA6 A;  2FKL A;  3CD6 A;  1BDO A;  3CU7 A;  1JDB B;  3EFX D;  1IBL H;  2VXW A;  3S14 H;  1U9R A;  3P20 A;  4K5V A;  4A3E B;  1LTS D;  4OX9 H;  1SNQ A;  3CCE A;  5LMU Q;  2OTJ A;  4LSA A;  2UUC L;  2N8N A;  2M05 A;  4HID A;  3B6Y A;  1EY0 A;  1E4G T;  1L1O B;  3S24 A;  1VCI A;  2X0S A;  1RIP A;  1STA A;  2WB1 E;  1C8C A;  2UUC H;  1P16 A;  2NVX H;  4JI1 Q;  2RQX A;  3I4N H;  3U9O A;  3GIL A;  2FLN A;  4U7C A;  2QEX A;  3KFU A;  4X66 Q;  1SYD A;  1CKM A;  5FLM G;  3KF8 A;  4QWD A;  3BAB A;  4O2A F;  4ED3 A;  2ZM6 Q;  2UUB Q;  2R84 A;  4HNT A;  4ZOL F;  4DR1 H;  1LUZ A;  1XPU A;  4XQQ A;  2HHH L;  2ZM6 L;  2UUB L;  1PYS B;  4XYM B;  2Q2U A;  4X3U A;  4DV3 H;  4OEM B;  5FJ8 G;  2H1E A;  3CXC A;  1EIH A;  3SR1 A;  4ME5 A;  3MFH A;  1BKB A;  2D5D A;  2VOB A;  4BA2 I;  2K28 A;  2RBM A;  3V05 A;  2IA6 A;  3RBD A;  3H15 A;  4UCO A;  1JWU D;  3P1H A;  2ASB A;  3S1M H;  4LF5 H;  4YQW A;  4DAM A;  3AEV A;  1X3Q A;  1EOT A;  3I2Z A;  4B3S L;  5IGD A;  1O7L A;  4JV2 A;  1RD9 D;  4HQ6 A;  2BH8 A;  3RAX A;  4A3D H;  2Y0S A;  4YHH Q;  1LT3 D;  1NY4 A;  3MFG A;  4DUZ Q;  2R8K A;  3M4Y A;  3FKI G;  1G29 1;  1SJH D;  4TQU S;  4RUC A;  2A19 A;  1SYX B;  2WIN B;  5J39 A;  5FLX E;  1I6H H;  3VR5 A;  2ZXP A;  5FLX c;  4LF6 Q;  4X3K A;  2L55 A;  4DAV A;  1XJV A;  1NCV A;  4JI3 Q;  4ME3 A;  1S10 A;  3TS0 A;  2Q2I A;  4IFD G;  3TS2 A;  2V4D A;  2EE1 A;  1O75 A;  1SRO A;  4O3P A;  3F8N A;  4NLG A;  3GV6 A;  4LF4 Q;  4EBD A;  2Z6K A;  1VQG A;  1Q82 C;  1IBM L;  3RIZ A;  2YV5 A;  4FM9 A;  5IP7 H;  1AW7 A;  4CDC C;  3BQ1 A;  5E4W C;  2BDN A;  3AMU A;  4EEY A;  1GUT A;  4JI1 L;  4X65 Q;  1JOO A;  4IZ8 A;  3CC2 A;  4JI4 Q;  3BZK A;  3IL8 A;  1JKJ B;  2BA0 A;  1PH9 A;  1K1Q A;  3HOZ G;  3G48 A;  2D0O A;  1SFO B;  3TDQ A;  1CQF A;  3JRW A;  2W9A A;  5IGC A;  1JB3 A;  4TSS A;  3BVM A;  2YTX A;  1JOR A;  1ZHQ A;  4O2B F;  2EXD A;  1A8V A;  4JYA H;  5D8D A;  1D5M C;  1KAW A;  3QB3 A;  3BS1 A;  2IJ0 A;  1GHJ A;  1SYE A;  2F0V A;  3KLS A;  4RNN A;  4JI2 L;  4YY3 L;  2HGS A;  4X66 L;  4ZLT F;  4GC7 A;  3HRZ C;  2I46 A;  1LTI D;  4YY3 Q;  1F2M A;  2FMC A;  2WKC A;  5CV8 A;  2EYL A;  4TRD A;  4JI4 H;  4KHP H;  1HR0 L;  1PTO C;  1VF5 C;  1D1I A;  2X6L A;  2YYZ A;  1QZG A;  5C44 B;  4JI7 L;  5DM7 3;  3G6X A;  4J9N A;  4A75 A;  1OXV A;  2ZJP A;  4RB2 C;  4ECY A;  3F2D A;  2I5M X;  1Y1V B;  5JQW A;  2FMM A;  5JVL A;  2VUG A;  1ESR A;  4AYB E;  3NGD A;  4KY7 A;  5C1P A;  2WFW A;  2UUA Q;  1QIL A;  5C3E G;  4C2M H;  4NXM H;  1N33 H;  1VQN A;  3VA5 A;  3MWY W;  3MWE A;  4B3M L;  2CW0 C;  4HN7 A;  1JDE A;  4IOA A;  1S5F D;  4ZRZ A;  1N36 L;  1C4Q A;  4O1N A;  3KLW A;  1Y8N B;  4K8J A;  1QVF A;  1A62 A;  4LF8 L;  3X3N A;  2W6P A;  3HOU B;  1U4R A;  3HFZ B;  4MA5 A;  4ECQ A;  3CCM A;  3QZ7 A;  2RGR A;  5KG5 A;  3JAM L;  3JAM i;  1SFO A;  4LF5 Q;  4JI6 Q;  1HCZ A;  1DV2 A;  3U4V A;  3DXJ C;  3GII A;  4RB3 C;  3M7N A;  4KD3 A;  1XNQ H;  3OHX C;  5JAV A;  2R93 G;  5IWA H;  3CCL A;  3WWV A;  2B3G A;  2Y0S G;  4FS1 A;  4DR7 Q;  1NMF A;  3T53 B;  1B2T A;  4U67 3;  3WOE A;  4A76 A;  2NTT A;  1I5F A;  1WH2 A;  4XZ3 B;  1EU4 A;  2B63 G;  1EYZ A;  4EQO A;  3OPO A;  3RMH A;  1X3G A;  3S2H B;  1BJT A;  3RZO B;  2WV6 D;  4QIW A;  4A3G G;  3GTL B;  2JN4 A;  2B8G A;  4HJ8 A;  4RB1 A;  2ID0 A;  3Q22 A;  1GM5 A;  3CP0 A;  1LTA