2R6FA

Crystal structure of bacillus stearothermophilus uvra
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
949
structure length
899
Chain Sequence
MDKIIVKGARAHNLKNIDVEIPRGKLVVLTGLSGSGKSSLAFDTIYAEGQRRYVESLSAYARQFLGQMEKPDVDAIEGLSPAISIDQKTTSRNPRSTVGTVTEIYDYLRLLFARIGRPICPTHGIEIQSQTIEQMVDRLLSYPERTKMQILAPIDVVVDRIIIKDGIAARLADSLETALKLADGKVVVDVIGEGELLFSEKHACPYCGFSIGELEPRLFSFNSPFGACPDCDGLGAKLEVDLDLVIPNDELTLKEHAIAPWEPYYPQLLEAVCRHYGIPMDVPVKDLPKEQLDKILYGSGGEPIYFRYTNDFGQVREQYIAFEGVIPNVERRYRETSSDYIREQMEKYMAEQPCPTCQGYRLKKESLAVLVGGKHIGEVTAMSVTEALAFFDGLELTEKEAQIARLILREIRDRLGFLQNVGLDYLTLSRSAGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLIATLKSMRDLGNTLIVVEHDEDTMLAADYLIDIGPGAGIHGGEVVAAGTPEEVMNDPNSLTGQYLSGKKFIPIPAERRRPDGRWLEVVGAREHNLKNVSVKIPLGTFVAVTGVSGSGKSTLVNEVLYKALAQKLHRAKAKPGEHRDIRGLEHLDKVIDIDQSPIGRTPRSNPATYTGVFDDIRDVFASTNEAKVRGYKKGRFSFNVKGGRCEACHGDGIIKIEMHFLPDVYVPCEVCHGKRYNRETLEVTYKGKNIAEVLDMTVEDALDFFASIPKIKRKLETLYDVGLGYMKLGQPATTLSGGEAQRVKLAAELHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTADYIIDLGPEGGDRGGQIVAVGTPEEVAEVKESHTGRYLKPILERDRARMQARYEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Excinuclease ABC subunit A
publication title Crystal Structure of Bacillus stearothermophilus UvrA Provides Insight into ATP-Modulated Dimerization, UvrB Interaction, and DNA Binding.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 231
structure length 899
sequence length 949
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17755 UvrA_DNA-bind UvrA DNA-binding domain
A PF17760 UvrA_inter UvrA interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.280 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 ABC transporter ATPase domain-like 2r6fA04
1.20.1580.10 Mainly Alpha Up-down Bundle ABC transporter ATPase like fold ABC transporter ATPase like domain 2r6fA06
1.20.1580.10 Mainly Alpha Up-down Bundle ABC transporter ATPase like fold ABC transporter ATPase like domain 2r6fA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r6fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6fA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6fA05
4DIDA 2QSZA 3LWNA 1W44A 3BB4A 2JIZA 1ONBA 3ZS8A 1T6NA 3R23A 1KSGA 2QTHA 3UANA 2Z83A 2F43B 3A58B 4RFSA 2NQ2C 5HKKD 4B34A 2ZSAA 3WRXC 1OB2A 2B6HA 4CEIB 2D62A 1TEXA 1AS3A 2GEUA 4P3YA 3U3MA 3CNNA 1QDEA 1IAQA 4URZR 4NTZA 1SHKA 3LVQE 2WWWA 3I12A 4WOPA 5CM8B 3K9GA 1W2GA 2QEQA 3BH6A 3PUYA 4LHVA 5EUQB 3GLIE 2ZU0C 1BNCA 2Q21A 3C14C 2QPAA 5AJVB 4B33A 1NBMD 1DO2A 3LDAA 4W7SA 4TQAA 4M9ZA 4IEIA 4BLTA 3U3KA 1R7RA 1YRBA 4JLAA 3ECCA 1CU1A 1N5IA 3GEIA 2QGZA 2EYUA 1AN0A 1AZTA 1HH4A 2FSIA 4ESHA 2IF0A 2HCJB 4QFMA 4M0LA 4M1OA 1G5PA 1XFAA 2CK3A 4PSAA 1ZC3A 2H16A 4RCZA 2KE5A 2J87A 721PA 4YJ3F 3RVBA 4RD6A 4FCWA 1QVRA 1G3MA 3CNLA 1QBKC 4CDGA 5KDOA 1E3MA 3R9WA 1NIJA 1FQKA 3GJ8A 2A9KA 3T5DA 2QMUA 4DLXA 1OKKD 4ZDJA 3DM5A 5K8TA 2ZRAA 4QHYA 2F7SA 3T15A 3EARA 3WBKA 1CF4A 1RJ9B 3W5JA 3LLMA 2SCUB 3GFPA 2FPIB 1E2KA 3L2OB 1E2DA 2W6ZA 2ZJ5A 1R0XA 4AKEA 5L3SA 1LW7A 2FEMA 2FU5C 2OCAA 3FTQA 2ZUCA 4QGGA 4A82A 1XTRA 5CJ2A 3ZD6A 4O3MA 1JI0A 2GXSA 1OE0A 2BWJA 3V4ZA 3PENA 4L5BA 1DAFA 1NMXA 3K0AB 2RHMA 4B73A 1IJFA 3QKTA 5JCPA 2ZI4A 4C9BA 4PANA 4KI0A 1GNQA 4FINA 3U3OA 3E5NA 4Z1MD 1Q1ZA 1LV7A 1JEDA 3W6NA 1XPOA 2IYRA 1II8A 3UKDA 5JCZA 3NHAA 4QGHA 5BXQC 3AF1A 5KTYA 1E9EA 3S1AA 2LKCA 2B7CA 1XJCA 2P0EA 2W0SA 5CDFA 2VSFA 4MKHA 1JR3E 2J59A 2ZROA 2O8FA 3U9TA 5SZKB 2P0AA 2VSOA 3P4YA 1IXZA 1H8ED 2VP2A 1K5DA 1MO6A 3QXHA 4PSVA 4YXWA 4UNNA 1D9XA 3BK7A 3VPDA 1TNDA 2DBYA 2DY1A 1E9SA 4Q4LA 3PXGA 5JJIA 2JIZD 3M6AA 1HEIA 1R10A 1AK2A 1GL9B 1OIWA 3M4YA 1NN1A 2ZI5A 5TDHA 4FIDA 5FPYA 4XWOA 4ZQIA 1A2BA 2QE7D 4KITB 2EFHB 2ZREA 2RGXA 2GPWA 5FOXA 3D3QA 1G291 3N5CA 1SXJE 1XTKA 3EASA 1OXVA 1KZ7B 3B9QA 2VP9A 1KAOA 4LJ9A 4B3BA 2W2TA 2G3YA 3KQHA 5LP6F 1FMLA 5AUNB 4Q21A 5C1PA 4TMKA 2W6JD 3DDCA 2NOAA 2JLRA 1XP8A 5LDDC 2MSDB 2IYUA 5EE1A 4YAKB 1RPZA 1TADA 4G5SA 2F1IA 3CRMA 3NC1C 2JJ2A 3RNLA 1W36C 2J0UB 1EXMA 5K2MA 3EPKA 4KV9A 1E6CA 2CJWA 4TQUS 1S0UA 3BFXA 3QOFA 5JWRA 3HU1A 2B92A 5HV6A 1KI7A 1E9BA 3U3JA 5EE0A 5BW8A 1ZYUA 3RC8A 4LHWA 3X1DA 1Q21A 5BWMA 4TZ0A 2UZ3A 2IYYA 2CNWA 3THWA 1BO6A 1VG9B 4HQ6A 1RRPA 3E1SA 1ZP6A 3NH9A 4ILEA 3RS5A 1TPZA 2A5JA 3QF4A 2ZPTX 4Q02A 2HCBA 3RS7A 1XWIA 1ZINA 3CIOA 3B60A 4XVQA 1RZ3A 1Q20A 4C2UA 1LNZA 2GDJA 3T12A 4BFYA 4Q4JA 2GAAA 2BDTA 5J4KA 3KQLA 4LSGA 2WJHA 1I4DD 3QBTA 3LFUA 3BWDD 4WXPA 1MABA 2YL2A 3W8NA 2E9SA 3ETHA 5BMVF 2B21A 5UKDA 2CMKA 4QC2A 2YZGA 2IWHA 3GP8A 1U94A 1OPXA 3RS3A 4HB2A 4OI0A 1KJWA 4O2BF 4RSGA 1TL7C 3V00A 3OEHA 4DLWA 1X6VA 3CO5A 3IBGA 3K70B 4QNMA 3MJRA 4W5JA 1UFQA 2OFXA 4OKSA 4A4DA 4EPVA 5C1BA 3GPLA 3GIDA 1VYVA 2DFLA 3AGQA 1HUQA 5EZ6B 4D4KA 1IY2A 5GADl 2J0VA 3WHKA 4JJKA 3K5HA 3SQWA 1YZNA 3VPBA 3KJGA 4RKFA 3W5IA 4CT4B 2OILA 1W0JA 3AM1A 2Z4SA 4NKRA 1G1MA 5FPTA 1OXTA 1I7LA 2ZRIA 3FMFA 4IVRA 2VR1A 4EQ6B 2WIAA 3UK6A 1E98A 3T35A 1U8YA 2K5UA 1IOWA 1LB1B 3BD9A 1IY0A 1S3GA 3QIAA 2GEVA 1QHHB 4YAJB 1H8HA 4CEJB 1NN0A 1FX0A 3ASYA 1SKQA 1IN6A 2XXAA 2FSHA 3V4SA 2BC9A 4QJ4A 1GAJA 2OSBA 1B23P 1JPNA 1KY2A 1X1RA 4J0QA 2GK6A 2VTKA 1VG8A 2VP4A 1Q57A 3NXSA 5FR1A 1G8FA 4YXWD 4JYCA 2NO6A 4NP6A 3ZZTA 4JL5A 4TZ6A 1QHXA 2AXPA 