4A93G

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a93G01
1C7YA 4JI2L 2HQLA 4JG2A 4LF9Q 4QL5A 4A3KG 3K8AA 4BA1I 1L2FA 1LUZA 3HKZE 1PH4A 1PH8A 1NMFA 4A93H 3A5UA 1AE3A 1VQ8A 1A0IA 5JEAJ 1VQ4A 2ATWA 1XJVA 1YEZA 4DR3L 3RLFA 4A3MH 3S2HH 2VQFQ 4A4IA 1JB7A 4KLKA 2VS1A 3FHWA 1J5EQ 2ALYB 1JJGA 1VQDA 1PH2A 2GVAA 3GTGH 3KDFA 2WB1G 4AYBE 4HJ8A 1CSPA 4HJ7A 4DV4L 1HNWQ 3K7UC 3HKSA 4ME3A 1LYLA 2ZTDA 2VQEQ 4JYAL 1G6PA 2A8VA 1HNXQ 2IX1A 4QQBX 1Y1WG 4JI5L 1KAWA 4YY3Q 4HIDA 1W3SA 4LF6L 4B3TL 2PI2E 5C3EG 1N34Q 2Q2HA 4DR6L 3S1MH 1X56A 4YCUA 2UXCQ 2C35B 1WCMG 2OQ0A 2YV5A 4DUZL 1N32L 5EAYA 4FDBA 3D31A 5C44G 3OTOQ 4DV0L 3M4QA 2JA6H 4GKJQ 3JAMi 2KBNA 2JA7G 3I56A 3PO2G 1UE1A 3G4SA 2UU9L 3CC4A 1HNZQ 1ASYA 1G51A 1PH9A 2N49A 2K4KA 4X65Q 2AMCB 4X64Q 4LF5Q 4B3ML 4JCVE 5IWAQ 4UP8A 3U50C 2ZM6L 1XPRA 1PA6A 4JBKA 1VQIA 1MJCA 1YZ6A 3MXNB 4GNXC 1IBML 2JA9A 4KHPQ 5LMNL 1CUKA 1N8RC 4A3BG 2Z6KC 5H1SE 1VQFA 1YBYA 1VQNA 2E2HH 1K0RA 5M3MH 2XGTA 4MTNA 4NXNL 4A3KH 3I55A 4HJ5A 3AYHB 3EN2A 4DV3Q 1XNRQ 4A3LG 5J3BA 4Y7NH 2RHSB 4PG3A 3LGJA 1VCIA 3KF8B 1L0WA 1YJWA 1EWIA 1GVPA 1PH5A 4DR7L 3KF6B 5C0XJ 4HIKA 4BXXG 2WAQG 3NEMA 1Q1EA 5E7NA 3HOXG 4JI4Q 1D8LA 2QGQA 3EIVA 3W5OA 2R7ZG 2EQSA 4JV5Q 4POGA 5JJIA 4NXML 2JK8A 3CCVA 4L5TA 1Y1WH 1XTDA 4GOPA 1R9TH 5FLXc 3PIPA 3I4NH 1A8VA 1IBLQ 1YVCA 1I6HH 4LFCQ 4MNOA 1XMQL 4JOIC 3D0FA 2MQHA 3PUVA 3KOJA 4X62Q 2BA0A 2PI2A 4A3MG 4BY1H 3BJUA 4OX9L 3VDYA 1K8GA 3CMEA 4IO9A 4OWXB 3CPFA 1M90C 4P71A 5C44H 2JE6I 4BY7G 1LM0A 4P74A 2K50A 4DV1L 2VW9A 3ER0A 4QJFA 1XNQL 3CW2C 4X66L 3PO2H 5BR8L 3NELA 1BBWA 2UUAQ 4GKKQ 4C3IH 2I5HA 1X3FA 1UE7A 1QVGA 1SLJA 1WI5A 1A62A 1Z47A 4DV6Q 3AFPA 2UUBQ 1EQRA 2GVBA 2Z0SA 1Q46A 4IJHA 3H15A 4DV5L 2IT1A 2ID0A 3PF4A 4LF4L 3F2CA 2PQAB 1N36Q 4A3BH 3CP0A 1X6OA 2F3IA 3DM3A 5C4XH 1UE5A 2HHHL 1L1OB 2CQOA 3HFZB 1EQQA 1X3EA 1KHIA 1Q12A 4JI6Q 2BH8A 4YCVA 2DGYA 4DAYB 2E5LQ 1FJGQ 3GD7A 3L7ZC 3S2DH 1IYJB 4BA2I 2JA6G 1S3OA 3M4PA 1PH6A 4EX5A 4JI0Q 4A3LH 4A3EH 1YNXA 4B3SL 2D0OA 3AEVA 3I4OA 3K80C 2WFWA 3CCQA 4DV2Q 4BY7H 5IE8A 1BVSA 4DR5Q 3PUWA 4LF7Q 1UWVA 2K5HA 2JJQA 5LMUQ 4GLVB 2KHIA 1B8AA 1D7QA 3HOXH 2UUCQ 4YCWA 4A3IH 1QZHA 3GO5A 2KCMA 5M3MG 2JEBI 3ERSX 3HOWG 4DR2L 4DV7Q 1H95A 4LUZA 3JC66 4C2MH 4LF9L 1VQGA 2LSSA 3RN5A 2NVQH 1HZBA 3TEHB 2LXJA 1X9NA 3CCSA 1Q8KA 3PIOA 3PO3H 4LFAQ 3STBC 1Q82C 1HZ9A 2UXBQ 1K83H 3PF5A 5C0XI 1CKNA 1SMXA 2VQFL 3KYHC 1HR0Q 2ZJQA 1EIYB 2B3GA 2ZJPA 2OCEA 1BBUA 1JJCB 1TWFH 4AQYQ 5LMNW 3RZDH 1J5EL 1HR0L 5GQOA 1VQLA 4JI7Q 1N33Q 5M3FG 1Q81C 1T9HA 2YTVA 4A3FG 2JEAI 4PZ6A 1HNWL 1LTLA 3CF5A 3E0EA 1XMOQ 1JJ2A 3GDEA 3GTMH 3UDXA 4DNIA 2VQEL 1VQ5A 3TS2A 3M85A 3I4NG 1MKHA 1TWGH 1UEBA 1HNXL 3A5ZB 3PGZA 1QUQA 2B29A 4YY3L 1PYSB 2HIXA 4POFA 1I94Q 4YHHQ 3GTQH 1AE2A 3J81i 3GTPH 1N34L 4BY1G 2IX0A 2UXCL 1VQ7A 3W1GA 4KI0A 4JI1Q 4XTCS 1VQCA 3HOVG 3M3YH 4GNXA 4A3CG 3J80c 2NVTH 2E2JH 4IOAA 4IFDJ 3ULJA 3OW2A 4O0AA 3OTOL 2Z6KA 4DUYQ 2MNAA 1Q1BA 4GKJL 3UE1A 1U5KA 2K52A 4DUYL 5IYDH 3G48A 1AH9A 1QVFA 1BKBA 3M7NA 1HNZL 4R4CA 3FKIH 3ULLA 4X65L 1Q86C 2F4VQ 4X64L 4LF5L 3J81j 5IWAL 5AJ3Q 2UXDL 1VQEA 1PVOA 1E24A 3H3VH 2PQAA 4KHPL 4K0KQ 1XPUA 5C4XG 2I5MX 2RF4A 4JBWA 3CCMA 1HJPA 4JI8Q 3RNUA 1XPOA 5ELOA 3HOWH 1C0AA 4GN5A 2NVYH 1PFSA 4HIMA 4LUVA 1WJJA 3WWVA 3A0JA 2PMZE 5IT9c 4OWWB 2UXDQ 1OXVA 4R4QA 4A3EG 5M5WH 4DV3L 1HH2P 1XNRL 4IJLA 4YWKA 4B3RQ 1L1OC 4JOIA 3K0XA 1OXXK 1SE8A 4GLXA 2VUMG 3GTLH 2D62A 5GAEC 3HOYG 5M3FH 1Y14B 4JI3Q 2JQOA 4A3IG 4JI4L 4A3FH 4IPHA 3CCLA 4QIWE 2RHQB 2BH2A 4JV5L 4TQUS 2B63G 1TXYA 4IOCA 4OWTB 4A3DG 3JAMc 1S72A 1K8AC 4Y52H 1IBLL 3M4OH 3PO3G 4LW1A 4LFCL 4P73A 2XTIA 4GN3B 2I5LX 4X62L 5GAHC 2KHJA 1E1OA 1TWAH 3CXCA 3HOVH 4A3CH 3KDFB 3PSIA 1YJ9A 4DR1Q 1P16A 3ULPA 1IBKQ 3KFUA 3CCEA 4MZ9A 1Y1VG 1EYGA 1NBWA 2UUAL 4QY7A 4GKKL 4OXPA 2QA4A 5ELNA 3HKZG 3H0GG 5DLQE 4DV6L 2I0QA 3CC2A 1X55A 2H5XA 2UUBL 2R7FA 4O2DA 3UDIA 5IP7H 3I2ZA 3S24A 1PHJA 2OTJA 4DK3C 4DPGA 2N3SA 3TRZA 1N36L 2Q2UA 3K81C 2GN5A 5K36G 4NPSA 1YIJA 1SRUA 4TVAB 1IXRA 4BBSH 5HY6A 4YWMA 3UDFA 3KJOA 1WOCA 4JI6L 4IFDI 3FP9A 4L5QA 4AYBG 1TWHH 2QEXA 2E5LL 1FJGL 3KLWA 2N78A 2CKZB 3B6YA 4JI0L 4XIGS 5IYDG 4RMFA 3T1YQ 2ZTEA 1VQBA 4QGUA 1WFQA 2WP8J 3DLLA 2R92G 1KQSA 3FKIG 4DV2L 4OO1I 2AWNA 2K75A 5C4JH 1VQOA 1E7ZA 1OXUA 4JBJA 5IY0A 1FGUA 4DR5L 1K73C 4LF7L 2VUMH 5LMUL 3HOYH 3BU2A 2UUCL 3U4ZA 1MIUA 1RL2A 2NN6I 3F2DA 4R4OA 1O7IA 3U58A 3BZCA 3PUXA 1C9OA 1PYBA 3MEFA 1B70B 1EOVA 3I7FA 4GLAC 3STBD 2B63H 4A3DH 3CCUA 4A3GH 4DV7L 1CKOA 1VS0A 2AWOA 2OWOA 3TS0A 3PUYA 3T1HQ 3E9HA 4HJ9A 3AQQA 1KRTA 2MO1A 4UY8C 4LFAL 1I50H 3S1NH 1JE5A 3T1HL 2UXBL 4LF8Q 5JJLA 5C0XG 3BZKA 3J80i 3KF6A 3CPWA 2BA1A 2Q2TA 2D0PA 5GAGC 1OTCA 4DR4Q 4LFBQ 1V1QA 3CQZH 4JI7L 4AQYL 4JI2Q 4A76A 5FJ8G 4BBRG 1Z9FA 1Y1VH 3GTOH 1I3QH 5JJKA 2NZOA 1N33L 4GOPB 1U0LA 2IHFA 5IYBG 4X6AH 1VQJA 2JA8H 1KXLA 3CAMA 5HGQA 4EQ5A 3H0GH 1XMOL 4DR3Q 1IZ6A 3I4MG 4IPGA 3GTKH 5IYCG 1CKMA 1MJEA 1EFWA 2YTYA 1VQPA 1K9MC 1I94L 4YHHL 2E8GA 2CWAA 3IRBA 2NVXH 3HOUH 4DKAC 1S40A 3RLOA 3RZOH 4JI1L 2R7DA 4DV4Q 3CCJA 1SROA 4KHZA 3TQYA 5FLMG 4JYAQ 2EIFA 2YYZA 4LUOA 3L2PA 1KD1C 2Y0SE 4PZ8A 1ASZA 4JI5Q 5M5YH 4LF6Q 2R93G 3CC7A 4B3TQ 2R92H 3S17H 1A63A 3G6EA 4DR6Q 1FVIA 1G291 3HOZH 1X65A 2F4VL 5GADC 1YHBA 4DUZQ 5IP7G 1Q7YC 3ZJYC 1VQMA 1N32Q 4C3HH 5AJ3L 3A74A 4H02A 4DV0Q 4BBSG 4GN4B 4K0KL 3S14H 1JT8A 1L1OA 4J15A 3G71A 2CCZA 4JI8L 3RR5A 1NY4A 4R1JA 1YJNA 1K3RA 1VQ6A 2UU9Q 4APVA 1SR3A 1GD7A 2CWPA 3NENA 4DAMA 4A75A 1OXSC 1KIXA 1GM5A 5IP9H 4R4IA 2L15A 4UP9A 4B3MQ 2IHEA 2ZM6Q 3PV0A 4AH6A 2VL6A 3RLNA 1B7YB 1IBMQ 1SN8A 5LMNQ 3S1QH 1NE3A 1NJIC 2N8NA 2WB1E 1W2BA 4B3RL 3J81c 3NBHB 3TREA 4A3JG 5FJ8H 4BBRH 3W1BA 3RN2A 1E1TA 4NXNQ 3Q8DA 4JI3L 5IYBH 2HIVA 2OQKA 1I5FA 1GKHA 2F52A 1YI2A 4P72A 2DUDA 4HJAA 4A3GG 3AFQA 3I4MH 3F2BA 1PH3A 5JEAG 3GTJH 2KENA 5IYCH 3CMAA 1YHQA 2KCTA 1IL2A 1X54A 4DR7Q 1NMGA 2NZHA 1WYDA 1CKNB 2K14A 1V43A 3ICEA 4PZ7A 1KRSA 1P8LA 2PNHA 5M5XH 2VZAA 4UP7A 3CD6A 1PV4A 5FLMH 1UE6A 1YITA 4L5SA 4NXMQ 3PCOB 2ASBA 2Q2IA 3S1RH 2JA5G 4DR1L 1EIFA 4WJ3M 1CSQA 1V9PA 1VQHA 4DK6C 3UDGA 1IBKL 2R93H 1NTGA 2YU9H 2JA8G 2ES2A 2R6GA 1XMQQ 1QUQB 1J6QA 3K7AH 1PH1A 3UE0A 5C3EH 4A93G 2AKWB 3CCRA 3L0OA 4P75A 4R4TA 2ZJRA 4NB3A 2K5VA 4OX9Q 1RIPA 1HZCA 1WCMH 1YHAA 1EUJA 3U4VA 4GNXB 3S16H 3HOUG 2EXDA 4DV1Q 1VQ9A 1XNQQ 1JMCA 2RCNA 4C3JH 1FL0A 4X66Q 5BR8Q 4GOPC 5GROA 1HR0W 4RG1A 4IFDG 3J7ZC 4IPCA 2JA7H 2ZTCA 4JC0A 4YWLA 2A19A 4UPAA 2LXKA 2YTXA 3F8TA 4LWCA 3OYYA 4DV5Q 3T1YL 1KC8C 4LF4Q 3S15H 3E9IA 3KJPA 1VQKA 2HT1A 4OO1G 3HOZG 2WAQE 4PMWA 3J7A5 2HHHQ 3EBEA 4GS3A 2IY5B 3M9BA 1M1KC 2MO0A 1X3GA 4A3JH 2NN6G 3F1ZA 2FXQA 4IPDA 3SGIA 4JBMA 1N9WA 4WJ4A 4HIOA 4L5RC 4ALPA 2K5NA 1E3PA 1QVCA 1QZGA 4OONA 4B3SQ 1E22A 2AHOB 2VNUD 5IP9G 2Y0SG 4LNQA 2CFMA 2MFIA 3PUZA 4BXXH 1DGSA 2VY3A 1KL9A 2E2IH 1TWCH 1PH7A 1OXTA 1VQAA 4LF8L 1GO3E 2OTLA 2V1CC 4DR4L 2A1AA 2R7ZH 3H3VI 4LFBL 2JA5H 1SFOH 4AIMA 1HZAA 4DR2Q
chains in the Genus database with same CATH superfamily
1C7YA 4LSAA 4IALA 2R3ZA 2R8KA 1EEID 1BXTA 3K8AA 4BA1I 1KJ9A 2R92B 3QZ7A 1AE3A 1EY8A 1A0IA 3HOZB 1I7NA 1VQ4A 3S2HH 5HGTA 5ISRA 3RGZA 4RHSA 3FHWA 3Q8QB 2EXZA 1JJGA 1PH2A 3BG5A 1HA6A 4HJ8A 1CSPA 3MWEA 5CAEB 4JYAL 4M8AA 1JIHA 5M5WB 2IX1A 4JI5L 1KAWA 2IMWP 5FO9B 5DQGA 1STHA 4B3TL 2PI2E 4QCLA 4RWSC 1AZQA 5E1FA 2HCCA 2V4RA 2SNMA 2TMPA 4BBRB 3OIQA 1N32L 1STGA 2FLNA 1DD2A 2F4IA 4FDBA 3D31A 4RGTA 5C44G 3OTOQ 3M4QA 1IBLH 2HVRA 4O3RA 2RDIA 2L1BA 5KFJA 4LFCH 3V4ZA 2YZMA 2JA7G 2DJGC 3G4SA 4X62H 2UU9L 1ASYA 2K4KA 2HUGA 2LS01 4LF5Q 2ZM6L 4UP8A 1XPRA 4M9UA 1MJCA 1GOZA 2WE6A 1N8RC 2QYZA 2Z6KC 4IN3A 1GUWA 1WSCA 2UUAH 1YBYA 2ZT9C 3TP7A 2RCFA 5KT6A 1K1QA 5M3MH 4MTNA 4NXNL 3I55A 1E0BA 3TINA 1RK5A 3SDZA 4DV3Q 4Y7NH 5EWFA 3LGJA 4P2CB 5KEEA 3HKZA 3KF8B 1L0WA 4J9KA 4C5CA 1N48A 1YJWA 4DR7L 2SOBA 3A55A 1E2WA 1FJGH 2E5LH 2WAQG 3NEMA 1Q1EA 1C48A 1JWUD 3QFFA 4JI4Q 4R8UA 3G6XA 2R7ZG 4WJWA 2JA6A 4AYBA 5BPFA 4NXML 4J9RA 4DV2H 3CCVA 4QWCA 2R8GA 1XTDA 3I4NH 5KFYA 1YVCA 4KJOA 1I6HH 5L1KA 1XMQL 3N6RA 4EGJA 3PUVA 5JPMC 3CMEA 2R85A 4P71A 1RYRA 2NTTA 5IGDA 3H09A 1XNQL 4X66L 1BF4A 4LFAH 1LO5D 1LV9A 4GKKQ 4IURA 1BDOA 1I4RA 3NHHA 2GVBA 2L4NA 4LFBH 1N36Q 4EQNA 4FVMA 1ENFA 1H9SA 2CQOA 1EQQA 2VPSA 2UVRA 4YJ2F 1X3EA 1I3QB 1EYZA 5CV4A 4YCVA 4FXDA 3GD7A 2W7OA 2O5IC 5TSSA 3TBIB 1I94H 5FO8B 4FYDA 3MFGA 1D2BA 3AEVA 3NTKA 1I4QA 3S2HB 4DR5Q 4LF7Q 1UWVA 1B8AA 5JUMA 2RSNA 4XXEA 1EZ6A 2R7MA 2MGSA 4YCWA 5EKIA 5ELFA 3MR3A 5FKAC 1QZHA 3BG3A 3IL8A 3NBHA 4XDXA 4WD3A 2A6EC 4MIUA 2JEBI 5JVDF 4DR2L 1H95A 3U9TA 4LF9L 5ELCA 2NVQH 1HZBA 2LXJA 3GIDA 3PIOA 3V6KA 1Q82C 1T3NA 3PF5A 2AUKA 2J6TA 4IZ8A 5KFCA 4JI8H 3KYHC 1MZBA 1PMRA 1J5EL 1VQLA 5I2YA 4JI7Q 1GSHA 3GIIA 1TS3A 1RJQA 1SSOA 2LY7A 5M3FG 2UVWA 2YTVA 4A3FG 1HNWL 4KMUC 1CQIB 3N6XA 3V05A 3GIKA 1VQ5A 3RGXA 5LMNH 2NZ1D 1JWSD 3BDOA 1HNXL 1WVLA 3GIMA 1RTNA 4YY3L 4POFA 1AE2A 3J81i 3C2PA 4R7RA 2IX0A 2UXCL 1VQ7A 3W1GA 1M8AA 2EY6A 5KG6A 4GNXA 1RJRA 2W70A 3I12A 4WRDA 3A7AB 4O4LF 2EYJA 4K8JA 5CV6A 2LMCB 1Q1BA 4ECTA 4C3IG 1AH9A 1QVFA 3M7NA 4R4CA 3BYTB 1B6RA 1K83A 4X64L 2UXDL 5CGKA 1VQEA 4DR1H 2RDGA 2Z4HA 1GGOA 2WB1B 2PQAA 3GV3A 4K0KQ 1XPUA 1TWFA 1CK1A 4ZLTF 3CCMA 3ORRA 5ELOA 2DPIA 3HOWH 1X3PA 1DV1A 3L9AX 2Z8LA 5HURA 4J9PA 3SHLA 5JAVA 4HQ6A 2QW7A 3GTQA 2FMMA 1WCMB 4YWKA 3T5HA 4C1NI 2DNCA 1OXXK 1SE8A 2VUMG 5DLFA 4A2AA 1A2TA 2BQUA 5KFOA 1Y14B 2JQOA 5KG2A 3G6YA 3MA2B 4FS2A 3T1YH 2I87A 4JV5L 2B63G 5LP6F 4GZYC 1W96A 3LP8A 1S72A 5NUCA 2FMAA 1L2ZA 4QWEA 1EYDA 3DWAA 3E0JA 2HDMA 3GIQA 3IKJA 5KFKA 1D5ZC 2B39A 1S5DD 4IR9A 4A3CH 4KHVA 4MV4A 4DL4A 2YRXA 2EDGA 1IBKQ 4IRCA 1EYGA 5D1PA 1Y1VG 3HRZC 3MJFA 1LTSD 4QY7A 4OXPA 1WTOA 5DLQE 3H0GG 4F87A 4DV6L 2I0QA 1X55A 3GQBA 3M9OB 3I2ZA 2EY1A 2N3SA 5IT9E 4H0LC 4TVAB 3UDFA 1HPCA 1U4MA 3CU7A 2QEXA 3J7AF 4ED2A 1PFMA 3HXLA 2N78A 5D3IB 2C2RA 2NVQB 5KFPA 2CKZB 3B6YA 3N40P 2PMZA 4RMFA 4UCUA 1WFQA 4OO1I 3FKIG 3Q8PB 3T53B 5BN4A 1VMPA 3MXNA 4L6TB 4PDBA 2UUCL 4FXKC 1AN8A 2EPBA 4R4OA 3F2DA 3NSWA 1KDBA 1PYBA 1B70B 1CA6A 4DR6H 5M9OA 5EPJA 4QIWA 4I4TF 3HKZB 1LTRD 1VS0A 2YU9A 2AWOA 5L37A 4F50A 3E9HA 3DEOA 2W6QA 1WR2A 2E2DC 5EOYA 5KFNA 3BZKA 3J80i 1SYFA 4R8UB 2D0PA 3Q23A 2B2YA 4K2LA 2JA6B 4ME5A 4AYBB 4AQYL 1FNWA 4B3MH 1N33L 2NBFA 3N8DA 1U0LA 4X6AH 4YAJB 4I55F 1KXLA 3CAMA 2K32A 2P5ZX 4O42A 1XMOL 4IPGA 4O2AF 2FK2A 2EVBA 4YHHL 2E8GA 2CWAA 1HUMA 3IRBA 4Q8FA 3HOUH 1S40A 4KK7A 3H40A 3VR3A 3T5JA 3RZOH 3OSPA 4JI1L 2V58A 3HOWB 3T5KA 3TQYA 4JYAQ 1TY0A 4X3TA 1HTLD 2YYZA 1KD1C 1ASZA 4JI5Q 4IUQA 4B3TQ 3S17H 3MFYA 3TIGA 3SE7A 3FMCA 2JEFA 4G4KA 5KG3A 2NYZD 2GA4B 4HEDA 1YHBA 5IP7G 1H9SB 1N32Q 3I72A 4I7ZC 4WFN3 4BBSG 4GN4B 2R7ZA 2WKDA 1L1OA 4J15A 3G71A 2CCZA 4O4HF 3RR5A 2VA2A 4F7XA 2UU9Q 1SYDA 1SR3A 1OXSC 5COYA 5IP9H 2NTSA 4UP9A 3TN2A 2IHEA 2ZM6Q 1Z2OX 1PRTF 1B7YB 3K6OA 4BY1B 1S03G 4HSVA 3F8NA 1NJIC 4L8JA 3OUUA 1W2BA 2KSWA 1LTGD 4U7CA 3EYYA 1AFPA 3NBHB 3TREA 2GPWA 5FJ8H 3PR4A 3GTGA 1JE4A 3W1BA 1LTAD 1VMCA 3SK4A 4NXNQ 1CQJB 4JI3L 3RB3A 2HIVA 5KG1A 1DOLA 5DM73 4DV5H 2ALZA 4M7EA 1O80A 2PYKA 2V4QA 2FP4B 1K1SA 2OF1A 1N36H 3F2BA 1PH3A 2XIWA 5IYCH 