1GYFA

Gyf domain from human cd2bp2 protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (CYTOPLASMIC DOMAIN BINDING PROTEIN (CD2BP2))
publication title The GYF domain is a novel structural fold that is involved in lymphoid signaling through proline-rich sequences.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1999-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1gyfA00
3FMAA 1WH2A 1L2ZA 1GYFA 3K3VA 1SYXB 4BWSC
chains in the Genus database with same CATH superfamily
5DQHA 1T3NA 1K1SA 3CVZA 3GIKA 5KG5A 2OH2A 3PW4A 4IRDA 2RDJA 3GV5B 3N8DA 4X64H 5LP6F 5KFIA 5DGAA 1WR2A 1N48A 1V9PA 3GIDA 2W70A 3KHHA 2V58A 3I12A 5KFUA 4J9LA 4DL6A 3RBDA 3GILA 5L1JA 1V51A 5DG8A 3LWBA 1K1QA 2WB1A 2R92G 4NLGA 2R7ZG 4YAJB 4EBDA 3T1YH 3EYYA 4MTEA 3Q8SB 4QIWA 3OTOH 2FLPA 3C0FB 2UU9H 4JI2H 4Q0YA 2B63A 4MV8A 4LF6H 3PW7A 2V9WA 4EEQA 2R8JA 4JUZA 3J81W 2ZDHA 1PK8A 2OWOA 2YRXA 2YZNA 1CE8A 5DG9A 2R6FA 3MWDA 2RDIA 2VUGA 3F8NA 5KFEA 3GIQA 5KG4A 1ZQ7A 3GQCA 3BQ2A 2J6SA 1AUVA 2AGQA 3HOYG 2JA7A 2NVYA 4EGJA 2FK3A 2HGSA 4AYBA 2FPIB 3ETHA 5C1OA 3PW5A 2JA6G 3KHGA 3K3PA 2C35B 2CW8A 3VPBA 3RJ0A 5HBRB 4RZQA 5J2UF 3K5IA 4DL2A 2JA5G 5KFYA 2ASJA 3R5FA 2HHHH 5F9NA 4JV2A 4GLXA 1S10A 4DR7H 3QZ7A 5IP7G 1I7NA 4ECRA 2ASLA 3LP8A 4OX9H 2UXBH 1E4EA 5D1OA 3GIPA 2QYZA 4Q44A 5KFZA 2J9GA 5KT4A 4QWBA 5LXTF 2AGPA 3U9SA 3V6KA 1KBLA 4FS1A 3H20A 3JSNA 4HR7A 4EBCA 3V6JA 1S0MA 5C4XG 1TWCA 4TQSA 1Z2PX 3R23A 3MFIA 2W9AA 2BQUA 4C2MA 4ECXA 1TWHA 4DR6H 3OHBA 5C44G 4YR2A 3BQ0A 1VKZA 4O4IF 2C28A 3MR5A 2X0SA 4MV7A 4I4TF 4ED7A 5C8YF 2C22A 1AUXA 2YS6A 3EPIA 3HBLA 3OUZA 2XGPA 2W6MA 1W96A 5KG3A 2IMWP 4GKKH 3JRXA 1N34H 2NVXA 1T94A 4O4LF 1TAEA 1S0NA 4DUZH 2W6OA 3RB0A 2VUMA 5K2MA 3RB4A 5DGBA 4WBNF 4GC7A 1ZHSA 4LF4H 4R8UB 3H0GG 1Y1VA 4F4XA 4DV7H 5C1PA 1JIHA 4A3DG 3OHAA 2JEIA 1S97A 4YB8B 4RB0A 4TV9F 4J9PA 1R9TA 1ZETA 2XCAA 4LF9H 2GPSA 3FKIG 3MWMA 2O03A 3R5XA 2W7OA 3HOXG 1WH2A 2HVRA 2DWCA 2R86A 4JI4H 4PDBA 3PR4A 3OSPA 4BBSG 5IT9W 5KG6A 3BA9A 1EYZA 2XGQA 4YY3H 3RAXA 5EZYF 3GTGA 1N56A 4LSXA 4ME6A 3TINA 2QK4A 2FB9A 1FJGH 5EWGA 4A3GG 2ZM6H 5C5JA 5BMVF 5FLMG 3M4IA 4LH6A 4AQYH 1E4FT 4J9QA 4ECSA 1N36H 4EYHB 4R7RA 4K0KH 3UQ8A 2WDTA 3BAAA 4LF8H 4MAMA 1RJPA 2PVPA 4HQ6A 4LFCH 1KJQA 4I50F 1VS0A 3CQZA 3V4SA 4ECVA 3PZPA 2J6UA 1SYXB 3GTOA 3KAKA 3GIIA 3R5HA 2YCHA 3J80W 2CZGA 1DGSA 2Q2UA 4QWCA 4NXNH 5L1IA 5F9LA 4E4TA 3KTMA 4A3EG 3H4BA 2FMAA 4MV1A 2R93G 4JI7H 2I80A 2WTFA 1N32H 2R7KA 4BXXG 4JI1H 3PVXA 4UCRA 4RB3C 4JI5H 4A3BG 4ETSA 5KT3A 2VQDA 3LMLA 3ETJA 