1GYFA

Gyf domain from human cd2bp2 protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CYTOPLASMIC DOMAIN BINDING PROTEIN (CD2BP2))
publication title The GYF domain is a novel structural fold that is involved in lymphoid signaling through proline-rich sequences.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 9
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1999-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1gyfA00
1L2ZA 4BWSC 3FMAA 1WH2A 3K3VA 1GYFA 1SYXB
chains in the Genus database with same CATH superfamily
4BBRG 4RZRA 5DGBA 4JV1A 5EWEA 5LMNH 1FKAH 5F9LA 2XIGA 4ECWA 2R7ZG 2V58A 4DR3H 2R93G 4RZQA 4X66H 5L1IA 5IYCG 2UXDH 2IMWP 3GIPA 2UUBH 4MV8A 3RTXA 3Q8PB 4DV0H 2JEJA 1AUXA 4Q45A 4J9QA 4AYBE 4QWDA 1I3QA 5KFYA 1UC9A 1K83A 2C35B 4JI1H 5FLMG 4FS2A 2Q2TA 3BA9A 3EPGA 4LSAA 1AN7A 1AUVA 5D1OB 4XYMB 5IP7G 2XCPA 2J6SA 4AYBA 4A93G 2OLSA 1GSAA 2W7OA 1Y1VA 4JI8H 2V9WA 5LYJF 4EFEA 4O3QA 1WR2A 5KFTA 4EBEA 4UCTA 4A3JG 4F4WA 2HGSA 2I8CA 5KG1A 4ECYA 4DR4H 4K0KH 3G6XA 4JI4H 5BPFA 1WCMA 4DV3H 2W6QA 2RGVA 3Q8SB 1N34H 3RUPA 1VS0A 3G6VA 3K5HA 1DGSA 3BA8A 3DF7A 2FPGB 2R8JA 3RB4A 3G8CA 1S0NA 2B63G 4UCOA 3RGZA 3RB3A 4O3NA 5JVLA 3HXLA 1HR0H 3F8NA 5D8DA 1RK5A 5J2TF 4A2BA 1S0MA 4XYLB 2CQYA 3K3PA 1MZBA 4YQWA 1K1SA 3OUZA 3Q2OA 1XMQH 1SYXB 3T1HH 3QZ7A 1L2ZA 1IBKH 4ZI7F 2IP4A 4RB1A 3GIIA 1Y1WA 2W57A 4EEYA 5LP6F 1M6VA 4ED1A 3N40P 2VPSA 4I50F 3V6KA 4PDBA 4YR3A 3PO2G 4RB2C 4NLGA 4F50A 2UUCH 2YS7A 2YS6A 4TUYF 1ULZA 5GONF 4HQ6A 1VAJA 2R8GA 5EZYF 4ECTA 1PX2A 2GPWA 4RAYA 3TQTA 2XGPA 3M9OB 4FM9A 1FJGH 1PK8A 2E2HA 4Q44A 4EEQA 2R87A 1JX4A 1JDEA 2I80A 2R86A 2FK1A 5FJ8G 3BABA 3VPDA 5JUMA 3KTMA 4MV3A 4DUZH 3GIDA 1W93A 3H4BA 3SI8A 4FBUA 5C3EG 2FMAA 5KFHA 3OHBA 3JRWA 5KG7A 3R23A 2NUAB 2CKZB 3N44B 1UNNC 3V6HA 4DL4A 1IOWA 2W8LA 3EYYA 5HV6A 3MR2A 3KAJA 1IOVA 2HVRA 1C3OA 2BR0A 4JUZA 3QZ8A 4O4IF 2R8IA 4J9PA 5L1KA 4DL6A 1TWGA 4U7CA 4J9MA 1S68A 3G6YA 3H20A 4A3FG 5BR8H 4QWBA 1R9TA 4APMA 3GTPA 1J5EH 2M05A 2YL2A 4J9OA 2JA8G 3MJFA 1KJ9A 3LMLA 2VA2A 2FLPA 3LP8A 1VKZA 4YJ2F 4A3EG 1WSCA 4YY3H 1B33N 5CA1F 5KT2A 3I4MG 5IP9G 3SE7A 2QYZA 5D1PA 4IRCA 2HHHH 1KBLA 1TWHA 5HBRB 2DPJA 2AGQA 1EUDB 4QWEA 3OSNA 1SFOA 4ECXA 4DL3A 2OH2A 2I87A 3K3VA 3L4KA 4IWXA 3PZPA 3H3VH 4UCSA 3BAAA 4F4YA 3MWDA 2GPSA 3UQ8A 2DPIA 3BQ2A 4DV1H 4ED2A 3RBEA 5C4XG 4CC5A 2JA5A 2C00A 5DLFA 1ZETA 2YZMA 1I7NA 3PW5A 4A2AA 3KHRA 4J9KA 4ED8A 1N32H 4DR7H 2Y0SE 5A2QW 5KFUA 4DV7H 4L1KA 3BQ0A 2ASLA 1BGWA 1RK6A 3N41B 3TQ1A 2VPQA 1P8LA 1I6UA 2NU8B 3MFHA 