1GYFA

Gyf domain from human cd2bp2 protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CYTOPLASMIC DOMAIN BINDING PROTEIN (CD2BP2))
publication title The GYF domain is a novel structural fold that is involved in lymphoid signaling through proline-rich sequences.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 9
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1999-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1gyfA00
1L2ZA 3FMAA 1SYXB 4BWSC 1WH2A 3K3VA 1GYFA
chains in the Genus database with same CATH superfamily
4YP3A 1UNNC 3LMLA 4RB3C 3BG5A 4JV1A 2CKZB 4MV6A 2C35B 4ECQA 3R5XA 3T5HA 4JI7H 1DIKA 2R86A 1HNWH 4EBDA 5J2TF 3GTQA 4IRDA 3M9OB 2E2HA 3H40A 3EPGA 4ECYA 3N44B 5KFVA 3WO1A 4RB1A 2V4QA 3L4KA 4WBNF 2FLPA 1GSOA 2W6PA 3EPIA 4IAJA 2W8LA 5CA1F 2FPIB 1AUVA 3RIZA 1TA8A 4EBEA 1EZ1A 4FU0A 2NU7B 3GIPA 5L9XA 2ALZA 3TIGA 5KG0A 5CA0F 4A2AA 2W71A 2P0AA 4MAMA 2YS6A 5KFDA 1Z2NX 2CW8A 3MWEA 3M9MB 3MR3A 4EYIB 5KFYA 4QWCA 3PW5A 2R93A 4A3FG 4DV2H 3PO3G 1KJ9A 5BPHA 4Y8VB 3H0GG 4PWQA 3T5KA 4O4IF 4ED3A 3K5IA 2WAQA 3IG0A 5KFFA 3PR5B 4Q8FA 2Y0SA 1RJQA 3SE7A 1ZETA 1T3NA 4MV9A 3OUUA 2W7PA 1TWHA 2NU6B 2V58A 2AGOA 3NGDA 2VUMA 1S03G 4AYBA 1CE8A 4J9LA 5LP6F 4LFAH 3G6YA 4LFCH 2X0SA 2XGPA 1WCMG 2B63A 1RJRA 2NVYA 4IZOA 1VBHA 4EGQA 2DPIA 3I4MG 3N6XA 5LL6b 4BBSG 3GTMA 4YQWA 1MZBA 3H4BA 4IRKA 2XCLA 4GC7A 4Q0YA 2AGQA 4X65H 2UVUA 3G6VA 5CB4F 2J6TA 4XZ3B 4JI8H 5F9NA 3G6XA 3I4NG 4GC6A 1HNXH 3JSNA 4JI2H 3BAAA 4EEQA 4ME6A 2C2RA 3IN5A 3GTGA 1CQJB 2FPPB 2GPSA 2RGVA 1KJ8A 4RU9A 1RK6A 4I4TF 3Q8QB 3PR4A 3MR5A 1JX4A 5BMVF 2Q2TA 5DLGA 2DIKA 1WR2A 4DR3H 5LYJF 4Q43A 3HBLA 5IP7G 3QZ7A 1SFOA 3BA8A 2E2IA 3JSLA 3PW2A 5KFMA 1S68A 1B6RA 2R92G 1UC8A 3RFCA 1XNQH 5KFXA 2FE3A 2C00A 2WAQE 4TUYF 5EZYF 1O75A 1B6SA 2Y0SE 4B3RH 1ZHSA 3U9SA 5LA6F 4DV5H 2OWOA 1C30A 4HQ6A 5KFAA 4RNMA 2XC9A 1GSAA 4BBRG 5CAEB 4AYBE 2VQDA 2FLNA 2JEGA 5L1LA 5DG8A 5KFQA 5BPFA 4R7RA 2JEJA 3KALA 4LF6H 2YYAA 1BXRA 4JI4H 3FDSA 1PX2A 3MFHA 2R7MA 3N43B 4LH7A 4ETSA 1N36H 2DWCA 4I7HA 5FD6A 1N48A 4X62H 4BXXG 4JV0A 2W9CA 4F4XA 4G3IA 4A3GG 5IT9W 1IBKH 4J9NA 3MFIA 4ED8A 3ETHA 3I12A 4Q45A 2W57A 3GQCA 4B3MH 4RB0A 1B04A 2R7ZA 2ZDQA 3JZIA 4DV1H 1JIHA 5FLXW 3RUPA 1ULZA 2HJWA 4ECSA 2IMWP 1WH2A 3Q2OA 4R8UB 2R93G 3RTXA 2WTFA 3F8NA 5KFKA 4QJFA 3BJYA 5LMUH 4DV6H 5KG5A 2I8CA 2PMZA 5KG1A 3T5LA 1TWGA 4GKJH 2E5LH 4IR9A 4YB8B 4FM9A 2WDTA 1EUCB 3JRXA 5KFLA 3N40P 1BGWA 4A2BA 5KT2A 4TQSA 5F9LA 1I7NA 4A3LG 2YW2A 5I47A 3GIQA 1DGSA 5DLFA 2VUMG 2UXBH 1ZQ7A 3GIDA 4UCRA 