D;  1H9R A;  1W3S A;  1I6U A;  1FNU A;  2NVQ B;  4K6L A;  5LMN L;  4KI0 A;  4OEL B;  1JWM D;  1UE6 A;  2OQ0 A;  5AFW A;  5KFE A;  5HBR B;  4O3R A;  2NUA B;  2E5L L;  4O3S A;  1XNQ Q;  2CW0 D;  4G7H C;  1VKZ A;  1GUO A;  1MKH A;  2WAC A;  4X64 H;  4YJ2 F;  4IPG A;  3A7L A;  1LTL A;  2ZTE A;  4DNT B;  4QWB A;  1IYJ B;  1R9T B;  3HKS A;  3D3R A;  2JP1 A;  4A3I G;  2PZT A;  1J9O A;  3S1Q H;  5KT6 A;  4CJ2 C;  3WDN A;  3S14 B;  2K1B A;  3Q8D A;  4R1J A;  4HYK A;  1H9J A;  1HNX Q;  2W6M A;  3MFI A;  1BVS A;  4TKO B;  3W5O A;  4PWQ A;  3N42 B;  4KN4 C;  3J81 j;  3TME A;  3BQ0 A;  2CQY A;  5KFM A;  4LFB Q;  4A2A A;  3BG5 A;  3JC6 6;  4LFB L;  2K5Q A;  1M4V A;  1LAC A;  1PZJ D;  4M8A A;  4DNR B;  5KFJ A;  5KFQ A;  4ECS A;  4A3E H;  3KJP A;  2YRX A;  1Y1W A;  2F3I A;  1YNN C;  4IJL A;  4HIK A;  1IW7 C;  3MEF A;  3EPG A;  1I50 B;  1R4P B;  2F0H A;  3S1R H;  3N8D A;  1I4H A;  3OYY A;  4A3C H;  2WE6 A;  3V2T A;  4CDE C;  4QIW E;  1ENC A;  3CKI B;  3I91 A;  1RJP A;  4JV5 H;  3G6V A;  4JVZ A;  3MR5 A;  4NXM Q;  3EA6 A;  4C3J G;  4V0B A;  1IBK Q;  4Q45 A;  2TMP A;  3BYT B;  3G8C A;  1S97 A;  4GLV B;  1VQ6 A;  2ZT9 C;  5IP7 G;  3BJU A;  3PMF A;  3GTK B;  4E4T A;  3DWP A;  1EZ6 A;  3HOV B;  1K0S A;  5CBE E;  4DV6 L;  3CW2 C;  1HA5 A;  1TVX A;  2K5N A;  1VQO A;  4K5W A;  3JAM c;  5G3L F;  4A3M B;  4GOP B;  4J9O A;  1PYB A;  4RGO S;  1UEA B;  4QW8 A;  1PH3 A;  3TQT A;  2CWA A;  1STY A;  4RZQ A;  4ECV A;  1ESF A;  1Y69 U;  2R87 A;  2SNS A;  4JI6 H;  3FMC A;  5C0X I;  1ZEQ X;  1B70 B;  2NVY B;  4C5A A;  4XXE A;  3WO0 A;  1T5E A;  1VF7 A;  2X69 A;  3CCR A;  1J5E H;  4TQR A;  2K7V A;  3LNN A;  1B3Q A;  4ECU A;  4DL7 A;  1PRT B;  2AGO A;  3V4Z A;  2L1B A;  2PPB C;  2KCM A;  3MZ5 A;  4FVM A;  5CBA E;  1HRJ A;  1TS4 A;  5C4X G;  3UFX B;  1JLL B;  2B29 A;  3SDZ A;  4J15 A;  1HNZ L;  1JWS D;  4C2M A;  2VA3 A;  2CFM A;  3CQZ A;  1NJI C;  3U58 A;  4K0K Q;  3GID A;  2F0S A;  2LXJ A;  1B9N A;  4A3K G;  3CCQ A;  3PO3 H;  2G9D A;  2R7Z G;  2XIG A;  4IAJ A;  2PQA B;  4R8N A;  5FD6 A;  5KG7 A;  2E2I A;  2AHO B;  4A3L H;  4A2B A;  2KCC A;  4QCL A;  4GOP C;  3QJY A;  4I7A A;  5C5J A;  4LNQ A;  4F88 A;  4DV4 H;  3Q8R B;  4X64 Q;  1U4M A;  4P2C B;  2FPG B;  4JBK A;  1I7N A;  3ERS X;  2K03 A;  1GGO A;  1E1O A;  1Z7T A;  2C00 A;  4F4X A;  1X3E A;  1YI2 A;  4YAK B;  4UP8 A;  2PMZ B;  4RUA A;  1SFO H;  3T1Y H;  4YR3 A;  4A3K B;  3CCS A;  4DV2 L;  4EFB A;  2NTS A;  4BY7 G;  1Q86 C;  3VR6 A;  2PI2 A;  2SEB D;  1N56 A;  5C4J B;  4RCO A;  1TWF B;  4K0K H;  5IYB G;  3K5N A;  5KFI A;  1XMQ L;  1LLR D;  2K4K A;  3M9O B;  2V4Q A;  3SI8 A;  5CMD A;  3VR3 A;  2A6H D;  4LF7 H;  4Q8F A;  2MO0 A;  3H0G G;  4OGQ C;  2OF1 A;  3QWN A;  4JI2 Q;  1WCM G;  3M3Y B;  5EZY F;  3EQL C;  4C1N I;  3AB9 A;  2FK3 A;  2PW7 A;  5KFV A;  3LWB A;  5M5Y B;  4G7O C;  2JA8 G;  2EYH A;  3D8G A;  4QL5 A;  1B6R A;  5I2X A;  1LT4 D;  4QMG A;  4LK1 C;  1HZC A;  5IP9 G;  4JI5 H;  4JI7 Q;  3BDO A;  5J1Z A;  1B04 A;  1V43 A;  4APM A;  2HQE A;  3CQZ B;  1KRS A;  4C3I H;  1B53 A;  1CKN B;  1QZH A;  3UE0 A;  4UP9 A;  3HGB A;  2UU9 L;  1XTD A;  1B6S A;  2QK4 A;  5J2U F;  3E0E A;  1UAP A;  4H02 A;  4XQJ A;  4B3T L;  3A55 A;  1BCP D;  1TXY A;  3R5F A;  4DL3 A;  3PUV A;  1PH5 A;  2OQK A;  3BZC A;  1I4X A;  3A54 A;  4EEQ A;  5M3M H;  4POG A;  1FR3 