3RFCA 4RAZA 4QJFA 4O3OA 4J9RA 4DR5H 1XMQH 3GTJA 5FD6A 5J2TF 1VBHA 4M7EA 5LMNH 1GLVA 2OLSA 2R8HA 5JH7F 4Q8FA 1I3QA 2YU9A 4ED0A 3KAJA 3GIJA 1JDEA 2DLNA 5KFPA 4QWAA 4DV2H 2I8CA 3VPCA 1EHIA 4ED8A 4MV3A 5KX5F 1DIKA 2R87A 3JAMW 1AN7A 2ALZA 4CC5A 1E4EB 3BJYA 5D1OB 4DR3H 2WE6A 2AGOA 2F4VH 4IRCA 2JA7G 2XCLA 4JI6H 1S68A 3GLKA 3RBEA 1Y1WA 1JLLB 4UCTA 4RNNA 3GTMA 5KFDA 4L1KA 4A3KG 2W6PA 2W71A 4ECTA 4XYLB 3GV8B 3HKZE 4RNOA 4YAKB 4ED6A 5JUMA 5BPFA 4UCSA 1E4GT 2V4RA 1RK6A 3T5KA 4ZHQF 5IYZF 1JDBB 4O2AF 1I50A 4RUCA 1HNWH 3KALA 4GKJH 3V6HA 2M05A 3Q1KA 1S03G 4B3TH 4F50A 1BNCA 2RGVA 2VR1A 3E5NA 2PMZE 1DV2A 4JI0H 4ED2A 5LYJF 4ECQA 4RB2C 5CB4F 2Y0SE 2YZMA 2ZJTA 5KT7A 4DUYH 3V4ZA 1J5EH 5L1LA 2WAQA 3HOUG 4YHHH 4F4YA 5KFRA 2YZGA 3N41B 2BQ3A 4TV8F 4EG0A 1I94H 3L2PA 4QWEA 5CA1F 1N33H 1GO3E 2R7LA 5FD5A 4FU0A 5I47A 3ORRA 4DV5H 3QFFA 4C5BA 4JYAH 3T1HH 2FLNA 5IYCG 2E5LH 2GPWA 3T5HA 5FJ8G 1XDNA 1BXRA 3PR5B 4J9KA 1IBMH 2IBKA 4PWQA 3RIZA 1Y1VG 4WD3A 4EYIB 4RNMA 1JXLA 4XX0B 2W9BA 1SCUB 4EEYA 2JEGA 4J0MA 2YRWA 4RU9A 3BA8A 4HNTA 4YR3A 2R7MA 1EZ1A 3PN1A 4IWYA 3WO1A 5EDWA 4ED3A 5H80A 5LOVF 3PO2G 5KG7A 4FM9A 4DR2H 1X9NA 3KHLA 2WB1E 5CA0F 5KG2A 4EFBA 1K83A 1RJRA 4LFAH 4KHPH 3RF2A 3I4MG 4QIWE 5BR8H 5T14A 2NU7B 4A3FG 4YR0A 4DV3H 1XNQH 2C2EA 4ECUA 3RTXA 3TQTA 5FLXW 3RB3A 2W8KA 4YJ2F 1WCMA 1WSCA 3DF7A 3RV3A 3T5JA 2JEJA 2UXCH 3J7AK 4DL7A 2FK1A 5JVLA 3FDSA 4MA5A 4XYMB 4A93G 4A3CG 4BY7G 3UFXB 5DLGA 2C2RA 2XD4A 1CS0A 1ULZA 1RJQA 2FK2A 2UVRA 2CQYA 4UCVA 2P0AA 5L1KA 4AYBE 2UUCH 2MCTA 1VBGA 2FE3A 3N6XA 2UVUA 4IR9A 3FMAA 4O2BF 4A2BA 3EPGA 4O3QA 5KFNA 4TQRA 4JV1A 1I6UA 4C5CA 3Q2OA 5D1PA 5BPHA 4ZI7F 5KFHA 4A3JG 1CQIB 4C5AA 1GSAA 2NU9B 4J9MA 2HVQA 4J9NA 4ECYA 3PW0A 4G3IA 3HOVG 2R8GA 4DV0H 3Q8QB 1B6SA 1VAJA 2V59A 2W6QA 4IWXA 1T36A 1UC9A 4LFBH 4DL5A 1RYSA 2UUAH 4RUAA 1TWGA 5IYDG 5KFWA 1GSHA 1JKJB 5DQGA 3RGXA 1I7LA 1M6VA 4IR1A 3AYHB 4MV4A 4APMA 2R85A 4A2AA 4F4WA 5IP9G 4X65H 2VPQA 4DR4H 3T5LA 1M0WA 1UC8A 2FP4B 5LL6b 2IP4A 5KFGA 3N44B 3IG0A 3M9NB 4O3NA 2B63G 5EOYA 2W9CA 5HV6A 2YYAA 1O75A 3N40P 2XC9A 3TIGA 3L4JA 4ECWA 1JX4A 1SEIA 1GYFA 2R7NA 1B6RA 1Y1WG 5KFOA 3RAQA 2UVVA 1M7JA 4RAYA 5KT6A 4TUYF 4ZQIA 2XIGA 1RK5A 4A3MG 3BG5A 3BABA 4O4HF 4UCUA 5JQWA 3BQ1A 1V4YA 4DL3A 3N43B 3H3VH 4IZOA 2E2IA 1M0TA 3PO3G 4JV0A 4U7CA 3GIMA 2R93A 3QZ8A 3ORQA 4I7HA 4HNVA 2VA3A 4BBRG 1B33N 2SCUB 4U6PA 2FPPB 2FPGB 2WYOA 3Q8RB 2ZDQA 1XNRH 3MFHA 1C30A 3M9OB 2FLLA 5EWEA 2V5AA 3HXLA 3VPDA 2PN1A 4LMYA 2PBZA 4JI3H 4YQWA 1FVIA 4MV9A 5DQIA 2VQEH 1S9FA 2R84A 