4A93G

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a93G01
1QVCA 4DV6Q 1YITA 2KCTA 5C0XJ 1S72A 3J80i 1IBLL 2R7FA 4IPCA 4BBRH 1EYGA 1TXYA 3S17H 4GKJL 1KXLA 4OWXB 1K73C 4B3RQ 3GD7A 4QL5A 3HOZH 2A1AA 2HIVA 4X65Q 2OCEA 1SRUA 5IYDH 2NZHA 3CMEA 3K7AH 1V43A 5FLXc 3PIOA 3KF6B 5ELNA 4UP8A 1GVPA 4GOPC 1OXSC 3AYHB 1VQOA 1T9HA 1W3SA 3J81i 3CPWA 4GOPA 4A3DH 1NTGA 3I4NH 4P72A 4A3MH 1VQ6A 4QGUA 1N32Q 4NXNQ 1H95A 4DR1Q 4OO1I 1IBKL 3M9BA 5LMNQ 4DR3L 4DR5Q 4GKJQ 1HNZQ 3B6YA 4R4QA 4KHPQ 1X56A 3HOXG 3PO3G 4A3LG 4LF9L 4P75A 3TRZA 2N49A 1YHAA 1Y1VH 2AWNA 4DK6C 4X65L 1OXUA 2K52A 3H0GG 3CCLA 2EIFA 4BBSG 1RIPA 5IP7G 1B70B 1TWFH 4LWCA 2C35B 3CQZH 2BH8A 3JAMi 1UE5A 2JEAI 1WYDA 4DPGA 2OQKA 3PCOB 1GKHA 1VQ7A 2R93H 2CQOA 2RCNA 3HOYG 2AKWB 3M7NA 2PQAA 4O0AA 1QZHA 2R93G 4A3IG 2R6GA 1JMCA 5FJ8G 1QVGA 3HKSA 3PUXA 4DUYQ 4AH6A 3HOZG 2BA0A 4L5SA 4AYBE 2BA1A 1J5EQ 3NBHB 5BR8L 4HJ9A 1TWHH 4GNXB 1G51A 4LF7Q 2XTIA 1N34Q 2F52A 1PH7A 3TS2A 4PZ6A 4OX9L 3J81c 4JI1L 2Q2TA 1TWCH 3BU2A 1YJNA 1K0RA 3MXNB 2OTJA 3NENA 1Q86C 3S14H 3CC7A 2YU9H 3S15H 1VQ5A 5M3MG 3H15A 1G6PA 2F3IA 4UPAA 4DUZQ 4IFDJ 2YYZA 2UUCL 3TEHB 3G71A 2E2HH 4DV5Q 2HIXA 4HJAA 4DK3C 1WJJA 3K8AA 4DR7L 1FVIA 1VQKA 1PH3A 2UXDQ 1SN8A 4UY8C 1HH2P 2NVQH 4A4IA 4B3SQ 4LFAL 1SFOH 1MKHA 4DUYL 4DV0L 4GNXA 3CCSA 3A5UA 1XJVA 1XPRA 4LUZA 4HIMA 3KFUA 1B7YB 1HZAA 4DR4L 1IZ6A 3TREA 1MJCA 3J81j 3PF4A 2MNAA 5AJ3L 3GTPH 3M4OH 5IT9c 4OX9Q 1Q82C 1M1KC 1HZCA 2GN5A 3FKIG 1YZ6A 4A3JG 2JA5H 3S2HH 5IE8A 2E2JH 2RF4A 5J3BA 1VQ4A 4DV6L 4JI8L 4KHZA 5IYBH 5C4XH 4A3IH 2VS1A 2ES2A 4IFDI 1N32L 2NVYH 2JA6H 2R7DA 3PGZA 1K9MC 1U5KA 1SLJA 2VY3A 4DV5L 1Y14B 1SROA 3GTGH 1EQRA 1Z9FA 2GVAA 3KF6A 4AIMA 4DV3Q 2UXDL 3CW2C 2JEBI 1Q1EA 1PV4A 2B3GA 5LMUL 4WJ4A 3CAMA 2Q2IA 1EIFA 1JJ2A 3F2CA 2ATWA 1EWIA 1EUJA 5GAGC 1HR0W 1Z47A 4JCVE 3GTQH 3I4MH 3S1RH 4A3KH 3L7ZC 4POGA 3HOYH 4X66L 2ZM6L 3UE1A 1VQHA 2VUMH 2CWAA 4P74A 3F2DA 4JV5L 2K4KA 1CKNB 3JC66 4YWKA 4JI4L 5HGQA 2NZOA 3A74A 4YCUA 1XMOL 1IBMQ 5DLQE 4JI8Q 2VQEL 2F4VL 4Y52H 3A0JA 1OXTA 4HJ5A 4JI7L 3CPFA 1TWGH 5HY6A 3RLFA 2OWOA 4KHPL 4A3MG 2JE6I 1IBLQ 1QUQB 2AWOA 4PZ8A 4EX5A 1CSPA 3E0EA 4L5TA 1NBWA 3KDFB 1PH6A 1KL9A 4DV7Q 4A3LH 4A76A 5LMUQ 4B3RL 4JOIA 4YHHQ 1EQQA 4OXPA 5IYDG 4A75A 1M90C 4R4IA 4KI0A 1A0IA 3RR5A 4LF5L 1XNRL 1YVCA 1K3RA 4JV5Q 1UE1A 3GDEA 3K7UC 4BY7H 4A3DG 3CCRA 5E7NA 5ELOA 1Q1BA 2JJQA 3TQYA 3CCEA 1L0WA 1AE3A 3EN2A 4IJLA 1U0LA 1N36L 2KCMA 4LFBQ 1VS0A 2XGTA 3T1YL 2I5LX 5BR8Q 1QZGA 1VQLA 2JA9A 2JQOA 2K5HA 4DR3Q 4LFCL 4LW1A 4GLAC 2KENA 2E5LQ 3FKIH 4DV7L 1PYSB 1HNZL 1DGSA 1YHBA 3NEMA 3HOXH 4A3KG 4NXMQ 4LF9Q 3HOWG 4L5QA 2MFIA 3I2ZA 2JA8H 2YTYA 4YY3L 2UXBL 4YWLA 2Y0SE 3TS0A 1V1QA 4QIWE 1Q81C 1JT8A 2EXDA 3Q8DA 4XTCS 3IRBA 2HHHQ 4A93H 1XMQQ 1CSQA 1VQEA 4A3EH 2QA4A 1KHIA 2K5VA 4XIGS 2HT1A 2JA6G 3PUZA 4K0KL 4DV0Q 1HNWQ 1W2BA 3HKZG 1FGUA 4BBRG 4LF8Q 4LFBL 4DR2Q 1YBYA 2VZAA 4LF4Q 2KHJA 2VL6A 1OXXK 4LFCQ 2VQFQ 3RZOH 3UDFA 5C44H 2UUBQ 4POFA 3K0XA 1OTCA 2V1CC 2CKZB 3UDIA 3CXCA 3RNUA 1Q12A 4JI1Q 3CMAA 4A3BH 4QY7A 4DV1L 2ZJRA 4X62L 1VQ8A 2K75A 3ERSX 3M4PA 3RLOA 3W1BA 2UXBQ 5C4XG 2Z6KA 3GTMH 4L5RC 2PMZE 3KOJA 2MO1A 1YEZA 4BY7G 1I94Q 1LUZA 1KIXA 2UUCQ 3CCJA 2ZTCA 3GO5A 3SGIA 2DGYA 4K0KQ 3AFQA 3CCQA 4LF8L 3AFPA 4NB3A 1QUQA 3DLLA 4HJ7A 2UXCQ 3AQQA 3BZKA 4AYBG 4LFAQ 5FJ8H 2NVTH 2H5XA 2VQFL 3MEFA 1QVFA 1X65A 1E7ZA 3ULLA 3KJOA 3BJUA 1PH5A 3G48A 3GTLH 2UU9L 1C7YA 3STBC 3RLNA 4AQYL 1X3FA 4BA2I 3W5OA 4JYAL 3T1HL 1ASZA 2JA8G 1XTDA 1A62A 4JI0L 1FL0A 2Y0SG 4MZ9A 4HIKA 1NE3A 5IWAQ 5JJKA 2N3SA 1L1OB 3LGJA 1LYLA 1I94L 2IX1A 1CKMA 3S16H 4IPHA 1K8AC 3CD6A 1ASYA 3S2DH 1XPUA 1HR0L 4DV3L 1JB7A 2I5MX 1E1OA 2LXJA 4DV4Q 2R92G 4DR6L 1UWVA 1VQMA 4LF6L 4A3FH 3CCUA 4TQUS 4R1JA 3U58A 3HOUH 3I4NG 2IHFA 1XNQQ 2IX0A 4C3JH 2UU9Q 1L1OC 3UE0A 3OW2A 2AHOB 2VUMG 3PIPA 5EAYA 1FJGL 3T1HQ 4GLXA 4GKKQ 4DNIA 4QJFA 1N36Q 3U4ZA 1NMGA 1Q46A 4JI0Q 1C9OA 1YJ9A 2VQEQ 4JI3L 2VW9A 2OQ0A 1PH1A 1V9PA 3EIVA 1UEBA 4Y7NH 2CWPA 4RMFA 5C0XG 2AMCB 1D8LA 2LXKA 2QGQA 5IYCH 1KD1C 3FHWA 1IL2A 4JC0A 5C44G 4A3CG 2KHIA 4LUVA 4OWTB 4HJ8A 2R92H 4R4TA 1WCMH 2OTLA 2A19A 2K5NA 3CC2A 4DR6Q 4C2MH 2WP8J 2I5HA 5FLMG 3PF5A 1WCMG 3F1ZA 1NMFA 1VQDA 4A3BG 1XMQL 3HKZE 4A3JH 2JA5G 2JA7H 1L2FA 4ME3A 3F8TA 5C3EG 1XNRQ 4BXXH 1IXRA 4QQBX 2YV5A 4PMWA 1HNWL 1PHJA 1KQSA 1YIJA 2CCZA 4DR1L 2ID0A 2R7ZG 4GOPB 5LMNL 4DR5L 2Q2UA 1HNXL 4JI3Q 4P71A 4B3TL 3AEVA 4B3ML 2E8GA 1YI2A 4LUOA 5GADC 2VNUD 1X54A 2YTVA 3A5ZB 4OO1G 1JJCB 3ULPA 1PH8A 4GS3A 5IYCG 4JBJA 4JI6Q 2PNHA 1I3QH 1JJGA 1BKBA 4OONA 2WFWA 3UDGA 4DV1Q 1LTLA 2PI2A 2ZJPA 2NVXH 2UUAQ 4NXML 2WAQE 1OXVA 4R4OA 1S3OA 2N8NA 3HOVH 5LMNW 1WFQA 4YY3Q 4J15A 4PG3A 3PUVA 5IP9G 3U50C 1TWAH 1PFSA 1N8RC 4TVAB 1E3PA 1I5FA 2LSSA 2UXCL 3PV0A 1HNXQ 1RL2A 4B3TQ 4JI2Q 3H3VH 2IY5B 4X64L 4A3GG 1SR3A 4DR2L 3I7FA 4PZ7A 1J5EL 1CKNA 2IHEA 1A8VA 3D31A 5GQOA 3RN5A 3D0FA 3GTOH 3PSIA 5JJIA 1N34L 3PO3H 3NELA 4AQYQ 4X66Q 2ZM6Q 1N33L 4IOAA 1L1OA 1KRSA 4DV2L 1E1TA 1SMXA 5IYBG 3I56A 1Y1WH 5GAEC 3GTJH 4JI4Q 1HZBA 1MIUA 3S1QH 3M4QA 1XMOQ 1IBML 2DUDA 3KDFA 4WJ3M 4YCWA 1LM0A 4EQ5A 4A3EG 5JJLA 3J80c 1PH9A 1UE7A 3W1GA 1E24A 1C0AA 2NN6I 5M3FG 3STBD 4IO9A 1HR0Q 2MQHA 3I4OA 4GN3B 3JAMc 4B3SL 3CP0A 1O7IA 2PI2E 5GROA 1EIYB 4LF6Q 2D62A 4JBWA 4YHHL 4A3GH 1BBWA 4X64Q 5K36G 2L15A 3RZDH 1XNQL 1EFWA 1VQFA 4IOCA 2YTXA 2RHSB 2WAQG 3H0GH 4IJHA 1R9TH 3H3VI 3CCVA 4R4CA 1N33Q 4A93G 1B8AA 4GKKL 4MNOA 4NXNL 4DAMA 4A3FG 1WOCA 1X3GA 3L2PA 2D0OA 4JI5L 3OTOL 4KLKA 3S1NH 4IFDG 1G291 3HOVG 4GLVB 1GO3E 2Q2HA 1S40A 1VQNA 1I50H 4P73A 1NJIC 3U4VA 3T1YQ 2HQLA 3M3YH 4GN4B 5IWAL 3EBEA 1PYBA 5JEAG 1KAWA 1GM5A 3G4SA 1A63A 3G6EA 1JE5A 2CFMA 5IP9H 1YHQA 3HOUG 3K80C 4BA1I 2Z6KC 1IYJB 4OWWB 5FLMH 1I6HH 4H02A 3CCMA 3PUYA 1YNXA 1MJEA 1BBUA 1HJPA 2D0PA 5C3EH 1E22A 2HHHL 4BXXG 1YJWA 1VCIA 1J6QA 4HIOA 1PA6A 3KYHC 3M85A 1FJGQ 1CKOA 1EOVA 1VQGA 1Q8KA 3ER0A 2MO0A 1PH4A 4B3MQ 4APVA 3GTKH 3WWVA 3J7A5 1Y1VG 1IBKQ 4DAYB 4LF7L 3BZCA 1KRTA 2UUBL 4IPDA 2B29A 5M5XH 3VDYA 4UP7A 3CF5A 1D7QA 5M3FH 1K8GA 3I4MG 1X3EA 2UUAL 1PVOA 1CUKA 3RN2A 3F2BA 1WI5A 1NY4A 2JA7G 2I0QA 2FXQA 2N78A 3PUWA 3PO2G 5IP7H 4GN5A 3ZJYC 2ZJQA 3ICEA 2WB1G 1HZ9A 1AE2A 1K83H 2JK8A 2RHQB 5C0XI 4LF5Q 1BVSA 1VQCA 4IPGA 3J7ZC 3KJPA 3CC4A 4RG1A 5M3MH 3I55A 1X9NA 1Q7YC 2K14A 2IT1A 4O2DA 3DM3A 4JI2L 4BY1H 4GNXC 4YWMA 2ZTEA 2B63G 2NN6G 2WB1E 5JEAJ 4BY1G 4A3CH 3ULJA 2E2IH 4DKAC 2E5LL 2PQAB 3L0OA 3K81C 4YCVA 4C3HH 4ALPA 4X6AH 4MTNA 1VQAA 1VQ9A 4UP9A 2ASBA 1VQJA 5H1SE 3E9IA 4JI6L 3KF8B 4JYAQ 4NPSA 3FP9A 3OYYA 4HIDA 1P8LA 4LNQA 4JBKA 1VQIA 1P16A 2BH2A 4C3IH 2EQSA 4JOIC 1XPOA 1AH9A 1Y1WG 4DUZL 2QEXA 2KBNA 1N9WA 5M5WH 2A8VA 4LF4L 2B63H 3KLWA 4DR7Q 1VQBA 2GVBA 4BBSH 1VQPA 4DV4L 3HFZB 2R7ZH 2ZTDA 3HOWH 1X55A 1KC8C 2ALYB 2K50A 2Z0SA 3UDXA 4JBMA 5M5YH 1UE6A 4DR4Q 1SE8A 1PH2A 4JG2A 3S24A 5AJ3Q 3OTOQ 5GAHC 5IY0A 4JI5Q 2F4VQ 4DV2Q 1GD7A 4FDBA 3S1MH 4X62Q 3PO2H 4JI7Q 5C4JH 3E9HA 1X6OA
chains in the Genus database with same CATH superfamily
1GXDC 1YITA 1S72A 2A6ED 2NB0A 3J80i 1IBLL 3F8NA 2V4RA 3C46A 3GP7A 3IKJA 3S17H 2BDOA 2FINB 4OWXB 4J1MA 5I4DA 1K73C 4B3RQ 2W6OA 5KFKA 3JRWA 4HAEA 3IL8A 2NZHA 1HFNA 1KJ9A 3MWYW 3K7AH 5FLXc 1E0BA 4B3SH 3K3PA 4Q5VA 5ELNA 4GOPC 1OXSC 3E6ZX 3AYHB 4V190 5IT9E 1T9HA 2K05A 3J81i 1VQOA 5CV5A 3S1MB 1NTGA 4P72A 1N32Q 4RZRA 1KNAA 2X6GA 2EY1A 4X3SA 2NN6H 2HVRA 3M9BA 3GLKA 4ETSA 2EY6A 5JPMC 1HNZQ 3UQ8A 3B6YA 1F9SA 4ECUA 4CDEC 3PO3G 3I91A 4C1NK 1NAPA 4DK6C 4X65L 1WSCA 1OXUA 4IUTA 1ZHQA 1B44D 5M9OA 1EZ1A 1E2ZA 3BDLA 1BXTA 5EWFA 2R7KA 3CHBD 3KF8A 2G9DA 3PCOB 4TQRA 4ECYA 3IN5A 4A3IG 3J7AK 4TV9F 3K0YA 3T51B 4ID6A 1JDBB 4MV8A 3PW0A 4XT3B 1ZXTA 4R8UA 4RB1A 2K5WA 1E2WA 5C3WA 1O7YA 1Y8OB 3MEHA 4GNXB 2R92A 2JA6A 3KLRA 3R5HA 1N34Q 4ZLTF 4PZ6A 4OX9L 1EZ6A 3NE5B 1TWCH 2Q2TA 2OTJA 3SDZA 3NENA 3S2HB 4RNMA 2YU9H 4EQOA 1B04A 3LMLA 3H09A 4IFDJ 4DUZQ 2YYZA 5KFRA 2SDFA 3HOXB 3HB9A 2EYLA 1SEIA 4OHJA 3QB3A 1WJJA 2XCLA 2RKSA 1FVIA 4Q44A 5C4XB 4ZKBB 1STBA 1PRTC 2B2YA 3GV6A 4I4TF 3CCSA 3OHAA 2XN9C 3TREA 3V2TA 3J81j 5DG8A 1C48A 5AJ3L 5IT9c 3ETJA 3FKIG 5TSSA 1YZ6A 4N8FA 1LT4D 5IE8A 1AN7A 4OELB 4Q8FA 2RF4A 2EPBA 1VQ4A 2DNCA 4HR7A 3QZ7A 3OOCA 2YL2A 2VS1A 4ECWA 2JA6H 1GSHA 1X3PA 2R7DA 5I6WA 1N32H 1U5KA 4DV5L 3R2TA 3K59A 4AIMA 2UXDL 1UAPA 3IFDA 1B6RA 5KFQA 2E2HA 4YJ2F 1EIFA 2ATWA 2DIKA 3JAME 4UCUA 4RGNA 2A5HA 1LTID 5EKKA 1I6HH 4X66L 3NXWA 2VUMH 2CWAA 4JV5L 3F2DA 4LF4H 2K4KA 4QW9A 3D6CA 5IGGA 3FVQA 3FMCA 3GIDA 4JI8Q 1V1PA 1IYVA 4RKLA 4A2BA 2F0FA 5HY6A 2OWOA 4QCLA 1CE8A 5KFGA 2VQEH 4EX5A 1N48A 4Q0FA 3E0EA 1NBWA 3KDFB 4WFN3 4A76A 3BJYA 3TN2A 1WTPA 4YHHQ 2XNAC 4RB0A 1EQQA 2FLNA 1XNRH 5IYDG 1ZYRD 2DPJA 3T5KA 2OXPA 5D65A 4KI0A 1UEAB 3G6JB 5KYLA 3EFXD 5GONF 3RR5A 1YVCA 3Q22A 1UE1A 2K32A 2X6LA 1IBMH 5ELOA 3TDQA 2W6NA 3EN2A 3VYTA 1MD2D 1YNND 3K5OA 1N36L 3KLSX 1HNZH 2WKDA 2JA9A 3EJIA 4DR3Q 4GLAC 2E2DC 5M5XB 4DV7L 2O2LD 2VUMB 3V6HA 2Z8LA 3DWPA 4LF9Q 4E4TA 5ELEA 3K6OA 1SYGA 1I4QA 3KXYT 1O78A 1RYRA 1TAEA 4HEDA 4QIWE 1X3QA 3Q8DA 4XXEA 1DOLA 3HRZC 5IGDA 1WTXA 4A3DB 4WJWA 2KOLA 1KHIA 2K5VA 2QDLA 4XIGS 3VR4A 2QA4A 1LTBD 2HT1A 1S5BD 1CQVA 3N52A 3GTJA 2DNEA 1K1QA 3RTXA 4DR2Q 2OLSA 2VZAA 1J9OA 2KHJA 5KFDA 4B9WA 1AZPA 3MFGA 3QR8A 3BDCA 1PTOC 4EGJA 5HURA 5C44H 1TA8A 2W6QA 2JEIA 1A3UA 2BE5D 1XX8A 4JW0A 5KG0A 2F03A 1Q12A 5CBAE 3AB9A 3CMAA 1DV1A 5KFYA 3ERSX 1M8AA 3M4PA 4DV7H 1DM0B 4DL3A 2C2RA 1Y8NB 2W6ZA 2W9BB 1FR3A 1Z2NX 5DNFA 1I94Q 4LF8H 3CCJA 3I70A 2DWCA 1BJTA 2DGYA 4K0KQ 3LNNA 3T13A 1STAA 2F0PA 4RNOA 2UXCQ 3RF2A 1QVFA 1SNQA 3ULLA 1CA5A 2EY5A 2F0JA 1PH5A 2EY2A 3I12A 4JYAL 3RLNA 1PZID 2XCPA 1JOOA 2JA8G 1QILA 3H20A 1D5XC 3NBIA 1C4QA 4JI0L 1VMPA 5KFCA 1NE3A 1L1OB 1BUVT 4RA8A 3K5MA 4J9PA 1CKMA 1M0TA 4CKCA 3GILA 4IPHA 2RBMA 3FDSA 1EOTA 2FMMA 3Q23A 2I5MX 1E1OA 1JB7A 4OX9H 1SNCA 3TP5A 3VA5A 2BQUA 4DR5H 3N40P 3I4LA 4C3JH 4YBZB 3RZDB 5KT2A 2LY7A 2IPKD 3PIPA 4GLXA 1HCZA 1F2YA 4GKKQ 4DNIA 2ZXOA 4QJFA 2HJWA 4JPBW 3VYSA 3U4ZA 3SE7A 2BR0A 2LXKA 4LK1C 1KD1C 1EY0A 4OWTB 2OTLA 3CC2A 4IZ8A 1PTOH 4C5BA 4A3BG 1XMQL 3N41B 4ZI7F 3PW2A 2BQRA 3PZPA 1LT3D 1TR5A 1XNRQ 2R87A 2YV5A 1HNWL 1PHJA 4XYLB 5IGFA 4I55F 2ID0A 2FFKB 1HUNA 2Q2UA 5FLXW 3ETHA 2FPGB 4B3ML 4YIJA 1K0SA 1FJGH 2VNUD 4O4LF 1X54A 1PRTD 2YTVA 3A5ZB 1JJCB 1JWSD 4M9UA 1B3QA 1E4FT 4GS3A 4L8JA 4JI6Q 4RCNA 1JJGA 5M3MB 3RJ0A 2UVUA 2ALZA 3RB4A 1F9QA 4WRDA 1OXVA 4R4OA 3EPIA 2N8NA 1H9SA 3IG0A 4H7BA 5CORA 4YY3Q 5A35A 5L1IA 4J15A 2V9WA 4JI7H 1NUCA 1O80A 2BCOA 3U50C 3K57A 2B2YC 3BYTB 1B1ZA 2CW0C 2FMCA 1I5FA 2LSSA 5CV9A 5EZYF 4JI2Q 1TWAA 3M9MB 4XZ3B 3WO1A 4X64L 5C5JA 4LF9H 3I7FA 1CKNA 1B4OA 3D31A 1EWHA 1LTAD 1KLUD 1PRTF 5GQOA 2W7PA 3GTOH 3PO3H 4AQYQ 4X66Q 5A2QL 4ECZA 1KRSA 4FP5D 2R61A 1WD0A 1HQMC 4J9QA 1DOMA 1HZBA 5DQHA 3A7LA 3KAKA 4IZOA 2PNRC 3OUUA 1LM0A 1TT2A 5JJLA 2I8CA 2XIGA 1UE7A 3W1GA 5D14A 1LO5D 5CR3A 1EYDA 3RMHA 4RU9A 1O7IA 5GROA 1EIYB 4S3SA 4JBWA 4YHHL 1BBWA 3CRLC 1S10A 5FKAC 3RZDH 4NKLA 4O3RA 2WAQG 1QOHA 1LTGD 2JA7A 1N33Q 5EGTA 1CT1D 1Z2PX 2F0QA 4A3FG 2CVRA 5JJZA 5C1OA 5LA6F 1BNCA 1OWTA 4GLVB 1N34H 4P73A 3DEOA 2W71A 3U4VA 2HQLA 3M3YH 4GN4B 