4BBSG

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbsG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bbsG01
4GNXC 3UDXA 3PO2H 3HOVG 3CXCA 1N34Q 1Q82C 2R7ZH 1NTGA 4DR6L 2R93H 3H0GG 1Q7YC 2IY5B 4DKAC 2C35B 2KHJA 1JE5A 1WCMG 4FDBA 1E3PA 4DK3C 1LM0A 3S14H 2UUAL 4NXNL 3J80c 2OWOA 2K5NA 2GVBA 4GKKL 1VQFA 2UXBL 4IFDG 1EQQA 4DR4Q 3CMEA 1N33L 1RIPA 5M3MG 4PZ8A 1YI2A 2NN6I 1XMOL 1Q46A 2KBNA 4ME3A 2EIFA 4YCUA 4AYBE 1WOCA 5BR8L 2ATWA 3PUVA 2B3GA 1A8VA 3GDEA 3ULLA 1YZ6A 3S24A 2JEBI 3NBHB 4LF9L 1G291 4B3TL 1QVGA 1VQ6A 2Y0SE 4A3GH 1PYBA 1ASZA 1FJGQ 5FJ8H 5IYCH 1YVCA 5M5WH 2HIVA 4LF7L 3CCVA 4BBSG 2ZJRA 1SMXA 1XPOA 2K52A 5C0XG 1VQDA 1WYDA 4EQ5A 2K5VA 4JI2Q 3HOWG 4KHPL 4POFA 4HJ5A 2Z6KA 1OTCA 2OQKA 4A3IG 2K14A 3ULJA 3MEFA 1OXUA 2E2IH 5GQOA 2NZOA 3BZCA 5M5XH 3STBC 2MO0A 1ASYA 4OWWB 1Y14B 4DR7Q 4A3MG 1A63A 3U58A 1JB7A 5IWAL 3JAMc 4GKJQ 1IBML 4DV3L 4DUYQ 3U4VA 2R7FA 5H1SE 2UXDL 3NELA 4R4TA 2A8VA 3KF8B 3PO3H 3W5OA 4DR5Q 2BA0A 1VQ4A 3CD6A 3I56A 3HKZG 2Q2UA 2YYZA 3S2HH 2JE6I 1LYLA 5IP9G 5GADC 1IBKL 4A3LG 4JV5L 2B63G 3HOYH 4PG3A 2Z6KC 5IP7G 3I55A 1K83H 2MO1A 2CQOA 3UDGA 4JI3Q 1H95A 1X56A 2B29A 4IPGA 1EYGA 3H3VH 2WAQG 3A5UA 4DV4Q 1XJVA 4Y7NH 1Y1WH 1XNRQ 1PVOA 1IBLL 4POGA 1XNQQ 1EOVA 4KLKA 1SE8A 4A3CG 1K3RA 3I4MH 3OTOQ 2ZM6Q 1VQMA 4NXML 4B3SQ 1CKNA 4A3KG 2Q2IA 3J7ZC 5FLMH 2OTLA 3Q8DA 1JJCB 3F1ZA 1VQPA 3GTGH 3CCMA 1I50H 1CKNB 5C3EG 4JI4Q 4AIMA 1KXLA 1FL0A 5GAEC 3FHWA 4DR1Q 5C44H 5ELOA 4PZ7A 4C3HH 4C2MH 3CMAA 1TWFH 4L5SA 1L1OA 1SLJA 1G51A 3RLFA 2VQFL 2YU9H 1HNXL 2BA1A 2HQLA 1VQEA 2XTIA 4A3DG 1U5KA 1X9NA 4KHZA 3UDFA 2JJQA 4GN3B 3PCOB 1L1OB 4X65Q 4PZ6A 4DV2Q 3AEVA 2D62A 2UXCL 1EIFA 3ZJYC 1NMGA 1VQGA 1HR0W 3EBEA 4JI6Q 4LF4L 2V1CC 1BBUA 5IYBH 4AYBG 3PF4A 3F8TA 4A3EG 2JA5G 1PYSB 1PHJA 3G6EA 2UUCQ 1BVSA 4BY7H 2Y0SG 3M7NA 4R1JA 2VY3A 4BA2I 4K0KL 4DR2L 1YNXA 1J5EL 3F2CA 4A93G 3IRBA 4TQUS 4RMFA 3UDIA 1HZCA 1YEZA 1PH6A 1BKBA 3M9BA 2FXQA 2LSSA 4A3FG 1L1OC 2GN5A 2NVYH 3RZDH 4JG2A 4HIKA 4HJ9A 1VQOA 1QZHA 4LF6Q 3TRZA 1HH2P 4DR3L 3RNUA 2PI2A 1AE3A 2MFIA 2UUAQ 4DUZL 3HKZE 1G6PA 2ALYB 2WP8J 4KI0A 4DNIA 4A3JH 4GKKQ 2UXBQ 3I7FA 1Q86C 1Y1VG 2F4VL 3CP0A 2BH2A 1V9PA 1WJJA 1V43A 1N33Q 4DV5L 1S72A 1VS0A 1XMOQ 5EAYA 5BR8Q 5M3FH 2NVQH 3PO2G 2I0QA 3KOJA 3L0OA 3S16H 4LF5L 3OW2A 2JA9A 5LMNW 4QIWE 2VUMH 4JC0A 3I4OA 3M4QA 4L5TA 3A0JA 3UE1A 2R7ZG 2R93G 2ZJQA 5JJIA 3S1RH 4LF7Q 4X62L 4HIOA 2AKWB 3CC2A 3J80i 4UP8A 4JBJA 4LFCL 1Q12A 1MKHA 1S3OA 5C4XH 4YY3L 1PH2A 5IT9c 1N32L 4KHPQ 4NPSA 1Q8KA 4JYAL 1FGUA 2L15A 2UUBQ 1PH3A 2WB1E 2AWNA 4GLVB 3T1HQ 3G4SA 1PA6A 1NJIC 1HR0L 1TWGH 4OONA 3ICEA 4IFDJ 3CCJA 2HHHL 1VQCA 2VL6A 4BBRH 3KDFB 3CCLA 4A3GG 1A62A 1J6QA 2XGTA 3HFZB 3PUZA 4LFAL 1QVFA 5IWAQ 4GN4B 2Q2HA 2CFMA 5IYCG 5FJ8G 1TWHH 4C3JH 5M5YH 4AQYL 4BY1H 2YTVA 2ZTDA 1EWIA 2UXDQ 1K8AC 1B8AA 3E0EA 3EN2A 4GN5A 3CAMA 1PH4A 2JA6H 3M4PA 1VQLA 1NE3A 1NMFA 5C0XJ 1HNWL 3PUXA 1Z9FA 1IBKQ 1KIXA 4JV5Q 5K36G 2HT1A 3PF5A 4JOIA 3CCQA 5JEAG 2K75A 1N36Q 5ELNA 4B3RL 1JJ2A 1UEBA 1MJEA 3GTPH 4QY7A 4A3BH 4DV6L 1P8LA 2E2JH 4YWKA 2YV5A 1C9OA 1LTLA 2A1AA 1N9WA 1TXYA 3J7A5 4QGUA 4NXMQ 3PIOA 3S2DH 1BBWA 4X64L 3G48A 1OXVA 5LMNL 3PO3G 4A76A 4DV0L 1MIUA 2D0PA 3KJPA 4R4CA 1UWVA 2I5LX 4RG1A 1C7YA 2Q2TA 3HOYG 3HOZG 2VQEL 5DLQE 2N49A 4HJ7A 4IFDI 1D8LA 1KRSA 3LGJA 2JA7H 3H15A 4JOIC 1Y1WG 1HNXQ 3M85A 4OX9L 4B3ML 3GTOH 4L5QA 3I4MG 1S40A 1TWCH 2E8GA 3KF6A 2EQSA 1E24A 2ID0A 4P75A 2QA4A 1OXSC 1XPUA 5FLMG 2UXCQ 4WJ3M 1VQ8A 4DPGA 2CCZA 4P73A 4DAMA 4GLXA 1X55A 3FP9A 2JQOA 3AFQA 2CKZB 2YTYA 2PQAA 3KF6B 3STBD 1GM5A 3K8AA 2IT1A 1HZBA 4DR4L 4X66L 2VW9A 5C0XI 1VQAA 5C44G 3GTLH 4K0KQ 1UE6A 2PQAB 1KRTA 4DR2Q 4IO9A 1VQ9A 1J5EQ 3RN5A 3S15H 3CPFA 2F3IA 1QZGA 1KQSA 5JJKA 1KD1C 3K81C 4DV7L 4IJLA 1PH9A 4MZ9A 4HJ8A 2N3SA 2NVXH 1CSQA 5IE8A 1T9HA 4YCVA 1IXRA 1SN8A 4UP7A 3HKSA 2WB1G 4YHHL 1OXTA 3TS0A 2QGQA 4JI2L 2RHQB 5IYBG 3I4NH 2F4VQ 1UE1A 2KENA 2VZAA 4DV1L 5JJLA 3RLNA 2HIXA 5LMUQ 4OO1G 4R4IA 2LXKA 1KL9A 4JI0L 4BY7G 3J81j 4MNOA 4DV5Q 3H3VI 1SRUA 1AH9A 1X3GA 1VCIA 2R7DA 2K5HA 4LF5Q 4JI5L 1VQKA 1PV4A 2CWPA 1NY4A 3K80C 1VQHA 1XMQL 4IPHA 4GKJL 1R9TH 4X62Q 3F2BA 5AJ3L 1K0RA 2ASBA 4APVA 2NVTH 4LUVA 1K8GA 4LFCQ 2ZTCA 4YY3Q 4A3JG 3A74A 1N32Q 4DR6Q 3TEHB 3TS2A 2R6GA 4JYAQ 4QQBX 3PV0A 3VDYA 3GO5A 4R4QA 4QJFA 3TREA 1HR0Q 1XTDA 3RN2A 5M3FG 4NXNQ 1Q81C 2HHHQ 3PUYA 3J81i 5IYDH 1X65A 1YBYA 1XNRL 2VUMG 2UU9L 4OXPA 4IJHA 4A75A 4LF8L 3FKIH 3GD7A 3OTOL 4B3SL 1JJGA 3DM3A 4X6AH 3DLLA 4LFBL 3S17H 4LUOA 2VNUD 1Q1EA 4LF9Q 2JEAI 4BA1I 4B3TQ 5C4XG 4JI4L 2ZTEA 2JA8H 2IX1A 3WWVA 4DR1L 4L5RC 3ULPA 1HNWQ 1PH7A 1K73C 2R92H 1X3EA 2RF4A 1OXXK 4UY8C 3HOXH 1JT8A 3JC66 1HZ9A 2NN6G 5J3BA 4BBRG 3RLOA 4B3RQ 4JI7L 2IHFA 3CCUA 3HOUH 3CC7A 1JMCA 4QL5A 4DV6Q 3KDFA 1VQNA 4X65L 4TVAB 2AWOA 2PI2E 3KLWA 4BXXH 4BY1G 3S1MH 2GVAA 4JI6L 3KJOA 5GROA 1YIJA 5LMNQ 4JI1L 3CPWA 4DV0Q 1YITA 1SR3A 2DUDA 2JA6G 2OTJA 2F52A 1IBMQ 4DV3Q 4JBMA 1FVIA 4PMWA 2VQEQ 1HNZL 4EX5A 4OX9Q 2BH8A 2YTXA 1I94L 5JEAJ 4B3MQ 4A3BG 4LF6L 1C0AA 4GS3A 3L7ZC 1QVCA 4XIGS 4GOPA 1VQIA 3T1YL 1EUJA 1KAWA 4JI8L 3SGIA 1YJWA 2E5LL 3HOVH 3A5ZB 2AHOB 4WJ4A 3CC4A 1I3QH 3GTJH 3I2ZA 3H0GH 4O0AA 3JAMi 4NB3A 4GOPB 3K7UC 2K50A 1IBLQ 4Y52H 4YCWA 1GVPA 1VQJA 1WCMH 4X66Q 3BJUA 1X3FA 1M1KC 1WI5A 1E1OA 2KCTA 1UE7A 3D31A 1X6OA 4JBWA 1O7IA 2JA7G 2CWAA 1YHAA 3K7AH 4DV7Q 2KHIA 4IPCA 3S1NH 5M3MH 2KCMA 2MNAA 1N8RC 1TWAH 1PH1A 4BBSH 1IZ6A 1EQRA 1L2FA 3K0XA 3TQYA 3RR5A 1N34L 3OYYA 4YHHQ 1CUKA 2VQFQ 1I5FA 4GOPC 2NZHA 2QEXA 4IOCA 4YWMA 3U4ZA 1VQ5A 3PUWA 1W2BA 4DV1Q 2OCEA 2UUBL 3T1HL 2ES2A 4JI0Q 1D7QA 1VQ7A 4LF4Q 3HOWH 1EFWA 5FLXc 4JI5Q 2OQ0A 3AFPA 2LXJA 1M90C 1XMQQ 1CKOA 4J15A 1HJPA 2N8NA 1CSPA 4A3IH 4GLAC 3PGZA 1P16A 2H5XA 1DGSA 5AJ3Q 3RZOH 1I6HH 4A3MH 1XPRA 1UE5A 3L2PA 3I4NG 3D0FA 3ER0A 1FJGL 1IYJB 4LUZA 1B7YB 4DR3Q 4P74A 3HOZH 5C4JH 1N36L 4DUZQ 3E9HA 1IL2A 2RHSB 1V1QA 4P71A 4YWLA 1E1TA 3UE0A 3W1BA 1Z47A 4IOAA 2UU9Q 4P72A 4ALPA 5IP9H 1SROA 4A3LH 3BZKA 2B63H 4LF8Q 3GTQH 3E9IA 4HJAA 5IP7H 1KC8C 2I5HA 1HZAA 5HGQA 3KFUA 4UPAA 4MTNA 5HY6A 3CF5A 4DR7L 4LFBQ 1GD7A 1PH8A 1SFOH 3ERSX 1U0LA 1B70B 3CQZH 2K4KA 4XTCS 3PIPA 4LWCA 4A3CH 3W1GA 4DUYL 4A3KH 1RL2A 2A19A 4LNQA 1W3SA 1YHBA 4HIMA 3MXNB 2ZJPA 4DR5L 2Z0SA 5IYDG 3S1QH 2DGYA 1CKMA 5C3EH 4JI7Q 4OWTB 2E2HH 4DAYB 1GKHA 5IY0A 1LUZA 3FKIG 4JCVE 1YJ9A 2IX0A 1K9MC 4OWXB 2JK8A 4JI3L 1NBWA 1WFQA 4DV4L 3BU2A 4JI1Q 1XNQL 4A3DH 3AQQA 1E7ZA 4LFAQ 4HIDA 2JA8G 3CCEA 5E7NA 2ZM6L 2WFWA 3G71A 4AQYQ 4UP9A 2R92G 3NENA 1GO3E 3HOXG 3B6YA 3M4OH 1A0IA 2PNHA 4IPDA 3CCSA 4A3EH 3U50C 1HNZQ 3KYHC 2JA5H 3HOUG 1L0WA 4GNXA 1KHIA 2I5MX 4OO1I 1I94Q 5GAGC 1PH5A 3NEMA 3F2DA 3EIVA 3T1YQ 4JI8Q 4GNXB 4A93H 4BXXG 2D0OA 2E5LQ 4H02A 1VQBA 1YHQA 2MQHA 3CW2C 4A3FH 1QUQA 3GTMH 3M3YH 1MJCA 1PFSA 3AYHB 4LW1A 5LMUL 4DV2L 3GTKH 1Q1BA 2WAQE 4O2DA 2EXDA 3PSIA 2RCNA 1QUQB 4X64Q 2AMCB 1EIYB 4JBKA 1AE2A 4A4IA 2IHEA 2PMZE 4R4OA 2VS1A 1Y1VH 3J81c 1E22A 1X54A 2N78A 3CCRA 4DK6C 5GAHC 1YJNA 2UUCL 4AH6A 4C3IH
chains in the Genus database with same CATH superfamily
1HUMA 4FNFA 1IW7C 2LS01 1CE8A 3V05A 1N34Q 5HGTA 2B2UC 2R7ZH 2Z4HA 4NXMH 2F0JA 4ME6A 4ECQA 2EJMA 1FD7D 2DZDA 1LM0A 3S14H 4XT1B 4RNNA 2A68C 3FKIB 2VUMA 4NXNL 2DY8A 5M3FB 2F0WA 4MTKA 1JC7A 1SNMA 4GKKL 4QWEA 1FYCA 3K5LA 2W6OA 2SDFA 5FPOA 2HVQA 3CMEA 1N33L 4JPBW 2VUGA 2ASJA 5KFBA 1YI2A 2NN6I 2JA8B 1ILPA 3PZPA 2KBNA 3S1RB 1D5ZC 1VMPA 4O2BF 3NBHB 1G291 1QVGA 3HOXB 2HQEA 4V190 1EUCB 4ECUA 3BVGA 4LF4H 3CCVA 1SMXA 4JI5H 2K52A 1EWCA 2QDLA 2F0LA 1LTRD 3N43B 4HJ5A 1KDBA 2Z6KA 1OTCA 4Q44A 2OQKA 2UVUA 4QUFA 1B9NA 4KJOA 2WIIB 3ULJA 1MSHA 3EA6A 4HNUA 1SE4A 3SK4A 1VMCA 4DUZH 1IBML 4DV3L 5KNBA 4RH6A 3JRWA 2UVVA 5J2UF 4R4TA 2A8VA 3GV5B 3KF8B 2BA0A 5HV6A 3S2HH 2YYZA 3GTJB 5EWGA 1LYLA 1IBKL 2B63G 4LFBH 5FLXE 1WCMB 3MFGA 1DOMA 1EYGA 3A5UA 1HA6A 3NXWA 1AZQA 4X62H 4A3CG 1EOVA 3E6ZX 4LAAA 4FXKC 2W9BB 1PTOD 1QNUA 4NXML 2Q2IA 5KG7A 2KCNA 1N32H 4IRCA 1VQPA 1TR5A 4F7XA 1CI3M 3BQ1A 2EYFA 1WD1A 3RGZA 2E74C 2BQ3A 1CKNB 4JI4Q 2IPKD 2V4QA 1RKNA 3OWEB 5K5PA 1HR0H 2DLNA 1B33N 5E1FA 3GTOB 5EPKA 4DAYA 4C2MH 3CMAA 1L1OA 4J1MA 4IN3A 3RLFA 4NDXA 2ZDGA 2HQLA 3DWPA 3MR3A 3T16A 1X9NA 4KHZA 3UDFA 5EOYA 3ORRA 2JJQA 3PCOB 1UUPA 3C3LA 1KABA 4DV2Q 1SNPA 1VQGA 4LF4L 3PN1A 5IYBH 4DA2A 3VYRA 4ZKCB 1PX2A 4PQXA 4A3EG 1ZXTA 3MR5A 4C1NI 4K5VA 4UCRA 1PYSB 5JJZA 5FKAC 4OO1H 1ESFA 2E5LH 2RGRA 4IR9A 3VYTA 2VY3A 2F0PA 4A93G 3IRBA 4TRDA 3UDIA 3W2DA 3EROA 1BKBA 2DJFC 1NSNS 2XGQA 4A3FG 1VQOA 1QZHA 3BA8A 4ECVA 4JG2A 2D9UA 5KFVA 4R8UA 3TRZA 1HH2P 2PI2A 1JORA 1AE3A 2UUAQ 4DUZL 1E2WA 3HKZE 1G6PA 4QMGA 2W9CB 3MJFA 2WAQB 4WBNF 4EFEA 1A2UA 4YR2A 3RB3A 2BH2A 4YAJB 1N34H 1PTOF 4C3IG 1VF5C 4RAYA 1XMOQ 3V6HA 5BR8Q 4YIJA 5FPRA 2R6FA 1SMYC 1A6XA 2NZ1D 4QIWE 2VUMH 2R7ZG 1DONA 5JJIA 4GC6A 2KEEA 4X62L 3L4JA 2BE5C 1PMRA 5F9LA 5KT5A 1Q12A 2EY5A 2YL2A 1N32L 4YQWA 2L15A 2MPMA 1PH3A 2WB1E 2UUBQ 2J6TA 1V1PB 1G91A 3BVZA 2Q8TA 1HR0L 5IYZF 3PW5A 4OONA 5KFYA 3CCJA 4O3PA 1VQCA 2ZT9C 2VOBA 3NSWA 3S17B 1J6QA 3M4OB 3GQCA 4AYBB 2R92A 3GIQA 3NBHA 2XN9C 4RGNA 4ZOLF 5C1PA 3A54A 5M5YH 1W6JA 2E2DC 2Y0SB 1GSAA 4DL4A 3PIP3 2O5IC 4ODGA 3RD4A 3CAMA 2VQDA 3GIIA 4XDXA 2JA6H 4QB4A 5E4XA 2Y0SA 3GTMB 3C1EA 2HT1A 3PF5A 4ECYA 4JOIA 2FJZA 3RB4A 1QWYA 1A2TA 5ELNA 4B3RL 3S1MB 2VA3A 1JJ2A 2A68D 5KFTA 5KG6A 4QF4A 3TP5A 1ILQA 4QY7A 4DV6L 4A3BH 3U9TA 4YWKA 1C9OA 1LTLA 1N9WA 1TXYA 1S5CD 5EDWA 1OXVA 5KFUA 1CA6A 1T3NA 4A76A 4CC5A 3H91A 3KF8A 2MCTA 3MVVA 1UWVA 2I5LX 2L9HA 2CVRA 2RDIA 2R93B 1DCZA 4ED7A 1MSGA 3GTJA 4I4TF 5DLQE 1A3TA 4HJ7A 2PCFB 1JKJB 2RDJA 1HNXQ 3M85A 4OX9L 2ZDQA 5KFXA 3NTKA 4L5QA 5KG0A 1TWCH 2I87A 2EQSA 1E24A 4P75A 3K59A 4JI4H 3SHLA 2CCZA 2W9BA 4P73A 3T51B 1X55A 2VA2A 2JQOA 5LL6X 1ZEQX 2CKZB 1GM5A 2F0UA 3K8AA 3Q0AA 1HZBA 5C0XI 5L1LA 3T5JA 4JI7H 2X0SA 4DR2Q 3RN5A 3S15H 2F3IA 2MP1A 1B44D 3K81C 4MZ9A 4HJ8A 3FPUB 2D5DA 2E2IA 3I91A 4K8IA 4F50A 1DM0B 3I3CA 3HKSA 2WB1G 2YZNA 1M7JA 4TQRA 3OHBA 4GC7A 5IYBG 4Q45A 4X3UA 4C56C 2F4VQ 4M7EA 2WDTA 2I46A 5LL6S 5I4DA 4OO1G 1KL9A 4JI0L 4I65A 4G7HC 1H9SA 4MNOA 3DXJC 1GJXA 4YJ3F 4LF5Q 3M4IA 1FNWA 2CW8A 3T13A 2UUAH 1K83A 2PQEA 1I7NA 5AJ3L 3Q22A 2NBFA 4LUVA 3VYSA 3IKJA 3TEHB 2R6GA 4JYAQ 1HTLD 5AFWA 5CC4A 4MAMA 5BR8H 1XMOH 1RJPA 3J81W 2WAQA 5JVDF 4QJFA 3RN2A 4O4IF 1Q81C 2JEGA 1T5EA 2HHHQ 3T4AC 2Q8RE 5I6YA 2XCAA 2BR0A 2VUMG 5T1GA 1SAPA 1Z6HA 4OXPA 1AUVA 4MTEA 3CRKC 1SFOB 3FKIH 3CQZB 3GD7A 4KD3A 4XYOA 4CKBA 3P75A 1J8IA 4XYQA 1PRTB 3BZDB 3I72A 2FK3A 4RUCA 4LUOA 2VNUD 2UUBH 1GYFA 2C5CA 4JI4L 2AU0A 2ZTEA 2YU9B 2JA8H 1AFPA 4HNVA 1HNWQ 3ULPA 3GQBA 2R92H 1QCBD 5CMDA 4R7RA 3HOXH 1TS5A 3JC66 5I2YA 3K5IA 4XZ3B 4JI7L 3CCUA 1HQRD 4FF4A 3GIPA 1EY0A 2AQ2B 2VB2X 4EQNA 4QL5A 1VQNA 2CZGA 2PI2E 2EJGC 2JA5A 2UVRA 1BXTA 5GROA 4ZCKA 4JI1L 2PN1A 2R86A 1NNXA 5EGTA 1SMYD 1LTSD 5FOBB 1SR3A 2A73B 5I6WA 1YITA 4G7ZC 2RBMA 4A3EB 2F52A 2JA6G 2PW5A 1SYFA 1PLFA 3RF2A 5KFRA 1K1QA 4FF2A 1EIGA 3GTMA 2A6HD 4A93B 1LTBD 2K32A 2EYOA 1HA5A 3KTMA 1V51A 5D8DA 4A3BG 5CV9A 2OF1A 1TIID 4A3FB 3L7ZC 2J9GA 3TBIB 4GOPA 3T1YL 4G7OC 4J0MA 4J6HA 2GA4B 3CC4A 1JQYD 1E4EB 4ZAIA 3GTJH 3VR6A 