4BWSC

Crystal structure of the heterotrimer of pqbp1, u5-15kd and u5-52kd.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
HHHMDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THIOREDOXIN-LIKE PROTEIN 4A
publication title Mutations in the Pqbp1 Gene Prevent its Interaction with the Spliceosomal Protein U5-15Kd.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 12
structure length 66
sequence length 66
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4bwsC00
3FMAA 4BWSC 1GYFA 1WH2A 3K3VA 1SYXB 1L2ZA
chains in the Genus database with same CATH superfamily
5KFIA 1DV2A 5LOVF 2IBKA 4OX9H 4DUYH 2E2IA 4ECVA 5JVDF 3ETJA 3WO0A 2C2EA 3MWEA 2IA6A 4A93G 2YW2A 4DL6A 3I4NG 2UVUA 3MR2A 2AGOA 3KTMA 2KSWA 4IRCA 1RJPA 3RBEA 4A3CG 3I4MG 4X62H 5DQIA 1Y14B 1HNWH 3RTXA 3I12A 4ZOLF 4J9MA 4ECWA 2HVSA 4A2BA 2V4QA 2YS6A 4M7EA 1RK6A 2BQUA 1OWTA 1C3OA 1ZQ7A 4I7HA 3RGZA 3PW0A 1GGOA 2R86A 3T5JA 1N56A 4EFEA 1TA8A 2VQFH 3Q1KA 2YZNA 3V6HA 1XMQH 3EYYA 2UVVA 3TQTA 4YBZB 4BWSC 2JA5A 1Y1VG 2ZJTA 4A3EG 2R7ZG 5L1JA 5KG2A 5KFMA 5KFAA 2WE6A 4ED6A 4ED7A 2DPJA 5FJ8G 1S9FA 2VUMG 4UCOA 5IP7G 5LYJF 1JDBB 3H0GG 3LP8A 3NGDA 4PWQA 4O2BF 4LF7H 4LF5H 2R92G 2DLNA 5KFYA 3HXLA 4ED8A 1TWCA 1S68A 1TWAA 3K5IA 2R8IA 4R8UB 4EFBA 1TWHA 4E4TA 4RU9A 4MV9A 4U6PA 4B3MH 3L4KA 1VBHA 4M9UA 4ECSA 2RDJA 5KFTA 4JI0H 3U9SA 3PW4A 5JVLA 2C22A 2W8KA 2JA7A 4QJFA 5EWGA 4RAYA 4QWCA 5IP9G 2WB1A 5EDWA 2FPIB 3GQCA 1FKAH 2C35B 2PVPA 5IYZF 3BA9A 4A3FG 3RAXA 3JSNA 3GV7B 1I7NA 1N48A 4YHHH 4B3RH 2RDIA 5KT5A 1ZHSA 4DR2H 1WR2A 1V4YA 1HNXH 5IYBG 4A3BG 3EPGA 1L2ZA 5KFGA 2XCAA 3G6VA 3HOVG 4RZRA 3WNZA 1RJRA 3OSNA 2FB9A 3N42B 1BGWA 3LMLA 5LMNH 2NU7B 3MFHA 2DPIA 2JEIA 1EYZA 1GYFA 2W9BB 4NXNH 1Z2NX 3JRWA 2R6FA 5KFHA 3GIMA 4FBUA 4MV7A 3N43B 1IBKH 4JI8H 2WDTA 3BA8A 4NXMH 2C28A 5LP6F 5KFXA 4C2MA 2SCUB 3EPIA 3FKIG 2R8HA 5DGBA 2VOBA 5FLXW 4BXXG 4RNMA 3GV5B 4BBSG 1K1SA 1X9NA 2J6SA 2UUAH 3RJ0A 3RGXA 3M9OB 4RNNA 1E4EA 3K5HA 3MWDA 5EZYF 4DV1H 4IZOA 4IAJA 4O3NA 4A3IG 3V6JA 1IBMH 2JA8G 2R7LA 3V4SA 1JX4A 5LL6b 2IP4A 4BBRG 2FMAA 3T1YH 4IWXA 1RYRA 5KG7A 5DG9A 1TWFA 4UCVA 2J9GA 4JYAH 3HOWG 2B63A 2FJZA 1T94A 5IWAH 2W9CA 1HNZH 4ETSA 4LF6H 3AYHB 3RUPA 3R5FA 2BR0A 3VMMA 5I47A 3QZ7A 4J9OA 1E4GT 3KHLA 3BAAA 2FK3A 1CQJB 3FMAA 4RNOA 2ATLA 1KJ8A 1B33N 2V9WA 1B04A 1BNCA 4ECZA 4J9PA 4LMYA 4RB2C 2YRWA 3RAQA 4LFAH 3R23A 4MTEA 4YY3H 5D1OB 1TAEA 2CQYA 3V4ZA 5DGAA 3RB4A 1RYSA 4Q8EA 3PW5A 5C1OA 3KHRA 4JUZA 4EGJA 1SYXB 4YJ2F 3BJYA 3JAMW 3GTOA 1UNNC 3Q8PB 2FPPB 2W71A 3QFFA 4GC7A 5CAEB 