4A93G

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a93G01
1UWVA 4GLAC 4LFAQ 4MZ9A 4QL5A 3RZOH 2FXQA 3PCOB 4X64Q 4P74A 4DV0Q 1IBMQ 1N32Q 2UXBL 2AWOA 2MFIA 2A1AA 4X62L 3S15H 1KXLA 1TWFH 2KHJA 2AHOB 4QJFA 3H0GG 1QZGA 5IT9c 3G4SA 4FDBA 1B7YB 2EIFA 4OXPA 1EQRA 1RIPA 3KF8B 1C9OA 3J81j 1VQ8A 2VZAA 4UPAA 1KAWA 4LF5L 1WI5A 3RZDH 1S40A 1G291 2HT1A 1YJ9A 4GKJL 1GVPA 4AIMA 4BY1H 2RHQB 1VQ7A 4OWXB 1KRTA 4JI1L 4C3HH 1UE1A 1XNQQ 1JT8A 2V1CC 4X65Q 3G6EA 2ZJPA 4RMFA 2WFWA 1I94L 4DAMA 1HR0L 1IBLQ 4LF7L 2L15A 3HOUH 4L5TA 3A5ZB 3CCRA 2ALYB 3CPWA 2KCTA 4DR2Q 4LFAL 3S1MH 1NJIC 1EIYB 4X64L 4DV0L 1N32L 1GO3E 1IBML 4A3DG 4JBJA 1VQHA 3CCEA 1PH9A 1Y1WG 1ASZA 4POFA 2OCEA 3U4VA 2VUMH 3CCVA 5M3FH 1XPUA 1XMOQ 1KQSA 2DUDA 3U58A 3KYHC 4YWMA 1W3SA 1K3RA 5IE8A 2R7FA 3CC7A 1VQAA 4DUYQ 1N36Q 3M4QA 3Q8DA 2F3IA 2VS1A 3GO5A 4LF8Q 4A3LG 2K5NA 2JJQA 1KHIA 1H95A 4BY7G 4DR1Q 1TWAH 3B6YA 3H3VI 1XNQL 5AJ3Q 5M3MH 3UDIA 4APVA 4X65L 1IBLL 4UP7A 1NE3A 2EXDA 1NMGA 2JA5H 4KHPQ 1K83H 1PH8A 3TQYA 2YTXA 4EQ5A 2OQ0A 2ATWA 4MNOA 2Q2IA 2GVAA 1EUJA 4DR2L 4R4OA 4X66Q 3PO3H 1XPRA 1UEBA 2R92H 1YZ6A 1LM0A 4A75A 1HNZQ 1BBWA 3NENA 4BA2I 4TVAB 2JA9A 2I5LX 3S16H 1CKMA 1XMOL 2BH8A 1Q7YC 1M1KC 3HOXG 3GTOH 3F8TA 3H15A 4OO1G 1N34Q 4DUZQ 2NN6G 1N36L 4DUYL 1YJNA 5FLMH 2MO0A 1MJEA 4A3KG 4LF8L 1PYSB 3ZJYC 4LFBQ 3UE1A 4DR1L 1OXTA 1QVCA 4BA1I 5AJ3L 3CMAA 3RN2A 4A3CH 4KHPL 1R9TH 3J7ZC 5GADC 3NBHB 1C0AA 3M4PA 4JI8Q 1FL0A 3MEFA 4DR7Q 3J81i 1VQIA 3CPFA 2F52A 3E9HA 4X66L 1VQLA 3HKZG 2A8VA 5IYBH 2JA6H 3CW2C 1PH5A 3RLOA 2ZJRA 3I4NH 3AEVA 1HNZL 4JBMA 3PSIA 4A3MH 1X3FA 4DV5Q 3CCLA 4LF9L 3PUYA 2PMZE 4QY7A 5M3MG 1XNRQ 5LMNQ 1N34L 4DUZL 1Z9FA 3OW2A 2JA5G 4B3TQ 1DGSA 2WAQG 3H3VH 3J81c 2ZTEA 1E1TA 1VQDA 4GOPA 4LFBL 2B29A 1Q12A 1L1OA 4XIGS 4LFCQ 3PO3G 1SE8A 2R92G 1IZ6A 1UE7A 2BH2A 2NZHA 3KDFA 4BBRG 2E2IH 1YHQA 1PH1A 2E5LQ 1CKOA 3CMEA 1SFOH 2R7DA 4GN3B 3BU2A 4JI8L 3RNUA 4R4IA 2YU9H 1EIFA 4PMWA 4DR7L 1X54A 2JA7H 2I5HA 3F2BA 2AWNA 1QVGA 4Y52H 1KL9A 4A3GH 2OWOA 4A93H 1KIXA 4JG2A 4HJ5A 4GOPC 4A3DH 5FLMG 1L1OC 2PQAA 2IT1A 1NMFA 4JBWA 1JJCB 1Y1WH 1XPOA 1QZHA 2BA0A 2PI2A 4DV5L 4JOIA 1HR0W 1IYJB 4BXXH 5JJIA 1P8LA 3S1RH 4DV3Q 1XNRL 3CCUA 3TS2A 3F2DA 5LMNL 4A3CG 1XTDA 1VQMA 5IY0A 4DR6Q 4B3TL 4POGA 4LW1A 4GNXB 4JI7Q 1VQOA 4BY7H 1Q8KA 4LNQA 2AMCB 1EWIA 2BA1A 4J15A 4LFCL 1EYGA 3S14H 2K5VA 5IYBG 2JA6G 3K7UC 4JC0A 4JOIC 2I0QA 4L5RC 5IWAQ 2GVBA 4IO9A 3I4NG 3HFZB 2E5LL 4DAYB 4A3MG 1V43A 2ID0A 3F2CA 1K0RA 1YHBA 3EBEA 4A4IA 4HJ8A 3W5OA 4AYBG 3KJOA 4ALPA 4KHZA 3UDFA 1BVSA 3SGIA 5IP9H 2NVYH 5LMUQ 2K5HA 3ULLA 2JA8H 3GTLH 3ER0A 3ICEA 5GQOA 4A76A 1ASYA 2HIXA 4AH6A 3STBD 2UXCQ 4IPGA 5ELNA 1LYLA 3HOXH 1J6QA 4DV3L 3HOVH 4R4QA 1M90C 2NVXH 2QGQA 1JJGA 1X65A 4A3KH 3S17H 4LUVA 4DR6L 3STBC 2XGTA 4DV6Q 1PA6A 3BJUA 3HOZH 4JI7L 4JYAQ 5C4XH 2JA7G 4OWTB 1K9MC 2Q2TA 1GD7A 3CQZH 5H1SE 3GTMH 4A3GG 4A93G 3BZCA 4YHHQ 1Q1BA 1WYDA 4GN5A 5IYCG 1YVCA 1D8LA 5IWAL 3NELA 2MO1A 1KC8C 1N33Q 3I55A 3GTGH 2N3SA 1NY4A 4LUZA 3L0OA 4BXXG 2WP8J 2RHSB 3KOJA 3PV0A 2QA4A 3CCMA 2NZOA 4JBKA 1SN8A 5BR8Q 2N8NA 4C3IH 5GAHC 3MXNB 1QVFA 1MJCA 3OTOQ 2K75A 1JE5A 1U0LA 4R4TA 3PIOA 1VQ5A 4L5QA 5LMUL 5K36G 1KRSA 2XTIA 2N78A 3NEMA 1LUZA 2UXCL 3PUZA 1WCMH 1WJJA 1I50H 1HJPA 4XTCS 4JI2Q 3D0FA 3UE0A 3TS0A 2ES2A 1Y14B 4HJAA 5ELOA 1VQEA 2H5XA 1IBKQ 4IPCA 4DV6L 1Q86C 1JJ2A 4JYAL 3RR5A 2RF4A 1VQ6A 4B3RQ 2WB1E 2K52A 2E2JH 3S2DH 4HJ9A 4YHHL 4BBRH 5IYDH 3A5UA 4A3BH 5IP9G 3CCQA 1I5FA 1NTGA 1YBYA 1NBWA 3PUVA 1OXVA 2JA8G 1B8AA 2R6GA 3AFPA 1FJGQ 1OXSC 4LF9Q 1N33L 3KFUA 3E9IA 5C44H 2R7ZH 3HOVG 1B70B 5BR8L 2UU9Q 4NXMQ 3PUXA 1N8RC 4R1JA 3OTOL 5M5WH 4JV5Q 3HOZG 1JB7A 1CSPA 3GDEA 1HZCA 5C4XG 3PGZA 3TEHB 3CCSA 4P71A 4LUOA 4DV7Q 4NXNQ 1L2FA 1I3QH 1E3PA 4JI2L 3T1YQ 1VQPA 3TREA 1CKNA 1Q81C 1CUKA 1RL2A 1IBKL 5C4JH 2Y0SG 3WWVA 5C0XI 2C35B 4B3RL 3CF5A 1Z47A 4YWKA 4NPSA 5M5XH 1TWHH 4IPDA 4R4CA 4IPHA 4MTNA 4OONA 5HY6A 1E22A 4PZ7A 5JEAG 1FJGL 3AYHB 5LMNW 5JJKA 4TQUS 4JI6Q 1P16A 1WCMG 2UXDQ 1GM5A 2OQKA 2IY5B 4BBSH 2ASBA 2UU9L 4NXML 2RCNA 4WJ4A 1XMQQ 2EQSA 4JV5L 2YTVA 1UE6A 5C3EH 3VDYA 2B3GA 1JMCA 4DV7L 1YIJA 3KF6B 4ME3A 4NXNL 4DNIA 4DPGA 4IFDI 5IYDG 4A3BG 3T1YL 3PF4A 4LF4Q 4GN4B 3W1GA 1OXUA 4YWLA 4JI4Q 3A74A 1I6HH 1IXRA 5C44G 2R7ZG 1A63A 1Q1EA 1X6OA 2JE6I 2QEXA 4PZ6A 3J80i 3FHWA 3RLNA 2LSSA 5IYCH 1PFSA 1KD1C 1PH2A 1TWCH 4P73A 4OWWB 2B63H 2Q2UA 1X56A 4O2DA 1AE2A 1VQFA 4JI6L 2CFMA 2MQHA 2ZTCA 2LXJA 3L7ZC 5C0XJ 4IOCA 4HIDA 4JI3Q 2UXDL 4YCUA 1PH6A 4UP9A 3E0EA 1HNXQ 1S3OA 1XMQL 1A62A 4C3JH 4C2MH 3G48A 3I56A 1YI2A 3J80c 4DR5Q 1VQGA 2CWAA 5M5YH 1QUQB 2YYZA 5E7NA 1VQ9A 3HKZE 2PNHA 1UE5A 4QGUA 4DV1Q 1VQ4A 4LF4L 3HOYG 3GTPH 4JI4L 3CP0A 1YITA 2NVTH 1VQJA 2CKZB 2UUBQ 3K0XA 4BBSG 1O7IA 2VY3A 1TWGH 2VQFQ 4WJ3M 2R93H 4DKAC 4IFDJ 1OXXK 4B3SQ 2OTJA 2F4VQ 2PQAB 3CAMA 4IJHA 1PYBA 2WAQE 5C3EG 2IHFA 2K14A 4DR3Q 3L2PA 1V9PA 1MIUA 4HIOA 4HIKA 4JI3L 4AQYQ 2D0PA 1J5EQ 3GTKH 3PO2H 3FKIG 4DK6C 2I5MX 1HNXL 4O0AA 3PIPA 4QIWE 4A3EH 2IX0A 5J3BA 3M3YH 2CWPA 2IHEA 1YEZA 1YHAA 2WB1G 1AE3A 3CC4A 2JK8A 4DR5L 3G71A 4JI0Q 5JEAJ 3U4ZA 2VL6A 3D31A 4QQBX 5HGQA 4DV1L 3BZKA 2ZM6Q 3K81C 4DK3C 4LF6Q 2B63G 1N9WA 2UUCQ 3FP9A 1TXYA 4GS3A 2UUBL 5FJ8H 3U50C 1EQQA 2VQEQ 1U5KA 1BBUA 2N49A 2VQFL 2KCMA 4PZ8A 1K8AC 1IL2A 2D0OA 4B3SL 2F4VL 1HH2P 2CQOA 2A19A 3EIVA 2ZJQA 4NB3A 1T9HA 3RN5A 5IP7H 4DR3L 2KBNA 4AQYL 4A3JH 1J5EL 1G6PA 2GN5A 4B3MQ 3AFQA 1SRUA 3W1BA 1VQBA 1AH9A 2KHIA 5C0XG 2HHHQ 3S1NH 2LXKA 2K4KA 4HIMA 3GTJH 1X3EA 2JEAI 4A3IH 3UDGA 2OTLA 4GLVB 4YY3Q 2HQLA 2UUAQ 5FLXc 2R93G 4JI0L 3DLLA 2NVQH 4AYBE 5DLQE 3M85A 4UY8C 2CCZA 3CCJA 2ZM6L 4LF6L 3M9BA 1SR3A 1GKHA 1PH7A 2UUCL 3TRZA 3CXCA 1HZ9A 3HKSA 1PHJA 1E1OA 1WFQA 3RLFA 2VQEL 1L0WA 5EAYA 1YJWA 3PO2G 1E24A 4GKKQ 2PI2E 1HNWQ 4A3EG 4YCVA 3CC2A 1CSQA 2JQOA 3OYYA 3S24A 3T1HQ 1BKBA 4DV2Q 4IFDG 3I2ZA 3EN2A 3IRBA 4K0KQ 1Q82C 4KLKA 1VQKA 4B3ML 3UDXA 3GD7A 2E8GA 4A3FH 1HZBA 3AQQA 5GAGC 1SLJA 4BY1G 1E7ZA 2HHHL 1Y1VH 4P75A 3KJPA 3ERSX 5FJ8G 3I4MH 1VS0A 2Z6KA 1WOCA 4YY3L 3ULPA 2UUAL 3HOUG 1EOVA 4IOAA 5GAEC 3K8AA 2MNAA 1YNXA 3HOYH 3LGJA 1PV4A 1MKHA 4DR4Q 1Q46A 2K50A 3HOWH 1D7QA 1SMXA 5IP7G 3M7NA 1W2BA 4YCWA 3KF6A 4A3JG 2E2HH 4X6AH 1K8GA 4OX9Q 2HIVA 4GKKL 4H02A 1FVIA 3DM3A 4KI0A 1HNWL 2Z6KC 4RG1A 1VCIA 4A3IG 3I7FA 3JC66 3KLWA 5M3FG 3T1HL 2VUMG 4DV2L 3K7AH 1OTCA 3PUWA 1EFWA 1K73C 4DV4Q 4K0KL 3I4OA 4IJLA 3J7A5 3FKIH 4JI5Q 2ZTDA 2AKWB 1VQCA 2JEBI 3ULJA 1CKNB 3H0GH 3JAMi 1HZAA 3K80C 1G51A 1XJVA 2IX1A 4LWCA 2YV5A 1FGUA 5GROA 1PH3A 3CD6A 2DGYA 2VNUD 2Q2HA 4GNXA 1C7YA 4OO1I 2NN6I 3M4OH 4DR4L 4EX5A 2KENA 3A0JA 4PG3A 4P72A 1V1QA 3S1QH 4UP8A 2UXBQ 1QUQA 4JCVE 4X62Q 4A3FG 4Y7NH 4L5SA 1X3GA 4OX9L 1PVOA 1PH4A 1Y1VG 4HJ7A 3JAMc 5JJLA 1X55A 4GOPB 3PF5A 3I4MG 1S72A 1L1OB 4GNXC 2Y0SE 1LTLA 4DV4L 4LF5Q 3KDFB 1A0IA 1VQNA 4JI5L 1X9NA 4GKJQ 4GLXA 3S2HH 3F1ZA 2YTYA 3HOWG 2Z0SA 4JI1Q 2D62A 3GTQH 1HR0Q 1I94Q 4LF7Q 1SROA 2VW9A 4A3LH 1A8VA
chains in the Genus database with same CATH superfamily
1S03G 5LMUH 5JUMA 1SFOB 3RZOH 2YU9B 4DV0Q 1IBMQ 3NGDA 5J22A 2YRWA 4QJFA 5IT9c 1CZWA 3KHRA 4FDBA 3RMHA 1B7YB 3MA2B 2PMZA 5KT5A 3E5NA 4DR2H 2F0SA 1KAWA 5KFPA 3S1RB 1G291 1JX4A 1YJ9A 4GKJL 5KFGA 1GVPA 4BY1H 2VA3A 3KUPA 4C3HH 1UE1A 1IBLQ 4RMFA 2WFWA 4ULLA 5LL6X 1I94L 3HOUH 4LF7L 3SEBA 3J80E 1JOKA 4UFZA 2HCIA 2ALYB 2F0OA 3T56B 2XIGA 4CC5A 3T53B 1SYFA 2KCTA 3QR8A 4LFAL 1GSAA 1G8ZD 1NJIC 4X64L 1B04A 1N32L 4A3DG 2HVQA 4J9MA 4LMQD 3RV3A 4JI2H 3CCVA 2PW5A 2NVYB 1XMOQ 1XPUA 3JSLA 3GTLB 2JA8B 5JH7F 3U58A 5HURA 1Q90A 1JDEA 5D14A 3KYHC 4YWMA 5IE8A 3S1NH 4O3QA 2R7FA 4B3RH 1VQAA 3TQTA 2F3IA 2VS1A 3GO5A 4V190 5L1KA 2NVXB 4G57A 4DR1Q 1TR5A 1AZQA 5DLGA 3DWPA 5AJ3Q 3K5LA 1F77A 2J6UA 4LF9H 1F2MA 4X65L 5EKLA 4KHPQ 2N55A 4YR2A 1K83H 3TQYA 4EQ5A 4LF6H 2OQ0A 2ATWA 2JA7A 4MNOA 1NAPA 2GVAA 1BGWA 1JORA 2R92H 2VB3X 5ISRA 4HAEA 4DAPA 2Z6BA 1LT6D 3GIIA 4TVAB 2JA9A 2I5LX 4C3HG 1JDBB 1K83A 1F2YA 1M1KC 3HOXG 4MV4A 2WACA 3F8TA 1N34Q 2RSOA 3IG0A 5FOBB 5KFLA 1I50B 2MO0A 2EJFC 4A3KG 1MJEA 4LF8L 1PYSB 2K05A 4LFBQ 5JAVA 1H9MA 5LYJF 4DV5H 1GUWA 3Q1KA 4G7HC 1OXTA 4BA1I 2J7ZA 4FXKC 3RN2A 3J7ZC 3GIDA 2AGQA 2AUJD 2JXMB 1AUVA 5HV6A 5T1IA 4YR3A 1EOTA 3CW2C 5C44B 5KFVA 1KDBA 2ZJRA 3I4NH 3AEVA 4YB8B 2XWBB 1C4QA 2V4DA 2AQ3B 3NTHA 1SE4A 3IFTA 3KK7A 2UVUA 3BABA 1A6XA 3TBIB 5LHY1 3K58A 1DGSA 2IL8A 2A6HC 3ORRA 4RB0A 2QK4A 2W6QA 2K03A 5DAUA 2VPQA 2B29A 3G7LA 4LFCQ 3ONAB 2R92G 4EQPA 2BH2A 5C4JB 3WDNA 1YHQA 2E5LQ 4HMJA 3CMEA 1SFOH 3AMUA 3RNUA 1V4YA 4R4IA 2YU9H 1EIFA 4PMWA 4ZOLF 2FLPA 2DPJA 3HOYB 4C5AA 1LTSD 1B4OA 1KL9A 2SDFA 2FPPB 4QW8A 1KIXA 4RKBA 3QFFA 1E4FT 4FS2A 4BBSB 4AYBB 1CQFA 4CJ1B 1QZHA 4DV1H 2FPIB 3V05A 3K5OA 3S1RH 1XNRL 2RGVA 3RFCA 3RJ0A 4OIJA 4Q44A 5IY0A 3K7AB 4B3TL 3LX0A 4JI7Q 1LTID 5KNCA 2AMCB 4O42A 5FLXW 4ZRZA 3K59A 1EYGA 2R7NA 3TP8A 3I4NG 4TRDA 4IO9A 5GONF 2A74C 3WO0A 1V43A 2V4RA 4FF2A 2PPBC 1SSOA 1K0RA 1YHBA 5CAEB 2ICEC 2W6PA 3OMGA 4ABNA 5J2TF 3W5OA 4C1NK 4KHZA 1BVSA 2Z8LA 5KG0A 2NVYH 5LMUQ 2JA8H 3GTLH 1ICFB 3A8IE 1ASYA 2HIXA 3STBD 2ZM6H 4C3JB 1LYLA 1PZJD 3KHLA 2NVXH 1GGOA 1F9RA 2C00A 1X65A 2VQEH 1GYFA 4LUVA 4DR6L 1PA6A 4R7RA 4CDFC 2NVYA 4OWTB 3MWEA 3GTLA 2J9GA 3GTPB 2B2WA 5H1SE 4YHHQ 1Q1BA 4GN5A 2B2YA 1QG7A 4QW9A 2R93B 2NVXA 1KC8C 3MWYW 1CI3M 1L2ZA 1SYXB 2DNCA 3KOJA 2HHHH 4X3KA 2OF1A 1SEBD 1BXTA 2K75A 5DGAA 2B2WC 4R4TA 3PO2B 4L5QA 1B9NA 4R8NA 2XTIA 3NEMA 2B2YC 1LUZA 2UXCL 3KAJA 3M3YB 1FJGH 1I50H 4XTCS 2WV6D 4JI2Q 3UE0A 3TS0A 2ES2A 1W93A 1VQEA 1PLFA 2MCTA 1JJ2A 1XYIA 2C28A 4JV5H 1HNWH 2N88A 1VQ6A 4B3RQ 4ECVA 2K6AA 1FYCA 4ZUIA 5IYDH 1I50A 5KFKA 2JA8G 3PUVA 1OXVA 1B8AA 2R6GA 3MWDA 3KFUA 4LF9Q 4E4TA 2WAQA 5C44H 3KLSA 4WFN3 2XRQD 4CDDC 5BR8L 3O13A 5L1LA 3TIGA 1M7JA 3T5LA 4A3JB 1SYDA 5AFWA 3JAMW 4NLGA 3NXWA 3PGZA 3CCSA 4DV7Q 2PVPA 1L2FA 4XDXA 4JI6H 2FINB 3QB3A 2HUGA 4RGMA 3JRWA 1B50A 1RL2A 5EOYA 4F4WA 5C4JH 2LS01 5ELFA 3GQCA 3CF5A 1JICA 2IW3A 3VPCA 1SYGA 4OONA 5JEAG 2I46A 3J81L 5LMNW 3BYTB 4FF3A 3D4DA 4OELB 2OQKA 4BBSH 4RB2C 3LWUA 3VYSA 1B53A 3MFGA 3K3VA 2NUAB 5KFJA 2YTVA 1UE6A 2CQYA 5KG7A 1JMCA 3A7LA 3EFXD 4ME3A 4NXNL 5IYDG 4FBUA 4UCVA 3T1YL 3PF4A 3DM1A 4AYBA 4Q45A 2UXBH 5C5JA 1U4RA 3N42B 4X62H 3A74A 4CKBA 5C44G 4ECTA 5KG6A 3SR1A 2QEXA 1SNPA 4PZ6A 3J80i 3HOWB 1PFSA 1HA6A 3HP3A 2CH4A 5J39A 4O2DA 3GIJA 4QWBA 1AE2A 4RFBA 3L7ZC 4ECRA 4IOCA 3IAYA 4HIDA 4JI1H 1DXMA 1QNUA 4XQNA 1S3OA 4C3JH 2KJXA 1HUMA 3BVMA 4RGOS 2R8KA 1KABA 3I56A 3SHLA 2FK3A 2R85A 2F4VH 2B8GA 1DD2A 4BWSC 3J80c 2IJ0A 3H0GB 2WB1B 1QUQB 4HN7A 3QIAA 1VQ9A 3GLKA 1UE5A 2L9HA 4QGUA 4DV1Q 3QWNA 3HOYG 3GQBA 5C0XH 1IHZA 3GTPH 1YITA 3EROA 4BBSG 1O7IA 2L55A 2VY3A 3M4OB 1GSOA 1CZGA 2V5AA 2R93H 3J81E 4IFDJ 3N43B 4M7EA 4DGZA 2K1BA 4J9NA 1V1PA 4R8IA 1MIUA 4HIOA 3GTPA 2D0PA 1TS5A 3PO2H 4TV9F 3JZIA 3OSPA 2LY7A 4KJOA 4FNFA 3PIPA 3M3YH 2R93A 5J3BA 1EEID 2JN4A 3P7JA 4E6IA 2R84A 3A56A 1YHAA 1EYAA 3PW2A 2R8GA 2PZUA 3GTQB 3BZKA 3M4YA 2ZM6Q 4ED6A 1N9WA 1SMYC 3FP9A 2UUBL 4G3IA 3OPOA 2VQEQ 1ZEQX 1VBGA 2UUAH 1WTXA 1LTAD 4C3JG 3NQIA 4IUNA 1EL0A 4DUYH 1HH2P 4TQSA 3EIVA 3M4IA 3S15B 4J9KA 4DR3L 4A3JH 4BWGB 3EJIA 2CQAA 