1GYFA

Gyf domain from human cd2bp2 protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
b'DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CYTOPLASMIC DOMAIN BINDING PROTEIN (CD2BP2))
publication title The GYF domain is a novel structural fold that is involved in lymphoid signaling through proline-rich sequences.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 9
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1999-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1gyfA00
4BWSC 1SYXB 3FMAA 3K3VA 1WH2A 1GYFA 1L2ZA
chains in the Genus database with same CATH superfamily
1FKAH 1B33N 4DV0H 2O03A 5D1PA 3VPDA 3PW4A 5BPFA 4EBEA 2C28A 3K5IA 1DV1A 2HVRA 4LFAH 1P8LA 2JEIA 2HJWA 5DG7A 2FK3A 4UCRA 5BMVF 3UQ8A 2FPIB 5JVLA 1JDBB 2W6OA 4I7HA 3M9NB 2AGPA 4MA0A 1MZBA 3GTOA 1IOVA 4MV8A 4DL3A 2CW8A 1Y1WA 5DG9A 2ZJTA 3T5HA 3C0FB 2R93G 1V51A 4DV2H 3BQ2A 4LH7A 3TQTA 3V6KA 5KFCA 4AYBA 2V59A 2ASJA 4IRCA 4QIWE 3Q2OA 1ZQ7A 4YR2A 3V4ZA 3G6VA 3Q8SB 3RF2A 1XMOH 3H0GA 3Q8RB 3RV3A 2V9WA 3MWMA 4JV0A 3GIDA 5EDWA 1A0IA 4QW8A 5FD5A 1UNNC 2AU0A 1DIKA 2E5LH 4Q8FA 4C5BA 2QK4A 2ATLA 4FBTA 4JI6H 1Y14B 1SYXB 1Y1VG 5F9NA 2OLSA 1T94A 5KT6A 2QYZA 1WSCA 4QWBA 5KG3A 2NU8B 3MWEA 4DUZH 4UCVA 2IA6A 2YS6A 1JKJB 2GLTA 3K3VA 3CQZA 5KFTA 4RZRA 4YY3H 3GTGA 2R7LA 4FBUA 4EGJA 2UUBH 2V58A 3HXLA 4DR4H 2R6FA 3WO0A 4XYLB 1KJ9A 4RNMA 4LF9H 3I4MG 1RJQA 3OSNA 1S9FA 4A93G 3MR5A 2W6NA 2FK1A 4C2MA 2W6QA 3OUZA 4IAJA 2Q2UA 4ECZA 4O3NA 4HNUA 1M6VA 4UFZA 3KHLA 4ED3A 5KG0A 3RUPA 3ORRA 4AYBE 2R87A 1VS0A 3PR4A 5KFHA 1XNQH 2UXDH 1N48A 4Q45A 2R85A 1Z2NX 2XCLA 4BBRG 4OX9H 3BA9A 4APMA 2AGOA 2FB9A 4UCSA 4RUCA 2C2DA 4B3TH 2W9AA 1I7LA 5C44G 1XMQH 1VBHA 4MV3A 4QW9A 2WAQE 5L1IA 1V9PA 1EYZA 4JI1H 3R5HA 4A3CG 1BXRA 2ZDHA 3UFXB 2XD4A 2JA6G 1TA8A 5KX5F 2UVVA 1S97A 2DIKA 3Q1KA 5KFOA 2FJZA 3G8CA 4EEYA 1KJQA 4ECVA 2W70A 1GO3E 5JH7F 3RGXA 1CS0A 3T5JA 4J9PA 3HKZA 2B63G 4ECUA 4M7EA 3L4JA 4J9SA 2W7OA 2AGQA 4BWSC 4DL6A 3L2PA 2YU9A 3I4NG 1N34H 1S68A 4XYMB 4EBCA 4QWDA 4B3SH 4DL2A 2DPJA 1WCMA 1RJPA 4A2AA 3KHRA 2YW2A 1PK8A 4R8UA 4CC6A 4GLXA 1S0OA 2R7ZG 1GSAA 1V4YA 3IG0A 3M4IA 1TWGA 2DWCA 4B3MH 3K5HA 3CVZA 2V5AA 4YAKB 1GSOA 1A9XA 2Y0SA 4U6PA 3GIKA 2JEJA 2V4RA 2E2HA 4IR1A 5EWGA 5JUMA 4F50A 4BY7G 2C22A 2R7NA 4IWYA 3JSNA 4F4YA 4I4TF 3J81W 4YJ2F 4DR2H 2NVXA 3U9TA 3H4DA 4MAMA 1RYRA 5T14A 3T5KA 4EYHB 4IR9A 1WR2A 2W6ZA 1EZ1A 1TWHA 2W9BB 4C5CA 5KFMA 5KFWA 5CA1F 2J6UA 2ASDA 4GKJH 1E4GT 5J2TF 4O3SA 3K3PA 4YB8B 5C5JA 3QFFA 4IWXA 1AUVA 5H80A 5KFPA 2C35B 2R86A 5FLMG 