2R6FA

Crystal structure of bacillus stearothermophilus uvra
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
949
structure length
899
Chain Sequence
b'MDKIIVKGARAHNLKNIDVEIPRGKLVVLTGLSGSGKSSLAFDTIYAEGQRRYVESLSAYARQFLGQMEKPDVDAIEGLSPAISIDQKTTSRNPRSTVGTVTEIYDYLRLLFARIGRPICPTHGIEIQSQTIEQMVDRLLSYPERTKMQILAPIDVVVDRIIIKDGIAARLADSLETALKLADGKVVVDVIGEGELLFSEKHACPYCGFSIGELEPRLFSFNSPFGACPDCDGLGAKLEVDLDLVIPNDELTLKEHAIAPWEPYYPQLLEAVCRHYGIPMDVPVKDLPKEQLDKILYGSGGEPIYFRYTNDFGQVREQYIAFEGVIPNVERRYRETSSDYIREQMEKYMAEQPCPTCQGYRLKKESLAVLVGGKHIGEVTAMSVTEALAFFDGLELTEKEAQIARLILREIRDRLGFLQNVGLDYLTLSRSAGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLIATLKSMRDLGNTLIVVEHDEDTMLAADYLIDIGPGAGIHGGEVVAAGTPEEVMNDPNSLTGQYLSGKKFIPIPAERRRPDGRWLEVVGAREHNLKNVSVKIPLGTFVAVTGVSGSGKSTLVNEVLYKALAQKLHRAKAKPGEHRDIRGLEHLDKVIDIDQSPIGRTPRSNPATYTGVFDDIRDVFASTNEAKVRGYKKGRFSFNVKGGRCEACHGDGIIKIEMHFLPDVYVPCEVCHGKRYNRETLEVTYKGKNIAEVLDMTVEDALDFFASIPKIKRKLETLYDVGLGYMKLGQPATTLSGGEAQRVKLAAELHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTADYIIDLGPEGGDRGGQIVAVGTPEEVAEVKESHTGRYLKPILERDRARMQARYEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Excinuclease ABC subunit A
molecule tags Hydrolase
source organism Geobacillus stearothermophilus
publication title Crystal Structure of Bacillus stearothermophilus UvrA Provides Insight into ATP-Modulated Dimerization, UvrB Interaction, and DNA Binding.
pubmed doi rcsb
total genus 231
structure length 899
sequence length 949
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17755 UvrA_DNA-bind UvrA DNA-binding domain
A PF17760 UvrA_inter UvrA interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.280 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 ABC transporter ATPase domain-like 2r6fA04
1.20.1580.10 Mainly Alpha Up-down Bundle ABC transporter ATPase like fold ABC transporter ATPase like domain 2r6fA06
1.20.1580.10 Mainly Alpha Up-down Bundle ABC transporter ATPase like fold ABC transporter ATPase like domain 2r6fA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r6fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6fA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6fA05
4IEIA 5JVLA 1QG4A 4TMVA 2R6CA 4HUQA 1FW6A 4Q1BA 2REXB 4XVRA 2JLXA 2CZGA 2J0UA 4NYMR 3BFKA 3SEAA 1G5TA 3AF2A 1JB1A 3R8FA 2Q21A 1KJWA 3GJ4A 1UBGA 1MABB 1GDDA 3AKDA 4FWIB 2SHKA 3NBFA 4M9ZA 4U5XA 5CIWA 4M9UA 2ZYWX 5EUMA 1KZGB 1T91A 4E5UA 1AIPA 2JJ1A 3RDPA 4DDUA 2W6PA 2OXRA 3ZQJA 2VEDA 4BWYA 5HR5A 2YW2A 4LYHA 1RIFA 1HA3A 1KJZA 3EPHA 1NY5A 3MD0A 2YVUA 2RMKA 3BOSA 2OCYC 4WA7A 4ILEA 2GESA 2GETA 3OE7D 2X1VA 2QT0A 3HPQA 1DAFA 1VECA 1A5TA 1OIXA 4G3XA 3VR6A 1RW4A 2CHGA 3RS4A 1VHTA 3PITA 4P4SA 5L3SB 2NO0A 4KHZA 2RAPA 2B6HA 4LI0A 4CEJB 1DV1A 4IFEA 1A4RA 2AKAB 2WJYA 1SKQA 2CCKA 2OFXA 4L1KA 3PG5A 1U0LA 4KCGA 1CU1A 2DY1A 2FU5C 3C8UA 3EIQA 3RRYA 2O8DA 2P6UA 3P1JA 5JH7F 2EWWA 1XTKA 1Z0FA 3Q9LA 4M1SA 3CB4A 4CEIA 5K8LA 5J4LA 1GSIA 3WHKA 1NI3A 2BEJA 1VIAA 3THYA 4F38A 3QF4A 2OBNA 2W6NA 3U4QA 2YINC 2JJ8A 4AG6A 2RHMA 2I8CA 5AK0A 3BC1A 1G3MA 2DLNA 1MR3F 2OAQ1 1P9RA 1RFLA 3GFOA 1VG1A 1KO4A 821PA 2OBLA 2ZI5A 4XWKA 1L4UA 2QAGB 1R2QA 1BIFA 2GVDC 4LHZA 1KI8A 4N3NA 4OQLA 3QKSA 4TTPA 1DV2A 5FUXA 3SHWA 3BWDD 2JCSA 3TQTA 1F2TB 1NVVQ 4Q1FA 5JS8A 1GZSA 5C8YF 1ZIPA 5FOWA 3QIAA 2YZ2A 3QKUA 1R5BA 2WMNB 4Y0VA 4ZKEA 3V9PA 3THWA 2ODWA 1FNNA 4PHTA 5H68A 4F4IA 1T3LA 5JEDA 2O0KA 2X2EA 4O25A 3ZGXA 2XITA 1FX0B 2V5AA 3LVRE 3ZS9A 1LY1A 1WMSA 5JSZB 3AVOA 2CVHA 2IYVA 1D9ZA 4B33A 4LJYA 4NYJR 2FSHA 3MWJA 2W6IA 4YJ2F 2RGXA 2H92A 4Z8YA 3GLFA 721PA 3VKGA 4DUGA 1S8FA 1TQ6A 2ZRBA 2ZYUX 2CK3A 4IKEA 1LB1B 3P20A 4WD3A 3LO5A 4Z54A 1XEWY 1G1MA 1GRNA 2O8CA 4TV9F 2C9CA 3RS0A 1DAHA 1KY2A 2ZJ8A 3QG5A 1D8TA 2VF8A 1Z6TA 1TF2A 3U9SA 2O0HA 5FI0B 2Z4RA 4C2TA 1G3IA 2VHTA 4P31A 5GJWC 2GEDA 3DPUA 3SYNA 4WZ6A 2P6NA 3H1TA 4LHXA 4MKGA 3A4LA 4XIGS 4M1YA 4TLBA 1KC7A 5LDDC 3BJIC 1N0VC 2GJSA 3QUSA 4NKRA 3NVAA 2AXPA 1S1MA 3W5JA 2BWJA 2GZDA 5DN6A 4TYNA 2WV9A 3LXRA 5D8DA 3D7MA 5ELXA 2O8CB 4B3BA 4PC2A 4JLDA 1YZNA 3N5CA 2BMDA 4C0JA 1TUEA 1DAEA 4M21A 1NJFA 1ZP6A 1ZCBA 1HUQA 2J45A 2W2TA 4C0SA 3SJCA 3C15C 1G8PA 3MSXA 1T36A 4GZMA 4XD7A 1YKSA 4JVMA 4AYXA 5BW8A 3A36A 3TAHA 1YZTA 2R85A 1W4BA 1OKKD 1NJGA 4NDZA 1NVWQ 1W2HA 2GTPA 2ZSAA 1Z6XA 2W2XA 4I81A 3KJEA 3AM1A 3GPLA 4ABYA 4YONB 2R65A 4JL6A 4US1R 2GJ8A 4JT4A 4CW7A 2R7MA 3JZMA 3IGFA 1YJ5A 4A2QA 3K0CC 4V0MA 3W90A 1GVNB 3IPYA 2VH5R 5L3RA 2RGNA 4RZXA 3GJ5A 2PMDA 2QMUA 1UKVY 3N8DA 2Q9AA 1WE2A 5C4MA 3SYKA 3PEUA 4JLPA 2YZGA 2Y8EA 1DARA 5JCPA 4MYHA 4ZIRB 4HZUA 1TQDA 3EA0A 4L9SA 3VR1A 2QAGC 1QG2A 3IIJA 1YR9A 2FP4B 4W5JA 3M6AA 5AUOB 1CS4C 3RRZA 2A30A 1X1RA 5EZ5A 2ZJAA 3THYB 4BFSA 1YQTA 4I1VA 2QUZA 1JXMA 2QTHA 2J0SA 1WRBA 2IYLD 1N6NA 1NSTA 4BFWA 2QPOA 3W3AA 4IFBA 3CRVA 2IK8A 1PX2A 2PN1A 3OEHA 3DZDA 2E1RA 2DFKB 3KB2A 3V4ZA 3WNCA 2YYAA 2VR1A 1F6BA 2YV5A 5EP3A 2FV8A 2YWFA 2ZJ2A 3K09C 5HV6A 5FL7D 2CCJA 1M6VA 1UKYA 1A1VA 3CUEF 1D9XA 1UKZA 5JJLA 3A58B 1QZXA 2GKSA 3I72A 4LYJA 5E7IA 4C3ZA 2OUKA 1QHNA 5TB5A 3WYAA 5J4YA 1VPLA 1YHNA 3EZ2A 5FPYA 4BEJA 4CT5A 4DIEA 4TZ6A 2ORWA 1Z6AA 4EG0A 2WIBA 4UNQA 3H0KA 2AHOA 1ZU4A 4LBWA 1ONBA 3ASYA 2ZETA 4LPKA 3MWKA 3T61A 4DIDA 4Q1DA 2A5FA 4G5SA 4GOJA 