2R6FA

Crystal structure of bacillus stearothermophilus uvra
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
949
structure length
899
Chain Sequence
b'MDKIIVKGARAHNLKNIDVEIPRGKLVVLTGLSGSGKSSLAFDTIYAEGQRRYVESLSAYARQFLGQMEKPDVDAIEGLSPAISIDQKTTSRNPRSTVGTVTEIYDYLRLLFARIGRPICPTHGIEIQSQTIEQMVDRLLSYPERTKMQILAPIDVVVDRIIIKDGIAARLADSLETALKLADGKVVVDVIGEGELLFSEKHACPYCGFSIGELEPRLFSFNSPFGACPDCDGLGAKLEVDLDLVIPNDELTLKEHAIAPWEPYYPQLLEAVCRHYGIPMDVPVKDLPKEQLDKILYGSGGEPIYFRYTNDFGQVREQYIAFEGVIPNVERRYRETSSDYIREQMEKYMAEQPCPTCQGYRLKKESLAVLVGGKHIGEVTAMSVTEALAFFDGLELTEKEAQIARLILREIRDRLGFLQNVGLDYLTLSRSAGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLIATLKSMRDLGNTLIVVEHDEDTMLAADYLIDIGPGAGIHGGEVVAAGTPEEVMNDPNSLTGQYLSGKKFIPIPAERRRPDGRWLEVVGAREHNLKNVSVKIPLGTFVAVTGVSGSGKSTLVNEVLYKALAQKLHRAKAKPGEHRDIRGLEHLDKVIDIDQSPIGRTPRSNPATYTGVFDDIRDVFASTNEAKVRGYKKGRFSFNVKGGRCEACHGDGIIKIEMHFLPDVYVPCEVCHGKRYNRETLEVTYKGKNIAEVLDMTVEDALDFFASIPKIKRKLETLYDVGLGYMKLGQPATTLSGGEAQRVKLAAELHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTADYIIDLGPEGGDRGGQIVAVGTPEEVAEVKESHTGRYLKPILERDRARMQARYEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Excinuclease ABC subunit A
publication title Crystal Structure of Bacillus stearothermophilus UvrA Provides Insight into ATP-Modulated Dimerization, UvrB Interaction, and DNA Binding.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 231
structure length 899
sequence length 949
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17755 UvrA_DNA-bind UvrA DNA-binding domain
A PF17760 UvrA_inter UvrA interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.280 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 ABC transporter ATPase domain-like 2r6fA04
1.20.1580.10 Mainly Alpha Up-down Bundle ABC transporter ATPase like fold ABC transporter ATPase like domain 2r6fA06
1.20.1580.10 Mainly Alpha Up-down Bundle ABC transporter ATPase like fold ABC transporter ATPase like domain 2r6fA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r6fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6fA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6fA05
2FV8A 2JJ1D 1CR0A 5HE8A 1OF1A 1R0ZA 1JJ7A 4RZ2A 5L3QB 4DSTA 4TT3D 1VKJA 4M1YA 4XIGS 1XP8A 3C14C 3NDPA 3TUJC 2OCYC 4TMWA 4KITB 1OIXA 1QZXA 4IDQA 1US8B 1U8ZA 3PUZA 5AUQA 1N6LA 3A36A 5J2UF 2NQ2C 4AKEA 3WRXC 2IW3A 2WSSD 4EGQA 2XAUA 4Z1MD 4AG6A 4OQXA 3K9HA 1Z07A 1XTIA 2F43B 3HWSA 3QI2A 2A5DA 2FSGA 1RE0A 3DEFA 4ESVA 4XWAA 2J7PD 1JQLB 1Z0FA 2OCBA 1OH6A 1XEXA 2OUKA 3OIUA 2RCNA 4BGDA 2QNRA 2CLDX 5L3QA 1T5LA 1SULA 1V5WA 2C9OA 1UPTA 3QF4A 3THXA 1X8KA 1VYUA 3G0HA 3ADDA 5C1BA 2YNMA 3PEYA 4A0FA 1E69A 4PPQA 1GVNB 3GCGA 3M1IA 4Q03A 4Z51A 2V9PA 3W8RA 1RIFA 2PZEA 2X0SA 1GKIA 4B34A 2IX3A 2ATVA 3LVQE 4MRSA 1GWNA 3HJNA 2FP4B 1PUIA 1KKLA 2FA9A 3U3RA 2WWWA 1E9AA 1GITA 2FDCA 3O8BA 3W6OA 5JRJA 1ZD1A 1QHNA 3E5NA 1N6IA 1NLYA 3R9WA 1ZYUA 3CLVA 3U7FB 1X8JA 1Y3AA 3BBPA 4IDOA 4LJ6A 521PA 4Z54A 4AK9A 3JRWA 3L0IB 3OEEA 2WVJA 3U44A 5AUPB 1G8GA 1JKJB 5JZVA 4ZQIA 2GPWA 3RUPA 5SZIA 4N0DA 1J2JA 1M7BA 3IIKA 4LHVA 4B32A 4GRAA 4ERNA 3U5ZB 2AXNA 1FTNA 5DGXA 2ZM5A 4CYMA 2PMKA 2QPOA 4PZZA 1EFRA 2QRZA 1E4EA 1LS6A 1X3SA 2RKOA 3MRSA 4IOKA 3AKYA 4BFVA 2XTZA 1JBKA 5GJWC 2IF0A 1ZINA 1KI9A 5EXTA 4MKFA 2ZJOA 3KTAB 4Z8YA 2G83A 1XPOA 3TJZA 2RGEA 4PHTA 1YVDA 4Q47A 1DG1G 2YWGA 3SFVA 1ESNA 3Q5DA 3TE6A 4O0MA 4AYXA 2GXAA 4BLRA 1JR3A 1G3UA 5HZKA 2E1RA 1J7KA 1BKDR 1N6OA 3AVOA 3A1TA 3ZVMA 1FL9A 4HSEA 3R8FA 3RS3A 1OXUA 2KJQA 4XX0B 2GTPA 4IDHA 2DWOA 1Z0AA 2QP4A 3QOFA 3T1OA 3ZD7A 3D6TB 2EQBA 3KJIA 2YHSA 4KFUA 4JLAA 2BOVA 4JLKA 2BJVA 1EESA 1Z0KA 2QA5A 1S9DA 2R65A 4CVNA 1QVRA 3RRZA 4EPXA 1SVSA 3IQXA 2W00A 4A0RA 1H8HD 3KUDA 3AVUA 1X86B 1A7JA 2ZRMA 1QHHB 3WMFA 4E03A 621PA 1JJVA 4G5QA 4L9SA 1ELOA 1UKVY 3ZYCA 1AN0A 3BWDD 3B82A 4RFSA 3TSWA 3VR2A 2XITA 2ZTSA 1VCMA 3AF3A 4L8GA 4QHSA 2ZITA 5CIWA 2A7QA 2FPPB 4B2PA 2QAGA 5CB6A 3LO5A 2YS7A 1MH1A 1XJ0A 2W6JA 4UXIA 1UKYA 1U0HC 3A1UA 2OILA 3VX3A 2PMDA 2P65A 4NCJA 2XNDD 1WMSA 1S3SA 3IPXA 1QHHA 3BH7A 3GEHA 5AR1A 8OHMA 3KJGA 2D2FA 4FD2A 2YW2A 4L15A 4LJ7A 3PUVA 4WZ6A 4C0AC 5JECA 4WBSA 5EP1A 2ANBA 2AX4A 3BS4A 2GZDA 1SVWA 2O8CA 4X8MA 1GNQA 1CR2A 3NH9A 2P0AA 4PO8A 3FGNA 2WSSA 2WJVA 3SHFA 4L4UA 5J4LA 1SXJA 1BIFA 2WSMA 1GLVA 3NXSA 3GJ7A 3BERA 3MCAA 3ZH9B 1ZW6A 1CBUA 1XWIA 3G82C 3RDPA 2ZR7A 4MYTA 1P2TA 2JA1A 1FUKA 5GVSA 1XPRA 4BFYA 1UBGA 1XEWX 3BK7A 2AWNA 4RZ3A 2C77A 2F1JA 4LBWA 5BN4A 2QT1A 2J46A 2VF7A 5KSYA 1P9RA 4CEHB 3KFVA 1UADA 5DN6D 3UPUA 5KNBA 2JLSA 3Q8XB 2JJ8A 5SZJA 2BCGY 2BC9A 4TYYA 4JL5A 1C9KA 5FPYA 3U3JA 1GSIA 1KSJA 1VMAA 1T8UA 2ZRFA 3QVVA 3H86A 1ZUHA 1W0KA 2ERYA 2HV8A 3EAQA 4YMTA 4G3XA 1CR1A 1GKUB 4OJQA 1LF5A 3KKNA 2QSYA 2GVDC 4HUQA 4WXPA 2XZLA 2NZ8A 3QPVA 1NF3A 1H8ED 1U81A 4UQOA 2VP4A 3ZQJA 3P1JA 3Q5EA 3ZVLA 4A4DA 2O0HA 2VP9A 2VR1A 1G8FA 1KY3A 4LBYA 4ON9A 2V3CC 3V9PA 2LKDA 1HYQA 1T6NA 3U4QA 1TQ6A 3FTQA 2IYZA 2DLNA 3IBGA 1ZM3A 1VIAA 2OFXA 3WHKA 4ZKEA 2JLYA 3C8UA 4B3DA 5G3ZA 2QK4A 1HT2E 2FOLA 4R9UC 2IYXA 2MSDB 3IILA 1EFCA 4URYR 2G6BA 2FFAA 2ZUBA 3F5FA 5KSPA 4TSFD 5FTJA 3W34A 3U7EB 4AURA 1PV4A 4KCGA 3SOPA 1JI0A 1F6BA 2AL7A 1G6OA 2GRJA 1E2KA 4ARZB 4TZ0A 3K09C 1NN5A 1W36D 4PZLA 4CEIA 5EUQB 2YZGA 