3IPXA 4AKHA 2FA9A 5TMPA 4RY2A 4PHFA 2WZQA 3L8YA 3K9LA 4BPBA 4DLVA 4HATA 4D0LB 4TMZA 1YZUA 2IEYA 3ORRA 3BORA 1C9KA 3TGPA 4YONB 4WZAE 1MH1A 4QG7A 4MGYR 1XDBA 1CR0A 4FCTA 3GLFB 1XJ0A 2IX3A 2QMEA 4C5AA 2AHOA 2OLSA 1E2IA 3DMNA 4I55F 4L8GA 1GKIA 1KI3A 2C96A 2O5VA 3GLGA 1L4YA 3WP1B 1W4CA 1QHGA 2JJ2D 2AK2A 2AXNA 2FWRA 4GT1A 4LYJA 5FUXA 3A4MA 1UDXA 2V55B 2B8WA 2P6UA 4K46A 4Q1BA 2EFDB 2BKEA 3PUWA 3GD7A 3ZZ0A 2UKDA 1DIKA 3A36A 2NO9A 3QVVA 3VQTA 2DWPA 1Z2AA 4B44A 4DUGD 1OH5A 2VF7A 1AM4D 4N0DA 4G5OA 3AKCA 4L9WA 3EPJA 4C0KA 1XXHA 4F4CA 2YC2C 2AKYA 2CNWD 1N3BA 1Z6AA 2ORIA 2J7KA 4LGMA 4KFTA 5J47A 2CCJA 2JATA 1I4TD 2HLDA 4Q1AA 3CWZA 1W4AA 3B9PA 3TSOA 1JQLB 3RWOA 4KLZA 1N0WA 5KNCA 1PUIA 4FU0A 1X1SA 2FDCA 1G17A 3GLIA 3Q7QA 1PVOA 5CB4F 1DV2A 1BH2A 4DIEA 6Q21A 2R65A 1W46A 4G5QA 3RV4A 5DYIA 3TSZA 4B47A 5JS7A 1XD9A 5FOUA 4TYWA 4Q7LA 4DT1B 4RD3A 5CK5A 5F98A 5FOTA 3PEYA 4NCNA 1AGPA 5GONF 2IWRA 3KKQA 4GOKA 3VKGA 2HJGA 2R62A 1EFTA 1OF1A 1ZNYA 4M4SA 1ZNWA 2QN6A 3CX8A 1E99A 1FZQA 1U8AA 4IHQA 4OHWA 1WXQA 4D26A 4FCVA 1T5IA 3NBXX 5CM9C 2ZRLA 1EYZA 4G3XA 4LBZA 2JGNA 4IJMA 1UBGA 3A4LA 1PJRA 3AP3A 1ELOA 2R6DA 4JT2A 4ESVA 2YOFA 4DB4A 1ZVQA 3PUZA 1KEEA 1F3OA 3R5FA 1VCOA 1W0JD 2WOJA 2YC4C 4HB0A 2HDNB 4JLVA 2P6NA 4EGQA 2AWOA 2W2VA 4Q9KA 5EP1A 2NPFA 4A2PA 2BBWA 2G1KA 3IILA 2QROA 3BFKA 3NVAA 3QVUA 4QBGB 3K70C 1FQJA 4JLNA 2D7CA 1UADA 3CW2A 3U44A 3KFVA 2GZDA 2XZLA 4I4LA 4MV1A 1TX4B 1SKYB 2QNRA 2RCNA 2ZITA 2WWXA 1WCV1 2YNMA 2QAGB 1O3YA 4DLSA 3UIEA 1CLUA 2GILA 4ME6A 4PC6A 1Q44A 2GCPA 5BPFA 1S9HA 1VHTA 1US8A 2PMDA 2YZ2A 1B6RA 2ZSEA 3CRVA 2VA8A 2AFHE 3TK1A 3A1SA 4Q4HA 4EFLA 2P6RA 2BBSA 2ZQ5A 4QNRA 2BBTA 4JBWA 4FMCF 5HCNA 2V1XA 2GBLA 4C5CA 3LLUA 3EWAA 3BOSA 3P20A 3TW8B 1ZNZA 2QL6A 4IFEA 4BRUA 2AR7A 4BASA 3EA0A 4XWAA 3H84A 2VSXA 4QJ5A 4NZYA 1F60A 221PA 1FP7A 4LJ6A 4WZ6A 5HTKA 5K8IA 3A1WA 1VDZA 4TQ9A 2IC5A 3PJRA 1DG3A 3KKPA 1U9IA 3QPWA 1FFHA 4D4JA 3ZVLA 2XB2A 4M53A 1KAGA 4KVAA 1UAAA 2V54A 1UEJA 2OCYC 1JECA 3WYGA 2VQSA 2QENA 4D2IA 2YKGA 1UKEA 1X8LA 5IF9A 3THYB 2XITA 4PO8A 1W4RA 3C7KA 5G40A 4D6PA 2PN1A 3KZ1E 3KUDA 3NBYC 2NUAB 1UEIA 3B1XA 3AVWA 5JWHA 1CS4C 1IOVA 3NH6A 2YOHA 3VU9B 1OYWA 1JPJA 4PPQA 3RS2A 3SJCA 1DAGA 5JVDF 1OXXK 2HF9A 1SXJA 4JKYA 1G9XA 4OI4A 4QXAA 1UDWA 2HUPA 4DWJA 2HLDD 1FNMA 2FE4A 2XNDA 4PSKA 5AK0A 4YDSA 1NF3A 4UKDA 3HWSA 1Q1QA 3E2IA 2WJYA 1VBHA 4K8OA 5GJVC 4X8LA 4PXAA 3KKMA 3IQXA 3T34A 3QXSA 3IHWA 3IO3A 3SEAA 1GKUB 2O0KA 2YWGA 1OH6A 4JYBA 2IXGA 5EUMA 2D74A 1XU4A 1JAHA 1U90A 1YKSA 1F2UA 3UMFA 1E0AA 1XMSA 2GJ9A 4PQYA 2O8EB 2CLDX 1E0SA 1S4QA 2IK8A 3VR2A 1OFUX 3OFND 1A1VA 4DLYA 3IUYA 3MWDA 1DG1G 5E3HA 1J90A 2IF2A 2ERYA 1KI6A 1GFIA 5JRZA 1VIYA 5CA1F 1D9ZA 3CF2A 1N6LA 1DV1A 4KU4A 5JQWA 3SHWA 2HYIC 2CHVA 1S3SA 4A2QA 3KTAA 3VX3A 3B2EA 2I80A 2YRXA 3KXLA 3IIJA 4NU0A 4Q7MB 3A1UA 2F9MA 2V3CC 1E2MA 3OIYA 4B3XA 2P2LA 1XCMA 3WRYC 5IHPA 4II7A 2PCJA 4BLSA 2MSEB 3JRXA 3D8BA 3KL4A 3VMFA 2GPSA 4F93B 3FMPB 2V9PA 4POAA 1CKEA 4GOXA 2WVJA 4TLDA 2PMKA 1G20E 3FB4A 5EE3A 4NONA 2J9RA 3OE7A 2XTNA 4A8JC 2GXAA 1W0KA 2PCLA 1OV4A 3K9NA 2A5FA 5JHHB 5LB4A 3ZIAD 1CR2A 2GXQA 3C4JA 3CRRA 4CT5A 1U81A 621PA 2BMJA 3PV0A 3JVVA 3EZFA 4IOMA 2DHRA 4DVGA 3THYA 4C7OA 1TU4A 4FI3C 1G7SA 5KUTA 3FKSA 2ERXA 2IXEA 5C1OA 1G6HA 1F48A 1IN4A 4I1OA 4Y0VA 5HE8A 2NU8B 2XGJA 2BJVA 1DOAA 2QAGC 3T1QA 2ZRJA 1R5NA 3GJ6A 3GLHB 1KIMA 3Q5DA 5JH7F 3VFDA 4D25A 2OO7A 1JR3D 1N2CE 1JEEA 1R2QA 1S9DA 2P3SA 2O8BA 2ODBA 4EPYA 1XZPA 2G6BA 3LW7A 1JLLB 4WVFA 3K09C 4AK9A 3GFOA 1VKZA 4NYIQ 4Z8YA 5AJYA 1XMVA 2W6QA 4I99A 5AJZA 2WSMA 3QSYA 1NG9A 4KODA 3H86A 3PEUA 5K8LA 5E7JA 2JASA 1DAMA 3B13B 4RFSB 3TVTA 1A7JA 1P3JA 1JDBB 2AD5A 3QFFA 1NVWQ 2KB0A 2V6IA 1NI3A 2XD4A 4Y8VB 4URVR 1SXJD 4U5XA 2X77A 4MV8A 1MRSA 3BS4A 1CR1A 1HQCA 1D2MA 2J0SA 1A2KC 5HZHA 1NMZA 2BV3A 2WJJA 3MCAA 1DAEA 4X8OA 2GRJA 5FBWB 4C30A 4OI1A 1KSHA 4B76A 2Z5FA 1MO3A 3W90A 4X8MA 3FMOB 1JBKA 3W6OA 1ZUNB 2CXXA 2HEIA 1FTNA 1G3QA 5LA6F 3I4LA 2ZRMA 2GJKA 5SZJA 4HUTA 4OHXA 1VCIA 2NO0A 2F1RA 4DEXA 1GP2A 1RRFA 1EK0A 3NTUA 2XZPA 1KDTA 1GVNB 2C9OA 4GMXA 3IEUA 3R8CA 4AY2A 3BC1A 1N6HA 4URYR 2IP4A 1WDTA 1Z0FA 821PA 4TWZA 1S8FA 1PLJA 2VQDA 3JRWA 1GL6A 1T8TA 1GGOA 1E9RA 1X86B 1KMHA 1TQDA 2WKPA 4OK5A 3TMKA 4G5RA 1G3IA 4IDQA 4AG5A 2C9YA 2FN4A 2FZ4A 2VLIA 4PC7A 4V0KA 2GEDA 2QT0A 3LVRE 4GRAA 4DCVA 1IONA 1NJGA 3LX5A 1HT1E 5KSOA 3KKOA 1ZM4A 2FGKA 4QM7A 3AKYA 3U9SA 3EWSA 1NVXQ 1P2SA 2J46A 1J2JA 1KJYA 1LY1A 5L3SB 2XB4A 4IDOA 1NLYA 1KI2A 4WIAA 5LYJF 2EFCB 4JLKA 3W3ZB 1P7CA 1QRAA 4AIIA 3VHLB 2WTUA 1OW3B 3OUUA 1GILA 4WBSA 4A92A 2F55A 2ZRDA 1W0KD 4B32A 3LQRA 2R6FA 4Q66C 4NYIR 4XWKA 1KSFX 2IEZA 1E2JA 5CYOA 2V58A 4BFZA 3QXJA 1VG0B 3P4XA 2GXUA 3DEFA 1M6VA 4G5GA 3P1JA 2ATXA 1JQJC 1G7RA 4OQMA 5TARA 5FBLB 3ZQ6A 2BMDA 1II8B 1DAIA 2ZRGA 4Q5IA 3QY0A 4NCJA 3I3SR 1ZAKA 1G4UR 1AGRA 3S1AB 4Q18A 4FMCB 3T61A 3O8CA 4HLQB 4TV9F 2GK7A 2J41A 4EPTA 4HAXA 2IYTA 4U7DA 1XXHE 1GM5A 1K8RA 1GUAA 4GBMA 5CAEB 1Q3HA 2O8FB 2JA1A 5FBRB 3WNBA 3FFBA 2BMEA 2QQEA 3EZ7A 4BECA 2WV9A 1PLLA 5IRCD 1F6BA 1NKSA 2IYQA 5B64A 4PAQA 3LW8A 4MYTA 2ZS8A 1MT0A 4RVCA 5EXXA 5CK4A 5DGXA 3EAQA 5JZVA 1KJQA 1HE1C 2GVZC 3FFAA 1Z6XA 1ZD9A 1VBGA 3KQUA 3ZVNA 3ZH9B 1EUCB 2G9NA 2OCPA 4BLOA 4HNVA 1G8YA 3U7GA 2C00A 1QZXA 4TMWA 2WJGA 4CIDA 1Z63A 4LV6A 4ZCIA 