4A93G

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a93G01
3S17H 3JAMi 2E2HH 2Z6KC 1HNWQ 2RF4A 1HZBA 3A74A 1YI2A 2B29A 1NE3A 1YHBA 2A8VA 1VQ8A 2R93G 1VQJA 3CCSA 4B3TQ 2B63H 1N33L 2ZJRA 1EIFA 1VQGA 1HNZQ 1J5EQ 3PUVA 4IPDA 5JJKA 2PQAB 1YEZA 3CCUA 3K81C 1GKHA 4QL5A 3T1HQ 1YIJA 4X65L 1HR0Q 3AFPA 2HHHL 5FJ8H 5IYDH 2NVXH 4BA2I 4A3BG 5M3FG 4LF4Q 1N36L 1VS0A 5GROA 1HZCA 2YTYA 5FLXc 1SE8A 1WOCA 4DV5Q 1WCMH 3A5UA 4DR1Q 1TWCH 1BBUA 4DUZQ 1A63A 1UE5A 4A3MG 1Y14B 3DM3A 2F4VQ 5M3MH 1BKBA 3FKIH 1KRTA 1HJPA 1L2FA 3PO2G 1B8AA 1U0LA 2JQOA 1I50H 1IBLL 3F2BA 2I5MX 4IFDI 1SR3A 1LUZA 2JK8A 2MFIA 1HR0L 1VQMA 4LFCQ 3ER0A 1XJVA 1SRUA 4B3SQ 3HOZH 2OQKA 1MJCA 2ZJPA 4YCUA 1XMQQ 4NXML 2YU9H 2LSSA 3HOWG 4A93G 3OTOL 1UE7A 4JV5Q 4UPAA 1WI5A 1NY4A 4DK6C 2ZTDA 1A8VA 3I56A 1DGSA 4WJ4A 3BZCA 1XPRA 2A1AA 3E0EA 4DV6L 1Q7YC 2JA7H 4JG2A 4JI0L 2R92G 4L5SA 1YNXA 3G48A 3A0JA 4LF5L 4GS3A 3K7AH 3NEMA 1RL2A 1Y1VH 5JJLA 4DV7L 2UUCL 3UE1A 1QVGA 4GKJL 1K9MC 2VL6A 4DKAC 4LF6Q 4JBWA 1EYGA 4KHZA 2NVQH 4LFBQ 4C3IH 2K14A 5JEAJ 2K5HA 4GKKQ 1KD1C 4P74A 5FLMG 4LFAL 3S16H 3F2CA 1Q8KA 2CWAA 4AH6A 4X62Q 2NVYH 3PV0A 4JV5L 1ASYA 1YZ6A 5IE8A 2XTIA 4QY7A 3OYYA 1HNXQ 1KRSA 3KYHC 4ME3A 1UE6A 2V1CC 5LMNQ 3RLFA 2VUMH 2UXDQ 4QGUA 4DR5Q 2EQSA 4XTCS 2ZTCA 4PZ6A 2CKZB 5GAGC 5IP7G 1IBMQ 3M3YH 1N32Q 4A3CH 1I3QH 2WB1E 1YJWA 1XTDA 4NXNQ 5C4XH 2BH8A 3K0XA 2R7ZH 2JA6H 1K0RA 3GTOH 4OX9Q 2ATWA 3ULJA 4XIGS 1Z9FA 2LXKA 4LNQA 5M5XH 4DR3L 4JI8Q 1KXLA 4X62L 2E2JH 3L2PA 2K52A 5M3MG 4FDBA 3KDFB 3CCJA 4TQUS 3FHWA 1PH7A 3FKIG 1TXYA 4H02A 3PIPA 1WYDA 4A3KG 1Y1WG 5LMNL 2UUBQ 4B3ML 1CKNB 2KHIA 3HOYG 4A3EG 3J80i 5IYBH 4LF8Q 2MO0A 4C3HH 3IRBA 3KDFA 3NELA 5IWAL 2WFWA 3U4VA 5C0XJ 3S1QH 3CW2C 4JI7Q 3GD7A 3GDEA 1CKNA 5J3BA 2KCMA 3CCMA 1W2BA 2GN5A 1EQRA 2JA5H 1FVIA 3K80C 1I94L 4AYBG 3E9HA 4OONA 2HT1A 4DPGA 1IXRA 2K50A 4DV4L 4A3LG 1HZAA 2ID0A 1UE1A 1T9HA 4KI0A 1J6QA 3G6EA 2CWPA 1YJNA 3ULPA 2OWOA 2JA7G 4K0KL 1VQAA 1HH2P 1QVCA 1IYJB 4LUVA 4X64Q 4JI4Q 5LMUQ 4DR7L 3DLLA 1LYLA 2VS1A 1TWFH 2VW9A 2OTLA 4YHHL 1TWGH 2JEBI 1V43A 4A3JH 1JJCB 4JI3Q 1FJGL 2NZOA 2PNHA 3W1BA 2CQOA 4JI7L 2E5LL 4GOPA 1MIUA 1X55A 2YTVA 4DV2Q 3VDYA 5JEAG 3CCLA 2ASBA 1KIXA 5JJIA 2CFMA 4P73A 3PIOA 4DV3L 3D31A 4JBMA 5AJ3L 4GNXB 2Q2UA 3J81c 1R9TH 4JI5Q 1A62A 4HJ7A 4DR6L 4L5QA 3CP0A 3HKZG 3PO3H 1QZHA 2NN6I 2UU9L 1PVOA 1XNQQ 2RCNA 1V9PA 2QA4A 1UWVA 1EIYB 1OXUA 4GNXA 4IFDJ 4DV1L 3F8TA 4PZ7A 1NBWA 3TREA 4EQ5A 4DUYQ 4A3CG 4OO1I 4R1JA 1G291 1VQLA 1VQNA 5C4XG 4JI3L 3CXCA 1VQ4A 1TWHH 2IX1A 1VQIA 2R7ZG 3B6YA 4JYAQ 1HNWL 4IJHA 4QQBX 1G51A 3EBEA 2R7DA 4DAMA 1N34Q 3GTJH 2Y0SE 1SLJA 3JAMc 3HKSA 2KBNA 1XNRQ 4B3TL 2AHOB 1VQ9A 1HNZL 1J5EL 4EX5A 1PH5A 4LW1A 4DUYL 1X3EA 3RLOA 4R4OA 5C44H 3T1HL 1Q12A 3CMEA 4TVAB 2IY5B 2RHSB 5IYCH 5C0XG 1PH9A 3I4NG 1WJJA 2OQ0A 3RLNA 1SMXA 4HJ5A 4DK3C 1M90C 3TS2A 1KHIA 2N78A 4R4CA 4JI2Q 3KF6A 3T1YQ 4LF4L 3GTGH 5M5WH 4HJ9A 3RR5A 5BR8Q 2QEXA 1E1OA 4UP8A 2D0OA 4DR1L 4DV5L 3CC2A 4BXXH 1IZ6A 4DUZL 1C7YA 4B3RQ 2BH2A 2VQEQ 1X3GA 2F4VL 2B3GA 3FP9A 4X66Q 1EWIA 3J7ZC 4A3DH 1RIPA 4A3IH 1E22A 4GLAC 2IT1A 2Z0SA 3KOJA 2IHFA 3PSIA 1XMOQ 1VQ7A 1XPUA 1C9OA 3J81j 2MNAA 4YWKA 4A3GH 3CMAA 1VQ5A 4P71A 4LFCL 4A3FH 2L15A 5C4JH 1VQHA 3D0FA 4B3SL 3J7A5 4BBSH 1XMQL 2Q2HA 1JJ2A 1X3FA 4NB3A 4JI1Q 5M5YH 2Q2TA 2B63G 1JB7A 5H1SE 3PO3G 2BA0A 3HOXH 3CC4A 1NTGA 4JI6Q 2ZJQA 2NZHA 1JE5A 1PFSA 4DR2Q 3NBHB 1SN8A 4IFDG 3A5ZB 3RNUA 2JEAI 1VCIA 3CPFA 5FJ8G 4LF7Q 2N3SA 4BBRH 1EUJA 2K5VA 5GAEC 5HY6A 1QUQB 4RG1A 3LGJA 3G4SA 1GO3E 2AWOA 4AQYQ 4LF6L 4IOAA 1S40A 1HR0W 3CCVA 2DUDA 2FXQA 1TWAH 3I2ZA 4JCVE 4JOIC 1YVCA 4R4QA 4GKKL 1K8AC 1WCMG 4HIMA 2JA9A 1SROA 3GTLH 2QGQA 1AE2A 1QUQA 4LF7L 1PH8A 2GVBA 2R93H 1YBYA 2HQLA 1Q82C 2H5XA 1X65A 4GLVB 4YWMA 5C3EH 4HIKA 2MO1A 2KENA 4DV0Q 1VQOA 1IBKQ 1HNXL 1AE3A 1VQKA 2NVTH 2XGTA 3F1ZA 3PF5A 5GQOA 4APVA 2UXDL 4GN4B 4DR5L 5E7NA 1MKHA 2EIFA 5C44G 3TS0A 1IBML 1N32L 3CC7A 4NXNL 4R4IA 3CCRA 3L7ZC 2ZM6Q 2AWNA 1U5KA 2VQFQ 1PH6A 3HOZG 4A3BH 5M3FH 1PH4A 1VQCA 1X54A 4MZ9A 3CCQA 1K8GA 4OX9L 2UXCQ 1KL9A 3AQQA 2K4KA 4KLKA 4YY3Q 4JI8L 1OTCA 4MTNA 4A3MH 2LXJA 3KJOA 1JMCA 3Q8DA 3H3VI 1A0IA 3JC66 2UUAQ 3ZJYC 4A4IA 1Y1VG 2UUBL 2IX0A 4GOPB 3PO2H 1L1OB 1P8LA 4J15A 3UDGA 4LF8L 1X6OA 3SGIA 3I55A 3H0GH 3GTMH 2IHEA 2MQHA 2D62A 3PUYA 3OW2A 3RN2A 1NMFA 4A3FG 4LF9Q 2R6GA 4A75A 4POFA 1GVPA 1L1OA 2K75A 4BBSG 1W3SA 4X6AH 4P75A 1MJEA 4WJ3M 1OXXK 4JBKA 1PA6A 4A93H 3UDXA 2OCEA 1N33Q 3HOXG 2JA8H 4LUZA 2KHJA 3M4PA 2WAQG 3RN5A 3MXNB 4X64L 2CCZA 1CUKA 4JI4L 2R92H 5LMUL 3BU2A 4GNXC 4BY7H 2VUMG 1PYBA 5K36G 4LUOA 4IPCA 4AIMA 4O2DA 5IYDG 1OXTA 4A76A 5IY0A 5LMNW 3U58A 4Y7NH 3S2HH 1N9WA 4X65Q 2HHHQ 4BBRG 1KAWA 4YWLA 1OXSC 1BVSA 1CSQA 1K3RA 1Q1EA 1YHAA 1N36Q 5C0XI 4L5RC 2JA6G 4DV2L 3M4QA 2Z6KA 1EOVA 1X56A 3M7NA 4DAYB 5FLMH 2UXBQ 1D7QA 1E3PA 1B70B 2WB1G 3MEFA 5GAHC 4JI5L 3HOUH 3I4OA 5C3EG 3G71A 1GM5A 5IT9c 1WFQA 4UP9A 3S1MH 1X9NA 1XNQL 3UE0A 3ICEA 4GN5A 4PMWA 1PHJA 2KCTA 5IYBG 4GLXA 2I0QA 1IBLQ 4UY8C 3KF6B 5IP7H 1VQBA 4QIWE 3M85A 1D8LA 3CQZH 1GD7A 3AEVA 4QJFA 2PQAA 2I5LX 2JA5G 1YITA 4HJAA 2R7FA 4IPHA 4NXMQ 3UDIA 2JE6I 4JYAL 1I6HH 3GO5A 3OTOQ 1SFOH 1Z47A 1KQSA 2PI2E 3U50C 1S72A 2UXBL 1O7IA 1P16A 3I7FA 4P72A 5DLQE 2F52A 1N34L 1IL2A 4DV6Q 3TRZA 3PCOB 2EXDA 1Q86C 3K8AA 2NN6G 4LWCA 4JI0Q 1Q1BA 1XNRL 1G6PA 3E9IA 4LF5Q 2WP8J 3PGZA 4AYBE 4A3KH 1Y1WH 4OO1G 3AFQA 2DGYA 3W1GA 4DV7Q 4HIOA 4L5TA 4IOCA 2UUCQ 4BY1H 3STBC 4HIDA 3L0OA 4A3EH 3HOYH 1OXVA 3CPWA 3CCEA 2HIVA 4A3JG 4OWWB 3S1NH 1PH3A 3H0GG 3KLWA 1NJIC 1VQDA 4HJ8A 1B7YB 1PH1A 4PG3A 3M4OH 2AMCB 3S1RH 3PUZA 4OXPA 5IP9H 4LFAQ 4JI2L 5ELOA 3T1YL 1HZ9A 4A3DG 5BR8L 2N8NA 4YCVA 4O0AA 4A3LH 1C0AA 3TQYA 2ALYB 2JA8G 1XPOA 4B3RL 1PH2A 4BY7G 2HIXA 2VQEL 3S24A 2ES2A 4RMFA 3RZOH 2F3IA 2E2IH 4X66L 4UP7A 1VQFA 2GVAA 4IPGA 3GTKH 3HOVH 2YYZA 1QVFA 3K7UC 1XMOL 1ASZA 5EAYA 3CD6A 3STBD 4JC0A 3S15H 4ALPA 3I4MH 3HKZE 2WAQE 1E1TA 4KHPQ 3ERSX 1LTLA 4DNIA 1Q81C 3GTPH 4Y52H 1L0WA 4DR3Q 4C2MH 2A19A 2E8GA 3HOUG 3ULLA 4JI1L 1VQPA 3H3VH 1VQEA 1H95A 1V1QA 2YV5A 4B3MQ 3M9BA 2JJQA 2VNUD 3KF8B 4JI6L 4JBJA 3U4ZA 1KC8C 4YCWA 1CSPA 4DR2L 2PMZE 1UEBA 3PUXA 1E24A 1EQQA 3KFUA 2C35B 2N49A 5IWAQ 3NENA 2Y0SG 1JJGA 5IYCG 3CAMA 1CKOA 4IJLA 1BBWA 1K73C 4OWTB 5GADC 3BZKA 4OWXB 2Q2IA 4AQYL 4LFBL 1I94Q 4POGA 4KHPL 1Q46A 1S3OA 2AKWB 4DV4Q 3RZDH 4JOIA 1M1KC 3EIVA 3EN2A 3AYHB 3UDFA 1YHQA 4BXXG 1FL0A 2VZAA 4PZ8A 1CKMA 1PV4A 3HFZB 4K0KQ 2OTJA 3PUWA 4DR7Q 4MNOA 3CF5A 1FGUA 3WWVA 1NMGA 3KJPA 4DV0L 4A3IG 1IBKL 3PF4A 4DR4Q 4YHHQ 4BY1G 1AH9A 2BA1A 1E7ZA 4R4TA 2VY3A 2RHQB 1JT8A 1FJGQ 4A3GG 1QZGA 3J81i 2E5LQ 3I4NH 4GOPC 5IP9G 5ELNA 1L1OC 4NPSA 2ZM6L 3J80c 2VQFL 4GKJQ 3H15A 2D0PA 4DV3Q 3GTQH 5AJ3Q 2UXCL 3HOWH 1VQ6A 1I5FA 4GN3B 3W5OA 4DR6Q 4YY3L 1LM0A 2UU9Q 3S14H 2ZTEA 2K5NA 4BA1I 3F2DA 1EFWA 2YTXA 4C3JH 5HGQA 4DR4L 1PYSB 2UUAL 3HOVG 4DV1Q 4IO9A 1YJ9A 2I5HA 1N8RC 2PI2A 3S2DH 3BJUA 3I4MG 3TEHB 1K83H 4LF9L
chains in the Genus database with same CATH superfamily
3KALA 3JAMi 2RF4A 1HZBA 1YI2A 1TS3A 2NU6B 5KFWA 3RB3A 1V1OA 2F0KA 1VQ8A 2R93G 1VQJA 2JA7A 2CZGA 1J8IA 2IPKD 4B3TQ 2FMAA 2V4RA 1JORA 3I4MB 3PW2A 5DGBA 4IPDA 5DLFA 4HNUA 4KD3A 3CCUA 4KHPH 1JWSD 2PW5A 2QCPX 1YIJA 5C5LA 1B44D 3T5KA 2B2UA 4X65L 5FJ8H 1WTOA 3JSLA 1U4RA 4BA2I 5M3FG 4LF4Q 1UC8A 1ONLA 1HZCA 5EGTA 3D4RA 1SE8A 4DR1Q 4DV5Q 5E4XA 1ILQA 3TZUA 1L2ZA 5KFNA 1S0OA 1LTID 3DM3A 2WAQA 1BKBA 2L55A 1XTCD 5LXTF 1S10A 3FKIH 1KRTA 2I07B 3BQ0A 1ENAA 5CV7A 2VQFH 4LMYA 3PO2G 5IIFA 2GPWA 3RZDB 2UXCH 2PMZB 1SR3A 2NU7B 2MFIA 3QZ8A 2M00A 1HR0L 4FS2A 4YY3H 5KG1A 2YW2A 1NUCA 5FPRA 2R7ZA 3GTOA 2RSNA 4ZQIA 1IOVA 2MP1A 3Q8PB 2IBKA 1KJIA 4A93G 1E2ZA 2XWBB 2F0HA 2ZTDA 1A8VA 3A55A 1DGSA 3BZCA 1XPRA 1FKAH 2RBMA 2GA4B 1WTHA 4J9KA 2R92G 2V4DA 1YNXA 4FVMA 5IGDA 3A0JA 4UAIA 4RHRA 1RL2A 3L3OC 3FEWX 2VL6A 5KT5A 1GSHA 4RB2C 4LF6Q 4JBWA 2K7VA 1EYGA 2ENBA 2NVQH 4C3IH 4Q8EA 4YAKB 2K14A 2TMPA 1KD1C 3G8CA 2UVRA 5JEAH 3S16H 4EFEA 1TWFB 1A3TA 4JV5L 1ASYA 3V2TA 1EY7A 1HNXQ 2HQEA 5L1IA 4RB3C 1KRSA 5KT7A 3KYHC 1K83B 2V1CC 5LMNQ 1RK6A 5KFCA 3HEJA 2UXDQ 1TWGA 3ND9A 5ELDA 3MFYA 4PZ6A 2CKZB 1YJWA 4YR0A 1YNNC 3M4YA 3Q24A 4RUCA 2BH8A 3ERQA 1G2TA 4EBEA 1W96A 1K0RA 3ITPA 4DR3H 4DGZA 2ATWA 2P0AA 4XIGS 5M5XH 1IBLH 2IP4A 4X62L 2NTSA 4XYLB 1EIHA 1I4RA 2O4XA 3KAJA 5KFRA 2PNRC 3FHWA 3FKIG 3ORRA 1TXYA 1WYDA 2UUBQ 4U673 1PK8A 1KLGD 1SNPA 2BE5C 3IRBA 3OTOH 5KG5A 5C0XJ 2AQ3B 3W3AA 4JI7Q 4ED0A 4DV6H 4H13C 5DG8A 3PIP3 1EQRA 3OW7A 1KDAA 3FKIB 1EUCB 1LLRD 3GIQA 3OSOA 4DV4L 4A3LG 1HZAA 1UE1A 3N52A 1J6QA 1B04A 1YJNA 3ULPA 1KEEA 1VQAA 1HH2P 4XT3B 5LMUQ 2VS1A 2VW9A 1SYXB 5GONF 5EWFA 2JEBI 5M5WB 2B2YC 5FKAC 4JI3Q 1AN8A 2PNHA 3W1BA 4C3IG 2KQ3A 4K6LA 4NW2A 1Q90A 1M6VA 1F2ZA 3GIDA 5JEAG 4GC7A 3CCLA 2YU9A 2CFMA 4P73A 2Q2UA 3J81c 4L6TB 4P2CB 2XRQD 2OEOA 4L5QA 3GIPA 3K5LA 1QZHA 5I2XA 4YR3A 2UU9L 4DL2A 1XNQQ 2RCNA 1V9PA 1UWVA 1OXUA 2QK4A 1VKZA 1VQLA 1TU2B 1VQNA 5HGTA 1TWHH 1U4MA 4IURA 4H0LC 1F77A 2KSWA 1SNMA 2EJFC 4IJHA 1G51A 1IOWA 1MI2A 3R8BA 4DAMA 3SXHA 1CQIB 4KKTA 1EZ8A 4F4XA 1SLJA 3HZXA 5IWAH 4HR7A 3GV5B 2FK3A 2A6HC 4BBRB 4H7BA 3U9SA 1VQ9A 3H20A 4J9SA 2ZXOA 2XNAC 2JEFA 1VF7A 4IQZA 4LW1A 1I3QA 4MTKA 1X3EA 2X69A 3RLOA 4CJ0B 5C44H 4RZRA 1Q12A 5M5XB 4C1NI 2RHSB 5FO9B 5IYCH 2HCCA 3RLNA 1TWAA 2N78A 2HJWA 3T1YQ 1ZHQA 5BR8Q 2D0OA 2LY7A 4BXXH 2WB1A 1IZ6A 2KCNA 4DUZL 1FJGH 1WTQA 2EOTA 4RGOS 1X3GA 4R8NA 4YR2A 2F4VL 3BG5A 1QE6A 3FP9A 4LSAA 2XRSD 2E5LH 4A3DH 1JE4A 3KOJA 2A69C 2V9WA 2IHFA 4DL4A 1F2MA 4ZAIA 2F0EA 1PMRA 3K57A 3BAAA 3NTKA 1VQ5A 4FXDA 4J1MA 5C4JH 1AEXA 1VQHA 2CVRA 1XWEA 3MTSA 3C46A 3Q6SA 3D0FA 2R87A 2W6MA 4YJ3F 4KY7A 3BQ1A 3J7AK 5TSSA 4EGVA 4JUZA 4DV1H 1KJQA 2K6AA 2Q2TA 5ELFA 3VPCA 1DONA 4JI6Q 1CT1D 4Q0FA 1PFSA 3G6JB 1N56A 1M0WA 4UCOA 2JEAI 4XX0B 4Q5VA 3M4IA 3H0GA 4LF7Q 1EUJA 2R8JA 4ETSA 1QUQB 3G4SA 4AQYQ 1DOMA 1GO3E 3NBHA 4B3TH 4IOAA 3O13A 5JH7F 1SNDA 4R4QA 2A74C 5JUMA 3KLSX 3L4KA 1YNJC 2JSOA 1AE2A 5DQHA 1HXYD 1GOZA 4DUYH 4DA2A 3H4BA 1I6UA 1YBYA 3KBXA 2R8GA 5IGBA 2H5XA 4MV8A 1SNCA 3M7GA 5C3EH 2W9BB 3V6HA 1IBKQ 2LFNA 4RHSA 1AE3A 3RTXA 4LF4H 1CQVA 4GN4B 2NU8B 5C44G 4DR1H 3R23A 4DV5H 3PMFA 3IL8A 3L7ZC 2AWNA 4E4TA 1VQCA 1X54A 4MZ9A 1K8GA 1G6ZA 2YRWA 2M2LA 3I3CA 2EY2A 2QKIC 5I9PA 2F4IA 2ZDHA 4JI8L 4MTNA 2LXJA 1JMCA 1QB5D 5I47A 3KTMA 5T1IA 1H9SA 3R2IA 3A8JE 4HNTA 5KFPA 5KFDA 4WJWA 3GLKA 5D65A 4RUAA 2TSSA 2Y0SA 5G3LF 1JWMD 5D14A 3G6YA 4RKLA 4DNTB 3LWEA 1NMFA 1ICWA 4RAZA 1SSOA 1TY2A 4POFA 1GVPA 3R5XA 1BJTA 3SK8A 2XGPA 3KHHA 4A3DB 2LKVA 1OXXK 4JBKA 1PA6A 1WTPA 5KFGA 3UDXA 2OCEA 1N33Q 2W8LA 2Z4HA 4JI4L 3JAMW 4LF6H 4XQJA 5K36G 5C4JB 5KFIA 4UCTA 4IPCA 4AIMA 1T3NA 3EPGA 1AUVA 1EY8A 1SJED 1F2YA 4ODGA 4KMUC 3GV8B 2HHHQ 1LTTD 1KAWA 4YWLA 3WO0A 3J7AV 1Q1EA 4L8JA 1SE2A 5KG7A 3N40P 2JA6G 2HGSA 1HNXH 4ZUIA 3DEOA 4DV2L 3M7NA 1KNEA 1X56A 5G3LD 4DAYB 5FLMH 2UXDH 1E3PA 3GTKB 3HOVB 1EHIA 3BVMA 1B70B 5GAHC 1PTOF 2NZ1D 4JI5L 4CJ1B 4DF7A 1AFPA 2RGRA 3I4OA 5C3EG 2EYFA 1FNWA 1FNVA 3G71A 4S3SA 2KHSA 4WRDA 3VR6A 2I87A 1X9NA 1PHJA 1MHWC 5IYBG 4GLXA 3UQ8A 1SJHD 3KF6B 1VQBA 4QIWE 4FYDA 3BABA 4ECUA 3QB3A 4ED8A 