1GYFA

Gyf domain from human cd2bp2 protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The GYF domain is a novel structural fold that is involved in lymphoid signaling through proline-rich sequences.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PROTEIN (CYTOPLASMIC DOMAIN BINDING PROTEIN (CD2BP2))
total genus 9
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1999-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1gyfA00
1WH2A 4BWSC 1SYXB 1GYFA 1L2ZA 3K3VA 3FMAA
chains in the Genus database with same CATH superfamily
5KFWA 1HNWH 4M9UA 1ZHQA 4QIWE 2OWOA 3H40A 3GIIA 5JQWA 3PW2A 1Z2OX 4LF9H 5LYJF 3MWMA 5KFFA 1E4EB 5KFSA 4ED8A 4ECWA 2UUBH 1Y1VG 4DR1H 3GIPA 4U7CA 4JV2A 2WDTA 1W93A 4EEYA 4M7EA 4QWDA 4QIWA 1KJJA 3E5NA 3BG5A 2W6ZA 5T14A 4Q43A 2IP4A 3RB0A 2ZJTA 2NVXA 3V4SA 1M7JA 4Q44A 3SE7A 4ECYA 2WE6A 2KSWA 5KFCA 4ECUA 1VBHA 5JH7F 5HBRB 4MTDA 2DPIA 4C5CA 5DG9A 1ZHSA 4RB2C 5EDWA 2WB1E 1K83A 5DQHA 2V9WA 2XGPA 5KFLA 4DV4H 5KG7A 5F9LA 5DGBA 5BR8H 5LXTF 4RUAA 2VA3A 1W96A 1GLVA 1RYRA 2IBKA 1FKAH 3PZPA 4DR6H 5CB4F 3K3VA 5KFJA 2R7ZA 4MV9A 3T5KA 4RUCA 4FU0A 5DLFA 2R7ZG 3RBEA 2RGVA 4HYKA 2BR0A 2Q2TA 4QW9A 4ECVA 1Y1WG 1GSHA 1XMQH 2FK3A 2FK2A 5KFMA 2YU9A 3UFXB 4JI3H 2B63G 5KFQA 1V9PA 3N8DA 2YL2A 1IOWA 5KFEA 3OSNA 4WD3A 2W71A 4JI1H 3RBDA 4CC6A 3N40P 1WH2A 4RAZA 4O3NA 2J6TA 5BPFA 4E4TA 1EZ1A 1KJ8A 1ZETA 4MTEA 3Q8SB 1I7LA 1GYFA 5KFTA 5KFPA 1TWAA 2V5AA 2UXBH 2ZDGA 3GTOA 2FLNA 3KTMA 1T36A 4A3EG 2R8IA 2VPSA 1CS0A 4LFAH 2XGQA 2RF4A 1WR2A 2R86A 2P0AA 5IWAH 2JA6A 1Z2PX 2VA2A 1SFOA 2W9AA 1KBLA 3PO2G 3RIZA 4JI5H 4MV1A 5C3EG 4GLXA 5LMUH 3H4DA 3KXYT 3N6XA 3RB4A 2V59A 4TV8F 3OUZA 4BBRG 2W6PA 4A3CG 4APMA 4MAMA 5KFXA 4F4YA 2UUCH 3R23A 2FB9A 4NXNH 4J9SA 3L4JA 5DQIA 1SYXB 2YYAA 3R5FA 2YCHA 3U9SA 2CW7A 4A2AA 4O3OA 5KFHA 5KT4A 5I47A 3RAXA 3PW7A 4QWBA 1B04A 4R7RA 5L1JA 4PDBA 3GV5B 1I50A 1V4YA 2M05A 1B33N 2WTFA 4EYIB 4CC5A 2UVWA 2WB1A 4ECXA 3GTMA 4DV3H 3R5XA 1XDNA 4UCRA 2XC9A 3G6VA 5KFIA 3UQ8A 1RK6A 4A3MG 1JDEA 1A0IA 3PW4A 2PBZA 3BQ2A 5EWGA 3L4KA 2JA8G 4DV1H 4A3KG 4DV0H 1TAEA 2HJWA 4XYMB 1J5EH 4YHHH 2OH2A 2FK1A 5KFAA 2E2IA 3PW0A 2JEIA 3MWDA 1UC8A 2R8KA 1DV2A 4X64H 4LMYA 5C1PA 4O2AF 4LH7A 2I87A 4X65H 3QZ8A 1HNZH 5C5JA 5KFYA 4MA0A 2CQYA 2YW2A 1RJPA 2XD4A 4EEQA 2FE3A 1CQJB 2PN1A 5DGAA 2R8GA 5KKNB 2YS6A 3VPDA 2X0SA 1EUDB 1B6SA 2CW8A 3DF7A 3H0GA 4IWYA 2RGRA 2VUMA 4L1KA 3VPCA 4J0MA 2J9GA 5IP7G 2WAQE 3PO3G 5BPHA 3QFFA 4MV3A 4J9PA 4F4ZA 1N32H 5KG6A 3RJ0A 4YP3A 1JIHA 1X9NA 4MV7A 4JI8H 3FKIA 4IRDA 1S10A 