4O2AF 2AXPA 1DELA 1AIPA 1L4UA 2H57A 1IN6A 4KVAA 5H1YA 2VP5A 5JI3E 3MJFA 4ZPXA 2HXYA 3KUCA 1G7CA 4R71A 2PT7A 3QXJA 1E2IA 4A0HA 1KI1A 4HAUA 3F0TA 5JCZA 1M6NA 4WVFA 3JZIA 5BN3A 4I1SA 5DE3A 2REBA 3TAUA 3QF7A 4EJSB 5LYJF 1E0JA 3K3PA 4HAVA 4I4LA 4CRWB 1T8TA 1ZCBA 2DR3A 1QG2A 2P2LA 3UATA 4ZV4A 4ZCIA 2AFIE 4RY2A 3W90A 2UKDA 2DBYA 3TQFA 2NU9B 4C0KA 1XTJA 2H5EA 4LJAA 3R8CA 4O4HF 5HR5A 3GLGA 1FX0B 3X1ZA 3B60A 5F9FA 1MABA 2JASA 1E9CA 3HU1A 2GAOA 2YYZA 2W6IA 5TY0A 4AI6A 2J41A 3RFCA 5J47A 1WB9A 4Q1AA 4DSNA 5IHPA 4KLNA 5EXXA 3NHAA 2HCBA 1NVWQ 2FU5C 5GVRA 4NKRA 2DPXA 2BVNA 5H68A 1A1VA 1Z0IA 4KO8A 3QBTA 3U9SA 2XJ4A 2QMOA 2C00A 4P4SB 1XXHA 3FMIA 3UMSA 1JB1A 4KI0A 3FFBA 3IPYA 4PANA 1OH5A 1I2MA 2ZRBA 1LS1A 2ZI6A 2I80A 1JALA 2J87A 3I8XA 3PUXA 4QBFA 4JT4A 5FL7D 2BMDA 1MRSA 4TUYF 2BCJQ 2VLIA 3M4YA 4EPVA 3QKTA 1PK8A 2GPSA 3BC1A 4FU0A 5K8TA 1Q3TA 1UEIA 4QGFA 1GDDA 4XH9B 1RVDA 5K8LA 1E1QD 4M4SA 4BLQA 5JLJA 2FEOA 4URVR 4UNPA 4YQFA 4M0LA 4DKXA 1KK1A 1NL3A 2QP3A 4P4SA 1UFQA 3TGPA 2CXXA 2QBYA 3OHMA 1DVRA 4KBGA 4ZDIA 2QG6A 1HH4A 2ZYTX 1M74A 3B5JA 1U8AA 4HLUC 3W3AA 2AN9A 1S2MA 2VP0A 3QPWA 2ZETA 4L16A 1LF0A 2W58A 4Q7LA 2D7DA 2D62A 2PJZA 1NN0A 2ZAMA 4KYUA 4QC2A 1Z6XA 1P6XA 4FMCF 3W3ZB 4XVUA 2HF9A 2P6RA 1OHHA 2KB0A 4JYCA 4OHXA 1B23P 5L3SA 1DG3A 1E2GA 2HDNB 2ZRKA 3OFNA 3SE7A 3SC3A 3IUYA 3RS0A 2FWRA 4FMDB 5CAEB 1ESMA 1E9FA 5C46F 1DE0A 4ZDJA 1WR2A 5EE9A 1WCV1 1DO2A 1F48A 1OLOA 2ZQ5A 3B7GA 4B74A 4Q4AB 4B6EA 1XD8A 5KKNB 3LX8A 5B57C 4XOIA 1GL9B 2WWFA 1CS0A 5TB5A 3VX4A 1K5DA 4CEJA 1XCGB 3KKOA 3CBQA 4ZHQF 3ZZUA 3VPBA 3MJRA 1XU4A 5A5GA 3AVWA 2W0SA 2XXAB 4PSAA 2PBRA 5LPNA 2O0JA 4XTCS 3PEWA 5DISB 4BZQA 2HCJB 4LDJA 1FTSA 3D8BA 1CLUA 1YQTA 2ZRNA 4GOKA 3VR6A 4DCUA 5LXTF 3RS5A 1Q1BA 2UVQA 3AGQA 4LC1A 4QOSA 1QHYA 3X2SA 4JVNA 2IHYA 1GAJA 5FH9A 3VNUA 2HEIA 4FCWA 3SJCA 4ABYA 4R98A 1NVVQ 4Q4AA 4Q1EA 3NEJA 4AD8A 5I47A 1OE0A 1P73A 2OLJA 3C7KA 3I61A 4D0GA 2QU8A 3VR5A 4JKYA 2H17A 2CL6X 2WOJA 5FOUA 4JIMA 1KJJA 2NUAB 2V7QA 2R6DA 1U2RA 1EFTA 5UKDA 3GLKA 3DKVA 4YJ3F 2HT1A 4I4TF 4YB8B 4W5WA 5DNYB 1D2MA 1G17A 2FFBA 2IK8A 4HAYA 2ZPTX 2PEYA 3EWSA 2D06A 1XTQA 1W36C 2C8VA 4NYJQ 5IF9A 1P2SA 1FPMA 1MKYA 3SBEA 1YZUA 4U02A 2WOOA 4D4JA 4KAXA 3K0FA 5E7JA 2Q3FA 1IHUA 2YOFA 2HLDA 2J45A 2GKSA 3CRQA 5E95A 1W7AA 2IS2A 1PVOA 2ZI4A 2NOAA 5F9HA 4PAMA 3WRYC 2VSFA 1Z6TA 1E98A 5F2EA 1EG7A 2Q3MA 4XJXA 2W2VA 3U3MA 1ZM2A 4DT1B 2ZRAA 1NKSA 5E7IA 1NMXA 4HEJA 2O0KA 1KI8A 4RD0A 4YONB 4YXWD 4E22A 1B0UA 4UJ3A 2O8FB 1BMFA 1II0A 4R7ZA 3DM5A 3UWOA 1ZU5A 2XZPA 4RZXA 5J4YA 1HURA 1LV7A 1G291 3CX6A 4EQ6A 1E9RA 2EFCB 2P5SA 5HKKA 2Z43A 1RPZA 4IEEA 4HLQB 1OYYA 4DLRA 2YZNA 1KJYA 1Z2CA 3I12A 4FXPA 3QKSA 3QFFA 3ADCA 1QDEA 4JT2A 4URWR 1DADA 3B1YA 4ASUD 4BZPA 1W93A 4WOPA 1ULZA 1NN1A 1AQYA 1JXOA 1YKSA 4P32A 2IS6A 3K0AA 1YHNA 4RKFA 4AYWA 4AWXA 4CT5A 4NCIA 1DO0A 1ZNWA 5FUVA 2IYVA 3CIOA 3UANA 1G7SA 3TKLA 2O8DA 1DAMA 1T9HA 3AUXA 3GJ4A 4AY2A 3QKRB 5FFMA 4K46A 4NE2A 4Q19A 3TIGA 1FW6A 1W5TA 3KQHA 4QNMA 1W4CA 2QZ4A 1CQIB 5JFGA 3UXMA 1P3JA 3P26A 5CK4A 1YR9A 2GK7A 2CNWA 4FINA 4OQNA 4F92B 3QIAA 5JJLA 1LTQA 3SHWA 3PQCA 2WPDA 3PITA 1XJQA 3QENA 5FPKA 3CRVA 3FMOB 4M9UA 2F3TA 1PZNA 1AQUA 2QN6A 2QMHA 4DLZA 1SVOA 4PPFA 2RGAA 1RRPA 2VPPA 1KC7A 2BKUA 4FI3C 3FKQA 1Q12A 1SKYB 3Q72A 2XJ9A 3LFUA 4GPTA 2JLVA 4YMSA 4V0LA 4HUTA 1HE8B 3X1DA 4S2EA 2ZE7A 1OYWA 4NCHA 4WA7A 2WMOB 1D2EA 3I73A 1TUIA 1WBBA 1L2TA 5CM8B 5IT5A 1XB2A 1GRNA 3AV0B 4OQMA 2PL3A 5LDDC 1WXQA 2GA8A 5F98A 1U0JA 1NG9A 1VBHA 2TMKA 1E0KA 1OPXA 4PQYA 4BEBA 2V58A 4Q7KA 1KAOA 1TAGA 1QF9A 3TNFA 1LB1B 1CS4C 4Q4JA 4TWZA 1KHTA 4TMTA 1PX2A 1GTVA 4RVCA 1E0SA 5EE5B 2G0NA 4MRVA 3SE0A 1OXSC 1XX6A 1KO4A 4Q7MB 5JHGB 1COWA 3RS2A 3SEAA 1KDOA 5FL3A 4DLWA 4PR0A 4DZZA 1NJGA 3OEED 1S96A 1JPNA 1VCNA 4MUBA 2JATA 2JJ2A 4LGMA 3KZ1E 1IN7A 3RLFA 1E6CA 1VYVA 3V4ZA 4YMVA 2IUSA 5F3WB 3LW8A 4K8OA 1ONBA 4CT4B 1WA5A 5DH9A 1IOZA 2G77B 3ADKA 1EFRD 4M22A 2PCLA 5DO9A 2R44A 1EXMA 1P61B 3L0OA 4Q4HB 4CZ2A 1Z63A 1KBLA 2WWXA 4MRNA 1ZM4A 4EPRA 3CF0A 1NSTA 2CVHA 4PC3A 2DWCA 2QQ0A 2QM8A 5BPHA 3BB4A 4LHWA 3TIFA 4TTQA 1VCIA 1GSAA 2JCSA 1MV5A 2A2ZA 5J2TF 3X1XA 1TU3A 2J7KA 2DFLA 5CIQA 3PR1A 5TV2A 1I4LD 1DAIA 1JR3D 3QXHA 3N2IA 3JVVA 5FOSA 3HU3A 2OBLA 2VSOA 1G18A 4KSBA 1XCPA 1VCOA 1A5TA 2GBLA 5BMVF 2VQDA 4LV5B 1EWRA 1TF7A 2R87A 2AR7A 2AFHE 4OL0A 2JLUA 2R7LA 4Q4HA 3OZXA 3B85A 3K9LA 1N6KA 3KL4A 4GZLA 4LUCA 2I4IA 5HTKA 5FOVA 2NTYC 1T36A 3OUZA 3PENA 1CRQA 2J0UA 1L7VC 2ZIAA 3LQQA 3T15A 4IFBA 2YC2C 3AUYA 3NH6A 2XD4A 5EQTA 1OFHA 3UMRA 3IKJA 1F2UB 4MA4A 1YU9A 5K2MA 1TF5A 4YMWA 2GF9A 4GBMA 1UEJA 1DIKA 2V6IA 1E79A 4TV8F 5KTYA 2A5JA 1TQ4A 2IYSA 4V0NA 1KOFA 1Z28A 1FOEB 4C0JA 2W6NA 2DHRA 3SN6A 1CRPA 2AKYA 3WP0A 1KYIA 5CB8A 2R85A 2ZRLA 1EFHA 5TVKA 3WNDA 3IIMA 3EPJA 1XD2A 2BBSA 2W6JD 3ZQ6A 4DUGA 4A1FA 2R62A 4GI7A 1XMVA 1VECA 2IXFA 1TEVA 4D6PA 2FPMA 2CE7A 4A8JA 3BJIC 4DBLC 4IRUB 3WNCA 1GM5A 4MYUA 4QBGB 1SVLA 1SKYE 2O8BB 3RRMA 2D74A 2IT1A 4N3NA 2WMNB 2JAQA 2LWIA 3TMKA 3K5IA 3O8CA 2Q3HA 5KDOA 2XSZA 1Q57A 3TQCA 3OAAD 3TRFA 2IYWA 1SXJD 3U60B 2ECKA 3FDIA 1CEEA 4C0HA 2X2EA 4ZCLA 1OV4A 1UF9A 2ZJAA 3A4LA 4TQ9A 2CK3A 1F5NA 1EYZA 2QROA 4D81A 1KSGA 1G3MA 4OK6A 1NI3A 4WAUA 4X8LA 2IYQA 1P60A 2PZGA 2I3BA 4Q9KA 1US8A 4A6PA 2JLXA 4OKSA 1LW7A 1UAAA 1T5IA 5IYZF 2BDTA 