4KKSA 5KFLA 2JA5G 3FPPA 3JSNA 4IPHA 4NXMQ 4O1NA 2UUBH 3GO5A 1GXDC 1KQSA 1ZQ7A 1O7IA 1P16A 2F52A 4DK0A 5DM63 2QILA 3K58A 3K8AA 4LWCA 1Q1BA 2J6TA 4LF5Q 5C4ZA 3PGZA 4A3KH 4HIOA 3R3OA 4DV7Q 1PTOD 1MSGA 3MA2B 4O3QA 3LMLA 3WOFA 1QWYA 2OLSA 1VQDA 4HJ8A 1PH1A 1X3QA 3IAYA 2AMCB 5JPNC 3PUZA 1EZ6A 2V58A 4LFAQ 5LMUH 2F0JA 2KCCA 2R7MA 4LMQD 3KUPA 1KDCA 3Q23A 1C0AA 1PRTC 2RKSA 3MXGA 2XIWA 2VQEL 2VB3X 2ES2A 2E2IH 4FF4A 4ZYSA 5K2MA 3DWAA 2Z6BA 2D5DA 2YYZA 4Q45A 1NR2A 1Y8PB 1QVFA 2BR0A 4TQSA 3TN2A 1XMOL 3D8GA 1WH2A 3STBD 4JC0A 3S15H 2DJFC 4J9MA 2XCPA 4DAVA 1EY9A 4KHPQ 5KT6A 2SNMA 4ZOLF 2KECA 1XNQH 4DR3Q 4C2MH 3DF7A 4JV0A 4IUVA 4IALA 4UDUC 2I80A 4J9PA 1RYSA 1H95A 3ULLA 4K2KA 3KLSA 1B53A 4R8UB 2R82A 3C3LA 2QEJC 3M9BA 1KC8C 4YCWA 1UEBA 1E24A 5IGGA 3KFUA 2C35B 1VBHA 4NLGA 1RJRA 1ESFA 3D4DA 2PVPA 3D6CA 5KFMA 5FPOA 2B2TA 1I94Q 2GLTA 4ZKCB 5IGFA 1Q46A 5FLXL 1M1KC 3EN2A 4CBVA 4HMIA 1C4QA 4K0KQ 3HFZB 1H9KA 3D3RA 3HB9A 3OHAA 1BCPF 2EYHA 1DD2A 2E74C 1NMGA 4DV0L 3SK5A 3T1YH 4I7AA 2VY3A 3FRPB 5BR8H 4A3GG 4RZQA 4EG0A 3HG9A 2HVQA 5C3WA 4GOPC 5M3MB 4NPSA 2ZM6L 3J80c 4A3KB 3GTQH 5AJ3Q 1TWCA 5FO8B 3W5OA 1WSCA 3RB6A 3FPUB 4XDXA 2VPQA 4M7EA 4BA1I 1X32A 4MIUA 4UCUA 5HGQA 1EWHA 1C30A 5KFFA 2RDHA 1YJ9A 2YZMA 4IAJA 2IL8A 5A2QL 1BCPD 5CV9A 1SYDA 3S2DH 5CORA 4KY5A 5D1OA 4ED7A 1EY5A 2JA7B 4OIJA 1HNWQ 3AB9A 1G8ZD 4JI6H 2PZUA 4ILWA 1EUDB 3G6XA 3SK4A 5KRUA 1NE3A 1YHBA 4G4KA 2DNEA 4HTHA 3NTIA 5KFAA 2CW0D 2B63H 1B9MA 1WTWA 3S15B 1JX4A 1EIFA 1IHZA 1NR4A 3T51B 1HNZQ 4LF7H 1EYZA 2AQ4A 3PUVA 4AQYH 1A2TA 3PN1A 3K81C 1B4OA 5CV5A 2QDLA 3J7AF 2J9GA 2W6OA 4IWXA 3BZDB 2W57A 4C5CA 3BDLA 4U7CA 1I4PA 2NVXH 4A3BG 1RODA 1UUPA 1N36L 5GROA 1RHPA 1IBKH 4KV6A 2ICIA 2B2WA 1WCMH 2NVYA 1C3OA 1O7LA 5DM73 4A3MG 1Y14B 5DG9A 3HKZA 3EA6A 3IFTA 3RF2A 2X6LA 4A2BA 1L2FA 2R7ZB 4YBZB 1U0LA 1RF2D 4OEMB 4KD4A 3RAQA 2I5MX 1JOKA 1LUZA 4OL7A 3C1FA 4X3UA 1RJTA 1VQMA 5C8YF 2NUCA 5DEHA 1SRUA 1IL8A 5HV6A 4APMA 2JA6A 3SEBA 4B3SQ 3HOZH 2XCAA 1MJCA 1XMQQ 2YU9H 1DM0B 3X3MA 2DY8A 2LSSA 1UE7A 2RGVA 4IRCA 1M4VA 2A1AA 3ETJA 4JG2A 1Q8IA 3MZ5A 5LYJF 1TQOA 5I9OA 4GS3A 3K7AH 2R86A 1Y1VH 2UUCL 4GKJL 1QVGA 2EYMA 2DY7A 1K9MC 5C1OA 5KFOA 4QW9A 1N33H 2JA5A 4MTEA 3V4SA 2K5HA 3QO2A 4TRDA 2YRXA 2A73B 2DN8A 5CYUA 1BR9A 3I12A 5ELEA 1TWGB 3NE5B 4AH6A 1S5DD 1TR5A 3CU7A 1Z2PX 2HHHH 1DOLA 4XYMB 4ME3A 1HTPA 2ZXPA 2E76C 2FPGB 2VUMH 5DAUA 4QGUA 5IP7G 4XTCS 2ZTCA 1N32Q 3PR4A 1IBMQ 3HXLA 3H09A 1D1IA 1I3QH 4PMBA 3NQTA 4RCNA 1UNNC 5KT4A 1DOKA 4NXNQ 5C4XH 2B2TC 2B63B 1UAPA 5FD5A 2E2HA 5CMDA 3K0XA 1QILA 5KNCA 1GYFA 3ULJA 4ZHQF 1R9TA 3TP7A 5E1FA 2FPPB 1C8CA 3L2PA 3CCJA 4XYQA 1PH7A 2EXZA 3PIPA 1Y1WG 5LMNL 1F9QA 2NVXB 4HCEA 1B2TA 3GQBA 4R8IA 3SE7A 4NXMH 4C3HH 4IN3A 2HCIA 1WCMB 4F4YA 2SEBD 2WFWA 3U4VA 3CW2C 4DLKA 1CKNA 2CH4A 1K0SA 2WINB 5D3IB 4AYBG 3E9HA 4OONA 4EQNA 2HT1A 5KFKA 4EBCA 4LF5H 4ECYA 1EYDA 4DV7H 4EVOA 2QDBA 2CWPA 1Y69U 4YIJA 4DR7L 3TIGA 3V6KA 2EJGC 2ZXRA 4IUTA 1TWFH 3HOZB 1GUNA 4YHHL 4LFAH 4AYBB 3MFGA 4K6DA 3RD4A 2YU9B 4A3JH 3A8KE 5BPFA 3ND8A 4JI7L 2J0TD 3N42B 3NWTA 3RMHA 3LP8A 4N8X1 4CDFC 1KIXA 3K7AB 1GUSA 4DV3L 1SAPA 1Y1VB 1A62A 3QOJA 2RDFA 5ELBA 4HJ7A 4DR6L 4LJZC 1B6SA 4RNOA 2RDIA 3TMEA 5HURA 2NN6I 1PVOA 2F0SA 2R61A 4GNXA 4IFDJ 2CH4W 3PIO3 3F8TA 4PZ7A 4DUYQ 4OO1I 3L9AX 1XDNA 2VOBA 3MXNA 1CI3M 1CK1A 2EYLA 5C4XG 4RKBA 4JI3L 2Z1CA 1BDOA 1VQ4A 1VMPA 2IX1A 3B6YA 4JYAQ 5EQ0A 2F0MA 4QQBX 2ZT9C 2R7DA 2VUMB 1N34Q 4O3NA 1SNQA 1I3QB 3JAMc 2I8CA 1XNRQ 3BA8A 5C4XB 2EE1A 1HQMC 4IR9A 3AMUA 1J5EL 4MA5A 3RGZA 3WOEA 1I94H 4X3TA 2ZJTA 3T1HL 3N6RA 1O7ZA 5KFUA 4JPBW 1PH9A 4K0KH 2WB1B 5J2UF 4QWEA 5IYZF 2FK2A 2YZNA 3GTGH 1DXMA 5M5WH 3RR5A 5M9OA 2FP4B 3CC2A 4FM9A 4C3HB 2ZDQA 1E4EB 4B3RQ 4ZI7F 2BH2A 3OIPA 4X66Q 1TS2A 3J7ZC 1E22A 3MWEA 5J1ZA 2IT1A 1LT3D 3PSIA 1C9OA 5KIXA 2F0QA 3J81j 4QCLA 2MNAA 1GJXA 3EJIA 4LFCL 2XIGA 1PRTB 4JI4H 1S97A 4DL3A 5EZYF 3K5IA 3I72A 4BBSH 1LT4D 5LHY1 4RGMA 4CDEC 1X3FA 4NB3A 4JI1Q 2SCUB 1JB7A 4A3JB 5H1SE 1DV2A 2DZDA 4XQQA 2YS7A 2C28A 1HPCA 5KFVA 2NZHA 4DR2Q 3NBHB 1IKLA 1SN8A 1DYQA 1HNWH 3A5ZB 3RNUA 3P20A 4DAPA 5JVDF 3CPFA 3GTMA 5FJ8G 1EL0A 5KFHA 4BBRH 5KYLA 5KG6A 2BOSA 5GAEC 4LFBQ 5HY6A 4ED6A 4RG1A 3LGJA 1S40A 1HR0W 1HNZH 2W8KA 4JOIC 4GKKL 1K8AC 2FLPA 2JA9A 3NSWA 3GTLH 2OH2A 2L5TA 1E0BA 2QGQA 1ESRA 2NU9B 1EY0A 2HQLA 1ZHSA 1Q82C 1HQRD 3NTHA 5IT9L 2MO1A 1VQKA 4KY6A 2KOLA 3H4DA 2Q8TA 4EFBA 2WIIB 4DR5L 1MKHA 1JOQA 1JLLB 1K1SA 3CC7A 4ZKBB 3RV4A 3RFCA 5KFBA 4DN4M 3HOUB 3J80E 1BUVT 2SOBA 3CCQA 1R4QB 4OX9L 1KL9A 3L4JA 1I4XA 2W6ZA 1H9SB 1CE8A 4EQOA 4KLKA 1OTCA 3KJOA 3H3VI 1O78A 5IGEA 3JC66 2UVWA 2KJXA 4IZ8A 4B3SH 3BDCA 4GOPB 3GTGB 3SE0A 2W9AA 2PN1A 1XMQH 3UDGA 3CQZA 4LF8L 2F1MA 3I55A 4ME6A 1JR0D 3PW0A 3PUYA 4TSSA 4LF9Q 1AZPA 2G9DA 1QNUA 1D5ZC 4BWGB 1STYA 2MGSA 1L1OA 4G7ZC 1S5BD 2L12A 3P7JA 4BBSG 2R8IA 4P75A 4O3RA 4O3SA 1XMOH 2XGQA 3OSPA 4ECXA 1B50A 2KHJA 3M4PA 4X64L 5IT9E 3MWDA 1CUKA 4GNXC 1PYBA 4O2DA 3U58A 5IY0A 1JCKB 2J6UA 4BBSB 3S2HH 1N9WA 2B2UC 1TT2A 2A6ED 4BBRG 4X65Q 4NMZA 3K3PA 3M9NB 2AU0A 3R5FA 1BVSA 1K3RA 3JRXA 4XXEA 4L5RC 3SI8A 4IR1A 2PZWA 3M4QA 2Z6KA 1F9PA 5JVH3 1GHJA 3MEFA 1N32H 1IBMH 1GUWA 2O2LD 1RKNA 4I4TF 2AGQA 4NXNH 5CC4A 3LWBA 4JV2A 3BQ2A 1PTOC 1WTRA 3ICEA 2C5CA 4PMWA 3BA9A 4TV9F 1E2VA 2ICEC 3GTLB 4MHEA 1W93A 3FDSA 1GD7A 2DJGC 1DZ1A 2GPSA 4UCVA 1AN7A 5T1GA 2I5LX 2R7FA 3OMGA 2JE6I 1Z47A 2PI2E 3U50C 1S72A 4QF4A 3TRZA 5DLQE 2R93A 3PCOB 2EXDA 2K32A 4H44C 2NBFA 1G6PA 3E9IA 5DQIA 5D8DA 4AYBE 5CA0F 3W1GA 2PW7A 2EDGA 3STBC 4HIDA 3HOYH 4A3EH 1OXVA 3CPWA 2HIVA 4MV3A 1BXRA 1B9NA 3KLWA 1NJIC 1B7YB 4PG3A 3IKJA 5F9NA 1STHA 4JI2L 5ELOA 1SYBA 3E5SA 1SEIA 1HZ9A 2EYPA 3MXUA 1STNA 4IUQA 4CKBA 4I7HA 1D2BA 2WE6A 3S24A 5KG2A 1O7YA 2F3IA 3ETHA 3GTKH 3HOVH 5KFEA 2BQRA 1ASZA 2DPJA 3HOWB 4C5AA 4F4WA 1F2LA 2L9HA 3HBLA 2FPIB 4PNYA 1NNXA 1LTLA 5L9XA 4J9OA 2N55A 3DMUA 4ECQA 3S2HB 1VQPA 1V1QA 1BGWA 2FJZA 4QB4A 1GSOA 2YV5A 4EYHB 1SYFA 2R92A 1CM9A 4DL7A 3BVGA 5DGAA 4HQ6A 1HUMA 2PMZE 2O5IC 1EQQA 1HCZA 1JWUD 4JYAH 2UXBH 4JW0A 3LX0A 1JJGA 5IYCG 1N34H 1K83A 4IJLA 1CKOA 3OPOA 1K73C 3BZKA 1S5CD 1XNRH 4KHPL 4DV4Q 4HN7A 3AYHB 3UDFA 4BXXG 2VZAA 4PZ8A 1CKMA 1PV4A 4M8AA 3TBIB 2F0UA 3PQIA 5COYA 2NUAB 1LTRD 3TDQA 5EBDA 4A3DG 1BCPC 3NBIA 2W6PA 1V51A 1AH9A 4IWYA 4CGYB 4XZ3B 2RHQB 1II3A 5CBEE 1JT8A 4ULLA 1A9XA 3VA7A 1QZGA 3QFFA 3I4NH 4B3RH 5LP6F 1L1OC 1WD0A 2VQFL 3H15A 1KABA 4X66H 2UXCL 3T16A 4QIWA 2CW0C 4GKJH 3HOYB 3V4ZA 4A3EB 1I5FA 3NGDA 2OT2A 2KEEA 4YY3L 2MHVA 2K05A 2UU9Q 3FKIA 2K5NA 3F2DA 1I6VC 2K5QA 2YTXA 4C3JH 1EFWA 4HMJA 2UUAL 3HOVG 4FU0A 2ASJA 4XT1B 2EY5A 1TVXA 2BDOA 4MV4A 1M8AA 2A5HA 3TEHB 4JI1H 3S17H 2E2HH 2Z6KC 4HNVA 4DR2H 1Y8NB 2FE3A 2A8VA 2PCFB 2VA2A 2F0PA 3JAME 2ZJRA 1VQGA 2RDJA 4LFBH 1F9RA 3NWSA 1Z7TA 5JJKA 1SYGA 4K14A 2PQAB 4MN3A 1GKHA 5JJZA 5D3DA 1JIHA 3GV6A 1FD7D 4CKEA 5J22A 4RNMA 4QUFA 3AFPA 2NVYB 2HVSA 3KHLA 1AUXA 1ZETA 4TKOB 3HKZB 2FHTA 5I6YA 3GTPA 4FF1A 5EDWA 2B2VA 1KTKA 2YTYA 3A5UA 3BG3A 4ECSA 1VDZA 4DUZQ 4ZQ3A 1RJQA 4F4ZA 4EEQA 2FLNA 2F4VQ 5M3MH 3VYUA 1EY4A 3RB4A 3H6MA 2JQOA 2N88A 2R6FA 4FBUA 1IBLL 1D1KA 3F2BA 3ONAB 5EJWA 4IFDI 4MV9A 2JK8A 2J4XA 2E2JB 3ER0A 4IUPA 1XJVA 4F88A 2KEDA 4QWBA 4YCUA 4DR4H 2VQDA 1BF4A 3OTOL 1PYWD 3GIIA 1WI5A 4DK6C 1KJ9A 3OWEB 3TP5A 1LT6D 2JA7H 4DV6L 4JI0L 4M1UB 4L5SA 2A68D 3N8DA 3G48A 1JB3A 1A3UA 3I4NB 5DQGA 1VMCA 2A6HD 4LF9H 1Q3LA 3G6VA 3MR2A 5JJLA 5KX5F 3VMMA 2IWHA 4B9WA 3IG0A 4FP5D 2C9OA 4HEDA 3EQLC 5IOCA 5CV6A 3V05A 1XX8A 4CDCC 4HYKA 2BQ3A 5KKNB 5JEAJ 1STEA 4K2LA 2H4OA 3UI2A 4C3JB 2AQ2B 5FLMG 1WD1A 3F2CA 3CHBD 3J81L 1TIID 1DV1A 1YZ6A 5IE8A 5LOVF 5H80A 3OYYA 4X65H 3PR5B 4NP5A 2IJ0A 1ZYRD 3RLFA 4J9RA 1I7NA 3GIMA 3S17B 3MXPA 3K3VA 2RCFA 2E2HB 3NHHA 3TQ1A 4CKCA 2K28A 5IYDH 3NQIA 3M3YH 2W7PA 2K5WA 4A3CH 1K3BC 4X3KA 3A7LA 3QWNA 4V0BA 3RGXA 2RQXA 2R7ZH 3GTOH 3PO3B 4O2BF 1STAA 5DLGA 2IW3A 3T5HA 2LXKA 4JI8Q 1IYVA 1KXLA 2Z9HA 2P5ZX 3WNZA 5M3MG 3FMCA 3OHBA 2AGPA 1HR0H 4A3KG 4B3ML 4LK1C 1CKNB 2KHIA 4MA0A 2XSCA 3J80i 2MO0A 1JOOA 3KDFA 5I6WA 4DK1A 5IWAL 4A2AA 3K0YA 2JYOA 1TWHA 5C0XH 1A6XA 3CCMA 3RBDA 2GN5A 1FVIA 1K28A 4DPGA 3RJ0A 1IXRA 2K50A 2Z4IA 3OOCA 5KT3A 3J81E 1QNKA 1YNJD 4FNFA 4KI0A 4DXFA 3G6EA 3MAQA 2JA7G 4FO2A 3K5HA 4RB1A 4ID6A 1N48A 4LUVA 4JI4Q 2CQAA 5EKLA 3C2PA 3DLLA 2FKLA 3SDZA 4YP3A 1LYLA 4U68A 5C4HA 4O3OA 3U9OA 2OTLA 3P1HA 3GIKA 1TWGH 1I50A 3N6XA 2V59A 1V43A 2L0CA 1JJCB 1FJGL 4JV5H 2AUKA 2CQOA 2E5LL 1X55A 3VDYA 2YTVA 2EYJA 4DV2Q 2ASBA 2F3VA 3MR6A 5JJIA 3PIOA 4GNXB 1V4YA 1WTVA 5FLXW 4JI5Q 2D2CC 3CP0A 2JEGA 2PBZA 1VF5C 1LO5D 4A3FB 4Q0YA 1LTSD 4DV1L 4EQ5A 5L1LA 5KFXA 4A3CG 4N8FA 4R1JA 1G291 1M7JA 4Y8VB 2YCHA 1S0MA 4PQXA 4X62H 3CXCA 1ZEQX 3N44B 5C6AA 2R7ZG 1JQYD 1FGBD 2WAQB 2B2VC 4XYOA 1A15A 3EBEA 1PTOB 3H3VC 1BOSA 3M3YB 4B3TL 3R93A 3J7YW 4CC6A 4DAYA 4OGQC 4EX5A 4IHJF 3GTOB 3JRWA 1PH5A 2W7OA 4DUYL 4DV4H 3CRLC 1T5XD 4R4OA 5A2QW 2E2DC 3CMEA 2IY5B 5C0XG 5CR3A 1GUTA 1Z2OX 1WJJA 2OQ0A 3TS2A 1T94A 4R4CA 4LF4L 3KF6A 1TS4A 4HJ9A 2MCTA 2QEXA 2JEJA 1LTBD 4UP8A 1O75A 4DR1L 4DV5L 2B8FA 1JICA 1EOTA 1BNZA 1SYEA 1C7YA 5K5PA 2VQEQ 4JV1A 5CGKA 2B3GA 2EPBA 4RA8A 3FMAA 3NXWA 4A3IH 5CBAE 1DCZA 2Z0SA 1B6RA 4UFZA 2W9CA 1XMOQ 3OWFA 1XPUA 2RDGA 1ET6A 3BVZA 4I55F 1GUOA 3CMAA 3LWUA 5BPHA 4FS1A 3T5JA 2O5JC 2UU9H 1NCVA 4KN7C 4IZOA 4FF2A 5LL6b 2BDNA 2F0OA 1JJ2A 5M5YH 2B63G 1A3VA 2BA0A 3I4LA 5FD6A 1NTGA 3NPPA 4KJOA 2ZJQA 1JDBB 2YZGA 1JE5A 1U9RA 3WDNA 2H1EA 3V96A 3TIIA 4ED3A 1TS5A 2J6SA 1B3AA 2FB9A 4LF6L 4QWAA 2EYOA 3CCVA 2DUDA 1TWAH 3QZ7A 1WCMG 3H94A 4HIMA 2PO4A 2DLNA 2GVBA 2R93H 2YYAA 4ZUJA 4RU9A 4GLVB 1X65A 4YWMA 5FOBB 1VQOA 1HNXL 4DV0Q 2KENA 3A56A 5KFTA 3R5HA 2M05A 2LS01 2KUMA 2XGTA 3F1ZA 4KJNA 5GQOA 2UXDL 5KNDA 4O4HF 2PZTA 4QMGA 2CQYA 4DUZH 3PVXA 2HDMA 4R4IA 3CCRA 4DNRB 2ZM6Q 1U5KA 3HOZG 4O4IF 2F4VH 5M3FH 4TV8F 5KYIA 2L4NA 4F7XA 3GTJA 2WTFA 3GQCA 1BCPB 2K4KA 5EPJA 3I91A 3NK9A 5CV4A 2WDTA 3MFIA 2XWJB 2NN6H 2V5AA 3AU7A 1CHQD 3ZJYC 4A4IA 4E6IA 1Y1VG 2UUBL 3I73A 1T36A 3K5OA 1IW7D 2A6EC 4OO1H 3PO2H 1L1OB 4X3SA 3K5NA 5C3XA 1P8LA 3URYA 2K5DA 2K03A 3IN5A 3H0GH 1DJRD 2MQHA 2VB2X 1KDBA 2X6GA 3OW2A 1NAPA 2R6GA 1HA5A 1W6JA 1GHKA 2K75A 1V1PA 1W3SA 4A3IB 4MV7A 4ED1A 4BY1B 4A93H 4J6HA 1HRJA 3S1NB 2JA8H 4LUZA 4WBNF 2HVRA 4DXGA 2R92H 5LMUL 3BU2A 2VUMG 1E2WA 2G9HD 2I46A 5LMNW 1KLUD 4Y7NH 4K5WA 2B2YA 1I7LA 1OXSC 3QG1A 1K1QA 5M5YB 3PW7A 5ISRA 1N36Q 2QF7A 4HR7B 5EKKA 3RZOB 2B2WC 2UXBQ 1D7QA 1I4QA 4LAAA 2C2DA 2WB1G 4Q8FA 3OMCA 4CC5A 2WV6D 3HOUH 2ATLA 5KG0A 4KKUA 5IODA 1WFQA 2E2IA 4UP9A 3S1MH 2VUGA 5EWEA 1XNQL 1GUGA 3UE0A 4RAYA 2C2RA 4GN5A 1TWAB 4C3HG 4UY8C 1OWTA 2JP1A 3M85A 1D8LA 1I4GA 3AEVA 4JI8H 4QJFA 1TKWB 3VYTA 2R93B 1BQQT 1KAAA 5FO7B 1WR2A 1YITA 3QOLA 3UDIA 1I6HH 3VYSA 4C2MA 5CB4F 3OUZA 2ALZA 4P72A 4Y52H 2JN4A 4UCRA 3TQTA 1IL2A 1UNSA 1Q86C 2NN6G 2NWGA 1J9OA 4RB0A 3VPBA 2WP8J 1E4FT 4NKLA 1S5ED 4OO1G 2DGYA 3LNNA 4IOCA 5M3FB 2UUCQ 4GKJQ 3L0OA 4A3JG 3CCEA 1HHVA 3T13A 1PH3A 3H0GG 1PXUA 4V190 3M4OH 3J80L 3Q8RB 4OXPA 3T1YL 3X3NA 2UUAH 5BR8L 2N8NA 3HP3A 4O4LF 3PO2B 4A3LH 1RYRA 3DM1A 3TQYA 2ALYB 5A35A 2JA8G 1PH2A 3H0GB 3Q2OA 