2NU7B 1IBLH 5DQGA 2CZGA 4QWCA 2JA6G 4BY7G 3HOVG 1WCMA 2BQUA 2XCAA 4QWEA 4EYHB 3CQZA 2Q2UA 4Y8VB 4ED0A 4JV5H 1KJIA 3EYYA 3JZIA 3K5HA 5KT7A 4F50A 2YRWA 2AGQA 3JRWA 4ED6A 3RGZA 1S68A 3KHLA 4I4TF 4FM9A 1K1QA 4DLKA 2XIGA 4LFCH 1S9FA 5LOVF 4R8UA 4Q0YA 2W7PA 1I3QA 4RZRA 3HKZA 2W57A 1VBGA 3GTQA 4EBDA 2YS7A 4R8UB 4A3DG 4G3IA 1S0NA 5KFRA 4IR1A 2Y0SA 4ECTA 3RV3A 2DIKA 3T5JA 4J9OA 2YZGA 4FS2A 4UCOA 2AGPA 1FJGH 1T94A 2UXCH 1S03G 2BQ3A 2V4QA 4LSAA 2W9CA 2FKLA 3WNZA 2WYOA 1Y14B 3VMMA 5C44G 5DG8A 4EG0A 1IBMH 5GONF 5LMNH 2BQRA 4J9MA 2W6OA 2E5LH 4YBZB 1R9TA 4WBNF 2YRXA 3N42B 1SCUB 5LA6F 3Q8QB 3K3PA 2VQFH 1V51A 1TA8A 4RZQA 4IAJA 4XX0B 1TWHA 3GIMA 3EPGA 2W8KA 3OSPA 2C00A 1EHIA 5D8DA 4RB1A 3G6XA 3U9TA 4MV4A 5KX5F 4RNOA 4YY3H 2E2HA 5KG5A 4DUYH 3BQ0A 5L9XA 2JEFA 2VUMG 5LP6F 1GO3E 3BABA 2ZM6H 4C2MA 4DL5A 2SCUB 2I80A 3F8NA 5IYZF 1L2ZA 4O4IF 4RAYA 4ED2A 5L1LA 2R82A 3OHBA 3CVZA 2J6UA 4LFBH 3MFHA 3PR4A 4O2BF 2GLTA 5LL6b 2C35B 3GTGA 4ED7A 3JRXA 3GIJA 3WO0A 1EYZA 1O75A 5KG4A 4J9KA 2QYZA 3MR6A 3RV4A 2ATLA 3GTKA 2CKZB 4DV2H 2FJZA 2C2RA 3N43B 2R85A 3GTJA 1DIKA 5CAEB 1CE8A 5EWFA 1XNQH 3BA9A 3BJYA 2R7MA 4IZOA 3RTXA 2UXDH 3FKIG 4Q45A 1UC9A 2W70A 4HNUA 2UUAH 3RB3A 3ETJA 5KG2A 1IBKH 1C3OA 4O3SA 4I7HA 3GLKA 3GQCA 2R8JA 3M4IA 4RNMA 4A3FG 4A3LG 4YJ2F 1Y1WA 4GC6A 1VS0A 3AYHB 1KJQA 1Y1VA 4TQRA 2W6QA 5BMVF 5D1PA 4I55F 4DL7A 5F9NA 4DL2A 3KHRA 4HNTA 3OTOH 3M9NB 4IWXA 3GV8B 1E4FT 5JVLA 5KT3A 5L1IA 4O4HF 4A93G 4YAJB 3C0FB 4DV5H 1BNCA 2WAQA 2I8CA 3LWBA 1B6RA 4B3RH 3KAJA 5FD5A 2OLSA 4J9QA 1MZBA 2W6NA 5J2UF 4J9NA 1JX4A 2V4RA 3J80W 2UVVA 4IRKA 3HOXG 3BQ1A 3H20A 3HBLA 3TINA 1I6UA 1CQIB 4AYBE 5CA1F 5KFBA 4JYAH 1DGSA 4UCUA 1SEIA 3MR2A 4ME6A 4UCTA 1S0OA 3LP8A 1RJQA 2C2DA 3TQ1A 4LF8H 1VKZA 2R8HA 2XCLA 1K1SA 3PW5A 5D1OA 5KG0A 2ASJA 3V6KA 3V6HA 2FPPB 1M0TA 1N36H 3K5IA 3MR5A 4J9LA 1N48A 4TQSA 4BY1G 4AYBA 2PMZE 3BAAA 4XYLB 4Q8EA 1KC7A 3WO1A 3GIKA 4GKJH 4DL4A 3NGDA 1RK5A 1E4GT 2VQDA 1N34H 4UCSA 2DLNA 3VPBA 4A2BA 2NVYA 5KFNA 4B3MH 2Y0SE 3OHAA 2ZDHA 2ZDQA 3G8CA 5J2TF 5CA0F 2JEJA 3TIGA 5KFKA 2W9BB 3L2PA 3G6YA 3ETHA 4EBEA 4U6PA 2W7OA 4TV9F 5KFDA 4JV0A 2R7KA 2W6MA 4BWSC 2FP4B 3IG0A 4NLGA 4ZQIA 5FPRA 3FDSA 2IA6A 4EGQA 1ULZA 2V58A 2FPGB 4HR7A 4JI7H 4MA5A 3V6JA 2AQ4A 1M6VA 4ZOLF 2JEGA 3I4NG 2R87A 5KFVA 1TWCA 1JXLA 1S97A 4RNNA 3PVXA 3EPIA 3Q8RB 5H80A 4ED1A 4O3RA 3T1HH 1PX2A 5A2QW 1EUCB 4A3GG 3PR5B 3M9OB 4AQYH 3RF2A 4JI4H 5KFUA 5IYBG 3J81W 2RDIA 5L1KA 4GC7A 4JI6H 4UFZA 1E4EA 1C30A 4YJ3F 1S0MA 3H3VH 5IYCG 5D1OB 3V4ZA 4YR2A 3TIIA 5JUMA 5JVDF 