3D31A 4QJ5A 3LAWA 5JSZA 3ETHA 1G41A 1U2RA 1DO0A 1KO7A 3VFDA 1NVUQ 5B58C 1E2HA 3THWB 1SVLA 2J7PA 4F4CA 1NLYA 2ANCA 1TF7A 3FFAA 1F5NA 3R5XA 2JLQA 2F3RA 3CNNA 1HYQA 2Q3HA 4NE2A 3JZIA 3GLHB 3ZJYA 2ZSFA 4DLXA 2QTFA 2CCGA 5EUQB 4DLTA 4YMTA 3IBYA 3QKTA 4QM6A 5JJIA 4YXWA 3UMFA 3R5FA 3TVDA 3GEEA 3EPJA 3JVUA 1FFHA 2XTZA 3DKVA 4Q21A 3PEYA 1ULZA 2GZHA 2R6AA 3T34A 5A4JA 2NG1A 2WOJA 3AF3A 3AVPA 4NPHA 4EJSB 4M0LA 1IN5A 1E79A 1TF5A 5CJPA 2IWHA 1YRBA 2HXSA 3QF4B 3QXXA 2ZRMA 4XVUA 4IOMA 3AVWA 2P2LA 1WA5A 1UPTA 4FW9A 4UJ5A 4OHZA 2R7KA 2H5EA 5FPHA 2QBYB 4B71A 4IVQA 1E2LA 2FJUA 4A8JB 3L0SA 6Q21A 5IRCD 1A2BA 1QHXA 1KI6B 2NO1A 5DGXA 5C46F 2V9PA 4CEHB 1N3BA 3SE0A 1Z47A 3IHWA 2X8AA 5F3WB 1WQ1R 3QNUA 2EFHB 3NTUA 3SYLA 1I4LD 4EFNA 3LBNA 3GP8A 1RRGA 1ZD1A 4ERNA 3B9QA 4B2PA 1NVVR 1N6PA 2A7QA 1KI6A 2VBCA 4B6EA 4PC6A 1S3GA 2HDNB 1J99A 3G5UA 5KDOA 2RGEA 2BCJQ 4JBXA 1CF4A 3K0CA 5E95A 4C0AC 4ACBA 4KFTA 3KTAB 1T5IA 4TQAA 3WP1B 2R6FA 4M4SA 1HQCA 3U6KA 5FBRB 1VBHA 1SXJC 1XBTA 3PUVA 2IL1A 5FOTA 1HEIA 2GK7A 3OFNA 3KFVA 1WP9A 5D3MA 4DSUA 3VNUA 1KKLA 5FL3A 5JWRA 1C30A 3WMEA 3WRXC 5F9HA 1E2FA 5FBQB 5JI3E 1G4AE 3VMMA 3E70C 4NZYA 1OFIA 4TL6A 5HCIA 2IXGA 2IYRA 3ZZ0A 4ON9A 2FPLA 2OLSA 2W6MA 1ZU5A 1XU4A 5GJCA 2ZE6A 2ZREA 4LJ7A 2RGAA 4B2LA 4TMWA 1PUIA 2FGJA 2R6GA 4GOXA 4PPQA 3S1AB 3RRNA 2O8EA 1U8YA 2AN9A 1OV4A 3ECCA 2I87A 2GILA 4G01B 3RAPR 1E4EA 4W7SA 1IQPA 1W36C 3AKYA 2OO7A 3BXZA 4PHGA 2DFTA 3L2OB 2EW1A 4B48A 4C7OA 4ZHQF 2PLFA 5M04A 4GI7A 2SCUB 1C3OA 3K0FB 3MFYA 4N1AA 3W3ZB 4PFSA 1OLOA 2GPWA 4DLRA 2AFIE 1XEXB 2F1HA 3M1IA 4DB2A 4MGKR 4TLEA 5EXPA 2GBLA 3VR4A 4QBFA 4XTCS 2P6RA 1DAIA 1M7GA 1T8TA 3HP1A 4LRWA 4B3GA 3QKRA 4KSBA 2WSSA 3EZ7A 2WPDA 2DWCA 3EA5A 1JPJA 1U9IC 2RGBA 4JZKA 4B76A 3BB4A 4I99A 3AEZA 2X2FA 5CM8B 2ZU0C 4WOPA 1Z28A 4BECA 2J87A 1IN8A 3GLIE 4HAUA 2X19A 4L16A 4ESVA 1LTQA 1GITA 3NEJA 1EX7A 3BH7A 1G6OA 4ZI7F 4FD2A 3THXB 1UFQA 1PLJA 4O4LF 1MH1A 2IXFA 4AKGA 1Z3IX 2V3CC 2PL3A 4FINA 4NL4H 4UQOA 1R7RA 3SS8A 4JVLA 1W2GA 4PZYA 3ZDQA 1EYZA 4A0HA 1A2KC 3LX8A 2QBYA 3IEVA 5J47A 1AS3A 3GJXC 1EFRD 1VG0B 3SC3A 3HJNA 4NP6A 4O4HF 1X8JA 4O4IF 4II7A 5CK4A 2HYDA 4DHEA 4DLUA 2DFNA 1GKUB 5J40A 2O8FB 5CJ2A 1FZQA 4HZUB 2WTUA 1F60A 2F1RA 3W6OA 2MMCA 3UG6A 1KMHB 1RRPA 5C1BA 1FUUA 3WXMA 2V6IA 2VP4A 3GMTA 2EFGA 2NU9B 1ZC4A 2YJTD 2UVQA 4Q7LA 5FPSA 4PZZA 3HPRA 3L0OA 4HDOB 1I7LA 4M2LA 5CLLA 2IX3A 1ZUHA 1XMSA 3PUWA 4OI0A 2EWVA 1KKMA 1ZNZA 1M6NA 1YZKA 2IEZA 2VO1A 3OZXA 3QXCA 4R2IA 1XD9A 2FX3A 2DZDA 2ZAOA 4DCTA 2H16A 4IXMA 2WWWA 5DI3B 1GKYA 1W48A 1T5LA 2A78A 4NTZA 3FWYA 3KQUA 2HEIA 2J9RA 3K53A 4BFUA 4E07A 1EX6A 1AQUA 1Z22A 4DUGD 3ADBA 1E32A 4BGDA 5KNDA 3K9GA 2JA1A 2V54A 5KSOA 2GXSA 1GGOA 2AD1A 2AFHE 2H57A 2OESA 1T0HB 4JSTA 1KK2A 1R6BX 1HV8A 3RHFA 4EDHA 4GDFA 5EXSA 4JLBA 2F3TA 4S35A 1L4YA 4ZV4A 3I61A 4OI1A 3I92A 4OQXA 4K81B 2N46A 2XJ9A 1FNMA 4WW0A 1GG2A 4V0ME 3F3YA 3AQ4A 4MRVA 1N6IA 1G18A 3KFXA 5FTKA 1DPFA 4OKSA 1E9RA 2PVPA 4IOLA 4BZPA 4ZI3A 4M53A 2GDJA 1OPXA 2PJZA 4MYUA 3CF2A 2HJGA 4TN1A 4A82A 5K8UA 3LWBA 1GRQA 1G17A 1MRSA 3R5HA 1FQJA 3D6TB 2XCLA 4Q9JA 1JJVA 4HSEA 1KO8A 1D2MA 5JJKA 4QNRA 4HYYA 5DSZA 5F98A 1YZUA 2PT5A 1GSHA 2WAXA 1JKJB 4EQ6A 1PUJA 4WXRA 2FSFA 2BBWA 4MRNA 4GBMA 4GRAA 4ZOLF 5IHPA 1YZQA 4TSFD 2VQDA 1JECA 1I4TD 1P72A 4XD7D 3OAAD 2IYTA 1GM5A 3RS7A 4GL2A 2RB4A 2WJIA 3P32A 3CR7A 3PV0A 4RFSB 5KSZA 4DCSA 2H7VA 5EZ6B 4HLUA 3ZD6A 1ZNWA 2HT6A 1E98A 2AXNA 1CJVC 1E0JA 4ZCLA 4E22A 3EIHA 4EIWA 3BAFA 4L4UA 2DB3A 2I1VB 2ATVA 1G6HA 4C5BA 1NN1A 5H70A 1NN3A 2KBFA 3EIEA 1U9IA 1RVDA 2QM7A 1U94A 4DCVA 2ZUCA 1U0HC 1IXZA 2ZUBA 4LJ8A 4A6XA 2EFDB 3SOPA 2YL2A 3G0HA 5EP4A 3V4FA 3W8RA 1NBMA 4IDPA 1B6RA 2LKDA 4OI4A 3VAAA 1KK0A 2XXAB 4PC1A 4LBZA 2G1KA 3U2QA 5CAEB 4UKDA 2R6DA 3H84A 1H8EA 3GQBA 1QHGA 1NBMD 2CHQA 3LRPA 1ZM9A 2J7KA 1NRJB 1KAOA 2A5JA 1N5JA 1KY3A 1XEXA 4DSNA 1KZ7B 2G88A 4G1UC 3SQWA 3UWOA 1OFHA 5BMVF 3B1XA 3ZYCA 4V0NA 1M7BA 3A1WA 2AR7A 1KJQA 4M1KA 5HBRB 2CXXA 2CVFA 4HATA 2FPMA 3H2YA 4L15A 1E2NA 2R2AA 4D0GA 2O8DB 3K5HA 1VBGA 2PX3A 3CNLA 1XEFA 4O2BF 3THOA 1EESA 1Z2AA 3UFXB 2VHJA 3TH5A 1UEIA 3ONWA 2QU8A 2PT7A 2I80A 2Z5FA 2NUAB 3GFPA 5DNYB 4ACAA 3LWNA 1W7AA 2FH5B 2DBYA 1II9A 2VHQA 3DEFA 3L43A 3I4LA 4D6PA 4F7WA 1KSHA 3KL4A 1CE8A 4LHWA 1AQYA 3B8HA 2REOA 4TL7A 4EPRA 2WJVA 4EUNA 4GNKA 3T5DA 2ONKA 4LJAA 1NG1A 4CF7A 1I2DA 3W6NA 5H8WA 5JRZA 4BPBA 4PZLA 3MWEA 3OAAA 1BYIA 3EPKA 3VHXA 3K0AB 4Q9IA 3I1FA 4MGZR 3CIOA 3VR5A 3UG7A 2GEUA 2XTMA 4Z1MD 3KTAA 3LH5A 1A9XA 3K70B 1VKZA 2IYYA 4PO8A 1ZIOA 4MV8A 3NH6A 4J0QA 1U8AA 4TUYF 2A5DA 2QAJA 5HE9A 3ZQ6A 5FBLB 2QSYA 3KQHA 3R23A 1G64A 1ANKA 2DR3A 4BEBA 1LF5A 1KGDA 4BZQA 3FFBA 3LDAA 3NIBA 1CIPA 4RCYA 1D2EA 4AKEA 1IAQA 1LVGA 1COWD 4TT3D 3TINA 4Q9HA 2YRXA 2IYUA 4TYQA 3U7HB 1G9XA 2BKUA 2V6JA 3FKQA 4TMTA 4M8NE 4QFMA 2GXQA 4PO9A 3ZH9B 1COWA 2ZRIA 1PV4A 2N42A 1Z0IA 3CH4B 1E2EA 2BKEA 3KQNA 2Q6TA 1W4AA 2QORA 2QPAA 5AUQA 1UC8A 5JI2E 4E03A 3QFFA 8OHMA 3RV4A 1DE0A 1NMYA 3MG9A 2AWNA 1LS1A 1E2IA 4G5QA 4IHJF 2CBZA 5F2EA 3U4QB 2IP4A 5KU1A 2KB0A 1F3OA 4DBLC 3NH9A 3ICQB 2WBLC 2GWHA 1TEXA 1W36D 3P4XA 2FFAA 1IHUA 4PQRA 3X1XA 3GLHE 5E7MA 1W5TA 1CJKC 4V0OA 5BYJA 1JNYA 2GAAA 4MRSA 3LBIA 1C9KA 2ZJYA 2FPPB 4DKXA 4LJ9A 3KJIA 4LY6A 5FI1B 1X8LA 4M9XA 2CNWA 4B3CA 4C4PA 5IYZF 1ZM3A 1KJ9A 3SBEA 2CL6X 