4DL7A 2DZDA 4HNVA 3PO2G 1KC7A 4RUCA 2UUBH 2B63G 4U6PA 5FPOA 4RZQA 4ED7A 1Y1WG 4UCOA 2FK1A 2VUGA 4JV2A 4EFBA 2PVPA 5DQIA 5K2MA 3WNZA 2CW7A 2ZDGA 3OSNA 4JI3H 2W6NA 5JVDF 4HYKA 4ED0A 4LF9H 2VA2A 2VA3A 1GYFA 4LSAA 1E4EB 2RDJA 2YRWA 5KFCA 4ZI7F 5KT4A 2JA5A 2RDIA 2FP4B 2YS7A 1KJJA 4YR3A 1SCUB 4JI0H 2NUAB 1Y14B 4O3PA 2XCPA 3GILA 3H4DA 1I3QA 2RF4A 2C2DA 4C5BA 4DR5H 3CQZA 2BQ3A 4RZRA 3ETJA 3HOVG 4BY1G 2YZNA 1GGOA 3TQTA 1S10A 3BABA 3SI8A 2QYZA 2W6OA 5KT7A 5JUMA 4QWAA 3GLKA 4LF5H 4MTEA 4TV8F 5KG6A 3GIIA 1GO3E 1RYRA 2IP4A 2PMZE 2FLLA 5EDWA 2Q2UA 4I50F 2ASDA 3GIMA 1IBMH 1XMQH 2V4RA 2CQYA 2AGPA 4FBTA 1S9FA 2R6FA 4DV4H 1KJIA 1WSCA 5FJ8G 4YJ2F 4YAJB 1V9PA 2OLSA 1BNCA 5HV6A 4ECRA 1JDBB 1JDEA 4M7EA 3KHGA 5KT3A 2VQFH 2JA6A 1VBGA 2V5AA 5KFWA 3PW7A 3PVXA 4J9PA 1I7LA 3R5FA 3GIJA 3TINA 2JA7A 5KFHA 3RAXA 2J9GA 3GTJA 1RJPA 1VKZA 5KFSA 3RB3A 1IOVA 2DPJA 4ZQIA 1RK5A 5D1OB 1DV1A 3RAQA 4FBUA 4MV7A 1V4YA 5C1PA 1TAEA 3V6HA 4ZOLF 2DLNA 5KFPA 4DR6H 1Y1VA 2UXDH 4WD3A 3V6JA 4CC5A 4JV5H 2C22A 3RV3A 4IWYA 4QW8A 3GTPA 1T94A 2R7ZG 4C5CA 4O4LF 4CC6A 5KG2A 3R23A 2XGQA 4O2AF 5DGAA 4HNUA 2VR1A 3M9NB 4J9SA 4QW9A 4X66H 2AQ4A 4EGJA 2GPWA 4F50A 4O3SA 3RF2A 2W8KA 1N32H 2R8KA 3T5JA 4TV9F 1VAJA 3RB0A 3KHHA 2UVVA 4ECVA 2YZGA 4EFEA 4YR2A 2PBZA 5D8DA 3K5HA 1SEIA 3L2PA 2KSWA 1S0MA 2ZM6H 1K1SA 3HOWG 2R7NA 3GIKA 4NXMH 3MWMA 1BJTA 3KAJA 5FPRA 3AYHB 4MA5A 4O3NA 5T14A 1B33N 1FJGH 4F4WA 2O03A 4IWXA 4LF4H 2W6ZA 4DL6A 5JQWA 2WYOA 5JVLA 4QWBA 3RGZA 2R8JA 4QIWA 3QFFA 4DR4H 4EYHB 1W93A 4PDBA 3OUZA 4MTDA 3H20A 2R8HA 4ECWA 3N41B 4DR7H 3KHLA 2C28A 3Q1KA 4M9UA 4QWEA 4DL3A 2FK3A 2MCTA 2W9BA 3GTKA 4RB2C 4YAKB 2FJZA 2JA8G 3Q8PB 2R8IA 4UCSA 4A3DG 5KG7A 4DL5A 3JAMW 4J9OA 3PW0A 3TIIA 5IYBG 1N34H 4HR7A 5DQHA 2BQRA 4JI5H 3UFXB 4A3CG 2W6MA 4J0MA 1J5EH 4B3TH 2W9CB 4GLXA 4Q8EA 3N42B 1HNZH 1I6UA 2QK4A 5C1OA 2ASLA 2PN1A 4A3BG 3T1YH 3VMMA 4BWSC 1PK8A 1I50A 3OHBA 1TWFA 1TWAA 5FLMG 4EEYA 3K3VA 2NVXA 4DL2A 4YY3H 4RAZA 1N33H 5KFBA 1ZHQA 4O3OA 2JA6G 1OWTA 2SCUB 3JRWA 2JA7G 2W6QA 4MV1A 1A0IA 4QIWE 4JI1H 2R7KA 1XMOH 4UFZA 2FMAA 1T36A 2I80A 2R7LA 3KHRA 4A3IG 4C5AA 5KG4A 5KKNB 3PZPA 3ORQA 3HOYG 3C0FB 3PN1A 2ATLA 1N56A 5DGBA 2YCHA 5KT5A 4TQRA 4DR2H 2V59A 1Y1VG 4E4TA 1E4EA 5LOVF 2R82A 3J81W 4EBCA 2HVSA 1VS0A 3K3PA 1E4FT 3MJFA 2RGRA 3KTMA 3FMAA 1EYZA 2ZDHA 3TQ1A 4LF7H 4LF8H 1K1QA 1V51A 2NU8B 3VPCA 2UXCH 1FVIA 3WO0A 4ED2A 4L1KA 4O3RA 5A2QW 2NU9B 3RB6A 3Q8SB 3VPDA 3KAKA 1C3OA 4O4HF 5HBRB 1GLVA 2AU0A 5D1PA 4UCVA 2UUCH 4A3MG 1KEEA 4O2BF 4YJ3F 2YL2A 2YZMA 3MWDA 4EG0A 