2DWCA 1AUVA 2GPSA 4C5BA 4DL6A 1KJ9A 3KHGA 2C2EA 4B3SH 3H4BA 2UVRA 5KT2A 3R5HA 4DR4H 3N44B 4K0KH 3I12A 4C5AA 3T5HA 4YR0A 2NUAB 2IMWP 3T5LA 2J6SA 2PVPA 2O03A 5KT5A 4X62H 3N41B 2AU0A 2F4VH 4HQ6A 2R84A 4MV8A 4O3QA 1OWTA 5KFZA 5IP9G 2B63A 3Q1KA 1BXRA 1ZQ7A 3MFIA 5FJ8G 2HHHH 2NU9B 1N56A 5EWEA 2HVRA 3RB6A 4QW8A 4RB3C 2QK4A 4RB0A 4ZHQF 1I7NA 3MR3A 2RDJA 2R93G 1N33H 2VR1A 4EFBA 3HOWG 3IN5A 3H0GG 3JSNA 5KG1A 2R7LA 1DV1A 4FBUA 4A3JG 4ECZA 5K2MA 1JLLB 2R92A 2DZDA 4ECRA 2FLLA 2FMAA 3KALA 4B3TH 2HVQA 1WSCA 4IHJF 3MJFA 1TWFA 1XNRH 3HOUG 3MWEA 1GGOA 4XZ3B 1WCMG 4JI2H 4DV6H 1A9XA 3GILA 2NU8B 4OX9H 5DLGA 2W9CB 4A3BG 1T3NA 5KG3A 5C8YF 2ASLA 4IR9A 5C4XG 2AGOA 1JKJB 3ORQA 2ALZA 3GIDA 3HXLA 4DR5H 2UVUA 4IRCA 1BGWA 3HB9A 2W9BA 2GPWA 2HGSA 4EFEA 3RAQA 3LMLA 4ECSA 4LSXA 1I94H 2HVSA 2MCTA 4DL3A 4O3PA 4DUZH 4F4XA 3GV7B 2DPJA 3GTLA 5KT6A 4DR3H 3GTPA 4LF5H 4LF4H 2R7NA 4EBCA 5KFOA 3JSLA 2W8LA 3J7AK 5IT9W 4YQWA 4ED3A 1JDBB 3I4MG 4DR2H 3HOYG 3OUUA 2FLPA 2C28A 4QWAA 1PK8A 4JV1A 3GIQA 2YZNA 4DR7H 3TQTA 1TWGA 3Q8PB 3HOZG 2R6FA 4FBTA 4BBSG 4TUYF 3PN1A 2JA5G 2JA7G 5C1OA 1Z2NX 3HKZE 4ETSA 4LF7H 5FLXW 3KAKA 2UU9H 4GKKH 5EZYF 1FVIA 1HR0H 4YAKB 3ORRA 2PMZA 4QJFA 3KHHA 1BJTA 4MV6A 2C22A 5FPOA 4X66H 1IOVA 3T1YH 4BXXG 1RYSA 1AN7A 2NU6B 2VOBA 1M0WA 1HNXH 4YR3A 4FS1A 4A3IG 5DG7A 2VPQA 2VQEH 5IYDG 2JA5A 1AUXA 2R93A 2JA7A 3RUPA 1XMOH 3M9MB 4LF6H 4JUZA 4DV7H 4F4WA 3JAMW 4NXMH 2XCPA 2R92G 5KFGA 4EGJA 1P8LA 4YB8B 1KEEA 4ECQA 4UCVA 3BA8A 3RFCA 5FLMG 4I50F 1GSOA 4J9RA 2YZMA 1GSAA 3SI8A 4Q8FA 3Q2OA 1VAJA 4LH6A 5EOYA 4HNVA 3RGXA 1RJRA 5HV6A 4RU9A 3QZ7A 4KHPH 1UNNC 2ASDA 2FPIB 4PWQA 5FD6A 2VUGA 4O4LF 3FMAA 4ZI7F 4JI0H
chains in the Genus database with same CATH topology
1HNWH 5D1OB 1ZHQA 2OWOA 4DV2H 1Z2OX 3N43B 4LF9H 3MWMA 4X64H 4LMYA 4B3SH 2UUBH 1XNQH 4LH7A 3BA9A 4DR1H 4DR4H 4X65H 2WDTA 3N44B 3RTXA 4K0KH 1HNZH 2UXDH 4M7EA 4JI0H 2ZJTA 2O03A 4X62H 3N41B 2F4VH 2UUAH 4EEQA 2FE3A 2KSWA 2WE6A 1IBKH 4MTDA 4I7HA 2HHHH 3M4IA 2CW8A 2HVRA 3DF7A 4RB3C 1VS0A 1ZHSA 4RB0A 4RB2C 2RGRA 1N33H 4EFBA 4J0MA 5D1PA 3JSNA 4DV4H 5BR8H 1N32H 3RJ0A 3OTOH 1FKAH 4DR6H 1E4FT 1X9NA 4MV7A 3K3VA 3KALA 4B3TH 2HVQA 4JI8H 3C0FB 4MV9A 4DV5H 1IBLH 2RGVA 1XNRH 4B3RH 3KAJA 5FD5A 4JI2H 4DV6H 2Q2TA 1XMQH 4OX9H 1MZBA 4JI3H 1V9PA 2Q2UA 3J80W 4JV5H 3EYYA 3HXLA 4DR5H 4JI1H 3H20A 1BGWA 1I6UA 3RGZA 1S68A 4CC6A 3N40P 1WH2A 4RAZA 4JYAH 1DGSA 4FM9A 2HGSA 4UCUA 1SEIA 2XIGA 4UCTA 3LMLA 4MTEA 4EFEA 4LFCH 1GYFA 4LSXA 1I94H 2HVSA 4Q0YA 2MCTA 4LF8H 2UXBH 4DUZH 5D1OA 4DR3H 2W57A 