4BWSC

Crystal structure of the heterotrimer of pqbp1, u5-15kd and u5-52kd.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
b'HHHMDVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THIOREDOXIN-LIKE PROTEIN 4A
molecule tags Transcription
source organism Homo sapiens
publication title Mutations in the Pqbp1 Gene Prevent its Interaction with the Spliceosomal Protein U5-15Kd.
pubmed doi rcsb
total genus 12
structure length 66
sequence length 66
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4bwsC00
1WH2A 3FMAA 4BWSC 1L2ZA 1SYXB 1GYFA 3K3VA
chains in the Genus database with same CATH superfamily
4RB1A 1E4GT 1IOVA 1I7LA 4X62H 4ECQA 1ULZA 1VBHA 5KFRA 4DR5H 2NU9B 3MFHA 3IG0A 4WBNF 3HB9A 3OHBA 2ZDQA 4DR6H 4LFBH 2DIKA 2R8IA 2AGPA 2OLSA 1CQJB 1RYRA 5CB4F 4GLXA 2NUAB 3RB0A 2DZDA 5DLGA 3BA8A 3PW0A 2C2RA 4YY3H 5L9XA 4J9MA 2RDIA 4LF5H 4UCOA 4BBRG 3I4MG 5J2TF 3ETJA 5BPHA 3RGXA 1X9NA 2ZDHA 2V58A 2OWOA 3EYYA 4ED0A 2AGOA 4A3EG 4A3KG 4PDBA 3JAMW 1HNWH 4UCUA 5F9NA 4DL2A 3PZPA 3QZ7A 3KAJA 5KKNB 3N42B 3G6YA 1AN7A 4A3BG 5LXTF 3OSNA 5LMNH 4DV5H 4RZRA 5KG6A 3PO3G 2PMZA 2R7ZG 3PR4A 2R8JA 5KG4A 4JI7H 1CS0A 5KT2A 5DG7A 3GLKA 4HR7A 2DPJA 2YYAA 2FLPA 2AGQA 2R7KA 3TIIA 3KALA 5KT3A 5KG3A 4PWQA 1RJPA 4CC6A 4YR2A 2YS7A 2NU8B 1FKAH 4DUYH 4Q45A 4EBEA 4RAZA 1L2ZA 5KFQA 2DLNA 5KFEA 4GC7A 1Y1VA 2VQDA 3BA9A 4MV1A 1TWCA 4RNNA 3RBEA 4LFAH 4EGQA 4BXXG 1EHIA 4Q43A 3MR6A 1FVIA 3M4IA 2VUMA 3BJYA 3N41B 3K5HA 5DG8A 3RB3A 1BNCA 2CZGA 1CQIB 2NVYA 4M9UA 3T1YH 2UUCH 3N8DA 1RK5A 4J9SA 5KFYA 4O4LF 1UC9A 1SEIA 3PW5A 4Q8FA 4HNTA 5KT4A 3BQ2A 3M9MB 4XYMB 2X0SA 4JI4H 3RFCA 4YR3A 1S0MA 4Q0YA 1S03G 5KG1A 4QWEA 5IYZF 4QJFA 1E4FT 3H0GA 5LL6b 1SFOA 3PO2G 4J9PA 4FBTA 4YBZB 4FBUA 5KFMA 1T94A 1I7NA 2PN1A 2W8KA 1RYSA 4O3SA 3HOUG 4DR4H 2Y0SA 3I4NG 5KFVA 2IBKA 4B3RH 4ECYA 1IBKH 2UVWA 1VS0A 5KG2A 2W6MA 4XX0B 2HJWA 4E4TA 4DV4H 2FP4B 4AYBE 2FLNA 5JVLA 2FE3A 5J2UF 4UCTA 2W9BA 4ZQIA 3M9OB 4DL4A 4JI8H 1RK6A 4DR7H 5FPOA 5KFUA 2JA7G 4A3LG 1HNXH 3FMAA 5D8DA 4ECUA 2HGSA 2XIGA 3Q8RB 4M7EA 4IWYA 1V9PA 3JRXA 4WD3A 3HOZG 5KG0A 3EPGA 5KX5F 3HKZE 4HNUA 3L4KA 4F4XA 1Z2OX 1TWHA 2VUMG 5EZYF 4ZI7F 5KFNA 2W9CB 3RV4A 2YRXA 1P8LA 4I7HA 3WNZA 5L1LA 1I50A 1RJQA 3M9NB 5C5JA 2J6SA 2R8KA 2KSWA 5I47A 4U6PA 3ORRA 3I12A 5CAEB 3IN5A 3MR3A 3T5LA 4A3CG 3RJ0A 1EUCB 1XDNA 4O2BF 2XC9A 2E2HA 2HVSA 4FM9A 2RGRA 4APMA 2B63A 1BJTA 3PR5B 3GV5B 4ED8A 2R8GA 4MV9A 3N43B 3KHGA 1DV1A 3PW2A 1KC7A 2W9AA 1Z2NX 5K2MA 3LP8A 2W9BB 1GSOA 5D1PA 2FK3A 3V4ZA 1JXLA 4EYIB 5C1OA 3K3VA 3MWDA 