3AB9A 1VQBA 3QG1A 2KHIA 5C0XG 2HHHQ 3BG5A 4HIMA 4ME6A 3C3LA 4JW0A 3RZDB 1KLGD 3UDGA 3K5IA 1NSNS 2R93G 1WCMA 4ECWA 5DLQE 3LNNA 3M85A 4UY8C 2CCZA 3MC0B 1HQMC 3L9AX 1PH7A 3VA7A 2O4XA 1HZ9A 3CXCA 3HKSA 3PO2G 1WFQA 3RLFA 2FE3A 1WTPA 2I8CA 2ZXRA 2VUGA 2VQDA 1HNWQ 3C1EA 2F03A 1BKBA 3KHHA 2VUMB 5M3FB 2R7ZA 4FM9A 4O3OA 3R3OA 3K5NA 3GD7A 1HZBA 2R8JA 5GAGC 2UVVA 3KJPA 2RSNA 3GV3A 5KG5A 4JI8H 4DR7H 4O3PA 2Z6KA 5EPJA 2KSWA 2WKDA 1EOVA 4NW2A 5GAEC 2MNAA 1RODA 3LGJA 2V4QA 1PV4A 1Y8OB 2JA5B 3HOWH 1EWHA 4A3JG 1PZKD 1S5CD 2F0VA 3RD4A 3PO3B 3SXHA 3DM3A 3CU7A 2Z6KC 5LL6S 3BVZA 3JC66 4QIWB 3T1HL 2KA7A 1DOMA 4IUTA 5KG1A 5KFHA 2D5DA 3V6HA 3I4OA 1CE8A 2ZTDA 2AKWB 5D65A 3A7AB 3ULJA 1CKNB 4RZRA 3H0GH 1UUPA 3K80C 1HZAA 2D9UA 2A68C 2F0UA 1XJVA 2DWCA 4F4YA 1A3TA 2YV5A 1FGUA 2J4XA 1M0WA 2VNUD 2Q2HA 5BN4A 5IGDA 4GNXA 5KFWA 2CH4W 2NN6I 3M4OH 1FR3A 2VPSA 1EUDB 1XXGA 5JVH3 2EYFA 2RQXA 2XCLA 3RTXA 3SE7A 3WOFA 5C4ZA 3S1QH 4UP8A 2UXBQ 5KEEA 1QUQA 2WB1A 3M9OB 4X62Q 2R61A 4DAYA 1X3GA 1HR0H 4HNVA 4C56C 1PH4A 4IRCA 2JA6B 3JSNA 5DM63 4EQNA 2DN8A 2B2UA 5KIXA 3MTSA 2EYOA 4GNXC 2Y0SE 4FO2A 4DV4L 4FF1A 4FYDA 4F7XA 2YCHA 5KFTA 4PV1C 4GLXA 3F1ZA 3JRXA 3HOWG 5KYIA 2R7KA 4JI1Q 4DL6A 3GTQH 1AN8A 1NNXA 2B2UC 5FO8B 3G6YA 5CV6A 3BYYB 1AEXA 3TP5A 4H44C 4DL5A 1ENCA 1BCPD 4GLAC 4MZ9A 2R86A 4EFEA 4RH6A 2AWOA 3J7AF 1KXLA 3S9WA 1TWGA 3S15H 1IBLH 3GTQA 4A93B 4UCTA 3H0GG 1VMCA 2SEBD 3G4SA 5F9LA 1TWCB 4DV6H 1EQRA 4O3RA 1C9OA 4UPAA 4LF5L 3GTKA 1JLLB 3RZDH 2HT1A 4AIMA 1SYEA 2RHQB 3R8BA 4OWXB 2I80A 2W8LA 4J8QA 1LLRD 2FJ2A 1N33H 1JT8A 3G6EA 4ED8A 1UEAB 1IL8A 4DAMA 2L15A 1Y69U 4L5TA 1BBXC 5KFSA 5CA0F 3MFHA 3CPWA 4OL7A 1QNKA 4ZCKA 4FS1A 1SYCA 1GO3E 3FDTA 4JBJA 1VQHA 2HCCA 5FLXL 1QB5D 3H20A 1PH9A 4RU9A 5CV9A 2IP4A 2VUMH 2EJGC 3NBIA 5M3FH 1T94A 1D5XC 3ND9A 4MTKA 1ET6A 2GA4B 2PNRC 1N36Q 4DUYQ 1C7YA 2AUKA 3HOXB 1W96A 2BE5D 3ZYYX 3E6ZX 3RUPA 5JVG3 4DU9A 2JJQA 3OW7A 3VR2A 4A3KB 3B6YA 3H3VI 1XNQL 5KFFA 2VUMA 1ZETA 5DNFA 5C4XB 4APVA 3RGXA 1EY6A 1NMGA 3CQZB 2JA5H 3I12A 3WO1A 2UU9H 2NWGA 2YTXA 1T5EA 3SVMA 4NXMH 1MBYA 3IKJA 1B33N 3OHAA 4DR2L 4RUAA 3GTGB 4LFBH 1AW7A 3PO3H 2RKSA 4EG0A 1PFNA 5TSSA 1BBWA 2XWJB 3VPDA 1IW7C 5C1OA 2GLTA 2EYPA 2F0TA 1Q7YC 4TUYF 3H15A 1RKNA 3MZ5A 4ED2A 5FK9C 4J6HA 5C4HA 3Q22A 3RB6A 1YJNA 3FMCA 1PDQA 1YNJC 4QIWA 4RHSA 4RKLA 5JVLA 1CHPD 3FPUB 4KKUA 2UXDH 1HTLD 3QOJA 1E2ZA 4A3CH 2E2JB 4HNTA 5GADC 1C0AA 3GIKA 1EU4A 1PMRA 2DY8A 2QDBA 4JI8Q 4DR7Q 3J81i 3L3OC 3CPFA 4HR7B 5FLXE 2F52A 4X66L 2A68D 5IYBH 2JA6H 2X6LA 5CORA 4K8JA 1HNZL 4JBMA 3PSIA 1SCUB 1WSCA 1X3FA 3CCLA 3FMAA 4LF4H 1A3UA 4WJWA 5M5WB 4LF9L 2PMZE 2CW0D 4QY7A 4RNOA 2SOBA 4O1NA 4DUZL 2JA5G 2NZ1D 4LMYA 1IYVA 5IT9W 2IMWP 3T5HA 3J81c 2ZTEA 2W7OA 1VQDA 1Q12A 3JAML 3SDZA 3PO3G 1I4XA 2NZHA 1H9RA 4BBRG 1SXTA 3C0FB 1HA5A 5IGEA 4XT3B 2R7DA 1RJQA 1MGSA 1TWHB 4XT1B 2YL2A 5KFEA 1HNXH 1X54A 4JVZA 1KJJA 3F2BA 3V2TA 4Y52H 1STGA 2F0QA 4MV8A 1TA8A 4A93H 4JG2A 4A3DH 2WTFA 3KTMA 1D6EC 2IT1A 1NMFA 4JBWA 4DR5H 4OEMB 4DV5L 4L6TB 1HR0W 5EJWA 1PRTB 2Q8TA 1JCKB 4O2BF 5BPHA 2AGOA 5C3EB 3F2DA 5LMNL 4A3CG 1XTDA 1DZ1A 3VR3A 2PZTA 4POGA 2SNSA 4EYHB 3TP7A 4LNQA 4XQJA 3ND8A 5IYBG 2JA6G 4J1MA 4DK1A 1QOHA 3K7UC 2I0QA 2NU6B 4L5RC 4XXEA 4AQYH 1J5EH 3D4WA 1BR9A 1SNCA 1QILA 4PQXA 3F2CA 4IR1A 5DGBA 5CYUA 1EY0A 1ZKOA 2B63B 4HJ8A 1RDPD 2FP4B 4PWQA 2YYAA 3Q8RB 1J8IA 3OWFA 3UDFA 3SGIA 4YHHH 1SNDA 5IOCA 2K5HA 3ICEA 3G6XA 4JI0H 3ER0A 2L5TA 5GQOA 5ELNA 4LSXA 1A2TA 3Q8QB 3HOXH 1J6QA 2BQUA 1LABA 4DV3L 1EFID 2R82A 1S0OA 4ZHQF 1WD1A 4R4QA 2UUCH 3JAME 1VMPA 4A3KH 4FVMA 2B39A 4EBDA 3CKIB 3STBC 4DV6Q 2C2RA 4CJ0B 5C4XH 4RB1A 3P1HA 2Q2TA 2DJGC 1GD7A 3CQZH 2NVTB 4A93G 3BZCA 1WYDA 5IWAL 3GV5B 2LKVA 2W9BB 4B3MH 3MR5A 1CT1D 1N33Q 3GTGH 1LO5D 2N3SA 1ZHSA 3L0OA 3TMEA 2WP8J 2RHSB 4XYMB 4RUCA 3CCMA 1QVFA 4J9SA 3CQZA 2V9WA 4GZYC 3BG3A 3OSOA 2F3WA 1ET9A 3PW5A 2B2VA 3GTGA 4DL4A 4G4KA 2H5XA 1EZ8A 5KYLA 1O80A 2WYOA 4GKKH 4JYAL 3BQ0A 1IW7D 3J7YW 2ZDHA 5ELBA 5D3IB 2E2JH 2EY2A 2F0DA 3A8JE 4DV7H 2F0EA 4RB3C 4ECSA 1I4HA 2B2VC 3PVXA 4K0KH 1I4GA 3AFPA 1OXSC 1YNJD 2QKIC 4MV1A 3V4ZA 5E4XA 5KT3A 4QUFA 2UU9Q 4NXMQ 3VR6A 3PUXA 4IZ8A 4DFAA 3OTOL 2R92A 5M5WH 4APMA 1KLUD 1ILQA 5C4XG 1CSPA 2ATLA 3AU7A 5FKAC 4HR7A 4K2LA 2C9OA 3CRLC 2QEJC 4KV6A 1TY0A 1E3PA 3TN2A 2J6SA 1KNEA 2F0IA 4LAAA 3GP7A 1SE3A 3DF7A 2NVQB 1CUKA 2CW8A 1IBKL 2XD4A 5CR3A 4L8JA 3WWVA 1SAPA 1H9SA 1Z47A 4YWKA 3TINA 1TWHH 4ODGA 4IPDA 1I6VC 3H91A 4JI5H 2HQEA 4PZ7A 1FJGL 2A6ED 3AYHB 3GIPA 2UXDQ 1VF5C 2QDLA 2ASBA 1BNZA 3OMCA 5F2DA 4IRDA 4FU0A 3LWEA 4CKEA 4PDBA 2JEJA 2EQSA 4JV5L 2RA4A 3CHBD 1TWHA 4A3FB 2W9CB 5C3EH 5KFYA 3I4LA 3RIZA 2RDJA 2MGSA 5G3LD 4EGQA 1PZID 5DM73 4DNIA 4QWDA 4IFDI 3I4MB 3HRZC 4YIJA 4LF4Q 4OGQC 3W1GA 1OXUA 1OWTA 3H6MA 1A63A 2L12A 5KGUA 4M1UB 1DCZA 1RJTA 2BCOA 2H1EA 1A2UA 5IGGA 2OH2A 4RWSC 1Z2PX 1DOLA 1T5XD 2B63H 1S68A 1X56A 4GKJH 1SFOA 2B8FA 4JI6L 2CFMA 2MQHA 4JV0A 2LXJA 4OHJA 5C0XJ 3WNZA 2YU9A 4YCUA 1GUTA 1KBLA 2VR1A 3E0EA 2PZWA 1HNXQ 1V8QA 1XMQL 1I94H 3G48A 3G6JB 2ALZA 2B63A 4DR5Q 1VQGA 2J6TA 2CWAA 4LFAH 2YYZA 4J9LA 3HKZE 4X64H 1C3OA 2PN1A 1N32H 4F8MA 4GC6A 4JI4L 2NVTH 4CKCA 5BN3A 2M9VA 3OWEB 1EU3A 1HCZA 1B44D 3N6RA 2PQAB 3CAMA 4IJHA 3N40P 2WAQE 5C3EG 5ELEA 4AQYQ 4JI3L 1J5EQ 3BZDB 1BCPB 1TAEA 4DK6C 2I5MX 5EKIA 4MV9A 3GIMA 2W9BA 4X65H 4F4XA 1ULZA 2CWPA 2IHEA 4Q8FA 2M05A 2R7MA 5D1PA 5C5MA 1AE3A 2ZXOA 3S2HB 2JK8A 2Q8RE 5I2YA 3G71A 4JI0Q 2VL6A 3D31A 2YS6A 2NYZD 5HGQA 5IGCA 3PW0A 3NUCA 4LF6Q 3K81C 2B63G 1E4EB 2UUCQ 3NSWA 3NWSA 4NDXA 4YJ3F 4BY7B 2VQFL 5FO7B 1IL2A 3RB0A 2D0OA 4B3SL 2QCPX 2F4VL 1WH2A 3G8CA 1M0TA 5JEAH 4HSPA 1I6UA 4NP5A 1EZ6A 5IP7H 4PNYA 4QMGA 1G6PA 3GV8B 1UAPA 2GN5A 5EPKA 4B3MQ 3H4BA 4EBCA 4HTHA 4F4ZA 3UQ8A 1X3EA 3MFIA 2OTLA 1S5FD 3PMFA 1B3QA 5FLXc 4MV7A 4KK7A 5DQIA 2NVQH 4U6PA 4AYBE 5J1ZA 4MTDA 5T14A 3M9BA 2KECA 2EXZA 4MA5A 5BMVF 3MXUA 5CBAE 5IODA 1E1OA 1L0WA 5JPMC 1E24A 3S1MB 4GKKQ 5C1PA 2PI2E 1WR2A 1E2VA 5JPNC 1LACA 4EGVA 5CC4A 1BDOA 4IZOA 1PXUA 3EN2A 4CC6A 4FXGC 4K0KQ 1AUXA 2QF7A 4KLKA 1VQKA 3UDXA 1L0YB 4A3FH 2EYLA 1SLJA 4UCOA 5KFCA 3BVGA 4LH6A 5KG3A 4RNNA 3I4MH 3T13A 4YY3L 2UUAL 4QWEA 3C1FA 3N6XA 4TSSA 4IOAA 3K8AA 5M3MB 3HOYH 4WD3A 2F3VA 1MKHA 3K5HA 1Q46A 2K50A 1D7QA 5IP7G 1JOOA 1S5BD 4YCWA 4X6AH 1SDFA 1I4QA 4OX9Q 1XNRH 1FVIA 2F0KA 1V51A 1EY5A 1VCIA 4DF7A 4B3TH 4NMZA 1KEEA 4DV2L 3K7AH 4K5VA 3PUWA 1EFWA 1CQIB 2DZDA 3S16B 2BDOA 4JI5Q 3GTOB 1VQCA 2JEBI 1SYBA 3RAXA 3BS1A 3G6VA 3JAMi 1VBHA 2NB0A 1WD0A 2MPMA 3V6KA 4LWCA 4K2KA 3VPBA 2DY7A 1PRTD 4X3TA 3KALA 4DR4L 1K1SA 2JYOA 2KENA 3A0JA 4PG3A 5IGBA 1V1QA 4N9TA 2Z4HA 5HGTA 4A3FG 3V96A 4IWXA 4K14A 3JAMc 5JJLA 4GOPB 3I4MG 3PF5A 4DR6H 2K32A 1L1OB 1DOKA 2KQ3A 1LTBD 4EGJA 3KDFB 3MEHA 5HBRB 4CDCC 2EZVA 4GKJQ 3I91A 2FHTA 1EIHA 3S2HH 3X3MA 1K8OA 2IX3A 2D62A 3R5HA 1I94Q 5EKKA 4LF7Q 1SROA 1ICWA 4A3LH 1A8VA 2E2IB 1STHA 1UWVA 3D6CA 1CHQD 1X32A 4LFAQ 1TVXA 2WINB 5IT9L 4X64Q 2EE1A 4KMUC 1N32Q 2ASJA 2UXCH 3KXYT 4KN7C 2A1AA 1AZPA 4A2AA 1QZGA 2AHOB 1BCPC 4EBEA 2RGRA 4IUUA 2EIFA 4QWCA 1VF7A 1VQ8A 2YZMA 2VZAA 1WI5A 5C3XA 3V4SA 5DLFA 2FMMA 5LOVF 5C3WA 2A5HA 4ZQIA 4X65Q 1HR0L 4OO1H 1XWEA 1T3NA 3EYYA 3HS0C 5BR8H 3A5ZB 1PTOB 5CMDA 1N36H 1IKMA 1RCVD 2JSOA 4K5WA 2KEDA 2MJ8A 1G2TA 1KJIA 1F9SA 3S1MH 1MSGA 4DV0L 1IBML 5KFIA 4XYQA 4DXGA 3CCEA 2ZDQA 1Y1WG 5KFNA 1ASZA 2FLLA 5JQWA 2OCEA 3DHQA 1KQSA 2ASDA 2OLSA 3LMLA 1QCBD 2VXWA 4CDEC 1K3RA 4XYLB 4LF8Q 4A3LG 3HOVB 1LTGD 4O2AF 2K5NA 1H95A 1KHIA 1EIGA 4BY7G 1A15A 1SNMA 5G3LF 5C5LA 3VYUA 1EY7A 1S4ZA 5NUCA 5M3MH 3HOZB 2BE5C 1IBLL 1JKJB 4UP7A 1NE3A 2EXDA 4MHEA 5IT9E 1PH8A 4IUVA 2ASLA 4QCLA 1S0MA 4TV8F 1EUJA 2TSSA 2O2LD 1XPRA 4YAKB 3N41B 4DK0A 2Y0SB 4NXNH 3NENA 1EY8A 1JIHA 2OEOA 3T1YH 1K0SA 3S16H 3FDSA 1CKMA 3DXJC 1XMOL 1GLVA 2L11A 2XSCA 3GTOH 4OO1G 1D2BA 2JEFA 1TQOA 4K5XA 4RNMA 1GUOA 1T36A 5FLMH 1DV2A 4XQQA 3ZJYC 1WTQA 4QUCA 3UE1A 4DR1L 4YR0A 5L1JA 1QVCA 5AJ3L 3CMAA 4IWYA 4KHPL 3MR3A 1I7LA 3D6WA 4BBRB 3GILA 4JPBW 1VQIA 1IKLA 1DIKA 3QZ8A 1LV9A 4UDUC 3K6OA 5C8YF 1FNUA 3PUYA 3SI8A 4R9WA 5M3MG 1XNRQ 2CW7A 1FNVA 2WDTA 1N34L 4K6DA 3OW2A 1Z9FA 1EQTA 4B3TQ 1I3QB 4HQ6A 4I7AA 2CW0C 4GOPA 4LFBL 1L1OA 3H0GA 3BDLA 4KTAA 1IZ6A 3KDFA 4KY7A 4B9XA 1CA5A 2E2IH 1PH1A 4WORA 4LK1C 4EQOA 5M5XB 4IHJF 4GN3B 1N48A 5EBDA 2I5HA 2WKCA 3NPPA 4ZKCB 2M00A 4GOPC 4HJ5A 2YZNA 5FLMG 1L1OC 5E3FA 4GC7A 4CGYB 4P2CB 2E2IA 2BQRA 1IYJB 4BXXH 1STYA 2RDIA 1BXRA 3CCUA 2UUBH 1HXYD 2AQ1B 4DR6Q 1VQOA 2R8HA 1WTVA 1XDNA 1TU2B 1M4VA 4LFCL 1EEFD 1I6HB 1PTOH 2K01A 4DR3H 1CK1A 2F0WA 2E5LL 5L9XA 3P75A 3T51B 4FF4A 5I9OA 4A4IA 1AP0A 4FP5D 3KJOA 2YRXA 3KBGA 5KT7A 3ULLA 1KJ8A 2RDHA 4DNRB 2NU7B 4Q0YA 1UC8A 4A76A 2UXCQ 4C2MB 4IRKA 5EDWA 4G7ZC 3MXPA 3HOVH 3DEOA 3H40A 1JJGA 1M90C 2QGQA 2AGPA 5M5YB 3HOZH 4JI7L 1KDAA 4NKLA 1PTOC 2LMCB 1RYRA 3BDOA 5IYCG 1YVCA 3N44B 3RV4A 1Z7TA 2M2LA 2MO1A 2FPGB 1U9RA 1NY4A 3FRPB 4LUZA 4ZQ3A 5ELDA 3SK6A 2QW7A 4BXXG 5KFBA 4RAYA 1KDCA 2H4OA 2NZOA 5BR8Q 2N8NA 2PMZB 5GAHC 3MXNB 3MXGA 1B6RA 2CZGA 1JE5A 3PIOA 5LMUL 1KRSA 2N78A 3U9TA 5IIFA 1HJPA 4DL7A 1S5DD 1SJHD 5CV5A 4HJAA 1D1KA 2I07B 1O75A 1HHVA 1EHIA 5LXTF 4IPCA 1Q86C 2RF4A 2FLNA 4BY1B 2K52A 4Z9CB 4YHHL 4HJ9A 4BBRH 3A5UA 1PRTF 3CCQA 1YBYA 1NTGA 1NBWA 2JA5A 4IUPA 1RD9D 3E9IA 1ENFA 4M9UA 2BDNA 3HOVG 3E5SA 4ED1A 1B70B 2R8IA 3VYTA 4ED3A 1N8RC 4R1JA 1HFNA 1B2TA 1EY4A 5KX5F 1LTTD 2F0FA 3M7GA 3HOZG 2BOSA 1JB7A 3GDEA 1HZCA 1RTNA 3TEHB 1TS4A 4P71A 3GTJB 4NXNQ 4RAUC 1I3QH 3GV7B 3HGBA 3T1YQ 1VQPA 4JI2L 3TREA 4ED7A 1IYUA 1CKNA 1B9MA 1KTKA 1Q81C 5EQ0A 5CGKA 2EY6A 2Y0SG 3NK9A 5C0XI 2C35B 5KRUA 4B3RL 4YBZB 3PR4A 4NPSA 5M5XH 3MFYA 5KT4A 1GOZA 3TZDA 2W6NA 5I47A 4DV4H 1VKZA 4IPHA 5HY6A 2XCAA 1S0NA 4TQUS 3DWAA 1GM5A 1KJQA 2DNEA 4FBTA 5C6AA 3MWMA 2JA6A 2A6EC 2G9HD 3UFXB 3VDYA 1L0XB 4L63B 1GHJA 4DA2A 3GIQA 4DV7L 1YIJA 3KF6B 2ZXPA 2MP1A 3URYA 1CS0A 1O7YA 3LWBA 2Z1CA 3ITPA 2NUCA 2KHSA 5IGFA 5M9OA 2A69D 1IXRA 1I6HH 3HB9A 2JE6I 3FHWA 4QB4A 2IBKA 1STNA 2LSSA 1KD1C 2E75C 4KKTA 1ZXTA 1TWCH 4U68A 4P73A 4OWWB 3D4RA 1SBBB 1VQFA 2GPWA 1PH6A 4K8IA 1K8MA 2PBZA 1NCVA 1A62A 1EY9A 4C2MH 1QJOA 1FNWA 1TWCA 1D5ZC 2ICIA 2I87A 4KY5A 1X3PA 2FKLA 4JV1A 5M5YH 2PNHA 1VQ4A 4DAVA 2EJMA 4MV3A 2K5WA 2UUBQ 3K0XA 4Y8VB 2IWHA 3M9MB 2OTJA 4RCOA 5KT2A 1PYBA 4UAIA 2PW7A 2IPKD 2FK2A 1U4PA 2IHFA 4DR3Q 3L2PA 4HIKA 1PTOD 2YZGA 3FKIG 1XNQH 1STBA 1K1QA 4O0AA 2F0GA 3FEWX 4EVOA 2IX0A 5FPRA 4QF4A 1C48A 3J7AK 2W6OA 1YEZA 1NR4A 2KOLA 4IR9A 3MXNA 5JEAJ 3U4ZA 4QQBX 3OUZA 4DV1L 3PW4A 3MVVA 2AQ4A 1EWCA 3FPPA 1PX2A 4GS3A 2WIIB 4BS9A 2EYJA 1EQQA 2P5ZX 1RK6A 3OHBA 1U5KA 2N49A 4YQWA 1JR0D 2OT2A 4PZ8A 1K8AC 5I6WA 2X6GA 2CQOA 5EZYF 1WTHA 5EBCA 1F2LA 1T9HA 3RN5A 3ETJA 1TWFB 4C5BA 4JK1C 4U7CA 3AFQA 1S5ED 1SRUA 1SEIA 2E74C 3BDCA 2FMAA 2LXKA 1XX8A 1Y8NB 3GV6A 3GTJH 1CFMA 1QE6A 4F88A 4RZQA 3L4KA 3R5FA 5A35A 5D1OB 4IALA 2F0NA 1CQJB 3VMMA 3A55A 4H13C 3DLLA 4X66H 3N8DA 1I4RA 2W6MA 2ZM6L 2RVLA 2W71A 2EOTA 1HNZH 1SR3A 1U4MA 3SE0A 3TRZA 3GTJA 1LT3D 1PHJA 1YJWA 2VQEL 2J0TD 5EAYA 3TIIA 5FD6A 1KNAA 4YJ2F 4DUZH 1ZYRD 5DEHA 1F9PA 1JE4A 1CSQA 3T1HQ 3OYYA 3S24A 4IN3A 1PFBA 4RCNA 2E8GA 