4BWSC

Crystal structure of the heterotrimer of pqbp1, u5-15kd and u5-52kd.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
HHHMDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords THIOREDOXIN-LIKE PROTEIN 4A
publication title Mutations in the Pqbp1 Gene Prevent its Interaction with the Spliceosomal Protein U5-15Kd.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 66
sequence length 66
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4bwsC00
1WH2A 3K3VA 4BWSC 3FMAA 1GYFA 1SYXB 1L2ZA
chains in the Genus database with same CATH superfamily
3KHRA 2VUMG 2R85A 2FE3A 4I7HA 1GO3E 4A3DG 4DL3A 2MCTA 2YRXA 1GYFA 5KFCA 1CQJB 3GIKA 3GIDA 3N42B 3UFXB 1IBKH 3VMMA 2WYOA 5JH7F 1VAJA 3MWEA 2R8GA 4MV1A 1AUVA 4RU9A 3EPIA 4XZ3B 3RFCA 4RNNA 2DPJA 2FK2A 4LF5H 3PO2G 2WTFA 4DL6A 2FLNA 4UFZA 2UU9H 4J9SA 3FKIG 2FMAA 5KFIA 5IYDG 1TWCA 5FPRA 4XX0B 5D8DA 5HBRB 5BR8H 3H3VH 2ZDHA 3RV3A 4FM9A 5KFUA 1E4EA 4DUZH 2VQDA 2XGPA 3T5HA 2FLLA 5DG8A 5EWFA 4J0MA 3HKZA 2GPSA 5L9XA 4YHHH 3HOXG 2GPWA 4NXNH 1VS0A 2QYZA 3KAKA 2C28A 2RDIA 3N40P 3JZIA 4RB1A 3V6JA 2UUBH 4O4IF 4HNTA 4EG0A 4MV3A 4A3BG 2UXCH 5JVDF 2ASJA 4QWAA 2VQFH 3JRWA 3GV8B 4A3MG 4YR3A 5L1LA 3HBLA 5JVLA 3PW2A 3K5HA 1S03G 4Q0YA 4DV3H 4JI3H 5KFTA 1IOVA 4ECQA 4RB0A 1CQIB 1V4YA 2W9BB 1S10A 2W6PA 1RJRA 4MV6A 4A3CG 2W7PA 4FBTA 3GV5B 1TWHA 5FLXW 2RGRA 4BY1G 2HVSA 4ZI7F 1VKZA 2VPSA 3MR6A 3ORRA 5IP9G 5D1OB 1GSHA 2V5AA 3ORQA 2JEFA 4YB8B 4QWDA 2W9BA 3T1YH 3GTLA 4DR5H 4C5AA 4J9PA 3KHHA 3TINA 4EBCA 5L1KA 1V9PA 3EPGA 2ASLA 3GTGA 4YJ3F 4YR0A 4J9QA 4IWXA 3N6XA 5DLFA 5HV6A 5LL6b 3R23A 2E5LH 1BXRA 2QK4A 1IOWA 4AYBA 2W8LA 4MV9A 5D1OA 1S0MA 4O3RA 1S0NA 5LOVF 4U7CA 2WB1A 3U9TA 5C1PA 2OH2A 1WCMA 1CE8A 2CW7A 4TV9F 2NVXA 3R5FA 3T5KA 3ETHA 1RK5A 3HOUG 1I50A 5LXTF 5DLGA 4J9MA 1T3NA 2NU7B 3RJ0A 3M9MB 1EZ1A 2DIKA 4AYBE 2VR1A 4O3QA 3KHGA 4A3JG 2FJZA 4NXMH 4O3NA 4MTDA 1CS0A 2C22A 4QWBA 4O3OA 1I6UA 3PW5A 2AU0A 4J9LA 1HNXH 5BMVF 2YRWA 4ZOLF 3RV4A 2SCUB 2M05A 4BWSC 4JI4H 2XD4A 2NU9B 4RZQA 2JEIA 4IAJA 5CA0F 4ED1A 1HR0H 3GIIA 4O2AF 5KFDA 2PBZA 1W93A 3GIPA 5DQGA 3BAAA 1WR2A 4A3KG 2NU6B 1SEIA 4EYHB 2ZM6H 3PO3G 1TA8A 3KTMA 3J80W 1W96A 1R9TA 5IP7G 4RZRA 3TQTA 3QZ8A 2J6UA 4JV0A 2C35B 1B33N 1JLLB 4JUZA 3CQZA 4EBEA 3GILA 4YAJB 1XDNA 4DL4A 1B6SA 1ZHQA 5DG9A 2Y0SA 3SE7A 2W6OA 3GTOA 3RBEA 2R8HA 4CC6A 3BA9A 3FMAA 4JI0H 2OWOA 2YS7A 5KKNB 1HNZH 4DV2H 4CC5A 2AQ4A 4A3LG 2FKLA 4F4XA 2RF4A 2VUGA 3K3PA 5L1JA 1RYRA 1WCMG 5EOYA 5BPFA 1B6RA 5F9NA 2XGQA 3WO0A 2Y0SE 3RAQA 4DR3H 5C8YF 3BABA 5KFGA 