2YS7A 4LH7A 5KFRA 5KFNA 2VR1A 4DL7A 4BY7G 2W6PA 2QYZA 4XZ3B 1A0IA 1ULZA 3PR4A 4PDBA 1V9PA 3PO2G 1XDNA 4I50F 1O75A 5D1OA 4QWDA 3BQ0A 2BQRA 1FVIA 4O3OA 2UU9H 2CW8A 3PN1A 1MZBA 5KT7A 1T36A 4EG0A 1ZETA 4YB8B 4JI6H 3MFIA 4CC6A 3H4BA 4YP3A 4J0MA 1Y1WA 3GTGA 2WAQE 4MV1A 2FPGB 2YCHA 3MR3A 5KFZA 3N44B 4I4TF 3KXYT 2J6UA 4QIWE 3R5HA 2C2DA 2RGRA 4O3PA 4MAMA 5KFDA 2R7MA 3KAJA 3R5XA 5J2TF 5KT3A 4YQWA 4LFCH 4YJ3F 4EEQA 4IHJF 2W6OA 2NU9B 1JIHA 4XYMB 5F9LA 1PX2A 4FM9A 4DL4A 2ASLA 3T5KA 4AYBE 3J7AK 2ALZA 2JA5G 2R85A 3T5HA 3BQ2A 2UXBH 5KG4A 4BY1G 3G6XA 2AGQA 3N40P 2VQEH 3V6KA 4Q45A 3PW2A 5F9NA 4LF8H 3Q8SB 2HGSA 4ECTA 1S10A 2FK2A 1JKJB 5L1KA 2R7NA 4KHPH 3H40A 1RK5A 4QIWA 3GIPA 4LSAA 4EYIB 4XYLB 4FS1A 3C0FB 3J81W 1HR0H 3SE7A 3GTLA 2Q2UA 4O3QA 4EBCA 4A3DG 2JA7G 2Q2TA 5GONF 4YAJB 1WSCA 4JI2H 5HBRB 4Q0YA 5JUMA 4DV5H 2R93A 4DR7H 5KG5A 4Q43A 4JV2A 4U7CA 3HKZE 4ECRA 3G6YA 3RV4A 2HHHH 5KG6A 3MR6A 2JEGA 2YU9A 4O4IF 2NUAB 4J9SA 4IRKA 1VAJA 5C3EG 1KJJA 4Q8FA 5FPRA 4QWEA 2FLNA 2R8GA 4B3SH 5KG3A 4RUAA 1XNRH 1UC9A 1K83A 1GLVA 1GO3E 1KC7A 2Y0SE 1XMOH 4R8UA 1EUDB 3TQ1A 5FD6A 4ED3A 3Q8QB 2E5LH 3H20A 4QWBA 5KFKA 4UCRA 4JV0A 2F4VH 2ZM6H 2AU0A 4CC5A 5T14A 2IMWP 3HKZA 2FE3A 3G8CA 5KFBA 2W7PA 2M05A 3K3VA 4C5CA 4C5AA 1BXRA 2W70A 3Q2OA 2FKLA 4DUZH 1I6UA 1N32H 1AUVA 1KJ9A 3GIDA 5BPHA 4GLXA 4J9RA 4DL2A 4B3TH 4LFBH 4UCUA 4F50A 4TQRA 5DQGA 4EYHB 1WH2A 3RV3A 1B6SA 4RB0A 3PVXA 1I7LA 2CKZB 1IOVA 1CQIB 5FPOA 2AGPA 5K2MA 3JZIA 3TINA 2VUGA 1JXLA 2B63G 3IG0A 4JI4H 4IR1A 2VA2A 4DR3H 2PBZA 2ZDHA 2W9BA 4GKJH 5CA1F 4ME6A 1IOWA 5KFCA 2DZDA 1W93A 5BPFA 3Q8RB 4F4YA 1UC8A 2HVQA 5KFWA 4EBDA 3OUZA 1WCMA 3RB3A 3HOUG 4DR4H 4DR5H 2GPSA 5BMVF 1S97A 4JV1A 5C4XG 2ZDQA 2PMZE 4XX0B 2O03A 3TIGA 2XCPA 3M9NB 4A3LG 4ZHQF 5DQHA 4DLKA 4J9QA 4HNVA 4UCSA 3VPBA 1M7JA 1DIKA 2V5AA 4TV9F 3T1HH 4O4LF 3GIIA 4MV8A 2W6ZA 2R8JA 3CVZA 3GIQA 2V58A 3PO3G 2C00A 3E5NA 4Y8VB 5KFEA 1C30A 1N34H 2OWOA 3HOXG 2DIKA 4MV6A 5IT9W 4GKKH 4X65H 5DLFA 2VQDA 3OHAA 1AN7A 2YRXA 5KT6A 2JEJA 3PW7A 1I94H 4IWYA 2R7KA 2GPWA 3GTPA 2YZGA 5KFPA 2JA6A 1Y1WG 4K0KH 1S03G 4TV8F 2HJWA 2NU6B 4TUYF 3OHBA 2RF4A 3F8NA 3GILA 3VPDA 4YR3A 3BABA 2DWCA 2VPSA 3GTJA 5JQWA 3PR5B 5KG1A 1CS0A 1KEEA 5BR8H 1M0WA 4HNTA 1VS0A 5KFJA 4DV6H 5EWFA 5J2UF 4UFZA 3ORQA 2WTFA 2ZDGA 3JRXA 3SI8A 4O3RA 3TIIA 5C44G 1W96A 4J9LA 3RBDA 4IRDA 2W6MA 1Z2PX 4EEYA 5LA6F 2P0AA 2XC9A 3MJFA 4DV0H 2UXCH 4MA0A 5DLGA 1SFOA 4ED1A 4ED0A 1S0MA 4MV3A 2R84A 5EWEA 3GTMA 1SCUB 2WAQA 3ORRA 3J80W 4HR7A 4FBTA 2FP4B 4AQYH 3KHGA 4DR1H 1AUXA 2YYAA 