4A93G

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a93G01
4P74A 3OW2A 4A3DH 2PI2E 1E3PA 2F52A 4HIKA 1KQSA 2RCNA 2ZTEA 3GO5A 4A76A 3F2BA 5J3BA 1TXYA 4DV1L 2Q2IA 2OQKA 1Y1WH 5HGQA 1HNXL 1Q1BA 2HHHL 1N36L 1N33Q 4P72A 1FGUA 3HKZG 3OTOQ 1KD1C 2UUAL 4JC0A 3NENA 5LMNL 4JI4Q 2JA7H 2IHFA 2MO0A 1JJ2A 4A3DG 2UXBL 2N49A 1LTLA 1SE8A 4LFBQ 4DV7Q 2AHOB 1EOVA 1VQ4A 1EWIA 3G6EA 4DV3L 3BZCA 4A3GG 1N32Q 1WJJA 2E2IH 5AJ3L 1SROA 3AFPA 4DV0L 2D0OA 1UE5A 4R4TA 2E5LL 4UY8C 3HOYG 1V9PA 3TS2A 5C4XH 1IBLL 1Q46A 1UE7A 1G51A 5M5XH 3M4OH 4IFDI 3HKZE 5LMNQ 4JI4L 2UXBQ 1Q7YC 4LF5Q 3UE1A 3PUZA 4A3JG 1K73C 3CAMA 4DR3L 1I94Q 1R9TH 4JYAQ 2ZTDA 1D8LA 1K9MC 2KCTA 1HR0L 3L2PA 2D0PA 3ERSX 4DK3C 5C44G 2MO1A 4OX9L 4PG3A 1A62A 2MFIA 3J81j 1C9OA 3CD6A 1KRSA 4ALPA 4A3EG 5C0XJ 5JJKA 1M90C 1XNQL 1OXTA 3H0GH 4HJ9A 3HOVH 1GM5A 1XMOQ 5GROA 3E0EA 1Q86C 1OXVA 2Q2UA 4HIOA 2HIVA 3CMAA 1YJNA 4B3MQ 1LUZA 4O2DA 1X54A 4X62L 2HT1A 2NN6G 4A3BH 5AJ3Q 2E5LQ 4BBSH 1X55A 2K4KA 1PFSA 1N9WA 1OXXK 3M4QA 2UU9L 4JBWA 3UE0A 1I5FA 1SLJA 2AKWB 4A3KH 4UP9A 4BBRG 3RN2A 1IXRA 3I4MG 2ZJQA 4C3JH 4NPSA 3HOZG 3K0XA 4IJHA 2H5XA 1MJCA 2DUDA 3UDIA 3A74A 3AQQA 2N3SA 4DV4L 1P8LA 4DR1Q 4AQYL 2E2HH 1JJCB 3CQZH 1NMGA 4L5TA 2UUCQ 2EXDA 2JQOA 2HHHQ 2CCZA 3J7ZC 4LF7L 1GD7A 5IYCG 1BBUA 2C35B 4HJAA 3CW2C 4OO1G 2WAQG 3NBHB 2OTLA 1PA6A 2CWAA 1M1KC 5C4JH 2Y0SE 2YYZA 3K80C 1Y1WG 1SRUA 3CC4A 5GAEC 3L0OA 1VQFA 2D62A 4YHHQ 1Q82C 1HNWQ 3HOUG 1X3FA 1ASYA 1IBMQ 4DK6C 4LF6L 5M3MH 3JAMi 4X65Q 1OXUA 1XNRL 1GO3E 4O0AA 3F2DA 1CSQA 3UDGA 2NVXH 4A3GH 1E22A 5K36G 1H95A 2VUMH 1K3RA 1YHBA 2N8NA 3TREA 4JOIA 1WI5A 4NB3A 2JEBI 2PI2A 2L15A 2VQFQ 3W1BA 1EUJA 2VW9A 4IOAA 1HR0W 2KENA 1JJGA 3ULPA 3T1YL 3TS0A 4LUZA 1AE3A 3PUVA 4DUZL 3PO2G 5H1SE 5LMUQ 2OTJA 4DR1L 2DGYA 5ELNA 2Z0SA 4HIMA 1XPOA 2F4VQ 2YTXA 2NVQH 3E9HA 5FJ8G 2NVTH 1EQRA 3I56A 1NE3A 3J81i 1CKNB 3CCMA 4A93G 4A3EH 5IWAQ 4LF4L 5IY0A 1P16A 3PUXA 4RG1A 3WWVA 1QZHA 1PH8A 4LFCL 4L5SA 1XJVA 2B3GA 2R93H 2Z6KA 4X62Q 1PVOA 3CCUA 4KHZA 5M5WH 3G48A 4JOIC 4B3ML 4LFBL 4NXNL 2NN6I 2RHSB 1Y14B 2WFWA 3GD7A 1EYGA 1XMOL 2I5MX 4JYAL 1GVPA 1HNZL 3OTOL 4YY3Q 4DV6Q 1QVGA 1N33L 1N36Q 4JI2Q 2JA8H 2NVYH 1XMQQ 4NXMQ 1QVCA 1XPRA 3T1HL 2K5NA 5IYDG 1X6OA 5M5YH 1MKHA 2VY3A 4YWLA 2NZOA 5C3EG 3CPWA 4JI0L 2PNHA 3RLOA 4EX5A 4R4IA 1Q1EA 1VQMA 4DR4L 3KF6A 5C0XG 2KHIA 1AH9A 1X3EA 1W2BA 1TWAH 4GKJL 3L7ZC 3PF5A 1SFOH 4ME3A 4JBMA 3RR5A 3UDFA 3RZDH 3BZKA 4BA2I 1IBLQ 1TWFH 3FKIH 2B29A 2R92H 1VQIA 1PH5A 2JA7G 2I0QA 2YTVA 3CCEA 3I4OA 2EQSA 2VL6A 4K0KL 1BVSA 2UXCQ 2XGTA 1VQ5A 3GTKH 1KL9A 1SR3A 1I6HH 4DV3Q 3CP0A 1UWVA 1VQGA 4B3TL 4LWCA 3PGZA 4MZ9A 3D31A 2QGQA 3H3VI 1VQ8A 4JI7L 1PH4A 2I5LX 1YIJA 2VNUD 2OCEA 2PQAB 2CKZB 4PZ7A 1NTGA 4GKKL 2QEXA 2ES2A 4DV2L 4GS3A 2YU9H 4X64Q 4X66L 2NZHA 1G6PA 3PSIA 4JI5L 2VQEQ 4A3JH 4KI0A 4A3LH 3K8AA 3STBD 5GAHC 4BY7G 5M3MG 3ER0A 4JI8L 3JAMc 1BBWA 1Y1VH 2JJQA 4B3RL 4QQBX 3EBEA 4AYBG 3ICEA 3KLWA 5IP9H 1SN8A 2V1CC 3TQYA 4KHPQ 1SMXA 2HQLA 3GTPH 4JBKA 1A8VA 4LW1A 3VDYA 2UXDL 4DR2L 1W3SA 3EN2A 3W5OA 1KIXA 1VQ7A 4DV5Q 1JE5A 3IRBA 1N34Q 2UUBL 4DR7Q 3ZJYC 4IPHA 1YJWA 1QZGA 4B3RQ 3KF8B 1FL0A 1NMFA 3CC2A 3AYHB 4B3TQ 4LF8L 1PH1A 4GN5A 1KHIA 3ULLA 3J80c 1TWCH 3CXCA 1TWGH 4BA1I 5M3FH 4A3BG 4JV5Q 1IYJB 5FJ8H 3PF4A 3HOXG 1VQHA 2K50A 1YBYA 1HZCA 4UP8A 5EAYA 3ULJA 3I4NH 3KFUA 2FXQA 4J15A 1EQQA 1UEBA 2K52A 3HOZH 5IYBG 4DUYQ 4GNXC 1QUQA 4A3FG 3HOWG 4JG2A 3A0JA 4TVAB 2ZM6Q 1XPUA 2JA8G 1VQCA 1L1OB 3KOJA 2VS1A 4DR5Q 1VQOA 1B70B 4XIGS 2BH8A 4YWKA 5DLQE 4C3IH 4LNQA 5FLXc 2IX0A 5IYDH 4R4OA 1X65A 2XTIA 3HOVG 5BR8Q 2BH2A 2VQEL 4JI5Q 3I55A 4B3SQ 4X66Q 4JCVE 1NJIC 3PO3G 3U58A 3OYYA 1VQDA 4C3HH 4NXNQ 3TRZA 4GKKQ 1WCMG 3CCSA 2KCMA 5IE8A 4JI3Q 4JI7Q 4LUOA 4IPCA 3CCQA 4JBJA 2LSSA 2A8VA 3RNUA 3H3VH 4FDBA 3HOUH 4YWMA 3J7A5 3KDFA 3S15H 3FP9A 2EIFA 2IHEA 2OQ0A 4B3SL 4R1JA 1KRTA 4OWTB 1EFWA 2R92G 4A3CH 3S24A 1KAWA 4P73A 4X6AH 1VQ9A 1B7YB 4DAMA 1IBKL 3CMEA 2VZAA 4JI1Q 4POFA 3KDFB 1J5EQ 4PZ6A 4DR5L 4DPGA 4GLAC 1L2FA 5IP7G 1PYBA 2N78A 1PH9A 3S14H 1K8AC 3DM3A 3T1YQ 2E8GA 2IY5B 3M4PA 2F3IA 1MJEA 4BY7H 5IT9c 1E1TA 4DR6Q 4UPAA 1V43A 1CKOA 3STBC 2KHJA 1J5EL 1CKNA 4BY1G 3G4SA 1VQBA 3T1HQ 4JI1L 1PH3A 2QA4A 1L1OA 2Z6KC 4DAYB 3CCRA 1AE2A 4DR7L 1VQAA 3GTJH 1U5KA 4JV5L 1HNZQ 1X56A 3I7FA 4RMFA 2OWOA 2UXDQ 3U50C 4YCUA 2R7DA 1RIPA 2WB1G 2GN5A 3FKIG 4GOPA 1IBML 4LF6Q 3GTLH 2KBNA 1FJGL 1I50H 3RLNA 3S1RH 4A93H 4LFAQ 4AIMA 3UDXA 3A5UA 1N34L 4LFCQ 1YI2A 2A1AA 2VUMG 4R4QA 4JI8Q 4YCWA 1YJ9A 3CCLA 3EIVA 1ASZA 4LF9Q 1FVIA 5IWAL 3A5ZB 5M3FG 1C0AA 5E7NA 4KLKA 1VQPA 2Q2TA 1HZAA 1BKBA 4HIDA 4DKAC 1E24A 4HJ7A 1E7ZA 1A0IA 4MTNA 4C2MH 4AYBE 1UE6A 4EQ5A 3AFQA 3I2ZA 1YNXA 4GN3B 4GOPC 4LF7Q 3HOWH 3PUWA 2R6GA 1YHQA 4DUZQ 4LFAL 4POGA 4IFDG 2PMZE 1PYSB 4MNOA 4OWWB 4Y52H 3F1ZA 4GLXA 2ZM6L 3K81C 1S40A 3KYHC 4BXXG 3S2DH 3PIOA 2AWNA 4A3FH 4UP7A 5IP9G 1HZ9A 1T9HA 2WAQE 2BA1A 1VQEA 4P71A 1K0RA 5GADC 3DLLA 3J81c 4IO9A 4BBRH 4A3MG 2K5HA 3RN5A 3PUYA 3GTGH 4HJ5A 4WJ4A 2AWOA 1D7QA 2JE6I 1OTCA 2B63H 2JA6G 4DR6L 5FLMG 4DR2Q 1YHAA 4QL5A 4K0KQ 1HZBA 2A19A 2ALYB 3Q8DA 2CFMA 3RLFA 3PO3H 4BXXH 4OONA 5JEAG 3S16H 1KXLA 5LMNW 4YHHL 3PCOB 3U4ZA 1CUKA 1GKHA 2PQAA 3GTOH 4DV5L 3U4VA 4HJ8A 1DGSA 1VS0A 3B6YA 4LUVA 5IYCH 3H0GG 1XMQL 5GAGC 1XNQQ 3MEFA 1HJPA 2WB1E 5FLMH 4KHPL 4OX9Q 4A3LG 3KJPA 5IYBH 4X64L 5C3EH 4LF9L 4BBSG 4DV2Q 4GNXA 1JMCA 4XTCS 3J80i 2K14A 1Y1VG 1YVCA 4P75A 1JB7A 1HR0Q 2JEAI 4H02A 3GTMH 4TQUS 3SGIA 3GTQH 4AH6A 2UXCL 4YCVA 3HFZB 3KF6B 2IX1A 4A3CG 4A3KG 1I94L 1WYDA 2YTYA 4JI2L 3HKSA 1FJGQ 3K7AH 3AEVA 4YY3L 2ZTCA 2JA5H 3HOYH 5C0XI 2UUCL 2CQOA 4GLVB 3CCVA 1PH7A 2R7ZH 4LF4Q 1J6QA 2Y0SG 1TWHH 5IP7H 2RF4A 2ID0A 3E9IA 5BR8L 1WOCA 2IT1A 2ATWA 3NEMA 1C7YA 2GVBA 1N32L 4L5RC 1O7IA 2JA5G 1WCMH 4QGUA 5HY6A 4IPGA 5C44H 3G71A 2R7ZG 5JJIA 1IL2A 3M7NA 4IFDJ 2K5VA 4R4CA 3W1GA 1CSPA 1Q81C 5ELOA 3S1MH 1G291 4IPDA 1K83H 4DUYL 1LM0A 4OXPA 2ZJRA 2WP8J 1Q8KA 2YV5A 3PO2H 1U0LA 1B8AA 4IJLA 3JC66 2R7FA 4DR4Q 1IBKQ 1JT8A 1HNXQ 4DV1Q 4A3IG 3FHWA 4JI0Q 1LYLA 4DV6L 1Z9FA 4PZ8A 1YEZA 1WFQA 2JA9A 3NELA 1KC8C 4GN4B 1N8RC 1L0WA 2ZJPA 3LGJA 4NXML 4IOCA 2ASBA 4A4IA 1PHJA 3KJOA 4OO1I 2HIXA 2BA0A 4JI3L 1RL2A 5C4XG 4DR3Q 5JEAJ 3CPFA 1VQLA 3BU2A 3GDEA 1IZ6A 2UUBQ 1XNRQ 4LF5L 2CWPA 2GVAA 1QUQB 4A75A 1EIFA 3H15A 4A3IH 3D0FA 3PIPA 4L5QA 1OXSC 4GOPB 1HNWL 4DV0Q 1VQJA 1I3QH 3F8TA 2JK8A 3CF5A 2F4VL 3S1QH 3TEHB 2AMCB 4DNIA 1PV4A 1VCIA 3HOXH 3F2CA 3I4NG 3M9BA 4WJ3M 3S2HH 5GQOA 4PMWA 4QY7A 2B63G 1Q12A 4DV7L 2JA6H 4OWXB 3S1NH 1K8GA 4QIWE 1EIYB 4AQYQ 3S17H 2VQFL 5LMUL 1S3OA 2UUAQ 3CCJA 1YITA 3I4MH 1V1QA 1Z47A 1PH6A 1MIUA 3CC7A 2RHQB 4DV4Q 1X9NA 3M3YH 2MNAA 4X65L 1VQKA 3PV0A 5JJLA 4LF8Q 1VQ6A 2R93G 1VQNA 3BJUA 1QVFA 1E1OA 1L1OC 1NBWA 1XTDA 1CKMA 2K75A 3MXNB 2LXKA 4JI6L 1YZ6A 3RZOH 4BY1H 1UE1A 1S72A 1A63A 2LXJA 1NY4A 2MQHA 2Q2HA 3M85A 2UU9Q 2I5HA 1X3GA 4GKJQ 4GNXB 4QJFA 3K7UC 4Y7NH 4JI6Q 4APVA 4A3MH 1PH2A 2E2JH 1HH2P
chains in the Genus database with same CATH superfamily
4RUCA 4OO1H 1PZJD 1ZEQX 4A3DH 1E3PA 2AUKA 2F52A 4K8JA 3F2BA 2KECA 4MTDA 2BE5D 3MWDA 3UQ8A 4DV1L 3HOWB 3K5HA 1JOQA 1Q1BA 2HHHL 3VPCA 1BCPC 4NW2A 1N33Q 5DLFA 1FGUA 4DL3A 4DAPA 3HP3A 1IOWA 1KJ8A 2JA7H 2WINB 1KJ9A 4A3DG 3V6JA 1WTPA 1JR0D 3BABA 3ZYYX 3RGZA 3GTKB 4DV7Q 4XYMB 5KKNB 3P7JA 3RV3A 3K5LA 5DQIA 1EWIA 5F2DA 3NP8A 4K5VA 3TQTA 1SYFA 3R2TA 2E2IH 2E5LL 4DV0L 1WCMB 1TWAB 1BNCA 1IBLL 1N32H 1UE7A 2KQ3A 4HYKA 1G51A 1MD2D 2WB1B 2SDFA 5M5XB 4IFDI 4ED8A 4JI4L 2UXBQ 4IUVA 2UVWA 1Q7YC 4EBCA 3UE1A 4FU0A 4A3JG 4DR6H 2R8JA 2ZTDA 2CH4A 3H0GA 1K9MC 2KCTA 1IHZA 1EYZA 3SE7A 4JI7H 2RDIA 4KKUA 5CBAE 3RUPA 4OX9L 2L5TA 4IHJF 3Q8PB 5C0XJ 4M1UB 1OXTA 2FPGB 3MTSA 1XMOQ 3R5FA 1Y1WB 1EEFD 2HIVA 3QIAA 3CMAA 5EDWA 2B2VA 4EBEA 1AZPA 3D4RA 4O2DA 4ECWA 2NN6G 2E5LQ 5D1OB 4LSXA 1N9WA 1OXXK 3M4QA 4JBWA 2AKWB 4A3KH 3FKIB 1WTRA 1SEIA 2HVSA 2ZJQA 2YW2A 4CJ0B 3K0XA 2FE3A 2M05A 3NWSA 4DV4L 4DR1Q 3FDTA 4JUZA 3C2PA 2UUCQ 2JQOA 1JWMD 2L1BA 2FPIB 2CCZA 1SNCA 4LF7L 5KFLA 4RZRA 1BUVT 5CMDA 2C35B 2FK2A 4OO1G 4APMA 3R93A 2CWAA 4R9WA 2W6QA 2J9GA 2O03A 3S1MB 1C8CA 4J0MA 3L0OA 2PMZB 5K5PA 4HN7A 3NBHA 1R9TA 1G8ZD 1VQFA 2UVRA 5JJZA 2XCLA 4JK1C 4OHJA 4K2LA 5M3MH 3T53B 4LH7A 4FVMA 1ZQ7A 5C4JB 2ASLA 2J6TA 2NVTB 1TS3A 4A3GH 3RBEA 1IBMH 5FOBB 1I6VC 1JIHA 2YZGA 2BQ3A 1EY5A 4J6HA 4NB3A 4O2BF 2VQFQ 4PMCA 3W1BA 5DG9A 1HR0W 2KENA 3A55A 3M4YA 2Z6BA 2Z4IA 1H9SB 5C3EB 4LF4H 1QJOA 3E5NA 1KLGD 4MV8A 4EQOA 5H1SE 5LMUQ 2F0PA 4HIMA 4DV0H 2F0VA 2VUMB 3M9MB 2W9AA 4Y7NB 2F4VQ 1GUWA 3E9HA 2NVTH 3GTOB 3J81i 1GUNA 2A6EC 5KYLA 4ZUJA 5IWAQ 1RK5A 1HCZA 4O4LF 5KG2A 3WWVA 2IBKA 1A3VA 1B2TA 5AFWA 2R93H 5KFEA 3CCUA 1EZ1A 4ZAIA 3LWEA 1IOVA 1EYDA 3J7AV 1QVGA 1GXDC 1N33L 1B53A 3HG9A 4JI2Q 2NVYH 2R7ZB 1GYFA 1KLUD 4MV1A 2OF1A 4NXMQ 1QVCA 2DY7A 3S1NB 4C3IG 5IYDG 3QZ7A 4V0BA 5M5YH 1TQOA 4KY6A 4JI0L 4R4IA 1Q1EA 5I2XA 4CDFC 1TWGA 1X3EA 4FS2A 3ORQA 2K5WA 3X3NA 3W3AA 1I4HA 3RZDH 3BZKA 4BA2I 1TWFH 3FKIH 4PMBA 3K58A 4ED6A 3SVMA 2EQSA 1QCBD 2D5DA 2VL6A 4DR4H 1BO0A 5C1PA 1I7LA 5C8YF 3ETHA 2MP1A 1JC7A 3E0JA 5CAEB 2EJFC 5JVG3 5DEHA 2YS7A 2NU7B 1PH4A 2I5LX 2VNUD 5A2QL 1HUNA 4IRCA 2PQAB 4PZ7A 4ECTA 2EYJA 2QEXA 1TIID 1CM9A 3GIKA 3C3LA 4X64Q 1A9XA 2FLPA 2NZHA 1G6PA 4IUTA 2XNAC 4A3JH 5KFUA 1TU2B 4IFDH 2Z4HA 3N41B 5M3MG 2DN8A 3T5KA 2K1BA 3PR5B 3J81E 3EYYA 3BAAA 1SN8A 4DU9A 2W6ZA 2UU9H 1SMXA 4C2MB 1JCKB 2HQLA 4Q0FA 1CA5A 5KFKA 1TWCA 2DY8A 5KFHA 4BBRB 3RB4A 1U9RA 3W5OA 1KIXA 5C4XB 4TQRA 4DV5Q 3IRBA 3NE5B 5DM73 1LTTD 3H3VC 4DR7Q 1YJWA 1QZGA 3W2DA 1KAAA 1OWTA 1TS2A 3K59A 3WO0A 1N34H 5LA6F 5KFYA 4FO2A 4B3TQ 4Q8EA 2F0LA 3MC0B 1TWCH 1N33H 4BA1I 4JV5Q 4TSSA 2K50A 3OSNA 3KFUA 2HVRA 2HDMA 2IX3A 4RH6A 1D5MC 3DUZA 1UEBA 2K52A 3T56B 1LT6D 2VUGA 4HMIA 3SDZA 3HOWG 4JG2A 3A0JA 2JEGA 4X3UA 4G7ZC 3I8ZA 3RGXA 5C5JA 3KOJA 3Q2OA 2AUJD 2V5AA 5DLQE 1GUGA 4LNQA 2IX0A 3SXHA 4N9PA 1EZ6A 5ELCA 2JXMB 3GQBA 2IPKD 4X3SA 4WFN3 1F2MA 5BR8Q 4B3SQ 1I4RA 1KNEA 2FMCA 3TRZA 2V4QA 2QK4A 1E4EA 1WCMG 3V05A 1O7YA 4FF3A 4JI7Q 2SNMA 3H3VH 3NTKA 3P20A 4IN3A 1KJJA 4DL2A 3FP9A 2NWGA 2DWCA 4OL7A 1KRTA 2KHSA 4OWTB 5KEEA 5L37A 1EFWA 3S24A 1K83B 4EVOA 2R92G 4XT1B 4A3CH 4QCLA 4X6AH 1VF7A 3CMEA 2EYLA 2VZAA 5BPFA 1PTOC 5KFPA 4FBUA 1S03G 2IJ0A 5L1JA 4O3NA 3S14H 2N78A 3GTJA 3DM3A 3H4BA 2E8GA 2CQYA 2IY5B 4FS1A 2F3IA 4DL5A 3ERQA 4BY7H 4HCEA 1ZHSA 4UCSA 3DWPA 4UPAA 2KHJA 2EY2A 4J9RA 2B2WA 2L55A 4MA0A 3G4SA 1VQBA 1ZYRD 5FKAC 3OWEB 4QIWB 4O3RA 2QA4A 4MN3A 5E4WC 4QWEA 4DR7L 4NXNH 4JV5L 3GTJH 2XIWA 4DL7A 1VKZA 4RMFA 4KN4C 2UXDQ 4YCUA 3J7AF 5JVLA 2NZ1D 1LTAD 4GOPA 4LFCH 2LY7A 4LFAQ 4LF9H 3I90A 5DNFA 4B3MH 5IGBA 1YI2A 3A7LA 4ZKCB 1YJ9A 4NLGA 5IWAL 3AU7A 5E7NA 4R8IA 1W96A 2AGOA 3K5IA 5KFSA 1E7ZA 1A0IA 4C2MH 4AYBE 3Q1KA 1HQRD 1KDAA 4EQ5A 3KLSX 1YNXA 4CDCC 4GOPC 2WDTA 2R6GA 2B63B 4DUZQ 1I6HH 1PK8A 4IFDG 2PMZE 3R3OA 2VXWA 2X6LA 2KVMA 3K81C 2B63A 1EY4A 3KYHC 3S2DH 2R82A 2AWNA 3I72A 3Q8QB 5IP9G 3HS0C 1SMYC 3RB0A 3EA6A 2WAQE 1VQEA 1V1OA 4KJNA 4IO9A 4IRKA 2K5HA 2G5DA 4R7RA 4PV1C 1FYCA 2EPBA 2XVSA 3GTGH 3J81W 2JA6G 4DR6L 3MFYA 1I6HB 5FLMG 2ICIA 1YHAA 3BQ0A 4J9MA 4KY7A 1BQQT 2C9OA 