3H0GG

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
170
structure length
170
Chain Sequence
FFLKELSLTISLHPSYFGPRMQDYLKAKLLADVEGTCSGQYGYIICVLDSNTIDIDKGRVVPGQGFAEFEVKYRAVLWRPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNYSGEDQVIEKGSNVRLKIVGTRTDATEIFAIATMKEDYLGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit rpb1
total genus 26
structure length 170
sequence length 170
chains with identical sequence S
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h0gG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3h0gG01
3NENA 2UU9L 1XMQL 1VQMA 3GTLH 3HKZE 4A3DG 4DUZL 1N32L 2HIVA 2VQFQ 4A76A 3U4ZA 1PH3A 1Q86C 2AWOA 4HJAA 4LF4L 4GKKL 1VQ8A 4PZ8A 4DV5L 1XNRL 1VQNA 3UDXA 1VQEA 5E7NA 1K73C 1I6HH 3CPFA 1OXVA 2NVYH 2N3SA 4DAYB 2OQKA 4LF6L 1WOCA 1KIXA 1HZ9A 3K0XA 3PO2H 4IJLA 2PI2E 2I5LX 3PIPA 1D8LA 3FKIG 3CP0A 3CCUA 4GNXA 4BY1H 3S17H 1TWFH 1VQIA 4DR3Q 1M90C 4B3TL 2ZM6Q 3UE0A 4IPDA 4LF8L 2A1AA 1V9PA 2D62A 4NPSA 4XIGS 5GAGC 4GNXB 2WB1E 2CCZA 4L5SA 3H3VH 4A3DH 1E24A 1KL9A 4DUYL 3PIOA 2ZM6L 2F3IA 5GAEC 4OWXB 2UU9Q 1JE5A 1CKMA 2UXBL 1Y14B 4RMFA 1YZ6A 4DR2Q 1PH7A 4A3KH 1SFOH 5K36G 4DV3Q 4GOPC 4AQYL 1ASZA 1Q7YC 1PH8A 1FJGL 1CUKA 1MJCA 2ZJRA 2HQLA 1GKHA 2AKWB 3ERSX 2Z6KA 2L15A 2Z0SA 1IYJB 3A74A 4ME3A 3RN5A 4JI0Q 3PV0A 4P73A 3TREA 1Q1EA 4DPGA 4BA1I 1HNXL 2E2HH 2YYZA 4DR7Q 5JJKA 2PMZE 3TS2A 3PCOB 1PV4A 5IP9G 1PA6A 1HNWQ 2K5NA 1PFSA 3PUXA 3J80c 4OWWB 1SMXA 3OTOL 1YI2A 1VQAA 2VY3A 1Q82C 3RLNA 2UUCL 4KHPQ 3S14H 3CCQA 2Q2IA 3GTQH 2WP8J 4JI3Q 3RZOH 4QY7A 1WI5A 1VQ7A 2UXCL 4JI2Q 2UUAQ 2D0PA 1OXXK 3FKIH 3RR5A 3A5UA 4DV1Q 4JOIA 1PH6A 1TWAH 2UXBQ 4GLAC 5JEAJ 3HOXH 1PH4A 3TS0A 4GKJL 4X64L 1NY4A 1CSPA 3FHWA 3M4QA 5EAYA 3PF5A 3BZKA 3CCJA 2UUAL 4JI2L 2JA7G 2ASBA 2LSSA 2RF4A 4BBSH 3Q8DA 3J7A5 3ZJYC 1UE1A 2QEXA 2H5XA 5FLXc 4JI0L 4POGA 1XNQQ 3T1HQ 1EUJA 1V43A 4A3EG 1VQGA 2KCMA 1IBLQ 5M3MH 5M3FG 1XMOQ 1HNZL 2OTLA 4DR5Q 1VQCA 3M4OH 5IYDG 1BKBA 1GD7A 2BH2A 1MIUA 3KF6A 1KHIA 5IYCG 3PUVA 5C0XG 4XTCS 4DK3C 1UWVA 3MXNB 3E9HA 4DR6Q 2K50A 1U0LA 4HIDA 2I5MX 4OX9Q 4JI4L 2R7ZH 1IBKQ 4B3ML 4A3IH 3H0GG 3I4OA 5IP7H 4HJ5A 1SROA 4LW1A 3HFZB 3PGZA 4R4CA 3E0EA 5IT9c 1PYBA 3F2CA 1MJEA 1VQDA 2Q2TA 1YJWA 1I94Q 3ULPA 2NZOA 2F52A 2HIXA 3HOUG 4GN4B 3W1BA 4QIWE 3S2HH 3WWVA 4JI8Q 1QUQA 4KLKA 4R4QA 4C2MH 3NEMA 4EQ5A 1N36L 3GTGH 1HR0W 1EOVA 1N33Q 1FGUA 4A3CH 3PO3G 2K5VA 4A3LH 4DV7Q 4R1JA 3AEVA 3BU2A 3EIVA 2RHQB 4LFAQ 4POFA 1N36Q 4JI1Q 4LNQA 5BR8Q 4OO1I 1VQJA 1JJ2A 2UXDQ 2ZTEA 3CMAA 3CCSA 1SRUA 4JI6L 3M7NA 2WAQG 4A3LG 2R6GA 4A3FG 4HJ8A 2K14A 3DM3A 1VQ4A 4A3EH 4DV5Q 1M1KC 4TQUS 3I7FA 3W1GA 1EIYB 2I0QA 4JV5L 1HNWL 4IPCA 1N9WA 4DV4Q 4X62Q 2VQEL 4HIMA 1A0IA 5HGQA 3CW2C 1SE8A 1N34Q 4R4IA 1IXRA 2C35B 1VQFA 1JT8A 4IPHA 2AHOB 5IYBG 1E3PA 4GOPB 5C3EG 3UDFA 4JI7Q 1YHQA 2ID0A 4JBJA 1Y1VH 5C44H 1EFWA 5IP7G 1N34L 3K7AH 3CCLA 4LF5Q 4C3HH 1YEZA 4YHHQ 4DV7L 3CCMA 1Y1WG 1XJVA 3HOWH 4JC0A 4NXNL 4WJ4A 1A62A 4JI1L 3STBD 1YHBA 4IJHA 4DV2Q 4GLXA 3CAMA 1OXSC 4DV3L 1X3EA 1VQOA 5GROA 5H1SE 2PI2A 3F2DA 4FDBA 4A3JG 1NBWA 1LUZA 4B3SQ 3S15H 4BY7H 5C4XG 3AYHB 1J5EQ 4OXPA 4A3IG 2NZHA 4PZ7A 3KFUA 5IY0A 4DNIA 2JEAI 4DV2L 1YVCA 4GOPA 1BBUA 4YCWA 2BA1A 4LUOA 3CCEA 1EWIA 1A63A 3EN2A 4DV6Q 2JK8A 4PZ6A 3FP9A 2OTJA 1L2FA 5IYDH 2D0OA 3S24A 1XPOA 1MKHA 4GN5A 1QVFA 4LF9Q 3H3VI 4LUVA 4OWTB 1JJGA 4LF6Q 4LF5L 2UUBQ 3KDFA 3M4PA 1B8AA 4LFCL 4YHHL 2Q2UA 1D7QA 5ELNA 2I5HA 4C3IH 3KF8B 2JA6H 4A3GH 5C4JH 5C0XI 4GS3A 4BY7G 3J81c 2B3GA 4MNOA 2PQAA 5LMNQ 3HOVH 3PF4A 1NMFA 2E8GA 2K4KA 3ICEA 4GKJQ 1VQHA 3AFQA 1J6QA 1HZAA 2DUDA 2EQSA 1E22A 2YV5A 1Q1BA 3RZDH 1IBMQ 2JA5G 4B3SL 1L1OA 4LF7L 4APVA 3GTOH 4A3BH 4QQBX 3HKZG 1VQ9A 3T1YQ 4PG3A 3GDEA 2EIFA 4JI5L 4BA2I 1XPRA 2BA0A 1BVSA 3E9IA 4EX5A 1IL2A 2V1CC 3EBEA 4OONA 1YJNA 4DR6L 2OCEA 3UDGA 3T1YL 4YCUA 4NXML 1XMQQ 2UUBL 1X54A 3LGJA 3PUZA 4DUZQ 2MO0A 3KJPA 2NVTH 1NMGA 1Y1WH 2VL6A 3CCVA 1L0WA 4J15A 3GTJH 4P71A 3KLWA 5GADC 4A3BG 1E7ZA 3A0JA 1L1OB 2LXJA 4A75A 3VDYA 1R9TH 2UXCQ 3F1ZA 4JI8L 3I4MH 1KQSA 5IYBH 2R7ZG 1PHJA 1HZBA 1Z47A 4AYBG 2VUMH 2VZAA 1Q46A 3J80i 3CMEA 3BZCA 2BH8A 3S1RH 1Q81C 2HT1A 4JYAL 4TVAB 2K75A 1EQQA 1TWHH 3UE1A 5LMUL 1K8AC 4P75A 4DUYQ 1XNQL 2JA9A 1AH9A 1PVOA 4L5TA 4X65L 5M3FH 1E1OA 3I56A 1VQBA 2N8NA 5IWAQ 1SN8A 4DR2L 1K3RA 4BBRG 4GN3B 3J7ZC 5LMUQ 2ZTCA 4DV0Q 1I5FA 4C3JH 4A3GG 3PO3H 1B7YB 1FJGQ 1WJJA 1VQ5A 2R92G 4NB3A 3S1QH 4GKKQ 3M9BA 1OXUA 3GTPH 5IE8A 4H02A 1CKNA 1K8GA 2WFWA 4LFCQ 2VUMG 2VQFL 2CWAA 2RHSB 5FJ8G 4A3MH 4QL5A 2KBNA 1ASYA 4JI7L 2NVXH 1C9OA 1V1QA 3OTOQ 3G4SA 4BXXH 3L2PA 1W3SA 1QVGA 2UUCQ 4KHPL 1CKNB 2MO1A 5M3MG 3L7ZC 4JBKA 5DLQE 1QZHA 3S16H 3KYHC 3HOYH 3CC7A 1JB7A 2YTVA 3RLOA 1G51A 1HR0Q 4NXNQ 4B3RL 3HOZG 1CSQA 2ATWA 2JA6G 4L5RC 4A3CG 2JEBI 3GD7A 2JJQA 1C7YA 1KRSA 4YWLA 4DR4Q 1EIFA 2WB1G 5LMNW 3MEFA 3A5ZB 3D31A 1VCIA 5C3EH 4DR1Q 3OW2A 2OWOA 3HOVG 4B3RQ 3HKSA 4IFDG 4X64Q 5BR8L 1E1TA 4JOIC 4A3MG 1HZCA 2PQAB 2MFIA 3W5OA 4PMWA 3IRBA 3F8TA 1WFQA 1S40A 4RG1A 3ER0A 3CF5A 1TXYA 4AQYQ 1W2BA 1I50H 1UE6A 3G71A 4WJ3M 5JJLA 1WCMG 4A3KG 3GO5A 1N8RC 2R7FA 5C0XJ 3U58A 4DV4L 4YWKA 1HNZQ 1TWGH 1N32Q 4HJ9A 1GM5A 4DR7L 1LM0A 1KAWA 1LTLA 1GVPA 1YNXA 