2R6FA

Crystal structure of bacillus stearothermophilus uvra
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
949
structure length
899
Chain Sequence
MDKIIVKGARAHNLKNIDVEIPRGKLVVLTGLSGSGKSSLAFDTIYAEGQRRYVESLSAYARQFLGQMEKPDVDAIEGLSPAISIDQKTTSRNPRSTVGTVTEIYDYLRLLFARIGRPICPTHGIEIQSQTIEQMVDRLLSYPERTKMQILAPIDVVVDRIIIKDGIAARLADSLETALKLADGKVVVDVIGEGELLFSEKHACPYCGFSIGELEPRLFSFNSPFGACPDCDGLGAKLEVDLDLVIPNDELTLKEHAIAPWEPYYPQLLEAVCRHYGIPMDVPVKDLPKEQLDKILYGSGGEPIYFRYTNDFGQVREQYIAFEGVIPNVERRYRETSSDYIREQMEKYMAEQPCPTCQGYRLKKESLAVLVGGKHIGEVTAMSVTEALAFFDGLELTEKEAQIARLILREIRDRLGFLQNVGLDYLTLSRSAGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLIATLKSMRDLGNTLIVVEHDEDTMLAADYLIDIGPGAGIHGGEVVAAGTPEEVMNDPNSLTGQYLSGKKFIPIPAERRRPDGRWLEVVGAREHNLKNVSVKIPLGTFVAVTGVSGSGKSTLVNEVLYKALAQKLHRAKAKPGEHRDIRGLEHLDKVIDIDQSPIGRTPRSNPATYTGVFDDIRDVFASTNEAKVRGYKKGRFSFNVKGGRCEACHGDGIIKIEMHFLPDVYVPCEVCHGKRYNRETLEVTYKGKNIAEVLDMTVEDALDFFASIPKIKRKLETLYDVGLGYMKLGQPATTLSGGEAQRVKLAAELHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTADYIIDLGPEGGDRGGQIVAVGTPEEVAEVKESHTGRYLKPILERDRARMQARYEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Excinuclease ABC subunit A
publication title Crystal Structure of Bacillus stearothermophilus UvrA Provides Insight into ATP-Modulated Dimerization, UvrB Interaction, and DNA Binding.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 231
structure length 899
sequence length 949
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17755 UvrA_DNA-bind UvrA DNA-binding domain
A PF17760 UvrA_inter UvrA interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.280 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 ABC transporter ATPase domain-like 2r6fA04
1.20.1580.10 Mainly Alpha Up-down Bundle ABC transporter ATPase like fold ABC transporter ATPase like domain 2r6fA06
1.20.1580.10 Mainly Alpha Up-down Bundle ABC transporter ATPase like fold ABC transporter ATPase like domain 2r6fA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2r6fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6fA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6fA05
3W3ZB 1Z2CA 3Q5EA 1E96A 1KO5A 2KBEA 4LJ4A 2E87A 4A0HA 1S9HA 1XWIA 3B1VA 5FOVA 1CRQA 5DO9A 4POAA 1NBMA 4US0R 4Q1BA 1IOZA 3NH6A 3KX2A 4OQNA 2CHGA 4B44A 3QFFA 3BD9A 1N0VC 3PV0A 3U2QA 2RMKA 1VCIA 2FNAA 4HDQB 3FMPB 1OHHD 4LJ7A 2HLDD 3H0KA 2J3EA 4MRNA 1I7NA 4PO9A 5DSZA 3QPUA 2QN6A 5KO2A 2QBYA 1BIFA 1FNMA 5GJWC 3GCGA 4D25A 4NCJA 1L7VC 4KLZA 5K8UA 2CDNA 4WXPA 1GDDA 5KNBA 4GBMA 3Q85A 1KTVA 3CX7A 2J7KA 3K0CC 2WOOA 3QPVA 5L3SA 2CHVA 2JLYA 5J5CA 1QHHB 5FPYA 2LKCA 1XJ0A 2WSSA 3QXCA 4MUAA 3TVDA 4B3BA 3NC1C 5JRJA 3K70C 4L1KA 4BFYA 3GIDA 3NDPA 2W6JD 4BQSA 2OLSA 1XPRA 2W6OA 3BRWD 4QC2A 3FYHA 4U02A 1NP6A 1UKYA 3T61A 4EPXA 4F38A 2BM0A 4GT1A 4JSYA 4WZAE 1OXSC 2IS1A 4M1MA 1W49A 1R8QA 5CLLA 1KJIA 1L4UA 4HUTA 5TDHA 2R84A 3UWKA 1DVRA 4OYHA 2VP6A 3Q9LA 1G3RA 1XB2A 2ECKA 3N70A 3K53A 4ASUD 5LP6F 4BRUA 4LY6A 1R2QA 3CWQA 1IM2A 3HU2A 5SZJA 3VR6A 4BFWA 3P32A 1HTWA 3I5YA 4H1VA 3V4ZA 1TADA 2WJYA 3L0SA 4HAVA 4LI0A 4RFSA 2J87A 3ZQ6A 2F3RA 421PA 3CX6A 1GSIA 2IYSA 1Q3TA 3GJXC 3TSOA 3AVVA 4GP7A 1J90A 1VCMA 1JDBB 2GK6A 1KO8A 3C4JA 3OIYA 4XOIA 4YDSA 2W6ID 2A5FA 1SXJD 3UG6A 3PENA 4DDTA 3K9LA 4BLTA 2J0VA 2JJ8A 3GLGB 2FFAA 4LCBA 5HCIA 1XCPA 3LW7A 1JPNA 1N0WA 1IN4A 1AQYA 3ASZA 3CNLA 3K0EA 5JZVA 1OYYA 1YZNA 2IYWA 2QUZA 4C0JA 4ZDIA 1PV4A 4NYMR 4IW3B 2WWGA 4M9XA 3LVRE 1GRRA 4ZPXA 1AN0A 3DZDA 2DZDA 1HA3A 4M9SA 4PQYA 4A82A 4KITB 1CEEA 1VTKA 1CKEA 5L3RA 1KJ8A 4DT1B 1OFTA 5AJWA 1KO7A 3CR7A 2AK2A 4V0LA 4ZV4A 2DB3A 4MYUA 3VX4A 821PA 1M6VA 1COWA 1SKYB 3PUVA 4D0GA 3OFNA 2CEAA 1HV8A 3ZIAD 2JDIA 4QGFA 2QNRA 3PUZA 4DLTA 1E9SA 1VHTA 4AC9A 1G3QA 4HLQB 3OAAA 2VYFA 4A36A 3AVQA 3A1SA 4AI6A 4G5SA 1EFRD 1R8SA 1WMSA 4GL2A 4MV6A 4BLSA 2GILA 4XSHA 1W36D 3PVSA 3EZ9A 3AKDA 4LV5B 1F2UB 4IOJA 4KXFB 2QE7D 2O8CA 4JKYA 1ZCAA 2NZ8A 3IIJA 3W8RA 2WM9B 2IXEA 1E69A 1S3GA 4DZZA 2REXB 1PUIA 2IUSA 2OFOA 3BWDD 1P6XA 4G5RA 4EJSA 4Q7MB 2HXYA 2BM1A 2WAXA 2ZI3A 2O8BB 1QDEA 1GOTA 2AFHE 4QG7A 3R9IA 4BLQA 2NU6B 5TMPA 2IYUA 3U3RA 2GAAA 1XMJA 3VU9B 4ZQIA 2C5LA 5JI2E 1KO1A 1AM4D 4W5JA 1NF3A 3HBLA 1B23P 3CH5A 1Q20A 1YR6A 1Q3HA 3W3AA 3RV3A 1JR6A 4I55F 5TVKA 2R8RA 1J99A 3K8YA 5HZKA 3CPEA 4I99A 2IUTA 2YZMA 4JYCA 1G19A 2QROA 1OH8A 4I4TF 3B13B 1GTVA 2F3TA 3FDIA 4IFBA 2FSFA 3B82A 4RKFA 1N6LA 1IN6A 5FL7D 5KDOA 2R6GA 3CB4A 3AVYA 4JMPA 2G77B 5JVDF 3VR3A 2PLFA 2VPQA 4DB2A 1RE0A 5DHAA 4OI4A 5EE1A 1SXJE 1P72A 3QF4B 1E2KA 2ZE5A 4H1UA 1VPLA 2R86A 1FOEB 2CJWA 2JLRA 1NVUQ 2GJ9A 2GXUA 4R7ZA 1RYFA 5EXPA 4DCVA 2GCOB 2RGGA 3AGQA 2IYLD 3IIKA 3IEUA 4P4UA 3I3SR 3HU1A 4TUYF 1CE8A 5AJVB 1HE1C 5GJCA 4R71A 1CJKC 3N2EA 2WBLC 4MA4A 1ZD8A 2J7PA 3LAWA 3GLFB 4UNSA 4A1FA 2WTUA 1NNEA 5LPNA 3SYNA 1U8ZA 2ODEA 1R0ZA 4F91B 1XEXB 4HZUA 2X1VA 2V54A 3IO5A 1E2EA 4RKEA 4MRPA 4BZPA 4J0QA 2XD4A 1ZNWA 4A92A 3LW8A 3WMFA 3FWYA 3NH9A 4U5XA 3EIQA 1JLLB 1Q22A 1ZRHA 4G3XA 4QBFA 1XP8A 4JYBA 4ILEA 2A5YB 3WNDA 2IEYA 1YZQA 2OFXA 4TQ9A 5BXQC 4Q4AB 2JA1A 3ADDA 1O3YA 2IS4A 1DADA 3CM0A 3GEHA 3VPDA 1Q0UA 1AS2A 3PEUA 1XDBA 2KE5A 3K09C 1EFTA 3H1TA 3ND8A 2PT7A 1XTKA 4JBXA 3DM5A 1Q1ZA 4BFSA 3WRXC 1SHKA 1YQTA 2PMDA 1II8A 