4BBSG

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbsG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bbsG01
2YTXA 3A5ZB 1NBWA 4DV1L 5M3FH 1V1QA 2RF4A 1FJGQ 3CP0A 4C3JH 2RCNA 4DPGA 3I2ZA 5HY6A 2ID0A 4GLAC 4B3MQ 1Y1VG 4ALPA 4NXML 3HFZB 3A74A 4X65Q 5IY0A 5M5YH 1PVOA 3UE1A 5IYCG 3T1HQ 1OXXK 2K75A 1IBML 1EQRA 4PMWA 5GAHC 2ZJQA 1N32Q 3FHWA 4BXXG 4DR2L 4BBRH 3CAMA 3CCRA 3CMAA 3M4OH 5IYDH 3JAMc 4DR3Q 3GDEA 4JI1Q 4P73A 3RLNA 4DV4Q 1LM0A 5M3MH 4B3SL 2Z0SA 4DV0L 2CWAA 2Q2UA 4L5QA 2ALYB 1YJ9A 1PA6A 1CKNA 4DV3L 1XPRA 4NXMQ 1Q86C 1HNWQ 3CPFA 4P75A 1G51A 2R7ZG 1MIUA 1V9PA 1Z47A 2KCMA 4UP8A 3HOXH 2E5LQ 2UUBL 1VQIA 4HIOA 4BY1H 3CPWA 4JI0L 2HHHQ 3KF8B 3PO2H 4BA2I 2HIXA 4PG3A 2JA9A 2MO1A 1IXRA 4HJ5A 2BA1A 4A3DH 2UXCL 1HNXL 1G6PA 4DUYQ 2F4VQ 1KC8C 2Q2HA 2UXBQ 4A3IG 3BZCA 3RLFA 4A4IA 1HNZQ 3I4MH 2V1CC 4PZ7A 1N9WA 1C0AA 2AWNA 4B3SQ 2UUCL 3PUZA 1GVPA 2JK8A 4EX5A 3OTOL 2MQHA 5C4JH 2K5HA 2NN6G 4A93G 2UXDL 5GROA 3PUXA 2A1AA 1LUZA 4HJAA 1UEBA 2AHOB 1QZHA 1EUJA 4JI0Q 3JAMi 4HIMA 5BR8L 1I94L 3HOUG 2K5VA 5LMNL 2Q2TA 4OWWB 1VQCA 3CCVA 1UE6A 3KDFB 1QZGA 4JBKA 2UXCQ 1SMXA 1S72A 4JI5L 3S1NH 1VCIA 1VQ9A 1Y1VH 3ULPA 2Z6KC 4K0KL 3L2PA 2H5XA 3ERSX 1L0WA 4HJ7A 1PV4A 4GS3A 1Z9FA 5IYCH 4JG2A 2KHJA 2PQAB 1UWVA 3KDFA 4QQBX 1VQJA 4A3DG 4R4QA 3J81j 3K81C 5C0XJ 1VQBA 2OQKA 2K50A 1Q1EA 1S3OA 1XNQL 1QVCA 2YTYA 3E9IA 1ASZA 4POGA 1PH8A 2QA4A 2E2JH 1SN8A 4LUVA 1PHJA 5ELOA 1AH9A 2PQAA 3TRZA 3KOJA 4JI4L 5FLMH 4Y52H 1GO3E 5C0XG 2VQEQ 2EQSA 2D0PA 2R7ZH 1NMGA 1FGUA 1P16A 5ELNA 4LF9L 4C2MH 2BH8A 3KF6B 5C0XI 2JA6G 3CW2C 2L15A 4R4OA 1E3PA 3UDXA 1TWAH 4B3TL 2JE6I 4JI6L 4B3RL 3CCMA 1KRTA 2ZTEA 5M3MG 3GTOH 3GTMH 2MFIA 1XNQQ 1D8LA 3AFPA 4TQUS 5EAYA 1K9MC 4X62Q 4XTCS 1EOVA 5IYBH 4GLXA 3KF6A 4A3BG 2IHFA 4LF5Q 4LNQA 2A19A 1G291 2B29A 4C3IH 4J15A 1WJJA 3F2BA 3M4QA 4A93H 5E7NA 2N8NA 3Q8DA 4GOPA 1K8GA 1HR0Q 1EIFA 1KAWA 3GTLH 3S1QH 2I5LX 4DK6C 4DR6Q 4AH6A 3PSIA 4B3ML 2ATWA 1X3GA 3HOUH 2VL6A 3M4PA 4DV7Q 5JJIA 4A75A 3CMEA 4X65L 4JCVE 1JJGA 3T1HL 2AMCB 2VQFQ 4LWCA 1N32L 4A3JG 1WYDA 4DR1Q 4LF8Q 3CC7A 1YZ6A 1VQ7A 1OXSC 1Q82C 3FKIG 4XIGS 4DR3L 4JI1L 4L5TA 4X64Q 3M3YH 4DV4L 4YCWA 3PF5A 2K52A 3BZKA 2HQLA 2JA8G 1V43A 1L1OC 1VQOA 1HNWL 3DLLA 2KENA 2D0OA 1Q1BA 2E5LL 4GKKQ 5HGQA 4DAMA 4QGUA 3AYHB 1NE3A 5C44G 2VUMG 3S15H 3S1MH 2HHHL 2YYZA 4UP7A 1U5KA 5IP7G 3GTPH 1WCMH 4NXNQ 4LFBQ 3S24A 2IHEA 4DUYL 1X65A 3K0XA 3CCJA 1YJWA 1CUKA 3CCEA 1YHBA 1J6QA 2F4VL 2JA6H 2UXBL 1HNZL 2N49A 1B70B 2WB1E 3TS2A 3S17H 1VQFA 2HIVA 5FLMG 3G6EA 2D62A 1K3RA 4QY7A 5GADC 3W1GA 2OWOA 3GD7A 1S40A 4DV6Q 1VQHA 1D7QA 4DAYB 4A3BH 3RR5A 4P74A 4DV5Q 1H95A 3CC2A 4IPCA 1YVCA 2NZHA 1YNXA 4X66Q 2ZJRA 4HJ9A 2JEBI 3CF5A 3UDFA 1NY4A 4O2DA 1GKHA 1UE1A 3S16H 2OCEA 2Z6KA 4YWLA 4LF4Q 3TEHB 1SLJA 5IYBG 1PH7A 1EIYB 4EQ5A 2CCZA 2WP8J 4LF6Q 2NZOA 5JJLA 2NVYH 1NTGA 2R7DA 3G48A 1TWGH 2K14A 2JA7G 5AJ3Q 4A76A 4JBJA 1VQDA 1W3SA 1OXUA 1PH5A 3CD6A 1A62A 4IOAA 4R4CA 3CQZH 4LFAQ 5GQOA 4OX9Q 4DR4Q 4A3JH 3DM3A 3NEMA 3STBC 3HKSA 3F2CA 3K7UC 3W1BA 1CSQA 3FKIH 4GLVB 1Q8KA 2ZTCA 2ZM6Q 4L5SA 3I4NG 4JV5Q 3D0FA 4QIWE 4UPAA 4WJ4A 1EWIA 4HJ8A 1E7ZA 4HIDA 2R6GA 1M90C 2LXJA 1YI2A 1E1OA 3T1YQ 2RHQB 2B63G 5IT9c 5K36G 4YY3Q 4KI0A 2ES2A 4DV2L 1WFQA 3OYYA 4GN3B 2JA8H 2VQEL 3GTGH 4DR7Q 1WI5A 4AIMA 1VQLA 4YCUA 2VUMH 5C44H 1VQEA 1BBUA 3RLOA 4MNOA 1K8AC 1Q12A 4P72A 2MO0A 1TWHH 5IP7H 4A3EG 2ZTDA 3ULLA 1CKMA 1JJCB 1HJPA 4R4IA 3KFUA 4QJFA 1SR3A 5LMUQ 4JI7Q 4PZ8A 1VQNA 4GNXC 1E22A 3KYHC 5J3BA 4X62L 1AE3A 3EIVA 4A3LH 1SFOH 4LF5L 3PUYA 5LMNW 4DR5Q 2VY3A 2A8VA 3EN2A 4QL5A 4A3CG 4DV2Q 4OXPA 1WCMG 2YTVA 4P71A 1HR0L 4GKJQ 2CWPA 4APVA 1IBLQ 5M5WH 1KL9A 1C9OA 5GAEC 1YIJA 4YHHQ 2VZAA 2CFMA 2WB1G 2OTLA 4DR6L 2IY5B 1PH2A 2E2HH 1KIXA 3J7A5 4DV7L 1I50H 1PH3A 1QVFA 1YEZA 5IE8A 1OTCA 3AEVA 2GN5A 1KD1C 3J80c 1BVSA 3E0EA 4JI8L 4POFA 1QUQB 4JI2Q 2VQFL 2ASBA 1L1OB 1PFSA 2AKWB 1PH1A 1JMCA 4YWKA 3KLWA 1N36Q 3KJOA 4PZ6A 3EBEA 2E8GA 4O0AA 4DR1L 4LF8L 2JA7H 5JJKA 1C7YA 4DUZQ 4JOIC 4YCVA 2EXDA 2I5MX 4IOCA 1XJVA 1FL0A 1X3EA 2JEAI 3H15A 2MNAA 2NVQH 4X64L 1EFWA 4JI3L 3CCSA 2AWOA 3F2DA 1EYGA 1L1OA 3FP9A 4R4TA 3S14H 2GVBA 1GM5A 1I3QH 3HOYG 3I4NH 2YV5A 5IWAQ 4TVAB 3MEFA 1B8AA 2VNUD 1N34Q 4BY7G 4GKKL 2QGQA 2BA0A 3I56A 3RZDH 4UY8C 4JI8Q 4H02A 2B63H 4IFDJ 1K0RA 1HZCA 1L2FA 4LUOA 2IX0A 1TWFH 3B6YA 1GD7A 2I0QA 4NXNL 4LFBL 1QVGA 3K7AH 1HH2P 4NPSA 4ME3A 3TQYA 4JBMA 4BBSG 2BH2A 1VQGA 1J5EQ 1HZBA 3CCUA 1T9HA 3HOWG 3KJPA 2UUAQ 3PCOB 1X6OA 4A3EH 4A3GG 4MTNA 2WAQG 3J80i 5FLXc 4Y7NH 4BA1I 1Q81C 1YBYA 4JI3Q 4LF7Q 4GN5A 2JA5G 3PO3H 3L0OA 4KHPQ 4IFDI 1JT8A 2XTIA 4UP9A 1IBKQ 4OWTB 4DV6L 4OO1I 4DV5L 2UU9Q 3UE0A 4X66L 4A3CH 1A63A 2R7FA 1X3FA 2DGYA 1JB7A 3IRBA 4IPGA 3GO5A 1IYJB 1K73C 1BBWA 3I55A 4LF4L 2R92G 4LF6L 4FDBA 4A3LG 3J81c 1XPOA 4A3MG 3PO3G 2QEXA 4GOPC 3PGZA 5AJ3L 1VQ6A 1N33Q 1Y1WG 2KCTA 2VS1A 1A0IA 1JE5A 3PIPA 3ER0A 3UDIA 1YHAA 4LFAL 4OX9L 3WWVA 1BKBA 3I7FA 4LFCQ 4DR4L 3L7ZC 3H0GG 2XGTA 1VS0A 1JJ2A 5C3EG 4JYAQ 3TREA 3AQQA 1RL2A 2ZM6L 4AQYQ 4JV5L 1OXVA 1PYSB 2N78A 1CKNB 2OQ0A 1XNRQ 2UXDQ 1CKOA 2KHIA 3T1YL 3MXNB 1OXTA 3I4OA 1VQMA 4JC0A 2N3SA 3U50C 4YY3L 4GNXB 5DLQE 4DV1Q 1XMOQ 1HZAA 1XPUA 3HOYH 4DR7L 3HOZH 1A8VA 1SROA 4L5RC 2R93G 4BY7H 3K80C 2YU9H 1I5FA 4IJHA 2K4KA 3A5UA 1VQ4A 2Y0SE 3E9HA 4RG1A 4GNXA 3PUVA 4BBSH 4RMFA 2VW9A 1IBMQ 5FJ8H 4WJ3M 2Q2IA 5LMUL 4HIKA 4JI7L 3HOWH 3J81i 2IT1A 4DR2Q 1PYBA 4A3GH 3HKZE 4A3KG 1HZ9A 4KHZA 1Q7YC 3U4VA 3PV0A 4DR5L 4LW1A 1YITA 2JA5H 2CQOA 2E2IH 1NJIC 1Q46A 2WAQE 1AE2A 4GKJL 3F8TA 2CKZB 2JQOA 3G71A 4DV0Q 4NB3A 1IBLL 3S2DH 4YWMA 1KHIA 1KRSA 4YHHL 4DV3Q 2JJQA 3D31A 1PH4A 3JC66 3G4SA 3CCQA 4A3FH 3GTKH 2UUBQ 2NVTH 3UDGA 4GN4B 2NN6I 5IP9G 3ICEA 4IPHA 3H3VI 5GAGC 3NELA 3HOVG 4AYBE 3RNUA 4JI2L 2NVXH 4X6AH 2R92H 1IL2A 4JOIA 1X55A 1N36L 1HNXQ 4A3MH 4MZ9A 1I6HH 2PI2E 1LTLA 4DUZL 5H1SE 3PUWA 1Y1WH 3AFQA 3J7ZC 1UE5A 4R1JA 3PF4A 1CSPA 1MJCA 5C4XG 3BJUA 2FXQA 2UUCQ 3U4ZA 2GVAA 1EQQA 3OTOQ 3H0GH 3PIOA 2F52A 1LYLA 1E1TA 1RIPA 5JEAJ 2KBNA 5C3EH 1U0LA 1PH9A 5M3FG 1VQKA 5IWAL 1SRUA 4BXXH 1N34L 1XMQL 3GTJH 4DK3C 1YHQA 5BR8Q 1I94Q 1VQ5A 5LMNQ 1DGSA 1FVIA 1TWCH 2HT1A 3LGJA 4DKAC 2LXKA 3K8AA 2IX1A 2B3GA 3NENA 2ZJPA 1R9TH 3STBD 4JI5Q 1VQAA 2R93H 2OTJA 3S1RH 5JEAG 1VQPA 2C35B 3A0JA 3M9BA 1N8RC 1J5EL 3S2HH 3CXCA 4K0KQ 2UUAL 3CC4A 4IO9A 2PI2A 4BBRG 1QUQA 5M5XH 1MJEA 2PMZE 4LF7L 1E24A 3VDYA 1P8LA 1HR0W 2RHSB 5IYDG 2K5NA 3TS0A 4KHPL 1IBKL 3F1ZA 3SGIA 3HOZG 4JBWA 1XMQQ 4DNIA 3U58A 4A3KH 2F3IA 4GOPB 2Y0SG 4C3HH 2UU9L 3W5OA 1X54A 4A3IH 3RN5A 3CCLA 1X9NA 3ULJA 1M1KC 3NBHB 3HOXG 4BY1G 3M85A 4JI4Q 4OONA 1NMFA 1PH6A 3HKZG 3PO2G 5FJ8G 3GTQH 1UE7A 1Y14B 1KXLA 3BU2A 3H3VH 3M7NA 4IFDG 4LF9Q 4KLKA 3OW2A 2EIFA 1KQSA 1W2BA 1ASYA 1FJGL 2I5HA 1B7YB 1O7IA 5IP9H 4OO1G 1K83H 1N33L 4LUZA 1SE8A 3HOVH 2DUDA 4B3TQ 4JI6Q 3I4MG 4B3RQ 3ZJYC 4IPDA 2PNHA 4LFCL 1TXYA 1WOCA 1X56A 1VQ8A 4JYAL 4A3FG 3RZOH 4AQYL 1IZ6A 4AYBG 4IJLA 5C4XH 4OWXB 1XNRL 3RN2A 2LSSA 1XTDA 1MKHA 1YJNA 1XMOL 2WFWA
chains in the Genus database with same CATH superfamily
3A5ZB 5D8DA 3ONAB 5M3FH 1N33H 4APMA 1FJGQ 2K28A 4C3JH 1EZ6A 2RCNA 1K83B 4B3MQ 1VMCA 3HOUB 2L1BA 4RWSC 3VYTA 2ASJA 1EUDB 4IUPA 4H13C 5L37A 3JAMW 3GTQA 4X65Q 4L1KA 2XGPA 5DQGA 4PDBA 5GAHC 4MV3A 3RF2A 1K83A 2PW5A 4LF4H 1XMOH 1IKLA 1QG7A 2M00A 2B39A 5IYDH 3J7AV 2ZT9C 1JE4A 3EQLC 2EJMA 4C3JB 3RLNA 5JJZA 3MC0B 5IT9L 1FGBD 2Z0SA 2Q2UA 5ELEA 1HNWQ 1G51A 3S15B 1PFBA 5CA1F 1VQIA 4QWDA 4JV5H 1WTWA 3KF8B 4FM9A 4BA2I 5EPJA 3MR6A 1TAEA 2MO1A 2FMCA 4HJ5A 4JV2A 2EY2A 1A3VA 2L11A 4DUYQ 2TSSA 3RB3A 3RLFA 1MGSA 3GP7A 3I4MH 1SBBB 2VA2A 3KF8A 2AWNA 4O3RA 3PUZA 5T1IA 3OTOL 5C4JH 2KEDA 3PUXA 2EVBA 2F0SA 4HJAA 2MHVA 1K28A 2F0UA 4MV9A 3RMHA 2V5AA 4OWWB 5C1OA 1Y69U 1UC8A 1M0TA 4H7BA 1UC9A 1RJTA 3S1NH 1SMYC 1VCIA 1ZHQA 2Z6KC 2BOSA 5KFZA 4YHHH 3AU7A 4DLKA 1QB5D 1BCPB 3Q8RB 1Z9FA 1Z2OX 2VA3A 2PQAB 4EQPA 1UWVA 5DGAA 2UVRA 3T51B 4U68A 3J81j 2N55A 5JPNC 1A3TA 2K50A 4JI2H 1EY8A 4ECXA 1QVCA 5DG9A 1VDZA 2B2UC 3Q8QB 5KFYA 3IN5A 1SN8A 2NYZD 2PQAA 3J80E 3KOJA 1A3UA 4G3IA 2EYFA 2Q8TA 1DOKA 1GO3E 2F4IA 2VQEQ 2EQSA 1S5DD 2SCUB 2VUMB 5ELNA 2X0SA 3CHBD 2JA6G 5CV4A 4MV6A 3FPPA 3F8NA 4JI6L 2FMAA 2JE6I 5DAUA 5FK9C 5M3MG 1T5XD 4M1UB 4J9RA 1XNQQ 5CV6A 4TQUS 4UCRA 1K9MC 2VUMA 4XTCS 1EOVA 5IYBH 4GLXA 2IHFA 4LF5Q 2GPSA 3BAAA 2B29A 1HRJA 4J15A 4MTEA 3TDQA 1HFGA 1WJJA 1KAAA 1DXMA 3M4QA 5E7NA 1LT6D 1TS4A 1ZYRD 3Q8DA 1GLVA 1EIFA 1D5MC 1KAWA 3S1QH 4RB2C 4KKSA 1B6RA 1DOLA 1IBKH 4B3RH 4ZKCB 2J7ZA 3PSIA 2ATWA 2UVUA 1LTTD 3J81L 1SYGA 4DV7Q 1NNXA 4YQWA 1JJGA 3T1HL 2AMCB 2VQFQ 2W6OA 4QWEA 1N32L 1RDPD 3MVVA 4IQZA 1Y8NB 4LF8Q 1YZ6A 4Z9CB 2YL2A 1Q82C 4I50F 3NWTA 4DR3L 4RZQA 5L1LA 4IUQA 4X64Q 4YCWA 2HQLA 3BA9A 3I4NB 1A9XA 1TS2A 1V43A 2I07B 3RGZA 1L1OC 3QOLA 3ND9A 1WSCA 2D0OA 1H9KA 4GKKQ 1PTOC 1NE3A 5C44G 3MEHA 1O7LA 1VBGA 1U5KA 3QZ8A 3OHAA 2C28A 1A15A 5KNCA 2V4QA 3I3CA 1X65A 3CCJA 4KD3A 1Q8IA 3CCEA 2JA6H 4JI1H 2A69C 2UXBL 4A3EB 1HNZL 3MXUA 1B70B 2WB1E 1BCPD 4ZCKA 3S17H 4MV8A 5KG3A 4NXMH 1VAJA 2HIVA 1QCBD 2CQAA 5FLMG 3G6EA 1PRTB 3GD7A 4RGMA 3LNNA 2HHHH 4DAYB 2JYOA 1H95A 3N41B 1YVCA 1Z7TA 4X66Q 2ZJRA 3U9OA 3MXGA 4TV8F 5L1IA 1FNUA 2NWGA 4KJNA 4K2KA 4RUCA 2O5JC 5KFPA 4HN7A 2CZGA 3N52A 4DAYA 4B3SH 1SLJA 1PH7A 1BBXC 1WVLA 2WP8J 2WINB 2NVYH 4DV3H 4DL3A 1CFMA 2RSOA 3L4KA 4JBJA 1STYA 5IOCA 2JA6A 4JI0H 3CQZH 5GQOA 4BWGB 2BQRA 2HQEA 3NEMA 3STBC 3GIPA 4O3QA 3TBIB 3K7UC 3H3VC 2FPPB 1T3NA 4GLVB 2ZM6Q 1HNXH 2UXCH 4O2BF 2E74C 4UPAA 2XIWA 3VMMA 2CW0C 1M90C 1E4EA 3T1YQ 1I4HA 4KI0A 3KK7A 4LMQD 4DV2L 1WFQA 2NVYB 3I90A 2UUCH 1ZEQX 3F2UA 1MI2A 5CV9A 1O78A 2UXDH 2F0HA 2CW7A 3V6KA 5C44H 2ZDHA 1K8AC 1PXUA 1HA5A 2WV6D 1MSHA 4MAMA 2VUGA 1HUNA 1I94H 2RGVA 3NUCA 1JKJB 2NVYA 1JJCB 3KFUA 4QJFA 4CDFC 4RCOA 1F9SA 5J3BA 4JI5H 5ELCA 4X62L 3ITPA 3T13A 4CKCA 1EQTA 4DR5Q 2JA5B 3CQZA 2A8VA 4K0KH 3J80W 3T5HA 5JVG3 1HR0L 2CWPA 4APVA 1QNUA 4QB4A 1YIJA 1KLGD 2WB1G 2CFMA 3EFXD 2OTLA 4DR6L 4IZOA 5COYA 1CZGA 3OSOA 5FD6A 2JA5A 4TUYF 1LT5D 2SNSA 3KXYT 3OHBA 1FYCA 2PQEA 1KD1C 1BVSA 3BQ0A 4JI8L 3W3AA 4PQXA 4POFA 2L5TA 3BYYB 3MFGA 4KY6A 2AKWB 1PFSA 5CMDA 1JMCA 3QB3A 1I6HB 5I4DA 3P7JA 2PCFB 2E8GA 2GLTA 1RKNA 4DUZQ 4EYIB 1KDAA 2A68D 1XJVA 2JEAI 2CH4W 4CKEA 2MNAA 1SYXB 4JI3L 1PRTD 2GVBA 2HCCA 3OIPA 5IGFA 5IWAQ 1GHKA 4P2CB 1N34Q 4UFZA 1RK6A 4UY8C 2ATLA 1JDEA 4NXNL 2YCHA 1QVGA 2M9VA 4OGQC 1AUXA 5T1GA 5J22A 4BBSG 3A7AB 2W8LA 2ASLA 4RUAA 3MR5A 3KJPA 4A3GG 2MJ8A 5D1OB 4BA1I 5KG2A 1LTID 3JAML 2KJXA 5KG4A 1EQVA 4CKBA 4C56C 3BQ2A 5L9XA 1EY4A 3L9AX 4DV5L 1PFNA 4C5BA 3UE0A 5FD5A 3NTIA 2B2TA 2HVRA 1JB7A 2W57A 4IPGA 2WKDA 3R3OA 1K73C 4QUFA 4EEYA 1RYRA 4LF4L 4TQSA 1G8ZD 4DV4H 3QR8A 1G2TA 4RU9A 4FDBA 1XPOA 1SAPA 1D1IA 2QEXA 2ZJTA 4DV6H 3HOVB 3ERQA 2KCTA 2VS1A 3T4AC 3DWPA 1A0IA 2EDGA 3ER0A 4YB8B 1JOQA 1RYSA 4FVMA 1F2ZA 3H0GG 3MFHA 2XGTA 1STHA 4JYAQ 3TREA 4JV5L 1CKNB 3VA5A 1JC7A 3AMUA 2NBFA 4LF6H 2K03A 4ECVA 5KKNB 2ASBA 1VQMA 3M7GA 4GNXB 3OMCA 4KHVA 4RHSA 1HZAA 5KG0A 5KEEA 3RV3A 1A8VA 2JN4A 3K80C 2YU9H 5EWEA 4IJHA 4TSSA 3TN2A 4H0LC 2K4KA 2WB1A 3CRLC 3V4ZA 5M5YB 3A5UA 2R8KA 5KFSA 2K7VA 4GNXA 