4BBSG

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbsG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bbsG01
4P71A 2JA8G 1Y1WH 2NN6I 1O7IA 1UE7A 4POGA 3BJUA 2K50A 1YJWA 4P73A 2JEAI 1I94Q 3DM3A 4A4IA 3KF8B 1WCMG 4JV5Q 3M4OH 3PV0A 2KENA 1QVFA 3I55A 1VQ5A 2BH2A 1QVGA 2VS1A 4BA1I 1GD7A 5C0XG 3UDFA 4HJ9A 4YY3Q 5IWAQ 4LFCQ 3GTLH 1AE3A 2QGQA 1L1OA 2E2HH 3OYYA 3GTGH 4OWTB 2N3SA 1R9TH 3HOUG 1N36L 2K5HA 2EIFA 1WYDA 3JAMc 3KJOA 4X66Q 3HOYH 2IY5B 4MZ9A 4IPCA 1U0LA 2I5MX 5IYBG 4DR2Q 4FDBA 4DUZQ 4A75A 1J5EL 1IXRA 3FHWA 5M5XH 1VQBA 3KFUA 4LUZA 2KBNA 4DV3Q 3T1YQ 4B3ML 2N49A 4DK3C 1CKMA 2UU9L 4DR1L 5IT9c 4KLKA 1JJ2A 2OQKA 2B3GA 4JI1L 1N9WA 2JA5H 2ASBA 1WFQA 2NZHA 1Q82C 4IOAA 4DUYL 2HIVA 3J7ZC 4A3JG 4LFBL 1I6HH 4DPGA 2MQHA 2LSSA 1YEZA 3CD6A 1IBLQ 3RN2A 3M4PA 4DV1Q 2Q2IA 1GO3E 4XTCS 3TS2A 3E9IA 5GQOA 4LF6Q 3S2DH 4JI7Q 2GVBA 4DR7Q 2BA1A 1GM5A 2OTJA 2RHQB 3HKZG 2JEBI 3S15H 4A3GG 3ER0A 1JJGA 3AYHB 2E2IH 3S24A 1VQ9A 2JA7H 3W5OA 4IOCA 1KD1C 4KI0A 1VQPA 2R93H 1PHJA 1EUJA 2YTXA 1CKNA 4AYBE 3G4SA 4DV5Q 4BBSG 1H95A 1LTLA 4YHHL 4DR5L 1LUZA 2E8GA 4JI6Q 4A3BG 1PH6A 1CSQA 2PI2A 1HR0W 3K81C 3U4ZA 4GOPC 4LFAL 3PUWA 2B63H 2VUMH 2IHFA 1I5FA 2BH8A 5M5YH 3OTOL 3AFPA 1G6PA 1TWFH 1VQFA 2A19A 4BY1G 3D0FA 5IP7G 1SR3A 3MEFA 4A3EG 2NVXH 3CF5A 2IX1A 1VQMA 4LUOA 5AJ3Q 1EOVA 1KQSA 2VQFL 1J6QA 2I5HA 4DV6Q 1T9HA 1JJCB 4YHHQ 4IO9A 2UUCL 2EXDA 1HR0L 4EQ5A 3OW2A 1YIJA 1NTGA 1L0WA 3K7UC 5BR8Q 3ULJA 4GNXC 3OTOQ 1IBKQ 3S16H 3K8AA 1YNXA 1IZ6A 5FJ8G 1PH9A 1JB7A 3GD7A 4X66L 2MNAA 4R4TA 2NVTH 3CCJA 5LMUQ 4DUZL 1P16A 1XPOA 1K9MC 4A3GH 4NXML 3PO3G 5C4XG 2K5NA 1LYLA 1N34Q 1XNQL 5M3MG 1XPUA 5C4XH 1NBWA 4QY7A 3F2CA 4DR3Q 4B3TQ 2WB1E 4GLAC 1B8AA 2UXBQ 2BA0A 3L7ZC 4X62L 4LWCA 1A62A 2LXKA 2E5LQ 2VQEL 4R4CA 2UXDL 3F8TA 1YVCA 4LF7L 5C0XJ 2RCNA 2VUMG 1QUQB 1FVIA 3HOZH 1X9NA 2CWAA 3FP9A 3NELA 5IYBH 1VQEA 3CC4A 4RG1A 1Q12A 3HOZG 4GNXA 3I4NG 2YTYA 1G291 2KCMA 2R7DA 4NB3A 1Y1WG 1TWGH 4BY1H 4OX9L 3PO2G 4A93G 3BU2A 2KHIA 2ALYB 5FLMH 4A3IH 2UXBL 5M3FH 3CC7A 3ICEA 3EBEA 2MO0A 4JOIC 1K8GA 1KC8C 3D31A 1MJEA 1VQJA 2QA4A 1XTDA 4LF5Q 1E3PA 1K0RA 2PMZE 2Y0SE 3K80C 3JAMi 4A3FH 1FL0A 4LF8L 1KRSA 2CKZB 3HOVH 5JEAG 4WJ4A 4AYBG 4KHPL 4GN5A 4P72A 3HOVG 1N32Q 5JJLA 4YCVA 5K36G 2Q2TA 5JJIA 2GN5A 1W2BA 2VNUD 2OWOA 4A3LG 1W3SA 1B7YB 2CFMA 4Y7NH 3HKZE 1XPRA 1PH4A 4JI3L 3KF6B 4A3LH 1E1OA 1P8LA 1OXXK 1VQGA 3STBC 3TRZA 3W1BA 4R4QA 3GTOH 2K52A 1JT8A 2WP8J 3K0XA 4DV0L 3ERSX 3RLOA 4A76A 1IBLL 3NEMA 4YWLA 4A3BH 1HH2P 1FJGQ 4JI8L 4LF4L 5GADC 2C35B 4A3JH 1VQ7A 1VQIA 4HJAA 2AWNA 3KJPA 1RL2A 2K14A 3I56A 5LMUL 1N33Q 3I4MG 4DR4L 4OO1G 1UE5A 5J3BA 1YHQA 4JI7L 3PIOA 1VCIA 3M85A 4DV5L 1PV4A 2FXQA 1AE2A 4DV0Q 1SMXA 4DR5Q 1V43A 4JC0A 3J81i 4JI6L 2HT1A 3I7FA 1FJGL 2F52A 1E22A 4JOIA 3SGIA 3KDFA 4JI8Q 4C3HH 4POFA 5IYCG 1Y1VG 2K4KA 4LF7Q 4LF4Q 4B3RQ 5IYDH 3H0GH 1Y1VH 1TWCH 4C2MH 2UXCQ 1L1OB 1SLJA 4C3IH 3S1NH 2PQAB 1UE6A 1E24A 4OONA 5GAHC 3PO3H 2JA6H 1N36Q 3PUXA 3CCEA 4X6AH 2RF4A 1Q86C 1HJPA 1FGUA 4OO1I 2YU9H 2Z6KA 2D0PA 2ZJRA 3U4VA 5C3EH 3S1RH 1J5EQ 4JI0Q 1YI2A 2Z6KC 2R92G 4DV3L 4HIOA 4LF5L 1EFWA 3T1YL 3EIVA 4JCVE 4ALPA 1VQHA 1NE3A 2YV5A 2VL6A 1SROA 2B63G 4KHPQ 2R7FA 2NN6G 1KXLA 3EN2A 1HR0Q 1SN8A 4PZ7A 2JA9A 2WAQE 2XTIA 3K7AH 3TS0A 2D0OA 2WFWA 5IP7H 3I4MH 3M7NA 1BBUA 1VQDA 2A1AA 3HFZB 2ZM6Q 4UPAA 4QQBX 4BY7G 1HNWQ 1SE8A 2ZTCA 4YCWA 5EAYA 3J81c 5FLMG 4A3IG 3BZCA 4X62Q 3J81j 1S72A 1HNXQ 4YWKA 4C3JH 1YJNA 2YYZA 1I94L 4JI0L 2Q2HA 2UXDQ 5C0XI 3PUZA 4HJ8A 1D8LA 4LF9Q 2ZJPA 2DUDA 4B3TL 1Q7YC 2A8VA 1Q1BA 2K75A 1K3RA 1KAWA 1MJCA 2JE6I 5JEAJ 1UE1A 4QJFA 4X65L 1HZCA 5FLXc 4HIKA 3HOUH 2JJQA 2ZM6L 3CAMA 3J80c 4DK6C 1CKNB 1XMQL 4QL5A 3UE0A 4WJ3M 2AMCB 3VDYA 1VQ8A 3E9HA 4A3CG 5HY6A 4HIDA 1OXUA 3TEHB 1NY4A 1E7ZA 1YHBA 4A3KG 4BA2I 5LMNQ 1SRUA 4LNQA 3A74A 3M9BA 4A3KH 5GAEC 1L2FA 3A5UA 3MXNB 1QZHA 2ES2A 2N78A 2CCZA 4LF9L 4DV7L 2ATWA 4IFDI 1PVOA 3W1GA 1OXSC 3CP0A 1CKOA 4HIMA 4R4IA 3HOXG 1K83H 1Q46A 4X65Q 3RZDH 4DV1L 1UWVA 3ZJYC 3A0JA 3CMEA 3RR5A 3PO2H 2B29A 3CQZH 4X64Q 3PUVA 4HJ7A 3UDGA 1XMOL 1B70B 1VS0A 1VQLA 1N32L 4JI4L 3JC66 4KHZA 3L2PA 4DAYB 2R7ZH 3PGZA 1PYBA 2JA7G 4JI3Q 4DV7Q 4IJHA 3M3YH 4JBMA 4TQUS 2R93G 1N8RC 4IJLA 3GTQH 4YCUA 4PMWA 1KIXA 4JBKA 1PFSA 1D7QA 3GTMH 5IP9H 3U58A 3CCUA 2WAQG 1ASZA 3KF6A 4GKJQ 2R6GA 5ELNA 1VQOA 5IP9G 1Y14B 1X54A 1WJJA 2AHOB 4NXNL 1VQCA 2PQAA 1HZBA 2DGYA 3CCMA 3CPWA 2ZTDA 1XMOQ 4JI4Q 4H02A 3T1HQ 3S14H 4A3CH 1TWHH 3WWVA 3G71A 4IPHA 3E0EA 1SFOH 4A93H 1UEBA 3G48A 2UUAL 2UU9Q 1VQKA 1IYJB 5AJ3L 4OXPA 3KDFB 3UDIA 1G51A 4DNIA 4DV2Q 5E7NA 3CCSA 1TXYA 4LFBQ 4DAMA 4OWWB 4A3FG 4L5TA 1U5KA 2RHSB 1HZAA 4GKJL 2UUBL 3TREA 2AWOA 3RNUA 4JYAQ 5IYDG 2Q2UA 1NMGA 1PH3A 3T1HL 1A8VA 3H3VI 1X55A 4DKAC 1OTCA 5FJ8H 1M1KC 3S17H 3RLNA 1QUQA 1X3FA 4GLVB 2H5XA 4JV5L 1N34L 1XNQQ 2R7ZG 4GN4B 3NENA 1KL9A 3HOWH 4DV2L 5M3MH 1HNZQ 3S1MH 3HOWG 1EWIA 4GOPB 3PSIA 1HNWL 3AQQA 3BZKA 1Q8KA 2KCTA 3GTJH 3GDEA 5GROA 1K73C 2F4VQ 4IFDG 4JYAL 2IHEA 1IBML 4LW1A 4GN3B 1I50H 1NJIC 4PG3A 1VQ6A 3CCVA 3HOYG 4QIWE 1RIPA 2WB1G 4UP8A 3GTKH 5C44G 4DV6L 2QEXA 4A3EH 2VQFQ 1BBWA 1TWAH 3STBD 5DLQE 2ZTEA 1Q1EA 2PNHA 2N8NA 2HHHQ 2JA5G 1HNZL 4JI2L 3GTPH 2PI2E 3KYHC 2MFIA 1LM0A 4DV4Q 1MIUA 3Q8DA 2E2JH 4L5SA 1VQ4A 4LF8Q 1QVCA 2LXJA 1X65A 2I5LX 2K5VA 3AEVA 4GNXB 2VY3A 4DR7L 5JJKA 3PIPA 3PCOB 1X3GA 5H1SE 3NBHB 1M90C 4P75A 3U50C 1EQQA 1PH5A 4AH6A 4HJ5A 1XMQQ 1QZGA 4LUVA 1Q81C 1VQAA 2HHHL 4UP9A 3S2HH 3CMAA 5IE8A 4YWMA 3KLWA 1XNRL 1X6OA 2OTLA 2VQEQ 4IPDA 1CUKA 1XJVA 5GAGC 1E1TA 1MKHA 3G6EA 5LMNL 1YITA 3J7A5 3FKIG 4LFAQ 4AQYL 1DGSA 1YHAA 1JE5A 1PH2A 3FKIH 4K0KQ 1AH9A 3F1ZA 1KRTA 3KOJA 2ZJQA 3H15A 3H3VH 4L5QA 3TQYA 1VQNA 4BXXH 1I3QH 3GO5A 4B3MQ 2JA8H 2IT1A 2JQOA 5M3FG 4DR1Q 1JMCA 1K8AC 4JBJA 4JI1Q 4BY7H 4BXXG 4J15A 5ELOA 1C0AA 1EIFA 2OQ0A 3CW2C 2EQSA 3AFQA 3IRBA 3CCLA 4DR2L 5IYCH 4GKKQ 5LMNW 4XIGS 4JI5L 1WCMH 2AKWB 2MO1A 4IPGA 4OWXB 4MTNA 2Y0SG 1IBKL 5M5WH 4K0KL 4AQYQ 4ME3A 2F3IA 3UE1A 3UDXA 1EQRA 3PF4A 2ID0A 1CSPA 3H0GG 1L1OC 1V9PA 2NVYH 4PZ8A 1Z47A 2UUAQ 5IWAL 3CPFA 4LF6L 1X56A 3A5ZB 3RN5A 4Y52H 4DR3L 4P74A 4OX9Q 3PUYA 4NXNQ 4MNOA 2YTVA 4BBSH 2KHJA 1YZ6A 2VW9A 1C7YA 2E5LL 2NVQH 1PA6A 4JI5Q 3RZOH 4IFDJ 4BBRG 3M4QA 4APVA 1S40A 3LGJA 4O0AA 4AIMA 1OXVA 5IY0A 1BVSA 4BBRH 4O2DA 1GVPA 2CWPA 2GVAA 4JG2A 3HKSA 1N33L 4DR4Q 4A3MG 4GKKL 1WOCA 4LFCL 3ULLA 4GLXA 1NMFA 4A3MH 1V1QA 2OCEA 1PH1A 5C4JH 4B3SQ 2HIXA 3B6YA 4X64L 1KHIA 3S1QH 2UUCQ 2I0QA 3I4OA 3CCQA 1XNRQ 1OXTA 4DR6Q 1WI5A 4QGUA 4EX5A 4UP7A 4L5RC 1HNXL 2D62A 5BR8L 3RLFA 1PH8A 1GKHA 2V1CC 4B3RL 1IBMQ 2CQOA 1BKBA 2XGTA 3I2ZA 3CXCA 4R4OA 4DUYQ 4UY8C 1YBYA 2UXCL 4GOPA 3DLLA 2JA6G 3CCRA 4RMFA 1EIYB 4NPSA 4R1JA 2Z0SA 4PZ6A 2F4VL 4JBWA 3CC2A 2VZAA 4GS3A 1PYSB 2JK8A 1ASYA 1HZ9A 1A63A 2HQLA 4B3SL 2R92H 2NZOA 4DR6L 3F2DA 4NXMQ 5C44H 5C3EG 3F2BA 4A3DH 2IX0A 5HGQA 3J80i 1Z9FA 3L0OA 4TVAB 4A3DG 1PH7A 1IL2A 4JI2Q 3HOXH 1A0IA 3ULPA 1X3EA 3PF5A 4DV4L 2L15A 2UUBQ 1C9OA 4YY3L 1YJ9A 1EYGA 1S3OA 3I4NH
chains in the Genus database with same CATH superfamily
3M4YA 3MXNA 2JA8G 2O4XA 1WTOA 1Y1WH 4FVMA 1BJTA 4RB2C 1OO9B 1LTSD 1GUSA 4P73A 3DM3A 1G91A 4L63B 2WYOA 3M4OH 2JA6A 4YJ2F 4ECUA 1SDFA 5C0XH 5KNBA 2NVQB 5C0XG 5KT5A 1AE3A 1L1OA 4HSVA 4OWTB 2N3SA 1R9TH 3HOUG 4KK7A 4RHSA 4F4WA 5KG3A 2IP4A 3JAMc 3KJOA 4MV7A 2EDGA 4IPCA 1U0LA 2UVRA 5C44B 4IALA 5KFFA 1UC9A 2E2DC 1STAA 5M5XH 4UCUA 2KBNA 4B3ML 4DK3C 4M8AA 3KBGA 2OLSA 4KLKA 5C6AA 5KFOA 2JA5H 1TS2A 3U9TA 2NZHA 1T94A 2HIVA 2QCPX 3A7LA 4DR7H 1IBLQ 4F4YA 2NVXA 2Q2IA 5C4HA 1LT3D 1LTBD 4AYBB 4JI7Q 4RA8A 2BA1A 3HOVB 3HKZG 4WFN3 3S15H 3S16B 1JJGA 1Z6HA 5KFAA 1V1PB 3S24A 1VQ9A 3W5OA 4HYKA 3GIDA 2E2HA 4CDFC 1ILQA 5JVLA 3KBXA 2L1BA 4BBSG 1GXDC 3LWBA 4K2KA 1U9RA 4YHHL 5HV6A 1LUZA 3FEWX 5DM63 1I50B 2EZVA 5BPFA 3NSWA 3CRLC 3K81C 5KFBA 4GOPC 4LFAL 4UAIA 4LF5H 2VUMH 4A2BA 5M5YH 4I55F 4LF7H 3K3PA 1G6PA 4YAJB 4BWSC 2W6QA 3ITPA 2F0DA 4EYIB 1W96A 2KECA 4A3EG 2ENBA 2I07B 3CF5A 2IX1A 5EOYA 2XGPA 5BR8H 1ET9A 3RF2A 2E2IB 3K3VA 1CS0A 4K0KH 4EQ5A 3DWAA 3NBIA 2Z4HA 5KX5F 2W6MA 5IODA 1L0WA 1IL8A 3BDCA 3K7UC 5EJWA 3ULJA 5BR8Q 3K5OA 5FJ8G 4JI2H 4RKLA 3NTIA 4TQRA 4KN4C 3GTQA 4R4TA 5LMUQ 1XPOA 1SYGA 3RZDB 4BBSB 4NXML 2K28A 1OWTA 1HA6A 1XNQL 3GILA 5F9NA 2QEJC 2K03A 1LTGD 2UXCH 4GLAC 1B8AA 3L7ZC 3SK6A 4X62L 4RB0A 1HA5A 2E5LQ 1TWHA 1DCZA 2B2UA 4R4CA 4KHVA 2UXDL 3UI2A 3ETHA 4GKKH 1I3QB 3OHXC 1NAPA 5D1OB 1U4MA 2RCNA 1FVIA 1SJHD 5M5XB 1JIHA 1X9NA 1WH2A 2LY7A 2EJMA 1Q12A 4JUZA 4GNXA 2F4IA 2YTYA 5CBEE 2F0KA 2ZXPA 4A93G 2SNSA 2ALYB 3OWEB 5M3FH 2MO0A 1K8GA 1KC8C 3GIMA 2PMZA 3JAMi 5KG5A 4A3FH 1FL0A 5FD6A 1KRSA 2V59A 3HOVH 3I4MB 2C2DA 4KHPL 3A8IE 2VR1A 2VPSA 3NE5B 3HOVG 4YCVA 3DEOA 1W2BA 2I80A 3S1NB 4QWDA 1W3SA 2CFMA 3HKZE 2J9GA 2L12A 1BCPD 1OXXK 1LTAD 2K52A 3RTXA 3RLOA 2KSWA 4J0MA 1JOOA 4YWLA 3RFCA 1HH2P 4LFCH 1EYDA 3HOWB 4J9LA 1ZHSA 3BA9A 5GADC 4QWCA 3GIJA 2AWNA 1M8AA 3MVVA 3EVQA 1TAEA 4ZYSA 2A73B 1SEIA 5L1JA 4EFBA 5CYUA 1XTCD 3OIPA 3S2HB 3GTGA 1RCVD 3RB0A 1UNSA 3M85A 1PV4A 3LP8A 4EYHB 4DV0Q 4DR5Q 1L0XB 4JC0A 1STYA 2HT1A 3I7FA 1QWYA 5JJKA 3SGIA 4C3HH 2M05A 2JN4A 3KDFA 4JI8Q 4Q0YA 4C1NK 2YL2A 2ICEC 3C0FB 3K5MA 1IHZA 3NUCA 5FD5A 3PO2B 2PZTA 1Y1VH 4C2MH 5KT3A 2BQRA 4C3IH 3MWMA 1N36H 3GTOA 5L37A 3VA7A 5D8DA 2JA8B 4MA0A 5K36H 3BABA 2F0SA 4OONA 4O1NA 1VMPA 5KFLA 4JV1A 3CCEA 4X6AH 2KOLA 1Q86C 4OO1I 3PMFA 2Z6KA 4CBVA 3U4VA 2EYJA 1J5EQ 4J9MA 1RK5A 4IUUA 4LF5L 2X6GA 3T1YL 1WTXA 1SFOB 1SROA 2B63G 2YCHA 1S0OA 1WTVA 2NN6G 1UUPA 2CW0C 3EN2A 1HR0Q 3R2IA 4FBUA 2JA9A 2HQEA 5JOBA 2HCIA 2HVQA 3TS0A 1WCMA 1I4RA 3I4MH 1BBUA 2ASLA 5M3FB 4DV1H 4QQBX 5KFRA 3CU7A 1XNRH 4MV3A 1S72A 1NR2A 1N33H 3A54A 3RZOB 5IIFA 4C3JH 1YJNA 3TN2A 2C2RA 1D8LA 4C3HG 3R3OA 3FKIB 3C3LA 2SCUB 3BQ1A 4MTDA 1HNZH 4B3TL 1Q7YC 1Q1BA 1HTPA 1R4QB 4NMZA 1TWFB 1DZ1A 4V190 1LT6D 1CKNB 2BQ3A 1VBHA 4QL5A 3UE0A 1I7LA 1VQ8A 2K6AA 5HY6A 1SCUB 2UXDH 3GTQB 4BA2I 2FPGB 1MI2A 2RKSA 5JQWA 4NLGA 3A74A 3M9BA 3N43B 4A3KH 1QZHA 5KFDA 2N78A 5EKKA 2J4XA 4DV7L 3J80L 1PVOA 2FINB 1RJRA 1VBGA 1AW7A 4R4IA 2FB9A 2B2YA 5ELEA 3I73A 3QG1A 5CV9A 1VQLA 4RB1A 4JI4L 2UU9H 3L2PA 4DAYB 2A69D 5FO8B 2F0FA 4JI3Q 4TV9F 3VA5A 1F9RA 2B63B 1JE4A 2PZWA 1N8RC 2GLTA 2UXBH 3VPBA 1KC7A 3GTMH 3U58A 3FMCA 3HG9A 2KVMA 4GKJQ 3KF6A 4ETSA 1LABA 4XYLB 5KFNA 2C9OA 5IP9G 2W8LA 3GTJB 5FLXE 3S14H 2EY5A 4DU9A 2BCOA 5G3LD 4CDCC 4IPHA 3J81L 1K83A 3G48A 2UUAL 4KMUC 2UU9Q 1VQKA 2V58A 3UDIA 3GTLB 4C3JB 4DV2Q 3CCSA 1CQJB 1TXYA 2W57A 4DAMA 3JRWA 4IRDA 1WVLA 3GTPB 3X3MA 3TREA 2F3VA 5KT2A 3RNUA 3V05A 3A55A 4DNTB 1EZ8A 4DLKA 4FF1A 1A8VA 3H3VI 2PO4A 1X55A 5FJ8H 1QUQA 1S9FA 5KIXA 1X3FA 3RD4A 2HCCA 4XYQA 2JA5B 2H5XA 1BO0A 3E5NA 1PRTF 4I7AA 2W7OA 3T4AC 2NU6B 4IQZA 3ETJA 3HOWG 4KKUA 4GOPB 1G6ZA 3NBHA 1TQOA 2F4VQ 3GDEA 1K73C 1IBML 1CQIB 1E4EB 2JEFA 4GN3B 1I50H 1NJIC 2NB0A 5KFCA 1HHVA 1GUGA 4GZYC 4QIWE 3BYYB 3VR5A 3VR3A 2FPIB 5M5YB 3GTKH 1SE2A 4B08A 3T16A 5A2QE 2QDBA 2QEXA 1VMCA 2LFNA 3NWSA 3S17B 1S0NA 2PNHA 2HHHQ 2WAQA 3GTPH 3QB3A 1LM0A 4F8MA 1MIUA 4LF8Q 4JI1H 4L5SA 4IHJF 4X3SA 1QVCA 2J7ZA 2LXJA 3R93A 5M3MB 1S5CD 4KY7A 1TY2A 2G9HD 3PQIA 