4BWSC

Crystal structure of the heterotrimer of pqbp1, u5-15kd and u5-52kd.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
HHHMDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THIOREDOXIN-LIKE PROTEIN 4A
publication title Mutations in the Pqbp1 Gene Prevent its Interaction with the Spliceosomal Protein U5-15Kd.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 12
structure length 66
sequence length 66
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4bwsC00
3FMAA 1SYXB 4BWSC 1GYFA 1L2ZA 1WH2A 3K3VA
chains in the Genus database with same CATH superfamily
2FLLA 2R7NA 1KJQA 4A3DG 4BWSC 5KG0A 2W8KA 4YY3H 3Q8PB 2W6PA 5CA1F 3GV7B 2NU8B 1A9XA 4DV0H 2MCTA 3I12A 2R82A 5EOYA 5KG1A 2R86A 5KFWA 4EEYA 5IP7G 4RB2C 3GTOA 2R8IA 2NVYA 3CVZA 5DQHA 3OTOH 4U7CA 1VBGA 5F9LA 4QJFA 3RUPA 5KFDA 4F4YA 1N56A 4IWYA 4BY1G 3G6YA 2DIKA 4R7RA 2UXCH 4B3SH 2VUGA 1X9NA 2DPJA 1BGWA 2R85A 3VPCA 2W7OA 2CQYA 5KFTA 2ATLA 2JA5G 4JI4H 5KFIA 4WD3A 2JA7G 3PVXA 5KKNB 4YHHH 2W8LA 1E4EB 1JIHA 2WYOA 4LF9H 4O2BF 4RUAA 4DR7H 1BJTA 3JAMW 4KHPH 3MFIA 2C28A 3J81W 3HOWG 2PMZA 4ED1A 4JV0A 2V4QA 4DUYH 4O3OA 4DL4A 1XMQH 2WE6A 5DGBA 3BA8A 1S0NA 4MTDA 5L1IA 2DZDA 2Y0SE 1S0MA 4LF5H 3N43B 3GV8B 5C1OA 4DR5H 4A3EG 4Q8FA 5FD6A 1WSCA 1ZHSA 2IA6A 2I8CA 1E4GT 4RNMA 5KFKA 3PW2A 1L2ZA 2JA6A 3FDSA 4FU0A 4A3CG 3MR3A 4MA0A 3H20A 2DPIA 4OX9H 4GKJH 4YR2A 1BXRA 1KJIA 1Y1VG 1N32H 2C35B 2C2DA 4GKKH 3F8NA 4YJ2F 5HV6A 3GILA 1W93A 3BAAA 5C8YF 4ETSA 3RBDA 4A3GG 5J2TF 4YAKB 3QZ7A 2RDJA 4LFBH 1KJ8A 4ECZA 4I50F 2UU9H 3E5NA 1Y1WG 1FKAH 5JVLA 1J5EH 5KFSA 5KFAA 4DLKA 3GTLA 3HXLA 3N40P 2W9BB 4MV9A 2W9AA 4J9MA 4JI5H 2WB1A 4ECWA 5KG2A 1K1SA 5IYBG 1Y1VA 2YYAA 5D1OB 3R5HA 2RGVA 3LP8A 5KFYA 4Y8VB 2NUAB 5EZYF 3HOVG 4IWXA 4UCVA 5LXTF 4UCTA 3N44B 4HNVA 3HBLA 1RYRA 2M05A 3MR5A 3RAQA 2AGOA 3WO0A 4I55F 4I4TF 2R92G 1P8LA 2X0SA 2XCPA 1N36H 3RV4A 2JA8G 3M9OB 4O3NA 1KJ9A 2FMAA 4RZRA 3MWMA 2VUMG 2IBKA 2F4VH 3CQZA 1AN7A 3RV3A 5DLFA 3L2PA 4DR1H 4O3SA 4R8UA 3AYHB 1JX4A 2R7KA 2FE3A 2NU6B 3N6XA 4LH7A 4EFBA 4GC7A 1N33H 1I50A 1JDBB 5L1KA 4ZOLF 5KT6A 5JH7F 4RNNA 1T3NA 4LMYA 2R92A 4X65H 3MR2A 2DLNA 1VKZA 2J6SA 2FPIB 4YQWA 4DL6A 4PWQA 2FB9A 4RB3C 4QW9A 2W9CA 2R93G 5FLXW 2JEGA 2R84A 5LMNH 4JI0H 4DL3A 2PBZA 4F50A 2CZGA 1ULZA 2J9GA 4FBUA 4TUYF 1GGOA 3RGXA 3V6KA 1VBHA 4J9OA 5KFLA 3PW0A 1CE8A 3V6JA 3G8CA 2SCUB 4RU9A 5FPRA 4YR0A 2NVXA 3GIMA 4K0KH 2VPQA 4WBNF 4J0MA 2R87A 1GSHA 5HBRB 4MTEA 5L1JA 5C1PA 4O3PA 3JRWA 5L9XA 3Q8QB 2JEFA 4YR3A 2V58A 2CKZB 3M9MB 4O3RA 4FS1A 2R93A 3DF7A 