5JSZA 4GL2A 2RAPA 3WNDA 1RKBA 4YB8B 1VCNA 4MRRA 3U2QA 5B57C 2IYSA 2VHQA 4Q19A 2Q6TA 3MFYA 4LV5B 1T4GA 5JWOA 1AUVA 1KJIA 1GOTA 2FV8A 3LQQA 3DMDA 3NEJA 1J70A 3K5IA 3VPCA 2XTMA 4V0ME 3QE0A 2ZRBA 1OHHA 3HPRA 3OEEA 4GPTA 4MRNA 2EFEB 2H57A 4GZLA 5KNDA 3JZMA 5KDLA 5KSYA 3OAAD 2FGJA 2CJWB 1ZM3A 4G0NA 5DHFA 2EW1A 5GVRA 4PFSA 1AKEA 1OH8A 1V43A 3PUXA 1XEXA 1CS0A 4MAMA 1L4UA 1QVAA 5DISB 3HBLA 4KFSA 4P4TA 1CJTC 4Q47A 4JBXA 1HV8A 2VEDA 3THWB 1NSFA 4LJ8A 1M6NA 4TV8F 1LVGA 1YZLA 4OBEA 3QF4B 4B35A 1IN8A 2XOKD 1FPMA 1ZD1A 5KOYA 2IS2A 3KXKA 1YZTA 2B7BA 4HAZA 4TTQA 2R86A 1R0WA 2EYQA 5KU1A 2LKDA 4A2WA 4Q4JB 4GZMA 4B3DA 1G7TA 3CONA 4XVRA 5J5CA 1MABB 2XSZA 3NDBB 1A4RA 4B3CA 4PC2A 2HXYA 2DCUA 3TIGA 3MG9A 3KJHA 4BEJA 1HA3A 1OH7A 2RGGA 5KX5F 4H1UA 1OXSC 5DHAA 2R7MA 1WMSA 3CR8A 3QKSA 4KXFB 2XAUA 4ASUD 1S96A 4TN1A 2SHKA 1W2HA 1Z47A 5AUQA 1E1QD 1R5BA 4KO8A 2YS6A 1L8QA 1KI9A 4HI0E 2VPQA 3K0FA 4HSEA 2IYZA 1QF9A 2ODEA 3HJNA 1MRNA 1NL3A 4M1SA 1FW6A 2Y8EA 4UNRA 4PPFA 3QQ5A 2JLWA 3PVSA 2R7LA 4LJ4A 2NTYC 1AIPA 5HPYB 1L2TA 1JNYA 2KBEA 1FX0B 5EP2A 3UATA 4EAQA 2H8KA 2XXAB 2W6MA 1E4EA 4DLZA 1UKYA 2PEYA 3RRZA 1KJJA 1SULA 1UJ2A 4PC3A 1PUJA 4L4UA 1ANKA 2GCOA 2P5TB 1UKVY 2WAYA 4YMSA 2BKUA 1E9DA 1YJ5A 4JVLA 4QBFA 4QBIA 4TUYF 3Q85A 3RWMB 3VR3A 5KSZA 1MV5A 4MDEA 2QGNA 1DAKA 4Q9JA 4PR0A 1OFHA 1BMFA 1WQ1R 3U6KA 5JS8A 1V5WA 2WICA 3SU8A 3Q72A 3ZGXA 3M1IA 4RD2A 2C99A 2GZAA 1KJ8A 5JI3E 1P6XA 1ZUHA 3QXCA 1MOZA 3B8HA 1G4AE 2LWIA 5D3MA 1ZRHA 2ODNA 4M9SA 1TTTA 1P2UA 2IHYA 2IUUA 4XX0B 2ANCA 5CIQA 3KKNA 2XJ9A 5FPSA 5JMTA 4EJSA 3KDSE 1XCPA 3MJHA 5J4LA 3AV0B 4MGIR 4YMVA 1GTVA 3P27A 3GLGB 3AVOA 3CH5A 4MA5A 1Z0AA 4NL4H 2CK3D 1M7BA 2QG6A 3AH8A 3OEED 1XJQA 4HZUA 4XSGA 1E9CA 3TBKA 1DELA 4BLRA 4K81B 3Q9LA 3BFVA 2GETA 2VIIA 3QPUA 1CR4A 1RIFA 1I4LD 3AGPA 4D0GA 2OCBA 1RFLA 3SC3A 1OB5A 2RMKA 2FMXA 121PA 3BJIC 4F92B 1XTSA 4XOIA 4XD7A 3QG5A 3RC3A 2QPTA 4IOJA 4YBZB 3NDPA 4V03A 1Z6YA 4BZQA 1OIXA 1XXHB 2XCLA 2CL6X 1DO0A 5FBQB 2OFOA 4F7WA 4E22A 4H9GA 5IK2A 3GJ4A 4YMUA 4DLTA 3RABA 3I1FA 3TKLA 1P72A 2FFHA 2JEOA 2R44A 4HYYA 3HU3A 4C2TA 2WKQA 4LUCA 3K0CA 3AF3A 1YE8A 5DO9A 3GLIB 4B3FX 5ELXA 1YZKA 1KO8A 4KVGA 1KBLA 5FTNA 4JJZA 5EXPA 2XSZD 3TLXA 1IHUA 4WXRA 5KPJA 2R6CA 4ZDWA 3T06B 3QG1A 2DFTA 1NMYA 2PVPA 2WWIA 2PZGA 2FPMA 2J45A 1RRCA 3UG7A 3BH7A 1VYUA 8OHMA 3GQBA 2GNOA 1GDDA 1E32A 1G8GA 4GMDA 4MQBA 2ZJAA 4Q7JB 2ZR7A 1RC8A 2R7NA 3FHTA 1YR8A 2JAQA 3UXMA 4NE2A 3JZAA 3ADDA 4Q7KA 1N6KA 1FOEB 4Q03A 1N0VC 4PO1A 521PA 3B1ZA 4JS0A 4ZI2A 1JAIA 4WBNF 1UF9A 5JFGA 2R8RA 3SDZA 2DLNA 4BRWA 2O8DA 3O8BA 1D2EA 2CHGA 2GJAA 4BFVA 3E70C 2EFGA 4TYQA 1CRPA 3KX2A 4JKIA 3AVXA 3UWKA 3GJ0A 1W4BA 2HXSA 2G0NA 2A5YB 3U44B 5H8WA 2ZYUX 2FZLA 3AP1A 4B48A 1J7KA 2NZJA 4IOKA 4A0FA 1KO4A 1LTQA 2NO1A 4HAYA 2I8CA 1E2EA 1IM2A 2W6IA 4ZPXA 5C18A 3K53A 5FUWA 1IOZA 1AA9A 1US8B 1SVKA 5AWFC 5KKNB 1Z5ZA 2ORWA 4BFUA 1TF7A 4LBWA 1CEEA 1D5CA 3VR6A 4JBYA 1P9WA 1Z29A 3LBHA 4Q4HB 4EGJA 3VKHA 3CZQA 1F5NA 2XZOA 2ZJ8A 5FUVA 4TYPA 3IO5A 2QRZA 4ACBA 2IA5A 4MA4A 4CRWB 3MWEA 5FOVA 4CF7A 1VPLA 5KHOC 1GSIA 2ZRPA 4IDNA 2EVWX 1CJKC 4LJYA 2W71A 3WO0A 4JVMA 4M21A 2OT3B 3MWJA 2IT1A 5J4HA 4O4LF 2D2EA 4KJZA 4LJ5A 3SOPA 1VCMA 3DVLA 4UNPA 4MDFA 2ONJA 3X1YA 1UBCA 1E1RA 1FTSA 1KI4A 1AQUA 1COWA 4US0R 1XEWY 4ZV4A 3PITA 1XMJA 2JLSA 2YWEA 3GEHA 3U4QA 4G01B 5FI1B 1LFDB 2G1JA 4LZZA 1N5KA 4Q9LA 3BB3A 2J1LA 3TUZC 4XD7D 3UWOA 4C0JA 1HYQA 4JT4A 2HYDA 4IVQA 1R8SA 2ZDQA 1RYFA 2E87A 2W6PA 4BFTA 1OSNA 1SXJB 5IK2D 1Q0UA 4FWIB 4KFRA 3WHLA 4ZKEA 4Q4AA 3ICEA 1OLOA 1SVMA 2AN9A 1S2MA 3OEHD 4DXAA 4V0MA 4IXMA 3R5HA 1IY1A 1EWQA 4KCGA 2YOGA 2C5LA 2OZEA 5FFMA 1K6MA 2A78A 2RH5A 2O0HA 5C2JB 2BM0A 2ZVQX 4F4JA 1F2UB 4IZOA 1SVWA 5BYKA 4F4IA 5EE9A 1ODFA 3F3YA 3QUSA 3ORQA 1N5JA 3PCRB 3IKJA 3TINA 4BQSA 1TAGA 1Z0KA 1ZCAA 4WA7A 5KSPA 1H8HD 4ZDIA 2ZR0A 4CVNA 5TXGA 1P9NA 1Z8FA 2DFKB 4EFMA 3Q7PA 4ACAA 1KI6B 2R84A 3EW9A 2NGRA 3AVVA 3AUXA 4O4IF 4MV3A 3O8RA 3CPHA 2ZJZA 4MGKR 2BBOA 1T91A 4ZOLF 1M34E 4OQXA 1DAHA 2MMCA 3ZVRA 3KTAB 1Z28A 2Z6VA 3A37A 1GZSA 2OBLA 1OXUA 3WNCA 2HJWA 3R5XA 2PLRA 3EIEA 1AZSC 3TIFA 2O8CA 2JLXA 1M1YE 1Z83A 1JALA 3IIMA 1UBEA 2EWVA 1G3RA 3VTKA 1A82A 4NCHA 4NPHA 3DL0A 3SI7A 4XJXA 1ZU4A 4OI2A 1G5RA 1IN5A 1QHSA 4LV8B 2V1UA 3I32A 1Q1EA 2DR3A 4TL9A 2AL7A 3CPJB 4L15A 1B0UA 2ZS9A 4PPNA 2V59A 4PAOA 2CCKA 2WWFA 3TH5A 3AF4A 2W00A 4B6EA 3X2SA 3FPAA 2CZGA 4C7OB 3SZRA 2PZEA 1MKYA 3QENA 3K1JA 3SYKA 4AKGA 2ZDHA 4XZ3B 2CE2X 4P32A 4U02A 3THXA 1E2NA 1W49A 1M7GA 3REGA 5BYJA 2C77A 1TU3A 3TQFA 3RFCA 4TLAA 3SS8A 2YRWA 3I61A 2E1RA 2O8BB 4KSCA 4JLBA 5F9FA 5CYPA 5JHGB 1E1RD 3BERA 4LJ7A 1COWD 4TT3A 2WIBA 1KK0A 3DPUA 4PQRA 5FL7A 3JZIA 4A6XA 4LOAA 4M1MA 2ZI7A 1YR6A 3H0KA 2GBLC 5FI0B 5HCIA 4AWXA 3ONWA 2YZNA 4OHVA 1P4SA 1CRQA 3OESA 3CM0A 1ZM2A 2NU7B 3QBVA 2QP3A 3LX8A 3KQKA 1KNQA 2W6NA 1R8QA 2OHFA 1UC8A 1U9IC 2VP0A 2ZUDA 4M1KA 3SYNA 1R5OA 1EX7A 1WF3A 4AC9A 2Z0MA 3WYAA 4NH0A 1YQTA 4AURA 4L9SA 2WOOA 3DOFA 2WJIA 1VECA 3MWLA 4PZYA 2WWYA 1W5TA 3B1YA 3MD0A 5B30A 4NDZA 1YVDA 1KDPA 4MKIA 1JXOA 4HLUA 4ZIRA 4MH0R 3G8CA 2IYXA 4TTRA 2Q9BA 2AD1A 4XIGS 5DI3A 4DDWA 4QM6A 3OF5A 2ZXUA 3EPHA 4KYIB 1Z06A 2I3BA 2GJSA 1SXJC 1TQ6A 1XRJA 2ASEA 4M9UA 3TUIC 3EIHA 4QKQA 5FOSA 2QPOA 1R0ZA 4YLGA 3B85A 5H68A 4NYMR 1XTJA 2QTFA 2JCSA 2QZ4A 5AUPB 