3I2ZA 3JAMi 3K7UC 3MWMA 3R93A 1WCMH 4FO2A 2F0OA 3BJUA 1M1KC 4KTAA 5DQGA 4FXDA 2QW7A 1HNXH 3D31A 1X6OA 5J22A 3JSNA 4JBWA 1CQIB 3OMCA 1YHAA 1RDPD 2XRQD 4IFDH 4IPCA 4RHRA 2XCPA 2R7ZB 3QIAA 5EKLA 1N8RC 4DV4H 1O7YA 3TQYA 3K0XA 4FBUA 3OUZA 3KLSA 4IUTA 1I4XA 1ML0D 2AQ3B 2K5QA 2Z4IA 4RHSA 2YW2A 2ZM6H 1AW7A 4YWMA 3U4ZA 3TQ1A 1OO9B 2UUBL 4DR2H 2J7ZA 1M4VA 4EBEA 1EYCA 1TWHB 4C3JB 1VKZA 5KT4A 3QOLA 1LACA 4XQNA 2W8LA 1EY4A 4Q8EA 1HJPA 4A3IH 2C9OA 4NKLA 2YCHA 1HQMC 5CGKA 1I4GA 3EJIA 3RZOH 1I6HH 3MFHA 5DM63 2F4VH 4RB1A 5FO8B 5LYJF 1J9OA 1LABA 4LUZA 2CW0D 3G6VA 2EE1A 4DR3Q 4P74A 3HB9A 3JAML 1IL2A 4P71A 3UE0A 4EBDA 1Z47A 2C2RA 4ALPA 1DOKA 2R8JA 1KC7A 4A3LH 3BZKA 5JPNC 5KFKA 1DD2A 1E2ZA 5HY6A 3CF5A 2Z8LA 4DR7L 4EGJA 1V4YA 1I4PA 2K4KA 2NTSA 2L55A 1DV1A 2HHHH 4A3KH 1RL2A 3SE0A 2R7NA 5KG4A 2CH4A 4HAEA 1H9MA 1CKMA 1C3OA 1EY5A 2XWJB 3IFDA 1EZ8A 1TVXA 3FKIG 2KA7A 3TP8A 2P0AA 5IGEA 2XSCA 4DV4L 3C46A 4LF7H 3X3NA 3HGBA 1HNWH 4R8IA 4HIDA 2JA8G 2ZM6L 1ZHQA 4MV3A 5IT9W 2WFWA 4AQYQ 4QIWB 2YU9A 2R92G 1JE4A 2KVMA 2QF7A 4DL7A 3M4OH 3HOXG 2PNHA 4IPDA 3CCSA 4C2MB 2JA5H 4GNXA 5DGAA 1X3QA 1I94Q 1F2ZA 3NWSA 4PMCA 3OIQA 2DIKA 5BN3A 2HVRA 5I2XA 4RUAA 1O75A 4DLKA 4ZLTF 5IWAH 1VQBA 2V4DA 2Z6BA 1MBYA 4RWSC 1YHQA 1WH2A 1QNKA 1D1IA 3GTMH 2PBZA 1MJCA 1PFSA 4ZQIA 4F4XA 2QK4A 2WAQE 2EXDA 2WKCA 1BBXC 5E3FA 1QUQB 4X64Q 3VR4A 5C5LA 1AE2A 4DFAA 1WTRA 2VS1A 3GP7A 1E22A 5CR3A 2N78A 1UAPA 3UDXA 4A2BA 1QB5D 3QZ7A 3I8ZA 1F9SA 1Q82C 5KEEA 1NTGA 3BG3A 3I90A 4RKBA 2R93H 3GIKA 3PW2A 2C35B 2KHJA 1JE5A 3M4YA 4DNTB 3MR6A 1GUGA 1WCMG 1E3PA 3K0YA 3ZYYX 1S03G 4QWAA 4U6PA 4UDUC 2OWOA 5FO7B 2K5NA 3ORQA 2UXBL 4CJ0B 1F2LA 3SK5A 4YAKB 4IFDG 1EQQA 1BDOA 1GHJA 3A8JE 5CORA 4PZ8A 5IGDA 4AYBE 4ME3A 2GLTA 2ATWA 1T5XD 2WKDA 3GDEA 4ED0A 4TKOB 3C2PA 4PWQA 1STHA 2F0VA 1VQ6A 3FDSA 2Y0SE 2ASLA 1PYBA 2IL8A 3NGDA 2UXCH 1FJGQ 4LF7L 3OIPA 1YVCA 2BOSA 2HIVA 5IYCH 5GONF 2HGSA 1Q3LA 1SNDA 3N40P 1ENCA 1XPOA 1WYDA 2K5VA 1GUTA 4POFA 1B3QA 3J7AF 3Q8PB 1TWHA 4A3IG 2K01A 3MEFA 5JEAH 2XD4A 3VMMA 3BZCA 4V0BA 3CU7A 4OWWB 2R8GA 1Y14B 3K6OA 1ICWA 5CB4F 4DR3H 4IRKA 2SNSA 3C1FA 5IWAL 3JAMc 4DUYQ 2IP4A 2ENBA 5KFIA 2B2YA 2UXDL 5EJWA 3W5OA 4DR5Q 1VQ4A 3DHQA 3MWYW 3I56A 2Z1CA 5BN5A 2JE6I 5GADC 4JV5L 1LV9A 3H0GB 4A3LG 2JXMB 4EQOA 4A3BB 2R7KA 3I55A 1M6VA 2MO1A 3UDGA 4JI3Q 1B6RA 3PW4A 3HS0C 2WAQG 3MXGA 1XNRQ 3OOCA 1G8ZD 2D2CC 4F88A 2P5ZX 1CFMA 3U9SA 1TWAA 1VQMA 4B3SQ 4A3KG 5I9PA 5A2QL 3J7ZC 5FLMH 2OTLA 4L8JA 4UAIA 3R5HA 4BBSB 4JV0A 3CCMA 4OIJA 3GILA 1KXLA 1FL0A 1GUWA 4XX0B 1SNQA 5GAEC 1YNJD 4DR1Q 1TY2A 4RB0A 4PZ7A 3A56A 3EYYA 4L5SA 1SLJA 2I80A 5J1ZA 5CV6A 2YU9H 1GLVA 5IGGA 3HOWB 4AQYH 3GTLA 1VBHA 3G7LA 3LNNA 2JEIA 1L1OB 1B4OA 4X65Q 4H7BA 2UXCL 5KFSA 1EIFA 1BXRA 1NMGA 4FS2A 4JI6Q 5KNDA 1CHPD 4AYBG 4S3SA 3F8TA 3S15B 5EKKA 2JA5G 1ZHSA 1JIHA 1BVSA 4BY7H 2Y0SG 3NBIA 4ZUIA 4BA2I 4K0KL 1H9KA 1YNXA 1J5EL 1EIHA 5C5JA 4RFBA 4TQUS 4RMFA 3IN5A 1YEZA 3TP7A 4RKLA 4IUPA 3N6XA 2GN5A 2O4XA 3E0JA 3TZUA 4LF6Q 4X64H 2QKIC 1IKLA 2V58A 2K6AA 4DR3L 5LMNH 3CRLC 1DV2A 2F0TA 2B2TC 4R8UB 3I73A 4OL7A 4FS1A 3OSPA 2PMZA 3I7FA 3T53B 2VQEH 1WJJA 3SDZA 3VPCA 2DJGC 4DV5L 1VS0A 3KUPA 2EXZA 2F0SA 2I0QA 4B3MH 3L0OA 4Q5VA 1EL0A 1BNZA 2HDMA 3R23A 3M4QA 1K8OA 3A0JA 5I47A 2R93G 5DGBA 1G2TA 4DNRB 2KHSA 2AKWB 3ETJA 3QJYA 4RGOS 3J80i 4LFCL 2R61A 2L0CA 3FPPA 4KHPQ 4NPSA 1BF4A 1SDFA 4ZI7F 4GLVB 4A3DB 3VR3A 2B8GA 3D4WA 1PA6A 1NJIC 1GSHA 2DN8A 4IFDJ 3TQTA 2NU6B 1KAAA 5IGCA 1I6VC 3DEOA 3CCLA 2ASDA 1A62A 2CHBD 3PUZA 3HEJA 1QVFA 4YHHH 5IYCG 4DXGA 1U4PA 1TWHH 4C3JH 4AQYL 4RA8A 5C6AA 4UCSA 2ZTDA 1EWIA 2TMPA 2R92B 1B8AA 1O80A 3TZDA 5CBEE 3E0EA 4MV6A 4DV1H 1A3UA 1WTVA 4DXFA 1PH4A 5EQ0A 3M4PA 5DLFA 1GOZA 1Z9FA 2B2VC 2F0EA 4CKCA 1IYVA 2G5DA 3J80E 3KAJA 2YRWA 5JEAG 3JAMW 1XMQH 3A7LA 1UEBA 1MJEA 4DUYH 4ECWA 4A2AA 2ALZA 1Y1VB 2AUJD 2MUYA 4DR5H 3S2DH 2RSOA 4X64L 3G48A 1JICA 5LMNL 3ERQA 4IHJF 3V6KA 1EYAA 4ED3A 2PO4A 4DV0L 2D0PA 3KJPA 3J80L 3BG5A 1JWMD 2ZXRA 1F2YA 1LT5D 1C7YA 1I3QA 1H9RA 1XNRH 1G6ZA 2VQEL 2UU9H 3H0GA 2N49A 1D8LA 3TINA 2W71A 4LF8H 3H15A 2OXPA 3R5FA 4B3SH 4B3ML 5HURA 2EVBA 1S40A 5KG3A 3KF6A 1BUVT 2ID0A 3EFXD 4J9RA 3D4DA 5FLMG 1Q8IA 3M9OB 5KFZA 3RAQA 4DR1H 5D14A 3EQLC 2YTYA 2W6MA 2A74C 1EHIA 2LFNA 3GTLH 1UE6A 4K6LA 2G9HD 1EFID 1QZGA 1EZ1A 4X65H 2ICIA 3SVMA 5FLXL 5IE8A 5CV7A 4JI6H 4YCVA 3QB3A 4Y8VB 1KJ8A 4YHHL 1PZJD 1SBBB 2ATLA 1KTKA 2E2IB 2FMCA 4X3KA 2VZAA 4DV1L 2RDGA 5JJLA 1VF7A 2VPSA 4A3IB 2HDLA 4BY7G 1HNZH 3J81j 1AH9A 5DLGA 3BJYA 1VCIA 2K5HA 4LF6H 4JI5L 5G3LD 4U673 3RZOB 1PV4A 1STEA 1I6HB 1XMQL 1H9SB 1HHVA 2EYLA 5KFJA 2XIGA 4EGVA 4HCEA 1K0RA 3HOYB 1K8GA 1K83B 3CVZA 4YY3Q 5CA0F 3TS2A 3LWBA 5KRUA 3VDYA 1Y1WB 3GO5A 2SCUB 3QR8A 4P2CB 3MFYA 3TREA 1XTDA 3D8GA 2ZDHA 3BDLA 1I50A 3MFIA 3PUYA 5IYDH 2F0QA 4MV8A 4LH6A 5EBDA 1XNRL 2UU9L 5BMVF 1CZGA 4IJHA 4RGTA 4ZKBB 4LF8L 3G6JB 4B3SL 2DPIA 3HRZC 4A3KB 4LFBL 4LF9Q 4NMZA 1M0WA 2JEAI 4QWBA 3NE5B 2K03A 3W3AA 5CA1F 3DEPA 1JX4A 3V6JA 2K5DA 1TS2A 4DR1L 4LK1C 2KQ3A 5TSSA 3IFTA 5NUCA 4F4WA 1X3EA 2RF4A 1JT8A 4RZRA 1DJRD 1HZ9A 5J3BA 1DYQA 2F0FA 3VPDA 2UVWA 1CZWA 3OPOA 4X65L 4TVAB 3MEHA 3Q24A 2AWOA 4E4TA 1PRTC 4BXXH 4C3JG 3EPGA 3V96A 1SE2A 2XRSD 4JI6L 3KJOA 1SYBA 1YIJA 5G3LF 3WO0A 4E6IA 2DUDA 1R4PB 2MJ8A 4FF1A 2FK1A 2JA5B 2FMAA 4ULLA 2A69C 1FVIA 4PMWA 1CTMA 3D3RA 5C4HA 2WTFA 3LWUA 1IW7D 1K0SA 1HNZL 5JEAJ 4HYKA 1FR3A 4LF6L 1QVCA 4JVZA 2FINB 1IHZA 4ILWA 3NP8A 2E5LL 3QWNA 4HR7B 1Y1VA 1I3QH 3JZIA 5KNCA 3H0GH 2F4IA 4GOPB 3S16B 2YYAA 4YCWA 3Q8SB 4YR0A 4XXEA 1VQJA 2N55A 4X3SA 4X66Q 1X3FA 2FPGB 2EPBA 4IUQA 2IA6A 1B04A 5A2QW 4J9KA 2NWGA 2CQAA 4CHTB 4DV7Q 2KHIA 5C4XB 5KFOA 2KCMA 1TWGA 5KG1A 3OSOA 2MGSA 4BBSH 1L0YB 1IZ6A 1EQRA 3RR5A 1N34L 3OYYA 4FXGC 3GV6A 2VQFQ 2LMCB 1I5FA 1C8CA 1KBLA 2NZHA 1W2BA 1CM9A 1EY8A 4M9UA 5J39A 4TV8F 2O5JC 1KDAA 2H1EA 3BYYB 1UEAB 4BY1B 3HOWH 5C5MA 5FLXc 1S5FD 5D65A 1EUDB 3AFPA 2AGOA 2LXJA 1D2BA 1CSPA 4CDCC 4GLAC 3TP6A 3PGZA 1P16A 2H5XA 2HUGA 1WR2A 4XQJA 2RKSA 4MIUA 4N8X1 5EBCA 1XPRA 3FDTA 1ZQ7A 1KLUD 4DV2H 3D0FA 3DF7A 4ECXA 1AP0A 3LMLA 2B39A 3VA7A 5KFGA 2B2WC 5BPHA 1RYSA 3HOZH 1Z2PX 5C3XA 5IGBA 1QG7A 1LO5D 4ZUJA 1LTID 4IUVA 3BDCA 1E1TA 4O3RA 3W1BA 1WSCA 4DK0A 1CQFA 4EG0A 5IP9H 2I07B 1SROA 4FVMA 3E9IA 4HJAA 5IP7H 1KC8C 5HGQA 4UPAA 4MTNA 3FMCA 1GD7A 4KV6A 1PH8A 3ERSX 4K8JA 1B70B 3G6YA 4BWSC 2JA7B 1NR2A 2A19A 5KYLA 1W3SA 1Y1WA 1YHBA 5KGUA 5F9NA 5IYDG 1MZBA 3I70A 4OWTB 4O1NA 5ELBA 1GKHA 2F0MA 1TQOA 4JCVE 1K9MC 3IG0A 4LF9H 4ZQ3A 2JK8A 1K3BC 5DNFA 2N88A 4A3DH 1Y69U 1E4FT 1KDCA 3AQQA 1E7ZA 3FRPB 4LFAQ 3M9MB 3BQ2A 2PZUA 5KFLA 2RA4A 3SK8A 2W6PA 2NVXB 1STYA 4KD4A 3NENA 1D1KA 1A0IA 3I12A 3U50C 4OO1I 2DPJA 2I5MX 4MV9A 4CC6A 1Y8NB 5CV8A 3RMHA 1QOHA 2B2UA 3F2DA 4BXXG 4JI8Q 4GNXB 1W96A 4UFZA 2BQUA 5KFQA 2KECA 5LXTF 3CW2C 5DM73 3MZ5A 3FVQA 3M3YH 1T36A 4LW1A 4DV2L 3URYA 1TS3A 2W57A 1R9TB 5ELFA 4BY7B 4MA5A 4JBKA 3CHBD 4U7CA 1IKMA 2OT2A 4A4IA 5LHY1 3WO1A 2NVTB 4DGZA 1HFGA 1Y1VH 1B50A 3CCRA 3SE7A 5GAHC 3SI8A 5KFFA 1ET6A 2W8KA 4K2LA 3PR5B 4PMBA 4WRDA 3AMUA 5DG7A 1PFBA 3CXCA 2BE5D 1I4HA 4HSPA 2EYJA 1PTOH 3H0GG 4HR7A 1Q7YC 2IY5B 4DKAC 3K5MA 2YZMA 5KG2A 4IUUA 4ABNA 3GV8B 4FDBA 2TSSA 4DK3C 1WTWA 2ZXOA 2UUAL 1CQJB 4DV7H 2FK2A 2GVBA 2R87A 4ED6A 4L1KA 4DR4Q 4ZYSA 4H0LC 4KMUC 5L1JA 2VQFH 1PYWD 1XMOL 1Q46A 5BR8L 5JUMA 3KLRA 4BBSG 4QQBX 2V9WA 2A69D 4RGMA 3ULLA 4B9XA 3N41B 5C1OA 3S24A 4LF9L 2JYOA 3KHGA 1JOKA 5FJ8H 4JV2A 3GIJA 5KIXA 3TN2A 1JOOA 2ZJRA 3VA5A 1RJRA 4IZOA 3QZ8A 4JI2Q 3HOWG 4NLGA 3H6MA 5K36H 2K14A 4J9MA 4PDBA 2E2IH 2M9VA 1ULZA 5M5XH 3STBC 2MO0A 1ASYA 3HP3A 5F2DA 2XNAC 3U58A 4DAVA 1EU4A 1JB7A 3SR1A 4GKJQ 3V4SA 4IRDA 2EJFC 2NB0A 5H1SE 2L5TA 2X69A 3GTPA 3TDQA 4CBVA 3HOVB 3QFFA 5C3WA 4OEMB 1S4ZA 3OSNA 4EEYA 2Q2UA 1EY6A 5IP9G 1SYEA 3HOYH 4LF5H 2Z6KC 4ID6A 5IP7G 1K83H 1LTGD 1H95A 3H3VH 1PRTF 4IPGA 3S2DB 4F4ZA 4ZHQF 1XJVA 1Y1WH 4J9SA 1PVOA 1XNQQ 4POGA 4YBZB 1SE8A 4J9NA 1N48A 1K3RA 3I4MH 4ZRZA 4DK1A 2JA7A 2C28A 4IURA 3Q8DA 1JJCB 3F1ZA 4JYAH 1TWAB 3Q6SA 3RBDA 4AIMA 2Q8IB 2VXWA 4DU9A 2FP4B 2VQFL 4LFAH 4K5WA 3SXHA 1HNXL 1RJTA 3PVXA 1VQEA 4A3DG 3RIZA 1RTNA 1U5KA 1DOLA 1HFNA 4GN3B 5KFCA 1ENAA 3AEVA 1JR0D 1HR0W 1GSOA 3EBEA 3GTLB 2YRXA 2V1CC 1BBUA 3MXPA 3NK9A 2NVXA 1Z2OX 4A3MB 1O78A 4K6DA 4JI8H 2UUCQ 2IX3A 2GPSA 3M7NA 4HN7A 2KUMA 4DR2L 1F2MA 5KFHA 1UC8A 3F2CA 3KLSX 1CHQD 1HZCA 3LX0A 1PH6A 3M9BA 2DNEA 2LSSA 2RVLA 1L1OC 4HIKA 4HJ9A 4TSSA 2ICEC 4BS9A 2O2LD 1B9MA 3TSSA 2ALYB 2WP8J 1S97A 4DNIA 2DWCA 4A3JH 4GKKQ 1R9TA 1PFNA 4K2KA 1Y1VG 2F4VL 3BDOA 4EGQA 5KFWA 1GHKA 1N33Q 2VB3X 5JVH3 1WVLA 1S72A 1WTPA 2PMZB 4IWYA 4H44C 3S16H 3KOJA 2I8CA 4LF5L 3OW2A 2JA9A 4JC0A 4F8MA 4L5TA 4ECTA 2ZJQA 3S1QB 3G8CA 5C3EB 1BCPB 4HIOA 5LP6F 3CC2A 5EZYF 4JBJA 1MKHA 2L1BA 5C4XH 1PH2A 1CT1D 2PNRC 4DR4H 1I4RA 4JYAL 3ETHA 1SNOA 5HBRB 3N6RA 3T1HQ 3G4SA 1D5XC 3ND9A 5KFDA 2W6QA 5IGFA 2NN6H 3OMGA 2HHHL 2EYMA 2VL6A 1HXYD 3NTIA 2XGTA 4LFAL 2YS7A 2HCCA 3H09A 5FJ8G 2G9DA 2F0KA 1B1ZA 4BY1H 4J9PA 1ENFA 4JI2H 3UQ8A 2E75C 2YTVA 5L1IA 1CS0A 4WORA 1K8AC 1ZETA 4GN5A 1S5ED 4MV4A 1NE3A 1HNWL 3PUXA 5K36G 1IBKQ 1KIXA 3K3PA 3IAYA 3GV7B 2EY6A 3RAXA 4UCOA 4JW0A 4UHVA 3CCQA 1BO0A 4LH7A 4GKJH 4EYHB 3CKIB 3GTPH 2PYKA 2RGVA 1P8LA 4UCTA 1SJHD 4QGUA 1B3AA 1LT3D 3PIOA 4NXMQ 1PK8A 1BBWA 1TU2B 3PO2B 2BCOA 1RTOA 3T5KA 3Q2OA 1JWSD 1TY0A 4R4CA 3F2UA 3HOYG 5EPJA 2K05A 5A35A 1SSOA 2EOTA 2LY7A 1XNQH 4IFDI 1A3VA 1KRSA 2JA7H 5JQWA 4JOIC 1Y1WG 1I3QB 2DY7A 5IIFA 1I7LA 5JVG3 2AUKA 3I4MG 2E8GA 1TA8A 3DUZA 2QA4A 4WJ3M 1OXSC 1VQ8A 4GLXA 3RTXA 3AFQA 2PQAA 3KF6B 3STBD 2W7PA 1SXTA 4DR4L 2VW9A 4K14A 1VQAA 4KK7A 1JCKB 1EWHA 1KRTA 5M5WB 4IO9A 3CPFA 1GUOA 1KQSA 5JJKA 3BQ0A 1TT2A 4IJLA 4CKEA 2A6EC 2N3SA 2NVXH 1CSQA 1MD2D 2XVSA 1SN8A 4UP7A 2GPWA 2PPBC 1G2SA 1S0OA 1OXTA 3TS0A 1S5BD 2QGQA 2RHQB 4JI2L 3E5NA 3DWAA 4IR1A 1UE1A 5L1KA 2HIXA 5LMUQ 2LXKA 3M9NB 3TIGA 3H3VI 4R8NA 1EY9A 1SRUA 1X3GA 1I94H 5COYA 2R7DA 3ITPA 3P1HA 1VQKA 5KFMA 3K80C 1NY4A 2FHTA 4GKJL 2X6GA 1R9TH 4BWGB 2W9AA 3A7AB 4X62Q 3F2BA 2ASBA 4APVA 2NVTH 4DF7A 1PZID 3HKZA 3HOZB 4QW9A 3I4LA 4TQSA 4A3JG 1N32Q 1N33H 4DR6Q 3GTQA 2H4OA 2J4XA 4Y7NB 2VR1A 2R8KA 4U68A 1HR0Q 2FPPB 3PMFA 1BR9A 3PW7A 3J81i 2R7MA 1X65A 5E4WC 1YBYA 2QDBA 2RDHA 1KJQA 5C8YF 1I50B 1JJGA 1KJJA 4H13C 2V5AA 2IWHA 1GUSA 1V8QA 1AN7A 3DLLA 3MWDA 1IOVA 3H3VC 5C4XG 4BA1I 4B3TQ 1TWFB 3T1HH 2WYOA 2IX1A 5H80A 4CDEC 4L5RC 2L11A 1K73C 2W6ZA 1C30A 2FLPA 2OH2A 3DMUA 1OXXK 4XQQA 4UY8C 3VR5A 2NN6G 1ONLA 3O13A 4WFN3 4B3RQ 3HOUH 1RYRA 3CC7A 4F87A 4DV6Q 1W93A 4BY1G 2W7OA 2GVAA 3J81E 1FJGH 2KOLA 3CPWA 1H9JA 1Y8PB 2RQXA 2OTJA 3TIIA 1I6UA 3RZDB 3MC0B 5T1IA 2OLSA 2K04A 5EWFA 4DL3A 5D1PA 4OX9Q 1I94L 1LLRD 3GTKA 2EYHA 1PXUA 3J81L 1C0AA 4GS3A 4O3QA 3RFCA 4XIGS 3M3YB 1VQIA 4KKTA 3HOVH 1KAWA 1YJWA 1AUXA 5FD6A 2AHOB 2BDNA 4MV7A 1XX8A 4RAUC 2NVQB 2FLNA 4O0AA 1IBLQ 4Y52H 2DNCA 4Q43A 4O2AF 3BS1A 1WI5A 1E1OA 2KCTA 3NHHA 1UE7A 4LMQD 2RDFA 2JA7G 3BA9A 1RF2D 4ECZA 2L4NA 5LL6b 1F9PA 2FLLA 3RB0A 4JI3H 1PTOB 5M3MH 1PDQA 3K5NA 2SEBD 5DAUA 1TWAH 3E5SA 1L2FA 1STAA 2JP1A 4GOPC 1VAJA 1TWGB 2HVSA 3PW0A 4O3OA 4BBRB 1VQ5A 3PUWA 1T94A 