2F0HA 3CMAA 2E75C 2P0AA 4DR7Q 1LT6D 1EZ1A 3BA8A 1KRSA 1P8LA 2PNHA 5M5XH 3PVXA 2VZAA 3JZIA 3OHBA 1PFNA 4IHJF 1PTOF 1G8ZD 5FLMH 4XYLB 4NXMQ 4ZI7F 2H4OA 3MR2A 2Q2IA 4NMZA 3S1RH 2JA5G 1GUTA 2VOBA 5G3LD 1SE2A 2B2TA 1CSQA 1VQHA 4K5XA 1FR3A 4FF2A 1NTGA 2YU9H 2R6GA 1XMQQ 1J6QA 3K7AH 4CBVA 3UE0A 3MC0B 4A93G 3GQCA 4EBEA 1GUNA 4MV8A 3PZPA 1S5CD 1HZCA 4ZOLF 5KX5F 4GNXB 1F2ZA 2M2LA 1XNQQ 3BA9A 4C3JH 4X66Q 1BO0A 4Q5VA 1HR0W 3OSOA 5GROA 3J7ZC 2JA7H 2ZTCA 2R8IA 4JC0A 4YWLA 1PRTB 2VQFH 4UPAA 1K83B 3TP6A 3J81E 3F8TA 1BR9A 3OYYA 4OO1G 5IGBA 3KJPA 3H3VC 4FO2A 4JI7H 2WAQE 1STYA 1WTXA 1G91A 2W6OA 3PW5A 1F9RA 5CA0F 4GS3A 1TWFB 1X3GA 4A3JH 1XYIA 1VKZA 3P1HA 1N9WA 3KLSA 4HIOA 1ENCA 2LFNA 3JRXA 5L1JA 1EQTA 3HP3A 3GTMB 4YIJA 4ECUA 2AHOB 3OWEB 2NUCA 1YNNC 1FD7D 3RB0A 1Y1WA 3GTQB 2Y0SG 5DGBA 1SMYD 2CFMA 3PUZA 1DGSA 1MI2A 1KL9A 2VY3A 2PW7A 5EKKA 3PW2A 3VR2A 1HQMC 4CC6A 2PO4A 1SNDA 2DY7A 3QOJA 3RZOB 2NVTB 1SMYC 3KBXA 3H3VI 2R7ZH 1GJXA 1MGSA 2SNSA 1QILA 3A7LA 1IOWA 4IZOA 4AIMA 4OHJA 1HNZH 4DR2Q 4JG2A 4LF9Q 5KNCA 3HZXA 5E3FA 5CMDA 1KJQA 1L2FA 5IWAH 5IGCA 1WTQA 4KHPH 2ATWA 3A8JE 4K0KH 3RLFA 3J7YW 2VS1A 1J5EQ 1PK8A 1DYQA 3GTGH 1J8IA 1EY0A 1SYGA 2OT2A 2NVYB 1HNWQ 3HKSA 4KY7A 1JCKB 4ME3A 2FPIB 4JVZA 2L55A 5I2XA 1G6PA 4RZRA 3AMUA 2A8VA 4DAPA 1HNXQ 1H9MA 4DL2A 4YY3Q 3Q0AA 1W3SA 4LF6L 1L0XB 2W8KA 4YCUA 2UXCQ 2C9OA 2C35B 2YV5A 2HCIA 1X3QA 4K6DA 2R87A 2BE5D 2QDLA 3IFDA 1ILQA 3CVZA 1SFOA 5BMVF 2KCNA 2W71A 1UE1A 1SCUB 5EQ0A 2W6ZA 1G51A 3LX0A 2EJGC 4EQPA 4X64Q 1JKJB 3T5LA 4JCVE 4KJNA 2UXDQ 1QOHA 2QKIC 5A2QL 1YZ6A 3MXNB 1IBML 2JA9A 3DWPA 2KCCA 4XT3B 3CHBD 3DHQA 5M5XB 2DPJA 4A3BG 1I6VC 5IOCA 1VQNA 2XN9C 4HNVA 1SNMA 4QIWB 4A3KH 1T5XD 3BDCA 4KN4C 3AYHB 2YU9B 2W57A 3K7AB 5CV5A 2R86A 3D4RA 4PG3A 1GHKA 1GXDC 2RQXA 1GVPA 5C0XJ 4HIKA 2AQ3B 4N9TA 2R84A 5E7NA 5C3WA 4ED1A 4C3JB 1IKLA 4JI0H 4YR3A 1D8LA 2QGQA 2DZDA 1O7LA 3VR5A 4JV5Q 4POGA 4IRKA 5C8YF 2JEGA 1S10A 2JK8A 3KHLA 1SAPA 1Y1WH 2IP4A 4GOPA 1BXRA 1B3QA 3PIPA 2CH4W 5LMUH 1ZHSA 3M4IA 4FF1A 3C0FB 4JOIC 5C4JB 1O7YA 1TQOA 3DUZA 2MQHA 2WTFA 1CQFA 4RGNA 3K5OA 2XC9A 2PI2A 4A3MG 5JQWA 3QIAA 3BJUA 4A3JB 4YQWA 3VDYA 4J9MA 3CPFA 2MHVA 1M90C 5KT5A 1DJRD 3I8ZA 4DV1L 2VW9A 3ER0A 3UI2A 2FLPA 2D2CC 1W6JA 3CW2C 3PO2H 4RAZA 5EZYF 4A3GB 4UCVA 4C3IH 1BUVT 4MA0A 4UFZA 1X3FA 1UE7A 2E74C 1WI5A 4DV6Q 3S1NB 5DM63 4N9PA 3KHHA 1ML0D 3PF4A 4ZKCB 4LF4L 5KFIA 2IA6A 1T94A 3CP0A 2F3IA 3DM3A 3TQ1A 1UE5A 2XRSD 1TY2A 4YAKB 2R7ZB 1L1OB 1TS4A 1TT2A 1D6EC 3C1FA 1Q12A 1DM0B 2Z1CA 3PMFA 4J9NA 3J7AV 3S2DH 1J9OA 4G3IA 3URYA 4A3LH 4XYQA 5KFXA 2F3VA 4K5WA 4B3SL 5F9NA 2X6LA 3EQLC 3CCQA 3E6ZX 1BVSA 1EUCB 1WTPA 4OGQC 2JJQA 2IW3A 1D7QA 3HOXH 2UUCQ 2F0EA 3GTGB 1II3A 4JYAH 1A3TA 2K6AA 1FGBD 3GO5A 2KCMA 4M1UB 3VR6A 5C1PA 2EY2A 2F0PA 1DOKA 1KABA 4HYKA 3RTXA 5KFVA 2I46A 3I70A 1NUCA 3STBC 4Y8VB 5JVH3 1N32H 4U6PA 4G7ZC 1HR0Q 1SMXA 4JPBW 5A2QW 2L9HA 5KFAA 2FHTA 4BY7H 4CC5A 4DL5A 1BBUA 4AQYQ 5KG7A 5GQOA 3CKIB 2KA7A 1N33Q 2A5HA 4PZ6A 2ZM6H 1LTLA 1XMOQ 1BCPB 2HQEA 3TS2A 4HN7A 3M85A 4MA5A 2SCUB 4B3RH 3PGZA 4RB2C 1PYSB 2HIXA 4YHHQ 1KJ8A 3K5IA 1N34L 4K2KA 2BDNA 5H80A 4JI1Q 2K5QA 3RJ0A 3HOVG 3J80c 4DXFA 2E2JH 2NU8B 4A3KB 4IOAA 4IFDJ 4UCSA 3ULJA 3VYTA 4O0AA 4DN4M 4BWGB 3OW2A 3G8CA 2KVMA 5T14A 4MTDA 2W9CA 4A2BA 4GKJL 2L11A 4DR7H 1U5KA 4DUYL 5CC4A 1QG7A 3D8GA 3JAML 3FKIH 4BWSC 2C5CA 2AQ4A 4GKJH 2Z6BA 1I50A 1PVOA 4ECSA 1E24A 1M4VA 3BQ0A 1TVXA 4NXMH 5C4XG 1XPOA 4H13C 4JBWA 2HD3A 1HJPA 5BN5A 3CQZA 2IPKD 5JVLA 2DIKA 2VPQA 4Q8EA 2R7KA 1Y1WB 1WJJA 5C3EB 4R4QA 4ECXA 1XNRL 2Z4IA 1S0OA 1O78A 4FXGC 2VR1A 4GLXA 3K0XA 4H7BA 3QR8A 5KFMA 4Q0YA 3BQ2A 1H9JA 1F77A 5K5PA 5GAEC 3HOYG 2KHSA 4JI3Q 4A3IG 3PO2B 2CQYA 5KYIA 4IUPA 4C3IB 5FPRA 4O3PA 4EGVA 3K5LA 4A3DG 2CW7A 3JAMc 1K8AC 4EVOA 1IBLL 3KALA 4DXGA 2G9DA 4LFCL 1RK6A 2XTIA 4GN3B 4NW2A 5KFUA 2I5LX 2ASDA 4X62L 2KHJA 3H94A 4UCRA 1TWAH 3T56B 2RKSA 1F2LA 3PSIA 2K05A 2CW8A 5C5JA 3J80W 4MTKA 4MZ9A 5CV9A 2VB2X 5JOBA 4TV9F 4FNFA 2UUAL 3R5FA 4LF8H 2IWHA 4DA2A 4EEYA 3Q2OA 4ECWA 4DR4H 2UUBL 3MWDA 3JSNA 2R7FA 2OTJA 5IP7H 1PHJA 3HOXB 4TKOB 4JI2H 1SYEA 2FK1A 1AEXA 2X6GA 3VYRA 1W93A 4BBSH 1SFOB 3PW4A 4JI6L 3Q24A 4FF3A 1FJGL 2E5LL 4DR3H 3KLWA 2PZTA 2B2VA 3OIPA 1A3UA 5KNBA 3RBEA 2AGQA 1B3AA 5IYDG 5KG0A 2F0OA 4QGUA 3GTJA 2R92G 1T5EA 1LT5D 4DV2L 5EPLA 1VQOA 3EPGA 1OXUA 2A6ED 5IY0A 4BY7B 4S3SA 3L4KA 1HCZA 2CZGA 1O7IA 1AP0A 1GSAA 3MTSA 3NE5B 1ZEQX 5EDWA 4F4ZA 3QO2A 2HVQA 3MEFA 4IUTA 1EOVA 2E76C 3I7FA 1TAEA 3CCUA 3BDLA 1NCVA 2R93A 1CKOA 3A8KE 3G7LA 2UXCH 4CKBA 2RDHA 2JYOA 3T1HQ 4ECQA 4HJ9A 3K58A 2MO1A 2MUYA 1I50H 4LFAL 3JAMW 1JE5A 1IL8A 1D5XC 4DV0H 1M0TA 2QEJC 1BNCA 4DL7A 2E2JB 5IGEA 3X3MA 3CQZH 4A76A 4LAAA 1Z9FA 4BBRG 2FINB 2W8LA 4GOPB 2IHFA 1H9KA 5IYBG 2RVLA 1VQJA 2BR0A 1QB5D 1QNKA 1KAAA 3ND8A 4EQ5A 5HGQA 1U4RA 3KAJA 1MJEA 1EFWA 1I94L 1JLLB 2EYPA 1RODA 1SNQA 5M3MB 2MPMA 1E2ZA 4RB0A 1HHVA 4Q45A 1SROA 2GPSA 4KHZA 1B9MA 3OUZA 2Y0SE 4Y7NB 2R8HA 3OMGA 1GYFA 4LF6Q 1MBYA 1CQVA 2K5WA 2F4VL 5GADC 5BN3A 3IFTA 1U4PA 5J1ZA 1VQMA 1EYAA 4C3HH 1TWCA 4JV5H 1IHZA 3MVVA 2VUGA 1R4PB 3R2IA 4H02A 1JORA 1Q8IA 4PV1C 3TP8A 1GSOA 4JI8L 1VQ6A 1NY4A 3D4WA 1K3RA 4DAYA 1KTKA 3I4NB 1GD7A 1G2TA 2JP1A 1PZID 1I6HB 1Y8NB 3D6WA 1IYVA 2L0CA 3PV0A 2VL6A 2CW0D 3A54A 3RLNA 2W9BA 4O4IF 1IBMQ 5C0XH 2CVRA 3QWNA 1ZETA 5JJZA 1EFID 4HTHA 5BR8H 1ENAA 1XXGA 2CW0C 3PW0A 3RN2A 3QOLA 1EY9A 2ZXPA 1A2UA 2F52A 1JR0D 4GC6A 4P72A 2DUDA 4HJAA 3AFQA 3I4MH 4J9LA 2HHHH 1JQYD 1VAJA 3GTJH 1YHQA 2PVPA 1WYDA 1JOOA 3ICEA 1K0SA 1NAPA 4O3OA 1SNPA 2G5DA 4BBSB 1ILPA 1RCVD 4ME6A 1F2YA 4UP7A 3IG0A 1ZYRD 3CD6A 3RMHA 1PV4A 4RKLA 3PCOB 5C5LA 4TUYF 4DR1L 2F0IA 3NUCA 1V9PA 5T1IA 3UDGA 3V4SA 1ZYRC 4HMIA 2R93H 3ETJA 3RAXA 5CYUA 2ES2A 2UUCH 3CCRA 1Z6HA 3L0OA 1VBGA 4P75A 3LWEA 2ZJRA 4NB3A 1F9PA 2ZJTA 4UCOA 4H44C 1CT1D 2AQ1B 1EUJA 3W2DA 5A35A 3U4VA 3V6JA 1TR5A 2EXDA 4V0BA 4DV1Q 2V9WA 1U4LA 4J1MA 2W9CB 3C46A 3RFCA 4ID6A 2E2HA 3Q6SA 4IPCA 3BABA 5I9PA 4FP5D 1ESRA 1HQRD 3TMEA 1HXYD 1B9NA 2WYOA 2C22A 2A19A 4RB3C 2LXKA 1HR0H 3S15H 3T1YL 2PQEA 1I50B 4LF4Q 1JX4A 2VA3A 1MD2D 3FEWX 3KBGA 1V51A 5HBRB 2IY5B 3M9BA 3GV7B 1F2MA 4ETSA 3NGDA 3H4BA 1SBBB 3SGIA 4JBMA 1XMOH 5EWGA 2MCTA 3T16A 3VPDA 1E3PA 3BYYB 4OONA 4KTAA 4B3SQ 3RB4A 1E22A 2RA4A 2XSCA 4YHHH 3M9NB 4XZ3B 2WKCA 1PZJD 3NBIA 5KT7A 1SYBA 4QB4A 2TSSA 2MFIA 2YL2A 4CGYB 1TWCH 4F8MA 3OTOH 3KHGA 4KY5A 2F0NA 3SE0A 1VF7A 1GO3E 2OTLA 2V1CC 1PX2A 5L9XA 2A1AA 2A73B 5KFWA 1HZAA 3IN5A 2FFKB 2JA7A 2HQLA 3PIO3 1EY4A 4QL5A 4LF5H 2EYHA 3L3OC 1PH4A 4IWYA 1NMFA 3MR6A 3A5UA 1VQ8A 2M00A 4ABNA 3N42B 1YEZA 2A69D 1E4FT 4A3MH 2C00A 4A4IA 4C3HB 2YYAA 4KLKA 3WDNA 3UFXB 2A69C 2GVAA 5IIFA 4IFDH 4X3SA 2WB1G 1IYUA 4DV3H 4DV4L 3LMLA 2F1MA 4E6IA 2ZTDA 1BNZA 4ZQ3A 4DGZA 4EQOA 4HIDA 3LNNA 5KT2A 1I4HA 1N34Q 2Q2HA 4DR6L 4JI4H 3S1MH 2NN6H 2WAQA 1WCMG 2OQ0A 4DUZL 2FJZA 4JV1A 4RAYA 2F0UA 5EAYA 3SEBA 3HEJA 5KFZA 4GKJQ 3JAMi 3E5SA 4C5BA 1KBLA 3I4MB 4C2MA 4TV8F 5FLXL 3MZ5A 3GTJB 1DCZA 1PH9A 2AMCB 1H9RA 1I4XA 5FOBB 3QZ8A 4B3ML 3U50C 3MFHA 4JBKA 1CZWA 1TIID 1XWEA 4GNXC 1VBHA 1B6SA 1CUKA 1OWTA 1PRTD 4I65A 2D9UA 4GKKH 4IQZA 1GUOA 4LMQD 2E2HH 2XGTA 2XCLA 1PRTC 2R93B 4RFBA 2NB0A 3VYUA 5C6AA 2O4XA 1XNRQ 1M6VA 2N88A 5I6WA 4IUNA 1EY7A 4OL7A 2ZDQA 1KC7A 1DZ1A 2AUJD 1EWIA 4I7HA 3GTPA 5L1IA 4BXXG 1W6KA 2EJFC 4ECVA 4J8QA 2V4DA 1ESFA 3L4JA 4FU0A 4K5VA 2NU9B 3PR5B 1N56A 1WD1A 4RGMA 4WORA 3EIVA 2WDTA 2EQSA 1A3VA 4FM9A 4N8X1 5JJIA 1VDZA 2FPPB 4HMJA 2ICEC 5LL6b 4DR5H 4LF7H 5FLXc 1CTMA 1PTOD 1QWYA 1IBLQ 4LFCQ 4X62Q 3KOJA 4RUAA 1RJPA 4ZHQF 1PTOC 5I6YA 4OX9L 2FMCA 2YZGA 1LT4D 2M9VA 5C44H 5DLGA 1UNSA 1LM0A 4P74A 2XRQD 4LJZC 1I4GA 3NELA 1BBWA 2UUAQ 4CJ1B 3NQTA 3K5MA 3T1HH 2OEOA 1SLJA 1C8CA 3SXHA 1Z47A 2F0MA 3R23A 1B04A 4XYOA 4CDFC 3AFPA 5KNDA 2UUBQ 1EQRA 2Z0SA 1UC8A 3H15A 4DV5L 2ID0A 4ZUJA 1TWCB 2PQAB 2H1EA 1X6OA 5C4XH 2RDJA 4ED3A 4Q44A 1YNND 4JI6Q 1KHIA 1C3OA 2BH8A 4DAYB 2E5LQ 1FJGQ 3KAKA 2OH2A 2SEBD 1KLUD 4UHVA 4NLGA 1IYJB 2JA6G 3MWMA 2DWCA 2NUAB 4EX5A 4FBTA 1U9RA 1YNXA 1JOQA 2W9BB 2WFWA 4DV2Q 4A3MB 1ICFB 5IE8A 3PUWA 4TRDA 1STBA 3HOUB 5GONF 4G57A 3EVQA 2KHIA 5D8DA 2FLLA 1WTHA 3PQIA 5C5MA 4A3IH 5KT4A 3R5HA 4I7AA 5A2QE 4OEMB 3ERSX 3C3LA 3HOWG 4XYMB 3I90A 5J2UF 4C2MH 3S17B 4Z9CB 2LSSA 3RN5A 4LFAQ 4QUFA 2HJWA 5FLXW 4F4YA 4EGQA 1CKNA 2VQFL 1I7LA 1EIYB 2B3GA 2ZJPA 3RZDH 1JJCB 3SK6A 2A74C 4UAIA 1T9HA 5JVG3 2ZXRA 5KFEA 3OHXC 1TWHA 3WO0A 1KJIA 3CF5A 3E0EA 1JJ2A 1IBMH 2VQEL 3P20A 1TWGH 1UEBA 3A5ZB 2W6PA 3VPBA 3SI8A 2B29A 1I94Q 2X0SA 4O2BF 1ULZA 3GTPH 2B2YC 1L0YB 1EYCA 2VUMA 4BY1G 5E4WC 3FDSA 4KI0A 2OXPA 4XTCS 1VQCA 3M3YH 1Z2NX 4A3CG 2E2HB 1JOKA 1M0WA 4O3QA 4XQQA 1HA5A 2Z6KA 2B63A 5CORA 2PMZB 2MNAA 4RB1A 3UE1A 2K52A 3I3CA 5IYDH 3G48A 4RAUC 1HNZL 2HGSA 1ICWA 1S0MA 4X65L 2F4VQ 2R6FA 3J81j 3RAQA 5IWAL 3QG1A 4XX0B 5T1GA 1Q90A 4KHPL 4C5AA 1IBKH 3K5NA 5KFSA 1GHJA 2I5MX 2RF4A 4YP3A 2ATLA 2IBKA 4JI8Q 3S1RB 1C0AA 4GN5A 5KIXA 1Y1VA 3GTOA 1PFSA 2WINB 4OWWB 3A0JA 4ULLA 4A3EG 3H0GA 1RF2D 5M5WH 1HH2P 3SR1A 1MHWC 2JXMB 2ZDGA 1L1OC 4DAVA 5C44B 5M3FH 1JC7A 2JA7B 4A3FH 4QW8A 5CV8A 3CCLA 2BH2A 1ZKOA 2QDBA 4LF4H 1ET6A 4IOCA 2DLNA 2RGRA 4MV3A 4Y52H 1KLGD 3M4OH 3J80E 4KKSA 3PO3G 3FKIA 4LW1A 4C56C 2O5JC 2OLSA 1C30A 1IOVA 3CXCA 1YJ9A 3I91A 4ECYA 4DR1Q 1A6XA 2EYFA 1P16A 2A6HD 1B50A 3OOCA 1NBWA 4JV0A 4DNTB 2L12A 2QA4A 1BCPF 2A6HC 1SEIA 4PMBA 1B4OA 4X3UA 3QB3A 1VF5C 2K1BA 2WAQB 1GUSA 2KEEA 3UDIA 3S24A 2F0QA 4DK3C 4DPGA 3TRZA 1F9SA 1K3BC 5E4XA 3K81C 1CHQD 2KEDA 3Q22A 5K36G 4DK1A 1O75A 1RHPA 1SRUA 2B2TC 2K03A 5LHY1 1WOCA 2Q8IB 4L5QA 1TWHH 2B8FA 3G6JB 2B2WC 4C2MB 2JN4A 4DU9A 3MAQA 2AU0A 4RZQA 4NDXA 4O3SA 3FPUB 4XIGS 3MXPA 4JI0L 3T1YQ 5ELBA 5KFQA 4U673 2J6UA 2WP8J 5DEHA 4NKLA 2K75A 1E7ZA 1K73C 4JBJA 2VUMH 1FGUA 5DQHA 2DNEA 3RZDB 1EUDB 1TWAA 5LMUL 2I80A 3R3OA 3R93A 5KGUA 3BU2A 1SDFA 4YB8B 3U4ZA 4KY6A 3K5HA 3JAME 1DOMA 4PMCA 4JI5H 1AW7A 1C9OA 1S4ZA 4KKTA 4B3TH 4GLAC 2F0SA 3STBD 4DK0A 2B63H 3KTMA 4ECRA 1FKAH 2R8JA 4DV7L 2OWOA 3TS0A 4YR2A 4LK1C 5LA6F 3RF2A 4GC7A 3GTPB 4UY8C 2XNAC 1KRTA 5LYJF 4FS1A 2UXBL 4OIKA 5D14A 2R82A 4MV1A 1WCMA 1PXUA 3KF6A 3BVMA 2BA1A 3CPWA 5GAGC 1OTCA 1SE4A 2Q2TA 2YW2A 3GILA 3MXGA 3ORQA 3WO1A 2UU9H 3KLRA 4B9XA 5FJ8G 1Y1VH 3GTOH 1I3QH 5JJKA 2NZOA 1FNVA 2KECA 5CA1F 1UEAB 2MP1A 3H0GH 2PPBC 5D65A 3TQTA 1IW7D 4IWXA 2EOTA 4DL6A 5IYCG 1CKMA 4ED0A 1K9MC 4NXNH 2WACA 2M05A 5DGAA 2B2UC 4DKAC 2ASJA 1IW7C 3RLOA 4DV4Q 3CCJA 1PDQA 2EYMA 1XNRH 5EKLA 5EGTA 5FLMG 3L2PA 2BCOA 5M5YH 2R7NA 1A63A 4CJ0B 4RNOA 3G6EA 4DFAA 3IAYA 4DR6Q 2VQDA 1WTWA 1QE6A 1KDCA 1X65A 4PNYA 4DUZQ 1Q7YC 3ZJYC 2E2IA 2F0FA 5AJ3L 5M3FB 2EZVA 1EWHA 1HTPA 1SNOA 4A3FB 2ZDHA 4LH6A 1CM9A 3S14H 5CBEE 1XMQH 2JA5A 4C3JG 4R1JA 3BZDB 1YJNA 1SEBD 2EYLA 3NXWA 2PZWA 4APVA 5EBDA 4DAMA 1KIXA 1GM5A 3BJYA 5C4HA 1B44D 1DIKA 4R4IA 2L15A 3M4OB 2I07B 4B3MQ 4AH6A 2BQ3A 4ILWA 5LL6S 1SN8A 1SJHD 2FE3A 1XNQH 3S1QH 4X66H 3M9MB 1TU2B 3BVZA 5LL6X 2N8NA 2WB1E 1Z2PX 4B3RL 1EL0A 3NQIA 4A3JG 1E1TA 3Q8DA 1EU3A 3H20A 5FD6A 2UUBH 5ELEA 1YI2A 4A3GG 2PBZA 1LLRD 4K14A 5JEAG 1QNUA 1PZKD 3MR5A 1IL2A 1X54A 2RBMA 3A8IE 1CKNB 2K14A 1TA8A 