2VHCA 4DEYA 2OBMA 5DI3A 2BHRA 3GLKA 4FXPA 5FUVA 5B2ZA 2O0KA 4UQOA 4LHYA 1W0KD 3LO5A 1WCV1 1FP6A 4RZ3A 4WBNF 3NEJA 5BYJA 4WVFA 1Y3AA 3QEJA 5FI0B 3NBZC 1GVNB 3OESA 1US8B 1KK1A 4X8OA 1ZU4A 2ZI7A 1FX0B 1DO2A 2BBOA 3PEWA 3BB4A 2NOAA 1T0HB 5B58C 4AKGA 1NKTA 1LV7A 2FA9A 3C7KA 3AUYA 3DL0A 3KKOA 3LP8A 3KUCA 3SFZA 3AKYA 1XEWY 1UEIA 2VSFA 1Z8FA 3LNCA 3BH0A 4Q4HB 4F7WA 3U9SA 2QTHA 4M4SA 4WAUA 5EP4A 3VFDA 4HB2A 2YW2A 2IYRA 3HR7A 3Q1KA 4O0MA 5LDDC 3MGCA 2ERXA 5TY0A 2O8DA 3TQTA 4XTRA 1KI9A 2WKQA 1F2TB 2KB0A 3WXMA 5IK2D 5C4MA 2HUPA 2QQEA 1CIPA 3FMIA 4DLVA 3L8YA 2CCJA 1UKZA 1IOWA 4A4DA 2UKDA 2ZU6A 4OBEA 1RIFA 3D6TB 1E4EA 121PA 2VQSA 1UF9A 1XXHB 2OLJA 2QP4A 2VHUA 5ANRB 4EFNA 3UPUA 2BMDA 5EE5B 3IGFA 4BFUA 2N42A 4YMUA 5KOYA 3Q8XB 3EC2A 4HB3A 1ZCBA 1GGOA 3U3MA 2B8WA 3U3JA 4LBWA 4QKQA 5LOVF 1G1MA 4N0DA 4YBZB 4O3MA 2IF0A 1OXTA 3TAHA 1FMLA 3OUUA 2FJUA 5DI9A 2QM7A 1YU9A 2JEOA 5JQWA 2YWHA 1Y63A 5K8LA 2FH5B 4FINA 2BMEA 5DYGA 4EDHA 5EE9A 1V5WA 1YZGA 1ZW6A 3P4XA 1G16A 3G82C 3FKSA 4HLCA 2AL7A 4YAKB 2BKUA 4PC1A 3RRZA 2ZDHA 4Q47A 3RUPA 2VF7A 1N6RA 3RRYA 2VP4A 4YB8B 2E1RA 3TR5A 4OK5A 2QMHA 4V0MA 5JRZA 3O8DA 5JEDA 1GKUB 4TLDA 2BJWA 2F9MA 2PCJA 1MT0A 2P0AA 2FSHA 3EA5A 1G6HA 3L0PA 4Q02A 2ZRKA 2ZYWX 4JLJA 4XX0B 2G1JA 3QI2A 1R0WA 2QAGA 1UC8A 1AKYA 2ZE6A 3PUXA 1NN3A 5FR1A 1MO4A 3CF6R 4B3DA 1G64A 3WNCA 1UKVY 5TXGA 1NJGA 1T36A 1QG4A 1ZC3A 2HCJB 2XITA 2D3WA 1O87A 1XF9A 1H8ED 1G3MA 4L4UA 1E1QD 4K81B 4Q01A 4LOAA 2CE7A 4TL9A 4L8GA 1T3SA 1UADA 2GXSA 1CR4A 1TNDA 2BVNA 3GLIA 2QP3A 1KOFA 2ORVA 2R6DA 4JLKA 4DCTA 1S9DA 1PZNA 1N0UA 1QZXA 2RB4A 3B2EA 3HPRA 3TMKA 3BXZA 4BZXA 2ZJBA 2XZLA 4AG6A 3C8UA 4PZZA 4AYTA 3OEHD 2IA5A 1A4RA 1Z6GA 3D7MA 3K0AB 3W34A 2YL2A 3ADBA 3ONWA 5IYZF 5KYKA 4KVAA 4KV9A 4M21A 4Q1AA 2DHRA 1OW3B 3C14C 3LWNA 4M9QA 1OT3A 3QVUA 4GSYA 2ZR9A 1J8MF 3OEEA 4XYLB 1RRGA 1P3JA 2AWOA 2D62A 2P6UA 1SVSA 2FSGA 2IYTA 3GPLA 4XVRA 1WF3A 1ZNYA 4ZDWA 3W5IA 2BWJA 5JCPA 2AXNA 1TQ4A 3KFVA 1QG2A 5FUYA 4YQFA 2Q3HA 2V7QD 4ZCLA 4UNRA 1IOVA 2XB4A 5AWFC 4RZUA 5BN3A 1OKKD 4PC7A 4OQXA 1N5LA 3NHBA 1KC7A 1HH4A 2H92A 2ZJ5A 3TSWA 1TF7A 2ZI6A 2C98A 4PO1A 3WNZA 3RS5A 4DCSA 4B3GA 1S2MA 4C3ZA 3SYLA 3P1JA 2Q3MA 1L2TA 2IYYA 3MJRA 3WYGA 5GONF 4JBWA 4EJSC 2Z4SA 4QBHA 3WY9A 4MKFA 1YZTA 3ZLJA 1JECA 1ZVQA 3RS2A 1WA5A 5L3VA 3MWDA 3B7GA 3AP1A 4JLAA 1OXVA 1EESA 4KFSA 2WICA 3R8FA 2JGNA 1S8FA 1FMJA 5KPDA 1Q44A 3AKCA 3AP2A 2C77A 4M1YA 1FQKA 3BOSA 2G6BA 2RHDA 1NBMD 3CH4B 4DDVA 3THOA 4ZKEA 4QL3A 2YWGA 1DPFA 3QJYA 4M9UA 3REGA 3LWBA 4KYUA 4CW7A 3NHAA 3AVUA 4TYPA 2GJ8A 3QENA 1CQJB 1P7CA 1PLJA 3V4FA 5F98A 2ZEJA 3E5HA 2JATA 2NO6A 2NPIA 2NTYC 3LH5A 4DHEA 3QXHA 3CPHA 3THWB 2VR1A 3PEYA 4P4TA 3U5ZB 3REFA 3GFPA 3GJ7A 4HYYA 3AVXA 1YRBA 1XCGB 2WSSD 4MKGA 3RYTC 1R0XA 3JRWA 2ONKA 4D2IA 4D26A 1GZSA 4A8JC 2R2AA 2G88A 3KZ1E 4RD1A 4TLAA 4YDHB 3PR1A 2R7NA 3SBEA 3X1YA 1NSTA 2VRWA 2O8EA 2YOFA 2AN9A 1PJRA 3LA6A 1ZMXA 2W6ZA 1CS0A 5LB2A 3MG9A 1QHSA 4YAJB 4TTPA 1KI2A 3BB1A 1VG8A 2QPAA 4K8OA 5BW8A 2Z83A 3HYRA 1EFHA 3QEOA 1W4AA 5KU1A 4AKIA 3ZZTA 2IHBA 5JBQA 1K5DA 4QRHA 2YS6A 4CEHB 3K5HA 2GTPA 3A58B 5LD2B 4C7OA 2DFNA 3VX3A 4KLNA 1NG1A 1KBLA 3O8RA 3FMOB 4ZCMA 1G20E 4FMCF 2G83A 3T15A 3RS4A 1ONBA 1JB1A 3BERA 1GKYA 2EFHB 1TTTA 1M2OB 1XZPA 3MWKA 3KKQA 4KFUA 3IQWA 4IVPA 1UBEA 3RVBA 4ZHQF 4TV9F 3K5IA 4KAXA 1OYWA 3LRPA 4YMVA 4P32A 1H8HA 2ZRCA 4X8LA 1ZNZA 1C4OA 4I4LA 1JDEA 1P62B 3MFYA 5CK5A 1KI3A 3I72A 5CDFE 5DIFA 2GEDA 3CF0A 1K8RA 2N46A 2QK4A 1E2IA 2HT6A 3AGPA 4NYJR 1G8PA 2IWRA 4B47A 5KTYA 3R23A 4Z1MA 5AJYA 4P33A 1Z22A 1G41A 3NKVA 1E32A 3QBTA 3RDPA 4F4JA 1KMHB 1S1CA 2WWFA 4RJLA 4ON9A 5EZYF 1RZ3A 2QEQA 2RGCA 4B34A 4M1WA 1SXJB 5FTNA 3X1ZA 1Z07A 2FX3A 1COWD 4MGZR 5C18A 1TEVA 1RC8A 3OFND 3TH5A 1WXQA 1Z29A 2D7CA 2JDID 4O2RA 3OAAD 3ICEA 1U94A 4IOMA 2YZGA 4RCZA 4B33A 5C1PA 2Q9AA 1YR7A 2VBCA 2ZSBA 4Q4JB 4Z8XA 1XTRA 4TMTA 3K9HA 4RVCA 4GRAA 3QG1A 2QMEA 1GSOA 1Q1QA 5FOSA 5C4GB 3UWOA 4JLNA 1RW4A 2Y8EA 1ODFA 4PC2A 2J59A 3LQQA 3IDQA 2AR7A 2RGNA 4NL4H 5BN4A 4NCNA 1VYUA 4MDEA 2FPPB 2QENA 2QT1A 4HLUC 4JLOA 4LV6A 4PSAA 5E7JA 3SOPA 1QVRA 3OEHA 4BEJA 5IRCD 2PLRA 2J0UB 3WBKA 4B48A 1ZIPA 3F8TA 4OJKA 1IXSB 1OSNA 3QF4A 3FGNA 1JKJB 3ETHA 2YJTD 4HATA 3QKSA 4MITA 3Q2OA 1GL7A 2HF8A 1W36B 3M4YA 3H86A 3DO6A 4EGQA 3TK1A 5EXTA 3MMPA 3WMGA 1PK8A 3W9YA 1P75A 4G5GA 4IWYA 3G5UA 1RPZA 1J8YF 3BFXA 1MH1A 4ME6A 2EWVA 2V7QA 1XD2B 1R0YA 1M34E 5BWMA 4TZ6A 3GJ5A 3KFXA 4LJ8A 4GFDA 3WO1A 2V6IA 5A0FA 5EP2A 3AF2A 2ZVQX 3E2IA 3QQ5A 5JVLA 3SN6A 2EVWX 3QG5A 2IS2A 4B76A 1RRPA 5J4LA 1R5OA 1BYIA 1XEXA 1GL6A 4LZZA 2G9NA 3SNHA 4TV8F 2BCJQ 5FTLA 3B60A 4A6PA 4URYR 4MA0A 4TMZA 3V00A 2DY1A 1KZ7B 1BNCA 5CDFA 1XX6A 1E2LA 1HYQA 2BOVA 4Q4AA 1JEEA 2O0JA 3KXIA 4JVNA 5SZKB 2H57A 2FFHA 4PHTA 1NIJA 2MMCA 4ZOLF 1M6NA 1NG9A 2YWEA 3ZS8A 2GKSA 2RGAA 4DIDA 5FH9A 5F9FA 4IEEA 4NYJQ 1YKSA 3LFUA 2VP0A 3EIEA 4ABYA 4QOSA 3U44B 1WBDA 5ELXA 2Z43A 2J7PD 4PPGA 1Q57A 2GNOA 5SZIA 1JXOA 2WKRA 5KHOC 1ETUA 2CVHA 4NH0A 3I32A 5EP3A 3K70B 3KQKA 3CZPA 4O2BF 5KSPA 2XNSA 3ZD7A 3ASYA 4JLPA 1KSGA 3B5JA 1IQPA 3QKTA 4KBFA 3PXGA 3TNFA 1VKJA 3T06B 1TQ2A 1AJEA 3T1TA 4A2QA 3VHLB 3T5GA 2AD5A 4CZ2A 3B9PA 1CR1A 4I81A 3GD7A 1FX0A 5B30A 1LFDB 4XWAA 4MRVA 1HT1E 4ZI3A 4PAOA 2BKEA 2BIFA 2PJZA 3GFOA 3EIHA 3NWJA 3EWAA 2QRZA 3E70C 2GEUA 3THXA 