2FB9A 5KFXA 4BBSH 1EY9A 3IFTA 3VYRA 4L6TB 4A3GH 4YY3H 3HKZE 3J7AF 2R85A 4KHZA 4C3HG 1Q7YC 1C8CA 1NJIC 5KFWA 2WAQE 4GKJL 1DCZA 3G71A 2Y0SB 4YHHL 4IWXA 4FS1A 1M8AA 3NTKA 3D31A 1ICWA 3GTKH 1DOMA 3KUPA 5I2YA 2NVTH 5JH7F 3PVXA 3R23A 3SK4A 3H3VI 5GAGC 3NELA 3RNUA 4JI2L 1JLLB 1O7ZA 1IL2A 5KFHA 3U9TA 2YYAA 3BG3A 3O13A 2XCAA 3PUWA 1KJJA 3PF4A 1HPCA 4XQJA 5K2MA 4ECQA 1EYAA 3OTOQ 4MA0A 3H0GH 2AGPA 1LYLA 1E1TA 1RIPA 4OELB 2KBNA 1K1QA 2W6MA 1KDBA 1VQKA 5G3LD 3PW2A 4KD4A 3GTJH 2IW3A 1VQ5A 1DGSA 2R7LA 3PZPA 2HT1A 4Q45A 3LGJA 2LXKA 3ND8A 2B3GA 2ZJPA 1KJ9A 1R9TH 3GTKA 3S1RH 2PW7A 1VQPA 3M9BA 2B8GA 3S2HH 5E4XA 2VB3X 2PI2A 4BBRG 1QUQA 2FJZA 2OH2A 2PMZE 1X32A 1E24A 3VDYA 1B53A 1Q3LA 2K5NA 3TS0A 1IBKL 3SGIA 3HOZG 3GTJB 1T5EA 3T5LA 3U58A 4C3HH 4HCSA 4O3PA 2F3WA 2UU9L 4UHVA 2W9AA 1TY2A 3LMLA 4KV6A 3ETHA 3H0GA 2F0VA 3ULJA 3HOXG 3C1EA 2EZVA 1S5FD 4CJ2C 1PH6A 4EFBA 3HKZG 2RA4A 2XRSD 3K3VA 1UE7A 3FMAA 3I12A 1Y14B 3GTJA 3BU2A 3K58A 5CV5A 4A3DG 4KLKA 3OW2A 2AGOA 1RCVD 1HFNA 4KHPH 2I5HA 4IN3A 1R9TA 4K5WA 5EWGA 2XIGA 1SE8A 4JI6Q 4KJOA 4IPDA 1S0NA 5KRUA 4O42A 1DONA 4A3FG 2KA7A 1RD9D 5FO7B 4Q44A 2H4OA 4X3TA 1MBYA 4EBCA 2GA4B 3GTLB 3SK8A 1V1QA 3NGDA 5IYZF 2J6SA 2HUGA 1YNJC 1XYIA 3WO1A 1IW7D 2VQDA 2HVQA 2ID0A 3G6VA 2K32A 3Q0AA 1TY0A 4UCUA 4NXML 3A74A 2DPJA 3OMGA 3UE1A 5IYCG 2W7OA 3T1HQ 4V0BA 3TP8A 2K75A 4PMWA 1N32Q 2FE3A 1CT1D 4BXXG 4BBRH 1E2WA 1AN7A 4UCSA 1IL8A 1AZQA 3M4OH 1EYCA 3GDEA 4DR3Q 3M3YB 1STEA 4DN4M 4B3SL 3PIP3 2CWAA 4L5QA 1PA6A 5EQ0A 4DV3L 3K5LA 4LFAH 1AEXA 2SDFA 4OX9H 2RDHA 3HOXH 1A63A 2KCMA 1GJXA 4I7HA 4JI0L 2B2WA 4K6LA 3FMCA 5DG7A 2EJGC 4J9LA 5EKLA 3NSWA 2BA1A 4A3DH 2UXCL 1HNXL 1G6PA 3JRXA 3DM1A 2IBKA 2KVMA 1KC8C 2UXBQ 4A3IG 1HNZQ 4A4IA 3TQ1A 2PPBC 4DNRB 4PZ7A 2WKCA 4O3OA 2UUCL 1VF7A 2X69A 4J9MA 4DL5A 1EU3A 4KKTA 5JVH3 2UXDL 1GUGA 3HOXB 4JI7H 1QZHA 1KNEA 4B9XA 4HIMA 2R86A 1I94L 3HOUG 2K5VA 2RDFA 4C5AA 1L2ZA 4A3DB 1F9PA 1VQCA 4JBKA 1UE6A 3J80L 1QZGA 5KFMA 1B3QA 3OWFA 1S72A 1AN8A 4HMJA 4JI5L 1C48A 5EDWA 1KJQA 2KUMA 4K0KL 4DFAA 1G2SA 3L2PA 2H5XA 5H80A 1PV4A 5IYCH 3GQCA 4JG2A 4L8JA 2KHJA 4LSAA 1EYDA 3KBXA 5CC4A 3VYSA 5C0XJ 4C3JG 1VQBA 4YIJA 1NR2A 3KLSA 1MSGA 1Q1EA 2F0PA 2YTYA 3E9IA 3EYYA 1N36H 3DUZA 2E2JH 1DJRD 3JZIA 1KABA 1PHJA 4ZOLF 2YZGA 1I7LA 3RUPA 3FVQA 4EBDA 1TVXA 3H6MA 5C0XG 5D3DA 3C3LA 3V6HA 2D0PA 5C8YF 2EY5A 5LP6F 4LF9L 3MWDA 5J2UF 3KF6B 5IIFA 5IGEA 3CW2C 2L15A 2ENBA 1U4PA 4ED1A 1PTOF 1KRTA 3MR2A 3GTMH 5A2QE 3OSNA 3AFPA 1VBHA 4CDEC 1PZID 5F9NA 4X62Q 1NUCA 1B3AA 1CM9A 3KF6A 4IURA 1Y8PB 4ED6A 2HDMA 2UUAH 1X3QA 1IOVA 1CE8A 4IR1A 2EOTA 2KOLA 3F2BA 1HR0Q 2N8NA 5M5WB 1K8GA 1V1PB 2ZDQA 3RBDA 4DR6Q 3TZDA 2O5IC 2FLNA 3WOEA 3HOUH 2FLPA 5JJIA 3CMEA 3GTMB 4XT3B 4WD3A 1GUOA 1QOHA 5E4WC 3RB6A 3SK5A 1N56A 1CQJB 2JA7B 3A8IE 3CC7A 3GTMA 1FJGH 2AUJD 1KJIA 4FXKC 2NTSA 4L5TA 1T36A 4G7OC 4DV4L 2K52A 1LTSD 3BZKA 1I3QB 3RGXA 4X65H 2JA7A 2JA8G 1QNKA 2F0NA 5C4ZA 5EJWA 4S3SA 2PZUA 2HVSA 2NU9B 3S15H 4MV1A 3KAJA 3AYHB 2VUMG 2MCTA 5C1PA 4AQYH 2W71A 4J0MA 4UP7A 5CV7A 5C0XH 4RHRA 1CI3M 1Y8OB 3GTPH 1WCMH 3K7AB 4NXNQ 3GIDA 3CVZA 4BWSC 1ICFB 3S24A 2F0DA 2F4VL 1CUKA 4I7ZC 2K5QA 3H91A 4K8JA 3QO2A 2BE5C 1O80A 2FMMA 3MTSA 1JCKB 4K5VA 2W7PA 1VQFA 1HNWH 4ED2A 2D62A 4JV0A 2HJWA 4WFN3 1H9SB 1S40A 2A74C 2F3VA 4OIKA 4DV5Q 4FU0A 2F03A 5KG7A 2JEBI 3GTPB 1IOWA 1WCMB 4KY7A 5CBEE 3BVMA 2YZMA 2M2LA 1UUPA 1XDNA 2EYLA 4YWLA 4LF4Q 5IYBG 4DV0H 4EQ5A 1ESRA 4CGYB 4RZRA 5KG1A 1NTGA 1WTQA 3G48A 2K14A 3GV6A 3GTPA 1WCMA 5E3FA 3KTMA 4XYMB 1B33N 3ETJA 1S03G 4IALA 1A62A 1TR5A 1IYUA 3HKSA 4I55F 2QILA 3W1BA 5FO9B 2ZTCA 3I4NG 4JV5Q 1S0MA 1TS3A 2IP4A 4HJ8A 1DIKA 1E7ZA 3JSNA 2LY7A 4MN3A 1YI2A 5K36G 3E0JA 1EUCB 5EWFA 2W8KA 2ES2A 2JA8H 3T5KA 4YCUA 2VUMH 1R4PB 4XYQA 1BBUA 3FDSA 2PZTA 1Q12A 4P72A 3ORQA 4A3EG 1HXYD 5BR8H 1EY6A 3VR6A 5LMNH 3TIIA 1CKMA 3N6RA 3DEOA 1HJPA 1XXGA 4R4IA 3PO3G 1JDBB 5LOVF 4PZ8A 5KFCA 4I7AA 3KYHC 3EIVA 4A3LH 1I4GA 5C3XA 5LMNW 2E2IB 2VQEH 4V190 2IWHA 2JA8B 5KX5F 3H4BA 1M7JA 4OXPA 2F0JA 3IL8A 1B2TA 4P71A 3PIO3 4GKJQ 1JQYD 1KL9A 4YHHQ 2EE1A 3D4WA 1WD0A 5KFUA 3WO0A 5JUMA 1KIXA 4ECTA 3J7A5 1XNQH 5KYIA 1OTCA 2K5DA 2A6HC 2GN5A 3AEVA 4F50A 3OUZA 3PW5A 2NVXB 4KKUA 5A2QW 1EY0A 4JI2Q 3QOJA 5L1KA 2EYJA 5FOBB 1TT2A 4A3MB 3KJOA 4DR1L 1FNWA 4DL2A 1C7YA 3HZXA 4JOIC 1UAPA 3Q22A 3PW0A 1FL0A 3H15A 3N6XA 4M8AA 3C1FA 2AWOA 3F2DA 3OHXC 4RB0A 4DV7H 4B3TH 3FP9A 2AQ3B 4E4TA 5DQHA 2JEGA 1F77A 3I4NH 2MPMA 2YV5A 3BJYA 4EG0A 3P1HA 3MEFA 1B8AA 2R8GA 2VQFH 1JWUD 2QGQA 3I56A 4IFDJ 5K36H 2QK4A 4H02A 1TWCB 5GONF 1K0RA 1HZCA 4EGQA 2IX0A 1TWFH 1HH2P 3RB4A 1ENFA 4CHTB 2ZXPA 4JBMA 2BH2A 4O4LF 1I4QA 3C2PA 1WTOA 3V96A 1D5XC 3E5SA 2CVRA 4A3EH 1Q81C 1YBYA 4GN5A 4Q5VA 2JA5G 3PO3H 1JT8A 4UP9A 1IBKQ 5KT6A 5LA6F 3IG0A 2UU9Q 1FR3A 1TWFB 4HMIA 4FF1A 2I87A 2R7FA 2RBMA 2W6PA 3MXPA 2FK2A 3RB0A 2J6TA 1SNCA 1SSOA 3R8BA 5KFGA 5DEHA 2R7MA 1TWFA 3PO3B 4FS2A 3PGZA 5AJ3L 1VQ6A 2PZWA 2F0IA 5NUCA 2DIKA 2E5LH 3A55A 4K6DA 1JE5A 3QJYA 1BGWA 3UDIA 4LFAL 4OX9L 1BKBA 1PZJD 3I7FA 3L7ZC 1CQVA 1OO9B 3RZOB 2L9HA 4HSVA 2OQ0A 1BXRA 1SYBA 1CKOA 2VR1A 3TP6A 4DL4A 2XSCA 3I4OA 5KFFA 1XPUA 1GHJA 1AZPA 1DZ1A 3L3OC 4KTAA 3KHHA 4L5RC 1SROA 2R93G 4RAZA 1QJOA 4B08A 2EYMA 3FDTA 1I4RA 1I5FA 2M05A 2K05A 2LS01 1RK5A 2FFKB 5KGUA 4IRCA 2Y0SE 4IWYA 4IRDA 4RG1A 1EEFD 3PUVA 1PX2A 4MV4A 5JOBA 2VW9A 4WJ3M 1L0XB 4JI7L 4HIKA 4R8UB 5KT7A 3OW7A 1PYBA 4A3KG 3NK9A 1HZ9A 1YITA 2JA5H 4HEDA 1RJQA 3N8DA 5I9PA 3TINA 4YP3A 1AE2A 1BXTA 4ED7A 1JX4A 2CKZB 2JQOA 2C9OA 1IBLL 4R8UA 1JR0D 4DV3Q 3DWQA 1PH4A 1LTBD 3CCQA 4BY1B 3X3MA 3ICEA 4IPHA 1ILPA 3D4RA 3HOVG 3KAKA 2K1BA 1B4OA 4ECZA 4DR5H 5HGTA 1ZYRC 1X55A 1N36L 1HNXQ 1I6HH 2X6LA 2PI2E 4RB1A 2HGSA 5H1SE 2SNMA 1UE5A 3V2TA 1CSPA 5C4XG 1II3A 1SEIA 3D6CA 2FXQA 2UUCQ 4ZUIA 2HCIA 3VR3A 3WOFA 3PIOA 2UXDQ 2PYKA 1ZQ7A 2F0QA 4AYBB 1SNQA 3QWNA 1LO5D 4HNUA 1D2BA 5BMVF 4Y8VB 1I94Q 5I47A 5BN3A 2IX1A 3EVQA 3K8AA 3NENA 1S0OA 1KNAA 4JI5Q 2R93H 1B1ZA 1Y1VB 2C35B 3S9WA 4ECWA 4FXGC 3GV8B 2C22A 1XX8A 3CXCA 4K0KQ 3LP8A 4LSXA 2UUAL 3CC4A 1A6XA 4C5CA 3D4DA 2XNAC 4ZAIA 4LF7L 4IRKA 5IWAH 3GIKA 4EVOA 1W6KA 2R82A 3VPDA 3F1ZA 4RNNA 1NAPA 3N40P 1XMQQ 4DNIA 4A3KH 4GOPB 1PZKD 2Y0SG 2C00A 1S5ED 2F0KA 3SDZA 4NP5A 2NU7B 3NBHB 3WNZA 2R93B 1TA8A 3M85A 1BCPC 4OONA 3PO2G 3N42B 4N9TA 3BVGA 1JORA 2NN6H 3CU7A 1UNSA 1UEAB 2ICEC 3MA2B 3M7NA 2R7ZB 3EA6A 4C2MB 4LF9Q 2QDBA 1FJGL 4RKBA 5JAVA 2RGRA 3NBHA 1SJED 1TWAB 1N33L 3H4DA 3HOVH 2R93A 2DUDA 2KECA 4A3KB 1V4YA 1BQQT 4DL7A 5EBDA 4LFBH 1WOCA 1X56A 5IGCA 1VQ8A 4ZLTF 2R7NA 5D1OA 4AQYL 5KT5A 3I70A 2YZNA 5C4XH 5D1PA 4OWXB 4EQNA 1TWAA 2FK1A 3L4JA 1S9FA 3RN2A 4A93B 3SR1A 2I80A 1YJNA 3HB9A 1XMOL 2WFWA 2YTXA 1NBWA 2G9DA 5KT3A 1K0SA 2DY7A 4DPGA 5CYUA 5HY6A 2A6EC 4GLAC 4ECYA 1AW7A 2R8HA 1DYQA 2KSWA 2W6ZA 4ALPA 4FXDA 3SEBA 2QW7A 2EY6A 5A35A 5M5YH 4JYAH 5TSSA 1CS0A 4G7HC 3PW4A 5I6YA 1EQRA 2B8FA 2R61A 2W9CB 2ZJQA 1E0BA 5C4XB 1R4QB 4CJ0B 3CAMA 3CCRA 3K5NA 2F0TA 2AUKA 3KHRA 2XC9A 2KCNA 4P73A 4DV4Q 1GSOA 1LM0A 4ED3A 4YR0A 2W9CA 4DV0L 5LXTF 2RQXA 1YJ9A 1CKNA 4HNVA 1XPRA 4DR4H 1Q86C 3S1MB 1V9PA 2EYHA 2OF1A 1U4LA 4HIOA 2MGSA 1ENCA 2QKIC 3PO2H 4JV1A 2HIXA 3MHBA 2CQYA 1EZ1A 4PG3A 3MWYW 3Q6SA 4CBVA 1CK1A 2RSNA 2XGQA 2F4VQ 3HRZC 4DR7H 3VR4A 2DN8A 3GQBA 4ILWA 4ECUA 4FBUA 1N9WA 1C0AA 5K5PA 2JK8A 4EX5A 2MQHA 5JPMC 3T53B 3SE0A 4Q0YA 1KEEA 5GROA 1LUZA 5LMUH 2K33A 1EUJA 3H09A 3PO2B 4DAVA 2D2CC 2P5ZX 1U9RA 5BR8L 4BS9A 5LMNL 1XWEA 2A68C 2Y0SA 4RGNA 3M9NB 5KFOA 4IHJF 1VQ9A 3TQTA 1PRTC 2YS7A 3ULPA 1EIHA 4A2AA 4WORA 2K01A 1L0WA 1FD7D 4MHEA 5EPLA 4PMCA 4QQBX 1RTNA 1VQJA 1LTAD 4HNTA 4R4QA 4A3JB 1BOSA 2AGQA 5A2QL 2Z4IA 1SNDA 1XNQL 4TRDA 1ASZA 1GUSA 2QA4A 2R87A 5ELOA 1AH9A 4OHJA 1KBLA 3TRZA 1C4QA 1F9RA 3J7AK 4Q43A 3CRKC 3GTGB 1NMGA 2N88A 4O1NA 3VR5A 4J9SA 2BH8A 5C0XI 2Z4HA 1ET6A 3TP7A 4R4OA 3UDXA 1AFPA 4B3TL 4B3RL 3CCMA 3BVZA 2ZTEA 4CJ1B 2MFIA 1D8LA 5EAYA 1PFMA 4A3BG 4XQNA 1J5EH 3I4LA 1G291 1NR4A 4C3IH 1EY7A 1TKWB 1I7NA 1TQOA 3GTLH 2ASDA 2F0LA 1RJRA 2I5LX 4DK6C 3N44B 4YAJB 1HA6A 4AH6A 3W2DA 2E2HB 1I50B 4LH7A 2K5WA 3M4PA 2XRQD 2Z9HA 3G6YA 2WDTA 1UNNC 5EGTA 5KT2A 5FLXW 1HQRD 5CGKA 3KLSX 4LWCA 5EZYF 2EPBA 1QE6A 2E2HA 1ILQA 4DR1Q 3HP3A 5IGBA 1I50A 4C3IB 4CDDC 1OXSC 4XIGS 2NVQB 4JI1L 1B9MA 3M3YH 4UCOA 3S14B 2EXZA 3PF5A 4CDCC 1U4MA 2ZDGA 4LFCH 2R84A 1VQOA 3T1HH 3BG5A 4RNMA 2KENA 3UI2A 3RZDB 2E5LL 2B63B 3K0YA 3GTLA 2HHHL 1XNRH 2Z1CA 2YYZA 3PR4A 1SCUB 3RAQA 5IP7G 5IGGA 3Q8PB 4RCNA 4DV1H 2IHEA 2Q8IB 5LL6S 1S5BD 1WD1A 3FRPB 1TIID 2BQ3A 4Y7NB 1M6VA 2O03A 3GLKA 4DK0A 1YNND 1S4ZA 4M7EA 1D1KA 4HSPA 2QYZA 1GXDC 1VQHA 4J8QA 1D7QA 1TU2B 4A3BH 1IBMH 4P74A 2RKSA 2P0AA 2F0WA 5KFIA 4IPCA 2NZHA 1YNXA 4HJ9A 3HS0C 3DHQA 3CF5A 4DR2H 2R8JA 3K5HA 4O2DA 2VOBA 1GKHA 3S16H 2Z6KA 2B2TC 1HNZH 1LT3D 2NUAB 2JP1A 1ZETA 1GUTA 2CCZA 2NZOA 5JJLA 3I73A 5D14A 5CORA 3K3PA 1QWYA 2RCFA 4DXFA 5AJ3Q 4A76A 2JA7G 1W3SA 1OXUA 2UUBH 3R2TA 4DL6A 4A3BB 1PH5A 3CD6A 5KFDA 4LFAQ 4OX9Q 2DLNA 1SNMA 4DGZA 2TMPA 1VMPA 3F2CA 4NLGA 4R8IA 4O4HF 1Q8KA 4L5SA 3S16B 3D0FA 2PN1A 4HIDA 4MTDA 2LXJA 1GSAA 5IT9c 5DGBA 1F2MA 3HOYB 4J9KA 3OYYA 4GN3B 1HHVA 2L55A 4IUUA 2D5DA 4FBTA 1JOKA 1ULZA 3T5JA 1VQEA 3RLOA 4N8X1 2MO0A 5IP7H 4QIWB 3ULLA 1LLRD 1CA6A 1EEID 1JICA 2FJ2A 4JI7Q 4C1NI 3HOWB 4GNXC 3HGBA 4ZK9B 1AE3A 2R8IA 2WAQB 1KTKA 2V4RA 3EN2A 1PTOH 4DV2Q 1PDQA 1ZKOA 1WCMG 2F0OA 2YTVA 3G7LA 1IBLQ 5M5WH 2A73B 1C9OA 2XN9C 1N48A 1EU4A 3NBIA 5BPFA 2V58A 1S10A 1PH3A 5C4HA 3R2IA 4X62H 1GUNA 2C2RA 2AQ1B 4YJ2F 2ZXRA 3ORRA 4JI4H 1L1OB 4O4IF 5KG6A 4ODGA 4YWKA 3KLWA 1N36Q 5KFLA 1PTOB 3EBEA 2NZ1D 4O0AA 5F2DA 1Y1WB 2JA7H 1IW7C 5JJKA 3KALA 1HR0H 4HCEA 2EXDA 4YCVA 4IOCA 4KK7A 1X3EA 4DR6H 3CCSA 4WRDA 1SMYD 1L1OA 5C3EB 1PLFA 4R4TA 1JOOA 1SNPA 1GM5A 1I3QH 3V6JA 4UCTA 3NQIA 4BY7G 2BA0A 1LACA 4JI8Q 1V1PA 1L2FA 1FNVA 3B6YA 1GD7A 5KG5A 4RGOS 2I0QA 4LFBL 2BCOA 3BDOA 3K7AH 3OUUA 1H9RA 4ULLA 3JRWA 4TKOB 2UUAQ 5D65A 3P20A 1X6OA 5M5XB 3EPGA 5DM63 4B3MH 4MTNA 4PV1C 5FLXc 4JI3Q 3H94A 3NP8A 4LF7Q 1F2YA 1ET9A 5ELBA 3L0OA 3DEPA 4IFDI 2XTIA 2FPIB 3M4IA 1BO0A 4DV6L 4QWBA 4GC7A 4FP5D 3K6OA 3EJIA 4DF7A 4ED0A 4NXNH 1SE2A 3SK6A 3VA7A 2DGYA 2OXPA 1LT4D 1I3QA 4KY5A 1IYJB 1J8IA 4ZHQF 4K8IA 3K5IA 1A2TA 3E3XA 1BBWA 3I55A 1HUMA 4NMZA 4UAIA 2RVLA 4ABNA 4LF6L 4A3LG 1VF5C 2FHTA 3J81c 1W96A 4A3MG 1KJ8A 4XYLB 5CR3A 1N33Q 5L1JA 4M9UA 4DV5H 3PIPA 3Q24A 5C5JA 3OWEB 1I6VC 4XYOA 4EGVA 2O2LD 1YHAA 4DR4L 3OSPA 5HV6A 3JSLA 1VS0A 1VKZA 2G9HD 3AQQA 4AQYQ 4DUYH 2N78A 1PYSB 3NQTA 5M9OA 4YBZB 3PW7A 1H9SA 2DJGC 1XMOQ 3OIQA 4JC0A 2N3SA 3U50C 4YY3L 5M3FB 1CA5A 4ZQIA 1JXLA 1WR2A 2W9BB 3RAXA 4DR7L 1SYFA 4FF3A 4BY7H 3KBGA 5BPHA 2HDLA 1ML0D 3WDNA 3BA8A 1E2ZA 4QF4A 4IUTA 2OT2A 3E9HA 5C3WA 3GV5B 2W9BA 5FJ8H 1M0WA 2Q2IA 3PQIA 5LMUL 2DPIA 4YJ3F 3J81i 4MA5A 2IT1A 3R5FA 1PTOD 2IX3A 3R5XA 4O3SA 1V1OA 2R7KA 3U4VA 1B44D 1TS5A 3PV0A 3QZ7A 1D6EC 1B9NA 2E2IH 4OO1H 4EYHB 5EKIA 1Q46A 4G57A 1ESFA 4BY7B 4Q0FA 2NTTA 4DV0Q 4NB3A 4YWMA 2QF7A 5KFRA 2A69D 1HCZA 2FP4B 3LWBA 3A7LA 3UDGA 1E4GT 1RJPA 2NN6I 1EY5A 4HR7B 5LYJF 4JPBW 4AYBE 3DF7A 3DMUA 2NVXH 2B2WC 5DG8A 4LAAA 1BCPF 1STNA 4A3MH 2BR0A 4MZ9A 