3T5LA 1T36A 4X62H 2ZDGA 3H4BA 5D1OB 1CQIB 5KG6A 5D8DA 4Q8EA 3GTJA 3AYHB 4IHJF 1RK5A 3RB0A 4WD3A 3PO3G 1I94H 2X0SA 3R5FA 2YZMA 3G6XA 2FPPB 4O4IF 3OHBA 3RJ0A 2JA5A 5CA0F 5KFFA 3N8DA 5KT7A 4DL7A 4U7CA 1T3NA 4NXMH 5C8YF 2Y0SE 2WTFA 3PO2G 4O2BF 3GV5B 3BJYA 4ED0A 5FPOA 3MFIA 5KFGA 3MFHA 4MV6A 4O3OA 3QZ8A 1CE8A 4TUYF 4AQYH 4TV8F 3FMAA 1E4EB 3L4KA 1N56A 2DZDA 1GSHA 3SE7A 3Q8PB 4DV7H 5KFXA 4YHHH 1OWTA 3J80W 1ZETA 4IZOA 1IBLH 4ED1A 4O2AF 1EUCB 1SCUB 2Q2TA 4J0MA 4EYIB 5A2QW 2OWOA 3GV7B 2ALZA 4GC7A 2WAQA 2JA6A 1ZHQA 2BQRA 2RGVA 2W6MA 4ECQA 5C1OA 3BABA 4ECTA 4ZOLF 1K1SA 2XIGA 2KSWA 5KFYA 3PN1A 3T1HH 2YRWA 5GONF 3BQ0A 3N6XA 4O3QA 3LWBA 5IYBG 3BA8A 2UXBH 3ETJA 1M0WA 4I55F 1HR0H 2IMWP 2V4QA 1SFOA 4A3LG 4RB2C 3KAJA 4LFCH 2F4VH 3RB6A 2NU7B 3RTXA 5DGAA 5JVDF 1HNWH 2R84A 4X66H 3RV4A 3OHAA 4X64H 4JI5H 4DV5H 1TWAA 1RK6A 3T1YH 3VMMA 1KJ8A 2YYAA 1CQJB 3N44B 2FP4B 5EWFA 5F9LA 4JI4H 5J2UF 3FKIG 1S0MA 1TWFA 2W57A 3FDSA 4ECSA 1B04A 3GIQA 4YP3A 4J9NA 4O3RA 3EPGA 3KHHA 3I12A 4UCUA 3KAKA 3VPCA 5IP7G 4FS2A 2YCHA 1VKZA 2R7KA 2ZDQA 5EOYA 3RAQA 4YAJB 3RAXA 2E2IA 4J9KA 4UCTA 2YL2A 4JI3H 5LMUH 4QWCA 4FS1A 3HOUG 2I87A 3N40P 2W9CB 1ZHSA 1E4FT 5JQWA 4A3FG 4O3PA 5KT3A 1R9TA 3ETHA 4ED7A 4MTDA 5KG4A 5DLGA 4O4HF 4BY1G 1VAJA 5KFQA 1K83A 2PBZA 2NU9B 5KKNB 3RB4A 1XNRH 1B6RA 4ECYA 3JSLA 1M7JA 4UCOA 5KFSA 3QZ7A 2UU9H 2CZGA 3J7AK 2VUMG 2VR1A 3JRXA 5I47A 1BNCA 5KT2A 1AUXA 4R7RA 3GILA 5C3EG 2FLLA 4GC6A 4JV1A 1KJJA 5BPHA 3NGDA 4RAYA 5C4XG 1N32H 2WDTA 2GPWA 2YZGA 2VPQA 2RGRA 3PVXA 5LOVF 1EUDB 5L1KA 1W93A 3EPIA 2RDJA 3SI8A 5FJ8G 1HNZH 5DQIA 4A3MG 3G6YA 3HOWG 2R92G 1X9NA 4DV3H 2R93A 1L2ZA 5IYDG 2XGPA 2JA7G 2FK2A 2W6PA 5LYJF 3N41B 3KALA 2XCAA 2BR0A 4MV7A 3GQCA 4DR1H 4DV4H 2VUGA 2YS7A 4JI2H 4J9LA 4DL5A 2GPSA 4TQRA 3MR2A 3GLKA 2BQ3A 3V6HA 1EHIA 4MV4A 2UVUA 2I80A 3KHGA 3OSPA 1W96A 3N42B 5BR8H 2C2EA 2IP4A 4DLKA 4DUYH 4ECXA 4EBDA 1RYSA 1UC8A 3GTMA 1Y1VA 3TIIA 5L9XA 5LMNH 3HB9A 1JLLB 2DLNA 4RNOA 4G3IA 4RB1A 4A2BA 2CW7A 2R8JA 1BJTA 4IRKA 3M9OB 4ED6A 2RDIA 3TINA 1ULZA 4DV1H 3BG5A 3H20A 4YR3A 3GTQA 3RGZA 3BAAA 4Q44A 2FLNA 5L1LA 2UVRA 3HOVG 2WB1A 3V4SA 2XC9A 1GYFA 2VA2A 4QWEA 4IRDA 3IN5A 3GIIA 2OH2A 4YJ3F 2WE6A 3PZPA 2YRXA 3ORQA 4LH6A 4EG0A 4B3RH 3TQ1A 2VQFH 2W8KA 4F4XA 4JI8H 3GTLA 2JA8G 1O75A 1Z2PX 5IT9W 4ZI7F 4RZQA 2J6SA 3MR3A 5FLXW 1M0TA 5KFAA 5KFVA 1WCMG 4ED8A 4KHPH 4A3JG 4GKKH 3MWDA 4DR6H 4CC5A 5CB4F 4RUAA 3JAMW 2ASLA 3HOYG 4K0KH 2SCUB 4TV9F 5IYCG 4A3DG 2W9BA 4WBNF 4LF6H 1N36H 2J9GA 2PMZA 3GIPA 5LP6F 1BGWA 5CAEB 5KT4A 1S03G 1DGSA 3E5NA 