2JA5G

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja5G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja5G01
5FLMH 2UXCQ 3GTQH 3MXNB 1SFOH 1K73C 4GLXA 2OQKA 2YYZA 2LXJA 2IY5B 1P16A 1N9WA 1WJJA 3F2CA 4A3LG 1L1OB 5M3MH 1NJIC 2R7FA 2HHHQ 1L1OA 3F2DA 1X6OA 4O2DA 4ME3A 5M5YH 3HKZE 1KL9A 1WYDA 4JI4Q 3I4MG 5M5XH 2L15A 5IP7H 2N78A 3GO5A 3LGJA 4AYBG 1YJNA 1L1OC 1X56A 5EAYA 4JI6L 3KJPA 1BVSA 4TVAB 3CMAA 2BH8A 1X9NA 4JI0Q 1NBWA 4QIWE 1HNXQ 1CKOA 3WWVA 3A5ZB 4P73A 3CCMA 3CCJA 4LW1A 2MNAA 5M5WH 2ZTEA 2OTLA 5C4XH 1VQ6A 4L5QA 4LUVA 2RHSB 4X6AH 3M3YH 2OWOA 4OO1G 2UXDL 1Z9FA 3PCOB 4OWWB 2VQEQ 4DAYB 2DGYA 4POFA 4DV4Q 2OTJA 2JEBI 4HJ7A 3UDFA 1YHBA 2A19A 4Y7NH 1I5FA 3J81c 3I4OA 1PFSA 1VQ8A 3S14H 1YEZA 2A8VA 4K0KL 3S16H 3PUZA 4PG3A 4JBJA 1FGUA 1VQFA 1JB7A 1PH7A 3STBD 1ASZA 4LFBQ 2K52A 4RG1A 1YJ9A 2Q2TA 2Q2UA 1KXLA 3KF8B 4QGUA 1X55A 3PUXA 1K8GA 2ZJRA 3EBEA 3ULJA 1SE8A 2C35B 3J81i 4UPAA 3PGZA 2BH2A 1MJCA 2Z6KA 3RR5A 2NZOA 3T1HQ 1T9HA 1MJEA 2NVXH 3S1MH 1XPRA 5JJIA 4JI0L 4LF9Q 3RZOH 5IP9H 1EIYB 2K4KA 4JG2A 4JOIA 4XIGS 5BR8Q 4C3HH 1K3RA 4DPGA 5C4JH 3RN5A 2FXQA 4P75A 1EQQA 1KHIA 1G51A 4DAMA 3MEFA 4A3MG 4O0AA 1QZGA 2PI2A 3L0OA 4FDBA 3BZKA 5GQOA 4DKAC 4DV4L 1LTLA 2PMZE 3DM3A 4JOIC 2B63H 1L2FA 3OYYA 1PVOA 3CPWA 3ICEA 4LFCL 4R1JA 5C3EH 3CAMA 3I56A 3S15H 4JI7L 1YIJA 3E0EA 1VQIA 4B3SL 2HT1A 2MO1A 1A8VA 2MO0A 4A3EG 4YHHL 3T1YQ 5HGQA 1BBUA 4AH6A 1HZCA 4DR4Q 1KAWA 1CSPA 3K80C 2H5XA 4DR2Q 3CCRA 1N32L 3S1RH 4IFDG 1K9MC 3TS0A 2XGTA 5GROA 4A3GG 1PH1A 2GVAA 3EIVA 2JA5G 4DR1Q 5ELOA 2ALYB 2JA8G 2GN5A 1A0IA 1VQKA 4A93G 4X66L 1WFQA 4WJ3M 1KQSA 3KOJA 4BY7G 3K8AA 4A3KG 3PO3H 4R4IA 4R4CA 5GAGC 4A3IG 5C44H 1XMQQ 1VQCA 3CCQA 1Y1VG 2ZJQA 1YZ6A 2ATWA 1HR0W 2VQFQ 1D7QA 4IOCA 2EQSA 1TWAH 1B8AA 1PH9A 4JYAL 4LF4L 4B3TQ 4A3CH 2UUAL 1EUJA 2AKWB 2MFIA 3G4SA 4DR7Q 2D0PA 2JEAI 1NMGA 4L5RC 4ALPA 1GVPA 4C3IH 1HNZQ 3I4MH 1TWFH 2NN6I 4NXML 4DR2L 4YY3L 5IYCH 1EIFA 1OXVA 3M4QA 1K83H 1VQOA 1TXYA 2PI2E 4DR6L 1AE2A 4DV6Q 3U4VA 4R4OA 4R4QA 4GKKQ 1Y1WG 5C0XI 1AH9A 3GTGH 3M9BA 4DR1L 3CCLA 4L5SA 4EQ5A 1OXSC 1PH5A 4A76A 1N34Q 1OXTA 1HZAA 5AJ3Q 1JT8A 2D0OA 4POGA 2KHIA 2JK8A 4GN5A 4XTCS 4JI8Q 1XPUA 4JCVE 4IFDJ 3HOXG 1XMQL 4WJ4A 5M3FG 2KHJA 4KHPQ 4HJ9A 4DR5L 1YJWA 4JI5Q 3ER0A 2IT1A 3S2DH 4PMWA 1YBYA 3S2HH 5GAEC 1Y14B 3GTKH 1XPOA 4B3TL 4A3BG 4DR7L 3AFPA 3UDXA 2OCEA 1UEBA 3J7ZC 3TREA 3HOWH 2JA6G 5LMUQ 1SLJA 1XJVA 1GD7A 3W1GA 2CQOA 2EXDA 1FVIA 4JBMA 4GKKL 1HZ9A 1Z47A 1I6HH 1JJGA 4QY7A 2HIXA 5LMNQ 1LUZA 4DUZQ 4BBRG 5IYDH 1IBLQ 4YCVA 1B70B 4BBSH 2IX0A 5E7NA 1IBKQ 2R7ZG 4DK3C 3S1NH 4P74A 4YWLA 5JJKA 3PUWA 1VS0A 3L2PA 3IRBA 2JJQA 1A63A 3PUYA 2D62A 4JI8L 4OX9Q 3K81C 3H0GH 4KI0A 3CC4A 4JI3L 3PV0A 2R93H 5JEAG 1D8LA 1VQDA 1NE3A 1UE5A 1V9PA 3KF6B 3NENA 1N33Q 2JA7G 3S17H 4LUZA 1VQAA 3J80c 3KF6A 4A3JG 1J5EQ 1HR0L 3HOYG 1NY4A 1PH4A 1Q86C 1K0RA 1Q12A 3M4OH 4GLAC 5FJ8G 2K50A 2UXCL 3I2ZA 3HOUH 1YITA 2Y0SE 2R92H 2WAQG 4MNOA 3STBC 3CC7A 3HOVH 4X62Q 1IYJB 2HHHL 3K7UC 3GD7A 3B6YA 1NMFA 3J80i 4DV2Q 1I94Q 1B7YB 2CCZA 4C3JH 4H02A 4Y52H 1E7ZA 1TWCH 1IBLL 4JI4L 1PH3A 2VUMG 3I55A 2R7DA 1JJ2A 3HOZH 2R6GA 2OQ0A 3PO2G 2KCTA 4HJ5A 2KCMA 4BY1G 2AHOB 3F8TA 1Q81C 2WB1E 3AFQA 4PZ6A 1H95A 4C2MH 1N36Q 1VQBA 4J15A 4NXNQ 3U4ZA 1HNXL 1QVFA 2QEXA 4DUYQ 4IO9A 3I4NG 3FKIH 2K5NA 2A1AA 3TQYA 3W5OA 4A3DG 4HIDA 2YV5A 4IPGA 4LF6Q 4P71A 1BBWA 1VQNA 2VQEL 4B3RQ 4LF8Q 2Z0SA 4YCUA 1CSQA 1FL0A 3AYHB 5FLMG 2YU9H 4BXXH 4DV5Q 1W3SA 2EIFA 1IL2A 4X62L 4JBWA 4HJ8A 3TS2A 5IYBH 3H3VH 5M3MG 2E8GA 3RN2A 1NTGA 2AMCB 4A3FH 4AYBE 3U58A 4LFBL 4LF7Q 3RLOA 2VY3A 3ULLA 1PA6A 2F4VQ 5IP7G 1UE1A 4RMFA 1RL2A 1XNRQ 3M7NA 3T1HL 1VQPA 1OXXK 2CWPA 1Q7YC 4A4IA 2GVBA 4NB3A 2ZM6Q 4LF9L 4GLVB 4UY8C 4UP8A 2VW9A 5BR8L 2VNUD 2QA4A 3NBHB 3FHWA 2UXBQ 3J81j 5C4XG 3S24A 1GM5A 1WCMH 1S40A 2E5LQ 1LYLA 1X3GA 4LF6L 3G71A 2QGQA 3CP0A 4B3RL 4GS3A 1U0LA 4HIMA 5IWAQ 4JI1Q 1OTCA 2ZJPA 3A0JA 4DV5L 1XMOQ 4YWMA 3I7FA 4LFAQ 3PUVA 2NN6G 3GTOH 2I0QA 4A3LH 1SRUA 1E1OA 2F3IA 2B3GA 1C7YA 1VQ5A 2YTYA 2F52A 4DNIA 5HY6A 2V1CC 3OTOQ 4DV7Q 1E22A 4LWCA 4UP9A 3UDIA 2RF4A 4IJLA 5C0XG 3KJOA 4GOPB 3T1YL 4LF7L 1YHQA 1UWVA 1IBMQ 1M1KC 4DR4L 5JJLA 2AWNA 3PIPA 4L5TA 4HJAA 3K0XA 3F2BA 3HKZG 1JMCA 3CXCA 5LMNW 4GOPC 1VQJA 4GKJL 3VDYA 3GDEA 1SMXA 4X64Q 5IP9G 2MQHA 1XNQQ 1RIPA 4B3MQ 2E5LL 2PQAB 1YHAA 4JI2Q 2K5VA 2PQAA 2ES2A 3NEMA 1G6PA 1A62A 1IXRA 2B63G 2KENA 3FP9A 2VQFL 3UE0A 3UDGA 5C3EG 4HIKA 3OTOL 2NZHA 1Q82C 2I5HA 4DV3Q 2HIVA 2IHFA 2Q2HA 1IZ6A 1HNZL 3CMEA 3OW2A 3BJUA 2WFWA 3RLNA 4BA1I 1TWHH 1V1QA 5FLXc 4P72A 4DV6L 2KBNA 2N49A 1XTDA 4GNXC 3H3VI 2HQLA 1MKHA 3GTPH 1KIXA 3Q8DA 4BA2I 3KDFB 2NVQH 3TEHB 4X64L 1VQ4A 1HZBA 1VQLA 1SR3A 1OXUA 5AJ3L 1N34L 2K14A 3F1ZA 4A3MH 2B29A 1X3EA 4LNQA 2UXDQ 4JC0A 4PZ7A 3NELA 5IT9c 3DLLA 1R9TH 1VQ9A 2IX1A 3PO3G 4QQBX 3PF4A 5C44G 4KHPL 1PH8A 4JI5L 4AIMA 1EFWA 1E1TA 4K0KQ 1G291 4OONA 3BZCA 4A3EH 4DV3L 4A3CG 2RHQB 2NVTH 5IE8A 1JE5A 3PSIA 2IHEA 5LMUL 5IYCG 3J7A5 3RZDH 5K36G 1PH2A 2K75A 1CUKA 4A3GH 1YI2A 5GADC 5LMNL 3G6EA 4DUZL 4OWXB 1EYGA 2JA5H 2UUCQ 1YVCA 1I50H 2JA8H 4R4TA 4QJFA 3ZJYC 4AQYQ 1IBKL 2LXKA 1VQHA 4IPHA 4A93H 4MZ9A 3CC2A 1FJGQ 1Q1BA 3TRZA 4OX9L 4BY7H 1GKHA 3U50C 4A3KH 5DLQE 4A3IH 3KFUA 2JQOA 1KC8C 3CD6A 1Y1VH 4QL5A 1CKNB 3A5UA 1N33L 4JV5Q 2YTVA 4X65Q 1CKNA 1I3QH 2N8NA 2VS1A 1J5EL 4LFCQ 2XTIA 3AQQA 3RLFA 4JI7Q 4OO1I 4B3SQ 4IOAA 2ZTCA 1SN8A 3JAMc 4JBKA 1DGSA 4YHHQ 2E2JH 2BA1A 3M4PA 3CCEA 1WOCA 3HOWG 3H15A 1UE7A 3KLWA 4DK6C 1VQEA 5JEAJ 1N32Q 4LF5Q 4A75A 2NVYH 3SGIA 2JA9A 4DV2L 1Y1WH 1S3OA 4YWKA 1M90C 1I94L 2UUCL 1Q1EA 3ERSX 1VQMA 1YNXA 4LF5L 4MTNA 2I5MX 3PIOA 4OXPA 5IYDG 4AQYL 3CQZH 3JAMi 1ASYA 4BBSG 2UUBQ 3CCVA 4DV0Q 1O7IA 2Z6KC 4X66Q 1FJGL 1HNWQ 1J6QA 1AE3A 1VCIA 1N36L 2ASBA 3HOXH 1E3PA 1EWIA 1HH2P 3H0GG 4NXNL 3HFZB 5M3FH 4DR3Q 1S72A 1U5KA 4DUYL 1PV4A 2E2HH 4IPDA 4KHZA 4GN4B 4NPSA 1VQ7A 2R93G 3KYHC 4JV5L 4X65L 1KD1C 3CCUA 2DUDA 1QVGA 1MIUA 1P8LA 2WAQE 3D0FA 4JYAQ 1QZHA 4A3BH 1QVCA 4LF4Q 4LF8L 3S1QH 1X3FA 2UUAQ 4IPCA 1PH6A 2JE6I 3HOUG 2YTXA 2I5LX 2CFMA 2CKZB 1KRSA 4DV1Q 2JA6H 1SROA 3GTJH 4NXMQ 2R92G 1WI5A 4YY3Q 3A74A 3HOVG 5ELNA 4DR6Q 5GAHC 1W2BA 3L7ZC 3BU2A 3E9HA 4BBRH 1TWGH 3D31A 4GOPA 4KLKA 3G48A 3HOZG 5J3BA 1X65A 2PNHA 2F4VL 2R7ZH 2UUBL 4DV0L 1C0AA 1UE6A 1XNRL 1E24A 1X54A 2UU9Q 4IFDI 2LSSA 1CKMA 3PF5A 3AEVA 3HKSA 2E2IH 1HNWL 2ZM6L 3GTMH 2VL6A 4DR3L 1V43A 2ID0A 2N3SA 3W1BA 2UXBL 3FKIG 3JC66 1HJPA 3UE1A 4DR5Q 2JA7H 4A3JH 3HOYH 1L0WA 4EX5A 3M85A 1PHJA 5FJ8H 5IWAL 4JI1L 2BA0A 1LM0A 1XMOL 4UP7A 4LFAL 4DV1L 1GO3E 4BXXG 4TQUS 4YCWA 1K8AC 3CCSA 1QUQB 2VZAA 5IYBG 1QUQA 4OWTB 4GNXB 4PZ8A 3ULPA 4DV7L 2K5HA 2Y0SG 3E9IA 4A3FG 1Q8KA 2Q2IA 4IJHA 3CF5A 1C9OA 4GNXA 4GN3B 1N8RC 1EOVA 4HIOA 3GTLH 2VUMH 1IBML 3PO2H 3EN2A 3CPFA 1KRTA 2CWAA 2RCNA 2UU9L 4BY1H 2WP8J 1JJCB 3K7AH 4JI6Q 2ZTDA 3RNUA 5H1SE 1PYBA 4LUOA 2AWOA 4JI3Q 3KDFA 1VQGA 5C0XJ 1XNQL 3I4NH 4APVA 1BKBA 2WB1G 4A3DH 3CW2C 4B3ML 1Q46A 1PYSB 5IY0A 4GKJQ 1HR0Q 4JI2L 1WCMG 1EQRA
chains in the Genus database with same CATH superfamily
4J9PA 2UXCQ 1J5EH 3N52A 4RNNA 2IP4A 3PO3B 5T14A 5M3MH 4L1KA 3F2DA 4I4TF 3V2TA 4O2DA 1XTCD 2VB2X 5M5YH 2B2YA 5KFVA 4F88A 5JUMA 2PMZA 3I4MG 2L15A 5ISRA 3HBLA 2N78A 1YJNA 2QK4A 4LF5H 1L1OC 3C1FA 5EAYA 2M00A 2I80A 3P7JA 4QIWE 1HNXQ 3K5LA 1D5ZC 2DN8A 2MHVA 2YCHA 1F2YA 2ZTEA 5C4XH 1UC8A 1Q3LA 3X3NA 2OWOA 2JEIA 4ECXA 4DAYB 4POFA 2D5DA 3PIO3 4XYMB 4X65H 1DYQA 4HJ7A 2W6ZA 4Y7NH 2Z1CA 5KNCA 4B3SH 1O80A 1TR5A 1Y8OB 3PUZA 4PG3A 1Y69U 1QB5D 4YIJA 1A9XA 1FGUA 4J9SA 4RG1A 1YJ9A 2Q2UA 2AUJD 3GTKB 1SNMA 1WH2A 4CC5A 2VA2A 1PRTF 3PUXA 3EBEA 1V8QA 2C35B 2MJ8A 5EKIA 3J81i 4RCNA 2Z6KA 1E0BA 3RR5A 1DD2A 1T9HA 2NVXH 2UUBH 4RGTA 2GA4B 4JI0L 1PMRA 1EYAA 3QWNA 4CJ1B 3RZOH 1CK1A 5BR8Q 4DPGA 5C4JH 1EQQA 1DXMA 4HR7A 4DAMA 5M5XB 4FDBA 3L0OA 5IT9E 2CW8A 5GQOA 3VR5A 1CA6A 3MJFA 2PCFB 4JOIC 2B63H 3QOLA 3V6HA 3ICEA 4CKCA 4JI7L 4B3SL 1R4QB 4DK0A 2MO0A 2B39A 5HGQA 3T1YQ 1UC9A 1BBUA 5KNBA 1IOWA 3ERQA 2YS6A 1EFID 3V96A 3TS0A 2FPGB 4MTDA 2UU9H 3NK9A 1SAPA 4C3JB 3CU7A 1O75A 1KQSA 4BY7G 1G2SA 1A2UA 1EQVA 2EZVA 1PX2A 4C5BA 4A3KG 3BDOA 5GAGC 3PW4A 1XMQQ 2XWJB 1KJ9A 4O3PA 3S1MB 2NYZD 4C2MB 4K6DA 2SEBD 1B8AA 2KQ3A 4B3TQ 2MP1A 2MFIA 4QWEA 2JP1A 1B6SA 3BA8A 2Z4HA 1TWFH 1B3QA 2B2TA 5EBDA 1EIFA 5K36H 1K83H 2PI2E 3U4VA 4LSXA 4GKKQ 1Y1WG 1AH9A 3ETHA 1JKJB 3NBIA 4XDXA 4EGJA 1B3AA 4L5SA 4DXFA 3NWSA 4JI6H 4RB0A 2F0OA 1HZAA 2KHIA 2JK8A 4JI8Q 4XTCS 3S1RB 2OH2A 4HSVA 2FMMA 1EYZA 3HOXG 4DAVA 5L9XA 2R3ZA 5M3FG 2FK1A 2AU0A 3VPBA 4HJ9A 4QCLA 2IT1A 4FM9A 2EY1A 2F4IA 3S2DH 4PMWA 1YBYA 3S2HH 2J7ZA 4A3BG 3NTIA 4ZCKA 4FP5D 5LXTF 1WCMB 2KJXA 5JAVA 3E3XA 5C44B 5LMUQ 3GTOB 2CQOA 2F0KA 4JI4H 2TSSA 5C5LA 1JJGA 1LUZA 2MGSA 5IYDH 1IBLQ 5ELFA 5KFPA 3L4KA 1MI2A 2IX0A 5E7NA 1UNSA 4BBSH 3TDQA 3BJYA 2ZXOA 4C56C 2B2UA 2A5HA 4Q0FA 1RHPA 3I4MB 4DL3A 2HJWA 2LKVA 3PUYA 5CC4A 1TS5A 1UUPA 2H4OA 4AYBA 4DGZA 3CC4A 2R93H 2NU9B 4XXEA 3K3PA 3S17H 2ASDA 1A2TA 1S68A 1K0RA 3MWEA 4ILWA 2XNAC 1S03G 3ORQA 3I2ZA 2A68D 2Y0SE 2R92H 3H91A 1TAEA 4DL5A 4X62Q 1IYJB 4LFBH 2VPSA 3GD7A 1XXGA 1EU3A 4UCSA 1S10A 4RB2C 1I94Q 1B7YB 4RUAA 4H02A 3SEBA 1K0SA 4JI4L 5FK9C 1PH3A 2R7DA 1FNVA 2D2CC 3T1HH 2L1BA 3GIKA 4LF9H 3F8TA 1GUOA 4EFBA 2OT2A 4J15A 4X66H 2WYOA 4V0BA 4DUYQ 3GTPB 1HHVA 5KFSA 3MHBA 2AGOA 5FD6A 4ETSA 1CTMA 1EY6A 4LF6Q 5DLGA 1VQNA 2VA3A 4DL4A 3AYHB 1UAPA 4UDUC 2IWHA 4QF4A 3WOFA 4DV5Q 2PBZA 3FMAA 3H0GB 4F4ZA 4WRDA 3TS2A 1IKLA 3IG0A 3H3VH 5M3MG 3RN2A 3QB3A 1NAPA 4RH6A 4U68A 1IKMA 1QE6A 4LFBL 4LF7Q 3RLOA 3KK7A 1GUNA 4R7RA 4O4HF 1RL2A 3MR2A 2DWCA 3T1HL 3G8CA 4M9UA 1OXXK 2FMAA 4A4IA 4NB3A 4DN4M 4LF9L 2VW9A 3N40P 1KTKA 5D3IB 5EJWA 2VNUD 4N8FA 3QOJA 5JVDF 3J81j 1D6EC 2A6HC 5C4XG 2E5LQ 1GM5A 1A3VA 4TKOB 5JVLA 1I50A 2JA5A 3G71A 3CP0A 5IGCA 2VQFH 1U0LA 3A8IE 2AQ2B 4JI1Q 3QO2A 3K5MA 4Q43A 4YWMA 3I7FA 1WTRA 1G2TA 3J81E 2I0QA 1SBBB 1SRUA 2F3IA 4DR7H 2DPJA 1FGBD 4PDBA 5HY6A 2CQYA 5E3FA 2K5QA 1E22A 4IJLA 1KDAA 1H9KA 4RWSC 1BGWA 1IBMQ 5JJLA 1BO0A 4QW9A 3PIPA 3DWPA 2E2JB 2NUCA 4KY6A 1AN8A 3CXCA 5LMNW 1CI3M 3HB9A 3MAQA 3GDEA 1SMXA 1N34H 2CW0D 1Y1WB 1E4GT 3ETJA 1LTGD 2EDGA 2MQHA 5EDWA 3ORRA 5DG7A 4B3MQ 2B8FA 2ZXPA 5FO8B 4I7ZC 3VR3A 1YHAA 2ES2A 3NEMA 1G6PA 5KKNB 4U6PA 1DZ1A 2B63G 1HR0H 3FP9A 2VQFL 3HOXB 4OEMB 5M3FB 4E4TA 5KFMA 3I70A 4HIKA 1H9SA 1MBYA 4O4LF 5F9LA 1LT4D 1PZJD 2I5HA 2IHFA 3K58A 3CMEA 4A3BB 3BJUA 2UVVA 4MA5A 1KC7A 3RIZA 4BA1I 2VPQA 2N49A 4GNXC 4R8IA 1IBKH 1MKHA 3Q8DA 3RD4A 3J7AV 4G4KA 2IL8A 2NVQH 3TEHB 1X32A 3HXLA 2EYMA 1N34L 5AJ3L 3SVMA 4A3MH 4LNQA 2Q8RE 4JC0A 3DWQA 3NELA 5IT9c 2IX1A 1GUTA 3PF4A 4HNVA 2O03A 3VMMA 5C5JA 5DGAA 4B9XA 2LMCB 2A68C 2Z4IA 2J0TD 1G291 4EGVA 3BZCA 3SE0A 1ESRA 2P5ZX 2RHQB 1EY5A 2MCTA 3OSPA 1T36A 2KUMA 4MV1A 1RJTA 3PSIA 4FYDA 2IHEA 1JX4A 5CYUA 3RZDH 5K36G 1PH2A 4JV0A 5J2UF 2K75A 1CUKA 4A3GH 1AP0A 2B2YC 1YI2A 4LF5Q 2NU6B 1HRJA 2JA8H 1IBKL 5FO9B 3KLSA 2LY7A 4MZ9A 3O13A 1TWHB 1ZQ7A 1KC8C 5KFDA 1O7LA 4B3RH 1STHA 2V59A 2HUGA 4X65Q 1CKNA 1I3QH 1H9JA 2XTIA 4JI7Q 1BF4A 4B3SQ 1JOKA 1GSHA 1R9TB 1L0XB 1S5DD 2BQRA 1F9RA 4ED3A 2J6TA 3SGIA 5JPMC 1M90C 4YWKA 