3W34A 4JVSB 4NHOA 2W00A 3QXSA 2KJQA 1E1QD 3B6EA 1P61B 3PENA 4HB0A 4TTQA 3ZZUA 1K5DA 1XB2A 4QGGA 1U8ZA 4Q5IA 3RV3A 1E1QA 2W71A 1GKIA 4DEXA 2BBOA 4P0TA 3QQ5A 3IBGA 3K0AA 4JKYA 4LGMA 1UBEA 2IF2A 4BFZA 5HPYB 3TLXA 3SE7A 4M1WA 2VP0A 4HNUA 2G1JA 4DWJA 4YAJB 2FEOA 4PPGA 2BBTA 5HZHA 2JDIA 1N6KA 2D4HA 1G3UA 4WBSA 1MO5A 1CKEA 4B6FA 5HZKA 2FFQA 3LVQE 2O52A 3CZQA 3QVUA 2XNSA 5KYKA 2FF7A 3AVXA 2OV2A 4DDTA 1F48A 5BN5A 3RNLA 1FPMA 4WVFA 4UJ3A 4DSOA 1N6RA 4Q7MB 1A82A 5P21A 4YDSA 4EJSC 5JZVA 2XGJA 1ZCAA 2ZSBA 1CJUC 3Q5DA 1Q1ZA 3B2EA 3JRWA 2EFCB 3PEWA 4ZI2A 1VIYA 2QRNA 1KYIA 1Y63A 1N5KA 1LS6A 2D2EA 2TMKA 4Q01A 5TDHA 2V58A 2QGNA 5FUWA 1SXJE 2GJAA 1XRJA 2W6ZA 1W0JA 2D7CA 2DWPA 4I4TF 2WSSD 2VHCA 1N5IA 2YZMA 5FL7A 3LP8A 3UPUA 3ZD7A 2HJWA 5LYJF 3PQCA 2XSZD 4D2IA 4QRHA 3QY0A 4ZDIA 4YDHB 1JDEA 5C1OA 2ORIA 2QI9C 5JWOA 4POAA 2AK3A 4TL9A 5JS7A 4LC1A 3NC1C 2VPPA 4HUTA 2FEMA 4Z8XA 3EARA 1SVIA 1PJRA 5KPDA 4Q1AA 2HV8A 3RS5A 4JLOA 1R10A 3ICEA 3NWJA 3HU1A 1Z2CA 2VTKA 3MJFA 1DTSA 1G4UR 1UEJA 1TU4A 4R7ZA 4UNRA 4QGAA 2ZE5A 4NCNA 4LYFA 1GSOA 4UXJA 1CXZA 4EGJA 4A2WA 2ZS9A 5F9FA 1HH4A 2AX4A 1OB2A 3NEYA 1OXXK 3B1WA 3KKOA 4RD0A 1GWNA 4N0DA 3GIDA 4NCIA 1RPZA 5DYGA 2C8VA 3KDSE 5FPTA 4IWXA 1XJ0A 5BQ5A 5KUTA 2PZGA 2QRZA 1SXJD 1R8SA 5K8IA 1CULC 4HDCA 1XXHE 2BVNA 4KLZA 4D4JA 3R7WB 5JCZA 4US0R 2XB4A 3PCRB 2MSDB 1KJIA 4AYTA 4U02A 4BE7B 3O8CA 1U90A 2KBEA 3IO5A 5IF9A 5LXTF 2I3BA 3EPLA 5KO2A 5GJBA 4JL5A 2PX0A 5HTKA 5TVKA 4KITB 3IUYA 1AS2A 2GVZC 2QP9X 1RZ3A 1G3RA 3Q8XB 4I4LA 3C14C 1JR3A 4DC9A 1G5RA 3QJYA 1QHSA 3GJ3A 4B47A 4KU4A 3SR0A 2ZRCA 4O2RA 2BIFA 2XZPA 4QL3A 3ZLJA 3SJZA 1KDPA 3O8BA 3SHFA 2QN6A 3LD9A 5G3YA 4ZCIA 4IOJA 2ZJ5A 4WAUA 5L3VA 3V00A 3RSLA 2NTYC 2ZRPA 2NOAA 4GOKA 4D0NA 3BGWA 1VYUA 2ERXA 1RRCA 4DB4A 3REFA 3TSOA 4A0GA 2CDNA 4JYCA 3T1QA 4AY2A 5HCNA 2XB2A 4AKHA 1KTVA 1ZYUA 4EAQA 2ZE7A 5E4FA 1OJLA 2DIKA 1KI3A 1SVWA 4HAVA 3CRMA 1NL3A 4PC7A 5CLQA 5G3ZA 2ORVA 3IHLA 2FDCA 3MWDA 2OZEA 4W9MC 1NSFA 2JATA 3QXJA 4WXPA 3TNFA 2HLDA 1UM8A 4DT1A 3D8BA 1OH7A 2IS4A 1UC9A 2J5XA 4M1OA 3MCAA 4ASUA 4G0NA 2G0NA 4H1UA 1VCOA 4FMBB 1R0ZA 5HKKD 1AK2A 2GXUA 1QHYA 1YZGA 3QKSB 4DRZA 2GXAA 1UAAA 2ASEA 2GK6A 4LHVA 4C0QC 2IC5A 5ANRB 1GILA 5DYIA 3K1JA 3HU2A 3JZAA 1Q1QA 2FB9A 2ZRKA 1IOZA 1EHIA 1CS0A 2OCPA 2JEOA 2O8FA 3MJRA 4HAZA 3RRMA 4LWZA 2YWHA 5GVRA 1XP8A 5DI9A 1EWRA 1Q44A 1MV5A 3PR1A 2YZNA 3BK7A 4HAXA 4HB3A 4JMPA 3AGQA 4Q19A 4XSGA 2X0SA 3K09A 1KDOA 1UBFA 3MRSA 2JLRA 3OIWA 2O8EB 4URXR 2I1QA 2D7DA 5EZYF 4KLNA 3Q5EA 2E87A 3EWSA 1XTQA 5CITA 5FTMA 1NVXQ 1AKEA 1X6VA 1OIVA 3GJ8A 4P32A 2W0MA 1PLKA 1S96A 4FU0A 1KEEA 3C5CA 4GMXA 3OIUA 4GP6A 5BN3A 2WWXA 2DHRA 4X8LA 2D2FA 4Y8VB 3CPEA 5AR1A 5BXQC 3GLGE 1VKJA 1GRRA 4A15A 1JAIA 4B32A 3PUXA 1GAJA 5EQTA 2F1JA 4ZDJA 1E79D 3B85A 3H4MA 3BG5A 1W96A 2C2HA 1G8FA 2PBZA 3K8YA 2R84A 3NHBA 1OH5A 2DWQA 5B2ZA 3TR0A 5B57C 4LV6A 3NBZC 3RANA 5CB6A 2BC9A 3U3OA 1UADA 4HZIA 3VX3A 3I3SR 3I8SA 5KKNB 1J2JA 5LP6F 5AUPB 1VCNA 3WMGA 4CYMA 5B64A 1E2MA 3FPAA 4QJ4A 3DMDA 2J0UB 2QT1A 3G82C 1H8HA 4US2R 3EG5A 4YAKB 3JRXA 1S9DA 3A37A 3L8ZA 3RC8A 1NG9A 4EPXA 4LOAA 2YYZA 4IHQA 2ZI6A 1ESNA 4JLKA 4L8GA 1R0XA 1ESMA 3REGA 3WBKA 3ADCA 3TIIA 3SN6A 2B21A 4BZXA 2P3SA 5HKKA 1W44A 1F2UB 3QSYA 3R9WA 1FMLA 2VRWA 4PPNA 2YOHA 3RSOA 2RGGA 1SHZA 3QPWA 4XTRA 1G7RA 3KJGA 5FH9A 3QBVA 1TTTA 2GF0A 2WJJA 2ZANA 4Z51A 5BYKA 4B3FX 2IWRA 3R9IA 3ZVRA 4KFUA 1Z06A 5UKDA 3AGPA 1FP7A 1OXSC 3ND9A 1KJ8A 4LK2A 1ZVQA 4D82A 3TMKA 4HLUC 1C1YA 1CR1A 4MDEA 2FZ4A 1XJCA 2K5UA 1TQ4A 2REBA 4JLMA 4PX9A 2NU6B 1G7CA 3M0EA 2H1LA 2YHSA 4NMMA 1GL9B 2CMKA 2R62A 1SULA 1ZW6A 4BLRA 3EXAA 4URVR 1G3QA 4JIMA 4EPVA 4IVRA 2YWEA 1X86B 4TWZA 5KSPA 3THXA 4C5CA 3KKQA 3A4MA 2YRWA 1CR2A 2Z0MA 1P3JA 2W0SA 3FOZA 2XOKA 1XZPA 3U7EB 5IT5A 2R7NA 1E99A 2IEYA 1BS1A 4XVQA 4FWTA 3N2IA 2W6JD 2A2ZA 4KBFA 4PXAA 3KUCA 2RCNA 5DIFA 3VR2A 4BASA 2DYKA 3U3MA 1XCMA 4RD4A 5E7JA 5B30A 4PPFA 4JSYA 3HU3A 1NY6A 2P5SA 5C4GB 2BEKA 4IWYA 1GOTA 3BB1A 1P75A 4B34A 1T0JB 4C0LA 3ZS8A 4O2AF 4A1FA 1GFIA 1US8A 1P5ZB 4OHXA 1YRAA 2WJGA 2HXYA 2O8BB 3DOFA 2VP2A 3LV8A 3TK1A 3CX7A 3CR8A 2OSBA 4E09A 4OQMA 4Q4LA 3B60A 2UZIR 4HLQB 3UKDA 1KJJA 3DM5A 1TX4B 3HB9A 4XOIA 2NO6A 2PZEA 1P2SA 4QGFA 5SZIA 4MV6A 3LA6A 2GCOA 1Q57A 2DPXA 1YR7A 5JVDF 2CNWD 2WKRA 4CVNA 1GTVA 5L3QB 1VMAA 4A92A 2ZRLA 2GF9A 2VHUA 1KSGA 4FMDB 1QF9A 2KE5A 4F91B 2B7BA 4IRUB 4MV3A 2YS6A 2BM0A 3BE4A 1KI1A 5EE5B 5AJYA 1EFUA 5A0FA 4MUBA 1GSAA 1EGAA 1E9BA 2ZR0A 4U7DA 3OUZA 4G5RA 4IXNA 2BMFA 4V0LA 1K5GA 2NO9A 1ZUNB 1T3HA 3IILA 1OHHD 2P67A 3AKCA 4Q4HB 4CT4B 3NHAA 4NCKA 5LB4A 4D80A 5I47A 5DH9A 1OHHA 3FMOB 4ZDKA 4G5GA 4ZPXA 4MA0A 1AN0A 2QQEA 5G53C 2E9SA 1XPRA 1P2TA 2G83A 1HE1C 4NYJQ 3GLGA 1AZSC 4C2UA 4X8MA 1IONA 3C7KA 4KFRA 4MGIR 3TIGA 5LD2C 3QEJA 4PAOA 1EUDB 2FFBA 3ADKA 2AL7A 2D62A 5JRJA 1UKEA 3NDPA 1FP6A 1GIAA 3BD9A 2C9YA 4D0LB 2H17A 3V4RA 3U61B 2V4ZA 4G5OA 1XXHB 2LKCA 3F0TA 1NKSA 2FSGA 3UIEA 5LOVF 1EFTA 4M22A 4RZUA 4JVNA 2JLVA 2ZAMA 4URYR 3AVYA 1IJEA 3U6BA 2YOFA 2LWIA 3ASZA 1J8YF 2PEYA 2VPQA 4P4TA 2MSEB 3H86A 2ZVQX 4H9GA 4HLCA 1SVOA 3B5JA 2KWIA 1L2TA 4RJLA 3VQTA 5DLQC 4RD6A 3O8RA 1QHIA 1GL6A 2XNDA 1Q12A 4TV8F 4YB8B 1FUKA 1G21E 1TQ2A 2MSCB 1E6CA 3CWZA 1E0SA 3HR8A 4XX0B 1FL9A 2WHXA 2QMHA 4IDNA 4UNSA 2GJ9A 4B74A 3U44B 5CM9C 1X3SA 2IW3A 2QROA 