2VPSA 4LFAH 4LF5H 4LF4H 1M0TA 1N36H 3JSLA 5IWAH 3J7AK 5IT9W 1Z2PX 4DR2H 3BAAA 4GKJH 4DR7H 3RIZA 4JI5H 4GLXA 1FJGH 4UCOA 1E4GT 5LMUH 1N34H 2UXCH 3KXYT 3N6XA 3PN1A 4UCSA 1S03G 1Z2NX 4A2BA 4LSAA 4ETSA 4LF7H 2WYOA 3KAKA 5FLXW 4APMA 2UU9H 4B3MH 4GKKH 1IBMH 2UUCH 1FVIA 1HR0H 5LMNH 4NXNH 2E5LH 3L2PA 3L4JA 3N42B 1SYXB 2VQFH 1BJTA 1TA8A 4IAJA 4RZQA 2YCHA 5FPOA 2CW7A 4A2AA 4BWSC 4X66H 3IG0A 3T1YH 5FPRA 1AN7A 4RB1A 2VOBA 1M0WA 1HNXH 1B04A 4R7RA 4YY3H 2VQEH 4DUYH 4PDBA 1XMOH 4JI7H 3BABA 4LF6H 2ZM6H 4DV7H 4CC5A 3F8NA 1L2ZA 3JAMW 4RAYA 4NXMH 4DV3H 4UCRA 1XDNA 1P8LA 3CVZA 3UQ8A 4UCVA 3BA8A 4LFBH 3T1HH 5A2QW 1A0IA 4LH6A 5LL6b 5EOYA 4KHPH 3RGXA 3RF2A 4AQYH 4JI4H 3L4KA 3J81W 4DV1H 5FD6A 4JI6H 1O75A 4UFZA 1TAEA 2VUGA 4DV0H 3FMAA 1J5EH 4YHHH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH2 A;  4BWS C;  1SYX B;  1GYF A;  1L2Z A;  3K3V A;  3FMA A; 
#chains in the Genus database with same CATH topology
 5KFW A;  1HNW H;  4M9U A;  1ZHQ A;  4QIW E;  2OWO A;  3H40 A;  3GII A;  5JQW A;  3PW2 A;  1Z2O X;  4LF9 H;  5LYJ F;  3MWM A;  5KFF A;  1E4E B;  5KFS A;  4ED8 A;  4ECW A;  2UUB H;  1Y1V G;  4DR1 H;  3GIP A;  4U7C A;  4JV2 A;  2WDT A;  1W93 A;  4EEY A;  4M7E A;  4QWD A;  4QIW A;  1KJJ A;  3E5N A;  3BG5 A;  2W6Z A;  5T14 A;  4Q43 A;  2IP4 A;  3RB0 A;  2ZJT A;  2NVX A;  3V4S A;  1M7J A;  4Q44 A;  3SE7 A;  4ECY A;  2WE6 A;  2KSW A;  5KFC A;  4ECU A;  1VBH A;  5JH7 F;  5HBR B;  4MTD A;  2DPI A;  4C5C A;  5DG9 A;  1ZHS A;  4RB2 C;  5EDW A;  2WB1 E;  1K83 A;  5DQH A;  2V9W A;  2XGP A;  5KFL A;  4DV4 H;  5KG7 A;  5F9L A;  5DGB A;  5BR8 H;  5LXT F;  4RUA A;  2VA3 A;  1W96 A;  1GLV A;  1RYR A;  2IBK A;  1FKA H;  3PZP A;  4DR6 H;  5CB4 F;  3K3V A;  5KFJ A;  2R7Z A;  4MV9 A;  3T5K A;  4RUC A;  4FU0 A;  5DLF A;  2R7Z G;  3RBE A;  2RGV A;  4HYK A;  2BR0 A;  2Q2T A;  4QW9 A;  4ECV A;  1Y1W G;  1GSH A;  1XMQ H;  2FK3 A;  2FK2 A;  5KFM A;  2YU9 A;  3UFX B;  4JI3 H;  2B63 G;  5KFQ A;  1V9P A;  3N8D A;  2YL2 A;  1IOW A;  5KFE A;  3OSN A;  4WD3 A;  2W71 A;  4JI1 H;  3RBD A;  4CC6 A;  3N40 P;  1WH2 A;  4RAZ A;  4O3N A;  2J6T A;  5BPF A;  4E4T A;  1EZ1 A;  1KJ8 A;  1ZET A;  4MTE A;  3Q8S B;  1I7L A;  1GYF A;  5KFT A;  5KFP A;  1TWA A;  2V5A A;  2UXB H;  2ZDG A;  3GTO A;  2FLN A;  3KTM A;  1T36 A;  4A3E G;  2R8I A;  2VPS A;  1CS0 A;  4LFA H;  2XGQ A;  2RF4 A;  1WR2 A;  2R86 A;  2P0A A;  5IWA H;  2JA6 A;  1Z2P X;  2VA2 A;  1SFO A;  2W9A A;  1KBL A;  3PO2 G;  3RIZ A;  4JI5 H;  4MV1 A;  5C3E G;  4GLX A;  5LMU H;  3H4D