5IWAL 2R3ZA 1PYBA 1KAWA 1QNUA 3K5IA 2CFMA 1YHQA 2F1MA 1E2VA 4R8IA 4BA1I 1PZKD 5J2TF 5E4XA 2ATLA 1GGOA 4F7XA 4UCOA 5CV6A 4TRDA 4DV1H 1DIKA 3TZUA 4U673 1E22A 3Q8PB 3KYHC 2L5TA 1CHQD 1ENAA 1KLGD 2ZDGA 1U4MA 1SFOB 1N32L 3ER0A 3GTKH 2MO0A 3G6YA 2B8FA 4APVA 1EY6A 4C2MB 3J7A5 3R5XA 3VYRA 3P75A 5KFHA 5M5XH 1K8GA 4KD4A 1UUPA 1PVOA 2UUAL 1CUKA 2YS6A 3N42B 4O3OA 2UUBH 2I0QA 4DUZH 4RAUC 3PUWA 2B2TC 4ED2A 2JK8A 4LF5Q 3HKZA 4G4KA 1G8ZD 4BY7B 1VQCA 4IPGA 1WCMA 1RTNA 2HD3A 4IURA 2I07B 4C3JG 4QB4A 2K14A 4LH6A 1BQQT 4IFDH 5T1IA 4QMGA 2HQEA 2NN6G 2RCFA 3SVMA 4A3CH 3ULJA 1SAPA 2E5LL 3L0OA 4YCVA 3GTOA 2VOBA 1VQ9A 1VQAA 4B3TH 5C3XA 2HVQA 1MZBA 3KF8B 4JYAQ 3LWUA 4JV1A 4HIDA 2J6TA 2CW0D 4JBKA 5ELDA 1P16A 2BH2A 4C3IH 4DLKA 2AQ3B 3DMUA 3ND9A 4JOIC 2QYZA 1RCVD 5EKIA 4DUZL 2KBNA 3ITPA 4DV4H 2NWGA 5M5WH 2A8VA 1ESRA 3C2PA 2B63H 3KLWA 1VQBA 1VQPA 4X66H 4Q45A 2PO4A 1EY8A 1G2SA 1X55A 2ZTDA 1KC8C 1YNNC 3FPPA 1EHIA 4JBMA 4I65A 3MFIA 3GIJA 1PH2A 5KGUA 3TSSA 2RDIA 5AJ3Q 1FYCA 1IBLH 2F0KA 3S1MH 3M9OB 1QNKA 4U7CA 3I55A 5C5MA 2E2JB 3NWSA 2NU6B 5C0XJ 2R7FA 3F2UA 2WACA 3NP8A 2XRSD 2EYOA 4GKJL 3BABA 4B3RH 1Y1WA 4K2KA 4P2CB 5D3IB 3CQZA 4LMYA 1KDBA 2A1AA 4ZQ3A 1SRUA 5IGCA 1HXYD 3PIOA 2R86A 1TWHB 1PFNA 2VPSA 4UP8A 1GVPA 4HR7B 4GOPA 3I4NH 2YCHA 1VQ6A 3T5LA 4ECXA 4LFCH 4ZK9B 4OO1I 4V0BA 2L9HA 3HOZB 4DR3L 1KEEA 2W6MA 1KBLA 4KJNA 4ECRA 1X56A 3BZDB 2EJGC 5JEAH 3HOXG 3MAQA 4YAKB 4LF9L 4P75A 2N49A 3C1FA 1YHAA 2AWNA 5A2QE 3CCLA 2EIFA 1KJJA 1RIPA 1N33H 1B70B 2QKIC 3SI8A 4DR7H 3JAMi 3Q1KA 2XVSA 5KNCA 3CRKC 3H0GB 4I7ZC 2W6PA 4XYQA 1TWCB 1WYDA 4DPGA 2RA4A 1VQ7A 4PDBA 1B2TA 3M7NA 1PLFA 2AKWB 2R8GA 2PQAA 3TP6A 3FKIA 2D9UA 4BBRB 5BR8H 5KT7A 3PUXA 4UDUC 4AH6A 4DUYQ 2BA0A 4L5SA 4CC6A 3NBHB 1RODA 3J80E 4HJ9A 1TWHH 4ED1A 4LF7Q 1HR0H 1H9KA 4J9RA 2XTIA 5KFTA 2F52A 4OGQC 4X3TA 1PH7A 2FLLA 4C1NI 4EG0A 3BU2A 4ZUJA 1K0RA 3MXNB 4DL6A 2UUCH 3CC7A 2NUCA 2EJFC 3H15A 1G6PA 5LMUH 5HBRB 3TEHB 4NP5A 3GTQA 4JK1C 4MV1A 1U4PA 4NLGA 3VR6A 2NVQH 1AN8A 2P0AA 4EGQA 1XJVA 4ED7A 3VMMA 2BOSA 3KFUA 1B7YB 1HA6A 1C3OA 1UC8A 3Q8SB 4JYAH 3KLSA 5KG5A 2YU9B 1MJCA 3PF4A 1S4ZA 1D1IA 2Q8IB 3GTPH 3M4OH 2YRWA 1M1KC 1HZCA 2N55A 4KHPH 3S2HH 2E2JH 4DXGA 1XMQH 1B9MA 5IYBH 3HOYB 1TQOA 4IFDI 1IL8A 1STYA 4HSPA 2F0NA 1DONA 1EL0A 3EA6A 3PGZA 2EE1A 1K9MC 2VY3A 3GTGH 1Y14B 3KHRA 4DL7A 2CHBD 2GVAA 1XXGA 1XTCD 2HGSA 1PV4A 5KFVA 1T94A 2Q2IA 3CAMA 3PN1A 5L1KA 1KJQA 1EWIA 5GAGC 1TU2B 1HR0W 3RB3A 5HV6A 1Z47A 4C3JB 1ZYRC 4RKBA 3I4MH 3VYUA 3PVXA 2Y0SA 4POGA 4DN4M 3HOYH 4EEQA 1VQHA 1MSGA 4P74A 4LFAH 1GHJA 1M4VA 4DV0H 4N9PA 2KQ3A 3HS0C 4JI4L 1JWMD 3A74A 2IMWP 1OXTA 4F87A 2EXZA 1J8IA 2O5JC 5KNDA 2F4VH 3KUPA 4PZ8A 4L5TA 4A3LH 1VAJA 2UXBH 3RGZA 1V1OA 5DQGA 2R7LA 4G7OC 5LMUQ 4K5VA 3M4IA 4JOIA 3TINA 3Q0AA 1S5FD 3GQBA 4F50A 4DV5H 3QG1A 3SK8A 2QK4A 2O03A 4DV2H 2ICEC 3K7AB 5C6AA 1MBYA 4LF5L 1XNRL 1EZ8A 5DLFA 2ZJTA 4BY7H 1T36A 5I9PA 3CCRA 4MTKA 4QUFA 1SE3A 1S5DD 3I8ZA 1AE3A 5DLGA 3M4OB 4ED6A 1EUDB 1TS3A 1OO9B 4C5CA 4LFBQ 1VS0A 2I5LX 5BR8Q 1QZGA 3WDNA 2JQOA 4OEMB 2KENA 2E5LQ 1W96A 5KT4A 2AGPA 2V58A 4A3KG 1G6ZA 1JKJB 3UFXB 1L2ZA 4K14A 1RJRA 2W9CB 1IKLA 4I7HA 2JEJA 2Z4HA 4YY3L 1JC7A 3L4KA 3QJYA 2IL8A 2Y0SE 1V1QA 1ONLA 1Y8PB 3TS0A 2UXCH 1WH2A 1XMQQ 1AP0A 2D2CC 1VQEA 5EBDA 1KNEA 1GUSA 2NU8B 2JA6G 3H40A 1GSOA 5DAUA 1HNWQ 1W2BA 3HKZG 1FGUA 3P20A 4BBRG 4G7ZC 4LF8Q 1YBYA 1IW7D 4LF4Q 2VL6A 1OXXK 4LFCQ 3URYA 1M6VA 3WNZA 2NYZD 4X62H 2CKZB 2W9AA 2F0UA 2K5DA 4K5XA 4O3QA 3KHLA 3TZDA 4OL7A 1SBBB 2NVTB 4JI1Q 3DF7A 4DL4A 4IQZA 4QWBA 5F9LA 2K75A 2UXBQ 5C4XG 4XDXA 4JI1H 2JSOA 5I9OA 3GTMH 2PMZE 2MO1A 1YEZA 2MJ8A 2EJMA 3T53B 1KIXA 4A3KB 2UUCQ 4KMUC 1S0MA 2IW3A 4YY3H 3AFPA 4NB3A 1QUQA 5KFLA 2FK1A 3BZKA 5FOBB 2NVTH 4LFAQ 4RGOS 2VQFL 4UCRA 3MEFA 2K5QA 1E7ZA 3BJUA 3CVZA 4DUYH 1HA5A 2F0EA 1VMCA 2AUKA 2K6AA 2UU9L 4AQYL 1XYIA 3EVQA 5KFPA 1QB5D 1XTDA 3C3LA 2Y0SG 5JJKA 2FJ2A 4RHRA 5IWAQ 2N3SA 2ASJA 2D5DA 1LYLA 2IX1A 2XGPA 4X3UA 4O2BF 1K8AC 3CD6A 4C3HG 3S2DH 5DGAA 5JQWA 2AGQA 1NSNS 2SOBA 3D3RA 4DV3L 3HEJA 1UNNC 2O4XA 3GIMA 1O7ZA 2E75C 4IAJA 2HHHH 2PW7A 4U68A 2F3WA 3KALA 3TQTA 2AGOA 2IX0A 4KKTA 1TIID 4A3BB 4EBDA 3J80L 2VUMG 2K03A 1EU3A 3OUZA 3T1HQ 4QIWB 1NMGA 1Q46A 5LXTF 1WTVA 1EIHA 3TIGA 2VQEQ 3OWEB 2BDNA 4F4YA 2UUAH 2CWPA 1GLVA 4RMFA 1I50B 1D8LA 1CM9A 4A3CG 1Y1VB 5IYCH 1IL2A 2SEBD 5C44G 1B3AA 2KHIA 4TV8F 2ENBA 3L9AX 1XWEA 5FLXL 4HJ8A 2VUGA 2A19A 3J81L 3VPDA 4DR6Q 2B2VC 1G91A 3V6KA 1PTOF 4C2MH 5FLMG 2I5HA 2R8KA 1BNZA 2PCFB 3F1ZA 2Z1CA 1CFMA 4A3JH 3NSWA 5T1GA 3KAJA 4Y8VB 2R93B 4DR1H 1ZETA 4JV2A 5DGBA 4BXXH 1IXRA 5KRUA 1B9NA 4LH7A 2RSNA 4DNRB 1KQSA 3ZYYX 2BQ3A 2A69D 4DR1L 4BBSB 1IYUA 4DR5L 4JI3Q 4P71A 4HNVA 2VQDA 1YI2A 4LUOA 1JR0D 4O4HF 3ULPA 5IYCG 3K5HA 1I3QH 2L4NA 1BKBA 4OONA 2KSWA 5KG3A 4DV1Q 2ZJPA 2UUAQ 4NXML 1BCPB 2WAQE 1S3OA 3HOVH 1SMYC 5L37A 4XYMB 1IW7C 1LTSD 3S17B 3RD4A 5A2QW 2ZXPA 3PUVA 1PFSA 2RDHA 4TVAB 2NVQB 3PV0A 1HNXQ 1RL2A 4B3TQ 4RB2C 2RGVA 4A3GG 1STEA 2QW7A 3NQTA 2IHEA 1EY9A 1KDCA 4FNFA 2UVWA 3GTGA 1CZWA 2K33A 3I4NB 4IOAA 1L1OA 2NVXB 5FPRA 2IA6A 1SMXA 4IUUA 4KN7C 3T16A 1Y1WH 3RAXA 4JI4Q 5BMVF 4IRCA 1MIUA 3E5NA 1E4EA 1A9XA 4XQNA 4K2LA 4RCOA 4HQ6A 2VB3X 4EQ5A 5JPNC 4J9OA 3GTPA 1A15A 4L1KA 5IT9W 3DWQA 4DK0A 2B39A 1PH9A 1SCUB 1QE6A 4FF3A 1K3BC 4IO9A 2KEEA 1HR0Q 3N44B 5KFAA 4GN3B 4HSVA 2MQHA 2WB1B 3GTOB 3JAMc 1C8CA 2PI2E 4FXDA 1K83B 4LF6Q 2D62A 4A3GH 4IUQA 2XGQA 5K36G 4ODGA 1XNQL 1EFWA 1VQFA 2KECA 1JQYD 4IJHA 3MFHA 3GV3A 2OH2A 5KT3A 1XNQH 4MNOA 3SK5A 4EQNA 4DR3H 3VPBA 5DG7A 1BCPC 2IBKA 1WOCA 3L2PA 5BPFA 1HPCA 2HUGA 5FD6A 4FVMA 4IFDG 5D1OA 1JE4A 1GO3E 1S40A 2WV6D 1NJIC 3MXGA 4J9LA 5IP9H 1SYCA 4O4IF 4Q8EA 1JIHA 3P1HA 3K80C 2AUJD 1I6VC 1V51A 4OWWB 4DAVA 3SK6A 4H44C 4CKBA 2VPQA 3PUYA 1YNXA 3C1EA 2OF1A 1U4RA 3U9TA 3OHXC 1I4RA 1HJPA 1MHWC 2D0PA 5C3EH 1EYCA 1VCIA 1I7LA 4TUYF 4K8JA 3M85A 1FJGQ 1ILQA 3GTKA 5KKNB 1CKOA 1EOVA 1Q8KA 2XSCA 1TWGB 3CQZB 1B33N 1Y1VG 3SHLA 4LF7L 2FLPA 1H9SB 4XX0B 5M3FH 4JI3H 2A6EC 1Q90A 4EGVA 1AZQA 3F2BA 3NUCA 2JEGA 2EYHA 2FXQA 4GC6A 2N78A 1TKWB 3TP7A 5IP7H 4HNUA 3D4WA 4UCSA 5L1LA 5CGKA 2CH4W 2RHQB 3SK4A 5C0XI 2V5AA 1TWFB 1T5EA 3J7ZC 1PTOB 1EUCB 3CC4A 4RAZA 5M3MH 1X9NA 1Q7YC 5LP6F 3OSNA 2RDJA 3X3NA 4DAYA 4BY1H 3SE0A 4GNXC 3M7GA 3H91A 5M5WB 2MUYA 2ZTEA 2B63G 2FPPB 4MA0A 4DL2A 5JEAJ 4AYBA 4BY1G 3GV7B 2FPIB 4ALPA 3K81C 4X6AH 4LF6H 2C2EA 5C3EB 2I87A 1ESFA 3FP9A 5I47A 1P8LA 1IOWA 4MN3A 1DV2A 4J9MA 4NXMH 1TY0A 2A69C 1O7LA 4YAJB 3A56A 1LT6D 5J39A 1BOSA 4YR3A 2F4IA 4RGTA 1VKZA 1NR4A 2PBZA 3BVMA 3G6XA 2RGRA 5C1PA 1SYFA 2R7ZH 2JA5A 3MXNA 2K50A 2ZT9C 4KN4C 4FBUA 1UE6A 4X3KA 1CQJB 3S24A 2B2TA 5GAHC 1SDFA 3PO2H 5C4JH 1D6EC 1QVCA 1S97A 5I2YA 2KCTA 4BBRH 1EYGA 2R7ZB 2A6HC 4QUCA 1GOZA 3J81W 2NUAB 4B3MH 4F8MA 1KXLA 2J9GA 4QL5A 1T3NA 4X65Q 1ET9A 2JA8B 5H80A 3CMEA 4A3IB 3GIIA 5FK9C 1IOVA 1B53A 3KF6B 1RJPA 4FS1A 3I90A 3RBEA 2FP4B 1W3SA 1PYWD 3CPWA 3SEBA 4MHEA 4A3MH 1I6HB 4QGUA 1H95A 2RQXA 4DR1Q 1IBKL 4DR5Q 4HCSA 5DM73 3BQ1A 1WTOA 3OTOH 4JI5H 3FRPB 2YZGA 1IBKH 2F0DA 3T56B 5KFIA 4O3SA 3G6VA 1EYAA 3TRZA 2A68D 4RHSA 1Y1VH 3V96A 2YZMA 2R92B 4MV7A 3PQIA 3H0GG 2K52A 2XD4A 1TWFH 1F9RA 2BH8A 3GTMB 1HUMA 2TSSA 1RHPA 2PW5A 4MV6A 1GKHA 2EDGA 1TS5A 1Q8IA 3OIPA 5EOYA 1F2ZA 1PDQA 4O0AA 1QZHA 2R93G 3R3OA 2YZNA 2J6SA 2L0CA 2R6GA 1JMCA 3KBGA 3OMGA 5FJ8G 1QVGA 3HKSA 4CDDC 2NVYB 3HOZG 3ORRA 2J6UA 4AYBE 1H9RA 3PO2B 4KK7A 5BR8L 3BVGA 5KFWA 1DJRD 3I4MB 4JI1L 3N43B 1YJNA 2AQ2B 1EEFD 1Q86C 3DUZA 4FM9A 4DF7A 3NK9A 2F3IA 4UPAA 1ULZA 5LHY1 5KT6A 2UUCL 3HP3A 2OT2A 3HZXA 2E2HH 3RV3A 4DV5Q 2HIXA 4HJAA 2TMPA 4DK3C 4APMA 3K8AA 4MAMA 5NUCA 1VQKA 1PH3A 2PZTA 2UXDQ 4ED0A 1HH2P 4LJZC 4RUAA 3JAMW 3QOLA 4LFAL 4EEYA 1MKHA 4GNXA 1FGBD 1HZAA 4DR4L 3T5HA 5L1JA 3EPGA 3FMAA 1KJ8A 2R6FA 5AFWA 4R8NA 2MNAA 1BBXC 4LSXA 4OX9Q 3ONAB 1EQVA 2QILA 4LAAA 3TBIB 4C56C 3Q8QB 4A3JG 4KKSA 2GPSA 5KFUA 1R9TA 4DV6L 1EIGA 4JI8L 4KHZA 3JZIA 2CZGA 5DEHA 2NVYH 4FF1A 3M9NB 1SLJA 1TVXA 1SROA 4RAYA 1EQRA 4ED8A 2MPMA 4E6IA 4DV3Q 2CW8A 3TIIA 5EKLA 1SJED 4A3MB 3Q24A 3F2CA 2F0LA 1LABA 1EUJA 1Z2OX 1IKMA 3GIQA 2ASDA 2RVLA 4ULLA 1RF2D 3S1RH 4A3KH 3L7ZC 4EYHB 2ZM6L 3MR5A 5C4HA 5ISRA 1JOQA 1LT5D 2XWBB 3R23A 1CKNB 3OSPA 2M00A 2B2VA 1LTRD 1QG7A 4YCUA 1IBMQ 2F4VL 5DLQE 4CDCC 5KIXA 4ZAIA 2VQEL 4A3EB 4Y52H 4IHJF 4EBEA 4JI7L 3CPFA 1TWGH 2SNMA 4J6HA 4KHPL 1PK8A 4CC5A 1QUQB 4TKOB 2H4OA 2XC9A 3VPCA 1KL9A 4DV7Q 4DFAA 1N56A 2FMAA 4A75A 1M90C 3FKIB 1A0IA 2CQYA 1D2BA 4LFBH 1K3RA 4JV5Q 2XIWA 2WDTA 1VDZA 3GDEA 3VR5A 1V1PB 5E7NA 3MHBA 2Q8TA 3T1YH 3CCEA 4LF5H 4IJLA 4JVZA 3NTIA 4ZYSA 5JH7F 2KCMA 2LFNA 1ENCA 2K5HA 4KKUA 2RDFA 3ORQA 3FKIH 2J4XA 1PYSB 5C0XH 3P7JA 1SYXB 3HOXH 5KFOA 1PFBA 4NXMQ 4YR2A 2EYFA 3HOVB 1GUGA 4FXGC 3GTQB 2MCTA 4YJ3F 2JA8H 5FLXE 4QIWA 4IN3A 1GYFA 3GV8B 1Q81C 1JT8A 2EXDA 1GUOA 4XT1B 4BS9A 1TY2A 2J0TD 3BQ0A 2BE5C 3PUZA 4PMBA 4PV1C 4K0KL 4DV0Q 5C4JB 3TMEA 1B50A 2PMZA 2ZDQA 3M4YA 3S9WA 4K0KH 3U9OA 3MWMA 2VUMA 5KFZA 4POFA 4FXKC 1OTCA 4BWSC 3RGXA 1T5XD 3UDIA 3CXCA 4A3BH 1FNWA 4DV1L 2ZJRA 1VQ8A 3RFCA 3RLOA 2KCCA 3HOUB 4QWAA 4WBNF 2Z6KA 1RDPD 4UAIA 1KJIA 4L5RC 3KOJA 1SYEA 4MIUA 3EYYA 1LUZA 4EFBA 3JSNA 1EFID 3E3XA 1STGA 4ZOLF 1S0OA 2CW7A 3SGIA 1VF7A 1S03G 5BN3A 3S2DB 3DLLA 2K01A 5FJ8H 1I4XA 1I3QA 3OPOA 1ZQ7A 1X65A 3KJOA 4N8X1 2DN8A 3G48A 3GTLH 5KYIA 4R7RA 2YRXA 1C7YA 4BA2I 3WO0A 1RKNA 2UVRA 3LWEA 1GSAA 1A3VA 4C3IG 1QJOA 1II3A 5EPKA 1BGWA 2SCUB 3R2IA 3LGJA 5BPHA 2F0MA 1I94L 4ECSA 1KTKA 2B63A 3GTGB 4YR0A 1XPUA 1HR0L 3HXLA 1F2LA 4DV4Q 1W6KA 5LL6X 4HCEA 1UWVA 1VQMA 4LF6L 3RUPA 1UNSA 2WYOA 4TQUS 3U58A 2F0HA 3HOUH 3MTSA 4H13C 4G7HC 1HFGA 2IHFA 1XNQQ 1MSHA 3UE0A 2AHOB 1ZKOA 2SNSA 1CI3M 3GTPB 5EAYA 1WTWA 1FJGL 5KFBA 4JI0Q 1RJTA 2L11A 3BDOA 1PX2A 1C9OA 2FKLA 1YJ9A 4QF4A 4HTHA 2E2IB 2VW9A 1BXRA 2OQ0A 1PH1A 4JI4H 1V9PA 3EIVA 3L3OC 4Y7NH 1GHKA 3KBXA 5JOBA 3E5SA 2IJ0A 2QGQA 3PIP3 4LUVA 3QOJA 2R92H 2K5NA 2WINB 5JVLA 2F0SA 3H4BA 1U9RA 1JX4A 1WCMG 1SNOA 1VBGA 3BA9A 1AW7A 2JYOA 3KK7A 3HKZE 2JA5G 2JA7H 5D1OB 1L2FA 3W2DA 3MWDA 2PN1A 3F8TA 2ASLA 3IFTA 4HYKA 2IX3A 1YIJA 2R7ZG 4GOPB 4PMCA 5LMNL 1F77A 3AEVA 1I4HA 4C5AA 4DU9A 4KY5A 3GTLA 1K8MA 1TWAB 1PH8A 4DAPA 1JLLB 4JBJA 1L0XB 1EWCA 3NQIA 3UDGA 5CA1F 2PI2A 2NVXH 1FNVA 2RSOA 3D4RA 2F3VA 3S1NB 4OIKA 5ELFA 3H6MA 4PG3A 5K2MA 2PZUA 5IP9G 5KG4A 3NPPA 1WR2A 4I50F 1CHPD 3A8JE 5E3FA 2DLNA 2IY5B 3H3VH 4DK1A 2EZVA 1STNA 4PZ7A 5CV7A 1TS2A 1A8VA 1J5EL 3RN5A 5JJIA 3GIKA 3OSOA 3NELA 2ZM6Q 1N33L 3J81E 3AMUA 5IYBG 5EWGA 5GAEC 3PR4A 2A6HD 3S1QH 1MI2A 1IBML 2F0VA 2KA7A 3J7AV 2PYKA 3KDFA 4YCWA 4A3EG 1PXUA 2NTSA 1E24A 4RFBA 2NN6I 3STBD 1WTRA 3I4OA 3PO3B 4OO1H 3MJFA 2KJXA 2PZWA 4QWCA 3NGDA 4B3SL 2FK2A 5IODA 2AQ4A 5KFSA 2VXWA 4X64Q 1SSOA 3GQCA 2NZ1D 2YTXA 3H0GH 3RZOB 1EQTA 4EVOA 1HTLD 2LKVA 4R4CA 3CCVA 3R5FA 1B8AA 5CBEE 2KCNA 2YU9A 1Y69U 2O5IC 1AUXA 3VR3A 5IWAH 2ICIA 1G291 3HOWB 1Y1VA 4AQYH 1ENFA 2Q2HA 5CYUA 1VQNA 1GJXA 1FKAH 4ECQA 1ICWA 1GUNA 4WORA 1ZHSA 1SFOA 3EBEA 5EDWA 1W6JA 1GM5A 5E4WC 3G4SA 4A3JB 1JE5A 4J9SA 4J8QA 3OIQA 3HOUG 5D8DA 5CAEB 1I7NA 1L0YB 3LX0A 2Z6KC 5COYA 1IYJB 1PTOD 1YNJD 4H02A 1K28A 