4A93G

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a93G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a93G01
1I5FA 3M4PA 3GDEA 4J15A 4A3FG 2WAQE 4DAYB 1SMXA 4KLKA 1G6PA 3OTOQ 4DR7Q 2F4VQ 4DV2L 4A3IG 1VQJA 5IYDH 3S15H 3RLOA 3T1YQ 4JI8Q 1VQ7A 2UUCQ 3TS2A 3HFZB 3PO2H 1X65A 2NZHA 3K0XA 4DR3L 4LUZA 5IYCH 5IYDG 4JI3Q 4JI2Q 4HJAA 4LF4L 1K0RA 1AH9A 2NVYH 3A74A 1N34L 2NVQH 2N78A 1DGSA 1QUQB 2OCEA 4UP9A 4A3KG 2CWAA 2A1AA 3CCLA 1SFOH 1LYLA 2NZOA 4DAMA 3RN2A 1V43A 2WFWA 2JA7H 4DV1L 4JI5Q 2KBNA 4P71A 3PUYA 3JC66 3U50C 4HJ8A 2YTVA 2VQEQ 5FJ8H 3G4SA 4DV7L 1HR0L 4NXNQ 1YVCA 1N33Q 4LW1A 4IO9A 4DV0L 3RZOH 1H95A 4DV6L 1UEBA 3J80c 1HZAA 2B29A 2PMZE 5BR8Q 3PIOA 1YIJA 2EQSA 2Q2TA 4Y52H 4KI0A 4A93G 3DLLA 1NY4A 1HNZL 3PO3H 1K8GA 1HNWQ 1VQOA 4OWTB 4DUYL 3F2DA 4DV5Q 1YJWA 2RHQB 2E5LL 1FJGL 1S40A 4R4TA 3NBHB 2MO0A 5C44H 4LF9Q 3H3VI 4DR4Q 2HHHQ 4IOAA 1CSPA 2KCTA 4APVA 2R7ZH 1CSQA 1YHBA 2YV5A 4JI4Q 3H3VH 2WAQG 1PH7A 2YTYA 4DR6Q 2QGQA 1A0IA 4A3JG 3PF5A 4JV5Q 3CCVA 5M5WH 2LXKA 3RZDH 5LMUQ 1YJ9A 3U4VA 4YHHQ 4K0KL 2Q2IA 2VQFQ 2IX0A 1SLJA 2ZTCA 1A63A 2I5LX 1YITA 3K81C 5C3EG 5C4XG 3UDFA 4GOPB 2JA5G 4IFDJ 4B3RQ 1EYGA 5IT9c 3A5ZB 1I3QH 1JJGA 4AQYQ 1B8AA 3H15A 4OWXB 1L1OC 2ID0A 3CCJA 4B3MQ 3HKZG 4A3DG 4JI5L 2K5NA 1YBYA 1I6HH 1SR3A 1NMGA 2ALYB 3AQQA 1A8VA 1X3FA 3AYHB 2RCNA 1IL2A 4IFDG 1PVOA 4OONA 3W1GA 3HOWG 1OXTA 2DUDA 2YTXA 4BA1I 1WFQA 1YZ6A 3AFQA 4A3LG 1HZ9A 3CW2C 1IZ6A 1E3PA 3PUVA 4X64Q 4OO1I 1SE8A 1Q86C 3W5OA 5LMNQ 2YYZA 1X9NA 1Q7YC 4B3SL 5M3FG 4LF6Q 2K75A 4JI0Q 5GROA 1Y14B 3RR5A 2ZM6Q 5LMNW 4YCWA 4WJ4A 4A3FH 2JK8A 5GADC 2K50A 1YI2A 1HZBA 4GLAC 2E2HH 1VQGA 3RN5A 1VQ5A 2CWPA 1XMOL 2A8VA 2NVTH 4A3IH 4X62L 3TREA 1Q1EA 4QY7A 1QZHA 4LNQA 1E24A 4DV2Q 5M5XH 4JYAL 3HOVG 3I55A 2Q2UA 4C3JH 3CPFA 3GTKH 1C0AA 1X56A 2VUMG 1BVSA 5IP9G 4DUZL 4YY3L 2JEBI 1OXXK 3UE0A 2VQFL 2XTIA 1TXYA 4C3HH 4DV3L 5DLQE 3HOXG 4DR3Q 2IT1A 4GLXA 4JBKA 4BXXG 1JJ2A 1CKOA 4LF4Q 2Y0SG 1U0LA 3U58A 3GTOH 1X3GA 4LFBL 4XIGS 1VQHA 2Q2HA 4R4OA 1YNXA 4IPGA 4A3KH 1QZGA 1PHJA 1EIYB 2VY3A 1HJPA 4A3EG 4B3ML 3PCOB 1HZCA 4LF7L 1FL0A 2K4KA 5H1SE 4A3MG 1QVFA 4JBWA 2L15A 1PYBA 4DV1Q 1GKHA 1CKNA 3S1MH 3CP0A 5JEAJ 4A75A 4A3BG 3I2ZA 4DV7Q 1HR0Q 1VS0A 2EIFA 2UUBQ 2KCMA 4GNXA 1D8LA 3BZCA 2Z6KA 4DV6Q 2PNHA 1HR0W 1U5KA 3PO2G 1GVPA 1KAWA 1HNZQ 4JI7L 4QQBX 1KXLA 1PYSB 5JEAG 2MNAA 4DUYQ 1PFSA 3D0FA 2E5LQ 4BBRG 4DNIA 1FJGQ 4DR2L 4PMWA 5M5YH 3S16H 1MJEA 1IBKL 2PQAB 3EIVA 1WJJA 4GKKL 1HH2P 2F3IA 3AFPA 4KHPL 4BY1H 4YWLA 3VDYA 4GN4B 2UXDL 4OX9Q 1VQBA 4A3JH 4LWCA 1BBWA 4GS3A 1L1OB 2WB1G 3RLFA 1MIUA 1B70B 3PSIA 5IYBH 1M90C 4L5SA 3TRZA 2RHSB 4AIMA 3S2DH 4K0KQ 4DV4L 1JB7A 1M1KC 1BBUA 4JI6L 5JJLA 5C3EH 1GO3E 5C4XH 1PH5A 3PUZA 2OTLA 3M85A 2HIVA 3Q8DA 1Q1BA 3I56A 2CCZA 1VQCA 3M9BA 4A3DH 3BJUA 2JA6G 1EFWA 3GO5A 1VQFA 2VS1A 4UP8A 3J81j 4IFDI 4C2MH 2F52A 1EWIA 3EN2A 4HJ7A 2R93G 3J7A5 1GD7A 4ME3A 1Q12A 2HIXA 1K8AC 3IRBA 1EQRA 2UUBL 3KF6A 1VQNA 2LXJA 2MFIA 4A3LH 3A0JA 1NJIC 4PZ6A 1HNXQ 1K3RA 1X55A 4FDBA 1VQEA 5HY6A 3NELA 1KRSA 4A76A 2ES2A 1J6QA 5M3FH 3FHWA 4B3SQ 4UY8C 4WJ3M 2R7FA 3K8AA 2B63H 2B3GA 5IE8A 5K36G 1JMCA 1CUKA 1XMOQ 1K73C 1PH2A 4QGUA 4OX9L 3BU2A 3DM3A 3L7ZC 4X62Q 2BH8A 2GVAA 3E9HA 4L5TA 5J3BA 4AYBE 3F2BA 1PA6A 3HOVH 1X6OA 4JYAQ 3H0GG 2VUMH 3L2PA 1Y1VG 2K5HA 5IP9H 1Y1WG 4DUZQ 5AJ3L 4YY3Q 1K9MC 2FXQA 4BXXH 4DV3Q 1XNQL 2IX1A 4L5QA 4DPGA 5ELOA 3S14H 1WYDA 3FKIG 3J81i 3CMEA 1RL2A 3KDFA 4LFBQ 1KHIA 3HOUG 1VCIA 4A3EH 3RNUA 3I4NG 1P8LA 1JE5A 2UU9L 3G48A 2ZTDA 1EIFA 4LF7Q 4A3MH 4AH6A 1J5EQ 4DK6C 1YHQA 2D0OA 2ATWA 1VQDA 2OQKA 3CAMA 2K14A 3G71A 1PH3A 4A3BH 2UXBL 4YWKA 3UE1A 4LUVA 1OXUA 4IPCA 4LFAL 3HOZG 4EX5A 1HNXL 4DKAC 1V9PA 4TQUS 2IHEA 3S24A 1OXSC 2RF4A 3OW2A 2N3SA 3PIPA 1XPRA 4MZ9A 1P16A 1E7ZA 3CCSA 4JI7Q 1LM0A 4H02A 3MXNB 1VQMA 1TWCH 1XNRL 3S1NH 1UE7A 5GAHC 4DR2Q 2K52A 1N36L 2JA8G 4JOIA 1IBKQ 4R4CA 4GKKQ 1BKBA 3S1RH 3GTQH 4NB3A 2VL6A 4ALPA 4KHPQ 4MTNA 2UXDQ 4X66L 1LUZA 3CQZH 1JJCB 5FJ8G 1Q81C 1KC8C 2NN6G 4AYBG 2VZAA 1YHAA 3F8TA 3E9IA 4BY7G 2D0PA 3K80C 3OYYA 4DR5L 4JI1L 1L0WA 4LF5L 4DV4Q 4UPAA 4JI6Q 3PO3G 4P72A 4GNXC 4PZ7A 2Z6KC 4OO1G 4OWWB 2VNUD 3TQYA 3CCMA 4A4IA 3PF4A 2ZTEA 3I7FA 1S72A 1PH8A 3J81c 1IBML 3GD7A 4LFCL 5FLXc 5C44G 1J5EL 2OWOA 2JA6H 3AEVA 1VQPA 1QUQA 2R93H 1PH9A 2D62A 3K7AH 4HIOA 4GKJQ 1TWHH 3KYHC 3TS0A 3STBC 3G6EA 2Z0SA 4X65L 1G51A 2JEAI 3TEHB 1MKHA 3UDXA 2BA1A 1KD1C 3GTGH 2HT1A 4IOCA 4GLVB 2I0QA 4A93H 4A3CG 2KHJA 3CC7A 4JG2A 5EAYA 4BA2I 3B6YA 1FVIA 5GAEC 3CXCA 3FP9A 4RG1A 1TWAH 1W2BA 5JJIA 2PI2A 3CCRA 1SROA 2R92G 4XTCS 1R9TH 4BBSG 2JJQA 3T1HL 1N32L 1JT8A 4HIDA 1VQ9A 5IWAQ 3K7UC 1EQQA 4A3CH 1YEZA 1Y1VH 5IP7G 3PUWA 1Y1WH 2PI2E 3KJOA 2K5VA 5FLMG 4HJ5A 2ASBA 1TWGH 4PZ8A 1PH6A 4NXML 1N9WA 5AJ3Q 2UUAQ 2CQOA 5GAGC 3ULJA 1XNQQ 2JA5H 4IJHA 2AKWB 3ERSX 4HIKA 1WCMG 4KHZA 4R1JA 3I4MG 3I4NH 4C3IH 1B7YB 4EQ5A 2AHOB 3NEMA 2UU9Q 3PV0A 1V1QA 4GOPA 1I94L 3KF8B 1C7YA 1IBLL 3J7ZC 1IYJB 3JAMi 1LTLA 1Z47A 1XMQL 3S2HH 1NBWA 4JCVE 3CF5A 1X54A 4GKJL 1C9OA 2UXBQ 3CCUA 1EOVA 4IPHA 2IY5B 3HKSA 3HOWH 2UXCL 5IY0A 4B3TL 1Z9FA 3HOZH 1VQ8A 3M4OH 4LFAQ 1Q8KA 1SRUA 1ASZA 3MEFA 3ULLA 4A3GG 3STBD 4JBMA 3CC2A 3A5UA 2AMCB 1E22A 1PH1A 1XNRQ 1CKNB 3HKZE 4Y7NH 5GQOA 2AWNA 3I4OA 4O2DA 2JA8H 2E2JH 5C0XJ 1N36Q 1S3OA 1UE1A 3HOYG 1VQKA 4R4QA 4GNXB 2NN6I 2ZJQA 5IWAL 4QL5A 4X66Q 3M4QA 1XPOA 1QVCA 3M3YH 3KLWA 1XTDA 1YJNA 3KFUA 4BY7H 1VQLA 5C0XG 2NVXH 2UUAL 1NE3A 5M3MG 3HOXH 1GM5A 4DR5Q 4JI1Q 1PV4A 3M7NA 1L2FA 1KQSA 1ASYA 4LF5Q 1VQAA 2DGYA 5E7NA 3ICEA 1MJCA 2V1CC 2MQHA 3S17H 1T9HA 4OXPA 2QEXA 1RIPA 3W1BA 1IBMQ 4IPDA 4YWMA 4LFCQ 3L0OA 4P73A 3OTOL 1G291 1OTCA 3CC4A 2F4VL 4DR7L 4IJLA 4BY1G 4DR1Q 4NPSA 2XGTA 1I50H 3T1YL 2ZJRA 1KIXA 4JOIC 4JI8L 4P75A 3JAMc 3KJPA 2LSSA 1W3SA 3EBEA 2UUCL 2C35B 3CMAA 3GTPH 2JE6I 4X65Q 2N8NA 4P74A 5IYBG 1UWVA 2BA0A 2WP8J 4R4IA 3F2CA 1CKMA 4JI3L 2E8GA 2Y0SE 4LUOA 4GN5A 4POFA 5IYCG 4JI2L 1OXVA 1K83H 3E0EA 2VW9A 1VQ6A 4PG3A 1E1OA 2GVBA 4GN3B 3PUXA 4BBRH 2B63G 3CPWA 1AE3A 1IXRA 4HIMA 2R92H 1KL9A 2BH2A 4BBSH 3KF6B 3GTMH 2JA7G 4L5RC 4MNOA 1Q82C 3T1HQ 2I5HA 3LGJA 4DK3C 4NXNL 2VQEL 4QIWE 4HJ9A 1N33L 1N32Q 2JQOA 1KRTA 2PQAA 5IP7H 3ZJYC 3UDGA 3CCQA 2YU9H 5FLMH 5BR8L 2OTJA 4JC0A 1QVGA 4NXMQ 1HNWL 4X6AH 1NTGA 5HGQA 4LF8Q 1L1OA 1WCMH 3F1ZA 4DV5L 3I4MH 2I5MX 1SN8A 1E1TA 3GTLH 4DR4L 4LF9L 2HHHL 3KOJA 5C4JH 4RMFA 2JA9A 4JI4L 2ZJPA 1XJVA 2A19A 1AE2A 4DR1L 2OQ0A 1I94Q 3CCEA 3UDIA 1XMQQ 1IBLQ 2R7ZG 4DR6L 1VQIA 2E2IH 4JV5L 3BZKA 1FGUA 1WOCA 2WB1E 2KHIA 5LMUL 2UXCQ 4QJFA 2QA4A 1NMFA 4UP7A 1UE5A 4O0AA 4YHHL 1A62A 3KDFB 4B3TQ 1VQ4A 2MO1A 4A3GH 2N49A 1EUJA 3S1QH 4B3RL 1WI5A 1N34Q 2AWOA 4AQYL 2KENA 2R6GA 4JBJA 1TWFH 2IHFA 3D31A 3WWVA 3HOYH 1O7IA 4POGA 1D7QA 3PGZA 2R7DA 4TVAB 3CD6A 3RLNA 4YCVA 2CFMA 3ER0A 3H0GH 5C0XI 4YCUA 3J80i 4GOPC 1N8RC 1PH4A 2HQLA 2EXDA 4DV0Q 2GN5A 2H5XA 5JJKA 1UE6A 3NENA 5M3MH 4X64L 2CKZB 5LMNL 3ULPA 3SGIA 1X3EA 3GTJH 3FKIH 4LF8L 4LF6L 1Q46A 1XPUA 4JI0L 3U4ZA 5ELNA 3HOUH 2ZM6L
chains in the Genus database with same CATH superfamily
3GDEA 4J15A 3K6OA 1EFID 4DV3H 4XXEA 1XYIA 1G6PA 1GSAA 1FGBD 4DR7Q 3OMCA 4UAIA 1VQJA 3S15H 2ICEC 1G6ZA 4JI8Q 1VQ7A 4HMJA 2UUCQ 1GUGA 4EQOA 4RAZA 1X65A 4MIUA 4C3JB 3J80L 4XT1B 3TP8A 4DR3L 4C2MA 4CC5A 2DPIA 2C9OA 1E4GT 4JI3Q 3BJYA 1AH9A 2PZTA 2V5AA 2ZXOA 3A74A 1N34L 2NVQH 1DXMA 3N44B 2G9HD 1SYFA 5KFUA 1B2TA 4A3KG 3TBIB 4MHEA 2W9BA 2WFWA 4DV1L 4JI5Q 1A3TA 5E4XA 2RA4A 3JC66 2W9CB 4LAAA 3G4SA 3OHXC 4DV7L 1N33Q 4RB2C 1YVCA 1PFBA 4LW1A 4DR2H 1WTHA 3RZOH 3VMMA 1SYBA 1UEBA 1IBKH 2KEEA 1CK1A 1E0BA 3F2UA 1HNZL 5IGCA 1O80A 2UXDH 4U673 1S5DD 3F2DA 3PR4A 3PW0A 2E5LL 2RHQB 4R4TA 4ECSA 2MO0A 2R82A 1B1ZA 4LF9Q 3K5IA 1LT5D 1DOMA 3IAYA 4K2KA 2MUYA 2YV5A 5D3DA 3H3VH 2WAQG 3Q8RB 4DV4H 1F2ZA 2EYPA 1B33N 4DR6Q 1JOKA 4WBNF 3KHHA 4ECYA 1PYWD 4ZKBB 4ZUIA 5LMUQ 5BPFA 3S2DB 4K0KL 3LX0A 1HTLD 3OSNA 3R5XA 4CC6A 3PQIA 5C3EB 5C4XB 2JA5G 3I70A 5KFJA 1O7YA 2MPMA 3OW7A 1JJGA 1PZID 2KCNA 2W6NA 4C3IG 3H15A 4OWXB 1B53A 3CCJA 4O4IF 2C22A 5I9PA 2R7MA 4JI5L 4F4ZA 2BQUA 1NMGA 3AQQA 2RCNA 1IL2A 1PVOA 2H4OA 4EGJA 5EGTA 1OXTA 1YZ6A 4A3LG 4KKSA 1G2SA 5EPKA 1K1SA 2RKSA 3V96A 4OO1I 1SE8A 2AGPA 1EOTA 1Z2PX 1PFMA 2DJGC 4UDUC 2YYZA 1VKZA 1U4RA 5JVLA 4DL3A 5GROA 2HDMA 2ZM6Q 5LMNW 4WJ4A 2JK8A 2E2HH 1O75A 2B63G 1ULZA 1VQGA 4MTDA 4ZAIA 5CR3A 4FF3A 2FK2A 3TIGA 5KYLA 1S0OA 1R4QB 3OSPA 4IR1A 5M5XH 5KT6A 4X3UA 3HOVG 3CPFA 2E74C 1LTSD 2VUMG 3MR3A 5IP9G 4DUZL 4YY3L 3UE0A 4FS1A 1QOHA 1IOWA 1CKOA 4LF4Q 4M8AA 4HNVA 1B9MA 1LACA 1X3QA 1EUDB 1CT1D 2Q2HA 4A3KH 4YAJB 5L1IA 2VY3A 1I3QB 3JRXA 4PMCA 5DLFA 4LFAH 2YZNA 3BG5A 1ICFB 1HZCA 2W57A 5KFVA 1QVFA 1VMPA 2XN9C 1ENFA 1CKNA 3S1MH 4DNRB 4A3BB 3I2ZA 1HR0Q 1VS0A 2RBMA 3P7JA 4E6IA 4GNXA 3BZCA 4DV6Q 4Q0YA 2QILA 1H9KA 1XXGA 2MNAA 2EJFC 4DUYQ 4ED8A 2MJ8A 4DNIA 5M5YH 2WDTA 2JEIA 4KD3A 4QWAA 1WJJA 2A5HA 1HH2P 4WFN3 3FKIA 4KHPL 3VDYA 2WACA 1O7ZA 4PNYA 3GTQB 3H4DA 1MGSA 4L8JA 4U68A 1TIID 3OMGA 1BQQT 3P75A 2WB1G 1MIUA 1IBMH 3RIZA 4AIMA 1BXTA 1GJXA 1GYFA 1KJIA 3LP8A 2UVUA 5JJLA 1PH5A 1GO3E 2HD3A 1CQFA 1JCKB 2OTLA 5IGGA 1EYCA 2UVRA 3I56A 4X65H 3M9BA 3GQBA 3BZDB 3BJUA 1ZQ7A 1EY9A 1CQVA 1D5ZC 2AQ4A 1EWIA 4Q5VA 4HJ7A 2R93B 3T53B 1GD7A 4EGQA 1Q12A 1EQRA 1SBBB 5KFGA 2KUMA 5EBCA 2MFIA 4A3LH 1LTGD 4I7HA 3GTGB 3A0JA 5I2YA 4IHJF 3DUZA 1WTVA 3QG1A 5HY6A 3NELA 4ILWA 4DL5A 2CW0C 5LL6S 2ES2A 3A56A 3BABA 2R7FA 1DJRD 3KLRA 5KFRA 3K8AA 2B63H 5IE8A 4MV6A 3JRWA 3SXHA 1CUKA 3QJYA 1IW7C 3KK7A 3MA2B 4QGUA 1K73C 3DM3A 4I50F 3E9HA 3HOVH 1RF2D 2LMCB 4FF1A 2VUMH 1EY8A 1E4EB 4FO2A 5IP9H 4ZUJA 1AZQA 5KFWA 5I47A 4P2CB 5AJ3L 1I94H 1XNQL 4O3QA 4GKJH 1WYDA 2FPPB 4LMQD 3C1EA 3CMEA 4XYQA 4LFBQ 1KHIA 4PQXA 5KG7A 4HCEA 3I4NG 1BO0A 4B3TH 1S5ED 2UU9L 3G48A 3JSLA 5IGFA 4RCNA 4LF7Q 1J5EQ 4KY5A 2A69D 4O2BF 3R8BA 4DL2A 1SCUB 4C2MB 3G71A 2UXBL 2L5TA 2C00A 3A8IE 4LUVA 1RKNA 3HOWB 3FPUB 2PPBC 4EX5A 4ZHQF 4J9MA 4MV1A 3E3XA 1HTPA 4TQUS 2IHEA 1BGWA 5F9LA 4ULLA 1WVLA 1EYZA 3K0YA 1XPRA 2W9BB 3CCSA 1MI2A 4OO1H 1LM0A 1LT6D 4H02A 5CBAE 1XNRL 1C30A 2BE5D 1UE7A 3ERQA 2K52A 3DWPA 4Y7NB 2K01A 3RB3A 4JOIA 2E2JB 4R4CA 3FDTA 3KBGA 4NB3A 3Q8SB 2WV6D 3C0FB 4FP5D 5HGTA 1EWHA 4X66L 2DZDA 4IUUA 5FJ8G 3M3YB 2E2HA 2NN6G 2VZAA 3F8TA 2D0PA 1STEA 3K80C 2WKCA 2HJWA 4LF5L 1ESRA 3LMLA 4JI6Q 3PO3G 2Z4HA 5EZYF 3PVXA 2Z6KC 2UUCH 4JI8H 3TQYA 1DD2A 3I7FA 1PH8A 3K3VA 2SNSA 4HAEA 3HEJA 4LFCL 1J5EL 2W7PA 1QCBD 4JI3H 4A3MB 2CQYA 1GUSA 3BVMA 5EPLA 2D62A 3BVZA 3K7AH 1SEIA 3E0JA 1HRJA 4QF4A 3EYYA 2O2LD 2JEAI 2JEGA 3UDXA 4FXGC 4GLVB 4A93H 4A3CG 3FEWX 1ZETA 1JOOA 1AUXA 4MV4A 1N33H 3TZDA 3GIKA 1EYDA 4ECQA 4ZRZA 1EZ6A 4RG1A 2RSNA 4ZI7F 4HEDA 1R9TH 1E2ZA 1QNKA 3FVQA 4HIDA 1B44D 4TQRA 2PI2E 3KJOA 2HCIA 2K5VA 5FLMG 2ASBA 4PZ8A 1IOVA 2CQOA 5GAGC 4DR1H 3N42B 4DR6H 3I73A 1HA6A 3J7AK 2AKWB 2CH4A 3NGDA 4N9PA 5KG0A 4KK7A 3I4NH 5LMUH 4XX0B 3H4BA 2EY5A 2QDBA 3PV0A 5C4JB 4TV9F 4ZCKA 3VR4A 1AN8A 1NBWA 3KLSX 1X54A 4JCVE 4EQPA 1SNMA 3BG3A 4C5CA 2FPIB 3HKSA 2A68D 5C1OA 3M4OH 4ED7A 1ASZA 2CZGA 4RHSA 1RJTA 2FMMA 1CA6A 3C3LA 2W6OA 2RDIA 1CKNB 4OGQC 3T4AC 2R7KA 2BCOA 3MXPA 3RBDA 3J7AV 4CKCA 4MV8A 