3CVZA 2R6FA 2Y0SA 1B6SA 3JAMW 1BJTA 4JV5H 2NVYA 3JSNA 1OWTA 4M7EA 2R85A 1IBMH 1KEEA 2VUGA 1JKJB 4GLXA 2JA6A 5KT6A 5DG8A 4B3TH 1V4YA 1I50A 4GC6A 1M0WA 2AGOA 4QW9A 3M9MB 2ZDQA 3T5KA 2ASJA 2ZDGA 2FB9A 4X64H 3PVXA 3OUUA 2ZJTA 4B3SH 2W9AA 3H0GA 4R7RA 3FDSA 3T5HA 4B3RH 1RJPA 2WB1E 3RBDA 5EDWA 1I7LA 1RJRA 4G3IA 5KFGA 1SEIA 2HVQA 3H40A 2DIKA 3WO0A 2O03A 4JI7H 4HNUA 4LH7A 2WE6A 1GSHA 5KFKA 2WB1A 5IYDG 3LWBA 2PMZE 2W6OA 1M0TA 2W6PA 4DR1H 4O3OA 2NU9B 5KT5A 4MV9A 5FD6A 4A3KG 1HNXH 2CW8A 4ME6A 4C2MA 1Z2OX 5KFAA 4Q0YA 4EGQA 2R8KA 3T1YH 3GILA 4YHHH 3IN5A 5L9XA 2E2IA 1E4FT 2PMZA 5KT7A 4LSXA 5KFVA 1SCUB 4YJ3F 3GV7B 2P0AA 2JA5G 3RFCA 5CAEB 3GTOA 2C28A 3MWEA 3RJ0A 4EBDA 2NU6B 2UU9H 3ETJA 1JIHA 4I55F 4UFZA 3IG0A 2VQEH 3HOXG 2V59A 4YR0A 3GLKA 4O3RA 4IRDA 3C0FB 4MV6A 4A3DG 4DR6H 2W70A 2YZNA 1EZ1A 4RU9A 4LFAH 1A0IA 2UXBH 1CS0A 4WD3A 1K1QA 2AQ4A 1O75A 2Q2UA 2W9BA 1RJQA 5KFDA 2WTFA 4YAKB 1KJ8A 2RF4A 4JV2A 2JA6G 4LF6H 1EYZA 3HKZE 5KG5A 1RYSA 4DV2H 3KHGA 4YBZB 5KG3A 3R5HA 3GTKA 3M4IA 4B3MH 2CZGA 2W9CA 4Q8EA 3H0GG 4EBCA 2BQ3A 3PW7A 1BNCA 3HKZA 3L4JA 3GTGA 5FPRA 5KFQA 4OX9H 4NXNH 2YZGA 4HYKA 3T5LA 3HOYG 4XX0B 4O3PA 3J7AK 5KFBA 4RAZA 4Q8FA 3J80W 2JA7G 2YRWA 4IWYA 3Q1KA 4MTEA 4TV8F 5C44G 2XGQA 2W6MA 4JI0H 2ZDHA 3GTQA 3GV5B 4MV4A 4MAMA 4GC7A 5EWGA 3N43B 5CA0F 5KFMA 4FS1A 1S9FA 1N48A 1N33H 1KJQA 4F4ZA 4ECUA 4LH6A 4TQSA 3RF2A 5FD5A 4EFBA 1GO3E 4BY1G 4ECVA 1JXLA 2UVWA 4FBTA 4C5BA 4QWAA 1E4EA 5LA6F 5KFPA 5EWFA 3GIKA 5DQHA 5LOVF 4RB0A 4JV0A 4IAJA 4LF5H 1ZHQA 4RB3C 4X65H 3OTOH 2W6ZA 5CB4F 5C1PA 1ZHSA 4GKJH 1Z2NX 2J6TA 4DLKA 5KFEA 3BJYA 4X62H 4J9RA 3PW2A 2RGRA 4BXXG 1RYRA 5KX5F 2UXCH 3R5XA 3E5NA 1CE8A 2X0SA 2C2DA 4ECSA 4DV6H 1X9NA 4PWQA 5DGAA 4ECRA 2HJWA 2PBZA 2DZDA 4ECQA 3HBLA 4R8UB 2ZM6H 5EOYA 4EYIB 4RNOA 5KG0A 1N36H 4UCVA 5K2MA 5F9NA 5KFCA 2HVSA 1XNRH 4YAJB 5BMVF 1JLLB 3ETHA 2UVVA 4R8UA 5T14A 2IA6A 5FLXW 2RDJA 5JH7F 1CQIB 1T94A 4IZOA 1GLVA 1DV2A 2UUAH 4CC6A 5KKNB 3PN1A 3GTMA 3RB0A 2J9GA 3PW4A 5KG2A 3MR5A 2R7LA 2YRXA 4MV1A 1W96A 3OHAA 3KHLA 4LF9H 3MFIA 4RNMA 2FK2A 4J0MA 3K5IA 4YB8B 3RB6A 5L1JA 1B6RA 1CQJB 4DUYH 3HOVG 2IBKA 3U9TA 1EUCB 5KG4A 2GLTA 4FU0A 4O2BF 2R8HA 3HOWG 5KT4A 1UC8A 4I4TF 4O4LF 3KXYT 1Z2PX 3TINA 4MA0A 2RDIA 2V4QA 2FK3A 1EHIA 4DL7A 3PW0A 5BPHA 1GYFA 3GTJA 2R82A 2QK4A 5KFSA 1KC7A 4RUAA 4BWSC 2ASDA 3N6XA 4JI6H 5LL6b 1XDNA 3VPCA 5DQGA 2BQUA 1ZQ7A 2F4VH 4ZOLF 3WO1A 5H80A 5LXTF 5JVDF 1V51A 1M7JA 1TA8A 4LF4H 2PVPA 3T5JA 4QJFA 1JDBB 2JA7A 1FVIA 5KFWA 2R84A 3HB9A 1I94H 2FKLA 3V4SA 4E4TA 4MTDA 5DG7A 