2JA5G

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja5G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja5G01
4A3BH 2PMZE 3D0FA 4BBSH 3PUYA 1TWCH 1E1TA 4A3DH 1SLJA 3L2PA 2L15A 1IL2A 4DV2Q 1PH4A 3CCRA 3NENA 1QZGA 1CUKA 4AQYL 3RZDH 3L7ZC 3HOUG 4WJ3M 1MKHA 4DAYB 2FXQA 1N36L 4OX9Q 1WYDA 4JI5Q 4LF5Q 4MZ9A 1HNZL 2I0QA 3A5UA 3CF5A 1OXUA 1VQHA 2Q2HA 4LW1A 4A3DG 4HJ5A 4HJ7A 1GD7A 4NPSA 1U5KA 1YHBA 4A3IH 4DR3L 3W1GA 4B3SL 3EBEA 4LUOA 1N32L 5M3FG 3S16H 4GKKQ 4TQUS 1C9OA 2K75A 4MTNA 1XMQL 4IJLA 3S2DH 1HNWL 5JJKA 1N34L 3CC7A 3I4MG 2KCTA 4P74A 1QUQB 1JE5A 3GDEA 1U0LA 4K0KQ 4ALPA 4GNXA 4JYAL 4JI4L 4A3IG 4WJ4A 4B3TL 4A75A 2IX1A 1QVFA 3CD6A 2VUMH 2UUAQ 2YTXA 3RZOH 1Q8KA 1PH8A 1L1OC 4QIWE 1VQCA 4XTCS 4JI6L 1PFSA 5C0XG 4IJHA 3HOWH 3ICEA 1EIFA 4GOPC 3KF6A 4DNIA 4TVAB 4BA2I 3AQQA 2F52A 2VUMG 4YHHQ 4AYBE 2K4KA 1MIUA 2ZM6L 1LUZA 1I94L 2OTJA 1J5EQ 3UDFA 1JJCB 2Z0SA 1QVCA 2F4VQ 3OTOQ 3K7AH 4LFAQ 3KYHC 2JK8A 2MNAA 4L5RC 4DV1L 1L1OB 4JI2Q 2N3SA 1E22A 2UXCQ 4YWLA 4DUZL 3MXNB 1CKOA 4DV0L 3I55A 1BBUA 4DK6C 2BH2A 3GTOH 2HQLA 1SE8A 5GAEC 1N33Q 4GOPB 2JEAI 3PO3H 4OO1G 1N8RC 5M5XH 4LF6Q 1YITA 2BA0A 1CKNB 3UE0A 2JA6G 4OONA 3T1YQ 2A8VA 5IP9H 3M85A 2N49A 4OWWB 2K5VA 1KQSA 4DV7Q 4DR7Q 2UXDL 3MEFA 2E8GA 2UUBQ 1CSQA 1EQQA 4LFBL 3CXCA 3H3VI 2B63H 4A3LH 4GLAC 5HY6A 1ASZA 3PO3G 1Q1EA 2OQ0A 3WWVA 4BY1H 3ULPA 1VQ6A 4YY3L 4H02A 4GLXA 3TS2A 1I5FA 1I3QH 3TQYA 2K5NA 1SMXA 1DGSA 4R4QA 4B3RQ 5HGQA 5C0XI 1VS0A 4DV2L 3UDGA 3HOXH 2VQEL 4DV5Q 3S1MH 4A3LG 5AJ3Q 4RMFA 2D0OA 5LMUL 1VQFA 4OX9L 4IFDG 4PZ6A 4JI5L 2JA5H 4LF5L 2Z6KA 4IOCA 1YJNA 1VQEA 3NEMA 4QL5A 3D31A 3CCVA 1G291 2WB1G 1C7YA 1VQ4A 1C0AA 5IYDG 3KJOA 2WP8J 4A3JH 1AE3A 2AWNA 3T1HQ 4QY7A 5BR8Q 4UY8C 4L5QA 1IBKQ 4GKKL 2JA5G 2AWOA 4OO1I 1HR0Q 2YYZA 1V9PA 1XMOQ 2XGTA 3U50C 1VQAA 1PH5A 4DAMA 1Q86C 5E7NA 3AEVA 4K0KL 4A3GH 2F3IA 4IPGA 1IBLQ 2NVQH 3CCSA 1KL9A 2NVYH 3BZCA 3CMAA 4A3JG 5FJ8H 2NN6G 3ERSX 2UUAL 5FLMG 3K8AA 3GTKH 1VQKA 1B7YB 1W3SA 4A3EH 4BY7G 2JE6I 2AHOB 1EQRA 1CSPA 4GKJL 1PYSB 3PSIA 2WFWA 5GAHC 3PUXA 2UUCQ 3PV0A 3S15H 4Y7NH 1VQ5A 4P71A 4QQBX 4X65Q 4YHHL 1IBMQ 1X3FA 1WCMH 4IPDA 4OWXB 2ZJPA 4Y52H 3IRBA 3J80i 2F4VL 3OTOL 4LFAL 3A0JA 4IFDJ 4ME3A 4R4TA 1JJGA 2H5XA 1EIYB 4JI2L 2UXCL 1UEBA 1KRTA 1YJ9A 3RLOA 1KAWA 5ELNA 2I5LX 5H1SE 1QUQA 1D8LA 1OXVA 1N33L 4NXNL 4P75A 4UPAA 3CAMA 3Q8DA 4LF6L 1L0WA 4A3BG 2DGYA 3HOYH 4BBSG 3T1YL 1RIPA 3AFPA 3I4OA 3I7FA 4JBJA 1VQ8A 4JBWA 1IYJB 1Q81C 4C2MH 2ATWA 3I4NH 5JJLA 1GVPA 2IHEA 4DV7L 1EUJA 1K83H 1X54A 3HKZG 4R1JA 1X55A 2UUBL 4LF4Q 3S1NH 1NBWA 1P16A 4BBRH 1VQDA 3KLWA 3JC66 3F2BA 1KD1C 1BKBA 3F2CA 1T9HA 2K52A 5J3BA 1UWVA 4DV6Q 3OW2A 1I50H 1PYBA 4LNQA 4BXXH 1I6HH 2CWAA 4IPHA 3I4NG 1PV4A 1WJJA 2JA8H 4DR1L 2IT1A 4B3RL 3S1RH 1HJPA 1FL0A 4YWKA 2RHQB 3A74A 1EWIA 1NY4A 1HH2P 2RCNA 4GN3B 4JOIC 1HZCA 5AJ3L 1NMFA 1TWGH 1L1OA 4JBKA 3M7NA 2D0PA 3RR5A 3AFQA 4KHPQ 2Y0SG 4GOPA 3M4OH 1KXLA 3GTGH 4C3HH 2QA4A 2LSSA 4HJ9A 1K0RA 4O0AA 1KRSA 1L2FA 2VQFQ 1HZBA 2CKZB 1UE5A 3RLNA 1FGUA 1NTGA 1BVSA 2KCMA 2MQHA 5BR8L 4HIOA 3T1HL 3HOWG 2NZHA 4DV4Q 1IBKL 4JI1Q 1HR0L 3RNUA 1XMOL 2PI2E 4J15A 4A4IA 3SGIA 1QVGA 2ZJQA 3PO2H 5IYCH 1X65A 5IYBH 2CFMA 2R7ZH 2HIXA 3BJUA 1IBLL 4NB3A 2HT1A 4DR2Q 4BA1I 4C3IH 2HIVA 1YHAA 4GN5A 4DPGA 3GTQH 4OXPA 3PUVA 3ZJYC 3J81j 3FP9A 3CC2A 1Z9FA 2VS1A 1KC8C 1SRUA 4HJAA 2PQAB 4JCVE 3F1ZA 1OXXK 2I5MX 2Q2IA 5C4XH 5IYBG 2UUCL 2CQOA 4DR4Q 1PH2A 3ULJA 3BU2A 4X65L 4X62Q 3K80C 3CCUA 1IBML 4LF8L 5IP9G 4IOAA 4YCWA 2JA9A 2R92H 4JI3L 1Q82C 1UE1A 4AH6A 5IY0A 4GLVB 1HNXQ 4DR6Q 1Y1WH 1XPUA 2YTVA 2B63G 1Y1VH 2UXBQ 1OXSC 1X56A 4PMWA 1YIJA 1JB7A 3G48A 4BY1G 3S14H 1YZ6A 2NVXH 2KHIA 1VCIA 3A5ZB 1SR3A 1B8AA 2ES2A 4B3SQ 3W5OA 1FVIA 4IPCA 1PH1A 1SROA 4X66Q 5GADC 1Y1WG 3HOXG 4A3KH 5M5YH 1M90C 4LF7Q 2N8NA 4LF4L 1NMGA 3HOVH 2IX0A 3M4QA 5ELOA 2E5LQ 3KF8B 2QEXA 2BA1A 3KOJA 3B6YA 4DV6L 2Z6KC 3PGZA 1O7IA 1KIXA 4L5TA 3KDFB 4A3KG 4JG2A 1LM0A 3STBC 1G51A 2WAQG 2Q2UA 1HZ9A 3F8TA 5M5WH 1XPRA 1X9NA 1HZAA 4JI8Q 2IY5B 1D7QA 3HOVG 5LMNQ 2MO0A 1BBWA 3PUZA 2EIFA 3J81c 3AYHB 4A3GG 4YCUA 4NXMQ 4A3FH 3PIPA 3NELA 4KHPL 5JEAG 5FJ8G 5IE8A 4QGUA 1ASYA 4LFCQ 3PCOB 4UP8A 1WFQA 4DV1Q 2VQFL 2ZTEA 5K36G 1J5EL 2K14A 4R4OA 4A3EG 3CMEA 3G6EA 3KFUA 1YBYA 4DV4L 4A93H 4IFDI 4JI1L 5FLXc 2C35B 1E24A 4DV3Q 3F2DA 4DKAC 4A3FG 5IP7H 3CCQA 5IWAQ 4HJ8A 4AIMA 2KENA 4JBMA 2WB1E 4HIDA 3GTLH 4DR2L 1WCMG 3I56A 1W2BA 1NJIC 1EOVA 3FKIH 3DM3A 3S24A 3GD7A 3HOUH 1N9WA 2R7DA 3J81i 3S1QH 4A93G 4P72A 3M3YH 3K0XA 1A8VA 4LUVA 1YJWA 1E7ZA 5IP7G 1IZ6A 1S72A 4POFA 1TXYA 3CCLA 2QGQA 1VQGA 3HKSA 4EQ5A 2ZTDA 3J7ZC 3CPWA 3S17H 4AYBG 4PZ7A 3HOZH 4YCVA 2WAQE 2NN6I 1TWAH 1UE7A 3FKIG 4R4IA 3ULLA 2VQEQ 4X62L 4HIKA 1SFOH 2D62A 3CCEA 3STBD 2B3GA 2MO1A 5LMUQ 5M3FH 3E9HA 4A3MH 4JI0Q 2OQKA 1XNRQ 2UU9Q 2NZOA 1VQOA 1HNXL 1X6OA 1LYLA 4DR6L 3K7UC 2A1AA 2AMCB 1YNXA 2GVBA 1K8GA 4BBRG 3I4MH 4DV5L 2UXBL 3H3VH 2VL6A 3H0GH 2DUDA 1VQMA 3HOZG 5JEAJ 3M4PA 3PIOA 4JOIA 2OTLA 4A3MG 4B3MQ 2JEBI 4O2DA 4BXXG 3EIVA 4XIGS 4JV5Q 4DR5Q 2CCZA 4X64Q 3E0EA 2JA8G 3FHWA 3UDIA 4X66L 1CKNA 2VW9A 4JI7Q 2E2HH 2GN5A 1A62A 3CQZH 3CW2C 4GNXC 2K50A 4HIMA 3RN5A 1MJEA 2HHHQ 2JA7H 1KHIA 3I2ZA 4KLKA 2EQSA 3H0GG 2PQAA 5GQOA 4LF7L 2YTYA 2BH8A 1YEZA 4DK3C 4A76A 4MNOA 1FJGQ 5DLQE 1AH9A 3GO5A 4LF9Q 2E5LL 1K9MC 1Q1BA 1HR0W 3CCJA 2ALYB 3LGJA 3GTPH 2JA7G 4GKJQ 1H95A 5JJIA 1Q46A 3U58A 3HKZE 1X3EA 4JI8L 4LWCA 1A63A 5LMNL 4DUYQ 4LUZA 2N78A 4GNXB 1CKMA 1Q7YC 1XNQQ 1K73C 1PH9A 3RLFA 5LMNW 3PO2G 2B29A 3OYYA 5IYCG 3NBHB 2R6GA 2R7ZG 1VQIA 2JQOA 3TEHB 4NXML 2JA6H 1EFWA 4DR7L 4EX5A 2MFIA 4RG1A 3UE1A 1VQ7A 1OTCA 3L0OA 4LFCL 1S3OA 1GKHA 4AQYQ 2ASBA 3VDYA 1OXTA 3KJPA 3JAMc 3KF6B 1N36Q 3PF4A 1XPOA 5GROA 3UDXA 1GM5A 1V1QA 4PZ8A 1S40A 1PA6A 1HNZQ 4NXNQ 3HFZB 5C4XG 1XJVA 1JJ2A 4KI0A 1K8AC 4DV3L 2OCEA 1QZHA 2Y0SE 5IWAL 5C44H 4DR3Q 3PF5A 2RF4A 4C3JH 1XTDA 1N32Q 2R92G 2R7FA 2IHFA 3KDFA 4A3CH 1B70B 4KHZA 1XMQQ 1HNWQ 3H15A 1WOCA 1N34Q 1TWHH 5C4JH 2JJQA 4UP7A 1PHJA 4QJFA 2PNHA 5IT9c 3CC4A 1P8LA 1Y1VG 3S2HH 1YHQA 4JYAQ 1LTLA 4JI4Q 5C44G 4B3TQ 2AKWB 4DR1Q 3EN2A 3U4VA 2YV5A 2I5HA 5C0XJ 2LXJA 5IYDH 2GVAA 4FDBA 1Q12A 3JAMi 4POGA 3CPFA 4DR4L 4A3CG 3W1BA 2OWOA 4JI6Q 2NVTH 5C3EH 1JMCA 4JI0L 4JC0A 1XNRL 2VZAA 2LXKA 2UU9L 2ZTCA 1Z47A 3CP0A 2E2IH 1VQNA 5M3MH 3J7A5 3TRZA 3RN2A 2RHSB 1Y14B 1EYGA 3HOYG 5EAYA 1IXRA 1PH7A 3PUWA 1K3RA 1VQPA 1SN8A 1UE6A 1VQBA 2VY3A 2ZM6Q 3CCMA 4IO9A 1I94Q 2E2JH 3ER0A 1A0IA 4X6AH 4APVA 1VQ9A 4B3ML 1J6QA 5FLMH 5C3EG 4JV5L 2VNUD 4DR5L 1RL2A 2R93H 1TWFH 2CWPA 4X64L 1E1OA 2KBNA 5M3MG 3BZKA 2ID0A 3J80c 4BY7H 4JI7L 4DUZQ 2A19A 2KHJA 4DV0Q 3TS0A 2HHHL 4R4CA 4P73A 4UP9A 5GAGC 3M9BA 1GO3E 3G4SA 1PH3A 2YU9H 2V1CC 1AE2A 1FJGL 4YWMA 3GTMH 3DLLA 4LF9L 1YI2A 4OWTB 2R93G 4GN4B 3U4ZA 1JT8A 2UXDQ 1G6PA 1WI5A 1E3PA 1NE3A 1V43A 3E9IA 2K5HA 1M1KC 2XTIA 4LFBQ 2PI2A 2Q2TA 1MJCA 4GS3A 4PG3A 3K81C 1VQJA 2EXDA 3TREA 1R9TH 4L5SA 3G71A 4DUYL 4YY3Q 1PH6A 1X3GA 4LF8Q 1PVOA 1XNQL 1YVCA 4JI3Q 3GTJH 2ZJRA 1VQLA
chains in the Genus database with same CATH superfamily
4BBSH 3PUYA 4Y7NB 1DOLA 4KTAA 3L2PA 2ZJTA 1IL2A 3OIPA 3CCRA 3T51B 1QZGA 2L1BA 3SR1A 3HOUG 2AQ4A 1EY6A 2BCOA 2I0QA 3A5UA 3QO2A 5CV6A 2Q2HA 3BA9A 2IJ0A 4A3DG 3N8DA 1QB5D 5I47A 2FK2A 1O7LA 5DG9A 3QZ8A 3NPPA 3VR6A 2DWCA 3K5MA 4JI1H 1DZ1A 2K75A 4O4HF 1HNWL 5IGEA 1N34L 4C2MB 3GDEA 5CGKA 2ZDQA 1K83B 4KY7A 4GNXA 2I07B 1QE6A 2VUMH 4KY5A 2F0DA 2YTXA 3RZOH 2K04A 1XXGA 1PH8A 2PN1A 4DR7H 2W6PA 3NWTA 4J9OA 1PFNA 1UNNC 4DAPA 3KF6A 4I65A 4ED7A 4TVAB 2JA6A 3AQQA 4MV8A 4FXGC 1DIKA 5KG4A 1PFMA 4AYBE 1MIUA 1X3PA 2DY8A 1II3A 5FK9C 2ZM6L 3A7LA 5DQIA 2Z0SA 4TQSA 2R7NA 1SEBD 1QVCA 3Q23A 3M4OB 5D8DA 4DV5H 3KYHC 4C3HB 4JI2Q 2UXCQ 4YWLA 1CKOA 2A6HD 1BBUA 1ZYRD 2HQLA 4OO1G 3MXGA 3PO3H 1ILPA 1N8RC 4ULLA 4LF6Q 2KSWA 1CKNB 3UE0A 4LMQD 4OONA 1DYQA 3MAQA 2A8VA 4TSSA 5FOBB 4OWWB 4I50F 1EYDA 4DR7Q 4LF7H 3MEFA 1GSHA 1BBXC 3DUZA 4ME5A 4F88A 1F2YA 2WIIB 3PR4A 1GHKA 2R85A 5D65A 2NU6B 2I46A 3EQLC 4GLAC 4K6LA 4ECZA 5DGBA 4YY3L 4HR7A 5KFAA 3R2TA 4CKBA 3J80E 1KJIA 4EGVA 2LFNA 4G7ZC 1DGSA 5HGQA 2JA5A 1I4GA 1VS0A 2J6SA 4JI8H 2E2IA 5LMNH 1ZQ7A 5KFYA 3HOXH 4DV5Q 5AJ3Q 3K5OA 2IW3A 2R92B 1XWEA 4R7RA 1VQFA 2R84A 5COYA 2IWHA 1A15A 1YJNA 2VA3A 3SXHA 4LFCH 1A3UA 1G291 1IBMH 3KJOA 3C1FA 2W6MA 4A3JH 2NVXB 4I7HA 4HSVA 3T1HQ 2FMAA 1CS0A 1XMOQ 5IWAH 2XGTA 3E3XA 2SOBA 5FD6A 1Q86C 4KY6A 2F3IA 3DM1A 3OUUA 2FK3A 4RB3C 1SJHD 2PZTA 4RFBA 4RHSA 5FJ8H 3HOVB 3T13A 5FLMG 2PQEA 3R5HA 1VQKA 2I80A 1Y8PB 4P2CB 4BY7G 4WJWA 4RWSC 2AHOB 1EQRA 1CSPA 1ICWA 1PYSB 3PSIA 4DAYA 1AUVA 1D1KA 2XWBB 1WTHA 4M9UA 2B8GA 1VQ5A 3A8KE 1IBMQ 4BWGB 2J9GA 1LO5D 1BXTA 1LTGD 3IRBA 4KJOA 3QFFA 4UCOA 3QIAA 3RUPA 4JV1A 4ME3A 4R4TA 3WO1A 2H5XA 4K2LA 2V5AA 4JI2L 1IW7D 1WCMB 2UXCL 2RDJA 1UEBA 4UCRA 2PZUA 5ELNA 3FMCA 5H1SE 1QUQA 1OXVA 4NXNL 4A93B 5KFMA 4UPAA 4LF6L 4A3BG 5KFLA 2W8LA 2WDTA 1RIPA 3AFPA 3I4OA 3I7FA 2BDNA 1VQ8A 4I55F 1H9SA 1IYJB 3VPDA 1B6RA 3OOCA 1GVPA 1JLLB 1EFID 4MTDA 1BCPD 1D5XC 1G2SA 1GJXA 1P16A 4CHTB 2Y0SA 1PK8A 3N43B 3JC66 3F2CA 2RA4A 1T9HA 2K52A 3TINA 2WV6D 1I6HH 2CWAA 5FPOA 2BR0A 3FPPA 3T53B 1EY8A 2JA8H 4K5WA 4DR1L 2OH2A 3NBHA 1O7ZA 3D4RA 1HJPA 3S1RH 1HH2P 2XN9C 4IALA 5AJ3L 1HZCA 4A3MB 4JV0A 1L1OA 4HNVA 4JBKA 2D0PA 4XYLB 3NQIA 2HVQA 4MA5A 1A2TA 4RAUC 3I4MB 2QEJC 4HJ9A 1L2FA 1S5FD 3U9TA 5NUCA 1LABA 2XNAC 3L4JA 1FGUA 3T1HL 4DR6H 4HIOA 1UC8A 2C2EA 2NUAB 1ZXTA 1QVGA 1XMOL 1R4QB 5C6AA 2E2HB 2XRQD 3VMMA 2UVRA 4IRCA 5IYCH 2P0AA 1BF4A 4RH6A 4C3HG 2W9BB 2ASJA 3LNNA 1HTLD 1W96A 4C3IH 1PTOB 1STNA 2ENBA 3MFYA 2W9CA 3F8NA 3CC2A 4ECVA 3ORQA 2VS1A 3PO2B 1SRUA 2FFKB 4IUNA 3V96A 2X0SA 4JYAH 4JI4H 5C4XH 2Q2IA 5IYBG 4B3TH 2AQ1B 4R8UA 2L12A 2VA2A 3BU2A 4ETSA 4IR9A 1IBML 2O5JC 4CJ1B 1SYBA 4YCWA 5KFOA 5DAUA 4YAKB 1TS4A 4DR6Q 3SI8A 1WTVA 2JP1A 1HXYD 3G48A 2Z1CA 4BY1G 1T94A 4ME6A 5D1OA 3S14H 2NU9B 4CKCA 2ES2A 1K0SA 1FVIA 3MVVA 5J2TF 4EYIB 4F8MA 4DUZH 2F1MA 4DV0H 4ZKCB 2IBKA 4HAEA 3V6HA 3TDQA 4OIKA 1VDZA 1S97A 5KYIA 3V4ZA 4GZYC 1FKAH 3K3VA 5EPJA 2V9WA 4DGZA 1TS2A 4K2KA 3VR5A 2QEXA 3JAML 1Y8OB 3KOJA 4J9QA 2UXDH 1S68A 1KC7A 2EJFC 4LFBH 4JG2A 5D3DA 3STBC 1G51A 2WAQG 1HZ9A 1XPRA 1E4GT 1FNWA 4ECTA 1HZAA 4R8NA 2PYKA 3HOVG 2XIGA 1G91A 5K36H 4JVZA 1BBWA 5C3EB 3OW7A 1L0YB 3GV6A 4A3FH 3PIPA 3URYA 2NYZD 4QIWA 3TBIB 1ASYA 5IGGA 5LMUH 2E2JB 5BMVF 3Q1KA 3V2TA 2EYPA 1J5EL 4UCVA 4A3EG 2UVWA 5D14A 2PVPA 5DQHA 3KBGA 5KFSA 5FLXc 3T5KA 2C35B 1E24A 4DKAC 3TMEA 1PZJD 4AIMA 4XZ3B 1JWUD 3GTLH 4IHJF 1WCMG 3M4IA 3L3OC 2KCNA 2YU9B 5J2UF 3I90A 1K8OA 3FKIH 1HUNA 2R7DA 3J81i 2EYMA 2F0GA 4A93G 4NLGA 3J81L 1WTOA 4K0KH 3M3YH 1A8VA 2KUMA 2VXWA 1EL0A 4POFA 2MHVA 5KNDA 4A2AA 4KD3A 3S1QB 4PZ7A 4YCVA 2WAQE 2NN6I 1TWAH 1UE7A 3ULLA 4HIKA 4DR4Q 3K58A 1SFOH 3CCEA 3K57A 3K5HA 3D6WA 5LMUQ 5M3FH 3E9HA 4JI0Q 2OQKA 1TWGA 4GKJH 1GSAA 5D3IB 4BBSB 1NCVA 1LYLA 4DR6L 3K7UC 2AMCB 1YNXA 4BBRG 4EVOA 5JVLA 3GTGA 3H0GH 2DUDA 2X6GA 5JEAJ 3M4PA 1RYRA 5ELFA 4A3MG 4BXXG 1PTOC 4XT3B 1EU3A 4FF1A 3HS0C 1CTMA 1NNXA 4RAYA 5ELBA 3QOJA 3CW2C 1MJEA 3RN5A 2R8IA 2K50A 2JA7H 1WH2A 2ICIA 2PQAA 2R7ZA 2YTYA 1EY5A 4A76A 4MNOA 3T1YH 5CV9A 