2WTFA 1FJGH 5KFWA 4TQSA 4LF6H 4DL6A 3RV3A 3JZIA 1JDEA 1GYFA 5LYJF 3NGDA 1M0TA 3HOYG 3HKZA 2R7LA 2FJZA 2VUGA 4I4TF 4FS1A 1K1QA 1Z2PX 2WAQA 4R7RA 4QWDA 2W6QA 4DL5A 1N36H 4MV8A 2JEGA 2JA5A 4O4HF 4QIWE 4A3IG 2ZM6H 2W8LA 3WO1A 5C1PA 1N48A 4JYAH 4RNOA 3G6VA 1WH2A 3FKIA 4HQ6A 2R82A 5D1OA 3JRWA 2VOBA 3ETHA 2UVVA 2ALZA 1M7JA 3KHRA 4HNVA 4YR0A 4J9OA 1KEEA 1S0NA 4GKKH 2YZGA 5C8YF 1IBMH 5HBRB 3HBLA 2JA7A 4RB0A 1N33H 2W9CA 4I50F 5KFFA 2C2EA 2W7PA 4LFCH 1PX2A 3GIDA 3SI8A 4B3SH 4YQWA 2R92G 2W7OA 1KJIA 1VAJA 3Q8QB 2W6NA 2JA8G 5FPRA 5JVDF 2IA6A 3BG5A 2I87A 5EOYA 1C30A 4BY1G 1EYZA 5EWFA 1S68A 5DLFA 2CW8A 4ECZA 3GTOA 3EPIA 2C22A 5DQHA 2Q2UA 4J9KA 2XCAA 4K0KH 5KFOA 3GTLA 4MTDA 4IRDA 2AQ4A 5FD6A 4YP3A 3BQ1A 3RAQA 4G3IA 1EUDB 5KFGA 1TWGA 2J6UA 4DR3H 2R93A 4NXNH 1JDBB 3OUUA 3MJFA 4ETSA 4MV6A 4B3TH 4RU9A 2NU7B 2JEIA 4DV2H 3RUPA 2E2IA 3TIGA 4UCSA 4LF8H 3BAAA 5LP6F 2AU0A 4MA0A 5IYBG 3V6JA 4JV2A 1M6VA 3Q1KA 2HHHH 3GTGA 4TV9F 4A3GG 3SE7A 3T5JA 2MCTA 4LH6A 2CKZB 5T14A 4HYKA 3MWMA 3J81W 5DGBA 4BWSC 5HV6A 1KJQA 5EDWA 5KFLA 2R85A 4ED6A 5F9LA 3MFIA 2WAQE 1J5EH 3QZ8A 3PW4A 3N40P 5KFSA 4J0MA 4C2MA 5KT7A 2R7NA 4MA5A 1W96A 5KFXA 2SCUB 3V6KA 2YCHA 2YRWA 4A3DG 4YHHH 1SCUB 2WB1E 4MTEA 2IMWP 3MR2A 5IT9W 4RZQA 4F4ZA 1GSHA 2RF4A 1EZ1A 3V6HA 4UCRA 4DL7A 5DGAA 5CA1F 2B63G 4X65H 3GTKA 1WCMG 4ZHQF 3Q2OA 1GGOA 2BQ3A 3H3VH 3CVZA 1AUXA 3KHLA 1XNRH 4IRCA 4JI6H 2R92A 4TV8F 4JV0A 3RTXA 1E4EA 2ZJTA 4UCVA 3U9TA 4IWXA 2YZNA 3PW7A 2UU9H 4LF7H 4EYHB 2VA2A 1A9XA 4IHJF 3N44B 4LSAA 3BQ0A 2HVRA 4ECSA 4L1KA 1DGSA 4IRKA 1GSAA 4MV7A 4TUYF 3G8CA 5KT6A 2VQEH 1KJJA 5L1KA 4ECXA 4QWAA 4NLGA 2FMAA 4O3QA 1T3NA 4ED7A 3ORQA 4BBSG 3C0FB 5JUMA 4GKJH 2UUBH 5EWGA 4Y8VB 2JEFA 4ECTA 2CQYA 4EGJA 3PN1A 2P0AA 5KFBA 1KJ8A 2ZDGA 1BXRA 4C5CA 4J9NA 1S0OA 2BR0A 2UXCH 4A2AA 3TQTA 4U7CA 4DV7H 2UXBH 2ASLA 1C3OA 3FDSA 4YJ2F 2XCLA 3K3PA 5IYCG 5FLMG 3VPCA 3H4DA 4EBCA 2JEJA 4JV1A 3GTPA 4ECVA 3N6XA 1HNZH 1TAEA 2J6TA 1ZHQA 1K83A 3U9SA 4UFZA 4O3PA 2R87A 2QK4A 5LA6F 1N32H 2R7ZA 2UVUA 1KBLA 4B3MH 2GLTA 5JH7F 3OTOH 4F4WA 4IR9A 3R23A 2Y0SE 1XMQH 3F8NA 5KFTA 4TQRA 2XCPA 5KFKA 4IR1A 1TA8A 2W6ZA 3T5HA 2M05A 3LMLA 4YAKB 2V9WA 3FKIG 3HXLA 2FLLA 3OSPA 1XMOH 5KFCA 4ECWA 5JQWA 1AUVA 1I3QA 1A0IA 4O3OA 2JA5G 2UUAH 2UVRA 4Q8EA 2YL2A 3VPDA 2R93G 2YW2A 5KFIA 4EFEA 1GO3E 5EWEA 4KHPH 4X64H 2QYZA 4I55F 1TWAA 4MV4A 3RB6A 4DL3A 2C28A 1R9TA 5KFJA 4GC6A 4QWBA 4JI5H 2R7MA 1DIKA 3WO0A 4DLKA 3GIKA 3T5KA 4EEQA 3L2PA 1S10A 1OWTA 2J9GA 4IZOA 4LSXA 5C44G 4DV3H 3LWBA 4R8UB 5KG5A 1RJRA 2WB1A 4FS2A 5KFPA 4LF9H 