4ED7A 4IR9A 3J81W 2FPPB 3GIMA 1VBHA 4HR7A 3KAKA 3MR3A 3RAQA 5D1OA 3KHHA 5C1OA 5DG9A 5KFIA 3U9SA 2NVXA 1N56A 5KFLA 4J9LA 3RV3A 2BQRA 2VUMA 4M9UA 3FMAA 2XC9A 4O3SA 3GIQA 2C2RA 3FKIG 4ED3A 3I12A 1S0OA 3PR4A 4JYAH 5KFFA 1WH2A 2XD4A 3RGXA 4J9SA 2NU7B 2W9BB 2MCTA 5KFOA 2R92G 4LF8H 3HOUG 3HOZG 4A3MG 2FLLA 1GGOA 5J2UF 5DLGA 2W7PA 2CW7A 1A9XA 2JEFA 2FP4B 2DLNA 5KG6A 2V4RA 3UFXB 4YP3A 2KSWA 2AGPA 2R7NA 2YW2A 4YR2A 4LMYA 2YCHA 2R7KA 5IYZF 2W9CB 3GV8B 5IT9W 1BXRA 3JRXA 3GQCA 5L1LA 2FPIB 2VR1A 4KHPH 3JZIA 1XNQH 3I4NG 3TIIA 4EGJA 4HNTA 5I47A 4QW8A 3L2PA 4MV7A 1TWCA 4HNVA 4LF7H 2PN1A 4A3GG 1B04A 4A3CG 4F4XA 2FJZA 5KT3A 4A3LG 4QIWE 4UCRA 4JI3H 3VMMA 5KFXA 2JEGA 3VPBA 2R7MA 2SCUB 2W6NA 4Y8VB 5LMUH 1KJIA 5FPOA 4DL5A 4MA5A 4QIWA 2ALZA 4ECZA 4QWCA 1T3NA 1S10A 4NXMH 4A3IG 1DIKA 4IR1A 4C5AA 3V6JA 4TV9F 1Y1VG 2WDTA 5C5JA 3N8DA 2W71A 1GSOA 3Q8RB 1T36A 1E4EB 4TQRA 3AYHB 1S03G 4A3BG 4O2AF 2AU0A 1C30A 2VUMG 5DQIA 2VQFH 2R93A 2R7ZA 3RIZA 1WCMG 1XMOH 4BBSG 5IWAH 4DV4H 4ED0A 3RV4A 1E4GT 2OWOA 1KJJA 3NGDA 1TWFA 4DV5H 3ORQA 4J9NA 2YU9A 4DL2A 3PR5B 4DR2H 1TWAA 4JI2H 2ATLA 1Y14B 3R5FA 5JQWA 2W8KA 2JEIA 2VQDA 2WAQE 3N42B 3PO3G 2FE3A 4RNNA 1VBGA 1HNZH 5IYBG 3CQZA 3V4ZA 4EYHB 3WNZA 2UVRA 4I7HA 2V5AA 2VOBA 1TAEA 1V9PA 4XZ3B 4EG0A 4C5CA 5C8YF 2DWCA 3GIJA 4DR5H 2C22A 2J6UA 3GTLA 2WAQA 3FKIA 4RUCA 3H4DA 1Y1WG 3M9NB 3QFFA 4WBNF 5KFZA 2YYAA 2FLNA 1IBLH 4LFCH 4UCUA 3TIGA 4IRKA 1DV1A 4AQYH 2WYOA 4ED6A 3KALA 3MR6A 1S97A 3Q8QB 4LFBH 2R92A 5KFJA 4ZQIA 2B63A 4ZHQF 2XCLA 2C2EA 4JI5H 4O4HF 4GKKH 2XCAA 3OSPA 4IHJF 4BY7G 4U6PA 4Q43A 1HNWH 2E5LH 3ORRA 5KFNA 3BQ1A 3MWMA 2UVUA 2VA3A 3RAXA 3EPIA 5KFRA 3BG5A 3JSLA 4ETSA
chains in the Genus database with same CATH topology
3FMAA 3L4JA 5LMNH 1FKAH 4LF5H 4YY3H 5FPRA 2XIGA 4DR3H 4OX9H 4RZQA 4X66H 5D1PA 4NXNH 4JYAH 3J7AK 2UXDH 2HHHH 2UUBH 1WH2A 3RTXA 4DV0H 3RGXA 4RAZA 3J80W 4MTEA 2MCTA 4LF8H 4JI1H 4JI0H 2Q2TA 3BA9A 2CW7A 3K3VA 4LSAA 3L4KA 1AN7A 5D1OB 4UCSA 3BAAA 3N43B 2KSWA 1N33H 4LMYA 2YCHA 4LH6A 5IT9W 3UQ8A 4JI8H 3RF2A 4DV1H 4EFEA 4KHPH 4CC5A 5FD5A 1XNQH 4EFBA 4UCTA 3L2PA 4A2AA 1N32H 4MV7A 2HGSA 4DR7H 4DR4H 4K0KH 4LF7H 5A2QW 4JI4H 4DV7H 1B04A 4RB0A 4IAJA 4DV3H 1BGWA 1ZHQA 2RGVA 3N41B 4UCRA 4X65H 1P8LA 4RB3C 3OTOH 4JI3H 1I6UA 1N34H 1ZHSA 4GKJH 1Z2NX 1VS0A 5LMUH 1DGSA 5FPOA 3CVZA 3BA8A 3DF7A 3JAMW 1BJTA 4X62H 2RGRA 3JSNA 2UXCH 4UCOA 4M7EA 3RGZA 1IBMH 2VUGA 4GLXA 3HXLA 4DV6H 1X9NA 4NXMH 1HR0H 3F8NA 4A2BA 4B3TH 1M0WA 2ZM6H 2WDTA 5EOYA 1MZBA 4X64H 4UCVA 1N36H 2ZJTA 2HVSA 4B3SH 1XNRH 