4HNUA 4I55F 2VOBA 3VMMA 3H40A 4EFEA 2J6TA 3RGZA 1A0IA 3HOZG 3I4NG 2KSWA 4LH7A 5KFXA 2W9BB 5KFKA 5LA6F 4EGQA 3KHRA 4DV1H 1HR0H 4FBTA 3HB9A 2R92A 4YJ3F 2BQRA 2R7ZA 2W57A 1EUCB 5KFQA 5LMUH 1S0OA 2UVWA 4LSAA 1ZHQA 5KFCA 2VQFH 3SE7A 3RUPA 2AQ4A 1HNXH 3L4KA 2NUAB 2Q2TA 3K5HA 3GV7B 4B3RH 2NU8B 3GTQA 3TQ1A 3RB6A 1SFOA 1Y14B 5KT5A 5KFJA 4ED1A 3WO0A 3OUUA 1IOVA 1BJTA 3WNZA 4FS2A 4Q8EA 3JSLA 5KFTA 5KFVA 5KFMA 1IBKH 2VUMG 3JZIA 2R8IA 2BR0A 2JA6A 2W6ZA 4UFZA 5KFSA 4UCOA 1KEEA 4BY1G 2HVSA 2JA5A 2W6NA 3IN5A 2DPJA 4RB1A 3GTLA 4X66H 5KFFA 2JEFA 3H4DA 5FPRA 2HJWA 3MWEA 1TWAA 3GTKA 4IRKA 3MR3A 5IWAH 4DLKA 2YW2A 1WCMG 1L2ZA 5JVDF 1GSOA 5KFLA 3MR6A 3G8CA 2W7PA 2ZDGA 4J9SA 1KJIA 4NXMH 4JI8H 2ATLA 4A3IG 2I87A 1W93A 2R82A 5KT2A 4LF5H 2NU6B 4YP3A 4J9OA 2JA8G 1C3OA 3TIIA 4DV4H 4O3SA 1Z2NX 2C00A 2XCPA 4HYKA 4DL4A 1KJ8A 2UUBH 3G6XA 1P8LA 1IBLH 5KKNB 2CW7A 1Z2OX 5C3EG 4MTDA 5KFAA 1MZBA 2GLTA 2RF4A 2FKLA 2VA2A 3OSNA 5EWFA 4IHJF 4DV6H 1PX2A 2CKZB 3H0GA 1A9XA 3N42B 2W9CB 1B04A 1TWFA 1TA8A 5KG0A 4EBEA 1BGWA 1KJ9A 5KFBA 4ECZA 2AU0A 5GONF 4MA0A 1RYRA 1DV1A 3HKZA 4IAJA 4O3PA 5L9XA 4RZRA 3K3VA 4QWDA 2YL2A 4BWSC 4X62H 5DG7A 1XMOH 1HNZH 2C2DA 3G6YA 2WAQE 2DZDA 3KXYT 4LF7H 3FKIA 4YBZB 3RV4A 2E2HA 4ZOLF 4B3SH 4QW9A 4O3RA 3U9TA 2RGRA 1CQJB 2DIKA 3MR2A 3PW2A 3M9MB 1FKAH 2PMZA 5D8DA 5DLFA 5IYBG 4R8UA 1IOWA 2Y0SA 4Q43A 3NGDA 4DR1H 3JRWA 4MV6A 2ASDA 4Q45A 4Y8VB 2V4QA 4M9UA 2UXDH 1KC7A 5KG1A 1KJJA 4F4ZA 2DPIA 3HOWG 4B3MH 4FBUA 3G6VA 4XZ3B 5A2QW 3GTPA 1UNNC 4CC6A 2IA6A 4A3LG 2FJZA 1OWTA 2R8KA 4QW8A 4JV5H 2YS7A 5FPOA 3MJFA 3Q8PB 2W8LA 3SI8A 5CAEB 1GGOA 4GC6A 1EUDB 2VPSA
chains in the Genus database with same CATH topology
3BA8A 5LMUH 2ZM6H 4LSAA 3CVZA 3PN1A 1ZHQA 3M4IA 4LH6A 4AQYH 1E4FT 2VQFH 1N36H 4X64H 4R7RA 4FM9A 4DR2H 1X9NA 1HNXH 3UQ8A 2WDTA 3L4KA 3BAAA 4K0KH 2Q2TA 4LF8H 4EFBA 4LFAH 4B3RH 4KHPH 3RF2A 4LFCH 1V9PA 1VS0A 5BR8H 1SYXB 3KAKA 4DV3H 3J80W 2YCHA 2Q2UA 1XNQH 1DGSA 3RTXA 5FLXW 1BJTA 4NXNH 3T1YH 3EYYA 3DF7A 2UXCH 3JSLA 4MTEA 3OTOH 3J7AK 3C0FB 1IBKH 4JI2H 2UU9H 4Q0YA 4LF6H 4JI7H 4UFZA 4EEQA 1N32H 4UCOA 3J81W 2HVSA 2OWOA 4JI1H 4UCRA 4RB3C 4UCVA 2UUCH 4ETSA 4RB1A 4JI5H 4X66H 2MCTA 2VUGA 2FE3A 3F8NA 3LMLA 3N6XA 4RAZA 5FPRA 4DR5H 3FMAA 4A2BA 1XMQH 5IWAH 5FD6A 1I6UA 4M7EA 5D1PA 5LMNH 1L2ZA 2HGSA 2HVQA 4DV0H 2CW8A 4NXMH 3KAJA 3RJ0A 4JI8H 4RZQA 4DV2H 4LF5H 2HHHH 3JAMW 4DV4H 4GLXA 1AN7A 4DR7H 4CC5A 4DR3H 4LFBH 5D1OB 2WE6A 2F4VH 2UXBH 1Z2NX 4OX9H 5D1OA 2UUAH 2UUBH 4JI6H 1P8LA 1S68A 3RGXA 4MTDA 2CW7A 1Z2OX 4UCTA 