4GKJH 4NDXA 1LTLA 4R8NA 2A5HA 3I4MB 3KHLA 3J7ZC 1EHIA 2VPQA 1MJCA 4HR7A 3U4ZA 5C4JB 2GVAA 2QDLA 5I9OA 3NE5B 5EOYA 5JEAJ 1U0LA 2E2IA 4ZRZA 2PO4A 3SHLA 4LF5H 3NTHA 5BR8Q 4ME5A 4F8MA 5LMNQ 4TQRA 1TWCH 3P75A 1RTOA 2BQUA 1IHZA 3HEJA 3S1NB 3STBD 3A54A 2OTJA 5JEAG 3A0JA 2BDOA 1J5EL 3GV7B 1O7YA 4IO9A 2CW0D 2NVXA 5HBRB 1JWSD 2RHSB 4G7ZC 1LABA 4KHPL 2PBZA 2RDIA 1SYDA 5FLXL 4EGJA 1WTRA 4JBWA 2DY8A 2L12A 4XZ3B 1EL0A 1CQIB 1X54A 4LF8H 3CCLA 5CAEB 5KFBA 4BY1G 4J9QA 4MV7A 4X64H 1KXLA 3IAYA 2VPSA 4IFDG 4JW0A 1TWCA 1KQSA 4HAEA 1O7IA 5EKKA 2MUYA 5BN4A 3GIMA 3SXHA 4GKKH 4B3TQ 4B3RQ 2UU9H 1PYWD 1T94A 3GIIA 4LFCL 3A56A 4XX0B 2EY1A 1SDFA 1I4XA 3RZOH 1IZ6A 4AYBG 2C2EA 1XNRL 3R5HA 2KCCA 1MKHA 2DZDA 1STBA 4DV1L 3S1QB 1IYVA 2RF4A 3CP0A 5DLFA 3I2ZA 4N9PA 3RFCA 1Y1VG 1J9OA 4QUCA 5J2TF 3HFZB 2F0FA 3MFYA 4X66H 4QCLA 5IY0A 3UFXB 2XVSA 3IFDA 1PVOA 3I8ZA 1OXXK 3LWUA 1Q90A 5JEAH 1IBML 4ETSA 4OL7A 2B2YA 3FHWA 3HG9A 4DR2L 1MZBA 4X3KA 4EEQA 1X3PA 2PNRC 1PRTF 3CMAA 1ZXTA 3JAMc 2XWBB 4JI1Q 4NKLA 3LWEA 1F9QA 5M3MH 3MFIA 1BJTA 2ALYB 5KFVA 1SNOA 4NXMQ 2YW2A 4J9OA 3CPFA 3GV3A 1SE3A 4P75A 2R7ZG 1MIUA 2E5LQ 1Z47A 4UP8A 3D3RA 2UUBL 1SEBD 4BY1H 3Q8SB 2ZM6H 3CPWA 2HHHQ 3VR2A 2PVPA 4C1NK 5KFTA 2JA9A 3T1YH 1IXRA 4EBEA 1GGOA 4IFDH 2FK3A 2R3ZA 2JA6B 4IUNA 2DWCA 3HBLA 3EPIA 3TSSA 2Q2HA 2VXWA 1B6SA 4PNYA 4F88A 3BZCA 2D9UA 3S17B 1F2LA 2V1CC 4R9WA 5M3MB 3A8KE 1PMRA 1A2UA 3MWMA 3I91A 4B3SQ 1LTRD 5IT9E 1GVPA 5KNBA 3DWAA 2K5HA 2NN6G 4A93G 1E4EB 5E1FA 1K1SA 5LL6X 2A1AA 2XCPA 2UVVA 1UEBA 2AHOB 2IPKD 4DAPA 2A6ED 4IAJA 4X3SA 3K5MA 4JI0Q 5KNDA 4G4KA 3JAMi 2E75C 1DV2A 2Q2TA 4KN4C 1WH2A 3CCVA 5FPOA 3KDFB 2UXCQ 1SMXA 5KIXA 4R7RA 2KHSA 5KFEA 1HTPA 3G8CA 4IZ8A 4RAUC 1Y1VH 2J4XA 2IA6A 3PN1A 4XT1B 3D6WA 1FKAH 3ERSX 4HJ7A 4I65A 4GS3A 3QFFA 3TIGA 2NB0A 3KDFA 3CQZB 3K81C 4YAKB 2FINB 1LTGD 2OQKA 5LHY1 4XXEA 4RNOA 5ELFA 1S3OA 4XQQA 2K6AA 1G91A 2AQ4A 5BN5A 5IODA 4POGA 1PH8A 4LUVA 4DUZH 4UCVA 4JI4L 4AYBA 5FLMH 4Y52H 4ECSA 3A8JE 3RJ0A 3OPOA 3K59A 1Z6HA 2R7ZH 1FGUA 1AUVA 1P16A 5C44B 5DQIA 4C2MH 1BF4A 1GYFA 4N8FA 1DM0B 2WYOA 1LV9A 2KEEA 1N34H 1E3PA 1XMQH 1TWAH 1Y1VA 3RV4A 4MIUA 3GTOH 1W93A 4ME6A 3IKJA 1KLUD 3X3NA 1M4VA 4LNQA 2FKLA 2A19A 2NU8B 2V9WA 4KMUC 2L4NA 4LF9H 3MJFA 3BDLA 4A93H 4GOPA 2DNEA 2JSOA 2YRWA 2CW8A 4OIJA 4TV9F 4RH6A 5JQWA 4B3ML 2O4XA 1I6UA 1U4RA 1X3GA 4X3UA 2VL6A 5FLXE 4A75A 3GTOB 2FPGB 4PMBA 4X65L 2J9GA 4JCVE 2JEIA 4QMGA 2R7ZA 4C2MA 4KN7C 5KFKA 1B04A 3M9OB 4A3JG 1WYDA 1VQ7A 5JVDF 3GTOA 4F4YA 3FKIG 3T56B 5G3LF 2F0GA 3BDCA 2CH4A 3M4YA 4JK1C 5KFJA 4CC6A 3I72A 3J81E 1V8QA 1HNWL 3DLLA 1Q1BA 5HGQA 4DAMA 4QGUA 3S1MH 5FO8B 5KFNA 4LFBQ 3UQ8A 1B50A 4DUYL 1YJWA 3K0XA 4Q8FA 1BUVT 1J6QA 1YHBA 2MP1A 4Q8EA 2N49A 4HQ6A 3TS2A 3TMEA 5I6WA 3V05A 3D8GA 1K3RA 4QY7A 4ZI7F 3QIAA 4ECRA 5GADC 3W1GA 2OWOA 4B9WA 4DV6Q 4J1MA 3RR5A 1RODA 3KHGA 5I2XA 3CC2A 3TP5A 2WACA 2C5CA 2I46A 4GZYC 3UDFA 5KYLA 1NY4A 2XCLA 1ENAA 1Z2NX 4F87A 1UE1A 2F4VH 2WB1B 2OCEA 1RHPA 3RUZA 3TEHB 1EIYB 4LF6Q 2R7DA 1TWGH 1GUWA 4UDUC 4C3IG 1VQDA 2Q8RE 1K8OA 5IT9W 4IOAA 4R4CA 2WE6A 1YNJD 4DR4Q 4A3JH 3DM3A 5T14A 1ZHSA 3GIQA 4HYKA 1CSQA 3FKIH 3QG1A 3T16A 2ALZA 4J6HA 4WJ4A 4XDXA 3G6JB 2QEJC 4QIWE 1EWIA 3RBEA 2R6GA 3KLRA 3H20A 1E1OA 2NU6B 2RHQB 5AFWA 2B63G 2B2YC 1EYZA 4YY3Q 3MR3A 2NUCA 2W70A 1BR9A 1TWGB 2VQEL 2YRXA 5EBCA 3GTGH 4DR7Q 1WI5A 3Q2OA 3RTXA 1KC7A 3OTOH 4AIMA 1VQLA 2YU9B 4IR9A 1XTCD 2HD3A 4MNOA 2V59A 1SYCA 5CB4F 1TWHH 2ZTDA 4BBSB 2H1EA 3FEWX 2E76C 1TWGA 3FKIB 4F4WA 1SR3A 5LMUQ 3NPPA 1VQNA 1QILA 1E22A 4A3GB 2YU9A 2LFNA 4EFEA 2W6QA 1CZWA 1SFOH 4LF5L 1AP0A 5CBAE 3PUYA 2VY3A 3VYUA 5C5LA 4QL5A 1BDOA 2F0EA 4A3CG 5DLGA 3BQ1A 4YR3A 1MHWC 4U6PA 4MTKA 1WTPA 2JEJA 3FKIA 2B2VA 3VPCA 5GAEC 2QCPX 1NSNS 1GOZA 2VZAA 5HURA 2IY5B 2RDJA 2XWJB 3GTKB 1TWHB 1PH2A 2E2HH 5KFAA 4DV7L 1I50H 2NVTB 1QVFA 1YEZA 4DXGA 5IE8A 2GPWA 1L0YB 2J6UA 3GTGA 5C6AA 2G5DA 3J80c 3E0EA 2AQ2B 1QUQB 4ID6A 2VQFL 2DNCA 1SFOB 1PH1A 2EYOA 2WIIB 4DA2A 4WJWA 4PZ6A 1TWHA 4LF8L 3C0FB 2LMCB 2I5MX 2ZXOA 2I8CA 3RIZA 3GIJA 3NXWA 1EFID 2NVQH 4X64L 1EFWA 3H0GB 1EYGA 3BZDB 4JI6H 1SFOA 3S14H 3VPBA 4O2AF 4J9PA 3HOYG 2C2DA 4TVAB 2VNUD 4HTHA 4GKKL 3RZDH 2B63H 2JXMB 4LUOA 4YR2A 2KQ3A 3BABA 1C3OA 4DR1H 4A2BA 1R9TB 4U673 1C30A 4DK1A 4WBNF 4RAYA 3S1RB 4NPSA 4ME3A 3TQYA 3PR5B 3S2HB 1VQGA 1J5EQ 1HZBA 3BYTB 4ZQ3A 1T9HA 1CHPD 3CCUA 3HOWG 4O3NA 4RB3C 3U9SA 3PCOB 3M9MB 1E4FT 2WAQG 5D3IB 3J80i 4Y7NH 4K14A 1S68A 1W6JA 3C46A 4LMYA 4K2LA 5FPRA 4KHPQ 3K57A 4PWQA 4OWTB 1EWHA 4C3HB 3J81W 4OO1I 1BNCA 2V4DA 1BNZA 2F1MA 4K5XA 1JIHA 4QWCA 4ZUJA 1WTHA 1N32H 3LX0A 4X66L 4A3CH 2CHBD 1IKMA 3H40A 1X3FA 1NCVA 3TZUA 3IRBA 2EYPA 3GO5A 3Q1KA 4DR3H 4FNFA 3NHHA 1Z2PX 2B63A 2R92G 2VB2X 1EZ8A 4JVZA 4GOPC 3JAME 3N43B 1Y1WG 3E6ZX 5IGDA 4RKLA 2JEFA 5DNFA 3WWVA 4LFCQ 1S97A 5FKAC 3Q23A 1OWTA 1JJ2A 5C3EG 2F0MA 1KDCA 1RL2A 2ZM6L 3GILA 1OXVA 1XNRQ 4FYDA 4CC5A 2UXBH 4LK1C 1STGA 2KHIA 4IUVA 3MWEA 3T1YL 3MXNB 1OXTA 4RFBA 1WTVA 5DLQE 4DV1Q 3HOYH 3PMFA 3ZYYX 3HOZH 1SYEA 1PK8A 2R6FA 5LL6b 4QWAA 3K5OA 1SJHD 1MD2D 2OLSA 1SXTA 1VQ4A 2K04A 4QW9A 3MXNA 1STAA 2OEOA 5F9LA 2B2UA 5J1ZA 4F4XA 4LH6A 4RMFA 3EROA 1IBMQ 2Z6BA 3AB9A 3HOWH 4U7CA 2IJ0A 4BBRB 4DR2Q 4FO2A 5JVLA 3M4OB 2SEBD 4DR5L 1WTXA 1GSHA 4LW1A 1HQMC 2ICIA 2XD4A 2CQOA 5KFQA 3HOZB 3SVMA 2IMWP 3F8TA 3S2DH 2WTFA 1E2VA 4I4TF 2EJFC 3G6XA 1KHIA 1KRSA 1CTMA 2LKVA 2DJFC 2JJQA 1EOTA 2BE5D 3R93A 4ED8A 1I4PA 3JC66 3G4SA 4NW2A 4A3FH 2UUBQ 2E2DC 4JUZA 3HKZB 2J0TD 4GN4B 5IP9G 1SE4A 1RF2D 4X6AH 2R92H 5C5MA 4JOIA 4DV2H 2AU0A 1D5ZC 5KT4A 4DUZL 4QIWA 1Y1WH 4OEMB 1IBLH 3AFQA 5CA0F 3HKZA 4R1JA 3OOCA 3S2DB 2Z8LA 3BJUA 3SI8A 1CQFA 1EQQA 3CKIB 2WAQA 2F52A 4A3FB 5C3EH 4EQOA 4FF2A 1PH9A 5M3FG 5IWAL 2SOBA 1SRUA 4BXXH 1N34L 1XMQL 4J9NA 5ISRA 3RD4A 3URYA 4DK3C 3J7YW 1YHQA 1DV1A 2W6NA 4H44C 2R92B 5ELDA 1FVIA 1ONLA 4DKAC 2RDGA 2YS6A 3FPUB 2X6GA 1HTLD 1VQAA 5CV8A 4ZYSA 4DNTB 1S5CD 1N8RC 4RA8A 4E6IA 1MJEA 1H9MA 5M5XH 2R92A 1P8LA 1HR0W 5IYDG 3SE7A 5DM73 1G6ZA 1Y1WA 4L63B 4JI8H 1JB3A 3HXLA 1CHQD 2F3IA 3W5OA 1K3BC 2E2JB 1JWMD 3MZ5A 2BDNA 2IL8A 4A3IH 3RN5A 1X9NA 1M1KC 3MAQA 1H9JA 2UVWA 4JI4Q 1NMFA 1K8MA 1YNNC 2PMZB 3NWSA 5FJ8G 4LJZC 1O75A 3GTQH 3DXJC 4JI3H 4LF7H 3BS1A 1DD2A 3H3VH 4DU9A 4QW8A 2EIFA 4ZKBB 1W2BA 1ASYA 1B7YB 5IP9H 2B2VC 4OO1G 1K83H 4LUZA 5EPKA 3I4MG 2PMZA 3ZJYC 4F7XA 2PNHA 1TXYA 2L0CA 4A3IB 4FF4A 1V51A 3E5NA 4JYAL 5J39A 4F4ZA 4RGTA 4IJLA 2A6HD 1EWCA 1EIGA 2LSSA 1XTDA 3GTQB 4GC6A 3V4SA 2FLLA
chains in the Genus database with same CATH topology
2YTXA 3A5ZB 1NBWA 4DV1L 5M3FH 1V1QA 2RF4A 1FJGQ 3CP0A 4C3JH 2RCNA 4DPGA 3I2ZA 5HY6A 2ID0A 4GLAC 4B3MQ 1Y1VG 4ALPA 4NXML 3HFZB 3A74A 4X65Q 5IY0A 5M5YH 1PVOA 3UE1A 5IYCG 3T1HQ 1OXXK 2K75A 1IBML 1EQRA 4PMWA 5GAHC 2ZJQA 1N32Q 3FHWA 4BXXG 4DR2L 4BBRH 3CAMA 3CCRA 3CMAA 3M4OH 5IYDH 3JAMc 4DR3Q 3GDEA 4JI1Q 4P73A 3RLNA 4DV4Q 1LM0A 5M3MH 4B3SL 2Z0SA 4DV0L 2CWAA 2Q2UA 4L5QA 2ALYB 1YJ9A 1PA6A 1CKNA 4DV3L 1XPRA 4NXMQ 1Q86C 1HNWQ 3CPFA 4P75A 1G51A 2R7ZG 1MIUA 1V9PA 1Z47A 2KCMA 4UP8A 3HOXH 2E5LQ 2UUBL 1VQIA 4HIOA 4BY1H 3CPWA 4JI0L 2HHHQ 3KF8B 3PO2H 4BA2I 2HIXA 4PG3A 2JA9A 2MO1A 1IXRA 4HJ5A 2BA1A 4A3DH 2UXCL 1HNXL 1G6PA 4DUYQ 2F4VQ 1KC8C 2Q2HA 2UXBQ 4A3IG 3BZCA 3RLFA 4A4IA 1HNZQ 3I4MH 2V1CC 4PZ7A 1N9WA 1C0AA 2AWNA 4B3SQ 2UUCL 3PUZA 1GVPA 2JK8A 4EX5A 3OTOL 2MQHA 5C4JH 2K5HA 2NN6G 4A93G 2UXDL 5GROA 3PUXA 2A1AA 1LUZA 4HJAA 1UEBA 2AHOB 1QZHA 1EUJA 4JI0Q 3JAMi 4HIMA 5BR8L 1I94L 3HOUG 2K5VA 5LMNL 2Q2TA 4OWWB 1VQCA 3CCVA 1UE6A 3KDFB 1QZGA 4JBKA 2UXCQ 1SMXA 1S72A 4JI5L 3S1NH 1VCIA 1VQ9A 1Y1VH 3ULPA 2Z6KC 4K0KL 3L2PA 2H5XA 3ERSX 1L0WA 4HJ7A 1PV4A 4GS3A 1Z9FA 5IYCH 4JG2A 2KHJA 2PQAB 1UWVA 3KDFA 4QQBX 1VQJA 4A3DG 4R4QA 3J81j 3K81C 5C0XJ 1VQBA 2OQKA 2K50A 1Q1EA 1S3OA 1XNQL 1QVCA 2YTYA 3E9IA 1ASZA 4POGA 1PH8A 2QA4A 2E2JH 1SN8A 4LUVA 1PHJA 5ELOA 1AH9A 2PQAA 3TRZA 3KOJA 4JI4L 5FLMH 4Y52H 1GO3E 5C0XG 2VQEQ 2EQSA 2D0PA 2R7ZH 1NMGA 1FGUA 1P16A 5ELNA 4LF9L 4C2MH 2BH8A 3KF6B 5C0XI 2JA6G 3CW2C 2L15A 4R4OA 1E3PA 3UDXA 1TWAH 4B3TL 2JE6I 4JI6L 4B3RL 3CCMA 1KRTA 2ZTEA 5M3MG 3GTOH 3GTMH 2MFIA 1XNQQ 1D8LA 3AFPA 4TQUS 5EAYA 1K9MC 4X62Q 4XTCS 1EOVA 5IYBH 4GLXA 3KF6A 4A3BG 2IHFA 4LF5Q 4LNQA 2A19A 1G291 2B29A 4C3IH 4J15A 1WJJA 3F2BA 3M4QA 4A93H 5E7NA 2N8NA 3Q8DA 4GOPA 1K8GA 1HR0Q 1EIFA 1KAWA 3GTLH 3S1QH 2I5LX 4DK6C 4DR6Q 4AH6A 3PSIA 4B3ML 2ATWA 1X3GA 3HOUH 2VL6A 3M4PA 4DV7Q 5JJIA 4A75A 3CMEA 4X65L 4JCVE 1JJGA 3T1HL 2AMCB 2VQFQ 4LWCA 1N32L 4A3JG 1WYDA 4DR1Q 4LF8Q 3CC7A 1YZ6A 1VQ7A 1OXSC 1Q82C 3FKIG 4XIGS 4DR3L 4JI1L 4L5TA 4X64Q 3M3YH 4DV4L 4YCWA 3PF5A 2K52A 3BZKA 2HQLA 2JA8G 1V43A 1L1OC 1VQOA 1HNWL 3DLLA 2KENA 2D0OA 1Q1BA 2E5LL 4GKKQ 5HGQA 4DAMA 4QGUA 3AYHB 1NE3A 5C44G 2VUMG 3S15H 3S1MH 2HHHL 2YYZA 4UP7A 1U5KA 5IP7G 3GTPH 1WCMH 4NXNQ 4LFBQ 3S24A 2IHEA 4DUYL 1X65A 3K0XA 3CCJA 1YJWA 1CUKA 3CCEA 1YHBA 1J6QA 2F4VL 2JA6H 2UXBL 1HNZL 2N49A 1B70B 2WB1E 3TS2A 3S17H 1VQFA 2HIVA 5FLMG 3G6EA 2D62A 1K3RA 4QY7A 5GADC 3W1GA 2OWOA 3GD7A 1S40A 4DV6Q 1VQHA 1D7QA 4DAYB 4A3BH 3RR5A 4P74A 4DV5Q 1H95A 3CC2A 4IPCA 1YVCA 2NZHA 1YNXA 4X66Q 2ZJRA 4HJ9A 2JEBI 3CF5A 3UDFA 1NY4A 4O2DA 1GKHA 1UE1A 3S16H 2OCEA 2Z6KA 4YWLA 4LF4Q 3TEHB 1SLJA 5IYBG 1PH7A 1EIYB 4EQ5A 2CCZA 2WP8J 4LF6Q 2NZOA 5JJLA 2NVYH 1NTGA 2R7DA 3G48A 1TWGH 2K14A 2JA7G 5AJ3Q 4A76A 4JBJA 1VQDA 1W3SA 1OXUA 1PH5A 3CD6A 1A62A 4IOAA 4R4CA 3CQZH 4LFAQ 5GQOA 4OX9Q 4DR4Q 4A3JH 3DM3A 3NEMA 3STBC 3HKSA 3F2CA 3K7UC 3W1BA 1CSQA 3FKIH 4GLVB 1Q8KA 2ZTCA 2ZM6Q 4L5SA 3I4NG 4JV5Q 3D0FA 4QIWE 4UPAA 4WJ4A 1EWIA 4HJ8A 1E7ZA 4HIDA 2R6GA 1M90C 2LXJA 1YI2A 1E1OA 3T1YQ 2RHQB 2B63G 5IT9c 5K36G 4YY3Q 4KI0A 2ES2A 4DV2L 1WFQA 3OYYA 4GN3B 2JA8H 2VQEL 3GTGH 4DR7Q 1WI5A 4AIMA 1VQLA 4YCUA 2VUMH 5C44H 1VQEA 1BBUA 3RLOA 4MNOA 1K8AC 1Q12A 4P72A 2MO0A 1TWHH 5IP7H 4A3EG 2ZTDA 3ULLA 1CKMA 1JJCB 1HJPA 4R4IA 3KFUA 4QJFA 1SR3A 5LMUQ 4JI7Q 4PZ8A 1VQNA 4GNXC 1E22A 3KYHC 5J3BA 4X62L 1AE3A 3EIVA 4A3LH 1SFOH 4LF5L 3PUYA 5LMNW 4DR5Q 2VY3A 2A8VA 3EN2A 4QL5A 4A3CG 4DV2Q 4OXPA 1WCMG 2YTVA 4P71A 1HR0L 4GKJQ 2CWPA 4APVA 1IBLQ 5M5WH 1KL9A 1C9OA 5GAEC 1YIJA 4YHHQ 2VZAA 2CFMA 2WB1G 2OTLA 4DR6L 2IY5B 1PH2A 2E2HH 1KIXA 3J7A5 4DV7L 1I50H 1PH3A 1QVFA 1YEZA 5IE8A 1OTCA 3AEVA 2GN5A 1KD1C 3J80c 1BVSA 3E0EA 4JI8L 4POFA 1QUQB 4JI2Q 2VQFL 2ASBA 1L1OB 1PFSA 2AKWB 1PH1A 1JMCA 4YWKA 3KLWA 1N36Q 3KJOA 4PZ6A 3EBEA 2E8GA 4O0AA 4DR1L 4LF8L 2JA7H 5JJKA 1C7YA 4DUZQ 4JOIC 4YCVA 2EXDA 2I5MX 4IOCA 1XJVA 1FL0A 1X3EA 2JEAI 3H15A 2MNAA 2NVQH 4X64L 1EFWA 4JI3L 3CCSA 2AWOA 3F2DA 1EYGA 1L1OA 3FP9A 4R4TA 3S14H 2GVBA 1GM5A 1I3QH 3HOYG 3I4NH 2YV5A 5IWAQ 4TVAB 3MEFA 1B8AA 2VNUD 1N34Q 4BY7G 4GKKL 2QGQA 2BA0A 3I56A 3RZDH 4UY8C 4JI8Q 4H02A 2B63H 4IFDJ 1K0RA 1HZCA 1L2FA 4LUOA 2IX0A 1TWFH 3B6YA 1GD7A 2I0QA 4NXNL 4LFBL 1QVGA 3K7AH 1HH2P 4NPSA 4ME3A 3TQYA 4JBMA 4BBSG 2BH2A 1VQGA 1J5EQ 1HZBA 3CCUA 1T9HA 3HOWG 3KJPA 2UUAQ 3PCOB 1X6OA 4A3EH 4A3GG 4MTNA 2WAQG 3J80i 5FLXc 4Y7NH 4BA1I 1Q81C 1YBYA 4JI3Q 4LF7Q 4GN5A 2JA5G 3PO3H 3L0OA 4KHPQ 4IFDI 1JT8A 2XTIA 4UP9A 1IBKQ 4OWTB 4DV6L 4OO1I 4DV5L 2UU9Q 3UE0A 4X66L 4A3CH 1A63A 2R7FA 1X3FA 2DGYA 1JB7A 3IRBA 