4IUNA 3R3OA 3T1HL 2ES2A 4JI0Q 1D7QA 5C0XH 2JA6A 1EFWA 2OQ0A 2XCLA 1Y8OB 2NYZD 4XYMB 2Z9HA 1VDZA 4CDFC 1DGSA 5AJ3Q 4I55F 4UCUA 5I9OA 3VPBA 4A3MH 3RB6A 4RZQA 1UE5A 3L2PA 3K57A 5LMUH 3GIDA 2EY2A 3WNZA 2EZVA 1FJGL 3L9AX 5LOVF 1MHWC 1PZKD 2E2JB 2NU9B 5CAEB 1ESRA 5BPFA 3E9HA 2RHSB 1KJIA 5DQHA 3ONAB 5M5XB 4LJZC 4IOAA 4P72A 1BOSA 1JB3A 1CQVA 1LT6D 3GTQH 5KKNB 4ED2A 4DR6H 1SYGA 4N8FA 3N42B 4R9WA 3MXNA 1TWCA 3VR2A 3W1GA 4DUYL 2A6ED 4LNQA 3DWQA 3OWFA 5EWEA 1S5DD 5KT6A 1WTXA 2K28A 4O4HF 1FKAH 4DN4M 2ZJPA 4DR5L 2Z0SA 3S1QH 2DGYA 4JI7Q 5C3EH 2VPQA 4IQZA 4CDDC 1VBGA 1EYZA 2IX0A 3OHAA 3GTGA 3I4MB 4HMIA 3MHBA 4OWXB 4JI3L 4B3TH 5KFAA 1S0MA 1WFQA 3WOFA 2WV6D 4JI1Q 2PZTA 1QJOA 3T56B 3PIO3 1NUCA 5D3DA 5E7NA 4G3IA 1TWFA 1U4MA 4B3RH 4KHPH 5FK9C 2C00A 1GO3E 2F0HA 1YNNC 4DV6H 3KYHC 3HOUG 1L0WA 3I4NB 4OHJA 5GAGC 2F0NA 3NEMA 3T1YQ 3EIVA 3Q8QB 2D0OA 3KHRA 1BQQT 2NUAB 3MA2B 4J9QA 4QWCA 3AYHB 5LMUL 3GTKH 4O2DA 2F3WA 3PSIA 2AMCB 2YZGA 4OX9H 1JDEA 2NVYA 4N9TA 2PMZE 4R4OA 3J81c 3MXUA 4DK6C 2M00A 4L63B 1TS4A 4GNXC 3PO2H 5IT9E 2NUCA 2A6HC 1GXDC 2WINB 3HOVG 5L9XA 1IBLH 4FF3A 4HCSA 2NU7B 4DR6L 3FKIA 1IYUA 4A3JB 1XDNA 3RUPA 4DL6A 3S9WA 5KT2A 2PZWA 3FMAA 1W6KA 3JRXA 3J80c 3RV3A 1AEXA 1VQFA 3K3VA 4FM9A 1WTOA 4QUCA 5FO9B 5KG5A 5IT9L 1DIKA 3H20A 1RIPA 5M3MG 2M05A 2LKVA 2EIFA 4YCUA 1WOCA 1IOWA 3PUVA 2B3GA 1A8VA 1ZYRC 1YZ6A 4YB8B 2JEBI 3D4RA 5D3IB 4B3TL 4A3GH 2BDOA 3OW7A 1S10A 1ASZA 4JI0H 3EVQA 2F0IA 5M5WH 2KSWA 2M2LA 5CYUA 5C0XG 2IMWP 1VQDA 2EY1A 4EQ5A 1CA5A 1RK5A 2W6NA 4KHPL 3N52A 3OUUA 2RCFA 1HCZA 1MI2A 4ZK9B 1ZKOA 1XTCD 2R8IA 1OXUA 5GQOA 2NZOA 4HEDA 1A63A 2R8HA 4DR7Q 4YP3A 4A3MG 2KCCA 1AN8A 4X3TA 1M0TA 1A15A 1WTQA 4EFBA 1QILA 4EEQA 3U4VA 2SOBA 2R7FA 3NELA 1JLLB 3PO3H 2V4RA 3CD6A 1NCVA 2QILA 1B2TA 2CW0C 1WCMA 3HKZG 4UCVA 3GTPB 1SE3A 2YS6A 4DL2A 4O42A 4PG3A 5BN4A 2CQOA 3KBXA 3BYTB 2AGQA 1X56A 2B29A 4DV4Q 1E2VA 4Y7NH 3LP8A 1IBLL 4KLKA 3OTOQ 3K7AB 2ZM6Q 1CKNA 4YY3H 3RUZA 3S1NB 1K8MA 3GTOA 3GTGH 3KAKA 1F9RA 2F1MA 2B2YC 1I50H 5C3EG 3FHWA 5C44H 5ELOA 2CH4W 2C2DA 4JI1H 3H4BA 4C3HH 1TWFH 4KY5A 1G51A 5ELCA 4C5AA 2BA1A 1KJ9A 2XTIA 4QCLA 3F8NA 4KKSA 5L37A 2J0TD 1STNA 4HTHA 4PZ6A 3RGXA 4OGQC 2B2TA 2D62A 5CBAE 3K58A 1RK6A 3ZJYC 3PR4A 5KFEA 3D6WA 4C1NK 5ELEA 3PF4A 3R2TA 4KJNA 4IWXA 1PHJA 1L0XB 2FMMA 3G6EA 2FE3A 2FB9A 3T1YH 4KHVA 2BQRA 1X3PA 4R1JA 3J7AV 1PFMA 5DG9A 2CQYA 3P7JA 5C4JB 1SYDA 2FXQA 2K7VA 3RZDH 2NVYH 4KN7C 3LWEA 1JWUD 5JVLA 2W9CA 3RNUA 4J8QA 2XC9A 2MFIA 2B63B 3JSLA 4KI0A 4HSVA 1UNNC 2UXBQ 1Q86C 3CP0A 1V9PA 1TAEA 1V43A 3X3MA 2NVQH 1RCVD 5EAYA 5M3FH 3PO2G 4RB3C 5LMNW 3I4OA 3UE1A 1YNND 2ZJTA 3J80W 3S1RH 4LF7Q 4G57A 2E2HB 2L12A 1RHPA 5D1OB 1DXMA 4MA0A 4UP8A 3MR2A 2KEDA 4O3NA 2AQ4A 1IL8A 1S3OA 1V1PA 5JAVA 4YY3L 5IT9c 2B2VA 4X66H 4RU9A 1Q8KA 4MTDA 1FGUA 1UC9A 4FYDA 2AWNA 3P20A 4RNOA 3NQIA 5DG8A 1TWGH 3ICEA 4AYBA 4RNMA 1PRTD 3DM1A 4BBRH 1S9FA 4QWDA 1II3A 3KDFB 4J9LA 4A3GG 1S68A 1MGSA 1BCPC 3HFZB 4NP5A 3KALA 4JK1C 5IWAQ 4GN4B 3MWEA 2Q2HA 2CFMA 1TKWB 2UXDQ 4HNTA 3EN2A 4EQPA 4YR3A 1XYIA 3SK6A 3HOUB 1VQLA 1NMFA 5C0XJ 4JV5Q 5FLXW 3M7GA 4DR7H 3R2IA 2IBKA 1N36Q 2PVPA 2K75A 2F0GA 3AB9A 4B08A 4PNYA 5IODA 2E2JH 2YV5A 2A1AA 3J7A5 3A55A 2W70A 3NPPA 1KEEA 4O4LF 4C3IB 1DZ1A 2R93A 3PO3G 1MIUA 1BJTA 1ZYRD 2XIWA 4RG1A 2Q2TA 4IZ8A 4HMJA 3HOZG 1L2ZA 4TUYF 1EQVA 1F77A 3S14B 4GZYC 4RB2C 3EPIA 3LGJA 4PV1C 3OTOH 1HPCA 2HD3A 3BVMA 2B8FA 4LSAA 3GTOH 1KNEA 1M8AA 2K5WA 1XPUA 2UXCQ 4M8AA 4DAPA 1EY7A 1FGBD 3PQIA 4DPGA 4DAMA 3JAME 3FP9A 5JOBA 2IT1A 3A8KE 2K1BA 4X66L 4LSXA 3L4KA 2EYPA 2OEOA 5C44G 4K0KQ 5M3MB 1FNUA 2PQAB 1VQ9A 2FPIB 3KK7A 4C3HG 1J5EQ 3BAAA 1LTAD 1HRJA 1KD1C 4DV7L 1YNJC 2KJXA 1PH9A 2J6UA 3J7AK 2AGPA 3GLKA 1T9HA 5JPMC 2R7LA 1IXRA 4ECSA 2FFKB 3WOEA 4I7ZC 5LA6F 3I4NH 1U9RA 3KBGA 3J7YW 2KENA 1KLGD 1EYDA 3RLNA 3KHHA 2C2EA 4R4IA 1Z2NX 4DV5Q 1KNAA 2FJ2A 3RV4A 2FKLA 2IJ0A 1SJED 1SEIA 4I50F 2CWPA 3UI2A 1STGA 1VQHA 4IPHA 4ETSA 4C5CA 4K5XA 3S2HB 4B9WA 2R3ZA 2SNMA 2UXBH 4HQ6A 4LFCQ 2ZTCA 1BNCA 2EDGA 4WD3A 3UFXB 3A74A 2B63A 3RBEA 1JDBB 1EEID 1D5MC 3PV0A 3HKZB 4R4QA 4A3CH 4YJ2F 1C4QA 3FEWX 3GTQB 5M3FG 4NXNQ 3Q8RB 1SFOA 4FP5D 3CQZA 2RSNA 2O03A 1EQTA 4XYLB 4ECRA 4Q0YA 1CK1A 1OWTA 4A75A 3HBLA 3H40A 3OTOL 2QYZA 3DM3A 4FU0A 3TMEA 4X6AH 4Q8FA 5EPLA 1O7LA 3IL8A 4CJ1B 3S17H 2E2HA 1Q1EA 2F3VA 5EKIA 5D1OA 3OHXC 3WWVA 4JV1A 2XWBB 1V1OA 1PH7A 3K5OA 3SEBA 1HTPA 1JXLA 4BBRG 3RLOA 3K5HA 2IHFA 2WB1B 1WD0A 4I7HA 1JMCA 1GUNA 2V59A 3KDFA 5K2MA 3QO2A 2UXDH 4Q0FA 3R5XA 1I4QA 3KLWA 3S1MH 1E0BA 4APMA 5LMNQ 3N44B 2R84A 4JV5H 4DV0Q 3KHLA 2R82A 1U4LA 2CW7A 1N36H 3BABA 1IBMQ 4DV3Q 1B6SA 4JBMA 4J9OA 3AU7A 1JOQA 4CJ2C 5JH7F 2VQEQ 3V2TA 4EX5A 5CV5A 2BH8A 2YTXA 3T5LA 3MTSA 4B3MQ 1AZPA 1E4EA 4OELB 4FBTA 2E76C 1EUJA 4JI8L 3SGIA 3GTKB 3A5ZB 4WJ4A 3HZXA 1UNSA 3MAQA 1XXGA 4NB3A 2K50A 1SEBD 1GVPA 2VUMB 3H4DA 2PW7A 1BCPD 1NR4A 5CV4A 4JUZA 2A5HA 5J2TF 2R7ZA 1X32A 4IALA 1O7IA 2CWAA 1FNVA 3K7AH 1QE6A 4Z9CB 3S1NH 3VYUA 2MNAA 1PH1A 1U4RA 1WTHA 3D6CA 1RJQA 2JEFA 4YHHQ 1EEFD 3N8DA 1CUKA 4F4YA 2NU8B 4KY6A 2B2WA 2QEXA 4IOCA 4O3SA 1SNCA 4K0KH 4DV1Q 2OCEA 4EYIB 2NTTA 1J5EH 2C22A 5M9OA 4XT3B 1HUNA 1VQ7A 3Q1KA 4M1UB 4G4KA 1EOTA 3QOJA 4LF4Q 5M5YB 3NTHA 2ZXPA 1SYXB 5ISRA 4JI5Q 1PTOC 1XMQQ 1CKOA 4J15A 1M90C 2N8NA 4A3GB 1GGOA 2JA6B 2JN4A 2F0DA 5DEHA 4TV9F 3HG9A 5A2QE 2AQ1B 1N56A 3I4NG 3U9OA 3ER0A 4IAJA 4DV5H 1IYJB 3T5HA 1B7YB 2QCPX 4C5BA 5C4JH 1N36L 4DUZQ 3NUCA 1V1QA 4YWLA 4EVOA 2UUCH 3GIMA 4KY7A 1F9QA 4I7AA 1XWEA 2UU9Q 3L3OC 2XGPA 4EBCA 2B63H 4LF8Q 4DL5A 4LFCH 1BCPF 1K28A 1HZAA 2I5HA 3H94A 3KFUA 5FD5A 5KT7A 4MV1A 5KT3A 2JEJA 4LFBQ 2R85A 3GV3A 4MHEA 1O7ZA 4NW2A 3PIPA 1LTTD 1U0LA 3CQZH 2JSOA 4XTCS 1SFOH 4LWCA 3PO3B 5DQIA 5KFPA 2HCIA 4NXNH 2IW3A 1NAPA 3ND8A 4GKKH 4HIMA 3MXNB 1TWCB 2K33A 2X6LA 3KXYT 1EZ6A 1D6EC 5KFNA 1STBA 2E2HH 4ME5A 4DAYB 3HXLA 3NWTA 5IY0A 4OIKA 1BGWA 4KKUA 1LUZA 1YJ9A 1NBWA 2MHVA 2F03A 1A9XA 4KN4C 4RAZA 3BU2A 4QIWA 5T14A 2QEJC 1XNQL 4QW8A 3GTGB 1S0NA 3CCEA 4CGYB 4C2MA 3QG1A 3G71A 1LT4D 4UP9A 5C44B 4WJWA 2WE6A 1B53A 3B6YA 5IOCA 3WDNA 4C3HB 4A3EH 1HNZQ 1RODA 1K1SA 4RCNA 1KHIA 3V4ZA 2WACA 5C4ZA 4L6TB 3Q23A 1PH5A 2WB1A 3C0FB 4ED8A 2HJWA 4ED1A 1ICFB 1R4QB 1EU3A 4A93H 4DV0H 1C48A 3E3XA 2E5LQ 4H02A 1SCUB 5ELDA 4RCOA 2MQHA 3RJ0A 4DV3H 1IBMH 1RD9D 1QUQA 4A3FH 1Z7TA 1E4GT 4LMYA 1Q90A 1Q1BA 3NQTA 2J6SA 3G6XA 2RCNA 3R8BA 1EIYB 1ET9A 2IHEA 1IBKH 5KX5F 4MN3A 1X54A 1YJNA 5KYIA 2UUCL 3A8IE 1SYCA 4AH6A 4C3IH 4N9PA 2NVYB
chains in the Genus database with same CATH topology
4GNXC 3UDXA 3PO2H 3HOVG 3CXCA 1N34Q 1Q82C 2R7ZH 1NTGA 4DR6L 2R93H 3H0GG 1Q7YC 2IY5B 4DKAC 2C35B 2KHJA 1JE5A 1WCMG 4FDBA 1E3PA 4DK3C 1LM0A 3S14H 2UUAL 4NXNL 3J80c 2OWOA 2K5NA 2GVBA 4GKKL 1VQFA 2UXBL 4IFDG 1EQQA 4DR4Q 3CMEA 1N33L 1RIPA 5M3MG 4PZ8A 1YI2A 2NN6I 1XMOL 1Q46A 2KBNA 4ME3A 2EIFA 4YCUA 4AYBE 1WOCA 5BR8L 2ATWA 3PUVA 2B3GA 1A8VA 3GDEA 3ULLA 1YZ6A 3S24A 2JEBI 3NBHB 4LF9L 1G291 4B3TL 1QVGA 1VQ6A 2Y0SE 4A3GH 1PYBA 1ASZA 1FJGQ 5FJ8H 5IYCH 1YVCA 5M5WH 2HIVA 4LF7L 3CCVA 4BBSG 2ZJRA 1SMXA 1XPOA 2K52A 5C0XG 1VQDA 1WYDA 4EQ5A 2K5VA 4JI2Q 3HOWG 4KHPL 4POFA 4HJ5A 2Z6KA 1OTCA 2OQKA 4A3IG 2K14A 3ULJA 3MEFA 1OXUA 2E2IH 5GQOA 2NZOA 3BZCA 5M5XH 3STBC 2MO0A 1ASYA 4OWWB 1Y14B 4DR7Q 4A3MG 1A63A 3U58A 1JB7A 5IWAL 3JAMc 4GKJQ 1IBML 4DV3L 4DUYQ 3U4VA 2R7FA 5H1SE 2UXDL 3NELA 4R4TA 2A8VA 3KF8B 3PO3H 3W5OA 4DR5Q 2BA0A 1VQ4A 3CD6A 3I56A 3HKZG 2Q2UA 2YYZA 3S2HH 2JE6I 1LYLA 5IP9G 5GADC 1IBKL 4A3LG 4JV5L 2B63G 3HOYH 4PG3A 2Z6KC 5IP7G 3I55A 1K83H 2MO1A 2CQOA 3UDGA 4JI3Q 1H95A 1X56A 2B29A 4IPGA 1EYGA 3H3VH 2WAQG 3A5UA 4DV4Q 1XJVA 4Y7NH 1Y1WH 1XNRQ 1PVOA 1IBLL 4POGA 1XNQQ 1EOVA 4KLKA 1SE8A 4A3CG 1K3RA 3I4MH 3OTOQ 2ZM6Q 1VQMA 4NXML 4B3SQ 1CKNA 4A3KG 2Q2IA 3J7ZC 5FLMH 2OTLA 3Q8DA 1JJCB 3F1ZA 1VQPA 3GTGH 3CCMA 1I50H 1CKNB 5C3EG 4JI4Q 4AIMA 1KXLA 1FL0A 5GAEC 3FHWA 4DR1Q 5C44H 5ELOA 4PZ7A 4C3HH 4C2MH 3CMAA 1TWFH 4L5SA 1L1OA 1SLJA 1G51A 3RLFA 2VQFL 2YU9H 1HNXL 2BA1A 2HQLA 1VQEA 2XTIA 4A3DG 1U5KA 1X9NA 4KHZA 3UDFA 2JJQA 4GN3B 3PCOB 1L1OB 4X65Q 4PZ6A 4DV2Q 3AEVA 2D62A 2UXCL 1EIFA 3ZJYC 1NMGA 1VQGA 1HR0W 3EBEA 4JI6Q 4LF4L 2V1CC 1BBUA 5IYBH 4AYBG 3PF4A 3F8TA 4A3EG 2JA5G 1PYSB 1PHJA 3G6EA 2UUCQ 1BVSA 4BY7H 2Y0SG 3M7NA 4R1JA 2VY3A 4BA2I 4K0KL 4DR2L 1YNXA 1J5EL 3F2CA 4A93G 3IRBA 4TQUS 4RMFA 3UDIA 1HZCA 1YEZA 1PH6A 1BKBA 3M9BA 2FXQA 2LSSA 4A3FG 1L1OC 2GN5A 2NVYH 3RZDH 4JG2A 4HIKA 4HJ9A 1VQOA 1QZHA 4LF6Q 3TRZA 1HH2P 4DR3L 3RNUA 2PI2A 1AE3A 2MFIA 2UUAQ 4DUZL 3HKZE 1G6PA 2ALYB 2WP8J 4KI0A 4DNIA 4A3JH 4GKKQ 2UXBQ 3I7FA 1Q86C 1Y1VG 2F4VL 3CP0A 2BH2A 1V9PA 1WJJA 1V43A 1N33Q 4DV5L 1S72A 1VS0A 1XMOQ 5EAYA 5BR8Q 5M3FH 2NVQH 3PO2G 2I0QA 3KOJA 3L0OA 3S16H 4LF5L 3OW2A 2JA9A 5LMNW 4QIWE 2VUMH 4JC0A 3I4OA 3M4QA 4L5TA 3A0JA 3UE1A 2R7ZG 2R93G 2ZJQA 5JJIA 3S1RH 4LF7Q 4X62L 4HIOA 2AKWB 3CC2A 3J80i 4UP8A 4JBJA 4LFCL 1Q12A 1MKHA 1S3OA 5C4XH 4YY3L 1PH2A 5IT9c 1N32L 4KHPQ 4NPSA 1Q8KA 4JYAL 1FGUA 2L15A 2UUBQ 1PH3A 2WB1E 2AWNA 4GLVB 3T1HQ 3G4SA 1PA6A 1NJIC 1HR0L 1TWGH 4OONA 3ICEA 4IFDJ 3CCJA 2HHHL 1VQCA 2VL6A 4BBRH 3KDFB 3CCLA 4A3GG 1A62A 1J6QA 2XGTA 3HFZB 3PUZA 4LFAL 1QVFA 5IWAQ 4GN4B 2Q2HA 2CFMA 5IYCG 5FJ8G 1TWHH 4C3JH 5M5YH 4AQYL 4BY1H 2YTVA 2ZTDA 1EWIA 2UXDQ 1K8AC 1B8AA 3E0EA 3EN2A 4GN5A 3CAMA 1PH4A 2JA6H 3M4PA 1VQLA 1NE3A 1NMFA 5C0XJ 1HNWL 3PUXA 1Z9FA 1IBKQ 1KIXA 4JV5Q 5K36G 2HT1A 3PF5A 4JOIA 3CCQA 5JEAG 2K75A 1N36Q 5ELNA 4B3RL 1JJ2A 1UEBA 1MJEA 3GTPH 4QY7A 4A3BH 4DV6L 1P8LA 2E2JH 4YWKA 2YV5A 1C9OA 1LTLA 2A1AA 1N9WA 1TXYA 3J7A5 4QGUA 4NXMQ 3PIOA 3S2DH 1BBWA 4X64L 3G48A 1OXVA 5LMNL 3PO3G 4A76A 4DV0L 1MIUA 2D0PA 3KJPA 4R4CA 1UWVA 2I5LX 4RG1A 1C7YA 2Q2TA 3HOYG 3HOZG 2VQEL 5DLQE 2N49A 4HJ7A 4IFDI 1D8LA 1KRSA 3LGJA 2JA7H 3H15A 4JOIC 1Y1WG 1HNXQ 3M85A 4OX9L 4B3ML 3GTOH 4L5QA 3I4MG 1S40A 1TWCH 2E8GA 3KF6A 2EQSA 1E24A 2ID0A 4P75A 2QA4A 1OXSC 1XPUA 5FLMG 2UXCQ 4WJ3M 1VQ8A 4DPGA 2CCZA 4P73A 4DAMA 4GLXA 1X55A 3FP9A 2JQOA 3AFQA 2CKZB 2YTYA 2PQAA 3KF6B 3STBD 1GM5A 3K8AA 2IT1A 1HZBA 4DR4L 4X66L 2VW9A 5C0XI 1VQAA 5C44G 3GTLH 4K0KQ 1UE6A 2PQAB 1KRTA 4DR2Q 4IO9A 1VQ9A 1J5EQ 3RN5A 3S15H 3CPFA 2F3IA 1QZGA 1KQSA 5JJKA 1KD1C 3K81C 4DV7L 4IJLA 1PH9A 4MZ9A 4HJ8A 2N3SA 2NVXH 1CSQA 5IE8A 1T9HA 4YCVA 1IXRA 1SN8A 4UP7A 3HKSA 2WB1G 4YHHL 1OXTA 3TS0A 2QGQA 4JI2L 2RHQB 5IYBG 3I4NH 2F4VQ 1UE1A 2KENA 2VZAA 4DV1L 5JJLA 3RLNA 2HIXA 5LMUQ 4OO1G 4R4IA 2LXKA 1KL9A 4JI0L 4BY7G 3J81j 4MNOA 4DV5Q 3H3VI 1SRUA 1AH9A 1X3GA 1VCIA 2R7DA 2K5HA 4LF5Q 4JI5L 1VQKA 1PV4A 2CWPA 1NY4A 3K80C 1VQHA 1XMQL 4IPHA 4GKJL 1R9TH 4X62Q 3F2BA 5AJ3L 1K0RA 2ASBA 4APVA 2NVTH 4LUVA 1K8GA 4LFCQ 2ZTCA 4YY3Q 4A3JG 3A74A 1N32Q 4DR6Q 3TEHB 3TS2A 2R6GA 4JYAQ 4QQBX 3PV0A 3VDYA 3GO5A 4R4QA 4QJFA 3TREA 1HR0Q 1XTDA 3RN2A 5M3FG 4NXNQ 1Q81C 2HHHQ 3PUYA 3J81i 5IYDH 1X65A 1YBYA 1XNRL 2VUMG 2UU9L 4OXPA 4IJHA 4A75A 4LF8L 3FKIH 3GD7A 3OTOL 4B3SL 1JJGA 3DM3A 4X6AH 3DLLA 4LFBL 3S17H 4LUOA 2VNUD 1Q1EA 4LF9Q 2JEAI 4BA1I 4B3TQ 5C4XG 4JI4L 2ZTEA 2JA8H 2IX1A 3WWVA 4DR1L 4L5RC 3ULPA 1HNWQ 1PH7A 1K73C 2R92H 1X3EA 2RF4A 1OXXK 4UY8C 3HOXH 1JT8A 3JC66 1HZ9A 2NN6G 5J3BA 4BBRG 3RLOA 4B3RQ 4JI7L 