1O75A 3KTMA 3GIJA 4J9LA 1B6SA 3GIQA 2FK1A 2F4VH 3VPBA 3GTQA 5C4XG 2C00A 5IP7G 1CE8A 1ZQ7A 3KHHA 1JLLB 4A3FG 2PMZE 1E4EB 3CQZA 4RB2C 4RNMA 1WSCA 4MV3A 2IP4A 4J9RA 3RAXA 3BABA 5IYDG 1TWFA 4A2BA 4EBDA 2R86A 1JKJB 2YU9A 3GTJA 3GILA 3GQCA 1UNNC 4JUZA 5BMVF 4EFBA 3GIIA 4F4YA 2XGQA 5BPFA 3GIPA 3K5IA 3H40A 5FJ8G 1N34H 5KFDA 5FLXW 1SYXB 1VKZA 1N56A 4NXMH 5CA0F 2UXDH 3MWEA 5FD5A 1Y14B 2V59A 2R8HA 1I94H 1IOWA 4ED2A 1XNQH 1WCMA 2W70A 4DV6H 4A3MG 1Y1VG 1GLVA 2O03A 3DF7A 4QW9A 4X66H 2VR1A 5KG7A 4R8UA 5BR8H 3HOVG 2FPIB 2JA6A 4ZOLF 4XYLB 2Q2TA 1JIHA 3GIMA 2C2DA 5DQGA 3OHAA 2NVXA 4F50A 4RAYA 2OH2A 4RB3C 5H80A 2VA3A 5KFHA 2V4RA 2WYOA 2VPSA 1V51A 4YB8B 2YS6A 4RUAA 3AYHB 3UFXB 1BGWA 3VMMA 3E5NA 1K1SA 4A3JG 1JX4A 4OX9H 2R84A 4EG0A 4QIWA 1DV2A 5L1JA 4EEYA 5C3EG 2VPQA 2VQFH 1KJ9A 3HOXG 4O4IF 5KT5A 4MAMA 5A2QW 3Q8SB 4IAJA 2DWCA 4C5AA 3Q8PB 2W57A 4YAJB 3KAKA 4Q44A 2BQRA 2HVQA 4ED1A 3RBDA 1IBLH 2JA6G 3PVXA 4A93G 4DUZH 3GV7B 4C5BA 2W6OA 3KXYT 5D1OB 2W71A 2ASJA 2E5LH 3JSLA 1PK8A 3RF2A 4JI0H 4JI3H 4RUCA 2ATLA 3J80W 2DPIA 3OUZA 1I6UA 1B04A 4XZ3B 5DQIA 5DG9A 5L1IA 4J9QA 1ZETA 3RGZA 3H4BA 1WR2A 5KFZA 1Y1WG 1MZBA 3R5HA 4YJ3F 2FB9A 4AQYH 4BY7G 4JV5H 2RDJA 2R6FA 4DR2H 5LMUH 3J7AK 1VBGA 3H20A 3RB4A 1S97A 3GTMA 3UQ8A 3JSNA 2C35B 3R5FA 4DV1H 3RIZA 1W93A 3TINA 4O3NA 2WDTA 3R5XA 1T36A 3V4SA 3QFFA 3L4JA 3GV8B 1UC8A 1B6RA 2PVPA 4FU0A 1B33N 4LH7A 4DR1H 2FPGB 2W6PA 4JI1H 4CC5A 5LOVF 1S9FA 2V4QA 2FKLA 5GONF 2V5AA 3H0GG 2GPWA 5IP9G 3TQ1A 5KFAA 2ASDA 2XD4A 3G6XA 4O3RA 2CW7A 4ME6A 2FK2A 4AYBA 4O2AF 2WE6A 4ECRA 2I80A 1V4YA 2RGVA 3HOWG 1HR0H 4JI2H 5IWAH 1M0WA 4QWCA 2XGPA 1Y1WA 2BQUA 4ED3A 4LF4H 2FPPB 3MR5A 2GPSA 1ZHSA 2PBZA 4QW8A 2NU6B 4LMYA 4DV0H 2I8CA 2YZMA 3T1HH
chains in the Genus database with same CATH topology
4RB1A 1E4GT 4X62H 1XNRH 1N34H 4JI6H 4DR5H 3RJ0A 5FLXW 1SYXB 1XDNA 3IG0A 3RTXA 4NXMH 2ZJTA 4UCVA 2UXDH 2HVSA 4DR6H 4FM9A 4LF7H 2RGRA 4APMA 4LFBH 5FD5A 1XNQH 1I94H 1BJTA 3N44B 4DV6H 4LSAA 4GLXA 2HVRA 4MV9A 2O03A 3DF7A 3N43B 1DGSA 3BA8A 1Z2NX 4MV7A 4YY3H 4X66H 4LF5H 4UCOA 5D1PA 2VQEH 1X9NA 3RGXA 5BR8H 2OWOA 3EYYA 3K3VA 1FJGH 4PDBA 2Q2TA 4LF6H 3C0FB 3JAMW 1HNWH 2UUBH 4GKJH 4UCUA 1GYFA 3KAJA 3PN1A 3N42B 1M0TA 1AN7A 4RAYA 4RB3C 5LMNH 4DV5H 2WYOA 2UXCH 2VPSA 2VUGA 4A2AA 4DV7H 1N36H 1Z2PX 4R7RA 4JI7H 2UXBH 1BGWA 3N6XA 1HNZH 2ZM6H 4OX9H 1TAEA 3KALA 1ZHQA 4JYAH 1WH2A 4CC6A 2VQFH 4UFZA 1FKAH 1N32H 5D1OA 2VOBA 4DUYH 1L2ZA 4RAZA 4B3MH 5A2QW 3OTOH 3BA9A 4IAJA 4LFAH 2W57A 3KAKA 4GKKH 1XMQH 3F8NA 1IBMH 1FVIA 2HVQA 3M4IA 1IBLH 3N41B 