3KDFB 4P74A 1XNRQ 1BBWA 4K0KQ 4JCVE 4DKAC 3JAMc 4UPAA 1K9MC 2ZJQA 2JA8H 5FLMH 5FJ8H 3PUYA 2IX1A 1GO3E 4YCVA 2AMCB 1P16A 1QUQB 1X56A 2GVAA 1K83H 2CFMA 1PYSB 2ES2A 1TWCH 2NN6G 4O0AA 3KOJA 4QGUA 3CCRA 4JI3L 4JBMA 4BBRH 2HHHQ 2CKZB 3RLFA 1AE2A 3STBC 1AE3A 1T9HA 3U50C 2E2JH 3M3YH 1VQLA 4LF8Q 1OTCA 2N78A 1IZ6A 2A19A 1L1OC 4JBWA 4Y7NH 2R92H 2YU9H 1FVIA 2ALYB 4OO1G 2GVBA 2Y0SG 2E2IH 2JA8G 4HIKA 4HJ7A 4X66L 1X65A 2LXKA 1XMOL 2NVQH 1K0RA 4UP7A 4YY3Q 4LWCA 3T1HL 2GN5A 1O7IA 5GQOA 2IHFA 2VW9A 2JA5H 2RCNA 4JI6Q 2K52A 2CQOA 3TQYA 2QGQA 4X62L 1WCMH 2JE6I 2VQEQ 4LFBQ 1SR3A 3AFPA 4BY1G 4KI0A 1JMCA 4IPGA 1IBKL 4YY3L 4JYAQ 3KF6B 3PUWA 5C4XH 1HJPA 1PH9A 2N49A 3CPWA 3OYYA 1Y1VG 1HR0L 4LF4Q 3I4NH 4R4OA 1YHAA 2HHHL 5IP9H 2VS1A 3H15A 5LMNL 4BXXG 1DGSA 2EXDA 2F4VQ 2AWNA 4UY8C 4AYBE 3HOWG 3S2DH 1I94L 2VNUD 2YTXA 2CWPA 4DV1L 4P72A 4GLVB 2R93H 1LYLA 2Y0SE 3NELA 4L5QA 4X65Q 4IOAA 3ULLA 1C0AA 3CXCA 3HOXG 1A8VA 2IT1A 2IX0A 2PNHA 1OXTA 4AIMA 3J81j 1QZGA 1VQ6A 4DV0L 4ALPA 1HH2P 3JC66 1PH1A 4LFBL 3TRZA 2NN6I 2QA4A 2Z6KC 1EQRA 4GNXC 3S1MH 1IBLL 4DAMA 1QVCA 5GAHC 2E5LQ 1NTGA 4JV5Q 2KHJA 4UP9A 3U4VA 4JG2A 1KRTA 1PH5A 1PH2A 5M5YH 1X3GA 2MNAA 1B70B 2IHEA 2KCTA 1NE3A 5IYCH 3K7UC 4HIOA 2K5HA 3D0FA 4IOCA 4LF9L 2A8VA 3I4MG 2E5LL 2WAQE 1HNXQ 4OX9L 1FL0A 2MQHA 1CKOA 3F2BA 3GTMH 3H0GH 2JA7H 4BBSG 3AQQA 4IFDI 1YJ9A 3S1NH 3GTKH 4A93H 2OQ0A 4IO9A 1YITA 4DR1L 5JJIA 5JEAG 2JQOA 2B63H 1Q8KA 1YBYA 3NBHB 4IFDJ 1RIPA 2KHIA 3G48A 2YTYA 4A3FH 1NJIC 1KXLA 1UEBA 5ELOA 1UE7A 3DLLA 1KD1C 2DGYA 5IWAL 2R93G 4LUZA 1J5EL 1VS0A 2Q2HA 3BJUA 4X6AH 3SGIA 4A4IA 1G291 4DK6C 2XGTA 2IY5B 4A3JH 3RNUA 1VQPA 1X9NA 1KC8C 4Y52H 3J81i 1S3OA 4NXMQ 2UXDL 5C44G 1X55A 5AJ3L 2XTIA 5HY6A 4K0KL 3CC2A 2R7DA 3HOUH 4DR5L 4DV6L 2B63G 3G6EA 2KENA 5M5WH 1XTDA 3B6YA 1UE5A 2F4VL 4AH6A 3HOYG 3KJOA 2ZJPA 3M85A 3ULJA 1YIJA 3CC4A 1U5KA 4JI4Q 3HOZH 1Z9FA 3PSIA 1P8LA 1RL2A 3K8AA 4B3MQ 1SLJA 3I55A 1Q12A 1EYGA 1WYDA 3K81C 2FXQA 5J3BA 3I4NG 3TEHB 3L0OA 1I3QH 2ZTDA 1G6PA 5M5XH 1X6OA 1VQKA 4A93G 4YWMA 1X3FA 5FLMG 4LF7Q 4DR4L 4QJFA 3I2ZA 3JAMi 3K80C 3RN2A 1IBML 4DR3L 4KHZA 3UDIA 1JJCB 4B3TQ 1H95A 4O2DA 1XPUA 1S72A 4X66Q 3PO2G 1N33L 4JI5Q 4MTNA 4R4TA 4UP8A 5AJ3Q 3CD6A 4MZ9A 2B29A 3CQZH 4LFAL
chains in the Genus database with same CATH superfamily
1BQQT 3U9SA 1IKMA 3HKZE 4A3DG 1GJXA 3S1QB 1Q86C 4ME5A 4HJAA 3LWEA 1XNRL 4QIWB 2J9GA 1SE4A 4XQJA 5IGEA 4HNVA 3MXPA 4DAYB 3CU7A 1WOCA 1LV9A 4IJLA 1SE3A 2I5LX 1O75A 2VPQA 4PMCA 3CCUA 2PQEA 3KXYT 4YBZB 4BY1H 4F4ZA 4RHSA 4DR3Q 2ZM6Q 4I7ZC 4ID6A 4RGMA 1JE4A 4XIGS 5GAGC 2CCZA 2WB1E 4L5SA 3Q0AA 3HP3A 3PIO3 4DUYL 2UUBH 3HOUB 2ZM6L 2F3IA 5GAEC 2UU9Q 3HOXB 3H3VC 1VAJA 4MV8A 2UXBL 4O4LF 2K5DA 1Y14B 1SFOH 4DV3Q 2XCLA 5I2YA 1EYCA 4GOPC 4MTKA 4LMQD 1FJGL 1RYSA 1CUKA 3BABA 2ZJRA 2Z6KA 1IKLA 2L15A 4JI0Q 3A74A 4ME3A 5EOYA 4DPGA 2E2HH 4B3TH 1HNXL 4ED3A 3TS2A 1PV4A 3TZUA 1PA6A 1H9RA 3ND9A 3GIQA 3PUXA 3RFCA 4OWWB 1SMXA 2R8GA 2YCHA 4KHPQ 2XIGA 3GTQH 1JB3A 1F9QA 2YZNA 4KV6A 4MN3A 2A68C 3TP5A 2D0PA 3NTHA 1OXXK 3RR5A 4CDDC 5LL6b 4HR7A 4GLAC 5E4XA 5JEAJ 3HOXH 3S2HB 1R9TA 3RAXA 1A9XA 3DUZA 5E1FA 3FHWA 2UUAL 4JI2L 5NUCA 4C1NK 4UHVA 4EFBA 1EY4A 2SEBD 4Q0FA 4I50F 2FMAA 4HCEA 4TV9F 2WACA 3T1HQ 3OHXC 1V43A 2FP4B 4A3EG 3MWMA 5M3MH 1XMOQ 3N6RA 5KT6A 2BH2A 4IUTA 3KF6A 5M5XB 1KHIA 2JEGA 5FPOA 1E2WA 1DOLA 1TWFB 1IBLH 4XTCS 4YB8B 4DR6Q 5KFMA 2F0VA 5T1GA 1B6SA 3P20A 4OX9Q 4A3BB 2HUGA 1I6VC 4HJ5A 2G9HD 1MHWC 1SROA 5KFJA 3IFTA 3EPGA 3GTPA 3LWUA 1B1ZA 4H0LC 1EY0A 3HOUG 4V0BA 4WORA 3S2HH 4NXMH 3JRXA 4U673 2X69A 2BE5D 1N56A 1DCZA 4R4QA 1Y8PB 3NEMA 4DN4M 4EQ5A 4NLGA 1SYXB 1N33Q 1FGUA 4X64H 3PO3G 2K5VA 4DV7Q 4R1JA 1ULZA 2TSSA 4LFAQ 2JEIA 1SNMA 5M3MB 4POFA 3RMHA 5BR8Q 4U7CA 1TS2A 2OLSA 2NVQB 2X6GA 1MZBA 5I6WA 5D1OB 2XC9A 2WAQG 2R6FA 4Q8FA 2R6GA 4HJ8A 3QOJA 2EYFA 4DV5Q 2PZUA 3KHLA 3W1GA 1QILA 4JV5L 4X62Q 1CQIB 1A0IA 4MHEA 4FP5D 3CW2C 5HGQA 4A3DB 3RGZA 4J9KA 1IXRA 2CW8A 1S0OA 1JT8A 2BR0A 1U4LA 3EROA 3UDFA 4JI7Q 5M9OA 3JRWA 1YHQA 3E6ZX 2OEOA 2D2CC 4HEDA 1TWHA 4EYIB 4LF5Q 4C3HH 4C2MB 2EXZA 4A3GB 1TAEA 4R8NA 2RDGA 3WO0A 1XJVA 2B2YC 1PK8A 4MTEA 4NXNL 4WJ4A 3WNZA 3BDLA 5L1KA 1A62A 5G3LF 3T5LA 3DHQA 3QR8A 3PVXA 3CAMA 5C0XH 4DV3L 2GLTA 3BDOA 5H1SE 2ZJTA 5CBEE 3S15H 3NTKA 3U9TA 1J5EQ 3TIGA 2NZHA 5IY0A 4YJ3F 2D9UA 2JEAI 3EVQA 1KJQA 2BA1A 3CCEA 2UVUA 1KBLA 1BBXC 4H44C 1EWIA 2WTFA 1A63A 2YU9A 5G3LD 5T1IA 3FP9A 4CKBA 3TMEA 1RJQA 3GV6A 4WJWA 3OUUA 1JOKA 4YP3A 3M9OB 4N8FA 3TZDA 4TKOB 3KF8B 2JA6H 4A3GH 4BY7G 4DV2H 3J81c 3NBIA 4RUAA 3HOVH 3PF4A 1HQMC 5LHY1 2K4KA 1LTID 3ICEA 4A3LH 2DUDA 1Q1BA 3E5SA 3NGDA 3ORQA 1HQRD 3VMMA 3T1YQ 2JA5A 1RHPA 2R7NA 3Q24A 4BA2I 1XPRA 5FPRA 4RUCA 1BVSA 1BOSA 2VXWA 3N42B 3T1YL 2F0MA 1SJHD 4YCUA 1WVLA 5KFAA 3LGJA 1WTOA 3QJYA 3PUZA 4DUZQ 2MO0A 5EDWA 3VYUA 4V190 4ED1A 2VL6A 4C3IB 3GTPB 1L0WA 5D1OA 4J15A 3GTJH 4P71A 5I9PA 1Z2NX 3JSNA 2W6QA 2UXCQ 1VBHA 4P2CB 1KQSA 1CHQD 3W3AA 4R7RA 1HZBA 4ED6A 4AYBG 2VUMH 1CHPD 3J80i 3X3MA 1EL0A 4ZUIA 3EPIA 3KHHA 4TVAB 2WIIB 5KGUA 1EQQA 4TSSA 1S9FA 1M7JA 4CKCA 5LMUL 1K8OA 4RGOS 2JA9A 5CA1F 1SCUB 4L5TA 4X65L 2EVBA 1E1OA 1Z2PX 2WAQA 4BWSC 4XQNA 3I12A 4BBRG 3MWDA 1MI2A 