2R93G 2W9AA 3H4DA 2VA3A 2I87A 2NU8B 4F4WA 4QWAA 5L1IA 2FK1A 1T3NA 4APMA 4A3GG 4AYBA 4GC6A 4JI5H 2FLLA 5KT2A 3N41B 2YL2A 3GLKA 4RB3C 5KFUA 5DG8A 4HYKA 3N6XA 2JEFA 3FDSA 2UVRA 4MA5A 1SEIA 2R8KA 4QW8A 1S0OA 4TQSA 1R9TA 2WB1E 1P8LA 3IN5A 5JH7F 4IR9A 3HOZG 4C5BA 3L4JA 5IYDG 5KFQA 4HQ6A 4R7RA 2C2RA 4UCTA 1V51A 3GTKA 3OSPA 3BG5A 2UUBH 4DL3A 3RB0A 4WD3A 4YR0A 1E4FT 1Y1VA 3LWBA 3L2PA 4ZI7F 2R7ZA 3BQ1A 4YAKB 2XIGA 1VKZA 5FD5A 3QZ8A 2VUMA 2NVXA 3UQ8A 4ECXA 5IYCG 3RB6A 3HOYG 4A3JG 4RZQA 3KAKA 3H0GA 4FU0A 4FS2A 2QK4A 2NVYA 4HNUA 2R92A 4EGQA 1DGSA 4ECYA 4X64H 2XGPA 4ED2A 4ECUA 4LSXA 5KFOA 3HBLA 2W6NA 2Y0SA 3K3PA 2R87A 4I55F 2FLPA 4LF9H 4JV5H 1PK8A 1I3QA 3H3VH 3GIKA 1VBGA 1WCMG 2XCLA 3OTOH 3MR5A 4DV2H 4O3SA 1E4EB 1K1QA 5D8DA 5DG7A 2BQ3A 2XD4A 3RIZA 5C5JA 2YZMA 3UFXB 1TWGA 4A3KG 4NLGA 4DL5A 5LXTF 5KFLA 2HVRA 2OLSA 2W57A 1KJIA 2GLTA 4Q44A 4DV7H 5FLMG 4RAZA 1KBLA 5KT4A 2V4RA 2W9CB 3WO1A 2MCTA 5C1PA 1DV1A 2I80A 5KKNB 2VPQA 5EOYA 1JDEA 2V59A 4QW9A 2UVWA 4JI1H 4JI3H 4A2AA 5KFSA 3CQZA 1FJGH 4DR6H 2AQ4A 2I8CA 2CZGA 2RGVA 1KJQA 2PN1A 1GSOA 1I50A 1BJTA 1RJQA 2XGQA 3GV8B 4LF4H 2E2HA 2JA6G 1ZHQA 1M0TA 3T5LA 4A3MG 3FKIA 5CA0F 5KG0A 5LMUH 2W6QA 4WBNF 4MV4A 4RB1A 1JLLB 3DF7A 4JI7H 3KHHA 4ZQIA 3GIJA 1EHIA 2WYOA 2PMZA 5L1LA 2OH2A 2UUCH 2W7OA 2J6TA 4MTDA 1GSHA 3M4IA 5C8YF 2UXDH 2R82A 4X66H 4DV3H 4YR2A 4G3IA 3N8DA 1J5EH 2ASJA 3OUUA 1A9XA 4LH6A 4RUCA 4DV4H 5D1PA 4O2AF 5KFVA 3U9TA 1M6VA 3MWMA 1GSAA 3KALA 3GTQA 1IBLH 4O4HF 3M9MB 3ETHA 3RF2A 2CW7A 4ECQA 5L9XA 5CB4F 3JSLA 1B6RA 2X0SA 1Z2OX 5A2QW 4L1KA 1EUCB 5KFFA 4J9KA 4F4ZA 4J9NA 5H80A 3VPCA 1S0NA 1N36H 3PZPA 1XNQH 3HB9A 4F4XA 4EBEA 3RFCA 1N33H 1EZ1A 5KX5F 1CE8A 2ASDA 2W8LA 5HV6A
chains in the Genus database with same CATH topology
3FMAA 4B3TH 4LFBH 4UCUA 1B04A 1P8LA 4DUYH 4OX9H 1WH2A 4LMYA 4RB2C 3L4JA 4LFAH 4LFCH 4YY3H 4MTEA 4RB0A 5D1OB 1TAEA 5FPOA 4R7RA 4UCTA 2VUGA 2KSWA 3IG0A 2UUBH 4JI4H 1SYXB 4DR3H 3JAMW 1E4FT 3L2PA 4X62H 4GKJH 4LH7A 2XIGA 5FD5A 1HNWH 3RTXA 3UQ8A 4RZQA 1A0IA 2HVQA 3KAKA 2HVSA 4PDBA 1V9PA 4A2BA 4DR4H 4DR5H 4M7EA 1DGSA 1XDNA 4I7HA 3RGZA 2O03A 1O75A 5D1OA 4X64H 4EFEA 1TA8A 2VQFH 1FVIA 1XMQH 2UU9H 2CW8A 3EYYA 3PN1A 1MZBA 4LSXA 4JI6H 4BWSC 4UCSA 4CC6A 2ZJTA 4J0MA 3T1HH 3CVZA 2WE6A 2YCHA 4LF9H 4JV5H 3N44B 4UCOA 3KXYT 2OWOA 1N34H 2RGRA 5IT9W 4LF7H 4LF5H 4GKKH 4DV2H 3KAJA 3HXLA 4X65H 3OTOH 1S68A 4EFBA 1AN7A 4EEQA 3RIZA 4MV9A 4B3MH 4FM9A 3L4KA 1I94H 4JI0H 3J7AK 2HVRA 2W57A 4K0KH 1S03G 2UXBH 4DV7H 3F8NA 4RAZA 4RAYA 3N40P 2VQEH 3BABA 2VPSA 2MCTA 1FKAH 