4JUZA 4ETSA 1I3QA 4XX0B 4J9OA 2M05A 2IBKA 2BQUA 4JI0H 1TWCA 4E4TA 2WB1E 2HVSA 1RJRA 1KC7A 2XGQA 5D1OA 4NLGA 2VUMA 2B63A 3N43B 4ME6A 3RBDA 4A3EG 4RNNA 1WH2A 1GLVA 4A3KG 4X65H 4RB3C 1VBGA 3EYYA 5DQGA 3GIMA 2XCPA 4Q43A 4PDBA 1C30A 5DLFA 5DGBA 3HOZG 4DR3H 2CQYA 5LXTF 3TIGA 2R7ZA 1PX2A 4DL4A 4LSXA 5KFJA 5KG1A 3WNZA 4RU9A 4DR7H 2R92A 1S0NA 3JZIA 1KBLA 1DV2A 2I8CA 4ZHQF 2PVPA 1AN7A 2CKZB 5KFDA 2W7PA 2UUAH 5DQHA 3M9MB 2R8GA 1S10A 2JA7A 3PW7A 4LMYA 1E4EA 4R8UB 2JA5G 4YBZB 4A3IG 3PW5A 4QJFA 5KG5A 5L1JA 1JIHA 1IOWA 1I6UA 1K1QA 2ZM6H 5KFRA 4BBSG 4I50F 3MR6A 2PMZE 2C2RA 4QWAA 5KFBA 1Y1WG 1C3OA 4F4ZA 2R7MA 4J9MA 1KJIA 3PR5B 4LF8H 4MTEA 3HOXG 2HVQA 4RB0A 3DF7A 1FVIA 3JRWA 5LL6b 3F8NA 4EFBA 2NVYA 4JYAH 2NU6B 5IWAH 3GIJA 4HNVA 1IBMH 1KEEA 2UUCH 2VA3A 3H3VH 1HNXH 5DG8A 3R23A 2R8IA 2VOBA 3H0GG 5IP9G 2J6TA 5EWEA 3PW0A 5KG2A 4MA5A 4HYKA 2UXCH 2AQ4A 2FKLA 3GTKA 4XZ3B 4LFBH 2WYOA 4EGQA 4YQWA 2FPGB 2FE3A 4NXNH 1TAEA 5HV6A 4HQ6A 4A3BG 5EZYF 3KTMA 3U9SA 3PW2A 5KFIA 1GGOA 1SEIA 4LF5H 3OUUA 5KFNA 4JV5H 3GTPA 5KFZA 3RFCA 4LF4H 4HR7A 5KG7A 4ED2A 2JEFA 1I7NA 2FLPA 3BQ1A 5K2MA 1UC9A 3H40A 4LF7H 1FJGH 4A3GG 2RF4A 2VPSA 2HHHH 4ECWA 3VPBA 5FD6A 4J9QA 2W8LA 2VQEH 4Y8VB 4RAZA 1IBKH 2P0AA 4J9RA 1B6SA 4M9UA 3RIZA 4ZQIA 3LMLA 2NUAB 4EEQA 3GV8B 1JXLA 2JEGA 2W9CA 2PN1A 4TQSA 3WO1A 3MJFA 5KT5A 2W71A 4C5AA 5KFKA 2HGSA 4JI7H 3KXYT 4MV9A 5LA6F 5KFLA 3Q8QB 2R8HA 5FPRA 3LP8A 1JX4A 5IYZF 3HBLA 4L1KA 3RBEA 5C1PA 3RB3A 1JDEA 3V6JA 1XDNA 4LSAA 4HNTA 4FU0A 4ECRA 4JV2A 2C00A 2FMAA 2R8KA 4EFEA 1I50A 4DR5H 4FM9A 4QIWA 2MCTA 5KFEA 2VQDA 3OTOH 4DV6H 1Z2OX 5KFUA 2YZNA 2R82A 4Q0YA 4O4LF 1N33H 4YR0A 4PWQA 4F4WA 3HKZE 4BXXG 2UVWA 1J5EH 3R5XA 3FKIA 5HBRB 2DPIA 4MV1A
chains in the Genus database with same CATH topology
1FKAH 4DV0H 2O03A 5D1PA 4MTDA 1WH2A 4X65H 4RB3C 3EYYA 2HVRA 4LFAH 1P8LA 4PDBA 3JSNA 4UCRA 3UQ8A 4DR3H 1XNRH 3JSLA 4UCOA 3J81W 3J7AK 4I7HA 4DR2H 2UU9H 4LSXA 1MZBA 2CW8A 4R7RA 4DR7H 2ZJTA 3C0FB 4DV2H 1AN7A 2UUAH 1E4GT 4GKJH 4LH7A 4RAYA 1N32H 4LMYA 2WDTA 2RGRA 4X62H 1I6UA 5D1OB 2ZM6H 1HNZH 3RF2A 1XMOH 1X9NA 3MWMA 4DV3H 4MTEA 4LF8H 2HVQA 1A0IA 4RB0A 3DF7A 5FD5A 1FVIA 2E5LH 5LL6b 1I94H 1L2ZA 3N41B 3F8NA 3KALA 4JI6H 4EFBA 1SYXB 4JYAH 4MV7A 4DR1H 3RJ0A 2VUGA 4JI2H 4DV4H 5IWAH 1IBMH 4NXMH 2UUCH 4DUZH 4UCVA 1HNXH 2VOBA 3K3VA 5FPOA 3N42B 5BR8H 4YY3H 2UXCH 4LFBH 2WYOA 4DUYH 4AQYH 2UUBH 2FE3A 3HXLA 3FMAA 4NXNH 1TAEA 4DR4H 3L4KA 5LMNH 4LF9H 4DV7H 4YHHH 4RB1A 4A2BA 2CW7A 1BJTA 1SEIA 3J80W 4LF5H 1IBLH 2Q2UA 4IAJA 4JV5H 4DV1H 3H20A 4UFZA 