2IHFA 3CCUA 3HOUH 3CC7A 1JMCA 4QL5A 4DV6Q 3KDFA 1VQNA 4X65L 4TVAB 2AWOA 2PI2E 3KLWA 4BXXH 4BY1G 3S1MH 2GVAA 4JI6L 3KJOA 5GROA 1YIJA 5LMNQ 4JI1L 3CPWA 4DV0Q 1YITA 1SR3A 2DUDA 2JA6G 2OTJA 2F52A 1IBMQ 4DV3Q 4JBMA 1FVIA 4PMWA 2VQEQ 1HNZL 4EX5A 4OX9Q 2BH8A 2YTXA 1I94L 5JEAJ 4B3MQ 4A3BG 4LF6L 1C0AA 4GS3A 3L7ZC 1QVCA 4XIGS 4GOPA 1VQIA 3T1YL 1EUJA 1KAWA 4JI8L 3SGIA 1YJWA 2E5LL 3HOVH 3A5ZB 2AHOB 4WJ4A 3CC4A 1I3QH 3GTJH 3I2ZA 3H0GH 4O0AA 3JAMi 4NB3A 4GOPB 3K7UC 2K50A 1IBLQ 4Y52H 4YCWA 1GVPA 1VQJA 1WCMH 4X66Q 3BJUA 1X3FA 1M1KC 1WI5A 1E1OA 2KCTA 1UE7A 3D31A 1X6OA 4JBWA 1O7IA 2JA7G 2CWAA 1YHAA 3K7AH 4DV7Q 2KHIA 4IPCA 3S1NH 5M3MH 2KCMA 2MNAA 1N8RC 1TWAH 1PH1A 4BBSH 1IZ6A 1EQRA 1L2FA 3K0XA 3TQYA 3RR5A 1N34L 3OYYA 4YHHQ 1CUKA 2VQFQ 1I5FA 4GOPC 2NZHA 2QEXA 4IOCA 4YWMA 3U4ZA 1VQ5A 3PUWA 1W2BA 4DV1Q 2OCEA 2UUBL 3T1HL 2ES2A 4JI0Q 1D7QA 1VQ7A 4LF4Q 3HOWH 1EFWA 5FLXc 4JI5Q 2OQ0A 3AFPA 2LXJA 1M90C 1XMQQ 1CKOA 4J15A 1HJPA 2N8NA 1CSPA 4A3IH 4GLAC 3PGZA 1P16A 2H5XA 1DGSA 5AJ3Q 3RZOH 1I6HH 4A3MH 1XPRA 1UE5A 3L2PA 3I4NG 3D0FA 3ER0A 1FJGL 1IYJB 4LUZA 1B7YB 4DR3Q 4P74A 3HOZH 5C4JH 1N36L 4DUZQ 3E9HA 1IL2A 2RHSB 1V1QA 4P71A 4YWLA 1E1TA 3UE0A 3W1BA 1Z47A 4IOAA 2UU9Q 4P72A 4ALPA 5IP9H 1SROA 4A3LH 3BZKA 2B63H 4LF8Q 3GTQH 3E9IA 4HJAA 5IP7H 1KC8C 2I5HA 1HZAA 5HGQA 3KFUA 4UPAA 4MTNA 5HY6A 3CF5A 4DR7L 4LFBQ 1GD7A 1PH8A 1SFOH 3ERSX 1U0LA 1B70B 3CQZH 2K4KA 4XTCS 3PIPA 4LWCA 4A3CH 3W1GA 4DUYL 4A3KH 1RL2A 2A19A 4LNQA 1W3SA 1YHBA 4HIMA 3MXNB 2ZJPA 4DR5L 2Z0SA 5IYDG 3S1QH 2DGYA 1CKMA 5C3EH 4JI7Q 4OWTB 2E2HH 4DAYB 1GKHA 5IY0A 1LUZA 3FKIG 4JCVE 1YJ9A 2IX0A 1K9MC 4OWXB 2JK8A 4JI3L 1NBWA 1WFQA 4DV4L 3BU2A 4JI1Q 1XNQL 4A3DH 3AQQA 1E7ZA 4LFAQ 4HIDA 2JA8G 3CCEA 5E7NA 2ZM6L 2WFWA 3G71A 4AQYQ 4UP9A 2R92G 3NENA 1GO3E 3HOXG 3B6YA 3M4OH 1A0IA 2PNHA 4IPDA 3CCSA 4A3EH 3U50C 1HNZQ 3KYHC 2JA5H 3HOUG 1L0WA 4GNXA 1KHIA 2I5MX 4OO1I 1I94Q 5GAGC 1PH5A 3NEMA 3F2DA 3EIVA 3T1YQ 4JI8Q 4GNXB 4A93H 4BXXG 2D0OA 2E5LQ 4H02A 1VQBA 1YHQA 2MQHA 3CW2C 4A3FH 1QUQA 3GTMH 3M3YH 1MJCA 1PFSA 3AYHB 4LW1A 5LMUL 4DV2L 3GTKH 1Q1BA 2WAQE 4O2DA 2EXDA 3PSIA 2RCNA 1QUQB 4X64Q 2AMCB 1EIYB 4JBKA 1AE2A 4A4IA 2IHEA 2PMZE 4R4OA 2VS1A 1Y1VH 3J81c 1E22A 1X54A 2N78A 3CCRA 4DK6C 5GAHC 1YJNA 2UUCL 4AH6A 4C3IH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNX C;  3UDX A;  3PO2 H;  3HOV G;  3CXC A;  1N34 Q;  1Q82 C;  2R7Z H;  1NTG A;  4DR6 L;  2R93 H;  3H0G G;  1Q7Y C;  2IY5 B;  4DKA C;  2C35 B;  2KHJ A;  1JE5 A;  1WCM G;  4FDB A;  1E3P A;  4DK3 C;  1LM0 A;  3S14 H;  2UUA L;  4NXN L;  3J80 c;  2OWO A;  2K5N A;  2GVB A;  4GKK L;  1VQF A;  2UXB L;  4IFD G;  1EQQ A;  4DR4 Q;  3CME A;  1N33 L;  1RIP A;  5M3M G;  4PZ8 A;  1YI2 A;  2NN6 I;  1XMO L;  1Q46 A;  2KBN A;  4ME3 A;  2EIF A;  4YCU A;  4AYB E;  1WOC A;  5BR8 L;  2ATW A;  3PUV A;  2B3G A;  1A8V A;  3GDE A;  3ULL A;  1YZ6 A;  3S24 A;  2JEB I;  3NBH B;  4LF9 L;  1G29 1;  4B3T L;  1QVG A;  1VQ6 A;  2Y0S E;  4A3G H;  1PYB A;  1ASZ A;  1FJG Q;  5FJ8 H;  5IYC H;  1YVC A;  5M5W H;  2HIV A;  4LF7 L;  3CCV A;  4BBS G;  2ZJR A;  1SMX A;  1XPO A;  2K52 A;  5C0X G;  1VQD A;  1WYD A;  4EQ5 A;  2K5V A;  4JI2 Q;  3HOW G;  4KHP L;  4POF A;  4HJ5 A;  2Z6K A;  1OTC A;  2OQK A;  4A3I G;  2K14 A;  3ULJ A;  3MEF A;  1OXU A;  2E2I H;  5GQO A;  2NZO A;  3BZC A;  5M5X H;  3STB C;  2MO0 A;  1ASY A;  4OWW B;  1Y14 B;  4DR7 Q;  4A3M G;  1A63 A;  3U58 A;  1JB7 A;  5IWA L;  3JAM c;  4GKJ Q;  1IBM L;  4DV3 L;  4DUY Q;  3U4V A;  2R7F A;  5H1S E;  2UXD L;  3NEL A;  4R4T A;  2A8V A;  3KF8 B;  3PO3 H;  3W5O A;  4DR5 Q;  2BA0 A;  1VQ4 A;  3CD6 A;  3I56 A;  3HKZ G;  2Q2U A;  2YYZ A;  3S2H H;  2JE6 I;  1LYL A;  5IP9 G;  5GAD C;  1IBK L;  4A3L G;  4JV5 L;  2B63 G;  3HOY H;  4PG3 A;  2Z6K C;  5IP7 G;  3I55 A;  1K83 H;  2MO1 A;  2CQO A;  3UDG A;  4JI3 Q;  1H95 A;  1X56 A;  2B29 A;  4IPG A;  1EYG A;  3H3V H;  2WAQ G;  3A5U A;  4DV4 Q;  1XJV A;  4Y7N H;  1Y1W H;  1XNR Q;  1PVO A;  1IBL L;  4POG A;  1XNQ Q;  1EOV A;  4KLK A;  1SE8 A;  4A3C G;  1K3R A;  3I4M H;  3OTO Q;  2ZM6 Q;  1VQM A;  4NXM L;  4B3S Q;  1CKN A;  4A3K G;  2Q2I A;  3J7Z C;  5FLM H;  2OTL A;  3Q8D A;  1JJC B;  3F1Z A;  1VQP A;  3GTG H;  3CCM A;  1I50 H;  1CKN B;  5C3E G;  4JI4 Q;  4AIM A;  1KXL A;  1FL0 A;  5GAE C;  3FHW A;  4DR1 Q;  5C44 H;  5ELO A;  4PZ7 A;  4C3H H;  4C2M H;  3CMA A;  1TWF H;  4L5S A;  1L1O A;  1SLJ A;  1G51 A;  3RLF A;  2VQF L;  2YU9 H;  1HNX L;  2BA1 A;  2HQL A;  1VQE A;  2XTI A;  4A3D G;  1U5K A;  1X9N A;  4KHZ A;  3UDF A;  2JJQ A;  4GN3 B;  3PCO B;  1L1O B;  4X65 Q;  4PZ6 A;  4DV2 Q;  3AEV A;  2D62 A;  2UXC L;  1EIF A;  3ZJY C;  1NMG A;  1VQG A;  1HR0 W;  3EBE A;  4JI6 Q;  4LF4 L;  2V1C C;  1BBU A;  5IYB H;  4AYB G;  3PF4 A;  3F8T A;  4A3E G;  2JA5 G;  1PYS B;  1PHJ A;  3G6E A;  2UUC Q;  1BVS A;  4BY7 H;  2Y0S G;  3M7N A;  4R1J A;  2VY3 A;  4BA2 I;  4K0K L;  4DR2 L;  1YNX A;  1J5E L;  3F2C A;  4A93 G;  3IRB A;  4TQU S;  4RMF A;  3UDI A;  1HZC A;  1YEZ A;  1PH6 A;  1BKB A;  3M9B A;  2FXQ A;  2LSS A;  4A3F G;  1L1O C;  2GN5 A;  2NVY H;  3RZD H;  4JG2 A;  4HIK A;  4HJ9 A;  1VQO A;  1QZH A;  4LF6 Q;  3TRZ A;  1HH2 P;  4DR3 L;  3RNU A;  2PI2 A;  1AE3 A;  2MFI A;  2UUA Q;  4DUZ L;  3HKZ E;  1G6P A;  2ALY B;  2WP8 J;  4KI0 A;  4DNI A;  4A3J H;  4GKK Q;  2UXB Q;  3I7F A;  1Q86 C;  1Y1V G;  2F4V L;  3CP0 A;  2BH2 A;  1V9P A;  1WJJ A;  1V43 A;  1N33 Q;  4DV5 L;  1S72 A;  1VS0 A;  1XMO Q;  5EAY A;  5BR8 Q;  5M3F H;  2NVQ H;  3PO2 G;  2I0Q A;  3KOJ A;  3L0O A;  3S16 H;  4LF5 L;  3OW2 A;  2JA9 A;  5LMN W;  4QIW E;  2VUM H;  4JC0 A;  3I4O A;  3M4Q A;  4L5T A;  3A0J A;  3UE1 A;  2R7Z G;  2R93 G;  2ZJQ A;  5JJI A;  3S1R H;  4LF7 Q;  4X62 L;  4HIO A;  2AKW B;  3CC2 A;  3J80 i;  4UP8 A;  4JBJ A;  4LFC L;  1Q12 A;  1MKH A;  1S3O A;  5C4X H;  4YY3 L;  1PH2 A;  5IT9 c;  1N32 L;  4KHP Q;  4NPS A;  1Q8K A;  4JYA L;  1FGU A;  2L15 A;  2UUB Q;  1PH3 A;  2WB1 E;  2AWN A;  4GLV B;  3T1H Q;  3G4S A;  1PA6 A;  1NJI C;  1HR0 L;  1TWG H;  4OON A;  3ICE A;  4IFD J;  3CCJ A;  2HHH L;  1VQC A;  2VL6 A;  4BBR H;  3KDF B;  3CCL A;  4A3G G;  1A62 A;  1J6Q A;  2XGT A;  3HFZ B;  3PUZ A;  4LFA L;  1QVF A;  5IWA Q;  4GN4 B;  2Q2H A;  2CFM A;  5IYC G;  5FJ8 G;  1TWH H;  4C3J H;  5M5Y H;  4AQY L;  4BY1 H;  2YTV A;  2ZTD A;  1EWI A;  2UXD Q;  1K8A C;  1B8A A;  3E0E A;  3EN2 A;  4GN5 A;  3CAM A;  1PH4 A;  2JA6 H;  3M4P A;  1VQL A;  1NE3 A;  1NMF A;  5C0X J;  1HNW L;  3PUX A;  1Z9F A;  1IBK Q;  1KIX A;  4JV5 Q;  5K36 G;  2HT1 A;  3PF5 A;  4JOI A;  3CCQ A;  5JEA G;  2K75 A;  1N36 Q;  5ELN A;  4B3R L;  1JJ2 A;  1UEB A;  1MJE A;  3GTP H;  4QY7 A;  4A3B H;  4DV6 L;  1P8L A;  2E2J H;  4YWK A;  2YV5 A;  1C9O A;  1LTL A;  2A1A A;  1N9W A;  1TXY A;  3J7A 5;  4QGU A;  4NXM Q;  3PIO A;  3S2D H;  1BBW A;  4X64 L;  3G48 A;  1OXV A;  5LMN L;  3PO3 G;  4A76 A;  4DV0 L;  1MIU A;  2D0P A;  3KJP A;  4R4C A;  1UWV A;  2I5L X;  4RG1 A;  1C7Y A;  2Q2T A;  3HOY G;  3HOZ G;  2VQE L;  5DLQ E;  2N49 A;  4HJ7 A;  4IFD I;  1D8L A;  1KRS A;  3LGJ A;  2JA7 H;  3H15 A;  4JOI C;  1Y1W G;  1HNX Q;  3M85 A;  4OX9 L;  4B3M L;  3GTO H;  4L5Q A;  3I4M G;  1S40 A;  1TWC H;  2E8G A;  3KF6 A;  2EQS A;  1E24 A;  2ID0 A;  4P75 A;  2QA4 A;  1OXS C;  1XPU A;  5FLM G;  2UXC Q;  4WJ3 M;  1VQ8 A;  4DPG A;  2CCZ A;  4P73 A;  4DAM A;  4GLX A;  1X55 A;  3FP9 A;  2JQO A;  3AFQ A;  2CKZ B;  2YTY A;  2PQA A;  3KF6 B;  3STB D;  1GM5 A;  3K8A A;  2IT1 A;  1HZB A;  4DR4 L;  4X66 L;  2VW9 A;  5C0X I;  1VQA A;  5C44 G;  3GTL H;  4K0K Q;  1UE6 A;  2PQA B;  1KRT A;  4DR2 Q;  4IO9 A;  1VQ9 A;  1J5E Q;  3RN5 A;  3S15 H;  3CPF A;  2F3I A;  1QZG A;  1KQS A;  5JJK A;  1KD1 C;  3K81 C;  4DV7 L;  4IJL A;  1PH9 A;  4MZ9 A;  4HJ8 A;  2N3S A;  2NVX H;  1CSQ A;  5IE8 A;  1T9H A;  4YCV A;  1IXR A;  1SN8 A;  4UP7 A;  3HKS A;  2WB1 G;  4YHH L;  1OXT A;  3TS0 A;  2QGQ A;  4JI2 L;  2RHQ B;  5IYB G;  3I4N H;  2F4V Q;  1UE1 A;  2KEN A;  2VZA A;  4DV1 L;  5JJL A;  3RLN A;  2HIX A;  5LMU Q;  4OO1 G;  4R4I A;  2LXK A;  1KL9 A;  4JI0 L;  4BY7 G;  3J81 j;  4MNO A;  4DV5 Q;  3H3V I;  1SRU A;  1AH9 A;  1X3G A;  1VCI A;  2R7D A;  2K5H A;  4LF5 Q;  4JI5 L;  1VQK A;  1PV4 A;  2CWP A;  1NY4 A;  3K80 C;  1VQH A;  1XMQ L;  4IPH A;  4GKJ L;  1R9T H;  4X62 Q;  3F2B A;  5AJ3 L;  1K0R A;  2ASB A;  4APV A;  2NVT H;  4LUV A;  1K8G A;  4LFC Q;  2ZTC A;  4YY3 Q;  4A3J G;  3A74 A;  1N32 Q;  4DR6 Q;  3TEH B;  3TS2 A;  2R6G A;  4JYA Q;  4QQB X;  3PV0 A;  3VDY A;  3GO5 A;  4R4Q A;  4QJF A;  3TRE A;  1HR0 Q;  1XTD A;  3RN2 A;  5M3F G;  4NXN Q;  1Q81 C;  2HHH Q;  3PUY A;  3J81 i;  5IYD H;  1X65 A;  1YBY A;  1XNR L;  2VUM G;  2UU9 L;  4OXP A;  4IJH A;  4A75 A;  4LF8 L;  3FKI H;  3GD7 A;  3OTO L;  4B3S L;  1JJG A;  3DM3 A;  4X6A H;  3DLL A;  4LFB L;  3S17 H;  4LUO A;  2VNU D;  1Q1E A;  4LF9 Q;  2JEA I;  4BA1 I;  4B3T Q;  5C4X G;  4JI4 L;  2ZTE A;  2JA8 H;  2IX1 A;  3WWV A;  4DR1 L;  4L5R C;  3ULP A;  1HNW Q;  1PH7 A;  1K73 C;  2R92 H;  1X3E A;  2RF4 A;  1OXX K;  4UY8 C;  3HOX H;  1JT8 A;  3JC6 6;  1HZ9 A;  2NN6 G;  5J3B A;  4BBR G;  3RLO A;  4B3R Q;  4JI7 L;  2IHF A;  3CCU A;  3HOU H;  3CC7 A;  1JMC A;  4QL5 A;  4DV6 Q;  3KDF A;  1VQN A;  4X65 L;  4TVA B;  2AWO A;  2PI2 E;  3KLW A;  4BXX H;  4BY1 G;  3S1M H;  2GVA A;  4JI6 L;  3KJO A;  5GRO A;  1YIJ A;  5LMN Q;  4JI1 L;  3CPW A;  4DV0 Q;  1YIT A;  1SR3 A;  2DUD A;  2JA6 G;  2OTJ A;  2F52 A;  1IBM Q;  4DV3 Q;  4JBM A;  1FVI A;  4PMW A;  2VQE Q;  1HNZ L;  4EX5 A;  4OX9 Q;  2BH8 A;  2YTX A;  1I94 L;  5JEA J;  4B3M Q;  4A3B G;  4LF6 L;  1C0A A;  4GS3 A;  3L7Z C;  1QVC A;  4XIG S;  4GOP A;  1VQI A;  3T1Y L;  1EUJ A;  1KAW A;  4JI8 L;  3SGI A;  1YJW A;  2E5L L;  3HOV H;  3A5Z B;  2AHO B;  4WJ4 A;  3CC4 A;  1I3Q H;  3GTJ H;  3I2Z A;  3H0G H;  4O0A A;  3JAM i;  4NB3 A;  4GOP B;  3K7U C;  2K50 A;  1IBL Q;  4Y52 H;  4YCW A;  1GVP A;  1VQJ A;  1WCM H;  4X66 Q;  3BJU A;  1X3F A;  1M1K C;  1WI5 A;  1E1O A;  2KCT A;  1UE7 A;  3D31 A;  1X6O A;  4JBW A;  1O7I A;  2JA7 G;  2CWA A;  1YHA A;  3K7A H;  4DV7 Q;  2KHI A;  4IPC A;  3S1N H;  5M3M H;  2KCM A;  2MNA A;  1N8R C;  1TWA H;  1PH1 A;  4BBS H;  1IZ6 A;  1EQR A;  1L2F A;  3K0X A;  3TQY A;  3RR5 A;  1N34 L;  3OYY A;  4YHH Q;  1CUK A;  2VQF Q;  1I5F A;  4GOP C;  2NZH A;  2QEX A;  4IOC A;  4YWM A;  3U4Z A;  1VQ5 A;  3PUW A;  1W2B A;  4DV1 Q;  2OCE A;  2UUB L;  3T1H L;  2ES2 A;  4JI0 Q;  1D7Q A;  1VQ7 A;  4LF4 Q;  3HOW H;  1EFW A;  5FLX c;  4JI5 Q;  2OQ0 A;  3AFP A;  2LXJ A;  1M90 C;  1XMQ Q;  1CKO A;  4J15 A;  1HJP A;  2N8N A;  1CSP A;  4A3I H;  4GLA C;  3PGZ A;  1P16 A;  2H5X A;  1DGS A;  5AJ3 Q;  3RZO H;  1I6H H;  4A3M H;  1XPR A;  1UE5 A;  3L2P A;  3I4N G;  3D0F A;  3ER0 A;  1FJG L;  1IYJ B;  4LUZ A;  1B7Y B;  4DR3 Q;  4P74 A;  3HOZ H;  5C4J H;  1N36 L;  4DUZ Q;  3E9H A;  1IL2 A;  2RHS B;  1V1Q A;  4P71 A;  4YWL A;  1E1T A;  3UE0 A;  3W1B A;  1Z47 A;  4IOA A;  2UU9 Q;  4P72 A;  4ALP A;  5IP9 H;  1SRO A;  4A3L H;  3BZK A;  2B63 H;  4LF8 Q;  3GTQ H;  3E9I A;  4HJA A;  5IP7 H;  1KC8 C;  2I5H A;  1HZA A;  5HGQ A;  3KFU A;  4UPA A;  4MTN A;  5HY6 A;  3CF5 A;  4DR7 L;  4LFB Q;  1GD7 A;  1PH8 A;  1SFO H;  3ERS X;  1U0L A;  1B70 B;  3CQZ H;  2K4K A;  4XTC S;  3PIP A;  4LWC A;  4A3C H;  3W1G A;  4DUY L;  4A3K H;  1RL2 A;  2A19 A;  4LNQ A;  1W3S A;  1YHB A;  4HIM A;  3MXN B;  2ZJP A;  4DR5 L;  2Z0S A;  5IYD G;  3S1Q H;  2DGY A;  1CKM A;  5C3E H;  4JI7 Q;  4OWT B;  2E2H H;  4DAY B;  1GKH A;  5IY0 A;  1LUZ A;  3FKI G;  4JCV E;  1YJ9 A;  2IX0 A;  1K9M C;  4OWX B;  2JK8 A;  4JI3 L;  1NBW A;  1WFQ A;  4DV4 L;  3BU2 A;  4JI1 Q;  1XNQ L;  4A3D H;  3AQQ A;  1E7Z A;  4LFA Q;  4HID A;  2JA8 G;  3CCE A;  5E7N A;  2ZM6 L;  2WFW A;  3G71 A;  4AQY Q;  4UP9 A;  2R92 G;  3NEN A;  1GO3 E;  3HOX G;  3B6Y A;  3M4O H;  1A0I A;  2PNH A;  4IPD A;  3CCS A;  4A3E H;  3U50 C;  1HNZ Q;  3KYH C;  2JA5 H;  3HOU G;  1L0W A;  4GNX A;  1KHI A;  2I5M X;  4OO1 I;  1I94 Q;  5GAG C;  1PH5 A;  3NEM A;  3F2D A;  3EIV A;  3T1Y Q;  4JI8 Q;  4GNX B;  4A93 H;  4BXX G;  2D0O A;  2E5L Q;  4H02 A;  1VQB A;  1YHQ A;  2MQH A;  3CW2 C;  4A3F H;  1QUQ A;  3GTM H;  3M3Y H;  1MJC A;  1PFS A;  3AYH B;  4LW1 A;  5LMU L;  4DV2 L;  3GTK H;  1Q1B A;  2WAQ E;  4O2D A;  2EXD A;  3PSI A;  2RCN A;  1QUQ B;  4X64 Q;  2AMC B;  1EIY B;  4JBK A;  1AE2 A;  4A4I A;  2IHE A;  2PMZ E;  4R4O A;  2VS1 A;  1Y1V H;  3J81 c;  1E22 A;  1X54 A;  2N78 A;  3CCR A;  4DK6 C;  5GAH C;  1YJN A;  2UUC L;  4AH6 A;  4C3I H; 
