4BBSG

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbsG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bbsG01
3EBEA 2OQ0A 5AJ3Q 5IE8A 1J5EQ 2NN6G 4OONA 4YWMA 1S40A 4JI2Q 3OTOL 1WCMG 4UPAA 1VQDA 3J7ZC 2KCMA 4DPGA 1FJGQ 4JYAQ 1UE1A 5JJKA 4JI6Q 1L1OC 2D0OA 2LSSA 1LUZA 2RHQB 3KJOA 1V9PA 4DR5L 2D0PA 1EYGA 2JA8H 3Q8DA 3TRZA 3UDIA 3K7AH 1PH7A 4JBKA 1D7QA 5M3MH 3CCJA 3RR5A 1VQ9A 2OWOA 4LF5Q 3J81j 1L2FA 3HOZG 1Y1VH 4IJLA 1IBKQ 2MO1A 2HIXA 3K0XA 3CPFA 4LWCA 3PUWA 2OQKA 3MXNB 5M5XH 4GOPA 1VQOA 2NVXH 2EQSA 2HHHL 2UXCQ 1KQSA 3TS2A 2F4VQ 3CAMA 3EN2A 5C4XG 4YWLA 4QY7A 5IY0A 5GAEC 3CW2C 4EX5A 1HNXQ 1I94L 4X6AH 2VZAA 3K7UC 4LFCL 3W1GA 2A8VA 1N32L 5IYBH 4DV6L 3M85A 2AHOB 1EQQA 2RCNA 5M5WH 4LUVA 4OWTB 1MJCA 2ZTDA 2K5HA 3FP9A 1WFQA 3BZKA 4IPHA 3S16H 4GN4B 4YY3Q 2XGTA 1HNZL 2LXJA 1JB7A 4GS3A 3RNUA 1YI2A 1SROA 1YVCA 3D31A 1CSPA 4IO9A 4JI1Q 1V43A 2PI2E 1X9NA 2UUBQ 3AEVA 5GROA 2QEXA 4X65L 2E5LQ 4BY7G 4AYBG 5JJIA 1N33L 2Q2TA 4POFA 1X54A 3CP0A 1HZCA 3GTJH 4GOPC 3KF6A 3H0GH 2K5VA 3M3YH 1X56A 2CWAA 2KHIA 4LF9Q 2UXDQ 3HFZB 1E3PA 3SGIA 2MNAA 1NJIC 4JBMA 1X3GA 4B3SL 4GNXB 3PO2H 4LF4L 2DUDA 2CFMA 1SFOH 2R93G 1N9WA 1L0WA 2ZJRA 2IY5B 4A3DG 1YJWA 5HY6A 3AQQA 1QUQA 1HZAA 4DV4L 4C3HH 4DV7Q 1Y1WH 4LFBQ 5IYDH 1FVIA 3KJPA 1XJVA 1YHBA 4A3KH 3TS0A 2IX1A 2RHSB 3NENA 4LNQA 3S14H 4R1JA 1PH5A 4YCVA 3KOJA 1HNWL 1H95A 2AWNA 1PVOA 4OO1G 4L5RC 1A62A 1E24A 3A5ZB 2HQLA 3GTOH 1WOCA 5JJLA 2VQFQ 3H3VI 4JI4L 2Z6KC 4XIGS 3OW2A 4JYAL 1JE5A 1CKNA 1UE6A 1VQPA 2E2IH 3E0EA 2N8NA 4LW1A 4HJ7A 4DNIA 3RN5A 1C9OA 1KRSA 3RLOA 1M1KC 3W1BA 2CQOA 4GLXA 3T1HQ 2R7ZG 2CKZB 1AE3A 1V1QA 4O2DA 1HH2P 3J81i 3JAMc 4DR3Q 2B63G 4BA1I 4C3JH 2N78A 3RN2A 1JJ2A 2I5LX 1QVGA 1X3EA 1AE2A 1N36Q 4EQ5A 3ER0A 2R92H 3FKIH 3K80C 3PUXA 1DGSA 5M5YH 1YHAA 3GTKH 1TWHH 4BBRH 1VQKA 1JT8A 1G51A 2NVYH 4JI0Q 2UXCL 4HIMA 4GKKL 3KYHC 1I3QH 3U4VA 4PMWA 1IBML 1HNXL 4A3LG 4IOCA 2YTYA 4JC0A 3WWVA 2UU9Q 1GO3E 3BJUA 4GN3B 3CXCA 2JA6G 2ZJQA 4BXXH 2IHEA 2MQHA 3F2CA 1XPUA 4R4IA 4GLVB 1X55A 3H15A 3HOYG 1E7ZA 1K3RA 1A8VA 4NB3A 4JI8L 1AH9A 2BH8A 1XMOQ 1RIPA 3PO3H 5LMUQ 1BKBA 4A3FH 2ES2A 4DUYQ 1IZ6A 1PFSA 2F3IA 3L0OA 1VQCA 4HIOA 5IP9H 2Z0SA 1VQ4A 3I4MH 4WJ4A 1PA6A 4B3RQ 3I2ZA 4AQYQ 4KHPL 1Q1BA 1GD7A 4TVAB 4K0KL 2VY3A 1HR0L 1QZHA 4IPGA 4BA2I 4IFDI 2UUAQ 2JK8A 1W3SA 1UE5A 4A3BG 1GVPA 1R9TH 3F2BA 1OXVA 1OXXK 1Z47A 5C4JH 4DKAC 2JA8G 1IXRA 2JA9A 2K5NA 1CKMA 1WJJA 2PQAA 1I50H 3L7ZC 4AH6A 1GM5A 2A19A 2BH2A 3HOUH 2VNUD 2MO0A 4QJFA 3HOXG 4A75A 1K73C 2I5HA 3PIOA 1HJPA 1Y1VG 4A3IH 4NXMQ 4DV2Q 1K9MC 1EWIA 1P8LA 1TWFH 1KD1C 4DV0L 4DR2L 4HJ9A 1PH8A 5BR8L 1XNQQ 5FLXc 1WYDA 3ERSX 2VQFL 4DV1Q 1BVSA 2K50A 3M4PA 3AFQA 2BA1A 3CCMA 1SMXA 2B3GA 3U50C 3A5UA 4XTCS 2KBNA 2L15A 3S1MH 4B3TL 2WAQG 4MNOA 3K81C 4DV5Q 1KC8C 4A3JH 2YU9H 2N3SA 2ZTEA 4R4TA 1YIJA 2ZM6Q 1TWAH 2ZJPA 1X3FA 5IWAQ 1S3OA 4DR1Q 4BBSG 2EIFA 4L5TA 4IPDA 1PYBA 1E1TA 1Q12A 2CCZA 3GTLH 4JI0L 2QGQA 1SLJA 3NELA 1VQIA 5JEAJ 1PH2A 4UP9A 2YV5A 1WCMH 2Q2IA 2UXBL 1K83H 1EIFA 1MKHA 2VL6A 5IP7H 4LFAQ 1YITA 1A63A 3F8TA 4DR7Q 1O7IA 3J81c 3DM3A 4X62Q 1S72A 2Z6KA 2I0QA 2GVBA 3M9BA 1RL2A 2KENA 4A4IA 5IYDG 1Y1WG 1HR0W 1VQMA 3HOWH 1Q81C 2JJQA 4DUYL 4A3KG 4KI0A 1VQ5A 3HOZH 4X64Q 5FJ8G 4POGA 4PG3A 1Q86C 2JA7H 3PF4A 4AQYL 4JV5L 4NXNQ 4C2MH 1HZBA 4IFDJ 3I7FA 4DV3L 4X66Q 4QIWE 5C44H 3I4OA 3RLFA 2ALYB 3OYYA 1KRTA 3CC4A 4OX9Q 2YYZA 2VW9A 1Q82C 3J80i 4DUZQ 3PUVA 3PUYA 3ICEA 1XMQQ 3BU2A 1CKNB 1CKOA 1TWGH 4DAYB 5AJ3L 2UUCQ 4MTNA 4GKJQ 1J5EL 2VUMH 3VDYA 3UDXA 3KFUA 5DLQE 2NZHA 4JI2L 2IHFA 4JI7Q 4A3MH 4LF8Q 4NXML 1FJGL 1N34Q 1OXTA 1SE8A 2PMZE 2WP8J 4RG1A 1VQ7A 4JI6L 3RZOH 4DR6Q 4A3GH 1SRUA 5LMNQ 4UP7A 1Q8KA 1MIUA 1KAWA 1ASYA 3UE1A 2F52A 1PH6A 4LF5L 4DV1L 1Q1EA 2WAQE 2B29A 3KDFA 4YHHQ 2A1AA 3G48A 3IRBA 4GNXA 2OTJA 2XTIA 1VS0A 3HOVG 2ID0A 2E2HH 1IBKL 4LF7Q 1U0LA 4QL5A 5J3BA 4PZ6A 4DR5Q 3JC66 1N8RC 3PF5A 2OTLA 1Y14B 3S2HH 2F4VL 2JA5H 2FXQA 4DAMA 3I56A 3CPWA 2N49A 4A3FG 2MFIA 3ULPA 1CSQA 1P16A 4A3CH 3I4MG 5C3EG 1IBLQ 1A0IA 2GN5A 1L1OB 3AYHB 3S15H 1XPOA 4APVA 4GN5A 3KLWA 4JBJA 5JEAG 1PH3A 5FLMG 5M3FG 2DGYA 4YY3L 4LUOA 3I4NH 3G4SA 1VQGA 2BA0A 2WB1G 1JMCA 4B3MQ 5IYCH 2UUBL 4JI1L 1YJ9A 4GNXC 4LFAL 4P75A 1G291 4HJ8A 4LFCQ 4IJHA 1N32Q 1KL9A 4DV6Q 2E5LL 4X62L 3PGZA 3S24A 1B7YB 3KF8B 4A3IG 2PI2A 2Y0SG 3PIPA 2LXKA 3HKZG 1VQLA 1EIYB 4LF9L 2UXDL 1I5FA 1G6PA 1QVFA 4IFDG 1FGUA 4X65Q 4BY1H 1GKHA 4NXNL 2ASBA 1EOVA 1I6HH 4C3IH 4DK6C 5M3MG 4PZ7A 4JOIA 3I55A 3STBC 3B6YA 5ELOA 4DV7L 4LFBL 2Q2HA 1VQAA 4LUZA 5C0XI 4DUZL 4A76A 1NMGA 1YZ6A 3ULLA 2E2JH 1T9HA 3CF5A 4LF4Q 1OXUA 3CCEA 4HIDA 2UUCL 4A3JG 4J15A 4A3EH 3TEHB 2YTXA 3GD7A 4DV4Q 5GAHC 4GOPB 4LF8L 1NBWA 4JCVE 1N34L 4A93H 3ZJYC 4DR6L 2RF4A 4Y7NH 4WJ3M 2D62A 1HZ9A 1VQJA 2NN6I 5IYBG 3DLLA 4P73A 2ATWA 2PNHA 1HNWQ 1UE7A 3T1HL 2JEAI 1OXSC 2YTVA 4YHHL 4DR3L 3J80c 1EFWA 3CMAA 4JI5Q 4LF6Q 2V1CC 4JI4Q 3G71A 3M7NA 1SR3A 4A3BH 1LM0A 4R4OA 1XNRQ 1E1OA 5IP7G 3UDFA 4JOIC 1VQ6A 1N36L 4LF7L 4P71A 2IT1A 3ULJA 1NY4A 4H02A 1PV4A 3H0GG 3HOXH 3HOWG 2AWOA 2Q2UA 4AIMA 1NMFA 2UU9L 3PO2G 1IBLL 3KF6B 2WB1E 4HIKA 4TQUS 1LTLA 3PV0A 3L2PA 2NZOA 3STBD 4JBWA 2KCTA 3T1YQ 1PYSB 1VQFA 2JA7G 3GTGH 5C44G 1ASZA 2HIVA 4UY8C 5GQOA 4IPCA 4GKKQ 2VS1A 4R4CA 4B3ML 3EIVA 3AFPA 3MEFA 1XMOL 1QVCA 5E7NA 2K4KA 5LMUL 1IBMQ 1QUQB 3NEMA 4GLAC 5IT9c 1NTGA 2Y0SE 3HKZE 4RMFA 4B3RL 1YEZA 1EUJA 2VQEQ 1EQRA 3W5OA 4KLKA 2JEBI 3G6EA 1IYJB 3CQZH 1PHJA 4JI3Q 3NBHB 2VUMG 4DR4Q 4FDBA 4ME3A 5ELNA 4JI8Q 2UUAL 4IOAA 3S17H 1YJNA 4A3MG 5C4XH 2ZTCA 3CCVA 4ALPA 2R7DA 4A3GG 2EXDA 3GO5A 3D0FA 4QGUA 2K75A 1XPRA 4BBSH 3E9HA 1FL0A 4HJ5A 2I5MX 1YHQA 1C0AA 3GTQH 1TXYA 1BBUA 1Z9FA 3CCSA 2QA4A 3J7A5 1PH1A 2HT1A 4KHPQ 1HR0Q 4K0KQ 3TREA 5C0XJ 1M90C 1PH9A 3UDGA 1KIXA 2JE6I 1K8GA 3CCRA 3KDFB 4DV2L 2R92G 1KXLA 3S1QH 4YCUA 2IX0A 1X65A 3FKIG 2OCEA 4L5SA 3RZDH 4BY7H 1E22A 2R7FA 4BBRG 5LMNW 1XNQL 2JA5G 4UP8A 2AKWB 3OTOQ 4NPSA 4A3CG 3PSIA 4OO1I 4P72A 5FJ8H 4HJAA 4P74A 3TQYA 5HGQA 1PH4A 4BXXG 1UEBA 3GTMH 2K14A 4DV0Q 2R93H 3F2DA 2E8GA 4DR2Q 2NVTH 4A3DH 1WI5A 2JQOA 4DV5L 1B8AA 4MZ9A 4JI5L 5BR8Q 4LF6L 2NVQH 3I4NG 1LYLA 5IYCG 3PO3G 4O0AA 1XNRL 1XTDA 2ZM6L 5IP9G 1Q7YC 5IWAL 1TWCH 3A74A 4R4QA 4DR1L 1K8AC 1B70B 3FHWA 4B3TQ 4YWKA 1JJCB 2AMCB 1VQ8A 1BBWA 3CMEA 1W2BA 4OWWB 2HHHQ 3CCLA 1VQNA 1MJEA 3CC2A 4OWXB 4L5QA 3S2DH 3T1YL 1I94Q 1Q46A 4BY1G 4DR7L 3H3VH 4DK3C 3E9IA 2R7ZH 3HOUG 3U58A 2B63H 3F1ZA 4JG2A 1K0RA 1HNZQ 5H1SE 2PQAB 2KHJA 5GAGC 3CCUA 4Y52H 1VQEA 2UXBQ 4X64L 3HOVH 1X6OA 3PUZA 1QZGA 1C7YA 3HKSA 2VQEL 1J6QA 4A3EG 4JI3L 1VCIA 5GADC 1N33Q 4DR4L 4QQBX 3M4QA 4X66L 1KHIA 5EAYA 4AYBE 3A0JA 3S1RH 3GDEA 3M4OH 3UE0A 2C35B 4OX9L 1L1OA 3LGJA 3U4ZA 3CD6A 4A93G 4YCWA 1IL2A 1VQHA 1U5KA 4A3LH 5C3EH 2JA6H 3CCQA 2WFWA 4B3SQ 1XMQL 1CUKA 1YNXA 3GTPH 3CC7A 4JV5Q 3PCOB 4OXPA 5C0XG 5FLMH 3RLNA 4PZ8A 2CWPA 3BZCA 5M3FH 4DV3Q 4GKJL 4KHZA 3HOYH 5K36G 1OTCA 4JI7L 3S1NH 1UWVA 2R6GA 2GVAA 3JAMi 2H5XA 2K52A 1D8LA 1JJGA 1NE3A 1SN8A 3K8AA 1VQBA 5LMNL 1YBYA
chains in the Genus database with same CATH superfamily
5CA1F 4QUFA 4CDCC 4JI2Q 2PMZA 1WCMG 4UPAA 1VQDA 4YQWA 4DPGA 3TZUA 5C44B 1K0SA 3BG5A 2XWBB 4JI6Q 1L1OC 2D0OA 5T14A 2EYPA 1V9PA 1LTSD 4ED1A 2WAQA 5M3MH 3RR5A 4LF5Q 3PW2A 1RD9D 1IYVA 1OWTA 1SSOA 2YZMA 3RIZA 1W6JA 1Y1VH 3MFGA 2VUMB 3GV6A 3AB9A 1IBKQ 2HIXA 3K0XA 2IMWP 3I70A 2PZTA 4LWCA 4GOPA 3A8IE 3I90A 1VQOA 2NVXH 2IJ0A 2HHHL 3GTJA 1KQSA 1IHZA 3CAMA 2EY6A 4YWLA 4MTDA 4QY7A 3RB4A 5GAEC 1PTOD 4EX5A 1HNXQ 2LS01 2VZAA 3W1GA 4DV6L 3PR5B 2EXZA 1SFOA 1EIHA 1KLUD 3MWMA 4ZRZA 4GN4B 4LJZC 3K3VA 2ZDGA 2LXJA 2BOSA 4TSSA 4APMA 2CZGA 1YI2A 1YVCA 4V0BA 1U4LA 4X3TA 1BOSA 5KGUA 4BY7G 2E5LQ 4KD4A 4AYBG 2K01A 1TR5A 3CRKC 1LTAD 1N33L 1N48A 4JI4H 2FINB 3GTJH 3BA9A 2FLPA 1WTHA 2ZM6H 5IGDA 4FF2A 2CWAA 4LF9Q 2E2IA 2MNAA 3PO2H 1W6KA 1X3GA 4E4TA 2JSOA 2PPBC 1SFOH 4ZK9B 1L0WA 5DLFA 3QZ7A 1BDOA 3PW5A 1HZAA 1DJRD 2RDGA 4C3HH 2J9GA 4LFBQ 2L0CA 5IYDH 4ZI7F 1FVIA 2B8FA 3A8KE 5CMDA 3TS0A 2GPWA 3NTKA 2H4OA 3NBHA 1PH5A 1QNKA 3KOJA 4MN3A 2NVYA 2CH4A 2JEJA 1E24A 5JJLA 3BYYB 3H3VI 2ATLA 1KNEA 3OW2A 4ABNA 2G5DA 1JE5A 1UE6A 3HGBA 5EKLA 3S1RB 2VQEH 2E2IH 4LW1A 3RN5A 4JI3H 4DNIA 4FF3A 1C9OA 4EGJA 1B6RA 1IOVA 2WIIB 3GTPB 3JAMc 2VOBA 4BA1I 2N78A 4C1NK 3RN2A 2I5LX 1QVGA 3GLKA 1N36Q 4EQ5A 2QK4A 2W6NA 4MA0A 3VA5A 1YHAA 2OH2A 4NKLA 4BBRH 1SEBD 1BBXC 1JT8A 1PFBA 2NVYH 4JW0A 4JI0Q 4O4LF 5FD6A 1LT6D 2AQ3B 4IOCA 4V190 4OHJA 1GO3E 3BJUA 3CXCA 3RMHA 3Q23A 4RNNA 3MR6A 2MQHA 4FXKC 3F2CA 2EZVA 4GLVB 1GUOA 4QW8A 3HOYG 1E7ZA 1ZYRC 1SE4A 4CKCA 3S9WA 4WRDA 2J7ZA 4CGYB 1XMOQ 4MV9A 1I4PA 3BVGA 1IZ6A 2Z0SA 1VQ4A 3I4MH 4TKOB 4IQZA 1ILQA 1SYCA 1IW7D 1STGA 1DOLA 4AQYQ 3NQIA 1TY2A 5JEAH 2RVLA 4K0KL 1WTVA 3K3PA 4XZ3B 1WD0A 4YB8B 1QZHA 4BA2I 1EOTA 3M7GA 3C1FA 4A3BG 1GVPA 5ELFA 4M1UB 2ZJTA 1Z47A 1ESFA 2J0TD 3LWUA 1V1OA 1K8OA 1G6ZA 2PMZB 2ZDHA 1JOKA 3JSNA 2HHHH 4K6DA 1LT4D 1MHWC 1WJJA 2F0EA 2SCUB 5IYZF 2VNUD 1K73C 2I5HA 4K8IA 4A3IH 4NXMQ 2RGVA 2EJGC 1GHKA 4J9OA 3NTHA 5JJZA 3BVMA 4DV0L 2GLTA 3C0FB 4DR2L 1FR3A 4HJ9A 1O78A 1QNUA 2KVMA 3ERSX 2VQFL 4IWXA 1TS3A 4I7HA 4RFBA 3M4PA 2EOTA 5KEEA 5JUMA 4ED0A 1N33H 2PQEA 4EQPA 3A5UA 2KBNA 3RV3A 3S1MH 5DG9A 2EYLA 1NR2A 1EWHA 2W6QA 4TQRA 3BQ1A 1Q3LA 4BY7B 2N3SA 3RFCA 5BPHA 1I6UA 2F0JA 4EEYA 1YIJA 5KT5A 1AN7A 3K6OA 1X3FA 5IWAQ 1S3OA 2RA4A 5KYLA 5JOBA 1HCZA 2W71A 2QGQA 2AGOA 1SLJA 3H4BA 2NTTA 4RCOA 1VQIA 4DXFA 3BAAA 2AGPA 4UP9A 4B9WA 4HEDA 4JK1C 2A5HA 1YNJC 1EIFA 2NVQB 2VL6A 5KFMA 4LFAQ 3FPUB 4A2BA 4G7HC 5KFAA 3DM3A 4X62Q 1TWCB 3M9BA 4GZYC 2FLLA 1RL2A 2F0IA 1E2WA 2PZUA 1HR0W 3MXNA 4A3KG 4DUYL 2K1BA 1Q81C 4O3RA 1ET9A 1RKNA 3HOZH 2WE6A 3R93A 4QWEA 4POGA 3TP5A 4PG3A 3PF4A 4JV5L 1X3QA 1NAPA 2PW5A 4IFDJ 2C00A 1SXTA 3J80W 2F0DA 3OYYA 3BS1A 4MV7A 4IUNA 4FYDA 3NK9A 2E2HA 1MGSA 3PUYA 3NXWA 4QW9A 2ZXRA 3BU2A 1XMQQ 2JP1A 4KHVA 3OIPA 4GKJQ 4MTNA 3VDYA 3UFXB 3NWSA 4C3JG 1XTCD 4JI2L 2B2UA 1K1SA 2PMZE 3NE5B 3NQTA 4JI6L 4RG1A 3RZOH 1NCVA 1CT1D 3W3AA 5BN5A 4ECZA 3I4MB 1KJJA 3S1NH 1PTOB 4LF5L 5C5JA 4DL4A 2WAQE 3KDFA 4L63B 4JI1H 4GNXA 3I4LA 4Q8FA 2ICIA 3R2TA 1U4MA 1M0WA 2E2HH 1IBKL 3V05A 1ZQ7A 1U0LA 4QL5A 5J3BA 4DR5Q 1H9SA 4QCLA 1N8RC 1I4RA 1JQYD 2NBFA 4FBUA 1EZ6A 2X6GA 3S2HH 1KEEA 4DNTB 1CSQA 1P16A 1IBLQ 4F7XA 2MPMA 4A3IB 3G6XA 3WNZA 4J8QA 3MZ5A 3G4SA 4TUYF 2GPSA 1S97A 5KG1A 1YJ9A 3LWBA 1G291 4IJHA 2E5LL 3VYTA 1GOZA 1EY9A 2VQFH 2KQ3A 1B7YB 4ECYA 3DEOA 3H94A 1K28A 3RF2A 1LV9A 1M0TA 1VQLA 3HKZG 4LF9L 1H9JA 2A6HD 1S9FA 1VBGA 3TIGA 1SYBA 5FO8B 1QVFA 1FGUA 4K8JA 1HQMC 1EOVA 3N41B 4DK6C 4KMUC 4JOIA 3KBXA 5ELOA 4LFBL 1VAJA 1TVXA 3A7AB 1LT3D 2VB3X 3MWEA 1NMGA 4ECWA 5EWGA 1EU4A 2W9BB 5FLXE 3BDOA 2EYMA 4HIDA 2UUCL 4A3JG 1M7JA 1F9QA 5GAHC 2NZ1D 3VYRA 4FO2A 4A93H 1MSGA 4EQNA 4Y7NH 1A9XA 3H0GB 1S0OA 3SHLA 1OO9B 2NN6I 5IYBG 2PNHA 4HN7A 1UE7A 2VXWA 2F0TA 5LMUH 2B2VA 1BNCA 4EFBA 4YHHL 4DUYH 1EY0A 3CMAA 5K36H 1AFPA 2V1CC 4JI4Q 3M7NA 3T56B 1IKLA 4JV5H 5IP7G 3LMLA 1N36L 4MV1A 3G6VA 5KNCA 3N6XA 4A2AA 3KHHA 4E6IA 4A3KB 1EIGA 1NY4A 2UUAH 4HR7A 3S14B 1PZJD 1PV4A 5EGTA 2NN6H 3HOXH 2W8KA 4J9PA 1U9RA 1TS4A 2Q2UA 3T4AC 1L2ZA 2F0UA 3URYA 3J81E 