4LF4H 3RGZA 3BAAA 2Q2TA 4J0MA 5A2QW 2OWOA 4LF7H 1ZHQA 1FJGH 1GYFA 2VPSA 2RGVA 1VS0A 2HHHH 3BABA 1XNQH 5FD6A 2UXDH 2VQEH 2XIGA 1Z2NX 2KSWA 4RAZA 3PN1A 1IBKH 3T1HH 4OX9H 3BA9A 3N6XA 4APMA 4B3TH 4UCSA 2WE6A 3BA8A 2UXBH 3RIZA 4EEQA 3LMLA 1XMQH 1M0WA 1HR0H 4JI1H 4LH6A 1V9PA 4B3RH 4RB2C 2VQFH 3KAJA 4LFCH 2F4VH 1TA8A 4JI8H 2HGSA 1Z2PX 1O75A 3KXYT 4MV9A 3RTXA 4RZQA 4JI7H 5IT9W 5FLXW 1HNWH 4X66H 5FPRA 4JI5H 4X64H 1M0TA 4DV5H 3T1YH 4KHPH 4GKKH 3N44B 4DR6H 4CC5A 4JI4H 3JAMW 3RGXA 1XDNA 4LSAA 4K0KH 2W57A 4M7EA 4EFEA 1B04A 4FM9A 3L4JA 4DR5H 2MCTA 4BWSC 3L2PA 4UCUA 3KAKA 1N34H 1N36H 1S68A 3OTOH 2YCHA 4LF6H 1BGWA 4DV6H 5EOYA 1S03G 1Z2OX 4B3SH 1DGSA 4UCTA 4ETSA 4JI3H 4A2AA 5LMUH 4Q0YA 1N33H 4GLXA 4CC6A 4JI0H 1J5EH 3N40P 2HVSA 1ZHSA 1E4FT 3IG0A 3M4IA 5D1OA 4B3MH 3N43B 3CVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWS C;  1SYX B;  3FMA A;  3K3V A;  1WH2 A;  1GYF A;  1L2Z A; 
#chains in the Genus database with same CATH topology
 1FKA H;  1B33 N;  4DV0 H;  2O03 A;  5D1P A;  3VPD A;  3PW4 A;  5BPF A;  4EBE A;  2C28 A;  3K5I A;  1DV1 A;  2HVR A;  4LFA H;  1P8L A;  2JEI A;  2HJW A;  5DG7 A;  2FK3 A;  4UCR A;  5BMV F;  3UQ8 A;  2FPI B;  5JVL A;  1JDB B;  2W6O A;  4I7H A;  3M9N B;  2AGP A;  4MA0 A;  1MZB A;  3GTO A;  1IOV A;  4MV8 A;  4DL3 A;  2CW8 A;  1Y1W A;  5DG9 A;  2ZJT A;  3T5H A;  3C0F B;  2R93 G;  1V51 A;  4DV2 H;  3BQ2 A;  4LH7 A;  3TQT A;  3V6K A;  5KFC A;  4AYB A;  2V59 A;  2ASJ A;  4IRC A;  4QIW E;  3Q2O A;  1ZQ7 A;  4YR2 A;  3V4Z A;  3G6V A;  3Q8S B;  3RF2 A;  1XMO H;  3H0G A;  3Q8R B;  3RV3 A;  2V9W A;  3MWM A;  4JV0 A;  3GID A;  5EDW A;  1A0I A;  4QW8 A;  5FD5 A;  1UNN C;  2AU0 A;  1DIK A;  2E5L H;  4Q8F A;  4C5B A;  2QK4 A;  2ATL A;  4FBT A;  4JI6 H;  1Y14 B;  1SYX B;  1Y1V G;  5F9N A;  2OLS A;  1T94 A;  5KT6 A;  2QYZ A;  1WSC A;  4QWB A;  5KG3 A;  2NU8 B;  3MWE A;  4DUZ H;  4UCV A;  2IA6 A;  2YS6 A;  1JKJ B;  2GLT A;  3K3V A;  3CQZ A;  5KFT A;  4RZR A;  4YY3 H;  3GTG A;  2R7L A;  4FBU A;  4EGJ A;  2UUB H;  2V58 A;  3HXL A;  4DR4 H;  2R6F A;  3WO0 A;  4XYL B;  1KJ9 A;  4RNM A;  4LF9 H;  3I4M G;  1RJQ A;  3OSN A;  1S9F A;  4A93 G;  3MR5 A;  2W6N A;  2FK1 A;  4C2M A;  2W6Q A;  3OUZ A;  4IAJ A;  2Q2U A;  4ECZ A;  4O3N A;  4HNU A;  1M6V A;  4UFZ A;  3KHL A;  4ED3 A;  5KG0 A;  3RUP A;  3ORR A;  4AYB E;  2R87 A;  1VS0 A;  3PR4 A;  5KFH A;  1XNQ H;  2UXD H;  1N48 A;  4Q45 A;  2R85 A;  1Z2N X;  2XCL A;  4BBR G;  4OX9 H;  3BA9 A;  4APM A;  2AGO A;  2FB9 A;  4UCS A;  4RUC A;  2C2D A;  