2O0JA 5CB4F 2WWFA 4DLWA 5KPJA 1CRPA 2BBSA 3E5HA 1XF9A 1OE0A 3LXXA 1G20E 3KXKA 1YU9A 3IPXA 4AKIA 1ZD8A 1ZUIA 2OLJA 4Q02A 1GL7A 4FCVA 2VF7A 3CONA 1P2UA 4BLTA 4TSFA 1W4CA 2FMXA 1SGWA 2QMOA 4S2EA 4TYPA 4DDVA 5AUNB 5EJEA 4ZIRA 5FTLA 1SXJB 3O8DA 3OIYA 1LW7A 4KBGA 3UXMA 2Z83A 1O3YA 1KIMA 3B78A 2ZSDA 4EFMA 1CRQA 4FCWA 5GJVC 4YC7A 5L3SA 1PLLA 2ZRNA 1RE0A 4CGZA 2V1XA 1XPUA 4XYMB 3VHLB 1E9CA 1VDZA 1L8QA 1IXRC 3U9TA 1NF3A 2NIPA 5J2UF 221PA 3WYFA 4BFYA 1HURA 4TT3A 2WWYA 2FPGB 1QVAA 2W6ID 5TXGA 4OL0A 3EW9A 4AWXA 4KYUA 2OHFA 1JR3E 3MAAC 2QEQA 3Q85A 4GP7A 3VTKA 2PCJA 2PZFA 1ZC3A 3KKNA 5L3QA 1KOFA 3LLUA 2ANBA 4OHYA 4OI2A 4DZZA 2G0TA 5K2MA 2OXCA 2FFHA 1ZAKA 3IIKA 5SZHB 2F1IA 1E2QA 1U81A 4WIAA 4NCHA 4R71A 2XEXA 2O5VA 1TL7C 1IBRA 2CL7X 3WRYC 3CZPA 3BS4A 4MYCA 1XXHA 1G291 3LQQA 3B1VA 4ESHA 3U3RA 3I8XA 3VPDA 2C96A 2XJ4A 2C03A 1JJ7A 3F8TA 2C9OA 3IQXA 2ZI9A 4AG5A 4M9QA 5JHGB 4XWOA 1N0WA 1US8B 1RJ9B 1E96A 1HY3A 2G77B 5DN6D 4I1UA 1CJMA 1SVKA 4NYIQ 1HT2E 4JBWA 4LPSA 1N5LA 4P33A 3U7FB 2VP6A 4TLDA 4QBGB 4LZZA 3TSZA 4BRWA 2ZRJA 1PVOA 4D4LA 1G7TA 4QBIA 2WKQA 1OXUA 1DS6A 4XYLB 3PJRA 3PVSA 1BXRA 3UK6A 1NN5A 3L8YA 1A7JA 1S1CA 4BFXA 5KNCA 5C1PA 1IY2A 1EFHA 5KHOC 2KSQA 3TVTA 1JQLB 1KBLA 3RVBA 1DADA 3OHMA 2ODEA 1JQJC 4UXHA 2J7PD 2WSMA 2ZPTX 4V02A 1AGRA 4IDQA 1FX0A 3X1DA 2IT1A 5TY0A 3TRFA 1HT1E 1SXJA 1XMIA 2J46A 2FGKA 2JDID 1UDXA 3BORA 2PJRA 4DLVA 2FA9A 2ZE8A 3DOEA 2RKOA 4Q4HA 4JLAA 4QHYA 1I7NA 2R86A 1KAGA 1NIJA 3FVQA 2QP3A 1NLZA 5SZKB 1UBCA 3M4YA 1E9SA 1UDWA 4MKHA 4DLYA 3MWLA 3KZ1E 4BQSA 4OK6A 4URWR 1Z8FA 1IN6A 1CP2A 4R9UC 2VLIA 2ZS7A 2WAYA 3WNBA 1JEEA 1GNRA 5FR2A 4DVGA 3FGNA 2O8BA 3PUZA 4D81A 1KNXA 3A1SA 3K9HA 4H1VA 4EKDA 4V0KA 3IEUA 5D3MB 5BPHA 2FOLA 2UZ3A 2MMGA 1U99A 2GLTA 1G19A 2PEZA 1E2KA 3UMSA 1VCIA 3B7GA 1XX6A 2BOVA 3RC3A 1MRNA 2PMKA 2Z6VA 4K46A 3E2IA 1N2CE 4Q4AB 1W0KA 2C99A 4NYIR 3SQXA 4HAWA 1S9HA 3K3PA 2BJWA 4Y0AA 5FOVA 1FTNA 3FHOA 3LQRA 4ARZA 1V43A 4P4SB 1W5SA 4XZ3B 4EFLA 4MKIA 4MUAA 4TMXA 3VKWA 4KVGA 2JLSA 5EP2A 2OFOA 2IHYA 2IUUA 4Q7JB 3GLKA 2W83A 1P60A 3QENA 3ZIAD 2B92A 3GEIA 4A0RA 5FBVB 5J5CA 1W49A 1J90A 2QG6A 4CIDA 4DLZA 2QENA 3LFUA 1E2GA 4O2LA 2AD5A 3K70D 1QRAA 3GLFE 2QGZA 1L7VC 2AWOA 1NN0A 2ZITA 1E4YA 3CKLA 4NONA 1SZPA 1DAGA 3KB1A 3JVVA 4MH0R 1XPOA 1K8RA 1J70A 1OF1A 1IOVA 1BKDR 1Y3AA 2Q3MA 3ADDA 3E5NA 1W47A 2GRJA 5TV2A 5GADl 4PO1A 1J7KA 4PQFA 3VNVA 4JL8A 3WY9A 1QVRA 2ZRHA 1RC8A 4NH0A 1DVRA 1T8UA 1Z0JA 4MITA 5EE3A 1O87A 4RCZA 3X1WA 3GJ7A 3QBTA 1AZTA 1Q3HA 1M7HA 2QP4A 2RH5A 4I1OA 2IBMA 3AF4A 2XTNA 3WNZA 4CEIB 2ZRGA 1NNEA 5KDLA 1P9NA 4WBNF 3UATA 4CRWB 1Z83A 2V55B 3DVLA 3TR5A 4DEYA 3BH6A 3NDBB 4RD2A 1N25A 5JQWA 3O47A 3HYRA 3TUJC 3DM9B 5FTNA 1G7SA 3KJHA 4BUJA 2W6JA 2NMVA 4Q00A 3CBQA 1OFUX 1NP6A 2CLSA 1J8MF 2FG5A 3BH0A 3Q2OA 1F2UA 3KKMA 3WYGA 1D5CA 2IS6A 2ZRDA 4DT1B 2F9MA 1XFAA 2ZRAA 3FKSA 5AJZA 2ZRFA 5G41A 3VU9B 1W93A 1Q22A 5EE9A 1NIPA 3TIFA 1H8HD 3FKSD 4O0MA 5EE0A 2ZYTX 3A1UA 1WCV1 1RJ9A 3AB3A 3LNCA 4EGQA 4HAYA 4ARZB 5DO9A 1IOWA 1S3SA 4C0BA 3K0SA 1XWIA 3F5FA 4HUQB 4KFSA 2J0QA 1Q20A 1G8YA 2BJVA 1K6MA 1P4SA 2JASA 4Q4AA 1EFRA 4Q03A 2WZQA 1R0WA 3VPBA 2EQBA 3T5GA 4PANA 5BWMA 3UWKA 2R9VA 2G6BA 2VL7A 3NBXX 1PZNA 1LV7A 3L82B 2NGRA 4EPWA 1Z08A 4LUCA 5CK5A 1OFTA 2HT1A 2WWHA 1Z5ZA 1E0AA 4B43A 3RS3A 1EXMA 4LV8B 4EJSA 3KXLA 4OBEA 2V8OA 3WMFA 3TQCA 1ZJ6A 2C98A 4KSCA 2OT3B 5LA6F 3AVVA 2EYQA 1C4OA 4UNNA 1YVDA 2NZJA 1E9AA 1MOZA 4OQNA 3TJZA 2ZIAA 3SZRA 1P6XA 5FOUA 2FZLA 3SU8A 4DXAA 1ELOA 2GPSA 1DIKA 3B82A 1E4VA 1NBME 3MGCA 1MKYA 2CQYA 4URZR 2P5TB 1M74A 4NCJA 4MV1A 3PFIA 4JLVA 3Q7QA 4RY2A 2CE7A 1AA9A 4Q1CA 2IYQA 4W5HA 2WICA 5AJXA 5TARA 3CRW1 4YMWA 1ZNXA 3KUDA 3QEOA 5G40A 3OESA 4D4MA 2YS7A 4N0EA 1IXSB 2GCPA 2R8RA 3C4JA 3CO5A 5KX5F 1HTWA 1Q1BA 3FMIA 4ITRC 1H8ED 3QI2A 2JJ1D 3SDZA 3SJBA 4MGYR 4PSKA 3CX8A 4PSAA 1MT0A 2IXEA 2YC4C 2X77A 5BPFA 2CL0X 3PXGA 3NG1A 4B75A 1T4GA 2JLZA 3TGPA 2GBLC 2ZUDA 4HB2A 5FUYA 4Q9KA 1IY0A 1S2MA 1JBKA 2FWRA 2GCNA 1WR2A 4BFTA 3Q3JB 4ZCMA 4HNTA 1G16A 4A2PA 2Z4SA 1JEDA 5IK2A 1II8B 2BMEA 4B73A 3EC1A 1MO4A 2ZEJA 1HE8B 3AP3A 4TZ0A 2ODNA 3BFXA 1WF3A 5TMPA 3W8NA 4M9SA 2RGNC 3CLVA 5EP1A 4F93B 5CDFA 1CEEA 1DOAA 4B2IA 2VA8A 3PUYA 1VTKA 1S0UA 1PK8A 1AM4D 1KMHA 3VKHA 1XCPA 1M8PA 4YLGA 2Q3FA 3A1VA 4FMDF 1E69A 1Z29A 3NXSA 2W6OA 4QXAA 3T1OA 1JLLB 4FN5A 1W1WA 3AUYA 3W6PA 1KNQA 5KSYA 2BV3A 4XH9B 3TBKA 1M34E 2ECKA 3T12A 3EWAA 2ZJBA 3KX2A 4A0FA 1HQYE 1XMVA 2IYZA 1ZNYA 1T6NA 4DDWA 1I2MA 3GFTA 2WIAA 1LFDB 1VHLA 4YMVA 1W46A 2ATXA 1YE8A 2QSZA 1XTIA 2R87A 2R82A 1GP2A 3GLGB 1XD2B 4RD1A 3RUPA 1R0YA 2I4IA 1G8GA 1ZMXA 2CE2X 5EE1A 1QDEA 2ZI7A 4RD3A 3OIVA 1SKYB 2OEPA 2D74A 2JIZD 3MUFA 5KOYA 2NZ8A 1CLUA 2ZU6A 3IQWA 1ZM2A 3K9NA 2F43A 3AF0A 1BNCA 3WO0A 1QHHB 2FPKA 4RFVA 2HF8A 1SVMA 2C04A 2V59A 1TU3A 5DE3A 1TPZA 2V7QD 4I1SA 4HNVA 4RZ2A 4I55F 1AUVA 2H18A 4UNPA 4AYWA 4NYMQ 4A4DA 1KDTA 1ZM7A 2VYFA 2ZROA 4MKFA 4PHHA 4MAMA 3AV0B 1VYTA 3ZVNA 3J81k 3AUXA 2V7QA 1UJ2A 1ZBDA 2NPIA 3EZ9A 4Q9LA 1ETUA 1YR6A 1XCGB 2VSFA 2PCLA 4PHFA 1W4RA 4XWAA 4GMDA 3GCGA 3NKVA 4YBZB 2A3RA 3LY5A 1DG1G 3MLEA 4IOKA 2WJHA 1E9FA 1N6HA 4IJMA 2XZLA 2BMJA 4YQFA 3K0FA 3SNHA 1N0UA 3C41J 4TQ9A 2IYSA 3L0PA 5KDDA 3U5ZB 5JMTA 3G8CA 1NKTA 5DI3A 5LPNA 4C9BA 1KSJA 2YC2C 2ZDQA 3OEED 4QC2A 2Q0HA 5LBIA 1UF9A 1E4EB 3ETJA 