1C4QA 3MWYW 4OONA 3GTQB 3S16H 4JI8H 5LMNW 2ZXOA 1GKHA 1O80A 3D6CA 4K5XA 3U4VA 4LUVA 1TWFB 3HZXA 4DK1A 1XNQQ 3PW5A 4ZQIA 3EVQA 3MEFA 5HV6A 1HJPA 2JA5A 3U9OA 2RQXA 1XYIA 4RB3C 1WTQA 1E2WA 4LF9L 4BBSG 1I50A 1JB7A 2JEAI 1Y1VG 3HOWH 3OHBA 4H02A 1PTOF 3GTMH 1NR4A 1BXTA 3SGIA 5J2UF 4YCVA 5EWEA 4HR7B 3KF6B 2IX1A 1M8AA 4A3KG 3FPUB 3I91A 4C1NI 3N6XA 1WYDA 2YTYA 4JI2L 1LTRD 3HOYH 3K7AH 1E2ZA 3GTJB 2ZTCA 2JA5H 4EGQA 3ITPA 2CQOA 3PIO3 1PH7A 1QWYA 1STYA 4DR3H 1TWHH 3E9IA 1WOCA 2IT1A 1MSHA 1GSOA 2ATWA 1EY0A 3N40P 4BY7B 3MFIA 1DV1A 5KG3A 4L5RC 2MUYA 2JA5G 4QGUA 1IYUA 1L0XB 1UC9A 1A2TA 2RGVA 1PZID 2R7ZG 1IL2A 2EY5A 2HJWA 3M7NA 4O3PA 3K5OA 4R4CA 5KFBA 5ELOA 1G291 4IPDA 1K83H 1HNWH 1F9QA 4RGMA 3I4MB 4K6LA 2EYPA 5HGTA 1IYVA 2AQ4A 3RMHA 5I4DA 1WVLA 4DR4Q 3Q23A 1IBKQ 1JT8A 4ULLA 3M4IA 5FPOA 3Q22A 5L1LA 2UUAH 4J9SA 1Z9FA 5CYUA 1RCVD 4DN4M 5H80A 3NELA 2W8LA 2ZXPA 4A93B 4EFBA 4H44C 3TP8A 5A2QE 1SE2A 2ASBA 4EYIB 2HIXA 1F2ZA 2BA0A 5C4XG 5K36H 3FEWX 5JEAJ 1IZ6A 3GDEA 3HRZC 2UUBQ 1BXRA 2NUCA 4A3IH 1WD0A 5D14A 1E2VA 1CZGA 1PTOB 4J9OA 3HBLA 1DV2A 1OXSC 3QO2A 1QE6A 4Q45A 1TY0A 1S97A 2AMCB 2G9DA 3WDNA 5LL6S 3M9BA 2N55A 4WJ3M 1HA6A 3JAME 5FLXW 3RBDA 4DV7L 1TS5A 5EQ0A 4QIWE 4ZRZA 4XDXA 5KG5A 5KIXA 4AQYQ 1IW7D 3ND8A 4ECUA 1DOMA 3PW0A 1TWCB 3CCJA 1YITA 1HTLD 2HQEA 3BYTB 5I47A 1MIUA 2A6HD 3R8BA 3CC7A 1E4GT 2RHQB 1TY2A 5FO7B 4DV4Q 1X9NA 3M3YH 2I46A 3OOCA 3N44B 5JJLA 1VQNA 1STEA 3BJUA 1QVFA 2K75A 3MXNB 4JI6H 3RZOH 4BY1H 3BZDB 3QB3A 4GKJQ 1BCPF 2Q2HA 5BN3A 5DQHA 3BS1A 2I5HA 3KHLA 4KHPH 3D4WA 1LLRD 2NVQB 2EXZA 5KFJA 1GUSA 2E2JH 3T1HH 2H4OA 2M00A 2PI2E 4RGNA 3HGBA 3GO5A 1BBXC 5DQGA 3VYSA 3KBXA 4KTAA 4B3SH 2F0FA 2Q2IA 1Y1WH 1HFGA 1SYDA 2PO4A 1CHPD 5HGQA 4WRDA 1N36L 1HNXL 5KFRA 4CGYB 2R87A 3OTOQ 2ALZA 3U9SA 1LV9A 4JC0A 3NENA 4JI4Q 2K28A 2UXBL 2IHFA 2MO0A 1JJ2A 2YRWA 3JSLA 2N49A 4K14A 3LP8A 1SE8A 1I4XA 4LFBQ 2AHOB 1ZXTA 1VQ4A 4ZYSA 5KFWA 4HNVA 4DV3L 2JA6A 4CBVA 4A3GG 3KBGA 3AFPA 5KFZA 2D0OA 5EKLA 3RZOB 3M4OH 3KALA 5KG0A 3SK6A 3SEBA 2C2EA 2N88A 5FO9B 2K33A 4LAAA 1EUCB 4IQZA 2FHTA 1B3QA 3PW2A 4EGVA 3VA7A 2UVVA 4JI3H 2D0PA 1I94H 1JOKA 4IR9A 5C44G 5JEAH 1EYCA 2DPIA 1C9OA 4IWYA 1M90C 1CQIB 4HJ9A 1Z2PX 1GM5A 1WTXA 4ZUIA 2ATLA 3R5XA 4CJ1B 4B3MQ 3T5JA 3O13A 4X62L 2W8KA 2HT1A 4DUYH 3K57A 5DG8A 2V58A 1D6EC 4A3DB 1JOOA 2EZVA 2TSSA 1I5FA 1SLJA 2XN9C 4YR3A 4UP9A 3OPOA 3J80L 1MI2A 2EY1A 2KCNA 5IGDA 2R8GA 4DXFA 3T5HA 2JA7A 2UXBH 5EPJA 1RKNA 1IKLA 4R8UA 4RNOA 4YR2A 1EIGA 4ODGA 3A74A 3AQQA 2E2HH 1P8LA 1JJCB 3MFGA 1LT4D 4L5TA 1PFBA 3BA8A 1GD7A 5KFNA 2E2IA 3K5NA 4HJAA 3CW2C 2R93A 2WAQG 3NBHB 4UCOA 1PA6A 2Y0SE 3K80C 3G6JB 3K0YA 1Y1WG 3DXJC 3RV4A 3K3VA 3H91A 4PDBA 5GAEC 1H9JA 1MHWC 3RB3A 3UI2A 3PMFA 5CBEE 2D62A 4ED3A 1I6UA 3MJFA 5KG6A 1X3FA 4YJ3F 4RGTA 3TP6A 4DK6C 3JAMi 5CB4F 1II3A 4X65Q 3WOFA 4JI0H 1XNRL 1NNXA 4O0AA 2NVXH 2ZT9C 2D9UA 1H95A 2O5IC 1YHBA 4H0LC 4JOIA 2JA5B 2NTSA 3F2UA 2L15A 5L1IA 3FKIA 1SNPA 2R92A 2QDBA 3ND9A 1A2UA 4IOAA 4A2AA 4ED7A 5KT5A 1VAJA 2YZNA 3M9OB 1S68A 2WV6D 2IL8A 4IAJA 5ELNA 2Z0SA 4A3KB 3BA9A 3MWMA 3CCMA 2W71A 3V96A 4LF4L 4CKEA 3S16B 2QILA 1P16A 2GPWA 3PUXA 4L5SA 4O4HF 5EBDA 4YQWA 3VPBA 4ECQA 2YCHA 2Z6KA 1B6RA 1K28A 4B3RH 2NN6I 2PZWA 1GVPA 4DL4A 4YY3Q 1N36Q 1YNND 2OH2A 5KFFA 2PYKA 3DMUA 3KAJA 2OXPA 5J22A 1J9OA 1SNDA 3T1HL 1GLVA 4IWXA 1MKHA 4ECZA 5COYA 2NZOA 4F88A 1XMQH 2RBMA 3CPWA 4H13C 4EX5A 1VQMA 3KF6A 1AH9A 2KHIA 4HR7A 2XRSD 3KXYT 1JLLB 3UDFA 2GPSA 4O42A 1FKAH 2EYHA 2J6SA 5E4XA 1PH5A 2JA7G 2I0QA 3CCEA 3I4OA 4DA2A 1BVSA 3AB9A 3GTKH 1SR3A 2RSNA 4LWCA 3PGZA 4RWSC 2FKLA 2J6UA 4UHVA 4MZ9A 2NU9B 4YAJB 2F4IA 1O7LA 3EJIA 4JI2H 2CKZB 4GKKL 1NTGA 2W9BB 2D2CC 2YU9H 3Q8RB 2VOBA 2XD4A 2JEJA 2VQEQ 4KI0A 4BY7G 2F0TA 1TKWB 4JI8L 2FFKB 1BBWA 1Y1VH 4F87A 3JAMc 2JJQA 2BQRA 4QQBX 2PW5A 1STAA 1LT5D 1NAPA 1FNWA 3EBEA 5CV8A 4AYBG 1WSCA 3TQ1A 2V1CC 4KHPQ 3U9TA 2K32A 4E6IA 4HMJA 4JBKA 4ZOLF 3BG3A 4EBDA 3E6ZX 1W3SA 2I80A 2C2DA 5JVDF 5KFGA 2UUBL 2R86A 2ENBA 4A3JB 3QR8A 2AGPA 4X3TA 1B44D 3AYHB 4TKOB 4LF8L 2Y0SA 4HNUA 4FF1A 2XC9A 4GN5A 4JV1A 2Z1CA 3ULLA 3J80c 1HNXH 4RNMA 5KT7A 3OTOH 3PF4A 5FJ8H 1VQHA 3I4NH 2R3ZA 1EQQA 3HOZH 2P0AA 5IYBG 1EY7A 4GNXC 3K3PA 2R92B 3HEJA 5IYZF 3V2TA 2BE5C 3L9AX 1ICFB 2QW7A 3I73A 4FF2A 4JPBW 4QIWA 3KUPA 3NSWA 4MHEA 4YWKA 1WR2A 2BH8A 4C3IH 1Z2OX 1KC7A 3VYTA 5FLXc 4K8IA 1JDEA 1V51A 5IYDH 1EHIA 4DR5H 1AZQA 2BH2A 2VQEL 2FB9A 1H9MA 4X66Q 4ECSA 1VQDA 1U4MA 2HVQA 1BDOA 4B3TH 3CCSA 4XYQA 2B2TA 4XT3B 4JI3Q 4C2MA 2KEEA 4RAYA 4IPCA 4JBJA 2LSSA 2W9CA 4KKSA 4O4IF 4JV5H 3J7A5 4YWMA 4MV3A 3KDFA 1KEEA 2XSCA 3TP5A 2R93B 4R1JA 3ONAB 4P73A 4DAMA 3J7YW 5LL6X 3KDFB 2WYOA 4PZ6A 2B2WC 2ZDQA 2E2DC 4GC7A 3I70A 1L2FA 2WKCA 4GLAC 5C1OA 4N8FA 1K8AC 4EGJA 3RTXA 5KFXA 5D65A 3M4PA 1JQYD 5FO8B 1I3QB 1BF4A 3S1QB 4UCUA 2F03A 4M9UA 1J5EL 1CKNA 5BR8H 2SNSA 1PTOH 1Z7TA 1PH3A 1SSOA 4KHVA 1T94A 5C6AA 4TV9F 5KG7A 1T5XD 4I7AA 5JUMA 2K5QA 4PNYA 2CVRA 4Q44A 2WB1G 1RIPA 4MIUA 1IBML 3GTLH 2KBNA 1FJGL 3RB6A 5KFOA 2M2LA 1F9RA 1LACA 4G57A 5ELFA 1VMCA 3UDXA 5M3MB 3A5UA 3TSSA 3DHQA 2VUMG 4R4QA 5EKIA 2R8KA 3EIVA 1M4VA 5IWAH 3A5ZB 3VR5A 2Q2TA 3IAYA 2KJXA 2W57A 1JXLA 2R7ZA 5KG1A 2QF7A 2A68D 2Y0SB 1Q8IA 4KD4A 3I2ZA 4LF7Q 3PUWA 1YHQA 3FMAA 3OHAA 3VMMA 2BDNA 4OWWB 4I7HA 4GLXA 2ZM6L 1FNUA 1S40A 4TV8F 2HHHH 4A3FH 1SMYD 4OEMB 4MA5A 3CHBD 4MV4A 3Q8SB 4P71A 5GADC 4A3MG 3J81c 2L9HA 4BBRH 3DEOA 2ZJTA 3GTOA 2JEFA 3RN5A 3PUYA 4HJ5A 2PBZA 2O2LD 2JE6I 1OTCA 4DR2Q 2F0HA 1KDCA 3Q8DA 4BXXH 3PO3H 2FINB 1H9SA 2YS6A 3FMCA 5JEAG 2RDFA 4YHHL 4RB1A 1CUKA 5IGFA 4HJ8A 1TAEA 3B6YA 1VS0A 1K3BC 1K8OA 2MGSA 4OX9Q 1ENCA 2A73B 1Z6HA 5IYBH 4X64L 5C3EH 3V4ZA 4DV2Q 1F9PA 1JMCA 4JYAQ 4B3RQ 1YVCA 4P75A 1HR0Q 3E5SA 1SCUB 4AH6A 1SYEA 4KD3A 1C48A 1UEAB 4A3CG 4L1KA 5L9XA 1NR2A 5CV7A 2R84A 3HKSA 3AEVA 4YY3L 3NQTA 4YY3H 4H7BA 1N36H 3SE0A 4EQPA 1J6QA 2Y0SG 5IP7H 2RF4A 4J9KA 3GTQA 2PNRC 3I12A 4J8QA 4F50A 2K04A 1C7YA 3GV5B 3LNNA 3CKIB 2C28A 4GZYC 4KKTA 5F9LA 4B9WA 2JYOA 2F3WA 2K5VA 3W1GA 1JORA 3CU7A 1C30A 1AFPA 3S1MH 3G6VA 2I87A 5C5MA 4DUYL 4X62H 4OXPA 2YV5A 2X69A 1MZBA 1QG7A 1U0LA 3TBIB 3K5MA 2VPSA 3NTIA 4CDDC 3C46A 3MXPA 3FHWA 3F8NA 1XX8A 3Q6SA 4RGOS 2AQ1B 2BQUA 1YEZA 1CE8A 5KFQA 2MJ8A 5BN5A 3KJOA 2B2UC 1RJQA 4JI3L 2IMWP 4DR3Q 1EEID 2QYZA 3G6XA 2W7OA 1RYSA 2W9BA 2GVAA 1QUQB 4A75A 3L4JA 1Z2NX 2F1MA 5EPLA 4GOPB 2XCAA 4EG0A 1A3TA 1VQJA 2JK8A 1CQFA 4C3HG 1U4RA 3TMEA 1RJPA 1TS4A 5GQOA 1L0YB 4PMWA 2B63G 4YBZB 1Q12A 2IWHA 2L11A 4DV3H 4OWXB 2HCCA 5G3LD 4ZKBB 1EIYB 1JE4A 1CQVA 3GV8B 3OIPA 2E75C 3N52A 4NMZA 3N42B 3TZDA 1PRTC 5C4HA 4QWBA 5LMUL 5JQWA 4A3GB 2UUAQ 2WB1A 3OIQA 3I4MH 3LX0A 1EY6A 5C5LA 3LMLA 4ETSA 5KFCA 2NU6B 4U7CA 5HURA 1A3UA 3NQIA 2EE1A 1K83A 1E1OA 1L1OC 4EEQA 1XTDA 1SYXB 2LXKA 4LK1C 5C4ZA 2W6MA 2RDJA 4F8MA 2WTFA 2F0SA 2Z8LA 4WJWA 2LKVA 2AQ3B 2E2IB 1EY9A 4FBTA 4APVA 4HSVA 1F77A 4HAEA 1HH2P 2E76C 2KSWA 3OW2A 1EU4A 3P1HA 2EVBA 4LJZC 5I2YA 1KQSA 2RCNA 3GILA 4F4YA 1ILQA 3M7GA 4F7XA 2YZMA 1EWCA 5J3BA 1SNOA 3IG0A 5C0XH 4P72A 1KD1C 3TIGA 5D3DA 3VR3A 1ONLA 4O1NA 4G4KA 3VYRA 5CA0F 1L2ZA 2F0DA 2X6GA 1EQTA 4HCSA 2DJFC 3QFFA 3MR2A 1HXYD 1EOVA 3MAQA 3G6EA 5KFTA 4C1NK 1W6KA 1N32Q 1WJJA 3EPIA 3BDCA 5AJ3L 1SROA 4BS9A 4QWCA 1UE5A 4R4TA 4UY8C 3H0GB 5C4XH 3MZ5A 4RKLA 3M4OB 1TA8A 2Z9HA 1GJXA 3HKZE 5LMNQ 2J7ZA 4JI5H 2CH4W 1K73C 5EOYA 1ZETA 1D8LA 2GLTA 1HR0L 1S0OA 5EKKA 4LH6A 3H20A 5LOVF 3DWQA 1H9KA 3VYUA 1RJRA 3PW7A 2MO1A 3FVQA 1JDBB 4PG3A 1A62A 1YNJD 2MFIA 2CW0D 5CR3A 3J81j 3CD6A 2KA7A 1QB5D 5FD5A 1W93A 3H0GH 1A6XA 3HOVH 2JA6B 4IALA 5GROA 3E0EA 2A69D 3QOLA 2E5LH 2Q2UA 4JI1H 3J80W 2UXCH 1ZYRC 1YJNA 1LUZA 1PRTF 3EFXD 2FMMA 1X54A 4A3BH 5A2QW 5AJ3Q 5J39A 1X55A 2K4KA 2P5ZX 1C3OA 4UCVA 3UE0A 2F0NA 2F0IA 4HEDA 4A3MB 1D5ZC 4BBRG 5KFIA 3RZDB 3RN2A 4DR1H 4UCRA 4C3JH 3C0FB 3SR1A 2DUDA 4AQYL 1V1PB 3CQZH 3TDQA 1NMGA 2EXDA 4ZK9B 3GIDA 3PR4A 1HNZH 5DLGA 2HHHQ 3JAMW 1MSGA 4A2BA 5IYCG 1BBUA 3D8GA 3S14B 5DGBA 2J0TD 2OTLA 1KNAA 1B6SA 1E4EB 5LL6b 1M6VA 5M5WB 2F0JA 1XWEA 4QF4A 5KGUA 2SCUB 1Q82C 1HNWQ 3BQ2A 1RF2D 2KEDA 1JICA 1ASYA 1IBMQ 1QOHA 2EOTA 1HRJA 1SYGA 1GO3E 3BVZA 2V4DA 1FD7D 3F2DA 5K36G 4M7EA 1RJTA 3BDLA 2VUMH 3TREA 2N8NA 5NUCA 2W6OA 1IW7C 2ZDGA 1SFOA 1HR0H 1PRTD 5CV9A 1EUJA 2W6PA 1H9RA 5BN4A 3TS0A 4LUZA 2O4XA 1AE3A 3PUVA 4DUZL 2VUMA 4LMQD 4O3QA 1O75A 2OTJA 2V59A 2HGSA 2PPBC 2B8FA 2B8GA 2DGYA 3OSOA 4IZ8A 1ESRA 1XPOA 2NVQH 1EQRA 1X3PA 3I56A 5IIFA 1SNMA 4FF4A 1PXUA 2PVPA 1SJED 4Q8FA 1CKNB 4RUAA 2A6ED 2R7KA 2CW0C 3VR6A 2C5CA 4RG1A 1PH8A 1QZHA 2W7PA 4LFCL 2NVYA 4G7HC 1XJVA 1WTHA 4P2CB 2B3GA 2A69C 1SAPA 4X62Q 3M3YB 4HQ6A 1PDQA 4KHZA 5M5WH 4B3ML 1FGBD 4NXNL 5EWGA 1Y14B 2WFWA 2I5MX 2IA6A 1HNZL 4FXDA 1MGSA 3KHRA 1KABA 4C3HB 4WORA 2R7MA 1R4QB 3A8JE 1F9SA 3QG1A 4U6PA 1XPRA 4CC6A 4XYOA 3KK7A 1GUTA 4YWLA 2RDHA 1JB3A 2E74C 3CQZB 5C3XA 2XRQD 4K0KH 5C0XG 2FJ2A 4I50F 5FLXE 4K6DA 4B08A 2DJGC 4JBMA 4ME5A 1DM0B 2IP4A 4M8AA 5T1IA 3NK9A 2BR0A 1LABA 4L63B 3NWTA 2B29A 2DNEA 2R92H 4AYBA 1VQIA 3SK5A 1ET9A 3HOZB 2UXCQ 2XGTA 4NDXA 1I50B 3A54A 2ASDA 4DV3Q 3CP0A 1UWVA 1GOZA 1SNQA 3MEHA 2LS01 3OMGA 4WD3A 5M3FB 1TWGB 2B2UA 4F4WA 4JI7L 1TWFA 2JP1A 2OCEA 4L6TB 3EROA 2ES2A 4DV2L 1CI3M 1QNUA 4FP5D 3PSIA 4JI5L 2F3VA 4A3LH 1B50A 1RTOA 2HUGA 3STBD 5GAHC 4CKCA 5T14A 2Q8TA 4B3RL 4IZOA 2B2YC 3MXUA 3ICEA 3KLWA 3P75A 2RKSA 5IP9H 4DV5H 2WKDA 1A8VA 4LW1A 3VDYA 2UXDL 4DR2L 4IUNA 3EN2A 2I8CA 1VQ7A 1N34Q 2FJZA 4LMYA 4IRDA 4IPHA 1EL0A 2V9WA 1ILPA 4GKKH 3OMCA 1FL0A 3JAML 1PH1A 3K7AB 4DR7H 4F4XA 3CXCA 1TT2A 4DV1H 1TVXA 1IYJB 5DGAA 1TWAA 3HOXG 4KJOA 3JRXA 3ULJA 4RA8A 2K03A 2YL2A 5T1GA 3GIIA 3OW7A 2VB2X 4I65A 1I4PA 1Y8NB 2K05A 4DNRB 4MTKA 4DUYQ 3PN1A 4PWQA 3QOJA 3SK8A 5JPNC 4A3FG 1RD9D 4G3IA 3GTKA 2ZM6Q 1XPUA 1XNRH 2ICEC 5HBRB 5LXTF 2LMCB 1DOLA 2R6FA 1VQCA 1LTBD 4DNTB 2VS1A 3CRLC 4FXGC 4V190 1HFNA 1ZHQA 4MTEA 3IKJA 4J9QA 1E4FT 4R4OA 1X65A 2XTIA 3HOVG 2VPQA 4JI5Q 3I55A 1EQVA 1NJIC 3EPGA 3OYYA 2QEJC 1IKMA 3T5LA 2KCMA 2NBFA 5IE8A 4N8X1 3S15B 4LUOA 3CCQA 2A8VA 3RNUA 4FDBA 3S15H 3LWBA 2IHEA 4B3SL 5KFDA 1KAWA 1V8QA 1VQ9A 1IBKL 4JI1Q 5EZYF 4POFA 3BYYB 1J5EQ 2RSOA 2UVUA 4DPGA 5A35A 2F0KA 1PYBA 2F0MA 4RKBA 2LFNA 3T1YQ 3NUCA 2C22A 1EUDB 4LF5H 1MJEA 1STHA 3STBC 2NYZD 4ID6A 2PN1A 1F2YA 1ML0D 5JVH3 1L1OA 2Z6KC 1XXGA 1U5KA 2XIGA 3HOYB 1HNZQ 1YNNC 4LF6Q 1DJRD 4C3IB 3RLNA 3S1RH 5ELDA 1BNZA 2HDLA 3CRKC 1STBA 3VA5A 1N34L 4LFCQ 1N56A 2A1AA 3G8CA 4LF9Q 4LFAH 4RB2C 2K7VA 3GP7A 4KLKA 1SDFA 1HZAA 1BKBA 2MHVA 4YAKB 2EYFA 1J8IA 1E24A 3J80E 2K01A 1PFMA 4ABNA 4MTNA 4HJ7A 3I4NB 1UE6A 3G6YA 2H1EA 4KK7A 4MNOA 5IT9L 3PIP3 1BCPB 3GTGA 3F1ZA 1DIKA 4XQJA 1EIHA 2OLSA 2JA8B 1FJGH 5D8DA 1HZ9A 3VPDA 1K0RA 4ECVA 4WJ4A 1D7QA 2AWOA 2B63H 2UXCL 4DF7A 2L12A 2ALYB 3T16A 2CFMA 1I4QA 1KXLA 1G2SA 4YHHH 3WNZA 1HHVA 5TSSA 1EY8A 2PQAA 1HTPA 4Q43A 2ZDHA 3NGDA 4ED0A 4OELB 4R8UB 5GAGC 4X3KA 4MAMA 1S9FA 1RHPA 5E1FA 1K1QA 2JA7B 4MV9A 4KHPL 4J9NA 2YYAA 1PLFA 4Z9CB 3KJPA 4LF7H 1XNQH 3I4LA 4NKLA 1TWHA 4KMUC 4GNXA 4XTCS 3J80i 2K14A 1Q3LA 5I6YA 4TQUS 4DGZA 2MCTA 3HFZB 1I94L 4MV6A 4XQQA 4GC6A 5FPRA 5JOBA 5C0XI 1EZ8A 2UUCL 4GLVB 2VQEH 3CCVA 2R7ZH 