#chains in the Genus database with same CATH topology
 1HUM A;  4FNF A;  1IW7 C;  2LS0 1;  1CE8 A;  3V05 A;  1N34 Q;  5HGT A;  2B2U C;  2R7Z H;  2Z4H A;  4NXM H;  2F0J A;  4ME6 A;  4ECQ A;  2EJM A;  1FD7 D;  2DZD A;  1LM0 A;  3S14 H;  4XT1 B;  4RNN A;  2A68 C;  3FKI B;  2VUM A;  4NXN L;  2DY8 A;  5M3F B;  2F0W A;  4MTK A;  1JC7 A;  1SNM A;  4GKK L;  4QWE A;  1FYC A;  3K5L A;  2W6O A;  2SDF A;  5FPO A;  2HVQ A;  3CME A;  1N33 L;  4JPB W;  2VUG A;  2ASJ A;  5KFB A;  1YI2 A;  2NN6 I;  2JA8 B;  1ILP A;  3PZP A;  2KBN A;  3S1R B;  1D5Z C;  1VMP A;  4O2B F;  3NBH B;  1G29 1;  1QVG A;  3HOX B;  2HQE A;  4V19 0;  1EUC B;  4ECU A;  3BVG A;  4LF4 H;  3CCV A;  1SMX A;  4JI5 H;  2K52 A;  1EWC A;  2QDL A;  2F0L A;  1LTR D;  3N43 B;  4HJ5 A;  1KDB A;  2Z6K A;  1OTC A;  4Q44 A;  2OQK A;  2UVU A;  4QUF A;  1B9N A;  4KJO A;  2WII B;  3ULJ A;  1MSH A;  3EA6 A;  4HNU A;  1SE4 A;  3SK4 A;  1VMC A;  4DUZ H;  1IBM L;  4DV3 L;  5KNB A;  4RH6 A;  3JRW A;  2UVV A;  5J2U F;  4R4T A;  2A8V A;  3GV5 B;  3KF8 B;  2BA0 A;  5HV6 A;  3S2H H;  2YYZ A;  3GTJ B;  5EWG A;  1LYL A;  1IBK L;  2B63 G;  4LFB H;  5FLX E;  1WCM B;  3MFG A;  1DOM A;  1EYG A;  3A5U A;  1HA6 A;  3NXW A;  1AZQ A;  4X62 H;  4A3C G;  1EOV A;  3E6Z X;  4LAA A;  4FXK C;  2W9B B;  1PTO D;  1QNU A;  4NXM L;  2Q2I A;  5KG7 A;  2KCN A;  1N32 H;  4IRC A;  1VQP A;  1TR5 A;  4F7X A;  1CI3 M;  3BQ1 A;  2EYF A;  1WD1 A;  3RGZ A;  2E74 C;  2BQ3 A;  1CKN B;  4JI4 Q;  2IPK D;  2V4Q A;  1RKN A;  3OWE B;  5K5P A;  1HR0 H;  2DLN A;  1B33 N;  5E1F A;  3GTO B;  5EPK A;  4DAY A;  4C2M H;  3CMA A;  1L1O A;  4J1M A;  4IN3 A;  3RLF A;  4NDX A;  2ZDG A;  2HQL A;  3DWP A;  3MR3 A;  3T16 A;  1X9N A;  4KHZ A;  3UDF A;  5EOY A;  3ORR A;  2JJQ A;  3PCO B;  1UUP A;  3C3L A;  1KAB A;  4DV2 Q;  1SNP A;  1VQG A;  4LF4 L;  3PN1 A;  5IYB H;  4DA2 A;  3VYR A;  4ZKC B;  1PX2 A;  4PQX A;  4A3E G;  1ZXT A;  3MR5 A;  4C1N I;  4K5V A;  4UCR A;  1PYS B;  5JJZ A;  5FKA C;  4OO1 H;  1ESF A;  2E5L H;  2RGR A;  4IR9 A;  3VYT A;  2VY3 A;  2F0P A;  4A93 G;  3IRB A;  4TRD A;  3UDI A;  3W2D A;  3ERO A;  1BKB A;  2DJF C;  1NSN S;  2XGQ A;  4A3F G;  1VQO A;  1QZH A;  3BA8 A;  4ECV A;  4JG2 A;  2D9U A;  5KFV A;  4R8U A;  3TRZ A;  1HH2 P;  2PI2 A;  1JOR A;  1AE3 A;  2UUA Q;  4DUZ L;  1E2W A;  3HKZ E;  1G6P A;  4QMG A;  2W9C B;  3MJF A;  2WAQ B;  4WBN F;  4EFE A;  1A2U A;  4YR2 A;  3RB3 A;  2BH2 A;  4YAJ B;  1N34 H;  1PTO F;  4C3I G;  1VF5 C;  4RAY A;  1XMO Q;  3V6H A;  5BR8 Q;  4YIJ A;  5FPR A;  2R6F A;  1SMY C;  1A6X A;  2NZ1 D;  4QIW E;  2VUM H;  2R7Z G;  1DON A;  5JJI A;  4GC6 A;  2KEE A;  4X62 L;  3L4J A;  2BE5 C;  1PMR A;  5F9L A;  5KT5 A;  1Q12 A;  2EY5 A;  2YL2 A;  1N32 L;  4YQW A;  2L15 A;  2MPM A;  1PH3 A;  2WB1 E;  2UUB Q;  2J6T A;  1V1P B;  1G91 A;  3BVZ A;  2Q8T A;  1HR0 L;  5IYZ F;  3PW5 A;  4OON A;  5KFY A;  3CCJ A;  4O3P A;  1VQC A;  2ZT9 C;  2VOB A;  3NSW A;  3S17 B;  1J6Q A;  3M4O B;  3GQC A;  4AYB B;  2R92 A;  3GIQ A;  3NBH A;  2XN9 C;  4RGN A;  4ZOL F;  5C1P A;  3A54 A;  5M5Y H;  1W6J A;  2E2D C;  2Y0S B;  1GSA A;  4DL4 A;  3PIP 3;  2O5I C;  4ODG A;  3RD4 A;  3CAM A;  2VQD A;  3GII A;  4XDX A;  2JA6 H;  4QB4 A;  5E4X A;  2Y0S A;  3GTM B;  3C1E A;  2HT1 A;  3PF5 A;  4ECY A;  4JOI A;  2FJZ A;  3RB4 A;  1QWY A;  1A2T A;  5ELN A;  4B3R L;  3S1M B;  2VA3 A;  1JJ2 A;  2A68 D;  5KFT A;  5KG6 A;  4QF4 A;  3TP5 A;  1ILQ A;  4QY7 A;  4DV6 L;  4A3B H;  3U9T A;  4YWK A;  1C9O A;  1LTL A;  1N9W A;  1TXY A;  1S5C D;  5EDW A;  1OXV A;  5KFU A;  1CA6 A;  1T3N A;  4A76 A;  4CC5 A;  3H91 A;  3KF8 A;  2MCT A;  3MVV A;  1UWV A;  2I5L X;  2L9H A;  2CVR A;  2RDI A;  2R93 B;  1DCZ A;  4ED7 A;  1MSG A;  3GTJ A;  4I4T F;  5DLQ E;  1A3T A;  4HJ7 A;  2PCF B;  1JKJ B;  2RDJ A;  1HNX Q;  3M85 A;  4OX9 L;  2ZDQ A;  5KFX A;  3NTK A;  4L5Q A;  5KG0 A;  1TWC H;  2I87 A;  2EQS A;  1E24 A;  4P75 A;  3K59 A;  4JI4 H;  3SHL A;  2CCZ A;  2W9B A;  4P73 A;  3T51 B;  1X55 A;  2VA2 A;  2JQO A;  5LL6 X;  1ZEQ X;  2CKZ B;  1GM5 A;  2F0U A;  3K8A A;  3Q0A A;  1HZB A;  5C0X I;  5L1L A;  3T5J A;  4JI7 H;  2X0S A;  4DR2 Q;  3RN5 A;  3S15 H;  2F3I A;  2MP1 A;  1B44 D;  3K81 C;  4MZ9 A;  4HJ8 A;  3FPU B;  2D5D A;  2E2I A;  3I91 A;  4K8I A;  4F50 A;  1DM0 B;  3I3C A;  3HKS A;  2WB1 G;  2YZN A;  1M7J A;  4TQR A;  3OHB A;  4GC7 A;  5IYB G;  4Q45 A;  4X3U A;  4C56 C;  2F4V Q;  4M7E A;  2WDT A;  2I46 A;  5LL6 S;  5I4D A;  4OO1 G;  1KL9 A;  4JI0 L;  4I65 A;  4G7H C;  1H9S A;  4MNO A;  3DXJ C;  1GJX A;  4YJ3 F;  4LF5 Q;  3M4I A;  1FNW A;  2CW8 A;  3T13 A;  2UUA H;  1K83 A;  2PQE A;  1I7N A;  5AJ3 L;  3Q22 A;  2NBF A;  4LUV A;  3VYS A;  3IKJ A;  3TEH B;  2R6G A;  4JYA Q;  1HTL D;  5AFW A;  5CC4 A;  4MAM A;  5BR8 H;  1XMO H;  1RJP A;  3J81 W;  2WAQ A;  5JVD F;  4QJF A;  3RN2 A;  4O4I F;  1Q81 C;  2JEG A;  1T5E A;  2HHH Q;  3T4A C;  2Q8R E;  5I6Y A;  2XCA A;  2BR0 A;  2VUM G;  5T1G A;  1SAP A;  1Z6H A;  4OXP A;  1AUV A;  4MTE A;  3CRK C;  1SFO B;  3FKI H;  3CQZ B;  3GD7 A;  4KD3 A;  4XYO A;  4CKB A;  3P75 A;  1J8I A;  4XYQ A;  1PRT B;  3BZD B;  3I72 A;  2FK3 A;  4RUC A;  4LUO A;  2VNU D;  2UUB H;  1GYF A;  2C5C A;  4JI4 L;  2AU0 A;  2ZTE A;  2YU9 B;  2JA8 H;  1AFP A;  4HNV A;  1HNW Q;  3ULP A;  3GQB A;  2R92 H;  1QCB D;  5CMD A;  4R7R A;  3HOX H;  1TS5 A;  3JC6 6;  5I2Y A;  3K5I A;  4XZ3 B;  4JI7 L;  3CCU A;  1HQR D;  4FF4 A;  3GIP A;  1EY0 A;  2AQ2 B;  2VB2 X;  4EQN A;  4QL5 A;  1VQN A;  2CZG A;  2PI2 E;  2EJG C;  2JA5 A;  2UVR A;  1BXT A;  5GRO A;  4ZCK A;  4JI1 L;  2PN1 A;  2R86 A;  1NNX A;  5EGT A;  1SMY D;  1LTS D;  5FOB B;  1SR3 A;  2A73 B;  5I6W A;  1YIT A;  4G7Z C;  2RBM A;  4A3E B;  2F52 A;  2JA6 G;  2PW5 A;  1SYF A;  1PLF A;  3RF2 A;  5KFR A;  1K1Q A;  4FF2 A;  1EIG A;  3GTM A;  2A6H D;  4A93 B;  1LTB D;  2K32 A;  2EYO A;  1HA5 A;  3KTM A;  1V51 A;  5D8D A;  4A3B G;  5CV9 A;  2OF1 A;  1TII D;  4A3F B;  3L7Z C;  2J9G A;  3TBI B;  4GOP A;  3T1Y L;  4G7O C;  4J0M A;  4J6H A;  2GA4 B;  3CC4 A;  1JQY D;  1E4E B;  4ZAI A;  3GTJ H;  3VR6 A;  3I2Z A;  3JAM i;  3K7U C;  3MWM A;  3R93 A;  1WCM H;  4FO2 A;  2F0O A;  3BJU A;  1M1K C;  4KTA A;  5DQG A;  4FXD A;  2QW7 A;  1HNX H;  3D31 A;  1X6O A;  5J22 A;  3JSN A;  4JBW A;  1CQI B;  3OMC A;  1YHA A;  1RDP D;  2XRQ D;  4IFD H;  4IPC A;  4RHR A;  2XCP A;  2R7Z B;  3QIA A;  5EKL A;  1N8R C;  4DV4 H;  1O7Y A;  3TQY A;  3K0X A;  4FBU A;  3OUZ A;  3KLS A;  4IUT A;  1I4X A;  1ML0 D;  2AQ3 B;  2K5Q A;  2Z4I A;  4RHS A;  2YW2 A;  2ZM6 H;  1AW7 A;  4YWM A;  3U4Z A;  3TQ1 A;  1OO9 B;  2UUB L;  4DR2 H;  2J7Z A;  1M4V A;  4EBE A;  1EYC A;  1TWH B;  4C3J B;  1VKZ A;  5KT4 A;  3QOL A;  1LAC A;  4XQN A;  2W8L A;  1EY4 A;  4Q8E A;  1HJP A;  4A3I H;  2C9O A;  4NKL A;  2YCH A;  1HQM C;  5CGK A;  1I4G A;  3EJI A;  3RZO H;  1I6H H;  3MFH A;  5DM6 3;  2F4V H;  4RB1 A;  5FO8 B;  5LYJ F;  1J9O A;  1LAB A;  4LUZ A;  2CW0 D;  3G6V A;  2EE1 A;  4DR3 Q;  4P74 A;  3HB9 A;  3JAM L;  1IL2 A;  4P71 A;  3UE0 A;  4EBD A;  1Z47 A;  2C2R A;  4ALP A;  1DOK A;  2R8J A;  1KC7 A;  4A3L H;  3BZK A;  5JPN C;  5KFK A;  1DD2 A;  1E2Z A;  5HY6 A;  3CF5 A;  2Z8L A;  4DR7 L;  4EGJ A;  1V4Y A;  1I4P A;  2K4K A;  2NTS A;  2L55 A;  1DV1 A;  2HHH H;  4A3K H;  1RL2 A;  3SE0 A;  2R7N A;  5KG4 A;  2CH4 A;  4HAE A;  1H9M A;  1CKM A;  1C3O A;  1EY5 A;  2XWJ B;  3IFD A;  1EZ8 A;  1TVX A;  3FKI G;  2KA7 A;  3TP8 A;  2P0A A;  5IGE A;  2XSC A;  4DV4 L;  3C46 A;  4LF7 H;  3X3N A;  3HGB A;  1HNW H;  4R8I A;  4HID A;  2JA8 G;  2ZM6 L;  1ZHQ A;  4MV3 A;  5IT9 W;  2WFW A;  4AQY Q;  4QIW B;  2YU9 A;  2R92 G;  1JE4 A;  2KVM A;  2QF7 A;  4DL7 A;  3M4O H;  3HOX G;  2PNH A;  4IPD A;  3CCS A;  4C2M B;  2JA5 H;  4GNX A;  5DGA A;  1X3Q A;  1I94 Q;  1F2Z A;  3NWS A;  4PMC A;  3OIQ A;  2DIK A;  5BN3 A;  2HVR A;  5I2X A;  4RUA A;  1O75 A;  4DLK A;  4ZLT F;  5IWA H;  1VQB A;  2V4D A;  2Z6B A;  1MBY A;  4RWS C;  1YHQ A;  1WH2 A;  1QNK A;  1D1I A;  3GTM H;  2PBZ A;  1MJC A;  1PFS A;  4ZQI A;  4F4X A;  2QK4 A;  2WAQ E;  2EXD A;  2WKC A;  1BBX C;  5E3F A;  1QUQ B;  4X64 Q;  3VR4 A;  5C5L A;  1AE2 A;  4DFA A;  1WTR A;  2VS1 A;  3GP7 A;  1E22 A;  5CR3 A;  2N78 A;  1UAP A;  3UDX A;  4A2B A;  1QB5 D;  3QZ7 A;  3I8Z A;  1F9S A;  1Q82 C;  5KEE A;  1NTG A;  3BG3 A;  3I90 A;  4RKB A;  2R93 H;  3GIK A;  3PW2 A;  2C35 B;  2KHJ A;  1JE5 A;  3M4Y A;  4DNT B;  3MR6 A;  1GUG A;  1WCM G;  1E3P A;  3K0Y A;  3ZYY X;  1S03 G;  4QWA A;  4U6P A;  4UDU C;  2OWO A;  5FO7 B;  2K5N A;  3ORQ A;  2UXB L;  4CJ0 B;  1F2L A;  3SK5 A;  4YAK B;  4IFD G;  1EQQ A;  1BDO A;  1GHJ A;  3A8J E;  5COR A;  4PZ8 A;  5IGD A;  4AYB E;  4ME3 A;  2GLT A;  2ATW A;  1T5X D;  2WKD A;  3GDE A;  4ED0 A;  4TKO B;  3C2P A;  4PWQ A;  1STH A;  2F0V A;  1VQ6 A;  3FDS A;  2Y0S E;  2ASL A;  1PYB A;  2IL8 A;  3NGD A;  2UXC H;  1FJG Q;  4LF7 L;  3OIP A;  1YVC A;  2BOS A;  2HIV A;  5IYC H;  5GON F;  2HGS A;  1Q3L A;  1SND A;  3N40 P;  1ENC A;  1XPO A;  1WYD A;  2K5V A;  1GUT A;  4POF A;  1B3Q A;  3J7A F;  3Q8P B;  1TWH A;  4A3I G;  2K01 A;  3MEF A;  5JEA H;  2XD4 A;  3VMM A;  3BZC A;  4V0B A;  3CU7 A;  4OWW B;  2R8G A;  1Y14 B;  3K6O A;  1ICW A;  5CB4 F;  4DR3 H;  4IRK A;  2SNS A;  3C1F A;  5IWA L;  3JAM c;  4DUY Q;  2IP4 A;  2ENB A;  5KFI A;  2B2Y A;  2UXD L;  5EJW A;  3W5O A;  4DR5 Q;  1VQ4 A;  3DHQ A;  3MWY W;  3I56 A;  2Z1C A;  5BN5 A;  2JE6 I;  5GAD C;  4JV5 L;  1LV9 A;  3H0G B;  4A3L G;  2JXM B;  4EQO A;  4A3B B;  2R7K