1TA8A 4RB0A 1N33H 3LMLA 3HXLA 4DUZH 3T1YH 1XMOH 3KXYT 5D1OB 2UU9H 2UUCH 2E5LH 4JI0H 3JSLA 4LFCH 3RF2A 4B3SH 4JI3H 1SEIA 3J80W 1A0IA 5FPRA 2UUAH 1I6UA 1B04A 4JI4H 5EOYA 1S03G 4Q0YA 3RGZA 1E4FT 1S68A 4EFEA 5LL6b 2CW8A 4KHPH 1MZBA 2Q2UA 4X64H 4K0KH 4MTDA 4AQYH 4JV5H 5FD6A 4JI5H 4DR2H 4DR4H 5LMUH 3J7AK 3H20A 4EEQA 3L2PA 4DR3H 4NXNH 4B3RH 4ETSA 3UQ8A 3JSNA 1IBKH 4B3TH 1VS0A 4DV2H 4LSXA 4DV1H 4DV3H 3RIZA 4UCSA 4DV4H 4LF8H 3BAAA 2WDTA 3L4JA 2HHHH 2FE3A 4UCTA 4LF9H 4DR7H 1O75A 2MCTA 4LH6A 4LH7A 4JI8H 5FPOA 4DR1H 3MWMA 3J81W 1HNXH 3FMAA 4JI1H 4CC5A 2F4VH 4BWSC 2HGSA 2XIGA 4M7EA 1J5EH 1V9PA 3N40P 4J0MA 4RB2C 2CW7A 3L4KA 2WE6A 1Z2OX 2YCHA 2RGVA 4YHHH 3BABA 4MTEA 4A2BA 1HR0H 4JI2H 5IWAH 1M0WA 5IT9W 4RZQA 4LF4H 4UCRA 1P8LA 4X65H 1ZHSA 4I7HA 4LMYA 4EFBA 4DV0H 2KSWA 3CVZA 3T1HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH2 A;  3FMA A;  4BWS C;  1L2Z A;  1SYX B;  1GYF A;  3K3V A; 
#chains in the Genus database with same CATH topology
 4RB1 A;  1E4G T;  1IOV A;  1I7L A;  4X62 H;  4ECQ A;  1ULZ A;  1VBH A;  5KFR A;  4DR5 H;  2NU9 B;  3MFH A;  3IG0 A;  4WBN F;  3HB9 A;  3OHB A;  2ZDQ A;  4DR6 H;  4LFB H;  2DIK A;  2R8I A;  2AGP A;  2OLS A;  1CQJ B;  1RYR A;  5CB4 F;  4GLX A;  2NUA B;  3RB0 A;  2DZD A;  5DLG A;  3BA8 A;  3PW0 A;  2C2R A;  4YY3 H;  5L9X A;  4J9M A;  2RDI A;  4LF5 H;  4UCO A;  4BBR G;  3I4M G;  5J2T F;  3ETJ A;  5BPH A;  3RGX A;  1X9N A;  2ZDH A;  2V58 A;  2OWO A;  3EYY A;  4ED0 A;  2AGO A;  4A3E G;  4A3K G;  4PDB A;  3JAM W;  1HNW H;  4UCU A;  5F9N A;  4DL2 A;  3PZP A;  3QZ7 A;  3KAJ A;  5KKN B;  3N42 B;  3G6Y A;  1AN7 A;  4A3B G;  5LXT F;  3OSN A;  5LMN H;  4DV5 H;  4RZR A;  5KG6 A;  3PO3 G;  2PMZ A;  2R7Z G;  3PR4 A;  2R8J A;  5KG4 A;  4JI7 H;  1CS0 A;  5KT2 A;  5DG7 A;  3GLK A;  4HR7 A;  2DPJ A;  2YYA A;  2FLP A;  2AGQ A;  2R7K A;  3TII A;  3KAL A;  5KT3 A;  5KG3 A;  4PWQ A;  1RJP A;  4CC6 A;  4YR2 A;  2YS7 A;  2NU8 B;  1FKA H;  4DUY H;  4Q45 A;  4EBE A;  4RAZ A;  1L2Z A;  5KFQ A;  2DLN A;  5KFE A;  4GC7 A;  1Y1V A;  2VQD A;  3BA9 A;  4MV1 A;  1TWC A;  4RNN A;  3RBE A;  4LFA H;  4EGQ A;  4BXX G;  1EHI A;  4Q43 A;  3MR6 A;  1FVI A;  3M4I A;  2VUM A;  3BJY A;  3N41 B;  3K5H A;  5DG8 A;  3RB3 A;  1BNC A;  2CZG A;  1CQI B;  2NVY A;  4M9U A;  3T1Y H;  2UUC H;  3N8D A;  1RK5 A;  4J9S A;  5KFY A;  4O4L F;  1UC9 A;  1SEI A;  3PW5 A;  4Q8F A;  4HNT A;  5KT4 A;  3BQ2 A;  3M9M B;  4XYM B;  2X0S A;  4JI4 H;  3RFC A;  4YR3 A;  1S0M A;  4Q0Y A;  1S03 G;  5KG1 A;  4QWE A;  5IYZ F;  4QJF