3GO5A 3N40P 2ALYB 1A2UA 3LGJA 1CHQD 3H94A 4GKJQ 1Q46A 2NUCA 2VUMB 3K5NA 3RZOB 4FVMA 4LWCA 4TV9F 4LJZC 1A63A 3N44B 4DUYQ 5KFPA 4LUZA 4KV6A 5LMNW 3PO2G 5IT9E 1ENFA 3E5NA 2C5CA 2JQOA 3TEHB 2JA6H 1EFWA 3SVMA 4RG1A 1VQ7A 4O3OA 3PZPA 4ZI7F 3JSNA 5IGFA 3KJPA 1Y1VA 1QG7A 2FJ2A 3FRPB 1LTAD 5KT6A 3UDXA 1V1QA 1S40A 4IZOA 5KFCA 3HFZB 1J8IA 1KEEA 4J9SA 2Q8IB 4KI0A 4O3NA 5LYJF 4EBEA 2Y0SE 2FLPA 1F9RA 2A68D 4DR3Q 2D9UA 5BN5A 1PRTD 3PF5A 5IIFA 4C5BA 4C3JH 1PX2A 3PO3B 5BR8H 3RGZA 4QWBA 2L4NA 4XYOA 3KDFA 3J7AK 4DL2A 1XMQQ 1H9RA 3H15A 3JRXA 1WOCA 1GYFA 2B2TA 1IBLH 1DM0B 2I8CA 2PCFB 1YHQA 1L0XB 2C2RA 3U4VA 2YV5A 4QW8A 5IYDH 5JUMA 4FDBA 1Q12A 4A3CG 3CPFA 4DR4L 5FLXE 2NTTA 5EPKA 4EYHB 2A74C 4JI6Q 2NVTH 4JI0L 3JAMW 1B4OA 1EQTA 4O4IF 2VZAA 1MZBA 2ZTCA 3CP0A 2E2IH 1VQNA 1S5DD 3TRZA 1V1PB 2F03A 1IXRA 1WTQA 3PUWA 4L1KA 5EWEA 1I94Q 2HVSA 4JI3H 2H4OA 3ER0A 1RTOA 3OWFA 3M9NB 3BG3A 5C3EG 1H9KA 5E4WC 2R93H 2EYJA 2ID0A 1O80A 4FS2A 3TIGA 4A3JB 2F0WA 2V4QA 3TS0A 2FB9A 5BPHA 4JI5H 1WD1A 4TV8F 4LSXA 4UP9A 2LMCB 3M9BA 4Q8EA 4Q44A 4JV2A 2CQYA 5LHY1 3SK4A 3VYSA 4F50A 2JSOA 5KIXA 1GUOA 3U4ZA 2N88A 1R9TA 2NTSA 4KK7A 1AEXA 3E9IA 1NE3A 4UCTA 2K5HA 1EZ1A 4LF4H 3VPBA 1QILA 4F4XA 2FPGB 4L5SA 3TREA 1VQJA 5KFEA 1B9MA 3BVGA 4J9NA 4DUYL 1PH6A 1PVOA 3DEPA 2F0NA 4JI3Q 3GTJH 1VF5C 1VQLA 2PMZE 3D0FA 5IYZF 1V51A 4NP5A 1SLJA 3N41B 3LWUA 3J80W 4O3RA 5KFTA 3MFIA 5EKIA 2WKDA 2FXQA 4OX9Q 5JVH3 2FPPB 4JI5Q 1DV1A 4ECQA 1LT6D 3KBXA 4O3SA 2OLSA 4R9WA 4LW1A 3MWYW 1GGOA 2EY5A 3D4DA 1U5KA 4A3IH 5C5LA 1HTPA 4DR3L 3CQZA 3QWNA 1VMPA 3W1GA 5CA1F 5KFVA 4DV4H 4GKKQ 4ED8A 4TQUS 1SDFA 2KCCA 3D8GA 1S5BD 2C9OA 5CBEE 1XMQL 1LT5D 1B6SA 1K3BC 2JEJA 1M7JA 2KCTA 4P74A 3OMCA 1JE5A 1U0LA 4DR2H 3A54A 4WJ4A 1EWHA 4KD4A 2HD3A 4A75A 4PDBA 4O42A 3BVMA 5EGTA 4YBZB 5C1OA 2FP4B 4QIWE 1VQCA 4XTCS 4JI6L 1I6HB 5C0XG 4CC6A 1SMYD 4GOPC 5HBRB 5LOVF 3S1RB 1DOMA 4V190 1BUVT 2F52A 3RAQA 2VUMG 2K4KA 1JX4A 1I94L 1LUZA 3MWMA 5KX5F 1JQYD 2OTJA 1ET9A 1JJCB 3UQ8A 3GTOA 1CA6A 3SK6A 3G6VA 4L5RC 4DV1L 3VA5A 2O4XA 3MXNB 3HBLA 2BH2A 4DK6C 4N8FA 1T3NA 1TR5A 5GAEC 1N33Q 1EWCA 2VB2X 5I2YA 5M5XH 2BA0A 1RKNA 5IP9H 4N9TA 1TWHA 5KFGA 1I6VC 3MJFA 1K28A 4QWEA 4V0BA 2UUBQ 1EQQA 1ET6A 2CH4A 5CB4F 3CXCA 3H3VI 4A3LH 3PO3G 4MV7A 5CV4A 2OQ0A 3WWVA 4PV1C 1TT2A 1EYAA 3TP7A 4GLXA 5C4XB 1I3QH 3TQYA 1EYCA 1SMXA 2K5NA 4R4QA 4DNTB 4B3RQ 4ZOLF 1BCPF 4M8AA 3BQ0A 1KDCA 3OHBA 1M0TA 2R8KA 3IFDA 2VQEL 5JOBA 4TUYF 4RMFA 3W2DA 4OX9L 2LY7A 4JI5L 1XDNA 2Z6KA 4IOCA 1JORA 3NEMA 3PIO3 5K2MA 3CCVA 3S1MB 1JOOA 1C7YA 1FYCA 2K01A 3S14B 2NN6H 2AWNA 2CW0C 4QY7A 4UY8C 1CQJB 1EUDB 2XVSA 4L5QA 3H09A 1IBKQ 4GKKL 3I8ZA 4OO1I 4MV3A 5KFNA 2YYZA 3U50C 5L1IA 4DAMA 3TIIA 4NMZA 2RDGA 4X3SA 5E7NA 3AEVA 4ECXA 1O78A 1XX8A 2OT2A 4HCEA 2NVQH 1KL9A 2NVYH 3BZCA 3CMAA 4A3JG 1RYSA 3E5SA 2YYAA 1RJTA 3PN1A 5I2XA 1I7NA 2KJXA 3PW7A 1CQFA 4JPBW 2J6UA 1B7YB 1W3SA 3J7AF 3EPIA 5GAHC 2WFWA 3PUXA 1S10A 5KFKA 1TWCA 1V1OA 4J1MA 2QDBA 4DV6H 4P71A 1KBLA 3H91A 1X3FA 3CKIB 1G8ZD 3OHAA 3C3LA 3DEOA 2PW5A 4A3FB 4Y52H 5CV7A 1F9SA 1E2ZA 4IFDJ 2AQ3B 2YRWA 1J9OA 4F87A 2C2DA 1EIYB 2M00A 2R8HA 1KRTA 1YJ9A 2B2YA 2RDHA 1STYA 4JV5H 1N33L 3OWEB 1DOKA 3ND9A 4P75A 3Q8DA 2A6EC 2DGYA 4EGJA 2F0KA 4JI7H 3WOEA 4JBWA 1Q81C 2B2WA 3NP8A 3I4NH 5J22A 3GTLB 1EUJA 4R1JA 1X55A 2UUBL 1TY2A 3S1NH 1FJGH 4MIUA 3FKIB 3HOYB 3OPOA 1VQDA 2AUJD 2OEOA 5DG8A 5J3BA 4FM9A 4DV6Q 3M3YB 1PYBA 4FF2A 2NB0A 4Y8VB 2VPQA 2ICEC 2G5DA 4B3RL 2GLTA 3ONAB 1QCBD 2XIWA 4YWKA 5T1GA 2NU8B 3BQ2A 1SFOB 1STBA 4JOIC 1NMFA 4FU0A 1TWGH 5M3FB 2B2VA 3KHHA 3V6JA 1JICA 2WTFA 3J7YW 3Q24A 3J7AV 3SDZA 2F0HA 3GTGH 3H0GB 2QA4A 2LSSA 4IUQA 1K0RA 1N36H 2FINB 1S0MA 4KKTA 2CKZB 1HNZH 1NTGA 4MV1A 2MQHA 3HOWG 2VB3X 1IBKL 3M9OB 2B2UA 3M7GA 5ELCA 4JI1Q 3GIDA 3RNUA 2ZJQA 5KFFA 1IKMA 1YNJD 2JA7B 4O4LF 3Q8SB 2R7ZH 2K1BA 2HIXA 4B3SH 1N32H 1HCZA 4BA1I 1H9MA 1YHAA 4GN5A 4DPGA 4QWCA 1BO0A 5F9NA 2EVBA 1KABA 2MUYA 1VF7A 3T5JA 4L8JA 1HQRD 3JRWA 1DJRD 4IUVA 2IMWP 2PPBC 2X69A 4UDUC 3VYUA 1PH2A 1F2ZA 3GIQA 4FXKC 4IOAA 2VPSA 3NUCA 1GOZA 5IODA 4GLVB 1DONA 2JA6B 2NVXA 4PQXA 2J7ZA 1Y1WH 3NGDA 1U4RA 1XPUA 2B63G 1Y1VH 1OXSC 1YIJA 2B39A 1PTOD 1YZ6A 2QYZA 1G2TA 4NXMH 4B3SQ 1B8AA 2WAQA 3J81E 4HMIA 5FD5A 4CDCC 5FPRA 4L63B 1SROA 4HQ6A 2FPIB 4CKEA 5C5MA 1Z6HA 2CHBD 3I91A 5M5YH 4LF7Q 2RBMA 1HFGA 1B1ZA 4IZ8A 2RDFA 3X3NA 5KNBA 1ENAA 3M4QA 5EBCA 5EZYF 3L4KA 4DV6L 3B6YA 4IQZA 2Z6KC 1W93A 1O7IA 4K8JA 5JEAH 1LM0A 2A69C 2AGQA 4JI8Q 2IY5B 4KHVA 3NXWA 5LMNQ 2FKLA 4YAJB 4ED3A 1C4QA 2NVTB 2VR1A 4EBDA 2EY2A 3AYHB 1WCMA 4A3GG 4NXMQ 2E2IB 4EFBA 5K5PA 1LT3D 2XWJB 4DV2H 2Z4HA 1FGBD 3VYRA 2PZWA 4LFCQ 4Q5VA 3N52A 3PCOB 1AW7A 4RGMA 1BGWA 2W9AA 4LF5H 3VR2A 5K36G 1TIID 1EU4A 2K14A 4J9MA 4H13C 3G6EA 3KFUA 2R93B 4IFDI 2QILA 3FPUB 3MEHA 4JI1L 5IGCA 4A3FG 3F2DA 5IP7H 3CCQA 5E3FA 5IWAQ 1STGA 3Q8RB 2XC9A 4HIDA 4DR5H 3I56A 1W2BA 4K5VA 1YNNC 1NJIC 2UVUA 1VMCA 3PQIA 3HOUH 2E2DC 3NWSA 3RV3A 2V4DA 4JW0A 3CCLA 4DR7L 1SE2A 1I50A 2QGQA 1PRTF 5KNCA 1JDEA 1QJOA 3S17H 4LF9H 1U4LA 5KGUA 3HOZH 3FKIG 3HOYG 2W6ZA 2B3GA 1GUTA 2JN4A 4ID6A 3GTJB 1RCVD 2F0MA 1WTRA 3H20A 4HMJA 1X6OA 2A1AA 4DL4A 5FLXW 4DV5L 3H3VH 1ULZA 3A55A 2IA6A 2W9BA 4YP3A 3EIVA 2SCUB 2F4VH 4DR5Q 1GUSA 2R82A 3FHWA 3UDIA 1IYUA 3V6KA 4GNXC 1A62A 3CQZH 4HIMA 4A3IB 3S15H 4MA0A 1KHIA 4LF7L 2EQSA 3H0GG 4U6PA 2BH8A 1MSGA 4IWXA 3KHLA 3GTQA 1B53A 1I4HA 2L5TA 3C1EA 4LF9Q 1AH9A 5KFWA 4ZUJA 3X3MA 3CCJA 2VQDA 4OGQC 3GTPH 4A2BA 2JA7G 4ED0A 3U58A 1X3EA 3GV3A 3VR4A 4JI8L 1NAPA 4KKSA 5LMNL 2ZDGA 1D5ZC 1CKMA 3AU7A 2M05A 3T5LA 4OO1H 3TQTA 1PH9A 3ND8A 4HN7A 3NBHB 3VPCA 4BWSC 4NXML 1AN8A 3FVQA 5IGBA 3NK9A 2MFIA 3UE1A 3L0OA 4LFCL 1S3OA 5KT2A 1I4QA 2ASBA 3K3PA 5A35A 3EPGA 3T16A 1WR2A 1XJVA 4KMUC 1ICFB 1MD2D 1K8AC 4ZUIA 1QZHA 2PMZA 5IWAL 4N8X1 2FLNA 2GA4B 5C44H 3QZ7A 5KFZA 5DLGA 2DIKA 1ZHSA 2R92G 5JPNC 4YB8B 4QWAA 1EY7A 1TWHH 5C4JH 2LKVA 2PNHA 5IT9c 3S2HH 5GONF 3GV7B 4JYAQ 4N9PA 4JI4Q 1GLVA 1JXLA 4B3TQ 2AKWB 2W9CB 1AZPA 5C0XJ 1IHZA 3JAMi 4POGA 3W1BA 1EIHA 1ZEQX 4ECUA 3V4SA 4JC0A 1I3QB 4R8UB 2UUCH 2WB1B 3SK8A 3EA6A 2RHSB 1EYGA 4QCLA 4OIJA 1PH7A 4LF8H 5EDWA 1UE6A 1VQBA 2VY3A 3BYTB 2F0EA 3IKJA 1B33N 1VBHA 3WO0A 4APVA 3MWEA 5FLMH 4DR5L 4CC5A 5CC4A 2YU9A 1E1OA 4BY7H 5EQ0A 5D1OB 4DUZQ 4DV0Q 4YJ2F 5T14A 2W7PA 5KG3A 1LT4D 1GO3E 1JOQA 2L9HA 4YWMA 3MHBA 2L11A 5DM63 4LF9L 2R93G 4GN4B 5JJZA 1JT8A 2UXDQ 5CA0F 1V43A 2NVQB 2NVYB 4LFBQ 5KG5A 3RBEA 5KT4A 3CVZA 2Q2TA 3GTMB 4RUCA 3G71A 4LF8Q 5FO8B 3EJIA 3S16H 3K5LA 4A3BH 1SYDA 1TWCH 2UUAH 2DPJA 1B44D 3J80L 2L15A 4F7XA 3RZDH 1LLRD 3Q0AA 1NSNS 2EYHA 3PW2A 2ASLA 3OSNA 1VQHA 2JEIA 3SHLA 3HRZC 3E6ZX 1U9RA 3HKZB 4HJ7A 3TP6A 1YHBA 4S3SA 2DZDA 1CQVA 2R8JA 4LUOA 2R61A 5J1ZA 3T56B 4PWQA 1A6XA 5KRUA 1C9OA 4LFAH 4LH6A 4ECRA 5F9LA 2NBFA 1SBBB 4MTNA 4IJLA 2BE5D 1CI3M 1Y8NB 2O5IC 2QK4A 3BA8A 3CC7A 3I4NB 1N56A 2FHTA 1HUMA 3I4MG 4X3UA 4K0KQ 5BN4A 2PO4A 4JYAL 4JI4L 4A3IG 4J9LA 3S1NB 4B3TL 1SJED 3CD6A 2UUAQ 1ILQA 2F3WA 2R3ZA 3I4LA 1I4XA 1L1OC 2ZXPA 1TY0A 1PFSA 3ICEA 4IJHA 1W6KA 1EIFA 4OEMB 4EEQA 4DNIA 1F2MA 3TZDA 3LP8A 5C3XA 3PIP3 1TWGB 1HA6A 2C22A 4WRDA 4DK1A 2F0FA 3UDFA 3C2PA 4PMBA 5A2QW 4RZRA 4ZK9B 4LFAQ 5I9OA 3GTGB 2UXBH 5KFHA 3BAAA 2N3SA 1E22A 4DUZL 4DV0L 3K59A 4IAJA 3O13A 2JEAI 4GOPB 3EYYA 4F4ZA 1YITA 2MPMA 5C4HA 4X66H 3T1YQ 3OSOA 5DGAA 2F0SA 1RK6A 3R3OA 2K5VA 3BABA 1KQSA 2UXDL 1SYXB 4RNOA 3RJ0A 2K05A 2YS6A 4ZHQF 4ECWA 4LFBL 1CT1D 1E2VA 4EFEA 1B04A 3EVQA 2E5LH 3PW4A 1Q1EA 2W71A 4BY1H 1V1PA 1W6JA 5LL6S 2HCIA 4IFDH 4XQJA 2I87A 1IOWA 1LTSD 4H02A 3V05A 1I5FA 3TS2A 1BOSA 2XGPA 1QOHA 4MV6A 1K1SA 2K7VA 1HRJA 1TKWB 5C0XI 1C30A 4HTHA 3HXLA 3BVZA 4A3LG 3HZXA 4OELB 4KN4C 5EKLA 2D0OA 5LMUL 1IW7C 2JA5H 1FNUA 1NR2A 4ILWA 1Y1WB 3D31A 2WACA 3HOXB 5KG6A 1Y1VB 1TWFA 2WB1G 5F2DA 4K14A 1ZHQA 3PW0A 4FF3A 5BPFA 2YRXA 1N48A 1QWYA 3HB9A 4DNRB 3R5XA 4XYQA 5BR8Q 4DA2A 2KA7A 3A7AB 1SEIA 5CBAE 1BCPC 2AWOA 4XDXA 4DV3H 1JC7A 3QG1A 2C00A 4UCSA 1M0WA 1PH5A 2W8KA 4RB2C 4K0KL 3MR3A 5M5YB 1XTCD 4IPGA 1IBLQ 4EG0A 3NHHA 1WSCA 1E0BA 1Z7TA 1WTPA 1BNCA 2WE6A 2NN6G 3ERSX 4ED1A 4RZQA 2UUAL 2NU7B 3BYYB 3K8AA 1E4EB 1B3QA 5CV5A 4A3EH 5JH7F 2QCPX 5JVDF 4F4YA 4GKJL 1PMRA 4FP5D 3PV0A 2Z6BA 4G57A 2XCPA 3TZUA 2HCCA 2R7LA 1I4RA 1WCMH 4O3QA 3KLSA 2UU9H 2NWGA 5L1KA 4IPDA 4PNYA 5KYLA 4OWXB 2ZJPA 1V8QA 1R4PB 3RIZA 4LFAL 3A0JA 3EROA 1JJGA 2JXMB 2H1EA 1S5ED 3OSPA 4B3MH 4KHPH 1I6UA 1SNOA 4IN3A 3ETHA 4X64H 2G9DA 3CAMA 4BBSG 3LMLA 3CRLC 3T1YL 2CW7A 2F0IA 3KHGA 4PMCA 3TSSA 2ATWA 3N6XA 2HHHH 2IHEA 3G6XA 3HKZG 4JUZA 1M8AA 4AYBB 1PTOF 4KJNA 4LF4Q 4EEYA 1NBWA 2HJWA 1PZKD 4H44C 4BBRH 4C56C 1TA8A 1KD1C 3F2BA 3HOUB 3UFXB 3OW2A 1UWVA 5I9PA 1JIHA 1I50H 4LNQA 1SNDA 4BXXH 3I4NG 1WJJA 1LACA 3S17B 4MTEA 1F9QA 2RHQB 5T1IA 3A74A 3HOZB 1GSOA 2YL2A 1EEFD 2F0QA 4GN3B 1EWIA 2RCNA 1XNQH 1Z2PX 4FXDA 1DD2A 3Q8QB 3U9SA 3M7NA 2JA8B 4YIJA 2RGVA 1B50A 1BJTA 4KHPQ 4YJ3F 4ZQ3A 4X62H 3T4AC 4DK0A 1Z2OX 1EOTA 2F0UA 1RK5A 1HZBA 3VA7A 1UE5A 3KTMA 5H80A 5CORA 2KCMA 5BR8L 3H4BA 2V58A 3HEJA 2NZHA 4DV4Q 3KLRA 1D6EC 3R2IA 1VBGA 4J15A 3SGIA 2IL8A 3PO2H 5LL6X 1LTRD 2CFMA 3BJUA 1IBLL 4NB3A 2HT1A 4DR2Q 1Z2NX 2HIVA 3GTQH 1PYWD 1HNWH 1QNKA 2M9VA 2CH4W 3PUVA 3ZJYC 1N34H 2B63A 2D5DA 2F4IA 1KC8C 4RGOS 2WKCA 4HJAA 4JCVE 3F1ZA 1O75A 1OXXK 3MR5A 4C3IB 2Z4IA 3GTPB 2I5MX 4XQQA 2SDFA 1AN7A 1X3QA 2VUMA 3ORRA 1JR0D 2CQOA 4UHVA 5DG7A 2HDLA 4X62Q 2RSOA 2G9HD 1KNEA 1RHPA 4JI3L 4DL7A 1UE1A 1IYVA 2B8FA 4RU9A 2YTVA 4DAVA 2BOSA 2ZXOA 4PMWA 1JB7A 3RGXA 2F3VA 2ZM6H 3TQ1A 2KHIA 3A5ZB 5C1PA 3W5OA 4YQWA 2B2TC 4IPCA 1PH1A 4DLKA 3D4WA 1Y1WG 5C44B 1KLUD 3HOXG 4A3KH 4K8IA 3PR5B 3H4DA 2AGOA 3OHXC 2OF1A 1OO9B 4LF4L 4EGQA 4QWDA 4TRDA 2AUKA 3KF8B 1TWHB 5C4JB 4I7ZC 2ALZA 3GTKA 3S2HB 1STHA 2Q2UA 2XCLA 5M5WH 2YS7A 2EJMA 3VR3A 4Z9CB 1D7QA 3JSLA 4YY3H 2HDMA 2DJGC 5LP6F 1RF2D 3J81c 2EIFA 3N42B 3KK7A 3RD4A 4YCUA 2ASDA 4KHPL 2K5QA 2W7OA 5JEAG 5FJ8G 1A9XA 4QGUA 3GV8B 3GV5B 4UP8A 4IWYA 2KHSA 2DN8A 2LS01 3KLSX 1SYCA 2ZTEA 1JOKA 2FMCA 3I3CA 5EJWA 4U68A 2R6FA 5HV6A 4RUAA 2XCAA 1MI2A 4RCNA 5IOCA 3GTLA 1YBYA 4DV4L 4NW2A 4G7OC 3FKIA 3IFTA 5G3LD 5IGDA 4DL6A 4JBMA 4I4TF 4RNMA 4C2MA 2XGQA 1SNMA 4DR2L 5KFJA 1K83A 5KFDA 2K28A 2V4RA 5EOYA 2K6AA 2WYOA 3NBIA 1N9WA 2QF7A 3S1QH 5CR3A 4P72A 4RGNA 4DL3A 3K0XA 4Q0YA 2PNRC 5IP7G 1SFOA 4EQ5A 1B3AA 2ZTDA 3CPWA 2XRSD 4AYBG 3H3VC 4R4IA 1KDBA 4B9WA 5LA6F 1S4ZA 4X62L 4KN7C 2D62A 3STBD 2MO1A 3S16B 3H0GA 4RHRA 4A3BB 5KFUA 2Q8RE 5KG1A 1TWCB 5FLXL 1GXDC 1PDQA 3LWEA 1KJJA 2GVBA 1K8GA 1TWAB 3RZDB 2VL6A 3GP7A 1VQMA 3HOZG 4R8IA 3IN5A 4CDDC 2OTLA 1RDPD 3Q8PB 2JA7A 2JEBI 4JV5Q 4XIGS 2A68C 2CCZA 2F0TA 1PRTC 4CJ2C 4XQNA 3E0EA 2JA8G 4AQYH 4JI2H 2UXCH 1CKNA 2FMMA 2VW9A 4JI7Q 4ZRZA 5C0XH 4FO2A 1CHPD 5I6YA 2VOBA 4KLKA 5GQOA 1ENCA 4NXNH 3JAME 3NTKA 4ODGA 4LF6H 4MV4A 1I7LA 2R7MA 1FJGQ 3DXJC 5DLQE 2CZGA 4CBVA 3G8CA 1K9MC 1Q1BA 3GQBA 4K6DA 4XX0B 3R23A 5L1JA 5JJIA 1U4PA 1VAJA 4QUFA 1E4FT 1FR3A 2A73B 2N78A 3MA2B 4GNXB 3GIPA 2N55A 1CK1A 2QDLA 1ZKOA 5IYCG 5CYUA 4DR1H 2R92A 2R6GA 5EWGA 4C3IG 3G7LA 1OTCA 5JQWA 4GC6A 4AQYQ 3VDYA 1UAPA 1OXTA 2EOTA 3KF6B 1N36Q 4QB4A 1MBYA 5GROA 1GM5A 1NUCA 