4IPGA 3GO5A 1IYJB 1K73C 1BBWA 3I55A 4LF4L 2R92G 4LF6L 4FDBA 4A3LG 3J81c 1XPOA 4A3MG 3PO3G 2QEXA 4GOPC 3PGZA 5AJ3L 1VQ6A 1N33Q 1Y1WG 2KCTA 2VS1A 1A0IA 1JE5A 3PIPA 3ER0A 3UDIA 1YHAA 4LFAL 4OX9L 3WWVA 1BKBA 3I7FA 4LFCQ 4DR4L 3L7ZC 3H0GG 2XGTA 1VS0A 1JJ2A 5C3EG 4JYAQ 3TREA 3AQQA 1RL2A 2ZM6L 4AQYQ 4JV5L 1OXVA 1PYSB 2N78A 1CKNB 2OQ0A 1XNRQ 2UXDQ 1CKOA 2KHIA 3T1YL 3MXNB 1OXTA 3I4OA 1VQMA 4JC0A 2N3SA 3U50C 4YY3L 4GNXB 5DLQE 4DV1Q 1XMOQ 1HZAA 1XPUA 3HOYH 4DR7L 3HOZH 1A8VA 1SROA 4L5RC 2R93G 4BY7H 3K80C 2YU9H 1I5FA 4IJHA 2K4KA 3A5UA 1VQ4A 2Y0SE 3E9HA 4RG1A 4GNXA 3PUVA 4BBSH 4RMFA 2VW9A 1IBMQ 5FJ8H 4WJ3M 2Q2IA 5LMUL 4HIKA 4JI7L 3HOWH 3J81i 2IT1A 4DR2Q 1PYBA 4A3GH 3HKZE 4A3KG 1HZ9A 4KHZA 1Q7YC 3U4VA 3PV0A 4DR5L 4LW1A 1YITA 2JA5H 2CQOA 2E2IH 1NJIC 1Q46A 2WAQE 1AE2A 4GKJL 3F8TA 2CKZB 2JQOA 3G71A 4DV0Q 4NB3A 1IBLL 3S2DH 4YWMA 1KHIA 1KRSA 4YHHL 4DV3Q 2JJQA 3D31A 1PH4A 3JC66 3G4SA 3CCQA 4A3FH 3GTKH 2UUBQ 2NVTH 3UDGA 4GN4B 2NN6I 5IP9G 3ICEA 4IPHA 3H3VI 5GAGC 3NELA 3HOVG 4AYBE 3RNUA 4JI2L 2NVXH 4X6AH 2R92H 1IL2A 4JOIA 1X55A 1N36L 1HNXQ 4A3MH 4MZ9A 1I6HH 2PI2E 1LTLA 4DUZL 5H1SE 3PUWA 1Y1WH 3AFQA 3J7ZC 1UE5A 4R1JA 3PF4A 1CSPA 1MJCA 5C4XG 3BJUA 2FXQA 2UUCQ 3U4ZA 2GVAA 1EQQA 3OTOQ 3H0GH 3PIOA 2F52A 1LYLA 1E1TA 1RIPA 5JEAJ 2KBNA 5C3EH 1U0LA 1PH9A 5M3FG 1VQKA 5IWAL 1SRUA 4BXXH 1N34L 1XMQL 3GTJH 4DK3C 1YHQA 5BR8Q 1I94Q 1VQ5A 5LMNQ 1DGSA 1FVIA 1TWCH 2HT1A 3LGJA 4DKAC 2LXKA 3K8AA 2IX1A 2B3GA 3NENA 2ZJPA 1R9TH 3STBD 4JI5Q 1VQAA 2R93H 2OTJA 3S1RH 5JEAG 1VQPA 2C35B 3A0JA 3M9BA 1N8RC 1J5EL 3S2HH 3CXCA 4K0KQ 2UUAL 3CC4A 4IO9A 2PI2A 4BBRG 1QUQA 5M5XH 1MJEA 2PMZE 4LF7L 1E24A 3VDYA 1P8LA 1HR0W 2RHSB 5IYDG 2K5NA 3TS0A 4KHPL 1IBKL 3F1ZA 3SGIA 3HOZG 4JBWA 1XMQQ 4DNIA 3U58A 4A3KH 2F3IA 4GOPB 2Y0SG 4C3HH 2UU9L 3W5OA 1X54A 4A3IH 3RN5A 3CCLA 1X9NA 3ULJA 1M1KC 3NBHB 3HOXG 4BY1G 3M85A 4JI4Q 4OONA 1NMFA 1PH6A 3HKZG 3PO2G 5FJ8G 3GTQH 1UE7A 1Y14B 1KXLA 3BU2A 3H3VH 3M7NA 4IFDG 4LF9Q 4KLKA 3OW2A 2EIFA 1KQSA 1W2BA 1ASYA 1FJGL 2I5HA 1B7YB 1O7IA 5IP9H 4OO1G 1K83H 1N33L 4LUZA 1SE8A 3HOVH 2DUDA 4B3TQ 4JI6Q 3I4MG 4B3RQ 3ZJYC 4IPDA 2PNHA 4LFCL 1TXYA 1WOCA 1X56A 1VQ8A 4JYAL 4A3FG 3RZOH 4AQYL 1IZ6A 4AYBG 4IJLA 5C4XH 4OWXB 1XNRL 3RN2A 2LSSA 1XTDA 1MKHA 1YJNA 1XMOL 2WFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTX A;  3A5Z B;  1NBW A;  4DV1 L;  5M3F H;  1V1Q A;  2RF4 A;  1FJG Q;  3CP0 A;  4C3J H;  2RCN A;  4DPG A;  3I2Z A;  5HY6 A;  2ID0 A;  4GLA C;  4B3M Q;  1Y1V G;  4ALP A;  4NXM L;  3HFZ B;  3A74 A;  4X65 Q;  5IY0 A;  5M5Y H;  1PVO A;  3UE1 A;  5IYC G;  3T1H Q;  1OXX K;  2K75 A;  1IBM L;  1EQR A;  4PMW A;  5GAH C;  2ZJQ A;  1N32 Q;  3FHW A;  4BXX G;  4DR2 L;  4BBR H;  3CAM A;  3CCR A;  3CMA A;  3M4O H;  5IYD H;  3JAM c;  4DR3 Q;  3GDE A;  4JI1 Q;  4P73 A;  3RLN A;  4DV4 Q;  1LM0 A;  5M3M H;  4B3S L;  2Z0S A;  4DV0 L;  2CWA A;  2Q2U A;  4L5Q A;  2ALY B;  1YJ9 A;  1PA6 A;  1CKN A;  4DV3 L;  1XPR A;  4NXM Q;  1Q86 C;  1HNW Q;  3CPF A;  4P75 A;  1G51 A;  2R7Z G;  1MIU A;  1V9P A;  1Z47 A;  2KCM A;  4UP8 A;  3HOX H;  2E5L Q;  2UUB L;  1VQI A;  4HIO A;  4BY1 H;  3CPW A;  4JI0 L;  2HHH Q;  3KF8 B;  3PO2 H;  4BA2 I;  2HIX A;  4PG3 A;  2JA9 A;  2MO1 A;  1IXR A;  4HJ5 A;  2BA1 A;  4A3D H;  2UXC L;  1HNX L;  1G6P A;  4DUY Q;  2F4V Q;  1KC8 C;  2Q2H A;  2UXB Q;  4A3I G;  3BZC A;  3RLF A;  4A4I A;  1HNZ Q;  3I4M H;  2V1C C;  4PZ7 A;  1N9W A;  1C0A A;  2AWN A;  4B3S Q;  2UUC L;  3PUZ A;  1GVP A;  2JK8 A;  4EX5 A;  3OTO L;  2MQH A;  5C4J H;  2K5H A;  2NN6 G;  4A93 G;  2UXD L;  5GRO A;  3PUX A;  2A1A A;  1LUZ A;  4HJA A;  1UEB A;  2AHO B;  1QZH A;  1EUJ A;  4JI0 Q;  3JAM i;  4HIM A;  5BR8 L;  1I94 L;  3HOU G;  2K5V A;  5LMN L;  2Q2T A;  4OWW B;  1VQC A;  3CCV A;  1UE6 A;  3KDF B;  1QZG A;  4JBK A;  2UXC Q;  1SMX A;  1S72 A;  4JI5 L;  3S1N H;  1VCI A;  1VQ9 A;  1Y1V H;  3ULP A;  2Z6K C;  4K0K L;  3L2P A;  2H5X A;  3ERS X;  1L0W A;  4HJ7 A;  1PV4 A;  4GS3 A;  1Z9F A;  5IYC H;  4JG2 A;  2KHJ A;  2PQA B;  1UWV A;  3KDF A;  4QQB X;  1VQJ A;  4A3D G;  4R4Q A;  3J81 j;  3K81 C;  5C0X J;  1VQB A;  2OQK A;  2K50 A;  1Q1E A;  1S3O A;  1XNQ L;  1QVC A;  2YTY A;  3E9I A;  1ASZ A;  4POG A;  1PH8 A;  2QA4 A;  2E2J H;  1SN8 A;  4LUV A;  1PHJ A;  5ELO A;  1AH9 A;  2PQA A;  3TRZ A;  3KOJ A;  4JI4 L;  5FLM H;  4Y52 H;  1GO3 E;  5C0X G;  2VQE Q;  2EQS A;  2D0P A;  2R7Z H;  1NMG A;  1FGU A;  1P16 A;  5ELN A;  4LF9 L;  4C2M H;  2BH8 A;  3KF6 B;  5C0X I;  2JA6 G;  3CW2 C;  2L15 A;  4R4O A;  1E3P A;  3UDX A;  1TWA H;  4B3T L;  2JE6 I;  4JI6 L;  4B3R L;  3CCM A;  1KRT A;  2ZTE A;  5M3M G;  3GTO H;  3GTM H;  2MFI A;  1XNQ Q;  1D8L A;  3AFP A;  4TQU S;  5EAY A;  1K9M C;  4X62 Q;  4XTC S;  1EOV A;  5IYB H;  4GLX A;  3KF6 A;  4A3B G;  2IHF A;  4LF5 Q;  4LNQ A;  2A19 A;  1G29 1;  2B29 A;  4C3I H;  4J15 A;  1WJJ A;  3F2B A;  3M4Q A;  4A93 H;  5E7N A;  2N8N A;  3Q8D A;  4GOP A;  1K8G A;  1HR0 Q;  1EIF A;  1KAW A;  3GTL H;  3S1Q H;  2I5L X;  4DK6 C;  4DR6 Q;  4AH6 A;  3PSI A;  4B3M L;  2ATW A;  1X3G A;  3HOU H;  2VL6 A;  3M4P A;  4DV7 Q;  5JJI A;  4A75 A;  3CME A;  4X65 L;  4JCV E;  1JJG A;  3T1H L;  2AMC B;  2VQF Q;  4LWC A;  1N32 L;  4A3J G;  1WYD A;  4DR1 Q;  4LF8 Q;  3CC7 A;  1YZ6 A;  1VQ7 A;  1OXS C;  1Q82 C;  3FKI G;  4XIG S;  4DR3 L;  4JI1 L;  4L5T A;  4X64 Q;  3M3Y H;  4DV4 L;  4YCW A;  3PF5 A;  2K52 A;  3BZK A;  2HQL A;  2JA8 G;  1V43 A;  1L1O C;  1VQO A;  1HNW L;  3DLL A;  2KEN A;  2D0O A;  1Q1B A;  2E5L L;  4GKK Q;  5HGQ A;  4DAM A;  4QGU A;  3AYH B;  1NE3 A;  5C44 G;  2VUM G;  3S15 H;  3S1M H;  2HHH L;  2YYZ A;  4UP7 A;  1U5K A;  5IP7 G;  3GTP H;  1WCM H;  4NXN Q;  4LFB Q;  3S24 A;  2IHE A;  4DUY L;  1X65 A;  3K0X A;  3CCJ A;  1YJW A;  1CUK A;  3CCE A;  1YHB A;  1J6Q A;  2F4V L;  2JA6 H;  2UXB L;  1HNZ L;  2N49 A;  1B70 B;  2WB1 E;  3TS2 A;  3S17 H;  1VQF A;  2HIV A;  5FLM G;  3G6E A;  2D62 A;  1K3R A;  4QY7 A;  5GAD C;  3W1G A;  2OWO A;  3GD7 A;  1S40 A;  4DV6 Q;  1VQH A;  1D7Q A;  4DAY B;  4A3B H;  3RR5 A;  4P74 A;  4DV5 Q;  1H95 A;  3CC2 A;  4IPC A;  1YVC A;  2NZH A;  1YNX A;  4X66 Q;  2ZJR A;  4HJ9 A;  2JEB I;  3CF5 A;  3UDF A;  1NY4 A;  4O2D A;  1GKH A;  1UE1 A;  3S16 H;  2OCE A;  2Z6K A;  4YWL A;  4LF4 Q;  3TEH B;  1SLJ A;  5IYB G;  1PH7 A;  1EIY B;  4EQ5 A;  2CCZ A;  2WP8 J;  4LF6 Q;  2NZO A;  5JJL A;  2NVY H;  1NTG A;  2R7D A;  3G48 A;  1TWG H;  2K14 A;  2JA7 G;  5AJ3 Q;  4A76 A;  4JBJ A;  1VQD A;  1W3S A;  1OXU A;  1PH5 A;  3CD6 A;  1A62 A;  4IOA A;  4R4C A;  3CQZ H;  4LFA Q;  5GQO A;  4OX9 Q;  4DR4 Q;  4A3J H;  3DM3 A;  3NEM A;  3STB C;  3HKS A;  3F2C A;  3K7U C;  3W1B A;  1CSQ A;  3FKI H;  4GLV B;  1Q8K A;  2ZTC A;  2ZM6 Q;  4L5S A;  3I4N G;  4JV5 Q;  3D0F A;  4QIW E;  4UPA A;  4WJ4 A;  1EWI A;  4HJ8 A;  1E7Z A;  4HID A;  2R6G A;  1M90 C;  2LXJ A;  1YI2 A;  1E1O A;  3T1Y Q;  2RHQ B;  2B63 G;  5IT9 c;  5K36 G;  4YY3 Q;  4KI0 A;  2ES2 A;  4DV2 L;  1WFQ A;  3OYY A;  4GN3 B;  2JA8 H;  2VQE L;  3GTG H;  4DR7 Q;  1WI5 A;  4AIM A;  1VQL A;  4YCU A;  2VUM H;  5C44 H;  1VQE A;  1BBU A;  3RLO A;  4MNO A;  1K8A C;  1Q12 A;  4P72 A;  2MO0 A;  1TWH H;  5IP7 H;  4A3E G;  2ZTD A;  3ULL A;  1CKM A;  1JJC B;  1HJP A;  4R4I A;  3KFU A;  4QJF A;  1SR3 A;  5LMU Q;  4JI7 Q;  4PZ8 A;  1VQN A;  4GNX C;  1E22 A;  3KYH C;  5J3B A;  4X62 L;  1AE3 A;  3EIV A;  4A3L H;  1SFO H;  4LF5 L;  3PUY A;  5LMN W;  4DR5 Q;  2VY3 A;  2A8V A;  3EN2 A;  4QL5 A;  4A3C G;  4DV2 Q;  4OXP A;  1WCM G;  2YTV A;  4P71 A;  1HR0 L;  4GKJ Q;  2CWP A;  4APV A;  1IBL Q;  5M5W H;  1KL9 A;  1C9O A;  5GAE C;  1YIJ A;  4YHH Q;  2VZA A;  2CFM A;  2WB1 G;  2OTL A;  4DR6 L;  2IY5 B;  1PH2 A;  2E2H H;  1KIX A;  3J7A 5;  4DV7 L;  1I50 H;  1PH3 A;  1QVF A;  1YEZ A;  5IE8 A;  1OTC A;  3AEV A;  2GN5 A;  1KD1 C;  3J80 c;  1BVS A;  3E0E A;  4JI8 L;  4POF A;  1QUQ B;  4JI2 Q;  2VQF L;  2ASB A;  1L1O B;  1PFS A;  2AKW B;  1PH1 A;  1JMC A;  4YWK A;  3KLW A;  1N36 Q;  3KJO A;  4PZ6 A;  3EBE A;  2E8G A;  4O0A A;  4DR1 L;  4LF8 L;  2JA7 H;  5JJK A;  1C7Y A;  4DUZ Q;  4JOI C;  4YCV A;  2EXD A;  2I5M X;  4IOC A;  1XJV A;  1FL0 A;  1X3E A;  2JEA I;  3H15 A;  2MNA A;  2NVQ H;  4X64 L;  1EFW A;  4JI3 L;  3CCS A;  2AWO A;  3F2D A;  1EYG A;  1L1O A;  3FP9 A;  4R4T A;  3S14 H;  2GVB A;  1GM5 A;  1I3Q H;  3HOY G;  3I4N H;  2YV5 A;  5IWA Q;  4TVA B;  3MEF A;  1B8A A;  2VNU D;  1N34 Q;  4BY7 G;  4GKK L;  2QGQ A;  2BA0 A;  3I56 A;  3RZD H;  4UY8 C;  4JI8 Q;  4H02 A;  2B63 H;  4IFD J;  1K0R A;  1HZC A;  1L2F A;  4LUO A;  2IX0 A;  1TWF H;  3B6Y A;  1GD7 A;  2I0Q A;  4NXN L;  4LFB L;  1QVG A;  3K7A H;  1HH2 P;  4NPS A;  4ME3 A;  3TQY A;  4JBM A;  4BBS G;  2BH2 A;  1VQG A;  1J5E Q;  1HZB A;  3CCU A;  1T9H A;  3HOW G;  3KJP A;  2UUA Q;  3PCO B;  1X6O A;  4A3E H;  4A3G G;  4MTN A;  2WAQ G;  3J80 i;  5FLX c;  4Y7N H;  4BA1 I;  1Q81 C;  1YBY A;  4JI3 Q;  4LF7 Q;  4GN5 A;  2JA5 G;  3PO3 H;  3L0O A;  4KHP Q;  4IFD I;  1JT8 A;  2XTI A;  4UP9 A;  1IBK Q;  4OWT B;  4DV6 L;  4OO1 I;  4DV5 L;  2UU9 Q;  3UE0 A;  4X66 L;  4A3C H;  1A63 A;  2R7F A;  1X3F A;  2DGY A;  1JB7 A;  3IRB A;  4IPG A;  3GO5 A;  1IYJ B;  1K73 C;  1BBW A;  3I55 A;  4LF4 L;  2R92 G;  4LF6 L;  4FDB A;  4A3L G;  3J81 c;  1XPO A;  4A3M G;  3PO3 G;  2QEX A;  4GOP C;  3PGZ A;  5AJ3 L;  1VQ6 A;  1N33 Q;  1Y1W G;  2KCT A;  2VS1 A;  1A0I A;  1JE5 A;  3PIP A;  3ER0 A;  3UDI A;  1YHA A;  4LFA L;  4OX9 L;  3WWV A;  1BKB A;  3I7F A;  4LFC Q;  4DR4 L;  3L7Z C;  3H0G G;  2XGT A;  1VS0 A;  1JJ2 A;  5C3E G;  4JYA Q;  3TRE A;  3AQQ A;  1RL2 A;  2ZM6 L;  4AQY Q;  4JV5 L;  1OXV A;  1PYS B;  2N78 A;  1CKN B;  2OQ0 A;  1XNR Q;  2UXD Q;  1CKO A;  2KHI A;  3T1Y L;  3MXN B;  1OXT A;  3I4O A;  1VQM A;  4JC0 A;  2N3S A;  3U50 C;  4YY3 L;  4GNX B;  5DLQ E;  4DV1 Q;  1XMO Q;  1HZA A;  1XPU A;  3HOY H;  4DR7 L;  3HOZ H;  1A8V A;  1SRO A;  4L5R C;  2R93 G;  4BY7 H;  3K80 C;  2YU9 H;  1I5F A;  4IJH A;  2K4K A;  3A5U A;  1VQ4 A;  2Y0S E;  3E9H A;  4RG1 A;  4GNX A;  3PUV A;  4BBS H;  4RMF A;  2VW9 A;  1IBM Q;  5FJ8 H;  4WJ3 M;  2Q2I A;  5LMU L;  4HIK A;  4JI7 L;  3HOW H;  3J81 i;  2IT1 A;  4DR2 Q;  1PYB A;  4A3G H;  3HKZ E;  4A3K G;  1HZ9 A;  4KHZ A;  1Q7Y C;  3U4V A;  3PV0 A;  4DR5 L;  4LW1 A;  1YIT A;  2JA5 H;  2CQO A;  2E2I H;  1NJI C;  1Q46 A;  2WAQ E;  1AE2 A;  4GKJ L;  3F8T A;  2CKZ B;  2JQO A;  3G71 A;  4DV0 Q;  4NB3 A;  1IBL L;  3S2D H;  4YWM A;  1KHI A;  1KRS A;  4YHH L;  4DV3 Q;  2JJQ A;  3D31 A;  1PH4 A;  3JC6 6;  3G4S A;  3CCQ A;  4A3F H;  3GTK H;  2UUB Q;  2NVT H;  3UDG A;  4GN4 B;  2NN6 I;  5IP9 G;  3ICE A;  4IPH A;  3H3V I;  5GAG C;  3NEL A;  3HOV G;  4AYB E;  3RNU A;  4JI2 L;  2NVX H;  4X6A H;  2R92 H;  1IL2 A;  4JOI A;  1X55 A;  1N36 L;  1HNX Q;  4A3M H;  4MZ9 A;  1I6H H;  2PI2 E;  1LTL A;  4DUZ L;  5H1S E;  3PUW A;  1Y1W H;  3AFQ A;  3J7Z C;  1UE5 A;  4R1J A;  3PF4 A;  1CSP A;  1MJC A;  5C4X G;  3BJU A;  2FXQ A;  2UUC Q;  3U4Z A;  2GVA A;  1EQQ A;  3OTO Q;  3H0G H;  3PIO A;  2F52 A;  1LYL A;  1E1T A;  1RIP A;  5JEA J;  2KBN A;  5C3E H;  1U0L A;  1PH9 A;  5M3F G;  1VQK A;  5IWA L;  1SRU A;  4BXX H;  1N34 L;  1XMQ L;  3GTJ H;  4DK3 C;  1YHQ A;  5BR8 Q;  1I94 Q;  1VQ5 A;  5LMN Q;  1DGS A;  1FVI A;  1TWC H;  2HT1 A;  3LGJ A;  4DKA C;  2LXK A;  3K8A A;  2IX1 A;  2B3G A;  3NEN A;  2ZJP A;  1R9T H;  3STB D;  4JI5 Q;  1VQA A;  2R93 H;  2OTJ A;  3S1R H;  5JEA G;  1VQP A;  2C35 B;  3A0J A;  3M9B A;  1N8R C;  1J5E L;  3S2H H;  3CXC A;  4K0K Q;  2UUA L;  3CC4 A;  4IO9 A;  2PI2 A;  4BBR G;  1QUQ A;  5M5X H;  1MJE A;  2PMZ E;  4LF7 L;  1E24 A;  3VDY A;  1P8L A;  1HR0 W;  2RHS B;  5IYD G;  2K5N A;  3TS0 A;  4KHP L;  1IBK L;  3F1Z A;  3SGI A;  3HOZ G;  4JBW A;  1XMQ Q;  4DNI A;  3U58 A;  4A3K H;  2F3I A;  4GOP B;  2Y0S G;  4C3H H;  2UU9 L;  3W5O A;  1X54 A;  4A3I H;  3RN5 A;  3CCL A;  1X9N A;  3ULJ A;  1M1K C;  3NBH B;  3HOX G;  4BY1 G;  3M85 A;  4JI4 Q;  4OON A;  1NMF A;  1PH6 A;  3HKZ G;  3PO2 G;  5FJ8 G;  3GTQ H;  1UE7 A;  1Y14 B;  1KXL A;  3BU2 A;  3H3V H;  3M7N A;  4IFD G;  4LF9 Q;  4KLK A;  3OW2 A;  2EIF A;  1KQS A;  1W2B A;  1ASY A;  1FJG L;  2I5H A;  1B7Y B;  1O7I A;  5IP9 H;  4OO1 G;  1K83 H;  1N33 L;  4LUZ A;  1SE8 A;  3HOV H;  2DUD A;  4B3T Q;  4JI6 Q;  3I4M G;  4B3R Q;  3ZJY C;  4IPD A;  2PNH A;  4LFC L;  1TXY A;  1WOC A;  1X56 A;  1VQ8 A;  4JYA L;  4A3F G;  3RZO H;  4AQY L;  1IZ6 A;  4AYB G;  4IJL A;  5C4X H;  4OWX B;  1XNR L;  3RN2 A;  2LSS A;  1XTD A;  1MKH A;  1YJN A;  1XMO L;  2WFW A; 