A;  1E4F T;  3H0G A;  5LL6 b;  1SFO A;  3PO2 G;  4J9P A;  4FBT A;  4YBZ B;  4FBU A;  5KFM A;  1T94 A;  1I7N A;  2PN1 A;  2W8K A;  1RYS A;  4O3S A;  3HOU G;  4DR4 H;  2Y0S A;  3I4N G;  5KFV A;  2IBK A;  4B3R H;  4ECY A;  1IBK H;  2UVW A;  1VS0 A;  5KG2 A;  2W6M A;  4XX0 B;  2HJW A;  4E4T A;  4DV4 H;  2FP4 B;  4AYB E;  2FLN A;  5JVL A;  2FE3 A;  5J2U F;  4UCT A;  2W9B A;  4ZQI A;  3M9O B;  4DL4 A;  4JI8 H;  1RK6 A;  4DR7 H;  5FPO A;  5KFU A;  2JA7 G;  4A3L G;  1HNX H;  3FMA A;  5D8D A;  4ECU A;  2HGS A;  2XIG A;  3Q8R B;  4M7E A;  4IWY A;  1V9P A;  3JRX A;  4WD3 A;  3HOZ G;  5KG0 A;  3EPG A;  5KX5 F;  3HKZ E;  4HNU A;  3L4K A;  4F4X A;  1Z2O X;  1TWH A;  2VUM G;  5EZY F;  4ZI7 F;  5KFN A;  2W9C B;  3RV4 A;  2YRX A;  1P8L A;  4I7H A;  3WNZ A;  5L1L A;  1I50 A;  1RJQ A;  3M9N B;  5C5J A;  2J6S A;  2R8K A;  2KSW A;  5I47 A;  4U6P A;  3ORR A;  3I12 A;  5CAE B;  3IN5 A;  3MR3 A;  3T5L A;  4A3C G;  3RJ0 A;  1EUC B;  1XDN A;  4O2B F;  2XC9 A;  2E2H A;  2HVS A;  4FM9 A;  2RGR A;  4APM A;  2B63 A;  1BJT A;  3PR5 B;  3GV5 B;  4ED8 A;  2R8G A;  4MV9 A;  3N43 B;  3KHG A;  1DV1 A;  3PW2 A;  1KC7 A;  2W9A A;  1Z2N X;  5K2M A;  3LP8 A;  2W9B B;  1GSO A;  5D1P A;  2FK3 A;  3V4Z A;  1JXL A;  4EYI B;  5C1O A;  3K3V A;  3MWD A;  2WTF A;  1FJG H;  5KFW A;  4TQS A;  4LF6 H;  4DL6 A;  3RV3 A;  3JZI A;  1JDE A;  1GYF A;  5LYJ F;  3NGD A;  1M0T A;  3HOY G;  3HKZ A;  2R7L A;  2FJZ A;  2VUG A;  4I4T F;  4FS1 A;  1K1Q A;  1Z2P X;  2WAQ A;  4R7R A;  4QWD A;  2W6Q A;  4DL5 A;  1N36 H;  4MV8 A;  2JEG A;  2JA5 A;  4O4H F;  4QIW E;  4A3I G;  2ZM6 H;  2W8L A;  3WO1 A;  5C1P A;  1N48 A;  4JYA H;  4RNO A;  3G6V A;  1WH2 A;  3FKI A;  4HQ6 A;  2R82 A;  5D1O A;  3JRW A;  2VOB A;  3ETH A;  2UVV A;  2ALZ A;  1M7J A;  3KHR A;  4HNV A;  4YR0 A;  4J9O A;  1KEE A;  1S0N A;  4GKK H;  2YZG A;  5C8Y F;  1IBM H;  5HBR B;  3HBL A;  2JA7 A;  4RB0 A;  1N33 H;  2W9C A;  4I50 F;  5KFF A;  2C2E A;  2W7P A;  4LFC H;  1PX2 A;  3GID A;  3SI8 A;  4B3S H;  4YQW A;  2R92 G;  2W7O A;  1KJI A;  1VAJ A;  3Q8Q B;  2W6N A;  2JA8 G;  5FPR A;  5JVD F;  2IA6 A;  3BG5 A;  2I87 A;  5EOY A;  1C30 A;  4BY1 G;  1EYZ A;  5EWF A;  1S68 A;  5DLF A;  2CW8 A;  4ECZ A;  3GTO A;  3EPI A;  2C22 A;  5DQH A;  2Q2U A;  4J9K A;  2XCA A;  4K0K H;  5KFO A;  3GTL A;  4MTD A;  4IRD A;  2AQ4 A;  5FD6 A;  4YP3 A;  3BQ1 A;  3RAQ A;  4G3I A;  1EUD B;  5KFG A;  1TWG A;  2J6U A;  4DR3 H;  2R93 A;  4NXN H;  1JDB B;  3OUU A;  3MJF A;  4ETS A;  4MV6 A;  4B3T H;  4RU9 A;  2NU7 