2N42A 4OYHA 3SJZA 2RGNA 2XTZA 3MUFA 2ZE6A 1FUKA 4NCIA 2BEJA 4O2LA 1KMHB 1HTWA 4JLMA 1G8HA 2GVDC 1E0KA 4O4HF 1QHYA 5TVKA 1KJ9A 1EHIA 2D3WA 3FGNA 1XF9A 3MJFA 2AWNA 2QSYA 4L16A 1NN5A 5AUOB 3W9YA 2A2ZA 1P5ZB 5GJCA 3I62A 1VG1A 1DTSA 1KY3A 4UXIA 5JLJA 3L43A 2AFIE 4PO9A 5EE5B 2JDIA 2FOLA 1J8MF 4FW9A 1MO4A 2GCNA 2H5EA 4TYNA 2X2EA 2A30A 5E95A 2VHCA 4C0HA 4C0SA 1Z22A 1Z2CA 1WP9A 3L0SA 1CQIB 4N1AA 3AKEA 5FTJA 2DPXA 3NC0C 3U7EB 4JLJA 4YJ2F 5TY0A 3WYFA 5M04A 1WR2A 1JJVA 2ZEJA 1KO1A 1WA5A 4P4UA 1G3UA 3LV8A 5JRJA 1AS2A 2FB9A 1G41A 2GF0A 1CJUC 2GHIA 4TL8A 1XD2A 2YJTD 1GNPA 1T3LA 4PZLA 2PZFA 4BLQA 1W7AA 4GSYA 4S35A 1J8YF 3R7WA 4LYFA 1BOFA 3LP8A 1W48A 3NKVA 1GRNA 4ZI7F 1QHIA 2C95A 2RGDA 2BOVA 3NWJA 4PAMA 5CIWA 5C46F 5K8UA 1AQYA 3VX4A 3CH4B 3LXRA 4EIWA 4QL3A 1EG7A 2DWQA 3IPYA 2VH5R 4I50F 1LS6A 3U3RA 4TT3D 1XX6A 1P2VA 5BN4A 1IXRC 3RS4A 5FL7D 2XNDD 1N25A 1PZNA 3TAUA 3O47A 1UM8A 1ZBDA 4NHOA 2ZAMA 4A6PA 2HV8A 1GLVA 2IBMA 1EFUA 1RW4A 4ERNA 2R6AA 2GWHA 2OG2A 1F2TA 2VHJA 2CLCX 3GJ5A 4DDUA 3TJZA 4W5WA 2DZDA 1KGDA 4UNSA 1Z0JA 2QK4A 5JSZB 3ZLJA 1JJ7A 1ZMXA 1N6NA 4C0LA 1CJVC 3L0IB 3W3AA 5FTLA 4LX0A 4BGDA 4CEHA 2ZJYA 2ZYVX 4JSYA 1XD8A 3MAAC 3SHFA 4IDHA 2YHSA 5DYGA 2W83A 3R9IA 4DBLC 4DDTA 4MRVA 1L7VC 1NIPA 1T5LA 2W0MA 2W2XA 3C8UA 1Q12A 2EU8A 3QF7A 1U0JA 1GG2A 4E09A 4TLBA 5JEEA 3DKVA 1D2NA 2WWGA 2BVNA 2V4ZA 1OJLA 3F5FA 3KFXA 4RD1A 3ADCA 1FUUA 2DIKA 1RRGA 2O52A 4JLDA 3CWQA 2REOA 1TF5A 3B78A 3VHXA 4UNQA 4MV6A 3DKPA 3GCGA 5LXTF 4PZZA 5CITA 1SQ5A 5E4FA 4DLRA 3BH0A 2FEOA 3IBYA 2FJUA 3D6TB 1VKJA 1XEXB 5CB6A 3EZ6A 4BE7B 4OQFA 4JVNA 2H7VA 1OKKA 4I4TF 4OQNA 3KQNA 2RHDA 3HU2A 3I92A 1GL7A 3Q2OA 1MO5A 3LBNA 2F1JA 3LA6A 1BIFA 3QJYA 4HB3A 4KYUA 4I81A 2X19A 3ADBA 1KI8A 3HP1A 3KB1A 3THOA 3TUJC 3AVQA 1XCGB 1XBTA 3OIVA 2IYLD 1DE0A 3LO5A 1NJFA 1JXMA 4M1YA 4A9AA 2ZM5A 1E2FA 3SE7A 1EGAA 4BLPA 2GZHA 4O2AF 4O2RA 2F3TA 4C5BA 3OE7D 4OK6A 4ZI3A 1E0JA 3WY9A 4DRZA 1XTIA 3QEJA 5C8YF 2PH1A 2GESA 2WJVA 2OBNA 3AVUA 4IEEA 1VHLA 4HLCA 3I8XA 1P73A 1WRBA 4IW3B 2JDID 2CL0X 4NCKA 4RZ3A 1A5TA 3SN6A 3B7GA 3TAHA 3U5ZB 3RSLA 3AQ4A 2R87A 3SJBA 2QA5A 3W8RA 2YV5A 5G3YA 3FKSD 5KO2A 1P2TA 2CQYA 4ARZA 3LH5A 2VYFA 4QBHA 1J99A 2QMOA 4HNTA 3X1XA 4KHZA 2WBLC 3QKSB 1N0UA 4PTLA 1T3HA 2FSGA 2L0XA 2ZSBA 4Q1FA 4TSFA 2D7DA 1WBDA 4HR7A 4DSTA 1A9XA 3W6PA 1HQYE 4LPSA 4D81A 5AJXA 2C03A 2OV2A 2VRWA 1YHNA 3PIRA 3K0FB 5FR2A 1Q1BA 4IHJF 2ORVA 5EZYF 3ZDQA 3EIQA 5FTKA 4D4LA 4BUJA 1GSAA 3AP2A 1WE2A 3IQWA 1E79A 1W36B 4JL8A 3EZ9A 1M2OB 1E4EB 1PV4A 2QE7A 5ANRB 4AI6A 4PPGA 4RKEA 2LCFA 2GCOB 3CX6A 5I47A 4ZCLA 5FL3A 3R9XA 3OIWA 3DM9B 4EG0A 5JI2E 2OESA 2ZSDA 3U6BA 2B8TA 2W6JA 2QBYA 2FFBA 3WO1A 1ULZA 2OAP1 2NU9B 2ZTSA 2OLJA 1KHTA 3ICQB 1E9FA 5EXSA 3LAWA 3ETJA 1DVRA 5DE3A 3CF6R 1IJEA 2P5SA 1ZW6A 3L0PA 4UXHA 3B1VA 1I7NA 5JVLA 1BYIA 2JJ8A 2RB4A 3EZ2A 3OIUA 2PBZA 4P0TA 5D3MB 5B58C 4L1KA 5H1YA 1EESA 5L3QA 3PQCA 2NZ8A 5F3WB 4ZDKA 4EJSB 2HT1A 2ZE5A 1EWRA 1YRAA 1E2HA 1EFRA 3EG5A 1LS1A 4HZUB 5JEDA 2ZS7A 2JLQA 1U0HC 1JDEA 2A5GA 2FX3A 3A1TA 1NG1A 4BFWA 2JLZA 4OHZA 5GVSA 5J4VA 3A6PC 2OXRA 2UVQA 2ZJ2A 5DIFA 3SYLA 2KJQA 1G8PA 1H65A 3GMTA 3H4MA 5G41A 4TYYA 2RKOA 1ZM7A 2ZIAA 3D7MA 3IHLA 2ONKA 4NYJR 3SFZA 4AYXA 1C4OA 2ZRHA 3JVUA 2VL7A 3MRSA 5LB2A 3SJAA 1MR3F 2CLSA 3K9HA 4B2LA 3SBDA 3OUZA 3PG5A 3QNUA 1KDOA 3TVDA 5DSZA 5IDVA 4MYUA 4B2IA 1JR6A 1U0LA 2ZDGA 1Q3TA 2IS1A 2ZVPX 1KO7A 4RZ2A 2PT5A 3GLFE 3SQXA 2F6RA 3V4RA 2VF8A 4P4SA 3WMEA 1G21E 5CJPA 4HUQB 4MV4A 4XTCS 2A5DA 2YW2A 1YZQA 4D0NA 1TUIA 5L8VA 2YYAA 4LC1A 3ND9A 4QGAA 5FPKA 2NMVA 1QG2A 4RCYA 4YMTA 2C04A 2RGCA 5FH9A 2F9LA 3CUEF 1GNRA 5H80A 1KYIA 3AVYA 5D3QA 1SVIA 4EUNA 3O8DA 1KZGB 1NNEA 3EA5A 1KOFA 5BN3A 1Z0DA 3GFTA 4M8NE 4ZCMA 4TTPA 1RVDA 5EQTA 2GF9A 2D2FA 2FP4B 3NBFA 4US2R 2WWHA 1ETUA 4TSFD 2F43A 3Q3JB 4B74A 1W5SA 2XEXA 3T1TA 3EC1A 5LOVF 4CEIA 5FUYA 3RYTC 3I5XA 2O8DB 4GOJA 4JSTA 4DKXA 2BHRA 2N1BA 2ZR9A 4HB4A 1ESMA 2FFAA 1AJEA 2G0TA 3AKDA 1CJMA 4A36A 5G3ZA 4G1UC 3QEOA 4TL6A 1EX6A 1ZIOA 1E79D 3I73A 4IOLA 3D31A 1ZM9A 3BXZA 4URUR 3WMFA 2YYZA 5HBRB 4URXR 3Q5EA 3QPVA 3B6EA 1P60A 2P67A 3I72A 4MRPA 3RRYA 4EPWA 2QMHA 1E4YA 2ZANA 4DCNA 2X1VA 1OYYA 3AEZA 3CX7A 3E5HA 4I1SA 1AKYA 5SZIA 3SFVA 5TV2A 2GJ8A 1G18A 4MGZR 2UZIR 4US1R 3OHMA 1DS6A 3RSOA 5LD2B 3U61B 1SVLA 1OHHD 5KDDA 4HDOB 4JIMA 4Q9IA 3G0HA 2ZSFA 3HR7A 3VR1A 5FTMA 3KJIA 1CXZA 1E4VA 2X8AA 1N6RA 2BCJQ 4MYCA 2KBFA 4LYAA 5GJWC 1W96A 3GLKA 3U7FB 3RS0A 4M9XA 1Z6GA 3AB3A 5E7IA 4DCTA 3T1VA 2WKRA 5AR1A 1PLKA 4DUGA 1EFRD 1ZUIA 2IYWA 2ZRCA 5CLLA 3TE6A 4DSOA 2V6JA 4FXPA 1GIAA 1RJ9A 3CPEA 1P75A 3TW4A 2I1VB 2W58A 4IKEA 3U4QB 1KMQA 4U00A 3N70A 1SKYE 4NBSA 4YMWA 3R20A 2G77B 1S1MA 3C5HA 1VYTA 1GRRA 1YZGA 1PX2A 1K5GA 3QXXA 3CF0A 3CLVA 4LBYA 1XEWX 2C9CA 2ZYTX 1JB1A 4JVSB 4HZIA 2WPDA 4HUQA 5BQ5A 4RD0A 1LF0A 3CBQA 3V4FA 5C4MA 4EJSC 2RGEA 1GWNA 4TLCA 1P9RA 3DZ8A 4LC0A 3K0AA 3FDIA 4Q4AB 3VNUA 4HAVA 5HE9A 1NLZA 2FNAA 4GP7A 1XMIA 3CKLA 3CRW1 1P62B 3AUYA 1C3OA 3LWBA 2REBA 4Q1EA 4A0HA 4IXNA 1SHZA 4MUBA 4ZHQF 1ZIPA 3TSWA 3MGCA 4R2IA 2XNSA 2XX3A 5JJLA 3CR7A 3FVQA 5AJWA 4XYLB 4OL0A 2JLVA 1UKZA 4IWXA 4ZKDA 2PL3A 2DWCA 3RHFA 4D4MA 3IEVA 1IN7A 1G7CA 1BS1A 1RE0A 4HNUA 2ZJBA 3LY5A 4GP6A 3BBPA 1C1YA 2KI5A 4XYMB 2ZAOA 3KJEA 4NMMA 2CL7X 3A4NA 4DCUA 4RZUA 3K0CC 2A3RA 1W36D 2CEAA 