1JICA 3C2PA 3K5NA 2PYKA 1UNSA 2PO4A 2XNAC 2ZTCA 4KY7A 4DV0Q 1B7YB 1WJJA 3S1QH 4GKKQ 3M9BA 1GOZA 2ASDA 5IE8A 1LTTD 3SE7A 4C56C 2RHSB 4JI7L 4DR3H 2RDFA 1DOKA 1BDOA 4R8IA 1ENAA 3OTOQ 4BXXH 2R84A 4MV7A 2UUCQ 1MBYA 4B3MH 5M3MG 2VQDA 3AMUA 3KYHC 3Q2OA 3HOYH 4NXNQ 4DLKA 4R8UB 1PZID 3GIDA 3FKIB 3G7LA 2CHBD 1XWEA 4DR4Q 4XYMB 2PMZA 5LMNW 3KAJA 3A5ZB 5C3EH 5C6AA 3OW2A 2OWOA 4ZKBB 1TS4A 2W8LA 4DL7A 4X64Q 5BR8L 1WTXA 1E1TA 4JOIC 4A3MG 3T5JA 2CVRA 4I7AA 3W5OA 4ECZA 1S40A 1WFQA 1KLGD 1TXYA 3T56B 4AQYQ 5IGDA 1UE6A 4I65A 3MJFA 1N8RC 1UNNC 4DV4L 1TWGH 3A8IE 1N32Q 3PW0A 4DR7L 1Y1VA 1GVPA 4P74A 2AQ2B 2J6SA 5FLXE 3OSOA 2QILA 1XNRQ 3CQZA 1BBWA 5K5PA 4K0KQ 4O3NA 4JCVE 1G91A 1RTNA 2IPKD 1GO3E 4UDUC 4YCVA 1P16A 3VYRA 5LOVF 2CFMA 1FD7D 3CKIB 4IWYA 1ILQA 3MXGA 4G57A 4O0AA 4QGUA 4F4XA 1KJ8A 2YRXA 2PZTA 1Q3LA 3M3YH 3GTGB 4EGVA 4DNTB 2E5LH 1STYA 2EY1A 1VQLA 2A19A 1L1OC 4Y7NH 2KJXA 4E4TA 1BNZA 4RB3C 2JA7B 4OO1G 3MR2A 2Y0SG 5ELCA 1UUPA 4HIKA 2NVXB 4DK1A 2NVQH 4DFAA 4LWCA 2JA5H 2GN5A 1O7IA 2HCIA 5JVH3 2JXMB 5EWEA 2K52A 1F9PA 2VQEQ 2QGQA 1JOOA 4LFBQ 3V6JA 1KAAA 4L6TB 4XX0B 4JYAQ 1TT2A 3QIAA 4J9PA 1HJPA 3DF7A 1GYFA 1Y1VG 5ELBA 3OPOA 3I4NH 1S68A 2EDGA 3H15A 1LACA 1DGSA 1AUVA 5KT5A 3C1EA 3BG5A 3BA9A 4AYBA 4LFAH 1CS0A 1I94L 3PO3B 2CWPA 3RGXA 5DQGA 4P72A 3VPCA 2Q8RE 4GLVB 3N40P 2R93H 4OIKA 3SR1A 4YY3H 4X65Q 3HZXA 1I50A 3X3NA 4DU9A 3GTQA 3KLRA 4RNMA 4AIMA 4QW8A 1N33H 5IT9W 3KBXA 1HH2P 3JC66 5CC4A 3RV4A 2CH4A 2HD3A 4K5XA 2NN6I 2Z6KC 1SXTA 1VKZA 1IBLL 1NTGA 3HS0C 4UP9A 3H20A 4Q0YA 3IL8A 1S5CD 1KRTA 3AB9A 5M5YH 4ZHQF 4O4HF 3K7UC 2A8VA 5C8YF 2XRQD 1FL0A 1Z7TA 4L1KA 3F2BA 1PTOB 3H6MA 4QWAA 1QNKA 1I50B 3T16A 4K14A 2PMZB 3I70A 2VR1A 4ETSA 3GTKH 2F0NA 2QF7A 3JAMW 4DR1L 5C5LA 5KFXA 1Q8KA 1YBYA 3NBHB 4IFDJ 5JUMA 3G48A 1X3QA 4K6LA 1CK1A 1HFNA 1UE7A 2L12A 1WTRA 3PO2B 5IWAL 3UFXB 1KEEA 1K1SA 1PTOF 3FDSA 1O80A 3BJUA 4ZUJA 4X6AH 1X3PA 4YR0A 2IY5B 5EQ0A 3J81i 1S3OA 4JI8H 2RDIA 1UC9A 4KJNA 2XTIA 5HY6A 4DV4H 3CC2A 3ETHA 2IW3A 4OGQC 3I73A 4ZLTF 4EBEA 2B63G 4FNFA 3MR5A 4GKKH 4M9UA 2KENA 3V96A 1PTOH 4F87A 3HOYG 1D1IA 3KJOA 1YIJA 4O2BF 5KG5A 3PSIA 4B3MQ 3H40A 2W9BA 4UCUA 3TQTA 1Q12A 1EYGA 1PRTB 3K81C 3K5MA 2R7ZB 1WTWA 4CJ1B 1I3QH 2ZTDA 3HGBA 3C1FA 1G6PA 4Q43A 1B33N 5M5XH 1X6OA 2MHVA 1X3FA 4YWMA 4LF7Q 5L1LA 4BS9A 4DR4H 3R3OA 3UI2A 3UDIA 1H95A 2KUMA 2Y0SA 4B3SH 3NHHA 3PO2G 1CQVA 5IT9E 2B29A 1SE2A 2NTTA 1IW7D 3OSPA 2F3VA 3NENA 3GQCA 2SNSA 1TWAB 1CA6A 1XMQL 3VR5A 4JI3H 3J7AF 4C5CA 2VQFQ 2VUGA 4DAPA 2NVTB 4LJZC 3NUCA 4IRCA 3SK6A 4A3FB 4RKLA 1RK5A 4RH6A 3D6CA 3A7LA 3CPFA 1GHKA 1HR0H 1FGBD 3EQLC 4MA0A 5LMUH 2DWCA 2VOBA 4XYLB 2B63A 1HZ9A 1ZYRD 4GNXA 1M0TA 3Q22A 3S17H 1M90C 4B3TL 4LF8L 3GTQB 2A1AA 3RZOB 1V9PA 1EU4A 5GONF 4TUYF 1E24A 4CC5A 3D4WA 1FNVA 3VA5A 1D5XC 1HTLD 2F0DA 1TA8A 3FEWX 4OWXB 3G6XA 4R8UA 4RMFA 3OUZA 1YZ6A 2A6ED 3DWPA 5KFPA 3MHBA 2KEDA 3T5KA 1PH8A 3OIPA 4RU9A 2F0SA 1TWGB 2HQLA 1GKHA 2Z0SA 5EKIA 4FXDA 1MD2D 2YYZA 2MCTA 2PMZE 4ECXA 5EBCA 3PCOB 3KK7A 2F0KA 4ECQA 1HNWQ 2EY6A 1O7ZA 3J80c 2JSOA 3KHGA 3OTOL 4Q5VA 4KK7A 4CJ0B 3I90A 1E0BA 2UUCL 1JC7A 5D3IB 3RZOH 1WI5A 2UXCL 3CQZB 1IOWA 1OWTA 3FKIH 4BBRB 3RUZA 4EYHB 5KFDA 1M0WA 3KUPA 1EY5A 4LK1C 2K03A 4YAJB 1NY4A 3PF5A 1N32H 4X65H 3FMCA 3NWTA 2F0OA 2LSSA 4HR7B 3Q8DA 5L37A 2ASBA 2QEXA 5IYZF 1LO5D 4RGTA 5FLXc 4NKLA 1IBLQ 2KCMA 4JV0A 4G3IA 5M3FG 1HNZL 3S9WA 3M4OH 2YYAA 1BKBA 5DLGA 1MIUA 5LL6X 3GTMA 1KTKA 3H0GA 4ME6A 1QOHA 4DK3C 3FDTA 2BQRA 1GHJA 4JI1H 2I5MX 1AN8A 4IUUA 1XYIA 2XN9C 4DV3H 4RAYA 5FOBB 1MJEA 2Q2TA 3E0EA 2Z1CA 1PYBA 2E75C 1YJWA 5DLFA 1U4MA 4QIWE 5I9OA 1B6RA 4LSXA 4JI0H 3W2DA 1QUQA 4DV7H 2B2TA 3HRZC 1C30A 4C2MH 4C3HB 3GTGH 1STGA 4DV6H 4HQ6A 4NP5A 4A3CH 4DR5H 2QYZA 2VQEH 3BU2A 2FMMA 2RBMA 2XGPA 4B9XA 1KNAA 1VQJA 1V1PB 2ZTEA 5JJZA 3CMAA 4HMJA 3CCSA 2UXDQ 2YZGA 1SRUA 3M7NA 4C1NI 4K8IA 2ZDQA 1W96A 1DIKA 3KLSX 5KG0A 5BPFA 2B2UC 1EIYB 1EFID 4DV4Q 1N9WA 4HIMA 4QF4A 2VQEL 2BQ3A 4OHJA 2C35B 2EY5A 2PW7A 4DK0A 1ZYRC 3BQ2A 2F3WA 3I72A 4KKSA 4JBJA 1Y1VH 4RGNA 1DOMA 5IP7G 3CCLA 2FB9A 3OOCA 3RIZA 1YEZA 3J81E 3CCMA 4DR6H 2EYPA 4LF8H 2OXPA 1V1PA 4IWXA 1I4PA 2I8CA 3STBD 2ASLA 4LF7H 1SNPA 3SI8A 4X3UA 4QCLA 5EPLA 3N8DA 4FDBA 5C3WA 1NBWA 4B3SQ 4MV3A 2K1BA 3AYHB 3D3RA 5C4XG 4C3JG 3S14B 2ATLA 1S10A 3HOYB 5DGAA 3NTIA 2BQUA 4YCWA 1RKNA 2R3ZA 2R85A 2C2DA 1E4EB 1I4XA 1IYUA 5BPHA 5KFBA 2VQFH 2MUYA 1MKHA 1S5BD 1VMPA 4LUVA 1JJGA 4LF6Q 4RHRA 4UCOA 4LF4H 4PMBA 4ZKCB 2UUBQ 2FLPA 4LFCL 4ZQIA 2EY2A 4G7ZC 4C3IH 1XMQH 1DZ1A 5C0XI 2DJFC 2B3GA 5KFLA 4ECRA 5LMNQ 1NMFA 2F0TA 3BYYB 4X62H 5CB4F 1J6QA 3RZDH 4ZYSA 1KC7A 1F9RA 5C1PA 2RQXA 1KDAA 1WTQA 3GTOH 4QQBX 3JSLA 1JX4A 1UEAB 1HUNA 3D4RA 1VQ9A 4MV4A 1E4EA 3GV5B 4MV6A 1IHZA 2FHTA 4PG3A 4JI5L 1L2ZA 3BQ0A 4ZK9B 2BA0A 1FKAH 1TWCB 2H4OA 4EX5A 4YR3A 1QG7A 1IL2A 4JW0A 4OONA 4DR6L 5L9XA 2OCEA 4BWGB 3UDGA 1RODA 1X54A 2W8KA 1NCVA 1LABA 2DLNA 2RVLA 4QMGA 2NVTH 5I2XA 4UCRA 2M00A 5CMDA 1F77A 4MV1A 1G6ZA 4A3BG 3KLWA 1J5EH 4FF1A 5KKNB 1E7ZA 4A75A 2DZDA 2LXJA 2X0SA 1AP0A 5I4DA 1WTHA 3BG3A 4IUQA 1EY9A 3RD4A 1EU3A 2GPWA 3OMCA 5TSSA 4A3EB 2J0TD 3DMUA 2LFNA 4GZYC 2EZVA 1JXLA 2R8KA 4ED7A 3BZCA 2BH8A 1EIHA 2K75A 1LTGD 