3DM1A 4JI6H 4PZ7A 3GV8B 3NWSA 2AGOA 2RSOA 3S2DB 1DV2A 3A56A 1UE6A 1YITA 1TWHB 4L5SA 3PIP3 2ASBA 1OO9B 2JA8G 2IX3A 1PH1A 2Y0SA 3V6HA 4RCNA 2AKWB 2CQAA 1XDNA 4R4TA 2VUMB 4OX9Q 2K5VA 2R7LA 1YHAA 1WCMH 1Z7TA 2J6SA 2EY5A 3S16H 2LKVA 4DR2H 3FRPB 4QWDA 1LTID 3SK5A 4LF9H 4X3KA 4MTEA 1FL0A 4GOPC 1SXTA 2B63B 3TIIA 1S5BD 3E5NA 3K59A 4IRDA 1JDEA 3TP5A 1CHPD 1J5EH 4DV5Q 4LWCA 3KUPA 4N8FA 5EWEA 3HOZG 4PMWA 4KKUA 4RU9A 2BOSA 1BQQT 2FKLA 1HNWH 1SJED 2MO0A 3D4DA 1RJTA 5KFDA 1NSNS 2FXQA 2A68D 4IPDA 1Y1VB 3GTOB 4EBCA 4L5RC 1HNXH 2K5NA 2ENBA 2DY8A 4YY3H 1QJOA 3HGBA 1QZGA 4QWBA 3R8BA 4CDEC 2A68C 3H0GB 4XQJA 1R9TA 3TDQA 5FD5A 4J9QA 4LNQA 1EY6A 5JPNC 4BXXH 2E2IH 1PH7A 4LF8L 1I4PA 3QJYA 4DR4L 2G9HD 4MV7A 4LFBL 2YRWA 2JA5H 4LMYA 2QF7A 3KHRA 2W6NA 4JI2L 4IR1A 4X64H 4A3KG 5M5YB 2F4VH 2NWGA 2UXDH 1LUZA 3HKZE 2F3WA 4ZYSA 3NTHA 3FKIB 1PH8A 4A93H 2JEJA 3NPPA 3GIPA 5JEAJ 4DNRB 1XJVA 4DR3L 5FK9C 1CFMA 2VQFQ 2V5AA 1WH2A 1JB7A 3P75A 3RV4A 2ALYB 2W9AA 1VQDA 3S14B 3KDFA 4AYBE 2NU6B 1Y8OB 4HJ7A 1V4YA 3K7UC 1LYLA 2VQEQ 1G2SA 2AQ2B 4QQBX 1Y1WG 4OO1H 1WTVA 2F03A 3CRKC 3VYSA 5C3EG 3UQ8A 4F4WA 3S1QB 1RYSA 3RIZA 1X56A 1KEEA 3LWUA 2J7ZA 4EBDA 3BVGA 3TZUA 2ICIA 4RGOS 3BAAA 5EJWA 5L1LA 1S5FD 4DV0L 2JA6H 1ZQ7A 2KBNA 2W6MA 1AUXA 3I56A 3PO2G 1E4EA 3CC4A 1HNZQ 4RNMA 2N49A 2CHBD 4X65Q 5DQIA 1EY5A 2WV6D 1CA5A 3CRLC 5IWAQ 4JK1C 5CR3A 1PA6A 1TWAB 1VQIA 4KHPQ 5LMNL 3F2UA 4R9WA 1G6ZA 5EBCA 3O13A 3AU7A 5H1SE 1VQFA 1LACA 5DNFA 1K0RA 4DV6H 3C1EA 3NP8A 5DAUA 4HJ5A 2SDFA 3EN2A 4A3LG 4MV6A 2C28A 5J3BA 3GTMA 3PN1A 2RHSB 1VCIA 3WOEA 1PH5A 4ED6A 3KF6B 3S16B 2BDOA 2ASLA 3S9WA 1SYCA 1LT3D 3HOXG 5I4DA 3W5OA 5IGGA 4MAMA 4CDCC 5I47A 3OMCA 4L5TA 1R9TH 1FNUA 4CJ2C 1A8VA 1QCBD 1E2VA 4MNOA 3D0FA 1XTCD 2BA0A 4K6LA 2XGQA 1NR4A 4BY1H 4O3NA 1K8GA 4IO9A 4EYHB 4OWXB 3TZDA 4FBUA 1HRJA 2JE6I 4BY7G 1STEA 2K50A 4ZRZA 1RKNA 4QJFA 2YCHA 1RD9D 5BR8L 2I8CA 1F9QA 5KFFA 2NVYA 1S5ED 2GLTA 2C2DA 2I5HA 1QVGA 1WD0A 1A62A 1V1PA 4HR7A 1GUGA 1E4GT 4QW9A 1Q46A 4F88A 4IJHA 4G7HC 3MFIA 2IT1A 2K33A 2E2IB 4AQYH 3F2CA 5KYLA 4A3BH 1N33H 1EQVA 3FPPA 4ZCKA 2ZXOA 2HHHL 3CQZB 3GTLA 3HFZB 2JA5B 3EJIA 2WIIB 2DGYA 4TQSA 2C2EA 2PNRC 1D1IA 3L7ZC 4BA2I 2Z9HA 1S3OA 3M4PA 1PH6A 4JI0Q 3K3PA 4CKCA 4A3EH 4A93B 1S68A 2N55A 2D0OA 3I4OA 2XWBB 1SE3A 3K80C 5D3DA 4ED8A 3RV3A 2KQ3A 4U68A 4JI1H 2K5HA 5LMUQ 4GLVB 1PFBA 4DV4H 1BGWA 2CH4A 2EE1A 5FLXE 1CS0A 2B2VC 2YS7A 4EFEA 4PQXA 4MHEA 1EHIA 5M3MG 4DV7Q 3TSSA 4LUZA 1JICA 3JC66 1KDAA 2KJXA 2PW5A 3ONAB 4K8IA 1VQGA 1UNNC 5CB4F 3TEHB 1X9NA 4DUZH 4B9WA 3CCSA 1Q8KA 4JW0A 3PO3H 2UXBQ 1HZ9A 4I50F 1K83H 4ZKBB 1MSGA 3RB6A 4HCEA 4L1KA 5C0XI 2ZJQA 3EROA 5C1OA 2J0TD 3G6VA 4J0MA 2OCEA 4CDDC 1TWFH 4V190 1HR0L 5LMNW 2YS6A 3RBDA 2HDLA 5AFWA 5F2DA 1Q81C 3JRWA 3ITPA 2K28A 2FK3A 2JEAI 2Q8TA 1BOSA 2Y0SB 5IT9L 3GDEA 3GTMH 3UDXA 2EJMA 2L5TA 4DNIA 4EFBA 3I4NG 1MKHA 4B08A 4RH6A 2BQRA 3T4AC 1QUQA 4KN7C 3GTQH 3HBLA 3DWQA 4JI3H 4QUCA 3NK9A 2QILA 3RUZA 5K36H 2HVSA 3HS0C 2AGPA 1B33N 1PTOH 2NVTH 4R8NA 1KNAA 4E4TA 4MN3A 4RKBA 4EEQA 4QMGA 4HNUA 1GLVA 3OTOL 4J9OA 4DUYQ 2X69A 1EZ8A 3MHBA 3WOFA 3D6CA 4JV2A 3BQ1A 5J22A 2W7PA 1D1KA 2B8GA 1BKBA 2F0LA 1NNXA 4L63B 3ULLA 1Q86C 3PW7A 2K5DA 5D1OA 4LF5L 5AJ3Q 3K57A 4DL3A 3ND9A 2RDFA 2EYOA 1RTOA 3H3VH 1EIHA 4HSPA 1BJTA 3RD4A 4CHTB 3RNUA 2RGVA 1I6UA 1R4QB 1EEFD 3MXUA 2NVYH 4HIMA 1R9TB 4LUVA 5IT9c 3WWVA 2PMZE 1ZHQA 1OXVA 4IAJA 1TS5A 4OX9H 1TWGA 4DV3L 1FYCA 4IJLA 3GTKA 2UVUA 2K7VA 2J4XA 5EPKA 5KKNB 2NVXA 4RHRA 4B3RQ 4JOIA 1JXLA 1T36A 5BPHA 3GTLH 2D62A 1LABA 2UVVA 4MV9A 2XWJB 1Q3LA 1MSHA 1TS2A 4JI4L 4IPHA 4RCOA 1DONA 4QIWE 1K8MA 2RHQB 4TQUS 2YZNA 1TXYA 2IJ0A 4OWTB 3S15B 5KFLA 1WTRA 5LXTF 2JSOA 2F0GA 2R92A 3H6MA 4P73A 1B53A 4A3BB 2IL8A 5GAHC 1E1OA 3HOVH 4LH7A 3KDFB 5G3LF 3GLKA 5KT3A 2D5DA 4ECZA 4RNNA 3AB9A 3H91A 4YJ3F 3ULPA 3KFUA 3CCEA 1V8QA 4A3EB 1UAPA 4J6HA 2DN8A 1STNA 4GKKL 4KD4A 4NP5A 5ELNA 4FF4A 3HKZG 4UCTA 2B2WA 3CC2A 3Q8RB 2H5XA 4O2DA 4BS9A 4RA8A 3OHAA 2QCPX 1CZGA 1N36L 2Q2UA 1HFGA 2GN5A 3FDTA 4NPSA 1YIJA 4KV6A 1IXRA 3MWYW 1K28A 2PZUA 4YWMA 5HY6A 4C1NK 3GV6A 3KJOA 3V96A 3FP9A 1D5MC 4IFDI 4AYBG 1E4EB 4YR0A 4EYIB 1BBXC 3PO3B 3LWBA 5FPOA 2ZTEA 5IT9W 4ODGA 1VQBA 5CBAE 1YNJD 3DLLA 1KQSA 2AWNA 5C4JH 2XD4A 2K01A 3JSLA 2XCPA 4DR5L 4LF7L 2XIGA 5IODA 3RUPA 3DEPA 3VA5A 1B1ZA 3HOYH 3BS1A 3N52A 1YNJC 4EG0A 1MIUA 1RL2A 2NN6I 4C3HG 2MJ8A 3I73A 1ET9A 2VQEH 1UC9A 3U58A 3BZCA 3PUXA 4LF6H 3VMMA 4F4XA 2F0DA 2F0JA 4A3DH 2FJ2A 4A3GH 3R5XA 1S0NA 1Y8PB 5J39A 5JEAH 5J2TF 3PUYA 3ZYYX 1AZPA 3S1MB 3S1NH 3AQQA 1SNCA 5KFBA 3GV5B 3R2TA 3KF8A 3T1HL 5JJLA 4ZAIA 4DF7A 4LF8Q 5C0XG 3WNZA 1M7JA 3K3VA 4DR4Q 3MEHA 1PTOB 4LFBQ 1V1QA 3SK8A 3K0YA 4JI7L 4JI2Q 3EFXD 3N44B 1EOTA 1PLFA 2B2UA 4HNTA 4X65H 3D3RA 4ZUIA 2JA8H 5DG8A 1JDBB 5KFRA 4DR3Q 1IZ6A 3I4MG 3GTKH 5KFTA 1JB3A 2YTYA 1VQPA 2NVXH 3NWTA 1ZXTA 4IUUA 3J81L 3GIJA 1UUPA 2R7DA 2VB3X 4ZQIA 3U9OA 4Q0FA 1O7ZA 2R61A 3X3NA 2F0WA 3GP7A 3OW7A 3T13A 5DG7A 2EIFA 3DF7A 3HB9A 5KG5A 1V1PB 4LUOA 4HR7B 4PZ8A 4PWQA 2F0TA 3P7JA 5C4ZA 2R93G 3CC7A 2R92H 1KNEA 1FVIA 1G291 3DMUA 3HOZH 2F0VA 4KD3A 3GTLB 1ONLA 1SYXB 3A74A 2KUMA 5KG4A 4DV0Q 4K0KL 1JWMD 1IKMA 5KFGA 1JT8A 1A9XA 4OIJA 4JUZA 1I3QA 4WBNF 1CI3M 1AUVA 2J9GA 2CWPA 3NENA 2BE5C 4A75A 1LTBD 3EA6A 2Q8RE 3OWFA 4XQNA 1B2TA 3KXYT 2F0KA 3HG9A 3J7AK 4DV1H 4TSSA 5LMNQ 2FB9A 3V2TA 4DLKA 2KOLA 3N43B 1NE3A 3HOVB 5KFHA 4LSXA 3NTIA 4XT1B 1HFNA 3J81c 3Q1KA 3N41B 4BBRH 2VXWA 3ETHA 3KK7A 1S9FA 2O03A 5IYBH 1V1OA 3E3XA 2OQKA 1I5FA 3KLSX 1GKHA 3VR4A 4RUCA 1AN7A 3ERQA 3SVMA 2XVSA 2FPGB 2KENA 5I9OA 2XCAA 2K04A 2KCTA 5KRUA 3I4LA 1NMGA 2NZHA 4O1NA 5C4XB 1V43A 4ZK9B 3M4YA 3U9SA 4B3SH 3VPCA 4R8IA 3EPIA 2XGPA 3DXJC 1PYWD 4YBZB 2O2LD 3FMAA 3VA7A 5C3XA 1EIFA 4WJ3M 4DK6C 1IBKL 5IGFA 2QK4A 1QUQB 5HV6A 1EU4A 4UDUC 5C3EH 3OSNA 1EWCA 1RIPA 3T51B 3HOYB 1BCPD 5FO7B 3HOUG 1RDPD 4A3IB 5IYZF 1VQ9A 1JMCA 2RCNA 4DV7H 2DJFC 5BR8Q 4OELB 1BCPC 4RG1A 4IFDG 2JEIA 4A3DB 5K2MA 1HUNA 2UXBH 5JH7F 3W3AA 1TKWB 2YTXA 5D1OB 1A15A 1KC8C 1X32A 3M7GA 3E9IA 1VQKA 4HCSA 2HT1A 4QF4A 3J7A5 1K8OA 2HHHQ 1EIGA 3EBEA 1M1KC 1STAA 2V59A 1LTTD 1DXMA 2NN6G 4CKEA 3F1ZA 2PCFB 4IUVA 1Y69U 1CE8A 2WB1A 5DG9A 3Q8SB 4WJ4A 5LOVF 4J9SA 4ALPA 3J81W 3OPOA 1QVCA 2JA8B 4APMA 2NU7B 4HAEA 1N34H 1TWGB 2VNUD 4Q43A 3H4DA 5IP9G 3GTKB 5ELDA 4TQRA 2PN1A 5F9LA 4QWAA 3FVQA 2NVXB 1C4QA 5CV7A 1KJJA 3M3YB 1OXTA 1VQAA 1NR2A 1XX8A 4G7OC 4DUYH 4ED7A 1S97A 3J80L 1SFOH
chains in the Genus database with same CATH topology
1C7YA 4JI2L 2HQLA 4JG2A 4LF9Q 4QL5A 4A3KG 3K8AA 4BA1I 1L2FA 1LUZA 3HKZE 1PH4A 1PH8A 1NMFA 4A93H 3A5UA 1AE3A 1VQ8A 1A0IA 5JEAJ 1VQ4A 2ATWA 1XJVA 1YEZA 4DR3L 3RLFA 4A3MH 3S2HH 2VQFQ 4A4IA 1JB7A 4KLKA 2VS1A 3FHWA 1J5EQ 2ALYB 1JJGA 1VQDA 1PH2A 2GVAA 3GTGH 3KDFA 2WB1G 4AYBE 4HJ8A 1CSPA 4HJ7A 4DV4L 1HNWQ 3K7UC 3HKSA 4ME3A 1LYLA 2ZTDA 2VQEQ 4JYAL 1G6PA 2A8VA 1HNXQ 2IX1A 4QQBX 1Y1WG 4JI5L 1KAWA 4YY3Q 4HIDA 1W3SA 4LF6L 4B3TL 2PI2E 5C3EG 1N34Q 2Q2HA 4DR6L 3S1MH 1X56A 4YCUA 2UXCQ 2C35B 1WCMG 2OQ0A 2YV5A 4DUZL 1N32L 5EAYA 4FDBA 3D31A 5C44G 3OTOQ 4DV0L 3M4QA 2JA6H 4GKJQ 3JAMi 2KBNA 2JA7G 3I56A 3PO2G 1UE1A 3G4SA 2UU9L 3CC4A 1HNZQ 1ASYA 1G51A 1PH9A 2N49A 2K4KA 4X65Q 2AMCB 4X64Q 4LF5Q 4B3ML 4JCVE 5IWAQ 4UP8A 3U50C 2ZM6L 1XPRA 1PA6A 4JBKA 1VQIA 1MJCA 1YZ6A 3MXNB 4GNXC 1IBML 2JA9A 4KHPQ 5LMNL 1CUKA 1N8RC 4A3BG 2Z6KC 5H1SE 1VQFA 1YBYA 1VQNA 2E2HH 1K0RA 5M3MH 2XGTA 4MTNA 4NXNL 4A3KH 3I55A 4HJ5A 3AYHB 3EN2A 4DV3Q 1XNRQ 4A3LG 5J3BA 4Y7NH 2RHSB 4PG3A 3LGJA 1VCIA 3KF8B 1L0WA 1YJWA 1EWIA 1GVPA 1PH5A 4DR7L 3KF6B 5C0XJ 4HIKA 4BXXG 2WAQG 3NEMA 1Q1EA 5E7NA 3HOXG 4JI4Q 1D8LA 2QGQA 3EIVA 3W5OA 2R7ZG 2EQSA 4JV5Q 4POGA 5JJIA 4NXML 2JK8A 3CCVA 4L5TA 1Y1WH 1XTDA 4GOPA 1R9TH 5FLXc 3PIPA 3I4NH 1A8VA 1IBLQ 1YVCA 1I6HH 4LFCQ 4MNOA 1XMQL 4JOIC 3D0FA 2MQHA 3PUVA 3KOJA 4X62Q 2BA0A 2PI2A 4A3MG 4BY1H 3BJUA 4OX9L 3VDYA 1K8GA 3CMEA 4IO9A 4OWXB 3CPFA 1M90C 4P71A 5C44H 2JE6I 4BY7G 1LM0A 4P74A 2K50A 4DV1L 2VW9A 3ER0A 4QJFA 1XNQL 3CW2C 4X66L 3PO2H 5BR8L 3NELA 1BBWA 2UUAQ 4GKKQ 4C3IH 2I5HA 1X3FA 1UE7A 1QVGA 1SLJA 1WI5A 1A62A 1Z47A 4DV6Q 3AFPA 2UUBQ 1EQRA 2GVBA 2Z0SA 1Q46A 4IJHA 3H15A 4DV5L 2IT1A 2ID0A 3PF4A 4LF4L 3F2CA 2PQAB 1N36Q 4A3BH 3CP0A 1X6OA 2F3IA 3DM3A 5C4XH 1UE5A 2HHHL 1L1OB 2CQOA 3HFZB 1EQQA 1X3EA 1KHIA 1Q12A 4JI6Q 2BH8A 4YCVA 2DGYA 4DAYB 2E5LQ 1FJGQ 3GD7A 3L7ZC 3S2DH 1IYJB 4BA2I 2JA6G 1S3OA 3M4PA 1PH6A 4EX5A 4JI0Q 4A3LH 4A3EH 1YNXA 4B3SL 2D0OA 3AEVA 3I4OA 3K80C 2WFWA 3CCQA 4DV2Q 4BY7H 5IE8A 1BVSA 4DR5Q 3PUWA 4LF7Q 1UWVA 2K5HA 2JJQA 5LMUQ 4GLVB 2KHIA 1B8AA 1D7QA 3HOXH 2UUCQ 4YCWA 4A3IH 1QZHA 3GO5A 2KCMA 5M3MG 2JEBI 3ERSX 3HOWG 4DR2L 4DV7Q 1H95A 4LUZA 3JC66 4C2MH 4LF9L 1VQGA 2LSSA 3RN5A 2NVQH 1HZBA 3TEHB 2LXJA 1X9NA 3CCSA 1Q8KA 3PIOA 3PO3H 4LFAQ 3STBC 1Q82C 1HZ9A 2UXBQ 1K83H 3PF5A 5C0XI 1CKNA 1SMXA 2VQFL 3KYHC 1HR0Q 2ZJQA 1EIYB 2B3GA 2ZJPA 2OCEA 1BBUA 1JJCB 1TWFH 4AQYQ 5LMNW 3RZDH 1J5EL 1HR0L 5GQOA 1VQLA 4JI7Q 1N33Q 5M3FG 1Q81C 1T9HA 2YTVA 4A3FG 2JEAI 4PZ6A 1HNWL 1LTLA 3CF5A 3E0EA 1XMOQ 1JJ2A 3GDEA 3GTMH 3UDXA 4DNIA 2VQEL 1VQ5A 3TS2A 3M85A 3I4NG 1MKHA 1TWGH 1UEBA 1HNXL 3A5ZB 3PGZA 1QUQA 2B29A 4YY3L 1PYSB 2HIXA 4POFA 1I94Q 4YHHQ 3GTQH 1AE2A 3J81i 3GTPH 1N34L 4BY1G 2IX0A 2UXCL 1VQ7A 3W1GA 4KI0A 4JI1Q 4XTCS 1VQCA 3HOVG 3M3YH 4GNXA 4A3CG 3J80c 2NVTH 2E2JH 4IOAA 4IFDJ 3ULJA 3OW2A 4O0AA 3OTOL 2Z6KA 4DUYQ 2MNAA 1Q1BA 4GKJL 3UE1A 1U5KA 2K52A 4DUYL 5IYDH 3G48A 1AH9A 1QVFA 1BKBA 3M7NA 1HNZL 4R4CA 3FKIH 3ULLA 4X65L 1Q86C 2F4VQ 4X64L 4LF5L 3J81j 5IWAL 5AJ3Q 2UXDL 1VQEA 1PVOA 1E24A 3H3VH 2PQAA 4KHPL 4K0KQ 1XPUA 5C4XG 2I5MX 2RF4A 4JBWA 3CCMA 1HJPA 4JI8Q 3RNUA 1XPOA 5ELOA 3HOWH 1C0AA 4GN5A 2NVYH 1PFSA 4HIMA 4LUVA 1WJJA 3WWVA 3A0JA 2PMZE 5IT9c 4OWWB 2UXDQ 1OXVA 4R4QA 4A3EG 5M5WH 4DV3L 1HH2P 1XNRL 4IJLA 4YWKA 4B3RQ 1L1OC 4JOIA 3K0XA 1OXXK 1SE8A 4GLXA 2VUMG 3GTLH 2D62A 5GAEC 3HOYG 5M3FH 1Y14B 4JI3Q 2JQOA 4A3IG 4JI4L 4A3FH 4IPHA 3CCLA 4QIWE 2RHQB 2BH2A 4JV5L 4TQUS 2B63G 1TXYA 4IOCA 4OWTB 4A3DG 3JAMc 1S72A 1K8AC 4Y52H 1IBLL 3M4OH 3PO3G 4LW1A 4LFCL 4P73A 2XTIA 4GN3B 2I5LX 4X62L 5GAHC 2KHJA 1E1OA 1TWAH 3CXCA 3HOVH 4A3CH 3KDFB 3PSIA 1YJ9A 4DR1Q 1P16A 3ULPA 1IBKQ 3KFUA 3CCEA 4MZ9A 1Y1VG 1EYGA 1NBWA 2UUAL 4QY7A 4GKKL 4OXPA 2QA4A 5ELNA 3HKZG 3H0GG 5DLQE 4DV6L 2I0QA 3CC2A 1X55A 2H5XA 2UUBL 2R7FA 4O2DA 3UDIA 5IP7H 3I2ZA 3S24A 1PHJA 2OTJA 4DK3C 4DPGA 2N3SA 3TRZA 1N36L 2Q2UA 3K81C 2GN5A 5K36G 4NPSA 1YIJA 1SRUA 4TVAB 1IXRA 4BBSH 5HY6A 4YWMA 3UDFA 3KJOA 1WOCA 4JI6L 4IFDI 3FP9A 4L5QA 4AYBG 1TWHH 2QEXA 2E5LL 1FJGL 3KLWA 2N78A 2CKZB 3B6YA 4JI0L 4XIGS 5IYDG 4RMFA 3T1YQ 2ZTEA 1VQBA 4QGUA 1WFQA 2WP8J 3DLLA 2R92G 1KQSA 3FKIG 4DV2L 4OO1I 2AWNA 2K75A 5C4JH 1VQOA 1E7ZA 1OXUA 4JBJA 5IY0A 1FGUA 4DR5L 1K73C 4LF7L 2VUMH 5LMUL 3HOYH 3BU2A 2UUCL 3U4ZA 1MIUA 1RL2A 2NN6I 3F2DA 4R4OA 1O7IA 3U58A 3BZCA 3PUXA 1C9OA 1PYBA 3MEFA 1B70B 1EOVA 3I7FA 4GLAC 3STBD 2B63H 4A3DH 3CCUA 4A3GH 4DV7L 1CKOA 1VS0A 2AWOA 2OWOA 3TS0A 3PUYA 3T1HQ 3E9HA 4HJ9A 3AQQA 1KRTA 2MO1A 4UY8C 4LFAL 1I50H 3S1NH 1JE5A 3T1HL 2UXBL 4LF8Q 5JJLA 5C0XG 3BZKA 3J80i 3KF6A 3CPWA 2BA1A 2Q2TA 2D0PA 5GAGC 1OTCA 