1K1QA 1C30A 3LMLA 1W96A 1XDNA 4I7HA 4DV7H 2VOBA 2GLTA 5A2QW 4L1KA 1IBMH 4NXNH 1I7LA 1Z2PX 1CQJB 1GLVA 3KTMA 5C5JA 4JI1H 4IR1A 3KAJA 1VAJA 2XCLA 3KHGA 4QWAA 1SYXB 2Y0SA 3Q1KA 3OHAA 5KG6A 4YAJB 3GTPA 3QZ8A 4ZQIA 5EDWA 4E4TA 5CB4F 1TWCA 3N8DA 1EHIA 3RIZA 1DGSA 5IYDG 5LMUH 4M7EA 4RB0A 4LSAA 2FP4B 3GTQA 3J7AK 4MV7A 5T14A 2FLPA 1ZQ7A 4CC6A 3K3PA 5BMVF 4MV4A 5DGAA 1B6SA 2J6TA 2UVUA 2FPPB 4CC5A 4ZHQF 3GIKA 2XCAA 1AUVA 4IRCA 2YL2A 3GIQA 3RFCA 3GTMA 1BNCA 5BPHA 2UVRA 3HOYG 1TAEA 4TV8F 1GO3E 2C00A 3HKZE 3V4SA 1GSOA 4J9PA 5FPOA 1T94A 4F4XA 1KJJA 3KHRA 1K83A 3JZIA 4APMA 4IRDA 2IP4A 2ZJTA 3TINA 1UNNC 4A3JG 2QK4A 4A3FG 3OUZA 4DR6H 4QWBA 4ECVA 3OUUA 1RYSA 4AYBE 2JA5A 3PW5A 2GPSA 5I47A 2JA7A 5FD5A 3U9TA 5FJ8G 4AQYH 4G3IA 5EWFA 4A93G 2W57A 4ED7A 3TIIA 5KFBA 4A3MG 2W6ZA 3FMAA 3T1HH 2YCHA 2P0AA 3UQ8A 5IP9G 3FKIG 3JSNA 4IAJA 1DV2A 1TWFA 3GQCA 1ZETA 1FVIA 5D1PA 1IOWA 4J9RA 2R8KA 4A3LG 2YRXA 2V4RA 4A2BA 5KG7A 4ECUA 2NU7B 4C5CA 3KAKA 5KT5A 1E4EA 3EPIA 4J9LA 2E2IA 4JYAH 3RB0A 2YS7A 2ZM6H 4EYHB 4J9SA 3M9NB 3T5HA 2VQDA 4IZOA 3GIJA 2V59A 3EYYA 5DQGA 5KT7A 2OWOA 2B63G 3V6HA 2WAQA 2AQ4A 2W6OA 4TQSA 2OH2A 4DR2H 4Q43A 4ED3A 4HYKA 3RTXA 1V4YA 3BQ0A 1B04A 5KFGA 2W6QA 3G6XA 1V51A 5KFUA 4ED6A 1M0TA 4YJ3F 3MR6A 4DR3H 2YW2A 5KT3A 1I94H 4JUZA 3I4NG 5L1LA 1IBLH 4M9UA 1EZ1A 4XZ3B 4R8UB 1TWGA 4UCSA 2W70A 5KFQA 4RB1A 4JV1A 2PMZE 1Y1WA 2UXBH 3T1YH 2FK2A 3BA9A 5KFRA 4FBTA 4NLGA 2B63A 1GSAA 2KSWA 5DG8A 1S97A 1TWAA 3SE7A 1MZBA 4Q0YA 1C3OA 4LH6A 5DQIA 2BQRA 4JI2H 2JEJA 3G6VA 2AGQA 5BR8H 1S9FA 1IBKH 1S03G 5KT2A 2BR0A 3BABA 5K2MA 5LA6F 4Q8EA 5IT9W 4UCUA 3H0GG 5LP6F 4UFZA 5KFEA 3T5JA 3GIIA 1I3QA 2FKLA 4TV9F 5KFXA 2JEIA 3GIPA 4LSXA 2W6MA 5KG4A 4U6PA 1PK8A 3PO3G 3K5HA 3K3VA 3JRXA 4A3KG 4ECQA 2XD4A 5D1OA 4JV2A 4YB8B 2ASLA 5EWEA 3GLKA 2VUMA 3IN5A 3I4MG 4B3RH 3H4DA 4DL2A 2W7PA 3PW7A 5DLGA 1N48A 4ECSA 3H0GA 2HHHH 4LF8H 2XIGA 5DG9A 3NGDA 4J9KA 2UVWA 5JVDF 5LOVF 4MV6A 2OLSA 1KC7A 4EFEA 4J9QA 2V9WA 4DV4H 5KFMA 4RUCA 2RGRA 1JDEA 2HGSA 4JV5H 4MV1A 2YZGA 4LFAH 4HNUA 1B33N 4EBDA 5IYZF 2ALZA 5H80A 4X66H 2WDTA 1S0OA 2Q2TA 4ECYA 4J9NA 3GTKA 4B3MH 2HVSA 3WNZA 3L4KA 2YRWA 4EGJA 2E2HA 1WCMG 1AUXA 4ED2A 3VPBA 4YP3A 3RJ0A 5LL6b 2YZNA 2DWCA 4O4HF 2ASJA 1ZHQA 4AYBA 3TQTA 1UC8A 4LF7H 3HB9A 4EEQA 1KEEA 3JSLA 4RNOA 2VPSA 4O2AF 4GC6A 1KBLA 3EPGA 3KXYT 2R7MA 2AGPA 4O3QA 1JXLA 4RZQA 2XGPA 4NXMH 4ED0A 5GONF 2NU9B 1E4FT 1B6RA 1RJRA 1S68A 5F9NA 4MA5A 3PR4A 1WCMA 2C2EA 3HOXG 3RF2A 2GPWA 2UUCH 2R7ZA 5C4XG 4PDBA 4JI8H 2VA3A 3N41B 2VQFH 1WH2A 1EUDB 1HNZH 