4DR1H 3H3VH 5KFIA 4DUZH 1KBLA 1IBLH 3FKIA 5JH7F 3G8CA 5EWEA 5KFTA 2R8GA 4RAYA 2JEFA 1TWCA 1XNRH 2BR0A 4MA0A 1EUDB 1JKJB 5C3EG 4F4ZA 4IRCA 3GV8B 4J9KA 2WB1A 1AN7A 4ECZA 5KFEA 2J6UA 3RB4A 2XD4A 3HOXG 1JLLB 3HOUG 4JUZA 5DQGA 1K83A 4YHHH 2YU9A 5IWAH 5C44G 4FS1A 2UVRA 5D1OA 5KFGA 3V4SA 3RV4A 4ZHQF 1SYXB 1S0NA 4I55F 3BA9A 4NXNH 2VPQA 2XIGA 4X64H 3HKZA 2V9WA 2VPSA 4BY7G 3LWBA 4J9RA 3UQ8A 4A93G 4A3KG 4O3QA 4Q44A 4APMA 1M6VA 5KX5F 1CQIB 4XYLB 4J9MA 1I94H 1Y1WA 2W9AA 2I87A 4MV4A 3LP8A 3Q8RB 1L2ZA 2F4VH 5IP9G 2GLTA 1A9XA 2C2EA 1E4GT 3HXLA 1M7JA 4GKKH 1CS0A 1S0OA 3OTOH 4DV0H 1W96A 5KFZA 2ZJTA 5IYCG 5IYDG 1Z2PX 4RUAA 4KHPH 3E5NA 4DUYH 4JI6H 5FD5A 1M0WA 5KT6A 5BR8H 3MR2A 4B3SH 2W7OA 5KFOA 4MV3A 4ECUA 2HVQA 3GV7B 1RYSA 2YRXA 1GSHA 4J9QA 2XCAA 3V6KA 3BQ2A 3J80W 4LH6A 2WB1E 3HOZG 2VQEH 4ECTA 4K0KH 3H0GA 5EWFA 4MV8A 4OX9H 3RJ0A 3M4IA 4YR0A 2HHHH 3R5HA 4UCTA 1JXLA 2FK2A 3DF7A 5KFUA 4FS2A 4DL4A 2JA5G 4IR1A 5LXTF 4RNOA 3T1HH 2VOBA 2HGSA 5KFJA 3QZ8A 4RNNA 3EYYA 2BQUA 1KJQA 2J6SA 3HKZE 5L1IA 5DG9A 4F4YA 4ECXA 1WCMA 4XYMB 2WE6A 1Z2OX 3PW4A 1X9NA 5GONF 4HNTA 5C5JA 4DV3H 4IHJF 3OSPA 1M0TA 3HB9A 5LMNH 4DV7H 4NLGA 3L4JA 2R84A 4R8UA 2W9BB 2CZGA 3BQ0A 4AQYH 1P8LA 1UC9A 2FPGB 4DLKA 2IA6A 4LSXA 1S97A 5EOYA 4ED1A 1IOWA 1DV2A 2FB9A 4LMYA 1HR0H 1FKAH 3FKIG 2M05A 4QWDA 3RBEA 4JYAH 2JEIA 4C2MA 2UVWA 2R85A 4UCUA 4XX0B 2ASJA 3OHAA 3VPBA 2HVRA 1AUXA 2FKLA 4U7CA 3GTOA 4LFBH 3BQ1A 3J7AK 2W70A 5IYZF 5KFRA 5L1KA 5KG3A 3CVZA 3U9TA 5KFNA 1R9TA 3ORRA 5J2UF 5EWGA 4ED6A 3RBDA 5C4XG 2IBKA 2R92A 3MR6A 5H80A 2UU9H 4YBZB 1XDNA 4A3JG 3GTLA 2OH2A 3RGXA 1EHIA 3V4ZA 3KXYT 3N8DA 5DG7A 3GV5B 2UUAH 5C8YF 5L1JA 4A3EG 2R87A
chains in the Genus database with same CATH topology
4RB0A 1B04A 1SEIA 3LMLA 3L2PA 4RB3C 2KSWA 4DV1H 4JI7H 4YHHH 5IWAH 5FLXW 2ZM6H 1HNWH 4NXMH 3MWMA 1BJTA 3KAJA 5D1OA 5FPRA 3N44B 3L4KA 4RB1A 1SYXB 4NXNH 3BA9A 1WH2A 1FJGH 2XIGA 2O03A 3RTXA 4X64H 3F8NA 4IAJA 4LF4H 4DV6H 2VPSA 5LMUH 2WYOA 4GKJH 3RGZA 3UQ8A 3RIZA 2E5LH 4DR4H 1TA8A 4APMA 4PDBA 4FM9A 2WDTA 4MTDA 3H20A 3N40P 1I94H 1BGWA 3N41B 4A2BA 4DR7H 4A2AA 1L2ZA 2F4VH 1Z2NX 1DGSA 2UXBH 2MCTA 2CW8A 1E4GT 4UCRA 4RB2C 3HXLA 4GKKH 4DV2H 2UUBH 3OTOH 4DV0H 5FPOA 4RZQA 2ZJTA 4UCOA 2VUGA 4UCSA 1Z2PX 4EFBA 4KHPH 3IG0A 3JAMW 2CW7A 4B3MH 4JI3H 4DUYH 4JI6H 5FD5A 1M0WA 4MV9A 1N34H 4LF9H 5BR8H 4JI5H 1GYFA 4LSAA 4B3SH 4J0MA 1S03G 1J5EH 2HVQA 4B3TH 4GLXA 4JI0H 3N42B 1HNZH 4LFAH 3J80W 4LH6A 4LFCH 1I6UA 4DR5H 2VQEH 4K0KH 3T1YH 4OX9H 4BWSC 3RJ0A 3M4IA 2HHHH 3N6XA 4UCTA 3BABA 3K3VA 