4DR4Q 4LFBQ 1V1QA 3CQZH 4JI7L 4AQYL 4JI2Q 4A76A 5FJ8G 4BBRG 1Z9FA 1Y1VH 3GTOH 1I3QH 5JJKA 2NZOA 1N33L 4GOPB 1U0LA 2IHFA 5IYBG 4X6AH 1VQJA 2JA8H 1KXLA 3CAMA 5HGQA 4EQ5A 3H0GH 1XMOL 4DR3Q 1IZ6A 3I4MG 4IPGA 3GTKH 5IYCG 1CKMA 1MJEA 1EFWA 2YTYA 1VQPA 1K9MC 1I94L 4YHHL 2E8GA 2CWAA 3IRBA 2NVXH 3HOUH 4DKAC 1S40A 3RLOA 3RZOH 4JI1L 2R7DA 4DV4Q 3CCJA 1SROA 4KHZA 3TQYA 5FLMG 4JYAQ 2EIFA 2YYZA 4LUOA 3L2PA 1KD1C 2Y0SE 4PZ8A 1ASZA 4JI5Q 5M5YH 4LF6Q 2R93G 3CC7A 4B3TQ 2R92H 3S17H 1A63A 3G6EA 4DR6Q 1FVIA 1G291 3HOZH 1X65A 2F4VL 5GADC 1YHBA 4DUZQ 5IP7G 1Q7YC 3ZJYC 1VQMA 1N32Q 4C3HH 5AJ3L 3A74A 4H02A 4DV0Q 4BBSG 4GN4B 4K0KL 3S14H 1JT8A 1L1OA 4J15A 3G71A 2CCZA 4JI8L 3RR5A 1NY4A 4R1JA 1YJNA 1K3RA 1VQ6A 2UU9Q 4APVA 1SR3A 1GD7A 2CWPA 3NENA 4DAMA 4A75A 1OXSC 1KIXA 1GM5A 5IP9H 4R4IA 2L15A 4UP9A 4B3MQ 2IHEA 2ZM6Q 3PV0A 4AH6A 2VL6A 3RLNA 1B7YB 1IBMQ 1SN8A 5LMNQ 3S1QH 1NE3A 1NJIC 2N8NA 2WB1E 1W2BA 4B3RL 3J81c 3NBHB 3TREA 4A3JG 5FJ8H 4BBRH 3W1BA 3RN2A 1E1TA 4NXNQ 3Q8DA 4JI3L 5IYBH 2HIVA 2OQKA 1I5FA 1GKHA 2F52A 1YI2A 4P72A 2DUDA 4HJAA 4A3GG 3AFQA 3I4MH 3F2BA 1PH3A 5JEAG 3GTJH 2KENA 5IYCH 3CMAA 1YHQA 2KCTA 1IL2A 1X54A 4DR7Q 1NMGA 2NZHA 1WYDA 1CKNB 2K14A 1V43A 3ICEA 4PZ7A 1KRSA 1P8LA 2PNHA 5M5XH 2VZAA 4UP7A 3CD6A 1PV4A 5FLMH 1UE6A 1YITA 4L5SA 4NXMQ 3PCOB 2ASBA 2Q2IA 3S1RH 2JA5G 4DR1L 1EIFA 4WJ3M 1CSQA 1V9PA 1VQHA 4DK6C 3UDGA 1IBKL 2R93H 1NTGA 2YU9H 2JA8G 2ES2A 2R6GA 1XMQQ 1QUQB 1J6QA 3K7AH 1PH1A 3UE0A 5C3EH 4A93G 2AKWB 3CCRA 3L0OA 4P75A 4R4TA 2ZJRA 4NB3A 2K5VA 4OX9Q 1RIPA 1HZCA 1WCMH 1YHAA 1EUJA 3U4VA 4GNXB 3S16H 3HOUG 2EXDA 4DV1Q 1VQ9A 1XNQQ 1JMCA 2RCNA 4C3JH 1FL0A 4X66Q 5BR8Q 4GOPC 5GROA 1HR0W 4RG1A 4IFDG 3J7ZC 4IPCA 2JA7H 2ZTCA 4JC0A 4YWLA 2A19A 4UPAA 2LXKA 2YTXA 3F8TA 4LWCA 3OYYA 4DV5Q 3T1YL 1KC8C 4LF4Q 3S15H 3E9IA 3KJPA 1VQKA 2HT1A 4OO1G 3HOZG 2WAQE 4PMWA 3J7A5 2HHHQ 3EBEA 4GS3A 2IY5B 3M9BA 1M1KC 2MO0A 1X3GA 4A3JH 2NN6G 3F1ZA 2FXQA 4IPDA 3SGIA 4JBMA 1N9WA 4WJ4A 4HIOA 4L5RC 4ALPA 2K5NA 1E3PA 1QVCA 1QZGA 4OONA 4B3SQ 1E22A 2AHOB 2VNUD 5IP9G 2Y0SG 4LNQA 2CFMA 2MFIA 3PUZA 4BXXH 1DGSA 2VY3A 1KL9A 2E2IH 1TWCH 1PH7A 1OXTA 1VQAA 4LF8L 1GO3E 2OTLA 2V1CC 4DR4L 2A1AA 2R7ZH 3H3VI 4LFBL 2JA5H 1SFOH 4AIMA 1HZAA 4DR2Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7Y A;  4JI2 L;  2HQL A;  4JG2 A;  4LF9 Q;  4QL5 A;  4A3K G;  3K8A A;  4BA1 I;  1L2F A;  1LUZ A;  3HKZ E;  1PH4 A;  1PH8 A;  1NMF A;  4A93 H;  3A5U A;  1AE3 A;  1VQ8 A;  1A0I A;  5JEA J;  1VQ4 A;  2ATW A;  1XJV A;  1YEZ A;  4DR3 L;  3RLF A;  4A3M H;  3S2H H;  2VQF Q;  4A4I A;  1JB7 A;  4KLK A;  2VS1 A;  3FHW A;  1J5E Q;  2ALY B;  1JJG A;  1VQD A;  1PH2 A;  2GVA A;  3GTG H;  3KDF A;  2WB1 G;  4AYB E;  4HJ8 A;  1CSP A;  4HJ7 A;  4DV4 L;  1HNW Q;  3K7U C;  3HKS A;  4ME3 A;  1LYL A;  2ZTD A;  2VQE Q;  4JYA L;  1G6P A;  2A8V A;  1HNX Q;  2IX1 A;  4QQB X;  1Y1W G;  4JI5 L;  1KAW A;  4YY3 Q;  4HID A;  1W3S A;  4LF6 L;  4B3T L;  2PI2 E;  5C3E G;  1N34 Q;  2Q2H A;  4DR6 L;  3S1M H;  1X56 A;  4YCU A;  2UXC Q;  2C35 B;  1WCM G;  2OQ0 A;  2YV5 A;  4DUZ L;  1N32 L;  5EAY A;  4FDB A;  3D31 A;  5C44 G;  3OTO Q;  4DV0 L;  3M4Q A;  2JA6 H;  4GKJ Q;  3JAM i;  2KBN A;  2JA7 G;  3I56 A;  3PO2 G;  1UE1 A;  3G4S A;  2UU9 L;  3CC4 A;  1HNZ Q;  1ASY A;  1G51 A;  1PH9 A;  2N49 A;  2K4K A;  4X65 Q;  2AMC B;  4X64 Q;  4LF5 Q;  4B3M L;  4JCV E;  5IWA Q;  4UP8 A;  3U50 C;  2ZM6 L;  1XPR A;  1PA6 A;  4JBK A;  1VQI A;  1MJC A;  1YZ6 A;  3MXN B;  4GNX C;  1IBM L;  2JA9 A;  4KHP Q;  5LMN L;  1CUK A;  1N8R C;  4A3B G;  2Z6K C;  5H1S E;  1VQF A;  1YBY A;  1VQN A;  2E2H H;  1K0R A;  5M3M H;  2XGT A;  4MTN A;  4NXN L;  4A3K H;  3I55 A;  4HJ5 A;  3AYH B;  3EN2 A;  4DV3 Q;  1XNR Q;  4A3L G;  5J3B A;  4Y7N H;  2RHS B;  4PG3 A;  3LGJ A;  1VCI A;  3KF8 B;  1L0W A;  1YJW A;  1EWI A;  1GVP A;  1PH5 A;  4DR7 L;  3KF6 B;  5C0X J;  4HIK A;  4BXX G;  2WAQ G;  3NEM A;  1Q1E A;  5E7N A;  3HOX G;  4JI4 Q;  1D8L A;  2QGQ A;  3EIV A;  3W5O A;  2R7Z G;  2EQS A;  4JV5 Q;  4POG A;  5JJI A;  4NXM L;  2JK8 A;  3CCV A;  4L5T A;  1Y1W H;  1XTD A;  4GOP A;  1R9T H;  5FLX c;  3PIP A;  3I4N H;  1A8V A;  1IBL Q;  1YVC A;  1I6H H;  4LFC Q;  4MNO A;  1XMQ L;  4JOI C;  3D0F A;  2MQH A;  3PUV A;  3KOJ A;  4X62 Q;  2BA0 A;  2PI2 A;  4A3M G;  4BY1 H;  3BJU A;  4OX9 L;  3VDY A;  1K8G A;  3CME A;  4IO9 A;  4OWX B;  3CPF A;  1M90 C;  4P71 A;  5C44 H;  2JE6 I;  4BY7 G;  1LM0 A;  4P74 A;  2K50 A;  4DV1 L;  2VW9 A;  3ER0 A;  4QJF A;  1XNQ L;  3CW2 C;  4X66 L;  3PO2 H;  5BR8 L;  3NEL A;  1BBW A;  2UUA Q;  4GKK Q;  4C3I H;  2I5H A;  1X3F A;  1UE7 A;  1QVG A;  1SLJ A;  1WI5 A;  1A62 A;  1Z47 A;  4DV6 Q;  3AFP A;  2UUB Q;  1EQR A;  2GVB A;  2Z0S A;  1Q46 A;  4IJH A;  3H15 A;  4DV5 L;  2IT1 A;  2ID0 A;  3PF4 A;  4LF4 L;  3F2C A;  2PQA B;  1N36 Q;  4A3B H;  3CP0 A;  1X6O A;  2F3I A;  3DM3 A;  5C4X H;  1UE5 A;  2HHH L;  1L1O B;  2CQO A;  3HFZ B;  1EQQ A;  1X3E A;  1KHI A;  1Q12 A;  4JI6 Q;  2BH8 A;  4YCV A;  2DGY A;  4DAY B;  2E5L Q;  1FJG Q;  3GD7 A;  3L7Z C;  3S2D H;  1IYJ B;  4BA2 I;  2JA6 G;  1S3O A;  3M4P A;  1PH6 A;  4EX5 A;  4JI0 Q;  4A3L H;  4A3E H;  1YNX A;  4B3S L;  2D0O A;  3AEV A;  3I4O A;  3K80 C;  2WFW A;  3CCQ A;  4DV2 Q;  4BY7 H;  5IE8 A;  1BVS A;  4DR5 Q;  3PUW A;  4LF7 Q;  1UWV A;  2K5H A;  2JJQ A;  5LMU Q;  4GLV B;  2KHI A;  1B8A A;  1D7Q A;  3HOX H;  2UUC Q;  4YCW A;  4A3I H;  1QZH A;  3GO5 A;  2KCM A;  5M3M G;  2JEB I;  3ERS X;  3HOW G;  4DR2 L;  4DV7 Q;  1H95 A;  4LUZ A;  3JC6 6;  4C2M H;  4LF9 L;  1VQG A;  2LSS A;  3RN5 A;  2NVQ H;  1HZB A;  3TEH B;  2LXJ A;  1X9N A;  3CCS A;  1Q8K A;  3PIO A;  3PO3 H;  4LFA Q;  3STB C;  1Q82 C;  1HZ9 A;  2UXB Q;  1K83 H;  3PF5 A;  5C0X I;  1CKN A;  1SMX A;  2VQF L;  3KYH C;  1HR0 Q;  2ZJQ A;  1EIY B;  2B3G A;  2ZJP A;  2OCE A;  1BBU A;  1JJC B;  1TWF H;  4AQY Q;  5LMN W;  3RZD H;  1J5E L;  1HR0 L;  5GQO A;  1VQL A;  4JI7 Q;  1N33 Q;  5M3F G;  1Q81 C;  1T9H A;  2YTV A;  4A3F G;  2JEA I;  4PZ6 A;  1HNW L;  1LTL A;  3CF5 A;  3E0E A;  1XMO Q;  1JJ2 A;  3GDE A;  3GTM H;  3UDX A;  4DNI A;  2VQE L;  1VQ5 A;  3TS2 A;  3M85 A;  3I4N G;  1MKH A;  1TWG H;  1UEB A;  1HNX L;  3A5Z B;  3PGZ A;  1QUQ A;  2B29 A;  4YY3 L;  1PYS B;  2HIX A;  4POF A;  1I94 Q;  4YHH Q;  3GTQ H;  1AE2 A;  3J81 i;  3GTP H;  1N34 L;  4BY1 G;  2IX0 A;  2UXC L;  1VQ7 A;  3W1G A;  4KI0 A;  4JI1 Q;  4XTC S;  1VQC A;  3HOV G;  3M3Y H;  4GNX A;  4A3C G;  3J80 c;  2NVT H;  2E2J H;  4IOA A;  4IFD J;  3ULJ A;  3OW2 A;  4O0A A;  3OTO L;  2Z6K A;  4DUY Q;  2MNA A;  1Q1B A;  4GKJ L;  3UE1 A;  1U5K A;  2K52 A;  4DUY L;  5IYD H;  3G48 A;  1AH9 A;  1QVF A;  1BKB A;  3M7N A;  1HNZ L;  4R4C A;  3FKI H;  3ULL A;  4X65 L;  1Q86 C;  2F4V Q;  4X64 L;  4LF5 L;  3J81 j;  5IWA L;  5AJ3 Q;  2UXD L;  1VQE A;  1PVO A;  1E24 A;  3H3V H;  2PQA A;  4KHP L;  4K0K Q;  1XPU A;  5C4X G;  2I5M X;  2RF4 A;  4JBW A;  3CCM A;  1HJP A;  4JI8 Q;  3RNU A;  1XPO A;  5ELO A;  3HOW H;  1C0A A;  4GN5 A;  2NVY H;  1PFS A;  4HIM A;  4LUV A;  1WJJ A;  3WWV A;  3A0J A;  2PMZ E;  5IT9 c;  4OWW B;  2UXD Q;  1OXV A;  4R4Q A;  4A3E G;  5M5W H;  4DV3 L;  1HH2 P;  1XNR L;  4IJL A;  4YWK A;  4B3R Q;  1L1O C;  4JOI A;  3K0X A;  1OXX K;  1SE8 A;  4GLX A;  2VUM G;  3GTL H;  2D62 A;  5GAE C;  3HOY G;  5M3F H;  1Y14 B;  4JI3 Q;  2JQO A;  4A3I G;  4JI4 L;  4A3F H;  4IPH A;  3CCL A;  4QIW E;  2RHQ B;  2BH2 A;  4JV5 L;  4TQU S;  2B63 G;  1TXY A;  4IOC A;  4OWT B;  4A3D G;  3JAM c;  1S72 A;  1K8A C;  4Y52 H;  1IBL L;  3M4O H;  3PO3 G;  4LW1 A;  4LFC L;  4P73 A;  2XTI A;  4GN3 B;  2I5L X;  4X62 L;  5GAH C;  2KHJ A;  1E1O A;  1TWA H;  3CXC A;  3HOV H;  4A3C H;  3KDF B;  3PSI A;  1YJ9 A;  4DR1 Q;  1P16 A;  3ULP A;  1IBK Q;  3KFU A;  3CCE A;  4MZ9 A;  1Y1V G;  1EYG A;  1NBW A;  2UUA L;  4QY7 A;  4GKK L;  4OXP A;  2QA4 A;  5ELN A;  3HKZ G;  3H0G G;  5DLQ E;  4DV6 L;  2I0Q A;  3CC2 A;  1X55 A;  2H5X A;  2UUB L;  2R7F A;  4O2D A;  3UDI A;  5IP7 H;  3I2Z A;  3S24 A;  1PHJ A;  2OTJ A;  4DK3 C;  4DPG A;  2N3S A;  3TRZ A;  1N36 L;  2Q2U A;  3K81 C;  2GN5 A;  5K36 G;  4NPS A;  1YIJ A;  1SRU A;  4TVA B;  1IXR A;  4BBS H;  5HY6 A;  4YWM A;  3UDF A;  3KJO A;  1WOC A;  4JI6 L;  4IFD I;  3FP9 A;  4L5Q A;  4AYB G;  1TWH H;  2QEX A;  2E5L L;  1FJG L;  3KLW A;  2N78 A;  2CKZ B;  3B6Y A;  4JI0 L;  4XIG S;  5IYD G;  4RMF A;  3T1Y Q;  2ZTE A;  1VQB A;  4QGU A;  1WFQ A;  2WP8 J;  3DLL A;  2R92 G;  1KQS A;  3FKI G;  4DV2 L;  4OO1 I;  2AWN A;  2K75 A;  5C4J H;  1VQO A;  1E7Z A;  1OXU A;  4JBJ A;  5IY0 A;  1FGU A;  4DR5 L;  1K73 C;  4LF7 L;  2VUM H;  5LMU L;  3HOY H;  3BU2 A;  2UUC L;  3U4Z A;  1MIU A;  1RL2 A;  2NN6 I;  3F2D A;  4R4O A;  1O7I A;  3U58 A;  3BZC A;  3PUX A;  1C9O A;  1PYB A;  3MEF A;  1B70 B;  1EOV A;  3I7F A;  4GLA C;  3STB D;  2B63 H;  4A3D H;  3CCU A;  4A3G H;  4DV7 L;  1CKO A;  1VS0 A;  2AWO A;  2OWO A;  3TS0 A;  3PUY A;  3T1H Q;  3E9H A;  4HJ9 A;  3AQQ A;  1KRT A;  2MO1 A;  4UY8 C;  4LFA L;  1I50 H;  3S1N H;  1JE5 A;  3T1H L;  2UXB L;  4LF8 Q;  5JJL A;  5C0X G;  3BZK A;  3J80 i;  3KF6 A;  3CPW A;  2BA1 A;  2Q2T A;  2D0P A;  5GAG C;  1OTC A;  4DR4 Q;  4LFB Q;  1V1Q A;  3CQZ H;  4JI7 L;  4AQY L;  4JI2 Q;  4A76 A;  5FJ8 G;  4BBR G;  1Z9F A;  1Y1V H;  3GTO H;  1I3Q H;  5JJK A;  2NZO A;  1N33 L;  4GOP B;  1U0L A;  2IHF A;  5IYB G;  4X6A H;  1VQJ A;  2JA8 H;  1KXL A;  3CAM A;  5HGQ A;  4EQ5 A;  3H0G H;  1XMO L;  4DR3 Q;  1IZ6 A;  3I4M G;  4IPG A;  3GTK H;  5IYC G;  1CKM A;  1MJE A;  1EFW A;  2YTY A;  1VQP A;  1K9M C;  1I94 L;  4YHH L;  2E8G A;  2CWA A;  3IRB A;  2NVX H;  3HOU H;  4DKA C;  1S40 A;  3RLO A;  3RZO H;  4JI1 L;  2R7D A;  4DV4 Q;  3CCJ A;  1SRO A;  4KHZ A;  3TQY A;  5FLM G;  4JYA Q;  2EIF A;  2YYZ A;  4LUO A;  3L2P A;  1KD1 C;  2Y0S E;  4PZ8 A;  1ASZ A;  4JI5 Q;  5M5Y H;  4LF6 Q;  2R93 G;  3CC7 A;  4B3T Q;  2R92 H;  3S17 H;  1A63 A;  3G6E A;  4DR6 Q;  1FVI A;  1G29 1;  3HOZ H;  1X65 A;  2F4V L;  5GAD C;  1YHB A;  4DUZ Q;  5IP7 G;  1Q7Y C;  3ZJY C;  1VQM A;  1N32 Q;  4C3H H;  5AJ3 L;  3A74 A;  4H02 A;  4DV0 Q;  4BBS G;  4GN4 B;  4K0K L;  3S14 H;  1JT8 A;  1L1O A;  4J15 A;  3G71 A;  2CCZ A;  4JI8 L;  3RR5 A;  1NY4 A;  4R1J A;  1YJN A;  1K3R A;  1VQ6 A;  2UU9 Q;  4APV A;  1SR3 A;  1GD7 A;  2CWP A;  3NEN A;  4DAM A;  4A75 A;  1OXS C;  1KIX A;  1GM5 A;  5IP9 H;  4R4I A;  2L15 A;  4UP9 A;  4B3M Q;  2IHE A;  2ZM6 Q;  3PV0 A;  4AH6 A;  2VL6 A;  3RLN A;  1B7Y B;  1IBM Q;  1SN8 A;  5LMN Q;  3S1Q H;  1NE3 A;  1NJI C;  2N8N A;  2WB1 E;  1W2B A;  4B3R L;  3J81 c;  3NBH B;  3TRE A;  4A3J G;  5FJ8 H;  4BBR H;  3W1B A;  3RN2 A;  1E1T A;  4NXN Q;  3Q8D A;  4JI3 L;  5IYB H;  2HIV A;  2OQK A;  1I5F A;  1GKH A;  2F52 A;  1YI2 A;  4P72 A;  2DUD A;  4HJA A;  4A3G G;  3AFQ A;  3I4M H;  3F2B A;  1PH3 A;  5JEA G;  3GTJ H;  2KEN A;  5IYC H;  3CMA A;  1YHQ A;  2KCT A;  1IL2 A;  1X54 A;  4DR7 Q;  1NMG A;  2NZH A;  1WYD A;  1CKN B;  2K14 A;  1V43 A;  3ICE A;  4PZ7 A;  1KRS A;  1P8L A;  2PNH A;  5M5X H;  2VZA A;  4UP7 A;  3CD6 A;  1PV4 A;  5FLM H;  1UE6 A;  1YIT A;  4L5S A;  4NXM Q;  3PCO B;  2ASB A;  2Q2I A;  3S1R H;  2JA5 G;  4DR1 L;  1EIF A;  4WJ3 M;  1CSQ A;  1V9P A;  1VQH A;  4DK6 C;  3UDG A;  1IBK L;  2R93 H;  1NTG A;  2YU9 H;  2JA8 G;  2ES2 A;  2R6G A;  1XMQ Q;  1QUQ B;  1J6Q A;  3K7A H;  1PH1 A;  3UE0 A;  5C3E H;  4A93 G;  2AKW B;  3CCR A;  3L0O A;  4P75 A;  4R4T A;  2ZJR A;  4NB3 A;  2K5V A;  4OX9 Q;  1RIP A;  1HZC A;  1WCM H;  1YHA A;  1EUJ A;  3U4V A;  4GNX B;  3S16 H;  3HOU G;  2EXD A;  4DV1 Q;  1VQ9 A;  1XNQ Q;  1JMC A;  2RCN A;  4C3J H;  1FL0 A;  4X66 Q;  5BR8 Q;  4GOP C;  5GRO A;  1HR0 W;  4RG1 A;  4IFD G;  3J7Z C;  4IPC A;  2JA7 H;  2ZTC A;  4JC0 A;  4YWL A;  2A19 A;  4UPA A;  2LXK A;  2YTX A;  3F8T A;  4LWC A;  3OYY A;  4DV5 Q;  3T1Y L;  1KC8 C;  4LF4 Q;  3S15 H;  3E9I A;  3KJP A;  1VQK A;  2HT1 A;  4OO1 G;  3HOZ G;  2WAQ E;  4PMW A;  3J7A 5;  2HHH Q;  3EBE A;  4GS3 A;  2IY5 B;  3M9B A;  1M1K C;  2MO0 A;  1X3G A;  4A3J H;  2NN6 G;  3F1Z A;  2FXQ A;  4IPD A;  3SGI A;  4JBM A;  1N9W A;  4WJ4 A;  4HIO A;  4L5R C;  4ALP A;  2K5N A;  1E3P A;  1QVC A;  1QZG A;  4OON A;  4B3S Q;  1E22 A;  2AHO B;  2VNU D;  5IP9 G;  2Y0S G;  4LNQ A;  2CFM A;  2MFI A;  3PUZ A;  4BXX H;  1DGS A;  2VY3 A;  1KL9 A;  2E2I H;  1TWC H;  1PH7 A;  1OXT A;  1VQA A;  4LF8 L;  1GO3 E;  2OTL A;  2V1C C;  4DR4 L;  2A1A A;  2R7Z H;  3H3V I;  4LFB L;  2JA5 H;  1SFO H;  4AIM A;  1HZA A;  4DR2 Q; 