3PQCA 1BO6A 4Q4HA 1DAFA 3L43A 4XH9B 2XXAA 2O8FA 5AJXA 2GPSA 1E0SA 5LXTF 2GCNA 4C5CA 2R62A 2JAQA 1EWQA 1ZINA 4XVQA 1E2PA 5B64A 1LW7A 1TMKA 5AUQA 4A2WA 1G7SA 4M8NE 4URVR 4B32A 1MKYA 1W4CA 5J2TF 3QKUA 1WBBA 1R10A 4NDZA 1KSFX 4P0TA 5FTMA 4RZXA 1IONA 4HQ6A 3K0SA 2DLNA 1GNPA 4G01B 3RS0A 3U9TA 2QL6A 2DFKB 3GJ3A 3A6PC 4W9MC 1T91A 2IYVA 4DWJA 2R6CA 2DIKA 2PBZA 4QNRA 2NZJA 4CEIB 1AGRA 2W6QA 2FDCA 3TUJC 3CRVA 1Z0KA 3RFCA 5FPTA 3QUSA 2Q3FA 4LK2A 4MRRA 3L0OA 4V0KA 3UK6A 1JNYA 621PA 2FMXA 4MGIR 3SZRA 4ARZB 3A8TA 1RYHA 4JIMA 2IX3A 1IAQA 2P5SA 2W00A 3HJNA 2CLCX 3N8DA 1AIPA 2OESA 2R87A 2GEVA 2CNWA 1QHGA 2ZRLA 3RV4A 3KB1A 3WYAA 3U4QB 2WV9A 2MMGA 2JLSA 4N3NA 4P4SB 2ZYTX 4GOJA 2NUAB 2OHFA 3FE2A 4BWYA 1M7HA 3TAUA 5GADl 5JJLA 1IXRC 2WVJA 1NVXQ 4ESVA 4F4CA 1DAKA 1CRPA 1GRNA 3OF5A 4RD2A 4WBSA 3IILA 1WB9A 1ESNA 3I4LA 4PO8A 4Q1CA 1X8KA 3JVUA 3EAQA 1EFCA 2W71A 1GRQA 4HB4A 3O8CA 3KKNA 3ORRA 3IPYA 1E2DA 2ZJ8A 3CWZA 3CLVA 1Z47A 4C0KA 3AUXA 3BK7A 2Z5FA 4IJMA 1ZD9A 4AG5A 3B78A 5JMTA 5BN5A 4FWTA 4WOPA 4EQ6B 4IXMA 3FOZA 3B9QA 3MAAC 4D4JA 3FKSD 3A4NA 1NLZA 2A9KA 2EFEB 1AUVA 5HE9A 2HF9A 3RWOA 1AK2A 2UZ3A 3AF1A 3DMDA 1FPMA 2VQDA 2F1RA 4DDUA 4XWOA 3U6KA 4JJKA 2BBWA 5GVSA 2IYQA 1G5TA 5KNDA 4JLVA 1KK2A 4M1SA 3IBYA 1DBSA 2Q9BA 3X1DA 1E6CA 2ATVA 3R7WA 1MABA 1XCMA 2XCLA 3ECCA 5D3MB 2QPTA 1ZM4A 2ZUCA 1TQDA 3T34A 4QGHA 2C2HA 4HLDA 2A7QA 4HNVA 1XTQA 1DTSA 4YC7A 4TYQA 4UKDA 4I50F 3RANA 3SBDA 4BFTA 3BH7A 2JJ2A 3CRMA 3BJIC 4IDQA 1N6IA 2LWIA 4F92B 2QU8A 1XMIA 1BXRA 2RGEA 3I5XA 1MV5A 4GP6A 1CBUA 2YRWA 3TINA 1I4LD 5J40A 5JS8A 2D06A 2OG2A 2DWOA 2YNMA 1OJLA 1YRAA 2ZETA 1GLVA 4QJ5A 5EQTA 3NBYC 3EA0A 2BC9A 1R5BA 1X6VA 5G3ZA 4LYJA 4JS0A 1SZPA 4TLEA 3DKPA 8OHMA 3ZD6A 3AQ4A 2DWCA 3MUFA 1X1SA 4D81A 1L8QA 2D4HA 2O52A 2ZRJA 4JSTA 4NONA 4DRZA 3UMSA 4LRWA 2GHIA 2V3CC 3QBVA 3OEED 2ZM5A 4TYWA 4IVQA 2VTKA 4MYTA 2YZ2A 3THYB 3SE0A 2P5TB 1E2FA 1KDPA 1XU4A 2ASEA 3VNUA 3CBQA 1R5NA 2JCSA 4C0BA 1KJZA 3TBKA 5E3HA 4C0QC 2QT0A 3I73A 1KO4A 4XSGA 4NYMQ 5A4JA 3HPQA 1K6MA 4DSOA 1KI6A 5J4YA 4A0FA 2NU8B 1G7TA 1TPZA 3HU3A 1U90A 2YC2C 2ZS8A 2OCAA 1AKEA 3GLHE 1KK3A 3R5HA 3RC3A 3LQRA 2RAPA 3RC8A 5C8YF 2RGNC 3K1JA 5FFMA 5HKKA 2G3YA 2OBNA 1NLYA 1X1RA 4FCWA 4KSCA 3NDBB 4Z54A 4CEJA 4FMDF 4WW0A 5DGXA 5DLQC 1Q1EA 2H1LA 1KJWA 4DXAA 2HT1A 2ZREA 4URZR 1D2EA 4MV8A 1X86B 4LC0A 5IHPA 1CJMA 3B8HA 3M0EA 2ZRHA 3C41J 4H9GA 4NCHA 4P3YA 3AM1A 2EFDB 3BORA 4TQUS 1KDOA 1XMVA 3KL4A 5JFGA 4QFMA 4MRSA 4KHZA 1W47A 1E0JA 1E9EA 1ZNXA 4Q1EA 4FD2A 5E7MA 3A37A 2V8OA 4ZDKA 2V4ZA 1F6BA 2NQ2C 5EZ6B 4OI0A 3VNVA 2R85A 2ZE7A 4EPRA 4IDOA 4V0ME 2CQYA 4DEXA 1Z0JA 1TL7C 3FHTA 3UG7A 4FN5A 2HCBA 1IBRA 4ZO4A 1YHNA 3PCRB 2W58A 4CYMA 3ADCA 1SVKA 1FNNA 5JJKA 1LF5A 2VP5A 2WIBA 5C1BA 3T1VA 2VP2A 4YONB 1OH6A 3AVTA 1JJ7A 2GESA 2Q0HA 2QGNA 4PC6A 2XTMA 3W8NA 2J46A 2GDJA 1G7CA 3D3QA 4MGKR 2NGRA 2YYAA 3SI7A 1B6RA 1XTIA 2H7VA 2W2TA 2ZSAA 4PC3A 5M04A 4CIDA 4YLGA 4DSUA 3GLIE 3U3OA 2NU9B 4C5BA 3WNBA 1JXMA 2I87A 1XRJA 5JLJA 1KSHA 2VEDA 4DIEA 3EWSA 2QP9X 4LC1A 3V4RA 1ZP6A 3GJ8A 1KNXA 2ZQ5A 5FL3A 5IT5A 3VAAA 3WHKA 1GG2A 3B1XA 2ANBA 1OE0A 4HUQA 3RS7A 1XFAA 1D5CA 1AUXA 4IWXA 3WHLA 5L3SB 4XYMB 3O8BA 1MO5A 3WRYC 1KKLA 2QSYA 1GILA 1OH5A 2J5XA 3QKRA 2PT5A 3R8CA 3BB3A 4B75A 2F43A 2CL7X 3ETLA 3C5HA 4URWR 3S1AA 4HB0A 1VG0B 5E4FA 4I1UA 2ANCA 1VMAA 1EHIA 4DLUA 3P20A 3PUWA 3K3PA 4HAYA 1KZGB 2W2XA 3TGPA 1SVIA 3Q7PA 4E22A 4QBIA 1P2VA 2X77A 3BGWA 3DEFA 2OCYC 3GLHA 3AVWA 2FP4B 2X8AA 1IY2A 1X8JA 2IYXA 2VSOA 4N0EA 2AK3A 1VKZA 1G9XA 1XNJA 4M1TA 1JAHA 2QM8A 1XEWX 2P65A 2WJJA 1JEDA 1H8HD 4GOXA 4YJ2F 3AV0B 5B57C 5KDDA 2OCPA 2DFTA 2FEMA 1KDRA 4PR0A 1OIXA 3TLXA 4IDPA 3L2OB 3QIAA 3RHFA 4ZIRA 1DIKA 1UC9A 2PCLA 3M1IA 1SULA 1ZJ6A 4IZOA 2H16A 2GJKA 4HAXA 4RFSB 1YJ5A 4Z1MD 2CBZA 1VBGA 4US1R 3KQLA 4Q9LA 4TYYA 2PMKA 1M74A 5FUWA 4AY2A 2BDTA 4XVUA 1W0JA 4FI3C 3CF2A 2GCPA 4LSGA 3JZIA 1CR2A 2DPXA 4DJTA 1OFHA 3TJZA 3W6NA 3MCAA 2XAUA 4Q19A 4A0GA 4JZKA 2B92A 3EZ2A 4BPBA 4R98A 4MAMA 2D2EA 2ZRMA 4RFVA 2OILA 3VMFA 2KI5A 1T3HA 1G3IA 3KQUA 1E98A 1DAMA 2P67A 1G21E 5FOTA 4C5AA 4M22A 1UBGA 1KI1A 1S3SA 2IC5A 4GZMA 4B43A 5EUMA 3OIWA 3LBNA 1NVWQ 5DN6A 2PEZA 3TW4A 4PANA 2SCUB 2W0SA 3FHCB 1GSAA 5JH7F 1N6HA 1GAJA 1MO6A 2OT3B 1C3OA 3EZFA 5H70A 4A6XA 3FFAA 3K0FA 4PAMA 1KJYA 3LX8A 3GLGE 2CK3A 5DNYB 5CAEB 3OZXA 1AQUA 1ELOA 1YZKA 3QNUA 1CQIB 4ZDJA 3SR0A 3X2SA 1GIAA 1NN5A 3TQCA 1G8YA 4JBYA 5AJZA 1TF5A 3HB9A 1QVAA 2JASA 1WRBA 3L8ZA 2O8CB 2ZUDA 3H4MA 3U7GA 4DC9A 3BBPA 3IPXA 1JJVA 1GNQA 2AD1A 3NXSA 3D8BA 1W5SA 1I2DA 3RLFA 1KAGA 1W7AA 2QZ4A 4EJSB 2IF2A 5CA1F 4HNUA 1CS4C 1JR3E 1AZSC 1KNQA 1JQLB 3VQTA 2DWQA 1EG7A 1NIPA 3IBGA 2ZTSA 1W46A 5TV2A 1XBTA 1NMXA 3QSYA 1L4YA 1J70A 1OXXK 1TAGA 3OUZA 4R2HA 2J9GA 2HYIC 1F3OA 2WWWA 4BEBA 2AKAB 1ZBDA 2BBSA 3N5CA 3QXXA 4G1UC 4TTQA 2NPFA 3CNNA 1XJCA 1ZIOA 4JVMA 4L16A 4TLCA 3UIEA 2QQ0A 2FGKA 5FTJA 4DLWA 4PAQA 2B7CA 4BFXA 4HEJA 1DG1G 1QHHA 4DSTA 1XEFA 3HDTA 5KNCA 2ZYVX 5SZHB 4OKSA 5DYIA 3VKGA 1S96A 2H5EA 3PITA 4JLMA 5K8TA 1JAIA 1LS6A 2OBLA 1DV1A 1KJ9A 4US2R 2UVQA 1II0A 1HURA 2GBLA 5FBQB 1HE8B 3KKPA 4MDFA 1P2SA 4TLBA 2ZJYA 3QXJA 1YZLA 4LYFA 1S4QA 1SGWA 2VL7A 2G1KA 2XSZA 2CJWB 3D31A 3MSXA 3OIVA 4Q9JA 3EPJA 1VECA 2O5VA 4RZ2A 3KJGA 4A8JB 1TUEA 3AP3A 4JT2A 3SHWA 2P6RA 3CUEF 2J41A 1ZD1A 3MLEA 