3HGBA 2DPIA 1MJEA 4RH6A 4DV3H 4IUVA 4DR6H 1WD1A 3GTJB 1YJWA 2R8IA 4HIOA 1PA6A 3BYYB 3H94A 4ZQIA 5LYJF 4J9KA 2F0OA 1VQGA 3N6XA 2ZXRA 3OMCA 4JI6H 2G9HD 1IBKQ 2W57A 4KHVA 5LL6b 2UXDH 4ZCKA 1KRTA 1JXLA 2B29A 4B08A 3VDYA 4UP7A 3A8KE 1D7QA 3I4MG 1X3EA 3WOEA 3E9HA 1WI5A 2KHSA 2W9BA 3PO2G 2ZJQA 3ZJYC 3BQ2A 1K1SA 1AE2A 2LS01 3V6JA 1SNDA 3T5JA 1XMOH 1SE2A 5J1ZA 2R8JA 1S5CD 4EBCA 1SJHD 4RG1A 3MR2A 5KG6A 2IT1A 3DM3A 1WTQA 2JP1A 4YWMA 2B8GA 3DWAA 1HNWH 2WB1E 1KAAA 3JAML 5J2UF 1E4EB 4MTNA 4I7AA 1NCVA 4UP9A 3GTMA 1VQJA 3M3YB 2E5LH 3OYYA 3HKZB 4LNQA 2FJZA 1WCMB 2R7MA 4U6PA 2JA6B 2V59A 1SXTA 1Y1WG 5FO7B 4L63B 1EY5A 3K3VA 2M2LA 1N9WA 3RAQA 1Y1WB 3V4SA 2GVBA 5EQ0A 5I2XA 2FB9A 3R8BA 4DV4L 3HFZB 2ZM6H 1D5ZC 2WTFA 1GUTA 2Z0SA 5M5YH 2VA2A 4YQWA 4DR4Q 4JI2H 1LLRD 1ILPA 1SE4A 1J5EH 3OTOQ 1S5ED 4JI5Q 2F4VQ 4DV2Q 1RK6A 1GD7A 4FDBA 3V05A 4X62Q 3HBLA 4JI7Q 3RB0A 4IRDA 4CBVA 4ME6A 4DV6Q 1QCBD 2RDGA 4X65H 3NTKA 4IPCA 1R4QB 2UVVA 1TXYA 2QF7A 2FK3A 2OEOA 1AFPA 1LTTD 4PQXA 1CQFA 3SXHA 3S14B 3GD7A 1AEXA 3HOZH 2HIVA 2OCEA 5IYDH 4MV3A 1V43A 4DXFA 1CA6A 4C3IB 3NWTA 3OWFA 4A3DH 2WAQA 5JUMA 2YYAA 4PWQA 3DHQA 1N36H 4DGZA 5JVG3 4NXNQ 3E0JA 4NW2A 4ABNA 5LMNQ 3Q8RB 1W93A 4NXNH 1SMYD 5BN4A 4GKJQ 5D1PA 5C4ZA 4R4QA 4KHPQ 2YS7A 4NMZA 3J7YW 3MXPA 3BS1A 4A3LG 4DR2H 1JWUD 3C0FB 3NBHA 1TWFA 3GIPA 4BBSG 1JDEA 5IP7G 2W70A 4LWCA 3K58A 1PZJD 2C35B 3CQZH 3EQLC 4ED3A 4XQJA 1HHVA 4Q0YA 3FPUB 1UE5A 1I4GA 1PRTB 2JEAI 2R93H 2OQKA 2XCAA 2CQOA 2RCNA 2A74C 4C3HB 2HVSA 3HOYG 4JI0H 2PVPA 1O75A 3J7AF 2R8HA 1S0NA 3DEPA 4DNTB 2X0SA 5C44B 3T4AC 4ZKCB 5ELCA 2R84A 4J9NA 2BA1A 1J5EQ 3N8DA 4O3PA 1G51A 2JN4A 3TS2A 2A68C 4LF7H 3J81c 2FHTA 2JEFA 4KJOA 3H0GA 3S14H 3S15H 1VQ5A 5M3MG 4M7EA 4WD3A 1A3TA 3G71A 4MA5A 3SR1A 2DY7A 4FS2A 4A2AA 2B2UA 4XQQA 4DR7L 4UCTA 5KG7A 1SN8A 4UY8C 4IWXA 4A4IA 4B3SQ 2NU9B 1SFOH 4DUYL 4DV0L 2E76C 1XPRA 2JXMB 3A5UA 1S68A 4QWEA 4LUZA 3PR5B 4HIMA 4H0LC 3DM1A 4FYDA 1V4YA 5KFEA 2UU9H 1IZ6A 1EYZA 1TS4A 1I4PA 1LACA 2F0GA 1MGSA 1Q82C 1RYSA 2GN5A 5IOCA 4HNTA 2JA5H 4JI8H 3K5LA 2R7ZA 2Y0SB 3KTMA 2B2WC 3QWNA 5J3BA 3OHBA 4DL5A 3A55A 1I94H 3S1RB 5C4XH 4A3IH 2ES2A 3QIAA 3JSLA 3MWEA 1JCKB 2PMZB 5DQIA 2AQ1B 3K5NA 2EYJA 1Z9FA 5JVH3 2GPWA 1HNXH 3KF6A 1ET6A 2JEBI 2Z9HA 1Q1EA 3CW2C 4IALA 2B3GA 3PMFA 5LMUL 4WJ4A 1JJ2A 1KC7A 1JORA 4JCVE 3GTQH 3BG3A 4XYOA 5KFMA 1PFMA 4F88A 5I6YA 3UE1A 4TQSA 3ND8A 5E1FA 4F4XA 3JC66 4C2MA 5G3LD 1DYQA 4YWKA 4FU0A 3UI2A 2NZOA 5HGQA 4EYIB 1XMOL 2NVXA 3A0JA 4HJ5A 4Y7NB 4RUCA 3RLFA 4A3MG 2JE6I 1IBLQ 1DZ1A 1A2TA 2AWOA 4DA2A 1CSPA 3MVVA 1PH6A 1I3QB 2B2UC 5IT9L 4B3RL 4R8UB 4UCVA 3U9SA 4GC7A 2L12A 4OXPA 1CZGA 2R85A 4R4IA 2F0IA 2KUMA 4Z9CB 1K8OA 5F9NA 2K1BA 3PIO3 3K7UC 4A3FB 3Q6SA 4A3DG 3BVZA 5C8YF 1Q1BA 2JJQA 3TQYA 1L0WA 4UFZA 2HDLA 4O2AF 1U0LA 4K5WA 3PW7A 2I80A 2XGTA 3T1YL 4LF4L 4JV5H 1VQLA 3RIZA 5FPOA 5KFFA 4LFCL 4LW1A 3RV4A 5CB4F 1EU4A 2EYMA 1DGSA 1YHBA 2EVBA 3NEMA 1EEID 1HNZL 4QW8A 3MA2B 4YHHH 2E74C 4CKEA 3HOWG 4L5QA 2MFIA 3CKIB 3I2ZA 2YTYA 3A8IE 3HG9A 5CMDA 4J0MA 3A7AB 2UXBL 1Z7TA 1S9FA 1DXMA 4YWLA 1ML0D 2PPBC 1SYDA 1BO0A 3IRBA 4XTCS 2HHHQ 4LMQD 4A93H 1CSQA 1B6SA 1D5MC 4CDFC 4A3EH 3JRXA 3RBDA 4JUZA 4GZYC 4GKJH 1HTPA 2C00A 2X69A 1VF5C 1R4PB 3RB6A 4LFBL 1H9MA 2I46A 2VQFQ 3RZOH 1BDOA 3UDFA 4CJ1B 1R9TB 2UUBQ 5KG1A 3FDTA 1KABA 1WTHA 3I73A 3K0XA 4B9XA 2E2HB 1EY7A 2NBFA 2V1CC 4F4ZA 4A93B 4RWSC 3RNUA 2EOTA 3J80W 2W7OA 4QY7A 2W8KA 4X62L 5FO9B 2FE3A 4IUPA 3W1BA 4RB3C 3BG5A 4ME5A 3I72A 2NTTA 4BY7G 2ZTCA 5M3FB 4O3NA 3GO5A 2GLTA 1STHA 2VQFH 3ERQA 3AFQA 3CCQA 5D3DA 2K28A 4LF8L 2W8LA 1FD7D 4HJ7A 3AQQA 4AYBG 1JOKA 3MC0B 2H5XA 4IRKA 1NR2A 2AU0A 3T1HH 2DJGC 1SYBA 4KY7A 4FF2A 2Q8RE 4RZQA 4HMIA 3STBC 4DR4H 1X3FA 3W5OA 4N9TA 3T1HL 5DG9A 4M8AA 1ASZA 5FD5A 3CU7A 5HGTA 1A62A 2KVMA 1CS0A 1FL0A 2F0WA 3MZ5A 4MZ9A 4HIKA 4OIJA 3RUZA 1RD9D 3OW7A 2IWHA 1U4LA 2P5ZX 3BA8A 3S16H 3Q2OA 1ASYA 2HCCA 3BAAA 2LXJA 2R92G 4FF4A 4DR6L 1TWCA 2R82A 4A3FH 1G2TA 3CCUA 4R1JA 5J22A 3I4NG 4KV6A 5LMNH 1X32A 4HMJA 2UU9Q 1L1OC 5IYZF 3OW2A 3D8GA 2N88A 3G7LA 2VA3A 4A3GB 4RGMA 2C2DA 1N36Q 2R93A 4L6TB 2JA7B 2QEJC 4JI3L 5KX5F 1UEBA 3H3VC 2WKCA 5IGEA 3L4JA 5C0XG 2AMCB 2CQAA 1F2MA 1XDNA 4K6LA 4G57A 3LP8A 4FBTA 1BR9A 5G3LF 3FHWA 4JC0A 4Q43A 4R4TA 1WCMH 1QWYA 3WOFA 4CGYB 2WP8J 4HN7A 3PF5A 2WIIB 2M9VA 1NMFA 1VQDA 5CV8A 4DV6H 4MTEA 2C22A 4ME3A 5C3EG 4QQBX 4PMWA 1KDAA 2CH4A 2CCZA 3VA7A 1HNXL 5ELBA 4B3TL 4R9WA 1I50A 2E8GA 3FEWX 5GADC 4RNNA 3W3AA 5KFXA 4OO1G 3V4ZA 4EQPA 1FNUA 1AUVA 2PNHA 3G8CA 2WFWA 3D6WA 1LTLA 3O13A 4KY6A 1LV9A 4G3IA 4IR1A 5LMNW 1PMRA 1WFQA 1DD2A 1SNPA 5EPJA 3PW5A 3MFYA 5BN5A 4ILWA 1TWAH 1WVLA 1N8RC 2IP4A 1E3PA 3QFFA 2UXCL 2K7VA 3QO2A 2QCPX 3MR3A 2KEDA 1D1KA 1SR3A 4DR2L 1SNMA 1EY4A 5CV4A 3MXUA 1ICFB 3D0FA 3PSIA 1N34L 2XWJB 4CJ0B 2NVYA 5JVDF 4DV2L 1E1TA 3LWBA 1HQRD 4MV9A 3I56A 2B63B 2WE6A 2J7ZA 5C5LA 3GTJH 1GUWA 3M4QA 1XMOQ 1I6UA 2C9OA 2DUDA 2VB2X 4WJ3M 3DXJC 4UHVA 3J80c 1A6XA 1C0AA 2LMCB 4YB8B 3TQ1A 5JAVA 5CA0F 5M3FG 5KFNA 2H1EA 2QDBA 5FO8B 2R7NA 4KTAA 4EFEA 1Z6HA 3CP0A 4IWYA 2L55A 4FO2A 2L15A 4GKKH 1VBHA 3N6RA 4IOCA 2RHSB 3H3VI 1R9TH 2F0TA 2E2IA 4A93G 1Q3LA 2V4QA 3PW4A 4GKKL 5KNBA 3TP8A 4NXNL 4BWGB 4DAMA 4NDXA 3S1QB 1X3GA 5EJWA 2D0OA 4JI5L 3OTOL 4KLKA 3S1NH 3HOVG 4ECTA 1I50H 3GTKB 1CQIB 3T1YQ 4LSAA 1RK5A 2WB1A 5LL6S 1CTMA 3A54A 5JEAG 1A63A 1BCPD 3G6EA 1K83A 2W9CA 2VR1A 2Z4IA 1YNJC 5EWEA 1RJQA 5FLMH 3CCMA 5LOVF 2MP1A 4IUNA 1BBUA 1UC9A 3QZ8A 2G5DA 2GA4B 1E4GT 4BXXG 2ZDHA 2HHHL 1DOKA 3EROA 1BF4A 1J6QA 2C5CA 3GTLB 1IHZA 4ZUIA 4PNYA 4CHTB 1TWHA 4M1UB 1JICA 4B3MQ 1HRJA 1PH4A 3WWVA 1V8QA 1M0WA 2DY8A 4DAYB 2MHVA 5L9XA 3KHGA 3BZCA 2UUBL 4IPDA 3R93A 3CF5A 1BCPF 3RN2A 2M05A 1ZEQX 1NY4A 2JA7G 5T14A 3S15B 4KD3A 3D4DA 2WAQB 4O1NA 5IGBA 5K36H 4GN5A 4ZRZA 3ICEA 2WB1G 1HZ9A 2NU7B 2B2WA 4MV4A 4JV0A 5KT5A 1K83H 5IIFA 4K6DA 2L1BA 1BVSA 2K04A 1NNXA 2DZDA 2XRQD 3KJPA 1TWGA 4O42A 4YP3A 4TSSA 5EPLA 4O2DA 4JI2L 4F4WA 3H4DA 2A73B 3VR2A 4CJ2C 3NHHA 4QWDA 3AU7A 2E2IH 1CK1A 4DKAC 2MGSA 2PQAB 2C28A 4C3HH 4ZHQF 3GV5B 2JA5B 5CC4A 3KHHA 2ASBA 3S16B 5H1SE 2DJFC 5M5YB 3E9IA 1C30A 1H9JA 4JI6L 3MR6A 4NPSA 2YW2A 5KG2A 1F9PA 1VQIA 1JB3A 2EQSA 1XPOA 1DCZA 2V4DA 2Z6BA 1AH9A 4ECVA 2QEXA 5K5PA 5KEEA 3NTHA 5KFJA 4AYBB 4DR7Q 2PQEA 1A2UA 2HCIA 4BBSH 4K8IA 1SEBD 5EBCA 3HOWH 1RTOA 2ALYB 4MTDA 3UDXA 5F2DA 2EYPA 1SE8A 3X3MA 4X64H 5DM63 4JG2A 3IAYA 5IY0A 1M7JA 3I3CA 4IR9A 2HDMA 1X6OA 4BY1B
chains in the Genus database with same CATH topology
1QVCA 4DV6Q 1YITA 2KCTA 5C0XJ 1S72A 3J80i 1IBLL 2R7FA 4IPCA 4BBRH 1EYGA 1TXYA 3S17H 4GKJL 1KXLA 4OWXB 1K73C 4B3RQ 3GD7A 4QL5A 3HOZH 2A1AA 2HIVA 4X65Q 2OCEA 1SRUA 5IYDH 2NZHA 3CMEA 3K7AH 1V43A 5FLXc 3PIOA 3KF6B 5ELNA 4UP8A 1GVPA 4GOPC 1OXSC 3AYHB 1VQOA 1T9HA 1W3SA 3J81i 3CPWA 4GOPA 4A3DH 1NTGA 3I4NH 4P72A 4A3MH 1VQ6A 4QGUA 1N32Q 4NXNQ 1H95A 4DR1Q 4OO1I 1IBKL 3M9BA 5LMNQ 4DR3L 4DR5Q 4GKJQ 1HNZQ 3B6YA 4R4QA 4KHPQ 1X56A 3HOXG 3PO3G 4A3LG 4LF9L 4P75A 3TRZA 2N49A 1YHAA 1Y1VH 2AWNA 4DK6C 4X65L 1OXUA 2K52A 3H0GG 3CCLA 2EIFA 4BBSG 1RIPA 5IP7G 1B70B 1TWFH 4LWCA 2C35B 3CQZH 2BH8A 3JAMi 1UE5A 2JEAI 1WYDA 4DPGA 2OQKA 3PCOB 1GKHA 1VQ7A 2R93H 2CQOA 2RCNA 3HOYG 2AKWB 3M7NA 2PQAA 4O0AA 1QZHA 2R93G 4A3IG 2R6GA 1JMCA 5FJ8G 1QVGA 3HKSA 3PUXA 4DUYQ 4AH6A 3HOZG 2BA0A 4L5SA 4AYBE 2BA1A 1J5EQ 3NBHB 5BR8L 4HJ9A 1TWHH 4GNXB 1G51A 4LF7Q 2XTIA 1N34Q 2F52A 1PH7A 3TS2A 4PZ6A 4OX9L 3J81c 4JI1L 2Q2TA 1TWCH 3BU2A 1YJNA 1K0RA 3MXNB 2OTJA 3NENA 1Q86C 3S14H 3CC7A 2YU9H 3S15H 1VQ5A 5M3MG 3H15A 1G6PA 2F3IA 4UPAA 4DUZQ 4IFDJ 2YYZA 2UUCL 3TEHB 3G71A 2E2HH 4DV5Q 2HIXA 4HJAA 4DK3C 1WJJA 3K8AA 4DR7L 1FVIA 1VQKA 1PH3A 2UXDQ 1SN8A 4UY8C 1HH2P 2NVQH 4A4IA 4B3SQ 4LFAL 1SFOH 1MKHA 4DUYL 4DV0L 4GNXA 3CCSA 3A5UA 1XJVA 1XPRA 4LUZA 4HIMA 3KFUA 1B7YB 1HZAA 4DR4L 1IZ6A 3TREA 1MJCA 3J81j 3PF4A 2MNAA 5AJ3L 3GTPH 3M4OH 5IT9c 4OX9Q 1Q82C 1M1KC 1HZCA 2GN5A 3FKIG 1YZ6A 4A3JG 2JA5H 3S2HH 5IE8A 2E2JH 2RF4A 5J3BA 1VQ4A 4DV6L 4JI8L 4KHZA 5IYBH 5C4XH 4A3IH 2VS1A 2ES2A 4IFDI 1N32L 2NVYH 2JA6H 2R7DA 3PGZA 1K9MC 1U5KA 1SLJA 2VY3A 4DV5L 1Y14B 1SROA 3GTGH 1EQRA 1Z9FA 2GVAA 3KF6A 4AIMA 4DV3Q 2UXDL 3CW2C 2JEBI 1Q1EA 1PV4A 2B3GA 5LMUL 4WJ4A 3CAMA 2Q2IA 1EIFA 1JJ2A 3F2CA 2ATWA 1EWIA 1EUJA 5GAGC 1HR0W 1Z47A 4JCVE 3GTQH 3I4MH 3S1RH 4A3KH 3L7ZC 4POGA 3HOYH 4X66L 2ZM6L 3UE1A 1VQHA 2VUMH 2CWAA 4P74A 3F2DA 4JV5L 2K4KA 1CKNB 3JC66 4YWKA 4JI4L 5HGQA 2NZOA 3A74A 4YCUA 1XMOL 1IBMQ 5DLQE 4JI8Q 2VQEL 2F4VL 4Y52H 3A0JA 1OXTA 4HJ5A 4JI7L 3CPFA 1TWGH 5HY6A 3RLFA 2OWOA 4KHPL 4A3MG 2JE6I 1IBLQ 1QUQB 2AWOA 4PZ8A 4EX5A 1CSPA 3E0EA 4L5TA 1NBWA 3KDFB 1PH6A 1KL9A 4DV7Q 4A3LH 4A76A 5LMUQ 4B3RL 4JOIA 4YHHQ 1EQQA 4OXPA 5IYDG 4A75A 1M90C 4R4IA 4KI0A 1A0IA 3RR5A 4LF5L 1XNRL 1YVCA 1K3RA 4JV5Q 1UE1A 3GDEA 3K7UC 4BY7H 4A3DG 3CCRA 5E7NA 5ELOA 1Q1BA 2JJQA 3TQYA 3CCEA 1L0WA 1AE3A 3EN2A 4IJLA 1U0LA 1N36L 2KCMA 4LFBQ 1VS0A 2XGTA 3T1YL 2I5LX 5BR8Q 1QZGA 1VQLA 2JA9A 2JQOA 2K5HA 4DR3Q 4LFCL 4LW1A 4GLAC 2KENA 2E5LQ 3FKIH 4DV7L 1PYSB 1HNZL 1DGSA 1YHBA 3NEMA 3HOXH 4A3KG 4NXMQ 4LF9Q 3HOWG 4L5QA 2MFIA 3I2ZA 2JA8H 2YTYA 4YY3L 2UXBL 4YWLA 2Y0SE 3TS0A 1V1QA 4QIWE 1Q81C 1JT8A 2EXDA 3Q8DA 4XTCS 3IRBA 2HHHQ 4A93H 1XMQQ 1CSQA 1VQEA 4A3EH 2QA4A 1KHIA 2K5VA 4XIGS 2HT1A 2JA6G 3PUZA 4K0KL 4DV0Q 1HNWQ 1W2BA 3HKZG 1FGUA 4BBRG 4LF8Q 4LFBL 4DR2Q 1YBYA 2VZAA 4LF4Q 2KHJA 2VL6A 1OXXK 4LFCQ 2VQFQ 3RZOH 3UDFA 5C44H 2UUBQ 4POFA 3K0XA 1OTCA 2V1CC 2CKZB 3UDIA 3CXCA 3RNUA 1Q12A 4JI1Q 3CMAA 4A3BH 4QY7A 4DV1L 2ZJRA 4X62L 1VQ8A 2K75A 3ERSX 3M4PA 3RLOA 3W1BA 2UXBQ 5C4XG 2Z6KA 3GTMH 4L5RC 2PMZE 3KOJA 2MO1A 1YEZA 4BY7G 1I94Q 1LUZA 1KIXA 2UUCQ 3CCJA 2ZTCA 3GO5A 3SGIA 2DGYA 4K0KQ 3AFQA 3CCQA 4LF8L 3AFPA 4NB3A 1QUQA 3DLLA 4HJ7A 2UXCQ 3AQQA 3BZKA 4AYBG 4LFAQ 5FJ8H 2NVTH 2H5XA 2VQFL 3MEFA 1QVFA 1X65A 1E7ZA 3ULLA 3KJOA 3BJUA 1PH5A 3G48A 3GTLH 2UU9L 1C7YA 3STBC 3RLNA 4AQYL 1X3FA 4BA2I 3W5OA 4JYAL 3T1HL 1ASZA 2JA8G 1XTDA 1A62A 4JI0L 1FL0A 2Y0SG 4MZ9A 4HIKA 1NE3A 5IWAQ 5JJKA 2N3SA 1L1OB 3LGJA 1LYLA 1I94L 2IX1A 1CKMA 3S16H 4IPHA 1K8AC 3CD6A 1ASYA 3S2DH 1XPUA 1HR0L 4DV3L 1JB7A 2I5MX 1E1OA 2LXJA 4DV4Q 2R92G 4DR6L 1UWVA 1VQMA 4LF6L 4A3FH 3CCUA 4TQUS 4R1JA 3U58A 3HOUH 3I4NG 2IHFA 1XNQQ 2IX0A 4C3JH 2UU9Q 1L1OC 3UE0A 3OW2A 2AHOB 2VUMG 3PIPA 5EAYA 1FJGL 3T1HQ 4GLXA 4GKKQ 4DNIA 4QJFA 1N36Q 3U4ZA 1NMGA 1Q46A 4JI0Q 1C9OA 1YJ9A 2VQEQ 4JI3L 2VW9A 2OQ0A 1PH1A 1V9PA 3EIVA 1UEBA 4Y7NH 2CWPA 4RMFA 5C0XG 2AMCB 1D8LA 2LXKA 2QGQA 5IYCH 1KD1C 3FHWA 1IL2A 4JC0A 5C44G 4A3CG 2KHIA 4LUVA 4OWTB 4HJ8A 2R92H 4R4TA 1WCMH 2OTLA 2A19A 2K5NA 3CC2A 4DR6Q 4C2MH 2WP8J 2I5HA 5FLMG 3PF5A 1WCMG 3F1ZA 1NMFA 1VQDA 4A3BG 1XMQL 3HKZE 4A3JH 2JA5G 2JA7H 1L2FA 4ME3A 3F8TA 5C3EG 1XNRQ 4BXXH 1IXRA 4QQBX 2YV5A 4PMWA 1HNWL 1PHJA 1KQSA 1YIJA 2CCZA 4DR1L 2ID0A 2R7ZG 4GOPB 5LMNL 4DR5L 2Q2UA 1HNXL 4JI3Q 4P71A 4B3TL 3AEVA 4B3ML 2E8GA 1YI2A 4LUOA 5GADC 2VNUD 1X54A 2YTVA 3A5ZB 4OO1G 1JJCB 3ULPA 1PH8A 4GS3A 5IYCG 4JBJA 4JI6Q 2PNHA 1I3QH 1JJGA 1BKBA 4OONA 2WFWA 3UDGA 4DV1Q 1LTLA 2PI2A 2ZJPA 2NVXH 2UUAQ 4NXML 2WAQE 1OXVA 4R4OA 1S3OA 2N8NA 3HOVH 5LMNW 1WFQA 4YY3Q 4J15A 4PG3A 3PUVA 