1IBLH 4JYAH 3H20A 3JSNA 1MZBA 4APMA 4A2AA 1Z2PX 4X65H 4DR6H 4DR4H 1M0WA 4DV6H 5LL6b 4UCSA 1E4GT 3N42B 3IG0A 1B04A 3N44B 1TA8A 4MV7A 1BGWA 5EOYA 3L4JA 1O75A 3N40P 1HNWH 4GKJH 4IAJA 1SEIA 3KALA 1XMOH 3K3VA 1GYFA 4BWSC 4X62H 1S03G 1HNZH 4B3TH 4RAYA 3KXYT 2RGVA 4LF7H 4JI0H 2XIGA 3BABA 4GKKH 4B3SH 4UCUA 4RB2C 1N34H 2ZJTA 4DUYH 1J5EH 1TAEA 2RGRA 4DUZH 3N43B 4LF4H 1M0TA 4YHHH 1ZHSA 1FKAH 3N41B 4DV7H 4I7HA 4DR1H 1I94H 3L2PA 1N33H 5FD5A 4RB0A 2WYOA 4DV5H 1XNRH 4LF9H 2UXDH 3HXLA 3MWMA 2O03A 3T1HH 4LMYA 4JI3H 1FVIA 1WH2A 4MV9A 2E5LH 5A2QW 2VQEH 2HVRA 4CC6A 4B3MH 4JI4H 4PDBA 2VOBA 1XDNA 4JV5H 5IT9W 4EFEA 5FPOA 3RGZA 1A0IA 3RIZA 1IBMH 2KSWA 3BA9A 4LH7A 4YY3H 1HR0H 4DV1H 4LSXA 4J0MA 2W57A 2VPSA 1FJGH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMA A;  1WH2 A;  1L2Z A;  1GYF A;  3K3V A;  1SYX B;  4BWS C; 
#chains in the Genus database with same CATH topology
 5DQH A;  1T3N A;  1K1S A;  3CVZ A;  3GIK A;  5KG5 A;  2OH2 A;  3PW4 A;  4IRD A;  2RDJ A;  3GV5 B;  3N8D A;  4X64 H;  5LP6 F;  5KFI A;  5DGA A;  1WR2 A;  1N48 A;  1V9P A;  3GID A;  2W70 A;  3KHH A;  2V58 A;  3I12 A;  5KFU A;  4J9L A;  4DL6 A;  3RBD A;  3GIL A;  5L1J A;  1V51 A;  5DG8 A;  3LWB A;  1K1Q A;  2WB1 A;  2R92 G;  4NLG A;  2R7Z G;  4YAJ B;  4EBD A;  3T1Y H;  3EYY A;  4MTE A;  3Q8S B;  4QIW A;  3OTO H;  2FLP A;  3C0F B;  2UU9 H;  4JI2 H;  4Q0Y A;  2B63 A;  4MV8 A;  4LF6 H;  3PW7 A;  2V9W A;  4EEQ A;  2R8J A;  4JUZ A;  3J81 W;  2ZDH A;  1PK8 A;  2OWO A;  2YRX A;  2YZN A;  1CE8 A;  5DG9 A;  2R6F A;  3MWD A;  2RDI A;  2VUG A;  3F8N A;  5KFE A;  3GIQ A;  5KG4 A;  1ZQ7 A;  3GQC A;  3BQ2 A;  2J6S A;  1AUV A;  2AGQ A;  3HOY G;  2JA7 A;  2NVY A;  4EGJ A;  2FK3 A;  2HGS A;  4AYB A;  2FPI B;  3ETH A;  5C1O A;  3PW5 A;  2JA6 G;  3KHG A;  3K3P A;  2C35 B;  2CW8 A;  3VPB A;  3RJ0 A;  5HBR B;  4RZQ A;  5J2U F;  3K5I A;  4DL2 A;  2JA5 G;  5KFY A;  2ASJ A;  3R5F A;  2HHH H;  5F9N A;  4JV2 A;  4GLX A;  1S10 A;  4DR7 H;  3QZ7 A;  5IP7 G;  1I7N A;  4ECR A;  2ASL A;  3LP8 A;  4OX9 H;  2UXB H;  1E4E A;  5D1O A;  3GIP A;  2QYZ A;  4Q44 A;  5KFZ A;  2J9G A;  5KT4 A;  4QWB A;  5LXT F;  2AGP A;  3U9S A;  3V6K A;  1KBL A;  4FS1 A;  3H20 A;  3JSN A;  4HR7 A;  4EBC A;  3V6J A;  1S0M A;  5C4X G;  1TWC A;  4TQS A;  1Z2P X;  3R23 A;  3MFI A;  2W9A A;  2BQU A;  4C2M A;  4ECX A;  1TWH A;  4DR6 H;  3OHB A;  5C44 G;  4YR2 A;  3BQ0 A;  1VKZ A;  4O4I F;  2C28 A;  3MR5 A;  2X0S A;  4MV7 A;  4I4T F;  4ED7 A;  5C8Y F;  2C22 A;  1AUX A;  2YS6 A;  3EPI