5TARA 1OF1A 4OK3A 4QHSA 2VA8A 4MYCA 4S35A 2RCNA 2WWIA 4WA7A 4HNTA 4IHJF 1GUAA 3A36A 4MA5A 3ADKA 1W93A 4Z51A 3MWLA 5KUTA 1E94E 4TL7A 2BEJA 1QHIA 1N6NA 4CEIA 2PN1A 4II7A 4TL6A 2C8VA 5AK0A 1GP2A 4V02A 5JSZB 2EWWA 3IIMA 5F3WB 3GLGA 3QE0A 1IN8A 4Q48A 4BLPA 1PUJA 4LHWA 3BAFA 2XZPA 1N5KA 3A4MA 2PBRA 1FFHA 3GJ6A 4HI0E 4CT5A 3NG1A 3VPBA 1ZM3A 2GETA 1Q12A 2GZHA 4DLXA 3U4QA 3N2IA 2GPWA 4LJYA 4TMVA 1RJ9B 2C96A 2F9LA 2X0SA 1F5NA 1UPTA 2J0QA 3IHWA 1Z6XA 5CM8B 2IHYA 4DT1A 2WZQA 2ZRGA 3CO5A 3T1QA 1JR3A 1AGPA 1A82A 1VDZA 4HDOB 4WXRA 5AUPB 4FIDA 2NO9A 3GLFE 2ZI5A 2Q21A 4PQFA 3DOEA 1II8B 5EUQB 4F93B 3RRMA 5DI3B 3KUDA 1Z6TA 1BYUA 1E79A 4IEIA 5DHFA 2OEPA 4KFRA 4QGAA 4C9BA 4GPTA 2FPKA 3CNOA 1F2UA 3LLMA 3ICQB 4EQ6A 2CNWD 4LBVA 5FPSA 3AF4A 1NLFA 2ORIA 3NVAA 4URXR 1DV2A 4KO8A 5FR2A 4E4TA 1G5RA 2DWPA 2F1JA 1E4VA 3MJFA 1FUUA 1W48A 1E2HA 5IDVA 4TT3A 5JWOA 1Z08A 3I92A 1P9NA 4OQFA 1CP2A 5CYOA 2O8BA 4W7SA 4YXWA 3OHMA 5CIWA 1BS1A 4M53A 4WZBE 3VU9A 4G5OA 4C2UA 1EUCB 1UAAA 5JHGB 3EPLA 4FWIB 2FFQA 3J81k 2CLDX 5FOUA 2RGBA 2WPDA 4OQLA 2O8DB 3GMTA 4K46A 4RD3A 1J7KA 5FBVB 1P2UA 1W1WA 2PEYA 3EASA 4B3CA 4OHVA 2ZSDA 2FE4A 2VPPA 1W44A 2C9YA 4DLSA 4XD7A 3ZZUA 1TQ6A 2FPIB 5TB5A 3CRQA 1TU3A 4L5BA 4RY2A 3LXRA 3RABA 2JJ1A 4R2IA 1PX2A 2QTVB 1E4EB 3SYKA 5EJEA 1SKQA 1T9HA 3H84A 4MQBA 5BMVF 2FN4A 2FU5C 3EPKA 3SHFA 4E07A 5JJIA 4GZLA 4B71A 1X8LA 1U81A 2IS6A 4U7DA 1IY1A 3UMRA 1Z83A 4IFEA 1KJQA 1E1RA 2ATXA 2JIZA 3CKLA 4LJAA 3EX7C 1MRNA 2FZ4A 4AURA 2A30A 6Q21A 2GCOA 4BRWA 2B6HA 1YR8A 1TF2A 3T35A 4XTCS 5D3QA 2I3BA 2IXFA 4IDNA 2AX4A 4Q03A 4AK9A 3F0TA 2IEZA 4LYAA 3KKMA 5EXSA 2JJ2D 4EIWA 1E2GA 1HT2E 2ZS9A 4TSFA 4MV3A 1KY3A 1NVVR 1VIYA 1ZM9A 2WKPA 5JWRA 4NBSA 4C30A 3T5DA 1IXZA 3JZAA 1XXHE 3B1WA 4ACBA 3GLFA 3Q72A 1HUQA 4UXIA 2OZEA 4AD8A 5JCZA 2F6RA 4PSKA 4E09A 1G3UA 3EPHA 2EYUA 4AKHA 4Q9HA 3IEVA 1UEJA 2F1HA 2V5AA 2YVUA 4HSEA 2HJWA 2IYZA 1ULZA 4E03A 5KSZA 5GJVC 2DR3A 1SVMA 4JL6A 4QM6A 1NN1A 1VIAA 2H18A 1S0UA 1G7RA 4OHXA 2ZSFA 1JBKA 4Q7JB 5L3QB 3B1YA 3GLIB 4ZCIA 4B3XA 5J4KA 2REBA 4FCVA 2QAGC 2OM2A 1W96A 1U0LA 1VG9B 4JT4A 2HDNB 3W90A 2C03A 1LTQA 1G4UR 1ZUIA 3ND9A 2XNDA 4KJZA 1DAHA 1GFIA 2MSEB 2OSBA 1QHNA 2Z4RA 4KODA 4MH0R 3A1VA 3KDSE 1SQ5A 1W5TA 2OE2A 3DHWC 4TYNA 4GDFA 2QTFA 1E3MA 1AZTA 3KB2A 4PZLA 5HKKD 5J4HA 1MO3A 3BC1A 4NYIR 4NCIA 1SVLA 4AYWA 4LBZA 1P5ZB 3P27A 1FP7A 1VCOA 2BMJA 1KK0A 1US8A 2H8KA 3IHLA 1IY0A 3IO3A 4QXAA 3P4YA 3R5FA 3RSLA 2W0MA 2YOGA 3SEAA 2WWYA 2W6NA 2ZI4A 3LV8A 5LA6F 2CL0X 4CRWB 4EPVA 1YVDA 2ODWA 2ZANA 1EFUA 2V6JA 2GLTA 3E5NA 3TIGA 2BBTA 5JS7A 4LJ5A 4B2LA 5KSOA 4AIIA 2EFGA 2ZJOA 5J4VA 2R9VA 2OAQ1 4WZ6A 4EPWA 4UXJA 2KSQA 2PZFA 5C46F 2BEKA 2WJGA 4JVSB 2IT1A 3DVLA 4Q9KA 2YINC 1P2TA 1FTNA 4I1VA 1I7LA 1PLLA 3LBHA 1F48A 4JVLA 2P3SA 1HQCA 1F2TA 3WBJA 2WSMA 2ZI9A 3Q5DA 1GKIA 4TL8A 3ZVNA 2O0HA 2WWHA 1HY3A 4LPKA 5C2JB 1WQ1R 3FKQA 4B3FX 2V1UA 4Q00A 4FMCB 2ZE8A 1W4RA 1BMFA 1OLOA 1XXHA 4OQMA 4XJXA 4ESHA 2R82A 2ZJZA 3UMFA 4UJ5A 1OXUA 4MKHA 5K8IA 3EC1A 2VHQA 2QPOA 2VH5R 4D0LB 2FG5A 1E9AA 3T12A 4XIGS 1IN7A 1NVVQ 1DG3A 2QSZA 2ERYA 2RH5A 3AF3A 4LBYA 2JLUA 1E9RA 1W2GA 4EAQA 1D9XA 2GBLC 4O2LA 4M0LA 2ZITA 2C78A 3KJEA 4KI0A 1D9ZA 3RSOA 2FF7A 1T4GA 1ESMA 4M9ZA 1ZM2A 2AHOA 4LYHA 1ANKA 4LDJA 2HJVA 4DUGA 2YV5A 1SVOA 1CJTC 2RGDA 3PFIA 1Z28A 1D2NA 5H80A 4Y0VA 2OCBA 2OXRA 5KX5F 5K2MA 3AF0A 4HZIA 4ITRC 1FW6A 3W6PA 3SJBA 5L8VA 1NRJB 2O8EB 1R4AA 4PPFA 4O4LF 3SQXA 1OB2A 3F3YA 4IOKA 1W4BA 2GVZC 1DS6A 4GI7A 4Q1DA 3SC3A 1KJJA 3VMMA 2NIPA 2I1QA 2R6FA 2ZRPA 4PSVA 1ZUHA 1NMZA 2Q9CA 3ZS9A 1S1MA 1G291 3MRSA 3A1UA 1YR9A 4LPSA 5UKDA 3SJAA 4OK6A 2GF9A 2FSIA 1FUKA 1Q1BA 3C16C 3GQBA 5F2EA 4C7OB 2XOKA 2NMVA 5CA0F 5DE3A 2CHQA 3GEIA 2L0XA 5DH9A 2XZOA 2IK8A 2EYQA 5H68A 3OIUA 1EK0A 4XZ3B 2IBMA 1U98A 2BMFA 4NYIQ 4AKEA 3G0HA 1E0AA 2NO1A 3EZ7A 3OE7A 2G0NA 3GJ4A 3U7HB 1QHXA 5J2UF 2AWNA 1T3LA 4FMBB 5JHHB 1U8YA 1W0JD 4LX0A 3K0AA 2EQBA 1RKBA 1GITA 2ONJA 4IHQA 4BECA 1EYZA 1JALA 1IHUA 3K9GA 5FBRB 3GEEA 3DMNA 1P4SA 5BYKA 3RWMB 1E9DA 2X2FA 3B1ZA 3PEVA 1I4DD 2FPMA 2V59A 2YWFA 1OB5A 1SVWA 2XX3A 1NY6A 1Z6AA 3CW2A 5E95A 5CK4A 1Z3IX 1M7BA 4ZI7F 3C15C 3K9NA 1WR2A 3V9PA 3NBXX 2RKOA 4P31A 3EXAA 2EFCB 2PJRA 4BLOA 4DBLC 1UM8A 2P2LA 5FOXA 1G8HA 4U00A 5DN6D 4B73A 4G0NA 3FB4A 5HTKA 3AB3A 2ZDGA 2GRJA 1CXZA 4Q4LA 5JWHA 2DCUA 1T8UA 2CZGA 2YRXA 2C9OA 2ZIAA 2EW1A 3KJHA 1GWNA 1Z0IA 2CK3D 1E4YA 2E9SA 2ZPTX 1H65A 3NC0C 3PG5A 4JLBA 4ZKDA 4JL5A 2V58A 4FU0A 1AA9A 3GFTA 4TQAA 4DKXA 2QMOA 1G18A 2J9RA 1DAGA 5FBWB 1T5LA 4BASA 1VYVA 2BCGY 2V1XA 2I80A 1DE0A 2XJ9A 3M6AA 5G53C 3SQWA 2J1LA 1I2MA 1VYTA 3FMFA 5P21A 2CLSA 3QVVA 1MOZA 2ODNA 3WO0A 3LBIA 3SU8A 3ZYCA 2HV8A 1T0JB 1WP9A 1G17A 1GSHA 1B6SA 3QKSB 1U0HC 2VHTA 3MWYW 4TTRA 2CVFA 2QI9C 3QF7A 1OH7A 3RRNA 2DBYA 3SE7A 1P61B 2VP9A 3LVQE 4A8JA 3JRXA 2Z6VA 3EW9A 1TX4B 5HE8A 1ZYUA 4D80A 4EKDA 4EG0A 3THWA 4BZQA 1OIWA 2AFIE 3WMEA 2GWHA 3SJZA 5KSYA 2ZRBA 3FVQA 1TEXA 2ORWA 3WYFA 1G8FA 4TN1A 3GP8A 3TUZC 4DLYA 1NN0A 3GJ0A 3KJIA 1Z63A 3VHXA 4Y0AA 721PA 1OHHA 4L9SA 2HLDA 3KTAB 1J2JA 1U99A 1QBKC 1KEEA 3JZMA 4X8HA 4Q18A 5JSZA 3L0IB 1DAIA 3DM9B 2VO1A 2ZRDA 4F4IA 2NO0A 1G4AE 1LNZA 4A0RA 1B0UA 1XPUA 2XSZD 5LYJF 3QOFA 3ZH9B 2CCKA 3DPUA 4CEHA 5LBIA 1KI8A 2VHJA 1A1VA 1CULC 1YE8A 4D4MA 1RJ9A 1CU1A 4L15A 1CR0A 3Q3JB 2W6JA 