1HNXH 3QB3A 1K8AC 2NU7B 1CZGA 4DUYQ 5K36H 1PVOA 5M3FH 3I56A 1VQBA 2N8NA 3FPUB 4PNYA 5IWAQ 1HRJA 3QOLA 1FNUA 5C44B 3HG9A 4GN3B 1LT6D 5A2QL 2E2JB 5E4WC 1QE6A 3CRKC 5LMUQ 4A3GG 1II3A 4I55F 3LX0A 3PO3H 2W9AA 1I4GA 4NB3A 1K8GA 4H02A 1CKNA 2B2WC 2VQFL 4OELB 2CWAA 5FJ8G 2ZDGA 4QL5A 3V6HA 1J9OA 3TP8A 1SMYD 3G4SA 3GIKA 3L2PA 1W3SA 1QVGA 2XWBB 2MO1A 3L7ZC 2C2RA 5DLQE 1QZHA 3S16H 4IUVA 3RLOA 1YNJD 1G51A 1ICFB 1HR0Q 4B3RL 1CSQA 4PV1C 2JA6G 4A3CG 2XD4A 2WAQB 4JUZA 1C7YA 1JCKB 1LTAD 1F2ZA 4FS1A 1BUVT 1YNNC 3HOVG 3MEFA 3GIIA 2PW5A 4B3RQ 1F9SA 3HKSA 5J39A 4IFDG 2O03A 2AUKA 3OSNA 5DG9A 4LFCH 1JORA 3F8TA 4RG1A 2I80A 3M9NB 5JJLA 3K58A 2L1BA 1VBGA 1R9TB 5C0XJ 3U58A 2B8FA 4K0KH 2AGOA 4U6PA 4OEMB 1LTLA 1YNXA 3PZPA 1ENFA 4J9MA 2F0GA 4DKAC 4FVMA 2JA8H 4EEQA 3S1RB 2NU9B 2IX1A 2AQ1B 5FD5A 5D3DA 5JVDF 2R87A 5C4XB 2GVAA 3Q23A 4A3JB 1QNUA 4KD3A 1PYSB 3GIPA 2BDNA 3KTMA 3KOJA 5CBAE 3MWEA 2VA3A 1Y1WA 4JBMA 4J9NA 4BBRH 3STBC 3RLFA 3U50C 1T9HA 1SNCA 5JPNC 2BCOA 4LF8Q 4PDBA 1JWSD 2N78A 3QWNA 2NUAB 1JDEA 3J7YW 1UAPA 1QJOA 5CV9A 2Z8LA 5EWGA 3J80W 1FVIA 2ALYB 2GVBA 5KFWA 4HJ7A 4DL2A 1X65A 1XMOL 2HJWA 4DL3A 4LFBH 4DV0H 2BOSA 2RSOA 4J8QA 3T1HL 4X3TA 3OWEB 2VW9A 1Q8IA 1K8MA 2XCPA 4DR7H 3TQYA 1WCMH 2B39A 3L3OC 1SR3A 3AFPA 4QUFA 1JMCA 5KNCA 3NE5B 2LY7A 1IBKL 3PUWA 5C4XH 1KDCA 3OYYA 3CPWA 2PVPA 2V9WA 4LF4Q 5KFCA 1D5MC 4LF6H 1YHAA 2NTSA 2HHHL 1O7LA 1A2UA 2J7ZA 2VS1A 5IP9H 5LMNL 1DONA 4BXXG 2WE6A 4XXEA 2ZXOA 2CW7A 3HOWG 3S2DH 4DV1H 4XYOA 3K59A 2UXDH 2KQ3A 3D6WA 3J80L 3EA6A 3NELA 1ICWA 1C0AA 2R61A 3CXCA 2A69C 2HGSA 4KMUC 3E5NA 3DM1A 4DV0L 1PH1A 2E76C 5EZYF 4B08A 1WCMB 3VPDA 2K33A 2CZGA 1EQRA 4GNXC 2NU6B 4JV5Q 2E5LQ 2K5QA 3J81W 4JG2A 1PH2A 1F2YA 1R4PB 2M2LA 2CW0C 3WOFA 4YIJA 4IOCA 1HTPA 5IYCH 3D0FA 4LF9L 2E5LL 2WAQE 3V6KA 2MQHA 5BN5A 1XNQH 1EY8A 5FLXL 3GTMH 3H0GH 2JA7H 4BBSG 2FJZA 2FPPB 1YJ9A 1BGWA 1UC8A 2PN1A 4A93H 2OQ0A 5CV7A 5CV5A 5ISRA 2JQOA 1D5ZC 1NJIC 1I3QB 5ELOA 1DV1A 1SYDA 1IBKH 4TRDA 4ILWA 4ABNA 1BXTA 1ET6A 2DGYA 1DYQA 3OTOH 4BY7B 4M8AA 4HNUA 4CBVA 1VS0A 2XIWA 3SGIA 4A4IA 3GTGA 3RNUA 3Q6SA 3K5LA 1A6XA 3V05A 2UXDL 5C4HA 5C44G 1BJTA 2R92A 5AJ3L 4K0KL 3BA8A 4M1UB 2F0WA 1SMYC 2JN4A 2MJ8A 4H7BA 2FLLA 1HA5A 3BZDB 1S5ED 1XTDA 3B6YA 2IWHA 5M5WH 2R92B 2F4VL 1MGSA 3GTMB 3NBHA 5KFZA 4AH6A 1B2TA 3T51B 3M85A 2E2HA 3CRLC 1U5KA 5KFVA 1Z9FA 4IR9A 3SK8A 1SLJA 2R7KA 5FO8B 5KFGA 5J3BA 3I4NG 3VYSA 1EZ8A 4DAVA 2JEJA 1ONLA 1CZWA 1VQKA 2YL2A 5FLXW 3JAMi 3K80C 1G2TA 4J9LA 4DR3L 4ECSA 4UCVA 4AYBB 1S72A 1XPUA 5C3XA 3CD6A 2F4IA 3L4JA 3VA7A 2W6ZA 2W57A 1EUCB 2J4XA 3IKJA 1ZXTA 5A35A 5CV6A 2UU9L 4X3KA 2V4RA 4IRKA 4DUZL 4JI2H 2UUAH 2HIVA 1T94A 4A76A 3U4ZA 1PH3A 2W70A 3R5FA 3PR4A 4BBSB 5HGTA 4GKKL 5I47A 1M8AA 3NSWA 1VQ8A 1OO9B 1VQNA 4K6DA 5E3FA 3G6JB 1AUXA 5E7NA 3V4ZA 2LS01 4YQWA 5KFIA 3BQ1A 2N3SA 2OQKA 4LF6L 1KIXA 2W6MA 2Q8IB 5H80A 4WBNF 3MVVA 2PI2E 1FR3A 3BVZA 3CP0A 4MV9A 4X66H 1VQIA 4QB4A 2I87A 3RB6A 3F2UA 3VR4A 4GC6A 2D62A 5KFEA 4GNXB 3SE0A 1GLVA 4A3DH 2KA7A 4DNRB 1FNWA 1QB5D 1PDQA 3MR3A 2Z6BA 1STHA 4DR2Q 1PH7A 4A3KH 5KFFA 1Y1VB 5K36G 5KX5F 2SDFA 3J80E 4KY5A 5DQHA 3T53B 1U9RA 1Q7YC 1ASZA 5BN3A 3M7GA 2UVVA 3HOZB 4C3JB 1GGOA 2AKWB 3ERSX 2B63B 2R7ZH 3RN5A 3M4OB 3PV0A 4P73A 4DR7Q 1Q1EA 1NR2A 4BA1I 5JJKA 4A2AA 1IW7C 1JR0D 4XQQA 4EBDA 5IP9G 4O3OA 3TQ1A 1T3NA 2KEEA 5KT4A 1YI2A 2H1EA 2VY3A 5KG2A 5JPMC 5EBDA 3CCQA 5DNFA 1W93A 4JI3Q 2NYZD 1EQVA 1VQ7A 5DG7A 5FK9C 3F8NA 2NZ1D 4GC7A 1W6KA 2IP4A 4DV1Q 2JA7A 1TWAH 3PW2A 1PH4A 3TS0A 3A55A 4X64L 1CSPA 1B44D 3M4QA 4NMZA 3BZKA 3RAQA 5DEHA 3J7A5 3ZJYC 4IFDH 4IZOA 2WKDA 5DGBA 2H5XA 4POGA 1SYCA 1TR5A 3U9OA 1EUJA 4A2BA 4CDCC 1C48A 1KJJA 4XT1B 2OH2A 1VQCA 3UQ8A 5IYDG 2EOTA 1GD7A 1ZETA 1C4QA 4RWSC 5IYCG 2HQEA 3N44B 2XRSD 3MXNB 2F0EA 4RB0A 2K01A 4HIDA 1T5XD 3GTOB 4JK1C 4B3ML 4CC6A 4A3IH 1PLFA 3H0GG 2W7PA 5J2TF 4C3HG 1I6UA 4LW1A 3HFZB 1JWUD 1QWYA 3PGZA 4R4CA 1ESRA 5LL6S 5IT9c 2M05A 3MFHA 4F50A 2KCCA 2HIXA 4WFN3 3RB0A 1SNOA 1ENCA 3S2DB 1ZEQX 4HMIA 3WWVA 4JI8Q 3GTLB 3QZ8A 2W9BB 1N36L 1I94H 1IL8A 1HR0W 1PYWD 1HNWH 2L11A 1VMCA 3I3CA 4IURA 4J1MA 3A7AB 4EQPA 2NVYB 4RB1A 5IIFA 1N36Q 3HOVB 2K05A 4APMA 3H4BA 2YW2A 5D65A 1RDPD 2SOBA 5KFHA 4JI6L 3GTJA 5F9LA 1VF7A 4FYDA 3DM3A 4EGQA 1BCPF 4R9WA 1GUGA 4A3EH 2NVXA 1M1KC 4TQUS 3I7FA 1HXYD 2B2WA 5KFQA 4DR1H 3K0YA 4IPCA 2A6HC 1N34Q 3GV7B 4J9QA 1VQFA 2FFKB 1PRTF 2O2LD 4IPHA 2HCCA 5IYBG 1E3PA 4GOPB 4IAJA 1Z2OX 4F4YA 2HVQA 5I6YA 4MA5A 2EYLA 5C44H 4FF4A 5JEAH 1WR2A 3KHRA 1A2TA 5KNDA 1BCPD 4HAEA 1MSHA 5ELDA 4DV7L 3QG1A 1Y1WG 4I7HA 1C3OA 1BCPC 3HOWH 3IAYA 4K5WA 4JI1L 2DY8A 1RCVD 4DV2Q 1I7NA 4GLXA 4ZAIA 1VQOA 5L1IA 3PMFA 4BY7H 3F2DA 1AZQA 1O78A 1LUZA 5FO9B 1SNQA 3PW5A 2RA4A 4S3SA 3V2TA 3KFUA 2A6HD 3ONAB 2PBZA 3G6YA 1JKJB 1YVCA 4TQSA 1Y8OB 1CFMA 2F1MA 2FKLA 3EN2A 4DV6Q 3MC0B 1F2MA 4PZ6A 2OTJA 1L2FA 1HPCA 2D0OA 5C3EB 3S24A 1QVFA 4GN5A 1V8QA 3H3VI 1NSNS 3VPBA 4Q45A 1K83A 2W7OA 3KBGA 1HFGA 2R7ZA 3KDFA 3M4PA 1B8AA 3L9AX 4YHHL 2Q2UA 4KD4A 5JAVA 1T5EA 1D7QA 5ELNA 2I5HA 3TP7A 4ZCKA 1SYGA 5KT2A 5C4JH 1B9NA 1A3TA 4U68A 3ITPA 2IMWP 4MNOA 2PQAA 2W6NA 2IA6A 1HUMA 2DY7A 1XX8A 3AFQA 1HZAA 2GPSA 2EQSA 4Y8VB 1E22A 2QW7A 1Y69U 