5LL6b 3DF7A 1MZBA 4Q0YA 4YY3H 3T1HH 4RAZA 4X65H 1N33H 2VOBA 2HGSA 1ZHQA 4LF5H 3EYYA 4MTEA 4JI8H 1HNXH 3JSNA 4JI2H 3BAAA 4EEQA 4JI1H 1A0IA 2Q2UA 2WE6A 1Z2OX 4UFZA 1XMOH 1XMQH 1X9NA 1IBMH 4DV3H 1M0TA 2RGVA 5LMNH 4DV4H 4DV7H 3L4JA 3C0FB 3PN1A 2Q2TA 2YCHA 4DR2H 4DR3H 1V9PA 4AQYH 1P8LA 3J81W 2HVSA 1VS0A 4M7EA 1E4FT 4LSXA 2VQFH 5EOYA 2RGRA 3FMAA 4LF7H 4LF8H 3BA8A 3JSLA 4LMYA 1HR0H 2UXCH 1FKAH 1S68A 1FVIA 1XNQH 4JYAH 2FE3A 5D1OB 5A2QW 1O75A 4UCUA 4B3RH 2HVRA 4LFBH 1ZHSA 4DV5H 3KAKA 2OWOA 4MV7A 1TAEA 5D1PA 4UCVA 2UUCH 4DR6H 2UXDH 3J7AK 4CC5A 4JV5H 3CVZA 4DR1H 4R7RA 4CC6A 3KALA 4LF6H 4DUZH 4JI4H 1IBLH 4X66H 2UU9H 3N43B 4LH7A 4RAYA 4ETSA 1XDNA 3RF2A 1N36H 1N32H 4I7HA 5FD6A 1XNRH 4X62H 3RGXA 5IT9W 1IBKH 3KXYT 4EFEA 1AN7A 2W57A 2UUAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2Z A;  3FMA A;  1SYX B;  4BWS C;  1WH2 A;  3K3V A;  1GYF A; 
#chains in the Genus database with same CATH topology
 4YP3 A;  1UNN C;  3LML A;  4RB3 C;  3BG5 A;  4JV1 A;  2CKZ B;  4MV6 A;  2C35 B;  4ECQ A;  3R5X A;  3T5H A;  4JI7 H;  1DIK A;  2R86 A;  1HNW H;  4EBD A;  5J2T F;  3GTQ A;  4IRD A;  3M9O B;  2E2H A;  3H40 A;  3EPG A;  4ECY A;  3N44 B;  5KFV A;  3WO1 A;  4RB1 A;  2V4Q A;  3L4K A;  4WBN F;  2FLP A;  1GSO A;  2W6P A;  3EPI A;  4IAJ A;  2W8L A;  5CA1 F;  2FPI B;  1AUV A;  3RIZ A;  1TA8 A;  4EBE A;  1EZ1 A;  4FU0 A;  2NU7 B;  3GIP A;  5L9X A;  2ALZ A;  3TIG A;  5KG0 A;  5CA0 F;  4A2A A;  2W71 A;  2P0A A;  4MAM A;  2YS6 A;  5KFD A;  1Z2N X;  2CW8 A;  3MWE A;  3M9M B;  3MR3 A;  4EYI B;  5KFY A;  4QWC A;  3PW5 A;  2R93 A;  4A3F G;  4DV2 H;  3PO3 G;  1KJ9 A;  5BPH A;  4Y8V B;  3H0G G;  4PWQ A;  3T5K A;  4O4I F;  4ED3 A;  3K5I A;  2WAQ A;  3IG0 A;  5KFF A;  3PR5 B;  4Q8F A;  2Y0S A;  1RJQ A;  3SE7 A;  1ZET A;  1T3N A;  4MV9 A;  3OUU A;  2W7P A;  1TWH A;  2NU6 B;  2V58 A;  2AGO A;  3NGD A;  2VUM A;  1S03 G;  4AYB A;  1CE8 A;  4J9L A;  5LP6 F;  4LFA H;  3G6Y A;  4LFC H;  2X0S A;  2XGP A;  1WCM G;  2B63 A;  1RJR A;  2NVY A;  4IZO A;  1VBH A;  4EGQ A;  2DPI A;  3I4M G;  3N6X A;  5LL6 b;  4BBS G;  3GTM A;  4YQW A;  1MZB A;  3H4B A;  4IRK A;  2XCL A;  4GC7 A;  4Q0Y A;  2AGQ A;  4X65 H;  2UVU A;  3G6V A;  5CB4 F;  2J6T A;  4XZ3 B;  4JI8 H;  5F9N A;  3G6X A;  3I4N G;  4GC6 A;  1HNX H;  3JSN A;  4JI2 H;  3BAA A;  4EEQ A;  4ME6 A;  2C2R A;  3IN5 A;  3GTG A;  1CQJ B;  2FPP B;  2GPS A;  2RGV A;  1KJ8 A;  4RU9 A;  1RK6 A;  4I4T F;  3Q8Q B;  3PR4 A;  3MR5 A;  1JX4 A;  5BMV F;  2Q2T A;  5DLG A;  2DIK A;  1WR2 A;  4DR3 