2XB2A 2PL3A 3FFBA 3SJCA 3BFKA 4QJ3A 3X1WA 2ZRNA 3BH6A 3DDCA 3LXXA 1M7GA 1SHZA 1KGDA 5GVRA 3HYTA 5JECA 4CVNA 2FPLA 2ZAMA 4C0AC 1DELA 4DB4A 3SDZA 4JKIA 1N6KA 3FHOA 4DSNA 2WWXA 1UFQA 4IRUB 2QBYB 1IJFA 4L9WA 1LS1A 4O25A 2LCFA 3DOFA 2WJHA 4OL0A 5FTKA 3TIFA 4ASUA 3TRFA 2F1IA 4LJ6A 3R9WA 2B21A 2XEXA 4TMWA 3ZJYA 4TZ0A 3R5XA 2WMNB 2GJSA 3P26A 3X1XA 3MD0A 4OJQA 2ZAOA 2P0EA 3Q7QA 4C0LA 4OHYA 2BJVA 4NKRA 3ORQA 3TVTA 1KMHA 1YZUA 4PZYA 1OFUX 1KYIA 4BFVA 1ZC4A 5EP1A 3THXB 1JR3D 1M8PA 1NMYA 2IP4A 1OIVA 1SXJA 2W6IA 3F5FA 4X8MA 3K70D 1VG1A 5BPFA 2QA5A 5AUOB 2XXAB 1EX7A 2O8FB 1U9IA 2R6AA 4W5WA 1P73A 5CYPA 2R7MA 1JI0A 2YZNA 1ZM7A 3O47A 4QBGB 2J0SA 4LUCA 4NCKA 4RD0A 4Q9IA 2CMKA 4Q4JA 1XD9A 3TSZA 1E79D 4HLUA 4A15A 2GXAA 4O4IF 1K5GA 5KKNB 4IOLA 4JL8A 4RD4A 1A7JA 1N5JA 5AR1A 5FI1B 3UANA 2JLVA 3U60B 3IUYA 1D8TA 1HQYE 2EU8A 3VR1A 3KXLA 4IDHA 3LLUA 1Z06A 3ZGXA 4C4PA 2TMKA 2ZSEA 3BFVA 1N6PA 5CIQA 4EPYA 4DVGA 3RAPR 3TIIA 1IJEA 4EFMA 2W83A 5HBRB 2FV8A 1EX6A 2MSCB 5I47A 3VR5A 1C9KA 3ZIAA 1EUDB 4GMDA 2OFWA 3BE4A 4MGYR 4TT3D 4BFZA 4DCUA 2J0UA 4Q5IA 5LB4A 3PJRA 4UXHA 3CRRA 5CJ2A 2YOHA 4QM7A 1EFRA 1OFIA 2JLXA 3CX8A 3HP1A 4NPHA 4YXWD 3AVOA 1DO0A 2CXXA 3FTQA 2I4IA 1VCNA 3VKWA 3A4LA 1E9FA 1E99A 1QRAA 4C0SA 3CR8A 1KKMA 2IW3A 1A2BA 3T1OA 4NU0A 1UJ2A 1FL9A 2VSXA 2ZU0C 3A1WA 1FZQA 4PHGA 2WPDD 2QE7A 3B85A 3CRW1 4CT4B 3CZQA 4DLKA 2QORA 4GMXA 2UZIR 1N3BA 2VLIA 5FPHA 4BE7B 2HJGA 1NI3A 4LGMA 4YMWA 4QJ4A 4NMMA 5F9HA 4XD7D 1VBHA 1N2CE 1XD2A 4QHTA 2YC4C 1P9RA 5HCNA 5CB6A 2JJ1D 1GL9B 1XTJA 2ZVPX 2WAYA 5FBLB 2OUKA 4C0HA 2OAP1 2ZUBA 3NIBA 2FB9A 5BQ5A 2ZRFA 5H1YA 3I62A 4TMXA 2RHMA 1DAEA 2FFBA 2OO7A 4OI2A 1G6OA 1E1RD 1JQJC 1T5IA 2JIZD 1QHYA 1A5TA 1FQJA 3DZ8A 3U3KA 1N5IA 2B8TA 3TUIC 4PPQA 5L3QA 4JLDA 1LF0A 2ZR0A 1U8AA 4LJ9A 2MSDB 2R7KA 4HAWA 4IXNA 2XJ4A 2WJIA 3TE6A 3ETJA 4Z8YA 5FL7A 1KHTA 5IF9A 1LB1B 2R65A 2PH1A 1R6BX 4HAUA 1QF9A 2QMUA 2AKYA 2GVDC 4S2EA 4TSFD 3K0CA 5KPJA 2QRNA 1KDTA 4Q66C 4W5HA 2D7DA 3L82B 1TUIA 3U44A 5CB8A 3DKVA 4D4KA 3LDAA 4LHXA 4BUJA 1SKYE 3FPAA 4OI1A 4DDWA 1OPXA 1U0JA 4PTLA 5EZ5A 1MABB 4UNNA 3R7WB 1E2NA 2X2EA 4D82A 2W6PA 3E1SA 3AVPA 4FMDB 3W5JA 2V9PA 3MWJA 4GNKA 3UKDA 2PX0A 4NZYA 1HEIA 1XD8A 4RSGA 2I8CA 2NG1A 2GZAA 3TR0A 1V43A 1W2HA 3NBFA 4NE2A 1EGAA 4C2TA 5G41A 1JPJA 2ZDQA 1EZ1A 3W6OA 2ZXUA 5CB4F 4KBGA 4Q7LA 1KI4A 2A5DA 2ZYUX 2G0TA 4FCTA 4HAZA 3UXMA 2FEOA 4MV1A 3CONA 2A78A 1PLKA 4LV8B 1PVOA 4AYXA 3U7EB 1AS3A 2ZROA 2QAJA 2XNDD 1Z6YA 4KYIB 1N6OA 2GF0A 3B6EA 3A1TA 1T6NA 3TKLA 2JLZA 5FPKA 5GJBA 4Y8VB 2KBFA 2CCGA 3HWSA 1BKDR 2D74A 2H17A 4FW9A 4UJ3A 3VR2A 4Q7KA 2FPGB 4M2LA 1A9XA 2IL1A 1E0KA 2CE2X 2NU7B 5FOWA 2OXCA 2W6MA 4MKIA 1DOAA 1KMQA 2WOJA 5AUNB 1G5PA 1X3SA 1CJUC 3QY0A 3JVVA 2B7BA 2LKDA 4GOKA 1KI6B 4KFTA 2X19A 3EARA 4NP6A 4CGZA 1MR3F 2J45A 3ZDQA 5HZHA 4O4HF 4OHZA 1T8TA 4B6EA 4HZUB 4ARZA 4PQRA 4B74A 1W0KA 5JI3E 4CEJB 3CIOA 221PA 3PUYA 4A9AA 2GJAA 1CLUA 3AKEA 4HDCA 1XMSA 4PPNA 3KQNA 4Q1FA 2PZEA 1UDXA 2IXGA 5DISB 3ZVLA 2ZS7A 3ZVMA 3WP1B 4MV4A 2HEIA 1RRFA 4P4SA 2QY9A 3TQFA 1UKEA 4KU4A 4EFLA 2W70A 4YMTA 1C30A 1VHLA 2GAOA 1BMFD 5CJPA 1E9BA 3BG5A 1NSFA 3WP0A 5D8DA 3LY5A 2PVPA 1Q21A 2W2VA 2FGJA 3R20A 5E7IA 2XGJA 2CL6X 3EZ6A 2I1VB 4LWZA 4D0NA 5C1OA 5CITA 4PX9A 2ZJAA 2P6NA 3I12A 4JJZA 2C99A 5KDLA 1RFLA 4IVRA 4OHWA 3NEYA 4O2AF 3HR8A 3CPJB 2FWRA 2ZJ2A 1U2RA 4I1SA 5IK2A 4B6FA 1NKSA 5G3YA 4AWXA 1D6JA 1N25A 1KI7A 4UNPA 1AS0A 4TWZA 4D6PA 3KQHA 3I8XA 1WDTA 1E2MA 3LD9A 4XWKA 2REOA 1BOFA 3KXKA 5BPHA 4DUGD 3ZQJA 2BV3A 4DLRA 3G8CA 3VKHA 3I8SA 3U6BA 5A5GA 1MRSA 5LD2C 2GK7A 3SS8A 4E5UA 4A2PA 1FTSA 2YS7A 4QNMA 1DARA 5HR5A 4HUQB 1LY1A 2YYZA 2A3RA 2ODBA 2Q6TA 2R44A 2C00A 1XJQA 4V0NA 5D3MA 2QGZA 1M1YE 1ZU5A 3I1FA 2R7LA 1E2JA 1NL3A 2WHXA 4MYHA 2V55B 3QKRB 2F55A 2WJVA 5EXXA 2C9CA 3I61A 4IKEA 4DLZA 2AXPA 1ZAKA 2Z0MA 1G8GA 2F43B 5HV6A 4TMKA 2GXQA 2XOKD 4RD6A 3SFVA 4EPTA 3S1AB 3MJHA 1NBME 2HYDA 3NTUA 5G40A 3IQXA 2A5GA 1P9WA 1TU4A 1E2QA 3PIRA 1KSJA 2F7SA 4V0OA 4UNQA 1P60A 1KAOA 2FZLA 2ZR7A 4EGJA 3OE7D 3GLHB 1D2MA 4B35A 3RNLA 1EWRA 1OV4A 2HXSA 4V03A 5JEEA 5CM9C 1NY5A 5J47A 2KWIA 2PX3A 2DYKA 2NO7A 4ZI2A 3U61B 1WE2A 1EXMA 3UATA 4B2IA 1I4TD 3EG5A 3IKJA 1H8EA 2VIIA 2GZDA 1E1QA 1A2KC 4G5QA 4PXAA 1SXJC 4QHYA 2JLWA 1II9A 4YJ3F 4Q21A 4KVGA 4ZIRB 1Z0AA 3ZVRA 2OLKA 1U9IC 4LHZA 2YKGA 1BH2A 4M1KA 3QXSA 4QGGA 1RRCA 2QG6A 2YHSA 2VF8A 1XTSA 2C04A 3THYA 1UBCA 1IN5A 4WIAA 1F60A 1CTQA 1XPOA 2ZRIA 1XZQA 1CJVC 3ZZ0A 3U7FB 3VR4A 4M1OA 3MWEA 4CF7A 1E9CA 1Z5ZA 3BS4A 5H8WA 4KSBA 4EUNA 3AEZA 521PA 4BGDA 4ERNA 1NJFA 5EE0A 1SCUB 3V4SA 2OV2A 1GNRA 2IWHA 2RGXA 2DFLA 1RVDA 3QPWA 4BLRA 4URUR 2QAGB 3R9XA 1Z2AA 4ACAA 5EE3A 1KIMA 3LX5A 1R7RA 4RCYA 1UDWA 1UBFA 1GM5A 2K5UA 2SHKA 3K09A 4YMSA 2ZRAA 5CLQA 4LHVA 2JLQA 1C1YA 1Z0DA 4HR7A 3VPCA 2XTNA 4CDGA 4I1OA 4R9UC 4PHHA 4PFSA 1W36C 2GA8A 3UFXB 1OKKA 2FOLA 3VTKA 4NTZA 4PHFA 3TW8B 2WMOB 3KTAA 1CF4A 1KY2A 3C5CA 3H2YA 2WIAA 1Z0FA 3AH8A 3RS3A 2A2ZA 4NHOA 3K0FB 4N1AA 2N1BA 1ZUNB 5HPYB 4WD3A 4B2PA 4D4LA 2XTZA 2A5JA 4KCGA 2IUUA 4MUBA 2PZGA 1DEKA 5FUXA 3BIFA 4DCNA 2D2FA 2C95A 1LVGA 2KJQA
chains in the Genus database with same CATH superfamily