2HIXA 3GP7A 4RMFA 3Q0AA 4UP7A 1VQFA 2GVAA 4IPGA 4DV2H 3RIZA 4M9UA 5EPLA 3P75A 4A93B 2VXWA 4JI5H 2WAQE 2JA8B 1RD9D 1E1TA 1RDPD 1EEID 1E4GT 2R92B 3GTQA 3GTPH 1KJ8A 4B9XA 1QJOA 5KFSA 1CHPD 2A19A 2E8GA 2ASLA 4Y7NB 2Q8IB 3HOUG 3H3VH 1VQEA 1EFID 2C22A 5KEEA 3VR2A 3HS0C 2JJQA 1CA6A 4JI6L 3CRKC 4JBJA 3U4ZA 4LH6A 4I7ZC 3Q8SB 2VA3A 2N49A 2IA6A 2Y0SG 3GV7B 2D9UA 4Q43A 4QUCA 3KF8A 3CAMA 3RUZA 4LF7L 1BBWA 4OWTB 2G5DA 4OHJA 4OWXB 2Q2IA 4AQYL 4F8MA 3A7AB 5LL6X 3S1MB 2AKWB 3J80W 1YHQA 4G7OC 5BN4A 2B63A 1SBBB 2F0IA 2PPBC 4DR7Q 3T56B 4MNOA 2Y0SB 3CF5A 3WWVA 4DR4Q 3KXYT 3KJPA 1IBKL 4K8IA 3PF4A 4YHHQ 5JOBA 1KNAA 2CW7A 4KK7A 2BA1A 4R4TA 1I6HB 3VA5A 2ZDGA 1MGSA 2R85A 2W6QA 4QIWB 4L1KA 2NVXA 3J81i 1SMYD 4JI0H 5ELNA 3SVMA 2VQEH 4FBTA 2D0PA 3MWMA 1SFOA 5NUCA 4DV3Q 1WCMA 1LTGD 3HOWH 1GLVA 4GN3B 2F0WA 4DR6Q 1LM0A 2EY6A 1PZKD 1PZJD 3S14H 1Y1WA 1SNOA 1PFNA 1RCVD 3M4OB 5IT9W 1CZGA 1N8RC 2PI2A 3GILA 1SXTA 5EKIA 1MZBA 1UC9A 1EU4A 5CA1F 3Q22A 1NSNS 4AYBA 4EYIB 1HTLD 3A74A 2EY1A 3MHBA 3PW5A 2B29A 3WO1A 4DFAA 3CCSA 2J7ZA 2FFKB 4WORA 1N33L 4B08A 2EVBA 3VR4A 1JDEA 3V6JA 1J5EQ 5L37A 2NVQB 4C3IB 1Y1VA 4K8JA 1YEZA 2DPIA 2F3WA 3GTPB 4QL5A 1BBXC 3S16B 2CHBD 3T1HQ 3E0JA 2LMCB 3BDOA 1HR0Q 2EZVA 2HHHL 3T5LA 3ORQA 3F2UA 2W6NA 4G3IA 3OHXC 1U4PA 4PMCA 1VS0A 2X0SA 3UFXB 2F0FA 4DV0H 4B3MH 3KLRA 5FLXc 1WOCA 1ICFB 1TWCH 1BBUA 1F9SA 3MEHA 1A63A 5KG4A 1UE5A 5KFJA 2A68C 4YQWA 3BYTB 1O80A 4HCSA 4WD3A 2RVLA 1EIGA 2VUMA 2ZM6H 1HJPA 4RH6A 3MVVA 1B8AA 4EEYA 2XN9C 1I50H 2FJ2A 4N9TA 1FR3A 3PZPA 4LFCQ 1EYAA 2OQKA 5CV8A 2ZJPA 3I90A 4RAUC 4NXML 2JEIA 2RA4A 2PMZA 4KN4C 3HOWG 4JV5Q 4UPAA 1NY4A 3IFDA 5C1PA 3M9MB 1TY0A 3I56A 4WJ4A 3VYRA 3CVZA 4QWDA 3E0EA 1Q7YC 4EGJA 1ZYRC 3DHQA 1EEFD 1ZKOA 3T4AC 3KAKA 4LF5L 1CQFA 3NEMA 4ECTA 3FDTA 4DV7L 1MD2D 3UE1A 1E4EA 2F03A 4MTDA 4DKAC 4FF3A 4IRKA 2JXMB 2K33A 4KHZA 1R4PB 3S14B 1RTOA 4GKKQ 4P74A 4LFAL 4FXKC 3EROA 1S9FA 1Q8KA 2CWAA 4X62Q 2NVYH 3PV0A 1W6KA 1K8OA 2XTIA 4QY7A 4RWSC 1UE6A 1HA6A 2W71A 3BJYA 1TWFA 1N36H 5K36H 5KG3A 4DR5Q 2EQSA 5EBCA 1DIKA 5GAGC 5L1KA 2WB1E 1BO0A 4C5BA 1XTDA 1MBYA 2HDLA 1STGA 2WYOA 1JKJB 2JA6H 2K1BA 4OX9Q 1ET9A 2CW8A 1Z9FA 4LNQA 2DIKA 4DR3L 3E6ZX 2F0LA 2E2JH 1HFNA 1PX2A 2UVVA 2K52A 3JAML 4FDBA 3KHGA 3KDFB 2BQUA 4TQUS 5KNBA 4H02A 1TWHB 1SE4A 1D6EC 4F87A 1ENFA 1GGOA 1RJPA 5T14A 3HOYG 2F0VA 4A3EG 5JQWA 5IYBH 4LF8Q 1ILPA 2FLLA 1QOHA 2FINB 3NELA 1TWCB 3R2TA 3S1QH 1S0NA 1B3QA 3GD7A 1YNND 3GDEA 5J3BA 1D5MC 2KCMA 1W2BA 2JA5H 3K80C 1I94L 3MR3A 3GIJA 1G2SA 2NYZD 5JVLA 2UUCH 2ID0A 3ZYYX 3N43B 1T9HA 4O42A 1I50B 2OXPA 2OWOA 4K0KL 5C44B 3S9WA 1QVCA 4X64Q 1IYJB 2V4QA 5D1OB 1Z2NX 1ENCA 3E3XA 4JVZA 1TA8A 3RV3A 3MC0B 2BE5D 3TINA 2NZOA 1ZXTA 3EPIA 4GOPA 1HFGA 1MIUA 4CHTB 3GTGA 4ECVA 4NDXA 3BS1A 2OF1A 1Y8OB 1KJJA 1IYUA 3D31A 5AJ3L 4JBMA 4QW8A 1OO9B 1R9TH 4TQRA 5DNFA 4G7HC 3TP8A 2NB0A 3HKZG 3D6WA 4LSXA 3PO3H 3G7LA 4ECZA 2F0NA 1H9JA 2QA4A 1EIYB 2Z8LA 4IUNA 2YL2A 3TREA 1NBWA 5KGUA 4IFDH 4J0MA 4CJ2C 1H9RA 1LACA 2MUYA 1EQVA 1VQIA 4HSPA 4G57A 1HNWL 3TZDA 5LMNH 3RAXA 3SK6A 3GTJH 4YB8B 1KBLA 2Y0SE 3CKIB 3HKSA 2KBNA 2YS6A 2AHOB 4I65A 2R84A 2R7KA 1HNZL 5JPMC 4KTAA 3EVQA 2JA6B 2F0TA 4TVAB 1Z6HA 4ZK9B 3BYYB 3I4NG 3M9OB 4HJ5A 1M90C 1SMXA 3C0FB 4DK3C 1JXLA 4DR7H 1KHIA 2WKCA 4JI2Q 5C3EB 1WTXA 1CA5A 3GTLA 1E1OA 4YHHH 4DL5A 1C48A 2L11A 2W9CB 1CS0A 4R7RA 3RBEA 1JC7A 3S1QB 2PQEA 1SE3A 4RGNA 5DG7A 2XD4A 4C3JG 4JI7H 1EWIA 1SDFA 1SYCA 1RIPA 4GLAC 2K01A 2JA5B 1G91A 1CTMA 4DL6A 3MFHA 1EYCA 1VQ7A 4DV3H 1L0XB 4ME5A 4YWKA 4A3GH 3DEPA 4L63B 4DR6H 4P71A 4A3FH 2L15A 4B3SL 4GC6A 4ECRA 3J7A5 2IMWP 3GV3A 1XMQL 5I4DA 2Q2HA 2DNCA 4LH7A 4YJ2F 3PO3G 4JI3H 3HOXH 3CC4A 4I50F 4TUYF 5EOYA 5BN3A 1PTOH 4IFDG 3VPDA 1VCIA 2A69D 2PYKA 1CZWA 1L0YB 2HD3A 2N3SA 1QG7A 4WFN3 1R9TB 2K5VA 4EGQA 2IX3A 2AWOA 1XXGA 1V8QA 4R9WA 2W70A 3I2ZA 2FXQA 5KFZA 4JCVE 4Q44A 5KT2A 1YVCA 3I70A 1J5EH 2RSOA 1SROA 4GZYC 2VPSA 5E3FA 1QUQA 1PH8A 1TAEA 3H91A 2FMCA 3T1HH 4HSVA 2QW7A 4HIKA 2NVTH 1IW7C 3D4WA 3PF5A 4APVA 5BN5A 5E7NA 2EIFA 3TS0A 1IBML 1UEAB 1N32L 1PFMA 3GTJB 2R3ZA 2W9BA 1I4HA 4NXNL 2B39A 2VQFQ 1PH6A 4A3BH 1PH4A 4MV6A 1EZ1A 3MWYW 2UXCQ 1PFBA 3AQQA 3C1EA 1ULZA 4J9QA 4N9PA 1LABA 3QIAA 4O3PA 4YY3Q 1EWCA 4A3MH 3J81W 4J9NA 3Q8DA 1A0IA 4LFCH 2UUAQ 3OIQA 2IX0A 4YAJB 5AFWA 4RNNA 1V1PB 4J15A 5F9LA 3NP8A 4QWCA 2ASDA 1K8MA 1X6OA 1WVLA 2M9VA 3SGIA 3GTMH 2IHEA 3SHLA 2D62A 4C1NK 3RN2A 4A3FG 2R8HA 2R8KA 2FK1A 4A75A 2C00A 4C56C 4X6AH 3Q1KA 1BXTA 1MJEA 4WJ3M 4J8QA 4JK1C 4UCSA 1RK5A 4ZRZA 3HOXG 4A3GB 2CCZA 2WAQG 3RN5A 3MXNB 5F2DA 3OSNA 3A54A 5C5MA 4BY7H 1QCBD 2KVMA 4ED2A 4LUOA 2WACA 4A76A 1B33N 5IYDG 1OXTA 4GKKH 2MJ8A 5IGCA 1LTAD 2XC9A 4KHVA 1CSQA 1AZQA 1YHAA 5ELCA 5C0XI 3HOXB 4EQPA 2E75C 1AW7A 1EOVA 5FLXE 2E2IB 3MJFA 4DR5H 2UVUA 3SR1A 2R7LA 4RGTA 1GM5A 5IT9c 3GTKA 1A2UA 3DWQA 2KCTA 4XQNA 2I0QA 1ML0D 4BS9A 5IP7H 1IBLQ 3QR8A 4OX9H 1RTNA 1KC7A 4C2MB 3U9TA 3CQZH 2F0DA 4RFBA 2PQAA 3I8ZA 5FK9C 2Q8RE 5JAVA 4HJAA 1BNCA 4U6PA 5EPKA 3HRZC 2NVTB 3MR5A 4JYAL 3VR5A 4MV1A 3OTOQ 1SFOH 2KA7A 2UXBL 4K5VA 3I7FA 1M0TA 1MSHA 1N34L 2MPMA 4LF8H 2L1BA 4DV6Q 4F50A 4JI0Q 1B1ZA 5CAEB 1XNRL 2K04A 2XCLA 1Y1WH 3DXJC 4A3BB 3AFQA 3EYYA 4L5TA 5A2QE 4BY1H 2AGOA 4OWWB 4IUUA 1PZID 3S1NH 1LV9A 4A3MB 4X64H 3S1RH 5IP9H 3FVQA 5L1JA 1PRTF 1VBGA 4MAMA 4YCVA 4O0AA 4BWSC 1SEBD 4K5XA 1XPOA 5KFQA 4B3RL 1U4LA 3GTMB 4BY7G 5J2TF 3RZOH 3DWPA 2HUGA 4X66L 4DU9A 4IRDA 5D1PA 3K7UC 4OIKA 4OELB 1PLFA 3GTQB 5EAYA 5JVG3 3CD6A 1VAJA 3N41B 4ALPA 3I4MH 3HKZE 2F0GA 4ZLTF 3K59A 2AUJD 1FYCA 3ERSX 4FXGC 4HAEA 4BY7B 2VR1A 1H9MA 4DNIA 1Q81C 1L0WA 1GSAA 4J9LA 3KBGA 1HUNA 3S2DB 1SCUB 4ECWA 4JI1L 1PRTD 4ZCKA 4B3MQ 2VNUD 3KF8B 4PWQA 5BMVF 1CSPA 2SDFA 3PW4A 3W2DA 4DR2L 2EJMA 3PUXA 2FMMA 3H40A 5IWAQ 4R8UA 1LT5D 3NENA 4Z9CB 1SMYC 3OUUA 1S68A 3EFXD 5GADC 4LFBL 2NTTA 3A8IE 1S5FD 5J39A 4POGA 4UHVA 1AP0A 4PDBA 1S3OA 3JZIA 3KK7A 4JOIA 1EQTA 1FNUA 3EIVA 3RZDH 2WKDA 1FL0A 3K6OA 3HGBA 5LA6F 1PDQA 2OTJA 3PUWA 3CQZB 1D5XC 5I2YA 3RUPA 1STBA 2QYZA 1FGUA 1IKMA 4A3IG 4EBDA 1CFMA 1EY6A 4BY1G 4ABNA 4JI2H 5C5JA 1E7ZA 2DWCA 2R7NA 5LL6S 5EWGA 1XYIA 1SFOB 1FJGQ 3Q8QB 4RCOA 2XVSA 3E5NA 2E5LQ 3K5MA 4O2AF 5IP9G 1T5EA 3DUZA 3KHRA 3TP6A 4PV1C 3TSSA 1CQJB 1Y1WB 5HBRB 3VR3A 1S03G 1EU3A 1VQ6A 5KFYA 3RB0A 3QJYA 4CDDC 2C2EA 2O03A 1S4ZA 2ZTEA 4DR4L 2BCOA 1PYSB 3S1RB 2AQ1B 4DV1Q 4IO9A 5E4WC 2I5HA 3F8NA 3NUCA 3BJUA 3T53B 3I4MG 2B8GA 1K83H 1X3PA 2SNSA 4LF9L
chains in the Genus database with same CATH topology
3S17H 3JAMi 2E2HH 2Z6KC 1HNWQ 2RF4A 1HZBA 3A74A 1YI2A 2B29A 1NE3A 1YHBA 2A8VA 1VQ8A 2R93G 1VQJA 3CCSA 4B3TQ 2B63H 1N33L 2ZJRA 1EIFA 1VQGA 1HNZQ 1J5EQ 3PUVA 4IPDA 5JJKA 2PQAB 1YEZA 3CCUA 3K81C 1GKHA 4QL5A 3T1HQ 1YIJA 4X65L 1HR0Q 3AFPA 2HHHL 5FJ8H 5IYDH 2NVXH 4BA2I 4A3BG 5M3FG 4LF4Q 1N36L 1VS0A 5GROA 1HZCA 2YTYA 5FLXc 1SE8A 1WOCA 4DV5Q 1WCMH 3A5UA 4DR1Q 1TWCH 1BBUA 4DUZQ 1A63A 1UE5A 4A3MG 1Y14B 3DM3A 2F4VQ 5M3MH 1BKBA 3FKIH 1KRTA 1HJPA 1L2FA 3PO2G 1B8AA 1U0LA 2JQOA 1I50H 1IBLL 3F2BA 2I5MX 4IFDI 1SR3A 1LUZA 2JK8A 2MFIA 1HR0L 1VQMA 4LFCQ 3ER0A 1XJVA 1SRUA 4B3SQ 3HOZH 2OQKA 1MJCA 2ZJPA 4YCUA 1XMQQ 4NXML 2YU9H 2LSSA 3HOWG 4A93G 3OTOL 1UE7A 4JV5Q 4UPAA 1WI5A 1NY4A 4DK6C 2ZTDA 1A8VA 3I56A 1DGSA 4WJ4A 3BZCA 1XPRA 2A1AA 3E0EA 4DV6L 1Q7YC 2JA7H 4JG2A 4JI0L 2R92G 4L5SA 1YNXA 3G48A 3A0JA 4LF5L 4GS3A 3K7AH 3NEMA 1RL2A 1Y1VH 5JJLA 4DV7L 2UUCL 3UE1A 1QVGA 4GKJL 1K9MC 2VL6A 4DKAC 4LF6Q 4JBWA 1EYGA 4KHZA 2NVQH 4LFBQ 4C3IH 2K14A 5JEAJ 2K5HA 4GKKQ 1KD1C 4P74A 5FLMG 4LFAL 3S16H 3F2CA 1Q8KA 2CWAA 4AH6A 4X62Q 2NVYH 3PV0A 4JV5L 1ASYA 1YZ6A 5IE8A 2XTIA 4QY7A 3OYYA 1HNXQ 1KRSA 3KYHC 4ME3A 1UE6A 2V1CC 5LMNQ 3RLFA 2VUMH 2UXDQ 4QGUA 4DR5Q 2EQSA 4XTCS 2ZTCA 4PZ6A 2CKZB 5GAGC 5IP7G 1IBMQ 3M3YH 1N32Q 4A3CH 1I3QH 2WB1E 1YJWA 1XTDA 4NXNQ 5C4XH 2BH8A 3K0XA 2R7ZH 2JA6H 1K0RA 3GTOH 4OX9Q 2ATWA 3ULJA 4XIGS 1Z9FA 2LXKA 4LNQA 5M5XH 4DR3L 4JI8Q 1KXLA 4X62L 2E2JH 3L2PA 2K52A 5M3MG 4FDBA 3KDFB 3CCJA 4TQUS 3FHWA 1PH7A 3FKIG 1TXYA 4H02A 3PIPA 1WYDA 4A3KG 1Y1WG 5LMNL 2UUBQ 4B3ML 1CKNB 2KHIA 3HOYG 4A3EG 3J80i 5IYBH 4LF8Q 2MO0A 4C3HH 3IRBA 3KDFA 3NELA 5IWAL 2WFWA 3U4VA 5C0XJ 3S1QH 3CW2C 4JI7Q 3GD7A 3GDEA 1CKNA 5J3BA 2KCMA 3CCMA 1W2BA 2GN5A 1EQRA 2JA5H 1FVIA 3K80C 1I94L 4AYBG 3E9HA 4OONA 2HT1A 4DPGA 1IXRA 2K50A 4DV4L 4A3LG 1HZAA 2ID0A 1UE1A 1T9HA 4KI0A 1J6QA 3G6EA 2CWPA 1YJNA 3ULPA 2OWOA 2JA7G 4K0KL 1VQAA 1HH2P 1QVCA 1IYJB 4LUVA 4X64Q 4JI4Q 5LMUQ 4DR7L 3DLLA 1LYLA 2VS1A 1TWFH 2VW9A 2OTLA 4YHHL 1TWGH 2JEBI 1V43A 4A3JH 1JJCB 4JI3Q 1FJGL 2NZOA 2PNHA 3W1BA 2CQOA 4JI7L 2E5LL 4GOPA 1MIUA 1X55A 2YTVA 4DV2Q 3VDYA 5JEAG 3CCLA 2ASBA 1KIXA 5JJIA 2CFMA 4P73A 3PIOA 4DV3L 3D31A 4JBMA 5AJ3L 4GNXB 2Q2UA 3J81c 1R9TH 4JI5Q 1A62A 4HJ7A 4DR6L 4L5QA 3CP0A 3HKZG 3PO3H 1QZHA 2NN6I 2UU9L 1PVOA 1XNQQ 2RCNA 1V9PA 2QA4A 1UWVA 1EIYB 1OXUA 4GNXA 4IFDJ 4DV1L 3F8TA 4PZ7A 1NBWA 3TREA 4EQ5A 4DUYQ 4A3CG 4OO1I 4R1JA 1G291 1VQLA 1VQNA 5C4XG 4JI3L 3CXCA 1VQ4A 1TWHH 2IX1A 1VQIA 2R7ZG 3B6YA 4JYAQ 1HNWL 4IJHA 4QQBX 1G51A 3EBEA 2R7DA 4DAMA 1N34Q 3GTJH 2Y0SE 1SLJA 3JAMc 3HKSA 2KBNA 1XNRQ 4B3TL 2AHOB 1VQ9A 1HNZL 1J5EL 4EX5A 1PH5A 4LW1A 4DUYL 1X3EA 3RLOA 4R4OA 5C44H 3T1HL 1Q12A 3CMEA 4TVAB 2IY5B 2RHSB 5IYCH 5C0XG 1PH9A 3I4NG 1WJJA 2OQ0A 3RLNA 1SMXA 4HJ5A 4DK3C 1M90C 3TS2A 1KHIA 2N78A 4R4CA 4JI2Q 3KF6A 3T1YQ 4LF4L 3GTGH 5M5WH 4HJ9A 3RR5A 5BR8Q 2QEXA 1E1OA 4UP8A 2D0OA 4DR1L 4DV5L 3CC2A 4BXXH 1IZ6A 4DUZL 1C7YA 4B3RQ 2BH2A 2VQEQ 1X3GA 2F4VL 2B3GA 3FP9A 4X66Q 1EWIA 3J7ZC 4A3DH 1RIPA 4A3IH 1E22A 4GLAC 2IT1A 2Z0SA 3KOJA 2IHFA 3PSIA 1XMOQ 1VQ7A 1XPUA 1C9OA 3J81j 2MNAA 4YWKA 4A3GH 3CMAA 1VQ5A 4P71A 4LFCL 4A3FH 2L15A 5C4JH 1VQHA 3D0FA 4B3SL 3J7A5 4BBSH 1XMQL 2Q2HA 1JJ2A 1X3FA 4NB3A 4JI1Q 5M5YH 2Q2TA 2B63G 1JB7A 5H1SE 3PO3G 2BA0A 3HOXH 3CC4A 1NTGA 4JI6Q 2ZJQA 2NZHA 1JE5A 1PFSA 4DR2Q 3NBHB 1SN8A 4IFDG 3A5ZB 3RNUA 2JEAI 1VCIA 3CPFA 5FJ8G 4LF7Q 2N3SA 4BBRH 1EUJA 2K5VA 5GAEC 5HY6A 1QUQB 4RG1A 3LGJA 3G4SA 1GO3E 2AWOA 4AQYQ 4LF6L 4IOAA 1S40A 1HR0W 3CCVA 2DUDA 2FXQA 1TWAH 3I2ZA 4JCVE 4JOIC 1YVCA 4R4QA 4GKKL 1K8AC 1WCMG 4HIMA 2JA9A 1SROA 3GTLH 2QGQA 1AE2A 1QUQA 4LF7L 1PH8A 2GVBA 2R93H 1YBYA 2HQLA 1Q82C 2H5XA 1X65A 4GLVB 4YWMA 5C3EH 4HIKA 2MO1A 2KENA 4DV0Q 1VQOA 1IBKQ 1HNXL 1AE3A 1VQKA 2NVTH 2XGTA 3F1ZA 3PF5A 5GQOA 4APVA 2UXDL 4GN4B 4DR5L 5E7NA 1MKHA 2EIFA 5C44G 3TS0A 1IBML 1N32L 3CC7A 4NXNL 4R4IA 3CCRA 3L7ZC 2ZM6Q 2AWNA 1U5KA 2VQFQ 1PH6A 3HOZG 4A3BH 5M3FH 1PH4A 1VQCA 1X54A 4MZ9A 3CCQA 1K8GA 4OX9L 2UXCQ 1KL9A 3AQQA 2K4KA 4KLKA 4YY3Q 4JI8L 1OTCA 4MTNA 4A3MH 2LXJA 3KJOA 1JMCA 3Q8DA 3H3VI 1A0IA 3JC66 2UUAQ 3ZJYC 4A4IA 1Y1VG 2UUBL 2IX0A 4GOPB 3PO2H 1L1OB 1P8LA 4J15A 3UDGA 4LF8L 1X6OA 3SGIA 3I55A 3H0GH 3GTMH 2IHEA 2MQHA 2D62A 3PUYA 3OW2A 3RN2A 1NMFA 4A3FG 4LF9Q 2R6GA 4A75A 4POFA 1GVPA 1L1OA 2K75A 4BBSG 1W3SA 4X6AH 4P75A 1MJEA 4WJ3M 1OXXK 4JBKA 1PA6A 4A93H 3UDXA 2OCEA 1N33Q 3HOXG 2JA8H 4LUZA 2KHJA 3M4PA 2WAQG 3RN5A 3MXNB 4X64L 2CCZA 1CUKA 4JI4L 2R92H 5LMUL 3BU2A 4GNXC 4BY7H 2VUMG 1PYBA 5K36G 4LUOA 4IPCA 4AIMA 4O2DA 5IYDG 1OXTA 4A76A 5IY0A 5LMNW 3U58A 4Y7NH 3S2HH 1N9WA 4X65Q 2HHHQ 4BBRG 1KAWA 