4BBSG

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbsG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bbsG01
4GNXA 4LFAQ 1S40A 3TS2A 3CC2A 4NXML 4DKAC 3F8TA 3M4QA 3BZKA 2H5XA 2L15A 1Q82C 5M3FG 3PO3G 4JBMA 2F4VL 1VQ7A 4DR6L 4X65Q 2N78A 2K75A 3HOYH 1TXYA 2VS1A 2E8GA 3J81j 1S72A 4DPGA 4GS3A 3J80c 4JI4L 1EFWA 1E3PA 1VQFA 4DUZQ 1MIUA 1Z47A 4DR7Q 1HZ9A 1I50H 3BJUA 1UWVA 2MO0A 4IPHA 1SROA 4C3IH 5IYDH 3E0EA 4IJLA 1N36L 5K36G 2ID0A 3PIPA 4J15A 4JI3L 2KHJA 4LWCA 5IY0A 4JI0L 3S2HH 4X62Q 3CCQA 1XMQL 4AQYL 4RG1A 2JA5H 4JYAL 2EIFA 3KDFB 4OONA 3HOXG 2UUAL 3K7AH 1GVPA 5J3BA 4A3CG 4ME3A 3AQQA 3RR5A 5JJLA 4R4OA 3ZJYC 4PZ6A 1M90C 4YCVA 4BA1I 4OXPA 4DV6L 5H1SE 1EIYB 1WCMG 3VDYA 3HOWG 1WCMH 2ALYB 1GM5A 1XTDA 1G291 3AFPA 3CMAA 1M1KC 1EIFA 2ZJPA 2UU9Q 2VW9A 2B63H 4LF6L 4A3FG 3RLFA 5ELNA 1HNWQ 4LFBQ 4HIDA 1A0IA 5LMUL 4GKJL 1TWCH 3E9IA 3CW2C 3HFZB 1Q1EA 3RLOA 4K0KL 2LSSA 4GOPB 1LYLA 3PO2H 3EN2A 4LFCQ 1Q1BA 4MNOA 1HR0L 3S24A 2A19A 4IPDA 4PZ7A 5FLXc 3CXCA 4DV3Q 2E2JH 4YWKA 4NPSA 2PI2A 3HKSA 5IP7H 5IYBH 3I56A 4PZ8A 2ZM6Q 2VQEL 1XMOQ 1PH7A 1VQLA 2K50A 4L5RC 1QZHA 1N32L 1QUQA 1G6PA 1I3QH 1NE3A 1X65A 4R1JA 3T1YL 4BY7H 3M7NA 1RIPA 1X3GA 4XIGS 4DK3C 3K7UC 3KLWA 1L0WA 1PH8A 2XTIA 1N34Q 2R92G 4A3LG 1JJGA 5M5XH 2R92H 2E2HH 1KRSA 2Z6KA 1XJVA 4A3GG 1XNQQ 2K4KA 1NY4A 3CCEA 2HIVA 4AH6A 1ASZA 1VQJA 3L0OA 2HHHQ 1YHQA 4DV5Q 1HNXQ 1BKBA 1WFQA 2VY3A 2BA1A 1XPRA 3MXNB 2IHEA 3TREA 3ULLA 1I94Q 3HOZH 1YEZA 4X64Q 3RNUA 4JI1L 3JAMc 5IE8A 4A3EH 2EXDA 3UDFA 1OXVA 1NJIC 1K8GA 1VQKA 1K3RA 2K52A 1EWIA 4FDBA 4YWLA 2N3SA 4AYBG 1B70B 1VQ8A 3FKIH 4A3MH 2K5HA 3HOUG 3I7FA 2OTLA 4NXMQ 3AEVA 2DUDA 4QQBX 5C3EG 3EBEA 3ULJA 2MQHA 5C3EH 5AJ3Q 1N33Q 2HQLA 3F2CA 4UP9A 4B3SL 2F4VQ 1VQ6A 4UP8A 4DR6Q 4GKKL 1VQEA 1IL2A 3I4MH 1SE8A 5JJKA 4APVA 5JEAJ 4JI4Q 4PG3A 2JA7G 3PGZA 5ELOA 1UE6A 4JI2L 4BY1G 1VQCA 1NTGA 1YJWA 1VQAA 4O2DA 1PH4A 1X54A 5LMNQ 3CD6A 2FXQA 2N49A 1LTLA 1N36Q 1FJGL 3HOVH 2ZJRA 2UUCL 4P75A 2I5MX 1XMQQ 5C0XJ 5GROA 1VQDA 3WWVA 4AQYQ 2MO1A 1E1TA 1OTCA 3OW2A 2JA6H 2YTVA 4H02A 3S15H 1GKHA 3UDIA 3GTMH 5DLQE 2B29A 2NN6I 5IP9G 4UY8C 4JOIA 3F2BA 4DV6Q 1GD7A 2I0QA 2JA8G 2D62A 2JA8H 1L1OC 3DLLA 3I4NG 4QL5A 3D31A 3AFQA 3U4ZA 3PSIA 1P8LA 5FJ8G 1PVOA 5GQOA 3UDXA 5FJ8H 1HZCA 1Y1VH 1PH3A 2D0PA 1HNZL 4LF6Q 4WJ4A 2CWPA 3KF6A 2GVBA 5GAGC 4LUOA 1C0AA 4LF7L 1Q81C 4GKJQ 5LMUQ 3PF4A 2NZHA 3A74A 2JEAI 3CCSA 3STBC 1PV4A 4K0KQ 3ER0A 3CCRA 1HR0Q 4QIWE 4P73A 3KOJA 1KRTA 1WI5A 4LNQA 3NELA 1UE1A 2GVAA 1CKMA 2HT1A 2OQ0A 1WOCA 2WB1G 3ERSX 2VQEQ 2IX1A 2AMCB 3S2DH 3CPFA 1CKNB 1VQPA 1R9TH 1HZBA 3ICEA 4BA2I 3HOYG 4NXNQ 4ALPA 3M4OH 1HZAA 1SRUA 4IOCA 1E1OA 2VZAA 3Q8DA 3J7A5 4WJ3M 2PQAB 1P16A 2Y0SG 3IRBA 1G51A 3GTJH 2R7DA 2WFWA 1UEBA 4A3IG 1TWAH 4JI8L 4A3IH 2OQKA 1JJCB 2WP8J 5IYDG 3RN5A 1K0RA 3PF5A 3GTGH 4A3KH 1PA6A 2EQSA 4O0AA 1K73C 4AIMA 4A75A 2NVYH 4YY3L 4HJ8A 4OO1I 4JI1Q 2JA5G 4HJ9A 3K0XA 2Z0SA 1CSQA 3KDFA 4EX5A 4YHHL 4DV4L 3H15A 1Q8KA 1IXRA 2NN6G 5C44H 4DV1L 1KIXA 4DR4L 1JMCA 4JI5L 1DGSA 3HKZE 1OXXK 4YWMA 1A62A 4JG2A 2B63G 1TWHH 2CQOA 4TQUS 2ZTCA 2UUBQ 3KJOA 4OX9L 2NZOA 1KHIA 4B3SQ 2WAQE 3GTKH 4GKKQ 5C4JH 1J6QA 3TS0A 2ZTDA 1MJEA 4JBJA 3F2DA 5HGQA 5JJIA 4JI7L 3PO2G 4DAMA 4GOPA 2E5LL 5EAYA 4JI2Q 5HY6A 1YJ9A 1IBKQ 1VS0A 1EUJA 4PMWA 1OXTA 5BR8L 1PH5A 4NB3A 1Q12A 5IP7G 5IYBG 3S16H 2ASBA 3GTPH 4YCUA 3NEMA 1PYSB 4GLXA 3RZOH 3G71A 4BY7G 3KJPA 1U0LA 2UUCQ 3GTOH 4DR3L 3GO5A 3W1BA 4DUYQ 3KYHC 3J81i 2PNHA 4OWWB 1UE7A 1VQGA 3GD7A 2YTYA 4GNXC 2RHSB 2UUAQ 4B3RL 4LF8L 1I6HH 3CCMA 1Q86C 1NMFA 5IYCG 2QEXA 3S1RH 5M5WH 2IX0A 5IYCH 1SFOH 1VQ5A 1YHAA 4QJFA 2Q2UA 1HNZQ 1VQOA 4BBSH 4HJAA 4L5QA 2AWOA 3G6EA 4B3TL 3HOZG 4OO1G 4A3DG 5FLMG 4LF7Q 2B3GA 1GO3E 5FLMH 4A3EG 4LF5Q 4LFAL 4A3DH 1SMXA 4A3JH 1IYJB 1YIJA 4LF9L 1VQ4A 1L1OB 3S17H 2JEBI 1VQIA 3CC4A 3FKIG 4X65L 3S1NH 4A3MG 4BXXH 1YI2A 3CMEA 1C9OA 3DM3A 3I4OA 4GN5A 4HJ5A 3T1HL 1JB7A 1SLJA 1XPOA 2VNUD 4A93H 3H0GH 5IT9c 3S1QH 2GN5A 2YYZA 2AWNA 5LMNW 4QGUA 2LXJA 3TEHB 3I4MG 2BH2A 3I55A 2QGQA 1X56A 2RCNA 3SGIA 4QY7A 4JV5L 1MKHA 1HH2P 2I5LX 2C35B 2R6GA 4POGA 2ZJQA 2VUMH 4JI8Q 3L2PA 4IFDJ 2KENA 1BVSA 4POFA 3M4PA 4JI6L 3KF8B 4X6AH 3HOVG 3NBHB 1NMGA 4JI0Q 4JI3Q 4YY3Q 3H3VH 3PUXA 3MEFA 2MNAA 4JYAQ 2UU9L 2KCMA 2JA6G 1IBLL 2UXBL 1FL0A 3J80i 1SR3A 5GADC 4YHHQ 4OWXB 3U50C 1VQBA 4DV4Q 4DK6C 4DR4Q 1YNXA 2OCEA 3LGJA 4DV1Q 4R4QA 1N8RC 2K5NA 1AE3A 1YVCA 1EQQA 5IWAL 1PHJA 2RHQB 4JI5Q 1HR0W 4A3BH 4LFCL 1Y1VG 2VL6A 3L7ZC 4DR2L 4OX9Q 3D0FA 4DR5L 3AYHB 4JC0A 4DR1L 4Y7NH 1PYBA 2Z6KC 3JC66 4C3JH 4Y52H 2K5VA 4AYBE 4JI7Q 1QVFA 2HIXA 1U5KA 2E5LQ 4L5SA 2IY5B 4LUZA 1PH6A 3RLNA 1KD1C 5BR8Q 1AE2A 1VCIA 4P74A 2PI2E 4RMFA 1AH9A 3PV0A 5JEAG 3G4SA 1X3EA 1CKNA 1N32Q 3J7ZC 1Z9FA 3STBD 3T1YQ 4DR3Q 2JJQA 2XGTA 3F1ZA 3RZDH 4P71A 3M85A 1XNRL 2Q2IA 4JCVE 4DNIA 4DV0L 1MJCA 1KC8C 2YV5A 4DV5L 3OTOL 3CCLA 1H95A 2R7ZH 1L2FA 4B3RQ 2PQAA 5C0XG 1VQ9A 5E7NA 2RF4A 1T9HA 1CSPA 4BBRG 2F3IA 4BBRH 4L5TA 4A3KG 4B3ML 1IBML 4B3TQ 1X55A 1IZ6A 4DV2L 4GNXB 2UXDL 1A8VA 3K81C 4UP7A 4DAYB 4LF9Q 2Q2HA 5AJ3L 1N33L 1X6OA 5M3FH 3PO3H 1YJNA 1QVCA 5C44G 1ASYA 2UXCL 2Q2TA 4OWTB 5GAHC 2AHOB 2NVQH 3T1HQ 2E2IH 1VQMA 2NVTH 4HIKA 3E9HA 3BZCA 3S1MH 1V9PA 2F52A 1X3FA 3BU2A 3GTLH 4R4IA 3CCUA 3FHWA 3JAMi 3PIOA 3FP9A 3CCVA 5LMNL 2NVXH 4JOIC 2VQFL 4GLAC 3K8AA 3PUYA 1B8AA 1Q46A 2CCZA 4JV5Q 4GN4B 1A63A 2CWAA 3W5OA 1TWFH 4JBKA 1Y14B 1FVIA 2WB1E 3CAMA 1O7IA 3CP0A 3PUZA 4X66L 3HOXH 1PH9A 4DV7L 3A5ZB 1JT8A 4A3CH 1LM0A 4JI6Q 1HJPA 1W3SA 1FJGQ 4C3HH 1KAWA 3PUWA 1C7YA 3H3VI 3HOWH 2D0OA 2V1CC 1IBLQ 2UXBQ 1KXLA 1CKOA 2Y0SE 2DGYA 4A3FH 1E7ZA 1WYDA 1EYGA 2YU9H 1B7YB 3EIVA 4IPCA 5IWAQ 4LF4L 1PH2A 2BA0A 1Y1WG 4BBSG 4DR2Q 1Y1WH 4KHPL 4LUVA 4DR5Q 1J5EL 1JJ2A 3UE1A 1YITA 3W1GA 4DR1Q 3S14H 3ULPA 4GN3B 2ATWA 4A3JG 1YHBA 3CQZH 3U4VA 1QUQB 1QVGA 3CC7A 1L1OA 4A76A 1OXUA 3OYYA 4NXNL 4BXXG 2ES2A 1KQSA 1YBYA 2IHFA 1BBUA 2I5HA 4A3LH 1QZGA 4KLKA 1E24A 4A93G 3H0GG 5GAEC 4DUZL 4A3GH 1EQRA 2BH8A 1X9NA 4DR7L 1RL2A 1WJJA 1Q7YC 2LXKA 2R7FA 2JK8A 1XNRQ 2K14A 2AKWB 2IT1A 4DV0Q 3OTOQ 1EOVA 4IFDI 1PH1A 4KHZA 4R4CA 3PCOB 2A1AA 3RN2A 1UE5A 1D7QA 2KBNA 4X62L 1E22A 2VUMG 4IPGA 3GTQH 2R93H 5C0XI 4UPAA 3UE0A 2MFIA 4R4TA 2YTXA 1K9MC 1I5FA 4B3MQ 3UDGA 1IBMQ 4LW1A 4DV2Q 4GOPC 2UXDQ 3CF5A 1OXSC 3B6YA 4TVAB 3HOUH 3KFUA 5M3MG 4MZ9A 5M3MH 2R93G 2PMZE 2UUBL 4HJ7A 3M3YH 2UXCQ 3A5UA 1HNWL 2JA9A 4LFBL 1D8LA 2CKZB 2OWOA 4A3BG 3TQYA 1SN8A 3J81c 2JE6I 2OTJA 2JA7H 2A8VA 1IBKL 1NBWA 1W2BA 4BY1H 3I2ZA 4DV3L 4XTCS 1PFSA 2ZTEA 4YCWA 2ZM6L 2VQFQ 1K8AC 3K80C 1XMOL 1VQNA 3M9BA 1N9WA 1K83H 3NENA 1YZ6A 4DUYL 4X66Q 4JBWA 1N34L 2CFMA 5C4XG 4HIOA 4DV7Q 5C4XH 4GLVB 1LUZA 3U58A 1V1QA 5IP9H 1XPUA 1BBWA 1XNQL 3CPWA 1KL9A 4IJHA 1FGUA 2QA4A 3I4NH 2KCTA 3HKZG 4IFDG 1VQHA 3TRZA 2HHHL 2KHIA 4KI0A 4HIMA 1V43A 3GDEA 1TWGH 3CCJA 1HNXL 2R7ZG 3KF6B 2JQOA 4P72A 4LF8Q 2WAQG 1I94L 4LF5L 3G48A 4A4IA 4X64L 4LF4Q 1JE5A 4C2MH 2N8NA 4MTNA 5M5YH 3PUVA 4KHPQ 1S3OA 4EQ5A 1J5EQ 4IOAA 1CUKA 4IO9A 3A0JA
chains in the Genus database with same CATH superfamily
3MFYA 1TWHA 2R86A 3TS2A 3SE7A 2B63A 3F8TA 4DAYA 4IUNA 1Q82C 1ZQ7A 3GQBA 1XNQH 3PO3G 4OHJA 4JBMA 3HOYH 3LP8A 4HNUA 1ILPA 4QUFA 1HNXH 2FMMA 2VB2X 3OMGA 3J81j 3BVZA 1S72A 2FPPB 1S10A 1I94H 4JI4L 4X64H 1EFWA 4DUZQ 5DQGA 4IR9A 4DR7Q 1HZ9A 4ECXA 3T5LA 1ILQA 1UWVA 3BJUA 4LAAA 3I8ZA 1TR5A 4C3IH 3GTOB 4IJLA 5IYDH 4K2LA 1N36L 5K36G 1B53A 3V05A 3K3VA 3QIAA 2QW7A 1HCZA 1JC7A 4RG1A 4AQYL 5IGEA 2JA5H 4JYAL 1N33H 2EIFA 4X3UA 2E2HA 3FMAA 3S1RB 4R4OA 4PZ6A 1SFOB 1M90C 5KX5F 1EIYB 3I90A 4OXPA 4BA1I 3GV5B 2CVRA 2RGVA 4JI4H 1KJQA 3T5KA 3NSWA 2PBZA 4QWCA 2VW9A 2F0WA 5C3XA 1HNWQ 4A3JB 5LMNH 3RBEA 4HIDA 1N36H 1BXTA 3J80L 1IL8A 1CHQD 4YJ3F 1G2TA 1CQJB 1Q1BA 4Y8VB 3K5HA 4AQYH 2YYAA 1SYCA 4RGMA 4IPDA 2W9CB 5J1ZA 3M9MB 3S9WA 2R8JA 2PI2A 1SYGA 2ZM6Q 2PQEA 2O2LD 4L5RC 2W6QA 2WACA 1N32L 4IQZA 1G6PA 1I3QH 1NE3A 1PTOC 4N8X1 4R1JA 5EBDA 4BY7H 5LP6F 3QZ8A 3A55A 4GC7A 5KG2A 3L3OC 1Q8IA 2R92G 2R8GA 1KRSA 2MHVA 1XJVA 2K4KA 4PNYA 4IUQA 2HIVA 4AH6A 1VQJA 2NUCA 2HHHQ 4DV5Q 1TQOA 1BKBA 2CH4W 1YNJC 1XPRA 2IHEA 5JVLA 3BDLA 5FPRA 3S15H 2R93G 4KK7A 3UDFA 1K8GA 5KGUA 4FDBA 4K6DA 4EFBA 4YWLA 5FLXL 4NXNH 1SNMA 4G57A 2I8CA 5KFDA 4FS1A 4A3BB 2J6UA 1WTRA 1HXYD 2DUDA 2ZXPA 2AQ1B 5C3EG 2F0LA 2MQHA 3F2CA 4DR6Q 3BA9A 5KFMA 3I4MH 3TMEA 5JJKA 2JA7G 4RU9A 5DQIA 1TY0A 2CHBD 3CD6A 3N52A 1X54A 3MR2A 2FXQA 3Q1KA 2K28A 1LTLA 4HCSA 2XWJB 2E75C 2CZGA 2RGRA 1FJGL 3NBIA 4F4ZA 1FD7D 1VBHA 3H6MA 3KTMA 3OW2A 2MGSA 4MAMA 4O3QA 1GKHA 1V1PA 1JQYD 1STAA 3UDIA 3PIP3 3GTMH 5KKNB 2AGOA 4DV6Q 1I4XA 4QWBA 2C22A 1RTNA 3D31A 4JK1C 2KHSA 5FJ8G 5GQOA 4LF6Q 5EPLA 3C46A 3RGXA 4ZKCB 3KF6A 5GAGC 4LUOA 1NUCA 4DL4A 3T5HA 2ZJTA 4GKJQ 1EYCA 2NZHA 3A74A 3PO3B 4K0KQ 1RKNA 3LMLA 4DL7A 3KOJA 4DUYH 5L1JA 3NELA 2X6LA 2NVTB 2GVAA 3MXPA 1CKMA 2OQ0A 2AMCB 4M1UB 3S2DH 4J9SA 4UCOA 4ALPA 1TA8A 1KDBA 3OHAA 1II3A 3RB4A 5FO9B 1SRUA 3KUPA 5D1PA 2F0VA 1EEFD 1JWSD 3J7A5 3HRZC 1F9RA 3GTJH 4Q5VA 5COYA 3N42B 4QMGA 1KEEA 5ELFA 3GTPA 3D4WA 5KFTA 5KT2A 1K0RA 4A3KH 2R8IA 5CBEE 4G4KA 1K73C 4A75A 2NVYH 4JI1Q 2N55A 3K0XA 1SNCA 4HR7A 2NN6G 5BPFA 5IT9E 4MN3A 1KIXA 4XT1B 4L1KA 4O4HF 1Y1WB 3HKZE 1CE8A 3BYYB 2B63G 2NZOA 1KHIA 3GTKH 2WAQE 4GKKQ 2DPJA 2ZTDA 4QWDA 4O1NA 3PO2G 1DOKA 5DLFA 4UCTA 1VS0A 4TQSA 1OXTA 4YAJB 2PCFB 4CBVA 3ETJA 5IP7G 3S16H 4ZCKA 1WD0A 3GTGA 4YCUA 5KFKA 4RA8A 3RZOH 2P0AA 3PN1A 2UUCQ 2W57A 1BF4A 2OEOA 1UE7A 2YTYA 3DXJC 1STYA 2RHSB 3UQ8A 2R93B 3CCMA 3BABA 5HV6A 2KEEA 2QEXA 5M5WH 3IN5A 1LTRD 5I4DA 1PTOD 1YHAA 3OHXC 4HSPA 1GSOA 2Q2UA 4J9MA 1HNZQ 1VQOA 1SYEA 4L5QA 4O2AF 3LWEA 2KVMA 1CTMA 4LFAL 4A3DH 3SI8A 4J9PA 2JEFA 3BZDB 3C0FB 1SE3A 4OEMB 3S17H 1VQIA 2C2DA 2K05A 5FO8B 4BXXH 1DD2A 2DWCA 1B33N 1NR2A 2I46A 3I4OA 4GN5A 2JA7B 1SLJA 4RB0A 3NWSA 2PVPA 2BQRA 4A93H 1V1OA 2DZDA 5IT9c 4MV6A 2LXJA 1K83B 4CJ2C 2KSWA 3SGIA 4HEDA 4JV5L 2R6GA 4ZQIA 1LTID 2JN4A 4FF2A 1PRTB 2R7KA 2V59A 4POFA 1VBGA 2NUAB 3M4PA 4J9LA 4Q0FA 3HOVG 4LMYA 1FNVA 1C4QA 4YY3Q 3H3VH 3HKZA 1ET9A 1TWGB 2MNAA 3MHBA 2UU9L 4JYAQ 4RAYA 2R7ZA 3G8CA 3RD4A 1SR3A 4YHHQ 1VQBA 5CGKA 2WAQA 3M9OB 1YNXA 2Z9HA 5M5YB 4IZ8A 4IUVA 1WTPA 1I7NA 3RUPA 2VB3X 4JV5H 1F2ZA 3L7ZC 1U4MA 4DR2L 1PFNA 3D0FA 3CU7A 3AYHB 3T53B 4J8QA 4WFN3 3GIPA 3F8NA 4EBCA 1PYBA 2Z6KC 3K5MA 3P20A 3D8GA 4JI7Q 1BO0A 1QVFA 3HS0C 3ERQA 1AN8A 3E6ZX 4ZLTF 3J7AK 1MI2A 4LUZA 3DEPA 1PX2A 1VCIA 3R5HA 3MFIA 5C8YF 4U673 5JEAG 3TQTA 1W6KA 1X3EA 3GTLA 1CKNA 1N32Q 2DIKA 3Q8PB 4DR2H 2BDOA 3H20A 2NVXA 1AW7A 4QB4A 4DNIA 4IFDH 2YS6A 2RDIA 2V5AA 2RCFA 1VKZA 5JUMA 5JPMC 2QF7A 1T5EA 2PQAA 5FLXE 5C0XG 4Q45A 3A8KE 5E7NA 2ZDQA 2WIIB 3WOEA 2JEGA 2F3IA 4BBRH 4IRKA 2LY7A 5KNBA 5EWEA 3U9TA 4CDCC 2B63B 2NU6B 4DAYB 1TT2A 5AJ3L 3RB6A 2OH2A 1QVCA 1E0BA 2UXCL 2YU9A 3PO2B 1U4LA 2NVQH 3UFXB 5KYLA 3T1HQ 2E2IH 1SYXB 5F2DA 3BZCA 5FK9C 3S1MH 2F52A 4QWEA 3BU2A 3FHWA 2F03A 3JAME 4ZUIA 3FP9A 3TP6A 2QILA 3P75A 2VQFL 3RAXA 5C5LA 5JJZA 3PUYA 1B8AA 4DGZA 2SNSA 3G6YA 3W5OA 4JBKA 5FD6A 5M5XB 1FVIA 1TIID 1Y14B 2E2HB 4J9QA 2UXCH 3HOXH 3ORQA 3NGDA 3A5ZB 1JT8A 2J4XA 1LM0A 1HJPA 3IFTA 3OWEB 1FJGQ 2C2RA 2TMPA 