4HIKA 1D1KA 2JA7G 2NZOA 4JBWA 1PYSB 4TV9F 3RTXA 3KTMA 2W8LA 3GTGH 1T5XD 4R8NA 2XSCA 3U9SA 1F2YA 4IPCA 4YJ3F 1XMOL 3AFPA 4HQ6A 4GLAC 1PLFA 1JB3A 1NTGA 3PW0A 4C3JB 5KFVA 1MBYA 1YEZA 2KA7A 2VQEQ 3Q8PB 4JI3Q 1PHJA 4FDBA 4ME3A 2IP4A 4OGQC 5KG7A 3S17H 1IBKH 4DLKA 1I6VC 2D2CC 5C4XH 1TS2A 3S2HB 4A3GG 2KSWA 2A73B 2YS7A 2EXDA 4XX0B 4DV5H 3GTMA 4OIJA 2CVRA 1C0AA 2QA4A 4IZOA 2J6UA 1BCPD 2HT1A 1GUSA 1Z2NX 2XRSD 5C0XJ 3NTIA 4DR1H 4ID6A 2EE1A 1K8GA 3KDFB 3T51B 3KK7A 2R92G 1KXLA 2F0WA 3EQLC 2HD3A 2R7FA 3QG1A 2OLSA 1M4VA 2CQAA 2EYHA 1H9SB 4ED3A 2DIKA 3K5IA 5KFHA 4DR7H 3D4WA 4A3CG 5M9OA 3MWDA 4OO1I 1WTWA 4RZQA 4P72A 1DXMA 3GTMH 1R9TB 1BUVT 2E8GA 3G7LA 4A3DH 1WI5A 2JQOA 1WTPA 1B8AA 3I4NG 4LF9H 4LF6L 2B63A 5IYCG 1RTNA 1XNRL 1XTDA 1STHA 3HOUB 4PNYA 2OT2A 5IWAL 5JVH3 1C30A 3GIJA 2NYZD 4ZAIA 1WVLA 3K5NA 4ME5A 2NWGA 1VQ8A 4LFBH 5D1PA 4OO1H 4OWWB 2HHHQ 4RB2C 3CC2A 1BXRA 4PDBA 4U6PA 4RGOS 4KTAA 1B4OA 1D2BA 2UUCH 2Q8RE 4C3IG 3CHBD 5JQWA 5T1GA 3E9IA 4DK3C 5FD5A 1C4QA 1CA5A 3U58A 2B63H 3D6CA 1F2ZA 4JG2A 3JSLA 4DNRB 1K0RA 2XCPA 4EBDA 4RGTA 4RNOA 3RAXA 3HOVH 1SE2A 5KYIA 1HTLD 3PUZA 1C7YA 3C2PA 4YHHH 3HKSA 3A56A 2D5DA 1J6QA 2DJGC 5GADC 4A3EG 4J0MA 1N33Q 4G4KA 1ZHSA 3HXLA 4FXDA 3M4QA 2O03A 5KFTA 3V6HA 1WD1A 2R3ZA 1L1OA 3LGJA 2C2DA 3FMAA 4A3LH 4K5XA 5C3EH 3PW7A 2WFWA 1XMQL 3KAJA 5F9LA 5FLMH 4GKJL 3BZCA 5M3FH 4KHZA 1KBLA 4N9TA 3GTGB 1UWVA 1TY0A 3VPCA 2K52A 3DMUA 1Q8IA 1NNXA 2RSOA 3DUZA 5J2UF 3K8AA 5KFPA 1ENCA 1XMOH 2M05A 1MSHA 2CW0C 1I4QA 2AUJD 5IE8A 2DN8A 2VQDA 4PMBA 4OONA 4YWMA 4MV4A 1S40A 3H4DA 3V4ZA 3OTOL 4MV6A 1RK6A 1UE1A 2F0NA 2PO4A 1JIHA 3S17B 5KFZA 3OUUA 2LSSA 4DR5L 1EYGA 3R5HA 1H9MA 3GTLA 4JBKA 3CCJA 3J81j 1L2FA 4B9XA 4X65H 2MO1A 3TN2A 5M5XH 1JOQA 1DOKA 1EHIA 3GIPA 5EJWA 3GV7B 1D1IA 2K32A 2VA2A 4LF4H 3EA6A 3WDNA 2EYOA 3K7UC 2L9HA 2A8VA 5BMVF 2WKCA 5J1ZA 1CA6A 1AUVA 1KNAA 1RJTA 2WDTA 4EBCA 5M5WH 1M8AA 3MA2B 1MJCA 4LUVA 2QEJC 3QO2A 3GTMB 2K28A 5KFDA 1HNZL 1K3BC 3D31A 2H1EA 5E1FA 4G57A 1V43A 4JI1Q 5ELDA 3AEVA 3IFTA 3DF7A 2EYJA 5C3WA 4LF6H 1PFMA 5JJIA 2Q2TA 3C1EA 3CP0A 3N6RA 1B3QA 1HZCA 1XNRH 2AQ4A 2K5VA 4HNVA 2EY2A 5A2QE 4FS2A 3HFZB 1ICWA 3OHAA 1NJIC 1TIID 1HXYD 4MTKA 2F0OA 4O4HF 4Z9CB 2R85A 1G2SA 2XGQA 3SE7A 4RH6A 2W9CA 3AQQA 4XXEA 4EBEA 1CM9A 1G91A 4OELB 2B2WC 2L4NA 3J7YW 3H20A 1YHBA 1EYZA 3RV4A 4EGVA 2RSNA 5EKKA 1RJQA 3FKIA 1H95A 1CHQD 5HGTA 5A35A 2AWNA 4I50F 2I46A 1IBMH 4L5RC 2FB9A 2HQLA 5I2YA 2VQFQ 4JI4L 2Z6KC 4RCNA 4PQXA 3H40A 4Q45A 5TSSA 2N8NA 1MZBA 4ED2A 5I47A 3NBIA 1M1KC 4M9UA 2R7ZG 4Q8EA 1V1QA 3NWTA 1PRTD 1VMPA 1JJ2A 1RJPA 4PWQA 4IUVA 2A68C 4I55F 4Q44A 1AE2A 2AQ2B 1O7ZA 3FKIH 3K80C 1F9RA 4K14A 1STNA 5CBEE 3Q24A 1SYXB 3DEPA 3C3LA 3KYHC 1STAA 3U4VA 2O2LD 4C5AA 2W7OA 4JC0A 1BCPB 2ZJQA 4BXXH 2IHEA 3UI2A 2F3VA 1GUWA 1XPUA 4R4IA 5FPRA 4RUAA 1E0BA 2F0QA 4I4TF 3OTOH 2K5WA 1A8VA 4RU9A 2XCAA 2BH8A 3PO3H 5FKAC 3TQ1A 5LMUQ 1W93A 1BKBA 4DUYQ 4HIOA 1UC9A 1VQCA 5IP9H 2MP1A 1PA6A 1TWFA 1GUGA 2V5AA 1GD7A 4ZKBB 5FLXL 2VY3A 3GTKA 4IPGA 1BQQT 2OF1A 5M5XB 4IFDI 2UUAQ 1LABA 1UE5A 4XQNA 3MR2A 5EBCA 4N8FA 4RB0A 3F2BA 4KKSA 4J9LA 2JA9A 1B9MA 2K5NA 4N8X1 2PQAA 3L7ZC 4HMJA 2YU9A 2IL8A 4QJFA 5M5WB 5D8DA 4X3UA 4QWAA 3I12A 1Y1VG 3CQZB 2M9VA 1K9MC 1EWIA 1P8LA 1TWFH 4XQJA 4IFDH 3E5NA 1HNZH 2YRXA 2UXBH 5CV9A 4BBSB 3GTQB 3ND9A 1WCMA 4KV6A 1K83A 3CCMA 3JRWA 3U50C 2B3GA 3KLSA 3KHGA 4XTCS 1UEAB 3J81L 3BDCA 2FMMA 3TQTA 2WAQG 4MNOA 4EYHB 3OHXC 1EY4A 4DV5Q 2YU9H 3R23A 2ZTEA 2HDMA 4U68A 1V8QA 3VA7A 1R4QB 4DR1Q 2EIFA 1PYBA 1E1TA 1Q12A 5IGFA 1EUDB 3NELA 1SMYD 1S5FD 5DM63 2YV5A 4NMZA 2NVTB 1WCMH 2F3WA 1KJIA 2B2TC 1K83H 5C4HA 5I4DA 3F8TA 4DR7Q 2PCFB 3GIIA 1J5EH 1HA6A 1S72A 3ONAB 5DNFA 1TWGA 3FEWX 1FJGH 5LHY1 3EVQA 2KENA 5IYDG 2C28A 5G3LF 1VQMA 1LT5D 4XDXA 2W9CB 3I73A 2W6PA 2F0KA 5FJ8G 5EZYF 2TMPA 1Q86C 4CJ1B 4AYBA 3IN5A 5C1OA 3I7FA 3VYUA 2A69C 5KFNA 1QCBD 4O3SA 1KDBA 2VW9A 2R7ZB 5FOBB 1STEA 1F2LA 3ICEA 4JPBW 4EG0A 1TWGH 4DAYB 2UUCQ 3MXUA 3UDXA 5CV6A 2IHFA 5CV5A 4A3MH 2FK2A 5K2MA 1JCKB 1OXTA 4L6TB 5DGAA 1F77A 5I2XA 3PIO3 4IURA 4ULLA 3JAME 1KAWA 1ASYA 3MR3A 3QOLA 3K5OA 4IRCA 3GV3A 2B29A 4YHHQ 2A1AA 3IRBA 2R8HA 3MHBA 3VR2A 1VS0A 2WV6D 2XC9A 3CU7A 1E2ZA 4HCEA 4PZ6A 3HBLA 5D1OA 5EPJA 2OTLA 2NUAB 1S10A 5KT6A 3Q0AA 4DAMA 3I56A 4ZOLF 2MFIA 3ULPA 2G9HD 3I4MG 1BXTA 1Y69U 1O7YA 2DNCA 1XPOA 4APVA 4GN5A 5JEAG 2F0VA 4DL6A 1LTRD 3NHHA 2HJWA 1PXUA 1YNNC 1TWFB 3R5FA 4R9WA 2BA0A 2DY7A 1JMCA 4X3SA 5M3MB 4JI1L 2L5TA 4K2KA 1CHPD 4P75A 4Y8VB 1VMCA 1KL9A 4XYQA 4ME6A 5HV6A 4QMGA 4FS1A 1Y1VB 3OHBA 2EPBA 1L0YB 1TAEA 3KF8B 3GV8B 4HAEA 2L12A 2BCOA 2NVXB 1SBBB 1KAAA 4A3IG 3N40P 3PIPA 4F4XA 1G6PA 4U673 2KCCA 4X65Q 2ASBA 1ILPA 4LSAA 5LYJF 3I55A 3STBC 5KKNB 5KNBA 2WAQB 1XX8A 4LUZA 4H44C 5C0XI 4A76A 4DUZL 1V4YA 3ULLA 1KDAA 2E2JH 4LF4Q 1DD2A 3ITPA 2EY1A 3CCEA 1PRTB 1S5DD 1CFMA 2FPGB 4ECVA 2O5IC 2HQEA 4DV4Q 4GOPB 5CV4A 1B50A 3L4JA 4DR6L 3GTJB 2RF4A 4KJOA 3DLLA 1EUCB 4UCVA 2NU8B 5C0XH 3PO2B 1OXSC 1DYQA 1SFOB 1EFWA 4LF6Q 4UCSA 4ZQIA 5DQHA 2UVWA 3G71A 4ODGA 4A3BH 3ETHA 3G6YA 2F1MA 5IT9L 1XNRQ 5T1IA 4LF7L 4C3HB 4KY5A 4DU9A 4P71A 2Z4HA 3ULJA 5DEHA 3QZ8A 1FGBD 2EJFC 3I3CA 1Z6HA 4LH7A 5DGBA 3HZXA 3H0GG 3JRXA 1TWGB 4CKEA 4RAUC 1XDNA 4ILWA 3DM1A 5E4XA 3L2PA 4A3MB 3IL8A 2BQ3A 3P20A 3OSNA 4H0LC 2E2IB 2SNMA 2HIVA 1HPCA 4P2CB 2JEGA 3N52A 3QFFA 5LMUL 1IBMQ 5A2QL 4R8UA 3OW7A 3BDLA 1EUJA 1IYJB 1JX4A 3NBHB 1Z7TA 5ELNA 1RHPA 2UUAL 4IOAA 1YJNA 4BBRB 4O42A 3BABA 2NVYB 2ZTCA 3DWAA 4ALPA 4IRDA 1XPRA 1O7LA 2VB2X 1G8ZD 2I5MX 2R93A 3J7A5 1TXYA 3CCSA 1E4EA 1PH1A 2JYOA 1X3PA 3A55A 4ECQA 2BQUA 5CR3A 1VBHA 1WH2A 3T5JA 3UDGA 1F9SA 4UCTA 5KT3A 2QCPX 4KY6A 4YCUA 2IX0A 1X65A 2SEBD 1DOMA 2OCEA 3SI8A 3RZDH 4ECRA 1II3A 3VMMA 2VR1A 2E74C 2AKWB 1L0XB 3OTOQ 2F0PA 3I91A 3P75A 3PSIA 3G8CA 3SEBA 1B6SA 3ORRA 1UEBA 3L4KA 2R93H 4DV5L 4JI5L 4CKBA 2YYAA 1GUNA 4R7RA 4ZQ3A 4X66H 4DR1L 1K8AC 1B70B 2AMCB 1BBWA 4OIKA 2E2JB 2WTFA 4DUZH 2C2RA 2WACA 1PDQA 3M9OB 4IUTA 4L5QA 3S2DH 1N56A 2JA6A 4QF4A 1CQFA 4DR7L 4XYMB 3KHLA 2QKIC 1I4GA 5C3XA 4GC7A 3HOUG 3H3VC 3S1MB 4DR6H 3EJIA 1HNZQ 5CORA 5IIFA 2UXBQ 3IKJA 2CHBD 2WKDA 2B8GA 5JVG3 3KXYT 4ED6A 3FVQA 3KBGA 1FYCA 2FMCA 2MUYA 3T16A 4QQBX 4AYBE 3I72A 2IX3A 1S5BD 2W7PA 4LF7H 5C5MA 4A93G 1IL2A 2Z4IA 4KN4C 5JH7F 2JA6H 1CQVA 3TP6A 4FF4A 4NDXA 3SXHA 4OXPA 3VPBA 1PTOC 4IALA 4MA5A 5K36G 3J7AF 2EY5A 2KHSA 1B53A 2BR0A 2R7LA 1EZ8A 1NE3A 3L9AX 3JZIA 2VA3A 5C4ZA 1YBYA 3HOZB 3K5HA 2OQ0A 5AJ3Q 5KFOA 2YW2A 1J5EQ 2NN6G 4J6HA 1EQVA 4J9RA 5KFBA 1N32H 1B1ZA 2KCMA 1FJGQ 2DJFC 1S5ED 3KJOA 2JA8H 2RHQB 2D0PA 4JUZA 4NW2A 3TRZA 3UDIA 3K7AH 2KEDA 2KEEA 1JICA 2X0SA 1VQ9A 4OEMB 5DAUA 4IJLA 1AW7A 1U4RA 3CPFA 3BYTB 3PUWA 2OQKA 3MXNB 2F4IA 2PZWA 1XYIA 2K04A 1VF7A 2C5CA 2EQSA 3RZOB 3D4DA 5EPKA 5J22A 3RZDB 3EN2A 5C4XG 2V4DA 1F2MA 1SNOA 3RBEA 1EWCA 1B3AA 3CW2C 3S1NB 3ETJA 4X6AH 2B39A 1JDBB 5KFFA 5ELBA 1SNCA 2KOLA 5IYBH 1DV2A 2RCNA 4DAVA 2YS6A 4OWTB 2ZTDA 2E2HB 3FP9A 3EPGA 1WFQA 4DV2H 3PVXA 4KN7C 2R93B 1JB7A 3X3MA 1Y1WA 1HNWH 4GS3A 3RNUA 4IO9A 1V1PA 4LK1C 5GROA 4X65L 4F4YA 3SVMA 4JI5H 4POFA 4TQSA 3GTOA 3KF6A 1STYA 3OMCA 3M3YH 1KJQA 1X56A 2LKVA 2YL2A 2KHIA 3DHQA 2UXDQ 3TINA 1ONLA 3SGIA 4JBMA 5IOCA 4TRDA 4G3IA 4GNXB 1A3VA 4J9MA 4LF4L 2CFMA 2IY5B 2F03A 1N9WA 1EQTA 3GP7A 4A3DG 2ASLA 1O80A 2I8CA 5CGKA 1QUQA 3JAML 4DV4L 1D6EC 4K5VA 1PFNA 4DV7Q 1Y1WH 3U9TA 4RB3C 3KJPA 3WO0A 1BO0A 4RHSA 3GIDA 5LOVF 2K6AA 2IX1A 2RHSB 2R92A 2GA4B 4R1JA 2QILA 4ZHQF 4YCVA 5KNDA 5JVLA 2ZT9C 3GQBA 1PVOA 1MI2A 1TWHA 1SE3A 1Y8NB 4OO1G 1RJRA 1EYCA 5EWEA 5EKIA 3GTOH 1WOCA 4RWSC 4JYAL 1IW7C 1CKNA 3RUPA 4CJ0B 3E0EA 4HJ7A 3N8DA 2C9OA 4IWYA 1KRSA 3W2DA 1EY6A 3H6MA 3EPIA 4JI8H 3W1BA 2CQOA 4GLXA 3T1HQ 2JA6B 4IRKA 5D3IB 1HH2P 5I6WA 2QDBA 2Z9HA 1X3EA 1KC7A 1SAPA 2QF7A 2R92H 1HR0H 2Q8TA 2NB0A 1KDCA 3LWEA 3V6JA 5M5YH 3GTKH 4A93B 1RK5A 1TWHH 4Y7NB 1VQKA 4RKLA 3MJFA 4EGQA 2UXCL 1DM0B 4HIMA 2F0SA 2FE3A 5F2DA 2WB1A 1IBML 4A3LG 2YTYA 2UU9Q 3WWVA 4GN3B 4X3KA 4KD3A 1GSAA 5CC4A 3LP8A 1I50A 4NP5A 2JA8B 1AH9A 4LMQD 1XWEA 2J4XA 2SDFA 3EROA 4UAIA 3SDZA 5EOYA 2Y0SA 4A3FH 2ES2A 3IFDA 1PFSA 2F3IA 3L0OA 4WJ4A 2A74C 3HOXB 1E2VA 5BR8H 2ZDQA 1S03G 1SNDA 2NU9B 2BE5D 5KT7A 1Q1BA 4TVAB 3MTSA 2V59A 1W3SA 1JWUD 4B3TH 4Q5VA 2LFNA 3M4YA 3BVZA 3GIMA 1U4PA 5NUCA 1CQJB 1CKMA 2A6ED 4PMCA 1S5CD 1I50H 2A19A 5FO7B 3SK4A 2BH2A 1QE6A 1DIKA 2MO0A 3MFHA 3H09A 4HR7B 1HJPA 2R82A 5KX5F 5KFCA 1TWAA 3DWPA 4CDDC 5KFYA 5C4XB 1VKZA 2KUMA 4HNUA 4JV0A 4QB4A 2RDHA 1PH8A 1XNQQ 3M9NB 1BVSA 2K50A 1ZYRD 3FPPA 1SMXA 3T5KA 4YR3A 3VR6A 1PZKD 3K81C 3KLRA 1KC8C 2XIWA 3ORQA 4IAJA 5L1LA 5IT9E 4H7BA 2FK1A 3QWNA 1TWAH 1RDPD 2ZJPA 4QWDA 4DV3H 4BBSG 4ZYSA 4DV4H 4IPDA 2W6MA 3GTLH 1JWMD 3RGXA 5KRUA 1TKWB 4IZ8A 2XD4A 4G7ZC 4WBNF 2LMCB 4DF7A 1PH2A 2I80A 4A3DB 2Q2IA 2UXBL 4RZRA 4DL7A 1MKHA 1S4ZA 2R61A 1EEFD 5JPMC 2QDLA 3X3NA 2I0QA 4JYAH 2VUMA 5FLXW 2K7VA 4B08A 3HOWH 2JJQA 4KI0A 4I7AA 1VQ5A 2CH4W 3KLSX 3OWEB 4M8AA 3K57A 4UCUA 3F8NA 1WTRA 4X66Q 5C44H 5DLGA 3I4OA 1S0NA 3RLFA 4IR1A 1KRTA 1FD7D 3CC4A 4O2AF 1K1QA 1NR4A 2YYZA 4GC6A 3J80i 1Y8OB 2X69A 3PUVA 4DUZQ 2B63B 1J8IA 2HVRA 2UXCH 4EVOA 1CKNB 4M7EA 1CKOA 2F4VH 3PMFA 2AGQA 3HOVB 5AJ3L 1J5EL 2VUMH 2JA5A 4JI7Q 2VUGA 1QWYA 1ESRA 2MGSA 3MXPA 1FJGL 2R7KA 4DR6Q 2UVUA 2R8IA 1J9OA 1SRUA 4YY3H 4UP7A 1Q8KA 3VR4A 2FP4B 2VPSA 3J81W 3Q6SA 2A6HC 5C3EB 5L1KA 2F52A 3I8ZA 4DV1L 4ECTA 3PQIA 1ZEQX 2UUBH 2W70A 3BZDB 1EYDA 2NU7B 1GGOA 5M3FB 2ID0A 1LTGD 1PMRA 2F0HA 4ZLTF 4LF7Q 3TP7A 2WB1B 1PZID 3JC66 4LAAA 1JKJB 5AFWA 3RB6A 3HB9A 1PTOF 1Y14B 5KT2A 1JWSD 2JA5H 2FXQA 5JPNC 1I50B 4UCOA 4XYOA 2Z8LA 1CQIB 2GN5A 1L1OB 3AYHB 3S15H 2NU6B 2RQXA 1PH3A 2EDGA 4KKTA 2DY8A 2DGYA 1ET6A 3RBDA 3BA8A 5HBRB 3EYYA 4LFCQ 3GTPA 1N32Q 4YR0A 4IUUA 3PGZA 3S24A 5D3DA 3HG9A 3E6ZX 1QILA 2PI2A 1UAPA 2UXDL 5KFJA 4IFDG 2O4XA 3SK5A 4BY1H 4NXNL 4DR3H 1I6HH 5KFRA 1TWAB 5EBDA 5M3MG 4PZ7A 1BR9A 3GTLB 3B6YA 4EQOA 4DV7L 4LSXA 2Q2HA 2RKSA 3PN1A 2OEOA 4YP3A 3CF5A 3L3OC 4JV2A 3TEHB 2YTXA 3GD7A 1D5MC 3MVVA 4LF8L 4UHVA 4U7CA 1N34L 1HA5A 1KJ9A 1M6VA 1LTTD 1VQJA 3HOWB 1HNWQ 4P73A 4YIJA 4Q43A 3SR1A 3T1HL 1Y8PB 2YTVA 4DAPA 3J80c 4JI5Q 5KFXA 4QWBA 1FKAH 1SR3A 2HVQA 4YAJB 4B3RH 3TDQA 1E1OA 1V51A 1VQ6A 1BCPC 4HMIA 2IT1A 1G2TA 4IUQA 1ZHQA 4H02A 4FXGC 1EYAA 5CA0F 5IODA 4TV8F 1NMFA 1B2TA 2UU9L 4R8IA 3PO2G 5KG2A 2WB1E 5I9PA 1LTLA 3PV0A 4O3QA 4C5CA 4NLGA 3OSPA 2P0AA 4F4ZA 5DQIA 2B2YC 1ENFA 1ASZA 2N55A 2M00A 4UY8C 5GQOA 4BS9A 4GKKQ 2VS1A 4C3HG 4R4CA 4B3ML 2DLNA 3EIVA 4C5BA 3E5SA 3CKIB 1QVCA 5E7NA 1NUCA 2K4KA 1ML0D 2Y0SE 1GXDC 4DV1H 5BN3A 3A7LA 1EQRA 3W5OA 1WSCA 5L9XA 3FKIB 3K0YA 2HDLA 5ELCA 4JI8Q 4L8JA 4A3MG 2R7MA 2RDJA 3QB3A 2KJXA 3CCVA 1B04A 2JA5B 3KUPA 5BPFA 1FL0A 4HJ5A 1YHQA 3D4RA 1BBUA 4KHPQ 4I7ZC 1LTBD 1HR0Q 3RB3A 5I9OA 3S15B 1MD2D 1M90C 5EWFA 3ERQA 3S1QH 3RUZA 1S68A 1TWCA 3PO3B 4BY7H 4N9PA 1E22A 4BBRG 1XNQL 2J6TA 1XXGA 5KFLA 4UP8A 1IL8A 4MTEA 5FJ8H 4HJAA 4P74A 3TQYA 2FHTA 5HGQA 5KFQA 5IT9W 2JN4A 2IPKD 4JV1A 1HQRD 3F2DA 3C46A 3LX0A 1HRJA 1PX2A 5BR8Q 2R84A 4BWSC 2UXDH 4BY1B 2NVQH 4X64H 1I6HB 4FVMA 4RA8A 2K5QA 1EZ1A 2BE5C 1CK1A 4DK1A 1RYRA 4NXNH 5I6YA 1Q7YC 