3PF4A 4PZ8A 1PA6A 1HNZQ 3GLKA 4NXNQ 3A8JE 4CJ0B 1AP0A 5C4XG 4ED6A 1JJ2A 4G4KA 2OCEA 1S9FA 1F77A 4O1NA 3T1HH 2R87A 1IL8A 2RF4A 5JAVA 1XTDA 1N32Q 1F9PA 2IHFA 2SNMA 1XMOH 2FK1A 4M1UB 2JJQA 4UP7A 3G6JB 3QR8A 4QJFA 4MV9A 4ED2A 3RB4A 4C3JB 2WINB 2K33A 5C44G 3FDSA 1EIGA 4DR1Q 3EN2A 1SYFA 2W6QA 2I5HA 2LXJA 4BY1B 1DXMA 4DU9A 2OWOA 1RJQA 2ATLA 2L0CA 1JMCA 1V4YA 2LXKA 5EBDA 5JVG3 1CZWA 3KUPA 3R93A 3P75A 5M3MH 2KEDA 2ZT9C 1Y14B 4HR7B 1IKLA 5EAYA 3RFCA 4FNFA 3MFHA 2R93A 1K3RA 5I4DA 4U7CA 4IRKA 1VQPA 1SN8A 4C5CA 3CCMA 4IO9A 1UNSA 2DPIA 2JA5B 1A0IA 2D2CC 1PLFA 1TVXA 1VQ9A 4YR0A 4JV5L 3RB3A 1RL2A 1BXRA 1TWFH 2CWPA 4JI7L 3Q2OA 4EBCA 4FBUA 2KHJA 3LX0A 5IT9W 2WAQB 2YCHA 1STEA 1GUGA 5GAGC 1PH3A 2TMPA 2V1CC 4MTKA 2MP1A 1JE4A 4TKOB 1FJGL 1D2BA 2K03A 1KJQA 1YI2A 5KKNB 4IUTA 2HQEA 1ML0D 3QJYA 4B9XA 2RCFA 1FD7D 1HA5A 2PI2A 3GTJA 4X3KA 3BJYA 1MHWC 1MJCA 1SMYC 4GS3A 4PG3A 3K81C 1R9TH 3LWBA 2IPKD 1EUCB 3Q6SA 1X3GA 4A3EB 1YVCA 2ZJRA 2F0LA 3KAJA 4A3DH 1E1TA 3RV4A 4DV2Q 1PH4A 5KT5A 3NENA 5LXTF 2B2YC 1CUKA 4AQYL 3L7ZC 4E6IA 4WJ3M 1MKHA 3SEBA 4DAYB 1N36L 1WYDA 2MGSA 3U9OA 3NTHA 4MZ9A 4LF5Q 4MN3A 2EY6A 1HNZL 3CF5A 1OXUA 3OUZA 1Q90A 2XSCA 4UFZA 2IX3A 2B2WC 4YHHH 4HJ5A 1GD7A 3P1HA 4NPSA 3I12A 2KQ3A 2Z9HA 2E2HA 1J5EH 1D5MC 2SEBD 2TSSA 3DF7A 3NTIA 4ECYA 4B3SL 3EBEA 3HGBA 1N32L 5M3FG 3OTOH 5KG2A 2QKIC 4FS1A 4O2AF 5JJKA 3S2DH 2KECA 5DEHA 1XYIA 1BR9A 1QUQB 4ALPA 3IL8A 2PBZA 4BBRB 2IP4A 2IX1A 1QVFA 3OIQA 1H9SB 1Q8KA 3MR6A 2B2VC 4DV7H 1I50B 1KLGD 2O2LD 4DXFA 1Y69U 1WD0A 2E76C 2F0OA 2JEGA 3K5IA 3HOWH 5KFQA 4ZCKA 2Y0SB 1SNCA 2BQRA 4CGYB 1PFBA 4BA2I 1S0OA 3Q22A 1EY0A 4HNUA 1T5EA 4IUUA 4YHHQ 5A2QL 1J5EQ 2B2UC 1EYZA 3K6OA 2F4VQ 3OTOQ 2W70A 3K7AH 2MNAA 2JK8A 3H6MA 3PMFA 2YZGA 1L1OB 5C4ZA 4J8QA 4QMGA 3I55A 3GTOH 2EDGA 4WORA 1SE8A 1JWMD 5J39A 5ELEA 4ZLTF 3GQCA 3KALA 2JA6G 3C0FB 5KFXA 3MFGA 3M85A 2N49A 3BG5A 4YR3A 4IR1A 4RA8A 4DXGA 2GPSA 4DV7Q 3C46A 1CZGA 3SK5A 2E8GA 1EY9A 1RJPA 1CSQA 3GTQB 5M5XB 4O2BF 1HR0H 2B63H 1I3QA 5HY6A 2DJFC 1ASZA 2WB1A 3ULPA 1VQ6A 1JB3A 4C1NI 5DNFA 2DNCA 3IAYA 2W57A 4APMA 1S5CD 4C5AA 1HPCA 4MAMA 4WD3A 3HG9A 4C3JG 4HYKA 3GIKA 4M7EA 1GUNA 4DV2L 3UDGA 3S1MH 3R5FA 4DFAA 4FBTA 1RTNA 4IFDG 4PZ6A 4LF5L 1VQEA 4QL5A 4C1NK 2C28A 1PXUA 3RMHA 4X65H 4Q45A 1TQOA 4HEDA 4J6HA 1VQ4A 1C0AA 5IYDG 2JEFA 2WP8J 1ZETA 3D6CA 1AE3A 2HVRA 4RGTA 2EZVA 5L1LA 1SCUB 1TS5A 1G6ZA 2NVYA 5DM73 2JA5G 1DV2A 2PMZB 1HR0Q 4LH7A 1TS3A 1V9PA 3RB6A 3GTMA 1H9JA 1VQAA 3MTSA 1STAA 4A3KB 1WTWA 4A3GH 4K5XA 4QUCA 3CCSA 2E75C 4RB1A 2DY7A 3IG0A 3P20A 1E2WA 3ETJA 1SNQA 3GTKH 1KJ8A 2YZNA 2JE6I 3FMAA 2EYOA 1S0NA 1LTBD 5HURA 2NZ1D 5M5WB 2UUCQ 3A56A 1BCPB 4Y7NH 5KG7A 4DR4H 4NKLA 3JZIA 2K5WA 5L37A 4QQBX 3FDTA 4X65Q 4YHHL 2VUGA 4JI0H 3HKZA 3BDOA 2K5DA 3J80i 3AMUA 2X6LA 2F4VL 3OTOL 4QF4A 1SXTA 3RBDA 2KVMA 2L55A 4J0MA 5C8YF 3RLOA 1KAWA 2R8GA 2I5LX 4QIWB 1D8LA 2A6HC 1YNJC 1ZYRC 2MJ8A 1JWSD 4H0LC 2J4XA 1L0WA 3HOYH 1OWTA 5JPMC 4JBJA 3TN2A 2CW0D 2VQFH 4C2MH 4TQRA 5JJLA 4DV7L 3NSWA 1K83H 1X54A 2BDOA 4RB0A 1X32A 3KLWA 1BKBA 4GC7A 2CW8A 4OL7A 4B08A 2RGRA 4IPHA 1PV4A 1CQIB 2IT1A 2EYLA 1FL0A 1EHIA 1JCKB 4DUYH 1SE3A 1NY4A 3CHBD 3W3AA 1JDBB 3D3RA 3WOFA 3RR5A 3AFQA 4ZKBB 2Y0SG 3TP5A 4GOPA 3M4OH 1KXLA 2W6NA 1QNUA 4OHJA 4C3HH 4HNTA 5DQGA 3GILA 4O0AA 3DMUA 1KRSA 2VQFQ 1GHJA 3A8IE 1HNXH 3RLNA 1BVSA 1HHVA 5E1FA 2V59A 1L2ZA 1HR0L 2PI2E 4A4IA 1MSHA 3N6RA 1X65A 5IYBH 4DR3H 3AB9A 2A6ED 3MZ5A 2CQAA 1XMQH 4OXPA 5TSSA 3J81j 3GIIA 3FP9A 1Z9FA 3M9MB 5CMDA 3T5HA 4G7HC 4Q8FA 2PQAB 2R7ZB 1F2LA 3WNZA 3MXPA 5CAEB 5G3LF 4CDFC 4YR2A 3BQ1A 2K32A 3PW5A 4RCOA 4X3TA 1UC9A 2UUCL 2AQ2B 2R7KA 5KFBA 1A3VA 4EQPA 1Y1WA 3DWQA 1TAEA 3ULJA 3RTXA 4X65L 4LF8L 3K80C 1SYEA 3CCUA 2HGSA 5IP9G 1I4PA 5KG0A 2JA9A 4JI6H 2F0JA 2R92H 2MCTA 1Q82C 3L9AX 3DWAA 4AH6A 5IY0A 1UUPA 1HNXQ 5LL6b 1Q8IA 1EZ8A 1HQMC 3ZYYX 1X56A 2UXBQ 1I94H 1RJRA 4WBNF 2YW2A 1ESFA 1AFPA 2NVXH 5DLFA 1VCIA 3ITPA 1SR3A 1KNAA 3G6YA 3VYTA 2FJZA 4DV1H 3PVXA 4X66Q 5GADC 2BQUA 4UAIA 2EYFA 5L9XA 1KJ9A 1T36A 1M90C 1E4EA 2N8NA 4E4TA 1NMGA 2RDIA 3HOVH 1BQQT 2IX0A 4Q0FA 5ELOA 2E5LQ 2BA1A 1WTXA 2BQ3A 2ZXRA 4I7AA 3CRKC 3GIJA 3PGZA 4ABNA 4KKUA 1KIXA 4L5TA 3KDFB 4A3KG 2CVRA 2RVLA 3F8TA 1X9NA 4U673 1K8MA 1BNZA 4Q43A 2MO0A 3H40A 3WDNA 3PUZA 3NE5B 3I70A 3TP8A 1RD9D 1LTID 5E4XA 5M3MB 3NELA 3MWDA 2RQXA 5IE8A 2VQEH 5AFWA 2QW7A 4DV1Q 1WFQA 1CM9A 4LAAA 3RB0A 1C3OA 4OX9H 1XNRH 2R86A 3BDCA 3OMGA 2VQFL 4FYDA 4R4OA 1RODA 4F4WA 3CMEA 1TWFB 2F0VA 4A93H 1NR4A 2EY1A 2DLNA 4AYBA 4DV3Q 5M9OA 4HJ8A 1Q3LA 3MC0B 2KENA 1GUWA 2WB1E 1ESRA 4LSAA 4ZQIA 4GKKH 1EOVA 3DM3A 2OXPA 3S24A 3GD7A 3DHQA 4ECSA 5CV8A 2XD4A 2Q8TA 2KOLA 1SSOA 4IURA 4LUVA 1YJWA 1E7ZA 1S72A 1IZ6A 3J81W 2AU0A 1TXYA 2UVVA 2JYOA 1VQGA 2SNSA 3HKSA 4EQNA 3J7ZC 4IRDA 1FNVA 3QOLA 5EKKA 3I72A 2M2LA 1R9TB 2VQEQ 3KHRA 5FO7B 1U4MA 4A3MH 1TU2B 1C8CA 1KDAA 2A69D 4L6TB 1XNRQ 2UU9Q 2NZOA 1VQOA 1HNXL 4A3DB 2O03A 2FLLA 4RKLA 1KTKA 1MGSA 5KEEA 3I4MH 4ZAIA 2UXBL 2GPWA 4H7BA 3RUZA 3GIMA 3PIOA 4RKBA 4HCSA 4JOIA 3MXNA 4WFN3 4B3MQ 4O2DA 1DCZA 5KT3A 4J9RA 4X64Q 5HGTA 4X66L 1SE4A 2A5HA 2F0PA 2E2HH 2GN5A 3EFXD 4UCUA 4XXEA 3F2UA 2HHHQ 1HFNA 1AUXA 3I2ZA 1N33H 1YEZA 4DK3C 1PTOH 3GTPA 3S2DB 2E5LL 3CU7A 3CQZB 4RNNA 3S15B 1HR0W 2W6OA 1YNND 3R8BA 2UUBH 1WVLA 1H95A 1SAPA 5KFRA 1PRTB 2EPBA 3HKZE 3KXYT 1CE8A 2J0TD 2FE3A 1VKZA 4CDEC 2Z8LA 2KEEA 1Q7YC 1XNQQ 1K73C 2RKSA 3HOWB 3ERQA 1BDOA 3BDLA 2B29A 3OYYA 3RLFA 3SE7A 5I6WA 2R7ZG 1VQIA 4B3RH 5FKAC 3MR2A 4EX5A 4O3PA 1M4VA 3E0JA 1B9NA 1JKJB 1GKHA 4RAZA 3MXUA 3HP3A 2ZDHA 3BZDB 5KT7A 3JAMc 1XPOA 2YZMA 3KAKA 1D1IA 3K7AB 4DV3L 3FEWX 2PW7A 5ISRA 3KF8A 3GTOB 4DF7A 1EEID 1A3TA 1S03G 4J9KA 1IBKH 1AZQA 5D1PA 2RSNA 2R7FA 3NQTA 4A3CH 5ELDA 1B70B 4KHZA 1HNWQ 1N34Q 3I73A 2E74C 1PHJA 3CC4A 2P5ZX 1P8LA 1Y1VG 5C5JA 1LTLA 4LMYA 4MHEA 1K1QA 3M4YA 2B63B 4BS9A 5BN3A 3BS1A 4FF4A 2GVAA 3P7JA 3RF2A 3DWPA 4DL5A 1LV9A 5C3EH 1XNRL 2UU9L 1SYGA 1Z47A 1EY4A 4JK1C 3S9WA 3J7A5 4IUPA 1M6VA 3RN2A 1PZID 5C3WA 3SE0A 3QB3A 4NDXA 2EXZA 2ZM6Q 5EPLA 2E2JH 4XT1B 5EWFA 1SNPA 4X6AH 1CFMA 4B3ML 1J6QA 1T5XD 2VNUD 4X64L 1KAAA 1EZ6A 2KBNA 5IT9L 3BZKA 5M3MG 3J80c 1C48A 2A19A 4EQOA 2BE5C 2HHHL 3K0YA 4R4CA 1O7YA 1B2TA 4P73A 4LK1C 3G4SA 2YU9H 1AE2A 3GTMH 3DLLA 5KFIA 4BY7B 4OWTB 4J9PA 4A3GB 1G6PA 2AGPA 1WI5A 1E3PA 1LTTD 4ZYSA 2XTIA 1M1KC 2EE1A 4QW9A 1EQVA 1UEAB 5A2QE 3GTKB 3UI2A 2EXDA 5FO9B 4G3IA 1ONLA 4DN4M 4YY3Q 3RAXA 1TWAA 2HUGA 2EJGC 1XNQL 2J6TA 1CA5A 2DNEA 4HSPA 1IOVA 4XYMB
chains in the Genus database with same CATH topology
4A3BH 2PMZE 3D0FA 4BBSH 3PUYA 1TWCH 1E1TA 4A3DH 1SLJA 3L2PA 2L15A 1IL2A 4DV2Q 1PH4A 3CCRA 3NENA 1QZGA 1CUKA 4AQYL 3RZDH 3L7ZC 3HOUG 4WJ3M 1MKHA 4DAYB 2FXQA 1N36L 4OX9Q 1WYDA 4JI5Q 4LF5Q 4MZ9A 1HNZL 2I0QA 3A5UA 3CF5A 1OXUA 1VQHA 2Q2HA 4LW1A 4A3DG 4HJ5A 4HJ7A 1GD7A 4NPSA 1U5KA 1YHBA 4A3IH 4DR3L 3W1GA 4B3SL 3EBEA 4LUOA 1N32L 5M3FG 3S16H 4GKKQ 4TQUS 1C9OA 2K75A 4MTNA 1XMQL 4IJLA 3S2DH 1HNWL 5JJKA 1N34L 3CC7A 3I4MG 2KCTA 4P74A 1QUQB 1JE5A 3GDEA 1U0LA 4K0KQ 4ALPA 4GNXA 4JYAL 4JI4L 4A3IG 4WJ4A 4B3TL 4A75A 2IX1A 1QVFA 3CD6A 2VUMH 2UUAQ 2YTXA 3RZOH 1Q8KA 1PH8A 1L1OC 4QIWE 1VQCA 4XTCS 4JI6L 1PFSA 5C0XG 4IJHA 3HOWH 3ICEA 1EIFA 4GOPC 3KF6A 4DNIA 4TVAB 4BA2I 3AQQA 2F52A 2VUMG 4YHHQ 4AYBE 2K4KA 1MIUA 2ZM6L 1LUZA 1I94L 2OTJA 1J5EQ 3UDFA 1JJCB 2Z0SA 1QVCA 2F4VQ 3OTOQ 3K7AH 4LFAQ 3KYHC 2JK8A 2MNAA 4L5RC 4DV1L 1L1OB 4JI2Q 2N3SA 1E22A 2UXCQ 4YWLA 4DUZL 3MXNB 1CKOA 4DV0L 3I55A 1BBUA 4DK6C 2BH2A 3GTOH 2HQLA 1SE8A 5GAEC 1N33Q 4GOPB 2JEAI 3PO3H 4OO1G 1N8RC 5M5XH 4LF6Q 1YITA 2BA0A 1CKNB 3UE0A 2JA6G 4OONA 3T1YQ 2A8VA 5IP9H 3M85A 2N49A 4OWWB 2K5VA 1KQSA 4DV7Q 4DR7Q 2UXDL 3MEFA 2E8GA 2UUBQ 1CSQA 1EQQA 4LFBL 3CXCA 3H3VI 2B63H 4A3LH 4GLAC 5HY6A 1ASZA 3PO3G 1Q1EA 2OQ0A 3WWVA 4BY1H 3ULPA 1VQ6A 4YY3L 4H02A 4GLXA 3TS2A 1I5FA 1I3QH 3TQYA 2K5NA 1SMXA 1DGSA 4R4QA 4B3RQ 5HGQA 5C0XI 1VS0A 4DV2L 3UDGA 3HOXH 2VQEL 4DV5Q 3S1MH 4A3LG 5AJ3Q 4RMFA 2D0OA 5LMUL 1VQFA 4OX9L 4IFDG 4PZ6A 4JI5L 2JA5H 4LF5L 2Z6KA 4IOCA 1YJNA 1VQEA 3NEMA 4QL5A 3D31A 3CCVA 1G291 2WB1G 1C7YA 1VQ4A 1C0AA 5IYDG 3KJOA 2WP8J 4A3JH 1AE3A 2AWNA 3T1HQ 4QY7A 5BR8Q 4UY8C 4L5QA 1IBKQ 4GKKL 2JA5G 2AWOA 4OO1I 1HR0Q 2YYZA 1V9PA 1XMOQ 2XGTA 3U50C 1VQAA 1PH5A 4DAMA 1Q86C 5E7NA 3AEVA 4K0KL 4A3GH 2F3IA 4IPGA 1IBLQ 2NVQH 3CCSA 1KL9A 2NVYH 3BZCA 3CMAA 4A3JG 5FJ8H 2NN6G 3ERSX 2UUAL 5FLMG 3K8AA 3GTKH 1VQKA 1B7YB 1W3SA 4A3EH 4BY7G 2JE6I 2AHOB 1EQRA 1CSPA 4GKJL 1PYSB 3PSIA 2WFWA 5GAHC 3PUXA 2UUCQ 3PV0A 3S15H 4Y7NH 1VQ5A 4P71A 4QQBX 4X65Q 4YHHL 1IBMQ 1X3FA 1WCMH 4IPDA 4OWXB 2ZJPA 4Y52H 3IRBA 3J80i 2F4VL 3OTOL 4LFAL 3A0JA 4IFDJ 4ME3A 4R4TA 1JJGA 2H5XA 1EIYB 4JI2L 2UXCL 1UEBA 1KRTA 1YJ9A 3RLOA 1KAWA 5ELNA 2I5LX 5H1SE 1QUQA 1D8LA 1OXVA 1N33L 4NXNL 4P75A 4UPAA 3CAMA 3Q8DA 4LF6L 1L0WA 4A3BG 2DGYA 3HOYH 4BBSG 3T1YL 1RIPA 3AFPA 3I4OA 3I7FA 4JBJA 1VQ8A 4JBWA 1IYJB 1Q81C 4C2MH 2ATWA 3I4NH 5JJLA 1GVPA 2IHEA 4DV7L 1EUJA 1K83H 1X54A 3HKZG 4R1JA 1X55A 2UUBL 4LF4Q 3S1NH 1NBWA 1P16A 4BBRH 1VQDA 3KLWA 3JC66 3F2BA 1KD1C 1BKBA 3F2CA 1T9HA 2K52A 5J3BA 1UWVA 4DV6Q 3OW2A 1I50H 1PYBA 4LNQA 4BXXH 1I6HH 2CWAA 4IPHA 3I4NG 1PV4A 1WJJA 2JA8H 4DR1L 2IT1A 4B3RL 3S1RH 1HJPA 1FL0A 4YWKA 2RHQB 3A74A 1EWIA 1NY4A 1HH2P 2RCNA 4GN3B 4JOIC 1HZCA 5AJ3L 1NMFA 1TWGH 1L1OA 4JBKA 3M7NA 2D0PA 3RR5A 3AFQA 4KHPQ 2Y0SG 4GOPA 3M4OH 1KXLA 3GTGH 4C3HH 2QA4A 2LSSA 4HJ9A 1K0RA 4O0AA 1KRSA 1L2FA 2VQFQ 1HZBA 2CKZB 1UE5A 3RLNA 1FGUA 1NTGA 1BVSA 2KCMA 2MQHA 5BR8L 4HIOA 3T1HL 3HOWG 2NZHA 4DV4Q 1IBKL 4JI1Q 1HR0L 3RNUA 1XMOL 2PI2E 4J15A 4A4IA 3SGIA 1QVGA 2ZJQA 3PO2H 5IYCH 1X65A 5IYBH 2CFMA 2R7ZH 2HIXA 3BJUA 1IBLL 4NB3A 2HT1A 4DR2Q 4BA1I 4C3IH 2HIVA 1YHAA 4GN5A 4DPGA 3GTQH 4OXPA 3PUVA 3ZJYC 3J81j 3FP9A 3CC2A 1Z9FA 2VS1A 1KC8C 1SRUA 4HJAA 2PQAB 4JCVE 3F1ZA 1OXXK 2I5MX 2Q2IA 5C4XH 5IYBG 2UUCL 2CQOA 4DR4Q 1PH2A 3ULJA 3BU2A 4X65L 4X62Q 3K80C 3CCUA 1IBML 4LF8L 5IP9G 4IOAA 4YCWA 2JA9A 2R92H 4JI3L 1Q82C 1UE1A 4AH6A 5IY0A 4GLVB 1HNXQ 4DR6Q 1Y1WH 1XPUA 2YTVA 2B63G 1Y1VH 2UXBQ 1OXSC 1X56A 4PMWA 1YIJA 1JB7A 3G48A 4BY1G 3S14H 1YZ6A 2NVXH 2KHIA 1VCIA 3A5ZB 1SR3A 1B8AA 2ES2A 4B3SQ 3W5OA 1FVIA 4IPCA 1PH1A 1SROA 4X66Q 5GADC 1Y1WG 3HOXG 4A3KH 5M5YH 1M90C 4LF7Q 2N8NA 4LF4L 1NMGA 3HOVH 2IX0A 3M4QA 5ELOA 2E5LQ 3KF8B 2QEXA 2BA1A 3KOJA 3B6YA 4DV6L 2Z6KC 3PGZA 1O7IA 1KIXA 4L5TA 3KDFB 4A3KG 4JG2A 1LM0A 3STBC 1G51A 2WAQG 2Q2UA 1HZ9A 3F8TA 5M5WH 1XPRA 1X9NA 1HZAA 4JI8Q 2IY5B 1D7QA 3HOVG 5LMNQ 2MO0A 1BBWA 3PUZA 2EIFA 3J81c 3AYHB 4A3GG 4YCUA 4NXMQ 4A3FH 3PIPA 3NELA 4KHPL 5JEAG 5FJ8G 5IE8A 4QGUA 1ASYA 4LFCQ 3PCOB 4UP8A 1WFQA 4DV1Q 2VQFL 2ZTEA 5K36G 1J5EL 2K14A 4R4OA 4A3EG 3CMEA 3G6EA 3KFUA 1YBYA 4DV4L 4A93H 4IFDI 4JI1L 5FLXc 2C35B 1E24A 4DV3Q 3F2DA 4DKAC 4A3FG 5IP7H 3CCQA 5IWAQ 4HJ8A 4AIMA 2KENA 4JBMA 2WB1E 4HIDA 3GTLH 4DR2L 1WCMG 3I56A 1W2BA 1NJIC 1EOVA 3FKIH 3DM3A 3S24A 3GD7A 3HOUH 1N9WA 2R7DA 3J81i 3S1QH 4A93G 4P72A 3M3YH 3K0XA 1A8VA 4LUVA 1YJWA 1E7ZA 5IP7G 1IZ6A 1S72A 4POFA 1TXYA 3CCLA 2QGQA 1VQGA 3HKSA 4EQ5A 2ZTDA 3J7ZC 3CPWA 3S17H 4AYBG 4PZ7A 3HOZH 4YCVA 2WAQE 2NN6I 1TWAH 1UE7A 3FKIG 4R4IA 3ULLA 2VQEQ 4X62L 