1E6WA 1KO5A 3DP7A 4US0R 2VDQB 4OQNA 3OD1A 5BN3B 3DBLA 5GJWC 4D25A 2FSVC 3PDUA 2CDNA 4FUTA 1UK9A 1QHHB 5B1DA 4B3BA 1W9HA 3DCIA 4BQSA 4U02A 3T61A 2MR9A 4GT1A 2GN2A 3HWWA 5REQB 5DM70 5IREB 1VPTA 1ZJZA 3FVTA 1XZGA 3UK1A 2F64A 4TRNA 3I5YA 4HVCA 3CX6A 5JO0A 1L4NA 2P79A 3OIYA 3M2TA 3KEOA 4GUDA 3K9LA 4JYPA 4L5JA 5A6SB 3SIRA 3LW7A 3ANSA 4OP3A 4TQGA 5JSUA 2IYWA 2XE4A 1TDHA 3DZDA 3H18A 4WCVA 4DT1B 2AK2A 8ADHA 1P7ZA 4IBBA 2O4UX 4DLTA 1XVUA 4AI6A 4Y3UA 3VVLA 1T4MA 3RSFA 1W36D 1PJAA 4IOJA 4KXFB 5MN4A 4INAA 4JKYA 2B63G 2DH5A 3OSNA 2HMSA 2DFDA 4DZZA 1X92A 1OI2A 2HXYA 5FHRA 5FQNA 3UJPA 1AHIA 4E88A 4TVBA 4EABA 1GTRA 3ROEA 4F4FA 2AC7A 4FE4A 5HZKA 1MB2A 1ZHFA 2PX8A 1L3IA 4FC7A 1QGDA 4F4ZA 5FL7D 1UMKA 2H7XA 1ES9A 3EXEB 3WGIA 4E7OA 1Y3BE 1RE0A 1DTWB 2VAWA 3QF4B 2R86A 3H3JA 2AQIA 5FNVF 2P9ZA 1P4JA 1JEAA 1O96B 4MGZE 4MA4A 2B5VA 2AJDA 1QZEA 3RJTA 4EELA 2X1VA 5AVUA 3LW8A 5E8JA 1ZMBA 1IHPA 5C3EG 1UQTA 1ZRHA 3ADDA 4NXNH 2CJPA 4WN9A 4KGXA 1L7DA 4OO3A 5EOVA 4WOJA 5ELMA 2PT7A 2YY5A 4H0CA 3WRXC 1SHKA 2NO5A 1W87A 2PMDA 5DI3A 3BL8A 2VBGA 4EB3A 5SY4A 4QWWA 1TJ3A 2X13A 1QTIA 2PMFA 2H59A 3NEJA 1YL7A 3H1PA 4X6LA 2R7AA 2QN1A 2VBIA 4KOEC 1FU4A 5LP6C 3G2PA 4F86A 4OLJA 4AKGA 1QH0A 1C3LA 1CX9B 4O4LB 4V0QA 2ISCA 2Q1TA 4AZSA 1T2EA 1K83A 4O0MA 4BLWA 3MGCA 1GPAA 1H6BA 1OWLA 3EOBI 2KB0A 2NZWA 5CA0B 2QQEA 3FMIA 4MXDA 4HNQA 1SUEA 3ABZA 4P2GA 2WQ6A 1H2RS 3FLAA 3IKVA 1QFMA 2B8WA 3U3JA 3DT6A 1G1MA 3STTA 2EKBA 3NATA 1YU9A 1WXXA 2JGDA 1Y63A 2HMYB 4YP7A 4ZI7B 1YZGA 3D0RA 2AL7A 1EK2A 3CNEA 1QDTA 2E1RA 1RBQA 3WQHA 3DHEA 2FSHA 1M1UA 2VDRB 4Q02A 5AMXA 2JW5A 1NN3A 3OTOH 2MYUA 2RJ3A 1G8AA 2DFPA 2INGX 2P2NA 3I4CA 4LOAA 4EGAA 3BPSA 1TNDA 3GLIA 4B6RA 2QP3A 1N0UA 1U2TA 2QQFA 13PKA 1A8IA 3S7ZA 1NBEA 3VC1A 5FB3A 3L6UA 5CDYA 1T15A 4RJIA 4C76A 2IA5A 5KOIA 1KYZA 1UM9A 5KYKA 3RUFA 3R2JA 4L08A 4V2UA 3LWNA 1OW3B 2WPNA 1ESEA 2YU9A 3F71A 3W5IA 1DQRA 4HSGA 5FUYA 1QO7A 4H7EA 5AWFC 1QTRA 3OLCX 1S2MA 3ELUA 2UU9B 1L2TA 2XYRA 4JBWA 3WY9A 3C48A 4U3JB 3R3SA 5ALWA 5C81A 1BDHA 2Y66A 1Q19A 4TTVA 3CH4B 1C7YA 4QUHA 3QJYA 2Q6LA 3U4AA 1MTOA 2P3QA 3B6MA 3NHAA 3PGA1 3JAMA 4TV9A 2GERA 4CIVA 2JATA 5DGHA 4S0ZA 3RK0A 4NXMB 3HV2A 3GFPA 3MNFA 1V3QE 3JQ9C 3VYUB 4MW2A 4J43A 4KB5A 3PX2A 2ONKA 4B6SA 2QZPA 2R7NA 1CG6A 1SHJA 2F3UA 1MN3A 4ITUA 1U2DA 2F1KA 3I1JA 2QPAA 1GYFA 3TG2A 4AKIA 3RSZA 4M46A 4ARSA 3QOWA 4CCAA 4K6MA 2OZLB 1W8DA 3FPKA 4Y1EA 4KWEA 4WY5A 1OYWA 2GK4A 1Y33E 2O7NA 1FDWA 5DIFA 1E2IA 4D56A 3R23A 2CLHB 1Z22A 3EEOA 3NKVA 1M6WA 4ECSA 1K75A 2PR7A 3KSRA 1Z62A 3NI2A 4G1CA 4FKMA 2UVWA 2VBCA 3K9HA 3BTSA 5C7YA 3QG1A 2QMEA 2R96A 2WSBA 1OLSB 2J59A 4BXOB 4Q3OA 3E53A 1UOEA 2Q5JA 2R1ZA 5IRCD 2J4CA 2VKQA 2VS1A 3BMQB 3PLRA 1IXSB 2GHQA 4MS1A 5C0OE 3BTOA 4JXJA 5KKAA 1I4EB 4EGQA 5BV7A 1J8YF 3BFXA 1XAHA 1Z4NA 4DAEA 5TS3A 3ZHYA 3GMDA 3WZ2A 3BRSA 4JI1B 5DSTA 1ZX1A 4URYR 2ZT6A 2ILVA 4Q4AA 1C1DA 3PXUA 3OT1A 2WIKA 4QYIA 3WGYA 2UUAH 5CLFA 1IN1A 4ZOLF 1KEPA 1M6NA 3W9UA 1FFYA 3ZS8A 1Y3IA 3BL6A 1JFFA 4D57A 1YKSA 2G04A 2R4UA 2GNOA 5ITRA 1QYDA 3ITEA 4QAJA 3GGPA 4BC1A 2XNSA 3TNFA 5AHRA 4RS4A 1WJ7A 2NUPB 1NVMB 5ALVA 3L43A 1DKUA 3S5UA 5TE9A 3FCCA 1NNUA 5D1OB 4E4YA 1TWAA 1TMGE 4IV5A 1YHYA 3N0XA 1R10A 1IONA 3PIDA 5HBRA 3GJ3A 4DV6H 3VDPA 2BFAA 4LK2A 1RYHA 5KVQA 4K86A 1PG0A 5LUAA 1YQEA 4KN6A 2GEVA 2JEJA 5IJXA 3Q87B 1Z17A 4N3NA 2ZYTX 5KFIA 3WIVA 5KCZA 1VAJA 3IUNA 3ZHVA 4BEVA 2Q6KA 1DDOA 1K7EB 2JVIA 2YMMA 3VU3A 5I5EA 1WB9A 2C7GA 3EAQA 4HB4A 2BFEA 3O84A 4Z9BA 2LWXA 4AG5A 1QDLB 1WB5A 3B9QA 3JSNA 4V1CI 2H4ZA 5HE9A 2B63A 1PZEA 3IRVA 3JR4A 4JLVA 2WZCA 3R7WA 2CW5A 4YA6A 4HUJA 3PB3A 1D0VA 4J3FA 3BF8A 3ZKAA 3TQSA 2WU4A 3ZIUA 4EBFA 1O0SA 1CZRA 5K3FB 5KFQA 1LBHA 1VRVA 4PRLA 1PQPA 4D81A 5KMGB 4PWYA 3F5DA 2GHIA 2ZM5A 5ER9A 2XKJE 1R5NA 3FA2A 3LYAA 1OZ0A 2K7ZA 3HJFA 1P4AA 1JHOA 1JRLA 2XA9A 3C1AA 4RH0A 1Q1EA 2H2AA 1KJWA 4KQJA 1JQAA 1TXGA 5JFGA 3AWDA 1S6YA 4FD2A 4LXYA 3A37A 4OHKA 2DAEA 1UBHS 1K3TA 4OSEA 3Q8PB 1IK4A 1SVKA 2CKZB 3ZXIA 1ZH4A 2XZTA 3H1BA 1YJCA 1EAMA 5CFMA 2HBQA 1TU0A 2E5WA 4X3CA 4JUBA 1G7CA 1NQ5A 5M04A 1L4LA 1JXMA 3ANTA 4MIOA 1N75A 5EHGA 3S44A 4G5FA 4HUQA 1PD1A 4ND1A 1UBRS 1QM5A 1F4VA 1EDEA 5B1IA 1K0UA 4X71A 3BB3A 4B75A 2FW0A 3L6CA 4CTJA 4MH0E 1SVIA 2FZGA 1WKVA 4HV4A 4REZA 5KINB 1H2FA 5AKKA 1CDZA 1XNJA 1XB2B 3Q7IA 4YJ2F 1SA0A 3TLXA 5CT5A 4XD2A 4HAXA 4B9AA 4Z1MD 2PMKA 4Q3CA 5GMOA 2QJWA 4HF7A 4YCAA 2HJ9A 2A86A 3SQNA 3C8ZA 3NBMA 1Y8QA 2D2EA 3VMFA 1T3HA 5YASA 1X7GA 5CFPA 3KYDA 2YV1A 3WK6A 1C4WA 4E2ZA 4J0CA 2OYRA 4H7HA 2RD2A 3PHJA 3ZEAA 1M6VB 4UCOA 1WZCA 3N6XA 1MO6A 3IBSA 4D3YA 2PL5A 4I66A 5DHUA 5ALGA 1J2UA 3KQVA 1G8YA 1HDRA 2BE9A 5EVJA 1NRIA 1J0CA 3IP7A 1PL8A 1ZRSA 1EWVA 3LC1O 3VKVA 3AIMA 2B25A 4KR9A 3TLGA 5JNWA 2EA0A 1ZBDA 2AZTA 2C61A 4ZALA 2QDXA 3CNNA 2PH3A 4TLCA 5BRNA 5A03A 4J0JA 3LOUA 3RUEA 1LS6A 1R12A 4N7RA 3UHOA 2UVQA 4EM6A 4XWGA 5SYNA 5JNSA 5IDXA 4CWAA 4IS2A 1SGWA 3BWVA 3DUFB 4WBNB 4OHPA 1JJAA 1R3DA 2P6RA 2X5KO 2HLPA 3TF5A 1J0BA 4HNTA 3IAS6 5LUBA 1L5LA 3MWLA 1YFLA 3ORYA 2W9AA 4AJEA 4KGDA 1F1JA 4CLOA 3MERA 2PBRA 1FFHA 1JN0A 2MSKA 3F3SA 3SXUB 1BDIA 2HPVA 2JEFA 1R8XA 5EYPB 3Q9UA 1J5EM 1WO8A 1RJ9B 2BI7A 2X0SA 2JI4A 3HA2A 1H6UA 1A82A 2JAUA 5AUPB 1E9VA 2WB4A 3PQ5A 4WECA 4YAGA 4F96A 3HCOA 2VVTA 1JZSA 2G9RA 5DHFA 4HDMA 4QGAA 1LLDA 2Z2ZA 4GPTA 1G0OA 1UANA 1ULHA 1NR5A 1Q3CA 1FA9A 3N2GB 4M9RA 3JTMA 2O8DB 4AZTA 5FBVB 4KPGA 1J23A 4J0DA 4QSMA 1TU3A 3RABA 4IBEA 2GZMA 1S2GA 3H84A 4EITA 