3EPIA 4BY1G 3HKZB 2HHHL 2R6FA 1GUNA 3E3XA 5IYZF 4OX9H 4P75A 2EDGA 3DUZA 3ERSX 2Z4IA 4J9RA 1WOCA 1HTPA 2PYKA 4CHTB 3ULPA 1TWAB 4LJZC 4V0BA 3HOUG 2C2EA 1BCPF 4CJ2C 1WTOA 3IN5A 4KD4A 1W6JA 1KAAA 3M7NA 2WAQB 1W2BA 3KF6A 1ENAA 4KN4C 2DPIA 2HIVA 2FFKB 1CTMA 2LFNA 1HNWL 5LMNH 3KLWA 3I8ZA 4PMBA 2NTSA 2F0PA 3NE5B 1OTCA 1K73C 4DV4Q 1GUSA 4O4LF 3J7A5 4MN3A 4N8X1 1HUNA 3FVQA 4I4TF 5LL6b 5EWFA 4F50A 2QYZA 5KG2A 4EFBA 2MHVA 2IX1A 4ECXA 3V6JA 1RTOA 1PH3A 3CD6A 2DGYA 4HSVA 1RJPA 2RCFA 3EVQA 5CV4A 2DJFC 3PR5B 1R9TB 2YS7A 4FXDA 3BAAA 4P72A 3TDQA 1F9QA 3RAQA 1PRTC 4L5SA 4CBVA 5L37A 5KFDA 4DV3H 2XIWA 4LF7H 4HJ7A 4HEDA 3KHGA 1S72A 4A3MB 2RDFA 3SK4A 5BPFA 1LTLA 4LF5Q 5LA6F 2BR0A 1A0IA 1VQNA 1E4GT 1X9NA 1O7ZA 3SK5A 5IWAH 1FKAH 2Z0SA 4MAMA 4N9PA 2XC9A 3OOCA 1EUCB 3PIO3 1DJRD 5KKNB 1YNNC 1S9FA 3C46A 1RJRA 3OIPA 5A2QW 4ETSA 5K2MA 4QL5A 2FXQA 2HDLA 3PCOB 4ZYSA 4P74A 2UXBL 3QZ7A 2FB9A 2JA7B 3R2TA 5J2UF 2MFIA 4X62L 1SE2A 4A3GB 2HGSA 1TWFH 1Z6HA 2KHJA 1M6VA 4B08A 1Y1WB 4L1KA 3PZPA 4OXPA 4JYAH 1RIPA 3KF8B 3J81j 1PYWD 1CA6A 1S40A 1RK5A 4XZ3B 2ENBA 1K28A 1VQ7A 1JOQA 2G5DA 3NHHA 1KRTA 4JI1L 1K3BC 1XNQQ 1TWFA 2V1CC 2ZJPA 2NN6H 4DNTB 1TIID 3S14B 1AFPA 2K04A 2K5QA 4LF8H 3OTOH 3CCRA 2NTTA 2SNMA 5H80A 4DR2Q 5D1OA 1V1PB 1EIYB 4MIUA 4KHVA 1WVLA 2JP1A 4POFA 4YP3A 5E4WC 5KFAA 3U4VA 1BOSA 1TKWB 3MR2A 5CB4F 2DUDA 1IBKH 3I70A 1G2SA 1W3SA 4I55F 4O3NA 4HYKA 3CC7A 5I6YA 1UNNC 3M4QA 3Q8DA 2HVSA 1B3AA 2PCFB 3S17B 1TWAH 1R4QB 1ZHQA 1S10A 3K0YA 3ORQA 3UDIA 5KFQA 1R4PB 3GTMB 1EZ1A 5CA1F 1UC9A 3HKZA 1HFGA 1DM0B 4OIKA 4I7HA 4ZKBB 2Q2IA 2HDMA 4G7OC 4R4OA 4X66Q 1UEBA 2F0MA 2E76C 1TS3A 1YZ6A 1LM0A 1TWAA 2EPBA 3PW7A 4A75A 2VA2A 1HNZQ 4C3IB 4BA2I 2BH8A 5DG7A 4QWAA 5KFMA 1AN7A 4DUZQ 2WE6A 2NN6G 1HQRD 1N36L 4DUYL 1WCMB 3L4JA 1UNSA 1OO9B 2L4NA 2W9CA 3J80W 1LT5D 2W57A 2W6ZA 1G6ZA 2VOBA 4KD3A 1J9OA 4HCEA 1R9TH 2Q8IB 2KCCA 3S2DB 3NBHB 1H9KA 2IA6A 3M4PA 4ECUA 1FL0A 3MEFA 4A3BB 1XMQH 3I73A 3RUZA 4ZI7F 3E9HA 1VQLA 3HKZG 2A8VA 2NU9B 1PH5A 2R7ZB 3RLOA 4UCSA 4A3MH 3QJYA 4DV5Q 2O5JC 1R9TA 1JWSD 2K28A 2A6HD 4MTEA 1PTOF 2W70A 1C8CA 4JI4H 1NUCA 3K57A 5LMNQ 3I90A 2WAQG 4O4HF 3H3VH 1FD7D 1E1TA 3IFDA 4XIGS 4MV6A 2GPSA 1SE8A 1UE7A 4RGTA 1Z2NX 1ESFA 4X3UA 4JI3H 1CKOA 4UCRA 5FO9B 1X3QA 3BU2A 4JI8L 4DR7L 2L0CA 4S3SA 2JA7H 1QVGA 2AWNA 2R87A 4A3GH 2OWOA 3A8KE 1ILPA 2PQAA 3Q2OA 1XPOA 1JJCB 4U673 1Y1WH 1YNND 2BA0A 2PI2A 4JOIA 3Q8SB 1M8AA 4IQZA 1P8LA 5JJIA 1Q3LA 4DV3Q 5DQHA 2NBFA 2RBMA 2B2TA 3TS2A 3OHXC 5F9NA 3T5JA 2XGQA 3UI2A 1VQMA 2C22A 3H3VC 5DQGA 2VQFH 4LW1A 4M8AA 5K36H 4GNXB 3MHBA 1Z2OX 3E0JA 4BY7H 1Q8KA 4B3SH 1Y1WA 1EWIA 2BA1A 4J15A 3S14H 2HVRA 3KF8A 2K5VA 4JOIC 4JC0A 1IOVA 4JV2A 5IWAQ 2GVBA 3HFZB 2F0JA 4DAYB 1E4EA 2OXPA 1RHPA 1SJED 4A3MG 1JC7A 2B2TC 2ID0A 4DXFA 3RB4A 2K33A 3BA9A 1HPCA 3EBEA 2CHBD 4AYBG 1PFMA 4ALPA 2DIKA 5BN5A 5IP9H 2K7VA 5K5PA 3S1QB 5EWEA 5KFOA 3MR6A 3MJFA 4AH6A 4IPGA 1XTCD 1TS2A 5JJZA 4Q43A 4EEQA 5I2XA 3S17H 3BJYA 1H9JA 2XGTA 5KFXA 3BJUA 4JYAQ 2JA7G 1K9MC 2SCUB 1E0BA 1F2ZA 3GTMH 4A3GG 3WOEA 4RAZA 2F1MA 1BQQT 1D8LA 3KAKA 3NELA 1TWGB 3P20A 3R2IA 3I55A 5I9PA 2ZJTA 3R5XA 3PV0A 2QA4A 3TSSA 2UVWA 4JBKA 1SN8A 5CV8A 4C3IH 1NR2A 1MJCA 3OTOQ 3GTKB 3GTMA 1U0LA 4YY3H 1VQ5A 5K36G 1S97A 1ML0D 4I7ZC 5JOBA 3PUZA 4A3EB 1II3A 1WCMH 1WJJA 3TP6A 4ME5A 3SK8A 1IOWA 2DLNA 3D0FA 1Y14B 2XVSA 1LTRD 5ELOA 2W9AA 3A54A 3MAQA 1IBKQ 1JQYD 4DV6L 3RR5A 4F87A 2JEIA 2WB1E 4ZK9B 3BA8A 5KFZA 1EYDA 3S2DH 2O5IC 4DV2H 4Q5VA 4A3BH 5IP9G 2W7PA 1I5FA 3TZUA 3KLSX 3NTIA 3QOLA 1FJGQ 1N33L 1WTWA 3VR5A 2R7ZH 1KJ9A 2PQEA 3Q8PB 4XX0B 1JWMD 1Q8IA 3Q0AA 1GHKA 3NBHA 4JV5Q 1DV1A 1BJTA 1MHWC 2G9DA 3CRKC 2KCNA 4LUOA 4Q8EA 4R8UB 4DR4H 2FJZA 3M9NB 1BUVT 4A3IB 2JEGA 3GTOA 1TT2A 1JWUD 4C3IG 1BF4A 2RDGA 1MI2A 2XRSD 2EY1A 1G91A 3RBEA 1SNQA 4R4CA 2K5DA 4MTNA 2F4IA 5JJKA 1E22A 3VA5A 4JI6Q 1P16A 1WCMG 2IY5B 3R93A 2UU9L 4NXML 2RCNA 5EPLA 3X3NA 1EYCA 3EQLC 1XMQQ 4WJ4A 2XNAC 2ZDGA 2B3GA 4A2BA 3QO2A 1Y1VB 4DPGA 2P0AA 2KEEA 4A3BG 5KFRA 5KG4A 1ONLA 2PO4A 4GN4B 4RA8A 1HRJA 4YWLA 3W3AA 4N8FA 4JI4Q 2R7ZG 3H09A 4WRDA 1Q1EA 1X6OA 1STAA 3K5MA 3RLNA 5IYCH 5ELCA 5I4DA 1PH2A 2E2HB 3OSNA 2A69C 1A9XA 4EEYA 2HD3A 2Q2UA 4YAJB 5EWGA 3HG9A 2ZTCA 4TKOB 4JI3Q 2UXDL 4HCSA 2E2DC 4UP9A 4C1NI 3U9SA 1V1OA 4MA0A 1DYQA 3FKIB 2X0SA 2TMPA 1U4LA 1EYZA 5KFUA 1YI2A 5CV7A 1RF2D 3VR4A 1KC7A 1GSHA 3KLRA 5E7NA 2A73B 4LF4L 4DV0H 1IBMH 4IAJA 3PQIA 3CP0A 2HJWA 1VQJA 2CKZB 2BQ3A 3BQ1A 3DMUA 5JVDF 1TWGH 2VQFQ 4WJ3M 2V58A 3D8GA 4DKAC 1OXXK 2EY5A 4B3SQ 4ED0A 2F4VQ 1MD2D 3T4AC 4Q0FA 4Y7NB 1WTRA 3T5KA 2EYMA 2K14A 5KNBA 1V9PA 3F2UA 3GTKH 2C2DA 5DG9A 3NWTA 1HNXL 5KT6A 4H0LC 4QIWE 4A3EH 3H4DA 4K6LA 3N52A 3HEJA 2MUYA 1JB3A 4A3DB 1RYSA 3KBXA 3I72A 4ILWA 2WB1G 4IFDH 5LP6F 3CC4A 1SMYD 4DR5L 3TQ1A 2CVRA 4WBNF 2UVRA 1JXLA 4DK3C 1C30A 4ZAIA 1TXYA 5FJ8H 3U50C 2EVBA 1MZBA 4EYIB 1BBUA 2FK1A 1XMOH 3HBLA 3RZOB 2KCMA 4ID6A 3Q23A 1BNCA 2A19A 2ZT9C 4ZUJA 2ZJQA 4NB3A 3RBDA 4DL2A 1CM9A 2KBNA 3U9OA 5A2QL 3Q24A 4AQYL 1J5EL 5E1FA 5DG8A 2Y0SA 2VB2X 4DR1H 1SNOA 3W1BA 1AH9A 5FD5A 2K4KA 5COYA 1TY2A 2XN9C 4KHPH 2JEAI 4A3IH 4JUZA 4GLVB 2F0HA 4C5CA 3T1HH 4YY3Q 2HQLA 3T16A 2UUAQ 4JI0L 4C3HB 4LH7A 4B9WA 4HMIA 4J9OA 1I7NA 3IL8A 3HXLA 3J81W 3EA6A 3CCJA 4J9PA 4LF6L 3HOUB 2XCPA 1GKHA 2UUCL 4J9QA 2R3ZA 3BQ2A 4R8UA 1ESRA 1N56A 1CQVA 1D5MC 2F0LA 1VDZA 1N34H 4A3EG 4YCVA 2KVMA 4I65A 3CC2A 2JQOA 4IFDG 1W6KA 4IURA 1O7LA 4DV2Q 3I2ZA 5KNDA 1PK8A 3IRBA 4HNUA 4DLKA 1Q82C 4B3ML 1ZYRC 3NP8A 3EPGA 4O4IF 3AQQA 1E7ZA 3S1NB 1Y1VH 4ZLTF 5T1GA 1O78A 5FJ8G 3PN1A 2XGPA 1QWYA 1VS0A 4X3SA 1B6SA 2FMCA 1I3QA 2X69A 3Q6SA 1YNXA 5D8DA 2NU8B 4DR4Q 1GXDC 1K83B 1SMXA 2QILA 2EYHA 3OIQA 4H7BA 4PMCA 4RHRA 1Y1VA 2V59A 2C5CA 3NQTA 3NTKA 2E2HH 1I4PA 1K8GA 5D3DA 1STEA 4GKKL 2AQ2B 2O03A 4H02A 1A3VA 4KI0A 5A2QE 2R92B 2YW2A 3R23A 4RG1A 3H94A 3DWQA 3I7FA 4A3IG 2VUMG 5M3FG 1VAJA 4K0KL 4KJNA 4IJLA 3FKIH 4TQRA 4LFCH 3D3RA 2E2HA 1D1IA 3RB3A 1E2WA 1B1ZA 2E5LH 1GJXA 1GUGA 4ECQA 1G51A 2D2CC 1DONA 3RF2A 2Z9HA 3J7AV 1ZQ7A 4XYOA 1H9SB 5GROA 3I3CA 4DL3A 4I50F 4LF5H 5EGTA 4DN4M 4OO1I 3FKIA 1FGBD 3VYRA 3C2PA 4EX5A 2L1BA 2W8KA 3J80L 4ECZA 4IUQA 4JCVE 4Y7NH 4OX9L 1BO0A 3PIP3 1PVOA 2AU0A 3HZXA 3K3PA 1Y1VG 4UHVA 4KKSA 3I4NB 1X55A 3RGZA 4JI7H 4J0MA 1Y8PB 2R7LA 1EQVA 3OUUA 4KY6A 5CBEE 4JI5L 4LSAA 5FPOA 5L1IA 4UCUA 3ERQA 2YTYA 3W2DA 3LP8A 4C2MA 2KUMA 1HR0Q 3F8NA 1MSHA 3ETHA 4RGNA 2VW9A 4O3SA 1LT4D 4ECYA 3CVZA 3DEPA
chains in the Genus database with same CATH topology
1UWVA 4GLAC 4LFAQ 4MZ9A 4QL5A 3RZOH 2FXQA 3PCOB 4X64Q 4P74A 4DV0Q 1IBMQ 1N32Q 2UXBL 2AWOA 2MFIA 2A1AA 4X62L 3S15H 1KXLA 1TWFH 2KHJA 2AHOB 4QJFA 3H0GG 1QZGA 5IT9c 3G4SA 4FDBA 1B7YB 2EIFA 4OXPA 1EQRA 1RIPA 3KF8B 1C9OA 3J81j 1VQ8A 2VZAA 4UPAA 1KAWA 4LF5L 1WI5A 3RZDH 1S40A 1G291 2HT1A 1YJ9A 4GKJL 1GVPA 4AIMA 4BY1H 2RHQB 1VQ7A 4OWXB 1KRTA 4JI1L 4C3HH 1UE1A 1XNQQ 1JT8A 2V1CC 4X65Q 3G6EA 2ZJPA 4RMFA 2WFWA 1I94L 4DAMA 1HR0L 1IBLQ 4LF7L 2L15A 3HOUH 4L5TA 3A5ZB 3CCRA 2ALYB 3CPWA 2KCTA 4DR2Q 4LFAL 3S1MH 1NJIC 1EIYB 4X64L 4DV0L 1N32L 1GO3E 1IBML 4A3DG 4JBJA 1VQHA 3CCEA 1PH9A 1Y1WG 1ASZA 4POFA 2OCEA 3U4VA 2VUMH 3CCVA 5M3FH 1XPUA 1XMOQ 1KQSA 2DUDA 3U58A 3KYHC 4YWMA 1W3SA 1K3RA 5IE8A 2R7FA 3CC7A 1VQAA 4DUYQ 1N36Q 3M4QA 3Q8DA 2F3IA 2VS1A 3GO5A 4LF8Q 4A3LG 2K5NA 2JJQA 1KHIA 1H95A 4BY7G 4DR1Q 1TWAH 3B6YA 3H3VI 1XNQL 5AJ3Q 5M3MH 3UDIA 4APVA 4X65L 1IBLL 4UP7A 1NE3A 2EXDA 1NMGA 2JA5H 4KHPQ 1K83H 1PH8A 3TQYA 2YTXA 4EQ5A 2OQ0A 2ATWA 4MNOA 2Q2IA 2GVAA 1EUJA 4DR2L 4R4OA 4X66Q 3PO3H 1XPRA 1UEBA 2R92H 1YZ6A 1LM0A 4A75A 1HNZQ 1BBWA 3NENA 4BA2I 4TVAB 2JA9A 2I5LX 3S16H 1CKMA 1XMOL 2BH8A 1Q7YC 1M1KC 3HOXG 3GTOH 3F8TA 3H15A 4OO1G 1N34Q 4DUZQ 2NN6G 1N36L 4DUYL 1YJNA 5FLMH 2MO0A 1MJEA 4A3KG 4LF8L 1PYSB 3ZJYC 4LFBQ 3UE1A 4DR1L 1OXTA 1QVCA 4BA1I 5AJ3L 3CMAA 3RN2A 4A3CH 4KHPL 1R9TH 3J7ZC 5GADC 3NBHB 1C0AA 3M4PA 4JI8Q 1FL0A 3MEFA 4DR7Q 3J81i 1VQIA 3CPFA 2F52A 3E9HA 4X66L 1VQLA 3HKZG 2A8VA 5IYBH 2JA6H 3CW2C 1PH5A 3RLOA 2ZJRA 3I4NH 3AEVA 1HNZL 4JBMA 3PSIA 4A3MH 1X3FA 4DV5Q 3CCLA 4LF9L 3PUYA 2PMZE 4QY7A 5M3MG 1XNRQ 5LMNQ 1N34L 4DUZL 1Z9FA 3OW2A 2JA5G 4B3TQ 1DGSA 2WAQG 3H3VH 3J81c 2ZTEA 1E1TA 1VQDA 4GOPA 4LFBL 2B29A 1Q12A 1L1OA 4XIGS 4LFCQ 3PO3G 1SE8A 2R92G 1IZ6A 1UE7A 2BH2A 2NZHA 3KDFA 4BBRG 2E2IH 1YHQA 1PH1A 2E5LQ 1CKOA 3CMEA 1SFOH 2R7DA 4GN3B 3BU2A 4JI8L 3RNUA 4R4IA 2YU9H 1EIFA 4PMWA 4DR7L 1X54A 2JA7H 2I5HA 3F2BA 2AWNA 1QVGA 4Y52H 1KL9A 4A3GH 2OWOA 4A93H 1KIXA 4JG2A 4HJ5A 4GOPC 4A3DH 5FLMG 1L1OC 2PQAA 2IT1A 1NMFA 4JBWA 1JJCB 1Y1WH 1XPOA 1QZHA 2BA0A 2PI2A 4DV5L 4JOIA 1HR0W 1IYJB 4BXXH 5JJIA 1P8LA 3S1RH 4DV3Q 1XNRL 3CCUA 3TS2A 3F2DA 5LMNL 4A3CG 1XTDA 1VQMA 5IY0A 4DR6Q 4B3TL 4POGA 4LW1A 4GNXB 4JI7Q 1VQOA 4BY7H 1Q8KA 4LNQA 2AMCB 1EWIA 2BA1A 4J15A 4LFCL 1EYGA 3S14H 2K5VA 5IYBG 2JA6G 3K7UC 4JC0A 4JOIC 2I0QA 4L5RC 5IWAQ 2GVBA 4IO9A 3I4NG 3HFZB 2E5LL 4DAYB 4A3MG 1V43A 2ID0A 3F2CA 1K0RA 1YHBA 3EBEA 4A4IA 4HJ8A 3W5OA 4AYBG 3KJOA 4ALPA 4KHZA 3UDFA 1BVSA 3SGIA 5IP9H 2NVYH 5LMUQ 2K5HA 3ULLA 2JA8H 3GTLH 3ER0A 3ICEA 5GQOA 4A76A 1ASYA 2HIXA 4AH6A 3STBD 2UXCQ 4IPGA 5ELNA 1LYLA 3HOXH 1J6QA 4DV3L 3HOVH 4R4QA 1M90C 2NVXH 2QGQA 1JJGA 1X65A 4A3KH 3S17H 4LUVA 4DR6L 3STBC 2XGTA 4DV6Q 1PA6A 3BJUA 3HOZH 4JI7L 4JYAQ 5C4XH 2JA7G 4OWTB 1K9MC 2Q2TA 1GD7A 3CQZH 5H1SE 3GTMH 4A3GG 4A93G 3BZCA 4YHHQ 1Q1BA 1WYDA 4GN5A 5IYCG 1YVCA 1D8LA 5IWAL 3NELA 2MO1A 1KC8C 1N33Q 3I55A 3GTGH 2N3SA 1NY4A 4LUZA 3L0OA 4BXXG 2WP8J 2RHSB 3KOJA 3PV0A 2QA4A 3CCMA 2NZOA 4JBKA 1SN8A 5BR8Q 2N8NA 4C3IH 5GAHC 3MXNB 1QVFA 1MJCA 3OTOQ 2K75A 1JE5A 1U0LA 4R4TA 3PIOA 1VQ5A 4L5QA 5LMUL 5K36G 1KRSA 2XTIA 2N78A 3NEMA 1LUZA 2UXCL 3PUZA 1WCMH 1WJJA 1I50H 1HJPA 4XTCS 4JI2Q 3D0FA 3UE0A 3TS0A 2ES2A 1Y14B 4HJAA 5ELOA 1VQEA 2H5XA 1IBKQ 4IPCA 4DV6L 1Q86C 1JJ2A 4JYAL 3RR5A 2RF4A 1VQ6A 4B3RQ 2WB1E 2K52A 2E2JH 3S2DH 4HJ9A 4YHHL 4BBRH 5IYDH 3A5UA 4A3BH 5IP9G 3CCQA 1I5FA 1NTGA 1YBYA 1NBWA 3PUVA 1OXVA 2JA8G 1B8AA 2R6GA 3AFPA 1FJGQ 1OXSC 4LF9Q 1N33L 3KFUA 3E9IA 5C44H 2R7ZH 3HOVG 1B70B 5BR8L 2UU9Q 4NXMQ 3PUXA 1N8RC 4R1JA 3OTOL 5M5WH 4JV5Q 3HOZG 1JB7A 1CSPA 3GDEA 1HZCA 5C4XG 3PGZA 3TEHB 3CCSA 4P71A 4LUOA 4DV7Q 4NXNQ 1L2FA 1I3QH 1E3PA 4JI2L 3T1YQ 1VQPA 3TREA 1CKNA 1Q81C 1CUKA 1RL2A 1IBKL 5C4JH 2Y0SG 3WWVA 5C0XI 2C35B 4B3RL 3CF5A 1Z47A 4YWKA 4NPSA 5M5XH 1TWHH 4IPDA 4R4CA 4IPHA 4MTNA 4OONA 5HY6A 1E22A 4PZ7A 5JEAG 1FJGL 3AYHB 5LMNW 5JJKA 4TQUS 4JI6Q 1P16A 1WCMG 2UXDQ 1GM5A 2OQKA 2IY5B 4BBSH 2ASBA 2UU9L 4NXML 2RCNA 4WJ4A 1XMQQ 2EQSA 4JV5L 2YTVA 1UE6A 5C3EH 3VDYA 2B3GA 1JMCA 4DV7L 1YIJA 3KF6B 4ME3A 4NXNL 4DNIA 4DPGA 4IFDI 5IYDG 4A3BG 3T1YL 3PF4A 4LF4Q 4GN4B 3W1GA 1OXUA 4YWLA 4JI4Q 3A74A 1I6HH 1IXRA 5C44G 2R7ZG 1A63A 1Q1EA 1X6OA 2JE6I 2QEXA 4PZ6A 3J80i 3FHWA 3RLNA 2LSSA 5IYCH 1PFSA 1KD1C 1PH2A 1TWCH 4P73A 4OWWB 2B63H 2Q2UA 1X56A 4O2DA 1AE2A 1VQFA 4JI6L 2CFMA 2MQHA 2ZTCA 2LXJA 3L7ZC 5C0XJ 4IOCA 4HIDA 4JI3Q 2UXDL 4YCUA 1PH6A 4UP9A 3E0EA 1HNXQ 1S3OA 1XMQL 1A62A 4C3JH 4C2MH 3G48A 3I56A 1YI2A 3J80c 4DR5Q 1VQGA 2CWAA 5M5YH 1QUQB 2YYZA 5E7NA 1VQ9A 3HKZE 2PNHA 1UE5A 4QGUA 4DV1Q 1VQ4A 4LF4L 3HOYG 3GTPH 4JI4L 