2QY9A 3L82B 2OBMA 3AF0A 3LRPA 4GDFA 4KFUA 2ZJOA 2WAXA 4IDPA 2Q3HA 4M1WA 2R2AA 1Z0IA 3T5GA 3W34A 2FG5A 3IDQA 4CZ2A 5JJKA 2D06A 2ZI6A 1OFTA 3REFA 1XNJA 4A15A 2WSSA 2IW3A 5L3RA 2VP6A 3R8FA 4R9UC 2PT7A 1TQ4A 4WAUA 2WMOB 3NBZC 4PX9A 4B2PA 5P21A 2NG1A 1NLFA 4FMBB 1BMFD 2J0QA 1E69A 1GITA 1GRQA 2CVHA 3BB1A 5A0FA 2JJ1A 3RANA 1NBME 1EFCA 3RAPR 2ZUBA 2O8CB 2J0UA 1DEKA 1ZNXA 3LNCA 1E2QA 2EWWA 2YWHA 1Z3IX 2HT6A 2CCGA 1NY5A 3FMIA 4O25A 2Q3MA 2J5XA 2TMKA 1VIAA 2VP5A 1ZJ6A 2DB3A 3Q1KA 2X0SA 4M1TA 4FMDF 3FHCB 3WP0A 4QJ3A 1D6JA 3MWYW 3G82C 5BPHA 3ASZA 2Q9AA 2QRNA 3CNOA 2Z4RA 2ZE8A 1XPRA 5IT5A 3EPLA 2KSQA 4C0QC 1OT3A 4AYTA 3CZPA 4DEYA 4HAUA 3BG5A 2KWIA 1II0A 3F0TA 3DO6A 1X3SA 3THXB 2GKSA 2PJZA 2PX0A 2QP9X 4Q1DA 1W93A 3SE0A 1AUXA 1N6PA 421PA 1WBBA 1KI1A 2F3RA 2YVUA 3FE2A 1KO5A 1T36A 2C98A 4BFSA 1BXRA 2QORA 3UFXB 3PR1A 4Q48A 4W9MC 3MSXA 2FPKA 2V7QA 3L0OA 4KBGA 5LD2C 1KK3A 2QUZA 3ZVMA 4KSBA 5JBQA 2IHBA 1Y3AA 2H18A 4HLDA 3TR0A 4V0OA 3X1WA 2R7KA 4R7ZA 1DBSA 3U60B 1KK1A 2QM7A 3NHBA 3BIFA 4PQFA 3UMRA 4BWYA 3K8YA 4MRSA 2ZI3A 3C15C 2WPDD 4R71A 3DZDA 2C8VA 4LYHA 4R2HA 5DNYB 2JLUA 4Z8XA 1KKLA 1SCUB 4RJLA 4AD8A 4B43A 2W6OA 1SVSA 1FP6A 2BJWA 5FBVB 3WBJA 1D8TA 5E7MA 1CULC 4EQ6A 3P32A 4DSUA 1VTKA 2ZE7A 3KXIA 3TIIA 2H92A 3OFNA 1QHNA 3UPUA 4ZIRB 1PK8A 2PJRA 1QHHA 4LI0A 1KSJA 4CEJA 3V9PA 4H1VA 1E2GA 5DI3B 2XJ4A 3GLHE 1C30A 3CB4A 2BCGY 4OK3A 2OLKA 4MKGA 1CP2A 1XB2A 4MKFA 3B5JA 4M2LA 2RGAA 3VR4A 4QHTA 1T0JB 4A8JB 5L3VA 2C2HA 4B6FA 2QQ0A 3ZD7A 2MMGA 2MSCB 1TQ2A 4DDVA 2IXFA 2FH5B 2G83A 2O0JA 3GJ3A 3QKRB 2DWOA 4E03A 4O0MA 4OJQA 1YR7A 4JMPA 4YC7A 3BRWD 3DHWC 5JECA 2IYVA 5F2EA 2VBCA 1FNNA 4DLUA 4WW0A 1CBUA 4Z51A 2J9GA 1KDRA 2F1HA 1VMAA 2V5AA 3N2EA 4NYMQ 5EP3A 2QP4A 4DZZA 1NKTA 4TMXA 2W6ID 1U99A 2WSSD 3FHOA 1CQJB 3N2IA 5C4GB 4HDQB 4V0NA 4F38A 3GLFA 2I87A 2PEZA 3ZYCA 1ZC4A 2OM2A 3GJ7A 4LHZA 1NY6A 1FL9A 3HB9A 3PEWA 2ODWA 4A0GA 1CIPA 2ZU6A 4C0BA 3ZIAA 1ESNA 3IIKA 2YZMA 3U7HB 2H1LA 2JJ1D 3EXAA 1QG4A 3N8DA 1U98A 4DHEA 1S1CA 3HYRA 3MWKA 5KYKA 2BMFA 4GFDA 2CDNA 3NIBA 5EXTA 4AYWA 3BAFA 5HZKA 1T8UA 1TF2A 2BM1A 3RV3A 1DADA 2NIPA 3RLFA 1U8ZA 1E9AA 1R4AA 1T3SA 3ZS9A 4DLKA 4LBVA 4P31A 4HEJA 3T1OA 5D8DA 1N5LA 3OZXA 2VHUA 3KB2A 5J40A 2REXB 2WM9B 3LXXA 1JR3A 4KAXA 1O87A 1XPUA 2YWFA 4A0RA 3FKQA 1XD2B 3UG6A 3I5YA 4EPXA 1GSOA 1X8KA 3LBIA 4BEBA 1TUEA 4B75A 1SVOA 3ZJYA 1JKJB 1KJZA 4DJTA 4MA0A 4MITA 5CA0F 2PX3A 3R7WB 4JZKA 4ABYA 2HF8A 2N46A 3H1TA 4YQFA 3WNZA 2GTPA 1E96A 2ATVA 2V7QD 4CYMA 3IGFA 3EX7C 3VMMA 1G16A 3A8TA 4IFBA 4DT1A 3X1ZA 4B71A 3NG1A 4EFNA 2ECKA 1WB9A 2IS4A 2IS6A 5LBIA 1T0HB 4FD2A 1Y63A 4ON9A 2OXCA 1BKDR 3K70D 2BEKA 3P26A 1F2TB 1B6SA 2Z43A 4ITRC 1G5TA 2EQBA 4C0AC 4B3GA 4LHXA 2X2FA 1UPTA 2ZI9A 4CW7A 4CEHB 3BGWA 2NU6B 1GSHA 3QKUA 1E94E 2GAOA 2VO1A 3PFIA 4R98A 2OUKA 4A8JA 2Q3FA 1KTVA 1XTQA 3FYHA 1KNXA 2OFWA 1HY3A 2J3EA 2CBZA 1OFIA 2QU8A 4GI7A 3HYTA 1NVUQ 1ZD8A 3QKRA 1UBFA 3WXMA 4A1FA 1AS0A 2WMNB 3AF2A 2QTVB 2ZRNA 1IXSB 5CDFE 4E4TA 1X8JA 3EC2A 5DN6A 4LHYA 3QI2A 4PHHA 1FMJA 1BYUA 3NEYA 2R82A 1Z08A 2J7PA 3C41J 2I4IA 4MUAA 4QRHA 4IVPA 4JLPA 1U2RA 4S2EA 2QAGA 4Y0AA 4DCSA 3HPQA 3I8SA 5TB5A 3TQTA 4BFXA 5J4YA 1LF5A 1SGWA 4N3NA 4UJ3A 4X8HA 4D80A 1W47A 2QT1A 3C5CA 4LY6A 4XSHA 2A7QA 4DSNA 3FOZA 4FWTA 5F9HA 1CTQA 5IYZF 3K09A 1KK2A 3PEVA 1G19A 2QAJA 2CHQA 2H17A 4FN5A 3SR0A 4HLUC 4TLEA 4V02A 2FPGB 4CGZA 2Q9CA 3ADKA 1Z6TA 3KUCA 1NSTA 1DPFA 2IUSA 3C16C 4I1VA 4EDHA 4TMVA 2FF7A 2OAQ1 4TMTA 3RDPA 3VAAA 4RD4A 4RFVA 4UJ5A 5SZHB 3UMSA 3H2YA 4PHTA 3A1VA 1G6OA 4UXJA 1HT2E 1RYHA 2RGNC 4EKDA 1IQPA 5EZ5A 4ARZB 4Q9HA 3FWYA 1KKMA 2DFNA 1EUDB 3SNHA 5HKKA 3VU9A 1HE8B 1GKYA 3RRNA 4HAWA 5FPHA 4FMDB 1KC7A 4QHSA 5GJBA 2ZRKA 3AVTA 1II9A 2HJVA 3MMPA 3F8TA 4Q1CA 5DI9A 4TL7A 4WD3A 2AX4A 1NVVQ 2CE7A 5EP4A 1IBRA 2G88A 4LRWA 4OJKA 4Q00A 2FSFA 4LK2A 3AVPA 5DH9A 4EPRA 1XEFA 2VPPA 4W5HA 3WMGA 4WZBE 2BIFA 5H70A 5B2ZA 5KNBA 2NPIA 2P65A 3LD9A 1Q22A 4C3ZA 1ZU5A 3GJXC 5LPNA 1NBMA 2NO7A 2FPLA 2QM8A 3GEEA 1E2LA 1I2DA 5J2UF 2CVFA 2IUTA 3TRFA 4F91B 3HDTA 4D82A 1EFHA 1R6BX 4XVUA 4N0EA 2QBYB 1YR9A 2FFQA 5CLQA 1M74A 3VKWA 4MYHA 4AKIA 2R85A 3DOEA 3VR5A 5EJEA 1EZ1A 3PUVA 2O8EA 3BE4A 5FOWA 1DARA 4UQOA 2D4HA 2AK3A 2V8OA 1W1WA 2WHXA 3B1WA 3TR5A 1M7HA 2QI9C 3OAAA 4Q01A 4RZXA 1M8PA 1NRJB 1R0YA 1OIVA 3K3PA 1ZCBA 3SBEA 3J81k 5L3QB 4DB2A 4ZO4A 5G53C 3ND8A 5A5GA 4BZXA 1N6OA 2RGBA 4QGFA 5KPDA 3M0EA 2YINC 3K0EA 4I1UA 2I1QA 4GNKA 5HR5A 2OEPA 4JLOA 2PLFA 5DLQC 4PHGA 2VHTA 1XZQA 4LCBA 3TQCA 3K0SA 2ZYWX 4P33A 2ANBA 3ETLA 1YU9A 1G64A 4JL6A 4PC1A 4V0LA 3CRQA 2XOKA 4OQLA 5DN6D 1SZPA 4E5UA 2R6GA 3RUPA 1TEVA 2C78A 1E2PA 2J7PD 4E07A 2DYKA 4QOSA 4M9QA 4XTRA 3VNVA 2PBRA 4LJAA 4M22A 4LDJA 2IL1A 2ZRFA 4YDHB 5A4JA 2GA8A 4NYJQ 1P61B 4AG6A 1CE8A 4LPKA 3G5UA 4HDCA 4IRUB 5J2TF 5BN5A 4Z1MA 2JLYA 4LWZA 5CB8A 1NN3A 3ZZUA 1N6IA 4DC9A 4Z54A 3B82A 4IWYA 3TNFA 4KBFA 4P4SB 3ZQJA 1NP6A 4KLNA 4BZPA 1T9HA 2FPPB 2R9VA 4XH9B 1Z07A 3RRMA 1I2MA 3L8ZA 2ZETA 2YS7A 1UC9A 3GLGE 1NVVR 2Q0HA 4ASUA 3GLHA 1TMKA 2OE2A 3HR8A 4OHYA 1E1QA 1HURA 4C4PA 2W70A 1H8EA 2GLTA 2AKAB 4URWR 3MLEA 3Q8XB
chains in the Genus database with same CATH superfamily