4CC5A 3RV3A 3HRZC 3J7AF 4C3JG 3RAQA 1EQQA 5KFEA 4ZOLF 2R7LA 4HJ5A 1XMQQ 3MWDA 4IR9A 1KBLA 1VQAA 2QKIC 1JCKB 4YWMA 2ASJA 1KNEA 1I4PA 2OTLA 5FO9B 4TRDA 4IPDA 2ASDA 1CUKA 2P0AA 4JYAH 1R4PB 1ZYRD 1JE5A 5EPLA 5L9XA 4DR5H 1PH2A 5I9PA 3VYTA 3RB3A 5CV7A 4EEQA 1SMYD 2ZJQA 3ONAB 2BOSA 4U673 3MZ5A 4B3MQ 1H9KA 3GTLA 2IT1A 2A68C 4JBJA 4YHHH 4BXXG 2KA7A 4J15A 5I2YA 2OQ0A 2R8HA 1ZQ7A 3IRBA 4Q43A 5LMNW 1M0TA 4LFAH 4NP5A 3V4SA 5JEAH 2MO1A 4IPGA 5CORA 4MTNA 4OWXB 1HCZA 1SEBD 1RF2D 4ZK9B 4ME3A 4R8IA 5J39A 4ME6A 1CZGA 4ZUJA 1T36A 1GSAA 1GHJA 2Q8IB 4XQQA 4UCRA 4Y8VB 1SNPA 2XRSD 3H0GG 2NVYH 4PZ8A 4FF3A 5KFPA 1PTOC 4DV3H 5IWAL 1X56A 2F0EA 3RN5A 5FPOA 2NUCA 2FMAA 3FKIA 3K59A 3L4KA 2A6ED 4QUCA 1PA6A 3GQCA 4IFDJ 3DMUA 3GV6A 4APVA 4BBRG 1WD1A 1OXVA 1K3BC 5IY0A 2E2HB 4MA5A 4ECVA 4BBRH 4O2DA 1GVPA 1RJPA 3KHLA 3HKSA 3K5IA 4EFEA 3PW0A 2PYKA 2RSOA 4XZ3B 1NMFA 1K1QA 4KV6A 4L6TB 4X62H 3B6YA 1KHIA 2F0TA 1I4QA 5IGFA 4MTEA 3HS0C 2FLNA 2QF7A 3G6YA 5EKIA 1LV9A 5BR8L 3RLFA 1PH8A 5DQGA 5FKAC 2O5JC 1Y1WA 1BKBA 4KKSA 4H44C 2LS01 4R4OA 2VQDA 1X3QA 5JUMA 1YBYA 4RAUC 1HPCA 3RBEA 2IX3A 2JA6G 3T5KA 3CCRA 4NPSA 4JBWA 4IR1A 2VZAA 4ED1A 2DPJA 1PYSB 4I7HA 5I6YA 1HZ9A 5BMVF 4HNTA 3IAYA 2QK4A 4DAPA 4DR6L 4I50F 5KG6A 1UC8A 3F2DA 3KHHA 2PZUA 3JSLA 2NZ1D 1ONLA 2KQ3A 5HGQA 5KFJA 3J80i 3MR6A 3ERQA 5BPHA 3N40P 4UFZA 1PH7A 1IL2A 5J2UF 3D4WA 5CAEB 3V96A 4QWEA 3HOYB 2W6PA 3HBLA 2A5HA 1S3OA 3I4NH 3BYTB 4P71A 4IAJA 2CW7A 1O7IA 1MD2D 2FMCA 4KY6A 2RCFA 3CKIB 3BJUA 3P75A 5DAUA 2K50A 1YJWA 1RHPA 1PZID 1XDNA 4KKTA 1EL0A 1A3VA 3KF8B 3PV0A 4IUPA 1H9JA 1VQ5A 2BH2A 2FLLA 1TWAA 1F2ZA 3QZ7A 2VA2A 1GD7A 4ED8A 3JAME 2K05A 4HJ9A 2QGQA 4G7ZC 3OYYA 1MSHA 5T14A 1D2BA 2YRXA 5LP6F 4HR7B 1WYDA 3C1EA 4LF9H 2MPMA 1C48A 2I5MX 4DR2Q 4A75A 3KFUA 4LUZA 4DV3Q 2PMZB 2R87A 1IOWA 4DL7A 2B3GA 3H0GA 3NP8A 2SDFA 4JK1C 1Q82C 1RJQA 1STBA 2ZDHA 1I6HH 2EYPA 5J22A 3SI8A 4HSPA 5EPKA 1YEZA 4OELB 3A8KE 3PW7A 3TS2A 4MV4A 5GQOA 1FJGH 1AP0A 4DR7Q 1O7ZA 4HMJA 3MHBA 5HURA 4UCVA 5I6WA 1BCPC 2JA7H 4CDDC 1KD1C 3GLKA 4KI0A 1VQPA 2W9CB 4Y7NB 4RGMA 3G4SA 4DV5Q 5CV5A 3Q8RB 5CV4A 1LTLA 2F1MA 4JI6Q 2YW2A 5LOVF 1PYWD 1PH6A 2PI2A 1HR0W 1EY6A 5J1ZA 3PW4A 1GGOA 3U4ZA 1MBYA 2L4NA 1I4HA 4DF7A 1CQFA 1I7NA 3AFPA 5C1OA 1TWFH 1VQFA 2P5ZX 3SE0A 4BY1G 1KABA 3JZIA 1SR3A 3MEFA 3P20A 1VF7A 1VQMA 1EY5A 1EOVA 2DNEA 2I5HA 4DV6Q 3VYSA 5IT9E 2UUCL 4F87A 1HR0L 1C30A 5KYIA 3A56A 4XYOA 4KJNA 1LT4D 1ILPA 2Y0SB 5IGGA 5A2QW 1IBKQ 2E5LH 2R93A 1HUMA 4X66L 4ZKBB 2MNAA 2R7KA 2JA7B 4FO2A 2ZJTA 3D3RA 5DEHA 4DR3H 4DUZL 2IW3A 3BG3A 2YZMA 3R23A 5M3MG 1XPUA 3OWFA 1NBWA 1S5DD 3I8ZA 2WTFA 4B3TQ 1T5XD 2VA3A 1A3UA 5KFWA 2I46A 5IGEA 5KEEA 2BA0A 5F9LA 2R6FA 3P7JA 1TWCB 4DFAA 4LWCA 3GTOB 2LXKA 4ZQ3A 2VQEL 3NQTA 4C56C 1YVCA 2HJWA 5KFXA 1E2ZA 2VUMG 1F2MA 3HOZH 3FP9A 3NELA 4RG1A 1LT5D 3I4NG 1N56A 2UXBL 4JOIC 2R92B 4WRDA 3Q0AA 3D31A 1MJEA 1VQJA 2F0OA 4FM9A 3H91A 1XTDA 3M7GA 4LF5Q 2PMZE 3K5LA 4JV0A 1CT1D 4C5BA 2EYMA 5JJLA 4F4XA 3H20A 3EROA 1K1SA 2OF1A 2UUAH 4A3LG 4HEDA 3GTJA 4Y7NH 3CHBD 2R61A 3KF6B 4JI3L 4A3LH 4ZUIA 3HKZA 4JI4H 1ESRA 1TR5A 1YNJD 3GTOH 2WP8J 4EGVA 3DWQA 4C5AA 4DV0L 1I6VC 3NEMA 3QWNA 4A3BH 4EQPA 4JI8L 1IKMA 4FU0A 1BF4A 5IGDA 3KLRA 1TWGA 4A3JH 2C35B 3BS1A 3KJPA 1WD0A 3E3XA 2K14A 3I56A 1D5XC 2AQ1B 1N33Q 2NVXB 1UE5A 3F2UA 4B9WA 2F0QA 2BR0A 2UUBH 3MR3A 2FXQA 1BGWA 1ZETA 4O4LF 1SMXA 2FJ2A 3J81i 2F0UA 4UCTA 2I8CA 4YB8B 1FJGL 2F52A 3A7AB 5BN4A 1HTLD 1D1IA 2R8IA 1J5EH 1K83B 2K4KA 4LF7Q 2V4QA 5KFHA 4APMA 2W8KA 4G3IA 3NXWA 2UXCQ 3PVXA 1QNKA 4FS2A 1UE6A 4DL5A 5ELCA 2JA6H 1N36Q 2RF4A 1AFPA 1HJPA 2PBZA 1F77A 3SXHA 4FXKC 2ZJRA 3S9WA 1EQTA 1YI2A 1EFWA 5L1LA 3QO2A 3EIVA 4JCVE 5JAVA 4ALPA 1VQHA 4LF4H 2KCNA 5DG8A 2R93B 1IW7C 2F0IA 4PNYA 4CJ2C 2R7FA 3V6HA 1RKNA 1KXLA 3KXYT 2HDLA 5I47A 5EWEA 5KFKA 2NN6H 2WAQE 2XTIA 4G57A 4RAYA 1GJXA 1VQDA 2A1AA 4QB4A 4NW2A 1HNWQ 3K6OA 1R9TB 3J81c 3PW2A 5FLMG 4A3IG 2EPBA 4FS1A 2Q2HA 4HJ8A 4ECSA 2XIGA 4LF9Q 2F0GA 3TINA 1KAWA 2K75A 2JE6I 3EPIA 5JEAJ 1ESFA 4K8IA 1HZCA 4HIKA 2JJQA 3J80c 1S4ZA 4DK6C 2H1EA 1XMQL 1KJ9A 4YY3H 1LACA 2F0JA 4UDUC 5CBAE 4WJ3M 5IWAH 3VDYA 4A3CG 4AQYH 2RSNA 3KLSA 4HIDA 4J9OA 2RDIA 5FOBB 3S15B 3N8DA 1E7ZA 4KJOA 5KT7A 1SRUA 4DGZA 2V5AA 1L2FA 4LF9L 3MXNB 1C4QA 2ES2A 4IFDI 3L4JA 2WKCA 1E2WA 2LMCB 3I72A 1FNWA 3FDTA 1DONA 3RUPA 1K83H 4A3GB 4FXDA 3ZJYC 3A0JA 4HMIA 4X64Q 1B9NA 5GONF 1N32L 3JC66 1BOSA 4DL4A 2R7ZH 1PYBA 1I3QA 3J80W 3PW5A 1SYDA 4IJHA 4JBMA 4PV1C 1EWHA 4TQUS 2R93G 3BVGA 4IJLA 4YCUA 4PMWA 3M4IA 2I87A 5IP9H 2WINB 1AZPA 4LJZC 1ASZA 5ELNA 1G8ZD 1Y14B 4HAEA 1ENCA 1WJJA 1PFMA 3KF8A 3MR5A 1HZBA 2DGYA 3CCMA 5IGBA 2ZTDA 4H02A 3DWPA 5KG7A 4JI8H 3OSPA 3MA2B 3G71A 3E0EA 1JORA 1UEBA 2F0HA 3MWYW 3GIPA 2A6HD 1IYJB 4OXPA 3KDFB 3BDLA 3MXPA 2NWGA 5D3DA 2PNRC 1WTPA 4H0LC 1ZEQX 4LFBQ 1JWUD 2RHSB 2UUBL 1IBLH 1NNXA 1EIHA 3JRXA 1FGBD 4J9NA 3T1HL 3H94A 1OTCA 4IUNA 1SNDA 3S17H 1VAJA 2NYZD 4WBNF 1I4XA 2FLPA 3T56B 4R9WA 3HOWH 1K8OA 5M3MH 1JC7A 4J9SA 1CTMA 3PSIA 3BZKA 1Q8KA 2KCTA 3TDQA 1PXUA 4RNNA 1KAAA 1C8CA 2JXMB 4UCOA 1EY9A 4MV1A 1V1PA 1VQ6A 3CCVA 2ZDQA 3I91A 2R8KA 4DL6A 4O3RA 4DV6L 1DIKA 2ATLA 2VQFQ 2WE6A 1YNNC 2W71A 3STBD 2ZTEA 4I7ZC 3LX0A 2N8NA 2F03A 4KHPH 5I9OA 1CM9A 4WD3A 4C3IB 4DK1A 2K5WA 5KFIA 3IL8A 1QCBD 3AEVA 2Z4IA 4A3MB 4CKCA 1JICA 1X3GA 4ZKCB 5H1SE 3VYRA 1JKJB 4P75A 4EGQA 5C5JA 3U50C 1ICFB 1UEAB 2F0MA 3Q6SA 5D1OA 2NU9B 2JEGA 3UFXB 1XWEA 2B63A 1QZGA 3S2HH 1CK1A 4UP9A 3CMAA 1X6OA 2B8GA 1D5MC 2D9UA 4HN7A 2VQEQ 4QF4A 4G7HC 2EYLA 3G6EA 1MKHA 2IL8A 5LMNL 3X3NA 3NTHA 3FKIG 4JI3H 2CW0D 4LFAQ 4AQYL 2HUGA 2WB1A 3HP3A 3FKIH 1DD2A 3BA8A 1EEID 2B39A 3F1ZA 3VYUA 3HZXA 3VPCA 1KRTA 3D6CA 3KOJA 3H3VH 5EWGA 4O3QA 4C5CA 4BXXH 3GO5A 3OTOH 1C3OA 2JA8H 5M3FG 2JQOA 1IKLA 5COYA 4X65H 5AFWA 5ELOA 2XSCA 3WOFA 1GSHA 3PO3B 1B44D 1B53A 2EE1A 2EQSA 1TVXA 3AFQA 5IYCH 3CCLA 2W6OA 4X64H 1DOMA 3BQ0A 1WCMH 1SYXB 2G9DA 2FK3A 3RGXA 4AQYQ 3UE1A 2F3IA 4O3OA 4F50A 1EQRA 4RZQA 4K5XA 2W6NA 1L1OC 2XN9C 5IT9L 3R5FA 2H4OA 3J7YW 4A3IB 3CPFA 2F4VH 2JEIA 3A5ZB 2HVSA 5CV8A 1F9PA 3TP5A 4NXNQ 1F9QA 5M9OA 4RGTA 2E5LL 3K58A 2NVQH 4B9XA 3I12A 4XT1B 3W2DA 4O0AA 2EXZA 1A9XA 5BN5A 3MFIA 4PQXA 1SNQA 2CWPA 2D5DA 4A3BB 1CA5A 1YNND 2GVAA 3NPPA 1N33L 2PN1A 2ZDGA 5D14A 2YS6A 3KLSX 4GLXA 1V51A 3SHLA 1SJED 4RWSC 1IYVA 4B3SQ 2HIXA 3S1QH 4XYMB 2UUCQ 3I4OA 4DR6Q 1JB3A 4QGUA 3EYYA 4OX9H 2Z8LA 4UP7A 2CW8A 4O2AF 2DIKA 1RTNA 4K14A 3T1YH 2OH2A 2XGTA 3I2ZA 1DYQA 4GOPA 5KFVA 3GTKA 4RMFA 4PZ6A 4GS3A 2X6LA 2JK8A 2Q8TA 3ND8A 4IZOA 2HQLA 4B3SL 1EFID 5C3WA 3J81W 1KDCA 2XC9A 3GTMA 4NXMQ 4MAMA 4N8FA 5C44H 3MTSA 4Q5VA 5LL6X 3F2BA 3SK8A 1PX2A 4ZRZA 2R82A 3MFHA 2FMMA 2WKDA 2XCLA 2ALZA 4K5WA 3Q8SB 5C8YF 4A3DG 5KFQA 1WCMB 1S68A 1B6SA 1IW7D 1X3EA 5CB4F 4DV4L 2L15A 1GHKA 1EYGA 4A3JB 1HNWL 5JVH3 2NN6I 4DV0H 1V1OA 4POGA 4Q44A 4IZ8A 1H9SA 1SE3A 2AQ2B 1PZJD 2TSSA 3QIAA 3MR2A 2JEAI 3Q1KA 1I94Q 2TMPA 4JV5Q 3JAML 4U7CA 1MHWC 2L0CA 3I55A 1QVFA 3EJIA 1QVGA 1LTRD 4DV7H 5CA0F 2OXPA 3S14B 4P2CB 3UDFA 3GTLH 4LFCQ 2NVTB 3GTGH 1WTWA 4O3PA 1MZBA 4YP3A 2AUJD 3DF7A 4X66Q 3HOYH 4MV9A 4MZ9A 5IYBG 2AQ3B 3I4LA 1SXTA 4DUZQ 1J5EL 3KHGA 1IXRA 3FHWA 1A2UA 1AN8A 4R8NA 4CKBA 3T1YQ 3PN1A 2N49A 5JPNC 2UU9L 4DR1L 1I4GA 4KY5A 2XCAA 2OQKA 4JI1L 1N9WA 1WFQA 4DUYL 3J7ZC 2EOTA 2EYOA 2LSSA 2Z1CA 4K8JA 3CD6A 3M4PA 4XTCS 3E9IA 4LF6Q 1ICWA 1QILA 1TWGB 1X3PA 2OTJA 4OGQC 2RHQB 4A3GG 1EEFD 4IURA 3U9SA 3AYHB 4DNRB 1S5BD 4MN3A 3LNNA 2CHBD 2R93H 1PHJA 1TS5A 4AYBE 3T1HH 1AN7A 1H95A 3VMMA 1XMOH 4JI0H 3Q22A 4LMQD 3EA6A 1HXYD 4DR5L 4RCOA 4A3BG 1SNCA 4ECTA 2KEEA 3WDNA 1CSQA 3NHHA 2W6ZA 4QMGA 3N41B 4J8QA 3NTKA 3PUWA 2IHFA 2BH8A 5DG9A 4YAKB 4TKOB 3HOXB 5L1KA 1J8IA 1IBKH 4ZI7F 4OHJA 4PDBA 4DK0A 4ECWA 5IP7G 3PIO3 4JV5H 2DN8A 1KQSA 4DV2H 4EBDA 1T9HA 4IO9A 3H09A 5K5PA 3TBIB 4ZCKA 2YZNA 1BCPB 4TQSA 1YIJA 1NTGA 4DV6H 1PTOF 2C5CA 2F0PA 3AMUA 3OTOQ 3S16H 3K8AA 1YNXA 1IZ6A 3LMLA 3TP8A 1JB7A 3GD7A 3SR1A 2RA4A 2NVTH 3CCJA 3OUUA 4GKJH 4A3GH 3FPPA 2E75C 3RIZA 2L5TA 3PO3G 3RB4A 3KHRA 4KD4A 3F2CA 4DR3Q 2WB1E 1PK8A 2UXBQ 1TWFA 1A62A 1SE4A 2KEDA 5C5LA 3H4BA 4NKLA 4J9QA 3F8TA 1VDZA 4LF7L 4Q0FA 4Z9CB 1BQQT 4MHEA 2A6EC 3E0JA 1QUQB 3K5HA 4XXEA 2CWAA 1HUNA 5IYBH 1TS4A 3HOZG 1G291 2AGQA 1TWGH 2VB3X 2SOBA 2SNMA 1Q8IA 1DOLA 2HVRA 1EU4A 3CVZA 1E3PA 1K0RA 2E74C 2Y0SE 5LHY1 1FKAH 2NVYB 1B04A 2CKZB 4WJ4A 5DG7A 2CH4W 4GN5A 2W9BA 4P72A 2WIIB 1N32Q 3H40A 5JJIA 1TWHB 2A6HC 3D4RA 3TQTA 2NU7B 4ED0A 2VNUD 1O75A 1XNQH 2PPBC 1Z7TA 1B7YB 4JVZA 1PH4A 3Q8QB 1N32H 1P8LA 3STBC 3TRZA 3V4ZA 2M00A 1STNA 2EYHA 1JT8A 1D1KA 2W70A 1IBLL 2F0LA 1W6KA 1FJGQ 1DV2A 3M9NB 2YS7A 4ED3A 3OUZA 4DA2A 1VQ7A 1VQIA 3VPDA 1RL2A 3I4MG 1D5ZC 1ZXTA 4XT3B 4DR4L 4OO1G 4DR1H 2RGRA 2MCTA 1V4YA 4ECZA 1PRTD 5J3BA 1JXLA 1YHQA 3PIOA 1EY0A 1V43A 4RUCA 2PW7A 2RVLA 1E22A 3FPUB 3L3OC 4WJWA 3BVZA 2V4DA 4HR7A 3D6WA 4CC6A 5IYDH 4YQWA 4IRKA 2FE3A 4B3TH 1L1OB 1SLJA 3S1NH 1EY4A 2FHTA 1KJJA 2K33A 4LSXA 4M1UB 3IN5A 1E24A 2LKVA 4ECQA 3PO3H 5KRUA 5GAHC 3PUXA 2YU9H 2D0PA 1JLLB 4DN4M 5C3EH 2R92G 2Z6KC 2KHSA 1CZWA 4B3RH 5E4XA 3H6MA 1NE3A 1BR9A 1PFNA 3A8JE 2RBMA 4A3KB 1AUXA 1J9OA 1SN8A 4CKEA 3TSSA 3G6VA 5T1GA 3RUZA 4QWAA 2EYFA 3T5LA 2D0OA 1EQVA 5IP7H 1HNXH 3HFZB 4UPAA 2K5DA 1AZQA 4DL2A 5EAYA 3BZCA 4X62Q 3J81j 5LMNH 4YWKA 2N55A 4RKBA 2UXDQ 1S5ED 3PUZA 2ZJPA 3WO0A 4M7EA 1O7YA 5C1PA 1B6RA 1MJCA 2A74C 3T51B 2UVWA 1JDEA 3PIP3 4QJFA 4X65L 5FLXc 3HOUH 5C4JB 5FPRA 4ILWA 3CAMA 2ZM6L 5DM73 2AMCB 5DGAA 3E9HA 3DXJC 4KN7C 1E2VA 4PMCA 1B3AA 1OXUA 1F2LA 1EHIA 4LF6H 4CJ0B 1EUDB 2W9BB 1N48A 5LMNQ 2B2TA 3BZDB 2CCZA 2CZGA 1FD7D 2K01A 3W1GA 2FPPB 4C3HB 1OXSC 3CP0A 4N8X1 4HIMA 1RTOA 3C2PA 4X65Q 4DV1L 4QIWA 2HD3A 2HGSA 3RR5A 4H7BA 3PO2H 3CQZH 4ED7A 1Z2PX 2WB1B 5D65A 2RGVA 5HBRB 3PUVA 4YBZB 3UDGA 1VS0A 1K28A 4PMBA 4ABNA 3C46A 3SVMA 3BJYA 1GUOA 1HQMC 2EVBA 4IUTA 3PGZA 2PQEA 1LTTD 5I4DA 2K1BA 1Y1VB 3S1QB 1K8MA 3DHQA 1Q90A 4JBKA 2ZXOA 3G7LA 4OEMB 5LMUH 4K5VA 3I3CA 1EIGA 1VQOA 1QG7A 2J6TA 2V9WA 1X54A 2AHOB 1IBMH 5J2TF 3D8GA 4NXNL 2PQAA 1KEEA 3OHBA 4DV5H 4EBEA 3T1HQ 1ZHQA 1DJRD 4A3CH 2RDGA 4J9KA 2Q8RE 2A68D 3FRPB 3WWVA 1SFOH 1B50A 5DLFA 5AJ3L 5FLXW 1BBXC 2QYZA 5E7NA 2L9HA 5BN3A 4OWWB 4A3FG 2BDOA 4L5TA 5CV6A 5IYDG 2E2JB 2AGOA 4OIKA 1T5EA 1PH3A 3SE7A 5KFTA 1EZ1A 1PFBA 4DKAC 5JVDF 3HOUB 1M1KC 3RLNA 2SEBD 5EDWA 1F9SA 2B2VC 4GLVB 4O3NA 4TSSA 4R8UA 2JYOA 3HEJA 1N34L 1SBBB 2R7ZG 4GN4B 1KL9A 1QB5D 5M5WB 2UVVA 2B8FA 4OL7A 4Q45A 2FKLA 1EWIA 3BVMA 3AQQA 5JJZA 3GTJH 3G6XA 5GROA 4JYAL 1D6EC 3HXLA 4IWXA 4IFDH 4LW1A 4RZRA 1EWCA 1F2YA 3D4DA 3HOYG 4C2MA 3VR4A 2XD4A 1CA6A 4UP8A 3K5NA 2WV6D 1I94H 5C44G 2C28A 4ZAIA 2R86A 1KDBA 1BBWA 2XVSA 1AUVA 1TWAH 2EY1A 1Q1EA 1H9RA 2ZXRA 2JA5G 3Q2OA 2R92A 5IOCA 4B3MH 2PI2E 2DLNA 3KYHC 4DV4Q 2E2JH 1VQ4A 2A69C 1X65A 2I5LX 3S1MB 2R3ZA 4GNXB 5KG4A 4DR7L 5DQHA 3PIPA 3PCOB 4EBCA 3GTMB 3NBHB 1M90C 2AGPA 2MHVA 1V8QA 3TMEA 1PH5A 1RYSA 4AH6A 1Q81C 5DNFA 3OPOA 4XQNA 1TWCA 3K0YA 3KLWA 5C3XA 3HB9A 3R5XA 4MV8A 1XJVA 4BWGB 5GAGC 1E1TA 4A3EB 2XWBB 1YITA 1WTHA 2W9CA 3K7AB 1DGSA 1Y8NB 4A3DB 3KK7A 3MEHA 3N44B 4G4KA 1KJQA 1EYCA 4QIWB 2JA7A 1DXMA 4ZHQF 2R7ZA 3DM1A 