3CP0A 1YITA 2NVTH 1VQJA 2CKZB 2UUBQ 3K0XA 4BBSG 1O7IA 2VY3A 1TWGH 2VQFQ 4WJ3M 2R93H 4DKAC 4IFDJ 1OXXK 4B3SQ 2OTJA 2F4VQ 2PQAB 3CAMA 4IJHA 1PYBA 2WAQE 5C3EG 2IHFA 2K14A 4DR3Q 3L2PA 1V9PA 1MIUA 4HIOA 4HIKA 4JI3L 4AQYQ 2D0PA 1J5EQ 3GTKH 3PO2H 3FKIG 4DK6C 2I5MX 1HNXL 4O0AA 3PIPA 4QIWE 4A3EH 2IX0A 5J3BA 3M3YH 2CWPA 2IHEA 1YEZA 1YHAA 2WB1G 1AE3A 3CC4A 2JK8A 4DR5L 3G71A 4JI0Q 5JEAJ 3U4ZA 2VL6A 3D31A 4QQBX 5HGQA 4DV1L 3BZKA 2ZM6Q 3K81C 4DK3C 4LF6Q 2B63G 1N9WA 2UUCQ 3FP9A 1TXYA 4GS3A 2UUBL 5FJ8H 3U50C 1EQQA 2VQEQ 1U5KA 1BBUA 2N49A 2VQFL 2KCMA 4PZ8A 1K8AC 1IL2A 2D0OA 4B3SL 2F4VL 1HH2P 2CQOA 2A19A 3EIVA 2ZJQA 4NB3A 1T9HA 3RN5A 5IP7H 4DR3L 2KBNA 4AQYL 4A3JH 1J5EL 1G6PA 2GN5A 4B3MQ 3AFQA 1SRUA 3W1BA 1VQBA 1AH9A 2KHIA 5C0XG 2HHHQ 3S1NH 2LXKA 2K4KA 4HIMA 3GTJH 1X3EA 2JEAI 4A3IH 3UDGA 2OTLA 4GLVB 4YY3Q 2HQLA 2UUAQ 5FLXc 2R93G 4JI0L 3DLLA 2NVQH 4AYBE 5DLQE 3M85A 4UY8C 2CCZA 3CCJA 2ZM6L 4LF6L 3M9BA 1SR3A 1GKHA 1PH7A 2UUCL 3TRZA 3CXCA 1HZ9A 3HKSA 1PHJA 1E1OA 1WFQA 3RLFA 2VQEL 1L0WA 5EAYA 1YJWA 3PO2G 1E24A 4GKKQ 2PI2E 1HNWQ 4A3EG 4YCVA 3CC2A 1CSQA 2JQOA 3OYYA 3S24A 3T1HQ 1BKBA 4DV2Q 4IFDG 3I2ZA 3EN2A 3IRBA 4K0KQ 1Q82C 4KLKA 1VQKA 4B3ML 3UDXA 3GD7A 2E8GA 4A3FH 1HZBA 3AQQA 5GAGC 1SLJA 4BY1G 1E7ZA 2HHHL 1Y1VH 4P75A 3KJPA 3ERSX 5FJ8G 3I4MH 1VS0A 2Z6KA 1WOCA 4YY3L 3ULPA 2UUAL 3HOUG 1EOVA 4IOAA 5GAEC 3K8AA 2MNAA 1YNXA 3HOYH 3LGJA 1PV4A 1MKHA 4DR4Q 1Q46A 2K50A 3HOWH 1D7QA 1SMXA 5IP7G 3M7NA 1W2BA 4YCWA 3KF6A 4A3JG 2E2HH 4X6AH 1K8GA 4OX9Q 2HIVA 4GKKL 4H02A 1FVIA 3DM3A 4KI0A 1HNWL 2Z6KC 4RG1A 1VCIA 4A3IG 3I7FA 3JC66 3KLWA 5M3FG 3T1HL 2VUMG 4DV2L 3K7AH 1OTCA 3PUWA 1EFWA 1K73C 4DV4Q 4K0KL 3I4OA 4IJLA 3J7A5 3FKIH 4JI5Q 2ZTDA 2AKWB 1VQCA 2JEBI 3ULJA 1CKNB 3H0GH 3JAMi 1HZAA 3K80C 1G51A 1XJVA 2IX1A 4LWCA 2YV5A 1FGUA 5GROA 1PH3A 3CD6A 2DGYA 2VNUD 2Q2HA 4GNXA 1C7YA 4OO1I 2NN6I 3M4OH 4DR4L 4EX5A 2KENA 3A0JA 4PG3A 4P72A 1V1QA 3S1QH 4UP8A 2UXBQ 1QUQA 4JCVE 4X62Q 4A3FG 4Y7NH 4L5SA 1X3GA 4OX9L 1PVOA 1PH4A 1Y1VG 4HJ7A 3JAMc 5JJLA 1X55A 4GOPB 3PF5A 3I4MG 1S72A 1L1OB 4GNXC 2Y0SE 1LTLA 4DV4L 4LF5Q 3KDFB 1A0IA 1VQNA 4JI5L 1X9NA 4GKJQ 4GLXA 3S2HH 3F1ZA 2YTYA 3HOWG 2Z0SA 4JI1Q 2D62A 3GTQH 1HR0Q 1I94Q 4LF7Q 1SROA 2VW9A 4A3LH 1A8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWV A;  4GLA C;  4LFA Q;  4MZ9 A;  4QL5 A;  3RZO H;  2FXQ A;  3PCO B;  4X64 Q;  4P74 A;  4DV0 Q;  1IBM Q;  1N32 Q;  2UXB L;  2AWO A;  2MFI A;  2A1A A;  4X62 L;  3S15 H;  1KXL A;  1TWF H;  2KHJ A;  2AHO B;  4QJF A;  3H0G G;  1QZG A;  5IT9 c;  3G4S A;  4FDB A;  1B7Y B;  2EIF A;  4OXP A;  1EQR A;  1RIP A;  3KF8 B;  1C9O A;  3J81 j;  1VQ8 A;  2VZA A;  4UPA A;  1KAW A;  4LF5 L;  1WI5 A;  3RZD H;  1S40 A;  1G29 1;  2HT1 A;  1YJ9 A;  4GKJ L;  1GVP A;  4AIM A;  4BY1 H;  2RHQ B;  1VQ7 A;  4OWX B;  1KRT A;  4JI1 L;  4C3H H;  1UE1 A;  1XNQ Q;  1JT8 A;  2V1C C;  4X65 Q;  3G6E A;  2ZJP A;  4RMF A;  2WFW A;  1I94 L;  4DAM A;  1HR0 L;  1IBL Q;  4LF7 L;  2L15 A;  3HOU H;  4L5T A;  3A5Z B;  3CCR A;  2ALY B;  3CPW A;  2KCT A;  4DR2 Q;  4LFA L;  3S1M H;  1NJI C;  1EIY B;  4X64 L;  4DV0 L;  1N32 L;  1GO3 E;  1IBM L;  4A3D G;  4JBJ A;  1VQH A;  3CCE A;  1PH9 A;  1Y1W G;  1ASZ A;  4POF A;  2OCE A;  3U4V A;  2VUM H;  3CCV A;  5M3F H;  1XPU A;  1XMO Q;  1KQS A;  2DUD A;  3U58 A;  3KYH C;  4YWM A;  1W3S A;  1K3R A;  5IE8 A;  2R7F A;  3CC7 A;  1VQA A;  4DUY Q;  1N36 Q;  3M4Q A;  3Q8D A;  2F3I A;  2VS1 A;  3GO5 A;  4LF8 Q;  4A3L G;  2K5N A;  2JJQ A;  1KHI A;  1H95 A;  4BY7 G;  4DR1 Q;  1TWA H;  3B6Y A;  3H3V I;  1XNQ L;  5AJ3 Q;  5M3M H;  3UDI A;  4APV A;  4X65 L;  1IBL L;  4UP7 A;  1NE3 A;  2EXD A;  1NMG A;  2JA5 H;  4KHP Q;  1K83 H;  1PH8 A;  3TQY A;  2YTX A;  4EQ5 A;  2OQ0 A;  2ATW A;  4MNO A;  2Q2I A;  2GVA A;  1EUJ A;  4DR2 L;  4R4O A;  4X66 Q;  3PO3 H;  1XPR A;  1UEB A;  2R92 H;  1YZ6 A;  1LM0 A;  4A75 A;  1HNZ Q;  1BBW A;  3NEN A;  4BA2 I;  4TVA B;  2JA9 A;  2I5L X;  3S16 H;  1CKM A;  1XMO L;  2BH8 A;  1Q7Y C;  1M1K C;  3HOX G;  3GTO H;  3F8T A;  3H15 A;  4OO1 G;  1N34 Q;  4DUZ Q;  2NN6 G;  1N36 L;  4DUY L;  1YJN A;  5FLM H;  2MO0 A;  1MJE A;  4A3K G;  4LF8 L;  1PYS B;  3ZJY C;  4LFB Q;  3UE1 A;  4DR1 L;  1OXT A;  1QVC A;  4BA1 I;  5AJ3 L;  3CMA A;  3RN2 A;  4A3C H;  4KHP L;  1R9T H;  3J7Z C;  5GAD C;  3NBH B;  1C0A A;  3M4P A;  4JI8 Q;  1FL0 A;  3MEF A;  4DR7 Q;  3J81 i;  1VQI A;  3CPF A;  2F52 A;  3E9H A;  4X66 L;  1VQL A;  3HKZ G;  2A8V A;  5IYB H;  2JA6 H;  3CW2 C;  1PH5 A;  3RLO A;  2ZJR A;  3I4N H;  3AEV A;  1HNZ L;  4JBM A;  3PSI A;  4A3M H;  1X3F A;  4DV5 Q;  3CCL A;  4LF9 L;  3PUY A;  2PMZ E;  4QY7 A;  5M3M G;  1XNR Q;  5LMN Q;  1N34 L;  4DUZ L;  1Z9F A;  3OW2 A;  2JA5 G;  4B3T Q;  1DGS A;  2WAQ G;  3H3V H;  3J81 c;  2ZTE A;  1E1T A;  1VQD A;  4GOP A;  4LFB L;  2B29 A;  1Q12 A;  1L1O A;  4XIG S;  4LFC Q;  3PO3 G;  1SE8 A;  2R92 G;  1IZ6 A;  1UE7 A;  2BH2 A;  2NZH A;  3KDF A;  4BBR G;  2E2I H;  1YHQ A;  1PH1 A;  2E5L Q;  1CKO A;  3CME A;  1SFO H;  2R7D A;  4GN3 B;  3BU2 A;  4JI8 L;  3RNU A;  4R4I A;  2YU9 H;  1EIF A;  4PMW A;  4DR7 L;  1X54 A;  2JA7 H;  2I5H A;  3F2B A;  2AWN A;  1QVG A;  4Y52 H;  1KL9 A;  4A3G H;  2OWO A;  4A93 H;  1KIX A;  4JG2 A;  4HJ5 A;  4GOP C;  4A3D H;  5FLM G;  1L1O C;  2PQA A;  2IT1 A;  1NMF A;  4JBW A;  1JJC B;  1Y1W H;  1XPO A;  1QZH A;  2BA0 A;  2PI2 A;  4DV5 L;  4JOI A;  1HR0 W;  1IYJ B;  4BXX H;  5JJI A;  1P8L A;  3S1R H;  4DV3 Q;  1XNR L;  3CCU A;  3TS2 A;  3F2D A;  5LMN L;  4A3C G;  1XTD A;  1VQM A;  5IY0 A;  4DR6 Q;  4B3T L;  4POG A;  4LW1 A;  4GNX B;  4JI7 Q;  1VQO A;  4BY7 H;  1Q8K A;  4LNQ A;  2AMC B;  1EWI A;  2BA1 A;  4J15 A;  4LFC L;  1EYG A;  3S14 H;  2K5V A;  5IYB G;  2JA6 G;  3K7U C;  4JC0 A;  4JOI C;  2I0Q A;  4L5R C;  5IWA Q;  2GVB A;  4IO9 A;  3I4N G;  3HFZ B;  2E5L L;  4DAY B;  4A3M G;  1V43 A;  2ID0 A;  3F2C A;  1K0R A;  1YHB A;  3EBE A;  4A4I A;  4HJ8 A;  3W5O A;  4AYB G;  3KJO A;  4ALP A;  4KHZ A;  3UDF A;  1BVS A;  3SGI A;  5IP9 H;  2NVY H;  5LMU Q;  2K5H A;  3ULL A;  2JA8 H;  3GTL H;  3ER0 A;  3ICE A;  5GQO A;  4A76 A;  1ASY A;  2HIX A;  4AH6 A;  3STB D;  2UXC Q;  4IPG A;  5ELN A;  1LYL A;  3HOX H;  1J6Q A;  4DV3 L;  3HOV H;  4R4Q A;  1M90 C;  2NVX H;  2QGQ A;  1JJG A;  1X65 A;  4A3K H;  3S17 H;  4LUV A;  4DR6 L;  3STB C;  2XGT A;  4DV6 Q;  1PA6 A;  3BJU A;  3HOZ H;  4JI7 L;  4JYA Q;  5C4X H;  2JA7 G;  4OWT B;  1K9M C;  2Q2T A;  1GD7 A;  3CQZ H;  5H1S E;  3GTM H;  4A3G G;  4A93 G;  3BZC A;  4YHH Q;  1Q1B A;  1WYD A;  4GN5 A;  5IYC G;  1YVC A;  1D8L A;  5IWA L;  3NEL A;  2MO1 A;  1KC8 C;  1N33 Q;  3I55 A;  3GTG H;  2N3S A;  1NY4 A;  4LUZ A;  3L0O A;  4BXX G;  2WP8 J;  2RHS B;  3KOJ A;  3PV0 A;  2QA4 A;  3CCM A;  2NZO A;  4JBK A;  1SN8 A;  5BR8 Q;  2N8N A;  4C3I H;  5GAH C;  3MXN B;  1QVF A;  1MJC A;  3OTO Q;  2K75 A;  1JE5 A;  1U0L A;  4R4T A;  3PIO A;  1VQ5 A;  4L5Q A;  5LMU L;  5K36 G;  1KRS A;  2XTI A;  2N78 A;  3NEM A;  1LUZ A;  2UXC L;  3PUZ A;  1WCM H;  1WJJ A;  1I50 H;  1HJP A;  4XTC S;  4JI2 Q;  3D0F A;  3UE0 A;  3TS0 A;  2ES2 A;  1Y14 B;  4HJA A;  5ELO A;  1VQE A;  2H5X A;  1IBK Q;  4IPC A;  4DV6 L;  1Q86 C;  1JJ2 A;  4JYA L;  3RR5 A;  2RF4 A;  1VQ6 A;  4B3R Q;  2WB1 E;  2K52 A;  2E2J H;  3S2D H;  4HJ9 A;  4YHH L;  4BBR H;  5IYD H;  3A5U A;  4A3B H;  5IP9 G;  3CCQ A;  1I5F A;  1NTG A;  1YBY A;  1NBW A;  3PUV A;  1OXV A;  2JA8 G;  1B8A A;  2R6G A;  3AFP A;  1FJG Q;  1OXS C;  4LF9 Q;  1N33 L;  3KFU A;  3E9I A;  5C44 H;  2R7Z H;  3HOV G;  1B70 B;  5BR8 L;  2UU9 Q;  4NXM Q;  3PUX A;  1N8R C;  4R1J A;  3OTO L;  5M5W H;  4JV5 Q;  3HOZ G;  1JB7 A;  1CSP A;  3GDE A;  1HZC A;  5C4X G;  3PGZ A;  3TEH B;  3CCS A;  4P71 A;  4LUO A;  4DV7 Q;  4NXN Q;  1L2F A;  1I3Q H;  1E3P A;  4JI2 L;  3T1Y Q;  1VQP A;  3TRE A;  1CKN A;  1Q81 C;  1CUK A;  1RL2 A;  1IBK L;  5C4J H;  2Y0S G;  3WWV A;  5C0X I;  2C35 B;  4B3R L;  3CF5 A;  1Z47 A;  4YWK A;  4NPS A;  5M5X H;  1TWH H;  4IPD A;  4R4C A;  4IPH A;  4MTN A;  4OON A;  5HY6 A;  1E22 A;  4PZ7 A;  5JEA G;  1FJG L;  3AYH B;  5LMN W;  5JJK A;  4TQU S;  4JI6 Q;  1P16 A;  1WCM G;  2UXD Q;  1GM5 A;  2OQK A;  2IY5 B;  4BBS H;  2ASB A;  2UU9 L;  4NXM L;  2RCN A;  4WJ4 A;  1XMQ Q;  2EQS A;  4JV5 L;  2YTV A;  1UE6 A;  5C3E H;  3VDY A;  2B3G A;  1JMC A;  4DV7 L;  1YIJ A;  3KF6 B;  4ME3 A;  4NXN L;  4DNI A;  4DPG A;  4IFD I;  5IYD G;  4A3B G;  3T1Y L;  3PF4 A;  4LF4 Q;  4GN4 B;  3W1G A;  1OXU A;  4YWL A;  4JI4 Q;  3A74 A;  1I6H H;  1IXR A;  5C44 G;  2R7Z G;  1A63 A;  1Q1E A;  1X6O A;  2JE6 I;  2QEX A;  4PZ6 A;  3J80 i;  3FHW A;  3RLN A;  2LSS A;  5IYC H;  1PFS A;  1KD1 C;  1PH2 A;  1TWC H;  4P73 A;  4OWW B;  2B63 H;  2Q2U A;  1X56 A;  4O2D A;  1AE2 A;  1VQF A;  4JI6 L;  2CFM A;  2MQH A;  2ZTC A;  2LXJ A;  3L7Z C;  5C0X J;  4IOC A;  4HID A;  4JI3 Q;  2UXD L;  4YCU A;  1PH6 A;  4UP9 A;  3E0E A;  1HNX Q;  1S3O A;  1XMQ L;  1A62 A;  4C3J H;  4C2M H;  3G48 A;  3I56 A;  1YI2 A;  3J80 c;  4DR5 Q;  1VQG A;  2CWA A;  5M5Y H;  1QUQ B;  2YYZ A;  5E7N A;  1VQ9 A;  3HKZ E;  2PNH A;  1UE5 A;  4QGU A;  4DV1 Q;  1VQ4 A;  4LF4 L;  3HOY G;  3GTP H;  4JI4 L;  3CP0 A;  1YIT A;  2NVT H;  1VQJ A;  2CKZ B;  2UUB Q;  3K0X A;  4BBS G;  1O7I A;  2VY3 A;  1TWG H;  2VQF Q;  4WJ3 M;  2R93 H;  4DKA C;  4IFD J;  1OXX K;  4B3S Q;  2OTJ A;  2F4V Q;  2PQA B;  3CAM A;  4IJH A;  1PYB A;  2WAQ E;  5C3E G;  2IHF A;  2K14 A;  4DR3 Q;  3L2P A;  1V9P A;  1MIU A;  4HIO A;  4HIK A;  4JI3 L;  4AQY Q;  2D0P A;  1J5E Q;  3GTK H;  3PO2 H;  3FKI G;  4DK6 C;  2I5M X;  1HNX L;  4O0A A;  3PIP A;  4QIW E;  4A3E H;  2IX0 A;  5J3B A;  3M3Y H;  2CWP A;  2IHE A;  1YEZ A;  1YHA A;  2WB1 G;  1AE3 A;  3CC4 A;  2JK8 A;  4DR5 L;  3G71 A;  4JI0 Q;  5JEA J;  3U4Z A;  2VL6 A;  3D31 A;  4QQB X;  5HGQ A;  4DV1 L;  3BZK A;  2ZM6 Q;  3K81 C;  4DK3 C;  4LF6 Q;  2B63 G;  1N9W A;  2UUC Q;  3FP9 A;  1TXY A;  4GS3 A;  2UUB L;  5FJ8 H;  3U50 C;  1EQQ A;  2VQE Q;  1U5K A;  1BBU A;  2N49 A;  2VQF L;  2KCM A;  4PZ8 A;  1K8A C;  1IL2 A;  2D0O A;  4B3S L;  2F4V L;  1HH2 P;  2CQO A;  2A19 A;  3EIV A;  2ZJQ A;  4NB3 A;  1T9H A;  3RN5 A;  5IP7 H;  4DR3 L;  2KBN A;  4AQY L;  4A3J H;  1J5E L;  1G6P A;  2GN5 A;  4B3M Q;  3AFQ A;  1SRU A;  3W1B A;  1VQB A;  1AH9 A;  2KHI A;  5C0X G;  2HHH Q;  3S1N H;  2LXK A;  2K4K A;  4HIM A;  3GTJ H;  1X3E A;  2JEA I;  4A3I H;  3UDG A;  2OTL A;  4GLV B;  4YY3 Q;  2HQL A;  2UUA Q;  5FLX c;  2R93 G;  4JI0 L;  3DLL A;  2NVQ H;  4AYB E;  5DLQ E;  3M85 A;  4UY8 C;  2CCZ A;  3CCJ A;  2ZM6 L;  4LF6 L;  3M9B A;  1SR3 A;  1GKH A;  1PH7 A;  2UUC L;  3TRZ A;  3CXC A;  1HZ9 A;  3HKS A;  1PHJ A;  1E1O A;  1WFQ A;  3RLF A;  2VQE L;  1L0W A;  5EAY A;  1YJW A;  3PO2 G;  1E24 A;  4GKK Q;  2PI2 E;  1HNW Q;  4A3E G;  4YCV A;  3CC2 A;  1CSQ A;  2JQO A;  3OYY A;  3S24 A;  3T1H Q;  1BKB A;  4DV2 Q;  4IFD G;  3I2Z A;  3EN2 A;  3IRB A;  4K0K Q;  1Q82 C;  4KLK A;  1VQK A;  4B3M L;  3UDX A;  3GD7 A;  2E8G A;  4A3F H;  1HZB A;  3AQQ A;  5GAG C;  1SLJ A;  4BY1 G;  1E7Z A;  2HHH L;  1Y1V H;  4P75 A;  3KJP A;  3ERS X;  5FJ8 G;  3I4M H;  1VS0 A;  2Z6K A;  1WOC A;  4YY3 L;  3ULP A;  2UUA L;  3HOU G;  1EOV A;  4IOA A;  5GAE C;  3K8A A;  2MNA A;  1YNX A;  3HOY H;  3LGJ A;  1PV4 A;  1MKH A;  4DR4 Q;  1Q46 A;  2K50 A;  3HOW H;  1D7Q A;  1SMX A;  5IP7 G;  3M7N A;  1W2B A;  4YCW A;  3KF6 A;  4A3J G;  2E2H H;  4X6A H;  1K8G A;  4OX9 Q;  2HIV A;  4GKK L;  4H02 A;  1FVI A;  3DM3 A;  4KI0 A;  1HNW L;  2Z6K C;  4RG1 A;  1VCI A;  4A3I G;  3I7F A;  3JC6 6;  3KLW A;  5M3F G;  3T1H L;  2VUM G;  4DV2 L;  3K7A H;  1OTC A;  3PUW A;  1EFW A;  1K73 C;  4DV4 Q;  4K0K L;  3I4O A;  4IJL A;  3J7A 5;  3FKI H;  4JI5 Q;  2ZTD A;  2AKW B;  1VQC A;  2JEB I;  3ULJ A;  1CKN B;  3H0G H;  3JAM i;  1HZA A;  3K80 C;  1G51 A;  1XJV A;  2IX1 A;  4LWC A;  2YV5 A;  1FGU A;  5GRO A;  1PH3 A;  3CD6 A;  2DGY A;  2VNU D;  2Q2H A;  4GNX A;  1C7Y A;  4OO1 I;  2NN6 I;  3M4O H;  4DR4 L;  4EX5 A;  2KEN A;  3A0J A;  4PG3 A;  4P72 A;  1V1Q A;  3S1Q H;  4UP8 A;  2UXB Q;  1QUQ A;  4JCV E;  4X62 Q;  4A3F G;  4Y7N H;  4L5S A;  1X3G A;  4OX9 L;  1PVO A;  1PH4 A;  1Y1V G;  4HJ7 A;  3JAM c;  5JJL A;  1X55 A;  4GOP B;  3PF5 A;  3I4M G;  1S72 A;  1L1O B;  4GNX C;  2Y0S E;  1LTL A;  4DV4 L;  4LF5 Q;  3KDF B;  1A0I A;  1VQN A;  4JI5 L;  1X9N A;  4GKJ Q;  4GLX A;  3S2H H;  3F1Z A;  2YTY A;  3HOW G;  2Z0S A;  4JI1 Q;  2D62 A;  3GTQ H;  1HR0 Q;  1I94 Q;  4LF7 Q;  1SRO A;  2VW9 A;  4A3L H;  1A8V A; 