4HIKA 1SFOH 2D62A 3CCEA 3STBD 2B3GA 2MO1A 5LMUQ 5M3FH 3E9HA 4A3MH 4JI0Q 2OQKA 1XNRQ 2UU9Q 2NZOA 1VQOA 1HNXL 1X6OA 1LYLA 4DR6L 3K7UC 2A1AA 2AMCB 1YNXA 2GVBA 1K8GA 4BBRG 3I4MH 4DV5L 2UXBL 3H3VH 2VL6A 3H0GH 2DUDA 1VQMA 3HOZG 5JEAJ 3M4PA 3PIOA 4JOIA 2OTLA 4A3MG 4B3MQ 2JEBI 4O2DA 4BXXG 3EIVA 4XIGS 4JV5Q 4DR5Q 2CCZA 4X64Q 3E0EA 2JA8G 3FHWA 3UDIA 4X66L 1CKNA 2VW9A 4JI7Q 2E2HH 2GN5A 1A62A 3CQZH 3CW2C 4GNXC 2K50A 4HIMA 3RN5A 1MJEA 2HHHQ 2JA7H 1KHIA 3I2ZA 4KLKA 2EQSA 3H0GG 2PQAA 5GQOA 4LF7L 2YTYA 2BH8A 1YEZA 4DK3C 4A76A 4MNOA 1FJGQ 5DLQE 1AH9A 3GO5A 4LF9Q 2E5LL 1K9MC 1Q1BA 1HR0W 3CCJA 2ALYB 3LGJA 3GTPH 2JA7G 4GKJQ 1H95A 5JJIA 1Q46A 3U58A 3HKZE 1X3EA 4JI8L 4LWCA 1A63A 5LMNL 4DUYQ 4LUZA 2N78A 4GNXB 1CKMA 1Q7YC 1XNQQ 1K73C 1PH9A 3RLFA 5LMNW 3PO2G 2B29A 3OYYA 5IYCG 3NBHB 2R6GA 2R7ZG 1VQIA 2JQOA 3TEHB 4NXML 2JA6H 1EFWA 4DR7L 4EX5A 2MFIA 4RG1A 3UE1A 1VQ7A 1OTCA 3L0OA 4LFCL 1S3OA 1GKHA 4AQYQ 2ASBA 3VDYA 1OXTA 3KJPA 3JAMc 3KF6B 1N36Q 3PF4A 1XPOA 5GROA 3UDXA 1GM5A 1V1QA 4PZ8A 1S40A 1PA6A 1HNZQ 4NXNQ 3HFZB 5C4XG 1XJVA 1JJ2A 4KI0A 1K8AC 4DV3L 2OCEA 1QZHA 2Y0SE 5IWAL 5C44H 4DR3Q 3PF5A 2RF4A 4C3JH 1XTDA 1N32Q 2R92G 2R7FA 2IHFA 3KDFA 4A3CH 1B70B 4KHZA 1XMQQ 1HNWQ 3H15A 1WOCA 1N34Q 1TWHH 5C4JH 2JJQA 4UP7A 1PHJA 4QJFA 2PNHA 5IT9c 3CC4A 1P8LA 1Y1VG 3S2HH 1YHQA 4JYAQ 1LTLA 4JI4Q 5C44G 4B3TQ 2AKWB 4DR1Q 3EN2A 3U4VA 2YV5A 2I5HA 5C0XJ 2LXJA 5IYDH 2GVAA 4FDBA 1Q12A 3JAMi 4POGA 3CPFA 4DR4L 4A3CG 3W1BA 2OWOA 4JI6Q 2NVTH 5C3EH 1JMCA 4JI0L 4JC0A 1XNRL 2VZAA 2LXKA 2UU9L 2ZTCA 1Z47A 3CP0A 2E2IH 1VQNA 5M3MH 3J7A5 3TRZA 3RN2A 2RHSB 1Y14B 1EYGA 3HOYG 5EAYA 1IXRA 1PH7A 3PUWA 1K3RA 1VQPA 1SN8A 1UE6A 1VQBA 2VY3A 2ZM6Q 3CCMA 4IO9A 1I94Q 2E2JH 3ER0A 1A0IA 4X6AH 4APVA 1VQ9A 4B3ML 1J6QA 5FLMH 5C3EG 4JV5L 2VNUD 4DR5L 1RL2A 2R93H 1TWFH 2CWPA 4X64L 1E1OA 2KBNA 5M3MG 3BZKA 2ID0A 3J80c 4BY7H 4JI7L 4DUZQ 2A19A 2KHJA 4DV0Q 3TS0A 2HHHL 4R4CA 4P73A 4UP9A 5GAGC 3M9BA 1GO3E 3G4SA 1PH3A 2YU9H 2V1CC 1AE2A 1FJGL 4YWMA 3GTMH 3DLLA 4LF9L 1YI2A 4OWTB 2R93G 4GN4B 3U4ZA 1JT8A 2UXDQ 1G6PA 1WI5A 1E3PA 1NE3A 1V43A 3E9IA 2K5HA 1M1KC 2XTIA 4LFBQ 2PI2A 2Q2TA 1MJCA 4GS3A 4PG3A 3K81C 1VQJA 2EXDA 3TREA 1R9TH 4L5SA 3G71A 4DUYL 4YY3Q 1PH6A 1X3GA 4LF8Q 1PVOA 1XNQL 1YVCA 4JI3Q 3GTJH 2ZJRA 1VQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B H;  2PMZ E;  3D0F A;  4BBS H;  3PUY A;  1TWC H;  1E1T A;  4A3D H;  1SLJ A;  3L2P A;  2L15 A;  1IL2 A;  4DV2 Q;  1PH4 A;  3CCR A;  3NEN A;  1QZG A;  1CUK A;  4AQY L;  3RZD H;  3L7Z C;  3HOU G;  4WJ3 M;  1MKH A;  4DAY B;  2FXQ A;  1N36 L;  4OX9 Q;  1WYD A;  4JI5 Q;  4LF5 Q;  4MZ9 A;  1HNZ L;  2I0Q A;  3A5U A;  3CF5 A;  1OXU A;  1VQH A;  2Q2H A;  4LW1 A;  4A3D G;  4HJ5 A;  4HJ7 A;  1GD7 A;  4NPS A;  1U5K A;  1YHB A;  4A3I H;  4DR3 L;  3W1G A;  4B3S L;  3EBE A;  4LUO A;  1N32 L;  5M3F G;  3S16 H;  4GKK Q;  4TQU S;  1C9O A;  2K75 A;  4MTN A;  1XMQ L;  4IJL A;  3S2D H;  1HNW L;  5JJK A;  1N34 L;  3CC7 A;  3I4M G;  2KCT A;  4P74 A;  1QUQ B;  1JE5 A;  3GDE A;  1U0L A;  4K0K Q;  4ALP A;  4GNX A;  4JYA L;  4JI4 L;  4A3I G;  4WJ4 A;  4B3T L;  4A75 A;  2IX1 A;  1QVF A;  3CD6 A;  2VUM H;  2UUA Q;  2YTX A;  3RZO H;  1Q8K A;  1PH8 A;  1L1O C;  4QIW E;  1VQC A;  4XTC S;  4JI6 L;  1PFS A;  5C0X G;  4IJH A;  3HOW H;  3ICE A;  1EIF A;  4GOP C;  3KF6 A;  4DNI A;  4TVA B;  4BA2 I;  3AQQ A;  2F52 A;  2VUM G;  4YHH Q;  4AYB E;  2K4K A;  1MIU A;  2ZM6 L;  1LUZ A;  1I94 L;  2OTJ A;  1J5E Q;  3UDF A;  1JJC B;  2Z0S A;  1QVC A;  2F4V Q;  3OTO Q;  3K7A H;  4LFA Q;  3KYH C;  2JK8 A;  2MNA A;  4L5R C;  4DV1 L;  1L1O B;  4JI2 Q;  2N3S A;  1E22 A;  2UXC Q;  4YWL A;  4DUZ L;  3MXN B;  1CKO A;  4DV0 L;  3I55 A;  1BBU A;  4DK6 C;  2BH2 A;  3GTO H;  2HQL A;  1SE8 A;  5GAE C;  1N33 Q;  4GOP B;  2JEA I;  3PO3 H;  4OO1 G;  1N8R C;  5M5X H;  4LF6 Q;  1YIT A;  2BA0 A;  1CKN B;  3UE0 A;  2JA6 G;  4OON A;  3T1Y Q;  2A8V A;  5IP9 H;  3M85 A;  2N49 A;  4OWW B;  2K5V A;  1KQS A;  4DV7 Q;  4DR7 Q;  2UXD L;  3MEF A;  2E8G A;  2UUB Q;  1CSQ A;  1EQQ A;  4LFB L;  3CXC A;  3H3V I;  2B63 H;  4A3L H;  4GLA C;  5HY6 A;  1ASZ A;  3PO3 G;  1Q1E A;  2OQ0 A;  3WWV A;  4BY1 H;  3ULP A;  1VQ6 A;  4YY3 L;  4H02 A;  4GLX A;  3TS2 A;  1I5F A;  1I3Q H;  3TQY A;  2K5N A;  1SMX A;  1DGS A;  4R4Q A;  4B3R Q;  5HGQ A;  5C0X I;  1VS0 A;  4DV2 L;  3UDG A;  3HOX H;  2VQE L;  4DV5 Q;  3S1M H;  4A3L G;  5AJ3 Q;  4RMF A;  2D0O A;  5LMU L;  1VQF A;  4OX9 L;  4IFD G;  4PZ6 A;  4JI5 L;  2JA5 H;  4LF5 L;  2Z6K A;  4IOC A;  1YJN A;  1VQE A;  3NEM A;  4QL5 A;  3D31 A;  3CCV A;  1G29 1;  2WB1 G;  1C7Y A;  1VQ4 A;  1C0A A;  5IYD G;  3KJO A;  2WP8 J;  4A3J H;  1AE3 A;  2AWN A;  3T1H Q;  4QY7 A;  5BR8 Q;  4UY8 C;  4L5Q A;  1IBK Q;  4GKK L;  2JA5 G;  2AWO A;  4OO1 I;  1HR0 Q;  2YYZ A;  1V9P A;  1XMO Q;  2XGT A;  3U50 C;  1VQA A;  1PH5 A;  4DAM A;  1Q86 C;  5E7N A;  3AEV A;  4K0K L;  4A3G H;  2F3I A;  4IPG A;  1IBL Q;  2NVQ H;  3CCS A;  1KL9 A;  2NVY H;  3BZC A;  3CMA A;  4A3J G;  5FJ8 H;  2NN6 G;  3ERS X;  2UUA L;  5FLM G;  3K8A A;  3GTK H;  1VQK A;  1B7Y B;  1W3S A;  4A3E H;  4BY7 G;  2JE6 I;  2AHO B;  1EQR A;  1CSP A;  4GKJ L;  1PYS B;  3PSI A;  2WFW A;  5GAH C;  3PUX A;  2UUC Q;  3PV0 A;  3S15 H;  4Y7N H;  1VQ5 A;  4P71 A;  4QQB X;  4X65 Q;  4YHH L;  1IBM Q;  1X3F A;  1WCM H;  4IPD A;  4OWX B;  2ZJP A;  4Y52 H;  3IRB A;  3J80 i;  2F4V L;  3OTO L;  4LFA L;  3A0J A;  4IFD J;  4ME3 A;  4R4T A;  1JJG A;  2H5X A;  1EIY B;  4JI2 L;  2UXC L;  1UEB A;  1KRT A;  1YJ9 A;  3RLO A;  1KAW A;  5ELN A;  2I5L X;  5H1S E;  1QUQ A;  1D8L A;  1OXV A;  1N33 L;  4NXN L;  4P75 A;  4UPA A;  3CAM A;  3Q8D A;  4LF6 L;  1L0W A;  4A3B G;  2DGY A;  3HOY H;  4BBS G;  3T1Y L;  1RIP A;  3AFP A;  3I4O A;  3I7F A;  4JBJ A;  1VQ8 A;  4JBW A;  1IYJ B;  1Q81 C;  4C2M H;  2ATW A;  3I4N H;  5JJL A;  1GVP A;  2IHE A;  4DV7 L;  1EUJ A;  1K83 H;  1X54 A;  3HKZ G;  4R1J A;  1X55 A;  2UUB L;  4LF4 Q;  3S1N H;  1NBW A;  1P16 A;  4BBR H;  1VQD A;  3KLW A;  3JC6 6;  3F2B A;  1KD1 C;  1BKB A;  3F2C A;  1T9H A;  2K52 A;  5J3B A;  1UWV A;  4DV6 Q;  3OW2 A;  1I50 H;  1PYB A;  4LNQ A;  4BXX H;  1I6H H;  2CWA A;  4IPH A;  3I4N G;  1PV4 A;  1WJJ A;  2JA8 H;  4DR1 L;  2IT1 A;  4B3R L;  3S1R H;  1HJP A;  1FL0 A;  4YWK A;  2RHQ B;  3A74 A;  1EWI A;  1NY4 A;  1HH2 P;  2RCN A;  4GN3 B;  4JOI C;  1HZC A;  5AJ3 L;  1NMF A;  1TWG H;  1L1O A;  4JBK A;  3M7N A;  2D0P A;  3RR5 A;  3AFQ A;  4KHP Q;  2Y0S G;  4GOP A;  3M4O H;  1KXL A;  3GTG H;  4C3H H;  2QA4 A;  2LSS A;  4HJ9 A;  1K0R A;  4O0A A;  1KRS A;  1L2F A;  2VQF Q;  1HZB A;  2CKZ B;  1UE5 A;  3RLN A;  1FGU A;  1NTG A;  1BVS A;  2KCM A;  2MQH A;  5BR8 L;  4HIO A;  3T1H L;  3HOW G;  2NZH A;  4DV4 Q;  1IBK L;  4JI1 Q;  1HR0 L;  3RNU A;  1XMO L;  2PI2 E;  4J15 A;  4A4I A;  3SGI A;  1QVG A;  2ZJQ A;  3PO2 H;  5IYC H;  1X65 A;  5IYB H;  2CFM A;  2R7Z H;  2HIX A;  3BJU A;  1IBL L;  4NB3 A;  2HT1 A;  4DR2 Q;  4BA1 I;  4C3I H;  2HIV A;  1YHA A;  4GN5 A;  4DPG A;  3GTQ H;  4OXP A;  3PUV A;  3ZJY C;  3J81 j;  3FP9 A;  3CC2 A;  1Z9F A;  2VS1 A;  1KC8 C;  1SRU A;  4HJA A;  2PQA B;  4JCV E;  3F1Z A;  1OXX K;  2I5M X;  2Q2I A;  5C4X H;  5IYB G;  2UUC L;  2CQO A;  4DR4 Q;  1PH2 A;  3ULJ A;  3BU2 A;  4X65 L;  4X62 Q;  3K80 C;  3CCU A;  1IBM L;  4LF8 L;  5IP9 G;  4IOA A;  4YCW A;  2JA9 A;  2R92 H;  4JI3 L;  1Q82 C;  1UE1 A;  4AH6 A;  5IY0 A;  4GLV B;  1HNX Q;  4DR6 Q;  1Y1W H;  1XPU A;  2YTV A;  2B63 G;  1Y1V H;  2UXB Q;  1OXS C;  1X56 A;  4PMW A;  1YIJ A;  1JB7 A;  3G48 A;  4BY1 G;  3S14 H;  1YZ6 A;  2NVX H;  2KHI A;  1VCI A;  3A5Z B;  1SR3 A;  1B8A A;  2ES2 A;  4B3S Q;  3W5O A;  1FVI A;  4IPC A;  1PH1 A;  1SRO A;  4X66 Q;  5GAD C;  1Y1W G;  3HOX G;  4A3K H;  5M5Y H;  1M90 C;  4LF7 Q;  2N8N A;  4LF4 L;  1NMG A;  3HOV H;  2IX0 A;  3M4Q A;  5ELO A;  2E5L Q;  3KF8 B;  2QEX A;  2BA1 A;  3KOJ A;  3B6Y A;  4DV6 L;  2Z6K C;  3PGZ A;  1O7I A;  1KIX A;  4L5T A;  3KDF B;  4A3K G;  4JG2 A;  1LM0 A;  3STB C;  1G51 A;  2WAQ G;  2Q2U A;  1HZ9 A;  3F8T A;  5M5W H;  1XPR A;  1X9N A;  1HZA A;  4JI8 Q;  2IY5 B;  1D7Q A;  3HOV G;  5LMN Q;  2MO0 A;  1BBW A;  3PUZ A;  2EIF A;  3J81 c;  3AYH B;  4A3G G;  4YCU A;  4NXM Q;  4A3F H;  3PIP A;  3NEL A;  4KHP L;  5JEA G;  5FJ8 G;  5IE8 A;  4QGU A;  1ASY A;  4LFC Q;  3PCO B;  4UP8 A;  1WFQ A;  4DV1 Q;  2VQF L;  2ZTE A;  5K36 G;  1J5E L;  2K14 A;  4R4O A;  4A3E G;  3CME A;  3G6E A;  3KFU A;  1YBY A;  4DV4 L;  4A93 H;  4IFD I;  4JI1 L;  5FLX c;  2C35 B;  1E24 A;  4DV3 Q;  3F2D A;  4DKA C;  4A3F G;  5IP7 H;  3CCQ A;  5IWA Q;  4HJ8 A;  4AIM A;  2KEN A;  4JBM A;  2WB1 E;  4HID A;  3GTL H;  4DR2 L;  1WCM G;  3I56 A;  1W2B A;  1NJI C;  1EOV A;  3FKI H;  3DM3 A;  3S24 A;  3GD7 A;  3HOU H;  1N9W A;  2R7D A;  3J81 i;  3S1Q H;  4A93 G;  4P72 A;  3M3Y H;  3K0X A;  1A8V A;  4LUV A;  1YJW A;  1E7Z A;  5IP7 G;  1IZ6 A;  1S72 A;  4POF A;  1TXY A;  3CCL A;  2QGQ A;  1VQG A;  3HKS A;  4EQ5 A;  2ZTD A;  3J7Z C;  3CPW A;  3S17 H;  4AYB G;  4PZ7 A;  3HOZ H;  4YCV A;  2WAQ E;  2NN6 I;  1TWA H;  1UE7 A;  3FKI G;  4R4I A;  3ULL A;  2VQE Q;  4X62 L;  4HIK A;  1SFO H;  2D62 A;  3CCE A;  3STB D;  2B3G A;  2MO1 A;  5LMU Q;  5M3F H;  3E9H A;  4A3M H;  4JI0 Q;  2OQK A;  1XNR Q;  2UU9 Q;  2NZO A;  1VQO A;  1HNX L;  1X6O A;  1LYL A;  4DR6 L;  3K7U C;  2A1A A;  2AMC B;  1YNX A;  2GVB A;  1K8G A;  4BBR G;  3I4M H;  4DV5 L;  2UXB L;  3H3V H;  2VL6 A;  3H0G H;  2DUD A;  1VQM A;  3HOZ G;  5JEA J;  3M4P A;  3PIO A;  4JOI A;  2OTL A;  4A3M G;  4B3M Q;  2JEB I;  4O2D A;  4BXX G;  3EIV A;  4XIG S;  4JV5 Q;  4DR5 Q;  2CCZ A;  4X64 Q;  3E0E A;  2JA8 G;  3FHW A;  3UDI A;  4X66 L;  1CKN A;  2VW9 A;  4JI7 Q;  2E2H H;  2GN5 A;  1A62 A;  3CQZ H;  3CW2 C;  4GNX C;  2K50 A;  4HIM A;  3RN5 A;  1MJE A;  2HHH Q;  2JA7 H;  1KHI A;  3I2Z A;  4KLK A;  2EQS A;  3H0G G;  2PQA A;  5GQO A;  4LF7 L;  2YTY A;  2BH8 A;  1YEZ A;  4DK3 C;  4A76 A;  4MNO A;  1FJG Q;  5DLQ E;  1AH9 A;  3GO5 A;  4LF9 Q;  2E5L L;  1K9M C;  1Q1B A;  1HR0 W;  3CCJ A;  2ALY B;  3LGJ A;  3GTP H;  2JA7 G;  4GKJ Q;  1H95 A;  5JJI A;  1Q46 A;  3U58 A;  3HKZ E;  1X3E A;  4JI8 L;  4LWC A;  1A63 A;  5LMN L;  4DUY Q;  4LUZ A;  2N78 A;  4GNX B;  1CKM A;  1Q7Y C;  1XNQ Q;  1K73 C;  1PH9 A;  3RLF A;  5LMN W;  3PO2 G;  2B29 A;  3OYY A;  5IYC G;  3NBH B;  2R6G A;  2R7Z G;  1VQI A;  2JQO A;  3TEH B;  4NXM L;  2JA6 H;  1EFW A;  4DR7 L;  4EX5 A;  2MFI A;  4RG1 A;  3UE1 A;  1VQ7 A;  1OTC A;  3L0O A;  4LFC L;  1S3O A;  1GKH A;  4AQY Q;  2ASB A;  3VDY A;  1OXT A;  3KJP A;  3JAM c;  3KF6 B;  1N36 Q;  3PF4 A;  1XPO A;  5GRO A;  3UDX A;  1GM5 A;  1V1Q A;  4PZ8 A;  1S40 A;  1PA6 A;  1HNZ Q;  4NXN Q;  3HFZ B;  5C4X G;  1XJV A;  1JJ2 A;  4KI0 A;  1K8A C;  4DV3 L;  2OCE A;  1QZH A;  2Y0S E;  5IWA L;  5C44 H;  4DR3 Q;  3PF5 A;  2RF4 A;  4C3J H;  1XTD A;  1N32 Q;  2R92 G;  2R7F A;  2IHF A;  3KDF A;  4A3C H;  1B70 B;  4KHZ A;  1XMQ Q;  1HNW Q;  3H15 A;  1WOC A;  1N34 Q;  1TWH H;  5C4J H;  2JJQ A;  4UP7 A;  1PHJ A;  4QJF A;  2PNH A;  5IT9 c;  3CC4 A;  1P8L A;  1Y1V G;  3S2H H;  1YHQ A;  4JYA Q;  1LTL A;  4JI4 Q;  5C44 G;  4B3T Q;  2AKW B;  4DR1 Q;  3EN2 A;  3U4V A;  2YV5 A;  2I5H A;  5C0X J;  2LXJ A;  5IYD H;  2GVA A;  4FDB A;  1Q12 A;  3JAM i;  4POG A;  3CPF A;  4DR4 L;  4A3C G;  3W1B A;  2OWO A;  4JI6 Q;  2NVT H;  5C3E H;  1JMC A;  4JI0 L;  4JC0 A;  1XNR L;  2VZA A;  2LXK A;  2UU9 L;  2ZTC A;  1Z47 A;  3CP0 A;  2E2I H;  1VQN A;  5M3M H;  3J7A 5;  3TRZ A;  3RN2 A;  2RHS B;  1Y14 B;  1EYG A;  3HOY G;  5EAY A;  1IXR A;  1PH7 A;  3PUW A;  1K3R A;  1VQP A;  1SN8 A;  1UE6 A;  1VQB A;  2VY3 A;  2ZM6 Q;  3CCM A;  4IO9 A;  1I94 Q;  2E2J H;  3ER0 A;  1A0I A;  4X6A H;  4APV A;  1VQ9 A;  4B3M L;  1J6Q A;  5FLM H;  5C3E G;  4JV5 L;  2VNU D;  4DR5 L;  1RL2 A;  2R93 H;  1TWF H;  2CWP A;  4X64 L;  1E1O A;  2KBN A;  5M3M G;  3BZK A;  2ID0 A;  3J80 c;  4BY7 H;  4JI7 L;  4DUZ Q;  2A19 A;  2KHJ A;  4DV0 Q;  3TS0 A;  2HHH L;  4R4C A;  4P73 A;  4UP9 A;  5GAG C;  3M9B A;  1GO3 E;  3G4S A;  1PH3 A;  2YU9 H;  2V1C C;  1AE2 A;  1FJG L;  4YWM A;  3GTM H;  3DLL A;  4LF9 L;  1YI2 A;  4OWT B;  2R93 G;  4GN4 B;  3U4Z A;  1JT8 A;  2UXD Q;  1G6P A;  1WI5 A;  1E3P A;  1NE3 A;  1V43 A;  3E9I A;  2K5H A;  1M1K C;  2XTI A;  4LFB Q;  2PI2 A;  2Q2T A;  1MJC A;  4GS3 A;  4PG3 A;  3K81 C;  1VQJ A;  2EXD A;  3TRE A;  1R9T H;  4L5S A;  3G71 A;  4DUY L;  4YY3 Q;  1PH6 A;  1X3G A;  4LF8 Q;  1PVO A;  1XNQ L;  1YVC A;  4JI3 Q;  3GTJ H;  2ZJR A;  1VQL A; 