2PVPA 2BQUA 2FK3A 5KFJA 2I87A 1I6UA 4ED8A 4DL7A 1DIKA 1VS0A 5FLMG 3R5FA 5D8DA 4LF4H 1IOVA 3QFFA 4GLXA 3KALA 2E5LH 1JLLB 1SFOA 4XYLB 5KFVA 1O75A 2VQEH 2YU9A 1V9PA 3R23A 4QIWE 4EG0A 4A2AA 4IR9A 4DR4H 2JA6G 1DV1A 3Q2OA 2UVVA 3VPDA 5IWAH 3H4BA 5J2UF 4O4LF 5KFFA 1RJPA 4DV2H 1R9TA 4EBEA 3HOUG 2RF4A 1PX2A 3ORRA 5JQWA 4F4WA 1HNWH 3Q8SB 4IHJF 4HQ6A 2HVRA 5KFPA 3GV5B 4MV3A 3RGZA 2ZDGA 2FLNA 4A3BG 3PN1A 5DG7A 4X62H 5KFOA 3ETJA 3OSPA 4DV5H 2HJWA 1Y14B 5KT4A 3BG5A 4XX0B 2R8HA 3PW4A 3H40A 1TWHA 5EWGA 3J80W 3KHHA 4ZI7F 1FJGH 4Q44A 4LFCH 4QW8A 3VMMA 3FKIA 5KX5F 4LF6H 2BQ3A 3ETHA 4JI3H 1XNQH 3K5IA 2I80A 5JUMA 5C44G 2PN1A 3GIDA 2AU0A 3GTJA 1M0WA 3PR5B 3L4JA 3IG0A 3ORQA 4ECXA 4F4ZA 1M7JA 3U9SA 1TA8A 3PZPA 4RAYA 4A3IG 2C2RA 5IYCG 2R8GA 1RJQA 1Z2OX 1A0IA 3MFHA 3RB4A 4QWCA 1UC9A 3T5KA 4C2MA 2HVQA 1RK6A 3BJYA 2UUAH 2VA2A 3OHBA 1M6VA 5CA0F 4QWDA 2W9CB 2R6FA 4JI7H 2YS6A 3PO2G 3MJFA 3RBEA 1SCUB 2CW8A 3T5LA 2W9BA 2IMWP 3UFXB 4BBSG 4EYIB 3MWDA 2CW7A 1HNXH 4O4IF 2W6NA 3RB3A 1XNRH 3Q8RB 1HR0H 4DV6H 4TQRA 4MV8A 5KFNA 4UCRA 2FJZA 1JKJB 1OWTA 3V4ZA 4C5BA 2XGQA 5C3EG 1SEIA 5LYJF 1N34H 4MAMA 3HOZG 2UUBH 2FPGB 3LWBA 3BQ1A 3TIGA 2C22A 4DL5A 2WB1E 2WAQE 4X64H 4Q45A 1RK5A 1S10A 4ME6A 1EUCB 1CQIB 1T36A 4FS2A 4ECRA 5KFZA 2R8JA 5BPFA 2ZDQA 4IRKA 3H3VH 2FK1A 4EGQA 3RAXA 2YZMA 4UCOA 4XYMB 2O03A 1GYFA 2QYZA 4BBRG 3HKZA 4ECTA 2Q2UA 3SI8A 2R7ZG 2RDIA 4RAZA 1EYZA 4C5AA 3MWEA 3OSNA 4YBZB 3C0FB 4DUZH 4DV1H 1CS0A 2VR1A 4EBCA 5KFHA 2UXDH 4JI6H 3TQ1A 3WO1A 3RB6A 2J6UA 5CAEB 4DV3H 1XMOH 3M4IA 3N42B 4BY7G 4QIWA 2V5AA 4HR7A 4BXXG 4HNTA 5KFCA 4B3TH 4QWEA 4FM9A 2ZDHA 2WTFA 5KG3A 3KHLA 3BQ2A 2ASDA 3GTGA 1Z2NX 3R5XA 2R7LA 2XC9A 5KG5A 1I7NA 2W71A 1WR2A
chains in the Genus database with same CATH topology
4DV2H 4BWSC 4UCSA 5FLXW 4YY3H 4RB1A 5LMNH 4JI0H 1HNWH 2UXBH 3T1YH 3BA9A 4DV0H 2HVRA 2MCTA 5EOYA 3RGXA 2KSWA 3RGZA 4RB2C 1MZBA 4Q0YA 3CVZA 4LH6A 3PN1A 4JI2H 3OTOH 4X62H 5BR8H 5FPRA 4DV5H 4K0KH 1IBKH 1S03G 5IT9W 3BABA 4J0MA 4MTEA 4R7RA 4UCUA 3J80W 2VUGA 1X9NA 4B3SH 4UFZA 1FJGH 2UXCH 4LFCH 1BGWA 4LF6H 4JI4H 4LSXA 3DF7A 4JI3H 1XNQH 3LMLA 4YHHH 1XDNA 4I7HA 2WYOA 4DV7H 2VOBA 3K3VA 4LF9H 1IBMH 5A2QW 4DR7H 1M0WA 1BJTA 3JAMW 4NXNH 4KHPH 3J81W 1Z2PX 5D1OA 3IG0A 3L4JA 4JI1H 4DUYH 3KAJA 4B3RH 1XMQH 1TA8A 2WE6A 3BA8A 1SYXB 4RAYA 1Z2OX 1A0IA 4MTDA 2HHHH 4LF8H 4LF5H 3N43B 2XIGA 4DR5H 2HVQA 5FD6A 3RIZA 1DGSA 1ZHSA 2UUAH 1E4GT 5LMUH 4EFEA 1IBLH 4M7EA 4RB0A 4DV4H 1L2ZA 4LSAA 2RGRA 2HGSA 4JI7H 3J7AK 4JV5H 4MV7A 4LFAH 4CC6A 2CW8A 3H20A 4OX9H 4GKJH 4X66H 2WDTA 