#chains in the Genus database with same CATH topology
 1S03 G;  5LMU H;  5JUM A;  1SFO B;  3RZO H;  2YU9 B;  4DV0 Q;  1IBM Q;  3NGD A;  5J22 A;  2YRW A;  4QJF A;  5IT9 c;  1CZW A;  3KHR A;  4FDB A;  3RMH A;  1B7Y B;  3MA2 B;  2PMZ A;  5KT5 A;  3E5N A;  4DR2 H;  2F0S A;  1KAW A;  5KFP A;  3S1R B;  1G29 1;  1JX4 A;  1YJ9 A;  4GKJ L;  5KFG A;  1GVP A;  4BY1 H;  2VA3 A;  3KUP A;  4C3H H;  1UE1 A;  1IBL Q;  4RMF A;  2WFW A;  4ULL A;  5LL6 X;  1I94 L;  3HOU H;  4LF7 L;  3SEB A;  3J80 E;  1JOK A;  4UFZ A;  2HCI A;  2ALY B;  2F0O A;  3T56 B;  2XIG A;  4CC5 A;  3T53 B;  1SYF A;  2KCT A;  3QR8 A;  4LFA L;  1GSA A;  1G8Z D;  1NJI C;  4X64 L;  1B04 A;  1N32 L;  4A3D G;  2HVQ A;  4J9M A;  4LMQ D;  3RV3 A;  4JI2 H;  3CCV A;  2PW5 A;  2NVY B;  1XMO Q;  1XPU A;  3JSL A;  3GTL B;  2JA8 B;  5JH7 F;  3U58 A;  5HUR A;  1Q90 A;  1JDE A;  5D14 A;  3KYH C;  4YWM A;  5IE8 A;  3S1N H;  4O3Q A;  2R7F A;  4B3R H;  1VQA A;  3TQT A;  2F3I A;  2VS1 A;  3GO5 A;  4V19 0;  5L1K A;  2NVX B;  4G57 A;  4DR1 Q;  1TR5 A;  1AZQ A;  5DLG A;  3DWP A;  5AJ3 Q;  3K5L A;  1F77 A;  2J6U A;  4LF9 H;  1F2M A;  4X65 L;  5EKL A;  4KHP Q;  2N55 A;  4YR2 A;  1K83 H;  3TQY A;  4EQ5 A;  4LF6 H;  2OQ0 A;  2ATW A;  2JA7 A;  4MNO A;  1NAP A;  2GVA A;  1BGW A;  1JOR A;  2R92 H;  2VB3 X;  5ISR A;  4HAE A;  4DAP A;  2Z6B A;  1LT6 D;  3GII A;  4TVA B;  2JA9 A;  2I5L X;  4C3H G;  1JDB B;  1K83 A;  1F2Y A;  1M1K C;  3HOX G;  4MV4 A;  2WAC A;  3F8T A;  1N34 Q;  2RSO A;  3IG0 A;  5FOB B;  5KFL A;  1I50 B;  2MO0 A;  2EJF C;  4A3K G;  1MJE A;  4LF8 L;  1PYS B;  2K05 A;  4LFB Q;  5JAV A;  1H9M A;  5LYJ F;  4DV5 H;  1GUW A;  3Q1K A;  4G7H C;  1OXT A;  4BA1 I;  2J7Z A;  4FXK C;  3RN2 A;  3J7Z C;  3GID A;  2AGQ A;  2AUJ D;  2JXM B;  1AUV A;  5HV6 A;  5T1I A;  4YR3 A;  1EOT A;  3CW2 C;  5C44 B;  5KFV A;  1KDB A;  2ZJR A;  3I4N H;  3AEV A;  4YB8 B;  2XWB B;  1C4Q A;  2V4D A;  2AQ3 B;  3NTH A;  1SE4 A;  3IFT A;  3KK7 A;  2UVU A;  3BAB A;  1A6X A;  3TBI B;  5LHY 1;  3K58 A;  1DGS A;  2IL8 A;  2A6H C;  3ORR A;  4RB0 A;  2QK4 A;  2W6Q A;  2K03 A;  5DAU A;  2VPQ A;  2B29 A;  3G7L A;  4LFC Q;  3ONA B;  2R92 G;  4EQP A;  2BH2 A;  5C4J B;  3WDN A;  1YHQ A;  2E5L Q;  4HMJ A;  3CME A;  1SFO H;  3AMU A;  3RNU A;  1V4Y A;  4R4I A;  2YU9 H;  1EIF A;  4PMW A;  4ZOL F;  2FLP A;  2DPJ A;  3HOY B;  4C5A A;  1LTS D;  1B4O A;  1KL9 A;  2SDF A;  2FPP B;  4QW8 A;  1KIX A;  4RKB A;  3QFF A;  1E4F T;  4FS2 A;  4BBS B;  4AYB B;  1CQF A;  4CJ1 B;  1QZH A;  4DV1 H;  2FPI B;  3V05 A;  3K5O A;  3S1R H;  1XNR L;  2RGV A;  3RFC A;  3RJ0 A;  4OIJ A;  4Q44 A;  5IY0 A;  3K7A B;  4B3T L;  3LX0 A;  4JI7 Q;  1LTI D;  5KNC A;  2AMC B;  4O42 A;  5FLX W;  4ZRZ A;  3K59 A;  1EYG A;  2R7N A;  3TP8 A;  3I4N G;  4TRD A;  4IO9 A;  5GON F;  2A74 C;  3WO0 A;  1V43 A;  2V4R A;  4FF2 A;  2PPB C;  1SSO A;  1K0R A;  1YHB A;  5CAE B;  2ICE C;  2W6P A;  3OMG A;  4ABN A;  5J2T F;  3W5O A;  4C1N K;  4KHZ A;  1BVS A;  2Z8L A;  5KG0 A;  2NVY H;  5LMU Q;  2JA8 H;  3GTL H;  1ICF B;  3A8I E;  1ASY A;  2HIX A;  3STB D;  2ZM6 H;  4C3J B;  1LYL A;  1PZJ D;  3KHL A;  2NVX H;  1GGO A;  1F9R A;  2C00 A;  1X65 A;  2VQE H;  1GYF A;  4LUV A;  4DR6 L;  1PA6 A;  4R7R A;  4CDF C;  2NVY A;  4OWT B;  3MWE A;  3GTL A;  2J9G A;  3GTP B;  2B2W A;  5H1S E;  4YHH Q;  1Q1B A;  4GN5 A;  2B2Y A;  1QG7 A;  4QW9 A;  2R93 B;  2NVX A;  1KC8 C;  3MWY W;  1CI3 M;  1L2Z A;  1SYX B;  2DNC A;  3KOJ A;  2HHH H;  4X3K A;  2OF1 A;  1SEB D;  1BXT A;  2K75 A;  5DGA A;  2B2W C;  4R4T A;  3PO2 B;  4L5Q A;  1B9N A;  4R8N A;  2XTI A;  3NEM A;  2B2Y C;  1LUZ A;  2UXC L;  3KAJ A;  3M3Y B;  1FJG H;  1I50 H;  4XTC S;  2WV6 D;  4JI2 Q;  3UE0 A;  3TS0 A;  2ES2 A;  1W93 A;  1VQE A;  1PLF A;  2MCT A;  1JJ2 A;  1XYI A;  2C28 A;  4JV5 H;  1HNW H;  2N88 A;  1VQ6 A;  4B3R Q;  4ECV A;  2K6A A;  1FYC A;  4ZUI A;  5IYD H;  1I50 A;  5KFK A;  2JA8 G;  3PUV A;  1OXV A;  1B8A A;  2R6G A;  3MWD A;  3KFU A;  4LF9 Q;  4E4T A;  2WAQ A;  5C44 H;  3KLS A;  4WFN 3;  2XRQ D;  4CDD C;  5BR8 L;  3O13 A;  5L1L A;  3TIG A;  1M7J A;  3T5L A;  4A3J B;  1SYD A;  5AFW A;  3JAM W;  4NLG A;  3NXW A;  3PGZ A;  3CCS A;  4DV7 Q;  2PVP A;  1L2F A;  4XDX A;  4JI6 H;  2FIN B;  3QB3 A;  2HUG A;  4RGM A;  3JRW A;  1B50 A;  1RL2 A;  5EOY A;  4F4W A;  5C4J H;  2LS0 1;  5ELF A;  3GQC A;  3CF5 A;  1JIC A;  2IW3 A;  3VPC A;  1SYG A;  4OON A;  5JEA G;  2I46 A;  3J81 L;  5LMN W;  3BYT B;  4FF3 A;  3D4D A;  4OEL B;  2OQK A;  4BBS H;  4RB2 C;  3LWU A;  3VYS A;  1B53 A;  3MFG A;  3K3V A;  2NUA B;  5KFJ A;  2YTV A;  1UE6 A;  2CQY A;  5KG7 A;  1JMC A;  3A7L A;  3EFX D;  4ME3 A;  4NXN L;  5IYD G;  4FBU A;  4UCV A;  3T1Y L;  3PF4 A;  3DM1 A;  4AYB A;  4Q45 A;  2UXB H;  5C5J A;  1U4R A;  3N42 B;  4X62 H;  3A74 A;  4CKB A;  5C44 G;  4ECT A;  5KG6 A;  3SR1 A;  2QEX A;  1SNP A;  4PZ6 A;  3J80 i;  3HOW B;  1PFS A;  1HA6 A;  3HP3 A;  2CH4 A;  5J39 A;  4O2D A;  3GIJ A;  4QWB A;  1AE2 A;  4RFB A;  3L7Z C;  4ECR A;  4IOC A;  3IAY A;  4HID A;  4JI1 H;  1DXM A;  1QNU A;  4XQN A;  1S3O A;  4C3J H;  2KJX A;  1HUM A;  3BVM A;  4RGO S;  2R8K A;  1KAB A;  3I56 A;  3SHL A;  2FK3 A;  2R85 A;  2F4V H;  2B8G A;  1DD2 A;  4BWS C;  3J80 c;  2IJ0 A;  3H0G B;  2WB1 B;  1QUQ B;  4HN7 A;  3QIA A;  1VQ9 A;  3GLK A;  1UE5 A;  2L9H A;  4QGU A;  4DV1 Q;  3QWN A;  3HOY G;  3GQB A;  5C0X H;  1IHZ A;  3GTP H;  1YIT A;  3ERO A;  4BBS G;  1O7I A;  2L55 A;  2VY3 A;  3M4O B;  1GSO A;  1CZG A;  2V5A A;  2R93 H;  3J81 E;  4IFD J;  3N43 B;  4M7E A;  4DGZ A;  2K1B A;  4J9N A;  1V1P A;  4R8I A;  1MIU A;  4HIO A;  3GTP A;  2D0P A;  1TS5 A;  3PO2 H;  4TV9 F;  3JZI A;  3OSP A;  2LY7 A;  4KJO A;  4FNF A;  3PIP A;  3M3Y H;  2R93 A;  5J3B A;  1EEI D;  2JN4 A;  3P7J A;  4E6I A;  2R84 A;  3A56 A;  1YHA A;  1EYA A;  3PW2 A;  2R8G A;  2PZU A;  3GTQ B;  3BZK A;  3M4Y A;  2ZM6 Q;  4ED6 A;  1N9W A;  1SMY C;  3FP9 A;  2UUB L;  4G3I A;  3OPO A;  2VQE Q;  1ZEQ X;  1VBG A;  2UUA H;  1WTX A;  1LTA D;  4C3J G;  3NQI A;  4IUN A;  1EL0 A;  4DUY H;  1HH2 P;  4TQS A;  3EIV A;  3M4I A;  3S15 B;  4J9K A;  4DR3 L;  4A3J H;  4BWG B;  3EJI A;  2CQA A;  3AB9 A;  1VQB A;  3QG1 A;  2KHI A;  5C0X G;  2HHH Q;  3BG5 A;  4HIM A;  4ME6 A;  3C3L A;  4JW0 A;  3RZD B;  1KLG D;  3UDG A;  3K5I A;  1NSN S;  2R93 G;  1WCM A;  4ECW A;  5DLQ E;  3LNN A;  3M85 A;  4UY8 C;  2CCZ A;  3MC0 B;  1HQM C;  3L9A X;  1PH7 A;  3VA7 A;  2O4X A;  1HZ9 A;  3CXC A;  3HKS A;  3PO2 G;  1WFQ A;  3RLF A;  2FE3 A;  1WTP A;  2I8C A;  2ZXR A;  2VUG A;  2VQD A;  1HNW Q;  3C1E A;  2F03 A;  1BKB A;  3KHH A;  2VUM B;  5M3F B;  2R7Z A;  4FM9 A;  4O3O A;  3R3O A;  3K5N A;  3GD7 A;  1HZB A;  2R8J A;  5GAG C;  2UVV A;  3KJP A;  2RSN A;  3GV3 A;  5KG5 A;  4JI8 H;  4DR7 H;  4O3P A;  2Z6K A;  5EPJ A;  2KSW A;  2WKD A;  1EOV A;  4NW2 A;  5GAE C;  2MNA A;  1ROD A;  3LGJ A;  2V4Q A;  1PV4 A;  1Y8O B;  2JA5 B;  3HOW H;  1EWH A;  4A3J G;  1PZK D;  1S5C D;  2F0V A;  3RD4 A;  3PO3 B;  3SXH A;  3DM3 A;  3CU7 A;  2Z6K C;  5LL6 S;  3BVZ A;  3JC6 6;  4QIW B;  3T1H L;  2KA7 A;  1DOM A;  4IUT A;  5KG1 A;  5KFH A;  2D5D A;  3V6H A;  3I4O A;  1CE8 A;  2ZTD A;  2AKW B;  5D65 A;  3A7A B;  3ULJ A;  1CKN B;  4RZR A;  3H0G H;  1UUP A;  3K80 C;  1HZA A;  2D9U A;  2A68 C;  2F0U A;  1XJV A;  2DWC A;  4F4Y A;  1A3T A;  2YV5 A;  1FGU A;  2J4X A;  1M0W A;  2VNU D;  2Q2H A;  5BN4 A;  5IGD A;  4GNX A;  5KFW A;  2CH4 W;  2NN6 I;  3M4O H;  1FR3 A;  2VPS A;  1EUD B;  1XXG A;  5JVH 3;  2EYF A;  2RQX A;  2XCL A;  3RTX A;  3SE7 A;  3WOF A;  5C4Z A;  3S1Q H;  4UP8 A;  2UXB Q;  5KEE A;  1QUQ A;  2WB1 A;  3M9O B;  4X62 Q;  2R61 A;  4DAY A;  1X3G A;  1HR0 H;  4HNV A;  4C56 C;  1PH4 A;  4IRC A;  2JA6 B;  3JSN A;  5DM6 3;  4EQN A;  2DN8 A;  2B2U A;  5KIX A;  3MTS A;  2EYO A;  4GNX C;  2Y0S E;  4FO2 A;  4DV4 L;  4FF1 A;  4FYD A;  4F7X A;  2YCH A;  5KFT A;  4PV1 C;  4GLX A;  3F1Z A;  3JRX A;  3HOW G;  5KYI A;  2R7K A;  4JI1 Q;  4DL6 A;  3GTQ H;  1AN8 A;  1NNX A;  2B2U C;  5FO8 B;  3G6Y A;  5CV6 A;  3BYY B;  1AEX A;  3TP5 A;  4H44 C;  4DL5 A;  1ENC A;  1BCP D;  4GLA C;  4MZ9 A;  2R86 A;  4EFE A;  4RH6 A;  2AWO A;  3J7A F;  1KXL A;  3S9W A;  1TWG A;  3S15 H;  1IBL H;  3GTQ A;  4A93 B;  4UCT A;  3H0G G;  1VMC A;  2SEB D;  3G4S A;  5F9L A;  1TWC B;  4DV6 H;  1EQR A;  4O3R A;  1C9O A;  4UPA A;  4LF5 L;  3GTK A;  1JLL B;  3RZD H;  2HT1 A;  4AIM A;  1SYE A;  2RHQ B;  3R8B A;  4OWX B;  2I80 A;  2W8L A;  4J8Q A;  1LLR D;  2FJ2 A;  1N33 H;  1JT8 A;  3G6E A;  4ED8 A;  1UEA B;  1IL8 A;  4DAM A;  2L15 A;  1Y69 U;  4L5T A;  1BBX C;  5KFS A;  5CA0 F;  3MFH A;  3CPW A;  4OL7 A;  1QNK A;  4ZCK A;  4FS1 A;  1SYC A;  1GO3 E;  3FDT A;  4JBJ A;  1VQH A;  2HCC A;  5FLX L;  1QB5 D;  3H20 A;  1PH9 A;  4RU9 A;  5CV9 A;  2IP4 A;  2VUM H;  2EJG C;  3NBI A;  5M3F H;  1T94 A;  1D5X C;  3ND9 A;  4MTK A;  1ET6 A;  2GA4 B;  2PNR C;  1N36 Q;  4DUY Q;  1C7Y A;  2AUK A;  3HOX B;  1W96 A;  2BE5 D;  3ZYY X;  3E6Z X;  3RUP A;  5JVG 3;  4DU9 A;  2JJQ A;  3OW7 A;  3VR2 A;  4A3K B;  3B6Y A;  3H3V I;  1XNQ L;  5KFF A;  2VUM A;  1ZET A;  5DNF A;  5C4X B;  4APV A;  3RGX A;  1EY6 A;  1NMG A;  3CQZ B;  2JA5 H;  3I12 A;  3WO1 A;  2UU9 H;  2NWG A;  2YTX A;  1T5E A;  3SVM A;  4NXM H;  1MBY A;  3IKJ A;  1B33 N;  3OHA A;  4DR2 L;  4RUA A;  3GTG B;  4LFB H;  1AW7 A;  3PO3 H;  2RKS A;  4EG0 A;  1PFN A;  5TSS A;  1BBW A;  2XWJ B;  3VPD A;  1IW7 C;  5C1O A;  2GLT A;  2EYP A;  2F0T A;  1Q7Y C;  4TUY F;  3H15 A;  1RKN A;  3MZ5 A;  4ED2 