4LF8H 5EOYA 4JI1H 2HGSA 3BA9A 5BR8H 4JI3H 4A2AA 1M0WA 3JSNA 1VS0A 1FJGH 4DR6H 4YHHH 4B3RH 4KHPH 1ZHSA 4DV6H 4DR2H 4LSAA 2RGVA 1BJTA 3C0FB 3J81W 1HR0H 4LF4H 1HNXH 4UFZA 1ZHQA 2Q2UA 1L2ZA 1M0TA 2Q2TA 3N42B 1BGWA 3LMLA 1Z2PX 4Q0YA 4JI2H 4RB1A 5LMNH 5LMUH 4DV5H 1GYFA 4DR7H 4NXNH 3DF7A 1Z2NX 4JI7H 2WYOA 2HHHH 4DV0H 4MV7A 3N43B 1IBKH 2UXCH 4JI8H 2UUCH 4MTDA 3BA8A 2WDTA 3M4IA 4NXMH 2UXDH 4X66H 4DV3H 1J5EH 5FPRA 3J80W 4B3SH 2VOBA 5FLXW 1XNRH 4AQYH 4LH6A 1X9NA 4DR1H 2UUAH 4DV4H 3RJ0A 5D1PA 3RGXA 1XMOH 4DV1H 3MWMA 5FD6A 3KALA 4IAJA 1IBLH 2E5LH 3H20A 1IBMH 4UCRA 5LL6b 2F4VH 2ZM6H 3RF2A 4CC5A 2CW7A 4APMA 3T1YH 3JSLA 2FE3A 1Z2OX 5A2QW 4UCVA 4JI5H 4JYAH 3K3VA 3N41B 5IWAH 1HNZH 4ETSA 4LF6H 1N36H 4DUZH 1XNQH 4RB3C 1I6UA 1N32H 3N6XA 1N33H 4GLXA 1SEIA 1E4GT 3BAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMA A;  4BWS C;  1GYF A;  1WH2 A;  3K3V A;  1SYX B;  1L2Z A; 
#chains in the Genus database with same CATH topology
 5KFI A;  1DV2 A;  5LOV F;  2IBK A;  4OX9 H;  4DUY H;  2E2I A;  4ECV A;  5JVD F;  3ETJ A;  3WO0 A;  2C2E A;  3MWE A;  2IA6 A;  4A93 G;  2YW2 A;  4DL6 A;  3I4N G;  2UVU A;  3MR2 A;  2AGO A;  3KTM A;  2KSW A;  4IRC A;  1RJP A;  3RBE A;  4A3C G;  3I4M G;  4X62 H;  5DQI A;  1Y14 B;  1HNW H;  3RTX A;  3I12 A;  4ZOL F;  4J9M A;  4ECW A;  2HVS A;  4A2B A;  2V4Q A;  2YS6 A;  4M7E A;  1RK6 A;  2BQU A;  1OWT A;  1C3O A;  1ZQ7 A;  4I7H A;  3RGZ A;  3PW0 A;  1GGO A;  2R86 A;  3T5J A;  1N56 A;  4EFE A;  1TA8 A;  2VQF H;  3Q1K A;  2YZN A;  3V6H A;  1XMQ H;  3EYY A;  2UVV A;  3TQT A;  4YBZ B;  4BWS C;  2JA5 A;  1Y1V G;  2ZJT A;  4A3E G;  2R7Z G;  5L1J A;  5KG2 A;  5KFM A;  5KFA A;  2WE6 A;  4ED6 A;  4ED7 A;  2DPJ A;  5FJ8 G;  1S9F A;  2VUM G;  4UCO A;  5IP7 G;  5LYJ F;  1JDB B;  3H0G G;  3LP8 A;  3NGD A;  4PWQ A;  4O2B F;  4LF7 H;  4LF5 H;  2R92 G;  2DLN A;  5KFY A;  3HXL A;  4ED8 A;  1TWC A;  1S68 A;  1TWA A;  3K5I A;  2R8I A;  4R8U B;  4EFB A;  1TWH A;  4E4T A;  4RU9 A;  4MV9 A;  4U6P A;  4B3M H;  3L4K A;  1VBH A;  4M9U A;  4ECS A;  2RDJ A;  5KFT A;  4JI0 H;  3U9S A;  3PW4 A;  5JVL A;  2C22 A;  2W8K A;  2JA7 A;  4QJF A;  5EWG A;  4RAY A;  4QWC A;  5IP9 G;  2WB1 A;  5EDW A;  2FPI B;  3GQC A;  1FKA H;  2C35 B;  2PVP A;  5IYZ F;  3BA9 A;  4A3F G;  3RAX A;  3JSN A;  3GV7 B;  1I7N A;  1N48 A;  4YHH H;  4B3R H;  2RDI A;  5KT5 A;  1ZHS A;  4DR2 H;  1WR2 A;  1V4Y A;  1HNX H;  5IYB G;  4A3B G;  3EPG A;  1L2Z A;  5KFG A;  2XCA A;  3G6V A;  3HOV G;  4RZR A;  3WNZ A;  1RJR A;  3OSN A;  2FB9 A;  3N42 