2CW7A 4CC5A 1HNXH 2Q2TA 4B3MH 1N32H 4GKKH 3F8NA 2HVSA 1XNRH 3L4KA 1HR0H 3BAAA 4DV6H 4ETSA 1TAEA 5FPOA 4LFBH 4UCRA 3RJ0A 5LL6b 2UU9H 4APMA 2ZJTA 1ZHQA 1FKAH 1J5EH 4DR6H 1SEIA 3HXLA 3N40P 1N34H 4EEQA 4MV9A 4LF7H 3JSLA 2UUBH 2VPSA 4JI5H 5FD5A 4AQYH 3KXYT 2W57A 4RZQA 4NXMH 5D1OB 4X64H 3FMAA 2RGVA 3T1HH 1E4FT 1S68A 2YCHA 4UCVA 4UCTA 3N44B 3RF2A 3UQ8A 2UUCH 3JSNA 4PDBA 4IAJA 4JI8H 4UCOA 1FVIA 2O03A 3N41B 5D1PA 2VQFH 1GYFA 1P8LA 4A2BA 1WH2A 2Q2UA 1N36H 3KAKA 1HNZH 4RAZA 1I6UA 4JYAH 3MWMA 1VS0A 2F4VH 2ZM6H 1AN7A 3C0FB 4DUZH 3L2PA 4DV1H 4DR1H 4LF4H 2UXDH 4JI6H 2FE3A 3EYYA 3N6XA 4LH7A 4GLXA 2OWOA 4EFBA 4DV3H 3KALA 1XMOH 2E5LH 3M4IA 3N42B 1N33H 4DR2H 1O75A 2VQEH 4B3TH 4LMYA 3RTXA 4FM9A 1V9PA 1B04A 4A2AA 4X65H 1Z2NX 4DR4H 1I94H 1M0TA 4DR3H 5IWAH 4RB3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMA A;  1SYX B;  4BWS C;  1GYF A;  1L2Z A;  1WH2 A;  3K3V A; 
#chains in the Genus database with same CATH topology
 2FLL A;  2R7N A;  1KJQ A;  4A3D G;  4BWS C;  5KG0 A;  2W8K A;  4YY3 H;  3Q8P B;  2W6P A;  5CA1 F;  3GV7 B;  2NU8 B;  1A9X A;  4DV0 H;  2MCT A;  3I12 A;  2R82 A;  5EOY A;  5KG1 A;  2R86 A;  5KFW A;  4EEY A;  5IP7 G;  4RB2 C;  3GTO A;  2R8I A;  2NVY A;  3CVZ A;  5DQH A;  3OTO H;  4U7C A;  1VBG A;  5F9L A;  4QJF A;  3RUP A;  5KFD A;  4F4Y A;  1N56 A;  4IWY A;  4BY1 G;  3G6Y A;  2DIK A;  4R7R A;  2UXC H;  4B3S H;  2VUG A;  1X9N A;  2DPJ A;  1BGW A;  2R85 A;  3VPC A;  2W7O A;  2CQY A;  5KFT A;  2ATL A;  2JA5 G;  4JI4 H;  5KFI A;  4WD3 A;  2JA7 G;  3PVX A;  5KKN B;  4YHH H;  2W8L A;  1E4E B;  1JIH A;  2WYO A;  4LF9 H;  4O2B F;  4RUA A;  4DR7 H;  1BJT A;  3JAM W;  4KHP H;  3MFI A;  2C28 A;  3J81 W;  3HOW G;  2PMZ A;  4ED1 A;  4JV0 A;  2V4Q A;  4DUY H;  4O3O A;  4DL4 A;  1XMQ H;  2WE6 A;  5DGB A;  3BA8 A;  1S0N A;  4MTD A;  5L1I A;  2DZD A;  2Y0S E;  1S0M A;  4LF5 H;  3N43 B;  3GV8 B;  5C1O A;  4DR5 H;  4A3E G;  4Q8F A;  5FD6 A;  1WSC A;  1ZHS A;  2IA6 A;  2I8C A;  1E4G T;  4RNM A;  5KFK A;  3PW2 A;  1L2Z A;  2JA6 A;  3FDS A;  4FU0 A;  4A3C G;  3MR3 A;  4MA0 A;  3H20 A;  2DPI A;  4OX9 H;  4GKJ H;  4YR2 A;  1BXR A;  1KJI A;  1Y1V G;  1N32 H;  2C35 B;  2C2D A;  4GKK H;  3F8N A;  4YJ2 F;  5HV6 A;  3GIL A;  1W93 A;  3BAA A;  5C8Y F;  4ETS A;  3RBD A;  4A3G G;  5J2T F;  4YAK B;  3QZ7 A;  2RDJ A;  4LFB H;  1KJ8 A;  4ECZ A;  4I50 F;  2UU9 H;  3E5N A;  1Y1W G;  1FKA H;  5JVL A;  1J5E H;  5KFS A;  5KFA A;  4DLK A;  3GTL A;  3HXL A;  3N40 P;  2W9B B;  4MV9 A;  2W9A A;  4J9M A;  4JI5 H;  2WB1 