A;  2NVX B;  4ZQI A;  3BZD B;  3K0Y A;  4P72 A;  1XPO A;  1PH4 A;  1YNN D;  1I94 H;  3X3M A;  1MSH A;  2F0U A;  2W9B B;  3T51 B;  2W9C A;  1KJ8 A;  3K5H A;  4CHT B;  1V8Q A;  2JEJ A;  2B2W C;  3TN2 A;  2J6T A;  2FFK B;  4HAE A;  3UQ8 A;  1E24 A;  1WYD A;  4J8Q A;  3Q8S B;  4J1M A;  2BR0 A;  1NTG A;  2XWB B;  3D6W A;  1YNX A;  2E8G A;  2D62 A;  3BAA A;  1QVG A;  2F0P A;  1RK5 A;  2A69 D;  4DPG A;  3UE1 A;  3GTK A;  2VS1 A;  1CFM A;  4RHR A;  2EIF A;  2SNM A;  4BY1 B;  2BE5 C;  5IY0 A;  3Q2O A;  4O4I F;  3S2D B;  1F9R A;  4IRD A;  3AQQ A;  4TUY F;  2W6Z A;  5J22 A;  4LFA Q;  4A3D B;  3HOX H;  2FE3 A;  1WTW A;  4A3G B;  5FPR A;  1TS5 A;  3OIP A;  1QJO A;  4ECZ A;  4L1K A;  1X6O A;  5A2Q W;  4EBC A;  4LFC H;  3L7Z C;  3S1N B;  3M9M B;  1EWH A;  4P75 A;  1WD1 A;  1XX8 A;  2VNU D;  3TP7 A;  1GXD C;  4LF9 Q;  2VPS A;  4RNM A;  1V1O A;  1HNW H;  4HTH A;  4H44 C;  4CJ0 B;  5DLQ E;  3KOJ A;  5ELC A;  5IGE A;  3R5H A;  3GLK A;  2D2C C;  3S15 H;  3NBI A;  5CV4 A;  4EX5 A;  1H9S B;  5LMN Q;  3HOU G;  1LM0 A;  2OH2 A;  1Y1W H;  1PX2 A;  1GYF A;  3GV7 B;  2UXD L;  3E6Z X;  1I6V C;  4BWS C;  2K5W A;  4K2L A;  3NWS A;  4AQY L;  4FF1 A;  4DV5 Q;  4LF9 H;  5KFO A;  4KHZ A;  1Z2N X;  4DK6 C;  5KRU A;  2CW7 A;  2JA5 B;  4DV5 L;  4C5B A;  2PQA A;  2WAQ E;  4DLK A;  1X32 A;  3Q6S A;  3VYT A;  2UUC Q;  1NBW A;  3RFC A;  1O78 A;  1D5X C;  3EYY A;  1STG A;  4PQX A;  4WJW A;  4O0A A;  2EOT A;  4O2D A;  1ASZ A;  1AZQ A;  5M3F G;  5KFS A;  2HVS A;  1HA6 A;  1VBH A;  5KFD A;  3HOW G;  1SYC A;  2LS0 1;  3GTQ H;  1UE1 A;  2J7Z A;  1KDB A;  1HQM C;  3I73 A;  5M5W H;  1Y1V H;  2E2D C;  2I87 A;  1KLU D;  4DU9 A;  5A35 A;  2V4R A;  5EBC A;  4CC6 A;  3IFT A;  2YL2 A;  2C35 B;  5H80 A;  2V5A A;  3T4A C;  2Z6B A;  4IWY A;  4YIJ A;  1JIC A;  4XYL B;  3KJO A;  1SCU B;  4RKB A;  1KAB A;  3SEB A;  3RGX A;  4ED7 A;  1SLJ A;  5KG3 A;  3DEP A;  5HY6 A;  1EFW A;  5IYC H;  4LF6 L;  5JJL A;  2ZDH A;  5GAH C;  4BWG B;  5HGT A;  1Y8P B;  1PH8 A;  4UHV A;  1E0B A;  1X3F A;  4Q43 A;  1WTO A;  1W96 A;  3HXL A;  3J7Z C;  2UXC L;  3E5N A;  4JK1 C;  5IT9 L;  2RDJ A;  5IYB H;  4PG3 A;  2RF4 A;  1T94 A;  5E7N A;  2QF7 A;  2R8I A;  4X3T A;  4OHJ A;  4L8J A;  4DV0 L;  2FLP A;  3GTO B;  3UDX A;  4ZKB B;  1ASY A;  2WAQ B;  4ED1 A;  2JEF A;  2QCP X;  1ET9 A;  5EJW A;  3S1M B;  4R9W A;  1JR0 D;  1FJG Q;  4DUY L;  1K3B C;  3G71 A;  3J80 E;  4O3N A;  4DUY H;  2DLN A;  4I4T F;  2L12 A;  1WTX A;  2LY7 A;  2IX3 A;  1Z2O X;  4ODG A;  3Q0A A;  2KEN A;  3PO3 B;  1RJQ A;  5L9X A;  4J6H A;  4R4O A;  1VQK A;  1E2V A;  2NYZ D;  4BBR B;  1WVL A;  1LTR D;  1YHA A;  2EYM A;  3DF7 A;  2OCE A;  4LH7 A;  1DOM A;  2ZDG A;  3ULP A;  4JBM A;  2UXD H;  2IHF A;  4GKJ L;  4IUQ A;  3URY A;  2FP4 B;  4X6A H;  4DR4 L;  3PVX A;  4ULL A;  5CV6 A;  2ICE C;  2ZXO A;  2KQ3 A;  4J0M A;  3T5K A;  2PI2 E;  2PW5 A;  4X65 H;  3OIQ A;  1HJP A;  3OWF A;  3WO1 A;  1GD7 A;  3KBX A;  1VQJ A;  4O3O A;  3RNU A;  4B3R Q;  2E2H A;  2V1C C;  3IN5 A;  1I3Q A;  4GNX A;  1LTG D;  1N34 Q;  5LL6 b;  2W9B A;  3O13 A;  4QWC A;  1U5K A;  3NK9 A;  5LMN W;  3TQY A;  2XGT A;  3J80 L;  2YS7 A;  2NVX A;  5EBD A;  2OXP A;  3PZP A;  4OXP A;  3RB3 A;  2E76 C;  1N36 Q;  2MHV A;  4IUN A;  5CYU A;  5EQ0 A;  4KV6 A;  4DUZ L;  3SXH A;  4CKB A;  1YZ6 A;  3RF2 A;  4HIM A;  5KIX A;  5KFL A;  