4BBSG

Structure of an initially transcribing rna polymerase ii-tfiib complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbsG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4bbsG01
4DR3Q 1K8AC 3UDIA 3TRZA 4JI4Q 4OXPA 5IYBG 4LF7L 5BR8L 2Q2IA 4LF8Q 4LFCQ 5M3MG 2KHJA 2I5MX 2NZHA 3CCRA 3T1HL 3B6YA 4YCUA 2GVAA 1PVOA 3A5ZB 4L5TA 2WP8J 2JA7G 1K0RA 1U5KA 3JC66 4KI0A 1X3EA 1VQDA 1VQAA 3MXNB 4TVAB 4DKAC 4QL5A 2ZM6L 4GKKL 4WJ3M 3KFUA 4DV4L 2NVYH 2R6GA 5BR8Q 4JBMA 1I3QH 2E2HH 1VQFA 4GKJL 3D0FA 4IPCA 3GTPH 4JI1L 2F3IA 4OX9L 4JV5Q 4QJFA 1CKNA 4BXXH 4YCWA 2UUCQ 3CQZH 2K52A 1Q7YC 3F2DA 1K83H 4LF4Q 1SLJA 4AYBG 3S24A 2UXCL 4MNOA 2JK8A 1I6HH 4XTCS 2DGYA 1VQ9A 1XNQQ 3I55A 1QVGA 1MIUA 1EIFA 1X3FA 4YY3Q 2BA0A 1IBKQ 1N33Q 4QIWE 5C3EG 3CCUA 3PSIA 2D0OA 1GKHA 4DAMA 1PH5A 1VQCA 1K8GA 1A62A 3PUZA 1QVCA 4DV3L 4YWMA 5C4JH 3OW2A 2JA5H 5M3FH 3GTOH 1CKMA 1WCMG 4GOPC 4X65L 2N78A 4LF9L 2V1CC 1Y14B 3A0JA 5IP9G 4A3IG 1X6OA 1KL9A 2YV5A 3ZJYC 5C3EH 1N34Q 2Y0SE 2VZAA 1VQ5A 1VQPA 4KHPQ 1SR3A 4RMFA 1P8LA 2RCNA 4IPDA 3G71A 1VQ4A 1IBMQ 4LUVA 2VUMG 4Y52H 4NXMQ 1A0IA 1WCMH 4JI8L 4X64L 4HIDA 2AWOA 3CXCA 3HKZG 3M9BA 3OTOQ 2NN6G 5C44G 3L2PA 3AFPA 4BBRH 4A3JG 4BBSH 1VQLA 1EQQA 3CP0A 4KHZA 1PH9A 4KHPL 3ER0A 3GDEA 3KLWA 4A3IH 1EIYB 3PCOB 1HNZL 3I4MG 4WJ4A 4DR5L 3UE0A 3NENA 1IBLQ 2I0QA 4LF5L 1HZBA 2HIXA 3GO5A 4DV5L 2VUMH 4GLXA 4BY1H 1Y1VH 1EYGA 4NB3A 1N36L 3PF4A 1Q46A 3S14H 4A75A 1Q82C 1U0LA 2R7FA 1MJCA 5C44H 4P72A 3TREA 4BBRG 3KJOA 4DR1Q 4A3JH 1KC8C 4B3SL 4BBSG 1TWAH 1HR0Q 2L15A 4TQUS 5ELOA 4UPAA 4IFDI 2K50A 3I4MH 3ULPA 4A3FG 1VQMA 3RR5A 1NY4A 1YJWA 4A3BG 1KAWA 5LMNW 1CSQA 1N8RC 1Y1WH 1YVCA 1GVPA 1Q81C 3AQQA 1DGSA 2UU9Q 4GLAC 1T9HA 2LSSA 5IP7G 4IO9A 1VS0A 2QA4A 1HR0W 4LF4L 3UDFA 1JMCA 1PH6A 2JA8H 1PYSB 4DPGA 2PMZE 1OXUA 2QEXA 3HKZE 1IYJB 3GTLH 1W2BA 1KXLA 3GD7A 1CKOA 4NXML 2AWNA 3J81i 4IJLA 1VQBA 4FDBA 5FLMH 3D31A 4YCVA 3HOUH 4L5QA 4LFAL 1CKNB 3AFQA 5IYCH 4GKKQ 2H5XA 1N34L 1IBLL 1XNQL 3CC7A 4QQBX 1XMOQ 1SN8A 1N9WA 2RHSB 1VCIA 2B3GA 2MFIA 3A74A 4JOIA 2JA8G 1NTGA 1YBYA 4LFCL 4DAYB 4LF6L 1V9PA 4JC0A 1WYDA 1JB7A 2NN6I 3S1QH 4IOAA 3M4PA 1PH8A 1N36Q 1X55A 1TWHH 3T1YQ 4J15A 4B3TL 3H15A 4DR3L 2UU9L 3HOUG 4GOPB 1PA6A 1I94Q 4DR6Q 4IFDJ 2AMCB 2YTVA 4L5SA 1E1TA 1CUKA 3BZCA 5JJIA 4PZ6A 1JJGA 1QUQA 3E9HA 1H95A 4YHHQ 4PMWA 4C3IH 5JJLA 1N32Q 2IHFA 2VY3A 4H02A 4GNXB 1S72A 1XPUA 2OWOA 2ZTEA 3W5OA 2E2IH 3I4NG 2BH8A 5AJ3L 3UDXA 1JT8A 2KCTA 3ERSX 4LF7Q 4POGA 5C0XG 2VQFQ 1M1KC 5IWAL 2Q2HA 3CCEA 2I5LX 3STBD 3CCMA 4GNXC 1HZCA 1C9OA 5JEAJ 4DR4L 1UE6A 4JI2Q 1GO3E 4AIMA 3G4SA 3JAMc 2Y0SG 1JJCB 3W1BA 3CCJA 1UE7A 4X66L 4A3MG 2IT1A 2ASBA 2A19A 3HOYH 1NBWA 1OXTA 2WAQE 2HQLA 4A3GH 4JI1Q 4OX9Q 2OCEA 4JI8Q 3K7UC 4JV5L 1B7YB 1OXXK 1PYBA 3CCVA 2R7ZH 2LXKA 4B3RQ 1PH7A 2Z6KA 2IX0A 1WOCA 4IJHA 4KLKA 4DV4Q 1LTLA 2KBNA 2JEAI 3S16H 3M85A 3S17H 4A3CH 1HNWL 3ICEA 4GKJQ 1E1OA 3H0GG 3S15H 1HH2P 3FHWA 3PO2H 2UXCQ 5E7NA 1VQEA 1GM5A 2HHHL 1AE3A 1LM0A 3PUWA 2NVXH 4A3MH 2R7DA 4GOPA 4HJ7A 4DR2L 1PFSA 3J7ZC 5C0XJ 2BH2A 4C3JH 2OTJA 1TWCH 5JJKA 1XPRA 4HJ8A 3CW2C 2EIFA 1YEZA 2K5VA 5GAEC 1FGUA 1QUQB 1Z47A 1AE2A 4DV7Q 1SMXA 1NMFA 4JCVE 4GNXA 2K14A 2UUAL 3H0GH 1OTCA 1G6PA 3PUXA 5LMUL 1X56A 2ZTDA 4IPHA 1SE8A 1TWGH 3PIOA 4DR7L 2MNAA 4AQYL 1XPOA 4AH6A 4A4IA 1SROA 5HY6A 4BA1I 3PO3H 2RHQB 3HKSA 2HHHQ 2F4VQ 4YWLA 4DV6L 2UUBQ 4NXNL 2UXBQ 2K5HA 2B29A 1P16A 3NBHB 1HNXQ 4LFBQ 2R92G 1E7ZA 1YHBA 1VQ7A 2E5LQ 2PNHA 1CSPA 3DM3A 4R4OA 2IY5B 1QVFA 5AJ3Q 1GD7A 1VQJA 2GN5A 1YI2A 1EOVA 1BBUA 3RNUA 4YY3L 3RZDH 1XTDA 2PI2E 3PO3G 3UE1A 3EN2A 3HOZH 4JI6Q 1UWVA 1C0AA 3T1HQ 3CPWA 3W1GA 4A3DH 4GN4B 4JI3L 3KYHC 4PZ8A 2FXQA 1G291 1KD1C 4DR7Q 2ZJRA 4X62L 2WFWA 3IRBA 4HJAA 3T1YL 4LFBL 4X62Q 4C3HH 3TS0A 2UUAQ 1LUZA 2VQFL 1FVIA 2Z6KC 2JA5G 1BKBA 5M3FG 3CMEA 1TWFH 3KDFB 1J6QA 2JJQA 3F8TA 4DV7L 2Q2TA 4K0KQ 1K3RA 3CAMA 4DUYL 2D62A 4DV1L 4B3MQ 1XMQL 1FJGL 2JA6G 4R1JA 4BA2I 4YWKA 3CMAA 4DUYQ 4DV1Q 4DR2Q 2HT1A 4A3DG 3H3VI 1BVSA 2N3SA 2N49A 3J81j 4OO1I 4DV2Q 4IOCA 1VQGA 1LYLA 3HOVH 5IYDG 1JJ2A 1KRTA 1EWIA 3KF8B 4A3KH 1R9TH 4BY7G 1I94L 2ID0A 4JBKA 2JQOA 4DUZQ 4P75A 2JA9A 1NE3A 3TEHB 4HIOA 3I56A 1PH3A 1L2FA 1Q8KA 3AYHB 2JA6H 3PIPA 2YTXA 1VQ8A 1XMOL 3U4ZA 4JBWA 2AKWB 4Y7NH 4HJ5A 4R4TA 2I5HA 2QGQA 4DR4Q 5M5WH 1L1OB 1I50H 5C4XG 3CD6A 5IWAQ 3BJUA 4P73A 4JI0L 4PZ7A 1YJNA 1RL2A 4BY1G 5H1SE 4JI7L 1HZAA 3HOWH 3M4OH 2CWAA 4DR6L 4B3TQ 4DR1L 1UEBA 5HGQA 3K8AA 4DV6Q 2VQEQ 2PI2A 1V43A 1K73C 1MKHA 2N8NA 4R4QA 1J5EQ 4DV5Q 3FKIH 2IHEA 1S3OA 4GN5A 3BU2A 3RLNA 1HJPA 5GQOA 1L0WA 1YITA 2EXDA 3AEVA 3L7ZC 3M4QA 1SRUA 2D0PA 5GROA 1Y1WG 5GAHC 1KRSA 3HOWG 3EBEA 4LWCA 3E9IA 1TXYA 1YNXA 3KJPA 4BXXG 5K36G 4HJ9A 4XIGS 3CCLA 2ATWA 3CC2A 4LW1A 3FKIG 1C7YA 4LF6Q 2ZJQA 2NZOA 3S2HH 1VQIA 5M5YH 3E0EA 5FLMG 2HIVA 3K0XA 2YU9H 1PV4A 1VQNA 3GTMH 4IPGA 4X6AH 2ZTCA 4MTNA 5IYCG 4LUZA 4DV0Q 1Q1EA 4IFDG 1VQHA 5M5XH 4QGUA 1Z9FA 2KHIA 4JYAL 2RF4A 1A63A 4ME3A 2A1AA 3TS2A 2BA1A 3J80c 4UY8C 2MO0A 3RZOH 5C0XI 4YHHL 3U4VA 3BZKA 5IP9H 1B70B 3J80i 4LFAQ 5IE8A 2KENA 3WWVA 2VS1A 4DR5Q 3FP9A 3ULLA 3NELA 1VQOA 3KDFA 1RIPA 4GS3A 1AH9A 4B3SQ 3PV0A 3KF6B 3S2DH 2E8GA 2R93H 1HZ9A 3S1MH 4X65Q 1ASZA 2OTLA 3I4OA 3PUYA 2PQAB 1M90C 1HR0L 5IT9c 2Q2UA 2IX1A 1VQKA 4GN3B 4DUZL 4LNQA 3NEMA 1FL0A 3I4NH 2NVQH 1KHIA 2AHOB 4LF5Q 2OQKA 3MEFA 3LGJA 3H3VH 4GLVB 3KOJA 2DUDA 3CPFA 1YIJA 4UP9A 1YHQA 4MZ9A 3CF5A 2R93G 3M7NA 1Y1VG 4B3ML 1PH4A 3CC4A 4LUOA 5ELNA 3RN5A 1Q12A 3L0OA 4JYAQ 2MQHA 1WI5A 2B63G 1IBML 2YYZA 1L1OA 3VDYA 3F1ZA 1X3GA 2E2JH 1WFQA 1ASYA 4OO1G 4X64Q 3U50C 3EIVA 1D8LA 2CCZA 1B8AA 2CKZB 4A3FH 3J7A5 4JG2A 4DV0L 4A3BH 4C2MH 3RN2A 4LF9Q 1VQ6A 3PO2G 3HFZB 1IBKL 4ALPA 1N33L 4JI6L 4L5RC 3SGIA 4A3EH 5IP7H 1KIXA 3DLLA 3K80C 3OTOL 3GTGH 2B63H 2GVBA 2WAQG 1NJIC 1PH2A 1UE5A 1YJ9A 2JE6I 2C35B 2XTIA 3TQYA 4AYBE 1IZ6A 4DK3C 3S1NH 1HNXL 2PQAA 3CCSA 2UXBL 1QZHA 1HNZQ 2XGTA 5GAGC 4HIKA 4A3EG 2KCMA 4JI5L 3JAMi 3S1RH 3G6EA 3K81C 1YHAA 2ALYB 3RLFA 3F2BA 4A93G 1D7QA 2VW9A 3OYYA 4JBJA 1BBWA 5LMUQ 1G51A 1PH1A 1E3PA 1NMGA 5J3BA 1L1OC 1I5FA 1S40A 2OQ0A 4NPSA 4UP7A 4DK6C 2R92H 1Q86C 2JEBI 4O2DA 2UUCL 1QZGA 3U58A 3Q8DA 2K75A 2EQSA 2F52A 2ZM6Q 1XJVA 3F2CA 2UXDL 4NXNQ 1WJJA 5FJ8H 1EUJA 1A8VA 4DV2L 3M3YH 4A93H 1OXSC 1J5EL 5EAYA 2MO1A 3STBC 3HOZG 4K0KL 1X65A 4PG3A 2ES2A 1O7IA 1EFWA 4R4CA 1KQSA 3HOXH 2VNUD 2A8VA 1HNWQ 3RLOA 2NVTH 3I7FA 4O0AA 3PGZA 4OWXB 4DV3Q 4LF8L 1X54A 3G48A 4HIMA 4DNIA 4B3RL 2CWPA 4POFA 4UP8A 3KF6A 4JI3Q 4JI4L 1V1QA 4A3LG 2CQOA 5IY0A 1X9NA 5FJ8G 3PUVA 4EX5A 1FJGQ 2F4VL 1E22A 5GADC 1K9MC 1XNRL 3HOXG 2VQEL 3HOYG 2WB1E 1OXVA 1Q1BA 1PHJA 4JI2L 4A3GG 3J81c 4OONA 5JEAG 5DLQE 5FLXc 2WB1G 4A76A 3GTKH 5LMNL 3HOVG 2YTYA 2UXDQ 5IYDH 4A3KG 4BY7H 2R7ZG 5LMNQ 1E24A 4A3LH 1UE1A 1YZ6A 3ULJA 2LXJA 4R4IA 1EQRA 1SFOH 4JI7Q 4A3CG 4RG1A 2ZJPA 4OWWB 4JI0Q 3CCQA 2VL6A 4P71A 1JE5A 5IYBH 1XNRQ 3GTQH 4EQ5A 4APVA 1N32L 4P74A 2K4KA 5M3MH 3PF5A 4QY7A 4AQYQ 4X66Q 1XMQQ 2UUBL 4JOIC 1W3SA 3UDGA 4JI5Q 3I2ZA 2Z0SA 3K7AH 2K5NA 1IXRA 2CFMA 2JA7H 4OWTB 1MJEA 5C4XH 2E5LL 3GTJH 1IL2A 3A5UA
chains in the Genus database with same CATH superfamily
3KLSX 2C28A 4RCNA 2F1MA 3N6RA 3J81E 3DEOA 1AN7A 4NW2A 5BR8L 1PRTB 1T5XD 2QDLA 3OIPA 4LF8Q 4Q8FA 4FM9A 1Z2OX 2I5MX 2NZHA 1C4QA 3CCRA 3B6YA 4V0BA 2XNAC 1H9RA 5KT5A 5EKIA 1N32H 2ZM6L 1UNSA 1X3EA 3MXNB 1BNZA 5JPNC 1MZBA 4LJZC 4MA0A 2JA7A 1SNPA 2E76C 3D4DA 3KFUA 4CKBA 4DV4L 4LH6A 2EJMA 3V96A 4MA5A 1VQFA 1X3PA 4IRKA 3MVVA 4ZLTF 4K8IA 4QJFA 4BXXH 5M5YB 5DGBA 1S5FD 2UUCQ 2R7ZA 4JI0H 2EOTA 2HUGA 3F2DA 1BF4A 2M9VA 4AYBG 1QWYA 2E2HB 3JRXA 2ZJTA 2UXCL 3FDSA 5C4ZA 4ME6A 1VQ9A 4H44C 1N33Q 2KCCA 2IWHA 2BDOA 1SNMA 3G8CA 2DIKA 3CCUA 5GONF 2HCIA 1ML0D 2IX3A 4DAMA 4J9LA 1SNCA 1D5ZC 3OW2A 1ZYRC 5M3FH 1WCMG 5C3EB 3EPGA 4X65L 5KYLA 2N78A 4KJOA 3QJYA 2RKSA 3SK6A 5IGEA 1Y14B 1A15A 1VBGA 1J9OA 4HCEA 2MGSA 3D4RA 3S14B 2YV5A 5C3EH 3BQ1A 3RD4A 4NKLA 4ECYA 3P75A 1VQ4A 4CJ0B 3WDNA 1IBMQ 4LUVA 3MXNA 5KFYA 1LTAD 4O1NA 1S03G 2AUKA 3M9BA 2NN6G 1JICA 3ORQA 4AYBA 4A3GB 4KHZA 1PH9A 1O75A 4EQNA 3ER0A 4KHPL 3Q8SB 2F4VH 3H09A 3I4MG 1RODA 2DZDA 1K1SA 4BBRB 4YY3H 2VUMH 1EYGA 3M7GA 4NB3A 1WTVA 5KFVA 2MUYA 4A75A 2UVWA 4A3FB 4ECTA 1U0LA 3KJOA 3NSWA 1EUCB 4BBRG 5KFJA 1PRTF 2EJGC 2B8FA 1TWAH 5FO7B 5ELCA 2L15A 3RAXA 1EY5A 2VA3A 4A3FG 1BJTA 3MXUA 1NY4A 2WIIB 5LMNW 5E4WC 2MCTA 1Y1WH 1QNKA 1YVCA 1TS4A 2PZUA 4OL7A 4IO9A 3UDFA 4CBVA 1JMCA 4DPGA 3G6JB 1G8ZD 4J9MA 1GSOA 2EY1A 4NXML 2VPQA 3K57A 3UQ8A 2E5LH 2JA8B 2WYOA 3GV6A 4L5QA 3VR3A 5IYCH 4GKKQ 2CH4W 3GTPB 1KDCA 1I4RA 2PNRC 1EY9A 4IFDH 1PTOD 4RFBA 3VA5A 2JA8G 2O03A 1YBYA 4NMZA 4DAYB 4HSVA 4R8UB 1V9PA 2JXMB 5LHY1 4IN3A 3H15A 4DR3L 4GOPB 4R9WA 1TY0A 4L5SA 1E1TA 2R8KA 1CUKA 3BZCA 1GUSA 2R61A 2RDFA 4UCTA 3FVQA 3MXGA 3E9HA 1KDBA 2K33A 2R82A 1LT4D 5JJLA 2VY3A 4GNXB 1XXGA 1F2LA 4J8QA 2ZTEA 3I72A 2E2IH 4EBCA 2BH8A 3UDXA 4EGQA 1GUNA 2HCCA 1JDEA 2VQFQ 4JVZA 5F2DA 3VPBA 5KFQA 1DM0B 5CBAE 3CCEA 3BDCA 1KAAA 3MWEA 5JEAJ 1UE6A 2ZXRA 1GO3E 4AIMA 1DOLA 2W6PA 2XGQA 4WJWA 3EPIA 1LT6D 4I7AA 2NU8B 3CCJA 1UE7A 3HKZB 4X66L 2UUBH 2ASBA 1YNND 1EZ1A 4EFEA 3HOYH 1AW7A 1NBWA 4APMA 2HQLA 5IGBA 4HAEA 2OCEA 3K7UC 3BYYB 1M4VA 1OXXK 4ODGA 5IWAH 3LX0A 4EQOA 2LXKA 2Z6KA 4IJHA 4KLKA 1LTLA 3M85A 3PQIA 5KFKA 5IGCA 2LFNA 3EJIA 1LTRD 1FD7D 2UXCQ 5E7NA 4O3OA 2NVXH 4GOPA 3P1HA 4HJ7A 4H0LC 1PFSA 2NZ1D 3U9TA 5COYA 4FBUA 3Q8RB 2WV6D 4OHJA 3CW2C 2W70A 2KVMA 5GAEC 4DR3H 2NVXB 1J8IA 4A3BB 4QWBA 4JCVE 5FPRA 2EYOA 2UUAL 3H0GH 3PUXA 3HOWB 3U9OA 4IPHA 4O4HF 1W93A 1B53A 3S16B 1PZJD 4AQYL 1XPOA 1V4YA 4DF7A 3H4BA 5BN5A 4FXKC 2RHQB 1KJ8A 1RYSA 4PDBA 3K5IA 2HDMA 3VYSA 1STHA 2UUBQ 1IOWA 3MR2A 2YU9B 5G3LF 2NTTA 3TP6A 1TWCB 2IY5B 3H40A 1YI2A 4IUNA 1KDAA 3RNUA 4L63B 3BZDB 1B3QA 3PO3G 5A35A 1R9TA 4CDFC 1TWAA 3HOZH 2R7MA 3Q8QB 1C0AA 1KJQA 1G291 4X3SA 4X62L 4DR6H 4F87A 2JA6B 1QILA 2VQFL 5JH7F 4CJ1B 1J6QA 2JSOA 3F8TA 5KFTA 1SAPA 3H4DA 4DV1L 3SK4A 1FJGL 2JA6G 5I2XA 1PFBA 1BQQT 3D8GA 3NPPA 1ZHQA 3H6MA 2UVUA 1VQGA 4K5XA 3HOVH 2PZTA 3BQ0A 4LF7H 1I4XA 1EWIA 1EUDB 4H7BA 4ETSA 4QUCA 2JQOA 3C1FA 4EG0A 3N42B 4CKEA 3I56A 1FNVA 4RGMA 2NUCA 2RA4A 1VQ8A 4JBWA 4C5AA 1K1QA 1MSGA 5C4XG 4LF9H 2IJ0A 2W9CB 3IAYA 4P73A 5I9PA 4C2MB 1TAEA 1YJNA 5H1SE 3M4OH 1HZAA 3D6CA 5E3FA 1F2MA 4GKJH 3J80L 1EY7A 1PYWD 3GTGB 4EEYA 3OIQA 2VQEQ 1K73C 1BCPF 1MKHA 4J9SA 4DV5Q 3JAMW 2JA6A 1I4QA 2PW7A 1SE4A 2EY6A 1L0WA 4J9NA 3L7ZC 1ILQA 4UCVA 1JC7A 5GAHC 1S5ED 3E5SA 1O80A 3BG5A 3EBEA 1KC7A 1HNZH 1PRTC 5M5WB 4KKTA 4BXXG 4ABNA 4RNMA 1K8MA 4XQNA 4XIGS 3OOCA 4ECXA 4UHVA 3V6KA 2ATWA 3LWBA 2LS01 3GIDA 2ATLA 1H9SA 2B39A 1C7YA 1LTTD 1JWSD 4ME5A 1UUPA 3RB0A 4IUTA 5C5MA 2ZTCA 2ZM6H 2XCAA 2TSSA 4HMJA 3KHHA 4ECWA 1ONLA 1VQHA 2G9HD 3X3NA 3MA2B 4GC6A 4V190 2FPGB 3CU7A 4GC7A 1KJIA 1YNNC 4MV6A 4O4IF 4FNFA 4JUZA 1A63A 1SE2A 2W9CA 3A8JE 4KMUC 3TINA 4DV3H 4WRDA 4YHHL 1CS0A 5E1FA 1I4GA 4LFAQ 2BE5C 4KN7C 2VS1A 3GTGA 3IKJA 1RIPA 2F0SA 2SNMA 1GSAA 4X65Q 2A6HC 1HR0L 2IX1A 1Q90A 3JSLA 3I12A 1DD2A 5CA1F 1FL0A 5EPLA 5KG3A 2W9BA 3LNNA 1B3AA 5KT3A 1KHIA 3K7AB 4LF5Q 2R93B 1I7LA 2OQKA 3MEFA 1AEXA 5FO8B 4IR1A 1C48A 4JI2H 1CZWA 1U4LA 2DUDA 