3MAQA 4ZKCB 4GNXB 4LF8H 3HBLA 1K8MA 3A55A 4GC6A 4O3OA 1XPOA 2B63A 2NN6H 3KLWA 2ZM6H 3NE5B 2O5IC 2JEJA 4APMA 2XIWA 2W6MA 5LA6F 2QDLA 3MC0B 1WSCA 3HOXH 1GM5A 4JI1Q 3M4IA 1SYDA 2OH2A 2IP4A 5IT9L 3FKIB 5E7NA 2EVBA 2VUMA 3PR5B 1MSGA 3WNZA 1T9HA 2W6ZA 2EYMA 2QEXA 2FK1A 2FJ2A 4YWMA 2SDFA 1F2YA 3L0OA 1KBLA 5KT3A 4LF4H 4V0BA 2D9UA 2B2UC 3S15B 1O78A 5FD5A 1W3SA 2YZGA 5LYJF 4Q44A 3GTPH 2F0LA 4ECXA 1TR5A 2JE6I 5CV8A 2R85A 2WP8J 3PO2H 4A3CH 2WIIB 2E8GA 2Y0SE 5IYCG 5EKLA 1OXVA 5JEAH 2ALZA 1E1OA 1HR0H 4LSXA 2NVQB 1YNJC 4ED3A 1A3UA 1AE3A 5LXTF 5KFKA 2DLNA 4OL7A 3N6RA 3GTMH 2JA7G 5KNDA 3T1HQ 2VQEL 3LGJA 4DK3C 4NXNL 1N32Q 4IN3A 2F0IA 2YU9H 5FLMH 4TV8F 2KECA 3RZOB 4UHVA 1Q90A 4KJNA 1SYEA 2OTJA 3OTOH 1WTRA 4H13C 1N56A 3GTKA 3I72A 1HA5A 1B9NA 1JICA 2WB1A 3WOEA 1JOQA 1KJ8A 2WYOA 2HHHL 3FPPA 1YNNC 2ZJPA 2FPGB 2R7ZG 3OUUA 5CB4F 1XMQQ 2E2IH 4JV5L 2Q8RE 3BZKA 4IQZA 4TRDA 4ME6A 4F4YA 1EL0A 4HSPA 2UXCQ 4OELB 3E5SA 5EWGA 3R23A 3AU7A 1Z2OX 2NU6B 5EOYA 3WO0A 2PYKA 3TIIA 3A7LA 3S1QH 4B3RL 1AN7A 1PRTB 4JBJA 4QW8A 1L0XB 5T14A 1TWFH 2IHFA 3D31A 1PTOD 1O7IA 1QILA 3JSNA 4EEQA 3G6XA 2R7DA 4ECUA 5LP6F 2K32A 3RLNA 2K05A 2VA2A 4YCVA 3MWEA 3H94A 1N8RC 3A8JE 3J80i 1U4PA 4DV0Q 2GN5A 5JJKA 4FS2A 4N8X1 3GTJH 2A73B 2PCFB 4J8QA 1I4RA 4DU9A 2SEBD 4DLKA 5ELEA 1BOSA 3HOUH 4ZOLF 3M4PA 1LT4D 2WAQE 2E2HB 4UCOA 2VQFH 1SMXA 2F4VQ 1EIGA 4A3IG 4LFBH 1RTNA 5M5XB 2KJXA 5CV6A 3KBXA 5CV7A 3HFZB 3SDZA 3C46A 2E75C 4LF7H 3K0XA 4LUZA 5IYCH 4TSSA 5IYDG 1ZYRD 1EY4A 4JI2Q 4XQJA 1EQVA 3EROA 2NVYH 5DAUA 1C4QA 1CFMA 3PN1A 4K8IA 4YR3A 1T94A 2YRXA 3RJ0A 4A3KB 4O1NA 4XDXA 3N43B 1TY0A 4N8FA 3D6CA 2JA7H 3MXNA 3H91A 3PUYA 3U50C 4HJ8A 2YTVA 5JVG3 1FKAH 3O13A 5KT4A 4DV0L 1H95A 4WRDA 4J9KA 3PIOA 3NQIA 1PXUA 5BR8Q 2ZT9C 4HN7A 1HNWQ 2ASLA 1VQOA 2C28A 2YS7A 1M8AA 3BQ2A 4DV5Q 1YJWA 1FJGL 1S40A 3IFDA 2HVRA 4TKOB 2ZDQA 2NBFA 5C44H 2RGVA 3H3VI 3AMUA 5M5YB 1QE6A 4IOAA 1CSPA 2KCTA 4ZK9B 2R7ZH 1CSQA 2J7ZA 4K5VA 4JI4Q 2R6FA 1PH7A 4JI6H 2YTYA 3GV3A 4YIJA 2QGQA 4Q8EA 1A0IA 4J9QA 4C5BA 5BPHA 2DPJA 3NTKA 2I46A 4RH6A 5M5WH 3G8CA 3KLSA 2F0DA 2BR0A 1BCPB 1K28A 3ZYYX 1MD2D 1W6KA 4ED1A 3HP3A 3GTPA 3BS1A 5IT9c 3A5ZB 1EYGA 3J80E 2UUBH 1I4PA 1TS2A 1B8AA 1PK8A 2ID0A 4B3MQ 2XGPA 4MTKA 1ILQA 1YBYA 3NBIA 3NP8A 1I6HH 5EDWA 1E2WA 4KD4A 3AYHB 4IFDG 1VBHA 5EWFA 2AGOA 3W1GA 2B2WC 2BOSA 1PTOF 1GUTA 3GTMA 2C2RA 1U4LA 1IZ6A 4I65A 2EYOA 2R84A 3CQZA 4B3SL 1Q7YC 4LF6Q 3KHGA 3H40A 1STBA 2K75A 4JI0Q 1S9FA 2YU9A 4RWSC 1Y14B 4Q8FA 5FLXL 2K04A 4YCWA 3FMCA 1HZBA 2B63B 1CE8A 5JVDF 1IL8A 1C3OA 5FPOA 2B2WA 2NVTH 3KHLA 3RUZA 4A3IH 4X62L 3PW5A 1QZHA 2EYHA 1E24A 4RGNA 4PWQA 3HOVB 5DNFA 3UFXB 1X56A 2VUMB 1BVSA 2PBZA 2PW5A 3SK5A 1OXXK 3QWNA 4L6TB 2XTIA 4DR3Q 5IYDH 5KT2A 4GLXA 3RBEA 4BXXG 2Y0SG 2XVSA 2IWHA 4XIGS 2QYZA 1VQHA 4R4OA 3TQ1A 1S10A 4J6HA 4B3ML 3OHBA 1CM9A 1FL0A 1EU4A 3T5JA 4ECZA 4DV1Q 1RHPA 2F0QA 5IODA 2I80A 2W6QA 1KNEA 3CP0A 5JEAJ 5KFBA 4DV7Q 3TINA 2EIFA 4RNMA 4DL4A 3MTSA 2KCMA 3X3NA 1HR0W 1U5KA 1TS4A 1GVPA 1RDPD 4PV1C 1HNZQ 1KXLA 4DK0A 4QQBX 1NR2A 3K58A 2W71A 4ED6A 1V8QA 3D0FA 2E5LQ 4BBRG 4PMWA 3S16H 5JQWA 1SNCA 1MJEA 4HR7A 1E2VA 4H44C 4GKKL 3GTJA 4BY1H 4YWLA 5I6WA 4GN4B 1PFNA 3MVVA 4OX9Q 4LWCA 3WOFA 2I87A 3OUZA 4GS3A 3Q8PB 3GTKB 4A2AA 4IALA 3EFXD 2WB1B 3TRZA 1GHJA 4H0LC 4K0KQ 3X3MA 4C3HB 1Z6HA 5AFWA 4A2BA 3GIJA 1GXDC 3NQTA 3PUZA 5NUCA 1S4ZA 2CCZA 1VQCA 3P20A 2GPSA 1B04A 4G7HC 5LL6b 2L1BA 3OWFA 1EFWA 4RAUC 1LTID 2NVYA 3T5LA 3IG0A 3GIIA 4JI7H 4DA2A 3K7AB 4IFDH 2DY7A 3ND9A 3NTIA 4J9PA 3MWDA 2JN4A 4E4TA 3KF6A 3I8ZA 5DQHA 1HNXQ 1K3RA 5DM63 4A76A 4A93B 3T1HH 1AP0A 1XX8A 2B2TA 1AEXA 1J6QA 5HV6A 2A6EC 4UY8C 4QCLA 4WJ3M 4R8UA 1C8CA 2B3GA 3TQTA 4LSAA 1JMCA 4K8JA 4QWBA 4FU0A 3J81W 4OX9L 3NSWA 3JAML 1SYCA 3L7ZC 1GUNA 2GVAA 4L5TA 3MZ5A 5J3BA 3VR3A 3F2BA 4A3JB 1X6OA 2FHTA 3H0GG 3FRPB 1Y1VG 2K5HA 2SNMA 4DUZQ 5K2MA 4YY3Q 3K57A 2FXQA 4BXXH 1ZHQA 4YJ3F 5ELOA 3ITPA 3S14H 2FE3A 2F0KA 2FFKB 3J81i 2EY2A 4V190 2UXCH 5M9OA 4G7ZC 3RNUA 3I4NB 1EIFA 4AH6A 2V59A 4DK6C 2P5ZX 1GUWA 2OQKA 3ND8A 3KAJA 3UE1A 2R92A 1II3A 3V6HA 1KLGD 4HMIA 4IPCA 5JJZA 3VYTA 3HOZG 1HNXL 3S24A 3GIPA 3OW2A 4C56C 1E7ZA 1AZPA 1UUPA 3MXNB 2RDHA 1TWCH 2EYFA 2AQ3B 3KHRA 1HQRD 1N36L 4PDBA 2JA8G 2UUAH 3RAQA 1BKBA 3S1RH 3GILA 4KHPQ 1SNDA 4MTNA 1BNCA 4JUZA 5C5JA 5GONF 5E1FA 1Q81C 2AU0A 4DAYA 1FYCA 4TQSA 4AYBG 4KN7C 1ET6A 1S97A 4F87A 2AUJD 2QF7A 3E9IA 2LY7A 1SJHD 4DR5L 3C2PA 2B39A 3HOXB 2F4VH 2F03A 3PW4A 4GNXC 1F9SA 4PZ7A 1E4FT 3HG9A 2ZTEA 1S72A 2KEDA 4QW9A 5BN4A 4NLGA 5FLXc 4JI2H 1QUQA 1F9RA 4HIOA 5KYIA 4EGVA 4JVZA 3GV8B 3TS0A 4RA8A 5KFEA 5ELFA 2FJZA 3T13A 1WTOA 1G51A 3GTPB 3TEHB 3N6XA 3VPDA 4EBCA 4EBDA 4LH7A 4CDFC 4IOCA 1FNUA 1O7LA 3PO2B 1OO9B 4FF2A 1D1IA 5EAYA 3LWUA 1FVIA 5GAEC 2EYJA 3GIMA 2VA3A 1TWAH 1W2BA 2PI2A 4DN4M 3CCRA 1SROA 4CDEC 4BBSG 4NP5A 3GTMB 1HNWH 3N8DA 4CJ1B 5LHY1 1JB3A 2Z1CA 3J81E 1TT2A 5IWAQ 1EQQA 4O4LF 4DV5H 3CQZB 5E4WC 1Y1VH 4FNFA 3PUWA 3VPBA 4ZQIA 1KEEA 2NZ1D 3VYSA 2YU9B 1B6RA 1TWGH 4G57A 4QWDA 1PH6A 4NXML 5AJ3Q 3QFFA 4JI4H 1SMYC 1WTWA 1XNQQ 1F2LA 2JA5H 4IJHA 4HIKA 4KHZA 4R1JA 5C8YF 4RCOA 5L1LA 3TP5A 4C3IH 1SEBD 2F0VA 1W93A 4DXFA 2UU9Q 3NEMA 1V1QA 1C7YA 1IBLL 3J7ZC 5KFAA 3S2HH 5KX5F 3CF5A 5DG8A 2XRSD 2UXBQ 2IY5B 2R8IA 3R5FA 1N48A 1I6UA 3WDNA 1Z9FA 3HOZH 1VQ8A 1JQYD 2KHSA 3A7AB 4PMBA 1TY2A 3RB0A 4A3GG 4Q43A 5FD6A 3H3VC 3A5UA 2AMCB 3S1QB 1ILPA 1XNRQ 3I91A 1NAPA 3GV5B 3HKZE 2OXPA 2JA8H 1S3OA 1UE1A 1V1OA 1VQKA 2N88A 3HOYG 4I7AA 4R4QA 2CW8A 2NN6I 3Q2OA 4LF6H 5IWAL 4UCTA 3V4ZA 4QL5A 1KDCA 2B2VA 3M4QA 4X66Q 4JI0H 2EPBA 2E76C 1PRTC 3EQLC 1SJED 5C0XG 5KG1A 1EY7A 2XD4A 5M3MG 1PV4A 4HR7B 2FLLA 4LF5Q 5JPMC 3GTJB 4RAYA 1C48A 2MQHA 2EYLA 3NK9A 4OXPA 3HOUB 3D4RA 3MWYW 3T5KA 4LFCQ 2Y0SA 4DAPA 3OTOL 1G291 3CC4A 1EYAA 4NPSA 2XGTA 1N34H 3T1YL 4JOIC 3JAMc 1W96A 5T1GA 4KHVA 2C35B 2IW3A 3E6ZX 3CMAA 1IKMA 2KSWA 4J9NA 1V1PA 2N8NA 5IYBG 4R4IA 2TSSA 5FOBB 1HPCA 5KFPA 3CRLC 3VA5A 3E0EA 1K83H 2PVPA 4YAKB 1Q8IA 1CZWA 5C3WA 3G7LA 1TKWB 4DV7H 4RNOA 2EXZA 1ESFA 1B3QA 2QCPX 3Q1KA 4BBSH 3KF6B 1K0SA 3Q23A 1HNZH 5L37A 1TWCA 4QIWE 2ENBA 3QOJA 3J7YW 2JQOA 1KRTA 3QZ8A 3HZXA 5D1OA 5F9NA 4R8UB 5A2QW 1Y8PB 1KNAA 1QVGA 1M7JA 4X6AH 5KEEA 4DR7H 1L1OA 5KFQA 2DJFC 1E1TA 4DR4L 1RTOA 5C44B 4K0KH 4M7EA 5ELBA 2A19A 3UDIA 2RCFA 4XT3B 5J2UF 4I55F 1ENAA 4ECVA 3M4YA 2QA4A 5CV4A 4YHHL 5M5WB 1UE5A 2FMAA 5L9XA 2W8LA 2FK3A 4RB3C 4JI5H 4A3GH 2N49A 4FM9A 1BR9A 1A2TA 3LNNA 3RV3A 2V9WA 1VMCA 2AWOA 4AQYL 3AB9A 3D4DA 5KNBA 2R92B 3WWVA 4MAMA 3HOYH 4RB1A 5I2XA 3VYRA 1SNOA 1YNJD 3SEBA 1BCPC 2CFMA 2X6LA 3ER0A 3Q0AA 4YCUA 1STNA 1PH4A 4LF9H 3OIQA 2EXDA 4H7BA 5CMDA 5C0XH 2WAQA 4G3IA 1UE6A 5M3MH 4X64L 2L55A 5LMNL 1LO5D 3K3PA 4OIJA 1Q46A 1XPUA 5KFHA 1SE2A 1SFOH 2IBKA 1CZGA 4DAVA 2XIGA 4DUZH 4EYHB 4A3FG 5JVH3 4DAYB 4YY3H 3M9MB 4JV2A 1KAAA 1LTTD 2JA5A 4KLKA 1FR3A 1GSOA 1D5XC 4F88A 5KFMA 2NVTB 4DV2L 4OEMB 1I6VC 2R8GA 5D14A 3RLOA 4MTEA 1DOLA 4YBZB 1YNND 4QUCA 1M0TA 5T1IA 1SYXB 2J9GA 2Z9HA 2DNEA 4L1KA 4HJAA 2K5QA 3RD4A 2N78A 1QUQB 2OCEA 4ODGA 1SYGA 2CWAA 2A1AA 1LYLA 5KIXA 4DAMA 3RN2A 1V43A 3IKJA 1X3PA 2KBNA 3MWMA 1A9XA 2VQEQ 5FJ8H 4NXNQ 5KG6A 1RYRA 3KTMA 2PMZE 2B29A 5KFYA 5DG7A 1CQIB 3PIO3 4R8IA 4KHPH 5A2QE 3DLLA 4QB4A 3PO3H 1OWTA 1K8GA 1ZHSA 1KJQA 2PN1A 4YJ2F 4OWTB 3RB4A 4ED0A 2X0SA 1IHZA 4O3SA 3S16B 2HHHQ 3DF7A 1B4OA 2JSOA 2MHVA 4APVA 1YHBA 4BY1B 4EYIB 1LABA 4JV5Q 4XQQA 2K5DA 3CCVA 2Z8LA 3U4VA 5IOCA 5CGKA 4R9WA 2VB3X 5CV5A 1SLJA 2I5LX 1YITA 1RODA 3K81C 2G5DA 3UDFA 3OHAA 4B3RQ 1JIHA 1I3QH 1JWMD 1D1KA 1EUCB 4IUVA 1S03G 4DV6H 3SVMA 1K83A 3HKZG 4A3DG 1WR2A 1I4XA 1W6JA 1SR3A 2ALYB 1D5MC 1A8VA 4DUYH 3UI2A 4OONA 3J7AF 3HOWG 5KFZA 1STAA 2DUDA 3CRKC 2F1MA 4BA1I 4DL7A 1WFQA 3KXYT 4EFEA 1E3PA 1V51A 3RFCA 1JX4A 1S0MA 3W5OA 1DCZA 4G4KA 3QIAA 1X9NA 5M3FG 1PX2A 4JW0A 1S5FD 1IYUA 1CI3M 4A3FH 5GADC 2ZDHA 5JAVA 4DF7A 1VQ5A 1PTOH 3BYYB 1XMOL 3M9NB 2R8HA 1XNQH 3TREA 1Q1EA 4LNQA 4J0MA 4MV7A 1PZJD 4N9TA 4JYAL 5ISRA 4O3PA 3V4SA 3I55A 1Y8OB 5E3FA 1S0NA 2DIKA 2SOBA 3NTHA 3D6WA 2QW7A 3MEHA 5IYZF 3KALA 4WJWA 4DV3L 4JBKA 5CC4A 2IT1A 1JJ2A 4IUTA 2Y0SB 3U58A 3GTOH 3J80W 2UXBH 3S14B 3HRZC 4M1UB 4JPBW 1PHJA 1YNXA 4IPGA 4FYDA 1QZGA 5BMVF 1ZKOA 3RMHA 3V2TA 4CBVA 4A3EG 1JDBB 5KG5A 3PCOB 2F3WA 1H9MA 2K4KA 4A3MG 5JOBA 3H20A 5J2TF 4ED2A 1V1PB 1PYBA 3Q6SA 1GKHA 1HHVA 3MR5A 4QWCA 1R9TA 4J1MA 3DM1A 2J6SA 1D8LA 4CDDC 5FO9B 4JI7L 3IL8A 1PYSB 4X66H 2Z4IA 3SK4A 2OEOA 1F2MA 1G8ZD 2EZVA 1TWCB 1FJGQ 4DR2L 1NCVA 3OIPA 5F2DA 1IBKL 2F0OA 3EIVA 5D1OB 3AFPA 1EEFD 4LF5H 3OOCA 3URYA 3QOLA 2UXDL 5KFSA 1VQBA 1SFOA 5FKAC 4DK1A 2PO4A 1BBWA 2HCCA 3EA6A 1L1OB 3RLFA 1DZ1A 1B70B 4LFCH 1J5EH 2RHSB 5IGEA 2BQRA 4DV4L 1BBUA 1HQMC 3EVQA 3M85A 2HIVA 3Q8DA 2XGQA 4Q45A 2VPSA 4A3DH 4ETSA 3K59A 2JA6G 3GO5A 1VQFA 2VS1A 4UP8A 4IFDI 1B50A 2FP4B 4C2MH 2F52A 2K7VA 3J7A5 4CJ2C 3BDOA 2NUAB 4ME3A 2HIXA 4KN4C 3S1MB 3IRBA 1RJQA 2A74C 1VQNA 5D3IB 3R2TA 2M00A 1X55A 2DN8A 1VQEA 1KRSA 3BA9A 5M3FH 3FHWA 4B3SQ 2F0FA 1HCZA 1PDQA 2O03A 2XSCA 3V05A 4RUAA 2L0CA 1CTMA 5EBDA 4IRCA 2C2EA 4NMZA 2WAQB 4ZQ3A 4X62Q 1CS0A 4KKUA 4AYBE 1PA6A 2VUGA 3H09A 3L2PA 1TS3A 4KJOA 3R5HA 1Y1WG 3UQ8A 1S68A 2QK4A 2ZDGA 2NUCA 3NWTA 4L5QA 1MZBA 3FKIG 2JA5B 2A6HC 1G91A 3BDCA 3HS0C 1VCIA 4A3EH 1UNNC 1P8LA 4C3IB 1ML0D 2KOLA 4A3MH 1YHQA 4OHJA 5ELDA 2D0OA 3S2HB 1I3QA 2ZXRA 1H9SA 1CHQD 4LFAL 5KRUA 1RK6A 2YCHA 1VDZA 4DKAC 2M2LA 1OXSC 2RF4A 1F9PA 5J39A 4F7XA 3PIPA 4F8MA 4MZ9A 1P16A 4UCUA 3S1NH 1K3BC 1F9QA 3R3OA 2EJGC 2JA8B 4GKKQ 4ALPA 2A6ED 4C1NI 4GC7A 3KAKA 1JJCB 3VYUA 1CA5A 5JUMA 3A54A 4QMGA 3RV4A 4KTAA 1YHAA 5LL6X 4BY7G 4K6LA 2VXWA 3OYYA 2WTFA 3RGXA 2E2IA 2GPWA 1G2TA 4P72A 2F0EA 1L0YB 4HTHA 1HFGA 4CDCC 1BUVT 2VNUD 3BDLA 3HXLA 1CHPD 3HB9A 3ORQA 1IBML 3GD7A 2JA6H 3GTOA 4FBTA 1ENCA 3V6KA 4GKJQ 2JP1A 3MHBA 1TWHH 3GV6A 1EQTA 1GGOA 3STBC 3G6EA 1TWFA 3L3OC 4X65L 1MKHA 4RFBA 2BA1A 1KD1C 1HUMA 2AQ2B 1FNVA 4JG2A 1K83B 1ZXTA 1LT3D 2VQEH 3B6YA 4NXNH 1DV2A 4RZQA 4IR9A 3CXCA 3U9TA 3PMFA 2HVSA 5KG2A 4JI1H 4BBSB 2NYZD 2JJQA 2VOBA 4FF4A 4LMYA 1VF5C 3PW7A 3NBHA 5EJWA 4RHRA 1WD1A 2RGRA 3RUPA 3K7UC 1YEZA 3MXUA 1Z7TA 4LH6A 1Y1WH 2HHHH 3DHQA 1N9WA 5HURA 4JV5H 3ERSX 3I4MG 4DXGA 1WCMG 3TSSA 1I7LA 4ID6A 4EQNA 2B2TC 4EQ5A 3D4WA 2AHOB 5EKKA 4GOPA 1I94L 5DM73 1IYJB 2F0MA 1Z47A 4GKJL 3I90A 4DFAA 3F8NA 2J4XA 3W2DA 1A6XA 3IN5A 4IPHA 3RAXA 4B3RH 4OIKA 5IY0A 3VR5A 4B3TL 3HKZA 2PZUA 2JA7A 3NXWA 1Q8KA 1SRUA 1Y69U 4A3GB 1UEAB 1N32H 1DONA 4JBMA 3CC2A 1PH1A 1BNZA 3I4OA 5CV9A 1JE4A 5J22A 1N36Q 5D1PA 4CKBA 5KFOA 1A2UA 1ONLA 1R9TB 1QB5D 3HOYB 4QWEA 1IYVA 2K6AA 4O2AF 1M6VA 1QVCA 4O3RA 2HUGA 1XTDA 4Z9CB 5D8DA 1YJNA 4BY7H 5FPRA 4J9SA 2R7ZA 2NVXH 5C1PA 3CHBD 5M3MB 1JWSD 4DR5Q 2J0TD 1L2FA 2EY6A 1XMQH 1ASYA 1VQAA 4KY7A 2DGYA 2D5DA 5I4DA 1MJCA 2I8CA 3TDQA 3S17H 4I4TF 3MJFA 3Q22A 1SFOB 1DYQA 4KV6A 5CBEE 2FLNA 1SMYD 4IPDA 1QG7A 4R8NA 1JC7A 4YP3A 1OTCA 2NU7B 4DR7L 1NUCA 1KDAA 4DR1Q 1J8IA 5FK9C 1I50H 2ZJRA 1KIXA 4JI8L 3KJPA 2UUCL 2XCLA 2LSSA 1HXYD 3T16A 3SK6A 4RB0A 4P74A 2YRWA 3M4OB 3N52A 4RZRA 4FBUA 4JI3L 1GLVA 4LUOA 2ICIA 4POFA 3FDSA 1VQ6A 4PG3A 4RKLA 4QIWA 2HDLA 4GN3B 3PUXA 5IGDA 