A;  5FK9 C;  4J6H A;  5C4H A;  3Q22 A;  3RB6 A;  1YJN A;  3FMC A;  1PDQ A;  1YNJ C;  4QIW A;  4RHS A;  4RKL A;  5JVL A;  1CHP D;  3FPU B;  4KKU A;  2UXD H;  1HTL D;  3QOJ A;  1E2Z A;  4A3C H;  2E2J B;  4HNT A;  5GAD C;  1C0A A;  3GIK A;  1EU4 A;  1PMR A;  2DY8 A;  2QDB A;  4JI8 Q;  4DR7 Q;  3J81 i;  3L3O C;  3CPF A;  4HR7 B;  5FLX E;  2F52 A;  4X66 L;  2A68 D;  5IYB H;  2JA6 H;  2X6L A;  5COR A;  4K8J A;  1HNZ L;  4JBM A;  3PSI A;  1SCU B;  1WSC A;  1X3F A;  3CCL A;  3FMA A;  4LF4 H;  1A3U A;  4WJW A;  5M5W B;  4LF9 L;  2PMZ E;  2CW0 D;  4QY7 A;  4RNO A;  2SOB A;  4O1N A;  4DUZ L;  2JA5 G;  2NZ1 D;  4LMY A;  1IYV A;  5IT9 W;  2IMW P;  3T5H A;  3J81 c;  2ZTE A;  2W7O A;  1VQD A;  1Q12 A;  3JAM L;  3SDZ A;  3PO3 G;  1I4X A;  2NZH A;  1H9R A;  4BBR G;  1SXT A;  3C0F B;  1HA5 A;  5IGE A;  4XT3 B;  2R7D A;  1RJQ A;  1MGS A;  1TWH B;  4XT1 B;  2YL2 A;  5KFE A;  1HNX H;  1X54 A;  4JVZ A;  1KJJ A;  3F2B A;  3V2T A;  4Y52 H;  1STG A;  2F0Q A;  4MV8 A;  1TA8 A;  4A93 H;  4JG2 A;  4A3D H;  2WTF A;  3KTM A;  1D6E C;  2IT1 A;  1NMF A;  4JBW A;  4DR5 H;  4OEM B;  4DV5 L;  4L6T B;  1HR0 W;  5EJW A;  1PRT B;  2Q8T A;  1JCK B;  4O2B F;  5BPH A;  2AGO A;  5C3E B;  3F2D A;  5LMN L;  4A3C G;  1XTD A;  1DZ1 A;  3VR3 A;  2PZT A;  4POG A;  2SNS A;  4EYH B;  3TP7 A;  4LNQ A;  4XQJ A;  3ND8 A;  5IYB G;  2JA6 G;  4J1M A;  4DK1 A;  1QOH A;  3K7U C;  2I0Q A;  2NU6 B;  4L5R C;  4XXE A;  4AQY H;  1J5E H;  3D4W A;  1BR9 A;  1SNC A;  1QIL A;  4PQX A;  3F2C A;  4IR1 A;  5DGB A;  5CYU A;  1EY0 A;  1ZKO A;  2B63 B;  4HJ8 A;  1RDP D;  2FP4 B;  4PWQ A;  2YYA A;  3Q8R B;  1J8I A;  3OWF A;  3UDF A;  3SGI A;  4YHH H;  1SND A;  5IOC A;  2K5H A;  3ICE A;  3G6X A;  4JI0 H;  3ER0 A;  2L5T A;  5GQO A;  5ELN A;  4LSX A;  1A2T A;  3Q8Q B;  3HOX H;  1J6Q A;  2BQU A;  1LAB A;  4DV3 L;  1EFI D;  2R82 A;  1S0O A;  4ZHQ F;  1WD1 A;  4R4Q A;  2UUC H;  3JAM E;  1VMP A;  4A3K H;  4FVM A;  2B39 A;  4EBD A;  3CKI B;  3STB C;  4DV6 Q;  2C2R A;  4CJ0 B;  5C4X H;  4RB1 A;  3P1H A;  2Q2T A;  2DJG C;  1GD7 A;  3CQZ H;  2NVT B;  4A93 G;  3BZC A;  1WYD A;  5IWA L;  3GV5 B;  2LKV A;  2W9B B;  4B3M H;  3MR5 A;  1CT1 D;  1N33 Q;  3GTG H;  1LO5 D;  2N3S A;  1ZHS A;  3L0O A;  3TME A;  2WP8 J;  2RHS B;  4XYM B;  4RUC A;  3CCM A;  1QVF A;  4J9S A;  3CQZ A;  2V9W A;  4GZY C;  3BG3 A;  3OSO A;  2F3W A;  1ET9 A;  3PW5 A;  2B2V A;  3GTG A;  4DL4 A;  4G4K A;  2H5X A;  1EZ8 A;  5KYL A;  1O80 A;  2WYO A;  4GKK H;  4JYA L;  3BQ0 A;  1IW7 D;  3J7Y W;  2ZDH A;  5ELB A;  5D3I B;  2E2J H;  2EY2 A;  2F0D A;  3A8J E;  4DV7 H;  2F0E A;  4RB3 C;  4ECS A;  1I4H A;  2B2V C;  3PVX A;  4K0K H;  1I4G A;  3AFP A;  1OXS C;  1YNJ D;  2QKI C;  4MV1 A;  3V4Z A;  5E4X A;  5KT3 A;  4QUF A;  2UU9 Q;  4NXM Q;  3VR6 A;  3PUX A;  4IZ8 A;  4DFA A;  3OTO L;  2R92 A;  5M5W H;  4APM A;  1KLU D;  1ILQ A;  5C4X G;  1CSP A;  2ATL A;  3AU7 A;  5FKA C;  4HR7 A;  4K2L A;  2C9O A;  3CRL C;  2QEJ C;  4KV6 A;  1TY0 A;  1E3P A;  3TN2 A;  2J6S A;  1KNE A;  2F0I A;  4LAA A;  3GP7 A;  1SE3 A;  3DF7 A;  2NVQ B;  1CUK A;  2CW8 A;  1IBK L;  2XD4 A;  5CR3 A;  4L8J A;  3WWV A;  1SAP A;  1H9S A;  1Z47 A;  4YWK A;  3TIN A;  1TWH H;  4ODG A;  4IPD A;  1I6V C;  3H91 A;  4JI5 H;  2HQE A;  4PZ7 A;  1FJG L;  2A6E D;  3AYH B;  3GIP A;  2UXD Q;  1VF5 C;  2QDL A;  2ASB A;  1BNZ A;  3OMC A;  5F2D A;  4IRD A;  4FU0 A;  3LWE A;  4CKE A;  4PDB A;  2JEJ A;  2EQS A;  4JV5 L;  2RA4 A;  3CHB D;  1TWH A;  4A3F B;  2W9C B;  5C3E H;  5KFY A;  3I4L A;  3RIZ A;  2RDJ A;  2MGS A;  5G3L D;  4EGQ A;  1PZI D;  5DM7 3;  4DNI A;  4QWD A;  4IFD I;  3I4M B;  3HRZ C;  4YIJ A;  4LF4 Q;  4OGQ C;  3W1G A;  1OXU A;  1OWT A;  3H6M A;  1A63 A;  2L12 A;  5KGU A;  4M1U B;  1DCZ A;  1RJT A;  2BCO A;  2H1E A;  1A2U A;  5IGG A;  2OH2 A;  4RWS C;  1Z2P X;  1DOL A;  1T5X D;  2B63 H;  1S68 A;  1X56 A;  4GKJ H;  1SFO A;  2B8F A;  4JI6 L;  2CFM A;  2MQH A;  4JV0 A;  2LXJ A;  4OHJ A;  5C0X J;  3WNZ A;  2YU9 A;  4YCU A;  1GUT A;  1KBL A;  2VR1 A;  3E0E A;  2PZW A;  1HNX Q;  1V8Q A;  1XMQ L;  1I94 H;  3G48 A;  3G6J B;  2ALZ A;  2B63 A;  4DR5 Q;  1VQG A;  2J6T A;  2CWA A;  4LFA H;  2YYZ A;  4J9L A;  3HKZ E;  4X64 H;  1C3O A;  2PN1 A;  1N32 H;  4F8M A;  4GC6 A;  4JI4 L;  2NVT H;  4CKC A;  5BN3 A;  2M9V A;  3OWE B;  1EU3 A;  1HCZ A;  1B44 D;  3N6R A;  2PQA B;  3CAM A;  4IJH A;  3N40 P;  2WAQ E;  5C3E G;  5ELE A;  4AQY Q;  4JI3 L;  1J5E Q;  3BZD B;  1BCP B;  1TAE A;  4DK6 C;  2I5M X;  5EKI A;  4MV9 A;  3GIM A;  2W9B A;  4X65 H;  4F4X A;  1ULZ A;  2CWP A;  2IHE A;  4Q8F A;  2M05 A;  2R7M A;  5D1P A;  5C5M A;  1AE3 A;  2ZXO A;  3S2H B;  2JK8 A;  2Q8R E;  5I2Y A;  3G71 A;  4JI0 Q;  2VL6 A;  3D31 A;  2YS6 A;  2NYZ D;  5HGQ A;  5IGC A;  3PW0 A;  3NUC A;  4LF6 Q;  3K81 C;  2B63 G;  1E4E B;  2UUC Q;  3NSW A;  3NWS A;  4NDX A;  4YJ3 F;  4BY7 B;  2VQF L;  5FO7 B;  1IL2 A;  3RB0 A;  2D0O A;  4B3S L;  2QCP X;  2F4V L;  1WH2 A;  3G8C A;  1M0T A;  5JEA H;  4HSP A;  1I6U A;  4NP5 A;  1EZ6 A;  5IP7 H;  4PNY A;  4QMG A;  1G6P A;  3GV8 B;  1UAP A;  2GN5 A;  5EPK A;  4B3M Q;  3H4B A;  4EBC A;  4HTH A;  4F4Z A;  3UQ8 A;  1X3E A;  3MFI A;  2OTL A;  1S5F D;  3PMF A;  1B3Q A;  5FLX c;  4MV7 A;  4KK7 A;  5DQI A;  2NVQ H;  4U6P A;  4AYB E;  5J1Z A;  4MTD A;  5T14 A;  3M9B A;  2KEC A;  2EXZ A;  4MA5 A;  5BMV F;  3MXU A;  5CBA E;  5IOD A;  1E1O A;  1L0W A;  5JPM C;  1E24 A;  3S1M B;  4GKK Q;  5C1P A;  2PI2 E;  1WR2 A;  1E2V A;  5JPN C;  1LAC A;  4EGV A;  5CC4 A;  1BDO A;  4IZO A;  1PXU A;  3EN2 A;  4CC6 A;  4FXG C;  4K0K Q;  1AUX A;  2QF7 A;  4KLK A;  1VQK A;  3UDX A;  1L0Y B;  4A3F H;  2EYL A;  1SLJ A;  4UCO A;  5KFC A;  3BVG A;  4LH6 A;  5KG3 A;  4RNN A;  3I4M H;  3T13 A;  4YY3 L;  2UUA L;  4QWE A;  3C1F A;  3N6X A;  4TSS A;  4IOA A;  3K8A A;  5M3M B;  3HOY H;  4WD3 A;  2F3V A;  1MKH A;  3K5H A;  1Q46 A;  2K50 A;  1D7Q A;  5IP7 G;  1JOO A;  1S5B D;  4YCW A;  4X6A H;  1SDF A;  1I4Q A;  4OX9 Q;  1XNR H;  1FVI A;  2F0K A;  1V51 A;  1EY5 A;  1VCI A;  4DF7 A;  4B3T H;  4NMZ A;  1KEE A;  4DV2 L;  3K7A H;  4K5V A;  3PUW A;  1EFW A;  1CQI B;  2DZD A;  3S16 B;  2BDO A;  4JI5 Q;  3GTO B;  1VQC A;  2JEB I;  1SYB A;  3RAX A;  3BS1 A;  3G6V A;  3JAM i;  1VBH A;  2NB0 A;  1WD0 A;  2MPM A;  3V6K A;  4LWC A;  4K2K A;  3VPB A;  2DY7 A;  1PRT D;  4X3T A;  3KAL A;  4DR4 L;  1K1S A;  2JYO A;  2KEN A;  3A0J A;  4PG3 A;  5IGB A;  1V1Q A;  4N9T A;  2Z4H A;  5HGT A;  4A3F G;  3V96 A;  4IWX A;  4K14 A;  3JAM c;  5JJL A;  4GOP B;  3I4M G;  3PF5 A;  4DR6 H;  2K32 A;  1L1O B;  1DOK A;  2KQ3 A;  1LTB D;  4EGJ A;  3KDF B;  3MEH A;  5HBR B;  4CDC C;  2EZV A;  4GKJ Q;  3I91 A;  2FHT A;  1EIH A;  3S2H H;  3X3M A;  1K8O A;  2IX3 A;  2D62 A;  3R5H A;  1I94 Q;  5EKK A;  4LF7 Q;  1SRO A;  1ICW A;  4A3L H;  1A8V A;  2E2I B;  1STH A;  1UWV A;  3D6C A;  1CHQ D;  1X32 A;  4LFA Q;  1TVX A;  2WIN B;  5IT9 L;  4X64 Q;  2EE1 A;  4KMU C;  1N32 Q;  2ASJ A;  2UXC H;  3KXY T;  4KN7 C;  2A1A A;  1AZP A;  4A2A A;  1QZG A;  2AHO B;  1BCP C;  4EBE A;  2RGR A;  4IUU A;  2EIF A;  4QWC A;  1VF7 A;  1VQ8 A;  2YZM A;  2VZA A;  1WI5 A;  5C3X A;  3V4S A;  5DLF A;  2FMM A;  5LOV F;  5C3W A;  2A5H A;  4ZQI A;  4X65 Q;  1HR0 L;  4OO1 H;  1XWE A;  1T3N A;  3EYY A;  3HS0 C;  5BR8 H;  3A5Z B;  1PTO B;  5CMD A;  1N36 H;  1IKM A;  1RCV D;  2JSO A;  4K5W A;  2KED A;  2MJ8 A;  1G2T A;  1KJI A;  1F9S A;  3S1M H;  1MSG A;  4DV0 L;  1IBM L;  5KFI A;  4XYQ A;  4DXG A;  3CCE A;  2ZDQ A;  1Y1W G;  5KFN A;  1ASZ A;  2FLL A;  5JQW A;  2OCE A;  3DHQ A;  1KQS A;  2ASD A;  2OLS A;  3LML A;  1QCB D;  2VXW A;  4CDE C;  1K3R A;  4XYL B;  4LF8 Q;  4A3L G;  3HOV B;  1LTG D;  4O2A F;  2K5N A;  1H95 A;  1KHI A;  1EIG A;  4BY7 G;  1A15 A;  1SNM A;  5G3L F;  5C5L A;  3VYU A;  1EY7 A;  1S4Z A;  5NUC A;  5M3M H;  3HOZ B;  2BE5 C;  1IBL L;  1JKJ B;  4UP7 A;  1NE3 A;  2EXD A;  4MHE A;  5IT9 E;  1PH8 A;  4IUV A;  2ASL A;  4QCL A;  1S0M A;  4TV8 F;  1EUJ A;  2TSS A;  2O2L D;  1XPR A;  4YAK B;  3N41 B;  4DK0 A;  2Y0S B;  4NXN H;  3NEN A;  1EY8 A;  1JIH A;  2OEO A;  3T1Y H;  1K0S A;  3S16 H;  3FDS A;  1CKM A;  3DXJ C;  1XMO L;  1GLV A;  2L11 A;  2XSC A;  3GTO H;  4OO1 G;  1D2B A;  2JEF A;  1TQO A;  4K5X A;  4RNM A;  1GUO A;  1T36 A;  5FLM H;  1DV2 A;  4XQQ A;  3ZJY C;  1WTQ A;  4QUC A;  3UE1 A;  4DR1 L;  4YR0 A;  5L1J A;  1QVC A;  5AJ3 L;  3CMA A;  4IWY A;  4KHP L;  3MR3 A;  1I7L A;  3D6W A;  4BBR B;  3GIL A;  4JPB W;  1VQI A;  1IKL A;  1DIK A;  3QZ8 A;  1LV9 A;  4UDU C;  3K6O A;  5C8Y F;  1FNU A;  3PUY A;  3SI8 A;  4R9W A;  5M3M G;  1XNR Q;  2CW7 A;  1FNV A;  2WDT A;  1N34 L;  4K6D A;  3OW2 A;  1Z9F A;  1EQT A;  4B3T Q;  1I3Q B;  4HQ6 A;  4I7A A;  2CW0 C;  4GOP A;  4LFB L;  1L1O A;  3H0G A;  3BDL A;  4KTA A;  1IZ6 A;  3KDF A;  4KY7 A;  4B9X A;  1CA5 A;  2E2I H;  1PH1 A;  4WOR A;  4LK1 C;  4EQO A;  5M5X B;  4IHJ F;  4GN3 B;  1N48 A;  5EBD A;  2I5H A;  2WKC A;  3NPP A;  4ZKC B;  2M00 A;  4GOP C;  4HJ5 A;  2YZN A;  5FLM G;  1L1O C;  5E3F A;  4GC7 A;  4CGY B;  4P2C B;  2E2I A;  2BQR A;  1IYJ B;  4BXX H;  1STY A;  2RDI A;  1BXR A;  3CCU A;  2UUB H;  1HXY D;  2AQ1 B;  4DR6 Q;  1VQO A;  2R8H A;  1WTV A;  1XDN A;  1TU2 B;  1M4V A;  4LFC L;  1EEF D;  1I6H B;  1PTO H;  2K01 A;  4DR3 H;  1CK1 A;  2F0W A;  2E5L L;  5L9X A;  3P75 A;  3T51 B;  4FF4 A;  5I9O A;  4A4I A;  1AP0 A;  4FP5 D;  3KJO A;  2YRX A;  3KBG A;  5KT7 A;  3ULL A;  1KJ8 A;  2RDH A;  4DNR B;  2NU7 B;  4Q0Y A;  1UC8 A;  4A76 A;  2UXC Q;  4C2M B;  4IRK A;  5EDW A;  4G7Z C;  3MXP A;  3HOV H;  3DEO A;  3H40 A;  1JJG A;  1M90 C;  2QGQ A;  2AGP A;  5M5Y B;  3HOZ H;  4JI7 L;  1KDA A;  4NKL A;  1PTO C;  2LMC B;  1RYR A;  3BDO A;  5IYC G;  1YVC A;  3N44 B;  3RV4 A;  1Z7T A;  2M2L A;  2MO1 A;  2FPG B;  1U9R A;  1NY4 A;  3FRP B;  4LUZ A;  4ZQ3 A;  5ELD A;  3SK6 A;  2QW7 A;  4BXX G;  5KFB A;  4RAY A;  1KDC A;  2H4O A;  2NZO A;  5BR8 Q;  2N8N A;  2PMZ B;  5GAH C;  3MXN B;  3MXG A;  1B6R A;  2CZG A;  1JE5 A;  3PIO A;  5LMU L;  1KRS A;  2N78 A;  3U9T A;  5IIF A;  1HJP A;  4DL7 A;  1S5D D;  1SJH D;  5CV5 A;  4HJA A;  1D1K A;  2I07 B;  1O75 A;  1HHV A;  1EHI A;  5LXT F;  4IPC A;  1Q86 C;  2RF4 A;  2FLN A;  4BY1 B;  2K52 A;  4Z9C B;  4YHH L;  4HJ9 A;  4BBR H;  3A5U A;  1PRT F;  3CCQ A;  1YBY A;  1NTG A;  1NBW A;  2JA5 A;  4IUP A;  1RD9 D;  3E9I A;  1ENF A;  4M9U A;  2BDN A;  3HOV G;  3E5S A;  4ED1 A;  1B70 B;  2R8I A;  3VYT A;  4ED3 A;  1N8R C;  4R1J A;  1HFN A;  1B2T A;  1EY4 A;  5KX5 F;  1LTT D;  2F0F A;  3M7G A;  3HOZ G;  2BOS A;  1JB7 A;  3GDE A;  1HZC A;  1RTN A;  3TEH B;  1TS4 A;  4P71 A;  3GTJ B;  4NXN Q;  4RAU C;  1I3Q H;  3GV7 B;  3HGB A;  3T1Y Q;  1VQP A;  4JI2 L;  3TRE A;  4ED7 A;  1IYU A;  1CKN A;  1B9M A;  1KTK A;  1Q81 C;  5EQ0 A;  5CGK A;  2EY6 A;  2Y0S G;  3NK9 A;  5C0X I;  2C35 B;  5KRU A;  4B3R L;  4YBZ B;  3PR4 A;  4NPS A;  5M5X H;  3MFY A;  5KT4 A;  1GOZ A;  3TZD A;  2W6N A;  5I47 A;  4DV4 H;  1VKZ A;  4IPH