A;  3I55 A;  1M6V A;  2MO1 A;  3UDG A;  4JI3 Q;  1B6R A;  3PW4 A;  3HS0 C;  2WAQ G;  3MXG A;  1XNR Q;  3OOC A;  1G8Z D;  2D2C C;  4F88 A;  2P5Z X;  1CFM A;  3U9S A;  1TWA A;  1VQM A;  4B3S Q;  4A3K G;  5I9P A;  5A2Q L;  3J7Z C;  5FLM H;  2OTL A;  4L8J A;  4UAI A;  3R5H A;  4BBS B;  4JV0 A;  3CCM A;  4OIJ A;  3GIL A;  1KXL A;  1FL0 A;  1GUW A;  4XX0 B;  1SNQ A;  5GAE C;  1YNJ D;  4DR1 Q;  1TY2 A;  4RB0 A;  4PZ7 A;  3A56 A;  3EYY A;  4L5S A;  1SLJ A;  2I80 A;  5J1Z A;  5CV6 A;  2YU9 H;  1GLV A;  5IGG A;  3HOW B;  4AQY H;  3GTL A;  1VBH A;  3G7L A;  3LNN A;  2JEI A;  1L1O B;  1B4O A;  4X65 Q;  4H7B A;  2UXC L;  5KFS A;  1EIF A;  1BXR A;  1NMG A;  4FS2 A;  4JI6 Q;  5KND A;  1CHP D;  4AYB G;  4S3S A;  3F8T A;  3S15 B;  5EKK A;  2JA5 G;  1ZHS A;  1JIH A;  1BVS A;  4BY7 H;  2Y0S G;  3NBI A;  4ZUI A;  4BA2 I;  4K0K L;  1H9K A;  1YNX A;  1J5E L;  1EIH A;  5C5J A;  4RFB A;  4TQU S;  4RMF A;  3IN5 A;  1YEZ A;  3TP7 A;  4RKL A;  4IUP A;  3N6X A;  2GN5 A;  2O4X A;  3E0J A;  3TZU A;  4LF6 Q;  4X64 H;  2QKI C;  1IKL A;  2V58 A;  2K6A A;  4DR3 L;  5LMN H;  3CRL C;  1DV2 A;  2F0T A;  2B2T C;  4R8U B;  3I73 A;  4OL7 A;  4FS1 A;  3OSP A;  2PMZ A;  3I7F A;  3T53 B;  2VQE H;  1WJJ A;  3SDZ A;  3VPC A;  2DJG C;  4DV5 L;  1VS0 A;  3KUP A;  2EXZ A;  2F0S A;  2I0Q A;  4B3M H;  3L0O A;  4Q5V A;  1EL0 A;  1BNZ A;  2HDM A;  3R23 A;  3M4Q A;  1K8O A;  3A0J A;  5I47 A;  2R93 G;  5DGB A;  1G2T A;  4DNR B;  2KHS A;  2AKW B;  3ETJ A;  3QJY A;  4RGO S;  3J80 i;  4LFC L;  2R61 A;  2L0C A;  3FPP A;  4KHP Q;  4NPS A;  1BF4 A;  1SDF A;  4ZI7 F;  4GLV B;  4A3D B;  3VR3 A;  2B8G A;  3D4W A;  1PA6 A;  1NJI C;  1GSH A;  2DN8 A;  4IFD J;  3TQT A;  2NU6 B;  1KAA A;  5IGC A;  1I6V C;  3DEO A;  3CCL A;  2ASD A;  1A62 A;  2CHB D;  3PUZ A;  3HEJ A;  1QVF A;  4YHH H;  5IYC G;  4DXG A;  1U4P A;  1TWH H;  4C3J H;  4AQY L;  4RA8 A;  5C6A A;  4UCS A;  2ZTD A;  1EWI A;  2TMP A;  2R92 B;  1B8A A;  1O80 A;  3TZD A;  5CBE E;  3E0E A;  4MV6 A;  4DV1 H;  1A3U A;  1WTV A;  4DXF A;  1PH4 A;  5EQ0 A;  3M4P A;  5DLF A;  1GOZ A;  1Z9F A;  2B2V C;  2F0E A;  4CKC A;  1IYV A;  2G5D A;  3J80 E;  3KAJ A;  2YRW A;  5JEA G;  3JAM W;  1XMQ H;  3A7L A;  1UEB A;  1MJE A;  4DUY H;  4ECW A;  4A2A A;  2ALZ A;  1Y1V B;  2AUJ D;  2MUY A;  4DR5 H;  3S2D H;  2RSO A;  4X64 L;  3G48 A;  1JIC A;  5LMN L;  3ERQ A;  4IHJ F;  3V6K A;  1EYA A;  4ED3 A;  2PO4 A;  4DV0 L;  2D0P A;  3KJP A;  3J80 L;  3BG5 A;  1JWM D;  2ZXR A;  1F2Y A;  1LT5 D;  1C7Y A;  1I3Q A;  1H9R A;  1XNR H;  1G6Z A;  2VQE L;  2UU9 H;  3H0G A;  2N49 A;  1D8L A;  3TIN A;  2W71 A;  4LF8 H;  3H15 A;  2OXP A;  3R5F A;  4B3S H;  4B3M L;  5HUR A;  2EVB A;  1S40 A;  5KG3 A;  3KF6 A;  1BUV T;  2ID0 A;  3EFX D;  4J9R A;  3D4D A;  5FLM G;  1Q8I A;  3M9O B;  5KFZ A;  3RAQ A;  4DR1 H;  5D14 A;  3EQL C;  2YTY A;  2W6M A;  2A74 C;  1EHI A;  2LFN A;  3GTL H;  1UE6 A;  4K6L A;  2G9H D;  1EFI D;  1QZG A;  1EZ1 A;  4X65 H;  2ICI A;  3SVM A;  5FLX L;  5IE8 A;  5CV7 A;  4JI6 H;  4YCV A;  3QB3 A;  4Y8V B;  1KJ8 A;  4YHH L;  1PZJ D;  1SBB B;  2ATL A;  1KTK A;  2E2I B;  2FMC A;  4X3K A;  2VZA A;  4DV1 L;  2RDG A;  5JJL A;  1VF7 A;  2VPS A;  4A3I B;  2HDL A;  4BY7 G;  1HNZ H;  3J81 j;  1AH9 A;  5DLG A;  3BJY A;  1VCI A;  2K5H A;  4LF6 H;  4JI5 L;  5G3L D;  4U67 3;  3RZO B;  1PV4 A;  1STE A;  1I6H B;  1XMQ L;  1H9S B;  1HHV A;  2EYL A;  5KFJ A;  2XIG A;  4EGV A;  4HCE A;  1K0R A;  3HOY B;  1K8G A;  1K83 B;  3CVZ A;  4YY3 Q;  5CA0 F;  3TS2 A;  3LWB A;  5KRU A;  3VDY A;  1Y1W B;  3GO5 A;  2SCU B;  3QR8 A;  4P2C B;  3MFY A;  3TRE A;  1XTD A;  3D8G A;  2ZDH A;  3BDL A;  1I50 A;  3MFI A;  3PUY A;  5IYD H;  2F0Q A;  4MV8 A;  4LH6 A;  5EBD A;  1XNR L;  2UU9 L;  5BMV F;  1CZG A;  4IJH A;  4RGT A;  4ZKB B;  4LF8 L;  3G6J B;  4B3S L;  2DPI A;  3HRZ C;  4A3K B;  4LFB L;  4LF9 Q;  4NMZ A;  1M0W A;  2JEA I;  4QWB A;  3NE5 B;  2K03 A;  3W3A A;  5CA1 F;  3DEP A;  1JX4 A;  3V6J A;  2K5D A;  1TS2 A;  4DR1 L;  4LK1 C;  2KQ3 A;  5TSS A;  3IFT A;  5NUC A;  4F4W A;  1X3E A;  2RF4 A;  1JT8 A;  4RZR A;  1DJR D;  1HZ9 A;  5J3B A;  1DYQ A;  2F0F A;  3VPD A;  2UVW A;  1CZW A;  3OPO A;  4X65 L;  4TVA B;  3MEH A;  3Q24 A;  2AWO A;  4E4T A;  1PRT C;  4BXX H;  4C3J G;  3EPG A;  3V96 A;  1SE2 A;  2XRS D;  4JI6 L;  3KJO A;  1SYB A;  1YIJ A;  5G3L F;  3WO0 A;  4E6I A;  2DUD A;  1R4P B;  2MJ8 A;  4FF1 A;  2FK1 A;  2JA5 B;  2FMA A;  4ULL A;  2A69 C;  1FVI A;  4PMW A;  1CTM A;  3D3R A;  5C4H A;  2WTF A;  3LWU A;  1IW7 D;  1K0S A;  1HNZ L;  5JEA J;  4HYK A;  1FR3 A;  4LF6 L;  1QVC A;  4JVZ A;  2FIN B;  1IHZ A;  4ILW A;  3NP8 A;  2E5L L;  3QWN A;  4HR7 B;  1Y1V A;  1I3Q H;  3JZI A;  5KNC A;  3H0G H;  2F4I A;  4GOP B;  3S16 B;  2YYA A;  4YCW A;  3Q8S B;  4YR0 A;  4XXE A;  1VQJ A;  2N55 A;  4X3S A;  4X66 Q;  1X3F A;  2FPG B;  2EPB A;  4IUQ A;  2IA6 A;  1B04 A;  5A2Q W;  4J9K A;  2NWG A;  2CQA A;  4CHT B;  4DV7 Q;  2KHI A;  5C4X B;  5KFO A;  2KCM A;  1TWG A;  5KG1 A;  3OSO A;  2MGS A;  4BBS H;  1L0Y B;  1IZ6 A;  1EQR A;  3RR5 A;  1N34 L;  3OYY A;  4FXG C;  3GV6 A;  2VQF Q;  2LMC B;  1I5F A;  1C8C A;  1KBL A;  2NZH A;  1W2B A;  1CM9 A;  1EY8 A;  4M9U A;  5J39 A;  4TV8 F;  2O5J C;  1KDA A;  2H1E A;  3BYY B;  1UEA B;  4BY1 B;  3HOW H;  5C5M A;  5FLX c;  1S5F D;  5D65 A;  1EUD B;  3AFP A;  2AGO A;  2LXJ A;  1D2B A;  1CSP A;  4CDC C;  4GLA C;  3TP6 A;  3PGZ A;  1P16 A;  2H5X A;  2HUG A;  1WR2 A;  4XQJ A;  2RKS A;  4MIU A;  4N8X 1;  5EBC A;  1XPR A;  3FDT A;  1ZQ7 A;  1KLU D;  4DV2 H;  3D0F A;  3DF7 A;  4ECX A;  1AP0 A;  3LML A;  2B39 A;  3VA7 A;  5KFG A;  2B2W C;  5BPH A;  1RYS A;  3HOZ H;  1Z2P X;  5C3X A;  5IGB A;  1QG7 A;  1LO5 D;  4ZUJ A;  1LTI D;  4IUV A;  3BDC A;  1E1T A;  4O3R A;  3W1B A;  1WSC A;  4DK0 A;  1CQF A;  4EG0 A;  5IP9 H;  2I07 B;  1SRO A;  4FVM A;  3E9I A;  4HJA A;  5IP7 H;  1KC8 C;  5HGQ A;  4UPA A;  4MTN A;  3FMC A;  1GD7 A;  4KV6 A;  1PH8 A;  3ERS X;  4K8J A;  1B70 B;  3G6Y A;  4BWS C;  2JA7 B;  1NR2 A;  2A19 A;  5KYL A;  1W3S A;  1Y1W A;  1YHB A;  5KGU A;  5F9N A;  5IYD G;  1MZB A;  3I70 A;  4OWT B;  4O1N A;  5ELB A;  1GKH A;  2F0M A;  1TQO A;  4JCV E;  1K9M C;  3IG0 A;  4LF9 H;  4ZQ3 A;  2JK8 A;  1K3B C;  5DNF A;  2N88 A;  4A3D H;  1Y69 U;  1E4F T;  1KDC A;  3AQQ A;  1E7Z A;  3FRP B;  4LFA Q;  3M9M B;  3BQ2 A;  2PZU A;  5KFL A;  2RA4 A;  3SK8 A;  2W6P A;  2NVX B;  1STY A;  4KD4 A;  3NEN A;  1D1K A;  1A0I A;  3I12 A;  3U50 C;  4OO1 I;  2DPJ A;  2I5M X;  4MV9 A;  4CC6 A;  1Y8N B;  5CV8 A;  3RMH A;  1QOH A;  2B2U A;  3F2D A;  4BXX G;  4JI8 Q;  4GNX B;  1W96 A;  4UFZ A;  2BQU A;  5KFQ A;  2KEC A;  5LXT F;  3CW2 C;  5DM7 3;  3MZ5 A;  3FVQ A;  3M3Y H;  1T36 A;  4LW1 A;  4DV2 L;  3URY A;  1TS3 A;  2W57 A;  1R9T B;  5ELF A;  4BY7 B;  4MA5 A;  4JBK A;  3CHB D;  4U7C A;  1IKM A;  2OT2 A;  4A4I A;  5LHY 1;  3WO1 A;  2NVT B;  4DGZ A;  1HFG A;  1Y1V H;  1B50 A;  3CCR A;  3SE7 A;  5GAH C;  3SI8 A;  5KFF A;  1ET6 A;  2W8K A;  4K2L A;  3PR5 B;  4PMB A;  4WRD A;  3AMU A;  5DG7 A;  1PFB A;  3CXC A;  2BE5 D;  1I4H A;  4HSP A;  2EYJ A;  1PTO H;  3H0G G;  4HR7 A;  1Q7Y C;  2IY5 B;  4DKA C;  3K5M A;  2YZM A;  5KG2 A;  4IUU A;  4ABN A;  3GV8 B;  4FDB A;  2TSS A;  4DK3 C;  1WTW A;  2ZXO A;  2UUA L;  1CQJ B;  4DV7 H;  2FK2 A;  2GVB A;  2R87 A;  4ED6 A;  4L1K A;  4DR4 Q;  4ZYS A;  4H0L C;  4KMU C;  5L1J A;  2VQF H;  1PYW D;  1XMO L;  1Q46 A;  5BR8 L;  5JUM A;  3KLR A;  4BBS G;  4QQB X;  2V9W A;  2A69 D;  4RGM A;  3ULL A;  4B9X A;  3N41 B;  5C1O A;  3S24 A;  4LF9 L;  2JYO A;  3KHG A;  1JOK A;  5FJ8 H;  4JV2 A;  3GIJ A;  5KIX A;  3TN2 A;  1JOO A;  2ZJR A;  3VA5 A;  1RJR A;  4IZO A;  3QZ8 A;  4JI2 Q;  3HOW G;  4NLG A;  3H6M A;  5K36 H;  2K14 A;  4J9M A;  4PDB A;  2E2I H;  2M9V A;  1ULZ A;  5M5X H;  3STB C;  2MO0 A;  1ASY A;  3HP3 A;  5F2D A;  2XNA C;  3U58 A;  4DAV A;  1EU4 A;  1JB7 A;  3SR1 A;  4GKJ Q;  3V4S A;  4IRD A;  2EJF C;  2NB0 A;  5H1S E;  2L5T A;  2X69 A;  3GTP A;  3TDQ A;  4CBV A;  3HOV B;  3QFF A;  5C3W A;  4OEM B;  1S4Z A;  3OSN A;  4EEY A;  2Q2U A;  1EY6 A;  5IP9 G;  1SYE A;  3HOY H;  4LF5 H;  2Z6K C;  4ID6 A;  5IP7 G;  1K83 H;  1LTG D;  1H95 A;  3H3V H;  1PRT F;  4IPG A;  3S2D B;  4F4Z A;  4ZHQ F;  1XJV A;  1Y1W H;  4J9S A;  1PVO A;  1XNQ Q;  4POG A;  4YBZ B;  1SE8 A;  4J9N A;  1N48 A;  1K3R A;  3I4M H;  4ZRZ A;  4DK1 A;  2JA7 A;  2C28 A;  4IUR A;  3Q8D A;  1JJC B;  3F1Z A;  4JYA H;  1TWA B;  3Q6S A;  3RBD A;  4AIM A;  2Q8I B;  2VXW A;  4DU9 A;  2FP4 B;  2VQF L;  4LFA H;  4K5W A;  3SXH A;  1HNX L;  1RJT A;  3PVX A;  1VQE A;  4A3D G;  3RIZ A;  1RTN A;  1U5K A;  1DOL A;  1HFN A;  4GN3 B;  5KFC A;  1ENA A;  3AEV A;  1JR0 D;  1HR0 W;  1GSO A;  3EBE A;  3GTL B;  2YRX A;  2V1C C;  1BBU A;  3MXP A;  3NK9 A;  2NVX A;  1Z2O X;  4A3M B;  1O78 A;  4K6D A;  4JI8 H;  2UUC Q;  2IX3 A;  2GPS A;  3M7N A;  4HN7 A;  2KUM A;  4DR2 L;  1F2M A;  5KFH A;  1UC8 A;  3F2C A;  3KLS X;  1CHQ D;  1HZC A;  3LX0 A;  1PH6 A;  3M9B A;  2DNE A;  2LSS A;  2RVL A;  1L1O C;  4HIK A;  4HJ9 A;  4TSS A;  2ICE C;  4BS9 A;  2O2L D;  1B9M A;  3TSS A;  2ALY B;  2WP8 J;  1S97 A;  4DNI A;  2DWC A;  4A3J H;  4GKK Q;  1R9T A;  1PFN A;  4K2K A;  1Y1V G;  2F4V L;  3BDO A;  4EGQ A;  5KFW A;  1GHK A;  1N33 Q;  2VB3 X;  5JVH 3;  1WVL A;  1S72 A;  1WTP A;  2PMZ B;  4IWY A;  4H44 C;  3S16 H;  3KOJ A;  2I8C A;  4LF5 L;  3OW2 A;  2JA9 A;  4JC0 A;  4F8M A;  4L5T A;  4ECT A;  2ZJQ A;  3S1Q B;  3G8C A;  5C3E B;  1BCP B;  4HIO A;  5LP6 F;  3CC2 A;  5EZY F;  4JBJ A;  1MKH A;  2L1B A;  5C4X H;  1PH2 A;  1CT1 D;  2PNR C;  4DR4 H;  1I4R A;  4JYA L;  3ETH A;  1SNO A;  5HBR B;  3N6R A;  3T1H Q;  3G4S A;  1D5X C;  3ND9 A;  5KFD A;  2W6Q A;  5IGF A;  2NN6 H;  3OMG A;  2HHH L;  2EYM A;  2VL6 A;  1HXY D;  3NTI A;  2XGT A;  4LFA L;  2YS7 A;  2HCC A;  3H09 A;  5FJ8 G;  2G9D A;  2F0K A;  1B1Z A;  4BY1 H;  4J9P A;  1ENF A;  4JI2 H;  3UQ8 A;  2E75 C;  2YTV A;  5L1I A;  1CS0 A;  4WOR A;  1K8A C;  1ZET A;  4GN5 A;  1S5E D;  4MV4 A;  1NE3 A;  1HNW L;  3PUX A;  5K36 G;  1IBK Q;  1KIX A;  3K3P A;  3IAY A;  3GV7 B;  2EY6 A;  3RAX A;  4UCO A;  4JW0 A;  4UHV A;  3CCQ A;  1BO0 A;  4LH7 A;  4GKJ H;  4EYH B;  3CKI B;  3GTP H;  2PYK A;  2RGV A;  1P8L A;  4UCT A;  1SJH D;  4QGU A;  1B3A A;  1LT3 D;  3PIO A;  4NXM Q;  1PK8 A;  1BBW A;  1TU2 B;  3PO2 B;  2BCO A;  1RTO A;  3T5K A;  3Q2O A;  1JWS D;  1TY0 A;  4R4C A;  3F2U A;  3HOY G;  5EPJ A;  2K05 A;  5A35 A;  1SSO A;  2EOT A;  2LY7 A;  1XNQ H;  4IFD I;  1A3V A;  1KRS A;  2JA7 H;  5JQW A;  4JOI C;  1Y1W G;  1I3Q B;  2DY7 A;  5IIF A;  1I7L A;  5JVG 3;  2AUK A;  3I4M G;  2E8G A;  1TA8 A;  3DUZ A;  2QA4 A;  4WJ3 M;  1OXS C;  1VQ8 A;  4GLX A;  3RTX A;  3AFQ A;  2PQA A;  3KF6 B;  3STB D;  2W7P A;  1SXT A;  4DR4 L;  2VW9 A;  4K14 A;  1VQA A;  4KK7 A;  1JCK B;  1EWH A;  1KRT A;  5M5W B;  4IO9 A;  3CPF A;  1GUO A;  1KQS A;  5JJK A;  3BQ0 A;  1TT2 A;  4IJL A;  4CKE A;  2A6E C;  2N3S A;  2NVX H;  