#chains in the Genus database with same CATH topology
 1C7Y A;  4LSA A;  4IAL A;  2R3Z A;  2R8K A;  1EEI D;  1BXT A;  3K8A A;  4BA1 I;  1KJ9 A;  2R92 B;  3QZ7 A;  1AE3 A;  1EY8 A;  1A0I A;  3HOZ B;  1I7N A;  1VQ4 A;  3S2H H;  5HGT A;  5ISR A;  3RGZ A;  4RHS A;  3FHW A;  3Q8Q B;  2EXZ A;  1JJG A;  1PH2 A;  3BG5 A;  1HA6 A;  4HJ8 A;  1CSP A;  3MWE A;  5CAE B;  4JYA L;  4M8A A;  1JIH A;  5M5W B;  2IX1 A;  4JI5 L;  1KAW A;  2IMW P;  5FO9 B;  5DQG A;  1STH A;  4B3T L;  2PI2 E;  4QCL A;  4RWS C;  1AZQ A;  5E1F A;  2HCC A;  2V4R A;  2SNM A;  2TMP A;  4BBR B;  3OIQ A;  1N32 L;  1STG A;  2FLN A;  1DD2 A;  2F4I A;  4FDB A;  3D31 A;  4RGT A;  5C44 G;  3OTO Q;  3M4Q A;  1IBL H;  2HVR A;  4O3R A;  2RDI A;  2L1B A;  5KFJ A;  4LFC H;  3V4Z A;  2YZM A;  2JA7 G;  2DJG C;  3G4S A;  4X62 H;  2UU9 L;  1ASY A;  2K4K A;  2HUG A;  2LS0 1;  4LF5 Q;  2ZM6 L;  4UP8 A;  1XPR A;  4M9U A;  1MJC A;  1GOZ A;  2WE6 A;  1N8R C;  2QYZ A;  2Z6K C;  4IN3 A;  1GUW A;  1WSC A;  2UUA H;  1YBY A;  2ZT9 C;  3TP7 A;  2RCF A;  5KT6 A;  1K1Q A;  5M3M H;  4MTN A;  4NXN L;  3I55 A;  1E0B A;  3TIN A;  1RK5 A;  3SDZ A;  4DV3 Q;  4Y7N H;  5EWF A;  3LGJ A;  4P2C B;  5KEE A;  3HKZ A;  3KF8 B;  1L0W A;  4J9K A;  4C5C A;  1N48 A;  1YJW A;  4DR7 L;  2SOB A;  3A55 A;  1E2W A;  1FJG H;  2E5L H;  2WAQ G;  3NEM A;  1Q1E A;  1C48 A;  1JWU D;  3QFF A;  4JI4 Q;  4R8U A;  3G6X A;  2R7Z G;  4WJW A;  2JA6 A;  4AYB A;  5BPF A;  4NXM L;  4J9R A;  4DV2 H;  3CCV A;  4QWC A;  2R8G A;  1XTD A;  3I4N H;  5KFY A;  1YVC A;  4KJO A;  1I6H H;  5L1K A;  1XMQ L;  3N6R A;  4EGJ A;  3PUV A;  5JPM C;  3CME A;  2R85 A;  4P71 A;  1RYR A;  2NTT A;  5IGD A;  3H09 A;  1XNQ L;  4X66 L;  1BF4 A;  4LFA H;  1LO5 D;  1LV9 A;  4GKK Q;  4IUR A;  1BDO A;  1I4R A;  3NHH A;  2GVB A;  2L4N A;  4LFB H;  1N36 Q;  4EQN A;  4FVM A;  1ENF A;  1H9S A;  2CQO A;  1EQQ A;  2VPS A;  2UVR A;  4YJ2 F;  1X3E A;  1I3Q B;  1EYZ A;  5CV4 A;  4YCV A;  4FXD A;  3GD7 A;  2W7O A;  2O5I C;  5TSS A;  3TBI B;  1I94 H;  5FO8 B;  4FYD A;  3MFG A;  1D2B A;  3AEV A;  3NTK A;  1I4Q A;  3S2H B;  4DR5 Q;  4LF7 Q;  1UWV A;  1B8A A;  5JUM A;  2RSN A;  4XXE A;  1EZ6 A;  2R7M A;  2MGS A;  4YCW A;  5EKI A;  5ELF A;  3MR3 A;  5FKA C;  1QZH A;  3BG3 A;  3IL8 A;  3NBH A;  4XDX A;  4WD3 A;  2A6E C;  4MIU A;  2JEB I;  5JVD F;  4DR2 L;  1H95 A;  3U9T A;  4LF9 L;  5ELC A;  2NVQ H;  1HZB A;  2LXJ A;  3GID A;  3PIO A;  3V6K A;  1Q82 C;  1T3N A;  3PF5 A;  2AUK A;  2J6T A;  4IZ8 A;  5KFC A;  4JI8 H;  3KYH C;  1MZB A;  1PMR A;  1J5E L;  1VQL A;  5I2Y A;  4JI7 Q;  1GSH A;  3GII A;  1TS3 A;  1RJQ A;  1SSO A;  2LY7 A;  5M3F G;  2UVW A;  2YTV A;  4A3F G;  1HNW L;  4KMU C;  1CQI B;  3N6X A;  3V05 A;  3GIK A;  1VQ5 A;  3RGX A;  5LMN H;  2NZ1 D;  1JWS D;  3BDO A;  1HNX L;  1WVL A;  3GIM A;  1RTN A;  4YY3 L;  4POF A;  1AE2 A;  3J81 i;  3C2P A;  4R7R A;  2IX0 A;  2UXC L;  1VQ7 A;  3W1G A;  1M8A A;  2EY6 A;  5KG6 A;  4GNX A;  1RJR A;  2W70 A;  3I12 A;  4WRD A;  3A7A B;  4O4L F;  2EYJ A;  4K8J A;  5CV6 A;  2LMC B;  1Q1B A;  4ECT A;  4C3I G;  1AH9 A;  1QVF A;  3M7N A;  4R4C A;  3BYT B;  1B6R A;  1K83 A;  4X64 L;  2UXD L;  5CGK A;  1VQE A;  4DR1 H;  2RDG A;  2Z4H A;  1GGO A;  2WB1 B;  2PQA A;  3GV3 A;  4K0K Q;  1XPU A;  1TWF A;  1CK1 A;  4ZLT F;  3CCM A;  3ORR A;  5ELO A;  2DPI A;  3HOW H;  1X3P A;  1DV1 A;  3L9A X;  2Z8L A;  5HUR A;  4J9P A;  3SHL A;  5JAV A;  4HQ6 A;  2QW7 A;  3GTQ A;  2FMM A;  1WCM B;  4YWK A;  3T5H A;  4C1N I;  2DNC A;  1OXX K;  1SE8 A;  2VUM G;  5DLF A;  4A2A A;  1A2T A;  2BQU A;  5KFO A;  1Y14 B;  2JQO A;  5KG2 A;  3G6Y A;  3MA2 B;  4FS2 A;  3T1Y H;  2I87 A;  4JV5 L;  2B63 G;  5LP6 F;  4GZY C;  1W96 A;  3LP8 A;  1S72 A;  5NUC A;  2FMA A;  1L2Z A;  4QWE A;  1EYD A;  3DWA A;  3E0J A;  2HDM A;  3GIQ A;  3IKJ A;  5KFK A;  1D5Z C;  2B39 A;  1S5D D;  4IR9 A;  4A3C H;  4KHV A;  4MV4 A;  4DL4 A;  2YRX A;  2EDG A;  1IBK Q;  4IRC A;  1EYG A;  5D1P A;  1Y1V G;  3HRZ C;  3MJF A;  1LTS D;  4QY7 A;  4OXP A;  1WTO A;  5DLQ E;  3H0G G;  4F87 A;  4DV6 L;  2I0Q A;  1X55 A;  3GQB A;  3M9O B;  3I2Z A;  2EY1 A;  2N3S A;  5IT9 E;  4H0L C;  4TVA B;  3UDF A;  1HPC A;  1U4M A;  3CU7 A;  2QEX A;  3J7A F;  4ED2 A;  1PFM A;  3HXL A;  2N78 A;  5D3I B;  2C2R A;  2NVQ B;  5KFP A;  2CKZ B;  3B6Y A;  3N40 P;  2PMZ A;  4RMF A;  4UCU A;  1WFQ A;  4OO1 I;  3FKI G;  3Q8P B;  3T53 B;  5BN4 A;  1VMP A;  3MXN A;  4L6T B;  4PDB A;  2UUC L;  4FXK C;  1AN8 A;  2EPB A;  4R4O A;  3F2D A;  3NSW A;  1KDB A;  1PYB A;  1B70 B;  1CA6 A;  4DR6 H;  5M9O A;  5EPJ A;  4QIW A;  4I4T F;  3HKZ B;  1LTR D;  1VS0 A;  2YU9 A;  2AWO A;  5L37 A;  4F50 A;  3E9H A;  3DEO A;  2W6Q A;  1WR2 A;  2E2D C;  5EOY A;  5KFN A;  3BZK A;  3J80 i;  1SYF A;  4R8U B;  2D0P A;  3Q23 A;  2B2Y A;  4K2L A;  2JA6 B;  4ME5 A;  4AYB B;  4AQY L;  1FNW A;  4B3M H;  1N33 L;  2NBF A;  3N8D A;  1U0L A;  4X6A H;  4YAJ B;  4I55 F;  1KXL A;  3CAM A;  2K32 A;  2P5Z X;  4O42 A;  1XMO L;  4IPG A;  4O2A F;  2FK2 A;  2EVB A;  4YHH L;  2E8G A;  2CWA A;  1HUM A;  3IRB A;  4Q8F A;  3HOU H;  1S40 A;  4KK7 A;  3H40 A;  3VR3 A;  3T5J A;  3RZO H;  3OSP A;  4JI1 L;  2V58 A;  3HOW B;  3T5K A;  3TQY A;  4JYA Q;  1TY0 A;  4X3T A;  1HTL D;  2YYZ A;  1KD1 C;  1ASZ A;  4JI5 Q;  4IUQ A;  4B3T Q;  3S17 H;  3MFY A;  3TIG A;  3SE7 A;  3FMC A;  2JEF A;  4G4K A;  5KG3 A;  2NYZ D;  2GA4 B;  4HED A;  1YHB A;  5IP7 G;  1H9S B;  1N32 Q;  3I72 A;  4I7Z C;  4WFN 3;  4BBS G;  4GN4 B;  2R7Z A;  2WKD A;  1L1O A;  4J15 A;  3G71 A;  2CCZ A;  4O4H F;  3RR5 A;  2VA2 A;  4F7X A;  2UU9 Q;  1SYD A;  1SR3 A;  1OXS C;  5COY A;  5IP9 H;  2NTS A;  4UP9 A;  3TN2 A;  2IHE A;  2ZM6 Q;  1Z2O X;  1PRT F;  1B7Y B;  3K6O A;  4BY1 B;  1S03 G;  4HSV A;  3F8N A;  1NJI C;  4L8J A;  3OUU A;  1W2B A;  2KSW A;  1LTG D;  4U7C A;  3EYY A;  1AFP A;  3NBH B;  3TRE A;  2GPW A;  5FJ8 H;  3PR4 A;  3GTG A;  1JE4 A;  3W1B A;  1LTA D;  1VMC A;  3SK4 A;  4NXN Q;  1CQJ B;  4JI3 L;  3RB3 A;  2HIV A;  5KG1 A;  1DOL A;  5DM7 3;  4DV5 H;  2ALZ A;  4M7E A;  1O80 A;  2PYK A;  2V4Q A;  2FP4 B;  1K1S A;  2OF1 A;  1N36 H;  3F2B A;  1PH3 A;  2XIW A;  5IYC H;  2F0H A;  3CMA A;  2E75 C;  2P0A A;  4DR7 Q;  1LT6 D;  1EZ1 A;  3BA8 A;  1KRS A;  1P8L A;  2PNH A;  5M5X H;  3PVX A;  2VZA A;  3JZI A;  3OHB A;  1PFN A;  4IHJ F;  1PTO F;  1G8Z D;  5FLM H;  4XYL B;  4NXM Q;  4ZI7 F;  2H4O A;  3MR2 A;  2Q2I A;  4NMZ A;  3S1R H;  2JA5 G;  1GUT A;  2VOB A;  5G3L D;  1SE2 A;  2B2T A;  1CSQ A;  1VQH A;  4K5X A;  1FR3 A;  4FF2 A;  1NTG A;  2YU9 H;  2R6G A;  1XMQ Q;  1J6Q A;  3K7A H;  4CBV A;  3UE0 A;  3MC0 B;  4A93 G;  3GQC A;  4EBE A;  1GUN A;  4MV8 A;  3PZP A;  1S5C D;  1HZC A;  4ZOL F;  5KX5 F;  4GNX B;  1F2Z A;  2M2L A;  1XNQ Q;  3BA9 A;  4C3J H;  4X66 Q;  1BO0 A;  4Q5V A;  1HR0 W;  3OSO A;  5GRO A;  3J7Z C;  2JA7 H;  2ZTC A;  2R8I A;  4JC0 A;  4YWL A;  1PRT B;  2VQF H;  4UPA A;  1K83 B;  3TP6 A;  3J81 E;  3F8T A;  1BR9 A;  3OYY A;  4OO1 G;  5IGB A;  3KJP A;  3H3V C;  4FO2 A;  4JI7 H;  2WAQ E;  1STY A;  1WTX A;  1G91 A;  2W6O A;  3PW5 A;  1F9R A;  5CA0 F;  4GS3 A;  1TWF B;  1X3G A;  4A3J H;  1XYI A;  1VKZ A;  3P1H A;  1N9W A;  3KLS A;  4HIO A;  1ENC A;  2LFN A;  3JRX A;  5L1J A;  1EQT A;  3HP3 A;  3GTM B;  4YIJ A;  4ECU A;  2AHO B;  3OWE B;  2NUC A;  1YNN C;  1FD7 D;  3RB0 A;  1Y1W A;  3GTQ B;  2Y0S G;  5DGB A;  1SMY D;  2CFM A;  3PUZ A;  1DGS A;  1MI2 A;  1KL9 A;  2VY3 A;  2PW7 A;  5EKK A;  3PW2 A;  3VR2 A;  1HQM C;  4CC6 A;  2PO4 A;  1SND A;  2DY7 A;  3QOJ A;  3RZO B;  2NVT B;  1SMY C;  3KBX A;  3H3V I;  2R7Z H;  1GJX A;  1MGS A;  2SNS A;  1QIL A;  3A7L A;  1IOW A;  4IZO A;  4AIM A;  4OHJ A;  1HNZ H;  4DR2 Q;  4JG2 A;  4LF9 Q;  5KNC A;  3HZX A;  5E3F A;  5CMD A;  1KJQ A;  1L2F A;  5IWA H;  5IGC A;  1WTQ A;  4KHP H;  2ATW A;  3A8J E;  4K0K H;  3RLF A;  3J7Y W;  2VS1 A;  1J5E Q;  1PK8 A;  1DYQ A;  3GTG H;  1J8I A;  1EY0 A;  1SYG A;  2OT2 A;  2NVY B;  1HNW Q;  3HKS A;  4KY7 A;  1JCK B;  4ME3 A;  2FPI B;  4JVZ A;  2L55 A;  5I2X A;  1G6P A;  4RZR A;  3AMU A;  2A8V A;  4DAP A;  1HNX Q;  1H9M A;  4DL2 A;  4YY3 Q;  3Q0A A;  1W3S A;  4LF6 L;  1L0X B;  2W8K A;  4YCU A;  2UXC Q;  2C9O A;  2C35 B;  2YV5 A;  2HCI A;  1X3Q A;  4K6D A;  2R87 A;  2BE5 D;  2QDL A;  3IFD A;  1ILQ A;  3CVZ A;  1SFO A;  5BMV F;  2KCN A;  2W71 A;  1UE1 A;  1SCU B;  5EQ0 A;  2W6Z A;  1G51 A;  3LX0 A;  2EJG C;  4EQP A;  4X64 Q;  1JKJ B;  3T5L A;  4JCV E;  4KJN A;  2UXD Q;  1QOH A;  2QKI C;  5A2Q L;  1YZ6 A;  3MXN B;  1IBM L;  2JA9 A;  3DWP A;  2KCC A;  4XT3 B;  3CHB D;  3DHQ A;  5M5X B;  2DPJ A;  4A3B G;  1I6V C;  5IOC A;  1VQN A;  2XN9 C;  4HNV A;  1SNM A;  4QIW B;  4A3K H;  1T5X D;  3BDC A;  4KN4 C;  3AYH B;  2YU9 B;  2W57 A;  3K7A B;  5CV5 A;  2R86 A;  3D4R A;  4PG3 A;  1GHK A;  1GXD C;  2RQX A;  1GVP A;  5C0X J;  4HIK A;  2AQ3 B;  4N9T A;  2R84 A;  5E7N A;  5C3W A;  4ED1 A;  4C3J B;  1IKL A;  4JI0 H;  4YR3 A;  1D8L A;  2QGQ A;  2DZD A;  1O7L A;  3VR5 A;  4JV5 Q;  4POG A;  4IRK A;  5C8Y F;  2JEG A;  1S10 A;  2JK8 A;  3KHL A;  1SAP A;  1Y1W H;  2IP4 A;  4GOP A;  1BXR A;  1B3Q A;  3PIP A;  2CH4 W;  5LMU H;  1ZHS A;  3M4I A;  4FF1 A;  3C0F B;  4JOI C;  5C4J B;  1O7Y A;  1TQO A;  3DUZ A;  2MQH A;  2WTF A;  1CQF A;  4RGN A;  3K5O A;  2XC9 A;  2PI2 A;  4A3M G;  5JQW A;  3QIA A;  3BJU A;  4A3J B;  4YQW A;  3VDY A;  4J9M A;  3CPF A;  2MHV A;  1M90 C;  5KT5 A;  1DJR D;  3I8Z A;  4DV1 L;  2VW9 A;  3ER0 A;  3UI2 A;  2FLP A;  2D2C C;  1W6J A;  3CW2 C;  3PO2 