A;  3HBL A;  3OUZ A;  2XGP A;  2W6M A;  1W96 A;  5KG3 A;  2IMW P;  4GKK H;  3JRX A;  1N34 H;  2NVX A;  1T94 A;  4O4L F;  1TAE A;  1S0N A;  4DUZ H;  2W6O A;  3RB0 A;  2VUM A;  5K2M A;  3RB4 A;  5DGB A;  4WBN F;  4GC7 A;  1ZHS A;  4LF4 H;  4R8U B;  3H0G G;  1Y1V A;  4F4X A;  4DV7 H;  5C1P A;  1JIH A;  4A3D G;  3OHA A;  2JEI A;  1S97 A;  4YB8 B;  4RB0 A;  4TV9 F;  4J9P A;  1R9T A;  1ZET A;  2XCA A;  4LF9 H;  2GPS A;  3FKI G;  3MWM A;  2O03 A;  3R5X A;  2W7O A;  3HOX G;  1WH2 A;  2HVR A;  2DWC A;  2R86 A;  4JI4 H;  4PDB A;  3PR4 A;  3OSP A;  4BBS G;  5IT9 W;  5KG6 A;  3BA9 A;  1EYZ A;  2XGQ A;  4YY3 H;  3RAX A;  5EZY F;  3GTG A;  1N56 A;  4LSX A;  4ME6 A;  3TIN A;  2QK4 A;  2FB9 A;  1FJG H;  5EWG A;  4A3G G;  2ZM6 H;  5C5J A;  5BMV F;  5FLM G;  3M4I A;  4LH6 A;  4AQY H;  1E4F T;  4J9Q A;  4ECS A;  1N36 H;  4EYH B;  4R7R A;  4K0K H;  3UQ8 A;  2WDT A;  3BAA A;  4LF8 H;  4MAM A;  1RJP A;  2PVP A;  4HQ6 A;  4LFC H;  1KJQ A;  4I50 F;  1VS0 A;  3CQZ A;  3V4S A;  4ECV A;  3PZP A;  2J6U A;  1SYX B;  3GTO A;  3KAK A;  3GII A;  3R5H A;  2YCH A;  3J80 W;  2CZG A;  1DGS A;  2Q2U A;  4QWC A;  4NXN H;  5L1I A;  5F9L A;  4E4T A;  3KTM A;  4A3E G;  3H4B A;  2FMA A;  4MV1 A;  2R93 G;  4JI7 H;  2I80 A;  2WTF A;  1N32 H;  2R7K A;  4BXX G;  4JI1 H;  3PVX A;  4UCR A;  4RB3 C;  4JI5 H;  4A3B G;  4ETS A;  5KT3 A;  2VQD A;  3LML A;  3ETJ A;  3RFC A;  4RAZ A;  4QJF A;  4O3O A;  4J9R A;  4DR5 H;  1XMQ H;  3GTJ A;  5FD6 A;  5J2T F;  1VBH A;  4M7E A;  5LMN H;  1GLV A;  2OLS A;  2R8H A;  5JH7 F;  4Q8F A;  1I3Q A;  2YU9 A;  4ED0 A;  3KAJ A;  3GIJ A;  1JDE A;  2DLN A;  5KFP A;  4QWA A;  4DV2 H;  2I8C A;  3VPC A;  1EHI A;  4ED8 A;  4MV3 A;  5KX5 F;  1DIK A;  2R87 A;  3JAM W;  1AN7 A;  2ALZ A;  4CC5 A;  1E4E B;  3BJY A;  5D1O B;  4DR3 H;  2WE6 A;  2AGO A;  2F4V H;  4IRC A;  2JA7 G;  2XCL A;  4JI6 H;  1S68 A;  3GLK A;  3RBE A;  1Y1W A;  1JLL B;  4UCT A;  4RNN A;  3GTM A;  5KFD A;  4L1K A;  4A3K G;  2W6P A;  2W71 A;  4ECT A;  4XYL B;  3GV8 B;  3HKZ E;  4RNO A;  4YAK B;  4ED6 A;  5JUM A;  5BPF A;  4UCS A;  1E4G T;  2V4R A;  1RK6 A;  3T5K A;  4ZHQ F;  5IYZ F;  1JDB B;  4O2A F;  1I50 A;  4RUC A;  1HNW H;  3KAL A;  4GKJ H;  3V6H A;  2M05 A;  3Q1K A;  1S03 G;  4B3T H;  4F50 A;  1BNC A;  2RGV A;  2VR1 A;  3E5N A;  2PMZ E;  1DV2 A;  4JI0 H;  4ED2 A;  5LYJ F;  4ECQ A;  4RB2 C;  5CB4 F;  2Y0S E;  2YZM A;  2ZJT A;  5KT7 A;  4DUY H;  3V4Z A;  1J5E H;  5L1L A;  2WAQ A;  3HOU G;  4YHH H;  4F4Y A;  5KFR A;  2YZG A;  