A;  5HY6 A;  2XCA A;  1S0N A;  4TQU S;  3DWA A;  1GM5 A;  1KJQ A;  2DNE A;  4FBT A;  5C6A A;  3MWM A;  2JA6 A;  2A6E C;  2G9H D;  3UFX B;  3VDY A;  1L0X B;  4L63 B;  1GHJ A;  4DA2 A;  3GIQ A;  4DV7 L;  1YIJ A;  3KF6 B;  2ZXP A;  2MP1 A;  3URY A;  1CS0 A;  1O7Y A;  3LWB A;  2Z1C A;  3ITP A;  2NUC A;  2KHS A;  5IGF A;  5M9O A;  2A69 D;  1IXR A;  1I6H H;  3HB9 A;  2JE6 I;  3FHW A;  4QB4 A;  2IBK A;  1STN A;  2LSS A;  1KD1 C;  2E75 C;  4KKT A;  1ZXT A;  1TWC H;  4U68 A;  4P73 A;  4OWW B;  3D4R A;  1SBB B;  1VQF A;  2GPW A;  1PH6 A;  4K8I A;  1K8M A;  2PBZ A;  1NCV A;  1A62 A;  1EY9 A;  4C2M H;  1QJO A;  1FNW A;  1TWC A;  1D5Z C;  2ICI A;  2I87 A;  4KY5 A;  1X3P A;  2FKL A;  4JV1 A;  5M5Y H;  2PNH A;  1VQ4 A;  4DAV A;  2EJM A;  4MV3 A;  2K5W A;  2UUB Q;  3K0X A;  4Y8V B;  2IWH A;  3M9M B;  2OTJ A;  4RCO A;  5KT2 A;  1PYB A;  4UAI A;  2PW7 A;  2IPK D;  2FK2 A;  1U4P A;  2IHF A;  4DR3 Q;  3L2P A;  4HIK A;  1PTO D;  2YZG A;  3FKI G;  1XNQ H;  1STB A;  1K1Q A;  4O0A A;  2F0G A;  3FEW X;  4EVO A;  2IX0 A;  5FPR A;  4QF4 A;  1C48 A;  3J7A K;  2W6O A;  1YEZ A;  1NR4 A;  2KOL A;  4IR9 A;  3MXN A;  5JEA J;  3U4Z A;  4QQB X;  3OUZ A;  4DV1 L;  3PW4 A;  3MVV A;  2AQ4 A;  1EWC A;  3FPP A;  1PX2 A;  4GS3 A;  2WII B;  4BS9 A;  2EYJ A;  1EQQ A;  2P5Z X;  1RK6 A;  3OHB A;  1U5K A;  2N49 A;  4YQW A;  1JR0 D;  2OT2 A;  4PZ8 A;  1K8A C;  5I6W A;  2X6G A;  2CQO A;  5EZY F;  1WTH A;  5EBC A;  1F2L A;  1T9H A;  3RN5 A;  3ETJ A;  1TWF B;  4C5B A;  4JK1 C;  4U7C A;  3AFQ A;  1S5E D;  1SRU A;  1SEI A;  2E74 C;  3BDC A;  2FMA A;  2LXK A;  1XX8 A;  1Y8N B;  3GV6 A;  3GTJ H;  1CFM A;  1QE6 A;  4F88 A;  4RZQ A;  3L4K A;  3R5F A;  5A35 A;  5D1O B;  4IAL A;  2F0N A;  1CQJ B;  3VMM A;  3A55 A;  4H13 C;  3DLL A;  4X66 H;  3N8D A;  1I4R A;  2W6M A;  2ZM6 L;  2RVL A;  2W71 A;  2EOT A;  1HNZ H;  1SR3 A;  1U4M A;  3SE0 A;  3TRZ A;  3GTJ A;  1LT3 D;  1PHJ A;  1YJW A;  2VQE L;  2J0T D;  5EAY A;  3TII A;  5FD6 A;  1KNA A;  4YJ2 F;  4DUZ H;  1ZYR D;  5DEH A;  1F9P A;  1JE4 A;  1CSQ A;  3T1H Q;  3OYY A;  3S24 A;  4IN3 A;  1PFB A;  4RCN A;  2E8G A;  3EPI A;  4BY1 G;  3HKZ B;  2HHH L;  2R6F A;  1GUN A;  3E3X A;  5IYZ F;  4OX9 H;  4P75 A;  2EDG A;  3DUZ A;  3ERS X;  2Z4I A;  4J9R A;  1WOC A;  1HTP A;  2PYK A;  4CHT B;  3ULP A;  1TWA B;  4LJZ C;  4V0B A;  3HOU G;  2C2E A;  1BCP F;  4CJ2 C;  1WTO A;  3IN5 A;  4KD4 A;  1W6J A;  1KAA A;  3M7N A;  2WAQ B;  1W2B A;  3KF6 A;  1ENA A;  4KN4 C;  2DPI A;  2HIV A;  2FFK B;  1CTM A;  2LFN A;  1HNW L;  5LMN H;  3KLW A;  3I8Z A;  4PMB A;  2NTS A;  2F0P A;  3NE5 B;  1OTC A;  1K73 C;  4DV4 Q;  1GUS A;  4O4L F;  3J7A 5;  4MN3 A;  4N8X 1;  1HUN A;  3FVQ A;  4I4T F;  5LL6 b;  5EWF A;  4F50 A;  2QYZ A;  5KG2 A;  4EFB A;  2MHV A;  2IX1 A;  4ECX A;  3V6J A;  1RTO A;  1PH3 A;  3CD6 A;  2DGY A;  4HSV A;  1RJP A;  2RCF A;  3EVQ A;  5CV4 A;  2DJF C;  3PR5 B;  1R9T B;  2YS7 A;  4FXD A;  3BAA A;  4P72 A;  3TDQ A;  1F9Q A;  3RAQ A;  1PRT C;  4L5S A;  4CBV A;  5L37 A;  5KFD A;  4DV3 H;  2XIW A;  4LF7 H;  4HJ7 A;  4HED A;  3KHG A;  1S72 A;  4A3M B;  2RDF A;  3SK4 A;  5BPF A;  1LTL A;  4LF5 Q;  5LA6 F;  2BR0 A;  1A0I A;  1VQN A;  1E4G T;  1X9N A;  1O7Z A;  3SK5 A;  5IWA H;  1FKA H;  2Z0S A;  4MAM A;  4N9P A;  2XC9 A;  3OOC A;  1EUC B;  3PIO 3;  1DJR D;  5KKN B;  1YNN C;  1S9F A;  3C46 A;  1RJR A;  3OIP A;  5A2Q W;  4ETS A;  5K2M A;  4QL5 A;  2FXQ A;  2HDL A;  3PCO B;  4ZYS A;  4P74 A;  2UXB L;  3QZ7 A;  2FB9 A;  2JA7 B;  3R2T A;  5J2U F;  2MFI A;  4X62 L;  1SE2 A;  4A3G B;  2HGS A;  1TWF H;  1Z6H A;  2KHJ A;  1M6V A;  4B08 A;  1Y1W B;  4L1K A;  3PZP A;  4OXP A;  4JYA H;  1RIP A;  3KF8 B;  3J81 j;  1PYW D;  1CA6 A;  1S40 A;  1RK5 A;  4XZ3 B;  2ENB A;  1K28 A;  1VQ7 A;  1JOQ A;  2G5D A;  3NHH A;  1KRT A;  4JI1 L;  1K3B C;  1XNQ Q;  1TWF A;  2V1C C;  2ZJP A;  2NN6 H;  4DNT B;  1TII D;  3S14 B;  1AFP A;  2K04 A;  2K5Q A;  4LF8 H;  3OTO H;  3CCR A;  2NTT A;  2SNM A;  5H80 A;  4DR2 Q;  5D1O A;  1V1P B;  1EIY B;  4MIU A;  4KHV A;  1WVL A;  2JP1 A;  4POF A;  4YP3 A;  5E4W C;  5KFA A;  3U4V A;  1BOS A;  1TKW B;  3MR2 A;  5CB4 F;  2DUD A;  1IBK H;  3I70 A;  1G2S A;  1W3S A;  4I55 F;  4O3N A;  4HYK A;  3CC7 A;  5I6Y A;  1UNN C;  3M4Q A;  3Q8D A;  2HVS A;  1B3A A;  2PCF B;  3S17 B;  1TWA H;  1R4Q B;  1ZHQ A;  1S10 A;  3K0Y A;  3ORQ A;  3UDI A;  5KFQ A;  1R4P B;  3GTM B;  1EZ1 A;  5CA1 F;  1UC9 A;  3HKZ A;  1HFG A;  1DM0 B;  4OIK A;  4I7H A;  4ZKB B;  2Q2I A;  2HDM A;  4G7O C;  4R4O A;  4X66 Q;  1UEB A;  2F0M A;  2E76 C;  1TS3 A;  1YZ6 A;  1LM0 A;  1TWA A;  2EPB A;  3PW7 A;  4A75 A;  2VA2 A;  1HNZ Q;  4C3I B;  4BA2 I;  2BH8 A;  5DG7 A;  4QWA A;  5KFM A;  1AN7 A;  4DUZ Q;  2WE6 A;  2NN6 G;  1HQR D;  1N36 L;  4DUY L;  1WCM B;  3L4J A;  1UNS A;  1OO9 B;  2L4N A;  2W9C A;  3J80 W;  1LT5 D;  2W57 A;  2W6Z A;  1G6Z A;  2VOB A;  4KD3 A;  1J9O A;  4HCE A;  1R9T H;  2Q8I B;  2KCC A;  3S2D B;  3NBH B;  1H9K A;  2IA6 A;  3M4P A;  4ECU A;  1FL0 A;  3MEF A;  4A3B B;  1XMQ H;  3I73 A;  3RUZ A;  4ZI7 F;  3E9H A;  1VQL A;  3HKZ G;  2A8V A;  2NU9 B;  1PH5 A;  2R7Z B;  3RLO A;  4UCS A;  4A3M H;  3QJY A;  4DV5 Q;  2O5J C;  1R9T A;  1JWS D;  2K28 A;  2A6H D;  4MTE A;  1PTO F;  2W70 A;  1C8C A;  4JI4 H;  1NUC A;  3K57 A;  5LMN Q;  3I90 A;  2WAQ G;  4O4H F;  3H3V H;  1FD7 D;  1E1T A;  3IFD A;  4XIG S;  4MV6 A;  2GPS A;  1SE8 A;  1UE7 A;  4RGT A;  1Z2N X;  1ESF A;  4X3U A;  4JI3 H;  1CKO A;  4UCR A;  5FO9 B;  1X3Q A;  3BU2 A;  4JI8 L;  4DR7 L;  2L0C A;  4S3S A;  2JA7 H;  1QVG A;  2AWN A;  2R87 A;  4A3G H;  2OWO A;  3A8K E;  1ILP A;  2PQA A;  3Q2O A;  1XPO A;  1JJC B;  4U67 3;  1Y1W H;  1YNN D;  2BA0 A;  2PI2 A;  4JOI A;  3Q8S B;  1M8A A;  4IQZ A;  1P8L A;  5JJI A;  1Q3L A;  4DV3 Q;  5DQH A;  2NBF A;  2RBM A;  2B2T A;  3TS2 A;  3OHX C;  5F9N A;  3T5J A;  2XGQ A;  3UI2 A;  1VQM A;  2C22 A;  3H3V C;  5DQG A;  2VQF H;  4LW1 A;  4M8A A;  5K36 H;  4GNX B;  3MHB A;  1Z2O X;  3E0J A;  4BY7 H;  1Q8K A;  4B3S H;  1Y1W A;  1EWI A;  2BA1 A;  4J15 A;  3S14 H;  2HVR A;  3KF8 A;  2K5V A;  4JOI C;  4JC0 A;  1IOV A;  4JV2 A;  5IWA Q;  2GVB A;  3HFZ B;  2F0J A;  4DAY B;  1E4E A;  2OXP A;  1RHP A;  1SJE D;  4A3M G;  1JC7 A;  2B2T C;  2ID0 A;  4DXF A;  3RB4 A;  2K33 A;  3BA9 A;  1HPC A;  3EBE A;  2CHB D;  4AYB G;  1PFM A;  4ALP A;  2DIK A;  5BN5 A;  5IP9 H;  2K7V A;  5K5P A;  3S1Q B;  5EWE A;  5KFO A;  3MR6 A;  3MJF A;  4AH6 A;  4IPG A;  1XTC D;  1TS2 A;  5JJZ A;  4Q43 A;  4EEQ A;  5I2X A;  3S17 H;  3BJY A;  1H9J A;  2XGT A;  5KFX A;  3BJU A;  4JYA Q;  2JA7 G;  1K9M C;  2SCU B;  1E0B A;  1F2Z A;  3GTM H;  4A3G G;  3WOE A;  4RAZ A;  2F1M A;  1BQQ T;  1D8L A;  3KAK A;  3NEL A;  1TWG B;  3P20 A;  3R2I A;  3I55 A;  5I9P A;  2ZJT A;  3R5X A;  3PV0 A;  2QA4 A;  3TSS A;  2UVW A;  4JBK A;  1SN8 A;  5CV8 A;  4C3I H;  1NR2 A;  1MJC A;  3OTO Q;  3GTK B;  3GTM A;  1U0L A;  4YY3 H;  1VQ5 A;  5K36 G;  1S97 A;  1ML0 D;  4I7Z C;  5JOB A;  3PUZ A;  4A3E B;  1II3 A;  1WCM H;  1WJJ A;  3TP6 A;  4ME5 A;  3SK8 A;  1IOW A;  2DLN A;  3D0F A;  1Y14 B;  2XVS A;  1LTR D;  5ELO A;  2W9A A;  3A54 A;  3MAQ A;  1IBK Q;  1JQY D;  4DV6 L;  3RR5 A;  4F87 A;  2JEI A;  2WB1 E;  4ZK9 B;  3BA8 A;  5KFZ A;  1EYD A;  3S2D H;  2O5I C;  4DV2 H;  4Q5V A;  4A3B H;  5IP9 G;  2W7P A;  1I5F A;  3TZU A;  3KLS X;  3NTI A;  3QOL A;  1FJG Q;  1N33 L;  1WTW A;  3VR5 A;  2R7Z H;  1KJ9 A;  2PQE A;  3Q8P B;  4XX0 B;  1JWM D;  1Q8I A;  3Q0A A;  1GHK A;  3NBH A;  4JV5 Q;  1DV1 A;  1BJT A;  1MHW C;  2G9D A;  3CRK C;  2KCN A;  4LUO A;  4Q8E A;  4R8U B;  4DR4 H;  2FJZ A;  3M9N B;  1BUV T;  4A3I B;  2JEG A;  3GTO A;  1TT2 A;  1JWU D;  4C3I G;  1BF4 A;  2RDG A;  1MI2 A;  2XRS D;  2EY1 A;  1G91 A;  3RBE A;  1SNQ A;  4R4C A;  2K5D A;  4MTN A;  2F4I A;  5JJK A;  1E22 A;  3VA5 A;  4JI6 Q;  1P16 A;  1WCM G;  2IY5 B;  3R93 A;  2UU9 L;  4NXM L;  2RCN A;  5EPL A;  3X3N A;  1EYC A;  3EQL C;  1XMQ Q;  4WJ4 A;  2XNA C;  2ZDG A;  2B3G A;  4A2B A;  3QO2 A;  1Y1V B;  4DPG A;  2P0A A;  2KEE A;  4A3B G;  5KFR A;  5KG4 A;  1ONL A;  2PO4 A;  4GN4 B;  4RA8 A;  1HRJ A;  4YWL A;  3W3A A;  4N8F A;  4JI4 Q;  2R7Z G;  3H09 A;  4WRD A;  1Q1E A;  1X6O A;  1STA A;  3K5M A;  3RLN A;  5IYC H;  5ELC A;  5I4D A;  1PH2 A;  2E2H B;  3OSN A;  2A69 C;  1A9X A;  4EEY A;  2HD3 A;  2Q2U A;  4YAJ B;  5EWG A;  3HG9 A;  2ZTC A;  4TKO B;  4JI3 Q;  2UXD L;  4HCS A;  2E2D C;  4UP9 A;  4C1N I;  3U9S A;  1V1O A;  4MA0 A;  1DYQ A;  3FKI B;  2X0S A;  2TMP A;  1U4L A;  1EYZ A;  5KFU A;  1YI2 A;  5CV7 A;  1RF2 D;  3VR4 A;  1KC7 A;  1GSH A;  3KLR A;  5E7N A;  2A73 B;  4LF4 L;  4DV0 H;  1IBM H;  4IAJ A;  3PQI A;  3CP0 A;  2HJW A;  1VQJ A;  2CKZ B;  2BQ3 A;  3BQ1 A;  3DMU A;  5JVD F;  1TWG H;  2VQF Q;  4WJ3 M;  2V58 A;  3D8G A;  4DKA C;  1OXX K;  2EY5 A;  4B3S Q;  4ED0 A;  2F4V Q;  1MD2 D;  3T4A C;  4Q0F A;  4Y7N B;  1WTR A;  3T5K A;  2EYM A;  2K14 A;  5KNB A;  1V9P A;  3F2U A;  3GTK H;  2C2D A;  5DG9 A;  3NWT A;  1HNX L;  5KT6 A;  4H0L C;  4QIW E;  4A3E H;  3H4D A;  4K6L A;  3N52 A;  3HEJ A;  2MUY A;  1JB3 A;  4A3D B;  1RYS A;  3KBX A;  3I72 A;  4ILW A;  2WB1 G;  4IFD H;  5LP6 F;  3CC4 A;  1SMY D;  4DR5 L;  3TQ1 A;  2CVR A;  4WBN F;  2UVR A;  1JXL A;  4DK3 C;  1C30 A;  4ZAI A;  1TXY A;  5FJ8 H;  3U50 C;  2EVB A;  1MZB A;  4EYI B;  1BBU A;  2FK1 A;  1XMO H;  3HBL A;  3RZO B;  2KCM A;  4ID6 A;  3Q23 A;  1BNC A;  2A19 A;  2ZT9 C;  4ZUJ A;  2ZJQ A;  4NB3 A;  3RBD A;  4DL2 A;  1CM9 A;  2KBN A;  3U9O A;  5A2Q L;  3Q24 A;  4AQY L;  1J5E L;  5E1F A;  5DG8 A;  2Y0S A;  2VB2 X;  4DR1 H;  1SNO A;  3W1B A;  1AH9 A;  5FD5 A;  2K4K A;  5COY A;  1TY2 A;  2XN9 C;  4KHP H;  2JEA I;  4A3I H;  4JUZ A;  4GLV B;  2F0H A;  4C5C A;  3T1H H;  4YY3 Q;  2HQL A;  3T16 A;  2UUA Q;  4JI0 L;  4C3H B;  4LH7 A;  4B9W A;  4HMI A;  4J9O A;  1I7N A;  3IL8 A;  3HXL A;  3J81 W;  3EA6 A;  3CCJ A;  4J9P A;  4LF6 L;  3HOU B;  2XCP A;  1GKH A;  2UUC L;  4J9Q A;  2R3Z A;  3BQ2 A;  4R8U A;  1ESR A;  1N56 A;  1CQV A;  1D5M C;  2F0L A;  1VDZ A;  1N34 H;  4A3E G;  4YCV A;  2KVM A;  4I65 A;  3CC2 A;  2JQO A;  4IFD G;  1W6K A;  4IUR A;  1O7L A;  4DV2 Q;  3I2Z A;  5KND A;  1PK8 A;  3IRB A;  4HNU A;  4DLK A;  1Q82 C;  4B3M L;  1ZYR C;  3NP8 A;  3EPG A;  4O4I F;  3AQQ A;  1E7Z A;  3S1N B;  1Y1V H;  4ZLT F;  5T1G A;  1O78 A;  5FJ8 G;  3PN1 A;  2XGP A;  1QWY A;  1VS0 A;  4X3S A;  1B6S A;  2FMC A;  1I3Q A;  2X69 A;  3Q6S A;  1YNX A;  5D8D A;  2NU8 B;  4DR4 Q;  1GXD C;  1K83 B;  1SMX A;  2QIL A;  2EYH A;  3OIQ A;  4H7B A;  4PMC A;  4RHR A;  1Y1V A;  2V59 A;  2C5C A;  3NQT A;  3NTK A;  2E2H H;  1I4P A;  1K8G A;  5D3D A;  1STE A;  4GKK L;  2AQ2 B;  2O03 A;  4H02 A;  1A3V A;  4KI0 A;  5A2Q E;  2R92 B;  2YW2 A;  3R23 A;  4RG1 A;  3H94 A;  3DWQ A;  3I7F A;  4A3I G;  2VUM G;  5M3F G;  1VAJ A;  4K0K L;  4KJN A;  4IJL A;  3FKI H;  4TQR A;  4LFC H;  3D3R A;  2E2H A;  1D1I A;  3RB3 A;  1E2W A;  1B1Z A;  2E5L H;  1GJX A;  1GUG A;  4ECQ A;  1G51 A;  2D2C C;  1DON A;  3RF2 A;  2Z9H A;  3J7A V;  1ZQ7 A;  4XYO A;  1H9S B;  5GRO A;  3I3C A;  4DL3 A;  4I50 F;  4LF5 H;  5EGT A;  4DN4 M;  4OO1 I;  3FKI A;  1FGB D;  3VYR A;  3C2P A;  4EX5 A;  2L1B A;  2W8K A;  3J80 L;  4ECZ A;  4IUQ A;  4JCV E;  4Y7N H;  4OX9 L;  1BO0 A;  3PIP 3;  1PVO A;  2AU0 A;  3HZX A;  3K3P A;  1Y1V G;  4UHV A;  4KKS A;  3I4N B;  1X55 A;  3RGZ A;  4JI7 H;  4J0M A;  1Y8P B;  2R7L A;  1EQV A;  3OUU A;  4KY6 A;  5CBE E;  4JI5 L;  4LSA A;  5FPO A;  5L1I A;  4UCU A;  3ERQ A;  2YTY A;  3W2D A;  3LP8 A;  4C2M A;  2KUM A;  1HR0 Q;  3F8N A;  1MSH A;  3ETH A;  4RGN A;  2VW9 A;  4O3S A;  1LT4 D;  4ECY A;  3CVZ A;  3DEP A; 