1SJHD 4FNFA 4A3FB 3UFXB 3HB9A 2C00A 3RFCA 2GVBA 3MA2B 4RCOA 1CTMA 5HY6A 3HKZB 4IPGA 5JJIA 3G7LA 2QKIC 3T13A 4ZHQF 4R8NA 1CSPA 1Q81C 1IBKH 3H09A 5IT9W 3HXLA 1LM0A 4OX9H 1XDNA 1B8AA 1Y8OB 1EOTA 4HTHA 2R7FA 3S17B 1HNXQ 1M0TA 2PZUA 4A3IG 2HCIA 5D3IB 4DV6H 2RDGA 4DV6L 3NXWA 2F0WA 1ESFA 1WFQA 2DLNA 3KLSA 1KC8C 3V6HA 4GN4B 1S4ZA 2ZJPA 5BPHA 2A68C 4A4IA 3GTLB 2V4RA 2FLNA 4OO1I 3IFDA 3H94A 4LF8H 1B9MA 4UAIA 2CWPA 1EIFA 2NTTA 3PIPA 4XXEA 2UUBH 4QUFA 3NPPA 1HNWL 3OSPA 4DV0Q 4N9TA 1I3QH 3F8TA 3CF5A 3S1QH 4ILWA 3RAXA 1IBLH 4DNIA 3MHBA 3OUZA 3S2HH 4XYLB 3RJ0A 4X66H 3GQCA 4DAYA 5KFMA 1SXTA 2RCFA 3S1NH 1K8GA 1JWSD 3KLRA 4ZI7F 3ORRA 4DXGA 4UCTA 3ETJA 3MXNA 1Q90A 1ET6A 3FPPA 4RHSA 1Z47A 4AQYH 1PMRA 4I7ZC 2R85A 1RK6A 1RTNA 5KT2A 1XTCD 1R9TB 4DV7H 4RAZA 2NUAB 2MNAA 4X65L 1VQKA 2R93G 4Q5VA 4C3JG 4DV4H 1I7NA 2QCPX 1UE1A 4EFEA 2MQHA 3M85A 4TRDA 1X3GA 1AUXA 4QJFA 4Y7NH 4JI6Q 3Q24A 4A3MH 1M0WA 1PH2A 2F0QA 5I9OA 4P74A 4GKJH 4G7OC 3L3OC 4I4TF 4JV2A 2VA2A 2BCOA 3GIJA 4HIKA 2ZTEA 1D1IA 4A76A 3CVZA 4RZQA 4XZ3B 3R2IA 1TXYA 2OQKA 2E2HB 4I55F 5M9OA 1WD1A 3HKZG 1BCPD 5CGKA 2UUAL 3X3MA 5LMNL 2L4NA 5D1OA 4KV6A 1G2TA 2C2RA 1LTLA 3A7AB 2PW7A 2VR1A 1XMOH 1CHQD 3J81L 4JI4H 2OEOA 2K5DA 4QB4A 3CQZA 1Y1WA 2SEBD 4HSPA 1SE4A 2CQAA 3BZCA 3PO3B 1CZWA 5BMVF 1U4LA 4OGQC 4CHTB 5KYIA 3HOYG 2FK3A 3TS2A 1V9PA 1Q46A 3SK4A 5M5XH 3VR4A 4FYDA 3T1YH 1Y8PB 4LF5Q 4J9LA 1CQJB 3PUZA 3CAMA 3KF8A 5M5YB 3NTHA 4DR3L 1R9TH 1I94Q 5KX5F 1Y1VB 5DG7A 1S0NA 5IGGA 3L2PA 2NVYB 2CW8A 3ERSX 2PMZA 4DK3C 1AP0A 2K6AA 1KRSA 4ALPA 4DR2H 2ZXRA 1SE3A 4A3EG 3BVGA 5JJKA 1XNQL 1B4OA 2J4XA 1G91A 1Q86C 1UNNC 1OXVA 4FXKC 4HIOA 3S2HB 1UC8A 1UAPA 4BBSH 4F4ZA 1B33N 2E2HA 2EDGA 2JSOA 2DPJA 5KNBA 1E0BA 1PFSA 5ELBA 2Q8IB 2UU9L 1NSNS 4RFBA 3GV6A 2XGQA 1IXRA 3I4MG 2JEIA 5LMNH 2B2TC 4J9PA 3HOVB 4NPSA 3HOZG 4IJHA 2H5XA 1MJCA 3UDIA 2N3SA 2DNCA 3JZIA 2TMPA 5KG4A 3MR5A 4Q0YA 4RU9A 1ENAA 5EWFA 3J7ZC 3PW4A 1AW7A 5DAUA 1BOSA 2AU0A 1M1KC 2B39A 2WACA 2YYZA 5C4JH 2FMAA 2HD3A 5LMUH 2X0SA 1SRUA 4BY1B 3CC4A 1SEBD 3BG5A 4QWAA 1CT1D 1X32A 1LTGD 4YHHQ 4X65H 2R8IA 4CC5A 2BOSA 3HOXB 3HOUG 5EPKA 4IR1A 4LF6L 3HOUB 4A3EB 2CW7A 4QMGA 1OXUA 1V1PA 5KFAA 4ZCKA 1KJIA 1CSQA 1TWHB 4DK0A 1E22A 2SOBA 1ENFA 1KBLA 1K3RA 1WI5A 3D6WA 2JEBI 2PI2A 1JKJB 3KHHA 5GONF 3D3RA 1CA6A 2VW9A 2EYOA 3NBIA 2VB3X 3R5HA 1JJGA 5IGCA 3ULPA 1HQMC 3T1YL 2NVXA 2G9HD 2UXDH 3PO2G 2OT2A 4C3JB 1M7JA 1EU3A 4DR1L 5EJWA 1S5FD 1Y69U 2YTXA 2NVXB 4FM9A 5FJ8G 1NUCA 2KUMA 2RA4A 4O3SA 1NE3A 4MV7A 2R8HA 4A93G 4A3EH 1JWUD 5IY0A 4TUYF 3FDSA 4UFZA 2M9VA 5JH7F 1PVOA 4LFBL 3GTGB 1PX2A 3G48A 4JOIC 1T36A 1WTOA 4OIKA 2RHSB 3GD7A 1EYGA 4JYAL 4YB8B 1XMOL 1O7ZA 3OTOL 2PQEA 4DV6Q 3V4SA 2JA8H 5KT3A 4HNTA 2FLLA 4QW9A 1XMQQ 3J7AK 4X64H 2WE6A 2WAQA 1I4GA 3OUUA 2K5NA 3S9WA 1IL8A 1X6OA 1GHJA 3K6OA 4DL6A 2VY3A 1D1KA 2PCFB 3C1EA 5C3EG 1PYWD 2PNHA 5EGTA 3RLOA 2F0UA 1DOKA 4DR4L 1DXMA 1KDBA 4EQNA 1W2BA 4ECRA 1TWAH 4GKJL 3L7ZC 3PF5A 1WTWA 4ME3A 1SFOH 3RR5A 2YU9B 5CV4A 1IBLQ 2YTVA 3TINA 3N43B 3GIPA 4K0KL 2YU9A 1VQ5A 3C1FA 4BBSB 1KL9A 2IW3A 1VQGA 4B3TL 3GTMB 1AN7A 1KJQA 3QZ8A 1CK1A 5E3FA 1GSHA 3D31A 2QGQA 3H3VI 2CZGA 1VQ8A 2YRXA 3GLKA 1YIJA 5CA1F 3RD4A 3A8KE 1FNVA 5KNCA 1OO9B 1X3QA 1YNJC 4GS3A 1AEXA 4X66L 4QW8A 4L8JA 2RVLA 5CC4A 1B9NA 3K8AA 2FPPB 1K8MA 1S5ED 3ER0A 4S3SA 1HPCA 1V4YA 3D4DA 5ISRA 1ULZA 1B04A 1BJTA 3TQYA 1F2LA 1SYBA 4K5WA 3GTPH 5KFVA 4NP5A 2EJGC 5LP6F 4Y8VB 1JE5A 1Y1VA 3ZJYC 2B2VC 3KF8B 1NMFA 3CC2A 2AQ2B 5EBCA 3H40A 4ECXA 1N48A 1KHIA 4IUUA 3GTPA 1RODA 1TWGH 5M3FH 4A3BG 3DM1A 1ICWA 4UP8A 1HZCA 1YBYA 5EAYA 2FXQA 4J15A 1QUQA 1K0SA 2KOLA 4TVAB 3TZUA 2JA8G 1L1OB 3BQ1A 4PQXA 2RGRA 4IUQA 3JRWA 1R4PB 4DR5Q 2R7NA 3S1RB 1B70B 4XIGS 1VQOA 5JPMC 1VBGA 1VMPA 2WIIB 5KNDA 1G6ZA 3KAKA 1T5EA 2EYMA 4JCVE 3PO3G 4KY5A 1PRTB 3QJYA 3U58A 4NXNQ 1HA5A 4C3HH 4GKKQ 1LT3D 4YJ2F 3SI8A 4WBNF 3BDOA 2NB0A 3DWAA 3HOUH 2FP4B 1UNSA 1STGA 2EIFA 2OQ0A 4UDUC 3R23A 3PO2B 1ZKOA 1B7YB 1RYRA 1K1SA 3WO1A 2R61A 1PTOD 4U673 4ECYA 5C44B 4DR5L 4OIJA 1S5CD 1GSAA 4BWGB 4ED2A 1PH9A 1GHKA 5IP7G 4IURA 3N6RA 3IFTA 1WH2A 1S5DD 1HUMA 4BWSC 5IT9c 3H6MA 5LYJF 1E1TA 1LTID 2EJMA 4KN7C 1V43A 4DR6Q 1CKOA 2VQDA 4DUZH 5F9NA 5DM63 4XX0B 3T1HQ 4BY1G 1S10A 4JI1L 5JAVA 1D2BA 3BVMA 4ZQ3A 4AYBB 1AE2A 4DAYB 3CCRA 4A3IB 4TQSA 1VQAA 1VDZA 3LWUA 3T4AC 1X56A 2BDOA 3I7FA 1MBYA 1PZKD 2OWOA 3U50C 1LTSD 2R7DA 2GN5A 3FKIG 4RAUC 3TIIA 2VA3A 4A93H 1I50H 4AIMA 3SHLA 5IGEA 3KHGA 1AN8A 3DF7A 1S0MA 4LFBH 1RDPD 3NHHA 3GV7B 3KTMA 4JI8Q 4YCWA 3CCLA 1ASZA 1DZ1A 1FVIA 3OHXC 5M3FG 1C0AA 1VQPA 3BJYA 3GTLA 2MPMA 3MFHA 4CDEC 4QUCA 4HIDA 4DKAC 2ASJA 3URYA 3GTPB 1VF5C 3H4DA 1QNKA 2F0GA 1U4PA 4RHRA 3AFQA 4GN3B 1EYAA 4DLKA 4LFAL 4CKBA 4POGA 1PYSB 4K2KA 4Y52H 3MXGA 5D1PA 4IUPA 2UUCH 4EYHB 1GUOA 4BXXG 3PIOA 2B2YA 4UP7A 2JN4A 1T9HA 3Q0AA 2BA1A 1VBHA 4ZLTF 2XGPA 3DLLA 3HKZA 4LF6H 2L0CA 5G3LF 4J1MA 5L1KA 3VR2A 2XWJB 5I6WA 4K0KQ 5IOCA 4RCNA 1DD2A 4QL5A 1HZBA 2A19A 3RLFA 4YP3A 2XCPA 3RAQA 3RF2A 5FD6A 3TP7A 4QWDA 1PFNA 1WTVA 3AMUA 1O78A 2EY6A 1EFID 3PCOB 3U4ZA 4YIJA 3GTOH 4DV5L 1DGSA 4JW0A 5IYCH 3H0GG 2Q8RE 1XMQL 1CS0A 4C5CA 4C5AA 4DV2H 3RUZA 2WB1E 4E4TA 5FLMH 4O2AF 3E3XA 4C5BA 4A3LG 2W70A 4XQNA 1EWHA 4RB0A 1SBBB 2R7LA 3GTQH 1DCZA 2GA4B 1DONA 1I3QA 3A56A 1STNA 4LSAA 4JV0A 2VQFH 2DZDA 3MR6A 4JYAH 1FJGQ 3DEPA 2E2JB 4LF4Q 5KT6A 4B9XA 2ID0A 5BR8L 1UUPA 1A15A 4YR0A 3S2DB 3NEMA 1BGWA 2F4VH 3IN5A 1N32L 1O7IA 2QDLA 4U68A 3N8DA 1WCMH 2NU8B 3RIZA 5C44H 3I3CA 3G71A 2A74C 2W9CB 2F0EA 4IFDJ 1SYCA 4DFAA 3QWNA 3M9NB 1BR9A 2PZTA 3GIQA 5K2MA 1LO5D 3PQIA 3IL8A 2WP8J 1Q8KA 5IODA 2ZJRA 4IJLA 3PO2H 3JC66 1W6JA 3A8IE 3PVXA 1WCMA 3MVVA 1TR5A 4DV1Q 5CV5A 5CORA 4JI0Q 5FK9C 1LYLA 3GIMA 4PZ8A 4CJ2C 2JA9A 5KRUA 1N8RC 2I07B 1L0WA 2A5HA 3LGJA 4NXMH 4NXML 4IOCA 4ED1A 4DAVA 1PHJA 1QILA 5ELEA 1NCVA 1RL2A 1JX4A 3CPFA 1VQLA 2AGQA 3BU2A 1XNRQ 2ZM6H 4LF5L 3EQLC 1D5XC 3H15A 1B3AA 1S5BD 3D0FA 4JVZA 2DIKA 4EEYA 4L5QA 2XWBB 3FRPB 1SFOB 3L4KA 3PZPA 3GTMA 1B1ZA 1KTKA 3TN2A 2F4VL 4A3BB 3WOEA 3TEHB 1PV4A 5IT9E 1VCIA 5KT4A 3HOXH 3F2CA 3I4NG 5J2TF 2FK1A 1CFMA 3OWFA 3T51B 2JA6H 4QY7A 5FLXL 1AUVA 5CV6A 2NN6H 2W6NA 3GV3A 5LHY1 4O3OA 3S17H 2VQFL 1S3OA 5I9PA 1V1QA 2CHBD 2O5JC 1PH6A 4C56C 2A6HC 5J1ZA 2WAQB 1GGOA 3PV0A 2KCCA 4LF8Q 1VQ6A 3JSNA 1J5EH 1NBWA 1CKMA 1DYQA 1T3NA 4JI6L 1YZ6A 3MWEA 5C3WA 1A63A 3MR3A 1S72A 4RNNA 2LXJA 1NY4A 2F0OA 2UU9Q 4GNXB 3V6KA 1FR3A 3K7UC 3UDGA 4ME6A
chains in the Genus database with same CATH topology
4P74A 3OW2A 4A3DH 2PI2E 1E3PA 2F52A 4HIKA 1KQSA 2RCNA 2ZTEA 3GO5A 4A76A 3F2BA 5J3BA 1TXYA 4DV1L 2Q2IA 2OQKA 1Y1WH 5HGQA 1HNXL 1Q1BA 2HHHL 1N36L 1N33Q 4P72A 1FGUA 3HKZG 3OTOQ 1KD1C 2UUAL 4JC0A 3NENA 5LMNL 4JI4Q 2JA7H 2IHFA 2MO0A 1JJ2A 4A3DG 2UXBL 2N49A 1LTLA 1SE8A 4LFBQ 4DV7Q 2AHOB 1EOVA 1VQ4A 1EWIA 3G6EA 4DV3L 3BZCA 4A3GG 1N32Q 1WJJA 2E2IH 5AJ3L 1SROA 3AFPA 4DV0L 2D0OA 1UE5A 4R4TA 2E5LL 4UY8C 3HOYG 1V9PA 3TS2A 5C4XH 1IBLL 1Q46A 1UE7A 1G51A 5M5XH 3M4OH 4IFDI 3HKZE 5LMNQ 4JI4L 2UXBQ 1Q7YC 4LF5Q 3UE1A 3PUZA 4A3JG 1K73C 3CAMA 4DR3L 1I94Q 1R9TH 4JYAQ 2ZTDA 1D8LA 1K9MC 2KCTA 1HR0L 3L2PA 2D0PA 3ERSX 4DK3C 5C44G 2MO1A 4OX9L 4PG3A 1A62A 2MFIA 3J81j 1C9OA 3CD6A 1KRSA 4ALPA 4A3EG 5C0XJ 5JJKA 1M90C 1XNQL 1OXTA 3H0GH 4HJ9A 3HOVH 1GM5A 1XMOQ 5GROA 3E0EA 1Q86C 1OXVA 2Q2UA 4HIOA 2HIVA 3CMAA 1YJNA 4B3MQ 1LUZA 4O2DA 1X54A 4X62L 2HT1A 2NN6G 4A3BH 5AJ3Q 2E5LQ 4BBSH 1X55A 2K4KA 1PFSA 1N9WA 1OXXK 3M4QA 2UU9L 4JBWA 3UE0A 1I5FA 1SLJA 2AKWB 4A3KH 4UP9A 4BBRG 3RN2A 1IXRA 3I4MG 2ZJQA 4C3JH 4NPSA 3HOZG 3K0XA 4IJHA 2H5XA 1MJCA 2DUDA 3UDIA 3A74A 3AQQA 2N3SA 4DV4L 1P8LA 4DR1Q 4AQYL 2E2HH 1JJCB 3CQZH 1NMGA 4L5TA 2UUCQ 2EXDA 2JQOA 2HHHQ 2CCZA 3J7ZC 4LF7L 1GD7A 5IYCG 1BBUA 2C35B 4HJAA 3CW2C 4OO1G 2WAQG 3NBHB 2OTLA 1PA6A 2CWAA 1M1KC 5C4JH 2Y0SE 2YYZA 3K80C 1Y1WG 1SRUA 3CC4A 5GAEC 3L0OA 1VQFA 2D62A 4YHHQ 1Q82C 1HNWQ 3HOUG 1X3FA 1ASYA 1IBMQ 4DK6C 4LF6L 5M3MH 3JAMi 4X65Q 1OXUA 1XNRL 1GO3E 4O0AA 3F2DA 1CSQA 3UDGA 2NVXH 4A3GH 1E22A 5K36G 1H95A 2VUMH 1K3RA 1YHBA 2N8NA 3TREA 4JOIA 1WI5A 4NB3A 2JEBI 2PI2A 2L15A 2VQFQ 3W1BA 1EUJA 2VW9A 4IOAA 1HR0W 2KENA 1JJGA 3ULPA 3T1YL 3TS0A 4LUZA 1AE3A 3PUVA 4DUZL 3PO2G 5H1SE 5LMUQ 2OTJA 4DR1L 2DGYA 5ELNA 2Z0SA 4HIMA 1XPOA 2F4VQ 2YTXA 2NVQH 3E9HA 5FJ8G 2NVTH 1EQRA 3I56A 1NE3A 3J81i 1CKNB 3CCMA 4A93G 4A3EH 5IWAQ 4LF4L 5IY0A 1P16A 3PUXA 4RG1A 3WWVA 1QZHA 1PH8A 4LFCL 4L5SA 1XJVA 2B3GA 2R93H 2Z6KA 4X62Q 1PVOA 3CCUA 4KHZA 5M5WH 3G48A 4JOIC 4B3ML 4LFBL 4NXNL 2NN6I 2RHSB 1Y14B 2WFWA 3GD7A 1EYGA 1XMOL 2I5MX 4JYAL 1GVPA 1HNZL 3OTOL 4YY3Q 4DV6Q 1QVGA 1N33L 1N36Q 4JI2Q 2JA8H 2NVYH 1XMQQ 4NXMQ 1QVCA 1XPRA 3T1HL 2K5NA 5IYDG 1X6OA 5M5YH 1MKHA 2VY3A 4YWLA 2NZOA 5C3EG 3CPWA 4JI0L 2PNHA 3RLOA 4EX5A 4R4IA 1Q1EA 1VQMA 4DR4L 3KF6A 5C0XG 2KHIA 1AH9A 1X3EA 1W2BA 1TWAH 4GKJL 3L7ZC 3PF5A 1SFOH 4ME3A 4JBMA 3RR5A 3UDFA 3RZDH 3BZKA 4BA2I 1IBLQ 1TWFH 3FKIH 2B29A 2R92H 1VQIA 1PH5A 2JA7G 2I0QA 2YTVA 3CCEA 3I4OA 2EQSA 2VL6A 4K0KL 1BVSA 2UXCQ 2XGTA 1VQ5A 3GTKH 1KL9A 1SR3A 1I6HH 4DV3Q 3CP0A 1UWVA 1VQGA 4B3TL 4LWCA 3PGZA 4MZ9A 3D31A 2QGQA 3H3VI 1VQ8A 4JI7L 1PH4A 2I5LX 1YIJA 2VNUD 2OCEA 2PQAB 2CKZB 4PZ7A 1NTGA 4GKKL 2QEXA 2ES2A 4DV2L 4GS3A 2YU9H 4X64Q 4X66L 2NZHA 1G6PA 3PSIA 4JI5L 2VQEQ 4A3JH 4KI0A 4A3LH 3K8AA 3STBD 5GAHC 4BY7G 5M3MG 3ER0A 4JI8L 3JAMc 1BBWA 1Y1VH 2JJQA 4B3RL 4QQBX 3EBEA 4AYBG 3ICEA 3KLWA 5IP9H 1SN8A 2V1CC 3TQYA 4KHPQ 1SMXA 2HQLA 3GTPH 4JBKA 1A8VA 4LW1A 3VDYA 2UXDL 4DR2L 1W3SA 3EN2A 3W5OA 1KIXA 1VQ7A 4DV5Q 1JE5A 3IRBA 1N34Q 2UUBL 4DR7Q 3ZJYC 4IPHA 1YJWA 1QZGA 4B3RQ 3KF8B 1FL0A 1NMFA 3CC2A 3AYHB 4B3TQ 4LF8L 1PH1A 4GN5A 1KHIA 3ULLA 3J80c 1TWCH 3CXCA 1TWGH 4BA1I 5M3FH 4A3BG 4JV5Q 1IYJB 5FJ8H 3PF4A 3HOXG 1VQHA 2K50A 1YBYA 1HZCA 4UP8A 5EAYA 3ULJA 3I4NH 3KFUA 2FXQA 4J15A 1EQQA 1UEBA 2K52A 3HOZH 5IYBG 4DUYQ 4GNXC 1QUQA 4A3FG 3HOWG 4JG2A 3A0JA 4TVAB 2ZM6Q 1XPUA 2JA8G 1VQCA 1L1OB 3KOJA 2VS1A 4DR5Q 1VQOA 1B70B 4XIGS 2BH8A 4YWKA 5DLQE 4C3IH 4LNQA 5FLXc 2IX0A 5IYDH 4R4OA 1X65A 2XTIA 3HOVG 5BR8Q 2BH2A 2VQEL 4JI5Q 3I55A 4B3SQ 4X66Q 4JCVE 1NJIC 3PO3G 3U58A 3OYYA 1VQDA 4C3HH 4NXNQ 3TRZA 4GKKQ 1WCMG 3CCSA 2KCMA 5IE8A 4JI3Q 4JI7Q 4LUOA 4IPCA 3CCQA 4JBJA 2LSSA 2A8VA 3RNUA 3H3VH 4FDBA 3HOUH 4YWMA 3J7A5 3KDFA 3S15H 3FP9A 2EIFA 2IHEA 2OQ0A 4B3SL 4R1JA 1KRTA 4OWTB 1EFWA 2R92G 4A3CH 3S24A 1KAWA 4P73A 4X6AH 1VQ9A 1B7YB 4DAMA 1IBKL 3CMEA 2VZAA 4JI1Q 4POFA 3KDFB 1J5EQ 4PZ6A 4DR5L 4DPGA 4GLAC 1L2FA 5IP7G 1PYBA 2N78A 1PH9A 3S14H 1K8AC 3DM3A 3T1YQ 2E8GA 2IY5B 3M4PA 2F3IA 1MJEA 4BY7H 5IT9c 1E1TA 4DR6Q 4UPAA 1V43A 1CKOA 3STBC 2KHJA 1J5EL 1CKNA 4BY1G 3G4SA 1VQBA 3T1HQ 4JI1L 1PH3A 2QA4A 1L1OA 2Z6KC 4DAYB 3CCRA 1AE2A 4DR7L 1VQAA 3GTJH 1U5KA 4JV5L 1HNZQ 1X56A 3I7FA 4RMFA 2OWOA 2UXDQ 3U50C 4YCUA 2R7DA 1RIPA 2WB1G 2GN5A 3FKIG 4GOPA 1IBML 4LF6Q 3GTLH 2KBNA 1FJGL 1I50H 3RLNA 3S1RH 4A93H 4LFAQ 4AIMA 3UDXA 3A5UA 1N34L 4LFCQ 1YI2A 2A1AA 2VUMG 4R4QA 4JI8Q 4YCWA 1YJ9A 3CCLA 3EIVA 1ASZA 4LF9Q 1FVIA 5IWAL 3A5ZB 5M3FG 1C0AA 5E7NA 4KLKA 1VQPA 2Q2TA 1HZAA 1BKBA 4HIDA 4DKAC 1E24A 4HJ7A 1E7ZA 1A0IA 4MTNA 4C2MH 4AYBE 1UE6A 4EQ5A 3AFQA 3I2ZA 1YNXA 4GN3B 