1VQNA 1I3QH 2WAQB 4DR1Q 1JMCA 1K8AC 4JI1Q 4LF8H 1PMRA 1B33N 3GV7B 1EIFA 3CW2C 5KYLA 1GOZA 4DR2L 2IBKA 4CHTB 2EJGC 4XIGS 4XDXA 4BS9A 1A3TA 4X3TA 4EGJA 3I70A 1RDPD 1TIID 1E4EA 2Y0SG 1IBKL 3OSOA 5M5WH 1DOKA 1MSGA 4C3IG 4K0KL 3RAXA 2GPWA 4ED2A 4FF2A 5A2QL 3PF4A 2AQ4A 3KALA 1T3NA 1RODA 1V9PA 2EY6A 3S1RB 4EG0A 1L2ZA 1H9MA 1Z47A 2FFKB 3EQLC 5LL6S 2UUAQ 4DXGA 3NK9A 5KFYA 4Y52H 3TZDA 4UCSA 4QW8A 2XNAC 4BBSH 2KHJA 2VW9A 1C7YA 1PTOD 2ZT9C 1O7LA 1RD9D 3M4QA 1S40A 2DWCA 4RAZA 4TUYF 1A15A 1BVSA 2RDJA 4RB3C 3T5JA 4JI7H 4F4ZA 2DJGC 4DR4Q 1ET6A 4A3MG 4GKKL 1I6HB 1WOCA 4LFCL 1KDAA 4AYBA 4QWBA 1W93A 2CH4A 4DAVA 1PH1A 1EY8A 4S3SA 2W9AA 3CCQA 1XNRQ 1OXTA 4ED6A 1WI5A 1CE8A 4EX5A 3QOJA 2C00A 1HNXL 3OHAA 4FF4A 2V1CC 5LA6F 1IBMQ 2CQOA 4ODGA 1AEXA 3BG5A 4U6PA 3S2DB 3CXCA 4DUYQ 4R7RA 2C2EA 3TQ1A 3GIIA 1ENFA 4RHRA 1N34H 4GKKQ 4R1JA 1EOTA 2Z0SA 2BDNA 5D3IB 5CR3A 1STEA 1JOQA 3AB9A 1ASYA 3R2TA 1DM0B 2NZOA 4ME5A 3PR4A 2FK2A 3AU7A 2ZM6H 3BAAA 1PZKD 2WACA 5C3EG 4A3DH 1R9TA 2IX0A 5KFGA 1Z9FA 3WNZA 4NDXA 4GC7A 2WDTA 5H80A 4JI2Q 3ULPA 1A0IA 3RBDA 3N52A 4IUVA 5E1FA 1YJ9A 4HNUA 5FO7B 1BCPF 1I6UA 1B4OA 4H13C 3IG0A 4ECXA 3GIKA 1UE7A 3SK5A 1DV1A 2O2LD 1QJOA 3DUZA 3MXUA 4A4IA 2YYAA 2ICIA 1M0WA 1WCMG 1U4PA 2KENA 2DY8A 2VS1A 4BA1I 3GV5B 4LSAA 1O78A 4YY3Q 5IWAQ 2E2HH 4N9PA 5HGTA 1N36L 4YR3A 2K5HA 2EIFA 4DR6H 4R8UB 5C4XB 1BNZA 2IY5B 4X3KA 4FDBA 1S10A 1S97A 3HOZB 3JAMW 1VQBA 3NQIA 4DXFA 3KTMA 1Y1WB 1CKMA 1A6XA 2VUMA 5IT9c 3C1FA 1JJ2A 2ASBA 1SNMA 4IOAA 1Z2OX 1G2SA 2DPIA 4A3JG 2XRQD 4LFBL 2JEJA 4DPGA 2UUCH 2MQHA 5KG2A 2HHHH 2KJXA 4HCEA 5ELFA 3RN2A 4DV1Q 2RQXA 1GO3E 4RU9A 2F3WA 1HFGA 2MP1A 4J6HA 3P1HA 1BNCA 1G2TA 3S2DH 2GVBA 4F88A 5JPMC 2YU9B 4DR2H 1GM5A 5ELDA 2JEBI 4DR4H 5DGBA 2DJFC 3ND9A 3ER0A 2W7PA 2E2IH 4IOCA 3Q8PB 4RUAA 1LLRD 1EUJA 1Y8PB 2YTXA 1SMYC 1CKNA 4PWQA 1BXRA 3O13A 3ORRA 4RFBA 1LO5D 4ECRA 1UAPA 1K0SA 2E8GA 3R5HA 2IPKD 5ELBA 1SYFA 1SYBA 1ZYRC 1NSNS 5EKLA 5KT6A 3RB6A 3G8CA 2VQEH 2B63H 1I5FA 2GPSA 1TU2B 3OTOL 2JA5A 4I65A 3SDZA 2A19A 5L1IA 4HCSA 3D0FA 4IRCA 2NVXH 4LUOA 4ZLTF 5AJ3Q 2VQFL 1HRJA 2JP1A 3MAQA 3GV3A 1J6QA 4BY1B 2AUKA 1JJCB 4YHHQ 2EXDA 3FVQA 4X3UA 2R84A 3OW2A 3PR5B 1STGA 1XX8A 3LWEA 4MV6A 4A2AA 3PZPA 1X32A 4GNXC 2EY2A 1B1ZA 5KFUA 1PH9A 1SYEA 5IT9W 2O5IC 3CRKC 2AU0A 1K9MC 1P16A 5C4XG 2K5NA 1LYLA 2MJ8A 3WO1A 1N34Q 2BQUA 1NUCA 5C4XH 2J0TD 2K7VA 4QY7A 1B2TA 5F2DA 1JDBB 1CFMA 2QDLA 4ULLA 4MTKA 1VKZA 1FR3A 4FNFA 5KFMA 4E4TA 5C0XJ 1PDQA 2DZDA 1U4LA 4QW9A 5KG1A 1VQEA 3CC4A 3KUPA 1MGSA 2KCMA 4NB3A 2R7DA 4ID6A 1Y1WG 4BY1H 4OX9L 3PO2G 3BU2A 5CGKA 2KHIA 5FLMH 4KTAA 4A3IH 2K04A 3CC7A 3ICEA 3EBEA 2QA4A 2F0WA 5CC4A 3K80C 4LF8L 1JWMD 2FP4B 1CHPD 5JEAG 3T53B 4AYBG 4X66H 2YZGA 3OSNA 4O2BF 2C22A 4DUZH 3V2TA 5K36G 2Q2TA 2GN5A 1NCVA 2OWOA 2R8GA 4N9TA 3I90A 1TWAB 1XPRA 1CI3M 2B2WA 1E1OA 1VQGA 2PCFB 3QR8A 3OMCA 5T1IA 2JA6B 3W1BA 4R4QA 5E3FA 3K0XA 2NTSA 3ERSX 3R8BA 5A35A 4A76A 5LL6b 1TS3A 1H9SB 2MUYA 4LF4L 2M2LA 2PW5A 2Z6BA 4FP5D 5C4ZA 1EUCB 2YU9A 1HNWH 4HJAA 2O03A 2XCPA 2IA6A 3WOEA 5LMUL 4E6IA 4M9UA 4K6DA 4LH7A 4Q8EA 2B2YC 2R7NA 1RJTA 1E4GT 2PVPA 5TSSA 4JI7L 1VCIA 4DV5L 1AE2A 1GLVA 4JI6L 4JOIA 5EPJA 2B2TC 5IYCG 4POFA 3T13A 3OMGA 1Y1VG 1SFOA 1UNNC 2L55A 4LF4Q 3KAKA 4B3RQ 5KGUA 3H0GH 2XWJB 3TP7A 1TWCH 2VB2X 2PQAB 4MIUA 5EWFA 1WTQA 2DNCA 3GTKB 3BQ2A 2VPQA 2E76C 4GC6A 5JVG3 1KLGD 4RGOS 1FGUA 1SSOA 1S5FD 2R85A 3S1RH 4EVOA 4JI0Q 4L1KA 4DUYH 5KNDA 4DV3L 4HIOA 5D1PA 1GYFA 4K6LA 4DV4H 2YV5A 3QJYA 5I2XA 2VL6A 4UHVA 4A93B 5DLGA 1GSOA 3LWUA 4KHPQ 3N42B 1JWSD 5E4WC 4KD3A 1WSCA 4LAAA 4PZ7A 2RDFA 3URYA 3K7AH 5KFSA 3IFDA 3TP6A 2WFWA 3M7NA 4BBRB 4O42A 4NXMH 2ZM6Q 3GTGB 4JV2A 4BY7G 1SE8A 2VUMB 3M4OB 2ZTCA 4YCWA 4XX0B 4B3SH 2N88A 2VUGA 3GIQA 3QFFA 1HNXQ 4JI0L 1I94L 2YYZA 1FYCA 2RDHA 5C0XI 4ZQIA 1SAPA 2DY7A 3RMHA 3CQZA 2DUDA 3F8NA 5K2MA 3SK4A 1S03G 1KJIA 2A8VA 1K3RA 4O4IF 2R7MA 4YR0A 2R8JA 1UE1A 1EU3A 1EY7A 3MXGA 1IOVA 2HDMA 4RH6A 4LH6A 1U4RA 4HQ6A 1HQRD 3W3AA 1TA8A 3E6ZX 3TEHB 1NY4A 1YHBA 3TZUA 4A3KG 2B2WC 3OW7A 4TV8F 2NUAB 4LNQA 4V0BA 1RYRA 5GAEC 1Y69U 3A5UA 2ATWA 1M7JA 2CQAA 1XXGA 3GQBA 2K5QA 1ENAA 3GV8B 1CKOA 2BE5C 1LTID 3HOXG 1Q46A 3RZDH 2X69A 1UWVA 5G3LF 3CMEA 4JI5H 3H0GB 1BUVT 2B29A 4DL3A 1CHQD 1ULZA 4LFBH 4HJ7A 1XMOL 1B70B 4J9RA 3U9OA 2OEOA 4KHZA 5NUCA 1SNOA 4IWYA 5EQ0A 1NR4A 2JA7G 5CA1F 4DV7Q 3M3YH 1L0YB 4L8JA 3FMAA 4RGNA 3GTQH 1KTKA 5FLXL 1KIXA 1PFSA 1D7QA 1JQYD 3CCUA 3HKZB 2IWHA 5EBCA 3MC0B 4EEYA 2WAQG 1XMQH 3L9AX 2R6GA 3J80E 3VR2A 2VOBA 4WORA 1VQCA 4JI4Q 4F7XA 4CGYB 3CPWA 5CMDA 3NWTA 1XMOQ 1PRTB 2V4RA 1TWHH 2K32A 4A93H 4I4TF 1PLFA 5IYZF 2NVYA 3G6JB 3KAJA 1E4FT 1STHA 4BY7B 1G51A 4HNVA 4DNIA 4Q8FA 2J6SA 3OIQA 4GKJL 1U5KA 1HZAA 1RK6A 2FJZA 1WR2A 2VQFH 2AWOA 3Q24A 4JYAQ 3MFYA 1QNUA 1EZ6A 3DEPA 2Q2UA 1NMGA 1WTRA 3N6RA 1KLUD 1BXTA 1II3A 3BDOA 2B2UC 4JV5L 1XNQQ 4J9PA 3NENA 1BDOA 4DV2L 3M9OB 3S1MH 1JR0D 4OIJA 1HNZQ 3NGDA 1PRTC 4EQOA 3I4NB 3E5SA 4IFDG 2M9VA 2IHEA 3RJ0A 3RGZA 4CDEC 4A3FB 3QOLA 1IYUA 4PG3A 1A2TA 1QOHA 2UVUA 4CJ1B 1RIPA 5IGCA 2WB1G 4RNOA 3J7AK 4ECYA 2QILA 3FDSA 4A3EH 3EPGA 5KT4A 4LK1C 2Z9HA 5DLQE 4JI2L 1HNZL 5KG0A 1FNVA 2MFIA 2R7ZB 2E2IA 3Q8DA 5C3EB 1CQVA 1KNAA 2IMWP 2VXWA 1E0BA 3M3YB 2K5VA 3EFXD 5EBDA 3TIGA 4YJ3F 1SYCA 3RV4A 2VY3A 5LXTF 1HR0H 2KUMA 2J6UA 3V6JA 1TT2A 4IUQA 4JW0A 1TY0A 3J7AV 1EYAA 2CQYA 2BE5D 4XQJA 5KKNB 4LUVA 2HHHL 1Y1VA 4C1NI 4YIJA 5IE8A 5LYJF 1I50A 4LMYA 1XNRL 4G7OC 2MGSA 1HFNA 3UQ8A 4DAYA 1JX4A 1W6JA 1GUNA 1TKWB 5DQIA 1PTOB 3MJFA 3J7A5 3H3VC 3MWEA 1YHAA 4FXGC 2X0SA 3ORQA 3QZ8A 4K0KQ 1AH9A 1YNJC 3H15A 3GTPA 3ZYYX 4L5QA 5FK9C 1Q3LA 3TQYA 5KFZA 4BY7H 1M4VA 2NBFA 2Y0SA 4QUFA 1C0AA 2CVRA 3N6XA 2G5DA 3JSNA 1B9MA 3VR6A 3SEBA 4JPBW 4JI5L 4C2MB 2AKWB 3T5HA 2NTTA 2F0NA 2XIWA 4JI6H 3UDXA 1Z2NX 2ID0A 1CSPA 1GUWA 3M9MB 4LF6L 3TIIA 3IKJA 4DR3L 4P74A 3PUYA 3CQZB 4MNOA 2YTVA 4J1MA 1YZ6A 4HTHA 1VF5C 1M6VA 2YRWA 3RZOH 4JI5Q 2JSOA 1Y8OB 3LGJA 4AIMA 4QCLA 4U68A 3Q23A 1EYZA 5ISRA 1ZKOA 4FYDA 4IN3A 4JG2A 1O80A 5EGTA 3ULLA 4YR2A 4FBTA 4A3MH 1V1QA 2OCEA 2D2CC 5C4JH 4X64L 3OOCA 5C5MA 5KNCA 3GP7A 1GUTA 2I0QA 2F0VA 4L5RC 2D62A 3HGBA 1GKHA 5EZYF 1B3QA 3MFGA 4B3RL 1S0MA 4O3SA 1XYIA 4RCNA 4UY8C 2L11A 2QW7A 3J81E 2UXCL 2FK1A 1JOKA 3DLLA 4O4HF 2XGQA 3H4DA 4NXNH 1EIYB 2F4VL 3CC2A 1A63A 2R92H 5JH7F 2OT2A 2EJFC 1PTOH 4K2LA 4EQNA 1QE6A 3IFTA 1ML0D 1FNUA 2IJ0A 3K57A 3L0OA 4TVAB 1KJ8A 2B2VA 4RNMA 3HOXH 2GA4B 2KCCA 2NU8B 3PF5A 2UUBQ 1C9OA 4YY3L 3V6KA 4OX9Q 4OO1H
chains in the Genus database with same CATH topology
4P71A 2JA8G 1Y1WH 2NN6I 1O7IA 1UE7A 4POGA 3BJUA 2K50A 1YJWA 4P73A 2JEAI 1I94Q 3DM3A 4A4IA 3KF8B 1WCMG 4JV5Q 3M4OH 3PV0A 2KENA 1QVFA 3I55A 1VQ5A 2BH2A 1QVGA 2VS1A 4BA1I 1GD7A 5C0XG 3UDFA 4HJ9A 4YY3Q 5IWAQ 4LFCQ 3GTLH 1AE3A 2QGQA 1L1OA 2E2HH 3OYYA 3GTGH 4OWTB 2N3SA 1R9TH 3HOUG 1N36L 2K5HA 2EIFA 1WYDA 3JAMc 3KJOA 4X66Q 3HOYH 2IY5B 4MZ9A 4IPCA 1U0LA 2I5MX 5IYBG 4DR2Q 4FDBA 4DUZQ 4A75A 1J5EL 1IXRA 3FHWA 5M5XH 1VQBA 3KFUA 4LUZA 2KBNA 4DV3Q 3T1YQ 4B3ML 2N49A 4DK3C 1CKMA 2UU9L 4DR1L 5IT9c 4KLKA 1JJ2A 2OQKA 2B3GA 4JI1L 1N9WA 2JA5H 2ASBA 1WFQA 2NZHA 1Q82C 4IOAA 4DUYL 2HIVA 3J7ZC 4A3JG 4LFBL 1I6HH 4DPGA 2MQHA 2LSSA 1YEZA 3CD6A 1IBLQ 3RN2A 3M4PA 4DV1Q 2Q2IA 1GO3E 4XTCS 3TS2A 3E9IA 5GQOA 4LF6Q 3S2DH 4JI7Q 2GVBA 4DR7Q 2BA1A 1GM5A 2OTJA 2RHQB 3HKZG 2JEBI 3S15H 4A3GG 3ER0A 1JJGA 3AYHB 2E2IH 3S24A 1VQ9A 2JA7H 3W5OA 4IOCA 1KD1C 4KI0A 1VQPA 2R93H 1PHJA 1EUJA 2YTXA 1CKNA 4AYBE 3G4SA 4DV5Q 4BBSG 1H95A 1LTLA 4YHHL 4DR5L 1LUZA 2E8GA 4JI6Q 4A3BG 1PH6A 1CSQA 2PI2A 1HR0W 3K81C 3U4ZA 4GOPC 4LFAL 3PUWA 2B63H 2VUMH 2IHFA 1I5FA 2BH8A 5M5YH 3OTOL 3AFPA 1G6PA 1TWFH 1VQFA 2A19A 4BY1G 3D0FA 5IP7G 1SR3A 3MEFA 4A3EG 2NVXH 3CF5A 2IX1A 1VQMA 4LUOA 5AJ3Q 1EOVA 1KQSA 2VQFL 1J6QA 2I5HA 4DV6Q 1T9HA 1JJCB 4YHHQ 4IO9A 2UUCL 2EXDA 1HR0L 4EQ5A 3OW2A 1YIJA 1NTGA 1L0WA 3K7UC 5BR8Q 3ULJA 4GNXC 3OTOQ 1IBKQ 3S16H 3K8AA 1YNXA 1IZ6A 5FJ8G 1PH9A 1JB7A 3GD7A 4X66L 2MNAA 4R4TA 2NVTH 3CCJA 5LMUQ 4DUZL 1P16A 1XPOA 1K9MC 4A3GH 4NXML 3PO3G 5C4XG 2K5NA 1LYLA 1N34Q 1XNQL 5M3MG 1XPUA 5C4XH 1NBWA 4QY7A 3F2CA 4DR3Q 4B3TQ 2WB1E 4GLAC 1B8AA 2UXBQ 2BA0A 3L7ZC 4X62L 4LWCA 1A62A 2LXKA 2E5LQ 2VQEL 4R4CA 2UXDL 3F8TA 1YVCA 4LF7L 5C0XJ 2RCNA 2VUMG 1QUQB 1FVIA 3HOZH 1X9NA 2CWAA 3FP9A 3NELA 5IYBH 1VQEA 3CC4A 4RG1A 1Q12A 3HOZG 4GNXA 3I4NG 2YTYA 1G291 2KCMA 2R7DA 4NB3A 1Y1WG 1TWGH 4BY1H 4OX9L 3PO2G 4A93G 3BU2A 2KHIA 2ALYB 5FLMH 4A3IH 2UXBL 5M3FH 3CC7A 3ICEA 3EBEA 2MO0A 4JOIC 1K8GA 1KC8C 3D31A 1MJEA 1VQJA 2QA4A 1XTDA 4LF5Q 1E3PA 1K0RA 2PMZE 2Y0SE 3K80C 3JAMi 4A3FH 1FL0A 4LF8L 1KRSA 2CKZB 3HOVH 5JEAG 4WJ4A 4AYBG 4KHPL 4GN5A 4P72A 3HOVG 1N32Q 5JJLA 4YCVA 5K36G 2Q2TA 5JJIA 2GN5A 1W2BA 2VNUD 2OWOA 4A3LG 1W3SA 1B7YB 2CFMA 4Y7NH 3HKZE 1XPRA 1PH4A 4JI3L 3KF6B 4A3LH 1E1OA 1P8LA 1OXXK 1VQGA 3STBC 3TRZA 3W1BA 4R4QA 3GTOH 2K52A 1JT8A 2WP8J 3K0XA 4DV0L 3ERSX 3RLOA 4A76A 1IBLL 3NEMA 4YWLA 4A3BH 1HH2P 1FJGQ 4JI8L 4LF4L 5GADC 2C35B 4A3JH 1VQ7A 1VQIA 4HJAA 2AWNA 3KJPA 1RL2A 2K14A 3I56A 5LMUL 1N33Q 3I4MG 4DR4L 4OO1G 1UE5A 5J3BA 1YHQA 4JI7L 3PIOA 1VCIA 3M85A 4DV5L 1PV4A 2FXQA 1AE2A 4DV0Q 1SMXA 4DR5Q 1V43A 4JC0A 3J81i 4JI6L 2HT1A 3I7FA 1FJGL 2F52A 1E22A 4JOIA 3SGIA 3KDFA 4JI8Q 4C3HH 4POFA 5IYCG 1Y1VG 2K4KA 4LF7Q 4LF4Q 4B3RQ 5IYDH 3H0GH 1Y1VH 1TWCH 4C2MH 2UXCQ 1L1OB 1SLJA 4C3IH 3S1NH 2PQAB 1UE6A 1E24A 4OONA 5GAHC 3PO3H 2JA6H 1N36Q 3PUXA 3CCEA 4X6AH 2RF4A 1Q86C 1HJPA 1FGUA 4OO1I 2YU9H 2Z6KA 2D0PA 2ZJRA 3U4VA 5C3EH 3S1RH 1J5EQ 4JI0Q 1YI2A 2Z6KC 2R92G 4DV3L 4HIOA 4LF5L 1EFWA 3T1YL 3EIVA 4JCVE 4ALPA 1VQHA 1NE3A 2YV5A 2VL6A 1SROA 2B63G 4KHPQ 2R7FA 2NN6G 1KXLA 3EN2A 1HR0Q 1SN8A 4PZ7A 2JA9A 2WAQE 2XTIA 3K7AH 3TS0A 2D0OA 2WFWA 5IP7H 3I4MH 3M7NA 1BBUA 1VQDA 2A1AA 3HFZB 2ZM6Q 4UPAA 4QQBX 4BY7G 1HNWQ 1SE8A 2ZTCA 4YCWA 5EAYA 3J81c 5FLMG 4A3IG 3BZCA 4X62Q 3J81j 1S72A 1HNXQ 4YWKA 4C3JH 1YJNA 2YYZA 1I94L 4JI0L 2Q2HA 2UXDQ 5C0XI 3PUZA 4HJ8A 1D8LA 4LF9Q 2ZJPA 2DUDA 4B3TL 1Q7YC 2A8VA 1Q1BA 2K75A 1K3RA 1KAWA 1MJCA 2JE6I 5JEAJ 1UE1A 4QJFA 4X65L 1HZCA 5FLXc 4HIKA 3HOUH 2JJQA 2ZM6L 3CAMA 3J80c 4DK6C 1CKNB 1XMQL 4QL5A 3UE0A 4WJ3M 2AMCB 3VDYA 1VQ8A 3E9HA 4A3CG 5HY6A 4HIDA 1OXUA 3TEHB 1NY4A 1E7ZA 1YHBA 4A3KG 4BA2I 5LMNQ 1SRUA 4LNQA 3A74A 3M9BA 4A3KH 5GAEC 1L2FA 3A5UA 3MXNB 1QZHA 2ES2A 2N78A 2CCZA 4LF9L 4DV7L 2ATWA 4IFDI 1PVOA 3W1GA 1OXSC 3CP0A 1CKOA 4HIMA 4R4IA 3HOXG 1K83H 1Q46A 4X65Q 3RZDH 4DV1L 1UWVA 3ZJYC 3A0JA 3CMEA 3RR5A 3PO2H 2B29A 3CQZH 4X64Q 3PUVA 4HJ7A 3UDGA 1XMOL 1B70B 1VS0A 1VQLA 1N32L 4JI4L 3JC66 4KHZA 3L2PA 4DAYB 2R7ZH 3PGZA 1PYBA 2JA7G 4JI3Q 4DV7Q 4IJHA 3M3YH 4JBMA 4TQUS 2R93G 1N8RC 4IJLA 3GTQH 4YCUA 4PMWA 1KIXA 4JBKA 1PFSA 1D7QA 3GTMH 5IP9H 3U58A 3CCUA 2WAQG 1ASZA 3KF6A 4GKJQ 2R6GA 5ELNA 1VQOA 5IP9G 1Y14B 1X54A 1WJJA 2AHOB 4NXNL 1VQCA 2PQAA 1HZBA 2DGYA 3CCMA 3CPWA 2ZTDA 1XMOQ 4JI4Q 4H02A 3T1HQ 3S14H 4A3CH 1TWHH 3WWVA 3G71A 4IPHA 3E0EA 1SFOH 4A93H 1UEBA 3G48A 2UUAL 2UU9Q 1VQKA 1IYJB 5AJ3L 4OXPA 3KDFB 3UDIA 1G51A 4DNIA 4DV2Q 5E7NA 3CCSA 1TXYA 4LFBQ 4DAMA 4OWWB 4A3FG 4L5TA 1U5KA 2RHSB 1HZAA 4GKJL 2UUBL 3TREA 2AWOA 3RNUA 4JYAQ 5IYDG 2Q2UA 1NMGA 1PH3A 