1K8G A;  1I4Q A;  2WB1 A;  3BU2 A;  4TQS A;  5KYL A;  2HIX A;  2A6E C;  3G7L A;  4KKU A;  2A73 B;  4KK7 A;  3PR5 B;  2F0J A;  1I3Q H;  2EYJ A;  4KHP Q;  2PN1 A;  4F8M A;  2EPB A;  3PUZ A;  2HD3 A;  2YTY A;  1C3O A;  4DV1 L;  2R7M A;  1BOS A;  5M5X B;  3PO2 H;  4R8U B;  4QWA A;  4EGV A;  4F7X A;  1Z47 A;  1SNO A;  4K6D A;  1AFP A;  2IL8 A;  3D0F A;  4ME6 A;  1ONL A;  1PZK D;  1RF2 D;  2ZTD A;  3GTO H;  4JV0 A;  4ZCK A;  3S17 B;  2R6F A;  3GTM H;  5KFT A;  3J7Y W;  1VAJ A;  4ECT A;  1OXT A;  1SXT A;  4N9P A;  4JYA L;  3W2D A;  2V59 A;  4A3B H;  2EQS A;  1DON A;  5ELD A;  3S2D H;  2BQU A;  2AQ3 B;  2FHT A;  2NN6 G;  3ERO A;  3MXG A;  4LUV A;  4OWX B;  3DLL A;  4QGU A;  2UU9 Q;  2UXB Q;  1ZHS A;  4FYD A;  4ECR A;  1WJJ A;  5KG6 A;  5GQO A;  4UDU C;  5DGB A;  1PK8 A;  2LSS A;  3FMA A;  5GRO A;  1HZB A;  4RG1 A;  1WR2 A;  3FHW A;  4O3Q A;  4IAL A;  4JG2 A;  2FMA A;  1YJN A;  4WFN 3;  3PW7 A;  1M90 C;  5EAY A;  4R8U A;  2PCF B;  3AYH B;  4HCS A;  5F9L A;  2SOB A;  3BDC A;  3RGZ A;  4DK0 A;  2JA7 B;  1IBK H;  1SMY C;  2B63 H;  2WII B;  4N8X 1;  3UDI A;  2WB1 G;  2OEO A;  3NHH A;  1Y1V A;  1JJG A;  4DV1 H;  2JK8 A;  3HB9 A;  1VS0 A;  2VL6 A;  2I80 A;  3I4N B;  4BA1 I;  3IKJ A;  4F4Z A;  2KHI A;  1TWH A;  1VMP A;  4RGT A;  3A0J A;  1YNJ D;  2QA4 A;  5ELO A;  1VQF A;  2PZW A;  4DR3 H;  4HNV A;  1WTR A;  4YBZ B;  3GTJ A;  3IG0 A;  4O42 A;  4A3K H;  4LH6 A;  3TP6 A;  1KIX A;  1RYR A;  4BS9 A;  3J81 W;  1SNC A;  1JX4 A;  2ALZ A;  4DV2 H;  2JA5 H;  3P7J A;  2K50 A;  1RKN A;  2YU9 B;  5FJ8 H;  4RZR A;  4APV A;  5EWG A;  3DWQ A;  3NWT A;  2EJM A;  3ICE A;  4CC5 A;  2FB9 A;  2H4O A;  5C0X G;  5M5Y H;  4XT3 B;  4GOP A;  3K81 C;  3I8Z A;  2RGV A;  1K0R A;  1B50 A;  1QB5 D;  4LWC A;  5M5X H;  3J80 i;  4DR1 L;  2LXK A;  5TSS A;  4HMI A;  3GTQ B;  5I47 A;  3G6E A;  3E5S A;  4A93 G;  5T14 A;  4QW9 A;  4QF4 A;  2XCL A;  2XCA A;  3GIP A;  3K57 A;  4UCV A;  1I50 A;  3FKI H;  4JBW A;  4DV6 Q;  1EY9 A;  1IOW A;  3BG3 A;  2G9H D;  2JA7 H;  1GSA A;  3T1H H;  2LKV A;  4JOI C;  4H0L C;  3GQC A;  3DUZ A;  4LW1 A;  1O7Y A;  3I7F A;  1LTB D;  4YWM A;  5KNC A;  1VQM A;  1BBX C;  3WOF A;  4FF3 A;  4A3C G;  4IPD A;  2DNE A;  1WTQ A;  2JA6 H;  2IWH A;  1NMG A;  3CCV A;  4DFA A;  2C2E A;  1JJC B;  2XGP A;  3ETJ A;  3U9S A;  3BVG A;  1LYL A;  2YS6 A;  3LGJ A;  4IPH A;  2J6S A;  2EY5 A;  1SNM A;  2NU7 B;  1M6V A;  3SGI A;  3SK5 A;  4JV5 Q;  1WFQ A;  4BXX G;  5C44 G;  1VQ9 A;  4YJ3 F;  3KXY T;  3GQB A;  2AUJ D;  4YCU A;  1HPC A;  2I8C A;  2HVR A;  3STB D;  4DV6 H;  3ER0 A;  2TSS A;  2R3Z A;  1H9S A;  4JBJ A;  4OIK A;  4C3J B;  3K5M A;  2DWC A;  2VW9 A;  1S5D D;  2YU9 A;  2UXB H;  1L0W A;  4RMF A;  1STB A;  1AZP A;  1K28 A;  4JI5 Q;  2VQD A;  4HIO A;  1R9T A;  2F0K A;  1PXU A;  3V6K A;  5IOC A;  2X6G A;  4B3S Q;  1KDC A;  3VDY A;  1I4P A;  1PH2 A;  4A3J H;  4KN7 C;  3RB6 A;  3ORQ A;  1BNC A;  3NSW A;  4LSX A;  5KG0 A;  4JOI A;  1G6P A;  3TII A;  4C3H B;  1TWA H;  3KHH A;  2HDM A;  3R3O A;  3R93 A;  5IGB A;  2J9G A;  1EQQ A;  2RKS A;  3J7A V;  3VR4 A;  1C0A A;  5A2Q L;  4WBN F;  1VQ7 A;  4DV4 Q;  1QWY A;  1KD1 C;  4BBS H;  4LFB H;  3I72 A;  1EQR A;  2EY2 A;  3KLS X;  3HOV H;  3CCJ A;  2WB1 B;  2PZU A;  2RHS B;  2JA7 A;  4C5C A;  1V4Y A;  2VQF H;  5KFP A;  1LTT D;  5CA0 F;  4S3S A;  2PVP A;  3T1Y Q;  