3N41 B;  2BQ3 A;  4TV8 F;  4EG0 A;  1I94 H;  3L2P A;  4QWE A;  5CA1 F;  1N33 H;  1GO3 E;  2R7L A;  5FD5 A;  4FU0 A;  5I47 A;  3ORR A;  4DV5 H;  3QFF A;  4C5B A;  4JYA H;  3T1H H;  2FLN A;  5IYC G;  2E5L H;  2GPW A;  3T5H A;  5FJ8 G;  1XDN A;  1BXR A;  3PR5 B;  4J9K A;  1IBM H;  2IBK A;  4PWQ A;  3RIZ A;  1Y1V G;  4WD3 A;  4EYI B;  4RNM A;  1JXL A;  4XX0 B;  2W9B A;  1SCU B;  4EEY A;  2JEG A;  4J0M A;  2YRW A;  4RU9 A;  3BA8 A;  4HNT A;  4YR3 A;  2R7M A;  1EZ1 A;  3PN1 A;  4IWY A;  3WO1 A;  5EDW A;  4ED3 A;  5H80 A;  5LOV F;  3PO2 G;  5KG7 A;  4FM9 A;  4DR2 H;  1X9N A;  3KHL A;  2WB1 E;  5CA0 F;  5KG2 A;  4EFB A;  1K83 A;  1RJR A;  4LFA H;  4KHP H;  3RF2 A;  3I4M G;  4QIW E;  5BR8 H;  5T14 A;  2NU7 B;  4A3F G;  4YR0 A;  4DV3 H;  1XNQ H;  2C2E A;  4ECU A;  3RTX A;  3TQT A;  5FLX W;  3RB3 A;  2W8K A;  4YJ2 F;  1WCM A;  1WSC A;  3DF7 A;  3RV3 A;  3T5J A;  2JEJ A;  2UXC H;  3J7A K;  4DL7 A;  2FK1 A;  5JVL A;  3FDS A;  4MA5 A;  4XYM B;  4A93 G;  4A3C G;  4BY7 G;  3UFX B;  5DLG A;  2C2R A;  2XD4 A;  1CS0 A;  1ULZ A;  1RJQ A;  2FK2 A;  2UVR A;  2CQY A;  4UCV A;  2P0A A;  5L1K A;  4AYB E;  2UUC H;  2MCT A;  1VBG A;  2FE3 A;  3N6X A;  2UVU A;  4IR9 A;  3FMA A;  4O2B F;  4A2B A;  3EPG A;  4O3Q A;  5KFN A;  4TQR A;  4JV1 A;  1I6U A;  4C5C A;  3Q2O A;  5D1P A;  5BPH A;  4ZI7 F;  5KFH A;  4A3J G;  1CQI B;  4C5A A;  1GSA A;  2NU9 B;  4J9M A;  2HVQ A;  4J9N A;  4ECY A;  3PW0 A;  4G3I A;  3HOV G;  2R8G A;  4DV0 H;  3Q8Q B;  1B6S A;  1VAJ A;  2V59 A;  2W6Q A;  4IWX A;  1T36 A;  1UC9 A;  4LFB H;  4DL5 A;  1RYS A;  2UUA H;  4RUA A;  1TWG A;  5IYD G;  5KFW A;  1GSH A;  1JKJ B;  5DQG A;  3RGX A;  1I7L A;  1M6V A;  4IR1 A;  3AYH B;  4MV4 A;  4APM A;  2R85 A;  4A2A A;  4F4W A;  5IP9 G;  4X65 H;  2VPQ A;  4DR4 H;  3T5L A;  1M0W A;  1UC8 A;  2FP4 B;  5LL6 b;  2IP4 A;  5KFG A;  3N44 B;  3IG0 A;  3M9N B;  4O3N A;  2B63 G;  5EOY A;  2W9C A;  5HV6 A;  2YYA A;  1O75 A;  3N40 P;  2XC9 A;  3TIG A;  3L4J A;  4ECW A;  1JX4 A;  1SEI A;  1GYF A;  2R7N A;  1B6R A;  1Y1W G;  5KFO A;  3RAQ A;  2UVV A;  1M7J A;  4RAY A;  5KT6 A;  4TUY F;  4ZQI A;  2XIG A;  1RK5 A;  4A3M G;  3BG5 A;  3BAB A;  4O4H F;  4UCU A;  5JQW A;  3BQ1 A;  1V4Y A;  4DL3 A;  3N43 B;  3H3V H;  4IZO A;  2E2I A;  1M0T A;  3PO3 G;  4JV0 A;  4U7C A;  3GIM A;  2R93 A;  3QZ8 A;  3ORQ A;  4I7H A;  4HNV A;  2VA3 A;  4BBR G;  1B33 N;  2SCU B;  4U6P A;  2FPP B;  2FPG B;  2WYO A;  3Q8R B;  2ZDQ A;  1XNR H;  3MFH A;  1C30 A;  3M9O B;  2FLL A;  