#chains in the Genus database with same CATH topology
 4BBS H;  3PUY A;  4Y7N B;  1DOL A;  4KTA A;  3L2P A;  2ZJT A;  1IL2 A;  3OIP A;  3CCR A;  3T51 B;  1QZG A;  2L1B A;  3SR1 A;  3HOU G;  2AQ4 A;  1EY6 A;  2BCO A;  2I0Q A;  3A5U A;  3QO2 A;  5CV6 A;  2Q2H A;  3BA9 A;  2IJ0 A;  4A3D G;  3N8D A;  1QB5 D;  5I47 A;  2FK2 A;  1O7L A;  5DG9 A;  3QZ8 A;  3NPP A;  3VR6 A;  2DWC A;  3K5M A;  4JI1 H;  1DZ1 A;  2K75 A;  4O4H F;  1HNW L;  5IGE A;  1N34 L;  4C2M B;  3GDE A;  5CGK A;  2ZDQ A;  1K83 B;  4KY7 A;  4GNX A;  2I07 B;  1QE6 A;  2VUM H;  4KY5 A;  2F0D A;  2YTX A;  3RZO H;  2K04 A;  1XXG A;  1PH8 A;  2PN1 A;  4DR7 H;  2W6P A;  3NWT A;  4J9O A;  1PFN A;  1UNN C;  4DAP A;  3KF6 A;  4I65 A;  4ED7 A;  4TVA B;  2JA6 A;  3AQQ A;  4MV8 A;  4FXG C;  1DIK A;  5KG4 A;  1PFM A;  4AYB E;  1MIU A;  1X3P A;  2DY8 A;  1II3 A;  5FK9 C;  2ZM6 L;  3A7L A;  5DQI A;  2Z0S A;  4TQS A;  2R7N A;  1SEB D;  1QVC A;  3Q23 A;  3M4O B;  5D8D A;  4DV5 H;  3KYH C;  4C3H B;  4JI2 Q;  2UXC Q;  4YWL A;  1CKO A;  2A6H D;  1BBU A;  1ZYR D;  2HQL A;  4OO1 G;  3MXG A;  3PO3 H;  1ILP A;  1N8R C;  4ULL A;  4LF6 Q;  2KSW A;  1CKN B;  3UE0 A;  4LMQ D;  4OON A;  1DYQ A;  3MAQ A;  2A8V A;  4TSS A;  5FOB B;  4OWW B;  4I50 F;  1EYD A;  4DR7 Q;  4LF7 H;  3MEF A;  1GSH A;  1BBX C;  3DUZ A;  4ME5 A;  4F88 A;  1F2Y A;  2WII B;  3PR4 A;  1GHK A;  2R85 A;  5D65 A;  2NU6 B;  2I46 A;  3EQL C;  4GLA C;  4K6L A;  4ECZ A;  5DGB A;  4YY3 L;  4HR7 A;  5KFA A;  3R2T A;  4CKB A;  3J80 E;  1KJI A;  4EGV A;  2LFN A;  4G7Z C;  1DGS A;  5HGQ A;  2JA5 A;  1I4G A;  1VS0 A;  2J6S A;  4JI8 H;  2E2I A;  5LMN H;  1ZQ7 A;  5KFY A;  3HOX H;  4DV5 Q;  5AJ3 Q;  3K5O A;  2IW3 A;  2R92 B;  1XWE A;  4R7R A;  1VQF A;  2R84 A;  5COY A;  2IWH A;  1A15 A;  1YJN A;  2VA3 A;  3SXH A;  4LFC H;  1A3U A;  1G29 1;  1IBM H;  3KJO A;  3C1F A;  2W6M A;  4A3J H;  2NVX B;  4I7H A;  4HSV A;  3T1H Q;  2FMA A;  1CS0 A;  1XMO Q;  5IWA H;  2XGT A;  3E3X A;  2SOB A;  5FD6 A;  1Q86 C;  4KY6 A;  2F3I A;  3DM1 A;  3OUU A;  2FK3 A;  4RB3 C;  1SJH D;  2PZT A;  4RFB A;  4RHS A;  5FJ8 H;  3HOV B;  3T13 A;  5FLM G;  2PQE A;  3R5H A;  1VQK A;  2I80 A;  1Y8P B;  4P2C B;  4BY7 G;  4WJW A;  4RWS C;  2AHO B;  1EQR A;  1CSP A;  1ICW A;  1PYS B;  3PSI A;  4DAY A;  1AUV A;  1D1K A;  2XWB B;  1WTH A;  4M9U A;  2B8G A;  1VQ5 A;  3A8K E;  1IBM Q;  4BWG B;  2J9G A;  1LO5 D;  1BXT A;  1LTG D;  3IRB A;  4KJO A;  3QFF A;  4UCO A;  3QIA A;  3RUP A;  4JV1 A;  4ME3 A;  4R4T A;  3WO1 A;  2H5X A;  4K2L A;  2V5A A;  4JI2 L;  1IW7 D;  1WCM B;  2UXC L;  2RDJ A;  1UEB A;  4UCR A;  2PZU A;  5ELN A;  3FMC A;  5H1S E;  1QUQ A;  1OXV A;  4NXN L;  4A93 B;  5KFM A;  4UPA A;  4LF6 L;  4A3B G;  5KFL A;  2W8L A;  2WDT A;  1RIP A;  3AFP A;  3I4O A;  3I7F A;  2BDN A;  1VQ8 A;  4I55 F;  1H9S A;  1IYJ B;  3VPD A;  1B6R A;  3OOC A;  1GVP A;  1JLL B;  1EFI D;  4MTD A;  1BCP D;  1D5X C;  1G2S A;  1GJX A;  1P16 A;  4CHT B;  2Y0S A;  1PK8 A;  3N43 B;  3JC6 6;  3F2C A;  2RA4 A;  1T9H A;  2K52 A;  3TIN A;  2WV6 D;  1I6H H;  2CWA A;  5FPO A;  2BR0 A;  3FPP A;  3T53 B;  1EY8 A;  2JA8 H;  4K5W A;  4DR1 L;  2OH2 A;  3NBH A;  1O7Z A;  3D4R A;  1HJP A;  3S1R H;  1HH2 P;  2XN9 C;  4IAL A;  5AJ3 L;  1HZC A;  4A3M B;  4JV0 A;  1L1O A;  4HNV A;  4JBK A;  2D0P A;  4XYL B;  3NQI A;  2HVQ A;  4MA5 A;  1A2T A;  4RAU C;  3I4M B;  2QEJ C;  4HJ9 A;  1L2F A;  1S5F D;  3U9T A;  5NUC A;  1LAB A;  2XNA C;  3L4J A;  1FGU A;  3T1H L;  4DR6 H;  4HIO A;  1UC8 A;  2C2E A;  2NUA B;  1ZXT A;  1QVG A;  1XMO L;  1R4Q B;  5C6A A;  2E2H B;  2XRQ D;  3VMM A;  2UVR A;  4IRC A;  5IYC H;  2P0A A;  1BF4 A;  4RH6 A;  4C3H G;  2W9B B;  2ASJ A;  3LNN A;  1HTL D;  1W96 A;  4C3I H;  1PTO B;  1STN A;  2ENB A;  3MFY A;  2W9C A;  3F8N A;  3CC2 A;  4ECV A;  3ORQ A;  2VS1 A;  3PO2 B;  1SRU A;  2FFK B;  4IUN A;  3V96 A;  2X0S A;  4JYA H;  4JI4 H;  5C4X H;  2Q2I A;  5IYB G;  4B3T H;  2AQ1 B;  4R8U A;  2L12 A;  2VA2 A;  3BU2 A;  4ETS A;  4IR9 A;  1IBM L;  2O5J C;  4CJ1 B;  1SYB A;  4YCW A;  5KFO A;  5DAU A;  4YAK B;  1TS4 A;  4DR6 Q;  3SI8 A;  1WTV A;  2JP1 A;  1HXY D;  3G48 A;  2Z1C A;  4BY1 G;  1T94 A;  4ME6 A;  5D1O A;  3S14 H;  2NU9 B;  4CKC A;  2ES2 A;  1K0S A;  1FVI A;  3MVV A;  5J2T F;  4EYI B;  4F8M A;  4DUZ H;  2F1M A;  4DV0 H;  4ZKC B;  2IBK A;  4HAE A;  3V6H A;  3TDQ A;  4OIK A;  1VDZ A;  1S97 A;  5KYI A;  3V4Z A;  4GZY C;  1FKA H;  3K3V A;  5EPJ A;  2V9W A;  4DGZ A;  1TS2 A;  4K2K A;  3VR5 A;  2QEX A;  3JAM L;  1Y8O B;  3KOJ A;  4J9Q A;  2UXD H;  1S68 A;  1KC7 A;  2EJF C;  4LFB H;  4JG2 A;  5D3D A;  3STB C;  1G51 A;  2WAQ G;  1HZ9 A;  1XPR A;  1E4G T;  1FNW A;  4ECT A;  1HZA A;  4R8N A;  2PYK A;  3HOV G;  2XIG A;  1G91 A;  5K36 H;  4JVZ A;  1BBW A;  5C3E B;  3OW7 A;  1L0Y B;  3GV6 A;  4A3F H;  3PIP A;  3URY A;  2NYZ D;  4QIW A;  3TBI B;  1ASY A;  5IGG A;  5LMU H;  2E2J B;  5BMV F;  3Q1K A;  3V2T A;  2EYP A;  1J5E L;  4UCV A;  4A3E G;  2UVW A;  5D14 A;  2PVP A;  5DQH A;  3KBG A;  5KFS A;  5FLX c;  3T5K A;  2C35 B;  1E24 A;  4DKA C;  3TME A;  1PZJ D;  4AIM A;  4XZ3 B;  1JWU D;  3GTL H;  4IHJ F;  1WCM G;  3M4I A;  3L3O C;  2KCN A;  2YU9 B;  5J2U F;  3I90 A;  1K8O A;  3FKI H;  1HUN A;  2R7D A;  3J81 i;  2EYM A;  2F0G A;  4A93 G;  4NLG A;  3J81 L;  1WTO A;  4K0K H;  3M3Y H;  1A8V A;  2KUM A;  2VXW A;  1EL0 A;  4POF A;  2MHV A;  5KND A;  4A2A A;  4KD3 A;  3S1Q B;  4PZ7 A;  4YCV A;  2WAQ E;  2NN6 I;  1TWA H;  1UE7 A;  3ULL A;  4HIK A;  4DR4 Q;  3K58 A;  1SFO H;  3CCE A;  3K57 A;  3K5H A;  3D6W A;  5LMU Q;  5M3F H;  3E9H A;  4JI0 Q;  2OQK A;  1TWG A;  4GKJ H;  1GSA A;  5D3I B;  4BBS B;  1NCV A;  1LYL A;  4DR6 L;  3K7U C;  2AMC B;  1YNX A;  4BBR G;  4EVO A;  5JVL A;  3GTG A;  3H0G H;  2DUD A;  2X6G A;  5JEA J;  3M4P A;  1RYR A;  5ELF A;  4A3M G;  4BXX G;  1PTO C;  4XT3 B;  1EU3 A;  4FF1 A;  3HS0 C;  1CTM A;  1NNX A;  4RAY A;  5ELB A;  3QOJ A;  3CW2 C;  1MJE A;  3RN5 A;  2R8I A;  2K50 A;  2JA7 H;  1WH2 A;  2ICI A;  2PQA A;  2R7Z A;  2YTY A;  1EY5 A;  4A76 A;  4MNO A;  3T1Y H;  5CV9 A;  3GO5 A;  3N40 P;  2ALY B;  1A2U A;  3LGJ A;  1CHQ D;  3H94 A;  4GKJ Q;  1Q46 A;  2NUC A;  2VUM B;  3K5N A;  3RZO B;  4FVM A;  4LWC A;  4TV9 F;  4LJZ C;  1A63 A;  3N44 B;  4DUY Q;  5KFP A;  4LUZ A;  4KV6 A;  5LMN W;  3PO2 G;  5IT9 E;  1ENF A;  3E5N A;  2C5C A;  2JQO A;  3TEH B;  2JA6 H;  1EFW A;  3SVM A;  4RG1 A;  1VQ7 A;  4O3O A;  3PZP A;  4ZI7 F;  3JSN A;  5IGF A;  3KJP A;  1Y1V A;  1QG7 A;  2FJ2 A;  3FRP B;  1LTA D;  5KT6 A;  3UDX A;  1V1Q A;  1S40 A;  4IZO A;  5KFC A;  3HFZ B;  1J8I A;  1KEE A;  4J9S A;  2Q8I B;  4KI0 A;  4O3N A;  5LYJ F;  4EBE A;  2Y0S E;  2FLP A;  1F9R A;  2A68 D;  4DR3 Q;  2D9U A;  5BN5 A;  1PRT D;  3PF5 A;  5IIF A;  4C5B A;  4C3J H;  1PX2 A;  3PO3 B;  5BR8 H;  3RGZ A;  4QWB A;  2L4N A;  4XYO A;  3KDF A;  3J7A K;  4DL2 A;  1XMQ Q;  1H9R A;  3H15 A;  3JRX A;  1WOC A;  1GYF A;  2B2T A;  1IBL H;  1DM0 B;  2I8C A;  2PCF B;  1YHQ A;  1L0X B;  2C2R A;  3U4V A;  2YV5 A;  4QW8 A;  5IYD H;  5JUM A;  4FDB A;  1Q12 A;  4A3C G;  3CPF A;  4DR4 L;  5FLX E;  2NTT A;  5EPK A;  4EYH B;  2A74 C;  4JI6 Q;  2NVT H;  4JI0 L;  3JAM W;  1B4O A;  1EQT A;  4O4I F;  2VZA A;  1MZB A;  2ZTC A;  3CP0 A;  2E2I H;  1VQN A;  1S5D D;  3TRZ A;  1V1P B;  2F03 A;  1IXR A;  1WTQ A;  3PUW A;  4L1K A;  5EWE A;  1I94 Q;  2HVS A;  4JI3 H;  2H4O A;  3ER0 A;  1RTO A;  3OWF A;  3M9N B;  3BG3 A;  5C3E G;  1H9K A;  5E4W C;  2R93 H;  2EYJ A;  2ID0 A;  1O80 A;  4FS2 A;  3TIG A;  4A3J B;  2F0W A;  2V4Q A;  3TS0 A;  2FB9 A;  5BPH A;  4JI5 H;  1WD1 A;  4TV8 F;  4LSX A;  4UP9 A;  2LMC B;  3M9B A;  4Q8E A;  4Q44 A;  4JV2 A;  2CQY A;  5LHY 1;  3SK4 A;  3VYS A;  4F50 A;  2JSO A;  5KIX A;  1GUO A;  3U4Z A;  2N88 A;  1R9T A;  2NTS A;  4KK7 A;  1AEX A;  3E9I A;  1NE3 A;  4UCT A;  2K5H A;  1EZ1 A;  4LF4 H;  3VPB A;  1QIL A;  4F4X A;  2FPG B;  4L5S A;  3TRE A;  1VQJ A;  5KFE A;  1B9M A;  3BVG A;  4J9N A;  4DUY L;  1PH6 A;  1PVO A;  3DEP A;  2F0N A;  4JI3 Q;  3GTJ H;  1VF5 C;  1VQL A;  2PMZ E;  3D0F A;  5IYZ F;  1V51 A;  4NP5 A;  1SLJ A;  3N41 B;  3LWU A;  3J80 W;  4O3R A;  5KFT A;  3MFI A;  5EKI A;  2WKD A;  2FXQ A;  4OX9 Q;  5JVH 3;  2FPP B;  4JI5 Q;  1DV1 A;  4ECQ A;  1LT6 D;  3KBX A;  4O3S A;  2OLS A;  4R9W A;  4LW1 A;  3MWY W;  1GGO A;  2EY5 A;  3D4D A;  1U5K A;  4A3I H;  5C5L A;  1HTP A;  4DR3 L;  3CQZ A;  3QWN A;  1VMP A;  3W1G A;  5CA1 F;  5KFV A;  4DV4 H;  4GKK Q;  4ED8 A;  4TQU S;  1SDF A;  2KCC A;  3D8G A;  1S5B D;  2C9O A;  5CBE E;  1XMQ L;  1LT5 D;  1B6S A;  1K3B C;  2JEJ A;  1M7J A;  2KCT A;  4P74 A;  3OMC A;  1JE5 A;  1U0L A;  4DR2 H;  3A54 A;  4WJ4 A;  1EWH A;  4KD4 A;  2HD3 A;  4A75 A;  4PDB A;  4O42 A;  3BVM A;  5EGT A;  4YBZ B;  5C1O A;  2FP4 B;  4QIW E;  1VQC A;  4XTC S;  4JI6 L;  1I6H B;  5C0X G;  4CC6 A;  1SMY D;  4GOP C;  5HBR B;  5LOV F;  3S1R B;  1DOM A;  4V19 0;  1BUV T;  2F52 A;  3RAQ A;  2VUM G;  2K4K A;  1JX4 A;  1I94 L;  1LUZ A;  3MWM A;  5KX5 F;  1JQY D;  2OTJ A;  1ET9 A;  1JJC B;  3UQ8 A;  3GTO A;  1CA6 A;  3SK6 A;  3G6V A;  4L5R C;  4DV1 L;  3VA5 A;  2O4X A;  3MXN B;  3HBL A;  2BH2 A;  4DK6 C;  4N8F A;  1T3N A;  1TR5 A;  5GAE C;  1N33 Q;  1EWC A;  2VB2 X;  5I2Y A;  5M5X H;  2BA0 A;  1RKN A;  5IP9 H;  4N9T A;  1TWH A;  5KFG A;  1I6V C;  3MJF A;  1K28 A;  4QWE A;  4V0B A;  2UUB Q;  1EQQ A;  1ET6 A;  2CH4 A;  5CB4 F;  3CXC A;  3H3V I;  4A3L H;  3PO3 G;  4MV7 A;  5CV4 A;  2OQ0 A;  3WWV A;  4PV1 C;  