2F4VH 1VQMA 3BQ1A 3PW0A 2F0QA 3PIOA 4OXPA 1JB3A 5AFWA 5IYDG 1ASYA 3CQZH 1KEEA 3KALA 4BBSG 3RAQA 2UUBQ 2Z6KC 4MV3A 1FJGL 2W9BA 4RB3C 3MC0B 2C00A 4MAMA 1J6QA 1A3TA 3MXGA 4KK7A 4ZKCB 4ECVA 1S72A 3EPIA 4NXNL 1W96A 4Q8FA 2UXBH 1U4LA 1PV4A 2R93G 1X3QA 4KHZA 1I6VC 4C5AA 2L9HA 1CZGA 1B2TA 2F3WA 4LMYA 2K04A 5IWAH 2YYAA 5KIXA 1F9SA 2WAQE 1XMOH 5CORA 2VR1A 3QG1A 1VBHA 4TV8F 4IPCA 5KFCA 2F0VA 2I5LX 5DAUA 1I4XA 3OTOH 2R92G 2XCLA 4M1UB 5C5MA 3GTJH 4LMQD 1KDCA 3D6WA 3RV4A 4Y7NB 1Y1VA 5KG4A 3D31A 5KYIA 3G7LA 4GOPA 3G48A 4JV2A 2F4VL 2R7ZH 3UFXB 3D8GA 3VYUA 2UU9Q 2CW0C 2ZM6L 3I90A 1XNQH 1BBXC 1LTBD 2ID0A 1I4QA 2UXBL 3MFGA 3JC66 4O3OA 1HJPA 1D1KA 4A3JH 3RZOB 3E6ZX 1DV2A 3M85A 4FF2A 1FKAH 1GHJA 5FJ8H 5IWAL 1EY0A 2BA0A 2F0DA 1XMOL 4UP7A 1GO3E 4TQUS 2PNRC 1B44D 1QUQB 4XQQA 2CQAA 2VZAA 2B63B 1WTHA 4UFZA 2Y0SG 2PW5A 3M4OH 4IJHA 1ET6A 1C9OA 1HQMC 1EOVA 2V4DA 4HIOA 3CPFA 2B2TC 1KRTA 4XT1B 3P1HA 2L12A 1ENCA 1BCPB 4JI6Q 1S0OA 1HUNA 1JOQA 4U7CA 2QF7A 1XNQL 3I4LA 4JK1C 3VYTA 4BBRB 1TWGB 4KV6A 4KN4C 4M8AA 5DEHA 4CDCC 2L0CA 5E1FA 1DOLA 2PZWA 4JPBW 3R8BA 3DHQA 2E74C 2E2IB 1ZHQA 3G6YA 2ASLA 1I4PA 1EUDB 2OQKA 2YYZA 2LXJA 1WJJA 1N9WA 1L1OB 2ENBA 3IFDA 4MV7A 2AGQA 2RCFA 1X6OA 2JA7B 3RF2A 5IGDA 4EYIB 4XYLB 3F2UA 1JLLB 1WYDA 4JI4Q 2AGPA 4XX0B 3GIIA 1I94H 1EEFD 1ICWA 2EJFC 3P20A 2KOLA 1TWFB 4AQYH 1SYBA 2NZ1D 5I9OA 3KJPA 4KKTA 3K5NA 1X9NA 5D1PA 3MWYW 1CKOA 4ZUJA 3A5ZB 2B2UC 1WR2A 2IA6A 4LW1A 2OTLA 1VQ6A 4GKJL 1WTVA 2VUMB 4X6AH 4LUVA 2RHSB 1W93A 2KHSA 2RVLA 3I8ZA 3PCOB 4NDXA 4JV5H 2YZNA 1O78A 4J8QA 3UDFA 1YHBA 2NN6H 2ASJA 1PRTD 2W6PA 3I91A 3J81c 2YRWA 5KFLA 3HGBA 3S16H 2SNSA 2QEJC 5C0XH 1WTQA 3JAML 3S2DB 1U9RA 4LFBQ 3S2HB 2K52A 2Q2TA 4F4XA 4IALA 4F87A 2FLLA 5F9NA 4QGUA 3GTKA 3LNNA 3T16A 1S0MA 2C2DA 3WO1A 1MJCA 4MA0A 3K57A 3V4ZA 2NZOA 3GTQA 3T1HQ 2K01A 1X3PA 1MJEA 5D1OB 2W7PA 4DV0H 4ME5A 1JC7A 3MR6A 4LF9Q 5KFQA 5IP9H 4XIGS 1CQJB 1K3RA 3RN5A 4TQRA 1KHIA 4DR3H 3MEFA 4A3MG 4O0AA 4BBSB 1RYRA 1EYDA 1EIGA 5I6YA 4TUYF 2JXMB 1MGSA 4DV4L 1LTLA 3DM3A 1L2FA 4J9MA 4ZUIA 2F0GA 3NQTA 1PVOA 3BABA 3I56A 4R1JA 2ZDGA 2UUAH 2R93B 1M0TA 5KG6A 1GYFA 2FKLA 3GQCA 2HT1A 1STNA 2MO1A 3DMUA 4HTHA 1VMCA 4ECSA 2NU8B 2JYOA 2XSCA 5JQWA 1HZCA 2HCIA 3SR1A 1KAWA 3CCRA 5KRUA 1K9MC 4MIUA 4HMIA 3BVMA 2R92B 2XGTA 4A3GG 3TBIB 2BOSA 1PH1A 2OEOA 3S14B 3EIVA 1EHIA 4FNFA 1PTOD 2JA8G 5M9OA 3JRXA 3H40A 3VYRA 2DY7A 2Q8TA 3MFHA 2Z8LA 1HPCA 3VA5A 4DU9A 4O2AF 4R4IA 2R8JA 1VQCA 2ALZA 2KA7A 2XN9C 2VQFQ 4IOCA 4C2MA 2EY5A 4EGQA 2R84A 2EQSA 1TWAH 4CC6A 1PH9A 4A3CH 2UUAL 4IRKA 4DR7Q 2OLSA 1NMGA 2SOBA 3NHHA 5D3DA 3Q8RB 2F1MA 4DR2L 1JWSD 1OXVA 1EZ1A 4EEQA 3JAMW 2YS7A 3QIAA 4R4QA 2GLTA 2Z6BA 3FEWX 2R8GA 4J9NA 2K03A 4DR1L 1QNKA 2Y0SB 3KLRA 1PH5A 3R2TA 4TQSA 3BDCA 2W7OA 1N34Q 5AJ3Q 1JT8A 2D0OA 4POGA 5E4WC 4LH6A 5LL6S 4A2AA 4GN5A 1XPUA 2JN4A 4JCVE 3OHAA 1B53A 2KHJA 4KTAA 1YJWA 5BPFA 1SXTA 2F0MA 5GAEC 3AFPA 3UDXA 3MFIA 1UEBA 3J7ZC 1G91A 1TA8A 1AEXA 3TREA 3HOWH 1B4OA 1WCMA 2W6OA 2N55A 3JRWA 4R8UA 4RZQA 1EY4A 2V4QA 1FVIA 4JBMA 3PMFA 3GTOA 4ED8A 1Z47A 2K28A 4QY7A 5KT6A 2K32A 4L6TB 1IBKQ 2R7ZG 4DK3C 4YWLA 4EQOA 4HNUA 4JI0H 1VS0A 3KAJA 2JJQA 4O3QA 1A63A 1V51A 2D62A 4KI0A 4FVMA 3URYA 1UE5A 3GTGB 5JVG3 3RB0A 2FINB 3KF6B 5DQHA 2VQEH 4LUZA 4A3JG 2W8LA 1PRTC 3N44B 1Q86C 1Q12A 4EQNA 5FJ8G 3MXPA 4DLKA 3JZIA 4JI7H 3SDZA 2WAQG 1BCPF 4MNOA 3HOVH 2HVQA 3ZYYX 4RNMA 3K7UC 1Q90A 1NMFA 5EKKA 1IYUA 1JQYD 4IUVA 1E7ZA 1FNUA 1TWCH 4CJ0B 3I55A 1JJ2A 5LL6b 3EFXD 4HJ5A 2HDMA 2KCMA 4RGNA 1E4EB 1SJHD 1KJJA 4IN3A 2FHTA 1VQBA 4NXNQ 1QVFA 2QEXA 2F0FA 1RDPD 2C9OA 2A1AA 2NVQB 2BQUA 2YV5A 3OOCA 4B3RQ 2VQEL 2CH4W 2Z0SA 4A3MB 1FL0A 2YU9H 4BXXH 1FD7D 1B6RA 1BNCA 1BUVT 1IL2A 4EEYA 3H0GA 1RJRA 2E8GA 2AMCB 4A3FH 2K6AA 2NTSA 4X3KA 1SE4A 2FLNA 2F0SA 1PA6A 3DF7A 2F4VQ 4J9OA 1UE1A 4RMFA 1Z2PX 3M7NA 1PTOC 3G6VA 2CWPA 1LLRD 5EGTA 2ZM6Q 1RTNA 3GV8B 4GLVB 4EBCA 1Y8PB 3NBHB 5KFJA 1KJIA 2UXBQ 2JA8B 1JCKB 1S40A 1LYLA 5FPRA 1JR0D 4HIMA 1L0YB 5IWAQ 5KYLA 1OTCA 5KFAA 2ZJPA 3A0JA 1LTSD 1PTOF 1XMOQ 2NN6G 2B3GA 1EZ6A 3FMCA 3NSWA 3R93A 3Q0AA 2V1CC 3OTOQ 2EY2A 4UP9A 5C0XG 3FKIA 4L63B 3UDIA 1I3QB 3KJOA 5KFTA 1UWVA 2A74C 1M1KC 3M9MB 2PQEA 1SNQA 2FMCA 4DV6H 1LACA 2FJ2A 3F2BA 5L1IA 5KFRA 1CFMA 4YR2A 1CHQD 5KEEA 1T94A 3Q2OA 4GOPC 3FPUB 3IAYA 5IP9G 1XNQQ 1J9OA 1JE4A 3E0JA 2RSNA 4CHTB 1RIPA 4ZAIA 4KKSA 3HG9A 4CGYB 2J6UA 3DEPA 2RDJA 1SYCA 3UDGA 1T3NA 5EWEA 3IFTA 4IZ8A 2WB1B 2NZHA 3I73A 4C1NK 2HVRA 3T13A 3RUPA 4F4YA 1LTAD 4UAIA 1LT6D 2WFWA 2CH4A 1BXRA 3RGXA 3LX0A 5LMNH 1V1QA 4DV6L 3H3VI 1JICA 2KBNA 1OWTA 1XTDA 4GC6A 1EQTA 3GTJB 5BN4A 1LT3D 3KDFB 4X64L 2F0EA 5C1OA 4OX9H 5IODA 1VQLA 1SR3A 2K14A 5LHY1 2R7ZB 1X3EA 2J4XA 3DLLA 2M9VA 1K8MA 1E4FT 3K59A 1XWEA 3M4IA 3H4BA 4AIMA 4NKLA 3OUUA 3GIQA 4QWDA 3J80L 3IL8A 1ILQA 4OONA 2F0LA 5EBCA 4A3CG 4DV3L 4ZRZA 2N88A 4N9TA 4A3JB 2NVTH 3OHXC 5IE8A 4GC7A 1JDEA 2QW7A 4DV2H 3T51B 2WAQB 2WACA 5GADC 5LMNL 1QWYA 4OWXB 1WTPA 1KJQA 1YVCA 4R4TA 3ZJYC 4AQYQ 3IKJA 1NR4A 2LXKA 3SK8A 3M4OB 4O2BF 2ICIA 3KLSX 1LT5D 1Q1BA 2ZT9C 4OX9L 4J9QA 4OELB 3QZ8A 1TVXA 3KFUA 5KFWA 1TWHA 1Y1VH 2JEJA 4X3UA 4HYKA 1HFNA 4JV5Q 4ECZA 5HURA 2V58A 2VS1A 4ZK9B 3C1EA 2DNEA 3TP6A 3TQ1A 5DQIA 1MZBA 1D2BA 5CAEB 3EQLC 2XRQD 2BA1A 1ONLA 1IHZA 3HOWG 1R9TA 2VXWA 5CB4F 2NVYH 2JA9A 4DV2L 3AMUA 2I8CA 4LSAA 3N6RA 2UUCL 1YNXA 5L37A 4MTNA 2I5MX 2ZJTA 1XNRH 5IGGA 4DK1A 3JAMi 5JJZA 4XT3B 3CCVA 4DV0Q 5A2QW 4V190 1SYEA 1CT1D 4RNOA 1FR3A 3N41B 2ASBA 1EWIA 1ZYRD 4I55F 1GGOA 4DR3Q 3CRLC 1U5KA 2JSOA 3H20A 4IPDA 4NPSA 4GN4B 1Z2NX 3CCUA 2DUDA 5J1ZA 1QVGA 1P8LA 4NP5A 3FDSA 3S1QH 5IYZF 2UUAQ 4RAUC 4LK1C 4KKUA 4BY7B 1TKWB 3J7A5 4A3KB 1XDNA 2JA6H 3J80W 2F0IA 4HEDA 5EPLA 3Q8QB 4DV7H 3A74A 5I6WA 3HOVG 2F0HA 3L7ZC 3OMCA 4XYOA 1RK6A 4MTEA 3GILA 2UVRA 3NUCA 5EPJA 2M2LA 5C4ZA 3S16B 4RAYA 2EOTA 5I2YA 5KG1A 2R6FA 1XNRL 1X54A 2LSSA 5KFOA 1HNWL 3DEOA 2F0UA 3GTMH 4PMCA 5JEAH 1B33N 4DL6A 3K5OA 3PQIA 2N3SA 3E5SA 4KN7C 3K3VA 3SK5A 3RUZA 1I4GA 5D8DA 2OF1A 3RBDA 4J6HA 4DV1L 4BXXG 4YCWA 3ITPA 3T5JA 2F0NA 1QUQA 4OWTB 3MZ5A 3PR4A 2RKSA 4PZ8A 4DV7L 3E9IA 4A3FG 1MSHA 2Q2IA 1VF5C 2KCCA 3CF5A 5JH7F 3A54A 1N8RC 5KFBA 1YNND 3BVGA 4J9LA 4PQXA 4BY1H 3KBGA 1SE2A 2AQ3B 1F9PA 4YR0A 1JJCB 3K7AH 2ZTDA 3RNUA 5H1SE 1PYBA 4LUOA 4H0LC 2AWOA 1K8OA 3I4NH 2K05A 5DM63 3BZDB 3CW2C 5BN5A 1Q46A 1PYWD 1TWGA 1BXTA 1O7YA 5FLMH 1JORA 2I07B 2L4NA 3GTQH 3MXNB 3NQIA 4K0KH 1SFOH 1K73C 2E2IA 1P16A 2PZTA 1MSGA 1PDQA 1SNDA 2R7FA 4LJZC 2O5JC 1L1OA 1QCBD 2KCNA 3NTKA 4BS9A 2JA7A 1U4RA 1KL9A 3DWAA 1TWAB 1AZQA 5M5XH 1S5ED 3D6CA 3LGJA 4RGMA 5DLFA 3E5NA 5J2TF 1X56A 2FE3A 1TWFA 2RBMA 2PO4A 1BVSA 4TVAB 3CMAA 4JI0Q 1HA6A 1IOVA 4UCTA 1FJGH 2HVSA 3G6XA 3WWVA 5IGEA 4P73A 3CCJA 4WJWA 4IRCA 5M5WH 3VPCA 4NXNH 4HAEA 4L5QA 2W9CB 1DIKA 1SCUB 3GTLA 4QUFA 2VUMA 1Z9FA 1I7NA 1ZKOA 2PN1A 2VQEQ 1HCZA 3C2PA 1ULZA 4LFCH 2OTJA 2JEBI 2A19A 1VMPA 1I5FA 1J8IA 1PFSA 1V4YA 4QWBA 4IUTA 4O3RA 1BDOA 4K0KL 1BR9A 1D5XC 3J7AF 4BWGB 3AU7A 4FU0A 1ASZA 5KT5A 2DPIA 1N32H 3KF8B 4PNYA 5JVH3 1X55A 4WBNF 3I3CA 1WD0A 2ZJRA 3EYYA 2BH2A 1SE8A 2E2HA 3T56B 3PGZA 2SNMA 1H9MA 5DQGA 3HOWB 4C5CA 1F2MA 3D4DA 3VR6A 5EPKA 3K6OA 3L9AX 5M3MB 1XPRA 4RCOA 3S1MH 5JJIA 1BOSA 2P0AA 5D1OA 4IUQA 4RFBA 4DNTB 1EIYB 4JOIA 2GPSA 5FLXW 5M5YB 2ZM6H 1ZYRC 4IWYA 2XIWA 1CQIB 4P75A 5CV6A 1IYVA 1QILA 2PI2A 4Q44A 4NMZA 4DKAC 2PMZE 4OIKA 4IUNA 3QR8A 4JYAH 2B2VA 1PLFA 1CM9A 4LFCL 3S15H 3CAMA 4I7HA 1YIJA 3E0EA 2R93A 3PW2A 3KBXA 3TMEA 2R7KA 4G3IA 2KVMA 4PV1C 3T53B 5C4XB 1RK5A 4NXMH 3I12A 4DR6H 1CSPA 1N32L 3S1RH 1I4HA 5TSSA 3C0FB 5GROA 3HOVB 3LMLA 2R92A 2GVAA 4HNTA 4J9RA 5ELOA 2ALYB 1A0IA 3BQ0A 1DCZA 1VQKA 1TWCB 2HD3A 2F0PA 5LOVF 4JW0A 3KOJA 2FLPA 3VR4A 3K8AA 4CKEA 4G57A 4DR5H 4R4CA 5C44H 3HKZA 3CCQA 3OPOA 1Y1VG 2NVXB 1RJPA 1LTTD 1YZ6A 1HR0W 1G6ZA 2O4XA 4ED7A 4JYAL 2EPBA 5C4JB 1EUJA 4B08A 3G4SA 2D0PA 3JAME 4L5RC 4QIWB 1YNJD 2RDHA 4KJOA 4C3IH 1GHKA 2FPPB 3I4MH 5CV5A 2NN6I 4NXML 2RDIA 4TV9F 4XYQA 3HEJA 4MHEA 1YNNC 1TXYA 2YU9B 4DR6L 1AE2A 4DV6Q 3KHLA 2EYPA 1SNPA 4R4OA 4GZYC 1GLVA 5C0XI 5KFXA 2ICEC 4A3FB 4FXDA 3TP7A 1CHPD 4A76A 4J0MA 1OXTA 5D65A 5IOCA 4CKBA 5KT4A 4JI3H 4DFAA 1N56A 4ID6A 3TN2A 2CZGA 1LO5D 1XMQL 4GKJH 1ICFB 1CS0A 1ESFA 1HFGA 4DR5L 4K8JA 3CHBD 3L3OC 2LFNA 4N9PA 4DXGA 3SI8A 3V6KA 1XPOA 4B3TL 4RHSA 3D4RA 2YZGA 2HHHH 2FK3A 2JA6G 3MXUA 2QDLA 3MR5A 2EXDA 5D14A 4GKKL 3KHHA 1I6HH 5K5PA 1DOKA 2HIXA 3HZXA 5LMNQ 4HQ6A 1B70B 3S1NH 4P74A 4YAKB 4IRDA 3RV3A 5JJKA 3PUWA 4RA8A 3IRBA 1LTID 1PRTB 2K33A 4JI8L 4OX9Q 4G7HC 3K81C 3H0GH 5KG7A 1K83B 1WVLA 4ECRA 4YR3A 2I46A 4JI3L 3PV0A 5JEAG 1D8LA 1VQDA 1BCPD 3UQ8A 1F77A 1V9PA 4UCUA 2K7VA 3GTGA 4DV4H 3KF6A 2XGPA 2BR0A 1NY4A 1PH4A 2J9GA 2EYLA 4GLAC 2K50A 4EVOA 2PVPA 3MWDA 3HOUH 4DAYA 3T5LA 1S0NA 3CC7A 4K6LA 4KMUC 1E2ZA 1CQFA 1OO9B 2K5DA 2HHHL 3F8NA 3Q6SA 3B6YA 3J80i 4DV2Q 3N42B 1V1PB 2QDBA 2CCZA 5CV7A 5KFUA 2R86A 2VQDA 4QUCA 1IBLL 3HOZH 2R6GA 2OQ0A 1ILPA 2KCTA 4JUZA 2F0WA 2YW2A 4BY1G 5EQ0A 1Q81C 5BMVF 3AFQA 4PZ6A 5C6AA 1H95A 1E4EA 2C28A 3OHBA 1STEA 3TZUA 3FDTA 4IO9A 3I4NG 2HGSA 4Q0YA 3FKIH 2K5NA 2CVRA 1Z6HA 4HIDA 4YJ2F 3MR3A 4IPGA 1VAJA 4P71A 3Q8SB 5CV4A 3LWBA 4C1NI 4WORA 4YCUA 1EY8A 5FLMG 3GIPA 5F2DA 2A69D 4KD3A 4X62L 4JBWA 3GLKA 1NSNS 2WDTA 4O4IF 1TY0A 1NTGA 3Q22A 4AYBE 4RKLA 1XYIA 1RODA 3S17B 1ET9A 1EL0A 4DR2H 4DR4H 1Q8IA 1MHWC 2W6NA 5KGUA 3BG5A 5HBRB 3ULLA 2KSWA 4K5XA 2NVTB 3OIQA 5IIFA 1XNRQ 4DNRB 4ZI7F 3M7GA 1PZKD 4DR1H 4UY8C 3ND9A 2QA4A 4FBTA 1GJXA 2KECA 4LF6L 2E2DC 4GS3A 4TSSA 5C4HA 5IGFA 2DZDA 2AUKA 2EJMA 4DV5L 3NPPA 2YL2A 4A3LH 1H9RA 4YP3A 4K8IA 1YNJC 4EG0A 1Y1VB 2F52A 4DNIA 3U9OA 3AB9A 4DV7Q 4EBDA 1EWCA 1LTRD 3IN5A 4GOPB 4LF7L 1I3QA 4DR4L 1V1OA 2AWNA 4DA2A 1RF2D 4L5TA 5FKAC 3K0XA 4H44C 1JMCA 4KY5A 4FBUA 3J7AK 3A56A 2KEEA 3N6XA 1VQJA 2FFKB 2G9HD 2NVYB 1K1QA 5KFNA 1TS4A 4M7EA 1WTWA 1O7ZA 2PQAB 2E5LL 4OO1H 4J9KA 4KHPH 3KAKA 1W6KA 1EU4A 4JI5H 1A62A 1IXRA 1SNCA 2R82A 4FF4A 1C48A 3BAAA 4APMA 2X0SA 4G7OC 1AFPA 4TRDA 2C5CA 2UVWA 3KHGA 4PWQA 4ECWA 1LV9A 2WB1A 2RSOA 2HIVA 1HNZL 1VKZA 1IZ6A 3GIJA 5DNFA 4ECUA 1SYDA 3OW2A 3LWUA 2YZMA 1SYGA 4DUZH 1TWHH 1FYCA 4QMGA 2JA6B 1SE3A 4RAZA 4IQZA 4H7BA 2R8KA 3GTJA 2YRXA 3TIGA 5EWGA 4RGOS 1K28A 1OXUA 4UCRA 2WE6A 2PYKA 3R5HA 1BCPC 1R9TH 1VQ9A 2R7ZA 4IAJA 1N33H 3CVZA 4QQBX 5C44G 4KHPL 4JI5L 3GTMB 2FJZA 5JPNC 1KAAA 4UCVA 4K0KQ 1SSOA 4A3EH 5GONF 3PVXA 5L1KA 2K1BA 4C3IG 5DM73 4IFDH 1TU2B 3A8KE 1D5MC 3ONAB 3GV5B 3GV7B 2JEFA 4KJNA 4L8JA 3N8DA 2BQ3A 2WAQA 1EUCB 3EA6A 4DUZL 5JOBA 4B9WA 1EYGA 2JA5H 1I50H 2BDOA 1VQHA 4IPHA 4DAPA 2RQXA 5E4XA 4A93H 1GUSA 3GP7A 3N43B 2NUAB 1N36H 4MV8A 4IR1A 3CC2A 1FJGQ 4F4WA 3PR5B 5DLQE 4A3IH 4BY1B 1GOZA 1ZEQX 2JQOA 3H09A 3K7AB 4J1MA 1N33L 3GTPA 4LF8H 3H6MA 1J5EL 4LFCQ 2N8NA 1ZETA 3I4NB 3AQQA 3RLFA 2A69C 5NUCA 1PZID 2ZTCA 3P75A 1SN8A 4R8NA 3JAMc 4JBKA 3Q8PB 1DGSA 2XC9A 3PZPA 3M4PA 3CCEA 1WOCA 2IJ0A 3KLWA 1QJOA 3R23A 1N32Q 4A75A 3GTQB 5A2QE 4IUUA 1SFOB 4IR9A 4LF5L 4O3NA 1Q1EA 1UEAB 4ABNA 5J39A 2PZUA 3RBEA 4O42A 3HRZC 1O7IA 3RFCA 5KT2A 3NTHA 4CDDC 1IW7D 1STYA 5ELCA 2PPBC 2MPMA 2L5TA 2R7NA 1VCIA 1N36L 1AZPA 3RZDB 1E3PA 