4C3HH 5KG0A 3PUWA 3HOWH 2D0OA 3MXGA 3R2IA 2XIGA 4K8IA 1KC7A 1CKOA 4IWXA 4MHEA 1WYDA 3C2PA 3Q8QB 4LMQD 2VQFH 3GTQA 3EIVA 4HMIA 1KAAA 1C30A 5DGAA 2BA0A 2M2LA 4BBSG 4KHPL 2JP1A 4ED1A 4QIWA 1JJ2A 1SSOA 1YITA 4DR1Q 4Q8EA 1ULZA 1S5ED 1JWMD 2FMCA 1QVGA 3CC7A 4A76A 3VPBA 1C48A 4EG0A 1Z7TA 3VMMA 3PW7A 2I5HA 1JIHA 4LF8H 2LMCB 4A3LH 4KLKA 1E24A 3I3CA 4DUZL 4IRDA 1EQRA 2AUJD 4DR7L 5KFYA 1WJJA 4QWAA 1Q7YC 4KHPH 2LXKA 1XNRQ 1HRJA 2AKWB 2IT1A 2QEJC 3HOVB 2O5JC 4RUCA 1HTPA 2B39A 2KBNA 1EWHA 3G7LA 2IJ0A 1BCPD 4IPGA 3KALA 3SK5A 5CBAE 1K9MC 4ECUA 4X3TA 2XNAC 1PLFA 4B3MQ 4KJOA 2KQ3A 3KF8A 4WRDA 4GOPC 3CF5A 1D5XC 1OXSC 3KFUA 4DUZH 5M3MH 1W93A 2UUBL 1IW7D 4DR7H 1KJ9A 2XC9A 3NTIA 2K32A 1HNWL 2JA9A 4I65A 4EVOA 1SN8A 3J81c 2JE6I 2OTJA 1KTKA 2W6ZA 2XCPA 1NBWA 1W2BA 4BY1H 3I2ZA 3OHBA 4XTCS 3OIPA 4C56C 1PFSA 4C3JG 2ZM6L 1S03G 4CKEA 2EDGA 4DAVA 1VQNA 1F9PA 2W7OA 1N9WA 3PW4A 2A6EC 1WTWA 3QZ7A 5DLGA 1YZ6A 3V96A 1B1ZA 1HNWH 4HIOA 1V1PB 1RTOA 1LUZA 2A6HD 3U58A 2L55A 4FS2A 1DIKA 2W6NA 1KL9A 5BMVF 1FGUA 2QA4A 2KCTA 5JOBA 3HKZG 5KFAA 2HHHL 4KI0A 2R7ZG 1HFGA 3CCJA 5EKKA 2NVYA 3KF6B 2JQOA 2ZM6H 5KG7A 2WAQG 3KLSX 4LF4Q 2Z4IA 3PUVA 1B3AA 1QJOA 1S3OA 4OIKA 4IO9A 1Z2OX 4FXDA 4LFAQ 2F0EA 4ZOLF 2L15A 1EEID 5C4JB 4DR6L 1MSGA 1KLUD 2SOBA 1TXYA 4UCSA 4DV5H 2DY8A 2HHHH 2B2VC 1NCVA 3D6CA 4L6TB 3VR4A 4KKTA 4DPGA 3EROA 3EFXD 1I7LA 3SDZA 1EIGA 1VQFA 3Q8RB 1Z47A 1B6RA 1I50H 3GTPB 1PDQA 2MO0A 4RHRA 4C3IG 2IA6A 4IURA 3CVZA 1M7JA 4J15A 4JI3L 2KHJA 4JI0L 4IRCA 3DHQA 3S2HH 3CCQA 4DU9A 1I6HB 4ILWA 3RIZA 4DR6H 2R92A 1WTOA 3K7AH 4HR7B 3RV4A 4ME3A 1LTBD 4U68A 3MJFA 5JH7F 4YCVA 4DV6L 2W6MA 4ZUJA 4UDUC 5H1SE 5KFVA 1O7ZA 3VDYA 4BBSB 2HUGA 1WCMH 4RWSC 5FO7B 1GM5A 3PMFA 3CMAA 2UU9Q 5LXTF 4LF6L 1DXMA 5KNDA 4RAZA 1ZYRD 1GJXA 1L2ZA 1J9OA 1A0IA 1A3VA 4GKJL 1TWCH 3E9IA 5E1FA 3VR6A 4I50F 3S1NB 2LSSA 5CR3A 4K0KL 5DG8A 2NBFA 3FKIA 1QNUA 2M00A 3WOFA 3S24A 5G3LD 1Y69U 2A19A 4PZ7A 2E2JH 3OWFA 2V9WA 5KG4A 3BJYA 3HKSA 5IYBH 1SNPA 1XMOQ 2FKLA 3S1QB 5D1OA 4DV6H 1QZHA 4N8FA 4F4XA 1QUQA 1Z6HA 3T1YL 3WNZA 5M9OA 4LF6H 4DK3C 3KLWA 1O78A 1LABA 2TSSA 1GSAA 3Q0AA 1JLLB 3J81W 5K5PA 3TINA 4GKJH 1JKJB 2Z6KA 4K0KH 4IUUA 1NY4A 3CCEA 4JV2A 3NPPA 1ASZA 2VA3A 5C4ZA 2ZXRA 2KA7A 1Q90A 1YHQA 4MV9A 5CAEB 3HOZH 3VR3A 3RNUA 1A3TA 4JI1L 4A3EH 2EXDA 1VQKA 1NJIC 2E76C 2K52A 3C3LA 2N3SA 4J0MA 1B70B 1VQ8A 1EY0A 1LLRD 3T5JA 1GUSA 4A3MH 3A7AB 1PZID 1JWUD 3EA6A 4NXMQ 4R7RA 1O75A 1Y1VA 4QQBX 3MZ5A 2WDTA 5CYUA 3ULJA 5AJ3Q 1CZWA 2F4VQ 4DNTB 4C3JB 4GKKL 4FO2A 4RB1A 1Z2PX 4DF7A 1IL2A 3MR5A 1TS4A 1SE8A 3R5XA 1T94A 5JEAJ 3DMUA 4JI1H 5ELOA 3BAAA 4C5BA 3KHLA 4QCLA 3KHGA 4RB3C 4DL2A 1NNXA 1VQCA 4Q44A 1NAPA 5JAVA 4ZKBB 1VQAA 5CV6A 1R9TA 2N49A 4RUAA 3D3RA 5T14A 3RZDB 1V51A 2ZJRA 2UUCL 3HKZB 1XMQQ 3HG9A 3I91A 3WWVA 5C0XJ 4KJNA 1K8OA 2R7ZB 4R8IA 1E1TA 1KNAA 4DK0A 1OTCA 1MZBA 3DEOA 2JA6H 4WD3A 1PFBA 2YTVA 4H02A 2WAQB 1DV1A 1CI3M 3Q2OA 5DLQE 5IP9G 2NN6I 1K0SA 5KT3A 2J0TD 4HNTA 1L1OC 3DLLA 3I4NG 2AGQA 1QNKA 3AFQA 3U4ZA 1P8LA 4CKCA 5DAUA 5KG5A 3ONAB 4G7OC 1A2UA 4CJ1B 2C9OA 2EYJA 1HNZL 4WJ4A 1IKMA 2QYZA 2WE6A 3BDCA 4TV9F 4APMA 1YNNC 5LMUQ 3KLSA 2JEAI 2UUCH 1XXGA 3ER0A 3CCRA 1HR0Q 4P73A 2IMWP 1WI5A 4I7ZC 4LNQA 1EU4A 2E2IA 3NQIA 3UI2A 2HT1A 2R3ZA 2IX1A 3GTLB 4ME6A 4OELB 1CKNB 1FNUA 2CW8A 4BA2I 3M4OH 1S4ZA 2NVXB 2VUGA 5DM73 2AQ2B 1HNZH 4F88A 4IOCA 2N88A 2PQAB 2OF1A 2V58A 2IBKA 1UEBA 1PTOB 1TWAH 4A3IH 3RN5A 1PMRA 1M6VA 4DA2A 3GV6A 3PF5A 4U6PA 5HBRB 1PA6A 2W8LA 2C28A 4AIMA 2C2EA 4YY3L 4HJ8A 1G2SA 2L12A 4J9OA 3KDFA 4C1NK 4EX5A 2NTTA 4YHHL 3H15A 2YU9B 1Q8KA 3VPCA 4J9KA 5C44H 2FE3A 2XCAA 2F4IA 1ESFA 3DWPA 4YWMA 1A62A 2JSOA 4JG2A 2CQOA 2IL8A 2UUBQ 4B3SQ 1J6QA 2EXZA 4V0BA 3TS0A 1MJEA 4JBJA 3F2DA 5JJIA 1EY5A 4JI7L 4YY3H 2BQ3A 4GOPA 3FPPA 4JYAH 4JI2Q 1F77A 2O4XA 3CRKC 4EEQA 4KMUC 3K5LA 4YHHH 3GIKA 2G5DA 3BQ2A 4YR0A 4B08A 2ASBA 3H0GA 1KDCA 4GLXA 3EPGA 4HQ6A 3GTOH 3JSNA 4WJWA 2AQ3B 5D8DA 2GPWA 3KYHC 3J81i 2R85A 2KECA 2W71A 1EL0A 4PWQA 1JOKA 5KIXA 4GKKH 3T13A 1EFID 3GTQB 1B9MA 1EYZA 3V6HA 2VUMA 4JI7H 3S1RH 4WBNF 5CORA 3I73A 1SFOH 1VQ5A 4EYHB 4ZK9B 3SVMA 4QIWB 2AUKA 5C6AA 4OO1G 4IUTA 4A3DG 2VXWA 2F0QA 3MXNA 3GIIA 2B3GA 1GO3E 3SK8A 1PZJD 1SMXA 3J7YW 4A3JH 3M3YB 1VMPA 1EHIA 1N32H 4O4LF 1AP0A 2SDFA 3FKIG 3KHHA 2LFNA 1C9OA 1F2MA 3DM3A 3T1HL 3MWMA 4K6LA 2IX3A 1CT1D 1STHA 4ZAIA 1JDEA 2AWNA 1VAJA 1AUVA 4O4IF 2XVSA 5EQ0A 5CB4F 1V4YA 5KFBA 4RNNA 1X56A 2RCNA 3G6JB 1BOSA 4KD4A 1RJRA 4JV0A 1I4PA 1SNDA 2X6GA 3NTHA 2E2DC 2RDHA 5C4XB 4IN3A 3LWBA 5I9PA 4TUYF 2B2VA 3KF8B 4X6AH 3I4NB 3T1HH 5KT6A 3NBHB 4JI0Q 4JI3Q 3MEFA 3VR2A 1F9SA 3U50C 3LGJA 4G7HC 2K1BA 4C2MB 1KJ8A 2UVVA 1EQQA 1HR0W 1OO9B 4A3BH 1KLGD 4LFCL 1O80A 1Y1VG 4JW0A 2FP4B 4DR1L 3BG3A 2JXMB 3JC66 2HDMA 2K5VA 3DWAA 1FJGH 4C5CA 1PXUA 2FPGB 1U5KA 1B2TA 5KT5A 2R61A 3NXWA 2BDNA 1KD1C 1AE2A 4IALA 5KFRA 1AH9A 4RMFA 1GHKA 3PV0A 3PQIA 4GC6A 3G4SA 4XT3B 1JDBB 1YNND 4XZ3B 1GXDC 1Z9FA 5IOCA 3T1YQ 4DR3Q 2JJQA 3ZYYX 3VYSA 1XNRL 2Q2IA 1X3PA 4DR1H 2YV5A 1RODA 5ELDA 4B3RQ 1E2WA 1TWFA 2F0FA 2B2WC 3J81L 3GILA 2K7VA 3P1HA 3KBXA 4H13C 1I4HA 1T9HA 4RNMA 5FOBB 4BBRG 3GIDA 4B3ML 1JB3A 4B3TQ 3WO1A 1IZ6A 3SK6A 5KFSA 1HUMA 3K81C 4UP7A 3M4YA 2Q2HA 1DONA 1T3NA 3VR5A 1X6OA 1NR4A 1YJNA 1ASYA 3D4DA 3PO3H 3HEJA 1XNRH 2Q2TA 2AHOB 2H4OA 3W2DA 1EUDB 5LOVF 2NVTH 1A6XA 4R4IA 4N9TA 4B3MH 3CQZA 2WINB 1SNOA 5K36H 4GLAC 3K8AA 2NU9B 4ED0A 2EYPA 2CWAA 3OSNA 3I4LA 2R92B 3CAMA 2WB1E 1R4QB 3MEHA 2M9VA 3FPUB 1WVLA 5IGBA 5M5WB 1W3SA 1QWYA 3PW5A 4C3HG 1TVXA 5ISRA 3QB3A 3E5NA 5ELBA 3TN2A 2V1CC 1RYRA 1KXLA 3DF7A 1WD1A 1GLVA 2NB0A 4RNOA 1BR9A 4IPCA 5IWAQ 4LF4L 1ONLA 3RGZA 4EGJA 3FKIB 1RJQA 5KFFA 4U7CA 1Y1WH 1UEAB 4DR5Q 1B44D 3PW2A 1QCBD 1CQFA 3A8IE 3SR1A 3ULPA 4GN3B 2A5HA 3FRPB 5C3WA 2R6FA 3IG0A 5KFGA 4E6IA 5C3EB 1TS2A 5D1OB 3MC0B 1YHBA 1QUQB 2EVBA 2F0MA 1EQTA 3BS1A 2PO4A 1L1OA 5KFCA 5K2MA 1KQSA 5GONF 1BJTA 5H80A 1K8MA 1BBUA 1RHPA 4KKUA 3H0GG 1BCPC 3TP5A 4LF4H 1LTGD 2A73B 1JX4A 1EYDA 4FF1A 1X9NA 1RCVD 1RL2A 4R9WA 3M4IA 2R7FA 1QILA 2K14A 4DV0Q 3V4ZA 2DY7A 1EY7A 4KHZA 4R4CA 3PCOB 2A1AA 1QOHA 1DZ1A 4LFAH 1BDOA 3EQLC 1E4FT 2VUMG 1UAPA 1IW7C 2R93H 4IWYA 4DNRB 2B8FA 4XDXA 1ZHQA 2VR1A 3JRXA 5EKIA 5LL6X 1SJHD 3HP3A 2EJGC 1Y1VB 1SMYC 2OT2A 3B6YA 5M3MG 1HA6A 4MZ9A 3VYTA 3J80E 5EWGA 2Q8RE 1FGBD 1DCZA 2J9GA 3A5UA 5KRUA 1D8LA 4ZI7F 1E2ZA 2OWOA 3TQYA 1CK1A 3J7AF 2JA7H 4J6HA 4XQQA 1IBKL 3A7LA 2QK4A 5KT7A 3EJIA 2YRWA 1R9TB 2WB1A 4KKSA 2A6HC 1K8AC 1XMOL 5J39A 1K83H 3KK7A 3HB9A 2UU9H 4FXKC 1AZQA 4F7XA 2EOTA 2J7ZA 3H3VC 3BVMA 3GLKA 4GLVB 1V1QA 1GUTA 3CPWA 3NK9A 5A2QW 2IPKD 3GTGB 4RB2C 2RDJA 1VQHA 4G7ZC 2KHIA 1V43A 1TWGH 5A35A 4P72A 4P2CB 1XMOH 2SCUB 4LF5L 2JA5A 3G48A 4A4IA 3V6KA 5CA0F 1JE5A 2N8NA 5M5YH 4IAJA 5CV7A 4JV1A 3V6JA 1CUKA 2RSOA 3U9OA 1QG7A 1CQVA 4EEYA 1TWHB 1SE2A 1S40A 3S1MB 2BE5D 3CC2A 4DKAC 4NXML 1LT5D 2HVRA 2RA4A 2H5XA 3Q6SA 5M3FG 1EY9A 1BUVT 2F4VL 2F0TA 2N78A 2K75A 5HGTA 4OL7A 1PRTF 4I4TF 3J80c 1E3PA 1MIUA 1CZGA 1UNSA 1HPCA 4PQXA 1WTHA 4UCRA 2DNEA 5IGCA 2W70A 3E0EA 1I3QA 2NYZD 2XGQA 4NXMH 5IY0A 3T4AC 1M8AA 3LX0A 4X62Q 1XMQL 2FK3A 3KHRA 1HUNA 3KDFB 2F4VH 2UUAL 1SDFA 5J3BA 1ZYRC 3CRLC 3TDQA 4CDDC 2F0HA 4A3CG 5JJLA 4LH7A 2NN6H 3ZJYC 2J6TA 4MIUA 5IT9W 4MTKA 1WCMG 2UVRA 1XTDA 4ODGA 1M1KC 1EIFA 4OGQC 2B63H 4A3FG 1RD9D 3K3PA 3N40P 5LMUL 3HFZB 3RLOA 1Q1EA 1HFNA 4GOPB 1LYLA 3PO2H 4LFCQ 5KFUA 1XMQH 1HR0L 5FLXc 1GUGA 2W9BA 5IGGA 4NPSA 1Y8NB 3H0GB 2G9DA 5IP7H 4PZ8A 3I56A 1PH7A 4MV1A 1VQLA 1QB5D 2K50A 1D2BA 5J2TF 5L9XA 3M7NA 3J7AV 1X3GA 3Q23A 4XIGS 1PH8A 1N34Q 4O3NA 1JJGA 2XGPA 5M5XH 1H9SA 2E2HH 4FYDA 5LMUH 2VUMB 4A3GG 3M9NB 2ZXOA 3H4DA 4DK1A 1HR0H 3L0OA 2W9AA 1WTQA 2W6PA 1I6VC 2GA4B 2BA1A 2VY3A 3MXNB 1A3UA 4GZYC 1RJTA 3ULLA 2J6SA 3JAMc 5IE8A 2X69A 1DV2A 1B50A 1EY4A 1K3RA 1EWIA 1AN7A 3GTMA 2D2CC 5ELEA 2K5HA 3R23A 4YJ2F 4DXGA 2L0CA 2G9HD 5EDWA 2B2TC 3I7FA 3HOUG 3AEVA 1I4GA 3OUUA 2B2WA 2HGSA 3BA8A 4UFZA 2HQLA 1S5DD 4IUPA 4B3SL 2VQDA 1ENAA 3JSLA 5CV4A 1O7YA 5ELCA 2XIWA 3EYYA 1JORA 3ITPA 2RDGA 3PGZA 1SMYD 3N44B 1UE6A 4JI2L 2ASLA 3NUCA 1YJWA 4XXEA 1PH4A 5IYZF 2L4NA 3MWDA 1TS5A 2Z6BA 1CHPD 4YIJA 3HOVH 3LWUA 3MAQA 1ZEQX 1LT6D 2I5MX 3N43B 5JVDF 5GROA 1E4EA 2UUBH 3K59A 4B3SH 3RAQA 3GTJA 2WKDA 1FNWA 3MTSA 4HCEA 4UY8C 3OSPA 3F2BA 2I0QA 1GD7A 4V190 2W7PA 2D62A 2JA8H 3JRWA 2HVSA 5I2YA 4QL5A 2FLLA 2P5ZX 4YAKB 3PSIA 1PVOA 4JI2H 3UDXA 1JCKB 2CWPA 1D5MC 2GVBA 1C0AA 2ICEC 4HYKA 1Q81C 3PF4A 5M3FB 3URYA 3STBC 1G8ZD 3CCSA 1PV4A 4FF4A 5AFWA 2R7MA 4MV3A 1SYBA 2R7LA 4I7HA 5KG6A 1ICWA 4KN4C 4UCVA 1KRTA 1UE1A 4QF4A 2R84A 2GPSA 2WV6D 1WOCA 2WB1G 3ERSX 2VQEQ 5JEAH 2D9UA 1VQPA 3AB9A 5FPOA 3GTKA 4M8AA 1V8QA 3HOYG 4XYOA 5KFLA 4YP3A 3OPOA 4WJ3M 1TWFB 1DJRD 1P16A 3W3AA 4CGYB 4CHTB 5C0XH 3JZIA 4A3IG 3BDOA 2KCNA 2WP8J 3KXYT 2YZNA 3H91A 3F2UA 5IYDG 1S97A 1CS0A 2PZTA 1U9RA 4K14A 4F4YA 4OO1I 2JA5G 3NP8A 4A3FB 1JICA 4LSAA 1EWCA 2PW7A 2F3WA 3MWYW 2W8KA 4J1MA 1JE4A 3SE0A 4ID6A 1JMCA 1DGSA 1OXXK 3GV3A 4TQUS 3S14B 5E4WC 1IOVA 4FU0A 1N56A 5C4JH 2D5DA 4MV8A 3CQZB 3RF2A 2PPBC 5HGQA 3KLRA 4JI0H 1U4RA 4JI3H 2F0OA 4DAMA 1F2LA 2Z8LA 5KG1A 4RHSA 5EAYA 1IBKQ 5HY6A 1EUJA 1ESRA 1Q12A 3GIQA 3WO0A 2DN8A 5IODA 1HQMC 4A3GB 4HNVA 5LL6b 3GTPH 3TIGA 4FBTA 5CC4A 1QE6A 5IIFA 1U0LA 4BY7G 4DR3L 4MV4A 3MR6A 3GO5A 1HHVA 3IL8A 2PNHA 1DOLA 1VQGA 1U4PA 3GD7A 4GNXC 4B3RL 1I6HH 1HA5A 4DL6A 1NMFA 1EQVA 2IX0A 5CV5A 3TBIB 5IYCH 4QJFA 3MFGA 5A2QL 4BBSH 3K58A 2R87A 4HJAA 3ETHA 3VA5A 4B3TL 3HOUB 4LF7Q 4LF5Q 1S5FD 2H1EA 5FLMH 5JQWA 2CW0D 3QFFA 1L1OB 3T1YH 3GP7A 4DR3H 2JEBI 1MGSA 5I6WA 3S1NH 4X65L 2K03A 4FP5D 1ENFA 1W6JA 2EY1A 4B3RH 4HJ5A 1UUPA 3RTXA 2XRSD 1XPOA 4DLKA 2VNUD 1UNNC 1I4QA 3S1QH 2GN5A 4EYIB 3TEHB 3I4MG 2BH2A 5KFEA 4B3TH 5LA6F 2EZVA 5C5JA 4QUCA 3QWNA 4POGA 2C35B 5FD5A 4Q43A 4NKLA 2WTFA 4JI8Q 2K5WA 4DN4M 3I12A 2GLTA 2VA2A 1PFMA 2LKVA 2K04A 3L2PA 1SJED 2KENA 1BVSA 1EOTA 1WSCA 5L1IA 4ABNA 1NMGA 1H9RA 5E3FA 3IKJA 4XQNA 2F1MA 5D3IB 5KYIA 4Q8FA 2KCMA 1FKAH 2XN9C 1FL0A 1LT3D 3J80i 2UUAQ 1N48A 4OWXB 4DV4Q 3PR4A 4DR4Q 4PDBA 4DV1Q 2OCEA 4ME5A 4R4QA 1XYIA 2K5NA 1AE3A 3SXHA 3P7JA 4FVMA 5IWAL 4JI5Q 4UAIA 3T16A 2WYOA 1VDZA 5IT9L 2VL6A 1EIHA 4OX9Q 4DR5L 4FNFA 5T1GA 2WB1B 4Y7NH 4TQRA 3DM1A 1RDPD 4C3JH 4AYBE 1OWTA 3HOYB 2E5LQ 4L5SA 4RCOA 1PK8A 4BWGB 3TQ1A 2FJZA 1W96A 5BR8Q 2PI2E 1J8IA 3GV8B 5JVG3 4EQOA 2JEJA 4DL5A 4EBDA 5IWAH 3STBD 1DOMA 2PW5A 4L63B 5C1OA 4C3IB 3RZDH 4P71A 4DR5H 4JCVE 4DV0L 2CH4A 1H95A 3OUZA 3L4KA 2R7ZH 5EJWA 2ASJA 2JA5B 1O7LA 3HGBA 1VQ9A 4B9WA 1CSPA 2RKSA 2EYMA 2JEIA 4A3KG 4L5TA 4S3SA 2BOSA 4RGOS 2HDLA 5KG3A 4LK1C 1FYCA 3QG1A 2F0PA 1GUWA 4LF9Q 5C4HA 1IYVA 3CKIB 2KOLA 5CMDA 1N33L 1AEXA 2EY5A 1ENCA 1MBYA 4DV0H 1B9NA 1ZKOA 4F4WA 1K1SA 2FK2A 2SEBD 4HIKA 5CV9A 1V9PA 1X3FA 3GTLH 3SEBA 3K6OA 1H9MA 3FEWX 3JAMi 4A2BA 3PIOA 2IP4A 5LMNL 3K0YA 2NVXH 4JOIC 2WKCA 1I3QB 4BY7B 1Q46A 2B2TA 4GN4B 2YS7A 1ET6A 2NU7B 2EJFC 5EPKA 3MXUA 2VOBA 3VYRA 3PUZA 4NMZA 4ED6A 1PH9A 1PTOH 3VPDA 4JI6Q 2I87A 2MUYA 2K6AA 1KAWA 3X3MA 2MP1A 4L8JA 2UXBQ 1IBLQ 3V2TA 2PN1A 5CV8A 2Y0SE 4YR2A 3S15B 3Q8SB 1EYGA 3FMCA 2YU9H 1DYQA 1F9QA 4AYBA 1H9JA 1Y1WG 2PZWA 