B;  1BGW A;  3LML A;  5LMN H;  2NU7 B;  3MFH A;  2DPI A;  2JEI A;  1EYZ A;  1GYF A;  2W9B B;  4NXN H;  1Z2N X;  3JRW A;  2R6F A;  5KFH A;  3GIM A;  4FBU A;  4MV7 A;  3N43 B;  1IBK H;  4JI8 H;  2WDT A;  3BA8 A;  4NXM H;  2C28 A;  5LP6 F;  5KFX A;  4C2M A;  2SCU B;  3EPI A;  3FKI G;  2R8H A;  5DGB A;  2VOB A;  5FLX W;  4BXX G;  4RNM A;  3GV5 B;  4BBS G;  1K1S A;  1X9N A;  2J6S A;  2UUA H;  3RJ0 A;  3RGX A;  3M9O B;  4RNN A;  1E4E A;  3K5H A;  3MWD A;  5EZY F;  4DV1 H;  4IZO A;  4IAJ A;  4O3N A;  4A3I G;  3V6J A;  1IBM H;  2JA8 G;  2R7L A;  3V4S A;  1JX4 A;  5LL6 b;  2IP4 A;  4BBR G;  2FMA A;  3T1Y H;  4IWX A;  1RYR A;  5KG7 A;  5DG9 A;  1TWF A;  4UCV A;  2J9G A;  4JYA H;  3HOW G;  2B63 A;  2FJZ A;  1T94 A;  5IWA H;  2W9C A;  1HNZ H;  4ETS A;  4LF6 H;  3AYH B;  3RUP A;  3R5F A;  2BR0 A;  3VMM A;  5I47 A;  3QZ7 A;  4J9O A;  1E4G T;  3KHL A;  3BAA A;  2FK3 A;  1CQJ B;  3FMA A;  4RNO A;  2ATL A;  1KJ8 A;  1B33 N;  2V9W A;  1B04 A;  1BNC A;  4ECZ A;  4J9P A;  4LMY A;  4RB2 C;  2YRW A;  3RAQ A;  4LFA H;  3R23 A;  4MTE A;  4YY3 H;  5D1O B;  1TAE A;  2CQY A;  3V4Z A;  5DGA A;  3RB4 A;  1RYS A;  4Q8E A;  3PW5 A;  5C1O A;  3KHR A;  4JUZ A;  4EGJ A;  1SYX B;  4YJ2 F;  3BJY A;  3JAM W;  3GTO A;  1UNN C;  3Q8P B;  2FPP B;  2W71 A;  3QFF A;  4GC7 A;  5CAE B;  2YS7 A;  4LH7 A;  5KFR A;  5KFN A;  2VR1 A;  4DL7 A;  4BY7 G;  2W6P A;  2QYZ A;  4XZ3 B;  1A0I A;  1ULZ A;  3PR4 A;  4PDB A;  1V9P A;  3PO2 G;  1XDN A;  4I50 F;  1O75 A;  5D1O A;  4QWD A;  3BQ0 A;  2BQR A;  1FVI A;  4O3O A;  2UU9 H;  2CW8 A;  3PN1 A;  1MZB A;  5KT7 A;  1T36 A;  4EG0 A;  1ZET A;  4YB8 B;  4JI6 H;  3MFI A;  4CC6 A;  3H4B A;  4YP3 A;  4J0M A;  1Y1W A;  3GTG A;  2WAQ E;  4MV1 A;  2FPG B;  2YCH A;  3MR3 A;  5KFZ A;  3N44 B;  4I4T F;  3KXY T;  2J6U A;  4QIW E;  3R5H A;  2C2D A;  2RGR A;  4O3P A;  4MAM A;  5KFD A;  2R7M A;  3KAJ A;  3R5X A;  5J2T F;  5KT3 A;  4YQW A;  4LFC H;  4YJ3 F;  4EEQ A;  4IHJ F;  2W6O A;  2NU9 B;  1JIH A;  4XYM B;  5F9L A;  1PX2 A;  4FM9 A;  4DL4 A;  2ASL A;  3T5K A;  4AYB E;  3J7A K;  2ALZ A;  2JA5 G;  2R85 A;  3T5H A;  3BQ2 A;  2UXB H;  5KG4 A;  4BY1 G;  3G6X A;  2AGQ A;  3N40 P;  2VQE H;  3V6K A;  4Q45 A;  3PW2 A;  5F9N A;  4LF8 H;  3Q8S B;  2HGS A;  4ECT A;  1S10 A;  2FK2 A;  1JKJ B;  5L1K A;  2R7N A;  4KHP H;  3H40 A;  1RK5 A;  4QIW A;  3GIP A;  4LSA A;  4EYI B;  4XYL B;  4FS1 A;  3C0F B;  3J81 W;  1HR0 H;  3SE7 A;  3GTL A;  2Q2U A;  4O3Q A;  4EBC A;  4A3D G;  2JA7 G;  2Q2T A;  5GON F;  4YAJ B;  