1ZMOA 2CWBA 2JIZA 1T6NA 2QUHA 1C7IA 4Y9SA 1TEXA 2GEUA 3L4EA 3C5VA 4LHVA 3EZLA 2J3IA 2QYSA 1YDWA 4OVZA 2ZJFA 4IIJB 2OR3A 5DHRA 2XHZA 2ZBUA 3CEAA 4D9CA 3SQMA 4UZEA 4PLVA 4QE3A 1A4UA 3OHAA 3H4BA 1UBTS 4C6HA 3VA7A 2JK1A 4DNXA 2HCJB 2Y0SA 1Y8CA 2J87A 2Z57A 4RELA 3VPGA 1OKKD 3U6OA 4FOOA 3NHPA 5BSKA 3T15A 3WKEA 3WKDA 4K86A 1J9GA 3LLMA 2G8LA 2FPIB 3ZW9A 1WMAA 2I7PA 2XY4A 4D3YA 1RI3A 2ZUCA 3IBTA 4S12A 1EDEA 3KSMA 2RHMA 3QU9A 1IJFA 1Y7HA 3T3OA 2C4HA 1C3LA 4FNAA 3H8SA 5DEOA 3FPSA 3OQPA 3AF1A 1E9EA 3L27A 1JG7A 3QU2A 4TWJA 3FYDA 2B7CA 1XJCA 4J3FA 2DVMA 5E9AA 1OY1A 4C4TA 3ENKA 4N01A 3NPAA 3HDYA 2GHRA 4PSVA 2DBYA 5ALVA 1HEIA 5TDHA 2QE7D 3WLLA 4RF1A 1SC6A 1YQUA 2JLRA 2JBAB 2RD2A 3W79A 1BS9A 1M2WA 3AUAA 3O90A 3H40A 4TQUS 2N9UA 5MHTA 2ZT5A 1BXKA 1D0KA 5JPIA 3X1DA 3SVTA 5EZSA 1NVGA 5BWOA 2WJHA 4QYIB 1R6XA 5C0OE 4L0QA 4RKUF 4KRXA 3H9QA 4EPVA 1UFQA 1QORA 1TIPA 3KJGA 1W1IA 3DDZX 4D8XA 3HI6A 3W7VA 2RHTA 4UEQA 2OV4A 1IY0A 3L01A 1K3TA 2EJWA 4DYDA 1OX5A 1D2GA 1PEAA 4JI3H 3F5SA 1Q57A 4P3PA 2POQX 2Z09A 4JL5A 3H5IA 4KXWA 2JK0A 4YQYA 2X22A 3SJ7A 4BPBA 3ORRA 1U4NA 4YONB 1JHAA 4UQPA 2C3MA 2FW7A 4Z3DA 1GZ4A 3E8MA 2VPYA 3W67A 5DXJA 2HXGA 1W4CA 2F8TA 1QHGA 2IV3A 1E1NA 4Z4HA 2AGPA 2ONCA 4HMQA 1RXEA 3E6AA 3KELA 4N0DA 2B9VA 1JFFB 4DR5B 5AKHA 2QMQA 1USUA 2H1RA 3IHTA 5KNCA 3FPLA 1G17A 1X7YA 2Q2EB 1DV2A 3OEWA 2IOYA 5DTIA 5CK5A 1NVKA 1AGPA 4I1YA 3NS7A 2L69A 5TJ9A 4D26A 3E3AA 4PE5B 5K0ZA 3TW6A 3SNKA 2XZTA 5FI3A 1F3OA 4J76A 4YAUA 4JP3A 1ZHOA 3EEYA 1T4CB 4R6WA 4JJGA 4IIGA 4D98A 1FQJA 4CMBA 1LTMA 1TX4B 3HJBA 3EK2A 4RVGA 2YVKA 3EG9B 4L95C 2RAUA 3LYLA 3U48A 2BBSA 1MX3A 5K6AA 4GQIA 2OD2A 1C9NA 3AESA 2I6TA 2BKXA 3C3JA 3PJRA 2PGOA 1J20A 4DV2H 1RXCA 2VQSA 1LNSA 5DM60 4PO8A 2A35A 2DPJA 3KUDA 3VNBA 1DAGA 1OXXK 1BDIA 4NBTA 2X3FA 1QP7A 3NU1A 2CHUA 1E6UA 1GCIA 2HA3A 1E0SA 1MNAA 4QGSA 1H3EA 4DLYA 2BE9A 4XR4A 2W9AA 1O2DA 3VU1A 4PPYA 1QK5A 1J90A 4LC9A 5JRZA 2OOKA 4KOAA 3DFMA 3T6KA 5KC8A 1N3LA 2CHVA 2B8EA 5LZ8A 3S2IA 3UOGA 3D8BA 1L7NA 4TKVB 2AXEA 2P3OA 3A9CA 3OE7A 4A8JC 3ZIAD 4MGEA 4ESEA 3L0YA 3VVCA 2VT7A 2XYGA 4IBBA 2WV7A 3L1IA 3VFDA 3EXG1 1JEEA 3LGAA 2PNJA 1XZPA 3IV9A 4OSOA 1VKZA 4I66A 2C9MA 3FX2A 2QX4A 4G84A 2DKLA 4N39A 4PY2A 3TVTA 3PVCA 4IMJB 4B7UA 1SXJD 4ZVKA 4H6VA 2IVFA 4DIBA 1HQCA 4LRSA 4UHEA 5H9VA 1IN1A 1M2NA 5HIJA 4W9NA 3QUTA 2LPMA 1MO3A 3W90A 1L5YA 1XZLA 1BQEA 5AP9A 4F2HA 2OORA 2Q46A 2V1CA 1EK0A 1NUPA 3FTPA 2CUZA 3BC1A 3D5TA 1G2OA 3NO4A 4S3MA 5FNVB 3ED1A 4Y18A 3ZDRA 3M5DA 2XGGA 4LSXA 4IBJA 4GRAA 3BGDA 3VR6H 1V1RB 5E4JA 3EWSA 1UXIA 1OA0A 5LYJF 1GDHA 1OW3B 3OUUA 4S0XA 4WBSA 3T0GA 1ORTA 2FVYA 1XKTA 3ZBUA 4K9QA 4LZWA 4LZLA 5B37A 3TZBA 2I78A 1GUAA 3KXDA 4L3OA 3EIXA 1RAFA 5ALNA 3JQ6A 1F6BA 3PDWA 3B3AA 4RSMA 3KQUA 2IEIA 1Z8DA 4GL2A 1YF3A 4AQ7A 3MFYA 5JWOA 5IAEA 1JQ3A 2DLCX 2XTMA 4B3SB 1OHHA 3OEEA 4JXKA 2FGJA 3MWMA 4Z4GA 4G0NA 2P9ZA 1I1QB 4KAJA 3U39A 4WADA 3PUKA 2P6PA 5AHOA 1HV8A 2X8BA 2FK7A 1LVGA 4EK9A 1R0WA 4IQFA 3KQTA 3A4TA 3H5NA 3LQ2A 2OD9A 5DNCA 4B3CA 1JT9A 4KUEA 4Q3KA 3OJWA 1JZQA 1WMSA 2HBYA 2H2AA 4PW0A 4ASUD 4DNQA 1E1QD 4LMBA 3LUDA 4K9OA 3GVPA 5FLXS 2VQFH 3HJNA 4M1SA 3QQ5A 5JXIA 3UATA 1QB7A 2XXAB 1QSGA 1KJJA 1UJ2A 3DHVA 5IWAB 4B4DA 2GCOA 2OC4A 1KRHA 3A32A 4MDEA 4XE5A 4GR5A 1DAKA 4Q9JA 4DM4A 3ZWXA 2AJTA 5BYBA 3U6KA 4CHTA 4R54A 2W8KA 1P6XA 4QTYA 2XVMA 3B8HA 2HQSA 4IH9A 1IHOA 3E84A 3FDSA 4MGIR 3AVOA 3OM1A 1DKRA 2QTCA 4XSGA 3T52A 3DR5A 1I4LD 5AM3A 4W5NA 5JDCA 5K4GA 4HRXA 2FMXA 121PA 1I2CA 1XHBA 3I05A 3TRKA 4HAOA 1Y4AE 1WKCA 3MT7A 1MJHA 3GJ4A 3D3NA 1P72A 2C94A 3PQ7A 1O57A 4OJMX 3MC1A 4NV1A 2R00C 1XAHA 3S4YA 5TQ2A 4Q15A 1O75A 5JE8A 5U1PA 2I2CA 4G1EB 2WWIA 2PZGA 2DPMA 2O1XA 3F8NA 4HQFA 1TR8A 3KLBA 4Q7JB 2ZR7A 1EGQA 1KEEB 1ZPDA 3KJFA 5IZ7D 4HH1A 3HYLA 4A0SA 2JIBA 4JU8A 2G0NA 4XQCA 5I7VA 4A0FA 2EF1A 1FW8A 2GX6A 3FSJX 4ZI7A 4IX1A 2XIGA 5FUWA 3LUCA 2J3QA 3NB0A 3OKAA 1P9WA 3VKHA 3GIMA 1ECPA 3CZQA 4WXMA 5K99A 3VUEA 1DKQA 3ZWCA 1VE5A 2HGSA 2ZRPA 2VQEH 2W71A 1H6BA 4M21A 1EAYA 2IT1A 3TRDA 3ZDYB 5LCXA 3GF4A 1E1RA 1FTSA 1WF6A 1I10A 4G01B 3BQ0A 3OCZA 4YJ3B 1HE3A 2FRXA 2HRDA 1PFYA 1LXCA 4FWIB 2IIQA 4DXAA 5LYJA 5EMMA 3U7QA 4QT0A 5CRIA 1HC7A 1PFGA 1Q0RA 1CYDA 3S27A 5E0KB 5KPRA 3TLYA 1Z8FA 1XZHA 5IT9S 2AJCA 1D4AA 2BBOA 5KQDA 1DAHA 4I8IA 4E2FA 2Q1YA 3E3LA 1YJ8A 4JI4B 1UMCA 3VTKA 3NVDA 4XJXA 2I4TA 3TG2A 1UCFA 1B0UA 2VZ9A 5G0UA 2Z9CA 4PAOA 4LF4H 1YS2X 3RFXA 1LU9A 1E2NA 2ATLA 1EXWA 3DFIA 4E3ZA 2ZTHA 2O8BB 3OICA 2VKQA 4B3MH 2WHPA 3RVPA 4A6XA 4IIJF 5TGTA 3IUEA 4OHVA 1DBQA 3EIWA 4JNCA 2CNDA 2W90A 1K0FA 4Q6BA 4NH0A 4MOWA 4E31A 3IJRA 4J8PA 4GH9A 3PC6A 4E08A 3RHSA 3HVRA 3JAWB 2P6OA 4DR7H 5C5DA 2I3BA 1SXJC 2GHQA 1F0YA 5AKLA 2IIBA 2QPOA 2Z3WA 2HPAA 3SR4A 2V0CA 2GERA 4X66M 1KBZA 1XNGA 1CQJA 2QRGA 4Q44A 2PJUA 1VG1A 2JH9A 4JX8A 4XARA 5EE5B 4NCAA 2KZUA 4H7FA 2BKAA 4TYNA 3S2SA 3UWSA 1PR3A 3FF4A 1V8PA 4N1AA 4QJIA 3GEDA 4C4OA 2ODTX 1OI7A 2B99A 1AGYA 3JWJA 4GWKA 4L85A 4NE9A 1GRNA 2BOVA 2VBFA 2DWQA 4ZVRA 1XT6A 2SKDA 2GD1O 1FNSA 4A6PA 1XALA 1YR1A 1GLVA 1EFUA 3Q15C 3A4VA 2CLCX 4YV7A 2EW2A 2ZJYA 1XD8A 3U6SA 4DBLC 4G9GA 4H35A 2IUFA 5GONB 1GG2A 1MXHA 3DKVA 1QOQB 1VLVA 3ADCA 1FUUA 1ENPA 4FVMA 1TF5A 2X2OA 2RIRA 4DLRA 3D8LA 4BE7B 1A71A 4OQNA 5HIAA 4I81A 1H94A 1KI8A 4DV1B 3OIVA 1HQKA 3M6WA 3MZ0A 4A9AA 2CN1A 1L6RA 4DLAA 5KTSA 4RA6A 4OK6A 4EDFA 4DRZA 1EIZA 4A3SA 2A9QA 3IAXA 4QU9A 1W88A 1JKMA 1N0UA 3O03A 1AKVA 2UVDA 3B7WA 4G0XA 3K0FB 1QNLA 4N8EA 