#chains in the Genus database with same CATH topology
 3A5Z B;  5D8D A;  3ONA B;  5M3F H;  1N33 H;  4APM A;  1FJG Q;  2K28 A;  4C3J H;  1EZ6 A;  2RCN A;  1K83 B;  4B3M Q;  1VMC A;  3HOU B;  2L1B A;  4RWS C;  3VYT A;  2ASJ A;  1EUD B;  4IUP A;  4H13 C;  5L37 A;  3JAM W;  3GTQ A;  4X65 Q;  4L1K A;  2XGP A;  5DQG A;  4PDB A;  5GAH C;  4MV3 A;  3RF2 A;  1K83 A;  2PW5 A;  4LF4 H;  1XMO H;  1IKL A;  1QG7 A;  2M00 A;  2B39 A;  5IYD H;  3J7A V;  2ZT9 C;  1JE4 A;  3EQL C;  2EJM A;  4C3J B;  3RLN A;  5JJZ A;  3MC0 B;  5IT9 L;  1FGB D;  2Z0S A;  2Q2U A;  5ELE A;  1HNW Q;  1G51 A;  3S15 B;  1PFB A;  5CA1 F;  1VQI A;  4QWD A;  4JV5 H;  1WTW A;  3KF8 B;  4FM9 A;  4BA2 I;  5EPJ A;  3MR6 A;  1TAE A;  2MO1 A;  2FMC A;  4HJ5 A;  4JV2 A;  2EY2 A;  1A3V A;  2L11 A;  4DUY Q;  2TSS A;  3RB3 A;  3RLF A;  1MGS A;  3GP7 A;  3I4M H;  1SBB B;  2VA2 A;  3KF8 A;  2AWN A;  4O3R A;  3PUZ A;  5T1I A;  3OTO L;  5C4J H;  2KED A;  3PUX A;  2EVB A;  2F0S A;  4HJA A;  2MHV A;  1K28 A;  2F0U A;  4MV9 A;  3RMH A;  2V5A A;  4OWW B;  5C1O A;  1Y69 U;  1UC8 A;  1M0T A;  4H7B A;  1UC9 A;  1RJT A;  3S1N H;  1SMY C;  1VCI A;  1ZHQ A;  2Z6K C;  2BOS A;  5KFZ A;  4YHH H;  3AU7 A;  4DLK A;  1QB5 D;  1BCP B;  3Q8R B;  1Z9F A;  1Z2O X;  2VA3 A;  2PQA B;  4EQP A;  1UWV A;  5DGA A;  2UVR A;  3T51 B;  4U68 A;  3J81 j;  2N55 A;  5JPN C;  1A3T A;  2K50 A;  4JI2 H;  1EY8 A;  4ECX A;  1QVC A;  5DG9 A;  1VDZ A;  2B2U C;  3Q8Q B;  5KFY A;  3IN5 A;  1SN8 A;  2NYZ D;  2PQA A;  3J80 E;  3KOJ A;  1A3U A;  4G3I A;  2EYF A;  2Q8T A;  1DOK A;  1GO3 E;  2F4I A;  2VQE Q;  2EQS A;  1S5D D;  2SCU B;  2VUM B;  5ELN A;  2X0S A;  3CHB D;  2JA6 G;  5CV4 A;  4MV6 A;  3FPP A;  3F8N A;  4JI6 L;  2FMA A;  2JE6 I;  5DAU A;  5FK9 C;  5M3M G;  1T5X D;  4M1U B;  4J9R A;  1XNQ Q;  5CV6 A;  4TQU S;  4UCR A;  1K9M C;  2VUM A;  4XTC S;  1EOV A;  5IYB H;  4GLX A;  2IHF A;  4LF5 Q;  2GPS A;  3BAA A;  2B29 A;  1HRJ A;  4J15 A;  4MTE A;  3TDQ A;  1HFG A;  1WJJ A;  1KAA A;  1DXM A;  3M4Q A;  5E7N A;  1LT6 D;  1TS4 A;  1ZYR D;  3Q8D A;  1GLV A;  1EIF A;  1D5M C;  1KAW A;  3S1Q H;  4RB2 C;  4KKS A;  1B6R A;  1DOL A;  1IBK H;  4B3R H;  4ZKC B;  2J7Z A;  3PSI A;  2ATW A;  2UVU A;  1LTT D;  3J81 L;  1SYG A;  4DV7 Q;  1NNX A;  4YQW A;  1JJG A;  3T1H L;  2AMC B;  2VQF Q;  2W6O A;  4QWE A;  1N32 L;  1RDP D;  3MVV A;  4IQZ A;  1Y8N B;  4LF8 Q;  1YZ6 A;  4Z9C B;  2YL2 A;  1Q82 C;  4I50 F;  3NWT A;  4DR3 L;  4RZQ A;  5L1L A;  4IUQ A;  4X64 Q;  4YCW A;  2HQL A;  3BA9 A;  3I4N B;  1A9X A;  1TS2 A;  1V43 A;  2I07 B;  3RGZ A;  1L1O C;  3QOL A;  3ND9 A;  1WSC A;  2D0O A;  1H9K A;  4GKK Q;  1PTO C;  1NE3 A;  5C44 G;  3MEH A;  1O7L A;  1VBG A;  1U5K A;  3QZ8 A;  3OHA A;  2C28 A;  1A15 A;  5KNC A;  2V4Q A;  3I3C A;  1X65 A;  3CCJ A;  4KD3 A;  1Q8I A;  3CCE A;  2JA6 H;  4JI1 H;  2A69 C;  2UXB L;  4A3E B;  1HNZ L;  3MXU A;  1B70 B;  2WB1 E;  1BCP D;  4ZCK A;  3S17 H;  4MV8 A;  5KG3 A;  4NXM H;  1VAJ A;  2HIV A;  1QCB D;  2CQA A;  5FLM G;  3G6E A;  1PRT B;  3GD7 A;  4RGM A;  3LNN A;  2HHH H;  4DAY B;  2JYO A;  1H95 A;  3N41 B;  1YVC A;  1Z7T A;  4X66 Q;  2ZJR A;  3U9O A;  3MXG A;  4TV8 F;  5L1I A;  1FNU A;  2NWG A;  4KJN A;  4K2K A;  4RUC A;  2O5J C;  5KFP A;  4HN7 A;  2CZG A;  3N52 A;  4DAY A;  4B3S H;  1SLJ A;  1PH7 A;  1BBX C;  1WVL A;  2WP8 J;  2WIN B;  2NVY H;  4DV3 H;  4DL3 A;  1CFM A;  2RSO A;  3L4K A;  4JBJ A;  1STY A;  5IOC A;  2JA6 A;  4JI0 H;  3CQZ H;  5GQO A;  4BWG B;  2BQR A;  2HQE A;  3NEM A;  3STB C;  3GIP A;  4O3Q A;  3TBI B;  3K7U C;  3H3V C;  2FPP B;  1T3N A;  4GLV B;  2ZM6 Q;  1HNX H;  2UXC H;  4O2B F;  2E74 C;  4UPA A;  2XIW A;  3VMM A;  2CW0 C;  1M90 C;  1E4E A;  3T1Y Q;  1I4H A;  4KI0 A;  3KK7 A;  4LMQ D;  4DV2 L;  1WFQ A;  2NVY B;  3I90 A;  2UUC H;  1ZEQ X;  3F2U A;  1MI2 A;  5CV9 A;  1O78 A;  2UXD H;  2F0H A;  2CW7 A;  3V6K A;  5C44 H;  2ZDH A;  1K8A C;  1PXU A;  1HA5 A;  2WV6 D;  1MSH A;  4MAM A;  2VUG A;  1HUN A;  1I94 H;  2RGV A;  3NUC A;  1JKJ B;  2NVY A;  1JJC B;  3KFU A;  4QJF A;  4CDF C;  4RCO A;  1F9S A;  5J3B A;  4JI5 H;  5ELC A;  4X62 L;  3ITP A;  3T13 A;  4CKC A;  1EQT A;  4DR5 Q;  2JA5 B;  3CQZ A;  2A8V A;  4K0K H;  3J80 W;  3T5H A;  5JVG 3;  1HR0 L;  2CWP A;  4APV A;  1QNU A;  4QB4 A;  1YIJ A;  1KLG D;  2WB1 G;  2CFM A;  3EFX D;  2OTL A;  4DR6 L;  4IZO A;  5COY A;  1CZG A;  3OSO A;  5FD6 A;  2JA5 A;  4TUY F;  1LT5 D;  2SNS A;  3KXY T;  3OHB A;  1FYC A;  2PQE A;  1KD1 C;  1BVS A;  3BQ0 A;  4JI8 L;  3W3A A;  4PQX A;  4POF A;  2L5T A;  3BYY B;  3MFG A;  4KY6 A;  2AKW B;  1PFS A;  5CMD A;  1JMC A;  3QB3 A;  1I6H B;  5I4D A;  3P7J A;  2PCF B;  2E8G A;  2GLT A;  1RKN A;  4DUZ Q;  4EYI B;  1KDA A;  2A68 D;  1XJV A;  2JEA I;  2CH4 W;  4CKE A;  2MNA A;  1SYX B;  4JI3 L;  1PRT D;  2GVB A;  2HCC A;  3OIP A;  5IGF A;  5IWA Q;  1GHK A;  4P2C B;  1N34 Q;  4UFZ A;  1RK6 A;  4UY8 C;  2ATL A;  1JDE A;  4NXN L;  2YCH A;  1QVG A;  2M9V A;  4OGQ C;  1AUX A;  5T1G A;  5J22 A;  4BBS G;  3A7A B;  2W8L A;  2ASL A;  4RUA A;  3MR5 A;  3KJP A;  4A3G G;  2MJ8 A;  5D1O B;  4BA1 I;  5KG2 A;  1LTI D;  3JAM L;  2KJX A;  5KG4 A;  1EQV A;  4CKB A;  4C56 C;  3BQ2 A;  5L9X A;  1EY4 A;  3L9A X;  4DV5 L;  1PFN A;  4C5B A;  3UE0 A;  5FD5 A;  3NTI A;  2B2T A;  2HVR A;  1JB7 A;  2W57 A;  4IPG A;  2WKD A;  3R3O A;  1K73 C;  4QUF A;  4EEY A;  1RYR A;  4LF4 L;  4TQS A;  1G8Z D;  4DV4 H;  3QR8 A;  1G2T A;  4RU9 A;  4FDB A;  1XPO A;  1SAP A;  1D1I A;  2QEX A;  2ZJT A;  4DV6 H;  3HOV B;  3ERQ A;  2KCT A;  2VS1 A;  3T4A C;  3DWP A;  1A0I A;  2EDG A;  3ER0 A;  4YB8 B;  1JOQ A;  1RYS A;  4FVM A;  1F2Z A;  3H0G G;  3MFH A;  2XGT A;  1STH A;  4JYA Q;  3TRE A;  4JV5 L;  1CKN B;  3VA5 A;  1JC7 A;  3AMU A;  2NBF A;  4LF6 H;  2K03 A;  4ECV A;  5KKN B;  2ASB A;  1VQM A;  3M7G A;  4GNX B;  3OMC A;  4KHV A;  4RHS A;  1HZA A;  5KG0 A;  5KEE A;  3RV3 A;  1A8V A;  2JN4 A;  3K80 C;  2YU9 H;  5EWE A;  4IJH A;  4TSS A;  3TN2 A;  4H0L C;  2K4K A;  2WB1 A;  3CRL C;  3V4Z A;  5M5Y B;  3A5U A;  2R8K A;  5KFS A;  2K7V A;  4GNX A;  2FB9 A;  5KFX A;  4BBS H;  1EY9 A;  3IFT A;  3VYR A;  4L6T B;  4A3G H;  4YY3 H;  3HKZ E;  3J7A F;  2R85 A;  4KHZ A;  4C3H G;  1Q7Y C;  1C8C A;  1NJI C;  5KFW A;  2WAQ E;  4GKJ L;  1DCZ A;  3G71 A;  2Y0S B;  4YHH L;  4IWX A;  4FS1 A;  1M8A A;  3NTK A;  3D31 A;  1ICW A;  3GTK H;  1DOM A;  3KUP A;  5I2Y A;  2NVT H;  5JH7 F;  3PVX A;  3R23 A;  3SK4 A;  3H3V I;  5GAG C;  3NEL A;  3RNU A;  4JI2 L;  1JLL B;  1O7Z A;  1IL2 A;  5KFH A;  3U9T A;  2YYA A;  3BG3 A;  3O13 A;  2XCA A;  3PUW A;  1KJJ A;  3PF4 A;  1HPC A;  4XQJ A;  5K2M A;  4ECQ A;  1EYA A;  3OTO Q;  4MA0 A;  3H0G H;  2AGP A;  1LYL A;  1E1T A;  1RIP A;  4OEL B;  2KBN A;  1K1Q A;  2W6M A;  1KDB A;  1VQK A;  5G3L D;  3PW2 A;  4KD4 A;  3GTJ H;  2IW3 A;  1VQ5 A;  1DGS A;  2R7L A;  3PZP A;  2HT1 A;  4Q45 A;  3LGJ A;  2LXK A;  3ND8 A;  2B3G A;  2ZJP A;  1KJ9 A;  1R9T H;  3GTK A;  3S1R H;  2PW7 A;  1VQP A;  3M9B A;  2B8G A;  3S2H H;  5E4X A;  2VB3 X;  2PI2 A;  4BBR G;  1QUQ A;  2FJZ A;  2OH2 A;  2PMZ E;  1X32 A;  1E24 A;  3VDY A;  1B53 A;  1Q3L A;  2K5N A;  3TS0 A;  1IBK L;  3SGI A;  3HOZ G;  3GTJ B;  1T5E A;  3T5L A;  3U58 A;  4C3H H;  4HCS A;  4O3P A;  2F3W A;  2UU9 L;  4UHV A;  2W9A A;  1TY2 A;  3LML A;  4KV6 A;  3ETH A;  3H0G A;  2F0V A;  3ULJ A;  3HOX G;  3C1E A;  2EZV A;  1S5F D;  4CJ2 C;  1PH6 A;  4EFB A;  3HKZ G;  2RA4 A;  2XRS D;  3K3V A;  1UE7 A;  3FMA A;  3I12 A;  1Y14 B;  3GTJ A;  3BU2 A;  3K58 A;  5CV5 A;  4A3D G;  4KLK A;  3OW2 A;  2AGO A;  1RCV D;  1HFN A;  4KHP H;  2I5H A;  4IN3 A;  1R9T A;  4K5W A;  5EWG A;  2XIG A;  1SE8 A;  4JI6 Q;  4KJO A;  4IPD A;  1S0N A;  5KRU A;  4O42 A;  1DON A;  4A3F G;  2KA7 A;  1RD9 D;  5FO7 B;  4Q44 A;  2H4O A;  4X3T A;  1MBY A;  4EBC A;  2GA4 B;  3GTL B;  3SK8 A;  1V1Q A;  3NGD A;  5IYZ F;  2J6S A;  2HUG A;  1YNJ C;  1XYI A;  3WO1 A;  1IW7 D;  2VQD A;  2HVQ A;  2ID0 A;  3G6V A;  2K32 A;  3Q0A A;  1TY0 A;  4UCU A;  4NXM L;  3A74 A;  2DPJ A;  3OMG A;  3UE1 A;  5IYC G;  2W7O A;  3T1H Q;  4V0B A;  3TP8 A;  2K75 A;  4PMW A;  1N32 Q;  2FE3 A;  1CT1 D;  4BXX G;  4BBR H;  1E2W A;  1AN7 A;  4UCS A;  1IL8 A;  1AZQ A;  3M4O H;  1EYC A;  3GDE A;  4DR3 Q;  3M3Y B;  1STE A;  4DN4 M;  4B3S L;  3PIP 3;  2CWA A;  4L5Q A;  1PA6 A;  5EQ0 A;  4DV3 L;  3K5L A;  4LFA H;  1AEX A;  2SDF A;  4OX9 H;  2RDH A;  3HOX H;  1A63 A;  2KCM A;  1GJX A;  4I7H A;  4JI0 L;  2B2W A;  4K6L A;  3FMC A;  5DG7 A;  2EJG C;  4J9L A;  5EKL A;  3NSW A;  2BA1 A;  4A3D H;  2UXC L;  1HNX L;  1G6P A;  3JRX A;  3DM1 A;  2IBK A;  2KVM A;  1KC8 C;  2UXB Q;  4A3I G;  1HNZ Q;  4A4I A;  3TQ1 A;  2PPB C;  4DNR B;  4PZ7 A;  2WKC A;  4O3O A;  2UUC L;  1VF7 A;  2X69 A;  4J9M A;  4DL5 A;  1EU3 A;  4KKT A;  5JVH 3;  2UXD L;  1GUG A;  3HOX B;  4JI7 H;  1QZH A;  1KNE A;  4B9X A;  4HIM A;  2R86 A;  1I94 L;  3HOU G;  2K5V A;  2RDF A;  4C5A A;  1L2Z A;  4A3D B;  1F9P A;  1VQC A;  4JBK A;  1UE6 A;  3J80 L;  1QZG A;  5KFM A;  1B3Q A;  3OWF A;  1S72 A;  1AN8 A;  4HMJ A;  4JI5 L;  1C48 A;  5EDW A;  1KJQ A;  2KUM A;  4K0K L;  4DFA A;  1G2S A;  3L2P A;  2H5X A;  5H80 A;  1PV4 A;  5IYC H;  3GQC A;  4JG2 A;  4L8J A;  2KHJ A;  4LSA A;  1EYD A;  3KBX A;  5CC4 A;  3VYS A;  5C0X J;  4C3J G;  1VQB A;  4YIJ A;  1NR2 A;  3KLS A;  1MSG A;  1Q1E A;  2F0P A;  2YTY A;  3E9I A;  3EYY A;  1N36 H;  3DUZ A;  2E2J H;  1DJR D;  3JZI A;  1KAB A;  1PHJ A;  4ZOL F;  2YZG A;  1I7L A;  3RUP A;  