3H0GA 4EBDA 2V59A 5K2MA 2R7LA 2OLSA 1FVIA 4JV5H 2AGOA 4J9NA 4C5BA 2R8KA 2CQYA 3N8DA 5DQIA 5KG5A 5C3EG 3T1HH 5KFKA 5KFRA 3NGDA 1JDBB 2R7NA 5KG2A 3L4JA 4ECSA 2F4VH 4APMA 3GTJA 1I7NA 2WDTA 3H20A 4TQRA 2UVWA 3OHBA 3JSNA 1E4EB 4LSXA 4A3IG 4XYMB 2PMZA 1K1QA 4QWCA 4X66H 2C2EA 5FPOA 2UVRA 3GTMA 4MA0A 5KG0A 3OSPA 2VQEH 2VA2A 5JUMA 1A0IA 4YR2A 4B3TH 1SYXB 5KG1A 4UCOA 2Q2UA 3Q8SB 4F4WA 3PR5B 2IMWP 1B04A 2FPPB 4JI2H 4YQWA 3RB4A 4FU0A 2UUCH 4ED7A 1RJPA 5T14A 4BY7G 5KFZA 4F50A 2PMZE 5LMNH 1TAEA 4HYKA 2PVPA 4B3RH 4J9KA 2HHHH 1M6VA 5C44G 1JKJB 2O03A 1VBHA 5KFQA 4B3MH 3Q8PB 5IYCG 3T5LA 2JA8G 4QWEA 1MZBA 4E4TA 4J9RA 1P8LA 5KFFA 2JA5G 5J2TF 3VPDA 2IA6A 4YJ2F 3HXLA 2C00A 1C3OA 2W71A 3GTKA 4JI6H 5C5JA 5C1OA 1Y14B 3HKZE 2IBKA 4QIWA 2IP4A 3IG0A 4EFEA 3KXYT 3PVXA 4OX9H 1JXLA 4LFCH 4HQ6A 3J81W 3H0GG 3G6VA 4DL7A 3IN5A 5EZYF 4JI7H 1RJQA 4LF8H 4X65H 2XC9A 3T5JA 3FDSA 5IYBG 1KJJA 2WAQA 4JYAH 3C0FB 2I87A 3TIGA 4FS1A 3OUZA 4LMYA 3MFHA 4RB2C 1GSOA 5DG7A 3HOZG 3LWBA 4WD3A 4B3SH 4EEQA 4I50F 3H40A 4R7RA 4QJFA 5KFWA 1A9XA 2V4QA 3UQ8A 4GC6A 4ZHQF 2DPIA 4ECTA 2YZGA 4DV6H 1L2ZA 5LYJF 2ASDA 2B63A 1GLVA 5EWEA 4YAKB 4RAYA 4IRCA 2WAQE 1XNQH 5DQHA 1N36H 3ETJA 1DV1A 2J6SA 4O3PA 4L1KA 4A3GG 4F4ZA 4ED0A 3OSNA 4QW9A 5KG3A 2YS6A 3OHAA 1DIKA 1T94A 1BJTA 3MR3A 3RB6A 1TWFA 2DWCA 2HGSA 3GTPA 3SI8A 4UCTA 4EGJA 2W9AA 2YCHA 4Q44A 2BQ3A 2WB1E 2YL2A 4R8UB 4BBRG 3GQCA 3OUUA 4HNUA 5KX5F 4DL2A 4DR6H 4XYLB 2UUAH 2JA7A 4LFBH 4ED6A 1E4FT 2XCPA 4R8UA 2R6FA 4UCSA 2W6ZA 3F8NA 4X64H 3J7AK 2PN1A 3M9OB 4A2BA 1SFOA 2W70A 2YW2A 3GTQA 4DR7H 4GKKH 4DV0H 2CW8A 2V58A 4Q43A 5KG4A 4TV8F 4LFAH 3GIJA 4ME6A 4TQSA 4LF4H 3RGZA 1TWGA 2I8CA 3Q8RB 2ALZA 1EYZA 4ZQIA 2R7KA 3CVZA 3L4KA 3L2PA 5KFLA 2HJWA 3V6KA 2W8KA 4MTEA 5LMUH 1I94H 3M9NB 4O4LF 3QZ7A 2FB9A 2ATLA 2FLPA 1T36A 2B63G 4Y8VB 2FPIB 4DR4H 3WNZA 5KFEA 4RAZA 1N56A 5KFBA 4MV4A 4ED2A 1DGSA 1X9NA 2E2HA 2JA5A 2R7MA 4LSAA 4JV1A 3K3VA 2R93A 3Q2OA 2JA6A 5KG7A 4DLKA 3GV7B 4YP3A 2R92A 2UVUA 5KT3A 2W9CB 2RDJA 2W6QA 3G6YA 4DR2H 4GKJH 1Y1WA 4MV7A 5H80A 4IR9A 3Q8QB 4U6PA 4LH7A 2UVVA 2V9WA 1N32H 4MAMA 3WO1A 4J9OA 1V51A 3OTOH 4O2BF 4RB3C 5FLMG 1UC9A 3KAJA 3RUPA 3MR5A 2W9CA 1S97A 5I47A 4HR7A 5EWGA 4ECVA 3PZPA 5LP6F 1BGWA 1O75A 4IWYA 5JQWA 3V4ZA 5FD6A 5IYZF 4IZOA 2JA7G 3MWMA 4LH6A 1AN7A 4JI1H 3JSLA 1DV2A 4C5CA 4C2MA 1UC8A 2DZDA 4QW8A 3RB0A 4F4YA 1UNNC 2CZGA 1FJGH 2RGVA 3E5NA 5KFVA 2ZDGA 2KSWA 3R5HA 1ZHSA 3LP8A 5D1PA 5KFAA 4YBZB 5DGBA 4GLXA 1GGOA 2YYAA 3EYYA 1FKAH 4A93G 3BQ2A 3PW4A 2J6TA 1JIHA 2V4RA 1AUXA 3BJYA 5KFOA 