5IP9G 3U50C 1TWAH 1PFSA 1N8RC 4TVAB 1E3PA 1I5FA 2LSSA 2UXCL 3PV0A 1HNXQ 1RL2A 4B3TQ 4JI2Q 3H3VH 2IY5B 4X64L 4A3GG 1SR3A 4DR2L 3I7FA 4PZ7A 1J5EL 1CKNA 2IHEA 1A8VA 3D31A 5GQOA 3RN5A 3D0FA 3GTOH 3PSIA 5JJIA 1N34L 3PO3H 3NELA 4AQYQ 4X66Q 2ZM6Q 1N33L 4IOAA 1L1OA 1KRSA 4DV2L 1E1TA 1SMXA 5IYBG 3I56A 1Y1WH 5GAEC 3GTJH 4JI4Q 1HZBA 1MIUA 3S1QH 3M4QA 1XMOQ 1IBML 2DUDA 3KDFA 4WJ3M 4YCWA 1LM0A 4EQ5A 4A3EG 5JJLA 3J80c 1PH9A 1UE7A 3W1GA 1E24A 1C0AA 2NN6I 5M3FG 3STBD 4IO9A 1HR0Q 2MQHA 3I4OA 4GN3B 3JAMc 4B3SL 3CP0A 1O7IA 2PI2E 5GROA 1EIYB 4LF6Q 2D62A 4JBWA 4YHHL 4A3GH 1BBWA 4X64Q 5K36G 2L15A 3RZDH 1XNQL 1EFWA 1VQFA 4IOCA 2YTXA 2RHSB 2WAQG 3H0GH 4IJHA 1R9TH 3H3VI 3CCVA 4R4CA 1N33Q 4A93G 1B8AA 4GKKL 4MNOA 4NXNL 4DAMA 4A3FG 1WOCA 1X3GA 3L2PA 2D0OA 4JI5L 3OTOL 4KLKA 3S1NH 4IFDG 1G291 3HOVG 4GLVB 1GO3E 2Q2HA 1S40A 1VQNA 1I50H 4P73A 1NJIC 3U4VA 3T1YQ 2HQLA 3M3YH 4GN4B 5IWAL 3EBEA 1PYBA 5JEAG 1KAWA 1GM5A 3G4SA 1A63A 3G6EA 1JE5A 2CFMA 5IP9H 1YHQA 3HOUG 3K80C 4BA1I 2Z6KC 1IYJB 4OWWB 5FLMH 1I6HH 4H02A 3CCMA 3PUYA 1YNXA 1MJEA 1BBUA 1HJPA 2D0PA 5C3EH 1E22A 2HHHL 4BXXG 1YJWA 1VCIA 1J6QA 4HIOA 1PA6A 3KYHC 3M85A 1FJGQ 1CKOA 1EOVA 1VQGA 1Q8KA 3ER0A 2MO0A 1PH4A 4B3MQ 4APVA 3GTKH 3WWVA 3J7A5 1Y1VG 1IBKQ 4DAYB 4LF7L 3BZCA 1KRTA 2UUBL 4IPDA 2B29A 5M5XH 3VDYA 4UP7A 3CF5A 1D7QA 5M3FH 1K8GA 3I4MG 1X3EA 2UUAL 1PVOA 1CUKA 3RN2A 3F2BA 1WI5A 1NY4A 2JA7G 2I0QA 2FXQA 2N78A 3PUWA 3PO2G 5IP7H 4GN5A 3ZJYC 2ZJQA 3ICEA 2WB1G 1HZ9A 1AE2A 1K83H 2JK8A 2RHQB 5C0XI 4LF5Q 1BVSA 1VQCA 4IPGA 3J7ZC 3KJPA 3CC4A 4RG1A 5M3MH 3I55A 1X9NA 1Q7YC 2K14A 2IT1A 4O2DA 3DM3A 4JI2L 4BY1H 4GNXC 4YWMA 2ZTEA 2B63G 2NN6G 2WB1E 5JEAJ 4BY1G 4A3CH 3ULJA 2E2IH 4DKAC 2E5LL 2PQAB 3L0OA 3K81C 4YCVA 4C3HH 4ALPA 4X6AH 4MTNA 1VQAA 1VQ9A 4UP9A 2ASBA 1VQJA 5H1SE 3E9IA 4JI6L 3KF8B 4JYAQ 4NPSA 3FP9A 3OYYA 4HIDA 1P8LA 4LNQA 4JBKA 1VQIA 1P16A 2BH2A 4C3IH 2EQSA 4JOIC 1XPOA 1AH9A 1Y1WG 4DUZL 2QEXA 2KBNA 1N9WA 5M5WH 2A8VA 4LF4L 2B63H 3KLWA 4DR7Q 1VQBA 2GVBA 4BBSH 1VQPA 4DV4L 3HFZB 2R7ZH 2ZTDA 3HOWH 1X55A 1KC8C 2ALYB 2K50A 2Z0SA 3UDXA 4JBMA 5M5YH 1UE6A 4DR4Q 1SE8A 1PH2A 4JG2A 3S24A 5AJ3Q 3OTOQ 5GAHC 5IY0A 4JI5Q 2F4VQ 4DV2Q 1GD7A 4FDBA 3S1MH 4X62Q 3PO2H 4JI7Q 5C4JH 3E9HA 1X6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVC A;  4DV6 Q;  1YIT A;  2KCT A;  5C0X J;  1S72 A;  3J80 i;  1IBL L;  2R7F A;  4IPC A;  4BBR H;  1EYG A;  1TXY A;  3S17 H;  4GKJ L;  1KXL A;  4OWX B;  1K73 C;  4B3R Q;  3GD7 A;  4QL5 A;  3HOZ H;  2A1A A;  2HIV A;  4X65 Q;  2OCE A;  1SRU A;  5IYD H;  2NZH A;  3CME A;  3K7A H;  1V43 A;  5FLX c;  3PIO A;  3KF6 B;  5ELN A;  4UP8 A;  1GVP A;  4GOP C;  1OXS C;  3AYH B;  1VQO A;  1T9H A;  1W3S A;  3J81 i;  3CPW A;  4GOP A;  4A3D H;  1NTG A;  3I4N H;  4P72 A;  4A3M H;  1VQ6 A;  4QGU A;  1N32 Q;  4NXN Q;  1H95 A;  4DR1 Q;  4OO1 I;  1IBK L;  3M9B A;  5LMN Q;  4DR3 L;  4DR5 Q;  4GKJ Q;  1HNZ Q;  3B6Y A;  4R4Q A;  4KHP Q;  1X56 A;  3HOX G;  3PO3 G;  4A3L G;  4LF9 L;  4P75 A;  3TRZ A;  2N49 A;  1YHA A;  1Y1V H;  2AWN A;  4DK6 C;  4X65 L;  1OXU A;  2K52 A;  3H0G G;  3CCL A;  2EIF A;  4BBS G;  1RIP A;  5IP7 G;  1B70 B;  1TWF H;  4LWC A;  2C35 B;  3CQZ H;  2BH8 A;  3JAM i;  1UE5 A;  2JEA I;  1WYD A;  4DPG A;  2OQK A;  3PCO B;  1GKH A;  1VQ7 A;  2R93 H;  2CQO A;  2RCN A;  3HOY G;  2AKW B;  3M7N A;  2PQA A;  4O0A A;  1QZH A;  2R93 G;  4A3I G;  2R6G A;  1JMC A;  5FJ8 G;  1QVG A;  3HKS A;  3PUX A;  4DUY Q;  4AH6 A;  3HOZ G;  2BA0 A;  4L5S A;  4AYB E;  2BA1 A;  1J5E Q;  3NBH B;  5BR8 L;  4HJ9 A;  1TWH H;  4GNX B;  1G51 A;  4LF7 Q;  2XTI A;  1N34 Q;  2F52 A;  1PH7 A;  3TS2 A;  4PZ6 A;  4OX9 L;  3J81 c;  4JI1 L;  2Q2T A;  1TWC H;  3BU2 A;  1YJN A;  1K0R A;  3MXN B;  2OTJ A;  3NEN A;  1Q86 C;  3S14 H;  3CC7 A;  2YU9 H;  3S15 H;  1VQ5 A;  5M3M G;  3H15 A;  1G6P A;  2F3I A;  4UPA A;  4DUZ Q;  4IFD J;  2YYZ A;  2UUC L;  3TEH B;  3G71 A;  2E2H H;  4DV5 Q;  2HIX A;  4HJA A;  4DK3 C;  1WJJ A;  3K8A A;  4DR7 L;  1FVI A;  1VQK A;  1PH3 A;  2UXD Q;  1SN8 A;  4UY8 C;  1HH2 P;  2NVQ H;  4A4I A;  4B3S Q;  4LFA L;  1SFO H;  1MKH A;  4DUY L;  4DV0 L;  4GNX A;  3CCS A;  3A5U A;  1XJV A;  1XPR A;  4LUZ A;  4HIM A;  3KFU A;  1B7Y B;  1HZA A;  4DR4 L;  1IZ6 A;  3TRE A;  1MJC A;  3J81 j;  3PF4 A;  2MNA A;  5AJ3 L;  3GTP H;  3M4O H;  5IT9 c;  4OX9 Q;  1Q82 C;  1M1K C;  1HZC A;  2GN5 A;  3FKI G;  1YZ6 A;  4A3J G;  2JA5 H;  3S2H H;  5IE8 A;  2E2J H;  2RF4 A;  5J3B A;  1VQ4 A;  4DV6 L;  4JI8 L;  4KHZ A;  5IYB H;  5C4X H;  4A3I H;  2VS1 A;  2ES2 A;  4IFD I;  1N32 L;  2NVY H;  2JA6 H;  2R7D A;  3PGZ A;  1K9M C;  1U5K A;  1SLJ A;  2VY3 A;  4DV5 L;  1Y14 B;  1SRO A;  3GTG H;  1EQR A;  1Z9F A;  2GVA A;  3KF6 A;  4AIM A;  4DV3 Q;  2UXD L;  3CW2 C;  2JEB I;  1Q1E A;  1PV4 A;  2B3G A;  5LMU L;  4WJ4 A;  3CAM A;  2Q2I A;  1EIF A;  1JJ2 A;  3F2C A;  2ATW A;  1EWI A;  1EUJ A;  5GAG C;  1HR0 W;  1Z47 A;  4JCV E;  3GTQ H;  3I4M H;  3S1R H;  4A3K H;  3L7Z C;  4POG A;  3HOY H;  4X66 L;  2ZM6 L;  3UE1 A;  1VQH A;  2VUM H;  2CWA A;  4P74 A;  3F2D A;  4JV5 L;  2K4K A;  1CKN B;  3JC6 6;  4YWK A;  4JI4 L;  5HGQ A;  2NZO A;  3A74 A;  4YCU A;  1XMO L;  1IBM Q;  5DLQ E;  4JI8 Q;  2VQE L;  2F4V L;  4Y52 H;  3A0J A;  1OXT A;  4HJ5 A;  4JI7 L;  3CPF A;  1TWG H;  5HY6 A;  3RLF A;  2OWO A;  4KHP L;  4A3M G;  2JE6 I;  1IBL Q;  1QUQ B;  2AWO A;  4PZ8 A;  4EX5 A;  1CSP A;  3E0E A;  4L5T A;  1NBW A;  3KDF B;  1PH6 A;  1KL9 A;  4DV7 Q;  4A3L H;  4A76 A;  5LMU Q;  4B3R L;  4JOI A;  4YHH Q;  1EQQ A;  4OXP A;  5IYD G;  4A75 A;  1M90 C;  4R4I A;  4KI0 A;  1A0I A;  3RR5 A;  4LF5 L;  1XNR L;  1YVC A;  1K3R A;  4JV5 Q;  1UE1 A;  3GDE A;  3K7U C;  4BY7 H;  4A3D G;  3CCR A;  5E7N A;  5ELO A;  1Q1B A;  2JJQ A;  3TQY A;  3CCE A;  1L0W A;  1AE3 A;  3EN2 A;  4IJL A;  1U0L A;  1N36 L;  2KCM A;  4LFB Q;  1VS0 A;  2XGT A;  3T1Y L;  2I5L X;  5BR8 Q;  1QZG A;  1VQL A;  2JA9 A;  2JQO A;  2K5H A;  4DR3 Q;  4LFC L;  4LW1 A;  4GLA C;  2KEN A;  2E5L Q;  3FKI H;  4DV7 L;  1PYS B;  1HNZ L;  1DGS A;  1YHB A;  3NEM A;  3HOX H;  4A3K G;  4NXM Q;  4LF9 Q;  3HOW G;  4L5Q A;  2MFI A;  3I2Z A;  2JA8 H;  2YTY A;  4YY3 L;  2UXB L;  4YWL A;  2Y0S E;  3TS0 A;  1V1Q A;  4QIW E;  1Q81 C;  1JT8 A;  2EXD A;  3Q8D A;  4XTC S;  3IRB A;  2HHH Q;  4A93 H;  1XMQ Q;  1CSQ A;  1VQE A;  4A3E H;  2QA4 A;  1KHI A;  2K5V A;  4XIG S;  2HT1 A;  2JA6 G;  3PUZ A;  4K0K L;  4DV0 Q;  1HNW Q;  1W2B A;  3HKZ G;  1FGU A;  4BBR G;  4LF8 Q;  4LFB L;  4DR2 Q;  1YBY A;  2VZA A;  4LF4 Q;  2KHJ A;  2VL6 A;  1OXX K;  4LFC Q;  2VQF Q;  3RZO H;  3UDF A;  5C44 H;  2UUB Q;  4POF A;  3K0X A;  1OTC A;  2V1C C;  2CKZ B;  3UDI A;  3CXC A;  3RNU A;  1Q12 A;  4JI1 Q;  3CMA A;  4A3B H;  4QY7 A;  4DV1 L;  2ZJR A;  4X62 L;  1VQ8 A;  2K75 A;  3ERS X;  3M4P A;  3RLO A;  3W1B A;  2UXB Q;  5C4X G;  2Z6K A;  3GTM H;  4L5R C;  2PMZ E;  3KOJ A;  2MO1 A;  1YEZ A;  4BY7 G;  1I94 Q;  1LUZ A;  1KIX A;  2UUC Q;  3CCJ A;  2ZTC A;  3GO5 A;  3SGI A;  2DGY A;  4K0K Q;  3AFQ A;  3CCQ A;  4LF8 L;  3AFP A;  4NB3 A;  1QUQ A;  3DLL A;  4HJ7 A;  2UXC Q;  3AQQ A;  3BZK A;  4AYB G;  4LFA Q;  5FJ8 H;  2NVT H;  2H5X A;  2VQF L;  3MEF A;  1QVF A;  1X65 A;  1E7Z A;  3ULL A;  3KJO A;  3BJU A;  1PH5 A;  3G48 A;  3GTL H;  2UU9 L;  1C7Y A;  3STB C;  3RLN A;  4AQY L;  1X3F A;  4BA2 I;  3W5O A;  4JYA L;  3T1H L;  1ASZ A;  2JA8 G;  1XTD A;  1A62 A;  4JI0 L;  1FL0 A;  2Y0S G;  4MZ9 A;  4HIK A;  1NE3 A;  5IWA Q;  5JJK A;  2N3S A;  1L1O B;  3LGJ A;  1LYL A;  1I94 L;  2IX1 A;  1CKM A;  3S16 H;  4IPH A;  1K8A C;  3CD6 A;  1ASY A;  3S2D H;  1XPU A;  1HR0 L;  4DV3 L;  1JB7 A;  2I5M X;  1E1O A;  2LXJ A;  4DV4 Q;  2R92 G;  4DR6 L;  1UWV A;  1VQM A;  4LF6 L;  4A3F H;  3CCU A;  4TQU S;  4R1J A;  3U58 A;  3HOU H;  3I4N G;  2IHF A;  1XNQ Q;  2IX0 A;  4C3J H;  2UU9 Q;  1L1O C;  3UE0 A;  3OW2 A;  2AHO B;  2VUM G;  3PIP A;  5EAY A;  1FJG L;  3T1H Q;  4GLX A;  4GKK Q;  4DNI A;  4QJF A;  1N36 Q;  3U4Z A;  1NMG A;  1Q46 A;  4JI0 Q;  1C9O A;  1YJ9 A;  2VQE Q;  4JI3 L;  2VW9 A;  2OQ0 A;  1PH1 A;  1V9P A;  3EIV A;  1UEB A;  4Y7N H;  2CWP A;  4RMF A;  5C0X G;  2AMC B;  1D8L A;  2LXK A;  2QGQ A;  5IYC H;  1KD1 C;  3FHW A;  1IL2 A;  4JC0 A;  5C44 G;  4A3C G;  2KHI A;  4LUV A;  4OWT B;  4HJ8 A;  2R92 H;  4R4T A;  1WCM H;  2OTL A;  2A19 A;  2K5N A;  3CC2 A;  4DR6 Q;  4C2M H;  2WP8 J;  2I5H A;  5FLM G;  3PF5 A;  1WCM G;  3F1Z A;  1NMF A;  1VQD A;  4A3B G;  1XMQ L;  3HKZ E;  4A3J H;  2JA5 G;  2JA7 H;  1L2F A;  4ME3 A;  3F8T A;  5C3E G;  1XNR Q;  4BXX H;  1IXR A;  4QQB X;  2YV5 A;  4PMW A;  1HNW L;  1PHJ A;  1KQS A;  1YIJ A;  2CCZ A;  4DR1 L;  2ID0 A;  2R7Z G;  4GOP B;  5LMN L;  4DR5 L;  2Q2U A;  1HNX L;  4JI3 Q;  4P71 A;  4B3T L;  3AEV A;  4B3M L;  2E8G A;  1YI2 A;  4LUO A;  5GAD C;  2VNU D;  1X54 A;  2YTV A;  3A5Z B;  4OO1 G;  1JJC B;  3ULP A;  1PH8 A;  4GS3 A;  5IYC G;  4JBJ A;  4JI6 Q;  2PNH A;  1I3Q H;  1JJG A;  1BKB A;  4OON A;  2WFW A;  3UDG A;  4DV1 Q;  1LTL A;  2PI2 A;  2ZJP A;  2NVX H;  2UUA Q;  4NXM L;  2WAQ E;  1OXV A;  4R4O A;  1S3O A;  2N8N A;  3HOV H;  5LMN W;  1WFQ A;  4YY3 Q;  4J15 A;  4PG3 A;  3PUV A;  5IP9 G;  3U50 C;  1TWA H;  1PFS A;  1N8R C;  4TVA B;  1E3P A;  1I5F A;  2LSS A;  2UXC L;  3PV0 A;  1HNX Q;  1RL2 A;  4B3T Q;  4JI2 Q;  3H3V H;  2IY5 B;  4X64 L;  4A3G G;  1SR3 A;  4DR2 L;  3I7F A;  4PZ7 A;  1J5E L;  1CKN A;  2IHE A;  1A8V A;  3D31 A;  5GQO A;  3RN5 A;  3D0F A;  3GTO H;  3PSI A;  5JJI A;  1N34 L;  3PO3 H;  3NEL A;  4AQY Q;  4X66 Q;  2ZM6 Q;  1N33 L;  4IOA A;  1L1O A;  1KRS A;  4DV2 L;  1E1T A;  1SMX A;  5IYB G;  3I56 A;  1Y1W H;  5GAE C;  3GTJ H;  4JI4 Q;  1HZB A;  1MIU A;  3S1Q H;  3M4Q A;  1XMO Q;  1IBM L;  2DUD A;  3KDF A;  4WJ3 M;  4YCW A;  1LM0 A;  4EQ5 A;  4A3E G;  5JJL A;  3J80 c;  1PH9 A;  1UE7 A;  3W1G A;  1E24 A;  1C0A A;  2NN6 I;  5M3F G;  3STB D;  4IO9 A;  1HR0 Q;  2MQH A;  3I4O A;  4GN3 B;  3JAM c;  4B3S L;  3CP0 A;  1O7I A;  2PI2 E;  5GRO A;  1EIY B;  4LF6 Q;  2D62 A;  4JBW A;  4YHH L;  4A3G H;  1BBW A;  4X64 Q;  5K36 G;  2L15 A;  3RZD H;  1XNQ L;  1EFW A;  1VQF A;  4IOC A;  2YTX A;  2RHS B;  2WAQ G;  3H0G H;  4IJH A;  1R9T H;  3H3V I;  3CCV A;  4R4C A;  1N33 Q;  4A93 G;  1B8A A;  4GKK L;  4MNO A;  4NXN L;  4DAM A;  4A3F G;  1WOC A;  1X3G A;  3L2P A;  2D0O A;  4JI5 L;  3OTO L;  4KLK A;  3S1N H;  4IFD G;  1G29 1;  3HOV G;  4GLV B;  1GO3 E;  2Q2H A;  1S40 A;  1VQN A;  1I50 H;  4P73 A;  1NJI C;  3U4V A;  3T1Y Q;  2HQL A;  3M3Y H;  4GN4 B;  5IWA L;  3EBE A;  1PYB A;  5JEA G;  1KAW A;  1GM5 A;  3G4S A;  1A63 A;  3G6E A;  1JE5 A;  2CFM A;  5IP9 H;  1YHQ A;  3HOU G;  3K80 C;  4BA1 I;  2Z6K C;  1IYJ B;  4OWW B;  5FLM H;  1I6H H;  4H02 A;  3CCM A;  3PUY A;  1YNX A;  1MJE A;  1BBU A;  1HJP A;  2D0P A;  5C3E H;  1E22 A;  2HHH L;  4BXX G;  1YJW A;  1VCI A;  1J6Q A;  4HIO A;  1PA6 A;  3KYH C;  3M85 A;  1FJG Q;  1CKO A;  1EOV A;  1VQG A;  1Q8K A;  3ER0 A;  2MO0 A;  1PH4 A;  4B3M Q;  4APV A;  3GTK H;  3WWV A;  3J7A 5;  1Y1V G;  1IBK Q;  4DAY B;  4LF7 L;  3BZC A;  1KRT A;  2UUB L;  4IPD A;  2B29 A;  5M5X H;  3VDY A;  4UP7 A;  3CF5 A;  1D7Q A;  5M3F H;  1K8G A;  3I4M G;  1X3E A;  2UUA L;  1PVO A;  1CUK A;  3RN2 A;  3F2B A;  1WI5 A;  1NY4 A;  2JA7 G;  2I0Q A;  2FXQ A;  2N78 A;  3PUW A;  3PO2 G;  5IP7 H;  4GN5 A;  3ZJY C;  2ZJQ A;  3ICE A;  2WB1 G;  1HZ9 A;  1AE2 A;  1K83 H;  2JK8 A;  2RHQ B;  5C0X I;  4LF5 Q;  1BVS A;  1VQC A;  4IPG A;  3J7Z C;  3KJP A;  3CC4 A;  4RG1 A;  5M3M H;  3I55 A;  1X9N A;  1Q7Y C;  2K14 A;  2IT1 A;  4O2D A;  3DM3 A;  4JI2 L;  4BY1 H;  4GNX C;  4YWM A;  2ZTE A;  2B63 G;  2NN6 G;  2WB1 E;  5JEA J;  4BY1 G;  4A3C H;  3ULJ A;  2E2I H;  4DKA C;  2E5L L;  2PQA B;  3L0O A;  3K81 C;  4YCV A;  4C3H H;  4ALP A;  4X6A H;  4MTN A;  1VQA A;  1VQ9 A;  4UP9 A;  2ASB A;  1VQJ A;  5H1S E;  3E9I A;  4JI6 L;  3KF8 B;  4JYA Q;  4NPS A;  3FP9 A;  3OYY A;  4HID A;  1P8L A;  4LNQ A;  4JBK A;  1VQI A;  1P16 A;  2BH2 A;  4C3I H;  2EQS A;  4JOI C;  1XPO A;  1AH9 A;  1Y1W G;  4DUZ L;  2QEX A;  2KBN A;  1N9W A;  5M5W H;  2A8V A;  4LF4 L;  2B63 H;  3KLW A;  4DR7 Q;  1VQB A;  2GVB A;  4BBS H;  1VQP A;  4DV4 L;  3HFZ B;  2R7Z H;  2ZTD A;  3HOW H;  1X55 A;  1KC8 C;  2ALY B;  2K50 A;  2Z0S A;  3UDX A;  4JBM A;  5M5Y H;  1UE6 A;  4DR4 Q;  1SE8 A;  1PH2 A;  4JG2 A;  3S24 A;  5AJ3 Q;  3OTO Q;  5GAH C;  5IY0 A;  4JI5 Q;  2F4V Q;  4DV2 Q;  1GD7 A;  4FDB A;  3S1M H;  4X62 Q;  3PO2 H;  4JI7 Q;  5C4J H;  3E9H A;  1X6O A; 