3KBGA 1SXTA 3IFDA 2YCHA 4LUVA 3UE1A 3W1GA 2W9BB 3PZPA 5D65A 2FHTA 3U4VA 4XQJA 3ORRA 1OXUA 2QDBA 3NTKA 4NXNL 3I4MB 4BXXG 4ETSA 1KDAA 1TY2A 2ES2A 1H9KA 1PTOF 1YBYA 2IHFA 2NZ1D 1G91A 1TAEA 1H9SB 5CA1F 1QZGA 4A93G 5GAEC 4FBUA 2BH8A 3OW7A 1UC9A 2JK8A 4EFEA 1XTCD 2FLPA 3OTOQ 2M05A 5IGFA 1PH1A 4G3IA 4NW2A 3RN2A 1UE5A 3I72A 1D7QA 1KABA 3NE5B 3ND9A 1E22A 4RCNA 4X62L 3R2TA 3GTQH 5C0XI 1GHJA 2FLNA 3UE0A 3GTMB 2MFIA 3BQ1A 4R4TA 2YTXA 5KEEA 2VPQA 4TSSA 2F0JA 1I5FA 1L0YB 1IBMQ 4LW1A 4DV2Q 3RFCA 2UXDQ 2HVQA 2HCIA 4HMJA 4TVAB 1X3QA 1EYAA 1EZ6A 5KFWA 2K33A 1RK5A 2PMZE 4HJ7A 2SNMA 3M3YH 1M4VA 2ZDHA 1LTAD 2DLNA 1EUCB 1VMCA 4NDXA 4X62H 3HZXA 1X32A 2A8VA 4KN7C 3S2DB 3TIIA 3D6WA 1HQRD 4EQNA 3K80C 4PV1C 4KD3A 4IZOA 3JAML 5L1KA 1E4EB 3FVQA 3NENA 1IOWA 2NTSA 5KFOA 4DUYL 4H0LC 4X66Q 1K1QA 1A2TA 3GTJB 4JBWA 1N34L 4F8MA 4DV7Q 5C4XH 2Y0SA 4ED3A 3QO2A 5A2QE 4HAEA 5IP9H 3R8BA 3K5NA 1I50A 4IJHA 5KFJA 2RQXA 4LFCH 3I4NH 2HCCA 4A3KB 4IFDG 3TRZA 1S0NA 2B2UC 4HIMA 2NVYB 2VPSA 2BE5C 2RBMA 5BPHA 2BCOA 4HTHA 4C2MH 4MTNA 2LS01 4EQ5A 1J5EQ 1LTSD 1N34H 2R7NA 2HD3A 1GUNA 2F0NA 1WCMA 2F3VA 2QDLA 4GNXA 1HTLD 1PYWD 3M4QA 3BZKA 3GTKB 4NP5A 2KUMA 5KFXA 4ZHQF 2EYHA 2QCPX 2FB9A 1VQ7A 4X65Q 2VS1A 1TWCA 2E8GA 4R8UA 3E5SA 1SAPA 4YQWA 4GS3A 2F0GA 1K3BC 1XWEA 5C5MA 1CQIB 3S16B 2ICIA 1M0WA 4KY7A 4KV6A 2JYOA 3Q22A 4IPHA 3RZOB 1D1IA 1SROA 1E2VA 2ID0A 3PIPA 4LWCA 1STBA 1BCPB 4K8JA 5LYJF 3OOCA 4OONA 3HOXG 3U9SA 2PMZA 3GV7B 1GVPA 3T51B 3AQQA 3RR5A 4O3OA 1SYFA 2HQEA 3TZUA 4O3SA 4X3KA 1PZKD 3QJYA 3HOWG 2ALYB 1G291 3AFPA 2DPIA 2ZJPA 3RUZA 1Q3LA 1IYUA 3RLFA 4A3DB 3FDSA 1TS3A 2A69C 5ELNA 4B9XA 1JOQA 3KAJA 4LFBQ 1CA6A 1EY6A 4KTAA 3S17B 4K2KA 3CW2C 4H7BA 1FR3A 3BYTB 3EN2A 4MNOA 1STNA 3NWTA 4TRDA 3CXCA 4DV3Q 4YWKA 4C1NI 3PW0A 4A93B 2VQEL 2XD4A 3E0JA 5EZYF 4J9RA 4OIJA 1B4OA 4ZQ3A 1X65A 1RIPA 1C3OA 4RZQA 1KNEA 3K7UC 1L0WA 2XTIA 4A3LG 1T36A 3R3OA 3IAYA 2R92H 4E4TA 2A68C 3TZDA 1XNQQ 2L5TA 1UC8A 5TSSA 4WORA 3A56A 4ECQA 1HNXQ 1WFQA 5E4XA 2VQEH 4H44C 3TREA 1I94Q 4OO1H 1YEZA 4X64Q 2B2YC 2JA6A 1OXVA 1WH2A 5D3DA 4AYBG 3EVQA 1BNCA 4EGVA 5J22A 1Y8PB 2QKIC 3FKIH 4ECTA 1YNJD 2OTLA 4XYQA 3TP8A 2C00A 1SEIA 3EBEA 4UHVA 1B3QA 5I9OA 5C3EH 1N33Q 2KCCA 1BCPF 4UP9A 5KFHA 1VQ6A 4UP8A 1VQEA 4RAUC 2OLSA 3MVVA 2YZGA 4QW9A 1SCUB 1D5ZC 4APVA 4JI4Q 3RB3A 4PG3A 2R8HA 4BY1G 5L37A 1NTGA 1ZHSA 4O2DA 3GIJA 5LMNQ 1N36Q 4FXGC 4CC6A 5DG9A 5DEHA 2C5CA 4P75A 3RMHA 3Q24A 4AQYQ 1VQDA 2R8KA 2MO1A 2K5QA 2KEDA 3E3XA 2B29A 4FF3A 4JOIA 2JA8G 1XX8A 2K01A 3C1EA 1TWAA 1A9XA 5D14A 2V4DA 4BBRB 1IBKH 1PH3A 3QOLA 5FJ8H 1HZCA 1Y1VH 4CC5A 2D0PA 1WR2A 4LF7L 2F0DA 5F9LA 1RJPA 1JXLA 2PZUA 4RH6A 2ASDA 4ED2A 2A74C 1LTTD 4QIWE 1S9FA 2NVQB 5DQHA 4ECVA 1LT4D 4ZRZA 2E2IB 2R82A 1B6SA 3H40A 2FPIB 2YZMA 3H09A 4MA5A 3SHLA 3CPFA 1R9TH 1HZBA 3ICEA 3GQCA 3BQ0A 4NXNQ 1JOOA 1PRTC 1NSNS 1B04A 1HZAA 3N6RA 4XYLB 1E1OA 1ZXTA 2VZAA 3Q8DA 4LF7H 3IRBA 2Y0SG 3WDNA 1G51A 5F9NA 4LF5H 1D1KA 2R7DA 2WFWA 5KFPA 3HOXB 4JPBW 4JI8L 3EPIA 2OQKA 1JJCB 3GTGH 4C3HB 1GGOA 5JPNC 2EQSA 4O0AA 3GTOA 3M7GA 3HOWB 4LSXA 4DAPA 4CJ0B 4HJ9A 2Z0SA 1CSQA 2NWGA 2EYLA 4DV4L 1IXRA 4DR4L 4DV1L 1S0MA 5JVH3 1SFOA 1RF2D 1I6UA 1EU3A 4JI5L 1K28A 1E4GT 2Z4HA 5KFZA 1TWHH 4BWSC 2ZTCA 5FKAC 4OX9L 3KJOA 1GSHA 3RV3A 4JI8H 2FINB 5BN3A 3AMUA 5C1PA 4M9UA 2HJWA 2YW2A 2UVWA 2IW3A 1AFPA 4CDFC 2E5LL 4RGNA 1IHZA 1YJ9A 4NLGA 4PMWA 1PH5A 5BR8L 2UUAH 4NB3A 2W9CA 4DV4H 5IYBG 1M0TA 4DR4H 4DV1H 2A69D 4JUZA 4JI5H 4FM9A 3NEMA 1PYSB 4MTEA 1CM9A 3G71A 1LO5D 5EBCA 3KJPA 5L1LA 1SEBD 3OMCA 3W1BA 4DUYQ 3J81E 4RZRA 4K5XA 4OX9H 4OWWB 4F87A 5G3LF 3VA7A 4LF8L 5BN4A 2CW0C 2FJ2A 2AGPA 1Q86C 5IGDA 1SYDA 5IYCG 4AYBB 4N9PA 4O42A 1BGWA 1KJJA 1EZ8A 4YB8B 2E5LH 3A8JE 2XRQD 4EQPA 5BR8H 3K5OA 3G6EA 2AWOA 2F0UA 3X3NA 5DGBA 2MJ8A 3HOZG 4M7EA 4ECSA 1ICFB 5FLMG 4A3EG 5M3MB 2AQ4A 1YIJA 4LF9L 1IYJB 2A68D 1VQ4A 2MCTA 3L4JA 4RKLA 3I70A 3CC4A 2L9HA 1S5BD 4A3MG 2B2UA 1YI2A 3FDTA 1STEA 3CMEA 2PNRC 5DG7A 1JB7A 4PMBA 4CKBA 4R8NA 4BY1B 2EY6A 3H0GH 4ECRA 4I55F 2YYZA 5LMNW 4QGUA 3PVXA 4PMCA 3I55A 2QGQA 2EYOA 2YL2A 4QY7A 2YRXA 4LF9H 1MKHA 1HH2P 2I5LX 1RK6A 1ZETA 1S0OA 2F0KA 2ZJQA 2VUMH 2ALZA 2B8GA 4IFDJ 4KY6A 4I7AA 2JA8B 4JI6L 3K57A 3NBHA 4XYMB 3PUXA 3R93A 2X0SA 1BQQT 1MD2D 3GIMA 3L9AX 2JA6G 1IBLL 2UXBL 5GADC 4DK6C 3J80W 2ZDGA 5KFQA 1N8RC 2EY2A 1YVCA 2Q8IB 4C2MA 1PHJA 2EJMA 1T5XD 2DJFC 2RHQB 4DFAA 2W6OA 2XWBB 4KY5A 1TU2B 4JC0A 2E74C 4HSVA 1Y8OB 4MA0A 4JI6H 1CFMA 4Y52H 2BR0A 4RFBA 2HIXA 1GYFA 2IY5B 1PH6A 3RLNA 2XSCA 4ED8A 1IBLH 2UXBH 4P74A 2Y0SB 1AUXA 4X3SA 1I50B 3HXLA 3J7ZC 2I80A 2DNCA 2L1BA 4J9NA 2XGTA 3N6XA 3F1ZA 3M85A 2EE1A 3CHBD 3CCLA 1MJCA 1KC8C 4DV5L 3OTOL 1L2FA 3S2HB 3VYUA 3G6VA 2O5IC 3K7AB 5LL6S 2F0SA 2RF4A 5FLXW 3BG5A 4TV8F 1PRTD 2EPBA 4ECWA 2ENBA 1IBML 1X55A 1WCMB 4DL3A 4DV2L 4GNXB 2UXDL 2O03A 3MWEA 1A8VA 3K5IA 3OSOA 2I07B 4XX0B 4MV7A 2Q8TA 3T56B 3RJ0A 5M3FH 1MHWC 4K5WA 5C44G 4YR3A 1TWCB 4UCUA 3AU7A 4OWTB 3OTOH 2OXPA 5GAHC 4R8UB 2ZT9C 5LHY1 4C5AA 1Y1WA 1VQMA 3E9HA 4K5VA 5NUCA 2E2JB 4EGQA 4HN7A 4MTDA 2B2YA 1EZ1A 3CCUA 1A15A 1XDNA 1SNQA 2RDFA 3CCVA 1WTXA 3JAMW 1IBMH 3KAKA 3TP7A 4DV2H 5KNCA 2UXDH 3H94A 2CCZA 2RSNA 4JV5Q 1A63A 4YBZB 1DM0B 1I4RA 1TWFH 4ECYA 4X66L 1O7IA 3CP0A 2PMZB 4DV7L 2RVLA 4IHJF 4JVZA 2IWHA 4A3CH 1GOZA 2FK1A 1Z2NX 3H3VI 1C7YA 3MA2B 4A2AA 3HOZB 2DGYA 3RBDA 4RGTA 4A3FH 1E7ZA 5I6YA 4A3EB 4IR1A 3N41B 2R93A 4Z9CB 1B7YB 1S5CD 1L0XB 1PH2A 2CQAA 2F0IA 4F50A 4DR2Q 4A3MB 5DM63 1J5EL 4X66H 2DJGC 3N8DA 3MR3A 3S14H 1ML0D 4DV7H 2Z1CA 2ATWA 4A3JG 5EKLA 2K5DA 4QW8A 3CQZH 5I2XA 5BN5A 4DXFA 3OYYA 2BQUA 3LNNA 1IKLA 1R4PB 3NHHA 1VF5C 3DWQA 3MFHA 4O2BF 2JA7A 2UVUA 1BBXC 1MSHA 1KJIA 4A3GH 3A54A 3C1FA 3ND8A 4TKOB 1J5EH 3H4BA 4IFDI 1EOVA 5T1IA 1K83A 4ECZA 2JA6B 4KHVA 3O13A 4UPAA 1D6EC 2FMAA 1AZPA 4X65H 5J2UF 3D4RA 1SBBB 3UDGA 4EBEA 1STGA 1BNZA 2CQYA 3SK4A 5DNFA 3BVGA 1WTVA 3HOUH 2AU0A 3OIQA 5EWFA 3QOJA 2V4RA 1F2YA 1TWGA 1BXRA 4Y7NB 2UXCQ 1G6ZA 4LFBL 5EOYA 2CKZB 4LJZC 3R5FA 4A3BG 1C8CA 4Q0YA 4O3RA 2ATLA 3PR5B 4DV3L 1SE4A 1S68A 2ZTEA 4YCWA 2VQFQ 3G6XA 4ED7A 2KJXA 2V4QA 3M4OB 5HURA 4CDEC 3NQTA 3M9BA 2EYFA 1RYSA 2L11A 3PIO3 1EY8A 1VF7A 5C4XG 2CFMA 2XCLA 1CA5A 4LFBH 2CW7A 3TSSA 1TWAB 1XPUA 2NU8B 4A3IB 1BBWA 4BS9A 5EGTA 1XNQL 3V4SA 3QR8A 2MPMA 1TKWB 2PYKA 4LH6A 2A6ED 5KFNA 4ULLA 5I47A 4DV3H 3RB0A 1HNXL 3GDEA 4O3PA 4LF8Q 1JR0D 1LACA 2FFKB 1I94L 3DUZA 5KFIA 4X64L 1KBLA 5EPJA 5C44B 4KHPQ 4ZYSA 4IOAA 4RKBA 1GUOA 3HBLA 3A0JA 5KT4A 1LV9A
chains in the Genus database with same CATH topology
4GNXA 4LFAQ 1S40A 3TS2A 3CC2A 4NXML 4DKAC 3F8TA 3M4QA 3BZKA 2H5XA 2L15A 1Q82C 5M3FG 3PO3G 4JBMA 2F4VL 1VQ7A 4DR6L 4X65Q 2N78A 2K75A 3HOYH 1TXYA 2VS1A 2E8GA 3J81j 1S72A 4DPGA 4GS3A 3J80c 4JI4L 1EFWA 1E3PA 1VQFA 4DUZQ 1MIUA 1Z47A 4DR7Q 1HZ9A 1I50H 3BJUA 1UWVA 2MO0A 4IPHA 1SROA 4C3IH 5IYDH 3E0EA 4IJLA 1N36L 5K36G 2ID0A 3PIPA 4J15A 4JI3L 2KHJA 4LWCA 5IY0A 4JI0L 3S2HH 4X62Q 3CCQA 1XMQL 4AQYL 4RG1A 2JA5H 4JYAL 2EIFA 3KDFB 4OONA 3HOXG 2UUAL 3K7AH 1GVPA 5J3BA 4A3CG 4ME3A 3AQQA 3RR5A 5JJLA 4R4OA 3ZJYC 4PZ6A 1M90C 4YCVA 4BA1I 4OXPA 4DV6L 5H1SE 1EIYB 1WCMG 3VDYA 3HOWG 1WCMH 2ALYB 1GM5A 1XTDA 1G291 3AFPA 3CMAA 1M1KC 1EIFA 2ZJPA 2UU9Q 2VW9A 2B63H 4LF6L 4A3FG 3RLFA 5ELNA 1HNWQ 4LFBQ 4HIDA 1A0IA 5LMUL 4GKJL 1TWCH 3E9IA 3CW2C 3HFZB 1Q1EA 3RLOA 4K0KL 2LSSA 4GOPB 1LYLA 3PO2H 3EN2A 4LFCQ 1Q1BA 4MNOA 1HR0L 3S24A 2A19A 4IPDA 4PZ7A 5FLXc 3CXCA 4DV3Q 2E2JH 4YWKA 4NPSA 2PI2A 3HKSA 5IP7H 5IYBH 3I56A 4PZ8A 2ZM6Q 2VQEL 1XMOQ 1PH7A 1VQLA 2K50A 4L5RC 1QZHA 1N32L 1QUQA 1G6PA 1I3QH 1NE3A 1X65A 4R1JA 3T1YL 4BY7H 3M7NA 1RIPA 1X3GA 4XIGS 4DK3C 3K7UC 3KLWA 1L0WA 1PH8A 2XTIA 1N34Q 2R92G 4A3LG 1JJGA 5M5XH 2R92H 2E2HH 1KRSA 2Z6KA 1XJVA 4A3GG 1XNQQ 2K4KA 1NY4A 3CCEA 2HIVA 4AH6A 1ASZA 1VQJA 3L0OA 2HHHQ 1YHQA 4DV5Q 1HNXQ 1BKBA 1WFQA 2VY3A 2BA1A 1XPRA 3MXNB 2IHEA 3TREA 3ULLA 1I94Q 3HOZH 1YEZA 4X64Q 3RNUA 4JI1L 3JAMc 5IE8A 4A3EH 2EXDA 3UDFA 1OXVA 1NJIC 1K8GA 1VQKA 1K3RA 2K52A 1EWIA 4FDBA 4YWLA 2N3SA 4AYBG 1B70B 1VQ8A 3FKIH 4A3MH 2K5HA 3HOUG 3I7FA 2OTLA 4NXMQ 3AEVA 2DUDA 4QQBX 5C3EG 3EBEA 3ULJA 2MQHA 5C3EH 5AJ3Q 1N33Q 2HQLA 3F2CA 4UP9A 4B3SL 2F4VQ 1VQ6A 4UP8A 4DR6Q 4GKKL 1VQEA 1IL2A 3I4MH 1SE8A 5JJKA 4APVA 5JEAJ 4JI4Q 4PG3A 2JA7G 3PGZA 5ELOA 1UE6A 4JI2L 4BY1G 1VQCA 1NTGA 1YJWA 1VQAA 4O2DA 1PH4A 1X54A 5LMNQ 3CD6A 2FXQA 2N49A 1LTLA 1N36Q 1FJGL 3HOVH 2ZJRA 2UUCL 4P75A 2I5MX 1XMQQ 5C0XJ 5GROA 1VQDA 3WWVA 4AQYQ 2MO1A 1E1TA 1OTCA 3OW2A 2JA6H 2YTVA 4H02A 3S15H 1GKHA 3UDIA 3GTMH 5DLQE 2B29A 2NN6I 5IP9G 4UY8C 4JOIA 3F2BA 4DV6Q 1GD7A 2I0QA 2JA8G 2D62A 2JA8H 1L1OC 3DLLA 3I4NG 4QL5A 3D31A 3AFQA 3U4ZA 3PSIA 1P8LA 5FJ8G 1PVOA 5GQOA 3UDXA 5FJ8H 1HZCA 1Y1VH 1PH3A 2D0PA 1HNZL 4LF6Q 4WJ4A 2CWPA 3KF6A 2GVBA 5GAGC 4LUOA 1C0AA 4LF7L 1Q81C 4GKJQ 5LMUQ 3PF4A 2NZHA 3A74A 2JEAI 3CCSA 3STBC 1PV4A 4K0KQ 3ER0A 3CCRA 1HR0Q 4QIWE 4P73A 3KOJA 1KRTA 1WI5A 4LNQA 3NELA 1UE1A 2GVAA 1CKMA 2HT1A 2OQ0A 1WOCA 2WB1G 3ERSX 2VQEQ 2IX1A 2AMCB 3S2DH 3CPFA 1CKNB 1VQPA 1R9TH 1HZBA 3ICEA 4BA2I 3HOYG 4NXNQ 4ALPA 3M4OH 1HZAA 1SRUA 4IOCA 1E1OA 2VZAA 3Q8DA 3J7A5 4WJ3M 2PQAB 1P16A 2Y0SG 3IRBA 1G51A 3GTJH 2R7DA 2WFWA 1UEBA 4A3IG 1TWAH 4JI8L 4A3IH 2OQKA 1JJCB 2WP8J 5IYDG 3RN5A 1K0RA 3PF5A 3GTGH 4A3KH 1PA6A 2EQSA 4O0AA 1K73C 4AIMA 4A75A 2NVYH 4YY3L 4HJ8A 4OO1I 4JI1Q 2JA5G 4HJ9A 3K0XA 2Z0SA 1CSQA 3KDFA 4EX5A 4YHHL 4DV4L 3H15A 1Q8KA 1IXRA 2NN6G 5C44H 4DV1L 1KIXA 4DR4L 1JMCA 4JI5L 1DGSA 3HKZE 1OXXK 4YWMA 1A62A 4JG2A 2B63G 1TWHH 2CQOA 4TQUS 2ZTCA 2UUBQ 3KJOA 4OX9L 2NZOA 1KHIA 4B3SQ 2WAQE 3GTKH 4GKKQ 5C4JH 1J6QA 3TS0A 2ZTDA 1MJEA 4JBJA 3F2DA 5HGQA 5JJIA 4JI7L 3PO2G 4DAMA 4GOPA 2E5LL 5EAYA 4JI2Q 5HY6A 1YJ9A 1IBKQ 1VS0A 1EUJA 4PMWA 1OXTA 5BR8L 1PH5A 4NB3A 1Q12A 5IP7G 5IYBG 3S16H 2ASBA 3GTPH 4YCUA 3NEMA 1PYSB 4GLXA 3RZOH 3G71A 4BY7G 3KJPA 1U0LA 2UUCQ 3GTOH 4DR3L 3GO5A 3W1BA 4DUYQ 3KYHC 3J81i 2PNHA 4OWWB 1UE7A 1VQGA 3GD7A 2YTYA 4GNXC 2RHSB 2UUAQ 4B3RL 4LF8L 1I6HH 3CCMA 1Q86C 1NMFA 5IYCG 2QEXA 3S1RH 5M5WH 2IX0A 5IYCH 1SFOH 1VQ5A 1YHAA 4QJFA 2Q2UA 1HNZQ 1VQOA 4BBSH 4HJAA 4L5QA 2AWOA 3G6EA 4B3TL 3HOZG 4OO1G 4A3DG 5FLMG 4LF7Q 2B3GA 1GO3E 5FLMH 4A3EG 4LF5Q 4LFAL 4A3DH 1SMXA 4A3JH 1IYJB 1YIJA 4LF9L 1VQ4A 1L1OB 3S17H 2JEBI 1VQIA 3CC4A 3FKIG 4X65L 3S1NH 4A3MG 4BXXH 1YI2A 3CMEA 1C9OA 3DM3A 3I4OA 4GN5A 4HJ5A 3T1HL 1JB7A 1SLJA 1XPOA 2VNUD 4A93H 3H0GH 5IT9c 3S1QH 2GN5A 2YYZA 2AWNA 5LMNW 4QGUA 2LXJA 3TEHB 3I4MG 2BH2A 3I55A 2QGQA 1X56A 2RCNA 3SGIA 4QY7A 4JV5L 1MKHA 1HH2P 2I5LX 2C35B 2R6GA 4POGA 2ZJQA 2VUMH 4JI8Q 3L2PA 4IFDJ 2KENA 1BVSA 4POFA 3M4PA 4JI6L 3KF8B 4X6AH 3HOVG 3NBHB 1NMGA 4JI0Q 4JI3Q 4YY3Q 3H3VH 3PUXA 3MEFA 2MNAA 4JYAQ 2UU9L 2KCMA 2JA6G 1IBLL 2UXBL 1FL0A 3J80i 1SR3A 5GADC 4YHHQ 4OWXB 3U50C 1VQBA 4DV4Q 4DK6C 4DR4Q 1YNXA 2OCEA 3LGJA 4DV1Q 4R4QA 1N8RC 2K5NA 1AE3A 1YVCA 1EQQA 5IWAL 1PHJA 2RHQB 4JI5Q 1HR0W 4A3BH 4LFCL 1Y1VG 2VL6A 3L7ZC 4DR2L 4OX9Q 3D0FA 4DR5L 3AYHB 4JC0A 4DR1L 4Y7NH 1PYBA 2Z6KC 3JC66 4C3JH 4Y52H 2K5VA 4AYBE 4JI7Q 1QVFA 2HIXA 1U5KA 2E5LQ 4L5SA 2IY5B 4LUZA 1PH6A 3RLNA 1KD1C 5BR8Q 1AE2A 1VCIA 4P74A 2PI2E 4RMFA 1AH9A 3PV0A 5JEAG 3G4SA 1X3EA 