4YWLA 1OXSC 1BVSA 1CSQA 1K3RA 1Q1EA 1YHAA 1N36Q 5C0XI 4L5RC 2JA6G 4DV2L 3M4QA 2Z6KA 1EOVA 1X56A 3M7NA 4DAYB 5FLMH 2UXBQ 1D7QA 1E3PA 1B70B 2WB1G 3MEFA 5GAHC 4JI5L 3HOUH 3I4OA 5C3EG 3G71A 1GM5A 5IT9c 1WFQA 4UP9A 3S1MH 1X9NA 1XNQL 3UE0A 3ICEA 4GN5A 4PMWA 1PHJA 2KCTA 5IYBG 4GLXA 2I0QA 1IBLQ 4UY8C 3KF6B 5IP7H 1VQBA 4QIWE 3M85A 1D8LA 3CQZH 1GD7A 3AEVA 4QJFA 2PQAA 2I5LX 2JA5G 1YITA 4HJAA 2R7FA 4IPHA 4NXMQ 3UDIA 2JE6I 4JYAL 1I6HH 3GO5A 3OTOQ 1SFOH 1Z47A 1KQSA 2PI2E 3U50C 1S72A 2UXBL 1O7IA 1P16A 3I7FA 4P72A 5DLQE 2F52A 1N34L 1IL2A 4DV6Q 3TRZA 3PCOB 2EXDA 1Q86C 3K8AA 2NN6G 4LWCA 4JI0Q 1Q1BA 1XNRL 1G6PA 3E9IA 4LF5Q 2WP8J 3PGZA 4AYBE 4A3KH 1Y1WH 4OO1G 3AFQA 2DGYA 3W1GA 4DV7Q 4HIOA 4L5TA 4IOCA 2UUCQ 4BY1H 3STBC 4HIDA 3L0OA 4A3EH 3HOYH 1OXVA 3CPWA 3CCEA 2HIVA 4A3JG 4OWWB 3S1NH 1PH3A 3H0GG 3KLWA 1NJIC 1VQDA 4HJ8A 1B7YB 1PH1A 4PG3A 3M4OH 2AMCB 3S1RH 3PUZA 4OXPA 5IP9H 4LFAQ 4JI2L 5ELOA 3T1YL 1HZ9A 4A3DG 5BR8L 2N8NA 4YCVA 4O0AA 4A3LH 1C0AA 3TQYA 2ALYB 2JA8G 1XPOA 4B3RL 1PH2A 4BY7G 2HIXA 2VQEL 3S24A 2ES2A 4RMFA 3RZOH 2F3IA 2E2IH 4X66L 4UP7A 1VQFA 2GVAA 4IPGA 3GTKH 3HOVH 2YYZA 1QVFA 3K7UC 1XMOL 1ASZA 5EAYA 3CD6A 3STBD 4JC0A 3S15H 4ALPA 3I4MH 3HKZE 2WAQE 1E1TA 4KHPQ 3ERSX 1LTLA 4DNIA 1Q81C 3GTPH 4Y52H 1L0WA 4DR3Q 4C2MH 2A19A 2E8GA 3HOUG 3ULLA 4JI1L 1VQPA 3H3VH 1VQEA 1H95A 1V1QA 2YV5A 4B3MQ 3M9BA 2JJQA 2VNUD 3KF8B 4JI6L 4JBJA 3U4ZA 1KC8C 4YCWA 1CSPA 4DR2L 2PMZE 1UEBA 3PUXA 1E24A 1EQQA 3KFUA 2C35B 2N49A 5IWAQ 3NENA 2Y0SG 1JJGA 5IYCG 3CAMA 1CKOA 4IJLA 1BBWA 1K73C 4OWTB 5GADC 3BZKA 4OWXB 2Q2IA 4AQYL 4LFBL 1I94Q 4POGA 4KHPL 1Q46A 1S3OA 2AKWB 4DV4Q 3RZDH 4JOIA 1M1KC 3EIVA 3EN2A 3AYHB 3UDFA 1YHQA 4BXXG 1FL0A 2VZAA 4PZ8A 1CKMA 1PV4A 3HFZB 4K0KQ 2OTJA 3PUWA 4DR7Q 4MNOA 3CF5A 1FGUA 3WWVA 1NMGA 3KJPA 4DV0L 4A3IG 1IBKL 3PF4A 4DR4Q 4YHHQ 4BY1G 1AH9A 2BA1A 1E7ZA 4R4TA 2VY3A 2RHQB 1JT8A 1FJGQ 4A3GG 1QZGA 3J81i 2E5LQ 3I4NH 4GOPC 5IP9G 5ELNA 1L1OC 4NPSA 2ZM6L 3J80c 2VQFL 4GKJQ 3H15A 2D0PA 4DV3Q 3GTQH 5AJ3Q 2UXCL 3HOWH 1VQ6A 1I5FA 4GN3B 3W5OA 4DR6Q 4YY3L 1LM0A 2UU9Q 3S14H 2ZTEA 2K5NA 4BA1I 3F2DA 1EFWA 2YTXA 4C3JH 5HGQA 4DR4L 1PYSB 2UUAL 3HOVG 4DV1Q 4IO9A 1YJ9A 2I5HA 1N8RC 2PI2A 3S2DH 3BJUA 3I4MG 3TEHB 1K83H 4LF9L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S17 H;  3JAM i;  2E2H H;  2Z6K C;  1HNW Q;  2RF4 A;  1HZB A;  3A74 A;  1YI2 A;  2B29 A;  1NE3 A;  1YHB A;  2A8V A;  1VQ8 A;  2R93 G;  1VQJ A;  3CCS A;  4B3T Q;  2B63 H;  1N33 L;  2ZJR A;  1EIF A;  1VQG A;  1HNZ Q;  1J5E Q;  3PUV A;  4IPD A;  5JJK A;  2PQA B;  1YEZ A;  3CCU A;  3K81 C;  1GKH A;  4QL5 A;  3T1H Q;  1YIJ A;  4X65 L;  1HR0 Q;  3AFP A;  2HHH L;  5FJ8 H;  5IYD H;  2NVX H;  4BA2 I;  4A3B G;  5M3F G;  4LF4 Q;  1N36 L;  1VS0 A;  5GRO A;  1HZC A;  2YTY A;  5FLX c;  1SE8 A;  1WOC A;  4DV5 Q;  1WCM H;  3A5U A;  4DR1 Q;  1TWC H;  1BBU A;  4DUZ Q;  1A63 A;  1UE5 A;  4A3M G;  1Y14 B;  3DM3 A;  2F4V Q;  5M3M H;  1BKB A;  3FKI H;  1KRT A;  1HJP A;  1L2F A;  3PO2 G;  1B8A A;  1U0L A;  2JQO A;  1I50 H;  1IBL L;  3F2B A;  2I5M X;  4IFD I;  1SR3 A;  1LUZ A;  2JK8 A;  2MFI A;  1HR0 L;  1VQM A;  4LFC Q;  3ER0 A;  1XJV A;  1SRU A;  4B3S Q;  3HOZ H;  2OQK A;  1MJC A;  2ZJP A;  4YCU A;  1XMQ Q;  4NXM L;  2YU9 H;  2LSS A;  3HOW G;  4A93 G;  3OTO L;  1UE7 A;  4JV5 Q;  4UPA A;  1WI5 A;  1NY4 A;  4DK6 C;  2ZTD A;  1A8V A;  3I56 A;  1DGS A;  4WJ4 A;  3BZC A;  1XPR A;  2A1A A;  3E0E A;  4DV6 L;  1Q7Y C;  2JA7 H;  4JG2 A;  4JI0 L;  2R92 G;  4L5S A;  1YNX A;  3G48 A;  3A0J A;  4LF5 L;  4GS3 A;  3K7A H;  3NEM A;  1RL2 A;  1Y1V H;  5JJL A;  4DV7 L;  2UUC L;  3UE1 A;  1QVG A;  4GKJ L;  1K9M C;  2VL6 A;  4DKA C;  4LF6 Q;  4JBW A;  1EYG A;  4KHZ A;  2NVQ H;  4LFB Q;  4C3I H;  2K14 A;  5JEA J;  2K5H A;  4GKK Q;  1KD1 C;  4P74 A;  5FLM G;  4LFA L;  3S16 H;  3F2C A;  1Q8K A;  2CWA A;  4AH6 A;  4X62 Q;  2NVY H;  3PV0 A;  4JV5 L;  1ASY A;  1YZ6 A;  5IE8 A;  2XTI A;  4QY7 A;  3OYY A;  1HNX Q;  1KRS A;  3KYH C;  4ME3 A;  1UE6 A;  2V1C C;  5LMN Q;  3RLF A;  2VUM H;  2UXD Q;  4QGU A;  4DR5 Q;  2EQS A;  4XTC S;  2ZTC A;  4PZ6 A;  2CKZ B;  5GAG C;  5IP7 G;  1IBM Q;  3M3Y H;  1N32 Q;  4A3C H;  1I3Q H;  2WB1 E;  1YJW A;  1XTD A;  4NXN Q;  5C4X H;  2BH8 A;  3K0X A;  2R7Z H;  2JA6 H;  1K0R A;  3GTO H;  4OX9 Q;  2ATW A;  3ULJ A;  4XIG S;  1Z9F A;  2LXK A;  4LNQ A;  5M5X H;  4DR3 L;  4JI8 Q;  1KXL A;  4X62 L;  2E2J H;  3L2P A;  2K52 A;  5M3M G;  4FDB A;  3KDF B;  3CCJ A;  4TQU S;  3FHW A;  1PH7 A;  3FKI G;  1TXY A;  4H02 A;  3PIP A;  1WYD A;  4A3K G;  1Y1W G;  5LMN L;  2UUB Q;  4B3M L;  1CKN B;  2KHI A;  3HOY G;  4A3E G;  3J80 i;  5IYB H;  4LF8 Q;  2MO0 A;  4C3H H;  3IRB A;  3KDF A;  3NEL A;  5IWA L;  2WFW A;  3U4V A;  5C0X J;  3S1Q H;  3CW2 C;  4JI7 Q;  3GD7 A;  3GDE A;  1CKN A;  5J3B A;  2KCM A;  3CCM A;  1W2B A;  2GN5 A;  1EQR A;  2JA5 H;  1FVI A;  3K80 C;  1I94 L;  4AYB G;  3E9H A;  4OON A;  2HT1 A;  4DPG A;  1IXR A;  2K50 A;  4DV4 L;  4A3L G;  1HZA A;  2ID0 A;  1UE1 A;  1T9H A;  4KI0 A;  1J6Q A;  3G6E A;  2CWP A;  1YJN A;  3ULP A;  2OWO A;  2JA7 G;  4K0K L;  1VQA A;  1HH2 P;  1QVC A;  1IYJ B;  4LUV A;  4X64 Q;  4JI4 Q;  5LMU Q;  4DR7 L;  3DLL A;  1LYL A;  2VS1 A;  1TWF H;  2VW9 A;  2OTL A;  4YHH L;  1TWG H;  2JEB I;  1V43 A;  4A3J H;  1JJC B;  4JI3 Q;  1FJG L;  2NZO A;  2PNH A;  3W1B A;  2CQO A;  4JI7 L;  2E5L L;  4GOP A;  1MIU A;  1X55 A;  2YTV A;  4DV2 Q;  3VDY A;  5JEA G;  3CCL A;  2ASB A;  1KIX A;  5JJI A;  2CFM A;  4P73 A;  3PIO A;  4DV3 L;  3D31 A;  4JBM A;  5AJ3 L;  4GNX B;  2Q2U A;  3J81 c;  1R9T H;  4JI5 Q;  1A62 A;  4HJ7 A;  4DR6 L;  4L5Q A;  3CP0 A;  3HKZ G;  3PO3 H;  1QZH A;  2NN6 I;  2UU9 L;  1PVO A;  1XNQ Q;  2RCN A;  1V9P A;  2QA4 A;  1UWV A;  1EIY B;  1OXU A;  4GNX A;  4IFD J;  4DV1 L;  3F8T A;  4PZ7 A;  1NBW A;  3TRE A;  4EQ5 A;  4DUY Q;  4A3C G;  4OO1 I;  4R1J A;  1G29 1;  1VQL A;  1VQN A;  5C4X G;  4JI3 L;  3CXC A;  1VQ4 A;  1TWH H;  2IX1 A;  1VQI A;  2R7Z G;  3B6Y A;  4JYA Q;  1HNW L;  4IJH A;  4QQB X;  1G51 A;  3EBE A;  2R7D A;  4DAM A;  1N34 Q;  3GTJ H;  2Y0S E;  1SLJ A;  3JAM c;  3HKS A;  2KBN A;  1XNR Q;  4B3T L;  2AHO B;  1VQ9 A;  1HNZ L;  1J5E L;  4EX5 A;  1PH5 A;  4LW1 A;  4DUY L;  1X3E A;  3RLO A;  4R4O A;  5C44 H;  3T1H L;  1Q12 A;  3CME A;  4TVA B;  2IY5 B;  2RHS B;  5IYC H;  5C0X G;  1PH9 A;  3I4N G;  1WJJ A;  2OQ0 A;  3RLN A;  1SMX A;  4HJ5 A;  4DK3 C;  1M90 C;  3TS2 A;  1KHI A;  2N78 A;  4R4C A;  4JI2 Q;  3KF6 A;  3T1Y Q;  4LF4 L;  3GTG H;  5M5W H;  4HJ9 A;  3RR5 A;  5BR8 Q;  2QEX A;  1E1O A;  4UP8 A;  2D0O A;  4DR1 L;  4DV5 L;  3CC2 A;  4BXX H;  1IZ6 A;  4DUZ L;  1C7Y A;  4B3R Q;  2BH2 A;  2VQE Q;  1X3G A;  2F4V L;  2B3G A;  3FP9 A;  4X66 Q;  1EWI A;  3J7Z C;  4A3D H;  1RIP A;  4A3I H;  1E22 A;  4GLA C;  2IT1 A;  2Z0S A;  3KOJ A;  2IHF A;  3PSI A;  1XMO Q;  1VQ7 A;  1XPU A;  1C9O A;  3J81 j;  2MNA A;  4YWK A;  4A3G H;  3CMA A;  1VQ5 A;  4P71 A;  4LFC L;  4A3F H;  2L15 A;  5C4J H;  1VQH A;  3D0F A;  4B3S L;  3J7A 5;  4BBS H;  1XMQ L;  2Q2H A;  1JJ2 A;  1X3F A;  4NB3 A;  4JI1 Q;  5M5Y H;  2Q2T A;  2B63 G;  1JB7 A;  5H1S E;  3PO3 G;  2BA0 A;  3HOX H;  3CC4 A;  1NTG A;  4JI6 Q;  2ZJQ A;  2NZH A;  1JE5 A;  1PFS A;  4DR2 Q;  3NBH B;  1SN8 A;  4IFD G;  3A5Z B;  3RNU A;  2JEA I;  1VCI A;  3CPF A;  5FJ8 G;  4LF7 Q;  2N3S A;  4BBR H;  1EUJ A;  2K5V A;  5GAE C;  5HY6 A;  1QUQ B;  4RG1 A;  3LGJ A;  3G4S A;  1GO3 E;  2AWO A;  4AQY Q;  4LF6 L;  4IOA A;  1S40 A;  1HR0 W;  3CCV A;  2DUD A;  2FXQ A;  1TWA H;  3I2Z A;  4JCV E;  4JOI C;  1YVC A;  4R4Q A;  4GKK L;  1K8A C;  1WCM G;  4HIM A;  2JA9 A;  1SRO A;  3GTL H;  2QGQ A;  1AE2 A;  1QUQ A;  4LF7 L;  1PH8 A;  2GVB A;  2R93 H;  1YBY A;  2HQL A;  1Q82 C;  2H5X A;  1X65 A;  4GLV B;  4YWM A;  5C3E H;  4HIK A;  2MO1 A;  2KEN A;  4DV0 Q;  1VQO A;  1IBK Q;  1HNX L;  1AE3 A;  1VQK A;  2NVT H;  2XGT A;  3F1Z A;  3PF5 A;  5GQO A;  4APV A;  2UXD L;  4GN4 B;  4DR5 L;  5E7N A;  1MKH A;  2EIF A;  5C44 G;  3TS0 A;  1IBM L;  1N32 L;  3CC7 A;  4NXN L;  4R4I A;  3CCR A;  3L7Z C;  2ZM6 Q;  2AWN A;  1U5K A;  2VQF Q;  1PH6 A;  3HOZ G;  4A3B H;  5M3F H;  1PH4 A;  1VQC A;  1X54 A;  4MZ9 A;  3CCQ A;  1K8G A;  4OX9 L;  2UXC Q;  1KL9 A;  3AQQ A;  2K4K A;  4KLK A;  4YY3 Q;  4JI8 L;  1OTC A;  4MTN A;  4A3M H;  2LXJ A;  3KJO A;  1JMC A;  3Q8D A;  3H3V I;  1A0I A;  3JC6 6;  2UUA Q;  3ZJY C;  4A4I A;  1Y1V G;  2UUB L;  2IX0 A;  4GOP B;  3PO2 H;  1L1O B;  1P8L A;  4J15 A;  3UDG A;  4LF8 L;  1X6O A;  3SGI A;  3I55 A;  3H0G H;  3GTM H;  2IHE A;  2MQH A;  2D62 A;  3PUY A;  3OW2 A;  3RN2 A;  1NMF A;  4A3F G;  4LF9 Q;  2R6G A;  4A75 A;  4POF A;  1GVP A;  1L1O A;  2K75 A;  4BBS G;  1W3S A;  4X6A H;  4P75 A;  1MJE A;  4WJ3 M;  1OXX K;  4JBK A;  1PA6 A;  4A93 H;  3UDX A;  2OCE A;  1N33 Q;  3HOX G;  2JA8 H;  4LUZ A;  2KHJ A;  3M4P A;  2WAQ G;  3RN5 A;  3MXN B;  4X64 L;  2CCZ A;  1CUK A;  4JI4 L;  2R92 H;  5LMU L;  3BU2 A;  4GNX C;  4BY7 H;  2VUM G;  1PYB A;  5K36 G;  4LUO A;  4IPC A;  4AIM A;  4O2D A;  5IYD G;  1OXT A;  4A76 A;  5IY0 A;  5LMN W;  3U58 A;  4Y7N H;  3S2H H;  1N9W A;  4X65 Q;  2HHH Q;  4BBR G;  1KAW A;  4YWL A;  1OXS C;  1BVS A;  1CSQ A;  1K3R A;  1Q1E A;  1YHA A;  1N36 Q;  5C0X I;  4L5R C;  2JA6 G;  4DV2 L;  3M4Q A;  2Z6K A;  1EOV A;  1X56 A;  3M7N A;  4DAY B;  5FLM H;  2UXB Q;  1D7Q A;  1E3P A;  1B70 B;  2WB1 G;  3MEF A;  5GAH C;  4JI5 L;  3HOU H;  3I4O A;  5C3E G;  3G71 A;  1GM5 A;  5IT9 c;  1WFQ A;  4UP9 A;  3S1M H;  1X9N A;  1XNQ L;  3UE0 A;  3ICE A;  4GN5 A;  4PMW A;  1PHJ A;  2KCT A;  5IYB G;  4GLX A;  2I0Q A;  1IBL Q;  4UY8 C;  3KF6 B;  5IP7 H;  1VQB A;  4QIW E;  3M85 A;  1D8L A;  3CQZ H;  1GD7 A;  3AEV A;  4QJF A;  2PQA A;  2I5L X;  2JA5 G;  1YIT A;  4HJA A;  2R7F A;  4IPH A;  4NXM Q;  3UDI A;  2JE6 I;  4JYA L;  1I6H H;  3GO5 A;  3OTO Q;  1SFO H;  1Z47 A;  1KQS A;  2PI2 E;  3U50 C;  1S72 A;  2UXB L;  1O7I A;  1P16 A;  3I7F A;  4P72 A;  5DLQ E;  2F52 A;  1N34 L;  1IL2 A;  4DV6 Q;  3TRZ A;  3PCO B;  2EXD A;  1Q86 C;  3K8A A;  2NN6 G;  4LWC A;  4JI0 Q;  1Q1B A;  1XNR L;  1G6P A;  3E9I A;  4LF5 Q;  2WP8 J;  3PGZ A;  4AYB E;  4A3K H;  1Y1W H;  4OO1 G;  3AFQ A;  2DGY A;  3W1G A;  4DV7 Q;  4HIO A;  4L5T A;  4IOC A;  2UUC Q;  4BY1 H;  3STB C;  4HID A;  3L0O A;  4A3E H;  3HOY H;  1OXV A;  3CPW A;  3CCE A;  2HIV A;  4A3J G;  4OWW B;  3S1N H;  1PH3 A;  3H0G G;  3KLW A;  1NJI C;  1VQD A;  4HJ8 A;  1B7Y B;  1PH1 A;  4PG3 A;  3M4O H;  2AMC B;  3S1R H;  3PUZ A;  4OXP A;  5IP9 H;  4LFA Q;  4JI2 L;  5ELO A;  3T1Y L;  1HZ9 A;  4A3D G;  5BR8 L;  2N8N A;  4YCV A;  4O0A A;  4A3L H;  1C0A A;  3TQY A;  2ALY B;  2JA8 G;  1XPO A;  4B3R L;  1PH2 A;  4BY7 G;  2HIX A;  2VQE L;  3S24 A;  2ES2 A;  4RMF A;  3RZO H;  2F3I A;  2E2I H;  4X66 L;  4UP7 A;  1VQF A;  2GVA A;  4IPG A;  3GTK H;  3HOV H;  2YYZ A;  1QVF A;  3K7U C;  1XMO L;  1ASZ A;  5EAY A;  3CD6 A;  3STB D;  4JC0 A;  3S15 H;  4ALP A;  3I4M H;  3HKZ E;  2WAQ E;  1E1T A;  4KHP Q;  3ERS X;  1LTL A;  4DNI A;  1Q81 C;  3GTP H;  4Y52 H;  1L0W A;  4DR3 Q;  4C2M H;  2A19 A;  2E8G A;  3HOU G;  3ULL A;  4JI1 L;  1VQP A;  3H3V H;  1VQE A;  1H95 A;  1V1Q A;  2YV5 A;  4B3M Q;  3M9B A;  2JJQ A;  2VNU D;  3KF8 B;  4JI6 L;  4JBJ A;  3U4Z A;  1KC8 C;  4YCW A;  1CSP A;  4DR2 L;  2PMZ E;  1UEB A;  3PUX A;  1E24 A;  1EQQ A;  3KFU A;  2C35 B;  2N49 A;  5IWA Q;  3NEN A;  2Y0S G;  1JJG A;  5IYC G;  3CAM A;  1CKO A;  4IJL A;  1BBW A;  1K73 C;  4OWT B;  5GAD C;  3BZK A;  4OWX B;  2Q2I A;  4AQY L;  4LFB L;  1I94 Q;  4POG A;  4KHP L;  1Q46 A;  1S3O A;  2AKW B;  4DV4 Q;  3RZD H;  4JOI A;  1M1K C;  3EIV A;  3EN2 A;  3AYH B;  3UDF A;  1YHQ A;  4BXX G;  1FL0 A;  2VZA A;  4PZ8 A;  1CKM A;  1PV4 A;  3HFZ B;  4K0K Q;  2OTJ A;  3PUW A;  4DR7 Q;  4MNO A;  3CF5 A;  1FGU A;  3WWV A;  1NMG A;  3KJP A;  4DV0 L;  4A3I G;  1IBK L;  3PF4 A;  4DR4 Q;  4YHH Q;  4BY1 G;  1AH9 A;  2BA1 A;  1E7Z A;  4R4T A;  2VY3 A;  2RHQ B;  1JT8 A;  1FJG Q;  4A3G G;  1QZG A;  3J81 i;  2E5L Q;  3I4N H;  4GOP C;  5IP9 G;  5ELN A;  1L1O C;  4NPS A;  2ZM6 L;  3J80 c;  2VQF L;  4GKJ Q;  3H15 A;  2D0P A;  4DV3 Q;  3GTQ H;  5AJ3 Q;  2UXC L;  3HOW H;  1VQ6 A;  1I5F A;  4GN3 B;  3W5O A;  4DR6 Q;  4YY3 L;  1LM0 A;  2UU9 Q;  3S14 H;  2ZTE A;  2K5N A;  4BA1 I;  3F2D A;  1EFW A;  2YTX A;  4C3J H;  5HGQ A;  4DR4 L;  1PYS B;  2UUA L;  3HOV G;  4DV1 Q;  4IO9 A;  1YJ9 A;  2I5H A;  1N8R C;  2PI2 A;  3S2D H;  3BJU A;  3I4M G;  3TEH B;  1K83 H;  4LF9 L; 