1XMQH 1S03G 4R7RA 4B3RH 1SYXB 3T1HH 1L2ZA 5FLXW 1IBKH 2VQFH 3RIZA 4RB1A 1SEIA 2HVQA 2W57A 1XMOH 5IWAH 4DV4H 2UUAH 2O03A 4CC6A 4JI7H 4LH7A 3N40P 2VPSA 2WE6A 3PN1A 1E4GT 2OWOA 4PDBA 4RB2C 4DV5H 2UUCH 4LF9H 1M0TA 4J0MA 4DR1H 4MV9A 5FD6A 4DR2H 4JI2H 4DUYH 1HNXH 2CW8A 1Z2OX 4RAYA 4FM9A 4Q0YA 1FJGH 3T1YH 4EEQA 3N42B 4YHHH 2FE3A 1E4FT 1HNZH 3KXYT 1Z2PX 3BABA 4LSXA 4DUZH 1GYFA 4I7HA 2VOBA 1TAEA 1V9PA 4JV5H 3RJ0A 4BWSC 4DR5H 2UU9H 3N6XA 4JI6H 5LL6b 1XDNA 4UFZA 2F4VH 3IG0A 3N44B 2VQEH 1TA8A 1IBLH 4UCUA 4LFCH 3EYYA 4LF4H 3C0FB 4AQYH 2WYOA 3KAJA 3KALA 4DR6H 2HVRA 4LFAH 1FVIA 1A0IA 1I94H 4LFBH 2UXBH 4MTDA 1O75A 2Q2UA 4JI5H 3J81W 4GKKH 4LF6H 1S68A 1HNWH 3H20A 2E5LH 3KAKA 5BR8H 4APMA 4DV2H 5D1OA 1J5EH 3MWMA 3M4IA 4B3MH 3LMLA 3JSLA 4ETSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2Z A;  4BWS C;  3FMA A;  1WH2 A;  3K3V A;  1GYF A;  1SYX B; 
#chains in the Genus database with same CATH topology
 4BBR G;  4RZR A;  5DGB A;  4JV1 A;  5EWE A;  5LMN H;  1FKA H;  5F9L A;  2XIG A;  4ECW A;  2R7Z G;  2V58 A;  4DR3 H;  2R93 G;  4RZQ A;  4X66 H;  5L1I A;  5IYC G;  2UXD H;  2IMW P;  3GIP A;  2UUB H;  4MV8 A;  3RTX A;  3Q8P B;  4DV0 H;  2JEJ A;  1AUX A;  4Q45 A;  4J9Q A;  4AYB E;  4QWD A;  1I3Q A;  5KFY A;  1UC9 A;  1K83 A;  2C35 B;  4JI1 H;  5FLM G;  4FS2 A;  2Q2T A;  3BA9 A;  3EPG A;  4LSA A;  1AN7 A;  1AUV A;  5D1O B;  4XYM B;  5IP7 G;  2XCP A;  2J6S A;  4AYB A;  4A93 G;  2OLS A;  1GSA A;  2W7O A;  1Y1V A;  4JI8 H;  2V9W A;  5LYJ F;  4EFE A;  4O3Q A;  1WR2 A;  5KFT A;  4EBE A;  4UCT A;  4A3J G;  4F4W A;  2HGS A;  2I8C A;  5KG1 A;  4ECY A;  4DR4 H;  4K0K H;  3G6X A;  4JI4 H;  5BPF A;  1WCM A;  4DV3 H;  2W6Q A;  2RGV A;  3Q8S B;  1N34 H;  3RUP A;  1VS0 A;  3G6V A;  3K5H A;  1DGS A;  3BA8 A;  3DF7 A;  2FPG B;  2R8J A;  3RB4 A;  3G8C A;  1S0N A;  2B63 G;  4UCO A;  3RGZ A;  3RB3 A;  4O3N A;  5JVL A;  3HXL A;  1HR0 H;  3F8N A;  5D8D A;  1RK5 A;  5J2T F;  4A2B A;  1S0M A;  4XYL B;  2CQY A;  3K3P A;  1MZB A;  4YQW A;  1K1S A;  3OUZ A;  3Q2O A;  1XMQ H;  1SYX B;  3T1H H;  3QZ7 A;  1L2Z A;  1IBK H;  4ZI7 F;  2IP4 A;  4RB1 A;  3GII A;  1Y1W A;  2W57 A;  4EEY A;  5LP6 F;  1M6V A;  4ED1 A;  3N40 P;  2VPS A;  4I50 F;  3V6K A;  4PDB A;  4YR3 A;  3PO2 G;  4RB2 C;  4NLG A;  4F50 A;  2UUC H;  2YS7 A;  2YS6 A;  4TUY F;  1ULZ A;  5GON F;  4HQ6 A;  1VAJ A;  2R8G A;  5EZY F;  4ECT A;  1PX2 A;  2GPW A;  4RAY A;  3TQT A;  2XGP A;  3M9O B;  4FM9 A;  1FJG H;  1PK8 A;  2E2H A;  4Q44 A;  4EEQ A;  2R87 A;  1JX4 A;  1JDE