#chains in the Genus database with same CATH topology
 1GXD C;  1YIT A;  1S72 A;  2A6E D;  2NB0 A;  3J80 i;  1IBL L;  3F8N A;  2V4R A;  3C46 A;  3GP7 A;  3IKJ A;  3S17 H;  2BDO A;  2FIN B;  4OWX B;  4J1M A;  5I4D A;  1K73 C;  4B3R Q;  2W6O A;  5KFK A;  3JRW A;  4HAE A;  3IL8 A;  2NZH A;  1HFN A;  1KJ9 A;  3MWY W;  3K7A H;  5FLX c;  1E0B A;  4B3S H;  3K3P A;  4Q5V A;  5ELN A;  4GOP C;  1OXS C;  3E6Z X;  3AYH B;  4V19 0;  5IT9 E;  1T9H A;  2K05 A;  3J81 i;  1VQO A;  5CV5 A;  3S1M B;  1NTG A;  4P72 A;  1N32 Q;  4RZR A;  1KNA A;  2X6G A;  2EY1 A;  4X3S A;  2NN6 H;  2HVR A;  3M9B A;  3GLK A;  4ETS A;  2EY6 A;  5JPM C;  1HNZ Q;  3UQ8 A;  3B6Y A;  1F9S A;  4ECU A;  4CDE C;  3PO3 G;  3I91 A;  4C1N K;  1NAP A;  4DK6 C;  4X65 L;  1WSC A;  1OXU A;  4IUT A;  1ZHQ A;  1B44 D;  5M9O A;  1EZ1 A;  1E2Z A;  3BDL A;  1BXT A;  5EWF A;  2R7K A;  3CHB D;  3KF8 A;  2G9D A;  3PCO B;  4TQR A;  4ECY A;  3IN5 A;  4A3I G;  3J7A K;  4TV9 F;  3K0Y A;  3T51 B;  4ID6 A;  1JDB B;  4MV8 A;  3PW0 A;  4XT3 B;  1ZXT A;  4R8U A;  4RB1 A;  2K5W A;  1E2W A;  5C3W A;  1O7Y A;  1Y8O B;  3MEH A;  4GNX B;  2R92 A;  2JA6 A;  3KLR A;  3R5H A;  1N34 Q;  4ZLT F;  4PZ6 A;  4OX9 L;  1EZ6 A;  3NE5 B;  1TWC H;  2Q2T A;  2OTJ A;  3SDZ A;  3NEN A;  3S2H B;  4RNM A;  2YU9 H;  4EQO A;  1B04 A;  3LML A;  3H09 A;  4IFD J;  4DUZ Q;  2YYZ A;  5KFR A;  2SDF A;  3HOX B;  3HB9 A;  2EYL A;  1SEI A;  4OHJ A;  3QB3 A;  1WJJ A;  2XCL A;  2RKS A;  1FVI A;  4Q44 A;  5C4X B;  4ZKB B;  1STB A;  1PRT C;  2B2Y A;  3GV6 A;  4I4T F;  3CCS A;  3OHA A;  2XN9 C;  3TRE A;  3V2T A;  3J81 j;  5DG8 A;  1C48 A;  5AJ3 L;  5IT9 c;  3ETJ A;  3FKI G;  5TSS A;  1YZ6 A;  4N8F A;  1LT4 D;  5IE8 A;  1AN7 A;  4OEL B;  4Q8F A;  2RF4 A;  2EPB A;  1VQ4 A;  2DNC A;  4HR7 A;  3QZ7 A;  3OOC A;  2YL2 A;  2VS1 A;  4ECW A;  2JA6 H;  1GSH A;  1X3P A;  2R7D A;  5I6W A;  1N32 H;  1U5K A;  4DV5 L;  3R2T A;  3K59 A;  4AIM A;  2UXD L;  1UAP A;  3IFD A;  1B6R A;  5KFQ A;  2E2H A;  4YJ2 F;  1EIF A;  2ATW A;  2DIK A;  3JAM E;  4UCU A;  4RGN A;  2A5H A;  1LTI D;  5EKK A;  1I6H H;  4X66 L;  3NXW A;  2VUM H;  2CWA A;  4JV5 L;  3F2D A;  4LF4 H;  2K4K A;  4QW9 A;  3D6C A;  5IGG A;  3FVQ A;  3FMC A;  3GID A;  4JI8 Q;  1V1P A;  1IYV A;  4RKL A;  4A2B A;  2F0F A;  5HY6 A;  2OWO A;  4QCL A;  1CE8 A;  5KFG A;  2VQE H;  4EX5 A;  1N48 A;  4Q0F A;  3E0E A;  1NBW A;  3KDF B;  4WFN 3;  4A76 A;  3BJY A;  3TN2 A;  1WTP A;  4YHH Q;  2XNA C;  4RB0 A;  1EQQ A;  2FLN A;  1XNR H;  5IYD G;  1ZYR D;  2DPJ A;  3T5K A;  2OXP A;  5D65 A;  4KI0 A;  1UEA B;  3G6J B;  5KYL A;  3EFX D;  5GON F;  3RR5 A;  1YVC A;  3Q22 A;  1UE1 A;  2K32 A;  2X6L A;  1IBM H;  5ELO A;  3TDQ A;  2W6N A;  3EN2 A;  3VYT A;  1MD2 D;  1YNN D;  3K5O A;  1N36 L;  3KLS X;  1HNZ H;  2WKD A;  2JA9 A;  3EJI A;  4DR3 Q;  4GLA C;  2E2D C;  5M5X B;  4DV7 L;  2O2L D;  2VUM B;  3V6H A;  2Z8L A;  3DWP A;  4LF9 Q;  4E4T A;  5ELE A;  3K6O A;  1SYG A;  1I4Q A;  3KXY T;  1O78 A;  1RYR A;  1TAE A;  4HED A;  4QIW E;  1X3Q A;  3Q8D A;  4XXE A;  1DOL A;  3HRZ C;  5IGD A;  1WTX A;  4A3D B;  4WJW A;  2KOL A;  1KHI A;  2K5V A;  2QDL A;  4XIG S;  3VR4 A;  2QA4 A;  1LTB D;  2HT1 A;  1S5B D;  1CQV A;  3N52 A;  3GTJ A;  2DNE A;  1K1Q A;  3RTX A;  4DR2 Q;  2OLS A;  2VZA A;  1J9O A;  2KHJ A;  5KFD A;  4B9W A;  1AZP A;  3MFG A;  3QR8 A;  3BDC A;  1PTO C;  4EGJ A;  5HUR A;  5C44 H;  1TA8 A;  2W6Q A;  2JEI A;  1A3U A;  2BE5 D;  1XX8 A;  4JW0 A;  5KG0 A;  2F03 A;  1Q12 A;  5CBA E;  3AB9 A;  3CMA A;  1DV1 A;  5KFY A;  3ERS X;  1M8A A;  3M4P A;  4DV7 H;  1DM0 B;  4DL3 A;  2C2R A;  1Y8N B;  2W6Z A;  2W9B B;  1FR3 A;  1Z2N X;  5DNF A;  1I94 Q;  4LF8 H;  3CCJ A;  3I70 A;  2DWC A;  1BJT A;  2DGY A;  4K0K Q;  3LNN A;  3T13 A;  1STA A;  2F0P A;  4RNO A;  2UXC Q;  3RF2 A;  1QVF A;  1SNQ A;  3ULL A;  1CA5 A;  2EY5 A;  2F0J A;  1PH5 A;  2EY2 A;  3I12 A;  4JYA L;  3RLN A;  1PZI D;  2XCP A;  1JOO A;  2JA8 G;  1QIL A;  3H20 A;  1D5X C;  3NBI A;  1C4Q A;  4JI0 L;  1VMP A;  5KFC A;  1NE3 A;  1L1O B;  1BUV T;  4RA8 A;  3K5M A;  4J9P A;  1CKM A;  1M0T A;  4CKC A;  3GIL A;  4IPH A;  2RBM A;  3FDS A;  1EOT A;  2FMM A;  3Q23 A;  2I5M X;  1E1O A;  1JB7 A;  4OX9 H;  1SNC A;  3TP5 A;  3VA5 A;  2BQU A;  4DR5 H;  3N40 P;  3I4L A;  4C3J H;  4YBZ B;  3RZD B;  5KT2 A;  2LY7 A;  2IPK D;  3PIP A;  4GLX A;  1HCZ A;  1F2Y A;  4GKK Q;  4DNI A;  2ZXO A;  4QJF A;  2HJW A;  4JPB W;  3VYS A;  3U4Z A;  3SE7 A;  2BR0 A;  2LXK A;  4LK1 C;  1KD1 C;  1EY0 A;  4OWT B;  2OTL A;  3CC2 A;  4IZ8 A;  1PTO H;  4C5B A;  4A3B G;  1XMQ L;  3N41 B;  4ZI7 F;  3PW2 A;  2BQR A;  3PZP A;  1LT3 D;  1TR5 A;  1XNR Q;  2R87 A;  2YV5 A;  1HNW L;  1PHJ A;  4XYL B;  5IGF A;  4I55 F;  2ID0 A;  2FFK B;  1HUN A;  2Q2U A;  5FLX W;  3ETH A;  2FPG B;  4B3M L;  4YIJ A;  1K0S A;  1FJG H;  2VNU D;  4O4L F;  1X54 A;  1PRT D;  2YTV A;  3A5Z B;  1JJC B;  1JWS D;  4M9U A;  1B3Q A;  1E4F T;  4GS3 A;  4L8J A;  4JI6 Q;  4RCN A;  1JJG A;  5M3M B;  3RJ0 A;  2UVU A;  2ALZ A;  3RB4 A;  1F9Q A;  4WRD A;  1OXV A;  4R4O A;  3EPI A;  2N8N A;  1H9S A;  3IG0 A;  4H7B A;  5COR A;  4YY3 Q;  5A35 A;  5L1I A;  4J15 A;  2V9W A;  4JI7 H;  1NUC A;  1O80 A;  2BCO A;  3U50 C;  3K57 A;  2B2Y C;  3BYT B;  1B1Z A;  2CW0 C;  2FMC A;  1I5F A;  2LSS A;  5CV9 A;  5EZY F;  4JI2 Q;  1TWA A;  3M9M B;  4XZ3 B;  3WO1 A;  4X64 L;  5C5J A;  4LF9 H;  3I7F A;  1CKN A;  1B4O A;  3D31 A;  1EWH A;  1LTA D;  1KLU D;  1PRT F;  5GQO A;  2W7P A;  3GTO H;  3PO3 H;  4AQY Q;  4X66 Q;  5A2Q L;  4ECZ A;  1KRS A;  4FP5 D;  2R61 A;  1WD0 A;  1HQM C;  4J9Q A;  1DOM A;  1HZB A;  5DQH A;  3A7L A;  3KAK A;  4IZO A;  2PNR C;  3OUU A;  1LM0 A;  1TT2 A;  5JJL A;  2I8C A;  2XIG A;  1UE7 A;  3W1G A;  5D14 A;  1LO5 D;  5CR3 A;  1EYD A;  3RMH A;  4RU9 A;  1O7I A;  5GRO A;  1EIY B;  4S3S A;  4JBW A;  4YHH L;  1BBW A;  3CRL C;  1S10 A;  5FKA C;  3RZD H;  4NKL A;  4O3R A;  2WAQ G;  1QOH A;  1LTG D;  2JA7 A;  1N33 Q;  5EGT A;  1CT1 D;  1Z2P X;  2F0Q A;  4A3F G;  2CVR A;  5JJZ A;  5C1O A;  5LA6 F;  1BNC A;  1OWT A;  4GLV B;  1N34 H;  4P73 A;  3DEO A;  2W71 A;  3U4V A;  2HQL A;  3M3Y H;  4GN4 B;  5IWA L;  2R3Z A;  1PYB A;  1KAW A;  1QNU A;  3K5I A;  2CFM A;  1YHQ A;  2F1M A;  1E2V A;  4R8I A;  4BA1 I;  1PZK D;  5J2T F;  5E4X A;  2ATL A;  1GGO A;  4F7X A;  4UCO A;  5CV6 A;  4TRD A;  4DV1 H;  1DIK A;  3TZU A;  4U67 3;  1E22 A;  3Q8P B;  3KYH C;  2L5T A;  1CHQ D;  1ENA A;  1KLG D;  2ZDG A;  1U4M A;  1SFO B;  1N32 L;  3ER0 A;  3GTK H;  2MO0 A;  3G6Y A;  2B8F A;  4APV A;  1EY6 A;  4C2M B;  3J7A 5;  3R5X A;  3VYR A;  3P75 A;  5KFH A;  5M5X H;  1K8G A;  4KD4 A;  1UUP A;  1PVO A;  2UUA L;  1CUK A;  2YS6 A;  3N42 B;  4O3O A;  2UUB H;  2I0Q A;  4DUZ H;  4RAU C;  3PUW A;  2B2T C;  4ED2 A;  2JK8 A;  4LF5 Q;  3HKZ A;  4G4K A;  1G8Z D;  4BY7 B;  1VQC A;  4IPG A;  1WCM A;  1RTN A;  2HD3 A;  4IUR A;  2I07 B;  4C3J G;  4QB4 A;  2K14 A;  4LH6 A;  1BQQ T;  4IFD H;  5T1I A;  4QMG A;  2HQE A;  2NN6 G;  2RCF A;  3SVM A;  4A3C H;  3ULJ A;  1SAP A;  2E5L L;  3L0O A;  4YCV A;  3GTO A;  2VOB A;  1VQ9 A;  1VQA A;  4B3T H;  5C3X A;  2HVQ A;  1MZB A;  3KF8 B;  4JYA Q;  3LWU A;  4JV1 A;  4HID A;  2J6T A;  2CW0 D;  4JBK A;  5ELD A;  1P16 A;  2BH2 A;  4C3I H;  4DLK A;  2AQ3 B;  3DMU A;  3ND9 A;  4JOI C;  2QYZ A;  1RCV D;  5EKI A;  4DUZ L;  2KBN A;  3ITP A;  4DV4 H;  2NWG A;  5M5W H;  2A8V A;  1ESR A;  3C2P A;  2B63 H;  3KLW A;  1VQB A;  1VQP A;  4X66 H;  4Q45 A;  2PO4 A;  1EY8 A;  1G2S A;  1X55 A;  2ZTD A;  1KC8 C;  1YNN C;  3FPP A;  1EHI A;  4JBM A;  4I65 A;  3MFI A;  3GIJ A;  1PH2 A;  5KGU A;  3TSS A;  2RDI A;  5AJ3 Q;  1FYC A;  1IBL H;  2F0K A;  3S1M H;  3M9O B;  1QNK A;  4U7C A;  3I55 A;  5C5M A;  2E2J B;  3NWS A;  2NU6 B;  5C0X J;  2R7F A;  3F2U A;  2WAC A;  3NP8 A;  2XRS D;  2EYO A;  4GKJ L;  3BAB A;  4B3R H;  1Y1W A;  4K2K A;  4P2C B;  5D3I B;  3CQZ A;  4LMY A;  1KDB A;  2A1A A;  4ZQ3 A;  1SRU A;  5IGC A;  1HXY D;  3PIO A;  2R86 A;  1TWH B;  1PFN A;  2VPS A;  4UP8 A;  1GVP A;  4HR7 B;  4GOP A;  3I4N H;  2YCH A;  1VQ6 A;  3T5L A;  4ECX A;  4LFC H;  4ZK9 B;  4OO1 I;  4V0B A;  2L9H A;  3HOZ B;  4DR3 L;  1KEE A;  2W6M A;  1KBL A;  4KJN A;  4ECR A;  1X56 A;  3BZD B;  2EJG C;  5JEA H;  3HOX G;  3MAQ A;  4YAK B;  4LF9 L;  4P75 A;  2N49 A;  3C1F A;  1YHA A;  2AWN A;  5A2Q E;  3CCL A;  2EIF A;  1KJJ A;  1RIP A;  1N33 H;  1B70 B;  2QKI C;  3SI8 A;  4DR7 H;  3JAM i;  3Q1K A;  2XVS A;  5KNC A;  3CRK C;  3H0G B;  4I7Z C;  2W6P A;  4XYQ A;  1TWC B;  1WYD A;  4DPG A;  2RA4 A;  1VQ7 A;  4PDB A;  1B2T A;  3M7N A;  1PLF A;  2AKW B;  2R8G A;  2PQA A;  3TP6 A;  3FKI A;  2D9U A;  4BBR B;  5BR8 H;  5KT7 A;  3PUX A;  4UDU C;  4AH6 A;  4DUY Q;  2BA0 A;  4L5S A;  4CC6 A;  3NBH B;  1ROD A;  3J80 E;  4HJ9 A;  1TWH H;  4ED1 A;  4LF7 Q;  1HR0 H;  1H9K A;  4J9R A;  2XTI A;  5KFT A;  2F52 A;  4OGQ C;  4X3T A;  1PH7 A;  2FLL A;  4C1N I;  4EG0 A;  3BU2 A;  4ZUJ A;  1K0R A;  3MXN B;  4DL6 A;  2UUC H;  3CC7 A;  2NUC A;  2EJF C;  3H15 A;  1G6P A;  5LMU H;  5HBR B;  3TEH B;  4NP5 A;  3GTQ A;  4JK1 C;  4MV1 A;  1U4P A;  4NLG A;  3VR6 A;  2NVQ H;  1AN8 A;  2P0A A;  4EGQ A;  1XJV A;  4ED7 A;  3VMM A;  2BOS A;  3KFU A;  1B7Y B;  1HA6 A;  1C3O A;  1UC8 A;  3Q8S B;  4JYA H;  3KLS A;  5KG5 A;  2YU9 B;  1MJC A;  3PF4 A;  1S4Z A;  1D1I A;  2Q8I B;  3GTP H;  3M4O H;  2YRW A;  1M1K C;  1HZC A;  2N55 A;  4KHP H;  3S2H H;  2E2J H;  4DXG A;  1XMQ H;  1B9M A;  5IYB H;  3HOY B;  1TQO A;  4IFD I;  1IL8 A;  1STY