3CF5A 2R93G 4B3ML 1PH4A 1W6KA 4ZYSA 1Q12A 2HD3A 2KJXA 4MHEA 1KNAA 3L0OA 1A2TA 1XYIA 2WKCA 4JYAQ 2L11A 3EA6A 4R8NA 2YYZA 1L1OA 4BWGB 3VDYA 4UCRA 1ASYA 1GXDC 3D4WA 4O3SA 1D8LA 4HNUA 2CKZB 4A3FH 4JG2A 1LLRD 4X3KA 2RDGA 2B2TA 3HFZB 1N33L 4ALPA 4JI6L 4L5RC 1FKAH 2KSWA 2UU9H 1D1KA 3OTOL 4RB3C 3GTJA 1KBLA 2WAQG 1PH2A 4RB2C 2B8GA 4L6TB 1SNOA 3TQYA 4LF5H 3S1NH 2F0NA 3VR2A 2WAQB 1Y69U 1QZHA 3BG3A 1HNZQ 4HIKA 2KECA 4A3EG 2KCMA 3JAMi 2X6LA 5DLFA 1VF7A 1BBWA 3NWTA 1G51A 5LMUQ 3OMGA 1E3PA 1PH1A 5J2TF 3MFGA 4JYAH 2XRQD 4FS2A 3OMCA 5J1ZA 4Y8VB 2ICEC 5I2YA 2C2DA 1CT1D 3BVZA 3J7YW 1S0OA 3Q8DA 1Y8PB 3MR6A 4KHVA 1XJVA 2UXDL 5FLXE 2KEEA 3OWFA 5FPOA 4X66H 1CZGA 5FJ8H 1V1PB 3DWPA 1J5EH 5EAYA 2MO1A 4EFBA 4PG3A 2ES2A 4UDUC 3HOXH 2WDTA 2A8VA 5IGDA 4DR7H 3RLOA 2NVTH 1FYCA 5EKKA 1ZEQX 3T56B 4DV3Q 5CAEB 1GOZA 4DNIA 4B3RL 3FMAA 4LMYA 2CWPA 3VR4A 3KF6A 5KGUA 4O3PA 1WCMA 2J9GA 2CQOA 5IY0A 1RDPD 3NHHA 4DR5H 1G2TA 3PUVA 3G6VA 4EX5A 4J6HA 2F4VL 5K2MA 1O78A 4C5CA 1CHPD 4TV8F 3HOYG 3CRLC 2WB1E 5DNFA 1F9SA 3J81c 1VKZA 5KT2A 3GTKH 2QF7A 4K5VA 3TSSA 5LMNQ 1UE1A 1YZ6A 2LXJA 4R4IA 4JI7Q 5C4HA 3HOYB 1JWMD 1EQTA 4K6DA 4P71A 4GKKH 5KG4A 4DL3A 2X0SA 2Z9HA 3PF5A 4RNNA 4AQYQ 1I6VC 3PVXA 3GIJA 3RMHA 1XMOH 4B08A 5F9NA 2CW0C 4S3SA 5ELBA 4YJ2F 3QZ8A 3PZPA 1N33H 1IXRA 1RTOA 4JPBW 4OWTB 4MTDA 2XCPA 3SK8A 5M3MB 3J80E 1IL2A 3T5LA 5KFXA 3I91A 1EU4A 3UDIA 1AN8A 2AGOA 4Y7NB 2A69D 4OXPA 4JI4Q 2Z1CA 3OSNA 3CQZA 5A2QE 4LF7L 1EEFD 5KG1A 1SBBB 1STGA 4QIWB 5M3MG 4HN7A 3V6HA 2DLNA 5CR3A 1Z2NX 1I7NA 2JEGA 1FJGH 2O5JC 3A5ZB 1CE8A 1K3BC 2JA7G 3IFDA 4DKAC 4TVAB 1VQAA 3E3XA 4TSSA 2HDLA 2EYFA 1I3QH 4AYBB 2E2HH 5L1LA 1CKNA 3V6JA 4JV1A 5KFUA 3DEPA 1K83H 2WE6A 1BUVT 4KKSA 3S24A 4IUUA 4X3TA 4XT1B 1I6HH 3OSPA 4XTCS 2B2UC 1DJRD 2DGYA 3PIO3 1XNQQ 1C3OA 1MIUA 3I3CA 4YY3Q 2BA0A 1PTOH 4ZUJA 5C3EG 4A2AA 1HTLD 4G57A 1PH5A 2R86A 1VQCA 1WTQA 1A62A 3PUZA 4DV3L 1S5DD 3VYUA 1CKMA 2QILA 4ZQIA 1S5CD 1SNDA 5IT9L 5G3LD 3A8KE 3WOFA 5I9OA 5FD6A 2CZGA 2PQEA 3NTIA 1VMCA 4LF9L 1U9RA 3A0JA 1UNNC 2E75C 1X6OA 3KAJA 1XX8A 1N34Q 4ED1A 5M9OA 1VQ5A 4DV7H 3G6XA 5D1PA 1SR3A 4RMFA 2IBKA 2ZDHA 3K3PA 1P8LA 2RCNA 1CA5A 3WNZA 3HP3A 4CC6A 2VUMG 3CRKC 1Q8IA 1A0IA 3GTQB 5CB4F 2AWOA 1QCBD 1V1OA 2K04A 1MD2D 1EYCA 4BBRH 3HOXB 1B04A 1VQLA 1S0MA 5KFFA 2F0KA 3CP0A 4F8MA 4N8FA 5J2UF 3GDEA 3PR4A 1HNZL 3LMLA 4ED2A 3Q1KA 3DUZA 2F3WA 3TIIA 3UE0A 1EL0A 3Q6SA 2HIXA 4FYDA 4DV5L 2XD4A 4NP5A 3OHXC 3O13A 3PF4A 5JVLA 1Q46A 3K59A 4XX0B 3T13A 2R7FA 1MJCA 4FS1A 1KC8C 3GTLA 4B3SL 2J7ZA 3T1YH 1T5EA 1EZ6A 2XVSA 4YAKB 3ULPA 3DHQA 2V58A 4JI3H 1YJWA 1KAWA 4BBSB 1N8RC 3N6XA 3C2PA 3ND9A 1AZPA 1JB3A 3AQQA 2FP4B 1DGSA 2UU9Q 1S4ZA 1T9HA 2UUAH 4LF4L 3GIPA 1VS0A 1IBMH 1IKMA 1PH6A 2JA8H 1PYSB 2PMZE 1OXUA 2QEXA 3S9WA 3HKZE 2W6QA 1DXMA 1JQYD 3RGZA 4ED8A 1KXLA 1STEA 3GD7A 2NWGA 3J81i 3V2TA 3K5NA 1TY2A 3AFQA 5EJWA 4ULLA 2H5XA 1N34L 4OELB 2K5DA 4C56C 4YR3A 3RZOB 1XMQH 5C4JB 4QQBX 3PMFA 1XMOQ 5DG8A 1VCIA 1RD9D 4LFCL 4LF6L 4IOAA 1WYDA 1JB7A 4MN3A 1N36Q 1X55A 2XN9C 1TWHH 2ASDA 1QNUA 3HOUG 1AP0A 1E4FT 3K3VA 2XWBB 4RCOA 5C1PA 2E2IB 2BQRA 1PDQA 5JJIA 2EZVA 4F7XA 4YHHQ 3HOUB 2YL2A 3LWUA 3PW0A 5LL6b 1GLVA 4LMQD 2C00A 1NR4A 1QE6A 4J9RA 5CV9A 1SYCA 3S15B 5KFDA 3MWMA 1B1ZA 5BR8H 2Q2HA 2GLTA 4GNXC 1HZCA 4JV5H 3S1QB 4DR4L 5EQ0A 1IW7D 4KY5A 1NSNS 5KRUA 2K01A 3JAMc 4F4WA 2I8CA 1RJPA 4F4YA 4DLKA 5FLXW 3MWDA 3K5OA 2J6SA 3AU7A 5IOCA 4DR4H 2WAQE 4A3GH 4ECVA 4JI8Q 4WD3A 2Y0SB 3RAQA 3CCVA 3E6ZX 4LF6H 2R7ZH 5L37A 3VA7A 2W7OA 2IX0A 4DV4Q 1R9TB 3S17H 4A3CH 4G4KA 4YB8B 1HNWL 3H0GG 5K5PA 1TR5A 4M9UA 5KFSA 1VQEA 1LM0A 2VQEH 1E2WA 2R7DA 4I7ZC 2CW8A 3NWSA 1K8OA 4DR2L 3J7ZC 1JOKA 5C0XJ 2N55A 2QEJC 3I90A 4FVMA 3H0GB 1LTGD 2OTJA 1XPRA 4HJ8A 1TU2B 1RYRA 1EIGA 1YEZA 2K5VA 1HA5A 4UCSA 3V4SA 4DV7Q 5DAUA 1NMFA 1KLUD 2K14A 4HMIA 1G6PA 1OTCA 1HUNA 4RAZA 2ZTDA 4TV9F 1SE8A 2K1BA 4Q0FA 2EJFC 1UC9A 4AH6A 4A4IA 3R93A 1CA6A 1E4GT 4BA1I 3PO3H 2NU6B 4DV2H 1M7JA 2F4VQ 1XWEA 2UXBQ 4NXNL 2XIGA 4DV0H 3NBHB 5KFCA 2FPIB 3GLKA 3D6WA 1YHBA 1PLFA 2PNHA 2X6GA 2E5LQ 3AMUA 4R4OA 3RB4A 2F03A 1B50A 2GN5A 3K6OA 3RZDH 4RB0A 1B33N 5KFHA 1C8CA 4TQRA 2J6TA 5A2QW 2HQEA 4ZKCB 4J9OA 5FKAC 4C2MA 3I8ZA 2A68C 4HR7B 3EN2A 3UE1A 4FF3A 1UWVA 3J81W 3T1HQ 2NVYA 5DQIA 1JX4A 1SNQA 2FMCA 3TMEA 4B9XA 1KD1C 2EYPA 4DR7Q 3C0FB 1PZKD 2EY5A 3BYTB 4EVOA 2W6ZA 4X62Q 4C3HH 1LUZA 1FVIA 3SHLA 1ILPA 2PBZA 2XRSD 3IL8A 4ED6A 1BKBA 3TQ1A 4K0KQ 2JJQA 3QIAA 2Q2TA 4O3QA 1CTMA 4ZHQF 2W8KA 1S9FA 2R7NA 1XMQL 4BA2I 4YWKA 3CMAA 4DV1Q 3K5MA 4OO1I 2N49A 2JA5B 2C2RA 3K5HA 2P5ZX 5LXTF 4XYMB 2I46A 5J39A 1KRTA 1ZETA 2AQ4A 1IKLA 1I94L 1WTXA 4A3DB 4JBKA 2B2YA 2F0UA 5BN4A 4R8IA 4O3NA 4U7CA 3TEHB 2JA9A 1M0TA 4RZRA 3NBHA 1RK6A 5C4XB 1L2FA 4BY7B 3KAKA 3T51B 1KEEA 3PIPA 2YTXA 2RDJA 5HGTA 2AKWB 4R4TA 2I5HA 2PPBC 4DR4Q 1HA6A 1E2ZA 1NAPA 4MV3A 1L1OB 1E4EA 5EZYF 4DL5A 3ITPA 3BJUA 2FKLA 3LP8A 4TRDA 4DR6L 3PO2B 5KFGA 2CWAA 1TQOA 1DONA 5JVDF 4B3TQ 2ZDGA 4P2CB 2SOBA 1UEBA 3R2TA 3K8AA 2UVRA 2A6ED 2F0WA 4LH7A 4IZ8A 4K5WA 3OWEB 1HR0H 5KFBA 4IURA 3MC0B 1J5EQ 2YYAA 3PN1A 2BE5D 3BU2A 1HJPA 5GQOA 2EXDA 2A6EC 4OGQC 1SRUA 2D0PA 2EY2A 3HOWG 1RJTA 2VUGA 4QUFA 5L1JA 3KJPA 1WTPA 1GSHA 4HCSA 4ILWA 3DXJC 1EWCA 5KFZA 5KFPA 4PMBA 2ZJQA 4QB4A 2YU9H 4F4ZA 4X6AH 3PIP3 4DV0Q 4LUZA 1GYFA 3FKIB 1Q1EA 3VPDA 1EY0A 2EYLA 4O2AF 2YS6A 3RTXA 1SSOA 4FU0A 4DL6A 1PTOB 2Q8IB 4RB1A 4ME3A 5EWEA 5FK9C 1ZYRD 3J80c 5KG2A 2W6NA 3GP7A 5E4XA 2B2TC 3FMCA 4ECUA 5KT7A 2KENA 3SXHA 3WWVA 4DR5Q 2FE3A 1JE4A 1IHZA 1VQOA 3KDFA 3RB6A 4GS3A 4B3SQ 3GTMB 2R93H 1H9KA 5M3FB 2FLPA 4ID6A 1HZ9A 4C3IG 3S1MH 3J7AF 1GUGA 3I4OA 3I70A 1U4PA 3PUYA 3GQCA 4G7HC 4LNQA 2NVQH 4HNVA 5M5XB 5ELDA 4K14A 1EQVA 3JAML 3H3VH 1SYFA 4GLVB 3KOJA 4CDEC 4J9QA 2R6FA 4LAAA 2F0MA 3M7NA 5KFEA 5LL6X 3BA9A 5CMDA 3CC4A 3GIIA 3RN5A 4HYKA 3T1HH 2W6MA 2W6OA 3DMUA 2MQHA 1WI5A 1X3GA 1Y1VB 1WFQA 4OO1G 1FGBD 4X64Q 4QMGA 4RGOS 2CCZA 3BAAA 1OO9B 1O7LA 5FO9B 4LF9Q 4G3IA 2V4QA 1HFNA 1KTKA 1IBKL 2G9DA 4FP5D 3SGIA 3GV8B 4A3EH 2K5QA 3CQZB 1KIXA 3M9NB 2B63H 2CQAA 3R23A 4I65A 1NJIC 4QF4A 4WFN3 3EVQA 3I73A 4AYBE 4LK1C 1IZ6A 3NP8A 4YIJA 4DK3C 1JOQA 2PQAA 3QFFA 2F0FA 3SK5A 1WTRA 2UXBL 1L2ZA 1B4OA 2KCNA 4YBZB 1EWHA 4JI5L 3RLFA 2ALYB 5D3IB 3GIKA 3BQ2A 3OYYA 5DG7A 1HNXH 3C1EA 1NMGA 2HGSA 2E2HA 1I5FA 2OQ0A 4NPSA 2QK4A 4N8X1 1Q86C 4O2DA 1KLGD 1QZGA 4QCLA 4J0MA 4EYHB 2K75A 2EQSA 4H13C 3F2CA 4NXNQ 1Y1VA 3TN2A 5KFAA 4A93H 1X65A 1O7IA 1RKNA 2OF1A 1EFWA 2VNUD 1HNWQ 3I7FA 4OWXB 3N44B 3RUPA 4A3IB 1TKWB 1X54A 4MV7A 1CQVA 4HIMA 4RUAA 3F8NA 3P20A 1GUTA 2R8GA 4JI3Q 1V1QA 5KIXA 1JIHA 1X9NA 2R8IA 2YZNA 2DJFC 2OXPA 4R7RA 2HVQA 4O2BF 1K9MC 4YP3A 3H91A 3GTQA 3DM1A 3MEHA 5C44B 2W57A 3S17B 4A3GG 4C1NI 4IWXA 1ICFB 1VAJA 3L4KA 4IRCA 5DLQE 4RKLA 2WB1G 4I50F 2QCPX 5LMNL 4OX9H 5IYDH 1ENCA 4BY7H 2R7ZG 4Q8EA 5JJZA 2N88A 2ZXPA 4A3CG 4DV4H 4RG1A 4OWWB 2L9HA 2VL6A 3OW7A 4M7EA 4FBTA 1JE5A 2FPPB 3GTQH 4CJ2C 4APVA 1EIHA 4CDCC 5KNDA 1BXRA 5M3MH 1KJ9A 1CQIB 2UUBL 1W3SA 2L0CA 3I2ZA 1JDBB 3K7AH 1IBKH 5JEAH 2JA7H 2CFMA 5C1OA 4LFAH 1MJEA 2FK3A 1SE3A 4TQSA 3GILA 3W3AA 2Z4HA 3DWQA 1F2ZA 3TRZA 3VPCA 4WBNF 3QO2A 5FD5A 2Q8RE 3MFYA 4K2LA 3H20A 4LFCQ 5C5JA 2KHJA 2J4XA 1S68A 5HV6A 2GVAA 1PVOA 2K6AA 2WP8J 1U5KA 2BQUA 3MJFA 4WJ3M 2NVYH 2CVRA 5BR8Q 2FJZA 5LA6F 4LFBH 4EBDA 4DN4M 4DAVA 4DA2A 3GTPH 3OSOA 4OX9L 4JV5Q 3ORRA 4TKOB 4A3EB 4JI7H 1PTOC 1Q7YC 4LF4Q 1SLJA 2A69C 2FMAA 3U9SA 3KHLA 4KD3A 4XYLB 3I55A 1QVGA 4B9WA 1EIFA 4KY6A 5ELFA 2Q8TA 1IBLH 1DYQA 3BJYA 2D0OA 1K8GA 3QOJA 1E0BA 2F4IA 4C3HG 5J22A 1QVCA 1SYBA 4DR1H 3GTOH 3S2DB 4IUQA 2FLNA 4LSAA 3RGXA 4GOPC 5NUCA 1JLLB 2DJGC 3SR1A 3MFHA 2V4RA 2M00A 4KV6A 1KL9A 3QOLA 3HZXA 2L5TA 2VZAA 2Y0SE 1PZID 4X65H 4KD4A 4NXMQ 3SE7A 5LOVF 4EBEA 3F2UA 4X64L 2O2LD 4HIDA 3CXCA 3T4AC 3QZ7A 3OTOQ 1B2TA 3L2PA 3AFPA 4ECQA 1MGSA 1EQQA 3KHRA 4ECSA 4A3IH 1ENFA 3KLWA 1EIYB 4YR2A 2C2EA 2F0PA 4WJ4A 1LT3D 3NENA 5JUMA 4A3JB 4LF5L 1HZBA 3GO5A 2RSNA 2B2UA 1NNXA 1Y1VH 1LACA 2YZGA 4DAPA 1ESFA 3JRWA 3S14H 2UVVA 2K5WA 1Q82C 5C44H 4P72A 3TREA 4A3JH 4BBSG 4X64H 3EYYA 4MV4A 4DV6H 4TQUS 2W9AA 5ELOA 3C3LA 4IFDI 1SDFA 2K50A 3GIQA 1VQMA 1CI3M 2QW7A 3RR5A 3K5LA 2FK1A 4A3BG 1LO5D 4HSPA 1IW7C 1CSQA 1GVPA 1DCZA 1Q81C 3SE0A 2PO4A 2LSSA 2M2LA 5IP7G 2A5HA 1F2YA 2MPMA 1TWGA 1IYJB 2ENBA 1W2BA 2CW0D 1BR9A 4FDBA 4DR2H 1W6JA 3D31A 4YCVA 3R3OA 3HOUH 5KG7A 1CFMA 1WD1A 4LFAL 2I80A 2RDIA 4U68A 4EEQA 1XNQL 2Y0SA 1STNA 3CC7A 3S2HB 1I4HA 4MAMA 3A7AB 1D2BA 4ED0A 1SN8A 2RHSB 2QYZA 1F9QA 1TWFB 1MHWC 2DY7A 1NTGA 3TQTA 2CH4A 4RGNA 1CK1A 3M4PA 4K2KA 1PH8A 3T1YQ 3DF7A 2NVYB 2LKVA 3G7LA 4IFDJ 4X62H 4XXEA 4UAIA 5I4DA 1GUOA 4Q44A 2WINB 1B6SA 4C3IH 2ICIA 4RAUC 1S72A 1XPUA 1B44D 3QWNA 1HUMA 3W5OA 1SYGA 5AJ3L 1HCZA 2KCTA 1X3QA 1JWUD 2F0OA 3EFXD 3ERSX 4LF7Q 4QW8A 2I5LX 2B2WC 3S1MB 1S5BD 3CCMA 2QKIC 1C9OA 2KHSA 2PYKA 1RK5A 3A55A 2Y0SG 5D14A 1SJHD 4DK0A 5D65A 1SMYD 3GV3A 1OXTA 4JI1Q 4XQJA 5C0XH 1B7YB 1PYBA 1ZXTA 4DNTB 4B3RQ 3I4MB 1PH7A 3S16H 3T5HA 1WOCA 4A3MB 5KFIA 4HR7A 2JEAI 3M4IA 1B9MA 2L55A 1HH2P 1H9JA 1PRTD 4RAYA 2HHHL 3PUWA 3R5HA 4A3MH 2Z4IA 4YHHH 3JAME 2BH2A 4C3JH 1PXUA 1BDOA 1TWCH 3SDZA 5JJKA 4N9PA 5I47A 4IHJF 1FGUA 1QUQB 1Z47A 5IT9E 1AE2A 1SMXA 3LWEA 2I07B 2SDFA 5LMUL 1X56A 1QJOA 2JA5A 1A3UA 4DR7L 3KBGA 2RGVA 2KUMA 1SROA 5HY6A 5KG5A 5FOBB 5CORA 2HHHQ 2AGPA 1DOKA 1T3NA 1JCKB 2G5DA 3VR6A 3IG0A 2B2YC 1H9SB 1P16A 3NK9A 3A8IE 4OIJA 3BVMA 3T5KA 1CSPA 3DM3A 2F0LA 1QVFA 2FFKB 5KG6A 1GD7A 2F0TA 1EOVA 1BBUA 4YY3L 4R8UA 4LF4H 3HEJA 3D3RA 3GIMA 3SEBA 2PI2E 2F0GA 1EYZA 1RF2D 4ZCKA 3MR3A 2W71A 1STYA 5FLXL 4JI6Q 1SCUB 3CPWA 3KK7A 2FXQA 5TSSA 2XWJB 2NBFA 2WFWA 3IRBA 4RWSC 5DGAA 2EE1A 4QWEA 2IPKD 4IR9A 2PCFB 2Z6KC 2JA5G 3CMEA 4DV7L 3KDFB 2VQDA 1EY6A 4HQ6A 1K3RA 3CAMA 4B3MQ 2JN4A 1M6VA 4A3DG 1ULZA 2PN1A 1SMYC 4DUYQ 4DR2Q 1SYDA 1ZKOA 2XC9A 3H3VI 2N3SA 1Z6HA 4XQQA 2AQ2B 3J81j 1N34H 4DV2Q 2W9BB 4IOCA 3BDOA 1LYLA 3KALA 5IYDG 3RBEA 4BY7G 2OT2A 1PK8A 4BS9A 2ID0A 1A6XA 4RU9A 3T5JA 1JR0D 4Q43A 2WTFA 4F4XA 4HIOA 1NE3A 2EYHA 5BPHA 3NGDA 1Q8KA 3AYHB 3FKIA 5KT6A 4AQYH 4Y7NH 4TUYF 4KN4C 5DM73 5M5WH 1SEBD 1I50H 2E2DC 4RH6A 3E0JA 4HTHA 5KEEA 2FK2A 5HBRB 4PZ7A 4JI7L 4BY1G 3HOWH 3HG9A 1F77A 4DR1L 5C6AA 4QW9A 5CV4A 4DV6Q 3S1RB 1NCVA 2PI2A 1V43A 3X3MA 2N8NA 4BY1B 2JP1A 3GTMA 2A74C 1K28A 2WKDA 3OHBA 3RUZA 5JAVA 1YITA 3AEVA 4Z9CB 4DU9A 5GROA 4IQZA 4MTKA 1KRSA 3E9IA 3HS0C 3OPOA 1TXYA 3HRZC 3KBXA 5K36G 3FPPA 3RF2A 3CCLA 3CC2A 2AQ3B 2ASLA 3FKIG 3ND8A 5BMVF 3ZYYX 4LF6Q 2YU9A 1EU3A 2NZOA 2L12A 1VQIA 2PMZB 5ELEA 4CHTB 3E0EA 5FLMG 3S2HH 3K0XA 3PW4A 1VQNA 4IPGA 5EDWA 3G6YA 1GHJA 1UEAB 5DEHA 3SVMA 5M5XH 4QGUA 5EPKA 2O5IC 4FXGC 2KHIA 3URYA 3PO3B 2RF4A 3TS2A 1V1PA 3JSNA 4G7OC 2BA1A 1I6HB 1A9XA 2MO0A 5C0XI 4JI5H 2DY8A 3M4YA 4RA8A 1T36A 3U4VA 3BZKA 3WOEA 4C3IB 1B70B 2K32A 1V51A 4J1MA 2F0VA 4HEDA 2SNSA 3ULLA 1DV1A 4ZI7F 4E6IA 1AH9A 3J80W 1SJED 1LV9A 3KF6B 4YJ3F 2DNEA 4DXFA 2ALZA 3PW5A 1M90C 2PQAB 2Q2UA 4LFCH 5IT9c 3I4NH 4GN3B 1ENAA 3NEMA 2XCLA 3TP5A 3UFXB 3OTOH 4FO2A 2D5DA 2AHOB 3GQBA 2SEBD 1TWHA 3LGJA 1E2VA 1D5MC 2K28A 3HOVB 4OO1H 3TIGA 3QG1A 3R2IA 1TT2A 3FEWX 3CPFA 4C1NK 4UP9A 1YIJA 