B;  2JEI A;  4DV2 H;  3RUP A;  2E2I A;  3TIG A;  4UCS A;  4LF8 H;  3BAA A;  5LP6 F;  2AU0 A;  4MA0 A;  5IYB G;  3V6J A;  4JV2 A;  1M6V A;  3Q1K A;  2HHH H;  3GTG A;  4TV9 F;  4A3G G;  3SE7 A;  3T5J A;  2MCT A;  4LH6 A;  2CKZ B;  5T14 A;  4HYK A;  3MWM A;  3J81 W;  5DGB A;  4BWS C;  5HV6 A;  1KJQ A;  5EDW A;  5KFL A;  2R85 A;  4ED6 A;  5F9L A;  3MFI A;  2WAQ E;  1J5E H;  3QZ8 A;  3PW4 A;  3N40 P;  5KFS A;  4J0M A;  4C2M A;  5KT7 A;  2R7N A;  4MA5 A;  1W96 A;  5KFX A;  2SCU B;  3V6K A;  2YCH A;  2YRW A;  4A3D G;  4YHH H;  1SCU B;  2WB1 E;  4MTE A;  2IMW P;  3MR2 A;  5IT9 W;  4RZQ A;  4F4Z A;  1GSH A;  2RF4 A;  1EZ1 A;  3V6H A;  4UCR A;  4DL7 A;  5DGA A;  5CA1 F;  2B63 G;  4X65 H;  3GTK A;  1WCM G;  4ZHQ F;  3Q2O A;  1GGO A;  2BQ3 A;  3H3V H;  3CVZ A;  1AUX A;  3KHL A;  1XNR H;  4IRC A;  4JI6 H;  2R92 A;  4TV8 F;  4JV0 A;  3RTX A;  1E4E A;  2ZJT A;  4UCV A;  3U9T A;  4IWX A;  2YZN A;  3PW7 A;  2UU9 H;  4LF7 H;  4EYH B;  2VA2 A;  1A9X A;  4IHJ F;  3N44 B;  4LSA A;  3BQ0 A;  2HVR A;  4ECS A;  4L1K A;  1DGS A;  4IRK A;  1GSA A;  4MV7 A;  4TUY F;  3G8C A;  5KT6 A;  2VQE H;  1KJJ A;  5L1K A;  4ECX A;  4QWA A;  4NLG A;  2FMA A;  4O3Q A;  1T3N A;  4ED7 A;  3ORQ A;  4BBS G;  3C0F B;  5JUM A;  4GKJ H;  2UUB H;  5EWG A;  4Y8V B;  2JEF A;  4ECT A;  2CQY A;  4EGJ A;  3PN1 A;  2P0A A;  5KFB A;  1KJ8 A;  2ZDG A;  1BXR A;  4C5C A;  4J9N A;  1S0O A;  2BR0 A;  2UXC H;  4A2A A;  3TQT A;  4U7C A;  4DV7 H;  2UXB H;  2ASL A;  1C3O A;  3FDS A;  4YJ2 F;  2XCL A;  3K3P A;  5IYC G;  5FLM G;  3VPC A;  3H4D A;  4EBC A;  2JEJ A;  4JV1 A;  3GTP A;  4ECV A;  3N6X A;  1HNZ H;  1TAE A;  2J6T A;  1ZHQ A;  1K83 A;  3U9S A;  4UFZ A;  4O3P A;  2R87 A;  2QK4 A;  5LA6 F;  1N32 H;  2R7Z A;  2UVU A;  1KBL A;  4B3M H;  2GLT A;  5JH7 F;  3OTO H;  4F4W A;  4IR9 A;  3R23 A;  2Y0S E;  1XMQ H;  3F8N A;  5KFT A;  4TQR A;  2XCP A;  5KFK A;  4IR1 A;  1TA8 A;  2W6Z A;  3T5H A;  2M05 A;  3LML A;  4YAK B;  2V9W A;  3FKI G;  3HXL A;  2FLL A;  3OSP A;  1XMO H;  5KFC A;  4ECW A;  5JQW A;  1AUV A;  1I3Q A;  1A0I A;  4O3O A;  2JA5 G;  2UUA H;  2UVR A;  4Q8E A;  2YL2 A;  3VPD A;  2R93 G;  2YW2 A;  5KFI A;  4EFE A;  1GO3 E;  5EWE A;  4KHP H;  4X64 H;  2QYZ A;  4I55 F;  1TWA A;  4MV4 A;  3RB6 A;  4DL3 A;  2C28 A;  1R9T A;  5KFJ A;  4GC6 A;  4QWB A;  4JI5 H;  2R7M A;  1DIK A;  3WO0 A;  4DLK A;  3GIK A;  3T5K A;  4EEQ A;  3L2P A;  1S10 A;  1OWT A;  2J9G A;  4IZO A;  4LSX A;  5C44 G;  4DV3 H;  3LWB A;  4R8U B;  5KG5 A;  1RJR A;  2WB1 A;  4FS2 