4I50F 1ZM4A 3QPUA 1LNZA 3IO3A 1FMJA 2QK4A 4FCTA 3WHLA 2WMOB 3OEEA 4TMKA 1CBUA 4HB4A 2BHRA 2IS2A 2CLCX 4ME6A 2N1BA 2IHBA 3V4SA 2LCFA 2WKPA 5FOXA 4KXFB 5JLJA 2JJ2D 4K8OA 1ODFA 1KMQA 4KYIB 1AS0A 1XTRA 4LBYA 4ZQIA 3RWOA 421PA 4QHSA 4YMSA 2OBMA 3B13B 3QE0A 4C0KA 3AH8A 3GLIA 2JJ2A 4AURA 1CTQA 3NC0C 4IEEA 2Q9CA 1JPNA 3Q1KA 3IKJA 1TAGA 4V03A 1CQIB 4HR7A 3BBPA 4QM7A 5LD2B 4TYYA 1RYFA 4C0HA 1BMFA 2DCUA 1MABA 4LSGA 5J4HA 1OKKA 1Z6GA 3LW7A 1P7CA 4PQYA 2ERYA 1Z6YA 4WZAE 1Q21A 2C77A 1D6JA 4OHWA 3FHTA 4QGHA 2B7CA 3FHCB 5FR1A 5A5GA 3I5YA 1G8HA 3RWMB 4QKQA 2OILA 5EXXA 2Q9BA 4JLNA 4PAQA 4A6PA 3K5IA 4LHYA 2GZAA 1WB9A 3C16C 4XSHA 4GPTA 4IW3B 4ZDWA 1GNQA 2QE7D 3KXIA 1Z0KA 1U98A 1H65A 1SVSA 3CW2A 1KI7A 2CK3D 1WBBA 1SQ5A 1RYHA 2IUTA 3QOFA 2QY9A 1DO2A 1R5NA 2WWIA 1E9DA 4AC9A 3I62A 1R5OA 1VG9B 2VP9A 2RGCA 3RYTC 3VX4A 2WWGA 4B44A 4DCUA 4PC3A 3LBHA 2BCGY 1V5WA 2QNRA 5AJVB 3HYTA 1FOEB 2C95A 3I73A 5JBQA 3OE7A 4LJ6A 1BOFA 3DKPA 2BDTA 2F55A 2NU8B 1KSFX 2EU8A 2GJKA 4A8JC 5J2TF 4LBVA 4R2HA 4OJQA 1Q0UA 1OH8A 2GCOB 2ZJZA 2XNDD 5EXTA 1N6OA 3AVQA 5H1YA 1W0KD 3N70A 1CQJB 1DBSA 2EYUA 4B3XA 2XSZA 3EZ6A 3Q7PA 3TW4A 3CM0A 4EPYA 5J4KA 1XEWX 4CEJA 1CR4A 3BB3A 4OHVA 1NLFA 2OE2A 3MWYW 2F6RA 5JWHA 1WBDA 1I4DD 4BRUA 1IJFA 2W6QA 2ZI4A 4NU0A 3T35A 1EFCA 2HCBA 4MRPA 4WZBE 5DHFA 1QBKC 2VSXA 3W9YA 3HBLA 4YJ3F 3I32A 4KV9A 4JT2A 2ZDHA 2OM2A 2R7LA 4HDQB 3D3QA 2OG2A 3QG1A 4QNMA 2ZSEA 3E1SA 2QPTA 1BMFD 4Z1MA 3L0IB 5FOSA 521PA 3R8CA 2WVJA 1NMZA 5FBWB 1KI9A 3T1TA 1QHHA 1TADA 2ZM5A 2RGDA 1WDTA 5C18A 4IZOA 2R44A 4BLSA 1BH2A 3GLIB 1S4QA 2YOGA 3LW8A 3KQLA 4JJKA 1Z63A 1M2OB 4RKFA 3UANA 1MO6A 5GONF 2IUSA 4MQBA 4OK5A 3N2EA 2P0AA 2CJWA 2QE7A 3UMRA 1JDBB 3BRWD 4OJKA 1Q1EA 2IA5A 4CEHA 3BFVA 4ZO4A 1JR3D 2ZYVX 3Q72A 3CPHA 3TUIC 4CDGA 1W36B 2HUPA 1GLVA 4A8JA 5K8TA 1VG8A 4MA4A 3WBJA 3CNOA 4KODA 1YR8A 1KI4A 1RRFA 4L5BA 3TE6A 2F7SA 1KO1A 3ETLA 4BFVA 1JXOA 1OXTA 1X8KA 3OEHD 2HCJB 1IN4A 3GJ6A 3T15A 4HLDA 1R4AA 4X8OA 2FE4A 3X1YA 4MA5A 3WNDA 3RLFA 2J3EA 5KTYA 3X1ZA 4AIIA 3AVUA 3HDTA 1KJYA 1XMJA 1DELA 4Q66C 1OXVA 1EWQA 2IF0A 2GA8A 2CLDX 2QM8A 4HEJA 4RKEA 3I12A 2VQSA 3HWSA 2PBRA 3KKPA 1IM2A 1EZ1A 3B9PA 3SFZA 1KDRA 1BO6A 1Q3TA 3IDQA 4Q48A 4JKIA 3TUZC 3BERA 2F43B 3BIFA 1OH6A 4JBYA 4TTRA 3DO6A 2JAQA 2G9NA 3ZIAA 1MO3A 3PIRA 4P4UA 4TQUS 3FMPB 4Q1EA 5L8VA 5JHHB 3ZVMA 5FTJA 3A6PC 1D2NA 2H8KA 3FB4A 4LCBA 4Q4JB 2IS1A 2B8WA 2WOOA 4CZ2A 3CF6R 5C2JB 4KJZA 2VSOA 1ZD9A 3OFND 3VMFA 4R98A 1II0A 3K70C 3K0EA 2J9GA 1AJEA 4W5WA 5JECA 2W70A 4ZKDA 3GJ0A 1N6LA 1JI0A 3ZZTA 2J0VA 4A36A 2CEAA 3IIMA 2BM1A 4FMCF 4GSYA 2QMEA 3U44A 4TL8A 5CA1F 1E0KA 4DJTA 2XZOA 4YXWD 1XD2A 5HE8A 1KHTA 3CH5A 1EG7A 2IYWA 3AKEA 3CRQA 4RFSA 4AD8A 4BLQA 1XZQA 1Z07A 2PH1A 621PA 5KNBA 2KI5A 2A9KA 1OT3A 5GVSA 4PSVA 1IY1A 3DMNA 1E2PA 1T3SA 4QJ3A 4LJ5A 2EFEB 4QHTA 1OB5A 3R7WA 5E3HA 1JR6A 2QL6A 1U0JA 3FTQA 1DEKA 4L9WA 2G3YA 4MRRA 2ZXUA 4UXIA 1FTSA 3OF5A 3DL0A 3LLMA 4GFDA 3EASA 4EQ6B 4MDFA 2ODBA 2GAOA 3A4NA 2OCAA 2OAP1 2VP5A 2J59A 3SBDA 1W0JD 3PEVA 1TEVA 3P27A 2FPIB 1XDBA 3U3KA 4YMUA 4LDJA 2NQ2C 4KI0A 5AWFC 3U7GA 3C5HA 2EVWX 1AKYA 2HJVA 2ZR7A 1R8QA 3DHWC 4O3MA 2OFWA 3QPVA 5D3QA 3EZFA 2C5LA 2HYIC 1ZRHA 5CYPA 3VU9A 1VYVA 3TSWA 1OIWA 3K9LA 1Z0AA 3FE2A 3U3JA 1TMKA 2XXAA 3I5XA 2QTVB 3SJAA 5CYOA 4KAXA 4RZ3A 3X2SA 3WO1A 1P73A 3SI7A 4BLOA 4TLCA 1DG3A 4MV4A 3P4YA 1JAHA 4Q7KA 1F2TA 3EX7C 121PA 1FQKA 1TUIA 4PTLA 2WM9B 1SKYE 2A5YB 2W58A 4ASUD 1XTJA 3ND8A 3AP1A 3VPCA 2JLWA 2XAUA 3MMPA 2XD4A 3CX6A 4GT1A 1E1RD 1IN7A 5JEEA 3U60B 4RSGA 2ZQ5A 4OYHA 4URUR 4F4JA 4U00A 4XJXA 2GNOA 2JGNA 2DWOA 4RVCA 3DDCA 2YNMA 2DFLA 1Z0DA 5AJWA 3AF1A 4LC0A 3R20A 4IVPA 1E2JA 5SZJA 3RFCA 1BYUA 2C78A 4M1TA 1EUCB 2FN4A 3B1ZA 1P9WA 4MYTA 3TQFA 1E3MA 3AP2A 3DZ8A 4DLKA 2FSIA 1E94E 2QZ4A 4BLPA 1AUXA 2UKDA 2CJWB 2JIZA 4GZLA 5CB8A 2RHDA 1XTSA 2QA5A 4X8HA 1GUAA 2IYXA 5DISB 3W5IA 3TAUA 4Q18A 5DHAA 5H80A 5FFMA 4JYBA 1B0UA 3T06B 3ORRA 1XJQA 2J41A 1XD8A 2ZI3A 2ZJOA 1KK1A 4JLJA 3WP0A 4DCNA 2AKYA 4DLSA 4LV5B 1E9EA 3CWQA 1OYYA 5LB2A 3GD7A 4AK9A 2JLUA 3B1YA 2D3WA 4QBHA 1P62B 3R9XA 3P26A 4EPTA 1EK0A 1GNPA 1II8A 1OSNA 1RKBA 2CHVA 2XOKD 3TKLA 4HQ6A 1B6SA 3NBYC 2GEVA 4LYAA 1YZLA 4Q4JA 3VR3A 3CRRA 1DAKA 1WXQA 1SCUB 2L0XA 2WPDD 3QXHA 2C00A 2XX3A 3QKRB 3FYHA 1JALA 2P0EA 1CJTC 3SFVA 2OCBA 2B8TA 3A8TA 3HR7A 4HI0E 4Q47A 3RS2A 5CDFE 3FMFA 2ZDGA 1SHKA 4LX0A 1P2VA 1X1SA 2ZTSA 2J1LA 4DSTA 2Z43A 4FXPA 3GLFB 1XNJA 4C30A 1TNDA 2AK2A 2ZR9A 4FI3C 1ZINA 4D25A 4NBSA 2JLYA 2VIIA 2GHIA 3RABA 4TLAA 2HLDD 1AGPA 4KO8A 4TMZA 3CF0A 3OUUA 5FPKA 3QF7A 5IK2D 4QG7A 5CA0F 2YKGA 2ZS8A 4JJZA 3ZVLA 4M1MA 4F92B 4LJ4A 1KO5A 4IDOA 1B23P 2HF9A 2NU7B 4OK3A 2NPFA 2NO7A 3LX5A 4PAMA 4QOSA 4JS0A 5FUVA 2PLRA 2P65A 4E4TA 1E1RA 1CR0A 3QVVA 5BN4A 4D26A 4P3YA 1NMXA 1E2DA 3TW8B 4OQFA 4D4KA 2YWGA 3ORQA 4KVAA 2D06A 2QAGA 3KQKA 1KK3A 1T9HA 4AI6A 5JFGA 1DAMA 1KI2A 4PR0A 1OYWA 1LF0A 3GEHA 4FMCB 4C7OB 1OW3B 4FIDA 4B35A 5J4VA 3EAQA 3AVTA 4B3DA 3GLHA 2FNAA 3A1TA 1M1YE 4IDHA 2QQ0A 3T1VA 4A9AA 3S1AA 2OLKA 2ZVPX 3EC2A 2F9LA 2A5GA 3FDIA 4TYWA 3CPJB 3MJHA 4C5AA 5IDVA 2V1UA 2W2VA 5CIQA 2ONJA 1G5PA 1VCMA
chains in the Genus database with same CATH superfamily