1WSC A;  4JI2 H;  5HBR B;  4Q0Y A;  5JUM A;  4DV5 H;  2R93 A;  4DR7 H;  5KG5 A;  4Q43 A;  4JV2 A;  4U7C A;  3HKZ E;  4ECR A;  3G6Y A;  3RV4 A;  2HHH H;  5KG6 A;  3MR6 A;  2JEG A;  2YU9 A;  4O4I F;  2NUA B;  4J9S A;  4IRK A;  1VAJ A;  5C3E G;  1KJJ A;  4Q8F A;  5FPR A;  4QWE A;  2FLN A;  2R8G A;  4B3S H;  5KG3 A;  4RUA A;  1XNR H;  1UC9 A;  1K83 A;  1GLV A;  1GO3 E;  1KC7 A;  2Y0S E;  1XMO H;  4R8U A;  1EUD B;  3TQ1 A;  5FD6 A;  4ED3 A;  3Q8Q B;  2E5L H;  3H20 A;  4QWB A;  5KFK A;  4UCR A;  4JV0 A;  2F4V H;  2ZM6 H;  2AU0 A;  4CC5 A;  5T14 A;  2IMW P;  3HKZ A;  2FE3 A;  3G8C A;  5KFB A;  2W7P A;  2M05 A;  3K3V A;  4C5C A;  4C5A A;  1BXR A;  2W70 A;  3Q2O A;  2FKL A;  4DUZ H;  1I6U A;  1N32 H;  1AUV A;  1KJ9 A;  3GID A;  5BPH A;  4GLX A;  4J9R A;  4DL2 A;  4B3T H;  4LFB H;  4UCU A;  4F50 A;  4TQR A;  5DQG A;  4EYH B;  1WH2 A;  3RV3 A;  1B6S A;  4RB0 A;  3PVX A;  1I7L A;  2CKZ B;  1IOV A;  1CQI B;  5FPO A;  2AGP A;  5K2M A;  3JZI A;  3TIN A;  2VUG A;  1JXL A;  2B63 G;  3IG0 A;  4JI4 H;  4IR1 A;  2VA2 A;  4DR3 H;  2PBZ A;  2ZDH A;  2W9B A;  4GKJ H;  5CA1 F;  4ME6 A;  1IOW A;  5KFC A;  2DZD A;  1W93 A;  5BPF A;  3Q8R B;  4F4Y A;  1UC8 A;  2HVQ A;  5KFW A;  4EBD A;  3OUZ A;  1WCM A;  3RB3 A;  3HOU G;  4DR4 H;  4DR5 H;  2GPS A;  5BMV F;  1S97 A;  4JV1 A;  5C4X G;  2ZDQ A;  2PMZ E;  4XX0 B;  2O03 A;  3TIG A;  2XCP A;  3M9N B;  4A3L G;  4ZHQ F;  5DQH A;  4DLK A;  4J9Q A;  4HNV A;  4UCS A;  3VPB A;  1M7J A;  1DIK A;  2V5A A;  4TV9 F;  3T1H H;  4O4L F;  3GII A;  4MV8 A;  2W6Z A;  2R8J A;  3CVZ A;  3GIQ A;  2V58 A;  3PO3 G;  2C00 A;  3E5N A;  4Y8V B;  5KFE A;  1C30 A;  1N34 H;  2OWO A;  3HOX G;  2DIK A;  4MV6 A;  5IT9 W;  4GKK H;  4X65 H;  5DLF A;  2VQD A;  3OHA A;  1AN7 A;  2YRX A;  5KT6 A;  2JEJ A;  3PW7 A;  1I94 H;  4IWY A;  2R7K A;  2GPW A;  3GTP A;  2YZG A;  5KFP A;  2JA6 A;  1Y1W G;  4K0K H;  1S03 G;  4TV8 F;  2HJW A;  2NU6 B;  4TUY F;  3OHB A;  2RF4 A;  3F8N A;  3GIL A;  3VPD A;  4YR3 A;  3BAB A;  2DWC A;  2VPS A;  3GTJ A;  5JQW A;  3PR5 B;  5KG1 A;  1CS0 A;  1KEE A;  5BR8 H;  1M0W A;  4HNT A;  1VS0 A;  5KFJ A;  4DV6 H;  5EWF A;  5J2U F;  4UFZ A;  3ORQ A;  2WTF A;  2ZDG A;  3JRX A;  3SI8 A;  4O3R A;  3TII A;  5C44 G;  1W96 A;  4J9L A;  3RBD A;  4IRD A;  2W6M A;  1Z2P X;  4EEY A;  5LA6 F;  2P0A A;  2XC9 A;  3MJF A;  4DV0 H;  2UXC H;  4MA0 A;  5DLG A;  1SFO A;  4ED1 A;  4ED0 A;  1S0M A;  4MV3 A;  2R84 A;  5EWE A;  3GTM A;  1SCU B;  2WAQ A;  3ORR A;  3J80 W;  4HR7 A;  4FBT A;  2FP4 