1CKNA 1N32Q 3J7ZC 1Z9FA 3STBD 3T1YQ 4DR3Q 2JJQA 2XGTA 3F1ZA 3RZDH 4P71A 3M85A 1XNRL 2Q2IA 4JCVE 4DNIA 4DV0L 1MJCA 1KC8C 2YV5A 4DV5L 3OTOL 3CCLA 1H95A 2R7ZH 1L2FA 4B3RQ 2PQAA 5C0XG 1VQ9A 5E7NA 2RF4A 1T9HA 1CSPA 4BBRG 2F3IA 4BBRH 4L5TA 4A3KG 4B3ML 1IBML 4B3TQ 1X55A 1IZ6A 4DV2L 4GNXB 2UXDL 1A8VA 3K81C 4UP7A 4DAYB 4LF9Q 2Q2HA 5AJ3L 1N33L 1X6OA 5M3FH 3PO3H 1YJNA 1QVCA 5C44G 1ASYA 2UXCL 2Q2TA 4OWTB 5GAHC 2AHOB 2NVQH 3T1HQ 2E2IH 1VQMA 2NVTH 4HIKA 3E9HA 3BZCA 3S1MH 1V9PA 2F52A 1X3FA 3BU2A 3GTLH 4R4IA 3CCUA 3FHWA 3JAMi 3PIOA 3FP9A 3CCVA 5LMNL 2NVXH 4JOIC 2VQFL 4GLAC 3K8AA 3PUYA 1B8AA 1Q46A 2CCZA 4JV5Q 4GN4B 1A63A 2CWAA 3W5OA 1TWFH 4JBKA 1Y14B 1FVIA 2WB1E 3CAMA 1O7IA 3CP0A 3PUZA 4X66L 3HOXH 1PH9A 4DV7L 3A5ZB 1JT8A 4A3CH 1LM0A 4JI6Q 1HJPA 1W3SA 1FJGQ 4C3HH 1KAWA 3PUWA 1C7YA 3H3VI 3HOWH 2D0OA 2V1CC 1IBLQ 2UXBQ 1KXLA 1CKOA 2Y0SE 2DGYA 4A3FH 1E7ZA 1WYDA 1EYGA 2YU9H 1B7YB 3EIVA 4IPCA 5IWAQ 4LF4L 1PH2A 2BA0A 1Y1WG 4BBSG 4DR2Q 1Y1WH 4KHPL 4LUVA 4DR5Q 1J5EL 1JJ2A 3UE1A 1YITA 3W1GA 4DR1Q 3S14H 3ULPA 4GN3B 2ATWA 4A3JG 1YHBA 3CQZH 3U4VA 1QUQB 1QVGA 3CC7A 1L1OA 4A76A 1OXUA 3OYYA 4NXNL 4BXXG 2ES2A 1KQSA 1YBYA 2IHFA 1BBUA 2I5HA 4A3LH 1QZGA 4KLKA 1E24A 4A93G 3H0GG 5GAEC 4DUZL 4A3GH 1EQRA 2BH8A 1X9NA 4DR7L 1RL2A 1WJJA 1Q7YC 2LXKA 2R7FA 2JK8A 1XNRQ 2K14A 2AKWB 2IT1A 4DV0Q 3OTOQ 1EOVA 4IFDI 1PH1A 4KHZA 4R4CA 3PCOB 2A1AA 3RN2A 1UE5A 1D7QA 2KBNA 4X62L 1E22A 2VUMG 4IPGA 3GTQH 2R93H 5C0XI 4UPAA 3UE0A 2MFIA 4R4TA 2YTXA 1K9MC 1I5FA 4B3MQ 3UDGA 1IBMQ 4LW1A 4DV2Q 4GOPC 2UXDQ 3CF5A 1OXSC 3B6YA 4TVAB 3HOUH 3KFUA 5M3MG 4MZ9A 5M3MH 2R93G 2PMZE 2UUBL 4HJ7A 3M3YH 2UXCQ 3A5UA 1HNWL 2JA9A 4LFBL 1D8LA 2CKZB 2OWOA 4A3BG 3TQYA 1SN8A 3J81c 2JE6I 2OTJA 2JA7H 2A8VA 1IBKL 1NBWA 1W2BA 4BY1H 3I2ZA 4DV3L 4XTCS 1PFSA 2ZTEA 4YCWA 2ZM6L 2VQFQ 1K8AC 3K80C 1XMOL 1VQNA 3M9BA 1N9WA 1K83H 3NENA 1YZ6A 4DUYL 4X66Q 4JBWA 1N34L 2CFMA 5C4XG 4HIOA 4DV7Q 5C4XH 4GLVB 1LUZA 3U58A 1V1QA 5IP9H 1XPUA 1BBWA 1XNQL 3CPWA 1KL9A 4IJHA 1FGUA 2QA4A 3I4NH 2KCTA 3HKZG 4IFDG 1VQHA 3TRZA 2HHHL 2KHIA 4KI0A 4HIMA 1V43A 3GDEA 1TWGH 3CCJA 1HNXL 2R7ZG 3KF6B 2JQOA 4P72A 4LF8Q 2WAQG 1I94L 4LF5L 3G48A 4A4IA 4X64L 4LF4Q 1JE5A 4C2MH 2N8NA 4MTNA 5M5YH 3PUVA 4KHPQ 1S3OA 4EQ5A 1J5EQ 4IOAA 1CUKA 4IO9A 3A0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNX A;  4LFA Q;  1S40 A;  3TS2 A;  3CC2 A;  4NXM L;  4DKA C;  3F8T A;  3M4Q A;  3BZK A;  2H5X A;  2L15 A;  1Q82 C;  5M3F G;  3PO3 G;  4JBM A;  2F4V L;  1VQ7 A;  4DR6 L;  4X65 Q;  2N78 A;  2K75 A;  3HOY H;  1TXY A;  2VS1 A;  2E8G A;  3J81 j;  1S72 A;  4DPG A;  4GS3 A;  3J80 c;  4JI4 L;  1EFW A;  1E3P A;  1VQF A;  4DUZ Q;  1MIU A;  1Z47 A;  4DR7 Q;  1HZ9 A;  1I50 H;  3BJU A;  1UWV A;  2MO0 A;  4IPH A;  1SRO A;  4C3I H;  5IYD H;  3E0E A;  4IJL A;  1N36 L;  5K36 G;  2ID0 A;  3PIP A;  4J15 A;  4JI3 L;  2KHJ A;  4LWC A;  5IY0 A;  4JI0 L;  3S2H H;  4X62 Q;  3CCQ A;  1XMQ L;  4AQY L;  4RG1 A;  2JA5 H;  4JYA L;  2EIF A;  3KDF B;  4OON A;  3HOX G;  2UUA L;  3K7A H;  1GVP A;  5J3B A;  4A3C G;  4ME3 A;  3AQQ A;  3RR5 A;  5JJL A;  4R4O A;  3ZJY C;  4PZ6 A;  1M90 C;  4YCV A;  4BA1 I;  4OXP A;  4DV6 L;  5H1S E;  1EIY B;  1WCM G;  3VDY A;  3HOW G;  1WCM H;  2ALY B;  1GM5 A;  1XTD A;  1G29 1;  3AFP A;  3CMA A;  1M1K C;  1EIF A;  2ZJP A;  2UU9 Q;  2VW9 A;  2B63 H;  4LF6 L;  4A3F G;  3RLF A;  5ELN A;  1HNW Q;  4LFB Q;  4HID A;  1A0I A;  5LMU L;  4GKJ L;  1TWC H;  3E9I A;  3CW2 C;  3HFZ B;  1Q1E A;  3RLO A;  4K0K L;  2LSS A;  4GOP B;  1LYL A;  3PO2 H;  3EN2 A;  4LFC Q;  1Q1B A;  4MNO A;  1HR0 L;  3S24 A;  2A19 A;  4IPD A;  4PZ7 A;  5FLX c;  3CXC A;  4DV3 Q;  2E2J H;  4YWK A;  4NPS A;  2PI2 A;  3HKS A;  5IP7 H;  5IYB H;  3I56 A;  4PZ8 A;  2ZM6 Q;  2VQE L;  1XMO Q;  1PH7 A;  1VQL A;  2K50 A;  4L5R C;  1QZH A;  1N32 L;  1QUQ A;  1G6P A;  1I3Q H;  1NE3 A;  1X65 A;  4R1J A;  3T1Y L;  4BY7 H;  3M7N A;  1RIP A;  1X3G A;  4XIG S;  4DK3 C;  3K7U C;  3KLW A;  1L0W A;  1PH8 A;  2XTI A;  1N34 Q;  2R92 G;  4A3L G;  1JJG A;  5M5X H;  2R92 H;  2E2H H;  1KRS A;  2Z6K A;  1XJV A;  4A3G G;  1XNQ Q;  2K4K A;  1NY4 A;  3CCE A;  2HIV A;  4AH6 A;  1ASZ A;  1VQJ A;  3L0O A;  2HHH Q;  1YHQ A;  4DV5 Q;  1HNX Q;  1BKB A;  1WFQ A;  2VY3 A;  2BA1 A;  1XPR A;  3MXN B;  2IHE A;  3TRE A;  3ULL A;  1I94 Q;  3HOZ H;  1YEZ A;  4X64 Q;  3RNU A;  4JI1 L;  3JAM c;  5IE8 A;  4A3E H;  2EXD A;  3UDF A;  1OXV A;  1NJI C;  1K8G A;  1VQK A;  1K3R A;  2K52 A;  1EWI A;  4FDB A;  4YWL A;  2N3S A;  4AYB G;  1B70 B;  1VQ8 A;  3FKI H;  4A3M H;  2K5H A;  3HOU G;  3I7F A;  2OTL A;  4NXM Q;  3AEV A;  2DUD A;  4QQB X;  5C3E G;  3EBE A;  3ULJ A;  2MQH A;  5C3E H;  5AJ3 Q;  1N33 Q;  2HQL A;  3F2C A;  4UP9 A;  4B3S L;  2F4V Q;  1VQ6 A;  4UP8 A;  4DR6 Q;  4GKK L;  1VQE A;  1IL2 A;  3I4M H;  1SE8 A;  5JJK A;  4APV A;  5JEA J;  4JI4 Q;  4PG3 A;  2JA7 G;  3PGZ A;  5ELO A;  1UE6 A;  4JI2 L;  4BY1 G;  1VQC A;  1NTG A;  1YJW A;  1VQA A;  4O2D A;  1PH4 A;  1X54 A;  5LMN Q;  3CD6 A;  2FXQ A;  2N49 A;  1LTL A;  1N36 Q;  1FJG L;  3HOV H;  2ZJR A;  2UUC L;  4P75 A;  2I5M X;  1XMQ Q;  5C0X J;  5GRO A;  1VQD A;  3WWV A;  4AQY Q;  2MO1 A;  1E1T A;  1OTC A;  3OW2 A;  2JA6 H;  2YTV A;  4H02 A;  3S15 H;  1GKH A;  3UDI A;  3GTM H;  5DLQ E;  2B29 A;  2NN6 I;  5IP9 G;  4UY8 C;  4JOI A;  3F2B A;  4DV6 Q;  1GD7 A;  2I0Q A;  2JA8 G;  2D62 A;  2JA8 H;  1L1O C;  3DLL A;  3I4N G;  4QL5 A;  3D31 A;  3AFQ A;  3U4Z A;  3PSI A;  1P8L A;  5FJ8 G;  1PVO A;  5GQO A;  3UDX A;  5FJ8 H;  1HZC A;  1Y1V H;  1PH3 A;  2D0P A;  1HNZ L;  4LF6 Q;  4WJ4 A;  2CWP A;  3KF6 A;  2GVB A;  5GAG C;  4LUO A;  1C0A A;  4LF7 L;  1Q81 C;  4GKJ Q;  5LMU Q;  3PF4 A;  2NZH A;  3A74 A;  2JEA I;  3CCS A;  3STB C;  1PV4 A;  4K0K Q;  3ER0 A;  3CCR A;  1HR0 Q;  4QIW E;  4P73 A;  3KOJ A;  1KRT A;  1WI5 A;  4LNQ A;  3NEL A;  1UE1 A;  2GVA A;  1CKM A;  2HT1 A;  2OQ0 A;  1WOC A;  2WB1 G;  3ERS X;  2VQE Q;  2IX1 A;  2AMC B;  3S2D H;  3CPF A;  1CKN B;  1VQP A;  1R9T H;  1HZB A;  3ICE A;  4BA2 I;  3HOY G;  4NXN Q;  4ALP A;  3M4O H;  1HZA A;  1SRU A;  4IOC A;  1E1O A;  2VZA A;  3Q8D A;  3J7A 5;  4WJ3 M;  2PQA B;  1P16 A;  2Y0S G;  3IRB A;  1G51 A;  3GTJ H;  2R7D A;  2WFW A;  1UEB A;  4A3I G;  1TWA H;  4JI8 L;  4A3I H;  2OQK A;  1JJC B;  2WP8 J;  5IYD G;  3RN5 A;  1K0R A;  3PF5 A;  3GTG H;  4A3K H;  1PA6 A;  2EQS A;  4O0A A;  1K73 C;  4AIM A;  4A75 A;  2NVY H;  4YY3 L;  4HJ8 A;  4OO1 I;  4JI1 Q;  2JA5 G;  4HJ9 A;  3K0X A;  2Z0S A;  1CSQ A;  3KDF A;  4EX5 A;  4YHH L;  4DV4 L;  3H15 A;  1Q8K A;  1IXR A;  2NN6 G;  5C44 H;  4DV1 L;  1KIX A;  4DR4 L;  1JMC A;  4JI5 L;  1DGS A;  3HKZ E;  1OXX K;  4YWM A;  1A62 A;  4JG2 A;  2B63 G;  1TWH H;  2CQO A;  4TQU S;  2ZTC A;  2UUB Q;  3KJO A;  4OX9 L;  2NZO A;  1KHI A;  4B3S Q;  2WAQ E;  3GTK H;  4GKK Q;  5C4J H;  1J6Q A;  3TS0 A;  2ZTD A;  1MJE A;  4JBJ A;  3F2D A;  5HGQ A;  5JJI A;  4JI7 L;  3PO2 G;  4DAM A;  4GOP A;  2E5L L;  5EAY A;  4JI2 Q;  5HY6 A;  1YJ9 A;  1IBK Q;  1VS0 A;  1EUJ A;  4PMW A;  1OXT A;  5BR8 L;  1PH5 A;  4NB3 A;  1Q12 A;  5IP7 G;  5IYB G;  3S16 H;  2ASB A;  3GTP H;  4YCU A;  3NEM A;  1PYS B;  4GLX A;  3RZO H;  3G71 A;  4BY7 G;  3KJP A;  1U0L A;  2UUC Q;  3GTO H;  4DR3 L;  3GO5 A;  3W1B A;  4DUY Q;  3KYH C;  3J81 i;  2PNH A;  4OWW B;  1UE7 A;  1VQG A;  3GD7 A;  2YTY A;  4GNX C;  2RHS B;  2UUA Q;  4B3R L;  4LF8 L;  1I6H H;  3CCM A;  1Q86 C;  1NMF A;  5IYC G;  2QEX A;  3S1R H;  5M5W H;  2IX0 A;  5IYC H;  1SFO H;  1VQ5 A;  1YHA A;  4QJF A;  2Q2U A;  1HNZ Q;  1VQO A;  4BBS H;  4HJA A;  4L5Q A;  2AWO A;  3G6E A;  4B3T L;  3HOZ G;  4OO1 G;  4A3D G;  5FLM G;  4LF7 Q;  2B3G A;  1GO3 E;  5FLM H;  4A3E G;  4LF5 Q;  4LFA L;  4A3D H;  1SMX A;  4A3J H;  1IYJ B;  1YIJ A;  4LF9 L;  1VQ4 A;  1L1O B;  3S17 H;  2JEB I;  1VQI A;  3CC4 A;  3FKI G;  4X65 L;  3S1N H;  4A3M G;  4BXX H;  1YI2 A;  3CME A;  1C9O A;  3DM3 A;  3I4O A;  4GN5 A;  4HJ5 A;  3T1H L;  1JB7 A;  1SLJ A;  1XPO A;  2VNU D;  4A93 H;  3H0G H;  5IT9 c;  3S1Q H;  2GN5 A;  2YYZ A;  2AWN A;  5LMN W;  4QGU A;  2LXJ A;  3TEH B;  3I4M G;  2BH2 A;  3I55 A;  2QGQ A;  1X56 A;  2RCN A;  3SGI A;  4QY7 A;  4JV5 L;  1MKH A;  1HH2 P;  2I5L X;  2C35 B;  2R6G A;  4POG A;  2ZJQ A;  2VUM H;  4JI8 Q;  3L2P A;  4IFD J;  2KEN A;  1BVS A;  4POF A;  3M4P A;  4JI6 L;  3KF8 B;  4X6A H;  3HOV G;  3NBH B;  1NMG A;  4JI0 Q;  4JI3 Q;  4YY3 Q;  3H3V H;  3PUX A;  3MEF A;  2MNA A;  4JYA Q;  2UU9 L;  2KCM A;  2JA6 G;  1IBL L;  2UXB L;  1FL0 A;  3J80 i;  1SR3 A;  5GAD C;  4YHH Q;  4OWX B;  3U50 C;  1VQB A;  4DV4 Q;  4DK6 C;  4DR4 Q;  1YNX A;  2OCE A;  3LGJ A;  4DV1 Q;  4R4Q A;  1N8R C;  2K5N A;  1AE3 A;  1YVC A;  1EQQ A;  5IWA L;  1PHJ A;  2RHQ B;  4JI5 Q;  1HR0 W;  4A3B H;  4LFC L;  1Y1V G;  2VL6 A;  3L7Z C;  4DR2 L;  4OX9 Q;  3D0F A;  4DR5 L;  3AYH B;  4JC0 A;  4DR1 L;  4Y7N H;  1PYB A;  2Z6K C;  3JC6 6;  4C3J H;  4Y52 H;  2K5V A;  4AYB E;  4JI7 Q;  1QVF A;  2HIX A;  1U5K A;  2E5L Q;  4L5S A;  2IY5 B;  4LUZ A;  1PH6 A;  3RLN A;  1KD1 C;  5BR8 Q;  1AE2 A;  1VCI A;  4P74 A;  2PI2 E;  4RMF A;  1AH9 A;  3PV0 A;  5JEA G;  3G4S A;  1X3E A;  1CKN A;  1N32 Q;  3J7Z C;  1Z9F A;  3STB D;  3T1Y Q;  4DR3 Q;  2JJQ A;  2XGT A;  3F1Z A;  3RZD H;  4P71 A;  3M85 A;  1XNR L;  2Q2I A;  4JCV E;  4DNI A;  4DV0 L;  1MJC A;  1KC8 C;  2YV5 A;  4DV5 L;  3OTO L;  3CCL A;  1H95 A;  2R7Z H;  1L2F A;  4B3R Q;  2PQA A;  5C0X G;  1VQ9 A;  5E7N A;  2RF4 A;  1T9H A;  1CSP A;  4BBR G;  2F3I A;  4BBR H;  4L5T A;  4A3K G;  4B3M L;  1IBM L;  4B3T Q;  1X55 A;  1IZ6 A;  4DV2 L;  4GNX B;  2UXD L;  1A8V A;  3K81 C;  4UP7 A;  4DAY B;  4LF9 Q;  2Q2H A;  5AJ3 L;  1N33 L;  1X6O A;  5M3F H;  3PO3 H;  1YJN A;  1QVC A;  5C44 G;  1ASY A;  2UXC L;  2Q2T A;  4OWT B;  5GAH C;  2AHO B;  2NVQ H;  3T1H Q;  2E2I H;  1VQM A;  2NVT H;  4HIK A;  3E9H A;  3BZC A;  3S1M H;  1V9P A;  2F52 A;  1X3F A;  3BU2 A;  3GTL H;  4R4I A;  3CCU A;  3FHW A;  3JAM i;  3PIO A;  3FP9 A;  3CCV A;  5LMN L;  2NVX H;  4JOI C;  2VQF L;  4GLA C;  3K8A A;  3PUY A;  1B8A A;  1Q46 A;  2CCZ A;  4JV5 Q;  4GN4 B;  1A63 A;  2CWA A;  3W5O A;  1TWF H;  4JBK A;  1Y14 B;  1FVI A;  2WB1 E;  3CAM A;  1O7I A;  3CP0 A;  3PUZ A;  4X66 L;  3HOX H;  1PH9 A;  4DV7 L;  3A5Z B;  1JT8 A;  4A3C H;  1LM0 A;  4JI6 Q;  1HJP A;  1W3S A;  1FJG Q;  4C3H H;  1KAW A;  3PUW A;  1C7Y A;  3H3V I;  3HOW H;  2D0O A;  2V1C C;  1IBL Q;  2UXB Q;  1KXL A;  1CKO A;  2Y0S E;  2DGY A;  4A3F H;  1E7Z A;  1WYD A;  1EYG A;  2YU9 H;  1B7Y B;  3EIV A;  4IPC A;  5IWA Q;  4LF4 L;  1PH2 A;  2BA0 A;  1Y1W G;  4BBS G;  4DR2 Q;  1Y1W H;  4KHP L;  4LUV A;  4DR5 Q;  1J5E L;  1JJ2 A;  3UE1 A;  1YIT A;  3W1G A;  4DR1 Q;  3S14 H;  3ULP A;  4GN3 B;  2ATW A;  4A3J G;  1YHB A;  3CQZ H;  3U4V A;  1QUQ B;  1QVG A;  3CC7 A;  1L1O A;  4A76 A;  1OXU A;  3OYY A;  4NXN L;  4BXX G;  2ES2 A;  1KQS A;  1YBY A;  2IHF A;  1BBU A;  2I5H A;  4A3L H;  1QZG A;  4KLK A;  1E24 A;  4A93 G;  3H0G G;  5GAE C;  4DUZ L;  4A3G H;  1EQR A;  2BH8 A;  1X9N A;  4DR7 L;  1RL2 A;  1WJJ A;  1Q7Y C;  2LXK A;  2R7F A;  2JK8 A;  1XNR Q;  2K14 A;  2AKW B;  2IT1 A;  4DV0 Q;  3OTO Q;  1EOV A;  4IFD I;  1PH1 A;  4KHZ A;  4R4C A;  3PCO B;  2A1A A;  3RN2 A;  1UE5 A;  1D7Q A;  2KBN A;  4X62 L;  1E22 A;  2VUM G;  4IPG A;  3GTQ H;  2R93 H;  5C0X I;  4UPA A;  3UE0 A;  2MFI A;  4R4T A;  2YTX A;  1K9M C;  1I5F A;  4B3M Q;  3UDG A;  1IBM Q;  4LW1 A;  4DV2 Q;  4GOP C;  2UXD Q;  3CF5 A;  1OXS C;  3B6Y A;  4TVA B;  3HOU H;  3KFU A;  5M3M G;  4MZ9 A;  5M3M H;  2R93 G;  2PMZ E;  2UUB L;  4HJ7 A;  3M3Y H;  2UXC Q;  3A5U A;  1HNW L;  2JA9 A;  4LFB L;  1D8L A;  2CKZ B;  2OWO A;  4A3B G;  3TQY A;  1SN8 A;  3J81 c;  2JE6 I;  2OTJ A;  2JA7 H;  2A8V A;  1IBK L;  1NBW A;  1W2B A;  4BY1 H;  3I2Z A;  4DV3 L;  4XTC S;  1PFS A;  2ZTE A;  4YCW A;  2ZM6 L;  2VQF Q;  1K8A C;  3K80 C;  1XMO L;  1VQN A;  3M9B A;  1N9W A;  1K83 H;  3NEN A;  1YZ6 A;  4DUY L;  4X66 Q;  4JBW A;  1N34 L;  2CFM A;  5C4X G;  4HIO A;  4DV7 Q;  5C4X H;  4GLV B;  1LUZ A;  3U58 A;  1V1Q A;  5IP9 H;  1XPU A;  1BBW A;  1XNQ L;  3CPW A;  1KL9 A;  4IJH A;  1FGU A;  2QA4 A;  3I4N H;  2KCT A;  3HKZ G;  4IFD G;  1VQH A;  3TRZ A;  2HHH L;  2KHI A;  4KI0 A;  4HIM A;  1V43 A;  3GDE A;  1TWG H;  3CCJ A;  1HNX L;  2R7Z G;  3KF6 B;  2JQO A;  4P72 A;  4LF8 Q;  2WAQ G;  1I94 L;  4LF5 L;  3G48 A;  4A4I A;  4X64 L;  4LF4 Q;  1JE5 A;  4C2M H;  2N8N A;  4MTN A;  5M5Y H;  3PUV A;  4KHP Q;  1S3O A;  4EQ5 A;  1J5E Q;  4IOA A;  1CUK A;  4IO9 A;  3A0J A; 