3FVQ A;  4EBD A;  1TVX A;  3H6M A;  5C0X G;  5D3D A;  3C3L A;  3V6H A;  2D0P A;  5C8Y F;  2EY5 A;  5LP6 F;  4LF9 L;  3MWD A;  5J2U F;  3KF6 B;  5IIF A;  5IGE A;  3CW2 C;  2L15 A;  2ENB A;  1U4P A;  4ED1 A;  1PTO F;  1KRT A;  3MR2 A;  3GTM H;  5A2Q E;  3OSN A;  3AFP A;  1VBH A;  4CDE C;  1PZI D;  5F9N A;  4X62 Q;  1NUC A;  1B3A A;  1CM9 A;  3KF6 A;  4IUR A;  1Y8P B;  4ED6 A;  2HDM A;  2UUA H;  1X3Q A;  1IOV A;  1CE8 A;  4IR1 A;  2EOT A;  2KOL A;  3F2B A;  1HR0 Q;  2N8N A;  5M5W B;  1K8G A;  1V1P B;  2ZDQ A;  3RBD A;  4DR6 Q;  3TZD A;  2O5I C;  2FLN A;  3WOE A;  3HOU H;  2FLP A;  5JJI A;  3CME A;  3GTM B;  4XT3 B;  4WD3 A;  1GUO A;  1QOH A;  5E4W C;  3RB6 A;  3SK5 A;  1N56 A;  1CQJ B;  2JA7 B;  3A8I E;  3CC7 A;  3GTM A;  1FJG H;  2AUJ D;  1KJI A;  4FXK C;  2NTS A;  4L5T A;  1T36 A;  4G7O C;  4DV4 L;  2K52 A;  1LTS D;  3BZK A;  1I3Q B;  3RGX A;  4X65 H;  2JA7 A;  2JA8 G;  1QNK A;  2F0N A;  5C4Z A;  5EJW A;  4S3S A;  2PZU A;  2HVS A;  2NU9 B;  3S15 H;  4MV1 A;  3KAJ A;  3AYH B;  2VUM G;  2MCT A;  5C1P A;  4AQY H;  2W71 A;  4J0M A;  4UP7 A;  5CV7 A;  5C0X H;  4RHR A;  1CI3 M;  1Y8O B;  3GTP H;  1WCM H;  3K7A B;  4NXN Q;  3GID A;  3CVZ A;  4BWS C;  1ICF B;  3S24 A;  2F0D A;  2F4V L;  1CUK A;  4I7Z C;  2K5Q A;  3H91 A;  4K8J A;  3QO2 A;  2BE5 C;  1O80 A;  2FMM A;  3MTS A;  1JCK B;  4K5V A;  2W7P A;  1VQF A;  1HNW H;  4ED2 A;  2D62 A;  4JV0 A;  2HJW A;  4WFN 3;  1H9S B;  1S40 A;  2A74 C;  2F3V A;  4OIK A;  4DV5 Q;  4FU0 A;  2F03 A;  5KG7 A;  2JEB I;  3GTP B;  1IOW A;  1WCM B;  4KY7 A;  5CBE E;  3BVM A;  2YZM A;  2M2L A;  1UUP A;  1XDN A;  2EYL A;  4YWL A;  4LF4 Q;  5IYB G;  4DV0 H;  4EQ5 A;  1ESR A;  4CGY B;  4RZR A;  5KG1 A;  1NTG A;  1WTQ A;  3G48 A;  2K14 A;  3GV6 A;  3GTP A;  1WCM A;  5E3F A;  3KTM A;  4XYM B;  1B33 N;  3ETJ A;  1S03 G;  4IAL A;  1A62 A;  1TR5 A;  1IYU A;  3HKS A;  4I55 F;  2QIL A;  3W1B A;  5FO9 B;  2ZTC A;  3I4N G;  4JV5 Q;  1S0M A;  1TS3 A;  2IP4 A;  4HJ8 A;  1DIK A;  1E7Z A;  3JSN A;  2LY7 A;  4MN3 A;  1YI2 A;  5K36 G;  3E0J A;  1EUC B;  5EWF A;  2W8K A;  2ES2 A;  2JA8 H;  3T5K A;  4YCU A;  2VUM H;  1R4P B;  4XYQ A;  1BBU A;  3FDS A;  2PZT A;  1Q12 A;  4P72 A;  3ORQ A;  4A3E G;  1HXY D;  5BR8 H;  1EY6 A;  3VR6 A;  5LMN H;  3TII A;  1CKM A;  3N6R A;  3DEO A;  1HJP A;  1XXG A;  4R4I A;  3PO3 G;  1JDB B;  5LOV F;  4PZ8 A;  5KFC A;  4I7A A;  3KYH C;  3EIV A;  4A3L H;  1I4G A;  5C3X A;  5LMN W;  2E2I B;  2VQE H;  4V19 0;  2IWH A;  2JA8 B;  5KX5 F;  3H4B A;  1M7J A;  4OXP A;  2F0J A;  3IL8 A;  1B2T A;  4P71 A;  3PIO 3;  4GKJ Q;  1JQY D;  1KL9 A;  4YHH Q;  2EE1 A;  3D4W A;  1WD0 A;  5KFU A;  3WO0 A;  5JUM A;  1KIX A;  4ECT A;  3J7A 5;  1XNQ H;  5KYI A;  1OTC A;  2K5D A;  2A6H C;  2GN5 A;  3AEV A;  4F50 A;  3OUZ A;  3PW5 A;  2NVX B;  4KKU A;  5A2Q W;  1EY0 A;  4JI2 Q;  3QOJ A;  5L1K A;  2EYJ A;  5FOB B;  1TT2 A;  4A3M B;  3KJO A;  4DR1 L;  1FNW A;  4DL2 A;  1C7Y A;  3HZX A;  4JOI C;  1UAP A;  3Q22 A;  3PW0 A;  1FL0 A;  3H15 A;  3N6X A;  4M8A A;  3C1F A;  2AWO A;  3F2D A;  3OHX C;  4RB0 A;  4DV7 H;  4B3T H;  3FP9 A;  2AQ3 B;  4E4T A;  5DQH A;  2JEG A;  1F77 A;  3I4N H;  2MPM A;  2YV5 A;  3BJY A;  4EG0 A;  3P1H A;  3MEF A;  1B8A A;  2R8G A;  2VQF H;  1JWU D;  2QGQ A;  3I56 A;  4IFD J;  5K36 H;  2QK4 A;  4H02 A;  1TWC B;  5GON F;  1K0R A;  1HZC A;  4EGQ A;  2IX0 A;  1TWF H;  1HH2 P;  3RB4 A;  1ENF A;  4CHT B;  2ZXP A;  4JBM A;  2BH2 A;  4O4L F;  1I4Q A;  3C2P A;  1WTO A;  3V96 A;  1D5X C;  3E5S A;  2CVR A;  4A3E H;  1Q81 C;  1YBY A;  4GN5 A;  4Q5V A;  2JA5 G;  3PO3 H;  1JT8 A;  4UP9 A;  1IBK Q;  5KT6 A;  5LA6 F;  3IG0 A;  2UU9 Q;  1FR3 A;  1TWF B;  4HMI A;  4FF1 A;  2I87 A;  2R7F A;  2RBM A;  2W6P A;  3MXP A;  2FK2 A;  3RB0 A;  2J6T A;  1SNC A;  1SSO A;  3R8B A;  5KFG A;  5DEH A;  2R7M A;  1TWF A;  3PO3 B;  4FS2 A;  3PGZ A;  5AJ3 L;  1VQ6 A;  2PZW A;  2F0I A;  5NUC A;  2DIK A;  2E5L H;  3A55 A;  4K6D A;  1JE5 A;  3QJY A;  1BGW A;  3UDI A;  4LFA L;  4OX9 L;  1BKB A;  1PZJ D;  3I7F A;  3L7Z C;  1CQV A;  1OO9 B;  3RZO B;  2L9H A;  4HSV A;  2OQ0 A;  1BXR A;  1SYB A;  1CKO A;  2VR1 A;  3TP6 A;  4DL4 A;  2XSC A;  3I4O A;  5KFF A;  1XPU A;  1GHJ A;  1AZP A;  1DZ1 A;  3L3O C;  4KTA A;  3KHH A;  4L5R C;  1SRO A;  2R93 G;  4RAZ A;  1QJO A;  4B08 A;  2EYM A;  3FDT A;  1I4R A;  1I5F A;  2M05 A;  2K05 A;  2LS0 1;  1RK5 A;  2FFK B;  5KGU A;  4IRC A;  2Y0S E;  4IWY A;  4IRD A;  4RG1 A;  1EEF D;  3PUV A;  1PX2 A;  4MV4 A;  5JOB A;  2VW9 A;  4WJ3 M;  1L0X B;  4JI7 L;  4HIK A;  4R8U B;  5KT7 A;  3OW7 A;  1PYB A;  4A3K G;  3NK9 A;  1HZ9 A;  1YIT A;  2JA5 H;  4HED A;  1RJQ A;  3N8D A;  5I9P A;  3TIN A;  4YP3 A;  1AE2 A;  1BXT A;  4ED7 A;  1JX4 A;  2CKZ B;  2JQO A;  2C9O A;  1IBL L;  4R8U A;  1JR0 D;  4DV3 Q;  3DWQ A;  1PH4 A;  1LTB D;  3CCQ A;  4BY1 B;  3X3M A;  3ICE A;  4IPH A;  1ILP A;  3D4R A;  3HOV G;  3KAK A;  2K1B A;  1B4O A;  4ECZ A;  4DR5 H;  5HGT A;  1ZYR C;  1X55 A;  1N36 L;  1HNX Q;  1I6H H;  2X6L A;  2PI2 E;  4RB1 A;  2HGS A;  5H1S E;  2SNM A;  1UE5 A;  3V2T A;  1CSP A;  5C4X G;  1II3 A;  1SEI A;  3D6C A;  2FXQ A;  2UUC Q;  4ZUI A;  2HCI A;  3VR3 A;  3WOF A;  3PIO A;  2UXD Q;  2PYK A;  1ZQ7 A;  2F0Q A;  4AYB B;  1SNQ A;  3QWN A;  1LO5 D;  4HNU A;  1D2B A;  5BMV F;  4Y8V B;  1I94 Q;  5I47 A;  5BN3 A;  2IX1 A;  3EVQ A;  3K8A A;  3NEN A;  1S0O A;  1KNA A;  4JI5 Q;  2R93 H;  1B1Z A;  1Y1V B;  2C35 B;  3S9W A;  4ECW A;  4FXG C;  3GV8 B;  2C22 A;  1XX8 A;  3CXC A;  4K0K Q;  3LP8 A;  4LSX A;  2UUA L;  3CC4 A;  1A6X A;  4C5C A;  3D4D A;  2XNA C;  4ZAI A;  4LF7 L;  4IRK A;  5IWA H;  3GIK A;  4EVO A;  1W6K A;  2R82 A;  3VPD A;  3F1Z A;  4RNN A;  1NAP A;  3N40 P;  1XMQ Q;  4DNI A;  4A3K H;  4GOP B;  1PZK D;  2Y0S G;  2C00 A;  1S5E D;  2F0K A;  3SDZ A;  4NP5 A;  2NU7 B;  3NBH B;  3WNZ A;  2R93 B;  1TA8 A;  3M85 A;  1BCP C;  4OON A;  3PO2 G;  3N42 B;  4N9T A;  3BVG A;  1JOR A;  2NN6 H;  3CU7 A;  1UNS A;  1UEA B;  2ICE C;  3MA2 B;  3M7N A;  2R7Z B;  3EA6 A;  4C2M B;  4LF9 Q;  2QDB A;  1FJG L;  4RKB A;  5JAV A;  2RGR A;  3NBH A;  1SJE D;  1TWA B;  1N33 L;  3H4D A;  3HOV H;  2R93 A;  2DUD A;  2KEC A;  4A3K B;  1V4Y A;  1BQQ T;  4DL7 A;  5EBD A;  4LFB H;  1WOC A;  1X56 A;  5IGC A;  1VQ8 A;  4ZLT F;  2R7N A;  5D1O A;  4AQY L;  5KT5 A;  3I70 A;  2YZN A;  5C4X H;  5D1P A;  4OWX B;  4EQN A;  1TWA A;  2FK1 A;  3L4J A;  1S9F A;  3RN2 A;  4A93 B;  3SR1 A;  2I80 A;  1YJN A;  3HB9 A;  1XMO L;  2WFW A;  2YTX A;  1NBW A;  2G9D A;  5KT3 A;  1K0S A;  2DY7 A;  4DPG A;  5CYU A;  5HY6 A;  2A6E C;  4GLA C;  4ECY A;  1AW7 A;  2R8H A;  1DYQ A;  2KSW A;  2W6Z A;  4ALP A;  4FXD A;  3SEB A;  2QW7 A;  2EY6 A;  5A35 A;  5M5Y H;  4JYA H;  5TSS A;  1CS0 A;  4G7H C;  3PW4 A;  5I6Y A;  1EQR A;  2B8F A;  2R61 A;  2W9C B;  2ZJQ A;  1E0B A;  5C4X B;  1R4Q B;  4CJ0 B;  3CAM A;  3CCR A;  3K5N A;  2F0T A;  2AUK A;  3KHR A;  2XC9 A;  2KCN A;  4P73 A;  4DV4 Q;  1GSO A;  1LM0 A;  4ED3 A;  4YR0 A;  2W9C A;  4DV0 L;  5LXT F;  2RQX A;  1YJ9 A;  1CKN A;  4HNV A;  1XPR A;  4DR4 H;  1Q86 C;  3S1M B;  1V9P A;  2EYH A;  2OF1 A;  1U4L A;  4HIO A;  2MGS A;  1ENC A;  2QKI C;  3PO2 H;  4JV1 A;  2HIX A;  3MHB A;  2CQY A;  1EZ1 A;  4PG3 A;  3MWY W;  3Q6S A;  4CBV A;  1CK1 A;  2RSN A;  2XGQ A;  2F4V Q;  3HRZ C;  4DR7 H;  3VR4 A;  2DN8 A;  3GQB A;  4ILW A;  4ECU A;  4FBU A;  1N9W A;  1C0A A;  5K5P A;  2JK8 A;  4EX5 A;  2MQH A;  5JPM C;  3T53 B;  3SE0 A;  4Q0Y A;  1KEE A;  5GRO A;  1LUZ A;  5LMU H;  2K33 A;  1EUJ A;  3H09 A;  3PO2 B;  4DAV A;  2D2C C;  2P5Z X;  1U9R A;  5BR8 L;  4BS9 A;  5LMN L;  1XWE A;  2A68 C;  2Y0S A;  4RGN A;  3M9N B;  5KFO A;  4IHJ F;  1VQ9 A;  3TQT A;  1PRT C;  2YS7 A;  3ULP A;  1EIH A;  4A2A A;  4WOR A;  2K01 A;  1L0W A;  1FD7 D;  4MHE A;  5EPL A;  4PMC A;  4QQB X;  1RTN A;  1VQJ A;  1LTA D;  4HNT A;  4R4Q A;  4A3J B;  1BOS A;  2AGQ A;  5A2Q L;  2Z4I A;  1SND A;  1XNQ L;  4TRD A;  1ASZ A;  1GUS A;  2QA4 A;  2R87 A;  5ELO A;  1AH9 A;  4OHJ A;  1KBL A;  3TRZ A;  1C4Q A;  1F9R A;  3J7A K;  4Q43 A;  3CRK C;  3GTG B;  1NMG A;  2N88 A;  4O1N A;  3VR5 A;  4J9S A;  2BH8 A;  5C0X I;  2Z4H A;  1ET6 A;  3TP7 A;  4R4O A;  3UDX A;  1AFP A;  4B3T L;  4B3R L;  3CCM A;  3BVZ A;  2ZTE A;  4CJ1 B;  2MFI A;  1D8L A;  5EAY A;  1PFM A;  4A3B G;  4XQN A;  1J5E H;  3I4L A;  1G29 1;  1NR4 A;  4C3I H;  1EY7 A;  1TKW B;  1I7N A;  1TQO A;  3GTL H;  2ASD A;  2F0L A;  1RJR A;  2I5L X;  4DK6 C;  3N44 B;  4YAJ B;  1HA6 A;  4AH6 A;  3W2D A;  2E2H B;  1I50 B;  4LH7 A;  2K5W A;  3M4P A;  2XRQ D;  2Z9H A;  3G6Y A;  2WDT A;  1UNN C;  5EGT A;  5KT2 A;  5FLX W;  1HQR D;  5CGK A;  3KLS X;  4LWC A;  5EZY F;  2EPB A;  1QE6 A;  2E2H A;  1ILQ A;  4DR1 Q;  3HP3 A;  5IGB A;  1I50 A;  4C3I B;  4CDD C;  1OXS C;  4XIG S;  2NVQ B;  4JI1 L;  1B9M A;  3M3Y H;  4UCO A;  3S14 B;  2EXZ A;  3PF5 A;  4CDC C;  1U4M A;  2ZDG A;  4LFC H;  2R84 A;  1VQO A;  3T1H H;  3BG5 A;  4RNM A;  2KEN A;  3UI2 A;  3RZD B;  2E5L L;  2B63 B;  3K0Y A;  3GTL A;  2HHH L;  1XNR H;  2Z1C A;  2YYZ A;  3PR4 A;  1SCU B;  3RAQ A;  5IP7 G;  5IGG A;  3Q8P B;  4RCN A;  4DV1 H;  2IHE A;  2Q8I B;  5LL6 S;  1S5B D;  1WD1 A;  3FRP B;  1TII D;  2BQ3 A;  4Y7N B;  1M6V A;  2O03 A;  3GLK A;  4DK0 A;  1YNN D;  1S4Z A;  4M7E A;  1D1K A;  4HSP A;  2QYZ A;  1GXD C;  1VQH A;  4J8Q A;  1D7Q A;  1TU2 B;  4A3B H;  1IBM H;  4P74 A;  2RKS A;  2P0A A;  2F0W A;  5KFI A;  4IPC A;  2NZH A;  1YNX A;  4HJ9 A;  3HS0 C;  3DHQ A;  3CF5 A;  4DR2 H;  2R8J A;  3K5H A;  4O2D A;  2VOB A;  1GKH A;  3S16 H;  2Z6K A;  2B2T C;  1HNZ H;  1LT3 D;  2NUA B;  2JP1 A;  1ZET A;  1GUT A;  2CCZ A;  2NZO A;  5JJL A;  3I73 A;  5D14 A;  5COR A;  3K3P A;  1QWY A;  2RCF A;  4DXF A;  5AJ3 Q;  4A76 A;  2JA7 G;  1W3S A;  1OXU A;  2UUB H;  3R2T A;  4DL6 A;  4A3B B;  1PH5 A;  3CD6 A;  5KFD A;  4LFA Q;  4OX9 Q;  2DLN A;  1SNM A;  4DGZ A;  2TMP A;  1VMP A;  3F2C A;  4NLG A;  4R8I A;  4O4H F;  1Q8K A;  4L5S A;  3S16 B;  3D0F A;  2PN1 A;  4HID A;  4MTD A;  2LXJ A;  1GSA A;  5IT9 c;  5DGB A;  1F2M A;  3HOY B;  4J9K A;  3OYY A;  4GN3 B;  1HHV A;  2L55 A;  4IUU A;  2D5D A;  4FBT A;  1JOK A;  1ULZ A;  3T5J A;  1VQE A;  3RLO A;  4N8X 1;  2MO0 A;  5IP7 H;  4QIW B;  3ULL A;  1LLR D;  1CA6 A;  1EEI D;  1JIC A;  2FJ2 A;  4JI7 Q;  4C1N I;  3HOW B;  4GNX C;  3HGB A;  4ZK9 B;  1AE3 A;  2R8I A;  2WAQ B;  1KTK A;  2V4R A;  3EN2 A;  1PTO H;  4DV2 Q;  1PDQ A;  1ZKO A;  1WCM G;  2F0O A;  2YTV A;  3G7L A;  1IBL Q;  5M5W H;  2A73 B;  1C9O A;  2XN9 C;  1N48 A;  1EU4 A;  3NBI A;  5BPF A;  2V58 A;  1S10 A;  1PH3 A;  5C4H A;  3R2I A;  4X62 H;  1GUN A;  2C2R A;  2AQ1 B;  4YJ2 F;  2ZXR A;  3ORR A;  4JI4 H;  1L1O B;  4O4I F;  5KG6 A;  4ODG A;  4YWK A;  3KLW A;  1N36 Q;  5KFL A;  1PTO B;  3EBE A;  2NZ1 D;  4O0A A;  5F2D A;  1Y1W B;  2JA7 H;  1IW7 C;  5JJK A;  3KAL A;  1HR0 H;  4HCE A;  2EXD A;  4YCV A;  4IOC A;  4KK7 A;  1X3E A;  4DR6 H;  3CCS A;  4WRD A;  1SMY D;  1L1O A;  5C3E B;  1PLF A;  