H;  4RAZ A;  5EZY F;  4A3G B;  4UCV A;  4C3I H;  1BUV T;  4MA0 A;  4UFZ A;  1X3F A;  1UE7 A;  2E74 C;  1WI5 A;  4DV6 Q;  3S1N B;  5DM6 3;  4N9P A;  3KHH A;  1ML0 D;  3PF4 A;  4ZKC B;  4LF4 L;  5KFI A;  2IA6 A;  1T94 A;  3CP0 A;  2F3I A;  3DM3 A;  3TQ1 A;  1UE5 A;  2XRS D;  1TY2 A;  4YAK B;  2R7Z B;  1L1O B;  1TS4 A;  1TT2 A;  1D6E C;  3C1F A;  1Q12 A;  1DM0 B;  2Z1C A;  3PMF A;  4J9N A;  3J7A V;  3S2D H;  1J9O A;  4G3I A;  3URY A;  4A3L H;  4XYQ A;  5KFX A;  2F3V A;  4K5W A;  4B3S L;  5F9N A;  2X6L A;  3EQL C;  3CCQ A;  3E6Z X;  1BVS A;  1EUC B;  1WTP A;  4OGQ C;  2JJQ A;  2IW3 A;  1D7Q A;  3HOX H;  2UUC Q;  2F0E A;  3GTG B;  1II3 A;  4JYA H;  1A3T A;  2K6A A;  1FGB D;  3GO5 A;  2KCM A;  4M1U B;  3VR6 A;  5C1P A;  2EY2 A;  2F0P A;  1DOK A;  1KAB A;  4HYK A;  3RTX A;  5KFV A;  2I46 A;  3I70 A;  1NUC A;  3STB C;  4Y8V B;  5JVH 3;  1N32 H;  4U6P A;  4G7Z C;  1HR0 Q;  1SMX A;  4JPB W;  5A2Q W;  2L9H A;  5KFA A;  2FHT A;  4BY7 H;  4CC5 A;  4DL5 A;  1BBU A;  4AQY Q;  5KG7 A;  5GQO A;  3CKI B;  2KA7 A;  1N33 Q;  2A5H A;  4PZ6 A;  2ZM6 H;  1LTL A;  1XMO Q;  1BCP B;  2HQE A;  3TS2 A;  4HN7 A;  3M85 A;  4MA5 A;  2SCU B;  4B3R H;  3PGZ A;  4RB2 C;  1PYS B;  2HIX A;  4YHH Q;  1KJ8 A;  3K5I A;  1N34 L;  4K2K A;  2BDN A;  5H80 A;  4JI1 Q;  2K5Q A;  3RJ0 A;  3HOV G;  3J80 c;  4DXF A;  2E2J H;  2NU8 B;  4A3K B;  4IOA A;  4IFD J;  4UCS A;  3ULJ A;  3VYT A;  4O0A A;  4DN4 M;  4BWG B;  3OW2 A;  3G8C A;  2KVM A;  5T14 A;  4MTD A;  2W9C A;  4A2B A;  4GKJ L;  2L11 A;  4DR7 H;  1U5K A;  4DUY L;  5CC4 A;  1QG7 A;  3D8G A;  3JAM L;  3FKI H;  4BWS C;  2C5C A;  2AQ4 A;  4GKJ H;  2Z6B A;  1I50 A;  1PVO A;  4ECS A;  1E24 A;  1M4V A;  3BQ0 A;  1TVX A;  4NXM H;  5C4X G;  1XPO A;  4H13 C;  4JBW A;  2HD3 A;  1HJP A;  5BN5 A;  3CQZ A;  2IPK D;  5JVL A;  2DIK A;  2VPQ A;  4Q8E A;  2R7K A;  1Y1W B;  1WJJ A;  5C3E B;  4R4Q A;  4ECX A;  1XNR L;  2Z4I A;  1S0O A;  1O78 A;  4FXG C;  2VR1 A;  4GLX A;  3K0X A;  4H7B A;  3QR8 A;  5KFM A;  4Q0Y A;  3BQ2 A;  1H9J A;  1F77 A;  5K5P A;  5GAE C;  3HOY G;  2KHS A;  4JI3 Q;  4A3I G;  3PO2 B;  2CQY A;  5KYI A;  4IUP A;  4C3I B;  5FPR A;  4O3P A;  4EGV A;  3K5L A;  4A3D G;  2CW7 A;  3JAM c;  1K8A C;  4EVO A;  1IBL L;  3KAL A;  4DXG A;  2G9D A;  4LFC L;  1RK6 A;  2XTI A;  4GN3 B;  4NW2 A;  5KFU A;  2I5L X;  2ASD A;  4X62 L;  2KHJ A;  3H94 A;  4UCR A;  1TWA H;  3T56 B;  2RKS A;  1F2L A;  3PSI A;  2K05 A;  2CW8 A;  5C5J A;  3J80 W;  4MTK A;  4MZ9 A;  5CV9 A;  2VB2 X;  5JOB A;  4TV9 F;  4FNF A;  2UUA L;  3R5F A;  4LF8 H;  2IWH A;  4DA2 A;  4EEY A;  3Q2O A;  4ECW A;  4DR4 H;  2UUB L;  3MWD A;  3JSN A;  2R7F A;  2OTJ A;  5IP7 H;  1PHJ A;  3HOX B;  4TKO B;  4JI2 H;  1SYE A;  2FK1 A;  1AEX A;  2X6G A;  3VYR A;  1W93 A;  4BBS H;  1SFO B;  3PW4 A;  4JI6 L;  3Q24 A;  4FF3 A;  1FJG L;  2E5L L;  4DR3 H;  3KLW A;  2PZT A;  2B2V A;  3OIP A;  1A3U A;  5KNB A;  3RBE A;  2AGQ A;  1B3A A;  5IYD G;  5KG0 A;  2F0O A;  4QGU A;  3GTJ A;  2R92 G;  1T5E A;  1LT5 D;  4DV2 L;  5EPL A;  1VQO A;  3EPG A;  1OXU A;  2A6E D;  5IY0 A;  4BY7 B;  4S3S A;  3L4K A;  1HCZ A;  2CZG A;  1O7I A;  1AP0 A;  1GSA A;  3MTS A;  3NE5 B;  1ZEQ X;  5EDW A;  4F4Z A;  3QO2 A;  2HVQ A;  3MEF A;  4IUT A;  1EOV A;  2E76 C;  3I7F A;  1TAE A;  3CCU A;  3BDL A;  1NCV A;  2R93 A;  1CKO A;  3A8K E;  3G7L A;  2UXC H;  4CKB A;  2RDH A;  2JYO A;  3T1H Q;  4ECQ A;  4HJ9 A;  3K58 A;  2MO1 A;  2MUY A;  1I50 H;  4LFA L;  3JAM W;  1JE5 A;  1IL8 A;  1D5X C;  4DV0 H;  1M0T A;  2QEJ C;  1BNC A;  4DL7 A;  2E2J B;  5IGE A;  3X3M A;  3CQZ H;  4A76 A;  4LAA A;  1Z9F A;  4BBR G;  2FIN B;  2W8L A;  4GOP B;  2IHF A;  1H9K A;  5IYB G;  2RVL A;  1VQJ A;  2BR0 A;  1QB5 D;  1QNK A;  1KAA A;  3ND8 A;  4EQ5 A;  5HGQ A;  1U4R A;  3KAJ A;  1MJE A;  1EFW A;  1I94 L;  1JLL B;  2EYP A;  1ROD A;  1SNQ A;  5M3M B;  2MPM A;  1E2Z A;  4RB0 A;  1HHV A;  4Q45 A;  1SRO A;  2GPS A;  4KHZ A;  1B9M A;  3OUZ A;  2Y0S E;  4Y7N B;  2R8H A;  3OMG A;  1GYF A;  4LF6 Q;  1MBY A;  1CQV A;  2K5W A;  2F4V L;  5GAD C;  5BN3 A;  3IFT A;  1U4P A;  5J1Z A;  1VQM A;  1EYA A;  4C3H H;  1TWC A;  4JV5 H;  1IHZ A;  3MVV A;  2VUG A;  1R4P B;  3R2I A;  4H02 A;  1JOR A;  1Q8I A;  4PV1 C;  3TP8 A;  1GSO A;  4JI8 L;  1VQ6 A;  1NY4 A;  3D4W A;  1K3R A;  4DAY A;  1KTK A;  3I4N B;  1GD7 A;  1G2T A;  2JP1 A;  1PZI D;  1I6H B;  1Y8N B;  3D6W A;  1IYV A;  2L0C A;  3PV0 A;  2VL6 A;  2CW0 D;  3A54 A;  3RLN A;  2W9B A;  4O4I F;  1IBM Q;  5C0X H;  2CVR A;  3QWN A;  1ZET A;  5JJZ A;  1EFI D;  4HTH A;  5BR8 H;  1ENA A;  1XXG A;  2CW0 C;  3PW0 A;  3RN2 A;  3QOL A;  1EY9 A;  2ZXP A;  1A2U A;  2F52 A;  1JR0 D;  4GC6 A;  4P72 A;  2DUD A;  4HJA A;  3AFQ A;  3I4M H;  4J9L A;  2HHH H;  1JQY D;  1VAJ A;  3GTJ H;  1YHQ A;  2PVP A;  1WYD A;  1JOO A;  3ICE A;  1K0S A;  1NAP A;  4O3O A;  1SNP A;  2G5D A;  4BBS B;  1ILP A;  1RCV D;  4ME6 A;  1F2Y A;  4UP7 A;  3IG0 A;  1ZYR D;  3CD6 A;  3RMH A;  1PV4 A;  4RKL A;  3PCO B;  5C5L A;  4TUY F;  4DR1 L;  2F0I A;  3NUC A;  1V9P A;  5T1I A;  3UDG A;  3V4S A;  1ZYR C;  4HMI A;  2R93 H;  3ETJ A;  3RAX A;  5CYU A;  2ES2 A;  2UUC H;  3CCR A;  1Z6H A;  3L0O A;  1VBG A;  4P75 A;  3LWE A;  2ZJR A;  4NB3 A;  1F9P A;  2ZJT A;  4UCO A;  4H44 C;  1CT1 D;  2AQ1 B;  1EUJ A;  3W2D A;  5A35 A;  3U4V A;  3V6J A;  1TR5 A;  2EXD A;  4V0B A;  4DV1 Q;  2V9W A;  1U4L A;  4J1M A;  2W9C B;  3C46 A;  3RFC A;  4ID6 A;  2E2H A;  3Q6S A;  4IPC A;  3BAB A;  5I9P A;  4FP5 D;  1ESR A;  1HQR D;  3TME A;  1HXY D;  1B9N A;  2WYO A;  2C22 A;  2A19 A;  4RB3 C;  2LXK A;  1HR0 H;  3S15 H;  3T1Y L;  2PQE A;  1I50 B;  4LF4 Q;  1JX4 A;  2VA3 A;  1MD2 D;  3FEW X;  3KBG A;  1V51 A;  5HBR B;  2IY5 B;  3M9B A;  3GV7 B;  1F2M A;  4ETS A;  3NGD A;  3H4B A;  1SBB B;  3SGI A;  4JBM A;  1XMO H;  5EWG A;  2MCT A;  3T16 A;  3VPD A;  1E3P A;  3BYY B;  4OON A;  4KTA A;  4B3S Q;  3RB4 A;  1E22 A;  2RA4 A;  2XSC A;  4YHH H;  3M9N B;  4XZ3 B;  2WKC A;  1PZJ D;  3NBI A;  5KT7 A;  1SYB A;  4QB4 A;  2TSS A;  2MFI A;  2YL2 A;  4CGY B;  1TWC H;  4F8M A;  3OTO H;  3KHG A;  4KY5 A;  2F0N A;  3SE0 A;  1VF7 A;  1GO3 E;  2OTL A;  2V1C C;  1PX2 A;  5L9X A;  2A1A A;  2A73 B;  5KFW A;  1HZA A;  3IN5 A;  2FFK B;  2JA7 A;  2HQL A;  3PIO 3;  1EY4 A;  4QL5 A;  4LF5 H;  2EYH A;  3L3O C;  1PH4 A;  4IWY A;  1NMF A;  3MR6 A;  3A5U A;  1VQ8 A;  2M00 A;  4ABN A;  3N42 B;  1YEZ A;  2A69 D;  1E4F T;  4A3M H;  2C00 A;  4A4I A;  4C3H B;  2YYA A;  4KLK A;  3WDN A;  3UFX B;  2A69 C;  2GVA A;  5IIF A;  4IFD H;  4X3S A;  2WB1 G;  1IYU A;  4DV3 H;  4DV4 L;  3LML A;  2F1M A;  4E6I A;  2ZTD A;  1BNZ A;  4ZQ3 A;  4DGZ A;  4EQO A;  4HID A;  3LNN A;  5KT2 A;  1I4H A;  1N34 Q;  2Q2H A;  4DR6 L;  4JI4 H;  3S1M H;  2NN6 H;  2WAQ A;  1WCM G;  2OQ0 A;  4DUZ L;  2FJZ A;  4JV1 A;  4RAY A;  2F0U A;  5EAY A;  3SEB A;  3HEJ A;  5KFZ A;  4GKJ Q;  3JAM i;  3E5S A;  4C5B A;  1KBL A;  3I4M B;  4C2M A;  4TV8 F;  5FLX L;  3MZ5 A;  3GTJ B;  1DCZ A;  1PH9 A;  2AMC B;  1H9R A;  1I4X A;  5FOB B;  3QZ8 A;  4B3M L;  3U50 C;  3MFH A;  4JBK A;  1CZW A;  1TII D;  1XWE A;  4GNX C;  1VBH A;  1B6S A;  1CUK A;  1OWT A;  1PRT D;  4I65 A;  2D9U A;  4GKK H;  4IQZ A;  1GUO A;  4LMQ D;  2E2H H;  2XGT A;  2XCL A;  1PRT C;  2R93 B;  4RFB A;  2NB0 A;  3VYU A;  5C6A A;  2O4X A;  1XNR Q;  1M6V A;  2N88 A;  5I6W A;  4IUN A;  1EY7 A;  4OL7 A;  2ZDQ A;  1KC7 A;  1DZ1 A;  2AUJ D;  1EWI A;  4I7H A;  3GTP A;  5L1I A;  4BXX G;  1W6K A;  2EJF C;  4ECV A;  4J8Q A;  2V4D A;  1ESF A;  3L4J A;  4FU0 A;  4K5V A;  2NU9 B;  3PR5 B;  1N56 A;  1WD1 A;  4RGM A;  4WOR A;  3EIV A;  2WDT A;  2EQS A;  1A3V A;  4FM9 A;  4N8X 1;  5JJI A;  1VDZ A;  2FPP B;  4HMJ A;  2ICE C;  5LL6 b;  4DR5 H;  4LF7 H;  5FLX c;  1CTM A;  1PTO D;  1QWY A;  1IBL Q;  4LFC Q;  4X62 Q;  3KOJ A;  4RUA A;  1RJP A;  4ZHQ F;  1PTO C;  5I6Y A;  4OX9 L;  2FMC A;  2YZG A;  1LT4 D;  2M9V A;  5C44 H;  5DLG A;  1UNS A;  1LM0 A;  4P74 A;  2XRQ D;  4LJZ C;  1I4G A;  3NEL A;  1BBW A;  2UUA Q;  4CJ1 B;  3NQT A;  3K5M A;  3T1H H;  2OEO A;  1SLJ A;  1C8C A;  3SXH A;  1Z47 A;  2F0M A;  3R23 A;  1B04 A;  4XYO A;  4CDF C;  3AFP A;  5KND A;  2UUB Q;  1EQR A;  2Z0S A;  1UC8 A;  3H15 A;  4DV5 L;  2ID0 A;  4ZUJ A;  1TWC B;  2PQA B;  2H1E A;  1X6O A;  5C4X H;  2RDJ A;  4ED3 A;  4Q44 A;  1YNN D;  4JI6 Q;  1KHI A;  1C3O A;  2BH8 A;  4DAY B;  2E5L Q;  1FJG Q;  3KAK A;  2OH2 A;  2SEB D;  1KLU D;  4UHV A;  4NLG A;  1IYJ B;  2JA6 G;  3MWM A;  2DWC A;  2NUA B;  4EX5 A;  4FBT A;  1U9R A;  1YNX A;  1JOQ A;  2W9B B;  2WFW A;  4DV2 Q;  4A3M B;  1ICF B;  5IE8 A;  3PUW A;  4TRD A;  1STB A;  3HOU B;  5GON F;  4G57 A;  3EVQ A;  2KHI A;  5D8D A;  2FLL A;  1WTH A;  3PQI A;  5C5M A;  4A3I H;  5KT4 A;  3R5H A;  4I7A A;  5A2Q E;  4OEM B;  3ERS X;  3C3L A;  3HOW G;  4XYM B;  3I90 A;  5J2U F;  4C2M H;  3S17 B;  4Z9C B;  2LSS A;  3RN5 A;  4LFA Q;  4QUF A;  2HJW A;  5FLX W;  4F4Y A;  4EGQ A;  1CKN A;  2VQF L;  1I7L A;  1EIY B;  2B3G A;  2ZJP A;  3RZD H;  1JJC B;  3SK6 A;  2A74 C;  4UAI A;  1T9H A;  5JVG 3;  2ZXR A;  5KFE A;  3OHX C;  1TWH A;  3WO0 A;  1KJI A;  3CF5 A;  3E0E A;  1JJ2 A;  1IBM H;  2VQE L;  3P20 A;  1TWG H;  1UEB A;  3A5Z B;  2W6P A;  3VPB A;  3SI8 A;  2B29 A;  1I94 Q;  2X0S A;  4O2B F;  1ULZ A;  3GTP H;  2B2Y C;  1L0Y B;  1EYC A;  2VUM A;  4BY1 G;  5E4W C;  3FDS A;  4KI0 A;  2OXP A;  4XTC S;  1VQC A;  3M3Y H;  1Z2N X;  4A3C G;  2E2H B;  1JOK A;  1M0W A;  4O3Q A;  4XQQ A;  1HA5 A;  2Z6K A;  2B63 A;  5COR A;  2PMZ B;  2MNA A;  4RB1 A;  3UE1 A;  2K52 A;  3I3C A;  5IYD H;  3G48 A;  4RAU C;  1HNZ L;  2HGS A;  1ICW A;  1S0M A;  4X65 L;  2F4V Q;  2R6F A;  3J81 j;  3RAQ A;  5IWA L;  3QG1 A;  4XX0 B;  5T1G A;  1Q90 A;  4KHP L;  4C5A A;  1IBK H;  3K5N A;  5KFS A;  1GHJ A;  2I5M X;  2RF4 A;  4YP3 A;  2ATL A;  2IBK A;  4JI8 Q;  3S1R B;  1C0A A;  4GN5 A;  5KIX A;  1Y1V A;  3GTO A;  1PFS A;  2WIN B;  4OWW B;  3A0J A;  4ULL A;  4A3E G;  3H0G A;  1RF2 D;  5M5W H;  1HH2 P;  3SR1 A;  1MHW C;  2JXM B;  2ZDG A;  1L1O C;  4DAV A;  5C44 B;  5M3F H;  1JC7 A;  2JA7 B;  4A3F H;  4QW8 A;  5CV8 A;  3CCL A;  2BH2 A;  1ZKO A;  2QDB A;  4LF4 H;  1ET6 A;  4IOC A;  2DLN A;  2RGR A;  4MV3 A;  4Y52 H;  1KLG D;  3M4O H;  3J80 E;  4KKS A;  3PO3 G;  3FKI A;  4LW1 A;  4C56 C;  2O5J C;  2OLS A;  1C30 A;  1IOV A;  3CXC A;  1YJ9 A;  3I91 A;  4ECY A;  4DR1 Q;  1A6X A;  2EYF A;  1P16 A;  2A6H D;  1B50 A;  3OOC A;  1NBW A;  4JV0 A;  4DNT B;  2L12 A;  2QA4 A;  1BCP F;  2A6H C;  1SEI A;  4PMB A;  1B4O A;  4X3U A;  3QB3 A;  1VF5 C;  2K1B A;  2WAQ B;  1GUS A;  2KEE A;  3UDI A;  3S24 A;  2F0Q A;  4DK3 C;  4DPG A;  3TRZ A;  1F9S A;  1K3B C;  5E4X A;  3K81 C;  1CHQ D;  2KED A;  3Q22 A;  5K36 G;  4DK1 A;  1O75 A;  1RHP A;  1SRU A;  2B2T C;  2K03 A;  5LHY 1;  1WOC A;  2Q8I B;  4L5Q A;  1TWH H;  2B8F A;  3G6J B;  2B2W C;  4C2M B;  2JN4 A;  4DU9 A;  3MAQ A;  2AU0 A;  4RZQ A;  4NDX A;  4O3S A;  3FPU B;  4XIG S;  3MXP A;  4JI0 L;  3T1Y