4BBRH 4DL6A 4HIMA 4DNTB 5H80A 4DV0H 2DY8A 2BH2A 2CW0D 1M0WA 4K2LA 1JKJB 4NDXA 2ASJA 1S5CD 4MNOA 1S5BD 1Y8NB 4U6PA 4ECWA 3T51B 2I5HA 4HJ9A 1N33L 2PQAA 1FJGH 2ATLA 3CCQA 1IW7D 5FO8B 1D2BA 2OT2A 4NXMQ 2JYOA 3PO3B 3I4MH 4LF8Q 4UCRA 1WCMH 3F1ZA 1PRTD 3SHLA 5K5PA 5DQGA 5DGBA 3I4LA 1I4QA 2FLPA 2PW7A 3GTLH 1T36A 2J6UA 4LF9L 2AUKA 1EZ1A 3KOJA 4RMFA 2JA9A 2V4DA 4CGYB 1AE2A 4DR1L 1IBLQ 3CCEA 4DR6L 5IGBA 1VQIA 1T5XD 4XQNA 1FNWA 1FGUA 1WOCA 5C3XA 1A3VA 2KHIA 2JA6A 5LMUL 2NWGA 1LTBD 1JWUD 4QJFA 4UP7A 4O0AA 4HQ6A 4DGZA 1VQ4A 1SDFA 2ZXPA 5KKNB 1TWHA 1EUJA 5KG4A 2WINB 3K5HA 5KFNA 1STGA 2EDGA 4YB8B 4F4WA 2R6GA 3SE0A 5BR8H 1H9SB 3TMEA 1NNXA 1D7QA 4RGMA 1MBYA 3PGZA 4TVAB 3MR2A 2VPQA 4B3SH 2XWBB 3H0GH 5C0XI 5COYA 2HQLA 2ZJTA 2R7NA 5JH7F 3NENA 2G9DA 3ULPA 3SGIA 1X3EA 2VQDA 4LF8L 4X62H 2FINB 1TQOA 5ELNA 3U4ZA 4OO1G 4XYOA 1Y1WA 2ZM6L 1BXRA 1I5FA 3K5OA 2IL8A 4IWXA 3EPIA 4A3FB 5IT9W 2IJ0A 5DQIA 5J1ZA 1PTOB 4XZ3B 3OTOQ 1LLRD 4C1NK 1SNQA 2E2IB 3T1YQ 3TS2A 4C3JG 2NZHA 1TS5A 4ECTA 1J9OA 4B3MH 4EBEA 2B2VC 4NW2A 2L11A 4C3HG 4LF4L 1K0RA 3GTOB 1DGSA 5C4HA 4UP9A 1VBGA 4O42A 1RJPA 3CCLA 2PMZA 4CKEA 4YR2A 2NZOA 1TWFB 2KQ3A 2VB2X 4P71A 1LTAD 2GA4B 1DV1A 2RDFA 1HR0L 3VPCA 2O5JC 3MFHA 3ORRA 1UC9A 1NR4A 4IO9A 2W8KA 3A8KE 4DV6L 3K5MA 2F0WA 1HZAA 2K1BA 3J80c 1YIJA 2NU9B 1WTPA 2EQSA 2Q2TA 4C5AA 4GKKH 4KI0A 1BCPD 4MN3A 4A93G 3U9SA 1NY4A 4IRKA 4DUYL 4X3SA 4KMUC 3NBHB 2NVXA 2WE6A 4IUQA 4DR4Q 2R87A 4DR3H 2K28A 3MFYA 1UC8A 1PRTF 3TP7A 2R8KA 3NWSA 1EEID 1SAPA 4A3JG 3PF5A 2W70A 3M7GA 2KA7A 3GQCA 1RD9D 2H1EA 2LXKA 3RZDH 2V4RA 1YJ9A 5DEHA 4YHHQ 1SSOA 2Q2IA 2VQFQ 2IX0A 2ZTCA 1A63A 1RK5A 1I50A 4DV1H 1STYA 3QO2A 4RU9A 3SK8A 5C3EG 5C4XG 2B8GA 2NVYB 4GOPB 4IFDJ 4MA5A 3PZPA 3SI8A 2AQ1B 4AQYQ 1GOZA 3FMAA 2F0PA 1L1OC 2RDJA 3QR8A 3HKZB 4A3DB 2K5NA 2JA7B 3SE7A 4HNUA 2E2DC 3CU7A 4XYLB 1X3FA 2B2YC 2E5LH 2YTXA 5KG3A 3AFQA 1HZ9A 1IKLA 2NTSA 3CW2C 3W3AA 3PUVA 4X64Q 1H9JA 1Q86C 5LMNQ 4OX9H 4WORA 3BQ0A 5M3FB 3J81L 1TAEA 2FKLA 3RR5A 1YI2A 2K50A 4GLAC 2A8VA 1UAPA 2EY1A 4CHTB 3RN5A 2CWPA 2B2YA 3PW2A 1T3NA 4ECRA 2R7ZB 2F0JA 5IT9E 1WCMA 4QY7A 4J9RA 4DV2Q 3GTLA 2RDGA 2K5WA 3D8GA 4ZYSA 4C3JH 2Q2UA 3GTKH 1C0AA 3NUCA 2FB9A 3KF8A 1LV9A 3GV7B 2JEBI 2VQFL 2YYAA 4YR0A 1TXYA 4C3HH 2C2DA 5DLQE 5A35A 3HOXG 2UVVA 2R61A 2MCTA 1I7NA 1U0LA 1X3GA 3OPOA 4LFBL 3ONAB 1EIYB 1HJPA 4A3EB 4LF7L 3Q8QB 1HNXH 3BVGA 2EE1A 5H1SE 2KVMA 4JBWA 2L15A 4RKBA 4CJ0B 1I6HB 4F4XA 2ASDA 5KFIA 5G3LD 4A3BG 1TWAA 4A75A 2J6TA 4QIWB 2UUBQ 2B8FA 5CYUA 1N36H 2Z6KA 2XNAC 2PNHA 2LFNA 3PO2G 3T5HA 1GHKA 1FD7D 1PLFA 2HQEA 1KAWA 2GLTA 3H0GA 4RUCA 4JK1C 5JEAG 1Y1VA 1EIHA 2CW7A 4RGOS 3G6VA 1HFNA 1PFSA 4Q0FA 3MFIA 1NSNS 4X3KA 3S1NB 5BN5A 2C5CA 1TWGA 3G6JB 2PQAB 1BCPF 5EPJA 4IZOA 2F3IA 2M9VA 4DR5H 2BQ3A 4IRDA 2X6GA 1R4PB 4A3IB 4A3JH 5KFTA 4EG0A 4I7ZC 5L1JA 5C5LA 1BJTA 5IYBH 4Y52H 3PSIA 4L5SA 3S2DH 1M90C 4BWSC 4RNNA 4J9LA 2W9AA 1JB7A 1M1KC 4JI6L 2F4IA 3H6MA 5C4XH 3VA7A 5C3EH 2A69C 1GSHA 3OWEB 1Q1BA 1GUOA 4FVMA 4IUPA 4B9WA 2JA6B 3J81j 3BA8A 1AFPA 3EN2A 1Q3LA 2R93G 2OLSA 1RYSA 1KABA 1K8AC 1TWHB 2UUBL 3WO1A 5KFFA 2LXJA 1AW7A 2BE5C 1NJIC 4PZ6A 5EWEA 4FDBA 4O4HF 5KNCA 4HNTA 3RGZA 4K5WA 3SR1A 3G6YA 2VR1A 4ABNA 4AYBA 2EJMA 3BAAA 2F0SA 3T56B 3ETJA 5K36G 3M9OB 2PZWA 4NXMH 1XMOQ 1PH2A 3BU2A 5FLXW 2BH8A 5KFLA 4JYAQ 1F77A 3GLKA 2BDOA 1EWCA 1Y1WB 1K9MC 4DV3Q 1IBLH 3DEOA 2IX1A 4DPGA 2NU8B 2IA6A 5HBRB 4XYMB 1RL2A 3KDFA 4MA0A 3C1FA 3HOUG 5KFXA 1QWYA 1JE5A 2BDNA 3RB6A 2ZTDA 1M4VA 4U7CA 3JZIA 2SCUB 2WKDA 2ATWA 1VQDA 3CAMA 2CH4W 2K14A 4LJZC 1PH3A 4A3BH 3N40P 4YWKA 4O3NA 1DIKA 2HGSA 2AGQA 1ZEQX 3N41B 1OXUA 2IMWP 1V9PA 5ELCA 1LTRD 1PZKD 1KDBA 5G3LF 2PMZB 2N3SA 2NB0A 1XTCD 4JI7Q 3PIP3 2YL2A 5IWAH 1VQMA 3CKIB 1K8OA 3RTXA 1D6EC 4UCSA 5GAHC 4DR2Q 3GIQA 1T5EA 2F3VA 3GIDA 2X69A 1IBKQ 2B2UA 2O4XA 3GTQH 2VL6A 2D2CC 3EPGA 3DEPA 4B08A 2UXDQ 1LUZA 1TVXA 3CQZH 4S3SA 2L4NA 1KC8C 1EY0A 4UCVA 2F0TA 1ICWA 3TN2A 5FO7B 2UU9H 1L2ZA 4BY7B 1SE4A 2NVXB 4JI1L 1L0WA 3Q24A 1V4YA 3NPPA 4DV4Q 4BWGB 4UPAA 3T1YH 4OWWB 1EU3A 2RVLA 1JXLA 3CCMA 4A4IA 3PF4A 3S17B 1SE3A 1EY5A 3J81c 2R7LA 3DWQA 5C44G 1JR0D 2A68C 2OWOA 2XC9A 2R86A 3AEVA 1VQPA 2A6HD 2R93H 1VAJA 1PH9A 1U9RA 1B3AA 1I50B 2F0GA 5BN3A 3KYHC 3VR6A 1KJJA 1XNRH 3BQ1A 2Z0SA 5CORA 5C6AA 5KT5A 3V6JA 4FXDA 3GTGH 3DXJC 3ETHA 2JXMB 2HT1A 2W9CA 2I0QA 1SXTA 1A15A 2KHJA 3CC7A 3TZUA 2K33A 4BA2I 4EVOA 3CVZA 2YS6A 3FP9A 3IFTA 4BBRB 1UNSA 5JJIA 1XDNA 3BYTB 3I3CA 2R92G 5K36H 4XTCS 4HSVA 3L4JA 3QZ7A 3S1RB 3T1HL 1N32L 2L12A 1JT8A 1AUVA 3MR6A 4RGTA 5A2QL 1VQ9A 5L1KA 3R93A 4K14A 5FLXE 5IP7G 3P1HA 4DR4H 1MSHA 2R8JA 4HJ5A 3JAMW 2MGSA 2UUAQ 2XWJB 2QKIC 2Z6BA 3ULJA 3EJIA 3LWEA 3I12A 3I4MB 1K1QA 5C4ZA 1WCMB 2EOTA 2IX3A 1B7YB 1I4GA 1WTQA 3GTLB 1JLLB 5EQ0A 4YHHH 1DOKA 3L4KA 5KFDA 3KF8B 3JAMi 1LTLA 2Q8IB 1XMQL 1B6SA 1VF7A 1C9OA 2CQAA 3U9OA 3CCUA 1EOVA 3HOWH 2UXCL 2CVRA 4AQYH 1U4MA 5IIFA 4LFAQ 4IZ8A 3D3RA 4KY6A 4TUYF 2HVQA 1RJRA 1STHA 3MEFA 3ULLA 3STBD 1EY6A 2MP1A 4J9OA 1X32A 1E22A 4Y8VB 1I4HA 1Z2NX 4K5XA 4LK1C 3K5LA 1TWAB 4Y7NH 1XWEA 1EZ8A 2AWNA 2QEJC 4O2DA 5GQOA 3S9WA 2E2JH 5C0XJ 1EHIA 4X64H 4B9XA 5LMNH 2ZJQA 2DWCA 2CHBD 3M3YH 3H0GB 1RCVD 2TMPA 1Y1VB 2V58A 3KFUA 1VQLA 3LWBA 2UUAL 1NE3A 1TWGB 3M7NA 1TA8A 1KQSA 2JEFA 2UVWA 4DV2H 1KLUD 3ICEA 2PNRC 2PQEA 1BBXC 4EEYA 1H9RA 2V1CC 2NTTA 4M9UA 2N55A 1RIPA 1PMRA 3W1BA 1IBMQ 5DG9A 5D65A 2V4QA 4L63B 4P73A 2F4VL 4ZLTF 4IJLA 4BY1G 4IUNA 4QUFA 3QB3A 2F0HA 4P75A 3EBEA 4R7RA 2F0UA 2W6PA 4X65Q 4X3TA 4ME5A 3HOZB 1UWVA 2BA0A 5LOVF 3F2CA 1CKMA 1BDOA 4JI2L 4GN5A 1QNUA 4JV1A 2P0AA 2VW9A 1PTOC 5DLGA 1KC7A 2W7OA 4KKTA 1HUNA 4FXKC 4EFBA 2GVBA 3DMUA 3CPWA 1IXRA 2R92H 3TP6A 1KL9A 5I6YA 5DGAA 2XRQD 4L5RC 1Q82C 2LS01 1KJ9A 2K03A 5CAEB 5KFCA 3RF2A 2OF1A 5IP7H 3K5NA 3ZJYC 5EKIA 4AYBB 3UDGA 2XCAA 3NHHA 1JDEA 5I9OA 5BR8L 3GTQA 4GZYC 3KUPA 4WD3A 4JC0A 1HNWL 3JAME 1BF4A 5CA1F 2RSOA 1NTGA 4BS9A 5HGQA 4DV5L 1WTXA 4HCSA 2L9HA 1MHWC 2I5MX 1SN8A 5KT7A 1ET9A 3VR2A 1WD0A 2M05A 4IAJA 4MV3A 5C4JH 4MV9A 2XCPA 4F50A 4JI4L 3MXGA 1XJVA 1I94Q 2OQ0A 3HGBA 4G7OC 1ZYRC 3R2IA 2FMCA 2R3ZA 2Q8TA 2WB1E 4IURA 1NMFA 3RZDB 4B3TQ 1A62A 3KDFB 5KGUA 1WH2A 2R93A 5TSSA 2MO1A 3E5NA 3L9AX 4NKLA 1JORA 2LKVA 3MFGA 1WI5A 1N34Q 2KCCA 4HYKA 3GTGA 2KENA 3DWAA 2F0NA 1SNPA 2IPKD 5JPNC 4YQWA 1DM0B 4POGA 4UFZA 2YZMA 4JV0A 5C5MA 2I07B 2RQXA 3CD6A 5CA0F 3OSOA 1CQJB 4GOPC 2DNCA 4IWYA 2H5XA 3GP7A 1XMOH 2CKZB 2YW2A 3FKIH 4LF6L 1E4EA 4K6DA 1KTKA 1TU2B 1QJOA 4JI0L 4JYAH
chains in the Genus database with same CATH topology
1I5FA 3M4PA 3GDEA 4J15A 4A3FG 2WAQE 4DAYB 1SMXA 4KLKA 1G6PA 3OTOQ 4DR7Q 2F4VQ 4DV2L 4A3IG 1VQJA 5IYDH 3S15H 3RLOA 3T1YQ 4JI8Q 1VQ7A 2UUCQ 3TS2A 3HFZB 3PO2H 1X65A 2NZHA 3K0XA 4DR3L 4LUZA 5IYCH 5IYDG 4JI3Q 4JI2Q 4HJAA 4LF4L 1K0RA 1AH9A 2NVYH 3A74A 1N34L 2NVQH 2N78A 1DGSA 1QUQB 2OCEA 4UP9A 4A3KG 2CWAA 2A1AA 3CCLA 1SFOH 1LYLA 2NZOA 4DAMA 3RN2A 1V43A 2WFWA 2JA7H 4DV1L 4JI5Q 2KBNA 4P71A 3PUYA 3JC66 3U50C 4HJ8A 2YTVA 2VQEQ 5FJ8H 3G4SA 4DV7L 1HR0L 4NXNQ 1YVCA 1N33Q 4LW1A 4IO9A 4DV0L 3RZOH 1H95A 4DV6L 1UEBA 3J80c 1HZAA 2B29A 2PMZE 5BR8Q 3PIOA 1YIJA 2EQSA 2Q2TA 4Y52H 4KI0A 4A93G 3DLLA 1NY4A 1HNZL 3PO3H 1K8GA 1HNWQ 1VQOA 4OWTB 4DUYL 3F2DA 4DV5Q 1YJWA 2RHQB 2E5LL 1FJGL 1S40A 4R4TA 3NBHB 2MO0A 5C44H 4LF9Q 3H3VI 4DR4Q 2HHHQ 4IOAA 1CSPA 2KCTA 4APVA 2R7ZH 1CSQA 1YHBA 2YV5A 4JI4Q 3H3VH 2WAQG 1PH7A 2YTYA 4DR6Q 2QGQA 1A0IA 4A3JG 3PF5A 4JV5Q 3CCVA 5M5WH 2LXKA 3RZDH 5LMUQ 1YJ9A 3U4VA 4YHHQ 4K0KL 2Q2IA 2VQFQ 2IX0A 1SLJA 2ZTCA 1A63A 2I5LX 1YITA 3K81C 5C3EG 5C4XG 3UDFA 4GOPB 2JA5G 4IFDJ 4B3RQ 1EYGA 5IT9c 3A5ZB 1I3QH 1JJGA 4AQYQ 1B8AA 3H15A 4OWXB 1L1OC 2ID0A 3CCJA 4B3MQ 3HKZG 4A3DG 4JI5L 2K5NA 1YBYA 1I6HH 1SR3A 1NMGA 2ALYB 3AQQA 1A8VA 1X3FA 3AYHB 2RCNA 1IL2A 4IFDG 1PVOA 4OONA 3W1GA 3HOWG 1OXTA 2DUDA 2YTXA 4BA1I 1WFQA 1YZ6A 3AFQA 4A3LG 1HZ9A 3CW2C 1IZ6A 1E3PA 3PUVA 4X64Q 4OO1I 1SE8A 1Q86C 3W5OA 5LMNQ 2YYZA 1X9NA 1Q7YC 4B3SL 5M3FG 4LF6Q 2K75A 4JI0Q 5GROA 1Y14B 3RR5A 2ZM6Q 5LMNW 4YCWA 4WJ4A 4A3FH 2JK8A 5GADC 2K50A 1YI2A 1HZBA 4GLAC 2E2HH 1VQGA 3RN5A 1VQ5A 2CWPA 1XMOL 2A8VA 2NVTH 4A3IH 4X62L 3TREA 1Q1EA 4QY7A 1QZHA 4LNQA 1E24A 4DV2Q 5M5XH 4JYAL 3HOVG 3I55A 2Q2UA 4C3JH 3CPFA 3GTKH 1C0AA 1X56A 2VUMG 1BVSA 5IP9G 4DUZL 4YY3L 2JEBI 1OXXK 3UE0A 2VQFL 2XTIA 1TXYA 4C3HH 4DV3L 5DLQE 3HOXG 4DR3Q 2IT1A 4GLXA 4JBKA 4BXXG 1JJ2A 1CKOA 4LF4Q 2Y0SG 1U0LA 3U58A 3GTOH 1X3GA 4LFBL 4XIGS 1VQHA 2Q2HA 4R4OA 1YNXA 4IPGA 4A3KH 1QZGA 1PHJA 1EIYB 2VY3A 1HJPA 4A3EG 4B3ML 3PCOB 1HZCA 4LF7L 1FL0A 2K4KA 5H1SE 4A3MG 1QVFA 4JBWA 2L15A 1PYBA 4DV1Q 1GKHA 1CKNA 3S1MH 3CP0A 5JEAJ 4A75A 4A3BG 3I2ZA 4DV7Q 1HR0Q 1VS0A 2EIFA 2UUBQ 2KCMA 4GNXA 1D8LA 3BZCA 2Z6KA 4DV6Q 2PNHA 1HR0W 1U5KA 3PO2G 1GVPA 1KAWA 1HNZQ 4JI7L 4QQBX 1KXLA 1PYSB 5JEAG 2MNAA 4DUYQ 1PFSA 3D0FA 2E5LQ 4BBRG 4DNIA 1FJGQ 4DR2L 4PMWA 5M5YH 3S16H 1MJEA 1IBKL 2PQAB 3EIVA 1WJJA 4GKKL 1HH2P 2F3IA 3AFPA 4KHPL 4BY1H 4YWLA 3VDYA 4GN4B 2UXDL 4OX9Q 1VQBA 4A3JH 4LWCA 1BBWA 4GS3A 1L1OB 2WB1G 3RLFA 1MIUA 1B70B 3PSIA 5IYBH 1M90C 4L5SA 3TRZA 2RHSB 4AIMA 3S2DH 4K0KQ 4DV4L 1JB7A 1M1KC 1BBUA 4JI6L 5JJLA 5C3EH 1GO3E 5C4XH 1PH5A 3PUZA 2OTLA 3M85A 2HIVA 3Q8DA 1Q1BA 3I56A 2CCZA 1VQCA 3M9BA 4A3DH 3BJUA 2JA6G 1EFWA 3GO5A 1VQFA 2VS1A 4UP8A 3J81j 4IFDI 4C2MH 2F52A 1EWIA 3EN2A 4HJ7A 2R93G 3J7A5 1GD7A 4ME3A 1Q12A 2HIXA 1K8AC 3IRBA 1EQRA 2UUBL 3KF6A 1VQNA 2LXJA 2MFIA 4A3LH 3A0JA 1NJIC 4PZ6A 1HNXQ 1K3RA 1X55A 4FDBA 1VQEA 5HY6A 3NELA 1KRSA 4A76A 2ES2A 1J6QA 5M3FH 3FHWA 4B3SQ 4UY8C 4WJ3M 2R7FA 3K8AA 2B63H 2B3GA 5IE8A 5K36G 1JMCA 1CUKA 1XMOQ 1K73C 1PH2A 4QGUA 4OX9L 3BU2A 3DM3A 3L7ZC 4X62Q 2BH8A 2GVAA 3E9HA 4L5TA 5J3BA 4AYBE 3F2BA 1PA6A 3HOVH 1X6OA 4JYAQ 3H0GG 2VUMH 3L2PA 1Y1VG 2K5HA 5IP9H 1Y1WG 4DUZQ 5AJ3L 4YY3Q 1K9MC 2FXQA 4BXXH 4DV3Q 1XNQL 2IX1A 4L5QA 4DPGA 5ELOA 3S14H 1WYDA 3FKIG 3J81i 3CMEA 1RL2A 3KDFA 4LFBQ 1KHIA 3HOUG 1VCIA 4A3EH 3RNUA 3I4NG 1P8LA 1JE5A 2UU9L 3G48A 2ZTDA 1EIFA 4LF7Q 4A3MH 4AH6A 1J5EQ 4DK6C 1YHQA 2D0OA 2ATWA 1VQDA 2OQKA 3CAMA 2K14A 3G71A 1PH3A 4A3BH 2UXBL 4YWKA 3UE1A 4LUVA 1OXUA 4IPCA 4LFAL 3HOZG 4EX5A 1HNXL 4DKAC 1V9PA 4TQUS 2IHEA 3S24A 1OXSC 2RF4A 3OW2A 2N3SA 3PIPA 1XPRA 4MZ9A 1P16A 1E7ZA 3CCSA 4JI7Q 1LM0A 4H02A 3MXNB 1VQMA 1TWCH 1XNRL 3S1NH 1UE7A 5GAHC 4DR2Q 2K52A 1N36L 2JA8G 4JOIA 1IBKQ 4R4CA 4GKKQ 1BKBA 3S1RH 3GTQH 4NB3A 2VL6A 4ALPA 4KHPQ 4MTNA 2UXDQ 4X66L 1LUZA 3CQZH 1JJCB 5FJ8G 1Q81C 1KC8C 2NN6G 4AYBG 2VZAA 1YHAA 3F8TA 3E9IA 4BY7G 2D0PA 3K80C 3OYYA 4DR5L 4JI1L 1L0WA 4LF5L 4DV4Q 4UPAA 4JI6Q 3PO3G 4P72A 4GNXC 4PZ7A 2Z6KC 4OO1G 4OWWB 2VNUD 3TQYA 3CCMA 4A4IA 3PF4A 2ZTEA 3I7FA 1S72A 1PH8A 3J81c 1IBML 3GD7A 4LFCL 5FLXc 5C44G 1J5EL 2OWOA 2JA6H 3AEVA 1VQPA 1QUQA 2R93H 1PH9A 2D62A 3K7AH 4HIOA 4GKJQ 1TWHH 3KYHC 3TS0A 3STBC 3G6EA 2Z0SA 4X65L 1G51A 2JEAI 3TEHB 1MKHA 3UDXA 2BA1A 1KD1C 3GTGH 2HT1A 4IOCA 4GLVB 2I0QA 4A93H 4A3CG 2KHJA 3CC7A 4JG2A 5EAYA 4BA2I 3B6YA 1FVIA 5GAEC 3CXCA 3FP9A 4RG1A 1TWAH 1W2BA 5JJIA 2PI2A 3CCRA 1SROA 2R92G 4XTCS 1R9TH 4BBSG 2JJQA 3T1HL 1N32L 1JT8A 4HIDA 1VQ9A 5IWAQ 3K7UC 1EQQA 4A3CH 1YEZA 1Y1VH 5IP7G 3PUWA 1Y1WH 2PI2E 3KJOA 2K5VA 5FLMG 