2ENBA 4PV1C 1TWCH 4Q0YA 2EJMA 5CV7A 4YWKA 1CTMA 4B3TQ 3KALA 1UNNC 3RJ0A 4DV7H 4OX9H 1JOOA 2IWHA 1SYDA 4F8MA 1W2BA 4MV3A 1WTOA 4RGMA 1VQNA 4WD3A 2A6EC 4OWXB 1SJHD 2DPIA 3GV5B 5CBAE 2RBMA 3T1YL 1BGWA 2PW7A 5A2QW 1Q46A 1DZ1A 3H3VH 1Q90A 2EVBA 3RB0A 3TZDA 1A3TA 4LF8H 4F87A 3DXJC 1N34H 2XVSA 1UNSA 2PQAB 5GAGC 5LMNH 4Y52H 4J9SA 4ZUIA 2V58A 2W6OA 2YU9B 4JVZA 3T1HH 2PNRC 1TS5A 1QZGA 2X6LA 5KT4A 4XYLB 4DR4L 4X66L 1RODA 5EAYA 4WFN3 3M4OH 3A0JA 2HGSA 4CC5A 2C35B 3IAYA 3CD6A 5COYA 2FK3A 4YCWA 3PZPA 1QB5D 1PTOH 3CCQA 5G3LD 2R86A 1WCMB 3CC7A 5C0XG 4QIWA 1K83B 5HURA 3V2TA 5LP6F 2CWPA 4DV3Q 5IGEA 3HOYH 2WINB 1O75A 2UU9H 4JI7L 4O3NA 1SEIA 2GVAA 2H5XA 1D8LA 2K33A 4HNTA 1T5EA 3OIQA 5EPLA 4ED8A 4B3MH 1VDZA 2E2DC 3EBEA 5KIXA 4KJNA 5EQ0A 4DV6H 3J7ZC 4JYAQ 1IOWA 5JJKA 1GSOA 1LUZA 1HUMA 4C56C 4ECSA 3Q8DA 2NTSA 1GUTA 1PH7A 1D7QA 2OWOA 4K2LA 2SOBA 2W9BA 2K05A 3HOZG 4RUCA 4HSVA 3WOFA 2FFKB 1JR0D 2HCCA 2XWJB 2ZXPA 1CS0A 2EYFA 3WOEA 3S1QB 3M4IA 2BQRA 3VR5A 2UXCQ 3TS2A 2F4VQ 2YCHA 3H0GA 4AYBB 2F0GA 1AP0A 1SYEA 4ETSA 5IY0A 1I94L 1Z2OX 5L1IA 4LFCL 1N32L 4ED7A 1XNQH 3H91A 2ALZA 3M85A 2AHOB 1EQQA 4FBTA 3S16H 2HUGA 2K5HA 4IPHA 3SK6A 3BZKA 1EU3A 3PR4A 4YY3Q 3T5HA 1RYSA 2XGTA 4RB1A 1SROA 1X9NA 2CW0D 1CSPA 2UUBQ 3A54A 2PI2E 5LXTF 3K5MA 2QEXA 1PRTC 3MC0B 4MV8A 4FNFA 1X54A 5KFWA 3O13A 4GOPC 3H0GH 2RCFA 2XGPA 1E3PA 4OL7A 1CE8A 4DXGA 1F9PA 4B3SL 3M9MB 2DUDA 2IA6A 2R93G 2ZJRA 2AUKA 5HY6A 1EEID 1YJWA 3FDTA 4DA2A 3Q1KA 5D1OB 2DZDA 3UQ8A 3T1YH 1XJVA 2HCIA 4A3KH 4WORA 3NENA 3S14H 1SNMA 4LNQA 1SJED 1HNWL 1CZGA 5KFKA 3R2IA 1S0MA 4MAMA 1A15A 1KJ8A 4RGNA 1A62A 3A5ZB 5DG7A 1I3QA 4XIGS 2DNEA 1A2UA 1VQPA 3M4OB 2PBZA 4RHRA 1JLLB 2BDNA 4DR4H 3SK8A 2XNAC 4FP5D 3CRLC 3RLOA 2CKZB 1AE3A 3J81i 4O2DA 2KCNA 4DR3Q 2YRWA 2XCLA 5C5LA 4C3JH 2E76C 2L1BA 3Q8RB 3HOYB 4K0KH 3ER0A 2W57A 3PUXA 1DGSA 1HFGA 1E4FT 2O5JC 4DGZA 4C1NI 4JI7H 1G51A 2K03A 4GKKL 3OSOA 2FJ2A 1CZWA 1I3QH 4PMWA 1R9TA 1RCVD 1HNXL 5IGGA 3VR3A 2JA6G 1AN8A 4A3BB 4FM9A 4O3PA 3GIQA 1D5XC 1X55A 3H15A 1K3RA 4NB3A 4JI8L 4QIWB 1GLVA 5KFUA 1RIPA 2UVRA 3R5XA 1CI3M 2ZXOA 3HKZA 4DV0H 4DR2H 1BCPF 1ICFB 4DK0A 3OOCA 5BN4A 4B3RQ 3I2ZA 4IN3A 4KHPL 3RGZA 2I87A 5LA6F 1B9NA 1HR0L 2XN9C 5L37A 2JK8A 3JAMW 2MCTA 2K5DA 1R9TH 1OXVA 1OXXK 5ELEA 3R3OA 4DKAC 5C4JH 2JA8G 1IXRA 1FNUA 3MAQA 2R6FA 1SMYC 2A68D 4ZCKA 1QOHA 3K59A 4AH6A 3J80L 3MFYA 1GM5A 2ASDA 3HOUH 5H80A 1Z2PX 1IKMA 3HOXG 1C3OA 4A75A 1I94H 3S16B 4LFCH 3PIOA 3T5LA 1IYUA 4DV2Q 2G9DA 3D3RA 2R8JA 3J7AK 1KD1C 1LLRD 4FU0A 3QR8A 5KG3A 2AU0A 5BR8L 5FLXc 1PYWD 2R7NA 1WYDA 4DV1Q 1BJTA 4J9KA 1WTQA 2JEFA 3R8BA 4ZUJA 1HHVA 3AFQA 2BA1A 5JAVA 2C22A 2E75C 5LL6X 4CJ2C 3FMCA 2L15A 4CHTB 3U9OA 4B3TL 1GHJA 5FK9C 2N88A 3GTGA 3N44B 4HTHA 3Q22A 4A3JH 1JE4A 4R8UB 4O3OA 3P1HA 4FF1A 2W9AA 4B3SH 2PN1A 4R4TA 5CYUA 2ZM6Q 4CBVA 1C8CA 2JA7A 1H9RA 4L5TA 2L55A 2FPIB 2CCZA 4C2MA 2B2WA 4JI0L 5FPOA 1T94A 2W6ZA 5JEAJ 1GJXA 3FRPB 4DL5A 1H9KA 2MJ8A 1LTID 2I07B 1E4EB 2M2LA 5IP7H 1YITA 1A63A 1T3NA 3Q8SB 1O7IA 3J81c 3BG3A 1HUNA 2JXMB 2D9UA 4JI2H 2Z6KA 3NP8A 3TIIA 2GVBA 1DV1A 4K6LA 1Y1WG 4A4IA 3CVZA 2J6SA 4JI6H 3K58A 1SYFA 4IHJF 5C8YF 4X64Q 2PYKA 2YZNA 1JXLA 1HFNA 1SCUB 4LF5H 2JA7H 4AQYL 4NXNQ 4O1NA 1RF2D 1HZBA 4C2MH 3S2DB 3KAKA 5CAEB 5JVDF 5LL6S 4DV3L 4QIWE 4DL2A 4O2BF 1PK8A 2ALYB 5IGCA 4OX9Q 3Q8QB 2MHVA 3V96A 2V4QA 1Q82C 5J39A 4CDEC 3NGDA 3N42B 3BQ2A 1I3QB 2CW7A 4GKKH 2QYZA 1KABA 1HNXH 3KFUA 5DLQE 2NZHA 4LF8Q 4NXML 2F0LA 1N34Q 2R87A 1KTKA 1SE8A 2WP8J 1VQ7A 4A3GH 4UCRA 1ENAA 4DL3A 5LMNQ 4H13C 5KFSA 1MIUA 3UE1A 2SNSA 1PH6A 1VF5C 3F2UA 1Q1EA 2B63G 2CW8A 4RNMA 2DPJA 3G48A 2OTJA 2F0FA 4F88A 4EFEA 2XTIA 2E5LH 1I4HA 3HOVG 4KHPH 2KECA 3D8GA 3PF5A 5D65A 5C4JB 3TMEA 2F4VL 5E3FA 3CPWA 2Q8IB 1EY7A 2N49A 4A3FG 1W96A 2A69D 4A3CH 5C3EG 2P5ZX 1A0IA 3WO1A 2B2UC 3HKZB 3KLWA 4JBJA 5FLMG 1C48A 5M3FG 4YY3L 4LUOA 3I4NH 5E4WC 1VQGA 2WB1G 4B3MQ 1K8MA 5IYCH 3K7AB 1BF4A 2UUBL 1AZPA 4UFZA 4LFAL 4GNXC 4HJ8A 1A2TA 4IUPA 4DV6Q 4EYIB 4X62L 4DN4M 3HP3A 3E0JA 3MFIA 1E4GT 5DQGA 2V9WA 2FKLA 4J1MA 2Y0SG 2LXKA 1EIYB 4A3JB 1QJOA 1I5FA 3MR5A 2Z6BA 1D5ZC 1LO5D 3V6KA 3QIAA 3J7AV 3QJYA 1GKHA 4KY7A 4C3IH 3RAQA 1SNQA 2FLNA 3GQCA 1N36H 4G7OC 1VQAA 1GYFA 1R4PB 2OXPA 4XT1B 1AEXA 1YZ6A 3T53B 4S3SA 4JI0H 1A3UA 1FNVA 1T9HA 3P7JA 4XT3B 3LNNA 5C6AA 1BNZA 1OXUA 2FPPB 2YZGA 4J15A 4A3EH 1AZQA 1TT2A 3AU7A 2B2TA 1I7NA 2LY7A 1NBWA 4J9NA 4HCSA 4JCVE 1YNND 3E3XA 3ZJYC 4WJ3M 3K5LA 5IGBA 2D62A 1HZ9A 4RAZA 2B2YA 4YJ2F 3T13A 3M3YB 2ATWA 1UUPA 1LACA 2IBKA 1PRTF 4WJWA 2NUCA 2JEAI 1WTXA 1T36A 2JA7B 1SYGA 3IG0A 4DR3L 1B33N 4C2MB 1LM0A 4Q0FA 4R4OA 4AQYH 2ICEC 3UDFA 4JOIC 2CQYA 4F50A 1Y1WB 1ZXTA 3BJYA 1RTOA 5KG5A 3TSSA 3FDSA 1I4XA 3ZYYX 3CQZA 1V1PB 5ISRA 3MXGA 5F9NA 3MWYW 3HOWG 1FNWA 2FJZA 2AWOA 1A6XA 4AIMA 2BDOA 3GTOB 1IBLL 3KF6B 1ULZA 2IW3A 4TQUS 3T1YQ 3STBD 2KCTA 1VQFA 1ZETA 4J9QA 3KHRA 4A3GB 3BQ0A 3GTQA 4ECXA 5C44G 4MHEA 4NXMH 3TBIB 2L11A 2DWCA 3MEFA 2B2VC 4L1KA 4MIUA 5GONF 1QUQB 3NEMA 3VYSA 5IT9c 4F4WA 3NSWA 3HKZE 3DWQA 3OPOA 1WR2A 2RDIA 4RMFA 4B3RL 2FMAA 3VPDA 3NUCA 4O4IF 4LH6A 3D6WA 2ASJA 3NPPA 3G6EA 4KLKA 2JEBI 3OUZA 3CQZH 2VUMG 4DR4Q 2R92B 5M5YB 3GTKB 1TWHB 5DM73 2R7DA 3ND8A 3GO5A 3D0FA 4QGUA 2K75A 4BBSH 5KFGA 3E9HA 5KG0A 3HEJA 3GIKA 3GILA 2Z1CA 4UDUC 3PIP3 3GTQH 3Q2OA 1Z9FA 3HRZC 3OMGA 4K0KQ 2RDFA 5LL6b 3TREA 1PH9A 5IWAH 1AUXA 1KIXA 5KFIA 2JE6I 3N43B 1ZKOA 3I4NB 3CCRA 2XIGA 4DV2L 4IR9A 3FKIG 4L5SA 4A3FB 5LMNW 2WYOA 1YNJD 2R8GA 1DCZA 1TQOA 2JA5G 4LFAH 5EDWA 3TP8A 4ECUA 3HS0C 2AQ1B 4NPSA 4X62H 1I7LA 4QWCA 4K5WA 1PH4A 4BXXG 2K14A 4DV0Q 3SE0A 1JDEA 1TU2B 4I65A 4DR2Q 2NVTH 4RAYA 5DG8A 3PW4A 2C2EA 2R7ZA 4MZ9A 1LYLA 2F0MA 4C3IB 4ZKCB 1EL0A 3PO3G 4O0AA 4HYKA 1QG7A 4CDFC 1SNPA 2ZM6L 2HVSA 5IP9G 3RD4A 4DAYA 5KFEA 2UVVA 3QOJA 4XQQA 3A74A 4R4QA 3AMUA 3FHWA 2Y0SB 4EEQA 1JJCB 1SDFA 1KLGD 4KK7A 3CMEA 1UC8A 3CCLA 5KG4A 1TA8A 1DONA 4A3EB 1MJEA 1XMQH 1GSHA 3G6JB 4DFAA 1I94Q 1JC7A 4GKJH 2TSSA 4BY1G 4YBZB 2XRQD 2R7ZH 4YAKB 5CV8A 3EFXD 3F1ZA 1EFID 4RKBA 2PVPA 5H1SE 1JORA 2KHJA 3CCUA 1VQEA 5K5PA 4X64L 3V4SA 1X6OA 2QW7A 5CB4F 3MEHA 1X32A 2VQEL 5D14A 4HSPA 2VPQA 5C1PA 4JI3L 1VCIA 4YR2A 1EY5A 1NSNS 1KHIA 3S1RH 5J2TF 3GDEA 3UE0A 4BWGB 4OX9L 3U4ZA 4DR5H 1VQHA 5KG6A 1U5KA 1EY8A 2JEIA 4B3SQ 1B44D 3GTPH 1CUKA 1YNXA 4JV5Q 3PCOB 5FO9B 3A8JE 3RLNA 4PZ8A 3OWFA 1OTCA 1IBLH 2R6GA 1HTPA 2V4RA 3JAMi 1JJGA 1Y1VA 2R8KA 5L1JA 4CC6A 3KF8A 1STBA 1SN8A 2RGRA 4KKUA 1VQBA 5LMNL 2NVXA 4QUCA 4LMYA 3J80E
chains in the Genus database with same CATH topology
3EBEA 2OQ0A 5AJ3Q 5IE8A 1J5EQ 2NN6G 4OONA 4YWMA 1S40A 4JI2Q 3OTOL 1WCMG 4UPAA 1VQDA 3J7ZC 2KCMA 4DPGA 1FJGQ 4JYAQ 1UE1A 5JJKA 4JI6Q 1L1OC 2D0OA 2LSSA 1LUZA 2RHQB 3KJOA 1V9PA 4DR5L 2D0PA 1EYGA 2JA8H 3Q8DA 3TRZA 3UDIA 3K7AH 1PH7A 4JBKA 1D7QA 5M3MH 3CCJA 3RR5A 1VQ9A 2OWOA 4LF5Q 3J81j 1L2FA 3HOZG 1Y1VH 4IJLA 1IBKQ 2MO1A 2HIXA 3K0XA 3CPFA 4LWCA 3PUWA 2OQKA 3MXNB 5M5XH 4GOPA 1VQOA 2NVXH 2EQSA 2HHHL 2UXCQ 1KQSA 3TS2A 2F4VQ 3CAMA 3EN2A 5C4XG 4YWLA 4QY7A 5IY0A 5GAEC 3CW2C 4EX5A 1HNXQ 1I94L 4X6AH 2VZAA 3K7UC 4LFCL 3W1GA 2A8VA 1N32L 5IYBH 4DV6L 3M85A 2AHOB 1EQQA 2RCNA 5M5WH 4LUVA 4OWTB 1MJCA 2ZTDA 2K5HA 3FP9A 1WFQA 3BZKA 4IPHA 3S16H 4GN4B 4YY3Q 2XGTA 1HNZL 2LXJA 1JB7A 4GS3A 3RNUA 1YI2A 1SROA 1YVCA 3D31A 1CSPA 4IO9A 4JI1Q 1V43A 2PI2E 1X9NA 2UUBQ 3AEVA 5GROA 2QEXA 4X65L 2E5LQ 4BY7G 4AYBG 5JJIA 1N33L 2Q2TA 4POFA 1X54A 3CP0A 1HZCA 3GTJH 4GOPC 3KF6A 3H0GH 2K5VA 3M3YH 1X56A 2CWAA 2KHIA 4LF9Q 2UXDQ 3HFZB 1E3PA 3SGIA 2MNAA 1NJIC 4JBMA 1X3GA 4B3SL 4GNXB 3PO2H 4LF4L 2DUDA 2CFMA 1SFOH 2R93G 1N9WA 1L0WA 2ZJRA 2IY5B 4A3DG 1YJWA 5HY6A 3AQQA 1QUQA 1HZAA 4DV4L 4C3HH 4DV7Q 1Y1WH 4LFBQ 5IYDH 1FVIA 3KJPA 1XJVA 1YHBA 4A3KH 3TS0A 2IX1A 2RHSB 3NENA 4LNQA 3S14H 4R1JA 1PH5A 4YCVA 3KOJA 1HNWL 1H95A 2AWNA 1PVOA 4OO1G 4L5RC 1A62A 1E24A 3A5ZB 2HQLA 3GTOH 1WOCA 5JJLA 2VQFQ 3H3VI 4JI4L 2Z6KC 4XIGS 3OW2A 4JYAL 1JE5A 1CKNA 1UE6A 1VQPA 2E2IH 3E0EA 2N8NA 4LW1A 4HJ7A 4DNIA 3RN5A 1C9OA 1KRSA 3RLOA 1M1KC 3W1BA 2CQOA 4GLXA 3T1HQ 2R7ZG 2CKZB 1AE3A 1V1QA 4O2DA 1HH2P 3J81i 3JAMc 4DR3Q 2B63G 4BA1I 4C3JH 2N78A 3RN2A 1JJ2A 2I5LX 1QVGA 1X3EA 1AE2A 1N36Q 4EQ5A 3ER0A 2R92H 3FKIH 3K80C 3PUXA 1DGSA 5M5YH 1YHAA 3GTKH 1TWHH 4BBRH 1VQKA 1JT8A 1G51A 2NVYH 4JI0Q 2UXCL 4HIMA 4GKKL 3KYHC 1I3QH 3U4VA 4PMWA 1IBML 1HNXL 4A3LG 4IOCA 2YTYA 4JC0A 3WWVA 2UU9Q 1GO3E 3BJUA 4GN3B 3CXCA 2JA6G 2ZJQA 4BXXH 2IHEA 2MQHA 3F2CA 1XPUA 4R4IA 4GLVB 1X55A 3H15A 3HOYG 1E7ZA 1K3RA 1A8VA 4NB3A 4JI8L 1AH9A 2BH8A 1XMOQ 1RIPA 3PO3H 5LMUQ 1BKBA 4A3FH 2ES2A 4DUYQ 1IZ6A 1PFSA 2F3IA 3L0OA 1VQCA 4HIOA 5IP9H 2Z0SA 1VQ4A 3I4MH 4WJ4A 1PA6A 4B3RQ 3I2ZA 4AQYQ 4KHPL 1Q1BA 1GD7A 4TVAB 4K0KL 2VY3A 1HR0L 1QZHA 4IPGA 4BA2I 4IFDI 2UUAQ 2JK8A 1W3SA 1UE5A 4A3BG 1GVPA 1R9TH 3F2BA 1OXVA 1OXXK 1Z47A 5C4JH 4DKAC 2JA8G 1IXRA 2JA9A 2K5NA 1CKMA 1WJJA 2PQAA 1I50H 3L7ZC 4AH6A 1GM5A 2A19A 2BH2A 3HOUH 2VNUD 2MO0A 4QJFA 3HOXG 4A75A 1K73C 2I5HA 3PIOA 1HJPA 1Y1VG 4A3IH 4NXMQ 4DV2Q 1K9MC 1EWIA 1P8LA 1TWFH 1KD1C 4DV0L 4DR2L 4HJ9A 1PH8A 5BR8L 1XNQQ 5FLXc 1WYDA 3ERSX 2VQFL 4DV1Q 1BVSA 2K50A 3M4PA 3AFQA 2BA1A 3CCMA 1SMXA 2B3GA 3U50C 3A5UA 4XTCS 2KBNA 2L15A 3S1MH 4B3TL 2WAQG 4MNOA 3K81C 4DV5Q 1KC8C 4A3JH 2YU9H 2N3SA 2ZTEA 4R4TA 1YIJA 2ZM6Q 1TWAH 2ZJPA 1X3FA 5IWAQ 1S3OA 4DR1Q 4BBSG 2EIFA 4L5TA 4IPDA 1PYBA 1E1TA 1Q12A 2CCZA 3GTLH 4JI0L 2QGQA 1SLJA 3NELA 1VQIA 5JEAJ 1PH2A 4UP9A 2YV5A 1WCMH 2Q2IA 2UXBL 1K83H 1EIFA 1MKHA 2VL6A 5IP7H 4LFAQ 1YITA 1A63A 3F8TA 4DR7Q 1O7IA 3J81c 3DM3A 4X62Q 1S72A 2Z6KA 2I0QA 2GVBA 3M9BA 1RL2A 2KENA 4A4IA 5IYDG 1Y1WG 1HR0W 1VQMA 3HOWH 1Q81C 2JJQA 4DUYL 4A3KG 4KI0A 1VQ5A 3HOZH 4X64Q 5FJ8G 4POGA 4PG3A 1Q86C 2JA7H 3PF4A 4AQYL 4JV5L 4NXNQ 4C2MH 1HZBA 4IFDJ 3I7FA 4DV3L 4X66Q 4QIWE 5C44H 3I4OA 3RLFA 2ALYB 3OYYA 1KRTA 3CC4A 4OX9Q 2YYZA 2VW9A 1Q82C 3J80i 4DUZQ 3PUVA 3PUYA 3ICEA 1XMQQ 3BU2A 1CKNB 1CKOA 1TWGH 4DAYB 5AJ3L 2UUCQ 4MTNA 4GKJQ 1J5EL 2VUMH 3VDYA 3UDXA 3KFUA 5DLQE 2NZHA 4JI2L 2IHFA 4JI7Q 4A3MH 4LF8Q 4NXML 1FJGL 1N34Q 1OXTA 1SE8A 2PMZE 2WP8J 4RG1A 1VQ7A 4JI6L 3RZOH 4DR6Q 4A3GH 1SRUA 5LMNQ 4UP7A 1Q8KA 1MIUA 1KAWA 1ASYA 3UE1A 2F52A 1PH6A 4LF5L 4DV1L 1Q1EA 2WAQE 2B29A 3KDFA 4YHHQ 2A1AA 3G48A 3IRBA 4GNXA 2OTJA 2XTIA 1VS0A 3HOVG 2ID0A 2E2HH 1IBKL 4LF7Q 1U0LA 4QL5A 5J3BA 4PZ6A 4DR5Q 3JC66 1N8RC 3PF5A 2OTLA 1Y14B 3S2HH 2F4VL 2JA5H 2FXQA 4DAMA 3I56A 3CPWA 2N49A 4A3FG 2MFIA 3ULPA 1CSQA 1P16A 4A3CH 3I4MG 5C3EG 1IBLQ 1A0IA 2GN5A 1L1OB 3AYHB 3S15H 1XPOA 4APVA 4GN5A 3KLWA 4JBJA 5JEAG 1PH3A 5FLMG 5M3FG 2DGYA 4YY3L 4LUOA 3I4NH 3G4SA 1VQGA 2BA0A 2WB1G 1JMCA 4B3MQ 5IYCH 2UUBL 4JI1L 1YJ9A 4GNXC 4LFAL 4P75A 1G291 4HJ8A 4LFCQ 4IJHA 1N32Q 1KL9A 4DV6Q 2E5LL 4X62L 3PGZA 3S24A 1B7YB 3KF8B 4A3IG 2PI2A 2Y0SG 3PIPA 2LXKA 3HKZG 1VQLA 1EIYB 4LF9L 2UXDL 1I5FA 1G6PA 1QVFA 4IFDG 1FGUA 4X65Q 4BY1H 1GKHA 4NXNL 2ASBA 1EOVA 1I6HH 4C3IH 4DK6C 5M3MG 4PZ7A 4JOIA 3I55A 3STBC 3B6YA 5ELOA 4DV7L 4LFBL 2Q2HA 1VQAA 4LUZA 5C0XI 4DUZL 4A76A 1NMGA 1YZ6A 3ULLA 2E2JH 1T9HA 3CF5A 4LF4Q 1OXUA 3CCEA 4HIDA 2UUCL 4A3JG 4J15A 4A3EH 3TEHB 2YTXA 3GD7A 4DV4Q 5GAHC 4GOPB 4LF8L 1NBWA 4JCVE 1N34L 4A93H 3ZJYC 