4E4TA 3RB3A 2FLLA 1XNRH 2BCOA 1Y1VG 3MXPA 4NLGA 3VYRA 4LUOA 2UUCH 1AUXA 3MFIA 2B63G 1IBML 3HB9A 3RJ0A 1B6RA 3RFCA 4B3RH 3F1ZA 2E2JH 1EYAA 4UCOA 3U50C 1DOMA 3EIVA 3J7A5 5DQGA 4DV0L 2K05A 3T16A 4A3BH 4C2MH 3RN2A 2B63B 1BXTA 1VQ6A 3PO2G 3A54A 3HXLA 2EPBA 5LYJF 5IP7H 3DLLA 1CQJB 3K80C 5D1OA 4B3TH 3GTGH 5L1IA 4DUYH 1WVLA 1EYDA 3RBDA 2GVBA 2A6HD 3N43B 4IWYA 1YJ9A 2I87A 3Q22A 4I7HA 4IRDA 2JE6I 3GTOA 5KFNA 4Q45A 2XTIA 1ET9A 1PFNA 2C5CA 4DL2A 4A93B 1I3QB 5HURA 2YRWA 2WACA 4C5BA 3RV3A 1PX2A 2XGTA 4KHPH 1TWHB 5IT9W 3S1RH 3G6EA 5T14A 3K81C 2D2CC 1TVXA 3F2BA 4A93G 2RGRA 4NXMH 1YNJD 1D7QA 4JBJA 5J3BA 1L1OC 4KJNA 1ET6A 2R92H 1X32A 2JEBI 1CQFA 4XYQA 4EGJA 5IGGA 2VPSA 2ZM6Q 1B9NA 2XGPA 1WJJA 1WH2A 2V5AA 1J5EL 3R5FA 5C5LA 3RV4A 3FRPB 3J7AK 2KQ3A 4IAJA 2JYOA 4O0AA 3G48A 5KFLA 3TZUA 1PMRA 4DL7A 5LP6F 4UP8A 4JI4L 1SYXB 3EROA 3WO0A 5CGKA 4QWDA 4O42A 1A2UA 5GADC 1G6ZA 1XNRL 2VQEL 1OXVA 1PHJA 1HXYD 5JOBA 4OONA 5JEAG 4ZUIA 4JI1H 4JI8H 4IUVA 4A3KG 4A3LH 3ULJA 4ZKBB 1SFOH 4DUZH 1K83A 2R7LA 5KYIA 2F0EA 2VA2A 3CCQA 1F9RA 1HQRD 1TS2A 1CM9A 1EFID 5DM63 4FXDA 1C30A 2JEJA 4P74A 4DXGA 1TA8A 4QY7A 4X66Q 1XMQQ 1S0NA 3UDGA 4JI5Q 3BA8A 1XNQH 1A3TA 2KEDA 2Z0SA 1RTNA 2F0HA 3M9OB 3GTLB 5BN3A 4WORA 3AB9A 3VR5A 2QDBA 2E5LL 2R85A 3OHAA 3A5UA 4DR3Q 1K8AC 1KNEA 4JW0A 1I94H 4RNOA 5IYBG 2Q2IA 1M0WA 1V8QA 3GTJB 3T1HL 1U4MA 4YCUA 3M4OB 4L5TA 1GGOA 1K0RA 3JC66 5KNBA 4KI0A 5EOYA 1VQDA 3A56A 4GKKL 1TWGB 4QL5A 2R6GA 1FNWA 4JBMA 2WAQA 1R4QB 2PZWA 2RVLA 4GKJL 2LY7A 3D0FA 4IPCA 4PWQA 4JI1L 2BDNA 2F3IA 4YCWA 1DZ1A 1VBHA 3CQZH 2K52A 1DV2A 4FF1A 4KY7A 1MI2A 1N36H 4EGVA 3M9MB 4MNOA 2JK8A 3NTHA 4RKBA 4IUPA 3Q2OA 4RUCA 1X3FA 1IBKQ 4QIWE 4DK1A 3PSIA 1GKHA 1AZQA 4FF4A 5KFRA 1O7ZA 4YWMA 5CC4A 4PV1C 5C4JH 2JA5H 1SFOA 3TP7A 2NU9B 2GA4B 4XDXA 2V1CC 1VF5C 4EQPA 3VMMA 5IP9G 4A3IG 3GTKB 2DNCA 2RCFA 1WCMB 4JK1C 3ZJYC 3RIZA 2AU0A 4CGYB 1JORA 1VQPA 3FPUB 3R8BA 3Q0AA 4KHPQ 2V9WA 4Y52H 4IPDA 3G71A 4GZYC 1VMPA 2Z6BA 2RBMA 1HRJA 1WCMH 4JI8L 2FB9A 1WTWA 3HKZG 1XTCD 5C44G 4A3JG 4BBSH 5IODA 2WB1B 2PW5A 2B2VA 3PCOB 5D3DA 4KK7A 1TWFA 2R7ZB 2UXBH 2GPSA 1JKJB 2O4XA 4DR5L 2KOLA 1IBLQ 2I0QA 1I6UA 1QB5D 4GLXA 4BY1H 4FF2A 2E2JB 1N36L 2DPJA 1RHPA 2L4NA 2Z8LA 3N52A 1LTSD 1I50B 1HQMC 2R7KA 4DR1Q 4EYIB 1K0SA 4M1UB 1HR0Q 4UPAA 3OUUA 3I4MH 2CQYA 3N41B 2NU7B 3N40P 1HHVA 4QIWA 4GLAC 2VXWA 4N9TA 2QA4A 1HR0W 3GTKA 5KFMA 4ZRZA 2OEOA 4CC5A 2BQ3A 2JA7B 4J9PA 2VUMA 3GTLH 2F0QA 2RSOA 1CKOA 4B3MH 2AWNA 4IJLA 1VQBA 5FLMH 4RHRA 4O3RA 1YNJC 1CKNB 4M8AA 5C3XA 1RJQA 4I55F 5DLGA 4RZQA 1IBLL 2F0IA 4IALA 1OWTA 2M05A 2WB1A 3A74A 1N9WA 2B3GA 2MFIA 4JOIA 3KXYT 5LMUH 2IA6A 4JC0A 2NN6I 3S1QH 1S97A 3IN5A 4DL4A 3C46A 4J15A 4B3TL 3BDLA 2UU9L 1PA6A 1I94Q 4DR6Q 2AMCB 1U4RA 2YTVA 4XZ3B 4C3HB 1ESRA 4HNTA 4PZ6A 1ICWA 1JJGA 1QUQA 2JEIA 1H95A 4PMWA 1N32Q 2IHFA 4H02A 4MIUA 2OWOA 5L1KA 1HNWH 3I4NG 2TMPA 1JT8A 2RQXA 1SEIA 4POGA 5C0XG 1M1KC 1O7YA 5IWAL 1PFMA 3STBD 3CKIB 3KLRA 1IOVA 1HTPA 2EYJA 2F0DA 4JI2Q 3I4NB 1HFGA 3G4SA 2VUMB 5CYUA 3P7JA 1JJCB 2BR0A 4DNRB 3W1BA 2K03A 4A3MG 2IT1A 3PW2A 1EOTA 2A19A 1FNUA 5A2QL 2UXDH 4ECZA 4F88A 2H1EA 4OX9Q 4C3JG 1WTOA 4JV5L 2YZMA 5KFWA 4YQWA 3GTPA 3E5NA 3PR5B 2KBNA 4ZQ3A 4JV2A 3ICEA 4GKJQ 1E1OA 4C3JB 3S15H 2IW3A 3FHWA 3PO2H 4U6PA 3V05A 1W96A 1GM5A 4L8JA 5DG9A 4Q5VA 1AE3A 4YR0A 3TBIB 5T1GA 2EIFA 3L9AX 2J0TD 1AUVA 4IZOA 4GNXA 1UAPA 4LF8H 5KNCA 1TWGH 3PIOA 2CW7A 2R8JA 3PW7A 2XIWA 2MNAA 3HGBA 1JOOA 3KF8A 3NUCA 2R92B 1IYUA 3HKSA 2SCUB 3MWYW 5H80A 4YWLA 4DV6L 3KUPA 4DFAA 1STBA 2B29A 2K5HA 1LTBD 1HNXQ 2KA7A 4LFBQ 2R92G 1E7ZA 1VQ7A 4OEMB 1BCPC 5EBCA 5BPFA 5AJ3Q 1R4PB 1VQJA 3QR8A 4XT3B 4DAYA 1XTDA 4RGTA 3TZDA 2UXCH 1WR2A 2V59A 4LSXA 3NBIA 3ETJA 3W1GA 1Z7TA 4A3DH 4GN4B 2ASJA 1N56A 4JI3L 3KYHC 4MV1A 4MV8A 3MR5A 4PZ8A 5F9LA 1Q3LA 1KABA 1TS3A 2E2IA 2ZJRA 4BWSC 2R8HA 4HJAA 1ZHSA 2F0JA 3T1YL 4LFBL 5EKLA 1BO0A 3TS0A 2UUAQ 4B3SH 3IFTA 3V4ZA 1LABA 5M3FG 3R5XA 1F9PA 1TWFH 1TIID 2ZT9C 5KG0A 2NVXA 4DV5H 4NDXA 4DUYL 2D62A 4R1JA 3ETHA 4CKCA 2HT1A 3W2DA 1FR3A 1BVSA 2BOSA 1STAA 4OIKA 4X3UA 4A3KH 3KF8B 3MAQA 1R9TH 1JJ2A 4MTEA 2R92A 1RCVD 1QOHA 5D8DA 2PMZA 4XYOA 4DUZQ 4P75A 3HKZA 3MHBA 5KFOA 1GHKA 2L1BA 1PH3A 2PVPA 5EBDA 2VR1A 2NN6H 4PMCA 2JA6H 3TDQA 1XMOL 3U4ZA 2XSCA 1II3A 4HJ5A 2QGQA 1BGWA 3Q24A 2R3ZA 4ED7A 1XDNA 1JXLA 2FINB 3CD6A 5IWAQ 3BS1A 4A2BA 4JI0L 1WSCA 3S1NB 1RL2A 1TWAB 4I4TF 3NQIA 2IP4A 2J6UA 2VOBA 2B63A 2MJ8A 5HGQA 2OH2A 3H0GA 1SYEA 5L9XA 5K36H 1Y1WB 2RDHA 2E74C 4R4QA 3NE5B 5D1OB 3FKIH 2IHEA 1S3OA 4GN5A 5CV5A 3RLNA 4ZK9B 3NTKA 3M4QA 1NUCA 1Y1WG 2MHVA 1EHIA 4LWCA 2X69A 5C3WA 1AFPA 1YNXA 4QWAA 4HJ9A 5DQHA 3FDTA 2FJ2A 2ZXOA 2YS7A 4LW1A 3T53B 1Y8OB 1D6EC 5CV8A 1LTID 1I4PA 5M5YH 2OLSA 5T1IA 2HIVA 4KKUA 3GTMH 1QG7A 5CV7A 3I4LA 1PV4A 2NVTB 1TWCA 1EY4A 3KHGA 3QB3A 4MTNA 1H9MA 5IYCG 5KKNB 1ZQ7A 1BOSA 1S10A 4IFDG 5CBEE 2ZDQA 2NVQB 5JQWA 1CHQD 1Z9FA 2AQ1B 2NYZD 2B2VC 4JYAL 1DIKA 2EVBA 2A1AA 4UY8C 2HVSA 2R84A 2W8LA 2V4DA 3RZOH 4PQXA 5IP9H 3J80i 5IE8A 5JPMC 1GUWA 3Q8PB 3N8DA 5JVH3 3FP9A 3NELA 4U673 1Y1WA 2CHBD 2NB0A 4YAJB 3BVGA 1TS5A 3ERQA 3PV0A 3GTOB 2E8GA 3S2DH 2A68D 4JI4H 3HBLA 3UI2A 1ASZA 2OTLA 1I3QA 2AUJD 4DGZA 1VQKA 4DUZL 2VQFH 4PNYA 1L0XB 4ZAIA 3J81L 2DN8A 1KJJA 1A3VA 2GPWA 5LMNH 1G91A 4KTAA 3CHBD 2IL8A 3CVZA 1GJXA 2HVRA 2W7PA 1YHQA 2IMWP 1M8AA 4MZ9A 2C22A 1BCPD 5ISRA 5ELNA 1MSHA 3H3VC 1RJRA 1EZ8A 3L4JA 1E4EB 2DPIA 1MBYA 2P0AA 2DWCA 4UCUA 2EXZA 5C8YF 1B8AA 3TP8A 3GV5B 1Y8NB 2YRXA 4NXNH 5IGFA 4K0KH 1D5XC 4QWCA 2B2WA 1IL8A 1Z2PX 1IYVA 4DV1H 2MP1A 1NR2A 5I6WA 3K58A 1UE5A 2C35B 1HPCA 3MTSA 1HNXL 3Q23A 3CCSA 4ZOLF 1L0YB 4K8JA 1EEID 5GAGC 1T94A 5AFWA 3A7LA 4MV9A 3RZDB 1BBXC 2HHHH 1UC8A 4L1KA 1D1IA 1YHAA 1K83B 1SXTA 2VW9A 5I6YA 2C9OA 5JVG3 1S40A 4UFZA 4UP7A 4JV0A 4DK6C 2VB2X 2UUCL 3M3YB 1WTHA 2HJWA 3KLSA 4ED3A 3HOZB 5IIFA 3U58A 2F52A 3ONAB 1BCPB 2D9UA 2FHTA 2K7VA 1EUJA 1A8VA 4DV2L 3M3YH 4Q0YA 1OXSC 4JI6H 5EWFA 4K0KL 3STBC 3HOZG 5LL6S 5CV6A 4R4CA 1SFOB 1KQSA 5EPJA 3OUZA 1WD0A 3PGZA 4LF8L 4J9KA 3SI8A 2A73B 4ECRA 4POFA 4A3LG 2YW2A 2R87A 3NQTA 5IYZF 3VYTA 5FJ8G 1FJGQ 2F3VA 1EY8A 2EDGA 1E22A 4A3KB 2R93A 3DWAA 2FMMA 3HOXG 2LMCB 1Q1BA 4G7ZC 4JI2L 4F50A 3JZIA 2UXDQ 5FLXc 4A76A 3MZ5A 3HOVG 2YTYA 3K0YA 5KX5F 2NUAB 2JEFA 3NXWA 2VB3X 2H4OA 1E24A 1PTOF 3BABA 5KT4A 1EQRA 3KTMA 3J7AV 4K6LA 2EYMA 3H94A 2ZJPA 4JI0Q 3L3OC 5CA0F 1XNRQ 5IYBH 1G2SA 4EQ5A 1N32L 2K4KA 5EGTA 2AGQA 1BNCA 3GV7B 2NTSA 4JOIC 1LT5D 2YCHA 3WO1A 4CDDC 1N48A 1I50A 5EWGA 2K5NA 4RHSA 1VDZA 5C4XH 4O4LF 3GTJH 3EQLC
chains in the Genus database with same CATH topology
4DR3Q 1K8AC 3UDIA 3TRZA 4JI4Q 4OXPA 5IYBG 4LF7L 5BR8L 2Q2IA 4LF8Q 4LFCQ 5M3MG 2KHJA 2I5MX 2NZHA 3CCRA 3T1HL 3B6YA 4YCUA 2GVAA 1PVOA 3A5ZB 4L5TA 2WP8J 2JA7G 1K0RA 1U5KA 3JC66 4KI0A 1X3EA 1VQDA 1VQAA 3MXNB 4TVAB 4DKAC 4QL5A 2ZM6L 4GKKL 4WJ3M 3KFUA 4DV4L 2NVYH 2R6GA 5BR8Q 4JBMA 1I3QH 2E2HH 1VQFA 4GKJL 3D0FA 4IPCA 3GTPH 4JI1L 2F3IA 4OX9L 4JV5Q 4QJFA 1CKNA 4BXXH 4YCWA 2UUCQ 3CQZH 2K52A 1Q7YC 3F2DA 1K83H 4LF4Q 1SLJA 4AYBG 3S24A 2UXCL 4MNOA 2JK8A 1I6HH 4XTCS 2DGYA 1VQ9A 1XNQQ 3I55A 1QVGA 1MIUA 1EIFA 1X3FA 4YY3Q 2BA0A 1IBKQ 1N33Q 4QIWE 5C3EG 3CCUA 3PSIA 2D0OA 1GKHA 4DAMA 1PH5A 1VQCA 1K8GA 1A62A 3PUZA 1QVCA 4DV3L 4YWMA 5C4JH 3OW2A 2JA5H 5M3FH 3GTOH 1CKMA 1WCMG 4GOPC 4X65L 2N78A 4LF9L 2V1CC 1Y14B 3A0JA 5IP9G 4A3IG 1X6OA 1KL9A 2YV5A 3ZJYC 5C3EH 1N34Q 2Y0SE 2VZAA 1VQ5A 1VQPA 4KHPQ 1SR3A 4RMFA 1P8LA 2RCNA 4IPDA 3G71A 1VQ4A 1IBMQ 4LUVA 2VUMG 4Y52H 4NXMQ 1A0IA 1WCMH 4JI8L 4X64L 4HIDA 2AWOA 3CXCA 3HKZG 3M9BA 3OTOQ 2NN6G 5C44G 3L2PA 3AFPA 4BBRH 4A3JG 4BBSH 1VQLA 1EQQA 3CP0A 4KHZA 1PH9A 4KHPL 3ER0A 3GDEA 3KLWA 4A3IH 1EIYB 3PCOB 1HNZL 3I4MG 4WJ4A 4DR5L 3UE0A 3NENA 1IBLQ 2I0QA 4LF5L 1HZBA 2HIXA 3GO5A 4DV5L 2VUMH 4GLXA 4BY1H 1Y1VH 1EYGA 4NB3A 1N36L 3PF4A 1Q46A 3S14H 4A75A 1Q82C 1U0LA 2R7FA 1MJCA 5C44H 4P72A 3TREA 4BBRG 3KJOA 4DR1Q 4A3JH 1KC8C 4B3SL 4BBSG 1TWAH 1HR0Q 2L15A 4TQUS 5ELOA 4UPAA 4IFDI 2K50A 3I4MH 3ULPA 4A3FG 1VQMA 3RR5A 1NY4A 1YJWA 4A3BG 1KAWA 5LMNW 1CSQA 1N8RC 1Y1WH 1YVCA 1GVPA 1Q81C 3AQQA 1DGSA 2UU9Q 4GLAC 1T9HA 2LSSA 5IP7G 4IO9A 1VS0A 2QA4A 1HR0W 4LF4L 3UDFA 1JMCA 1PH6A 2JA8H 1PYSB 4DPGA 2PMZE 1OXUA 2QEXA 3HKZE 1IYJB 3GTLH 1W2BA 1KXLA 3GD7A 1CKOA 4NXML 2AWNA 3J81i 4IJLA 1VQBA 4FDBA 5FLMH 3D31A 4YCVA 3HOUH 4L5QA 4LFAL 1CKNB 3AFQA 5IYCH 4GKKQ 2H5XA 1N34L 1IBLL 1XNQL 3CC7A 4QQBX 1XMOQ 1SN8A 1N9WA 2RHSB 1VCIA 2B3GA 2MFIA 3A74A 4JOIA 2JA8G 1NTGA 1YBYA 4LFCL 4DAYB 4LF6L 1V9PA 4JC0A 1WYDA 1JB7A 2NN6I 3S1QH 4IOAA 3M4PA 1PH8A 1N36Q 1X55A 1TWHH 3T1YQ 4J15A 4B3TL 3H15A 4DR3L 2UU9L 3HOUG 4GOPB 1PA6A 1I94Q 4DR6Q 4IFDJ 2AMCB 2YTVA 4L5SA 1E1TA 1CUKA 3BZCA 5JJIA 4PZ6A 1JJGA 1QUQA 3E9HA 1H95A 4YHHQ 4PMWA 4C3IH 5JJLA 1N32Q 2IHFA 2VY3A 4H02A 4GNXB 1S72A 1XPUA 2OWOA 2ZTEA 3W5OA 2E2IH 3I4NG 2BH8A 5AJ3L 3UDXA 1JT8A 2KCTA 3ERSX 4LF7Q 4POGA 5C0XG 2VQFQ 1M1KC 5IWAL 2Q2HA 3CCEA 2I5LX 3STBD 3CCMA 4GNXC 1HZCA 1C9OA 5JEAJ 4DR4L 1UE6A 4JI2Q 1GO3E 4AIMA 3G4SA 3JAMc 2Y0SG 1JJCB 3W1BA 3CCJA 1UE7A 4X66L 4A3MG 2IT1A 2ASBA 2A19A 3HOYH 1NBWA 1OXTA 2WAQE 2HQLA 4A3GH 4JI1Q 4OX9Q 2OCEA 4JI8Q 3K7UC 4JV5L 1B7YB 1OXXK 1PYBA 3CCVA 2R7ZH 2LXKA 4B3RQ 1PH7A 2Z6KA 2IX0A 1WOCA 4IJHA 4KLKA 4DV4Q 1LTLA 2KBNA 2JEAI 3S16H 3M85A 3S17H 4A3CH 1HNWL 3ICEA 4GKJQ 1E1OA 3H0GG 3S15H 1HH2P 3FHWA 3PO2H 2UXCQ 5E7NA 1VQEA 1GM5A 2HHHL 1AE3A 1LM0A 3PUWA 2NVXH 4A3MH 2R7DA 4GOPA 4HJ7A 4DR2L 1PFSA 3J7ZC 5C0XJ 2BH2A 4C3JH 2OTJA 1TWCH 5JJKA 1XPRA 4HJ8A 3CW2C 2EIFA 1YEZA 2K5VA 5GAEC 1FGUA 1QUQB 1Z47A 1AE2A 4DV7Q 1SMXA 1NMFA 4JCVE 4GNXA 2K14A 2UUAL 3H0GH 1OTCA 1G6PA 3PUXA 5LMUL 1X56A 2ZTDA 4IPHA 1SE8A 1TWGH 3PIOA 4DR7L 2MNAA 4AQYL 1XPOA 4AH6A 4A4IA 1SROA 5HY6A 4BA1I 3PO3H 2RHQB 3HKSA 2HHHQ 2F4VQ 4YWLA 4DV6L 2UUBQ 4NXNL 2UXBQ 2K5HA 2B29A 1P16A 3NBHB 1HNXQ 4LFBQ 2R92G 1E7ZA 1YHBA 1VQ7A 2E5LQ 2PNHA 1CSPA 3DM3A 4R4OA 2IY5B 1QVFA 5AJ3Q 1GD7A 1VQJA 2GN5A 1YI2A 1EOVA 1BBUA 3RNUA 4YY3L 3RZDH 1XTDA 2PI2E 3PO3G 3UE1A 3EN2A 3HOZH 4JI6Q 1UWVA 1C0AA 3T1HQ 3CPWA 3W1GA 4A3DH 4GN4B 4JI3L 3KYHC 4PZ8A 2FXQA 1G291 1KD1C 4DR7Q 2ZJRA 4X62L 2WFWA 3IRBA 4HJAA 3T1YL 4LFBL 4X62Q 4C3HH 3TS0A 2UUAQ 1LUZA 2VQFL 1FVIA 2Z6KC 2JA5G 1BKBA 5M3FG 3CMEA 1TWFH 3KDFB 1J6QA 2JJQA 3F8TA 4DV7L 2Q2TA 4K0KQ 1K3RA 3CAMA 4DUYL 2D62A 4DV1L 4B3MQ 1XMQL 1FJGL 2JA6G 4R1JA 4BA2I 4YWKA 3CMAA 4DUYQ 4DV1Q 4DR2Q 2HT1A 4A3DG 3H3VI 1BVSA 2N3SA 2N49A 3J81j 4OO1I 4DV2Q 4IOCA 1VQGA 1LYLA 3HOVH 5IYDG 1JJ2A 1KRTA 1EWIA 3KF8B 4A3KH 1R9TH 4BY7G 1I94L 2ID0A 4JBKA 2JQOA 4DUZQ 4P75A 2JA9A 1NE3A 3TEHB 4HIOA 3I56A 1PH3A 1L2FA 1Q8KA 3AYHB 2JA6H 3PIPA 2YTXA 1VQ8A 1XMOL 3U4ZA 4JBWA 2AKWB 4Y7NH 4HJ5A 4R4TA 2I5HA 2QGQA 4DR4Q 5M5WH 1L1OB 1I50H 5C4XG 3CD6A 5IWAQ 3BJUA 4P73A 4JI0L 4PZ7A 1YJNA 1RL2A 4BY1G 5H1SE 4JI7L 1HZAA 3HOWH 3M4OH 2CWAA 4DR6L 4B3TQ 4DR1L 1UEBA 5HGQA 3K8AA 4DV6Q 2VQEQ 2PI2A 1V43A 1K73C 1MKHA 2N8NA 4R4QA 1J5EQ 4DV5Q 3FKIH 2IHEA 1S3OA 4GN5A 3BU2A 3RLNA 1HJPA 5GQOA 1L0WA 1YITA 2EXDA 3AEVA 3L7ZC 3M4QA 1SRUA 2D0PA 5GROA 1Y1WG 5GAHC 1KRSA 3HOWG 3EBEA 4LWCA 3E9IA 1TXYA 1YNXA 3KJPA 4BXXG 5K36G 4HJ9A 4XIGS 3CCLA 2ATWA 3CC2A 4LW1A 3FKIG 