2YRXA 4D0NA 3GJXC 2REXB 2BIFA 1Q0UA 3IGFA 1W5SA 4QGHA 2V1XA 1EFUA 1MO6A 2GF0A 1YZGA 1Y63A 2F43A 2B21A 4LJYA 1E32A 4B3XA 1W0KD 2CCGA 4NH0A 4KSCA 3M0EA 2QORA 4IVQA 4JLNA 3SFZA 4DIDA 2A5FA 1YE8A 3CKLA 1NSFA 4NCKA 1HQYE 1NG1A 4FW9A 4Q21A 1ZIPA 4O4IF 1E94E 3PG5A 2GHIA 3QUSA 1W96A 3G8CA 2NU7B 4OI2A 4Y0VA 2GETA 1YRAA 2EVWX 1GKYA 2HXSA 4XVQA 2O52A 2N42A 3ASZA 3B9QA 3QQ5A 1I4DD 4IHJF 4MV4A 1NRJB 4G1UC 3L8ZA 4HDQB 4WZBE 3VHXA 4C0LA 2FSFA 1R5BA 4BFWA 3ZLJA 2ZI5A 1BOFA 1FQJA 5FUWA 2FFQA 821PA 1G20E 4RSGA 1ZVQA 1D6JA 2EFHB 2W2TA 3MWLA 1W2HA 4Q01A 4KVGA 1N5LA 2RB4A 4PPNA 2FMXA 3WMEA 1FQKA 2R8RA 3B1ZA 3SZRA 2ZDHA 3GLFB 3T12A 5JWOA 3QEOA 4OQLA 4MQBA 4F4IA 5ANRB 5FTKA 4FWTA 4C4PA 2OESA 4C5AA 4WW0A 5DLQC 5B2ZA 2V8OA 3R7WB 4PQFA 2VH5R 1E96A 2X19A 4HLDA 3AF4A 3GJ3A 3MWJA 2OM2A 1F2TB 2OXCA 3C5CA 1GUAA 2DB3A 3MLEA 4LV8B 4BWYA 4G5GA 2NO1A 4JL6A 2NZJA 4IDNA 1TPZA 4JMPA 4ZI2A 3IHLA 1D2NA 1C30A 1GG2A 4DHEA 4MAMA 4DLVA 1NIPA 2JEOA 4DLSA 5CYOA 2ZI7A 3MMPA 3TVTA 1WE2A 3KTAA 4OYHA 3TUZC 3K0SA 3RSOA 2XB4A 1KTVA 4DWJA 3W6NA 4D4KA 2A78A 4OI0A 1LY1A 1BXRA 1XF9A 3QEJA 3PV0A 2W6ID 2BBOA 2CMKA 3AP1A 3KQNA 5KX5F 3SJBA 4PHFA 2DIKA 2QRNA 1O3YA 4X8OA 3GJ8A 1F2TA 3I92A 2GK6A 2R6GA 1IN5A 3GD7A 1AKYA 4B71A 4FCTA 3M6AA 3GFPA 1UC8A 1KNQA 4QRHA 2GJ8A 4C0QC 5CITA 1CKEA 2IHBA 2QGNA 4I1OA 3WXMA 3MSXA 5KDDA 2OFOA 2J0SA 2ODBA 2YWFA 5EXPA 1R6BX 2SHKA 2WWIA 3IEUA 4NPHA 1PLJA 4KXFB 4NYMQ 1Q1EA 3REGA 4O2RA 5C8YF 2G9NA 3Q9LA 2QAJA 1X1RA 1J8YF 5EZYF 2W0MA 4CGZA 3OESA 3FHCB 2DWPA 4YAJB 4KHZA 3BB3A 2C78A 4YAKB 2FG5A 2HT6A 2RGXA 3OAAA 2FFHA 1D8TA 3BFVA 3PXGA 1DAKA 3SQXA 2IP4A 3KKPA 1IBRA 3VU9B 3VQTA 1OIVA 1YZTA 3C16C 2F1HA 3CX8A 2OT3B 4IOLA 4M9SA 5AJVB 2HYIC 5TARA 3RC3A 3NWJA 5AJXA 4BFXA 5KPJA 2G3YA 3RWMB 2VP6A 3VMMA 2C99A 4Q9JA 1IONA 4HB2A 1G7TA 3SI7A 2JLRA 4RD6A 1U98A 1IOWA 2BBTA 2O5VA 2OFWA 4UNNA 1IY0A 1E9EA 4KJZA 3SR0A 1CP2A 1OHHD 1YZKA 2ZS9A 3HR8A 4HYYA 1P9NA 1VG9B 2WTUA 1ZRHA 4I1VA 1P5ZB 3BIFA 5JJKA 3BFXA 2P6UA 5JH7F 3OFND 3A58B 5FBVB 2IYYA 4K81B 5E7MA 4L5BA 2ZUDA 3FB4A 3IEVA 4J0QA 3X1WA 3OEHA 4B76A 1KJ9A 5DYIA 2HJVA 1Z47A 3E2IA 2ZSFA 1R10A 4B2LA 3EC1A 1TL7C 4Q1FA 2R82A 4HZUB 3DZ8A 2NPIA 3Q2OA 3RRNA 3T1QA 1R0XA 3WBJA 4F7WA 4GDFA 2FGKA 2F9MA 2I8CA 2H16A 4MKIA 4D4LA 1SHZA 1DS6A 1KDRA 3GLFE 5CLLA 3QBVA 5GJBA 2C9CA 4JLJA 3GJ6A 4IW3B 3IIJA 3GLIB 2BEJA 1R5OA 3FMFA 4CEHA 2W83A 3PVSA 5LB2A 5AUNB 2Q9BA 1IN4A 2YJTD 1E4VA 1PLLA 5JHHB 3FPAA 3VKWA 4TL8A 4FCVA 1IXSB 2Z6VA 4OHVA 1FZQA 1SVMA 4Q02A 1G8HA 3UMFA 4YJ2F 1EGAA 1QHXA 4BE7B 4OBEA 1D9ZA 2Z5FA 3LWBA 4MA0A 1NY5A 4OJKA 5CM9C 1F60A 3EASA 1GNRA 2NGRA 5BW8A 1G5RA 2QE7A 4W9MC 1FNNA 4OHZA 3DMNA 2H1LA 1SGWA 2QPTA 2GVZC 2C5LA 2HYDA 3MWYW 1W48A 2EWWA 5K8IA 2V7QD 4QNRA 1D5CA 5IDVA 2NO6A 2ORWA 1FNMA 3DHWC 2CEAA 1EWQA 2ZRGA 2ZSDA 4NDZA 3K09A 2B8WA 4JBWA 3RHFA 1M2OB 1QHGA 1JDEA 2W2XA 1P75A 3B9PA 1E2LA 1N0VC 2MSEB 3BFKA 4HB3A 4TLBA 3D31A 3VFDA 1G3IA 2C9YA 1OH7A 1KI6B 2WHXA 4LBZA 4D4MA 2XX3A 4B44A 1IM2A 3AEZA 2OXRA 1KO7A 1U9IC 2HLDD 2L0XA 4LV6A 4ARZA 2JLZA 4TYPA 4MV6A 4IFEA 4MITA 1KKMA 2FZLA 3A37A 4CW7A 1G8YA 2WKPA 4MV8A 3ASYA 1NVVR 2ODWA 3PFIA 2ZRCA 4UXJA 3WYAA 2W6MA 2VPQA 5FOWA 2VHUA 3R5HA 4DCSA 3AVYA 3QXCA 2OZEA 4ZI3A 1G19A 5BXQC 2ANCA 4GOXA 1OSNA 2ZUCA 3K5HA 1KIMA 1UKZA 1YR6A 2ZRJA 3OF5A 3UIEA 1BMFD 4M1OA 5FBLB 4MDFA 2GJAA 5CB4F 4Q5IA 3DVLA 2RGCA 2J3EA 4Q9IA 4F4JA 4DB2A 3PEVA 5HKKD 4MYHA 1XMSA 4EJSA 2VA8A 4M9QA 4QGAA 3TR5A 3VMFA 4YMUA 3SS8A 2NO9A 1KJQA 4Q1CA 5AJYA 4NYJR 3DOEA 3SJAA 5B64A 5EJEA 2XB2A 4DDWA 3FHTA 3DOFA 3CR8A 5IK2A 3RANA 1FX0A 1KI4A 2A5GA 1ZUNB 2CHQA 3U6KA 4BPBA 3I3SR 3AP2A 3ZVRA 4POAA 1XDBA 2A5YB 4M21A 2IA5A 3N8DA 3BB1A 3KB1A 5D3QA 3ICEA 3NBXX 3KKMA 2R9VA 3B1WA 3DM9B 5GADl 2B8TA 1II8B 2Z4RA 3BOSA 3HPRA 1OKKD 4QJ5A 3VHLB 2Z83A 1S0UA 2CNWD 3A8TA 3EPKA 2CLSA 3LWNA 4TN1A 1I7NA 1BO6A 2WPDD 3BE4A 4BRUA 2DCUA 4A9AA 1WRBA 4PC6A 4FWIB 3LVRE 2H7VA 2JDIA 1J90A 3EX7C 4JBXA 4C7OB 2CDNA 3HYTA 3LV8A 2VHQA 3K0EA 4LYJA 4E09A 2PH1A 3A1SA 1S1MA 1GRRA 2ZR0A 5HCNA 3L0PA 1EX6A 2WM9B 4HLUA 4QHTA 1R5NA 3UWKA 1KZGB 3GLIE 2GZAA 4XD7A 5H8WA 4QJ4A 2XGJA 1ZJ6A 1FUUA 3IO5A 3A4NA 4F4CA 2WJYA 3W9YA 5KO2A 3AF1A 4XYMB 4F93B 4XTRA 4EUNA 3UG7A 1KI7A 2WAXA 3BD9A 3GLHB 3CH4B 1ZM7A 1U8YA 2Q21A 2QMEA 5GJVC 1M8PA 3T06B 1Z6YA 3EXAA 4LOAA 3GQBA 4IVPA 2EW1A 1NKTA 3HB9A 3NHBA 2ZJ8A 4EFLA 3IO3A 2UZ3A 2R7KA 3GPLA 1N25A 3NKVA 4MDEA 1GL7A 4U00A 4DDUA 4RFVA 1Z22A 1KJZA 2GZHA 3S1AB 1COWD 2G88A 3K9GA 5J4HA 1ZC3A 3KXKA 2QMUA 1KMHB 4QKQA 1Q22A 1QVAA 2YZMA 5FTNA 5H70A 1G9XA 4ACBA 2YL2A 4QL3A 2I1VB 2JJ2D 1T4GA 2EFEB 2BHRA 5HPYB 4MGZR 3ADBA 5DHAA 3O8RA 2FH5B 3ZVNA 4EPWA 1W36B 4PPGA 1IAQA 3L82B 4M1TA 2OBNA 5ELXA 3RRYA 2VQSA 4G5OA 5A4JA 1PLKA 2BEKA 2OO7A 4LBVA 4LI0A 5DIFA 4XWOA 2XXAA 4DVGA 4DRZA 5LD2B 2YS6A 5AJZA 2IEZA 2ZS8A 5TXGA 2FPIB 4M8NE 4E07A 2NU8B 2CJWB 3CH5A 3VR3A 4PAOA 1P9WA 1W44A 4EPTA 3ICQB 1QBKC 3OIWA 2F1RA 5LD2C 3CPEA 3AM1A 2EYQA 1CJKC 121PA 2VBCA 4L9WA 4OHWA 4HATA 3CX7A 1C3OA 2VF8A 3MWEA 1UJ2A 1UKEA 4A0GA 4GL2A 1HA3A 1G1MA 2CCKA 2YV5A 2ZSAA 3K70D 4Y0AA 4NYIQ 2O8EB 3CF6R 1N6HA 4V03A 3MUFA 4GFDA 5JJIA 3PIRA 4B3FX 2RGBA 1II9A 2ZRHA 4TLAA 3LLMA 3FMPB 4RCYA 4US1R 3PEUA 1E79D 2RGNC 2KSQA 3I8SA 4BFSA 5FTLA 4B73A 2B7BA 4BUJA 1HEIA 3I5XA 1VHTA 4P3YA 1NVXQ 4GP7A 4KFSA 2IYTA 