A;  3KXY T;  3N6X A;  3RB4 A;  2V59 A;  4TV8 F;  3OUZ A;  4BBR G;  2W6P A;  4A3C G;  4APM A;  4MAM A;  5KFX A;  4F4Y A;  2UUC H;  3R23 A;  2FB9 A;  4NXN H;  4J9S A;  3L4J A;  5DQI A;  1SYX B;  2YYA A;  3R5F A;  2YCH A;  3U9S A;  2CW7 A;  4A2A A;  4O3O A;  5KFH A;  5KT4 A;  5I47 A;  3RAX A;  3PW7 A;  4QWB A;  1B04 A;  4R7R A;  5L1J A;  4PDB A;  3GV5 B;  1I50 A;  1V4Y A;  2M05 A;  1B33 N;  2WTF A;  4EYI B;  4CC5 A;  2UVW A;  2WB1 A;  4ECX A;  3GTM A;  4DV3 H;  3R5X A;  1XDN A;  4UCR A;  2XC9 A;  3G6V A;  5KFI A;  3UQ8 A;  1RK6 A;  4A3M G;  1JDE A;  1A0I A;  3PW4 A;  2PBZ A;  3BQ2 A;  5EWG A;  3L4K A;  2JA8 G;  4DV1 H;  4A3K G;  4DV0 H;  1TAE A;  2HJW A;  4XYM B;  1J5E H;  4YHH H;  2OH2 A;  2FK1 A;  5KFA A;  2E2I A;  3PW0 A;  2JEI A;  3MWD A;  1UC8 A;  2R8K A;  1DV2 A;  4X64 H;  4LMY A;  5C1P A;  4O2A F;  4LH7 A;  2I87 A;  4X65 H;  3QZ8 A;  1HNZ H;  5C5J A;  5KFY A;  4MA0 A;  2CQY A;  2YW2 A;  1RJP A;  2XD4 A;  4EEQ A;  2FE3 A;  1CQJ B;  2PN1 A;  5DGA A;  2R8G A;  5KKN B;  2YS6 A;  3VPD A;  2X0S A;  1EUD B;  1B6S A;  2CW8 A;  3DF7 A;  3H0G A;  4IWY A;  2RGR A;  2VUM A;  4L1K A;  3VPC A;  4J0M A;  2J9G A;  5IP7 G;  2WAQ E;  3PO3 G;  5BPH A;  3QFF A;  4MV3 A;  4J9P A;  4F4Z A;  1N32 H;  5KG6 A;  3RJ0 A;  4YP3 A;  1JIH A;  1X9N A;  4MV7 A;  4JI8 H;  3FKI A;  4IRD A;  1S10 A;  2NU7 B;  1IBL H;  5DQG A;  2CZG A;  4QWC A;  2JA6 G;  4BY7 G;  3HOV G;  1WCM A;  2BQU A;  2XCA A;  4QWE A;  4EYH B;  3CQZ A;  2Q2U A;  4Y8V B;  4ED0 A;  4JV5 H;  1KJI A;  3EYY A;  3JZI A;  3K5H A;  5KT7 A;  4F50 A;  2YRW A;  2AGQ A;  3JRW A;  4ED6 A;  3RGZ A;  1S68 A;  3KHL A;  4I4T F;  4FM9 A;  1K1Q A;  4DLK A;  2XIG A;  4LFC H;  1S9F A;  5LOV F;  4R8U A;  4Q0Y A;  2W7P A;  1I3Q A;  4RZR A;  3HKZ A;  2W57 A;  1VBG A;  3GTQ A;  4EBD A;  2YS7 A;  4R8U B;  4A3D G;  4G3I A;  1S0N A;  5KFR A;  4IR1 A;  2Y0S A;  4ECT A;  3RV3 A;  2DIK A;  3T5J A;  4J9O A;  2YZG A;  4FS2 A;  4UCO A;  2AGP A;  1FJG H;  1T94 A;  2UXC H;  1S03 G;  2BQ3 A;  2V4Q A;  4LSA A;  2W9C A;  2FKL A;  3WNZ A;  2WYO A;  1Y14 B;  3VMM A;  5C44 G;  5DG8 A;  4EG0 A;  1IBM H;  5GON F;  5LMN H;  2BQR A;  4J9M A;  2W6O A;  2E5L H;  4YBZ B;  1R9T A;  4WBN F;  2YRX A;  3N42 B;  1SCU B;  5LA6 F;  3Q8Q B;  3K3P A;  2VQF H;  1V51 A;  1TA8 A;  4RZQ A;  4IAJ A;  4XX0 B;  1TWH A;  3GIM A;  3EPG A;  2W8K A;  3OSP A;  2C00 A;  1EHI A;  5D8D A;  4RB1 A;  3G6X A;  3U9T A;  4MV4 A;  5KX5 F;  4RNO A;  4YY3 H;  2E2H A;  5KG5 A;  4DUY H;  3BQ0 A;  5L9X A;  2JEF