A;  5KFP A;  4LF9 H;  1O75 A;  3KTM A;  3GIJ A;  4J9L A;  1B6S A;  3GIQ A;  2FK1 A;  2F4V H;  3VPB A;  3GTQ A;  5C4X G;  2C00 A;  5IP7 G;  1CE8 A;  1ZQ7 A;  3KHH A;  1JLL B;  4A3F G;  2PMZ E;  1E4E B;  3CQZ A;  4RB2 C;  4RNM A;  1WSC A;  4MV3 A;  2IP4 A;  4J9R A;  3RAX A;  3BAB A;  5IYD G;  1TWF A;  4A2B A;  4EBD A;  2R86 A;  1JKJ B;  2YU9 A;  3GTJ A;  3GIL A;  3GQC A;  1UNN C;  4JUZ A;  5BMV F;  4EFB A;  3GII A;  4F4Y A;  2XGQ A;  5BPF A;  3GIP A;  3K5I A;  3H40 A;  5FJ8 G;  1N34 H;  5KFD A;  5FLX W;  1SYX B;  1VKZ A;  1N56 A;  4NXM H;  5CA0 F;  2UXD H;  3MWE A;  5FD5 A;  1Y14 B;  2V59 A;  2R8H A;  1I94 H;  1IOW A;  4ED2 A;  1XNQ H;  1WCM A;  2W70 A;  4DV6 H;  4A3M G;  1Y1V G;  1GLV A;  2O03 A;  3DF7 A;  4QW9 A;  4X66 H;  2VR1 A;  5KG7 A;  4R8U A;  5BR8 H;  3HOV G;  2FPI B;  2JA6 A;  4ZOL F;  4XYL B;  2Q2T A;  1JIH A;  3GIM A;  2C2D A;  5DQG A;  3OHA A;  2NVX A;  4F50 A;  4RAY A;  2OH2 A;  4RB3 C;  5H80 A;  2VA3 A;  5KFH A;  2V4R A;  2WYO A;  2VPS A;  1V51 A;  4YB8 B;  2YS6 A;  4RUA A;  3AYH B;  3UFX B;  1BGW A;  3VMM A;  3E5N A;  1K1S A;  4A3J G;  1JX4 A;  4OX9 H;  2R84 A;  4EG0 A;  4QIW A;  1DV2 A;  5L1J A;  4EEY A;  5C3E G;  2VPQ A;  2VQF H;  1KJ9 A;  3HOX G;  4O4I F;  5KT5 A;  4MAM A;  5A2Q W;  3Q8S B;  4IAJ A;  2DWC A;  4C5A A;  3Q8P B;  2W57 A;  4YAJ B;  3KAK A;  4Q44 A;  2BQR A;  2HVQ A;  4ED1 A;  3RBD A;  1IBL H;  2JA6 G;  3PVX A;  4A93 G;  4DUZ H;  3GV7 B;  4C5B A;  2W6O A;  3KXY T;  5D1O B;  2W71 A;  2ASJ A;  2E5L H;  3JSL A;  1PK8 A;  3RF2 A;  4JI0 H;  4JI3 H;  4RUC A;  2ATL A;  3J80 W;  2DPI A;  3OUZ A;  1I6U A;  1B04 A;  4XZ3 B;  5DQI A;  5DG9 A;  5L1I A;  4J9Q A;  1ZET A;  3RGZ A;  3H4B A;  1WR2 A;  5KFZ A;  1Y1W G;  1MZB A;  3R5H A;  4YJ3 F;  2FB9 A;  4AQY H;  4BY7 G;  4JV5 H;  2RDJ A;  2R6F A;  4DR2 H;  5LMU H;  3J7A K;  1VBG A;  3H20 A;  3RB4 A;  1S97 A;  3GTM A;  3UQ8 A;  3JSN A;  2C35 B;  3R5F A;  4DV1 H;  3RIZ A;  1W93 A;  3TIN A;  4O3N A;  2WDT A;  3R5X A;  1T36 A;  3V4S A;  3QFF A;  3L4J A;  3GV8 B;  1UC8 A;  1B6R A;  2PVP A;  4FU0 A;  1B33 N;  4LH7 A;  4DR1 H;  2FPG B;  2W6P A;  4JI1 H;  4CC5 A;  5LOV F;  1S9F A;  2V4Q A;  2FKL A;  5GON F;  2V5A A;  3H0G G;  2GPW A;  5IP9 G;  3TQ1 A;  5KFA A;  2ASD A;  2XD4 A;  3G6X A;  4O3R A;  2CW7 A;  4ME6 A;  2FK2 A;  4AYB A;  4O2A F;  2WE6 A;  4ECR A;  2I80 A;  1V4Y A;  2RGV A;  3HOW G;  1HR0 H;  4JI2 H;  5IWA H;  1M0W A;  4QWC A;  2XGP A;  1Y1W A;  2BQU A;  4ED3 A;  4LF4 H;  2FPP B;  3MR5 A;  2GPS A;  1ZHS A;  2PBZ A;  4QW8 A;  2NU6 B;  4LMY A;  4DV0 H;  2I8C A;  2YZM A;  3T1H H; 