1HH2P 3H0GG 4IWXA 2R61A 3HFZB 3SE7A 4A3GB 1GUWA 2DNCA 3KYHC 4X65L 2B2WA 3BYYB 3J80E 1MIUA 5COYA 4QB4A 3PW7A 4JYAQ 1QZHA 4LFAH 1QVCA 4LF8L 5M5WB 2AQ4A 4I65A 4ECYA 3HOUG 2CFMA 2B2VC 1Y8NB 1KRSA 2CKZB 4HCEA 4YBZB 2RDGA 4NXMQ 1B50A 3TQTA 1KBLA 3SK4A 1B9NA 3KUPA 1M7JA 2GPWA 3BG3A 4DR6Q 5CBAE 2F0TA 1W2BA 1R4PB 3OW7A 3BU2A 4BBRH 1TWGH 4X3TA 5CV9A 4KLKA 3HOZG 2R8IA 1X65A 2UUBL 3RB4A 2EYFA 3PF5A 3AEVA 2QCPX 2E2IH 4X64H 1BNZA 2Z9HA 1C30A 3RB6A 2IBKA 2A6HD 3A8JE 4ED1A 3W1BA 4JI2H 1Y1WA 5KFIA 3FKIG 4DR5Q 2JA7H 3UE1A 1K3BC 3CQZB 3HOYH 2V9WA 4FXKC 4LFAL 4MV9A 3U9TA 3WNZA 4DV3H 5I2XA 5LYJF 4GNXB 1PFBA 4PMBA 3MFYA 3HP3A 2DJFC 4QWCA 3S15B 1ENAA 3GTLH 4DF7A 2VUMH 1VBGA 3PO2H 2X6LA 2CWAA 1AW7A 1PFNA 2RCNA 2UU9L 4RZRA 5A2QL 1D1IA 2CHBD 1STGA 1WTXA 1TS3A 3M9NB 2CW7A 3H3VC 4NLGA 4JI3Q 4Z9CB 1JOOA 5C0XJ 4APVA 2UXDH 1BKBA 4A3DH 4GKJQ 1RTOA 1PYSB 4OIJA 4I50F 4JI2L 1HTPA 3Q23A 5IT9L 1EQRA 2E2HH 4IURA 2JEGA 2SDFA 1B04A 3A7LA 4S3SA 1PTOH 2PW7A 3KHRA 4GLXA 2IY5B 5I9PA 3MXNA 4R8UB 4A3LG 3F2CA 1NJIC 2HHHQ 3WOEA 3TSSA 5ELEA 4ME3A 3D3RA 3HKZE 2PMZB 1EWHA 1DOMA 1HQRD 4MTKA 1TWAA 3R5XA 5IP7H 3GO5A 4AYBG 4Y8VB 1S97A 2UUCH 3FVQA 1HTLD 4C3IB 3L4JA 2IMWP 4JI6L 5K2MA 5KG5A 2RDFA 2QYZA 3T5HA 2BH8A 3EVQA 5HV6A 1NBWA 4ZLTF 5IGBA 5FPOA 3NXWA 5T1GA 1LABA 1EIHA 3CCMA 5C8YF 2MNAA 4FF3A 3BQ2A 2HDLA 2G5DA 3M3YH 4OO1G 2UXDL 2W9CA 3TP8A 1I6UA 1HXYD 4OWWB 3VYSA 4DV4Q 2DGYA 1ZHSA 3K5IA 3BYTB 1TIID 3I4OA 3RMHA 2O2LD 1VQ8A 3S14H 1YEZA 2A8VA 5KFGA 4YHHH 1AUXA 4JBJA 1S5FD 1VQFA 1JB7A 1PH7A 3STBD 2FPIB 2WTFA 1ML0D 3W2DA 1KXLA 1WSCA 3A7AB 4KD4A 3KF8A 3U9SA 1K8GA 3OIPA 3ULJA 4UPAA 5FLXE 3NGDA 5CV8A 1SYXB 3X3MA 1IW7C 2XRSD 3ND8A 2VUGA 2W8KA 1I7LA 2K4KA 2EJGC 4JG2A 4C3HH 1HNWH 4HR7B 1I6HB 4K5VA 1QNUA 2FXQA 2X6GA 4O3SA 1G51A 1WD1A 4ZOLF 1QZGA 4MV6A 3S1NB 3BZKA 1A15A 1FNWA 1M0WA 4JV1A 3OYYA 1JIHA 3CPWA 4LF4H 4R9WA 5C3EH 5IT9W 3KTMA 1U4MA 1QG7A 1VQIA 4DV1H 3OSOA 4HN7A 3H94A 1A8VA 4A3EG 4YY3H 4YHHL 3EPGA 4AH6A 2W6MA 4IUPA 4DR4Q 3K80C 4DR2Q 2H5XA 3M4YA 4IFDG 3HOUB 3LWEA 1GUGA 3KXYT 4ED0A 2DJGC 3HS0C 4K5WA 3C46A 3R2IA 2JA5G 4DR1Q 2F3VA 2GN5A 1ZXTA 4A93G 4X66L 1WFQA 3BVZA 2R7MA 3HOZB 2R85A 4WD3A 4CDEC 4WJ3M 1S9FA 1TWCA 3TINA 4BWSC 3PO3H 4K2KA 4A3IG 4LH7A 2ZJQA 2W9AA 2ATWA 1KABA 1D7QA 2NVXA 1EOTA 3R5FA 4NW2A 1KJ8A 4LF4L 3FKIB 3K5HA 2AKWB 2JEAI 1PK8A 4ALPA 1GVPA 1HNZQ 4QIWA 5EKLA 1DV1A 4YY3L 4E6IA 2M05A 5IYCH 5FOBB 4YQWA 1KNAA 3M4QA 1VQOA 2B63A 2HQEA 4ULLA 2YU9A 5I47A 4MV4A 3DUZA 3GTGH 1WTOA 3M9BA 4IHJF 1AUVA 3CCLA 4EQ5A 4K2LA 1OXSC 1TT2A 4RB1A 3QZ7A 5FLXL 4QWAA 1GXDC 3RTXA 2XCPA 4ECTA 3I72A 4RHRA 2A6ED 4IFDJ 4WJ4A 1RCVD 2RA4A 2L11A 4KHPQ 4JI5Q 3ER0A 2F0JA 2DY8A 2UXCH 1AN7A 4FF1A 1Y14B 3JSNA 3GTKH 4DR7L 1KDBA 2OCEA 4UCOA 4I7AA 5C1PA 4XQNA 2EYOA 1STBA 2D9UA 1SLJA 1XX8A 1GD7A 1XJVA 3W1GA 2R7LA 1TS2A 4F50A 1HZ9A 2HCCA 5KG3A 2F03A 4DUZQ 4P2CB 2VB3X 4BBRG 2XGQA 5L1JA 1L2ZA 4YCVA 3RGZA 4WFN3 2C22A 2L55A 5KFZA 3L2PA 2QKIC 3UI2A 1HNXH 4AYBB 3MEHA 2W57A 2IPKD 5CA1F 4RUCA 1KLGD 1K83A 1NE3A 5LL6X 3T5KA 1M8AA 3OSNA 3NENA 1N33Q 2JA7G 1VQAA 3J80c 1J5EQ 1HR0L 3HOYG 5KFFA 5KX5F 3GV3A 2BDNA 5LA6F 5LP6F 2UXCL 3SHLA 4RKBA 1YITA 2ZDQA 3J81L 4CDFC 3STBC 5J22A 3OWEB 5HGTA 1JWUD 2XCAA 1U4PA 1SMYD 4Y52H 3TP5A 4C3JH 1RJQA 1CA5A 1V1PA 2NWGA 2VUMG 2AQ1B 3PO2G 5FD5A 3FRPB 1F9QA 1T5XD 2AHOB 2NBFA 1STAA 2WB1E 3PN1A 5BR8H 3RB3A 4C2MH 1N36Q 3T4AC 1SEIA 1DJRD 3U4ZA 1HNXL 1G8ZD 3TQYA 4KY7A 3W5OA 4A3DG 2J6SA 3M9OB 1RD9D 1BBWA 1GSAA 4LF8Q 5ELBA 4EBEA 1CSQA 1W3SA 2EIFA 4YB8B 2A73B 2Q8IB 4HJ8A 4ZQIA 4O1NA 3V05A 5IYBH 3J7YW 3MWMA 3T1YH 1EZ8A 3Q24A 3U58A 3G6JB 2B8GA 3D4WA 2EE1A 5ELDA 1PXUA 2EXZA 5C3XA 1NUCA 1KLUD 2VY3A 3W3AA 5L1LA 4MN3A 4A3EB 5DG9A 5IP7G 3WO0A 3VA7A 3NP8A 5KFYA 1B1ZA 1VQPA 3GIDA 1Q7YC 2GVBA 4HCSA 1SEBD 4UP8A 5FO7B 5BR8L 1I4RA 2LS01 3FHWA 2JA5B 4FS1A 1I50B 1XMQH 4ZQ3A 1PFMA 3S24A 1WCMH 1X3GA 2DIKA 2QGQA 4B3RL 4A93B 5CGKA 4KHVA 1SDFA 1E2VA 4FS2A 3GTOH 3TIIA 4LFAQ 3PUVA 1JXLA 3MTSA 2B2WC 4A3IB 4B3TH 1E1OA 1C7YA 1UNNC 1VQ5A 2YTYA 1IL8A 1SNOA 2EY6A 2OXPA 2G9DA 3JSLA 4LWCA 2RF4A 3T1YL 4CBVA 3J81W 1YHQA 2ATLA 3VPDA 4GKKH 4ED2A 4HJAA 3HKZG 3SXHA 2RGRA 5C3WA 4CJ2C 3VDYA 4ZYSA 3CRKC 2A6EC 4X64Q 2SCUB 2NVYA 2Y0SA 2X69A 4C3HG 4JI8H 1NR2A 4Q8EA 1HA5A 2R8HA 1E2WA 5CMDA 4ECQA 4JI2Q 2K5VA 2PQAA 3OUZA 2KEDA 4X3SA 2XVSA 4ED6A 1EEID 2BE5D 2KENA 1H9SB 2IW3A 3UE0A 5C3EG 1W6JA 2W6QA 2EYHA 3OTOL 1NCVA 1Q82C 5BPHA 1C3OA 4DV3Q 5LMUH 3WDNA 1S4ZA 2Q2HA 3DXJC 4N8X1 2FK2A 3RLNA 3K0YA 5KFEA 5FLXc 4P72A 1IBLH 2HQLA 2FP4B 3GTPH 1KIXA 2E76C 2JA6A 1CQVA 5G3LD 4BA2I 4F8MA 3FPPA 4FXGC 1EY9A 4ODGA 1VQ4A 2ZXRA 1HZBA 3S9WA 2DLNA 4U673 3F1ZA 4EFEA 2B29A 2E75C 5T1IA 5CA0F 2UXDQ 4PZ7A 2C2EA 3PO3G 5CBEE 3VR2A 4YAJB 1PH8A 4DL2A 1MD2D 3PW5A 4YJ3F 3GV6A 2W71A 3GTMA 5KT3A 1EFWA 2H1EA 1E1TA 1A6XA 2BCOA 4X62H 3HOYB 1JE5A 3NE5B 2V5AA 5KG2A 1SMYC 4G7ZC 2RGVA 5LMUL 1JDBB 5IYCG 4Q45A 4XZ3B 1DONA 1JWMD 5CR3A 3TZDA 3LP8A 2O5IC 5EZYF 2UUCQ 3G6EA 4XQJA 1EY7A 3OWFA 5I4DA 4OHJA 1K1SA 2XIGA 3C3LA 3GIMA 4QJFA 3QFFA 5EWFA 1HUMA 3GTLB 2WINB 3PO2B 2WKDA 1II3A 3TRZA 4BY7H 1GKHA 3U50C 4DUYH 4A3KH 5A35A 3BA9A 1A3UA 3CD6A 2K5WA 4LF6H 4QL5A 1CKNB 3A5UA 3Q1KA 1VDZA 2YTVA 4OO1I 2I87A 1T5EA 4DV5H 2TMPA 3EROA 2EVBA 4IOAA 4A3DB 5DG8A 4YHHQ 2E2JH 1C8CA 3GQBA 2E2HB 3H15A 2ZDHA 5EOYA 1UE7A 1F2ZA 4DK6C 1VQEA 5JEAJ 1RYSA 1EYCA 1PTOB 4LF7H 2WKCA 1Y1WH 1S3OA 1I94L 2NTTA 1SFOA 1RKNA 3ERSX 3R3OA 4AQYL 3MA2B 5KNDA 5DGBA 2MUYA 2W9BB 4X66Q 2R87A 1HNWQ 1Z2OX 1AE3A 3HOXH 4IZOA 5M3FH 5BN3A 4DUYL 2E5LH 3BS1A 1VQ7A 4JV5L 5KG0A 3PIP3 3NBHA 1KD1C 1QOHA 4JI1H 3D0FA 4ZKBB 3MVVA 4A3BH 4DL7A 4LF4Q 3NWTA 1X3FA 3EJIA 3M3YB 1PH6A 2JE6I 4Q5VA 2YTXA 4DV1Q 1TY2A 1SROA 4K14A 4HMJA 1WI5A 4YY3Q 4OL7A 3V4SA 5ELNA 1HNZH 5GAHC 3RAXA 1IBMH 1CZWA 3E9HA 1BJTA 4C3JG 4FO2A 2C2RA 4EQPA 1M4VA 5J3BA 2IX3A 2PNHA 2QILA 4DV0L 1C0AA 1UE6A 1E24A 4IFDI 1CKMA 3HKSA 3V6JA 2VL6A 3HKZB 1VF7A 2WIIB 1V43A 4DR3L 5KT7A 4B3MH 4EYHB 5H80A 4OGQC 1SJED 4UHVA 2V4RA 1BQQT 1M6VA 1L0WA 1S5CD 2BE5C 4JVZA 3BDLA 4EX5A 4C3HB 1NNXA 1CE8A 3CQZA 4QW8A 1PHJA 2XD4A 5KFHA 4JI1L 2UVUA 1LM0A 1TQOA 1C4QA 3OMGA 4HSPA 3SK6A 1K8AC 3CCSA 2FB9A 5IYBG 4LAAA 3ULPA 4RU9A 2K5HA 1Q8KA 4GNXA 5C3EB 2EYJA 4GN3B 1DM0B 1IBML 4ZHQF 1N48A 3EN2A 3S1QB 4F7XA 3RJ0A 2W70A 3DM1A 2WP8J 3CKIB 3H4DA 1S5BD 4H13C 2VOBA 5KFKA 1SYFA 1B9MA 3KDFA 1VQGA 4A2BA 2WV6D 2WB1G 2NU7B 1F2LA 4ME6A 4B3ML 3A55A 5IY0A 1ENFA 2NB0A 1GSOA 1HR0Q 1Z7TA 1WCMG 2XWBB 1KNEA 3QJYA 5G3LF
chains in the Genus database with same CATH topology
5FLMH 2UXCQ 3GTQH 3MXNB 1SFOH 1K73C 4GLXA 2OQKA 2YYZA 2LXJA 2IY5B 1P16A 1N9WA 1WJJA 3F2CA 4A3LG 1L1OB 5M3MH 1NJIC 2R7FA 2HHHQ 1L1OA 3F2DA 1X6OA 4O2DA 4ME3A 5M5YH 3HKZE 1KL9A 1WYDA 4JI4Q 3I4MG 5M5XH 2L15A 5IP7H 2N78A 3GO5A 3LGJA 4AYBG 1YJNA 1L1OC 1X56A 5EAYA 4JI6L 3KJPA 1BVSA 4TVAB 3CMAA 2BH8A 1X9NA 4JI0Q 1NBWA 4QIWE 1HNXQ 1CKOA 3WWVA 3A5ZB 4P73A 3CCMA 3CCJA 4LW1A 2MNAA 5M5WH 2ZTEA 2OTLA 5C4XH 1VQ6A 4L5QA 4LUVA 2RHSB 4X6AH 3M3YH 2OWOA 4OO1G 2UXDL 1Z9FA 3PCOB 4OWWB 2VQEQ 4DAYB 2DGYA 4POFA 4DV4Q 2OTJA 2JEBI 4HJ7A 3UDFA 1YHBA 2A19A 4Y7NH 1I5FA 3J81c 3I4OA 1PFSA 1VQ8A 3S14H 1YEZA 2A8VA 4K0KL 3S16H 3PUZA 4PG3A 4JBJA 1FGUA 1VQFA 1JB7A 1PH7A 3STBD 1ASZA 4LFBQ 2K52A 4RG1A 1YJ9A 2Q2TA 2Q2UA 1KXLA 3KF8B 4QGUA 1X55A 3PUXA 1K8GA 2ZJRA 3EBEA 3ULJA 1SE8A 2C35B 3J81i 4UPAA 3PGZA 2BH2A 1MJCA 2Z6KA 3RR5A 2NZOA 3T1HQ 1T9HA 1MJEA 2NVXH 3S1MH 1XPRA 5JJIA 4JI0L 4LF9Q 3RZOH 5IP9H 1EIYB 2K4KA 4JG2A 4JOIA 4XIGS 5BR8Q 4C3HH 1K3RA 4DPGA 5C4JH 3RN5A 2FXQA 4P75A 1EQQA 1KHIA 1G51A 4DAMA 3MEFA 4A3MG 4O0AA 1QZGA 2PI2A 3L0OA 4FDBA 3BZKA 5GQOA 4DKAC 4DV4L 1LTLA 2PMZE 3DM3A 4JOIC 2B63H 1L2FA 3OYYA 1PVOA 3CPWA 3ICEA 4LFCL 4R1JA 5C3EH 3CAMA 3I56A 3S15H 4JI7L 1YIJA 3E0EA 1VQIA 4B3SL 2HT1A 2MO1A 1A8VA 2MO0A 4A3EG 4YHHL 3T1YQ 5HGQA 1BBUA 4AH6A 1HZCA 4DR4Q 1KAWA 1CSPA 3K80C 2H5XA 4DR2Q 3CCRA 1N32L 3S1RH 4IFDG 1K9MC 3TS0A 2XGTA 5GROA 4A3GG 1PH1A 2GVAA 3EIVA 2JA5G 4DR1Q 5ELOA 2ALYB 2JA8G 2GN5A 1A0IA 1VQKA 4A93G 4X66L 1WFQA 4WJ3M 1KQSA 3KOJA 4BY7G 3K8AA 4A3KG 3PO3H 4R4IA 4R4CA 5GAGC 4A3IG 5C44H 1XMQQ 1VQCA 3CCQA 1Y1VG 2ZJQA 1YZ6A 2ATWA 1HR0W 2VQFQ 1D7QA 4IOCA 2EQSA 1TWAH 1B8AA 1PH9A 4JYAL 4LF4L 4B3TQ 4A3CH 2UUAL 1EUJA 2AKWB 2MFIA 3G4SA 4DR7Q 2D0PA 2JEAI 1NMGA 4L5RC 4ALPA 1GVPA 4C3IH 1HNZQ 3I4MH 1TWFH 2NN6I 4NXML 4DR2L 4YY3L 5IYCH 1EIFA 1OXVA 3M4QA 1K83H 1VQOA 1TXYA 2PI2E 4DR6L 1AE2A 4DV6Q 3U4VA 4R4OA 4R4QA 4GKKQ 1Y1WG 5C0XI 1AH9A 3GTGH 3M9BA 4DR1L 3CCLA 4L5SA 4EQ5A 1OXSC 1PH5A 4A76A 1N34Q 1OXTA 1HZAA 5AJ3Q 1JT8A 2D0OA 4POGA 2KHIA 2JK8A 4GN5A 4XTCS 4JI8Q 1XPUA 4JCVE 4IFDJ 3HOXG 1XMQL 4WJ4A 5M3FG 2KHJA 4KHPQ 4HJ9A 4DR5L 1YJWA 4JI5Q 3ER0A 2IT1A 3S2DH 4PMWA 1YBYA 3S2HH 5GAEC 1Y14B 3GTKH 1XPOA 4B3TL 4A3BG 4DR7L 3AFPA 3UDXA 2OCEA 1UEBA 3J7ZC 3TREA 3HOWH 2JA6G 5LMUQ 1SLJA 1XJVA 1GD7A 3W1GA 2CQOA 2EXDA 1FVIA 4JBMA 4GKKL 1HZ9A 1Z47A 1I6HH 1JJGA 4QY7A 2HIXA 5LMNQ 1LUZA 4DUZQ 4BBRG 5IYDH 1IBLQ 4YCVA 1B70B 4BBSH 2IX0A 5E7NA 1IBKQ 2R7ZG 4DK3C 3S1NH 4P74A 4YWLA 5JJKA 3PUWA 1VS0A 3L2PA 3IRBA 2JJQA 1A63A 3PUYA 2D62A 4JI8L 4OX9Q 3K81C 3H0GH 4KI0A 3CC4A 4JI3L 3PV0A 2R93H 5JEAG 1D8LA 1VQDA 1NE3A 1UE5A 1V9PA 3KF6B 3NENA 1N33Q 2JA7G 3S17H 4LUZA 1VQAA 3J80c 3KF6A 4A3JG 1J5EQ 1HR0L 3HOYG 1NY4A 1PH4A 1Q86C 1K0RA 1Q12A 3M4OH 4GLAC 5FJ8G 2K50A 2UXCL 3I2ZA 3HOUH 1YITA 2Y0SE 2R92H 2WAQG 4MNOA 3STBC 3CC7A 3HOVH 4X62Q 1IYJB 2HHHL 3K7UC 3GD7A 3B6YA 1NMFA 3J80i 4DV2Q 1I94Q 1B7YB 2CCZA 4C3JH 4H02A 4Y52H 1E7ZA 1TWCH 1IBLL 4JI4L 1PH3A 2VUMG 3I55A 2R7DA 1JJ2A 3HOZH 2R6GA 2OQ0A 3PO2G 2KCTA 4HJ5A 2KCMA 4BY1G 2AHOB 3F8TA 1Q81C 2WB1E 3AFQA 4PZ6A 1H95A 4C2MH 1N36Q 1VQBA 4J15A 4NXNQ 3U4ZA 1HNXL 1QVFA 2QEXA 4DUYQ 4IO9A 3I4NG 3FKIH 2K5NA 2A1AA 3TQYA 3W5OA 4A3DG 4HIDA 2YV5A 4IPGA 4LF6Q 4P71A 1BBWA 1VQNA 2VQEL 4B3RQ 4LF8Q 2Z0SA 4YCUA 1CSQA 1FL0A 3AYHB 5FLMG 2YU9H 4BXXH 4DV5Q 1W3SA 2EIFA 1IL2A 4X62L 4JBWA 4HJ8A 3TS2A 5IYBH 3H3VH 5M3MG 2E8GA 3RN2A 1NTGA 2AMCB 4A3FH 4AYBE 3U58A 4LFBL 4LF7Q 3RLOA 2VY3A 3ULLA 1PA6A 2F4VQ 5IP7G 1UE1A 4RMFA 1RL2A 1XNRQ 3M7NA 3T1HL 1VQPA 1OXXK 2CWPA 1Q7YC 4A4IA 2GVBA 4NB3A 2ZM6Q 4LF9L 4GLVB 4UY8C 4UP8A 2VW9A 5BR8L 2VNUD 2QA4A 3NBHB 3FHWA 2UXBQ 3J81j 5C4XG 3S24A 1GM5A 1WCMH 1S40A 2E5LQ 1LYLA 1X3GA 4LF6L 3G71A 2QGQA 3CP0A 4B3RL 4GS3A 1U0LA 4HIMA 5IWAQ 4JI1Q 1OTCA 2ZJPA 3A0JA 4DV5L 1XMOQ 4YWMA 3I7FA 4LFAQ 3PUVA 2NN6G 3GTOH 2I0QA 4A3LH 1SRUA 1E1OA 2F3IA 2B3GA 1C7YA 1VQ5A 2YTYA 2F52A 4DNIA 5HY6A 2V1CC 3OTOQ 4DV7Q 1E22A 4LWCA 4UP9A 3UDIA 2RF4A 4IJLA 5C0XG 3KJOA 4GOPB 3T1YL 4LF7L 1YHQA 1UWVA 1IBMQ 1M1KC 4DR4L 5JJLA 2AWNA 3PIPA 4L5TA 4HJAA 3K0XA 3F2BA 3HKZG 1JMCA 3CXCA 5LMNW 4GOPC 1VQJA 4GKJL 3VDYA 3GDEA 1SMXA 4X64Q 5IP9G 2MQHA 1XNQQ 1RIPA 4B3MQ 2E5LL 2PQAB 1YHAA 4JI2Q 2K5VA 2PQAA 2ES2A 3NEMA 1G6PA 1A62A 1IXRA 2B63G 2KENA 3FP9A 2VQFL 3UE0A 3UDGA 5C3EG 4HIKA 3OTOL 2NZHA 1Q82C 2I5HA 4DV3Q 2HIVA 2IHFA 2Q2HA 1IZ6A 1HNZL 3CMEA 3OW2A 3BJUA 2WFWA 3RLNA 4BA1I 1TWHH 1V1QA 5FLXc 4P72A 4DV6L 2KBNA 2N49A 1XTDA 4GNXC 3H3VI 2HQLA 1MKHA 3GTPH 1KIXA 3Q8DA 4BA2I 3KDFB 2NVQH 3TEHB 4X64L 1VQ4A 1HZBA 1VQLA 1SR3A 1OXUA 5AJ3L 