2R6FA

Crystal structure of bacillus stearothermophilus uvra
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
949
structure length
899
Chain Sequence
MDKIIVKGARAHNLKNIDVEIPRGKLVVLTGLSGSGKSSLAFDTIYAEGQRRYVESLSAYARQFLGQMEKPDVDAIEGLSPAISIDQKTTSRNPRSTVGTVTEIYDYLRLLFARIGRPICPTHGIEIQSQTIEQMVDRLLSYPERTKMQILAPIDVVVDRIIIKDGIAARLADSLETALKLADGKVVVDVIGEGELLFSEKHACPYCGFSIGELEPRLFSFNSPFGACPDCDGLGAKLEVDLDLVIPNDELTLKEHAIAPWEPYYPQLLEAVCRHYGIPMDVPVKDLPKEQLDKILYGSGGEPIYFRYTNDFGQVREQYIAFEGVIPNVERRYRETSSDYIREQMEKYMAEQPCPTCQGYRLKKESLAVLVGGKHIGEVTAMSVTEALAFFDGLELTEKEAQIARLILREIRDRLGFLQNVGLDYLTLSRSAGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLIATLKSMRDLGNTLIVVEHDEDTMLAADYLIDIGPGAGIHGGEVVAAGTPEEVMNDPNSLTGQYLSGKKFIPIPAERRRPDGRWLEVVGAREHNLKNVSVKIPLGTFVAVTGVSGSGKSTLVNEVLYKALAQKLHRAKAKPGEHRDIRGLEHLDKVIDIDQSPIGRTPRSNPATYTGVFDDIRDVFASTNEAKVRGYKKGRFSFNVKGGRCEACHGDGIIKIEMHFLPDVYVPCEVCHGKRYNRETLEVTYKGKNIAEVLDMTVEDALDFFASIPKIKRKLETLYDVGLGYMKLGQPATTLSGGEAQRVKLAAELHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTADYIIDLGPEGGDRGGQIVAVGTPEEVAEVKESHTGRYLKPILERDRARMQARYEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Bacillus stearothermophilus UvrA Provides Insight into ATP-Modulated Dimerization, UvrB Interaction, and DNA Binding.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Excinuclease ABC subunit A
total genus 231
structure length 899
sequence length 949
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17755 UvrA_DNA-bind UvrA DNA-binding domain
A PF17760 UvrA_inter UvrA interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.280 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 ABC transporter ATPase domain-like 2r6fA04
1.20.1580.10 Mainly Alpha Up-down Bundle ABC transporter ATPase like fold ABC transporter ATPase like domain 2r6fA06
1.20.1580.10 Mainly Alpha Up-down Bundle ABC transporter ATPase like fold ABC transporter ATPase like domain 2r6fA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r6fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6fA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6fA05
1G6HA 3QE0A 4LWZA 3ZIAD 3GP8A 5HTKA 1GKIA 1KOFA 2CDNA 3SC3A 5KKNB 5AJYA 3T1QA 1U8AA 4TL8A 2EVWX 4R2IA 5FUXA 4YMVA 2O52A 4QNMA 3P1JA 4PHFA 2J46A 4KAXA 4TYPA 1AQYA 1XJQA 3RRMA 3TUIC 2FDCA 5L3QA 3FHCB 1W36C 4Z1MD 3C15C 4IDOA 3RYTC 1GOTA 1K8RA 2D2FA 3B1VA 3T5GA 1B6RA 1FL9A 4HNVA 2PMKA 4Q19A 3T15A 1UADA 2EFHB 2WJGA 3IIKA 2R7NA 1X8JA 2OZEA 2Q3FA 4TSFD 5HCNA 1IHUA 4O4LF 4I4LA 1XBTA 2SCUB 4OI1A 5DHAA 4A8JB 2FMXA 3GFPA 1E2FA 4MKHA 1Z22A 4PFSA 4YQFA 4PZZA 1Y3AA 4PQRA 5BPFA 1E1QD 5FBWB 5IK2D 1E96A 5AUPB 1E32A 5BPHA 1DS6A 1QHIA 2QSZA 1NKTA 2ZRNA 1XTKA 2Q3HA 3SOPA 3Q2OA 2CHQA 4CVNA 4C0SA 3EPLA 1VG9B 2GJSA 2VHTA 2NOAA 5DNYB 3CLVA 4A4DA 3PR1A 3OESA 4WZ6A 1UPTA 3LRPA 3LW7A 2JDID 3QY0A 5EZ6B 3CO5A 4FXPA 3WNBA 3AVPA 2DCUA 3LP8A 1G8GA 1S1MA 2JEOA 3QKSA 4MRVA 5DYGA 3TRFA 3EZ7A 1Z28A 5K8TA 5D3QA 1N6KA 1QHYA 4U00A 3V4ZA 3GQBA 3IPYA 3T1VA 4DLUA 4A6XA 2PEYA 2GK6A 2WPDA 1TEXA 2GLTA 1EFUA 2ORWA 4RZ3A 5DE3A 4YB8B 1HT2E 1KI6B 3PQCA 5KNBA 3NXSA 1ZUNB 3MD0A 1TU3A 1Z3IX 5EE0A 4AG5A 1DO2A 2LKCA 2GAOA 2QU8A 2GILA 4TTQA 3FYHA 1JAIA 4MUAA 4Q01A 2CE7A 4D25A 3ZGXA 4TTRA 3S1AB 2IUUA 1GNQA 2FF7A 2DWPA 4B2PA 2DHRA 2FFQA 2IYQA 1M7BA 4KJZA 1HT1E 1E4YA 4AD8A 5IYZF 4TUYF 1I7LA 3FMOB 4HAYA 3B60A 1JALA 2SHKA 4WZBE 821PA 3IHWA 1JNYA 1WP9A 2OXRA 5EE1A 1QZXA 4NCNA 1ETUA 5D3MA 2VF8A 3A58B 3AKEA 5A4JA 2GJKA 1E2GA 1UEJA 4C3ZA 1W2HA 4IFBA 3JVVA 3PUYA 4TLBA 1FTNA 3KJEA 3ECCA 5G3ZA 1VIAA 5G53C 3A1VA 4MRRA 4XTCS 1GITA 4A36A 1TF2A 1N0VC 3CUEF 4CGZA 2QM8A 1ANKA 4OHVA 4M1OA 1NMXA 4Q4AB 3IEVA 4TYYA 3TSOA 1OW3B 5GVRA 1QF9A 2EU8A 1TQ2A 2WWHA 2WPDD 1E9AA 4IOLA 2JLRA 1VYVA 5CB8A 3NH6A 2JJ2D 2ZRJA 4QL3A 2J0QA 2NO1A 4KHZA 1G21E 4P4UA 4LSGA 4IEEA 4YDSA 5SZJA 1E4EB 1X1SA 3ZZTA 1ZJ6A 2AFIE 1LNZA 1U9IC 5GJVC 4OQMA 1A9XA 1HUQA 3QNUA 3THYA 2PX3A 2CJWA 3EZFA 2ZU6A 4JLOA 1JI0A 4V02A 1KK0A 4KI0A 4N0EA 2OAQ1 1TUIA 1ZYUA 3KFXA 1EUCB 3U9TA 1YZKA 2W00A 4IRUB 1OKKD 1KI3A 3K1JA 2V9PA 3AVXA 4Q1CA 4NPHA 3Q1KA 3DHWC 4BLPA 3X1ZA 4ZI7F 2QTHA 2V5AA 2PBZA 2ZRAA 3RS0A 1VBGA 2ZE7A 5CDFE 1QDEA 4G0NA 5CJ2A 1PUJA 4GI7A 3MLEA 3VR5A 4BRWA 1P5ZB 2O8BB 3OZXA 2P67A 2O8BA 4O4HF 1IONA 5FH9A 2I4IA 4MDEA 3Q5EA 1W0JA 2OXCA 3CX6A 1KDPA 1WQ1R 2AD5A 3VMMA 2VLIA 5E7JA 1Z08A 2ORIA 5B2ZA 2QAGC 1AM4D 4ASUA 5HZHA 5BN4A 2YS7A 3VPCA 5K8LA 2BEJA 3RRNA 1COWD 2EQBA 4X8OA 5FBRB 1U8YA 1NG9A 2E87A 3ZJYA 1JAHA 1NL3A 3SFZA 1EUDB 2YNMA 2FPGB 5CK4A 2IYYA 2CJWB 1F5NA 3IBYA 3ZVLA 3THYB 3NIBA 1SVLA 3TQCA 1E4EA 4FMCF 2ZEJA 4PC6A 3VR1A 5C1PA 2Z4SA 1W36B 1ONBA 2IF0A 3MRSA 2IWHA 5DN6D 5DISB 1GDDA 3LA6A 4KLNA 1T0JB 3AUXA 4D2IA 4HQ6A 4HUTA 1U0HC 2NO9A 3AKYA 1R6BX 1KC7A 3ZLJA 4Q4AA 1Z2AA 3QPVA 4MITA 5JJLA 1W4CA 3BK7A 3R20A 3B1XA 3VFDA 4IVRA 3K09C 2W2TA 1Q3TA 4D4MA 2P65A 2KBFA 1Z83A 4N3NA 4YDHB 3AB3A 1W36D 2VP2A 3QG1A 2JLQA 3HWSA 2W58A 3GJ5A 3MJRA 1GSOA 1KSHA 5D3MB 1H8ED 4PPFA 1Q22A 1NSTA 2J1LA 4HB2A 2ZDGA 1DBSA 4HEJA 4TMKA 1CLUA 1UKVY 3I73A 4DWJA 4OHYA 4MA4A 2OG2A 1XD8A 4TQ9A 1F6BA 2CLCX 3CR8A 3RSLA 2IF2A 2FFBA 3NEYA 4JLMA 4RCZA 2WJYA 1U94A 1T8TA 2WOOA 3L8YA 1XPOA 3MSXA 3U3JA 1QHXA 3L43A 5E7IA 1T0HB 1S0UA 2B7BA 2EYQA 