A;  4HSP A;  2F0N A;  1DON A;  1EL0 A;  3EA6 A;  3PGZ A;  2EE1 A;  1K9M C;  2VY3 A;  3GTG H;  1Y14 B;  3KHR A;  4DL7 A;  2CHB D;  2GVA A;  1XXG A;  1XTC D;  2HGS A;  1PV4 A;  5KFV A;  1T94 A;  2Q2I A;  3CAM A;  3PN1 A;  5L1K A;  1KJQ A;  1EWI A;  5GAG C;  1TU2 B;  1HR0 W;  3RB3 A;  5HV6 A;  1Z47 A;  4C3J B;  1ZYR C;  4RKB A;  3I4M H;  3VYU A;  3PVX A;  2Y0S A;  4POG A;  4DN4 M;  3HOY H;  4EEQ A;  1VQH A;  1MSG A;  4P74 A;  4LFA H;  1GHJ A;  1M4V A;  4DV0 H;  4N9P A;  2KQ3 A;  3HS0 C;  4JI4 L;  1JWM D;  3A74 A;  2IMW P;  1OXT A;  4F87 A;  2EXZ A;  1J8I A;  2O5J C;  5KND A;  2F4V H;  3KUP A;  4PZ8 A;  4L5T A;  4A3L H;  1VAJ A;  2UXB H;  3RGZ A;  1V1O A;  5DQG A;  2R7L A;  4G7O C;  5LMU Q;  4K5V A;  3M4I A;  4JOI A;  3TIN A;  3Q0A A;  1S5F D;  3GQB A;  4F50 A;  4DV5 H;  3QG1 A;  3SK8 A;  2QK4 A;  2O03 A;  4DV2 H;  2ICE C;  3K7A B;  5C6A A;  1MBY A;  4LF5 L;  1XNR L;  1EZ8 A;  5DLF A;  2ZJT A;  4BY7 H;  1T36 A;  5I9P A;  3CCR A;  4MTK A;  4QUF A;  1SE3 A;  1S5D D;  3I8Z A;  1AE3 A;  5DLG A;  3M4O B;  4ED6 A;  1EUD B;  1TS3 A;  1OO9 B;  4C5C A;  4LFB Q;  1VS0 A;  2I5L X;  5BR8 Q;  1QZG A;  3WDN A;  2JQO A;  4OEM B;  2KEN A;  2E5L Q;  1W96 A;  5KT4 A;  2AGP A;  2V58 A;  4A3K G;  1G6Z A;  1JKJ B;  3UFX B;  1L2Z A;  4K14 A;  1RJR A;  2W9C B;  1IKL A;  4I7H A;  2JEJ A;  2Z4H A;  4YY3 L;  1JC7 A;  3L4K A;  3QJY A;  2IL8 A;  2Y0S E;  1V1Q A;  1ONL A;  1Y8P B;  3TS0 A;  2UXC H;  1WH2 A;  1XMQ Q;  1AP0 A;  2D2C C;  1VQE A;  5EBD A;  1KNE A;  1GUS A;  2NU8 B;  2JA6 G;  3H40 A;  1GSO A;  5DAU A;  1HNW Q;  1W2B A;  3HKZ G;  1FGU A;  3P20 A;  4BBR G;  4G7Z C;  4LF8 Q;  1YBY A;  1IW7 D;  4LF4 Q;  2VL6 A;  1OXX K;  4LFC Q;  3URY A;  1M6V A;  3WNZ A;  2NYZ D;  4X62 H;  2CKZ B;  2W9A A;  2F0U A;  2K5D A;  4K5X A;  4O3Q A;  3KHL A;  3TZD A;  4OL7 A;  1SBB B;  2NVT B;  4JI1 Q;  3DF7 A;  4DL4 A;  4IQZ A;  4QWB A;  5F9L A;  2K75 A;  2UXB Q;  5C4X G;  4XDX A;  4JI1 H;  2JSO A;  5I9O A;  3GTM H;  2PMZ E;  2MO1 A;  1YEZ A;  2MJ8 A;  2EJM A;  3T53 B;  1KIX A;  4A3K B;  2UUC Q;  4KMU C;  1S0M A;  2IW3 A;  4YY3 H;  3AFP A;  4NB3 A;  1QUQ A;  5KFL A;  2FK1 A;  3BZK A;  5FOB B;  2NVT H;  4LFA Q;  4RGO S;  2VQF L;  4UCR A;  3MEF A;  2K5Q A;  1E7Z A;  3BJU A;  3CVZ A;  4DUY H;  1HA5 A;  2F0E A;  1VMC A;  2AUK A;  2K6A A;  2UU9 L;  4AQY L;  1XYI A;  3EVQ A;  5KFP A;  1QB5 D;  1XTD A;  3C3L A;  2Y0S G;  5JJK A;  2FJ2 A;  4RHR A;  5IWA Q;  2N3S A;  2ASJ A;  2D5D A;  1LYL A;  2IX1 A;  2XGP A;  4X3U A;  4O2B F;  1K8A C;  3CD6 A;  4C3H G;  3S2D H;  5DGA A;  5JQW A;  2AGQ A;  1NSN S;  2SOB A;  3D3R A;  4DV3 L;  3HEJ A;  1UNN C;  2O4X A;  3GIM A;  1O7Z A;  2E75 C;  4IAJ A;  2HHH H;  2PW7 A;  4U68 A;  2F3W A;  3KAL A;  3TQT A;  2AGO A;  2IX0 A;  4KKT A;  1TII D;  4A3B B;  4EBD A;  3J80 L;  2VUM G;  2K03 A;  1EU3 A;  3OUZ A;  3T1H Q;  4QIW B;  1NMG A;  1Q46 A;  5LXT F;  1WTV A;  1EIH A;  3TIG A;  2VQE Q;  3OWE B;  2BDN A;  4F4Y A;  2UUA H;  2CWP A;  1GLV A;  4RMF A;  1I50 B;  1D8L A;  1CM9 A;  4A3C G;  1Y1V B;  5IYC H;  1IL2 A;  2SEB D;  5C44 G;  1B3A A;  2KHI A;  4TV8 F;  2ENB A;  3L9A X;  1XWE A;  5FLX L;  4HJ8 A;  2VUG A;  2A19 A;  3J81 L;  3VPD A;  4DR6 Q;  2B2V C;  1G91 A;  3V6K A;  1PTO F;  4C2M H;  5FLM G;  2I5H A;  2R8K A;  1BNZ A;  2PCF B;  3F1Z A;  2Z1C A;  1CFM A;  4A3J H;  3NSW A;  5T1G A;  3KAJ A;  4Y8V B;  2R93 B;  4DR1 H;  1ZET A;  4JV2 A;  5DGB A;  4BXX H;  1IXR A;  5KRU A;  1B9N A;  4LH7 A;  2RSN A;  4DNR B;  1KQS A;  3ZYY X;  2BQ3 A;  2A69 D;  4DR1 L;  4BBS B;  1IYU A;  4DR5 L;  4JI3 Q;  4P71 A;  4HNV A;  2VQD A;  1YI2 A;  4LUO A;  1JR0 D;  4O4H F;  3ULP A;  5IYC G;  3K5H A;  1I3Q H;  2L4N A;  1BKB A;  4OON A;  2KSW A;  5KG3 A;  4DV1 Q;  2ZJP A;  2UUA Q;  4NXM L;  1BCP B;  2WAQ E;  1S3O A;  3HOV H;  1SMY C;  5L37 A;  4XYM B;  1IW7 C;  1LTS D;  3S17 B;  3RD4 A;  5A2Q W;  2ZXP A;  3PUV A;  1PFS A;  2RDH A;  4TVA B;  2NVQ B;  3PV0 A;  1HNX Q;  1RL2 A;  4B3T Q;  4RB2 C;  2RGV A;  4A3G G;  1STE A;  2QW7 A;  3NQT A;  2IHE A;  1EY9 A;  1KDC A;  4FNF A;  2UVW A;  3GTG A;  1CZW A;  2K33 A;  3I4N B;  4IOA A;  1L1O A;  2NVX B;  5FPR A;  2IA6 A;  1SMX A;  4IUU A;  4KN7 C;  3T16 A;  1Y1W H;  3RAX A;  4JI4 Q;  5BMV F;  4IRC A;  1MIU A;  3E5N A;  1E4E A;  1A9X A;  4XQN A;  4K2L A;  4RCO A;  4HQ6 A;  2VB3 X;  4EQ5 A;  5JPN C;  4J9O A;  3GTP A;  1A15 A;  4L1K A;  5IT9 W;  3DWQ A;  4DK0 A;  2B39 A;  1PH9 A;  1SCU B;  1QE6 A;  4FF3 A;  1K3B C;  4IO9 A;  2KEE A;  1HR0 Q;  3N44 B;  5KFA A;  4GN3 B;  4HSV A;  2MQH A;  2WB1 B;  3GTO B;  3JAM c;  1C8C A;  2PI2 E;  4FXD A;  1K83 B;  4LF6 Q;  2D62 A;  4A3G H;  4IUQ A;  2XGQ A;  5K36 G;  4ODG A;  1XNQ L;  1EFW A;  1VQF A;  2KEC A;  1JQY D;  4IJH A;  3MFH A;  3GV3 A;  2OH2 A;  5KT3 A;  1XNQ H;  4MNO A;  3SK5 A;  4EQN A;  4DR3 H;  3VPB A;  5DG7 A;  1BCP C;  2IBK A;  1WOC A;  3L2P A;  5BPF A;  1HPC A;  2HUG A;  5FD6 A;  4FVM A;  4IFD G;  5D1O A;  1JE4 A;  1GO3 E;  1S40 A;  2WV6 D;  1NJI C;  3MXG A;  4J9L A;  5IP9 H;  1SYC A;  4O4I F;  4Q8E A;  1JIH A;  3P1H A;  3K80 C;  2AUJ D;  1I6V C;  1V51 A;  4OWW B;  4DAV A;  3SK6 A;  4H44 C;  4CKB A;  2VPQ A;  3PUY A;  1YNX A;  3C1E A;  2OF1 A;  1U4R A;  3U9T A;  3OHX C;  1I4R A;  1HJP A;  1MHW C;  2D0P A;  5C3E H;  1EYC A;  1VCI A;  1I7L A;  4TUY F;  4K8J A;  3M85 A;  1FJG Q;  1ILQ A;  3GTK A;  5KKN B;  1CKO A;  1EOV A;  1Q8K A;  2XSC A;  1TWG B;  3CQZ B;  1B33 N;  1Y1V G;  3SHL A;  4LF7 L;  2FLP A;  1H9S B;  4XX0 B;  5M3F H;  4JI3 H;  2A6E C;  1Q90 A;  4EGV A;  1AZQ A;  3F2B A;  3NUC A;  2JEG A;  2EYH A;  2FXQ A;  4GC6 A;  2N78 A;  1TKW B;  3TP7 A;  5IP7 H;  4HNU A;  3D4W A;  4UCS A;  5L1L A;  5CGK A;  2CH4 W;  2RHQ B;  3SK4 A;  5C0X I;  2V5A A;  1TWF B;  1T5E A;  3J7Z C;  1PTO B;  1EUC B;  3CC4 A;  4RAZ A;  5M3M H;  1X9N A;  1Q7Y C;  5LP6 F;  3OSN A;  2RDJ A;  3X3N A;  4DAY A;  4BY1 H;  3SE0 A;  4GNX C;  3M7G A;  3H91 A;  5M5W B;  2MUY A;  2ZTE A;  2B63 G;  2FPP B;  4MA0 A;  4DL2 A;  5JEA J;  4AYB A;  4BY1 G;  3GV7 B;  2FPI B;  4ALP A;  3K81 C;  4X6A H;  4LF6 H;  2C2E A;  5C3E B;  2I87 A;  1ESF A;  3FP9 A;  5I47 A;  1P8L A;  1IOW A;  4MN3 A;  1DV2 A;  4J9M A;  4NXM H;  1TY0 A;  2A69 C;  1O7L A;  4YAJ B;  3A56 A;  1LT6 D;  5J39 A;  1BOS A;  4YR3 A;  2F4I A;  4RGT A;  1VKZ A;  1NR4 A;  2PBZ A;  3BVM A;  3G6X A;  2RGR A;  5C1P A;  1SYF A;  2R7Z H;  2JA5 A;  3MXN A;  2K50 A;  2ZT9 C;  4KN4 C;  4FBU A;  1UE6 A;  4X3K A;  1CQJ B;  3S24 A;  2B2T A;  5GAH C;  1SDF A;  3PO2 H;  5C4J H;  1D6E C;  1QVC A;  1S97 A;  5I2Y A;  2KCT A;  4BBR H;  1EYG A;  2R7Z B;  2A6H C;  4QUC A;  1GOZ A;  3J81 W;  2NUA B;  4B3M H;  4F8M A;  1KXL A;  2J9G A;  4QL5 A;  1T3N A;  4X65 Q;  1ET9 A;  2JA8 B;  5H80 A;  3CME A;  4A3I B;  3GII A;  5FK9 C;  1IOV A;  1B53 A;  3KF6 B;  1RJP A;  4FS1 A;  3I90 A;  3RBE A;  2FP4 B;  1W3S A;  1PYW D;  3CPW A;  3SEB A;  4MHE A;  4A3M H;  1I6H B;  4QGU A;  1H95 A;  2RQX A;  4DR1 Q;  1IBK L;  4DR5 Q;  4HCS A;  5DM7 3;  3BQ1 A;  1WTO A;  3OTO H;  4JI5 H;  3FRP B;  2YZG A;  1IBK H;  2F0D A;  3T56 B;  5KFI A;  4O3S A;  3G6V A;  1EYA A;  3TRZ A;  2A68 D;  4RHS A;  1Y1V H;  3V96 A;  2YZM A;  2R92 B;  4MV7 A;  3PQI A;  3H0G G;  2K52 A;  2XD4 A;  1TWF H;  1F9R A;  2BH8 A;  3GTM B;  1HUM A;  2TSS A;  1RHP A;  2PW5 A;  4MV6 A;  1GKH A;  2EDG A;  1TS5 A;  1Q8I A;  3OIP A;  5EOY A;  1F2Z A;  1PDQ A;  4O0A A;  1QZH A;  2R93 G;  3R3O A;  2YZN A;  2J6S A;  2L0C A;  2R6G A;  1JMC A;  3KBG A;  3OMG A;  5FJ8 G;  1QVG A;  3HKS A;  4CDD C;  2NVY B;  3HOZ G;  3ORR A;  2J6U A;  4AYB E;  1H9R A;  3PO2 B;  4KK7 A;  5BR8 L;  3BVG A;  5KFW A;  1DJR D;  3I4M B;  4JI1 L;  3N43 B;  1YJN A;  2AQ2 B;  1EEF D;  1Q86 C;  3DUZ A;  4FM9 A;  4DF7 A;  3NK9 A;  2F3I A;  4UPA A;  1ULZ A;  5LHY 1;  5KT6 A;  2UUC L;  3HP3 A;  2OT2 A;  3HZX A;  2E2H H;  3RV3 A;  4DV5 Q;  2HIX A;  4HJA A;  2TMP A;  4DK3 C;  4APM A;  3K8A A;  4MAM A;  5NUC A;  1VQK A;  1PH3 A;  2PZT A;  2UXD Q;  4ED0 A;  1HH2 P;  4LJZ C;  4RUA A;  3JAM W;  3QOL A;  4LFA L;  4EEY A;  1MKH A;  4GNX A;  1FGB D;  1HZA A;  4DR4 L;  3T5H A;  5L1J A;  3EPG A;  3FMA A;  1KJ8 A;  2R6F A;  5AFW A;  4R8N A;  2MNA A;  1BBX C;  4LSX A;  4OX9 Q;  3ONA B;  1EQV A;  2QIL A;  4LAA A;  3TBI B;  4C56 C;  3Q8Q B;  4A3J G;  4KKS A;  2GPS A;  5KFU A;  1R9T A;  4DV6 L;  1EIG A;  4JI8 L;  4KHZ A;  3JZI A;  2CZG A;  5DEH A;  2NVY H;  4FF1 A;  3M9N B;  1SLJ A;  1TVX A;  1SRO A;  4RAY A;  1EQR A;  4ED8 A;  2MPM A;  4E6I A;  4DV3 Q;  2CW8 A;  3TII A;  5EKL A;  1SJE D;  4A3M B;  3Q24 A;  3F2C A;  2F0L A;  1LAB A;  1EUJ A;  1Z2O X;  1IKM A;  3GIQ A;  2ASD A;  2RVL A;  4ULL A;  1RF2 D;  3S1R H;  4A3K H;  3L7Z C;  4EYH B;  2ZM6 L;  3MR5 A;  5C4H A;  5ISR A;  1JOQ A;  1LT5 D;  2XWB B;  3R23 A;  1CKN B;  3OSP A;  2M00 A;  2B2V A;  1LTR D;  1QG7 A;  4YCU A;  1IBM Q;  2F4V L;  5DLQ E;  4CDC C;  5KIX A;  4ZAI A;  2VQE L;  4A3E B;  4Y52 H;  4IHJ F;  4EBE A;  4JI7 L;  3CPF A;  1TWG H;  2SNM A;  4J6H A;  4KHP L;  1PK8 A;  4CC5 A;  1QUQ B;  4TKO B;  2H4O A;  2XC9 A;  3VPC A;  1KL9 A;  4DV7 Q;  4DFA A;  1N56 A;  2FMA A;  4A75 A;  1M90 C;  3FKI B;  1A0I A;  2CQY A;  1D2B A;  4LFB H;  1K3R A;  4JV5 Q;  2XIW A;  2WDT A;  1VDZ A;  3GDE A;  3VR5 A;  1V1P B;  5E7N A;  3MHB A;  2Q8T A;  3T1Y H;  3CCE A;  4LF5 H;  4IJL A;  4JVZ A;  3NTI A;  4ZYS A;  5JH7 F;  2KCM A;  2LFN A;  1ENC A;  2K5H A;  4KKU A;  2RDF A;  3ORQ A;  3FKI H;  2J4X A;  1PYS B;  5C0X H;  3P7J A;  1SYX B;  3HOX H;  5KFO A;  1PFB A;  4NXM Q;  4YR2 A;  2EYF A;  3HOV B;  1GUG A;  4FXG C;  3GTQ B;  2MCT A;  4YJ3 F;  2JA8 H;  5FLX E;  4QIW A;  4IN3 A;  1GYF A;  3GV8 B;  1Q81 C;  1JT8 A;  2EXD A;  1GUO A;  4XT1 B;  4BS9 A;  1TY2 A;  2J0T D;  3BQ0 A;  2BE5 C;  3PUZ A;  4PMB A;  4PV1 C;  4K0K L;  4DV0 Q;  5C4J B;  3TME A;  1B50 A;  2PMZ A;  2ZDQ A;  3M4Y A;  3S9W A;  4K0K H;  3U9O A;  3MWM A;  2VUM A;  5KFZ A;  4POF A;  4FXK C;  1OTC A;  4BWS C;  3RGX A;  1T5X D;  3UDI A;  3CXC A;  4A3B H;  1FNW A;  4DV1 L;  2ZJR A;  1VQ8 A;  3RFC A;  3RLO A;  2KCC A;  3HOU B;  4QWA A;  4WBN F;  2Z6K A;  1RDP D;  4UAI A;  1KJI A;  4L5R C;  3KOJ A;  1SYE A;  4MIU A;  3EYY A;  1LUZ A;  4EFB A;  3JSN A;  1EFI D;  3E3X A;  1STG A;  4ZOL F;  1S0O A;  2CW7 A;  3SGI A;  1VF7 A;  1S03 G;  5BN3 A;  3S2D B;  3DLL A;  2K01 A;  5FJ8 H;  1I4X A;  1I3Q A;  3OPO A;  1ZQ7 A;  1X65 A;  3KJO A;  4N8X 1;  2DN8 A;  3G48 A;  3GTL H;  5KYI A;  4R7R A;  2YRX A;  1C7Y A;  4BA2 I;  3WO0 A;  1RKN A;  2UVR A;  3LWE A;  1GSA A;  1A3V A;  4C3I G;  1QJO A;  1II3 A;  5EPK A;  1BGW A;  2SCU B;  3R2I A;  3LGJ A;  5BPH A;  2F0M A;  1I94 L;  4ECS A;  1KTK A;  2B63 A;  3GTG B;  4YR0 A;  1XPU A;  1HR0 L;  3HXL A;  1F2L A;  4DV4 Q;  1W6K A;  5LL6 X;  4HCE A;  1UWV A;  1VQM A;  4LF6 L;  3RUP A;  1UNS A;  2WYO A;  4TQU S;  3U58 A;  2F0H A;  3HOU H;  3MTS A;  4H13 C;  4G7H C;  1HFG A;  2IHF A;  1XNQ Q;  1MSH A;  3UE0 A;  2AHO B;  1ZKO A;  2SNS A;  1CI3 