1N34L 2K14A 3F1ZA 4A3MH 2B29A 1X3EA 4LNQA 2UXDQ 4JC0A 4PZ7A 3NELA 5IT9c 3DLLA 1R9TH 1VQ9A 2IX1A 3PO3G 4QQBX 3PF4A 5C44G 4KHPL 1PH8A 4JI5L 4AIMA 1EFWA 1E1TA 4K0KQ 1G291 4OONA 3BZCA 4A3EH 4DV3L 4A3CG 2RHQB 2NVTH 5IE8A 1JE5A 3PSIA 2IHEA 5LMUL 5IYCG 3J7A5 3RZDH 5K36G 1PH2A 2K75A 1CUKA 4A3GH 1YI2A 5GADC 5LMNL 3G6EA 4DUZL 4OWXB 1EYGA 2JA5H 2UUCQ 1YVCA 1I50H 2JA8H 4R4TA 4QJFA 3ZJYC 4AQYQ 1IBKL 2LXKA 1VQHA 4IPHA 4A93H 4MZ9A 3CC2A 1FJGQ 1Q1BA 3TRZA 4OX9L 4BY7H 1GKHA 3U50C 4A3KH 5DLQE 4A3IH 3KFUA 2JQOA 1KC8C 3CD6A 1Y1VH 4QL5A 1CKNB 3A5UA 1N33L 4JV5Q 2YTVA 4X65Q 1CKNA 1I3QH 2N8NA 2VS1A 1J5EL 4LFCQ 2XTIA 3AQQA 3RLFA 4JI7Q 4OO1I 4B3SQ 4IOAA 2ZTCA 1SN8A 3JAMc 4JBKA 1DGSA 4YHHQ 2E2JH 2BA1A 3M4PA 3CCEA 1WOCA 3HOWG 3H15A 1UE7A 3KLWA 4DK6C 1VQEA 5JEAJ 1N32Q 4LF5Q 4A75A 2NVYH 3SGIA 2JA9A 4DV2L 1Y1WH 1S3OA 4YWKA 1M90C 1I94L 2UUCL 1Q1EA 3ERSX 1VQMA 1YNXA 4LF5L 4MTNA 2I5MX 3PIOA 4OXPA 5IYDG 4AQYL 3CQZH 3JAMi 1ASYA 4BBSG 2UUBQ 3CCVA 4DV0Q 1O7IA 2Z6KC 4X66Q 1FJGL 1HNWQ 1J6QA 1AE3A 1VCIA 1N36L 2ASBA 3HOXH 1E3PA 1EWIA 1HH2P 3H0GG 4NXNL 3HFZB 5M3FH 4DR3Q 1S72A 1U5KA 4DUYL 1PV4A 2E2HH 4IPDA 4KHZA 4GN4B 4NPSA 1VQ7A 2R93G 3KYHC 4JV5L 4X65L 1KD1C 3CCUA 2DUDA 1QVGA 1MIUA 1P8LA 2WAQE 3D0FA 4JYAQ 1QZHA 4A3BH 1QVCA 4LF4Q 4LF8L 3S1QH 1X3FA 2UUAQ 4IPCA 1PH6A 2JE6I 3HOUG 2YTXA 2I5LX 2CFMA 2CKZB 1KRSA 4DV1Q 2JA6H 1SROA 3GTJH 4NXMQ 2R92G 1WI5A 4YY3Q 3A74A 3HOVG 5ELNA 4DR6Q 5GAHC 1W2BA 3L7ZC 3BU2A 3E9HA 4BBRH 1TWGH 3D31A 4GOPA 4KLKA 3G48A 3HOZG 5J3BA 1X65A 2PNHA 2F4VL 2R7ZH 2UUBL 4DV0L 1C0AA 1UE6A 1XNRL 1E24A 1X54A 2UU9Q 4IFDI 2LSSA 1CKMA 3PF5A 3AEVA 3HKSA 2E2IH 1HNWL 2ZM6L 3GTMH 2VL6A 4DR3L 1V43A 2ID0A 2N3SA 3W1BA 2UXBL 3FKIG 3JC66 1HJPA 3UE1A 4DR5Q 2JA7H 4A3JH 3HOYH 1L0WA 4EX5A 3M85A 1PHJA 5FJ8H 5IWAL 4JI1L 2BA0A 1LM0A 1XMOL 4UP7A 4LFAL 4DV1L 1GO3E 4BXXG 4TQUS 4YCWA 1K8AC 3CCSA 1QUQB 2VZAA 5IYBG 1QUQA 4OWTB 4GNXB 4PZ8A 3ULPA 4DV7L 2K5HA 2Y0SG 3E9IA 4A3FG 1Q8KA 2Q2IA 4IJHA 3CF5A 1C9OA 4GNXA 4GN3B 1N8RC 1EOVA 4HIOA 3GTLH 2VUMH 1IBML 3PO2H 3EN2A 3CPFA 1KRTA 2CWAA 2RCNA 2UU9L 4BY1H 2WP8J 1JJCB 3K7AH 4JI6Q 2ZTDA 3RNUA 5H1SE 1PYBA 4LUOA 2AWOA 4JI3Q 3KDFA 1VQGA 5C0XJ 1XNQL 3I4NH 4APVA 1BKBA 2WB1G 4A3DH 3CW2C 4B3ML 1Q46A 1PYSB 5IY0A 4GKJQ 1HR0Q 4JI2L 1WCMG 1EQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLM H;  2UXC Q;  3GTQ H;  3MXN B;  1SFO H;  1K73 C;  4GLX A;  2OQK A;  2YYZ A;  2LXJ A;  2IY5 B;  1P16 A;  1N9W A;  1WJJ A;  3F2C A;  4A3L G;  1L1O B;  5M3M H;  1NJI C;  2R7F A;  2HHH Q;  1L1O A;  3F2D A;  1X6O A;  4O2D A;  4ME3 A;  5M5Y H;  3HKZ E;  1KL9 A;  1WYD A;  4JI4 Q;  3I4M G;  5M5X H;  2L15 A;  5IP7 H;  2N78 A;  3GO5 A;  3LGJ A;  4AYB G;  1YJN A;  1L1O C;  1X56 A;  5EAY A;  4JI6 L;  3KJP A;  1BVS A;  4TVA B;  3CMA A;  2BH8 A;  1X9N A;  4JI0 Q;  1NBW A;  4QIW E;  1HNX Q;  1CKO A;  3WWV A;  3A5Z B;  4P73 A;  3CCM A;  3CCJ A;  4LW1 A;  2MNA A;  5M5W H;  2ZTE A;  2OTL A;  5C4X H;  1VQ6 A;  4L5Q A;  4LUV A;  2RHS B;  4X6A H;  3M3Y H;  2OWO A;  4OO1 G;  2UXD L;  1Z9F A;  3PCO B;  4OWW B;  2VQE Q;  4DAY B;  2DGY A;  4POF A;  4DV4 Q;  2OTJ A;  2JEB I;  4HJ7 A;  3UDF A;  1YHB A;  2A19 A;  4Y7N H;  1I5F A;  3J81 c;  3I4O A;  1PFS A;  1VQ8 A;  3S14 H;  1YEZ A;  2A8V A;  4K0K L;  3S16 H;  3PUZ A;  4PG3 A;  4JBJ A;  1FGU A;  1VQF A;  1JB7 A;  1PH7 A;  3STB D;  1ASZ A;  4LFB Q;  2K52 A;  4RG1 A;  1YJ9 A;  2Q2T A;  2Q2U A;  1KXL A;  3KF8 B;  4QGU A;  1X55 A;  3PUX A;  1K8G A;  2ZJR A;  3EBE A;  3ULJ A;  1SE8 A;  2C35 B;  3J81 i;  4UPA A;  3PGZ A;  2BH2 A;  1MJC A;  2Z6K A;  3RR5 A;  2NZO A;  3T1H Q;  1T9H A;  1MJE A;  2NVX H;  3S1M H;  1XPR A;  5JJI A;  4JI0 L;  4LF9 Q;  3RZO H;  5IP9 H;  1EIY B;  2K4K A;  4JG2 A;  4JOI A;  4XIG S;  5BR8 Q;  4C3H H;  1K3R A;  4DPG A;  5C4J H;  3RN5 A;  2FXQ A;  4P75 A;  1EQQ A;  1KHI A;  1G51 A;  4DAM A;  3MEF A;  4A3M G;  4O0A A;  1QZG A;  2PI2 A;  3L0O A;  4FDB A;  3BZK A;  5GQO A;  4DKA C;  4DV4 L;  1LTL A;  2PMZ E;  3DM3 A;  4JOI C;  2B63 H;  1L2F A;  3OYY A;  1PVO A;  3CPW A;  3ICE A;  4LFC L;  4R1J A;  5C3E H;  3CAM A;  3I56 A;  3S15 H;  4JI7 L;  1YIJ A;  3E0E A;  1VQI A;  4B3S L;  2HT1 A;  2MO1 A;  1A8V A;  2MO0 A;  4A3E G;  4YHH L;  3T1Y Q;  5HGQ A;  1BBU A;  4AH6 A;  1HZC A;  4DR4 Q;  1KAW A;  1CSP A;  3K80 C;  2H5X A;  4DR2 Q;  3CCR A;  1N32 L;  3S1R H;  4IFD G;  1K9M C;  3TS0 A;  2XGT A;  5GRO A;  4A3G G;  1PH1 A;  2GVA A;  3EIV A;  2JA5 G;  4DR1 Q;  5ELO A;  2ALY B;  2JA8 G;  2GN5 A;  1A0I A;  1VQK A;  4A93 G;  4X66 L;  1WFQ A;  4WJ3 M;  1KQS A;  3KOJ A;  4BY7 G;  3K8A A;  4A3K G;  3PO3 H;  4R4I A;  4R4C A;  5GAG C;  4A3I G;  5C44 H;  1XMQ Q;  1VQC A;  3CCQ A;  1Y1V G;  2ZJQ A;  1YZ6 A;  2ATW A;  1HR0 W;  2VQF Q;  1D7Q A;  4IOC A;  2EQS A;  1TWA H;  1B8A A;  1PH9 A;  4JYA L;  4LF4 L;  4B3T Q;  4A3C H;  2UUA L;  1EUJ A;  2AKW B;  2MFI A;  3G4S A;  4DR7 Q;  2D0P A;  2JEA I;  1NMG A;  4L5R C;  4ALP A;  1GVP A;  4C3I H;  1HNZ Q;  3I4M H;  1TWF H;  2NN6 I;  4NXM L;  4DR2 L;  4YY3 L;  5IYC H;  1EIF A;  1OXV A;  3M4Q A;  1K83 H;  1VQO A;  1TXY A;  2PI2 E;  4DR6 L;  1AE2 A;  4DV6 Q;  3U4V A;  4R4O A;  4R4Q A;  4GKK Q;  1Y1W G;  5C0X I;  1AH9 A;  3GTG H;  3M9B A;  4DR1 L;  3CCL A;  4L5S A;  4EQ5 A;  1OXS C;  1PH5 A;  4A76 A;  1N34 Q;  1OXT A;  1HZA A;  5AJ3 Q;  1JT8 A;  2D0O A;  4POG A;  2KHI A;  2JK8 A;  4GN5 A;  4XTC S;  4JI8 Q;  1XPU A;  4JCV E;  4IFD J;  3HOX G;  1XMQ L;  4WJ4 A;  5M3F G;  2KHJ A;  4KHP Q;  4HJ9 A;  4DR5 L;  1YJW A;  4JI5 Q;  3ER0 A;  2IT1 A;  3S2D H;  4PMW A;  1YBY A;  3S2H H;  5GAE C;  1Y14 B;  3GTK H;  1XPO A;  4B3T L;  4A3B G;  4DR7 L;  3AFP A;  3UDX A;  2OCE A;  1UEB A;  3J7Z C;  3TRE A;  3HOW H;  2JA6 G;  5LMU Q;  1SLJ A;  1XJV A;  1GD7 A;  3W1G A;  2CQO A;  2EXD A;  1FVI A;  4JBM A;  4GKK L;  1HZ9 A;  1Z47 A;  1I6H H;  1JJG A;  4QY7 A;  2HIX A;  5LMN Q;  1LUZ A;  4DUZ Q;  4BBR G;  5IYD H;  1IBL Q;  4YCV A;  1B70 B;  4BBS H;  2IX0 A;  5E7N A;  1IBK Q;  2R7Z G;  4DK3 C;  3S1N H;  4P74 A;  4YWL A;  5JJK A;  3PUW A;  1VS0 A;  3L2P A;  3IRB A;  2JJQ A;  1A63 A;  3PUY A;  2D62 A;  4JI8 L;  4OX9 Q;  3K81 C;  3H0G H;  4KI0 A;  3CC4 A;  4JI3 L;  3PV0 A;  2R93 H;  5JEA G;  1D8L A;  1VQD A;  1NE3 A;  1UE5 A;  1V9P A;  3KF6 B;  3NEN A;  1N33 Q;  2JA7 G;  3S17 H;  4LUZ A;  1VQA A;  3J80 c;  3KF6 A;  4A3J G;  1J5E Q;  1HR0 L;  3HOY G;  1NY4 A;  1PH4 A;  1Q86 C;  1K0R A;  1Q12 A;  3M4O H;  4GLA C;  5FJ8 G;  2K50 A;  2UXC L;  3I2Z A;  3HOU H;  1YIT A;  2Y0S E;  2R92 H;  2WAQ G;  4MNO A;  3STB C;  3CC7 A;  3HOV H;  4X62 Q;  1IYJ B;  2HHH L;  3K7U C;  3GD7 A;  3B6Y A;  1NMF A;  3J80 i;  4DV2 Q;  1I94 Q;  1B7Y B;  2CCZ A;  4C3J H;  4H02 A;  4Y52 H;  1E7Z A;  1TWC H;  1IBL L;  4JI4 L;  1PH3 A;  2VUM G;  3I55 A;  2R7D A;  1JJ2 A;  3HOZ H;  2R6G A;  2OQ0 A;  3PO2 G;  2KCT A;  4HJ5 A;  2KCM A;  4BY1 G;  2AHO B;  3F8T A;  1Q81 C;  2WB1 E;  3AFQ A;  4PZ6 A;  1H95 A;  4C2M H;  1N36 Q;  1VQB A;  4J15 A;  4NXN Q;  3U4Z A;  1HNX L;  1QVF A;  2QEX A;  4DUY Q;  4IO9 A;  3I4N G;  3FKI H;  2K5N A;  2A1A A;  3TQY A;  3W5O A;  4A3D G;  4HID A;  2YV5 A;  4IPG A;  4LF6 Q;  4P71 A;  1BBW A;  1VQN A;  2VQE L;  4B3R Q;  4LF8 Q;  2Z0S A;  4YCU A;  1CSQ A;  1FL0 A;  3AYH B;  5FLM G;  2YU9 H;  4BXX H;  4DV5 Q;  1W3S A;  2EIF A;  1IL2 A;  4X62 L;  4JBW A;  4HJ8 A;  3TS2 A;  5IYB H;  3H3V H;  5M3M G;  2E8G A;  3RN2 A;  1NTG A;  2AMC B;  4A3F H;  4AYB E;  3U58 A;  4LFB L;  4LF7 Q;  3RLO A;  2VY3 A;  3ULL A;  1PA6 A;  2F4V Q;  5IP7 G;  1UE1 A;  4RMF A;  1RL2 A;  1XNR Q;  3M7N A;  3T1H L;  1VQP A;  1OXX K;  2CWP A;  1Q7Y C;  4A4I A;  2GVB A;  4NB3 A;  2ZM6 Q;  4LF9 L;  4GLV B;  4UY8 C;  4UP8 A;  2VW9 A;  5BR8 L;  2VNU D;  2QA4 A;  3NBH B;  3FHW A;  2UXB Q;  3J81 j;  5C4X G;  3S24 A;  1GM5 A;  1WCM H;  1S40 A;  2E5L Q;  1LYL A;  1X3G A;  4LF6 L;  3G71 A;  2QGQ A;  3CP0 A;  4B3R L;  4GS3 A;  1U0L A;  4HIM A;  5IWA Q;  4JI1 Q;  1OTC A;  2ZJP A;  3A0J A;  4DV5 L;  1XMO Q;  4YWM A;  3I7F A;  4LFA Q;  3PUV A;  2NN6 G;  3GTO H;  2I0Q A;  4A3L H;  1SRU A;  1E1O A;  2F3I A;  2B3G A;  1C7Y A;  1VQ5 A;  2YTY A;  2F52 A;  4DNI A;  5HY6 A;  2V1C C;  3OTO Q;  4DV7 Q;  1E22 A;  4LWC A;  4UP9 A;  3UDI A;  2RF4 A;  4IJL A;  5C0X G;  3KJO A;  4GOP B;  3T1Y L;  4LF7 L;  1YHQ A;  1UWV A;  1IBM Q;  1M1K C;  4DR4 L;  5JJL A;  2AWN A;  3PIP A;  4L5T A;  4HJA A;  3K0X A;  3F2B A;  3HKZ G;  1JMC A;  3CXC A;  5LMN W;  4GOP C;  1VQJ A;  4GKJ L;  3VDY A;  3GDE A;  1SMX A;  4X64 Q;  5IP9 G;  2MQH A;  1XNQ Q;  1RIP A;  4B3M Q;  2E5L L;  2PQA B;  1YHA A;  4JI2 Q;  2K5V A;  2PQA A;  2ES2 A;  3NEM A;  1G6P A;  1A62 A;  1IXR A;  2B63 G;  2KEN A;  3FP9 A;  2VQF L;  3UE0 A;  3UDG A;  5C3E G;  4HIK A;  3OTO L;  2NZH A;  1Q82 C;  2I5H A;  4DV3 Q;  2HIV A;  2IHF A;  2Q2H A;  1IZ6 A;  1HNZ L;  3CME A;  3OW2 A;  3BJU A;  2WFW A;  3RLN A;  4BA1 I;  1TWH H;  1V1Q A;  5FLX c;  4P72 A;  4DV6 L;  2KBN A;  2N49 A;  1XTD A;  4GNX C;  3H3V I;  2HQL A;  1MKH A;  3GTP H;  1KIX A;  3Q8D A;  4BA2 I;  3KDF B;  2NVQ H;  3TEH B;  4X64 L;  1VQ4 A;  1HZB A;  1VQL A;  1SR3 A;  1OXU A;  5AJ3 L;  1N34 L;  2K14 A;  3F1Z A;  4A3M H;  2B29 A;  1X3E A;  4LNQ A;  2UXD Q;  4JC0 A;  4PZ7 A;  3NEL A;  5IT9 c;  3DLL A;  1R9T H;  1VQ9 A;  2IX1 A;  3PO3 G;  4QQB X;  3PF4 A;  5C44 G;  4KHP L;  1PH8 A;  4JI5 L;  4AIM A;  1EFW A;  1E1T A;  4K0K Q;  1G29 1;  4OON A;  3BZC A;  4A3E H;  4DV3 L;  4A3C G;  2RHQ B;  2NVT H;  5IE8 A;  1JE5 A;  3PSI A;  2IHE A;  5LMU L;  5IYC G;  3J7A 5;  3RZD H;  5K36 G;  1PH2 A;  2K75 A;  1CUK A;  4A3G H;  1YI2 A;  5GAD C;  5LMN L;  3G6E A;  4DUZ L;  4OWX B;  1EYG A;  2JA5 H;  2UUC Q;  1YVC A;  1I50 H;  2JA8 H;  4R4T A;  4QJF A;  3ZJY C;  4AQY Q;  1IBK L;  2LXK A;  1VQH A;  4IPH A;  4A93 H;  4MZ9 A;  3CC2 A;  1FJG Q;  1Q1B A;  3TRZ A;  4OX9 L;  4BY7 H;  1GKH A;  3U50 C;  4A3K H;  5DLQ E;  4A3I H;  3KFU A;  2JQO A;  1KC8 C;  3CD6 A;  1Y1V H;  4QL5 A;  1CKN B;  3A5U A;  1N33 L;  4JV5 Q;  2YTV A;  4X65 Q;  1CKN A;  1I3Q H;  2N8N A;  2VS1 A;  1J5E L;  4LFC Q;  2XTI A;  3AQQ A;  3RLF A;  4JI7 Q;  4OO1 I;  4B3S Q;  4IOA A;  2ZTC A;  1SN8 A;  3JAM c;  4JBK A;  1DGS A;  4YHH Q;  2E2J H;  2BA1 A;  3M4P A;  3CCE A;  1WOC A;  3HOW G;  3H15 A;  1UE7 A;  3KLW A;  4DK6 C;  1VQE A;  5JEA J;  1N32 Q;  4LF5 Q;  4A75 A;  2NVY H;  3SGI A;  2JA9 A;  4DV2 L;  1Y1W H;  1S3O A;  4YWK A;  1M90 C;  1I94 L;  2UUC L;  1Q1E A;  3ERS X;  1VQM A;  1YNX A;  4LF5 L;  4MTN A;  2I5M X;  3PIO A;  4OXP A;  5IYD G;  4AQY L;  3CQZ H;  3JAM i;  1ASY A;  4BBS G;  2UUB Q;  3CCV A;  4DV0 Q;  1O7I A;  2Z6K C;  4X66 Q;  1FJG L;  1HNW Q;  1J6Q A;  1AE3 A;  1VCI A;  1N36 L;  2ASB A;  3HOX H;  1E3P A;  1EWI A;  1HH2 P;  3H0G G;  4NXN L;  3HFZ B;  5M3F H;  4DR3 Q;  1S72 A;  1U5K A;  4DUY L;  1PV4 A;  2E2H H;  4IPD A;  4KHZ A;  4GN4 B;  4NPS A;  1VQ7 A;  2R93 G;  3KYH C;  4JV5 L;  4X65 L;  1KD1 C;  3CCU A;  2DUD A;  1QVG A;  1MIU A;  1P8L A;  2WAQ E;  3D0F A;  4JYA Q;  1QZH A;  4A3B H;  1QVC A;  4LF4 Q;  4LF8 L;  3S1Q H;  1X3F A;  2UUA Q;  4IPC A;  1PH6 A;  2JE6 I;  3HOU G;  2YTX A;  2I5L X;  2CFM A;  2CKZ B;  1KRS A;  4DV1 Q;  2JA6 H;  1SRO A;  3GTJ H;  4NXM Q;  2R92 G;  1WI5 A;  4YY3 Q;  3A74 A;  3HOV G;  5ELN A;  4DR6 Q;  5GAH C;  1W2B A;  3L7Z C;  3BU2 A;  3E9H A;  4BBR H;  1TWG H;  3D31 A;  4GOP A;  4KLK A;  3G48 A;  3HOZ G;  5J3B A;  1X65 A;  2PNH A;  2F4V L;  2R7Z H;  2UUB L;  4DV0 L;  1C0A A;  1UE6 A;  1XNR L;  1E24 A;  1X54 A;  2UU9 Q;  4IFD I;  2LSS A;  1CKM A;  3PF5 A;  3AEV A;  3HKS A;  2E2I H;  1HNW L;  2ZM6 L;  3GTM H;  2VL6 A;  4DR3 L;  1V43 A;  2ID0 A;  2N3S A;  3W1B A;  2UXB L;  3FKI G;  3JC6 6;  1HJP A;  3UE1 A;  4DR5 Q;  2JA7 H;  4A3J H;  3HOY H;  1L0W A;  4EX5 A;  3M85 A;  1PHJ A;  5FJ8 H;  5IWA L;  4JI1 L;  2BA0 A;  1LM0 A;  1XMO L;  4UP7 A;  4LFA L;  4DV1 L;  1GO3 E;  4BXX G;  4TQU S;  4YCW A;  1K8A C;  3CCS A;  1QUQ B;  2VZA A;  5IYB G;  1QUQ A;  4OWT B;  4GNX B;  4PZ8 A;  3ULP A;  4DV7 L;  2K5H A;  2Y0S G;  3E9I A;  4A3F G;  1Q8K A;  2Q2I A;  4IJH A;  3CF5 A;  1C9O A;  4GNX A;  4GN3 B;  1N8R C;  1EOV A;  4HIO A;  3GTL H;  2VUM H;  1IBM L;  3PO2 H;  3EN2 A;  3CPF A;  1KRT A;  2CWA A;  2RCN A;  2UU9 L;  4BY1 H;  2WP8 J;  1JJC B;  3K7A H;  4JI6 Q;  2ZTD A;  3RNU A;  5H1S E;  1PYB A;  4LUO A;  2AWO A;  4JI3 Q;  3KDF A;  1VQG A;  5C0X J;  1XNQ L;  3I4N H;  4APV A;  1BKB A;  2WB1 G;  4A3D H;  3CW2 C;  4B3M L;  1Q46 A;  1PYS B;  5IY0 A;  4GKJ Q;  1HR0 Q;  4JI2 L;  1WCM G;  1EQR A; 