#chains in the Genus database with same CATH topology
 3KAL A;  3JAM i;  2RF4 A;  1HZB A;  1YI2 A;  1TS3 A;  2NU6 B;  5KFW A;  3RB3 A;  1V1O A;  2F0K A;  1VQ8 A;  2R93 G;  1VQJ A;  2JA7 A;  2CZG A;  1J8I A;  2IPK D;  4B3T Q;  2FMA A;  2V4R A;  1JOR A;  3I4M B;  3PW2 A;  5DGB A;  4IPD A;  5DLF A;  4HNU A;  4KD3 A;  3CCU A;  4KHP H;  1JWS D;  2PW5 A;  2QCP X;  1YIJ A;  5C5L A;  1B44 D;  3T5K A;  2B2U A;  4X65 L;  5FJ8 H;  1WTO A;  3JSL A;  1U4R A;  4BA2 I;  5M3F G;  4LF4 Q;  1UC8 A;  1ONL A;  1HZC A;  5EGT A;  3D4R A;  1SE8 A;  4DR1 Q;  4DV5 Q;  5E4X A;  1ILQ A;  3TZU A;  1L2Z A;  5KFN A;  1S0O A;  1LTI D;  3DM3 A;  2WAQ A;  1BKB A;  2L55 A;  1XTC D;  5LXT F;  1S10 A;  3FKI H;  1KRT A;  2I07 B;  3BQ0 A;  1ENA A;  5CV7 A;  2VQF H;  4LMY A;  3PO2 G;  5IIF A;  2GPW A;  3RZD B;  2UXC H;  2PMZ B;  1SR3 A;  2NU7 B;  2MFI A;  3QZ8 A;  2M00 A;  1HR0 L;  4FS2 A;  4YY3 H;  5KG1 A;  2YW2 A;  1NUC A;  5FPR A;  2R7Z A;  3GTO A;  2RSN A;  4ZQI A;  1IOV A;  2MP1 A;  3Q8P B;  2IBK A;  1KJI A;  4A93 G;  1E2Z A;  2XWB B;  2F0H A;  2ZTD A;  1A8V A;  3A55 A;  1DGS A;  3BZC A;  1XPR A;  1FKA H;  2RBM A;  2GA4 B;  1WTH A;  4J9K A;  2R92 G;  2V4D A;  1YNX A;  4FVM A;  5IGD A;  3A0J A;  4UAI A;  4RHR A;  1RL2 A;  3L3O C;  3FEW X;  2VL6 A;  5KT5 A;  1GSH A;  4RB2 C;  4LF6 Q;  4JBW A;  2K7V A;  1EYG A;  2ENB A;  2NVQ H;  4C3I H;  4Q8E A;  4YAK B;  2K14 A;  2TMP A;  1KD1 C;  3G8C A;  2UVR A;  5JEA H;  3S16 H;  4EFE A;  1TWF B;  1A3T A;  4JV5 L;  1ASY A;  3V2T A;  1EY7 A;  1HNX Q;  2HQE A;  5L1I A;  4RB3 C;  1KRS A;  5KT7 A;  3KYH C;  1K83 B;  2V1C C;  5LMN Q;  1RK6 A;  5KFC A;  3HEJ A;  2UXD Q;  1TWG A;  3ND9 A;  5ELD A;  3MFY A;  4PZ6 A;  2CKZ B;  1YJW A;  4YR0 A;  1YNN C;  3M4Y A;  3Q24 A;  4RUC A;  2BH8 A;  3ERQ A;  1G2T A;  4EBE A;  1W96 A;  1K0R A;  3ITP A;  4DR3 H;  4DGZ A;  2ATW A;  2P0A A;  4XIG S;  5M5X H;  1IBL H;  2IP4 A;  4X62 L;  2NTS A;  4XYL B;  1EIH A;  1I4R A;  2O4X A;  3KAJ A;  5KFR A;  2PNR C;  3FHW A;  3FKI G;  3ORR A;  1TXY A;  1WYD A;  2UUB Q;  4U67 3;  1PK8 A;  1KLG D;  1SNP A;  2BE5 C;  3IRB A;  3OTO H;  5KG5 A;  5C0X J;  2AQ3 B;  3W3A A;  4JI7 Q;  4ED0 A;  4DV6 H;  4H13 C;  5DG8 A;  3PIP 3;  1EQR A;  3OW7 A;  1KDA A;  3FKI B;  1EUC B;  1LLR D;  3GIQ A;  3OSO A;  4DV4 L;  4A3L G;  1HZA A;  1UE1 A;  3N52 A;  1J6Q A;  1B04 A;  1YJN A;  3ULP A;  1KEE A;  1VQA A;  1HH2 P;  4XT3 B;  5LMU Q;  2VS1 A;  2VW9 A;  1SYX B;  5GON F;  5EWF A;  2JEB I;  5M5W B;  2B2Y C;  5FKA C;  4JI3 Q;  1AN8 A;  2PNH A;  3W1B A;  4C3I G;  2KQ3 A;  4K6L A;  4NW2 A;  1Q90 A;  1M6V A;  1F2Z A;  3GID A;  5JEA G;  4GC7 A;  3CCL A;  2YU9 A;  2CFM A;  4P73 A;  2Q2U A;  3J81 c;  4L6T B;  4P2C B;  2XRQ D;  2OEO A;  4L5Q A;  3GIP A;  3K5L A;  1QZH A;  5I2X A;  4YR3 A;  2UU9 L;  4DL2 A;  1XNQ Q;  2RCN A;  1V9P A;  1UWV A;  1OXU A;  2QK4 A;  1VKZ A;  1VQL A;  1TU2 B;  1VQN A;  5HGT A;  1TWH H;  1U4M A;  4IUR A;  4H0L C;  1F77 A;  2KSW A;  1SNM A;  2EJF C;  4IJH A;  1G51 A;  1IOW A;  1MI2 A;  3R8B A;  4DAM A;  3SXH A;  1CQI B;  4KKT A;  1EZ8 A;  4F4X A;  1SLJ A;  3HZX A;  5IWA H;  4HR7 A;  3GV5 B;  2FK3 A;  2A6H C;  4BBR B;  4H7B A;  3U9S A;  1VQ9 A;  3H20 A;  4J9S A;  2ZXO A;  2XNA C;  2JEF A;  1VF7 A;  4IQZ A;  4LW1 A;  1I3Q A;  4MTK A;  1X3E A;  2X69 A;  3RLO A;  4CJ0 B;  5C44 H;  4RZR A;  1Q12 A;  5M5X B;  4C1N I;  2RHS B;  5FO9 B;  5IYC H;  2HCC A;  3RLN A;  1TWA A;  2N78 A;  2HJW A;  3T1Y Q;  1ZHQ A;  5BR8 Q;  2D0O A;  2LY7 A;  4BXX H;  2WB1 A;  1IZ6 A;  2KCN A;  4DUZ L;  1FJG H;  1WTQ A;  2EOT A;  4RGO S;  1X3G A;  4R8N A;  4YR2 A;  2F4V L;  3BG5 A;  1QE6 A;  3FP9 A;  4LSA A;  2XRS D;  2E5L H;  4A3D H;  1JE4 A;  3KOJ A;  2A69 C;  2V9W A;  2IHF A;  4DL4 A;  1F2M A;  4ZAI A;  2F0E A;  1PMR A;  3K57 A;  3BAA A;  3NTK A;  1VQ5 A;  4FXD A;  4J1M A;  5C4J H;  1AEX A;  1VQH A;  2CVR A;  1XWE A;  3MTS A;  3C46 A;  3Q6S A;  3D0F A;  2R87 A;  2W6M A;  4YJ3 F;  4KY7 A;  3BQ1 A;  3J7A K;  5TSS A;  4EGV A;  4JUZ A;  4DV1 H;  1KJQ A;  2K6A A;  2Q2T A;  5ELF A;  3VPC A;  1DON A;  4JI6 Q;  1CT1 D;  4Q0F A;  1PFS A;  3G6J B;  1N56 A;  1M0W A;  4UCO A;  2JEA I;  4XX0 B;  4Q5V A;  3M4I A;  3H0G A;  4LF7 Q;  1EUJ A;  2R8J A;  4ETS A;  1QUQ B;  3G4S A;  4AQY Q;  1DOM A;  1GO3 E;  3NBH A;  4B3T H;  4IOA A;  3O13 A;  5JH7 F;  1SND A;  4R4Q A;  2A74 C;  5JUM A;  3KLS X;  3L4K A;  1YNJ C;  2JSO A;  1AE2 A;  5DQH A;  1HXY D;  1GOZ A;  4DUY H;  4DA2 A;  3H4B A;  1I6U A;  1YBY A;  3KBX A;  2R8G A;  5IGB A;  2H5X A;  4MV8 A;  1SNC A;  3M7G A;  5C3E H;  2W9B B;  3V6H A;  1IBK Q;  2LFN A;  4RHS A;  1AE3 A;  3RTX A;  4LF4 H;  1CQV A;  4GN4 B;  2NU8 B;  5C44 G;  4DR1 H;  3R23 A;  4DV5 H;  3PMF A;  3IL8 A;  3L7Z C;  2AWN A;  4E4T A;  1VQC A;  1X54 A;  4MZ9 A;  1K8G A;  1G6Z A;  2YRW A;  2M2L A;  3I3C A;  2EY2 A;  2QKI C;  5I9P A;  2F4I A;  2ZDH A;  4JI8 L;  4MTN A;  2LXJ A;  1JMC A;  1QB5 D;  5I47 A;  3KTM A;  5T1I A;  1H9S A;  3R2I A;  3A8J E;  4HNT A;  5KFP A;  5KFD A;  4WJW A;  3GLK A;  5D65 A;  4RUA A;  2TSS A;  2Y0S A;  5G3L F;  1JWM D;  5D14 A;  3G6Y A;  4RKL A;  4DNT B;  3LWE A;  1NMF A;  1ICW A;  4RAZ A;  1SSO A;  1TY2 A;  4POF A;  1GVP A;  3R5X A;  1BJT A;  3SK8 A;  2XGP A;  3KHH A;  4A3D B;  2LKV A;  1OXX K;  4JBK A;  1PA6 A;  1WTP A;  5KFG A;  3UDX A;  2OCE A;  1N33 Q;  2W8L A;  2Z4H A;  4JI4 L;  3JAM W;  4LF6 H;  4XQJ A;  5K36 G;  5C4J B;  5KFI A;  4UCT A;  4IPC A;  4AIM A;  1T3N A;  3EPG A;  1AUV A;  1EY8 A;  1SJE D;  1F2Y A;  4ODG A;  4KMU C;  3GV8 B;  2HHH Q;  1LTT D;  1KAW A;  4YWL A;  3WO0 A;  3J7A V;  1Q1E A;  4L8J A;  1SE2 A;  5KG7 A;  3N40 P;  2JA6 G;  2HGS A;  1HNX H;  4ZUI A;  3DEO A;  4DV2 L;  3M7N A;  1KNE A;  1X56 A;  5G3L D;  4DAY B;  5FLM H;  2UXD H;  1E3P A;  3GTK B;  3HOV B;  1EHI A;  3BVM A;  1B70 B;  5GAH C;  1PTO F;  2NZ1 D;  4JI5 L;  4CJ1 B;  4DF7 A;  1AFP A;  2RGR A;  3I4O A;  5C3E G;  2EYF A;  1FNW A;  1FNV A;  3G71 A;  4S3S A;  2KHS A;  4WRD A;  3VR6 A;  2I87 A;  1X9N A;  1PHJ A;  1MHW C;  5IYB G;  4GLX A;  3UQ8 A;  1SJH D;  3KF6 B;  1VQB A;  4QIW E;  4FYD A;  3BAB A;  4ECU A;  3QB3 A;  4ED8 A;  4KKS A;  5KFL A;  2JA5 G;  3FPP A;  3JSN A;  4IPH A;  4NXM Q;  4O1N A;  2UUB H;  3GO5 A;  1GXD C;  1KQS A;  1ZQ7 A;  1O7I A;  1P16 A;  2F52 A;  4DK0 A;  5DM6 3;  2QIL A;  3K58 A;  3K8A A;  4LWC A;  1Q1B A;  2J6T A;  4LF5 Q;  5C4Z A;  3PGZ A;  4A3K H;  4HIO A;  3R3O A;  4DV7 Q;  1PTO D;  1MSG A;  3MA2 B;  4O3Q A;  3LML A;  3WOF A;  1QWY A;  2OLS A;  1VQD A;  4HJ8 A;  1PH1 A;  1X3Q A;  3IAY A;  2AMC B;  5JPN C;  3PUZ A;  1EZ6 A;  2V58 A;  4LFA Q;  5LMU H;  2F0J A;  2KCC A;  2R7M A;  4LMQ D;  3KUP A;  1KDC A;  3Q23 A;  1C0A A;  1PRT C;  2RKS A;  3MXG A;  2XIW A;  2VQE L;  2VB3 X;  2ES2 A;  2E2I H;  4FF4 A;  4ZYS A;  5K2M A;  3DWA A;  2Z6B A;  2D5D A;  2YYZ A;  4Q45 A;  1NR2 A;  1Y8P B;  1QVF A;  2BR0 A;  4TQS A;  3TN2 A;  1XMO L;  3D8G A;  1WH2 A;  3STB D;  4JC0 A;  3S15 H;  2DJF C;  4J9M A;  2XCP A;  4DAV A;  1EY9 A;  4KHP Q;  5KT6 A;  2SNM A;  4ZOL F;  2KEC A;  1XNQ H;  4DR3 Q;  4C2M H;  3DF7 A;  4JV0 A;  4IUV A;  4IAL A;  4UDU C;  2I80 A;  4J9P A;  1RYS A;  1H95 A;  3ULL A;  4K2K A;  3KLS A;  1B53 A;  4R8U B;  2R82 A;  3C3L A;  2QEJ C;  3M9B A;  1KC8 C;  4YCW A;  1UEB A;  1E24 A;  5IGG A;  3KFU A;  2C35 B;  1VBH A;  4NLG A;  1RJR A;  1ESF A;  3D4D A;  2PVP A;  3D6C A;  5KFM A;  5FPO A;  2B2T A;  1I94 Q;  2GLT A;  4ZKC B;  5IGF A;  1Q46 A;  5FLX L;  1M1K C;  3EN2 A;  4CBV A;  4HMI A;  1C4Q A;  4K0K Q;  3HFZ B;  1H9K A;  3D3R A;  3HB9 A;  3OHA A;  1BCP F;  2EYH A;  1DD2 A;  2E74 C;  1NMG A;  4DV0 L;  3SK5 A;  3T1Y H;  4I7A A;  2VY3 A;  3FRP B;  5BR8 H;  4A3G G;  4RZQ A;  4EG0 A;  3HG9 A;  2HVQ A;  5C3W A;  4GOP C;  5M3M B;  4NPS A;  2ZM6 L;  3J80 c;  4A3K B;  3GTQ H;  5AJ3 Q;  1TWC A;  5FO8 B;  3W5O A;  1WSC A;  3RB6 A;  3FPU B;  4XDX A;  2VPQ A;  4M7E A;  4BA1 I;  1X32 A;  4MIU A;  4UCU A;  5HGQ A;  1EWH A;  1C30 A;  5KFF A;  2RDH A;  1YJ9 A;  2YZM A;  4IAJ A;  2IL8 A;  5A2Q L;  1BCP D;  5CV9 A;  1SYD A;  3S2D H;  5COR A;  4KY5 A;  5D1O A;  4ED7 A;  1EY5 A;  2JA7 B;  4OIJ A;  1HNW Q;  3AB9 A;  1G8Z D;  4JI6 H;  2PZU A;  4ILW A;  1EUD B;  3G6X A;  3SK4 A;  5KRU A;  1NE3 A;  1YHB A;  4G4K A;  2DNE A;  4HTH A;  3NTI A;  5KFA A;  2CW0 D;  2B63 H;  1B9M A;  1WTW A;  3S15 B;  1JX4 A;  1EIF A;  1IHZ A;  1NR4 A;  3T51 B;  1HNZ Q;  4LF7 H;  1EYZ A;  2AQ4 A;  3PUV A;  4AQY H;  1A2T A;  3PN1 A;  3K81 C;  1B4O A;  5CV5 A;  2QDL A;  3J7A F;  2J9G A;  2W6O A;  4IWX A;  3BZD B;  2W57 A;  4C5C A;  3BDL A;  4U7C A;  1I4P A;  2NVX H;  4A3B G;  1ROD A;  1UUP A;  1N36 L;  5GRO A;  1RHP A;  1IBK H;  4KV6 A;  2ICI A;  2B2W A;  1WCM H;  2NVY A;  1C3O A;  1O7L A;  5DM7 3;  4A3M G;  1Y14 B;  5DG9 A;  3HKZ A;  3EA6 A;  3IFT A;  3RF2 A;  2X6L A;  4A2B A;  1L2F A;  2R7Z B;  4YBZ B;  1U0L A;  1RF2 D;  4OEM B;  4KD4 A;  3RAQ A;  2I5M X;  1JOK A;  1LUZ A;  4OL7 A;  3C1F A;  4X3U A;  1RJT A;  1VQM A;  5C8Y F;  2NUC A;  5DEH A;  1SRU A;  1IL8 A;  5HV6 A;  4APM A;  2JA6 A;  3SEB A;  4B3S Q;  3HOZ H;  2XCA A;  1MJC A;  1XMQ Q;  2YU9 H;  1DM0 B;  3X3M A;  2DY8 A;  2LSS A;  1UE7 A;  2RGV A;  4IRC A;  1M4V A;  2A1A A;  3ETJ A;  4JG2 A;  1Q8I A;  3MZ5 A;  5LYJ F;  1TQO A;  5I9O A;  4GS3 A;  3K7A H;  2R86 A;  1Y1V H;  2UUC L;  4GKJ L;  1QVG A;  2EYM A;  2DY7 A;  1K9M C;  5C1O A;  5KFO A;  4QW9 A;  1N33 H;  2JA5 A;  4MTE A;  3V4S A;  2K5H A;  3QO2 A;  4TRD A;  2YRX A;  2A73 B;  2DN8 