4DR6L 2RF4A 4Y7NH 4WJ3M 2D62A 1HZ9A 1VQJA 2NN6I 5IYBG 3DLLA 4P73A 2ATWA 2PNHA 1HNWQ 1UE7A 3T1HL 2JEAI 1OXSC 2YTVA 4YHHL 4DR3L 3J80c 1EFWA 3CMAA 4JI5Q 4LF6Q 2V1CC 4JI4Q 3G71A 3M7NA 1SR3A 4A3BH 1LM0A 4R4OA 1XNRQ 1E1OA 5IP7G 3UDFA 4JOIC 1VQ6A 1N36L 4LF7L 4P71A 2IT1A 3ULJA 1NY4A 4H02A 1PV4A 3H0GG 3HOXH 3HOWG 2AWOA 2Q2UA 4AIMA 1NMFA 2UU9L 3PO2G 1IBLL 3KF6B 2WB1E 4HIKA 4TQUS 1LTLA 3PV0A 3L2PA 2NZOA 3STBD 4JBWA 2KCTA 3T1YQ 1PYSB 1VQFA 2JA7G 3GTGH 5C44G 1ASZA 2HIVA 4UY8C 5GQOA 4IPCA 4GKKQ 2VS1A 4R4CA 4B3ML 3EIVA 3AFPA 3MEFA 1XMOL 1QVCA 5E7NA 2K4KA 5LMUL 1IBMQ 1QUQB 3NEMA 4GLAC 5IT9c 1NTGA 2Y0SE 3HKZE 4RMFA 4B3RL 1YEZA 1EUJA 2VQEQ 1EQRA 3W5OA 4KLKA 2JEBI 3G6EA 1IYJB 3CQZH 1PHJA 4JI3Q 3NBHB 2VUMG 4DR4Q 4FDBA 4ME3A 5ELNA 4JI8Q 2UUAL 4IOAA 3S17H 1YJNA 4A3MG 5C4XH 2ZTCA 3CCVA 4ALPA 2R7DA 4A3GG 2EXDA 3GO5A 3D0FA 4QGUA 2K75A 1XPRA 4BBSH 3E9HA 1FL0A 4HJ5A 2I5MX 1YHQA 1C0AA 3GTQH 1TXYA 1BBUA 1Z9FA 3CCSA 2QA4A 3J7A5 1PH1A 2HT1A 4KHPQ 1HR0Q 4K0KQ 3TREA 5C0XJ 1M90C 1PH9A 3UDGA 1KIXA 2JE6I 1K8GA 3CCRA 3KDFB 4DV2L 2R92G 1KXLA 3S1QH 4YCUA 2IX0A 1X65A 3FKIG 2OCEA 4L5SA 3RZDH 4BY7H 1E22A 2R7FA 4BBRG 5LMNW 1XNQL 2JA5G 4UP8A 2AKWB 3OTOQ 4NPSA 4A3CG 3PSIA 4OO1I 4P72A 5FJ8H 4HJAA 4P74A 3TQYA 5HGQA 1PH4A 4BXXG 1UEBA 3GTMH 2K14A 4DV0Q 2R93H 3F2DA 2E8GA 4DR2Q 2NVTH 4A3DH 1WI5A 2JQOA 4DV5L 1B8AA 4MZ9A 4JI5L 5BR8Q 4LF6L 2NVQH 3I4NG 1LYLA 5IYCG 3PO3G 4O0AA 1XNRL 1XTDA 2ZM6L 5IP9G 1Q7YC 5IWAL 1TWCH 3A74A 4R4QA 4DR1L 1K8AC 1B70B 3FHWA 4B3TQ 4YWKA 1JJCB 2AMCB 1VQ8A 1BBWA 3CMEA 1W2BA 4OWWB 2HHHQ 3CCLA 1VQNA 1MJEA 3CC2A 4OWXB 4L5QA 3S2DH 3T1YL 1I94Q 1Q46A 4BY1G 4DR7L 3H3VH 4DK3C 3E9IA 2R7ZH 3HOUG 3U58A 2B63H 3F1ZA 4JG2A 1K0RA 1HNZQ 5H1SE 2PQAB 2KHJA 5GAGC 3CCUA 4Y52H 1VQEA 2UXBQ 4X64L 3HOVH 1X6OA 3PUZA 1QZGA 1C7YA 3HKSA 2VQEL 1J6QA 4A3EG 4JI3L 1VCIA 5GADC 1N33Q 4DR4L 4QQBX 3M4QA 4X66L 1KHIA 5EAYA 4AYBE 3A0JA 3S1RH 3GDEA 3M4OH 3UE0A 2C35B 4OX9L 1L1OA 3LGJA 3U4ZA 3CD6A 4A93G 4YCWA 1IL2A 1VQHA 1U5KA 4A3LH 5C3EH 2JA6H 3CCQA 2WFWA 4B3SQ 1XMQL 1CUKA 1YNXA 3GTPH 3CC7A 4JV5Q 3PCOB 4OXPA 5C0XG 5FLMH 3RLNA 4PZ8A 2CWPA 3BZCA 5M3FH 4DV3Q 4GKJL 4KHZA 3HOYH 5K36G 1OTCA 4JI7L 3S1NH 1UWVA 2R6GA 2GVAA 3JAMi 2H5XA 2K52A 1D8LA 1JJGA 1NE3A 1SN8A 3K8AA 1VQBA 5LMNL 1YBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBE A;  2OQ0 A;  5AJ3 Q;  5IE8 A;  1J5E Q;  2NN6 G;  4OON A;  4YWM A;  1S40 A;  4JI2 Q;  3OTO L;  1WCM G;  4UPA A;  1VQD A;  3J7Z C;  2KCM A;  4DPG A;  1FJG Q;  4JYA Q;  1UE1 A;  5JJK A;  4JI6 Q;  1L1O C;  2D0O A;  2LSS A;  1LUZ A;  2RHQ B;  3KJO A;  1V9P A;  4DR5 L;  2D0P A;  1EYG A;  2JA8 H;  3Q8D A;  3TRZ A;  3UDI A;  3K7A H;  1PH7 A;  4JBK A;  1D7Q A;  5M3M H;  3CCJ A;  3RR5 A;  1VQ9 A;  2OWO A;  4LF5 Q;  3J81 j;  1L2F A;  3HOZ G;  1Y1V H;  4IJL A;  1IBK Q;  2MO1 A;  2HIX A;  3K0X A;  3CPF A;  4LWC A;  3PUW A;  2OQK A;  3MXN B;  5M5X H;  4GOP A;  1VQO A;  2NVX H;  2EQS A;  2HHH L;  2UXC Q;  1KQS A;  3TS2 A;  2F4V Q;  3CAM A;  3EN2 A;  5C4X G;  4YWL A;  4QY7 A;  5IY0 A;  5GAE C;  3CW2 C;  4EX5 A;  1HNX Q;  1I94 L;  4X6A H;  2VZA A;  3K7U C;  4LFC L;  3W1G A;  2A8V A;  1N32 L;  5IYB H;  4DV6 L;  3M85 A;  2AHO B;  1EQQ A;  2RCN A;  5M5W H;  4LUV A;  4OWT B;  1MJC A;  2ZTD A;  2K5H A;  3FP9 A;  1WFQ A;  3BZK A;  4IPH A;  3S16 H;  4GN4 B;  4YY3 Q;  2XGT A;  1HNZ L;  2LXJ A;  1JB7 A;  4GS3 A;  3RNU A;  1YI2 A;  1SRO A;  1YVC A;  3D31 A;  1CSP A;  4IO9 A;  4JI1 Q;  1V43 A;  2PI2 E;  1X9N A;  2UUB Q;  3AEV A;  5GRO A;  2QEX A;  4X65 L;  2E5L Q;  4BY7 G;  4AYB G;  5JJI A;  1N33 L;  2Q2T A;  4POF A;  1X54 A;  3CP0 A;  1HZC A;  3GTJ H;  4GOP C;  3KF6 A;  3H0G H;  2K5V A;  3M3Y H;  1X56 A;  2CWA A;  2KHI A;  4LF9 Q;  2UXD Q;  3HFZ B;  1E3P A;  3SGI A;  2MNA A;  1NJI C;  4JBM A;  1X3G A;  4B3S L;  4GNX B;  3PO2 H;  4LF4 L;  2DUD A;  2CFM A;  1SFO H;  2R93 G;  1N9W A;  1L0W A;  2ZJR A;  2IY5 B;  4A3D G;  1YJW A;  5HY6 A;  3AQQ A;  1QUQ A;  1HZA A;  4DV4 L;  4C3H H;  4DV7 Q;  1Y1W H;  4LFB Q;  5IYD H;  1FVI A;  3KJP A;  1XJV A;  1YHB A;  4A3K H;  3TS0 A;  2IX1 A;  2RHS B;  3NEN A;  4LNQ A;  3S14 H;  4R1J A;  1PH5 A;  4YCV A;  3KOJ A;  1HNW L;  1H95 A;  2AWN A;  1PVO A;  4OO1 G;  4L5R C;  1A62 A;  1E24 A;  3A5Z B;  2HQL A;  3GTO H;  1WOC A;  5JJL A;  2VQF Q;  3H3V I;  4JI4 L;  2Z6K C;  4XIG S;  3OW2 A;  4JYA L;  1JE5 A;  1CKN A;  1UE6 A;  1VQP A;  2E2I H;  3E0E A;  2N8N A;  4LW1 A;  4HJ7 A;  4DNI A;  3RN5 A;  1C9O A;  1KRS A;  3RLO A;  1M1K C;  3W1B A;  2CQO A;  4GLX A;  3T1H Q;  2R7Z G;  2CKZ B;  1AE3 A;  1V1Q A;  4O2D A;  1HH2 P;  3J81 i;  3JAM c;  4DR3 Q;  2B63 G;  4BA1 I;  4C3J H;  2N78 A;  3RN2 A;  1JJ2 A;  2I5L X;  1QVG A;  1X3E A;  1AE2 A;  1N36 Q;  4EQ5 A;  3ER0 A;  2R92 H;  3FKI H;  3K80 C;  3PUX A;  1DGS A;  5M5Y H;  1YHA A;  3GTK H;  1TWH H;  4BBR H;  1VQK A;  1JT8 A;  1G51 A;  2NVY H;  4JI0 Q;  2UXC L;  4HIM A;  4GKK L;  3KYH C;  1I3Q H;  3U4V A;  4PMW A;  1IBM L;  1HNX L;  4A3L G;  4IOC A;  2YTY A;  4JC0 A;  3WWV A;  2UU9 Q;  1GO3 E;  3BJU A;  4GN3 B;  3CXC A;  2JA6 G;  2ZJQ A;  4BXX H;  2IHE A;  2MQH A;  3F2C A;  1XPU A;  4R4I A;  4GLV B;  1X55 A;  3H15 A;  3HOY G;  1E7Z A;  1K3R A;  1A8V A;  4NB3 A;  4JI8 L;  1AH9 A;  2BH8 A;  1XMO Q;  1RIP A;  3PO3 H;  5LMU Q;  1BKB A;  4A3F H;  2ES2 A;  4DUY Q;  1IZ6 A;  1PFS A;  2F3I A;  3L0O A;  1VQC A;  4HIO A;  5IP9 H;  2Z0S A;  1VQ4 A;  3I4M H;  4WJ4 A;  1PA6 A;  4B3R Q;  3I2Z A;  4AQY Q;  4KHP L;  1Q1B A;  1GD7 A;  4TVA B;  4K0K L;  2VY3 A;  1HR0 L;  1QZH A;  4IPG A;  4BA2 I;  4IFD I;  2UUA Q;  2JK8 A;  1W3S A;  1UE5 A;  4A3B G;  1GVP A;  1R9T H;  3F2B A;  1OXV A;  1OXX K;  1Z47 A;  5C4J H;  4DKA C;  2JA8 G;  1IXR A;  2JA9 A;  2K5N A;  1CKM A;  1WJJ A;  2PQA A;  1I50 H;  3L7Z C;  4AH6 A;  1GM5 A;  2A19 A;  2BH2 A;  3HOU H;  2VNU D;  2MO0 A;  4QJF A;  3HOX G;  4A75 A;  1K73 C;  2I5H A;  3PIO A;  1HJP A;  1Y1V G;  4A3I H;  4NXM Q;  4DV2 Q;  1K9M C;  1EWI A;  1P8L A;  1TWF H;  1KD1 C;  4DV0 L;  4DR2 L;  4HJ9 A;  1PH8 A;  5BR8 L;  1XNQ Q;  5FLX c;  1WYD A;  3ERS X;  2VQF L;  4DV1 Q;  1BVS A;  2K50 A;  3M4P A;  3AFQ A;  2BA1 A;  3CCM A;  1SMX A;  2B3G A;  3U50 C;  3A5U A;  4XTC S;  2KBN A;  2L15 A;  3S1M H;  4B3T L;  2WAQ G;  4MNO A;  3K81 C;  4DV5 Q;  1KC8 C;  4A3J H;  2YU9 H;  2N3S A;  2ZTE A;  4R4T A;  1YIJ A;  2ZM6 Q;  1TWA H;  2ZJP A;  1X3F A;  5IWA Q;  1S3O A;  4DR1 Q;  4BBS G;  2EIF A;  4L5T A;  4IPD A;  1PYB A;  1E1T A;  1Q12 A;  2CCZ A;  3GTL H;  4JI0 L;  2QGQ A;  1SLJ A;  3NEL A;  1VQI A;  5JEA J;  1PH2 A;  4UP9 A;  2YV5 A;  1WCM H;  2Q2I A;  2UXB L;  1K83 H;  1EIF A;  1MKH A;  2VL6 A;  5IP7 H;  4LFA Q;  1YIT A;  1A63 A;  3F8T A;  4DR7 Q;  1O7I A;  3J81 c;  3DM3 A;  4X62 Q;  1S72 A;  2Z6K A;  2I0Q A;  2GVB A;  3M9B A;  1RL2 A;  2KEN A;  4A4I A;  5IYD G;  1Y1W G;  1HR0 W;  1VQM A;  3HOW H;  1Q81 C;  2JJQ A;  4DUY L;  4A3K G;  4KI0 A;  1VQ5 A;  3HOZ H;  4X64 Q;  5FJ8 G;  4POG A;  4PG3 A;  1Q86 C;  2JA7 H;  3PF4 A;  4AQY L;  4JV5 L;  4NXN Q;  4C2M H;  1HZB A;  4IFD J;  3I7F A;  4DV3 L;  4X66 Q;  4QIW E;  5C44 H;  3I4O A;  3RLF A;  2ALY B;  3OYY A;  1KRT A;  3CC4 A;  4OX9 Q;  2YYZ A;  2VW9 A;  1Q82 C;  3J80 i;  4DUZ Q;  3PUV A;  3PUY A;  3ICE A;  1XMQ Q;  3BU2 A;  1CKN B;  1CKO A;  1TWG H;  4DAY B;  5AJ3 L;  2UUC Q;  4MTN A;  4GKJ Q;  1J5E L;  2VUM H;  3VDY A;  3UDX A;  3KFU A;  5DLQ E;  2NZH A;  4JI2 L;  2IHF A;  4JI7 Q;  4A3M H;  4LF8 Q;  4NXM L;  1FJG L;  1N34 Q;  1OXT A;  1SE8 A;  2PMZ E;  2WP8 J;  4RG1 A;  1VQ7 A;  4JI6 L;  3RZO H;  4DR6 Q;  4A3G H;  1SRU A;  5LMN Q;  4UP7 A;  1Q8K A;  1MIU A;  1KAW A;  1ASY A;  3UE1 A;  2F52 A;  1PH6 A;  4LF5 L;  4DV1 L;  1Q1E A;  2WAQ E;  2B29 A;  3KDF A;  4YHH Q;  2A1A A;  3G48 A;  3IRB A;  4GNX A;  2OTJ A;  2XTI A;  1VS0 A;  3HOV G;  2ID0 A;  2E2H H;  1IBK L;  4LF7 Q;  1U0L A;  4QL5 A;  5J3B A;  4PZ6 A;  4DR5 Q;  3JC6 6;  1N8R C;  3PF5 A;  2OTL A;  1Y14 B;  3S2H H;  2F4V L;  2JA5 H;  2FXQ A;  4DAM A;  3I56 A;  3CPW A;  2N49 A;  4A3F G;  2MFI A;  3ULP A;  1CSQ A;  1P16 A;  4A3C H;  3I4M G;  5C3E G;  1IBL Q;  1A0I A;  2GN5 A;  1L1O B;  3AYH B;  3S15 H;  1XPO A;  4APV A;  4GN5 A;  3KLW A;  4JBJ A;  5JEA G;  1PH3 A;  5FLM G;  5M3F G;  2DGY A;  4YY3 L;  4LUO A;  3I4N H;  3G4S A;  1VQG A;  2BA0 A;  2WB1 G;  1JMC A;  4B3M Q;  5IYC H;  2UUB L;  4JI1 L;  1YJ9 A;  4GNX C;  4LFA L;  4P75 A;  1G29 1;  4HJ8 A;  4LFC Q;  4IJH A;  1N32 Q;  1KL9 A;  4DV6 Q;  2E5L L;  4X62 L;  3PGZ A;  3S24 A;  1B7Y B;  3KF8 B;  4A3I G;  2PI2 A;  2Y0S G;  3PIP A;  2LXK A;  3HKZ G;  1VQL A;  1EIY B;  4LF9 L;  2UXD L;  1I5F A;  1G6P A;  1QVF A;  4IFD G;  1FGU A;  4X65 Q;  4BY1 H;  1GKH A;  4NXN L;  2ASB A;  1EOV A;  1I6H H;  4C3I H;  4DK6 C;  5M3M G;  4PZ7 A;  4JOI A;  3I55 A;  3STB C;  3B6Y A;  5ELO A;  4DV7 L;  4LFB L;  2Q2H A;  1VQA A;  4LUZ A;  5C0X I;  4DUZ L;  4A76 A;  1NMG A;  1YZ6 A;  3ULL A;  2E2J H;  1T9H A;  3CF5 A;  4LF4 Q;  1OXU A;  3CCE A;  4HID A;  2UUC L;  4A3J G;  4J15 A;  4A3E H;  3TEH B;  2YTX A;  3GD7 A;  4DV4 Q;  5GAH C;  4GOP B;  4LF8 L;  1NBW A;  4JCV E;  1N34 L;  4A93 H;  3ZJY C;  4DR6 L;  2RF4 A;  4Y7N H;  4WJ3 M;  2D62 A;  1HZ9 A;  1VQJ A;  2NN6 I;  5IYB G;  3DLL A;  4P73 A;  2ATW A;  2PNH A;  1HNW Q;  1UE7 A;  3T1H L;  2JEA I;  1OXS C;  2YTV A;  4YHH L;  4DR3 L;  3J80 c;  1EFW A;  3CMA A;  4JI5 Q;  4LF6 Q;  2V1C C;  4JI4 Q;  3G71 A;  3M7N A;  1SR3 A;  4A3B H;  1LM0 A;  4R4O A;  1XNR Q;  1E1O A;  5IP7 G;  3UDF A;  4JOI C;  1VQ6 A;  1N36 L;  4LF7 L;  4P71 A;  2IT1 A;  3ULJ A;  1NY4 A;  4H02 A;  1PV4 A;  3H0G G;  3HOX H;  3HOW G;  2AWO A;  2Q2U A;  4AIM A;  1NMF A;  2UU9 L;  3PO2 G;  1IBL L;  3KF6 B;  2WB1 E;  4HIK A;  4TQU S;  1LTL A;  3PV0 A;  3L2P A;  2NZO A;  3STB D;  4JBW A;  2KCT A;  3T1Y Q;  1PYS B;  1VQF A;  2JA7 G;  3GTG H;  5C44 G;  1ASZ A;  2HIV A;  4UY8 C;  5GQO A;  4IPC A;  4GKK Q;  2VS1 A;  4R4C A;  4B3M L;  3EIV A;  3AFP A;  3MEF A;  1XMO L;  1QVC A;  5E7N A;  2K4K A;  5LMU L;  1IBM Q;  1QUQ B;  3NEM A;  4GLA C;  5IT9 c;  1NTG A;  2Y0S E;  3HKZ E;  4RMF A;  4B3R L;  1YEZ A;  1EUJ A;  2VQE Q;  1EQR A;  3W5O A;  4KLK A;  2JEB I;  3G6E A;  1IYJ B;  3CQZ H;  1PHJ A;  4JI3 Q;  3NBH B;  2VUM G;  4DR4 Q;  4FDB A;  4ME3 A;  5ELN A;  4JI8 Q;  2UUA L;  4IOA A;  3S17 H;  1YJN A;  4A3M G;  5C4X H;  2ZTC A;  3CCV A;  4ALP A;  2R7D A;  4A3G G;  2EXD A;  3GO5 A;  3D0F A;  4QGU A;  2K75 A;  1XPR A;  4BBS H;  3E9H A;  1FL0 A;  4HJ5 A;  2I5M X;  1YHQ A;  1C0A A;  3GTQ H;  1TXY A;  1BBU A;  1Z9F A;  3CCS A;  2QA4 A;  3J7A 5;  1PH1 A;  2HT1 A;  4KHP Q;  1HR0 Q;  4K0K Q;  3TRE A;  5C0X J;  1M90 C;  1PH9 A;  3UDG A;  1KIX A;  2JE6 I;  1K8G A;  3CCR A;  3KDF B;  4DV2 L;  2R92 G;  1KXL A;  3S1Q H;  4YCU A;  2IX0 A;  1X65 A;  3FKI G;  2OCE A;  4L5S A;  3RZD H;  4BY7 H;  1E22 A;  2R7F A;  4BBR G;  5LMN W;  1XNQ L;  2JA5 G;  4UP8 A;  2AKW B;  3OTO Q;  4NPS A;  4A3C G;  3PSI A;  4OO1 I;  4P72 A;  5FJ8 H;  4HJA A;  4P74 A;  3TQY A;  5HGQ A;  1PH4 A;  4BXX G;  1UEB A;  3GTM H;  2K14 A;  4DV0 Q;  2R93 H;  3F2D A;  2E8G A;  4DR2 Q;  2NVT H;  4A3D H;  1WI5 A;  2JQO A;  4DV5 L;  1B8A A;  4MZ9 A;  4JI5 L;  5BR8 Q;  4LF6 L;  2NVQ H;  3I4N G;  1LYL A;  5IYC G;  3PO3 G;  4O0A A;  1XNR L;  1XTD A;  2ZM6 L;  5IP9 G;  1Q7Y C;  5IWA L;  1TWC H;  3A74 A;  4R4Q A;  4DR1 L;  1K8A C;  1B70 B;  3FHW A;  4B3T Q;  4YWK A;  1JJC B;  2AMC B;  1VQ8 A;  1BBW A;  3CME A;  1W2B A;  4OWW B;  2HHH Q;  3CCL A;  1VQN A;  1MJE A;  3CC2 A;  4OWX B;  4L5Q A;  3S2D H;  3T1Y L;  1I94 Q;  1Q46 A;  4BY1 G;  4DR7 L;  3H3V H;  4DK3 C;  3E9I A;  2R7Z H;  3HOU G;  3U58 A;  2B63 H;  3F1Z A;  4JG2 A;  1K0R A;  1HNZ Q;  5H1S E;  2PQA B;  2KHJ A;  5GAG C;  3CCU A;  4Y52 H;  1VQE A;  2UXB Q;  4X64 L;  3HOV H;  1X6O A;  3PUZ A;  1QZG A;  1C7Y A;  3HKS A;  2VQE L;  1J6Q A;  4A3E G;  4JI3 L;  1VCI A;  5GAD C;  1N33 Q;  4DR4 L;  4QQB X;  3M4Q A;  4X66 L;  1KHI A;  5EAY A;  4AYB E;  3A0J A;  3S1R H;  3GDE A;  3M4O H;  3UE0 A;  2C35 B;  4OX9 L;  1L1O A;  3LGJ A;  3U4Z A;  3CD6 A;  4A93 G;  4YCW A;  1IL2 A;  1VQH A;  1U5K A;  4A3L H;  5C3E H;  2JA6 H;  3CCQ A;  2WFW A;  4B3S Q;  1XMQ L;  1CUK A;  1YNX A;  3GTP H;  3CC7 A;  4JV5 Q;  3PCO B;  4OXP A;  5C0X G;  5FLM H;  3RLN A;  4PZ8 A;  2CWP A;  3BZC A;  5M3F H;  4DV3 Q;  4GKJ L;  4KHZ A;  3HOY H;  5K36 G;  1OTC A;  4JI7 L;  3S1N H;  1UWV A;  2R6G A;  2GVA A;  3JAM i;  2H5X A;  2K52 A;  1D8L A;  1JJG A;  1NE3 A;  1SN8 A;  3K8A A;  1VQB A;  5LMN L;  1YBY A; 