A;  2I80 A;  2R86 A;  2FK1 A;  5FJ8 G;  3BAB A;  3VPD A;  5JUM A;  3KTM A;  4MV3 A;  4DUZ H;  3GID A;  1W93 A;  3H4B A;  3SI8 A;  4FBU A;  5C3E G;  2FMA A;  5KFH A;  3OHB A;  3JRW A;  5KG7 A;  3R23 A;  2NUA B;  2CKZ B;  3N44 B;  1UNN C;  3V6H A;  4DL4 A;  1IOW A;  2W8L A;  3EYY A;  5HV6 A;  3MR2 A;  3KAJ A;  1IOV A;  2HVR A;  1C3O A;  2BR0 A;  4JUZ A;  3QZ8 A;  4O4I F;  2R8I A;  4J9P A;  5L1K A;  4DL6 A;  1TWG A;  4U7C A;  4J9M A;  1S68 A;  3G6Y A;  3H20 A;  4A3F G;  5BR8 H;  4QWB A;  1R9T A;  4APM A;  3GTP A;  1J5E H;  2M05 A;  2YL2 A;  4J9O A;  2JA8 G;  3MJF A;  1KJ9 A;  3LML A;  2VA2 A;  2FLP A;  3LP8 A;  1VKZ A;  4YJ2 F;  4A3E G;  1WSC A;  4YY3 H;  1B33 N;  5CA1 F;  5KT2 A;  3I4M G;  5IP9 G;  3SE7 A;  2QYZ A;  5D1P A;  4IRC A;  2HHH H;  1KBL A;  1TWH A;  5HBR B;  2DPJ A;  2AGQ A;  1EUD B;  4QWE A;  3OSN A;  1SFO A;  4ECX A;  4DL3 A;  2OH2 A;  2I87 A;  3K3V A;  3L4K A;  4IWX A;  3PZP A;  3H3V H;  4UCS A;  3BAA A;  4F4Y A;  3MWD A;  2GPS A;  3UQ8 A;  2DPI A;  3BQ2 A;  4DV1 H;  4ED2 A;  3RBE A;  5C4X G;  4CC5 A;  2JA5 A;  2C00 A;  5DLF A;  1ZET A;  2YZM A;  1I7N A;  3PW5 A;  4A2A A;  3KHR A;  4J9K A;  4ED8 A;  1N32 H;  4DR7 H;  2Y0S E;  5A2Q W;  5KFU A;  4DV7 H;  4L1K A;  3BQ0 A;  2ASL A;  1BGW A;  1RK6 A;  3N41 B;  3TQ1 A;  2VPQ A;  1P8L A;  1I6U A;  2NU8 B;  3MFH A;  3CVZ A;  2R6F A;  2Y0S A;  1B6S A;  3JAM W;  1BJT A;  4JV5 H;  2NVY A;  3JSN A;  1OWT A;  4M7E A;  2R85 A;  1IBM H;  1KEE A;  2VUG A;  1JKJ B;  4GLX A;  2JA6 A;  5KT6 A;  5DG8 A;  4B3T H;  1V4Y A;  1I50 A;  4GC6 A;  1M0W A;  2AGO A;  4QW9 A;  3M9M B;  2ZDQ A;  3T5K A;  2ASJ A;  2ZDG A;  2FB9 A;  4X64 H;  3PVX A;  3OUU A;  2ZJT A;  4B3S H;  2W9A A;  3H0G A;  4R7R A;  3FDS A;  3T5H A;  4B3R H;  1RJP A;  2WB1 E;  3RBD A;  5EDW A;  1I7L A;  1RJR A;  4G3I A;  5KFG A;  1SEI A;  2HVQ A;  3H40 A;  2DIK A;  3WO0 A;  2O03 A;  4JI7 H;  4HNU A;  4LH7 A;  2WE6 A;  1GSH A;  5KFK A;  2WB1 A;  5IYD G;  3LWB A;  2PMZ E;  2W6O A;  1M0T A;  2W6P A;  4DR1 H;  4O3O A;  2NU9 B;  5KT5 A;  4MV9 A;  5FD6 A;  4A3K G;  1HNX H;  2CW8 A;  4ME6 A;  4C2M A;  1Z2O X;  5KFA A;  4Q0Y A;  4EGQ A;  2R8K A;  3T1Y H;  3GIL A;  4YHH H;  3IN5 A;  5L9X A;  2E2I A;  1E4F T;  2PMZ A;  5KT7 A;  4LSX A;  5KFV A;  1SCU B;  4YJ3 F;  3GV7 B;  2P0A A;  2JA5 G;  3RFC A;  5CAE B;  3GTO A;  2C28 A;  3MWE A;  3RJ0 A;  4EBD A;  2NU6 B;  2UU9 H;  3ETJ A;  1JIH A;  4I55 F;  4UFZ A;  3IG0 A;  2VQE H;  3HOX G;  2V59 A;  4YR0 A;  3GLK A;  4O3R A;  4IRD A;  3C0F