3T1HL 1A8VA 3H3VI 1X55A 4DKAC 1OTCA 5FJ8H 1M1KC 3S17H 3RLNA 1QUQA 1X3FA 4GLVB 2H5XA 4JV5L 1N34L 1XNQQ 2R7ZG 4GN4B 3NENA 1KL9A 3HOWH 4DV2L 5M3MH 1HNZQ 3S1MH 3HOWG 1EWIA 4GOPB 3PSIA 1HNWL 3AQQA 3BZKA 1Q8KA 2KCTA 3GTJH 3GDEA 5GROA 1K73C 2F4VQ 4IFDG 4JYAL 2IHEA 1IBML 4LW1A 4GN3B 1I50H 1NJIC 4PG3A 1VQ6A 3CCVA 3HOYG 4QIWE 1RIPA 2WB1G 4UP8A 3GTKH 5C44G 4DV6L 2QEXA 4A3EH 2VQFQ 1BBWA 1TWAH 3STBD 5DLQE 2ZTEA 1Q1EA 2PNHA 2N8NA 2HHHQ 2JA5G 1HNZL 4JI2L 3GTPH 2PI2E 3KYHC 2MFIA 1LM0A 4DV4Q 1MIUA 3Q8DA 2E2JH 4L5SA 1VQ4A 4LF8Q 1QVCA 2LXJA 1X65A 2I5LX 2K5VA 3AEVA 4GNXB 2VY3A 4DR7L 5JJKA 3PIPA 3PCOB 1X3GA 5H1SE 3NBHB 1M90C 4P75A 3U50C 1EQQA 1PH5A 4AH6A 4HJ5A 1XMQQ 1QZGA 4LUVA 1Q81C 1VQAA 2HHHL 4UP9A 3S2HH 3CMAA 5IE8A 4YWMA 3KLWA 1XNRL 1X6OA 2OTLA 2VQEQ 4IPDA 1CUKA 1XJVA 5GAGC 1E1TA 1MKHA 3G6EA 5LMNL 1YITA 3J7A5 3FKIG 4LFAQ 4AQYL 1DGSA 1YHAA 1JE5A 1PH2A 3FKIH 4K0KQ 1AH9A 3F1ZA 1KRTA 3KOJA 2ZJQA 3H15A 3H3VH 4L5QA 3TQYA 1VQNA 4BXXH 1I3QH 3GO5A 4B3MQ 2JA8H 2IT1A 2JQOA 5M3FG 4DR1Q 1JMCA 1K8AC 4JBJA 4JI1Q 4BY7H 4BXXG 4J15A 5ELOA 1C0AA 1EIFA 2OQ0A 3CW2C 2EQSA 3AFQA 3IRBA 3CCLA 4DR2L 5IYCH 4GKKQ 5LMNW 4XIGS 4JI5L 1WCMH 2AKWB 2MO1A 4IPGA 4OWXB 4MTNA 2Y0SG 1IBKL 5M5WH 4K0KL 4AQYQ 4ME3A 2F3IA 3UE1A 3UDXA 1EQRA 3PF4A 2ID0A 1CSPA 3H0GG 1L1OC 1V9PA 2NVYH 4PZ8A 1Z47A 2UUAQ 5IWAL 3CPFA 4LF6L 1X56A 3A5ZB 3RN5A 4Y52H 4DR3L 4P74A 4OX9Q 3PUYA 4NXNQ 4MNOA 2YTVA 4BBSH 2KHJA 1YZ6A 2VW9A 1C7YA 2E5LL 2NVQH 1PA6A 4JI5Q 3RZOH 4IFDJ 4BBRG 3M4QA 4APVA 1S40A 3LGJA 4O0AA 4AIMA 1OXVA 5IY0A 1BVSA 4BBRH 4O2DA 1GVPA 2CWPA 2GVAA 4JG2A 3HKSA 1N33L 4DR4Q 4A3MG 4GKKL 1WOCA 4LFCL 3ULLA 4GLXA 1NMFA 4A3MH 1V1QA 2OCEA 1PH1A 5C4JH 4B3SQ 2HIXA 3B6YA 4X64L 1KHIA 3S1QH 2UUCQ 2I0QA 3I4OA 3CCQA 1XNRQ 1OXTA 4DR6Q 1WI5A 4QGUA 4EX5A 4UP7A 4L5RC 1HNXL 2D62A 5BR8L 3RLFA 1PH8A 1GKHA 2V1CC 4B3RL 1IBMQ 2CQOA 1BKBA 2XGTA 3I2ZA 3CXCA 4R4OA 4DUYQ 4UY8C 1YBYA 2UXCL 4GOPA 3DLLA 2JA6G 3CCRA 4RMFA 1EIYB 4NPSA 4R1JA 2Z0SA 4PZ6A 2F4VL 4JBWA 3CC2A 2VZAA 4GS3A 1PYSB 2JK8A 1ASYA 1HZ9A 1A63A 2HQLA 4B3SL 2R92H 2NZOA 4DR6L 3F2DA 4NXMQ 5C44H 5C3EG 3F2BA 4A3DH 2IX0A 5HGQA 3J80i 1Z9FA 3L0OA 4TVAB 4A3DG 1PH7A 1IL2A 4JI2Q 3HOXH 1A0IA 3ULPA 1X3EA 3PF5A 4DV4L 2L15A 2UUBQ 1C9OA 4YY3L 1YJ9A 1EYGA 1S3OA 3I4NH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P71 A;  2JA8 G;  1Y1W H;  2NN6 I;  1O7I A;  1UE7 A;  4POG A;  3BJU A;  2K50 A;  1YJW A;  4P73 A;  2JEA I;  1I94 Q;  3DM3 A;  4A4I A;  3KF8 B;  1WCM G;  4JV5 Q;  3M4O H;  3PV0 A;  2KEN A;  1QVF A;  3I55 A;  1VQ5 A;  2BH2 A;  1QVG A;  2VS1 A;  4BA1 I;  1GD7 A;  5C0X G;  3UDF A;  4HJ9 A;  4YY3 Q;  5IWA Q;  4LFC Q;  3GTL H;  1AE3 A;  2QGQ A;  1L1O A;  2E2H H;  3OYY A;  3GTG H;  4OWT B;  2N3S A;  1R9T H;  3HOU G;  1N36 L;  2K5H A;  2EIF A;  1WYD A;  3JAM c;  3KJO A;  4X66 Q;  3HOY H;  2IY5 B;  4MZ9 A;  4IPC A;  1U0L A;  2I5M X;  5IYB G;  4DR2 Q;  4FDB A;  4DUZ Q;  4A75 A;  1J5E L;  1IXR A;  3FHW A;  5M5X H;  1VQB A;  3KFU A;  4LUZ A;  2KBN A;  4DV3 Q;  3T1Y Q;  4B3M L;  2N49 A;  4DK3 C;  1CKM A;  2UU9 L;  4DR1 L;  5IT9 c;  4KLK A;  1JJ2 A;  2OQK A;  2B3G A;  4JI1 L;  1N9W A;  2JA5 H;  2ASB A;  1WFQ A;  2NZH A;  1Q82 C;  4IOA A;  4DUY L;  2HIV A;  3J7Z C;  4A3J G;  4LFB L;  1I6H H;  4DPG A;  2MQH A;  2LSS A;  1YEZ A;  3CD6 A;  1IBL Q;  3RN2 A;  3M4P A;  4DV1 Q;  2Q2I A;  1GO3 E;  4XTC S;  3TS2 A;  3E9I A;  5GQO A;  4LF6 Q;  3S2D H;  4JI7 Q;  2GVB A;  4DR7 Q;  2BA1 A;  1GM5 A;  2OTJ A;  2RHQ B;  3HKZ G;  2JEB I;  3S15 H;  4A3G G;  3ER0 A;  1JJG A;  3AYH B;  2E2I H;  3S24 A;  1VQ9 A;  2JA7 H;  3W5O A;  4IOC A;  1KD1 C;  4KI0 A;  1VQP A;  2R93 H;  1PHJ A;  1EUJ A;  2YTX A;  1CKN A;  4AYB E;  3G4S A;  4DV5 Q;  4BBS G;  1H95 A;  1LTL A;  4YHH L;  4DR5 L;  1LUZ A;  2E8G A;  4JI6 Q;  4A3B G;  1PH6 A;  1CSQ A;  2PI2 A;  1HR0 W;  3K81 C;  3U4Z A;  4GOP C;  4LFA L;  3PUW A;  2B63 H;  2VUM H;  2IHF A;  1I5F A;  2BH8 A;  5M5Y H;  3OTO L;  3AFP A;  1G6P A;  1TWF H;  1VQF A;  2A19 A;  4BY1 G;  3D0F A;  5IP7 G;  1SR3 A;  3MEF A;  4A3E G;  2NVX H;  3CF5 A;  2IX1 A;  1VQM A;  4LUO A;  5AJ3 Q;  1EOV A;  1KQS A;  2VQF L;  1J6Q A;  2I5H A;  4DV6 Q;  1T9H A;  1JJC B;  4YHH Q;  4IO9 A;  2UUC L;  2EXD A;  1HR0 L;  4EQ5 A;  3OW2 A;  1YIJ A;  1NTG A;  1L0W A;  3K7U C;  5BR8 Q;  3ULJ A;  4GNX C;  3OTO Q;  1IBK Q;  3S16 H;  3K8A A;  1YNX A;  1IZ6 A;  5FJ8 G;  1PH9 A;  1JB7 A;  3GD7 A;  4X66 L;  2MNA A;  4R4T A;  2NVT H;  3CCJ A;  5LMU Q;  4DUZ L;  1P16 A;  1XPO A;  1K9M C;  4A3G H;  4NXM L;  3PO3 G;  5C4X G;  2K5N A;  1LYL A;  1N34 Q;  1XNQ L;  5M3M G;  1XPU A;  5C4X H;  1NBW A;  4QY7 A;  3F2C A;  4DR3 Q;  4B3T Q;  2WB1 E;  4GLA C;  1B8A A;  2UXB Q;  2BA0 A;  3L7Z C;  4X62 L;  4LWC A;  1A62 A;  2LXK A;  2E5L Q;  2VQE L;  4R4C A;  2UXD L;  3F8T A;  1YVC A;  4LF7 L;  5C0X J;  2RCN A;  2VUM G;  1QUQ B;  1FVI A;  3HOZ H;  1X9N A;  2CWA A;  3FP9 A;  3NEL A;  5IYB H;  1VQE A;  3CC4 A;  4RG1 A;  1Q12 A;  3HOZ G;  4GNX A;  3I4N G;  2YTY A;  1G29 1;  2KCM A;  2R7D A;  4NB3 A;  1Y1W G;  1TWG H;  4BY1 H;  4OX9 L;  3PO2 G;  4A93 G;  3BU2 A;  2KHI A;  2ALY B;  5FLM H;  4A3I H;  2UXB L;  5M3F H;  3CC7 A;  3ICE A;  3EBE A;  2MO0 A;  4JOI C;  1K8G A;  1KC8 C;  3D31 A;  1MJE A;  1VQJ A;  2QA4 A;  1XTD A;  4LF5 Q;  1E3P A;  1K0R A;  2PMZ E;  2Y0S E;  3K80 C;  3JAM i;  4A3F H;  1FL0 A;  4LF8 L;  1KRS A;  2CKZ B;  3HOV H;  5JEA G;  4WJ4 A;  4AYB G;  4KHP L;  4GN5 A;  4P72 A;  3HOV G;  1N32 Q;  5JJL A;  4YCV A;  5K36 G;  2Q2T A;  5JJI A;  2GN5 A;  1W2B A;  2VNU D;  2OWO A;  4A3L G;  1W3S A;  1B7Y B;  2CFM A;  4Y7N H;  3HKZ E;  1XPR A;  1PH4 A;  4JI3 L;  3KF6 B;  4A3L H;  1E1O A;  1P8L A;  1OXX K;  1VQG A;  3STB C;  3TRZ A;  3W1B A;  4R4Q A;  3GTO H;  2K52 A;  1JT8 A;  2WP8 J;  3K0X A;  4DV0 L;  3ERS X;  3RLO A;  4A76 A;  1IBL L;  3NEM A;  4YWL A;  4A3B H;  1HH2 P;  1FJG Q;  4JI8 L;  4LF4 L;  5GAD C;  2C35 B;  4A3J H;  1VQ7 A;  1VQI A;  4HJA A;  2AWN A;  3KJP A;  1RL2 A;  2K14 A;  3I56 A;  5LMU L;  1N33 Q;  3I4M G;  4DR4 L;  4OO1 G;  1UE5 A;  5J3B A;  1YHQ A;  4JI7 L;  3PIO A;  1VCI A;  3M85 A;  4DV5 L;  1PV4 A;  2FXQ A;  1AE2 A;  4DV0 Q;  1SMX A;  4DR5 Q;  1V43 A;  4JC0 A;  3J81 i;  4JI6 L;  2HT1 A;  3I7F A;  1FJG L;  2F52 A;  1E22 A;  4JOI A;  3SGI A;  3KDF A;  4JI8 Q;  4C3H H;  4POF A;  5IYC G;  1Y1V G;  2K4K A;  4LF7 Q;  4LF4 Q;  4B3R Q;  5IYD H;  3H0G H;  1Y1V H;  1TWC H;  4C2M H;  2UXC Q;  1L1O B;  1SLJ A;  4C3I H;  3S1N H;  2PQA B;  1UE6 A;  1E24 A;  4OON A;  5GAH C;  3PO3 H;  2JA6 H;  1N36 Q;  3PUX A;  3CCE A;  4X6A H;  2RF4 A;  1Q86 C;  1HJP A;  1FGU A;  4OO1 I;  2YU9 H;  2Z6K A;  2D0P A;  2ZJR A;  3U4V A;  5C3E H;  3S1R H;  1J5E Q;  4JI0 Q;  1YI2 A;  2Z6K C;  2R92 G;  4DV3 L;  4HIO A;  4LF5 L;  1EFW A;  3T1Y L;  3EIV A;  4JCV E;  4ALP A;  1VQH A;  1NE3 A;  2YV5 A;  2VL6 A;  1SRO A;  2B63 G;  4KHP Q;  2R7F A;  2NN6 G;  1KXL A;  3EN2 A;  1HR0 Q;  1SN8 A;  4PZ7 A;  2JA9 A;  2WAQ E;  2XTI A;  3K7A H;  3TS0 A;  2D0O A;  2WFW A;  5IP7 H;  3I4M H;  3M7N A;  1BBU A;  1VQD A;  2A1A A;  3HFZ B;  2ZM6 Q;  4UPA A;  4QQB X;  4BY7 G;  1HNW Q;  1SE8 A;  2ZTC A;  4YCW A;  5EAY A;  3J81 c;  5FLM G;  4A3I G;  3BZC A;  4X62 Q;  3J81 j;  1S72 A;  1HNX Q;  4YWK A;  4C3J H;  1YJN A;  2YYZ A;  1I94 L;  4JI0 L;  2Q2H A;  2UXD Q;  5C0X I;  3PUZ A;  4HJ8 A;  1D8L A;  4LF9 Q;  2ZJP A;  2DUD A;  4B3T L;  1Q7Y C;  2A8V A;  1Q1B A;  2K75 A;  1K3R A;  1KAW A;  1MJC A;  2JE6 I;  5JEA J;  1UE1 A;  4QJF A;  4X65 L;  1HZC A;  5FLX c;  4HIK A;  3HOU H;  2JJQ A;  2ZM6 L;  3CAM A;  3J80 c;  4DK6 C;  1CKN B;  1XMQ L;  4QL5 A;  3UE0 A;  4WJ3 M;  2AMC B;  3VDY A;  1VQ8 A;  3E9H A;  4A3C G;  5HY6 A;  4HID A;  1OXU A;  3TEH B;  1NY4 A;  1E7Z A;  1YHB A;  4A3K G;  4BA2 I;  5LMN Q;  1SRU A;  4LNQ A;  3A74 A;  3M9B A;  4A3K H;  5GAE C;  1L2F A;  3A5U A;  3MXN B;  1QZH A;  2ES2 A;  2N78 A;  2CCZ A;  4LF9 L;  4DV7 L;  2ATW A;  4IFD I;  1PVO A;  3W1G A;  1OXS C;  3CP0 A;  1CKO A;  4HIM A;  4R4I A;  3HOX G;  1K83 H;  1Q46 A;  4X65 Q;  3RZD H;  4DV1 L;  1UWV A;  3ZJY C;  3A0J A;  3CME A;  3RR5 A;  3PO2 H;  2B29 A;  3CQZ H;  4X64 Q;  3PUV A;  4HJ7 A;  3UDG A;  1XMO L;  1B70 B;  1VS0 A;  1VQL A;  1N32 L;  4JI4 L;  3JC6 6;  4KHZ A;  3L2P A;  4DAY B;  2R7Z H;  3PGZ A;  1PYB A;  2JA7 G;  4JI3 Q;  4DV7 Q;  4IJH A;  3M3Y H;  4JBM A;  4TQU S;  2R93 G;  1N8R C;  4IJL A;  3GTQ H;  4YCU A;  4PMW A;  1KIX A;  4JBK A;  1PFS A;  1D7Q A;  3GTM H;  5IP9 H;  3U58 A;  3CCU A;  2WAQ G;  1ASZ A;  3KF6 A;  4GKJ Q;  2R6G A;  5ELN A;  1VQO A;  5IP9 G;  1Y14 B;  1X54 A;  1WJJ A;  2AHO B;  4NXN L;  1VQC A;  2PQA A;  1HZB A;  2DGY A;  3CCM A;  3CPW A;  2ZTD A;  1XMO Q;  4JI4 Q;  4H02 A;  3T1H Q;  3S14 H;  4A3C H;  1TWH H;  3WWV A;  3G71 A;  4IPH A;  3E0E A;  1SFO H;  4A93 H;  1UEB A;  3G48 A;  2UUA L;  2UU9 Q;  1VQK A;  1IYJ B;  5AJ3 L;  4OXP A;  3KDF B;  3UDI A;  1G51 A;  4DNI A;  4DV2 Q;  5E7N A;  3CCS A;  1TXY A;  4LFB Q;  4DAM A;  4OWW B;  4A3F G;  4L5T A;  1U5K A;  2RHS B;  1HZA A;  4GKJ L;  2UUB L;  3TRE A;  2AWO A;  3RNU A;  4JYA Q;  5IYD G;  2Q2U A;  1NMG A;  1PH3 A;  3T1H L;  1A8V A;  3H3V I;  1X55 A;  4DKA C;  1OTC A;  5FJ8 H;  1M1K C;  3S17 H;  3RLN A;  1QUQ A;  1X3F A;  4GLV B;  2H5X A;  4JV5 L;  1N34 L;  1XNQ Q;  2R7Z G;  4GN4 B;  3NEN A;  1KL9 A;  3HOW H;  4DV2 L;  5M3M H;  1HNZ Q;  3S1M H;  3HOW G;  1EWI A;  4GOP B;  3PSI A;  1HNW L;  3AQQ A;  3BZK A;  1Q8K A;  2KCT A;  3GTJ H;  3GDE A;  5GRO A;  1K73 C;  2F4V Q;  4IFD G;  4JYA L;  2IHE A;  1IBM L;  4LW1 A;  4GN3 B;  1I50 H;  1NJI C;  4PG3 A;  1VQ6 A;  3CCV A;  3HOY G;  4QIW E;  1RIP A;  2WB1 G;  4UP8 A;  3GTK H;  5C44 G;  4DV6 L;  2QEX A;  4A3E H;  2VQF Q;  1BBW A;  1TWA H;  3STB D;  5DLQ E;  2ZTE A;  1Q1E A;  2PNH A;  2N8N A;  2HHH Q;  2JA5 G;  1HNZ L;  4JI2 L;  3GTP H;  2PI2 E;  3KYH C;  2MFI A;  1LM0 A;  4DV4 Q;  1MIU A;  3Q8D A;  2E2J H;  4L5S A;  1VQ4 A;  4LF8 Q;  1QVC A;  2LXJ A;  1X65 A;  2I5L X;  2K5V A;  3AEV A;  4GNX B;  2VY3 A;  4DR7 L;  5JJK A;  3PIP A;  3PCO B;  1X3G A;  5H1S E;  3NBH B;  1M90 C;  4P75 A;  3U50 C;  1EQQ A;  1PH5 A;  4AH6 A;  4HJ5 A;  1XMQ Q;  1QZG A;  4LUV A;  1Q81 C;  1VQA A;  2HHH L;  4UP9 A;  3S2H H;  3CMA A;  5IE8 A;  4YWM A;  3KLW A;  1XNR L;  1X6O A;  2OTL A;  2VQE Q;  4IPD A;  1CUK A;  1XJV A;  5GAG C;  1E1T A;  1MKH A;  3G6E A;  5LMN L;  1YIT A;  3J7A 5;  3FKI G;  4LFA Q;  4AQY L;  1DGS A;  1YHA A;  1JE5 A;  1PH2 A;  3FKI H;  4K0K Q;  1AH9 A;  3F1Z A;  1KRT A;  3KOJ A;  2ZJQ A;  3H15 A;  3H3V H;  4L5Q A;  3TQY A;  1VQN A;  4BXX H;  1I3Q H;  3GO5 A;  4B3M Q;  2JA8 H;  2IT1 A;  2JQO A;  5M3F G;  4DR1 Q;  1JMC A;  1K8A C;  4JBJ A;  4JI1 Q;  4BY7 H;  4BXX G;  4J15 A;  5ELO A;  1C0A A;  1EIF A;  2OQ0 A;  3CW2 C;  2EQS A;  3AFQ A;  3IRB A;  3CCL A;  4DR2 L;  5IYC H;  4GKK Q;  5LMN W;  4XIG S;  4JI5 L;  1WCM H;  2AKW B;  2MO1 A;  4IPG A;  4OWX B;  4MTN A;  2Y0S G;  1IBK L;  5M5W H;  4K0K L;  4AQY Q;  4ME3 A;  2F3I A;  3UE1 A;  3UDX A;  1EQR A;  3PF4 A;  2ID0 A;  1CSP A;  3H0G G;  1L1O C;  1V9P A;  2NVY H;  4PZ8 A;  1Z47 A;  2UUA Q;  5IWA L;  3CPF A;  4LF6 L;  1X56 A;  3A5Z B;  3RN5 A;  4Y52 H;  4DR3 L;  4P74 A;  4OX9 Q;  3PUY A;  4NXN Q;  4MNO A;  2YTV A;  4BBS H;  2KHJ A;  1YZ6 A;  2VW9 A;  1C7Y A;  2E5L L;  2NVQ H;  1PA6 A;  4JI5 Q;  3RZO H;  4IFD J;  4BBR G;  3M4Q A;  4APV A;  1S40 A;  3LGJ A;  4O0A A;  4AIM A;  1OXV A;  5IY0 A;  1BVS A;  4BBR H;  4O2D A;  1GVP A;  2CWP A;  2GVA A;  4JG2 A;  3HKS A;  1N33 L;  4DR4 Q;  4A3M G;  4GKK L;  1WOC A;  4LFC L;  3ULL A;  4GLX A;  1NMF A;  4A3M H;  1V1Q A;  2OCE A;  1PH1 A;  5C4J H;  4B3S Q;  2HIX A;  3B6Y A;  4X64 L;  1KHI A;  3S1Q H;  2UUC Q;  2I0Q A;  3I4O A;  3CCQ A;  1XNR Q;  1OXT A;  4DR6 Q;  1WI5 A;  4QGU A;  4EX5 A;  4UP7 A;  4L5R C;  1HNX L;  2D62 A;  5BR8 L;  3RLF A;  1PH8 A;  1GKH A;  2V1C C;  4B3R L;  1IBM Q;  2CQO A;  1BKB A;  2XGT A;  3I2Z A;  3CXC A;  4R4O A;  4DUY Q;  4UY8 C;  1YBY A;  2UXC L;  4GOP A;  3DLL A;  2JA6 G;  3CCR A;  4RMF A;  1EIY B;  4NPS A;  4R1J A;  2Z0S A;  4PZ6 A;  2F4V L;  4JBW A;  3CC2 A;  2VZA A;  4GS3 A;  1PYS B;  2JK8 A;  1ASY A;  1HZ9 A;  1A63 A;  2HQL A;  4B3S L;  2R92 H;  2NZO A;  4DR6 L;  3F2D A;  4NXM Q;  5C44 H;  5C3E G;  3F2B A;  4A3D H;  2IX0 A;  5HGQ A;  3J80 i;  1Z9F A;  3L0O A;  4TVA B;  4A3D G;  1PH7 A;  1IL2 A;  4JI2 Q;  3HOX H;  1A0I A;  3ULP A;  1X3E A;  3PF5 A;  4DV4 L;  2L15 A;  2UUB Q;  1C9O A;  4YY3 L;  1YJ9 A;  1EYG A;  1S3O A;  3I4N H; 