B;  4AQY H;  3KHG A;  4DR1 H;  1AUX A;  2YYA A;  2R93 G;  2W9A A;  3H4D A;  2VA3 A;  2I87 A;  2NU8 B;  4F4W A;  4QWA A;  5L1I A;  2FK1 A;  1T3N A;  4APM A;  4A3G G;  4AYB A;  4GC6 A;  4JI5 H;  2FLL A;  5KT2 A;  3N41 B;  2YL2 A;  3GLK A;  4RB3 C;  5KFU A;  5DG8 A;  4HYK A;  3N6X A;  2JEF A;  3FDS A;  2UVR A;  4MA5 A;  1SEI A;  2R8K A;  4QW8 A;  1S0O A;  4TQS A;  1R9T A;  2WB1 E;  1P8L A;  3IN5 A;  5JH7 F;  4IR9 A;  3HOZ G;  4C5B A;  3L4J A;  5IYD G;  5KFQ A;  4HQ6 A;  4R7R A;  2C2R A;  4UCT A;  1V51 A;  3GTK A;  3OSP A;  3BG5 A;  2UUB H;  4DL3 A;  3RB0 A;  4WD3 A;  4YR0 A;  1E4F T;  1Y1V A;  3LWB A;  3L2P A;  4ZI7 F;  2R7Z A;  3BQ1 A;  4YAK B;  2XIG A;  1VKZ A;  5FD5 A;  3QZ8 A;  2VUM A;  2NVX A;  3UQ8 A;  4ECX A;  5IYC G;  3RB6 A;  3HOY G;  4A3J G;  4RZQ A;  3KAK A;  3H0G A;  4FU0 A;  4FS2 A;  2QK4 A;  2NVY A;  4HNU A;  2R92 A;  4EGQ A;  1DGS A;  4ECY A;  4X64 H;  2XGP A;  4ED2 A;  4ECU A;  4LSX A;  5KFO A;  3HBL A;  2W6N A;  2Y0S A;  3K3P A;  2R87 A;  4I55 F;  2FLP A;  4LF9 H;  4JV5 H;  1PK8 A;  1I3Q A;  3H3V H;  3GIK A;  1VBG A;  1WCM G;  2XCL A;  3OTO H;  3MR5 A;  4DV2 H;  4O3S A;  1E4E B;  1K1Q A;  5D8D A;  5DG7 A;  2BQ3 A;  2XD4 A;  3RIZ A;  5C5J A;  2YZM A;  3UFX B;  1TWG A;  4A3K G;  4NLG A;  4DL5 A;  5LXT F;  5KFL A;  2HVR A;  2OLS A;  2W57 A;  1KJI A;  2GLT A;  4Q44 A;  4DV7 H;  5FLM G;  4RAZ A;  1KBL A;  5KT4 A;  2V4R A;  2W9C B;  3WO1 A;  2MCT A;  5C1P A;  1DV1 A;  2I80 A;  5KKN B;  2VPQ A;  5EOY A;  1JDE A;  2V59 A;  4QW9 A;  2UVW A;  4JI1 H;  4JI3 H;  4A2A A;  5KFS A;  3CQZ A;  1FJG H;  4DR6 H;  2AQ4 A;  2I8C A;  2CZG A;  2RGV A;  1KJQ A;  2PN1 A;  1GSO A;  1I50 A;  1BJT A;  1RJQ A;  2XGQ A;  3GV8 B;  4LF4 H;  2E2H A;  2JA6 G;  1ZHQ A;  1M0T A;  3T5L A;  4A3M G;  3FKI A;  5CA0 F;  5KG0 A;  5LMU H;  2W6Q A;  4WBN F;  4MV4 A;  4RB1 A;  1JLL B;  3DF7 A;  4JI7 H;  3KHH A;  4ZQI A;  3GIJ A;  1EHI A;  2WYO A;  2PMZ A;  5L1L A;  2OH2 A;  2UUC H;  2W7O A;  2J6T A;  4MTD A;  1GSH A;  3M4I A;  5C8Y F;  2UXD H;  2R82 A;  4X66 H;  4DV3 H;  4YR2 A;  4G3I A;  3N8D A;  1J5E H;  2ASJ A;  3OUU A;  1A9X A;  4LH6 A;  4RUC A;  4DV4 H;  5D1P A;  4O2A F;  5KFV A;  3U9T A;  1M6V A;  3MWM A;  1GSA A;  3KAL A;  3GTQ A;  1IBL H;  4O4H F;  3M9M B;  3ETH A;  3RF2 A;  2CW7 A;  4ECQ A;  5L9X A;  5CB4 F;  3JSL A;  1B6R A;  2X0S A;  1Z2O X;  5A2Q W;  4L1K A;  1EUC B;  5KFF A;  4J9K A;  4F4Z A;  4J9N A;  5H80 A;  3VPC A;  1S0N A;  1N36 H;  3PZP A;  1XNQ H;  3HB9 A;  4F4X A;  4EBE A;  3RFC A;  1N33 H;  1EZ1 A;  5KX5 F;  1CE8 A;  2ASD A;  2W8L A;  5HV6 A; 