4HJ5A 2ASBA 1TWGH 4PZ8A 1PH6A 4NXML 1N9WA 5AJ3Q 2UUAQ 2CQOA 5GAGC 3ULJA 1XNQQ 2JA5H 4IJHA 2AKWB 3ERSX 4HIKA 1WCMG 4KHZA 4R1JA 3I4MG 3I4NH 4C3IH 1B7YB 4EQ5A 2AHOB 3NEMA 2UU9Q 3PV0A 1V1QA 4GOPA 1I94L 3KF8B 1C7YA 1IBLL 3J7ZC 1IYJB 3JAMi 1LTLA 1Z47A 1XMQL 3S2HH 1NBWA 4JCVE 3CF5A 1X54A 4GKJL 1C9OA 2UXBQ 3CCUA 1EOVA 4IPHA 2IY5B 3HKSA 3HOWH 2UXCL 5IY0A 4B3TL 1Z9FA 3HOZH 1VQ8A 3M4OH 4LFAQ 1Q8KA 1SRUA 1ASZA 3MEFA 3ULLA 4A3GG 3STBD 4JBMA 3CC2A 3A5UA 2AMCB 1E22A 1PH1A 1XNRQ 1CKNB 3HKZE 4Y7NH 5GQOA 2AWNA 3I4OA 4O2DA 2JA8H 2E2JH 5C0XJ 1N36Q 1S3OA 1UE1A 3HOYG 1VQKA 4R4QA 4GNXB 2NN6I 2ZJQA 5IWAL 4QL5A 4X66Q 3M4QA 1XPOA 1QVCA 3M3YH 3KLWA 1XTDA 1YJNA 3KFUA 4BY7H 1VQLA 5C0XG 2NVXH 2UUAL 1NE3A 5M3MG 3HOXH 1GM5A 4DR5Q 4JI1Q 1PV4A 3M7NA 1L2FA 1KQSA 1ASYA 4LF5Q 1VQAA 2DGYA 5E7NA 3ICEA 1MJCA 2V1CC 2MQHA 3S17H 1T9HA 4OXPA 2QEXA 1RIPA 3W1BA 1IBMQ 4IPDA 4YWMA 4LFCQ 3L0OA 4P73A 3OTOL 1G291 1OTCA 3CC4A 2F4VL 4DR7L 4IJLA 4BY1G 4DR1Q 4NPSA 2XGTA 1I50H 3T1YL 2ZJRA 1KIXA 4JOIC 4JI8L 4P75A 3JAMc 3KJPA 2LSSA 1W3SA 3EBEA 2UUCL 2C35B 3CMAA 3GTPH 2JE6I 4X65Q 2N8NA 4P74A 5IYBG 1UWVA 2BA0A 2WP8J 4R4IA 3F2CA 1CKMA 4JI3L 2E8GA 2Y0SE 4LUOA 4GN5A 4POFA 5IYCG 4JI2L 1OXVA 1K83H 3E0EA 2VW9A 1VQ6A 4PG3A 1E1OA 2GVBA 4GN3B 3PUXA 4BBRH 2B63G 3CPWA 1AE3A 1IXRA 4HIMA 2R92H 1KL9A 2BH2A 4BBSH 3KF6B 3GTMH 2JA7G 4L5RC 4MNOA 1Q82C 3T1HQ 2I5HA 3LGJA 4DK3C 4NXNL 2VQEL 4QIWE 4HJ9A 1N33L 1N32Q 2JQOA 1KRTA 2PQAA 5IP7H 3ZJYC 3UDGA 3CCQA 2YU9H 5FLMH 5BR8L 2OTJA 4JC0A 1QVGA 4NXMQ 1HNWL 4X6AH 1NTGA 5HGQA 4LF8Q 1L1OA 1WCMH 3F1ZA 4DV5L 3I4MH 2I5MX 1SN8A 1E1TA 3GTLH 4DR4L 4LF9L 2HHHL 3KOJA 5C4JH 4RMFA 2JA9A 4JI4L 2ZJPA 1XJVA 2A19A 1AE2A 4DR1L 2OQ0A 1I94Q 3CCEA 3UDIA 1XMQQ 1IBLQ 2R7ZG 4DR6L 1VQIA 2E2IH 4JV5L 3BZKA 1FGUA 1WOCA 2WB1E 2KHIA 5LMUL 2UXCQ 4QJFA 2QA4A 1NMFA 4UP7A 1UE5A 4O0AA 4YHHL 1A62A 3KDFB 4B3TQ 1VQ4A 2MO1A 4A3GH 2N49A 1EUJA 3S1QH 4B3RL 1WI5A 1N34Q 2AWOA 4AQYL 2KENA 2R6GA 4JBJA 1TWFH 2IHFA 3D31A 3WWVA 3HOYH 1O7IA 4POGA 1D7QA 3PGZA 2R7DA 4TVAB 3CD6A 3RLNA 4YCVA 2CFMA 3ER0A 3H0GH 5C0XI 4YCUA 3J80i 4GOPC 1N8RC 1PH4A 2HQLA 2EXDA 4DV0Q 2GN5A 2H5XA 5JJKA 1UE6A 3NENA 5M3MH 4X64L 2CKZB 5LMNL 3ULPA 3SGIA 1X3EA 3GTJH 3FKIH 4LF8L 4LF6L 1Q46A 1XPUA 4JI0L 3U4ZA 5ELNA 3HOUH 2ZM6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5F A;  3M4P A;  3GDE A;  4J15 A;  4A3F G;  2WAQ E;  4DAY B;  1SMX A;  4KLK A;  1G6P A;  3OTO Q;  4DR7 Q;  2F4V Q;  4DV2 L;  4A3I G;  1VQJ A;  5IYD H;  3S15 H;  3RLO A;  3T1Y Q;  4JI8 Q;  1VQ7 A;  2UUC Q;  3TS2 A;  3HFZ B;  3PO2 H;  1X65 A;  2NZH A;  3K0X A;  4DR3 L;  4LUZ A;  5IYC H;  5IYD G;  4JI3 Q;  4JI2 Q;  4HJA A;  4LF4 L;  1K0R A;  1AH9 A;  2NVY H;  3A74 A;  1N34 L;  2NVQ H;  2N78 A;  1DGS A;  1QUQ B;  2OCE A;  4UP9 A;  4A3K G;  2CWA A;  2A1A A;  3CCL A;  1SFO H;  1LYL A;  2NZO A;  4DAM A;  3RN2 A;  1V43 A;  2WFW A;  2JA7 H;  4DV1 L;  4JI5 Q;  2KBN A;  4P71 A;  3PUY A;  3JC6 6;  3U50 C;  4HJ8 A;  2YTV A;  2VQE Q;  5FJ8 H;  3G4S A;  4DV7 L;  1HR0 L;  4NXN Q;  1YVC A;  1N33 Q;  4LW1 A;  4IO9 A;  4DV0 L;  3RZO H;  1H95 A;  4DV6 L;  1UEB A;  3J80 c;  1HZA A;  2B29 A;  2PMZ E;  5BR8 Q;  3PIO A;  1YIJ A;  2EQS A;  2Q2T A;  4Y52 H;  4KI0 A;  4A93 G;  3DLL A;  1NY4 A;  1HNZ L;  3PO3 H;  1K8G A;  1HNW Q;  1VQO A;  4OWT B;  4DUY L;  3F2D A;  4DV5 Q;  1YJW A;  2RHQ B;  2E5L L;  1FJG L;  1S40 A;  4R4T A;  3NBH B;  2MO0 A;  5C44 H;  4LF9 Q;  3H3V I;  4DR4 Q;  2HHH Q;  4IOA A;  1CSP A;  2KCT A;  4APV A;  2R7Z H;  1CSQ A;  1YHB A;  2YV5 A;  4JI4 Q;  3H3V H;  2WAQ G;  1PH7 A;  2YTY A;  4DR6 Q;  2QGQ A;  1A0I A;  4A3J G;  3PF5 A;  4JV5 Q;  3CCV A;  5M5W H;  2LXK A;  3RZD H;  5LMU Q;  1YJ9 A;  3U4V A;  4YHH Q;  4K0K L;  2Q2I A;  2VQF Q;  2IX0 A;  1SLJ A;  2ZTC A;  1A63 A;  2I5L X;  1YIT A;  3K81 C;  5C3E G;  5C4X G;  3UDF A;  4GOP B;  2JA5 G;  4IFD J;  4B3R Q;  1EYG A;  5IT9 c;  3A5Z B;  1I3Q H;  1JJG A;  4AQY Q;  1B8A A;  3H15 A;  4OWX B;  1L1O C;  2ID0 A;  3CCJ A;  4B3M Q;  3HKZ G;  4A3D G;  4JI5 L;  2K5N A;  1YBY A;  1I6H H;  1SR3 A;  1NMG A;  2ALY B;  3AQQ A;  1A8V A;  1X3F A;  3AYH B;  2RCN A;  1IL2 A;  4IFD G;  1PVO A;  4OON A;  3W1G A;  3HOW G;  1OXT A;  2DUD A;  2YTX A;  4BA1 I;  1WFQ A;  1YZ6 A;  3AFQ A;  4A3L G;  1HZ9 A;  3CW2 C;  1IZ6 A;  1E3P A;  3PUV A;  4X64 Q;  4OO1 I;  1SE8 A;  1Q86 C;  3W5O A;  5LMN Q;  2YYZ A;  1X9N A;  1Q7Y C;  4B3S L;  5M3F G;  4LF6 Q;  2K75 A;  4JI0 Q;  5GRO A;  1Y14 B;  3RR5 A;  2ZM6 Q;  5LMN W;  4YCW A;  4WJ4 A;  4A3F H;  2JK8 A;  5GAD C;  2K50 A;  1YI2 A;  1HZB A;  4GLA C;  2E2H H;  1VQG A;  3RN5 A;  1VQ5 A;  2CWP A;  1XMO L;  2A8V A;  2NVT H;  4A3I H;  4X62 L;  3TRE A;  1Q1E A;  4QY7 A;  1QZH A;  4LNQ A;  1E24 A;  4DV2 Q;  5M5X H;  4JYA L;  3HOV G;  3I55 A;  2Q2U A;  4C3J H;  3CPF A;  3GTK H;  1C0A A;  1X56 A;  2VUM G;  1BVS A;  5IP9 G;  4DUZ L;  4YY3 L;  2JEB I;  1OXX K;  3UE0 A;  2VQF L;  2XTI A;  1TXY A;  4C3H H;  4DV3 L;  5DLQ E;  3HOX G;  4DR3 Q;  2IT1 A;  4GLX A;  4JBK A;  4BXX G;  1JJ2 A;  1CKO A;  4LF4 Q;  2Y0S G;  1U0L A;  3U58 A;  3GTO H;  1X3G A;  4LFB L;  4XIG S;  1VQH A;  2Q2H A;  4R4O A;  1YNX A;  4IPG A;  4A3K H;  1QZG A;  1PHJ A;  1EIY B;  2VY3 A;  1HJP A;  4A3E G;  4B3M L;  3PCO B;  1HZC A;  4LF7 L;  1FL0 A;  2K4K A;  5H1S E;  4A3M G;  1QVF A;  4JBW A;  2L15 A;  1PYB A;  4DV1 Q;  1GKH A;  1CKN A;  3S1M H;  3CP0 A;  5JEA J;  4A75 A;  4A3B G;  3I2Z A;  4DV7 Q;  1HR0 Q;  1VS0 A;  2EIF A;  2UUB Q;  2KCM A;  4GNX A;  1D8L A;  3BZC A;  2Z6K A;  4DV6 Q;  2PNH A;  1HR0 W;  1U5K A;  3PO2 G;  1GVP A;  1KAW A;  1HNZ Q;  4JI7 L;  4QQB X;  1KXL A;  1PYS B;  5JEA G;  2MNA A;  4DUY Q;  1PFS A;  3D0F A;  2E5L Q;  4BBR G;  4DNI A;  1FJG Q;  4DR2 L;  4PMW A;  5M5Y H;  3S16 H;  1MJE A;  1IBK L;  2PQA B;  3EIV A;  1WJJ A;  4GKK L;  1HH2 P;  2F3I A;  3AFP A;  4KHP L;  4BY1 H;  4YWL A;  3VDY A;  4GN4 B;  2UXD L;  4OX9 Q;  1VQB A;  4A3J H;  4LWC A;  1BBW A;  4GS3 A;  1L1O B;  2WB1 G;  3RLF A;  1MIU A;  1B70 B;  3PSI A;  5IYB H;  1M90 C;  4L5S A;  3TRZ A;  2RHS B;  4AIM A;  3S2D H;  4K0K Q;  4DV4 L;  1JB7 A;  1M1K C;  1BBU A;  4JI6 L;  5JJL A;  5C3E H;  1GO3 E;  5C4X H;  1PH5 A;  3PUZ A;  2OTL A;  3M85 A;  2HIV A;  3Q8D A;  1Q1B A;  3I56 A;  2CCZ A;  1VQC A;  3M9B A;  4A3D H;  3BJU A;  2JA6 G;  1EFW A;  3GO5 A;  1VQF A;  2VS1 A;  4UP8 A;  3J81 j;  4IFD I;  4C2M H;  2F52 A;  1EWI A;  3EN2 A;  4HJ7 A;  2R93 G;  3J7A 5;  1GD7 A;  4ME3 A;  1Q12 A;  2HIX A;  1K8A C;  3IRB A;  1EQR A;  2UUB L;  3KF6 A;  1VQN A;  2LXJ A;  2MFI A;  4A3L H;  3A0J A;  1NJI C;  4PZ6 A;  1HNX Q;  1K3R A;  1X55 A;  4FDB A;  1VQE A;  5HY6 A;  3NEL A;  1KRS A;  4A76 A;  2ES2 A;  1J6Q A;  5M3F H;  3FHW A;  4B3S Q;  4UY8 C;  4WJ3 M;  2R7F A;  3K8A A;  2B63 H;  2B3G A;  5IE8 A;  5K36 G;  1JMC A;  1CUK A;  1XMO Q;  1K73 C;  1PH2 A;  4QGU A;  4OX9 L;  3BU2 A;  3DM3 A;  3L7Z C;  4X62 Q;  2BH8 A;  2GVA A;  3E9H A;  4L5T A;  5J3B A;  4AYB E;  3F2B A;  1PA6 A;  3HOV H;  1X6O A;  4JYA Q;  3H0G G;  2VUM H;  3L2P A;  1Y1V G;  2K5H A;  5IP9 H;  1Y1W G;  4DUZ Q;  5AJ3 L;  4YY3 Q;  1K9M C;  2FXQ A;  4BXX H;  4DV3 Q;  1XNQ L;  2IX1 A;  4L5Q A;  4DPG A;  5ELO A;  3S14 H;  1WYD A;  3FKI G;  3J81 i;  3CME A;  1RL2 A;  3KDF A;  4LFB Q;  1KHI A;  3HOU G;  1VCI A;  4A3E H;  3RNU A;  3I4N G;  1P8L A;  1JE5 A;  2UU9 L;  3G48 A;  2ZTD A;  1EIF A;  4LF7 Q;  4A3M H;  4AH6 A;  1J5E Q;  4DK6 C;  1YHQ A;  2D0O A;  2ATW A;  1VQD A;  2OQK A;  3CAM A;  2K14 A;  3G71 A;  1PH3 A;  4A3B H;  2UXB L;  4YWK A;  3UE1 A;  4LUV A;  1OXU A;  4IPC A;  4LFA L;  3HOZ G;  4EX5 A;  1HNX L;  4DKA C;  1V9P A;  4TQU S;  2IHE A;  3S24 A;  1OXS C;  2RF4 A;  3OW2 A;  2N3S A;  3PIP A;  1XPR A;  4MZ9 A;  1P16 A;  1E7Z A;  3CCS A;  4JI7 Q;  1LM0 A;  4H02 A;  3MXN B;  1VQM A;  1TWC H;  1XNR L;  3S1N H;  1UE7 A;  5GAH C;  4DR2 Q;  2K52 A;  1N36 L;  2JA8 G;  4JOI A;  1IBK Q;  4R4C A;  4GKK Q;  1BKB A;  3S1R H;  3GTQ H;  4NB3 A;  2VL6 A;  4ALP A;  4KHP Q;  4MTN A;  2UXD Q;  4X66 L;  1LUZ A;  3CQZ H;  1JJC B;  5FJ8 G;  1Q81 C;  1KC8 C;  2NN6 G;  4AYB G;  2VZA A;  1YHA A;  3F8T A;  3E9I A;  4BY7 G;  2D0P A;  3K80 C;  3OYY A;  4DR5 L;  4JI1 L;  1L0W A;  4LF5 L;  4DV4 Q;  4UPA A;  4JI6 Q;  3PO3 G;  4P72 A;  4GNX C;  4PZ7 A;  2Z6K C;  4OO1 G;  4OWW B;  2VNU D;  3TQY A;  3CCM A;  4A4I A;  3PF4 A;  2ZTE A;  3I7F A;  1S72 A;  1PH8 A;  3J81 c;  1IBM L;  3GD7 A;  4LFC L;  5FLX c;  5C44 G;  1J5E L;  2OWO A;  2JA6 H;  3AEV A;  1VQP A;  1QUQ A;  2R93 H;  1PH9 A;  2D62 A;  3K7A H;  4HIO A;  4GKJ Q;  1TWH H;  3KYH C;  3TS0 A;  3STB C;  3G6E A;  2Z0S A;  4X65 L;  1G51 A;  2JEA I;  3TEH B;  1MKH A;  3UDX A;  2BA1 A;  1KD1 C;  3GTG H;  2HT1 A;  4IOC A;  4GLV B;  2I0Q A;  4A93 H;  4A3C G;  2KHJ A;  3CC7 A;  4JG2 A;  5EAY A;  4BA2 I;  3B6Y A;  1FVI A;  5GAE C;  3CXC A;  3FP9 A;  4RG1 A;  1TWA H;  1W2B A;  5JJI A;  2PI2 A;  3CCR A;  1SRO A;  2R92 G;  4XTC S;  1R9T H;  4BBS G;  2JJQ A;  3T1H L;  1N32 L;  1JT8 A;  4HID A;  1VQ9 A;  5IWA Q;  3K7U C;  1EQQ A;  4A3C H;  1YEZ A;  1Y1V H;  5IP7 G;  3PUW A;  1Y1W H;  2PI2 E;  3KJO A;  2K5V A;  5FLM G;  4HJ5 A;  2ASB A;  1TWG H;  4PZ8 A;  1PH6 A;  4NXM L;  1N9W A;  5AJ3 Q;  2UUA Q;  2CQO A;  5GAG C;  3ULJ A;  1XNQ Q;  2JA5 H;  4IJH A;  2AKW B;  3ERS X;  4HIK A;  1WCM G;  4KHZ A;  4R1J A;  3I4M G;  3I4N H;  4C3I H;  1B7Y B;  4EQ5 A;  2AHO B;  3NEM A;  2UU9 Q;  3PV0 A;  1V1Q A;  4GOP A;  1I94 L;  3KF8 B;  1C7Y A;  1IBL L;  3J7Z C;  1IYJ B;  3JAM i;  1LTL A;  1Z47 A;  1XMQ L;  3S2H H;  1NBW A;  4JCV E;  3CF5 A;  1X54 A;  4GKJ L;  1C9O A;  2UXB Q;  3CCU A;  1EOV A;  4IPH A;  2IY5 B;  3HKS A;  3HOW H;  2UXC L;  5IY0 A;  4B3T L;  1Z9F A;  3HOZ H;  1VQ8 A;  3M4O H;  4LFA Q;  1Q8K A;  1SRU A;  1ASZ A;  3MEF A;  3ULL A;  4A3G G;  3STB D;  4JBM A;  3CC2 A;  3A5U A;  2AMC B;  1E22 A;  1PH1 A;  1XNR Q;  1CKN B;  3HKZ E;  4Y7N H;  5GQO A;  2AWN A;  3I4O A;  4O2D A;  2JA8 H;  2E2J H;  5C0X J;  1N36 Q;  1S3O A;  1UE1 A;  3HOY G;  1VQK A;  4R4Q A;  4GNX B;  2NN6 I;  2ZJQ A;  5IWA L;  4QL5 A;  4X66 Q;  3M4Q A;  1XPO A;  1QVC A;  3M3Y H;  3KLW A;  1XTD A;  1YJN A;  3KFU A;  4BY7 H;  1VQL A;  5C0X G;  2NVX H;  2UUA L;  1NE3 A;  5M3M G;  3HOX H;  1GM5 A;  4DR5 Q;  4JI1 Q;  1PV4 A;  3M7N A;  1L2F A;  1KQS A;  1ASY A;  4LF5 Q;  1VQA A;  2DGY A;  5E7N A;  3ICE A;  1MJC A;  2V1C C;  2MQH A;  3S17 H;  1T9H A;  4OXP A;  2QEX A;  1RIP A;  3W1B A;  1IBM Q;  4IPD A;  4YWM A;  4LFC Q;  3L0O A;  4P73 A;  3OTO L;  1G29 1;  1OTC A;  3CC4 A;  2F4V L;  4DR7 L;  4IJL A;  4BY1 G;  4DR1 Q;  4NPS A;  2XGT A;  1I50 H;  3T1Y L;  2ZJR A;  1KIX A;  4JOI C;  4JI8 L;  4P75 A;  3JAM c;  3KJP A;  2LSS A;  1W3S A;  3EBE A;  2UUC L;  2C35 B;  3CMA A;  3GTP H;  2JE6 I;  4X65 Q;  2N8N A;  4P74 A;  5IYB G;  1UWV A;  2BA0 A;  2WP8 J;  4R4I A;  3F2C A;  1CKM A;  4JI3 L;  2E8G A;  2Y0S E;  4LUO A;  4GN5 A;  4POF A;  5IYC G;  4JI2 L;  1OXV A;  1K83 H;  3E0E A;  2VW9 A;  1VQ6 A;  4PG3 A;  1E1O A;  2GVB A;  4GN3 B;  3PUX A;  4BBR H;  2B63 G;  3CPW A;  1AE3 A;  1IXR A;  4HIM A;  2R92 H;  1KL9 A;  2BH2 A;  4BBS H;  3KF6 B;  3GTM H;  2JA7 G;  4L5R C;  4MNO A;  1Q82 C;  3T1H Q;  2I5H A;  3LGJ A;  4DK3 C;  4NXN L;  2VQE L;  4QIW E;  4HJ9 A;  1N33 L;  1N32 Q;  2JQO A;  1KRT A;  2PQA A;  5IP7 H;  3ZJY C;  3UDG A;  3CCQ A;  2YU9 H;  5FLM H;  5BR8 L;  2OTJ A;  4JC0 A;  1QVG A;  4NXM Q;  1HNW L;  4X6A H;  1NTG A;  5HGQ A;  4LF8 Q;  1L1O A;  1WCM H;  3F1Z A;  4DV5 L;  3I4M H;  2I5M X;  1SN8 A;  1E1T A;  3GTL H;  4DR4 L;  4LF9 L;  2HHH L;  3KOJ A;  5C4J H;  4RMF A;  2JA9 A;  4JI4 L;  2ZJP A;  1XJV A;  2A19 A;  1AE2 A;  4DR1 L;  2OQ0 A;  1I94 Q;  3CCE A;  3UDI A;  1XMQ Q;  1IBL Q;  2R7Z G;  4DR6 L;  1VQI A;  2E2I H;  4JV5 L;  3BZK A;  1FGU A;  1WOC A;  2WB1 E;  2KHI A;  5LMU L;  2UXC Q;  4QJF A;  2QA4 A;  1NMF A;  4UP7 A;  1UE5 A;  4O0A A;  4YHH L;  1A62 A;  3KDF B;  4B3T Q;  1VQ4 A;  2MO1 A;  4A3G H;  2N49 A;  1EUJ A;  3S1Q H;  4B3R L;  1WI5 A;  1N34 Q;  2AWO A;  4AQY L;  2KEN A;  2R6G A;  4JBJ A;  1TWF H;  2IHF A;  3D31 A;  3WWV A;  3HOY H;  1O7I A;  4POG A;  1D7Q A;  3PGZ A;  2R7D A;  4TVA B;  3CD6 A;  3RLN A;  4YCV A;  2CFM A;  3ER0 A;  3H0G H;  5C0X I;  4YCU A;  3J80 i;  4GOP C;  1N8R C;  1PH4 A;  2HQL A;  2EXD A;  4DV0 Q;  2GN5 A;  2H5X A;  5JJK A;  1UE6 A;  3NEN A;  5M3M H;  4X64 L;  2CKZ B;  5LMN L;  3ULP A;  3SGI A;  1X3E A;  3GTJ H;  3FKI H;  4LF8 L;  4LF6 L;  1Q46 A;  1XPU A;  4JI0 L;  3U4Z A;  5ELN A;  3HOU H;  2ZM6 L; 