#chains in the Genus database with same CATH topology
 3M4Y A;  3MXN A;  2JA8 G;  2O4X A;  1WTO A;  1Y1W H;  4FVM A;  1BJT A;  4RB2 C;  1OO9 B;  1LTS D;  1GUS A;  4P73 A;  3DM3 A;  1G91 A;  4L63 B;  2WYO A;  3M4O H;  2JA6 A;  4YJ2 F;  4ECU A;  1SDF A;  5C0X H;  5KNB A;  2NVQ B;  5C0X G;  5KT5 A;  1AE3 A;  1L1O A;  4HSV A;  4OWT B;  2N3S A;  1R9T H;  3HOU G;  4KK7 A;  4RHS A;  4F4W A;  5KG3 A;  2IP4 A;  3JAM c;  3KJO A;  4MV7 A;  2EDG A;  4IPC A;  1U0L A;  2UVR A;  5C44 B;  4IAL A;  5KFF A;  1UC9 A;  2E2D C;  1STA A;  5M5X H;  4UCU A;  2KBN A;  4B3M L;  4DK3 C;  4M8A A;  3KBG A;  2OLS A;  4KLK A;  5C6A A;  5KFO A;  2JA5 H;  1TS2 A;  3U9T A;  2NZH A;  1T94 A;  2HIV A;  2QCP X;  3A7L A;  4DR7 H;  1IBL Q;  4F4Y A;  2NVX A;  2Q2I A;  5C4H A;  1LT3 D;  1LTB D;  4AYB B;  4JI7 Q;  4RA8 A;  2BA1 A;  3HOV B;  3HKZ G;  4WFN 3;  3S15 H;  3S16 B;  1JJG A;  1Z6H A;  5KFA A;  1V1P B;  3S24 A;  1VQ9 A;  3W5O A;  4HYK A;  3GID A;  2E2H A;  4CDF C;  1ILQ A;  5JVL A;  3KBX A;  2L1B A;  4BBS G;  1GXD C;  3LWB A;  4K2K A;  1U9R A;  4YHH L;  5HV6 A;  1LUZ A;  3FEW X;  5DM6 3;  1I50 B;  2EZV A;  5BPF A;  3NSW A;  3CRL C;  3K81 C;  5KFB A;  4GOP C;  4LFA L;  4UAI A;  4LF5 H;  2VUM H;  4A2B A;  5M5Y H;  4I55 F;  4LF7 H;  3K3P A;  1G6P A;  4YAJ B;  4BWS C;  2W6Q A;  3ITP A;  2F0D A;  4EYI B;  1W96 A;  2KEC A;  4A3E G;  2ENB A;  2I07 B;  3CF5 A;  2IX1 A;  5EOY A;  2XGP A;  5BR8 H;  1ET9 A;  3RF2 A;  2E2I B;  3K3V A;  1CS0 A;  4K0K H;  4EQ5 A;  3DWA A;  3NBI A;  2Z4H A;  5KX5 F;  2W6M A;  5IOD A;  1L0W A;  1IL8 A;  3BDC A;  3K7U C;  5EJW A;  3ULJ A;  5BR8 Q;  3K5O A;  5FJ8 G;  4JI2 H;  4RKL A;  3NTI A;  4TQR A;  4KN4 C;  3GTQ A;  4R4T A;  5LMU Q;  1XPO A;  1SYG A;  3RZD B;  4BBS B;  4NXM L;  2K28 A;  1OWT A;  1HA6 A;  1XNQ L;  3GIL A;  5F9N A;  2QEJ C;  2K03 A;  1LTG D;  2UXC H;  4GLA C;  1B8A A;  3L7Z C;  3SK6 A;  4X62 L;  4RB0 A;  1HA5 A;  2E5L Q;  1TWH A;  1DCZ A;  2B2U A;  4R4C A;  4KHV A;  2UXD L;  3UI2 A;  3ETH A;  4GKK H;  1I3Q B;  3OHX C;  1NAP A;  5D1O B;  1U4M A;  2RCN A;  1FVI A;  1SJH D;  5M5X B;  1JIH A;  1X9N A;  1WH2 A;  2LY7 A;  2EJM A;  1Q12 A;  4JUZ A;  4GNX A;  2F4I A;  2YTY A;  5CBE E;  2F0K A;  2ZXP A;  4A93 G;  2SNS A;  2ALY B;  3OWE B;  5M3F H;  2MO0 A;  1K8G A;  1KC8 C;  3GIM A;  2PMZ A;  3JAM i;  5KG5 A;  4A3F H;  1FL0 A;  5FD6 A;  1KRS A;  2V59 A;  3HOV H;  3I4M B;  2C2D A;  4KHP L;  3A8I E;  2VR1 A;  2VPS A;  3NE5 B;  3HOV G;  4YCV A;  3DEO A;  1W2B A;  2I80 A;  3S1N B;  4QWD A;  1W3S A;  2CFM A;  3HKZ E;  2J9G A;  2L12 A;  1BCP D;  1OXX K;  1LTA D;  2K52 A;  3RTX A;  3RLO A;  2KSW A;  4J0M A;  1JOO A;  4YWL A;  3RFC A;  1HH2 P;  4LFC H;  1EYD A;  3HOW B;  4J9L A;  1ZHS A;  3BA9 A;  5GAD C;  4QWC A;  3GIJ A;  2AWN A;  1M8A A;  3MVV A;  3EVQ A;  1TAE A;  4ZYS A;  2A73 B;  1SEI A;  5L1J A;  4EFB A;  5CYU A;  1XTC D;  3OIP A;  3S2H B;  3GTG A;  1RCV D;  3RB0 A;  1UNS A;  3M85 A;  1PV4 A;  3LP8 A;  4EYH B;  4DV0 Q;  4DR5 Q;  1L0X B;  4JC0 A;  1STY A;  2HT1 A;  3I7F A;  1QWY A;  5JJK A;  3SGI A;  4C3H H;  2M05 A;  2JN4 A;  3KDF A;  4JI8 Q;  4Q0Y A;  4C1N K;  2YL2 A;  2ICE C;  3C0F B;  3K5M A;  1IHZ A;  3NUC A;  5FD5 A;  3PO2 B;  2PZT A;  1Y1V H;  4C2M H;  5KT3 A;  2BQR A;  4C3I H;  3MWM A;  1N36 H;  3GTO A;  5L37 A;  3VA7 A;  5D8D A;  2JA8 B;  4MA0 A;  5K36 H;  3BAB A;  2F0S A;  4OON A;  4O1N A;  1VMP A;  5KFL A;  4JV1 A;  3CCE A;  4X6A H;  2KOL A;  1Q86 C;  4OO1 I;  3PMF A;  2Z6K A;  4CBV A;  3U4V A;  2EYJ A;  1J5E Q;  4J9M A;  1RK5 A;  4IUU A;  4LF5 L;  2X6G A;  3T1Y L;  1WTX A;  1SFO B;  1SRO A;  2B63 G;  2YCH A;  1S0O A;  1WTV A;  2NN6 G;  1UUP A;  2CW0 C;  3EN2 A;  1HR0 Q;  3R2I A;  4FBU A;  2JA9 A;  2HQE A;  5JOB A;  2HCI A;  2HVQ A;  3TS0 A;  1WCM A;  1I4R A;  3I4M H;  1BBU A;  2ASL A;  5M3F B;  4DV1 H;  4QQB X;  5KFR A;  3CU7 A;  1XNR H;  4MV3 A;  1S72 A;  1NR2 A;  1N33 H;  3A54 A;  3RZO B;  5IIF A;  4C3J H;  1YJN A;  3TN2 A;  2C2R A;  1D8L A;  4C3H G;  3R3O A;  3FKI B;  3C3L A;  2SCU B;  3BQ1 A;  4MTD A;  1HNZ H;  4B3T L;  1Q7Y C;  1Q1B A;  1HTP A;  1R4Q B;  4NMZ A;  1TWF B;  1DZ1 A;  4V19 0;  1LT6 D;  1CKN B;  2BQ3 A;  1VBH A;  4QL5 A;  3UE0 A;  1I7L A;  1VQ8 A;  2K6A A;  5HY6 A;  1SCU B;  2UXD H;  3GTQ B;  4BA2 I;  2FPG B;  1MI2 A;  2RKS A;  5JQW A;  4NLG A;  3A74 A;  3M9B A;  3N43 B;  4A3K H;  1QZH A;  5KFD A;  2N78 A;  5EKK A;  2J4X A;  4DV7 L;  3J80 L;  1PVO A;  2FIN B;  1RJR A;  1VBG A;  1AW7 A;  4R4I A;  2FB9 A;  2B2Y A;  5ELE A;  3I73 A;  3QG1 A;  5CV9 A;  1VQL A;  4RB1 A;  4JI4 L;  2UU9 H;  3L2P A;  4DAY B;  2A69 D;  5FO8 B;  2F0F A;  4JI3 Q;  4TV9 F;  3VA5 A;  1F9R A;  2B63 B;  1JE4 A;  2PZW A;  1N8R C;  2GLT A;  2UXB H;  3VPB A;  1KC7 A;  3GTM H;  3U58 A;  3FMC A;  3HG9 A;  2KVM A;  4GKJ Q;  3KF6 A;  4ETS A;  1LAB A;  4XYL B;  5KFN A;  2C9O A;  5IP9 G;  2W8L A;  3GTJ B;  5FLX E;  3S14 H;  2EY5 A;  4DU9 A;  2BCO A;  5G3L D;  4CDC C;  4IPH A;  3J81 L;  1K83 A;  3G48 A;  2UUA L;  4KMU C;  2UU9 Q;  1VQK A;  2V58 A;  3UDI A;  3GTL B;  4C3J B;  4DV2 Q;  3CCS A;  1CQJ B;  1TXY A;  2W57 A;  4DAM A;  3JRW A;  4IRD A;  1WVL A;  3GTP B;  3X3M A;  3TRE A;  2F3V A;  5KT2 A;  3RNU A;  3V05 A;  3A55 A;  4DNT B;  1EZ8 A;  4DLK A;  4FF1 A;  1A8V A;  3H3V I;  2PO4 A;  1X55 A;  5FJ8 H;  1QUQ A;  1S9F A;  5KIX A;  1X3F A;  3RD4 A;  2HCC A;  4XYQ A;  2JA5 B;  2H5X A;  1BO0 A;  3E5N A;  1PRT F;  4I7A A;  2W7O A;  3T4A C;  2NU6 B;  4IQZ A;  3ETJ A;  3HOW G;  4KKU A;  4GOP B;  1G6Z A;  3NBH A;  1TQO A;  2F4V Q;  3GDE A;  1K73 C;  1IBM L;  1CQI B;  1E4E B;  2JEF A;  4GN3 B;  1I50 H;  1NJI C;  2NB0 A;  5KFC A;  1HHV A;  1GUG A;  4GZY C;  4QIW E;  3BYY B;  3VR5 A;  3VR3 A;  2FPI B;  5M5Y B;  3GTK H;  1SE2 A;  4B08 A;  3T16 A;  5A2Q E;  2QDB A;  2QEX A;  1VMC A;  2LFN A;  3NWS A;  3S17 B;  1S0N A;  2PNH A;  2HHH Q;  2WAQ A;  3GTP H;  3QB3 A;  1LM0 A;  4F8M A;  1MIU A;  4LF8 Q;  4JI1 H;  4L5S A;  4IHJ F;  4X3S A;  1QVC A;  2J7Z A;  2LXJ A;  3R93 A;  5M3M B;  1S5C D;  4KY7 A;  1TY2 A;  2G9H D;  3PQI A;  4CC5 A;  3RV3 A;  3HRZ C;  3J7A F;  4C3J G;  3RAQ A;  1EQQ A;  5KFE A;  4ZOL F;  2R7L A;  4HJ5 A;  1XMQ Q;  3MWD A;  4IR9 A;  1KBL A;  1VQA A;  2QKI C;  1JCK B;  4YWM A;  2ASJ A;  1KNE A;  1I4P A;  2OTL A;  5FO9 B;  4TRD A;  4IPD A;  2ASD A;  1CUK A;  2P0A A;  4JYA H;  1R4P B;  1ZYR D;  1JE5 A;  5EPL A;  5L9X A;  4DR5 H;  1PH2 A;  5I9P A;  3VYT A;  3RB3 A;  5CV7 A;  4EEQ A;  1SMY D;  2ZJQ A;  3ONA B;  2BOS A;  4U67 3;  3MZ5 A;  4B3M Q;  1H9K A;  3GTL A;  2IT1 A;  2A68 C;  4JBJ A;  4YHH H;  4BXX G;  2KA7 A;  4J15 A;  5I2Y A;  2OQ0 A;  2R8H A;  1ZQ7 A;  3IRB A;  4Q43 A;  5LMN W;  1M0T A;  4LFA H;  4NP5 A;  3V4S A;  5JEA H;  2MO1 A;  4IPG A;  5COR A;  4MTN A;  4OWX B;  1HCZ A;  1SEB D;  1RF2 D;  4ZK9 B;  4ME3 A;  4R8I A;  5J39 A;  4ME6 A;  1CZG A;  4ZUJ A;  1T36 A;  1GSA A;  1GHJ A;  2Q8I B;  4XQQ A;  4UCR A;  4Y8V B;  1SNP A;  2XRS D;  3H0G G;  2NVY H;  4PZ8 A;  4FF3 A;  5KFP A;  1PTO C;  4DV3 H;  5IWA L;  1X56 A;  2F0E A;  3RN5 A;  5FPO A;  2NUC A;  2FMA A;  3FKI A;  3K59 A;  3L4K A;  2A6E D;  4QUC A;  1PA6 A;  3GQC A;  4IFD J;  3DMU A;  3GV6 A;  4APV A;  4BBR G;  1WD1 A;  1OXV A;  1K3B C;  5IY0 A;  2E2H B;  4MA5 A;  4ECV A;  4BBR H;  4O2D A;  1GVP A;  1RJP A;  3KHL A;  3HKS A;  3K5I A;  4EFE A;  3PW0 A;  2PYK A;  2RSO A;  4XZ3 B;  1NMF A;  1K1Q A;  4KV6 A;  4L6T B;  4X62 H;  3B6Y A;  1KHI A;  2F0T A;  1I4Q A;  5IGF A;  4MTE A;  3HS0 C;  2FLN A;  2QF7 A;  3G6Y A;  5EKI A;  1LV9 A;  5BR8 L;  3RLF A;  1PH8 A;  5DQG A;  5FKA C;  2O5J C;  1Y1W A;  1BKB A;  4KKS A;  4H44 C;  2LS0 1;  4R4O A;  2VQD A;  1X3Q A;  5JUM A;  1YBY A;  4RAU C;  1HPC A;  3RBE A;  2IX3 A;  2JA6 G;  3T5K A;  3CCR A;  4NPS A;  4JBW A;  4IR1 A;  2VZA A;  4ED1 A;  2DPJ A;  1PYS B;  4I7H A;  5I6Y A;  1HZ9 A;  5BMV F;  4HNT A;  3IAY A;  2QK4 A;  4DAP A;  4DR6 L;  4I50 F;  5KG6 A;  1UC8 A;  3F2D A;  3KHH A;  2PZU A;  3JSL A;  2NZ1 D;  1ONL A;  2KQ3 A;  5HGQ A;  5KFJ A;  3J80 i;  3MR6 A;  3ERQ A;  5BPH A;  3N40 P;  4UFZ A;  1PH7 A;  1IL2 A;  5J2U F;  3D4W A;  5CAE B;  3V96 A;  4QWE A;  3HOY B;  2W6P A;  3HBL A;  2A5H A;  1S3O A;  3I4N H;  3BYT B;  4P71 A;  4IAJ A;  2CW7 A;  1O7I A;  1MD2 D;  2FMC A;  4KY6 A;  2RCF A;  3CKI B;  3BJU A;  3P75 A;  5DAU A;  2K50 A;  1YJW A;  1RHP A;  1PZI D;  1XDN A;  4KKT A;  1EL0 A;  1A3V A;  3KF8 B;  3PV0 A;  4IUP A;  1H9J A;  1VQ5 A;  2BH2 A;  2FLL A;  1TWA A;  1F2Z A;  3QZ7 A;  2VA2 A;  1GD7 A;  4ED8 A;  3JAM E;  2K05 A;  4HJ9 A;  2QGQ A;  4G7Z C;  3OYY A;  1MSH A;  5T14 A;  1D2B A;  2YRX A;  5LP6 F;  4HR7 B;  1WYD A;  3C1E A;  4LF9 H;  2MPM A;  1C48 A;  2I5M X;  4DR2 Q;  4A75 A;  3KFU A;  4LUZ A;  4DV3 Q;  2PMZ B;  2R87 A;  1IOW A;  4DL7 A;  2B3G A;  3H0G A;  3NP8 A;  2SDF A;  4JK1 C;  1Q82 C;  1RJQ A;  1STB A;  2ZDH A;  1I6H H;  2EYP A;  5J22 A;  3SI8 A;  4HSP A;  5EPK A;  1YEZ A;  4OEL B;  3A8K E;  3PW7 A;  3TS2 A;  4MV4 A;  5GQO A;  1FJG H;  1AP0 A;  4DR7 Q;  1O7Z A;  4HMJ A;  3MHB A;  5HUR A;  4UCV A;  5I6W A;  1BCP C;  2JA7 H;  4CDD C;  1KD1 C;  3GLK A;  4KI0 A;  1VQP A;  2W9C B;  4Y7N B;  4RGM A;  3G4S A;  4DV5 Q;  5CV5 A;  3Q8R B;  5CV4 A;  1LTL A;  2F1M A;  4JI6 Q;  2YW2 A;  5LOV F;  1PYW D;  1PH6 A;  2PI2 A;  1HR0 W;  1EY6 A;  5J1Z A;  3PW4 A;  1GGO A;  3U4Z A;  1MBY A;  2L4N A;  1I4H A;  4DF7 A;  1CQF A;  1I7N A;  3AFP A;  5C1O A;  1TWF H;  1VQF A;  2P5Z X;  3SE0 A;  4BY1 G;  1KAB A;  3JZI