1KJ9A 1L1OA 3RF2A 4JI4H 4LF7L 4J9SA 5KG4A 3HKZG 4DXFA 2CH4W 2AQ4A 5C5JA 1STBA 1BXRA 1A3VA 3GILA 3GDEA 1M6VA 2F4VH 5T14A 4ECTA 4FXKC 1CI3M 1E2ZA 3T13A 2L5TA 5KFSA 1EZ1A 2V1CC 3EBEA 1YJNA 5IODA 2C9OA 3K3VA 2QCPX 1SYBA 1BNCA 4XZ3B 3KJPA 1GSAA 4PWQA 4KN7C 4DA2A 1H9SB 2W9CA 2ICEC 3M9MB 1I6HB 3NK9A 2PNRC 4NW2A 4JV2A 1PFNA 2PZWA 1KNEA 1L1OB 3A0JA 3TINA 3VDYA 3QO2A 5EKLA 3I4MH 3G6VA 4PQXA 1JQYD 2R7ZG 4IN3A 1PHJA 1Z47A 5IGBA 1Q90A 3DEOA 3FPPA 3H09A 2ALZA 2AGQA 4DL6A 3GIJA 3CMEA 5DG8A 1D1KA 2HT1A 5CAEB 5ELEA 1TWHH 4P75A 1XNQL 5JVLA 4O42A 2FK3A 3I4NB 4YAKB 1ILPA 3FMAA 2EJGC 1K3RA 4QIWA 4ED8A 5LMNH 4HSPA 3M3YB 4C3IG 3R8BA 1I5FA 4C3JH 2C2EA 1FJGQ 1VQ5A 2R92G 2UXCH 1S5FD 1E2VA 2R93B 2VUMG 1T36A 1ASYA 4A3MH 1TY2A 4CDFC 2QDLA 2NVXH 1C9OA 5EGTA 2V58A 5KFOA 4EFEA 1CKNB 1EQTA 2JA8B 2A5HA 3OW7A 3CC7A 5J22A 2YTVA 3NP8A 5C5MA 1EWHA 2ATWA 3TIIA 3GD7A 4DF7A 1EY7A 2JJQA 4ECVA 2R82A 2J6TA 2DPJA 1TWHB 4YWLA 1EIFA 2WB1G 4KKTA 4WJ3M 5D14A 1VCIA 4G7HC 2JA6A 4LMYA 3VYTA 4IQZA 4L63B 5CGKA 3DEPA 2MFIA 2DJGC 3J81L 3IRBA 2VB2X 2R93A 3ER0A 1WD0A 1H9JA 2G9DA 3H0GB 5JVG3 5EWFA 1I50H 4UAIA 4E6IA 3GQBA 3JAML 4ZI7F 3H91A 3GO5A 2F0PA 4KKUA 4A3KG 3TSSA 2UUCH 4YWKA 1S4ZA 1EUDB 3KF8A 1GM5A 1KAWA 2C00A 1RF2D 3KDFB 1CQJB 1AEXA 5BN4A 3OHAA 2QEJC 4DL4A 1DJRD 1ZHQA 1WTPA 5FLMH 5IWAH 1AW7A 3PUYA 2CQYA 3E0JA 1QUQB 5KFUA 2VUMA 1H9KA 2RSNA 1K83H 2ES2A 2NN6G 1RJRA 1LLRD 4C5AA 5M5YB 2FINB 4JI3L 1TKWB 2HHHQ 1AE2A 1HCZA 1AE3A 2KHSA 1RK6A 5KFRA 1SBBB 2RKSA 3HKZA 1Y1WB 3GTKA 1DD2A 1ET9A 3KALA 1PMRA 1TS5A 2AQ3B 1EOTA 2XCAA 1EIGA 3GTKB 2RGVA 1SDFA 1YNND 3ZYYX 5F9NA 1K0RA 3NWSA 4UP7A 1NUCA 3SEBA 1TIID 4CKEA 4YY3Q 4IHJF 3LWBA 2DNCA 2JE6I 3EYYA 1TU2B 1DV2A 4BY1G 4KI0A 3SDZA 2XGQA 4IPGA 3K5HA 1KLUD 3KF6B 1V51A 3BDCA 1PH9A 2A74C 2EPBA 2SNMA 1RJTA 4R4OA 4YHHH 2CW0D 4OO1H 2EXDA 3K7AB 2AWNA 3GIMA 4OL7A 2WV6D 3D4DA 2YTXA 1U4PA 3RB3A 2LMCB 2R8JA 1JIHA 2OT2A 2NWGA 3TN2A 1GUTA 1WTVA 1Y8NB 4IOAA 4N8X1 2IJ0A 1AN7A 2VPSA 4B3RH 3R23A 2R8IA 2C28A 1B50A 1QCBD 2IT1A 1LT4D 2IX0A 2PNHA 1OXTA 1QZGA 4O2AF 3K6OA 4KHPH 4ALPA 2WYOA 3TRZA 4F8MA 1D2BA 3R5XA 2K28A 2QA4A 1RJPA 1QVCA 3U4VA 2IL8A 3TP6A 4ED2A 1LTRD 3GLKA 5F2DA 2IHEA 2L9HA 4QUCA 4KTAA 2K5HA 3I4MG 1HNXQ 3RBDA 1CKOA 5M5WB 2E74C 1TWGA 2QKIC 3EJIA 3ERQA 1BF4A 3H4DA 5EJWA 2B2YA 1N34H 4Q8EA 1M4VA 2FK2A 2TMPA 4IO9A 1YITA 2B2VA 5JEAG 2WB1A 2B63H 1X32A 2ZM6H 5JQWA 3OMGA 2JA5B 2YTYA 4A3FH 3WDNA 5KEEA 2AGPA 3DLLA 2R93G 4LUZA 2WINB 1RTOA 2R86A 1J5EL 3SVMA 4BY1B 1NAPA 4B9WA 2L4NA 4DK6C 3S1MB 1K3BC 2JP1A 1VQPA 1KC8C 4Y52H 4NXMQ 5J2UF 4FU0A 4F7XA 4G7OC 3MFGA 2R7DA 3MWYW 3V4SA 3HOUH 2WKCA 4K2KA 4DR5L 2VA2A 4DV6L 2YS7A 5EPKA 3JAME 3G8CA 4RAUC 1UE5A 1EWCA 3N52A 3HXLA 4JV1A 2I46A 2YU9B 1KDBA 3MXNA 5BR8H 3CC4A 3ULJA 1XXGA 2UU9H 4JI4Q 1RL2A 5C4JB 3I55A 5KT3A 4XT3B 5COYA 3TEHB 3L0OA 5KFKA 4XYQA 4IRDA 3NXWA 2UVRA 2ICIA 3WOEA 3D8GA 3I8ZA 4RCNA 4DXGA 1SJED 4TQRA 4B3TQ 4KHZA 1JJCB 2V4QA 1G8ZD 1XDNA 3JZIA 1N33L 4JI5Q 4UP8A 4MZ9A 5BMVF 4LF5H 5KG1A 4LFAL 2UVWA 4A3KB 2NU8B 1VQMA 3GTLH 1S5DD 1N32L 4RA8A 3R93A 1GUNA 2EYOA 2AWOA 4LF4L 4ECYA 2DNEA 4A3MB 4PZ8A 4DV5L 5L1JA 3M4IA 3UDXA 1VQEA 1K73C 2B8GA 1I6HH 4C2MA 3IN5A 1OXVA 2JEFA 2NVYH 4MIUA 3K0XA 4KN4C 3PO2H 3PIPA 1D8LA 4KHVA 3FKIG 3P75A 1TWFH 4RCOA 3KAKA 3UE0A 4IPDA 1I4HA 1VDZA 4NPSA 3BVGA 1GXDC 3C0FB 3H3VH 1GUOA 4RNOA 1CQFA 1KL9A 2P5ZX 3PIOA 4OX9H 3MFYA 1JE5A 1CKMA 4ULLA 3SXHA 2NN6H 5KG6A 2WB1B 5DAUA 1S0MA 2J6UA 4Z9CB 3P1HA 4AQYL 1B9MA 1MJCA 1IYVA 1B3QA 3NQIA 1IYJB 3LNNA 3TREA 1EHIA 2P0AA 2Z4IA 2EE1A 1CA5A 1LT5D 3RUPA 2A73B 2K5NA 1PFSA 4IZ8A 5CV8A 1HNZH 1VQAA 4K8JA 1Q82C 3RLNA 4A3IB 3S14H 5IGFA 1YNJC 3N41B 2Q2IA 2WP8J 4QY7A 1PXUA 4JI2Q 2UUAQ 1B04A 1STNA 1L0YB 2MGSA 2K04A 3A5UA 1EEFD 2LKVA 1ZHSA 4DUZH 4JOIA 1PH6A 2UXBQ 4N9PA 3BAAA 3A8JE 4QWEA 2F0JA 4DV5H 4GKJL 5AFWA 5EAYA 4JVZA 1E4FT 4DGZA 2A68D 3CCJA 1U4RA 2JA7G 4BBSH 2RF4A 4EQOA 1I3QA 1PRTC 2E2IB 1UE1A 3KLSA 4RFBA 5KFTA 1HHVA 4JI0L 1ZQ7A 1XNQQ 3QFFA 1JWMD 3H94A 1VQGA 4EGJA 1DXMA 2KECA 2OTLA 1A15A 4DR5Q 2E2HB 4NDXA 3GV8B 4J9OA 5IT9L 2ASJA 3T1HH 2AU0A 3PUVA 5C0XG 3N43B 1UWVA 2A69D 3E9HA 2K50A 1U0LA 4H13C 3MAQA 4JI4L 4O3RA 5KYIA 4FBTA 1IBKQ 3BS1A 2NBFA 2N88A 3I4OA 5IP7H 2R7MA 2BE5C 3K57A 3K3PA 4XDXA 4DL5A 3GTOA 3F2CA 3SHLA 1VQDA 4X3SA 2ZXPA 3LP8A 5HURA 3SK4A 1I94Q 3ULPA 2NZOA 2F52A 2W6OA 4IR1A 2GA4B 4CHTB 4GN4B 3W1BA 3RJ0A 4QW9A 4KY6A 4KLKA 2EYMA 3L4KA 1EOVA 1XTCD 1CE8A 4KJOA 2FK1A 5LA6F 5KG3A 3HOWB 3AEVA 2F0LA 3SK5A 2V59A 5EKKA 3EIVA 2RHQB 4O4IF 4J6HA 2HDMA 3PIP3 3R2TA 4JI1Q 4LNQA 2O5JC 3ORRA 4OO1I 1JJ2A 4ODGA 4A3LG 1GSHA 1I4QA 2G5DA 4A3FG 2K14A 3RZDB 1JDBB 1VQ4A 3BVMA 1EZ6A 2I0QA 1HNWL 1IOVA 1O7YA 2XSCA 4WD3A 4RZQA 1SE8A 1PZJD 4R4IA 1WH2A 2FE3A 2AHOB 5JH7F 5C3EG 4MTDA 5M3FB 3P7JA 3FKIA 3T1YH 2ID0A 3K5OA 1SFOB 1Z6HA 1AFPA 1EFWA 1N34L 3K7AH 2FPGB 5KYLA 1RYRA 4YHHQ 3TBIB 3E3XA 3EFXD 4EQNA 4RZRA 5JOBA 4JC0A 3PW4A 2D5DA 4K2LA 3GTJB 3DXJC 1YHBA 4IJHA 2F0FA 1OXSC 1X3EA 2KOLA 1CM9A 5GROA 1V4YA 2PI2A 4A3JG 1VF5C 3C3LA 4OXPA 2Z9HA 4A3IG 2PPBC 4PZ7A 4JI6H 1JLLB 4DNIA 4DV2L 2PCFB 2R7LA 4GOPA 1BBUA 5KG7A 4LUOA 2JYOA 2L55A 2EJMA 2JK8A 1SEIA 1ESFA 1KABA 3BYTB 1C8CA 3TDQA 