1C7YA 4LF6Q 2ZJQA 2NZOA 3S2HH 1VQIA 5M5YH 3E0EA 5FLMG 2HIVA 3K0XA 2YU9H 1PV4A 1VQNA 3GTMH 4IPGA 4X6AH 2ZTCA 4MTNA 5IYCG 4LUZA 4DV0Q 1Q1EA 4IFDG 1VQHA 5M5XH 4QGUA 1Z9FA 2KHIA 4JYAL 2RF4A 1A63A 4ME3A 2A1AA 3TS2A 2BA1A 3J80c 4UY8C 2MO0A 3RZOH 5C0XI 4YHHL 3U4VA 3BZKA 5IP9H 1B70B 3J80i 4LFAQ 5IE8A 2KENA 3WWVA 2VS1A 4DR5Q 3FP9A 3ULLA 3NELA 1VQOA 3KDFA 1RIPA 4GS3A 1AH9A 4B3SQ 3PV0A 3KF6B 3S2DH 2E8GA 2R93H 1HZ9A 3S1MH 4X65Q 1ASZA 2OTLA 3I4OA 3PUYA 2PQAB 1M90C 1HR0L 5IT9c 2Q2UA 2IX1A 1VQKA 4GN3B 4DUZL 4LNQA 3NEMA 1FL0A 3I4NH 2NVQH 1KHIA 2AHOB 4LF5Q 2OQKA 3MEFA 3LGJA 3H3VH 4GLVB 3KOJA 2DUDA 3CPFA 1YIJA 4UP9A 1YHQA 4MZ9A 3CF5A 2R93G 3M7NA 1Y1VG 4B3ML 1PH4A 3CC4A 4LUOA 5ELNA 3RN5A 1Q12A 3L0OA 4JYAQ 2MQHA 1WI5A 2B63G 1IBML 2YYZA 1L1OA 3VDYA 3F1ZA 1X3GA 2E2JH 1WFQA 1ASYA 4OO1G 4X64Q 3U50C 3EIVA 1D8LA 2CCZA 1B8AA 2CKZB 4A3FH 3J7A5 4JG2A 4DV0L 4A3BH 4C2MH 3RN2A 4LF9Q 1VQ6A 3PO2G 3HFZB 1IBKL 4ALPA 1N33L 4JI6L 4L5RC 3SGIA 4A3EH 5IP7H 1KIXA 3DLLA 3K80C 3OTOL 3GTGH 2B63H 2GVBA 2WAQG 1NJIC 1PH2A 1UE5A 1YJ9A 2JE6I 2C35B 2XTIA 3TQYA 4AYBE 1IZ6A 4DK3C 3S1NH 1HNXL 2PQAA 3CCSA 2UXBL 1QZHA 1HNZQ 2XGTA 5GAGC 4HIKA 4A3EG 2KCMA 4JI5L 3JAMi 3S1RH 3G6EA 3K81C 1YHAA 2ALYB 3RLFA 3F2BA 4A93G 1D7QA 2VW9A 3OYYA 4JBJA 1BBWA 5LMUQ 1G51A 1PH1A 1E3PA 1NMGA 5J3BA 1L1OC 1I5FA 1S40A 2OQ0A 4NPSA 4UP7A 4DK6C 2R92H 1Q86C 2JEBI 4O2DA 2UUCL 1QZGA 3U58A 3Q8DA 2K75A 2EQSA 2F52A 2ZM6Q 1XJVA 3F2CA 2UXDL 4NXNQ 1WJJA 5FJ8H 1EUJA 1A8VA 4DV2L 3M3YH 4A93H 1OXSC 1J5EL 5EAYA 2MO1A 3STBC 3HOZG 4K0KL 1X65A 4PG3A 2ES2A 1O7IA 1EFWA 4R4CA 1KQSA 3HOXH 2VNUD 2A8VA 1HNWQ 3RLOA 2NVTH 3I7FA 4O0AA 3PGZA 4OWXB 4DV3Q 4LF8L 1X54A 3G48A 4HIMA 4DNIA 4B3RL 2CWPA 4POFA 4UP8A 3KF6A 4JI3Q 4JI4L 1V1QA 4A3LG 2CQOA 5IY0A 1X9NA 5FJ8G 3PUVA 4EX5A 1FJGQ 2F4VL 1E22A 5GADC 1K9MC 1XNRL 3HOXG 2VQEL 3HOYG 2WB1E 1OXVA 1Q1BA 1PHJA 4JI2L 4A3GG 3J81c 4OONA 5JEAG 5DLQE 5FLXc 2WB1G 4A76A 3GTKH 5LMNL 3HOVG 2YTYA 2UXDQ 5IYDH 4A3KG 4BY7H 2R7ZG 5LMNQ 1E24A 4A3LH 1UE1A 1YZ6A 3ULJA 2LXJA 4R4IA 1EQRA 1SFOH 4JI7Q 4A3CG 4RG1A 2ZJPA 4OWWB 4JI0Q 3CCQA 2VL6A 4P71A 1JE5A 5IYBH 1XNRQ 3GTQH 4EQ5A 4APVA 1N32L 4P74A 2K4KA 5M3MH 3PF5A 4QY7A 4AQYQ 4X66Q 1XMQQ 2UUBL 4JOIC 1W3SA 3UDGA 4JI5Q 3I2ZA 2Z0SA 3K7AH 2K5NA 1IXRA 2CFMA 2JA7H 4OWTB 1MJEA 5C4XH 2E5LL 3GTJH 1IL2A 3A5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 Q;  1K8A C;  3UDI A;  3TRZ A;  4JI4 Q;  4OXP A;  5IYB G;  4LF7 L;  5BR8 L;  2Q2I A;  4LF8 Q;  4LFC Q;  5M3M G;  2KHJ A;  2I5M X;  2NZH A;  3CCR A;  3T1H L;  3B6Y A;  4YCU A;  2GVA A;  1PVO A;  3A5Z B;  4L5T A;  2WP8 J;  2JA7 G;  1K0R A;  1U5K A;  3JC6 6;  4KI0 A;  1X3E A;  1VQD A;  1VQA A;  3MXN B;  4TVA B;  4DKA C;  4QL5 A;  2ZM6 L;  4GKK L;  4WJ3 M;  3KFU A;  4DV4 L;  2NVY H;  2R6G A;  5BR8 Q;  4JBM A;  1I3Q H;  2E2H H;  1VQF A;  4GKJ L;  3D0F A;  4IPC A;  3GTP H;  4JI1 L;  2F3I A;  4OX9 L;  4JV5 Q;  4QJF A;  1CKN A;  4BXX H;  4YCW A;  2UUC Q;  3CQZ H;  2K52 A;  1Q7Y C;  3F2D A;  1K83 H;  4LF4 Q;  1SLJ A;  4AYB G;  3S24 A;  2UXC L;  4MNO A;  2JK8 A;  1I6H H;  4XTC S;  2DGY A;  1VQ9 A;  1XNQ Q;  3I55 A;  1QVG A;  1MIU A;  1EIF A;  1X3F A;  4YY3 Q;  2BA0 A;  1IBK Q;  1N33 Q;  4QIW E;  5C3E G;  3CCU A;  3PSI A;  2D0O A;  1GKH A;  4DAM A;  1PH5 A;  1VQC A;  1K8G A;  1A62 A;  3PUZ A;  1QVC A;  4DV3 L;  4YWM A;  5C4J H;  3OW2 A;  2JA5 H;  5M3F H;  3GTO H;  1CKM A;  1WCM G;  4GOP C;  4X65 L;  2N78 A;  4LF9 L;  2V1C C;  1Y14 B;  3A0J A;  5IP9 G;  4A3I G;  1X6O A;  1KL9 A;  2YV5 A;  3ZJY C;  5C3E H;  1N34 Q;  2Y0S E;  2VZA A;  1VQ5 A;  1VQP A;  4KHP Q;  1SR3 A;  4RMF A;  1P8L A;  2RCN A;  4IPD A;  3G71 A;  1VQ4 A;  1IBM Q;  4LUV A;  2VUM G;  4Y52 H;  4NXM Q;  1A0I A;  1WCM H;  4JI8 L;  4X64 L;  4HID A;  2AWO A;  3CXC A;  3HKZ G;  3M9B A;  3OTO Q;  2NN6 G;  5C44 G;  3L2P A;  3AFP A;  4BBR H;  4A3J G;  4BBS H;  1VQL A;  1EQQ A;  3CP0 A;  4KHZ A;  1PH9 A;  4KHP L;  3ER0 A;  3GDE A;  3KLW A;  4A3I H;  1EIY B;  3PCO B;  1HNZ L;  3I4M G;  4WJ4 A;  4DR5 L;  3UE0 A;  3NEN A;  1IBL Q;  2I0Q A;  4LF5 L;  1HZB A;  2HIX A;  3GO5 A;  4DV5 L;  2VUM H;  4GLX A;  4BY1 H;  1Y1V H;  1EYG A;  4NB3 A;  1N36 L;  3PF4 A;  1Q46 A;  3S14 H;  4A75 A;  1Q82 C;  1U0L A;  2R7F A;  1MJC A;  5C44 H;  4P72 A;  3TRE A;  4BBR G;  3KJO A;  4DR1 Q;  4A3J H;  1KC8 C;  4B3S L;  4BBS G;  1TWA H;  1HR0 Q;  2L15 A;  4TQU S;  5ELO A;  4UPA A;  4IFD I;  2K50 A;  3I4M H;  3ULP A;  4A3F G;  1VQM A;  3RR5 A;  1NY4 A;  1YJW A;  4A3B G;  1KAW A;  5LMN W;  1CSQ A;  1N8R C;  1Y1W H;  1YVC A;  1GVP A;  1Q81 C;  3AQQ A;  1DGS A;  2UU9 Q;  4GLA C;  1T9H A;  2LSS A;  5IP7 G;  4IO9 A;  1VS0 A;  2QA4 A;  1HR0 W;  4LF4 L;  3UDF A;  1JMC A;  1PH6 A;  2JA8 H;  1PYS B;  4DPG A;  2PMZ E;  1OXU A;  2QEX A;  3HKZ E;  1IYJ B;  3GTL H;  1W2B A;  1KXL A;  3GD7 A;  1CKO A;  4NXM L;  2AWN A;  3J81 i;  4IJL A;  1VQB A;  4FDB A;  5FLM H;  3D31 A;  4YCV A;  3HOU H;  4L5Q A;  4LFA L;  1CKN B;  3AFQ A;  5IYC H;  4GKK Q;  2H5X A;  1N34 L;  1IBL L;  1XNQ L;  3CC7 A;  4QQB X;  1XMO Q;  1SN8 A;  1N9W A;  2RHS B;  1VCI A;  2B3G A;  2MFI A;  3A74 A;  4JOI A;  2JA8 G;  1NTG A;  1YBY A;  4LFC L;  4DAY B;  4LF6 L;  1V9P A;  4JC0 A;  1WYD A;  1JB7 A;  2NN6 I;  3S1Q H;  4IOA A;  3M4P A;  1PH8 A;  1N36 Q;  1X55 A;  1TWH H;  3T1Y Q;  4J15 A;  4B3T L;  3H15 A;  4DR3 L;  2UU9 L;  3HOU G;  4GOP B;  1PA6 A;  1I94 Q;  4DR6 Q;  4IFD J;  2AMC B;  2YTV A;  4L5S A;  1E1T A;  1CUK A;  3BZC A;  5JJI A;  4PZ6 A;  1JJG A;  1QUQ A;  3E9H A;  1H95 A;  4YHH Q;  4PMW A;  4C3I H;  5JJL A;  1N32 Q;  2IHF A;  2VY3 A;  4H02 A;  4GNX B;  1S72 A;  1XPU A;  2OWO A;  2ZTE A;  3W5O A;  2E2I H;  3I4N G;  2BH8 A;  5AJ3 L;  3UDX A;  1JT8 A;  2KCT A;  3ERS X;  4LF7 Q;  4POG A;  5C0X G;  2VQF Q;  1M1K C;  5IWA L;  2Q2H A;  3CCE A;  2I5L X;  3STB D;  3CCM A;  4GNX C;  1HZC A;  1C9O A;  5JEA J;  4DR4 L;  1UE6 A;  4JI2 Q;  1GO3 E;  4AIM A;  3G4S A;  3JAM c;  2Y0S G;  1JJC B;  3W1B A;  3CCJ A;  1UE7 A;  4X66 L;  4A3M G;  2IT1 A;  2ASB A;  2A19 A;  3HOY H;  1NBW A;  1OXT A;  2WAQ E;  2HQL A;  4A3G H;  4JI1 Q;  4OX9 Q;  2OCE A;  4JI8 Q;  3K7U C;  4JV5 L;  1B7Y B;  1OXX K;  1PYB A;  3CCV A;  2R7Z H;  2LXK A;  4B3R Q;  1PH7 A;  2Z6K A;  2IX0 A;  1WOC A;  4IJH A;  4KLK A;  4DV4 Q;  1LTL A;  2KBN A;  2JEA I;  3S16 H;  3M85 A;  3S17 H;  4A3C H;  1HNW L;  3ICE A;  4GKJ Q;  1E1O A;  3H0G G;  3S15 H;  1HH2 P;  3FHW A;  3PO2 H;  2UXC Q;  5E7N A;  1VQE A;  1GM5 A;  2HHH L;  1AE3 A;  1LM0 A;  3PUW A;  2NVX H;  4A3M H;  2R7D A;  4GOP A;  4HJ7 A;  4DR2 L;  1PFS A;  3J7Z C;  5C0X J;  2BH2 A;  4C3J H;  2OTJ A;  1TWC H;  5JJK A;  1XPR A;  4HJ8 A;  3CW2 C;  2EIF A;  1YEZ A;  2K5V A;  5GAE C;  1FGU A;  1QUQ B;  1Z47 A;  1AE2 A;  4DV7 Q;  1SMX A;  1NMF A;  4JCV E;  4GNX A;  2K14 A;  2UUA L;  3H0G H;  1OTC A;  1G6P A;  3PUX A;  5LMU L;  1X56 A;  2ZTD A;  4IPH A;  1SE8 A;  1TWG H;  3PIO A;  4DR7 L;  2MNA A;  4AQY L;  1XPO A;  4AH6 A;  4A4I A;  1SRO A;  5HY6 A;  4BA1 I;  3PO3 H;  2RHQ B;  3HKS A;  2HHH Q;  2F4V Q;  4YWL A;  4DV6 L;  2UUB Q;  4NXN L;  2UXB Q;  2K5H A;  2B29 A;  1P16 A;  3NBH B;  1HNX Q;  4LFB Q;  2R92 G;  1E7Z A;  1YHB A;  1VQ7 A;  2E5L Q;  2PNH A;  1CSP A;  3DM3 A;  4R4O A;  2IY5 B;  1QVF A;  5AJ3 Q;  1GD7 A;  1VQJ A;  2GN5 A;  1YI2 A;  1EOV A;  1BBU A;  3RNU A;  4YY3 L;  3RZD H;  1XTD A;  2PI2 E;  3PO3 G;  3UE1 A;  3EN2 A;  3HOZ H;  4JI6 Q;  1UWV A;  1C0A A;  3T1H Q;  3CPW A;  3W1G A;  4A3D H;  4GN4 B;  4JI3 L;  3KYH C;  4PZ8 A;  2FXQ A;  1G29 1;  1KD1 C;  4DR7 Q;  2ZJR A;  4X62 L;  2WFW A;  3IRB A;  4HJA A;  3T1Y L;  4LFB L;  4X62 Q;  4C3H H;  3TS0 A;  2UUA Q;  1LUZ A;  2VQF L;  1FVI A;  2Z6K C;  2JA5 G;  1BKB A;  5M3F G;  3CME A;  1TWF H;  3KDF B;  1J6Q A;  2JJQ A;  3F8T A;  4DV7 L;  2Q2T A;  4K0K Q;  1K3R A;  3CAM A;  4DUY L;  2D62 A;  4DV1 L;  4B3M Q;  1XMQ L;  1FJG L;  2JA6 G;  4R1J A;  4BA2 I;  4YWK A;  3CMA A;  4DUY Q;  4DV1 Q;  4DR2 Q;  2HT1 A;  4A3D G;  3H3V I;  1BVS A;  2N3S A;  2N49 A;  3J81 j;  4OO1 I;  4DV2 Q;  4IOC A;  1VQG A;  1LYL A;  3HOV H;  5IYD G;  1JJ2 A;  1KRT A;  1EWI A;  3KF8 B;  4A3K H;  1R9T H;  4BY7 G;  1I94 L;  2ID0 A;  4JBK A;  2JQO A;  4DUZ Q;  4P75 A;  2JA9 A;  1NE3 A;  3TEH B;  4HIO A;  3I56 A;  1PH3 A;  1L2F A;  1Q8K A;  3AYH B;  2JA6 H;  3PIP A;  2YTX A;  1VQ8 A;  1XMO L;  3U4Z A;  4JBW A;  2AKW B;  4Y7N H;  4HJ5 A;  4R4T A;  2I5H A;  2QGQ A;  4DR4 Q;  5M5W H;  1L1O B;  1I50 H;  5C4X G;  3CD6 A;  5IWA Q;  3BJU A;  4P73 A;  4JI0 L;  4PZ7 A;  1YJN A;  1RL2 A;  4BY1 G;  5H1S E;  4JI7 L;  1HZA A;  3HOW H;  3M4O H;  2CWA A;  4DR6 L;  4B3T Q;  4DR1 L;  1UEB A;  5HGQ A;  3K8A A;  4DV6 Q;  2VQE Q;  2PI2 A;  1V43 A;  1K73 C;  1MKH A;  2N8N A;  4R4Q A;  1J5E Q;  4DV5 Q;  3FKI H;  2IHE A;  1S3O A;  4GN5 A;  3BU2 A;  3RLN A;  1HJP A;  5GQO A;  1L0W A;  1YIT A;  2EXD A;  3AEV A;  3L7Z C;  3M4Q A;  1SRU A;  2D0P A;  5GRO A;  1Y1W G;  5GAH C;  1KRS A;  3HOW G;  3EBE A;  4LWC A;  3E9I A;  1TXY A;  1YNX A;  3KJP A;  4BXX G;  5K36 G;  4HJ9 A;  4XIG S;  3CCL A;  2ATW A;  3CC2 A;  4LW1 A;  3FKI G;  1C7Y A;  4LF6 Q;  2ZJQ A;  2NZO A;  3S2H H;  1VQI A;  5M5Y H;  3E0E A;  5FLM G;  2HIV A;  3K0X A;  2YU9 H;  1PV4 A;  1VQN A;  3GTM H;  4IPG A;  4X6A H;  2ZTC A;  4MTN A;  5IYC G;  4LUZ A;  4DV0 Q;  1Q1E A;  4IFD G;  1VQH A;  5M5X H;  4QGU A;  1Z9F A;  2KHI A;  4JYA L;  2RF4 A;  1A63 A;  4ME3 A;  2A1A A;  3TS2 A;  2BA1 A;  3J80 c;  4UY8 C;  2MO0 A;  3RZO H;  5C0X I;  4YHH L;  3U4V A;  3BZK A;  5IP9 H;  1B70 B;  3J80 i;  4LFA Q;  5IE8 A;  2KEN A;  3WWV A;  2VS1 A;  4DR5 Q;  3FP9 A;  3ULL A;  3NEL A;  1VQO A;  3KDF A;  1RIP A;  4GS3 A;  1AH9 A;  4B3S Q;  3PV0 A;  3KF6 B;  3S2D H;  2E8G A;  2R93 H;  1HZ9 A;  3S1M H;  4X65 Q;  1ASZ A;  2OTL A;  3I4O A;  3PUY A;  2PQA B;  1M90 C;  1HR0 L;  5IT9 c;  2Q2U A;  2IX1 A;  1VQK A;  4GN3 B;  4DUZ L;  4LNQ A;  3NEM A;  1FL0 A;  3I4N H;  2NVQ H;  1KHI A;  2AHO B;  4LF5 Q;  2OQK A;  3MEF A;  3LGJ A;  3H3V H;  4GLV B;  3KOJ A;  2DUD A;  3CPF A;  1YIJ A;  4UP9 A;  1YHQ A;  4MZ9 A;  3CF5 A;  2R93 G;  3M7N A;  1Y1V G;  4B3M L;  1PH4 A;  3CC4 A;  4LUO A;  5ELN A;  3RN5 A;  1Q12 A;  3L0O A;  4JYA Q;  2MQH A;  1WI5 A;  2B63 G;  1IBM L;  2YYZ A;  1L1O A;  3VDY A;  3F1Z A;  1X3G A;  2E2J H;  1WFQ A;  1ASY A;  4OO1 G;  4X64 Q;  3U50 C;  3EIV A;  1D8L A;  2CCZ A;  1B8A A;  2CKZ B;  4A3F H;  3J7A 5;  4JG2 A;  4DV0 L;  4A3B H;  4C2M H;  3RN2 A;  4LF9 Q;  1VQ6 A;  3PO2 G;  3HFZ B;  1IBK L;  4ALP A;  1N33 L;  4JI6 L;  4L5R C;  3SGI A;  4A3E H;  5IP7 H;  1KIX A;  3DLL A;  3K80 C;  3OTO L;  3GTG H;  2B63 H;  2GVB A;  2WAQ G;  1NJI C;  1PH2 A;  1UE5 A;  1YJ9 A;  2JE6 I;  2C35 B;  2XTI A;  3TQY A;  4AYB E;  1IZ6 A;  4DK3 C;  3S1N H;  1HNX L;  2PQA A;  3CCS A;  2UXB L;  1QZH A;  1HNZ Q;  2XGT A;  5GAG C;  4HIK A;  4A3E G;  2KCM A;  4JI5 L;  3JAM i;  3S1R H;  3G6E A;  3K81 C;  1YHA A;  2ALY B;  3RLF A;  3F2B A;  4A93 G;  1D7Q A;  2VW9 A;  3OYY A;  4JBJ A;  1BBW A;  5LMU Q;  1G51 A;  1PH1 A;  1E3P A;  1NMG A;  5J3B A;  1L1O C;  1I5F A;  1S40 A;  2OQ0 A;  4NPS A;  4UP7 A;  4DK6 C;  2R92 H;  1Q86 C;  2JEB I;  4O2D A;  2UUC L;  1QZG A;  3U58 A;  3Q8D A;  2K75 A;  2EQS A;  2F52 A;  2ZM6 Q;  1XJV A;  3F2C A;  2UXD L;  4NXN Q;  1WJJ A;  5FJ8 H;  1EUJ A;  1A8V A;  4DV2 L;  3M3Y H;  4A93 H;  1OXS C;  1J5E L;  5EAY A;  2MO1 A;  3STB C;  3HOZ G;  4K0K L;  1X65 A;  4PG3 A;  2ES2 A;  1O7I A;  1EFW A;  4R4C A;  1KQS A;  3HOX H;  2VNU D;  2A8V A;  1HNW Q;  3RLO A;  2NVT H;  3I7F A;  4O0A A;  3PGZ A;  4OWX B;  4DV3 Q;  4LF8 L;  1X54 A;  3G48 A;  4HIM A;  4DNI A;  4B3R L;  2CWP A;  4POF A;  4UP8 A;  3KF6 A;  4JI3 Q;  4JI4 L;  1V1Q A;  4A3L G;  2CQO A;  5IY0 A;  1X9N A;  5FJ8 G;  3PUV A;  4EX5 A;  1FJG Q;  2F4V L;  1E22 A;  5GAD C;  1K9M C;  1XNR L;  3HOX G;  2VQE L;  3HOY G;  2WB1 E;  1OXV A;  1Q1B A;  1PHJ A;  4JI2 L;  4A3G G;  3J81 c;  4OON A;  5JEA G;  5DLQ E;  5FLX c;  2WB1 G;  4A76 A;  3GTK H;  5LMN L;  3HOV G;  2YTY A;  2UXD Q;  5IYD H;  4A3K G;  4BY7 H;  2R7Z G;  5LMN Q;  1E24 A;  4A3L H;  1UE1 A;  1YZ6 A;  3ULJ A;  2LXJ A;  4R4I A;  1EQR A;  1SFO H;  4JI7 Q;  4A3C G;  4RG1 A;  2ZJP A;  4OWW B;  4JI0 Q;  3CCQ A;  2VL6 A;  4P71 A;  1JE5 A;  5IYB H;  1XNR Q;  3GTQ H;  4EQ5 A;  4APV A;  1N32 L;  4P74 A;  2K4K A;  5M3M H;  3PF5 A;  4QY7 A;  4AQY Q;  4X66 Q;  1XMQ Q;  2UUB L;  4JOI C;  1W3S A;  3UDG A;  4JI5 Q;  3I2Z A;  2Z0S A;  3K7A H;  2K5N A;  1IXR A;  2CFM A;  2JA7 H;  4OWT B;  1MJE A;  5C4X H;  2E5L L;  3GTJ H;  1IL2 A;  3A5U A; 