5DQGA 4DR4M 5JVLA 1QG4A 1V2GA 2H65A 4IEIA 4FE4A 3RQIA 4FMPA 4HUQA 4PTZA 4AQDA 4E2ZA 1FW6A 2LRHA 2NN3C 2PZMA 1Y34E 3R8FA 2J0UA 3E81A 2Y2UA 1Z39A 2R00A 3SEAA 3ZXUB 4UVDA 2HX1A 1MABB 1ICEA 2DKOA 3AKDA 3QWIA 4M9ZA 1R3DA 4B5KA 1ZH4A 2NTJA 2Z1NA 4U5XA 3MJTA 5H7XA 4HY3A 5DK4A 1T91A 2I99A 2FE8A 5A2QW 4DDUA 2I6XA 2D4AA 2OXRA 2Z1MA 2OZKA 2VDRB 4DV5B 1BMTA 3HA7A 1K83A 5AIAA 1RIFA 1KJZA 2BGGA 1WMEA 3PDIB 1IJBA 3GDOA 4YRRA 2FN9A 2RMKA 2MJ5B 3A70A 2HJSA 4HTFA 3IBCA 5EUCA 2GESA 3TZHA 3V6LA 2D5LA 1YOVA 3BX1A 2CMFA 1N32M 2GHRA 1V3TA 2ISSD 4UTRA 1A5TA 5DLGA 5KFQA 4KQFA 1I01A 2IZOA 3HDGA 5BSGA 3O03A 1HX7A 1VHTA 2C2GA 4MS1A 1Y9ZA 1MU5A 3KYCA 4KHZA 2VF5X 1TZKA 2IGBA 1T8YA 1DIAA 4IFEA 4MSUA 4RX1A 2H1CA 4YQEA 1JDVA 2HIGA 4E5KA 2CCKA 4F9EA 4L1KA 3IVCA 4KCGA 2Y05A 2DY1A 2YIDA 3C8UA 2C7GA 3EIQA 2NM0A 3TOXA 1NSYA 4YRJA 3FZGA 1TCBA 2EX0A 2E5LH 4BDTA 5K8LA 3NCTA 3VNBA 1WSBA 2CLIB 1VIAA 3NR2A 1FFSA 3LQFA 3FNBA 3DWIA 4QULA 5FA6A 1KARA 4B2YA 2COKA 3A27A 1L6IA 4Y9UA 5DVZA 3U4QA 1RJFA 4AB1A 3R3WA 3GFFA 1U7DA 3GNTA 4GWGA 1U3CA 1P3DA 4PYOA 3O83A 4F6LA 2OAQ1 1RFLA 2BI4A 2VJMB 4EB0A 2ZI5A 3GR6A 2G28A 4K2HA 1QJCA 4JWTA 1KI8A 2CHEA 4JYAH 4BNIA 4MV5A 2XQFA 2QRHA 4RA9B 3ICEA 4LF5H 1COZA 3O2SB 3RGPA 1AKVA 1DGHB 1Q0ZA 5KYNA 3PZPA 1A0IA 1VP9A 1EK6A 4Q1FA 4OSEA 1FNSA 3KZNA 4JBIA 4G8JA 3CLRC 3UTDA 1SIOA 3MT9A 3PWZA 3O90A 2P1ZA 3IEXA 3U49A 3FZNA 3V9PA 3WDSA 4F0JA 4UPEA 2ODWA 1FNNA 5ALOA 2JH8A 4KXVA 1FX0B 4N4AA 1LY1A 4N7JA 5JSZB 5LMNH 3OTOH 3A25A 3PQ2A 2CVHA 5ALRA 5AOVA 4B40A 5HQ3A 5L53A 1N8TA 2FSHA 3AO0B 1AD2A 4NYJR 4YJ2F 4Z8YA 3P2OA 1QU3A 3VKGA 4MV0A 5CW1A 4GKKM 1TQ6A 3DEJA 1HLPA 3P20A 1GAQA 2XKJE 4WD3A 3LO5A 4G9EA 4Z54A 4X54A 1ODCA 1G1MA 1GRNA 1XEWY 2P9CA 3SEFA 1B00A 3Q3CA 1DHTA 2C9CA 3J7TA 3KE9A 1K8QA 4KXWA 4YPFA 1DWUA 3N44B 1VPTA 2I6TA 2IU0A 1K3UB 3RJ5A 4XDZA 2RHWA 1U9JA 3N74A 4GC9A 4RGQA 2Z4RA 4B4OA 4C2TA 3TI9A 2GHQA 3R77A 5F9MA 1FIUA 2GEDA 3DPUA 4XDGA 4YB8A 1Y9DA 1F1BA 4LHXA 4MKGA 3HHPA 2OHVA 4DQ0A 4ZHSA 4BTVA 4EYKA 3A4LA 4XIGS 5ICSA 4UREA 4TLBA 3S70A 2PKCA 3H11B 3X1KA 1LTMA 2VNIA 1CUBA 5EMMA 4FDUA 1WP4A 4H15A 2BFWA 3MD9A 3D7LA 2Q5FA 3W5JA 4JFRA 3BXGA 4A3KG 4Z6YA 1SAYA 2BWJA 1PRYA 5DBFA 5P8WA 3P96A 2QM3A 3LXRA 4PLTA 3SX2A 2WB4A 1PG5A 3G9UA 3LLCA 5AW2A 2WA1A 1JN0A 2I78A 1E5TA 3D7MA 3SXJA 4W4TA 2F4VB 1D2RA 5GMOA 3RFFA 3GEBA 3EGOA 3NS7A 3FLEA 5HMLA 5EAIA 4C0JA 1DAEA 4M21A 1SRRA 4KPGA 1ZP6A 4RZRA 1MLDA 1HUQA 1N7HA 1ZCBA 5A05A 1K4MA 4HMQA 4GZMA 4BIMA 4LXTA 2OD9A 4OH1A 4XD7A 4INOA 2E5LM 3HOYG 4AYXA 3A36A 3TAHA 5HQ3B 1W4BA 2FLKA 3UMCA 2ZSAA 4JV5M 3GRCA 3OMXA 2O7NA 3KJEA 4EVRA 4JASB 5DZSA 4CODB 4PAWA 4YONB 1E7QA 2VDWB 3EIUA 1QGAA 4G1CA 1H6AA 5IC5A 3FPBA 3QPDA 5JXHA 1XQVA 3K0CC 4JJEA 4JMLA 3W90A 3IPYA 1JEAA 5L3RA 1VJ1A 4N54A 1JH8A 2JFBA 2ZJ4A 3USES 3L7CA 4ETMA 2HGSA 1H6DA 1NW8A 4LGYA 1YZHA 2PMDA 3AHIA 3LDGA 2AJBA 3LRXA 3BMNA 4B0OA 2JGRA 5DLDA 3RVQA 2XE6A 4LYDA 2EX1A 3SYKA 4R9NA 1YF3A 1LVUA 4TKLA 2YZGA 1EDZA 1E7WA 2AFHB 2FUG6 2R7ZA 3C24A 3HS3A 4MYHA 1TQDA 3C3MA 1HDRA 5A06A 3EA0A 3AHHA 5JJCA 3VR1A 4FE3A 3ZGZA 3M6AA 2HTEA 5AUOB 2XKKA 4DA4A 2A30A 3LPDA 3PVCA 4KLAA 3ER8A 1KRHA 1EDDA 3P9NA 2ZJAA 2L09A 1GEEA 5LBUA 3SZOA 3KR0A 4BFSA 2QRGA 5JXIA 4DMLA 1SMKA 2FW9A 4I1VA 2QUZA 2J0SA 1FDIA 4E1AA 5BV8A 2WRZA 2Y99A 2BFMA 2QPOA 3W3AA 4X71A 3CRVA 3MJ4A 1FLDA 1FW8A 4J0MA 3DH0A 3GGPA 3ZG6A 5A5VA 4YQYA 3K35A 1JG4A 2W9CB 2G04A 2C42A 1PJCA 5EP3A 5FLXW 2ODTX 3FZYA 4OJYA 2G6TA 2YWFA 4BMVA 3K09C 3O8QA 5HV6A 1DRKA 3PQFA 4JBLA 2CCJA 4WGGA 1UKYA 3P0EA 5EMHA 1UQUA 3X43A 4IHJA 3BWBA 4AICA 5HIKA 4I4TA 3A58B 3ZY4A 1Q11A 2Q27A 3LT4A 4LRUA 4R1TA 2GKSA 3I72A 1X94A 1GYPA 1VE3A 4MWZA 4C3ZA 2YIJA 1SXQA 2OUKA 4B3SM 3Q7SA 3LTNC 2PT6A 1CWUA 5C32A 5IP5A 1YHNA 1ZVMA 1ZI9A 2IDZA 5FPYA 5SY9A 3T5MA 4BEJA 4LMYA 5LDHA 4DIEA 2ORWA 3OLCX 1HL7A 3PQ5A 1SQ6A 4WBXC 1I7PA 2UVUA 2WIBA 4UNQA 3SLGA 3IP6A 2XYGA 3G9XA 4D57A 4Y2PA 1ONBA 1NVEA 4QOIA 5HA5A 1G2OA 2P41A 4UMEA 1BS2A 2A5FA 2XGNA 3PXXA 4OBBA 1XKQA 1OWNA 4IHAA 5D84A 4QJ5A 1XHBA 2C5AA 3SQOA 4ND6A 2E48A 4RL6A 4EYHB 5GM2A 4BC1A 2J4FA 3HXTA 1DO0A 3FWKA 3VFDA 3GJYA 2A1UB 4FFBB 4G0ZA 3NBIA 5B58C 1Y3CE 2P9BA 1ATZA 4JQZA 2J7PA 4O4IB 3WKEA 4BNUA 4MGHA 1P31A 1XAIA 3OI7A 2VK1A 1M0WA 4WLUA 1CUAA 1HYQA 3E18A 3JZIA 2F8TA 3IQDB 4LZOA 3ES9A 1Z0SA 2PRYA 3PVXA 4P5DA 4QOJA 4URFA 3A42A 2CCGA 3CJTA 1P1CA 3K32A 2R8JA 3QKTA 3D6NB 5TQ2A 4C4RA 4YMTA 5E1OA 3UMFA 5I7HA 1W25A 3FJ1A 4CL2A 4JBHA 4BMDA 3AJEA 4FJ1A 2AFIA 1D0MA 1VKRA 3DKVA 2R6AA 1NW3A 4Q21A 4XM2A 3N2KB 1PX0A 1PR9A 2NG1A 5AKIA 1FDTA 4CQLB 4EVQA 4M0LA 1IN5A 2IWHA 2NXEA 3LCUA 3Q9UA 4D92A 3QF4B 3QVTA 2VAXA 2I54A 3SX4A 2G9UA 1CY6A 4FW9A 1UPTA 5TSDA 2UVRA 2R7KA 4B7HA 3NYRA 3HUFA 2IYOA 3N2YA 4OSPA 4B71A 2ONYA 1U0SY 3AILA 1RAIA 1V96A 2IE8A 3WNQA 4A8JB 2O2YA 2QJFA 3ZI7A 1AB6A 1IZ0A 1GNLA 2AC4A 1S9FA 3CUTA 4HFRA 1A2BA 2WFZA 2DAPA 2NO1A 3OFVA 4DQVA 2ATIA 5T41A 1SVUA 3RSCA 4BB9A 1SO8A 1RBQA 1Z47A 2HWYA 2N0SA 2X8JA 3EIFA 3IHWA 3OSZA 3PPIA 4FX5A 3Q8QB 3NIGB 3CUVA 3PC8A 4PCVA 3ZIUA 5DGBA 3NTUA 1JG3A 1I4LD 2ONZA 4EFNA 3BT7A 1RRGA 1ZD1A 3B9QA 3EVZA 4B2PA 4XB6B 2A7QA 2BGRA 3ADPA 1KI6A 3V8BA 4B6EA 3TD9A 4IBIA 2PUVA 3ZCSA 1J99A 4E31A 5ALGA 3UH0A 4MW9A 1IQ0A 3KT6A 1V1JA 4RNDB 1G98A 4KFTA 4LRQA 2I9PA 5K6AC 1NM5C 1OA1A 4TQAA 1X3LA 3WP1B 4M4SA 4BEVA 1HQCA 4EUKA 2CSXA 2L18A 2MYPA 5FBRB 1N2HA 2IL1A 1JQEA 3M4ZA 4NCXA 1WP9A 2EIXA 3OPNA 4DSUA 4NXNB 3VNUA 3D3KA 2CXTA 2VUTA 