#chains in the Genus database with same CATH topology
 3GDE A;  4J15 A;  3K6O A;  1EFI D;  4DV3 H;  4XXE A;  1XYI A;  1G6P A;  1GSA A;  1FGB D;  4DR7 Q;  3OMC A;  4UAI A;  1VQJ A;  3S15 H;  2ICE C;  1G6Z A;  4JI8 Q;  1VQ7 A;  4HMJ A;  2UUC Q;  1GUG A;  4EQO A;  4RAZ A;  1X65 A;  4MIU A;  4C3J B;  3J80 L;  4XT1 B;  3TP8 A;  4DR3 L;  4C2M A;  4CC5 A;  2DPI A;  2C9O A;  1E4G T;  4JI3 Q;  3BJY A;  1AH9 A;  2PZT A;  2V5A A;  2ZXO A;  3A74 A;  1N34 L;  2NVQ H;  1DXM A;  3N44 B;  2G9H D;  1SYF A;  5KFU A;  1B2T A;  4A3K G;  3TBI B;  4MHE A;  2W9B A;  2WFW A;  4DV1 L;  4JI5 Q;  1A3T A;  5E4X A;  2RA4 A;  3JC6 6;  2W9C B;  4LAA A;  3G4S A;  3OHX C;  4DV7 L;  1N33 Q;  4RB2 C;  1YVC A;  1PFB A;  4LW1 A;  4DR2 H;  1WTH A;  3RZO H;  3VMM A;  1SYB A;  1UEB A;  1IBK H;  2KEE A;  1CK1 A;  1E0B A;  3F2U A;  1HNZ L;  5IGC A;  1O80 A;  2UXD H;  4U67 3;  1S5D D;  3F2D A;  3PR4 A;  3PW0 A;  2E5L L;  2RHQ B;  4R4T A;  4ECS A;  2MO0 A;  2R82 A;  1B1Z A;  4LF9 Q;  3K5I A;  1LT5 D;  1DOM A;  3IAY A;  4K2K A;  2MUY A;  2YV5 A;  5D3D A;  3H3V H;  2WAQ G;  3Q8R B;  4DV4 H;  1F2Z A;  2EYP A;  1B33 N;  4DR6 Q;  1JOK A;  4WBN F;  3KHH A;  4ECY A;  1PYW D;  4ZKB B;  4ZUI A;  5LMU Q;  5BPF A;  3S2D B;  4K0K L;  3LX0 A;  1HTL D;  3OSN A;  3R5X A;  4CC6 A;  3PQI A;  5C3E B;  5C4X B;  2JA5 G;  3I70 A;  5KFJ A;  1O7Y A;  2MPM A;  3OW7 A;  1JJG A;  1PZI D;  2KCN A;  2W6N A;  4C3I G;  3H15 A;  4OWX B;  1B53 A;  3CCJ A;  4O4I F;  2C22 A;  5I9P A;  2R7M A;  4JI5 L;  4F4Z A;  2BQU A;  1NMG A;  3AQQ A;  2RCN A;  1IL2 A;  1PVO A;  2H4O A;  4EGJ A;  5EGT A;  1OXT A;  1YZ6 A;  4A3L G;  4KKS A;  1G2S A;  5EPK A;  1K1S A;  2RKS A;  3V96 A;  4OO1 I;  1SE8 A;  2AGP A;  1EOT A;  1Z2P X;  1PFM A;  2DJG C;  4UDU C;  2YYZ A;  1VKZ A;  1U4R A;  5JVL A;  4DL3 A;  5GRO A;  2HDM A;  2ZM6 Q;  5LMN W;  4WJ4 A;  2JK8 A;  2E2H H;  1O75 A;  2B63 G;  1ULZ A;  1VQG A;  4MTD A;  4ZAI A;  5CR3 A;  4FF3 A;  2FK2 A;  3TIG A;  5KYL A;  1S0O A;  1R4Q B;  3OSP A;  4IR1 A;  5M5X H;  5KT6 A;  4X3U A;  3HOV G;  3CPF A;  2E74 C;  1LTS D;  2VUM G;  3MR3 A;  5IP9 G;  4DUZ L;  4YY3 L;  3UE0 A;  4FS1 A;  1QOH A;  1IOW A;  1CKO A;  4LF4 Q;  4M8A A;  4HNV A;  1B9M A;  1LAC A;  1X3Q A;  1EUD B;  1CT1 D;  2Q2H A;  4A3K H;  4YAJ B;  5L1I A;  2VY3 A;  1I3Q B;  3JRX A;  4PMC A;  5DLF A;  4LFA H;  2YZN A;  3BG5 A;  1ICF B;  1HZC A;  2W57 A;  5KFV A;  1QVF A;  1VMP A;  2XN9 C;  1ENF A;  1CKN A;  3S1M H;  4DNR B;  4A3B B;  3I2Z A;  1HR0 Q;  1VS0 A;  2RBM A;  3P7J A;  4E6I A;  4GNX A;  3BZC A;  4DV6 Q;  4Q0Y A;  2QIL A;  1H9K A;  1XXG A;  2MNA A;  2EJF C;  4DUY Q;  4ED8 A;  2MJ8 A;  4DNI A;  5M5Y H;  2WDT A;  2JEI A;  4KD3 A;  4QWA A;  1WJJ A;  2A5H A;  1HH2 P;  4WFN 3;  3FKI A;  4KHP L;  3VDY A;  2WAC A;  1O7Z A;  4PNY A;  3GTQ B;  3H4D A;  1MGS A;  4L8J A;  4U68 A;  1TII D;  3OMG A;  1BQQ T;  3P75 A;  2WB1 G;  1MIU A;  1IBM H;  3RIZ A;  4AIM A;  1BXT A;  1GJX A;  1GYF A;  1KJI A;  3LP8 A;  2UVU A;  5JJL A;  1PH5 A;  1GO3 E;  2HD3 A;  1CQF A;  1JCK B;  2OTL A;  5IGG A;  1EYC A;  2UVR A;  3I56 A;  4X65 H;  3M9B A;  3GQB A;  3BZD B;  3BJU A;  1ZQ7 A;  1EY9 A;  1CQV A;  1D5Z C;  2AQ4 A;  1EWI A;  4Q5V A;  4HJ7 A;  2R93 B;  3T53 B;  1GD7 A;  4EGQ A;  1Q12 A;  1EQR A;  1SBB B;  5KFG A;  2KUM A;  5EBC A;  2MFI A;  4A3L H;  1LTG D;  4I7H A;  3GTG B;  3A0J A;  5I2Y A;  4IHJ F;  3DUZ A;  1WTV A;  3QG1 A;  5HY6 A;  3NEL A;  4ILW A;  4DL5 A;  2CW0 C;  5LL6 S;  2ES2 A;  3A56 A;  3BAB A;  2R7F A;  1DJR D;  3KLR A;  5KFR A;  3K8A A;  2B63 H;  5IE8 A;  4MV6 A;  3JRW A;  3SXH A;  1CUK A;  3QJY A;  1IW7 C;  3KK7 A;  3MA2 B;  4QGU A;  1K73 C;  3DM3 A;  4I50 F;  3E9H A;  3HOV H;  1RF2 D;  2LMC B;  4FF1 A;  2VUM H;  1EY8 A;  1E4E B;  4FO2 A;  5IP9 H;  4ZUJ A;  1AZQ A;  5KFW A;  5I47 A;  4P2C B;  5AJ3 L;  1I94 H;  1XNQ L;  4O3Q A;  4GKJ H;  1WYD A;  2FPP B;  4LMQ D;  3C1E A;  3CME A;  4XYQ A;  4LFB Q;  1KHI A;  4PQX A;  5KG7 A;  4HCE A;  3I4N G;  1BO0 A;  4B3T H;  1S5E D;  2UU9 L;  3G48 A;  3JSL A;  5IGF A;  4RCN A;  4LF7 Q;  1J5E Q;  4KY5 A;  2A69 D;  4O2B F;  3R8B A;  4DL2 A;  1SCU B;  4C2M B;  3G71 A;  2UXB L;  2L5T A;  2C00 A;  3A8I E;  4LUV A;  1RKN A;  3HOW B;  3FPU B;  2PPB C;  4EX5 A;  4ZHQ F;  4J9M A;  4MV1 A;  3E3X A;  1HTP A;  4TQU S;  2IHE A;  1BGW A;  5F9L A;  4ULL A;  1WVL A;  1EYZ A;  3K0Y A;  1XPR A;  2W9B B;  3CCS A;  1MI2 A;  4OO1 H;  1LM0 A;  1LT6 D;  4H02 A;  5CBA E;  1XNR L;  1C30 A;  2BE5 D;  1UE7 A;  3ERQ A;  2K52 A;  3DWP A;  4Y7N B;  2K01 A;  3RB3 A;  4JOI A;  2E2J B;  4R4C A;  3FDT A;  3KBG A;  4NB3 A;  3Q8S B;  2WV6 D;  3C0F B;  4FP5 D;  5HGT A;  1EWH A;  4X66 L;  2DZD A;  4IUU A;  5FJ8 G;  3M3Y B;  2E2H A;  2NN6 G;  2VZA A;  3F8T A;  2D0P A;  1STE A;  3K80 C;  2WKC A;  2HJW A;  4LF5 L;  1ESR A;  3LML A;  4JI6 Q;  3PO3 G;  2Z4H A;  5EZY F;  3PVX A;  2Z6K C;  2UUC H;  4JI8 H;  3TQY A;  1DD2 A;  3I7F A;  1PH8 A;  3K3V A;  2SNS A;  4HAE A;  3HEJ A;  4LFC L;  1J5E L;  2W7P A;  1QCB D;  4JI3 H;  4A3M B;  2CQY A;  1GUS A;  3BVM A;  5EPL A;  2D62 A;  3BVZ A;  3K7A H;  1SEI A;  3E0J A;  1HRJ A;  4QF4 A;  3EYY A;  2O2L D;  2JEA I;  2JEG A;  3UDX A;  4FXG C;  4GLV B;  4A93 H;  4A3C G;  3FEW X;  1ZET A;  1JOO A;  1AUX A;  4MV4 A;  1N33 H;  3TZD A;  3GIK A;  1EYD A;  4ECQ A;  4ZRZ A;  1EZ6 A;  4RG1 A;  2RSN A;  4ZI7 F;  4HED A;  1R9T H;  1E2Z A;  1QNK A;  3FVQ A;  4HID A;  1B44 D;  4TQR A;  2PI2 E;  3KJO A;  2HCI A;  2K5V A;  5FLM G;  2ASB A;  4PZ8 A;  1IOV A;  2CQO A;  5GAG C;  4DR1 H;  3N42 B;  4DR6 H;  3I73 A;  1HA6 A;  3J7A K;  2AKW B;  2CH4 A;  3NGD A;  4N9P A;  5KG0 A;  4KK7 A;  3I4N H;  5LMU H;  4XX0 B;  3H4B A;  2EY5 A;  2QDB A;  3PV0 A;  5C4J B;  4TV9 F;  4ZCK A;  3VR4 A;  1AN8 A;  1NBW A;  3KLS X;  1X54 A;  4JCV E;  4EQP A;  1SNM A;  3BG3 A;  4C5C A;  2FPI B;  3HKS A;  2A68 D;  5C1O A;  3M4O H;  4ED7 A;  1ASZ A;  2CZG A;  4RHS A;  1RJT A;  2FMM A;  1CA6 A;  3C3L A;  2W6O A;  2RDI A;  1CKN B;  4OGQ C;  3T4A C;  2R7K A;  2BCO A;  3MXP A;  3RBD A;  3J7A V;  4CKC A;  4MV8 A;  3MAQ A;  4ZKC B;  4GNX B;  4LF8 H;  3HBL A;  1K8M A;  3A55 A;  4GC6 A;  4O3O A;  1XPO A;  2B63 A;  2NN6 H;  3KLW A;  2ZM6 H;  3NE5 B;  2O5I C;  2JEJ A;  4APM A;  2XIW A;  2W6M A;  5LA6 F;  2QDL A;  3MC0 B;  1WSC A;  3HOX H;  1GM5 A;  4JI1 Q;  3M4I A;  1SYD A;  2OH2 A;  2IP4 A;  5IT9 L;  3FKI B;  5E7N A;  2EVB A;  2VUM A;  3PR5 B;  1MSG A;  3WNZ A;  1T9H A;  2W6Z A;  2EYM A;  2QEX A;  2FK1 A;  2FJ2 A;  4YWM A;  2SDF A;  1F2Y A;  3L0O A;  1KBL A;  5KT3 A;  4LF4 H;  4V0B A;  2D9U A;  2B2U C;  3S15 B;  1O78 A;  5FD5 A;  1W3S A;  2YZG A;  5LYJ F;  4Q44 A;  3GTP H;  2F0L A;  4ECX A;  1TR5 A;  2JE6 I;  5CV8 A;  2R85 A;  2WP8 J;  3PO2 H;  4A3C H;  2WII B;  2E8G A;  2Y0S E;  5IYC G;  5EKL A;  1OXV A;  5JEA H;  2ALZ A;  1E1O A;  1HR0 H;  4LSX A;  2NVQ B;  1YNJ C;  4ED3 A;  1A3U A;  1AE3 A;  5LXT F;  5KFK A;  2DLN A;  4OL7 A;  3N6R A;  3GTM H;  2JA7 G;  5KND A;  3T1H Q;  2VQE L;  3LGJ A;  4DK3 C;  4NXN L;  1N32 Q;  4IN3 A;  2F0I A;  2YU9 H;  5FLM H;  4TV8 F;  2KEC A;  3RZO B;  4UHV A;  1Q90 A;  4KJN A;  1SYE A;  2OTJ A;  3OTO H;  1WTR A;  4H13 C;  1N56 A;  3GTK A;  3I72 A;  1HA5 A;  1B9N A;  1JIC A;  2WB1 A;  3WOE A;  1JOQ A;  1KJ8 A;  2WYO A;  2HHH L;  3FPP A;  1YNN C;  2ZJP A;  2FPG B;  2R7Z G;  3OUU A;  5CB4 F;  1XMQ Q;  2E2I H;  4JV5 L;  2Q8R E;  3BZK A;  4IQZ A;  4TRD A;  4ME6 A;  4F4Y A;  1EL0 A;  4HSP A;  2UXC Q;  4OEL B;  3E5S A;  5EWG A;  3R23 A;  3AU7 A;  1Z2O X;  2NU6 B;  5EOY A;  3WO0 A;  2PYK A;  3TII A;  3A7L A;  3S1Q H;  4B3R L;  1AN7 A;  1PRT B;  4JBJ A;  4QW8 A;  1L0X B;  5T14 A;  1TWF H;  2IHF A;  3D31 A;  1PTO D;  1O7I A;  1QIL A;  3JSN A;  4EEQ A;  3G6X A;  2R7D A;  4ECU A;  5LP6 F;  2K32 A;  3RLN A;  2K05 A;  2VA2 A;  4YCV A;  3MWE A;  3H94 A;  1N8R C;  3A8J E;  3J80 i;  1U4P A;  4DV0 Q;  2GN5 A;  5JJK A;  4FS2 A;  4N8X 1;  3GTJ H;  2A73 B;  2PCF B;  4J8Q A;  1I4R A;  4DU9 A;  2SEB D;  4DLK A;  5ELE A;  1BOS A;  3HOU H;  4ZOL F;  3M4P A;  1LT4 D;  2WAQ E;  2E2H B;  4UCO A;  2VQF H;  1SMX A;  2F4V Q;  1EIG A;  4A3I G;  4LFB H;  1RTN A;  5M5X B;  2KJX A;  5CV6 A;  3KBX A;  5CV7 A;  3HFZ B;  3SDZ A;  3C46 A;  2E75 C;  4LF7 H;  3K0X A;  4LUZ A;  5IYC H;  4TSS A;  5IYD G;  1ZYR D;  1EY4 A;  4JI2 Q;  4XQJ A;  1EQV A;  3ERO A;  2NVY H;  5DAU A;  1C4Q A;  1CFM A;  3PN1 A;  4K8I A;  4YR3 A;  1T94 A;  2YRX A;  3RJ0 A;  4A3K B;  4O1N A;  4XDX A;  3N43 B;  1TY0 A;  4N8F A;  3D6C A;  2JA7 H;  3MXN A;  3H91 A;  3PUY A;  3U50 C;  4HJ8 A;  2YTV A;  5JVG 3;  1FKA H;  3O13 A;  5KT4 A;  4DV0 L;  1H95 A;  4WRD A;  4J9K A;  3PIO A;  3NQI A;  1PXU A;  5BR8 Q;  2ZT9 C;  4HN7 A;  1HNW Q;  2ASL A;  1VQO A;  2C28 A;  2YS7 A;  1M8A A;  3BQ2 A;  4DV5 Q;  1YJW A;  1FJG L;  1S40 A;  3IFD A;  2HVR A;  4TKO B;  2ZDQ A;  2NBF A;  5C44 H;  2RGV A;  3H3V I;  3AMU A;  5M5Y B;  1QE6 A;  4IOA A;  1CSP A;  2KCT A;  4ZK9 B;  2R7Z H;  1CSQ A;  2J7Z A;  4K5V A;  4JI4 Q;  2R6F A;  1PH7 A;  4JI6 H;  2YTY A;  3GV3 A;  4YIJ A;  2QGQ A;  4Q8E A;  1A0I A;  4J9Q A;  4C5B A;  5BPH A;  2DPJ A;  3NTK A;  2I46 A;  4RH6 A;  5M5W H;  3G8C A;  3KLS A;  2F0D A;  2BR0 A;  1BCP B;  1K28 A;  3ZYY X;  1MD2 D;  1W6K A;  4ED1 A;  3HP3 A;  3GTP A;  3BS1 A;  5IT9 c;  3A5Z B;  1EYG A;  3J80 E;  2UUB H;  1I4P A;  1TS2 A;  1B8A A;  1PK8 A;  2ID0 A;  4B3M Q;  2XGP A;  4MTK A;  1ILQ A;  1YBY A;  3NBI A;  3NP8 A;  1I6H H;  5EDW A;  1E2W A;  4KD4 A;  