3NBYC 3RNLA 3S1AA 1S9HA 2OM2A 3K53A 4JT2A 2AK2A 4PHGA 1SVOA 4I4TF 3SNHA 4Q9JA 4LJ4A 2G6BA 2ZJAA 4LUCA 3PCRB 4CIDA 4GMDA 2CHGA 3TR0A 5H80A 1KI6A 4R98A 3X1XA 3AVUA 2FOLA 2X0SA 3CW2A 3WMFA 1VBHA 4YMWA 1EWQA 1C1YA 3L0PA 4KSCA 4PO8A 1II9A 3LW8A 3CX7A 3OIWA 4C0LA 5TDHA 1IJEA 2X2EA 2ZI9A 1E2DA 2ONJA 2H16A 3RS4A 3DKVA 3MWDA 3FFBA 2QK4A 1S1CA 2I87A 3QKSB 2ZPTX 1KDTA 3RRYA 1CJTC 2XSZA 1N0WA 1P61B 1DAEA 2WVJA 3B1WA 5KSZA 4IXMA 1W5SA 1EFRD 4N1AA 4XJXA 3OAAA 5G41A 2G3YA 2W0SA 2QZ4A 2AFHE 1OKKA 4RD6A 3EZ9A 5DN6A 2P6RA 3M0EA 4D26A 3EIQA 3C8UA 3BOSA 4NTZA 4HLDA 3JVUA 1N5LA 2P5TB 1EHIA 3RDPA 4A0HA 2DWQA 4MH0R 3PENA 3TINA 2RHDA 4CRWB 3CWZA 2ZI4A 121PA 3JZAA 2D62A 2QM7A 3SN6A 4A8JA 5EE5B 5B58C 2D7DA 1E0JA 4AKEA 2R6FA 1W46A 2KJQA 2JLXA 5BN3A 5JFGA 4KSBA 3LO5A 3IO5A 3RSOA 2Q9CA 3LBIA 4AWXA 4M9UA 2CL7X 5L3QB 2VPPA 4IDHA 2F55A 3BERA 1E1RD 2AXPA 2W6ZA 5UKDA 5EQTA 3A1TA 1OHHD 5IK2A 4A9AA 4BFZA 5LOVF 2PLFA 4JSTA 2LWIA 4NCHA 2XZPA 2QG6A 3SQWA 4XVQA 4EPXA 4LV8B 2V3CC 2IYZA 3BWDD 3FKQA 4LDJA 4WW0A 1ULZA 1GFIA 1HA3A 1X8KA 1DG3A 2OFOA 3T5DA 4BZPA 2O8CB 4JKYA 5FTNA 2GBLC 2C9YA 5FFMA 4BLRA 2PZFA 2VEDA 5J40A 2JATA 2OCPA 2C96A 4DCVA 4JJKA 5FOVA 4LJAA 1P72A 2QSYA 3KUDA 3VPDA 3K0FB 4RSGA 4BFUA 3QXXA 1TQDA 5F98A 1R8QA 5JQWA 4JLBA 2QQ0A 1XJCA 4DZZA 5FOXA 3K0CA 521PA 1P7CA 1WA5A 1N2CE 4IOJA 4Z51A 3Q3JB 3ZZ0A 1VHTA 2GCPA 3FTQA 4LPSA 1R4AA 4O0MA 3THWA 4AYTA 3QI2A 1Q1EA 3WYFA 4PQFA 3X1WA 3KQKA 5L3RA 4O4IF 1H8EA 1S96A 2ZJBA 2HEIA 4L8GA 1KJ9A 4MRSA 4QHTA 4MUBA 4RZ2A 1P73A 2YINC 4G5OA 1GKYA 3GPLA 4CEJA 3VQTA 1J7KA 1GSAA 4C5AA 2N1BA 4YAKB 1J8YF 4QHYA 3TAUA 3QBVA 2ZRKA 4NYMR 4D6PA 3VKHA 1Z47A 4C7OA 3W6OA 1ZUHA 2XB4A 3AVYA 1GNPA 1ZP6A 5EE3A 1KSGA 5KOYA 2GXQA 1E99A 3A4NA 4JSYA 4QGGA 3LX5A 5J4HA 4DHEA 2G1JA 4Q03A 1ZD8A 4B32A 3GLGA 3MUFA 5JJKA 1H65A 4YJ3F 1MO5A 2EWVA 4L9WA 4EKDA 1RJ9A 3CPEA 3W5IA 4DB4A 3EASA 4UXJA 5HCIA 3N2IA 1XEWX 1KYIA 1K5GA 2NO6A 4NHOA 2WWGA 2A5JA 4MGZR 4RD4A 5LB2A 3ZZUA 5EXTA 1B23P 3QXSA 4PR0A 2BMJA 1E79A 4CYMA 4XVRA 4B3DA 4DLRA 2IHBA 1KI8A 2PX0A 3FWYA 1Z6XA 2B8TA 1KZ7B 4JVMA 1XXHA 1XPUA 2VQDA 4IHJF 1WCV1 5DYIA 3VAAA 4TZ6A 4I1VA 1NSFA 2BVNA 4DBLC 1L2TA 4GOKA 2OLJA 4DKXA 4P32A 3GLHB 1LW7A 1TMKA 3SR0A 2BBWA 3VR3A 3IIMA 3BH7A 2IUSA 4X8MA 1R2QA 2QROA 2KBEA 1G7RA 4EJSC 4BASA 1G17A 2GEDA 4DXAA 4EQ6A 3U4QA 3BJIC 5JRJA 1P9RA 2OFWA 3E5NA 3C14C 2BBSA 1WBBA 5LB4A 2A5GA 5M04A 4B34A 2W0MA 1GSHA 4X8LA 2OILA 1OV4A 4MV8A 1E9FA 4TWZA 2K5UA 1VG8A 1L4YA 1S4QA 3H4MA 3I62A 2FSHA 2D06A 3TVTA 1XXHE 5CA1F 5JJIA 4YMSA 3UMSA 3BIFA 1F2UA 1DTSA 4Q1DA 2J7KA 1PV4A 4FI3C 4H1UA 1T3SA 2VHJA 2XEXA 2PN1A 1ZM4A 1W4AA 2F43B 3ETLA 4JLVA 1GWNA 3UFXB 3U6KA 1NN3A 3OUZA 3AF0A 4HNTA 4ZCLA 3VX3A 4DLTA 5C46F 5F3WB 5HV6A 4C0HA 4A2QA 3B8HA 3KZ1E 4NCKA 2YYZA 1KJ8A 4ESHA 2RGCA 4NYJR 3TMKA 1BMFA 4DLXA 3NDBB 1ZIOA 1Z07A 5AJVB 4XX0B 3RC8A 4TN1A 3B2EA 3OFNA 3LVQE 1MO3A 2QN6A 5EP1A 1K5DA 2YWEA 5KTYA 1T5LA 2XITA 4LBWA 2FFAA 4UXIA 3PXGA 1X8LA 5D8DA 4RZXA 2ZAMA 4AKHA 1WB9A 2IEYA 1EGAA 1NRJB 1QHNA 1IOVA 5AR1A 4OI0A 2NMVA 1COWA 1JXMA 3NC1C 1ZNYA 1KBLA 4C0KA 3FHTA 3V4SA 1XD2A 4EAQA 1G3QA 5H1YA 3AGPA 1OT3A 4R2HA 1MKYA 1OYWA 1U98A 4NL4H 3RC3A 4FWTA 3BFVA 4CW7A 1NMYA 3W8RA 6Q21A 2XAUA 2ATVA 4PQYA 4B2IA 1XX6A 1QHGA 3U3OA 2P3SA 4QNRA 2O0KA 5KNCA 3UANA 1P2TA 4CEHB 2BWJA 2JAQA 1YVDA 2NQ2C 3H84A 4MKFA 3GCGA 2ZUCA 1E0KA 4XD7A 1QHHB 4NCJA 1UKYA 1R10A 3F8TA 5EP3A 1I7NA 1FNNA 2FPLA 3G82C 5GADl 3GLFE 1NN1A 1E2KA 2EFCB 2AWOA 2VIIA 2H18A 2LCFA 2KI5A 2ZSBA 3WP1B 3AV0B 1G7TA 1Q1BA 2REBA 4PSVA 3SQXA 3AGQA 2ZRBA 1NVVR 1TNDA 5G40A 4Q5IA 1W1WA 2ZANA 2ECKA 4O2BF 4PHTA 4EPTA 3N5CA 2AKAB 4JT4A 1A2BA 1YZQA 2VTKA 4MGYR 2VYFA 4FINA 2Q3MA 3IKJA 1KGDA 1KY2A 3I8XA 2C95A 2OV2A 2FE4A 4POAA 1RPZA 4NYJQ 5AWFC 4DDTA 2G88A 1SXJE 4DSTA 1YU9A 2QEQA 3RUPA 3WO1A 4P33A 3WRXC 2EFGA 1OB5A 1O87A 3K70B 4URYR 1US8B 1FP6A 5J4YA 3CZQA 2FA9A 4B47A 3ZQ6A 2QTFA 2GEUA 3N70A 2GCNA 4I50F 5JH7F 2C77A 5KYKA 3FOZA 1ESMA 1PLLA 2ZSEA 4LYJA 2OT3B 2VPQA 4IOMA 2B92A 2IXEA 4L1KA 4LJ8A 3V4FA 2CK3D 3RAPR 4EPWA 2AK3A 3IQXA 1GIAA 1AKYA 2X19A 1KEEA 5EZYF 1KMHA 1MV5A 2OCAA 4LJ9A 3WYGA 2UKDA 2XTNA 1KO8A 4KXFB 1E9DA 1RE0A 1KHTA 4GBMA 3MWJA 1EXMA 2WKQA 3M4YA 5LBIA 3U7HB 2F1HA 1OXXK 4MV1A 1A2KC 1N6NA 1LS1A 2C5LA 2FZLA 5CB4F 2C2HA 2RKOA 3T12A 3K3PA 1VPLA 1QRAA 2PT5A 4DDUA 5JMTA 1A4RA 2HLDA 5KPJA 3DKPA 3MJFA 4FD2A 3KJGA 3FKSA 3AP3A 4YMUA 2JA1A 3ZVMA 3BB1A 1EX7A 3LQRA 4URWR 4V0KA 3DMDA 3F0TA 1N5JA 1NLZA 2X8AA 1KK3A 4WXPA 2P0AA 1OIVA 5C18A 1RIFA 4HDOB 4LK2A 3U7GA 2WIBA 2QP3A 3Q7PA 1BYUA 1G20E 4Y0AA 3EWSA 2YC2C 5J2TF 2IYTA 5KUTA 1JKJB 3U3RA 1IOZA 1CR0A 5KSPA 2IYSA 3FVQA 5FBVB 1XTIA 2DZDA 2IL1A 1GG2A 1QG2A 5CLQA 3GLHE 5CYOA 1OHHA 4ZDKA 5CDFA 1U99A 1P3JA 4WA7A 4L9SA 1KDRA 1CP2A 2BJWA 1OFUX 2QAGB 1OXSC 4URVR 3U7EB 4XWAA 1H8HD 3LAWA 2O8FA 4YC7A 4JBXA 4YAJB 3P20A 1OJLA 5DH9A 4BE7B 5L3SB 4DVGA 1G8HA 1EFTA 1F60A 4MGIR 3MWEA 4JIMA 1DIKA 2R7KA 4A82A 3SS8A 4NYIQ 3K70D 1GLVA 4OL0A 1KO4A 1E9RA 1XU4A 4G1UC 4LJYA 2GJ9A 4OHWA 2FSGA 1Z6AA 3OE7D 1G3RA 1S8FA 4E4TA 4URZR 4MA5A 4BEBA 3T1TA 4ZQIA 2HF8A 2IWRA 4AIIA 3X1YA 1XEXB 1WBDA 1IM2A 2JLWA 2NG1A 3ZDQA 4PAOA 5BWMA 3TSWA 1U81A 3TUZC 1E69A 3VKWA 2ONKA 3L8ZA 2R87A 1VCNA 4DT1B 4BZQA 2GVDC 3TR5A 3FPAA 5CITA 4LRWA 3SDZA 5LXTF 1BYIA 4HUQB 3FHOA 