A;  4ECW A;  5KG2 A;  1K1S A;  5IYB G;  1Y1V A;  2YYA A;  5D1O B;  3R5H A;  2RGV A;  3LP8 A;  5KFY A;  4Y8V B;  2NUA B;  5EZY F;  3HOV G;  4IWX A;  4UCV A;  5LXT F;  4UCT A;  3N44 B;  4HNV A;  3HBL A;  1RYR A;  2M05 A;  3MR5 A;  3RAQ A;  2AGO A;  3WO0 A;  4I55 F;  4I4T F;  2R92 G;  1P8L A;  2X0S A;  2XCP A;  1N36 H;  3RV4 A;  2JA8 G;  3M9O B;  4O3N A;  1KJ9 A;  2FMA A;  4RZR A;  3MWM A;  2VUM G;  2IBK A;  2F4V H;  3CQZ A;  1AN7 A;  3RV3 A;  5DLF A;  3L2P A;  4DR1 H;  4O3S A;  4R8U A;  3AYH B;  1JX4 A;  2R7K A;  2FE3 A;  2NU6 B;  3N6X A;  4LH7 A;  4EFB A;  4GC7 A;  1N33 H;  1I50 A;  1JDB B;  5L1K A;  4ZOL F;  5KT6 A;  5JH7 F;  4RNN A;  1T3N A;  4LMY A;  2R92 A;  4X65 H;  3MR2 A;  2DLN A;  1VKZ A;  2J6S A;  2FPI B;  4YQW A;  4DL6 A;  4PWQ A;  2FB9 A;  4RB3 C;  4QW9 A;  2W9C A;  2R93 G;  5FLX W;  2JEG A;  2R84 A;  5LMN H;  4JI0 H;  4DL3 A;  2PBZ A;  4F50 A;  2CZG A;  1ULZ A;  2J9G A;  4FBU A;  4TUY F;  1GGO A;  3RGX A;  3V6K A;  1VBH A;  4J9O A;  5KFL A;  3PW0 A;  1CE8 A;  3V6J A;  3G8C A;  2SCU B;  4RU9 A;  5FPR A;  4YR0 A;  2NVX A;  3GIM A;  4K0K H;  2VPQ A;  4WBN F;  4J0M A;  2R87 A;  1GSH A;  5HBR B;  4MTE A;  5L1J A;  5C1P A;  4O3P A;  3JRW A;  5L9X A;  3Q8Q B;  2JEF A;  4YR3 A;  2V58 A;  2CKZ B;  3M9M B;  4O3R A;  4FS1 A;  2R93 A;  3DF7 A;  1K1Q A;  1C30 A;  3LML A;  1W96 A;  1XDN A;  4I7H A;  4DV7 H;  2VOB A;  2GLT A;  5A2Q W;  4L1K A;  1IBM H;  4NXN H;  1I7L A;  1Z2P X;  1CQJ B;  1GLV A;  3KTM A;  5C5J A;  4JI1 H;  4IR1 A;  3KAJ A;  1VAJ A;  2XCL A;  3KHG A;  4QWA A;  1SYX B;  2Y0S A;  3Q1K A;  3OHA A;  5KG6 A;  4YAJ B;  3GTP A;  3QZ8 A;  4ZQI A;  5EDW A;  4E4T A;  5CB4 F;  1TWC A;  3N8D A;  1EHI A;  3RIZ A;  1DGS A;  5IYD G;  5LMU H;  4M7E A;  4RB0 A;  4LSA A;  2FP4 B;  3GTQ A;  3J7A K;  4MV7 A;  5T14 A;  2FLP A;  1ZQ7 A;  4CC6 A;  3K3P A;  5BMV F;  4MV4 A;  5DGA A;  1B6S A;  2J6T A;  2UVU A;  2FPP B;  4CC5 A;  4ZHQ F;  3GIK A;  2XCA A;  1AUV A;  4IRC A;  2YL2 A;  3GIQ A;  3RFC A;  3GTM A;  1BNC A;  5BPH A;  2UVR A;  3HOY G;  1TAE A;  4TV8 F;  1GO3 E;  2C00 A;  3HKZ E;  3V4S A;  1GSO A;  4J9P A;  5FPO A;  1T94 A;  4F4X A;  1KJJ A;  3KHR A;  1K83 A;  3JZI A;  4APM A;  4IRD A;  2IP4 A;  2ZJT A;  3TIN A;  1UNN C;  4A3J G;  2QK4 A;  4A3F G;  3OUZ A;  4DR6 H;  4QWB A;  4ECV A;  3OUU A;  1RYS A;  4AYB E;  2JA5 A;  3PW5 A;  2GPS A;  5I47 A;  2JA7 A;  5FD5 A;  3U9T A;  5FJ8 G;  4AQY H;  4G3I A;  5EWF A;  4A93 G;  2W57 A;  4ED7 A;  3TII A;  5KFB A;  4A3M G;  2W6Z A;  3FMA A;  