A;  2VUM G;  5LP6 F;  1GO3 E;  3BAB A;  2ZM6 H;  4C2M A;  4DL5 A;  2SCU B;  2I80 A;  3F8N A;  5IYZ F;  1L2Z A;  4O4I F;  4RAY A;  4ED2 A;  5L1L A;  2R82 A;  3OHB A;  3CVZ A;  2J6U A;  4LFB H;  3MFH A;  3PR4 A;  4O2B F;  2GLT A;  5LL6 b;  2C35 B;  3GTG A;  4ED7 A;  3JRX A;  3GIJ A;  3WO0 A;  1EYZ A;  1O75 A;  5KG4 A;  4J9K A;  2QYZ A;  3MR6 A;  3RV4 A;  2ATL A;  3GTK A;  2CKZ B;  4DV2 H;  2FJZ A;  2C2R A;  3N43 B;  2R85 A;  3GTJ A;  1DIK A;  5CAE B;  1CE8 A;  5EWF A;  1XNQ H;  3BA9 A;  3BJY A;  2R7M A;  4IZO A;  3RTX A;  2UXD H;  3FKI G;  4Q45 A;  1UC9 A;  2W70 A;  4HNU A;  2UUA H;  3RB3 A;  3ETJ A;  5KG2 A;  1IBK H;  1C3O A;  4O3S A;  4I7H A;  3GLK A;  3GQC A;  2R8J A;  3M4I A;  4RNM A;  4A3F G;  4A3L G;  4YJ2 F;  1Y1W A;  4GC6 A;  1VS0 A;  3AYH B;  1KJQ A;  1Y1V A;  4TQR A;  2W6Q A;  5BMV F;  5D1P A;  4I55 F;  4DL7 A;  5F9N A;  4DL2 A;  3KHR A;  4HNT A;  3OTO H;  3M9N B;  4IWX A;  3GV8 B;  1E4F T;  5JVL A;  5KT3 A;  5L1I A;  4O4H F;  4A93 G;  4YAJ B;  3C0F B;  4DV5 H;  1BNC A;  2WAQ A;  2I8C A;  3LWB A;  1B6R A;  4B3R H;  3KAJ A;  5FD5 A;  2OLS A;  4J9Q A;  1MZB A;  2W6N A;  5J2U F;  4J9N A;  1JX4 A;  2V4R A;  3J80 W;  2UVV A;  4IRK A;  3HOX G;  3BQ1 A;  3H20 A;  3HBL A;  3TIN A;  1I6U A;  1CQI B;  4AYB E;  5CA1 F;  5KFB A;  4JYA H;  1DGS A;  4UCU A;  1SEI A;  3MR2 A;  4ME6 A;  4UCT A;  1S0O A;  3LP8 A;  1RJQ A;  2C2D A;  3TQ1 A;  4LF8 H;  1VKZ A;  2R8H A;  2XCL A;  1K1S A;  3PW5 A;  5D1O A;  5KG0 A;  2ASJ A;  3V6K A;  3V6H A;  2FPP B;  1M0T A;  1N36 H;  3K5I A;  3MR5 A;  4J9L A;  1N48 A;  4TQS A;  4BY1 G;  4AYB A;  2PMZ E;  3BAA A;  4XYL B;  4Q8E A;  1KC7 A;  3WO1 A;  3GIK A;  4GKJ H;  4DL4 A;  3NGD A;  1RK5 A;  1E4G T;  2VQD A;  1N34 H;  4UCS A;  2DLN A;  3VPB A;  4A2B A;  2NVY A;  5KFN A;  4B3M H;  2Y0S E;  3OHA A;  2ZDH A;  2ZDQ A;  3G8C A;  5J2T F;  5CA0 F;  2JEJ A;  3TIG A;  5KFK A;  2W9B B;  3L2P A;  3G6Y A;  3ETH A;  4EBE A;  4U6P A;  2W7O A;  4TV9 F;  5KFD A;  4JV0 A;  2R7K A;  2W6M A;  4BWS C;  2FP4 B;  3IG0 A;  4NLG A;  4ZQI A;  5FPR A;  3FDS A;  2IA6 A;  4EGQ A;  1ULZ A;  2V58 A;  2FPG B;  4HR7 A;  4JI7 H;  4MA5 A;  3V6J A;  2AQ4 A;  1M6V A;  4ZOL F;  2JEG A;  3I4N G;  2R87 A;  5KFV A;  1TWC A;  1JXL A;  1S97 A;  4RNN A;  3PVX A;  3EPI A;  3Q8R B;  5H80 A;  4ED1 A;  4O3R A;  3T1H H;  1PX2 A;  5A2Q W;  1EUC B;  4A3G G;  3PR5 B;  3M9O B;  4AQY H;  3RF2 A;  4JI4 H;  5KFU A;  5IYB G;  3J81 W;  2RDI A;  5L1K A;  4GC7 A;  4JI6 H;  4UFZ A;  1E4E A;  1C30 A;  4YJ3 