1CSQ A;  1MD2 D;  2XVS A;  1SN8 A;  4UP7 A;  2GPW A;  2PPB C;  1G2S A;  1S0O A;  1OXT A;  3TS0 A;  1S5B D;  2QGQ A;  2RHQ B;  4JI2 L;  3E5N A;  3DWA A;  4IR1 A;  1UE1 A;  5L1K A;  2HIX A;  5LMU Q;  2LXK A;  3M9N B;  3TIG A;  3H3V I;  4R8N A;  1EY9 A;  1SRU A;  1X3G A;  1I94 H;  5COY A;  2R7D A;  3ITP A;  3P1H A;  1VQK A;  5KFM A;  3K80 C;  1NY4 A;  2FHT A;  4GKJ L;  2X6G A;  1R9T H;  4BWG B;  2W9A A;  3A7A B;  4X62 Q;  3F2B A;  2ASB A;  4APV A;  2NVT H;  4DF7 A;  1PZI D;  3HKZ A;  3HOZ B;  4QW9 A;  3I4L A;  4TQS A;  4A3J G;  1N32 Q;  1N33 H;  4DR6 Q;  3GTQ A;  2H4O A;  2J4X A;  4Y7N B;  2VR1 A;  2R8K A;  4U68 A;  1HR0 Q;  2FPP B;  3PMF A;  1BR9 A;  3PW7 A;  3J81 i;  2R7M A;  1X65 A;  5E4W C;  1YBY A;  2QDB A;  2RDH A;  1KJQ A;  5C8Y F;  1I50 B;  1JJG A;  1KJJ A;  4H13 C;  2V5A A;  2IWH A;  1GUS A;  1V8Q A;  1AN7 A;  3DLL A;  3MWD A;  1IOV A;  3H3V C;  5C4X G;  4BA1 I;  4B3T Q;  1TWF B;  3T1H H;  2WYO A;  2IX1 A;  5H80 A;  4CDE C;  4L5R C;  2L11 A;  1K73 C;  2W6Z A;  1C30 A;  2FLP A;  2OH2 A;  3DMU A;  1OXX K;  4XQQ A;  4UY8 C;  3VR5 A;  2NN6 G;  1ONL A;  3O13 A;  4WFN 3;  4B3R Q;  3HOU H;  1RYR A;  3CC7 A;  4F87 A;  4DV6 Q;  1W93 A;  4BY1 G;  2W7O A;  2GVA A;  3J81 E;  1FJG H;  2KOL A;  3CPW A;  1H9J A;  1Y8P B;  2RQX A;  2OTJ A;  3TII A;  1I6U A;  3RZD B;  3MC0 B;  5T1I A;  2OLS A;  2K04 A;  5EWF A;  4DL3 A;  5D1P A;  4OX9 Q;  1I94 L;  1LLR D;  3GTK A;  2EYH A;  1PXU A;  3J81 L;  1C0A A;  4GS3 A;  4O3Q A;  3RFC A;  4XIG S;  3M3Y B;  1VQI A;  4KKT A;  3HOV H;  1KAW A;  1YJW A;  1AUX A;  5FD6 A;  2AHO B;  2BDN A;  4MV7 A;  1XX8 A;  4RAU C;  2NVQ B;  2FLN A;  4O0A A;  1IBL Q;  4Y52 H;  2DNC A;  4Q43 A;  4O2A F;  3BS1 A;  1WI5 A;  1E1O A;  2KCT A;  3NHH A;  1UE7 A;  4LMQ D;  2RDF A;  2JA7 G;  3BA9 A;  1RF2 D;  4ECZ A;  2L4N A;  5LL6 b;  1F9P A;  2FLL A;  3RB0 A;  4JI3 H;  1PTO B;  5M3M H;  1PDQ A;  3K5N A;  2SEB D;  5DAU A;  1TWA H;  3E5S A;  1L2F A;  1STA A;  2JP1 A;  4GOP C;  1VAJ A;  1TWG B;  2HVS A;  3PW0 A;  4O3O A;  4BBR B;  1VQ5 A;  3PUW A;  1T94 A;  4IUN A;  3R3O A;  3T1H L;  2ES2 A;  4JI0 Q;  1D7Q A;  5C0X H;  2JA6 A;  1EFW A;  2OQ0 A;  2XCL A;  1Y8O B;  2NYZ D;  4XYM B;  2Z9H A;  1VDZ A;  4CDF C;  1DGS A;  5AJ3 Q;  4I55 F;  4UCU A;  5I9O A;  3VPB A;  4A3M H;  3RB6 A;  4RZQ A;  1UE5 A;  3L2P A;  3K57 A;  5LMU H;  3GID A;  2EY2 A;  3WNZ A;  2EZV A;  1FJG L;  3L9A X;  5LOV F;  1MHW C;  1PZK D;  2E2J B;  2NU9 B;  5CAE B;  1ESR A;  5BPF A;  3E9H A;  2RHS B;  1KJI A;  5DQH A;  3ONA B;  5M5X B;  4LJZ C;  4IOA A;  4P72 A;  1BOS A;  1JB3 A;  1CQV A;  1LT6 D;  3GTQ H;  5KKN B;  4ED2 A;  4DR6 H;  1SYG A;  4N8F A;  3N42 B;  4R9W A;  3MXN A;  1TWC A;  3VR2 A;  3W1G A;  4DUY L;  2A6E D;  4LNQ A;  3DWQ A;  3OWF A;  5EWE A;  1S5D D;  5KT6 A;  1WTX A;  2K28 A;  4O4H F;  1FKA H;  4DN4 M;  2ZJP A;  4DR5 L;  2Z0S A;  3S1Q H;  2DGY A;  4JI7 Q;  5C3E H;  2VPQ A;  4IQZ A;  4CDD C;  1VBG A;  1EYZ A;  2IX0 A;  3OHA A;  3GTG A;  3I4M B;  4HMI A;  3MHB A;  4OWX B;  4JI3 L;  4B3T H;  5KFA A;  1S0M A;  1WFQ A;  3WOF A;  2WV6 D;  4JI1 Q;  2PZT A;  1QJO A;  3T56 B;  3PIO 3;  1NUC A;  5D3D A;  5E7N A;  4G3I A;  1TWF A;  1U4M A;  4B3R H;  4KHP H;  5FK9 C;  2C00 A;  1GO3 E;  2F0H A;  1YNN C;  4DV6 H;  3KYH C;  3HOU G;  1L0W A;  3I4N B;  4OHJ A;  5GAG C;  2F0N A;  3NEM A;  3T1Y Q;  3EIV A;  3Q8Q B;  2D0O A;  3KHR A;  1BQQ T;  2NUA B;  3MA2 B;  4J9Q A;  4QWC A;  3AYH B;  5LMU L;  3GTK H;  4O2D A;  2F3W A;  3PSI A;  2AMC B;  2YZG A;  4OX9 H;  1JDE A;  2NVY A;  4N9T A;  2PMZ E;  4R4O A;  3J81 c;  3MXU A;  4DK6 C;  2M00 A;  4L63 B;  1TS4 A;  4GNX C;  3PO2 H;  5IT9 E;  2NUC A;  2A6H C;  1GXD C;  2WIN B;  3HOV G;  5L9X A;  1IBL H;  4FF3 A;  4HCS A;  2NU7 B;  4DR6 L;  3FKI A;  1IYU A;  4A3J B;  1XDN A;  3RUP A;  4DL6 A;  3S9W A;  5KT2 A;  2PZW A;  3FMA A;  1W6K A;  3JRX A;  3J80 c;  3RV3 A;  1AEX A;  1VQF A;  3K3V A;  4FM9 A;  1WTO A;  4QUC A;  5FO9 B;  5KG5 A;  5IT9 L;  1DIK A;  3H20 A;  1RIP A;  5M3M G;  2M05 A;  2LKV A;  2EIF A;  4YCU A;  1WOC A;  1IOW A;  3PUV A;  2B3G A;  1A8V A;  1ZYR C;  1YZ6 A;  4YB8 B;  2JEB I;  3D4R A;  5D3I B;  4B3T L;  4A3G H;  2BDO A;  3OW7 A;  1S10 A;  1ASZ A;  4JI0 H;  3EVQ A;  2F0I A;  5M5W H;  2KSW A;  2M2L A;  5CYU A;  5C0X G;  2IMW P;  1VQD A;  2EY1 A;  4EQ5 A;  1CA5 A;  1RK5 A;  2W6N A;  4KHP L;  3N52 A;  3OUU A;  2RCF A;  1HCZ A;  1MI2 A;  4ZK9 B;  1ZKO A;  1XTC D;  2R8I A;  1OXU A;  5GQO A;  2NZO A;  4HED A;  1A63 A;  2R8H A;  4DR7 Q;  4YP3 A;  4A3M G;  2KCC A;  1AN8 A;  4X3T A;  1M0T A;  1A15 A;  1WTQ A;  4EFB A;  1QIL A;  4EEQ A;  3U4V A;  2SOB A;  2R7F A;  3NEL A;  1JLL B;  3PO3 H;  2V4R A;  3CD6 A;  1NCV A;  2QIL A;  1B2T A;  2CW0 C;  1WCM A;  3HKZ G;  4UCV A;  3GTP B;  1SE3 A;  2YS6 A;  4DL2 A;  4O42 A;  4PG3 A;  5BN4 A;  2CQO A;  3KBX A;  3BYT B;  2AGQ A;  1X56 A;  2B29 A;  4DV4 Q;  1E2V A;  4Y7N H;  3LP8 A;  1IBL L;  4KLK A;  3OTO Q;  3K7A B;  2ZM6 Q;  1CKN A;  4YY3 H;  3RUZ A;  3S1N B;  1K8M A;  3GTO A;  3GTG H;  3KAK A;  1F9R A;  2F1M A;  2B2Y C;  1I50 H;  5C3E G;  3FHW A;  5C44 H;  5ELO A;  2CH4 W;  2C2D A;  4JI1 H;  3H4B A;  4C3H H;  1TWF H;  4KY5 A;  1G51 A;  5ELC A;  4C5A A;  2BA1 A;  1KJ9 A;  2XTI A;  4QCL A;  3F8N A;  4KKS A;  5L37 A;  2J0T D;  1STN A;  4HTH A;  4PZ6 A;  3RGX A;  4OGQ C;  2B2T A;  2D62 A;  5CBA E;  3K58 A;  1RK6 A;  3ZJY C;  3PR4 A;  5KFE A;  3D6W A;  4C1N K;  5ELE A;  3PF4 A;  3R2T A;  4KJN A;  4IWX A;  1PHJ A;  1L0X B;  2FMM A;  3G6E A;  2FE3 A;  2FB9 A;  3T1Y H;  4KHV A;  2BQR A;  1X3P A;  4R1J A;  3J7A V;  1PFM A;  5DG9 A;  2CQY A;  3P7J A;  5C4J B;  1SYD A;  2FXQ A;  2K7V A;  3RZD H;  2NVY H;  4KN7 C;  3LWE A;  1JWU D;  5JVL A;  2W9C A;  3RNU A;  4J8Q A;  2XC9 A;  2MFI A;  2B63 B;  3JSL A;  4KI0 A;  4HSV A;  1UNN C;  2UXB Q;  1Q86 C;  3CP0 A;  1V9P A;  1TAE A;  1V43 A;  3X3M A;  2NVQ H;  1RCV D;  5EAY A;  5M3F H;  3PO2 G;  4RB3 C;  5LMN W;  3I4O A;  3UE1 A;  1YNN D;  2ZJT A;  3J80 W;  3S1R H;  4LF7 Q;  4G57 A;  2E2H B;  2L12 A;  1RHP A;  5D1O B;  1DXM A;  4MA0 A;  4UP8 A;  3MR2 A;  2KED A;  4O3N A;  2AQ4 A;  1IL8 A;  1S3O A;  1V1P A;  5JAV A;  4YY3 L;  5IT9 c;  2B2V A;  4X66 H;  4RU9 A;  1Q8K A;  4MTD A;  1FGU A;  1UC9 A;  4FYD A;  2AWN A;  3P20 A;  4RNO A;  3NQI A;  5DG8 A;  1TWG H;  3ICE A;  4AYB A;  4RNM A;  1PRT D;  3DM1 A;  4BBR H;  1S9F A;  4QWD A;  1II3 A;  3KDF B;  4J9L A;  4A3G G;  1S68 A;  1MGS A;  1BCP C;  3HFZ B;  4NP5 A;  3KAL A;  4JK1 C;  5IWA Q;  4GN4 B;  3MWE A;  2Q2H A;  2CFM A;  1TKW B;  2UXD Q;  4HNT A;  3EN2 A;  4EQP A;  4YR3 A;  1XYI A;  3SK6 A;  3HOU B;  1VQL A;  1NMF A;  5C0X J;  4JV5 Q;  5FLX W;  3M7G A;  4DR7 H;  3R2I A;  2IBK A;  1N36 Q;  2PVP A;  2K75 A;  2F0G A;  3AB9 A;  4B08 A;  4PNY A;  5IOD A;  2E2J H;  2YV5 A;  2A1A A;  3J7A 5;  3A55 A;  2W70 A;  3NPP A;  1KEE A;  4O4L F;  4C3I B;  1DZ1 A;  2R93 A;  3PO3 G;  1MIU A;  1BJT A;  1ZYR D;  2XIW A;  4RG1 A;  2Q2T A;  4IZ8 A;  4HMJ A;  3HOZ G;  1L2Z A;  4TUY F;  1EQV A;  1F77 A;  3S14 B;  4GZY C;  4RB2 C;  3EPI A;  3LGJ A;  4PV1 C;  3OTO H;  1HPC A;  2HD3 A;  3BVM A;  2B8F A;  4LSA A;  3GTO H;  1KNE A;  1M8A A;  2K5W A;  1XPU A;  2UXC Q;  4M8A A;  4DAP A;  1EY7 A;  1FGB D;  3PQI A;  4DPG A;  4DAM A;  3JAM E;  3FP9 A;  5JOB A;  2IT1 A;  3A8K E;  2K1B A;  4X66 L;  4LSX A;  3L4K A;  2EYP A;  2OEO A;  5C44 G;  4K0K Q;  5M3M B;  1FNU A;  2PQA B;  1VQ9 A;  2FPI B;  3KK7 A;  4C3H G;  1J5E Q;  3BAA A;  1LTA D;  1HRJ A;  1KD1 C;  4DV7 L;  1YNJ C;  2KJX A;  1PH9 A;  2J6U A;  3J7A K;  2AGP A;  3GLK A;  1T9H A;  5JPM C;  2R7L A;  1IXR A;  4ECS A;  2FFK B;  3WOE A;  4I7Z C;  5LA6 F;  3I4N H;  1U9R A;  3KBG A;  3J7Y W;  2KEN A;  1KLG D;  1EYD A;  3RLN A;  3KHH A;  2C2E A;  4R4I A;  1Z2N X;  4DV5 Q;  1KNA A;  2FJ2 A;  3RV4 A;  2FKL A;  2IJ0 A;  1SJE D;  1SEI A;  4I50 F;  2CWP A;  3UI2 A;  1STG A;  1VQH A;  4IPH A;  4ETS A;  4C5C A;  4K5X A;  3S2H B;  4B9W A;  2R3Z A;  2SNM A;  2UXB H;  4HQ6 A;  4LFC Q;  2ZTC A;  1BNC A;  2EDG A;  4WD3 A;  3UFX B;  3A74 A;  2B63 A;  3RBE A;  1JDB B;  1EEI D;  1D5M C;  3PV0 A;  3HKZ B;  4R4Q A;  4A3C H;  4YJ2 F;  1C4Q A;  3FEW X;  3GTQ B;  5M3F G;  4NXN Q;  3Q8R B;  1SFO A;  4FP5 D;  3CQZ A;  2RSN A;  2O03 A;  1EQT A;  4XYL B;  4ECR A;  4Q0Y A;  1CK1 A;  1OWT A;  4A75 A;  3HBL A;  3H40 A;  3OTO L;  2QYZ A;  3DM3 A;  4FU0 A;  3TME A;  4X6A H;  4Q8F A;  5EPL A;  1O7L A;  3IL8 A;  4CJ1 B;  3S17 H;  2E2H A;  1Q1E A;  2F3V A;  5EKI A;  5D1O A;  3OHX C;  3WWV A;  4JV1 A;  2XWB B;  1V1O A;  1PH7 A;  3K5O A;  3SEB A;  1HTP A;  1JXL A;  4BBR G;  3RLO A;  3K5H A;  2IHF A;  2WB1 B;  1WD0 A;  4I7H A;  1JMC A;  1GUN A;  2V59 A;  3KDF A;  5K2M A;  3QO2 A;  2UXD H;  4Q0F A;  3R5X A;  1I4Q A;  3KLW A;  3S1M H;  1E0B A;  4APM A;  5LMN Q;  3N44 B;  2R84 A;  4JV5 H;  4DV0 Q;  3KHL A;  2R82 A;  1U4L A;  2CW7 A;  1N36 H;  3BAB A;  1IBM Q;  4DV3 Q;  1B6S A;  4JBM A;  4J9O A;  3AU7 A;  1JOQ A;  4CJ2 C;  5JH7 F;  2VQE Q;  3V2T A;  4EX5 A;  5CV5 A;  2BH8 A;  2YTX A;  3T5L A;  3MTS A;  4B3M Q;  1AZP A;  1E4E A;  4OEL B;  4FBT A;  2E76 C;  1EUJ A;  4JI8 L;  3SGI A;  3GTK B;  3A5Z B;  4WJ4 A;  3HZX A;  1UNS A;  3MAQ A;  1XXG A;  4NB3 A;  2K50 A;  1SEB D;  1GVP A;  2VUM B;  3H4D A;  2PW7 A;  1BCP D;  1NR4 A;  5CV4 A;  4JUZ A;  2A5H A;  5J2T F;  2R7Z A;  1X32 A;  4IAL A;  1O7I A;  2CWA A;  1FNV A;  3K7A H;  1QE6 A;  4Z9C B;  3S1N H;  3VYU A;  2MNA A;  1PH1 A;  1U4R A;  1WTH A;  3D6C A;  1RJQ A;  2JEF A;  4YHH Q;  1EEF D;  3N8D A;  1CUK A;  4F4Y A;  2NU8 B;  4KY6 A;  2B2W A;  2QEX A;  4IOC A;  4O3S A;  1SNC A;  4K0K H;  4DV1 Q;  2OCE A;  4EYI B;  2NTT A;  1J5E H;  2C22 A;  5M9O A;  4XT3 B;  1HUN A;  1VQ7 A;  3Q1K A;  4M1U B;  4G4K A;  1EOT A;  3QOJ A;  4LF4 Q;  5M5Y B;  3NTH A;  2ZXP A;  1SYX B;  5ISR A;  4JI5 Q;  1PTO C;  1XMQ Q;  1CKO A;  4J15 A;  1M90 C;  2N8N A;  4A3G B;  1GGO A;  2JA6 B;  2JN4 A;  2F0D A;  5DEH A;  4TV9 F;  3HG9 A;  5A2Q E;  2AQ1 B;  1N56 A;  3I4N G;  3U9O A;  3ER0 A;  4IAJ A;  4DV5 H;  1IYJ B;  3T5H A;  1B7Y B;  2QCP X;  4C5B A;  5C4J H;  1N36 L;  4DUZ Q;  3NUC A;  1V1Q A;  4YWL A;  4EVO A;  2UUC H;  3GIM A;  4KY7 A;  1F9Q A;  4I7A A;  1XWE A;  2UU9 Q;  3L3O C;  2XGP A;  4EBC A;  2B63 H;  4LF8 Q;  4DL5 A;  4LFC H;  1BCP F;  1K28 A;  1HZA A;  2I5H A;  3H94 A;  3KFU A;  5FD5 A;  5KT7 A;  4MV1 A;  5KT3 A;  2JEJ A;  4LFB Q;  2R85 A;  3GV3 A;  4MHE A;  1O7Z A;  4NW2 A;  3PIP A;  1LTT D;  1U0L A;  3CQZ H;  2JSO A;  4XTC S;  1SFO H;  4LWC A;  3PO3 B;  5DQI A;  5KFP A;  2HCI A;  4NXN H;  2IW3 A;  1NAP A;  3ND8 A;  4GKK H;  4HIM A;  3MXN B;  1TWC B;  2K33 A;  2X6L A;  3KXY T;  1EZ6 A;  1D6E C;  5KFN A;  1STB A;  2E2H H;  4ME5 A;  4DAY B;  3HXL A;  3NWT A;  5IY0 A;  4OIK A;  1BGW A;  4KKU A;  1LUZ A;  1YJ9 A;  1NBW A;  2MHV A;  2F03 A;  1A9X A;  4KN4 C;  4RAZ A;  3BU2 A;  4QIW A;  5T14 A;  2QEJ C;  1XNQ L;  4QW8 A;  3GTG B;  1S0N A;  3CCE A;  4CGY B;  4C2M A;  3QG1 A;  3G71 A;  1LT4 D;  4UP9 A;  5C44 B;  4WJW A;  2WE6 A;  1B53 A;  3B6Y A;  5IOC A;  3WDN A;  4C3H B;  4A3E H;  1HNZ Q;  1ROD A;  1K1S A;  4RCN A;  1KHI A;  3V4Z A;  2WAC A;  5C4Z A;  4L6T B;  3Q23 A;  1PH5 A;  2WB1 A;  3C0F B;  4ED8 A;  2HJW A;  4ED1 A;  1ICF B;  1R4Q B;  1EU3 A;  4A93 H;  4DV0 H;  1C48 A;  3E3X A;  2E5L Q;  4H02 A;  1SCU B;  5ELD A;  4RCO A;  2MQH A;  3RJ0 A;  4DV3 H;  1IBM H;  1RD9 D;  1QUQ A;  4A3F H;  1Z7T A;  1E4G T;  4LMY A;  1Q90 A;  1Q1B A;  3NQT A;  2J6S A;  3G6X A;  2RCN A;  3R8B A;  1EIY B;  1ET9 A;  2IHE A;  1IBK H;  5KX5 F;  4MN3 A;  1X54 A;  1YJN A;  5KYI A;  2UUC L;  3A8I E;  1SYC A;  4AH6 A;  4C3I H;  4N9P A;  2NVY B; 