3AYH B;  4IFD G;  1VBH A;  5EWF A;  2AGO A;  3W1G A;  2B2W C;  2BOS A;  1PTO F;  1GUT A;  3GTM A;  2C2R A;  1U4L A;  1IZ6 A;  4I65 A;  2EYO A;  2R84 A;  3CQZ A;  4B3S L;  1Q7Y C;  4LF6 Q;  3KHG A;  3H40 A;  1STB A;  2K75 A;  4JI0 Q;  1S9F A;  2YU9 A;  4RWS C;  1Y14 B;  4Q8F A;  5FLX L;  2K04 A;  4YCW A;  3FMC A;  1HZB A;  2B63 B;  1CE8 A;  5JVD F;  1IL8 A;  1C3O A;  5FPO A;  2B2W A;  2NVT H;  3KHL A;  3RUZ A;  4A3I H;  4X62 L;  3PW5 A;  1QZH A;  2EYH A;  1E24 A;  4RGN A;  4PWQ A;  3HOV B;  5DNF A;  3UFX B;  1X56 A;  2VUM B;  1BVS A;  2PBZ A;  2PW5 A;  3SK5 A;  1OXX K;  3QWN A;  4L6T B;  2XTI A;  4DR3 Q;  5IYD H;  5KT2 A;  4GLX A;  3RBE A;  4BXX G;  2Y0S G;  2XVS A;  2IWH A;  4XIG S;  2QYZ A;  1VQH A;  4R4O A;  3TQ1 A;  1S10 A;  4J6H A;  4B3M L;  3OHB A;  1CM9 A;  1FL0 A;  1EU4 A;  3T5J A;  4ECZ A;  4DV1 Q;  1RHP A;  2F0Q A;  5IOD A;  2I80 A;  2W6Q A;  1KNE A;  3CP0 A;  5JEA J;  5KFB A;  4DV7 Q;  3TIN A;  2EIF A;  4RNM A;  4DL4 A;  3MTS A;  2KCM A;  3X3N A;  1HR0 W;  1U5K A;  1TS4 A;  1GVP A;  1RDP D;  4PV1 C;  1HNZ Q;  1KXL A;  4DK0 A;  4QQB X;  1NR2 A;  3K58 A;  2W71 A;  4ED6 A;  1V8Q A;  3D0F A;  2E5L Q;  4BBR G;  4PMW A;  3S16 H;  5JQW A;  1SNC A;  1MJE A;  4HR7 A;  1E2V A;  4H44 C;  4GKK L;  3GTJ A;  4BY1 H;  4YWL A;  5I6W A;  4GN4 B;  1PFN A;  3MVV A;  4OX9 Q;  4LWC A;  3WOF A;  2I87 A;  3OUZ A;  4GS3 A;  3Q8P B;  3GTK B;  4A2A A;  4IAL A;  3EFX D;  2WB1 B;  3TRZ A;  1GHJ A;  4H0L C;  4K0K Q;  3X3M A;  4C3H B;  1Z6H A;  5AFW A;  4A2B A;  3GIJ A;  1GXD C;  3NQT A;  3PUZ A;  5NUC A;  1S4Z A;  2CCZ A;  1VQC A;  3P20 A;  2GPS A;  1B04 A;  4G7H C;  5LL6 b;  2L1B A;  3OWF A;  1EFW A;  4RAU C;  1LTI D;  2NVY A;  3T5L A;  3IG0 A;  3GII A;  4JI7 H;  4DA2 A;  3K7A B;  4IFD H;  2DY7 A;  3ND9 A;  3NTI A;  4J9P A;  3MWD A;  2JN4 A;  4E4T A;  3KF6 A;  3I8Z A;  5DQH A;  1HNX Q;  1K3R A;  5DM6 3;  4A76 A;  4A93 B;  3T1H H;  1AP0 A;  1XX8 A;  2B2T A;  1AEX A;  1J6Q A;  5HV6 A;  2A6E C;  4UY8 C;  4QCL A;  4WJ3 M;  4R8U A;  1C8C A;  2B3G A;  3TQT A;  4LSA A;  1JMC A;  4K8J A;  4QWB A;  4FU0 A;  3J81 W;  4OX9 L;  3NSW A;  3JAM L;  1SYC A;  3L7Z C;  1GUN A;  2GVA A;  4L5T A;  3MZ5 A;  5J3B A;  3VR3 A;  3F2B A;  4A3J B;  1X6O A;  2FHT A;  3H0G G;  3FRP B;  1Y1V G;  2K5H A;  2SNM A;  4DUZ Q;  5K2M A;  4YY3 Q;  3K57 A;  2FXQ A;  4BXX H;  1ZHQ A;  4YJ3 F;  5ELO A;  3ITP A;  3S14 H;  2FE3 A;  2F0K A;  2FFK B;  3J81 i;  2EY2 A;  4V19 0;  2UXC H;  5M9O A;  4G7Z C;  3RNU A;  3I4N B;  1EIF A;  4AH6 A;  2V59 A;  4DK6 C;  2P5Z X;  1GUW A;  2OQK A;  3ND8 A;  3KAJ A;  3UE1 A;  2R92 A;  1II3 A;  3V6H A;  1KLG D;  4HMI A;  4IPC A;  5JJZ A;  3VYT A;  3HOZ G;  1HNX L;  3S24 A;  3GIP A;  3OW2 A;  4C56 C;  1E7Z A;  1AZP A;  1UUP A;  3MXN B;  2RDH A;  1TWC H;  2EYF A;  2AQ3 B;  3KHR A;  1HQR D;  1N36 L;  4PDB A;  2JA8 G;  2UUA H;  3RAQ A;  1BKB A;  3S1R H;  3GIL A;  4KHP Q;  1SND A;  4MTN A;  1BNC A;  4JUZ A;  5C5J A;  5GON F;  5E1F A;  1Q81 C;  2AU0 A;  4DAY A;  1FYC A;  4TQS A;  4AYB G;  4KN7 C;  1ET6 A;  1S97 A;  4F87 A;  2AUJ D;  2QF7 A;  3E9I A;  2LY7 A;  1SJH D;  4DR5 L;  3C2P A;  2B39 A;  3HOX B;  2F4V H;  2F03 A;  3PW4 A;  4GNX C;  1F9S A;  4PZ7 A;  1E4F T;  3HG9 A;  2ZTE A;  1S72 A;  2KED A;  4QW9 A;  5BN4 A;  4NLG A;  5FLX c;  4JI2 H;  1QUQ A;  1F9R A;  4HIO A;  5KYI A;  4EGV A;  4JVZ A;  3GV8 B;  3TS0 A;  4RA8 A;  5KFE A;  5ELF A;  2FJZ A;  3T13 A;  1WTO A;  1G51 A;  3GTP B;  3TEH B;  3N6X A;  3VPD A;  4EBC A;  4EBD A;  4LH7 A;  4CDF C;  4IOC A;  1FNU A;  1O7L A;  3PO2 B;  1OO9 B;  4FF2 A;  1D1I A;  5EAY A;  3LWU A;  1FVI A;  5GAE C;  2EYJ A;  3GIM A;  2VA3 A;  1TWA H;  1W2B A;  2PI2 A;  4DN4 M;  3CCR A;  1SRO A;  4CDE C;  4BBS G;  4NP5 A;  3GTM B;  1HNW H;  3N8D A;  4CJ1 B;  5LHY 1;  1JB3 A;  2Z1C A;  3J81 E;  1TT2 A;  5IWA Q;  1EQQ A;  4O4L F;  4DV5 H;  3CQZ B;  5E4W C;  1Y1V H;  4FNF A;  3PUW A;  3VPB A;  4ZQI A;  1KEE A;  2NZ1 D;  3VYS A;  2YU9 B;  1B6R A;  1TWG H;  4G57 A;  4QWD A;  1PH6 A;  4NXM L;  5AJ3 Q;  3QFF A;  4JI4 H;  1SMY C;  1WTW A;  1XNQ Q;  1F2L A;  2JA5 H;  4IJH A;  4HIK A;  4KHZ A;  4R1J A;  5C8Y F;  4RCO A;  5L1L A;  3TP5 A;  4C3I H;  1SEB D;  2F0V A;  1W93 A;  4DXF A;  2UU9 Q;  3NEM A;  1V1Q A;  1C7Y A;  1IBL L;  3J7Z C;  5KFA A;  3S2H H;  5KX5 F;  3CF5 A;  5DG8 A;  2XRS D;  2UXB Q;  2IY5 B;  2R8I A;  3R5F A;  1N48 A;  1I6U A;  3WDN A;  1Z9F A;  3HOZ H;  1VQ8 A;  1JQY D;  2KHS A;  3A7A B;  4PMB A;  1TY2 A;  3RB0 A;  4A3G G;  4Q43 A;  5FD6 A;  3H3V C;  3A5U A;  2AMC B;  3S1Q B;  1ILP A;  1XNR Q;  3I91 A;  1NAP A;  3GV5 B;  3HKZ E;  2OXP A;  2JA8 H;  1S3O A;  1UE1 A;  1V1O A;  1VQK A;  2N88 A;  3HOY G;  4I7A A;  4R4Q A;  2CW8 A;  2NN6 I;  3Q2O A;  4LF6 H;  5IWA L;  4UCT A;  3V4Z A;  4QL5 A;  1KDC A;  2B2V A;  3M4Q A;  4X66 Q;  4JI0 H;  2EPB A;  2E76 C;  1PRT C;  3EQL C;  1SJE D;  5C0X G;  5KG1 A;  1EY7 A;  2XD4 A;  5M3M G;  1PV4 A;  4HR7 B;  2FLL A;  4LF5 Q;  5JPM C;  3GTJ B;  4RAY A;  1C48 A;  2MQH A;  2EYL A;  3NK9 A;  4OXP A;  3HOU B;  3D4R A;  3MWY W;  3T5K A;  4LFC Q;  2Y0S A;  4DAP A;  3OTO L;  1G29 1;  3CC4 A;  1EYA A;  4NPS A;  2XGT A;  1N34 H;  3T1Y L;  4JOI C;  3JAM c;  1W96 A;  5T1G A;  4KHV A;  2C35 B;  2IW3 A;  3E6Z X;  3CMA A;  1IKM A;  2KSW A;  4J9N A;  1V1P A;  2N8N A;  5IYB G;  4R4I A;  2TSS A;  5FOB B;  1HPC A;  5KFP A;  3CRL C;  3VA5 A;  3E0E A;  1K83 H;  2PVP A;  4YAK B;  1Q8I A;  1CZW A;  5C3W A;  3G7L A;  1TKW B;  4DV7 H;  4RNO A;  2EXZ A;  1ESF A;  1B3Q A;  2QCP X;  3Q1K A;  4BBS H;  3KF6 B;  1K0S A;  3Q23 A;  1HNZ H;  5L37 A;  1TWC A;  4QIW E;  2ENB A;  3QOJ A;  3J7Y W;  2JQO A;  1KRT A;  3QZ8 A;  3HZX A;  5D1O A;  5F9N A;  4R8U B;  5A2Q W;  1Y8P B;  1KNA A;  1QVG A;  1M7J A;  4X6A H;  5KEE A;  4DR7 H;  1L1O A;  5KFQ A;  2DJF C;  1E1T A;  4DR4 L;  1RTO A;  5C44 B;  4K0K H;  4M7E A;  5ELB A;  2A19 A;  3UDI A;  2RCF A;  4XT3 B;  5J2U F;  4I55 F;  1ENA A;  4ECV A;  3M4Y A;  2QA4 A;  5CV4 A;  4YHH L;  5M5W B;  1UE5 A;  2FMA A;  5L9X A;  2W8L A;  2FK3 A;  4RB3 C;  4JI5 H;  4A3G H;  2N49 A;  4FM9 A;  1BR9 A;  1A2T A;  3LNN A;  3RV3 A;  2V9W A;  1VMC A;  2AWO A;  4AQY L;  3AB9 A;  3D4D A;  5KNB A;  2R92 B;  3WWV A;  4MAM A;  3HOY H;  4RB1 A;  5I2X A;  3VYR A;  1SNO A;  1YNJ D;  3SEB A;  1BCP C;  2CFM A;  2X6L A;  3ER0 A;  3Q0A A;  4YCU A;  1STN A;  1PH4 A;  4LF9 H;  3OIQ A;  2EXD A;  4H7B A;  5CMD A;  5C0X H;  2WAQ A;  4G3I A;  1UE6 A;  5M3M H;  4X64 L;  2L55 A;  5LMN L;  1LO5 D;  3K3P A;  4OIJ A;  1Q46 A;  1XPU A;  5KFH A;  1SE2 A;  1SFO H;  2IBK A;  1CZG A;  4DAV A;  2XIG A;  4DUZ H;  4EYH B;  4A3F G;  5JVH 3;  4DAY B;  4YY3 H;  3M9M B;  4JV2 A;  1KAA A;  1LTT D;  2JA5 A;  4KLK A;  1FR3 A;  1GSO A;  1D5X C;  4F88 A;  5KFM A;  2NVT B;  4DV2 L;  4OEM B;  1I6V C;  2R8G A;  5D14 A;  3RLO A;  4MTE A;  1DOL A;  4YBZ B;  1YNN D;  4QUC A;  1M0T A;  5T1I A;  1SYX B;  2J9G A;  2Z9H A;  2DNE A;  4L1K A;  4HJA A;  2K5Q A;  3RD4 A;  2N78 A;  1QUQ B;  2OCE A;  4ODG A;  1SYG A;  2CWA A;  2A1A A;  1LYL A;  5KIX A;  4DAM A;  3RN2 A;  1V43 A;  3IKJ A;  1X3P A;  2KBN A;  3MWM A;  1A9X A;  2VQE Q;  5FJ8 H;  4NXN Q;  5KG6 A;  1RYR A;  3KTM A;  2PMZ E;  2B29 A;  5KFY A;  5DG7 A;  1CQI B;  3PIO 3;  4R8I A;  4KHP H;  5A2Q E;  3DLL A;  4QB4 A;  3PO3 H;  1OWT A;  1K8G A;  1ZHS A;  1KJQ A;  2PN1 A;  4YJ2 F;  4OWT B;  3RB4 A;  4ED0 A;  2X0S A;  1IHZ A;  4O3S A;  3S16 B;  2HHH Q;  3DF7 A;  1B4O A;  2JSO A;  2MHV A;  4APV A;  1YHB A;  4BY1 B;  4EYI B;  1LAB A;  4JV5 Q;  4XQQ A;  2K5D A;  3CCV A;  2Z8L A;  3U4V A;  5IOC A;  5CGK A;  4R9W A;  2VB3 X;  5CV5 A;  1SLJ A;  2I5L X;  1YIT A;  1ROD A;  3K81 C;  2G5D A;  3UDF A;  3OHA A;  4B3R Q;  1JIH A;  1I3Q H;  1JWM D;  1D1K A;  1EUC B;  4IUV A;  1S03 G;  4DV6 H;  3SVM A;  1K83 A;  3HKZ G;  4A3D G;  1WR2 A;  1I4X A;  1W6J A;  1SR3 A;  2ALY B;  1D5M C;  1A8V A;  4DUY H;  3UI2 A;  4OON A;  3J7A F;  3HOW G;  5KFZ A;  1STA A;  2DUD A;  3CRK C;  2F1M A;  4BA1 I;  4DL7 A;  1WFQ A;  3KXY T;  4EFE A;  1E3P A;  1V51 A;  3RFC A;  1JX4 A;  1S0M A;  3W5O A;  1DCZ A;  4G4K A;  3QIA A;  1X9N A;  5M3F G;  1PX2 A;  4JW0 A;  1S5F D;  1IYU A;  1CI3 M;  4A3F H;  5GAD C;  2ZDH A;  5JAV A;  4DF7 A;  1VQ5 A;  1PTO H;  3BYY B;  1XMO L;  3M9N B;  2R8H A;  1XNQ H;  3TRE A;  1Q1E A;  4LNQ A;  4J0M A;  4MV7 A;  1PZJ D;  4N9T A;  4JYA L;  5ISR A;  4O3P A;  3V4S A;  3I55 A;  1Y8O B;  5E3F A;  1S0N A;  2DIK A;  2SOB A;  3NTH A;  3D6W A;  2QW7 A;  3MEH A;  5IYZ F;  3KAL A;  4WJW A;  4DV3 L;  4JBK A;  5CC4 A;  2IT1 A;  1JJ2 A;  4IUT A;  2Y0S B;  3U58 A;  3GTO H;  3J80 W;  2UXB H;  3S14 B;  3HRZ C;  4M1U B;  4JPB W;  1PHJ A;  1YNX A;  4IPG A;  4FYD A;  1QZG A;  5BMV F;  1ZKO A;  3RMH A;  3V2T A;  4CBV A;  4A3E G;  1JDB B;  5KG5 A;  3PCO B;  2F3W A;  1H9M A;  2K4K A;  4A3M G;  5JOB A;  3H20 A;  5J2T F;  4ED2 A;  1V1P B;  1PYB A;  3Q6S A;  1GKH A;  1HHV A;  3MR5 A;  4QWC A;  1R9T A;  4J1M A;  3DM1 A;  2J6S A;  1D8L A;  4CDD C;  5FO9 B;  4JI7 L;  3IL8 A;  1PYS B;  4X66 H;  2Z4I A;  3SK4 A;  2OEO A;  1F2M A;  1G8Z D;  2EZV A;  1TWC B;  1FJG Q;  4DR2 L;  1NCV A;  3OIP A;  5F2D A;  1IBK L;  2F0O A;  3EIV A;  5D1O B;  3AFP A;  1EEF D;  4LF5 H;  3OOC A;  3URY A;  3QOL A;  2UXD L;  5KFS A;  1VQB A;  1SFO A;  5FKA C;  4DK1 A;  2PO4 A;  1BBW A;  2HCC A;  3EA6 A;  1L1O B;  3RLF A;  1DZ1 A;  1B70 B;  4LFC H;  1J5E H;  2RHS B;  5IGE A;  2BQR A;  4DV4 L;  1BBU A;  1HQM C;  3EVQ A;  3M85 A;  2HIV A;  3Q8D A;  2XGQ A;  4Q45 A;  2VPS A;  4A3D H;  4ETS A;  3K59 A;  2JA6 G;  3GO5 A;  1VQF A;  2VS1 A;  4UP8 A;  4IFD I;  1B50 A;  2FP4 B;  4C2M H;  2F52 A;  2K7V A;  3J7A 5;  4CJ2 C;  3BDO A;  2NUA B;  4ME3 A;  2HIX A;  4KN4 C;  3S1M B;  3IRB A;  1RJQ A;  2A74 C;  1VQN A;  5D3I B;  3R2T A;  2M00 A;  1X55 A;  2DN8 A;  1VQE A;  1KRS A;  3BA9 A;  5M3F H;  3FHW A;  4B3S Q;  2F0F A;  1HCZ A;  1PDQ A;  2O03 A;  2XSC A;  3V05 A;  4RUA A;  2L0C A;  1CTM A;  5EBD A;  4IRC A;  2C2E A;  4NMZ A;  2WAQ B;  4ZQ3 A;  4X62 Q;  1CS0 A;  4KKU A;  4AYB E;  1PA6 A;  2VUG A;  3H09 A;  3L2P A;  1TS3 A;  4KJO A;  3R5H A;  1Y1W G;  3UQ8 A;  1S68 A;  2QK4 A;  2ZDG A;  2NUC A;  3NWT A;  4L5Q A;  1MZB A;  3FKI G;  2JA5 B;  2A6H C;  1G91 A;  3BDC A;  3HS0 C;  1VCI A;  4A3E H;  1UNN C;  1P8L A;  4C3I B;  1ML0 D;  2KOL A;  4A3M H;  1YHQ A;  4OHJ A;  5ELD A;  2D0O A;  3S2H B;  1I3Q A;  2ZXR A;  1H9S A;  1CHQ D;  4LFA L;  5KRU A;  1RK6 A;  2YCH A;  1VDZ A;  4DKA C;  2M2L A;  1OXS C;  2RF4 A;  1F9P A;  5J39 A;  4F7X A;  3PIP A;  4F8M A;  4MZ9 A;  1P16 A;  4UCU A;  3S1N H;  1K3B C;  1F9Q A;  3R3O A;  2EJG C;  2JA8 B;  4GKK Q;  4ALP A;  2A6E D;  4C1N I;  4GC7 A;  3KAK A;  1JJC B;  3VYU A;  1CA5 A;  5JUM A;  3A54 A;  4QMG A;  3RV4 A;  4KTA A;  1YHA A;  5LL6 X;  4BY7 G;  4K6L A;  2VXW A;  3OYY A;  2WTF A;  3RGX A;  2E2I A;  2GPW A;  1G2T A;  4P72 A;  2F0E A;  1L0Y B;  4HTH A;  1HFG A;  4CDC C;  1BUV T;  2VNU D;  3BDL A;  3HXL A;  1CHP D;  