F;  1S0M A;  3H3V H;  5IYC G;  5D1O B;  3V4Z A;  4YR2 A;  3TII A;  5JUM A;  5JVD F;  2DWC A;  1AUV A;  2GPS A;  4C5B A;  4DL6 A;  1KJ9 A;  3KHG A;  2C2E A;  4B3S H;  3H4B A;  2UVR A;  5KT2 A;  3R5H A;  4DR4 H;  3N44 B;  4K0K H;  3I12 A;  4C5A A;  3T5H A;  4YR0 A;  2NUA B;  2IMW P;  3T5L A;  2J6S A;  2PVP A;  2O03 A;  5KT5 A;  4X62 H;  3N41 B;  2AU0 A;  2F4V H;  4HQ6 A;  2R84 A;  4MV8 A;  4O3Q A;  1OWT A;  5KFZ A;  5IP9 G;  2B63 A;  3Q1K A;  1BXR A;  1ZQ7 A;  3MFI A;  5FJ8 G;  2HHH H;  2NU9 B;  1N56 A;  5EWE A;  2HVR A;  3RB6 A;  4QW8 A;  4RB3 C;  2QK4 A;  4RB0 A;  4ZHQ F;  1I7N A;  3MR3 A;  2RDJ A;  2R93 G;  1N33 H;  2VR1 A;  4EFB A;  3HOW G;  3IN5 A;  3H0G G;  3JSN A;  5KG1 A;  2R7L A;  1DV1 A;  4FBU A;  4A3J G;  4ECZ A;  5K2M A;  1JLL B;  2R92 A;  2DZD A;  4ECR A;  2FLL A;  2FMA A;  3KAL A;  4B3T H;  2HVQ A;  1WSC A;  4IHJ F;  3MJF A;  1TWF A;  1XNR H;  3HOU G;  3MWE A;  1GGO A;  4XZ3 B;  1WCM G;  4JI2 H;  4DV6 H;  1A9X A;  3GIL A;  2NU8 B;  4OX9 H;  5DLG A;  2W9C B;  4A3B G;  1T3N A;  5KG3 A;  5C8Y F;  2ASL A;  4IR9 A;  5C4X G;  2AGO A;  1JKJ B;  3ORQ A;  2ALZ A;  3GID A;  3HXL A;  4DR5 H;  2UVU A;  4IRC A;  1BGW A;  3HB9 A;  2W9B A;  2GPW A;  2HGS A;  4EFE A;  3RAQ A;  3LML A;  4ECS A;  4LSX A;  1I94 H;  2HVS A;  2MCT A;  4DL3 A;  4O3P A;  4DUZ H;  4F4X A;  3GV7 B;  2DPJ A;  3GTL A;  5KT6 A;  4DR3 H;  3GTP A;  4LF5 H;  4LF4 H;  2R7N A;  4EBC A;  5KFO A;  3JSL A;  2W8L A;  3J7A K;  5IT9 W;  4YQW A;  4ED3 A;  1JDB B;  3I4M G;  4DR2 H;  3HOY G;  3OUU A;  2FLP A;  2C28 A;  4QWA A;  1PK8 A;  4JV1 A;  3GIQ A;  2YZN A;  4DR7 H;  3TQT A;  1TWG A;  3Q8P B;  3HOZ G;  2R6F A;  4FBT A;  4BBS G;  4TUY F;  3PN1 A;  2JA5 G;  2JA7 G;  5C1O A;  1Z2N X;  3HKZ E;  4ETS A;  4LF7 H;  5FLX W;  3KAK A;  2UU9 H;  4GKK H;  5EZY F;  1FVI A;  1HR0 H;  4YAK B;  3ORR A;  2PMZ A;  4QJF A;  3KHH A;  1BJT A;  4MV6 A;  2C22 A;  5FPO A;  4X66 H;  1IOV A;  3T1Y H;  4BXX G;  1RYS A;  1AN7 A;  2NU6 B;  2VOB A;  1M0W A;  1HNX H;  4YR3 A;  4FS1 A;  4A3I G;  5DG7 A;  2VPQ A;  2VQE H;  5IYD G;  2JA5 A;  1AUX A;  2R93 A;  2JA7 A;  3RUP A;  1XMO H;  3M9M B;  4LF6 H;  4JUZ A;  4DV7 H;  4F4W A;  3JAM W;  4NXM H;  2XCP A;  2R92 G;  5KFG A;  4EGJ A;  1P8L A;  4YB8 B;  1KEE A;  4ECQ A;  4UCV A;  3BA8 A;  3RFC A;  5FLM G;  4I50 F;  1GSO A;  4J9R A;  2YZM A;  1GSA A;  3SI8 A;  4Q8F A;  3Q2O A;  1VAJ A;  4LH6 A;  5EOY A;  4HNV A;  3RGX A;  1RJR A;  5HV6 A;  4RU9 A;  3QZ7 A;  4KHP H;  1UNN C;  2ASD A;  2FPI B;  4PWQ A;  5FD6 A;  2VUG A;  4O4L F;  3FMA A;  4ZI7 F;  4JI0 H; 