#chains in the Genus database with same CATH topology
 3KLS X;  2C28 A;  4RCN A;  2F1M A;  3N6R A;  3J81 E;  3DEO A;  1AN7 A;  4NW2 A;  5BR8 L;  1PRT B;  1T5X D;  2QDL A;  3OIP A;  4LF8 Q;  4Q8F A;  4FM9 A;  1Z2O X;  2I5M X;  2NZH A;  1C4Q A;  3CCR A;  3B6Y A;  4V0B A;  2XNA C;  1H9R A;  5KT5 A;  5EKI A;  1N32 H;  2ZM6 L;  1UNS A;  1X3E A;  3MXN B;  1BNZ A;  5JPN C;  1MZB A;  4LJZ C;  4MA0 A;  2JA7 A;  1SNP A;  2E76 C;  3D4D A;  3KFU A;  4CKB A;  4DV4 L;  4LH6 A;  2EJM A;  3V96 A;  4MA5 A;  1VQF A;  1X3P A;  4IRK A;  3MVV A;  4ZLT F;  4K8I A;  4QJF A;  4BXX H;  5M5Y B;  5DGB A;  1S5F D;  2UUC Q;  2R7Z A;  4JI0 H;  2EOT A;  2HUG A;  3F2D A;  1BF4 A;  2M9V A;  4AYB G;  1QWY A;  2E2H B;  3JRX A;  2ZJT A;  2UXC L;  3FDS A;  5C4Z A;  4ME6 A;  1VQ9 A;  4H44 C;  1N33 Q;  2KCC A;  2IWH A;  2BDO A;  1SNM A;  3G8C A;  2DIK A;  3CCU A;  5GON F;  2HCI A;  1ML0 D;  2IX3 A;  4DAM A;  4J9L A;  1SNC A;  1D5Z C;  3OW2 A;  1ZYR C;  5M3F H;  1WCM G;  5C3E B;  3EPG A;  4X65 L;  5KYL A;  2N78 A;  4KJO A;  3QJY A;  2RKS A;  3SK6 A;  5IGE A;  1Y14 B;  1A15 A;  1VBG A;  1J9O A;  4HCE A;  2MGS A;  3D4R A;  3S14 B;  2YV5 A;  5C3E H;  3BQ1 A;  3RD4 A;  4NKL A;  4ECY A;  3P75 A;  1VQ4 A;  4CJ0 B;  3WDN A;  1IBM Q;  4LUV A;  3MXN A;  5KFY A;  1LTA D;  4O1N A;  1S03 G;  2AUK A;  3M9B A;  2NN6 G;  1JIC A;  3ORQ A;  4AYB A;  4A3G B;  4KHZ A;  1PH9 A;  1O75 A;  4EQN A;  3ER0 A;  4KHP L;  3Q8S B;  2F4V H;  3H09 A;  3I4M G;  1ROD A;  2DZD A;  1K1S A;  4BBR B;  4YY3 H;  2VUM H;  1EYG A;  3M7G A;  4NB3 A;  1WTV A;  5KFV A;  2MUY A;  4A75 A;  2UVW A;  4A3F B;  4ECT A;  1U0L A;  3KJO A;  3NSW A;  1EUC B;  4BBR G;  5KFJ A;  1PRT F;  2EJG C;  2B8F A;  1TWA H;  5FO7 B;  5ELC A;  2L15 A;  3RAX A;  1EY5 A;  2VA3 A;  4A3F G;  1BJT A;  3MXU A;  1NY4 A;  2WII B;  5LMN W;  5E4W C;  2MCT A;  1Y1W H;  1QNK A;  1YVC A;  1TS4 A;  2PZU A;  4OL7 A;  4IO9 A;  3UDF A;  4CBV A;  1JMC A;  4DPG A;  3G6J B;  1G8Z D;  4J9M A;  1GSO A;  2EY1 A;  4NXM L;  2VPQ A;  3K57 A;  3UQ8 A;  2E5L H;  2JA8 B;  2WYO A;  3GV6 A;  4L5Q A;  3VR3 A;  5IYC H;  4GKK Q;  2CH4 W;  3GTP B;  1KDC A;  1I4R A;  2PNR C;  1EY9 A;  4IFD H;  1PTO D;  4RFB A;  3VA5 A;  2JA8 G;  2O03 A;  1YBY A;  4NMZ A;  4DAY B;  4HSV A;  4R8U B;  1V9P A;  2JXM B;  5LHY 1;  4IN3 A;  3H15 A;  4DR3 L;  4GOP B;  4R9W A;  1TY0 A;  4L5S A;  1E1T A;  2R8K A;  1CUK A;  3BZC A;  1GUS A;  2R61 A;  2RDF A;  4UCT A;  3FVQ A;  3MXG A;  3E9H A;  1KDB A;  2K33 A;  2R82 A;  1LT4 D;  5JJL A;  2VY3 A;  4GNX B;  1XXG A;  1F2L A;  4J8Q A;  2ZTE A;  3I72 A;  2E2I H;  4EBC A;  2BH8 A;  3UDX A;  4EGQ A;  1GUN A;  2HCC A;  1JDE A;  2VQF Q;  4JVZ A;  5F2D A;  3VPB A;  5KFQ A;  1DM0 B;  5CBA E;  3CCE A;  3BDC A;  1KAA A;  3MWE A;  5JEA J;  1UE6 A;  2ZXR A;  1GO3 E;  4AIM A;  1DOL A;  2W6P A;  2XGQ A;  4WJW A;  3EPI A;  1LT6 D;  4I7A A;  2NU8 B;  3CCJ A;  1UE7 A;  3HKZ B;  4X66 L;  2UUB H;  2ASB A;  1YNN D;  1EZ1 A;  4EFE A;  3HOY H;  1AW7 A;  1NBW A;  4APM A;  2HQL A;  5IGB A;  4HAE A;  2OCE A;  3K7U C;  3BYY B;  1M4V A;  1OXX K;  4ODG A;  5IWA H;  3LX0 A;  4EQO A;  2LXK A;  2Z6K A;  4IJH A;  4KLK A;  1LTL A;  3M85 A;  3PQI A;  5KFK A;  5IGC A;  2LFN A;  3EJI A;  1LTR D;  1FD7 D;  2UXC Q;  5E7N A;  4O3O A;  2NVX H;  4GOP A;  3P1H A;  4HJ7 A;  4H0L C;  1PFS A;  2NZ1 D;  3U9T A;  5COY A;  4FBU A;  3Q8R B;  2WV6 D;  4OHJ A;  3CW2 C;  2W70 A;  2KVM A;  5GAE C;  4DR3 H;  2NVX B;  1J8I A;  4A3B B;  4QWB A;  4JCV E;  5FPR A;  2EYO A;  2UUA L;  3H0G H;  3PUX A;  3HOW B;  3U9O A;  4IPH A;  4O4H F;  1W93 A;  1B53 A;  3S16 B;  1PZJ D;  4AQY L;  1XPO A;  1V4Y A;  4DF7 A;  3H4B A;  5BN5 A;  4FXK C;  2RHQ B;  1KJ8 A;  1RYS A;  4PDB A;  3K5I A;  2HDM A;  3VYS A;  1STH A;  2UUB Q;  1IOW A;  3MR2 A;  2YU9 B;  5G3L F;  2NTT A;  3TP6 A;  1TWC B;  2IY5 B;  3H40 A;  1YI2 A;  4IUN A;  1KDA A;  3RNU A;  4L63 B;  3BZD B;  1B3Q A;  3PO3 G;  5A35 A;  1R9T A;  4CDF C;  1TWA A;  3HOZ H;  2R7M A;  3Q8Q B;  1C0A A;  1KJQ A;  1G29 1;  4X3S A;  4X62 L;  4DR6 H;  4F87 A;  2JA6 B;  1QIL A;  2VQF L;  5JH7 F;  4CJ1 B;  1J6Q A;  2JSO A;  3F8T A;  5KFT A;  1SAP A;  3H4D A;  4DV1 L;  3SK4 A;  1FJG L;  2JA6 G;  5I2X A;  1PFB A;  1BQQ T;  3D8G A;  3NPP A;  1ZHQ A;  3H6M A;  2UVU A;  1VQG A;  4K5X A;  3HOV H;  2PZT A;  3BQ0 A;  4LF7 H;  1I4X A;  1EWI A;  1EUD B;  4H7B A;  4ETS A;  4QUC A;  2JQO A;  3C1F A;  4EG0 A;  3N42 B;  4CKE A;  3I56 A;  1FNV A;  4RGM A;  2NUC A;  2RA4 A;  1VQ8 A;  4JBW A;  4C5A A;  1K1Q A;  1MSG A;  5C4X G;  4LF9 H;  2IJ0 A;  2W9C B;  3IAY A;  4P73 A;  5I9P A;  4C2M B;  1TAE A;  1YJN A;  5H1S E;  3M4O H;  1HZA A;  3D6C A;  5E3F A;  1F2M A;  4GKJ H;  3J80 L;  1EY7 A;  1PYW D;  3GTG B;  4EEY A;  3OIQ A;  2VQE Q;  1K73 C;  1BCP F;  1MKH A;  4J9S A;  4DV5 Q;  3JAM W;  2JA6 A;  1I4Q A;  2PW7 A;  1SE4 A;  2EY6 A;  1L0W A;  4J9N A;  3L7Z C;  1ILQ A;  4UCV A;  1JC7 A;  5GAH C;  1S5E D;  3E5S A;  1O80 A;  3BG5 A;  3EBE A;  1KC7 A;  1HNZ H;  1PRT C;  5M5W B;  4KKT A;  4BXX G;  4ABN A;  4RNM A;  1K8M A;  4XQN A;  4XIG S;  3OOC A;  4ECX A;  4UHV A;  3V6K A;  2ATW A;  3LWB A;  2LS0 1;  3GID A;  2ATL A;  1H9S A;  2B39 A;  1C7Y A;  1LTT D;  1JWS D;  4ME5 A;  1UUP A;  3RB0 A;  4IUT A;  5C5M A;  2ZTC A;  2ZM6 H;  2XCA A;  2TSS A;  4HMJ A;  3KHH A;  4ECW A;  1ONL A;  1VQH A;  2G9H D;  3X3N A;  3MA2 B;  4GC6 A;  4V19 0;  2FPG B;  3CU7 A;  4GC7 A;  1KJI A;  1YNN C;  4MV6 A;  4O4I F;  4FNF A;  4JUZ A;  1A63 A;  1SE2 A;  2W9C A;  3A8J E;  4KMU C;  3TIN A;  4DV3 H;  4WRD A;  4YHH L;  1CS0 A;  5E1F A;  1I4G A;  4LFA Q;  2BE5 C;  4KN7 C;  2VS1 A;  3GTG A;  3IKJ A;  1RIP A;  2F0S A;  2SNM A;  1GSA A;  4X65 Q;  2A6H C;  1HR0 L;  2IX1 A;  1Q90 A;  3JSL A;  3I12 A;  1DD2 A;  5CA1 F;  1FL0 A;  5EPL A;  5KG3 A;  2W9B A;  3LNN A;  1B3A A;  5KT3 A;  1KHI A;  3K7A B;  4LF5 Q;  2R93 B;  1I7L A;  2OQK A;  3MEF A;  1AEX A;  5FO8 B;  4IR1 A;  1C48 A;  4JI2 H;  1CZW A;  1U4L A;  2DUD A;  3CF5 A;  2R93 G;  4B3M L;  1PH4 A;  1W6K A;  4ZYS A;  1Q12 A;  2HD3 A;  2KJX A;  4MHE A;  1KNA A;  3L0O A;  1A2T A;  1XYI A;  2WKC A;  4JYA Q;  2L11 A;  3EA6 A;  4R8N A;  2YYZ A;  1L1O A;  4BWG B;  3VDY A;  4UCR A;  1ASY A;  1GXD C;  3D4W A;  4O3S A;  1D8L A;  4HNU A;  2CKZ B;  4A3F H;  4JG2 A;  1LLR D;  4X3K A;  2RDG A;  2B2T A;  3HFZ B;  1N33 L;  4ALP A;  4JI6 L;  4L5R C;  1FKA H;  2KSW A;  2UU9 H;  1D1K A;  3OTO L;  4RB3 C;  3GTJ A;  1KBL A;  2WAQ G;  1PH2 A;  4RB2 C;  2B8G A;  4L6T B;  1SNO A;  3TQY A;  4LF5 H;  3S1N H;  2F0N A;  3VR2 A;  2WAQ B;  1Y69 U;  1QZH A;  3BG3 A;  1HNZ Q;  4HIK A;  2KEC A;  4A3E G;  2KCM A;  3JAM i;  2X6L A;  5DLF A;  1VF7 A;  1BBW A;  3NWT A;  1G51 A;  5LMU Q;  3OMG A;  1E3P A;  1PH1 A;  5J2T F;  3MFG A;  4JYA H;  2XRQ D;  4FS2 A;  3OMC A;  5J1Z A;  4Y8V B;  2ICE C;  5I2Y A;  2C2D A;  1CT1 D;  3BVZ A;  3J7Y W;  1S0O A;  3Q8D A;  1Y8P B;  3MR6 A;  4KHV A;  1XJV A;  2UXD L;  5FLX E;  2KEE A;  3OWF A;  5FPO A;  4X66 H;  1CZG A;  5FJ8 H;  1V1P B;  3DWP A;  1J5E H;  5EAY A;  2MO1 A;  4EFB A;  4PG3 A;  2ES2 A;  4UDU C;  3HOX H;  2WDT A;  2A8V A;  5IGD A;  4DR7 H;  3RLO A;  2NVT H;  1FYC A;  5EKK A;  1ZEQ X;  3T56 B;  4DV3 Q;  5CAE B;  1GOZ A;  4DNI A;  4B3R L;  3FMA A;  4LMY A;  2CWP A;  3VR4 A;  3KF6 A;  5KGU A;  4O3P A;  1WCM A;  2J9G A;  2CQO A;  5IY0 A;  1RDP D;  3NHH A;  4DR5 H;  1G2T A;  3PUV A;  3G6V A;  4EX5 A;  4J6H A;  2F4V L;  5K2M A;  1O78 A;  4C5C A;  1CHP D;  4TV8 F;  3HOY G;  3CRL C;  2WB1 E;  5DNF A;  1F9S A;  3J81 c;  1VKZ A;  5KT2 A;  3GTK H;  2QF7 A;  4K5V A;  3TSS A;  5LMN Q;  1UE1 A;  1YZ6 A;  2LXJ A;  4R4I A;  4JI7 Q;  5C4H A;  3HOY B;  1JWM D;  1EQT A;  4K6D A;  4P71 A;  4GKK H;  5KG4 A;  4DL3 A;  2X0S A;  2Z9H A;  3PF5 A;  4RNN A;  4AQY Q;  1I6V C;  3PVX A;  3GIJ A;  3RMH A;  1XMO H;  4B08 A;  5F9N A;  2CW0 C;  4S3S A;  5ELB A;  4YJ2 F;  3QZ8 A;  3PZP A;  1N33 H;  1IXR A;  1RTO A;  4JPB W;  4OWT B;  4MTD A;  2XCP A;  3SK8 A;  5M3M B;  3J80 E;  1IL2 A;  3T5L A;  5KFX A;  3I91 A;  1EU4 A;  3UDI A;  1AN8 A;  2AGO A;  4Y7N B;  2A69 D;  4OXP A;  4JI4 Q;  2Z1C A;  3OSN A;  3CQZ A;  5A2Q E;  4LF7 L;  1EEF D;  5KG1 A;  1SBB B;  1STG A;  4QIW B;  5M3M G;  4HN7 A;  3V6H A;  2DLN A;  5CR3 A;  1Z2N X;  1I7N A;  2JEG A;  1FJG H;  2O5J C;  3A5Z B;  1CE8 A;  1K3B C;  2JA7 G;  3IFD A;  4DKA C;  4TVA B;  1VQA A;  3E3X A;  4TSS A;  2HDL A;  2EYF A;  1I3Q H;  4AYB B;  2E2H H;  5L1L A;  1CKN A;  3V6J A;  4JV1 A;  5KFU A;  3DEP A;  1K83 H;  2WE6 A;  1BUV T;  4KKS A;  3S24 A;  4IUU A;  4X3T A;  4XT1 B;  1I6H H;  3OSP A;  4XTC S;  2B2U C;  1DJR D;  2DGY A;  3PIO 3;  1XNQ Q;  1C3O A;  1MIU A;  3I3C A;  4YY3 Q;  2BA0 A;  1PTO H;  4ZUJ A;  5C3E G;  4A2A A;  1HTL D;  4G57 A;  1PH5 A;  2R86 A;  1VQC A;  1WTQ A;  1A62 A;  3PUZ A;  4DV3 L;  1S5D D;  3VYU A;  1CKM A;  2QIL A;  4ZQI A;  1S5C D;  1SND A;  5IT9 L;  5G3L D;  3A8K E;  3WOF A;  5I9O A;  5FD6 A;  2CZG A;  2PQE A;  3NTI A;  1VMC A;  4LF9 L;  1U9R A;  3A0J A;  1UNN C;  2E75 C;  1X6O A;  3KAJ A;  1XX8 A;  1N34 Q;  4ED1 A;  5M9O A;  1VQ5 A;  4DV7 H;  3G6X A;  5D1P A;  1SR3 A;  4RMF A;  2IBK A;  2ZDH A;  3K3P A;  1P8L A;  2RCN A;  1CA5 A;  3WNZ A;  3HP3 A;  4CC6 A;  2VUM G;  3CRK C;  1Q8I A;  1A0I A;  3GTQ B;  5CB4 F;  2AWO A;  1QCB D;  1V1O A;  2K04 A;  1MD2 D;  1EYC A;  4BBR H;  3HOX B;  1B04 A;  1VQL A;  1S0M A;  5KFF A;  2F0K A;  3CP0 A;  4F8M A;  4N8F A;  5J2U F;  3GDE A;  3PR4 