3CB4A 4N1AA 4UNSA 3WYGA 3SJZA 1RJ9B 2CCJA 2VHTA 4MGYR 2WICA 1K6MA 5EUMA 1IJFA 3LA6A 1NLFA 4MGKR 4DUGD 1VPLA 2FF7A 4DT1A 5KU1A 4O2BF 3R5FA 4M1SA 5BYJA 3ETJA 2JIZA 1IOVA 3EIQA 3GEEA 3V4FA 5C2JB 2O8FA 1E1RA 5JVDF 2B7CA 3FHOA 1XTKA 2QGZA 3JVUA 4GP6A 5JWRA 1OKKA 3QXXA 2RGGA 3IDQA 2EFDB 2KE5A 3K0CA 4IXMA 4PSVA 1Z0JA 1RYHA 1Z83A 1G7RA 2ONJA 2XSZD 1G5TA 2QM7A 4MRPA 2GCOB 1ZNXA 5L3RA 5BWMA 4IWXA 1Z08A 3GEIA 1XMIA 3GLHE 2G1KA 3TVDA 2RMKA 1G64A 3B13B 3CPJB 4JKIA 4G01B 1XPUA 3R23A 2CK3D 4PHHA 1W4RA 3VR1A 1TMKA 1EZ1A 1Q20A 1U99A 1BH2A 3QKRA 2P6NA 2GDJA 2ZRDA 1A2BA 3AF0A 2FEMA 1N2CE 3B78A 2N46A 3NDBB 2PEZA 1E2NA 2X77A 2RHMA 2IF2A 2ZVPX 4EPYA 2GCOA 3CWQA 1SCUB 2FSIA 4HAZA 2H8KA 2ZAOA 3TLXA 4D0LB 2ZS7A 3TH5A 3RNLA 3F8TA 3B2EA 2E87A 2GJSA 1XFAA 4QG7A 2HJGA 3CR7A 1OT3A 2ZJYA 3RSLA 3MAAC 2JGNA 2ZE6A 4PX9A 2X8AA 5KOYA 1CTQA 2R6CA 3GJ5A 5CK5A 3THYB 1IQPA 3LRPA 5G3YA 4TTRA 1VHLA 3B1VA 1KO1A 1IXZA 1KNXA 2OCAA 3CO5A 4LX0A 1QHSA 5EE1A 2NMVA 2A9KA 1IN8A 1RW4A 2NO7A 1DAFA 3FE2A 3KDSE 5CJPA 2RGDA 4G0NA 2OCPA 3U61B 3EA0A 1GGOA 2W70A 3BGWA 4DLUA 2YOGA 1BNCA 1RYFA 1MO5A 2MMCA 2WKRA 4GT1A 4P4TA 4ZIRB 2R84A 1U0LA 4R2IA 3AB3A 1P7CA 4JYBA 1G4AE 5LOVF 2HJWA 1YR8A 2VIIA 4ITRC 2GNOA 3ZJYA 5JS8A 4LYHA 1NBME 5FI1B 5KSOA 1AA9A 2ZYUX 1M1YE 1B6SA 4R2HA 1CF4A 2ZJ5A 1GIAA 3I1FA 5JBQA 1OH8A 4P0TA 4LYFA 4TYNA 2QT0A 2ZXUA 2CZGA 2V4ZA 2GEVA 2OG2A 2XOKA 3P4YA 1J8MF 5J5CA 4W5JA 2GCPA 4FIDA 3TSZA 1FMJA 1GP2A 3P4XA 1SVIA 2YWHA 4JJZA 4ZIRA 2ORVA 2XTMA 1GZSA 2Q9AA 2ZSBA 2C96A 3U6BA 4DDTA 3ZS8A 2PBZA 1DARA 1E2MA 2IEYA 4QGGA 4Z8XA 3PJRA 2GJKA 3AVTA 4V0ME 3U3OA 5FR2A 1A82A 2F3RA 2QQEA 2V5AA 3WY9A 4B2IA 1CU1A 4RD3A 3W8NA 1ODFA 2FB9A 1CXZA 2A3RA 5FPTA 2OE2A 4Q1DA 4EGJA 1EX7A 5FBQB 3OIVA 3OE7D 1JAIA 2GBLC 4RD2A 1Q1ZA 4URZR 4XSHA 4CF7A 1UBFA 3NC1C 2ZJ2A 3CNOA 5JCPA 2DFKB 1S4QA 5AWFC 3QJYA 1R8QA 4TTPA 1P72A 2VTKA 1C4OA 2OLSA 2YC4C 3K70C 3CRRA 4B3BA 1VBGA 2LKCA 2WV9A 1E9BA 3LDAA 3SDZA 2ONKA 3BRWD 4C3ZA 1AKEA 2F6RA 4C5CA 1BYUA 4DLYA 3SYLA 3Q7PA 3THWB 1ZAKA 1O87A 3KFXA 3Q3JB 1W4BA 3AH8A 3U7GA 2RHDA 4GOJA 4BRWA 2ZEJA 2ZRPA 1E4YA 3EC2A 1FP6A 2OHFA 1XZQA 1ZD8A 3AGPA 3EG5A 1F2UA 3B1XA 3ZDQA 3ZGXA 2IYRA 3C15C 2IWRA 4GZMA 2PT5A 2C98A 2ZE8A 2AKAB 2YOHA 3D7MA 2EYUA 4NBSA 2QP9X 2VHJA 4ZI7F 5HCIA 2GWHA 4LJ9A 1N6RA 3DZDA 5FR1A 3CPHA 3BH0A 1XRJA 6Q21A 1TADA 4A8JC 5FTMA 5LBIA 1JEDA 2W6QA 3TINA 1RZ3A 3KQLA 3NVAA 3EZ6A 1JDBB 4ZOLF 4IOMA 5CYPA 4D82A 5HBRB 1XEXB 4YDHB 3HBLA 1AS0A 1KI3A 2FSHA 3T5GA 3IQWA 4JBYA 3LY5A 1RRFA 5DYGA 4ACAA 3QF4B 5C1PA 2I1QA 3THXB 2CQYA 1E2EA 2QPAA 4FMDF 2PX3A 1HT1E 1SVKA 2O8BA 2WJJA 5EXSA 3RAPR 1ZD9A 1AGRA 3FVQA 4H1VA 2OBMA 1BYIA 2BKEA 3MD0A 3MWKA 4NYMR 3TUIC 4EAQA 4MRRA 1NY6A 3DMDA 1X6VA 1EHIA 4PC7A 1E2HA 1U90A 3PUWA 4M53A 2REOA 3ZS9A 1TQDA 4AC9A 1DBSA 2GCNA 1ZU4A 3FWYA 5FOTA 3RYTC 3U3KA 3KXIA 5CDFE 3OEHD 3AKEA 1ZP6A 1JEEA 3VKGA 1GILA 5EZ5A 5HZHA 3JRXA 4IKEA 4MYCA 5KSZA 4IHQA 4DCVA 2VP2A 1XNJA 4GMDA 3U44B 2BM0A 4AKHA 3L8YA 4FMCB 4TL6A 3BAFA 1LNZA 1T0HB 5CLQA 3TSOA 1HE1C 2OV2A 3QE0A 3G5UA 3UKDA 4EKDA 3TW4A 1E4EB 3C4JA 4V0OA 2J0QA 1DAEA 3Q85A 4KLZA 3K9NA 1L8QA 3AP3A 4Q4LA 1F3OA 3FKSA 1UBEA 3L2OB 1N3BA 4HAWA 2QE7D 1CULC 1LFDB 3RWOA 3LP8A 3T1VA 4L1KA 3IBYA 3N5CA 3ZD6A 2KBFA 3AVXA 1KK2A 3U2QA 2DWQA 2ZVQX 4RKEA 1JECA 2GILA 2W6ZA 2F7SA 2KBEA 3EARA 5FUYA 2KI5A 2B6HA 1L4YA 4MKGA 3NBFA 1CJTC 5DI3B 4A6XA 2JLWA 3K8YA 1XD9A 4YBZB 1MO4A 2FGJA 1P4SA 1IY1A 2F55A 4IJMA 4TLDA 1KZ7B 3QY0A 1R2QA 3JZMA 1VYTA 5HV6A 2GEUA 5EP3A 3ETLA 1E2FA 1SQ5A 1ZBDA 4KODA 2IUUA 4Q1BA 3GLFA 2BWJA 1M7GA 4LSGA 2ZJBA 4QHYA 3OE7A 3OUUA 3JZAA 3TW8B 1NP6A 2X1VA 4CDGA 4A82A 2NIPA 3N2EA 2AHOA 1GRQA 2C95A 5DI3A 1J99A 4RFSB 1SKQA 3R7WA 2QUZA 5CJ2A 3W5JA 1E2PA 4DSOA 3EPHA 3EIHA 2YRWA 1RFLA 3UG6A 1WDTA 2QAGB 3T1TA 3HR7A 4AG5A 4DB4A 4US2R 5KDLA 4ZDKA 3EIEA 1W49A 4M9XA 4M2LA 3ONWA 5JI2E 3HDTA 4KFTA 4YLGA 1KI2A 3L43A 2H92A 2D3WA 4LZZA 5DSZA 5L3VA 3W5IA 4GNKA 1KO8A 1XBTA 5IK2D 2J1LA 1E9SA 1NVUQ 3Q1KA 2QTFA 1YZLA 2QAGC 4NL4H 4MV1A 2O8CB 1G21E 2Q0HA 1YR7A 4P4UA 1T3LA 3AVVA 2Z0MA 1VG0B 5CDFA 3O47A 2R7MA 2V6JA 4IOJA 1RKBA 1SXJB 1N6PA 2IXGA 1Z8FA 2ZJZA 1R4AA 3TBKA 4RCZA 4OHYA 2ZR9A 2BMFA 4LHZA 4RJLA 1TTTA 3I72A 2JJ1A 1MRNA 3E70C 1YZQA 4HDOB 4PTLA 3FYHA 4JSTA 4DLTA 2GESA 2JDID 5E4FA 4TT3A 1E9DA 5BQ5A 5K8UA 4F91B 1SXJC 2CLCX 2ZREA 1W0JD 4LCBA 3THOA 4D26A 1A2KC 2C04A 1G3QA 4XYLB 3TR0A 3WNBA 1T3HA 4C0SA 2YVUA 4JLDA 4MGIR 5KHOC 1DV2A 4DIEA 1G8PA 2J9GA 3KKQA 2P5TB 4TMKA 2DYKA 2VEDA 4Z1MA 3VAAA 3AVPA 4XD7D 4DEXA 3NEYA 4ME6A 3KXLA 3SQWA 5BPFA 3BORA 5SZHB 1N0WA 1R0YA 5JRZA 2J7PA 3VU9A 2V1UA 2V59A 3U9TA 4UKDA 2PVPA 4BASA 5JEDA 4HZIA 1HY3A 2ZU6A 3CNNA 3MWDA 4HUQB 4YDSA 3R9IA 4ZKDA 3LBNA 3E1SA 1T91A 1WF3A 1I4TD 2ASEA 3VTKA 1U94A 4Q00A 3EZ9A 4BLSA 2FZ4A 4B47A 4BFZA 1MO3A 1FFHA 2F9LA 2P67A 1E2QA 4PQRA 1OW3B 2V54A 4EG0A 2AWOA 3T34A 4QM7A 4IZOA 4GMXA 2FN4A 1W2GA 1ZMXA 1E2JA 2AD5A 3LLUA 3I62A 3NG1A 4NONA 3DKPA 3UK6A 3U4QB 1OXXK 4LYAA 1JR3E 4D80A 2FX3A 4JVLA 3LQRA 1M6VA 4IVRA 1N6NA 3VPDA 4ZDWA 5TMPA 3DDCA 1X8LA 1G16A 1UDWA 4WZAE 3V4SA 3DL0A 5FBRB 4E5UA 4O3MA 3CUEF 2A30A 4DJTA 4I50F 2IL1A 5G40A 5IRCD 4HNTA 4LJ8A 1Z3IX 2YYAA 4DLXA 1DEKA 4N0EA 2IYUA 2YINC 4HZUA 2FPGB 5EE3A 2QEQA 4CEIB 1VDZA 2FPLA 2OAQ1 1W1WA 4QFMA 3VNVA 4PHGA 4OQFA 1ANKA 