4GOPC 4LF7Q 3HOWH 3PUWA 2R6GA 1YHQA 4DUZQ 4LFAL 4POGA 4IFDG 2PMZE 1PYSB 4MNOA 4OWWB 4Y52H 3F1ZA 4GLXA 2ZM6L 3K81C 1S40A 3KYHC 4BXXG 3S2DH 3PIOA 2AWNA 4A3FH 4UP7A 5IP9G 1HZ9A 1T9HA 2WAQE 2BA1A 1VQEA 4P71A 1K0RA 5GADC 3DLLA 3J81c 4IO9A 4BBRH 4A3MG 2K5HA 3RN5A 3PUYA 3GTGH 4HJ5A 4WJ4A 2AWOA 1D7QA 2JE6I 1OTCA 2B63H 2JA6G 4DR6L 5FLMG 4DR2Q 1YHAA 4QL5A 4K0KQ 1HZBA 2A19A 2ALYB 3Q8DA 2CFMA 3RLFA 3PO3H 4BXXH 4OONA 5JEAG 3S16H 1KXLA 5LMNW 4YHHL 3PCOB 3U4ZA 1CUKA 1GKHA 2PQAA 3GTOH 4DV5L 3U4VA 4HJ8A 1DGSA 1VS0A 3B6YA 4LUVA 5IYCH 3H0GG 1XMQL 5GAGC 1XNQQ 3MEFA 1HJPA 2WB1E 5FLMH 4KHPL 4OX9Q 4A3LG 3KJPA 5IYBH 4X64L 5C3EH 4LF9L 4BBSG 4DV2Q 4GNXA 1JMCA 4XTCS 3J80i 2K14A 1Y1VG 1YVCA 4P75A 1JB7A 1HR0Q 2JEAI 4H02A 3GTMH 4TQUS 3SGIA 3GTQH 4AH6A 2UXCL 4YCVA 3HFZB 3KF6B 2IX1A 4A3CG 4A3KG 1I94L 1WYDA 2YTYA 4JI2L 3HKSA 1FJGQ 3K7AH 3AEVA 4YY3L 2ZTCA 2JA5H 3HOYH 5C0XI 2UUCL 2CQOA 4GLVB 3CCVA 1PH7A 2R7ZH 4LF4Q 1J6QA 2Y0SG 1TWHH 5IP7H 2RF4A 2ID0A 3E9IA 5BR8L 1WOCA 2IT1A 2ATWA 3NEMA 1C7YA 2GVBA 1N32L 4L5RC 1O7IA 2JA5G 1WCMH 4QGUA 5HY6A 4IPGA 5C44H 3G71A 2R7ZG 5JJIA 1IL2A 3M7NA 4IFDJ 2K5VA 4R4CA 3W1GA 1CSPA 1Q81C 5ELOA 3S1MH 1G291 4IPDA 1K83H 4DUYL 1LM0A 4OXPA 2ZJRA 2WP8J 1Q8KA 2YV5A 3PO2H 1U0LA 1B8AA 4IJLA 3JC66 2R7FA 4DR4Q 1IBKQ 1JT8A 1HNXQ 4DV1Q 4A3IG 3FHWA 4JI0Q 1LYLA 4DV6L 1Z9FA 4PZ8A 1YEZA 1WFQA 2JA9A 3NELA 1KC8C 4GN4B 1N8RC 1L0WA 2ZJPA 3LGJA 4NXML 4IOCA 2ASBA 4A4IA 1PHJA 3KJOA 4OO1I 2HIXA 2BA0A 4JI3L 1RL2A 5C4XG 4DR3Q 5JEAJ 3CPFA 1VQLA 3BU2A 3GDEA 1IZ6A 2UUBQ 1XNRQ 4LF5L 2CWPA 2GVAA 1QUQB 4A75A 1EIFA 3H15A 4A3IH 3D0FA 3PIPA 4L5QA 1OXSC 4GOPB 1HNWL 4DV0Q 1VQJA 1I3QH 3F8TA 2JK8A 3CF5A 2F4VL 3S1QH 3TEHB 2AMCB 4DNIA 1PV4A 1VCIA 3HOXH 3F2CA 3I4NG 3M9BA 4WJ3M 3S2HH 5GQOA 4PMWA 4QY7A 2B63G 1Q12A 4DV7L 2JA6H 4OWXB 3S1NH 1K8GA 4QIWE 1EIYB 4AQYQ 3S17H 2VQFL 5LMUL 1S3OA 2UUAQ 3CCJA 1YITA 3I4MH 1V1QA 1Z47A 1PH6A 1MIUA 3CC7A 2RHQB 4DV4Q 1X9NA 3M3YH 2MNAA 4X65L 1VQKA 3PV0A 5JJLA 4LF8Q 1VQ6A 2R93G 1VQNA 3BJUA 1QVFA 1E1OA 1L1OC 1NBWA 1XTDA 1CKMA 2K75A 3MXNB 2LXKA 4JI6L 1YZ6A 3RZOH 4BY1H 1UE1A 1S72A 1A63A 2LXJA 1NY4A 2MQHA 2Q2HA 3M85A 2UU9Q 2I5HA 1X3GA 4GKJQ 4GNXB 4QJFA 3K7UC 4Y7NH 4JI6Q 4APVA 4A3MH 1PH2A 2E2JH 1HH2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P74 A;  3OW2 A;  4A3D H;  2PI2 E;  1E3P A;  2F52 A;  4HIK A;  1KQS A;  2RCN A;  2ZTE A;  3GO5 A;  4A76 A;  3F2B A;  5J3B A;  1TXY A;  4DV1 L;  2Q2I A;  2OQK A;  1Y1W H;  5HGQ A;  1HNX L;  1Q1B A;  2HHH L;  1N36 L;  1N33 Q;  4P72 A;  1FGU A;  3HKZ G;  3OTO Q;  1KD1 C;  2UUA L;  4JC0 A;  3NEN A;  5LMN L;  4JI4 Q;  2JA7 H;  2IHF A;  2MO0 A;  1JJ2 A;  4A3D G;  2UXB L;  2N49 A;  1LTL A;  1SE8 A;  4LFB Q;  4DV7 Q;  2AHO B;  1EOV A;  1VQ4 A;  1EWI A;  3G6E A;  4DV3 L;  3BZC A;  4A3G G;  1N32 Q;  1WJJ A;  2E2I H;  5AJ3 L;  1SRO A;  3AFP A;  4DV0 L;  2D0O A;  1UE5 A;  4R4T A;  2E5L L;  4UY8 C;  3HOY G;  1V9P A;  3TS2 A;  5C4X H;  1IBL L;  1Q46 A;  1UE7 A;  1G51 A;  5M5X H;  3M4O H;  4IFD I;  3HKZ E;  5LMN Q;  4JI4 L;  2UXB Q;  1Q7Y C;  4LF5 Q;  3UE1 A;  3PUZ A;  4A3J G;  1K73 C;  3CAM A;  4DR3 L;  1I94 Q;  1R9T H;  4JYA Q;  2ZTD A;  1D8L A;  1K9M C;  2KCT A;  1HR0 L;  3L2P A;  2D0P A;  3ERS X;  4DK3 C;  5C44 G;  2MO1 A;  4OX9 L;  4PG3 A;  1A62 A;  2MFI A;  3J81 j;  1C9O A;  3CD6 A;  1KRS A;  4ALP A;  4A3E G;  5C0X J;  5JJK A;  1M90 C;  1XNQ L;  1OXT A;  3H0G H;  4HJ9 A;  3HOV H;  1GM5 A;  1XMO Q;  5GRO A;  3E0E A;  1Q86 C;  1OXV A;  2Q2U A;  4HIO A;  2HIV A;  3CMA A;  1YJN A;  4B3M Q;  1LUZ A;  4O2D A;  1X54 A;  4X62 L;  2HT1 A;  2NN6 G;  4A3B H;  5AJ3 Q;  2E5L Q;  4BBS H;  1X55 A;  2K4K A;  1PFS A;  1N9W A;  1OXX K;  3M4Q A;  2UU9 L;  4JBW A;  3UE0 A;  1I5F A;  1SLJ A;  2AKW B;  4A3K H;  4UP9 A;  4BBR G;  3RN2 A;  1IXR A;  3I4M G;  2ZJQ A;  4C3J H;  4NPS A;  3HOZ G;  3K0X A;  4IJH A;  2H5X A;  1MJC A;  2DUD A;  3UDI A;  3A74 A;  3AQQ A;  2N3S A;  4DV4 L;  1P8L A;  4DR1 Q;  4AQY L;  2E2H H;  1JJC B;  3CQZ H;  1NMG A;  4L5T A;  2UUC Q;  2EXD A;  2JQO A;  2HHH Q;  2CCZ A;  3J7Z C;  4LF7 L;  1GD7 A;  5IYC G;  1BBU A;  2C35 B;  4HJA A;  3CW2 C;  4OO1 G;  2WAQ G;  3NBH B;  2OTL A;  1PA6 A;  2CWA A;  1M1K C;  5C4J H;  2Y0S E;  2YYZ A;  3K80 C;  1Y1W G;  1SRU A;  3CC4 A;  5GAE C;  3L0O A;  1VQF A;  2D62 A;  4YHH Q;  1Q82 C;  1HNW Q;  3HOU G;  1X3F A;  1ASY A;  1IBM Q;  4DK6 C;  4LF6 L;  5M3M H;  3JAM i;  4X65 Q;  1OXU A;  1XNR L;  1GO3 E;  4O0A A;  3F2D A;  1CSQ A;  3UDG A;  2NVX H;  4A3G H;  1E22 A;  5K36 G;  1H95 A;  2VUM H;  1K3R A;  1YHB A;  2N8N A;  3TRE A;  4JOI A;  1WI5 A;  4NB3 A;  2JEB I;  2PI2 A;  2L15 A;  2VQF Q;  3W1B A;  1EUJ A;  2VW9 A;  4IOA A;  1HR0 W;  2KEN A;  1JJG A;  3ULP A;  3T1Y L;  3TS0 A;  4LUZ A;  1AE3 A;  3PUV A;  4DUZ L;  3PO2 G;  5H1S E;  5LMU Q;  2OTJ A;  4DR1 L;  2DGY A;  5ELN A;  2Z0S A;  4HIM A;  1XPO A;  2F4V Q;  2YTX A;  2NVQ H;  3E9H A;  5FJ8 G;  2NVT H;  1EQR A;  3I56 A;  1NE3 A;  3J81 i;  1CKN B;  3CCM A;  4A93 G;  4A3E H;  5IWA Q;  4LF4 L;  5IY0 A;  1P16 A;  3PUX A;  4RG1 A;  3WWV A;  1QZH A;  1PH8 A;  4LFC L;  4L5S A;  1XJV A;  2B3G A;  2R93 H;  2Z6K A;  4X62 Q;  1PVO A;  3CCU A;  4KHZ A;  5M5W H;  3G48 A;  4JOI C;  4B3M L;  4LFB L;  4NXN L;  2NN6 I;  2RHS B;  1Y14 B;  2WFW A;  3GD7 A;  1EYG A;  1XMO L;  2I5M X;  4JYA L;  1GVP A;  1HNZ L;  3OTO L;  4YY3 Q;  4DV6 Q;  1QVG A;  1N33 L;  1N36 Q;  4JI2 Q;  2JA8 H;  2NVY H;  1XMQ Q;  4NXM Q;  1QVC A;  1XPR A;  3T1H L;  2K5N A;  5IYD G;  1X6O A;  5M5Y H;  1MKH A;  2VY3 A;  4YWL A;  2NZO A;  5C3E G;  3CPW A;  4JI0 L;  2PNH A;  3RLO A;  4EX5 A;  4R4I A;  1Q1E A;  1VQM A;  4DR4 L;  3KF6 A;  5C0X G;  2KHI A;  1AH9 A;  1X3E A;  1W2B A;  1TWA H;  4GKJ L;  3L7Z C;  3PF5 A;  1SFO H;  4ME3 A;  4JBM A;  3RR5 A;  3UDF A;  3RZD H;  3BZK A;  4BA2 I;  1IBL Q;  1TWF H;  3FKI H;  2B29 A;  2R92 H;  1VQI A;  1PH5 A;  2JA7 G;  2I0Q A;  2YTV A;  3CCE A;  3I4O A;  2EQS A;  2VL6 A;  4K0K L;  1BVS A;  2UXC Q;  2XGT A;  1VQ5 A;  3GTK H;  1KL9 A;  1SR3 A;  1I6H H;  4DV3 Q;  3CP0 A;  1UWV A;  1VQG A;  4B3T L;  4LWC A;  3PGZ A;  4MZ9 A;  3D31 A;  2QGQ A;  3H3V I;  1VQ8 A;  4JI7 L;  1PH4 A;  2I5L X;  1YIJ A;  2VNU D;  2OCE A;  2PQA B;  2CKZ B;  4PZ7 A;  1NTG A;  4GKK L;  2QEX A;  2ES2 A;  4DV2 L;  4GS3 A;  2YU9 H;  4X64 Q;  4X66 L;  2NZH A;  1G6P A;  3PSI A;  4JI5 L;  2VQE Q;  4A3J H;  4KI0 A;  4A3L H;  3K8A A;  3STB D;  5GAH C;  4BY7 G;  5M3M G;  3ER0 A;  4JI8 L;  3JAM c;  1BBW A;  1Y1V H;  2JJQ A;  4B3R L;  4QQB X;  3EBE A;  4AYB G;  3ICE A;  3KLW A;  5IP9 H;  1SN8 A;  2V1C C;  3TQY A;  4KHP Q;  1SMX A;  2HQL A;  3GTP H;  4JBK A;  1A8V A;  4LW1 A;  3VDY A;  2UXD L;  4DR2 L;  1W3S A;  3EN2 A;  3W5O A;  1KIX A;  1VQ7 A;  4DV5 Q;  1JE5 A;  3IRB A;  1N34 Q;  2UUB L;  4DR7 Q;  3ZJY C;  4IPH A;  1YJW A;  1QZG A;  4B3R Q;  3KF8 B;  1FL0 A;  1NMF A;  3CC2 A;  3AYH B;  4B3T Q;  4LF8 L;  1PH1 A;  4GN5 A;  1KHI A;  3ULL A;  3J80 c;  1TWC H;  3CXC A;  1TWG H;  4BA1 I;  5M3F H;  4A3B G;  4JV5 Q;  1IYJ B;  5FJ8 H;  3PF4 A;  3HOX G;  1VQH A;  2K50 A;  1YBY A;  1HZC A;  4UP8 A;  5EAY A;  3ULJ A;  3I4N H;  3KFU A;  2FXQ A;  4J15 A;  1EQQ A;  1UEB A;  2K52 A;  3HOZ H;  5IYB G;  4DUY Q;  4GNX C;  1QUQ A;  4A3F G;  3HOW G;  4JG2 A;  3A0J A;  4TVA B;  2ZM6 Q;  1XPU A;  2JA8 G;  1VQC A;  1L1O B;  3KOJ A;  2VS1 A;  4DR5 Q;  1VQO A;  1B70 B;  4XIG S;  2BH8 A;  4YWK A;  5DLQ E;  4C3I H;  4LNQ A;  5FLX c;  2IX0 A;  5IYD H;  4R4O A;  1X65 A;  2XTI A;  3HOV G;  5BR8 Q;  2BH2 A;  2VQE L;  4JI5 Q;  3I55 A;  4B3S Q;  4X66 Q;  4JCV E;  1NJI C;  3PO3 G;  3U58 A;  3OYY A;  1VQD A;  4C3H H;  4NXN Q;  3TRZ A;  4GKK Q;  1WCM G;  3CCS A;  2KCM A;  5IE8 A;  4JI3 Q;  4JI7 Q;  4LUO A;  4IPC A;  3CCQ A;  4JBJ A;  2LSS A;  2A8V A;  3RNU A;  3H3V H;  4FDB A;  3HOU H;  4YWM A;  3J7A 5;  3KDF A;  3S15 H;  3FP9 A;  2EIF A;  2IHE A;  2OQ0 A;  4B3S L;  4R1J A;  1KRT A;  4OWT B;  1EFW A;  2R92 G;  4A3C H;  3S24 A;  1KAW A;  4P73 A;  4X6A H;  1VQ9 A;  1B7Y B;  4DAM A;  1IBK L;  3CME A;  2VZA A;  4JI1 Q;  4POF A;  3KDF B;  1J5E Q;  4PZ6 A;  4DR5 L;  4DPG A;  4GLA C;  1L2F A;  5IP7 G;  1PYB A;  2N78 A;  1PH9 A;  3S14 H;  1K8A C;  3DM3 A;  3T1Y Q;  2E8G A;  2IY5 B;  3M4P A;  2F3I A;  1MJE A;  4BY7 H;  5IT9 c;  1E1T A;  4DR6 Q;  4UPA A;  1V43 A;  1CKO A;  3STB C;  2KHJ A;  1J5E L;  1CKN A;  4BY1 G;  3G4S A;  1VQB A;  3T1H Q;  4JI1 L;  1PH3 A;  2QA4 A;  1L1O A;  2Z6K C;  4DAY B;  3CCR A;  1AE2 A;  4DR7 L;  1VQA A;  3GTJ H;  1U5K A;  4JV5 L;  1HNZ Q;  1X56 A;  3I7F A;  4RMF A;  2OWO A;  2UXD Q;  3U50 C;  4YCU A;  2R7D A;  1RIP A;  2WB1 G;  2GN5 A;  3FKI G;  4GOP A;  1IBM L;  4LF6 Q;  3GTL H;  2KBN A;  1FJG L;  1I50 H;  3RLN A;  3S1R H;  4A93 H;  4LFA Q;  4AIM A;  3UDX A;  3A5U A;  1N34 L;  4LFC Q;  1YI2 A;  2A1A A;  2VUM G;  4R4Q A;  4JI8 Q;  4YCW A;  1YJ9 A;  3CCL A;  3EIV A;  1ASZ A;  4LF9 Q;  1FVI A;  5IWA L;  3A5Z B;  5M3F G;  1C0A A;  5E7N A;  4KLK A;  1VQP A;  2Q2T A;  1HZA A;  1BKB A;  4HID A;  4DKA C;  1E24 A;  4HJ7 A;  1E7Z A;  1A0I A;  4MTN A;  4C2M H;  4AYB E;  1UE6 A;  4EQ5 A;  3AFQ A;  3I2Z A;  1YNX A;  4GN3 B;  4GOP C;  4LF7 Q;  3HOW H;  3PUW A;  2R6G A;  1YHQ A;  4DUZ Q;  4LFA L;  4POG A;  4IFD G;  2PMZ E;  1PYS B;  4MNO A;  4OWW B;  4Y52 H;  3F1Z A;  4GLX A;  2ZM6 L;  3K81 C;  1S40 A;  3KYH C;  4BXX G;  3S2D H;  3PIO A;  2AWN A;  4A3F H;  4UP7 A;  5IP9 G;  1HZ9 A;  1T9H A;  2WAQ E;  2BA1 A;  1VQE A;  4P71 A;  1K0R A;  5GAD C;  3DLL A;  3J81 c;  4IO9 A;  4BBR H;  4A3M G;  2K5H A;  3RN5 A;  3PUY A;  3GTG H;  4HJ5 A;  4WJ4 A;  2AWO A;  1D7Q A;  2JE6 I;  1OTC A;  2B63 H;  2JA6 G;  4DR6 L;  5FLM G;  4DR2 Q;  1YHA A;  4QL5 A;  4K0K Q;  1HZB A;  2A19 A;  2ALY B;  3Q8D A;  2CFM A;  3RLF A;  3PO3 H;  4BXX H;  4OON A;  5JEA G;  3S16 H;  1KXL A;  5LMN W;  4YHH L;  3PCO B;  3U4Z A;  1CUK A;  1GKH A;  2PQA A;  3GTO H;  4DV5 L;  3U4V A;  4HJ8 A;  1DGS A;  1VS0 A;  3B6Y A;  4LUV A;  5IYC H;  3H0G G;  1XMQ L;  5GAG C;  1XNQ Q;  3MEF A;  1HJP A;  2WB1 E;  5FLM H;  4KHP L;  4OX9 Q;  4A3L G;  3KJP A;  5IYB H;  4X64 L;  5C3E H;  4LF9 L;  4BBS G;  4DV2 Q;  4GNX A;  1JMC A;  4XTC S;  3J80 i;  2K14 A;  1Y1V G;  1YVC A;  4P75 A;  1JB7 A;  1HR0 Q;  2JEA I;  4H02 A;  3GTM H;  4TQU S;  3SGI A;  3GTQ H;  4AH6 A;  2UXC L;  4YCV A;  3HFZ B;  3KF6 B;  2IX1 A;  4A3C G;  4A3K G;  1I94 L;  1WYD A;  2YTY A;  4JI2 L;  3HKS A;  1FJG Q;  3K7A H;  3AEV A;  4YY3 L;  2ZTC A;  2JA5 H;  3HOY H;  5C0X I;  2UUC L;  2CQO A;  4GLV B;  3CCV A;  1PH7 A;  2R7Z H;  4LF4 Q;  1J6Q A;  2Y0S G;  1TWH H;  5IP7 H;  2RF4 A;  2ID0 A;  3E9I A;  5BR8 L;  1WOC A;  2IT1 A;  2ATW A;  3NEM A;  1C7Y A;  2GVB A;  1N32 L;  4L5R C;  1O7I A;  2JA5 G;  1WCM H;  4QGU A;  5HY6 A;  4IPG A;  5C44 H;  3G71 A;  2R7Z G;  5JJI A;  1IL2 A;  3M7N A;  4IFD J;  2K5V A;  4R4C A;  3W1G A;  1CSP A;  1Q81 C;  5ELO A;  3S1M H;  1G29 1;  4IPD A;  1K83 H;  4DUY L;  1LM0 A;  4OXP A;  2ZJR A;  2WP8 J;  1Q8K A;  2YV5 A;  3PO2 H;  1U0L A;  1B8A A;  4IJL A;  3JC6 6;  2R7F A;  4DR4 Q;  1IBK Q;  1JT8 A;  1HNX Q;  4DV1 Q;  4A3I G;  3FHW A;  4JI0 Q;  1LYL A;  4DV6 L;  1Z9F A;  4PZ8 A;  1YEZ A;  1WFQ A;  2JA9 A;  3NEL A;  1KC8 C;  4GN4 B;  1N8R C;  1L0W A;  2ZJP A;  3LGJ A;  4NXM L;  4IOC A;  2ASB A;  4A4I A;  1PHJ A;  3KJO A;  4OO1 I;  2HIX A;  2BA0 A;  4JI3 L;  1RL2 A;  5C4X G;  4DR3 Q;  5JEA J;  3CPF A;  1VQL A;  3BU2 A;  3GDE A;  1IZ6 A;  2UUB Q;  1XNR Q;  4LF5 L;  2CWP A;  2GVA A;  1QUQ B;  4A75 A;  1EIF A;  3H15 A;  4A3I H;  3D0F A;  3PIP A;  4L5Q A;  1OXS C;  4GOP B;  1HNW L;  4DV0 Q;  1VQJ A;  1I3Q H;  3F8T A;  2JK8 A;  3CF5 A;  2F4V L;  3S1Q H;  3TEH B;  2AMC B;  4DNI A;  1PV4 A;  1VCI A;  3HOX H;  3F2C A;  3I4N G;  3M9B A;  4WJ3 M;  3S2H H;  5GQO A;  4PMW A;  4QY7 A;  2B63 G;  1Q12 A;  4DV7 L;  2JA6 H;  4OWX B;  3S1N H;  1K8G A;  4QIW E;  1EIY B;  4AQY Q;  3S17 H;  2VQF L;  5LMU L;  1S3O A;  2UUA Q;  3CCJ A;  1YIT A;  3I4M H;  1V1Q A;  1Z47 A;  1PH6 A;  1MIU A;  3CC7 A;  2RHQ B;  4DV4 Q;  1X9N A;  3M3Y H;  2MNA A;  4X65 L;  1VQK A;  3PV0 A;  5JJL A;  4LF8 Q;  1VQ6 A;  2R93 G;  1VQN A;  3BJU A;  1QVF A;  1E1O A;  1L1O C;  1NBW A;  1XTD A;  1CKM A;  2K75 A;  3MXN B;  2LXK A;  4JI6 L;  1YZ6 A;  3RZO H;  4BY1 H;  1UE1 A;  1S72 A;  1A63 A;  2LXJ A;  1NY4 A;  2MQH A;  2Q2H A;  3M85 A;  2UU9 Q;  2I5H A;  1X3G A;  4GKJ Q;  4GNX B;  4QJF A;  3K7U C;  4Y7N H;  4JI6 Q;  4APV A;  4A3M H;  1PH2 A;  2E2J H;  1HH2 P; 