4R4T A;  1JOO A;  1SNP A;  1GM5 A;  1I3Q H;  3V6J A;  4UCT A;  3NQI A;  4BY7 G;  2BA0 A;  1LAC A;  4JI8 Q;  1V1P A;  1L2F A;  1FNV A;  3B6Y A;  1GD7 A;  5KG5 A;  4RGO S;  2I0Q A;  4LFB L;  2BCO A;  3BDO A;  3K7A H;  3OUU A;  1H9R A;  4ULL A;  3JRW A;  4TKO B;  2UUA Q;  5D65 A;  3P20 A;  1X6O A;  5M5X B;  3EPG A;  5DM6 3;  4B3M H;  4MTN A;  4PV1 C;  5FLX c;  4JI3 Q;  3H94 A;  3NP8 A;  4LF7 Q;  1F2Y A;  1ET9 A;  5ELB A;  3L0O A;  3DEP A;  4IFD I;  2XTI A;  2FPI B;  3M4I A;  1BO0 A;  4DV6 L;  4QWB A;  4GC7 A;  4FP5 D;  3K6O A;  3EJI A;  4DF7 A;  4ED0 A;  4NXN H;  1SE2 A;  3SK6 A;  3VA7 A;  2DGY A;  2OXP A;  1LT4 D;  1I3Q A;  4KY5 A;  1IYJ B;  1J8I A;  4ZHQ F;  4K8I A;  3K5I A;  1A2T A;  3E3X A;  1BBW A;  3I55 A;  1HUM A;  4NMZ A;  4UAI A;  2RVL A;  4ABN A;  4LF6 L;  4A3L G;  1VF5 C;  2FHT A;  3J81 c;  1W96 A;  4A3M G;  1KJ8 A;  4XYL B;  5CR3 A;  1N33 Q;  5L1J A;  4M9U A;  4DV5 H;  3PIP A;  3Q24 A;  5C5J A;  3OWE B;  1I6V C;  4XYO A;  4EGV A;  2O2L D;  1YHA A;  4DR4 L;  3OSP A;  5HV6 A;  3JSL A;  1VS0 A;  1VKZ A;  2G9H D;  3AQQ A;  4AQY Q;  4DUY H;  2N78 A;  1PYS B;  3NQT A;  5M9O A;  4YBZ B;  3PW7 A;  1H9S A;  2DJG C;  1XMO Q;  3OIQ A;  4JC0 A;  2N3S A;  3U50 C;  4YY3 L;  5M3F B;  1CA5 A;  4ZQI A;  1JXL A;  1WR2 A;  2W9B B;  3RAX A;  4DR7 L;  1SYF A;  4FF3 A;  4BY7 H;  3KBG A;  5BPH A;  2HDL A;  1ML0 D;  3WDN A;  3BA8 A;  1E2Z A;  4QF4 A;  4IUT A;  2OT2 A;  3E9H A;  5C3W A;  3GV5 B;  2W9B A;  5FJ8 H;  1M0W A;  2Q2I A;  3PQI A;  5LMU L;  2DPI A;  4YJ3 F;  3J81 i;  4MA5 A;  2IT1 A;  3R5F A;  1PTO D;  2IX3 A;  3R5X A;  4O3S A;  1V1O A;  2R7K A;  3U4V A;  1B44 D;  1TS5 A;  3PV0 A;  3QZ7 A;  1D6E C;  1B9N A;  2E2I H;  4OO1 H;  4EYH B;  5EKI A;  1Q46 A;  4G57 A;  1ESF A;  4BY7 B;  4Q0F A;  2NTT A;  4DV0 Q;  4NB3 A;  4YWM A;  2QF7 A;  5KFR A;  2A69 D;  1HCZ A;  2FP4 B;  3LWB A;  3A7L A;  3UDG A;  1E4G T;  1RJP A;  2NN6 I;  1EY5 A;  4HR7 B;  5LYJ F;  4JPB W;  4AYB E;  3DF7 A;  3DMU A;  2NVX H;  2B2W C;  5DG8 A;  4LAA A;  1BCP F;  1STN A;  4A3M H;  2BR0 A;  4MZ9 A;  4GKJ H;  4NDX A;  1LTL A;  4R8N A;  2A5H A;  3I4M B;  3KHL A;  3J7Z C;  1EHI A;  2VPQ A;  1MJC A;  4HR7 A;  3U4Z A;  5C4J B;  2GVA A;  2QDL A;  5I9O A;  3NE5 B;  5EOY A;  5JEA J;  1U0L A;  2E2I A;  4ZRZ A;  2PO4 A;  3SHL A;  4LF5 H;  3NTH A;  5BR8 Q;  4ME5 A;  4F8M A;  5LMN Q;  4TQR A;  1TWC H;  3P75 A;  1RTO A;  2BQU A;  1IHZ A;  3HEJ A;  3S1N B;  3STB D;  3A54 A;  2OTJ A;  5JEA G;  3A0J A;  2BDO A;  1J5E L;  3GV7 B;  1O7Y A;  4IO9 A;  2CW0 D;  2NVX A;  5HBR B;  1JWS D;  2RHS B;  4G7Z C;  1LAB A;  4KHP L;  2PBZ A;  2RDI A;  1SYD A;  5FLX L;  4EGJ A;  1WTR A;  4JBW A;  2DY8 A;  2L12 A;  4XZ3 B;  1EL0 A;  1CQI B;  1X54 A;  4LF8 H;  3CCL A;  5CAE B;  5KFB A;  4BY1 G;  4J9Q A;  4MV7 A;  4X64 H;  1KXL A;  3IAY A;  2VPS A;  4IFD G;  4JW0 A;  1TWC A;  1KQS A;  4HAE A;  1O7I A;  5EKK A;  2MUY A;  5BN4 A;  3GIM A;  3SXH A;  4GKK H;  4B3T Q;  4B3R Q;  2UU9 H;  1PYW D;  1T94 A;  3GII A;  4LFC L;  3A56 A;  4XX0 B;  2EY1 A;  1SDF A;  1I4X A;  3RZO H;  1IZ6 A;  4AYB G;  2C2E A;  1XNR L;  3R5H A;  2KCC A;  1MKH A;  2DZD A;  1STB A;  4DV1 L;  3S1Q B;  1IYV A;  2RF4 A;  3CP0 A;  5DLF A;  3I2Z A;  4N9P A;  3RFC A;  1Y1V G;  1J9O A;  4QUC A;  5J2T F;  3HFZ B;  2F0F A;  3MFY A;  4X66 H;  4QCL A;  5IY0 A;  3UFX B;  2XVS A;  3IFD A;  1PVO A;  3I8Z A;  1OXX K;  3LWU A;  1Q90 A;  5JEA H;  1IBM L;  4ETS A;  4OL7 A;  2B2Y A;  3FHW A;  3HG9 A;  4DR2 L;  1MZB A;  4X3K A;  4EEQ A;  1X3P A;  2PNR C;  1PRT F;  3CMA A;  1ZXT A;  3JAM c;  2XWB B;  4JI1 Q;  4NKL A;  3LWE A;  1F9Q A;  5M3M H;  3MFI A;  1BJT A;  2ALY B;  5KFV A;  1SNO A;  4NXM Q;  2YW2 A;  4J9O A;  3CPF A;  3GV3 A;  1SE3 A;  4P75 A;  2R7Z G;  1MIU A;  2E5L Q;  1Z47 A;  4UP8 A;  3D3R A;  2UUB L;  1SEB D;  4BY1 H;  3Q8S B;  2ZM6 H;  3CPW A;  2HHH Q;  3VR2 A;  2PVP A;  4C1N K;  5KFT A;  2JA9 A;  3T1Y H;  1IXR A;  4EBE A;  1GGO A;  4IFD H;  2FK3 A;  2R3Z A;  2JA6 B;  4IUN A;  2DWC A;  3HBL A;  3EPI A;  3TSS A;  2Q2H A;  2VXW A;  1B6S A;  4PNY A;  4F88 A;  3BZC A;  2D9U A;  3S17 B;  1F2L A;  2V1C C;  4R9W A;  5M3M B;  3A8K E;  1PMR A;  1A2U A;  3MWM A;  3I91 A;  4B3S Q;  1LTR D;  5IT9 E;  1GVP A;  5KNB A;  3DWA A;  2K5H A;  2NN6 G;  4A93 G;  1E4E B;  5E1F A;  1K1S A;  5LL6 X;  2A1A A;  2XCP A;  2UVV A;  1UEB A;  2AHO B;  2IPK D;  4DAP A;  2A6E D;  4IAJ A;  4X3S A;  3K5M A;  4JI0 Q;  5KND A;  4G4K A;  3JAM i;  2E75 C;  1DV2 A;  2Q2T A;  4KN4 C;  1WH2 A;  3CCV A;  5FPO A;  3KDF B;  2UXC Q;  1SMX A;  5KIX A;  4R7R A;  2KHS A;  5KFE A;  1HTP A;  3G8C A;  4IZ8 A;  4RAU C;  1Y1V H;  2J4X A;  2IA6 A;  3PN1 A;  4XT1 B;  3D6W A;  1FKA H;  3ERS X;  4HJ7 A;  4I65 A;  4GS3 A;  3QFF A;  3TIG A;  2NB0 A;  3KDF A;  3CQZ B;  3K81 C;  4YAK B;  2FIN B;  1LTG D;  2OQK A;  5LHY 1;  4XXE A;  4RNO A;  5ELF A;  1S3O A;  4XQQ A;  2K6A A;  1G91 A;  2AQ4 A;  5BN5 A;  5IOD A;  4POG A;  1PH8 A;  4LUV A;  4DUZ H;  4UCV A;  4JI4 L;  4AYB A;  5FLM H;  4Y52 H;  4ECS A;  3A8J E;  3RJ0 A;  3OPO A;  3K59 A;  1Z6H A;  2R7Z H;  1FGU A;  1AUV A;  1P16 A;  5C44 B;  5DQI A;  4C2M H;  1BF4 A;  1GYF A;  4N8F A;  1DM0 B;  2WYO A;  1LV9 A;  2KEE A;  1N34 H;  1E3P A;  1XMQ H;  1TWA H;  1Y1V A;  3RV4 A;  4MIU A;  3GTO H;  1W93 A;  4ME6 A;  3IKJ A;  1KLU D;  3X3N A;  1M4V A;  4LNQ A;  2FKL A;  2A19 A;  2NU8 B;  2V9W A;  4KMU C;  2L4N A;  4LF9 H;  3MJF A;  3BDL A;  4A93 H;  4GOP A;  2DNE A;  2JSO A;  2YRW A;  2CW8 A;  4OIJ A;  4TV9 F;  4RH6 A;  5JQW A;  4B3M L;  2O4X A;  1I6U A;  1U4R A;  1X3G A;  4X3U A;  2VL6 A;  5FLX E;  4A75 A;  3GTO B;  2FPG B;  4PMB A;  4X65 L;  2J9G A;  4JCV E;  2JEI A;  4QMG A;  2R7Z A;  4C2M A;  4KN7 C;  5KFK A;  1B04 A;  3M9O B;  4A3J G;  1WYD A;  1VQ7 A;  5JVD F;  3GTO A;  4F4Y A;  3FKI G;  3T56 B;  5G3L F;  2F0G A;  3BDC A;  2CH4 A;  3M4Y A;  4JK1 C;  5KFJ A;  4CC6 A;  3I72 A;  3J81 E;  1V8Q A;  1HNW L;  3DLL A;  1Q1B A;  5HGQ A;  4DAM A;  4QGU A;  3S1M H;  5FO8 B;  5KFN A;  4LFB Q;  3UQ8 A;  1B50 A;  4DUY L;  1YJW A;  3K0X A;  4Q8F A;  1BUV T;  1J6Q A;  1YHB A;  2MP1 A;  4Q8E A;  2N49 A;  4HQ6 A;  3TS2 A;  3TME A;  5I6W A;  3V05 A;  3D8G A;  1K3R A;  4QY7 A;  4ZI7 F;  3QIA A;  4ECR A;  5GAD C;  3W1G A;  2OWO A;  4B9W A;  4DV6 Q;  4J1M A;  3RR5 A;  1ROD A;  3KHG A;  5I2X A;  3CC2 A;  3TP5 A;  2WAC A;  2C5C A;  2I46 A;  4GZY C;  3UDF A;  5KYL A;  1NY4 A;  2XCL A;  1ENA A;  1Z2N X;  4F87 A;  1UE1 A;  2F4V H;  2WB1 B;  2OCE A;  1RHP A;  3RUZ A;  3TEH B;  1EIY B;  4LF6 Q;  2R7D A;  1TWG H;  1GUW A;  4UDU C;  4C3I G;  1VQD A;  2Q8R E;  1K8O A;  5IT9 W;  4IOA A;  4R4C A;  2WE6 A;  1YNJ D;  4DR4 Q;  4A3J H;  3DM3 A;  5T14 A;  1ZHS A;  3GIQ A;  4HYK A;  1CSQ A;  3FKI H;  3QG1 A;  3T16 A;  2ALZ A;  4J6H A;  4WJ4 A;  4XDX A;  3G6J B;  2QEJ C;  4QIW E;  1EWI A;  3RBE A;  2R6G A;  3KLR A;  3H20 A;  1E1O A;  2NU6 B;  2RHQ B;  5AFW A;  2B63 G;  2B2Y C;  1EYZ A;  4YY3 Q;  3MR3 A;  2NUC A;  2W70 A;  1BR9 A;  1TWG B;  2VQE L;  2YRX A;  5EBC A;  3GTG H;  4DR7 Q;  1WI5 A;  3Q2O A;  3RTX A;  1KC7 A;  3OTO H;  4AIM A;  1VQL A;  2YU9 B;  4IR9 A;  1XTC D;  2HD3 A;  4MNO A;  2V59 A;  1SYC A;  5CB4 F;  1TWH H;  2ZTD A;  4BBS B;  2H1E A;  3FEW X;  2E76 C;  1TWG A;  3FKI B;  4F4W A;  1SR3 A;  5LMU Q;  3NPP A;  1VQN A;  1QIL A;  1E22 A;  4A3G B;  2YU9 A;  2LFN A;  4EFE A;  2W6Q A;  1CZW A;  1SFO H;  4LF5 L;  1AP0 A;  5CBA E;  3PUY A;  2VY3 A;  3VYU A;  5C5L A;  4QL5 A;  1BDO A;  2F0E A;  4A3C G;  5DLG A;  3BQ1 A;  4YR3 A;  1MHW C;  4U6P A;  4MTK A;  1WTP A;  2JEJ A;  3FKI A;  2B2V A;  3VPC A;  5GAE C;  2QCP X;  1NSN S;  1GOZ A;  2VZA A;  5HUR A;  2IY5 B;  2RDJ A;  2XWJ B;  3GTK B;  1TWH B;  1PH2 A;  2E2H H;  5KFA A;  4DV7 L;  1I50 H;  2NVT B;  1QVF A;  1YEZ A;  4DXG A;  5IE8 A;  2GPW A;  1L0Y B;  2J6U A;  3GTG A;  5C6A A;  2G5D A;  3J80 c;  3E0E A;  2AQ2 B;  1QUQ B;  4ID6 A;  2VQF L;  2DNC A;  1SFO B;  1PH1 A;  2EYO A;  2WII B;  4DA2 A;  4WJW A;  4PZ6 A;  1TWH A;  4LF8 L;  3C0F B;  2LMC B;  2I5M X;  2ZXO A;  2I8C A;  3RIZ A;  3GIJ A;  3NXW A;  1EFI D;  2NVQ H;  4X64 L;  1EFW A;  3H0G B;  1EYG A;  3BZD B;  4JI6 H;  1SFO A;  3S14 H;  3VPB A;  4O2A F;  4J9P A;  3HOY G;  2C2D A;  4TVA B;  2VNU D;  4HTH A;  4GKK L;  3RZD H;  2B63 H;  2JXM B;  4LUO A;  4YR2 A;  2KQ3 A;  3BAB A;  1C3O A;  4DR1 H;  4A2B A;  1R9T B;  4U67 3;  1C30 A;  4DK1 A;  4WBN F;  4RAY A;  3S1R B;  4NPS A;  4ME3 A;  3TQY A;  3PR5 B;  3S2H B;  1VQG A;  1J5E Q;  1HZB A;  3BYT B;  4ZQ3 A;  1T9H A;  1CHP D;  3CCU A;  3HOW G;  4O3N A;  4RB3 C;  3U9S A;  3PCO B;  3M9M B;  1E4F T;  2WAQ G;  5D3I B;  3J80 i;  4Y7N H;  4K14 A;  1S68 A;  1W6J A;  3C46 A;  4LMY A;  4K2L A;  5FPR A;  4KHP Q;  3K57 A;  4PWQ A;  4OWT B;  1EWH A;  4C3H B;  3J81 W;  4OO1 I;  1BNC A;  2V4D A;  1BNZ A;  2F1M A;  4K5X A;  1JIH A;  4QWC A;  4ZUJ A;  1WTH A;  1N32 H;  3LX0 A;  4X66 L;  4A3C H;  2CHB D;  1IKM A;  3H40 A;  1X3F A;  1NCV A;  3TZU A;  3IRB A;  2EYP A;  3GO5 A;  3Q1K A;  4DR3 H;  4FNF A;  3NHH A;  1Z2P X;  2B63 A;  2R92 G;  2VB2 X;  1EZ8 A;  4JVZ A;  4GOP C;  3JAM E;  3N43 B;  1Y1W G;  3E6Z X;  5IGD A;  4RKL A;  2JEF A;  5DNF A;  3WWV A;  4LFC Q;  1S97 A;  5FKA C;  3Q23 A;  1OWT A;  1JJ2 A;  5C3E G;  2F0M A;  1KDC A;  1RL2 A;  2ZM6 L;  3GIL A;  1OXV A;  1XNR Q;  4FYD A;  4CC5 A;  2UXB H;  4LK1 C;  1STG A;  2KHI A;  4IUV A;  3MWE A;  3T1Y L;  3MXN B;  1OXT A;  4RFB A;  1WTV A;  5DLQ E;  4DV1 Q;  3HOY H;  3PMF A;  3ZYY X;  3HOZ H;  1SYE A;  1PK8 A;  2R6F A;  5LL6 b;  4QWA A;  3K5O A;  1SJH D;  1MD2 D;  2OLS A;  1SXT A;  1VQ4 A;  2K04 A;  4QW9 A;  3MXN A;  1STA A;  2OEO A;  5F9L A;  2B2U A;  5J1Z A;  4F4X A;  4LH6 A;  4RMF A;  3ERO A;  1IBM Q;  2Z6B A;  3AB9 A;  3HOW H;  4U7C A;  2IJ0 A;  4BBR B;  4DR2 Q;  4FO2 A;  5JVL A;  3M4O B;  2SEB D;  4DR5 L;  1WTX A;  1GSH A;  4LW1 A;  1HQM C;  2ICI A;  2XD4 A;  2CQO A;  5KFQ A;  3HOZ B;  3SVM A;  2IMW P;  3F8T A;  3S2D H;  2WTF A;  1E2V A;  4I4T F;  2EJF C;  3G6X A;  1KHI A;  1KRS A;  1CTM A;  2LKV A;  2DJF C;  2JJQ A;  1EOT A;  2BE5 D;  3R93 A;  4ED8 A;  1I4P A;  3JC6 6;  3G4S A;  4NW2 A;  4A3F H;  2UUB Q;  2E2D C;  4JUZ A;  3HKZ B;  2J0T D;  4GN4 B;  5IP9 G;  1SE4 A;  1RF2 D;  4X6A H;  2R92 H;  5C5M A;  4JOI A;  4DV2 H;  2AU0 A;  1D5Z C;  5KT4 A;  4DUZ L;  4QIW A;  1Y1W H;  4OEM B;  1IBL H;  3AFQ A;  5CA0 F;  3HKZ A;  4R1J A;  3OOC A;  3S2D B;  2Z8L A;  3BJU A;  3SI8 A;  1CQF A;  1EQQ A;  3CKI B;  2WAQ A;  2F52 A;  4A3F B;  5C3E H;  4EQO A;  4FF2 A;  1PH9 A;  5M3F G;  5IWA L;  2SOB A;  1SRU A;  4BXX H;  1N34 L;  1XMQ L;  4J9N A;  5ISR A;  3RD4 A;  3URY A;  4DK3 C;  3J7Y W;  1YHQ A;  1DV1 A;  2W6N A;  4H44 C;  2R92 B;  5ELD A;  1FVI A;  1ONL A;  4DKA C;  2RDG A;  2YS6 A;  3FPU B;  2X6G A;  1HTL D;  1VQA A;  5CV8 A;  4ZYS A;  4DNT B;  1S5C D;  1N8R C;  4RA8 A;  4E6I A;  1MJE A;  1H9M A;  5M5X H;  2R92 A;  1P8L A;  1HR0 W;  5IYD G;  3SE7 A;  5DM7 3;  1G6Z A;  1Y1W A;  4L63 B;  4JI8 H;  1JB3 A;  3HXL A;  1CHQ D;  2F3I A;  3W5O A;  1K3B C;  2E2J B;  1JWM D;  3MZ5 A;  2BDN A;  2IL8 A;  4A3I H;  3RN5 A;  1X9N A;  1M1K C;  3MAQ A;  1H9J A;  2UVW A;  4JI4 Q;  1NMF A;  1K8M A;  1YNN C;  2PMZ B;  3NWS A;  5FJ8 G;  4LJZ C;  1O75 A;  3GTQ H;  3DXJ C;  4JI3 H;  4LF7 H;  3BS1 A;  1DD2 A;  3H3V H;  4DU9 A;  4QW8 A;  2EIF A;  4ZKB B;  1W2B A;  1ASY A;  1B7Y B;  5IP9 H;  2B2V C;  4OO1 G;  1K83 H;  4LUZ A;  5EPK A;  3I4M G;  2PMZ A;  3ZJY C;  4F7X A;  2PNH A;  1TXY A;  2L0C A;  4A3I B;  4FF4 A;  1V51 A;  3E5N A;  4JYA L;  5J39 A;  4F4Z A;  4RGT A;  4IJL A;  2A6H D;  1EWC A;  1EIG A;  2LSS A;  1XTD A;  3GTQ B;  4GC6 A;  3V4S A;  2FLL A; 