1V1P B;  1FGU A;  3OSN A;  1HZ9 A;  3K80 C;  1SMY D;  3VYR A;  3KDF A;  4MHE A;  1MJE A;  2K5D A;  1S5B D;  4PMC A;  1E4E A;  2W7O A;  4FXD A;  3C1E A;  1F9P A;  4AH6 A;  3K5O A;  3IRB A;  1YJ9 A;  1A0I A;  2KOL A;  4HED A;  4X62 L;  2RSO A;  2N88 A;  1ENF A;  1S9F A;  4RGM A;  4GKJ H;  2IHE A;  1TKW B;  1PHJ A;  1IW7 D;  2NN6 H;  2WKD A;  2E5L H;  2Q8R E;  1DD2 A;  3KLR A;  1UE7 A;  4KD4 A;  3TRZ A;  2IPK D;  4YR2 A;  3PIO 3;  3T56 B;  2JJQ A;  1QOH A;  3I55 A;  3K59 A;  4JPB W;  5KYI A;  2B39 A;  4NDX A;  1MBY A;  2WYO A;  1HNW L;  4JV5 L;  2M2L A;  1CZG A;  1WSC A;  1Y14 B;  5LXT F;  2JEG A;  3DHQ A;  3TIG A;  1WOC A;  1PRT C;  3C2P A;  4LF7 Q;  4DR6 L;  3JRX A;  1TWH H;  3GO5 A;  1S3O A;  2ATL A;  4DAY B;  4I7Z C;  4P73 A;  4AYB A;  2IP4 A;  1W6J A;  5KFB A;  1RTO A;  5HV6 A;  1KJ9 A;  1TWC H;  1AN7 A;  4OWW B;  4A3F H;  1GO3 E;  1L0X B;  1L0Y B;  4L6T B;  3RD4 A;  1PH1 A;  2KA7 A;  1PH7 A;  1V1Q A;  2RVL A;  4G7Z C;  1GSO A;  2CVR A;  1BUV T;  3K0X A;  2ZJQ A;  4GNX B;  4BBR G;  2E2H B;  2QKI C;  1TWA B;  1SDF A;  3TZU A;  3GTP H;  1HR0 W;  1DZ1 A;  2BCO A;  2GVA A;  2F0L A;  3Q1K A;  4XIG S;  4ZUJ A;  4RFB A;  1JE5 A;  1MHW C;  4MV3 A;  3L3O C;  5E1F A;  1AE3 A;  2A8V A;  4MA0 A;  2R92 A;  2UXB L;  4X3S A;  3J81 L;  3I4M G;  2KBN A;  3M9N B;  4J9Q A;  2PMZ A;  3KAJ A;  4ZHQ F;  2NVT H;  3OWE B;  4TVA B;  3PW2 A;  1UC8 A;  3NQT A;  1N33 L;  4NXM L;  1CSQ A;  3ONA B;  4X64 L;  2A74 C;  1QCB D;  1I6H B;  1E4E B;  3RB0 A;  1B4O A;  4GC6 A;  3GIJ A;  2RA4 A;  1KC8 C;  1CA5 A;  2R7Z B;  3Q8P B;  4GN4 B;  2NZO A;  2AQ2 B;  1KRT A;  1MI2 A;  5JH7 F;  1QNK A;  4MV7 A;  5ELB A;  1H9K A;  3D4R A;  1VQE A;  2ENB A;  1Q46 A;  2F4V Q;  2R8G A;  4LF4 H;  2JQO A;  1XMO L;  3SE0 A;  5JJZ A;  1Z9F A;  4O4L F;  4MV1 A;  1C9O A;  2CQO A;  2JA7 G;  4LF9 L;  5DAU A;  3RV3 A;  3EIV A;  4AQY H;  3C0F B;  3D31 A;  4EQ5 A;  1OXS C;  5IGG A;  1BXR A;  1WCM A;  1MSG A;  1PTO D;  3A8I E;  3K7A B;  4KTA A;  1WI5 A;  3TP5 A;  5H1S E;  2VPQ A;  1TU2 B;  1XNQ L;  2I5L X;  1Q1E A;  4GS3 A;  1HTL D;  3J81 E;  2PNH A;  1N32 Q;  1A2U A;  2B2V A;  5K36 G;  2YZG A;  3VR2 A;  1F77 A;  2CH4 A;  1IZ6 A;  4KHV A;  2L9H A;  3KK7 A;  3V6J A;  1RL2 A;  2AUK A;  5IGF A;  3MJF A;  4BXX H;  4Q8E A;  3VYS A;  2KJX A;  3UDF A;  4ECX A;  2K14 A;  4K0K L;  2MPM A;  1QUQ B;  3HZX A;  1M7J A;  2R82 A;  5KND A;  4JI1 H;  4A3F B;  1I94 Q;  2SCU B;  3JSN A;  3KHL A;  2AU0 A;  1HZA A;  2F0W A;  1SE4 A;  1F9S A;  3KHG A;  3MWD A;  1IHZ A;  4ZYS A;  4YWK A;  4XTC S;  4DR1 Q;  3CC4 A;  3J80 c;  2P0A A;  4K8I A;  5KGU A;  5C5L A;  3KF8 B;  4P74 A;  2MUY A;  2E2I B;  3RR5 A;  2ASL A;  3PUX A;  1HNZ Q;  2F0G A;  4P71 A;  1B7Y B;  3OHB A;  3C46 A;  5IOD A;  5C1O A;  3RLN A;  4DV4 L;  4ALP A;  1PYW D;  3M4Q A;  2W7P A;  4C2M B;  2DJG C;  5C0X J;  4DR3 L;  3PW5 A;  1FGB D;  2Z0S A;  3RTX A;  4LAA A;  1JCK B;  2EXZ A;  2R8H A;  1NSN S;  2BA1 A;  2W8L A;  2F0E A;  3HOZ B;  3K8A A;  4DK3 C;  2OWO A;  1YHB A;  2R6G A;  1H95 A;  4RB0 A;  3I70 A;  4IPC A;  2DN8 A;  2JA6 B;  3PF4 A;  2DY8 A;  4DUZ H;  1WTH A;  1IBK L;  1AE2 A;  3H94 A;  1Z2P X;  1GUN A;  2HDL A; 
#chains in the Genus database with same CATH homology