#chains in the Genus database with same CATH topology
 4RUC A;  4OO1 H;  1PZJ D;  1ZEQ X;  4A3D H;  1E3P A;  2AUK A;  2F52 A;  4K8J A;  3F2B A;  2KEC A;  4MTD A;  2BE5 D;  3MWD A;  3UQ8 A;  4DV1 L;  3HOW B;  3K5H A;  1JOQ A;  1Q1B A;  2HHH L;  3VPC A;  1BCP C;  4NW2 A;  1N33 Q;  5DLF A;  1FGU A;  4DL3 A;  4DAP A;  3HP3 A;  1IOW A;  1KJ8 A;  2JA7 H;  2WIN B;  1KJ9 A;  4A3D G;  3V6J A;  1WTP A;  1JR0 D;  3BAB A;  3ZYY X;  3RGZ A;  3GTK B;  4DV7 Q;  4XYM B;  5KKN B;  3P7J A;  3RV3 A;  3K5L A;  5DQI A;  1EWI A;  5F2D A;  3NP8 A;  4K5V A;  3TQT A;  1SYF A;  3R2T A;  2E2I H;  2E5L L;  4DV0 L;  1WCM B;  1TWA B;  1BNC A;  1IBL L;  1N32 H;  1UE7 A;  2KQ3 A;  4HYK A;  1G51 A;  1MD2 D;  2WB1 B;  2SDF A;  5M5X B;  4IFD I;  4ED8 A;  4JI4 L;  2UXB Q;  4IUV A;  2UVW A;  1Q7Y C;  4EBC A;  3UE1 A;  4FU0 A;  4A3J G;  4DR6 H;  2R8J A;  2ZTD A;  2CH4 A;  3H0G A;  1K9M C;  2KCT A;  1IHZ A;  1EYZ A;  3SE7 A;  4JI7 H;  2RDI A;  4KKU A;  5CBA E;  3RUP A;  4OX9 L;  2L5T A;  4IHJ F;  3Q8P B;  5C0X J;  4M1U B;  1OXT A;  2FPG B;  3MTS A;  1XMO Q;  3R5F A;  1Y1W B;  1EEF D;  2HIV A;  3QIA A;  3CMA A;  5EDW A;  2B2V A;  4EBE A;  1AZP A;  3D4R A;  4O2D A;  4ECW A;  2NN6 G;  2E5L Q;  5D1O B;  4LSX A;  1N9W A;  1OXX K;  3M4Q A;  4JBW A;  2AKW B;  4A3K H;  3FKI B;  1WTR A;  1SEI A;  2HVS A;  2ZJQ A;  2YW2 A;  4CJ0 B;  3K0X A;  2FE3 A;  2M05 A;  3NWS A;  4DV4 L;  4DR1 Q;  3FDT A;  4JUZ A;  3C2P A;  2UUC Q;  2JQO A;  1JWM D;  2L1B A;  2FPI B;  2CCZ A;  1SNC A;  4LF7 L;  5KFL A;  4RZR A;  1BUV T;  5CMD A;  2C35 B;  2FK2 A;  4OO1 G;  4APM A;  3R93 A;  2CWA A;  4R9W A;  2W6Q A;  2J9G A;  2O03 A;  3S1M B;  1C8C A;  4J0M A;  3L0O A;  2PMZ B;  5K5P A;  4HN7 A;  3NBH A;  1R9T A;  1G8Z D;  1VQF A;  2UVR A;  5JJZ A;  2XCL A;  4JK1 C;  4OHJ A;  4K2L A;  5M3M H;  3T53 B;  4LH7 A;  4FVM A;  1ZQ7 A;  5C4J B;  2ASL A;  2J6T A;  2NVT B;  1TS3 A;  4A3G H;  3RBE A;  1IBM H;  5FOB B;  1I6V C;  1JIH A;  2YZG A;  2BQ3 A;  1EY5 A;  4J6H A;  4NB3 A;  4O2B F;  2VQF Q;  4PMC A;  3W1B A;  5DG9 A;  1HR0 W;  2KEN A;  3A55 A;  3M4Y A;  2Z6B A;  2Z4I A;  1H9S B;  5C3E B;  4LF4 H;  1QJO A;  3E5N A;  1KLG D;  4MV8 A;  4EQO A;  5H1S E;  5LMU Q;  2F0P A;  4HIM A;  4DV0 H;  2F0V A;  2VUM B;  3M9M B;  2W9A A;  4Y7N B;  2F4V Q;  1GUW A;  3E9H A;  2NVT H;  3GTO B;  3J81 i;  1GUN A;  2A6E C;  5KYL A;  4ZUJ A;  5IWA Q;  1RK5 A;  1HCZ A;  4O4L F;  5KG2 A;  3WWV A;  2IBK A;  1A3V A;  1B2T A;  5AFW A;  2R93 H;  5KFE A;  3CCU A;  1EZ1 A;  4ZAI A;  3LWE A;  1IOV A;  1EYD A;  3J7A V;  1QVG A;  1GXD C;  1N33 L;  1B53 A;  3HG9 A;  4JI2 Q;  2NVY H;  2R7Z B;  1GYF A;  1KLU D;  4MV1 A;  2OF1 A;  4NXM Q;  1QVC A;  2DY7 A;  3S1N B;  4C3I G;  5IYD G;  3QZ7 A;  4V0B A;  5M5Y H;  1TQO A;  4KY6 A;  4JI0 L;  4R4I A;  1Q1E A;  5I2X A;  4CDF C;  1TWG A;  1X3E A;  4FS2 A;  3ORQ A;  2K5W A;  3X3N A;  3W3A A;  1I4H A;  3RZD H;  3BZK A;  4BA2 I;  1TWF H;  3FKI H;  4PMB A;  3K58 A;  4ED6 A;  3SVM A;  2EQS A;  1QCB D;  2D5D A;  2VL6 A;  4DR4 H;  1BO0 A;  5C1P A;  1I7L A;  5C8Y F;  3ETH A;  2MP1 A;  1JC7 A;  3E0J A;  5CAE B;  2EJF C;  5JVG 3;  5DEH A;  2YS7 A;  2NU7 B;  1PH4 A;  2I5L X;  2VNU D;  5A2Q L;  1HUN A;  4IRC A;  2PQA B;  4PZ7 A;  4ECT A;  2EYJ A;  2QEX A;  1TII D;  1CM9 A;  3GIK A;  3C3L A;  4X64 Q;  1A9X A;  2FLP A;  2NZH A;  1G6P A;  4IUT A;  2XNA C;  4A3J H;  5KFU A;  1TU2 B;  4IFD H;  2Z4H A;  3N41 B;  5M3M G;  2DN8 A;  3T5K A;  2K1B A;  3PR5 B;  3J81 E;  3EYY A;  3BAA A;  1SN8 A;  4DU9 A;  2W6Z A;  2UU9 H;  1SMX A;  4C2M B;  1JCK B;  2HQL A;  4Q0F A;  1CA5 A;  5KFK A;  1TWC A;  2DY8 A;  5KFH A;  4BBR B;  3RB4 A;  1U9R A;  3W5O A;  1KIX A;  5C4X B;  4TQR A;  4DV5 Q;  3IRB A;  3NE5 B;  5DM7 3;  1LTT D;  3H3V C;  4DR7 Q;  1YJW A;  1QZG A;  3W2D A;  1KAA A;  1OWT A;  1TS2 A;  3K59 A;  3WO0 A;  1N34 H;  5LA6 F;  5KFY A;  4FO2 A;  4B3T Q;  4Q8E A;  2F0L A;  3MC0 B;  1TWC H;  1N33 H;  4BA1 I;  4JV5 Q;  4TSS A;  2K50 A;  3OSN A;  3KFU A;  2HVR A;  2HDM A;  2IX3 A;  4RH6 A;  1D5M C;  3DUZ A;  1UEB A;  2K52 A;  3T56 B;  1LT6 D;  2VUG A;  4HMI A;  3SDZ A;  3HOW G;  4JG2 A;  3A0J A;  2JEG A;  4X3U A;  4G7Z C;  3I8Z A;  3RGX A;  5C5J A;  3KOJ A;  3Q2O A;  2AUJ D;  2V5A A;  5DLQ E;  1GUG A;  4LNQ A;  2IX0 A;  3SXH A;  4N9P A;  1EZ6 A;  5ELC A;  2JXM B;  3GQB A;  2IPK D;  4X3S A;  4WFN 3;  1F2M A;  5BR8 Q;  4B3S Q;  1I4R A;  1KNE A;  2FMC A;  3TRZ A;  2V4Q A;  2QK4 A;  1E4E A;  1WCM G;  3V05 A;  1O7Y A;  4FF3 A;  4JI7 Q;  2SNM A;  3H3V H;  3NTK A;  3P20 A;  4IN3 A;  1KJJ A;  4DL2 A;  3FP9 A;  2NWG A;  2DWC A;  4OL7 A;  1KRT A;  2KHS A;  4OWT B;  5KEE A;  5L37 A;  1EFW A;  3S24 A;  1K83 B;  4EVO A;  2R92 G;  4XT1 B;  4A3C H;  4QCL A;  4X6A H;  1VF7 A;  3CME A;  2EYL A;  2VZA A;  5BPF A;  1PTO C;  5KFP A;  4FBU A;  1S03 G;  2IJ0 A;  5L1J A;  4O3N A;  3S14 H;  2N78 A;  3GTJ A;  3DM3 A;  3H4B A;  2E8G A;  2CQY A;  2IY5 B;  4FS1 A;  2F3I A;  4DL5 A;  3ERQ A;  4BY7 H;  4HCE A;  1ZHS A;  4UCS A;  3DWP A;  4UPA A;  2KHJ A;  2EY2 A;  4J9R A;  2B2W A;  2L55 A;  4MA0 A;  3G4S A;  1VQB A;  1ZYR D;  5FKA C;  3OWE B;  4QIW B;  4O3R A;  2QA4 A;  4MN3 A;  5E4W C;  4QWE A;  4DR7 L;  4NXN H;  4JV5 L;  3GTJ H;  2XIW A;  4DL7 A;  1VKZ A;  4RMF A;  4KN4 C;  2UXD Q;  4YCU A;  3J7A F;  5JVL A;  2NZ1 D;  1LTA D;  4GOP A;  4LFC H;  2LY7 A;  4LFA Q;  4LF9 H;  3I90 A;  5DNF A;  4B3M H;  5IGB A;  1YI2 A;  3A7L A;  4ZKC B;  1YJ9 A;  4NLG A;  5IWA L;  3AU7 A;  5E7N A;  4R8I A;  1W96 A;  2AGO A;  3K5I A;  5KFS A;  1E7Z A;  1A0I A;  4C2M H;  4AYB E;  3Q1K A;  1HQR D;  1KDA A;  4EQ5 A;  3KLS X;  1YNX A;  4CDC C;  4GOP C;  2WDT A;  2R6G A;  2B63 B;  4DUZ Q;  1I6H H;  1PK8 A;  4IFD G;  2PMZ E;  3R3O A;  2VXW A;  2X6L A;  2KVM A;  3K81 C;  2B63 A;  1EY4 A;  3KYH C;  3S2D H;  2R82 A;  2AWN A;  3I72 A;  3Q8Q B;  5IP9 G;  3HS0 C;  1SMY C;  3RB0 A;  3EA6 A;  2WAQ E;  1VQE A;  1V1O A;  4KJN A;  4IO9 A;  4IRK A;  2K5H A;  2G5D A;  4R7R A;  4PV1 C;  1FYC A;  2EPB A;  2XVS A;  3GTG H;  3J81 W;  2JA6 G;  4DR6 L;  3MFY A;  1I6H B;  5FLM G;  2ICI A;  1YHA A;  3BQ0 A;  4J9M A;  4KY7 A;  1BQQ T;  2C9O A;  1C4Q A;  3MWY W;  4OON A;  3GTQ B;  3S16 H;  4JI8 H;  5LMN W;  2ZXO A;  1GKH A;  1O80 A;  3D6C A;  4K5X A;  3U4V A;  4LUV A;  1TWF B;  3HZX A;  4DK1 A;  1XNQ Q;  3PW5 A;  4ZQI A;  3EVQ A;  3MEF A;  5HV6 A;  1HJP A;  2JA5 A;  3U9O A;  2RQX A;  1XYI A;  4RB3 C;  1WTQ A;  1E2W A;  4LF9 L;  4BBS G;  1I50 A;  1JB7 A;  2JEA I;  1Y1V G;  3HOW H;  3OHB A;  4H02 A;  1PTO F;  3GTM H;  1NR4 A;  1BXT A;  3SGI A;  5J2U F;  4YCV A;  5EWE A;  4HR7 B;  3KF6 B;  2IX1 A;  1M8A A;  4A3K G;  3FPU B;  3I91 A;  4C1N I;  3N6X A;  1WYD A;  2YTY A;  4JI2 L;  1LTR D;  3HOY H;  3K7A H;  1E2Z A;  3GTJ B;  2ZTC A;  2JA5 H;  4EGQ A;  3ITP A;  2CQO A;  3PIO 3;  1PH7 A;  1QWY A;  1STY A;  4DR3 H;  1TWH H;  3E9I A;  1WOC A;  2IT1 A;  1MSH A;  1GSO A;  2ATW A;  1EY0 A;  3N40 P;  4BY7 B;  3MFI A;  1DV1 A;  5KG3 A;  4L5R C;  2MUY A;  2JA5 G;  4QGU A;  1IYU A;  1L0X B;  1UC9 A;  1A2T A;  2RGV A;  1PZI D;  2R7Z G;  1IL2 A;  2EY5 A;  2HJW A;  3M7N A;  4O3P A;  3K5O A;  4R4C A;  5KFB A;  5ELO A;  1G29 1;  4IPD A;  1K83 H;  1HNW H;  1F9Q A;  4RGM A;  3I4M B;  4K6L A;  2EYP A;  5HGT A;  1IYV A;  2AQ4 A;  3RMH A;  5I4D A;  1WVL A;  4DR4 Q;  3Q23 A;  1IBK Q;  1JT8 A;  4ULL A;  3M4I A;  5FPO A;  3Q22 A;  5L1L A;  2UUA H;  4J9S A;  1Z9F A;  5CYU A;  1RCV D;  4DN4 M;  5H80 A;  3NEL A;  2W8L A;  2ZXP A;  4A93 B;  4EFB A;  4H44 C;  3TP8 A;  5A2Q E;  1SE2 A;  2ASB A;  4EYI B;  2HIX A;  1F2Z A;  2BA0 A;  5C4X G;  5K36 H;  3FEW X;  5JEA J;  1IZ6 A;  3GDE A;  3HRZ C;  2UUB Q;  1BXR A;  2NUC A;  4A3I H;  1WD0 A;  5D14 A;  1E2V A;  1CZG A;  1PTO B;  4J9O A;  3HBL A;  1DV2 A;  1OXS C;  3QO2 A;  1QE6 A;  4Q45 A;  1TY0 A;  1S97 A;  2AMC B;  2G9D A;  3WDN A;  5LL6 S;  3M9B A;  2N55 A;  4WJ3 M;  1HA6 A;  3JAM E;  5FLX W;  3RBD A;  4DV7 L;  1TS5 A;  5EQ0 A;  4QIW E;  4ZRZ A;  4XDX A;  5KG5 A;  5KIX A;  4AQY Q;  1IW7 D;  3ND8 A;  4ECU A;  1DOM A;  3PW0 A;  1TWC B;  3CCJ A;  1YIT A;  1HTL D;  2HQE A;  3BYT B;  5I47 A;  1MIU A;  2A6H D;  3R8B A;  3CC7 A;  1E4G T;  2RHQ B;  1TY2 A;  5FO7 B;  4DV4 Q;  1X9N A;  3M3Y H;  2I46 A;  3OOC A;  3N44 B;  5JJL A;  1VQN A;  1STE A;  3BJU A;  1QVF A;  2K75 A;  3MXN B;  4JI6 H;  3RZO H;  4BY1 H;  3BZD B;  3QB3 A;  4GKJ Q;  1BCP F;  2Q2H A;  5BN3 A;  5DQH A;  3BS1 A;  2I5H A;  3KHL A;  4KHP H;  3D4W A;  1LLR D;  2NVQ B;  2EXZ A;  5KFJ A;  1GUS A;  2E2J H;  3T1H H;  2H4O A;  2M00 A;  2PI2 E;  4RGN A;  3HGB A;  3GO5 A;  1BBX C;  5DQG A;  3VYS A;  3KBX A;  4KTA A;  4B3S H;  2F0F A;  2Q2I A;  1Y1W H;  1HFG A;  1SYD A;  2PO4 A;  1CHP D;  5HGQ A;  4WRD A;  1N36 L;  1HNX L;  5KFR A;  4CGY B;  2R87 A;  3OTO Q;  2ALZ A;  3U9S A;  1LV9 A;  4JC0 A;  3NEN A;  4JI4 Q;  2K28 A;  2UXB L;  2IHF A;  2MO0 A;  1JJ2 A;  2YRW A;  3JSL A;  2N49 A;  4K14 A;  3LP8 A;  1SE8 A;  1I4X A;  4LFB Q;  2AHO B;  1ZXT A;  1VQ4 A;  4ZYS A;  5KFW A;  4HNV A;  4DV3 L;  2JA6 A;  4CBV A;  4A3G G;  3KBG A;  3AFP A;  5KFZ A;  2D0O A;  5EKL A;  3RZO B;  3M4O H;  3KAL A;  5KG0 A;  3SK6 A;  3SEB A;  2C2E A;  2N88 A;  5FO9 B;  2K33 A;  4LAA A;  1EUC B;  4IQZ A;  2FHT A;  1B3Q A;  3PW2 A;  4EGV A;  3VA7 A;  2UVV A;  4JI3 H;  2D0P A;  1I94 H;  1JOK A;  4IR9 A;  5C44 G;  5JEA H;  1EYC A;  2DPI A;  1C9O A;  4IWY A;  1M90 C;  1CQI B;  4HJ9 A;  1Z2P X;  1GM5 A;  1WTX A;  4ZUI A;  2ATL A;  3R5X A;  4CJ1 B;  4B3M Q;  3T5J