5IT9W 5KFMA 1M0TA 1ULZA 4NLGA 3PW7A 3N44B 1BNCA 3BQ0A 2BQUA 2W57A 2AGPA 1N48A 2YZMA 2XCLA 5KFXA 4UCRA 2NUAB 3MWDA 1XMOH 3RF2A 4IRKA 2C2DA 2C2RA 2AGQA 2UXBH 4M9UA 4ECZA 5C4XG 3GLKA 2R93G 4O3SA 3HB9A 2JA6G 4RUAA 3G8CA 4ECYA 4TUYF 2R92G 4IHJF 1Y1VA 4IRDA 1VBGA 3MJFA 3BG5A 1Y1WG 5FD5A 3R5XA 4DR1H 2VOBA 1KEEA 1Z2OX 2W6MA 1M0WA 2R7ZA 4ETSA 2FPGB 1TWAA 3RTXA 5KFHA 4LF6H 4ECXA 4ECRA 5KT2A 4RNOA 2R8IA 2GLTA 2WE6A 2ZJTA 5KFNA 4QIWE 2E2IA 5KT5A 2XCAA 3H4DA 1K1SA 2I80A 5KFJA 5DGAA 1ZETA 2FP4B 1S0OA 2Q2TA 1KJIA 1Z2NX 4LF9H 3G6XA 5CA1F 5EDWA 2HVQA 4PDBA 4I55F 5LA6F 4YY3H 3VPBA 4Q8EA 1XNRH 4PWQA 4ECWA 3H4BA 3PW0A 2BR0A 1SCUB 4DL5A 3KALA 1KBLA 5KT4A 3K5IA 2JEJA 1EHIA 2YU9A 1WSCA 5KT6A 3I12A 4MA5A 1N34H 2R87A 3Q1KA 4LF7H 4KHPH 4DV5H 3BQ1A 2VA3A 4K0KH 2FK3A 3I4MG 4IR1A 5J2UF 2R84A 1Z2PX 3MFIA 4MV8A 4O4HF 2DLNA 4UCVA 1KC7A 4ED8A 3QFFA 1JDEA 1RYSA 3M4IA 5CAEB 5IWAH 4ECUA 3U9SA 4FBUA 4AQYH 5KT7A 1Y1VG 5FJ8G 2W6NA 2J9GA 1M7JA 2R82A 4ED3A 1GSAA 3RB3A 5CB4F 3HOYG 2P0AA 4JI8H 3PN1A 3N41B 3RAXA 2R7ZG 4JV2A 2R86A 1KJQA 1KJ8A 2NU8B 2VUMA 2XIGA 5KFPA 5L1IA 1C30A 2CKZB 2BQRA 3HOWG 1OWTA 4I4TF 1EUCB 4DV1H 3RBDA 1PX2A 1S9FA 2NVYA 1IBLH 1IBMH 4WBNF 3RGXA 2YZNA 1EUDB 1PK8A 2VPQA 4JI5H 3N43B 5KFSA 4EFBA 3FKIA 1J5EH 2ZDQA 4A3FG 4M7EA 2UXDH 1RK6A 4EGQA 4DV7H 4RUCA 3V6HA 4Q45A 4A3EG 3JAMW 3MR2A 1XMQH 3JRXA 3LMLA 5A2QW 4Q8FA 1E4GT 2FK1A 3PR4A 3BA8A 4G3IA 5GONF 5BPHA 4A2AA 4GC7A 4HNVA 3HOVG 2R8JA 2W7OA 3GIQA 3KHLA 1S68A 4RNMA 1WH2A 1JX4A 3AYHB 1I7LA 3V4SA 3GIMA 4UCUA 1K83A 4X62H 1I3QA 2HVRA 3I4NG 1HNWH 4BBSG 3DF7A 4DUYH 5F9LA 3TIIA 4DV4H 1KJ9A 3VPCA 1N33H 5KFYA 4FS2A 5KG6A 2JEGA 1ZQ7A 3TQ1A 4BXXG 3RIZA 4EYIB 4EEYA 2X0SA
chains in the Genus database with same CATH topology
2YCHA 1XDNA 2FE3A 4I7HA 1ZHQA 2MCTA 1GYFA 2WE6A 2ZJTA 3N42B 1IBKH 2WYOA 2Q2TA 4CC6A 3BA9A 3FMAA 4JI0H 1Z2NX 2OWOA 4LF5H 4LF9H 1HNZH 4DR6H 2HVQA 4DV2H 4CC5A 4PDBA 2UUAH 4UFZA 4YY3H 4LFBH 2UU9H 1E4FT 2VUGA 1XNRH 4UCSA 3F8NA 5EOYA 5FPRA 4X64H 5BR8H 3J7AK 4A2BA 4DR7H 3KALA 4FM9A 4DV0H 4DR3H 3BABA 4GKKH 4DUZH 2CW8A 1FVIA 3RIZA 4LFAH 4JV5H 4J0MA 4LF4H 3RGZA 1N34H 3CVZA 3L4KA 4YHHH 4LF7H 4NXNH 3T1HH 4KHPH 1VS0A 3KAKA 3L2PA 4DV5H 3N40P 4RB1A 4LF6H 4K0KH 2UUBH 4MTEA 5LMUH 1I94H 3L4JA 1Z2PX 2UXCH 2F4VH 4APMA 2WDTA 3H20A 2VQFH 3JSNA 4DR4H 4UCVA 4RAZA 4LSXA 3M4IA 5IWAH 1DGSA 1X9NA 1S03G 4LSAA 4X66H 3K3VA 4Q0YA 5FPOA 4DV3H 4JI3H 4AQYH 4RB0A 2VQEH 1A0IA 4B3TH 1SYXB 4UCOA 2Q2UA 4DR2H 4GKJH 1B04A 4MV7A 5FLXW 4JI8H 3PN1A 3N41B 4JI2H 2HVSA 2UUCH 2RGRA 4LH7A 1N32H 