A;  5CYU A;  1BR9 A;  3I12 A;  5ELE A;  1TWG B;  3NE5 B;  4AH6 A;  1S5D D;  1TR5 A;  3CU7 A;  1Z2P X;  2HHH H;  1DOL A;  4XYM B;  4ME3 A;  1HTP A;  2ZXP A;  2E76 C;  2FPG B;  2VUM H;  5DAU A;  4QGU A;  5IP7 G;  4XTC S;  2ZTC A;  1N32 Q;  3PR4 A;  1IBM Q;  3HXL A;  3H09 A;  1D1I A;  1I3Q H;  4PMB A;  3NQT A;  4RCN A;  1UNN C;  5KT4 A;  1DOK A;  4NXN Q;  5C4X H;  2B2T C;  2B63 B;  1UAP A;  5FD5 A;  2E2H A;  5CMD A;  3K0X A;  1QIL A;  5KNC A;  1GYF A;  3ULJ A;  4ZHQ F;  1R9T A;  3TP7 A;  5E1F A;  2FPP B;  1C8C A;  3L2P A;  3CCJ A;  4XYQ A;  1PH7 A;  2EXZ A;  3PIP A;  1Y1W G;  5LMN L;  1F9Q A;  2NVX B;  4HCE A;  1B2T A;  3GQB A;  4R8I A;  3SE7 A;  4NXM H;  4C3H H;  4IN3 A;  2HCI A;  1WCM B;  4F4Y A;  2SEB D;  2WFW A;  3U4V A;  3CW2 C;  4DLK A;  1CKN A;  2CH4 A;  1K0S A;  2WIN B;  5D3I B;  4AYB G;  3E9H A;  4OON A;  4EQN A;  2HT1 A;  5KFK A;  4EBC A;  4LF5 H;  4ECY A;  1EYD A;  4DV7 H;  4EVO A;  2QDB A;  2CWP A;  1Y69 U;  4YIJ A;  4DR7 L;  3TIG A;  3V6K A;  2EJG C;  2ZXR A;  4IUT A;  1TWF H;  3HOZ B;  1GUN A;  4YHH L;  4LFA H;  4AYB B;  3MFG A;  4K6D A;  3RD4 A;  2YU9 B;  4A3J H;  3A8K E;  5BPF A;  3ND8 A;  4JI7 L;  2J0T D;  3N42 B;  3NWT A;  3RMH A;  3LP8 A;  4N8X 1;  4CDF C;  1KIX A;  3K7A B;  1GUS A;  4DV3 L;  1SAP A;  1Y1V B;  1A62 A;  3QOJ A;  2RDF A;  5ELB A;  4HJ7 A;  4DR6 L;  4LJZ C;  1B6S A;  4RNO A;  2RDI A;  3TME A;  5HUR A;  2NN6 I;  1PVO A;  2F0S A;  2R61 A;  4GNX A;  4IFD J;  2CH4 W;  3PIO 3;  3F8T A;  4PZ7 A;  4DUY Q;  4OO1 I;  3L9A X;  1XDN A;  2VOB A;  3MXN A;  1CI3 M;  1CK1 A;  2EYL A;  5C4X G;  4RKB A;  4JI3 L;  2Z1C A;  1BDO A;  1VQ4 A;  1VMP A;  2IX1 A;  3B6Y A;  4JYA Q;  5EQ0 A;  2F0M A;  4QQB X;  2ZT9 C;  2R7D A;  2VUM B;  1N34 Q;  4O3N A;  1SNQ A;  1I3Q B;  3JAM c;  2I8C A;  1XNR Q;  3BA8 A;  5C4X B;  2EE1 A;  1HQM C;  4IR9 A;  3AMU A;  1J5E L;  4MA5 A;  3RGZ A;  3WOE A;  1I94 H;  4X3T A;  2ZJT A;  3T1H L;  3N6R A;  1O7Z A;  5KFU A;  4JPB W;  1PH9 A;  4K0K H;  2WB1 B;  5J2U F;  4QWE A;  5IYZ F;  2FK2 A;  2YZN A;  3GTG H;  1DXM A;  5M5W H;  3RR5 A;  5M9O A;  2FP4 B;  3CC2 A;  4FM9 A;  4C3H B;  2ZDQ A;  1E4E B;  4B3R Q;  4ZI7 F;  2BH2 A;  3OIP A;  4X66 Q;  1TS2 A;  3J7Z C;  1E22 A;  3MWE A;  5J1Z A;  2IT1 A;  1LT3 D;  3PSI A;  1C9O A;  5KIX A;  2F0Q A;  3J81 j;  4QCL A;  2MNA A;  1GJX A;  3EJI A;  4LFC L;  2XIG A;  1PRT B;  4JI4 H;  1S97 A;  4DL3 A;  5EZY F;  3K5I A;  3I72 A;  4BBS H;  1LT4 D;  5LHY 1;  4RGM A;  4CDE C;  1X3F A;  4NB3 A;  4JI1 Q;  2SCU B;  1JB7 A;  4A3J B;  5H1S E;  1DV2 A;  2DZD A;  4XQQ A;  2YS7 A;  2C28 A;  1HPC A;  5KFV A;  2NZH A;  4DR2 Q;  3NBH B;  1IKL A;  1SN8 A;  1DYQ A;  1HNW H;  3A5Z B;  3RNU A;  3P20 A;  4DAP A;  5JVD F;  3CPF A;  3GTM A;  5FJ8 G;  1EL0 A;  5KFH A;  4BBR H;  5KYL A;  5KG6 A;  2BOS A;  5GAE C;  4LFB Q;  5HY6 A;  4ED6 A;  4RG1 A;  3LGJ A;  1S40 A;  1HR0 W;  1HNZ H;  2W8K A;  4JOI C;  4GKK L;  1K8A C;  2FLP A;  2JA9 A;  3NSW A;  3GTL H;  2OH2 A;  2L5T A;  1E0B A;  2QGQ A;  1ESR A;  2NU9 B;  1EY0 A;  2HQL A;  1ZHS A;  1Q82 C;  1HQR D;  3NTH A;  5IT9 L;  2MO1 A;  1VQK A;  4KY6 A;  2KOL A;  3H4D A;  2Q8T A;  4EFB A;  2WII B;  4DR5 L;  1MKH A;  1JOQ A;  1JLL B;  1K1S A;  3CC7 A;  4ZKB B;  3RV4 A;  3RFC A;  5KFB A;  4DN4 M;  3HOU B;  3J80 E;  1BUV T;  2SOB A;  3CCQ A;  1R4Q B;  4OX9 L;  1KL9 A;  3L4J A;  1I4X A;  2W6Z A;  1H9S B;  1CE8 A;  4EQO A;  4KLK A;  1OTC A;  3KJO A;  3H3V I;  1O78 A;  5IGE A;  3JC6 6;  2UVW A;  2KJX A;  4IZ8 A;  4B3S H;  3BDC A;  4GOP B;  3GTG B;  3SE0 A;  2W9A A;  2PN1 A;  1XMQ H;  3UDG A;  3CQZ A;  4LF8 L;  2F1M A;  3I55 A;  4ME6 A;  1JR0 D;  3PW0 A;  3PUY A;  4TSS A;  4LF9 Q;  1AZP A;  2G9D A;  1QNU A;  1D5Z C;  4BWG B;  1STY A;  2MGS A;  1L1O A;  4G7Z C;  1S5B D;  2L12 A;  3P7J A;  4BBS G;  2R8I A;  4P75 A;  4O3R A;  4O3S A;  1XMO H;  2XGQ A;  3OSP A;  4ECX A;  1B50 A;  2KHJ A;  3M4P A;  4X64 L;  5IT9 E;  3MWD A;  1CUK A;  4GNX C;  1PYB A;  4O2D A;  3U58 A;  5IY0 A;  1JCK B;  2J6U A;  4BBS B;  3S2H H;  1N9W A;  2B2U C;  1TT2 A;  2A6E D;  4BBR G;  4X65 Q;  4NMZ A;  3K3P A;  3M9N B;  2AU0 A;  3R5F A;  1BVS A;  1K3R A;  3JRX A;  4XXE A;  4L5R C;  3SI8 A;  4IR1 A;  2PZW A;  3M4Q A;  2Z6K A;  1F9P A;  5JVH 3;  1GHJ A;  3MEF A;  1N32 H;  1IBM H;  1GUW A;  2O2L D;  1RKN A;  4I4T F;  2AGQ A;  4NXN H;  5CC4 A;  3LWB A;  4JV2 A;  3BQ2 A;  1PTO C;  1WTR A;  3ICE A;  2C5C A;  4PMW A;  3BA9 A;  4TV9 F;  1E2V A;  2ICE C;  3GTL B;  4MHE A;  1W93 A;  3FDS A;  1GD7 A;  2DJG C;  1DZ1 A;  2GPS A;  4UCV A;  1AN7 A;  5T1G A;  2I5L X;  2R7F A;  3OMG A;  2JE6 I;  1Z47 A;  2PI2 E;  3U50 C;  1S72 A;  4QF4 A;  3TRZ A;  5DLQ E;  2R93 A;  3PCO B;  2EXD A;  2K32 A;  4H44 C;  2NBF A;  1G6P A;  3E9I A;  5DQI A;  5D8D A;  4AYB E;  5CA0 F;  3W1G A;  2PW7 A;  2EDG A;  3STB C;  4HID A;  3HOY H;  4A3E H;  1OXV A;  3CPW A;  2HIV A;  4MV3 A;  1BXR A;  1B9N A;  3KLW A;  1NJI C;  1B7Y B;  4PG3 A;  3IKJ A;  5F9N A;  1STH A;  4JI2 L;  5ELO A;  1SYB A;  3E5S A;  1SEI A;  1HZ9 A;  2EYP A;  3MXU A;  1STN A;  4IUQ A;  4CKB A;  4I7H A;  1D2B A;  2WE6 A;  3S24 A;  5KG2 A;  1O7Y A;  2F3I A;  3ETH A;  3GTK H;  3HOV H;  5KFE A;  2BQR A;  1ASZ A;  2DPJ A;  3HOW B;  4C5A A;  4F4W A;  1F2L A;  2L9H A;  3HBL A;  2FPI B;  4PNY A;  1NNX A;  1LTL A;  5L9X A;  4J9O A;  2N55 A;  3DMU A;  4ECQ A;  3S2H B;  1VQP A;  1V1Q A;  1BGW A;  2FJZ A;  4QB4 A;  1GSO A;  2YV5 A;  4EYH B;  1SYF A;  2R92 A;  1CM9 A;  4DL7 A;  3BVG A;  5DGA A;  4HQ6 A;  1HUM A;  2PMZ E;  2O5I C;  1EQQ A;  1HCZ A;  1JWU D;  4JYA H;  2UXB H;  4JW0 A;  3LX0 A;  1JJG A;  5IYC G;  1N34 H;  1K83 A;  4IJL A;  1CKO A;  3OPO A;  1K73 C;  3BZK A;  1S5C D;  1XNR H;  4KHP L;  4DV4 Q;  4HN7 A;  3AYH B;  3UDF A;  4BXX G;  2VZA A;  4PZ8 A;  1CKM A;  1PV4 A;  4M8A A;  3TBI B;  2F0U A;  3PQI A;  5COY A;  2NUA B;  1LTR D;  3TDQ A;  5EBD A;  4A3D G;  1BCP C;  3NBI A;  2W6P A;  1V51 A;  1AH9 A;  4IWY A;  4CGY B;  4XZ3 B;  2RHQ B;  1II3 A;  5CBE E;  1JT8 A;  4ULL A;  1A9X A;  3VA7 A;  1QZG A;  3QFF A;  3I4N H;  4B3R H;  5LP6 F;  1L1O C;  1WD0 A;  2VQF L;  3H15 A;  1KAB A;  4X66 H;  2UXC L;  3T16 A;  4QIW A;  2CW0 C;  4GKJ H;  3HOY B;  3V4Z A;  4A3E B;  1I5F A;  3NGD A;  2OT2 A;  2KEE A;  4YY3 L;  2MHV A;  2K05 A;  2UU9 Q;  3FKI A;  2K5N A;  3F2D A;  1I6V C;  2K5Q A;  2YTX A;  4C3J H;  1EFW A;  4HMJ A;  2UUA L;  3HOV G;  4FU0 A;  2ASJ A;  4XT1 B;  2EY5 A;  1TVX A;  2BDO A;  4MV4 A;  1M8A A;  2A5H A;  3TEH B;  4JI1 H;  3S17 H;  2E2H H;  2Z6K C;  4HNV A;  4DR2 H;  1Y8N B;  2FE3 A;  2A8V A;  2PCF B;  2VA2 A;  2F0P A;  3JAM E;  2ZJR A;  1VQG A;  2RDJ A;  4LFB H;  1F9R A;  3NWS A;  1Z7T A;  5JJK A;  1SYG A;  4K14 A;  2PQA B;  4MN3 A;  1GKH A;  5JJZ A;  5D3D A;  1JIH A;  3GV6 A;  1FD7 D;  4CKE A;  5J22 A;  4RNM A;  4QUF A;  3AFP A;  2NVY B;  2HVS A;  3KHL A;  1AUX A;  1ZET A;  4TKO B;  3HKZ B;  2FHT A;  5I6Y A;  3GTP A;  4FF1 A;  5EDW A;  2B2V A;  1KTK A;  2YTY A;  3A5U A;  3BG3 A;  4ECS A;  1VDZ A;  4DUZ Q;  4ZQ3 A;  1RJQ A;  4F4Z A;  4EEQ A;  2FLN A;  2F4V Q;  5M3M H;  3VYU A;  1EY4 A;  3RB4 A;  3H6M A;  2JQO A;  2N88 A;  2R6F A;  4FBU A;  1IBL L;  1D1K A;  3F2B A;  3ONA B;  5EJW A;  4IFD I;  4MV9 A;  2JK8 A;  2J4X A;  2E2J B;  3ER0 A;  4IUP A;  1XJV A;  4F88 A;  2KED A;  4QWB A;  4YCU A;  4DR4 H;  2VQD A;  1BF4 A;  3OTO L;  1PYW D;  3GII A;  1WI5 A;  4DK6 C;  1KJ9 A;  3OWE B;  3TP5 A;  1LT6 D;  2JA7 H;  4DV6 L;  4JI0 L;  4M1U B;  4L5S A;  2A68 D;  3N8D A;  3G48 A;  1JB3 A;  1A3U A;  3I4N B;  5DQG A;  1VMC A;  2A6H D;  4LF9 H;  1Q3L A;  3G6V A;  3MR2 A;  5JJL A;  5KX5 F;  3VMM A;  2IWH A;  4B9W A;  3IG0 A;  4FP5 D;  2C9O A;  4HED A;  3EQL C;  5IOC A;  5CV6 A;  3V05 A;  1XX8 A;  4CDC C;  4HYK A;  2BQ3 A;  5KKN B;  5JEA J;  1STE A;  4K2L A;  2H4O A;  3UI2 A;  4C3J B;  2AQ2 B;  5FLM G;  1WD1 A;  3F2C A;  3CHB D;  3J81 L;  1TII D;  1DV1 A;  1YZ6 A;  5IE8 A;  5LOV F;  5H80 A;  3OYY A;  4X65 H;  3PR5 B;  4NP5 A;  2IJ0 A;  1ZYR D;  3RLF A;  4J9R A;  1I7N A;  3GIM A;  3S17 B;  3MXP A;  3K3V A;  2RCF A;  2E2H B;  3NHH A;  3TQ1 A;  4CKC A;  2K28 A;  5IYD H;  3NQI A;  3M3Y H;  2W7P A;  2K5W A;  4A3C H;  1K3B C;  4X3K A;  3A7L A;  3QWN A;  4V0B A;  3RGX A;  2RQX A;  2R7Z H;  3GTO H;  3PO3 B;  4O2B F;  1STA A;  5DLG A;  2IW3 A;  3T5H A;  2LXK A;  4JI8 Q;  1IYV A;  1KXL A;  2Z9H A;  2P5Z X;  3WNZ A;  5M3M G;  3FMC A;  3OHB A;  2AGP A;  1HR0 H;  4A3K G;  4B3M L;  4LK1 C;  1CKN B;  2KHI A;  4MA0 A;  2XSC A;  3J80 i;  2MO0 A;  1JOO A;  3KDF A;  5I6W A;  4DK1 A;  5IWA L;  4A2A A;  3K0Y A;  2JYO A;  1TWH A;  5C0X H;  1A6X A;  3CCM A;  3RBD A;  2GN5 A;  1FVI A;  1K28 A;  4DPG A;  3RJ0 A;  1IXR A;  2K50 A;  2Z4I A;  3OOC A;  5KT3 A;  3J81 E;  1QNK A;  1YNJ D;  4FNF A;  4KI0 A;  4DXF A;  3G6E A;  3MAQ A;  2JA7 G;  4FO2 A;  3K5H A;  4RB1 A;  4ID6 A;  1N48 A;  4LUV A;  4JI4 Q;  2CQA A;  5EKL A;  3C2P A;  3DLL A;  2FKL A;  3SDZ A;  4YP3 A;  1LYL A;  4U68 A;  5C4H A;  4O3O A;  3U9O A;  2OTL A;  3P1H A;  3GIK A;  1TWG H;  1I50 A;  3N6X A;  2V59 A;  1V43 A;  2L0C A;  1JJC B;  1FJG L;  4JV5 H;  2AUK A;  2CQO A;  2E5L L;  1X55 A;  3VDY A;  2YTV A;  2EYJ A;  4DV2 Q;  2ASB A;  2F3V A;  3MR6 A;  5JJI A;  3PIO A;  4GNX B;  1V4Y A;  1WTV A;  5FLX W;  4JI5 Q;  2D2C C;  3CP0 A;  2JEG A;  2PBZ A;  1VF5 C;  1LO5 D;  4A3F B;  4Q0Y A;  1LTS D;  4DV1 L;  4EQ5 A;  5L1L A;  5KFX A;  4A3C G;  4N8F A;  4R1J A;  1G29 1;  1M7J A;  4Y8V B;  2YCH A;  1S0M A;  4PQX A;  4X62 H;  3CXC A;  1ZEQ X;  3N44 B;  5C6A A;  2R7Z G;  1JQY D;  1FGB D;  2WAQ B;  2B2V C;  4XYO A;  1A15 A;  3EBE A;  1PTO B;  3H3V C;  1BOS A;  3M3Y B;  4B3T L;  3R93 A;  3J7Y W;  4CC6 A;  4DAY A;  4OGQ C;  4EX5 A;  4IHJ F;  3GTO B;  3JRW A;  1PH5 A;  2W7O A;  4DUY L;  4DV4 H;  3CRL C;  1T5X D;  4R4O A;  5A2Q W;  2E2D C;  3CME A;  2IY5 B;  5C0X G;  5CR3 A;  1GUT A;  1Z2O X;  1WJJ A;  2OQ0 A;  3TS2 A;  1T94 A;  4R4C A;  4LF4 L;  3KF6 A;  1TS4 A;  4HJ9 A;  2MCT A;  2QEX A;  2JEJ A;  1LTB D;  4UP8 A;  1O75 A;  4DR1 L;  4DV5 L;  2B8F A;  1JIC A;  1EOT A;  1BNZ A;  1SYE A;  1C7Y A;  5K5P A;  2VQE Q;  4JV1 A;  5CGK A;  2B3G A;  2EPB A;  4RA8 A;  3FMA A;  3NXW A;  4A3I H;  5CBA E;  1DCZ A;  2Z0S A;  1B6R A;  4UFZ A;  2W9C A;  1XMO Q;  3OWF A;  1XPU A;  2RDG A;  1ET6 A;  3BVZ A;  4I55 F;  1GUO A;  3CMA A;  3LWU A;  5BPH A;  4FS1 A;  3T5J A;  2O5J C;  2UU9 H;  1NCV A;  4KN7 C;  4IZO A;  4FF2 A;  5LL6 b;  2BDN A;  2F0O A;  1JJ2 A;  5M5Y H;  2B63 G;  1A3V A;  2BA0 A;  3I4L A;  5FD6 A;  1NTG A;  3NPP A;  4KJO A;  2ZJQ A;  1JDB B;  2YZG A;  1JE5 A;  1U9R A;  3WDN A;  2H1E A;  3V96 A;  3TII A;  4ED3 A;  1TS5 A;  2J6S A;  1B3A A;  2FB9 A;  4LF6 L;  4QWA A;  2EYO A;  3CCV A;  2DUD A;  1TWA H;  3QZ7 A;  1WCM G;  3H94 A;  4HIM A;  2PO4 A;  2DLN A;  2GVB A;  2R93 H;  2YYA A;  4ZUJ A;  4RU9 A;  4GLV B;  1X65 A;  4YWM A;  5FOB B;  1VQO A;  1HNX L;  4DV0 Q;  2KEN A;  3A56 A;  5KFT A;  3R5H A;  2M05 A;  2LS0 