4B3T H;  2W9A A;  1I7L A;  5C44 G;  1XMQ H;  1VBH A;  4MV3 A;  4QW9 A;  2WAQ E;  5L1I A;  1V9P A;  1EYZ A;  4JI1 H;  3R5H A;  4A3C G;  1BXR A;  2ZDH A;  3UFX B;  2XD4 A;  2JA6 G;  1TA8 A;  5KX5 F;  2UVV A;  1S97 A;  2DIK A;  3Q1K A;  5KFO A;  2FJZ A;  3G8C A;  4EEY A;  1KJQ A;  4ECV A;  2W70 A;  1GO3 E;  5JH7 F;  3RGX A;  1CS0 A;  3T5J A;  4J9P A;  3HKZ A;  2B63 G;  4ECU A;  4M7E A;  3L4J A;  4J9S A;  2W7O A;  2AGQ A;  4BWS C;  4DL6 A;  3L2P A;  2YU9 A;  3I4N G;  1N34 H;  1S68 A;  4XYM B;  4EBC A;  4QWD A;  4B3S H;  4DL2 A;  2DPJ A;  1WCM A;  1RJP A;  4A2A A;  3KHR A;  2YW2 A;  1PK8 A;  4R8U A;  4CC6 A;  4GLX A;  1S0O A;  2R7Z G;  1GSA A;  1V4Y A;  3IG0 A;  3M4I A;  1TWG A;  2DWC A;  4B3M H;  3K5H A;  3CVZ A;  2V5A A;  4YAK B;  1GSO A;  1A9X A;  2Y0S A;  4U6P A;  3GIK A;  2JEJ A;  2V4R A;  2E2H A;  4IR1 A;  5EWG A;  5JUM A;  4F50 A;  4BY7 G;  2C22 A;  2R7N A;  4IWY A;  3JSN A;  4F4Y A;  4I4T F;  3J81 W;  4YJ2 F;  4DR2 H;  2NVX A;  3U9T A;  3H4D A;  4MAM A;  1RYR A;  5T14 A;  3T5K A;  4EYH B;  4IR9 A;  1WR2 A;  2W6Z A;  1EZ1 A;  1TWH A;  2W9B B;  4C5C A;  5KFM A;  5KFW A;  5CA1 F;  2J6U A;  2ASD A;  4GKJ H;  1E4G T;  5J2T F;  4O3S A;  3K3P A;  4YB8 B;  5C5J A;  3QFF A;  4IWX A;  1AUV A;  5H80 A;  5KFP A;  2C35 B;  2R86 A;  5FLM G;  3T5L A;  1T36 A;  4X62 H;  2ZDG A;  3H4B A;  5D1O B;  1CQI B;  5KG6 A;  5D8D A;  4Q8E A;  3GTJ A;  3AYH B;  4IHJ F;  1RK5 A;  3RB0 A;  4WD3 A;  3PO3 G;  1I94 H;  2X0S A;  3R5F A;  2YZM A;  3G6X A;  2FPP B;  4O4I F;  3OHB A;  3RJ0 A;  2JA5 A;  5CA0 F;  5KFF A;  3N8D A;  5KT7 A;  4DL7 A;  4U7C A;  1T3N A;  4NXM H;  5C8Y F;  2Y0S E;  2WTF A;  3PO2 G;  4O2B F;  3GV5 B;  3BJY A;  4ED0 A;  5FPO A;  3MFI A;  5KFG A;  3MFH A;  4MV6 A;  4O3O A;  3QZ8 A;  1CE8 A;  4TUY F;  4AQY H;  4TV8 F;  3FMA A;  1E4E B;  3L4K A;  1N56 A;  2DZD A;  1GSH A;  3SE7 A;  3Q8P B;  4DV7 H;  5KFX A;  4YHH H;  1OWT A;  3J80 W;  1ZET A;  4IZO A;  1IBL H;  4ED1 A;  4O2A F;  1EUC B;  1SCU B;  2Q2T A;  4J0M A;  4EYI B;  5A2Q W;  2OWO A;  3GV7 B;  2ALZ A;  4GC7 A;  2WAQ A;  2JA6 A;  1ZHQ A;  2BQR A;  2RGV A;  2W6M A;  4ECQ A;  5C1O A;  3BAB A;  4ECT A;  4ZOL F;  1K1S A;  2XIG A;  2KSW A;  5KFY A;  3PN1 A;  3T1H H;  2YRW A;  5GON F;  3BQ0 A;  3N6X A;  4O3Q A;  3LWB A;  5IYB G;  3BA8 A;  2UXB H;  3ETJ A;  1M0W A;  4I55 F;  1HR0 H;  2IMW P;  2V4Q A;  1SFO A;  4A3L G;  4RB2 C;  3KAJ A;  4LFC H;  2F4V H;  3RB6 A;  2NU7 B;  3RTX A;  5DGA A;  5JVD F;  1HNW H;  2R84 A;  4X66 H;  3RV4 A;  3OHA A;  