3T1H H;  2YCH A;  2P0A A;  3UQ8 A;  5IP9 G;  3FKI G;  3JSN A;  4IAJ A;  1DV2 A;  1TWF A;  3GQC A;  1ZET A;  1FVI A;  5D1P A;  1IOW A;  4J9R A;  2R8K A;  4A3L G;  2YRX A;  2V4R A;  4A2B A;  5KG7 A;  4ECU A;  2NU7 B;  4C5C A;  3KAK A;  5KT5 A;  1E4E A;  3EPI A;  4J9L A;  2E2I A;  4JYA H;  3RB0 A;  2YS7 A;  2ZM6 H;  4EYH B;  4J9S A;  3M9N B;  3T5H A;  2VQD A;  4IZO A;  3GIJ A;  2V59 A;  3EYY A;  5DQG A;  5KT7 A;  2OWO A;  2B63 G;  3V6H A;  2WAQ A;  2AQ4 A;  2W6O A;  4TQS A;  2OH2 A;  4DR2 H;  4Q43 A;  4ED3 A;  4HYK A;  3RTX A;  1V4Y A;  3BQ0 A;  1B04 A;  5KFG A;  2W6Q A;  3G6X A;  1V51 A;  5KFU A;  4ED6 A;  1M0T A;  4YJ3 F;  3MR6 A;  4DR3 H;  2YW2 A;  5KT3 A;  1I94 H;  4JUZ A;  3I4N G;  5L1L A;  1IBL H;  4M9U A;  1EZ1 A;  4XZ3 B;  4R8U B;  1TWG A;  4UCS A;  2W70 A;  5KFQ A;  4RB1 A;  4JV1 A;  2PMZ E;  1Y1W A;  2UXB H;  3T1Y H;  2FK2 A;  3BA9 A;  5KFR A;  4FBT A;  4NLG A;  2B63 A;  1GSA A;  2KSW A;  5DG8 A;  1S97 A;  1TWA A;  3SE7 A;  1MZB A;  4Q0Y A;  1C3O A;  4LH6 A;  5DQI A;  2BQR A;  4JI2 H;  2JEJ A;  3G6V A;  2AGQ A;  5BR8 H;  1S9F A;  1IBK H;  1S03 G;  5KT2 A;  2BR0 A;  3BAB A;  5K2M A;  5LA6 F;  4Q8E A;  5IT9 W;  4UCU A;  3H0G G;  5LP6 F;  4UFZ A;  5KFE A;  3T5J A;  3GII A;  1I3Q A;  2FKL A;  4TV9 F;  5KFX A;  2JEI A;  3GIP A;  4LSX A;  2W6M A;  5KG4 A;  4U6P A;  1PK8 A;  3PO3 G;  3K5H A;  3K3V A;  3JRX A;  4A3K G;  4ECQ A;  2XD4 A;  5D1O A;  4JV2 A;  4YB8 B;  2ASL A;  5EWE A;  3GLK A;  2VUM A;  3IN5 A;  3I4M G;  4B3R H;  3H4D A;  4DL2 A;  2W7P A;  3PW7 A;  5DLG A;  1N48 A;  4ECS A;  3H0G A;  2HHH H;  4LF8 H;  2XIG A;  5DG9 A;  3NGD A;  4J9K A;  2UVW A;  5JVD F;  5LOV F;  4MV6 A;  2OLS A;  1KC7 A;  4EFE A;  4J9Q A;  2V9W A;  4DV4 H;  5KFM A;  4RUC A;  2RGR A;  1JDE A;  2HGS A;  4JV5 H;  4MV1 A;  2YZG A;  4LFA H;  4HNU A;  1B33 N;  4EBD A;  5IYZ F;  2ALZ A;  5H80 A;  4X66 H;  2WDT A;  1S0O A;  2Q2T A;  4ECY A;  4J9N A;  3GTK A;  4B3M H;  2HVS A;  3WNZ A;  3L4K A;  2YRW A;  4EGJ A;  2E2H A;  1WCM G;  1AUX A;  4ED2 A;  3VPB A;  4YP3 A;  3RJ0 A;  5LL6 b;  2YZN A;  2DWC A;  4O4H F;  2ASJ A;  1ZHQ A;  4AYB A;  3TQT A;  1UC8 A;  4LF7 H;  3HB9 A;  4EEQ A;  1KEE A;  3JSL A;  4RNO A;  2VPS A;  4O2A F;  4GC6 A;  1KBL A;  3EPG A;  3KXY T;  2R7M A;  2AGP A;  4O3Q A;  1JXL A;  4RZQ A;  2XGP A;  4NXM H;  4ED0 A;  5GON F;  2NU9 B;  1E4F T;  1B6R A;  1RJR A;  1S68 A;  5F9N A;  4MA5 A;  3PR4 A;  1WCM A;  2C2E A;  3HOX G;  3RF2 A;  2GPW A;  2UUC H;  2R7Z A;  5C4X G;  4PDB A;  4JI8 H;  2VA3 