#chains in the Genus database with same CATH homology
 3FMA A;  4B3T H;  4LFB H;  4UCU A;  1B04 A;  1P8L A;  4DUY H;  4OX9 H;  1WH2 A;  4LMY A;  4RB2 C;  3L4J A;  4LFA H;  4LFC H;  4YY3 H;  4MTE A;  4RB0 A;  5D1O B;  1TAE A;  5FPO A;  4R7R A;  4UCT A;  2VUG A;  2KSW A;  3IG0 A;  2UUB H;  4JI4 H;  1SYX B;  4DR3 H;  3JAM W;  1E4F T;  3L2P A;  4X62 H;  4GKJ H;  4LH7 A;  2XIG A;  5FD5 A;  1HNW H;  3RTX A;  3UQ8 A;  4RZQ A;  1A0I A;  2HVQ A;  3KAK A;  2HVS A;  4PDB A;  1V9P A;  4A2B A;  4DR4 H;  4DR5 H;  4M7E A;  1DGS A;  1XDN A;  4I7H A;  3RGZ A;  2O03 A;  1O75 A;  5D1O A;  4X64 H;  4EFE A;  1TA8 A;  2VQF H;  1FVI A;  1XMQ H;  2UU9 H;  2CW8 A;  3EYY A;  3PN1 A;  1MZB A;  4LSX A;  4JI6 H;  4BWS C;  4UCS A;  4CC6 A;  2ZJT A;  4J0M A;  3T1H H;  3CVZ A;  2WE6 A;  2YCH A;  4LF9 H;  4JV5 H;  3N44 B;  4UCO A;  3KXY T;  2OWO A;  1N34 H;  2RGR A;  5IT9 W;  4LF7 H;  4LF5 H;  4GKK H;  4DV2 H;  3KAJ A;  3HXL A;  4X65 H;  3OTO H;  1S68 A;  4EFB A;  1AN7 A;  4EEQ A;  3RIZ A;  4MV9 A;  4B3M H;  4FM9 A;  3L4K A;  1I94 H;  4JI0 H;  3J7A K;  2HVR A;  2W57 A;  4K0K H;  1S03 G;  2UXB H;  4DV7 H;  3F8N A;  4RAZ A;  4RAY A;  3N40 P;  2VQE H;  3BAB A;  2VPS A;  2MCT A;  1FKA H;  4LF8 H;  5EOY A;  4JI1 H;  2HGS A;  3BA9 A;  5BR8 H;  4JI3 H;  4A2A A;  1M0W A;  3JSN A;  1VS0 A;  1FJG H;  4DR6 H;  4YHH H;  4B3R H;  4KHP H;  1ZHS A;  4DV6 H;  4DR2 H;  4LSA A;  2RGV A;  1BJT A;  3C0F B;  3J81 W;  1HR0 H;  4LF4 H;  1HNX H;  4UFZ A;  1ZHQ A;  2Q2U A;  1L2Z A;  1M0T A;  2Q2T A;  3N42 B;  1BGW A;  3LML A;  1Z2P X;  4Q0Y A;  4JI2 H;  4RB1 A;  5LMN H;  5LMU H;  4DV5 H;  1GYF A;  4DR7 H;  4NXN H;  3DF7 A;  1Z2N X;  4JI7 H;  2WYO A;  2HHH H;  4DV0 H;  4MV7 A;  3N43 B;  1IBK H;  2UXC H;  4JI8 H;  2UUC H;  4MTD A;  3BA8 A;  2WDT A;  3M4I A;  4NXM H;  2UXD H;  4X66 H;  4DV3 H;  1J5E H;  5FPR A;  3J80 W;  4B3S H;  2VOB A;  5FLX W;  1XNR H;  4AQY H;  4LH6 A;  1X9N A;  4DR1 H;  2UUA H;  4DV4 H;  3RJ0 A;  5D1P A;  3RGX A;  1XMO H;  4DV1 H;  3MWM A;  5FD6 A;  3KAL A;  4IAJ A;  1IBL H;  2E5L H;  3H20 A;  1IBM H;  4UCR A;  5LL6 b;  2F4V H;  2ZM6 H;  3RF2 A;  4CC5 A;  2CW7 A;  4APM A;  3T1Y H;  3JSL A;  2FE3 A;  1Z2O X;  5A2Q W;  4UCV A;  4JI5 H;  4JYA H;  3K3V A;  3N41 B;  5IWA H;  1HNZ H;  4ETS A;  4LF6 H;  1N36 H;  4DUZ H;  1XNQ H;  4RB3 C;  1I6U A;  1N32 H;  3N6X A;  1N33 H;  4GLX A;  1SEI A;  1E4G T;  3BAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...