#chains in the Genus database with same CATH topology
 4J9P A;  2UXC Q;  1J5E H;  3N52 A;  4RNN A;  2IP4 A;  3PO3 B;  5T14 A;  5M3M H;  4L1K A;  3F2D A;  4I4T F;  3V2T A;  4O2D A;  1XTC D;  2VB2 X;  5M5Y H;  2B2Y A;  5KFV A;  4F88 A;  5JUM A;  2PMZ A;  3I4M G;  2L15 A;  5ISR A;  3HBL A;  2N78 A;  1YJN A;  2QK4 A;  4LF5 H;  1L1O C;  3C1F A;  5EAY A;  2M00 A;  2I80 A;  3P7J A;  4QIW E;  1HNX Q;  3K5L A;  1D5Z C;  2DN8 A;  2MHV A;  2YCH A;  1F2Y A;  2ZTE A;  5C4X H;  1UC8 A;  1Q3L A;  3X3N A;  2OWO A;  2JEI A;  4ECX A;  4DAY B;  4POF A;  2D5D A;  3PIO 3;  4XYM B;  4X65 H;  1DYQ A;  4HJ7 A;  2W6Z A;  4Y7N H;  2Z1C A;  5KNC A;  4B3S H;  1O80 A;  1TR5 A;  1Y8O B;  3PUZ A;  4PG3 A;  1Y69 U;  1QB5 D;  4YIJ A;  1A9X A;  1FGU A;  4J9S A;  4RG1 A;  1YJ9 A;  2Q2U A;  2AUJ D;  3GTK B;  1SNM A;  1WH2 A;  4CC5 A;  2VA2 A;  1PRT F;  3PUX A;  3EBE A;  1V8Q A;  2C35 B;  2MJ8 A;  5EKI A;  3J81 i;  4RCN A;  2Z6K A;  1E0B A;  3RR5 A;  1DD2 A;  1T9H A;  2NVX H;  2UUB H;  4RGT A;  2GA4 B;  4JI0 L;  1PMR A;  1EYA A;  3QWN A;  4CJ1 B;  3RZO H;  1CK1 A;  5BR8 Q;  4DPG A;  5C4J H;  1EQQ A;  1DXM A;  4HR7 A;  4DAM A;  5M5X B;  4FDB A;  3L0O A;  5IT9 E;  2CW8 A;  5GQO A;  3VR5 A;  1CA6 A;  3MJF A;  2PCF B;  4JOI C;  2B63 H;  3QOL A;  3V6H A;  3ICE A;  4CKC A;  4JI7 L;  4B3S L;  1R4Q B;  4DK0 A;  2MO0 A;  2B39 A;  5HGQ A;  3T1Y Q;  1UC9 A;  1BBU A;  5KNB A;  1IOW A;  3ERQ A;  2YS6 A;  1EFI D;  3V96 A;  3TS0 A;  2FPG B;  4MTD A;  2UU9 H;  3NK9 A;  1SAP A;  4C3J B;  3CU7 A;  1O75 A;  1KQS A;  4BY7 G;  1G2S A;  1A2U A;  1EQV A;  2EZV A;  1PX2 A;  4C5B A;  4A3K G;  3BDO A;  5GAG C;  3PW4 A;  1XMQ Q;  2XWJ B;  1KJ9 A;  4O3P A;  3S1M B;  2NYZ D;  4C2M B;  4K6D A;  2SEB D;  1B8A A;  2KQ3 A;  4B3T Q;  2MP1 A;  2MFI A;  4QWE A;  2JP1 A;  1B6S A;  3BA8 A;  2Z4H A;  1TWF H;  1B3Q A;  2B2T A;  5EBD A;  1EIF A;  5K36 H;  1K83 H;  2PI2 E;  3U4V A;  4LSX A;  4GKK Q;  1Y1W G;  1AH9 A;  3ETH A;  1JKJ B;  3NBI A;  4XDX A;  4EGJ A;  1B3A A;  4L5S A;  4DXF A;  3NWS A;  4JI6 H;  4RB0 A;  2F0O A;  1HZA A;  2KHI A;  2JK8 A;  4JI8 Q;  4XTC S;  3S1R B;  2OH2 A;  4HSV A;  2FMM A;  1EYZ A;  3HOX G;  4DAV A;  5L9X A;  2R3Z A;  5M3F G;  2FK1 A;  2AU0 A;  3VPB A;  4HJ9 A;  4QCL A;  2IT1 A;  4FM9 A;  2EY1 A;  2F4I A;  3S2D H;  4PMW A;  1YBY A;  3S2H H;  2J7Z A;  4A3B G;  3NTI A;  4ZCK A;  4FP5 D;  5LXT F;  1WCM B;  2KJX A;  5JAV A;  3E3X A;  5C44 B;  5LMU Q;  3GTO B;  2CQO A;  2F0K A;  4JI4 H;  2TSS A;  5C5L A;  1JJG A;  1LUZ A;  2MGS A;  5IYD H;  1IBL Q;  5ELF A;  5KFP A;  3L4K A;  1MI2 A;  2IX0 A;  5E7N A;  1UNS A;  4BBS H;  3TDQ A;  3BJY A;  2ZXO A;  4C56 C;  2B2U A;  2A5H A;  4Q0F A;  1RHP A;  3I4M B;  4DL3 A;  2HJW A;  2LKV A;  3PUY A;  5CC4 A;  1TS5 A;  1UUP A;  2H4O A;  4AYB A;  4DGZ A;  3CC4 A;  2R93 H;  2NU9 B;  4XXE A;  3K3P A;  3S17 H;  2ASD A;  1A2T A;  1S68 A;  1K0R A;  3MWE A;  4ILW A;  2XNA C;  1S03 G;  3ORQ A;  3I2Z A;  2A68 D;  2Y0S E;  2R92 H;  3H91 A;  1TAE A;  4DL5 A;  4X62 Q;  1IYJ B;  4LFB H;  2VPS A;  3GD7 A;  1XXG A;  1EU3 A;  4UCS A;  1S10 A;  4RB2 C;  1I94 Q;  1B7Y B;  4RUA A;  4H02 A;  3SEB A;  1K0S A;  4JI4 L;  5FK9 C;  1PH3 A;  2R7D A;  1FNV A;  2D2C C;  3T1H H;  2L1B A;  3GIK A;  4LF9 H;  3F8T A;  1GUO A;  4EFB A;  2OT2 A;  4J15 A;  4X66 H;  2WYO A;  4V0B A;  4DUY Q;  3GTP B;  1HHV A;  5KFS A;  3MHB A;  2AGO A;  5FD6 A;  4ETS A;  1CTM A;  1EY6 A;  4LF6 Q;  5DLG A;  1VQN A;  2VA3 A;  4DL4 A;  3AYH B;  1UAP A;  4UDU C;  2IWH A;  4QF4 A;  3WOF A;  4DV5 Q;  2PBZ A;  3FMA A;  3H0G B;  4F4Z A;  4WRD A;  3TS2 A;  1IKL A;  3IG0 A;  3H3V H;  5M3M G;  3RN2 A;  3QB3 A;  1NAP A;  4RH6 A;  4U68 A;  1IKM A;  1QE6 A;  4LFB L;  4LF7 Q;  3RLO A;  3KK7 A;  1GUN A;  4R7R A;  4O4H F;  1RL2 A;  3MR2 A;  2DWC A;  3T1H L;  3G8C A;  4M9U A;  1OXX K;  2FMA A;  4A4I A;  4NB3 A;  4DN4 M;  4LF9 L;  2VW9 A;  3N40 P;  1KTK A;  5D3I B;  5EJW A;  2VNU D;  4N8F A;  3QOJ A;  5JVD F;  3J81 j;  1D6E C;  2A6H C;  5C4X G;  2E5L Q;  1GM5 A;  1A3V A;  4TKO B;  5JVL A;  1I50 A;  2JA5 A;  3G71 A;  3CP0 A;  5IGC A;  2VQF H;  1U0L A;  3A8I E;  2AQ2 B;  4JI1 Q;  3QO2 A;  3K5M A;  4Q43 A;  4YWM A;  3I7F A;  1WTR A;  1G2T A;  3J81 E;  2I0Q A;  1SBB B;  1SRU A;  2F3I A;  4DR7 H;  2DPJ A;  1FGB D;  4PDB A;  5HY6 A;  2CQY A;  5E3F A;  2K5Q A;  1E22 A;  4IJL A;  1KDA A;  1H9K A;  4RWS C;  1BGW A;  1IBM Q;  5JJL A;  1BO0 A;  4QW9 A;  3PIP A;  3DWP A;  2E2J B;  2NUC A;  4KY6 A;  1AN8 A;  3CXC A;  5LMN W;  1CI3 M;  3HB9 A;  3MAQ A;  3GDE A;  1SMX A;  1N34 H;  2CW0 D;  1Y1W B;  1E4G T;  3ETJ A;  1LTG D;  2EDG A;  2MQH A;  5EDW A;  3ORR A;  5DG7 A;  4B3M Q;  2B8F A;  2ZXP A;  5FO8 B;  4I7Z C;  3VR3 A;  1YHA A;  2ES2 A;  3NEM A;  1G6P A;  5KKN B;  4U6P A;  1DZ1 A;  2B63 G;  1HR0 H;  3FP9 A;  2VQF L;  3HOX B;  4OEM B;  5M3F B;  4E4T A;  5KFM A;  3I70 A;  4HIK A;  1H9S A;  1MBY A;  4O4L F;  5F9L A;  1LT4 D;  1PZJ D;  2I5H A;  2IHF A;  3K58 A;  3CME A;  4A3B B;  3BJU A;  2UVV A;  4MA5 A;  1KC7 A;  3RIZ A;  4BA1 I;  2VPQ A;  2N49 A;  4GNX C;  4R8I A;  1IBK H;  1MKH A;  3Q8D A;  3RD4 A;  3J7A V;  4G4K A;  2IL8 A;  2NVQ H;  3TEH B;  1X32 A;  3HXL A;  2EYM A;  1N34 L;  5AJ3 L;  3SVM A;  4A3M H;  4LNQ A;  2Q8R E;  4JC0 A;  3DWQ A;  3NEL A;  5IT9 c;  2IX1 A;  1GUT A;  3PF4 A;  4HNV A;  2O03 A;  3VMM A;  5C5J A;  5DGA A;  4B9X A;  2LMC B;  2A68 C;  2Z4I A;  2J0T D;  1G29 1;  4EGV A;  3BZC A;  3SE0 A;  1ESR A;  2P5Z X;  2RHQ B;  1EY5 A;  2MCT A;  3OSP A;  1T36 A;  2KUM A;  4MV1 A;  1RJT A;  3PSI A;  4FYD A;  2IHE A;  1JX4 A;  5CYU A;  3RZD H;  5K36 G;  1PH2 A;  4JV0 A;  5J2U F;  2K75 A;  1CUK A;  4A3G H;  1AP0 A;  2B2Y C;  1YI2 A;  4LF5 Q;  2NU6 B;  1HRJ A;  2JA8 H;  1IBK L;  5FO9 B;  3KLS A;  2LY7 A;  4MZ9 A;  3O13 A;  1TWH B;  1ZQ7 A;  1KC8 C;  5KFD A;  1O7L A;  4B3R H;  1STH A;  2V59 A;  2HUG A;  4X65 Q;  1CKN A;  1I3Q H;  1H9J A;  2XTI A;  4JI7 Q;  1BF4 A;  4B3S Q;  1JOK A;  1GSH A;  1R9T B;  1L0X B;  1S5D D;  2BQR A;  1F9R A;  4ED3 A;  2J6T A;  3SGI A;  5JPM C;  1M90 C;  4YWK A;  2F4V H;  1VQM A;  3BQ1 A;  3PW0 A;  2F0Q A;  3PIO A;  4OXP A;  1JB3 A;  5AFW A;  5IYD G;  1ASY A;  3CQZ H;  1KEE A;  3KAL A;  4BBS G;  3RAQ A;  2UUB Q;  2Z6K C;  4MV3 A;  1FJG L;  2W9B A;  4RB3 C;  3MC0 B;  2C00 A;  4MAM A;  1J6Q A;  1A3T A;  3MXG A;  4KK7 A;  4ZKC B;  4ECV A;  1S72 A;  3EPI A;  4NXN L;  1W96 A;  4Q8F A;  2UXB H;  1U4L A;  1PV4 A;  2R93 G;  1X3Q A;  4KHZ A;  1I6V C;  4C5A A;  2L9H A;  1CZG A;  1B2T A;  2F3W A;  4LMY A;  2K04 A;  5IWA H;  2YYA A;  5KIX A;  1F9S A;  2WAQ E;  1XMO H;  5COR A;  2VR1 A;  3QG1 A;  1VBH A;  4TV8 F;  4IPC A;  5KFC A;  2F0V A;  2I5L X;  5DAU A;  1I4X A;  3OTO H;  2R92 G;  2XCL A;  4M1U B;  5C5M A;  3GTJ H;  4LMQ D;  1KDC A;  3D6W A;  3RV4 A;  4Y7N B;  1Y1V A;  5KG4 A;  3D31 A;  5KYI A;  3G7L A;  4GOP A;  3G48 A;  4JV2 A;  2F4V L;  2R7Z H;  3UFX B;  3D8G A;  3VYU A;  2UU9 Q;  2CW0 C;  2ZM6 L;  3I90 A;  1XNQ H;  1BBX C;  1LTB D;  2ID0 A;  1I4Q A;  2UXB L;  3MFG A;  3JC6 6;  4O3O A;  1HJP A;  1D1K A;  4A3J H;  3RZO B;  3E6Z X;  1DV2 A;  3M85 A;  4FF2 A;  1FKA H;  1GHJ A;  5FJ8 H;  5IWA L;  1EY0 A;  2BA0 A;  2F0D A;  1XMO L;  4UP7 A;  1GO3 E;  4TQU S;  2PNR C;  1B44 D;  1QUQ B;  4XQQ A;  2CQA A;  2VZA A;  2B63 B;  1WTH A;  4UFZ A;  2Y0S G;  2PW5 A;  3M4O H;  4IJH A;  1ET6 A;  1C9O A;  1HQM C;  1EOV A;  2V4D A;  4HIO A;  3CPF A;  2B2T C;  1KRT A;  4XT1 B;  3P1H A;  2L12 A;  1ENC A;  1BCP B;  4JI6 Q;  1S0O A;  1HUN A;  1JOQ A;  4U7C A;  2QF7 A;  1XNQ L;  3I4L A;  4JK1 C;  3VYT A;  4BBR B;  1TWG B;  4KV6 A;  4KN4 C;  4M8A A;  5DEH A;  4CDC C;  2L0C A;  5E1F A;  1DOL A;  2PZW A;  4JPB W;  3R8B A;  3DHQ A;  2E74 C;  2E2I B;  1ZHQ A;  3G6Y A;  2ASL A;  1I4P A;  1EUD B;  2OQK A;  2YYZ A;  2LXJ A;  1WJJ A;  1N9W A;  1L1O B;  2ENB A;  3IFD A;  4MV7 A;  2AGQ A;  2RCF A;  1X6O A;  2JA7 B;  3RF2 A;  5IGD A;  4EYI B;  4XYL B;  3F2U A;  1JLL B;  1WYD A;  4JI4 Q;  2AGP A;  4XX0 B;  3GII A;  1I94 H;  1EEF D;  1ICW A;  2EJF C;  3P20 A;  2KOL A;  1TWF B;  4AQY H;  1SYB A;  2NZ1 D;  5I9O A;  3KJP A;  4KKT A;  3K5N A;  1X9N A;  5D1P A;  3MWY W;  1CKO A;  4ZUJ A;  3A5Z B;  2B2U C;  1WR2 A;  2IA6 A;  4LW1 A;  2OTL A;  1VQ6 A;  4GKJ L;  1WTV A;  2VUM B;  4X6A H;  4LUV A;  2RHS B;  1W93 A;  2KHS A;  2RVL A;  3I8Z A;  3PCO B;  4NDX A;  4JV5 H;  2YZN A;  1O78 A;  4J8Q A;  3UDF A;  1YHB A;  2NN6 H;  2ASJ A;  1PRT D;  2W6P A;  3I91 A;  3J81 c;  2YRW A;  5KFL A;  3HGB A;  3S16 H;  2SNS A;  2QEJ C;  5C0X H;  1WTQ A;  3JAM L;  3S2D B;  1U9R A;  4LFB Q;  3S2H B;  2K52 A;  2Q2T A;  4F4X A;  4IAL A;  4F87 A;  2FLL A;  5F9N A;  4QGU A;  3GTK A;  3LNN A;  3T16 A;  1S0M A;  2C2D A;  3WO1 A;  1MJC A;  4MA0 A;  3K57 A;  3V4Z A;  2NZO A;  3GTQ A;  3T1H Q;  2K01 A;  1X3P A;  1MJE A;  5D1O B;  2W7P A;  4DV0 H;  4ME5 A;  1JC7 A;  3MR6 A;  4LF9 Q;  5KFQ A;  5IP9 H;  4XIG S;  1CQJ B;  1K3R A;  3RN5 A;  4TQR A;  1KHI A;  4DR3 H;  3MEF A;  4A3M G;  4O0A A;  4BBS B;  1RYR A;  1EYD A;  1EIG A;  5I6Y A;  4TUY F;  2JXM B;  1MGS A;  4DV4 L;  1LTL A;  3DM3 A;  1L2F A;  4J9M A;  4ZUI A;  2F0G A;  3NQT A;  1PVO A;  3BAB A;  3I56 A;  4R1J A;  2ZDG A;  2UUA H;  2R93 B;  1M0T A;  5KG6 A;  1GYF A;  2FKL A;  3GQC A;  2HT1 A;  1STN A;  2MO1 A;  3DMU A;  4HTH A;  1VMC A;  4ECS A;  2NU8 B;  2JYO A;  2XSC A;  5JQW A;  1HZC A;  2HCI A;  3SR1 A;  1KAW A;  3CCR A;  5KRU A;  1K9M C;  4MIU A;  4HMI A;  3BVM A;  2R92 B;  