#chains in the Genus database with same CATH topology
 3MFY A;  1TWH A;  2R86 A;  3TS2 A;  3SE7 A;  2B63 A;  3F8T A;  4DAY A;  4IUN A;  1Q82 C;  1ZQ7 A;  3GQB A;  1XNQ H;  3PO3 G;  4OHJ A;  4JBM A;  3HOY H;  3LP8 A;  4HNU A;  1ILP A;  4QUF A;  1HNX H;  2FMM A;  2VB2 X;  3OMG A;  3J81 j;  3BVZ A;  1S72 A;  2FPP B;  1S10 A;  1I94 H;  4JI4 L;  4X64 H;  1EFW A;  4DUZ Q;  5DQG A;  4IR9 A;  4DR7 Q;  1HZ9 A;  4ECX A;  3T5L A;  1ILQ A;  1UWV A;  3BJU A;  4LAA A;  3I8Z A;  1TR5 A;  4C3I H;  3GTO B;  4IJL A;  5IYD H;  4K2L A;  1N36 L;  5K36 G;  1B53 A;  3V05 A;  3K3V A;  3QIA A;  2QW7 A;  1HCZ A;  1JC7 A;  4RG1 A;  4AQY L;  5IGE A;  2JA5 H;  4JYA L;  1N33 H;  2EIF A;  4X3U A;  2E2H A;  3FMA A;  3S1R B;  4R4O A;  4PZ6 A;  1SFO B;  1M90 C;  5KX5 F;  1EIY B;  3I90 A;  4OXP A;  4BA1 I;  3GV5 B;  2CVR A;  2RGV A;  4JI4 H;  1KJQ A;  3T5K A;  3NSW A;  2PBZ A;  4QWC A;  2VW9 A;  2F0W A;  5C3X A;  1HNW Q;  4A3J B;  5LMN H;  3RBE A;  4HID A;  1N36 H;  1BXT A;  3J80 L;  1IL8 A;  1CHQ D;  4YJ3 F;  1G2T A;  1CQJ B;  1Q1B A;  4Y8V B;  3K5H A;  4AQY H;  2YYA A;  1SYC A;  4RGM A;  4IPD A;  2W9C B;  5J1Z A;  3M9M B;  3S9W A;  2R8J A;  2PI2 A;  1SYG A;  2ZM6 Q;  2PQE A;  2O2L D;  4L5R C;  2W6Q A;  2WAC A;  1N32 L;  4IQZ A;  1G6P A;  1I3Q H;  1NE3 A;  1PTO C;  4N8X 1;  4R1J A;  5EBD A;  4BY7 H;  5LP6 F;  3QZ8 A;  3A55 A;  4GC7 A;  5KG2 A;  3L3O C;  1Q8I A;  2R92 G;  2R8G A;  1KRS A;  2MHV A;  1XJV A;  2K4K A;  4PNY A;  4IUQ A;  2HIV A;  4AH6 A;  1VQJ A;  2NUC A;  2HHH Q;  4DV5 Q;  1TQO A;  1BKB A;  2CH4 W;  1YNJ C;  1XPR A;  2IHE A;  5JVL A;  3BDL A;  5FPR A;  3S15 H;  2R93 G;  4KK7 A;  3UDF A;  1K8G A;  5KGU A;  4FDB A;  4K6D A;  4EFB A;  4YWL A;  5FLX L;  4NXN H;  1SNM A;  4G57 A;  2I8C A;  5KFD A;  4FS1 A;  4A3B B;  2J6U A;  1WTR A;  1HXY D;  2DUD A;  2ZXP A;  2AQ1 B;  5C3E G;  2F0L A;  2MQH A;  3F2C A;  4DR6 Q;  3BA9 A;  5KFM A;  3I4M H;  3TME A;  5JJK A;  2JA7 G;  4RU9 A;  5DQI A;  1TY0 A;  2CHB D;  3CD6 A;  3N52 A;  1X54 A;  3MR2 A;  2FXQ A;  3Q1K A;  2K28 A;  1LTL A;  4HCS A;  2XWJ B;  2E75 C;  2CZG A;  2RGR A;  1FJG L;  3NBI A;  4F4Z A;  1FD7 D;  1VBH A;  3H6M A;  3KTM A;  3OW2 A;  2MGS A;  4MAM A;  4O3Q A;  1GKH A;  1V1P A;  1JQY D;  1STA A;  3UDI A;  3PIP 3;  3GTM H;  5KKN B;  2AGO A;  4DV6 Q;  1I4X A;  4QWB A;  2C22 A;  1RTN A;  3D31 A;  4JK1 C;  2KHS A;  5FJ8 G;  5GQO A;  4LF6 Q;  5EPL A;  3C46 A;  3RGX A;  4ZKC B;  3KF6 A;  5GAG C;  4LUO A;  1NUC A;  4DL4 A;  3T5H A;  2ZJT A;  4GKJ Q;  1EYC A;  2NZH A;  3A74 A;  3PO3 B;  4K0K Q;  1RKN A;  3LML A;  4DL7 A;  3KOJ A;  4DUY H;  5L1J A;  3NEL A;  2X6L A;  2NVT B;  2GVA A;  3MXP A;  1CKM A;  2OQ0 A;  2AMC B;  4M1U B;  3S2D H;  4J9S A;  4UCO A;  4ALP A;  1TA8 A;  1KDB A;  3OHA A;  1II3 A;  3RB4 A;  5FO9 B;  1SRU A;  3KUP A;  5D1P A;  2F0V A;  1EEF D;  1JWS D;  3J7A 5;  3HRZ C;  1F9R A;  3GTJ H;  4Q5V A;  5COY A;  3N42 B;  4QMG A;  1KEE A;  5ELF A;  3GTP A;  3D4W A;  5KFT A;  5KT2 A;  1K0R A;  4A3K H;  2R8I A;  5CBE E;  4G4K A;  1K73 C;  4A75 A;  2NVY H;  4JI1 Q;  2N55 A;  3K0X A;  1SNC A;  4HR7 A;  2NN6 G;  5BPF A;  5IT9 E;  4MN3 A;  1KIX A;  4XT1 B;  4L1K A;  4O4H F;  1Y1W B;  3HKZ E;  1CE8 A;  3BYY B;  2B63 G;  2NZO A;  1KHI A;  3GTK H;  2WAQ E;  4GKK Q;  2DPJ A;  2ZTD A;  4QWD A;  4O1N A;  3PO2 G;  1DOK A;  5DLF A;  4UCT A;  1VS0 A;  4TQS A;  1OXT A;  4YAJ B;  2PCF B;  4CBV A;  3ETJ A;  5IP7 G;  3S16 H;  4ZCK A;  1WD0 A;  3GTG A;  4YCU A;  5KFK A;  4RA8 A;  3RZO H;  2P0A A;  3PN1 A;  2UUC Q;  2W57 A;  1BF4 A;  2OEO A;  1UE7 A;  2YTY A;  3DXJ C;  1STY A;  2RHS B;  3UQ8 A;  2R93 B;  3CCM A;  3BAB A;  5HV6 A;  2KEE A;  2QEX A;  5M5W H;  3IN5 A;  1LTR D;  5I4D A;  1PTO D;  1YHA A;  3OHX C;  4HSP A;  1GSO A;  2Q2U A;  4J9M A;  1HNZ Q;  1VQO A;  1SYE A;  4L5Q A;  4O2A F;  3LWE A;  2KVM A;  1CTM A;  4LFA L;  4A3D H;  3SI8 A;  4J9P A;  2JEF A;  3BZD B;  3C0F B;  1SE3 A;  4OEM B;  3S17 H;  1VQI A;  2C2D A;  2K05 A;  5FO8 B;  4BXX H;  1DD2 A;  2DWC A;  1B33 N;  1NR2 A;  2I46 A;  3I4O A;  4GN5 A;  2JA7 B;  1SLJ A;  4RB0 A;  3NWS A;  2PVP A;  2BQR A;  4A93 H;  1V1O A;  2DZD A;  5IT9 c;  4MV6 A;  2LXJ A;  1K83 B;  4CJ2 C;  2KSW A;  3SGI A;  4HED A;  4JV5 L;  2R6G A;  4ZQI A;  1LTI D;  2JN4 A;  4FF2 A;  1PRT B;  2R7K A;  2V59 A;  4POF A;  1VBG A;  2NUA B;  3M4P A;  4J9L A;  4Q0F A;  3HOV G;  4LMY A;  1FNV A;  1C4Q A;  4YY3 Q;  3H3V H;  3HKZ A;  1ET9 A;  1TWG B;  2MNA A;  3MHB A;  2UU9 L;  4JYA Q;  4RAY A;  2R7Z A;  3G8C A;  3RD4 A;  1SR3 A;  4YHH Q;  1VQB A;  5CGK A;  2WAQ A;  3M9O B;  1YNX A;  2Z9H A;  5M5Y B;  4IZ8 A;  4IUV A;  1WTP A;  1I7N A;  3RUP A;  2VB3 X;  4JV5 H;  1F2Z A;  3L7Z C;  1U4M A;  4DR2 L;  1PFN A;  3D0F A;  3CU7 A;  3AYH B;  3T53 B;  4J8Q A;  4WFN 3;  3GIP A;  3F8N A;  4EBC A;  1PYB A;  2Z6K C;  3K5M A;  3P20 A;  3D8G A;  4JI7 Q;  1BO0 A;  1QVF A;  3HS0 C;  3ERQ A;  1AN8 A;  3E6Z X;  4ZLT F;  3J7A K;  1MI2 A;  4LUZ A;  3DEP A;  1PX2 A;  1VCI A;  3R5H A;  3MFI A;  5C8Y F;  4U67 3;  5JEA G;  3TQT A;  1W6K A;  1X3E A;  3GTL A;  1CKN A;  1N32 Q;  2DIK A;  3Q8P B;  4DR2 H;  2BDO A;  3H20 A;  2NVX A;  1AW7 A;  4QB4 A;  4DNI A;  4IFD H;  2YS6 A;  2RDI A;  2V5A A;  2RCF A;  1VKZ A;  5JUM A;  5JPM C;  2QF7 A;  1T5E A;  2PQA A;  5FLX E;  5C0X G;  4Q45 A;  3A8K E;  5E7N A;  2ZDQ A;  2WII B;  3WOE A;  2JEG A;  2F3I A;  4BBR H;  4IRK A;  2LY7 A;  5KNB A;  5EWE A;  3U9T A;  4CDC C;  2B63 B;  2NU6 B;  4DAY B;  1TT2 A;  5AJ3 L;  3RB6 A;  2OH2 A;  1QVC A;  1E0B A;  2UXC L;  2YU9 A;  3PO2 B;  1U4L A;  2NVQ H;  3UFX B;  5KYL A;  3T1H Q;  2E2I H;  1SYX B;  5F2D A;  3BZC A;  5FK9 C;  3S1M H;  2F52 A;  4QWE A;  3BU2 A;  3FHW A;  2F03 A;  3JAM E;  4ZUI A;  3FP9 A;  3TP6 A;  2QIL A;  3P75 A;  2VQF L;  3RAX A;  5C5L A;  5JJZ A;  3PUY A;  1B8A A;  4DGZ A;  2SNS A;  3G6Y A;  3W5O A;  4JBK A;  5FD6 A;  5M5X B;  1FVI A;  1TII D;  1Y14 B;  2E2H B;  4J9Q A;  2UXC H;  3HOX H;  3ORQ A;  3NGD A;  3A5Z B;  1JT8 A;  2J4X A;  1LM0 A;  1HJP A;  3IFT A;  3OWE B;  1FJG Q;  2C2R A;  2TMP A;  4C3H H;  5KG0 A;  3PUW A;  3HOW H;  2D0O A;  3MXG A;  3R2I A;  2XIG A;  4K8I A;  1KC7 A;  1CKO A;  4IWX A;  4MHE A;  1WYD A;  3C2P A;  3Q8Q B;  4LMQ D;  2VQF H;  3GTQ A;  3EIV A;  4HMI A;  1KAA A;  1C30 A;  5DGA A;  2BA0 A;  2M2L A;  4BBS G;  4KHP L;  2JP1 A;  4ED1 A;  4QIW A;  1JJ2 A;  1SSO A;  1YIT A;  4DR1 Q;  4Q8E A;  1ULZ A;  1S5E D;  1JWM D;  2FMC A;  1QVG A;  3CC7 A;  4A76 A;  3VPB A;  1C48 A;  4EG0 A;  1Z7T A;  3VMM A;  3PW7 A;  2I5H A;  1JIH A;  4LF8 H;  2LMC B;  4A3L H;  4KLK A;  1E24 A;  3I3C A;  4DUZ L;  4IRD A;  1EQR A;  2AUJ D;  4DR7 L;  5KFY A;  1WJJ A;  4QWA A;  1Q7Y C;  4KHP H;  2LXK A;  1XNR Q;  1HRJ A;  2AKW B;  2IT1 A;  2QEJ C;  3HOV B;  2O5J C;  4RUC A;  1HTP A;  2B39 A;  2KBN A;  1EWH A;  3G7L A;  2IJ0 A;  1BCP D;  4IPG A;  3KAL A;  3SK5 A;  5CBA E;  1K9M C;  4ECU A;  4X3T A;  2XNA C;  1PLF A;  4B3M Q;  4KJO A;  2KQ3 A;  3KF8 A;  4WRD A;  4GOP C;  3CF5 A;  1D5X C;  1OXS C;  3KFU A;  4DUZ H;  5M3M H;  1W93 A;  2UUB L;  1IW7 D;  4DR7 H;  1KJ9 A;  2XC9 A;  3NTI A;  2K32 A;  1HNW L;  2JA9 A;  4I65 A;  4EVO A;  1SN8 A;  3J81 c;  2JE6 I;  2OTJ A;  1KTK A;  2W6Z A;  2XCP A;  1NBW A;  1W2B A;  4BY1 H;  3I2Z A;  3OHB A;  4XTC S;  3OIP A;  4C56 C;  1PFS A;  4C3J G;  2ZM6 L;  1S03 G;  4CKE A;  2EDG A;  4DAV A;  1VQN A;  1F9P A;  2W7O A;  1N9W A;  3PW4 A;  2A6E C;  1WTW A;  3QZ7 A;  5DLG A;  1YZ6 A;  3V96 A;  1B1Z A;  1HNW H;  4HIO A;  1V1P B;  1RTO A;  1LUZ A;  2A6H D;  3U58 A;  2L55 A;  4FS2 A;  1DIK A;  2W6N A;  1KL9 A;  5BMV F;  1FGU A;  2QA4 A;  2KCT A;  5JOB A;  3HKZ G;  5KFA A;  2HHH L;  4KI0 A;  2R7Z G;  1HFG A;  3CCJ A;  5EKK A;  2NVY A;  3KF6 B;  2JQO A;  2ZM6 H;  5KG7 A;  2WAQ G;  3KLS X;  4LF4 Q;  2Z4I A;  3PUV A;  1B3A A;  1QJO A;  1S3O A;  4OIK A;  4IO9 A;  1Z2O X;  4FXD A;  4LFA Q;  2F0E A;  4ZOL F;  2L15 A;  1EEI D;  5C4J B;  4DR6 L;  1MSG A;  1KLU D;  2SOB A;  1TXY A;  4UCS A;  4DV5 H;  2DY8 A;  2HHH H;  2B2V C;  1NCV A;  3D6C A;  4L6T B;  3VR4 A;  4KKT A;  4DPG A;  3ERO A;  3EFX D;  1I7L A;  3SDZ A;  1EIG A;  1VQF A;  3Q8R B;  1Z47 A;  1B6R A;  1I50 H;  3GTP B;  1PDQ A;  2MO0 A;  4RHR A;  4C3I G;  2IA6 A;  4IUR A;  3CVZ A;  1M7J A;  4J15 A;  4JI3 L;  2KHJ A;  4JI0 L;  4IRC A;  3DHQ A;  3S2H H;  3CCQ A;  4DU9 A;  1I6H B;  4ILW A;  3RIZ A;  4DR6 H;  2R92 A;  1WTO A;  3K7A H;  4HR7 B;  3RV4 A;  4ME3 A;  1LTB D;  4U68 A;  3MJF A;  5JH7 F;  4YCV A;  4DV6 L;  2W6M A;  4ZUJ A;  4UDU C;  5H1S E;  5KFV A;  1O7Z A;  3VDY A;  4BBS B;  2HUG A;  1WCM H;  4RWS C;  5FO7 B;  1GM5 A;  3PMF A;  3CMA A;  2UU9 Q;  5LXT F;  4LF6 L;  1DXM A;  5KND A;  4RAZ A;  1ZYR D;  1GJX A;  1L2Z A;  1J9O A;  1A0I A;  1A3V A;  4GKJ L;  1TWC H;  3E9I A;  5E1F A;  3VR6 A;  4I50 F;  3S1N B;  2LSS A;  5CR3 A;  4K0K L;  5DG8 A;  2NBF A;  3FKI A;  1QNU A;  2M00 A;  3WOF A;  3S24 A;  5G3L D;  1Y69 U;  2A19 A;  4PZ7 A;  2E2J H;  3OWF A;  2V9W A;  5KG4 A;  3BJY A;  3HKS A;  5IYB H;  1SNP A;  1XMO Q;  2FKL A;  3S1Q B;  5D1O A;  4DV6 H;  1QZH A;  4N8F A;  4F4X A;  1QUQ A;  1Z6H A;  3T1Y L;  3WNZ A;  5M9O A;  4LF6 H;  4DK3 C;  3KLW A;  1O78 A;  1LAB A;  2TSS A;  1GSA A;  3Q0A A;  1JLL B;  3J81 W;  5K5P A;  3TIN A;  4GKJ H;  1JKJ B;  2Z6K A;  4K0K H;  4IUU A;  1NY4 A;  3CCE A;  4JV2 A;  3NPP A;  1ASZ A;  2VA3 A;  5C4Z A;  2ZXR A;  2KA7 A;  1Q90 A;  1YHQ A;  4MV9 A;  5CAE B;  3HOZ H;  3VR3 A;  3RNU A;  1A3T A;  