4H7EA 1C30A 1GPMA 4ZTUB 5AT1A 2NVUA 3VMMA 1RWOA 2BHNA 3BL5A 2L42A 3K05A 5FQOA 2IXGA 3GRRA 4ON9A 4UTOA 2YYSA 5L7WA 3KNZA 4ZOLB 2OLSA 2ZUFA 2JJYA 1X1AA 1Z2NX 3PYXA 4RWEA 1BVSA 1PR4A 5ED0A 4EI2A 1DDOA 1R0RE 3WB2A 3ITKA 2ZE6A 4LJ7A 1CUZA 1CCWA 2FGJA 4PPQA 4GOXA 1LK7A 2CEKA 2HN9A 4EEYA 2PWPA 3NJ8A 3RRNA 3S1AB 1U8YA 2AN9A 1WPGA 3VVBA 4B45A 3IUBA 2GILA 2HRZA 4UHDA 5CFRA 1E4EA 2GZSA 3AW8A 2XTJA 4W7SA 4ZVQA 2OO7A 3CLSC 4BIIA 4MOWA 1W36C 4YRGA 3HX3A 5BSTA 2PGJA 4WLEA 4NRDA 3I9KA 4EBEA 4P16A 3Q6MA 1ZBQA 5GZ3A 3OC0A 3ZDDA 4IBJA 2VPXA 3HZJA 4CG3A 4LMRA 4MGKE 5HM6A 2XLJA 2SCUB 3B51X 3MFYA 3K0FB 4G84A 3MTGA 5EQFA 1WZIA 5E3JA 2HAEA 4HRAA 2NU8A 2AFIE 5DLYA 4XYGA 3MCVA 1M6HA 3BHJA 3FXAA 4DV2M 2GBLA 2XHEA 3PA8A 3VR4A 2UXCB 5EYPB 3QPBA 4UHJA 1NXQA 1BROA 1T8TA 2IHZA 3AF5A 3R5TA 4IGFA 4IDEA 3ZGYA 1PV1A 4DCCA 4B3GA 4OIFA 3EZ7A 2JY7A 5F9LA 2DWCA 2NZYA 1JPJA 3EC7A 3L7MA 4HTFB 1R6DA 2RGBA 3LSTA 4JZKA 4JI6B 5AW7A 1S8OA 4PQGA 4YCBA 4I99A 2D0IA 2X2FA 4WNYA 4CUJA 3R9XB 2YIVX 3NASA 4WOPA 2JEGA 1X74A 2Q0SA 4S1OA 5BR7A 3GLIE 4O1HA 4L16A 2Q5QA 2X19A 4OMFG 4AKSA 4ESVA 1AX9A 1GITA 2ACKA 3NEJA 4PNZA 4YO7A 2O3RA 5A6VA 4P2BA 3BH7A 4CL8A 2E4YA 3H8JA 2G17A 4FD2A 3GEPA 5K3BA 1KQFA 6ADHA 3EGXB 1VPDA 3BWCA 2FF5A 1Z3IX 2C20A 2PL3A 3HUUA 3RUCA 4FINA 5KX5B 4AJOA 1V3VA 2V3CC 2FEKA 4PGMA 5EWMA 3ZDQA 3BXEA 5IU6A 4JGGA 1HR0M 4FNOA 5TQJA 1VFPA 3CF6E 2JJMA 2NXJA 4L08A 5IZ7D 5IAJA 4Q9DA 2XLCA 3GILA 2FLPA 1A9TA 4FDVA 3HCFA 4PCLA 3TRIA 4CI0B 1X8JA 3G1UA 1M8FA 2OM6A 3KLOA 3MPUA 2HYDA 5CK4A 3U1VA 3HUDA 4OVZB 4DLUA 2DFNA 2R2GA 3IV6A 4GD3Q 3FCEA 4J9OA 4IF6A 4QBKA 4AYBE 2XZFA 2H4JA 2I6FA 1SXHA 4HZUB 2QU7A 3Q3IA 4XGQA 2WTUA 1PE0A 1TI7A 4RTLA 4XOUA 3E3LA 5A4KA 3E22A 5C1BA 1FUUA 1FFYA 2Q5IA 1TZJA 2VP4A 1ZC4A 2G0AA 2WDTA 2FPGA 4MWCA 3ZU5A 4Q7LA 5FPSA 1NX6A 4GKVA 4IDBA 3P9ZA 4Q3LA 2WJ4A 2Y1OA 4M2LA 3PWKA 4G0PA 2UXCM 1ZUHA 1XMSA 3PUWA 3RD5A 3V6KA 1Q6ZA 2Y1XA 3COSA 1UQTA 3CRNA 4RH3A 5A71A 2XQIA 2DCMA 1DIBA 2VO1A 3QXCA 1KVSA 1XD9A 3MOSA 1XALA 4QARA 2D7GA 4IXMA 5ITSA 1WNTA 1GKYA 5H3LA 4LGVA 3REQB 2XGMA 1TMYA 3FWYA 2AW5A 3RT1A 4ETWA 2I4OA 3G88A 1YZYA 3KQUA 2PG3A 3GZ4A 3VR3D 1KPHA 2YXLA 4DUGD 3ADBA 1E32A 1JDSA 3O2QB 4BGDA 5B2EA 5IT9W 3K9GA 2JA1A 2OZPA 2YJ3A 4PNHA 2GXSA 5GQSA 3GBPA 1T36B 5KSOA 2HUNA 2AD1A 2AFHE 2OESA 3LF2A 1FYDA 4KWEA 4F93B 4DV3M 5KG4A 5EXSA 1NR5A 3OPYA 4RS4A 5IVIA 4BL5A 1GAXA 5E38A 2ZB4A 3I61A 2ZBGA 3EISA 1V1MA 3HI6A 1NW4A 1TM3E 3FOWA 1QYIA 1AIPC 3AQ4A 4FGWA 1OAOA 2JIQA 4YUYA 1TE2A 3A98B 2EKPA 4EI7A 4IOLA 4BZPA 1SM4A 4JUAA 4X1YB 4M53A 5JISA 1OYOA 3TG8A 1OPXA 2MTBA 3EDOA 4Y9TA 2E6UX 4MYUA 4XE5A 2QX7A 3RLIA 2G8LA 2ZPAA 3VM6A 3GVCA 3EGIA 3P2YA 3PNLA 4H0NA 3UJHA 3O8OB 4BNHA 4PHCA 2K0BX 2BE7A 5JZBA 1JJVA 2MSKA 3O4RA 4BUZA 4J9PA 2QLNA 4RW0A 4UAGA 4EGFA 1KO8A 3IUQA 4YRBA 3FCCA 3N6VA 4HYYA 5F98A 3IQEA 2PKRA 1KVQA 4BMYA 4E7OA 1XNRM 4F4WA 1NDUA 3K0BA 3A9UA 3W6ZA 3EGVA 2P35A 5L9AA 1C3XA 2ZUUA 3WJAA 1DOZA 3GQVA 1HQKA 4UU7A 4DTCA 4GBMA 2BLLA 4N12A 4EEQA 1YT5A 4DILA 1WJGA 2B2CA 2UUCH 3OAAD 4KQGA 1GPAA 1ULUA 2RB4A 1UBSB 2YHIA 4LCJA 4OXYA 1VI5A 3CG4A 4HGOA 3AUJB 2EF1A 4I50B 4RFSB 3B9RA 2FZCA 1DTWB 2H7VA 3CW9A 5FNVF 5EXDA 4CV2A 1MBZA 1N2IA 4U9HS 1R8YA 2YCLA 1GZUA 1TC1A 4J0FA 1CJVC 1Z26A 5G4KA 3D3WB 4A8HA 4C7XA 1CF2O 2BGNA 3A9VA 4QYIB 2J6HA 4PZDA 3H6GA 5H70A 1NN3A 2NQ8C 2F9FA 4XLZA 5AVUA 3R9KA 3USCS 1RVDA 2QM7A 2Q6OA 2WHPA 5CH5A 2JZNA 3H6HA 3I2HA 3DZJA 3M83A 4RADA 1U0HC 2YV1A 4G0QA 4JI0H 4BZZA 4LJ8A 4IY1A 3L1HA 4K9PA 5IBQA 1SUIA 2EIHA 5IABA 4LEIA 3UJ7A 5ITTA 2YL2A 4ARBA 2XMSA 3W8RA 1CFZA 1SA0A 2Q45A 3ND7A 3I9OA 2WR8A 4GE0A 5EHNA 4AJEA 4IGEA 3KZVA 1QIGA 2G1KA 3U2QA 2YWRA 4MXDA 4UKDA 2EARA 1QHGA 2CHQA 2D0DA 3D2BA 4XXHA 3AHFA 5F5XA 5J5AA 1Z13A 4M6WB 3ZXSA 4YRKA 1EBFA 1E1LA 3ZHZA 1PR6A 1CETA 3AK4A 4D44A 4MUKA 2W48A 3IT3A 3L0DA 5BMVF 4WWHA 3B1XA 3CSDA 4D6XA 1VRWA 2RONA 4A26A 2I2FA 2AR7A 2X5NA 5EKUA 1Q77A 5EXEA 4CMGA 1RLTA 3E9YA 4KKVA 1VP3A 5JW6A 5HBRB 3DE1X 4GVXA 1O6GA 1U1CA 1YFKA 4LY9A 3H2YA 2JBAA 4B3JA 1E2NA 1TEHA 4D0GA 2WIKA 1M2GA 2BR4A 3CNLA 2RGYA 3C3PA 4WZZA 3THOA 3G5MA 1BMQA 4NPCA 3UAWA 4D1YA 3N42B 3UFXB 3TH5A 2JCGA 3ESYA 3ONWA 1KR2A 3H1FA 3MINA 1E77A 2FH5B 4GH9A 5FLXS 1P4AA 3L43A 4F7WA 2XNJA 3H11A 1L5OA 4Q93A 1AQYA 1NZJA 2QTNA 4TL7A 2XCOA 4J0JA 4NV1A 3RE8A 4E94A 4EUNA 1MOSA 3QOWA 3MGAA 5JRZA 2HRCA 3TI7A 3PYMA 1S2GA 3C0FB 1JKIA 1LBHA 1BYIA 3OZDA 3KT8A 4LTMA 2GCIA 5CEFA 2NADA 2EBUA 1YGYA 2AEMA 3U1TA 2AUMA 2WB1E 1CP3A 1CIJA 1XNGA 3UJ6A 2DBZA 1YL5A 1JSCA 3ED5A 1R2ZA 2E85A 2I7TA 1A9XA 3SMQA 4LQLA 5IYCG 2OKCA 5EHQA 1F8GA 4MV8A 2MSLA 3OSNA 4LQDA 3JQ9A 2A5DA 5CT4A 4YJKA 1I94B 3ZQ6A 5FBLB 1FRVA 3M70A 2V9WA 1ANKA 4BEBA 3Q2IA 1HG0A 3SM9A 4UUQA 4DJ5X 3E35A 2EFYA 3LJKA 4JUBA 1YXMA 4I1PA 3I2IA 3V1LA 1IK4A 4JU8A 2MYNA 1COWD 4C2AA 4PYLA 4NDNE 2TSYB 3TINA 2HRQA 2YRXA 2IYUA 4I7HA 4R1NA 4TYQA 1G9XA 1MEJA 4Q9HA 5DX0A 5GPBA 1J0BA 1QRUA 1COWA 1L4LA 3EUEA 1ENYA 1GR0A 1LVHA 1UL1X 2N42A 2RJOA 1GDHA 2WG2A 3GGJA 1XQYA 4IJ6A 3CUWA 1PEYA 2Q6TA 2XGGA 1Z4LA 2QORA 4NU5A 4HTAA 4F4HA 4PZEA 4LZPA 1ZMRA 4PDGA 3H4BA 3M6FA 3OOSA 3QE3A 3UJ8A 5EKXA 3RV4A 1ACMA 3ET4A 1NMYA 3QEMB 4YUWA 2QYOA 3EZYA 1IHOA 2EP8A 1IY9A 4N39A 5FNVA 3T7RA 1X7YB 4IHJF 2CBZA 3LT2A 1BU8A 2IP4A 5KU1A 9GPBA 1IU9A 2QQ8A 3ILVA 4DTIA 3BAAA 4QWMA 3TGLA 4OJNA 