H;  5LYJ F;  4Q43 A;  3HBL A;  5IP7 G;  3QZ7 A;  1SFO A;  3BA8 A;  2E2I A;  3JSL A;  3PW2 A;  5KFM A;  1S68 A;  1B6R A;  2R92 G;  1UC8 A;  3RFC A;  1XNQ H;  5KFX A;  2FE3 A;  2C00 A;  2WAQ E;  4TUY F;  5EZY F;  1O75 A;  1B6S A;  2Y0S E;  4B3R H;  1ZHS A;  3U9S A;  5LA6 F;  4DV5 H;  2OWO A;  1C30 A;  4HQ6 A;  5KFA A;  4RNM A;  2XC9 A;  1GSA A;  4BBR G;  5CAE B;  4AYB E;  2VQD A;  2FLN A;  2JEG A;  5L1L A;  5DG8 A;  5KFQ A;  5BPF A;  4R7R A;  2JEJ A;  3KAL A;  4LF6 H;  2YYA A;  1BXR A;  4JI4 H;  3FDS A;  1PX2 A;  3MFH A;  2R7M A;  3N43 B;  4LH7 A;  4ETS A;  1N36 H;  2DWC A;  4I7H A;  5FD6 A;  1N48 A;  4X62 H;  4BXX G;  4JV0 A;  2W9C A;  4F4X A;  4G3I A;  4A3G G;  5IT9 W;  1IBK H;  4J9N A;  3MFI A;  4ED8 A;  3ETH A;  3I12 A;  4Q45 A;  2W57 A;  3GQC A;  4B3M H;  4RB0 A;  1B04 A;  2R7Z A;  2ZDQ A;  3JZI A;  4DV1 H;  1JIH A;  5FLX W;  3RUP A;  1ULZ A;  2HJW A;  4ECS A;  2IMW P;  1WH2 A;  3Q2O A;  4R8U B;  2R93 G;  3RTX A;  2WTF A;  3F8N A;  5KFK A;  4QJF A;  3BJY A;  5LMU H;  4DV6 H;  5KG5 A;  2I8C A;  2PMZ A;  5KG1 A;  3T5L A;  1TWG A;  4GKJ H;  2E5L H;  4IR9 A;  4YB8 B;  4FM9 A;  2WDT A;  1EUC B;  3JRX A;  5KFL A;  3N40 P;  1BGW A;  4A2B A;  5KT2 A;  4TQS A;  5F9L A;  1I7N A;  4A3L G;  2YW2 A;  5I47 A;  3GIQ A;  1DGS A;  5DLF A;  2VUM G;  2UXB H;  1ZQ7 A;  3GID A;  4UCR A;  4DL7 A;  2DZD A;  4HNV A;  3PO2 G;  1KC7 A;  4RUC A;  2UUB H;  2B63 G;  4U6P A;  5FPO A;  4RZQ A;  4ED7 A;  1Y1W G;  4UCO A;  2FK1 A;  2VUG A;  4JV2 A;  4EFB A;  2PVP A;  5DQI A;  5K2M A;  3WNZ A;  2CW7 A;  2ZDG A;  3OSN A;  4JI3 H;  2W6N A;  5JVD F;  4HYK A;  4ED0 A;  4LF9 H;  2VA2 A;  2VA3 A;  1GYF A;  4LSA A;  1E4E B;  2RDJ A;  2YRW A;  5KFC A;  4ZI7 F;  5KT4 A;  2JA5 A;  2RDI A;  2FP4 B;  2YS7 A;  1KJJ A;  4YR3 A;  1SCU B;  4JI0 H;  2NUA B;  1Y14 B;  4O3P A;  2XCP A;  3GIL A;  3H4D A;  1I3Q A;  2RF4 A;  2C2D A;  4C5B A;  4DR5 H;  3CQZ A;  2BQ3 A;  4RZR A;  3ETJ A;  3HOV G;  4BY1 G;  2YZN A;  1GGO A;  3TQT A;  1S10 A;  3BAB A;  3SI8 A;  2QYZ A;  2W6O A;  5KT7 A;  5JUM A;  4QWA A;  3GLK A;  4LF5 H;  4MTE A;  4TV8 F;  5KG6 A;  3GII A;  1GO3 E;  1RYR A;  2IP4 A;  2PMZ E;  2FLL A;  5EDW A;  2Q2U A;  4I50 F;  2ASD A;  3GIM A;  1IBM H;  1XMQ H;  2V4R A;  2CQY A;  2AGP A;  4FBT A;  1S9F A;  2R6F A;  4DV4 H;  1KJI A;  1WSC A;  5FJ8 G;  4YJ2 F;  4YAJ B;  1V9P A;  2OLS A;  1BNC A;  5HV6 A;  4ECR A;  1JDB B;  1JDE A;  4M7E A;  3KHG A;  5KT3 A;  2VQF H;  2JA6 A;  1VBG A;  2V5A A;  5KFW A;  3PW7 A;  3PVX A;  4J9P