4BFSA 1KY3A 2BEKA 4PAMA 1R8SA 4JS0A 4M0LA 3CIOA 4W9MC 4URXR 4OI4A 4R71A 2LKDA 1KAGA 1KKMA 5KX5F 4M22A 3ZIAA 1DO0A 4BWYA 4JVNA 4AG6A 5ANRB 2CXXA 1Z0KA 4LBYA 3W34A 2V4ZA 4Q1AA 1D2MA 5KPDA 4LGMA 2FG5A 1Q57A 2FGKA 3JRXA 2XZLA 1Z29A 4DB2A 2KWIA 3HU2A 4A2PA 4EPYA 2P2LA 1YR8A 1DAMA 5DLQC 1ZCAA 1P9WA 2ZSAA 4CT4B 2QY9A 2OBLA 4JYBA 5LYJF 2ODEA 4AYXA 1E79D 5GJBA 4V0MA 3I61A 1RRGA 4XOIA 4RJLA 2AL7A 1TPZA 4MV3A 3EAQA 4Q7LA 2IBMA 4V0LA 4ZIRA 3K0AB 4XVUA 4NH0A 1DAHA 1RKBA 5FOTA 4TQAA 4ZDIA 1CF4A 3A1WA 3THXA 1GSIA 2RGXA 4B3BA 1PJRA 1ZRHA 3QKTA 1E2IA 1UBFA 1XCMA 1L8QA 1W4BA 4I55F 3GJ6A 5TARA 5EUQB 2IHYA 2ZI3A 4Q02A 2Q9AA 1WMSA 3OIYA 4OQXA 4LC0A 1F2TA 2PCJA 3OIVA 4GMXA 4JBYA 4OQLA 2QENA 4KFRA 3RWOA 2HYIC 3BS4A 4IWYA 1NIJA 1GL7A 3OF5A 5KSYA 1AIPA 4PPQA 4V0ME 3G0HA 4PC2A 4ABYA 4PANA 1CRPA 1K6MA 1E2QA 1G3IA 1CULC 4V03A 2GAAA 5TMPA 3HR7A 2J9GA 1OSNA 1F48A 1ZD9A 4LYHA 3RS2A 4KODA 1EG7A 1KK2A 3EXAA 4IHQA 2WJIA 3EA0A 2J0UA 3KJIA 4DSNA 5JCPA 1J99A 3VHXA 1CQJB 3FMPB 2IK8A 3Q9LA 1KIMA 5CJPA 3MWKA 2VSOA 3VMFA 1W5TA 4I1UA 5EJEA 4LYFA 4O25A 5B64A 2A5FA 2A9KA 2VP4A 4JBWA 1N6IA 2FZ4A 4HLQB 5FR2A 4B74A 2FPPB 2J3EA 1UJ2A 1G4UR 1S9DA 5AJZA 1OH7A 1NBMD 2R2AA 2I3BA 2P6NA 4MRPA 3X1DA 1ESNA 3BFKA 2EW1A 4Q4HB 3GEHA 2ZRFA 4Q4JA 3QVUA 3ZS8A 2ZJOA 4M8NE 2Q0HA 5DGXA 3U2QA 3C41J 2JJ1A 3MAAC 4QC2A 2NO0A 2R8RA 1VIYA 2V55B 3MJHA 1JXOA 1F3OA 4TQUS 1YR7A 3BBPA 4LJ7A 2O8EA 2CCGA 2ZRCA 3KB1A 5BN5A 1W2GA 4P3YA 2MMGA 3VU9B 1NVXQ 4PO9A 1N5KA 4NBSA 3VKGA 1L7VC 2A5DA 1W49A 3W90A 5LD2B 4GZMA 3CRVA 4P4SA 1T5IA 1ZNWA 4ZDJA 1M7HA 1MABA 2HYDA 5JHGB 2GZHA 2RGEA 4ZHQF 2OO7A 3U44B 5DSZA 3TGPA 3O8CA 4C9BA 1CRQA 1MRNA 1GAJA 3EX7C 4UXHA 1XRJA 1T4GA 2FSFA 4YJ2F 5JSZA 3TE6A 1G6OA 2R6CA 3TW8B 5A0FA 2B8WA 3K9GA 3WY9A 3GD7A 2AXNA 4KLZA 5JZVA 1YZNA 2IP4A 2RHMA 4EDHA 2ZJ5A 2QORA 2R6GA 5JLJA 2QBYA 2IS4A 3A37A 3CM0A 2YOHA 2QPTA 4JLKA 1U0JA 1CQIB 1OPXA 2AD1A 2EFDB 2FEOA 1KNQA 4BFTA 3REGA 4MKIA 2ATXA 5EXPA 3AVQA 1E4VA 1I4TD 2PBRA 1C9KA 1E2LA 2C99A 3ADBA 1TAGA 2CMKA 2GBLA 5FL3A 4E09A 2QQEA 2WMNB 4L5BA 2R6DA 2B6HA 2PH1A 3TIGA 1XCPA 5FTKA 2G1KA 1FX0B 4ZOLF 5GJWC 1G7SA 2C98A 2H8KA 1T36A 3GFTA 4B76A 4A15A 3GLFA 4HI0E 4XWKA 2D4HA 1DG1G 3SU8A 1SCUB 1ZU5A 3LXXA 1QVAA 3KDSE 2VP6A 2ZYTX 5CB6A 1AS3A 3J81k 4FU0A 1Z0DA 4FCVA 1UAAA 4ZV4A 2D7CA 1CS0A 5GONF 1NJGA 3GJXC 4Q66C 2RGNA 4TYNA 3AM1A 1KO1A 2XGJA 1I2DA 4F7WA 2AKYA 4MYHA 2JLZA 2ZSDA 2ERYA 2IUTA 4E03A 4I99A 3B85A 5EXSA 3CRMA 2CVHA 5CLLA 4UJ3A 4ILEA 3W6PA 3DOEA 3BH6A 2VSFA 3GJ3A 1EFHA 3ZD7A 3U9SA 2ZRMA 3GMTA 1R5OA 1FP7A 1AGPA 2I1VB 4BLOA 1D6JA 3BGWA 5K8UA 1P6XA 2XZOA 4D80A 3OE7A 5HE9A 4MGKR 4NCIA 3ZS9A 2BKEA 1WXQA 2QT1A 2BDTA 4EJSB 2YRWA 3QFFA 3L0SA 2GA8A 4RKEA 1TF5A 3NHAA 5TXGA 1NN5A 3NC0C 4GDFA 2CQYA 3DDCA 2QNRA 2E9SA 4KYIB 4MRNA 4EFMA 3GLIE 5AUOB 1RVDA 4G5QA 4LHVA 1R0XA 4PSAA 2WHXA 1ZU4A 2ZR7A 3BB3A 2F9MA 4M9ZA 4QBGB 1XB2A 2XSZD 3H86A 4HZUA 4KU4A 2HDNB 4MYCA 1ZC3A 3W8NA 4A8JC 2IYUA 2A5YB 3ADKA 3FB4A 4U7DA 2R86A 1UDWA 4LOAA 3REFA 2IYXA 3WHKA 4JLAA 3CWQA 3QKRA 3NBZC 5J4VA 4XZ3B 1TL7C 1CJKC 1YR6A 2A2ZA 5FI1B 4G5RA 2OCYC 2W6NA 3CPHA 1GZSA 4B71A 2W71A 5AJWA 1UFQA 1JR3E 3TH5A 3I1FA 2BM0A 5HZKA 1OIXA 1N6PA 4B3XA 2KB0A 2C78A 2G9NA 2GZDA 1SGWA 4OQFA 5KHOC 5JECA 4QM6A 4I1OA 1Q21A 4UJ5A 2J7PA 3A6PC 4G5GA 3RLFA 2F6RA 4AURA 3C5HA 4DUGA 4KO8A 2HF9A 4NZYA 4RCYA 3FE2A 1T91A 3OAAD 3DZ8A 2ZR9A 1KI9A 2BMDA 3CR7A 1MO4A 1ZNZA 4NP6A 1YRAA 2KE5A 2L0XA 4ON9A 2W6JA 4WOPA 3TSZA 5HKKA 1FOEB 4ZO4A 1II8A 4LZZA 1KDOA 3CZPA 2HJVA 2MSDB 3B9PA 4E22A 1RC8A 3MMPA 3SJZA 4B3CA 2AR7A 2YZNA 2WAXA 3NBXX 1D8TA 3P32A 4HR7A 4KV9A 3BG5A 1XJ0A 1JDBB 3QF4A 5FTJA 3UG6A 1Z0AA 3LDAA 3TKLA 2JCSA 3OHMA 3GEIA 2BV3A 5JWHA 4L15A 3PVSA 3THOA 4C4PA 5DI3A 1DEKA 1Q1QA 1GM5A 2J5XA 2VRWA 5BMVF 4BPBA 3ZD6A 2ZITA 4TLDA 5BQ5A 2HJGA 2Q9BA 1ZM2A 3E70C 1NBME 1KMQA 3A4MA 3ETHA 1EFCA 1YQTA 4NMMA 3KUCA 2ZS9A 1C3OA 4ZPXA 1DVRA 1W0JD 1LB1B 3QKUA 4KVGA 3F3YA 2G0NA 4M1MA 5JEEA 4XH9B 3PJRA 3RWMB 4QBFA 3TIFA 4QJ3A 4PC1A 4GFDA 2YL2A 3QPUA 4DSOA 2CLDX 3RS5A 2EFEB 4BLTA 1XNJA 2ZM5A 4XTRA 2DWOA 2GKSA 4TTPA 1SXJA 4QXAA 5CK5A 4B3GA 2XD4A 2ZYWX 3BH0A 4B3FX 1C30A 2GJ8A 3NHBA 3VX4A 2GVZC 1J90A 4WZAE 1PLJA 3O47A 1JR6A 4ARZA 1XEWY 1XWIA 5KNDA 4MDFA 1G64A 5FPTA 2O8DA 4V0OA 1R0YA 5HPYB 4M1WA 1FNMA 2W6OA 4K46A 4PHHA 3BORA 1KTVA 3CRQA 3Q8XB 2FEMA 3K70C 3TIIA 4Q4LA 5CIQA 3SYKA 3T35A 2XXAA 4HATA 2F1RA 3FFAA 1Y63A 2ZXUA 1XPRA 1IAQA 4YMTA 4PTLA 4LV6A 2G0TA 3L0IB 4L4UA 1RYHA 2HUPA 1T6NA 2GCOA 2DLNA 2XNSA 3NEJA 3ZVNA 3ZQJA 3SYNA 1CBUA 3ND9A 3EPJA 1JQLB 2OBNA 5K2MA 4A1FA 4CDGA 2WKPA 3DPUA 1KI1A 3CF2A 2W70A 5FUWA 5BYKA 2GF9A 2GHIA 5FOWA 3FGNA 1DAIA 2WWYA 5JVDF 4B75A 2FN4A 3KFVA 4RFSB 5DIFA 4AYWA 3GLIB 3EW9A 1RZ3A 1UBEA 4QRHA 3QJYA 2DFTA 3AKDA 1IN5A 4TLAA 3IO3A 3KL4A 2NPFA 1G3MA 3QF7A 4M1KA 4RY2A 621PA 3SJAA 3JZIA 3K0EA 1X3SA 2BHRA 2F3RA 2WMOB 4RD2A 3CRRA 4EGJA 2ZJYA 4M53A 1E9EA 1R5BA 2ZJ8A 1YJ5A 4QOSA 1KJIA 2QMOA 3Q85A 5L3VA 3CH4B 1DV2A 3GJ0A 4QHSA 1MO6A 5EP4A 5F2EA 1OH5A 1CU1A 4KBGA 4YLGA 3RS3A 3SEAA 1BXRA 5BW8A 1SVMA 3CNLA 4AKGA 1J8MF 3RV4A 1N6LA 1NJFA 1ZM9A 1AJEA 2OAP1 4CF7A 4NYIR 2F1JA 4NU0A 2QI9C 3TNFA 4CEIB 1GVNB 3VHLB 1R0WA 2IW3A 4Q7JB 2FP4B 721PA 2WWFA 4P31A 2V7QA 5GJCA 2QMUA 4KFTA 4A92A 4QGAA 5J47A 3KTAA 3PEUA 4TL7A 1JJVA 2H57A 2JIZA 