#chains in the Genus database with same CATH homology
 1UWV A;  4GLA C;  4LFA Q;  4MZ9 A;  4QL5 A;  3RZO H;  2FXQ A;  3PCO B;  4X64 Q;  4P74 A;  4DV0 Q;  1IBM Q;  1N32 Q;  2UXB L;  2AWO A;  2MFI A;  2A1A A;  4X62 L;  3S15 H;  1KXL A;  1TWF H;  2KHJ A;  2AHO B;  4QJF A;  3H0G G;  1QZG A;  5IT9 c;  3G4S A;  4FDB A;  1B7Y B;  2EIF A;  4OXP A;  1EQR A;  1RIP A;  3KF8 B;  1C9O A;  3J81 j;  1VQ8 A;  2VZA A;  4UPA A;  1KAW A;  4LF5 L;  1WI5 A;  3RZD H;  1S40 A;  1G29 1;  2HT1 A;  1YJ9 A;  4GKJ L;  1GVP A;  4AIM A;  4BY1 H;  2RHQ B;  1VQ7 A;  4OWX B;  1KRT A;  4JI1 L;  4C3H H;  1UE1 A;  1XNQ Q;  1JT8 A;  2V1C C;  4X65 Q;  3G6E A;  2ZJP A;  4RMF A;  2WFW A;  1I94 L;  4DAM A;  1HR0 L;  1IBL Q;  4LF7 L;  2L15 A;  3HOU H;  4L5T A;  3A5Z B;  3CCR A;  2ALY B;  3CPW A;  2KCT A;  4DR2 Q;  4LFA L;  3S1M H;  1NJI C;  1EIY B;  4X64 L;  4DV0 L;  1N32 L;  1GO3 E;  1IBM L;  4A3D G;  4JBJ A;  1VQH A;  3CCE A;  1PH9 A;  1Y1W G;  1ASZ A;  4POF A;  2OCE A;  3U4V A;  2VUM H;  3CCV A;  5M3F H;  1XPU A;  1XMO Q;  1KQS A;  2DUD A;  3U58 A;  3KYH C;  4YWM A;  1W3S A;  1K3R A;  5IE8 A;  2R7F A;  3CC7 A;  1VQA A;  4DUY Q;  1N36 Q;  3M4Q A;  3Q8D A;  2F3I A;  2VS1 A;  3GO5 A;  4LF8 Q;  4A3L G;  2K5N A;  2JJQ A;  1KHI A;  1H95 A;  4BY7 G;  4DR1 Q;  1TWA H;  3B6Y A;  3H3V I;  1XNQ L;  5AJ3 Q;  5M3M H;  3UDI A;  4APV A;  4X65 L;  1IBL L;  4UP7 A;  1NE3 A;  2EXD A;  1NMG A;  2JA5 H;  4KHP Q;  1K83 H;  1PH8 A;  3TQY A;  2YTX A;  4EQ5 A;  2OQ0 A;  2ATW A;  4MNO A;  2Q2I A;  2GVA A;  1EUJ A;  4DR2 L;  4R4O A;  4X66 Q;  3PO3 H;  1XPR A;  1UEB A;  2R92 H;  1YZ6 A;  1LM0 A;  4A75 A;  1HNZ Q;  1BBW A;  3NEN A;  4BA2 I;  4TVA B;  2JA9 A;  2I5L X;  3S16 H;  1CKM A;  1XMO L;  2BH8 A;  1Q7Y C;  1M1K C;  3HOX G;  3GTO H;  3F8T A;  3H15 A;  4OO1 G;  1N34 Q;  4DUZ Q;  2NN6 G;  1N36 L;  4DUY L;  1YJN A;  5FLM H;  2MO0 A;  1MJE A;  4A3K G;  4LF8 L;  1PYS B;  3ZJY C;  4LFB Q;  3UE1 A;  4DR1 L;  1OXT A;  1QVC A;  4BA1 I;  5AJ3 L;  3CMA A;  3RN2 A;  4A3C H;  4KHP L;  1R9T H;  3J7Z C;  5GAD C;  3NBH B;  1C0A A;  3M4P A;  4JI8 Q;  1FL0 A;  3MEF A;  4DR7 Q;  3J81 i;  1VQI A;  3CPF A;  2F52 A;  3E9H A;  4X66 L;  1VQL A;  3HKZ G;  2A8V A;  5IYB H;  2JA6 H;  3CW2 C;  1PH5 A;  3RLO A;  2ZJR A;  3I4N H;  3AEV A;  1HNZ L;  4JBM A;  3PSI A;  4A3M H;  1X3F A;  4DV5 Q;  3CCL A;  4LF9 L;  3PUY A;  2PMZ E;  4QY7 A;  5M3M G;  1XNR Q;  5LMN Q;  1N34 L;  4DUZ L;  1Z9F A;  3OW2 A;  2JA5 G;  4B3T Q;  1DGS A;  2WAQ G;  3H3V H;  3J81 c;  2ZTE A;  1E1T A;  1VQD A;  4GOP A;  4LFB L;  2B29 A;  1Q12 A;  1L1O A;  4XIG S;  4LFC Q;  3PO3 G;  1SE8 A;  2R92 G;  1IZ6 A;  1UE7 A;  2BH2 A;  2NZH A;  3KDF A;  4BBR G;  2E2I H;  1YHQ A;  1PH1 A;  2E5L Q;  1CKO A;  3CME A;  1SFO H;  2R7D A;  4GN3 B;  3BU2 A;  4JI8 L;  3RNU A;  4R4I A;  2YU9 H;  1EIF A;  4PMW A;  4DR7 L;  1X54 A;  2JA7 H;  2I5H A;  3F2B A;  2AWN A;  1QVG A;  4Y52 H;  1KL9 A;  4A3G H;  2OWO A;  4A93 H;  1KIX A;  4JG2 A;  4HJ5 A;  4GOP C;  4A3D H;  5FLM G;  1L1O C;  2PQA A;  2IT1 A;  1NMF A;  4JBW A;  1JJC B;  1Y1W H;  1XPO A;  1QZH A;  2BA0 A;  2PI2 A;  4DV5 L;  4JOI A;  1HR0 W;  1IYJ B;  4BXX H;  5JJI A;  1P8L A;  3S1R H;  4DV3 Q;  1XNR L;  3CCU A;  3TS2 A;  3F2D A;  5LMN L;  4A3C G;  1XTD A;  1VQM A;  5IY0 A;  4DR6 Q;  4B3T L;  4POG A;  4LW1 A;  4GNX B;  4JI7 Q;  1VQO A;  4BY7 H;  1Q8K A;  4LNQ A;  2AMC B;  1EWI A;  2BA1 A;  4J15 A;  4LFC L;  1EYG A;  3S14 H;  2K5V A;  5IYB G;  2JA6 G;  3K7U C;  4JC0 A;  4JOI C;  2I0Q A;  4L5R C;  5IWA Q;  2GVB A;  4IO9 A;  3I4N G;  3HFZ B;  2E5L L;  4DAY B;  4A3M G;  1V43 A;  2ID0 A;  3F2C A;  1K0R A;  1YHB A;  3EBE A;  4A4I A;  4HJ8 A;  3W5O A;  4AYB G;  3KJO A;  4ALP A;  4KHZ A;  3UDF A;  1BVS A;  3SGI A;  5IP9 H;  2NVY H;  5LMU Q;  2K5H A;  3ULL A;  2JA8 H;  3GTL H;  3ER0 A;  3ICE A;  5GQO A;  4A76 A;  1ASY A;  2HIX A;  4AH6 A;  3STB D;  2UXC Q;  4IPG A;  5ELN A;  1LYL A;  3HOX H;  1J6Q A;  4DV3 L;  3HOV H;  4R4Q A;  1M90 C;  2NVX H;  2QGQ A;  1JJG A;  1X65 A;  4A3K H;  3S17 H;  4LUV A;  4DR6 L;  3STB C;  2XGT A;  4DV6 Q;  1PA6 A;  3BJU A;  3HOZ H;  4JI7 L;  4JYA Q;  5C4X H;  2JA7 G;  4OWT B;  1K9M C;  2Q2T A;  1GD7 A;  3CQZ H;  5H1S E;  3GTM H;  4A3G G;  4A93 G;  3BZC A;  4YHH Q;  1Q1B A;  1WYD A;  4GN5 A;  5IYC G;  1YVC A;  1D8L A;  5IWA L;  3NEL A;  2MO1 A;  1KC8 C;  1N33 Q;  3I55 A;  3GTG H;  2N3S A;  1NY4 A;  4LUZ A;  3L0O A;  4BXX G;  2WP8 J;  2RHS B;  3KOJ A;  3PV0 A;  2QA4 A;  3CCM A;  2NZO A;  4JBK A;  1SN8 A;  5BR8 Q;  2N8N A;  4C3I H;  5GAH C;  3MXN B;  1QVF A;  1MJC A;  3OTO Q;  2K75 A;  1JE5 A;  1U0L A;  4R4T A;  3PIO A;  1VQ5 A;  4L5Q A;  5LMU L;  5K36 G;  1KRS A;  2XTI A;  2N78 A;  3NEM A;  1LUZ A;  2UXC L;  3PUZ A;  1WCM H;  1WJJ A;  1I50 H;  1HJP A;  4XTC S;  4JI2 Q;  3D0F A;  3UE0 A;  3TS0 A;  2ES2 A;  1Y14 B;  4HJA A;  5ELO A;  1VQE A;  2H5X A;  1IBK Q;  4IPC A;  4DV6 L;  1Q86 C;  1JJ2 A;  4JYA L;  3RR5 A;  2RF4 A;  1VQ6 A;  4B3R Q;  2WB1 E;  2K52 A;  2E2J H;  3S2D H;  4HJ9 A;  4YHH L;  4BBR H;  5IYD H;  3A5U A;  4A3B H;  5IP9 G;  3CCQ A;  1I5F A;  1NTG A;  1YBY A;  1NBW A;  3PUV A;  1OXV A;  2JA8 G;  1B8A A;  2R6G A;  3AFP A;  1FJG Q;  1OXS C;  4LF9 Q;  1N33 L;  3KFU A;  3E9I A;  5C44 H;  2R7Z H;  3HOV G;  1B70 B;  5BR8 L;  2UU9 Q;  4NXM Q;  3PUX A;  1N8R C;  4R1J A;  3OTO L;  5M5W H;  4JV5 Q;  3HOZ G;  1JB7 A;  1CSP A;  3GDE A;  1HZC A;  5C4X G;  3PGZ A;  3TEH B;  3CCS A;  4P71 A;  4LUO A;  4DV7 Q;  4NXN Q;  1L2F A;  1I3Q H;  1E3P A;  4JI2 L;  3T1Y Q;  1VQP A;  3TRE A;  1CKN A;  1Q81 C;  1CUK A;  1RL2 A;  1IBK L;  5C4J H;  2Y0S G;  3WWV A;  5C0X I;  2C35 B;  4B3R L;  3CF5 A;  1Z47 A;  4YWK A;  4NPS A;  5M5X H;  1TWH H;  4IPD A;  4R4C A;  4IPH A;  4MTN A;  4OON A;  5HY6 A;  1E22 A;  4PZ7 A;  5JEA G;  1FJG L;  3AYH B;  5LMN W;  5JJK A;  4TQU S;  4JI6 Q;  1P16 A;  1WCM G;  2UXD Q;  1GM5 A;  2OQK A;  2IY5 B;  4BBS H;  2ASB A;  2UU9 L;  4NXM L;  2RCN A;  4WJ4 A;  1XMQ Q;  2EQS A;  4JV5 L;  2YTV A;  1UE6 A;  5C3E H;  3VDY A;  2B3G A;  1JMC A;  4DV7 L;  1YIJ A;  3KF6 B;  4ME3 A;  4NXN L;  4DNI A;  4DPG A;  4IFD I;  5IYD G;  4A3B G;  3T1Y L;  3PF4 A;  4LF4 Q;  4GN4 B;  3W1G A;  1OXU A;  4YWL A;  4JI4 Q;  3A74 A;  1I6H H;  1IXR A;  5C44 G;  2R7Z G;  1A63 A;  1Q1E A;  1X6O A;  2JE6 I;  2QEX A;  4PZ6 A;  3J80 i;  3FHW A;  3RLN A;  2LSS A;  5IYC H;  1PFS A;  1KD1 C;  1PH2 A;  1TWC H;  4P73 A;  4OWW B;  2B63 H;  2Q2U A;  1X56 A;  4O2D A;  1AE2 A;  1VQF A;  4JI6 L;  2CFM A;  2MQH A;  2ZTC A;  2LXJ A;  3L7Z C;  5C0X J;  4IOC A;  4HID A;  4JI3 Q;  2UXD L;  4YCU A;  1PH6 A;  4UP9 A;  3E0E A;  1HNX Q;  1S3O A;  1XMQ L;  1A62 A;  4C3J H;  4C2M H;  3G48 A;  3I56 A;  1YI2 A;  3J80 c;  4DR5 Q;  1VQG A;  2CWA A;  5M5Y H;  1QUQ B;  2YYZ A;  5E7N A;  1VQ9 A;  3HKZ E;  2PNH A;  1UE5 A;  4QGU A;  4DV1 Q;  1VQ4 A;  4LF4 L;  3HOY G;  3GTP H;  4JI4 L;  3CP0 A;  1YIT A;  2NVT H;  1VQJ A;  2CKZ B;  2UUB Q;  3K0X A;  4BBS G;  1O7I A;  2VY3 A;  1TWG H;  2VQF Q;  4WJ3 M;  2R93 H;  4DKA C;  4IFD J;  1OXX K;  4B3S Q;  2OTJ A;  2F4V Q;  2PQA B;  3CAM A;  4IJH A;  1PYB A;  2WAQ E;  5C3E G;  2IHF A;  2K14 A;  4DR3 Q;  3L2P A;  1V9P A;  1MIU A;  4HIO A;  4HIK A;  4JI3 L;  4AQY Q;  2D0P A;  1J5E Q;  3GTK H;  3PO2 H;  3FKI G;  4DK6 C;  2I5M X;  1HNX L;  4O0A A;  3PIP A;  4QIW E;  4A3E H;  2IX0 A;  5J3B A;  3M3Y H;  2CWP A;  2IHE A;  1YEZ A;  1YHA A;  2WB1 G;  1AE3 A;  3CC4 A;  2JK8 A;  4DR5 L;  3G71 A;  4JI0 Q;  5JEA J;  3U4Z A;  2VL6 A;  3D31 A;  4QQB X;  5HGQ A;  4DV1 L;  3BZK A;  2ZM6 Q;  3K81 C;  4DK3 C;  4LF6 Q;  2B63 G;  1N9W A;  2UUC Q;  3FP9 A;  1TXY A;  4GS3 A;  2UUB L;  5FJ8 H;  3U50 C;  1EQQ A;  2VQE Q;  1U5K A;  1BBU A;  2N49 A;  2VQF L;  2KCM A;  4PZ8 A;  1K8A C;  1IL2 A;  2D0O A;  4B3S L;  2F4V L;  1HH2 P;  2CQO A;  2A19 A;  3EIV A;  2ZJQ A;  4NB3 A;  1T9H A;  3RN5 A;  5IP7 H;  4DR3 L;  2KBN A;  4AQY L;  4A3J H;  1J5E L;  1G6P A;  2GN5 A;  4B3M Q;  3AFQ A;  1SRU A;  3W1B A;  1VQB A;  1AH9 A;  2KHI A;  5C0X G;  2HHH Q;  3S1N H;  2LXK A;  2K4K A;  4HIM A;  3GTJ H;  1X3E A;  2JEA I;  4A3I H;  3UDG A;  2OTL A;  4GLV B;  4YY3 Q;  2HQL A;  2UUA Q;  5FLX c;  2R93 G;  4JI0 L;  3DLL A;  2NVQ H;  4AYB E;  5DLQ E;  3M85 A;  4UY8 C;  2CCZ A;  3CCJ A;  2ZM6 L;  4LF6 L;  3M9B A;  1SR3 A;  1GKH A;  1PH7 A;  2UUC L;  3TRZ A;  3CXC A;  1HZ9 A;  3HKS A;  1PHJ A;  1E1O A;  1WFQ A;  3RLF A;  2VQE L;  1L0W A;  5EAY A;  1YJW A;  3PO2 G;  1E24 A;  4GKK Q;  2PI2 E;  1HNW Q;  4A3E G;  4YCV A;  3CC2 A;  1CSQ A;  2JQO A;  3OYY A;  3S24 A;  3T1H Q;  1BKB A;  4DV2 Q;  4IFD G;  3I2Z A;  3EN2 A;  3IRB A;  4K0K Q;  1Q82 C;  4KLK A;  1VQK A;  4B3M L;  3UDX A;  3GD7 A;  2E8G A;  4A3F H;  1HZB A;  3AQQ A;  5GAG C;  1SLJ A;  4BY1 G;  1E7Z A;  2HHH L;  1Y1V H;  4P75 A;  3KJP A;  3ERS X;  5FJ8 G;  3I4M H;  1VS0 A;  2Z6K A;  1WOC A;  4YY3 L;  3ULP A;  2UUA L;  3HOU G;  1EOV A;  4IOA A;  5GAE C;  3K8A A;  2MNA A;  1YNX A;  3HOY H;  3LGJ A;  1PV4 A;  1MKH A;  4DR4 Q;  1Q46 A;  2K50 A;  3HOW H;  1D7Q A;  1SMX A;  5IP7 G;  3M7N A;  1W2B A;  4YCW A;  3KF6 A;  4A3J G;  2E2H H;  4X6A H;  1K8G A;  4OX9 Q;  2HIV A;  4GKK L;  4H02 A;  1FVI A;  3DM3 A;  4KI0 A;  1HNW L;  2Z6K C;  4RG1 A;  1VCI A;  4A3I G;  3I7F A;  3JC6 6;  3KLW A;  5M3F G;  3T1H L;  2VUM G;  4DV2 L;  3K7A H;  1OTC A;  3PUW A;  1EFW A;  1K73 C;  4DV4 Q;  4K0K L;  3I4O A;  4IJL A;  3J7A 5;  3FKI H;  4JI5 Q;  2ZTD A;  2AKW B;  1VQC A;  2JEB I;  3ULJ A;  1CKN B;  3H0G H;  3JAM i;  1HZA A;  3K80 C;  1G51 A;  1XJV A;  2IX1 A;  4LWC A;  2YV5 A;  1FGU A;  5GRO A;  1PH3 A;  3CD6 A;  2DGY A;  2VNU D;  2Q2H A;  4GNX A;  1C7Y A;  4OO1 I;  2NN6 I;  3M4O H;  4DR4 L;  4EX5 A;  2KEN A;  3A0J A;  4PG3 A;  4P72 A;  1V1Q A;  3S1Q H;  4UP8 A;  2UXB Q;  1QUQ A;  4JCV E;  4X62 Q;  4A3F G;  4Y7N H;  4L5S A;  1X3G A;  4OX9 L;  1PVO A;  1PH4 A;  1Y1V G;  4HJ7 A;  3JAM c;  5JJL A;  1X55 A;  4GOP B;  3PF5 A;  3I4M G;  1S72 A;  1L1O B;  4GNX C;  2Y0S E;  1LTL A;  4DV4 L;  4LF5 Q;  3KDF B;  1A0I A;  1VQN A;  4JI5 L;  1X9N A;  4GKJ Q;  4GLX A;  3S2H H;  3F1Z A;  2YTY A;  3HOW G;  2Z0S A;  4JI1 Q;  2D62 A;  3GTQ H;  1HR0 Q;  1I94 Q;  4LF7 Q;  1SRO A;  2VW9 A;  4A3L H;  1A8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...