B;  4MV6 A;  4A3D G;  4DR6 H;  2W70 A;  2YZN A;  1EZ1 A;  4RU9 A;  4LFA H;  1A0I A;  2UXB H;  1CS0 A;  4WD3 A;  1K1Q A;  2AQ4 A;  1O75 A;  2Q2U A;  2W9B A;  1RJQ A;  5KFD A;  2WTF A;  4YAK B;  1KJ8 A;  2RF4 A;  4JV2 A;  2JA6 G;  4LF6 H;  1EYZ A;  3HKZ E;  5KG5 A;  1RYS A;  4DV2 H;  3KHG A;  4YBZ B;  5KG3 A;  3R5H A;  3GTK A;  3M4I A;  4B3M H;  2CZG A;  2W9C A;  4Q8E A;  3H0G G;  4EBC A;  2BQ3 A;  3PW7 A;  1BNC A;  3HKZ A;  3L4J A;  3GTG A;  5FPR A;  5KFQ A;  4OX9 H;  4NXN H;  2YZG A;  4HYK A;  3T5L A;  3HOY G;  4XX0 B;  4O3P A;  3J7A K;  5KFB A;  4RAZ A;  4Q8F A;  3J80 W;  2JA7 G;  2YRW A;  4IWY A;  3Q1K A;  4MTE A;  4TV8 F;  5C44 G;  2XGQ A;  2W6M A;  4JI0 H;  2ZDH A;  3GTQ A;  3GV5 B;  4MV4 A;  4MAM A;  4GC7 A;  5EWG A;  3N43 B;  5CA0 F;  5KFM A;  4FS1 A;  1S9F A;  1N48 A;  1N33 H;  1KJQ A;  4F4Z A;  4ECU A;  4LH6 A;  4TQS A;  3RF2 A;  5FD5 A;  4EFB A;  1GO3 E;  4BY1 G;  4ECV A;  1JXL A;  2UVW A;  4FBT A;  4C5B A;  4QWA A;  1E4E A;  5LA6 F;  5KFP A;  5EWF A;  3GIK A;  5DQH A;  5LOV F;  4RB0 A;  4JV0 A;  4IAJ A;  4LF5 H;  1ZHQ A;  4RB3 C;  4X65 H;  3OTO H;  2W6Z A;  5CB4 F;  5C1P A;  1ZHS A;  4GKJ H;  1Z2N X;  2J6T A;  4DLK A;  5KFE A;  3BJY A;  4X62 H;  4J9R A;  3PW2 A;  2RGR A;  4BXX G;  1RYR A;  5KX5 F;  2UXC H;  3R5X A;  3E5N A;  1CE8 A;  2X0S A;  2C2D A;  4ECS A;  4DV6 H;  1X9N A;  4PWQ A;  5DGA A;  4ECR A;  2HJW A;  2PBZ A;  2DZD A;  4ECQ A;  3HBL A;  4R8U B;  2ZM6 H;  5EOY A;  4EYI B;  4RNO A;  5KG0 A;  1N36 H;  4UCV A;  5K2M A;  5F9N A;  5KFC A;  2HVS A;  1XNR H;  4YAJ B;  5BMV F;  1JLL B;  3ETH A;  2UVV A;  4R8U A;  5T14 A;  2IA6 A;  5FLX W;  2RDJ A;  5JH7 F;  1CQI B;  1T94 A;  4IZO A;  1GLV A;  1DV2 A;  2UUA H;  4CC6 A;  5KKN B;  3PN1 A;  3GTM A;  3RB0 A;  2J9G A;  3PW4 A;  5KG2 A;  3MR5 A;  2R7L A;  2YRX A;  4MV1 A;  1W96 A;  3OHA A;  3KHL A;  4LF9 H;  3MFI A;  4RNM A;  2FK2 A;  4J0M A;  3K5I A;  4YB8 B;  3RB6 A;  5L1J A;  1B6R A;  1CQJ B;  4DUY H;  3HOV G;  2IBK A;  3U9T A;  1EUC B;  5KG4 A;  2GLT A;  4FU0 A;  4O2B F;  2R8H A;  3HOW G;  5KT4 A;  1UC8 A;  4I4T F;  4O4L F;  3KXY T;  1Z2P X;  3TIN A;  4MA0 A;  2RDI A;  2V4Q A;  2FK3 A;  1EHI A;  4DL7 A;  3PW0 A;  5BPH A;  1GYF A;  3GTJ A;  2R82 A;  2QK4 A;  5KFS A;  1KC7 A;  4RUA A;  4BWS C;  2ASD A;  3N6X A;  4JI6 H;  5LL6 b;  1XDN A;  3VPC A;  5DQG A;  2BQU A;  1ZQ7 A;  2F4V H;  4ZOL F;  3WO1 A;  5H80 A;  5LXT F;  5JVD F;  1V51 A;  1M7J A;  1TA8 A;  4LF4 H;  2PVP A;  3T5J A;  4QJF A;  1JDB B;  2JA7 A;  1FVI