2XGT A;  4A3G G;  3TBI B;  2BOS A;  1PH1 A;  2OEO A;  3S14 B;  3EIV A;  1EHI A;  4FNF A;  1PTO D;  2JA8 G;  5M9O A;  3JRX A;  3H40 A;  3VYR A;  2DY7 A;  2Q8T A;  3MFH A;  2Z8L A;  1HPC A;  3VA5 A;  4DU9 A;  4O2A F;  4R4I A;  2R8J A;  1VQC A;  2ALZ A;  2KA7 A;  2XN9 C;  2VQF Q;  4IOC A;  4C2M A;  2EY5 A;  4EGQ A;  2R84 A;  2EQS A;  1TWA H;  4CC6 A;  1PH9 A;  4A3C H;  2UUA L;  4IRK A;  4DR7 Q;  2OLS A;  1NMG A;  2SOB A;  3NHH A;  5D3D A;  3Q8R B;  2F1M A;  4DR2 L;  1JWS D;  1OXV A;  1EZ1 A;  4EEQ A;  3JAM W;  2YS7 A;  3QIA A;  4R4Q A;  2GLT A;  2Z6B A;  3FEW X;  2R8G A;  4J9N A;  2K03 A;  4DR1 L;  1QNK A;  2Y0S B;  3KLR A;  1PH5 A;  3R2T A;  4TQS A;  3BDC A;  2W7O A;  1N34 Q;  5AJ3 Q;  1JT8 A;  2D0O A;  4POG A;  5E4W C;  4LH6 A;  5LL6 S;  4A2A A;  4GN5 A;  1XPU A;  2JN4 A;  4JCV E;  3OHA A;  1B53 A;  2KHJ A;  4KTA A;  1YJW A;  5BPF A;  1SXT A;  2F0M A;  5GAE C;  3AFP A;  3UDX A;  3MFI A;  1UEB A;  3J7Z C;  1G91 A;  1TA8 A;  1AEX A;  3TRE A;  3HOW H;  1B4O A;  1WCM A;  2W6O A;  2N55 A;  3JRW A;  4R8U A;  4RZQ A;  1EY4 A;  2V4Q A;  1FVI A;  4JBM A;  3PMF A;  3GTO A;  4ED8 A;  1Z47 A;  2K28 A;  4QY7 A;  5KT6 A;  2K32 A;  4L6T B;  1IBK Q;  2R7Z G;  4DK3 C;  4YWL A;  4EQO A;  4HNU A;  4JI0 H;  1VS0 A;  3KAJ A;  2JJQ A;  4O3Q A;  1A63 A;  1V51 A;  2D62 A;  4KI0 A;  4FVM A;  3URY A;  1UE5 A;  3GTG B;  5JVG 3;  3RB0 A;  2FIN B;  3KF6 B;  5DQH A;  2VQE H;  4LUZ A;  4A3J G;  2W8L A;  1PRT C;  3N44 B;  1Q86 C;  1Q12 A;  4EQN A;  5FJ8 G;  3MXP A;  4DLK A;  3JZI A;  4JI7 H;  3SDZ A;  2WAQ G;  1BCP F;  4MNO A;  3HOV H;  2HVQ A;  3ZYY X;  4RNM A;  3K7U C;  1Q90 A;  1NMF A;  5EKK A;  1IYU A;  1JQY D;  4IUV A;  1E7Z A;  1FNU A;  1TWC H;  4CJ0 B;  3I55 A;  1JJ2 A;  5LL6 b;  3EFX D;  4HJ5 A;  2HDM A;  2KCM A;  4RGN A;  1E4E B;  1SJH D;  1KJJ A;  4IN3 A;  2FHT A;  1VQB A;  4NXN Q;  1QVF A;  2QEX A;  2F0F A;  1RDP D;  2C9O A;  2A1A A;  2NVQ B;  2BQU A;  2YV5 A;  3OOC A;  4B3R Q;  2VQE L;  2CH4 W;  2Z0S A;  4A3M B;  1FL0 A;  2YU9 H;  4BXX H;  1FD7 D;  1B6R A;  1BNC A;  1BUV T;  1IL2 A;  4EEY A;  3H0G A;  1RJR A;  2E8G A;  2AMC B;  4A3F H;  2K6A A;  2NTS A;  4X3K A;  1SE4 A;  2FLN A;  2F0S A;  1PA6 A;  3DF7 A;  2F4V Q;  4J9O A;  1UE1 A;  4RMF A;  1Z2P X;  3M7N A;  1PTO C;  3G6V A;  2CWP A;  1LLR D;  5EGT A;  2ZM6 Q;  1RTN A;  3GV8 B;  4GLV B;  4EBC A;  1Y8P B;  3NBH B;  5KFJ A;  1KJI A;  2UXB Q;  2JA8 B;  1JCK B;  1S40 A;  1LYL A;  5FPR A;  1JR0 D;  4HIM A;  1L0Y B;  5IWA Q;  5KYL A;  1OTC A;  5KFA A;  2ZJP A;  3A0J A;  1LTS D;  1PTO F;  1XMO Q;  2NN6 G;  2B3G A;  1EZ6 A;  3FMC A;  3NSW A;  3R93 A;  3Q0A A;  2V1C C;  3OTO Q;  2EY2 A;  4UP9 A;  5C0X G;  3FKI A;  4L63 B;  3UDI A;  1I3Q B;  3KJO A;  5KFT A;  1UWV A;  2A74 C;  1M1K C;  3M9M B;  2PQE A;  1SNQ A;  2FMC A;  4DV6 H;  1LAC A;  2FJ2 A;  3F2B A;  5L1I A;  5KFR A;  1CFM A;  4YR2 A;  1CHQ D;  5KEE A;  1T94 A;  3Q2O A;  4GOP C;  3FPU B;  3IAY A;  5IP9 G;  1XNQ Q;  1J9O A;  1JE4 A;  3E0J A;  2RSN A;  4CHT B;  1RIP A;  4ZAI A;  4KKS A;  3HG9 A;  4CGY B;  2J6U A;  3DEP A;  2RDJ A;  1SYC A;  3UDG A;  1T3N A;  5EWE A;  3IFT A;  4IZ8 A;  2WB1 B;  2NZH A;  3I73 A;  4C1N K;  2HVR A;  3T13 A;  3RUP A;  4F4Y A;  1LTA D;  4UAI A;  1LT6 D;  2WFW A;  2CH4 A;  1BXR A;  3RGX A;  3LX0 A;  5LMN H;  1V1Q A;  4DV6 L;  3H3V I;  1JIC A;  2KBN A;  1OWT A;  1XTD A;  4GC6 A;  1EQT A;  3GTJ B;  5BN4 A;  1LT3 D;  3KDF B;  4X64 L;  2F0E A;  5C1O A;  4OX9 H;  5IOD A;  1VQL A;  1SR3 A;  2K14 A;  5LHY 1;  2R7Z B;  1X3E A;  2J4X A;  3DLL A;  2M9V A;  1K8M A;  1E4F T;  3K59 A;  1XWE A;  3M4I A;  3H4B A;  4AIM A;  4NKL A;  3OUU A;  3GIQ A;  4QWD A;  3J80 L;  3IL8 A;  1ILQ A;  4OON A;  2F0L A;  5EBC A;  4A3C G;  4DV3 L;  4ZRZ A;  2N88 A;  4N9T A;  4A3J B;  2NVT H;  3OHX C;  5IE8 A;  4GC7 A;  1JDE A;  2QW7 A;  4DV2 H;  3T51 B;  2WAQ B;  2WAC A;  5GAD C;  5LMN L;  1QWY A;  4OWX B;  1WTP A;  1KJQ A;  1YVC A;  4R4T A;  3ZJY C;  4AQY Q;  3IKJ A;  1NR4 A;  2LXK A;  3SK8 A;  3M4O B;  4O2B F;  2ICI A;  3KLS X;  1LT5 D;  1Q1B A;  2ZT9 C;  4OX9 L;  4J9Q A;  4OEL B;  3QZ8 A;  1TVX A;  3KFU A;  5KFW A;  1TWH A;  1Y1V H;  2JEJ A;  4X3U A;  4HYK A;  1HFN A;  4JV5 Q;  4ECZ A;  5HUR A;  2V58 A;  2VS1 A;  4ZK9 B;  3C1E A;  2DNE A;  3TP6 A;  3TQ1 A;  5DQI A;  1MZB A;  1D2B A;  5CAE B;  3EQL C;  2XRQ D;  2BA1 A;  1ONL A;  1IHZ A;  3HOW G;  1R9T A;  2VXW A;  5CB4 F;  2NVY H;  2JA9 A;  4DV2 L;  3AMU A;  2I8C A;  4LSA A;  3N6R A;  2UUC L;  1YNX A;  5L37 A;  4MTN A;  2I5M X;  2ZJT A;  1XNR H;  5IGG A;  4DK1 A;  3JAM i;  5JJZ A;  4XT3 B;  3CCV A;  4DV0 Q;  5A2Q W;  4V19 0;  1SYE A;  1CT1 D;  4RNO A;  1FR3 A;  3N41 B;  2ASB A;  1EWI A;  1ZYR D;  4I55 F;  1GGO A;  4DR3 Q;  3CRL C;  1U5K A;  2JSO A;  3H20 A;  4IPD A;  4NPS A;  4GN4 B;  1Z2N X;  3CCU A;  2DUD A;  5J1Z A;  1QVG A;  1P8L A;  4NP5 A;  3FDS A;  3S1Q H;  5IYZ F;  2UUA Q;  4RAU C;  4LK1 C;  4KKU A;  4BY7 B;  1TKW B;  3J7A 5;  4A3K B;  1XDN A;  2JA6 H;  3J80 W;  2F0I A;  4HED A;  5EPL A;  3Q8Q B;  4DV7 H;  3A74 A;  5I6W A;  3HOV G;  2F0H A;  3L7Z C;  3OMC A;  4XYO A;  1RK6 A;  4MTE A;  3GIL A;  2UVR A;  3NUC A;  5EPJ A;  2M2L A;  5C4Z A;  3S16 B;  4RAY A;  2EOT A;  5I2Y A;  5KG1 A;  2R6F A;  1XNR L;  1X54 A;  2LSS A;  5KFO A;  1HNW L;  3DEO A;  2F0U A;  3GTM H;  4PMC A;  5JEA H;  1B33 N;  4DL6 A;  3K5O A;  3PQI A;  2N3S A;  3E5S A;  4KN7 C;  3K3V A;  3SK5 A;  3RUZ A;  1I4G A;  5D8D A;  2OF1 A;  3RBD A;  4J6H A;  4DV1 L;  4BXX G;  4YCW A;  3ITP A;  3T5J A;  2F0N A;  1QUQ A;  4OWT B;  3MZ5 A;  3PR4 A;  2RKS A;  4PZ8 A;  4DV7 L;  3E9I A;  4A3F G;  1MSH A;  2Q2I A;  1VF5 C;  2KCC A;  3CF5 A;  5JH7 F;  3A54 A;  1N8R C;  5KFB A;  1YNN D;  3BVG A;  4J9L A;  4PQX A;  4BY1 H;  3KBG A;  1SE2 A;  2AQ3 B;  1F9P A;  4YR0 A;  1JJC B;  3K7A H;  2ZTD A;  3RNU A;  5H1S E;  1PYB A;  4LUO A;  4H0L C;  2AWO A;  1K8O A;  3I4N H;  2K05 A;  5DM6 3;  3BZD B;  3CW2 C;  5BN5 A;  1Q46 A;  1PYW D;  1TWG A;  1BXT A;  1O7Y A;  5FLM H;  1JOR A;  2I07 B;  2L4N A;  3GTQ H;  3MXN B;  3NQI A;  4K0K H;  1SFO H;  1K73 C;  2E2I A;  1P16 A;  2PZT A;  1MSG A;  1PDQ A;  1SND A;  2R7F A;  4LJZ C;  2O5J C;  1L1O A;  1QCB D;  2KCN A;  3NTK A;  4BS9 A;  2JA7 A;  1U4R A;  1KL9 A;  3DWA A;  1TWA B;  1AZQ A;  5M5X H;  1S5E D;  3D6C A;  3LGJ A;  4RGM A;  5DLF A;  3E5N A;  5J2T F;  1X56 A;  2FE3 A;  1TWF A;  2RBM A;  2PO4 A;  1BVS A;  4TVA B;  3CMA A;  4JI0 Q;  1HA6 A;  1IOV A;  4UCT A;  1FJG H;  2HVS A;  3G6X A;  3WWV A;  5IGE A;  4P73 A;  3CCJ A;  4WJW A;  4IRC A;  5M5W H;  3VPC A;  4NXN H;  4HAE A;  4L5Q A;  2W9C B;  1DIK A;  1SCU B;  3GTL A;  4QUF A;  2VUM A;  1Z9F A;  1I7N A;  1ZKO A;  2PN1 A;  2VQE Q;  1HCZ A;  3C2P A;  1ULZ A;  4LFC H;  2OTJ A;  2JEB I;  2A19 A;  1VMP A;  1I5F A;  1J8I A;  1PFS A;  1V4Y A;  4QWB A;  4IUT A;  4O3R A;  1BDO A;  4K0K L;  1BR9 A;  1D5X C;  3J7A F;  4BWG B;  3AU7 A;  4FU0 A;  1ASZ A;  5KT5 A;  2DPI A;  1N32 H;  3KF8 B;  4PNY A;  5JVH 3;  1X55 A;  4WBN F;  3I3C A;  1WD0 A;  2ZJR A;  3EYY A;  2BH2 A;  1SE8 A;  2E2H A;  3T56 B;  3PGZ A;  2SNM A;  1H9M A;  5DQG A;  3HOW B;  4C5C A;  1F2M A;  3D4D A;  3VR6 A;  5EPK A;  3K6O A;  3L9A X;  5M3M B;  1XPR A;  4RCO A;  3S1M H;  5JJI A;  1BOS A;  2P0A A;  5D1O A;  4IUQ A;  4RFB A;  4DNT B;  1EIY B;  4JOI A;  2GPS A;  5FLX W;  5M5Y B;  2ZM6 H;  1ZYR C;  4IWY A;  2XIW A;  1CQI B;  4P75 A;  5CV6 A;  1IYV A;  1QIL A;  2PI2 A;  4Q44 A;  4NMZ A;  4DKA C;  2PMZ E;  4OIK A;  4IUN A;  3QR8 A;  4JYA H;  2B2V A;  1PLF A;  1CM9 A;  4LFC L;  3S15 H;  3CAM A;  4I7H A;  1YIJ A;  3E0E A;  2R93 A;  3PW2 A;  3KBX A;  3TME A;  2R7K A;  4G3I A;  2KVM A;  4PV1 C;  3T53 B;  5C4X B;  1RK5 A;  4NXM H;  3I12 A;  4DR6 H;  1CSP A;  1N32 L;  3S1R H;  1I4H A;  5TSS A;  3C0F B;  5GRO A;  3HOV B;  3LML A;  2R92 A;  2GVA A;  4HNT A;  4J9R A;  5ELO A;  2ALY B;  1A0I A;  3BQ0 A;  1DCZ A;  1VQK A;  1TWC B;  2HD3 A;  2F0P A;  5LOV F;  4JW0 A;  3KOJ A;  2FLP A;  3VR4 A;  3K8A A;  4CKE A;  4G57 A;  4DR5 H;  4R4C A;  5C44 H;  3HKZ A;  3CCQ A;  3OPO A;  1Y1V G;  2NVX B;  1RJP A;  1LTT D;  1YZ6 A;  1HR0 W;  1G6Z A;  2O4X A;  4ED7 A;  4JYA L;  2EPB A;  5C4J B;  1EUJ A;  4B08 A;  3G4S A;  2D0P A;  3JAM E;  4L5R C;  4QIW B;  1YNJ D;  2RDH A;  4KJO A;  4C3I H;  1GHK A;  2FPP B;  3I4M H;  5CV5 A;  2NN6 I;  4NXM L;  2RDI A;  4TV9 F;  4XYQ A;  3HEJ A;  4MHE A;  1YNN C;  1TXY A;  2YU9 B;  4DR6 L;  1AE2 A;  4DV6 Q;  3KHL A;  2EYP A;  1SNP A;  4R4O A;  4GZY C;  1GLV A;  5C0X I;  5KFX A;  2ICE C;  4A3F B;  4FXD A;  3TP7 A;  1CHP D;  4A76 A;  4J0M A;  1OXT A;  5D65 A;  5IOC A;  4CKB A;  5KT4 A;  4JI3 H;  4DFA A;  1N56 A;  4ID6 A;  3TN2 A;  2CZG A;  1LO5 D;  1XMQ L;  4GKJ H;  1ICF B;  1CS0 A;  1ESF A;  1HFG A;  4DR5 L;  4K8J A;  3CHB D;  3L3O C;  2LFN A;  4N9P A;  4DXG A;  3SI8 A;  3V6K A;  1XPO A;  4B3T L;  4RHS A;  3D4R A;  2YZG A;  2HHH H;  2FK3 A;  2JA6 G;  3MXU A;  2QDL A;  3MR5 A;  2EXD A;  5D14 A;  4GKK L;  3KHH A;  1I6H H;  5K5P A;  1DOK A;  2HIX A;  3HZX A;  5LMN Q;  4HQ6 A;  1B70 B;  3S1N H;  4P74 A;  4YAK B;  4IRD A;  3RV3 A;  5JJK A;  3PUW A;  4RA8 A;  3IRB A;  1LTI D;  1PRT B;  2K33 A;  4JI8 L;  4OX9 Q;  4G7H C;  3K81 C;  3H0G H;  5KG7 A;  1K83 B;  1WVL A;  4ECR A;  4YR3 A;  2I46 A;  4JI3 L;  3PV0 A;  5JEA G;  1D8L A;  1VQD A;  1BCP D;  3UQ8 A;  1F77 A;  1V9P A;  4UCU A;  2K7V A;  3GTG A;  4DV4 H;  3KF6 A;  2XGP A;  2BR0 A;  1NY4 A;  1PH4 A;  2J9G A;  2EYL A;  4GLA C;  2K50 A;  4EVO A;  2PVP A;  3MWD A;  3HOU H;  4DAY A;  3T5L A;  1S0N A;  3CC7 A;  4K6L A;  4KMU C;  1E2Z A;  1CQF A;  1OO9 B;  2K5D A;  2HHH L;  3F8N A;  3Q6S A;  3B6Y A;  3J80 i;  4DV2 Q;  3N42 B;  1V1P B;  2QDB A;  2CCZ A;  5CV7 A;  5KFU A;  2R86 A;  2VQD A;  4QUC A;  1IBL L;  3HOZ H;  2R6G A;  2OQ0 A;  1ILP A;  2KCT A;  4JUZ A;  2F0W A;  2YW2 A;  4BY1 G;  5EQ0 A;  1Q81 C;  5BMV F;  3AFQ A;  4PZ6 A;  5C6A A;  1H95 A;  1E4E A;  2C28 A;  3OHB A;  1STE A;  3TZU A;  3FDT A;  4IO9 A;  3I4N G;  2HGS A;  4Q0Y A;  3FKI H;  2K5N A;  2CVR A;  1Z6H A;  4HID A;  4YJ2 F;  3MR3 A;  4IPG A;  1VAJ A;  4P71 A;  3Q8S B;  5CV4 A;  3LWB A;  4C1N I;  4WOR A;  4YCU A;  1EY8 A;  5FLM G;  3GIP A;  5F2D A;  2A69 D;  4KD3 A;  4X62 L;  4JBW A;  3GLK A;  1NSN S;  2WDT A;  4O4I F;  1TY0 A;  1NTG A;  3Q22 A;  4AYB E;  4RKL A;  1XYI A;  1ROD A;  3S17 B;  1ET9 A;  1EL0 A;  4DR2 H;  4DR4 H;  1Q8I A;  1MHW C;  2W6N A;  5KGU A;  3BG5 A;  5HBR B;  3ULL A;  2KSW A;  4K5X A;  2NVT B;  3OIQ A;  5IIF A;  1XNR Q;  4DNR B;  4ZI7 F;  3M7G A;  1PZK D;  4DR1 H;  4UY8 C;  3ND9 A;  2QA4 A;  4FBT A;  1GJX A;  2KEC A;  4LF6 L;  2E2D C;  4GS3 A;  4TSS A;  5C4H A;  5IGF A;  2DZD A;  2AUK A;  2EJM A;  4DV5 L;  3NPP A;  2YL2 A;  4A3L H;  1H9R A;  4YP3 A;  4K8I A;  1YNJ C;  4EG0 A;  1Y1V B;  2F52 A;  4DNI A;  3U9O A;  3AB9 A;  4DV7 Q;  4EBD A;  1EWC A;  1LTR D;  3IN5 A;  4GOP B;  4LF7 L;  1I3Q A;  4DR4 L;  1V1O A;  2AWN A;  4DA2 A;  1RF2 D;  4L5T A;  