4UNQA 3O8DA 4GP7A 1E2HA 2WOJA 3R7WA 3I5XA 1MH1A 3W9YA 1AZTA 2PJZA 2A30A 4US2R 1HQCA 2GRJA 1OH8A 1BMFD 4TSFA 1Z6GA 1TEVA 3Q7QA 3E1SA 2H17A 1CR2A 1AZSC 1S3GA 2PEZA 4II7A 3CPJB 1VDZA 3WBKA 4RZUA 4S2EA 2VHCA 1E3MA 3R7WB 2V58A 3FDIA 3UKDA 4C5CA 1HURA 2QA5A 1OB2A 5CA0F 4PO1A 3KTAB 5JI3E 2ZRLA 1VCMA 2VP9A 2X77A 3CRW1 3B1YA 3QPWA 2DYKA 4PPGA 3V4RA 2GXAA 4HLCA 1ZD1A 2Z6VA 4G5SA 3T06B 2YS6A 2CBZA 2CVFA 4CEIA 3QXCA 1FUKA 2QP4A 4TYQA 1DAKA 2YOFA 1W48A 2FX3A 1AA9A 1VMAA 4C0QC 1DOAA 2IYRA 1SKYB 5TY0A 1ZNXA 2VR1A 2FWRA 2VHUA 2J59A 4BEJA 3GJ7A 2CCJA 4OHZA 4OHXA 1JLLB 1GRRA 2QL6A 2W6IA 2R9VA 4D4KA 4GOXA 1KJYA 4WD3A 4WAUA 4DEXA 1RFLA 5C1BA 1VKJA 4XYLB 3DO6A 4K8OA 4OQNA 4FCTA 5IHPA 1LVGA 2HT6A 4GPTA 4LYAA 2PT7A 2C8VA 4KCGA 2VBCA 2W2VA 3TBKA 1SKQA 1EFRA 1YZUA 3ETJA 4TLEA 2DWCA 1CR1A 4LHXA 4HZIA 3CKLA 2Z0MA 3VPBA 3SFVA 1W93A 5AJXA 4LHYA 2ZRGA 4RFSA 3GLIA 4JKIA 5JHHB 2GJAA 2P6UA 2XOKD 1I4DD 5SZIA 3WXMA 1DPFA 3QIAA 4WXRA 2HT1A 5FR1A 4KFUA 3K0CC 1B6SA 5FUVA 3LLMA 1UC8A 4DLVA 5F9HA 2GWHA 2QP9X 5B30A 1XTJA 1HE8B 1A82A 1SVWA 3MGCA 3P4XA 2QE7D 5DI9A 4DUGD 4KVAA 1HQYE 3OEHD 4JLPA 4TMWA 1SVSA 2GCOB 3QENA 1FQJA 4XSGA 3G5UA 2CL6X 4K81B 4LHWA 4ESVA 4D4LA 2NU9B 2ZDHA 2WV9A 2XXAB 3Q72A 2J0SA 4TT3A 2FSIA 3K9LA 5EUMA 2XTMA 4E07A 2GETA 1T3LA 4DDVA 1IXSB 4G01B 5BYJA 4HB4A 2O8DB 1KO5A 5P21A 4BFWA 1NVUQ 3KB2A 3U7FB 2W6QA 1FMLA 4ARZB 4M1SA 1ODFA 4DLZA 3PEVA 2VF7A 1IN7A 2DFKB 2YV5A 3AP1A 1P60A 1N6OA 3AF3A 3HPQA 4XSHA 3RVBA 1KK1A 2XJ4A 3A4LA 4Q48A 1MT0A 2EWWA 1KI7A 1SXJB 3R9IA 3TJZA 2W6MA 3O8BA 3PEYA 4JYCA 2HJWA 1GRNA 1Z0IA 1W0KA 4O2AF 4HAXA 1XZPA 4QGHA 1GL6A 1MRSA 5C2JB 1E9CA 2I8CA 2CL0X 1Z0JA 5L8VA 2CK3A 3L0OA 4PAQA 4US1R 5B57C 1LTQA 1AK2A 2ORVA 5TB5A 4JJZA 3UATA 2GK7A 4D0LB 3TAHA 1EX6A 2ZRPA 1AKEA 1CJMA 2H1LA 2NU8B 3OEHA 3RANA 5DI3B 1CXZA 1G16A 2R44A 2RGAA 3AF2A 5C8YF 2YOGA 4Q47A 1YZLA 3QF4B 1E0SA 1M74A 4JL8A 4Z54A 1TTTA 4KFSA 1G41A 4EUNA 3WHLA 2IXFA 5E7MA 2AWNA 4FWIB 1D5CA 2BOVA 2ZVPX 4B2LA 3RFCA 3QQ5A 3NG1A 1Z6YA 1II8B 1P4SA 1KJJA 5HKKD 3SJCA 3WO0A 3E2IA 4UQOA 4W7SA 3PUWA 1G7CA 3H2YA 2XOKA 5KSOA 3HU3A 4F4CA 5CIWA 3PITA 1T3HA 3I5YA 5EE9A 3BFXA 4D0GA 1VKZA 3AF1A 2FV8A 2IEZA 1AUVA 2PL3A 5H70A 4A2WA 3U6BA 1YR9A 2OE2A 2BKUA 3WP0A 4Z8YA 5KU1A 4O2LA 1G9XA 2IYLD 5JVLA 4TT3D 3EC1A 1P9NA 4IDPA 4TZ0A 4J0QA 4RD3A 2IX3A 4DRZA 4AKIA 1FQKA 3R5FA 8OHMA 3HDTA 1OFHA 2XTZA 1Z63A 4H1VA 4A6PA 2IC5A 5G3YA 3KKNA 3LQQA 1HYQA 4YXWD 4HYYA 1RYFA 2DFLA 3HJNA 2AN9A 2QMEA 2NU6B 4NE2A 1P75A 2WAYA 3CH5A 3I3SR 1CEEA 4A0RA 3QKRB 4WIAA 4TMTA 4X8HA 4JLJA 2IYVA 4US0R 2YZ2A 4Y0VA 3UWKA 3I72A 1I4LD 3K09A 3QG5A 1PLKA 2TMKA 2UZIR 5LD2C 2QMHA 4Q1FA 4HZUB 3P26A 3KQUA 3DOFA 3HB9A 1U0LA 1XDBA 1UBGA 4DDWA 3K5HA 1G1MA 1TU4A 2CE2X 2RAPA 2VP5A 4LX0A 1TF7A 1NMZA 4ZI3A 2J0VA 5JCZA 4D81A 3AVTA 2ZI7A 1XMJA 3NKVA 5FTMA 3K9HA 3QBTA 1KZGB 4FN5A 3LWNA 1FMJA 3C16C 2WWWA 1E2NA 2FU5C 4OI2A 4EJSA 1FW6A 1IN4A 2A78A 2IS2A 4Q7KA 2YHSA 2R65A 2ZJZA 3AVWA 1YE8A 1HE1C 4LBVA 4IFEA 5KDLA 2O0HA 3C4JA 4H9GA 3L2OB 1E2MA 1IXZA 4GRAA 2HV8A 5A5GA 1G5PA 1IBRA 2ASEA 1Z8FA 1HH4A 2QPAA 3D6TB 2C04A 2JLUA 2DR3A 4LCBA 4PPNA 1P2VA 2ZI5A 3A36A 3HU1A 3B78A 3QVVA 2Z5FA 4QFMA 4C0JA 3KQHA 1RRCA 2ZE5A 2AX4A 2ZTSA 3DM9B 2AHOA 4XIGS 4BQSA 3RV3A 1SKYE 1HEIA 3IILA 4TMVA 4EG0A 1T8UA 1B0UA 4M4SA 1JJ7A 4IVQA 4PSKA 4YXWA 5TVKA 4UNRA 1QVRA 4WVFA 2V8OA 4OBEA 4QKQA 1KO7A 3SYLA 3FMFA 4XD7D 4C0AC 3UK6A 4RD0A 2Q6TA 2PZGA 3DL0A 4UNPA 3KXLA 3SHWA 1OIWA 2RMKA 2IS6A 3GLFB 3DZDA 3ICQB 3C5CA 1JDEA 1XZQA 3R5XA 3KKOA 1UM8A 3KX2A 2C00A 2EYUA 2WICA 3AQ4A 1FX0A 5KO2A 1U90A 2RGNC 3TVDA 4G3XA 4IW3B 1JPNA 1G8FA 5IDVA 1VYUA 2GDJA 1XMIA 2JJ2A 1UC9A 2H7VA 3UMRA 2ZQ5A 4EPRA 1W96A 5CAEB 1JQJC 4UNNA 2CNWD 4F4IA 5JEDA 1GGOA 1IN6A 1DE0A 1NVVQ 2DBYA 2N42A 3SE7A 4Q00A 1Z2CA 1QG4A 3EC2A 2ZYUX 3ASZA 1N5IA 2QBYB 1IXRC 4GNKA 3UMFA 1WF3A 2Q21A 3NWJA 2RH5A 2ZJ2A 4C0BA 2Y8EA 3I32A 2J9RA 2A7QA 1VCOA 4M9QA 4BGDA 4MAMA 5F9FA 1AS0A 2WWXA 3AVVA 1E2EA 2GPSA 1XF9A 5LA6F 4IXNA 4JZKA 1PX2A 4E5UA 5FL7A 2WWIA 5JSZB 4Q1EA 3DM5A 1W4RA 5IT5A 2E1RA 2QT0A 2YVUA 1NVWQ 1Z6TA 3U44A 1OE0A 4CT5A 3FKSD 4HDQB 1W47A 2FB9A 3WNCA 1MABB 5K8IA 4BFVA 1P2UA 1E94E 5KDOA 1II0A 1N6RA 1PK8A 2RGBA 4OYHA 1XMSA 4P4SB 3ZH9B 3NBFA 4M9XA 2ZR0A 1N6HA 1XFAA 4QGFA 4UKDA 5FPHA 4B73A 1WRBA 2YRXA 4I81A 2V6IA 3VU9A 4B43A 2CLSA 2HCBA 2O8EB 2UVQA 3T34A 2JLYA 1W7AA 4HB0A 5J5CA 2I1QA 3RRZA 4W5HA 2CEAA 5IF9A 1G8PA 1BNCA 3AVOA 3B82A 3CX8A 5FOSA 4Q4JB 1VECA 2R85A 1CJUC 3WRYC 4F93B 2UZ3A 4Q4HA 1PUIA 2ZROA 1R0ZA 3VR6A 4MQBA 1N0UA 4FMBB 1N3BA 3BXZA 3VR4A 2JASA 3EG5A 2Z4RA 4M21A 4B48A 3GJ8A 1L4UA 4MYUA 1JPJA 1Z0FA 1CS4C 1OFTA 3UIEA 2NO7A 2VO1A 2R62A 1SHKA 2MSCB 3LXRA 1BH2A 3TLXA 2H5EA 5JWOA 1PVOA 3TQTA 2PCLA 2ODNA 3LBNA 1BS1A 4RFVA 1WR2A 4HSEA 1KJQA 5CYPA 4BLSA 4O2RA 2F3TA 1R5NA 3WMGA 5JWRA 1Q20A 2ZS8A 4JLNA 1FTSA 3LD9A 4B35A 4HAVA 2J0UB 3KKPA 4URUR 2OLSA 3IHLA 1NLYA 2GZAA 3W6NA 1UEIA 2WJJA 4RVCA 1E2PA 5BXQC 1SXJC 4JL6A 5AUQA 1M7GA 2C03A 5EP2A 1SZPA 3F5FA 4GT1A 3FMIA 1TUEA 2WZQA 1RRPA 3I8SA 4DIEA 1NY5A 4DLWA 1E9SA 1NF3A 5E95A 2J87A 4HLUC 2ZE8A 3BB4A 4OK3A 2XCLA 1F2TB 3ADCA 4Q21A 1DELA 3K5IA 3ORRA 1FPMA 2QUZA 1GNRA 1Q3HA 3D3QA 3D7MA 4MYTA 3KQLA 4BZXA 2FH5B 4UNSA 2R82A 1DV1A 4DEYA 1CKEA 3KXKA 4DJTA 1Z06A 3THXB 3IDQA 2B7CA 4LBZA 4NYMQ 