3BK2A 1TYCA 1EB9A 1KJQA 3NU1A 5J59A 1FUEA 2KQUA 3T6PA 1LDBA 4HL4A 1GGVA 5D3QA 1SCBA 2OXTA 4Q03A 3G2IA 2WKPA 2P8JA 4C30A 1A4XA 4N82A 2Z9DA 1E2UA 1DNPA 2QD2A 4CU5A 3NUGA 3HDJA 2WLTA 4GQIA 4OHXA 5CBKA 2OM2A 4P4NA 2OE2A 5ICEA 3ST7A 3SJ7A 3G0OA 5CCDA 3A6LA 2PQ0A 3H97A 4NCIA 1RLJA 1NOJA 2BRUC 2ECPA 3R5FA 1W88A 4TYMA 5K6AA 3IXLA 6PFKA 4EECA 3K32A 2BBTA 4FDAA 2ZJOA 3DTYA 2CLOB 1GPBA 1HORA 1XP5A 4XB6B 2AGVA 4LJKA 2ESRA 3P7MA 5JOQA 3DVLA 2VWGA 4C0WA 1RPTA 2GYYA 2CXPA 1ENOA 1BMFA 4CDMA 2XHEA 4HZGA 2VTBB 3DOJA 5HIJA 1TQHA 1OXUA 4YAEA 3TIVA 2QSZA 1S3FA 2OHJA 3CXUA 2J67A 1J2TA 2G80A 3T5MA 1OFVA 3R4CA 2JS7A 5KYTA 3Q3GE 1UC4B 1ENYA 2HX1A 5KQGA 4Q1DA 2XNJA 2AS0A 2JK0A 3BIXA 1DCMA 4PSVA 3TFOA 1YR9A 2P7IA 3WDKA 4O3PA 2JANA 5T6MA 5CHYA 4UTOA 1GZHB 3MK31 1G38A 2Y0SE 1NBAA 5DN9A 1ID8A 4TRJA 1EK0A 3HO1A 2Y77A 3NFRA 1TDJA 4BP8A 4HWPA 5K3CA 4B82A 2J7NA 5ENDA 2JLAA 1BEZA 4Z7NB 1P91A 2QUKA 5LIRA 4Y2HA 3HSYA 3EVEA 5KVSA 1SVWA 1WCMA 2UVRA 5LC1A 4UMDA 3AF6A 3EGVA 1YVRA 4U00A 3EJ6A 1P9OA 1WW3A 2YRXA 1D2HA 1Z0IA 5JAHA 2PVSA 3ZGOA 3GFTA 1L5FA 4M0KA 1N33M 3C0FB 2BTQB 3TCNA 4R1TA 3PW4A 3SQWA 2CFTA 1KWKA 4MZDA 2JCBA 2IX9A 3HS3A 4PF1A 1GSHA 4UOQA 4DVJA 1N3YA 2NAFA 1OH7A 5KFBA 5FNZA 1H3EA 2CJFA 3MB5A 4MQEB 5KSYA 4BWGA 2W48A 2X6TA 3KTAB 1J2JA 5JSZA 3PE6A 3L0IB 5KBYA 4X95A 3QK7A 3AI1A 4Q6WA 1JBQA 4UCQA 4R9RA 2IIQA 1RLOA 3QEBZ 2NXJA 1YE8A 2XB2A 4QJ3A 4LY3A 3FUWA 1HZZA 2NVUA 4PYMA 2HO5A 2N75A 2XCQA 1SPBS 1P5JA 3PQ3A 4AF7A 4INZA 2WP0A 3SLKA 1C7QA 3DFKA 3PTZA 4FBGA 1YZUA 5EP1A 2GHTA 1OIVA 1E1NA 3MILA 4XARA 3MR2A 2V6FA 4RD0A 4POOA 1K5GA 4U0KA 5E3JA 2F5SA 3X2FA 4KKVA 3ZGXA 1C9MA 4WRRA 4FWGA 1GFZA 1YC2A 4FW8A 3TPZA 3VC7A 2JY6B 1YB5A 4BQPA 1HNWB 1IOLA 4YI3A 3RVOA 1UJ2A 2IUEA 2HCRA 2A3NA 1OFUA 2R6JA 2XDYA 3PCXA 1N2CE 1P9RA 2E37A 1OXMA 1ILWA 1PHRA 5U1PA 3N8GA 3TUIC 5L3QA 4UBLA 2ZR0A 3LCRA 1CEXA 2WJIA 4GVPA 1V5FA 2Z6QA 3MFQA 3GVIA 1QF9A 4OOEA 4TSFD 4Q66C 4FYHA 4PTLA 3GARA 1UCFA 4LZLA 2W6PA 1J25A 3L6DA 3G5TA 3RW9A 1TCAA 2ZXUA 3H0CA 4O63O 1X0VA 1IRIA 3KCNA 4KQFA 3KKEA 4RKQA 1A5SB 2XZUA 1DOHA 5FPKA 3BXEA 3H75A 1SU4A 2H17A 4BIIA 1YD7A 4WLFA 1VGRA 3K8ZA 1N2CA 4GVXA 2I22A 4YJFA 2R1VB 5A4KA 4UHDA 1M7JA 5GM1A 2G8NA 5JI3E 2J6TA 3NUZA 1I6KA 4BMPB 1XLVA 1YBAA 5ERYA 1UDXA 3ZIDA 1SBIA 1RRFA 2QY9A 3BMOA 3BCSA 3NONA 4H4DA 2WYOA 2XGJA 2OCGA 5CNJA 2ZJAA 3NEYA 4O2AF 1U2RA 4B6FA 1N25A 1KI7A 1WDTA 2Y6VA 1GFSA 2W9CB 2PRYA 3JAMW 3I8SA 2PGAA 4R7RA 3W1EA 3HYNA 4Z49A 3GJSA 1O6GA 2AQ8A 1M1YE 1HNZB 4ECAA 1EFPA 5JDCA 1EX1A 3S1AB 2H00A 1I7SB 5A71A 3PIRA 3R8XA 1KAOA 4A3KG 5EJ5A 2OC9A 5I7WA 4W8GA 5JEEA 5CM9C 4JI0B 4FFBA 4GC7A 3HY4A 3PUJA 1KKUA 1TKAA 5DEOA 5PGMA 1H8EA 1SXJC 3AR4A 1Z0AA 4BMYA 3LPMA 4IZIA 1WBBA 3HXPA 3QKIA 3N8HA 1Z7WA 4RVOA 2NU8A 1XDUA 4L4ZA 4NAHA 2IWHA 1NXPA 1KDZA 4XYBA 2K5UA 1C1YA 2XWJI 4EHNA 4LNUB 4JI7B 2PGNA 1UZNA 1XWFA 4MQMA 3UWKA 2PIDA 1H2HA 2BHSA 5JAPA 1F0PA 1N0VC 3CNQS 1L7OA 2I4MA 4LJ7A 4RVGA 5K0NA 4H7IA 1KIFA 2QBYA 1L7VC 2XCAA 2H5XA 5L3SA 5K0ZA 4L8FA 3CV3A 3OLZA 3AHEA 1FJ2A 4IBJA 5C8ZA 1DGBA 3OVMA 2R46A 5AOAA 2ZWPA 2C1ZA 2W6JD 1GTL1 1P1HA 3HY3A 4EF4A 4M1MA 4WNYA 1VBFA 1KFEB 2XVZA 3BMNA 2LD4A 4YROA 2VP6A 4UUQA 4H35A 5LP6F 3TOVA 3CWQA 2Q2VA 1MU0A 1M2JA 4K28A 3V8EA 2Y0TA 2OCDA 2GK6A 3LIPA 5EWMA 2W6ID 3UG6A 3WWDA 4G8JA 2JD1A 1CZNA 1IN4A 5JZVA 4X65B 2YVQA 1GCIA 4B3SH 3GG9A 5I9LA 3D2LA 5JVDA 1COWA 1E9SA 4ZVQA 4AC9A 3PVSA 4QUEA 4TUYA 1I6WA 1WUTA 2FYTA 3W8RA 1J7JA 2WM9B 4KYTA 1Q0ZA 3WV4A 3TYXA 2NU6B 1N2IA 1DUIA 1U3CA 4G85A 2BTOA 1JDVA 5IM5A 3HBLA 1E3JA 3STWA 3ZV5A 1QPZA 3AI7A 1LEHA 4JC5A 2IUTA 4NENB 5I4KA 3OQVA 4JMPA 4OI4A 3GV0A 4OU5A 5HS6A 1P72A 1FOEB 3PDIA 3FD9A 3NRJA 1VI6A 2H3HA 3IEUA 5AJVB 1CJKC 3KEMA 2WBLC 2R18A 2OHOA 4HWTA 2GVNA 2EG9A 1JMYA 3BCUA 3U6MA 1TGVA 2WB2A 4M36A 2XDWA 4KIUA 1DC3A 4ZAWA 1TI7A 1HL7A 1ZNWA 3JR5A 1ZOOA 1Q22A 3OZUA 2P30A 5IWAB 5JV5A 5I4IA 3K7EA 4JP8A 2VKTA 4R9NA 1B1CA 3BXPA 1E1KA 5HUHA 2BLNA 2PUCA 4L4XA 3R6DA 2VHCA 5C1IA 4ZA2A 4FXPA 3HL0A 3HGTA 3TI7A 1IUKA 5CGQB 3JYPA 4GC9A 4XR9A 4FNGA 2JA7G 3QGMA 4JLWA 1XRRA 1FRFS 1GGNA 2HQOA 4NBTA 2H1SA 2RH8A 2HREA 2UXDH 1UKZA 2X6RA 4GLOA 1UF9A 1RWKA 1TUBA 5HP4A 3ZH2A 1BWRA 1ZH2A 1XZCA 2V3WA 4TOIA 2VZ0A 2YWHA 4NJMB 4LMYA 3EZGA 4KE7A 3LHFA 2XWPA 3K0HA 3FY4A 3BWBA 4XX0B 2G1JA 1ZD3A 3AUTA 4B3DA 3OPQA 2HCJB 1ZC3A 3ZY2A 1AGYA 4EFEA 2C7VA 4TL9A 3N5KA 2ORVA 3EA4A 3TMKA 5K0EA 3BXZA 4IGIA 4ZGWA 3X0DA 4F8JA 1GFWA 4Q1AA 2HAEA 4KGVA 1GABA 4LKOA 3LUKA 3NM6B 4XYLB 1HBJA 2JAPA 3FTNA 2BWJA 3QH4A 1VP9A 3LPCA 4JWKA 4MB0A 2VNKA 1IOVA 5F1YA 1OKKD 2PSSA 4AWBA 2NSDA 3LECA 2H51A 2ASJA 4QGSA 1TWFA 2KXEA 5KPDA 3AKCA 3RE8A 4NBUA 1ZGBA 3RUAA 2RHDA 3LVFO 4TM8A 5ITUA 1CQJB 1E5VA 2NTYC 3GPBA 5KNBD 2G67A 1XK6A 4ND8B 1QOZA 3ZCXA 1W59A 1FFDA 2G88A 1GNTA 1ZMWA 3SBEA 3ITDA 4ZODA 4UCRA 5LB2A 2QF7A 3V8BA 4TTPA 4X66B 1L7EA 5KVAA 4QOHA 1ZVMA 2LRHA 1EFHA 3G2OA 4CEHB 2YS6A 2VJMA 1ODTC 2MINA 2VA2A 3RKRA 4I19A 4P86A 3DKIA 2EFHB 3IDZA 3IPRA 1TMYA 1P2BA 4KAXA 3PNPA 4R5HA 4ETWA 5HOQA 5CNKA 2DQYA 1U6JA 4XWWA 3NJ4A 1XC8A 5ERXA 3MCZA 2HNAA 4RJLA 2WMDA 4ON9A 4B34A 4JGIA 2NTEA 1X15A 4M99A 1XA4A 2V3VA 4TV8A 4B33A 4R9SA 1KBZA 4RSMA 4CPDA 4RVCA 3D2BA 5C4GB 4D9HA 2GO7A 3ONFA 3ED1A 2XV1A 5TGZA 4BNYA 1ZIPA 1JKJB 2YJTD 4AW4A 2XUFA 1HG0A 4LDQA 3TK1A 1NO1A 3OSPA 4GHLA 1P75A 