A;  5KFW A;  2R84 A;  3HB9 A;  1I94 H;  2FKL A;  3V4S A;  4E4T A;  4MTD A;  5DG7 A;  4ED7 A;  4IR9 A;  3J81 W;  2FPP B;  3GIM A;  1VBH A;  4HR7 A;  3KAK A;  3MR3 A;  3RAQ A;  5D1O A;  3KHH A;  5C1O A;  5DG9 A;  5KFI A;  3U9S A;  2NVX A;  1N56 A;  5KFL A;  4J9L A;  3RV3 A;  2BQR A;  2VUM A;  4M9U A;  3FMA A;  2XC9 A;  4O3S A;  3GIQ A;  2C2R A;  3FKI G;  4ED3 A;  3I12 A;  1S0O A;  3PR4 A;  4JYA H;  5KFF A;  1WH2 A;  2XD4 A;  3RGX A;  4J9S A;  2NU7 B;  2W9B B;  2MCT A;  5KFO A;  2R92 G;  4LF8 H;  3HOU G;  3HOZ G;  4A3M G;  2FLL A;  1GGO A;  5J2U F;  5DLG A;  2W7P A;  2CW7 A;  1A9X A;  2JEF A;  2FP4 B;  2DLN A;  5KG6 A;  2V4R A;  3UFX B;  4YP3 A;  2KSW A;  2AGP A;  2R7N A;  2YW2 A;  4YR2 A;  4LMY A;  2YCH A;  2R7K A;  5IYZ F;  2W9C B;  3GV8 B;  5IT9 W;  1BXR A;  3JRX A;  3GQC A;  5L1L A;  2FPI B;  2VR1 A;  4KHP H;  3JZI A;  1XNQ H;  3I4N G;  3TII A;  4EGJ A;  4HNT A;  5I47 A;  4QW8 A;  3L2P A;  4MV7 A;  1TWC A;  4HNV A;  4LF7 H;  2PN1 A;  4A3G G;  1B04 A;  4A3C G;  4F4X A;  2FJZ A;  5KT3 A;  4A3L G;  4QIW E;  4UCR A;  4JI3 H;  3VMM A;  5KFX A;  2JEG A;  3VPB A;  2R7M A;  2SCU B;  2W6N A;  4Y8V B;  5LMU H;  1KJI A;  5FPO A;  4DL5 A;  4MA5 A;  4QIW A;  2ALZ A;  4ECZ A;  4QWC A;  1T3N A;  1S10 A;  4NXM H;  4A3I G;  1DIK A;  4IR1 A;  4C5A A;  3V6J A;  4TV9 F;  1Y1V G;  2WDT A;  5C5J A;  3N8D A;  2W71 A;  1GSO A;  3Q8R B;  1T36 A;  1E4E B;  4TQR A;  3AYH B;  1S03 G;  4A3B G;  4O2A F;  2AU0 A;  1C30 A;  2VUM G;  5DQI A;  2VQF H;  2R93 A;  2R7Z A;  3RIZ A;  1WCM G;  1XMO H;  4BBS G;  5IWA H;  4DV4 H;  4ED0 A;  3RV4 A;  1E4G T;  2OWO A;  1KJJ A;  3NGD A;  1TWF A;  4DV5 H;  3ORQ A;  4J9N A;  2YU9 A;  4DL2 A;  3PR5 B;  4DR2 H;  1TWA A;  4JI2 H;  2ATL A;  1Y14 B;  3R5F A;  5JQW A;  2W8K A;  2JEI A;  2VQD A;  2WAQ E;  3N42 B;  3PO3 G;  2FE3 A;  4RNN A;  1VBG A;  1HNZ H;  5IYB G;  3CQZ A;  3V4Z A;  4EYH B;  3WNZ A;  2UVR A;  4I7H A;  2V5A A;  2VOB A;  1TAE A;  1V9P A;  4XZ3 B;  4EG0 A;  4C5C A;  5C8Y F;  2DWC A;  3GIJ A;  4DR5 H;  2C22 A;  2J6U A;  3GTL A;  2WAQ A;  3FKI A;  4RUC A;  3H4D A;  1Y1W G;  3M9N B;  3QFF A;  4WBN F;  5KFZ A;  2YYA A;  2FLN A;  1IBL H;  4LFC H;  4UCU A;  3TIG A;  4IRK A;  1DV1 A;  4AQY H;  2WYO A;  4ED6 A;  3KAL A;  3MR6 A;  1S97 A;  3Q8Q B;  4LFB H;  2R92 A;  5KFJ A;  4ZQI A;  2B63 A;  4ZHQ F;  2XCL A;  2C2E A;  4JI5 H;  4O4H F;  4GKK H;  2XCA A;  3OSP A;  4IHJ F;  4BY7 G;  4U6P A;  4Q43 A;  1HNW H;  2E5L H;  3ORR A;  5KFN A;  3BQ1 A;  3MWM A;  2UVU A;  2VA3 A;  3RAX A;  3EPI A;  5KFR A;  3BG5 A;  3JSL A;  4ETS A; 