1K5GA 1OJLA 2JLQA 2CHGA 3A4MA 1AUXA 3GLIA 5FPSA 2CVFA 1IY2A 4BEJA 2C2HA 4PO1A 5LP6F 1D9XA 4WD3A 4QBHA 1OFTA 4I1UA 2B92A 3EW9A 4C2UA 5KNCA 2YZ2A 1GOTA 3CZPA 4BLOA 1VKZA 4O2LA 1KDTA 1VIYA 3QKUA 2F1IA 1OB2A 2ZDGA 5D8DA 2VYFA 3W6PA 4II7A 3MGCA 5P21A 3T5DA 2ZYVX 3LNCA 1KAGA 1AK2A 1TQ2A 4TL9A 1H65A 2IS4A 3LBIA 2WKQA 4RZUA 1NJFA 3GLGB 3ND8A 1DTSA 1ZUIA 1MABB 4AYTA 1S3GA 2EU8A 1U9IA 5BN5A 4B3GA 2ATXA 4PFSA 1FMLA 1X1SA 5LB4A 2BMJA 2J5XA 4JVMA 4LWZA 3KQKA 4G5SA 1G5PA 4W5HA 1AGPA 1XCMA 4JLBA 3REFA 4DCTA 4PXAA 1Z2AA 2W6PA 1KI6A 5B30A 1KMQA 2D4HA 4GSYA 1AZTA 1GL6A 1SXJE 5LA6F 2IBMA 2XNSA 1S9HA 2DZDA 3I4LA 3KJHA 3ND9A 4UNQA 5J40A 1XXHB 1NBMD 3NBYC 3QPUA 4HB4A 5TDHA 3FOZA 2CE2X 2I87A 1H8HA 4KBFA 1CIPA 1KDPA 1UBCA 1E99A 5CA0F 3SYKA 1TU4A 3H1TA 2QI9C 4KFRA 2IWHA 1J70A 3GIDA 2J0VA 5FPHA 4NTZA 4YC7A 5J4VA 4EJSC 3BXZA 4C2TA 2ZROA 3VPCA 2XEXA 4LHXA 2JIZD 4H9GA 4LRWA 3N70A 2EFGA 4PC1A 1E1RD 4KYIB 4RD4A 1NMZA 2NPFA 2RAPA 1NMYA 4IEIA 3E5HA 4NYIR 3K1JA 1OFIA 3A1WA 4HI0E 1QHIA 4LC0A 2P0EA 2QBYB 3UFXB 2GJ9A 4I55F 1UC9A 3QNUA 3AVQA 3BH6A 4ESHA 2IS1A 2XNDA 4X8HA 4Y8VB 3DPUA 1Q44A 2HUPA 2WZQA 1G4UR 2PN1A 2BM1A 4B3CA 2ORIA 2ZYWX 5FOXA 5AUOB 3P27A 2WIBA 4HLCA 1W0JA 5GJCA 3RVBA 4A2PA 5KPDA 5L3SB 3H84A 4DEYA 3NTUA 2WWYA 2VL7A 1Z06A 4E4TA 3ORQA 1Q3HA 3F3YA 5D3MB 1TUEA 3QSYA 2W6OA 1II8A 3HYRA 1DAHA 3K53A 4O25A 4U5XA 3U7HB 2NU6B 2Y8EA 1R7RA 2D7CA 3QG1A 3RV3A 1HUQA 1Q21A 3P20A 3KJEA 4JS0A 4CEJB 2IXEA 4UXHA 2PLFA 1TEXA 1KK0A 5JWHA 3VKHA 4C7OA 4TLCA 1JXMA 4FMBB 1CJVC 2WWHA 5DHFA 5A0FA 3T61A 4BZXA 5JEEA 1AS2A 4QM6A 5FI0B 5L8VA 5DN6A 5D3MA 2GLTA 1R8SA 4PZYA 4JLVA 1ZM9A 2MMGA 1DV1A 1NN3A 1V43A 2WWGA 1VTKA 1YZNA 5G53C 1AZSC 1SZPA 4HNUA 5JMTA 2PCJA 3GLHA 2R7NA 2R6FA 4M9ZA 4XVRA 2R86A 3R5XA 4TLEA 1R0WA 1WQ1R 1CJMA 1H8EA 4A2WA 3MFYA 1YJ5A 3DO6A 2Q9CA 1XTSA 4M1WA 5CA1F 4Q9LA 1UDXA 2ZI3A 3D3QA 3AKDA 2BV3A 3LXRA 3QG5A 3GLGE 3AQ4A 4EFNA 3WNZA 3GP8A 3S1AA 1A9XA 3GFTA 1AJEA 3CRMA 1RC8A 1S8FA 2XOKD 1TF2A 4JLMA 4XSGA 1KMHA 2GXSA 1KY2A 1BS1A 2J59A 2VRWA 2AK2A 1YRBA 4MA5A 1XEWY 4OK5A 4TSFA 2J9RA 3K0FB 2GAAA 1AUVA 1LVGA 3I32A 1S1CA 1G6HA 5JQWA 3HPQA 1XJCA 4P31A 1ZNYA 3H2YA 1CR4A 3CWZA 3R9XA 1ZC4A 3Q7QA 4KV9A 4TYWA 4TQUS 1GSOA 1T0JB 1P2VA 1XXHE 1PUJA 3B8HA 3VR4A 3ZIAD 1JNYA 2W71A 2QY9A 2BJWA 3LAWA 2ODNA 2IYLD 2ODEA 1T3SA 2VHCA 2GXQA 4PC2A 5KNDA 4KU4A 1WP9A 3CM0A 4G5RA 2GXUA 3BG5A 4LK2A 2DY1A 2CJWA 1GSHA 1CJUC 3LX5A 4OI1A 4EQ6B 4XWKA 2ZE5A 4JJKA 4MKHA 2LCFA 4Q66C 4DSUA 4V02A 4URUR 4LJ5A 5AJWA 3WBKA 1DAGA 5J4KA 4I99A 3WMGA 4WXRA 1KK3A 4UNRA 2R6AA 2BBWA 3QKSB 1NBMA 2QSZA 2WBLC 4JVSB 2RGNA 4NP6A 4BFTA 2AD1A 4DDVA 3K0AB 4QBIA 2SCUB 1NLZA 4D25A 4MH0R 1OFUX 3H4MA 2XZOA 2O8DB 2O8EA 2WJIA 4LPKA 1ZNZA 2E9SA 1A4RA 1FP7A 1I2DA 4B33A 4F38A 4DLKA 2XCLA 2QTHA 5JSZB 5C18A 4C5BA 2IUTA 3AF2A 1DPFA 3PUYA 4PAQA 3J81k 1M7HA 3PCRB 1KJIA 4U7DA 4O4LF 3R20A 4V0MA 3HP1A 1EUDB 2QTVB 3TIIA 4EFMA 1NNEA 1E0AA 2ZI9A 3GMTA 3IHWA 1Z0DA 1GNPA 4QXAA 4V0KA 4B35A 4B6FA 4XZ3B 3CF2A 3X1YA 1RJ9A 4MUAA 1N5IA 3EA5A 5FL7A 1KSFX 2PZFA 2CHVA 2N1BA 4AKIA 4NHOA 4ZCMA 2PLRA 4H1UA 2FNAA 1G3RA 3K0CC 3LBHA 1G41A 4NU0A 1Z5ZA 3V4RA 1XTRA 3CNLA 3HU2A 4PSKA 2OEPA 1IXRC 5KYKA 5JSZA 4TV9F 1E1QA 4WIAA 3V00A 3O8DA 4Q18A 3MJHA 4FN5A 4NZYA 2QL6A 4Q48A 1ZCAA 3ZZTA 4MV3A 3QVUA 2C03A 1UM8A 2WAYA 4B43A 3WHLA 3WP1B 1OB5A 3KX2A 4WBNF 5FUXA 3KQUA 2ZRIA 4NCNA 4DCNA 2FE4A 1HV8A 1WBDA 4JL8A 3TQTA 1OXVA 3B6EA 3RABA 5AK0A 2IC5A 4I81A 1P62B 3SNHA 3P32A 1MT0A 3WO0A 3LXXA 1EK0A 4Q4JB 2CL0X 1N0UA 4JZKA 4C30A 1B6RA 2NO0A 4IDPA 3ZZ0A 4BECA 3EPLA 1KO5A 1QRAA 2BMEA 2R2AA 5EE0A 2QENA 4BFUA 5GONF 4PO9A 2OSBA 4DXAA 2Q6TA 4W7SA 1PJRA 3H0KA 4TZ6A 2KWIA 2FJUA 2Z4SA 5EZ6B 3KB2A 4P33A 1Z6GA 1XZPA 3EZ7A 3LW7A 4A2QA 5BYKA 1N5KA 2YWEA 1OIWA 4RD1A 4A92A 3GFOA 2CBZA 1VG8A 3LD9A 1MR3F 3OIYA 4BLPA 4ILEA 3CONA 3C41J 1DOAA 1KEEA 4Q9HA 4S35A 1W46A 3ORRA 1NIJA 1Z6AA 2OLKA 3FKSD 4Q7JB 5C4GB 3THYA 4C0BA 1CQJB 3CW2A 1IJEA 1GFIA 3FFAA 1ETUA 1TNDA 3CZQA 5C4MA 4C9BA 1AS3A 1RRGA 4M1KA 3C5HA 3TAHA 1JR6A 2DFNA 1RRCA 1XEFA 1W4AA 1OXTA 4JLPA 3SYNA 3WO1A 1XMJA 4B48A 1K8RA 3GJ0A 4HB0A 4LJ4A 4HNVA 2NG1A 2X2FA 2ZSEA 3ECCA 5EP2A 5EP4A 5HE9A 4EIWA 2WIAA 4TYQA 1KGDA 5FBWB 2RH5A 3L0SA 5JVLA 1HQCA 5KUTA 4US0R 4BLTA 2WJHA 3ZIAA 3K70B 1TX4B 2J0UB 4HAXA 1Q1QA 4HQ6A 4TMVA 3EWAA 3MG9A 5JS7A 3QXSA 1M34E 2ERXA 4UJ5A 4ZO4A 3RS7A 2G0TA 4OI4A 4AKGA 1QG4A 4LY6A 2D2EA 2FPKA 3I5YA 4LPSA 1JLLB 421PA 3A6PC 1VG1A 5G41A 2MSCB 1EUCB 3WYFA 4EDHA 1HTWA 2EWVA 1MOZA 4AIIA 2GEDA 5C1OA 1P2UA 3RS4A 4B75A 721PA 3EZ2A 3A1VA 4JLOA 2XTNA 3NBZC 2PJRA 4LHYA 4QJ3A 4TQAA 4TMXA 5H80A 4D2IA 2YKGA 1XD2B 2WJGA 1JPJA 5SZKB 2PX0A 3EZFA 4NMMA 4IXNA 1KJWA 2P3SA 1JAHA 1E2DA 2DFTA 4M1MA 3ETHA 2AK3A 3TK1A 1I7LA 3T35A 4YXWA 1CE8A 4JSYA 5DI9A 4TMZA 4A8JB 4A15A 2UZIR 5M04A 4TL7A 4IWYA 4BQSA 2K5UA 4HR7A 5E3HA 4DC9A 2G1JA 1C1YA 1SHKA 2VSXA 5B58C 1KSHA 4URXR 1AM4D 2H18A 3NC0C 2ZANA 3AKCA 3LH5A 4A36A 2V55B 1W47A 3CRW1 3RC8A 3NIBA 2ZDQA 2HF8A 2VO1A 221PA 4OK3A 3RV4A 1N5JA 1ZIOA 3SBDA 4HDCA 4CIDA 4ASUA 2ZU0C 3SU8A 2OAP1 1KJ8A 1E3MA 2CL7X 3THWA 1Z29A 1JQJC
chains in the Genus database with same CATH superfamily