A;  1I7L A;  3R5F A;  3GIJ A;  3TIN A;  2JA7 A;  5KFH A;  3RAX A;  2J9G A;  3GTJ A;  1RJP A;  1VKZ A;  5KFS A;  3RB3 A;  1IOV A;  2DPJ A;  4ZQI A;  1RK5 A;  5D1O B;  1DV1 A;  3RAQ A;  4FBU A;  4MV7 A;  1V4Y A;  5C1P A;  1TAE A;  3V6H A;  4ZOL F;  2DLN A;  5KFP A;  4DR6 H;  1Y1V A;  2UXD H;  4WD3 A;  3V6J A;  4CC5 A;  4JV5 H;  2C22 A;  3RV3 A;  4IWY A;  4QW8 A;  3GTP A;  1T94 A;  2R7Z G;  4C5C A;  4O4L F;  4CC6 A;  5KG2 A;  3R23 A;  2XGQ A;  4O2A F;  5DGA A;  4HNU A;  2VR1 A;  3M9N B;  4J9S A;  4QW9 A;  4X66 H;  2AQ4 A;  4EGJ A;  2GPW A;  4F50 A;  4O3S A;  3RF2 A;  2W8K A;  1N32 H;  2R8K A;  3T5J A;  4TV9 F;  1VAJ A;  3RB0 A;  3KHH A;  2UVV A;  4ECV A;  2YZG A;  4EFE A;  4YR2 A;  2PBZ A;  5D8D A;  3K5H A;  1SEI A;  3L2P A;  2KSW A;  1S0M A;  2ZM6 H;  1K1S A;  3HOW G;  2R7N A;  3GIK A;  4NXM H;  3MWM A;  1BJT A;  3KAJ A;  5FPR A;  3AYH B;  4MA5 A;  4O3N A;  5T14 A;  1B33 N;  1FJG H;  4F4W A;  2O03 A;  4IWX A;  4LF4 H;  2W6Z A;  4DL6 A;  5JQW A;  2WYO A;  5JVL A;  4QWB A;  3RGZ A;  2R8J A;  4QIW A;  3QFF A;  4DR4 H;  4EYH B;  1W93 A;  4PDB A;  3OUZ A;  4MTD A;  3H20 A;  2R8H A;  4ECW A;  3N41 B;  4DR7 H;  3KHL A;  2C28 A;  3Q1K A;  4M9U A;  4QWE A;  4DL3 A;  2FK3 A;  2MCT A;  2W9B A;  3GTK A;  4RB2 C;  4YAK B;  2FJZ A;  2JA8 G;  3Q8P B;  2R8I A;  4UCS A;  4A3D G;  5KG7 A;  4DL5 A;  3JAM W;  4J9O A;  3PW0 A;  3TII A;  5IYB G;  1N34 H;  4HR7 A;  5DQH A;  2BQR A;  4JI5 H;  3UFX B;  4A3C G;  2W6M A;  4J0M A;  1J5E H;  4B3T H;  2W9C B;  4GLX A;  4Q8E A;  3N42 B;  1HNZ H;  1I6U A;  2QK4 A;  5C1O A;  2ASL A;  2PN1 A;  4A3B G;  3T1Y H;  3VMM A;  4BWS C;  1PK8 A;  1I50 A;  3OHB A;  1TWF A;  1TWA A;  5FLM G;  4EEY A;  3K3V A;  2NVX A;  4DL2 A;  4YY3 H;  4RAZ A;  1N33 H;  5KFB A;  1ZHQ A;  4O3O A;  2JA6 G;  1OWT A;  2SCU B;  3JRW A;  2JA7 G;  2W6Q A;  4MV1 A;  1A0I A;  4QIW E;  4JI1 H;  2R7K A;  1XMO H;  4UFZ A;  2FMA A;  1T36 A;  2I80 A;  2R7L A;  3KHR A;  4A3I G;  4C5A A;  5KG4 A;  5KKN B;  3PZP A;  3ORQ A;  3HOY G;  3C0F B;  3PN1 A;  2ATL A;  1N56 A;  5DGB A;  2YCH A;  5KT5 A;  4TQR A;  4DR2 H;  2V59 A;  1Y1V G;  4E4T A;  1E4E A;  5LOV F;  2R82 A;  3J81 W;  4EBC A;  2HVS A;  1VS0 A;  3K3P A;  1E4F T;  3MJF A;  2RGR A;  3KTM A;  3FMA A;  1EYZ A;  2ZDH A;  3TQ1 A;  4LF7 H;  4LF8 H;  1K1Q A;  1V51 A;  2NU8 B;  3VPC A;  2UXC H;  1FVI A;  3WO0 A;  4ED2 A;  4L1K A;  4O3R A;  5A2Q W;  2NU9 B;  3RB6 A;  3Q8S B;  3VPD A;  3KAK A;  1C3O A;  4O4H F;  5HBR B;  1GLV A;  2AU0 A;  5D1P A;  4UCV