M;  3GTP B;  5EAY A;  1WTW A;  1FJG L;  5KFB A;  4JI0 Q;  1RJT A;  2L11 A;  3BDO A;  1PX2 A;  1C9O A;  2FKL A;  1YJ9 A;  4QF4 A;  4HTH A;  2E2I B;  2VW9 A;  1BXR A;  2OQ0 A;  1PH1 A;  4JI4 H;  1V9P A;  3EIV A;  3L3O C;  4Y7N H;  1GHK A;  3KBX A;  5JOB A;  3E5S A;  2IJ0 A;  2QGQ A;  3PIP 3;  4LUV A;  3QOJ A;  2R92 H;  2K5N A;  2WIN B;  5JVL A;  2F0S A;  3H4B A;  1U9R A;  1JX4 A;  1WCM G;  1SNO A;  1VBG A;  3BA9 A;  1AW7 A;  2JYO A;  3KK7 A;  3HKZ E;  2JA5 G;  2JA7 H;  5D1O B;  1L2F A;  3W2D A;  3MWD A;  2PN1 A;  3F8T A;  2ASL A;  3IFT A;  4HYK A;  2IX3 A;  1YIJ A;  2R7Z G;  4GOP B;  4PMC A;  5LMN L;  1F77 A;  3AEV A;  1I4H A;  4C5A A;  4DU9 A;  4KY5 A;  3GTL A;  1K8M A;  1TWA B;  1PH8 A;  4DAP A;  1JLL B;  4JBJ A;  1L0X B;  1EWC A;  3NQI A;  3UDG A;  5CA1 F;  2PI2 A;  2NVX H;  1FNV A;  2RSO A;  3D4R A;  2F3V A;  3S1N B;  4OIK A;  5ELF A;  3H6M A;  4PG3 A;  5K2M A;  2PZU A;  5IP9 G;  5KG4 A;  3NPP A;  1WR2 A;  4I50 F;  1CHP D;  3A8J E;  5E3F A;  2DLN A;  2IY5 B;  3H3V H;  4DK1 A;  2EZV A;  1STN A;  4PZ7 A;  5CV7 A;  1TS2 A;  1A8V A;  1J5E L;  3RN5 A;  5JJI A;  3GIK A;  3OSO A;  3NEL A;  2ZM6 Q;  1N33 L;  3J81 E;  3AMU A;  5IYB G;  5EWG A;  5GAE C;  3PR4 A;  2A6H D;  3S1Q H;  1MI2 A;  1IBM L;  2F0V A;  2KA7 A;  3J7A V;  2PYK A;  3KDF A;  4YCW A;  4A3E G;  1PXU A;  2NTS A;  1E24 A;  4RFB A;  2NN6 I;  3STB D;  1WTR A;  3I4O A;  3PO3 B;  4OO1 H;  3MJF A;  2KJX A;  2PZW A;  4QWC A;  3NGD A;  4B3S L;  2FK2 A;  5IOD A;  2AQ4 A;  5KFS A;  2VXW A;  4X64 Q;  1SSO A;  3GQC A;  2NZ1 D;  2YTX A;  3H0G H;  3RZO B;  1EQT A;  4EVO A;  1HTL D;  2LKV A;  4R4C A;  3CCV A;  3R5F A;  1B8A A;  5CBE E;  2KCN A;  2YU9 A;  1Y69 U;  2O5I C;  1AUX A;  3VR3 A;  5IWA H;  2ICI A;  1G29 1;  3HOW B;  1Y1V A;  4AQY H;  1ENF A;  2Q2H A;  5CYU A;  1VQN A;  1GJX A;  1FKA H;  4ECQ A;  1ICW A;  1GUN A;  4WOR A;  1ZHS A;  1SFO A;  3EBE A;  5EDW A;  1W6J A;  1GM5 A;  5E4W C;  3G4S A;  4A3J B;  1JE5 A;  4J9S A;  4J8Q A;  3OIQ A;  3HOU G;  5D8D A;  5CAE B;  1I7N A;  1L0Y B;  3LX0 A;  2Z6K C;  5COY A;  1IYJ B;  1PTO D;  1YNJ D;  4H02 A;  1K28 A;  3HGB A;  2DPI A;  1MJE A;  4RH6 A;  4DV3 H;  4IUV A;  4DR6 H;  1WD1 A;  3GTJ B;  1YJW A;  2R8I A;  4HIO A;  1PA6 A;  3BYY B;  3H94 A;  4ZQI A;  5LYJ F;  4J9K A;  2F0O A;  1VQG A;  3N6X A;  2ZXR A;  3OMC A;  4JI6 H;  2G9H D;  1IBK Q;  2W57 A;  4KHV A;  5LL6 b;  2UXD H;  4ZCK A;  1KRT A;  1JXL A;  2B29 A;  4B08 A;  3VDY A;  4UP7 A;  3A8K E;  1D7Q A;  3I4M G;  1X3E A;  3WOE A;  3E9H A;  1WI5 A;  2KHS A;  2W9B A;  3PO2 G;  2ZJQ A;  3ZJY C;  3BQ2 A;  1K1S A;  1AE2 A;  2LS0 1;  3V6J A;  1SND A;  3T5J A;  1XMO H;  1SE2 A;  5J1Z A;  2R8J A;  1S5C D;  4EBC A;  1SJH D;  4RG1 A;  3MR2 A;  5KG6 A;  2IT1 A;  3DM3 A;  1WTQ A;  2JP1 A;  4YWM A;  2B8G A;  3DWA A;  1HNW H;  2WB1 E;  1KAA A;  3JAM L;  5J2U F;  1E4E B;  4MTN A;  4I7A A;  1NCV A;  4UP9 A;  3GTM A;  1VQJ A;  3M3Y B;  2E5L H;  3OYY A;  3HKZ B;  4LNQ A;  2FJZ A;  1WCM B;  2R7M A;  4U6P A;  2JA6 B;  2V59 A;  1SXT A;  1Y1W G;  5FO7 B;  4L63 B;  1EY5 A;  3K3V A;  2M2L A;  1N9W A;  3RAQ A;  1Y1W B;  3V4S A;  2GVB A;  5EQ0 A;  5I2X A;  2FB9 A;  3R8B A;  4DV4 L;  3HFZ B;  2ZM6 H;  1D5Z C;  2WTF A;  1GUT A;  2Z0S A;  5M5Y H;  2VA2 A;  4YQW A;  4DR4 Q;  4JI2 H;  1LLR D;  1ILP A;  1SE4 A;  1J5E H;  3OTO Q;  1S5E D;  4JI5 Q;  2F4V Q;  4DV2 Q;  1RK6 A;  1GD7 A;  4FDB A;  3V05 A;  4X62 Q;  3HBL A;  4JI7 Q;  3RB0 A;  4IRD A;  4CBV A;  4ME6 A;  4DV6 Q;  1QCB D;  2RDG A;  4X65 H;  3NTK A;  4IPC A;  1R4Q B;  2UVV A;  1TXY A;  2QF7 A;  2FK3 A;  2OEO A;  1AFP A;  1LTT D;  4PQX A;  1CQF A;  3SXH A;  3S14 B;  3GD7 A;  1AEX A;  3HOZ H;  2HIV A;  2OCE A;  5IYD H;  4MV3 A;  1V43 A;  4DXF A;  1CA6 A;  4C3I B;  3NWT A;  3OWF A;  4A3D H;  2WAQ A;  5JUM A;  2YYA A;  4PWQ A;  3DHQ A;  1N36 H;  4DGZ A;  5JVG 3;  4NXN Q;  3E0J A;  4NW2 A;  4ABN A;  5LMN Q;  3Q8R B;  1W93 A;  4NXN H;  1SMY D;  5BN4 A;  4GKJ Q;  5D1P A;  5C4Z A;  4R4Q A;  4KHP Q;  2YS7 A;  4NMZ A;  3J7Y W;  3MXP A;  3BS1 A;  4A3L G;  4DR2 H;  1JWU D;  3C0F B;  3NBH A;  1TWF A;  3GIP A;  4BBS G;  1JDE A;  5IP7 G;  2W70 A;  4LWC A;  3K58 A;  1PZJ D;  2C35 B;  3CQZ H;  3EQL C;  4ED3 A;  4XQJ A;  1HHV A;  4Q0Y A;  3FPU B;  1UE5 A;  1I4G A;  1PRT B;  2JEA I;  2R93 H;  2OQK A;  2XCA A;  2CQO A;  2RCN A;  2A74 C;  4C3H B;  2HVS A;  3HOY G;  4JI0 H;  2PVP A;  1O75 A;  3J7A F;  2R8H A;  1S0N A;  3DEP A;  4DNT B;  2X0S A;  5C44 B;  3T4A C;  4ZKC B;  5ELC A;  2R84 A;  4J9N A;  2BA1 A;  1J5E Q;  3N8D A;  4O3P A;  1G51 A;  2JN4 A;  3TS2 A;  2A68 C;  4LF7 H;  3J81 c;  2FHT A;  2JEF A;  4KJO A;  3H0G A;  3S14 H;  3S15 H;  1VQ5 A;  5M3M G;  4M7E A;  4WD3 A;  1A3T A;  3G71 A;  4MA5 A;  3SR1 A;  2DY7 A;  4FS2 A;  4A2A A;  2B2U A;  4XQQ A;  4DR7 L;  4UCT A;  5KG7 A;  1SN8 A;  4UY8 C;  4IWX A;  4A4I A;  4B3S Q;  2NU9 B;  1SFO H;  4DUY L;  4DV0 L;  2E76 C;  1XPR A;  2JXM B;  3A5U A;  1S68 A;  4QWE A;  4LUZ A;  3PR5 B;  4HIM A;  4H0L C;  3DM1 A;  4FYD A;  1V4Y A;  5KFE A;  2UU9 H;  1IZ6 A;  1EYZ A;  1TS4 A;  1I4P A;  1LAC A;  2F0G A;  1MGS A;  1Q82 C;  1RYS A;  2GN5 A;  5IOC A;  4HNT A;  2JA5 H;  4JI8 H;  3K5L A;  2R7Z A;  2Y0S B;  3KTM A;  2B2W C;  3QWN A;  5J3B A;  3OHB A;  4DL5 A;  3A55 A;  1I94 H;  3S1R B;  5C4X H;  4A3I H;  2ES2 A;  3QIA A;  3JSL A;  3MWE A;  1JCK B;  2PMZ B;  5DQI A;  2AQ1 B;  3K5N A;  2EYJ A;  1Z9F A;  5JVH 3;  2GPW A;  1HNX H;  3KF6 A;  1ET6 A;  2JEB I;  2Z9H A;  1Q1E A;  3CW2 C;  4IAL A;  2B3G A;  3PMF A;  5LMU L;  4WJ4 A;  1JJ2 A;  1KC7 A;  1JOR A;  4JCV E;  3GTQ H;  3BG3 A;  4XYO A;  5KFM A;  1PFM A;  4F88 A;  5I6Y A;  3UE1 A;  4TQS A;  3ND8 A;  5E1F A;  4F4X A;  3JC6 6;  4C2M A;  5G3L D;  1DYQ A;  4YWK A;  4FU0 A;  3UI2 A;  2NZO A;  5HGQ A;  4EYI B;  1XMO L;  2NVX A;  3A0J A;  4HJ5 A;  4Y7N B;  4RUC A;  3RLF A;  4A3M G;  2JE6 I;  1IBL Q;  1DZ1 A;  1A2T A;  2AWO A;  4DA2 A;  1CSP A;  3MVV A;  1PH6 A;  1I3Q B;  2B2U C;  5IT9 L;  4B3R L;  4R8U B;  4UCV A;  3U9S A;  4GC7 A;  2L12 A;  4OXP A;  1CZG A;  2R85 A;  4R4I A;  2F0I A;  2KUM A;  4Z9C B;  1K8O A;  5F9N A;  2K1B A;  3PIO 3;  3K7U C;  4A3F B;  3Q6S A;  4A3D G;  3BVZ A;  5C8Y F;  1Q1B A;  2JJQ A;  3TQY A;  1L0W A;  4UFZ A;  2HDL A;  4O2A F;  1U0L A;  4K5W A;  3PW7 A;  2I80 A;  2XGT A;  3T1Y L;  4LF4 L;  4JV5 H;  1VQL A;  3RIZ A;  5FPO A;  5KFF A;  4LFC L;  4LW1 A;  3RV4 A;  5CB4 F;  1EU4 A;  2EYM A;  1DGS A;  1YHB A;  2EVB A;  3NEM A;  1EEI D;  1HNZ L;  4QW8 A;  3MA2 B;  4YHH H;  2E74 C;  4CKE A;  3HOW G;  4L5Q A;  2MFI A;  3CKI B;  3I2Z A;  2YTY A;  3A8I E;  3HG9 A;  5CMD A;  4J0M A;  3A7A B;  2UXB L;  1Z7T A;  1S9F A;  1DXM A;  4YWL A;  1ML0 D;  2PPB C;  1SYD A;  1BO0 A;  3IRB A;  4XTC S;  2HHH Q;  4LMQ D;  4A93 H;  1CSQ A;  1B6S A;  1D5M C;  4CDF C;  4A3E H;  3JRX A;  3RBD A;  4JUZ A;  4GZY C;  4GKJ H;  1HTP A;  2C00 A;  2X69 A;  1VF5 C;  1R4P B;  3RB6 A;  4LFB L;  1H9M A;  2I46 A;  2VQF Q;  3RZO H;  1BDO A;  3UDF A;  4CJ1 B;  1R9T B;  2UUB Q;  5KG1 A;  3FDT A;  1KAB A;  1WTH A;  3I73 A;  3K0X A;  4B9X A;  2E2H B;  1EY7 A;  2NBF A;  2V1C C;  4F4Z A;  4A93 B;  4RWS C;  3RNU A;  2EOT A;  3J80 W;  2W7O A;  4QY7 A;  2W8K A;  4X62 L;  5FO9 B;  2FE3 A;  4IUP A;  3W1B A;  4RB3 C;  3BG5 A;  4ME5 A;  3I72 A;  2NTT A;  4BY7 G;  2ZTC A;  5M3F B;  4O3N A;  3GO5 A;  2GLT A;  1STH A;  2VQF H;  3ERQ A;  3AFQ A;  3CCQ A;  5D3D A;  2K28 A;  4LF8 L;  2W8L A;  1FD7 D;  4HJ7 A;  3AQQ A;  4AYB G;  1JOK A;  3MC0 B;  2H5X A;  4IRK A;  1NR2 A;  2AU0 A;  3T1H H;  2DJG C;  1SYB A;  4KY7 A;  4FF2 A;  2Q8R E;  4RZQ A;  4HMI A;  3STB C;  4DR4 H;  1X3F A;  3W5O A;  4N9T A;  3T1H L;  5DG9 A;  4M8A A;  1ASZ A;  5FD5 A;  3CU7 A;  5HGT A;  1A62 A;  2KVM A;  1CS0 A;  1FL0 A;  2F0W A;  3MZ5 A;  4MZ9 A;  4HIK A;  4OIJ A;  3RUZ A;  1RD9 D;  3OW7 A;  2IWH A;  1U4L A;  2P5Z X;  3BA8 A;  3S16 H;  3Q2O A;  1ASY A;  2HCC A;  3BAA A;  2LXJ A;  2R92 G;  4FF4 A;  4DR6 L;  1TWC A;  2R82 A;  4A3F H;  1G2T A;  3CCU A;  4R1J A;  5J22 A;  3I4N G;  4KV6 A;  5LMN H;  1X32 A;  4HMJ A;  2UU9 Q;  1L1O C;  5IYZ F;  3OW2 A;  3D8G A;  2N88 A;  3G7L A;  2VA3 A;  4A3G B;  4RGM A;  2C2D A;  1N36 Q;  2R93 A;  4L6T B;  2JA7 B;  2QEJ C;  4JI3 L;  5KX5 F;  1UEB A;  3H3V C;  2WKC A;  5IGE A;  3L4J A;  5C0X G;  2AMC B;  2CQA A;  1F2M A;  1XDN A;  4K6L A;  4G57 A;  3LP8 A;  4FBT A;  1BR9 A;  5G3L F;  3FHW A;  4JC0 A;  4Q43 A;  4R4T A;  1WCM H;  1QWY A;  3WOF A;  4CGY B;  2WP8 J;  4HN7 A;  3PF5 A;  2WII B;  2M9V A;  1NMF A;  1VQD A;  5CV8 A;  4DV6 H;  4MTE A;  2C22 A;  4ME3 A;  5C3E G;  4QQB X;  4PMW A;  1KDA A;  2CH4 A;  2CCZ A;  3VA7 A;  1HNX L;  5ELB A;  4B3T L;  4R9W A;  1I50 A;  2E8G A;  3FEW X;  5GAD C;  4RNN A;  3W3A A;  5KFX A;  4OO1 G;  3V4Z A;  4EQP A;  1FNU A;  1AUV A;  2PNH A;  3G8C A;  2WFW A;  3D6W A;  1LTL A;  3O13 A;  4KY6 A;  1LV9 A;  4G3I A;  4IR1 A;  5LMN W;  1PMR A;  1WFQ A;  1DD2 A;  1SNP A;  5EPJ A;  3PW5 A;  3MFY A;  5BN5 A;  4ILW A;  1TWA H;  1WVL A;  1N8R C;  2IP4 A;  1E3P A;  3QFF A;  2UXC L;  2K7V A;  3QO2 A;  2QCP X;  3MR3 A;  2KED A;  1D1K A;  1SR3 A;  4DR2 L;  1SNM A;  1EY4 A;  5CV4 A;  3MXU A;  1ICF B;  3D0F A;  3PSI A;  1N34 L;  2XWJ B;  4CJ0 B;  2NVY A;  5JVD F;  4DV2 L;  1E1T A;  3LWB A;  1HQR D;  4MV9 A;  3I56 A;  2B63 B;  2WE6 A;  2J7Z A;  5C5L A;  3GTJ H;  1GUW A;  3M4Q A;  1XMO Q;  1I6U A;  2C9O A;  2DUD A;  2VB2 X;  4WJ3 M;  3DXJ C;  4UHV A;  3J80 c;  1A6X A;  1C0A A;  2LMC B;  4YB8 B;  3TQ1 A;  5JAV A;  5CA0 F;  5M3F G;  5KFN A;  2H1E A;  2QDB A;  5FO8 B;  2R7N A;  4KTA A;  4EFE A;  1Z6H A;  3CP0 A;  4IWY A;  2L55 A;  4FO2 A;  2L15 A;  4GKK H;  1VBH A;  3N6R A;  4IOC A;  2RHS B;  3H3V I;  1R9T H;  2F0T A;  2E2I A;  4A93 G;  1Q3L A;  2V4Q A;  3PW4 A;  4GKK L;  5KNB A;  3TP8 A;  4NXN L;  4BWG B;  4DAM A;  4NDX A;  3S1Q B;  1X3G A;  5EJW A;  2D0O A;  4JI5 L;  3OTO L;  4KLK A;  3S1N H;  3HOV G;  4ECT A;  1I50 H;  3GTK B;  1CQI B;  3T1Y Q;  4LSA A;  1RK5 A;  2WB1 A;  5LL6 S;  1CTM A;  3A54 A;  5JEA G;  1A63 A;  1BCP D;  3G6E A;  1K83 A;  2W9C A;  2VR1 A;  2Z4I A;  1YNJ C;  5EWE A;  1RJQ A;  5FLM H;  3CCM A;  5LOV F;  2MP1 A;  4IUN A;  1BBU A;  1UC9 A;  3QZ8 A;  2G5D A;  2GA4 B;  1E4G T;  4BXX G;  2ZDH A;  2HHH L;  1DOK A;  3ERO A;  1BF4 A;  1J6Q A;  2C5C A;  3GTL B;  1IHZ A;  4ZUI A;  4PNY A;  4CHT B;  1TWH A;  4M1U B;  1JIC A;  4B3M Q;  1HRJ A;  1PH4 A;  3WWV A;  1V8Q A;  1M0W A;  2DY8 A;  4DAY B;  2MHV A;  5L9X A;  3KHG A;  3BZC A;  2UUB L;  4IPD A;  3R93 A;  3CF5 A;  1BCP F;  3RN2 A;  2M05 A;  1ZEQ X;  1NY4 A;  2JA7 G;  5T14 A;  3S15 B;  4KD3 A;  3D4D A;  2WAQ B;  4O1N A;  5IGB A;  5K36 H;  4GN5 A;  4ZRZ A;  3ICE A;  2WB1 G;  1HZ9 A;  2NU7 B;  2B2W A;  4MV4 A;  4JV0 A;  5KT5 A;  1K83 H;  5IIF A;  4K6D A;  2L1B A;  1BVS A;  2K04 A;  1NNX A;  2DZD A;  2XRQ D;  3KJP A;  1TWG A;  4O42 A;  4YP3 A;  4TSS A;  5EPL A;  4O2D A;  4JI2 L;  4F4W A;  3H4D A;  2A73 B;  3VR2 A;  4CJ2 C;  3NHH A;  4QWD A;  3AU7 A;  2E2I H;  1CK1 A;  4DKA C;  2MGS A;  2PQA B;  2C28 A;  4C3H H;  4ZHQ F;  3GV5 B;  2JA5 B;  5CC4 A;  3KHH A;  2ASB A;  3S16 B;  5H1S E;  2DJF C;  5M5Y B;  3E9I A;  1C30 A;  1H9J A;  4JI6 L;  3MR6 A;  4NPS A;  2YW2 A;  5KG2 A;  1F9P A;  1VQI A;  1JB3 A;  2EQS A;  1XPO A;  1DCZ A;  2V4D A;  2Z6B A;  1AH9 A;  4ECV A;  2QEX A;  5K5P A;  5KEE A;  3NTH A;  5KFJ A;  4AYB B;  4DR7 Q;  2PQE A;  1A2U A;  2HCI A;  4BBS H;  4K8I A;  1SEB D;  5EBC A;  3HOW H;  1RTO A;  2ALY B;  4MTD A;  3UDX A;  5F2D A;  2EYP A;  1SE8 A;  3X3M A;  4X64 H;  5DM6 3;  4JG2 A;  3IAY A;  5IY0 A;  1M7J A;  3I3C A;  4IR9 A;  2HDM A;  1X6O A;  4BY1 B; 