1TT2 A;  1EYA A;  3TP7 A;  4GLX A;  5C4X B;  1I3Q H;  3TQY A;  1EYC A;  1SMX A;  2K5N A;  4R4Q A;  4DNT B;  4B3R Q;  4ZOL F;  1BCP F;  4M8A A;  3BQ0 A;  1KDC A;  3OHB A;  1M0T A;  2R8K A;  3IFD A;  2VQE L;  5JOB A;  4TUY F;  4RMF A;  3W2D A;  4OX9 L;  2LY7 A;  4JI5 L;  1XDN A;  2Z6K A;  4IOC A;  1JOR A;  3NEM A;  3PIO 3;  5K2M A;  3CCV A;  3S1M B;  1JOO A;  1C7Y A;  1FYC A;  2K01 A;  3S14 B;  2NN6 H;  2AWN A;  2CW0 C;  4QY7 A;  4UY8 C;  1CQJ B;  1EUD B;  2XVS A;  4L5Q A;  3H09 A;  1IBK Q;  4GKK L;  3I8Z A;  4OO1 I;  4MV3 A;  5KFN A;  2YYZ A;  3U50 C;  5L1I A;  4DAM A;  3TII A;  4NMZ A;  2RDG A;  4X3S A;  5E7N A;  3AEV A;  4ECX A;  1O78 A;  1XX8 A;  2OT2 A;  4HCE A;  2NVQ H;  1KL9 A;  2NVY H;  3BZC A;  3CMA A;  4A3J G;  1RYS A;  3E5S A;  2YYA A;  1RJT A;  3PN1 A;  5I2X A;  1I7N A;  2KJX A;  3PW7 A;  1CQF A;  4JPB W;  2J6U A;  1B7Y B;  1W3S A;  3J7A F;  3EPI A;  5GAH C;  2WFW A;  3PUX A;  1S10 A;  5KFK A;  1TWC A;  1V1O A;  4J1M A;  2QDB A;  4DV6 H;  4P71 A;  1KBL A;  3H91 A;  1X3F A;  3CKI B;  1G8Z D;  3OHA A;  3C3L A;  3DEO A;  2PW5 A;  4A3F B;  4Y52 H;  5CV7 A;  1F9S A;  1E2Z A;  4IFD J;  2AQ3 B;  2YRW A;  1J9O A;  4F87 A;  2C2D A;  1EIY B;  2M00 A;  2R8H A;  1KRT A;  1YJ9 A;  2B2Y A;  2RDH A;  1STY A;  4JV5 H;  1N33 L;  3OWE B;  1DOK A;  3ND9 A;  4P75 A;  3Q8D A;  2A6E C;  2DGY A;  4EGJ A;  2F0K A;  4JI7 H;  3WOE A;  4JBW A;  1Q81 C;  2B2W A;  3NP8 A;  3I4N H;  5J22 A;  3GTL B;  1EUJ A;  4R1J A;  1X55 A;  2UUB L;  1TY2 A;  3S1N H;  1FJG H;  4MIU A;  3FKI B;  3HOY B;  3OPO A;  1VQD A;  2AUJ D;  2OEO A;  5DG8 A;  5J3B A;  4FM9 A;  4DV6 Q;  3M3Y B;  1PYB A;  4FF2 A;  2NB0 A;  4Y8V B;  2VPQ A;  2ICE C;  2G5D A;  4B3R L;  2GLT A;  3ONA B;  1QCB D;  2XIW A;  4YWK A;  5T1G A;  2NU8 B;  3BQ2 A;  1SFO B;  1STB A;  4JOI C;  1NMF A;  4FU0 A;  1TWG H;  5M3F B;  2B2V A;  3KHH A;  3V6J A;  1JIC A;  2WTF A;  3J7Y W;  3Q24 A;  3J7A V;  3SDZ A;  2F0H A;  3GTG H;  3H0G B;  2QA4 A;  2LSS A;  4IUQ A;  1K0R A;  1N36 H;  2FIN B;  1S0M A;  4KKT A;  2CKZ B;  1HNZ H;  1NTG A;  4MV1 A;  2MQH A;  3HOW G;  2VB3 X;  1IBK L;  3M9O B;  2B2U A;  3M7G A;  5ELC A;  4JI1 Q;  3GID A;  3RNU A;  2ZJQ A;  5KFF A;  1IKM A;  1YNJ D;  2JA7 B;  4O4L F;  3Q8S B;  2R7Z H;  2K1B A;  2HIX A;  4B3S H;  1N32 H;  1HCZ A;  4BA1 I;  1H9M A;  1YHA A;  4GN5 A;  4DPG A;  4QWC A;  1BO0 A;  5F9N A;  2EVB A;  1KAB A;  2MUY A;  1VF7 A;  3T5J A;  4L8J A;  1HQR D;  3JRW A;  1DJR D;  4IUV A;  2IMW P;  2PPB C;  2X69 A;  4UDU C;  3VYU A;  1PH2 A;  1F2Z A;  3GIQ A;  4FXK C;  4IOA A;  2VPS A;  3NUC A;  1GOZ A;  5IOD A;  4GLV B;  1DON A;  2JA6 B;  2NVX A;  4PQX A;  2J7Z A;  1Y1W H;  3NGD A;  1U4R A;  1XPU A;  2B63 G;  1Y1V H;  1OXS C;  1YIJ A;  2B39 A;  1PTO D;  1YZ6 A;  2QYZ A;  1G2T A;  4NXM H;  4B3S Q;  1B8A A;  2WAQ A;  3J81 E;  4HMI A;  5FD5 A;  4CDC C;  5FPR A;  4L63 B;  1SRO A;  4HQ6 A;  2FPI B;  4CKE A;  5C5M A;  1Z6H A;  2CHB D;  3I91 A;  5M5Y H;  4LF7 Q;  2RBM A;  1HFG A;  1B1Z A;  4IZ8 A;  2RDF A;  3X3N A;  5KNB A;  1ENA A;  3M4Q A;  5EBC A;  5EZY F;  3L4K A;  4DV6 L;  3B6Y A;  4IQZ A;  2Z6K C;  1W93 A;  1O7I A;  4K8J A;  5JEA H;  1LM0 A;  2A69 C;  2AGQ A;  4JI8 Q;  2IY5 B;  4KHV A;  3NXW A;  5LMN Q;  2FKL A;  4YAJ B;  4ED3 A;  1C4Q A;  2NVT B;  2VR1 A;  4EBD A;  2EY2 A;  3AYH B;  1WCM A;  4A3G G;  4NXM Q;  2E2I B;  4EFB A;  5K5P A;  1LT3 D;  2XWJ B;  4DV2 H;  2Z4H A;  1FGB D;  3VYR A;  2PZW A;  4LFC Q;  4Q5V A;  3N52 A;  3PCO B;  1AW7 A;  4RGM A;  1BGW A;  2W9A A;  4LF5 H;  3VR2 A;  5K36 G;  1TII D;  1EU4 A;  2K14 A;  4J9M A;  4H13 C;  3G6E A;  3KFU A;  2R93 B;  4IFD I;  2QIL A;  3FPU B;  3MEH A;  4JI1 L;  5IGC A;  4A3F G;  3F2D A;  5IP7 H;  3CCQ A;  5E3F A;  5IWA Q;  1STG A;  3Q8R B;  2XC9 A;  4HID A;  4DR5 H;  3I56 A;  1W2B A;  4K5V A;  1YNN C;  1NJI C;  2UVU A;  1VMC A;  3PQI A;  3HOU H;  2E2D C;  3NWS A;  3RV3 A;  2V4D A;  4JW0 A;  3CCL A;  4DR7 L;  1SE2 A;  1I50 A;  2QGQ A;  1PRT F;  5KNC A;  1JDE A;  1QJO A;  3S17 H;  4LF9 H;  1U4L A;  5KGU A;  3HOZ H;  3FKI G;  3HOY G;  2W6Z A;  2B3G A;  1GUT A;  2JN4 A;  4ID6 A;  3GTJ B;  1RCV D;  2F0M A;  1WTR A;  3H20 A;  4HMJ A;  1X6O A;  2A1A A;  4DL4 A;  5FLX W;  4DV5 L;  3H3V H;  1ULZ A;  3A55 A;  2IA6 A;  2W9B A;  4YP3 A;  3EIV A;  2SCU B;  2F4V H;  4DR5 Q;  1GUS A;  2R82 A;  3FHW A;  3UDI A;  1IYU A;  3V6K A;  4GNX C;  1A62 A;  3CQZ H;  4HIM A;  4A3I B;  3S15 H;  4MA0 A;  1KHI A;  4LF7 L;  2EQS A;  3H0G G;  4U6P A;  2BH8 A;  1MSG A;  4IWX A;  3KHL A;  3GTQ A;  1B53 A;  1I4H A;  2L5T A;  3C1E A;  4LF9 Q;  1AH9 A;  5KFW A;  4ZUJ A;  3X3M A;  3CCJ A;  2VQD A;  4OGQ C;  3GTP H;  4A2B A;  2JA7 G;  4ED0 A;  3U58 A;  1X3E A;  3GV3 A;  3VR4 A;  4JI8 L;  1NAP A;  4KKS A;  5LMN L;  2ZDG A;  1D5Z C;  1CKM A;  3AU7 A;  2M05 A;  3T5L A;  4OO1 H;  3TQT A;  1PH9 A;  3ND8 A;  4HN7 A;  3NBH B;  3VPC A;  4BWS C;  4NXM L;  1AN8 A;  3FVQ A;  5IGB A;  3NK9 A;  2MFI A;  3UE1 A;  3L0O A;  4LFC L;  1S3O A;  5KT2 A;  1I4Q A;  2ASB A;  3K3P A;  5A35 A;  3EPG A;  3T16 A;  1WR2 A;  1XJV A;  4KMU C;  1ICF B;  1MD2 D;  1K8A C;  4ZUI A;  1QZH A;  2PMZ A;  5IWA L;  4N8X 1;  2FLN A;  2GA4 B;  5C44 H;  3QZ7 A;  5KFZ A;  5DLG A;  2DIK A;  1ZHS A;  2R92 G;  5JPN C;  4YB8 B;  4QWA A;  1EY7 A;  1TWH H;  5C4J H;  2LKV A;  2PNH A;  5IT9 c;  3S2H H;  5GON F;  3GV7 B;  4JYA Q;  4N9P A;  4JI4 Q;  1GLV A;  1JXL A;  4B3T Q;  2AKW B;  2W9C B;  1AZP A;  5C0X J;  1IHZ A;  3JAM i;  4POG A;  3W1B A;  1EIH A;  1ZEQ X;  4ECU A;  3V4S A;  4JC0 A;  1I3Q B;  4R8U B;  2UUC H;  2WB1 B;  3SK8 A;  3EA6 A;  2RHS B;  1EYG A;  4QCL A;  4OIJ A;  1PH7 A;  4LF8 H;  5EDW A;  1UE6 A;  1VQB A;  2VY3 A;  3BYT B;  2F0E A;  3IKJ A;  1B33 N;  1VBH A;  3WO0 A;  4APV A;  3MWE A;  5FLM H;  4DR5 L;  4CC5 A;  5CC4 A;  2YU9 A;  1E1O A;  4BY7 H;  5EQ0 A;  5D1O B;  4DUZ Q;  4DV0 Q;  4YJ2 F;  5T14 A;  2W7P A;  5KG3 A;  1LT4 D;  1GO3 E;  1JOQ A;  2L9H A;  4YWM A;  3MHB A;  2L11 A;  5DM6 3;  4LF9 L;  2R93 G;  4GN4 B;  5JJZ A;  1JT8 A;  2UXD Q;  5CA0 F;  1V43 A;  2NVQ B;  2NVY B;  4LFB Q;  5KG5 A;  3RBE A;  5KT4 A;  3CVZ A;  2Q2T A;  3GTM B;  4RUC A;  3G71 A;  4LF8 Q;  5FO8 B;  3EJI A;  3S16 H;  3K5L A;  4A3B H;  1SYD A;  1TWC H;  2UUA H;  2DPJ A;  1B44 D;  3J80 L;  2L15 A;  4F7X A;  3RZD H;  1LLR D;  3Q0A A;  1NSN S;  2EYH A;  3PW2 A;  2ASL A;  3OSN A;  1VQH A;  2JEI A;  3SHL A;  3HRZ C;  3E6Z X;  1U9R A;  3HKZ B;  4HJ7 A;  3TP6 A;  1YHB A;  4S3S A;  2DZD A;  1CQV A;  2R8J A;  4LUO A;  2R61 A;  5J1Z A;  3T56 B;  4PWQ A;  1A6X A;  5KRU A;  1C9O A;  4LFA H;  4LH6 A;  4ECR A;  5F9L A;  2NBF A;  1SBB B;  4MTN A;  4IJL A;  2BE5 D;  1CI3 M;  1Y8N B;  2O5I C;  2QK4 A;  3BA8 A;  3CC7 A;  3I4N B;  1N56 A;  2FHT A;  1HUM A;  3I4M G;  4X3U A;  4K0K Q;  5BN4 A;  2PO4 A;  4JYA L;  4JI4 L;  4A3I G;  4J9L A;  3S1N B;  4B3T L;  1SJE D;  3CD6 A;  2UUA Q;  1ILQ A;  2F3W A;  2R3Z A;  3I4L A;  1I4X A;  1L1O C;  2ZXP A;  1TY0 A;  1PFS A;  3ICE A;  4IJH A;  1W6K A;  1EIF A;  4OEM B;  4EEQ A;  4DNI A;  1F2M A;  3TZD A;  3LP8 A;  5C3X A;  3PIP 3;  1TWG B;  1HA6 A;  2C22 A;  4WRD A;  4DK1 A;  2F0F A;  3UDF A;  3C2P A;  4PMB A;  5A2Q W;  4RZR A;  4ZK9 B;  4LFA Q;  5I9O A;  3GTG B;  2UXB H;  5KFH A;  3BAA A;  2N3S A;  1E22 A;  4DUZ L;  4DV0 L;  3K59 A;  4IAJ A;  3O13 A;  2JEA I;  4GOP B;  3EYY A;  4F4Z A;  1YIT A;  2MPM A;  5C4H A;  4X66 H;  3T1Y Q;  3OSO A;  5DGA A;  2F0S A;  1RK6 A;  3R3O A;  2K5V A;  3BAB A;  1KQS A;  2UXD L;  1SYX B;  4RNO A;  3RJ0 A;  2K05 A;  2YS6 A;  4ZHQ F;  4ECW A;  4LFB L;  1CT1 D;  1E2V A;  4EFE A;  1B04 A;  3EVQ A;  2E5L H;  3PW4 A;  1Q1E A;  2W71 A;  4BY1 H;  1V1P A;  1W6J A;  5LL6 S;  2HCI A;  4IFD H;  4XQJ A;  2I87 A;  1IOW A;  1LTS D;  4H02 A;  3V05 A;  1I5F A;  3TS2 A;  1BOS A;  2XGP A;  1QOH A;  4MV6 A;  1K1S A;  2K7V A;  1HRJ A;  1TKW B;  5C0X I;  1C30 A;  4HTH A;  3HXL A;  3BVZ A;  4A3L G;  3HZX A;  4OEL B;  4KN4 C;  5EKL A;  2D0O A;  5LMU L;  1IW7 C;  2JA5 H;  1FNU A;  1NR2 A;  4ILW A;  1Y1W B;  3D31 A;  2WAC A;  3HOX B;  5KG6 A;  1Y1V B;  1TWF A;  2WB1 G;  5F2D A;  4K14 A;  1ZHQ A;  3PW0 A;  4FF3 A;  5BPF A;  2YRX A;  1N48 A;  1QWY A;  3HB9 A;  4DNR B;  3R5X A;  4XYQ A;  5BR8 Q;  4DA2 A;  2KA7 A;  3A7A B;  1SEI A;  5CBA E;  1BCP C;  2AWO A;  4XDX A;  4DV3 H;  1JC7 A;  3QG1 A;  2C00 A;  4UCS A;  1M0W A;  1PH5 A;  2W8K A;  4RB2 C;  4K0K L;  3MR3 A;  5M5Y B;  1XTC D;  4IPG A;  1IBL Q;  4EG0 A;  3NHH A;  1WSC A;  1E0B A;  1Z7T A;  1WTP A;  1BNC A;  2WE6 A;  2NN6 G;  3ERS X;  4ED1 A;  4RZQ A;  2UUA L;  2NU7 B;  3BYY B;  3K8A A;  1E4E B;  1B3Q A;  5CV5 A;  4A3E H;  5JH7 F;  2QCP X;  5JVD F;  4F4Y A;  4GKJ L;  1PMR A;  4FP5 D;  3PV0 A;  2Z6B A;  4G57 A;  2XCP A;  3TZU A;  2HCC A;  2R7L A;  1I4R A;  1WCM H;  4O3Q A;  3KLS A;  2UU9 H;  2NWG A;  5L1K A;  4IPD A;  4PNY A;  5KYL A;  4OWX B;  2ZJP A;  1V8Q A;  1R4P B;  3RIZ A;  4LFA L;  3A0J A;  3ERO A;  1JJG A;  2JXM B;  2H1E A;  1S5E D;  3OSP A;  4B3M H;  4KHP H;  1I6U A;  1SNO A;  4IN3 A;  3ETH A;  4X64 H;  2G9D A;  3CAM A;  4BBS G;  3LML A;  3CRL C;  3T1Y L;  2CW7 A;  2F0I A;  3KHG A;  4PMC A;  3TSS A;  2ATW A;  3N6X A;  2HHH H;  2IHE A;  3G6X A;  3HKZ G;  4JUZ A;  1M8A A;  4AYB B;  1PTO F;  4KJN A;  4LF4 Q;  4EEY A;  1NBW A;  2HJW A;  1PZK D;  4H44 C;  4BBR H;  4C56 C;  1TA8 A;  1KD1 C;  3F2B A;  3HOU B;  3UFX B;  3OW2 A;  1UWV A;  5I9P A;  1JIH A;  1I50 H;  4LNQ A;  1SND A;  4BXX H;  3I4N G;  1WJJ A;  1LAC A;  3S17 B;  4MTE A;  1F9Q A;  2RHQ B;  5T1I A;  3A74 A;  3HOZ B;  1GSO A;  2YL2 A;  1EEF D;  2F0Q A;  4GN3 B;  1EWI A;  2RCN A;  1XNQ H;  1Z2P X;  4FXD A;  1DD2 A;  3Q8Q B;  3U9S A;  3M7N A;  2JA8 B;  4YIJ A;  2RGV A;  1B50 A;  1BJT A;  4KHP Q;  4YJ3 F;  4ZQ3 A;  4X62 H;  3T4A C;  4DK0 A;  1Z2O X;  1EOT A;  2F0U A;  1RK5 A;  1HZB A;  3VA7 A;  1UE5 A;  3KTM A;  5H80 A;  5COR A;  2KCM A;  5BR8 L;  3H4B A;  2V58 A;  3HEJ A;  2NZH A;  4DV4 Q;  3KLR A;  1D6E C;  3R2I A;  1VBG A;  4J15 A;  3SGI A;  2IL8 A;  3PO2 H;  5LL6 X;  1LTR D;  2CFM A;  3BJU A;  1IBL L;  4NB3 A;  2HT1 A;  4DR2 Q;  1Z2N X;  2HIV A;  3GTQ H;  1PYW D;  1HNW H;  1QNK A;  2M9V A;  2CH4 W;  3PUV A;  3ZJY C;  1N34 H;  2B63 A;  2D5D A;  2F4I A;  1KC8 C;  4RGO S;  2WKC A;  4HJA A;  4JCV E;  3F1Z A;  1O75 A;  1OXX K;  3MR5 A;  4C3I B;  2Z4I A;  3GTP B;  2I5M X;  4XQQ A;  2SDF A;  1AN7 A;  1X3Q A;  2VUM A;  3ORR A;  1JR0 D;  2CQO A;  4UHV A;  5DG7 A;  2HDL A;  4X62 Q;  2RSO A;  2G9H D;  1KNE A;  1RHP A;  4JI3 L;  4DL7 A;  1UE1 A;  1IYV A;  2B8F A;  4RU9 A;  2YTV A;  4DAV A;  2BOS A;  2ZXO A;  4PMW A;  1JB7 A;  3RGX A;  2F3V A;  2ZM6 H;  3TQ1 A;  2KHI A;  3A5Z B;  5C1P A;  3W5O A;  4YQW A;  2B2T C;  4IPC A;  1PH1 A;  4DLK A;  3D4W A;  1Y1W G;  5C44 B;  1KLU D;  3HOX G;  4A3K H;  4K8I A;  3PR5 B;  3H4D A;  2AGO A;  3OHX C;  2OF1 A;  1OO9 B;  4LF4 L;  4EGQ A;  4QWD A;  4TRD A;  2AUK A;  3KF8 B;  1TWH B;  5C4J B;  4I7Z C;  2ALZ A;  3GTK A;  3S2H B;  