#chains in the Genus database with same CATH topology
 5CA1 F;  4QUF A;  4CDC C;  4JI2 Q;  2PMZ A;  1WCM G;  4UPA A;  1VQD A;  4YQW A;  4DPG A;  3TZU A;  5C44 B;  1K0S A;  3BG5 A;  2XWB B;  4JI6 Q;  1L1O C;  2D0O A;  5T14 A;  2EYP A;  1V9P A;  1LTS D;  4ED1 A;  2WAQ A;  5M3M H;  3RR5 A;  4LF5 Q;  3PW2 A;  1RD9 D;  1IYV A;  1OWT A;  1SSO A;  2YZM A;  3RIZ A;  1W6J A;  1Y1V H;  3MFG A;  2VUM B;  3GV6 A;  3AB9 A;  1IBK Q;  2HIX A;  3K0X A;  2IMW P;  3I70 A;  2PZT A;  4LWC A;  4GOP A;  3A8I E;  3I90 A;  1VQO A;  2NVX H;  2IJ0 A;  2HHH L;  3GTJ A;  1KQS A;  1IHZ A;  3CAM A;  2EY6 A;  4YWL A;  4MTD A;  4QY7 A;  3RB4 A;  5GAE C;  1PTO D;  4EX5 A;  1HNX Q;  2LS0 1;  2VZA A;  3W1G A;  4DV6 L;  3PR5 B;  2EXZ A;  1SFO A;  1EIH A;  1KLU D;  3MWM A;  4ZRZ A;  4GN4 B;  4LJZ C;  3K3V A;  2ZDG A;  2LXJ A;  2BOS A;  4TSS A;  4APM A;  2CZG A;  1YI2 A;  1YVC A;  4V0B A;  1U4L A;  4X3T A;  1BOS A;  5KGU A;  4BY7 G;  2E5L Q;  4KD4 A;  4AYB G;  2K01 A;  1TR5 A;  3CRK C;  1LTA D;  1N33 L;  1N48 A;  4JI4 H;  2FIN B;  3GTJ H;  3BA9 A;  2FLP A;  1WTH A;  2ZM6 H;  5IGD A;  4FF2 A;  2CWA A;  4LF9 Q;  2E2I A;  2MNA A;  3PO2 H;  1W6K A;  1X3G A;  4E4T A;  2JSO A;  2PPB C;  1SFO H;  4ZK9 B;  1L0W A;  5DLF A;  3QZ7 A;  1BDO A;  3PW5 A;  1HZA A;  1DJR D;  2RDG A;  4C3H H;  2J9G A;  4LFB Q;  2L0C A;  5IYD H;  4ZI7 F;  1FVI A;  2B8F A;  3A8K E;  5CMD A;  3TS0 A;  2GPW A;  3NTK A;  2H4O A;  3NBH A;  1PH5 A;  1QNK A;  3KOJ A;  4MN3 A;  2NVY A;  2CH4 A;  2JEJ A;  1E24 A;  5JJL A;  3BYY B;  3H3V I;  2ATL A;  1KNE A;  3OW2 A;  4ABN A;  2G5D A;  1JE5 A;  1UE6 A;  3HGB A;  5EKL A;  3S1R B;  2VQE H;  2E2I H;  4LW1 A;  3RN5 A;  4JI3 H;  4DNI A;  4FF3 A;  1C9O A;  4EGJ A;  1B6R A;  1IOV A;  2WII B;  3GTP B;  3JAM c;  2VOB A;  4BA1 I;  2N78 A;  4C1N K;  3RN2 A;  2I5L X;  1QVG A;  3GLK A;  1N36 Q;  4EQ5 A;  2QK4 A;  2W6N A;  4MA0 A;  3VA5 A;  1YHA A;  2OH2 A;  4NKL A;  4BBR H;  1SEB D;  1BBX C;  1JT8 A;  1PFB A;  2NVY H;  4JW0 A;  4JI0 Q;  4O4L F;  5FD6 A;  1LT6 D;  2AQ3 B;  4IOC A;  4V19 0;  4OHJ A;  1GO3 E;  3BJU A;  3CXC A;  3RMH A;  3Q23 A;  4RNN A;  3MR6 A;  2MQH A;  4FXK C;  3F2C A;  2EZV A;  4GLV B;  1GUO A;  4QW8 A;  3HOY G;  1E7Z A;  1ZYR C;  1SE4 A;  4CKC A;  3S9W A;  4WRD A;  2J7Z A;  4CGY B;  1XMO Q;  4MV9 A;  1I4P A;  3BVG A;  1IZ6 A;  2Z0S A;  1VQ4 A;  3I4M H;  4TKO B;  4IQZ A;  1ILQ A;  1SYC A;  1IW7 D;  1STG A;  1DOL A;  4AQY Q;  3NQI A;  1TY2 A;  5JEA H;  2RVL A;  4K0K L;  1WTV A;  3K3P A;  4XZ3 B;  1WD0 A;  4YB8 B;  1QZH A;  4BA2 I;  1EOT A;  3M7G A;  3C1F A;  4A3B G;  1GVP A;  5ELF A;  4M1U B;  2ZJT A;  1Z47 A;  1ESF A;  2J0T D;  3LWU A;  1V1O A;  1K8O A;  1G6Z A;  2PMZ B;  2ZDH A;  1JOK A;  3JSN A;  2HHH H;  4K6D A;  1LT4 D;  1MHW C;  1WJJ A;  2F0E A;  2SCU B;  5IYZ F;  2VNU D;  1K73 C;  2I5H A;  4K8I A;  4A3I H;  4NXM Q;  2RGV A;  2EJG C;  1GHK A;  4J9O A;  3NTH A;  5JJZ A;  3BVM A;  4DV0 L;  2GLT A;  3C0F B;  4DR2 L;  1FR3 A;  4HJ9 A;  1O78 A;  1QNU A;  2KVM A;  3ERS X;  2VQF L;  4IWX A;  1TS3 A;  4I7H A;  4RFB A;  3M4P A;  2EOT A;  5KEE A;  5JUM A;  4ED0 A;  1N33 H;  2PQE A;  4EQP A;  3A5U A;  2KBN A;  3RV3 A;  3S1M H;  5DG9 A;  2EYL A;  1NR2 A;  1EWH A;  2W6Q A;  4TQR A;  3BQ1 A;  1Q3L A;  4BY7 B;  2N3S A;  3RFC A;  5BPH A;  1I6U A;  2F0J A;  4EEY A;  1YIJ A;  5KT5 A;  1AN7 A;  3K6O A;  1X3F A;  5IWA Q;  1S3O A;  2RA4 A;  5KYL A;  5JOB A;  1HCZ A;  2W71 A;  2QGQ A;  2AGO A;  1SLJ A;  3H4B A;  2NTT A;  4RCO A;  1VQI A;  4DXF A;  3BAA A;  2AGP A;  4UP9 A;  4B9W A;  4HED A;  4JK1 C;  2A5H A;  1YNJ C;  1EIF A;  2NVQ B;  2VL6 A;  5KFM A;  4LFA Q;  3FPU B;  4A2B A;  4G7H C;  5KFA A;  3DM3 A;  4X62 Q;  1TWC B;  3M9B A;  4GZY C;  2FLL A;  1RL2 A;  2F0I A;  1E2W A;  2PZU A;  1HR0 W;  3MXN A;  4A3K G;  4DUY L;  2K1B A;  1Q81 C;  4O3R A;  1ET9 A;  1RKN A;  3HOZ H;  2WE6 A;  3R93 A;  4QWE A;  4POG A;  3TP5 A;  4PG3 A;  3PF4 A;  4JV5 L;  1X3Q A;  1NAP A;  2PW5 A;  4IFD J;  2C00 A;  1SXT A;  3J80 W;  2F0D A;  3OYY A;  3BS1 A;  4MV7 A;  4IUN A;  4FYD A;  3NK9 A;  2E2H A;  1MGS A;  3PUY A;  3NXW A;  4QW9 A;  2ZXR A;  3BU2 A;  1XMQ Q;  2JP1 A;  4KHV A;  3OIP A;  4GKJ Q;  4MTN A;  3VDY A;  3UFX B;  3NWS A;  4C3J G;  1XTC D;  4JI2 L;  2B2U A;  1K1S A;  2PMZ E;  3NE5 B;  3NQT A;  4JI6 L;  4RG1 A;  3RZO H;  1NCV A;  1CT1 D;  3W3A A;  5BN5 A;  4ECZ A;  3I4M B;  1KJJ A;  3S1N H;  1PTO B;  4LF5 L;  5C5J A;  4DL4 A;  2WAQ E;  3KDF A;  4L63 B;  4JI1 H;  4GNX A;  3I4L A;  4Q8F A;  2ICI A;  3R2T A;  1U4M A;  1M0W A;  2E2H H;  1IBK L;  3V05 A;  1ZQ7 A;  1U0L A;  4QL5 A;  5J3B A;  4DR5 Q;  1H9S A;  4QCL A;  1N8R C;  1I4R A;  1JQY D;  2NBF A;  4FBU A;  1EZ6 A;  2X6G A;  3S2H H;  1KEE A;  4DNT B;  1CSQ A;  1P16 A;  1IBL Q;  4F7X A;  2MPM A;  4A3I B;  3G6X A;  3WNZ A;  4J8Q A;  3MZ5 A;  3G4S A;  4TUY F;  2GPS A;  1S97 A;  5KG1 A;  1YJ9 A;  3LWB A;  1G29 1;  4IJH A;  2E5L L;  3VYT A;  1GOZ A;  1EY9 A;  2VQF H;  2KQ3 A;  1B7Y B;  4ECY A;  3DEO A;  3H94 A;  1K28 A;  3RF2 A;  1LV9 A;  1M0T A;  1VQL A;  3HKZ G;  4LF9 L;  1H9J A;  2A6H D;  1S9F A;  1VBG A;  3TIG A;  1SYB A;  5FO8 B;  1QVF A;  1FGU A;  4K8J A;  1HQM C;  1EOV A;  3N41 B;  4DK6 C;  4KMU C;  4JOI A;  3KBX A;  5ELO A;  4LFB L;  1VAJ A;  1TVX A;  3A7A B;  1LT3 D;  2VB3 X;  3MWE A;  1NMG A;  4ECW A;  5EWG A;  1EU4 A;  2W9B B;  5FLX E;  3BDO A;  2EYM A;  4HID A;  2UUC L;  4A3J G;  1M7J A;  1F9Q A;  5GAH C;  2NZ1 D;  3VYR A;  4FO2 A;  4A93 H;  1MSG A;  4EQN A;  4Y7N H;  1A9X A;  3H0G B;  1S0O A;  3SHL A;  1OO9 B;  2NN6 I;  5IYB G;  2PNH A;  4HN7 A;  1UE7 A;  2VXW A;  2F0T A;  5LMU H;  2B2V A;  1BNC A;  4EFB A;  4YHH L;  4DUY H;  1EY0 A;  3CMA A;  5K36 H;  1AFP A;  2V1C C;  4JI4 Q;  3M7N A;  3T56 B;  1IKL A;  4JV5 H;  5IP7 G;  3LML A;  1N36 L;  4MV1 A;  3G6V A;  5KNC A;  3N6X A;  4A2A A;  3KHH A;  4E6I A;  4A3K B;  1EIG A;  1NY4 A;  2UUA H;  4HR7 A;  3S14 B;  1PZJ D;  1PV4 A;  5EGT A;  2NN6 H;  3HOX H;  2W8K A;  4J9P A;  1U9R A;  1TS4 A;  2Q2U A;  3T4A C;  1L2Z A;  2F0U A;  3URY A;  3J81 E;  4HIK A;  1D1K A;  2JA7 G;  2NZO A;  4JBW A;  1PYS B;  4TV9 F;  3RTX A;  3KTM A;  2W8L A;  3GTG H;  1T5X D;  4R8N A;  2XSC A;  3U9S A;  1F2Y A;  4IPC A;  4YJ3 F;  1XMO L;  3AFP A;  4HQ6 A;  4GLA C;  1PLF A;  1JB3 A;  1NTG A;  3PW0 A;  4C3J B;  5KFV A;  1MBY A;  1YEZ A;  2KA7 A;  2VQE Q;  3Q8P B;  4JI3 Q;  1PHJ A;  4FDB A;  4ME3 A;  2IP4 A;  4OGQ C;  5KG7 A;  3S17 H;  1IBK H;  4DLK A;  1I6V C;  2D2C C;  5C4X H;  1TS2 A;  3S2H B;  4A3G G;  2KSW A;  2A73 B;  2YS7 A;  2EXD A;  4XX0 B;  4DV5 H;  3GTM A;  4OIJ A;  2CVR A;  1C0A A;  2QA4 A;  4IZO A;  2J6U A;  1BCP D;  2HT1 A;  1GUS A;  1Z2N X;  2XRS D;  5C0X J;  3NTI A;  4DR1 H;  4ID6 A;  2EE1 A;  1K8G A;  3KDF B;  3T51 B;  3KK7 A;  2R92 G;  1KXL A;  2F0W A;  3EQL C;  2HD3 A;  2R7F A;  3QG1 A;  2OLS A;  1M4V A;  2CQA A;  2EYH A;  1H9S B;  4ED3 A;  2DIK A;  3K5I A;  5KFH A;  4DR7 H;  3D4W A;  4A3C G;  5M9O A;  3MWD A;  4OO1 I;  1WTW A;  4RZQ A;  4P72 A;  1DXM A;  3GTM H;  1R9T B;  1BUV T;  2E8G A;  3G7L A;  4A3D H;  1WI5 A;  2JQO A;  1WTP A;  1B8A A;  3I4N G;  4LF9 H;  4LF6 L;  2B63 A;  5IYC G;  1RTN A;  1XNR L;  1XTD A;  1STH A;  3HOU B;  4PNY A;  2OT2 A;  5IWA L;  5JVH 3;  1C30 A;  3GIJ A;  2NYZ D;  4ZAI A;  1WVL A;  3K5N A;  4ME5 A;  2NWG A;  1VQ8 A;  4LFB H;  5D1P A;  4OO1 H;  4OWW B;  2HHH Q;  4RB2 C;  3CC2 A;  1BXR A;  4PDB A;  4U6P A;  4RGO S;  4KTA A;  1B4O A;  1D2B A;  2UUC H;  2Q8R E;  4C3I G;  3CHB D;  5JQW A;  5T1G A;  3E9I A;  4DK3 C;  5FD5 A;  1C4Q A;  1CA5 A;  3U58 A;  2B63 H;  3D6C A;  1F2Z A;  4JG2 A;  3JSL A;  4DNR B;  1K0R A;  2XCP A;  4EBD A;  4RGT A;  4RNO A;  3RAX A;  3HOV H;  1SE2 A;  5KYI A;  1HTL D;  3PUZ A;  1C7Y A;  3C2P A;  4YHH H;  3HKS A;  3A56 A;  2D5D A;  1J6Q A;  2DJG C;  5GAD C;  4A3E G;  4J0M A;  1N33 Q;  4G4K A;  1ZHS A;  3HXL A;  4FXD A;  3M4Q A;  2O03 A;  5KFT A;  3V6H A;  1WD1 A;  2R3Z A;  1L1O A;  3LGJ A;  2C2D A;  3FMA A;  4A3L H;  4K5X A;  5C3E H;  3PW7 A;  2WFW A;  1XMQ L;  3KAJ A;  5F9L A;  5FLM H;  4GKJ L;  3BZC A;  5M3F H;  4KHZ A;  1KBL A;  4N9T A;  3GTG B;  1UWV A;  1TY0 A;  3VPC A;  2K52 A;  3DMU A;  1Q8I A;  1NNX A;  2RSO A;  3DUZ A;  5J2U F;  3K8A A;  5KFP A;  1ENC A;  1XMO H;  2M05 A;  1MSH A;  2CW0 C;  1I4Q A;  2AUJ D;  5IE8 A;  2DN8 A;  2VQD A;  4PMB A;  4OON A;  4YWM A;  4MV4 A;  1S40 A;  3H4D A;  3V4Z A;  3OTO L;  4MV6 A;  1RK6 A;  1UE1 A;  2F0N A;  2PO4 A;  1JIH A;  3S17 B;  5KFZ A;  3OUU A;  2LSS A;  4DR5 L;  1EYG A;  3R5H A;  1H9M A;  3GTL A;  4JBK A;  3CCJ A;  3J81 j;  1L2F A;  4B9X A;  4X65 H;  2MO1 A;  3TN2 A;  5M5X H;  1JOQ A;  1DOK A;  1EHI A;  3GIP A;  5EJW A;  3GV7 B;  1D1I A;  2K32 A;  2VA2 A;  4LF4 H;  3EA6 A;  3WDN A;  2EYO A;  3K7U C;  2L9H A;  2A8V A;  5BMV F;  2WKC A;  5J1Z A;  1CA6 A;  1AUV A;  1KNA A;  1RJT A;  2WDT A;  4EBC A;  5M5W H;  1M8A A;  3MA2 B;  1MJC A;  4LUV A;  2QEJ C;  3QO2 A;  3GTM B;  2K28 A;  5KFD A;  1HNZ L;  1K3B C;  3D31 A;  2H1E A;  5E1F A;  4G57 A;  1V43 A;  4JI1 Q;  5ELD A;  3AEV A;  3IFT A;  3DF7 A;  2EYJ A;  5C3W A;  4LF6 H;  1PFM A;  5JJI A;  2Q2T A;  3C1E A;  3CP0 A;  3N6R A;  1B3Q A;  1HZC A;  1XNR H;  2AQ4 A;  2K5V A;  4HNV A;  2EY2 A;  5A2Q E;  4FS2 A;  3HFZ B;  1ICW A;  3OHA A;  1NJI C;  1TII D;  1HXY D;  4MTK A;  2F0O A;  4O4H F;  4Z9C B;  2R85 A;  1G2S A;  2XGQ A;  3SE7 A;  4RH6 A;  2W9C A;  3AQQ A;  4XXE A;  4EBE A;  1CM9 A;  1G91 A;  4OEL B;  