4WBSA 2VH5R 3K0AA 4IOKA 4ZIRB 2ZU0C 1C4OA 1IY2A 1GL9B 2X2FA 1SHZA 2ZRHA 4YBZB 2CNWA 1KKLA 4OJQA 4BFYA 2GF0A 2QPOA 1M6VA 1FFHA 1T9HA 2WKRA 1YHNA 5H68A 3V00A 2PVPA 1NP6A 1AGRA 1E9BA 2C9OA 4IJMA 4B6FA 3EWAA 4M9SA 3WNZA 4KYUA 2YZGA 3U60B 5FPSA 4NONA 5I47A 2BBTA 1E1RA 1ZAKA 2HXYA 5EZ5A 1CR4A 3CF0A 1W0KD 2QRNA 3H1TA 3WYAA 2WSSD 5KDDA 4FW9A 4PZYA 3MWLA 4XYMB 3PG5A 3W3ZB 4ZKDA 4NKRA 3RHFA 1OXTA 3EZ2A 3IEUA 3B7GA 2J45A 1TQ4A 1ZIPA 5H8WA 1Q44A 3SZRA 3LLUA 4GOJA 2R84A 4PXAA 3I92A 4M1YA 4EIWA 4F92B 3AEZA 3RABA 3H0KA 3KXIA 4HAZA 1I2MA 3GFOA 3BD9A 3M6AA 4HUQA 2JLSA 1OF1A 2ZREA 1D9ZA 3R9WA 1UBCA 3OIUA 4DT1A 3HP1A 4ITRC 4QBIA 1O3YA 5FPKA 2ZUBA 3WNDA 1NG1A 2FNAA 2OSBA 2FJUA 421PA 4GSYA 1YRBA 4PZLA 1XEXA 2DY1A 4LPKA 2NTYC 4C30A 3WBJA 3DEFA 1WDTA 1A5TA 4EFLA 2ANCA 2QTVB 1JR3D 5IRCD 3LVRE 3O8RA 4BECA 4F4JA 2YZMA 1MOZA 2D3WA 3R23A 1X86B 3R8CA 1VG1A 4ZI2A 4DC9A 3KJHA 1HY3A 5FUYA 1LY1A 1Q0UA 3W5JA 2YC4C 1ZBDA 3M1IA 4MKGA 3RS7A 2ERXA 3AH8A 2VHQA 5ELXA 1P2SA 1YZTA 4DLSA 3EA5A 5L3SA 4F38A 1OXVA 1V5WA 2VQSA 5C4MA 2V59A 2Z43A 3CNNA 4HB3A 2O8FB 2NZJA 3U3MA 3EPKA 4OK6A 4DIDA 2GESA 2QAGA 4Q9LA 2JIZD 3NH9A 4C2TA 4QJ4A 2W6ID 5CM9C 4IWXA 1U9IA 3TUJC 1E2JA 221PA 5EXXA 1D9XA 1NNEA 4KBFA 1BIFA 2JGNA 2ZIAA 1D2EA 2C9CA 4C5BA 3U61B 2V54A 4YONB 1D2NA 4P0TA 1KSFX 2QRZA 4PC3A 3ZYCA 1U8ZA 1W44A 3D8BA 3ZVRA 5HR5A 4RD1A 3B9QA 3KKMA 5HBRB 3AKCA 2B21A 3EARA 4IKEA 1XD9A 1IY1A 3QXHA 2GNOA 3TW4A 1ZM7A 1E0AA 2NIPA 4GP6A 2KSQA 3CF6R 2YWHA 4A0FA 5AK0A 4W5WA 3TK1A 4EPVA 1GTVA 3GEEA 1A1VA 3JRWA 4WBNF 1NY6A 1QBKC 4V0NA 5DO9A 1CE8A 4S35A 4R7ZA 3ICEA 4EFNA 1JR3A 4LHZA 2QGNA 3GLKA 5JRZA 4PC7A 1JECA 3TQFA 2HLDD 4OJKA 3IBGA 1IOWA 1EK0A 1G5RA 2BMFA 2H92A 2VL7A 4DCUA 2V1UA 3SBEA 1M2OB 4TV9F 5FTLA 4B33A 1BKDR 1JB1A 2NGRA 2OLKA 5FL7D 1JBKA 2QGZA 5FPYA 1KAOA 2BC9A 4AC9A 2JJ1D 1X1RA 4QJ5A 1XTQA 2ODWA 1VCIA 5FBLB 2FPKA 4Q18A 3QEOA 3GJ4A 4Q1BA 2REOA 3R9XA 2ZUDA 1G4AE 1CIPA 2FPIB 2BMEA 3K8YA 4M1TA 1HTWA 1KMHB 5C4GB 1PZNA 3NTUA 1AQUA 1WE2A 2IA5A 2BBOA 4IVPA 3A8TA 1ZINA 4TL9A 1H8HA 4XWOA 5J4LA 3UPUA 4IDNA 4LI0A 5GVSA 4JL5A 4LY6A 4MA0A 1DAGA 5LPNA 3AUYA 4IEIA 1A7JA 2YJTD 2ZS7A 1GP2A 1UF9A 4HLUA 1NKSA 4Z8XA 5LDDC 4JVLA 3P27A 2JDIA 4D4JA 5JBQA 2BIFA 1US8A 2IYWA 3MFYA 3Q5DA 1FZQA 1YZGA 2GXUA 4BUJA 4Z1MA 1M6NA 2G77B 5JS8A 1GUAA 4AI6A 3KQNA 4LJ5A 2NUAB 3T1OA 4PX9A 3ORQA 2HCJB 3PUZA 1KJZA 2FPMA 5E3HA 3PUXA 5FOUA 3HYTA 4JMPA 2BJVA 4OKSA 1UKEA 3VTKA 2XNDD 3QEJA 1S2MA 2YW2A 2R7LA 4D82A 4D0NA 2GPWA 4ME6A 3ND8A 2REXB 2IT1A 3EZ6A 1OXUA 2OEPA 2WTUA 1ZCBA 3HPRA 3IGFA 3SBDA 2WBLC 1CJVC 4ACAA 4F91B 3A1SA 1KI4A 4HDCA 1TX4B 3JZMA 3U3KA 2ZI6A 3OEEA 2OHFA 4TMZA 2G83A 3HR8A 1OLOA 1E98A 3K9NA 1QHHA 3X2SA 1ELOA 5C1OA 1ZUIA 2CHVA 3VNVA 4CEHA 5JI2E 4IZOA 3I12A 1IJFA 1TQ6A 3EIEA 1EYZA 3OFND 4FIDA 1AUXA 4ZDWA 3CB4A 5JS7A 2ZRIA 3LV8A 1IN8A 1GRQA 5E4FA 1XD2B 3CNOA 3U5ZB 1KSJA 1JEDA 1G291 2WJHA 1KI2A 1N25A 3QOFA 3MG9A 3PUVA 3R8FA 2JLVA 1Z5ZA 2R6AA 1NN0A 2OBMA 2I80A 2IXGA 2YWGA 1EZ1A 2V1XA 2W2XA 5TV2A 2P5SA 1Q12A 2DB3A 1RRFA 2F9LA 4FMDB 4DLYA 1DARA 3LY5A 4U02A 3VNUA 4DSUA 2Z83A 4QM7A 1LF5A 3ONWA 3D31A 1NLFA 3PFIA 3EPHA 1AN0A 1LF0A 2WJVA 2O0JA 1G19A 4ZKEA 5CM8B 3B5JA 3LX8A 2X1VA 2RCNA 3C7KA 1YKSA 3E5HA 2ANBA 1TADA 3SHFA 4Q9IA 3B1ZA 1KJWA 1XMVA 3EIHA 2XB2A 2A3RA 3N2EA 2DPXA 1ZC4A 2V6JA 2RGGA 4ASUD 3LFUA 5FI0B 2V7QD 1IQPA 1M34E 3AF4A 5AUNB 2ZRDA 1HV8A 1OH6A 1P62B 1ZW6A 1ZM3A 2BCJQ 2QAJA 2ZSFA 2D74A 2PZEA 3IQWA 4KITB 4FMDF 3L82B 4JLDA 4ACBA 2F43A 4A0GA 1J2JA 1UDXA 2P0EA 3HBLA 1OYYA 3QUSA 4OK5A 4LC1A 2XNDA 2DIKA 1F2UB 3SJBA 4RKFA 4P4TA 4ZCMA 5J4KA 4Q9KA 3DVLA 2WIAA 1XP8A 4NDZA 1V43A 2GXSA 3BRWD 3OUUA 2D2EA 3W3AA 2RB4A 2W6PA 5SZHB 4BFXA 4DCTA 1G5TA 1M1YE 4JVSB 2VP0A 3CBQA 4W5JA 1SVKA 1VTKA 1GILA 2YWFA 5J2UF 1RW4A 2CCKA 2J7PD 1LV7A 1X6VA 5HE8A 2NU7B 1EWRA 1NBMA 4LV5B 2XX3A 4MV6A 3V9PA 3U4QB 2WSSA 4EQ6B 2ZAOA 4QBHA 2W6JD 4N0DA 1SULA 1G3UA 3MWYW 2ZETA 3KKQA 1J70A 1XTRA 3GLHA 3T61A 4HAWA 2JJ8A 2WSMA 3ADDA 1BOFA 3ASYA 3P4YA 4TL6A 2W83A 2YYAA 1AS2A 2MSEB 1XXHB 2ZVQX 3AP2A 3NDPA 3QSYA 4Y8VB 2CZGA 1Q1ZA 1QHSA 2NPIA 2NZ8A 2XJ9A 2OCBA 4FMCB 2BCGY 2VSXA 2GTPA 2DFNA 3B6EA 4TMXA 3UWOA 1LFDB 4ERNA 4B44A 3GIDA 1XCGB 2ODBA 3VR2A 3A1UA 4CZ2A 2MMCA 4BLQA 4DCSA 4M2LA 2R7MA 3OEED 1MR3F 1CTQA 3B13B 1RJ9B 4U5XA 3LH5A 4DCNA 3PIRA 3LBHA 5DHFA 4R9UC 3SE0A 3GLGB 3LNCA 4TYWA 3NVAA 1E1QA 1ZVQA 1VG0B 2FFHA 2OFXA 2F7SA 4EGQA 1DAFA 4GL2A 3CONA 2VA8A 4ZCIA 1NI3A 1XEFA 1KNXA 2WM9B 4AK9A 2N46A 3BAFA 3IUYA 1VHLA 1DADA 4C7OB 4LJ6A 3HYRA 4L16A 2F1IA 2PMDA 1SXJD 5FBQB 4QG7A 3UXMA 1E6CA 3UG7A 4CEJB 4HNUA 3BE4A 3BC1A 1XTSA 2GEVA 4BRUA 4GZLA 5SZKB 1M8PA 2RGDA 4MV4A 3MCAA 2IS1A 3THWB 4I1SA 1G8YA 2OUKA 3IPXA 4HAUA 1SQ5A 4C2UA 3WMEA 3IIJA 3K0SA 1EESA 3R5HA 2OESA 2J41A 4AY2A 1IY0A 3GLGE 1ZMXA 1NIPA 3I4LA 2PJRA 2YKGA 1SVIA 1VYTA 3N8DA 2PLRA 1BO6A 4Q7MB 1JEEA 1G18A 1S3SA 4O3MA 3LWBA 4DLKA 3SI7A 4IDQA 2HXSA 3K0FA 2FGJA 1FUUA 3DMNA 3G8CA 2ZDQA 1OFIA 1U2RA 3PEWA 2ZE6A 1LS6A 4Q9HA 4B6EA 2BM1A 2ZYVX 2QE7A 4TV8F 2O5VA 1GKUB 5LP6F 1UKZA 3QXJA 2O8CA 3PV0A 4FCWA 1R7RA 4TLCA
chains in the Genus database with same CATH superfamily