1XPOA 5IYDH 1SYFA 4LF9Q 5HV6A 1V1OA 4OWTB 2V5AA 4LF5L 5CV4A 2C22A 1N36H 4UCSA 3J7AV 5FKAC 1EEID 3ND8A 1K0SA 4QWDA 4GS3A 2C5CA 4DR2H 3RBEA 2YRWA 1A3UA 3MEHA 4RNNA 4I4TF 4UFZA 5D8DA 2F0HA 1W6JA 4RB2C 2R8HA 2E8GA 4GKJQ 1VQHA 3VR3A 1LTSD 1PX2A 2YV5A 1IBMQ 2F0IA 2JA5G 4B3SL 3MA2B 3R5HA 4JYAH 2E2IA 4APVA 4A3BH 3URYA 1K28A 5KIXA 3HKZB 2EIFA 1SSOA 3BJYA 2RCFA 5KFNA 5DM63 3C46A 3QZ7A 3E9IA 4AQYH 3I91A 1GUWA 5LYJF 4LH7A 2NUCA 1F2LA 1R4QB 2K6AA 3PN1A 5DQIA 4NXML 4NXNH 1XMQQ 2UUBL 4DUYH 3RB4A 1WD1A 5K2MA 2W6PA 2EJFC 3OHBA 1NMGA 3VR6A 1Y1WH 4LAAA 1GSOA 3PR5B 2VB3X 3CCVA 5GADC 4LSAA 4QWBA 4CDEC 1R9TH 3MXUA 3F1ZA 4JI8L 3Q8SB 5C1OA 5IYBH 3A8KE 1SNDA 4JI5H 1TY0A 1ZKOA 4FS2A 2X6LA 1I7LA 2IX3A 2VZAA 5IGCA 1Q46A 3S1RH 2O4XA 1Q81C 4HNTA 4CJ2C 5KRUA 3UE1A 1AZPA 1WCMA 3IFDA 4JPBW 4HSVA 1AH9A 1B3AA 1LT3D 1S97A 1FJGH 2XVSA 1SN8A 1EYAA 1SAPA 3R2IA 5EPJA 4DR2L 2YS6A 2F0UA 2MP1A 3J7ZC 3CHBD 4ZOLF 4IUNA 4ED0A 2L0CA 1STEA 1OXUA 2B2UA 3GTPH 4LFCQ 3MFIA 2WFWA 3MR6A 2FJ2A 3Q1KA 2KBNA 2RGRA 1PFBA 1V1QA 1SYEA 1G2SA 1EYDA 4KHPL 3FRPB 4EVOA 3S15B 3M4YA 2K32A 4JBKA 2FPIB 3VR2A 1JB7A 4FF2A 2B2VC 5LXTF 4TV8F 4FM9A 3HOZG 1K83B 4HN7A 3OWFA 4L5RC 2JEBI 2QK4A 1H9MA 2V4DA 1KRSA 4J9RA 5CYUA 4O3PA 4DR1Q 3D31A 3Q8PB 2M9VA 5CA0F 4ZRZA 1CTMA 1HZCA 2PQAB 5J1ZA 4PMWA 3GP7A 1TVXA 3RTXA 4CGYB 3CF5A 1W2BA 2HVRA 4O3SA 3GV3A 3G71A 1WCMG 1EYZA 2R7FA 3I4MB 1HNZQ 1J8IA 4HJ9A 2RDJA 4EEYA 1LM0A 4RKBA 1LTBD 3PQIA 5FD6A 4WRDA 2HVSA 1B4OA 3MZ5A 1K9MC 3JAMc 4UPAA 2ZJQA 3ETJA 2AUJD 5FJ8H 2AMCB 4ECUA 3DWQA 3T5HA 1GUSA 1XNRH 3GTLA 1X56A 4J0MA 5KNBA 1TWCH 4K5VA 2SCUB 4OIJA 4HTHA 4F4WA 4L8JA 3CCRA 2CKZB 2E2JH 2NVYA 1NNXA 1NR4A 3IG0A 4C5BA 2W71A 4QWCA 1PTOD 1OTCA 4JBWA 1IZ6A 2R92H 2K7VA 3O13A 1MSGA 2YU9H 1TWFA 4HCSA 2UXBH 1TS3A 2E2IH 3RV3A 2DN8A 2JA8G 1ML0D 2MPMA 5IOCA 4A93B 2W9CB 4X66L 2LXKA 1E4GT 4JYAL 2CQAA 5GQOA 4JI6Q 2IHFA 2F03A 2RCNA 1S0NA 2KVMA 2CQOA 5ELFA 4X62L 2VUMB 4JI7H 2KCNA 1EY6A 3PW7A 5A2QE 4YY3L 3Q8QB 1B53A 2N49A 1HA6A 4M7EA 1HR0L 5KT7A 5DM73 2EYHA 2B2TC 2F4VQ 1PFMA 4UY8C 2Y0SB 4AYBE 1JOQA 2YZMA 2VNUD 5LP6F 4DV1L 5HBRB 5A2QW 4YR2A 4Y7NB 4FO2A 4G4KA 4GKJH 1LYLA 2Y0SE 4L5QA 2DPIA 4UCTA 3ULLA 1IBMH 1SFOA 1BCPB 2E2DC 2K5WA 3HBLA 2DIKA 3HOXG 1SEBD 1A8VA 4N9TA 4F88A 2RDHA 3A56A 4O1NA 2OF1A 2NB0A 3J81j 1VQ6A 1CT1D 1DM0B 4LFBL 1XMOH 3S16B 1PRTD 2ZXRA 3OIQA 4DAYA 3S1MH 5KFYA 4ECWA 4DAMA 5GAHC 2KHJA 2XWJB 2WDTA 3LMLA 1PH5A 5C4ZA 1STAA 1D6EC 1X3GA 2MNAA 1B70B 1PZKD 2KCTA 3NPPA 1NE3A 2ZT9C 4HIOA 4FF3A 4O3QA 1WSCA 4OX9L 4EG0A 3AU7A 3CVZA 2JA6B 3AQQA 2Q8TA 2Z4HA 2O5IC 4HYKA 4IFDI 3S1NH 5D1PA 3HEJA 1PTOC 2I07B 4IALA 2HHHH 5JJIA 1RD9D 3WO1A 1FYCA 1RIPA 2KHIA 1KXLA 1UEBA 4YJ2F 2HDLA 3T4AC 1KD1C 2ZDHA 3HB9A 4JV5H 1I4RA 1BO0A 1L0XB 2Q2HA 3S17B 3DWAA 1G291 2ENBA 4FBUA 2XGTA 1S03G 3MTSA 4A3JH 1X9NA 1N48A 1KJIA 1X55A 2A6EC 1BR9A 3K5IA 2IBKA 4LH6A 1TQOA 3G6EA 5FO7B 2QDBA 4ZQ3A 3I4LA 1TWAA 3N6XA 5CORA 2ZJPA 3S1NB 3J7AK 3HOZH 2N55A 1P8LA 4LF9H 3K8AA 4MAMA 2KSWA 5IGGA 1WYDA 2FMCA 2FXQA 2FLNA 1K1QA 3A54A 1H9SA 4FXGC 4A93G 3FVQA 2BDOA 5FLMG 4DR4L 1TWCA 4QJFA 3I2ZA 4RAZA 3RN2A 1IBML 3Q8RB 5CR3A 4EBCA 4O2DA 4X66Q 2F0QA 4MTNA 4R4TA 3NQTA 5AJ3Q 4IUPA 4Q44A 3CQZH 2EYJA
chains in the Genus database with same CATH topology
3NENA 2UU9L 1XMQL 1VQMA 3GTLH 3HKZE 4A3DG 4DUZL 1N32L 2HIVA 2VQFQ 4A76A 3U4ZA 1PH3A 1Q86C 2AWOA 4HJAA 4LF4L 4GKKL 1VQ8A 4PZ8A 4DV5L 1XNRL 1VQNA 3UDXA 1VQEA 5E7NA 1K73C 1I6HH 3CPFA 1OXVA 2NVYH 2N3SA 4DAYB 2OQKA 4LF6L 1WOCA 1KIXA 1HZ9A 3K0XA 3PO2H 4IJLA 2PI2E 2I5LX 3PIPA 1D8LA 3FKIG 3CP0A 3CCUA 4GNXA 4BY1H 3S17H 1TWFH 1VQIA 4DR3Q 1M90C 4B3TL 2ZM6Q 3UE0A 4IPDA 4LF8L 2A1AA 1V9PA 2D62A 4NPSA 4XIGS 5GAGC 4GNXB 2WB1E 2CCZA 4L5SA 3H3VH 4A3DH 1E24A 1KL9A 4DUYL 3PIOA 2ZM6L 2F3IA 5GAEC 4OWXB 2UU9Q 1JE5A 1CKMA 2UXBL 1Y14B 4RMFA 1YZ6A 4DR2Q 1PH7A 4A3KH 1SFOH 5K36G 4DV3Q 4GOPC 4AQYL 1ASZA 1Q7YC 1PH8A 1FJGL 1CUKA 1MJCA 2ZJRA 2HQLA 1GKHA 2AKWB 3ERSX 2Z6KA 2L15A 2Z0SA 1IYJB 3A74A 4ME3A 3RN5A 4JI0Q 3PV0A 4P73A 3TREA 1Q1EA 4DPGA 4BA1I 1HNXL 2E2HH 2YYZA 4DR7Q 5JJKA 2PMZE 3TS2A 3PCOB 1PV4A 5IP9G 1PA6A 1HNWQ 2K5NA 1PFSA 3PUXA 3J80c 4OWWB 1SMXA 3OTOL 1YI2A 1VQAA 2VY3A 1Q82C 3RLNA 2UUCL 4KHPQ 3S14H 3CCQA 2Q2IA 3GTQH 2WP8J 4JI3Q 3RZOH 4QY7A 1WI5A 1VQ7A 2UXCL 4JI2Q 2UUAQ 2D0PA 1OXXK 3FKIH 3RR5A 3A5UA 4DV1Q 4JOIA 1PH6A 1TWAH 2UXBQ 4GLAC 5JEAJ 3HOXH 1PH4A 3TS0A 4GKJL 4X64L 1NY4A 1CSPA 3FHWA 3M4QA 5EAYA 3PF5A 3BZKA 3CCJA 2UUAL 4JI2L 2JA7G 2ASBA 2LSSA 2RF4A 4BBSH 3Q8DA 3J7A5 3ZJYC 1UE1A 2QEXA 2H5XA 5FLXc 4JI0L 4POGA 1XNQQ 3T1HQ 1EUJA 1V43A 4A3EG 1VQGA 2KCMA 1IBLQ 5M3MH 5M3FG 1XMOQ 1HNZL 2OTLA 4DR5Q 1VQCA 3M4OH 5IYDG 1BKBA 1GD7A 2BH2A 1MIUA 3KF6A 1KHIA 5IYCG 3PUVA 5C0XG 4XTCS 4DK3C 1UWVA 3MXNB 3E9HA 4DR6Q 2K50A 1U0LA 4HIDA 2I5MX 4OX9Q 4JI4L 2R7ZH 1IBKQ 4B3ML 4A3IH 3H0GG 3I4OA 5IP7H 4HJ5A 1SROA 4LW1A 3HFZB 3PGZA 4R4CA 3E0EA 5IT9c 1PYBA 3F2CA 1MJEA 1VQDA 2Q2TA 1YJWA 1I94Q 3ULPA 2NZOA 2F52A 2HIXA 3HOUG 4GN4B 3W1BA 4QIWE 3S2HH 3WWVA 4JI8Q 1QUQA 4KLKA 4R4QA 4C2MH 3NEMA 4EQ5A 1N36L 3GTGH 1HR0W 1EOVA 1N33Q 1FGUA 4A3CH 3PO3G 2K5VA 4A3LH 4DV7Q 4R1JA 3AEVA 3BU2A 3EIVA 2RHQB 4LFAQ 4POFA 1N36Q 4JI1Q 4LNQA 5BR8Q 