 2ZM6 L;  2UUB L;  3M4P A;  1PYS B;  3UDG A;  3KJO A;  4HJ5 A;  2E2J H;  4A3I H;  1Q7Y C;  2Q2U A;  2PMZ E;  5FJ8 G;  1SLJ A;  3CXC A;  1A63 A;  1BKB A;  2H5X A;  5HY6 A;  5IYC H;  1EFW A;  4LF6 L;  1FJG L;  4BA2 I;  5JJL A;  1FVI A;  4DUY Q;  5GAH C;  1T9H A;  5IYC G;  3H15 A;  1PH8 A;  1YHQ A;  1DGS A;  2ASB A;  3S1M H;  1K3R A;  4FDB A;  1X3F A;  1E3P A;  2ALY B;  2IT1 A;  5J3B A;  4DAM A;  3M3Y H;  3AEV A;  3STB C;  3I2Z A;  4B3S L;  3J7Z C;  2UXC L;  2F52 A;  2BH8 A;  3KF6 A;  1U0L A;  1V9P A;  3KYH C;  1CSP A;  3NBH B;  4PG3 A;  2RF4 A;  5IYB H;  4YHH Q;  1NY4 A;  4DV0 Q;  4A3D H;  5E7N A;  4DUZ Q;  3H0G H;  2HHH Q;  3FKI G;  1G29 1;  4TQU S;  5IT9 c;  1PH6 A;  1HR0 Q;  2YTV A;  2A19 A;  4DV0 L;  3UDX A;  1ASY A;  1KXL A;  1SR3 A;  1I6H H;  1E22 A;  3CPF A;  3RLF A;  2VY3 A;  5FLX c;  2YU9 H;  4LF6 Q;  1FJG Q;  4JI3 Q;  1XJV A;  4DUY L;  4ME3 A;  3GDE A;  3TS0 A;  2Q2I A;  4IFD G;  2R92 H;  4DNI A;  3TS2 A;  3G71 A;  1SRO A;  3G4S A;  1M1K C;  3OTO Q;  4LF4 Q;  4LFC L;  2Z6K A;  2UXD Q;  1VQG A;  1SN8 A;  4YWL A;  1Q82 C;  2ATW A;  1IBM L;  3OTO L;  2YV5 A;  2KEN A;  4PZ8 A;  4R4O A;  5IP7 H;  4QJF A;  1VQK A;  2MNA A;  4AQY Q;  1YHA A;  4JCV E;  1N34 L;  2OCE A;  4JI1 L;  2E2H H;  4X65 Q;  3ULP A;  4JBM A;  2IHF A;  4GKJ L;  5AJ3 Q;  4X6A H;  4JC0 A;  3CC2 A;  1JJ2 A;  1PFS A;  4JI4 Q;  4DR4 L;  2IX0 A;  3BZK A;  2BA0 A;  4DV2 Q;  1PH9 A;  5AJ3 L;  3HOZ G;  3G48 A;  2D0O A;  5IYD H;  1NE3 A;  2PI2 E;  4MZ9 A;  1VQ5 A;  2YTX A;  1VQP A;  2MFI A;  2EXD A;  3ZJY C;  4LF5 L;  3F2C A;  1HJP A;  1I50 H;  3E9H A;  1A8V A;  1E7Z A;  5JEA J;  1GD7 A;  1KAW A;  3GTJ H;  4NXN Q;  1VQJ A;  1Q1B A;  1N33 Q;  3RNU A;  4B3R Q;  2V1C C;  4JI2 L;  4YY3 L;  1KL9 A;  4R4I A;  4X66 L;  4GNX A;  1N34 Q;  1IXR A;  2CKZ B;  4WJ3 M;  4R4Q A;  3TEH B;  1U5K A;  2QGQ A;  4X65 L;  5LMN W;  1X65 A;  2XGT A;  3TQY A;  4YY3 Q;  4IFD J;  4OXP A;  3CAM A;  1QVC A;  1N36 Q;  4DUZ L;  5M3F H;  1HR0 L;  1IBL Q;  1YZ6 A;  2YYZ A;  1QZG A;  4JI7 L;  4NB3 A;  4HIM A;  4A75 A;  1OXV A;  2ZJP A;  1K8G A;  3F2D A;  2I5M X;  1SE8 A;  4OX9 Q;  5JJI A;  3RLO A;  3BU2 A;  1XPR A;  4OO1 G;  4X62 Q;  2HIX A;  1PV4 A;  4OX9 L;  2ES2 A;  1VQI A;  5HGQ A;  1I3Q H;  4AYB E;  4KHP Q;  1HH2 P;  5FLM H;  3HOX G;  4B3R L;  1X9N A;  2WFW A;  2UUA Q;  3W1B A;  3PUZ A;  4JI5 L;  5C3E G;  2NVY H;  4C2M H;  2YTY A;  2Z6K C;  4DV1 L;  1VQN A;  4DR5 L;  2MO1 A;  5C3E H;  3PO2 H;  4B3M L;  4B3T Q;  1Z47 A;  2D0P A;  3D0F A;  3K7U C;  5JEA G;  1IL2 A;  4IOA A;  1N36 L;  4Y52 H;  2ZTD A;  3GTO H;  3KLW A;  2AWO A;  1KHI A;  4A3M H;  1OXX K;  3KF6 B;  1QVF A;  3GTM H;  1A62 A;  4LF8 L;  4LF7 L;  4WJ4 A;  1OXT A;  3J81 c;  4JYA L;  3HFZ B;  1YJW A;  2EQS A;  4A3B H;  3NEL A;  3CCM A;  5IWA Q;  3S2D H;  2CCZ A;  1TWG H;  4DR5 Q;  2HIV A;  2NN6 G;  4OWX B;  3E9I A;  3PV0 A;  4LUV A;  3DLL A;  1PA6 A;  4HJ9 A;  4QGU A;  2UU9 Q;  2UXB Q;  3JAM i;  1WJJ A;  4LF5 Q;  5GQO A;  4JI8 Q;  4JI6 Q;  1EYG A;  1VQD A;  3U4V A;  2R93 H;  1L1O C;  2JE6 I;  2LSS A;  5GRO A;  1HZB A;  4RG1 A;  4L5Q A;  3FHW A;  1CUK A;  4IO9 A;  3T1H Q;  3T1Y L;  3M7N A;  2R93 G;  4JG2 A;  3CCL A;  3WWV A;  2B3G A;  2Y0S G;  2KCT A;  4DR7 Q;  1NMF A;  2E2I H;  3KDF B;  1YJN A;  2JA8 H;  1M90 C;  5EAY A;  4DR4 Q;  3AYH B;  2IY5 B;  4A76 A;  3PUY A;  1K9M C;  2HQL A;  4LF8 Q;  1I5F A;  3FP9 A;  1BBW A;  4DR2 L;  2B63 G;  2K5H A;  3K7A H;  2JEB I;  2B63 H;  1X3G