A;  1HNZ L;  3LML A;  4ED2 A;  3Q1K A;  3DUZ A;  2F3W A;  3TII A;  3UE0 A;  1EL0 A;  3Q6S A;  2HIX A;  4FYD A;  4DV5 L;  2XD4 A;  4NP5 A;  3OHX C;  3O13 A;  3PF4 A;  5JVL A;  1Q46 A;  3K59 A;  4XX0 B;  3T13 A;  2R7F A;  1MJC A;  4FS1 A;  1KC8 C;  3GTL A;  4B3S L;  2J7Z A;  3T1Y H;  1T5E A;  1EZ6 A;  2XVS A;  4YAK B;  3ULP A;  3DHQ A;  2V58 A;  4JI3 H;  1YJW A;  1KAW A;  4BBS B;  1N8R C;  3N6X A;  3C2P A;  3ND9 A;  1AZP A;  1JB3 A;  3AQQ A;  2FP4 B;  1DGS A;  2UU9 Q;  1S4Z A;  1T9H A;  2UUA H;  4LF4 L;  3GIP A;  1VS0 A;  1IBM H;  1IKM A;  1PH6 A;  2JA8 H;  1PYS B;  2PMZ E;  1OXU A;  2QEX A;  3S9W A;  3HKZ E;  2W6Q A;  1DXM A;  1JQY D;  3RGZ A;  4ED8 A;  1KXL A;  1STE A;  3GD7 A;  2NWG A;  3J81 i;  3V2T A;  3K5N A;  1TY2 A;  3AFQ A;  5EJW A;  4ULL A;  2H5X A;  1N34 L;  4OEL B;  2K5D A;  4C56 C;  4YR3 A;  3RZO B;  1XMQ H;  5C4J B;  4QQB X;  3PMF A;  1XMO Q;  5DG8 A;  1VCI A;  1RD9 D;  4LFC L;  4LF6 L;  4IOA A;  1WYD A;  1JB7 A;  4MN3 A;  1N36 Q;  1X55 A;  2XN9 C;  1TWH H;  2ASD A;  1QNU A;  3HOU G;  1AP0 A;  1E4F T;  3K3V A;  2XWB B;  4RCO A;  5C1P A;  2E2I B;  2BQR A;  1PDQ A;  5JJI A;  2EZV A;  4F7X A;  4YHH Q;  3HOU B;  2YL2 A;  3LWU A;  3PW0 A;  5LL6 b;  1GLV A;  4LMQ D;  2C00 A;  1NR4 A;  1QE6 A;  4J9R A;  5CV9 A;  1SYC A;  3S15 B;  5KFD A;  3MWM A;  1B1Z A;  5BR8 H;  2Q2H A;  2GLT A;  4GNX C;  1HZC A;  4JV5 H;  3S1Q B;  4DR4 L;  5EQ0 A;  1IW7 D;  4KY5 A;  1NSN S;  5KRU A;  2K01 A;  3JAM c;  4F4W A;  2I8C A;  1RJP A;  4F4Y A;  4DLK A;  5FLX W;  3MWD A;  3K5O A;  2J6S A;  3AU7 A;  5IOC A;  4DR4 H;  2WAQ E;  4A3G H;  4ECV A;  4JI8 Q;  4WD3 A;  2Y0S B;  3RAQ A;  3CCV A;  3E6Z X;  4LF6 H;  2R7Z H;  5L37 A;  3VA7 A;  2W7O A;  2IX0 A;  4DV4 Q;  1R9T B;  3S17 H;  4A3C H;  4G4K A;  4YB8 B;  1HNW L;  3H0G G;  5K5P A;  1TR5 A;  4M9U A;  5KFS A;  1VQE A;  1LM0 A;  2VQE H;  1E2W A;  2R7D A;  4I7Z C;  2CW8 A;  3NWS A;  1K8O A;  4DR2 L;  3J7Z C;  1JOK A;  5C0X J;  2N55 A;  2QEJ C;  3I90 A;  4FVM A;  3H0G B;  1LTG D;  2OTJ A;  1XPR A;  4HJ8 A;  1TU2 B;  1RYR A;  1EIG A;  1YEZ A;  2K5V A;  1HA5 A;  4UCS A;  3V4S A;  4DV7 Q;  5DAU A;  1NMF A;  1KLU D;  2K14 A;  4HMI A;  1G6P A;  1OTC A;  1HUN A;  4RAZ A;  2ZTD A;  4TV9 F;  1SE8 A;  2K1B A;  4Q0F A;  2EJF C;  1UC9 A;  4AH6 A;  4A4I A;  3R93 A;  1CA6 A;  1E4G T;  4BA1 I;  3PO3 H;  2NU6 B;  4DV2 H;  1M7J A;  2F4V Q;  1XWE A;  2UXB Q;  4NXN L;  2XIG A;  4DV0 H;  3NBH B;  5KFC A;  2FPI B;  3GLK A;  3D6W A;  1YHB A;  1PLF A;  2PNH A;  2X6G A;  2E5L Q;  3AMU A;  4R4O A;  3RB4 A;  2F03 A;  1B50 A;  2GN5 A;  3K6O A;  3RZD H;  4RB0 A;  1B33 N;  5KFH A;  1C8C A;  4TQR A;  2J6T A;  5A2Q W;  2HQE A;  4ZKC B;  4J9O A;  5FKA C;  4C2M A;  3I8Z A;  2A68 C;  4HR7 B;  3EN2 A;  3UE1 A;  4FF3 A;  1UWV A;  3J81 W;  3T1H Q;  2NVY A;  5DQI A;  1JX4 A;  1SNQ A;  2FMC A;  3TME A;  4B9X A;  1KD1 C;  2EYP A;  4DR7 Q;  3C0F B;  1PZK D;  2EY5 A;  3BYT B;  4EVO A;  2W6Z A;  4X62 Q;  4C3H H;  1LUZ A;  1FVI A;  3SHL A;  1ILP A;  2PBZ A;  2XRS D;  3IL8 A;  4ED6 A;  1BKB A;  3TQ1 A;  4K0K Q;  2JJQ A;  3QIA A;  2Q2T A;  4O3Q A;  1CTM A;  4ZHQ F;  2W8K A;  1S9F A;  2R7N A;  1XMQ L;  4BA2 I;  4YWK A;  3CMA A;  4DV1 Q;  3K5M A;  4OO1 I;  2N49 A;  2JA5 B;  2C2R A;  3K5H A;  2P5Z X;  5LXT F;  4XYM B;  2I46 A;  5J39 A;  1KRT A;  1ZET A;  2AQ4 A;  1IKL A;  1I94 L;  1WTX A;  4A3D B;  4JBK A;  2B2Y A;  2F0U A;  5BN4 A;  4R8I A;  4O3N A;  4U7C A;  3TEH B;  2JA9 A;  1M0T A;  4RZR A;  3NBH A;  1RK6 A;  5C4X B;  1L2F A;  4BY7 B;  3KAK A;  3T51 B;  1KEE A;  3PIP A;  2YTX A;  2RDJ A;  5HGT A;  2AKW B;  4R4T A;  2I5H A;  2PPB C;  4DR4 Q;  1HA6 A;  1E2Z A;  1NAP A;  4MV3 A;  1L1O B;  1E4E A;  5EZY F;  4DL5 A;  3ITP A;  3BJU A;  2FKL A;  3LP8 A;  4TRD A;  4DR6 L;  3PO2 B;  5KFG A;  2CWA A;  1TQO A;  1DON A;  5JVD F;  4B3T Q;  2ZDG A;  4P2C B;  2SOB A;  1UEB A;  3R2T A;  3K8A A;  2UVR A;  2A6E D;  2F0W A;  4LH7 A;  4IZ8 A;  4K5W A;  3OWE B;  1HR0 H;  5KFB A;  4IUR A;  3MC0 B;  1J5E Q;  2YYA A;  3PN1 A;  2BE5 D;  3BU2 A;  1HJP A;  5GQO A;  2EXD A;  2A6E C;  4OGQ C;  1SRU A;  2D0P A;  2EY2 A;  3HOW G;  1RJT A;  2VUG A;  4QUF A;  5L1J A;  3KJP A;  1WTP A;  1GSH A;  4HCS A;  4ILW A;  3DXJ C;  1EWC A;  5KFZ A;  5KFP A;  4PMB A;  2ZJQ A;  4QB4 A;  2YU9 H;  4F4Z A;  4X6A H;  3PIP 3;  4DV0 Q;  4LUZ A;  1GYF A;  3FKI B;  1Q1E A;  3VPD A;  1EY0 A;  2EYL A;  4O2A F;  2YS6 A;  3RTX A;  1SSO A;  4FU0 A;  4DL6 A;  1PTO B;  2Q8I B;  4RB1 A;  4ME3 A;  5EWE A;  5FK9 C;  1ZYR D;  3J80 c;  5KG2 A;  2W6N A;  3GP7 A;  5E4X A;  2B2T C;  3FMC A;  4ECU A;  5KT7 A;  2KEN A;  3SXH A;  3WWV A;  4DR5 Q;  2FE3 A;  1JE4 A;  1IHZ A;  1VQO A;  3KDF A;  3RB6 A;  4GS3 A;  4B3S Q;  3GTM B;  2R93 H;  1H9K A;  5M3F B;  2FLP A;  4ID6 A;  1HZ9 A;  4C3I G;  3S1M H;  3J7A F;  1GUG A;  3I4O A;  3I70 A;  1U4P A;  3PUY A;  3GQC A;  4G7H C;  4LNQ A;  2NVQ H;  4HNV A;  5M5X B;  5ELD A;  4K14 A;  1EQV A;  3JAM L;  3H3V H;  1SYF A;  4GLV B;  3KOJ A;  4CDE C;  4J9Q A;  2R6F A;  4LAA A;  2F0M A;  3M7N A;  5KFE A;  5LL6 X;  3BA9 A;  5CMD A;  3CC4 A;  3GII A;  3RN5 A;  4HYK A;  3T1H H;  2W6M A;  2W6O A;  3DMU A;  2MQH A;  1WI5 A;  1X3G A;  1Y1V B;  1WFQ A;  4OO1 G;  1FGB D;  4X64 Q;  4QMG A;  4RGO S;  2CCZ A;  3BAA A;  1OO9 B;  1O7L A;  5FO9 B;  4LF9 Q;  4G3I A;  2V4Q A;  1HFN A;  1KTK A;  1IBK L;  2G9D A;  4FP5 D;  3SGI A;  3GV8 B;  4A3E H;  2K5Q A;  3CQZ B;  1KIX A;  3M9N B;  2B63 H;  2CQA A;  3R23 A;  4I65 A;  1NJI C;  4QF4 A;  4WFN 3;  3EVQ A;  3I73 A;  4AYB E;  4LK1 C;  1IZ6 A;  3NP8 A;  4YIJ A;  4DK3 C;  1JOQ A;  2PQA A;  3QFF A;  2F0F A;  3SK5 A;  1WTR A;  2UXB L;  1L2Z A;  1B4O A;  2KCN A;  4YBZ B;  1EWH A;  4JI5 L;  3RLF A;  2ALY B;  5D3I B;  3GIK A;  3BQ2 A;  3OYY A;  5DG7 A;  1HNX H;  3C1E A;  1NMG A;  2HGS A;  2E2H A;  1I5F A;  2OQ0 A;  4NPS A;  2QK4 A;  4N8X 1;  1Q86 C;  4O2D A;  1KLG D;  1QZG A;  4QCL A;  4J0M A;  4EYH B;  2K75 A;  2EQS A;  4H13 C;  3F2C A;  4NXN Q;  1Y1V A;  3TN2 A;  5KFA A;  4A93 H;  1X65 A;  1O7I A;  1RKN A;  2OF1 A;  1EFW A;  2VNU D;  1HNW Q;  3I7F A;  4OWX B;  3N44 B;  3RUP A;  4A3I B;  1TKW B;  1X54 A;  4MV7 A;  1CQV A;  4HIM A;  4RUA A;  3F8N A;  3P20 A;  1GUT A;  2R8G A;  4JI3 Q;  1V1Q A;  5KIX A;  1JIH A;  1X9N A;  2R8I A;  2YZN A;  2DJF C;  2OXP A;  4R7R A;  2HVQ A;  4O2B F;  1K9M C;  4YP3 A;  3H91 A;  3GTQ A;  3DM1 A;  3MEH A;  5C44 B;  2W57 A;  3S17 B;  4A3G G;  4C1N I;  4IWX A;  1ICF B;  1VAJ A;  3L4K A;  4IRC A;  5DLQ E;  4RKL A;  2WB1 G;  4I50 F;  2QCP X;  5LMN L;  4OX9 H;  5IYD H;  1ENC A;  4BY7 H;  2R7Z G;  4Q8E A;  5JJZ A;  2N88 A;  2ZXP A;  4A3C G;  4DV4 H;  4RG1 A;  4OWW B;  2L9H A;  2VL6 A;  3OW7 A;  4M7E A;  4FBT A;  1JE5 A;  2FPP B;  3GTQ H;  4CJ2 C;  4APV A;  1EIH A;  4CDC C;  5KND A;  1BXR A;  5M3M H;  1KJ9 A;  1CQI B;  2UUB L;  1W3S A;  2L0C A;  3I2Z A;  1JDB B;  3K7A H;  1IBK H;  5JEA H;  2JA7 H;  2CFM A;  5C1O A;  4LFA H;  1MJE A;  2FK3 A;  1SE3 A;  4TQS A;  3GIL A;  3W3A A;  2Z4H A;  3DWQ A;  1F2Z A;  3TRZ A;  3VPC A;  4WBN F;  3QO2 A;  5FD5 A;  2Q8R E;  3MFY A;  4K2L A;  3H20 A;  4LFC Q;  5C5J A;  2KHJ A;  2J4X A;  1S68 A;  5HV6 A;  2GVA A;  1PVO A;  2K6A A;  2WP8 J;  1U5K A;  2BQU A;  3MJF A;  4WJ3 M;  2NVY H;  2CVR A;  5BR8 Q;  2FJZ A;  5LA6 F;  4LFB H;  4EBD A;  4DN4 M;  4DAV A;  4DA2 A;  3GTP H;  3OSO A;  4OX9 L;  4JV5 Q;  3ORR A;  4TKO B;  4A3E B;  4JI7 H;  1PTO C;  1Q7Y C;  4LF4 Q;  1SLJ A;  2A69 C;  2FMA A;  3U9S A;  3KHL A;  4KD3 A;  4XYL B;  3I55 A;  1QVG A;  4B9W A;  1EIF A;  4KY6 A;  5ELF A;  2Q8T A;  1IBL H;  1DYQ A;  3BJY A;  2D0O A;  1K8G A;  3QOJ A;  1E0B A;  2F4I A;  4C3H G;  5J22 A;  1QVC A;  1SYB A;  4DR1 H;  3GTO H;  3S2D B;  4IUQ A;  2FLN A;  4LSA A;  3RGX A;  4GOP C;  5NUC A;  1JLL B;  2DJG C;  3SR1 A;  3MFH A;  2V4R A;  2M00 A;  4KV6 A;  1KL9 A;  3QOL A;  3HZX A;  2L5T A;  2VZA A;  2Y0S E;  1PZI D;  4X65 H;  4KD4 A;  4NXM Q;  3SE7 A;  5LOV F;  4EBE A;  3F2U A;  4X64 L;  2O2L D;  4HID A;  3CXC A;  3T4A C;  3QZ7 A;  3OTO Q;  1B2T A;  3L2P A;  3AFP A;  4ECQ A;  1MGS A;  1EQQ A;  3KHR A;  4ECS A;  4A3I H;  1ENF A;  3KLW A;  1EIY B;  4YR2 A;  2C2E A;  2F0P A;  4WJ4 A;  1LT3 D;  3NEN A;  5JUM A;  4A3J B;  4LF5 L;  1HZB A;  3GO5 A;  2RSN A;  2B2U A;  1NNX A;  1Y1V H;  1LAC A;  2YZG A;  4DAP A;  1ESF A;  3JRW A;  3S14 H;  2UVV A;  2K5W A;  1Q82 C;  5C44 H;  4P72 A;  3TRE A;  4A3J H;  4BBS G;  4X64 H;  3EYY A;  4MV4 A;  4DV6 H;  4TQU S;  2W9A A;  5ELO A;  3C3L A;  4IFD I;  1SDF A;  2K50 A;  3GIQ A;  1VQM A;  1CI3 M;  2QW7 A;  3RR5 A;  3K5L A;  2FK1 A;  4A3B G;  1LO5 D;  4HSP A;  1IW7 C;  1CSQ A;  1GVP A;  1DCZ A;  1Q81 C;  3SE0 A;  2PO4 A;  2LSS A;  2M2L A;  5IP7 G;  2A5H A;  1F2Y A;  2MPM A;  1TWG A;  1IYJ B;  2ENB A;  1W2B A;  2CW0 D;  1BR9 A;  4FDB A;  4DR2 H;  1W6J A;  3D31 A;  4YCV A;  3R3O A;  3HOU H;  5KG7 A;  1CFM A;  1WD1 A;  4LFA L;  2I80 A;  2RDI A;  4U68 A;  4EEQ A;  1XNQ L;  2Y0S A;  1STN A;  3CC7 A;  3S2H B;  1I4H A;  4MAM A;  3A7A B;  1D2B A;  4ED0 A;  1SN8 A;  2RHS B;  2QYZ A;  1F9Q A;  1TWF B;  1MHW C;  2DY7 A;  1NTG A;  3TQT A;  2CH4 A;  4RGN A;  1CK1 A;  3M4P A;  4K2K A;  1PH8 A;  3T1Y Q;  3DF7 A;  2NVY B;  2LKV A;  3G7L A;  4IFD J;  4X62 H;  4XXE A;  4UAI A;  5I4D A;  1GUO A;  4Q44 A;  2WIN B;  1B6S A;  4C3I H;  2ICI A;  4RAU C;  1S72 A;  1XPU A;  1B44 D;  3QWN A;  1HUM A;  3W5O A;  1SYG A;  5AJ3 L;  1HCZ A;  2KCT A;  1X3Q A;  1JWU D;  2F0O A;  3EFX D;  3ERS X;  4LF7 Q;  4QW8 A;  2I5L X;  2B2W C;  3S1M B;  1S5B D;  3CCM A;  2QKI C;  1C9O A;  2KHS A;  2PYK A;  1RK5 A;  3A55 A;  2Y0S G;  5D14 A;  1SJH D;  4DK0 A;  5D65 A;  1SMY D;  3GV3 A;  1OXT A;  4JI1 Q;  4XQJ A;  5C0X H;  1B7Y B;  1PYB A;  1ZXT A;  4DNT B;  4B3R Q;  3I4M B;  1PH7 A;  3S16 H;  3T5H A;  1WOC A;  4A3M B;  5KFI A;  4HR7 A;  2JEA I;  3M4I A;  1B9M A;  2L55 A;  1HH2 P;  1H9J A;  1PRT D;  4RAY A;  2HHH L;  3PUW A;  3R5H A;  4A3M H;  2Z4I A;  4YHH H;  3JAM E;  2BH2 A;  4C3J H;  1PXU A;  1BDO A;  1TWC H;  3SDZ A;  5JJK A;  4N9P A;  5I47 A;  4IHJ F;  1FGU A;  1QUQ B;  1Z47 A;  5IT9 E;  1AE2 A;  1SMX A;  3LWE A;  2I07 B;  2SDF A;  5LMU L;  1X56 A;  1QJO A;  2JA5 A;  1A3U A;  4DR7 L;  3KBG A;  2RGV A;  2KUM A;  1SRO A;  5HY6 A;  5KG5 A;  5FOB B;  5COR A;  2HHH Q;  2AGP A;  1DOK A;  1T3N A;  1JCK B;  2G5D A;  3VR6 A;  3IG0 A;  2B2Y C;  1H9S B;  1P16 A;  3NK9 A;  3A8I E;  4OIJ A;  3BVM A;  3T5K A;  1CSP A;  3DM3 A;  2F0L A;  1QVF A;  2FFK B;  5KG6 A;  1GD7 A;  2F0T A;  1EOV A;  1BBU A;  4YY3 L;  4R8U A;  4LF4 H;  3HEJ A;  3D3R A;  3GIM A;  3SEB A;  2PI2 E;  2F0G A;  1EYZ A;  1RF2 D;  4ZCK A;  3MR3 A;  2W71 A;  1STY A;  5FLX L;  4JI6 Q;  1SCU B;  3CPW A;  3KK7 A;  2FXQ A;  5TSS A;  2XWJ B;  2NBF A;  2WFW A;  3IRB A;  4RWS C;  5DGA A;  2EE1 A;  4QWE A;  2IPK D;  4IR9 A;  2PCF B;  2Z6K C;  2JA5 G;  3CME A;  4DV7 L;  3KDF B;  2VQD A;  1EY6 A;  4HQ6 A;  1K3R A;  3CAM A;  4B3M Q;  2JN4 A;  1M6V A;  4A3D G;  1ULZ A;  2PN1 A;  1SMY C;  4DUY Q;  4DR2 Q;  1SYD A;  1ZKO A;  2XC9 A;  3H3V I;  2N3S A;  1Z6H A;  4XQQ A;  2AQ2 B;  3J81 j;  1N34 H;  4DV2 Q;  2W9B B;  4IOC A;  3BDO A;  1LYL A;  3KAL A;  5IYD G;  3RBE A;  4BY7 G;  2OT2 A;  1PK8 A;  4BS9 A;  2ID0 A;  1A6X A;  4RU9 A;  3T5J A;  1JR0 D;  4Q43 A;  2WTF A;  4F4X A;  4HIO A;  1NE3 A;  2EYH A;  5BPH A;  3NGD A;  1Q8K A;  3AYH B;  3FKI A;  5KT6 A;  4AQY H;  4Y7N H;  4TUY F;  4KN4 C;  5DM7 3;  5M5W H;  1SEB D;  1I50 H;  2E2D C;  4RH6 A;  3E0J A;  4HTH A;  5KEE A;  2FK2 A;  5HBR B;  4PZ7 A;  4JI7 L;  4BY1 G;  3HOW H;  3HG9 A;  1F77 A;  4DR1 L;  5C6A A;  4QW9 A;  5CV4 A;  4DV6 Q;  3S1R B;  1NCV A;  2PI2 A;  1V43 A;  3X3M A;  2N8N A;  4BY1 B;  2JP1 A;  3GTM A;  2A74 C;  1K28 A;  2WKD A;  3OHB A;  3RUZ A;  5JAV A;  1YIT A;  3AEV A;  4Z9C B;  4DU9 A;  5GRO A;  4IQZ A;  4MTK A;  1KRS A;  3E9I A;  3HS0 C;  3OPO A;  1TXY A;  3HRZ C;  3KBX A;  5K36 G;  3FPP A;  3RF2 A;  3CCL A;  3CC2 A;  2AQ3 B;  2ASL A;  3FKI G;  3ND8 A;  5BMV F;  3ZYY X;  4LF6 Q;  2YU9 A;  1EU3 A;  2NZO A;  2L12 A;  1VQI A;  2PMZ B;  5ELE A;  4CHT B;  3E0E A;  5FLM G;  3S2H H;  3K0X A;  3PW4 A;  1VQN A;  4IPG A;  5EDW A;  3G6Y A;  1GHJ A;  1UEA B;  5DEH A;  3SVM A;  5M5X H;  4QGU A;  5EPK A;  2O5I C;  4FXG C;  2KHI A;  3URY A;  3PO3 B;  2RF4 A;  3TS2 A;  1V1P A;  3JSN A;  4G7O C;  2BA1 A;  1I6H B;  1A9X A;  2MO0 A;  5C0X I;  4JI5 H;  2DY8 A;  3M4Y A;  4RA8 A;  1T36 A;  3U4V A;  3BZK A;  3WOE A;  4C3I B;  1B70 B;  2K32 A;  1V51 A;  4J1M A;  2F0V A;  4HED A;  2SNS A;  3ULL A;  1DV1 A;  4ZI7 F;  4E6I A;  1AH9 A;  3J80 W;  1SJE D;  1LV9 A;  3KF6 B;  4YJ3 F;  2DNE A;  4DXF A;  2ALZ A;  3PW5 A;  1M90 C;  2PQA B;  2Q2U A;  4LFC H;  5IT9 c;  3I4N H;  4GN3 B;  1ENA A;  3NEM A;  2XCL A;  3TP5 A;  3UFX B;  3OTO H;  4FO2 A;  2D5D A;  2AHO B;  3GQB A;  2SEB D;  1TWH A;  3LGJ A;  1E2V A;  1D5M C;  2K28 A;  3HOV B;  4OO1 H;  3TIG A;  3QG1 A;  3R2I A;  1TT2 A;  3FEW X;  3CPF A;  4C1N K;  4UP9 A;  1YIJ A;  4E4T A;  3RB3 A;  2FLL A;  1XNR H;  2BCO A;  1Y1V G;  3MXP A;  4NLG A;  3VYR A;  4LUO A;  2UUC H;  1AUX A;  3MFI A;  2B63 G;  1IBM L;  3HB9 A;  3RJ0 A;  1B6R A;  3RFC A;  4B3R H;  3F1Z A;  2E2J H;  1EYA A;  4UCO A;  3U50 C;  1DOM A;  3EIV A;  3J7A 5;  5DQG A;  4DV0 L;  2K05 A;  3T16 A;  4A3B H;  4C2M H;  3RN2 A;  2B63 B;  1BXT A;  1VQ6 A;  3PO2 G;  3A54 A;  3HXL A;  2EPB A;  5LYJ F;  5IP7 H;  3DLL A;  1CQJ B;  3K80 C;  5D1O A;  4B3T H;  3GTG H;  5L1I A;  4DUY H;  1WVL A;  1EYD A;  3RBD A;  2GVB A;  2A6H D;  3N43 B;  4IWY A;  1YJ9 A;  2I87 A;  3Q22 A;  4I7H A;  4IRD A;  2JE6 I;  3GTO A;  5KFN A;  4Q45 A;  2XTI A;  1ET9 A;  1PFN A;  2C5C A;  4DL2 A;  4A93 B;  1I3Q B;  5HUR A;  2YRW A;  2WAC A;  4C5B A;  3RV3 A;  1PX2 A;  2XGT A;  4KHP H;  1TWH B;  5IT9 W;  3S1R H;  3G6E A;  5T14 A;  3K81 C;  2D2C C;  1TVX A;  3F2B A;  4A93 G;  2RGR A;  4NXM H;  1YNJ D;  1D7Q A;  4JBJ A;  5J3B A;  1L1O C;  4KJN A;  1ET6 A;  2R92 H;  1X32 A;  2JEB I;  1CQF A;  4XYQ A;  4EGJ A;  5IGG A;  2VPS A;  2ZM6 Q;  1B9N A;  2XGP A;  1WJJ A;  1WH2 A;  2V5A A;  1J5E L;  3R5F A;  5C5L A;  3RV4 A;  3FRP B;  3J7A K;  2KQ3 A;  4IAJ A;  2JYO A;  4O0A A;  3G48 A;  5KFL A;  3TZU A;  1PMR A;  4DL7 A;  5LP6 F;  4UP8 A;  4JI4 L;  1SYX B;  3ERO A;  3WO0 A;  5CGK A;  4QWD A;  4O42 A;  1A2U A;  5GAD C;  1G6Z A;  1XNR L;  2VQE L;  1OXV A;  1PHJ A;  1HXY D;  5JOB A;  4OON A;  5JEA G;  4ZUI A;  4JI1 H;  4JI8 H;  4IUV A;  4A3K G;  4A3L H;  3ULJ A;  4ZKB B;  1SFO H;  4DUZ H;  1K83 A;  2R7L A;  5KYI A;  2F0E A;  2VA2 A;  3CCQ A;  1F9R A;  1HQR D;  1TS2 A;  1CM9 A;  1EFI D;  5DM6 3;  4FXD A;  1C30 A;  2JEJ A;  4P74 A;  4DXG A;  1TA8 A;  4QY7 A;  4X66 Q;  1XMQ Q;  1S0N A;  3UDG A;  4JI5 Q;  3BA8 A;  1XNQ H;  1A3T A;  2KED A;  2Z0S A;  1RTN A;  2F0H A;  3M9O B;  3GTL B;  5BN3 A;  4WOR A;  3AB9 A;  3VR5 A;  2QDB A;  2E5L L;  2R85 A;  3OHA A;  3A5U A;  4DR3 Q;  1K8A C;  1KNE A;  4JW0 A;  1I94 H;  4RNO A;  5IYB G;  2Q2I A;  1M0W A;  1V8Q A;  3GTJ B;  3T1H L;  1U4M A;  4YCU A;  3M4O B;  4L5T A;  1GGO A;  1K0R A;  3JC6 6;  5KNB A;  4KI0 A;  5EOY A;  1VQD A;  3A56 A;  4GKK L;  1TWG B;  4QL5 A;  2R6G A;  1FNW A;  4JBM A;  2WAQ A;  1R4Q B;  2PZW A;  2RVL A;  4GKJ L;  2LY7 A;  3D0F A;  4IPC A;  4PWQ A;  4JI1 L;  2BDN A;  2F3I A;  4YCW A;  1DZ1 A;  1VBH A;  3CQZ H;  2K52 A;  1DV2 A;  4FF1 A;  4KY7 A;  1MI2 A;  1N36 H;  4EGV A;  3M9M B;  4MNO A;  2JK8 A;  3NTH A;  4RKB A;  4IUP A;  3Q2O A;  4RUC A;  1X3F A;  1IBK Q;  4QIW E;  4DK1 A;  3PSI A;  1GKH A;  1AZQ A;  4FF4 A;  5KFR A;  1O7Z A;  4YWM A;  5CC4 A;  4PV1 C;  5C4J H;  2JA5 H;  1SFO A;  3TP7 A;  2NU9 B;  2GA4 B;  4XDX A;  2V1C C;  1VF5 C;  4EQP A;  3VMM A;  5IP9 G;  4A3I G;  3GTK B;  2DNC A;  2RCF A;  1WCM B;  4JK1 C;  3ZJY C;  3RIZ A;  2AU0 A;  4CGY B;  1JOR A;  1VQP A;  3FPU B;  3R8B A;  3Q0A A;  4KHP Q;  2V9W A;  4Y52 H;  4IPD A;  3G71 A;  4GZY C;  1VMP A;  2Z6B A;  2RBM A;  1HRJ A;  1WCM H;  4JI8 L;  2FB9 A;  1WTW A;  3HKZ G;  1XTC D;  5C44 G;  4A3J G;  4BBS H;  5IOD A;  2WB1 B;  2PW5 A;  2B2V A;  3PCO B;  5D3D A;  4KK7 A;  1TWF A;  2R7Z B;  2UXB H;  2GPS A;  1JKJ B;  2O4X A;  4DR5 L;  2KOL A;  1IBL Q;  2I0Q A;  1I6U A;  1QB5 D;  4GLX A;  4BY1 H;  4FF2 A;  2E2J B;  1N36 L;  2DPJ A;  1RHP A;  2L4N A;  2Z8L A;  3N52 A;  1LTS D;  1I50 B;  1HQM C;  2R7K A;  4DR1 Q;  4EYI B;  1K0S A;  4M1U B;  1HR0 Q;  4UPA A;  3OUU A;  3I4M H;  2CQY A;  3N41 B;  2NU7 B;  3N40 P;  1HHV A;  4QIW A;  4GLA C;  2VXW A;  4N9T A;  2QA4 A;  1HR0 W;  3GTK A;  5KFM A;  4ZRZ A;  2OEO A;  4CC5 A;  2BQ3 A;  2JA7 B;  4J9P A;  2VUM A;  3GTL H;  2F0Q A;  2RSO A;  1CKO A;  4B3M H;  2AWN A;  4IJL A;  1VQB A;  5FLM H;  4RHR A;  4O3R A;  1YNJ C;  1CKN B;  4M8A A;  5C3X A;  1RJQ A;  4I55 F;  5DLG A;  4RZQ A;  1IBL L;  2F0I A;  4IAL A;  1OWT A;  2M05 A;  2WB1 A;  3A74 A;  1N9W A;  2B3G A;  2MFI A;  4JOI A;  3KXY T;  5LMU H;  2IA6 A;  4JC0 A;  2NN6 I;  3S1Q H;  1S97 A;  3IN5 A;  4DL4 A;  3C46 A;  4J15 A;  4B3T L;  3BDL A;  2UU9 L;  1PA6 A;  1I94 Q;  4DR6 Q;  2AMC B;  1U4R A;  2YTV A;  4XZ3 B;  4C3H B;  1ESR A;  4HNT A;  4PZ6 A;  1ICW A;  1JJG A;  1QUQ A;  2JEI A;  1H95 A;  4PMW A;  1N32 Q;  2IHF A;  4H02 A;  4MIU A;  2OWO A;  5L1K A;  1HNW H;  3I4N G;  2TMP A;  1JT8 A;  2RQX A;  1SEI A;  4POG A;  5C0X G;  1M1K C;  1O7Y A;  5IWA L;  1PFM A;  3STB D;  3CKI B;  3KLR A;  1IOV A;  1HTP A;  2EYJ A;  2F0D A;  4JI2 Q;  3I4N B;  1HFG A;  3G4S A;  2VUM B;  5CYU A;  3P7J A;  1JJC B;  2BR0 A;  4DNR B;  3W1B A;  2K03 A;  4A3M G;  2IT1 A;  3PW2 A;  1EOT A;  2A19 A;  1FNU A;  5A2Q L;  2UXD H;  4ECZ A;  4F88 A;  2H1E A;  4OX9 Q;  4C3J G;  1WTO A;  4JV5 L;  2YZM A;  5KFW A;  4YQW A;  3GTP A;  3E5N A;  3PR5 B;  2KBN A;  4ZQ3 A;  4JV2 A;  3ICE A;  4GKJ Q;  1E1O A;  4C3J B;  3S15 H;  2IW3 A;  3FHW A;  3PO2 H;  4U6P A;  3V05 A;  1W96 A;  1GM5 A;  4L8J A;  5DG9 A;  4Q5V A;  1AE3 A;  4YR0 A;  3TBI B;  5T1G A;  2EIF A;  3L9A X;  2J0T D;  1AUV A;  4IZO A;  4GNX A;  1UAP A;  4LF8 H;  5KNC A;  1TWG H;  3PIO A;  2CW7 A;  2R8J A;  3PW7 A;  2XIW A;  2MNA A;  3HGB A;  1JOO A;  3KF8 A;  3NUC A;  2R92 B;  1IYU A;  3HKS A;  2SCU B;  3MWY W;  5H80 A;  4YWL A;  4DV6 L;  3KUP A;  4DFA A;  1STB A;  2B29 A;  2K5H A;  1LTB D;  1HNX Q;  2KA7 A;  4LFB Q;  2R92 G;  1E7Z A;  1VQ7 A;  4OEM B;  1BCP C;  5EBC A;  5BPF A;  5AJ3 Q;  1R4P B;  1VQJ A;  3QR8 A;  4XT3 B;  4DAY A;  1XTD A;  4RGT A;  3TZD A;  2UXC H;  1WR2 A;  2V59 A;  4LSX A;  3NBI A;  3ETJ A;  3W1G A;  1Z7T A;  4A3D H;  4GN4 B;  2ASJ A;  1N56 A;  4JI3 L;  3KYH C;  4MV1 A;  4MV8 A;  3MR5 A;  4PZ8 A;  5F9L A;  1Q3L A;  1KAB A;  1TS3 A;  2E2I A;  2ZJR A;  4BWS C;  2R8H A;  4HJA A;  1ZHS A;  2F0J A;  3T1Y L;  4LFB L;  5EKL A;  1BO0 A;  3TS0 A;  2UUA Q;  4B3S H;  3IFT A;  3V4Z A;  1LAB A;  5M3F G;  3R5X A;  1F9P A;  1TWF H;  1TII D;  2ZT9 C;  5KG0 A;  2NVX A;  4DV5 H;  4NDX A;  4DUY L;  2D62 A;  4R1J A;  3ETH A;  4CKC A;  2HT1 A;  3W2D A;  1FR3 A;  1BVS A;  2BOS A;  1STA A;  4OIK A;  4X3U A;  4A3K H;  3KF8 B;  3MAQ A;  1R9T H;  1JJ2 A;  4MTE A;  2R92 A;  1RCV D;  1QOH A;  5D8D A;  2PMZ A;  4XYO A;  4DUZ Q;  4P75 A;  3HKZ A;  3MHB A;  5KFO A;  1GHK A;  2L1B A;  1PH3 A;  2PVP A;  5EBD A;  2VR1 A;  2NN6 H;  4PMC A;  2JA6 H;  3TDQ A;  1XMO L;  3U4Z A;  2XSC A;  1II3 A;  4HJ5 A;  2QGQ A;  1BGW A;  3Q24 A;  2R3Z A;  4ED7 A;  1XDN A;  1JXL A;  2FIN B;  3CD6 A;  5IWA Q;  3BS1 A;  4A2B A;  4JI0 L;  1WSC A;  3S1N B;  1RL2 A;  1TWA B;  4I4T F;  3NQI A;  2IP4 A;  2J6U A;  2VOB A;  2B63 A;  2MJ8 A;  5HGQ A;  2OH2 A;  3H0G A;  1SYE A;  5L9X A;  5K36 H;  1Y1W B;  2RDH A;  2E74 C;  4R4Q A;  3NE5 B;  5D1O B;  3FKI H;  2IHE A;  1S3O A;  4GN5 A;  5CV5 A;  3RLN A;  4ZK9 B;  3NTK A;  3M4Q A;  1NUC A;  1Y1W G;  2MHV A;  1EHI A;  4LWC A;  2X69 A;  5C3W A;  1AFP A;  1YNX A;  4QWA A;  4HJ9 A;  5DQH A;  3FDT A;  2FJ2 A;  2ZXO A;  2YS7 A;  4LW1 A;  3T53 B;  1Y8O B;  1D6E C;  5CV8 A;  1LTI D;  1I4P A;  5M5Y H;  2OLS A;  5T1I A;  2HIV A;  4KKU A;  3GTM H;  1QG7 A;  5CV7 A;  3I4L A;  1PV4 A;  2NVT B;  1TWC A;  1EY4 A;  3KHG A;  3QB3 A;  4MTN A;  1H9M A;  5IYC G;  5KKN B;  1ZQ7 A;  1BOS A;  1S10 A;  4IFD G;  5CBE E;  2ZDQ A;  2NVQ B;  5JQW A;  1CHQ D;  1Z9F A;  2AQ1 B;  2NYZ D;  2B2V C;  4JYA L;  1DIK A;  2EVB A;  2A1A A;  4UY8 C;  2HVS A;  2R84 A;  2W8L A;  2V4D A;  3RZO H;  4PQX A;  5IP9 H;  3J80 i;  5IE8 A;  5JPM C;  1GUW A;  3Q8P B;  3N8D A;  5JVH 3;  3FP9 A;  3NEL A;  4U67 3;  1Y1W A;  2CHB D;  2NB0 A;  4YAJ B;  3BVG A;  1TS5 A;  3ERQ A;  3PV0 A;  3GTO B;  2E8G A;  3S2D H;  2A68 D;  4JI4 H;  3HBL A;  3UI2 A;  1ASZ A;  2OTL A;  1I3Q A;  2AUJ D;  4DGZ A;  1VQK A;  4DUZ L;  2VQF H;  4PNY A;  1L0X B;  4ZAI A;  3J81 L;  2DN8 A;  1KJJ A;  1A3V A;  2GPW A;  5LMN H;  1G91 A;  4KTA A;  3CHB D;  2IL8 A;  3CVZ A;  1GJX A;  2HVR A;  2W7P A;  1YHQ A;  2IMW P;  1M8A A;  4MZ9 A;  2C22 A;  1BCP D;  5ISR A;  5ELN A;  1MSH A;  3H3V C;  1RJR A;  1EZ8 A;  3L4J A;  1E4E B;  2DPI A;  1MBY A;  2P0A A;  2DWC A;  4UCU A;  2EXZ A;  5C8Y F;  1B8A A;  3TP8 A;  3GV5 B;  1Y8N B;  2YRX A;  4NXN H;  5IGF A;  4K0K H;  1D5X C;  4QWC A;  2B2W A;  1IL8 A;  1Z2P X;  1IYV A;  4DV1 H;  2MP1 A;  1NR2 A;  5I6W A;  3K58 A;  1UE5 A;  2C35 B;  1HPC A;  3MTS A;  1HNX L;  3Q23 A;  3CCS A;  4ZOL F;  1L0Y B;  4K8J A;  1EEI D;  5GAG C;  1T94 A;  5AFW A;  3A7L A;  4MV9 A;  3RZD B;  1BBX C;  2HHH H;  1UC8 A;  4L1K A;  1D1I A;  1YHA A;  1K83 B;  1SXT A;  2VW9 A;  5I6Y A;  2C9O A;  5JVG 3;  1S40 A;  4UFZ A;  4UP7 A;  4JV0 A;  4DK6 C;  2VB2 X;  2UUC L;  3M3Y B;  1WTH A;  2HJW A;  3KLS A;  4ED3 A;  3HOZ B;  5IIF A;  3U58 A;  2F52 A;  3ONA B;  1BCP B;  2D9U A;  2FHT A;  2K7V A;  1EUJ A;  1A8V A;  4DV2 L;  3M3Y H;  4Q0Y A;  1OXS C;  4JI6 H;  5EWF A;  4K0K L;  3STB C;  3HOZ G;  5LL6 S;  5CV6 A;  4R4C A;  1SFO B;  1KQS A;  5EPJ A;  3OUZ A;  1WD0 A;  3PGZ A;  4LF8 L;  4J9K A;  3SI8 A;  2A73 B;  4ECR A;  4POF A;  4A3L G;  2YW2 A;  2R87 A;  3NQT A;  5IYZ F;  3VYT A;  5FJ8 G;  1FJG Q;  2F3V A;  1EY8 A;  2EDG A;  1E22 A;  4A3K B;  2R93 A;  3DWA A;  2FMM A;  3HOX G;  2LMC B;  1Q1B A;  4G7Z C;  4JI2 L;  4F50 A;  3JZI A;  2UXD Q;  5FLX c;  4A76 A;  3MZ5 A;  3HOV G;  2YTY A;  3K0Y A;  5KX5 F;  2NUA B;  2JEF A;  3NXW A;  2VB3 X;  2H4O A;  1E24 A;  1PTO F;  3BAB A;  5KT4 A;  1EQR A;  3KTM A;  3J7A V;  4K6L A;  2EYM A;  3H94 A;  2ZJP A;  4JI0 Q;  3L3O C;  5CA0 F;  1XNR Q;  5IYB H;  1G2S A;  4EQ5 A;  1N32 L;  2K4K A;  5EGT A;  2AGQ A;  1BNC A;  3GV7 B;  2NTS A;  4JOI C;  1LT5 D;  2YCH A;  3WO1 A;  4CDD C;  1N48 A;  1I50 A;  5EWG A;  2K5N A;  4RHS A;  1VDZ A;  5C4X H;  4O4L F;  3GTJ H;  3EQL C; 