4OO1I 1VQJA 1JJ2A 2UXDQ 2ZTEA 3CMAA 3CCSA 1SRUA 4JI6L 3M7NA 2WAQG 4A3LG 2R6GA 4A3FG 4HJ8A 2K14A 3DM3A 1VQ4A 4A3EH 4DV5Q 1M1KC 4TQUS 3I7FA 3W1GA 1EIYB 2I0QA 4JV5L 1HNWL 4IPCA 1N9WA 4DV4Q 4X62Q 2VQEL 4HIMA 1A0IA 5HGQA 3CW2C 1SE8A 1N34Q 4R4IA 1IXRA 2C35B 1VQFA 1JT8A 4IPHA 2AHOB 5IYBG 1E3PA 4GOPB 5C3EG 3UDFA 4JI7Q 1YHQA 2ID0A 4JBJA 1Y1VH 5C44H 1EFWA 5IP7G 1N34L 3K7AH 3CCLA 4LF5Q 4C3HH 1YEZA 4YHHQ 4DV7L 3CCMA 1Y1WG 1XJVA 3HOWH 4JC0A 4NXNL 4WJ4A 1A62A 4JI1L 3STBD 1YHBA 4IJHA 4DV2Q 4GLXA 3CAMA 1OXSC 4DV3L 1X3EA 1VQOA 5GROA 5H1SE 2PI2A 3F2DA 4FDBA 4A3JG 1NBWA 1LUZA 4B3SQ 3S15H 4BY7H 5C4XG 3AYHB 1J5EQ 4OXPA 4A3IG 2NZHA 4PZ7A 3KFUA 5IY0A 4DNIA 2JEAI 4DV2L 1YVCA 4GOPA 1BBUA 4YCWA 2BA1A 4LUOA 3CCEA 1EWIA 1A63A 3EN2A 4DV6Q 2JK8A 4PZ6A 3FP9A 2OTJA 1L2FA 5IYDH 2D0OA 3S24A 1XPOA 1MKHA 4GN5A 1QVFA 4LF9Q 3H3VI 4LUVA 4OWTB 1JJGA 4LF6Q 4LF5L 2UUBQ 3KDFA 3M4PA 1B8AA 4LFCL 4YHHL 2Q2UA 1D7QA 5ELNA 2I5HA 4C3IH 3KF8B 2JA6H 4A3GH 5C4JH 5C0XI 4GS3A 4BY7G 3J81c 2B3GA 4MNOA 2PQAA 5LMNQ 3HOVH 3PF4A 1NMFA 2E8GA 2K4KA 3ICEA 4GKJQ 1VQHA 3AFQA 1J6QA 1HZAA 2DUDA 2EQSA 1E22A 2YV5A 1Q1BA 3RZDH 1IBMQ 2JA5G 4B3SL 1L1OA 4LF7L 4APVA 3GTOH 4A3BH 4QQBX 3HKZG 1VQ9A 3T1YQ 4PG3A 3GDEA 2EIFA 4JI5L 4BA2I 1XPRA 2BA0A 1BVSA 3E9IA 4EX5A 1IL2A 2V1CC 3EBEA 4OONA 1YJNA 4DR6L 2OCEA 3UDGA 3T1YL 4YCUA 4NXML 1XMQQ 2UUBL 1X54A 3LGJA 3PUZA 4DUZQ 2MO0A 3KJPA 2NVTH 1NMGA 1Y1WH 2VL6A 3CCVA 1L0WA 4J15A 3GTJH 4P71A 3KLWA 5GADC 4A3BG 1E7ZA 3A0JA 1L1OB 2LXJA 4A75A 3VDYA 1R9TH 2UXCQ 3F1ZA 4JI8L 3I4MH 1KQSA 5IYBH 2R7ZG 1PHJA 1HZBA 1Z47A 4AYBG 2VUMH 2VZAA 1Q46A 3J80i 3CMEA 3BZCA 2BH8A 3S1RH 1Q81C 2HT1A 4JYAL 4TVAB 2K75A 1EQQA 1TWHH 3UE1A 5LMUL 1K8AC 4P75A 4DUYQ 1XNQL 2JA9A 1AH9A 1PVOA 4L5TA 4X65L 5M3FH 1E1OA 3I56A 1VQBA 2N8NA 5IWAQ 1SN8A 4DR2L 1K3RA 4BBRG 4GN3B 3J7ZC 5LMUQ 2ZTCA 4DV0Q 1I5FA 4C3JH 4A3GG 3PO3H 1B7YB 1FJGQ 1WJJA 1VQ5A 2R92G 4NB3A 3S1QH 4GKKQ 3M9BA 1OXUA 3GTPH 5IE8A 4H02A 1CKNA 1K8GA 2WFWA 4LFCQ 2VUMG 2VQFL 2CWAA 2RHSB 5FJ8G 4A3MH 4QL5A 2KBNA 1ASYA 4JI7L 2NVXH 1C9OA 1V1QA 3OTOQ 3G4SA 4BXXH 3L2PA 1W3SA 1QVGA 2UUCQ 4KHPL 1CKNB 2MO1A 5M3MG 3L7ZC 4JBKA 5DLQE 1QZHA 3S16H 3KYHC 3HOYH 3CC7A 1JB7A 2YTVA 3RLOA 1G51A 1HR0Q 4NXNQ 4B3RL 3HOZG 1CSQA 2ATWA 2JA6G 4L5RC 4A3CG 2JEBI 3GD7A 2JJQA 1C7YA 1KRSA 4YWLA 4DR4Q 1EIFA 2WB1G 5LMNW 3MEFA 3A5ZB 3D31A 1VCIA 5C3EH 4DR1Q 3OW2A 2OWOA 3HOVG 4B3RQ 3HKSA 4IFDG 4X64Q 5BR8L 1E1TA 4JOIC 4A3MG 1HZCA 2PQAB 2MFIA 3W5OA 4PMWA 3IRBA 3F8TA 1WFQA 1S40A 4RG1A 3ER0A 3CF5A 1TXYA 4AQYQ 1W2BA 1I50H 1UE6A 3G71A 4WJ3M 5JJLA 1WCMG 4A3KG 3GO5A 1N8RC 2R7FA 5C0XJ 3U58A 4DV4L 4YWKA 1HNZQ 1TWGH 1N32Q 4HJ9A 1GM5A 4DR7L 1LM0A 1KAWA 1LTLA 1GVPA 1YNXA 3KDFB 4P74A 1XNRQ 1BBWA 4K0KQ 4JCVE 4DKAC 3JAMc 4UPAA 1K9MC 2ZJQA 2JA8H 5FLMH 5FJ8H 3PUYA 2IX1A 1GO3E 4YCVA 2AMCB 1P16A 1QUQB 1X56A 2GVAA 1K83H 2CFMA 1PYSB 2ES2A 1TWCH 2NN6G 4O0AA 3KOJA 4QGUA 3CCRA 4JI3L 4JBMA 4BBRH 2HHHQ 2CKZB 3RLFA 1AE2A 3STBC 1AE3A 1T9HA 3U50C 2E2JH 3M3YH 1VQLA 4LF8Q 1OTCA 2N78A 1IZ6A 2A19A 1L1OC 4JBWA 4Y7NH 2R92H 2YU9H 1FVIA 2ALYB 4OO1G 2GVBA 2Y0SG 2E2IH 2JA8G 4HIKA 4HJ7A 4X66L 1X65A 2LXKA 1XMOL 2NVQH 1K0RA 4UP7A 4YY3Q 4LWCA 3T1HL 2GN5A 1O7IA 5GQOA 2IHFA 2VW9A 2JA5H 2RCNA 4JI6Q 2K52A 2CQOA 3TQYA 2QGQA 4X62L 1WCMH 2JE6I 2VQEQ 4LFBQ 1SR3A 3AFPA 4BY1G 4KI0A 1JMCA 4IPGA 1IBKL 4YY3L 4JYAQ 3KF6B 3PUWA 5C4XH 1HJPA 1PH9A 2N49A 3CPWA 3OYYA 1Y1VG 1HR0L 4LF4Q 3I4NH 4R4OA 1YHAA 2HHHL 5IP9H 2VS1A 3H15A 5LMNL 4BXXG 1DGSA 2EXDA 2F4VQ 2AWNA 4UY8C 4AYBE 3HOWG 3S2DH 1I94L 2VNUD 2YTXA 2CWPA 4DV1L 4P72A 4GLVB 2R93H 1LYLA 2Y0SE 3NELA 4L5QA 4X65Q 4IOAA 3ULLA 1C0AA 3CXCA 3HOXG 1A8VA 2IT1A 2IX0A 2PNHA 1OXTA 4AIMA 3J81j 1QZGA 1VQ6A 4DV0L 4ALPA 1HH2P 3JC66 1PH1A 4LFBL 3TRZA 2NN6I 2QA4A 2Z6KC 1EQRA 4GNXC 3S1MH 1IBLL 4DAMA 1QVCA 5GAHC 2E5LQ 1NTGA 4JV5Q 2KHJA 4UP9A 3U4VA 4JG2A 1KRTA 1PH5A 1PH2A 5M5YH 1X3GA 2MNAA 1B70B 2IHEA 2KCTA 1NE3A 5IYCH 3K7UC 4HIOA 2K5HA 3D0FA 4IOCA 4LF9L 2A8VA 3I4MG 2E5LL 2WAQE 1HNXQ 4OX9L 1FL0A 2MQHA 1CKOA 3F2BA 3GTMH 3H0GH 2JA7H 4BBSG 3AQQA 4IFDI 1YJ9A 3S1NH 3GTKH 4A93H 2OQ0A 4IO9A 1YITA 4DR1L 5JJIA 5JEAG 2JQOA 2B63H 1Q8KA 1YBYA 3NBHB 4IFDJ 1RIPA 2KHIA 3G48A 2YTYA 4A3FH 1NJIC 1KXLA 1UEBA 5ELOA 1UE7A 3DLLA 1KD1C 2DGYA 5IWAL 2R93G 4LUZA 1J5EL 1VS0A 2Q2HA 3BJUA 4X6AH 3SGIA 4A4IA 1G291 4DK6C 2XGTA 2IY5B 4A3JH 3RNUA 1VQPA 1X9NA 1KC8C 4Y52H 3J81i 1S3OA 4NXMQ 2UXDL 5C44G 1X55A 5AJ3L 2XTIA 5HY6A 4K0KL 3CC2A 2R7DA 3HOUH 4DR5L 4DV6L 2B63G 3G6EA 2KENA 5M5WH 1XTDA 3B6YA 1UE5A 2F4VL 4AH6A 3HOYG 3KJOA 2ZJPA 3M85A 3ULJA 1YIJA 3CC4A 1U5KA 4JI4Q 3HOZH 1Z9FA 3PSIA 1P8LA 1RL2A 3K8AA 4B3MQ 1SLJA 3I55A 1Q12A 1EYGA 1WYDA 3K81C 2FXQA 5J3BA 3I4NG 3TEHB 3L0OA 1I3QH 2ZTDA 1G6PA 5M5XH 1X6OA 1VQKA 4A93G 4YWMA 1X3FA 5FLMG 4LF7Q 4DR4L 4QJFA 3I2ZA 3JAMi 3K80C 3RN2A 1IBML 4DR3L 4KHZA 3UDIA 1JJCB 4B3TQ 1H95A 4O2DA 1XPUA 1S72A 4X66Q 3PO2G 1N33L 4JI5Q 4MTNA 4R4TA 4UP8A 5AJ3Q 3CD6A 4MZ9A 2B29A 3CQZH 4LFAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEN A;  2UU9 L;  1XMQ L;  1VQM A;  3GTL H;  3HKZ E;  4A3D G;  4DUZ L;  1N32 L;  2HIV A;  2VQF Q;  4A76 A;  3U4Z A;  1PH3 A;  1Q86 C;  2AWO A;  4HJA A;  4LF4 L;  4GKK