5FKA C;  3K0X A;  4H44 C;  1JMC A;  4KY5 A;  4FBU A;  3J7A K;  3A56 A;  2KEE A;  3N6X A;  1VQJ A;  2FFK B;  2G9H D;  2NVY B;  1K1Q A;  5KFN A;  1TS4 A;  4M7E A;  1WTW A;  1O7Z A;  2PQA B;  2E5L L;  4OO1 H;  4J9K A;  4KHP H;  3KAK A;  1W6K A;  1EU4 A;  4JI5 H;  1A62 A;  1IXR A;  1SNC A;  2R82 A;  4FF4 A;  1C48 A;  3BAA A;  4APM A;  2X0S A;  4G7O C;  1AFP A;  4TRD A;  2C5C A;  2UVW A;  3KHG A;  4PWQ A;  4ECW A;  1LV9 A;  2WB1 A;  2RSO A;  2HIV A;  1HNZ L;  1VKZ A;  1IZ6 A;  3GIJ A;  5DNF A;  4ECU A;  1SYD A;  3OW2 A;  3LWU A;  2YZM A;  1SYG A;  4DUZ H;  1TWH H;  1FYC A;  4QMG A;  2JA6 B;  1SE3 A;  4RAZ A;  4IQZ A;  4H7B A;  2R8K A;  3GTJ A;  2YRX A;  3TIG A;  5EWG A;  4RGO S;  1K28 A;  1OXU A;  4UCR A;  2WE6 A;  2PYK A;  3R5H A;  1BCP C;  1R9T H;  1VQ9 A;  2R7Z A;  4IAJ A;  1N33 H;  3CVZ A;  4QQB X;  5C44 G;  4KHP L;  4JI5 L;  3GTM B;  2FJZ A;  5JPN C;  1KAA A;  4UCV A;  4K0K Q;  1SSO A;  4A3E H;  5GON F;  3PVX A;  5L1K A;  2K1B A;  4C3I G;  5DM7 3;  4IFD H;  1TU2 B;  3A8K E;  1D5M C;  3ONA B;  3GV5 B;  3GV7 B;  2JEF A;  4KJN A;  4L8J A;  3N8D A;  2BQ3 A;  2WAQ A;  1EUC B;  3EA6 A;  4DUZ L;  5JOB A;  4B9W A;  1EYG A;  2JA5 H;  1I50 H;  2BDO A;  1VQH A;  4IPH A;  4DAP A;  2RQX A;  5E4X A;  4A93 H;  1GUS A;  3GP7 A;  3N43 B;  2NUA B;  1N36 H;  4MV8 A;  4IR1 A;  3CC2 A;  1FJG Q;  4F4W A;  3PR5 B;  5DLQ E;  4A3I H;  4BY1 B;  1GOZ A;  1ZEQ X;  2JQO A;  3H09 A;  3K7A B;  4J1M A;  1N33 L;  3GTP A;  4LF8 H;  3H6M A;  1J5E L;  4LFC Q;  2N8N A;  1ZET A;  3I4N B;  3AQQ A;  3RLF A;  2A69 C;  5NUC A;  1PZI D;  2ZTC A;  3P75 A;  1SN8 A;  4R8N A;  3JAM c;  4JBK A;  3Q8P B;  1DGS A;  2XC9 A;  3PZP A;  3M4P A;  3CCE A;  1WOC A;  2IJ0 A;  3KLW A;  1QJO A;  3R23 A;  1N32 Q;  4A75 A;  3GTQ B;  5A2Q E;  4IUU A;  1SFO B;  4IR9 A;  4LF5 L;  4O3N A;  1Q1E A;  1UEA B;  4ABN A;  5J39 A;  2PZU A;  3RBE A;  4O42 A;  3HRZ C;  1O7I A;  3RFC A;  5KT2 A;  3NTH A;  4CDD C;  1IW7 D;  1STY A;  5ELC A;  2PPB C;  2MPM A;  2L5T A;  2R7N A;  1VCI A;  1N36 L;  1AZP A;  3RZD B;  1E3P A;  1HH2 P;  3H0G G;  4IWX A;  2R61 A;  3HFZ B;  3SE7 A;  4A3G B;  1GUW A;  2DNC A;  3KYH C;  4X65 L;  2B2W A;  3BYY B;  3J80 E;  1MIU A;  5COY A;  4QB4 A;  3PW7 A;  4JYA Q;  1QZH A;  4LFA H;  1QVC A;  4LF8 L;  5M5W B;  2AQ4 A;  4I65 A;  4ECY A;  3HOU G;  2CFM A;  2B2V C;  1Y8N B;  1KRS A;  2CKZ B;  4HCE A;  4YBZ B;  2RDG A;  4NXM Q;  1B50 A;  3TQT A;  1KBL A;  3SK4 A;  1B9N A;  3KUP A;  1M7J A;  2GPW A;  3BG3 A;  4DR6 Q;  5CBA E;  2F0T A;  1W2B A;  1R4P B;  3OW7 A;  3BU2 A;  4BBR H;  1TWG H;  4X3T A;  5CV9 A;  4KLK A;  3HOZ G;  2R8I A;  1X65 A;  2UUB L;  3RB4 A;  2EYF A;  3PF5 A;  3AEV A;  2QCP X;  2E2I H;  4X64 H;  1BNZ A;  2Z9H A;  1C30 A;  3RB6 A;  2IBK A;  2A6H D;  3A8J E;  4ED1 A;  3W1B A;  4JI2 H;  1Y1W A;  5KFI A;  3FKI G;  4DR5 Q;  2JA7 H;  3UE1 A;  1K3B C;  3CQZ B;  3HOY H;  2V9W A;  4FXK C;  4LFA L;  4MV9 A;  3U9T A;  3WNZ A;  4DV3 H;  5I2X A;  5LYJ F;  4GNX B;  1PFB A;  4PMB A;  3MFY A;  3HP3 A;  2DJF C;  4QWC A;  3S15 B;  1ENA A;  3GTL H;  4DF7 A;  2VUM H;  1VBG A;  3PO2 H;  2X6L A;  2CWA A;  1AW7 A;  1PFN A;  2RCN A;  2UU9 L;  4RZR A;  5A2Q L;  1D1I A;  2CHB D;  1STG A;  1WTX A;  1TS3 A;  3M9N B;  2CW7 A;  3H3V C;  4NLG A;  4JI3 Q;  4Z9C B;  1JOO A;  5C0X J;  4APV A;  2UXD H;  1BKB A;  4A3D H;  4GKJ Q;  1RTO A;  1PYS B;  4OIJ A;  4I50 F;  4JI2 L;  1HTP A;  3Q23 A;  5IT9 L;  1EQR A;  2E2H H;  4IUR A;  2JEG A;  2SDF A;  1B04 A;  3A7L A;  4S3S A;  1PTO H;  2PW7 A;  3KHR A;  4GLX A;  2IY5 B;  5I9P A;  3MXN A;  4R8U B;  4A3L G;  3F2C A;  1NJI C;  2HHH Q;  3WOE A;  3TSS A;  5ELE A;  4ME3 A;  3D3R A;  3HKZ E;  2PMZ B;  1EWH A;  1DOM A;  1HQR D;  4MTK A;  1TWA A;  3R5X A;  5IP7 H;  3GO5 A;  4AYB G;  4Y8V B;  1S97 A;  2UUC H;  3FVQ A;  1HTL D;  4C3I B;  3L4J A;  2IMW P;  4JI6 L;  5K2M A;  5KG5 A;  2RDF A;  2QYZ A;  3T5H A;  2BH8 A;  3EVQ A;  5HV6 A;  1NBW A;  4ZLT F;  5IGB A;  5FPO A;  3NXW A;  5T1G A;  1LAB A;  1EIH A;  3CCM A;  5C8Y F;  2MNA A;  4FF3 A;  3BQ2 A;  2HDL A;  2G5D A;  3M3Y H;  4OO1 G;  2UXD L;  2W9C A;  3TP8 A;  1I6U A;  1HXY D;  4OWW B;  3VYS A;  4DV4 Q;  2DGY A;  1ZHS A;  3K5I A;  3BYT B;  1TII D;  3I4O A;  3RMH A;  2O2L D;  1VQ8 A;  3S14 H;  1YEZ A;  2A8V A;  5KFG A;  4YHH H;  1AUX A;  4JBJ A;  1S5F D;  1VQF A;  1JB7 A;  1PH7 A;  3STB D;  2FPI B;  2WTF A;  1ML0 D;  3W2D A;  1KXL A;  1WSC A;  3A7A B;  4KD4 A;  3KF8 A;  3U9S A;  1K8G A;  3OIP A;  3ULJ A;  4UPA A;  5FLX E;  3NGD A;  5CV8 A;  1SYX B;  3X3M A;  1IW7 C;  2XRS D;  3ND8 A;  2VUG A;  2W8K A;  1I7L A;  2K4K A;  2EJG C;  4JG2 A;  4C3H H;  1HNW H;  4HR7 B;  1I6H B;  4K5V A;  1QNU A;  2FXQ A;  2X6G A;  4O3S A;  1G51 A;  1WD1 A;  4ZOL F;  1QZG A;  4MV6 A;  3S1N B;  3BZK A;  1A15 A;  1FNW A;  1M0W A;  4JV1 A;  3OYY A;  1JIH A;  3CPW A;  4LF4 H;  4R9W A;  5C3E H;  5IT9 W;  3KTM A;  1U4M A;  1QG7 A;  1VQI A;  4DV1 H;  3OSO A;  4HN7 A;  3H94 A;  1A8V A;  4A3E G;  4YY3 H;  4YHH L;  3EPG A;  4AH6 A;  2W6M A;  4IUP A;  4DR4 Q;  3K80 C;  4DR2 Q;  2H5X A;  3M4Y A;  4IFD G;  3HOU B;  3LWE A;  1GUG A;  3KXY T;  4ED0 A;  2DJG C;  3HS0 C;  4K5W A;  3C46 A;  3R2I A;  2JA5 G;  4DR1 Q;  2F3V A;  2GN5 A;  1ZXT A;  4A93 G;  4X66 L;  1WFQ A;  3BVZ A;  2R7M A;  3HOZ B;  2R85 A;  4WD3 A;  4CDE C;  4WJ3 M;  1S9F A;  1TWC A;  3TIN A;  4BWS C;  3PO3 H;  4K2K A;  4A3I G;  4LH7 A;  2ZJQ A;  2W9A A;  2ATW A;  1KAB A;  1D7Q A;  2NVX A;  1EOT A;  3R5F A;  4NW2 A;  1KJ8 A;  4LF4 L;  3FKI B;  3K5H A;  2AKW B;  2JEA I;  1PK8 A;  4ALP A;  1GVP A;  1HNZ Q;  4QIW A;  5EKL A;  1DV1 A;  4YY3 L;  4E6I A;  2M05 A;  5IYC H;  5FOB B;  4YQW A;  1KNA A;  3M4Q A;  1VQO A;  2B63 A;  2HQE A;  4ULL A;  2YU9 A;  5I47 A;  4MV4 A;  3DUZ A;  3GTG H;  1WTO A;  3M9B A;  4IHJ F;  1AUV A;  3CCL A;  4EQ5 A;  4K2L A;  1OXS C;  1TT2 A;  4RB1 A;  3QZ7 A;  5FLX L;  4QWA A;  1GXD C;  3RTX A;  2XCP A;  4ECT A;  3I72 A;  4RHR A;  2A6E D;  4IFD J;  4WJ4 A;  1RCV D;  2RA4 A;  2L11 A;  4KHP Q;  4JI5 Q;  3ER0 A;  2F0J A;  2DY8 A;  2UXC H;  1AN7 A;  4FF1 A;  1Y14 B;  3JSN A;  3GTK H;  4DR7 L;  1KDB A;  2OCE A;  4UCO A;  4I7A A;  5C1P A;  4XQN A;  2EYO A;  1STB A;  2D9U A;  1SLJ A;  1XX8 A;  1GD7 A;  1XJV A;  3W1G A;  2R7L A;  1TS2 A;  4F50 A;  1HZ9 A;  2HCC A;  5KG3 A;  2F03 A;  4DUZ Q;  4P2C B;  2VB3 X;  4BBR G;  2XGQ A;  5L1J A;  1L2Z A;  4YCV A;  3RGZ A;  4WFN 3;  2C22 A;  2L55 A;  5KFZ A;  3L2P A;  2QKI C;  3UI2 A;  1HNX H;  4AYB B;  3MEH A;  2W57 A;  2IPK D;  5CA1 F;  4RUC A;  1KLG D;  1K83 A;  1NE3 A;  5LL6 X;  3T5K A;  1M8A A;  3OSN A;  3NEN A;  1N33 Q;  2JA7 G;  1VQA A;  3J80 c;  1J5E Q;  1HR0 L;  3HOY G;  5KFF A;  5KX5 F;  3GV3 A;  2BDN A;  5LA6 F;  5LP6 F;  2UXC L;  3SHL A;  4RKB A;  1YIT A;  2ZDQ A;  3J81 L;  4CDF C;  3STB C;  5J22 A;  3OWE B;  5HGT A;  1JWU D;  2XCA A;  1U4P A;  1SMY D;  4Y52 H;  3TP5 A;  4C3J H;  1RJQ A;  1CA5 A;  1V1P A;  2NWG A;  2VUM G;  2AQ1 B;  3PO2 G;  5FD5 A;  3FRP B;  1F9Q A;  1T5X D;  2AHO B;  2NBF A;  1STA A;  2WB1 E;  3PN1 A;  5BR8 H;  3RB3 A;  4C2M H;  1N36 Q;  3T4A C;  1SEI A;  1DJR D;  3U4Z A;  1HNX L;  1G8Z D;  3TQY A;  4KY7 A;  3W5O A;  4A3D G;  2J6S A;  3M9O B;  1RD9 D;  1BBW A;  1GSA A;  4LF8 Q;  5ELB A;  4EBE A;  1CSQ A;  1W3S A;  2EIF A;  4YB8 B;  2A73 B;  2Q8I B;  4HJ8 A;  4ZQI A;  4O1N A;  3V05 A;  5IYB H;  3J7Y W;  3MWM A;  3T1Y H;  1EZ8 A;  3Q24 A;  3U58 A;  3G6J B;  2B8G A;  3D4W A;  2EE1 A;  5ELD A;  1PXU A;  2EXZ A;  5C3X A;  1NUC A;  1KLU D;  2VY3 A;  3W3A A;  5L1L A;  4MN3 A;  4A3E B;  5DG9 A;  5IP7 G;  3WO0 A;  3VA7 A;  3NP8 A;  5KFY A;  1B1Z A;  1VQP A;  3GID A;  1Q7Y C;  2GVB A;  4HCS A;  1SEB D;  4UP8 A;  5FO7 B;  5BR8 L;  1I4R A;  2LS0 1;  3FHW A;  2JA5 B;  4FS1 A;  1I50 B;  1XMQ H;  4ZQ3 A;  1PFM A;  3S24 A;  1WCM H;  1X3G A;  2DIK A;  2QGQ A;  4B3R L;  4A93 B;  5CGK A;  4KHV A;  1SDF A;  1E2V A;  4FS2 A;  3GTO H;  3TII A;  4LFA Q;  3PUV A;  1JXL A;  3MTS A;  2B2W C;  4A3I B;  4B3T H;  1E1O A;  1C7Y A;  1UNN C;  1VQ5 A;  2YTY A;  1IL8 A;  1SNO A;  2EY6 A;  2OXP A;  2G9D A;  3JSL A;  4LWC A;  2RF4 A;  3T1Y L;  4CBV A;  3J81 W;  1YHQ A;  2ATL A;  3VPD A;  4GKK H;  4ED2 A;  4HJA A;  3HKZ G;  3SXH A;  2RGR A;  5C3W A;  4CJ2 C;  3VDY A;  4ZYS A;  3CRK C;  2A6E C;  4X64 Q;  2SCU B;  2NVY A;  2Y0S A;  2X69 A;  4C3H G;  4JI8 H;  1NR2 A;  4Q8E A;  1HA5 A;  2R8H A;  1E2W A;  5CMD A;  4ECQ A;  4JI2 Q;  2K5V A;  2PQA A;  3OUZ A;  2KED A;  4X3S A;  2XVS A;  4ED6 A;  1EEI D;  2BE5 D;  2KEN A;  1H9S B;  2IW3 A;  3UE0 A;  5C3E G;  1W6J A;  2W6Q A;  2EYH A;  3OTO L;  1NCV A;  1Q82 C;  5BPH A;  1C3O A;  4DV3 Q;  5LMU H;  3WDN A;  1S4Z A;  2Q2H A;  3DXJ C;  4N8X 1;  2FK2 A;  3RLN A;  3K0Y A;  5KFE A;  5FLX c;  4P72 A;  1IBL H;  2HQL A;  2FP4 B;  3GTP H;  1KIX A;  2E76 C;  2JA6 A;  1CQV A;  5G3L D;  4BA2 I;  4F8M A;  3FPP A;  4FXG C;  1EY9 A;  4ODG A;  1VQ4 A;  2ZXR A;  1HZB A;  3S9W A;  2DLN A;  4U67 3;  3F1Z A;  4EFE A;  2B29 A;  2E75 C;  5T1I A;  5CA0 F;  2UXD Q;  4PZ7 A;  2C2E A;  3PO3 G;  5CBE E;  3VR2 A;  4YAJ B;  1PH8 A;  4DL2 A;  1MD2 D;  3PW5 A;  4YJ3 F;  3GV6 A;  2W71 A;  3GTM A;  5KT3 A;  1EFW A;  2H1E A;  1E1T A;  1A6X A;  2BCO A;  4X62 H;  3HOY B;  1JE5 A;  3NE5 B;  2V5A A;  5KG2 A;  1SMY C;  4G7Z C;  2RGV A;  5LMU L;  1JDB B;  5IYC G;  4Q45 A;  4XZ3 B;  1DON A;  1JWM D;  5CR3 A;  3TZD A;  3LP8 A;  2O5I C;  5EZY F;  2UUC Q;  3G6E A;  4XQJ A;  1EY7 A;  3OWF A;  5I4D A;  4OHJ A;  1K1S A;  2XIG A;  3C3L A;  3GIM A;  4QJF A;  3QFF A;  5EWF A;  1HUM A;  3GTL B;  2WIN B;  3PO2 B;  2WKD A;  1II3 A;  3TRZ A;  4BY7 H;  1GKH A;  3U50 C;  4DUY H;  4A3K H;  5A35 A;  3BA9 A;  1A3U A;  3CD6 A;  2K5W A;  4LF6 H;  4QL5 A;  1CKN B;  3A5U A;  3Q1K A;  1VDZ A;  2YTV A;  4OO1 I;  2I87 A;  1T5E A;  4DV5 H;  2TMP A;  3ERO A;  2EVB A;  4IOA A;  4A3D B;  5DG8 A;  4YHH Q;  2E2J H;  1C8C A;  3GQB A;  2E2H B;  3H15 A;  2ZDH A;  5EOY A;  1UE7 A;  1F2Z A;  4DK6 C;  1VQE A;  5JEA J;  1RYS A;  1EYC A;  1PTO B;  4LF7 H;  2WKC A;  1Y1W H;  1S3O A;  1I94 L;  2NTT A;  1SFO A;  1RKN A;  3ERS X;  3R3O A;  4AQY L;  3MA2 B;  5KND A;  5DGB A;  2MUY A;  2W9B B;  4X66 Q;  2R87 A;  1HNW Q;  1Z2O X;  1AE3 A;  3HOX H;  4IZO A;  5M3F H;  5BN3 A;  4DUY L;  2E5L H;  3BS1 A;  1VQ7 A;  4JV5 L;  5KG0 A;  3PIP 3;  3NBH A;  1KD1 C;  1QOH A;  4JI1 H;  3D0F A;  4ZKB B;  3MVV A;  4A3B H;  4DL7 A;  4LF4 Q;  3NWT A;  1X3F A;  3EJI A;  3M3Y B;  1PH6 A;  2JE6 I;  4Q5V A;  2YTX A;  4DV1 Q;  1TY2 A;  1SRO A;  4K14 A;  4HMJ A;  1WI5 A;  4YY3 Q;  4OL7 A;  3V4S A;  5ELN A;  1HNZ H;  5GAH C;  3RAX A;  1IBM H;  1CZW A;  3E9H A;  1BJT A;  4C3J G;  4FO2 A;  2C2R A;  4EQP A;  1M4V A;  5J3B A;  2IX3 A;  2PNH A;  2QIL A;  4DV0 L;  1C0A A;  1UE6 A;  1E24 A;  4IFD I;  1CKM A;  3HKS A;  3V6J A;  2VL6 A;  3HKZ B;  1VF7 A;  2WII B;  1V43 A;  4DR3 L;  5KT7 A;  4B3M H;  4EYH B;  5H80 A;  4OGQ C;  1SJE D;  4UHV A;  2V4R A;  1BQQ T;  1M6V A;  1L0W A;  1S5C D;  2BE5 C;  4JVZ A;  3BDL A;  4EX5 A;  4C3H B;  1NNX A;  1CE8 A;  3CQZ A;  4QW8 A;  1PHJ A;  2XD4 A;  5KFH A;  4JI1 L;  2UVU A;  1LM0 A;  1TQO A;  1C4Q A;  3OMG A;  4HSP A;  3SK6 A;  1K8A C;  3CCS A;  2FB9 A;  5IYB G;  4LAA A;  3ULP A;  4RU9 A;  2K5H A;  1Q8K A;  4GNX A;  5C3E B;  2EYJ A;  4GN3 B;  1DM0 B;  1IBM L;  4ZHQ F;  1N48 A;  3EN2 A;  3S1Q B;  4F7X A;  3RJ0 A;  2W70 A;  3DM1 A;  2WP8 J;  3CKI B;  3H4D A;  1S5B D;  4H13 C;  2VOB A;  5KFK A;  1SYF A;  1B9M A;  3KDF A;  1VQG A;  4A2B A;  2WV6 D;  2WB1 G;  2NU7 B;  1F2L A;  4ME6 A;  4B3M L;  3A55 A;  5IY0 A;  1ENF A;  2NB0 A;  1GSO A;  1HR0 Q;  1Z7T A;  1WCM G;  2XWB B;  1KNE A;  3QJY A;  5G3L F; 