#chains in the Genus database with same CATH homology
 1HNW H;  5D1O B;  1ZHQ A;  2OWO A;  4DV2 H;  1Z2O X;  3N43 B;  4LF9 H;  3MWM A;  4X64 H;  4LMY A;  4B3S H;  2UUB H;  1XNQ H;  4LH7 A;  3BA9 A;  4DR1 H;  4DR4 H;  4X65 H;  2WDT A;  3N44 B;  3RTX A;  4K0K H;  1HNZ H;  2UXD H;  4M7E A;  4JI0 H;  2ZJT A;  2O03 A;  4X62 H;  3N41 B;  2F4V H;  2UUA H;  4EEQ A;  2FE3 A;  2KSW A;  2WE6 A;  1IBK H;  4MTD A;  4I7H A;  2HHH H;  3M4I A;  2CW8 A;  2HVR A;  3DF7 A;  4RB3 C;  1VS0 A;  1ZHS A;  4RB0 A;  4RB2 C;  2RGR A;  1N33 H;  4EFB A;  4J0M A;  5D1P A;  3JSN A;  4DV4 H;  5BR8 H;  1N32 H;  3RJ0 A;  3OTO H;  1FKA H;  4DR6 H;  1E4F T;  1X9N A;  4MV7 A;  3K3V A;  3KAL A;  4B3T H;  2HVQ A;  4JI8 H;  3C0F B;  4MV9 A;  4DV5 H;  1IBL H;  2RGV A;  1XNR H;  4B3R H;  3KAJ A;  5FD5 A;  4JI2 H;  4DV6 H;  2Q2T A;  1XMQ H;  4OX9 H;  1MZB A;  4JI3 H;  1V9P A;  2Q2U A;  3J80 W;  4JV5 H;  3EYY A;  3HXL A;  4DR5 H;  4JI1 H;  3H20 A;  1BGW A;  1I6U A;  3RGZ A;  1S68 A;  4CC6 A;  3N40 P;  1WH2 A;  4RAZ A;  4JYA H;  1DGS A;  4FM9 A;  2HGS A;  4UCU A;  1SEI A;  2XIG A;  4UCT A;  3LML A;  4MTE A;  4EFE A;  4LFC H;  1GYF A;  4LSX A;  1I94 H;  2HVS A;  4Q0Y A;  2MCT A;  4LF8 H;  2UXB H;  4DUZ H;  5D1O A;  4DR3 H;  2W57 A;  2VPS A;  4LFA H;  4LF5 H;  4LF4 H;  1M0T A;  1N36 H;  3JSL A;  5IWA H;  3J7A K;  5IT9 W;  1Z2P X;  4DR2 H;  3BAA A;  4GKJ H;  4DR7 H;  3RIZ A;  4JI5 H;  4GLX A;  1FJG H;  4UCO A;  1E4G T;  5LMU H;  1N34 H;  2UXC H;  3KXY T;  3N6X A;  3PN1 A;  4UCS A;  1S03 G;  1Z2N X;  4A2B A;  4LSA A;  4ETS A;  4LF7 H;  2WYO A;  3KAK A;  5FLX W;  4APM A;  2UU9 H;  4B3M H;  4GKK H;  1IBM H;  2UUC H;  1FVI A;  1HR0 H;  5LMN H;  4NXN H;  2E5L H;  3L2P A;  3L4J A;  3N42 B;  1SYX B;  2VQF H;  1BJT A;  1TA8 A;  4IAJ A;  4RZQ A;  2YCH A;  5FPO A;  2CW7 A;  4A2A A;  4BWS C;  4X66 H;  3IG0 A;  3T1Y H;  5FPR A;  1AN7 A;  4RB1 A;  2VOB A;  1M0W A;  1HNX H;  1B04 A;  4R7R A;  4YY3 H;  2VQE H;  4DUY H;  4PDB A;  1XMO H;  4JI7 H;  3BAB A;  4LF6 H;  2ZM6 H;  4DV7 H;  4CC5 A;  3F8N A;  1L2Z A;  3JAM W;  4RAY A;  4NXM H;  4DV3 H;  4UCR A;  1XDN A;  1P8L A;  3CVZ A;  3UQ8 A;  4UCV A;  3BA8 A;  4LFB H;  3T1H H;  5A2Q W;  1A0I A;  4LH6 A;  5LL6 b;  5EOY A;  4KHP H;  3RGX A;  3RF2 A;  4AQY H;  4JI4 H;  3L4K A;  3J81 W;  4DV1 H;  5FD6 A;  4JI6 H;  1O75 A;  4UFZ A;  1TAE A;  2VUG A;  4DV0 H;  3FMA A;  1J5E H;  4YHH H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...