Q;  5ELB A;  5KFQ A;  4U67 3;  2J6U A;  2WP8 J;  5DEH A;  4NKL A;  2K75 A;  1E7Z A;  1K73 C;  4JBJ A;  2VUM H;  1FGU A;  5DQH A;  2DNE A;  3RZD B;  1EUD B;  1TWA A;  5LMU L;  2I80 A;  3R3O A;  3R93 A;  5KGU A;  3BU2 A;  1SDF A;  4YB8 B;  3U4Z A;  4KY6 A;  3K5H A;  3JAM E;  1DOM A;  4PMC A;  4JI5 H;  1AW7 A;  1C9O A;  1S4Z A;  4KKT A;  4B3T H;  4GLA C;  2F0S A;  3STB D;  4DK0 A;  2B63 H;  3KTM A;  4ECR A;  1FKA H;  2R8J A;  4DV7 L;  2OWO A;  3TS0 A;  4YR2 A;  4LK1 C;  5LA6 F;  3RF2 A;  4GC7 A;  3GTP B;  4UY8 C;  2XNA C;  1KRT A;  5LYJ F;  4FS1 A;  2UXB L;  4OIK A;  5D14 A;  2R82 A;  4MV1 A;  1WCM A;  1PXU A;  3KF6 A;  3BVM A;  2BA1 A;  3CPW A;  5GAG C;  1OTC A;  1SE4 A;  2Q2T A;  2YW2 A;  3GIL A;  3MXG A;  3ORQ A;  3WO1 A;  2UU9 H;  3KLR A;  4B9X A;  5FJ8 G;  1Y1V H;  3GTO H;  1I3Q H;  5JJK A;  2NZO A;  1FNV A;  2KEC A;  5CA1 F;  1UEA B;  2MP1 A;  3H0G H;  2PPB C;  5D65 A;  3TQT A;  1IW7 D;  4IWX A;  2EOT A;  4DL6 A;  5IYC G;  1CKM A;  4ED0 A;  1K9M C;  4NXN H;  2WAC A;  2M05 A;  5DGA A;  2B2U C;  4DKA C;  2ASJ A;  1IW7 C;  3RLO A;  4DV4 Q;  3CCJ A;  1PDQ A;  2EYM A;  1XNR H;  5EKL A;  5EGT A;  5FLM G;  3L2P A;  2BCO A;  5M5Y H;  2R7N A;  1A63 A;  4CJ0 B;  4RNO A;  3G6E A;  4DFA A;  3IAY A;  4DR6 Q;  2VQD A;  1WTW A;  1QE6 A;  1KDC A;  1X65 A;  4PNY A;  4DUZ Q;  1Q7Y C;  3ZJY C;  2E2I A;  2F0F A;  5AJ3 L;  5M3F B;  2EZV A;  1EWH A;  1HTP A;  1SNO A;  4A3F B;  2ZDH A;  4LH6 A;  1CM9 A;  3S14 H;  5CBE E;  1XMQ H;  2JA5 A;  4C3J G;  4R1J A;  3BZD B;  1YJN A;  1SEB D;  2EYL A;  3NXW A;  2PZW A;  4APV A;  5EBD A;  4DAM A;  1KIX A;  1GM5 A;  3BJY A;  5C4H A;  1B44 D;  1DIK A;  4R4I A;  2L15 A;  3M4O B;  2I07 B;  4B3M Q;  4AH6 A;  2BQ3 A;  4ILW A;  5LL6 S;  1SN8 A;  1SJH D;  2FE3 A;  1XNQ H;  3S1Q H;  4X66 H;  3M9M B;  1TU2 B;  3BVZ A;  5LL6 X;  2N8N A;  2WB1 E;  1Z2P X;  4B3R L;  1EL0 A;  3NQI A;  4A3J G;  1E1T A;  3Q8D A;  1EU3 A;  3H20 A;  5FD6 A;  2UUB H;  5ELE A;  1YI2 A;  4A3G G;  2PBZ A;  1LLR D;  4K14 A;  5JEA G;  1QNU A;  1PZK D;  3MR5 A;  1IL2 A;  1X54 A;  2RBM A;  3A8I E;  1CKN B;  2K14 A;  1TA8 A;  3DM1 A;  4JI6 H;  4PZ7 A;  3GV8 B;  3NWS A;  2AGO A;  2RSO A;  3S2D B;  1DV2 A;  3A56 A;  1UE6 A;  1YIT A;  1TWH B;  4L5S A;  3PIP 3;  2ASB A;  1OO9 B;  2JA8 G;  2IX3 A;  1PH1 A;  2Y0S A;  3V6H A;  4RCN A;  2AKW B;  2CQA A;  1XDN A;  4R4T A;  2VUM B;  4OX9 Q;  2K5V A;  2R7L A;  1YHA A;  1WCM H;  1Z7T A;  2J6S A;  2EY5 A;  3S16 H;  2LKV A;  4DR2 H;  3FRP B;  4QWD A;  1LTI D;  3SK5 A;  4LF9 H;  4X3K A;  4MTE A;  1FL0 A;  4GOP C;  1SXT A;  2B63 B;  3TII A;  1S5B D;  3E5N A;  3K59 A;  4IRD A;  1JDE A;  3TP5 A;  1CHP D;  1J5E H;  4DV5 Q;  4LWC A;  3KUP A;  4N8F A;  5EWE A;  3HOZ G;  4PMW A;  4KKU A;  4RU9 A;  2BOS A;  1BQQ T;  2FKL A;  1HNW H;  1SJE D;  2MO0 A;  3D4D A;  1RJT A;  5KFD A;  1NSN S;  2FXQ A;  2A68 D;  4IPD A;  1Y1V B;  3GTO B;  4EBC A;  4L5R C;  1HNX H;  2K5N A;  2ENB A;  2DY8 A;  4YY3 H;  1QJO A;  3HGB A;  1QZG A;  4QWB A;  3R8B A;  4CDE C;  2A68 C;  3H0G B;  4XQJ A;  1R9T A;  3TDQ A;  5FD5 A;  4J9Q A;  4LNQ A;  1EY6 A;  5JPN C;  4BXX H;  2E2I H;  1PH7 A;  4LF8 L;  1I4P A;  3QJY A;  4DR4 L;  2G9H D;  4MV7 A;  4LFB L;  2YRW A;  2JA5 H;  4LMY A;  2QF7 A;  3KHR A;  2W6N A;  4JI2 L;  4IR1 A;  4X64 H;  4A3K G;  5M5Y B;  2F4V H;  2NWG A;  2UXD H;  1LUZ A;  3HKZ E;  2F3W A;  4ZYS A;  3NTH A;  3FKI B;  1PH8 A;  4A93 H;  2JEJ A;  3NPP A;  3GIP A;  5JEA J;  4DNR B;  1XJV A;  4DR3 L;  5FK9 C;  1CFM A;  2VQF Q;  2V5A A;  1WH2 A;  1JB7 A;  3P75 A;  3RV4 A;  2ALY B;  2W9A A;  1VQD A;  3S14 B;  3KDF A;  4AYB E;  2NU6 B;  1Y8O B;  4HJ7 A;  1V4Y A;  3K7U C;  1LYL A;  2VQE Q;  1G2S A;  2AQ2 B;  4QQB X;  1Y1W G;  4OO1 H;  1WTV A;  2F03 A;  3CRK C;  3VYS A;  5C3E G;  3UQ8 A;  4F4W A;  3S1Q B;  1RYS A;  3RIZ A;  1X56 A;  1KEE A;  3LWU A;  2J7Z A;  4EBD A;  3BVG A;  3TZU A;  2ICI A;  4RGO S;  3BAA A;  5EJW A;  5L1L A;  1S5F D;  4DV0 L;  2JA6 H;  1ZQ7 A;  2KBN A;  2W6M A;  1AUX A;  3I56 A;  3PO2 G;  1E4E A;  3CC4 A;  1HNZ Q;  4RNM A;  2N49 A;  2CHB D;  4X65 Q;  5DQI A;  1EY5 A;  2WV6 D;  1CA5 A;  3CRL C;  5IWA Q;  4JK1 C;  5CR3 A;  1PA6 A;  1TWA B;  1VQI A;  4KHP Q;  5LMN L;  3F2U A;  4R9W A;  1G6Z A;  5EBC A;  3O13 A;  3AU7 A;  5H1S E;  1VQF A;  1LAC A;  5DNF A;  1K0R A;  4DV6 H;  3C1E A;  3NP8 A;  5DAU A;  4HJ5 A;  2SDF A;  3EN2 A;  4A3L G;  4MV6 A;  2C28 A;  5J3B A;  3GTM A;  3PN1 A;  2RHS B;  1VCI A;  3WOE A;  1PH5 A;  4ED6 A;  3KF6 B;  3S16 B;  2BDO A;  2ASL A;  3S9W A;  1SYC A;  1LT3 D;  3HOX G;  5I4D A;  3W5O A;  5IGG A;  4MAM A;  4CDC C;  5I47 A;  3OMC A;  4L5T A;  1R9T H;  1FNU A;  4CJ2 C;  1A8V A;  1QCB D;  1E2V A;  4MNO A;  3D0F A;  1XTC D;  2BA0 A;  4K6L A;  2XGQ A;  1NR4 A;  4BY1 H;  4O3N A;  1K8G A;  4IO9 A;  4EYH B;  4OWX B;  3TZD A;  4FBU A;  1HRJ A;  2JE6 I;  4BY7 G;  1STE A;  2K50 A;  4ZRZ A;  1RKN A;  4QJF A;  2YCH A;  1RD9 D;  5BR8 L;  2I8C A;  1F9Q A;  5KFF A;  2NVY A;  1S5E D;  2GLT A;  2C2D A;  2I5H A;  1QVG A;  1WD0 A;  1A62 A;  1V1P A;  4HR7 A;  1GUG A;  1E4G T;  4QW9 A;  1Q46 A;  4F88 A;  4IJH A;  4G7H C;  3MFI A;  2IT1 A;  2K33 A;  2E2I B;  4AQY H;  3F2C A;  5KYL A;  4A3B H;  1N33 H;  1EQV A;  3FPP A;  4ZCK A;  2ZXO A;  2HHH L;  3CQZ B;  3GTL A;  3HFZ B;  2JA5 B;  3EJI A;  2WII B;  2DGY A;  4TQS A;  2C2E A;  2PNR C;  1D1I A;  3L7Z C;  4BA2 I;  2Z9H A;  1S3O A;  3M4P A;  1PH6 A;  4JI0 Q;  3K3P A;  4CKC A;  4A3E H;  4A93 B;  1S68 A;  2N55 A;  2D0O A;  3I4O A;  2XWB B;  1SE3 A;  3K80 C;  5D3D A;  4ED8 A;  3RV3 A;  2KQ3 A;  4U68 A;  4JI1 H;  2K5H A;  5LMU Q;  4GLV B;  1PFB A;  4DV4 H;  1BGW A;  2CH4 A;  2EE1 A;  5FLX E;  1CS0 A;  2B2V C;  2YS7 A;  4EFE A;  4PQX A;  4MHE A;  1EHI A;  5M3M G;  4DV7 Q;  3TSS A;  4LUZ A;  1JIC A;  3JC6 6;  1KDA A;  2KJX A;  2PW5 A;  3ONA B;  4K8I A;  1VQG A;  1UNN C;  5CB4 F;  3TEH B;  1X9N A;  4DUZ H;  4B9W A;  3CCS A;  1Q8K A;  4JW0 A;  3PO3 H;  2UXB Q;  1HZ9 A;  4I50 F;  1K83 H;  4ZKB B;  1MSG A;  3RB6 A;  4HCE A;  4L1K A;  5C0X I;  2ZJQ A;  3ERO A;  5C1O A;  2J0T D;  3G6V A;  4J0M A;  2OCE A;  4CDD C;  1TWF H;  4V19 0;  1HR0 L;  5LMN W;  2YS6 A;  3RBD A;  2HDL A;  5AFW A;  5F2D A;  1Q81 C;  3JRW A;  3ITP A;  2K28 A;  2FK3 A;  2JEA I;  2Q8T A;  1BOS A;  2Y0S B;  5IT9 L;  3GDE A;  3GTM H;  3UDX A;  2EJM A;  2L5T A;  4DNI A;  4EFB A;  3I4N G;  1MKH A;  4B08 A;  4RH6 A;  2BQR A;  3T4A C;  1QUQ A;  4KN7 C;  3GTQ H;  3HBL A;  3DWQ A;  4JI3 H;  4QUC A;  3NK9 A;  2QIL A;  3RUZ A;  5K36 H;  2HVS A;  3HS0 C;  2AGP A;  1B33 N;  1PTO H;  2NVT H;  4R8N A;  1KNA A;  4E4T A;  4MN3 A;  4RKB A;  4EEQ A;  4QMG A;  4HNU A;  1GLV A;  3OTO L;  4J9O A;  4DUY Q;  2X69 A;  1EZ8 A;  3MHB A;  3WOF A;  3D6C A;  4JV2 A;  3BQ1 A;  5J22 A;  2W7P A;  1D1K A;  2B8G A;  1BKB A;  2F0L A;  1NNX A;  4L63 B;  3ULL A;  1Q86 C;  3PW7 A;  2K5D A;  5D1O A;  4LF5 L;  5AJ3 Q;  3K57 A;  4DL3 A;  3ND9 A;  2RDF A;  2EYO A;  1RTO A;  3H3V H;  1EIH A;  4HSP A;  1BJT A;  3RD4 A;  4CHT B;  3RNU A;  2RGV A;  1I6U A;  1R4Q B;  1EEF D;  3MXU A;  2NVY H;  4HIM A;  1R9T B;  4LUV A;  5IT9 c;  3WWV A;  2PMZ E;  1ZHQ A;  1OXV A;  4IAJ A;  1TS5 A;  4OX9 H;  1TWG A;  4DV3 L;  1FYC A;  4IJL A;  3GTK A;  2UVU A;  2K7V A;  2J4X A;  5EPK A;  5KKN B;  2NVX A;  4RHR A;  4B3R Q;  4JOI A;  1JXL A;  1T36 A;  5BPH A;  3GTL H;  2D62 A;  1LAB A;  2UVV A;  4MV9 A;  2XWJ B;  1Q3L A;  1MSH A;  1TS2 A;  4JI4 L;  4IPH A;  4RCO A;  1DON A;  4QIW E;  1K8M A;  2RHQ B;  4TQU S;  2YZN A;  1TXY A;  2IJ0 A;  4OWT B;  3S15 B;  5KFL A;  1WTR A;  5LXT F;  2JSO A;  2F0G A;  2R92 A;  3H6M A;  4P73 A;  1B53 A;  4A3B B;  2IL8 A;  5GAH C;  1E1O A;  3HOV H;  4LH7 A;  3KDF B;  5G3L F;  3GLK A;  5KT3 A;  2D5D A;  4ECZ A;  4RNN A;  3AB9 A;  3H91 A;  4YJ3 F;  3ULP A;  3KFU A;  3CCE A;  1V8Q A;  4A3E B;  1UAP A;  4J6H A;  2DN8 A;  1STN A;  4GKK L;  4KD4 A;  4NP5 A;  5ELN A;  4FF4 A;  3HKZ G;  4UCT A;  2B2W A;  3CC2 A;  3Q8R B;  2H5X A;  4O2D A;  4BS9 A;  4RA8 A;  3OHA A;  2QCP X;  1CZG A;  1N36 L;  2Q2U A;  1HFG A;  2GN5 A;  3FDT A;  4NPS A;  1YIJ A;  4KV6 A;  1IXR A;  3MWY W;  1K28 A;  2PZU A;  4YWM A;  5HY6 A;  4C1N K;  3GV6 A;  3KJO A;  3V96 A;  3FP9 A;  1D5M C;  4IFD I;  4AYB G;  1E4E B;  4YR0 A;  4EYI B;  1BBX C;  3PO3 B;  3LWB A;  5FPO A;  2ZTE A;  5IT9 W;  4ODG A;  1VQB A;  5CBA E;  1YNJ D;  3DLL A;  1KQS A;  2AWN A;  5C4J H;  2XD4 A;  2K01 A;  3JSL A;  2XCP A;  4DR5 L;  4LF7 L;  2XIG A;  5IOD A;  3RUP A;  3DEP A;  3VA5 A;  1B1Z A;  3HOY H;  3BS1 A;  3N52 A;  1YNJ C;  4EG0 A;  1MIU A;  1RL2 A;  2NN6 I;  4C3H G;  2MJ8 A;  3I73 A;  1ET9 A;  2VQE H;  1UC9 A;  3U58 A;  3BZC A;  3PUX A;  4LF6 H;  3VMM A;  4F4X A;  2F0D A;  2F0J A;  4A3D H;  2FJ2 A;  4A3G H;  3R5X A;  1S0N A;  1Y8P B;  5J39 A;  5JEA H;  5J2T F;  3PUY A;  3ZYY X;  1AZP A;  3S1M B;  3S1N H;  3AQQ A;  1SNC A;  5KFB A;  3GV5 B;  3R2T A;  3KF8 A;  3T1H L;  5JJL A;  4ZAI A;  4DF7 A;  4LF8 Q;  5C0X G;  3WNZ A;  1M7J A;  3K3V A;  4DR4 Q;  3MEH A;  1PTO B;  4LFB Q;  1V1Q A;  3SK8 A;  3K0Y A;  4JI7 L;  4JI2 Q;  3EFX D;  3N44 B;  1EOT A;  1PLF A;  2B2U A;  4HNT A;  4X65 H;  3D3R A;  4ZUI A;  2JA8 H;  5DG8 A;  1JDB B;  5KFR A;  4DR3 Q;  1IZ6 A;  3I4M G;  3GTK H;  5KFT A;  1JB3 A;  2YTY A;  1VQP A;  2NVX H;  3NWT A;  1ZXT A;  4IUU A;  3J81 L;  3GIJ A;  1UUP A;  2R7D A;  2VB3 X;  4ZQI A;  3U9O A;  4Q0F A;  1O7Z A;  2R61 A;  3X3N A;  2F0W A;  3GP7 A;  3OW7 A;  3T13 A;  5DG7 A;  2EIF A;  3DF7 A;  3HB9 A;  5KG5 A;  1V1P B;  4LUO A;  4HR7 B;  4PZ8 A;  4PWQ A;  2F0T A;  3P7J A;  5C4Z A;  2R93 G;  3CC7 A;  2R92 H;  1KNE A;  1FVI A;  1G29 1;  3DMU A;  3HOZ H;  2F0V A;  4KD3 A;  3GTL B;  1ONL A;  1SYX B;  3A74 A;  2KUM A;  5KG4 A;  4DV0 Q;  4K0K L;  1JWM D;  1IKM A;  5KFG A;  1JT8 A;  1A9X A;  4OIJ A;  4JUZ A;  1I3Q A;  4WBN F;  1CI3 M;  1AUV A;  2J9G A;  2CWP A;  3NEN A;  2BE5 C;  4A75 A;  1LTB D;  3EA6 A;  2Q8R E;  3OWF A;  4XQN A;  1B2T A;  3KXY T;  2F0K A;  3HG9 A;  3J7A K;  4DV1 H;  4TSS A;  5LMN Q;  2FB9 A;  3V2T A;  4DLK A;  2KOL A;  3N43 B;  1NE3 A;  3HOV B;  5KFH A;  4LSX A;  3NTI A;  4XT1 B;  1HFN A;  3J81 c;  3Q1K A;  3N41 B;  4BBR H;  2VXW A;  3ETH A;  3KK7 A;  1S9F A;  2O03 A;  5IYB H;  1V1O A;  3E3X A;  2OQK A;  1I5F A;  3KLS X;  1GKH A;  3VR4 A;  4RUC A;  1AN7 A;  3ERQ A;  3SVM A;  2XVS A;  2FPG B;  2KEN A;  5I9O A;  2XCA A;  2K04 A;  2KCT A;  5KRU A;  3I4L A;  1NMG A;  2NZH A;  4O1N A;  5C4X B;  1V43 A;  4ZK9 B;  3M4Y A;  3U9S A;  4B3S H;  3VPC A;  4R8I A;  3EPI A;  2XGP A;  3DXJ C;  1PYW D;  4YBZ B;  2O2L D;  3FMA A;  3VA7 A;  5C3X A;  1EIF A;  4WJ3 M;  4DK6 C;  1IBK L;  5IGF A;  2QK4 A;  1QUQ B;  5HV6 A;  1EU4 A;  4UDU C;  5C3E H;  3OSN A;  1EWC A;  1RIP A;  3T51 B;  3HOY B;  1BCP D;  5FO7 B;  3HOU G;  1RDP D;  4A3I B;  5IYZ F;  1VQ9 A;  1JMC A;  2RCN A;  4DV7 H;  2DJF C;  5BR8 Q;  4OEL B;  1BCP C;  4RG1 A;  4IFD G;  2JEI A;  4A3D B;  5K2M A;  1HUN A;  2UXB H;  5JH7 F;  3W3A A;  1TKW B;  2YTX A;  5D1O B;  1A15 A;  1KC8 C;  1X32 A;  3M7G A;  3E9I A;  1VQK A;  4HCS A;  2HT1 A;  4QF4 A;  3J7A 5;  1K8O A;  2HHH Q;  1EIG A;  3EBE A;  1M1K C;  1STA A;  2V59 A;  1LTT D;  1DXM A;  2NN6 G;  4CKE A;  3F1Z A;  2PCF B;  4IUV A;  1Y69 U;  1CE8 A;  2WB1 A;  5DG9 A;  3Q8S B;  4WJ4 A;  5LOV F;  4J9S A;  4ALP A;  3J81 W;  3OPO A;  1QVC A;  2JA8 B;  4APM A;  2NU7 B;  4HAE A;  1N34 H;  1TWG B;  2VNU D;  4Q43 A;  3H4D A;  5IP9 G;  3GTK B;  5ELD A;  4TQR A;  2PN1 A;  5F9L A;  4QWA A;  3FVQ A;  2NVX B;  1C4Q A;  5CV7 A;  1KJJ A;  3M3Y B;  1OXT A;  1VQA A;  1NR2 A;  1XX8 A;  4G7O C;  4DUY H;  4ED7 A;  1S97 A;  3J80 L;  1SFO H; 