4JI1 L;  4A3E H;  2EXD A;  1VQK A;  1NJI C;  2E76 C;  2K52 A;  3C3L A;  2N3S A;  4J0M A;  1B70 B;  1VQ8 A;  1EY0 A;  1LLR D;  3T5J A;  1GUS A;  4A3M H;  3A7A B;  1PZI D;  1JWU D;  3EA6 A;  4NXM Q;  4R7R A;  1O75 A;  1Y1V A;  4QQB X;  3MZ5 A;  2WDT A;  5CYU A;  3ULJ A;  5AJ3 Q;  1CZW A;  2F4V Q;  4DNT B;  4C3J B;  4GKK L;  4FO2 A;  4RB1 A;  1Z2P X;  4DF7 A;  1IL2 A;  3MR5 A;  1TS4 A;  1SE8 A;  3R5X A;  1T94 A;  5JEA J;  3DMU A;  4JI1 H;  5ELO A;  3BAA A;  4C5B A;  3KHL A;  4QCL A;  3KHG A;  4RB3 C;  4DL2 A;  1NNX A;  1VQC A;  4Q44 A;  1NAP A;  5JAV A;  4ZKB B;  1VQA A;  5CV6 A;  1R9T A;  2N49 A;  4RUA A;  3D3R A;  5T14 A;  3RZD B;  1V51 A;  2ZJR A;  2UUC L;  3HKZ B;  1XMQ Q;  3HG9 A;  3I91 A;  3WWV A;  5C0X J;  4KJN A;  1K8O A;  2R7Z B;  4R8I A;  1E1T A;  1KNA A;  4DK0 A;  1OTC A;  1MZB A;  3DEO A;  2JA6 H;  4WD3 A;  1PFB A;  2YTV A;  4H02 A;  2WAQ B;  1DV1 A;  1CI3 M;  3Q2O A;  5DLQ E;  5IP9 G;  2NN6 I;  1K0S A;  5KT3 A;  2J0T D;  4HNT A;  1L1O C;  3DLL A;  3I4N G;  2AGQ A;  1QNK A;  3AFQ A;  3U4Z A;  1P8L A;  4CKC A;  5DAU A;  5KG5 A;  3ONA B;  4G7O C;  1A2U A;  4CJ1 B;  2C9O A;  2EYJ A;  1HNZ L;  4WJ4 A;  1IKM A;  2QYZ A;  2WE6 A;  3BDC A;  4TV9 F;  4APM A;  1YNN C;  5LMU Q;  3KLS A;  2JEA I;  2UUC H;  1XXG A;  3ER0 A;  3CCR A;  1HR0 Q;  4P73 A;  2IMW P;  1WI5 A;  4I7Z C;  4LNQ A;  1EU4 A;  2E2I A;  3NQI A;  3UI2 A;  2HT1 A;  2R3Z A;  2IX1 A;  3GTL B;  4ME6 A;  4OEL B;  1CKN B;  1FNU A;  2CW8 A;  4BA2 I;  3M4O H;  1S4Z A;  2NVX B;  2VUG A;  5DM7 3;  2AQ2 B;  1HNZ H;  4F88 A;  4IOC A;  2N88 A;  2PQA B;  2OF1 A;  2V58 A;  2IBK A;  1UEB A;  1PTO B;  1TWA H;  4A3I H;  3RN5 A;  1PMR A;  1M6V A;  4DA2 A;  3GV6 A;  3PF5 A;  4U6P A;  5HBR B;  1PA6 A;  2W8L A;  2C28 A;  4AIM A;  2C2E A;  4YY3 L;  4HJ8 A;  1G2S A;  2L12 A;  4J9O A;  3KDF A;  4C1N K;  4EX5 A;  2NTT A;  4YHH L;  3H15 A;  2YU9 B;  1Q8K A;  3VPC A;  4J9K A;  5C44 H;  2FE3 A;  2XCA A;  2F4I A;  1ESF A;  3DWP A;  4YWM A;  1A62 A;  2JSO A;  4JG2 A;  2CQO A;  2IL8 A;  2UUB Q;  4B3S Q;  1J6Q A;  2EXZ A;  4V0B A;  3TS0 A;  1MJE A;  4JBJ A;  3F2D A;  5JJI A;  1EY5 A;  4JI7 L;  4YY3 H;  2BQ3 A;  4GOP A;  3FPP A;  4JYA H;  4JI2 Q;  1F77 A;  2O4X A;  3CRK C;  4EEQ A;  4KMU C;  3K5L A;  4YHH H;  3GIK A;  2G5D A;  3BQ2 A;  4YR0 A;  4B08 A;  2ASB A;  3H0G A;  1KDC A;  4GLX A;  3EPG A;  4HQ6 A;  3GTO H;  3JSN A;  4WJW A;  2AQ3 B;  5D8D A;  2GPW A;  3KYH C;  3J81 i;  2R85 A;  2KEC A;  2W71 A;  1EL0 A;  4PWQ A;  1JOK A;  5KIX A;  4GKK H;  3T13 A;  1EFI D;  3GTQ B;  1B9M A;  1EYZ A;  3V6H A;  2VUM A;  4JI7 H;  3S1R H;  4WBN F;  5COR A;  3I73 A;  1SFO H;  1VQ5 A;  4EYH B;  4ZK9 B;  3SVM A;  4QIW B;  2AUK A;  5C6A A;  4OO1 G;  4IUT A;  4A3D G;  2VXW A;  2F0Q A;  3MXN A;  3GII A;  2B3G A;  1GO3 E;  3SK8 A;  1PZJ D;  1SMX A;  3J7Y W;  4A3J H;  3M3Y B;  1VMP A;  1EHI A;  1N32 H;  4O4L F;  1AP0 A;  2SDF A;  3FKI G;  3KHH A;  2LFN A;  1C9O A;  1F2M A;  3DM3 A;  3T1H L;  3MWM A;  4K6L A;  2IX3 A;  1CT1 D;  1STH A;  4ZAI A;  1JDE A;  2AWN A;  1VAJ A;  1AUV A;  4O4I F;  2XVS A;  5EQ0 A;  5CB4 F;  1V4Y A;  5KFB A;  4RNN A;  1X56 A;  2RCN A;  3G6J B;  1BOS A;  4KD4 A;  1RJR A;  4JV0 A;  1I4P A;  1SND A;  2X6G A;  3NTH A;  2E2D C;  2RDH A;  5C4X B;  4IN3 A;  3LWB A;  5I9P A;  4TUY F;  2B2V A;  3KF8 B;  4X6A H;  3I4N B;  3T1H H;  5KT6 A;  3NBH B;  4JI0 Q;  4JI3 Q;  3MEF A;  3VR2 A;  1F9S A;  3U50 C;  3LGJ A;  4G7H C;  2K1B A;  4C2M B;  1KJ8 A;  2UVV A;  1EQQ A;  1HR0 W;  1OO9 B;  4A3B H;  1KLG D;  4LFC L;  1O80 A;  1Y1V G;  4JW0 A;  2FP4 B;  4DR1 L;  3BG3 A;  2JXM B;  3JC6 6;  2HDM A;  2K5V A;  3DWA A;  1FJG H;  4C5C A;  1PXU A;  2FPG B;  1U5K A;  1B2T A;  5KT5 A;  2R61 A;  3NXW A;  2BDN A;  1KD1 C;  1AE2 A;  4IAL A;  5KFR A;  1AH9 A;  4RMF A;  1GHK A;  3PV0 A;  3PQI A;  4GC6 A;  3G4S A;  4XT3 B;  1JDB B;  1YNN D;  4XZ3 B;  1GXD C;  1Z9F A;  5IOC A;  3T1Y Q;  4DR3 Q;  2JJQ A;  3ZYY X;  3VYS A;  1XNR L;  2Q2I A;  1X3P A;  4DR1 H;  2YV5 A;  1ROD A;  5ELD A;  4B3R Q;  1E2W A;  1TWF A;  2F0F A;  2B2W C;  3J81 L;  3GIL A;  2K7V A;  3P1H A;  3KBX A;  4H13 C;  1I4H A;  1T9H A;  4RNM A;  5FOB B;  4BBR G;  3GID A;  4B3M L;  1JB3 A;  4B3T Q;  3WO1 A;  1IZ6 A;  3SK6 A;  5KFS A;  1HUM A;  3K81 C;  4UP7 A;  3M4Y A;  2Q2H A;  1DON A;  1T3N A;  3VR5 A;  1X6O A;  1NR4 A;  1YJN A;  1ASY A;  3D4D A;  3PO3 H;  3HEJ A;  1XNR H;  2Q2T A;  2AHO B;  2H4O A;  3W2D A;  1EUD B;  5LOV F;  2NVT H;  1A6X A;  4R4I A;  4N9T A;  4B3M H;  3CQZ A;  2WIN B;  1SNO A;  5K36 H;  4GLA C;  3K8A A;  2NU9 B;  4ED0 A;  2EYP A;  2CWA A;  3OSN A;  3I4L A;  2R92 B;  3CAM A;  2WB1 E;  1R4Q B;  3MEH A;  2M9V A;  3FPU B;  1WVL A;  5IGB A;  5M5W B;  1W3S A;  1QWY A;  3PW5 A;  4C3H G;  1TVX A;  5ISR A;  3QB3 A;  3E5N A;  5ELB A;  3TN2 A;  2V1C C;  1RYR A;  1KXL A;  3DF7 A;  1WD1 A;  1GLV A;  2NB0 A;  4RNO A;  1BR9 A;  4IPC A;  5IWA Q;  4LF4 L;  1ONL A;  3RGZ A;  4EGJ A;  3FKI B;  1RJQ A;  5KFF A;  4U7C A;  1Y1W H;  1UEA B;  4DR5 Q;  1B44 D;  3PW2 A;  1QCB D;  1CQF A;  3A8I E;  3SR1 A;  3ULP A;  4GN3 B;  2A5H A;  3FRP B;  5C3W A;  2R6F A;  3IG0 A;  5KFG A;  4E6I A;  5C3E B;  1TS2 A;  5D1O B;  3MC0 B;  1YHB A;  1QUQ B;  2EVB A;  2F0M A;  1EQT A;  3BS1 A;  2PO4 A;  1L1O A;  5KFC A;  5K2M A;  1KQS A;  5GON F;  1BJT A;  5H80 A;  1K8M A;  1BBU A;  1RHP A;  4KKU A;  3H0G G;  1BCP C;  3TP5 A;  4LF4 H;  1LTG D;  2A73 B;  1JX4 A;  1EYD A;  4FF1 A;  1X9N A;  1RCV D;  1RL2 A;  4R9W A;  3M4I A;  2R7F A;  1QIL A;  2K14 A;  4DV0 Q;  3V4Z A;  2DY7 A;  1EY7 A;  4KHZ A;  4R4C A;  3PCO B;  2A1A A;  1QOH A;  1DZ1 A;  4LFA H;  1BDO A;  3EQL C;  1E4F T;  2VUM G;  1UAP A;  1IW7 C;  2R93 H;  4IWY A;  4DNR B;  2B8F A;  4XDX A;  1ZHQ A;  2VR1 A;  3JRX A;  5EKI A;  5LL6 X;  1SJH D;  3HP3 A;  2EJG C;  1Y1V B;  1SMY C;  2OT2 A;  3B6Y A;  5M3M G;  1HA6 A;  4MZ9 A;  3VYT A;  3J80 E;  5EWG A;  2Q8R E;  1FGB D;  1DCZ A;  2J9G A;  3A5U A;  5KRU A;  1D8L A;  4ZI7 F;  1E2Z A;  2OWO A;  3TQY A;  1CK1 A;  3J7A F;  2JA7 H;  4J6H A;  4XQQ A;  1IBK L;  3A7L A;  2QK4 A;  5KT7 A;  3EJI A;  2YRW A;  1R9T B;  2WB1 A;  4KKS A;  2A6H C;  1K8A C;  1XMO L;  5J39 A;  1K83 H;  3KK7 A;  3HB9 A;  2UU9 H;  4FXK C;  1AZQ A;  4F7X A;  2EOT A;  2J7Z A;  3H3V C;  3BVM A;  3GLK A;  4GLV B;  1V1Q A;  1GUT A;  3CPW A;  3NK9 A;  5A2Q W;  2IPK D;  3GTG B;  4RB2 C;  2RDJ A;  1VQH A;  4G7Z C;  2KHI A;  1V43 A;  1TWG H;  5A35 A;  4P72 A;  4P2C B;  1XMO H;  2SCU B;  4LF5 L;  2JA5 A;  3G48 A;  4A4I A;  3V6K A;  5CA0 F;  1JE5 A;  2N8N A;  5M5Y H;  4IAJ A;  5CV7 A;  4JV1 A;  3V6J A;  1CUK A;  2RSO A;  3U9O A;  1QG7 A;  1CQV A;  4EEY A;  1TWH B;  1SE2 A;  1S40 A;  3S1M B;  2BE5 D;  3CC2 A;  4DKA C;  4NXM L;  1LT5 D;  2HVR A;  2RA4 A;  2H5X A;  3Q6S A;  5M3F G;  1EY9 A;  1BUV T;  2F4V L;  2F0T A;  2N78 A;  2K75 A;  5HGT A;  4OL7 A;  1PRT F;  4I4T F;  3J80 c;  1E3P A;  1MIU A;  1CZG A;  1UNS A;  1HPC A;  4PQX A;  1WTH A;  4UCR A;  2DNE A;  5IGC A;  2W70 A;  3E0E A;  1I3Q A;  2NYZ D;  2XGQ A;  4NXM H;  5IY0 A;  3T4A C;  1M8A A;  3LX0 A;  4X62 Q;  1XMQ L;  2FK3 A;  3KHR A;  1HUN A;  3KDF B;  2F4V H;  2UUA L;  1SDF A;  5J3B A;  1ZYR C;  3CRL C;  3TDQ A;  4CDD C;  2F0H A;  4A3C G;  5JJL A;  4LH7 A;  2NN6 H;  3ZJY C;  2J6T A;  4MIU A;  5IT9 W;  4MTK A;  1WCM G;  2UVR A;  1XTD A;  4ODG A;  1M1K C;  1EIF A;  4OGQ C;  2B63 H;  4A3F G;  1RD9 D;  3K3P A;  3N40 P;  5LMU L;  3HFZ B;  3RLO A;  1Q1E A;  1HFN A;  4GOP B;  1LYL A;  3PO2 H;  4LFC Q;  5KFU A;  1XMQ H;  1HR0 L;  5FLX c;  1GUG A;  2W9B A;  5IGG A;  4NPS A;  1Y8N B;  3H0G B;  2G9D A;  5IP7 H;  4PZ8 A;  3I56 A;  1PH7 A;  4MV1 A;  1VQL A;  1QB5 D;  2K50 A;  1D2B A;  5J2T F;  5L9X A;  3M7N A;  3J7A V;  1X3G A;  3Q23 A;  4XIG S;  1PH8 A;  1N34 Q;  4O3N A;  1JJG A;  2XGP A;  5M5X H;  1H9S A;  2E2H H;  4FYD A;  5LMU H;  2VUM B;  4A3G G;  3M9N B;  2ZXO A;  3H4D A;  4DK1 A;  1HR0 H;  3L0O A;  2W9A A;  1WTQ A;  2W6P A;  1I6V C;  2GA4 B;  2BA1 A;  2VY3 A;  3MXN B;  1A3U A;  4GZY C;  1RJT A;  3ULL A;  2J6S A;  3JAM c;  5IE8 A;  2X69 A;  1DV2 A;  1B50 A;  1EY4 A;  1K3R A;  1EWI A;  1AN7 A;  3GTM A;  2D2C C;  5ELE A;  2K5H A;  3R23 A;  4YJ2 F;  4DXG A;  2L0C A;  2G9H D;  5EDW A;  2B2T C;  3I7F A;  3HOU G;  3AEV A;  1I4G A;  3OUU A;  2B2W A;  2HGS A;  3BA8 A;  4UFZ A;  2HQL A;  1S5D D;  4IUP A;  4B3S L;  2VQD A;  1ENA A;  3JSL A;  5CV4 A;  1O7Y A;  5ELC A;  2XIW A;  3EYY A;  1JOR A;  3ITP A;  2RDG A;  3PGZ A;  1SMY D;  3N44 B;  1UE6 A;  4JI2 L;  2ASL A;  3NUC A;  1YJW A;  4XXE A;  1PH4 A;  5IYZ F;  2L4N A;  3MWD A;  1TS5 A;  2Z6B A;  1CHP D;  4YIJ A;  3HOV H;  3LWU A;  3MAQ A;  1ZEQ X;  1LT6 D;  2I5M X;  3N43 B;  5JVD F;  5GRO A;  1E4E A;  2UUB H;  3K59 A;  4B3S H;  3RAQ A;  3GTJ A;  2WKD A;  1FNW A;  3MTS A;  4HCE A;  4UY8 C;  3OSP A;  3F2B A;  2I0Q A;  1GD7 A;  4V19 0;  2W7P A;  2D62 A;  2JA8 H;  3JRW A;  2HVS A;  5I2Y A;  4QL5 A;  2FLL A;  2P5Z X;  4YAK B;  3PSI A;  1PVO A;  4JI2 H;  3UDX A;  1JCK B;  2CWP A;  1D5M C;  2GVB A;  1C0A A;  2ICE C;  4HYK A;  1Q81 C;  3PF4 A;  5M3F B;  3URY A;  3STB C;  1G8Z D;  3CCS A;  1PV4 A;  4FF4 A;  5AFW A;  2R7M A;  4MV3 A;  1SYB A;  2R7L A;  4I7H A;  5KG6 A;  1ICW A;  4KN4 C;  4UCV A;  1KRT A;  1UE1 A;  4QF4 A;  2R84 A;  2GPS A;  2WV6 D;  1WOC A;  2WB1 G;  3ERS X;  2VQE Q;  5JEA H;  2D9U A;  1VQP A;  3AB9 A;  5FPO A;  3GTK A;  4M8A A;  1V8Q A;  3HOY G;  4XYO A;  5KFL A;  4YP3 A;  3OPO A;  4WJ3 M;  1TWF B;  1DJR D;  1P16 A;  3W3A A;  4CGY B;  4CHT B;  5C0X H;  3JZI A;  4A3I G;  3BDO A;  2KCN A;  2WP8 J;  3KXY T;  2YZN A;  3H91 A;  3F2U A;  5IYD G;  1S97 A;  1CS0 A;  2PZT A;  1U9R A;  4K14 A;  4F4Y A;  4OO1 I;  2JA5 G;  3NP8 A;  4A3F B;  1JIC A;  4LSA A;  1EWC A;  2PW7 A;  2F3W A;  3MWY W;  2W8K A;  4J1M A;  1JE4 A;  3SE0 A;  4ID6 A;  1JMC A;  1DGS A;  1OXX K;  3GV3 A;  4TQU S;  3S14 B;  5E4W C;  1IOV A;  4FU0 A;  1N56 A;  5C4J H;  2D5D A;  4MV8 A;  3CQZ B;  3RF2 A;  2PPB C;  5HGQ A;  3KLR A;  4JI0 H;  1U4R A;  4JI3 H;  2F0O A;  4DAM A;  1F2L A;  2Z8L A;  5KG1 A;  4RHS A;  5EAY A;  1IBK Q;  5HY6 A;  1EUJ A;  1ESR A;  1Q12 A;  3GIQ A;  3WO0 A;  2DN8 A;  5IOD A;  1HQM C;  4A3G B;  4HNV A;  5LL6 b;  3GTP H;  3TIG A;  4FBT A;  5CC4 A;  1QE6 A;  5IIF A;  1U0L A;  4BY7 G;  4DR3 L;  4MV4 A;  3MR6 A;  3GO5 A;  1HHV A;  3IL8 A;  2PNH A;  1DOL A;  1VQG A;  1U4P A;  3GD7 A;  4GNX C;  4B3R L;  1I6H H;  1HA5 A;  4DL6 A;  1NMF A;  1EQV A;  2IX0 A;  5CV5 A;  3TBI B;  5IYC H;  4QJF A;  3MFG A;  5A2Q L;  4BBS H;  3K58 A;  2R87 A;  4HJA A;  3ETH A;  3VA5 A;  4B3T L;  3HOU B;  4LF7 Q;  4LF5 Q;  1S5F D;  2H1E A;  5FLM H;  5JQW A;  2CW0 D;  3QFF A;  1L1O B;  3T1Y H;  3GP7 A;  4DR3 H;  2JEB I;  1MGS A;  5I6W A;  3S1N H;  4X65 L;  2K03 A;  4FP5 D;  1ENF A;  1W6J A;  2EY1 A;  4B3R H;  4HJ5 A;  1UUP A;  3RTX A;  2XRS D;  1XPO A;  4DLK A;  2VNU D;  1UNN C;  1I4Q A;  3S1Q H;  2GN5 A;  4EYI B;  3TEH B;  3I4M G;  2BH2 A;  5KFE A;  