1STH A;  2Q2U A;  2XCL A;  5M5W H;  2YS7 A;  2EJM A;  3VR3 A;  4Z9C B;  1D7Q A;  3JSL A;  4YY3 H;  2HDM A;  2DJG C;  5LP6 F;  1RF2 D;  3J81 c;  2EIF A;  3N42 B;  3KK7 A;  3RD4 A;  4YCU A;  2ASD A;  4KHP L;  2K5Q A;  2W7O A;  5JEA G;  5FJ8 G;  1A9X A;  4QGU A;  3GV8 B;  3GV5 B;  4UP8 A;  4IWY A;  2KHS A;  2DN8 A;  2LS0 1;  3KLS X;  1SYC A;  2ZTE A;  1JOK A;  2FMC A;  3I3C A;  5EJW A;  4U68 A;  2R6F A;  5HV6 A;  4RUA A;  2XCA A;  1MI2 A;  4RCN A;  5IOC A;  3GTL A;  1YBY A;  4DV4 L;  4NW2 A;  4G7O C;  3FKI A;  3IFT A;  5G3L D;  5IGD A;  4DL6 A;  4JBM A;  4I4T F;  4RNM A;  4C2M A;  2XGQ A;  1SNM A;  4DR2 L;  5KFJ A;  1K83 A;  5KFD A;  2K28 A;  2V4R A;  5EOY A;  2K6A A;  2WYO A;  3NBI A;  1N9W A;  2QF7 A;  3S1Q H;  5CR3 A;  4P72 A;  4RGN A;  4DL3 A;  3K0X A;  4Q0Y A;  2PNR C;  5IP7 G;  1SFO A;  4EQ5 A;  1B3A A;  2ZTD A;  3CPW A;  2XRS D;  4AYB G;  3H3V C;  4R4I A;  1KDB A;  4B9W A;  5LA6 F;  1S4Z A;  4X62 L;  4KN7 C;  2D62 A;  3STB D;  2MO1 A;  3S16 B;  3H0G A;  4RHR A;  4A3B B;  5KFU A;  2Q8R E;  5KG1 A;  1TWC B;  5FLX L;  1GXD C;  1PDQ A;  3LWE A;  1KJJ A;  2GVB A;  1K8G A;  1TWA B;  3RZD B;  2VL6 A;  3GP7 A;  1VQM A;  3HOZ G;  4R8I A;  3IN5 A;  4CDD C;  2OTL A;  1RDP D;  3Q8P B;  2JA7 A;  2JEB I;  4JV5 Q;  4XIG S;  2A68 C;  2CCZ A;  2F0T A;  1PRT C;  4CJ2 C;  4XQN A;  3E0E A;  2JA8 G;  4AQY H;  4JI2 H;  2UXC H;  1CKN A;  2FMM A;  2VW9 A;  4JI7 Q;  4ZRZ A;  5C0X H;  4FO2 A;  1CHP D;  5I6Y A;  2VOB A;  4KLK A;  5GQO A;  1ENC A;  4NXN H;  3JAM E;  3NTK A;  4ODG A;  4LF6 H;  4MV4 A;  1I7L A;  2R7M A;  1FJG Q;  3DXJ C;  5DLQ E;  2CZG A;  4CBV A;  3G8C A;  1K9M C;  1Q1B A;  3GQB A;  4K6D A;  4XX0 B;  3R23 A;  5L1J A;  5JJI A;  1U4P A;  1VAJ A;  4QUF A;  1E4F T;  1FR3 A;  2A73 B;  2N78 A;  3MA2 B;  4GNX B;  3GIP A;  2N55 A;  1CK1 A;  2QDL A;  1ZKO A;  5IYC G;  5CYU A;  4DR1 H;  2R92 A;  2R6G A;  5EWG A;  4C3I G;  3G7L A;  1OTC A;  5JQW A;  4GC6 A;  4AQY Q;  3VDY A;  1UAP A;  1OXT A;  2EOT A;  3KF6 B;  1N36 Q;  4QB4 A;  1MBY A;  5GRO A;  1GM5 A;  1NUC A;  3PF4 A;  4PZ8 A;  1PA6 A;  1HNZ Q;  3GLK A;  4NXN Q;  3A8J E;  4CJ0 B;  1AP0 A;  5C4X G;  4ED6 A;  1JJ2 A;  4G4K A;  2OCE A;  1S9F A;  1F77 A;  4O1N A;  3T1H H;  2R87 A;  1IL8 A;  2RF4 A;  5JAV A;  1XTD A;  1N32 Q;  1F9P A;  2IHF A;  2SNM A;  1XMO H;  2FK1 A;  4M1U B;  2JJQ A;  4UP7 A;  3G6J B;  3QR8 A;  4QJF A;  4MV9 A;  4ED2 A;  3RB4 A;  4C3J B;  2WIN B;  2K33 A;  5C44 G;  3FDS A;  1EIG A;  4DR1 Q;  3EN2 A;  1SYF A;  2W6Q A;  2I5H A;  2LXJ A;  4BY1 B;  1DXM A;  4DU9 A;  2OWO A;  1RJQ A;  2ATL A;  2L0C A;  1JMC A;  1V4Y A;  2LXK A;  5EBD A;  5JVG 3;  1CZW A;  3KUP A;  3R93 A;  3P75 A;  5M3M H;  2KED A;  2ZT9 C;  1Y14 B;  4HR7 B;  1IKL A;  5EAY A;  3RFC A;  4FNF A;  3MFH A;  2R93 A;  1K3R A;  5I4D A;  4U7C A;  4IRK A;  1VQP A;  1SN8 A;  4C5C A;  3CCM A;  4IO9 A;  1UNS A;  2DPI A;  2JA5 B;  1A0I A;  2D2C C;  1PLF A;  1TVX A;  1VQ9 A;  4YR0 A;  4JV5 L;  3RB3 A;  1RL2 A;  1BXR A;  1TWF H;  2CWP A;  4JI7 L;  3Q2O A;  4EBC A;  4FBU A;  2KHJ A;  3LX0 A;  5IT9 W;  2WAQ B;  2YCH A;  1STE A;  1GUG A;  5GAG C;  1PH3 A;  2TMP A;  2V1C C;  4MTK A;  2MP1 A;  1JE4 A;  4TKO B;  1FJG L;  1D2B A;  2K03 A;  1KJQ A;  1YI2 A;  5KKN B;  4IUT A;  2HQE A;  1ML0 D;  3QJY A;  4B9X A;  2RCF A;  1FD7 D;  1HA5 A;  2PI2 A;  3GTJ A;  4X3K A;  3BJY A;  1MHW C;  1MJC A;  1SMY C;  4GS3 A;  4PG3 A;  3K81 C;  1R9T H;  3LWB A;  2IPK D;  1EUC B;  3Q6S A;  1X3G A;  4A3E B;  1YVC A;  2ZJR A;  2F0L A;  3KAJ A;  4A3D H;  1E1T A;  3RV4 A;  4DV2 Q;  1PH4 A;  5KT5 A;  3NEN A;  5LXT F;  2B2Y C;  1CUK A;  4AQY L;  3L7Z C;  4E6I A;  4WJ3 M;  1MKH A;  3SEB A;  4DAY B;  1N36 L;  1WYD A;  2MGS A;  3U9O A;  3NTH A;  4MZ9 A;  4LF5 Q;  4MN3 A;  2EY6 A;  1HNZ L;  3CF5 A;  1OXU A;  3OUZ A;  1Q90 A;  2XSC A;  4UFZ A;  2IX3 A;  2B2W C;  4YHH H;  4HJ5 A;  1GD7 A;  3P1H A;  4NPS A;  3I12 A;  2KQ3 A;  2Z9H A;  2E2H A;  1J5E H;  1D5M C;  2SEB D;  2TSS A;  3DF7 A;  3NTI A;  4ECY A;  4B3S L;  3EBE A;  3HGB A;  1N32 L;  5M3F G;  3OTO H;  5KG2 A;  2QKI C;  4FS1 A;  4O2A F;  5JJK A;  3S2D H;  2KEC A;  5DEH A;  1XYI A;  1BR9 A;  1QUQ B;  4ALP A;  3IL8 A;  2PBZ A;  4BBR B;  2IP4 A;  2IX1 A;  1QVF A;  3OIQ A;  1H9S B;  1Q8K A;  3MR6 A;  2B2V C;  4DV7 H;  1I50 B;  1KLG D;  2O2L D;  4DXF A;  1Y69 U;  1WD0 A;  2E76 C;  2F0O A;  2JEG A;  3K5I A;  3HOW H;  5KFQ A;  4ZCK A;  2Y0S B;  1SNC A;  2BQR A;  4CGY B;  1PFB A;  4BA2 I;  1S0O A;  3Q22 A;  1EY0 A;  4HNU A;  1T5E A;  4IUU A;  4YHH Q;  5A2Q L;  1J5E Q;  2B2U C;  1EYZ A;  3K6O A;  2F4V Q;  3OTO Q;  2W70 A;  3K7A H;  2MNA A;  2JK8 A;  3H6M A;  3PMF A;  2YZG A;  1L1O B;  5C4Z A;  4J8Q A;  4QMG A;  3I55 A;  3GTO H;  2EDG A;  4WOR A;  1SE8 A;  1JWM D;  5J39 A;  5ELE A;  4ZLT F;  3GQC A;  3KAL A;  2JA6 G;  3C0F B;  5KFX A;  3MFG A;  3M85 A;  2N49 A;  3BG5 A;  4YR3 A;  4IR1 A;  4RA8 A;  4DXG A;  2GPS A;  4DV7 Q;  3C46 A;  1CZG A;  3SK5 A;  2E8G A;  1EY9 A;  1RJP A;  1CSQ A;  3GTQ B;  5M5X B;  4O2B F;  1HR0 H;  2B63 H;  1I3Q A;  5HY6 A;  2DJF C;  1ASZ A;  2WB1 A;  3ULP A;  1VQ6 A;  1JB3 A;  4C1N I;  5DNF A;  2DNC A;  3IAY A;  2W57 A;  4APM A;  1S5C D;  4C5A A;  1HPC A;  4MAM A;  4WD3 A;  3HG9 A;  4C3J G;  4HYK A;  3GIK A;  4M7E A;  1GUN A;  4DV2 L;  3UDG A;  3S1M H;  3R5F A;  4DFA A;  4FBT A;  1RTN A;  4IFD G;  4PZ6 A;  4LF5 L;  1VQE A;  4QL5 A;  4C1N K;  2C28 A;  1PXU A;  3RMH A;  4X65 H;  4Q45 A;  1TQO A;  4HED A;  4J6H A;  1VQ4 A;  1C0A A;  5IYD G;  2JEF A;  2WP8 J;  1ZET A;  3D6C A;  1AE3 A;  2HVR A;  4RGT A;  2EZV A;  5L1L A;  1SCU B;  1TS5 A;  1G6Z A;  2NVY A;  5DM7 3;  2JA5 G;  1DV2 A;  2PMZ B;  1HR0 Q;  4LH7 A;  1TS3 A;  1V9P A;  3RB6 A;  3GTM A;  1H9J A;  1VQA A;  3MTS A;  1STA A;  4A3K B;  1WTW A;  4A3G H;  4K5X A;  4QUC A;  3CCS A;  2E75 C;  4RB1 A;  2DY7 A;  3IG0 A;  3P20 A;  1E2W A;  3ETJ A;  1SNQ A;  3GTK H;  1KJ8 A;  2YZN A;  2JE6 I;  3FMA A;  2EYO A;  1S0N A;  1LTB D;  5HUR A;  2NZ1 D;  5M5W B;  2UUC Q;  3A56 A;  1BCP B;  4Y7N H;  5KG7 A;  4DR4 H;  4NKL A;  3JZI A;  2K5W A;  5L37 A;  4QQB X;  3FDT A;  4X65 Q;  4YHH L;  2VUG A;  4JI0 H;  3HKZ A;  3BDO A;  2K5D A;  3J80 i;  3AMU A;  2X6L A;  2F4V L;  3OTO L;  4QF4 A;  1SXT A;  3RBD A;  2KVM A;  2L55 A;  4J0M A;  5C8Y F;  3RLO A;  1KAW A;  2R8G A;  2I5L X;  4QIW B;  1D8L A;  2A6H C;  1YNJ C;  1ZYR C;  2MJ8 A;  1JWS D;  4H0L C;  2J4X A;  1L0W A;  3HOY H;  1OWT A;  5JPM C;  4JBJ A;  3TN2 A;  2CW0 D;  2VQF H;  4C2M H;  4TQR A;  5JJL A;  4DV7 L;  3NSW A;  1K83 H;  1X54 A;  2BDO A;  4RB0 A;  1X32 A;  3KLW A;  1BKB A;  4GC7 A;  2CW8 A;  4OL7 A;  4B08 A;  2RGR A;  4IPH A;  1PV4 A;  1CQI B;  2IT1 A;  2EYL A;  1FL0 A;  1EHI A;  1JCK B;  4DUY H;  1SE3 A;  1NY4 A;  3CHB D;  3W3A A;  1JDB B;  3D3R A;  3WOF A;  3RR5 A;  3AFQ A;  4ZKB B;  2Y0S G;  3TP5 A;  4GOP A;  3M4O H;  1KXL A;  2W6N A;  1QNU A;  4OHJ A;  4C3H H;  4HNT A;  5DQG A;  3GIL A;  4O0A A;  3DMU A;  1KRS A;  2VQF Q;  1GHJ A;  3A8I E;  1HNX H;  3RLN A;  1BVS A;  1HHV A;  5E1F A;  2V59 A;  1L2Z A;  1HR0 L;  2PI2 E;  4A4I A;  1MSH A;  3N6R A;  1X65 A;  5IYB H;  4DR3 H;  3AB9 A;  2A6E D;  3MZ5 A;  2CQA A;  1XMQ H;  4OXP A;  5TSS A;  3J81 j;  3GII A;  3FP9 A;  1Z9F A;  3M9M B;  5CMD A;  3T5H A;  4G7H C;  4Q8F A;  2PQA B;  2R7Z B;  1F2L A;  3WNZ A;  3MXP A;  5CAE B;  5G3L F;  4CDF C;  4YR2 A;  3BQ1 A;  2K32 A;  3PW5 A;  4RCO A;  4X3T A;  1UC9 A;  2UUC L;  2AQ2 B;  2R7K A;  5KFB A;  1A3V A;  4EQP A;  1Y1W A;  3DWQ A;  1TAE A;  3ULJ A;  3RTX A;  4X65 L;  4LF8 L;  3K80 C;  1SYE A;  3CCU A;  2HGS A;  5IP9 G;  1I4P A;  5KG0 A;  2JA9 A;  4JI6 H;  2F0J A;  2R92 H;  2MCT A;  1Q82 C;  3L9A X;  3DWA A;  4AH6 A;  5IY0 A;  1UUP A;  1HNX Q;  5LL6 b;  1Q8I A;  1EZ8 A;  1HQM C;  3ZYY X;  1X56 A;  2UXB Q;  1I94 H;  1RJR A;  4WBN F;  2YW2 A;  1ESF A;  1AFP A;  2NVX H;  5DLF A;  1VCI A;  3ITP A;  1SR3 A;  1KNA A;  3G6Y A;  3VYT A;  2FJZ A;  4DV1 H;  3PVX A;  4X66 Q;  5GAD C;  2BQU A;  4UAI A;  2EYF A;  5L9X A;  1KJ9 A;  1T36 A;  1M90 C;  1E4E A;  2N8N A;  4E4T A;  1NMG A;  2RDI A;  3HOV H;  1BQQ T;  2IX0 A;  4Q0F A;  5ELO A;  2E5L Q;  2BA1 A;  1WTX A;  2BQ3 A;  2ZXR A;  4I7A A;  3CRK C;  3GIJ A;  3PGZ A;  4ABN A;  4KKU A;  1KIX A;  4L5T A;  3KDF B;  4A3K G;  2CVR A;  2RVL A;  3F8T A;  1X9N A;  4U67 3;  1K8M A;  1BNZ A;  4Q43 A;  2MO0 A;  3H40 A;  3WDN A;  3PUZ A;  3NE5 B;  3I70 A;  3TP8 A;  1RD9 D;  1LTI D;  5E4X A;  5M3M B;  3NEL A;  3MWD A;  2RQX A;  5IE8 A;  2VQE H;  5AFW A;  2QW7 A;  4DV1 Q;  1WFQ A;  1CM9 A;  4LAA A;  3RB0 A;  1C3O A;  4OX9 H;  1XNR H;  2R86 A;  3BDC A;  3OMG A;  2VQF L;  4FYD A;  4R4O A;  1ROD A;  4F4W A;  3CME A;  1TWF B;  2F0V A;  4A93 H;  1NR4 A;  2EY1 A;  2DLN A;  4AYB A;  4DV3 Q;  5M9O A;  4HJ8 A;  1Q3L A;  3MC0 B;  2KEN A;  1GUW A;  2WB1 E;  1ESR A;  4LSA A;  4ZQI A;  4GKK H;  1EOV A;  3DM3 A;  2OXP A;  3S24 A;  3GD7 A;  3DHQ A;  4ECS A;  5CV8 A;  2XD4 A;  2Q8T A;  2KOL A;  1SSO A;  4IUR A;  4LUV A;  1YJW A;  1E7Z A;  1S72 A;  1IZ6 A;  3J81 W;  2AU0 A;  1TXY A;  2UVV A;  2JYO A;  1VQG A;  2SNS A;  3HKS A;  4EQN A;  3J7Z C;  4IRD A;  1FNV A;  3QOL A;  5EKK A;  3I72 A;  2M2L A;  1R9T B;  2VQE Q;  3KHR A;  5FO7 B;  1U4M A;  4A3M H;  1TU2 B;  1C8C A;  1KDA A;  2A69 D;  4L6T B;  1XNR Q;  2UU9 Q;  2NZO A;  1VQO A;  1HNX L;  4A3D B;  2O03 A;  2FLL A;  4RKL A;  1KTK A;  1MGS A;  5KEE A;  3I4M H;  4ZAI A;  2UXB L;  2GPW A;  4H7B A;  3RUZ A;  3GIM A;  3PIO A;  4RKB A;  4HCS A;  4JOI A;  3MXN A;  4WFN 3;  4B3M Q;  4O2D A;  1DCZ A;  5KT3 A;  4J9R A;  4X64 Q;  5HGT A;  4X66 L;  1SE4 A;  2A5H A;  2F0P A;  2E2H H;  2GN5 A;  3EFX D;  4UCU A;  4XXE A;  3F2U A;  2HHH Q;  1HFN A;  1AUX A;  3I2Z A;  1N33 H;  1YEZ A;  4DK3 C;  1PTO H;  3GTP A;  3S2D B;  2E5L L;  3CU7 A;  3CQZ B;  4RNN A;  3S15 B;  1HR0 W;  2W6O A;  1YNN D;  3R8B A;  2UUB H;  1WVL A;  1H95 A;  1SAP A;  5KFR A;  1PRT B;  2EPB A;  3HKZ E;  3KXY T;  1CE8 A;  2J0T D;  2FE3 A;  1VKZ A;  4CDE C;  2Z8L A;  2KEE A;  1Q7Y C;  1XNQ Q;  1K73 C;  2RKS A;  3HOW B;  3ERQ A;  1BDO A;  3BDL A;  2B29 A;  3OYY A;  3RLF A;  3SE7 A;  5I6W A;  2R7Z G;  1VQI A;  4B3R H;  5FKA C;  3MR2 A;  4EX5 A;  4O3P A;  1M4V A;  3E0J A;  1B9N A;  1JKJ B;  1GKH A;  4RAZ A;  3MXU A;  3HP3 A;  2ZDH A;  3BZD B;  5KT7 A;  3JAM c;  1XPO A;  2YZM A;  3KAK A;  1D1I A;  3K7A B;  4DV3 L;  3FEW X;  2PW7 A;  5ISR A;  3KF8 A;  3GTO B;  4DF7 A;  1EEI D;  1A3T A;  1S03 G;  4J9K A;  1IBK H;  1AZQ A;  5D1P A;  2RSN A;  2R7F A;  3NQT A;  4A3C H;  5ELD A;  1B70 B;  4KHZ A;  1HNW Q;  1N34 Q;  3I73 A;  2E74 C;  1PHJ A;  3CC4 A;  2P5Z X;  1P8L A;  1Y1V G;  5C5J A;  1LTL A;  4LMY A;  4MHE A;  1K1Q A;  3M4Y A;  2B63 B;  4BS9 A;  5BN3 A;  3BS1 A;  4FF4 A;  2GVA A;  3P7J A;  3RF2 A;  3DWP A;  4DL5 A;  1LV9 A;  5C3E H;  1XNR L;  2UU9 L;  1SYG A;  1Z47 A;  1EY4 A;  4JK1 C;  3S9W A;  3J7A 5;  4IUP A;  1M6V A;  3RN2 A;  1PZI D;  5C3W A;  3SE0 A;  3QB3 A;  4NDX A;  2EXZ A;  2ZM6 Q;  5EPL A;  2E2J H;  4XT1 B;  5EWF A;  1SNP A;  4X6A H;  1CFM A;  4B3M L;  1J6Q A;  1T5X D;  2VNU D;  4X64 L;  1KAA A;  1EZ6 A;  2KBN A;  5IT9 L;  3BZK A;  5M3M G;  3J80 c;  1C48 A;  2A19 A;  4EQO A;  2BE5 C;  2HHH L;  3K0Y A;  4R4C A;  1O7Y A;  1B2T A;  4P73 A;  4LK1 C;  3G4S A;  2YU9 H;  1AE2 A;  3GTM H;  3DLL A;  5KFI A;  4BY7 B;  4OWT B;  4J9P A;  4A3G B;  1G6P A;  2AGP A;  1WI5 A;  1E3P A;  1LTT D;  4ZYS A;  2XTI A;  1M1K C;  2EE1 A;  4QW9 A;  1EQV A;  1UEA B;  5A2Q E;  3GTK B;  3UI2 A;  2EXD A;  5FO9 B;  4G3I A;  1ONL A;  4DN4 M;  4YY3 Q;  3RAX A;  1TWA A;  2HUG A;  2EJG C;  1XNQ L;  2J6T A;  1CA5 A;  2DNE A;  4HSP A;  1IOV A;  4XYM B; 