#chains in the Genus database with same CATH homology
 1C7Y A;  4JI2 L;  2HQL A;  4JG2 A;  4LF9 Q;  4QL5 A;  4A3K G;  3K8A A;  4BA1 I;  1L2F A;  1LUZ A;  3HKZ E;  1PH4 A;  1PH8 A;  1NMF A;  4A93 H;  3A5U A;  1AE3 A;  1VQ8 A;  1A0I A;  5JEA J;  1VQ4 A;  2ATW A;  1XJV A;  1YEZ A;  4DR3 L;  3RLF A;  4A3M H;  3S2H H;  2VQF Q;  4A4I A;  1JB7 A;  4KLK A;  2VS1 A;  3FHW A;  1J5E Q;  2ALY B;  1JJG A;  1VQD A;  1PH2 A;  2GVA A;  3GTG H;  3KDF A;  2WB1 G;  4AYB E;  4HJ8 A;  1CSP A;  4HJ7 A;  4DV4 L;  1HNW Q;  3K7U C;  3HKS A;  4ME3 A;  1LYL A;  2ZTD A;  2VQE Q;  4JYA L;  1G6P A;  2A8V A;  1HNX Q;  2IX1 A;  4QQB X;  1Y1W G;  4JI5 L;  1KAW A;  4YY3 Q;  4HID A;  1W3S A;  4LF6 L;  4B3T L;  2PI2 E;  5C3E G;  1N34 Q;  2Q2H A;  4DR6 L;  3S1M H;  1X56 A;  4YCU A;  2UXC Q;  2C35 B;  1WCM G;  2OQ0 A;  2YV5 A;  4DUZ L;  1N32 L;  5EAY A;  4FDB A;  3D31 A;  5C44 G;  3OTO Q;  4DV0 L;  3M4Q A;  2JA6 H;  4GKJ Q;  3JAM i;  2KBN A;  2JA7 G;  3I56 A;  3PO2 G;  1UE1 A;  3G4S A;  2UU9 L;  3CC4 A;  1HNZ Q;  1ASY A;  1G51 A;  1PH9 A;  2N49 A;  2K4K A;  4X65 Q;  2AMC B;  4X64 Q;  4LF5 Q;  4B3M L;  4JCV E;  5IWA Q;  4UP8 A;  3U50 C;  2ZM6 L;  1XPR A;  1PA6 A;  4JBK A;  1VQI A;  1MJC A;  1YZ6 A;  3MXN B;  4GNX C;  1IBM L;  2JA9 A;  4KHP Q;  5LMN L;  1CUK A;  1N8R C;  4A3B G;  2Z6K C;  5H1S E;  1VQF A;  1YBY A;  1VQN A;  2E2H H;  1K0R A;  5M3M H;  2XGT A;  4MTN A;  4NXN L;  4A3K H;  3I55 A;  4HJ5 A;  3AYH B;  3EN2 A;  4DV3 Q;  1XNR Q;  4A3L G;  5J3B A;  4Y7N H;  2RHS B;  4PG3 A;  3LGJ A;  1VCI A;  3KF8 B;  1L0W A;  1YJW A;  1EWI A;  1GVP A;  1PH5 A;  4DR7 L;  3KF6 B;  5C0X J;  4HIK A;  4BXX G;  2WAQ G;  3NEM A;  1Q1E A;  5E7N A;  3HOX G;  4JI4 Q;  1D8L A;  2QGQ A;  3EIV A;  3W5O A;  2R7Z G;  2EQS A;  4JV5 Q;  4POG A;  5JJI A;  4NXM L;  2JK8 A;  3CCV A;  4L5T A;  1Y1W H;  1XTD A;  4GOP A;  1R9T H;  5FLX c;  3PIP A;  3I4N H;  1A8V A;  1IBL Q;  1YVC A;  1I6H H;  4LFC Q;  4MNO A;  1XMQ L;  4JOI C;  3D0F A;  2MQH A;  3PUV A;  3KOJ A;  4X62 Q;  2BA0 A;  2PI2 A;  4A3M G;  4BY1 H;  3BJU A;  4OX9 L;  3VDY A;  1K8G A;  3CME A;  4IO9 A;  4OWX B;  3CPF A;  1M90 C;  4P71 A;  5C44 H;  2JE6 I;  4BY7 G;  1LM0 A;  4P74 A;  2K50 A;  4DV1 L;  2VW9 A;  3ER0 A;  4QJF A;  1XNQ L;  3CW2 C;  4X66 L;  3PO2 H;  5BR8 L;  3NEL A;  1BBW A;  2UUA Q;  4GKK Q;  4C3I H;  2I5H A;  1X3F A;  1UE7 A;  1QVG A;  1SLJ A;  1WI5 A;  1A62 A;  1Z47 A;  4DV6 Q;  3AFP A;  2UUB Q;  1EQR A;  2GVB A;  2Z0S A;  1Q46 A;  4IJH A;  3H15 A;  4DV5 L;  2IT1 A;  2ID0 A;  3PF4 A;  4LF4 L;  3F2C A;  2PQA B;  1N36 Q;  4A3B H;  3CP0 A;  1X6O A;  2F3I A;  3DM3 A;  5C4X H;  1UE5 A;  2HHH L;  1L1O B;  2CQO A;  3HFZ B;  1EQQ A;  1X3E A;  1KHI A;  1Q12 A;  4JI6 Q;  2BH8 A;  4YCV A;  2DGY A;  4DAY B;  2E5L Q;  1FJG Q;  3GD7 A;  3L7Z C;  3S2D H;  1IYJ B;  4BA2 I;  2JA6 G;  1S3O A;  3M4P A;  1PH6 A;  4EX5 A;  4JI0 Q;  4A3L H;  4A3E H;  1YNX A;  4B3S L;  2D0O A;  3AEV A;  3I4O A;  3K80 C;  2WFW A;  3CCQ A;  4DV2 Q;  4BY7 H;  5IE8 A;  1BVS A;  4DR5 Q;  3PUW A;  4LF7 Q;  1UWV A;  2K5H A;  2JJQ A;  5LMU Q;  4GLV B;  2KHI A;  1B8A A;  1D7Q A;  3HOX H;  2UUC Q;  4YCW A;  4A3I H;  1QZH A;  3GO5 A;  2KCM A;  5M3M G;  2JEB I;  3ERS X;  3HOW G;  4DR2 L;  4DV7 Q;  1H95 A;  4LUZ A;  3JC6 6;  4C2M H;  4LF9 L;  1VQG A;  2LSS A;  3RN5 A;  2NVQ H;  1HZB A;  3TEH B;  2LXJ A;  1X9N A;  3CCS A;  1Q8K A;  3PIO A;  3PO3 H;  4LFA Q;  3STB C;  1Q82 C;  1HZ9 A;  2UXB Q;  1K83 H;  3PF5 A;  5C0X I;  1CKN A;  1SMX A;  2VQF L;  3KYH C;  1HR0 Q;  2ZJQ A;  1EIY B;  2B3G A;  2ZJP A;  2OCE A;  1BBU A;  1JJC B;  1TWF H;  4AQY Q;  5LMN W;  3RZD H;  1J5E L;  1HR0 L;  5GQO A;  1VQL A;  4JI7 Q;  1N33 Q;  5M3F G;  1Q81 C;  1T9H A;  2YTV A;  4A3F G;  2JEA I;  4PZ6 A;  1HNW L;  1LTL A;  3CF5 A;  3E0E A;  1XMO Q;  1JJ2 A;  3GDE A;  3GTM H;  3UDX A;  4DNI A;  2VQE L;  1VQ5 A;  3TS2 A;  3M85 A;  3I4N G;  1MKH A;  1TWG H;  1UEB A;  1HNX L;  3A5Z B;  3PGZ A;  1QUQ A;  2B29 A;  4YY3 L;  1PYS B;  2HIX A;  4POF A;  1I94 Q;  4YHH Q;  3GTQ H;  1AE2 A;  3J81 i;  3GTP H;  1N34 L;  4BY1 G;  2IX0 A;  2UXC L;  1VQ7 A;  3W1G A;  4KI0 A;  4JI1 Q;  4XTC S;  1VQC A;  3HOV G;  3M3Y H;  4GNX A;  4A3C G;  3J80 c;  2NVT H;  2E2J H;  4IOA A;  4IFD J;  3ULJ A;  3OW2 A;  4O0A A;  3OTO L;  2Z6K A;  4DUY Q;  2MNA A;  1Q1B A;  4GKJ L;  3UE1 A;  1U5K A;  2K52 A;  4DUY L;  5IYD H;  3G48 A;  1AH9 A;  1QVF A;  1BKB A;  3M7N A;  1HNZ L;  4R4C A;  3FKI H;  3ULL A;  4X65 L;  1Q86 C;  2F4V Q;  4X64 L;  4LF5 L;  3J81 j;  5IWA L;  5AJ3 Q;  2UXD L;  1VQE A;  1PVO A;  1E24 A;  3H3V H;  2PQA A;  4KHP L;  4K0K Q;  1XPU A;  5C4X G;  2I5M X;  2RF4 A;  4JBW A;  3CCM A;  1HJP A;  4JI8 Q;  3RNU A;  1XPO A;  5ELO A;  3HOW H;  1C0A A;  4GN5 A;  2NVY H;  1PFS A;  4HIM A;  4LUV A;  1WJJ A;  3WWV A;  3A0J A;  2PMZ E;  5IT9 c;  4OWW B;  2UXD Q;  1OXV A;  4R4Q A;  4A3E G;  5M5W H;  4DV3 L;  1HH2 P;  1XNR L;  4IJL A;  4YWK A;  4B3R Q;  1L1O C;  4JOI A;  3K0X A;  1OXX K;  1SE8 A;  4GLX A;  2VUM G;  3GTL H;  2D62 A;  5GAE C;  3HOY G;  5M3F H;  1Y14 B;  4JI3 Q;  2JQO A;  4A3I G;  4JI4 L;  4A3F H;  4IPH A;  3CCL A;  4QIW E;  2RHQ B;  2BH2 A;  4JV5 L;  4TQU S;  2B63 G;  1TXY A;  4IOC A;  4OWT B;  4A3D G;  3JAM c;  1S72 A;  1K8A C;  4Y52 H;  1IBL L;  3M4O H;  3PO3 G;  4LW1 A;  4LFC L;  4P73 A;  2XTI A;  4GN3 B;  2I5L X;  4X62 L;  5GAH C;  2KHJ A;  1E1O A;  1TWA H;  3CXC A;  3HOV H;  4A3C H;  3KDF B;  3PSI A;  1YJ9 A;  4DR1 Q;  1P16 A;  3ULP A;  1IBK Q;  3KFU A;  3CCE A;  4MZ9 A;  1Y1V G;  1EYG A;  1NBW A;  2UUA L;  4QY7 A;  4GKK L;  4OXP A;  2QA4 A;  5ELN A;  3HKZ G;  3H0G G;  5DLQ E;  4DV6 L;  2I0Q A;  3CC2 A;  1X55 A;  2H5X A;  2UUB L;  2R7F A;  4O2D A;  3UDI A;  5IP7 H;  3I2Z A;  3S24 A;  1PHJ A;  2OTJ A;  4DK3 C;  4DPG A;  2N3S A;  3TRZ A;  1N36 L;  2Q2U A;  3K81 C;  2GN5 A;  5K36 G;  4NPS A;  1YIJ A;  1SRU A;  4TVA B;  1IXR A;  4BBS H;  5HY6 A;  4YWM A;  3UDF A;  3KJO A;  1WOC A;  4JI6 L;  4IFD I;  3FP9 A;  4L5Q A;  4AYB G;  1TWH H;  2QEX A;  2E5L L;  1FJG L;  3KLW A;  2N78 A;  2CKZ B;  3B6Y A;  4JI0 L;  4XIG S;  5IYD G;  4RMF A;  3T1Y Q;  2ZTE A;  1VQB A;  4QGU A;  1WFQ A;  2WP8 J;  3DLL A;  2R92 G;  1KQS A;  3FKI G;  4DV2 L;  4OO1 I;  2AWN A;  2K75 A;  5C4J H;  1VQO A;  1E7Z A;  1OXU A;  4JBJ A;  5IY0 A;  1FGU A;  4DR5 L;  1K73 C;  4LF7 L;  2VUM H;  5LMU L;  3HOY H;  3BU2 A;  2UUC L;  3U4Z A;  1MIU A;  1RL2 A;  2NN6 I;  3F2D A;  4R4O A;  1O7I A;  3U58 A;  3BZC A;  3PUX A;  1C9O A;  1PYB A;  3MEF A;  1B70 B;  1EOV A;  3I7F A;  4GLA C;  3STB D;  2B63 H;  4A3D H;  3CCU A;  4A3G H;  4DV7 L;  1CKO A;  1VS0 A;  2AWO A;  2OWO A;  3TS0 A;  3PUY A;  3T1H Q;  3E9H A;  4HJ9 A;  3AQQ A;  1KRT A;  2MO1 A;  4UY8 C;  4LFA L;  1I50 H;  3S1N H;  1JE5 A;  3T1H L;  2UXB L;  4LF8 Q;  5JJL A;  5C0X G;  3BZK A;  3J80 i;  3KF6 A;  3CPW A;  2BA1 A;  2Q2T A;  2D0P A;  5GAG C;  1OTC A;  4DR4 Q;  4LFB Q;  1V1Q A;  3CQZ H;  4JI7 L;  4AQY L;  4JI2 Q;  4A76 A;  5FJ8 G;  4BBR G;  1Z9F A;  1Y1V H;  3GTO H;  1I3Q H;  5JJK A;  2NZO A;  1N33 L;  4GOP B;  1U0L A;  2IHF A;  5IYB G;  4X6A H;  1VQJ A;  2JA8 H;  1KXL A;  3CAM A;  5HGQ A;  4EQ5 A;  3H0G H;  1XMO L;  4DR3 Q;  1IZ6 A;  3I4M G;  4IPG A;  3GTK H;  5IYC G;  1CKM A;  1MJE A;  1EFW A;  2YTY A;  1VQP A;  1K9M C;  1I94 L;  4YHH L;  2E8G A;  2CWA A;  3IRB A;  2NVX H;  3HOU H;  4DKA C;  1S40 A;  3RLO A;  3RZO H;  4JI1 L;  2R7D A;  4DV4 Q;  3CCJ A;  1SRO A;  4KHZ A;  3TQY A;  5FLM G;  4JYA Q;  2EIF A;  2YYZ A;  4LUO A;  3L2P A;  1KD1 C;  2Y0S E;  4PZ8 A;  1ASZ A;  4JI5 Q;  5M5Y H;  4LF6 Q;  2R93 G;  3CC7 A;  4B3T Q;  2R92 H;  3S17 H;  1A63 A;  3G6E A;  4DR6 Q;  1FVI A;  1G29 1;  3HOZ H;  1X65 A;  2F4V L;  5GAD C;  1YHB A;  4DUZ Q;  5IP7 G;  1Q7Y C;  3ZJY C;  1VQM A;  1N32 Q;  4C3H H;  5AJ3 L;  3A74 A;  4H02 A;  4DV0 Q;  4BBS G;  4GN4 B;  4K0K L;  3S14 H;  1JT8 A;  1L1O A;  4J15 A;  3G71 A;  2CCZ A;  4JI8 L;  3RR5 A;  1NY4 A;  4R1J A;  1YJN A;  1K3R A;  1VQ6 A;  2UU9 Q;  4APV A;  1SR3 A;  1GD7 A;  2CWP A;  3NEN A;  4DAM A;  4A75 A;  1OXS C;  1KIX A;  1GM5 A;  5IP9 H;  4R4I A;  2L15 A;  4UP9 A;  4B3M Q;  2IHE A;  2ZM6 Q;  3PV0 A;  4AH6 A;  2VL6 A;  3RLN A;  1B7Y B;  1IBM Q;  1SN8 A;  5LMN Q;  3S1Q H;  1NE3 A;  1NJI C;  2N8N A;  2WB1 E;  1W2B A;  4B3R L;  3J81 c;  3NBH B;  3TRE A;  4A3J G;  5FJ8 H;  4BBR H;  3W1B A;  3RN2 A;  1E1T A;  4NXN Q;  3Q8D A;  4JI3 L;  5IYB H;  2HIV A;  2OQK A;  1I5F A;  1GKH A;  2F52 A;  1YI2 A;  4P72 A;  2DUD A;  4HJA A;  4A3G G;  3AFQ A;  3I4M H;  3F2B A;  1PH3 A;  5JEA G;  3GTJ H;  2KEN A;  5IYC H;  3CMA A;  1YHQ A;  2KCT A;  1IL2 A;  1X54 A;  4DR7 Q;  1NMG A;  2NZH A;  1WYD A;  1CKN B;  2K14 A;  1V43 A;  3ICE A;  4PZ7 A;  1KRS A;  1P8L A;  2PNH A;  5M5X H;  2VZA A;  4UP7 A;  3CD6 A;  1PV4 A;  5FLM H;  1UE6 A;  1YIT A;  4L5S A;  4NXM Q;  3PCO B;  2ASB A;  2Q2I A;  3S1R H;  2JA5 G;  4DR1 L;  1EIF A;  4WJ3 M;  1CSQ A;  1V9P A;  1VQH A;  4DK6 C;  3UDG A;  1IBK L;  2R93 H;  1NTG A;  2YU9 H;  2JA8 G;  2ES2 A;  2R6G A;  1XMQ Q;  1QUQ B;  1J6Q A;  3K7A H;  1PH1 A;  3UE0 A;  5C3E H;  4A93 G;  2AKW B;  3CCR A;  3L0O A;  4P75 A;  4R4T A;  2ZJR A;  4NB3 A;  2K5V A;  4OX9 Q;  1RIP A;  1HZC A;  1WCM H;  1YHA A;  1EUJ A;  3U4V A;  4GNX B;  3S16 H;  3HOU G;  2EXD A;  4DV1 Q;  1VQ9 A;  1XNQ Q;  1JMC A;  2RCN A;  4C3J H;  1FL0 A;  4X66 Q;  5BR8 Q;  4GOP C;  5GRO A;  1HR0 W;  4RG1 A;  4IFD G;  3J7Z C;  4IPC A;  2JA7 H;  2ZTC A;  4JC0 A;  4YWL A;  2A19 A;  4UPA A;  2LXK A;  2YTX A;  3F8T A;  4LWC A;  3OYY A;  4DV5 Q;  3T1Y L;  1KC8 C;  4LF4 Q;  3S15 H;  3E9I A;  3KJP A;  1VQK A;  2HT1 A;  4OO1 G;  3HOZ G;  2WAQ E;  4PMW A;  3J7A 5;  2HHH Q;  3EBE A;  4GS3 A;  2IY5 B;  3M9B A;  1M1K C;  2MO0 A;  1X3G A;  4A3J H;  2NN6 G;  3F1Z A;  2FXQ A;  4IPD A;  3SGI A;  4JBM A;  1N9W A;  4WJ4 A;  4HIO A;  4L5R C;  4ALP A;  2K5N A;  1E3P A;  1QVC A;  1QZG A;  4OON A;  4B3S Q;  1E22 A;  2AHO B;  2VNU D;  5IP9 G;  2Y0S G;  4LNQ A;  2CFM A;  2MFI A;  3PUZ A;  4BXX H;  1DGS A;  2VY3 A;  1KL9 A;  2E2I H;  1TWC H;  1PH7 A;  1OXT A;  1VQA A;  4LF8 L;  1GO3 E;  2OTL A;  2V1C C;  4DR4 L;  2A1A A;  2R7Z H;  3H3V I;  4LFB L;  2JA5 H;  1SFO H;  4AIM A;  1HZA A;  4DR2 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...