3EEYA 2HDHA 1FVFA 3H04A 1XCBA 3C14C 4RV9A 5EHNA 2NQ2C 4G0MA 3CXRA 4YALA 3GRVA 2VYVD 1AH2A 4KXYA 4BV9A 4DBZA 5CCXA 1Z0FA 4KP7A 3D6JA 2C9OA 2HMUA 3SXPA 4B34A 4RVNA 5U9CA 3VHXB 1TMGE 1K66A 2YFQA 3PDHA 3U3RA 4F4YA 3UJCA 4JH0A 4XI9A 4DYDA 4EEQA 1PV2A 4M7EA 4ER6A 4JB3A 1JQBA 4ZC8A 4QVGA 1ZSYA 3JQ8B 4GRAA 2QPOA 5EMHA 2RKOA 1ZA2A 3QK7A 3MINB 3S99A 1KS2A 3A9WA 2G83A 1XPOA 1E58A 4JCOA 1DG1G 5HA5A 3TE6A 1JR3A 5GV7A 2VUHB 4I4TB 4HSEA 3OF2A 4R41A 4RZSA 2C3MA 5FORA 2YHSA 1OLUB 3GJRA 4BRZA 5ITSA 5K6RA 3AVUA 1QGOA 4L9SA 1H4QA 1T4BA 4QT0A 1K82A 1AN0A 3EEOA 1Y9ZA 2ZITA 4Z7NB 1AKMA 5H83A 2O2IA 2LBPA 4FYVA 3T1HB 1PJTA 1K9VF 3RGGA 4TZTA 1HFKA 2CHUA 5CLHA 1UKYA 3VX3A 3VOAA 1S3SA 4CFSA 3GEHA 3NWBA 1RCTE 1TH3A 2W8ZA 3ZY5A 3KR9A 3DTVD 2E4WA 1M6WA 4IF6A 2PS9A 2ZBVA 2WSMA 2DHYA 4CCYB 3MTDA 4FDAA 2DAGA 1NF8A 1HYEA 3ZJUA 4OYLA 4TVBA 3R44A 4RZ3A 5BN4A 1WHSB 4FFBA 3HUEA 1DBIA 3F71A 3UPUA 2JJ8A 4U6PA 4EVIA 1C9KA 1DHRA 4KIWA 1OQYA 2FR0A 3SKXA 4MB7A 2R8IA 5EWLB 2R4EA 1LF5A 3U7IA 5DHPA 3HV2A 4WBNA 3EH2A 1PK9A 4OX9M 1XAGA 3NTVA 1KEZA 2HCRA 3FTQA 3CO0S 2JLYA 3GUHA 4B3DA 4R9UC 1HT2E 3E9ZA 4URYR 2F00A 1GG9A 2DR0A 5ESDA 5C31A 4UFZA 3E3OA 5J2TB 1J24A 1KQOA 5LYJF 5AXBA 1PFGA 1Q5PA 3X1ZA 2WUFA 5F9FA 5ALKA 3WK6A 3A06A 3OJCA 3D54D 3GLTA 4E32A 1E7SA 3HDQA 3DZBA 3NT2A 3HHYA 1CG6A 3ZDAA 1V5IA 4KMOA 4WK4B 2I80A 3B48A 3A70A 4ND5A 3FVVA 5KVQA 5CBKA 3TGPA 3G1WA 5F35A 1CUEA 3CCFA 4L16A 2NT4A 3LUGA 1PTKA 2XYHA 3SE7A 3SC3A 5CAEB 5LIRA 5IFKA 1P1CA 4B6EA 4C2BA 4QDXA 4GR4A 5CJJA 3A3YA 2QZPA 3SJUA 2HK8A 3C8ZA 1XRRA 4X1IA 4ZHQF 1DGFA 1HDOA 1XU4A 3KG2A 1E7RA 2LVPC 4GMHA 3RS5A 4LC1A 5KTNA 1RYMA 2I4NA 2P91A 2QRMA 4DL4A 4L5JA 5GZ3A 3I61A 2A0YA 4XBOA 1ZJWA 4K7JA 2AYXA 3CN7A 5F3RA 3ZWYA 3GZNB 3ZIDA 2J45A 2GKSA 4IHJA 2YFYA 1V39A 4EATA 1UWKA 2V65A 4W82A 3FUUA 1VPWA 1XMOH 4YB8A 2O0KA 4JC8A 4PCAA 4R7ZA 2Q2VA 5KYWA 5JO9A 2EDAA 4UFOA 3H7IA 4BZPA 1YKSA 3WKEA 4F8EA 1NQTA 1M34A 1FYDA 4NBWA 3JAWB 3RFTA 1G7SA 3K16A 3QKRB 2G63A 2CNWA 1EAMA 1LTQA 1PFQA 2WPDA 3PITA 5JY6A 2OZLA 3GDOA 2F3TA 3TLEA 2XR1A 2G1UA 3A9CA 4EEYA 2XUAA 4OAPA 2C2WA 2WUVA 1PNOA 1ZH0A 4HUTA 1HE8B 4N54A 1XNRB 4GSKA 5CM8B 4YWJA 4NCXA 4PYMA 3SX2A 4TMTA 4OX9Y 5EJCA 3WJAA 1N33H 2O2DA 4ARUA 2FUG1 3AR8A 3WB2A 5K6AC 2H5XA 5KNBH 3KJNA 3AEYA 1V35A 5KPZA 5JH7A 1AKWA 3NYIA 3WIUA 1LSOA 4L22A 1B74A 2NYVA 2JCSA 2QZJA 5ICGA 2QIOA 4NX2A 1CPYA 3RYCA 1BEEA 3G7SA 4NJOA 4IILA 4LUCA 3ZGLA 1ZH6A 3W5BA 1FY2A 3TSCA 3UMRA 1OWOA 1GYFA 1E1CA 5BT8A 1EUCA 3HA5A 4V0NA 4C0JA 2JIMA 1VHWA 5DYTA 4GI7A 3RVPA 2FPMA 4KWEA 2C59A 3TTSA 4QBGB 3N8NA 2XRZA 5CD1A 3HKEB 3TMKA 4QDZA 1ODLA 4MRMB 2PR2A 4R8SA 5JCOA 5JANA 1KIAA 1SBHA 3GCXA 3U7JA 3THRA 3L8EA 2IH4A 2OOBA 4OKSA 2FZ5A 2HHAA 3ELBA 1X77A 3T9BA 1W96A 4U3JB 2YXDA 4WKCA 4W5OA 2H1OA 1WXXA 1TM2A 3TQHA 3SQLA 4B1FA 1X2BA 5IZCC 4BTVA 1W2HA 2Y93A 2VDUE 2R8RA 4X64M 3DGEC 1UPBA 4CETA 2J32A 1ZGZA 1Q7BA 1R9GA 3RSHA 4MWGA 5LZ4A 1YVUA 1T3NA 4YQEA 2X19A 3E9DA 2IY8A 2PRKA 2BP7A 3MLEA 4JR2A 3CSUA 1XMXA 4LCJA 1BXZA 1MJNA 5DZSA 3H2GA 4DIFA 1G5FA 3GIKA 4G8CA 3AY3A 1XKXA 2A78A 5JYBA 2CYAA 4UE3S 5CYGA 4GIBA 3GD7A 4FCTA 1KNQA 2HA5A 2XKKA 5TMBA 3NCHA 1VB5A 1YT5A 4ZU1X 4YAKB 2QCUA 1JB9A 3WGQA 2JA6G 2B82A 1OLSB 4PZ9A 3JASA 5TARA 3K4HA 4O4LB 4O4JB 3W5DA 2ZTDA 4Q9JA 3W5AA 3WGHA 4RD6A 4FFOA 2VDVE 1IEVA 4LK3A 3QFCA 2XFSA 1K0FA 5CT8A 2AF4C 3GDWA 3FB4A 3L4BC 1R10A 3DLTA 3EC1A 2UZ1A 1C9JA 3UYLA 4ZK2A 2PKYX 3QWLA 3GLIB 2K47A 4OGGA 3G2PA 1DIHA 1SD1A 5DBGA 5F12A 3FPAA 2XD9A 4K6FA 4OBEA 3VNAA 1D9ZA 1YTLA 1EIJA 3ZE7A 5LLDA 4KO3S 1PZEA 3CE9A 1P9LA 1SGWA 2EWWA 3SXUB 4WCDA 3DHWC 2YN0A 3AY7A 1M2OB 5HZMA 2VJAA 4RPJA 3DBLB 1L2BA 4F3KA 2RC6A 2O0MA 4A3BG 3RTCA 2L0XA 4LV6A 1OXKB 4TYPA 1F2DA 2DY0A 3AFHA 1AXEA 1MW9X 3NBAA 1DIGA 5FOWA 4RIEA 3N8IA 2NM0A 2V7BA 1OA1A 2DPYA 2RGCA 1UL1X 3KHLA 3VMFA 1QTRA 4KXNA 3IUPA 1D0KA 4MQMA 3JYPA 2QRVB 3DOEA 2DUNA 1T25A 3MTQA 1FX0A 2C1XA 1O0BA 2J48A 3AP2A 2IA5A 1NJSA 3BB1A 3OPYA 1ENPA 1GEEA 4DV0M 2ZYAA 1LVHA 3TLGA 3HPRA 4RZQA 5KJ6A 3VOBA 4FP9A 3LVRE 4LF8M 4AZ3B 2CDNA 1ZUNA 5GPBA 2VHQA 5A3QA 3QEMA 4HL4A 2GZAA 1H66A 1I10A 2FYTA 1KVRA 2ZT6A 1KI7A 3IA2A 4QXRA 4ZI7A 5GJVC 1RCUA 3TLYA 5KQDA 3BKXA 3NHBA 1XEAA 3IO3A 1EFPA 5E6RB 4S1TA 3M9XA 4EBFA 2ZK7A 5BUQA 5DHRA 3FA2A 3RB8A 3SIPA 2M2IA 5ECGC 2OD2A 4DSAA 2NTEA 3ZVNA 2O01F 2AYZA 4DNPA 4KK4A 2NQ8C 1IC6A 4DRZA 4L6V6 4JXXA 3VH2A 3AC0A 3R09A 4J7CA 1OIPA 1EXDA 2F1RA 1R9MA 5ESRA 1F4PA 5JAPA 3ZWVA 121PA 2AXEA 1CUKA 4L9WA 4OHWA 4UVDA 1G1MA 4EB6A 3WB9A 4NYIQ 3HRKA 2ZULA 2CW8A 3MUFA 1P1RA 4PVCA 3ER6A 4GP7A 4N7MA 1QOZA 4UNSA 4E14A 1V1JA 4I4CA 1X0VA 2P2CA 5KU1A 2ZW9A 3HM2A 3V4FA 5F1PA 3O2JA 4N03A 2B7CA 1O58A 5F5XA 4GQAA 2XODA 5NLLA 1G5TA 4A73A 5KPTA 5DXAA 1LJLA 3IS3A 5ES4B 4GYJA 5EJMA 1A2BA 1SWWA 4OBXA 1YLAA 5JS6A 2RHMA 2NPOA 4ZCQA 3BK2A 4RJ2A 3BMQB 4ED3A 3BRSA 1KEEB 3F1KA 4AJ2A 4PX9A 3BXHA 5KOYA 3GJ5A 5CK5A 1RW4A 4G4NA 1I3CA 2OCPA 4C3UA 4GT1A 4DPMA 4LKRA 1HL7A 3OTHA 4DMFA 1EI9A 1IIRA 2BW0A 4B6RA 3SI8A 3KTFA 1WS6A 2AZMA 1N0IA 1T24A 2C96A 1VHJA 5B53A 5JT1A 4ENTA 4DG9A 3MNFA 1P0MA 2WF7A 2GAFA 3P52A 1DQYA 4APMA 2XMCA 3OE7D 3OKCA 1JAIA 1TVKB 4WINA 4LY0A 3WLEA 3WOHA 3G1UA 1C4OA 5CGZA 4XYGA 4AY6A 3MIZA 1E9BA 2CXHA 2PR7A 3SDZA 4C5CA 4PVDA 1ZAKA 1O87A 4INZA 1GPWB 1VL0A 4D4GA 3ZHTA 3I6QA 4HWGA 1XZQA 3QX9A 3S1SA 5JUMA 1UM9B 4JITA 5EFZA 2EYUA 4LJ9A 2X9LA 2J6IA 5LZ2A 1Y14B 4MS4A 5FTMA 3LQ2A 3U1BA 4M9CA 5GGXA 1LZKA 1BKSB 1E2EA 4U0KA 2PX3A 