4X64 H;  4JI5 H;  4DV5 H;  1TWA A;  1RK6 A;  3T1Y H;  3VMM A;  1KJ8 A;  2YYA A;  1CQJ B;  3N44 B;  2FP4 B;  5EWF A;  5F9L A;  4JI4 H;  5J2U F;  3FKI G;  1S0M A;  1TWF A;  2W57 A;  3FDS A;  4ECS A;  1B04 A;  3GIQ A;  4YP3 A;  4J9N A;  4O3R A;  3EPG A;  3KHH A;  3I12 A;  4UCU A;  3KAK A;  3VPC A;  5IP7 G;  4FS2 A;  2YCH A;  1VKZ A;  2R7K A;  2ZDQ A;  5EOY A;  3RAQ A;  4YAJ B;  3RAX A;  2E2I A;  4J9K A;  4UCT A;  2YL2 A;  4JI3 H;  5LMU H;  4QWC A;  4FS1 A;  3HOU G;  2I87 A;  3N40 P;  2W9C B;  1ZHS A;  1E4F T;  5JQW A;  4A3F G;  4O3P A;  5KT3 A;  1R9T A;  3ETH A;  4ED7 A;  4MTD A;  5KG4 A;  5DLG A;  4O4H F;  4BY1 G;  1VAJ A;  5KFQ A;  1K83 A;  2PBZ A;  2NU9 B;  5KKN B;  3RB4 A;  1XNR H;  1B6R A;  4ECY A;  3JSL A;  1M7J A;  4UCO A;  5KFS A;  3QZ7 A;  2UU9 H;  2CZG A;  3J7A K;  2VUM G;  2VR1 A;  3JRX A;  5I47 A;  1BNC A;  5KT2 A;  1AUX A;  4R7R A;  3GIL A;  5C3E G;  2FLL A;  4GC6 A;  4JV1 A;  1KJJ A;  5BPH A;  3NGD A;  4RAY A;  5C4X G;  1N32 H;  2WDT A;  2GPW A;  2YZG A;  2VPQ A;  2RGR A;  3PVX A;  5LOV F;  1EUD B;  5L1K A;  1W93 A;  3EPI A;  2RDJ A;  3SI8 A;  5FJ8 G;  1HNZ H;  5DQI A;  4A3M G;  3G6Y A;  3HOW G;  2R92 G;  1X9N A;  4DV3 H;  2R93 A;  1L2Z A;  5IYD G;  2XGP A;  2JA7 G;  2FK2 A;  2W6P A;  5LYJ F;  3N41 B;  3KAL A;  2XCA A;  2BR0 A;  4MV7 A;  3GQC A;  4DR1 H;  4DV4 H;  2VUG A;  2YS7 A;  4JI2 H;  4J9L A;  4DL5 A;  2GPS A;  4TQR A;  3MR2 A;  3GLK A;  2BQ3 A;  3V6H A;  1EHI A;  4MV4 A;  2UVU A;  2I80 A;  3KHG A;  3OSP A;  1W96 A;  3N42 B;  5BR8 H;  2C2E A;  2IP4 A;  4DLK A;  4DUY H;  4ECX A;  4EBD A;  1RYS A;  1UC8 A;  3GTM A;  1Y1V A;  3TII A;  5L9X A;  5LMN H;  3HB9 A;  1JLL B;  2DLN A;  4RNO A;  4G3I A;  4RB1 A;  4A2B A;  2CW7 A;  2R8J A;  1BJT A;  4IRK A;  3M9O B;  4ED6 A;  2RDI A;  3TIN A;  1ULZ A;  4DV1 H;  3BG5 A;  3H20 A;  4YR3 A;  3GTQ A;  3RGZ A;  3BAA A;  4Q44 A;  2FLN A;  5L1L A;  2UVR A;  3HOV G;  2WB1 A;  3V4S A;  2XC9 A;  1GYF A;  2VA2 A;  4QWE A;  4IRD A;  3IN5 A;  3GII A;  2OH2 A;  4YJ3 F;  2WE6 A;  3PZP A;  2YRX A;  3ORQ A;  4LH6 A;  4EG0 A;  4B3R H;  3TQ1 A;  2VQF H;  2W8K A;  4F4X A;  4JI8 H;  3GTL A;  2JA8 G;  1O75 A;  1Z2P X;  5IT9 W;  4ZI7 F;  4RZQ A;  2J6S A;  3MR3 A;  5FLX W;  1M0T A;  5KFA A;  5KFV A;  1WCM G;  4ED8 A;  4KHP H;  4A3J G;  4GKK H;  3MWD A;  4DR6 H;  4CC5 A;  5CB4 F;  4RUA A;  3JAM W;  2ASL A;  3HOY G;  4K0K H;  2SCU B;  4TV9 F;  5IYC G;  4A3D G;  2W9B A;  4WBN F;  4LF6 H;  1N36 H;  2J9G A;  2PMZ A;  3GIP A;  5LP6 F;  1BGW A;  5CAE B;  