A;  3N41 B;  2VQF H;  1WH2 A;  1EUD B;  1HNZ H;  2PVP A;  2BQU A;  2FK3 A;  5KFJ A;  2I87 A;  1I6U A;  4ED8 A;  4DL7 A;  1DIK A;  1VS0 A;  5FLM G;  3R5F A;  5D8D A;  4LF4 H;  1IOV A;  3QFF A;  4GLX A;  3KAL A;  2E5L H;  1JLL B;  1SFO A;  4XYL B;  5KFV A;  1O75 A;  2VQE H;  2YU9 A;  1V9P A;  3R23 A;  4QIW E;  4EG0 A;  4A2A A;  4IR9 A;  4DR4 H;  2JA6 G;  1DV1 A;  3Q2O A;  2UVV A;  3VPD A;  5IWA H;  3H4B A;  5J2U F;  4O4L F;  5KFF A;  1RJP A;  4DV2 H;  1R9T A;  4EBE A;  3HOU G;  2RF4 A;  1PX2 A;  3ORR A;  5JQW A;  4F4W A;  1HNW H;  3Q8S B;  4IHJ F;  4HQ6 A;  2HVR A;  5KFP A;  3GV5 B;  4MV3 A;  3RGZ A;  2ZDG A;  2FLN A;  4A3B G;  3PN1 A;  5DG7 A;  4X62 H;  5KFO A;  3ETJ A;  3OSP A;  4DV5 H;  2HJW A;  1Y14 B;  5KT4 A;  3BG5 A;  4XX0 B;  2R8H A;  3PW4 A;  3H40 A;  1TWH A;  5EWG A;  3J80 W;  3KHH A;  4ZI7 F;  1FJG H;  4Q44 A;  4LFC H;  4QW8 A;  3VMM A;  3FKI A;  5KX5 F;  4LF6 H;  2BQ3 A;  3ETH A;  4JI3 H;  1XNQ H;  3K5I A;  2I80 A;  5JUM A;  5C44 G;  2PN1 A;  3GID A;  2AU0 A;  3GTJ A;  1M0W A;  3PR5 B;  3L4J A;  3IG0 A;  3ORQ A;  4ECX A;  4F4Z A;  1M7J A;  3U9S A;  1TA8 A;  3PZP A;  4RAY A;  4A3I G;  2C2R A;  5IYC G;  2R8G A;  1RJQ A;  1Z2O X;  1A0I A;  3MFH A;  3RB4 A;  4QWC A;  1UC9 A;  3T5K A;  4C2M A;  2HVQ A;  1RK6 A;  3BJY A;  2UUA H;  2VA2 A;  3OHB A;  1M6V A;  5CA0 F;  4QWD A;  2W9C B;  2R6F A;  4JI7 H;  2YS6 A;  3PO2 G;  3MJF A;  3RBE A;  1SCU B;  2CW8 A;  3T5L A;  2W9B A;  2IMW P;  3UFX B;  4BBS G;  4EYI B;  3MWD A;  2CW7 A;  1HNX H;  4O4I F;  2W6N A;  3RB3 A;  1XNR H;  3Q8R B;  1HR0 H;  4DV6 H;  4TQR A;  4MV8 A;  5KFN A;  4UCR A;  2FJZ A;  1JKJ B;  1OWT A;  3V4Z A;  4C5B A;  2XGQ A;  5C3E G;  1SEI A;  5LYJ F;  1N34 H;  4MAM A;  3HOZ G;  2UUB H;  2FPG B;  3LWB A;  3BQ1 A;  3TIG A;  2C22 A;  4DL5 A;  2WB1 E;  2WAQ E;  4X64 H;  4Q45 A;  1RK5 A;  1S10 A;  4ME6 A;  1EUC B;  1CQI B;  1T36 A;  4FS2 A;  4ECR A;  5KFZ A;  2R8J A;  5BPF A;  2ZDQ A;  4IRK A;  3H3V H;  2FK1 A;  4EGQ A;  3RAX A;  2YZM A;  4UCO A;  4XYM B;  2O03 A;  1GYF A;  2QYZ A;  4BBR G;  3HKZ A;  4ECT A;  2Q2U A;  3SI8 A;  2R7Z G;  2RDI A;  4RAZ A;  1EYZ A;  4C5A A;  3MWE A;  3OSN A;  4YBZ B;  3C0F B;  4DUZ H;  4DV1 H;  1CS0 A;  2VR1 A;  4EBC A;  5KFH A;  2UXD H;  4JI6 H;  3TQ1 A;  3WO1 A;  3RB6 A;  2J6U A;  5CAE B;  4DV3 H;  1XMO H;  3M4I A;  3N42 B;  4BY7 G;  4QIW A;  2V5A A;  4HR7 A;  4BXX G;  4HNT A;  5KFC A;  4B3T H;  4QWE A;  4FM9 A;  2ZDH A;  2WTF A;  5KG3 A;  3KHL A;  3BQ2 A;  2ASD A;  3GTG A;  1Z2N X;  3R5X A;  2R7L A;  2XC9 A;  5KG5 A;  1I7N A;  2W71 A;  1WR2 A; 