2B2W C;  2L4N A;  3J7Y W;  3H20 A;  1YHB A;  1EYZ A;  3RV4 A;  4EGV A;  2RSN A;  5EKK A;  1RJQ A;  3FKI A;  1H95 A;  1CHQ D;  5HGT A;  5A35 A;  2AWN A;  4I50 F;  2I46 A;  1IBM H;  4L5R C;  2FB9 A;  2HQL A;  5I2Y A;  2VQF Q;  4JI4 L;  2Z6K C;  4RCN A;  4PQX A;  3H40 A;  4Q45 A;  5TSS A;  2N8N A;  1MZB A;  4ED2 A;  5I47 A;  3NBI A;  1M1K C;  4M9U A;  2R7Z G;  4Q8E A;  1V1Q A;  3NWT A;  1PRT D;  1VMP A;  1JJ2 A;  1RJP A;  4PWQ A;  4IUV A;  2A68 C;  4I55 F;  4Q44 A;  1AE2 A;  2AQ2 B;  1O7Z A;  3FKI H;  3K80 C;  1F9R A;  4K14 A;  1STN A;  5CBE E;  3Q24 A;  1SYX B;  3DEP A;  3C3L A;  3KYH C;  1STA A;  3U4V A;  2O2L D;  4C5A A;  2W7O A;  4JC0 A;  1BCP B;  2ZJQ A;  4BXX H;  2IHE A;  3UI2 A;  2F3V A;  1GUW A;  1XPU A;  4R4I A;  5FPR A;  4RUA A;  1E0B A;  2F0Q A;  4I4T F;  3OTO H;  2K5W A;  1A8V A;  4RU9 A;  2XCA A;  2BH8 A;  3PO3 H;  5FKA C;  3TQ1 A;  5LMU Q;  1W93 A;  1BKB A;  4DUY Q;  4HIO A;  1UC9 A;  1VQC A;  5IP9 H;  2MP1 A;  1PA6 A;  1TWF A;  1GUG A;  2V5A A;  1GD7 A;  4ZKB B;  5FLX L;  2VY3 A;  3GTK A;  4IPG A;  1BQQ T;  2OF1 A;  5M5X B;  4IFD I;  2UUA Q;  1LAB A;  1UE5 A;  4XQN A;  3MR2 A;  5EBC A;  4N8F A;  4RB0 A;  3F2B A;  4KKS A;  4J9L A;  2JA9 A;  1B9M A;  2K5N A;  4N8X 1;  2PQA A;  3L7Z C;  4HMJ A;  2YU9 A;  2IL8 A;  4QJF A;  5M5W B;  5D8D A;  4X3U A;  4QWA A;  3I12 A;  1Y1V G;  3CQZ B;  2M9V A;  1K9M C;  1EWI A;  1P8L A;  1TWF H;  4XQJ A;  4IFD H;  3E5N A;  1HNZ H;  2YRX A;  2UXB H;  5CV9 A;  4BBS B;  3GTQ B;  3ND9 A;  1WCM A;  4KV6 A;  1K83 A;  3CCM A;  3JRW A;  3U50 C;  2B3G A;  3KLS A;  3KHG A;  4XTC S;  1UEA B;  3J81 L;  3BDC A;  2FMM A;  3TQT A;  2WAQ G;  4MNO A;  4EYH B;  3OHX C;  1EY4 A;  4DV5 Q;  2YU9 H;  3R23 A;  2ZTE A;  2HDM A;  4U68 A;  1V8Q A;  3VA7 A;  1R4Q B;  4DR1 Q;  2EIF A;  1PYB A;  1E1T A;  1Q12 A;  5IGF A;  1EUD B;  3NEL A;  1SMY D;  1S5F D;  5DM6 3;  2YV5 A;  4NMZ A;  2NVT B;  1WCM H;  2F3W A;  1KJI A;  2B2T C;  1K83 H;  5C4H A;  5I4D A;  3F8T A;  4DR7 Q;  2PCF B;  3GII A;  1J5E H;  1HA6 A;  1S72 A;  3ONA B;  5DNF A;  1TWG A;  3FEW X;  1FJG H;  5LHY 1;  3EVQ A;  2KEN A;  5IYD G;  2C28 A;  5G3L F;  1VQM A;  1LT5 D;  4XDX A;  2W9C B;  3I73 A;  2W6P A;  2F0K A;  5FJ8 G;  5EZY F;  2TMP A;  1Q86 C;  4CJ1 B;  4AYB A;  3IN5 A;  5C1O A;  3I7F A;  3VYU A;  2A69 C;  5KFN A;  1QCB D;  4O3S A;  1KDB A;  2VW9 A;  2R7Z B;  5FOB B;  1STE A;  1F2L A;  3ICE A;  4JPB W;  4EG0 A;  1TWG H;  4DAY B;  2UUC Q;  3MXU A;  3UDX A;  5CV6 A;  2IHF A;  5CV5 A;  4A3M H;  2FK2 A;  5K2M A;  1JCK B;  1OXT A;  4L6T B;  5DGA A;  1F77 A;  5I2X A;  3PIO 3;  4IUR A;  4ULL A;  3JAM E;  1KAW A;  1ASY A;  3MR3 A;  3QOL A;  3K5O A;  4IRC A;  3GV3 A;  2B29 A;  4YHH Q;  2A1A A;  3IRB A;  2R8H A;  3MHB A;  3VR2 A;  1VS0 A;  2WV6 D;  2XC9 A;  3CU7 A;  1E2Z A;  4HCE A;  4PZ6 A;  3HBL A;  5D1O A;  5EPJ A;  2OTL A;  2NUA B;  1S10 A;  5KT6 A;  3Q0A A;  4DAM A;  3I56 A;  4ZOL F;  2MFI A;  3ULP A;  2G9H D;  3I4M G;  1BXT A;  1Y69 U;  1O7Y A;  2DNC A;  1XPO A;  4APV A;  4GN5 A;  5JEA G;  2F0V A;  4DL6 A;  1LTR D;  3NHH A;  2HJW A;  1PXU A;  1YNN C;  1TWF B;  3R5F A;  4R9W A;  2BA0 A;  2DY7 A;  1JMC A;  4X3S A;  5M3M B;  4JI1 L;  2L5T A;  4K2K A;  1CHP D;  4P75 A;  4Y8V B;  1VMC A;  1KL9 A;  4XYQ A;  4ME6 A;  5HV6 A;  4QMG A;  4FS1 A;  1Y1V B;  3OHB A;  2EPB A;  1L0Y B;  1TAE A;  3KF8 B;  3GV8 B;  4HAE A;  2L12 A;  2BCO A;  2NVX B;  1SBB B;  1KAA A;  4A3I G;  3N40 P;  3PIP A;  4F4X A;  1G6P A;  4U67 3;  2KCC A;  4X65 Q;  2ASB A;  1ILP A;  4LSA A;  5LYJ F;  3I55 A;  3STB C;  5KKN B;  5KNB A;  2WAQ B;  1XX8 A;  4LUZ A;  4H44 C;  5C0X I;  4A76 A;  4DUZ L;  1V4Y A;  3ULL A;  1KDA A;  2E2J H;  4LF4 Q;  1DD2 A;  3ITP A;  2EY1 A;  3CCE A;  1PRT B;  1S5D D;  1CFM A;  2FPG B;  4ECV A;  2O5I C;  2HQE A;  4DV4 Q;  4GOP B;  5CV4 A;  1B50 A;  3L4J A;  4DR6 L;  3GTJ B;  2RF4 A;  4KJO A;  3DLL A;  1EUC B;  4UCV A;  2NU8 B;  5C0X H;  3PO2 B;  1OXS C;  1DYQ A;  1SFO B;  1EFW A;  4LF6 Q;  4UCS A;  4ZQI A;  5DQH A;  2UVW A;  3G71 A;  4ODG A;  4A3B H;  3ETH A;  3G6Y A;  2F1M A;  5IT9 L;  1XNR Q;  5T1I A;  4LF7 L;  4C3H B;  4KY5 A;  4DU9 A;  4P71 A;  2Z4H A;  3ULJ A;  5DEH A;  3QZ8 A;  1FGB D;  2EJF C;  3I3C A;  1Z6H A;  4LH7 A;  5DGB A;  3HZX A;  3H0G G;  3JRX A;  1TWG B;  4CKE A;  4RAU C;  1XDN A;  4ILW A;  3DM1 A;  5E4X A;  3L2P A;  4A3M B;  3IL8 A;  2BQ3 A;  3P20 A;  3OSN A;  4H0L C;  2E2I B;  2SNM A;  2HIV A;  1HPC A;  4P2C B;  2JEG A;  3N52 A;  3QFF A;  5LMU L;  1IBM Q;  5A2Q L;  4R8U A;  3OW7 A;  3BDL A;  1EUJ A;  1IYJ B;  1JX4 A;  3NBH B;  1Z7T A;  5ELN A;  1RHP A;  2UUA L;  4IOA A;  1YJN A;  4BBR B;  4O42 A;  3BAB A;  2NVY B;  2ZTC A;  3DWA A;  4ALP A;  4IRD A;  1XPR A;  1O7L A;  2VB2 X;  1G8Z D;  2I5M X;  2R93 A;  3J7A 5;  1TXY A;  3CCS A;  1E4E A;  1PH1 A;  2JYO A;  1X3P A;  3A55 A;  4ECQ A;  2BQU A;  5CR3 A;  1VBH A;  1WH2 A;  3T5J A;  3UDG A;  1F9S A;  4UCT A;  5KT3 A;  2QCP X;  4KY6 A;  4YCU A;  2IX0 A;  1X65 A;  2SEB D;  1DOM A;  2OCE A;  3SI8 A;  3RZD H;  4ECR A;  1II3 A;  3VMM A;  2VR1 A;  2E74 C;  2AKW B;  1L0X B;  3OTO Q;  2F0P A;  3I91 A;  3P75 A;  3PSI A;  3G8C A;  3SEB A;  1B6S A;  3ORR A;  1UEB A;  3L4K A;  2R93 H;  4DV5 L;  4JI5 L;  4CKB A;  2YYA A;  1GUN A;  4R7R A;  4ZQ3 A;  4X66 H;  4DR1 L;  1K8A C;  1B70 B;  2AMC B;  1BBW A;  4OIK A;  2E2J B;  2WTF A;  4DUZ H;  2C2R A;  2WAC A;  1PDQ A;  3M9O B;  4IUT A;  4L5Q A;  3S2D H;  1N56 A;  2JA6 A;  4QF4 A;  1CQF A;  4DR7 L;  4XYM B;  3KHL A;  2QKI C;  1I4G A;  5C3X A;  4GC7 A;  3HOU G;  3H3V C;  3S1M B;  4DR6 H;  3EJI A;  1HNZ Q;  5COR A;  5IIF A;  2UXB Q;  3IKJ A;  2CHB D;  2WKD A;  2B8G A;  5JVG 3;  3KXY T;  4ED6 A;  3FVQ A;  3KBG A;  1FYC A;  2FMC A;  2MUY A;  3T16 A;  4QQB X;  4AYB E;  3I72 A;  2IX3 A;  1S5B D;  2W7P A;  4LF7 H;  5C5M A;  4A93 G;  1IL2 A;  2Z4I A;  4KN4 C;  5JH7 F;  2JA6 H;  1CQV A;  3TP6 A;  4FF4 A;  4NDX A;  3SXH A;  4OXP A;  3VPB A;  1PTO C;  4IAL A;  4MA5 A;  5K36 G;  3J7A F;  2EY5 A;  2KHS A;  1B53 A;  2BR0 A;  2R7L A;  1EZ8 A;  1NE3 A;  3L9A X;  3JZI A;  2VA3 A;  5C4Z A;  1YBY A;  3HOZ B;  3K5H A;  2OQ0 A;  5AJ3 Q;  5KFO A;  2YW2 A;  1J5E Q;  2NN6 G;  4J6H A;  1EQV A;  4J9R A;  5KFB A;  1N32 H;  1B1Z A;  2KCM A;  1FJG Q;  2DJF C;  1S5E D;  3KJO A;  2JA8 H;  2RHQ B;  2D0P A;  4JUZ A;  4NW2 A;  3TRZ A;  3UDI A;  3K7A H;  2KED A;  2KEE A;  1JIC A;  2X0S A;  1VQ9 A;  4OEM B;  5DAU A;  4IJL A;  1AW7 A;  1U4R A;  3CPF A;  3BYT B;  3PUW A;  2OQK A;  3MXN B;  2F4I A;  2PZW A;  1XYI A;  2K04 A;  1VF7 A;  2C5C A;  2EQS A;  3RZO B;  3D4D A;  5EPK A;  5J22 A;  3RZD B;  3EN2 A;  5C4X G;  2V4D A;  1F2M A;  1SNO A;  3RBE A;  1EWC A;  1B3A A;  3CW2 C;  3S1N B;  3ETJ A;  4X6A H;  2B39 A;  1JDB B;  5KFF A;  5ELB A;  1SNC A;  2KOL A;  5IYB H;  1DV2 A;  2RCN A;  4DAV A;  2YS6 A;  4OWT B;  2ZTD A;  2E2H B;  3FP9 A;  3EPG A;  1WFQ A;  4DV2 H;  3PVX A;  4KN7 C;  2R93 B;  1JB7 A;  3X3M A;  1Y1W A;  1HNW H;  4GS3 A;  3RNU A;  4IO9 A;  1V1P A;  4LK1 C;  5GRO A;  4X65 L;  4F4Y A;  3SVM A;  4JI5 H;  4POF A;  4TQS A;  3GTO A;  3KF6 A;  1STY A;  3OMC A;  3M3Y H;  1KJQ A;  1X56 A;  2LKV A;  2YL2 A;  2KHI A;  3DHQ A;  2UXD Q;  3TIN A;  1ONL A;  3SGI A;  4JBM A;  5IOC A;  4TRD A;  4G3I A;  4GNX B;  1A3V A;  4J9M A;  4LF4 L;  2CFM A;  2IY5 B;  2F03 A;  1N9W A;  1EQT A;  3GP7 A;  4A3D G;  2ASL A;  1O80 A;  2I8C A;  5CGK A;  1QUQ A;  3JAM L;  4DV4 L;  1D6E C;  4K5V A;  1PFN A;  4DV7 Q;  1Y1W H;  3U9T A;  4RB3 C;  3KJP A;  3WO0 A;  1BO0 A;  4RHS A;  3GID A;  5LOV F;  2K6A A;  2IX1 A;  2RHS B;  2R92 A;  2GA4 B;  4R1J A;  2QIL A;  4ZHQ F;  4YCV A;  5KND A;  5JVL A;  2ZT9 C;  3GQB A;  1PVO A;  1MI2 A;  1TWH A;  1SE3 A;  1Y8N B;  4OO1 G;  1RJR A;  1EYC A;  5EWE A;  5EKI A;  3GTO H;  1WOC A;  4RWS C;  4JYA L;  1IW7 C;  1CKN A;  3RUP A;  4CJ0 B;  3E0E A;  4HJ7 A;  3N8D A;  2C9O A;  4IWY A;  1KRS A;  3W2D A;  1EY6 A;  3H6M A;  3EPI A;  4JI8 H;  3W1B A;  2CQO A;  4GLX A;  3T1H Q;  2JA6 B;  4IRK A;  5D3I B;  1HH2 P;  5I6W A;  2QDB A;  2Z9H A;  1X3E A;  1KC7 A;  1SAP A;  2QF7 A;  2R92 H;  1HR0 H;  2Q8T A;  2NB0 A;  1KDC A;  3LWE A;  3V6J A;  5M5Y H;  3GTK H;  4A93 B;  1RK5 A;  1TWH H;  4Y7N B;  1VQK A;  4RKL A;  3MJF A;  4EGQ A;  2UXC L;  1DM0 B;  4HIM A;  2F0S A;  2FE3 A;  5F2D A;  2WB1 A;  1IBM L;  4A3L G;  2YTY A;  2UU9 Q;  3WWV A;  4GN3 B;  4X3K A;  4KD3 A;  1GSA A;  5CC4 A;  3LP8 A;  1I50 A;  4NP5 A;  2JA8 B;  1AH9 A;  4LMQ D;  1XWE A;  2J4X A;  2SDF A;  3ERO A;  4UAI A;  3SDZ A;  5EOY A;  2Y0S A;  4A3F H;  2ES2 A;  3IFD A;  1PFS A;  2F3I A;  3L0O A;  4WJ4 A;  2A74 C;  3HOX B;  1E2V A;  5BR8 H;  2ZDQ A;  1S03 G;  1SND A;  2NU9 B;  2BE5 D;  5KT7 A;  1Q1B A;  4TVA B;  3MTS A;  2V59 A;  1W3S A;  1JWU D;  4B3T H;  4Q5V A;  2LFN A;  3M4Y A;  3BVZ A;  3GIM A;  1U4P A;  5NUC A;  1CQJ B;  1CKM A;  2A6E D;  4PMC A;  1S5C D;  1I50 H;  2A19 A;  5FO7 B;  3SK4 A;  2BH2 A;  1QE6 A;  1DIK A;  2MO0 A;  3MFH A;  3H09 A;  4HR7 B;  1HJP A;  2R82 A;  5KX5 F;  5KFC A;  1TWA A;  3DWP A;  4CDD C;  5KFY A;  5C4X B;  1VKZ A;  2KUM A;  4HNU A;  4JV0 A;  4QB4 A;  2RDH A;  1PH8 A;  1XNQ Q;  3M9N B;  1BVS A;  2K50 A;  1ZYR D;  3FPP A;  1SMX A;  3T5K A;  4YR3 A;  3VR6 A;  1PZK D;  3K81 C;  3KLR A;  1KC8 C;  2XIW A;  3ORQ A;  4IAJ A;  5L1L A;  5IT9 E;  4H7B A;  2FK1 A;  3QWN A;  1TWA H;  1RDP D;  2ZJP A;  4QWD A;  4DV3 H;  4BBS G;  4ZYS A;  4DV4 H;  4IPD A;  2W6M A;  3GTL H;  1JWM D;  3RGX A;  5KRU A;  1TKW B;  4IZ8 A;  2XD4 A;  4G7Z C;  4WBN F;  2LMC B;  4DF7 A;  1PH2 A;  2I80 A;  4A3D B;  2Q2I A;  2UXB L;  4RZR A;  4DL7 A;  1MKH A;  1S4Z A;  2R61 A;  1EEF D;  5JPM C;  2QDL A;  3X3N A;  2I0Q A;  4JYA H;  2VUM A;  5FLX W;  2K7V A;  4B08 A;  3HOW H;  2JJQ A;  4KI0 A;  4I7A A;  1VQ5 A;  2CH4 W;  3KLS X;  3OWE B;  4M8A A;  3K57 A;  4UCU A;  3F8N A;  1WTR A;  4X66 Q;  5C44 H;  5DLG A;  3I4O A;  1S0N A;  3RLF A;  4IR1 A;  1KRT A;  1FD7 D;  3CC4 A;  4O2A F;  1K1Q A;  1NR4 A;  2YYZ A;  4GC6 A;  3J80 i;  1Y8O B;  2X69 A;  3PUV A;  4DUZ Q;  2B63 B;  1J8I A;  2HVR A;  2UXC H;  4EVO A;  1CKN B;  4M7E A;  1CKO A;  2F4V H;  3PMF A;  2AGQ A;  3HOV B;  5AJ3 L;  1J5E L;  2VUM H;  2JA5 A;  4JI7 Q;  2VUG A;  1QWY A;  1ESR A;  2MGS A;  3MXP A;  1FJG L;  2R7K A;  4DR6 Q;  2UVU A;  2R8I A;  1J9O A;  1SRU A;  4YY3 H;  4UP7 A;  1Q8K A;  3VR4 A;  2FP4 B;  2VPS A;  3J81 W;  3Q6S A;  2A6H C;  5C3E B;  5L1K A;  2F52 A;  3I8Z A;  4DV1 L;  4ECT A;  3PQI A;  1ZEQ X;  2UUB H;  2W70 A;  3BZD B;  1EYD A;  2NU7 B;  1GGO A;  5M3F B;  2ID0 A;  1LTG D;  1PMR A;  2F0H A;  4ZLT F;  4LF7 Q;  3TP7 A;  2WB1 B;  1PZI D;  3JC6 6;  4LAA A;  1JKJ B;  5AFW A;  3RB6 A;  3HB9 A;  1PTO F;  1Y14 B;  5KT2 A;  1JWS D;  2JA5 H;  2FXQ A;  5JPN C;  1I50 B;  4UCO A;  4XYO A;  2Z8L A;  1CQI B;  2GN5 A;  1L1O B;  3AYH B;  3S15 H;  2NU6 B;  2RQX A;  1PH3 A;  2EDG A;  4KKT A;  2DY8 A;  2DGY A;  1ET6 A;  3RBD A;  3BA8 A;  5HBR B;  3EYY A;  4LFC Q;  3GTP A;  