3HB9 A;  3ORQ A;  1IBM L;  3GD7 A;  2JA6 H;  3GTO A;  4FBT A;  1ENC A;  3V6K A;  4GKJ Q;  2JP1 A;  3MHB A;  1TWH H;  3GV6 A;  1EQT A;  1GGO A;  3STB C;  3G6E A;  1TWF A;  3L3O C;  4X65 L;  1MKH A;  4RFB A;  2BA1 A;  1KD1 C;  1HUM A;  2AQ2 B;  1FNV A;  4JG2 A;  1K83 B;  1ZXT A;  1LT3 D;  2VQE H;  3B6Y A;  4NXN H;  1DV2 A;  4RZQ A;  4IR9 A;  3CXC A;  3U9T A;  3PMF A;  2HVS A;  5KG2 A;  4JI1 H;  4BBS B;  2NYZ D;  2JJQ A;  2VOB A;  4FF4 A;  4LMY A;  1VF5 C;  3PW7 A;  3NBH A;  5EJW A;  4RHR A;  1WD1 A;  2RGR A;  3RUP A;  3K7U C;  1YEZ A;  3MXU A;  1Z7T A;  4LH6 A;  1Y1W H;  2HHH H;  3DHQ A;  1N9W A;  5HUR A;  4JV5 H;  3ERS X;  3I4M G;  4DXG A;  1WCM G;  3TSS A;  1I7L A;  4ID6 A;  4EQN A;  2B2T C;  4EQ5 A;  3D4W A;  2AHO B;  5EKK A;  4GOP A;  1I94 L;  5DM7 3;  1IYJ B;  2F0M A;  1Z47 A;  4GKJ L;  3I90 A;  4DFA A;  3F8N A;  2J4X A;  3W2D A;  1A6X A;  3IN5 A;  4IPH A;  3RAX A;  4B3R H;  4OIK A;  5IY0 A;  3VR5 A;  4B3T L;  3HKZ A;  2PZU A;  2JA7 A;  3NXW A;  1Q8K A;  1SRU A;  1Y69 U;  4A3G B;  1UEA B;  1N32 H;  1DON A;  4JBM A;  3CC2 A;  1PH1 A;  1BNZ A;  3I4O A;  5CV9 A;  1JE4 A;  5J22 A;  1N36 Q;  5D1P A;  4CKB A;  5KFO A;  1A2U A;  1ONL A;  1R9T B;  1QB5 D;  3HOY B;  4QWE A;  1IYV A;  2K6A A;  4O2A F;  1M6V A;  1QVC A;  4O3R A;  2HUG A;  1XTD A;  4Z9C B;  5D8D A;  1YJN A;  4BY7 H;  5FPR A;  4J9S A;  2R7Z A;  2NVX H;  5C1P A;  3CHB D;  5M3M B;  1JWS D;  4DR5 Q;  2J0T D;  1L2F A;  2EY6 A;  1XMQ H;  1ASY A;  1VQA A;  4KY7 A;  2DGY A;  2D5D A;  5I4D A;  1MJC A;  2I8C A;  3TDQ A;  3S17 H;  4I4T F;  3MJF A;  3Q22 A;  1SFO B;  1DYQ A;  4KV6 A;  5CBE E;  2FLN A;  1SMY D;  4IPD A;  1QG7 A;  4R8N A;  1JC7 A;  4YP3 A;  1OTC A;  2NU7 B;  4DR7 L;  1NUC A;  1KDA A;  4DR1 Q;  1J8I A;  5FK9 C;  1I50 H;  2ZJR A;  1KIX A;  4JI8 L;  3KJP A;  2UUC L;  2XCL A;  2LSS A;  1HXY D;  3T16 A;  3SK6 A;  4RB0 A;  4P74 A;  2YRW A;  3M4O B;  3N52 A;  4RZR A;  4FBU A;  4JI3 L;  1GLV A;  4LUO A;  2ICI A;  4POF A;  3FDS A;  1VQ6 A;  4PG3 A;  4RKL A;  4QIW A;  2HDL A;  4GN3 B;  3PUX A;  5IGD A;  4BBR H;  4DL6 A;  4HIM A;  4DNT B;  5H80 A;  4DV0 H;  2DY8 A;  2BH2 A;  2CW0 D;  1M0W A;  4K2L A;  1JKJ B;  4NDX A;  2ASJ A;  1S5C D;  4MNO A;  1S5B D;  1Y8N B;  4U6P A;  4ECW A;  3T51 B;  2I5H A;  4HJ9 A;  1N33 L;  2PQA A;  1FJG H;  2ATL A;  3CCQ A;  1IW7 D;  5FO8 B;  1D2B A;  2OT2 A;  4NXM Q;  2JYO A;  3PO3 B;  3I4M H;  4LF8 Q;  4UCR A;  1WCM H;  3F1Z A;  1PRT D;  3SHL A;  5K5P A;  5DQG A;  5DGB A;  3I4L A;  1I4Q A;  2FLP A;  2PW7 A;  3GTL H;  1T36 A;  2J6U A;  4LF9 L;  2AUK A;  1EZ1 A;  3KOJ A;  4RMF A;  2JA9 A;  2V4D A;  4CGY B;  1AE2 A;  4DR1 L;  1IBL Q;  3CCE A;  4DR6 L;  5IGB A;  1VQI A;  1T5X D;  4XQN A;  1FNW A;  1FGU A;  1WOC A;  5C3X A;  1A3V A;  2KHI A;  2JA6 A;  5LMU L;  2NWG A;  1LTB D;  1JWU D;  4QJF A;  4UP7 A;  4O0A A;  4HQ6 A;  4DGZ A;  1VQ4 A;  1SDF A;  2ZXP A;  5KKN B;  1TWH A;  1EUJ A;  5KG4 A;  2WIN B;  3K5H A;  5KFN A;  1STG A;  2EDG A;  4YB8 B;  4F4W A;  2R6G A;  3SE0 A;  5BR8 H;  1H9S B;  3TME A;  1NNX A;  1D7Q A;  4RGM A;  1MBY A;  3PGZ A;  4TVA B;  3MR2 A;  2VPQ A;  4B3S H;  2XWB B;  3H0G H;  5C0X I;  5COY A;  2HQL A;  2ZJT A;  2R7N A;  5JH7 F;  3NEN A;  2G9D A;  3ULP A;  3SGI A;  1X3E A;  2VQD A;  4LF8 L;  4X62 H;  2FIN B;  1TQO A;  5ELN A;  3U4Z A;  4OO1 G;  4XYO A;  1Y1W A;  2ZM6 L;  1BXR A;  1I5F A;  3K5O A;  2IL8 A;  4IWX A;  3EPI A;  4A3F B;  5IT9 W;  2IJ0 A;  5DQI A;  5J1Z A;  1PTO B;  4XZ3 B;  3OTO Q;  1LLR D;  4C1N K;  1SNQ A;  2E2I B;  3T1Y Q;  3TS2 A;  4C3J G;  2NZH A;  1TS5 A;  4ECT A;  1J9O A;  4B3M H;  4EBE A;  2B2V C;  4NW2 A;  2L11 A;  4C3H G;  4LF4 L;  1K0R A;  3GTO B;  1DGS A;  5C4H A;  4UP9 A;  1VBG A;  4O42 A;  1RJP A;  3CCL A;  2PMZ A;  4CKE A;  4YR2 A;  2NZO A;  1TWF B;  2KQ3 A;  2VB2 X;  4P71 A;  1LTA D;  2GA4 B;  1DV1 A;  2RDF A;  1HR0 L;  3VPC A;  2O5J C;  3MFH A;  3ORR A;  1UC9 A;  1NR4 A;  4IO9 A;  2W8K A;  3A8K E;  4DV6 L;  3K5M A;  2F0W A;  1HZA A;  2K1B A;  3J80 c;  1YIJ A;  2NU9 B;  1WTP A;  2EQS A;  2Q2T A;  4C5A A;  4GKK H;  4KI0 A;  1BCP D;  4MN3 A;  4A93 G;  3U9S A;  1NY4 A;  4IRK A;  4DUY L;  4X3S A;  4KMU C;  3NBH B;  2NVX A;  2WE6 A;  4IUQ A;  4DR4 Q;  2R87 A;  4DR3 H;  2K28 A;  3MFY A;  1UC8 A;  1PRT F;  3TP7 A;  2R8K A;  3NWS A;  1EEI D;  1SAP A;  4A3J G;  3PF5 A;  2W70 A;  3M7G A;  2KA7 A;  3GQC A;  1RD9 D;  2H1E A;  2LXK A;  3RZD H;  2V4R A;  1YJ9 A;  5DEH A;  4YHH Q;  1SSO A;  2Q2I A;  2VQF Q;  2IX0 A;  2ZTC A;  1A63 A;  1RK5 A;  1I50 A;  4DV1 H;  1STY A;  3QO2 A;  4RU9 A;  3SK8 A;  5C3E G;  5C4X G;  2B8G A;  2NVY B;  4GOP B;  4IFD J;  4MA5 A;  3PZP A;  3SI8 A;  2AQ1 B;  4AQY Q;  1GOZ A;  3FMA A;  2F0P A;  1L1O C;  2RDJ A;  3QR8 A;  3HKZ B;  4A3D B;  2K5N A;  2JA7 B;  3SE7 A;  4HNU A;  2E2D C;  3CU7 A;  4XYL B;  1X3F A;  2B2Y C;  2E5L H;  2YTX A;  5KG3 A;  3AFQ A;  1HZ9 A;  1IKL A;  2NTS A;  3CW2 C;  3W3A A;  3PUV A;  4X64 Q;  1H9J A;  1Q86 C;  5LMN Q;  4OX9 H;  4WOR A;  3BQ0 A;  5M3F B;  3J81 L;  1TAE A;  2FKL A;  3RR5 A;  1YI2 A;  2K50 A;  4GLA C;  2A8V A;  1UAP A;  2EY1 A;  4CHT B;  3RN5 A;  2CWP A;  2B2Y A;  3PW2 A;  1T3N A;  4ECR A;  2R7Z B;  2F0J A;  5IT9 E;  1WCM A;  4QY7 A;  4J9R A;  4DV2 Q;  3GTL A;  2RDG A;  2K5W A;  3D8G A;  4ZYS A;  4C3J H;  2Q2U A;  3GTK H;  1C0A A;  3NUC A;  2FB9 A;  3KF8 A;  1LV9 A;  3GV7 B;  2JEB I;  2VQF L;  2YYA A;  4YR0 A;  1TXY A;  4C3H H;  2C2D A;  5DLQ E;  5A35 A;  3HOX G;  2UVV A;  2R61 A;  2MCT A;  1I7N A;  1U0L A;  1X3G A;  3OPO A;  4LFB L;  3ONA B;  1EIY B;  1HJP A;  4A3E B;  4LF7 L;  3Q8Q B;  1HNX H;  3BVG A;  2EE1 A;  5H1S E;  2KVM A;  4JBW A;  2L15 A;  4RKB A;  4CJ0 B;  1I6H B;  4F4X A;  2ASD A;  5KFI A;  5G3L D;  4A3B G;  1TWA A;  4A75 A;  2J6T A;  4QIW B;  2UUB Q;  2B8F A;  5CYU A;  1N36 H;  2Z6K A;  2XNA C;  2PNH A;  2LFN A;  3PO2 G;  3T5H A;  1GHK A;  1FD7 D;  1PLF A;  2HQE A;  1KAW A;  2GLT A;  3H0G A;  4RUC A;  4JK1 C;  5JEA G;  1Y1V A;  1EIH A;  2CW7 A;  4RGO S;  3G6V A;  1HFN A;  1PFS A;  4Q0F A;  3MFI A;  1NSN S;  4X3K A;  3S1N B;  5BN5 A;  2C5C A;  1TWG A;  3G6J B;  2PQA B;  1BCP F;  5EPJ A;  4IZO A;  2F3I A;  2M9V A;  4DR5 H;  2BQ3 A;  4IRD A;  2X6G A;  1R4P B;  4A3I B;  4A3J H;  5KFT A;  4EG0 A;  4I7Z C;  5L1J A;  5C5L A;  1BJT A;  5IYB H;  4Y52 H;  3PSI A;  4L5S A;  3S2D H;  1M90 C;  4BWS C;  4RNN A;  4J9L A;  2W9A A;  1JB7 A;  1M1K C;  4JI6 L;  2F4I A;  3H6M A;  5C4X H;  3VA7 A;  5C3E H;  2A69 C;  1GSH A;  3OWE B;  1Q1B A;  1GUO A;  4FVM A;  4IUP A;  4B9W A;  2JA6 B;  3J81 j;  3BA8 A;  1AFP A;  3EN2 A;  1Q3L A;  2R93 G;  2OLS A;  1RYS A;  1KAB A;  1K8A C;  1TWH B;  2UUB L;  3WO1 A;  5KFF A;  2LXJ A;  1AW7 A;  2BE5 C;  1NJI C;  4PZ6 A;  5EWE A;  4FDB A;  4O4H F;  5KNC A;  4HNT A;  3RGZ A;  4K5W A;  3SR1 A;  3G6Y A;  2VR1 A;  4ABN A;  4AYB A;  2EJM A;  3BAA A;  2F0S A;  3T56 B;  3ETJ A;  5K36 G;  3M9O B;  2PZW A;  4NXM H;  1XMO Q;  1PH2 A;  3BU2 A;  5FLX W;  2BH8 A;  5KFL A;  4JYA Q;  1F77 A;  3GLK A;  2BDO A;  1EWC A;  1Y1W B;  1K9M C;  4DV3 Q;  1IBL H;  3DEO A;  2IX1 A;  4DPG A;  2NU8 B;  2IA6 A;  5HBR B;  4XYM B;  1RL2 A;  3KDF A;  4MA0 A;  3C1F A;  3HOU G;  5KFX A;  1QWY A;  1JE5 A;  2BDN A;  3RB6 A;  2ZTD A;  1M4V A;  4U7C A;  3JZI A;  2SCU B;  2WKD A;  2ATW A;  1VQD A;  3CAM A;  2CH4 W;  2K14 A;  4LJZ C;  1PH3 A;  4A3B H;  3N40 P;  4YWK A;  4O3N A;  1DIK A;  2HGS A;  2AGQ A;  1ZEQ X;  3N41 B;  1OXU A;  2IMW P;  1V9P A;  5ELC A;  1LTR D;  1PZK D;  1KDB A;  5G3L F;  2PMZ B;  2N3S A;  2NB0 A;  1XTC D;  4JI7 Q;  3PIP 3;  2YL2 A;  5IWA H;  1VQM A;  3CKI B;  1K8O A;  3RTX A;  1D6E C;  4UCS A;  5GAH C;  4DR2 Q;  3GIQ A;  1T5E A;  2F3V A;  3GID A;  2X69 A;  1IBK Q;  2B2U A;  2O4X A;  3GTQ H;  2VL6 A;  2D2C C;  3EPG A;  3DEP A;  4B08 A;  2UXD Q;  1LUZ A;  1TVX A;  3CQZ H;  4S3S A;  2L4N A;  1KC8 C;  1EY0 A;  4UCV A;  2F0T A;  1ICW A;  3TN2 A;  5FO7 B;  2UU9 H;  1L2Z A;  4BY7 B;  1SE4 A;  2NVX B;  4JI1 L;  1L0W A;  3Q24 A;  1V4Y A;  3NPP A;  4DV4 Q;  4BWG B;  4UPA A;  3T1Y H;  4OWW B;  1EU3 A;  2RVL A;  1JXL A;  3CCM A;  4A4I A;  3PF4 A;  3S17 B;  1SE3 A;  1EY5 A;  3J81 c;  2R7L A;  3DWQ A;  5C44 G;  1JR0 D;  2A68 C;  2OWO A;  2XC9 A;  2R86 A;  3AEV A;  1VQP A;  2A6H D;  2R93 H;  1VAJ A;  1PH9 A;  1U9R A;  1B3A A;  1I50 B;  2F0G A;  5BN3 A;  3KYH C;  3VR6 A;  1KJJ A;  1XNR H;  3BQ1 A;  2Z0S A;  5COR A;  5C6A A;  5KT5 A;  3V6J A;  4FXD A;  3GTG H;  3DXJ C;  3ETH A;  2JXM B;  2HT1 A;  2W9C A;  2I0Q A;  1SXT A;  1A15 A;  2KHJ A;  3CC7 A;  3TZU A;  2K33 A;  4BA2 I;  4EVO A;  3CVZ A;  2YS6 A;  3FP9 A;  3IFT A;  4BBR B;  1UNS A;  5JJI A;  1XDN A;  3BYT B;  3I3C A;  2R92 G;  5K36 H;  4XTC S;  4HSV A;  3L4J A;  3QZ7 A;  3S1R B;  3T1H L;  1N32 L;  2L12 A;  1JT8 A;  1AUV A;  3MR6 A;  4RGT A;  5A2Q L;  1VQ9 A;  5L1K A;  3R93 A;  4K14 A;  5FLX E;  5IP7 G;  3P1H A;  4DR4 H;  1MSH A;  2R8J A;  4HJ5 A;  3JAM W;  2MGS A;  2UUA Q;  2XWJ B;  2QKI C;  2Z6B A;  3ULJ A;  3EJI A;  3LWE A;  3I12 A;  3I4M B;  1K1Q A;  5C4Z A;  1WCM B;  2EOT A;  2IX3 A;  1B7Y B;  1I4G A;  1WTQ A;  3GTL B;  1JLL B;  5EQ0 A;  4YHH H;  1DOK A;  3L4K A;  5KFD A;  3KF8 B;  3JAM i;  1LTL A;  2Q8I B;  1XMQ L;  1B6S A;  1VF7 A;  1C9O A;  2CQA A;  3U9O A;  3CCU A;  1EOV A;  3HOW H;  2UXC L;  2CVR A;  4AQY H;  1U4M A;  5IIF A;  4LFA Q;  4IZ8 A;  3D3R A;  4KY6 A;  4TUY F;  2HVQ A;  1RJR A;  1STH A;  3MEF A;  3ULL A;  3STB D;  1EY6 A;  2MP1 A;  4J9O A;  1X32 A;  1E22 A;  4Y8V B;  1I4H A;  1Z2N X;  4K5X A;  4LK1 C;  3K5L A;  1TWA B;  4Y7N H;  1XWE A;  1EZ8 A;  2AWN A;  2QEJ C;  4O2D A;  5GQO A;  3S9W A;  2E2J H;  5C0X J;  1EHI A;  4X64 H;  4B9X A;  5LMN H;  2ZJQ A;  2DWC A;  2CHB D;  3M3Y H;  3H0G B;  1RCV D;  2TMP A;  1Y1V B;  2V58 A;  3KFU A;  1VQL A;  3LWB A;  2UUA L;  1NE3 A;  1TWG B;  3M7N A;  1TA8 A;  1KQS A;  2JEF A;  2UVW A;  4DV2 H;  1KLU D;  3ICE A;  2PNR C;  2PQE A;  1BBX C;  4EEY A;  1H9R A;  2V1C C;  2NTT A;  4M9U A;  2N55 A;  1RIP A;  1PMR A;  3W1B A;  1IBM Q;  5DG9 A;  5D65 A;  2V4Q A;  4L63 B;  4P73 A;  2F4V L;  4ZLT F;  4IJL A;  4BY1 G;  4IUN A;  4QUF A;  3QB3 A;  2F0H A;  4P75 A;  3EBE A;  4R7R A;  2F0U A;  2W6P A;  4X65 Q;  4X3T A;  4ME5 A;  3HOZ B;  1UWV A;  2BA0 A;  5LOV F;  3F2C A;  1CKM A;  1BDO A;  4JI2 L;  4GN5 A;  1QNU A;  4JV1 A;  2P0A A;  2VW9 A;  1PTO C;  5DLG A;  1KC7 A;  2W7O A;  4KKT A;  1HUN A;  4FXK C;  4EFB A;  2GVB A;  3DMU A;  3CPW A;  1IXR A;  2R92 H;  3TP6 A;  1KL9 A;  5I6Y A;  5DGA A;  2XRQ D;  4L5R C;  1Q82 C;  2LS0 1;  1KJ9 A;  2K03 A;  5CAE B;  5KFC A;  3RF2 A;  2OF1 A;  5IP7 H;  3K5N A;  3ZJY C;  5EKI A;  4AYB B;  3UDG A;  2XCA A;  3NHH A;  1JDE A;  5I9O A;  5BR8 L;  3GTQ A;  4GZY C;  3KUP A;  4WD3 A;  4JC0 A;  1HNW L;  3JAM E;  1BF4 A;  5CA1 F;  2RSO A;  1NTG A;  4BS9 A;  5HGQ A;  4DV5 L;  1WTX A;  4HCS A;  2L9H A;  1MHW C;  2I5M X;  1SN8 A;  5KT7 A;  1ET9 A;  3VR2 A;  1WD0 A;  2M05 A;  4IAJ A;  4MV3 A;  5C4J H;  4MV9 A;  2XCP A;  4F50 A;  4JI4 L;  3MXG A;  1XJV A;  1I94 Q;  2OQ0 A;  3HGB A;  4G7O C;  1ZYR C;  3R2I A;  2FMC A;  2R3Z A;  2Q8T A;  2WB1 E;  4IUR A;  1NMF A;  3RZD B;  4B3T Q;  1A62 A;  3KDF B;  5KGU A;  1WH2 A;  2R93 A;  5TSS A;  2MO1 A;  3E5N A;  3L9A X;  4NKL A;  1JOR A;  2LKV A;  3MFG A;  1WI5 A;  1N34 Q;  2KCC A;  4HYK A;  3GTG A;  2KEN A;  3DWA A;  2F0N A;  1SNP A;  2IPK D;  5JPN C;  4YQW A;  1DM0 B;  4POG A;  4UFZ A;  2YZM A;  4JV0 A;  5C5M A;  2I07 B;  2RQX A;  3CD6 A;  5CA0 F;  3OSO A;  1CQJ B;  4GOP C;  2DNC A;  4IWY A;  2H5X A;  3GP7 A;  1XMO H;  2CKZ B;  2YW2 A;  3FKI H;  4LF6 L;  1E4E A;  4K6D A;  1KTK A;  1TU2 B;  1QJO A;  4JI0 L;  4JYA H; 