2VPSA 5D1OB 5LMNH 1TAEA 3OTOH 4RB3C 3KAJA 3T1YH 4B3RH 2XIGA 2HHHH 4DR5H 2O03A 4B3MH 1V9PA 1BGWA 1MZBA 1O75A 3N6XA 1P8LA 4DV1H 1IBLH 5LL6b 2E5LH 1IBMH 5FD6A 4MV9A 5D1OA 3HXLA 3RGXA 3MWMA 4JI6H 4LH6A 1AN7A 4JI1H 3JSLA 3N43B 4JI5H 4EFBA 3IG0A 4EFEA 1J5EH 3KXYT 4OX9H 1FJGH 2CW7A 2RGVA 4M7EA 4LFCH 2UXDH 4DV7H 5D1PA 2KSWA 3J81W 1ZHSA 1FKAH 4JI7H 4GLXA 3EYYA 3JAMW 4X65H 1XMQH 4LF8H 3LMLA 4JYAH 3C0FB 3RJ0A 5A2QW 1E4GT 3BA8A 4LMYA 4RB2C 4NXMH 5IT9W 4A2AA 1M0TA 4MTDA 4B3SH 3N44B 1I6UA 4EEQA 1HNXH 4R7RA 2W57A 1S68A 3UQ8A 1L2ZA 1WH2A 4DV6H 4BWSC 4UCRA 4JI4H 4UCUA 3RF2A 1XMOH 4RAYA 4RZQA 4X62H 4IAJA 1HR0H 2UXBH 2HVRA 1XNQH 1N36H 1HNWH 3BAAA 3DF7A 4ETSA 4DUYH 4DV4H 1SEIA 2ZM6H 1TA8A 5FD5A 3J80W 1N33H 1BJTA 4DR1H 2VOBA 1Z2OX 1M0WA 2HGSA 4UCTA 3RTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH2 A;  3K3V A;  4BWS C;  3FMA A;  1GYF A;  1SYX B;  1L2Z A; 
#chains in the Genus database with same CATH topology
 3KHR A;  2VUM G;  2R85 A;  2FE3 A;  4I7H A;  1GO3 E;  4A3D G;  4DL3 A;  2MCT A;  2YRX A;  1GYF A;  5KFC A;  1CQJ B;  3GIK A;  3GID A;  3N42 B;  3UFX B;  1IBK H;  3VMM A;  2WYO A;  5JH7 F;  1VAJ A;  3MWE A;  2R8G A;  4MV1 A;  1AUV A;  4RU9 A;  3EPI A;  4XZ3 B;  3RFC A;  4RNN A;  2DPJ A;  2FK2 A;  4LF5 H;  3PO2 G;  2WTF A;  4DL6 A;  2FLN A;  4UFZ A;  2UU9 H;  4J9S A;  3FKI G;  2FMA A;  5KFI A;  5IYD G;  1TWC A;  5FPR A;  4XX0 B;  5D8D A;  5HBR B;  5BR8 H;  3H3V H;  2ZDH A;  3RV3 A;  4FM9 A;  5KFU A;  1E4E A;  4DUZ H;  2VQD A;  2XGP A;  3T5H A;  2FLL A;  5DG8 A;  5EWF A;  4J0M A;  3HKZ A;  2GPS A;  5L9X A;  4YHH H;  3HOX G;  2GPW A;  4NXN H;  1VS0 A;  2QYZ A;  3KAK A;  2C28 A;  2RDI A;  3N40 P;  3JZI A;  4RB1 A;  3V6J A;  2UUB H;  4O4I F;  4HNT A;  4EG0 A;  4MV3 A;  4A3B G;  2UXC H;  5JVD F;  2ASJ A;  4QWA A;  2VQF H;  3JRW A;  3GV8 B;  4A3M G;  4YR3 A;  5L1L A;  3HBL A;  5JVL A;  3PW2 A;  3K5H A;  1S03 G;  4Q0Y A;  4DV3 H;  4JI3 H;  5KFT A;  1IOV A;  4ECQ A;  4RB0 A;  1CQI B;  1V4Y A;  2W9B B;  1S10 A;  2W6P A;  1RJR A;  4MV6 A;  4A3C G;  2W7P A;  4FBT A;  3GV5 B;  1TWH A;  5FLX W;  2RGR A;  4BY1 G;  2HVS A;  4ZI7 F;  1VKZ A;  2VPS A;  3MR6 A;  3ORR A;  5IP9 G;  5D1O B;  1GSH A;  2V5A A;  3ORQ A;  2JEF A;  4YB8 B;  4QWD A;  2W9B A;  3T1Y H;  3GTL A;  4DR5 H;  4C5A A;  4J9P A;  3KHH A;  3TIN A;  4EBC A;  5L1K A;  1V9P A;  3EPG A;  2ASL A;  3GTG A;  4YJ3 F;  4YR0 A;  4J9Q A;  4IWX A;  3N6X A;  5DLF A;  5HV6 A;  5LL6 b;  3R23 A;  2E5L H;  1BXR A;  2QK4 A;  1IOW A;  4AYB A;  2W8L A;  