A;  1SR3 A;  3MEF A;  3P20 A;  1VF7 A;  1VQM A;  1EY5 A;  1EOV A;  2DNE A;  2I5H A;  4DV6 Q;  3VYS A;  5IT9 E;  2UUC L;  4F87 A;  1HR0 L;  1C30 A;  5KYI A;  3A56 A;  4XYO A;  4KJN A;  1LT4 D;  1ILP A;  2Y0S B;  5IGG A;  5A2Q W;  1IBK Q;  2E5L H;  2R93 A;  1HUM A;  4X66 L;  4ZKB B;  2MNA A;  2R7K A;  2JA7 B;  4FO2 A;  2ZJT A;  3D3R A;  5DEH A;  4DR3 H;  4DUZ L;  2IW3 A;  3BG3 A;  2YZM A;  3R23 A;  5M3M G;  1XPU A;  3OWF A;  1NBW A;  1S5D D;  3I8Z A;  2WTF A;  4B3T Q;  1T5X D;  2VA3 A;  1A3U A;  5KFW A;  2I46 A;  5IGE A;  5KEE A;  2BA0 A;  5F9L A;  2R6F A;  3P7J A;  1TWC B;  4DFA A;  4LWC A;  3GTO B;  2LXK A;  4ZQ3 A;  2VQE L;  3NQT A;  4C56 C;  1YVC A;  2HJW A;  5KFX A;  1E2Z A;  2VUM G;  1F2M A;  3HOZ H;  3FP9 A;  3NEL A;  4RG1 A;  1LT5 D;  3I4N G;  1N56 A;  2UXB L;  4JOI C;  2R92 B;  4WRD A;  3Q0A A;  3D31 A;  1MJE A;  1VQJ A;  2F0O A;  4FM9 A;  3H91 A;  1XTD A;  3M7G A;  4LF5 Q;  2PMZ E;  3K5L A;  4JV0 A;  1CT1 D;  4C5B A;  2EYM A;  5JJL A;  4F4X A;  3H20 A;  3ERO A;  1K1S A;  2OF1 A;  2UUA H;  4A3L G;  4HED A;  3GTJ A;  4Y7N H;  3CHB D;  2R61 A;  3KF6 B;  4JI3 L;  4A3L H;  4ZUI A;  3HKZ A;  4JI4 H;  1ESR A;  1TR5 A;  1YNJ D;  3GTO H;  2WP8 J;  4EGV A;  3DWQ A;  4C5A A;  4DV0 L;  1I6V C;  3NEM A;  3QWN A;  4A3B H;  4EQP A;  4JI8 L;  1IKM A;  4FU0 A;  1BF4 A;  5IGD A;  3KLR A;  1TWG A;  4A3J H;  2C35 B;  3BS1 A;  3KJP A;  1WD0 A;  3E3X A;  2K14 A;  3I56 A;  1D5X C;  2AQ1 B;  1N33 Q;  2NVX B;  1UE5 A;  3F2U A;  4B9W A;  2F0Q A;  2BR0 A;  2UUB H;  3MR3 A;  2FXQ A;  1BGW A;  1ZET A;  4O4L F;  1SMX A;  2FJ2 A;  3J81 i;  2F0U A;  4UCT A;  2I8C A;  4YB8 B;  1FJG L;  2F52 A;  3A7A B;  5BN4 A;  1HTL D;  1D1I A;  2R8I A;  1J5E H;  1K83 B;  2K4K A;  4LF7 Q;  2V4Q A;  5KFH A;  4APM A;  2W8K A;  4G3I A;  3NXW A;  2UXC Q;  3PVX A;  1QNK A;  4FS2 A;  1UE6 A;  4DL5 A;  5ELC A;  2JA6 H;  1N36 Q;  2RF4 A;  1AFP A;  1HJP A;  2PBZ A;  1F77 A;  3SXH A;  4FXK C;  2ZJR A;  3S9W A;  1EQT A;  1YI2 A;  1EFW A;  5L1L A;  3QO2 A;  3EIV A;  4JCV E;  5JAV A;  4ALP A;  1VQH A;  4LF4 H;  2KCN A;  5DG8 A;  2R93 B;  1IW7 C;  2F0I A;  4PNY A;  4CJ2 C;  2R7F A;  3V6H A;  1RKN A;  1KXL A;  3KXY T;  2HDL A;  5I47 A;  5EWE A;  5KFK A;  2NN6 H;  2WAQ E;  2XTI A;  4G57 A;  4RAY A;  1GJX A;  1VQD A;  2A1A A;  4QB4 A;  4NW2 A;  1HNW Q;  3K6O A;  1R9T B;  3J81 c;  3PW2 A;  5FLM G;  4A3I G;  2EPB A;  4FS1 A;  2Q2H A;  4HJ8 A;  4ECS A;  2XIG A;  4LF9 Q;  2F0G A;  3TIN A;  1KAW A;  2K75 A;  2JE6 I;  3EPI A;  5JEA J;  1ESF A;  4K8I A;  1HZC A;  4HIK A;  2JJQ A;  3J80 c;  1S4Z A;  4DK6 C;  2H1E A;  1XMQ L;  1KJ9 A;  4YY3 H;  1LAC A;  2F0J A;  4UDU C;  5CBA E;  4WJ3 M;  5IWA H;  3VDY A;  4A3C G;  4AQY H;  2RSN A;  3KLS A;  4HID A;  4J9O A;  2RDI A;  5FOB B;  3S15 B;  3N8D A;  1E7Z A;  4KJO A;  5KT7 A;  1SRU A;  4DGZ A;  2V5A A;  1L2F A;  4LF9 L;  3MXN B;  1C4Q A;  2ES2 A;  4IFD I;  3L4J A;  2WKC A;  1E2W A;  2LMC B;  3I72 A;  1FNW A;  3FDT A;  1DON A;  3RUP A;  1K83 H;  4A3G B;  4FXD A;  3ZJY C;  3A0J A;  4HMI A;  4X64 Q;  1B9N A;  5GON F;  1N32 L;  3JC6 6;  1BOS A;  4DL4 A;  2R7Z H;  1PYB A;  1I3Q A;  3J80 W;  3PW5 A;  1SYD A;  4IJH A;  4JBM A;  4PV1 C;  1EWH A;  4TQU S;  2R93 G;  3BVG A;  4IJL A;  4YCU A;  4PMW A;  3M4I A;  2I87 A;  5IP9 H;  2WIN B;  1AZP A;  4LJZ C;  1ASZ A;  5ELN A;  1G8Z D;  1Y14 B;  4HAE A;  1ENC A;  1WJJ A;  1PFM A;  3KF8 A;  3MR5 A;  1HZB A;  2DGY A;  3CCM A;  5IGB A;  2ZTD A;  4H02 A;  3DWP A;  5KG7 A;  4JI8 H;  3OSP A;  3MA2 B;  3G71 A;  3E0E A;  1JOR A;  1UEB A;  2F0H A;  3MWY W;  3GIP A;  2A6H D;  1IYJ B;  4OXP A;  3KDF B;  3BDL A;  3MXP A;  2NWG A;  5D3D A;  2PNR C;  1WTP A;  4H0L C;  1ZEQ X;  4LFB Q;  1JWU D;  2RHS B;  2UUB L;  1IBL H;  1NNX A;  1EIH A;  3JRX A;  1FGB D;  4J9N A;  3T1H L;  3H94 A;  1OTC A;  4IUN A;  1SND A;  3S17 H;  1VAJ A;  2NYZ D;  4WBN F;  1I4X A;  2FLP A;  3T56 B;  4R9W A;  3HOW H;  1K8O A;  5M3M H;  1JC7 A;  4J9S A;  1CTM A;  3PSI A;  3BZK A;  1Q8K A;  2KCT A;  3TDQ A;  1PXU A;  4RNN A;  1KAA A;  1C8C A;  2JXM B;  4UCO A;  1EY9 A;  4MV1 A;  1V1P A;  1VQ6 A;  3CCV A;  2ZDQ A;  3I91 A;  2R8K A;  4DL6 A;  4O3R A;  4DV6 L;  1DIK A;  2ATL A;  2VQF Q;  2WE6 A;  1YNN C;  2W71 A;  3STB D;  2ZTE A;  4I7Z C;  3LX0 A;  2N8N A;  2F03 A;  4KHP H;  5I9O A;  1CM9 A;  4WD3 A;  4C3I B;  4DK1 A;  2K5W A;  5KFI A;  3IL8 A;  1QCB D;  3AEV A;  2Z4I A;  4A3M B;  4CKC A;  1JIC A;  1X3G A;  4ZKC B;  5H1S E;  3VYR A;  1JKJ B;  4P75 A;  4EGQ A;  5C5J A;  3U50 C;  1ICF B;  1UEA B;  2F0M A;  3Q6S A;  5D1O A;  2NU9 B;  2JEG A;  3UFX B;  1XWE A;  2B63 A;  1QZG A;  3S2H H;  1CK1 A;  4UP9 A;  3CMA A;  1X6O A;  2B8G A;  1D5M C;  2D9U A;  4HN7 A;  2VQE Q;  4QF4 A;  4G7H C;  2EYL A;  3G6E A;  1MKH A;  2IL8 A;  5LMN L;  3X3N A;  3NTH A;  3FKI G;  4JI3 H;  2CW0 D;  4LFA Q;  4AQY L;  2HUG A;  2WB1 A;  3HP3 A;  3FKI H;  1DD2 A;  3BA8 A;  1EEI D;  2B39 A;  3F1Z A;  3VYU A;  3HZX A;  3VPC A;  1KRT A;  3D6C A;  3KOJ A;  3H3V H;  5EWG A;  4O3Q A;  4C5C A;  4BXX H;  3GO5 A;  3OTO H;  1C3O A;  2JA8 H;  5M3F G;  2JQO A;  1IKL A;  5COY A;  4X65 H;  5AFW A;  5ELO A;  2XSC A;  3WOF A;  1GSH A;  3PO3 B;  1B44 D;  1B53 A;  2EE1 A;  2EQS A;  1TVX A;  3AFQ A;  5IYC H;  3CCL A;  2W6O A;  4X64 H;  1DOM A;  3BQ0 A;  1WCM H;  1SYX B;  2G9D A;  2FK3 A;  3RGX A;  4AQY Q;  3UE1 A;  2F3I A;  4O3O A;  4F50 A;  1EQR A;  4RZQ A;  4K5X A;  2W6N A;  1L1O C;  2XN9 C;  5IT9 L;  3R5F A;  2H4O A;  3J7Y W;  4A3I B;  3CPF A;  2F4V H;  2JEI A;  3A5Z B;  2HVS A;  5CV8 A;  1F9P A;  3TP5 A;  4NXN Q;  1F9Q A;  5M9O A;  4RGT A;  2E5L L;  3K58 A;  2NVQ H;  4B9X A;  3I12 A;  4XT1 B;  3W2D A;  4O0A A;  2EXZ A;  1A9X A;  5BN5 A;  3MFI A;  4PQX A;  1SNQ A;  2CWP A;  2D5D A;  4A3B B;  1CA5 A;  1YNN D;  2GVA A;  3NPP A;  1N33 L;  2PN1 A;  2ZDG A;  5D14 A;  2YS6 A;  3KLS X;  4GLX A;  1V51 A;  3SHL A;  1SJE D;  4RWS C;  1IYV A;  4B3S Q;  2HIX A;  3S1Q H;  4XYM B;  2UUC Q;  3I4O A;  4DR6 Q;  1JB3 A;  4QGU A;  3EYY A;  4OX9 H;  2Z8L A;  4UP7 A;  2CW8 A;  4O2A F;  2DIK A;  1RTN A;  4K14 A;  3T1Y H;  2OH2 A;  2XGT A;  3I2Z A;  1DYQ A;  4GOP A;  5KFV A;  3GTK A;  4RMF A;  4PZ6 A;  4GS3 A;  2X6L A;  2JK8 A;  2Q8T A;  3ND8 A;  4IZO A;  2HQL A;  4B3S L;  1EFI D;  5C3W A;  3J81 W;  1KDC A;  2XC9 A;  3GTM A;  4NXM Q;  4MAM A;  4N8F A;  5C44 H;  3MTS A;  4Q5V A;  5LL6 X;  3F2B A;  3SK8 A;  1PX2 A;  4ZRZ A;  2R82 A;  3MFH A;  2FMM A;  2WKD A;  2XCL A;  2ALZ A;  4K5W A;  3Q8S B;  5C8Y F;  4A3D G;  5KFQ A;  1WCM B;  1S68 A;  1B6S A;  1IW7 D;  1X3E A;  5CB4 F;  4DV4 L;  2L15 A;  1GHK A;  1EYG A;  4A3J B;  1HNW L;  5JVH 3;  2NN6 I;  4DV0 H;  1V1O A;  4POG A;  4Q44 A;  4IZ8 A;  1H9S A;  1SE3 A;  2AQ2 B;  1PZJ D;  2TSS A;  3QIA A;  3MR2 A;  2JEA I;  3Q1K A;  1I94 Q;  2TMP A;  4JV5 Q;  3JAM L;  4U7C A;  1MHW C;  2L0C A;  3I55 A;  1QVF A;  3EJI A;  1QVG A;  1LTR D;  4DV7 H;  5CA0 F;  2OXP A;  3S14 B;  4P2C B;  3UDF A;  3GTL H;  4LFC Q;  2NVT B;  3GTG H;  1WTW A;  4O3P A;  1MZB A;  4YP3 A;  2AUJ D;  3DF7 A;  4X66 Q;  3HOY H;  4MV9 A;  4MZ9 A;  5IYB G;  2AQ3 B;  3I4L A;  1SXT A;  4DUZ Q;  1J5E L;  3KHG A;  1IXR A;  3FHW A;  1A2U A;  1AN8 A;  4R8N A;  4CKB A;  3T1Y Q;  3PN1 A;  2N49 A;  5JPN C;  2UU9 L;  4DR1 L;  1I4G A;  4KY5 A;  2XCA A;  2OQK A;  4JI1 L;  1N9W A;  1WFQ A;  4DUY L;  3J7Z C;  2EOT A;  2EYO A;  2LSS A;  2Z1C A;  4K8J A;  3CD6 A;  3M4P A;  4XTC S;  3E9I A;  4LF6 Q;  1ICW A;  1QIL A;  1TWG B;  1X3P A;  2OTJ A;  4OGQ C;  2RHQ B;  4A3G G;  1EEF D;  4IUR A;  3U9S A;  3AYH B;  4DNR B;  1S5B D;  4MN3 A;  3LNN A;  2CHB D;  2R93 H;  1PHJ A;  1TS5 A;  4AYB E;  3T1H H;  1AN7 A;  1H95 A;  3VMM A;  1XMO H;  4JI0 H;  3Q22 A;  4LMQ D;  3EA6 A;  1HXY D;  4DR5 L;  4RCO A;  4A3B G;  1SNC A;  4ECT A;  2KEE A;  3WDN A;  1CSQ A;  3NHH A;  2W6Z A;  4QMG A;  3N41 B;  4J8Q A;  3NTK A;  3PUW A;  2IHF A;  2BH8 A;  5DG9 A;  4YAK B;  4TKO B;  3HOX B;  5L1K A;  1J8I A;  1IBK H;  4ZI7 F;  4OHJ A;  4PDB A;  4DK0 A;  4ECW A;  5IP7 G;  3PIO 3;  4JV5 H;  2DN8 A;  1KQS A;  4DV2 H;  4EBD A;  1T9H A;  4IO9 A;  3H09 A;  5K5P A;  3TBI B;  4ZCK A;  2YZN A;  1BCP B;  4TQS A;  1YIJ A;  1NTG A;  4DV6 H;  1PTO F;  2C5C A;  2F0P A;  3AMU A;  3OTO Q;  3S16 H;  3K8A A;  1YNX A;  1IZ6 A;  3LML A;  3TP8 A;  1JB7 A;  3GD7 A;  3SR1 A;  2RA4 A;  2NVT H;  3CCJ A;  3OUU A;  4GKJ H;  4A3G H;  3FPP A;  2E75 C;  3RIZ A;  2L5T A;  3PO3 G;  3RB4 A;  3KHR A;  4KD4 A;  3F2C A;  4DR3 Q;  2WB1 E;  1PK8 A;  2UXB Q;  1TWF A;  1A62 A;  1SE4 A;  2KED A;  5C5L A;  3H4B A;  4NKL A;  4J9Q A;  3F8T A;  1VDZ A;  4LF7 L;  4Q0F A;  4Z9C B;  1BQQ T;  4MHE A;  2A6E C;  3E0J A;  1QUQ B;  3K5H A;  4XXE A;  2CWA A;  1HUN A;  5IYB H;  1TS4 A;  3HOZ G;  1G29 1;  2AGQ A;  1TWG H;  2VB3 X;  2SOB A;  2SNM A;  1Q8I A;  1DOL A;  2HVR A;  1EU4 A;  3CVZ A;  1E3P A;  1K0R A;  2E74 C;  2Y0S E;  5LHY 1;  1FKA H;  2NVY B;  1B04 A;  2CKZ B;  4WJ4 A;  5DG7 A;  2CH4 W;  4GN5 A;  2W9B A;  4P72 A;  2WII B;  1N32 Q;  3H40 A;  5JJI A;  1TWH B;  2A6H C;  3D4R A;  3TQT A;  2NU7 B;  4ED0 A;  2VNU D;  1O75 A;  1XNQ H;  2PPB C;  1Z7T A;  1B7Y B;  4JVZ A;  1PH4 A;  3Q8Q B;  1N32 H;  1P8L A;  3STB C;  3TRZ A;  3V4Z A;  2M00 A;  1STN A;  2EYH A;  1JT8 A;  1D1K A;  2W70 A;  1IBL L;  2F0L A;  1W6K A;  1FJG Q;  1DV2 A;  3M9N B;  2YS7 A;  4ED3 A;  3OUZ A;  4DA2 A;  1VQ7 A;  1VQI A;  3VPD A;  1RL2 A;  3I4M G;  1D5Z C;  1ZXT A;  4XT3 B;  4DR4 L;  4OO1 G;  4DR1 H;  2RGR A;  2MCT A;  1V4Y A;  4ECZ A;  1PRT D;  5J3B A;  1JXL A;  1YHQ A;  3PIO A;  1EY0 A;  1V43 A;  4RUC A;  2PW7 A;  2RVL A;  1E22 A;  3FPU B;  3L3O C;  4WJW A;  3BVZ A;  2V4D A;  4HR7 A;  3D6W A;  4CC6 A;  5IYD H;  4YQW A;  4IRK A;  2FE3 A;  4B3T H;  1L1O B;  1SLJ A;  3S1N H;  1EY4 A;  2FHT A;  1KJJ A;  2K33 A;  4LSX A;  4M1U B;  3IN5 A;  1E24 A;  2LKV A;  4ECQ A;  3PO3 H;  5KRU A;  5GAH C;  3PUX A;  2YU9 H;  2D0P A;  1JLL B;  4DN4 M;  5C3E H;  2R92 G;  2Z6K C;  2KHS A;  1CZW A;  4B3R H;  5E4X A;  3H6M A;  1NE3 A;  1BR9 A;  1PFN A;  3A8J E;  2RBM A;  4A3K B;  1AUX A;  1J9O A;  1SN8 A;  4CKE A;  3TSS A;  3G6V A;  5T1G A;  3RUZ A;  4QWA A;  2EYF A;  3T5L A;  2D0O A;  1EQV A;  5IP7 H;  1HNX H;  3HFZ B;  4UPA A;  2K5D A;  1AZQ A;  4DL2 A;  5EAY A;  3BZC A;  4X62 Q;  3J81 j;  5LMN H;  4YWK A;  2N55 A;  4RKB A;  2UXD Q;  1S5E D;  3PUZ A;  2ZJP A;  3WO0 A;  4M7E A;  1O7Y A;  5C1P A;  1B6R A;  1MJC A;  2A74 C;  3T51 B;  2UVW A;  1JDE A;  3PIP 3;  4QJF A;  4X65 L;  5FLX c;  3HOU H;  5C4J B;  5FPR A;  4ILW A;  3CAM A;  2ZM6 L;  5DM7 3;  2AMC B;  5DGA A;  3E9H A;  3DXJ C;  4KN7 C;  1E2V A;  4PMC A;  1B3A A;  1OXU A;  1F2L A;  1EHI A;  4LF6 H;  4CJ0 B;  1EUD B;  2W9B B;  1N48 A;  5LMN Q;  2B2T A;  3BZD B;  2CCZ A;  2CZG A;  1FD7 D;  2K01 A;  3W1G A;  2FPP B;  4C3H B;  1OXS C;  3CP0 A;  4N8X 1;  4HIM A;  1RTO A;  3C2P A;  4X65 Q;  4DV1 L;  4QIW A;  2HD3 A;  2HGS A;  3RR5 A;  4H7B A;  3PO2 H;  3CQZ H;  4ED7 A;  1Z2P X;  