1;  2KUM A;  2XGT A;  3F1Z A;  4KJN A;  5GQO A;  2UXD L;  5KND A;  4O4H F;  2PZT A;  4QMG A;  2CQY A;  4DUZ H;  3PVX A;  2HDM A;  4R4I A;  3CCR A;  4DNR B;  2ZM6 Q;  1U5K A;  3HOZ G;  4O4I F;  2F4V H;  5M3F H;  4TV8 F;  5KYI A;  2L4N A;  4F7X A;  3GTJ A;  2WTF A;  3GQC A;  1BCP B;  2K4K A;  5EPJ A;  3I91 A;  3NK9 A;  5CV4 A;  2WDT A;  3MFI A;  2XWJ B;  2NN6 H;  2V5A A;  3AU7 A;  1CHQ D;  3ZJY C;  4A4I A;  4E6I A;  1Y1V G;  2UUB L;  3I73 A;  1T36 A;  3K5O A;  1IW7 D;  2A6E C;  4OO1 H;  3PO2 H;  1L1O B;  4X3S A;  3K5N A;  5C3X A;  1P8L A;  3URY A;  2K5D A;  2K03 A;  3IN5 A;  3H0G H;  1DJR D;  2MQH A;  2VB2 X;  1KDB A;  2X6G A;  3OW2 A;  1NAP A;  2R6G A;  1HA5 A;  1W6J A;  1GHK A;  2K75 A;  1V1P A;  1W3S A;  4A3I B;  4MV7 A;  4ED1 A;  4BY1 B;  4A93 H;  4J6H A;  1HRJ A;  3S1N B;  2JA8 H;  4LUZ A;  4WBN F;  2HVR A;  4DXG A;  2R92 H;  5LMU L;  3BU2 A;  2VUM G;  1E2W A;  2G9H D;  2I46 A;  5LMN W;  1KLU D;  4Y7N H;  4K5W A;  2B2Y A;  1I7L A;  1OXS C;  3QG1 A;  1K1Q A;  5M5Y B;  3PW7 A;  5ISR A;  1N36 Q;  2QF7 A;  4HR7 B;  5EKK A;  3RZO B;  2B2W C;  2UXB Q;  1D7Q A;  1I4Q A;  4LAA A;  2C2D A;  2WB1 G;  4Q8F A;  3OMC A;  4CC5 A;  2WV6 D;  3HOU H;  2ATL A;  5KG0 A;  4KKU A;  5IOD A;  1WFQ A;  2E2I A;  4UP9 A;  3S1M H;  2VUG A;  5EWE A;  1XNQ L;  1GUG A;  3UE0 A;  4RAY A;  2C2R A;  4GN5 A;  1TWA B;  4C3H G;  4UY8 C;  1OWT A;  2JP1 A;  3M85 A;  1D8L A;  1I4G A;  3AEV A;  4JI8 H;  4QJF A;  1TKW B;  3VYT A;  2R93 B;  1BQQ T;  1KAA A;  5FO7 B;  1WR2 A;  1YIT A;  3QOL A;  3UDI A;  1I6H H;  3VYS A;  4C2M A;  5CB4 F;  3OUZ A;  2ALZ A;  4P72 A;  4Y52 H;  2JN4 A;  4UCR A;  3TQT A;  1IL2 A;  1UNS A;  1Q86 C;  2NN6 G;  2NWG A;  1J9O A;  4RB0 A;  3VPB A;  2WP8 J;  1E4F T;  4NKL A;  1S5E D;  4OO1 G;  2DGY A;  3LNN A;  4IOC A;  5M3F B;  2UUC Q;  4GKJ Q;  3L0O A;  4A3J G;  3CCE A;  1HHV A;  3T13 A;  1PH3 A;  3H0G G;  1PXU A;  4V19 0;  3M4O H;  3J80 L;  3Q8R B;  4OXP A;  3T1Y L;  3X3N A;  2UUA H;  5BR8 L;  2N8N A;  3HP3 A;  4O4L F;  3PO2 B;  4A3L H;  1RYR A;  3DM1 A;  3TQY A;  2ALY B;  5A35 A;  2JA8 G;  1PH2 A;  3H0G B;  3Q2O A;  2HIX A;  3GP7 A;  4RMF A;  3Q0A A;  4UP7 A;  1VQF A;  2GVA A;  4IPG A;  4DV2 H;  3RIZ A;  4M9U A;  5EPL A;  3P75 A;  4A93 B;  2VXW A;  4JI5 H;  2WAQ E;  2JA8 B;  1RD9 D;  1E1T A;  1RDP D;  1EEI D;  1E4G T;  2R92 B;  3GTQ A;  3GTP H;  1KJ8 A;  4B9X A;  1QJO A;  5KFS A;  1CHP D;  2A19 A;  2E8G A;  2ASL A;  4Y7N B;  2Q8I B;  3HOU G;  3H3V H;  1VQE A;  1EFI D;  2C22 A;  5KEE A;  3VR2 A;  3HS0 C;  2JJQ A;  1CA6 A;  4JI6 L;  3CRK C;  4JBJ A;  3U4Z A;  4LH6 A;  4I7Z C;  3Q8S B;  2VA3 A;  2N49 A;  2IA6 A;  2Y0S G;  3GV7 B;  2D9U A;  4Q43 A;  4QUC A;  3KF8 A;  3CAM A;  3RUZ A;  4LF7 L;  1BBW A;  4OWT B;  2G5D A;  4OHJ A;  4OWX B;  2Q2I A;  4AQY L;  4F8M A;  3A7A B;  5LL6 X;  3S1M B;  2AKW B;  3J80 W;  1YHQ A;  4G7O C;  5BN4 A;  2B63 A;  1SBB B;  2F0I A;  2PPB C;  4DR7 Q;  3T56 B;  4MNO A;  2Y0S B;  3CF5 A;  3WWV A;  4DR4 Q;  3KXY T;  3KJP A;  1IBK L;  4K8I A;  3PF4 A;  4YHH Q;  5JOB A;  1KNA A;  2CW7 A;  4KK7 A;  2BA1 A;  4R4T A;  1I6H B;  3VA5 A;  2ZDG A;  1MGS A;  2R85 A;  2W6Q A;  4QIW B;  4L1K A;  2NVX A;  3J81 i;  1SMY D;  4JI0 H;  5ELN A;  3SVM A;  2VQE H;  4FBT A;  2D0P A;  3MWM A;  1SFO A;  5NUC A;  4DV3 Q;  1WCM A;  1LTG D;  3HOW H;  1GLV A;  4GN3 B;  2F0W A;  4DR6 Q;  1LM0 A;  2EY6 A;  1PZK D;  1PZJ D;  3S14 H;  1Y1W A;  1SNO A;  1PFN A;  1RCV D;  3M4O B;  5IT9 W;  1CZG A;  1N8R C;  2PI2 A;  3GIL A;  1SXT A;  5EKI A;  1MZB A;  1UC9 A;  1EU4 A;  5CA1 F;  3Q22 A;  1NSN S;  4AYB A;  4EYI B;  1HTL D;  3A74 A;  2EY1 A;  3MHB A;  3PW5 A;  2B29 A;  3WO1 A;  4DFA A;  3CCS A;  2J7Z A;  2FFK B;  4WOR A;  1N33 L;  4B08 A;  2EVB A;  3VR4 A;  1JDE A;  3V6J A;  1J5E Q;  5L37 A;  2NVQ B;  4C3I B;  1Y1V A;  4K8J A;  1YEZ A;  2DPI A;  2F3W A;  3GTP B;  4QL5 A;  1BBX C;  3S16 B;  2CHB D;  3T1H Q;  3E0J A;  2LMC B;  3BDO A;  1HR0 Q;  2EZV A;  2HHH L;  3T5L A;  3ORQ A;  3F2U A;  2W6N A;  4G3I A;  3OHX C;  1U4P A;  4PMC A;  1VS0 A;  2X0S A;  3UFX B;  2F0F A;  4DV0 H;  4B3M H;  3KLR A;  5FLX c;  1WOC A;  1ICF B;  1TWC H;  1BBU A;  1F9S A;  3MEH A;  1A63 A;  5KG4 A;  1UE5 A;  5KFJ A;  2A68 C;  4YQW A;  3BYT B;  1O80 A;  4HCS A;  4WD3 A;  2RVL A;  1EIG A;  2VUM A;  2ZM6 H;  1HJP A;  4RH6 A;  3MVV A;  1B8A A;  4EEY A;  2XN9 C;  1I50 H;  2FJ2 A;  4N9T A;  1FR3 A;  3PZP A;  4LFC Q;  1EYA A;  2OQK A;  5CV8 A;  2ZJP A;  3I90 A;  4RAU C;  4NXM L;  2JEI A;  2RA4 A;  2PMZ A;  4KN4 C;  3HOW G;  4JV5 Q;  4UPA A;  1NY4 A;  3IFD A;  5C1P A;  3M9M B;  1TY0 A;  3I56 A;  4WJ4 A;  3VYR A;  3CVZ A;  4QWD A;  3E0E A;  1Q7Y C;  4EGJ A;  1ZYR C;  3DHQ A;  1EEF D;  1ZKO A;  3T4A C;  3KAK A;  4LF5 L;  1CQF A;  3NEM A;  4ECT A;  3FDT A;  4DV7 L;  1MD2 D;  3UE1 A;  1E4E A;  2F03 A;  4MTD A;  4DKA C;  4FF3 A;  4IRK A;  2JXM B;  2K33 A;  4KHZ A;  1R4P B;  3S14 B;  1RTO A;  4GKK Q;  4P74 A;  4LFA L;  4FXK C;  3ERO A;  1S9F A;  1Q8K A;  2CWA A;  4X62 Q;  2NVY H;  3PV0 A;  1W6K A;  1K8O A;  2XTI A;  4QY7 A;  4RWS C;  1UE6 A;  1HA6 A;  2W71 A;  3BJY A;  1TWF A;  1N36 H;  5K36 H;  5KG3 A;  4DR5 Q;  2EQS A;  5EBC A;  1DIK A;  5GAG C;  5L1K A;  2WB1 E;  1BO0 A;  4C5B A;  1XTD A;  1MBY A;  2HDL A;  1STG A;  2WYO A;  1JKJ B;  2JA6 H;  2K1B A;  4OX9 Q;  1ET9 A;  2CW8 A;  1Z9F A;  4LNQ A;  2DIK A;  4DR3 L;  3E6Z X;  2F0L A;  2E2J H;  1HFN A;  1PX2 A;  2UVV A;  2K52 A;  3JAM L;  4FDB A;  3KHG A;  3KDF B;  2BQU A;  4TQU S;  5KNB A;  4H02 A;  1TWH B;  1SE4 A;  1D6E C;  4F87 A;  1ENF A;  1GGO A;  1RJP A;  5T14 A;  3HOY G;  2F0V A;  4A3E G;  5JQW A;  5IYB H;  4LF8 Q;  1ILP A;  2FLL A;  1QOH A;  2FIN B;  3NEL A;  1TWC B;  3R2T A;  3S1Q H;  1S0N A;  1B3Q A;  3GD7 A;  1YNN D;  3GDE A;  5J3B A;  1D5M C;  2KCM A;  1W2B A;  2JA5 H;  3K80 C;  1I94 L;  3MR3 A;  3GIJ A;  1G2S A;  2NYZ D;  5JVL A;  2UUC H;  2ID0 A;  3ZYY X;  3N43 B;  1T9H A;  4O42 A;  1I50 B;  2OXP A;  2OWO A;  4K0K L;  5C44 B;  3S9W A;  1QVC A;  4X64 Q;  1IYJ B;  2V4Q A;  5D1O B;  1Z2N X;  1ENC A;  3E3X A;  4JVZ A;  1TA8 A;  3RV3 A;  3MC0 B;  2BE5 D;  3TIN A;  2NZO A;  1ZXT A;  3EPI A;  4GOP A;  1HFG A;  1MIU A;  4CHT B;  3GTG A;  4ECV A;  4NDX A;  3BS1 A;  2OF1 A;  1Y8O B;  1KJJ A;  1IYU A;  3D31 A;  5AJ3 L;  4JBM A;  4QW8 A;  1OO9 B;  1R9T H;  4TQR A;  5DNF A;  4G7H C;  3TP8 A;  2NB0 A;  3HKZ G;  3D6W A;  4LSX A;  3PO3 H;  3G7L A;  4ECZ A;  2F0N A;  1H9J A;  2QA4 A;  1EIY B;  2Z8L A;  4IUN A;  2YL2 A;  3TRE A;  1NBW A;  5KGU A;  4IFD H;  4J0M A;  4CJ2 C;  1H9R A;  1LAC A;  2MUY A;  1EQV A;  1VQI A;  4HSP A;  4G57 A;  1HNW L;  3TZD A;  5LMN H;  3RAX A;  3SK6 A;  3GTJ H;  4YB8 B;  1KBL A;  2Y0S E;  3CKI B;  3HKS A;  2KBN A;  2YS6 A;  2AHO B;  4I65 A;  2R84 A;  2R7K A;  1HNZ L;  5JPM C;  4KTA A;  3EVQ A;  2JA6 B;  2F0T A;  4TVA B;  1Z6H A;  4ZK9 B;  3BYY B;  3I4N G;  3M9O B;  4HJ5 A;  1M90 C;  1SMX A;  3C0F B;  4DK3 C;  1JXL A;  4DR7 H;  1KHI A;  2WKC A;  4JI2 Q;  5C3E B;  1WTX A;  1CA5 A;  3GTL A;  1E1O A;  4YHH H;  4DL5 A;  1C48 A;  2L11 A;  2W9C B;  1CS0 A;  4R7R A;  3RBE A;  1JC7 A;  3S1Q B;  2PQE A;  1SE3 A;  4RGN A;  5DG7 A;  2XD4 A;  4C3J G;  4JI7 H;  1EWI A;  1SDF A;  1SYC A;  1RIP A;  4GLA C;  2K01 A;  2JA5 B;  1G91 A;  1CTM A;  4DL6 A;  3MFH A;  1EYC A;  1VQ7 A;  4DV3 H;  1L0X B;  4ME5 A;  4YWK A;  4A3G H;  3DEP A;  4L63 B;  4DR6 H;  4P71 A;  4A3F H;  2L15 A;  4B3S L;  4GC6 A;  4ECR A;  3J7A 5;  2IMW P;  3GV3 A;  1XMQ L;  5I4D A;  2Q2H A;  2DNC A;  4LH7 A;  4YJ2 F;  3PO3 G;  4JI3 H;  3HOX H;  3CC4 A;  4I50 F;  4TUY F;  5EOY A;  5BN3 A;  1PTO H;  4IFD G;  3VPD A;  1VCI A;  2A69 D;  2PYK A;  1CZW A;  1L0Y B;  2HD3 A;  2N3S A;  1QG7 A;  4WFN 3;  1R9T B;  2K5V A;  4EGQ A;  2IX3 A;  2AWO A;  1XXG A;  1V8Q A;  4R9W A;  2W70 A;  3I2Z A;  2FXQ A;  5KFZ A;  4JCV E;  4Q44 A;  5KT2 A;  1YVC A;  3I70 A;  1J5E H;  2RSO A;  1SRO A;  4GZY C;  2VPS A;  5E3F A;  1QUQ A;  1PH8 A;  1TAE A;  3H91 A;  2FMC A;  3T1H H;  4HSV A;  2QW7 A;  4HIK A;  2NVT H;  1IW7 C;  3D4W A;  3PF5 A;  4APV A;  5BN5 A;  5E7N A;  2EIF A;  3TS0 A;  1IBM L;  1UEA B;  1N32 L;  1PFM A;  3GTJ B;  2R3Z A;  2W9B A;  1I4H A;  4NXN L;  2B39 A;  2VQF Q;  1PH6 A;  4A3B H;  1PH4 A;  4MV6 A;  1EZ1 A;  3MWY W;  2UXC Q;  1PFB A;  3AQQ A;  3C1E A;  1ULZ A;  4J9Q A;  4N9P A;  1LAB A;  3QIA A;  4O3P A;  4YY3 Q;  1EWC A;  4A3M H;  3J81 W;  4J9N A;  3Q8D A;  1A0I A;  4LFC H;  2UUA Q;  3OIQ A;  2IX0 A;  4YAJ B;  5AFW A;  4RNN A;  1V1P B;  4J15 A;  5F9L A;  3NP8 A;  4QWC A;  2ASD A;  1K8M A;  1X6O A;  1WVL A;  2M9V A;  3SGI A;  3GTM H;  2IHE A;  3SHL A;  2D62 A;  4C1N K;  3RN2 A;  4A3F G;  2R8H A;  2R8K A;  2FK1 A;  4A75 A;  2C00 A;  4C56 C;  4X6A H;  3Q1K A;  1BXT A;  1MJE A;  4WJ3 M;  4J8Q A;  4JK1 C;  4UCS A;  1RK5 A;  4ZRZ A;  3HOX G;  4A3G B;  2CCZ A;  2WAQ G;  3RN5 A;  3MXN B;  5F2D A;  3OSN A;  3A54 A;  5C5M A;  4BY7 H;  1QCB D;  2KVM A;  4ED2 A;  4LUO A;  2WAC A;  4A76 A;  1B33 N;  5IYD G;  1OXT A;  4GKK H;  2MJ8 A;  5IGC A;  1LTA D;  2XC9 A;  4KHV A;  1CSQ A;  1AZQ A;  1YHA A;  5ELC A;  5C0X I;  3HOX B;  4EQP A;  2E75 C;  1AW7 A;  1EOV A;  5FLX E;  2E2I B;  3MJF A;  4DR5 H;  2UVU A;  3SR1 A;  2R7L A;  4RGT A;  1GM5 A;  5IT9 c;  3GTK A;  1A2U A;  3DWQ A;  2KCT A;  4XQN A;  2I0Q A;  1ML0 D;  4BS9 A;  5IP7 H;  1IBL Q;  3QR8 A;  4OX9 H;  1RTN A;  1KC7 A;  4C2M B;  3U9T A;  3CQZ H;  2F0D A;  4RFB A;  2PQA A;  3I8Z A;  5FK9 C;  2Q8R E;  5JAV A;  4HJA A;  1BNC A;  4U6P A;  5EPK A;  3HRZ C;  2NVT B;  3MR5 A;  4JYA L;  3VR5 A;  4MV1 A;  3OTO Q;  1SFO H;  2KA7 A;  2UXB L;  4K5V A;  3I7F A;  1M0T A;  1MSH A;  1N34 L;  2MPM A;  4LF8 H;  2L1B A;  4DV6 Q;  4F50 A;  4JI0 Q;  1B1Z A;  5CAE B;  1XNR L;  2K04 A;  2XCL A;  1Y1W H;  3DXJ C;  4A3B B;  3AFQ A;  3EYY A;  4L5T A;  5A2Q E;  4BY1 H;  2AGO A;  4OWW B;  4IUU A;  1PZI D;  3S1N H;  1LV9 A;  4A3M B;  4X64 H;  3S1R H;  5IP9 H;  3FVQ A;  5L1J A;  1PRT F;  1VBG A;  4MAM A;  4YCV A;  4O0A A;  4BWS C;  1SEB D;  4K5X A;  1XPO A;  5KFQ A;  4B3R L;  1U4L A;  3GTM B;  4BY7 G;  5J2T F;  3RZO H;  3DWP A;  2HUG A;  4X66 L;  4DU9 A;  4IRD A;  5D1P A;  3K7U C;  4OIK A;  4OEL B;  1PLF A;  3GTQ B;  5EAY A;  5JVG 3;  3CD6 A;  1VAJ A;  3N41 B;  4ALP A;  3I4M H;  3HKZ E;  2F0G A;  4ZLT F;  3K59 A;  2AUJ D;  1FYC A;  3ERS X;  4FXG C;  4HAE A;  4BY7 B;  2VR1 A;  1H9M A;  4DNI A;  1Q81 C;  1L0W A;  1GSA A;  4J9L A;  3KBG A;  1HUN A;  3S2D B;  1SCU B;  4ECW A;  4JI1 L;  1PRT D;  4ZCK A;  4B3M Q;  2VNU D;  3KF8 B;  4PWQ A;  5BMV F;  1CSP A;  2SDF A;  3PW4 A;  3W2D A;  4DR2 L;  2EJM A;  3PUX A;  2FMM A;  3H40 A;  5IWA Q;  4R8U A;  1LT5 D;  3NEN A;  4Z9C B;  1SMY C;  3OUU A;  1S68 A;  3EFX D;  5GAD C;  4LFB L;  2NTT A;  3A8I E;  1S5F D;  5J39 A;  4POG A;  4UHV A;  1AP0 A;  4PDB A;  1S3O A;  3JZI A;  3KK7 A;  4JOI A;  1EQT A;  1FNU A;  3EIV A;  3RZD H;  2WKD A;  1FL0 A;  3K6O A;  3HGB A;  5LA6 F;  1PDQ A;  2OTJ A;  3PUW A;  3CQZ B;  1D5X C;  5I2Y A;  3RUP A;  1STB A;  2QYZ A;  1FGU A;  1IKM A;  4A3I G;  4EBD A;  1CFM A;  1EY6 A;  4BY1 G;  4ABN A;  4JI2 H;  5C5J A;  1E7Z A;  2DWC A;  2R7N A;  5LL6 S;  5EWG A;  1XYI A;  1SFO B;  1FJG Q;  3Q8Q B;  4RCO A;  2XVS A;  3E5N A;  2E5L Q;  3K5M A;  4O2A F;  5IP9 G;  1T5E A;  3DUZ A;  3KHR A;  3TP6 A;  4PV1 C;  3TSS A;  1CQJ B;  1Y1W B;  5HBR B;  3VR3 A;  1S03 G;  1EU3 A;  1VQ6 A;  5KFY A;  3RB0 A;  3QJY A;  4CDD C;  2C2E A;  2O03 A;  1S4Z A;  2ZTE A;  4DR4 L;  2BCO A;  1PYS B;  3S1R B;  2AQ1 B;  4DV1 Q;  4IO9 A;  5E4W C;  2I5H A;  3F8N A;  3NUC A;  3BJU A;  3T53 B;  3I4M G;  2B8G A;  1K83 H;  1X3P A;  2SNS A;  4LF9 L; 