4MV9 A;  5D1O A;  1S0M A;  4O3R A;  1S0N A;  5LOV F;  4U7C A;  2WB1 A;  3U9T A;  5C1P A;  2OH2 A;  1WCM A;  1CE8 A;  2CW7 A;  4TV9 F;  2NVX A;  3R5F A;  3T5K A;  3ETH A;  1RK5 A;  3HOU G;  1I50 A;  5LXT F;  5DLG A;  4J9M A;  1T3N A;  2NU7 B;  3RJ0 A;  3M9M B;  1EZ1 A;  2DIK A;  4AYB E;  2VR1 A;  4O3Q A;  3KHG A;  4A3J G;  2FJZ A;  4NXM H;  4O3N A;  4MTD A;  1CS0 A;  2C22 A;  4QWB A;  4O3O A;  1I6U A;  3PW5 A;  2AU0 A;  4J9L A;  1HNX H;  5BMV F;  2YRW A;  4ZOL F;  3RV4 A;  2SCU B;  2M05 A;  4BWS C;  4JI4 H;  2XD4 A;  2NU9 B;  4RZQ A;  2JEI A;  4IAJ A;  5CA0 F;  4ED1 A;  1HR0 H;  3GII A;  4O2A F;  5KFD A;  2PBZ A;  1W93 A;  3GIP A;  5DQG A;  3BAA A;  1WR2 A;  4A3K G;  2NU6 B;  1SEI A;  4EYH B;  2ZM6 H;  3PO3 G;  1TA8 A;  3KTM A;  3J80 W;  1W96 A;  1R9T A;  5IP7 G;  4RZR A;  3TQT A;  3QZ8 A;  2J6U A;  4JV0 A;  2C35 B;  1B33 N;  1JLL B;  4JUZ A;  3CQZ A;  4EBE A;  3GIL A;  4YAJ B;  1XDN A;  4DL4 A;  1B6S A;  1ZHQ A;  5DG9 A;  2Y0S A;  3SE7 A;  2W6O A;  3GTO A;  3RBE A;  2R8H A;  4CC6 A;  3BA9 A;  3FMA A;  4JI0 H;  2OWO A;  2YS7 A;  5KKN B;  1HNZ H;  4DV2 H;  4CC5 A;  2AQ4 A;  4A3L G;  2FKL A;  4F4X A;  2RF4 A;  2VUG A;  3K3P A;  5L1J A;  1RYR A;  1WCM G;  5EOY A;  5BPF A;  1B6R A;  5F9N A;  2XGQ A;  3WO0 A;  2Y0S E;  3RAQ A;  4DR3 H;  5C8Y F;  3BAB A;  5KFG A;  3H0G A;  4EBD A;  2V59 A;  5K2M A;  2R7L A;  2OLS A;  1FVI A;  4JV5 H;  2AGO A;  4J9N A;  4C5B A;  2R8K A;  2CQY A;  3N8D A;  5DQI A;  5KG5 A;  5C3E G;  3T1H H;  5KFK A;  5KFR A;  3NGD A;  1JDB B;  2R7N A;  5KG2 A;  3L4J A;  4ECS A;  2F4V H;  4APM A;  3GTJ A;  1I7N A;  2WDT A;  3H20 A;  4TQR A;  2UVW A;  3OHB A;  3JSN A;  1E4E B;  4LSX A;  4A3I G;  4XYM B;  2PMZ A;  1K1Q A;  4QWC A;  4X66 H;  2C2E A;  5FPO A;  2UVR A;  3GTM A;  4MA0 A;  5KG0 A;  3OSP A;  2VQE H;  2VA2 A;  5JUM A;  1A0I A;  4YR2 A;  4B3T H;  1SYX B;  5KG1 A;  4UCO A;  2Q2U A;  3Q8S B;  4F4W A;  3PR5 B;  2IMW P;  1B04 A;  2FPP B;  4JI2 H;  4YQW A;  3RB4 A;  4FU0 A;  2UUC H;  4ED7 A;  1RJP A;  5T14 A;  4BY7 G;  5KFZ A;  4F50 A;  2PMZ E;  5LMN H;  1TAE A;  4HYK A;  2PVP A;  4B3R H;  4J9K A;  2HHH H;  1M6V A;  5C44 G;  1JKJ B;  2O03 A;  1VBH A;  5KFQ A;  4B3M H;  3Q8P B;  5IYC G;  3T5L A;  2JA8 G;  4QWE A;  1MZB A;  4E4T A;  4J9R A;  1P8L A;  5KFF A;  2JA5 G;  5J2T F;  3VPD A;  2IA6 A;  4YJ2 F;  3HXL A;  2C00 A;  1C3O A;  2W71 A;  3GTK A;  4JI6 H;  5C5J A;  5C1O A;  1Y14 B;  3HKZ E;  2IBK A;  4QIW A;  2IP4 A;  3IG0 A;  4EFE A;  3KXY T;  3PVX A;  4OX9 H;  1JXL