4UU0A 2WJJA 3TMAA 1CY8A 1ZD9A 4EW3A 3MD0A 2GFIA 3TDNA 1I0LA 4M53A 2QVBA 3FWYA 1E7MA 5JAZA 1W76A 5ENDA 2C1EA 3VRHA 5DX0A 1F7VA 3U44B 3HLKA 4QREA 2OXEA 4A3KG 1HE1C 4EKDA 5K99A 1KH1A 2VBFA 5CDHA 1IY8A 3LKZA 2GWRA 3TI7A 1VJDA 2GILA 3F5MA 4MKGA 3OHPA 2QE6A 1JHUA 1QYRA 1GYQA 1HOTA 1XD9A 2F3SA 2HIAA 3BPSA 2GEUA 4UMFA 5HWSA 2EKQA 5JXHA 1NHWC 1QWSA 5CPBA 1DLIA 2FZCA 2QUZA 3UBMA 2ZM6M 2G3QA 2GPJA 1WDTA 2QAGB 5DIZA 3T1TA 4DB4A 4PRZA 1QM5A 4RPCA 1ESEA 1Z73A 2FWPA 3Q1KA 1VG0B 2IV2X 4W1SA 3OCWA 4FYPA 1BD4A 3HJCA 3OICA 1AXRA 3E70C 3AYXB 4IRMA 2GUWA 2WYOA 2BGTA 4EX6A 1K63A 5D5HA 1T3HA 1DV2A 1G8PA 1NXPA 3C8MA 1YR3A 3A6DA 1ORIA 5BRJA 3BORA 5JRZA 3I42A 3U9TA 2PGJA 1I4OA 3VTKA 4EHIA 1U94A 1FFGA 1DGHA 1GG8A 4G8JA 1PR5A 2IGBA 2OGUA 4MUYA 4DR4B 2A9VA 3H5LA 3IVCA 2DHDA 4W8GA 3CR3C 2A30A 1C1HA 2DAKA 2PTGA 3OA0A 3Q10A 5EE3A 4ZOBA 1VDZA 2F5QA 3IVRA 1OAOA 3L7KA 1XQWA 2Z58A 1DWQA 1B0PA 3K6RA 4WI1A 3EW9A 2QRQA 2VDRB 3RQIA 3OSZA 4UHKA 1VIYA 2OO3A 2CW5A 5EJAA 4TL9A 4UFPA 3BMOA 2EF0A 4GWLA 5E9JA 5U4QA 2LTUA 1XCMA 2IYAA 3REFA 4DCTA 1OC4A 1NNUC 3PTAA 2R5FA 3LGSA 2G04A 3WLIA 4UNQA 2ZJ3A 1NBMD 4H0FA 1KDPA 5CA0F 1N2SA 2C2YA 2SKEA 3SIXA 4YC7A 1U28C 1UAYA 8ABPA 2GZ3A 1Z0UA 2GZ1A 2RAPA 1JSLA 4QIWE 1ZRMA 3ZOKA 4ZA2A 3ZCQA 1SOUA 5HS4A 2HUPA 4B3CA 5FLYA 3E58A 1QCDA 5ADWA 1AX9A 5L3SB 1CQPA 3A6JA 4B87A 1TWFA 4OBWA 4B79A 1GU1A 4E4TA 1L5OA 3X2EA 3QSYA 2HVSA 2VT6A 1CZNA 4RTNA 2IU4A 1MU5A 1TD9A 3KJEA 1TJNA 2FE8A 3VKHA 4R5HA 1LX6A 2OP0A 5KQ8A 1KORA 2JY6B 3S8EA 4F04A 3NM4A 2CLLB 4IDDA 1AZSC 5IYZB 2R7NA 4A2WA 3ZOZA 3SEQA 2XF8A 3D3QA 1Y1LA 2CXOA 1R5LA 2R8GA 2LVNC 4KXLA 2UYHA 1A9XA 1ILEA 1WOYA 1VJ1A 4J1TC 4HNAA 5IDXA 1G6HA 1ORWA 1XJCA 4M7RA 4UVHA 3I6MA 3CURA 3OWXA 4ZJYA 1Y3HA 3JYNA 4BMZA 4LSZA 2BJWA 2IYLD 2O2YA 5A4AA 4UCSA 2ABWA 3V1UA 1G71A 2WTXA 1DAGA 1LBIA 4UNRA 2ZAIA 1M1YA 1FJ2A 4JVSB 3I4CA 5M34A 2HWYA 3DFFA 1A4RA 1I2DA 4BJ3A 2QZZA 1DPFA 1KJIA 4U7DA 5C5EA 2JGJA 1IQ0A 3HZOA 4EFMA 2HNBA 3O7MA 4OXQA 1GNPA 2JFBA 5ALLA 4XZ3B 2W8BA 3GPIA 2DAEA 2Q9UA 1WG8A 2N75A 5IFLA 4EJMA 4HD8A 4IIEA 4Q18A 1ZCAA 3ZZTA 1XB2B 1QH1B 2EEPA 4WNYA 2FE4A 1HV8A 5AK0A 4ZICA 3EMKA 3X43A 3I9V1 4A23A 4BECA 3S8YA 1Z68A 4OXXA 1KO5A 2R2AA 1STOA 3D59A 5KT3A 3ET4A 5JXGA 3UYKA 1NRIA 1JHAA 3CC8A 4MEJA 1N5KA 3IKLA 1YOBA 5CM2Z 2E6KA 3PC4A 3DOHA 4S35A 3G5AA 4RHEA 1BG6A 1TLTA 4FYXA 2C20A 4N82A 3T95A 2LUOA 1RRCA 4DR1B 3TW6A 4F97A 3DV9A 4K9KA 1RPJA 2IYNA 1SR8A 3ZIAA 2J0UB 3OH8A 5FQOA 4I1RA 1I0IA 3V2UA 4E11A 3I5YA 3ETDA 3PL5A 1MOZA 3DP9A 2I1LA 2G40A 3R9KA 3TG2A 1FVIA 3N8HA 4TQAA 1F6DA 4IXNA 2BFFB 3T35A 4O59O 2UZIR 4XE5A 2Q2EB 4COOA 2QD3A 1BCSA 4CIDA 5DTEA 3R7LA 2OAP1 1KJ8A 3DL7A 3ELYA 3H5OA 4MGZE 1FUEA 4ENWA 3LC0A 1IWPB 2FV8A 1HOXA 4L4YA 3WGMA 1MAAA 4Z1OA 4GL2A 4W1RA 4WASA 2X4AA 1LC3A 2NXEA 3RS8A 3UAVA 1JQLB 3FUXA 4S3MA 1V5WA 2DKLA 1VYUA 1G21A 4RKUF 1T0PA 4YY3B 4PLZA 3HYLA 3LVQE 1J5PA 5LQNA 3RUIA 1BOOA 4J03A 3TB6A 1RXUA 3DW3X 3W6OA 1NLYA 2G36A 1ZYUA 3EPIA 4IDOA 4B3SM 1WMDA 5BQXA 2Q2WA 4UBJA 2BZ1A 4AK9A 3G5LA 3L0IB 1JHVA 5AUPB 1YA4A 4I1YA 1JKJB 2VDBB 4B32A 3G2MA 1X3SA 4NVRA 5AOCA 5JNWA 2XYQA 2ZJOA 4K9OA 2CKDA 4AMYA 3TJZA 4BE9A 2HPVA 4DLPA 4F6RB 3AIOA 3HOXG 2XE6A 3LYHA 1I5OA 2PL9A 3CNEA 4HWSA 1Z0KA 2D1SA 4R9SA 2A88A 1N2HA 3G8BA 5DNDA 4E03A 3DDSA 3QX3A 1RADA 4G5QA 3ZYCA 2OAEA 3DAGA 3CUWA 3VDUA 2QVZX 4Y9UA 1K2VN 1N75A 3OOJA 3N43B 5CXSA 2UUOA 3ZIUA 1XIVA 5DK6A 2ISQA 4LVNA 3BH7A 3EGIA 2D2FA 5CG2A 1V4NA 3TFOA 1CCWA 1ODKA 5BVGA 4I4NA 5KI6A 3VZDA 3FGNA 1IZ9A 4LRYA 3USCS 1E7QA 4QTUB 4D8WA 1XZAA 1YR2A 2BEWB 1PT9A 1T43A 4WL0A 4CI9A 2NAFA 3U31A 3HWX1 4M8IA 1OZHA 2QRKA 3EB9A 3WGUA 3AL3A 3JQDA 2XTAA 5CCEA 4YRRA 3RF2A 3UJ3X 4K9QA 4GITA 2YYSA 4RY0A 3RSCA 3I8OA 3N2GB 1GKUB 4WXPA 3KR2A 4X64H 4J76A 4YX9A 3D2BA 4G63A 2O2EA 3VHQA 3KSBC 4NR0A 1QV7A 5EWFA 2X9VA 3VC2A 4K1LA 2HIHA 5G3ZA 4TQGA 2ZUBA 1A5ZA 1Y8RA 4KCGA 1IHXA 1RPAA 2AL7A 4Y9DA 4WN3A 2FPGA 3F8WA 4KVAA 5JI3E 3MJFA 3F7OA 3KW6A 4XLTA 2CVPA 5DE3A 1KYQA 1QH9A 3UATA 2XIQA 2YQZA 1K6XA 3R8CA 4L8WB 4ZVUA 5ITQA 1QYXA 4PCUA 2YYZA 5EXXA 4OLBA 3D0OA 5F1OA 2IA6A 3H97A 3C3DA 1CW2B 1QYCA 1Z0IA 5IZ4A 3Q6NA 4NJEB 4QGSA 2C00A 3UMSA 4JT4A 2Y68A 5L45A 4EPVA 2R92G 1QGDA 4LWPA 5LL6P 5K8LA 4BJ6A 2QP3A 5KG4A 5T41A 1HNWH 2D7DA 4OJNA 1O4VA 2PS0A 5H3CA 2BI7A 3B7GA 1EBFA 4CHTA 1WCXA 1FXWA 2JARA 1K5DA 1KPHA 2XGQA 2C3UA 3ZZUA 1X8XA 3EWNA 5A5GA 2VRCA 1CUUA 1YF3A 4LIPD 3GEMA 2DERA 1QHYA 3X2SA 4X0EA 4FM9A 4Q4AA 3KQWA 1P19A 5I47A 1UK8A 3DF7A 2DPLA 2I0FA 5KG2A 4G0ZA 4DR7M 2QRHA 1AZLA 3FKEA 2ZPTX 3W5SA 3V1YA 4J9NA 5A3SA 4FQ7A 3K0FA 1CQXA 2YOFA 2HLDA 2OBFA 2ON6A 1JF8A 5B6PA 1X14A 5BSFA 4DHWA 5A71A 3W9BA 2ZIWB 2V7VA 4CIYA 5BV0A 1NKSA 1BMFA 4DV0H 1LV7A 3ZWMA 1JHDA 4CG3A 3DTNA 4PQEA 5CVVA 4ASUD 2SCUA 1Z6ZA 4JI0B 3M5DA 2GYWA 3QXGA 1N2OA 1T10A 4DV7M 4RTJA 3GNTA 1RRKA 3QLUA 3RTEA 3QIAA 3TLJA 5JCXA 5I51A 3ZCVA 1OR8A 5KC9A 3CTPA 3QENA 2FEKA 4E3ZA 1I3OA 2QTVA 1PZNA 1NFFA 4PSUA 4PGMA 4DLZA 4O3FA 1SVOA 4FOLA 3GJYA 2BKUA 4FI3C 1DMRA 3FNRA 4AJ4A 2B9EA 2WAOA 3LRXA 3FYTA 4BQEA 2I7VA 2G07A 2JIPA 1WBBA 4HDKB 1TW2A 3TXYA 1E0KA 3ZHOA 4NJMB 3A28A 3HDYA 3MK6A 4Q4JA 2L09A 2OWEA 3NJ8A 4DWOA 2OGWA 4MRVA 3ITKA 2XUJA 1YCFA 4JASB 1JPNA 1MFZA 2DM6A 3UHPA 1CIVA 1PS8A 4B5LA 4Q0YA 2DZNB 2I6XA 5IVDA 4YJ2B 1XTPA 1TTHA 2BH2A 3TZLA 4IJWA 2XKAA 3GEDA 4LGVA 4CQJA 1W6RA 4IMIB 3KJZA 2CUZA 3HU3A 2VSOA 1A5TA 1G20B 4LV5B 4MW0A 1JA1A 3UGQA 1L1RA 1O0SA 1EUQA 3GC6A 3OUZA 3IKJA 1F2UB 4ND7A 4ANFA 3F6BX 3OCJA 5IJAA 4QQNA 3RAFC 1Z2OX 4MQFB 2A9RA 4CMIA 2QSJA 3SN6A 4WXYB 1RSZA 4MZXA 2IXFA 2BONA 1X7DA 4IRUB 3PVCA 5BY2A 1FS6A 2FKNA 2LWIA 3O8CA 4KO2S 1X13A 4I2NA 4BX9A 1KDVA 5TC4A 4GH9A 3RSZA 4OHMA 1S6YA 4F6CA 2WVAA 1EM6A 3W3AH 3ZG6A 1XAHA 3O2SB 3QMVA 2GHIA 3QUSA 3ESQA 2C3OA 4MGKE 4Y0VA 5JQGF 3AEUB 3B9QA 2O25A 4KQ9A 5LBTA 4B08A 4I6EA 3BILA 1H1LA 4UD6A 5IHXA 3VR6H 1YONA 1Q6YA 3U5ZA 2BY4A 4RL4A 4NATA 3RFVA 5LXTA 3NMUF 3D6MA 5IH3A 1GG2A 3D3EA 1HXHA 1E1MA 1YQDA 2P30A 4OYHA 2E2HA 4KK3A 1BXGB 3PR3A 4ER5A 1VMEA 3UK1A 3J2PB 3SJBA 4V0SA 3EIFA 4MX8A 1ESCA 4B71A 3M6AA 3MSXA 1JDUA 2VPZA 2J3QA 3F46A 1C41A 2JFUA 1PJZA 4L2IA 1QGZA 4P81A 4CQLB 1ONOA 4B6GA 4BE4A 2KLBA 5FD8A 1PG5A 3PDWA 4GHAA 4M9SA 1VSUA 2WVHA 2Y2UA 2VPXA 3AV3A 4WN9B 3HJRA 3TFQA 4IJUA 2GFQA 2ZS9A 4HYYA 4WXEA 4R81A 4K6HA 2ZOSA 2C0QA 3IEVA 4QLAA 3HCWA 4XUDA 1IATA 3OTIA 1ZONA 3PA6A 1Y5IA 3IBCA 4EYEA 4RYLA 2X9GA 4NFYA 1NY5A 3WOVA 2BZ0A 4QGBA 5TS3A 2ISCA 2C5LA 2WIGA 2DQ4A 3GTQA 3EYYA 3GTJA 5IDVA 4K9LA 1J1ZA 2IQ5A 4FQ5A 3K09A 4FNOA 3RFUA 4M37A 2OGZA 2LNHC 3D31A 3IQFA 4KR0A 1KI6B 1ZHOA 1KO7A 1L6IA 1QP4A 5EGNA 4PTZA 4MV8A 1HMYA 3NVMB 3WYAA 3KC2A 4J07A 1SCAA 2H59A 2AVNA 1T9CA 2JIDA 3ZDFA 4WCFA 3NHJA 3LFTA 1PQPA 4OU4A 4Q1CA 3OZRA 4QIHA 4QYTA 2XGGA 4V0QA 4M0WA 1CJSA 4KDEA 5T3YA 4K2AA 4DV4M 3KB1A 1BW9A 1YDMA 1MIOB 3O2NA 4BGUA 3ZE9A 3L02A 3T52A 3EPKA 1E7WA 3AW8A 1WRBA 1R9JA 4C7OB 3KQTA 5EWGA 3ESXA 3LV8A 3A3NA 1GTZA 3CJQA 5AW1A 3FLEA 3MD9A 1ZGGA 2E4ZA 2ZIZA 2OVBA 2I2DA 2FK3A 3HHEA 3QWBA 2CYCA 5L40A 3LKDA 2P62A 1DPGA 2NAPA 1Z6YA 5E1OA 3CY6A 3GQBA 3SMPA 4RTSA 1QYDA 2P68A 1Z5WA 1XRMA 3T7JA 2K7ZA 1Z5BA 4DDUA 2MR5A 4OQDA 5E4JA 2I1VB 4WE3A 2HF7A 4QYMA 3M1AA 2LD4A 4PPGA 1ATZA 4M1TA 3AETA 3ILXA 2XXAA 2K0BX 4BV8A 1KU6A 3VKUA 3IUMA 2OHVA 4IFIA 1SCJA 5KFOA 4YGYA 1O6GA 3VDRA 1Y7TA 3V6LA 3VJKA 3SAVA 2VF8A 3ZXSA 2QD4A 2ID4A 3CF6R 5DNYA 5JY1A 3OIDA 4LX8A 1II9A 3P9CA 2Q2UA 4N1AA 3SVZA 1UBNA 2ZB2A 5FAKA 1LSSA 3GFRA 3LA6A 2PGAA 3R7DA 3RVKA 4DUGD 4YIKA 4DA4A 3ETJA 1ZS9A 1DKNA 3RU7A 1E1RA 3KPVA 4X84A 1QK4A 2RONA 4B3MB 1IH8A 4ETSA 2R5WA 2XSZD 2QM7A 1PT7A 4EZEA 4J8PA 4F06A 4H60A 3D8LA 3BJRA 5ITXE 2VHWA 1BH2A 5DSXA 5TEVA 1I2AA 4JC5A 4OU7A 3NDBB 4LDRA 3COSA 4BO4A 4WADA 4ZV9A 3HG7A 2GJSA 3ABSB 3DDWA 1T9ZA 3B1VA 1W8DA 2OCAA 2W7OA 4DLUA 2VK1A 3JZFA 1DMSA 5LOVF 3LC2O 2HJRA 4LYHA 2F1OA 2B25A 4OGKA 1LXCA 2OG2A 5FPRA 2DI0A 2YWBA 3ROZA 4QFDA 3NBMA 3GUYA 3TQQA 3D5TA 4UM9B 4B2IA 2NVXA 3EVTA 2ZJ4A 3U6OA 3SQOA 2GVNA 3E22A 4AJIA 4QUJA 3NDIA 2R6HA 1YD7A 5FIUA 2O1WA 4CLOA 1ACMA 1AKEA 2HXGA 3THWB 4IUDS 4EG5A 2ZRPA 3SCZA 1DV0A 4GKBA 3AGPA 3HVUA 2H52A 3ZQUA 5MF6A 3D7MA 4JT9A 3H8JA 1ORVA 13PKA 3TL4X 3OQIB 5FD6A 3Q8GA 5AH0A 6PFKA 1JDBB 4ZOLF 4IKPA 4IOMA 3QV1A 4YDHB 5KYYB 3IQWA 2XNHA 2ZBUA 5C1PA 3H0EA 4XVCA 1EH5A 3QVGB 2WZJA 3OT4A 1Y6RA 3K35A 4PS0A 3PEEA 4JP5A 2CWWA 4WJZA 4K9DA 2K87A 4FUQA 4OHUA 1RZRD 1AGXA 2F2TA 2I3GA 4CNBA 4I6JA 5BW6B 4YA6A 3PCTA 1J5EB 3K9NA 2EP5A 3O4RA 3KNZA 3P19A 4HAWA 3RWOA 4NG5A 2W42A 3KT6A 2F7SA 2H4ZA 1BVUA 4AROA 4LQ4A 2HA4A 2C8JA 2VA3A 4MW7A 3MILA 3OFSA 4IHAA 2PLAA 5HQTA 3G2JA 4G3OA 3OE7A 1C9YA 1XQVA 4A82A 4D4IA 1KY5A 3EIHA 1PV1A 3UG6A 1B0AA 3T8YA 4M9XA 4MVJM 5HILA 2KDLA 1T2AA 3L5KA 4I36A 1PT8A 1Y4AE 3G3EA 2Q0HA 3ILYA 2H2WA 2B37A 3Q2IA 4YCCA 1PYDA 1CHNA 4ZCSA 2RHBA 2PUGA 5I6DA 2EBHX 4MJLA 2CLCX 1O6CA 2C04A 3ORHA 4O02B 1FYFA 3MMNA 4HTFB 2F3UA 2YIVX 1GYRA 1GDTA 3NGDA 1UT8A 5L9AA 5FBZA 2PVPA 4TKZA 5AYVA 3MWDA 3LBNA 4B3SH 4UEOA 1GABA 1FFBA 2DHCA 5HCUA 5AOBA 3B3AA 3UMMA 4IZOA 3GT0A 2FN4A 1E2JA 3ER8A 3LLUA 3U4QB 4EGFA 2LVOC 1HNXB 1UZUA 4ZCRA 4WZAE 1G16A 4TV9A 1QPBA 4QUDA 3M3PA 3G9QA 1CFJA 4TTIA 1TAQA 2C1ZA 4U7HA 4DMMA 3Q8MA 3BZUA 3JD4A 3DNPA 4DE5A 1N2JA 4QFMA 2JFXA 1NW9B 4QDOA 5FPSA 1FDTA 1OFTA 3AHEA 3B70A 3Q8RB 1GOTA 4UBNA 5GP1A 1OAKA 3KYCB 1RHMA 3W6PA 4ZOCA 2VN8A 3T5DA 1E3LA 2XDYA 3S3TA 2BPOA 2BMJA 5DGBA 4JLBA 4L72A 5B30A 3RFXA 5AVKA 2DZDA 3ND9A 2AI2A 2XUDA 1XXHB 2EATA 2EKDA 3GIDA 3G8YA 4PYRA 2IOHA 2ZROA 4BQQA 4H9GA 3GLRA 1R64A 4B17A 4KYIB 3OJLA 4RD4A 3IT0A 3KVWA 3A1WA 3NS7A 1MZPA 3Q87B 2ZYWX 4ZN6A 1V16B 4F4ZA 3CKYA 3SZLA 3ORQA 3I76A 2R97A 5D3MB 5EUBA 4O25A 2CXSA 4U5XA 4HGPA 4Q3LA 2E0IA 4D0RA 4X7MA 2FRDA 4JS0A 2WEKA 5AVSA 5GOTA 4IR1A 1LW6E 3Q3VA 3Q1LA 4ZYXA 1CJVC 3L07A 5KQRA 4JHXA 3PRYA 1R50A 3BMXA 2B4QA 2BGLA 2HQ1A 3I9OA 2PCJA 1V11A 1UDRA 4BB6A 1GPUA 4P92A 5KQSA 2PT9A 1K8QA 4ER7A 4JP1A 4TVKA 4TRMA 5IW8A 4OK5A 3H4TA 1S1CA 5BQFA 5JQWA 3R9XA 5F77A 1JQAA 3VGPA 5AVRA 2CL5A 2ODNA 4NMWA 3UH0A 1QRTA 4PC2A 2YU9A 1PR0A 3DBHB 1CJUC 1EP1B 4OI1A 5ARBA 3I45A 4I99A 3NORA 2R6AA 1NBMA 2X1LA 4E5VA 4LG2A 1GZDA 4PX2A 1S2GA 1P6QA 2OAGA 3H4MA 3DE4X 4P4LA 4FHGA 3AF2A 1IBKB 4J16C 4X94A 2ZTCA 1JVSA 2WKWA 1OZ0A 3HP1A 1NNEA 5AM2A 1ODTC 4QXAA 3C6QA 3LP5A 3X1YA 3DVAA 5ALMA 3LBHA 3JS5A 4P58A 1RYNA 3H4DA 3DJYA 2X3YA 1B6TA 4JQZA 4C7XA 3U6CA 2E48A 1NT4A 2CJFA 3DG9A 2D00A 5LQDA 4JL8A 3UGJA 2QVLA 3WO0A 3K96A 4QQ8A 4MUFA 1B6RA 1K3WA 2NO0A 4IDPA 3ZZ0A 3H5WA 3EPLA 4OQPA 3I1IA 3JQ7B 5F2OA 3ILVA 2O8NA 3ZJVA 1QU3A 4BMXA 2QSUA 2PSHA 3OVMA 2VQEM 1W4LA 4KO4S 4BNWA 1VG8A 2H11A 5KHAA 1UJ4A 3G17A 1XJ5A