#chains in the Genus database with same CATH homology
 4DV2 H;  4BWS C;  4UCS A;  5FLX W;  4YY3 H;  4RB1 A;  5LMN H;  4JI0 H;  1HNW H;  2UXB H;  3T1Y H;  3BA9 A;  4DV0 H;  2HVR A;  2MCT A;  5EOY A;  3RGX A;  2KSW A;  3RGZ A;  4RB2 C;  1MZB A;  4Q0Y A;  3CVZ A;  4LH6 A;  3PN1 A;  4JI2 H;  3OTO H;  4X62 H;  5BR8 H;  5FPR A;  4DV5 H;  4K0K H;  1IBK H;  1S03 G;  5IT9 W;  3BAB A;  4J0M A;  4MTE A;  4R7R A;  4UCU A;  3J80 W;  2VUG A;  1X9N A;  4B3S H;  4UFZ A;  1FJG H;  2UXC H;  4LFC H;  1BGW A;  4LF6 H;  4JI4 H;  4LSX A;  3DF7 A;  4JI3 H;  1XNQ H;  3LML A;  4YHH H;  1XDN A;  4I7H A;  2WYO A;  4DV7 H;  2VOB A;  3K3V A;  4LF9 H;  1IBM H;  5A2Q W;  4DR7 H;  1M0W A;  1BJT A;  3JAM W;  4NXN H;  4KHP H;  3J81 W;  1Z2P X;  5D1O A;  3IG0 A;  3L4J A;  4JI1 H;  4DUY H;  3KAJ A;  4B3R H;  1XMQ H;  1TA8 A;  2WE6 A;  3BA8 A;  1SYX B;  4RAY A;  1Z2O X;  1A0I A;  4MTD A;  2HHH H;  4LF8 H;  4LF5 H;  3N43 B;  2XIG A;  4DR5 H;  2HVQ A;  5FD6 A;  3RIZ A;  1DGS A;  1ZHS A;  2UUA H;  1E4G T;  5LMU H;  4EFE A;  1IBL H;  4M7E A;  4RB0 A;  4DV4 H;  1L2Z A;  4LSA A;  2RGR A;  2HGS A;  4JI7 H;  3J7A K;  4JV5 H;  4MV7 A;  4LFA H;  4CC6 A;  2CW8 A;  3H20 A;  4OX9 H;  4GKJ H;  4X66 H;  2WDT A;  2CW7 A;  4CC5 A;  1HNX H;  2Q2T A;  4B3M H;  1N32 H;  4GKK H;  3F8N A;  2HVS A;  1XNR H;  3L4K A;  1HR0 H;  3BAA A;  4DV6 H;  4ETS A;  1TAE A;  5FPO A;  4LFB H;  4UCR A;  3RJ0 A;  5LL6 b;  2UU9 H;  4APM A;  2ZJT A;  1ZHQ A;  1FKA H;  1J5E H;  4DR6 H;  1SEI A;  3HXL A;  3N40 P;  1N34 H;  4EEQ A;  4MV9 A;  4LF7 H;  3JSL A;  2UUB H;  2VPS A;  4JI5 H;  5FD5 A;  4AQY H;  3KXY T;  2W57 A;  4RZQ A;  4NXM H;  5D1O B;  4X64 H;  3FMA A;  2RGV A;  3T1H H;  1E4F T;  1S68 A;  2YCH A;  4UCV A;  4UCT A;  3N44 B;  3RF2 A;  3UQ8 A;  2UUC H;  3JSN A;  4PDB A;  4IAJ A;  4JI8 H;  4UCO A;  1FVI A;  2O03 A;  3N41 B;  5D1P A;  2VQF H;  1GYF A;  1P8L A;  4A2B A;  1WH2 A;  2Q2U A;  1N36 H;  3KAK A;  1HNZ H;  4RAZ A;  1I6U A;  4JYA H;  3MWM A;  1VS0 A;  2F4V H;  2ZM6 H;  1AN7 A;  3C0F B;  4DUZ H;  3L2P A;  4DV1 H;  4DR1 H;  4LF4 H;  2UXD H;  4JI6 H;  2FE3 A;  3EYY A;  3N6X A;  4LH7 A;  4GLX A;  2OWO A;  4EFB A;  4DV3 H;  3KAL A;  1XMO H;  2E5L H;  3M4I A;  3N42 B;  1N33 H;  4DR2 H;  1O75 A;  2VQE H;  4B3T H;  4LMY A;  3RTX A;  4FM9 A;  1V9P A;  1B04 A;  4A2A A;  4X65 H;  1Z2N X;  4DR4 H;  1I94 H;  1M0T A;  4DR3 H;  5IWA H;  4RB3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...