A;  3O13 A;  4X62 L;  2W8K A;  2HT1 A;  4DUY H;  3K57 A;  5DG8 A;  2V58 A;  1D6E C;  4A3D B;  1JOO A;  2EZV A;  2TSS A;  1I5F A;  1SLJ A;  2XN9 C;  4YR3 A;  4UP9 A;  3OPO A;  3J80 L;  1MI2 A;  2EY1 A;  2KCN A;  5IGD A;  2R8G A;  4DXF A;  3T5H A;  2JA7 A;  2UXB H;  5EPJ A;  1RKN A;  1IKL A;  4R8U A;  4RNO A;  4YR2 A;  1EIG A;  4ODG A;  3A74 A;  3AQQ A;  2E2H H;  1P8L A;  1JJC B;  3MFG A;  1LT4 D;  4L5T A;  1PFB A;  3BA8 A;  1GD7 A;  5KFN A;  2E2I A;  3K5N A;  4HJA A;  3CW2 C;  2R93 A;  2WAQ G;  3NBH B;  4UCO A;  1PA6 A;  2Y0S E;  3K80 C;  3G6J B;  3K0Y A;  1Y1W G;  3DXJ C;  3RV4 A;  3K3V A;  3H91 A;  4PDB A;  5GAE C;  1H9J A;  1MHW C;  3RB3 A;  3UI2 A;  3PMF A;  5CBE E;  2D62 A;  4ED3 A;  1I6U A;  3MJF A;  5KG6 A;  1X3F A;  4YJ3 F;  4RGT A;  3TP6 A;  4DK6 C;  3JAM i;  5CB4 F;  1II3 A;  4X65 Q;  3WOF A;  4JI0 H;  1XNR L;  1NNX A;  4O0A A;  2NVX H;  2ZT9 C;  2D9U A;  1H95 A;  2O5I C;  1YHB A;  4H0L C;  4JOI A;  2JA5 B;  2NTS A;  3F2U A;  2L15 A;  5L1I A;  3FKI A;  1SNP A;  2R92 A;  2QDB A;  3ND9 A;  1A2U A;  4IOA A;  4A2A A;  4ED7 A;  5KT5 A;  1VAJ A;  2YZN A;  3M9O B;  1S68 A;  2WV6 D;  2IL8 A;  4IAJ A;  5ELN A;  2Z0S A;  4A3K B;  3BA9 A;  3MWM A;  3CCM A;  2W71 A;  3V96 A;  4LF4 L;  4CKE A;  3S16 B;  2QIL A;  1P16 A;  2GPW A;  3PUX A;  4L5S A;  4O4H F;  5EBD A;  4YQW A;  3VPB A;  4ECQ A;  2YCH A;  2Z6K A;  1B6R A;  1K28 A;  4B3R H;  2NN6 I;  2PZW A;  1GVP A;  4DL4 A;  4YY3 Q;  1N36 Q;  1YNN D;  2OH2 A;  5KFF A;  2PYK A;  3DMU A;  3KAJ A;  2OXP A;  5J22 A;  1J9O A;  1SND A;  3T1H L;  1GLV A;  4IWX A;  1MKH A;  4ECZ A;  5COY A;  2NZO A;  4F88 A;  1XMQ H;  2RBM A;  3CPW A;  4H13 C;  4EX5 A;  1VQM A;  3KF6 A;  1AH9 A;  2KHI A;  4HR7 A;  2XRS D;  3KXY T;  1JLL B;  3UDF A;  2GPS A;  4O42 A;  1FKA H;  2EYH A;  2J6S A;  5E4X A;  1PH5 A;  2JA7 G;  2I0Q A;  3CCE A;  3I4O A;  4DA2 A;  1BVS A;  3AB9 A;  3GTK H;  1SR3 A;  2RSN A;  4LWC A;  3PGZ A;  4RWS C;  2FKL A;  2J6U A;  4UHV A;  4MZ9 A;  2NU9 B;  4YAJ B;  2F4I A;  1O7L A;  3EJI A;  4JI2 H;  2CKZ B;  4GKK L;  1NTG A;  2W9B B;  2D2C C;  2YU9 H;  3Q8R B;  2VOB A;  2XD4 A;  2JEJ A;  2VQE Q;  4KI0 A;  4BY7 G;  2F0T A;  1TKW B;  4JI8 L;  2FFK B;  1BBW A;  1Y1V H;  4F87 A;  3JAM c;  2JJQ A;  2BQR A;  4QQB X;  2PW5 A;  1STA A;  1LT5 D;  1NAP A;  1FNW A;  3EBE A;  5CV8 A;  4AYB G;  1WSC A;  3TQ1 A;  2V1C C;  4KHP Q;  3U9T A;  2K32 A;  4E6I A;  4HMJ A;  4JBK A;  4ZOL F;  3BG3 A;  4EBD A;  3E6Z X;  1W3S A;  2I80 A;  2C2D A;  5JVD F;  5KFG A;  2UUB L;  2R86 A;  2ENB A;  4A3J B;  3QR8 A;  2AGP A;  4X3T A;  1B44 D;  3AYH B;  4TKO B;  4LF8 L;  2Y0S A;  4HNU A;  4FF1 A;  2XC9 A;  4GN5 A;  4JV1 A;  2Z1C A;  3ULL A;  3J80 c;  1HNX H;  4RNM A;  5KT7 A;  3OTO H;  3PF4 A;  5FJ8 H;  1VQH A;  3I4N H;  2R3Z A;  1EQQ A;  3HOZ H;  2P0A A;  5IYB G;  1EY7 A;  4GNX C;  3K3P A;  2R92 B;  3HEJ A;  5IYZ F;  3V2T A;  2BE5 C;  3L9A X;  1ICF B;  2QW7 A;  3I73 A;  4FF2 A;  4JPB W;  4QIW A;  3KUP A;  3NSW A;  4MHE A;  4YWK A;  1WR2 A;  2BH8 A;  4C3I H;  1Z2O X;  1KC7 A;  3VYT A;  5FLX c;  4K8I A;  1JDE A;  1V51 A;  5IYD H;  1EHI A;  4DR5 H;  1AZQ A;  2BH2 A;  2VQE L;  2FB9 A;  1H9M A;  4X66 Q;  4ECS A;  1VQD A;  1U4M A;  2HVQ A;  1BDO A;  4B3T H;  3CCS A;  4XYQ A;  2B2T A;  4XT3 B;  4JI3 Q;  4C2M A;  2KEE A;  4RAY A;  4IPC A;  4JBJ A;  2LSS A;  2W9C A;  4KKS A;  4O4I F;  4JV5 H;  3J7A 5;  4YWM A;  4MV3 A;  3KDF A;  1KEE A;  2XSC A;  3TP5 A;  2R93 B;  4R1J A;  3ONA B;  4P73 A;  4DAM A;  3J7Y W;  5LL6 X;  3KDF B;  2WYO A;  4PZ6 A;  2B2W C;  2ZDQ A;  2E2D C;  4GC7 A;  3I70 A;  1L2F A;  2WKC A;  4GLA C;  5C1O A;  4N8F A;  1K8A C;  4EGJ A;  3RTX A;  5KFX A;  5D65 A;  3M4P A;  1JQY D;  5FO8 B;  1I3Q B;  1BF4 A;  3S1Q B;  4UCU A;  2F03 A;  4M9U A;  1J5E L;  1CKN A;  5BR8 H;  2SNS A;  1PTO H;  1Z7T A;  1PH3 A;  1SSO A;  4KHV A;  1T94 A;  5C6A A;  4TV9 F;  5KG7 A;  1T5X D;  4I7A A;  5JUM A;  2K5Q A;  4PNY A;  2CVR A;  4Q44 A;  2WB1 G;  1RIP A;  4MIU A;  1IBM L;  3GTL H;  2KBN A;  1FJG L;  3RB6 A;  5KFO A;  2M2L A;  1F9R A;  1LAC A;  4G57 A;  5ELF A;  1VMC A;  3UDX A;  5M3M B;  3A5U A;  3TSS A;  3DHQ A;  2VUM G;  4R4Q A;  5EKI A;  2R8K A;  3EIV A;  1M4V A;  5IWA H;  3A5Z B;  3VR5 A;  2Q2T A;  3IAY A;  2KJX A;  2W57 A;  1JXL A;  2R7Z A;  5KG1 A;  2QF7 A;  2A68 D;  2Y0S B;  1Q8I A;  4KD4 A;  3I2Z A;  4LF7 Q;  3PUW A;  1YHQ A;  3FMA A;  3OHA A;  3VMM A;  2BDN A;  4OWW B;  4I7H A;  4GLX A;  2ZM6 L;  1FNU A;  1S40 A;  4TV8 F;  2HHH H;  4A3F H;  1SMY D;  4OEM B;  4MA5 A;  3CHB D;  4MV4 A;  3Q8S B;  4P71 A;  5GAD C;  4A3M G;  3J81 c;  2L9H A;  4BBR H;  3DEO A;  2ZJT A;  3GTO A;  2JEF A;  3RN5 A;  3PUY A;  4HJ5 A;  2PBZ A;  2O2L D;  2JE6 I;  1OTC A;  4DR2 Q;  2F0H A;  1KDC A;  3Q8D A;  4BXX H;  3PO3 H;  2FIN B;  1H9S A;  2YS6 A;  3FMC A;  5JEA G;  2RDF A;  4YHH L;  4RB1 A;  1CUK A;  5IGF A;  4HJ8 A;  1TAE A;  3B6Y A;  1VS0 A;  1K3B C;  1K8O A;  2MGS A;  4OX9 Q;  1ENC A;  2A73 B;  1Z6H A;  5IYB H;  4X64 L;  5C3E H;  3V4Z A;  4DV2 Q;  1F9P A;  1JMC A;  4JYA Q;  4B3R Q;  1YVC A;  4P75 A;  1HR0 Q;  3E5S A;  1SCU B;  4AH6 A;  1SYE A;  4KD3 A;  1C48 A;  1UEA B;  4A3C G;  4L1K A;  5L9X A;  1NR2 A;  5CV7 A;  2R84 A;  3HKS A;  3AEV A;  4YY3 L;  3NQT A;  4YY3 H;  4H7B A;  1N36 H;  3SE0 A;  4EQP A;  1J6Q A;  2Y0S G;  5IP7 H;  2RF4 A;  4J9K A;  3GTQ A;  2PNR C;  3I12 A;  4J8Q A;  4F50 A;  2K04 A;  1C7Y A;  3GV5 B;  3LNN A;  3CKI B;  2C28 A;  4GZY C;  4KKT A;  5F9L A;  4B9W A;  2JYO A;  2F3W A;  2K5V A;  3W1G A;  1JOR A;  3CU7 A;  1C30 A;  1AFP A;  3S1M H;  3G6V A;  2I87 A;  5C5M A;  4DUY L;  4X62 H;  4OXP A;  2YV5 A;  2X69 A;  1MZB A;  1QG7 A;  1U0L A;  3TBI B;  3K5M A;  2VPS A;  3NTI A;  4CDD C;  3C46 A;  3MXP A;  3FHW A;  3F8N A;  1XX8 A;  3Q6S A;  4RGO S;  2AQ1 B;  2BQU A;  1YEZ A;  1CE8 A;  5KFQ A;  2MJ8 A;  5BN5 A;  3KJO A;  2B2U C;  1RJQ A;  4JI3 L;  2IMW P;  4DR3 Q;  1EEI D;  2QYZ A;  3G6X A;  2W7O A;  1RYS A;  2W9B A;  2GVA A;  1QUQ B;  4A75 A;  3L4J A;  1Z2N X;  2F1M A;  5EPL A;  4GOP B;  2XCA A;  4EG0 A;  1A3T A;  1VQJ A;  2JK8 A;  1CQF A;  4C3H G;  1U4R A;  3TME A;  1RJP A;  1TS4 A;  5GQO A;  1L0Y B;  4PMW A;  2B63 G;  4YBZ B;  1Q12 A;  2IWH A;  2L11 A;  4DV3 H;  4OWX B;  2HCC A;  5G3L D;  4ZKB B;  1EIY B;  1JE4 A;  1CQV A;  3GV8 B;  3OIP A;  2E75 C;  3N52 A;  4NMZ A;  3N42 B;  3TZD A;  1PRT C;  5C4H A;  4QWB A;  5LMU L;  5JQW A;  4A3G B;  2UUA Q;  2WB1 A;  3OIQ A;  3I4M H;  3LX0 A;  1EY6 A;  5C5L A;  3LML A;  4ETS A;  5KFC A;  2NU6 B;  4U7C A;  5HUR A;  1A3U A;  3NQI A;  2EE1 A;  1K83 A;  1E1O A;  1L1O C;  4EEQ A;  1XTD A;  1SYX B;  2LXK A;  4LK1 C;  5C4Z A;  2W6M A;  2RDJ A;  4F8M A;  2WTF A;  2F0S A;  2Z8L A;  4WJW A;  2LKV A;  2AQ3 B;  2E2I B;  1EY9 A;  4FBT A;  4APV A;  4HSV A;  1F77 A;  4HAE A;  1HH2 P;  2E76 C;  2KSW A;  3OW2 A;  1EU4 A;  3P1H A;  2EVB A;  4LJZ C;  5I2Y A;  1KQS A;  2RCN A;  3GIL A;  4F4Y A;  1ILQ A;  3M7G A;  4F7X A;  2YZM A;  1EWC A;  5J3B A;  1SNO A;  3IG0 A;  5C0X H;  4P72 A;  1KD1 C;  3TIG A;  5D3D A;  3VR3 A;  1ONL A;  4O1N A;  4G4K A;  3VYR A;  5CA0 F;  1L2Z A;  2F0D A;  2X6G A;  1EQT A;  4HCS A;  2DJF C;  3QFF A;  3MR2 A;  1HXY D;  1EOV A;  3MAQ A;  3G6E A;  5KFT A;  4C1N K;  1W6K A;  1N32 Q;  1WJJ A;  3EPI A;  3BDC A;  5AJ3 L;  1SRO A;  4BS9 A;  4QWC A;  1UE5 A;  4R4T A;  4UY8 C;  3H0G B;  5C4X H;  3MZ5 A;  4RKL A;  3M4O B;  1TA8 A;  2Z9H A;  1GJX A;  3HKZ E;  5LMN Q;  2J7Z A;  4JI5 H;  2CH4 W;  1K73 C;  5EOY A;  1ZET A;  1D8L A;  2GLT A;  1HR0 L;  1S0O A;  5EKK A;  4LH6 A;  3H20 A;  5LOV F;  3DWQ A;  1H9K A;  3VYU A;  1RJR A;  3PW7 A;  2MO1 A;  3FVQ A;  1JDB B;  4PG3 A;  1A62 A;  1YNJ D;  2MFI A;  2CW0 D;  5CR3 A;  3J81 j;  3CD6 A;  2KA7 A;  1QB5 D;  5FD5 A;  1W93 A;  3H0G H;  1A6X A;  3HOV H;  2JA6 B;  4IAL A;  5GRO A;  3E0E A;  2A69 D;  3QOL A;  2E5L H;  2Q2U A;  4JI1 H;  3J80 W;  2UXC H;  1ZYR C;  1YJN A;  1LUZ A;  1PRT F;  3EFX D;  2FMM A;  1X54 A;  4A3B H;  5A2Q W;  5AJ3 Q;  5J39 A;  1X55 A;  2K4K A;  2P5Z X;  1C3O A;  4UCV A;  3UE0 A;  2F0N A;  2F0I A;  4HED A;  4A3M B;  1D5Z C;  4BBR G;  5KFI A;  3RZD B;  3RN2 A;  4DR1 H;  4UCR A;  4C3J H;  3C0F B;  3SR1 A;  2DUD A;  4AQY L;  1V1P B;  3CQZ H;  3TDQ A;  1NMG A;  2EXD A;  4ZK9 B;  3GID A;  3PR4 A;  1HNZ H;  5DLG A;  2HHH Q;  3JAM W;  1MSG A;  4A2B A;  5IYC G;  1BBU A;  3D8G A;  3S14 B;  5DGB A;  2J0T D;  2OTL A;  1KNA A;  1B6S A;  1E4E B;  5LL6 b;  1M6V A;  5M5W B;  2F0J A;  1XWE A;  4QF4 A;  5KGU A;  2SCU B;  1Q82 C;  1HNW Q;  3BQ2 A;  1RF2 D;  2KED A;  1JIC A;  1ASY A;  1IBM Q;  1QOH A;  2EOT A;  1HRJ A;  1SYG A;  1GO3 E;  3BVZ A;  2V4D A;  1FD7 D;  3F2D A;  5K36 G;  4M7E A;  1RJT A;  3BDL A;  2VUM H;  3TRE A;  2N8N A;  5NUC A;  2W6O A;  1IW7 C;  2ZDG A;  1SFO A;  1HR0 H;  1PRT D;  5CV9 A;  1EUJ A;  2W6P A;  1H9R A;  5BN4 A;  3TS0 A;  4LUZ A;  2O4X A;  1AE3 A;  3PUV A;  4DUZ L;  2VUM A;  4LMQ D;  4O3Q A;  1O75 A;  2OTJ A;  2V59 A;  2HGS A;  2PPB C;  2B8F A;  2B8G A;  2DGY A;  3OSO A;  4IZ8 A;  1ESR A;  1XPO A;  2NVQ H;  1EQR A;  1X3P A;  3I56 A;  5IIF A;  1SNM A;  4FF4 A;  1PXU A;  2PVP A;  1SJE D;  4Q8F A;  1CKN B;  4RUA A;  2A6E D;  2R7K A;  2CW0 C;  3VR6 A;  2C5C A;  4RG1 A;  1PH8 A;  1QZH A;  2W7P A;  4LFC L;  2NVY A;  4G7H C;  1XJV A;  1WTH A;  4P2C B;  2B3G A;  2A69 C;  1SAP A;  4X62 Q;  3M3Y B;  4HQ6 A;  1PDQ A;  4KHZ A;  5M5W H;  4B3M L;  1FGB D;  4NXN L;  5EWG A;  1Y14 B;  2WFW A;  2I5M X;  2IA6 A;  1HNZ L;  4FXD A;  1MGS A;  3KHR A;  1KAB A;  4C3H B;  4WOR A;  2R7M A;  1R4Q B;  3A8J E;  1F9S A;  3QG1 A;  4U6P A;  1XPR A;  4CC6 A;  4XYO A;  3KK7 A;  1GUT A;  4YWL A;  2RDH A;  1JB3 A;  2E74 C;  3CQZ B;  5C3X A;  2XRQ D;  4K0K H;  5C0X G;  2FJ2 A;  4I50 F;  5FLX E;  4K6D A;  4B08 A;  2DJG C;  4JBM A;  4ME5 A;  1DM0 B;  2IP4 A;  4M8A A;  5T1I A;  3NK9 A;  2BR0 A;  1LAB A;  4L63 B;  3NWT A;  2B29 A;  2DNE A;  2R92 H;  4AYB A;  1VQI A;  3SK5 A;  1ET9 A;  3HOZ B;  2UXC Q;  2XGT A;  4NDX A;  1I50 B;  3A54 A;  2ASD A;  4DV3 Q;  3CP0 A;  1UWV A;  1GOZ A;  1SNQ A;  3MEH A;  2LS0 1;  3OMG A;  4WD3 A;  5M3F B;  1TWG B;  2B2U A;  4F4W A;  4JI7 L;  1TWF A;  2JP1 A;  2OCE A;  4L6T B;  3ERO A;  2ES2 A;  4DV2 L;  1CI3 M;  1QNU A;  4FP5 D;  3PSI A;  4JI5 L;  2F3V A;  4A3L H;  1B50 A;  1RTO A;  2HUG A;  3STB D;  5GAH C;  4CKC A;  5T14 A;  2Q8T A;  4B3R L;  4IZO A;  2B2Y C;  3MXU A;  3ICE A;  3KLW A;  3P75 A;  2RKS A;  5IP9 H;  4DV5 H;  2WKD A;  1A8V A;  4LW1 A;  3VDY A;  2UXD L;  4DR2 L;  4IUN A;  3EN2 A;  2I8C A;  1VQ7 A;  1N34 Q;  2FJZ A;  4LMY A;  4IRD A;  4IPH A;  1EL0 A;  2V9W A;  1ILP A;  4GKK H;  3OMC A;  1FL0 A;  3JAM L;  1PH1 A;  3K7A B;  4DR7 H;  4F4X A;  3CXC A;  1TT2 A;  4DV1 H;  1TVX A;  1IYJ B;  5DGA A;  1TWA A;  3HOX G;  4KJO A;  3JRX A;  3ULJ A;  4RA8 A;  2K03 A;  2YL2 A;  5T1G A;  3GII A;  3OW7 A;  2VB2 X;  4I65 A;  1I4P A;  1Y8N B;  2K05 A;  4DNR B;  4MTK A;  4DUY Q;  3PN1 A;  4PWQ A;  3QOJ A;  3SK8 A;  5JPN C;  4A3F G;  1RD9 D;  4G3I A;  3GTK A;  2ZM6 Q;  1XPU A;  1XNR H;  2ICE C;  5HBR B;  5LXT F;  2LMC B;  1DOL A;  2R6F A;  1VQC A;  1LTB D;  4DNT B;  2VS1 A;  3CRL C;  4FXG C;  4V19 0;  1HFN A;  1ZHQ A;  4MTE A;  3IKJ A;  4J9Q A;  1E4F T;  4R4O A;  1X65 A;  2XTI A;  3HOV G;  2VPQ A;  4JI5 Q;  3I55 A;  1EQV A;  1NJI C;  3EPG A;  3OYY A;  2QEJ C;  1IKM A;  3T5L A;  2KCM A;  2NBF A;  5IE8 A;  4N8X 1;  3S15 B;  4LUO A;  3CCQ A;  2A8V A;  3RNU A;  4FDB A;  3S15 H;  3LWB A;  2IHE A;  4B3S L;  5KFD A;  1KAW A;  1V8Q A;  1VQ9 A;  1IBK L;  4JI1 Q;  5EZY F;  4POF A;  3BYY B;  1J5E Q;  2RSO A;  2UVU A;  4DPG A;  5A35 A;  2F0K A;  1PYB A;  2F0M A;  4RKB A;  2LFN A;  3T1Y Q;  3NUC A;  2C22 A;  1EUD B;  4LF5 H;  1MJE A;  1STH A;  3STB C;  2NYZ D;  4ID6 A;  2PN1 A;  1F2Y A;  1ML0 D;  5JVH 3;  1L1O A;  2Z6K C;  1XXG A;  1U5K A;  2XIG A;  3HOY B;  1HNZ Q;  1YNN C;  4LF6 Q;  1DJR D;  4C3I B;  3RLN A;  3S1R H;  5ELD A;  1BNZ A;  2HDL A;  3CRK C;  1STB A;  3VA5 A;  1N34 L;  4LFC Q;  1N56 A;  2A1A A;  3G8C A;  4LF9 Q;  4LFA H;  4RB2 C;  2K7V A;  3GP7 A;  4KLK A;  1SDF A;  1HZA A;  1BKB A;  2MHV A;  4YAK B;  2EYF A;  1J8I A;  1E24 A;  3J80 E;  2K01 A;  1PFM A;  4ABN A;  4MTN A;  4HJ7 A;  3I4N B;  1UE6 A;  3G6Y A;  2H1E A;  4KK7 A;  4MNO A;  5IT9 L;  3PIP 3;  1BCP B;  3GTG A;  3F1Z A;  1DIK A;  4XQJ A;  1EIH A;  2OLS A;  2JA8 B;  1FJG H;  5D8D A;  1HZ9 A;  3VPD A;  1K0R A;  4ECV A;  4WJ4 A;  1D7Q A;  2AWO A;  2B63 H;  2UXC L;  4DF7 A;  2L12 A;  2ALY B;  3T16 A;  2CFM A;  1I4Q A;  1KXL A;  1G2S A;  4YHH H;  3WNZ A;  1HHV A;  5TSS A;  1EY8 A;  2PQA A;  1HTP A;  4Q43 A;  2ZDH A;  3NGD A;  4ED0 A;  4OEL B;  4R8U B;  5GAG C;  4X3K A;  4MAM A;  1S9F A;  1RHP A;  5E1F A;  1K1Q A;  2JA7 B;  4MV9 A;  4KHP L;  4J9N A;  2YYA A;  1PLF A;  4Z9C B;  3KJP A;  4LF7 H;  1XNQ H;  3I4L A;  4NKL A;  1TWH A;  4KMU C;  4GNX A;  4XTC S;  3J80 i;  2K14 A;  1Q3L A;  5I6Y A;  4TQU S;  4DGZ A;  2MCT A;  3HFZ B;  1I94 L;  4MV6 A;  4XQQ A;  4GC6 A;  5FPR A;  5JOB A;  5C0X I;  1EZ8 A;  2UUC L;  4GLV B;  2VQE H;  3CCV A;  2R7Z H;  1SJH D;  4FNF A;  4A3F B;  3UFX B;  3HB9 A;  2C00 A;  3RFC A;  2GVB A;  3MA2 B;  4RCO A;  1CTM A;  5HY6 A;  3HKZ B;  4IPG A;  5JJI A;  3G7L A;  2QKI C;  3T13 A;  4ZHQ F;  4R8N A;  1CSP A;  1Q81 C;  1IBK H;  3H09 A;  5IT9 W;  3HXL A;  1LM0 A;  4OX9 H;  1XDN A;  1B8A A;  1Y8O B;  1EOT A;  4HTH A;  2R7F A;  3S17 B;  1HNX Q;  1M0T A;  2PZU A;  4A3I G;  2HCI A;  5D3I B;  4DV6 H;  2RDG A;  4DV6 L;  3NXW A;  2F0W A;  1ESF A;  1WFQ A;  2DLN A;  3KLS A;  1KC8 C;  3V6H A;  4GN4 B;  1S4Z A;  2ZJP A;  5BPH A;  2A68 C;  4A4I A;  3GTL B;  2V4R A;  2FLN A;  4OO1 I;  3IFD A;  3H94 A;  4LF8 H;  1B9M A;  4UAI A;  2CWP A;  1EIF A;  2NTT A;  3PIP A;  4XXE A;  2UUB H;  4QUF A;  3NPP A;  1HNW L;  3OSP A;  4DV0 Q;  4N9T A;  1I3Q H;  3F8T A;  3CF5 A;  3S1Q H;  4ILW A;  3RAX A;  1IBL H;  4DNI A;  3MHB A;  3OUZ A;  3S2H H;  4XYL B;  3RJ0 A;  4X66 H;  3GQC A;  4DAY A;  5KFM A;  1SXT A;  2RCF A;  3S1N H;  1K8G A;  1JWS D;  3KLR A;  4ZI7 F;  3ORR A;  4DXG A;  4UCT A;  3ETJ A;  3MXN A;  1Q90 A;  1ET6 A;  3FPP A;  4RHS A;  1Z47 A;  4AQY H;  1PMR A;  4I7Z C;  2R85 A;  1RK6 A;  1RTN A;  5KT2 A;  1XTC D;  1R9T B;  4DV7 H;  4RAZ A;  2NUA B;  2MNA A;  4X65 L;  1VQK A;  2R93 G;  4Q5V A;  4C3J G;  4DV4 H;  1I7N A;  2QCP X;  1UE1 A;  4EFE A;  2MQH A;  3M85 A;  4TRD A;  1X3G A;  1AUX A;  4QJF A;  4Y7N H;  4JI6 Q;  3Q24 A;  4A3M H;  1M0W A;  1PH2 A;  2F0Q A;  5I9O A;  4P74 A;  4GKJ H;  4G7O C;  3L3O C;  4I4T F;  4JV2 A;  2VA2 A;  2BCO A;  3GIJ A;  4HIK A;  2ZTE A;  1D1I A;  4A76 A;  3CVZ A;  4RZQ A;  4XZ3 B;  3R2I A;  1TXY A;  2OQK A;  2E2H B;  4I55 F;  5M9O A;  1WD1 A;  3HKZ G;  1BCP D;  5CGK A;  2UUA L;  3X3M A;  5LMN L;  2L4N A;  5D1O A;  4KV6 A;  1G2T A;  2C2R A;  1LTL A;  3A7A B;  2PW7 A;  2VR1 A;  1XMO H;  1CHQ D;  3J81 L;  4JI4 H;  2OEO A;  2K5D A;  4QB4 A;  3CQZ A;  1Y1W A;  2SEB D;  4HSP A;  1SE4 A;  2CQA A;  3BZC A;  3PO3 B;  1CZW A;  5BMV F;  1U4L A;  4OGQ C;  4CHT B;  5KYI A;  3HOY G;  2FK3 A;  3TS2 A;  1V9P A;  1Q46 A;  3SK4 A;  5M5X H;  3VR4 A;  4FYD A;  3T1Y H;  1Y8P B;  4LF5 Q;  4J9L A;  1CQJ B;  3PUZ A;  3CAM A;  3KF8 A;  5M5Y B;  3NTH A;  4DR3 L;  1R9T H;  1I94 Q;  5KX5 F;  1Y1V B;  5DG7 A;  1S0N A;  5IGG A;  3L2P A;  2NVY B;  2CW8 A;  3ERS X;  2PMZ A;  4DK3 C;  1AP0 A;  2K6A A;  1KRS A;  4ALP A;  4DR2 H;  2ZXR A;  1SE3 A;  4A3E G;  3BVG A;  5JJK A;  1XNQ L;  1B4O A;  2J4X A;  1G91 A;  1Q86 C;  1UNN C;  1OXV A;  4FXK C;  4HIO A;  3S2H B;  1UC8 A;  1UAP A;  4BBS H;  4F4Z A;  1B33 N;  2E2H A;  2EDG A;  2JSO A;  2DPJ A;  5KNB A;  1E0B A;  1PFS A;  5ELB A;  2Q8I B;  2UU9 L;  1NSN S;  4RFB A;  3GV6 A;  2XGQ A;  1IXR A;  3I4M G;  2JEI A;  5LMN H;  2B2T C;  4J9P A;  3HOV B;  4NPS A;  3HOZ G;  4IJH A;  2H5X A;  1MJC A;  3UDI A;  2N3S A;  2DNC A;  3JZI A;  2TMP A;  5KG4 A;  3MR5 A;  4Q0Y A;  4RU9 A;  1ENA A;  5EWF A;  3J7Z C;  3PW4 A;  1AW7 A;  5DAU A;  1BOS A;  2AU0 A;  1M1K C;  2B39 A;  2WAC A;  2YYZ A;  5C4J H;  2FMA A;  2HD3 A;  5LMU H;  2X0S A;  1SRU A;  4BY1 B;  3CC4 A;  1SEB D;  3BG5 A;  4QWA A;  1CT1 D;  1X32 A;  1LTG D;  4YHH Q;  4X65 H;  2R8I A;  4CC5 A;  2BOS A;  3HOX B;  3HOU G;  5EPK A;  4IR1 A;  4LF6 L;  3HOU B;  4A3E B;  2CW7 A;  4QMG A;  1OXU A;  1V1P A;  5KFA A;  4ZCK A;  1KJI A;  1CSQ A;  1TWH B;  4DK0 A;  1E22 A;  2SOB A;  1ENF A;  1KBL A;  1K3R A;  1WI5 A;  3D6W A;  2JEB I;  2PI2 A;  1JKJ B;  3KHH A;  5GON F;  3D3R A;  1CA6 A;  2VW9 A;  2EYO A;  3NBI A;  2VB3 X;  3R5H A;  1JJG A;  5IGC A;  3ULP A;  1HQM C;  3T1Y L;  2NVX A;  2G9H D;  2UXD H;  3PO2 G;  2OT2 A;  4C3J B;  1M7J A;  1EU3 A;  4DR1 L;  5EJW A;  1S5F D;  1Y69 U;  2YTX A;  2NVX B;  4FM9 A;  5FJ8 G;  1NUC A;  2KUM A;  2RA4 A;  4O3S A;  1NE3 A;  4MV7 A;  2R8H A;  4A93 G;  4A3E H;  1JWU D;  5IY0 A;  4TUY F;  3FDS A;  4UFZ A;  2M9V A;  5JH7 F;  1PVO A;  4LFB L;  3GTG B;  1PX2 A;  3G48 A;  4JOI C;  1T36 A;  1WTO A;  4OIK A;  2RHS B;  3GD7 A;  1EYG A;  4JYA L;  4YB8 B;  1XMO L;  1O7Z A;  3OTO L;  2PQE A;  4DV6 Q;  3V4S A;  2JA8 H;  5KT3 A;  4HNT A;  2FLL A;  4QW9 A;  1XMQ Q;  3J7A K;  4X64 H;  2WE6 A;  2WAQ A;  1I4G A;  3OUU A;  2K5N A;  3S9W A;  1IL8 A;  1X6O A;  1GHJ A;  3K6O A;  4DL6 A;  2VY3 A;  1D1K A;  2PCF B;  3C1E A;  5C3E G;  1PYW D;  2PNH A;  5EGT A;  3RLO A;  2F0U A;  1DOK A;  4DR4 L;  1DXM A;  1KDB A;  4EQN A;  1W2B A;  4ECR A;  1TWA H;  4GKJ L;  3L7Z C;  3PF5 A;  1WTW A;  4ME3 A;  1SFO H;  3RR5 A;  2YU9 B;  5CV4 A;  1IBL Q;  2YTV A;  3TIN A;  3N43 B;  3GIP A;  4K0K L;  2YU9 A;  1VQ5 A;  3C1F A;  4BBS B;  1KL9 A;  2IW3 A;  1VQG A;  4B3T L;  3GTM B;  1AN7 A;  1KJQ A;  3QZ8 A;  1CK1 A;  5E3F A;  1GSH A;  3D31 A;  2QGQ A;  3H3V I;  2CZG A;  1VQ8 A;  2YRX A;  3GLK A;  1YIJ A;  5CA1 F;  3RD4 A;  3A8K E;  1FNV A;  5KNC A;  1OO9 B;  1X3Q A;  1YNJ C;  4GS3 A;  1AEX A;  4X66 L;  4QW8 A;  4L8J A;  2RVL A;  5CC4 A;  1B9N A;  3K8A A;  2FPP B;  1K8M A;  1S5E D;  3ER0 A;  4S3S A;  1HPC A;  1V4Y A;  3D4D A;  5ISR A;  1ULZ A;  1B04 A;  1BJT A;  3TQY A;  1F2L A;  1SYB A;  4K5W A;  3GTP H;  5KFV A;  4NP5 A;  2EJG C;  5LP6 F;  4Y8V B;  1JE5 A;  1Y1V A;  3ZJY C;  2B2V C;  3KF8 B;  1NMF A;  3CC2 A;  2AQ2 B;  5EBC A;  3H40 A;  4ECX A;  1N48 A;  1KHI A;  4IUU A;  3GTP A;  1ROD A;  1TWG H;  5M3F H;  4A3B G;  3DM1 A;  1ICW A;  4UP8 A;  1HZC A;  1YBY A;  5EAY A;  2FXQ A;  4J15 A;  1QUQ A;  1K0S A;  2KOL A;  4TVA B;  3TZU A;  2JA8 G;  1L1O B;  3BQ1 A;  4PQX A;  2RGR A;  4IUQ A;  3JRW A;  1R4P B;  4DR5 Q;  2R7N A;  3S1R B;  1B70 B;  4XIG S;  1VQO A;  5JPM C;  1VBG A;  1VMP A;  2WII B;  5KND A;  1G6Z A;  3KAK A;  1T5E A;  2EYM A;  4JCV E;  3PO3 G;  4KY5 A;  1PRT B;  3QJY A;  3U58 A;  4NXN Q;  1HA5 A;  4C3H H;  4GKK Q;  1LT3 D;  4YJ2 F;  3SI8 A;  4WBN F;  3BDO A;  2NB0 A;  3DWA A;  3HOU H;  2FP4 B;  1UNS A;  1STG A;  2EIF A;  2OQ0 A;  4UDU C;  3R23 A;  3PO2 B;  1ZKO A;  1B7Y B;  1RYR A;  1K1S A;  3WO1 A;  2R61 A;  1PTO D;  4U67 3;  4ECY A;  5C44 B;  4DR5 L;  4OIJ A;  1S5C D;  1GSA A;  4BWG B;  4ED2 A;  1PH9 A;  1GHK A;  5IP7 G;  4IUR A;  3N6R A;  3IFT A;  1WH2 A;  1S5D D;  1HUM A;  4BWS C;  5IT9 c;  3H6M A;  5LYJ F;  1E1T A;  1LTI D;  2EJM A;  4KN7 C;  1V43 A;  4DR6 Q;  1CKO A;  2VQD A;  4DUZ H;  5F9N A;  5DM6 3;  4XX0 B;  3T1H Q;  4BY1 G;  1S10 A;  4JI1 L;  5JAV A;  1D2B A;  3BVM A;  4ZQ3 A;  4AYB B;  1AE2 A;  4DAY B;  3CCR A;  4A3I B;  4TQS A;  1VQA A;  1VDZ A;  3LWU A;  3T4A C;  1X56 A;  2BDO A;  3I7F A;  1MBY A;  1PZK D;  2OWO A;  3U50 C;  1LTS D;  2R7D A;  2GN5 A;  3FKI G;  4RAU C;  3TII A;  2VA3 A;  4A93 H;  1I50 H;  4AIM A;  3SHL A;  5IGE A;  3KHG A;  1AN8 A;  3DF7 A;  1S0M A;  4LFB H;  1RDP D;  3NHH A;  3GV7 B;  3KTM A;  4JI8 Q;  4YCW A;  3CCL A;  1ASZ A;  1DZ1 A;  1FVI A;  3OHX C;  5M3F G;  1C0A A;  1VQP A;  3BJY A;  3GTL A;  2MPM A;  3MFH A;  4CDE C;  4QUC A;  4HID A;  4DKA C;  2ASJ A;  3URY A;  3GTP B;  1VF5 C;  3H4D A;  1QNK A;  2F0G A;  1U4P A;  4RHR A;  3AFQ A;  4GN3 B;  1EYA A;  4DLK A;  4LFA L;  4CKB A;  4POG A;  1PYS B;  4K2K A;  4Y52 H;  3MXG A;  5D1P A;  4IUP A;  2UUC H;  4EYH B;  1GUO A;  4BXX G;  3PIO A;  2B2Y A;  4UP7 A;  2JN4 A;  1T9H A;  3Q0A A;  2BA1 A;  1VBH A;  4ZLT F;  2XGP A;  3DLL A;  3HKZ A;  4LF6 H;  2L0C A;  5G3L F;  4J1M A;  5L1K A;  3VR2 A;  2XWJ B;  5I6W A;  4K0K Q;  5IOC A;  4RCN A;  1DD2 A;  4QL5 A;  1HZB A;  2A19 A;  3RLF A;  4YP3 A;  2XCP A;  3RAQ A;  3RF2 A;  5FD6 A;  3TP7 A;  4QWD A;  1PFN A;  1WTV A;  3AMU A;  1O78 A;  2EY6 A;  1EFI D;  3PCO B;  3U4Z A;  4YIJ A;  3GTO H;  4DV5 L;  1DGS A;  4JW0 A;  5IYC H;  3H0G G;  2Q8R E;  1XMQ L;  1CS0 A;  4C5C A;  4C5A A;  4DV2 H;  3RUZ A;  2WB1 E;  4E4T A;  5FLM H;  4O2A F;  3E3X A;  4C5B A;  4A3L G;  2W70 A;  4XQN A;  1EWH A;  4RB0 A;  1SBB B;  2R7L A;  3GTQ H;  1DCZ A;  2GA4 B;  1DON A;  1I3Q A;  3A56 A;  1STN A;  4LSA A;  4JV0 A;  2VQF H;  2DZD A;  3MR6 A;  4JYA H;  1FJG Q;  3DEP A;  2E2J B;  4LF4 Q;  5KT6 A;  4B9X A;  2ID0 A;  5BR8 L;  1UUP A;  1A15 A;  4YR0 A;  3S2D B;  3NEM A;  1BGW A;  2F4V H;  3IN5 A;  1N32 L;  1O7I A;  2QDL A;  4U68 A;  3N8D A;  1WCM H;  2NU8 B;  3RIZ A;  5C44 H;  3I3C A;  3G71 A;  2A74 C;  2W9C B;  2F0E A;  4IFD J;  1SYC A;  4DFA A;  3QWN A;  3M9N B;  1BR9 A;  2PZT A;  3GIQ A;  5K2M A;  1LO5 D;  3PQI A;  3IL8 A;  2WP8 J;  1Q8K A;  5IOD A;  2ZJR A;  4IJL A;  3PO2 H;  3JC6 6;  1W6J A;  3A8I E;  3PVX A;  1WCM A;  3MVV A;  1TR5 A;  4DV1 Q;  5CV5 A;  5COR A;  4JI0 Q;  5FK9 C;  1LYL A;  3GIM A;  4PZ8 A;  4CJ2 C;  2JA9 A;  5KRU A;  1N8R C;  2I07 B;  1L0W A;  2A5H A;  3LGJ A;  4NXM H;  4NXM L;  4IOC A;  4ED1 A;  4DAV A;  1PHJ A;  1QIL A;  5ELE A;  1NCV A;  1RL2 A;  1JX4 A;  3CPF A;  1VQL A;  2AGQ A;  3BU2 A;  1XNR Q;  2ZM6 H;  4LF5 L;  3EQL C;  1D5X C;  3H15 A;  1B3A A;  1S5B D;  3D0F A;  4JVZ A;  2DIK A;  4EEY A;  4L5Q A;  2XWB B;  3FRP B;  1SFO B;  3L4K A;  3PZP A;  3GTM A;  1B1Z A;  1KTK A;  3TN2 A;  2F4V L;  4A3B B;  3WOE A;  3TEH B;  1PV4 A;  5IT9 E;  1VCI A;  5KT4 A;  3HOX H;  3F2C A;  3I4N G;  5J2T F;  2FK1 A;  1CFM A;  3OWF A;  3T51 B;  2JA6 H;  4QY7 A;  5FLX L;  1AUV A;  5CV6 A;  2NN6 H;  2W6N A;  3GV3 A;  5LHY 1;  4O3O A;  3S17 H;  2VQF L;  1S3O A;  5I9P A;  1V1Q A;  2CHB D;  2O5J C;  1PH6 A;  4C56 C;  2A6H C;  5J1Z A;  2WAQ B;  1GGO A;  3PV0 A;  2KCC A;  4LF8 Q;  1VQ6 A;  3JSN A;  1J5E H;  1NBW A;  1CKM A;  1DYQ A;  1T3N A;  4JI6 L;  1YZ6 A;  3MWE A;  5C3W A;  1A63 A;  3MR3 A;  1S72 A;  4RNN A;  2LXJ A;  1NY4 A;  2F0O A;  2UU9 Q;  4GNX B;  3V6K A;  1FR3 A;  3K7U C;  3UDG A;  4ME6 A; 