4B3T H;  5LA6 F;  2EZV A;  5C5J A;  4QUC A;  3QWN A;  4POG A;  2C35 B;  5FD5 A;  4Q43 A;  4NKL A;  2WTF A;  4JI8 Q;  2K5W A;  4DN4 M;  3I12 A;  2GLT A;  2VA2 A;  1PFM A;  2LKV A;  2K04 A;  3L2P A;  1SJE D;  2KEN A;  1BVS A;  1EOT A;  1WSC A;  5L1I A;  4ABN A;  1NMG A;  1H9R A;  5E3F A;  3IKJ A;  4XQN A;  2F1M A;  5D3I B;  5KYI A;  4Q8F A;  2KCM A;  1FKA H;  2XN9 C;  1FL0 A;  1LT3 D;  3J80 i;  2UUA Q;  1N48 A;  4OWX B;  4DV4 Q;  3PR4 A;  4DR4 Q;  4PDB A;  4DV1 Q;  2OCE A;  4ME5 A;  4R4Q A;  1XYI A;  2K5N A;  1AE3 A;  3SXH A;  3P7J A;  4FVM A;  5IWA L;  4JI5 Q;  4UAI A;  3T16 A;  2WYO A;  1VDZ A;  5IT9 L;  2VL6 A;  1EIH A;  4OX9 Q;  4DR5 L;  4FNF A;  5T1G A;  2WB1 B;  4Y7N H;  4TQR A;  3DM1 A;  1RDP D;  4C3J H;  4AYB E;  1OWT A;  3HOY B;  2E5L Q;  4L5S A;  4RCO A;  1PK8 A;  4BWG B;  3TQ1 A;  2FJZ A;  1W96 A;  5BR8 Q;  2PI2 E;  1J8I A;  3GV8 B;  5JVG 3;  4EQO A;  2JEJ A;  4DL5 A;  4EBD A;  5IWA H;  3STB D;  1DOM A;  2PW5 A;  4L63 B;  5C1O A;  4C3I B;  3RZD H;  4P71 A;  4DR5 H;  4JCV E;  4DV0 L;  2CH4 A;  1H95 A;  3OUZ A;  3L4K A;  2R7Z H;  5EJW A;  2ASJ A;  2JA5 B;  1O7L A;  3HGB A;  1VQ9 A;  4B9W A;  1CSP A;  2RKS A;  2EYM A;  2JEI A;  4A3K G;  4L5T A;  4S3S A;  2BOS A;  4RGO S;  2HDL A;  5KG3 A;  4LK1 C;  1FYC A;  3QG1 A;  2F0P A;  1GUW A;  4LF9 Q;  5C4H A;  1IYV A;  3CKI B;  2KOL A;  5CMD A;  1N33 L;  1AEX A;  2EY5 A;  1ENC A;  1MBY A;  4DV0 H;  1B9N A;  1ZKO A;  4F4W A;  1K1S A;  2FK2 A;  2SEB D;  4HIK A;  5CV9 A;  1V9P A;  1X3F A;  3GTL H;  3SEB A;  3K6O A;  1H9M A;  3FEW X;  3JAM i;  4A2B A;  3PIO A;  2IP4 A;  5LMN L;  3K0Y A;  2NVX H;  4JOI C;  2WKC A;  1I3Q B;  4BY7 B;  1Q46 A;  2B2T A;  4GN4 B;  2YS7 A;  1ET6 A;  2NU7 B;  2EJF C;  5EPK A;  3MXU A;  2VOB A;  3VYR A;  3PUZ A;  4NMZ A;  4ED6 A;  1PH9 A;  1PTO H;  3VPD A;  4JI6 Q;  2I87 A;  2MUY A;  2K6A A;  1KAW A;  3X3M A;  2MP1 A;  4L8J A;  2UXB Q;  1IBL Q;  3V2T A;  2PN1 A;  5CV8 A;  2Y0S E;  4YR2 A;  3S15 B;  3Q8S B;  1EYG A;  3FMC A;  2YU9 H;  1DYQ A;  1F9Q A;  4AYB A;  1H9J A;  1Y1W G;  2PZW A;  3KBG A;  1SXT A;  3IFD A;  2YCH A;  4LUV A;  3UE1 A;  3W1G A;  2W9B B;  3PZP A;  5D65 A;  2FHT A;  3U4V A;  4XQJ A;  3ORR A;  1OXU A;  2QDB A;  3NTK A;  4NXN L;  3I4M B;  4BXX G;  4ETS A;  1KDA A;  1TY2 A;  2ES2 A;  1H9K A;  1PTO F;  1YBY A;  2IHF A;  2NZ1 D;  1G91 A;  1TAE A;  1H9S B;  5CA1 F;  1QZG A;  4A93 G;  5GAE C;  4FBU A;  2BH8 A;  3OW7 A;  1UC9 A;  2JK8 A;  4EFE A;  1XTC D;  2FLP A;  3OTO Q;  2M05 A;  5IGF A;  1PH1 A;  4G3I A;  4NW2 A;  3RN2 A;  1UE5 A;  3I72 A;  1D7Q A;  1KAB A;  3NE5 B;  3ND9 A;  1E22 A;  4RCN A;  4X62 L;  3R2T A;  3GTQ H;  5C0X I;  1GHJ A;  2FLN A;  3UE0 A;  3GTM B;  2MFI A;  3BQ1 A;  4R4T A;  2YTX A;  5KEE A;  2VPQ A;  4TSS A;  2F0J A;  1I5F A;  1L0Y B;  1IBM Q;  4LW1 A;  4DV2 Q;  3RFC A;  2UXD Q;  2HVQ A;  2HCI A;  4HMJ A;  4TVA B;  1X3Q A;  1EYA A;  1EZ6 A;  5KFW A;  2K33 A;  1RK5 A;  2PMZ E;  4HJ7 A;  2SNM A;  3M3Y H;  1M4V A;  2ZDH A;  1LTA D;  2DLN A;  1EUC B;  1VMC A;  4NDX A;  4X62 H;  3HZX A;  1X32 A;  2A8V A;  4KN7 C;  3S2D B;  3TII A;  3D6W A;  1HQR D;  4EQN A;  3K80 C;  4PV1 C;  4KD3 A;  4IZO A;  3JAM L;  5L1K A;  1E4E B;  3FVQ A;  3NEN A;  1IOW A;  2NTS A;  5KFO A;  4DUY L;  4H0L C;  4X66 Q;  1K1Q A;  1A2T A;  3GTJ B;  4JBW A;  1N34 L;  4F8M A;  4DV7 Q;  5C4X H;  2Y0S A;  4ED3 A;  3QO2 A;  5A2Q E;  4HAE A;  5IP9 H;  3R8B A;  3K5N A;  1I50 A;  4IJH A;  5KFJ A;  2RQX A;  4LFC H;  3I4N H;  2HCC A;  4A3K B;  4IFD G;  3TRZ A;  1S0N A;  2B2U C;  4HIM A;  2NVY B;  2VPS A;  2BE5 C;  2RBM A;  5BPH A;  2BCO A;  4HTH A;  4C2M H;  4MTN A;  2LS0 1;  4EQ5 A;  1J5E Q;  1LTS D;  1N34 H;  2R7N A;  2HD3 A;  1GUN A;  2F0N A;  1WCM A;  2F3V A;  2QDL A;  4GNX A;  1HTL D;  1PYW D;  3M4Q A;  3BZK A;  3GTK B;  4NP5 A;  2KUM A;  5KFX A;  4ZHQ F;  2EYH A;  2QCP X;  2FB9 A;  1VQ7 A;  4X65 Q;  2VS1 A;  1TWC A;  2E8G A;  4R8U A;  3E5S A;  1SAP A;  4YQW A;  4GS3 A;  2F0G A;  1K3B C;  1XWE A;  5C5M A;  1CQI B;  3S16 B;  2ICI A;  1M0W A;  4KY7 A;  4KV6 A;  2JYO A;  3Q22 A;  4IPH A;  3RZO B;  1D1I A;  1SRO A;  1E2V A;  2ID0 A;  3PIP A;  4LWC A;  1STB A;  1BCP B;  4K8J A;  5LYJ F;  3OOC A;  4OON A;  3HOX G;  3U9S A;  2PMZ A;  3GV7 B;  1GVP A;  3T51 B;  3AQQ A;  3RR5 A;  4O3O A;  1SYF A;  2HQE A;  3TZU A;  4O3S A;  4X3K A;  1PZK D;  3QJY A;  3HOW G;  2ALY B;  1G29 1;  3AFP A;  2DPI A;  2ZJP A;  3RUZ A;  1Q3L A;  1IYU A;  3RLF A;  4A3D B;  3FDS A;  1TS3 A;  2A69 C;  5ELN A;  4B9X A;  1JOQ A;  3KAJ A;  4LFB Q;  1CA6 A;  1EY6 A;  4KTA A;  3S17 B;  4K2K A;  3CW2 C;  4H7B A;  1FR3 A;  3BYT B;  3EN2 A;  4MNO A;  1STN A;  3NWT A;  4TRD A;  3CXC A;  4DV3 Q;  4YWK A;  4C1N I;  3PW0 A;  4A93 B;  2VQE L;  2XD4 A;  3E0J A;  5EZY F;  4J9R A;  4OIJ A;  1B4O A;  4ZQ3 A;  1X65 A;  1RIP A;  1C3O A;  4RZQ A;  1KNE A;  3K7U C;  1L0W A;  2XTI A;  4A3L G;  1T36 A;  3R3O A;  3IAY A;  2R92 H;  4E4T A;  2A68 C;  3TZD A;  1XNQ Q;  2L5T A;  1UC8 A;  5TSS A;  4WOR A;  3A56 A;  4ECQ A;  1HNX Q;  1WFQ A;  5E4X A;  2VQE H;  4H44 C;  3TRE A;  1I94 Q;  4OO1 H;  1YEZ A;  4X64 Q;  2B2Y C;  2JA6 A;  1OXV A;  1WH2 A;  5D3D A;  4AYB G;  3EVQ A;  1BNC A;  4EGV A;  5J22 A;  1Y8P B;  2QKI C;  3FKI H;  4ECT A;  1YNJ D;  2OTL A;  4XYQ A;  3TP8 A;  2C00 A;  1SEI A;  3EBE A;  4UHV A;  1B3Q A;  5I9O A;  5C3E H;  1N33 Q;  2KCC A;  1BCP F;  4UP9 A;  5KFH A;  1VQ6 A;  4UP8 A;  1VQE A;  4RAU C;  2OLS A;  3MVV A;  2YZG A;  4QW9 A;  1SCU B;  1D5Z C;  4APV A;  4JI4 Q;  3RB3 A;  4PG3 A;  2R8H A;  4BY1 G;  5L37 A;  1NTG A;  1ZHS A;  4O2D A;  3GIJ A;  5LMN Q;  1N36 Q;  4FXG C;  4CC6 A;  5DG9 A;  5DEH A;  2C5C A;  4P75 A;  3RMH A;  3Q24 A;  4AQY Q;  1VQD A;  2R8K A;  2MO1 A;  2K5Q A;  2KED A;  3E3X A;  2B29 A;  4FF3 A;  4JOI A;  2JA8 G;  1XX8 A;  2K01 A;  3C1E A;  1TWA A;  1A9X A;  5D14 A;  2V4D A;  4BBR B;  1IBK H;  1PH3 A;  3QOL A;  5FJ8 H;  1HZC A;  1Y1V H;  4CC5 A;  2D0P A;  1WR2 A;  4LF7 L;  2F0D A;  5F9L A;  1RJP A;  1JXL A;  2PZU A;  4RH6 A;  2ASD A;  4ED2 A;  2A74 C;  1LTT D;  4QIW E;  1S9F A;  2NVQ B;  5DQH A;  4ECV A;  1LT4 D;  4ZRZ A;  2E2I B;  2R82 A;  1B6S A;  3H40 A;  2FPI B;  2YZM A;  3H09 A;  4MA5 A;  3SHL A;  3CPF A;  1R9T H;  1HZB A;  3ICE A;  3GQC A;  3BQ0 A;  4NXN Q;  1JOO A;  1PRT C;  1NSN S;  1B04 A;  1HZA A;  3N6R A;  4XYL B;  1E1O A;  1ZXT A;  2VZA A;  3Q8D A;  4LF7 H;  3IRB A;  2Y0S G;  3WDN A;  1G51 A;  5F9N A;  4LF5 H;  1D1K A;  2R7D A;  2WFW A;  5KFP A;  3HOX B;  4JPB W;  4JI8 L;  3EPI A;  2OQK A;  1JJC B;  3GTG H;  4C3H B;  1GGO A;  5JPN C;  2EQS A;  4O0A A;  3GTO A;  3M7G A;  3HOW B;  4LSX A;  4DAP A;  4CJ0 B;  4HJ9 A;  2Z0S A;  1CSQ A;  2NWG A;  2EYL A;  4DV4 L;  1IXR A;  4DR4 L;  4DV1 L;  1S0M A;  5JVH 3;  1SFO A;  1RF2 D;  1I6U A;  1EU3 A;  4JI5 L;  1K28 A;  1E4G T;  2Z4H A;  5KFZ A;  1TWH H;  4BWS C;  2ZTC A;  5FKA C;  4OX9 L;  3KJO A;  1GSH A;  3RV3 A;  4JI8 H;  2FIN B;  5BN3 A;  3AMU A;  5C1P A;  4M9U A;  2HJW A;  2YW2 A;  2UVW A;  2IW3 A;  1AFP A;  4CDF C;  2E5L L;  4RGN A;  1IHZ A;  1YJ9 A;  4NLG A;  4PMW A;  1PH5 A;  5BR8 L;  2UUA H;  4NB3 A;  2W9C A;  4DV4 H;  5IYB G;  1M0T A;  4DR4 H;  4DV1 H;  2A69 D;  4JUZ A;  4JI5 H;  4FM9 A;  3NEM A;  1PYS B;  4MTE A;  1CM9 A;  3G71 A;  1LO5 D;  5EBC A;  3KJP A;  5L1L A;  1SEB D;  3OMC A;  3W1B A;  4DUY Q;  3J81 E;  4RZR A;  4K5X A;  4OX9 H;  4OWW B;  4F87 A;  5G3L F;  3VA7 A;  4LF8 L;  5BN4 A;  2CW0 C;  2FJ2 A;  2AGP A;  1Q86 C;  5IGD A;  1SYD A;  5IYC G;  4AYB B;  4N9P A;  4O42 A;  1BGW A;  1KJJ A;  1EZ8 A;  4YB8 B;  2E5L H;  3A8J E;  2XRQ D;  4EQP A;  5BR8 H;  3K5O A;  3G6E A;  2AWO A;  2F0U A;  3X3N A;  5DGB A;  2MJ8 A;  3HOZ G;  4M7E A;  4ECS A;  1ICF B;  5FLM G;  4A3E G;  5M3M B;  2AQ4 A;  1YIJ A;  4LF9 L;  1IYJ B;  2A68 D;  1VQ4 A;  2MCT A;  3L4J A;  4RKL A;  3I70 A;  3CC4 A;  2L9H A;  1S5B D;  4A3M G;  2B2U A;  1YI2 A;  3FDT A;  1STE A;  3CME A;  2PNR C;  5DG7 A;  1JB7 A;  4PMB A;  4CKB A;  4R8N A;  4BY1 B;  2EY6 A;  3H0G H;  4ECR A;  4I55 F;  2YYZ A;  5LMN W;  4QGU A;  3PVX A;  4PMC A;  3I55 A;  2QGQ A;  2EYO A;  2YL2 A;  4QY7 A;  2YRX A;  4LF9 H;  1MKH A;  1HH2 P;  2I5L X;  1RK6 A;  1ZET A;  1S0O A;  2F0K A;  2ZJQ A;  2VUM H;  2ALZ A;  2B8G A;  4IFD J;  4KY6 A;  4I7A A;  2JA8 B;  4JI6 L;  3K57 A;  3NBH A;  4XYM B;  3PUX A;  3R93 A;  2X0S A;  1BQQ T;  1MD2 D;  3GIM A;  3L9A X;  2JA6 G;  1IBL L;  2UXB L;  5GAD C;  4DK6 C;  3J80 W;  2ZDG A;  5KFQ A;  1N8R C;  2EY2 A;  1YVC A;  2Q8I B;  4C2M A;  1PHJ A;  2EJM A;  1T5X D;  2DJF C;  2RHQ B;  4DFA A;  2W6O A;  2XWB B;  4KY5 A;  1TU2 B;  4JC0 A;  2E74 C;  4HSV A;  1Y8O B;  4MA0 A;  4JI6 H;  1CFM A;  4Y52 H;  2BR0 A;  4RFB A;  2HIX A;  1GYF A;  2IY5 B;  1PH6 A;  3RLN A;  2XSC A;  4ED8 A;  1IBL H;  2UXB H;  4P74 A;  2Y0S B;  1AUX A;  4X3S A;  1I50 B;  3HXL A;  3J7Z C;  2I80 A;  2DNC A;  2L1B A;  4J9N A;  2XGT A;  3N6X A;  3F1Z A;  3M85 A;  2EE1 A;  3CHB D;  3CCL A;  1MJC A;  1KC8 C;  4DV5 L;  3OTO L;  1L2F A;  3S2H B;  3VYU A;  3G6V A;  2O5I C;  3K7A B;  5LL6 S;  2F0S A;  2RF4 A;  5FLX W;  3BG5 A;  4TV8 F;  1PRT D;  2EPB A;  4ECW A;  2ENB A;  1IBM L;  1X55 A;  1WCM B;  4DL3 A;  4DV2 L;  4GNX B;  2UXD L;  2O03 A;  3MWE A;  1A8V A;  3K5I A;  3OSO A;  2I07 B;  4XX0 B;  4MV7 A;  2Q8T A;  3T56 B;  3RJ0 A;  5M3F H;  1MHW C;  4K5W A;  5C44 G;  4YR3 A;  1TWC B;  4UCU A;  3AU7 A;  4OWT B;  3OTO H;  2OXP A;  5GAH C;  4R8U B;  2ZT9 C;  5LHY 1;  4C5A A;  1Y1W A;  1VQM A;  3E9H A;  4K5V A;  5NUC A;  2E2J B;  4EGQ A;  4HN7 A;  4MTD A;  2B2Y A;  1EZ1 A;  3CCU A;  1A15 A;  1XDN A;  1SNQ A;  2RDF A;  3CCV A;  1WTX A;  3JAM W;  1IBM H;  3KAK A;  3TP7 A;  4DV2 H;  5KNC A;  2UXD H;  3H94 A;  2CCZ A;  2RSN A;  4JV5 Q;  1A63 A;  4YBZ B;  1DM0 B;  1I4R A;  1TWF H;  4ECY A;  4X66 L;  1O7I A;  3CP0 A;  2PMZ B;  4DV7 L;  2RVL A;  4IHJ F;  4JVZ A;  2IWH A;  4A3C H;  1GOZ A;  2FK1 A;  1Z2N X;  3H3V I;  1C7Y A;  3MA2 B;  4A2A A;  3HOZ B;  2DGY A;  3RBD A;  4RGT A;  4A3F H;  1E7Z A;  5I6Y A;  4A3E B;  4IR1 A;  3N41 B;  2R93 A;  4Z9C B;  1B7Y B;  1S5C D;  1L0X B;  1PH2 A;  2CQA A;  2F0I A;  4F50 A;  4DR2 Q;  4A3M B;  5DM6 3;  1J5E L;  4X66 H;  2DJG C;  3N8D A;  3MR3 A;  3S14 H;  1ML0 D;  4DV7 H;  2Z1C A;  2ATW A;  4A3J G;  5EKL A;  2K5D A;  4QW8 A;  3CQZ H;  5I2X A;  5BN5 A;  4DXF A;  3OYY A;  2BQU A;  3LNN A;  1IKL A;  1R4P B;  3NHH A;  1VF5 C;  3DWQ A;  3MFH A;  4O2B F;  2JA7 A;  2UVU A;  1BBX C;  1MSH A;  1KJI A;  4A3G H;  3A54 A;  3C1F A;  3ND8 A;  4TKO B;  1J5E H;  3H4B A;  4IFD I;  1EOV A;  5T1I A;  1K83 A;  4ECZ A;  2JA6 B;  4KHV A;  3O13 A;  4UPA A;  1D6E C;  2FMA A;  1AZP A;  4X65 H;  5J2U F;  3D4R A;  1SBB B;  3UDG A;  4EBE A;  1STG A;  1BNZ A;  2CQY A;  3SK4 A;  5DNF A;  3BVG A;  1WTV A;  3HOU H;  2AU0 A;  3OIQ A;  5EWF A;  3QOJ A;  2V4R A;  1F2Y A;  1TWG A;  1BXR A;  4Y7N B;  2UXC Q;  1G6Z A;  4LFB L;  5EOY A;  2CKZ B;  4LJZ C;  3R5F A;  4A3B G;  1C8C A;  4Q0Y A;  4O3R A;  2ATL A;  3PR5 B;  4DV3 L;  1SE4 A;  1S68 A;  2ZTE A;  4YCW A;  2VQF Q;  3G6X A;  4ED7 A;  2KJX A;  2V4Q A;  3M4O B;  5HUR A;  4CDE C;  3NQT A;  3M9B A;  2EYF A;  1RYS A;  2L11 A;  3PIO 3;  1EY8 A;  1VF7 A;  5C4X G;  2CFM A;  2XCL A;  1CA5 A;  4LFB H;  2CW7 A;  3TSS A;  1TWA B;  1XPU A;  2NU8 B;  4A3I B;  1BBW A;  4BS9 A;  5EGT A;  1XNQ L;  3V4S A;  3QR8 A;  2MPM A;  1TKW B;  2PYK A;  4LH6 A;  2A6E D;  5KFN A;  4ULL A;  5I47 A;  4DV3 H;  3RB0 A;  1HNX L;  3GDE A;  4O3P A;  4LF8 Q;  1JR0 D;  1LAC A;  2FFK B;  1I94 L;  3DUZ A;  5KFI A;  4X64 L;  1KBL A;  5EPJ A;  5C44 B;  4KHP Q;  4ZYS A;  4IOA A;  4RKB A;  1GUO A;  3HBL A;  3A0J A;  5KT4 A;  1LV9 A; 