2BTEA 3GP8A 4WLEA 1WXHA 3GRRA 3LCMA 1GKIA 2CDNA 5DP2A 3UJDA 3UUEA 1PW5A 3EQZA 3PHIA 3G5AA 5KKNB 5AJYA 2J3MA 5LQCA 3T1QA 4DZRA 4I1YA 4R2IA 2WQ7A 2X1MA 4QWCA 2B0JA 3GT4A 3N0VA 3TVTA 4PHFA 3JQAD 1LTHR 3OLQA 1BCRA 3D6AA 2V6MA 3RRMA 3HWWA 2GPTA 3AEUA 2ZIZA 3FHCB 5EXEA 5KNLA 5E6UA 3C15C 3BTVA 3RYTC 4KQXA 5HKAA 1ZKDA 1Y48E 3D8RA 4J1TA 2B9EA 4HNVA 4KXMA 5E1DA 3NNNA 2PANA 2WJGA 2JY6B 1X8JA 2Q3FA 3KXDA 4TSRA 4TSFD 1IHUA 4O4LF 1V41E 1XBTA 5HCNA 4DBVO 5DHAA 2BAGA 3EH1A 1SD1A 5EAIA 2JH3A 4LWPA 5E9JA 5BPFA 4CTOA 2RBEA 3AW8A 2OHIA 5FBWB 4PM4A 3BE8A 3EXG1 4B7UA 5BURA 1I13A 5AUPB 1IEQA 1VYHA 1RQGA 1A4UA 4DV3H 1BU5A 2B8JA 2ZRNA 3NHJA 5TQ0B 3WIBA 1TDJA 3WJ2A 5E9AA 3SOPA 2CHQA 4C0SA 1TU0A 5AW4A 4TMFA 3T7KA 5DNYB 4PXYA 3E61A 5DG8A 1PP4A 3QY0A 3LRPA 2Z2JA 4U7PB 2WSIA 4CIYA 3RARA 1E1DA 4FR0A 1E6WA 1QV7A 3INGA 5HF6A 4AF7A 4CV0A 4ZJUA 3MYYA 5JXGA 1LQ2A 2GEJA 1QHYA 1V6SA 4RQBA 5DMHA 2QNIA 3DO8A 3IPYA 4DLUA 4E94A 1IB6A 4TRNA 3GPYA 2GK6A 2QV0A 2ZBRA 4F2DA 5I4CA 1IY8A 3SK0A 3P9XA 3C87A 4JN6A 1EFUA 4JB8A 1GHTA 2DTEA 5I5EA 5IXJA 4EI9A 4LFBM 1KI6B 4QVKA 3DEJA 3PICA 4CGYB 3NXSA 3UHOA 1OTYA 4A2CA 4Z4FA 1JYFA 4GE0A 1WVIA 3UW3A 1DO2A 2QU8A 1JWAB 1Z4MA 3RWBA 5KNDH 5BPVA 4TTQA 3IQGX 5C34B 1BHQ1 1JAIA 3EOZA 4MUAA 1HE3A 2CE7A 3IBCA 3K5WA 4TTRA 3ZGXA 3AB8A 5EWLB 2NXWA 2FF7A 1WM1A 2QRGA 1IRXA 3IS3A 5KYTA 2HUNA 3E9NA 3COPA 3KT3A 1HT1E 4KRXA 1E4YA 3M4ZA 4CMKA 4QEZA 3FVTA 1DC6A 1PJBA 4HF7A 3B60A 4UE3S 4B6SA 1JALA 4HGPA 3WGUA 2OG1A 4ZICA 2FDXA 4HZGA 1YQ9A 1R8JA 1ZFNA 4BO9A 821PA 2FK3A 3AWDA 3IHWA 5DEOA 1HNXH 3W9BA 1WP9A 2OXRA 5EE1A 1JF8A 4OB8A 4R3WA 1PS9A 2G9UA 3DFZA 1WB6A 2OBXA 3ZTTA 4K0KM 3U0VA 5BSEA 1X7WB 2GJKA 4FJ0A 4JOCA 1CB7A 1UEJA 1CQPA 4BUCA 1NV9A 5AXDA 4C88A 1FSZA 4KXVA 4BQRA 1T1GA 3JVVA 4HX9A 3VZRA 4LF4M 2QHXA 3K20A 4H6PA 2C2BA 5AI9A 3THRA 3KJEA 5IVKA 2F8TA 1FMTA 4PLCA 1HM5A 2WJZB 4EHAA 1EFPB 2QMQA 4EHLA 2FZWA 4KTVE 3HEBA 3O1IC 1XKXA 1EB8A 1OYVA 3TMAA 1S5PA 4DA4A 1DUSA 3OCUA 3DYIA 2YHUA 1LX7A 2FSSA 2P4QA 3WBFA 2K9DA 1NMXA 1XE3A 4TYYA 3E8SA 4YJ3B 3MFIA 1T9GR 1XZMA 3KPWA 4XPIB 1TQ2A 1WNTA 2FK7A 2WWHA 1JVSA 1UXOA 3L40A 3LPAA 2R2GA 2P9ZA 3IVRA 2PWPA 4D8TA 1VYVA 3KFLA 1DKLA 4Y9SA 5EJ4A 2H08A 2ZIWB 1PBNA 5KYWB 1YRLA 1QZZA 3ICWA 1CRZA 3G0OA 2ECOA 4IUBS 4KHZA 4I8XA 1E20A 2NZUG 3GZTB 1G21E 2AYXA 2L09A 4YDSA 1UPBA 1L4FA 2WYHA 1X1SA 1LKZA 1O2DA 2HSJA 2IOHA 1U9IC 2ZIXA 3F67A 3LQ1A 5GJVC 1UAYA 5F1KA 1OI4A 5LQAA 3CSDA 1GJTA 3EZFA 1YNOA 4J7AA 4J94A 2XAAA 4WKOA 4WOJA 1FXSA 3A3KA 1JB9A 3KPVA 2OHVA 4I5GA 4KI0A 3KFXA 3DP9A 3HB1A 4IRUB 2VBIA 1OKKD 3FPBA 2VNIA 4UOZA 1OAOC 3K1JA 5L8RF 2V9PA 5BN4B 2ZKLA 5CFPA 1XUOA 4NPHA 1WXWA 3Q1KA 3PZPA 4I19A 3U0BA 5KCMA 2V5AA 3BABA 1Y4DE 3VVLA 2ZE7A 3TRJA 1QDEA 4G0NA 1NNI1 4S2UA 1PUJA 5CTAA 5ISMA 4H17A 4IIEA 1P5ZB 5JAPA 2R92G 3CX4A 3SARA 1AGXA 2ZWMA 4KSYA 1IONA 1XRRA 4BNHA 4FS1A 5FH9A 2JH8A 4BV8A 4MDEA 5G4KA 4EMBA 4FBTA 5CTJA 4JI8M 3RJ9A 4LXIA 1O96B 2VQEB 5JH7A 3CX6A 5K0BA 2XBMA 3GGJA 2AD5A 2ZM6B 3MJ5A 1MCZA 2OB2A 2ORIA 3DLIA 2QAGC 1AM4D 3VKFA 4OUDA 1LRJA 3K6SB 1RBQA 2BUBA 3WWOA 3VPCA 4FYIA 5I9NA 2YWBA 4YQEA 1QHFA 1EUCA 1V1RA 5D87A 3BCRA 2A1TS 1SCNE 1U8YA 3RK1A 1BWSA 1PJ3A 1G9TA 1NL3A 3C48A 5D6NA 2J85A 2IYYA 4PN3A 1PYDA 3IBYA 2ZWPA 3ZVLA 3THYB 5IZ7D 2AN1A 4J2OA 1KBZA 1M6HA 1D0LA 2WVAA 4PC6A 4MVJE 1IUNA 4TX1A 3R7SA 1KE1A 2IWHA 2IF0A 3PHLA 5DN6D 4LF6H 4UULA 3AX6A 4YVFA 1JA9A 3FCXA 2G7MC 3AUXA 3ZHQA 4D2IA 4HQ6A 3QYBA 2UUAM 3ANSA 1FTWA 2BHNA 2JKZA 4P8RA 3PFFA 3ED1A 3NWLA 3ZLJA 4GITA 2ISQA 2JLBA 1FUIA 3QPVA 1JX4A 2XDQB 5JJLA 3H2GA 1LH0A 2W9XA 2H3EA 2C2EA 1YI8A 3VFDA 2HWKA 3HCPA 1WMDA 4IJVA 4IVRA 1F0YA 1ZN9A 2EHDA 2GZ3A 2JK0A 2OVBA 1MAHA 2W2TA 3CZ5A 3EGWA 3BPSA 3QA9A 5EIBC 2D2IA 1SCBA 1SD2A 2R79A 4DR1B 2L19A 1X9GA 2DPYA 1JUDA 2VP2A 3E2MA 5F5NA 3WWCA 2JLQA 4F1JA 2WD7B 1RMQA 2W58A 3GJ5A 3MJRA 4B9AA 2E5LB 1KSHA 1L8OA 5D3MB 4AQYB 3QE2A 4DR4H 1NULA 4YXFA 3WICA 4HEJA 4YY3H 3D7RA 4W8GA 1UKVY 5EFOA 3JYNA 3MQFA 5J2UB 4YRPA 2CLCX 3HHYA 3OJOA 4LMYA 2VF4X 1T9DA 1YOVB 2C9BA 3EZLA 4DLBA 5BSKA 4EJFA 1ZK2A 2XCOA 4JLMA 4NI5A 1PQ4A 3C3MA 1NVBA 4RCZA 1GA1A 4BGUA 1T8TA 2W90A 2WOOA 3A1DA 2PXHA 4F8EA 1ZH0A 3U3JA 1XNQB 3N74A 1O77A 4JV5M 1YS9A 5FPRA 1NF9A 4DR5H 5FO1A 1U28A 4RPIA 3M6IA 4PXSA 4BXOA 4JT2A 2AK2A 1R3DA 3IV9A 1SVOA 2C92A 3LUJA 4G1BA 3DV2A 4QPDA 3SNHA 1MPXA 2PSSA 1E61A 2C4HA 5AI5A 3TOXA 1ZUNA 2PSFA 2ZJAA 3NBMA 3J7AK 3ZD9A 1V25A 2CHGA 3TR0A 2RHWA 4BNDA 3Q88A 4HDAA 4YB8A 1A97A 1X74A 3VM6A 1KBQA 1FU7A 1KVQA 3MW8A 4H15A 5F2OA 4O1MA 1XCJA 1PNRA 1C1YA 1DDOA 1MGOA 2JS7A 3FR7A 3L0PA 4B5KA 4C76A 3OIWA 4ZRMA 1ZSVA 4UUQA 1E4GT 1IJEA 2X2EA 2XUOA 2ZI9A 4I1IA 2H16A 2OPHA 1LPMA 3RS4A 4U8GA 1XNRM 3MWDA 2VNJA 3FFBA 2QK4A 3ZDCA 1S1CA 2I87A 1PL8A 3QKSB 4TVOA 1RAFA 1N0WA 1P61B 1SBCA 3MK6A 1DAEA 1KH3A 1YB1A 1YDFA 2WVJA 2Y68A 3DO5A 3F6BX 4NU5A 4P4NA 4R1LA 5PGMA 1UK8A 4I6GA 3OP1A 4XJXA 3UTCA 5CD9A 1X15A 2QZ4A 2AFHE 1OKKA 3KQTA 3D6MA 4D26A 4EA6A 1U7DA 3F97A 1U31A 3G8AA 4EJ2A 4ITQA 2G09A 1N5LA 2Y1FA 5DWQA 1Q84A 1YSCA 4B4VA 2WSFF 3JR4A 1Q2UA 2DWQA 4A27A 3TINA 2BY4A 2BUCA 3KYJB 4L27A 4WKGA 2QM7A 3SN6A 3UK1A 4CG3A 4U2KA 4A10A 1GTZA 1UUFA 1X39A 1WUKS 3N2GA 2MH8A 1DBRA 2YHIB 4O6VA 4XYGA 1JFSA 2QTWB 2KJQA 3UJNA 4Q44A 6AT1A 1DBVO 5JFGA 3LO5A 5KPTA 1FE8A 3RSOA 4AWXA 3LBIA 4FCCA 1HYEA 3M4XA 4MPPA 2HAKA 2CL7X 4O59O 4W1SA 2QD5A 1M8GA 4IDHA 3KR9A 4KE7A 1L2BA 3J7BA 2FEPA 3KLOA 4RXMA 1ZMUA 1SEPA 1KVRA 4Z0HO 5UKDA 3K96A 3BMCA 