#chains in the Genus database with same CATH homology
 4P74 A;  3OW2 A;  4A3D H;  2PI2 E;  1E3P A;  2F52 A;  4HIK A;  1KQS A;  2RCN A;  2ZTE A;  3GO5 A;  4A76 A;  3F2B A;  5J3B A;  1TXY A;  4DV1 L;  2Q2I A;  2OQK A;  1Y1W H;  5HGQ A;  1HNX L;  1Q1B A;  2HHH L;  1N36 L;  1N33 Q;  4P72 A;  1FGU A;  3HKZ G;  3OTO Q;  1KD1 C;  2UUA L;  4JC0 A;  3NEN A;  5LMN L;  4JI4 Q;  2JA7 H;  2IHF A;  2MO0 A;  1JJ2 A;  4A3D G;  2UXB L;  2N49 A;  1LTL A;  1SE8 A;  4LFB Q;  4DV7 Q;  2AHO B;  1EOV A;  1VQ4 A;  1EWI A;  3G6E A;  4DV3 L;  3BZC A;  4A3G G;  1N32 Q;  1WJJ A;  2E2I H;  5AJ3 L;  1SRO A;  3AFP A;  4DV0 L;  2D0O A;  1UE5 A;  4R4T A;  2E5L L;  4UY8 C;  3HOY G;  1V9P A;  3TS2 A;  5C4X H;  1IBL L;  1Q46 A;  1UE7 A;  1G51 A;  5M5X H;  3M4O H;  4IFD I;  3HKZ E;  5LMN Q;  4JI4 L;  2UXB Q;  1Q7Y C;  4LF5 Q;  3UE1 A;  3PUZ A;  4A3J G;  1K73 C;  3CAM A;  4DR3 L;  1I94 Q;  1R9T H;  4JYA Q;  2ZTD A;  1D8L A;  1K9M C;  2KCT A;  1HR0 L;  3L2P A;  2D0P A;  3ERS X;  4DK3 C;  5C44 G;  2MO1 A;  4OX9 L;  4PG3 A;  1A62 A;  2MFI A;  3J81 j;  1C9O A;  3CD6 A;  1KRS A;  4ALP A;  4A3E G;  5C0X J;  5JJK A;  1M90 C;  1XNQ L;  1OXT A;  3H0G H;  4HJ9 A;  3HOV H;  1GM5 A;  1XMO Q;  5GRO A;  3E0E A;  1Q86 C;  1OXV A;  2Q2U A;  4HIO A;  2HIV A;  3CMA A;  1YJN A;  4B3M Q;  1LUZ A;  4O2D A;  1X54 A;  4X62 L;  2HT1 A;  2NN6 G;  4A3B H;  5AJ3 Q;  2E5L Q;  4BBS H;  1X55 A;  2K4K A;  1PFS A;  1N9W A;  1OXX K;  3M4Q A;  2UU9 L;  4JBW A;  3UE0 A;  1I5F A;  1SLJ A;  2AKW B;  4A3K H;  4UP9 A;  4BBR G;  3RN2 A;  1IXR A;  3I4M G;  2ZJQ A;  4C3J H;  4NPS A;  3HOZ G;  3K0X A;  4IJH A;  2H5X A;  1MJC A;  2DUD A;  3UDI A;  3A74 A;  3AQQ A;  2N3S A;  4DV4 L;  1P8L A;  4DR1 Q;  4AQY L;  2E2H H;  1JJC B;  3CQZ H;  1NMG A;  4L5T A;  2UUC Q;  2EXD A;  2JQO A;  2HHH Q;  2CCZ A;  3J7Z C;  4LF7 L;  1GD7 A;  5IYC G;  1BBU A;  2C35 B;  4HJA A;  3CW2 C;  4OO1 G;  2WAQ G;  3NBH B;  2OTL A;  1PA6 A;  2CWA A;  1M1K C;  5C4J H;  2Y0S E;  2YYZ A;  3K80 C;  1Y1W G;  1SRU A;  3CC4 A;  5GAE C;  3L0O A;  1VQF A;  2D62 A;  4YHH Q;  1Q82 C;  1HNW Q;  3HOU G;  1X3F A;  1ASY A;  1IBM Q;  4DK6 C;  4LF6 L;  5M3M H;  3JAM i;  4X65 Q;  1OXU A;  1XNR L;  1GO3 E;  4O0A A;  3F2D A;  1CSQ A;  3UDG A;  2NVX H;  4A3G H;  1E22 A;  5K36 G;  1H95 A;  2VUM H;  1K3R A;  1YHB A;  2N8N A;  3TRE A;  4JOI A;  1WI5 A;  4NB3 A;  2JEB I;  2PI2 A;  2L15 A;  2VQF Q;  3W1B A;  1EUJ A;  2VW9 A;  4IOA A;  1HR0 W;  2KEN A;  1JJG A;  3ULP A;  3T1Y L;  3TS0 A;  4LUZ A;  1AE3 A;  3PUV A;  4DUZ L;  3PO2 G;  5H1S E;  5LMU Q;  2OTJ A;  4DR1 L;  2DGY A;  5ELN A;  2Z0S A;  4HIM A;  1XPO A;  2F4V Q;  2YTX A;  2NVQ H;  3E9H A;  5FJ8 G;  2NVT H;  1EQR A;  3I56 A;  1NE3 A;  3J81 i;  1CKN B;  3CCM A;  4A93 G;  4A3E H;  5IWA Q;  4LF4 L;  5IY0 A;  1P16 A;  3PUX A;  4RG1 A;  3WWV A;  1QZH A;  1PH8 A;  4LFC L;  4L5S A;  1XJV A;  2B3G A;  2R93 H;  2Z6K A;  4X62 Q;  1PVO A;  3CCU A;  4KHZ A;  5M5W H;  3G48 A;  4JOI C;  4B3M L;  4LFB L;  4NXN L;  2NN6 I;  2RHS B;  1Y14 B;  2WFW A;  3GD7 A;  1EYG A;  1XMO L;  2I5M X;  4JYA L;  1GVP A;  1HNZ L;  3OTO L;  4YY3 Q;  4DV6 Q;  1QVG A;  1N33 L;  1N36 Q;  4JI2 Q;  2JA8 H;  2NVY H;  1XMQ Q;  4NXM Q;  1QVC A;  1XPR A;  3T1H L;  2K5N A;  5IYD G;  1X6O A;  5M5Y H;  1MKH A;  2VY3 A;  4YWL A;  2NZO A;  5C3E G;  3CPW A;  4JI0 L;  2PNH A;  3RLO A;  4EX5 A;  4R4I A;  1Q1E A;  1VQM A;  4DR4 L;  3KF6 A;  5C0X G;  2KHI A;  1AH9 A;  1X3E A;  1W2B A;  1TWA H;  4GKJ L;  3L7Z C;  3PF5 A;  1SFO H;  4ME3 A;  4JBM A;  3RR5 A;  3UDF A;  3RZD H;  3BZK A;  4BA2 I;  1IBL Q;  1TWF H;  3FKI H;  2B29 A;  2R92 H;  1VQI A;  1PH5 A;  2JA7 G;  2I0Q A;  2YTV A;  3CCE A;  3I4O A;  2EQS A;  2VL6 A;  4K0K L;  1BVS A;  2UXC Q;  2XGT A;  1VQ5 A;  3GTK H;  1KL9 A;  1SR3 A;  1I6H H;  4DV3 Q;  3CP0 A;  1UWV A;  1VQG A;  4B3T L;  4LWC A;  3PGZ A;  4MZ9 A;  3D31 A;  2QGQ A;  3H3V I;  1VQ8 A;  4JI7 L;  1PH4 A;  2I5L X;  1YIJ A;  2VNU D;  2OCE A;  2PQA B;  2CKZ B;  4PZ7 A;  1NTG A;  4GKK L;  2QEX A;  2ES2 A;  4DV2 L;  4GS3 A;  2YU9 H;  4X64 Q;  4X66 L;  2NZH A;  1G6P A;  3PSI A;  4JI5 L;  2VQE Q;  4A3J H;  4KI0 A;  4A3L H;  3K8A A;  3STB D;  5GAH C;  4BY7 G;  5M3M G;  3ER0 A;  4JI8 L;  3JAM c;  1BBW A;  1Y1V H;  2JJQ A;  4B3R L;  4QQB X;  3EBE A;  4AYB G;  3ICE A;  3KLW A;  5IP9 H;  1SN8 A;  2V1C C;  3TQY A;  4KHP Q;  1SMX A;  2HQL A;  3GTP H;  4JBK A;  1A8V A;  4LW1 A;  3VDY A;  2UXD L;  4DR2 L;  1W3S A;  3EN2 A;  3W5O A;  1KIX A;  1VQ7 A;  4DV5 Q;  1JE5 A;  3IRB A;  1N34 Q;  2UUB L;  4DR7 Q;  3ZJY C;  4IPH A;  1YJW A;  1QZG A;  4B3R Q;  3KF8 B;  1FL0 A;  1NMF A;  3CC2 A;  3AYH B;  4B3T Q;  4LF8 L;  1PH1 A;  4GN5 A;  1KHI A;  3ULL A;  3J80 c;  1TWC H;  3CXC A;  1TWG H;  4BA1 I;  5M3F H;  4A3B G;  4JV5 Q;  1IYJ B;  5FJ8 H;  3PF4 A;  3HOX G;  1VQH A;  2K50 A;  1YBY A;  1HZC A;  4UP8 A;  5EAY A;  3ULJ A;  3I4N H;  3KFU A;  2FXQ A;  4J15 A;  1EQQ A;  1UEB A;  2K52 A;  3HOZ H;  5IYB G;  4DUY Q;  4GNX C;  1QUQ A;  4A3F G;  3HOW G;  4JG2 A;  3A0J A;  4TVA B;  2ZM6 Q;  1XPU A;  2JA8 G;  1VQC A;  1L1O B;  3KOJ A;  2VS1 A;  4DR5 Q;  1VQO A;  1B70 B;  4XIG S;  2BH8 A;  4YWK A;  5DLQ E;  4C3I H;  4LNQ A;  5FLX c;  2IX0 A;  5IYD H;  4R4O A;  1X65 A;  2XTI A;  3HOV G;  5BR8 Q;  2BH2 A;  2VQE L;  4JI5 Q;  3I55 A;  4B3S Q;  4X66 Q;  4JCV E;  1NJI C;  3PO3 G;  3U58 A;  3OYY A;  1VQD A;  4C3H H;  4NXN Q;  3TRZ A;  4GKK Q;  1WCM G;  3CCS A;  2KCM A;  5IE8 A;  4JI3 Q;  4JI7 Q;  4LUO A;  4IPC A;  3CCQ A;  4JBJ A;  2LSS A;  2A8V A;  3RNU A;  3H3V H;  4FDB A;  3HOU H;  4YWM A;  3J7A 5;  3KDF A;  3S15 H;  3FP9 A;  2EIF A;  2IHE A;  2OQ0 A;  4B3S L;  4R1J A;  1KRT A;  4OWT B;  1EFW A;  2R92 G;  4A3C H;  3S24 A;  1KAW A;  4P73 A;  4X6A H;  1VQ9 A;  1B7Y B;  4DAM A;  1IBK L;  3CME A;  2VZA A;  4JI1 Q;  4POF A;  3KDF B;  1J5E Q;  4PZ6 A;  4DR5 L;  4DPG A;  4GLA C;  1L2F A;  5IP7 G;  1PYB A;  2N78 A;  1PH9 A;  3S14 H;  1K8A C;  3DM3 A;  3T1Y Q;  2E8G A;  2IY5 B;  3M4P A;  2F3I A;  1MJE A;  4BY7 H;  5IT9 c;  1E1T A;  4DR6 Q;  4UPA A;  1V43 A;  1CKO A;  3STB C;  2KHJ A;  1J5E L;  1CKN A;  4BY1 G;  3G4S A;  1VQB A;  3T1H Q;  4JI1 L;  1PH3 A;  2QA4 A;  1L1O A;  2Z6K C;  4DAY B;  3CCR A;  1AE2 A;  4DR7 L;  1VQA A;  3GTJ H;  1U5K A;  4JV5 L;  1HNZ Q;  1X56 A;  3I7F A;  4RMF A;  2OWO A;  2UXD Q;  3U50 C;  4YCU A;  2R7D A;  1RIP A;  2WB1 G;  2GN5 A;  3FKI G;  4GOP A;  1IBM L;  4LF6 Q;  3GTL H;  2KBN A;  1FJG L;  1I50 H;  3RLN A;  3S1R H;  4A93 H;  4LFA Q;  4AIM A;  3UDX A;  3A5U A;  1N34 L;  4LFC Q;  1YI2 A;  2A1A A;  2VUM G;  4R4Q A;  4JI8 Q;  4YCW A;  1YJ9 A;  3CCL A;  3EIV A;  1ASZ A;  4LF9 Q;  1FVI A;  5IWA L;  3A5Z B;  5M3F G;  1C0A A;  5E7N A;  4KLK A;  1VQP A;  2Q2T A;  1HZA A;  1BKB A;  4HID A;  4DKA C;  1E24 A;  4HJ7 A;  1E7Z A;  1A0I A;  4MTN A;  4C2M H;  4AYB E;  1UE6 A;  4EQ5 A;  3AFQ A;  3I2Z A;  1YNX A;  4GN3 B;  4GOP C;  4LF7 Q;  3HOW H;  3PUW A;  2R6G A;  1YHQ A;  4DUZ Q;  4LFA L;  4POG A;  4IFD G;  2PMZ E;  1PYS B;  4MNO A;  4OWW B;  4Y52 H;  3F1Z A;  4GLX A;  2ZM6 L;  3K81 C;  1S40 A;  3KYH C;  4BXX G;  3S2D H;  3PIO A;  2AWN A;  4A3F H;  4UP7 A;  5IP9 G;  1HZ9 A;  1T9H A;  2WAQ E;  2BA1 A;  1VQE A;  4P71 A;  1K0R A;  5GAD C;  3DLL A;  3J81 c;  4IO9 A;  4BBR H;  4A3M G;  2K5H A;  3RN5 A;  3PUY A;  3GTG H;  4HJ5 A;  4WJ4 A;  2AWO A;  1D7Q A;  2JE6 I;  1OTC A;  2B63 H;  2JA6 G;  4DR6 L;  5FLM G;  4DR2 Q;  1YHA A;  4QL5 A;  4K0K Q;  1HZB A;  2A19 A;  2ALY B;  3Q8D A;  2CFM A;  3RLF A;  3PO3 H;  4BXX H;  4OON A;  5JEA G;  3S16 H;  1KXL A;  5LMN W;  4YHH L;  3PCO B;  3U4Z A;  1CUK A;  1GKH A;  2PQA A;  3GTO H;  4DV5 L;  3U4V A;  4HJ8 A;  1DGS A;  1VS0 A;  3B6Y A;  4LUV A;  5IYC H;  3H0G G;  1XMQ L;  5GAG C;  1XNQ Q;  3MEF A;  1HJP A;  2WB1 E;  5FLM H;  4KHP L;  4OX9 Q;  4A3L G;  3KJP A;  5IYB H;  4X64 L;  5C3E H;  4LF9 L;  4BBS G;  4DV2 Q;  4GNX A;  1JMC A;  4XTC S;  3J80 i;  2K14 A;  1Y1V G;  1YVC A;  4P75 A;  1JB7 A;  1HR0 Q;  2JEA I;  4H02 A;  3GTM H;  4TQU S;  3SGI A;  3GTQ H;  4AH6 A;  2UXC L;  4YCV A;  3HFZ B;  3KF6 B;  2IX1 A;  4A3C G;  4A3K G;  1I94 L;  1WYD A;  2YTY A;  4JI2 L;  3HKS A;  1FJG Q;  3K7A H;  3AEV A;  4YY3 L;  2ZTC A;  2JA5 H;  3HOY H;  5C0X I;  2UUC L;  2CQO A;  4GLV B;  3CCV A;  1PH7 A;  2R7Z H;  4LF4 Q;  1J6Q A;  2Y0S G;  1TWH H;  5IP7 H;  2RF4 A;  2ID0 A;  3E9I A;  5BR8 L;  1WOC A;  2IT1 A;  2ATW A;  3NEM A;  1C7Y A;  2GVB A;  1N32 L;  4L5R C;  1O7I A;  2JA5 G;  1WCM H;  4QGU A;  5HY6 A;  4IPG A;  5C44 H;  3G71 A;  2R7Z G;  5JJI A;  1IL2 A;  3M7N A;  4IFD J;  2K5V A;  4R4C A;  3W1G A;  1CSP A;  1Q81 C;  5ELO A;  3S1M H;  1G29 1;  4IPD A;  1K83 H;  4DUY L;  1LM0 A;  4OXP A;  2ZJR A;  2WP8 J;  1Q8K A;  2YV5 A;  3PO2 H;  1U0L A;  1B8A A;  4IJL A;  3JC6 6;  2R7F A;  4DR4 Q;  1IBK Q;  1JT8 A;  1HNX Q;  4DV1 Q;  4A3I G;  3FHW A;  4JI0 Q;  1LYL A;  4DV6 L;  1Z9F A;  4PZ8 A;  1YEZ A;  1WFQ A;  2JA9 A;  3NEL A;  1KC8 C;  4GN4 B;  1N8R C;  1L0W A;  2ZJP A;  3LGJ A;  4NXM L;  4IOC A;  2ASB A;  4A4I A;  1PHJ A;  3KJO A;  4OO1 I;  2HIX A;  2BA0 A;  4JI3 L;  1RL2 A;  5C4X G;  4DR3 Q;  5JEA J;  3CPF A;  1VQL A;  3BU2 A;  3GDE A;  1IZ6 A;  2UUB Q;  1XNR Q;  4LF5 L;  2CWP A;  2GVA A;  1QUQ B;  4A75 A;  1EIF A;  3H15 A;  4A3I H;  3D0F A;  3PIP A;  4L5Q A;  1OXS C;  4GOP B;  1HNW L;  4DV0 Q;  1VQJ A;  1I3Q H;  3F8T A;  2JK8 A;  3CF5 A;  2F4V L;  3S1Q H;  3TEH B;  2AMC B;  4DNI A;  1PV4 A;  1VCI A;  3HOX H;  3F2C A;  3I4N G;  3M9B A;  4WJ3 M;  3S2H H;  5GQO A;  4PMW A;  4QY7 A;  2B63 G;  1Q12 A;  4DV7 L;  2JA6 H;  4OWX B;  3S1N H;  1K8G A;  4QIW E;  1EIY B;  4AQY Q;  3S17 H;  2VQF L;  5LMU L;  1S3O A;  2UUA Q;  3CCJ A;  1YIT A;  3I4M H;  1V1Q A;  1Z47 A;  1PH6 A;  1MIU A;  3CC7 A;  2RHQ B;  4DV4 Q;  1X9N A;  3M3Y H;  2MNA A;  4X65 L;  1VQK A;  3PV0 A;  5JJL A;  4LF8 Q;  1VQ6 A;  2R93 G;  1VQN A;  3BJU A;  1QVF A;  1E1O A;  1L1O C;  1NBW A;  1XTD A;  1CKM A;  2K75 A;  3MXN B;  2LXK A;  4JI6 L;  1YZ6 A;  3RZO H;  4BY1 H;  1UE1 A;  1S72 A;  1A63 A;  2LXJ A;  1NY4 A;  2MQH A;  2Q2H A;  3M85 A;  2UU9 Q;  2I5H A;  1X3G A;  4GKJ Q;  4GNX B;  4QJF A;  3K7U C;  4Y7N H;  4JI6 Q;  4APV A;  4A3M H;  1PH2 A;  2E2J H;  1HH2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...