#chains in the Genus database with same CATH homology
 4A3B H;  2PMZ E;  3D0F A;  4BBS H;  3PUY A;  1TWC H;  1E1T A;  4A3D H;  1SLJ A;  3L2P A;  2L15 A;  1IL2 A;  4DV2 Q;  1PH4 A;  3CCR A;  3NEN A;  1QZG A;  1CUK A;  4AQY L;  3RZD H;  3L7Z C;  3HOU G;  4WJ3 M;  1MKH A;  4DAY B;  2FXQ A;  1N36 L;  4OX9 Q;  1WYD A;  4JI5 Q;  4LF5 Q;  4MZ9 A;  1HNZ L;  2I0Q A;  3A5U A;  3CF5 A;  1OXU A;  1VQH A;  2Q2H A;  4LW1 A;  4A3D G;  4HJ5 A;  4HJ7 A;  1GD7 A;  4NPS A;  1U5K A;  1YHB A;  4A3I H;  4DR3 L;  3W1G A;  4B3S L;  3EBE A;  4LUO A;  1N32 L;  5M3F G;  3S16 H;  4GKK Q;  4TQU S;  1C9O A;  2K75 A;  4MTN A;  1XMQ L;  4IJL A;  3S2D H;  1HNW L;  5JJK A;  1N34 L;  3CC7 A;  3I4M G;  2KCT A;  4P74 A;  1QUQ B;  1JE5 A;  3GDE A;  1U0L A;  4K0K Q;  4ALP A;  4GNX A;  4JYA L;  4JI4 L;  4A3I G;  4WJ4 A;  4B3T L;  4A75 A;  2IX1 A;  1QVF A;  3CD6 A;  2VUM H;  2UUA Q;  2YTX A;  3RZO H;  1Q8K A;  1PH8 A;  1L1O C;  4QIW E;  1VQC A;  4XTC S;  4JI6 L;  1PFS A;  5C0X G;  4IJH A;  3HOW H;  3ICE A;  1EIF A;  4GOP C;  3KF6 A;  4DNI A;  4TVA B;  4BA2 I;  3AQQ A;  2F52 A;  2VUM G;  4YHH Q;  4AYB E;  2K4K A;  1MIU A;  2ZM6 L;  1LUZ A;  1I94 L;  2OTJ A;  1J5E Q;  3UDF A;  1JJC B;  2Z0S A;  1QVC A;  2F4V Q;  3OTO Q;  3K7A H;  4LFA Q;  3KYH C;  2JK8 A;  2MNA A;  4L5R C;  4DV1 L;  1L1O B;  4JI2 Q;  2N3S A;  1E22 A;  2UXC Q;  4YWL A;  4DUZ L;  3MXN B;  1CKO A;  4DV0 L;  3I55 A;  1BBU A;  4DK6 C;  2BH2 A;  3GTO H;  2HQL A;  1SE8 A;  5GAE C;  1N33 Q;  4GOP B;  2JEA I;  3PO3 H;  4OO1 G;  1N8R C;  5M5X H;  4LF6 Q;  1YIT A;  2BA0 A;  1CKN B;  3UE0 A;  2JA6 G;  4OON A;  3T1Y Q;  2A8V A;  5IP9 H;  3M85 A;  2N49 A;  4OWW B;  2K5V A;  1KQS A;  4DV7 Q;  4DR7 Q;  2UXD L;  3MEF A;  2E8G A;  2UUB Q;  1CSQ A;  1EQQ A;  4LFB L;  3CXC A;  3H3V I;  2B63 H;  4A3L H;  4GLA C;  5HY6 A;  1ASZ A;  3PO3 G;  1Q1E A;  2OQ0 A;  3WWV A;  4BY1 H;  3ULP A;  1VQ6 A;  4YY3 L;  4H02 A;  4GLX A;  3TS2 A;  1I5F A;  1I3Q H;  3TQY A;  2K5N A;  1SMX A;  1DGS A;  4R4Q A;  4B3R Q;  5HGQ A;  5C0X I;  1VS0 A;  4DV2 L;  3UDG A;  3HOX H;  2VQE L;  4DV5 Q;  3S1M H;  4A3L G;  5AJ3 Q;  4RMF A;  2D0O A;  5LMU L;  1VQF A;  4OX9 L;  4IFD G;  4PZ6 A;  4JI5 L;  2JA5 H;  4LF5 L;  2Z6K A;  4IOC A;  1YJN A;  1VQE A;  3NEM A;  4QL5 A;  3D31 A;  3CCV A;  1G29 1;  2WB1 G;  1C7Y A;  1VQ4 A;  1C0A A;  5IYD G;  3KJO A;  2WP8 J;  4A3J H;  1AE3 A;  2AWN A;  3T1H Q;  4QY7 A;  5BR8 Q;  4UY8 C;  4L5Q A;  1IBK Q;  4GKK L;  2JA5 G;  2AWO A;  4OO1 I;  1HR0 Q;  2YYZ A;  1V9P A;  1XMO Q;  2XGT A;  3U50 C;  1VQA A;  1PH5 A;  4DAM A;  1Q86 C;  5E7N A;  3AEV A;  4K0K L;  4A3G H;  2F3I A;  4IPG A;  1IBL Q;  2NVQ H;  3CCS A;  1KL9 A;  2NVY H;  3BZC A;  3CMA A;  4A3J G;  5FJ8 H;  2NN6 G;  3ERS X;  2UUA L;  5FLM G;  3K8A A;  3GTK H;  1VQK A;  1B7Y B;  1W3S A;  4A3E H;  4BY7 G;  2JE6 I;  2AHO B;  1EQR A;  1CSP A;  4GKJ L;  1PYS B;  3PSI A;  2WFW A;  5GAH C;  3PUX A;  2UUC Q;  3PV0 A;  3S15 H;  4Y7N H;  1VQ5 A;  4P71 A;  4QQB X;  4X65 Q;  4YHH L;  1IBM Q;  1X3F A;  1WCM H;  4IPD A;  4OWX B;  2ZJP A;  4Y52 H;  3IRB A;  3J80 i;  2F4V L;  3OTO L;  4LFA L;  3A0J A;  4IFD J;  4ME3 A;  4R4T A;  1JJG A;  2H5X A;  1EIY B;  4JI2 L;  2UXC L;  1UEB A;  1KRT A;  1YJ9 A;  3RLO A;  1KAW A;  5ELN A;  2I5L X;  5H1S E;  1QUQ A;  1D8L A;  1OXV A;  1N33 L;  4NXN L;  4P75 A;  4UPA A;  3CAM A;  3Q8D A;  4LF6 L;  1L0W A;  4A3B G;  2DGY A;  3HOY H;  4BBS G;  3T1Y L;  1RIP A;  3AFP A;  3I4O A;  3I7F A;  4JBJ A;  1VQ8 A;  4JBW A;  1IYJ B;  1Q81 C;  4C2M H;  2ATW A;  3I4N H;  5JJL A;  1GVP A;  2IHE A;  4DV7 L;  1EUJ A;  1K83 H;  1X54 A;  3HKZ G;  4R1J A;  1X55 A;  2UUB L;  4LF4 Q;  3S1N H;  1NBW A;  1P16 A;  4BBR H;  1VQD A;  3KLW A;  3JC6 6;  3F2B A;  1KD1 C;  1BKB A;  3F2C A;  1T9H A;  2K52 A;  5J3B A;  1UWV A;  4DV6 Q;  3OW2 A;  1I50 H;  1PYB A;  4LNQ A;  4BXX H;  1I6H H;  2CWA A;  4IPH A;  3I4N G;  1PV4 A;  1WJJ A;  2JA8 H;  4DR1 L;  2IT1 A;  4B3R L;  3S1R H;  1HJP A;  1FL0 A;  4YWK A;  2RHQ B;  3A74 A;  1EWI A;  1NY4 A;  1HH2 P;  2RCN A;  4GN3 B;  4JOI C;  1HZC A;  5AJ3 L;  1NMF A;  1TWG H;  1L1O A;  4JBK A;  3M7N A;  2D0P A;  3RR5 A;  3AFQ A;  4KHP Q;  2Y0S G;  4GOP A;  3M4O H;  1KXL A;  3GTG H;  4C3H H;  2QA4 A;  2LSS A;  4HJ9 A;  1K0R A;  4O0A A;  1KRS A;  1L2F A;  2VQF Q;  1HZB A;  2CKZ B;  1UE5 A;  3RLN A;  1FGU A;  1NTG A;  1BVS A;  2KCM A;  2MQH A;  5BR8 L;  4HIO A;  3T1H L;  3HOW G;  2NZH A;  4DV4 Q;  1IBK L;  4JI1 Q;  1HR0 L;  3RNU A;  1XMO L;  2PI2 E;  4J15 A;  4A4I A;  3SGI A;  1QVG A;  2ZJQ A;  3PO2 H;  5IYC H;  1X65 A;  5IYB H;  2CFM A;  2R7Z H;  2HIX A;  3BJU A;  1IBL L;  4NB3 A;  2HT1 A;  4DR2 Q;  4BA1 I;  4C3I H;  2HIV A;  1YHA A;  4GN5 A;  4DPG A;  3GTQ H;  4OXP A;  3PUV A;  3ZJY C;  3J81 j;  3FP9 A;  3CC2 A;  1Z9F A;  2VS1 A;  1KC8 C;  1SRU A;  4HJA A;  2PQA B;  4JCV E;  3F1Z A;  1OXX K;  2I5M X;  2Q2I A;  5C4X H;  5IYB G;  2UUC L;  2CQO A;  4DR4 Q;  1PH2 A;  3ULJ A;  3BU2 A;  4X65 L;  4X62 Q;  3K80 C;  3CCU A;  1IBM L;  4LF8 L;  5IP9 G;  4IOA A;  4YCW A;  2JA9 A;  2R92 H;  4JI3 L;  1Q82 C;  1UE1 A;  4AH6 A;  5IY0 A;  4GLV B;  1HNX Q;  4DR6 Q;  1Y1W H;  1XPU A;  2YTV A;  2B63 G;  1Y1V H;  2UXB Q;  1OXS C;  1X56 A;  4PMW A;  1YIJ A;  1JB7 A;  3G48 A;  4BY1 G;  3S14 H;  1YZ6 A;  2NVX H;  2KHI A;  1VCI A;  3A5Z B;  1SR3 A;  1B8A A;  2ES2 A;  4B3S Q;  3W5O A;  1FVI A;  4IPC A;  1PH1 A;  1SRO A;  4X66 Q;  5GAD C;  1Y1W G;  3HOX G;  4A3K H;  5M5Y H;  1M90 C;  4LF7 Q;  2N8N A;  4LF4 L;  1NMG A;  3HOV H;  2IX0 A;  3M4Q A;  5ELO A;  2E5L Q;  3KF8 B;  2QEX A;  2BA1 A;  3KOJ A;  3B6Y A;  4DV6 L;  2Z6K C;  3PGZ A;  1O7I A;  1KIX A;  4L5T A;  3KDF B;  4A3K G;  4JG2 A;  1LM0 A;  3STB C;  1G51 A;  2WAQ G;  2Q2U A;  1HZ9 A;  3F8T A;  5M5W H;  1XPR A;  1X9N A;  1HZA A;  4JI8 Q;  2IY5 B;  1D7Q A;  3HOV G;  5LMN Q;  2MO0 A;  1BBW A;  3PUZ A;  2EIF A;  3J81 c;  3AYH B;  4A3G G;  4YCU A;  4NXM Q;  4A3F H;  3PIP A;  3NEL A;  4KHP L;  5JEA G;  5FJ8 G;  5IE8 A;  4QGU A;  1ASY A;  4LFC Q;  3PCO B;  4UP8 A;  1WFQ A;  4DV1 Q;  2VQF L;  2ZTE A;  5K36 G;  1J5E L;  2K14 A;  4R4O A;  4A3E G;  3CME A;  3G6E A;  3KFU A;  1YBY A;  4DV4 L;  4A93 H;  4IFD I;  4JI1 L;  5FLX c;  2C35 B;  1E24 A;  4DV3 Q;  3F2D A;  4DKA C;  4A3F G;  5IP7 H;  3CCQ A;  5IWA Q;  4HJ8 A;  4AIM A;  2KEN A;  4JBM A;  2WB1 E;  4HID A;  3GTL H;  4DR2 L;  1WCM G;  3I56 A;  1W2B A;  1NJI C;  1EOV A;  3FKI H;  3DM3 A;  3S24 A;  3GD7 A;  3HOU H;  1N9W A;  2R7D A;  3J81 i;  3S1Q H;  4A93 G;  4P72 A;  3M3Y H;  3K0X A;  1A8V A;  4LUV A;  1YJW A;  1E7Z A;  5IP7 G;  1IZ6 A;  1S72 A;  4POF A;  1TXY A;  3CCL A;  2QGQ A;  1VQG A;  3HKS A;  4EQ5 A;  2ZTD A;  3J7Z C;  3CPW A;  3S17 H;  4AYB G;  4PZ7 A;  3HOZ H;  4YCV A;  2WAQ E;  2NN6 I;  1TWA H;  1UE7 A;  3FKI G;  4R4I A;  3ULL A;  2VQE Q;  4X62 L;  4HIK A;  1SFO H;  2D62 A;  3CCE A;  3STB D;  2B3G A;  2MO1 A;  5LMU Q;  5M3F H;  3E9H A;  4A3M H;  4JI0 Q;  2OQK A;  1XNR Q;  2UU9 Q;  2NZO A;  1VQO A;  1HNX L;  1X6O A;  1LYL A;  4DR6 L;  3K7U C;  2A1A A;  2AMC B;  1YNX A;  2GVB A;  1K8G A;  4BBR G;  3I4M H;  4DV5 L;  2UXB L;  3H3V H;  2VL6 A;  3H0G H;  2DUD A;  1VQM A;  3HOZ G;  5JEA J;  3M4P A;  3PIO A;  4JOI A;  2OTL A;  4A3M G;  4B3M Q;  2JEB I;  4O2D A;  4BXX G;  3EIV A;  4XIG S;  4JV5 Q;  4DR5 Q;  2CCZ A;  4X64 Q;  3E0E A;  2JA8 G;  3FHW A;  3UDI A;  4X66 L;  1CKN A;  2VW9 A;  4JI7 Q;  2E2H H;  2GN5 A;  1A62 A;  3CQZ H;  3CW2 C;  4GNX C;  2K50 A;  4HIM A;  3RN5 A;  1MJE A;  2HHH Q;  2JA7 H;  1KHI A;  3I2Z A;  4KLK A;  2EQS A;  3H0G G;  2PQA A;  5GQO A;  4LF7 L;  2YTY A;  2BH8 A;  1YEZ A;  4DK3 C;  4A76 A;  4MNO A;  1FJG Q;  5DLQ E;  1AH9 A;  3GO5 A;  4LF9 Q;  2E5L L;  1K9M C;  1Q1B A;  1HR0 W;  3CCJ A;  2ALY B;  3LGJ A;  3GTP H;  2JA7 G;  4GKJ Q;  1H95 A;  5JJI A;  1Q46 A;  3U58 A;  3HKZ E;  1X3E A;  4JI8 L;  4LWC A;  1A63 A;  5LMN L;  4DUY Q;  4LUZ A;  2N78 A;  4GNX B;  1CKM A;  1Q7Y C;  1XNQ Q;  1K73 C;  1PH9 A;  3RLF A;  5LMN W;  3PO2 G;  2B29 A;  3OYY A;  5IYC G;  3NBH B;  2R6G A;  2R7Z G;  1VQI A;  2JQO A;  3TEH B;  4NXM L;  2JA6 H;  1EFW A;  4DR7 L;  4EX5 A;  2MFI A;  4RG1 A;  3UE1 A;  1VQ7 A;  1OTC A;  3L0O A;  4LFC L;  1S3O A;  1GKH A;  4AQY Q;  2ASB A;  3VDY A;  1OXT A;  3KJP A;  3JAM c;  3KF6 B;  1N36 Q;  3PF4 A;  1XPO A;  5GRO A;  3UDX A;  1GM5 A;  1V1Q A;  4PZ8 A;  1S40 A;  1PA6 A;  1HNZ Q;  4NXN Q;  3HFZ B;  5C4X G;  1XJV A;  1JJ2 A;  4KI0 A;  1K8A C;  4DV3 L;  2OCE A;  1QZH A;  2Y0S E;  5IWA L;  5C44 H;  4DR3 Q;  3PF5 A;  2RF4 A;  4C3J H;  1XTD A;  1N32 Q;  2R92 G;  2R7F A;  2IHF A;  3KDF A;  4A3C H;  1B70 B;  4KHZ A;  1XMQ Q;  1HNW Q;  3H15 A;  1WOC A;  1N34 Q;  1TWH H;  5C4J H;  2JJQ A;  4UP7 A;  1PHJ A;  4QJF A;  2PNH A;  5IT9 c;  3CC4 A;  1P8L A;  1Y1V G;  3S2H H;  1YHQ A;  4JYA Q;  1LTL A;  4JI4 Q;  5C44 G;  4B3T Q;  2AKW B;  4DR1 Q;  3EN2 A;  3U4V A;  2YV5 A;  2I5H A;  5C0X J;  2LXJ A;  5IYD H;  2GVA A;  4FDB A;  1Q12 A;  3JAM i;  4POG A;  3CPF A;  4DR4 L;  4A3C G;  3W1B A;  2OWO A;  4JI6 Q;  2NVT H;  5C3E H;  1JMC A;  4JI0 L;  4JC0 A;  1XNR L;  2VZA A;  2LXK A;  2UU9 L;  2ZTC A;  1Z47 A;  3CP0 A;  2E2I H;  1VQN A;  5M3M H;  3J7A 5;  3TRZ A;  3RN2 A;  2RHS B;  1Y14 B;  1EYG A;  3HOY G;  5EAY A;  1IXR A;  1PH7 A;  3PUW A;  1K3R A;  1VQP A;  1SN8 A;  1UE6 A;  1VQB A;  2VY3 A;  2ZM6 Q;  3CCM A;  4IO9 A;  1I94 Q;  2E2J H;  3ER0 A;  1A0I A;  4X6A H;  4APV A;  1VQ9 A;  4B3M L;  1J6Q A;  5FLM H;  5C3E G;  4JV5 L;  2VNU D;  4DR5 L;  1RL2 A;  2R93 H;  1TWF H;  2CWP A;  4X64 L;  1E1O A;  2KBN A;  5M3M G;  3BZK A;  2ID0 A;  3J80 c;  4BY7 H;  4JI7 L;  4DUZ Q;  2A19 A;  2KHJ A;  4DV0 Q;  3TS0 A;  2HHH L;  4R4C A;  4P73 A;  4UP9 A;  5GAG C;  3M9B A;  1GO3 E;  3G4S A;  1PH3 A;  2YU9 H;  2V1C C;  1AE2 A;  1FJG L;  4YWM A;  3GTM H;  3DLL A;  4LF9 L;  1YI2 A;  4OWT B;  2R93 G;  4GN4 B;  3U4Z A;  1JT8 A;  2UXD Q;  1G6P A;  1WI5 A;  1E3P A;  1NE3 A;  1V43 A;  3E9I A;  2K5H A;  1M1K C;  2XTI A;  4LFB Q;  2PI2 A;  2Q2T A;  1MJC A;  4GS3 A;  4PG3 A;  3K81 C;  1VQJ A;  2EXD A;  3TRE A;  1R9T H;  4L5S A;  3G71 A;  4DUY L;  4YY3 Q;  1PH6 A;  1X3G A;  4LF8 Q;  1PVO A;  1XNQ L;  1YVC A;  4JI3 Q;  3GTJ H;  2ZJR A;  1VQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...