#chains in the Genus database with same CATH homology
 4GNX A;  4LFA Q;  1S40 A;  3TS2 A;  3CC2 A;  4NXM L;  4DKA C;  3F8T A;  3M4Q A;  3BZK A;  2H5X A;  2L15 A;  1Q82 C;  5M3F G;  3PO3 G;  4JBM A;  2F4V L;  1VQ7 A;  4DR6 L;  4X65 Q;  2N78 A;  2K75 A;  3HOY H;  1TXY A;  2VS1 A;  2E8G A;  3J81 j;  1S72 A;  4DPG A;  4GS3 A;  3J80 c;  4JI4 L;  1EFW A;  1E3P A;  1VQF A;  4DUZ Q;  1MIU A;  1Z47 A;  4DR7 Q;  1HZ9 A;  1I50 H;  3BJU A;  1UWV A;  2MO0 A;  4IPH A;  1SRO A;  4C3I H;  5IYD H;  3E0E A;  4IJL A;  1N36 L;  5K36 G;  2ID0 A;  3PIP A;  4J15 A;  4JI3 L;  2KHJ A;  4LWC A;  5IY0 A;  4JI0 L;  3S2H H;  4X62 Q;  3CCQ A;  1XMQ L;  4AQY L;  4RG1 A;  2JA5 H;  4JYA L;  2EIF A;  3KDF B;  4OON A;  3HOX G;  2UUA L;  3K7A H;  1GVP A;  5J3B A;  4A3C G;  4ME3 A;  3AQQ A;  3RR5 A;  5JJL A;  4R4O A;  3ZJY C;  4PZ6 A;  1M90 C;  4YCV A;  4BA1 I;  4OXP A;  4DV6 L;  5H1S E;  1EIY B;  1WCM G;  3VDY A;  3HOW G;  1WCM H;  2ALY B;  1GM5 A;  1XTD A;  1G29 1;  3AFP A;  3CMA A;  1M1K C;  1EIF A;  2ZJP A;  2UU9 Q;  2VW9 A;  2B63 H;  4LF6 L;  4A3F G;  3RLF A;  5ELN A;  1HNW Q;  4LFB Q;  4HID A;  1A0I A;  5LMU L;  4GKJ L;  1TWC H;  3E9I A;  3CW2 C;  3HFZ B;  1Q1E A;  3RLO A;  4K0K L;  2LSS A;  4GOP B;  1LYL A;  3PO2 H;  3EN2 A;  4LFC Q;  1Q1B A;  4MNO A;  1HR0 L;  3S24 A;  2A19 A;  4IPD A;  4PZ7 A;  5FLX c;  3CXC A;  4DV3 Q;  2E2J H;  4YWK A;  4NPS A;  2PI2 A;  3HKS A;  5IP7 H;  5IYB H;  3I56 A;  4PZ8 A;  2ZM6 Q;  2VQE L;  1XMO Q;  1PH7 A;  1VQL A;  2K50 A;  4L5R C;  1QZH A;  1N32 L;  1QUQ A;  1G6P A;  1I3Q H;  1NE3 A;  1X65 A;  4R1J A;  3T1Y L;  4BY7 H;  3M7N A;  1RIP A;  1X3G A;  4XIG S;  4DK3 C;  3K7U C;  3KLW A;  1L0W A;  1PH8 A;  2XTI A;  1N34 Q;  2R92 G;  4A3L G;  1JJG A;  5M5X H;  2R92 H;  2E2H H;  1KRS A;  2Z6K A;  1XJV A;  4A3G G;  1XNQ Q;  2K4K A;  1NY4 A;  3CCE A;  2HIV A;  4AH6 A;  1ASZ A;  1VQJ A;  3L0O A;  2HHH Q;  1YHQ A;  4DV5 Q;  1HNX Q;  1BKB A;  1WFQ A;  2VY3 A;  2BA1 A;  1XPR A;  3MXN B;  2IHE A;  3TRE A;  3ULL A;  1I94 Q;  3HOZ H;  1YEZ A;  4X64 Q;  3RNU A;  4JI1 L;  3JAM c;  5IE8 A;  4A3E H;  2EXD A;  3UDF A;  1OXV A;  1NJI C;  1K8G A;  1VQK A;  1K3R A;  2K52 A;  1EWI A;  4FDB A;  4YWL A;  2N3S A;  4AYB G;  1B70 B;  1VQ8 A;  3FKI H;  4A3M H;  2K5H A;  3HOU G;  3I7F A;  2OTL A;  4NXM Q;  3AEV A;  2DUD A;  4QQB X;  5C3E G;  3EBE A;  3ULJ A;  2MQH A;  5C3E H;  5AJ3 Q;  1N33 Q;  2HQL A;  3F2C A;  4UP9 A;  4B3S L;  2F4V Q;  1VQ6 A;  4UP8 A;  4DR6 Q;  4GKK L;  1VQE A;  1IL2 A;  3I4M H;  1SE8 A;  5JJK A;  4APV A;  5JEA J;  4JI4 Q;  4PG3 A;  2JA7 G;  3PGZ A;  5ELO A;  1UE6 A;  4JI2 L;  4BY1 G;  1VQC A;  1NTG A;  1YJW A;  1VQA A;  4O2D A;  1PH4 A;  1X54 A;  5LMN Q;  3CD6 A;  2FXQ A;  2N49 A;  1LTL A;  1N36 Q;  1FJG L;  3HOV H;  2ZJR A;  2UUC L;  4P75 A;  2I5M X;  1XMQ Q;  5C0X J;  5GRO A;  1VQD A;  3WWV A;  4AQY Q;  2MO1 A;  1E1T A;  1OTC A;  3OW2 A;  2JA6 H;  2YTV A;  4H02 A;  3S15 H;  1GKH A;  3UDI A;  3GTM H;  5DLQ E;  2B29 A;  2NN6 I;  5IP9 G;  4UY8 C;  4JOI A;  3F2B A;  4DV6 Q;  1GD7 A;  2I0Q A;  2JA8 G;  2D62 A;  2JA8 H;  1L1O C;  3DLL A;  3I4N G;  4QL5 A;  3D31 A;  3AFQ A;  3U4Z A;  3PSI A;  1P8L A;  5FJ8 G;  1PVO A;  5GQO A;  3UDX A;  5FJ8 H;  1HZC A;  1Y1V H;  1PH3 A;  2D0P A;  1HNZ L;  4LF6 Q;  4WJ4 A;  2CWP A;  3KF6 A;  2GVB A;  5GAG C;  4LUO A;  1C0A A;  4LF7 L;  1Q81 C;  4GKJ Q;  5LMU Q;  3PF4 A;  2NZH A;  3A74 A;  2JEA I;  3CCS A;  3STB C;  1PV4 A;  4K0K Q;  3ER0 A;  3CCR A;  1HR0 Q;  4QIW E;  4P73 A;  3KOJ A;  1KRT A;  1WI5 A;  4LNQ A;  3NEL A;  1UE1 A;  2GVA A;  1CKM A;  2HT1 A;  2OQ0 A;  1WOC A;  2WB1 G;  3ERS X;  2VQE Q;  2IX1 A;  2AMC B;  3S2D H;  3CPF A;  1CKN B;  1VQP A;  1R9T H;  1HZB A;  3ICE A;  4BA2 I;  3HOY G;  4NXN Q;  4ALP A;  3M4O H;  1HZA A;  1SRU A;  4IOC A;  1E1O A;  2VZA A;  3Q8D A;  3J7A 5;  4WJ3 M;  2PQA B;  1P16 A;  2Y0S G;  3IRB A;  1G51 A;  3GTJ H;  2R7D A;  2WFW A;  1UEB A;  4A3I G;  1TWA H;  4JI8 L;  4A3I H;  2OQK A;  1JJC B;  2WP8 J;  5IYD G;  3RN5 A;  1K0R A;  3PF5 A;  3GTG H;  4A3K H;  1PA6 A;  2EQS A;  4O0A A;  1K73 C;  4AIM A;  4A75 A;  2NVY H;  4YY3 L;  4HJ8 A;  4OO1 I;  4JI1 Q;  2JA5 G;  4HJ9 A;  3K0X A;  2Z0S A;  1CSQ A;  3KDF A;  4EX5 A;  4YHH L;  4DV4 L;  3H15 A;  1Q8K A;  1IXR A;  2NN6 G;  5C44 H;  4DV1 L;  1KIX A;  4DR4 L;  1JMC A;  4JI5 L;  1DGS A;  3HKZ E;  1OXX K;  4YWM A;  1A62 A;  4JG2 A;  2B63 G;  1TWH H;  2CQO A;  4TQU S;  2ZTC A;  2UUB Q;  3KJO A;  4OX9 L;  2NZO A;  1KHI A;  4B3S Q;  2WAQ E;  3GTK H;  4GKK Q;  5C4J H;  1J6Q A;  3TS0 A;  2ZTD A;  1MJE A;  4JBJ A;  3F2D A;  5HGQ A;  5JJI A;  4JI7 L;  3PO2 G;  4DAM A;  4GOP A;  2E5L L;  5EAY A;  4JI2 Q;  5HY6 A;  1YJ9 A;  1IBK Q;  1VS0 A;  1EUJ A;  4PMW A;  1OXT A;  5BR8 L;  1PH5 A;  4NB3 A;  1Q12 A;  5IP7 G;  5IYB G;  3S16 H;  2ASB A;  3GTP H;  4YCU A;  3NEM A;  1PYS B;  4GLX A;  3RZO H;  3G71 A;  4BY7 G;  3KJP A;  1U0L A;  2UUC Q;  3GTO H;  4DR3 L;  3GO5 A;  3W1B A;  4DUY Q;  3KYH C;  3J81 i;  2PNH A;  4OWW B;  1UE7 A;  1VQG A;  3GD7 A;  2YTY A;  4GNX C;  2RHS B;  2UUA Q;  4B3R L;  4LF8 L;  1I6H H;  3CCM A;  1Q86 C;  1NMF A;  5IYC G;  2QEX A;  3S1R H;  5M5W H;  2IX0 A;  5IYC H;  1SFO H;  1VQ5 A;  1YHA A;  4QJF A;  2Q2U A;  1HNZ Q;  1VQO A;  4BBS H;  4HJA A;  4L5Q A;  2AWO A;  3G6E A;  4B3T L;  3HOZ G;  4OO1 G;  4A3D G;  5FLM G;  4LF7 Q;  2B3G A;  1GO3 E;  5FLM H;  4A3E G;  4LF5 Q;  4LFA L;  4A3D H;  1SMX A;  4A3J H;  1IYJ B;  1YIJ A;  4LF9 L;  1VQ4 A;  1L1O B;  3S17 H;  2JEB I;  1VQI A;  3CC4 A;  3FKI G;  4X65 L;  3S1N H;  4A3M G;  4BXX H;  1YI2 A;  3CME A;  1C9O A;  3DM3 A;  3I4O A;  4GN5 A;  4HJ5 A;  3T1H L;  1JB7 A;  1SLJ A;  1XPO A;  2VNU D;  4A93 H;  3H0G H;  5IT9 c;  3S1Q H;  2GN5 A;  2YYZ A;  2AWN A;  5LMN W;  4QGU A;  2LXJ A;  3TEH B;  3I4M G;  2BH2 A;  3I55 A;  2QGQ A;  1X56 A;  2RCN A;  3SGI A;  4QY7 A;  4JV5 L;  1MKH A;  1HH2 P;  2I5L X;  2C35 B;  2R6G A;  4POG A;  2ZJQ A;  2VUM H;  4JI8 Q;  3L2P A;  4IFD J;  2KEN A;  1BVS A;  4POF A;  3M4P A;  4JI6 L;  3KF8 B;  4X6A H;  3HOV G;  3NBH B;  1NMG A;  4JI0 Q;  4JI3 Q;  4YY3 Q;  3H3V H;  3PUX A;  3MEF A;  2MNA A;  4JYA Q;  2UU9 L;  2KCM A;  2JA6 G;  1IBL L;  2UXB L;  1FL0 A;  3J80 i;  1SR3 A;  5GAD C;  4YHH Q;  4OWX B;  3U50 C;  1VQB A;  4DV4 Q;  4DK6 C;  4DR4 Q;  1YNX A;  2OCE A;  3LGJ A;  4DV1 Q;  4R4Q A;  1N8R C;  2K5N A;  1AE3 A;  1YVC A;  1EQQ A;  5IWA L;  1PHJ A;  2RHQ B;  4JI5 Q;  1HR0 W;  4A3B H;  4LFC L;  1Y1V G;  2VL6 A;  3L7Z C;  4DR2 L;  4OX9 Q;  3D0F A;  4DR5 L;  3AYH B;  4JC0 A;  4DR1 L;  4Y7N H;  1PYB A;  2Z6K C;  3JC6 6;  4C3J H;  4Y52 H;  2K5V A;  4AYB E;  4JI7 Q;  1QVF A;  2HIX A;  1U5K A;  2E5L Q;  4L5S A;  2IY5 B;  4LUZ A;  1PH6 A;  3RLN A;  1KD1 C;  5BR8 Q;  1AE2 A;  1VCI A;  4P74 A;  2PI2 E;  4RMF A;  1AH9 A;  3PV0 A;  5JEA G;  3G4S A;  1X3E A;  1CKN A;  1N32 Q;  3J7Z C;  1Z9F A;  3STB D;  3T1Y Q;  4DR3 Q;  2JJQ A;  2XGT A;  3F1Z A;  3RZD H;  4P71 A;  3M85 A;  1XNR L;  2Q2I A;  4JCV E;  4DNI A;  4DV0 L;  1MJC A;  1KC8 C;  2YV5 A;  4DV5 L;  3OTO L;  3CCL A;  1H95 A;  2R7Z H;  1L2F A;  4B3R Q;  2PQA A;  5C0X G;  1VQ9 A;  5E7N A;  2RF4 A;  1T9H A;  1CSP A;  4BBR G;  2F3I A;  4BBR H;  4L5T A;  4A3K G;  4B3M L;  1IBM L;  4B3T Q;  1X55 A;  1IZ6 A;  4DV2 L;  4GNX B;  2UXD L;  1A8V A;  3K81 C;  4UP7 A;  4DAY B;  4LF9 Q;  2Q2H A;  5AJ3 L;  1N33 L;  1X6O A;  5M3F H;  3PO3 H;  1YJN A;  1QVC A;  5C44 G;  1ASY A;  2UXC L;  2Q2T A;  4OWT B;  5GAH C;  2AHO B;  2NVQ H;  3T1H Q;  2E2I H;  1VQM A;  2NVT H;  4HIK A;  3E9H A;  3BZC A;  3S1M H;  1V9P A;  2F52 A;  1X3F A;  3BU2 A;  3GTL H;  4R4I A;  3CCU A;  3FHW A;  3JAM i;  3PIO A;  3FP9 A;  3CCV A;  5LMN L;  2NVX H;  4JOI C;  2VQF L;  4GLA C;  3K8A A;  3PUY A;  1B8A A;  1Q46 A;  2CCZ A;  4JV5 Q;  4GN4 B;  1A63 A;  2CWA A;  3W5O A;  1TWF H;  4JBK A;  1Y14 B;  1FVI A;  2WB1 E;  3CAM A;  1O7I A;  3CP0 A;  3PUZ A;  4X66 L;  3HOX H;  1PH9 A;  4DV7 L;  3A5Z B;  1JT8 A;  4A3C H;  1LM0 A;  4JI6 Q;  1HJP A;  1W3S A;  1FJG Q;  4C3H H;  1KAW A;  3PUW A;  1C7Y A;  3H3V I;  3HOW H;  2D0O A;  2V1C C;  1IBL Q;  2UXB Q;  1KXL A;  1CKO A;  2Y0S E;  2DGY A;  4A3F H;  1E7Z A;  1WYD A;  1EYG A;  2YU9 H;  1B7Y B;  3EIV A;  4IPC A;  5IWA Q;  4LF4 L;  1PH2 A;  2BA0 A;  1Y1W G;  4BBS G;  4DR2 Q;  1Y1W H;  4KHP L;  4LUV A;  4DR5 Q;  1J5E L;  1JJ2 A;  3UE1 A;  1YIT A;  3W1G A;  4DR1 Q;  3S14 H;  3ULP A;  4GN3 B;  2ATW A;  4A3J G;  1YHB A;  3CQZ H;  3U4V A;  1QUQ B;  1QVG A;  3CC7 A;  1L1O A;  4A76 A;  1OXU A;  3OYY A;  4NXN L;  4BXX G;  2ES2 A;  1KQS A;  1YBY A;  2IHF A;  1BBU A;  2I5H A;  4A3L H;  1QZG A;  4KLK A;  1E24 A;  4A93 G;  3H0G G;  5GAE C;  4DUZ L;  4A3G H;  1EQR A;  2BH8 A;  1X9N A;  4DR7 L;  1RL2 A;  1WJJ A;  1Q7Y C;  2LXK A;  2R7F A;  2JK8 A;  1XNR Q;  2K14 A;  2AKW B;  2IT1 A;  4DV0 Q;  3OTO Q;  1EOV A;  4IFD I;  1PH1 A;  4KHZ A;  4R4C A;  3PCO B;  2A1A A;  3RN2 A;  1UE5 A;  1D7Q A;  2KBN A;  4X62 L;  1E22 A;  2VUM G;  4IPG A;  3GTQ H;  2R93 H;  5C0X I;  4UPA A;  3UE0 A;  2MFI A;  4R4T A;  2YTX A;  1K9M C;  1I5F A;  4B3M Q;  3UDG A;  1IBM Q;  4LW1 A;  4DV2 Q;  4GOP C;  2UXD Q;  3CF5 A;  1OXS C;  3B6Y A;  4TVA B;  3HOU H;  3KFU A;  5M3M G;  4MZ9 A;  5M3M H;  2R93 G;  2PMZ E;  2UUB L;  4HJ7 A;  3M3Y H;  2UXC Q;  3A5U A;  1HNW L;  2JA9 A;  4LFB L;  1D8L A;  2CKZ B;  2OWO A;  4A3B G;  3TQY A;  1SN8 A;  3J81 c;  2JE6 I;  2OTJ A;  2JA7 H;  2A8V A;  1IBK L;  1NBW A;  1W2B A;  4BY1 H;  3I2Z A;  4DV3 L;  4XTC S;  1PFS A;  2ZTE A;  4YCW A;  2ZM6 L;  2VQF Q;  1K8A C;  3K80 C;  1XMO L;  1VQN A;  3M9B A;  1N9W A;  1K83 H;  3NEN A;  1YZ6 A;  4DUY L;  4X66 Q;  4JBW A;  1N34 L;  2CFM A;  5C4X G;  4HIO A;  4DV7 Q;  5C4X H;  4GLV B;  1LUZ A;  3U58 A;  1V1Q A;  5IP9 H;  1XPU A;  1BBW A;  1XNQ L;  3CPW A;  1KL9 A;  4IJH A;  1FGU A;  2QA4 A;  3I4N H;  2KCT A;  3HKZ G;  4IFD G;  1VQH A;  3TRZ A;  2HHH L;  2KHI A;  4KI0 A;  4HIM A;  1V43 A;  3GDE A;  1TWG H;  3CCJ A;  1HNX L;  2R7Z G;  3KF6 B;  2JQO A;  4P72 A;  4LF8 Q;  2WAQ G;  1I94 L;  4LF5 L;  3G48 A;  4A4I A;  4X64 L;  4LF4 Q;  1JE5 A;  4C2M H;  2N8N A;  4MTN A;  5M5Y H;  3PUV A;  4KHP Q;  1S3O A;  4EQ5 A;  1J5E Q;  4IOA A;  1CUK A;  4IO9 A;  3A0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...