1N32 Q;  4YR0 A;  4IUU A;  3PGZ A;  3S24 A;  5D3D A;  3HG9 A;  3E6Z X;  1QIL A;  2PI2 A;  1UAP A;  2UXD L;  5KFJ A;  4IFD G;  2O4X A;  3SK5 A;  4BY1 H;  4NXN L;  4DR3 H;  1I6H H;  5KFR A;  1TWA B;  5EBD A;  5M3M G;  4PZ7 A;  1BR9 A;  3GTL B;  3B6Y A;  4EQO A;  4DV7 L;  4LSX A;  2Q2H A;  2RKS A;  3PN1 A;  2OEO A;  4YP3 A;  3CF5 A;  3L3O C;  4JV2 A;  3TEH B;  2YTX A;  3GD7 A;  1D5M C;  3MVV A;  4LF8 L;  4UHV A;  4U7C A;  1N34 L;  1HA5 A;  1KJ9 A;  1M6V A;  1LTT D;  1VQJ A;  3HOW B;  1HNW Q;  4P73 A;  4YIJ A;  4Q43 A;  3SR1 A;  3T1H L;  1Y8P B;  2YTV A;  4DAP A;  3J80 c;  4JI5 Q;  5KFX A;  4QWB A;  1FKA H;  1SR3 A;  2HVQ A;  4YAJ B;  4B3R H;  3TDQ A;  1E1O A;  1V51 A;  1VQ6 A;  1BCP C;  4HMI A;  2IT1 A;  1G2T A;  4IUQ A;  1ZHQ A;  4H02 A;  4FXG C;  1EYA A;  5CA0 F;  5IOD A;  4TV8 F;  1NMF A;  1B2T A;  2UU9 L;  4R8I A;  3PO2 G;  5KG2 A;  2WB1 E;  5I9P A;  1LTL A;  3PV0 A;  4O3Q A;  4C5C A;  4NLG A;  3OSP A;  2P0A A;  4F4Z A;  5DQI A;  2B2Y C;  1ENF A;  1ASZ A;  2N55 A;  2M00 A;  4UY8 C;  5GQO A;  4BS9 A;  4GKK Q;  2VS1 A;  4C3H G;  4R4C A;  4B3M L;  2DLN A;  3EIV A;  4C5B A;  3E5S A;  3CKI B;  1QVC A;  5E7N A;  1NUC A;  2K4K A;  1ML0 D;  2Y0S E;  1GXD C;  4DV1 H;  5BN3 A;  3A7L A;  1EQR A;  3W5O A;  1WSC A;  5L9X A;  3FKI B;  3K0Y A;  2HDL A;  5ELC A;  4JI8 Q;  4L8J A;  4A3M G;  2R7M A;  2RDJ A;  3QB3 A;  2KJX A;  3CCV A;  1B04 A;  2JA5 B;  3KUP A;  5BPF A;  1FL0 A;  4HJ5 A;  1YHQ A;  3D4R A;  1BBU A;  4KHP Q;  4I7Z C;  1LTB D;  1HR0 Q;  3RB3 A;  5I9O A;  3S15 B;  1MD2 D;  1M90 C;  5EWF A;  3ERQ A;  3S1Q H;  3RUZ A;  1S68 A;  1TWC A;  3PO3 B;  4BY7 H;  4N9P A;  1E22 A;  4BBR G;  1XNQ L;  2J6T A;  1XXG A;  5KFL A;  4UP8 A;  1IL8 A;  4MTE A;  5FJ8 H;  4HJA A;  4P74 A;  3TQY A;  2FHT A;  5HGQ A;  5KFQ A;  5IT9 W;  2JN4 A;  2IPK D;  4JV1 A;  1HQR D;  3F2D A;  3C46 A;  3LX0 A;  1HRJ A;  1PX2 A;  5BR8 Q;  2R84 A;  4BWS C;  2UXD H;  4BY1 B;  2NVQ H;  4X64 H;  1I6H B;  4FVM A;  4RA8 A;  2K5Q A;  1EZ1 A;  2BE5 C;  1CK1 A;  4DK1 A;  1RYR A;  4NXN H;  5I6Y A;  1Q7Y C;  2ENB A;  4PV1 C;  1TWC H;  4Q0Y A;  2EJM A;  5CV7 A;  4YWK A;  1CTM A;  4B3T Q;  3KAL A;  1UNN C;  3RJ0 A;  4DV7 H;  4OX9 H;  1JOO A;  2IWH A;  1SYD A;  4F8M A;  1W2B A;  4MV3 A;  1WTO A;  4RGM A;  1VQN A;  4WD3 A;  2A6E C;  4OWX B;  1SJH D;  2DPI A;  3GV5 B;  5CBA E;  2RBM A;  3T1Y L;  1BGW A;  2PW7 A;  5A2Q W;  1Q46 A;  1DZ1 A;  3H3V H;  1Q90 A;  2EVB A;  3RB0 A;  3TZD A;  1A3T A;  4LF8 H;  4F87 A;  3DXJ C;  1N34 H;  2XVS A;  1UNS A;  2PQA B;  5GAG C;  5LMN H;  4Y52 H;  4J9S A;  4ZUI A;  2V58 A;  2W6O A;  2YU9 B;  4JVZ A;  3T1H H;  2PNR C;  1TS5 A;  1QZG A;  2X6L A;  5KT4 A;  4XYL B;  4DR4 L;  4X66 L;  1ROD A;  5EAY A;  4WFN 3;  3M4O H;  3A0J A;  2HGS A;  4CC5 A;  2C35 B;  3IAY A;  3CD6 A;  5COY A;  2FK3 A;  4YCW A;  3PZP A;  1QB5 D;  1PTO H;  3CCQ A;  5G3L D;  2R86 A;  1WCM B;  3CC7 A;  5C0X G;  4QIW A;  1K83 B;  5HUR A;  3V2T A;  5LP6 F;  2CWP A;  4DV3 Q;  5IGE A;  3HOY H;  2WIN B;  1O75 A;  2UU9 H;  4JI7 L;  4O3N A;  1SEI A;  2GVA A;  2H5X A;  1D8L A;  2K33 A;  4HNT A;  1T5E A;  3OIQ A;  5EPL A;  4ED8 A;  4B3M H;  1VDZ A;  2E2D C;  3EBE A;  5KIX A;  4KJN A;  5EQ0 A;  4DV6 H;  3J7Z C;  4JYA Q;  1IOW A;  5JJK A;  1GSO A;  1LUZ A;  1HUM A;  4C56 C;  4ECS A;  3Q8D A;  2NTS A;  1GUT A;  1PH7 A;  1D7Q A;  2OWO A;  4K2L A;  2SOB A;  2W9B A;  2K05 A;  3HOZ G;  4RUC A;  4HSV A;  3WOF A;  2FFK B;  1JR0 D;  2HCC A;  2XWJ B;  2ZXP A;  1CS0 A;  2EYF A;  3WOE A;  3S1Q B;  3M4I A;  2BQR A;  3VR5 A;  2UXC Q;  3TS2 A;  2F4V Q;  2YCH A;  3H0G A;  4AYB B;  2F0G A;  1AP0 A;  1SYE A;  4ETS A;  5IY0 A;  1I94 L;  1Z2O X;  5L1I A;  4LFC L;  1N32 L;  4ED7 A;  1XNQ H;  3H91 A;  2ALZ A;  3M85 A;  2AHO B;  1EQQ A;  4FBT A;  3S16 H;  2HUG A;  2K5H A;  4IPH A;  3SK6 A;  3BZK A;  1EU3 A;  3PR4 A;  4YY3 Q;  3T5H A;  1RYS A;  2XGT A;  4RB1 A;  1SRO A;  1X9N A;  2CW0 D;  1CSP A;  2UUB Q;  3A54 A;  2PI2 E;  5LXT F;  3K5M A;  2QEX A;  1PRT C;  3MC0 B;  4MV8 A;  4FNF A;  1X54 A;  5KFW A;  3O13 A;  4GOP C;  3H0G H;  2RCF A;  2XGP A;  1E3P A;  4OL7 A;  1CE8 A;  4DXG A;  1F9P A;  4B3S L;  3M9M B;  2DUD A;  2IA6 A;  2R93 G;  2ZJR A;  2AUK A;  5HY6 A;  1EEI D;  1YJW A;  3FDT A;  4DA2 A;  3Q1K A;  5D1O B;  2DZD A;  3UQ8 A;  3T1Y H;  1XJV A;  2HCI A;  4A3K H;  4WOR A;  3NEN A;  3S14 H;  1SNM A;  4LNQ A;  1SJE D;  1HNW L;  1CZG A;  5KFK A;  3R2I A;  1S0M A;  4MAM A;  1A15 A;  1KJ8 A;  4RGN A;  1A62 A;  3A5Z B;  5DG7 A;  1I3Q A;  4XIG S;  2DNE A;  1A2U A;  1VQP A;  3M4O B;  2PBZ A;  4RHR A;  1JLL B;  2BDN A;  4DR4 H;  3SK8 A;  2XNA C;  4FP5 D;  3CRL C;  3RLO A;  2CKZ B;  1AE3 A;  3J81 i;  4O2D A;  2KCN A;  4DR3 Q;  2YRW A;  2XCL A;  5C5L A;  4C3J H;  2E76 C;  2L1B A;  3Q8R B;  3HOY B;  4K0K H;  3ER0 A;  2W57 A;  3PUX A;  1DGS A;  1HFG A;  1E4F T;  2O5J C;  4DGZ A;  4C1N I;  4JI7 H;  1G51 A;  2K03 A;  4GKK L;  3OSO A;  2FJ2 A;  1CZW A;  1I3Q H;  4PMW A;  1R9T A;  1RCV D;  1HNX L;  5IGG A;  3VR3 A;  2JA6 G;  1AN8 A;  4A3B B;  4FM9 A;  4O3P A;  3GIQ A;  1D5X C;  1X55 A;  3H15 A;  1K3R A;  4NB3 A;  4JI8 L;  4QIW B;  1GLV A;  5KFU A;  1RIP A;  2UVR A;  3R5X A;  1CI3 M;  2ZXO A;  3HKZ A;  4DV0 H;  4DR2 H;  1BCP F;  1ICF B;  4DK0 A;  3OOC A;  5BN4 A;  4B3R Q;  3I2Z A;  4IN3 A;  4KHP L;  3RGZ A;  2I87 A;  5LA6 F;  1B9N A;  1HR0 L;  2XN9 C;  5L37 A;  2JK8 A;  3JAM W;  2MCT A;  2K5D A;  1R9T H;  1OXV A;  1OXX K;  5ELE A;  3R3O A;  4DKA C;  5C4J H;  2JA8 G;  1IXR A;  1FNU A;  3MAQ A;  2R6F A;  1SMY C;  2A68 D;  4ZCK A;  1QOH A;  3K59 A;  4AH6 A;  3J80 L;  3MFY A;  1GM5 A;  2ASD A;  3HOU H;  5H80 A;  1Z2P X;  1IKM A;  3HOX G;  1C3O A;  4A75 A;  1I94 H;  3S16 B;  4LFC H;  3PIO A;  3T5L A;  1IYU A;  4DV2 Q;  2G9D A;  3D3R A;  2R8J A;  3J7A K;  1KD1 C;  1LLR D;  4FU0 A;  3QR8 A;  5KG3 A;  2AU0 A;  5BR8 L;  5FLX c;  1PYW D;  2R7N A;  1WYD A;  4DV1 Q;  1BJT A;  4J9K A;  1WTQ A;  2JEF A;  3R8B A;  4ZUJ A;  1HHV A;  3AFQ A;  2BA1 A;  5JAV A;  2C22 A;  2E75 C;  5LL6 X;  4CJ2 C;  3FMC A;  2L15 A;  4CHT B;  3U9O A;  4B3T L;  1GHJ A;  5FK9 C;  2N88 A;  3GTG A;  3N44 B;  4HTH A;  3Q22 A;  4A3J H;  1JE4 A;  4R8U B;  4O3O A;  3P1H A;  4FF1 A;  2W9A A;  4B3S H;  2PN1 A;  4R4T A;  5CYU A;  2ZM6 Q;  4CBV A;  1C8C A;  2JA7 A;  1H9R A;  4L5T A;  2L55 A;  2FPI B;  2CCZ A;  4C2M A;  2B2W A;  4JI0 L;  5FPO A;  1T94 A;  2W6Z A;  5JEA J;  1GJX A;  3FRP B;  4DL5 A;  1H9K A;  2MJ8 A;  1LTI D;  2I07 B;  1E4E B;  2M2L A;  5IP7 H;  1YIT A;  1A63 A;  1T3N A;  3Q8S B;  1O7I A;  3J81 c;  3BG3 A;  1HUN A;  2JXM B;  2D9U A;  4JI2 H;  2Z6K A;  3NP8 A;  3TII A;  2GVB A;  1DV1 A;  4K6L A;  1Y1W G;  4A4I A;  3CVZ A;  2J6S A;  4JI6 H;  3K58 A;  1SYF A;  4IHJ F;  5C8Y F;  4X64 Q;  2PYK A;  2YZN A;  1JXL A;  1HFN A;  1SCU B;  4LF5 H;  2JA7 H;  4AQY L;  4NXN Q;  4O1N A;  1RF2 D;  1HZB A;  4C2M H;  3S2D B;  3KAK A;  5CAE B;  5JVD F;  5LL6 S;  4DV3 L;  4QIW E;  4DL2 A;  4O2B F;  1PK8 A;  2ALY B;  5IGC A;  4OX9 Q;  3Q8Q B;  2MHV A;  3V96 A;  2V4Q A;  1Q82 C;  5J39 A;  4CDE C;  3NGD A;  3N42 B;  3BQ2 A;  1I3Q B;  2CW7 A;  4GKK H;  2QYZ A;  1KAB A;  1HNX H;  3KFU A;  5DLQ E;  2NZH A;  4LF8 Q;  4NXM L;  2F0L A;  1N34 Q;  2R87 A;  1KTK A;  1SE8 A;  2WP8 J;  1VQ7 A;  4A3G H;  4UCR A;  1ENA A;  4DL3 A;  5LMN Q;  4H13 C;  5KFS A;  1MIU A;  3UE1 A;  2SNS A;  1PH6 A;  1VF5 C;  3F2U A;  1Q1E A;  2B63 G;  2CW8 A;  4RNM A;  2DPJ A;  3G48 A;  2OTJ A;  2F0F A;  4F88 A;  4EFE A;  2XTI A;  2E5L H;  1I4H A;  3HOV G;  4KHP H;  2KEC A;  3D8G A;  3PF5 A;  5D65 A;  5C4J B;  3TME A;  2F4V L;  5E3F A;  3CPW A;  2Q8I B;  1EY7 A;  2N49 A;  4A3F G;  1W96 A;  2A69 D;  4A3C H;  5C3E G;  2P5Z X;  1A0I A;  3WO1 A;  2B2U C;  3HKZ B;  3KLW A;  4JBJ A;  5FLM G;  1C48 A;  5M3F G;  4YY3 L;  4LUO A;  3I4N H;  5E4W C;  1VQG A;  2WB1 G;  4B3M Q;  1K8M A;  5IYC H;  3K7A B;  1BF4 A;  2UUB L;  1AZP A;  4UFZ A;  4LFA L;  4GNX C;  4HJ8 A;  1A2T A;  4IUP A;  4DV6 Q;  4EYI B;  4X62 L;  4DN4 M;  3HP3 A;  3E0J A;  3MFI A;  1E4G T;  5DQG A;  2V9W A;  2FKL A;  4J1M A;  2Y0S G;  2LXK A;  1EIY B;  4A3J B;  1QJO A;  1I5F A;  3MR5 A;  2Z6B A;  1D5Z C;  1LO5 D;  3V6K A;  3QIA A;  3J7A V;  3QJY A;  1GKH A;  4KY7 A;  4C3I H;  3RAQ A;  1SNQ A;  2FLN A;  3GQC A;  1N36 H;  4G7O C;  1VQA A;  1GYF A;  1R4P B;  2OXP A;  4XT1 B;  1AEX A;  1YZ6 A;  3T53 B;  4S3S A;  4JI0 H;  1A3U A;  1FNV A;  1T9H A;  3P7J A;  4XT3 B;  3LNN A;  5C6A A;  1BNZ A;  1OXU A;  2FPP B;  2YZG A;  4J15 A;  4A3E H;  1AZQ A;  1TT2 A;  3AU7 A;  2B2T A;  1I7N A;  2LY7 A;  1NBW A;  4J9N A;  4HCS A;  4JCV E;  1YNN D;  3E3X A;  3ZJY C;  4WJ3 M;  3K5L A;  5IGB A;  2D62 A;  1HZ9 A;  4RAZ A;  2B2Y A;  4YJ2 F;  3T13 A;  3M3Y B;  2ATW A;  1UUP A;  1LAC A;  2IBK A;  1PRT F;  4WJW A;  2NUC A;  2JEA I;  1WTX A;  1T36 A;  2JA7 B;  1SYG A;  3IG0 A;  4DR3 L;  1B33 N;  4C2M B;  1LM0 A;  4Q0F A;  4R4O A;  4AQY H;  2ICE C;  3UDF A;  4JOI C;  2CQY A;  4F50 A;  1Y1W B;  1ZXT A;  3BJY A;  1RTO A;  5KG5 A;  3TSS A;  3FDS A;  1I4X A;  3ZYY X;  3CQZ A;  1V1P B;  5ISR A;  3MXG A;  5F9N A;  3MWY W;  3HOW G;  1FNW A;  2FJZ A;  2AWO A;  1A6X A;  4AIM A;  2BDO A;  3GTO B;  1IBL L;  3KF6 B;  1ULZ A;  2IW3 A;  4TQU S;  3T1Y Q;  3STB D;  2KCT A;  1VQF A;  1ZET A;  4J9Q A;  3KHR A;  4A3G B;  3BQ0 A;  3GTQ A;  4ECX A;  5C44 G;  4MHE A;  4NXM H;  3TBI B;  2L11 A;  2DWC A;  3MEF A;  2B2V C;  4L1K A;  4MIU A;  5GON F;  1QUQ B;  3NEM A;  3VYS A;  5IT9 c;  4F4W A;  3NSW A;  3HKZ E;  3DWQ A;  3OPO A;  1WR2 A;  2RDI A;  4RMF A;  4B3R L;  2FMA A;  3VPD A;  3NUC A;  4O4I F;  4LH6 A;  3D6W A;  2ASJ A;  3NPP A;  3G6E A;  4KLK A;  2JEB I;  3OUZ A;  3CQZ H;  2VUM G;  4DR4 Q;  2R92 B;  5M5Y B;  3GTK B;  1TWH B;  5DM7 3;  2R7D A;  3ND8 A;  3GO5 A;  3D0F A;  4QGU A;  2K75 A;  4BBS H;  5KFG A;  3E9H A;  5KG0 A;  3HEJ A;  3GIK A;  3GIL A;  2Z1C A;  4UDU C;  3PIP 3;  3GTQ H;  3Q2O A;  1Z9F A;  3HRZ C;  3OMG A;  4K0K Q;  2RDF A;  5LL6 b;  3TRE A;  1PH9 A;  5IWA H;  1AUX A;  1KIX A;  5KFI A;  2JE6 I;  3N43 B;  1ZKO A;  3I4N B;  3CCR A;  2XIG A;  4DV2 L;  4IR9 A;  3FKI G;  4L5S A;  4A3F B;  5LMN W;  2WYO A;  1YNJ D;  2R8G A;  1DCZ A;  1TQO A;  2JA5 G;  4LFA H;  5EDW A;  3TP8 A;  4ECU A;  3HS0 C;  2AQ1 B;  4NPS A;  4X62 H;  1I7L A;  4QWC A;  4K5W A;  1PH4 A;  4BXX G;  2K14 A;  4DV0 Q;  3SE0 A;  1JDE A;  1TU2 B;  4I65 A;  4DR2 Q;  2NVT H;  4RAY A;  5DG8 A;  3PW4 A;  2C2E A;  2R7Z A;  4MZ9 A;  1LYL A;  2F0M A;  4C3I B;  4ZKC B;  1EL0 A;  3PO3 G;  4O0A A;  4HYK A;  1QG7 A;  4CDF C;  1SNP A;  2ZM6 L;  2HVS A;  5IP9 G;  3RD4 A;  4DAY A;  5KFE A;  2UVV A;  3QOJ A;  4XQQ A;  3A74 A;  4R4Q A;  3AMU A;  3FHW A;  2Y0S B;  4EEQ A;  1JJC B;  1SDF A;  1KLG D;  4KK7 A;  3CME A;  1UC8 A;  3CCL A;  5KG4 A;  1TA8 A;  1DON A;  4A3E B;  1MJE A;  1XMQ H;  1GSH A;  3G6J B;  4DFA A;  1I94 Q;  1JC7 A;  4GKJ H;  2TSS A;  4BY1 G;  4YBZ B;  2XRQ D;  2R7Z H;  4YAK B;  5CV8 A;  3EFX D;  3F1Z A;  1EFI D;  4RKB A;  2PVP A;  5H1S E;  1JOR A;  2KHJ A;  3CCU A;  1VQE A;  5K5P A;  4X64 L;  3V4S A;  1X6O A;  2QW7 A;  5CB4 F;  3MEH A;  1X32 A;  2VQE L;  5D14 A;  4HSP A;  2VPQ A;  5C1P A;  4JI3 L;  1VCI A;  4YR2 A;  1EY5 A;  1NSN S;  1KHI A;  3S1R H;  5J2T F;  3GDE A;  3UE0 A;  4BWG B;  4OX9 L;  3U4Z A;  4DR5 H;  1VQH A;  5KG6 A;  1U5K A;  1EY8 A;  2JEI A;  4B3S Q;  1B44 D;  3GTP H;  1CUK A;  1YNX A;  4JV5 Q;  3PCO B;  5FO9 B;  3A8J E;  3RLN A;  4PZ8 A;  3OWF A;  1OTC A;  1IBL H;  2R6G A;  1HTP A;  2V4R A;  3JAM i;  1JJG A;  1Y1V A;  2R8K A;  5L1J A;  4CC6 A;  3KF8 A;  1STB A;  1SN8 A;  2RGR A;  4KKU A;  1VQB A;  5LMN L;  2NVX A;  4QUC A;  4LMY A;  3J80 E; 