#chains in the Genus database with same CATH homology
 1QVC A;  4DV6 Q;  1YIT A;  2KCT A;  5C0X J;  1S72 A;  3J80 i;  1IBL L;  2R7F A;  4IPC A;  4BBR H;  1EYG A;  1TXY A;  3S17 H;  4GKJ L;  1KXL A;  4OWX B;  1K73 C;  4B3R Q;  3GD7 A;  4QL5 A;  3HOZ H;  2A1A A;  2HIV A;  4X65 Q;  2OCE A;  1SRU A;  5IYD H;  2NZH A;  3CME A;  3K7A H;  1V43 A;  5FLX c;  3PIO A;  3KF6 B;  5ELN A;  4UP8 A;  1GVP A;  4GOP C;  1OXS C;  3AYH B;  1VQO A;  1T9H A;  1W3S A;  3J81 i;  3CPW A;  4GOP A;  4A3D H;  1NTG A;  3I4N H;  4P72 A;  4A3M H;  1VQ6 A;  4QGU A;  1N32 Q;  4NXN Q;  1H95 A;  4DR1 Q;  4OO1 I;  1IBK L;  3M9B A;  5LMN Q;  4DR3 L;  4DR5 Q;  4GKJ Q;  1HNZ Q;  3B6Y A;  4R4Q A;  4KHP Q;  1X56 A;  3HOX G;  3PO3 G;  4A3L G;  4LF9 L;  4P75 A;  3TRZ A;  2N49 A;  1YHA A;  1Y1V H;  2AWN A;  4DK6 C;  4X65 L;  1OXU A;  2K52 A;  3H0G G;  3CCL A;  2EIF A;  4BBS G;  1RIP A;  5IP7 G;  1B70 B;  1TWF H;  4LWC A;  2C35 B;  3CQZ H;  2BH8 A;  3JAM i;  1UE5 A;  2JEA I;  1WYD A;  4DPG A;  2OQK A;  3PCO B;  1GKH A;  1VQ7 A;  2R93 H;  2CQO A;  2RCN A;  3HOY G;  2AKW B;  3M7N A;  2PQA A;  4O0A A;  1QZH A;  2R93 G;  4A3I G;  2R6G A;  1JMC A;  5FJ8 G;  1QVG A;  3HKS A;  3PUX A;  4DUY Q;  4AH6 A;  3HOZ G;  2BA0 A;  4L5S A;  4AYB E;  2BA1 A;  1J5E Q;  3NBH B;  5BR8 L;  4HJ9 A;  1TWH H;  4GNX B;  1G51 A;  4LF7 Q;  2XTI A;  1N34 Q;  2F52 A;  1PH7 A;  3TS2 A;  4PZ6 A;  4OX9 L;  3J81 c;  4JI1 L;  2Q2T A;  1TWC H;  3BU2 A;  1YJN A;  1K0R A;  3MXN B;  2OTJ A;  3NEN A;  1Q86 C;  3S14 H;  3CC7 A;  2YU9 H;  3S15 H;  1VQ5 A;  5M3M G;  3H15 A;  1G6P A;  2F3I A;  4UPA A;  4DUZ Q;  4IFD J;  2YYZ A;  2UUC L;  3TEH B;  3G71 A;  2E2H H;  4DV5 Q;  2HIX A;  4HJA A;  4DK3 C;  1WJJ A;  3K8A A;  4DR7 L;  1FVI A;  1VQK A;  1PH3 A;  2UXD Q;  1SN8 A;  4UY8 C;  1HH2 P;  2NVQ H;  4A4I A;  4B3S Q;  4LFA L;  1SFO H;  1MKH A;  4DUY L;  4DV0 L;  4GNX A;  3CCS A;  3A5U A;  1XJV A;  1XPR A;  4LUZ A;  4HIM A;  3KFU A;  1B7Y B;  1HZA A;  4DR4 L;  1IZ6 A;  3TRE A;  1MJC A;  3J81 j;  3PF4 A;  2MNA A;  5AJ3 L;  3GTP H;  3M4O H;  5IT9 c;  4OX9 Q;  1Q82 C;  1M1K C;  1HZC A;  2GN5 A;  3FKI G;  1YZ6 A;  4A3J G;  2JA5 H;  3S2H H;  5IE8 A;  2E2J H;  2RF4 A;  5J3B A;  1VQ4 A;  4DV6 L;  4JI8 L;  4KHZ A;  5IYB H;  5C4X H;  4A3I H;  2VS1 A;  2ES2 A;  4IFD I;  1N32 L;  2NVY H;  2JA6 H;  2R7D A;  3PGZ A;  1K9M C;  1U5K A;  1SLJ A;  2VY3 A;  4DV5 L;  1Y14 B;  1SRO A;  3GTG H;  1EQR A;  1Z9F A;  2GVA A;  3KF6 A;  4AIM A;  4DV3 Q;  2UXD L;  3CW2 C;  2JEB I;  1Q1E A;  1PV4 A;  2B3G A;  5LMU L;  4WJ4 A;  3CAM A;  2Q2I A;  1EIF A;  1JJ2 A;  3F2C A;  2ATW A;  1EWI A;  1EUJ A;  5GAG C;  1HR0 W;  1Z47 A;  4JCV E;  3GTQ H;  3I4M H;  3S1R H;  4A3K H;  3L7Z C;  4POG A;  3HOY H;  4X66 L;  2ZM6 L;  3UE1 A;  1VQH A;  2VUM H;  2CWA A;  4P74 A;  3F2D A;  4JV5 L;  2K4K A;  1CKN B;  3JC6 6;  4YWK A;  4JI4 L;  5HGQ A;  2NZO A;  3A74 A;  4YCU A;  1XMO L;  1IBM Q;  5DLQ E;  4JI8 Q;  2VQE L;  2F4V L;  4Y52 H;  3A0J A;  1OXT A;  4HJ5 A;  4JI7 L;  3CPF A;  1TWG H;  5HY6 A;  3RLF A;  2OWO A;  4KHP L;  4A3M G;  2JE6 I;  1IBL Q;  1QUQ B;  2AWO A;  4PZ8 A;  4EX5 A;  1CSP A;  3E0E A;  4L5T A;  1NBW A;  3KDF B;  1PH6 A;  1KL9 A;  4DV7 Q;  4A3L H;  4A76 A;  5LMU Q;  4B3R L;  4JOI A;  4YHH Q;  1EQQ A;  4OXP A;  5IYD G;  4A75 A;  1M90 C;  4R4I A;  4KI0 A;  1A0I A;  3RR5 A;  4LF5 L;  1XNR L;  1YVC A;  1K3R A;  4JV5 Q;  1UE1 A;  3GDE A;  3K7U C;  4BY7 H;  4A3D G;  3CCR A;  5E7N A;  5ELO A;  1Q1B A;  2JJQ A;  3TQY A;  3CCE A;  1L0W A;  1AE3 A;  3EN2 A;  4IJL A;  1U0L A;  1N36 L;  2KCM A;  4LFB Q;  1VS0 A;  2XGT A;  3T1Y L;  2I5L X;  5BR8 Q;  1QZG A;  1VQL A;  2JA9 A;  2JQO A;  2K5H A;  4DR3 Q;  4LFC L;  4LW1 A;  4GLA C;  2KEN A;  2E5L Q;  3FKI H;  4DV7 L;  1PYS B;  1HNZ L;  1DGS A;  1YHB A;  3NEM A;  3HOX H;  4A3K G;  4NXM Q;  4LF9 Q;  3HOW G;  4L5Q A;  2MFI A;  3I2Z A;  2JA8 H;  2YTY A;  4YY3 L;  2UXB L;  4YWL A;  2Y0S E;  3TS0 A;  1V1Q A;  4QIW E;  1Q81 C;  1JT8 A;  2EXD A;  3Q8D A;  4XTC S;  3IRB A;  2HHH Q;  4A93 H;  1XMQ Q;  1CSQ A;  1VQE A;  4A3E H;  2QA4 A;  1KHI A;  2K5V A;  4XIG S;  2HT1 A;  2JA6 G;  3PUZ A;  4K0K L;  4DV0 Q;  1HNW Q;  1W2B A;  3HKZ G;  1FGU A;  4BBR G;  4LF8 Q;  4LFB L;  4DR2 Q;  1YBY A;  2VZA A;  4LF4 Q;  2KHJ A;  2VL6 A;  1OXX K;  4LFC Q;  2VQF Q;  3RZO H;  3UDF A;  5C44 H;  2UUB Q;  4POF A;  3K0X A;  1OTC A;  2V1C C;  2CKZ B;  3UDI A;  3CXC A;  3RNU A;  1Q12 A;  4JI1 Q;  3CMA A;  4A3B H;  4QY7 A;  4DV1 L;  2ZJR A;  4X62 L;  1VQ8 A;  2K75 A;  3ERS X;  3M4P A;  3RLO A;  3W1B A;  2UXB Q;  5C4X G;  2Z6K A;  3GTM H;  4L5R C;  2PMZ E;  3KOJ A;  2MO1 A;  1YEZ A;  4BY7 G;  1I94 Q;  1LUZ A;  1KIX A;  2UUC Q;  3CCJ A;  2ZTC A;  3GO5 A;  3SGI A;  2DGY A;  4K0K Q;  3AFQ A;  3CCQ A;  4LF8 L;  3AFP A;  4NB3 A;  1QUQ A;  3DLL A;  4HJ7 A;  2UXC Q;  3AQQ A;  3BZK A;  4AYB G;  4LFA Q;  5FJ8 H;  2NVT H;  2H5X A;  2VQF L;  3MEF A;  1QVF A;  1X65 A;  1E7Z A;  3ULL A;  3KJO A;  3BJU A;  1PH5 A;  3G48 A;  3GTL H;  2UU9 L;  1C7Y A;  3STB C;  3RLN A;  4AQY L;  1X3F A;  4BA2 I;  3W5O A;  4JYA L;  3T1H L;  1ASZ A;  2JA8 G;  1XTD A;  1A62 A;  4JI0 L;  1FL0 A;  2Y0S G;  4MZ9 A;  4HIK A;  1NE3 A;  5IWA Q;  5JJK A;  2N3S A;  1L1O B;  3LGJ A;  1LYL A;  1I94 L;  2IX1 A;  1CKM A;  3S16 H;  4IPH A;  1K8A C;  3CD6 A;  1ASY A;  3S2D H;  1XPU A;  1HR0 L;  4DV3 L;  1JB7 A;  2I5M X;  1E1O A;  2LXJ A;  4DV4 Q;  2R92 G;  4DR6 L;  1UWV A;  1VQM A;  4LF6 L;  4A3F H;  3CCU A;  4TQU S;  4R1J A;  3U58 A;  3HOU H;  3I4N G;  2IHF A;  1XNQ Q;  2IX0 A;  4C3J H;  2UU9 Q;  1L1O C;  3UE0 A;  3OW2 A;  2AHO B;  2VUM G;  3PIP A;  5EAY A;  1FJG L;  3T1H Q;  4GLX A;  4GKK Q;  4DNI A;  4QJF A;  1N36 Q;  3U4Z A;  1NMG A;  1Q46 A;  4JI0 Q;  1C9O A;  1YJ9 A;  2VQE Q;  4JI3 L;  2VW9 A;  2OQ0 A;  1PH1 A;  1V9P A;  3EIV A;  1UEB A;  4Y7N H;  2CWP A;  4RMF A;  5C0X G;  2AMC B;  1D8L A;  2LXK A;  2QGQ A;  5IYC H;  1KD1 C;  3FHW A;  1IL2 A;  4JC0 A;  5C44 G;  4A3C G;  2KHI A;  4LUV A;  4OWT B;  4HJ8 A;  2R92 H;  4R4T A;  1WCM H;  2OTL A;  2A19 A;  2K5N A;  3CC2 A;  4DR6 Q;  4C2M H;  2WP8 J;  2I5H A;  5FLM G;  3PF5 A;  1WCM G;  3F1Z A;  1NMF A;  1VQD A;  4A3B G;  1XMQ L;  3HKZ E;  4A3J H;  2JA5 G;  2JA7 H;  1L2F A;  4ME3 A;  3F8T A;  5C3E G;  1XNR Q;  4BXX H;  1IXR A;  4QQB X;  2YV5 A;  4PMW A;  1HNW L;  1PHJ A;  1KQS A;  1YIJ A;  2CCZ A;  4DR1 L;  2ID0 A;  2R7Z G;  4GOP B;  5LMN L;  4DR5 L;  2Q2U A;  1HNX L;  4JI3 Q;  4P71 A;  4B3T L;  3AEV A;  4B3M L;  2E8G A;  1YI2 A;  4LUO A;  5GAD C;  2VNU D;  1X54 A;  2YTV A;  3A5Z B;  4OO1 G;  1JJC B;  3ULP A;  1PH8 A;  4GS3 A;  5IYC G;  4JBJ A;  4JI6 Q;  2PNH A;  1I3Q H;  1JJG A;  1BKB A;  4OON A;  2WFW A;  3UDG A;  4DV1 Q;  1LTL A;  2PI2 A;  2ZJP A;  2NVX H;  2UUA Q;  4NXM L;  2WAQ E;  1OXV A;  4R4O A;  1S3O A;  2N8N A;  3HOV H;  5LMN W;  1WFQ A;  4YY3 Q;  4J15 A;  4PG3 A;  3PUV A;  5IP9 G;  3U50 C;  1TWA H;  1PFS A;  1N8R C;  4TVA B;  1E3P A;  1I5F A;  2LSS A;  2UXC L;  3PV0 A;  1HNX Q;  1RL2 A;  4B3T Q;  4JI2 Q;  3H3V H;  2IY5 B;  4X64 L;  4A3G G;  1SR3 A;  4DR2 L;  3I7F A;  4PZ7 A;  1J5E L;  1CKN A;  2IHE A;  1A8V A;  3D31 A;  5GQO A;  3RN5 A;  3D0F A;  3GTO H;  3PSI A;  5JJI A;  1N34 L;  3PO3 H;  3NEL A;  4AQY Q;  4X66 Q;  2ZM6 Q;  1N33 L;  4IOA A;  1L1O A;  1KRS A;  4DV2 L;  1E1T A;  1SMX A;  5IYB G;  3I56 A;  1Y1W H;  5GAE C;  3GTJ H;  4JI4 Q;  1HZB A;  1MIU A;  3S1Q H;  3M4Q A;  1XMO Q;  1IBM L;  2DUD A;  3KDF A;  4WJ3 M;  4YCW A;  1LM0 A;  4EQ5 A;  4A3E G;  5JJL A;  3J80 c;  1PH9 A;  1UE7 A;  3W1G A;  1E24 A;  1C0A A;  2NN6 I;  5M3F G;  3STB D;  4IO9 A;  1HR0 Q;  2MQH A;  3I4O A;  4GN3 B;  3JAM c;  4B3S L;  3CP0 A;  1O7I A;  2PI2 E;  5GRO A;  1EIY B;  4LF6 Q;  2D62 A;  4JBW A;  4YHH L;  4A3G H;  1BBW A;  4X64 Q;  5K36 G;  2L15 A;  3RZD H;  1XNQ L;  1EFW A;  1VQF A;  4IOC A;  2YTX A;  2RHS B;  2WAQ G;  3H0G H;  4IJH A;  1R9T H;  3H3V I;  3CCV A;  4R4C A;  1N33 Q;  4A93 G;  1B8A A;  4GKK L;  4MNO A;  4NXN L;  4DAM A;  4A3F G;  1WOC A;  1X3G A;  3L2P A;  2D0O A;  4JI5 L;  3OTO L;  4KLK A;  3S1N H;  4IFD G;  1G29 1;  3HOV G;  4GLV B;  1GO3 E;  2Q2H A;  1S40 A;  1VQN A;  1I50 H;  4P73 A;  1NJI C;  3U4V A;  3T1Y Q;  2HQL A;  3M3Y H;  4GN4 B;  5IWA L;  3EBE A;  1PYB A;  5JEA G;  1KAW A;  1GM5 A;  3G4S A;  1A63 A;  3G6E A;  1JE5 A;  2CFM A;  5IP9 H;  1YHQ A;  3HOU G;  3K80 C;  4BA1 I;  2Z6K C;  1IYJ B;  4OWW B;  5FLM H;  1I6H H;  4H02 A;  3CCM A;  3PUY A;  1YNX A;  1MJE A;  1BBU A;  1HJP A;  2D0P A;  5C3E H;  1E22 A;  2HHH L;  4BXX G;  1YJW A;  1VCI A;  1J6Q A;  4HIO A;  1PA6 A;  3KYH C;  3M85 A;  1FJG Q;  1CKO A;  1EOV A;  1VQG A;  1Q8K A;  3ER0 A;  2MO0 A;  1PH4 A;  4B3M Q;  4APV A;  3GTK H;  3WWV A;  3J7A 5;  1Y1V G;  1IBK Q;  4DAY B;  4LF7 L;  3BZC A;  1KRT A;  2UUB L;  4IPD A;  2B29 A;  5M5X H;  3VDY A;  4UP7 A;  3CF5 A;  1D7Q A;  5M3F H;  1K8G A;  3I4M G;  1X3E A;  2UUA L;  1PVO A;  1CUK A;  3RN2 A;  3F2B A;  1WI5 A;  1NY4 A;  2JA7 G;  2I0Q A;  2FXQ A;  2N78 A;  3PUW A;  3PO2 G;  5IP7 H;  4GN5 A;  3ZJY C;  2ZJQ A;  3ICE A;  2WB1 G;  1HZ9 A;  1AE2 A;  1K83 H;  2JK8 A;  2RHQ B;  5C0X I;  4LF5 Q;  1BVS A;  1VQC A;  4IPG A;  3J7Z C;  3KJP A;  3CC4 A;  4RG1 A;  5M3M H;  3I55 A;  1X9N A;  1Q7Y C;  2K14 A;  2IT1 A;  4O2D A;  3DM3 A;  4JI2 L;  4BY1 H;  4GNX C;  4YWM A;  2ZTE A;  2B63 G;  2NN6 G;  2WB1 E;  5JEA J;  4BY1 G;  4A3C H;  3ULJ A;  2E2I H;  4DKA C;  2E5L L;  2PQA B;  3L0O A;  3K81 C;  4YCV A;  4C3H H;  4ALP A;  4X6A H;  4MTN A;  1VQA A;  1VQ9 A;  4UP9 A;  2ASB A;  1VQJ A;  5H1S E;  3E9I A;  4JI6 L;  3KF8 B;  4JYA Q;  4NPS A;  3FP9 A;  3OYY A;  4HID A;  1P8L A;  4LNQ A;  4JBK A;  1VQI A;  1P16 A;  2BH2 A;  4C3I H;  2EQS A;  4JOI C;  1XPO A;  1AH9 A;  1Y1W G;  4DUZ L;  2QEX A;  2KBN A;  1N9W A;  5M5W H;  2A8V A;  4LF4 L;  2B63 H;  3KLW A;  4DR7 Q;  1VQB A;  2GVB A;  4BBS H;  1VQP A;  4DV4 L;  3HFZ B;  2R7Z H;  2ZTD A;  3HOW H;  1X55 A;  1KC8 C;  2ALY B;  2K50 A;  2Z0S A;  3UDX A;  4JBM A;  5M5Y H;  1UE6 A;  4DR4 Q;  1SE8 A;  1PH2 A;  4JG2 A;  3S24 A;  5AJ3 Q;  3OTO Q;  5GAH C;  5IY0 A;  4JI5 Q;  2F4V Q;  4DV2 Q;  1GD7 A;  4FDB A;  3S1M H;  4X62 Q;  3PO2 H;  4JI7 Q;  5C4J H;  3E9H A;  1X6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...