#chains in the Genus database with same CATH homology
 4RB1 A;  1E4G T;  4X62 H;  1XNR H;  1N34 H;  4JI6 H;  4DR5 H;  3RJ0 A;  5FLX W;  1SYX B;  1XDN A;  3IG0 A;  3RTX A;  4NXM H;  2ZJT A;  4UCV A;  2UXD H;  2HVS A;  4DR6 H;  4FM9 A;  4LF7 H;  2RGR A;  4APM A;  4LFB H;  5FD5 A;  1XNQ H;  1I94 H;  1BJT A;  3N44 B;  4DV6 H;  4LSA A;  4GLX A;  2HVR A;  4MV9 A;  2O03 A;  3DF7 A;  3N43 B;  1DGS A;  3BA8 A;  1Z2N X;  4MV7 A;  4YY3 H;  4X66 H;  4LF5 H;  4UCO A;  5D1P A;  2VQE H;  1X9N A;  3RGX A;  5BR8 H;  2OWO A;  3EYY A;  3K3V A;  1FJG H;  4PDB A;  2Q2T A;  4LF6 H;  3C0F B;  3JAM W;  1HNW H;  2UUB H;  4GKJ H;  4UCU A;  1GYF A;  3KAJ A;  3PN1 A;  3N42 B;  1M0T A;  1AN7 A;  4RAY A;  4RB3 C;  5LMN H;  4DV5 H;  2WYO A;  2UXC H;  2VPS A;  2VUG A;  4A2A A;  4DV7 H;  1N36 H;  1Z2P X;  4R7R A;  4JI7 H;  2UXB H;  1BGW A;  3N6X A;  1HNZ H;  2ZM6 H;  4OX9 H;  1TAE A;  3KAL A;  1ZHQ A;  4JYA H;  1WH2 A;  4CC6 A;  2VQF H;  4UFZ A;  1FKA H;  1N32 H;  5D1O A;  2VOB A;  4DUY H;  1L2Z A;  4RAZ A;  4B3M H;  5A2Q W;  3OTO H;  3BA9 A;  4IAJ A;  4LFA H;  2W57 A;  3KAK A;  4GKK H;  1XMQ H;  3F8N A;  1IBM H;  1FVI A;  2HVQ A;  3M4I A;  1IBL H;  3N41 B;  1TA8 A;  4RB0 A;  1N33 H;  3LML A;  3HXL A;  4DUZ H;  3T1Y H;  1XMO H;  3KXY T;  5D1O B;  2UU9 H;  2UUC H;  2E5L H;  4JI0 H;  3JSL A;  4LFC H;  3RF2 A;  4B3S H;  4JI3 H;  1SEI A;  3J80 W;  1A0I A;  5FPR A;  2UUA H;  1I6U A;  1B04 A;  4JI4 H;  5EOY A;  1S03 G;  4Q0Y A;  3RGZ A;  1E4F T;  1S68 A;  4EFE A;  5LL6 b;  2CW8 A;  4KHP H;  1MZB A;  2Q2U A;  4X64 H;  4K0K H;  4MTD A;  4AQY H;  4JV5 H;  5FD6 A;  4JI5 H;  4DR2 H;  4DR4 H;  5LMU H;  3J7A K;  3H20 A;  4EEQ A;  3L2P A;  4DR3 H;  4NXN H;  4B3R H;  4ETS A;  3UQ8 A;  3JSN A;  1IBK H;  4B3T H;  1VS0 A;  4DV2 H;  4LSX A;  4DV1 H;  4DV3 H;  3RIZ A;  4UCS A;  4DV4 H;  4LF8 H;  3BAA A;  2WDT A;  3L4J A;  2HHH H;  2FE3 A;  4UCT A;  4LF9 H;  4DR7 H;  1O75 A;  2MCT A;  4LH6 A;  4LH7 A;  4JI8 H;  5FPO A;  4DR1 H;  3MWM A;  3J81 W;  1HNX H;  3FMA A;  4JI1 H;  4CC5 A;  2F4V H;  4BWS C;  2HGS A;  2XIG A;  4M7E A;  1J5E H;  1V9P A;  3N40 P;  4J0M A;  4RB2 C;  2CW7 A;  3L4K A;  2WE6 A;  1Z2O X;  2YCH A;  2RGV A;  4YHH H;  3BAB A;  4MTE A;  4A2B A;  1HR0 H;  4JI2 H;  5IWA H;  1M0W A;  5IT9 W;  4RZQ A;  4LF4 H;  4UCR A;  1P8L A;  4X65 H;  1ZHS A;  4I7H A;  4LMY A;  4EFB A;  4DV0 H;  2KSW A;  3CVZ A;  3T1H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...