#chains in the Genus database with same CATH homology
 5FLM H;  2UXC Q;  3GTQ H;  3MXN B;  1SFO H;  1K73 C;  4GLX A;  2OQK A;  2YYZ A;  2LXJ A;  2IY5 B;  1P16 A;  1N9W A;  1WJJ A;  3F2C A;  4A3L G;  1L1O B;  5M3M H;  1NJI C;  2R7F A;  2HHH Q;  1L1O A;  3F2D A;  1X6O A;  4O2D A;  4ME3 A;  5M5Y H;  3HKZ E;  1KL9 A;  1WYD A;  4JI4 Q;  3I4M G;  5M5X H;  2L15 A;  5IP7 H;  2N78 A;  3GO5 A;  3LGJ A;  4AYB G;  1YJN A;  1L1O C;  1X56 A;  5EAY A;  4JI6 L;  3KJP A;  1BVS A;  4TVA B;  3CMA A;  2BH8 A;  1X9N A;  4JI0 Q;  1NBW A;  4QIW E;  1HNX Q;  1CKO A;  3WWV A;  3A5Z B;  4P73 A;  3CCM A;  3CCJ A;  4LW1 A;  2MNA A;  5M5W H;  2ZTE A;  2OTL A;  5C4X H;  1VQ6 A;  4L5Q A;  4LUV A;  2RHS B;  4X6A H;  3M3Y H;  2OWO A;  4OO1 G;  2UXD L;  1Z9F A;  3PCO B;  4OWW B;  2VQE Q;  4DAY B;  2DGY A;  4POF A;  4DV4 Q;  2OTJ A;  2JEB I;  4HJ7 A;  3UDF A;  1YHB A;  2A19 A;  4Y7N H;  1I5F A;  3J81 c;  3I4O A;  1PFS A;  1VQ8 A;  3S14 H;  1YEZ A;  2A8V A;  4K0K L;  3S16 H;  3PUZ A;  4PG3 A;  4JBJ A;  1FGU A;  1VQF A;  1JB7 A;  1PH7 A;  3STB D;  1ASZ A;  4LFB Q;  2K52 A;  4RG1 A;  1YJ9 A;  2Q2T A;  2Q2U A;  1KXL A;  3KF8 B;  4QGU A;  1X55 A;  3PUX A;  1K8G A;  2ZJR A;  3EBE A;  3ULJ A;  1SE8 A;  2C35 B;  3J81 i;  4UPA A;  3PGZ A;  2BH2 A;  1MJC A;  2Z6K A;  3RR5 A;  2NZO A;  3T1H Q;  1T9H A;  1MJE A;  2NVX H;  3S1M H;  1XPR A;  5JJI A;  4JI0 L;  4LF9 Q;  3RZO H;  5IP9 H;  1EIY B;  2K4K A;  4JG2 A;  4JOI A;  4XIG S;  5BR8 Q;  4C3H H;  1K3R A;  4DPG A;  5C4J H;  3RN5 A;  2FXQ A;  4P75 A;  1EQQ A;  1KHI A;  1G51 A;  4DAM A;  3MEF A;  4A3M G;  4O0A A;  1QZG A;  2PI2 A;  3L0O A;  4FDB A;  3BZK A;  5GQO A;  4DKA C;  4DV4 L;  1LTL A;  2PMZ E;  3DM3 A;  4JOI C;  2B63 H;  1L2F A;  3OYY A;  1PVO A;  3CPW A;  3ICE A;  4LFC L;  4R1J A;  5C3E H;  3CAM A;  3I56 A;  3S15 H;  4JI7 L;  1YIJ A;  3E0E A;  1VQI A;  4B3S L;  2HT1 A;  2MO1 A;  1A8V A;  2MO0 A;  4A3E G;  4YHH L;  3T1Y Q;  5HGQ A;  1BBU A;  4AH6 A;  1HZC A;  4DR4 Q;  1KAW A;  1CSP A;  3K80 C;  2H5X A;  4DR2 Q;  3CCR A;  1N32 L;  3S1R H;  4IFD G;  1K9M C;  3TS0 A;  2XGT A;  5GRO A;  4A3G G;  1PH1 A;  2GVA A;  3EIV A;  2JA5 G;  4DR1 Q;  5ELO A;  2ALY B;  2JA8 G;  2GN5 A;  1A0I A;  1VQK A;  4A93 G;  4X66 L;  1WFQ A;  4WJ3 M;  1KQS A;  3KOJ A;  4BY7 G;  3K8A A;  4A3K G;  3PO3 H;  4R4I A;  4R4C A;  5GAG C;  4A3I G;  5C44 H;  1XMQ Q;  1VQC A;  3CCQ A;  1Y1V G;  2ZJQ A;  1YZ6 A;  2ATW A;  1HR0 W;  2VQF Q;  1D7Q A;  4IOC A;  2EQS A;  1TWA H;  1B8A A;  1PH9 A;  4JYA L;  4LF4 L;  4B3T Q;  4A3C H;  2UUA L;  1EUJ A;  2AKW B;  2MFI A;  3G4S A;  4DR7 Q;  2D0P A;  2JEA I;  1NMG A;  4L5R C;  4ALP A;  1GVP A;  4C3I H;  1HNZ Q;  3I4M H;  1TWF H;  2NN6 I;  4NXM L;  4DR2 L;  4YY3 L;  5IYC H;  1EIF A;  1OXV A;  3M4Q A;  1K83 H;  1VQO A;  1TXY A;  2PI2 E;  4DR6 L;  1AE2 A;  4DV6 Q;  3U4V A;  4R4O A;  4R4Q A;  4GKK Q;  1Y1W G;  5C0X I;  1AH9 A;  3GTG H;  3M9B A;  4DR1 L;  3CCL A;  4L5S A;  4EQ5 A;  1OXS C;  1PH5 A;  4A76 A;  1N34 Q;  1OXT A;  1HZA A;  5AJ3 Q;  1JT8 A;  2D0O A;  4POG A;  2KHI A;  2JK8 A;  4GN5 A;  4XTC S;  4JI8 Q;  1XPU A;  4JCV E;  4IFD J;  3HOX G;  1XMQ L;  4WJ4 A;  5M3F G;  2KHJ A;  4KHP Q;  4HJ9 A;  4DR5 L;  1YJW A;  4JI5 Q;  3ER0 A;  2IT1 A;  3S2D H;  4PMW A;  1YBY A;  3S2H H;  5GAE C;  1Y14 B;  3GTK H;  1XPO A;  4B3T L;  4A3B G;  4DR7 L;  3AFP A;  3UDX A;  2OCE A;  1UEB A;  3J7Z C;  3TRE A;  3HOW H;  2JA6 G;  5LMU Q;  1SLJ A;  1XJV A;  1GD7 A;  3W1G A;  2CQO A;  2EXD A;  1FVI A;  4JBM A;  4GKK L;  1HZ9 A;  1Z47 A;  1I6H H;  1JJG A;  4QY7 A;  2HIX A;  5LMN Q;  1LUZ A;  4DUZ Q;  4BBR G;  5IYD H;  1IBL Q;  4YCV A;  1B70 B;  4BBS H;  2IX0 A;  5E7N A;  1IBK Q;  2R7Z G;  4DK3 C;  3S1N H;  4P74 A;  4YWL A;  5JJK A;  3PUW A;  1VS0 A;  3L2P A;  3IRB A;  2JJQ A;  1A63 A;  3PUY A;  2D62 A;  4JI8 L;  4OX9 Q;  3K81 C;  3H0G H;  4KI0 A;  3CC4 A;  4JI3 L;  3PV0 A;  2R93 H;  5JEA G;  1D8L A;  1VQD A;  1NE3 A;  1UE5 A;  1V9P A;  3KF6 B;  3NEN A;  1N33 Q;  2JA7 G;  3S17 H;  4LUZ A;  1VQA A;  3J80 c;  3KF6 A;  4A3J G;  1J5E Q;  1HR0 L;  3HOY G;  1NY4 A;  1PH4 A;  1Q86 C;  1K0R A;  1Q12 A;  3M4O H;  4GLA C;  5FJ8 G;  2K50 A;  2UXC L;  3I2Z A;  3HOU H;  1YIT A;  2Y0S E;  2R92 H;  2WAQ G;  4MNO A;  3STB C;  3CC7 A;  3HOV H;  4X62 Q;  1IYJ B;  2HHH L;  3K7U C;  3GD7 A;  3B6Y A;  1NMF A;  3J80 i;  4DV2 Q;  1I94 Q;  1B7Y B;  2CCZ A;  4C3J H;  4H02 A;  4Y52 H;  1E7Z A;  1TWC H;  1IBL L;  4JI4 L;  1PH3 A;  2VUM G;  3I55 A;  2R7D A;  1JJ2 A;  3HOZ H;  2R6G A;  2OQ0 A;  3PO2 G;  2KCT A;  4HJ5 A;  2KCM A;  4BY1 G;  2AHO B;  3F8T A;  1Q81 C;  2WB1 E;  3AFQ A;  4PZ6 A;  1H95 A;  4C2M H;  1N36 Q;  1VQB A;  4J15 A;  4NXN Q;  3U4Z A;  1HNX L;  1QVF A;  2QEX A;  4DUY Q;  4IO9 A;  3I4N G;  3FKI H;  2K5N A;  2A1A A;  3TQY A;  3W5O A;  4A3D G;  4HID A;  2YV5 A;  4IPG A;  4LF6 Q;  4P71 A;  1BBW A;  1VQN A;  2VQE L;  4B3R Q;  4LF8 Q;  2Z0S A;  4YCU A;  1CSQ A;  1FL0 A;  3AYH B;  5FLM G;  2YU9 H;  4BXX H;  4DV5 Q;  1W3S A;  2EIF A;  1IL2 A;  4X62 L;  4JBW A;  4HJ8 A;  3TS2 A;  5IYB H;  3H3V H;  5M3M G;  2E8G A;  3RN2 A;  1NTG A;  2AMC B;  4A3F H;  4AYB E;  3U58 A;  4LFB L;  4LF7 Q;  3RLO A;  2VY3 A;  3ULL A;  1PA6 A;  2F4V Q;  5IP7 G;  1UE1 A;  4RMF A;  1RL2 A;  1XNR Q;  3M7N A;  3T1H L;  1VQP A;  1OXX K;  2CWP A;  1Q7Y C;  4A4I A;  2GVB A;  4NB3 A;  2ZM6 Q;  4LF9 L;  4GLV B;  4UY8 C;  4UP8 A;  2VW9 A;  5BR8 L;  2VNU D;  2QA4 A;  3NBH B;  3FHW A;  2UXB Q;  3J81 j;  5C4X G;  3S24 A;  1GM5 A;  1WCM H;  1S40 A;  2E5L Q;  1LYL A;  1X3G A;  4LF6 L;  3G71 A;  2QGQ A;  3CP0 A;  4B3R L;  4GS3 A;  1U0L A;  4HIM A;  5IWA Q;  4JI1 Q;  1OTC A;  2ZJP A;  3A0J A;  4DV5 L;  1XMO Q;  4YWM A;  3I7F A;  4LFA Q;  3PUV A;  2NN6 G;  3GTO H;  2I0Q A;  4A3L H;  1SRU A;  1E1O A;  2F3I A;  2B3G A;  1C7Y A;  1VQ5 A;  2YTY A;  2F52 A;  4DNI A;  5HY6 A;  2V1C C;  3OTO Q;  4DV7 Q;  1E22 A;  4LWC A;  4UP9 A;  3UDI A;  2RF4 A;  4IJL A;  5C0X G;  3KJO A;  4GOP B;  3T1Y L;  4LF7 L;  1YHQ A;  1UWV A;  1IBM Q;  1M1K C;  4DR4 L;  5JJL A;  2AWN A;  3PIP A;  4L5T A;  4HJA A;  3K0X A;  3F2B A;  3HKZ G;  1JMC A;  3CXC A;  5LMN W;  4GOP C;  1VQJ A;  4GKJ L;  3VDY A;  3GDE A;  1SMX A;  4X64 Q;  5IP9 G;  2MQH A;  1XNQ Q;  1RIP A;  4B3M Q;  2E5L L;  2PQA B;  1YHA A;  4JI2 Q;  2K5V A;  2PQA A;  2ES2 A;  3NEM A;  1G6P A;  1A62 A;  1IXR A;  2B63 G;  2KEN A;  3FP9 A;  2VQF L;  3UE0 A;  3UDG A;  5C3E G;  4HIK A;  3OTO L;  2NZH A;  1Q82 C;  2I5H A;  4DV3 Q;  2HIV A;  2IHF A;  2Q2H A;  1IZ6 A;  1HNZ L;  3CME A;  3OW2 A;  3BJU A;  2WFW A;  3RLN A;  4BA1 I;  1TWH H;  1V1Q A;  5FLX c;  4P72 A;  4DV6 L;  2KBN A;  2N49 A;  1XTD A;  4GNX C;  3H3V I;  2HQL A;  1MKH A;  3GTP H;  1KIX A;  3Q8D A;  4BA2 I;  3KDF B;  2NVQ H;  3TEH B;  4X64 L;  1VQ4 A;  1HZB A;  1VQL A;  1SR3 A;  1OXU A;  5AJ3 L;  1N34 L;  2K14 A;  3F1Z A;  4A3M H;  2B29 A;  1X3E A;  4LNQ A;  2UXD Q;  4JC0 A;  4PZ7 A;  3NEL A;  5IT9 c;  3DLL A;  1R9T H;  1VQ9 A;  2IX1 A;  3PO3 G;  4QQB X;  3PF4 A;  5C44 G;  4KHP L;  1PH8 A;  4JI5 L;  4AIM A;  1EFW A;  1E1T A;  4K0K Q;  1G29 1;  4OON A;  3BZC A;  4A3E H;  4DV3 L;  4A3C G;  2RHQ B;  2NVT H;  5IE8 A;  1JE5 A;  3PSI A;  2IHE A;  5LMU L;  5IYC G;  3J7A 5;  3RZD H;  5K36 G;  1PH2 A;  2K75 A;  1CUK A;  4A3G H;  1YI2 A;  5GAD C;  5LMN L;  3G6E A;  4DUZ L;  4OWX B;  1EYG A;  2JA5 H;  2UUC Q;  1YVC A;  1I50 H;  2JA8 H;  4R4T A;  4QJF A;  3ZJY C;  4AQY Q;  1IBK L;  2LXK A;  1VQH A;  4IPH A;  4A93 H;  4MZ9 A;  3CC2 A;  1FJG Q;  1Q1B A;  3TRZ A;  4OX9 L;  4BY7 H;  1GKH A;  3U50 C;  4A3K H;  5DLQ E;  4A3I H;  3KFU A;  2JQO A;  1KC8 C;  3CD6 A;  1Y1V H;  4QL5 A;  1CKN B;  3A5U A;  1N33 L;  4JV5 Q;  2YTV A;  4X65 Q;  1CKN A;  1I3Q H;  2N8N A;  2VS1 A;  1J5E L;  4LFC Q;  2XTI A;  3AQQ A;  3RLF A;  4JI7 Q;  4OO1 I;  4B3S Q;  4IOA A;  2ZTC A;  1SN8 A;  3JAM c;  4JBK A;  1DGS A;  4YHH Q;  2E2J H;  2BA1 A;  3M4P A;  3CCE A;  1WOC A;  3HOW G;  3H15 A;  1UE7 A;  3KLW A;  4DK6 C;  1VQE A;  5JEA J;  1N32 Q;  4LF5 Q;  4A75 A;  2NVY H;  3SGI A;  2JA9 A;  4DV2 L;  1Y1W H;  1S3O A;  4YWK A;  1M90 C;  1I94 L;  2UUC L;  1Q1E A;  3ERS X;  1VQM A;  1YNX A;  4LF5 L;  4MTN A;  2I5M X;  3PIO A;  4OXP A;  5IYD G;  4AQY L;  3CQZ H;  3JAM i;  1ASY A;  4BBS G;  2UUB Q;  3CCV A;  4DV0 Q;  1O7I A;  2Z6K C;  4X66 Q;  1FJG L;  1HNW Q;  1J6Q A;  1AE3 A;  1VCI A;  1N36 L;  2ASB A;  3HOX H;  1E3P A;  1EWI A;  1HH2 P;  3H0G G;  4NXN L;  3HFZ B;  5M3F H;  4DR3 Q;  1S72 A;  1U5K A;  4DUY L;  1PV4 A;  2E2H H;  4IPD A;  4KHZ A;  4GN4 B;  4NPS A;  1VQ7 A;  2R93 G;  3KYH C;  4JV5 L;  4X65 L;  1KD1 C;  3CCU A;  2DUD A;  1QVG A;  1MIU A;  1P8L A;  2WAQ E;  3D0F A;  4JYA Q;  1QZH A;  4A3B H;  1QVC A;  4LF4 Q;  4LF8 L;  3S1Q H;  1X3F A;  2UUA Q;  4IPC A;  1PH6 A;  2JE6 I;  3HOU G;  2YTX A;  2I5L X;  2CFM A;  2CKZ B;  1KRS A;  4DV1 Q;  2JA6 H;  1SRO A;  3GTJ H;  4NXM Q;  2R92 G;  1WI5 A;  4YY3 Q;  3A74 A;  3HOV G;  5ELN A;  4DR6 Q;  5GAH C;  1W2B A;  3L7Z C;  3BU2 A;  3E9H A;  4BBR H;  1TWG H;  3D31 A;  4GOP A;  4KLK A;  3G48 A;  3HOZ G;  5J3B A;  1X65 A;  2PNH A;  2F4V L;  2R7Z H;  2UUB L;  4DV0 L;  1C0A A;  1UE6 A;  1XNR L;  1E24 A;  1X54 A;  2UU9 Q;  4IFD I;  2LSS A;  1CKM A;  3PF5 A;  3AEV A;  3HKS A;  2E2I H;  1HNW L;  2ZM6 L;  3GTM H;  2VL6 A;  4DR3 L;  1V43 A;  2ID0 A;  2N3S A;  3W1B A;  2UXB L;  3FKI G;  3JC6 6;  1HJP A;  3UE1 A;  4DR5 Q;  2JA7 H;  4A3J H;  3HOY H;  1L0W A;  4EX5 A;  3M85 A;  1PHJ A;  5FJ8 H;  5IWA L;  4JI1 L;  2BA0 A;  1LM0 A;  1XMO L;  4UP7 A;  4LFA L;  4DV1 L;  1GO3 E;  4BXX G;  4TQU S;  4YCW A;  1K8A C;  3CCS A;  1QUQ B;  2VZA A;  5IYB G;  1QUQ A;  4OWT B;  4GNX B;  4PZ8 A;  3ULP A;  4DV7 L;  2K5H A;  2Y0S G;  3E9I A;  4A3F G;  1Q8K A;  2Q2I A;  4IJH A;  3CF5 A;  1C9O A;  4GNX A;  4GN3 B;  1N8R C;  1EOV A;  4HIO A;  3GTL H;  2VUM H;  1IBM L;  3PO2 H;  3EN2 A;  3CPF A;  1KRT A;  2CWA A;  2RCN A;  2UU9 L;  4BY1 H;  2WP8 J;  1JJC B;  3K7A H;  4JI6 Q;  2ZTD A;  3RNU A;  5H1S E;  1PYB A;  4LUO A;  2AWO A;  4JI3 Q;  3KDF A;  1VQG A;  5C0X J;  1XNQ L;  3I4N H;  4APV A;  1BKB A;  2WB1 G;  4A3D H;  3CW2 C;  4B3M L;  1Q46 A;  1PYS B;  5IY0 A;  4GKJ Q;  1HR0 Q;  4JI2 L;  1WCM G;  1EQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...