1X7XA 4ZGWA 2M32A 3IBFA 3X1XA 4ZOEA 1VGRA 5E7MA 2HU2A 1AVTA 3GCWA 3OTWA 3WB1A 3HLYA 1Y6QA 1ND6A 3O4GA 4V0OA 1GV0A 4XAQA 3HBMA 5BYJA 3N0TA 2HHLA 1NC1A 3KL2A 3UXYA 4KG7A 1X7DA 1WW2A 4UN2B 2JF0A 2R48A 3M49A 4LH6A 4EB3A 3G0OA 4WA8A 4LJ9A 3QEMA 1OC2A 1OTHA 1P2BA 1A9ZA 3N8GA 5ECGC 3IAXA 1YE5A 4M9XA 4C4PA 5IYZF 1E89A 1G1AA 2PQ6A 4M0CA 4NHOA 4D41A 2W00A 2W2KA 4Z49A 3OO1A 3PR2B 3TO5A 1P1KA 1J5EH 4TTQA 6PFKA 1BFUA 2W2QA 3ZE7A 2X0NA 5TT1A 4XCVA 5A7HA 4QGGA 3RUIA 1U8ZA 1E8DA 1PT9A 3F6RA 4XCXA 3ND6A 4F4YA 2GRUA 4PAGA 4Q5IA 1TB4A 5K9ZA 1DWPA 2W71A 2TECE 3IDOA 1C0EA 4N7RA 1RMQA 3QQ5A 2RH9B 4YAOA 5DGTA 4CKEA 1T43A 4EF4A 1S03G 5IKXA 4UBMA 2LVAA 5GWXA 1YR2A 2Y1DA 1RYRA 1K0FA 4EHDA 1N2JA 2VP0A 5HRAA 2G1JA 2EJUA 2ZCUA 4FEEA 1TRKA 4FBLA 4P3NA 3GQCA 1EVZA 1ZRSA 2D4HA 2IZZA 5KJEA 3UAYA 3GPUA 1G3UA 1PGPA 1MO5A 2HI0A 1C7IA 1CKEA 2A0KA 3VVLA 4DIKA 2R3SA 3QE4A 5FB3A 4IDFA 3VTAA 3I30X 2OK8A 4DR2H 1JEOA 1XI2A 2XNSA 4ZICA 4G5HA 1Q3BA 3HCNA 1EFVB 5AFSA 5BN5A 2A9RA 8MHTA 4AU1A 1JGTA 4RNMA 3TLBA 2PRZA 5P21A 3L8FA 4I2VA 4DRXA 5KNBD 1EFAA 4ECQA 1CF9A 4MEJA 3OH8A 1CB0A 2VK4A 4G0OA 1ZCAA 5NLLA 2CDRA 3TPFA 3WSVA 1NW9B 5D7NA 3Q5DA 1VL5A 2ZBDA 3B2EA 5JYDA 2J9YB 1IWOA 3PPWA 4FYKA 4ZCTA 1BKYA 5L6MB 1LDNA 1LA2A 2WYIA 3R3ZA 3EYAA 4FONA 1C0KA 1LS6A 4Y2VA 1WKVA 1SU8A 1XZGA 3T5JA 1PT8A 2V58A 2R751 3IHPA 2WJWA 3A3PA 3I42A 4CV0A 4CHTA 5H4GA 4Z4QA 1Z6ZA 3ZQ4A 4E5YA 2QUHA 3T0GA 1TZBA 2A58A 4GHWA 5DN9A 4Z4HA 2Q07A 1P9OA 4I4TF 2IZ6A 2NZUG 4JK3A 1N5IA 1DNPA 1HR0B 4YJGB 3ZD7A 2ZUEA 5LYJF 1QTNA 3K4PA 4QRHA 3QY0A 4ZDIA 3DR3A 2HLPA 4YDHB 5SYAA 2CNLA 5JAMA 1KMMA 3EQZA 1V1MB 4BMNA 4EW3A 2F67A 3GVIA 3NC4A 4AQYH 5GZ6A 5GZ1A 5KFBA 3EARA 1SVIA 4G26A 4OP1A 3DEAA 2GM5A 2FMFA 2HV8A 3GQ4A 4R1LA 3NWJA 4R3UC 1UBKS 3V1NA 1K4YA 2I1WA 3D5TA 1CW2B 3SSAA 3I23A 1T25A 1TU4A 3I6YA 4NCNA 4LYFA 1NV9A 1GSOA 1XT6A 4YGYA 3JVIA 4E12A 2ZT5A 4ZGBA 5KG7A 2ZS9A 3KUXA 3QVOA 1QSGA 4AO6A 1HH4A 3MZ0A 1OB2A 3KKOA 1M0EA 1Q3KA 2RAVA 5DYGA 1LPPA 4JBNA 3N0XA 1BCRA 1QQTA 4LTDA 2OK7A 2BE9A 2QRZA 1SXJD 1V34A 4HDCA 1XXHE 2PX6A 3IPLA 1YTUA 5HM8A 2BVNA 3PQ8A 4US0R 1ULTA 3JD4A 4QYWA 4JI8B 4Q39A 1Y7HA 1ZJJA 4YJ3A 4FIZA 1KJIA 4UVHA 3MWEB 4RDXA 4H31A 3G23A 1X7GA 3QYJA 2HL7A 3ANYB 2OD2A 3UGJA 2CB0A 3CTMA 1K7XB 2BEVB 1CZNA 3HY6A 2I3BA 1AKQA 2VEOA 2F00A 3EBPA 3LC0A 3COVA 3O0TA 4I8DA 3B12A 1M75A 3VOSA 3ZHTA 3LYHA 2QVCA 1M6EX 13PKA 4QVIA 1RZ3A 4I4LA 2JD0A 4DV0H 3C14C 1C9YA 1FVOA 1L5FA 3GBSA 4HQNA 4X6YA 5ERGB 4CDMA 1K7SN 4DC9A 2IXBA 1OZ0A 3AWIA 2BI7A 5REQA 3TDKA 3V97A 1M1XB 3GJ3A 4ARVA 4C0XA 4KU4A 1H5NA 1XZIA 2ZRCA 1C29B 5D6NA 1KWKA 3U7RA 4W6ZA 4UCRA 5AKLA 4L51A 1V7QA 3QELA 1G8JA 4RCVA 3LD9A 4Z5XA 4Y1FA 5HF9A 3RVSA 1N7JA 1HNWM 2QTMA 5JALA 3V00A 3RSLA 4J6EA 2ZCJA 1CDZA 1XMXA 3RVKA 2F4VH 2GPTA 1VYUA 2Y1GA 3H99A 1SUFA 2X0KA 3GO8A 1VJDA 3OF2A 4KUEA 4RKWA 2GQFA 3REFA 4A0GA 5IZCA 3DMYA 1PCXA 1TVKA 4AKHA 3C4QA 3EYWA 1KR5A 3ZOZA 1HDGO 2DIKA 4NBKA 2KA6B 5K0BA 3OZCA 5E4YA 4MR9A 2JIMA 3DA8A 4GG1A 5I7AA 1MA0A 1XVIA 1B16A 1V4YA 3IHLA 3SZMA 5IAKA 4K6CA 1FP2A 3KUUA 3QXJA 1N1MA 5AW5A 2CKMA 3UJ9A 4S2UA 4B17A 4RDCA 1UC9A 1ZESA 4I19A 2IU4A 4P4NA 4GQAA 2GEBA 4BU1A 1QUFA 2CZCA 2G0NA 2IIBA 3C98A 3T5TA 1VCOA 1R0ZA 4A0QA 3ITNA 4KZKA 4MQFB 1AK2A 3JR3A 1QHYA 2WC1A 2J07A 1ZISA 3AUTA 3QKSB 4LHVA 1U5CA 2P6MA 2JFPA 2QTBA 5KNDA 3M7IA 3AERB 5DYIA 5HBGA 5JYEA 2HIHA 4QWBA 3HU2A 3JZAA 3O84A 5ICEA 4OLAA 3HVJA 4HUJA 4DR7H 2FB9A 1S7GA 2YIMA 3DE0X 2ZRKA 1IOZA 1EHIA 2BFFA 3FA2A 1ZL2A 3IHKA 3TS1A 4HC4A 1PZFA 1APBA 2X0DA 3ZD8A 4TRMA 5JVDB 4TXNA 1Z4OA 4LWZA 1PWYE 4HWGA 5DI9A 3PR1A 2G72A 2NZWA 4A16A 2VH2A 3AGQA 3OTGA 3PXUA 3VR0A 3K09A 3AY7A 2XBUA 1KDOA 3OIWA 3L06A 3MRSA 2LBCA 3ZKWB 1RIIA 5EZYF 4BZWA 1XTQA 3A26A 2Q2TA 3GJ8A 1AA6A 2IPXA 2XUJA 2YFYA 4Z0NA 3RTCA 1L9KA 3CLUD 1GG5A 3O9VA 5T4HA 3OIUA 4R7TA 3EXIB 4UTZA 1GXSA 3T1HH 3ME5A 2DHRA 4EL0A 2D2FA 1LC3A 4R8VA 2GEFA 4CR8A 3IURA 4RIIA 4RTQA 1MX3A 4EI9A 1RAHA 1O0CA 4A15A 1JAIA 2VT7A 4X41A 3ZTYA 3FKJA 2R93A 5EQTA 4QIHA 3ZNPA 4B3RM 3B85A 1AKUA 2MINA 2QTGA 2UYQA 4DLBA 1YI8A 5JDCA 1A96A 2QE6A 4L8WB 2PBZA 3K8YA 2R84A 3KT3A 3TR0A 4LV6A 3O4VA 1K6JA 2ZUVA 1UADA 1O03A 4ZYUA 1DWQA 5G4LA 3DDWA 2GN8A 2W4QA 2IHJA 4CYMA 3BKWA 4OMUA 1FS5A 4LSAA 3WOVA 3RB6A 4QJ4A 4RO0A 4Z9XA 3KOWE 2QT1A 3W67A 1W88B 4PVDA 2UUBB 1DJNA 4LI3X 1WHTB 1Z6PA 2JHAA 3F2IA 4A7PA 3JRXA 1S9DA 2XDYA 3GEMA 1OWMA 1V11B 3N07A 2PV0A 3OOYA 4MI3A 3WBKA 1N2GA 2EDCA 3F47A 3ZV3A 2V7XA 3TIIA 5SICE 2OBYA 2P3SA 3GY0A 4HJRA 4LFCB 2WD9A 2JAWA 4RV9A 3QSYA 1FMLA 1ZGGA 5JSFA 4F2GA 1K1SA 2VRWA 3K0KA 3JQBC 4PPNA 4WZBA 4MB2A 4PCAA 3C5EA 4YAEA 3ZE0B 3GTPA 1SHZA 3W7VA 3QPWA 3WG9A 2B0CA 1VGVA 3DWEX 1SBCA 3PFFA 3N2KA 4KXYA 1MENA 5FH9A 3W77A 4G4NA 2GF0A 2ZANA 2WJJA 4IMRA 1Y5LA 4B3FX 3ZVRA 1YRHA 2E7ZA 1T3ZA 1UBOS 4BMPB 5ALVA 3R3UA 3AGPA 1NKVA 3UJCA 4ECWA 1U2EA 1EG2A 1KJ8A 3CEMA 1ZVQA 4LK2A 2E5FA 3TMKA 5KPRA 2GN6A 2QHXA 1C1YA 1N3LA 2MHCA 2RI6A 3QXGA 4HLUC 1VEJA 4ILKA 4QPCA 1A8PA 4V24A 1TC2A 3DXYA 3FFXA 3GC6A 5EDWA 1JT2A 1QIMA 2BMWA 2K5UA 4Y7CA 5C31A 4PX9A 2REBA 4ZU6X 4C6TB 4QRDA 5DRYA 4ED8A 1V33A 2H1LA 3P52A 3HY5A 2J3DA 5HYVA 4NMMA 4IKPA 3PW0A 1XU7A 1NVBA 1HZZA 2OAEA 2CMKA 2R62A 2W8BA 2LHCA 1SULA 1XRQA 1ZW6A 3PPYA 3EXAA 4MLDA 1QGDA 4BV8A 4NV3A 4OG2A 2O2IA 4JIMA 4IVRA 2H9YA 1GTZA 1IAVA 2YWEA 4UPDA