A;  2UUC H;  4A3M G;  1KEE A;  4O2B F;  4YJ3 F;  2YL2 A;  2YZM A;  3MWD A;  4EG0 A;  4DR1 H;  3H3V H;  5KFI A;  4DUZ H;  1KBL A;  1IBL H;  3FKI A;  5JH7 F;  3G8C A;  5EWE A;  5KFT A;  2R8G A;  4RAY A;  2JEF A;  1TWC A;  1XNR H;  2BR0 A;  4MA0 A;  1EUD B;  1JKJ B;  5C3E G;  4F4Z A;  4IRC A;  3GV8 B;  4J9K A;  2WB1 A;  1AN7 A;  4ECZ A;  5KFE A;  2J6U A;  3RB4 A;  2XD4 A;  3HOX G;  1JLL B;  3HOU G;  4JUZ A;  5DQG A;  1K83 A;  4YHH H;  2YU9 A;  5IWA H;  5C44 G;  4FS1 A;  2UVR A;  5D1O A;  5KFG A;  3V4S A;  3RV4 A;  4ZHQ F;  1SYX B;  1S0N A;  4I55 F;  3BA9 A;  4NXN H;  2VPQ A;  2XIG A;  4X64 H;  3HKZ A;  2V9W A;  2VPS A;  4BY7 G;  3LWB A;  4J9R A;  3UQ8 A;  4A93 G;  4A3K G;  4O3Q A;  4Q44 A;  4APM A;  1M6V A;  5KX5 F;  1CQI B;  4XYL B;  4J9M A;  1I94 H;  1Y1W A;  2W9A A;  2I87 A;  4MV4 A;  3LP8 A;  3Q8R B;  1L2Z A;  2F4V H;  5IP9 G;  2GLT A;  1A9X A;  2C2E A;  1E4G T;  3HXL A;  1M7J A;  4GKK H;  1CS0 A;  1S0O A;  3OTO H;  4DV0 H;  1W96 A;  5KFZ A;  2ZJT A;  5IYC G;  5IYD G;  1Z2P X;  4RUA A;  4KHP H;  3E5N A;  4DUY H;  4JI6 H;  5FD5 A;  1M0W A;  5KT6 A;  5BR8 H;  3MR2 A;  4B3S H;  2W7O A;  5KFO A;  4MV3 A;  4ECU A;  2HVQ A;  3GV7 B;  1RYS A;  2YRX A;  1GSH A;  4J9Q A;  2XCA A;  3V6K A;  3BQ2 A;  3J80 W;  4LH6 A;  2WB1 E;  3HOZ G;  2VQE H;  4ECT A;  4K0K H;  3H0G A;  5EWF A;  4MV8 A;  4OX9 H;  3RJ0 A;  3M4I A;  4YR0 A;  2HHH H;  3R5H A;  4UCT A;  1JXL A;  2FK2 A;  3DF7 A;  5KFU A;  4FS2 A;  4DL4 A;  2JA5 G;  4IR1 A;  5LXT F;  4RNO A;  3T1H H;  2VOB A;  2HGS A;  5KFJ A;  3QZ8 A;  4RNN A;  3EYY A;  2BQU A;  1KJQ A;  2J6S A;  3HKZ E;  5L1I A;  5DG9 A;  4F4Y A;  4ECX A;  1WCM A;  4XYM B;  2WE6 A;  1Z2O X;  3PW4 A;  1X9N A;  5GON F;  4HNT A;  5C5J A;  4DV3 H;  4IHJ F;  3OSP A;  1M0T A;  3HB9 A;  5LMN H;  4DV7 H;  4NLG A;  3L4J A;  2R84 A;  4R8U A;  2W9B B;  2CZG A;  3BQ0 A;  4AQY H;  1P8L A;  1UC9 A;  2FPG B;  4DLK A;  2IA6 A;  4LSX A;  1S97 A;  5EOY A;  4ED1 A;  1IOW A;  1DV2 A;  2FB9 A;  4LMY A;  1HR0 H;  1FKA H;  3FKI G;  2M05 A;  4QWD A;  3RBE A;  4JYA H;  2JEI A;  4C2M A;  2UVW A;  2R85 A;  4UCU A;  4XX0 B;  2ASJ A;  3OHA A;  3VPB A;  2HVR A;  1AUX A;  2FKL A;  4U7C A;  3GTO A;  4LFB H;  3BQ1 A;  3J7A K;  2W70 A;  5IYZ F;  5KFR A;  5L1K A;  5KG3 A;  3CVZ A;  3U9T A;  5KFN A;  1R9T A;  3ORR A;  5J2U F;  5EWG A;  4ED6 A;  3RBD A;  5C4X G;  2IBK A;  2R92 A;  3MR6 A;  5H80 A;  2UU9 H;  4YBZ B;  1XDN A;  4A3J G;  3GTL A;  2OH2 A;  3RGX A;  1EHI A;  3V4Z A;  3KXY T;  3N8D A;  5DG7 A;  3GV5 B;  2UUA H;  5C8Y F;  5L1J A;  4A3E G;  2R87 A; 