2WB1 B;  5D65 A;  2RGV A;  5HBR B;  3PUV A;  4YBZ B;  3UDG A;  1VS0 A;  1K28 A;  4PMB A;  4ABN A;  3C46 A;  3SVM A;  3BJY A;  1GUO A;  1HQM C;  2EVB A;  4IUT A;  3PGZ A;  2PQE A;  1LTT D;  5I4D A;  2K1B A;  1Y1V B;  3S1Q B;  1K8M A;  3DHQ A;  1Q90 A;  4JBK A;  2ZXO A;  3G7L A;  4OEM B;  5LMU H;  4K5V A;  3I3C A;  1EIG A;  1VQO A;  1QG7 A;  2J6T A;  2V9W A;  1X54 A;  2AHO B;  1IBM H;  5J2T F;  3D8G A;  4NXN L;  2PQA A;  1KEE A;  3OHB A;  4DV5 H;  4EBE A;  3T1H Q;  1ZHQ A;  1DJR D;  4A3C H;  2RDG A;  4J9K A;  2Q8R E;  2A68 D;  3FRP B;  3WWV A;  1SFO H;  1B50 A;  5DLF A;  5AJ3 L;  5FLX W;  1BBX C;  2QYZ A;  5E7N A;  2L9H A;  5BN3 A;  4OWW B;  4A3F G;  2BDO A;  4L5T A;  5CV6 A;  5IYD G;  2E2J B;  2AGO A;  4OIK A;  1T5E A;  1PH3 A;  3SE7 A;  5KFT A;  1EZ1 A;  1PFB A;  4DKA C;  5JVD F;  3HOU B;  1M1K C;  3RLN A;  2SEB D;  5EDW A;  1F9S A;  2B2V C;  4GLV B;  4O3N A;  4TSS A;  4R8U A;  2JYO A;  3HEJ A;  1N34 L;  1SBB B;  2R7Z G;  4GN4 B;  1KL9 A;  1QB5 D;  5M5W B;  2UVV A;  2B8F A;  4OL7 A;  4Q45 A;  2FKL A;  1EWI A;  3BVM A;  3AQQ A;  5JJZ A;  3GTJ H;  3G6X A;  5GRO A;  4JYA L;  1D6E C;  3HXL A;  4IWX A;  4IFD H;  4LW1 A;  4RZR A;  1EWC A;  1F2Y A;  3D4D A;  3HOY G;  4C2M A;  3VR4 A;  2XD4 A;  1CA6 A;  4UP8 A;  3K5N A;  2WV6 D;  1I94 H;  5C44 G;  2C28 A;  4ZAI A;  2R86 A;  1KDB A;  1BBW A;  2XVS A;  1AUV A;  1TWA H;  2EY1 A;  1Q1E A;  1H9R A;  2ZXR A;  2JA5 G;  3Q2O A;  2R92 A;  5IOC A;  4B3M H;  2PI2 E;  2DLN A;  3KYH C;  4DV4 Q;  2E2J H;  1VQ4 A;  2A69 C;  1X65 A;  2I5L X;  3S1M B;  2R3Z A;  4GNX B;  5KG4 A;  4DR7 L;  5DQH A;  3PIP A;  3PCO B;  4EBC A;  3GTM B;  3NBH B;  1M90 C;  2AGP A;  2MHV A;  1V8Q A;  3TME A;  1PH5 A;  1RYS A;  4AH6 A;  1Q81 C;  5DNF A;  3OPO A;  4XQN A;  1TWC A;  3K0Y A;  3KLW A;  5C3X A;  3HB9 A;  3R5X A;  4MV8 A;  1XJV A;  4BWG B;  5GAG C;  1E1T A;  4A3E B;  2XWB B;  1YIT A;  1WTH A;  2W9C A;  3K7A B;  1DGS A;  1Y8N B;  4A3D B;  3KK7 A;  3MEH A;  3N44 B;  4G4K A;  1KJQ A;  1EYC A;  4QIW B;  2JA7 A;  1DXM A;  4ZHQ F;  2R7Z A;  3DM1 A;  1VQN A;  1I3Q H;  2WAQ B;  4DR1 Q;  1JMC A;  1K8A C;  4JI1 Q;  4LF8 H;  1PMR A;  1B33 N;  3GV7 B;  1EIF A;  3CW2 C;  5KYL A;  1GOZ A;  4DR2 L;  2IBK A;  4CHT B;  2EJG C;  4XIG S;  4XDX A;  4BS9 A;  1A3T A;  4X3T A;  4EGJ A;  3I70 A;  1RDP D;  1TII D;  1E4E A;  2Y0S G;  1IBK L;  3OSO A;  5M5W H;  1DOK A;  1MSG A;  4C3I G;  4K0K L;  3RAX A;  2GPW A;  4ED2 A;  4FF2 A;  5A2Q L;  3PF4 A;  2AQ4 A;  3KAL A;  1T3N A;  1ROD A;  1V9P A;  2EY6 A;  3S1R B;  4EG0 A;  1L2Z A;  1H9M A;  1Z47 A;  2FFK B;  3EQL C;  5LL6 S;  2UUA Q;  4DXG A;  3NK9 A;  5KFY A;  4Y52 H;  3TZD A;  4UCS A;  4QW8 A;  2XNA C;  4BBS H;  2KHJ A;  2VW9 A;  1C7Y A;  1PTO D;  2ZT9 C;  1O7L A;  1RD9 D;  3M4Q A;  1S40 A;  2DWC A;  4RAZ A;  4TUY F;  1A15 A;  1BVS A;  2RDJ A;  4RB3 C;  3T5J A;  4JI7 H;  4F4Z A;  2DJG C;  4DR4 Q;  1ET6 A;  4A3M G;  4GKK L;  1I6H B;  1WOC A;  4LFC L;  1KDA A;  4AYB A;  4QWB A;  1W93 A;  2CH4 A;  4DAV A;  1PH1 A;  1EY8 A;  4S3S A;  2W9A A;  3CCQ A;  1XNR Q;  1OXT A;  4ED6 A;  1WI5 A;  1CE8 A;  4EX5 A;  3QOJ A;  2C00 A;  1HNX L;  3OHA A;  4FF4 A;  2V1C C;  5LA6 F;  1IBM Q;  2CQO A;  4ODG A;  1AEX A;  3BG5 A;  4U6P A;  3S2D B;  3CXC A;  4DUY Q;  4R7R A;  2C2E A;  3TQ1 A;  3GII A;  1ENF A;  4RHR A;  1N34 H;  4GKK Q;  4R1J A;  1EOT A;  2Z0S A;  2BDN A;  5D3I B;  5CR3 A;  1STE A;  1JOQ A;  3AB9 A;  1ASY A;  3R2T A;  1DM0 B;  2NZO A;  4ME5 A;  3PR4 A;  2FK2 A;  3AU7 A;  2ZM6 H;  3BAA A;  1PZK D;  2WAC A;  5C3E G;  4A3D H;  1R9T A;  2IX0 A;  5KFG A;  1Z9F A;  3WNZ A;  4NDX A;  4GC7 A;  2WDT A;  5H80 A;  4JI2 Q;  3ULP A;  1A0I A;  3RBD A;  3N52 A;  4IUV A;  5E1F A;  1YJ9 A;  4HNU A;  5FO7 B;  1BCP F;  1I6U A;  1B4O A;  4H13 C;  3IG0 A;  4ECX A;  3GIK A;  1UE7 A;  3SK5 A;  1DV1 A;  2O2L D;  1QJO A;  3DUZ A;  3MXU A;  4A4I A;  2YYA A;  2ICI A;  1M0W A;  1WCM G;  1U4P A;  2KEN A;  2DY8 A;  2VS1 A;  4BA1 I;  3GV5 B;  4LSA A;  1O78 A;  4YY3 Q;  5IWA Q;  2E2H H;  4N9P A;  5HGT A;  1N36 L;  4YR3 A;  2K5H A;  2EIF A;  4DR6 H;  4R8U B;  5C4X B;  1BNZ A;  2IY5 B;  4X3K A;  4FDB A;  1S10 A;  1S97 A;  3HOZ B;  3JAM W;  1VQB A;  3NQI A;  4DXF A;  3KTM A;  1Y1W B;  1CKM A;  1A6X A;  2VUM A;  5IT9 c;  3C1F A;  1JJ2 A;  2ASB A;  1SNM A;  4IOA A;  1Z2O X;  1G2S A;  2DPI A;  4A3J G;  2XRQ D;  4LFB L;  2JEJ A;  4DPG A;  2UUC H;  2MQH A;  5KG2 A;  2HHH H;  2KJX A;  4HCE A;  5ELF A;  3RN2 A;  4DV1 Q;  2RQX A;  1GO3 E;  4RU9 A;  2F3W A;  1HFG A;  2MP1 A;  4J6H A;  3P1H A;  1BNC A;  1G2T A;  3S2D H;  2GVB A;  4F88 A;  5JPM C;  2YU9 B;  4DR2 H;  1GM5 A;  5ELD A;  2JEB I;  4DR4 H;  5DGB A;  2DJF C;  3ND9 A;  3ER0 A;  2W7P A;  2E2I H;  4IOC A;  3Q8P B;  4RUA A;  1LLR D;  1EUJ A;  1Y8P B;  2YTX A;  1SMY C;  1CKN A;  4PWQ A;  1BXR A;  3O13 A;  3ORR A;  4RFB A;  1LO5 D;  4ECR A;  1UAP A;  1K0S A;  2E8G A;  3R5H A;  2IPK D;  5ELB A;  1SYF A;  1SYB A;  1ZYR C;  1NSN S;  5EKL A;  5KT6 A;  3RB6 A;  3G8C A;  2VQE H;  2B63 H;  1I5F A;  2GPS A;  1TU2 B;  3OTO L;  2JA5 A;  4I65 A;  3SDZ A;  2A19 A;  5L1I A;  4HCS A;  3D0F A;  4IRC A;  2NVX H;  4LUO A;  4ZLT F;  5AJ3 Q;  2VQF L;  1HRJ A;  2JP1 A;  3MAQ A;  3GV3 A;  1J6Q A;  4BY1 B;  2AUK A;  1JJC B;  4YHH Q;  2EXD A;  3FVQ A;  4X3U A;  2R84 A;  3OW2 A;  3PR5 B;  1STG A;  1XX8 A;  3LWE A;  4MV6 A;  4A2A A;  3PZP A;  1X32 A;  4GNX C;  2EY2 A;  1B1Z A;  5KFU A;  1PH9 A;  1SYE A;  5IT9 W;  2O5I C;  3CRK C;  2AU0 A;  1K9M C;  1P16 A;  5C4X G;  2K5N A;  1LYL A;  2MJ8 A;  3WO1 A;  1N34 Q;  2BQU A;  1NUC A;  5C4X H;  2J0T D;  2K7V A;  4QY7 A;  1B2T A;  5F2D A;  1JDB B;  1CFM A;  2QDL A;  4ULL A;  4MTK A;  1VKZ A;  1FR3 A;  4FNF A;  5KFM A;  4E4T A;  5C0X J;  1PDQ A;  2DZD A;  1U4L A;  4QW9 A;  5KG1 A;  1VQE A;  3CC4 A;  3KUP A;  1MGS A;  2KCM A;  4NB3 A;  2R7D A;  4ID6 A;  1Y1W G;  4BY1 H;  4OX9 L;  3PO2 G;  3BU2 A;  5CGK A;  2KHI A;  5FLM H;  4KTA A;  4A3I H;  2K04 A;  3CC7 A;  3ICE A;  3EBE A;  2QA4 A;  2F0W A;  5CC4 A;  3K80 C;  4LF8 L;  1JWM D;  2FP4 B;  1CHP D;  5JEA G;  3T53 B;  4AYB G;  4X66 H;  2YZG A;  3OSN A;  4O2B F;  2C22 A;  4DUZ H;  3V2T A;  5K36 G;  2Q2T A;  2GN5 A;  1NCV A;  2OWO A;  2R8G A;  4N9T A;  3I90 A;  1TWA B;  1XPR A;  1CI3 M;  2B2W A;  1E1O A;  1VQG A;  2PCF B;  3QR8 A;  3OMC A;  5T1I A;  2JA6 B;  3W1B A;  4R4Q A;  5E3F A;  3K0X A;  2NTS A;  3ERS X;  3R8B A;  5A35 A;  4A76 A;  5LL6 b;  1TS3 A;  1H9S B;  2MUY A;  4LF4 L;  2M2L A;  2PW5 A;  2Z6B A;  4FP5 D;  5C4Z A;  1EUC B;  2YU9 A;  1HNW H;  4HJA A;  2O03 A;  2XCP A;  2IA6 A;  3WOE A;  5LMU L;  4E6I A;  4M9U A;  4K6D A;  4LH7 A;  4Q8E A;  2B2Y C;  2R7N A;  1RJT A;  1E4G T;  2PVP A;  5TSS A;  4JI7 L;  1VCI A;  4DV5 L;  1AE2 A;  1GLV A;  4JI6 L;  4JOI A;  5EPJ A;  2B2T C;  5IYC G;  4POF A;  3T13 A;  3OMG A;  1Y1V G;  1SFO A;  1UNN C;  2L55 A;  4LF4 Q;  3KAK A;  4B3R Q;  5KGU A;  3H0G H;  2XWJ B;  3TP7 A;  1TWC H;  2VB2 X;  2PQA B;  4MIU A;  5EWF A;  1WTQ A;  2DNC A;  3GTK B;  3BQ2 A;  2VPQ A;  2E76 C;  4GC6 A;  5JVG 3;  1KLG D;  4RGO S;  1FGU A;  1SSO A;  1S5F D;  2R85 A;  3S1R H;  4EVO A;  4JI0 Q;  4L1K A;  4DUY H;  5KND A;  4DV3 L;  4HIO A;  5D1P A;  1GYF A;  4K6L A;  4DV4 H;  2YV5 A;  3QJY A;  5I2X A;  2VL6 A;  4UHV A;  4A93 B;  5DLG A;  1GSO A;  3LWU A;  4KHP Q;  3N42 B;  1JWS D;  5E4W C;  4KD3 A;  1WSC A;  4LAA A;  4PZ7 A;  2RDF A;  3URY A;  3K7A H;  5KFS A;  3IFD A;  3TP6 A;  2WFW A;  3M7N A;  4BBR B;  4O42 A;  4NXM H;  2ZM6 Q;  3GTG B;  4JV2 A;  4BY7 G;  1SE8 A;  2VUM B;  3M4O B;  2ZTC A;  4YCW A;  4XX0 B;  4B3S H;  2N88 A;  2VUG A;  3GIQ A;  3QFF A;  1HNX Q;  4JI0 L;  1I94 L;  2YYZ A;  1FYC A;  2RDH A;  5C0X I;  4ZQI A;  1SAP A;  2DY7 A;  3RMH A;  3CQZ A;  2DUD A;  3F8N A;  5K2M A;  3SK4 A;  1S03 G;  1KJI A;  2A8V A;  1K3R A;  4O4I F;  2R7M A;  4YR0 A;  2R8J A;  1UE1 A;  1EU3 A;  1EY7 A;  3MXG A;  1IOV A;  2HDM A;  4RH6 A;  4LH6 A;  1U4R A;  4HQ6 A;  1HQR D;  3W3A A;  1TA8 A;  3E6Z X;  3TEH B;  1NY4 A;  1YHB A;  3TZU A;  4A3K G;  2B2W C;  3OW7 A;  4TV8 F;  2NUA B;  4LNQ A;  4V0B A;  1RYR A;  5GAE C;  1Y69 U;  3A5U A;  2ATW A;  1M7J A;  2CQA A;  1XXG A;  3GQB A;  2K5Q A;  1ENA A;  3GV8 B;  1CKO A;  2BE5 C;  1LTI D;  3HOX G;  1Q46 A;  3RZD H;  2X69 A;  1UWV A;  5G3L F;  3CME A;  4JI5 H;  3H0G B;  1BUV T;  2B29 A;  4DL3 A;  1CHQ D;  1ULZ A;  4LFB H;  4HJ7 A;  1XMO L;  1B70 B;  4J9R A;  3U9O A;  2OEO A;  4KHZ A;  5NUC A;  1SNO A;  4IWY A;  5EQ0 A;  1NR4 A;  2JA7 G;  5CA1 F;  4DV7 Q;  3M3Y H;  1L0Y B;  4L8J A;  3FMA A;  4RGN A;  3GTQ H;  1KTK A;  5FLX L;  1KIX A;  1PFS A;  1D7Q A;  1JQY D;  3CCU A;  3HKZ B;  2IWH A;  5EBC A;  3MC0 B;  4EEY A;  2WAQ G;  1XMQ H;  3L9A X;  2R6G A;  3J80 E;  3VR2 A;  2VOB A;  4WOR A;  1VQC A;  4JI4 Q;  4F7X A;  4CGY B;  3CPW A;  5CMD A;  3NWT A;  1XMO Q;  1PRT B;  2V4R A;  1TWH H;  2K32 A;  4A93 H;  4I4T F;  1PLF A;  5IYZ F;  2NVY A;  3G6J B;  3KAJ A;  1E4F T;  1STH A;  4BY7 B;  1G51 A;  4HNV A;  4DNI A;  4Q8F A;  2J6S A;  3OIQ A;  4GKJ L;  1U5K A;  1HZA A;  1RK6 A;  2FJZ A;  1WR2 A;  2VQF H;  2AWO A;  3Q24 A;  4JYA Q;  3MFY A;  1QNU A;  1EZ6 A;  3DEP A;  2Q2U A;  1NMG A;  1WTR A;  3N6R A;  1KLU D;  1BXT A;  1II3 A;  3BDO A;  2B2U C;  4JV5 L;  1XNQ Q;  4J9P A;  3NEN A;  1BDO A;  4DV2 L;  3M9O B;  3S1M H;  1JR0 D;  4OIJ A;  1HNZ Q;  3NGD A;  1PRT C;  4EQO A;  3I4N B;  3E5S A;  4IFD G;  2M9V A;  2IHE A;  3RJ0 A;  3RGZ A;  4CDE C;  4A3F B;  3QOL A;  1IYU A;  4PG3 A;  1A2T A;  1QOH A;  2UVU A;  4CJ1 B;  1RIP A;  5IGC A;  2WB1 G;  4RNO A;  3J7A K;  4ECY A;  2QIL A;  3FDS A;  4A3E H;  3EPG A;  5KT4 A;  4LK1 C;  2Z9H A;  5DLQ E;  4JI2 L;  1HNZ L;  5KG0 A;  1FNV A;  2MFI A;  2R7Z B;  2E2I A;  3Q8D A;  5C3E B;  1CQV A;  1KNA A;  2IMW P;  2VXW A;  1E0B A;  3M3Y B;  2K5V A;  3EFX D;  5EBD A;  3TIG A;  4YJ3 F;  1SYC A;  3RV4 A;  2VY3 A;  5LXT F;  1HR0 H;  2KUM A;  2J6U A;  3V6J A;  1TT2 A;  4IUQ A;  4JW0 A;  1TY0 A;  3J7A V;  1EYA A;  2CQY A;  2BE5 D;  4XQJ A;  5KKN B;  4LUV A;  2HHH L;  1Y1V A;  4C1N I;  4YIJ A;  5IE8 A;  5LYJ F;  1I50 A;  4LMY A;  1XNR L;  4G7O C;  2MGS A;  1HFN A;  3UQ8 A;  4DAY A;  1JX4 A;  1W6J A;  1GUN A;  1TKW B;  5DQI A;  1PTO B;  3MJF A;  3J7A 5;  3H3V C;  3MWE A;  1YHA A;  4FXG C;  2X0S A;  3ORQ A;  3QZ8 A;  4K0K Q;  1AH9 A;  1YNJ C;  3H15 A;  3GTP A;  3ZYY X;  4L5Q A;  5FK9 C;  1Q3L A;  3TQY A;  5KFZ A;  4BY7 H;  1M4V A;  2NBF A;  2Y0S A;  4QUF A;  1C0A A;  2CVR A;  3N6X A;  2G5D A;  3JSN A;  1B9M A;  3VR6 A;  3SEB A;  4JPB W;  4JI5 L;  4C2M B;  2AKW B;  3T5H A;  2NTT A;  2F0N A;  2XIW A;  4JI6 H;  3UDX A;  1Z2N X;  2ID0 A;  1CSP A;  1GUW A;  3M9M B;  4LF6 L;  3TII A;  3IKJ A;  4DR3 L;  4P74 A;  3PUY A;  3CQZ B;  4MNO A;  2YTV A;  4J1M A;  1YZ6 A;  4HTH A;  1VF5 C;  1M6V A;  2YRW A;  3RZO H;  4JI5 Q;  2JSO A;  1Y8O B;  3LGJ A;  4AIM A;  4QCL A;  4U68 A;  3Q23 A;  1EYZ A;  5ISR A;  1ZKO A;  4FYD A;  4IN3 A;  4JG2 A;  1O80 A;  5EGT A;  3ULL A;  4YR2 A;  4FBT A;  4A3M H;  1V1Q A;  2OCE A;  2D2C C;  5C4J H;  4X64 L;  3OOC A;  5C5M A;  5KNC A;  3GP7 A;  1GUT A;  2I0Q A;  2F0V A;  4L5R C;  2D62 A;  3HGB A;  1GKH A;  5EZY F;  1B3Q A;  3MFG A;  4B3R L;  1S0M A;  4O3S A;  1XYI A;  4RCN A;  4UY8 C;  2L11 A;  2QW7 A;  3J81 E;  2UXC L;  2FK1 A;  1JOK A;  3DLL A;  4O4H F;  2XGQ A;  3H4D A;  4NXN H;  1EIY B;  2F4V L;  3CC2 A;  1A63 A;  2R92 H;  5JH7 F;  2OT2 A;  2EJF C;  1PTO H;  4K2L A;  4EQN A;  1QE6 A;  3IFT A;  1ML0 D;  1FNU A;  2IJ0 A;  3K57 A;  3L0O A;  4TVA B;  1KJ8 A;  2B2V A;  4RNM A;  3HOX H;  2GA4 B;  2KCC A;  2NU8 B;  3PF5 A;  2UUB Q;  1C9O A;  4YY3 L;  3V6K A;  4OX9 Q;  4OO1 H; 