A;  4LFC H;  4HQ6 A;  3J81 W;  3H0G G;  3G6V A;  4DL7 A;  3IN5 A;  5EZY F;  4JI7 H;  1RJQ A;  4LF8 H;  4X65 H;  2XC9 A;  3T5J A;  3FDS A;  5IYB G;  1KJJ A;  2WAQ A;  4JYA H;  3C0F B;  2I87 A;  3TIG A;  4FS1 A;  3OUZ A;  4LMY A;  3MFH A;  4RB2 C;  1GSO A;  5DG7 A;  3HOZ G;  3LWB A;  4WD3 A;  4B3S H;  4EEQ A;  4I50 F;  3H40 A;  4R7R A;  4QJF A;  5KFW A;  1A9X A;  2V4Q A;  3UQ8 A;  4GC6 A;  4ZHQ F;  2DPI A;  4ECT A;  2YZG A;  4DV6 H;  1L2Z A;  5LYJ F;  2ASD A;  2B63 A;  1GLV A;  5EWE A;  4YAK B;  4RAY A;  4IRC A;  2WAQ E;  1XNQ H;  5DQH A;  1N36 H;  3ETJ A;  1DV1 A;  2J6S A;  4O3P A;  4L1K A;  4A3G G;  4F4Z A;  4ED0 A;  3OSN A;  4QW9 A;  5KG3 A;  2YS6 A;  3OHA A;  1DIK A;  1T94 A;  1BJT A;  3MR3 A;  3RB6 A;  1TWF A;  2DWC A;  2HGS A;  3GTP A;  3SI8 A;  4UCT A;  4EGJ A;  2W9A A;  2YCH A;  4Q44 A;  2BQ3 A;  2WB1 E;  2YL2 A;  4R8U B;  4BBR G;  3GQC A;  3OUU A;  4HNU A;  5KX5 F;  4DL2 A;  4DR6 H;  4XYL B;  2UUA H;  2JA7 A;  4LFB H;  4ED6 A;  1E4F T;  2XCP A;  4R8U A;  2R6F A;  4UCS A;  2W6Z A;  3F8N A;  4X64 H;  3J7A K;  2PN1 A;  3M9O B;  4A2B A;  1SFO A;  2W70 A;  2YW2 A;  3GTQ A;  4DR7 H;  4GKK H;  4DV0 H;  2CW8 A;  2V58 A;  4Q43 A;  5KG4 A;  4TV8 F;  4LFA H;  3GIJ A;  4ME6 A;  4TQS A;  4LF4 H;  3RGZ A;  1TWG A;  2I8C A;  3Q8R B;  2ALZ A;  1EYZ A;  4ZQI A;  2R7K A;  3CVZ A;  3L4K A;  3L2P A;  5KFL A;  2HJW A;  3V6K A;  2W8K A;  4MTE A;  5LMU H;  1I94 H;  3M9N B;  4O4L F;  3QZ7 A;  2FB9 A;  2ATL A;  2FLP A;  1T36 A;  2B63 G;  4Y8V B;  2FPI B;  4DR4 H;  3WNZ A;  5KFE A;  4RAZ A;  1N56 A;  5KFB A;  4MV4 A;  4ED2 A;  1DGS A;  1X9N A;  2E2H A;  2JA5 A;  2R7M A;  4LSA A;  4JV1 A;  3K3V A;  2R93 A;  3Q2O A;  2JA6 A;  5KG7 A;  4DLK A;  3GV7 B;  4YP3 A;  2R92 A;  2UVU A;  5KT3 A;  2W9C B;  2RDJ A;  2W6Q A;  3G6Y A;  4DR2 H;  4GKJ H;  1Y1W A;  4MV7 A;  5H80 A;  4IR9 A;  3Q8Q B;  4U6P A;  4LH7 A;  2UVV A;  2V9W A;  1N32 H;  4MAM A;  3WO1 A;  4J9O A;  1V51 A;  3OTO H;  4O2B F;  4RB3 C;  5FLM G;  1UC9 A;  3KAJ A;  3RUP A;  3MR5 A;  2W9C A;  1S97 A;  5I47 A;  4HR7 A;  5EWG A;  4ECV A;  3PZP A;  5LP6 F;  1BGW A;  1O75 A;  4IWY A;  5JQW A;  3V4Z A;  5FD6 A;  5IYZ F;  4IZO A;  2JA7 G;  3MWM A;  4LH6 A;  1AN7 A;  4JI1 H;  3JSL A;  1DV2 A;  4C5C A;  4C2M A;  1UC8 A;  2DZD A;  4QW8 A;  3RB0 A;  4F4Y A;  1UNN C;  2CZG A;  1FJG H;  2RGV A;  3E5N A;  5KFV A;  2ZDG A;  2KSW A;  3R5H A;  1ZHS A;  3LP8 A;  5D1P A;  5KFA A;  4YBZ B;  5DGB A;  4GLX A;  1GGO A;  2YYA A;  3EYY A;  1FKA H;  4A93 G;  3BQ2 A;  