4X6XA 2ZJ6A 1DPGA 1P6QA 4JI8M 5JYEA 2ZPUA 1JLSA 4MKXA 2C83A 4KFCA 2KYRA 2XQVA 3OSNA 2ZSDA 2NNWB 2G4VA 2HB6A 3PBKA 1PGYA 5EXSA 3ENVA 2P5SA 1ZW6A 4MCIA 3BJMA 5K3DA 1GQYA 4ZDKA 2RJNA 4NU6A 1BWSA 3ZW7A 4Z7QB 4BFWA 3G89A 2QTRA 1RRMA 3OCCA 2WD9A 2EKLA 3BA8A 4I6EA 3RU9A 3HJUA 3MAGA 2RKOA 3SFZA 4B80A 4G1VA 2CLSA 3JQ7A 2UVPB 3LHIA 1FTYA 2PT5A 3IJEB 4YUAA 4IGEA 5FUQA 3X3HA 2NMVA 1LRKA 1GNRA 5H80A 2F5PA 4X0EA 2FP4B 5KTOA 2IQ5A 1ETUA 1NW5A 1TQ8A 4H3KB 2PDAA 3I5XA 4J9MA 2WHRA 3AKDA 3QXGA 3C4QA 2B5VA 4IIJA 4L9RA 2DBZA 3M5CA 2X1VA 4RVUA 2H8GA 4QREA 4UUPA 2RH8A 3IRUA 4DGSA 1J6UA 1GY8A 4RKQA 1W96A 3RS0A 1Z6GA 4C87A 4C7VA 4DUGA 5C8VA 2HWYA 3I45A 3CPEA 5EJ2A 1W94A 2FPIA 4MRAA 1DX9A 1RQ2A 2C7PA 1MW8X 5BQ5A 3AR2A 2QXUA 2XVYA 4LC0A 4AJJA 4L74A 2NYAA 3OTOB 4A0HA 5IREB 4IXNA 1ZIPA 1L2CA 2VAMA 4NFHA 3ULKA 2XMSA 1YUNA 1TJYA 3Q6IA 4OL0A 4EM6A 2UDPA 3TWKA 1ZSVA 3AILA 1MPXA 2NTVA 2CF5A 1E0DA 4XYMB 5JZOA 3A4NA 4G41A 1MN3A 3L4JA 4F1WA 1SEPA 1NBEA 2B82A 2WSSA 3I28A 2PT7A 3L1HA 1TJ4A 2CW5A 2JBAA 1DBWA 1NBME 4W1PA 1ZNXA 3VLFB 2YWHA 2I6GA 3W05A 2QRVB 3ST7A 3IYLW 4M1TA 4QJ3A 2X0KA 2H2DA 3KE8A 3P94A 1E3QA 1HZZA 3AG6A 1OT3A 2KWIA 2DGDA 1GN8A 3FBGA 2Z5VA 4K9NA 2V7QA 4QYIA 5JBQA 2EZUA 2IP1A 5H4HA 2CXSA 2EL9A 1Z82A 3WGGA 3SSNA 3GRPA 2FRVA 1T2CA 1M5UA 5BOSB 3VNAA 3BF7A 1SVSA 5FNVF 1EJ2A 2RHOA 4PDBA 2O2DA 2ZKIA 2Z6AA 2QTZA 2Q5OA 4M2LA 4MP3A 1OMOA 2LV8A 4JB2A 1YDHA 4ZC1A 2ZBEA 3N75A 4WW0A 2PWAA 3QFCA 3WK7A 1Y3BE 1FL9A 4GWGA 1N34B 3AJAA 3RUAA 2VZ8A 3ROPA 1L1ZA 1WUIS 1T3SA 4FQ5A 2ZB8A 4K9LA 3OZXA 1JFFA 3OURA 4E5NA 5IBCA 3CSUA 1SVOA 3CLHA 4XM2A 2HCFA 4OB6A 1D4ZA 5BN4B 2IX9A 4MQEB 2CLEB 3A0UA 3FLBA 3MJDA 2Z43A 4YR9A 1FFBA 5AHWA 4YRGA 4TWIA 2W9XA 2E5FA 3DE5X 1KNXA 4MH0E 1P5JA 3P0JA 1SHLA 1T4CA 2AUMA 1WY7A 2AE1A 3BCUA 3GWZA 3JPYA 4ARSA 3ZDCA 3IKVA 3ZE2B 2YUTA 3WQBA 5DNAA 3EG9A 5KFFA 1SUPA 1MNQA 2O14A 4TLEA 2PKYX 3RAQA 3TOSA 3J7TA 3QLUC 3F1KA 4J75A 1QR2A 3C5WP 1QPBA 3H5OA 3UMSA 2RGNC 1Z7BA 1QO9A 1WSDA 2FN7A 4QFDA 5KVVA 2DFNA 3JTEA 3RWBA 4KR7A 4DMKA 4ZI5A 4J3JA 2WG0A 4MARA 3FNHA 1SH7A 2O7VA 2VC2B 1LKZA 2EC5A 1P3DA 4C3ZA 4MR7B 5BSTA 1NBMA 3MYYA 2NO7A 2IUTA 2CHEA 3TRFA 4HOYA 5CLQA 2GKGA 5EJEA 3U13A 1SEVA 2WHXA 1M7HA 4XFKA 4QEDA 1U9CA 2AIRA 1NUUA 3UJCA 16PKA 3V42A 3FSEA 1U4SA 1ZSYA 3B7ZA 4DDKA 1BOOA 3JCZA 3CVVA 1JIVA 4TPKA 3UH1A 3GIIA 4PC1A 1NV8A 2NV6A 2R6GA 3C7CB 4TKVA 3RIYA 3GFBA 4RTOA 1KAEA 1OLSB 4ZT6A 4PNPA 3T95A 4RK5A 1RXUA 3Q9UA 3DCNA 2QUJA 3IOCA 2VUHB 1N33M 3UICA 4QX6A 2XFTA 2JEYA 3KT8A 1TMKA 3T3GA 1HURA 5I4BA 3GW8A 3W0FA 3EDMA 3VC7A 2M6LA 2O1WA 3ZS8A 1D4FA 5KNCH 2ST1A 3RIMA 3SQDA 3L4SO 4OOFA 3A1FA 5IZ4A 5EHIA 4URZR 3SDBA 4NZMA 3DTNA 2VJKA 3D2BA 2XEDA 5IULC 3LF1A 2QPAA 3L2PA 1EX9A 1U0GA 4B33A 2EEZA 1DXYA 4ABTA 3L7MA 3T7SA 5DCYA 2EYUA 2PGIA 4DXDA 1GGFA 2IY9A 3U62A 1XFAA 4AF8A 4YJ3F 5FNVA 4MZDA 1QBKC 1J0XO 5ALRA 3ZGLA 3IQGX 4L8WB 1GHTA 2RARA 5KFTA 1QVVA 1V1RA 1DFIA 1E2DA 4IIXA 2FEMA 4BP9A 1Q7RA 5F12A 4C2AA 1PBNA 3R3YA 5JCPA 4V39A 4R40A 5KT7A 4B4WA 5IMBA 4R68A 1RXVA 2IYNA 4BO0A 4KWTA 4YJ2B 1C0LA 3NNSA 2ZPAA 2GEKA 4OFWA 1Z4JA 4PWZA 4XQ9A 3VSEA 1R10A 1WWKA 1NN1A 2ZI5A 3COWA 2RGXA 4B0PA 3EASA 4B3BA 3T5KA 1O9BA 3WQSB 5CH8A 1EXMA 4NEQA 3C3DA 4FQ8A 4YAEA 1TCBA 1C9EA 4LY3A 1SVNA 2XQFA 2C2OA 3GMDA 4E1BA 2XT0A 1SUCA 4DXHA 4IINA 3OOJA 4NZPA 2HCBA 4OMFG 1LVUA 4XVQA 5A9TA 4C2UA 3L9WA 4YAFA 2J5KA 4WDQA 1EFPB 5LXTB 4RMGA 2JF0A 1GGNA 1HE4A 1ZOOA 2XCTB 1VEKA 4I14A 3DDSA 2W2QA 2NNLD 3H9UA 2JAHA 4L5IA 1ZGBA 1I7LA 2ZRIA 4M1ZA 1U8YA 2K5UA 3MUEA 4RSHA 4MAFA 1NN0A 2JFNA 2Y27A 4KH0A 2XXAA 4NK4A 1V9LA 3WZLA 2JEGA 2BDUA 1XCOA 4BN4A 4MWTA 2HRZA 4QIHA 4V38A 2IEYA 4U9IS 4FYKA 3QHAA 3PHLA 4ZGWA 1VBNA 2GYYA 4WLFA 3HR4A 5H5JA 2EUCA 3L29A 4QFBA 2AK2A 3H20A 3ZCVA 1ZGHA 2VA3A 1U28A 4DUZB 4L02A 3OZUA 1Z2AA 2TMYA 4MZXA 1YU6A 2CZCA 3HDVA 5EJIA 3EVFA 1GKKA 3TI9A 4Q8FA 4Z9AA 1S02A 3RV4A 3R9KA 2X86A 4DMMA 2EERA 3LC1O 1N1DA 4IVNA 5GONF 4GOKA 1EFTA 1OF1A 2X7HA 3VI4B 3GARA 4Q7JA 2VXBA 4XLTA 1ZA2A 2YOFA 3CMMA 4Y6RA 1KEEA 1VCOA 2GN6A 2UZ4A 4INAA 2C2MA 5C4XG 2QROA 3HU5A 3KFVA 2PRIA 3EPGA 4I4LA 2QNRA 5EEHA 2ZITA 1KE1A 2WWXA 3LJKA 2P3LA 2ZYHA 4NECA 4F1KA 4EBDA 4F4FA 2ZSEA 1ZMVA 3FTDA 1Y1PA 3TK1A 2YXEA 3WK6A 4F6LA 1UM9B 3RS8A 4FMCF 1YQEA 2AR7A 4GZ6A 4XWAA 5DBGA 1S4MA 4WOJA 5LQUA 1YNSA 3I76A 5CDYA 1N5DA 1UFZA 2PN1A 4YJ3A 3AMVA 4RVNA 1YSCA 1JB9A 2HNAA 2CLOB 1KP3A 2KPOA 5DKFA 3S8MA 3HADA 4D41A 1WQ4A 4H7EA 3DBHB 3PXEA 2A0XA 4QXAA 1HFWA 4FHGA 2HLDD 4IRMA 1GU7A 4UKDA 1Q1QA 3N86A 3GOQA 4UUBA 3Q8MA 4PBRA 4WFIA 3DEKA 1VIDA 3PRJA 2OK7A 4DY6A 1P18A 3NGXA 3AJIB 2DR0A 4MQFB 4G4QA 1KC1A 2F67A 1MJGA 1J1IA 4EYEA 3K9FC 4O3OA 4GLFA 1DV1A 5KYVA 2HYIC 2M9MA 3UJAA 1E2MA 2O2ZA 2R92A 3WRYC 2ZBPA 4RTMA 3HWX1 1E9VA 4RW0A 3A4YA 4J0HA 4F5DA 3RFUA 2I6UA 2A0UA 4EYKA 3ET4A 1OIPA 4RL6A 5BV1A 2IHJA 4PBSA 4I3FA 4AW4A 1JR3D 1X2BA 2O8BA 1JLLB 1MHPA 4LE0A 4JJEA 2XA1A 1XMVA 5D5HA 2B1IA 1YBFA 3BL6A 2WJZB 1MB0A 3GQ5A 5F3DA 4DR4B 3GA5A 3QH4A 1A76A 4DV3M 3ZHRA 4P7BA 2K4MA 3VDNB 2X49A 3BF8A 3BS4A 5K09A 4ZQHA 3PGLA 4U4AA 1SMKA 4D4HA 4G4RA 2GRJA 4FQ7A 3AG5A 3W6OA 4ECEA 2CXXA 3JAWA 4HXGA 3ZHCA 4BQRA 1WY5A 1HLFA 1XL1A 2SNIE 2V65A 4C3VA 4DEXA 1GP2A 1EWVA 4AY2A 2EZ4A 4G4SP 1EVJA 4NDNE 1HEYA 5H3HA 1P6UA 3TNLA 3FLMA 1JI3A 3SC6A 1IONA 1ULTA 1ZM4A 4NMXB 1J2JA 