5KT4 A;  1S03 G;  1DGS A;  3E5N A;  4JUZ A;  4ETS A;  1I3Q A;  4XX0 B;  4J9O A;  2M05 A;  2IBK A;  2BQU A;  4JI0 H;  1TWC A;  4E4T A;  2WB1 E;  2HVS A;  1RJR A;  1KC7 A;  2XGQ A;  5D1O A;  4NLG A;  2VUM A;  2B63 A;  3N43 B;  4ME6 A;  3RBD A;  4A3E G;  4RNN A;  1WH2 A;  1GLV A;  4A3K G;  4X65 H;  4RB3 C;  1VBG A;  3EYY A;  5DQG A;  3GIM A;  2XCP A;  4Q43 A;  4PDB A;  1C30 A;  5DLF A;  5DGB A;  3HOZ G;  4DR3 H;  2CQY A;  5LXT F;  3TIG A;  2R7Z A;  1PX2 A;  4DL4 A;  4LSX A;  5KFJ A;  5KG1 A;  3WNZ A;  4RU9 A;  4DR7 H;  2R92 A;  1S0N A;  3JZI A;  1KBL A;  1DV2 A;  2I8C A;  4ZHQ F;  2PVP A;  1AN7 A;  2CKZ B;  5KFD A;  2W7P A;  2UUA H;  5DQH A;  3M9M B;  2R8G A;  1S10 A;  2JA7 A;  3PW7 A;  4LMY A;  1E4E A;  4R8U B;  2JA5 G;  4YBZ B;  4A3I G;  3PW5 A;  4QJF A;  5KG5 A;  5L1J A;  1JIH A;  1IOW A;  1I6U A;  1K1Q A;  2ZM6 H;  5KFR A;  4BBS G;  4I50 F;  3MR6 A;  2PMZ E;  2C2R A;  4QWA A;  5KFB A;  1Y1W G;  1C3O A;  4F4Z A;  2R7M A;  4J9M A;  1KJI A;  3PR5 B;  4LF8 H;  4MTE A;  3HOX G;  2HVQ A;  4RB0 A;  3DF7 A;  1FVI A;  3JRW A;  5LL6 b;  3F8N A;  4EFB A;  2NVY A;  4JYA H;  2NU6 B;  5IWA H;  3GIJ A;  4HNV A;  1IBM H;  1KEE A;  2UUC H;  2VA3 A;  3H3V H;  1HNX H;  5DG8 A;  3R23 A;  2R8I A;  2VOB A;  3H0G G;  5IP9 G;  2J6T A;  5EWE A;  3PW0 A;  5KG2 A;  4MA5 A;  4HYK A;  2UXC H;  2AQ4 A;  2FKL A;  3GTK A;  4XZ3 B;  4LFB H;  2WYO A;  4EGQ A;  4YQW A;  2FPG B;  2FE3 A;  4NXN H;  1TAE A;  5HV6 A;  4HQ6 A;  4A3B G;  5EZY F;  3KTM A;  3U9S A;  3PW2 A;  5KFI A;  1GGO A;  1SEI A;  4LF5 H;  3OUU A;  5KFN A;  4JV5 H;  3GTP A;  5KFZ A;  3RFC A;  4LF4 H;  4HR7 A;  5KG7 A;  4ED2 A;  2JEF A;  1I7N A;  2FLP A;  3BQ1 A;  5K2M A;  1UC9 A;  3H40 A;  4LF7 H;  1FJG H;  4A3G G;  2RF4 A;  2VPS A;  2HHH H;  4ECW A;  3VPB A;  5FD6 A;  4J9Q A;  2W8L A;  2VQE H;  4Y8V B;  4RAZ A;  1IBK H;  2P0A A;  4J9R A;  1B6S A;  4M9U A;  3RIZ A;  4ZQI A;  3LML A;  2NUA B;  4EEQ A;  3GV8 B;  1JXL A;  2JEG A;  2W9C A;  2PN1 A;  4TQS A;  3WO1 A;  3MJF A;  5KT5 A;  2W71 A;  4C5A A;  5KFK A;  2HGS A;  4JI7 H;  3KXY T;  4MV9 A;  5LA6 F;  5KFL A;  3Q8Q B;  2R8H A;  5FPR A;  3LP8 A;  1JX4 A;  5IYZ F;  3HBL A;  4L1K A;  3RBE A;  5C1P A;  3RB3 A;  1JDE A;  3V6J A;  1XDN A;  4LSA A;  4HNT A;  4FU0 A;  4ECR A;  4JV2 A;  2C00 A;  2FMA A;  2R8K A;  4EFE A;  1I50 A;  4DR5 H;  4FM9 A;  4QIW A;  2MCT A;  5KFE A;  2VQD A;  3OTO H;  4DV6 H;  1Z2O X;  5KFU A;  2YZN A;  2R82 A;  4Q0Y A;  4O4L F;  1N33 H;  4YR0 A;  4PWQ A;  4F4W A;  3HKZ E;  4BXX G;  2UVW A;  1J5E H;  3R5X A;  3FKI A;  5HBR B;  2DPI A;  4MV1 A; 