3PW4 A;  2J6T A;  1JIH A;  2V4R A;  1AUX A;  3BJY A;  5KFO A;  5IT9 W;  5KFM A;  1M0T A;  1ULZ A;  4NLG A;  3PW7 A;  3N44 B;  1BNC A;  3BQ0 A;  2BQU A;  2W57 A;  2AGP A;  1N48 A;  2YZM A;  2XCL A;  5KFX A;  4UCR A;  2NUA B;  3MWD A;  1XMO H;  3RF2 A;  4IRK A;  2C2D A;  2C2R A;  2AGQ A;  2UXB H;  4M9U A;  4ECZ A;  5C4X G;  3GLK A;  2R93 G;  4O3S A;  3HB9 A;  2JA6 G;  4RUA A;  3G8C A;  4ECY A;  4TUY F;  2R92 G;  4IHJ F;  1Y1V A;  4IRD A;  1VBG A;  3MJF A;  3BG5 A;  1Y1W G;  5FD5 A;  3R5X A;  4DR1 H;  2VOB A;  1KEE A;  1Z2O X;  2W6M A;  1M0W A;  2R7Z A;  4ETS A;  2FPG B;  1TWA A;  3RTX A;  5KFH A;  4LF6 H;  4ECX A;  4ECR A;  5KT2 A;  4RNO A;  2R8I A;  2GLT A;  2WE6 A;  2ZJT A;  5KFN A;  4QIW E;  2E2I A;  5KT5 A;  2XCA A;  3H4D A;  1K1S A;  2I80 A;  5KFJ A;  5DGA A;  1ZET A;  2FP4 B;  1S0O A;  2Q2T A;  1KJI A;  1Z2N X;  4LF9 H;  3G6X A;  5CA1 F;  5EDW A;  2HVQ A;  4PDB A;  4I55 F;  5LA6 F;  4YY3 H;  3VPB A;  4Q8E A;  1XNR H;  4PWQ A;  4ECW A;  3H4B A;  3PW0 A;  2BR0 A;  1SCU B;  4DL5 A;  3KAL A;  1KBL A;  5KT4 A;  3K5I A;  2JEJ A;  1EHI A;  2YU9 A;  1WSC A;  5KT6 A;  3I12 A;  4MA5 A;  1N34 H;  2R87 A;  3Q1K A;  4LF7 H;  4KHP H;  4DV5 H;  3BQ1 A;  2VA3 A;  4K0K H;  2FK3 A;  3I4M G;  4IR1 A;  5J2U F;  2R84 A;  1Z2P X;  3MFI A;  4MV8 A;  4O4H F;  2DLN A;  4UCV A;  1KC7 A;  4ED8 A;  3QFF A;  1JDE A;  1RYS A;  3M4I A;  5CAE B;  5IWA H;  4ECU A;  3U9S A;  4FBU A;  4AQY H;  5KT7 A;  1Y1V G;  5FJ8 G;  2W6N A;  2J9G A;  1M7J A;  2R82 A;  4ED3 A;  1GSA A;  3RB3 A;  5CB4 F;  3HOY G;  2P0A A;  4JI8 H;  3PN1 A;  3N41 B;  3RAX A;  2R7Z G;  4JV2 A;  2R86 A;  1KJQ A;  1KJ8 A;  2NU8 B;  2VUM A;  2XIG A;  5KFP A;  5L1I A;  1C30 A;  2CKZ B;  2BQR A;  3HOW G;  1OWT A;  4I4T F;  1EUC B;  4DV1 H;  3RBD A;  1PX2 A;  1S9F A;  2NVY A;  1IBL H;  1IBM H;  4WBN F;  3RGX A;  2YZN A;  1EUD B;  1PK8 A;  2VPQ A;  4JI5 H;  3N43 B;  5KFS A;  4EFB A;  3FKI A;  1J5E H;  2ZDQ A;  4A3F G;  4M7E A;  2UXD H;  1RK6 A;  4EGQ A;  4DV7 H;  4RUC A;  3V6H A;  4Q45 A;  4A3E G;  3JAM W;  3MR2 A;  1XMQ H;  3JRX A;  3LML A;  5A2Q W;  4Q8F A;  1E4G T;  2FK1 A;  3PR4 A;  3BA8 A;  4G3I A;  5GON F;  5BPH A;  4A2A A;  4GC7 A;  4HNV A;  3HOV G;  2R8J A;  2W7O A;  3GIQ A;  3KHL A;  1S68 A;  4RNM A;  1WH2 A;  1JX4 A;  3AYH B;  1I7L A;  3V4S A;  3GIM A;  4UCU A;  1K83 A;  4X62 H;  1I3Q A;  2HVR A;  3I4N G;  1HNW H;  4BBS G;  3DF7 A;  4DUY H;  5F9L A;  3TII A;  4DV4 H;  1KJ9 A;  3VPC A;  1N33 H;  5KFY A;  4FS2 A;  5KG6 A;  2JEG A;  1ZQ7 A;  3TQ1 A;  4BXX G;  3RIZ A;  4EYI B;  4EEY A;  2X0S A; 