#chains in the Genus database with same CATH homology
 1I5F A;  3M4P A;  3GDE A;  4J15 A;  4A3F G;  2WAQ E;  4DAY B;  1SMX A;  4KLK A;  1G6P A;  3OTO Q;  4DR7 Q;  2F4V Q;  4DV2 L;  4A3I G;  1VQJ A;  5IYD H;  3S15 H;  3RLO A;  3T1Y Q;  4JI8 Q;  1VQ7 A;  2UUC Q;  3TS2 A;  3HFZ B;  3PO2 H;  1X65 A;  2NZH A;  3K0X A;  4DR3 L;  4LUZ A;  5IYC H;  5IYD G;  4JI3 Q;  4JI2 Q;  4HJA A;  4LF4 L;  1K0R A;  1AH9 A;  2NVY H;  3A74 A;  1N34 L;  2NVQ H;  2N78 A;  1DGS A;  1QUQ B;  2OCE A;  4UP9 A;  4A3K G;  2CWA A;  2A1A A;  3CCL A;  1SFO H;  1LYL A;  2NZO A;  4DAM A;  3RN2 A;  1V43 A;  2WFW A;  2JA7 H;  4DV1 L;  4JI5 Q;  2KBN A;  4P71 A;  3PUY A;  3JC6 6;  3U50 C;  4HJ8 A;  2YTV A;  2VQE Q;  5FJ8 H;  3G4S A;  4DV7 L;  1HR0 L;  4NXN Q;  1YVC A;  1N33 Q;  4LW1 A;  4IO9 A;  4DV0 L;  3RZO H;  1H95 A;  4DV6 L;  1UEB A;  3J80 c;  1HZA A;  2B29 A;  2PMZ E;  5BR8 Q;  3PIO A;  1YIJ A;  2EQS A;  2Q2T A;  4Y52 H;  4KI0 A;  4A93 G;  3DLL A;  1NY4 A;  1HNZ L;  3PO3 H;  1K8G A;  1HNW Q;  1VQO A;  4OWT B;  4DUY L;  3F2D A;  4DV5 Q;  1YJW A;  2RHQ B;  2E5L L;  1FJG L;  1S40 A;  4R4T A;  3NBH B;  2MO0 A;  5C44 H;  4LF9 Q;  3H3V I;  4DR4 Q;  2HHH Q;  4IOA A;  1CSP A;  2KCT A;  4APV A;  2R7Z H;  1CSQ A;  1YHB A;  2YV5 A;  4JI4 Q;  3H3V H;  2WAQ G;  1PH7 A;  2YTY A;  4DR6 Q;  2QGQ A;  1A0I A;  4A3J G;  3PF5 A;  4JV5 Q;  3CCV A;  5M5W H;  2LXK A;  3RZD H;  5LMU Q;  1YJ9 A;  3U4V A;  4YHH Q;  4K0K L;  2Q2I A;  2VQF Q;  2IX0 A;  1SLJ A;  2ZTC A;  1A63 A;  2I5L X;  1YIT A;  3K81 C;  5C3E G;  5C4X G;  3UDF A;  4GOP B;  2JA5 G;  4IFD J;  4B3R Q;  1EYG A;  5IT9 c;  3A5Z B;  1I3Q H;  1JJG A;  4AQY Q;  1B8A A;  3H15 A;  4OWX B;  1L1O C;  2ID0 A;  3CCJ A;  4B3M Q;  3HKZ G;  4A3D G;  4JI5 L;  2K5N A;  1YBY A;  1I6H H;  1SR3 A;  1NMG A;  2ALY B;  3AQQ A;  1A8V A;  1X3F A;  3AYH B;  2RCN A;  1IL2 A;  4IFD G;  1PVO A;  4OON A;  3W1G A;  3HOW G;  1OXT A;  2DUD A;  2YTX A;  4BA1 I;  1WFQ A;  1YZ6 A;  3AFQ A;  4A3L G;  1HZ9 A;  3CW2 C;  1IZ6 A;  1E3P A;  3PUV A;  4X64 Q;  4OO1 I;  1SE8 A;  1Q86 C;  3W5O A;  5LMN Q;  2YYZ A;  1X9N A;  1Q7Y C;  4B3S L;  5M3F G;  4LF6 Q;  2K75 A;  4JI0 Q;  5GRO A;  1Y14 B;  3RR5 A;  2ZM6 Q;  5LMN W;  4YCW A;  4WJ4 A;  4A3F H;  2JK8 A;  5GAD C;  2K50 A;  1YI2 A;  1HZB A;  4GLA C;  2E2H H;  1VQG A;  3RN5 A;  1VQ5 A;  2CWP A;  1XMO L;  2A8V A;  2NVT H;  4A3I H;  4X62 L;  3TRE A;  1Q1E A;  4QY7 A;  1QZH A;  4LNQ A;  1E24 A;  4DV2 Q;  5M5X H;  4JYA L;  3HOV G;  3I55 A;  2Q2U A;  4C3J H;  3CPF A;  3GTK H;  1C0A A;  1X56 A;  2VUM G;  1BVS A;  5IP9 G;  4DUZ L;  4YY3 L;  2JEB I;  1OXX K;  3UE0 A;  2VQF L;  2XTI A;  1TXY A;  4C3H H;  4DV3 L;  5DLQ E;  3HOX G;  4DR3 Q;  2IT1 A;  4GLX A;  4JBK A;  4BXX G;  1JJ2 A;  1CKO A;  4LF4 Q;  2Y0S G;  1U0L A;  3U58 A;  3GTO H;  1X3G A;  4LFB L;  4XIG S;  1VQH A;  2Q2H A;  4R4O A;  1YNX A;  4IPG A;  4A3K H;  1QZG A;  1PHJ A;  1EIY B;  2VY3 A;  1HJP A;  4A3E G;  4B3M L;  3PCO B;  1HZC A;  4LF7 L;  1FL0 A;  2K4K A;  5H1S E;  4A3M G;  1QVF A;  4JBW A;  2L15 A;  1PYB A;  4DV1 Q;  1GKH A;  1CKN A;  3S1M H;  3CP0 A;  5JEA J;  4A75 A;  4A3B G;  3I2Z A;  4DV7 Q;  1HR0 Q;  1VS0 A;  2EIF A;  2UUB Q;  2KCM A;  4GNX A;  1D8L A;  3BZC A;  2Z6K A;  4DV6 Q;  2PNH A;  1HR0 W;  1U5K A;  3PO2 G;  1GVP A;  1KAW A;  1HNZ Q;  4JI7 L;  4QQB X;  1KXL A;  1PYS B;  5JEA G;  2MNA A;  4DUY Q;  1PFS A;  3D0F A;  2E5L Q;  4BBR G;  4DNI A;  1FJG Q;  4DR2 L;  4PMW A;  5M5Y H;  3S16 H;  1MJE A;  1IBK L;  2PQA B;  3EIV A;  1WJJ A;  4GKK L;  1HH2 P;  2F3I A;  3AFP A;  4KHP L;  4BY1 H;  4YWL A;  3VDY A;  4GN4 B;  2UXD L;  4OX9 Q;  1VQB A;  4A3J H;  4LWC A;  1BBW A;  4GS3 A;  1L1O B;  2WB1 G;  3RLF A;  1MIU A;  1B70 B;  3PSI A;  5IYB H;  1M90 C;  4L5S A;  3TRZ A;  2RHS B;  4AIM A;  3S2D H;  4K0K Q;  4DV4 L;  1JB7 A;  1M1K C;  1BBU A;  4JI6 L;  5JJL A;  5C3E H;  1GO3 E;  5C4X H;  1PH5 A;  3PUZ A;  2OTL A;  3M85 A;  2HIV A;  3Q8D A;  1Q1B A;  3I56 A;  2CCZ A;  1VQC A;  3M9B A;  4A3D H;  3BJU A;  2JA6 G;  1EFW A;  3GO5 A;  1VQF A;  2VS1 A;  4UP8 A;  3J81 j;  4IFD I;  4C2M H;  2F52 A;  1EWI A;  3EN2 A;  4HJ7 A;  2R93 G;  3J7A 5;  1GD7 A;  4ME3 A;  1Q12 A;  2HIX A;  1K8A C;  3IRB A;  1EQR A;  2UUB L;  3KF6 A;  1VQN A;  2LXJ A;  2MFI A;  4A3L H;  3A0J A;  1NJI C;  4PZ6 A;  1HNX Q;  1K3R A;  1X55 A;  4FDB A;  1VQE A;  5HY6 A;  3NEL A;  1KRS A;  4A76 A;  2ES2 A;  1J6Q A;  5M3F H;  3FHW A;  4B3S Q;  4UY8 C;  4WJ3 M;  2R7F A;  3K8A A;  2B63 H;  2B3G A;  5IE8 A;  5K36 G;  1JMC A;  1CUK A;  1XMO Q;  1K73 C;  1PH2 A;  4QGU A;  4OX9 L;  3BU2 A;  3DM3 A;  3L7Z C;  4X62 Q;  2BH8 A;  2GVA A;  3E9H A;  4L5T A;  5J3B A;  4AYB E;  3F2B A;  1PA6 A;  3HOV H;  1X6O A;  4JYA Q;  3H0G G;  2VUM H;  3L2P A;  1Y1V G;  2K5H A;  5IP9 H;  1Y1W G;  4DUZ Q;  5AJ3 L;  4YY3 Q;  1K9M C;  2FXQ A;  4BXX H;  4DV3 Q;  1XNQ L;  2IX1 A;  4L5Q A;  4DPG A;  5ELO A;  3S14 H;  1WYD A;  3FKI G;  3J81 i;  3CME A;  1RL2 A;  3KDF A;  4LFB Q;  1KHI A;  3HOU G;  1VCI A;  4A3E H;  3RNU A;  3I4N G;  1P8L A;  1JE5 A;  2UU9 L;  3G48 A;  2ZTD A;  1EIF A;  4LF7 Q;  4A3M H;  4AH6 A;  1J5E Q;  4DK6 C;  1YHQ A;  2D0O A;  2ATW A;  1VQD A;  2OQK A;  3CAM A;  2K14 A;  3G71 A;  1PH3 A;  4A3B H;  2UXB L;  4YWK A;  3UE1 A;  4LUV A;  1OXU A;  4IPC A;  4LFA L;  3HOZ G;  4EX5 A;  1HNX L;  4DKA C;  1V9P A;  4TQU S;  2IHE A;  3S24 A;  1OXS C;  2RF4 A;  3OW2 A;  2N3S A;  3PIP A;  1XPR A;  4MZ9 A;  1P16 A;  1E7Z A;  3CCS A;  4JI7 Q;  1LM0 A;  4H02 A;  3MXN B;  1VQM A;  1TWC H;  1XNR L;  3S1N H;  1UE7 A;  5GAH C;  4DR2 Q;  2K52 A;  1N36 L;  2JA8 G;  4JOI A;  1IBK Q;  4R4C A;  4GKK Q;  1BKB A;  3S1R H;  3GTQ H;  4NB3 A;  2VL6 A;  4ALP A;  4KHP Q;  4MTN A;  2UXD Q;  4X66 L;  1LUZ A;  3CQZ H;  1JJC B;  5FJ8 G;  1Q81 C;  1KC8 C;  2NN6 G;  4AYB G;  2VZA A;  1YHA A;  3F8T A;  3E9I A;  4BY7 G;  2D0P A;  3K80 C;  3OYY A;  4DR5 L;  4JI1 L;  1L0W A;  4LF5 L;  4DV4 Q;  4UPA A;  4JI6 Q;  3PO3 G;  4P72 A;  4GNX C;  4PZ7 A;  2Z6K C;  4OO1 G;  4OWW B;  2VNU D;  3TQY A;  3CCM A;  4A4I A;  3PF4 A;  2ZTE A;  3I7F A;  1S72 A;  1PH8 A;  3J81 c;  1IBM L;  3GD7 A;  4LFC L;  5FLX c;  5C44 G;  1J5E L;  2OWO A;  2JA6 H;  3AEV A;  1VQP A;  1QUQ A;  2R93 H;  1PH9 A;  2D62 A;  3K7A H;  4HIO A;  4GKJ Q;  1TWH H;  3KYH C;  3TS0 A;  3STB C;  3G6E A;  2Z0S A;  4X65 L;  1G51 A;  2JEA I;  3TEH B;  1MKH A;  3UDX A;  2BA1 A;  1KD1 C;  3GTG H;  2HT1 A;  4IOC A;  4GLV B;  2I0Q A;  4A93 H;  4A3C G;  2KHJ A;  3CC7 A;  4JG2 A;  5EAY A;  4BA2 I;  3B6Y A;  1FVI A;  5GAE C;  3CXC A;  3FP9 A;  4RG1 A;  1TWA H;  1W2B A;  5JJI A;  2PI2 A;  3CCR A;  1SRO A;  2R92 G;  4XTC S;  1R9T H;  4BBS G;  2JJQ A;  3T1H L;  1N32 L;  1JT8 A;  4HID A;  1VQ9 A;  5IWA Q;  3K7U C;  1EQQ A;  4A3C H;  1YEZ A;  1Y1V H;  5IP7 G;  3PUW A;  1Y1W H;  2PI2 E;  3KJO A;  2K5V A;  5FLM G;  4HJ5 A;  2ASB A;  1TWG H;  4PZ8 A;  1PH6 A;  4NXM L;  1N9W A;  5AJ3 Q;  2UUA Q;  2CQO A;  5GAG C;  3ULJ A;  1XNQ Q;  2JA5 H;  4IJH A;  2AKW B;  3ERS X;  4HIK A;  1WCM G;  4KHZ A;  4R1J A;  3I4M G;  3I4N H;  4C3I H;  1B7Y B;  4EQ5 A;  2AHO B;  3NEM A;  2UU9 Q;  3PV0 A;  1V1Q A;  4GOP A;  1I94 L;  3KF8 B;  1C7Y A;  1IBL L;  3J7Z C;  1IYJ B;  3JAM i;  1LTL A;  1Z47 A;  1XMQ L;  3S2H H;  1NBW A;  4JCV E;  3CF5 A;  1X54 A;  4GKJ L;  1C9O A;  2UXB Q;  3CCU A;  1EOV A;  4IPH A;  2IY5 B;  3HKS A;  3HOW H;  2UXC L;  5IY0 A;  4B3T L;  1Z9F A;  3HOZ H;  1VQ8 A;  3M4O H;  4LFA Q;  1Q8K A;  1SRU A;  1ASZ A;  3MEF A;  3ULL A;  4A3G G;  3STB D;  4JBM A;  3CC2 A;  3A5U A;  2AMC B;  1E22 A;  1PH1 A;  1XNR Q;  1CKN B;  3HKZ E;  4Y7N H;  5GQO A;  2AWN A;  3I4O A;  4O2D A;  2JA8 H;  2E2J H;  5C0X J;  1N36 Q;  1S3O A;  1UE1 A;  3HOY G;  1VQK A;  4R4Q A;  4GNX B;  2NN6 I;  2ZJQ A;  5IWA L;  4QL5 A;  4X66 Q;  3M4Q A;  1XPO A;  1QVC A;  3M3Y H;  3KLW A;  1XTD A;  1YJN A;  3KFU A;  4BY7 H;  1VQL A;  5C0X G;  2NVX H;  2UUA L;  1NE3 A;  5M3M G;  3HOX H;  1GM5 A;  4DR5 Q;  4JI1 Q;  1PV4 A;  3M7N A;  1L2F A;  1KQS A;  1ASY A;  4LF5 Q;  1VQA A;  2DGY A;  5E7N A;  3ICE A;  1MJC A;  2V1C C;  2MQH A;  3S17 H;  1T9H A;  4OXP A;  2QEX A;  1RIP A;  3W1B A;  1IBM Q;  4IPD A;  4YWM A;  4LFC Q;  3L0O A;  4P73 A;  3OTO L;  1G29 1;  1OTC A;  3CC4 A;  2F4V L;  4DR7 L;  4IJL A;  4BY1 G;  4DR1 Q;  4NPS A;  2XGT A;  1I50 H;  3T1Y L;  2ZJR A;  1KIX A;  4JOI C;  4JI8 L;  4P75 A;  3JAM c;  3KJP A;  2LSS A;  1W3S A;  3EBE A;  2UUC L;  2C35 B;  3CMA A;  3GTP H;  2JE6 I;  4X65 Q;  2N8N A;  4P74 A;  5IYB G;  1UWV A;  2BA0 A;  2WP8 J;  4R4I A;  3F2C A;  1CKM A;  4JI3 L;  2E8G A;  2Y0S E;  4LUO A;  4GN5 A;  4POF A;  5IYC G;  4JI2 L;  1OXV A;  1K83 H;  3E0E A;  2VW9 A;  1VQ6 A;  4PG3 A;  1E1O A;  2GVB A;  4GN3 B;  3PUX A;  4BBR H;  2B63 G;  3CPW A;  1AE3 A;  1IXR A;  4HIM A;  2R92 H;  1KL9 A;  2BH2 A;  4BBS H;  3KF6 B;  3GTM H;  2JA7 G;  4L5R C;  4MNO A;  1Q82 C;  3T1H Q;  2I5H A;  3LGJ A;  4DK3 C;  4NXN L;  2VQE L;  4QIW E;  4HJ9 A;  1N33 L;  1N32 Q;  2JQO A;  1KRT A;  2PQA A;  5IP7 H;  3ZJY C;  3UDG A;  3CCQ A;  2YU9 H;  5FLM H;  5BR8 L;  2OTJ A;  4JC0 A;  1QVG A;  4NXM Q;  1HNW L;  4X6A H;  1NTG A;  5HGQ A;  4LF8 Q;  1L1O A;  1WCM H;  3F1Z A;  4DV5 L;  3I4M H;  2I5M X;  1SN8 A;  1E1T A;  3GTL H;  4DR4 L;  4LF9 L;  2HHH L;  3KOJ A;  5C4J H;  4RMF A;  2JA9 A;  4JI4 L;  2ZJP A;  1XJV A;  2A19 A;  1AE2 A;  4DR1 L;  2OQ0 A;  1I94 Q;  3CCE A;  3UDI A;  1XMQ Q;  1IBL Q;  2R7Z G;  4DR6 L;  1VQI A;  2E2I H;  4JV5 L;  3BZK A;  1FGU A;  1WOC A;  2WB1 E;  2KHI A;  5LMU L;  2UXC Q;  4QJF A;  2QA4 A;  1NMF A;  4UP7 A;  1UE5 A;  4O0A A;  4YHH L;  1A62 A;  3KDF B;  4B3T Q;  1VQ4 A;  2MO1 A;  4A3G H;  2N49 A;  1EUJ A;  3S1Q H;  4B3R L;  1WI5 A;  1N34 Q;  2AWO A;  4AQY L;  2KEN A;  2R6G A;  4JBJ A;  1TWF H;  2IHF A;  3D31 A;  3WWV A;  3HOY H;  1O7I A;  4POG A;  1D7Q A;  3PGZ A;  2R7D A;  4TVA B;  3CD6 A;  3RLN A;  4YCV A;  2CFM A;  3ER0 A;  3H0G H;  5C0X I;  4YCU A;  3J80 i;  4GOP C;  1N8R C;  1PH4 A;  2HQL A;  2EXD A;  4DV0 Q;  2GN5 A;  2H5X A;  5JJK A;  1UE6 A;  3NEN A;  5M3M H;  4X64 L;  2CKZ B;  5LMN L;  3ULP A;  3SGI A;  1X3E A;  3GTJ H;  3FKI H;  4LF8 L;  4LF6 L;  1Q46 A;  1XPU A;  4JI0 L;  3U4Z A;  5ELN A;  3HOU H;  2ZM6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...