2JHGA 3R0ZA 5D6NA 1X3LA 3KV3O 2IXTA 3DO5A 1QRAA 4LDAA 1NKVA 4A92A 3J7BA 2RHRA 3V6MA 1DEXA 1KSFX 3DMHA 2UVUA 4EG1A 4QJBA 1F20A 3GK3A 4EEXA 3HJQA 3EXFB 2I7VA 3WIUA 4NCJA 3T61A 3M1LA 4AN0A 1FRQA 2ZW9A 5TMEA 5KPTA 1D4OA 5HUJA 1IQUA 3DWEX 4PAQA 4MYTA 3RB0A 2IZZA 5DGXA 1J2UA 5J23A 3N2NA 5IG2A 1JS1X 4HSGA 5CA0B 3M4JA 4CIDA 1Q3CA 4MRRA 2O7QA 4Q19A 1T4GA 2QG9A 3GPUA 3K4QA 1NW6A 3SARA 1PJTA 2DPYA 5GONA 2G17A 2YXNA 3J7AC 4CN9A 2R5WA 4MB6A 4AW9A 4WASA 1V43A 3VO8A 2I76A 2OQ2A 4YRKA 3FD8A 5LVAA 3SZUA 4F96A 1HDXA 5KU1A 2NT3A 1PG5A 1G7TA 4XEHA 4XVRA 4QTXA 4FEAA 2BGJA 4X64M 1VSUA 1YBMA 5K3SA 3CT4A 3CR8A 2YX1A 4ERXA 2UXBB 5K0EA 2Z3ZA 2SHKA 2WDTA 3G2LA 3K0FA 1FW6A 2NUBA 3MMXA 2WE8A 2D59A 4IUDS 1O58A 1ULUA 5F76A 2KLBA 4ETSA 1EJ0A 2PGDA 3TNYA 3A9TA 3VR3A 2C2RA 1K66A 2BZSA 3GU3A 1ZGZA 4UVEA 3OZCA 3W8EA 1HDIA 3M1IA 4DSZA 3LPNA 2OMKA 5AT1A 1ZBQA 2I03A 3HO8A 4C7BA 2ABWA 3UMJA 1CB0A 4DC0A 3IURA 2Z1DA 3BDVA 2QL5A 4DN6A 2E55A 2A94A 3L0ZA 1FMCA 3NYRA 3PLAE 4ZVLA 2QTMA 4H6XA 4E22A 2UVPA 4CU5A 3GFSA 3AF3A 4GLOA 4P7KA 1YZKA 5HGXA 1KBLA 2PWYA 4JOQA 2FW8A 3SSOA 4A03A 3EGIA 3PWZA 2ZK7A 4CDNA 4INOA 3WIEA 3ZR4B 4Z86A 1JIQA 4OUDB 2FP4A 3BMOB 2JFBA 3QVXA 4JS0A 4GOMD 1RBMA 5KZMB 1QGED 4OHBA 1V5IA 1O7JA 1MVNA 3QRWA 2GFIA 4D9HA 5IH3A 4N0PA 2GBFA 2NZJA 3OZ7A 4MHSA 4JEIA 5IXJA 4OG2A 1W19A 1SVKA 5AWFC 1ZIYA 4EYHB 4CMEA 3ESZA 4KT0F 1Z29A 3C3PA 3LBHA 2W37A 1OWMA 3IO5A 4MUIA 2JKVA 2PV0A 1WAMA 2JJMA 4NBKA 1V4NA 4HWPA 4GXRA 1BHQ1 1F2VA 2YJ5A 3BRQA 1JJFA 1XEWY 1B2LA 1LFDB 4LZZA 3G2MA 4F9GA 4YRBA 1SXJB 5CFPA 3AJDA 1UK7A 4KCGA 2A78A 1IWPB 4ZOAA 4YMHA 1UMKA 2WINI 5IH7A 3E21A 1JLHA 4IGAA 1M8JA 4XYMA 1Z0KA 1PR9A 4IXWA 4CNBA 2L19A 3Q7PA 4CETA 3TOXA 3QUAA 3CPHA 3M9OB 4DA8A 4M76B 1L7AA 3WNCA 2JLXA 1Z83A 5HP4A 4L4RA 2QRVA 1A7AA 1SIUA 3Q12A 2WT4A 4ALMA 2W00A 3LCUA 4ZEWA 5DNDA 4YP6A 2P2YA 2ROQA 3PLRA 2PZJA 4GLBA 1TZBA 4ND4A 3UJ3X 2B9EA 3H0KA 1D6SA 1J2YA 1LPAB 4LF7B 1U9IC 5BOSA 1HLDA 2ZUDA 4D9JA 3HN7A 5E2BA 4WDRA 1NGSA 1VECA 1ONOA 2DWUA 3NNNA 5F2OA 4O2BB 1V5FA 3EPHA 2Q0SA 3KXPA 2GJSA 1RJWA 2FH0A 2YQZA 2C2YA 3T1NA 2Q7XA 3A3PA 3KOZE 3FDJA 3TLKA 1ZQ7A 3SJZA 1WHSB 3R0VA 1STOA 1WLYA 1TM1E 1E0KA 1QHYA 3FCSB 4CM4B 1P5ZB 4MTDA 3E9ZA 1J8MF 4BC1A 2OV6A 1CQIB 4LVUA 4YJ2F 4B3IA 4ZRMA 3NWPA 1IJKA 1EB9A 3R5JA 4R8MA 1PYGA 3NKLA 2PZFA 3SM3A 3H9BA 4PCZA 1XELA 4LZJA 4PAMA 2RGDA 1SBIA 4JT9A 5LP6C 1K4MA 5BN4A 3RS4A 3HBNA 2K6BA 4MQEA 3TAUA 4BWVA 5B4VA 1ZBDA 5AI8A 2OM6A 2IBMA 5FFFA 2VHJA 3FYTA 4XQEA 3OMLA 1MVOA 2AYZA 4LEIA 3L4BC 4OP2A 1RWXA 2V4ZA 5AJUA 2L18A 4PIMA 3TG8A 3G2QA 1R9GA 1I1OA 5AI4A 5LXTF 2Z8YA 2G9VA 1Y5RA 3G9ZA 1IVNA 3KQNA 2HF2A 3HA5A 3G2HA 4AMZA 1UBLS 3HP1A 4MW2A 4BNHA 1Z8HA 3NHRA 1L7BA 1DQRA 2WY2D 4F8EA 1H2AS 7AT1A 2NYVA 3U4AA 1RPTA 4ECXA 4Q8EA 2ZM6B 3EIOA 4M54A 3CA8A 3IEPA 1R15A 3VDRA 2JARA 1P2TA 2CQYA 4FWGA 4B6QA 4EP1A 3J80A 3FXAA 2JRLA 4MS1B 2X5XA 4LPSA 2W42A 3N8HA 3AU9A 4JL8A 3JQRA 2C0CA 8LDHA 3KD3A 2PNFA 4MR7A 3CX6A 2HHHM 4J0DA 3DM9B 2A57A 1YGPA 5JI2E 5KFPA 5M3BA 3CCBA 1ULZA 4Z0TA 3O4RA 3U16A 1I7NA 3OJLA 4BQPA 2ZS7A 3F78A 3IE0A 4Y6SA 3H4MA 3BHNA 3TWOA 5AKZA 1OLSA 2ZJ1A 5F51A 5EL0A 3L77A 3SATA 4MYUA 3E05A 4BWFB 1DGFA 2MR9A 3ZNOA 2CMDA 3SQXA 2F6RA 2P9HA 4PLCA 1A8IA 3WLNA 1YQWA 1R18A 2VNKA 4NXMM 4QGAA 3NPMA 1BWRA 4DY4A 3OA2A 4DR5H 4AMUA 1GTMA 3NHFA 4Y2JA 3A2NA 5BQ3A 5AI6A 4R9RA 4QFCA 4DG5A 1K6EA 3SEFA 2NVWA 4MV7A 1FSSA 3IOYA 3NRCA 4Y30A 4ZMSA 3WMFA 4GKAA 5IUJC 3NYIA 1AGXA 1P60A 5ALSA 2TSYB 3DE0X 3SFVA 1ZJWA 2RSLA 1IHYA 3JWIA 2KRUA 4YV2A 1FP4B 3G0HA 3MCVA 3MWEB 3G8BA 2VHEA 3FJYA 3O1LA 5KOJB 4M9XA 2MCFA 2WKRA 1HZJA 3OLCX 3HHYA 1L8LA 1J21A 3TW4A 3U4QB 4U00A 3IG0A 3N70A 1C41A 3HDHA 3UAXA 4J03A 1YA6A 4YJGB 3F6RA 2WE7A 2CLKB 2IOFK 1XMIA 2C07A 3ABRB 3JQQA 2R46A 4D45A 4R1NA 3CR7A 3RGZA 2JGRA 2WUGA 3HO6A 1WJGA 4YJ2A 4Y9DA 4EX6A 1X14A 4HNUA 2ZJBA 4FOTA 1OU0A 3GRYA 3RT7A 1Z0IA 2P41A 4CZ2A 1E6KA 5L3RA 3S8EA 2UV8A 5IF3A 3LNCA 1AF4A 3ACCA 3MR5A 2ZE8A 2EBHX 5F4ZA 4HAUA 2AJLI 3FPKA 2VHVA 1CZHA 2JLBA 4BMZA 4CV3A 2N3ZA 3IAM1 4JX9A 1N6PA 3WLEA 1WSWA 2C98A 4GBED 1EFPA 5LXTA 1Z6PA 3MJEA 2VAVA 4PX5A 1G5IA 2IHBA 1H42A 1XLVA 4U7CA 2AGVA 4O8CA 2PO7A 2AQ4A 4K26A 1YK1A 2ZI3A 4DFDA 3D59A 3MRXA 1RYDA 4NV3A 3AWIA 3VYTB 4OJYA 1Q0TA 3ZDXB 3NM4A 4YT8A 3UPUA 3ZG6A 3G7NA 4UARA 4OK3A 1CP2A 1T8YA 3IP8A 3LT2A 4S1VA 2POCA 4YAOA 4L4SA 5FKJA 3RBZA 4O0MA 1LK7A 2IDKA 3TD9A 1CBUA 2Z2KA 4NJOA 4LFCB 3DHYA 4BMXA 1UDRA 3W9UA 3N2IA 4WKOA 5C3EG 1AXEA 2PEZA 1AZLA 3D1JA 3IE1A 2CW8A 2JJ1D 2BMFA 5HZKA 3T9FA 1N36H 3AERB 2VHUA 3SR3A 3OX3A 2QOEA 4LFBM 5KG4A 1CJBA 1N7IA 4EH1A 5CA0F 3FE3A 4TQRA 2AA3A 1SOUA 2X76A 1S7GA 1G16A 2X0NA 4EFNA 1TECE 4NBLA 5CG1A 1TTHA 4XFJA 2R6ZA 3I9V6 3W04A 1JFRA 4ITRC 1JVBA 4C0AC 3IDOA 3M6FA 2CHFA 1UPTA 2V7BA 4A8JA 1AQLA 4Z0HO 2QXYA 1F0KA 1E2BA 4I9NA 3D43A 5EMLA 1TUBB 4OYLA 3PW0A 2ZRNA 3ODPA 5CDFE 3RYIA 4AMBA 3T41A 1YBVA 4KE8A 1N78A 1SGWA 3U0BA 2AZMA 4B3SH 4UNIA 7ABPA 1UM9A 1WOMA 2ZBVA 3PPYA 5LQDA 3L6UA 3IULA 2D6FA 1JU9A 1Z6TA 2F5QA 1DPFA 2V4UA 5B55A 4BBZA 3IQZA 1JR2A 4HH3C 4BJ3A 3KEQA 4YVFA 2KS6A 4ITQA 2AHMA 5F2KA 2Y1GA 3AVTA 1XCJA 3DBHA 5EP4A 2G88A 4WH0A 3F8WA 5AVOA 1GO3E 4GO1A 4JLWA 4BMYA 1NFQA 3F7OA 3FI9A 4ATNA 4AWAA 5THKA 4AKIA 2K0BX 3WLKX 2FX5A 2BH9A 4MQFA 3PQEA 2XA2A 2FG7C 3PGXA 2FKAA 3PC3A 3B1JA 3R0JA