#chains in the Genus database with same CATH homology
 2YCH A;  1XDN A;  2FE3 A;  4I7H A;  1ZHQ A;  2MCT A;  1GYF A;  2WE6 A;  2ZJT A;  3N42 B;  1IBK H;  2WYO A;  2Q2T A;  4CC6 A;  3BA9 A;  3FMA A;  4JI0 H;  1Z2N X;  2OWO A;  4LF5 H;  4LF9 H;  1HNZ H;  4DR6 H;  2HVQ A;  4DV2 H;  4CC5 A;  4PDB A;  2UUA H;  4UFZ A;  4YY3 H;  4LFB H;  2UU9 H;  1E4F T;  2VUG A;  1XNR H;  4UCS A;  3F8N A;  5EOY A;  5FPR A;  4X64 H;  5BR8 H;  3J7A K;  4A2B A;  4DR7 H;  3KAL A;  4FM9 A;  4DV0 H;  4DR3 H;  3BAB A;  4GKK H;  4DUZ H;  2CW8 A;  1FVI A;  3RIZ A;  4LFA H;  4JV5 H;  4J0M A;  4LF4 H;  3RGZ A;  1N34 H;  3CVZ A;  3L4K A;  4YHH H;  4LF7 H;  4NXN H;  3T1H H;  4KHP H;  1VS0 A;  3KAK A;  3L2P A;  4DV5 H;  3N40 P;  4RB1 A;  4LF6 H;  4K0K H;  2UUB H;  4MTE A;  5LMU H;  1I94 H;  3L4J A;  1Z2P X;  2UXC H;  2F4V H;  4APM A;  2WDT A;  3H20 A;  2VQF H;  3JSN A;  4DR4 H;  4UCV A;  4RAZ A;  4LSX A;  3M4I A;  5IWA H;  1DGS A;  1X9N A;  1S03 G;  4LSA A;  4X66 H;  3K3V A;  4Q0Y A;  5FPO A;  4DV3 H;  4JI3 H;  4AQY H;  4RB0 A;  2VQE H;  1A0I A;  4B3T H;  1SYX B;  4UCO A;  2Q2U A;  4DR2 H;  4GKJ H;  1B04 A;  4MV7 A;  5FLX W;  4JI8 H;  3PN1 A;  3N41 B;  4JI2 H;  2HVS A;  2UUC H;  2RGR A;  4LH7 A;  1N32 H;  2VPS A;  5D1O B;  5LMN H;  1TAE A;  3OTO H;  4RB3 C;  3KAJ A;  3T1Y H;  4B3R H;  2XIG A;  2HHH H;  4DR5 H;  2O03 A;  4B3M H;  1V9P A;  1BGW A;  1MZB A;  1O75 A;  3N6X A;  1P8L A;  4DV1 H;  1IBL H;  5LL6 b;  2E5L H;  1IBM H;  5FD6 A;  4MV9 A;  5D1O A;  3HXL A;  3RGX A;  3MWM A;  4JI6 H;  4LH6 A;  1AN7 A;  4JI1 H;  3JSL A;  3N43 B;  4JI5 H;  4EFB A;  3IG0 A;  4EFE A;  1J5E H;  3KXY T;  4OX9 H;  1FJG H;  2CW7 A;  2RGV A;  4M7E A;  4LFC H;  2UXD H;  4DV7 H;  5D1P A;  2KSW A;  3J81 W;  1ZHS A;  1FKA H;  4JI7 H;  4GLX A;  3EYY A;  3JAM W;  4X65 H;  1XMQ H;  4LF8 H;  3LML A;  4JYA H;  3C0F B;  3RJ0 A;  5A2Q W;  1E4G T;  3BA8 A;  4LMY A;  4RB2 C;  4NXM H;  5IT9 W;  4A2A A;  1M0T A;  4MTD A;  4B3S H;  3N44 B;  1I6U A;  4EEQ A;  1HNX H;  4R7R A;  2W57 A;  1S68 A;  3UQ8 A;  1L2Z A;  1WH2 A;  4DV6 H;  4BWS C;  4UCR A;  4JI4 H;  4UCU A;  3RF2 A;  1XMO H;  4RAY A;  4RZQ A;  4X62 H;  4IAJ A;  1HR0 H;  2UXB H;  2HVR A;  1XNQ H;  1N36 H;  1HNW H;  3BAA A;  3DF7 A;  4ETS A;  4DUY H;  4DV4 H;  1SEI A;  2ZM6 H;  1TA8 A;  5FD5 A;  3J80 W;  1N33 H;  1BJT A;  4DR1 H;  2VOB A;  1Z2O X;  1M0W A;  2HGS A;  4UCT A;  3RTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...