5EWE A;  2V5A A;  3HXL A;  3VPD A;  2PN1 A;  4LMY A;  2PBZ A;  4JI3 H;  4YQW A;  1FVI A;  4MV9 A;  5DQI A;  2VQE H;  1S9F A;  2R84 A;  4HNU A;  4I55 F;  2VOB A;  3VMM A;  3H40 A;  4EFE A;  2J6T A;  3RGZ A;  1A0I A;  3HOZ G;  3I4N G;  2KSW A;  4LH7 A;  5KFX A;  2W9B B;  5KFK A;  5LA6 F;  4EGQ A;  3KHR A;  4DV1 H;  1HR0 H;  4FBT A;  3HB9 A;  2R92 A;  4YJ3 F;  2BQR A;  2R7Z A;  2W57 A;  1EUC B;  5KFQ A;  5LMU H;  1S0O A;  2UVW A;  4LSA A;  1ZHQ A;  5KFC A;  2VQF H;  3SE7 A;  3RUP A;  2AQ4 A;  1HNX H;  3L4K A;  2NUA B;  2Q2T A;  3K5H A;  3GV7 B;  4B3R H;  2NU8 B;  3GTQ A;  3TQ1 A;  3RB6 A;  1SFO A;  1Y14 B;  5KT5 A;  5KFJ A;  4ED1 A;  3WO0 A;  3OUU A;  1IOV A;  1BJT A;  3WNZ A;  4FS2 A;  4Q8E A;  3JSL A;  5KFT A;  5KFV A;  5KFM A;  1IBK H;  2VUM G;  3JZI A;  2R8I A;  2BR0 A;  2JA6 A;  2W6Z A;  4UFZ A;  5KFS A;  4UCO A;  1KEE A;  4BY1 G;  2HVS A;  2JA5 A;  2W6N A;  3IN5 A;  2DPJ A;  4RB1 A;  3GTL A;  4X66 H;  5KFF A;  2JEF A;  3H4D A;  5FPR A;  2HJW A;  3MWE A;  1TWA A;  3GTK A;  4IRK A;  3MR3 A;  5IWA H;  4DLK A;  2YW2 A;  1WCM G;  1L2Z A;  5JVD F;  1GSO A;  5KFL A;  3MR6 A;  3G8C A;  2W7P A;  2ZDG A;  4J9S A;  1KJI A;  4NXM H;  4JI8 H;  2ATL A;  4A3I G;  2I87 A;  1W93 A;  2R82 A;  5KT2 A;  4LF5 H;  2NU6 B;  4YP3 A;  4J9O A;  2JA8 G;  1C3O A;  3TII A;  4DV4 H;  4O3S A;  1Z2N X;  2C00 A;  2XCP A;  4HYK A;  4DL4 A;  1KJ8 A;  2UUB H;  3G6X A;  1P8L A;  1IBL H;  5KKN B;  2CW7 A;  1Z2O X;  5C3E G;  4MTD A;  5KFA A;  1MZB A;  2GLT A;  2RF4 A;  2FKL A;  2VA2 A;  3OSN A;  5EWF A;  4IHJ F;  4DV6 H;  1PX2 A;  2CKZ B;  3H0G A;  1A9X A;  3N42 B;  2W9C B;  1B04 A;  1TWF A;  1TA8 A;  5KG0 A;  4EBE A;  1BGW A;  1KJ9 A;  5KFB A;  4ECZ A;  2AU0 A;  5GON F;  4MA0 A;  1RYR A;  1DV1 A;  3HKZ A;  4IAJ A;  4O3P A;  5L9X A;  4RZR A;  3K3V A;  4QWD A;  2YL2 A;  4BWS C;  4X62 H;  5DG7 A;  1XMO H;  1HNZ H;  2C2D A;  3G6Y A;  2WAQ E;  2DZD A;  3KXY T;  4LF7 H;  3FKI A;  4YBZ B;  3RV4 A;  2E2H A;  4ZOL F;  4B3S H;  4QW9 A;  4O3R A;  3U9T A;  2RGR A;  1CQJ B;  2DIK A;  3MR2 A;  3PW2 A;  3M9M B;  1FKA H;  2PMZ A;  5D8D A;  5DLF A;  5IYB G;  4R8U A;  1IOW A;  2Y0S A;  4Q43 A;  3NGD A;  4DR1 H;  3JRW A;  4MV6 A;  2ASD A;  4Q45 A;  4Y8V B;  2V4Q A;  4M9U A;  2UXD H;  1KC7 A;  5KG1 A;  1KJJ A;  4F4Z A;  2DPI A;  3HOW G;  4B3M H;  4FBU A;  3G6V A;  4XZ3 B;  5A2Q W;  3GTP A;  1UNN C;  4CC6 A;  2IA6 A;  4A3L G;  2FJZ A;  1OWT A;  2R8K A;  4QW8 A;  4JV5 H;  2YS7 A;  5FPO A;  3MJF A;  3Q8P B;  2W8L A;  3SI8 A;  5CAE B;  1GGO A;  4GC6 A;  1EUD B;  2VPS A; 