2Q2UA 2O7NA 4BBJA 1OHHD 2AOVA 2PLFA 4JSTA 3O8QA 1HDYA 1ZETA 2XZPA 4K9SA 4F5WA 2QG6A 3QITA 1G5QA 3DS8A 4L7VA 4XVQA 2V3CC 4RF5A 4DNOA 3FKQA 4LDJA 1XAJA 3H16A 2VJAA 4MMYB 3WISA 3E0QA 3E9EA 2B34A 3JS5A 2C9YA 4U7JA 1PGQA 4BLRA 3B7QA 4XWGA 4ZEOA 1BU8A 4P9NA 2EFYA 2IPXA 4DCVA 2VHEA 2YU9A 4QWBA 1P7ZA 1M10A 4U63A 1P45A 5I4KA 4BFUA 1XJ5A 4DR2B 3FCCA 4BV3A 1R8QA 3UWDA 5JQWA 1TYBE 1XAIA 2HWXA 2CNNA 4IIDA 5L7YA 2GT1A 3K0CA 1ZITA 1P7CA 1WA5A 4L5IA 1R27A 4QREA 3DVQX 2FN8A 1N2CE 1P91A 1ZICA 2H9AA 3MOIA 3QEKA 1T3ZA 4PGAA 3VC7A 4G9EA 1VHTA 2GN4A 2GCPA 4Z51A 5A4DA 3FTQA 3QU2A 2HGSA 1PKXA 3THWA 4O0MA 4E0BA 1SURA 3QI2A 5TGZA 1Z33A 2FWBA 3A2NA 4PQFA 4O4IB 4O4IF 1H8EA 4R4JA 3S1LA 3G7SA 1YFLA 1AURA 4MRMB 2PKQP 3RRXA 4CCYB 4G5OA 3B74A 3N41B 2OD7A 4BN4A 1J7KA 4M6WB 4C5AA 4Z9BA 1DWUA 2AOUA 4C6SA 2XYVA 4H7FA 2OH2A 3QBVA 3PD0A 3FKEA 3OZEA 3GTJA 1ZUHA 4ITUA 3TKYA 1EEXB 1QH8B 2BSQA 1ZP6A 3EWNA 3NBQA 5EE3A 5A3VA 1E99A 4GZ6A 3B7ZA 4JSYA 2Y93A 4AY5A 4TXLA 1ZD8A 2V7TA 5JJKA 1PDVA 1MO5A 1T6YA 5DHQA 2GM5A 1EJ2A 2Q6OA 1RJ9A 4X54A 1MZPA 1JXLA 3I2YX 4EY7A 3EASA 1XZAA 2ZCUA 2VBGA 3PUHA 1T5HX 4UXJA 5HCIA 5E2IA 4EMUA 5LN1A 2PRYA 2QTTA 3FPJA 1K5GA 4NHOA 5AH0A 2WWGA 3RTAA 3ZGOA 4BVLA 5EXTA 1X42A 3HI6A 1B23P 3VZDA 3GI1A 3ZWQA 3BFPA 5ALVA 1WL8A 3QXSA 4PR0A 1DO8A 1THMA 2R47A 4JQSA 1ECBA 2R46A 1TW2A 3W4JA 4II2A 3GJTA 3RIXA 5EHNA 2J0EA 3FWYA 1Z6XA 4Y8VA 5KFNA 1KZ7B 1ND5A 2VSYA 3LT4A 1GYPA 1QYWA 1W30A 2QJWA 1NSFA 1IHDA 4J0DA 1JMVA 1L2TA 3VDXA 1VQ1A 2NYRA 4DANA 1DAPA 4YCSA 4RPHA 2GBCA 3GLHB 2A14A 1LW7A 2CFSA 4DV2M 4EB6A 3L79A 3GRYA 3W04A 3NO4A 4WY5A 1ENYA 2VK4A 2XOXA 1R2QA 2A84A 1PEAA 3LYLA 1RWVA 4JI3B 4F4HA 4RNOA 1PGYA 1F0NA 1U4NA 5L1KA 1G7RA 2O0LA 3R24A 4QATA 5ILQA 4HNHA 3AUKA 3BCSA 3TOZA 3U4QA 1XP5A 3TXAA 1UXGA 4QTUB 4GMGA 4OSOA 1GN9A 4P0PB 3B38A 2YH2A 1X19A 3SHVA 3W79A 4BO2A 2CVOA 2QRMA 3ZHXA 2Q5CA 5AM1A 4MV8A 1EK5A 1HFJA 2GYVA 4XASA 4ES6A 1KVUA 5SICE 1L4YA 1S4QA 4O4LB 1K3UB 2VUMG 1I1HA 1OAAA 2D06A 1XXHE 2QVBA 5KFJA 1GU0A 1YAJA 2FW9A 4UC0A 5F78A 4OIMA 3SDSA 3KV3O 3FIJA 3WGGA 4AKSA 1TWGA 3BIFA 4K05A 4OMUA 2OZPA 4P5DA 4R0NA 3UMSA 2ODTX 3WYBA 4CBVA 1ZEJA 1UFRA 3L2PA 3MK31 1XF1A 2XEXA 4BY9E 1ZM4A 2C7GA 1QUEA 2F43B 2JAOA 2PS0A 3FZEA 3H8WA 4GI2A 4JLVA 3UFXB 3VYVA 5AK3A 4C4AA 3OUZA 3FNQA 1YDWA 3TEFA 4AN1A 2L2QA 4JIGA 2AS0A 3EGXB 4TKZA 4PLFA 2PZKA 4JH0A 4OP3A 4UBIA 5HG0A 1WZEA 1KF0A 5C0OE 5JG7A 4DV3M 1RLIA 1K4MA 1QMPA 1UC4B 3EK2A 4WVLA 4YS6A 1K8XB 5HV6A 4TS9A 5EKUA 3ZBQA 5JISA 2XECA 3LGXA 3C3BA 1VJCA 2XUIA 3CZRA 1ENPA 2NP6A 4OXYA 4U7WA 4FOOA 4Y2VA 3WL7A 3LUPA 1WCXA 2Q99A 3B8HA 3KZ1E 2I3DA 3WLQA 2AR0A 4BNJA 3CMMA 1B1AA 5E7QA 4XK8F 2EG5A 3NDBB 1H85A 5AJVB 3RC8A 4TN1A 3AEXA 3G7NA 1DC3A 2HNBA 1GLNA 1MO3A 5ELMA 3S0JA 1K5DA 3OHBA 4C4RA 5ICSA 4LBWA 3ZWWA 3Q8PB 1RVV1 2VDMB 4P86A 3HDHA 4UXIA 4D56A 4ZMSA 2ZVJA 1XA3A 3MELA 5EKXA 5D8DA 1ISFA 3DNMA 3RUEA 2ZAMA 2YNMC 2ZKIA 1R0KA 3ENZA 2C9MA 3T7TA 3UJCA 4ZFNA 3O2SB 4H7PA 2B5WA 4OI0A 5ALEA 3OG9A 3CMCO 1KBLA 3LC2O 4QQNA 1XVTA 1QLJA 3L0ZA 1NAIA 4ZVNA 1CY2A 3TM5A 4D41A 5H1YA 1OT3A 4R2HA 1OYWA 2BGWA 3PNYA 2E6UX 1D0KA 2PQ0A 3MERA 1UBNA 2CXQA 4GHWA 4PFQA 1VZ3A 2ZPUA 4YCJA 1ORYB 1XRNA 1GFSA 3RFTA 3DMGA 2HHCA 1OWNA 2XH9A 1JFLA 1AUQA 5DNAA 5F64A 5KNCA 2IELA 3WKEA 2FW0A 5DCLA 3H84A 2H1WA 1FVOA 2Q6KA 4IIJB 2X13A 1U7HA 4MKFA 4PW0A 3GCGA 2YJNA 4A3EG 2ZUCA 1Q16A 4R1OA 3B5IA 3L8DA 5AI8A 4HXEB 1MC8A 5B7QA 2HF7A 1QVVA 3P9IA 3LNTA 4PVDA 5IC4A 1I7NA 3KVRA 3AR3A 3QX7A 2JEFA 5GADl 3TQ1A 1RSZA 3HJAA 3T52A 1XMOH 2VIIA 2H18A 1ZLXA 2LCFA 2C5BA 2IUEA 3CG4A 3PU6A 3WP1B 3D7SA 1Q1BA 3NORA 1AUPA 3PFGA 4PSVA 3SQXA 1TNDA 4LZAA 2G28A 3G7UA 5BNIA 1YR3A 4BNXA 3CTPA 3AESB 2UYQA 3BZUA 3NHSA 3R6WA 4G0UA 4IHJB 3V9AA 1G8KA 3A42A 1MAAA 1XVIA 1LI4A 3KHUA 2AKAB 4GWKA 4ANFA 2XV1A 3VK8A 3EUAA 1MJGM 1YZQA 3HDVA 1QONA 2QTAA 3I9V1 3GIWA 2VYFA 3ID6C 4E7PA 3WZMA 3OMWA 2OV2A 4HTFB 3F1LA 5EKSA 4B7CA 1M3SA 3GA5A 1WXIA 4PBTA 5K03A 3IAUA 1SXJE 3BA9A 1KU6A 2AQIA 2JHPA 1JG7A 1YU9A 2QEQA 2J48A 2P1ZA 2ZTUA 4IBIA 3WO1A 3GP3A 1L8LA 3HWRA 3PI6A 4EKIA 4ZCRA 2MR6A 4CLXA 3T5AA 1US8B 3K70B 2RB5A 3COWA 3HCBA 1SC3A 1AE1A 4NFYA 4IHAA 2QUHA 4UM9D 5CLGA 4DJDC 5EIEA 1NNSA 5LYJB 2GEUA 3OE1A 2OXEA 4NCAA 1BZYA 3FAKA 4RLQA 5D1OB 3O1LA 1E6UA 4DR1H 4LYGA 3L92A 4KQEA 2JA8G 2OT3B 4BX9A 1N4DA 3VR6D 3KR0A 2XA2A 1U0FA 4L1KA 3GNLA 3C1TA 2VNSA 4NH4A 2AK3A 4EPWA 5B4VA 3NTOA 3BAAA 4HXYA 5ALNA 1MHPA 1KEEA 1Z2DA 4CU5A 5KIAA 2G1PA 2FPIA 1UBHS 4J7UA 5ITSA 1DC5A 2YWXA 4H4DA 5IU6A 4UMEA 2UKDA 2X8WA 3WYGA 2ZCJA 2Q5QA 2IY7A 3R9XB 1FVIA 1KVTA 3S2UA 4GBMA 1KHTA 5FDFA 2AMYA 3W3AD 3IX7A 3RVJA 4K8RB 3ZWKA 2PUHA 4P3XA 4D02A 4IV0A 3AIOA 1MX3A 2EF0A 2F1HA 2HWYA 4UTNA 3AHJA 3CTWB 1P0IA 5CB4F 4CI9A 2INGX 4UPEA 3U80A 3LA8A 3T12A 2OV6A 1TRHA 5DOZA 4B3HA 1YRWA 2FXVA 5IP7G 2OGUA 5CFZA 3OFSA 1V8OA 4HGRA 3VTZA 1I4EB 2G9RA 2P2DA 4M7RA 5FFFA 2FRVA 5KPJA 1H2HA 3LVWA 4BKPA 1F9EA 2ZBDA 1CE8B 3ZVMA 4KR2A 3QZ7A 1K83A 4REZA 3VZPA 4URWR 4X90A 1RLMA 2NV2B 2XYHA 3F0TA 4XJVA 4ZV7A 2BRUC 3DBVO 5L6MB 1YJ8A 3OZUA 4BO1A 2WIBA 1U7PA 4KB5A 1YI0A 2ZT8A 3TLAA 2E5FA 1BYUA 4UCSA 3Q7PA 7AT1A 1V2GA 3AOGA 4NICA 3GLUA 2ZTVA 3QUAA 5E4JA 5JPIA 5BXYA 4FUQA 5KSPA 1KBOA 2IYSA 3U61A 3FVQA 3OC6A 4OP1A 4IRCA 2ECQA 2OC9A 2IL1A 3MC1A 3P0HA 4Z7OB 5JPCA 1E1YA 1E5VA 2V4UA 2X8LA 