#chains in the Genus database with same CATH homology
 2YTX A;  3A5Z B;  1NBW A;  4DV1 L;  5M3F H;  1V1Q A;  2RF4 A;  1FJG Q;  3CP0 A;  4C3J H;  2RCN A;  4DPG A;  3I2Z A;  5HY6 A;  2ID0 A;  4GLA C;  4B3M Q;  1Y1V G;  4ALP A;  4NXM L;  3HFZ B;  3A74 A;  4X65 Q;  5IY0 A;  5M5Y H;  1PVO A;  3UE1 A;  5IYC G;  3T1H Q;  1OXX K;  2K75 A;  1IBM L;  1EQR A;  4PMW A;  5GAH C;  2ZJQ A;  1N32 Q;  3FHW A;  4BXX G;  4DR2 L;  4BBR H;  3CAM A;  3CCR A;  3CMA A;  3M4O H;  5IYD H;  3JAM c;  4DR3 Q;  3GDE A;  4JI1 Q;  4P73 A;  3RLN A;  4DV4 Q;  1LM0 A;  5M3M H;  4B3S L;  2Z0S A;  4DV0 L;  2CWA A;  2Q2U A;  4L5Q A;  2ALY B;  1YJ9 A;  1PA6 A;  1CKN A;  4DV3 L;  1XPR A;  4NXM Q;  1Q86 C;  1HNW Q;  3CPF A;  4P75 A;  1G51 A;  2R7Z G;  1MIU A;  1V9P A;  1Z47 A;  2KCM A;  4UP8 A;  3HOX H;  2E5L Q;  2UUB L;  1VQI A;  4HIO A;  4BY1 H;  3CPW A;  4JI0 L;  2HHH Q;  3KF8 B;  3PO2 H;  4BA2 I;  2HIX A;  4PG3 A;  2JA9 A;  2MO1 A;  1IXR A;  4HJ5 A;  2BA1 A;  4A3D H;  2UXC L;  1HNX L;  1G6P A;  4DUY Q;  2F4V Q;  1KC8 C;  2Q2H A;  2UXB Q;  4A3I G;  3BZC A;  3RLF A;  4A4I A;  1HNZ Q;  3I4M H;  2V1C C;  4PZ7 A;  1N9W A;  1C0A A;  2AWN A;  4B3S Q;  2UUC L;  3PUZ A;  1GVP A;  2JK8 A;  4EX5 A;  3OTO L;  2MQH A;  5C4J H;  2K5H A;  2NN6 G;  4A93 G;  2UXD L;  5GRO A;  3PUX A;  2A1A A;  1LUZ A;  4HJA A;  1UEB A;  2AHO B;  1QZH A;  1EUJ A;  4JI0 Q;  3JAM i;  4HIM A;  5BR8 L;  1I94 L;  3HOU G;  2K5V A;  5LMN L;  2Q2T A;  4OWW B;  1VQC A;  3CCV A;  1UE6 A;  3KDF B;  1QZG A;  4JBK A;  2UXC Q;  1SMX A;  1S72 A;  4JI5 L;  3S1N H;  1VCI A;  1VQ9 A;  1Y1V H;  3ULP A;  2Z6K C;  4K0K L;  3L2P A;  2H5X A;  3ERS X;  1L0W A;  4HJ7 A;  1PV4 A;  4GS3 A;  1Z9F A;  5IYC H;  4JG2 A;  2KHJ A;  2PQA B;  1UWV A;  3KDF A;  4QQB X;  1VQJ A;  4A3D G;  4R4Q A;  3J81 j;  3K81 C;  5C0X J;  1VQB A;  2OQK A;  2K50 A;  1Q1E A;  1S3O A;  1XNQ L;  1QVC A;  2YTY A;  3E9I A;  1ASZ A;  4POG A;  1PH8 A;  2QA4 A;  2E2J H;  1SN8 A;  4LUV A;  1PHJ A;  5ELO A;  1AH9 A;  2PQA A;  3TRZ A;  3KOJ A;  4JI4 L;  5FLM H;  4Y52 H;  1GO3 E;  5C0X G;  2VQE Q;  2EQS A;  2D0P A;  2R7Z H;  1NMG A;  1FGU A;  1P16 A;  5ELN A;  4LF9 L;  4C2M H;  2BH8 A;  3KF6 B;  5C0X I;  2JA6 G;  3CW2 C;  2L15 A;  4R4O A;  1E3P A;  3UDX A;  1TWA H;  4B3T L;  2JE6 I;  4JI6 L;  4B3R L;  3CCM A;  1KRT A;  2ZTE A;  5M3M G;  3GTO H;  3GTM H;  2MFI A;  1XNQ Q;  1D8L A;  3AFP A;  4TQU S;  5EAY A;  1K9M C;  4X62 Q;  4XTC S;  1EOV A;  5IYB H;  4GLX A;  3KF6 A;  4A3B G;  2IHF A;  4LF5 Q;  4LNQ A;  2A19 A;  1G29 1;  2B29 A;  4C3I H;  4J15 A;  1WJJ A;  3F2B A;  3M4Q A;  4A93 H;  5E7N A;  2N8N A;  3Q8D A;  4GOP A;  1K8G A;  1HR0 Q;  1EIF A;  1KAW A;  3GTL H;  3S1Q H;  2I5L X;  4DK6 C;  4DR6 Q;  4AH6 A;  3PSI A;  4B3M L;  2ATW A;  1X3G A;  3HOU H;  2VL6 A;  3M4P A;  4DV7 Q;  5JJI A;  4A75 A;  3CME A;  4X65 L;  4JCV E;  1JJG A;  3T1H L;  2AMC B;  2VQF Q;  4LWC A;  1N32 L;  4A3J G;  1WYD A;  4DR1 Q;  4LF8 Q;  3CC7 A;  1YZ6 A;  1VQ7 A;  1OXS C;  1Q82 C;  3FKI G;  4XIG S;  4DR3 L;  4JI1 L;  4L5T A;  4X64 Q;  3M3Y H;  4DV4 L;  4YCW A;  3PF5 A;  2K52 A;  3BZK A;  2HQL A;  2JA8 G;  1V43 A;  1L1O C;  1VQO A;  1HNW L;  3DLL A;  2KEN A;  2D0O A;  1Q1B A;  2E5L L;  4GKK Q;  5HGQ A;  4DAM A;  4QGU A;  3AYH B;  1NE3 A;  5C44 G;  2VUM G;  3S15 H;  3S1M H;  2HHH L;  2YYZ A;  4UP7 A;  1U5K A;  5IP7 G;  3GTP H;  1WCM H;  4NXN Q;  4LFB Q;  3S24 A;  2IHE A;  4DUY L;  1X65 A;  3K0X A;  3CCJ A;  1YJW A;  1CUK A;  3CCE A;  1YHB A;  1J6Q A;  2F4V L;  2JA6 H;  2UXB L;  1HNZ L;  2N49 A;  1B70 B;  2WB1 E;  3TS2 A;  3S17 H;  1VQF A;  2HIV A;  5FLM G;  3G6E A;  2D62 A;  1K3R A;  4QY7 A;  5GAD C;  3W1G A;  2OWO A;  3GD7 A;  1S40 A;  4DV6 Q;  1VQH A;  1D7Q A;  4DAY B;  4A3B H;  3RR5 A;  4P74 A;  4DV5 Q;  1H95 A;  3CC2 A;  4IPC A;  1YVC A;  2NZH A;  1YNX A;  4X66 Q;  2ZJR A;  4HJ9 A;  2JEB I;  3CF5 A;  3UDF A;  1NY4 A;  4O2D A;  1GKH A;  1UE1 A;  3S16 H;  2OCE A;  2Z6K A;  4YWL A;  4LF4 Q;  3TEH B;  1SLJ A;  5IYB G;  1PH7 A;  1EIY B;  4EQ5 A;  2CCZ A;  2WP8 J;  4LF6 Q;  2NZO A;  5JJL A;  2NVY H;  1NTG A;  2R7D A;  3G48 A;  1TWG H;  2K14 A;  2JA7 G;  5AJ3 Q;  4A76 A;  4JBJ A;  1VQD A;  1W3S A;  1OXU A;  1PH5 A;  3CD6 A;  1A62 A;  4IOA A;  4R4C A;  3CQZ H;  4LFA Q;  5GQO A;  4OX9 Q;  4DR4 Q;  4A3J H;  3DM3 A;  3NEM A;  3STB C;  3HKS A;  3F2C A;  3K7U C;  3W1B A;  1CSQ A;  3FKI H;  4GLV B;  1Q8K A;  2ZTC A;  2ZM6 Q;  4L5S A;  3I4N G;  4JV5 Q;  3D0F A;  4QIW E;  4UPA A;  4WJ4 A;  1EWI A;  4HJ8 A;  1E7Z A;  4HID A;  2R6G A;  1M90 C;  2LXJ A;  1YI2 A;  1E1O A;  3T1Y Q;  2RHQ B;  2B63 G;  5IT9 c;  5K36 G;  4YY3 Q;  4KI0 A;  2ES2 A;  4DV2 L;  1WFQ A;  3OYY A;  4GN3 B;  2JA8 H;  2VQE L;  3GTG H;  4DR7 Q;  1WI5 A;  4AIM A;  1VQL A;  4YCU A;  2VUM H;  5C44 H;  1VQE A;  1BBU A;  3RLO A;  4MNO A;  1K8A C;  1Q12 A;  4P72 A;  2MO0 A;  1TWH H;  5IP7 H;  4A3E G;  2ZTD A;  3ULL A;  1CKM A;  1JJC B;  1HJP A;  4R4I A;  3KFU A;  4QJF A;  1SR3 A;  5LMU Q;  4JI7 Q;  4PZ8 A;  1VQN A;  4GNX C;  1E22 A;  3KYH C;  5J3B A;  4X62 L;  1AE3 A;  3EIV A;  4A3L H;  1SFO H;  4LF5 L;  3PUY A;  5LMN W;  4DR5 Q;  2VY3 A;  2A8V A;  3EN2 A;  4QL5 A;  4A3C G;  4DV2 Q;  4OXP A;  1WCM G;  2YTV A;  4P71 A;  1HR0 L;  4GKJ Q;  2CWP A;  4APV A;  1IBL Q;  5M5W H;  1KL9 A;  1C9O A;  5GAE C;  1YIJ A;  4YHH Q;  2VZA A;  2CFM A;  2WB1 G;  2OTL A;  4DR6 L;  2IY5 B;  1PH2 A;  2E2H H;  1KIX A;  3J7A 5;  4DV7 L;  1I50 H;  1PH3 A;  1QVF A;  1YEZ A;  5IE8 A;  1OTC A;  3AEV A;  2GN5 A;  1KD1 C;  3J80 c;  1BVS A;  3E0E A;  4JI8 L;  4POF A;  1QUQ B;  4JI2 Q;  2VQF L;  2ASB A;  1L1O B;  1PFS A;  2AKW B;  1PH1 A;  1JMC A;  4YWK A;  3KLW A;  1N36 Q;  3KJO A;  4PZ6 A;  3EBE A;  2E8G A;  4O0A A;  4DR1 L;  4LF8 L;  2JA7 H;  5JJK A;  1C7Y A;  4DUZ Q;  4JOI C;  4YCV A;  2EXD A;  2I5M X;  4IOC A;  1XJV A;  1FL0 A;  1X3E A;  2JEA I;  3H15 A;  2MNA A;  2NVQ H;  4X64 L;  1EFW A;  4JI3 L;  3CCS A;  2AWO A;  3F2D A;  1EYG A;  1L1O A;  3FP9 A;  4R4T A;  3S14 H;  2GVB A;  1GM5 A;  1I3Q H;  3HOY G;  3I4N H;  2YV5 A;  5IWA Q;  4TVA B;  3MEF A;  1B8A A;  2VNU D;  1N34 Q;  4BY7 G;  4GKK L;  2QGQ A;  2BA0 A;  3I56 A;  3RZD H;  4UY8 C;  4JI8 Q;  4H02 A;  2B63 H;  4IFD J;  1K0R A;  1HZC A;  1L2F A;  4LUO A;  2IX0 A;  1TWF H;  3B6Y A;  1GD7 A;  2I0Q A;  4NXN L;  4LFB L;  1QVG A;  3K7A H;  1HH2 P;  4NPS A;  4ME3 A;  3TQY A;  4JBM A;  4BBS G;  2BH2 A;  1VQG A;  1J5E Q;  1HZB A;  3CCU A;  1T9H A;  3HOW G;  3KJP A;  2UUA Q;  3PCO B;  1X6O A;  4A3E H;  4A3G G;  4MTN A;  2WAQ G;  3J80 i;  5FLX c;  4Y7N H;  4BA1 I;  1Q81 C;  1YBY A;  4JI3 Q;  4LF7 Q;  4GN5 A;  2JA5 G;  3PO3 H;  3L0O A;  4KHP Q;  4IFD I;  1JT8 A;  2XTI A;  4UP9 A;  1IBK Q;  4OWT B;  4DV6 L;  4OO1 I;  4DV5 L;  2UU9 Q;  3UE0 A;  4X66 L;  4A3C H;  1A63 A;  2R7F A;  1X3F A;  2DGY A;  1JB7 A;  3IRB A;  4IPG A;  3GO5 A;  1IYJ B;  1K73 C;  1BBW A;  3I55 A;  4LF4 L;  2R92 G;  4LF6 L;  4FDB A;  4A3L G;  3J81 c;  1XPO A;  4A3M G;  3PO3 G;  2QEX A;  4GOP C;  3PGZ A;  5AJ3 L;  1VQ6 A;  1N33 Q;  1Y1W G;  2KCT A;  2VS1 A;  1A0I A;  1JE5 A;  3PIP A;  3ER0 A;  3UDI A;  1YHA A;  4LFA L;  4OX9 L;  3WWV A;  1BKB A;  3I7F A;  4LFC Q;  4DR4 L;  3L7Z C;  3H0G G;  2XGT A;  1VS0 A;  1JJ2 A;  5C3E G;  4JYA Q;  3TRE A;  3AQQ A;  1RL2 A;  2ZM6 L;  4AQY Q;  4JV5 L;  1OXV A;  1PYS B;  2N78 A;  1CKN B;  2OQ0 A;  1XNR Q;  2UXD Q;  1CKO A;  2KHI A;  3T1Y L;  3MXN B;  1OXT A;  3I4O A;  1VQM A;  4JC0 A;  2N3S A;  3U50 C;  4YY3 L;  4GNX B;  5DLQ E;  4DV1 Q;  1XMO Q;  1HZA A;  1XPU A;  3HOY H;  4DR7 L;  3HOZ H;  1A8V A;  1SRO A;  4L5R C;  2R93 G;  4BY7 H;  3K80 C;  2YU9 H;  1I5F A;  4IJH A;  2K4K A;  3A5U A;  1VQ4 A;  2Y0S E;  3E9H A;  4RG1 A;  4GNX A;  3PUV A;  4BBS H;  4RMF A;  2VW9 A;  1IBM Q;  5FJ8 H;  4WJ3 M;  2Q2I A;  5LMU L;  4HIK A;  4JI7 L;  3HOW H;  3J81 i;  2IT1 A;  4DR2 Q;  1PYB A;  4A3G H;  3HKZ E;  4A3K G;  1HZ9 A;  4KHZ A;  1Q7Y C;  3U4V A;  3PV0 A;  4DR5 L;  4LW1 A;  1YIT A;  2JA5 H;  2CQO A;  2E2I H;  1NJI C;  1Q46 A;  2WAQ E;  1AE2 A;  4GKJ L;  3F8T A;  2CKZ B;  2JQO A;  3G71 A;  4DV0 Q;  4NB3 A;  1IBL L;  3S2D H;  4YWM A;  1KHI A;  1KRS A;  4YHH L;  4DV3 Q;  2JJQ A;  3D31 A;  1PH4 A;  3JC6 6;  3G4S A;  3CCQ A;  4A3F H;  3GTK H;  2UUB Q;  2NVT H;  3UDG A;  4GN4 B;  2NN6 I;  5IP9 G;  3ICE A;  4IPH A;  3H3V I;  5GAG C;  3NEL A;  3HOV G;  4AYB E;  3RNU A;  4JI2 L;  2NVX H;  4X6A H;  2R92 H;  1IL2 A;  4JOI A;  1X55 A;  1N36 L;  1HNX Q;  4A3M H;  4MZ9 A;  1I6H H;  2PI2 E;  1LTL A;  4DUZ L;  5H1S E;  3PUW A;  1Y1W H;  3AFQ A;  3J7Z C;  1UE5 A;  4R1J A;  3PF4 A;  1CSP A;  1MJC A;  5C4X G;  3BJU A;  2FXQ A;  2UUC Q;  3U4Z A;  2GVA A;  1EQQ A;  3OTO Q;  3H0G H;  3PIO A;  2F52 A;  1LYL A;  1E1T A;  1RIP A;  5JEA J;  2KBN A;  5C3E H;  1U0L A;  1PH9 A;  5M3F G;  1VQK A;  5IWA L;  1SRU A;  4BXX H;  1N34 L;  1XMQ L;  3GTJ H;  4DK3 C;  1YHQ A;  5BR8 Q;  1I94 Q;  1VQ5 A;  5LMN Q;  1DGS A;  1FVI A;  1TWC H;  2HT1 A;  3LGJ A;  4DKA C;  2LXK A;  3K8A A;  2IX1 A;  2B3G A;  3NEN A;  2ZJP A;  1R9T H;  3STB D;  4JI5 Q;  1VQA A;  2R93 H;  2OTJ A;  3S1R H;  5JEA G;  1VQP A;  2C35 B;  3A0J A;  3M9B A;  1N8R C;  1J5E L;  3S2H H;  3CXC A;  4K0K Q;  2UUA L;  3CC4 A;  4IO9 A;  2PI2 A;  4BBR G;  1QUQ A;  5M5X H;  1MJE A;  2PMZ E;  4LF7 L;  1E24 A;  3VDY A;  1P8L A;  1HR0 W;  2RHS B;  5IYD G;  2K5N A;  3TS0 A;  4KHP L;  1IBK L;  3F1Z A;  3SGI A;  3HOZ G;  4JBW A;  1XMQ Q;  4DNI A;  3U58 A;  4A3K H;  2F3I A;  4GOP B;  2Y0S G;  4C3H H;  2UU9 L;  3W5O A;  1X54 A;  4A3I H;  3RN5 A;  3CCL A;  1X9N A;  3ULJ A;  1M1K C;  3NBH B;  3HOX G;  4BY1 G;  3M85 A;  4JI4 Q;  4OON A;  1NMF A;  1PH6 A;  3HKZ G;  3PO2 G;  5FJ8 G;  3GTQ H;  1UE7 A;  1Y14 B;  1KXL A;  3BU2 A;  3H3V H;  3M7N A;  4IFD G;  4LF9 Q;  4KLK A;  3OW2 A;  2EIF A;  1KQS A;  1W2B A;  1ASY A;  1FJG L;  2I5H A;  1B7Y B;  1O7I A;  5IP9 H;  4OO1 G;  1K83 H;  1N33 L;  4LUZ A;  1SE8 A;  3HOV H;  2DUD A;  4B3T Q;  4JI6 Q;  3I4M G;  4B3R Q;  3ZJY C;  4IPD A;  2PNH A;  4LFC L;  1TXY A;  1WOC A;  1X56 A;  1VQ8 A;  4JYA L;  4A3F G;  3RZO H;  4AQY L;  1IZ6 A;  4AYB G;  4IJL A;  5C4X H;  4OWX B;  1XNR L;  3RN2 A;  2LSS A;  1XTD A;  1MKH A;  1YJN A;  1XMO L;  2WFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...