#chains in the Genus database with same CATH homology
 3FMA A;  3L4J A;  5LMN H;  1FKA H;  4LF5 H;  4YY3 H;  5FPR A;  2XIG A;  4DR3 H;  4OX9 H;  4RZQ A;  4X66 H;  5D1P A;  4NXN H;  4JYA H;  3J7A K;  2UXD H;  2HHH H;  2UUB H;  1WH2 A;  3RTX A;  4DV0 H;  3RGX A;  4RAZ A;  3J80 W;  4MTE A;  2MCT A;  4LF8 H;  4JI1 H;  4JI0 H;  2Q2T A;  3BA9 A;  2CW7 A;  3K3V A;  4LSA A;  3L4K A;  1AN7 A;  5D1O B;  4UCS A;  3BAA A;  3N43 B;  2KSW A;  1N33 H;  4LMY A;  2YCH A;  4LH6 A;  5IT9 W;  3UQ8 A;  4JI8 H;  3RF2 A;  4DV1 H;  4EFE A;  4KHP H;  4CC5 A;  5FD5 A;  1XNQ H;  4EFB A;  4UCT A;  3L2P A;  4A2A A;  1N32 H;  4MV7 A;  2HGS A;  4DR7 H;  4DR4 H;  4K0K H;  4LF7 H;  5A2Q W;  4JI4 H;  4DV7 H;  1B04 A;  4RB0 A;  4IAJ A;  4DV3 H;  1BGW A;  1ZHQ A;  2RGV A;  3N41 B;  4UCR A;  4X65 H;  1P8L A;  4RB3 C;  3OTO H;  4JI3 H;  1I6U A;  1N34 H;  1ZHS A;  4GKJ H;  1Z2N X;  1VS0 A;  5LMU H;  1DGS A;  5FPO A;  3CVZ A;  3BA8 A;  3DF7 A;  3JAM W;  1BJT A;  4X62 H;  2RGR A;  3JSN A;  2UXC H;  4UCO A;  4M7E A;  3RGZ A;  1IBM H;  2VUG A;  4GLX A;  3HXL A;  4DV6 H;  1X9N A;  4NXM H;  1HR0 H;  3F8N A;  4A2B A;  4B3T H;  1M0W A;  2ZM6 H;  2WDT A;  5EOY A;  1MZB A;  4X64 H;  4UCV A;  1N36 H;  2ZJT A;  2HVS A;  4B3S H;  1XNR H;  1XMQ H;  1S03 G;  4R7R A;  4B3R H;  1SYX B;  3T1H H;  1L2Z A;  5FLX W;  1IBK H;  2VQF H;  3RIZ A;  4RB1 A;  1SEI A;  2HVQ A;  2W57 A;  1XMO H;  5IWA H;  4DV4 H;  2UUA H;  2O03 A;  4CC6 A;  4JI7 H;  4LH7 A;  3N40 P;  2VPS A;  2WE6 A;  3PN1 A;  1E4G T;  2OWO A;  4PDB A;  4RB2 C;  4DV5 H;  2UUC H;  4LF9 H;  1M0T A;  4J0M A;  4DR1 H;  4MV9 A;  5FD6 A;  4DR2 H;  4JI2 H;  4DUY H;  1HNX H;  2CW8 A;  1Z2O X;  4RAY A;  4FM9 A;  4Q0Y A;  1FJG H;  3T1Y H;  4EEQ A;  3N42 B;  4YHH H;  2FE3 A;  1E4F T;  1HNZ H;  3KXY T;  1Z2P X;  3BAB A;  4LSX A;  4DUZ H;  1GYF A;  4I7H A;  2VOB A;  1TAE A;  1V9P A;  4JV5 H;  3RJ0 A;  4BWS C;  4DR5 H;  2UU9 H;  3N6X A;  4JI6 H;  5LL6 b;  1XDN A;  4UFZ A;  2F4V H;  3IG0 A;  3N44 B;  2VQE H;  1TA8 A;  1IBL H;  4UCU A;  4LFC H;  3EYY A;  4LF4 H;  3C0F B;  4AQY H;  2WYO A;  3KAJ A;  3KAL A;  4DR6 H;  2HVR A;  4LFA H;  1FVI A;  1A0I A;  1I94 H;  4LFB H;  2UXB H;  4MTD A;  1O75 A;  2Q2U A;  4JI5 H;  3J81 W;  4GKK H;  4LF6 H;  1S68 A;  1HNW H;  3H20 A;  2E5L H;  3KAK A;  5BR8 H;  4APM A;  4DV2 H;  5D1O A;  1J5E H;  3MWM A;  3M4I A;  4B3M H;  3LML A;  3JSL A;  4ETS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...