4GF5A 4K9DA 2VI5A 4MKRA 2PS1A 5CYOA 1AIPC 1FNSA 4UCWA 4LF7M 2PY6A 4B4DA 1J0BA 4C4OA 3OM0A 5L1LA 5T8KC 2Y2UA 3K1TA 1LLUA 4BDTA 3HHXA 2W37A 2X4IA 2ZYAA 4RV9A 1VSVA 5AKEA 1A27A 3UEOA 4MTDA 1H8HD 4ZOBA 1LGYA 1CUFA 1G42A 3QMVA 2BTQA 3VPGA 1JDBC 3Q2IA 4MQLA 4HDKA 4Y6LA 4MH0E 4YTEA 4DREA 4BE7B 1EHYA 1Q7GA 2G4VA 3O03A 4KO4S 5L3SB 3F7MA 4MARA 4QPJC 5T4EA 3OTOM 3OHPA 1X77A 3CJRA 3T5CA 1AB5A 1DIKA 3CURA 3FWKA 3K16A 4JIMA 5EA2A 3U5TA 2YR0A 4O2AB 1GLVA 3GTQA 1F4PA 4LF9M 1KO4A 4KIJA 3OPNA 4OFXA 5CVCA 1E9RA 1T0BA 1XU4A 2CFOA 1NRWA 3NBUA 3QNWA 4G1UC 1K1EA 1Z6AA 2H9IA 3RBEA 1G3RA 3OE7D 4URZR 4L6IA 1V45E 4X7BA 4ZEVA 3K2LA 3DVAA 1L1RA 1WSBA 2HF8A 4AMUA 3K9FC 2GQFA 5H3HA 2C9ZA 4RGYA 3DGEC 2Z2XA 1CX9B 4RWZA 1JEJA 8AT1A 3PC6A 5HJ7A 2P62A 1OBVA 1U81A 1K27A 1A7AA 1TK3A 3HZOA 3GFVA 3JQPA 2GARA 1OBFO 2GVDC 2B8EA 1DI0A 3LIPA 2PE5A 3FPAA 4DMKA 1I6WA 1S2IA 3WOVA 4XKJA 4JI6M 1C29B 4C4SA 2V7BA 5KFKA 4X1KA 2DVWB 4PAMA 5ED4A 1I0LA 2XNKA 3VDMA 1IVNA 4DM4A 5FV4A 1GFZA 2RONA 2WKSA 3JAWA 5C7LO 1N5DA 4CKBB 2IGTA 4AO8A 1KKMA 4W82A 5KX5F 1M6WA 2OOKA 4BNVA 1EFVA 1QGOA 3W4KA 3FTPA 3L93A 4LBYA 2Z3WA 4R6XA 3RRJA 3W34A 5KREA 3K5PA 1T1IA 2YJ3A 1G0OA 5KPDA 2WYOA 2G0AA 2O2IA 1YS4A 2FG5A 1H1TA 2H2IA 1Q57A 2PSJA 3JRXA 1U7XA 2WV7A 1Z29A 3ZXYA 3ZV7A 3HKZE 1ABFA 1Q17A 2TS1A 2W43A 1I5EA 2P2LA 4GI3A 4OVZA 4YRTA 4EPYA 3OT4A 4O2BA 2NP7A 1WCMA 1ZGZA 2WUEA 1DPGA 4JI8B 2ONYA 5KT6A 4BYGA 5LYJF 3HN6A 4AYXA 2Z8YA 4U7HA 4J8PA 5ALQA 1E79D 3NIWA 4PQEA 3EGEA 5GJBA 4C6TA 3NM6B 3KYDB 3PXDA 2WDTA 4XOIA 4YBZA 4K40A 1TA8A 4MV3A 4Q7LA 1N5OX 1AKMA 3D2LA 3RU7A 4ZIRA 1BXZA 1WUIS 1YRQA 2M9MA 3T5HA 2C7VA 4KQJA 4XVUA 1XI2A 2OXFA 4R5MA 1A1SA 5FOTA 1CF4A 3V1TC 4IJ6A 1I5OA 1T2VA 2I03A 3WLJA 5U9CA 3THXA 3HDJA 4B3BA 3A32A 1L8QA 1YH3A 2E21A 3L7NA 4YCAA 1ABBA 3CY6A 5L95A 4NOLA 3GJ6A 4YRZA 2AJCA 4RNAA 3T7CA 5DFLA 2RHLA 2ZI3A 1A8HA 1WMSA 1SRRA 3OIYA 4DCPA 1F2TA 2I7PA 2PCJA 3JVEA 3OIVA 1YCFA 2QENA 4GMXA 4JBYA 3BFJA 4WMLA 3TN7A 4IWYA 5JBIA 1GL7A 3WAGA 2ERCA 4V0ME 3FNBA 6NULA 3ZU4A 3DHVA 3SQOA 5CW1A 3ENNA 1CUDA 1DAOA 4ABYA 1TCVA 1E2QA 2CWDA 3L6CA 2EBHX 1A50B 3PE3A 2G72A 4FWTA 3HR7A 5T4FA 2J9GA 1OSNA 4RVDA 2RFLA 1Q0RA 2APJA 2J9FB 3RS2A 3NR2A 4KBYA 3G1TA 2RJNA 3VO9A 4DL7A 1GL3A 1HDEA 3TTXA 1FRFS 2V9WA 2J0UA 3WGJA 2VCEA 4DSNA 1LJUA 1J99A 1OX6A 1KAMA 4G37A 1EWTA 3VHXA 3Q9LA 2EJBA 1J5XA 5DASA 4BVHA 1IQUA 1IFYA 5DBFA 5DYTA 1PL7A 4HDNA 1IUKA 4O02B 4LYFA 4EG4A 3JYQA 1UBJS 4MK4A 5SY4A 1QFYA 4QJFA 3DOIA 3TEJA 2WM2A 4O1IA 1PGNA 2D8MA 4BBSG 4UTPA 1I3MA 1NLMA 2J3EA 2PYIA 3LC1O 4BQFA 5BMVA 5IJ9A 2R2AA 3HZHA 1OH7A 1MQ9A 2I3BA 3KQMA 3T1HM 3K0BA 4RH1A 4OGKA 4QPNA 1KP3A 1OWTA 1MVNA 2BFOA 2A0FA 3W8DA 4C2AA 1DGBA 1EX1A 1EWKA 2HY7A 4DJFC 4YV2A 1V71A 4MCJA 3MAAC 3I05A 2NO0A 2R8RA 1RADA 4LHSA 1YB6A 1ZVKA 1VIYA 2Q0QA 2QVYX 4LFCH 3FPEA 3H5TA 1L7BA 2Z5GA 5DTEA 2J6IA 4LJ7A 3BBPA 3FLBA 5JVDB 5K6TA 1NO1A 1W2GA 2BLLA 3UB2A 4PO9A 5KU7A 4XYBA 3ML1A 3R76A 2YIDA 5LD2B 3CRVA 5IFLA 3I04M 1MABA 3HKDB 3PGKA 3OTIA 3L02A 1SC6A 1NXWA 3CKKA 3FZYA 1FDRA 2JIOA 4KQGA 2BEWA 1CRQA 4YALA 1GAJA 3TGPA 5G4LA 3O8CA 3EX7C 5L4NA 2G1UA 3IG5A 4G1CA 4BB9A 1CHNA 4Z7QB 4BP9A 4H3KB 4EUEA 5AVUA 1LZKA 3TW8B 2Y0EA 1EBFA 2FWNA 1OR8A 5A0FA 3ZK9A 4G8DA 4QTYA 2WG1A 3K9GA 3WY9A 3ZWNA 2VDPB 4L2IB 3CNEA 5C37A 1J23A 4RPGA 3H6HA 2R92A 2B4YA 5AI0A 1YZNA 2IP4A 2RHMA 5LBTA 4EDHA 5JZVA 4F0JA 4EF4A 2WZCA 1YR2A 4IF6A 1S3FA 2QBYA 1JHYA 1UH5A 4IJUA 4U0KA 1AXRA 2YOHA 5L4SA 1TM7E 4JLKA 3FOFC 1HFWA 3HHWA 2AD1A 1P1KA 4XUDA 3EGCA 2DKLA 5EXPA 4MTLA 4E46A 1E4VA 1I4TD 3IR5A 2G8LA 4DR3B 1DMSA 1C9KA 2C99A 3C70A 3CSUA 4WEQA 1TAGA 3X1MA 4KG7A 2VXOA 2GBLA 1FXUA 3QLVA 4ZD6A 4MGIE 1E66A 1EDDA 2B35A 3GQVA 3HCCA 3R0VA 5K3FB 2L6OA 4YHHH 2QMZA 3VHRA 3T4UA 2PH1A 2JG3A 2G82A 4D97A 2PUCA 4X66B 4GI1A 3A2KA 5GJWC 1FX0B 4D0RA 2ILTA 1G7SA 2C98A 1M34B 4MP3A 3B7WA 5AIAA 2VXYA 2XNJA 2C1ZA 4K87A 1T5TA 3IR6A 4Y67A 4A15A 4B40A 4HI0E 4JENA 3L1VA 1BX3A 1DG1G 1YE5A 3QVXA 4MR8B 4PNPA 4XM1A 4HWOA 3SU8A 3KW6A 4C4TA 1QVAA 4W1QA 1RLOA 2VP6A 2ZYTX 1FYVA 2OZLA 3RAGA 1TAEA 2VPTA 4CKZA 1I4WA 4FU0A 1MQ8B 1Z0DA 1UAAA 1NRIA 1DNPA 1CS0A 1PSZA 1NJGA 2CY0A 3NT2A 1DBQA 4GXQA 5ALPA 2QLFA 3RVOA 3W67A 3RSCA 2Q8QA 1Z6PA 1TECE 4CCSA 4F50A 4IO0A 2IW1A 4ER3A 2IUTA 1WLSA 3A11A 2ZSHA 5AK4A 5GGYA 5K0NA 5CLLA 3FJ1A 3PSAA 1AN7A 1FPQA 4V38A 2JFPA 2OA0A 1KAQA 3DOEA 3RHZA 4DRXB 5IT9A 1FJXA 4U2EA 3QVSA 5AKYA 2O5EA 1BW9A 2DAPA 4DL2A 3ZD7A 1K3XA 3GMTA 4RJ2A 1AD2A 4RM3A 1XV5A 1KC3A 5CFRA 4J1QA 3VISA 3ZDBA 1FP7A 4N5IX 2A0KA 1CZHA 2AH5A 3GGGA 3GELA 1XDZA 3L7YA 1L1FA 3RF6A 4BLOA 1H4SA 4K6MA 1D0MA 1ONSA 3AEKA 3IYLW 3OE7A 3AILA 4BMVA 2BFCA 1MU5A 1ITZA 1HG1A 3V8PA 1E7RA 4GQIA 2BDTA 2EGUA 4EJSB 4Z3KA 5I3CA 2PUBA 3HKBA 1ZGJA 3U7FB 2C8LA 3D3NA 3GEGA 1U6JA 1BHO1 4UEQA 4CR6A 4E4RA 1YGYA 2DWNA 3EGVA 1CRLA 1NN5A 3NC0C 3RUDA 1R4GA 2CQYA 1GAEO 3GLIE 1OX4A 3DDCA 1L7OA 4KYIB 3U3DA 1RVDA 4K6GA 2UXBM 1G1AA 4BNLA 1RR6A 4LQ4A 4DW8A 1UINA 2WHXA 1BMQA 3GVCA 4JI1H 4MW9A 4QBGB 1XB2A 2IZ7A 4KU4A 5LYYA 3OQBA 4ZO8A 4RORA 2HKIA 1ZC3A 3S1SA 4DR7B 1JIHA 2R86A 3NTRA 5BSMA 2WILA 2XKBA 1TAQA 3WHKA 1PZEA 2IYXA 4JLAA 4X62B 3CWQA 2R8KA 4NJOA 1U8TA 5B37A 1OQAA 1NJ8A 3FUXA 5FI1B 2B82A 4F56A 5CVDA 2HH9A 1I6KA 5IMBA 4UTVA 3CPHA 3I4YA 2J3DA 5AJWA 1UFQA 1JR3E 3E9RA 2FMKA 1U0BB 3W2TA