#chains in the Genus database with same CATH homology
 4DR3 Q;  1K8A C;  3UDI A;  3TRZ A;  4JI4 Q;  4OXP A;  5IYB G;  4LF7 L;  5BR8 L;  2Q2I A;  4LF8 Q;  4LFC Q;  5M3M G;  2KHJ A;  2I5M X;  2NZH A;  3CCR A;  3T1H L;  3B6Y A;  4YCU A;  2GVA A;  1PVO A;  3A5Z B;  4L5T A;  2WP8 J;  2JA7 G;  1K0R A;  1U5K A;  3JC6 6;  4KI0 A;  1X3E A;  1VQD A;  1VQA A;  3MXN B;  4TVA B;  4DKA C;  4QL5 A;  2ZM6 L;  4GKK L;  4WJ3 M;  3KFU A;  4DV4 L;  2NVY H;  2R6G A;  5BR8 Q;  4JBM A;  1I3Q H;  2E2H H;  1VQF A;  4GKJ L;  3D0F A;  4IPC A;  3GTP H;  4JI1 L;  2F3I A;  4OX9 L;  4JV5 Q;  4QJF A;  1CKN A;  4BXX H;  4YCW A;  2UUC Q;  3CQZ H;  2K52 A;  1Q7Y C;  3F2D A;  1K83 H;  4LF4 Q;  1SLJ A;  4AYB G;  3S24 A;  2UXC L;  4MNO A;  2JK8 A;  1I6H H;  4XTC S;  2DGY A;  1VQ9 A;  1XNQ Q;  3I55 A;  1QVG A;  1MIU A;  1EIF A;  1X3F A;  4YY3 Q;  2BA0 A;  1IBK Q;  1N33 Q;  4QIW E;  5C3E G;  3CCU A;  3PSI A;  2D0O A;  1GKH A;  4DAM A;  1PH5 A;  1VQC A;  1K8G A;  1A62 A;  3PUZ A;  1QVC A;  4DV3 L;  4YWM A;  5C4J H;  3OW2 A;  2JA5 H;  5M3F H;  3GTO H;  1CKM A;  1WCM G;  4GOP C;  4X65 L;  2N78 A;  4LF9 L;  2V1C C;  1Y14 B;  3A0J A;  5IP9 G;  4A3I G;  1X6O A;  1KL9 A;  2YV5 A;  3ZJY C;  5C3E H;  1N34 Q;  2Y0S E;  2VZA A;  1VQ5 A;  1VQP A;  4KHP Q;  1SR3 A;  4RMF A;  1P8L A;  2RCN A;  4IPD A;  3G71 A;  1VQ4 A;  1IBM Q;  4LUV A;  2VUM G;  4Y52 H;  4NXM Q;  1A0I A;  1WCM H;  4JI8 L;  4X64 L;  4HID A;  2AWO A;  3CXC A;  3HKZ G;  3M9B A;  3OTO Q;  2NN6 G;  5C44 G;  3L2P A;  3AFP A;  4BBR H;  4A3J G;  4BBS H;  1VQL A;  1EQQ A;  3CP0 A;  4KHZ A;  1PH9 A;  4KHP L;  3ER0 A;  3GDE A;  3KLW A;  4A3I H;  1EIY B;  3PCO B;  1HNZ L;  3I4M G;  4WJ4 A;  4DR5 L;  3UE0 A;  3NEN A;  1IBL Q;  2I0Q A;  4LF5 L;  1HZB A;  2HIX A;  3GO5 A;  4DV5 L;  2VUM H;  4GLX A;  4BY1 H;  1Y1V H;  1EYG A;  4NB3 A;  1N36 L;  3PF4 A;  1Q46 A;  3S14 H;  4A75 A;  1Q82 C;  1U0L A;  2R7F A;  1MJC A;  5C44 H;  4P72 A;  3TRE A;  4BBR G;  3KJO A;  4DR1 Q;  4A3J H;  1KC8 C;  4B3S L;  4BBS G;  1TWA H;  1HR0 Q;  2L15 A;  4TQU S;  5ELO A;  4UPA A;  4IFD I;  2K50 A;  3I4M H;  3ULP A;  4A3F G;  1VQM A;  3RR5 A;  1NY4 A;  1YJW A;  4A3B G;  1KAW A;  5LMN W;  1CSQ A;  1N8R C;  1Y1W H;  1YVC A;  1GVP A;  1Q81 C;  3AQQ A;  1DGS A;  2UU9 Q;  4GLA C;  1T9H A;  2LSS A;  5IP7 G;  4IO9 A;  1VS0 A;  2QA4 A;  1HR0 W;  4LF4 L;  3UDF A;  1JMC A;  1PH6 A;  2JA8 H;  1PYS B;  4DPG A;  2PMZ E;  1OXU A;  2QEX A;  3HKZ E;  1IYJ B;  3GTL H;  1W2B A;  1KXL A;  3GD7 A;  1CKO A;  4NXM L;  2AWN A;  3J81 i;  4IJL A;  1VQB A;  4FDB A;  5FLM H;  3D31 A;  4YCV A;  3HOU H;  4L5Q A;  4LFA L;  1CKN B;  3AFQ A;  5IYC H;  4GKK Q;  2H5X A;  1N34 L;  1IBL L;  1XNQ L;  3CC7 A;  4QQB X;  1XMO Q;  1SN8 A;  1N9W A;  2RHS B;  1VCI A;  2B3G A;  2MFI A;  3A74 A;  4JOI A;  2JA8 G;  1NTG A;  1YBY A;  4LFC L;  4DAY B;  4LF6 L;  1V9P A;  4JC0 A;  1WYD A;  1JB7 A;  2NN6 I;  3S1Q H;  4IOA A;  3M4P A;  1PH8 A;  1N36 Q;  1X55 A;  1TWH H;  3T1Y Q;  4J15 A;  4B3T L;  3H15 A;  4DR3 L;  2UU9 L;  3HOU G;  4GOP B;  1PA6 A;  1I94 Q;  4DR6 Q;  4IFD J;  2AMC B;  2YTV A;  4L5S A;  1E1T A;  1CUK A;  3BZC A;  5JJI A;  4PZ6 A;  1JJG A;  1QUQ A;  3E9H A;  1H95 A;  4YHH Q;  4PMW A;  4C3I H;  5JJL A;  1N32 Q;  2IHF A;  2VY3 A;  4H02 A;  4GNX B;  1S72 A;  1XPU A;  2OWO A;  2ZTE A;  3W5O A;  2E2I H;  3I4N G;  2BH8 A;  5AJ3 L;  3UDX A;  1JT8 A;  2KCT A;  3ERS X;  4LF7 Q;  4POG A;  5C0X G;  2VQF Q;  1M1K C;  5IWA L;  2Q2H A;  3CCE A;  2I5L X;  3STB D;  3CCM A;  4GNX C;  1HZC A;  1C9O A;  5JEA J;  4DR4 L;  1UE6 A;  4JI2 Q;  1GO3 E;  4AIM A;  3G4S A;  3JAM c;  2Y0S G;  1JJC B;  3W1B A;  3CCJ A;  1UE7 A;  4X66 L;  4A3M G;  2IT1 A;  2ASB A;  2A19 A;  3HOY H;  1NBW A;  1OXT A;  2WAQ E;  2HQL A;  4A3G H;  4JI1 Q;  4OX9 Q;  2OCE A;  4JI8 Q;  3K7U C;  4JV5 L;  1B7Y B;  1OXX K;  1PYB A;  3CCV A;  2R7Z H;  2LXK A;  4B3R Q;  1PH7 A;  2Z6K A;  2IX0 A;  1WOC A;  4IJH A;  4KLK A;  4DV4 Q;  1LTL A;  2KBN A;  2JEA I;  3S16 H;  3M85 A;  3S17 H;  4A3C H;  1HNW L;  3ICE A;  4GKJ Q;  1E1O A;  3H0G G;  3S15 H;  1HH2 P;  3FHW A;  3PO2 H;  2UXC Q;  5E7N A;  1VQE A;  1GM5 A;  2HHH L;  1AE3 A;  1LM0 A;  3PUW A;  2NVX H;  4A3M H;  2R7D A;  4GOP A;  4HJ7 A;  4DR2 L;  1PFS A;  3J7Z C;  5C0X J;  2BH2 A;  4C3J H;  2OTJ A;  1TWC H;  5JJK A;  1XPR A;  4HJ8 A;  3CW2 C;  2EIF A;  1YEZ A;  2K5V A;  5GAE C;  1FGU A;  1QUQ B;  1Z47 A;  1AE2 A;  4DV7 Q;  1SMX A;  1NMF A;  4JCV E;  4GNX A;  2K14 A;  2UUA L;  3H0G H;  1OTC A;  1G6P A;  3PUX A;  5LMU L;  1X56 A;  2ZTD A;  4IPH A;  1SE8 A;  1TWG H;  3PIO A;  4DR7 L;  2MNA A;  4AQY L;  1XPO A;  4AH6 A;  4A4I A;  1SRO A;  5HY6 A;  4BA1 I;  3PO3 H;  2RHQ B;  3HKS A;  2HHH Q;  2F4V Q;  4YWL A;  4DV6 L;  2UUB Q;  4NXN L;  2UXB Q;  2K5H A;  2B29 A;  1P16 A;  3NBH B;  1HNX Q;  4LFB Q;  2R92 G;  1E7Z A;  1YHB A;  1VQ7 A;  2E5L Q;  2PNH A;  1CSP A;  3DM3 A;  4R4O A;  2IY5 B;  1QVF A;  5AJ3 Q;  1GD7 A;  1VQJ A;  2GN5 A;  1YI2 A;  1EOV A;  1BBU A;  3RNU A;  4YY3 L;  3RZD H;  1XTD A;  2PI2 E;  3PO3 G;  3UE1 A;  3EN2 A;  3HOZ H;  4JI6 Q;  1UWV A;  1C0A A;  3T1H Q;  3CPW A;  3W1G A;  4A3D H;  4GN4 B;  4JI3 L;  3KYH C;  4PZ8 A;  2FXQ A;  1G29 1;  1KD1 C;  4DR7 Q;  2ZJR A;  4X62 L;  2WFW A;  3IRB A;  4HJA A;  3T1Y L;  4LFB L;  4X62 Q;  4C3H H;  3TS0 A;  2UUA Q;  1LUZ A;  2VQF L;  1FVI A;  2Z6K C;  2JA5 G;  1BKB A;  5M3F G;  3CME A;  1TWF H;  3KDF B;  1J6Q A;  2JJQ A;  3F8T A;  4DV7 L;  2Q2T A;  4K0K Q;  1K3R A;  3CAM A;  4DUY L;  2D62 A;  4DV1 L;  4B3M Q;  1XMQ L;  1FJG L;  2JA6 G;  4R1J A;  4BA2 I;  4YWK A;  3CMA A;  4DUY Q;  4DV1 Q;  4DR2 Q;  2HT1 A;  4A3D G;  3H3V I;  1BVS A;  2N3S A;  2N49 A;  3J81 j;  4OO1 I;  4DV2 Q;  4IOC A;  1VQG A;  1LYL A;  3HOV H;  5IYD G;  1JJ2 A;  1KRT A;  1EWI A;  3KF8 B;  4A3K H;  1R9T H;  4BY7 G;  1I94 L;  2ID0 A;  4JBK A;  2JQO A;  4DUZ Q;  4P75 A;  2JA9 A;  1NE3 A;  3TEH B;  4HIO A;  3I56 A;  1PH3 A;  1L2F A;  1Q8K A;  3AYH B;  2JA6 H;  3PIP A;  2YTX A;  1VQ8 A;  1XMO L;  3U4Z A;  4JBW A;  2AKW B;  4Y7N H;  4HJ5 A;  4R4T A;  2I5H A;  2QGQ A;  4DR4 Q;  5M5W H;  1L1O B;  1I50 H;  5C4X G;  3CD6 A;  5IWA Q;  3BJU A;  4P73 A;  4JI0 L;  4PZ7 A;  1YJN A;  1RL2 A;  4BY1 G;  5H1S E;  4JI7 L;  1HZA A;  3HOW H;  3M4O H;  2CWA A;  4DR6 L;  4B3T Q;  4DR1 L;  1UEB A;  5HGQ A;  3K8A A;  4DV6 Q;  2VQE Q;  2PI2 A;  1V43 A;  1K73 C;  1MKH A;  2N8N A;  4R4Q A;  1J5E Q;  4DV5 Q;  3FKI H;  2IHE A;  1S3O A;  4GN5 A;  3BU2 A;  3RLN A;  1HJP A;  5GQO A;  1L0W A;  1YIT A;  2EXD A;  3AEV A;  3L7Z C;  3M4Q A;  1SRU A;  2D0P A;  5GRO A;  1Y1W G;  5GAH C;  1KRS A;  3HOW G;  3EBE A;  4LWC A;  3E9I A;  1TXY A;  1YNX A;  3KJP A;  4BXX G;  5K36 G;  4HJ9 A;  4XIG S;  3CCL A;  2ATW A;  3CC2 A;  4LW1 A;  3FKI G;  1C7Y A;  4LF6 Q;  2ZJQ A;  2NZO A;  3S2H H;  1VQI A;  5M5Y H;  3E0E A;  5FLM G;  2HIV A;  3K0X A;  2YU9 H;  1PV4 A;  1VQN A;  3GTM H;  4IPG A;  4X6A H;  2ZTC A;  4MTN A;  5IYC G;  4LUZ A;  4DV0 Q;  1Q1E A;  4IFD G;  1VQH A;  5M5X H;  4QGU A;  1Z9F A;  2KHI A;  4JYA L;  2RF4 A;  1A63 A;  4ME3 A;  2A1A A;  3TS2 A;  2BA1 A;  3J80 c;  4UY8 C;  2MO0 A;  3RZO H;  5C0X I;  4YHH L;  3U4V A;  3BZK A;  5IP9 H;  1B70 B;  3J80 i;  4LFA Q;  5IE8 A;  2KEN A;  3WWV A;  2VS1 A;  4DR5 Q;  3FP9 A;  3ULL A;  3NEL A;  1VQO A;  3KDF A;  1RIP A;  4GS3 A;  1AH9 A;  4B3S Q;  3PV0 A;  3KF6 B;  3S2D H;  2E8G A;  2R93 H;  1HZ9 A;  3S1M H;  4X65 Q;  1ASZ A;  2OTL A;  3I4O A;  3PUY A;  2PQA B;  1M90 C;  1HR0 L;  5IT9 c;  2Q2U A;  2IX1 A;  1VQK A;  4GN3 B;  4DUZ L;  4LNQ A;  3NEM A;  1FL0 A;  3I4N H;  2NVQ H;  1KHI A;  2AHO B;  4LF5 Q;  2OQK A;  3MEF A;  3LGJ A;  3H3V H;  4GLV B;  3KOJ A;  2DUD A;  3CPF A;  1YIJ A;  4UP9 A;  1YHQ A;  4MZ9 A;  3CF5 A;  2R93 G;  3M7N A;  1Y1V G;  4B3M L;  1PH4 A;  3CC4 A;  4LUO A;  5ELN A;  3RN5 A;  1Q12 A;  3L0O A;  4JYA Q;  2MQH A;  1WI5 A;  2B63 G;  1IBM L;  2YYZ A;  1L1O A;  3VDY A;  3F1Z A;  1X3G A;  2E2J H;  1WFQ A;  1ASY A;  4OO1 G;  4X64 Q;  3U50 C;  3EIV A;  1D8L A;  2CCZ A;  1B8A A;  2CKZ B;  4A3F H;  3J7A 5;  4JG2 A;  4DV0 L;  4A3B H;  4C2M H;  3RN2 A;  4LF9 Q;  1VQ6 A;  3PO2 G;  3HFZ B;  1IBK L;  4ALP A;  1N33 L;  4JI6 L;  4L5R C;  3SGI A;  4A3E H;  5IP7 H;  1KIX A;  3DLL A;  3K80 C;  3OTO L;  3GTG H;  2B63 H;  2GVB A;  2WAQ G;  1NJI C;  1PH2 A;  1UE5 A;  1YJ9 A;  2JE6 I;  2C35 B;  2XTI A;  3TQY A;  4AYB E;  1IZ6 A;  4DK3 C;  3S1N H;  1HNX L;  2PQA A;  3CCS A;  2UXB L;  1QZH A;  1HNZ Q;  2XGT A;  5GAG C;  4HIK A;  4A3E G;  2KCM A;  4JI5 L;  3JAM i;  3S1R H;  3G6E A;  3K81 C;  1YHA A;  2ALY B;  3RLF A;  3F2B A;  4A93 G;  1D7Q A;  2VW9 A;  3OYY A;  4JBJ A;  1BBW A;  5LMU Q;  1G51 A;  1PH1 A;  1E3P A;  1NMG A;  5J3B A;  1L1O C;  1I5F A;  1S40 A;  2OQ0 A;  4NPS A;  4UP7 A;  4DK6 C;  2R92 H;  1Q86 C;  2JEB I;  4O2D A;  2UUC L;  1QZG A;  3U58 A;  3Q8D A;  2K75 A;  2EQS A;  2F52 A;  2ZM6 Q;  1XJV A;  3F2C A;  2UXD L;  4NXN Q;  1WJJ A;  5FJ8 H;  1EUJ A;  1A8V A;  4DV2 L;  3M3Y H;  4A93 H;  1OXS C;  1J5E L;  5EAY A;  2MO1 A;  3STB C;  3HOZ G;  4K0K L;  1X65 A;  4PG3 A;  2ES2 A;  1O7I A;  1EFW A;  4R4C A;  1KQS A;  3HOX H;  2VNU D;  2A8V A;  1HNW Q;  3RLO A;  2NVT H;  3I7F A;  4O0A A;  3PGZ A;  4OWX B;  4DV3 Q;  4LF8 L;  1X54 A;  3G48 A;  4HIM A;  4DNI A;  4B3R L;  2CWP A;  4POF A;  4UP8 A;  3KF6 A;  4JI3 Q;  4JI4 L;  1V1Q A;  4A3L G;  2CQO A;  5IY0 A;  1X9N A;  5FJ8 G;  3PUV A;  4EX5 A;  1FJG Q;  2F4V L;  1E22 A;  5GAD C;  1K9M C;  1XNR L;  3HOX G;  2VQE L;  3HOY G;  2WB1 E;  1OXV A;  1Q1B A;  1PHJ A;  4JI2 L;  4A3G G;  3J81 c;  4OON A;  5JEA G;  5DLQ E;  5FLX c;  2WB1 G;  4A76 A;  3GTK H;  5LMN L;  3HOV G;  2YTY A;  2UXD Q;  5IYD H;  4A3K G;  4BY7 H;  2R7Z G;  5LMN Q;  1E24 A;  4A3L H;  1UE1 A;  1YZ6 A;  3ULJ A;  2LXJ A;  4R4I A;  1EQR A;  1SFO H;  4JI7 Q;  4A3C G;  4RG1 A;  2ZJP A;  4OWW B;  4JI0 Q;  3CCQ A;  2VL6 A;  4P71 A;  1JE5 A;  5IYB H;  1XNR Q;  3GTQ H;  4EQ5 A;  4APV A;  1N32 L;  4P74 A;  2K4K A;  5M3M H;  3PF5 A;  4QY7 A;  4AQY Q;  4X66 Q;  1XMQ Q;  2UUB L;  4JOI C;  1W3S A;  3UDG A;  4JI5 Q;  3I2Z A;  2Z0S A;  3K7A H;  2K5N A;  1IXR A;  2CFM A;  2JA7 H;  4OWT B;  1MJE A;  5C4X H;  2E5L L;  3GTJ H;  1IL2 A;  3A5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...