#chains in the Genus database with same CATH homology
 1FKA H;  4DV0 H;  2O03 A;  5D1P A;  4MTD A;  1WH2 A;  4X65 H;  4RB3 C;  3EYY A;  2HVR A;  4LFA H;  1P8L A;  4PDB A;  3JSN A;  4UCR A;  3UQ8 A;  4DR3 H;  1XNR H;  3JSL A;  4UCO A;  3J81 W;  3J7A K;  4I7H A;  4DR2 H;  2UU9 H;  4LSX A;  1MZB A;  2CW8 A;  4R7R A;  4DR7 H;  2ZJT A;  3C0F B;  4DV2 H;  1AN7 A;  2UUA H;  1E4G T;  4GKJ H;  4LH7 A;  4RAY A;  1N32 H;  4LMY A;  2WDT A;  2RGR A;  4X62 H;  1I6U A;  5D1O B;  2ZM6 H;  1HNZ H;  3RF2 A;  1XMO H;  1X9N A;  3MWM A;  4DV3 H;  4MTE A;  4LF8 H;  2HVQ A;  1A0I A;  4RB0 A;  3DF7 A;  5FD5 A;  1FVI A;  2E5L H;  5LL6 b;  1I94 H;  1L2Z A;  3N41 B;  3F8N A;  3KAL A;  4JI6 H;  4EFB A;  1SYX B;  4JYA H;  4MV7 A;  4DR1 H;  3RJ0 A;  2VUG A;  4JI2 H;  4DV4 H;  5IWA H;  1IBM H;  4NXM H;  2UUC H;  4DUZ H;  4UCV A;  1HNX H;  2VOB A;  3K3V A;  5FPO A;  3N42 B;  5BR8 H;  4YY3 H;  2UXC H;  4LFB H;  2WYO A;  4DUY H;  4AQY H;  2UUB H;  2FE3 A;  3HXL A;  3FMA A;  4NXN H;  1TAE A;  4DR4 H;  3L4K A;  5LMN H;  4LF9 H;  4DV7 H;  4YHH H;  4RB1 A;  4A2B A;  2CW7 A;  1BJT A;  1SEI A;  3J80 W;  4LF5 H;  1IBL H;  2Q2U A;  4IAJ A;  4JV5 H;  4DV1 H;  3H20 A;  4UFZ A;  4LF4 H;  3RGZ A;  3BAA A;  2Q2T A;  4J0M A;  5A2Q W;  2OWO A;  4LF7 H;  1ZHQ A;  1FJG H;  1GYF A;  2VPS A;  2RGV A;  1VS0 A;  2HHH H;  3BAB A;  1XNQ H;  5FD6 A;  2UXD H;  2VQE H;  2XIG A;  1Z2N X;  2KSW A;  4RAZ A;  3PN1 A;  1IBK H;  3T1H H;  4OX9 H;  3BA9 A;  3N6X A;  4APM A;  4B3T H;  4UCS A;  2WE6 A;  3BA8 A;  2UXB H;  3RIZ A;  4EEQ A;  3LML A;  1XMQ H;  1M0W A;  1HR0 H;  4JI1 H;  4LH6 A;  1V9P A;  4B3R H;  4RB2 C;  2VQF H;  3KAJ A;  4LFC H;  2F4V H;  1TA8 A;  4JI8 H;  2HGS A;  1Z2P X;  1O75 A;  3KXY T;  4MV9 A;  3RTX A;  4RZQ A;  4JI7 H;  5IT9 W;  5FLX W;  1HNW H;  4X66 H;  5FPR A;  4JI5 H;  4X64 H;  1M0T A;  4DV5 H;  3T1Y H;  4KHP H;  4GKK H;  3N44 B;  4DR6 H;  4CC5 A;  4JI4 H;  3JAM W;  3RGX A;  1XDN A;  4LSA A;  4K0K H;  2W57 A;  4M7E A;  4EFE A;  1B04 A;  4FM9 A;  3L4J A;  4DR5 H;  2MCT A;  4BWS C;  3L2P A;  4UCU A;  3KAK A;  1N34 H;  1N36 H;  1S68 A;  3OTO H;  2YCH A;  4LF6 H;  1BGW A;  4DV6 H;  5EOY A;  1S03 G;  1Z2O X;  4B3S H;  1DGS A;  4UCT A;  4ETS A;  4JI3 H;  4A2A A;  5LMU H;  4Q0Y A;  1N33 H;  4GLX A;  4CC6 A;  4JI0 H;  1J5E H;  3N40 P;  2HVS A;  1ZHS A;  1E4F T;  3IG0 A;  3M4I A;  5D1O A;  4B3M H;  3N43 B;  3CVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...