A;  1VQ4 A;  3UDI A;  4A3G G;  2VUM G;  2WB1 G;  4JI0 Q;  4HJ8 A;  2VZA A;  2ID0 A;  1JJG A;  1GM5 A;  4UY8 C;  2JK8 A;  1W3S A;  1VS0 A;  2VL6 A;  3CP0 A;  4NXN L;  3AFP A;  4BA1 I;  5LMN L;  1Q8K A;  4KI0 A;  2KHI A;  2N3S A;  1XMO Q;  5GAD C;  1EUJ A;  1VQ8 A;  1MJC A;  1UE6 A;  2OQ0 A;  3A0J A;  2QA4 A;  1E1T A;  5ELO A;  4BBS G;  1VQF A;  2E5L L;  1XNQ Q;  3I4N G;  1MKH A;  4A3K H;  4DV1 Q;  3HKZ G;  4IPG A;  1KIX A;  1FL0 A;  2N49 A;  1LTL A;  2ZTE A;  1IBL L;  3RN2 A;  1IYJ B;  1J5E L;  4KLK A;  3HKS A;  4DV7 L;  3GTL H;  1EIF A;  2JA5 H;  2BH2 A;  2K50 A;  1K83 H;  4A3I G;  1J5E Q;  3S1Q H;  5FJ8 H;  3CME A;  1N9W A;  4L5R C;  4APV A;  1JMC A;  3HKZ E;  1JB7 A;  3Q8D A;  4R1J A;  1MIU A;  4IOC A;  3ICE A;  1HNX Q;  5C0X G;  5M5Y H;  4GOP A;  2CWP A;  3K81 C;  3I4M H;  1BVS A;  1AH9 A;  1D8L A;  1K0R A;  1VQA A;  2NN6 I;  4LWC A;  3W5O A;  5M5X H;  2L15 A;  2AWN A;  4L5T A;  2E5L Q;  3J80 i;  4DR1 L;  3PF5 A;  2LXK A;  3J81 j;  4JI8 L;  4BY1 G;  1I94 L;  4NPS A;  3G6E A;  4LFB Q;  4A93 G;  4QY7 A;  3JC6 6;  3F8T A;  4LFB L;  3I56 A;  1N32 L;  4A3E G;  4IFD I;  1Q12 A;  2XTI A;  3GTK H;  3FKI H;  4A3E H;  3KJP A;  4JBW A;  4DV6 Q;  2JA7 H;  2F3I A;  4JOI C;  4GKK Q;  2A1A A;  2DUD A;  4LW1 A;  1GVP A;  1HNX L;  3EBE A;  4IJL A;  4HIK A;  3MEF A;  3PGZ A;  2UUC L;  3PO2 G;  3I7F A;  3S1R H;  2K5V A;  1S72 A;  3OYY A;  4A3C H;  4YWM A;  1VQM A;  4QIW E;  2R92 G;  3T1H L;  4C3J H;  4IPD A;  4A3C G;  2JA6 H;  2GN5 A;  4NXM Q;  1SRU A;  1NMG A;  4R4T A;  3CCV A;  3CC7 A;  1IBK Q;  1JJC B;  3PSI A;  1YIT A;  1LYL A;  4GLV B;  1VQ6 A;  1KQS A;  3LGJ A;  4IPH A;  5IP7 G;  3BJU A;  1C7Y A;  2R7F A;  3SGI A;  2HT1 A;  4JV5 Q;  1WFQ A;  3HOY H;  4BXX G;  5C44 G;  1VQC A;  1VQ9 A;  3PCO B;  4DV6 L;  3CW2 C;  4L5S A;  1GKH A;  4YCU A;  1VQO A;  2K5N A;  3STB D;  4DR3 Q;  4JI3 L;  3ER0 A;  3JAM c;  4GOP B;  3TRE A;  1PYB A;  4HJA A;  4JBJ A;  5IYD G;  4HJ7 A;  2VW9 A;  1PH3 A;  1VQH A;  2CWA A;  4RMF A;  1L0W A;  1EWI A;  1IBM Q;  1PVO A;  5C0X I;  3MXN B;  4YHH L;  1B70 B;  4JI5 Q;  4A4I A;  4HIO A;  4AYB G;  3CCR A;  3RZO H;  4B3S Q;  3VDY A;  1PH2 A;  4A3J H;  1UWV A;  2JA9 A;  4A3G H;  4YCV A;  4GLX A;  2KCM A;  4DKA C;  4JOI A;  3L2P A;  1G6P A;  1TWA H;  5C4X H;  4OO1 I;  5C4X G;  4LF4 L;  2B29 A;  1EQQ A;  4J15 A;  1HNZ L;  1C0A A;  4KHP L;  3M4O H;  2VQE Q;  4R4C A;  1VQ7 A;  2CFM A;  4DV4 Q;  1KD1 C;  1NJI C;  3HOW H;  4BBS H;  3U58 A;  4K0K Q;  2IX1 A;  2R7Z H;  1EQR A;  2LXJ A;  3HOV H;  4A3K G;  3CCJ A;  3CCQ A;  3PO3 H;  2R7Z G;  2RHS B;  2PQA B;  2AMC B;  1EIY B;  3HOV G;  3PO3 G;  5GAG C;  2AHO B;  4A3L H;  3T1Y Q;  2ZJR A;  4GOP C;  1FGU A;  4LNQ A;  3S17 H;  2RCN A;  1HZ9 A;  4X64 Q;  5BR8 L;  3K80 C;  1X56 A;  4JBK A;  2JEA I;  3KDF A;  3ERS X;  1MJE A;  1E1O A;  1XNR L;  2I0Q A;  1HNW Q;  5BR8 Q;  2VQF Q;  1QUQ A;  4GKJ Q;  1X3E A;  1YI2 A;  4UP8 A;  5IWA L;  3A5U A;  4AH6 A;  1SFO H;  2OTL A;  2DGY A;  3U4Z A;  4BY7 H;  3CCS A;  4DV2 L;  2MQH A;  4A3M G;  2VQE L;  4DR6 Q;  4BY7 G;  3IRB A;  1Q86 C;  1YJ9 A;  1A0I A;  1X54 A;  2K75 A;  1R9T H;  2PI2 A;  4AIM A;  4X62 L;  1TWF H;  2N78 A;  3PIP A;  5IYB G;  4A3D G;  3I4O A;  2Q2T A;  1D7Q A;  4POF A;  1UE5 A;  1XMQ L;  2RHQ B;  2IHE A;  1L2F A;  1YBY A;  2K4K A;  1PHJ A;  2GVB A;  1UE7 A;  3TRZ A;  2MO0 A;  3H0G G;  4JI2 Q;  1WCM G;  2JJQ A;  3I55 A;  4DR2 Q;  1HNW L;  3AFQ A;  4MTN A;  2JA8 G;  4JV5 L;  1Y14 B;  4GN3 B;  2NZH A;  4QL5 A;  1YVC A;  1WOC A;  5IP9 H;  4JI0 L;  1CKN A;  4LF7 Q;  4LUO A;  4DR6 L;  5IP9 G;  1HZC A;  1TWH H;  3GO5 A;  1S3O A;  4JI7 Q;  4DAY B;  4QQB X;  1V43 A;  4P73 A;  4PZ6 A;  1G51 A;  1K8A C;  3L0O A;  2UUA L;  1KRS A;  4C3I H;  1CKN B;  1QZH A;  3UE0 A;  4UP9 A;  2UU9 L;  3S16 H;  1XTD A;  1XMQ Q;  3E0E A;  4H02 A;  4B3T L;  4B3M Q;  4A3F G;  2VUM H;  5IE8 A;  2UXC Q;  3F1Z A;  1TWC H;  4OWW B;  3CPW A;  1SMX A;  1TXY A;  4A3F H;  1GO3 E;  3PUV A;  1PH1 A;  4YCW A;  1PH5 A;  2I5H A;  1PH7 A;  1V1Q A;  3H3V I;  2OQK A;  2Y0S E;  3BZC A;  4PMW A;  5C44 H;  1VQL A;  4BBR H;  3K0X A;  4UP7 A;  5M3M H;  2ZJQ A;  4POG A;  4GNX B;  3M9B A;  1Y1V G;  4BBR G;  5M3M G;  3HOZ H;  1XPO A;  4P72 A;  1PH4 A;  3ULL A;  3GTP H;  3ULJ A;  4DV3 Q;  1HR0 W;  3CMA A;  1XNR Q;  2Q2H A;  2GVA A;  2FXQ A;  4XIG S;  1J6Q A;  4DV3 L;  2JA5 G;  3GTG H;  1JE5 A;  1OTC A;  3J81 i;  5ELN A;  3OW2 A;  1E24 A;  1WYD A;  4JI6 L;  4GKK L;  1AE3 A;  2A8V A;  3J7A 5;  5JJK A;  1NTG A;  1YNX A;  2UXB L;  1EOV A;  2E8G A;  4MNO A;  3I4M G;  2KBN A;  4A3J G;  4DR7 L;  4OON A;  2D62 A;  1QVG A;  2NVT H;  4TVA B;  1Q81 C;  1K73 C;  1N33 L;  4NXM L;  1CSQ A;  4X64 L;  4IJH A;  4PZ7 A;  4DPG A;  1S40 A;  3UE1 A;  1YEZ A;  2VS1 A;  3CCU A;  3F2B A;  2EIF A;  1KC8 C;  2VQF L;  4A93 H;  4BY1 H;  5IY0 A;  3U50 C;  5LMU L;  2R7D A;  4GN4 B;  1OXU A;  2NZO A;  1KRT A;  3AQQ A;  4DV7 Q;  4LFA Q;  3HOX H;  1VQE A;  1Q46 A;  1X55 A;  1N8R C;  2F4V Q;  2JQO A;  3DM3 A;  1XMO L;  1Z9F A;  4C3H H;  4A3L G;  1X6O A;  1C9O A;  2CQO A;  2K52 A;  3L7Z C;  3A5Z B;  2JA7 G;  4P75 A;  4LF9 L;  3S1N H;  2VNU D;  3EIV A;  2KHJ A;  3D31 A;  4EQ5 A;  1OXS C;  4LF9 Q;  5H1S E;  1WI5 A;  3H3V H;  1XNQ L;  2I5L X;  2JA6 G;  1Q1E A;  4GS3 A;  2PNH A;  1BBU A;  4A3B G;  1N32 Q;  4LFA L;  1B8A A;  5K36 G;  1YIJ A;  1O7I A;  1UEB A;  4GN5 A;  1IZ6 A;  2F4V L;  5DLQ E;  3KOJ A;  3RN5 A;  1RL2 A;  3HOU H;  4LUZ A;  3HOY G;  1Y1W G;  4UPA A;  3S15 H;  4EX5 A;  3CF5 A;  4BXX H;  4JYA Q;  5LMN Q;  3RZD H;  1CKO A;  1LM0 A;  4Y7N H;  3UDF A;  3M85 A;  2ZTC A;  1Y1W H;  2K14 A;  3EN2 A;  4GLA C;  4LFC Q;  4K0K L;  2UXD L;  1WCM H;  1QUQ B;  5GAE C;  1I94 Q;  3S2H H;  1HZA A;  2WP8 J;  4AQY L;  1JT8 A;  4DV5 Q;  3W1G A;  3A74 A;  4XTC S;  4YWK A;  4KHZ A;  3J80 c;  4DR1 Q;  3GD7 A;  3CC4 A;  1VQB A;  4DK6 C;  3CD6 A;  4DV5 L;  3KF8 B;  4P74 A;  1P8L A;  3RR5 A;  2PQA A;  2WAQ E;  3S14 H;  3PUX A;  2WAQ G;  1HNZ Q;  3PUW A;  4P71 A;  2UUC Q;  4OWT B;  1NBW A;  1B7Y B;  3NEN A;  1L1O A;  3RLN A;  4DV4 L;  4ALP A;  3CCE A;  5LMU Q;  2OTJ A;  3M4Q A;  2N8N A;  4O0A A;  4O2D A;  5C0X J;  1W2B A;  4DR3 L;  5M3F G;  1ASZ A;  4HID A;  2Z0S A;  3B6Y A;  4GNX C;  1L1O B;  3NEM A;  3HOW G;  3S24 A;  3GTQ H;  2BA1 A;  1VCI A;  1UE1 A;  1RIP A;  2WB1 E;  5C4J H;  3HOU G;  1P16 A;  3K8A A;  4DK3 C;  1YHB A;  2AKW B;  2R6G A;  2OWO A;  2NVX H;  4JI1 Q;  1H95 A;  2NVQ H;  3I4N H;  5M5W H;  1Y1V H;  2QEX A;  4IPC A;  3CQZ H;  3PIO A;  3KFU A;  4X66 Q;  3PF4 A;  1CKM A;  5FLM G;  4JI4 L;  2ZM6 Q;  2UUB Q;  1IBK L;  1AE2 A;  1LUZ A;  1XPU A;  2HHH L;  2C35 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...