#chains in the Genus database with same CATH homology
 4P71 A;  2JA8 G;  1Y1W H;  2NN6 I;  1O7I A;  1UE7 A;  4POG A;  3BJU A;  2K50 A;  1YJW A;  4P73 A;  2JEA I;  1I94 Q;  3DM3 A;  4A4I A;  3KF8 B;  1WCM G;  4JV5 Q;  3M4O H;  3PV0 A;  2KEN A;  1QVF A;  3I55 A;  1VQ5 A;  2BH2 A;  1QVG A;  2VS1 A;  4BA1 I;  1GD7 A;  5C0X G;  3UDF A;  4HJ9 A;  4YY3 Q;  5IWA Q;  4LFC Q;  3GTL H;  1AE3 A;  2QGQ A;  1L1O A;  2E2H H;  3OYY A;  3GTG H;  4OWT B;  2N3S A;  1R9T H;  3HOU G;  1N36 L;  2K5H A;  2EIF A;  1WYD A;  3JAM c;  3KJO A;  4X66 Q;  3HOY H;  2IY5 B;  4MZ9 A;  4IPC A;  1U0L A;  2I5M X;  5IYB G;  4DR2 Q;  4FDB A;  4DUZ Q;  4A75 A;  1J5E L;  1IXR A;  3FHW A;  5M5X H;  1VQB A;  3KFU A;  4LUZ A;  2KBN A;  4DV3 Q;  3T1Y Q;  4B3M L;  2N49 A;  4DK3 C;  1CKM A;  2UU9 L;  4DR1 L;  5IT9 c;  4KLK A;  1JJ2 A;  2OQK A;  2B3G A;  4JI1 L;  1N9W A;  2JA5 H;  2ASB A;  1WFQ A;  2NZH A;  1Q82 C;  4IOA A;  4DUY L;  2HIV A;  3J7Z C;  4A3J G;  4LFB L;  1I6H H;  4DPG A;  2MQH A;  2LSS A;  1YEZ A;  3CD6 A;  1IBL Q;  3RN2 A;  3M4P A;  4DV1 Q;  2Q2I A;  1GO3 E;  4XTC S;  3TS2 A;  3E9I A;  5GQO A;  4LF6 Q;  3S2D H;  4JI7 Q;  2GVB A;  4DR7 Q;  2BA1 A;  1GM5 A;  2OTJ A;  2RHQ B;  3HKZ G;  2JEB I;  3S15 H;  4A3G G;  3ER0 A;  1JJG A;  3AYH B;  2E2I H;  3S24 A;  1VQ9 A;  2JA7 H;  3W5O A;  4IOC A;  1KD1 C;  4KI0 A;  1VQP A;  2R93 H;  1PHJ A;  1EUJ A;  2YTX A;  1CKN A;  4AYB E;  3G4S A;  4DV5 Q;  4BBS G;  1H95 A;  1LTL A;  4YHH L;  4DR5 L;  1LUZ A;  2E8G A;  4JI6 Q;  4A3B G;  1PH6 A;  1CSQ A;  2PI2 A;  1HR0 W;  3K81 C;  3U4Z A;  4GOP C;  4LFA L;  3PUW A;  2B63 H;  2VUM H;  2IHF A;  1I5F A;  2BH8 A;  5M5Y H;  3OTO L;  3AFP A;  1G6P A;  1TWF H;  1VQF A;  2A19 A;  4BY1 G;  3D0F A;  5IP7 G;  1SR3 A;  3MEF A;  4A3E G;  2NVX H;  3CF5 A;  2IX1 A;  1VQM A;  4LUO A;  5AJ3 Q;  1EOV A;  1KQS A;  2VQF L;  1J6Q A;  2I5H A;  4DV6 Q;  1T9H A;  1JJC B;  4YHH Q;  4IO9 A;  2UUC L;  2EXD A;  1HR0 L;  4EQ5 A;  3OW2 A;  1YIJ A;  1NTG A;  1L0W A;  3K7U C;  5BR8 Q;  3ULJ A;  4GNX C;  3OTO Q;  1IBK Q;  3S16 H;  3K8A A;  1YNX A;  1IZ6 A;  5FJ8 G;  1PH9 A;  1JB7 A;  3GD7 A;  4X66 L;  2MNA A;  4R4T A;  2NVT H;  3CCJ A;  5LMU Q;  4DUZ L;  1P16 A;  1XPO A;  1K9M C;  4A3G H;  4NXM L;  3PO3 G;  5C4X G;  2K5N A;  1LYL A;  1N34 Q;  1XNQ L;  5M3M G;  1XPU A;  5C4X H;  1NBW A;  4QY7 A;  3F2C A;  4DR3 Q;  4B3T Q;  2WB1 E;  4GLA C;  1B8A A;  2UXB Q;  2BA0 A;  3L7Z C;  4X62 L;  4LWC A;  1A62 A;  2LXK A;  2E5L Q;  2VQE L;  4R4C A;  2UXD L;  3F8T A;  1YVC A;  4LF7 L;  5C0X J;  2RCN A;  2VUM G;  1QUQ B;  1FVI A;  3HOZ H;  1X9N A;  2CWA A;  3FP9 A;  3NEL A;  5IYB H;  1VQE A;  3CC4 A;  4RG1 A;  1Q12 A;  3HOZ G;  4GNX A;  3I4N G;  2YTY A;  1G29 1;  2KCM A;  2R7D A;  4NB3 A;  1Y1W G;  1TWG H;  4BY1 H;  4OX9 L;  3PO2 G;  4A93 G;  3BU2 A;  2KHI A;  2ALY B;  5FLM H;  4A3I H;  2UXB L;  5M3F H;  3CC7 A;  3ICE A;  3EBE A;  2MO0 A;  4JOI C;  1K8G A;  1KC8 C;  3D31 A;  1MJE A;  1VQJ A;  2QA4 A;  1XTD A;  4LF5 Q;  1E3P A;  1K0R A;  2PMZ E;  2Y0S E;  3K80 C;  3JAM i;  4A3F H;  1FL0 A;  4LF8 L;  1KRS A;  2CKZ B;  3HOV H;  5JEA G;  4WJ4 A;  4AYB G;  4KHP L;  4GN5 A;  4P72 A;  3HOV G;  1N32 Q;  5JJL A;  4YCV A;  5K36 G;  2Q2T A;  5JJI A;  2GN5 A;  1W2B A;  2VNU D;  2OWO A;  4A3L G;  1W3S A;  1B7Y B;  2CFM A;  4Y7N H;  3HKZ E;  1XPR A;  1PH4 A;  4JI3 L;  3KF6 B;  4A3L H;  1E1O A;  1P8L A;  1OXX K;  1VQG A;  3STB C;  3TRZ A;  3W1B A;  4R4Q A;  3GTO H;  2K52 A;  1JT8 A;  2WP8 J;  3K0X A;  4DV0 L;  3ERS X;  3RLO A;  4A76 A;  1IBL L;  3NEM A;  4YWL A;  4A3B H;  1HH2 P;  1FJG Q;  4JI8 L;  4LF4 L;  5GAD C;  2C35 B;  4A3J H;  1VQ7 A;  1VQI A;  4HJA A;  2AWN A;  3KJP A;  1RL2 A;  2K14 A;  3I56 A;  5LMU L;  1N33 Q;  3I4M G;  4DR4 L;  4OO1 G;  1UE5 A;  5J3B A;  1YHQ A;  4JI7 L;  3PIO A;  1VCI A;  3M85 A;  4DV5 L;  1PV4 A;  2FXQ A;  1AE2 A;  4DV0 Q;  1SMX A;  4DR5 Q;  1V43 A;  4JC0 A;  3J81 i;  4JI6 L;  2HT1 A;  3I7F A;  1FJG L;  2F52 A;  1E22 A;  4JOI A;  3SGI A;  3KDF A;  4JI8 Q;  4C3H H;  4POF A;  5IYC G;  1Y1V G;  2K4K A;  4LF7 Q;  4LF4 Q;  4B3R Q;  5IYD H;  3H0G H;  1Y1V H;  1TWC H;  4C2M H;  2UXC Q;  1L1O B;  1SLJ A;  4C3I H;  3S1N H;  2PQA B;  1UE6 A;  1E24 A;  4OON A;  5GAH C;  3PO3 H;  2JA6 H;  1N36 Q;  3PUX A;  3CCE A;  4X6A H;  2RF4 A;  1Q86 C;  1HJP A;  1FGU A;  4OO1 I;  2YU9 H;  2Z6K A;  2D0P A;  2ZJR A;  3U4V A;  5C3E H;  3S1R H;  1J5E Q;  4JI0 Q;  1YI2 A;  2Z6K C;  2R92 G;  4DV3 L;  4HIO A;  4LF5 L;  1EFW A;  3T1Y L;  3EIV A;  4JCV E;  4ALP A;  1VQH A;  1NE3 A;  2YV5 A;  2VL6 A;  1SRO A;  2B63 G;  4KHP Q;  2R7F A;  2NN6 G;  1KXL A;  3EN2 A;  1HR0 Q;  1SN8 A;  4PZ7 A;  2JA9 A;  2WAQ E;  2XTI A;  3K7A H;  3TS0 A;  2D0O A;  2WFW A;  5IP7 H;  3I4M H;  3M7N A;  1BBU A;  1VQD A;  2A1A A;  3HFZ B;  2ZM6 Q;  4UPA A;  4QQB X;  4BY7 G;  1HNW Q;  1SE8 A;  2ZTC A;  4YCW A;  5EAY A;  3J81 c;  5FLM G;  4A3I G;  3BZC A;  4X62 Q;  3J81 j;  1S72 A;  1HNX Q;  4YWK A;  4C3J H;  1YJN A;  2YYZ A;  1I94 L;  4JI0 L;  2Q2H A;  2UXD Q;  5C0X I;  3PUZ A;  4HJ8 A;  1D8L A;  4LF9 Q;  2ZJP A;  2DUD A;  4B3T L;  1Q7Y C;  2A8V A;  1Q1B A;  2K75 A;  1K3R A;  1KAW A;  1MJC A;  2JE6 I;  5JEA J;  1UE1 A;  4QJF A;  4X65 L;  1HZC A;  5FLX c;  4HIK A;  3HOU H;  2JJQ A;  2ZM6 L;  3CAM A;  3J80 c;  4DK6 C;  1CKN B;  1XMQ L;  4QL5 A;  3UE0 A;  4WJ3 M;  2AMC B;  3VDY A;  1VQ8 A;  3E9H A;  4A3C G;  5HY6 A;  4HID A;  1OXU A;  3TEH B;  1NY4 A;  1E7Z A;  1YHB A;  4A3K G;  4BA2 I;  5LMN Q;  1SRU A;  4LNQ A;  3A74 A;  3M9B A;  4A3K H;  5GAE C;  1L2F A;  3A5U A;  3MXN B;  1QZH A;  2ES2 A;  2N78 A;  2CCZ A;  4LF9 L;  4DV7 L;  2ATW A;  4IFD I;  1PVO A;  3W1G A;  1OXS C;  3CP0 A;  1CKO A;  4HIM A;  4R4I A;  3HOX G;  1K83 H;  1Q46 A;  4X65 Q;  3RZD H;  4DV1 L;  1UWV A;  3ZJY C;  3A0J A;  3CME A;  3RR5 A;  3PO2 H;  2B29 A;  3CQZ H;  4X64 Q;  3PUV A;  4HJ7 A;  3UDG A;  1XMO L;  1B70 B;  1VS0 A;  1VQL A;  1N32 L;  4JI4 L;  3JC6 6;  4KHZ A;  3L2P A;  4DAY B;  2R7Z H;  3PGZ A;  1PYB A;  2JA7 G;  4JI3 Q;  4DV7 Q;  4IJH A;  3M3Y H;  4JBM A;  4TQU S;  2R93 G;  1N8R C;  4IJL A;  3GTQ H;  4YCU A;  4PMW A;  1KIX A;  4JBK A;  1PFS A;  1D7Q A;  3GTM H;  5IP9 H;  3U58 A;  3CCU A;  2WAQ G;  1ASZ A;  3KF6 A;  4GKJ Q;  2R6G A;  5ELN A;  1VQO A;  5IP9 G;  1Y14 B;  1X54 A;  1WJJ A;  2AHO B;  4NXN L;  1VQC A;  2PQA A;  1HZB A;  2DGY A;  3CCM A;  3CPW A;  2ZTD A;  1XMO Q;  4JI4 Q;  4H02 A;  3T1H Q;  3S14 H;  4A3C H;  1TWH H;  3WWV A;  3G71 A;  4IPH A;  3E0E A;  1SFO H;  4A93 H;  1UEB A;  3G48 A;  2UUA L;  2UU9 Q;  1VQK A;  1IYJ B;  5AJ3 L;  4OXP A;  3KDF B;  3UDI A;  1G51 A;  4DNI A;  4DV2 Q;  5E7N A;  3CCS A;  1TXY A;  4LFB Q;  4DAM A;  4OWW B;  4A3F G;  4L5T A;  1U5K A;  2RHS B;  1HZA A;  4GKJ L;  2UUB L;  3TRE A;  2AWO A;  3RNU A;  4JYA Q;  5IYD G;  2Q2U A;  1NMG A;  1PH3 A;  3T1H L;  1A8V A;  3H3V I;  1X55 A;  4DKA C;  1OTC A;  5FJ8 H;  1M1K C;  3S17 H;  3RLN A;  1QUQ A;  1X3F A;  4GLV B;  2H5X A;  4JV5 L;  1N34 L;  1XNQ Q;  2R7Z G;  4GN4 B;  3NEN A;  1KL9 A;  3HOW H;  4DV2 L;  5M3M H;  1HNZ Q;  3S1M H;  3HOW G;  1EWI A;  4GOP B;  3PSI A;  1HNW L;  3AQQ A;  3BZK A;  1Q8K A;  2KCT A;  3GTJ H;  3GDE A;  5GRO A;  1K73 C;  2F4V Q;  4IFD G;  4JYA L;  2IHE A;  1IBM L;  4LW1 A;  4GN3 B;  1I50 H;  1NJI C;  4PG3 A;  1VQ6 A;  3CCV A;  3HOY G;  4QIW E;  1RIP A;  2WB1 G;  4UP8 A;  3GTK H;  5C44 G;  4DV6 L;  2QEX A;  4A3E H;  2VQF Q;  1BBW A;  1TWA H;  3STB D;  5DLQ E;  2ZTE A;  1Q1E A;  2PNH A;  2N8N A;  2HHH Q;  2JA5 G;  1HNZ L;  4JI2 L;  3GTP H;  2PI2 E;  3KYH C;  2MFI A;  1LM0 A;  4DV4 Q;  1MIU A;  3Q8D A;  2E2J H;  4L5S A;  1VQ4 A;  4LF8 Q;  1QVC A;  2LXJ A;  1X65 A;  2I5L X;  2K5V A;  3AEV A;  4GNX B;  2VY3 A;  4DR7 L;  5JJK A;  3PIP A;  3PCO B;  1X3G A;  5H1S E;  3NBH B;  1M90 C;  4P75 A;  3U50 C;  1EQQ A;  1PH5 A;  4AH6 A;  4HJ5 A;  1XMQ Q;  1QZG A;  4LUV A;  1Q81 C;  1VQA A;  2HHH L;  4UP9 A;  3S2H H;  3CMA A;  5IE8 A;  4YWM A;  3KLW A;  1XNR L;  1X6O A;  2OTL A;  2VQE Q;  4IPD A;  1CUK A;  1XJV A;  5GAG C;  1E1T A;  1MKH A;  3G6E A;  5LMN L;  1YIT A;  3J7A 5;  3FKI G;  4LFA Q;  4AQY L;  1DGS A;  1YHA A;  1JE5 A;  1PH2 A;  3FKI H;  4K0K Q;  1AH9 A;  3F1Z A;  1KRT A;  3KOJ A;  2ZJQ A;  3H15 A;  3H3V H;  4L5Q A;  3TQY A;  1VQN A;  4BXX H;  1I3Q H;  3GO5 A;  4B3M Q;  2JA8 H;  2IT1 A;  2JQO A;  5M3F G;  4DR1 Q;  1JMC A;  1K8A C;  4JBJ A;  4JI1 Q;  4BY7 H;  4BXX G;  4J15 A;  5ELO A;  1C0A A;  1EIF A;  2OQ0 A;  3CW2 C;  2EQS A;  3AFQ A;  3IRB A;  3CCL A;  4DR2 L;  5IYC H;  4GKK Q;  5LMN W;  4XIG S;  4JI5 L;  1WCM H;  2AKW B;  2MO1 A;  4IPG A;  4OWX B;  4MTN A;  2Y0S G;  1IBK L;  5M5W H;  4K0K L;  4AQY Q;  4ME3 A;  2F3I A;  3UE1 A;  3UDX A;  1EQR A;  3PF4 A;  2ID0 A;  1CSP A;  3H0G G;  1L1O C;  1V9P A;  2NVY H;  4PZ8 A;  1Z47 A;  2UUA Q;  5IWA L;  3CPF A;  4LF6 L;  1X56 A;  3A5Z B;  3RN5 A;  4Y52 H;  4DR3 L;  4P74 A;  4OX9 Q;  3PUY A;  4NXN Q;  4MNO A;  2YTV A;  4BBS H;  2KHJ A;  1YZ6 A;  2VW9 A;  1C7Y A;  2E5L L;  2NVQ H;  1PA6 A;  4JI5 Q;  3RZO H;  4IFD J;  4BBR G;  3M4Q A;  4APV A;  1S40 A;  3LGJ A;  4O0A A;  4AIM A;  1OXV A;  5IY0 A;  1BVS A;  4BBR H;  4O2D A;  1GVP A;  2CWP A;  2GVA A;  4JG2 A;  3HKS A;  1N33 L;  4DR4 Q;  4A3M G;  4GKK L;  1WOC A;  4LFC L;  3ULL A;  4GLX A;  1NMF A;  4A3M H;  1V1Q A;  2OCE A;  1PH1 A;  5C4J H;  4B3S Q;  2HIX A;  3B6Y A;  4X64 L;  1KHI A;  3S1Q H;  2UUC Q;  2I0Q A;  3I4O A;  3CCQ A;  1XNR Q;  1OXT A;  4DR6 Q;  1WI5 A;  4QGU A;  4EX5 A;  4UP7 A;  4L5R C;  1HNX L;  2D62 A;  5BR8 L;  3RLF A;  1PH8 A;  1GKH A;  2V1C C;  4B3R L;  1IBM Q;  2CQO A;  1BKB A;  2XGT A;  3I2Z A;  3CXC A;  4R4O A;  4DUY Q;  4UY8 C;  1YBY A;  2UXC L;  4GOP A;  3DLL A;  2JA6 G;  3CCR A;  4RMF A;  1EIY B;  4NPS A;  4R1J A;  2Z0S A;  4PZ6 A;  2F4V L;  4JBW A;  3CC2 A;  2VZA A;  4GS3 A;  1PYS B;  2JK8 A;  1ASY A;  1HZ9 A;  1A63 A;  2HQL A;  4B3S L;  2R92 H;  2NZO A;  4DR6 L;  3F2D A;  4NXM Q;  5C44 H;  5C3E G;  3F2B A;  4A3D H;  2IX0 A;  5HGQ A;  3J80 i;  1Z9F A;  3L0O A;  4TVA B;  4A3D G;  1PH7 A;  1IL2 A;  4JI2 Q;  3HOX H;  1A0I A;  3ULP A;  1X3E A;  3PF5 A;  4DV4 L;  2L15 A;  2UUB Q;  1C9O A;  4YY3 L;  1YJ9 A;  1EYG A;  1S3O A;  3I4N H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...