#chains in the Genus database with same CATH homology
 3S17 H;  3JAM i;  2E2H H;  2Z6K C;  1HNW Q;  2RF4 A;  1HZB A;  3A74 A;  1YI2 A;  2B29 A;  1NE3 A;  1YHB A;  2A8V A;  1VQ8 A;  2R93 G;  1VQJ A;  3CCS A;  4B3T Q;  2B63 H;  1N33 L;  2ZJR A;  1EIF A;  1VQG A;  1HNZ Q;  1J5E Q;  3PUV A;  4IPD A;  5JJK A;  2PQA B;  1YEZ A;  3CCU A;  3K81 C;  1GKH A;  4QL5 A;  3T1H Q;  1YIJ A;  4X65 L;  1HR0 Q;  3AFP A;  2HHH L;  5FJ8 H;  5IYD H;  2NVX H;  4BA2 I;  4A3B G;  5M3F G;  4LF4 Q;  1N36 L;  1VS0 A;  5GRO A;  1HZC A;  2YTY A;  5FLX c;  1SE8 A;  1WOC A;  4DV5 Q;  1WCM H;  3A5U A;  4DR1 Q;  1TWC H;  1BBU A;  4DUZ Q;  1A63 A;  1UE5 A;  4A3M G;  1Y14 B;  3DM3 A;  2F4V Q;  5M3M H;  1BKB A;  3FKI H;  1KRT A;  1HJP A;  1L2F A;  3PO2 G;  1B8A A;  1U0L A;  2JQO A;  1I50 H;  1IBL L;  3F2B A;  2I5M X;  4IFD I;  1SR3 A;  1LUZ A;  2JK8 A;  2MFI A;  1HR0 L;  1VQM A;  4LFC Q;  3ER0 A;  1XJV A;  1SRU A;  4B3S Q;  3HOZ H;  2OQK A;  1MJC A;  2ZJP A;  4YCU A;  1XMQ Q;  4NXM L;  2YU9 H;  2LSS A;  3HOW G;  4A93 G;  3OTO L;  1UE7 A;  4JV5 Q;  4UPA A;  1WI5 A;  1NY4 A;  4DK6 C;  2ZTD A;  1A8V A;  3I56 A;  1DGS A;  4WJ4 A;  3BZC A;  1XPR A;  2A1A A;  3E0E A;  4DV6 L;  1Q7Y C;  2JA7 H;  4JG2 A;  4JI0 L;  2R92 G;  4L5S A;  1YNX A;  3G48 A;  3A0J A;  4LF5 L;  4GS3 A;  3K7A H;  3NEM A;  1RL2 A;  1Y1V H;  5JJL A;  4DV7 L;  2UUC L;  3UE1 A;  1QVG A;  4GKJ L;  1K9M C;  2VL6 A;  4DKA C;  4LF6 Q;  4JBW A;  1EYG A;  4KHZ A;  2NVQ H;  4LFB Q;  4C3I H;  2K14 A;  5JEA J;  2K5H A;  4GKK Q;  1KD1 C;  4P74 A;  5FLM G;  4LFA L;  3S16 H;  3F2C A;  1Q8K A;  2CWA A;  4AH6 A;  4X62 Q;  2NVY H;  3PV0 A;  4JV5 L;  1ASY A;  1YZ6 A;  5IE8 A;  2XTI A;  4QY7 A;  3OYY A;  1HNX Q;  1KRS A;  3KYH C;  4ME3 A;  1UE6 A;  2V1C C;  5LMN Q;  3RLF A;  2VUM H;  2UXD Q;  4QGU A;  4DR5 Q;  2EQS A;  4XTC S;  2ZTC A;  4PZ6 A;  2CKZ B;  5GAG C;  5IP7 G;  1IBM Q;  3M3Y H;  1N32 Q;  4A3C H;  1I3Q H;  2WB1 E;  1YJW A;  1XTD A;  4NXN Q;  5C4X H;  2BH8 A;  3K0X A;  2R7Z H;  2JA6 H;  1K0R A;  3GTO H;  4OX9 Q;  2ATW A;  3ULJ A;  4XIG S;  1Z9F A;  2LXK A;  4LNQ A;  5M5X H;  4DR3 L;  4JI8 Q;  1KXL A;  4X62 L;  2E2J H;  3L2P A;  2K52 A;  5M3M G;  4FDB A;  3KDF B;  3CCJ A;  4TQU S;  3FHW A;  1PH7 A;  3FKI G;  1TXY A;  4H02 A;  3PIP A;  1WYD A;  4A3K G;  1Y1W G;  5LMN L;  2UUB Q;  4B3M L;  1CKN B;  2KHI A;  3HOY G;  4A3E G;  3J80 i;  5IYB H;  4LF8 Q;  2MO0 A;  4C3H H;  3IRB A;  3KDF A;  3NEL A;  5IWA L;  2WFW A;  3U4V A;  5C0X J;  3S1Q H;  3CW2 C;  4JI7 Q;  3GD7 A;  3GDE A;  1CKN A;  5J3B A;  2KCM A;  3CCM A;  1W2B A;  2GN5 A;  1EQR A;  2JA5 H;  1FVI A;  3K80 C;  1I94 L;  4AYB G;  3E9H A;  4OON A;  2HT1 A;  4DPG A;  1IXR A;  2K50 A;  4DV4 L;  4A3L G;  1HZA A;  2ID0 A;  1UE1 A;  1T9H A;  4KI0 A;  1J6Q A;  3G6E A;  2CWP A;  1YJN A;  3ULP A;  2OWO A;  2JA7 G;  4K0K L;  1VQA A;  1HH2 P;  1QVC A;  1IYJ B;  4LUV A;  4X64 Q;  4JI4 Q;  5LMU Q;  4DR7 L;  3DLL A;  1LYL A;  2VS1 A;  1TWF H;  2VW9 A;  2OTL A;  4YHH L;  1TWG H;  2JEB I;  1V43 A;  4A3J H;  1JJC B;  4JI3 Q;  1FJG L;  2NZO A;  2PNH A;  3W1B A;  2CQO A;  4JI7 L;  2E5L L;  4GOP A;  1MIU A;  1X55 A;  2YTV A;  4DV2 Q;  3VDY A;  5JEA G;  3CCL A;  2ASB A;  1KIX A;  5JJI A;  2CFM A;  4P73 A;  3PIO A;  4DV3 L;  3D31 A;  4JBM A;  5AJ3 L;  4GNX B;  2Q2U A;  3J81 c;  1R9T H;  4JI5 Q;  1A62 A;  4HJ7 A;  4DR6 L;  4L5Q A;  3CP0 A;  3HKZ G;  3PO3 H;  1QZH A;  2NN6 I;  2UU9 L;  1PVO A;  1XNQ Q;  2RCN A;  1V9P A;  2QA4 A;  1UWV A;  1EIY B;  1OXU A;  4GNX A;  4IFD J;  4DV1 L;  3F8T A;  4PZ7 A;  1NBW A;  3TRE A;  4EQ5 A;  4DUY Q;  4A3C G;  4OO1 I;  4R1J A;  1G29 1;  1VQL A;  1VQN A;  5C4X G;  4JI3 L;  3CXC A;  1VQ4 A;  1TWH H;  2IX1 A;  1VQI A;  2R7Z G;  3B6Y A;  4JYA Q;  1HNW L;  4IJH A;  4QQB X;  1G51 A;  3EBE A;  2R7D A;  4DAM A;  1N34 Q;  3GTJ H;  2Y0S E;  1SLJ A;  3JAM c;  3HKS A;  2KBN A;  1XNR Q;  4B3T L;  2AHO B;  1VQ9 A;  1HNZ L;  1J5E L;  4EX5 A;  1PH5 A;  4LW1 A;  4DUY L;  1X3E A;  3RLO A;  4R4O A;  5C44 H;  3T1H L;  1Q12 A;  3CME A;  4TVA B;  2IY5 B;  2RHS B;  5IYC H;  5C0X G;  1PH9 A;  3I4N G;  1WJJ A;  2OQ0 A;  3RLN A;  1SMX A;  4HJ5 A;  4DK3 C;  1M90 C;  3TS2 A;  1KHI A;  2N78 A;  4R4C A;  4JI2 Q;  3KF6 A;  3T1Y Q;  4LF4 L;  3GTG H;  5M5W H;  4HJ9 A;  3RR5 A;  5BR8 Q;  2QEX A;  1E1O A;  4UP8 A;  2D0O A;  4DR1 L;  4DV5 L;  3CC2 A;  4BXX H;  1IZ6 A;  4DUZ L;  1C7Y A;  4B3R Q;  2BH2 A;  2VQE Q;  1X3G A;  2F4V L;  2B3G A;  3FP9 A;  4X66 Q;  1EWI A;  3J7Z C;  4A3D H;  1RIP A;  4A3I H;  1E22 A;  4GLA C;  2IT1 A;  2Z0S A;  3KOJ A;  2IHF A;  3PSI A;  1XMO Q;  1VQ7 A;  1XPU A;  1C9O A;  3J81 j;  2MNA A;  4YWK A;  4A3G H;  3CMA A;  1VQ5 A;  4P71 A;  4LFC L;  4A3F H;  2L15 A;  5C4J H;  1VQH A;  3D0F A;  4B3S L;  3J7A 5;  4BBS H;  1XMQ L;  2Q2H A;  1JJ2 A;  1X3F A;  4NB3 A;  4JI1 Q;  5M5Y H;  2Q2T A;  2B63 G;  1JB7 A;  5H1S E;  3PO3 G;  2BA0 A;  3HOX H;  3CC4 A;  1NTG A;  4JI6 Q;  2ZJQ A;  2NZH A;  1JE5 A;  1PFS A;  4DR2 Q;  3NBH B;  1SN8 A;  4IFD G;  3A5Z B;  3RNU A;  2JEA I;  1VCI A;  3CPF A;  5FJ8 G;  4LF7 Q;  2N3S A;  4BBR H;  1EUJ A;  2K5V A;  5GAE C;  5HY6 A;  1QUQ B;  4RG1 A;  3LGJ A;  3G4S A;  1GO3 E;  2AWO A;  4AQY Q;  4LF6 L;  4IOA A;  1S40 A;  1HR0 W;  3CCV A;  2DUD A;  2FXQ A;  1TWA H;  3I2Z A;  4JCV E;  4JOI C;  1YVC A;  4R4Q A;  4GKK L;  1K8A C;  1WCM G;  4HIM A;  2JA9 A;  1SRO A;  3GTL H;  2QGQ A;  1AE2 A;  1QUQ A;  4LF7 L;  1PH8 A;  2GVB A;  2R93 H;  1YBY A;  2HQL A;  1Q82 C;  2H5X A;  1X65 A;  4GLV B;  4YWM A;  5C3E H;  4HIK A;  2MO1 A;  2KEN A;  4DV0 Q;  1VQO A;  1IBK Q;  1HNX L;  1AE3 A;  1VQK A;  2NVT H;  2XGT A;  3F1Z A;  3PF5 A;  5GQO A;  4APV A;  2UXD L;  4GN4 B;  4DR5 L;  5E7N A;  1MKH A;  2EIF A;  5C44 G;  3TS0 A;  1IBM L;  1N32 L;  3CC7 A;  4NXN L;  4R4I A;  3CCR A;  3L7Z C;  2ZM6 Q;  2AWN A;  1U5K A;  2VQF Q;  1PH6 A;  3HOZ G;  4A3B H;  5M3F H;  1PH4 A;  1VQC A;  1X54 A;  4MZ9 A;  3CCQ A;  1K8G A;  4OX9 L;  2UXC Q;  1KL9 A;  3AQQ A;  2K4K A;  4KLK A;  4YY3 Q;  4JI8 L;  1OTC A;  4MTN A;  4A3M H;  2LXJ A;  3KJO A;  1JMC A;  3Q8D A;  3H3V I;  1A0I A;  3JC6 6;  2UUA Q;  3ZJY C;  4A4I A;  1Y1V G;  2UUB L;  2IX0 A;  4GOP B;  3PO2 H;  1L1O B;  1P8L A;  4J15 A;  3UDG A;  4LF8 L;  1X6O A;  3SGI A;  3I55 A;  3H0G H;  3GTM H;  2IHE A;  2MQH A;  2D62 A;  3PUY A;  3OW2 A;  3RN2 A;  1NMF A;  4A3F G;  4LF9 Q;  2R6G A;  4A75 A;  4POF A;  1GVP A;  1L1O A;  2K75 A;  4BBS G;  1W3S A;  4X6A H;  4P75 A;  1MJE A;  4WJ3 M;  1OXX K;  4JBK A;  1PA6 A;  4A93 H;  3UDX A;  2OCE A;  1N33 Q;  3HOX G;  2JA8 H;  4LUZ A;  2KHJ A;  3M4P A;  2WAQ G;  3RN5 A;  3MXN B;  4X64 L;  2CCZ A;  1CUK A;  4JI4 L;  2R92 H;  5LMU L;  3BU2 A;  4GNX C;  4BY7 H;  2VUM G;  1PYB A;  5K36 G;  4LUO A;  4IPC A;  4AIM A;  4O2D A;  5IYD G;  1OXT A;  4A76 A;  5IY0 A;  5LMN W;  3U58 A;  4Y7N H;  3S2H H;  1N9W A;  4X65 Q;  2HHH Q;  4BBR G;  1KAW A;  4YWL A;  1OXS C;  1BVS A;  1CSQ A;  1K3R A;  1Q1E A;  1YHA A;  1N36 Q;  5C0X I;  4L5R C;  2JA6 G;  4DV2 L;  3M4Q A;  2Z6K A;  1EOV A;  1X56 A;  3M7N A;  4DAY B;  5FLM H;  2UXB Q;  1D7Q A;  1E3P A;  1B70 B;  2WB1 G;  3MEF A;  5GAH C;  4JI5 L;  3HOU H;  3I4O A;  5C3E G;  3G71 A;  1GM5 A;  5IT9 c;  1WFQ A;  4UP9 A;  3S1M H;  1X9N A;  1XNQ L;  3UE0 A;  3ICE A;  4GN5 A;  4PMW A;  1PHJ A;  2KCT A;  5IYB G;  4GLX A;  2I0Q A;  1IBL Q;  4UY8 C;  3KF6 B;  5IP7 H;  1VQB A;  4QIW E;  3M85 A;  1D8L A;  3CQZ H;  1GD7 A;  3AEV A;  4QJF A;  2PQA A;  2I5L X;  2JA5 G;  1YIT A;  4HJA A;  2R7F A;  4IPH A;  4NXM Q;  3UDI A;  2JE6 I;  4JYA L;  1I6H H;  3GO5 A;  3OTO Q;  1SFO H;  1Z47 A;  1KQS A;  2PI2 E;  3U50 C;  1S72 A;  2UXB L;  1O7I A;  1P16 A;  3I7F A;  4P72 A;  5DLQ E;  2F52 A;  1N34 L;  1IL2 A;  4DV6 Q;  3TRZ A;  3PCO B;  2EXD A;  1Q86 C;  3K8A A;  2NN6 G;  4LWC A;  4JI0 Q;  1Q1B A;  1XNR L;  1G6P A;  3E9I A;  4LF5 Q;  2WP8 J;  3PGZ A;  4AYB E;  4A3K H;  1Y1W H;  4OO1 G;  3AFQ A;  2DGY A;  3W1G A;  4DV7 Q;  4HIO A;  4L5T A;  4IOC A;  2UUC Q;  4BY1 H;  3STB C;  4HID A;  3L0O A;  4A3E H;  3HOY H;  1OXV A;  3CPW A;  3CCE A;  2HIV A;  4A3J G;  4OWW B;  3S1N H;  1PH3 A;  3H0G G;  3KLW A;  1NJI C;  1VQD A;  4HJ8 A;  1B7Y B;  1PH1 A;  4PG3 A;  3M4O H;  2AMC B;  3S1R H;  3PUZ A;  4OXP A;  5IP9 H;  4LFA Q;  4JI2 L;  5ELO A;  3T1Y L;  1HZ9 A;  4A3D G;  5BR8 L;  2N8N A;  4YCV A;  4O0A A;  4A3L H;  1C0A A;  3TQY A;  2ALY B;  2JA8 G;  1XPO A;  4B3R L;  1PH2 A;  4BY7 G;  2HIX A;  2VQE L;  3S24 A;  2ES2 A;  4RMF A;  3RZO H;  2F3I A;  2E2I H;  4X66 L;  4UP7 A;  1VQF A;  2GVA A;  4IPG A;  3GTK H;  3HOV H;  2YYZ A;  1QVF A;  3K7U C;  1XMO L;  1ASZ A;  5EAY A;  3CD6 A;  3STB D;  4JC0 A;  3S15 H;  4ALP A;  3I4M H;  3HKZ E;  2WAQ E;  1E1T A;  4KHP Q;  3ERS X;  1LTL A;  4DNI A;  1Q81 C;  3GTP H;  4Y52 H;  1L0W A;  4DR3 Q;  4C2M H;  2A19 A;  2E8G A;  3HOU G;  3ULL A;  4JI1 L;  1VQP A;  3H3V H;  1VQE A;  1H95 A;  1V1Q A;  2YV5 A;  4B3M Q;  3M9B A;  2JJQ A;  2VNU D;  3KF8 B;  4JI6 L;  4JBJ A;  3U4Z A;  1KC8 C;  4YCW A;  1CSP A;  4DR2 L;  2PMZ E;  1UEB A;  3PUX A;  1E24 A;  1EQQ A;  3KFU A;  2C35 B;  2N49 A;  5IWA Q;  3NEN A;  2Y0S G;  1JJG A;  5IYC G;  3CAM A;  1CKO A;  4IJL A;  1BBW A;  1K73 C;  4OWT B;  5GAD C;  3BZK A;  4OWX B;  2Q2I A;  4AQY L;  4LFB L;  1I94 Q;  4POG A;  4KHP L;  1Q46 A;  1S3O A;  2AKW B;  4DV4 Q;  3RZD H;  4JOI A;  1M1K C;  3EIV A;  3EN2 A;  3AYH B;  3UDF A;  1YHQ A;  4BXX G;  1FL0 A;  2VZA A;  4PZ8 A;  1CKM A;  1PV4 A;  3HFZ B;  4K0K Q;  2OTJ A;  3PUW A;  4DR7 Q;  4MNO A;  3CF5 A;  1FGU A;  3WWV A;  1NMG A;  3KJP A;  4DV0 L;  4A3I G;  1IBK L;  3PF4 A;  4DR4 Q;  4YHH Q;  4BY1 G;  1AH9 A;  2BA1 A;  1E7Z A;  4R4T A;  2VY3 A;  2RHQ B;  1JT8 A;  1FJG Q;  4A3G G;  1QZG A;  3J81 i;  2E5L Q;  3I4N H;  4GOP C;  5IP9 G;  5ELN A;  1L1O C;  4NPS A;  2ZM6 L;  3J80 c;  2VQF L;  4GKJ Q;  3H15 A;  2D0P A;  4DV3 Q;  3GTQ H;  5AJ3 Q;  2UXC L;  3HOW H;  1VQ6 A;  1I5F A;  4GN3 B;  3W5O A;  4DR6 Q;  4YY3 L;  1LM0 A;  2UU9 Q;  3S14 H;  2ZTE A;  2K5N A;  4BA1 I;  3F2D A;  1EFW A;  2YTX A;  4C3J H;  5HGQ A;  4DR4 L;  1PYS B;  2UUA L;  3HOV G;  4DV1 Q;  4IO9 A;  1YJ9 A;  2I5H A;  1N8R C;  2PI2 A;  3S2D H;  3BJU A;  3I4M G;  3TEH B;  1K83 H;  4LF9 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...