#chains in the Genus database with same CATH homology
 4GNX C;  3UDX A;  3PO2 H;  3HOV G;  3CXC A;  1N34 Q;  1Q82 C;  2R7Z H;  1NTG A;  4DR6 L;  2R93 H;  3H0G G;  1Q7Y C;  2IY5 B;  4DKA C;  2C35 B;  2KHJ A;  1JE5 A;  1WCM G;  4FDB A;  1E3P A;  4DK3 C;  1LM0 A;  3S14 H;  2UUA L;  4NXN L;  3J80 c;  2OWO A;  2K5N A;  2GVB A;  4GKK L;  1VQF A;  2UXB L;  4IFD G;  1EQQ A;  4DR4 Q;  3CME A;  1N33 L;  1RIP A;  5M3M G;  4PZ8 A;  1YI2 A;  2NN6 I;  1XMO L;  1Q46 A;  2KBN A;  4ME3 A;  2EIF A;  4YCU A;  4AYB E;  1WOC A;  5BR8 L;  2ATW A;  3PUV A;  2B3G A;  1A8V A;  3GDE A;  3ULL A;  1YZ6 A;  3S24 A;  2JEB I;  3NBH B;  4LF9 L;  1G29 1;  4B3T L;  1QVG A;  1VQ6 A;  2Y0S E;  4A3G H;  1PYB A;  1ASZ A;  1FJG Q;  5FJ8 H;  5IYC H;  1YVC A;  5M5W H;  2HIV A;  4LF7 L;  3CCV A;  4BBS G;  2ZJR A;  1SMX A;  1XPO A;  2K52 A;  5C0X G;  1VQD A;  1WYD A;  4EQ5 A;  2K5V A;  4JI2 Q;  3HOW G;  4KHP L;  4POF A;  4HJ5 A;  2Z6K A;  1OTC A;  2OQK A;  4A3I G;  2K14 A;  3ULJ A;  3MEF A;  1OXU A;  2E2I H;  5GQO A;  2NZO A;  3BZC A;  5M5X H;  3STB C;  2MO0 A;  1ASY A;  4OWW B;  1Y14 B;  4DR7 Q;  4A3M G;  1A63 A;  3U58 A;  1JB7 A;  5IWA L;  3JAM c;  4GKJ Q;  1IBM L;  4DV3 L;  4DUY Q;  3U4V A;  2R7F A;  5H1S E;  2UXD L;  3NEL A;  4R4T A;  2A8V A;  3KF8 B;  3PO3 H;  3W5O A;  4DR5 Q;  2BA0 A;  1VQ4 A;  3CD6 A;  3I56 A;  3HKZ G;  2Q2U A;  2YYZ A;  3S2H H;  2JE6 I;  1LYL A;  5IP9 G;  5GAD C;  1IBK L;  4A3L G;  4JV5 L;  2B63 G;  3HOY H;  4PG3 A;  2Z6K C;  5IP7 G;  3I55 A;  1K83 H;  2MO1 A;  2CQO A;  3UDG A;  4JI3 Q;  1H95 A;  1X56 A;  2B29 A;  4IPG A;  1EYG A;  3H3V H;  2WAQ G;  3A5U A;  4DV4 Q;  1XJV A;  4Y7N H;  1Y1W H;  1XNR Q;  1PVO A;  1IBL L;  4POG A;  1XNQ Q;  1EOV A;  4KLK A;  1SE8 A;  4A3C G;  1K3R A;  3I4M H;  3OTO Q;  2ZM6 Q;  1VQM A;  4NXM L;  4B3S Q;  1CKN A;  4A3K G;  2Q2I A;  3J7Z C;  5FLM H;  2OTL A;  3Q8D A;  1JJC B;  3F1Z A;  1VQP A;  3GTG H;  3CCM A;  1I50 H;  1CKN B;  5C3E G;  4JI4 Q;  4AIM A;  1KXL A;  1FL0 A;  5GAE C;  3FHW A;  4DR1 Q;  5C44 H;  5ELO A;  4PZ7 A;  4C3H H;  4C2M H;  3CMA A;  1TWF H;  4L5S A;  1L1O A;  1SLJ A;  1G51 A;  3RLF A;  2VQF L;  2YU9 H;  1HNX L;  2BA1 A;  2HQL A;  1VQE A;  2XTI A;  4A3D G;  1U5K A;  1X9N A;  4KHZ A;  3UDF A;  2JJQ A;  4GN3 B;  3PCO B;  1L1O B;  4X65 Q;  4PZ6 A;  4DV2 Q;  3AEV A;  2D62 A;  2UXC L;  1EIF A;  3ZJY C;  1NMG A;  1VQG A;  1HR0 W;  3EBE A;  4JI6 Q;  4LF4 L;  2V1C C;  1BBU A;  5IYB H;  4AYB G;  3PF4 A;  3F8T A;  4A3E G;  2JA5 G;  1PYS B;  1PHJ A;  3G6E A;  2UUC Q;  1BVS A;  4BY7 H;  2Y0S G;  3M7N A;  4R1J A;  2VY3 A;  4BA2 I;  4K0K L;  4DR2 L;  1YNX A;  1J5E L;  3F2C A;  4A93 G;  3IRB A;  4TQU S;  4RMF A;  3UDI A;  1HZC A;  1YEZ A;  1PH6 A;  1BKB A;  3M9B A;  2FXQ A;  2LSS A;  4A3F G;  1L1O C;  2GN5 A;  2NVY H;  3RZD H;  4JG2 A;  4HIK A;  4HJ9 A;  1VQO A;  1QZH A;  4LF6 Q;  3TRZ A;  1HH2 P;  4DR3 L;  3RNU A;  2PI2 A;  1AE3 A;  2MFI A;  2UUA Q;  4DUZ L;  3HKZ E;  1G6P A;  2ALY B;  2WP8 J;  4KI0 A;  4DNI A;  4A3J H;  4GKK Q;  2UXB Q;  3I7F A;  1Q86 C;  1Y1V G;  2F4V L;  3CP0 A;  2BH2 A;  1V9P A;  1WJJ A;  1V43 A;  1N33 Q;  4DV5 L;  1S72 A;  1VS0 A;  1XMO Q;  5EAY A;  5BR8 Q;  5M3F H;  2NVQ H;  3PO2 G;  2I0Q A;  3KOJ A;  3L0O A;  3S16 H;  4LF5 L;  3OW2 A;  2JA9 A;  5LMN W;  4QIW E;  2VUM H;  4JC0 A;  3I4O A;  3M4Q A;  4L5T A;  3A0J A;  3UE1 A;  2R7Z G;  2R93 G;  2ZJQ A;  5JJI A;  3S1R H;  4LF7 Q;  4X62 L;  4HIO A;  2AKW B;  3CC2 A;  3J80 i;  4UP8 A;  4JBJ A;  4LFC L;  1Q12 A;  1MKH A;  1S3O A;  5C4X H;  4YY3 L;  1PH2 A;  5IT9 c;  1N32 L;  4KHP Q;  4NPS A;  1Q8K A;  4JYA L;  1FGU A;  2L15 A;  2UUB Q;  1PH3 A;  2WB1 E;  2AWN A;  4GLV B;  3T1H Q;  3G4S A;  1PA6 A;  1NJI C;  1HR0 L;  1TWG H;  4OON A;  3ICE A;  4IFD J;  3CCJ A;  2HHH L;  1VQC A;  2VL6 A;  4BBR H;  3KDF B;  3CCL A;  4A3G G;  1A62 A;  1J6Q A;  2XGT A;  3HFZ B;  3PUZ A;  4LFA L;  1QVF A;  5IWA Q;  4GN4 B;  2Q2H A;  2CFM A;  5IYC G;  5FJ8 G;  1TWH H;  4C3J H;  5M5Y H;  4AQY L;  4BY1 H;  2YTV A;  2ZTD A;  1EWI A;  2UXD Q;  1K8A C;  1B8A A;  3E0E A;  3EN2 A;  4GN5 A;  3CAM A;  1PH4 A;  2JA6 H;  3M4P A;  1VQL A;  1NE3 A;  1NMF A;  5C0X J;  1HNW L;  3PUX A;  1Z9F A;  1IBK Q;  1KIX A;  4JV5 Q;  5K36 G;  2HT1 A;  3PF5 A;  4JOI A;  3CCQ A;  5JEA G;  2K75 A;  1N36 Q;  5ELN A;  4B3R L;  1JJ2 A;  1UEB A;  1MJE A;  3GTP H;  4QY7 A;  4A3B H;  4DV6 L;  1P8L A;  2E2J H;  4YWK A;  2YV5 A;  1C9O A;  1LTL A;  2A1A A;  1N9W A;  1TXY A;  3J7A 5;  4QGU A;  4NXM Q;  3PIO A;  3S2D H;  1BBW A;  4X64 L;  3G48 A;  1OXV A;  5LMN L;  3PO3 G;  4A76 A;  4DV0 L;  1MIU A;  2D0P A;  3KJP A;  4R4C A;  1UWV A;  2I5L X;  4RG1 A;  1C7Y A;  2Q2T A;  3HOY G;  3HOZ G;  2VQE L;  5DLQ E;  2N49 A;  4HJ7 A;  4IFD I;  1D8L A;  1KRS A;  3LGJ A;  2JA7 H;  3H15 A;  4JOI C;  1Y1W G;  1HNX Q;  3M85 A;  4OX9 L;  4B3M L;  3GTO H;  4L5Q A;  3I4M G;  1S40 A;  1TWC H;  2E8G A;  3KF6 A;  2EQS A;  1E24 A;  2ID0 A;  4P75 A;  2QA4 A;  1OXS C;  1XPU A;  5FLM G;  2UXC Q;  4WJ3 M;  1VQ8 A;  4DPG A;  2CCZ A;  4P73 A;  4DAM A;  4GLX A;  1X55 A;  3FP9 A;  2JQO A;  3AFQ A;  2CKZ B;  2YTY A;  2PQA A;  3KF6 B;  3STB D;  1GM5 A;  3K8A A;  2IT1 A;  1HZB A;  4DR4 L;  4X66 L;  2VW9 A;  5C0X I;  1VQA A;  5C44 G;  3GTL H;  4K0K Q;  1UE6 A;  2PQA B;  1KRT A;  4DR2 Q;  4IO9 A;  1VQ9 A;  1J5E Q;  3RN5 A;  3S15 H;  3CPF A;  2F3I A;  1QZG A;  1KQS A;  5JJK A;  1KD1 C;  3K81 C;  4DV7 L;  4IJL A;  1PH9 A;  4MZ9 A;  4HJ8 A;  2N3S A;  2NVX H;  1CSQ A;  5IE8 A;  1T9H A;  4YCV A;  1IXR A;  1SN8 A;  4UP7 A;  3HKS A;  2WB1 G;  4YHH L;  1OXT A;  3TS0 A;  2QGQ A;  4JI2 L;  2RHQ B;  5IYB G;  3I4N H;  2F4V Q;  1UE1 A;  2KEN A;  2VZA A;  4DV1 L;  5JJL A;  3RLN A;  2HIX A;  5LMU Q;  4OO1 G;  4R4I A;  2LXK A;  1KL9 A;  4JI0 L;  4BY7 G;  3J81 j;  4MNO A;  4DV5 Q;  3H3V I;  1SRU A;  1AH9 A;  1X3G A;  1VCI A;  2R7D A;  2K5H A;  4LF5 Q;  4JI5 L;  1VQK A;  1PV4 A;  2CWP A;  1NY4 A;  3K80 C;  1VQH A;  1XMQ L;  4IPH A;  4GKJ L;  1R9T H;  4X62 Q;  3F2B A;  5AJ3 L;  1K0R A;  2ASB A;  4APV A;  2NVT H;  4LUV A;  1K8G A;  4LFC Q;  2ZTC A;  4YY3 Q;  4A3J G;  3A74 A;  1N32 Q;  4DR6 Q;  3TEH B;  3TS2 A;  2R6G A;  4JYA Q;  4QQB X;  3PV0 A;  3VDY A;  3GO5 A;  4R4Q A;  4QJF A;  3TRE A;  1HR0 Q;  1XTD A;  3RN2 A;  5M3F G;  4NXN Q;  1Q81 C;  2HHH Q;  3PUY A;  3J81 i;  5IYD H;  1X65 A;  1YBY A;  1XNR L;  2VUM G;  2UU9 L;  4OXP A;  4IJH A;  4A75 A;  4LF8 L;  3FKI H;  3GD7 A;  3OTO L;  4B3S L;  1JJG A;  3DM3 A;  4X6A H;  3DLL A;  4LFB L;  3S17 H;  4LUO A;  2VNU D;  1Q1E A;  4LF9 Q;  2JEA I;  4BA1 I;  4B3T Q;  5C4X G;  4JI4 L;  2ZTE A;  2JA8 H;  2IX1 A;  3WWV A;  4DR1 L;  4L5R C;  3ULP A;  1HNW Q;  1PH7 A;  1K73 C;  2R92 H;  1X3E A;  2RF4 A;  1OXX K;  4UY8 C;  3HOX H;  1JT8 A;  3JC6 6;  1HZ9 A;  2NN6 G;  5J3B A;  4BBR G;  3RLO A;  4B3R Q;  4JI7 L;  2IHF A;  3CCU A;  3HOU H;  3CC7 A;  1JMC A;  4QL5 A;  4DV6 Q;  3KDF A;  1VQN A;  4X65 L;  4TVA B;  2AWO A;  2PI2 E;  3KLW A;  4BXX H;  4BY1 G;  3S1M H;  2GVA A;  4JI6 L;  3KJO A;  5GRO A;  1YIJ A;  5LMN Q;  4JI1 L;  3CPW A;  4DV0 Q;  1YIT A;  1SR3 A;  2DUD A;  2JA6 G;  2OTJ A;  2F52 A;  1IBM Q;  4DV3 Q;  4JBM A;  1FVI A;  4PMW A;  2VQE Q;  1HNZ L;  4EX5 A;  4OX9 Q;  2BH8 A;  2YTX A;  1I94 L;  5JEA J;  4B3M Q;  4A3B G;  4LF6 L;  1C0A A;  4GS3 A;  3L7Z C;  1QVC A;  4XIG S;  4GOP A;  1VQI A;  3T1Y L;  1EUJ A;  1KAW A;  4JI8 L;  3SGI A;  1YJW A;  2E5L L;  3HOV H;  3A5Z B;  2AHO B;  4WJ4 A;  3CC4 A;  1I3Q H;  3GTJ H;  3I2Z A;  3H0G H;  4O0A A;  3JAM i;  4NB3 A;  4GOP B;  3K7U C;  2K50 A;  1IBL Q;  4Y52 H;  4YCW A;  1GVP A;  1VQJ A;  1WCM H;  4X66 Q;  3BJU A;  1X3F A;  1M1K C;  1WI5 A;  1E1O A;  2KCT A;  1UE7 A;  3D31 A;  1X6O A;  4JBW A;  1O7I A;  2JA7 G;  2CWA A;  1YHA A;  3K7A H;  4DV7 Q;  2KHI A;  4IPC A;  3S1N H;  5M3M H;  2KCM A;  2MNA A;  1N8R C;  1TWA H;  1PH1 A;  4BBS H;  1IZ6 A;  1EQR A;  1L2F A;  3K0X A;  3TQY A;  3RR5 A;  1N34 L;  3OYY A;  4YHH Q;  1CUK A;  2VQF Q;  1I5F A;  4GOP C;  2NZH A;  2QEX A;  4IOC A;  4YWM A;  3U4Z A;  1VQ5 A;  3PUW A;  1W2B A;  4DV1 Q;  2OCE A;  2UUB L;  3T1H L;  2ES2 A;  4JI0 Q;  1D7Q A;  1VQ7 A;  4LF4 Q;  3HOW H;  1EFW A;  5FLX c;  4JI5 Q;  2OQ0 A;  3AFP A;  2LXJ A;  1M90 C;  1XMQ Q;  1CKO A;  4J15 A;  1HJP A;  2N8N A;  1CSP A;  4A3I H;  4GLA C;  3PGZ A;  1P16 A;  2H5X A;  1DGS A;  5AJ3 Q;  3RZO H;  1I6H H;  4A3M H;  1XPR A;  1UE5 A;  3L2P A;  3I4N G;  3D0F A;  3ER0 A;  1FJG L;  1IYJ B;  4LUZ A;  1B7Y B;  4DR3 Q;  4P74 A;  3HOZ H;  5C4J H;  1N36 L;  4DUZ Q;  3E9H A;  1IL2 A;  2RHS B;  1V1Q A;  4P71 A;  4YWL A;  1E1T A;  3UE0 A;  3W1B A;  1Z47 A;  4IOA A;  2UU9 Q;  4P72 A;  4ALP A;  5IP9 H;  1SRO A;  4A3L H;  3BZK A;  2B63 H;  4LF8 Q;  3GTQ H;  3E9I A;  4HJA A;  5IP7 H;  1KC8 C;  2I5H A;  1HZA A;  5HGQ A;  3KFU A;  4UPA A;  4MTN A;  5HY6 A;  3CF5 A;  4DR7 L;  4LFB Q;  1GD7 A;  1PH8 A;  1SFO H;  3ERS X;  1U0L A;  1B70 B;  3CQZ H;  2K4K A;  4XTC S;  3PIP A;  4LWC A;  4A3C H;  3W1G A;  4DUY L;  4A3K H;  1RL2 A;  2A19 A;  4LNQ A;  1W3S A;  1YHB A;  4HIM A;  3MXN B;  2ZJP A;  4DR5 L;  2Z0S A;  5IYD G;  3S1Q H;  2DGY A;  1CKM A;  5C3E H;  4JI7 Q;  4OWT B;  2E2H H;  4DAY B;  1GKH A;  5IY0 A;  1LUZ A;  3FKI G;  4JCV E;  1YJ9 A;  2IX0 A;  1K9M C;  4OWX B;  2JK8 A;  4JI3 L;  1NBW A;  1WFQ A;  4DV4 L;  3BU2 A;  4JI1 Q;  1XNQ L;  4A3D H;  3AQQ A;  1E7Z A;  4LFA Q;  4HID A;  2JA8 G;  3CCE A;  5E7N A;  2ZM6 L;  2WFW A;  3G71 A;  4AQY Q;  4UP9 A;  2R92 G;  3NEN A;  1GO3 E;  3HOX G;  3B6Y A;  3M4O H;  1A0I A;  2PNH A;  4IPD A;  3CCS A;  4A3E H;  3U50 C;  1HNZ Q;  3KYH C;  2JA5 H;  3HOU G;  1L0W A;  4GNX A;  1KHI A;  2I5M X;  4OO1 I;  1I94 Q;  5GAG C;  1PH5 A;  3NEM A;  3F2D A;  3EIV A;  3T1Y Q;  4JI8 Q;  4GNX B;  4A93 H;  4BXX G;  2D0O A;  2E5L Q;  4H02 A;  1VQB A;  1YHQ A;  2MQH A;  3CW2 C;  4A3F H;  1QUQ A;  3GTM H;  3M3Y H;  1MJC A;  1PFS A;  3AYH B;  4LW1 A;  5LMU L;  4DV2 L;  3GTK H;  1Q1B A;  2WAQ E;  4O2D A;  2EXD A;  3PSI A;  2RCN A;  1QUQ B;  4X64 Q;  2AMC B;  1EIY B;  4JBK A;  1AE2 A;  4A4I A;  2IHE A;  2PMZ E;  4R4O A;  2VS1 A;  1Y1V H;  3J81 c;  1E22 A;  1X54 A;  2N78 A;  3CCR A;  4DK6 C;  5GAH C;  1YJN A;  2UUC L;  4AH6 A;  4C3I H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...