#chains in the Genus database with same CATH homology
 3BA8 A;  5LMU H;  2ZM6 H;  4LSA A;  3CVZ A;  3PN1 A;  1ZHQ A;  3M4I A;  4LH6 A;  4AQY H;  1E4F T;  2VQF H;  1N36 H;  4X64 H;  4R7R A;  4FM9 A;  4DR2 H;  1X9N A;  1HNX H;  3UQ8 A;  2WDT A;  3L4K A;  3BAA A;  4K0K H;  2Q2T A;  4LF8 H;  4EFB A;  4LFA H;  4B3R H;  4KHP H;  3RF2 A;  4LFC H;  1V9P A;  1VS0 A;  5BR8 H;  1SYX B;  3KAK A;  4DV3 H;  3J80 W;  2YCH A;  2Q2U A;  1XNQ H;  1DGS A;  3RTX A;  5FLX W;  1BJT A;  4NXN H;  3T1Y H;  3EYY A;  3DF7 A;  2UXC H;  3JSL A;  4MTE A;  3OTO H;  3J7A K;  3C0F B;  1IBK H;  4JI2 H;  2UU9 H;  4Q0Y A;  4LF6 H;  4JI7 H;  4UFZ A;  4EEQ A;  1N32 H;  4UCO A;  3J81 W;  2HVS A;  2OWO A;  4JI1 H;  4UCR A;  4RB3 C;  4UCV A;  2UUC H;  4ETS A;  4RB1 A;  4JI5 H;  4X66 H;  2MCT A;  2VUG A;  2FE3 A;  3F8N A;  3LML A;  3N6X A;  4RAZ A;  5FPR A;  4DR5 H;  3FMA A;  4A2B A;  1XMQ H;  5IWA H;  5FD6 A;  1I6U A;  4M7E A;  5D1P A;  5LMN H;  1L2Z A;  2HGS A;  2HVQ A;  4DV0 H;  2CW8 A;  4NXM H;  3KAJ A;  3RJ0 A;  4JI8 H;  4RZQ A;  4DV2 H;  4LF5 H;  2HHH H;  3JAM W;  4DV4 H;  4GLX A;  1AN7 A;  4DR7 H;  4CC5 A;  4DR3 H;  4LFB H;  5D1O B;  2WE6 A;  2F4V H;  2UXB H;  1Z2N X;  4OX9 H;  5D1O A;  2UUA H;  2UUB H;  4JI6 H;  1P8L A;  1S68 A;  3RGX A;  4MTD A;  2CW7 A;  1Z2O X;  4UCT A;  1IBL H;  4JYA H;  3H20 A;  3JSN A;  1MZB A;  4APM A;  4A2A A;  1Z2P X;  4X65 H;  4DR6 H;  4DR4 H;  1M0W A;  4DV6 H;  5LL6 b;  4UCS A;  1E4G T;  3N42 B;  3IG0 A;  1B04 A;  3N44 B;  1TA8 A;  4MV7 A;  1BGW A;  5EOY A;  3L4J A;  1O75 A;  3N40 P;  1HNW H;  4GKJ H;  4IAJ A;  1SEI A;  3KAL A;  1XMO H;  3K3V A;  1GYF A;  4BWS C;  4X62 H;  1S03 G;  1HNZ H;  4B3T H;  4RAY A;  3KXY T;  2RGV A;  4LF7 H;  4JI0 H;  2XIG A;  3BAB A;  4GKK H;  4B3S H;  4UCU A;  4RB2 C;  1N34 H;  2ZJT A;  4DUY H;  1J5E H;  1TAE A;  2RGR A;  4DUZ H;  3N43 B;  4LF4 H;  1M0T A;  4YHH H;  1ZHS A;  1FKA H;  3N41 B;  4DV7 H;  4I7H A;  4DR1 H;  1I94 H;  3L2P A;  1N33 H;  5FD5 A;  4RB0 A;  2WYO A;  4DV5 H;  1XNR H;  4LF9 H;  2UXD H;  3HXL A;  3MWM A;  2O03 A;  3T1H H;  4LMY A;  4JI3 H;  1FVI A;  1WH2 A;  4MV9 A;  2E5L H;  5A2Q W;  2VQE H;  2HVR A;  4CC6 A;  4B3M H;  4JI4 H;  4PDB A;  2VOB A;  1XDN A;  4JV5 H;  5IT9 W;  4EFE A;  5FPO A;  3RGZ A;  1A0I A;  3RIZ A;  1IBM H;  2KSW A;  3BA9 A;  4LH7 A;  4YY3 H;  1HR0 H;  4DV1 H;  4LSX A;  4J0M A;  2W57 A;  2VPS A;  1FJG H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...