4ED3A 3V34A 5EPEA 1JWBB 2YIVX 4OP1A 1BKYA 4I8DA 4RTJA 3W5DA 4JVNA 4EBEA 4MWEA 1CNFA 2RGAA 4AS2A 4D44A 4UEJA 5IARA 1Q57A 2WG1A 2ZIXA 1ETUA 1AMNA 3CZPA 3H5WA 1X9HA 1KSGA 3B5JA 1BE0A 4EW6A 1ORWA 3FTFA 1FX0A 4OHOA 2FW6A 3CLTC 4N5MA 1DAFA 1R1DA 4XH9B 1R6AA 3ANLA 4RPHA 4C5CA 3VKFA 3F9CA 1LD3A 1GQYA 3C3EA 4J9UE 1MKYA 2PT6A 2FF5A 1P81A 2DPYA 2C2GA 4AP6A 2DLNA 3FMAA 4UAJA 1HFWA 3AC0A 4DWJA 2PBZA 3IH5A 5FWDA 2PGXA 5FPTA 1Q0TA 621PA 4F97A 2W00A 4UOZA 3I4NG 4YNBA 4EFDA 5IN5A 2ZRLA 3RV4A 4RORA 2VA3A 3FFTA 4ZZIA 1JHDA 2XUIA 4QWDA 3BFJA 3FE2A 3DTVB 1IXRC 2Q6VA 2VJPA 4PNPA 3U31A 1CRZA 1LLCA 2VDWB 5HBGA 1IEWA 3O8CA 4RBNA 3UCXA 1KIAA 4IJMA 3U26A 2RHWA 4FP9A 4ZGBA 4LF5H 5JATA 4XWOA 2UYCA 1KK2A 3JSAA 1MABA 5K4HA 4OX9B 4PXYA 4OJNA 5KYGA 3WWCA 2HFJA 1Y8CA 1QP8A 3L8HA 4ALJA 2LWIA 4GP6A 3O1LA 4IFIA 3F98A 1NZFA 2YY6A 1M5UA 3BDIA 2DG2A 4LZPA 4DWOA 2NSHA 1GLVA 3HVJA 5EQTA 2BKVA 1YVUA 1Y6FA 2VJDA 3M7GA 4DR1H 2VDUE 2FWNA 4XPIA 3V8MA 4OA8A 1EHCA 1H3FA 1NQAO 1ACJA 3LQRA 3T0GA 4A10A 1X0XA 4CEJA 1LLFA 3CKYA 2H1LA 3DF9A 1X86B 4C29A 3C41J 3AM1A 1PJTA 4TQUS 1QYVA 2O6LA 3FRHA 3ZTWA 2UVPA 2CYCA 1Z0JA 3S7TA 3UG7A 4FN5A 5MHTA 1T3TA 3CE6A 4ZO4A 1YHNA 2AW5A 4KDCA 4LY0A 2I55A 3HP7A 1U65A 5JASA 4KV7A 1EXWA 1N36M 4R8VA 4MGKR 1YGPA 2R79A 4DUYB 2XWQA 4PC3A 4DSUA 1JILA 4B6OA 3KQQA 2JA7A 1ZP6A 4FGWA 1DT5A 5F23A 5K05A 1FLDA 2ZBPA 3OF2A 1BCRA 4R3DA 1NXWA 2OV1A 5JAOA 1V4NA 1BHSA 1B93A 2O2IA 1TPYA 4EEYA 1RCTE 1VFNA 3H11A 2BGKA 4CG0A 5AKHA 4DBZA 4DA4A 2ZQZA 2OCPA 3MMZA 5TQVA 5H3LA 4CJ6A 4PWQA 3OZWA 3GNQA 5FUWA 3W4KA 4XVUA 3TECE 2DPXA 3TJZA 3W6NA 2B0JA 2RK6A 4ZQFA 4M22A 2IC5A 5EUMA 3H2ZA 2RBEA 4DDKA 2ODQA 2IFTA 4NF2A 3LX8A 3U16A 5KJFA 2AJBA 2XGNA 1A0IA 1QRRA 3L8DA 2O8CB 3DSRA 3H2JA 3I2KA 3FX2A 1H5QA 2JNWA 4F6RA 4HJXA 1JQLB 1MD9A 5ELLA 3QSYA 5AOVA 4G1UC 2NPFA 2GKOA 1UEXC 4LI3X 5AESA 3VA7A 4RHYA 3NTVA 4F84A 2YW9A 4BX9A 3HJHA 2DUMA 2ACKA 5DK6A 4IYJA 3KKPA 4MDFA 4TLBA 3RC9A 3IUPA 2AN4A 3QXJA 1K8QA 3DW3X 3FLMA 3MLEA 5DHQA 2BGJA 4DAOA 3SIPA 2WWIA 4J2OA 3DEIA 3FDSA 2PN1A 4LFCB 2GZRA 5F3WB 4Q48A 4NAUA 5HK9A 3LG2A 3RFTA 3SGLA 2GPWA 2Q2TA 2RBKA 3N53A 2APJA 2J0QA 2WTNA 4B3RH 2WU1A 5JCOA 3W2HA 4AJNA 2YXLA 2Y20A 3TD9A 3LBFA 4QU8A 7ADHA 4OVZA 3ND5A 4Q9NA 2XMPA 3ETNA 4QLBA 3HYLA 1F2UA 3KJXA 4EFBA 1HGXA 4EQ6A 1P1KA 3OHPA 1MC5A 2DWNA 1HLGA 1A8PA 1ZK3A 2F1JA 1NAIA 1K08A 2XF8A 3NC4A 4PDGA 4WZBE 3AUSA 1LK7A 3ML1A 3R1IA 4N01A 3W78A 3IPLA 4DJ5X 1P2UA 3RGZA 5TQ0B 3GRRA 1FMTA 2B37A 3KWJA 3SYKA 3E8SA 5KFEA 3WSWA 1WMAA 1CFZA 1U81A 2PFKA 1YI1A 4LOHA 3T7RA 1HJPA 4JNKA 1R4GA 3JVEA 3PRJA 1NVEA 3RU3A 2Y1KA 3G2MA 2IIPA 4PVCA 2JJ2D 1WXIA 3OF3A 1DV0A 3EPHA 2NV6A 1QNFA 4N8EA 3AFGA 2F1HA 3CYFA 1FVXA 2XD9A 5EJ9A 2Z3VA 1ISGA 5AVRA 3E9CA 4KQWA 3ZC7B 2AE1A 1TK3A 3HI6A 3M9WA 1ZA2A 3E4CA 3H2HA 3E58A 1ZUIA 3BA1A 3KSMA 5EJGA 4TYNA 4MEAA 5JMOA 1MIHA 3PRHA 2WHEA 4P82A 3M89A 4YWHA 3CEPB 2GQFA 3JV7A 3TD6A 1QHEA 4UU8A 4OV6B 1WDKA 2Q3JA 5J4VA 2KEBA 4X7MA 1Y3FE 3KIPA 2C0PA 4X20A 1FTNA 3TW0A 2A35A 2B1RA 2O9JA 3HEBA 3QELB 3I09A 1LBIA 2CFCA 1PR5A 2XE8A 3JQFA 5KG3A 3SQOA 3ZDRA 3AEQA 2XUGA 3N7UA 2SKDA 3BSSA 4D9GA 4LDJA 1XMOB 1Z5OA 5H80A 3VR4H 5E6RA 2ENUA 1F8UA 4GI7A 3DBHB 4N9QA 1PRBA 2R6FA 2BGWA 3I34X 4D92A 3VDMA 1A9SA 5KYUB 2I4TA 3U5TA 3H1FA 5HQ3B 2BD0A 3QA9A 3RQSA 1VC2A 2XB9A 4NYIQ 2SCUA 4TTAA 1IZZA 4F2LA 2C5FA 5DW3A 4QECA 4RIGA 1K4YA 3HY6A 2EO2A 2Q0XA 1T5DX 4HWOA 3GQ4A 4GKJB 1NATA 1CQXA 4WK0B 1GNVA 1FNCA 3B53X 1Q6ZA 3UJ8A 3E8XA 4D98A 3WAJA 4D9CA 4YRSA 5F9FA 4I3GA 1O97C 2G9QA 1GHTA 4LMBA 2HTEA 3PE3A 2H7YA 1DGFA 4MVJM 1RAIA 3K31A 3QP9A 2VTVA 1G17A 2XQGA 2BFFA 4EZBA 1TZMA 1YKFA 4ZT4A 4YRAA 5CLJA 1P61B 3JRXA 1SFRA 5HE8A 4EKDA 3AIKA 3MOIA 4Q3LA 4G1BA 4PHCA 2QU7A 2NQTA 4Y0AA 3PHGA 4KAFA 2AYZA 2DR0A 1TB4A 1LNZA 1XPUA 2XSZD 3WDMA 3U39A 4RX1A 5IDQA 3MHVC 3PTAA 4FFSA 4GX5A 1B00A 1WP4A 4P16A 3L7BA 3NM4A 1VEJA 3BHMA 4KIJA 1IPEA 2B21A 4TMWA 3R5XA 5EIWA 7YASA 1E5XA 4JBGA 4JBHA 3W1VA 1RM3A 3ELYA 5EJAA 5JARA 1OFUX 1ZC4A 4CMEA 3F5FA 5BPFA 2R93G 3RRBA 5FADA 4O1HA 4HDSA 3ZE2B 2GXAA 3HJCA 4OQEA 2H1RA 3VR1A 3PWSA 1RPNA 3RAPR 1RKXA 4TT3D 1JTFA 4KFCA 3PJRA 1ZIXA 1NOKA 3RJ9A 3CR8A 3ZUPA 3VZPA 2VSXA 1EKXA 3OTWA 1S2NA 4GMXA 2G1UA 5JS2A 4KMMA 1GEGA 1NDUA 4INPA 4L8VA 3K6SB 3WLEA 4CKYA 1BQ3A 4PN3A 1U8UA 2OAP1 1EVJA 1MQAA 3KZKA 2V9CA 4IICA 4ZAZA 3RFXA 4HXEB 2A0YA 1TVKA 4IRKA 3TD2A 5KG5A 3DZ8A 4AUNA 2J85A 4UVEA 1E89A 2JI7A 2PQMA 2VQEB 3KOZE 5FL7A 3EK2A 1I94H 4V24A 2IOFK 2ORED 1TLTA 3ANYB 4OI1A 3OOHA 3E1SA 4FMDB 3ZW9A 4F1IA 4NZYA 3F5MA 3U6OA 4S2UA 2G0TA 1DIAA 5BNIA 3GF4A 4AECA 2I2AA 3CRZA 2H54A 1USKA 4K9RA 3D4NA 4FW9A 4GIPA 4F1KA 3OQHA 2AMFA 2IEBA 5KEIA 2VJKA 4LOJA 4II2A 3FBWA 1GZ5A 3GNSA 3FKEA 5JXGA 3B2QA 5LMUM 4JI8B 2BFDB 4U6NA 2V7VA 2C4TA 1RI3A 4LK3A 3IVXA 5IZ4A 4HZUB 2AEEA 3K35A 5DTMA 2GJAA 1H3NA 2JIDA 2C5HA 4Q1FA 4G07A 3HCBA 3ZVMA 3KOZA 3CUYA 1VHLA 1VLJA 2V1CA 4JQYA 1WY7A 3LY5A 4J29A 4FYVA 1JBEA 3ZDBA 5IP7G 1DJOA 1V96A 3JARA 3PJGA 3HH8A 1L1EA 3U6BA 3ASVA 2H1VA 4ENWA 3NHPA 5BUSA 1JSXA 4GXQA 4RNMA 5CJJA 1LY1A 2XBLA 1DP4A 1ZITA 1Z68A 5GOZA 5EKTA 1E2JA 2QD5A 3RGSA 1K4MA 3M81A 4WX2B 3SZLA 1KSJA 1EM8B 1EGVB 3OZCA 4AQYH 2AU0A 3IKJA 4MM3B 3PGXA 1KEUA 2HL7A 2GPYA 1F60A 2R8EA 2UVDA 4DR2M 3VO2A 3LI2A 1VJDA 2FG7C 3FWPA 3G89A 4BVEA 3QA3E 2PUFA 3ICCA 1YB2A