#chains in the Genus database with same CATH homology
 4RB0 A;  1B04 A;  1SEI A;  3LML A;  3L2P A;  4RB3 C;  2KSW A;  4DV1 H;  4JI7 H;  4YHH H;  5IWA H;  5FLX W;  2ZM6 H;  1HNW H;  4NXM H;  3MWM A;  1BJT A;  3KAJ A;  5D1O A;  5FPR A;  3N44 B;  3L4K A;  4RB1 A;  1SYX B;  4NXN H;  3BA9 A;  1WH2 A;  1FJG H;  2XIG A;  2O03 A;  3RTX A;  4X64 H;  3F8N A;  4IAJ A;  4LF4 H;  4DV6 H;  2VPS A;  5LMU H;  2WYO A;  4GKJ H;  3RGZ A;  3UQ8 A;  3RIZ A;  2E5L H;  4DR4 H;  1TA8 A;  4APM A;  4PDB A;  4FM9 A;  2WDT A;  4MTD A;  3H20 A;  3N40 P;  1I94 H;  1BGW A;  3N41 B;  4A2B A;  4DR7 H;  4A2A A;  1L2Z A;  2F4V H;  1Z2N X;  1DGS A;  2UXB H;  2MCT A;  2CW8 A;  1E4G T;  4UCR A;  4RB2 C;  3HXL A;  4GKK H;  4DV2 H;  2UUB H;  3OTO H;  4DV0 H;  5FPO A;  4RZQ A;  2ZJT A;  4UCO A;  2VUG A;  4UCS A;  1Z2P X;  4EFB A;  4KHP H;  3IG0 A;  3JAM W;  2CW7 A;  4B3M H;  4JI3 H;  4DUY H;  4JI6 H;  5FD5 A;  1M0W A;  4MV9 A;  1N34 H;  4LF9 H;  5BR8 H;  4JI5 H;  1GYF A;  4LSA A;  4B3S H;  4J0M A;  1S03 G;  1J5E H;  2HVQ A;  4B3T H;  4GLX A;  4JI0 H;  3N42 B;  1HNZ H;  4LFA H;  3J80 W;  4LH6 A;  4LFC H;  1I6U A;  4DR5 H;  2VQE H;  4K0K H;  3T1Y H;  4OX9 H;  4BWS C;  3RJ0 A;  3M4I A;  2HHH H;  3N6X A;  4UCT A;  3BAB A;  3K3V A;  5LL6 b;  3DF7 A;  1MZB A;  4Q0Y A;  4YY3 H;  3T1H H;  4RAZ A;  4X65 H;  1N33 H;  2VOB A;  2HGS A;  1ZHQ A;  4LF5 H;  3EYY A;  4MTE A;  4JI8 H;  1HNX H;  3JSN A;  4JI2 H;  3BAA A;  4EEQ A;  4JI1 H;  1A0I A;  2Q2U A;  2WE6 A;  1Z2O X;  4UFZ A;  1XMO H;  1XMQ H;  1X9N A;  1IBM H;  4DV3 H;  1M0T A;  2RGV A;  5LMN H;  4DV4 H;  4DV7 H;  3L4J A;  3C0F B;  3PN1 A;  2Q2T A;  2YCH A;  4DR2 H;  4DR3 H;  1V9P A;  4AQY H;  1P8L A;  3J81 W;  2HVS A;  1VS0 A;  4M7E A;  1E4F T;  4LSX A;  2VQF H;  5EOY A;  2RGR A;  3FMA A;  4LF7 H;  4LF8 H;  3BA8 A;  3JSL A;  4LMY A;  1HR0 H;  2UXC H;  1FKA H;  1S68 A;  1FVI A;  1XNQ H;  4JYA H;  2FE3 A;  5D1O B;  5A2Q W;  1O75 A;  4UCU A;  4B3R H;  2HVR A;  4LFB H;  1ZHS A;  4DV5 H;  3KAK A;  2OWO A;  4MV7 A;  1TAE A;  5D1P A;  4UCV A;  2UUC H;  4DR6 H;  2UXD H;  3J7A K;  4CC5 A;  4JV5 H;  3CVZ A;  4DR1 H;  4R7R A;  4CC6 A;  3KAL A;  4LF6 H;  4DUZ H;  4JI4 H;  1IBL H;  4X66 H;  2UU9 H;  3N43 B;  4LH7 A;  4RAY A;  4ETS A;  1XDN A;  3RF2 A;  1N36 H;  1N32 H;  4I7H A;  5FD6 A;  1XNR H;  4X62 H;  3RGX A;  5IT9 W;  1IBK H;  3KXY T;  4EFE A;  1AN7 A;  2W57 A;  2UUA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...