#chains in the Genus database with same CATH homology
 3EBE A;  2OQ0 A;  5AJ3 Q;  5IE8 A;  1J5E Q;  2NN6 G;  4OON A;  4YWM A;  1S40 A;  4JI2 Q;  3OTO L;  1WCM G;  4UPA A;  1VQD A;  3J7Z C;  2KCM A;  4DPG A;  1FJG Q;  4JYA Q;  1UE1 A;  5JJK A;  4JI6 Q;  1L1O C;  2D0O A;  2LSS A;  1LUZ A;  2RHQ B;  3KJO A;  1V9P A;  4DR5 L;  2D0P A;  1EYG A;  2JA8 H;  3Q8D A;  3TRZ A;  3UDI A;  3K7A H;  1PH7 A;  4JBK A;  1D7Q A;  5M3M H;  3CCJ A;  3RR5 A;  1VQ9 A;  2OWO A;  4LF5 Q;  3J81 j;  1L2F A;  3HOZ G;  1Y1V H;  4IJL A;  1IBK Q;  2MO1 A;  2HIX A;  3K0X A;  3CPF A;  4LWC A;  3PUW A;  2OQK A;  3MXN B;  5M5X H;  4GOP A;  1VQO A;  2NVX H;  2EQS A;  2HHH L;  2UXC Q;  1KQS A;  3TS2 A;  2F4V Q;  3CAM A;  3EN2 A;  5C4X G;  4YWL A;  4QY7 A;  5IY0 A;  5GAE C;  3CW2 C;  4EX5 A;  1HNX Q;  1I94 L;  4X6A H;  2VZA A;  3K7U C;  4LFC L;  3W1G A;  2A8V A;  1N32 L;  5IYB H;  4DV6 L;  3M85 A;  2AHO B;  1EQQ A;  2RCN A;  5M5W H;  4LUV A;  4OWT B;  1MJC A;  2ZTD A;  2K5H A;  3FP9 A;  1WFQ A;  3BZK A;  4IPH A;  3S16 H;  4GN4 B;  4YY3 Q;  2XGT A;  1HNZ L;  2LXJ A;  1JB7 A;  4GS3 A;  3RNU A;  1YI2 A;  1SRO A;  1YVC A;  3D31 A;  1CSP A;  4IO9 A;  4JI1 Q;  1V43 A;  2PI2 E;  1X9N A;  2UUB Q;  3AEV A;  5GRO A;  2QEX A;  4X65 L;  2E5L Q;  4BY7 G;  4AYB G;  5JJI A;  1N33 L;  2Q2T A;  4POF A;  1X54 A;  3CP0 A;  1HZC A;  3GTJ H;  4GOP C;  3KF6 A;  3H0G H;  2K5V A;  3M3Y H;  1X56 A;  2CWA A;  2KHI A;  4LF9 Q;  2UXD Q;  3HFZ B;  1E3P A;  3SGI A;  2MNA A;  1NJI C;  4JBM A;  1X3G A;  4B3S L;  4GNX B;  3PO2 H;  4LF4 L;  2DUD A;  2CFM A;  1SFO H;  2R93 G;  1N9W A;  1L0W A;  2ZJR A;  2IY5 B;  4A3D G;  1YJW A;  5HY6 A;  3AQQ A;  1QUQ A;  1HZA A;  4DV4 L;  4C3H H;  4DV7 Q;  1Y1W H;  4LFB Q;  5IYD H;  1FVI A;  3KJP A;  1XJV A;  1YHB A;  4A3K H;  3TS0 A;  2IX1 A;  2RHS B;  3NEN A;  4LNQ A;  3S14 H;  4R1J A;  1PH5 A;  4YCV A;  3KOJ A;  1HNW L;  1H95 A;  2AWN A;  1PVO A;  4OO1 G;  4L5R C;  1A62 A;  1E24 A;  3A5Z B;  2HQL A;  3GTO H;  1WOC A;  5JJL A;  2VQF Q;  3H3V I;  4JI4 L;  2Z6K C;  4XIG S;  3OW2 A;  4JYA L;  1JE5 A;  1CKN A;  1UE6 A;  1VQP A;  2E2I H;  3E0E A;  2N8N A;  4LW1 A;  4HJ7 A;  4DNI A;  3RN5 A;  1C9O A;  1KRS A;  3RLO A;  1M1K C;  3W1B A;  2CQO A;  4GLX A;  3T1H Q;  2R7Z G;  2CKZ B;  1AE3 A;  1V1Q A;  4O2D A;  1HH2 P;  3J81 i;  3JAM c;  4DR3 Q;  2B63 G;  4BA1 I;  4C3J H;  2N78 A;  3RN2 A;  1JJ2 A;  2I5L X;  1QVG A;  1X3E A;  1AE2 A;  1N36 Q;  4EQ5 A;  3ER0 A;  2R92 H;  3FKI H;  3K80 C;  3PUX A;  1DGS A;  5M5Y H;  1YHA A;  3GTK H;  1TWH H;  4BBR H;  1VQK A;  1JT8 A;  1G51 A;  2NVY H;  4JI0 Q;  2UXC L;  4HIM A;  4GKK L;  3KYH C;  1I3Q H;  3U4V A;  4PMW A;  1IBM L;  1HNX L;  4A3L G;  4IOC A;  2YTY A;  4JC0 A;  3WWV A;  2UU9 Q;  1GO3 E;  3BJU A;  4GN3 B;  3CXC A;  2JA6 G;  2ZJQ A;  4BXX H;  2IHE A;  2MQH A;  3F2C A;  1XPU A;  4R4I A;  4GLV B;  1X55 A;  3H15 A;  3HOY G;  1E7Z A;  1K3R A;  1A8V A;  4NB3 A;  4JI8 L;  1AH9 A;  2BH8 A;  1XMO Q;  1RIP A;  3PO3 H;  5LMU Q;  1BKB A;  4A3F H;  2ES2 A;  4DUY Q;  1IZ6 A;  1PFS A;  2F3I A;  3L0O A;  1VQC A;  4HIO A;  5IP9 H;  2Z0S A;  1VQ4 A;  3I4M H;  4WJ4 A;  1PA6 A;  4B3R Q;  3I2Z A;  4AQY Q;  4KHP L;  1Q1B A;  1GD7 A;  4TVA B;  4K0K L;  2VY3 A;  1HR0 L;  1QZH A;  4IPG A;  4BA2 I;  4IFD I;  2UUA Q;  2JK8 A;  1W3S A;  1UE5 A;  4A3B G;  1GVP A;  1R9T H;  3F2B A;  1OXV A;  1OXX K;  1Z47 A;  5C4J H;  4DKA C;  2JA8 G;  1IXR A;  2JA9 A;  2K5N A;  1CKM A;  1WJJ A;  2PQA A;  1I50 H;  3L7Z C;  4AH6 A;  1GM5 A;  2A19 A;  2BH2 A;  3HOU H;  2VNU D;  2MO0 A;  4QJF A;  3HOX G;  4A75 A;  1K73 C;  2I5H A;  3PIO A;  1HJP A;  1Y1V G;  4A3I H;  4NXM Q;  4DV2 Q;  1K9M C;  1EWI A;  1P8L A;  1TWF H;  1KD1 C;  4DV0 L;  4DR2 L;  4HJ9 A;  1PH8 A;  5BR8 L;  1XNQ Q;  5FLX c;  1WYD A;  3ERS X;  2VQF L;  4DV1 Q;  1BVS A;  2K50 A;  3M4P A;  3AFQ A;  2BA1 A;  3CCM A;  1SMX A;  2B3G A;  3U50 C;  3A5U A;  4XTC S;  2KBN A;  2L15 A;  3S1M H;  4B3T L;  2WAQ G;  4MNO A;  3K81 C;  4DV5 Q;  1KC8 C;  4A3J H;  2YU9 H;  2N3S A;  2ZTE A;  4R4T A;  1YIJ A;  2ZM6 Q;  1TWA H;  2ZJP A;  1X3F A;  5IWA Q;  1S3O A;  4DR1 Q;  4BBS G;  2EIF A;  4L5T A;  4IPD A;  1PYB A;  1E1T A;  1Q12 A;  2CCZ A;  3GTL H;  4JI0 L;  2QGQ A;  1SLJ A;  3NEL A;  1VQI A;  5JEA J;  1PH2 A;  4UP9 A;  2YV5 A;  1WCM H;  2Q2I A;  2UXB L;  1K83 H;  1EIF A;  1MKH A;  2VL6 A;  5IP7 H;  4LFA Q;  1YIT A;  1A63 A;  3F8T A;  4DR7 Q;  1O7I A;  3J81 c;  3DM3 A;  4X62 Q;  1S72 A;  2Z6K A;  2I0Q A;  2GVB A;  3M9B A;  1RL2 A;  2KEN A;  4A4I A;  5IYD G;  1Y1W G;  1HR0 W;  1VQM A;  3HOW H;  1Q81 C;  2JJQ A;  4DUY L;  4A3K G;  4KI0 A;  1VQ5 A;  3HOZ H;  4X64 Q;  5FJ8 G;  4POG A;  4PG3 A;  1Q86 C;  2JA7 H;  3PF4 A;  4AQY L;  4JV5 L;  4NXN Q;  4C2M H;  1HZB A;  4IFD J;  3I7F A;  4DV3 L;  4X66 Q;  4QIW E;  5C44 H;  3I4O A;  3RLF A;  2ALY B;  3OYY A;  1KRT A;  3CC4 A;  4OX9 Q;  2YYZ A;  2VW9 A;  1Q82 C;  3J80 i;  4DUZ Q;  3PUV A;  3PUY A;  3ICE A;  1XMQ Q;  3BU2 A;  1CKN B;  1CKO A;  1TWG H;  4DAY B;  5AJ3 L;  2UUC Q;  4MTN A;  4GKJ Q;  1J5E L;  2VUM H;  3VDY A;  3UDX A;  3KFU A;  5DLQ E;  2NZH A;  4JI2 L;  2IHF A;  4JI7 Q;  4A3M H;  4LF8 Q;  4NXM L;  1FJG L;  1N34 Q;  1OXT A;  1SE8 A;  2PMZ E;  2WP8 J;  4RG1 A;  1VQ7 A;  4JI6 L;  3RZO H;  4DR6 Q;  4A3G H;  1SRU A;  5LMN Q;  4UP7 A;  1Q8K A;  1MIU A;  1KAW A;  1ASY A;  3UE1 A;  2F52 A;  1PH6 A;  4LF5 L;  4DV1 L;  1Q1E A;  2WAQ E;  2B29 A;  3KDF A;  4YHH Q;  2A1A A;  3G48 A;  3IRB A;  4GNX A;  2OTJ A;  2XTI A;  1VS0 A;  3HOV G;  2ID0 A;  2E2H H;  1IBK L;  4LF7 Q;  1U0L A;  4QL5 A;  5J3B A;  4PZ6 A;  4DR5 Q;  3JC6 6;  1N8R C;  3PF5 A;  2OTL A;  1Y14 B;  3S2H H;  2F4V L;  2JA5 H;  2FXQ A;  4DAM A;  3I56 A;  3CPW A;  2N49 A;  4A3F G;  2MFI A;  3ULP A;  1CSQ A;  1P16 A;  4A3C H;  3I4M G;  5C3E G;  1IBL Q;  1A0I A;  2GN5 A;  1L1O B;  3AYH B;  3S15 H;  1XPO A;  4APV A;  4GN5 A;  3KLW A;  4JBJ A;  5JEA G;  1PH3 A;  5FLM G;  5M3F G;  2DGY A;  4YY3 L;  4LUO A;  3I4N H;  3G4S A;  1VQG A;  2BA0 A;  2WB1 G;  1JMC A;  4B3M Q;  5IYC H;  2UUB L;  4JI1 L;  1YJ9 A;  4GNX C;  4LFA L;  4P75 A;  1G29 1;  4HJ8 A;  4LFC Q;  4IJH A;  1N32 Q;  1KL9 A;  4DV6 Q;  2E5L L;  4X62 L;  3PGZ A;  3S24 A;  1B7Y B;  3KF8 B;  4A3I G;  2PI2 A;  2Y0S G;  3PIP A;  2LXK A;  3HKZ G;  1VQL A;  1EIY B;  4LF9 L;  2UXD L;  1I5F A;  1G6P A;  1QVF A;  4IFD G;  1FGU A;  4X65 Q;  4BY1 H;  1GKH A;  4NXN L;  2ASB A;  1EOV A;  1I6H H;  4C3I H;  4DK6 C;  5M3M G;  4PZ7 A;  4JOI A;  3I55 A;  3STB C;  3B6Y A;  5ELO A;  4DV7 L;  4LFB L;  2Q2H A;  1VQA A;  4LUZ A;  5C0X I;  4DUZ L;  4A76 A;  1NMG A;  1YZ6 A;  3ULL A;  2E2J H;  1T9H A;  3CF5 A;  4LF4 Q;  1OXU A;  3CCE A;  4HID A;  2UUC L;  4A3J G;  4J15 A;  4A3E H;  3TEH B;  2YTX A;  3GD7 A;  4DV4 Q;  5GAH C;  4GOP B;  4LF8 L;  1NBW A;  4JCV E;  1N34 L;  4A93 H;  3ZJY C;  4DR6 L;  2RF4 A;  4Y7N H;  4WJ3 M;  2D62 A;  1HZ9 A;  1VQJ A;  2NN6 I;  5IYB G;  3DLL A;  4P73 A;  2ATW A;  2PNH A;  1HNW Q;  1UE7 A;  3T1H L;  2JEA I;  1OXS C;  2YTV A;  4YHH L;  4DR3 L;  3J80 c;  1EFW A;  3CMA A;  4JI5 Q;  4LF6 Q;  2V1C C;  4JI4 Q;  3G71 A;  3M7N A;  1SR3 A;  4A3B H;  1LM0 A;  4R4O A;  1XNR Q;  1E1O A;  5IP7 G;  3UDF A;  4JOI C;  1VQ6 A;  1N36 L;  4LF7 L;  4P71 A;  2IT1 A;  3ULJ A;  1NY4 A;  4H02 A;  1PV4 A;  3H0G G;  3HOX H;  3HOW G;  2AWO A;  2Q2U A;  4AIM A;  1NMF A;  2UU9 L;  3PO2 G;  1IBL L;  3KF6 B;  2WB1 E;  4HIK A;  4TQU S;  1LTL A;  3PV0 A;  3L2P A;  2NZO A;  3STB D;  4JBW A;  2KCT A;  3T1Y Q;  1PYS B;  1VQF A;  2JA7 G;  3GTG H;  5C44 G;  1ASZ A;  2HIV A;  4UY8 C;  5GQO A;  4IPC A;  4GKK Q;  2VS1 A;  4R4C A;  4B3M L;  3EIV A;  3AFP A;  3MEF A;  1XMO L;  1QVC A;  5E7N A;  2K4K A;  5LMU L;  1IBM Q;  1QUQ B;  3NEM A;  4GLA C;  5IT9 c;  1NTG A;  2Y0S E;  3HKZ E;  4RMF A;  4B3R L;  1YEZ A;  1EUJ A;  2VQE Q;  1EQR A;  3W5O A;  4KLK A;  2JEB I;  3G6E A;  1IYJ B;  3CQZ H;  1PHJ A;  4JI3 Q;  3NBH B;  2VUM G;  4DR4 Q;  4FDB A;  4ME3 A;  5ELN A;  4JI8 Q;  2UUA L;  4IOA A;  3S17 H;  1YJN A;  4A3M G;  5C4X H;  2ZTC A;  3CCV A;  4ALP A;  2R7D A;  4A3G G;  2EXD A;  3GO5 A;  3D0F A;  4QGU A;  2K75 A;  1XPR A;  4BBS H;  3E9H A;  1FL0 A;  4HJ5 A;  2I5M X;  1YHQ A;  1C0A A;  3GTQ H;  1TXY A;  1BBU A;  1Z9F A;  3CCS A;  2QA4 A;  3J7A 5;  1PH1 A;  2HT1 A;  4KHP Q;  1HR0 Q;  4K0K Q;  3TRE A;  5C0X J;  1M90 C;  1PH9 A;  3UDG A;  1KIX A;  2JE6 I;  1K8G A;  3CCR A;  3KDF B;  4DV2 L;  2R92 G;  1KXL A;  3S1Q H;  4YCU A;  2IX0 A;  1X65 A;  3FKI G;  2OCE A;  4L5S A;  3RZD H;  4BY7 H;  1E22 A;  2R7F A;  4BBR G;  5LMN W;  1XNQ L;  2JA5 G;  4UP8 A;  2AKW B;  3OTO Q;  4NPS A;  4A3C G;  3PSI A;  4OO1 I;  4P72 A;  5FJ8 H;  4HJA A;  4P74 A;  3TQY A;  5HGQ A;  1PH4 A;  4BXX G;  1UEB A;  3GTM H;  2K14 A;  4DV0 Q;  2R93 H;  3F2D A;  2E8G A;  4DR2 Q;  2NVT H;  4A3D H;  1WI5 A;  2JQO A;  4DV5 L;  1B8A A;  4MZ9 A;  4JI5 L;  5BR8 Q;  4LF6 L;  2NVQ H;  3I4N G;  1LYL A;  5IYC G;  3PO3 G;  4O0A A;  1XNR L;  1XTD A;  2ZM6 L;  5IP9 G;  1Q7Y C;  5IWA L;  1TWC H;  3A74 A;  4R4Q A;  4DR1 L;  1K8A C;  1B70 B;  3FHW A;  4B3T Q;  4YWK A;  1JJC B;  2AMC B;  1VQ8 A;  1BBW A;  3CME A;  1W2B A;  4OWW B;  2HHH Q;  3CCL A;  1VQN A;  1MJE A;  3CC2 A;  4OWX B;  4L5Q A;  3S2D H;  3T1Y L;  1I94 Q;  1Q46 A;  4BY1 G;  4DR7 L;  3H3V H;  4DK3 C;  3E9I A;  2R7Z H;  3HOU G;  3U58 A;  2B63 H;  3F1Z A;  4JG2 A;  1K0R A;  1HNZ Q;  5H1S E;  2PQA B;  2KHJ A;  5GAG C;  3CCU A;  4Y52 H;  1VQE A;  2UXB Q;  4X64 L;  3HOV H;  1X6O A;  3PUZ A;  1QZG A;  1C7Y A;  3HKS A;  2VQE L;  1J6Q A;  4A3E G;  4JI3 L;  1VCI A;  5GAD C;  1N33 Q;  4DR4 L;  4QQB X;  3M4Q A;  4X66 L;  1KHI A;  5EAY A;  4AYB E;  3A0J A;  3S1R H;  3GDE A;  3M4O H;  3UE0 A;  2C35 B;  4OX9 L;  1L1O A;  3LGJ A;  3U4Z A;  3CD6 A;  4A93 G;  4YCW A;  1IL2 A;  1VQH A;  1U5K A;  4A3L H;  5C3E H;  2JA6 H;  3CCQ A;  2WFW A;  4B3S Q;  1XMQ L;  1CUK A;  1YNX A;  3GTP H;  3CC7 A;  4JV5 Q;  3PCO B;  4OXP A;  5C0X G;  5FLM H;  3RLN A;  4PZ8 A;  2CWP A;  3BZC A;  5M3F H;  4DV3 Q;  4GKJ L;  4KHZ A;  3HOY H;  5K36 G;  1OTC A;  4JI7 L;  3S1N H;  1UWV A;  2R6G A;  2GVA A;  3JAM i;  2H5X A;  2K52 A;  1D8L A;  1JJG A;  1NE3 A;  1SN8 A;  3K8A A;  1VQB A;  5LMN L;  1YBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...