L;  1VQ8 A;  4PZ8 A;  4DV5 L;  1XNR L;  1VQN A;  3UDX A;  1VQE A;  5E7N A;  1K73 C;  1I6H H;  3CPF A;  1OXV A;  2NVY H;  2N3S A;  4DAY B;  2OQK A;  4LF6 L;  1WOC A;  1KIX A;  1HZ9 A;  3K0X A;  3PO2 H;  4IJL A;  2PI2 E;  2I5L X;  3PIP A;  1D8L A;  3FKI G;  3CP0 A;  3CCU A;  4GNX A;  4BY1 H;  3S17 H;  1TWF H;  1VQI A;  4DR3 Q;  1M90 C;  4B3T L;  2ZM6 Q;  3UE0 A;  4IPD A;  4LF8 L;  2A1A A;  1V9P A;  2D62 A;  4NPS A;  4XIG S;  5GAG C;  4GNX B;  2WB1 E;  2CCZ A;  4L5S A;  3H3V H;  4A3D H;  1E24 A;  1KL9 A;  4DUY L;  3PIO A;  2ZM6 L;  2F3I A;  5GAE C;  4OWX B;  2UU9 Q;  1JE5 A;  1CKM A;  2UXB L;  1Y14 B;  4RMF A;  1YZ6 A;  4DR2 Q;  1PH7 A;  4A3K H;  1SFO H;  5K36 G;  4DV3 Q;  4GOP C;  4AQY L;  1ASZ A;  1Q7Y C;  1PH8 A;  1FJG L;  1CUK A;  1MJC A;  2ZJR A;  2HQL A;  1GKH A;  2AKW B;  3ERS X;  2Z6K A;  2L15 A;  2Z0S A;  1IYJ B;  3A74 A;  4ME3 A;  3RN5 A;  4JI0 Q;  3PV0 A;  4P73 A;  3TRE A;  1Q1E A;  4DPG A;  4BA1 I;  1HNX L;  2E2H H;  2YYZ A;  4DR7 Q;  5JJK A;  2PMZ E;  3TS2 A;  3PCO B;  1PV4 A;  5IP9 G;  1PA6 A;  1HNW Q;  2K5N A;  1PFS A;  3PUX A;  3J80 c;  4OWW B;  1SMX A;  3OTO L;  1YI2 A;  1VQA A;  2VY3 A;  1Q82 C;  3RLN A;  2UUC L;  4KHP Q;  3S14 H;  3CCQ A;  2Q2I A;  3GTQ H;  2WP8 J;  4JI3 Q;  3RZO H;  4QY7 A;  1WI5 A;  1VQ7 A;  2UXC L;  4JI2 Q;  2UUA Q;  2D0P A;  1OXX K;  3FKI H;  3RR5 A;  3A5U A;  4DV1 Q;  4JOI A;  1PH6 A;  1TWA H;  2UXB Q;  4GLA C;  5JEA J;  3HOX H;  1PH4 A;  3TS0 A;  4GKJ L;  4X64 L;  1NY4 A;  1CSP A;  3FHW A;  3M4Q A;  5EAY A;  3PF5 A;  3BZK A;  3CCJ A;  2UUA L;  4JI2 L;  2JA7 G;  2ASB A;  2LSS A;  2RF4 A;  4BBS H;  3Q8D A;  3J7A 5;  3ZJY C;  1UE1 A;  2QEX A;  2H5X A;  5FLX c;  4JI0 L;  4POG A;  1XNQ Q;  3T1H Q;  1EUJ A;  1V43 A;  4A3E G;  1VQG A;  2KCM A;  1IBL Q;  5M3M H;  5M3F G;  1XMO Q;  1HNZ L;  2OTL A;  4DR5 Q;  1VQC A;  3M4O H;  5IYD G;  1BKB A;  1GD7 A;  2BH2 A;  1MIU A;  3KF6 A;  1KHI A;  5IYC G;  3PUV A;  5C0X G;  4XTC S;  4DK3 C;  1UWV A;  3MXN B;  3E9H A;  4DR6 Q;  2K50 A;  1U0L A;  4HID A;  2I5M X;  4OX9 Q;  4JI4 L;  2R7Z H;  1IBK Q;  4B3M L;  4A3I H;  3H0G G;  3I4O A;  5IP7 H;  4HJ5 A;  1SRO A;  4LW1 A;  3HFZ B;  3PGZ A;  4R4C A;  3E0E A;  5IT9 c;  1PYB A;  3F2C A;  1MJE A;  1VQD A;  2Q2T A;  1YJW A;  1I94 Q;  3ULP A;  2NZO A;  2F52 A;  2HIX A;  3HOU G;  4GN4 B;  3W1B A;  4QIW E;  3S2H H;  3WWV A;  4JI8 Q;  1QUQ A;  4KLK A;  4R4Q A;  4C2M H;  3NEM A;  4EQ5 A;  1N36 L;  3GTG H;  1HR0 W;  1EOV A;  1N33 Q;  1FGU A;  4A3C H;  3PO3 G;  2K5V A;  4A3L H;  4DV7 Q;  4R1J A;  3AEV A;  3BU2 A;  3EIV A;  2RHQ B;  4LFA Q;  4POF A;  1N36 Q;  4JI1 Q;  4LNQ A;  5BR8 Q;  4OO1 I;  1VQJ A;  1JJ2 A;  2UXD Q;  2ZTE A;  3CMA A;  3CCS A;  1SRU A;  4JI6 L;  3M7N A;  2WAQ G;  4A3L G;  2R6G A;  4A3F G;  4HJ8 A;  2K14 A;  3DM3 A;  1VQ4 A;  4A3E H;  4DV5 Q;  1M1K C;  4TQU S;  3I7F A;  3W1G A;  1EIY B;  2I0Q A;  4JV5 L;  1HNW L;  4IPC A;  1N9W A;  4DV4 Q;  4X62 Q;  2VQE L;  4HIM A;  1A0I A;  5HGQ A;  3CW2 C;  1SE8 A;  1N34 Q;  4R4I A;  1IXR A;  2C35 B;  1VQF A;  1JT8 A;  4IPH A;  2AHO B;  5IYB G;  1E3P A;  4GOP B;  5C3E G;  3UDF A;  4JI7 Q;  1YHQ A;  2ID0 A;  4JBJ A;  1Y1V H;  5C44 H;  1EFW A;  5IP7 G;  1N34 L;  3K7A H;  3CCL A;  4LF5 Q;  4C3H H;  1YEZ A;  4YHH Q;  4DV7 L;  3CCM A;  1Y1W G;  1XJV A;  3HOW H;  4JC0 A;  4NXN L;  4WJ4 A;  1A62 A;  4JI1 L;  3STB D;  1YHB A;  4IJH A;  4DV2 Q;  4GLX A;  3CAM A;  1OXS C;  4DV3 L;  1X3E A;  1VQO A;  5GRO A;  5H1S E;  2PI2 A;  3F2D A;  4FDB A;  4A3J G;  1NBW A;  1LUZ A;  4B3S Q;  3S15 H;  4BY7 H;  5C4X G;  3AYH B;  1J5E Q;  4OXP A;  4A3I G;  2NZH A;  4PZ7 A;  3KFU A;  5IY0 A;  4DNI A;  2JEA I;  4DV2 L;  1YVC A;  4GOP A;  1BBU A;  4YCW A;  2BA1 A;  4LUO A;  3CCE A;  1EWI A;  1A63 A;  3EN2 A;  4DV6 Q;  2JK8 A;  4PZ6 A;  3FP9 A;  2OTJ A;  1L2F A;  5IYD H;  2D0O A;  3S24 A;  1XPO A;  1MKH A;  4GN5 A;  1QVF A;  4LF9 Q;  3H3V I;  4LUV A;  4OWT B;  1JJG A;  4LF6 Q;  4LF5 L;  2UUB Q;  3KDF A;  3M4P A;  1B8A A;  4LFC L;  4YHH L;  2Q2U A;  1D7Q A;  5ELN A;  2I5H A;  4C3I H;  3KF8 B;  2JA6 H;  4A3G H;  5C4J H;  5C0X I;  4GS3 A;  4BY7 G;  3J81 c;  2B3G A;  4MNO A;  2PQA A;  5LMN Q;  3HOV H;  3PF4 A;  1NMF A;  2E8G A;  2K4K A;  3ICE A;  4GKJ Q;  1VQH A;  3AFQ A;  1J6Q A;  1HZA A;  2DUD A;  2EQS A;  1E22 A;  2YV5 A;  1Q1B A;  3RZD H;  1IBM Q;  2JA5 G;  4B3S L;  1L1O A;  4LF7 L;  4APV A;  3GTO H;  4A3B H;  4QQB X;  3HKZ G;  1VQ9 A;  3T1Y Q;  4PG3 A;  3GDE A;  2EIF A;  4JI5 L;  4BA2 I;  1XPR A;  2BA0 A;  1BVS A;  3E9I A;  4EX5 A;  1IL2 A;  2V1C C;  3EBE A;  4OON A;  1YJN A;  4DR6 L;  2OCE A;  3UDG A;  3T1Y L;  4YCU A;  4NXM L;  1XMQ Q;  2UUB L;  1X54 A;  3LGJ A;  3PUZ A;  4DUZ Q;  2MO0 A;  3KJP A;  2NVT H;  1NMG A;  1Y1W H;  2VL6 A;  3CCV A;  1L0W A;  4J15 A;  3GTJ H;  4P71 A;  3KLW A;  5GAD C;  4A3B G;  1E7Z A;  3A0J A;  1L1O B;  2LXJ A;  4A75 A;  3VDY A;  1R9T H;  2UXC Q;  3F1Z A;  4JI8 L;  3I4M H;  1KQS A;  5IYB H;  2R7Z G;  1PHJ A;  1HZB A;  1Z47 A;  4AYB G;  2VUM H;  2VZA A;  1Q46 A;  3J80 i;  3CME A;  3BZC A;  2BH8 A;  3S1R H;  1Q81 C;  2HT1 A;  4JYA L;  4TVA B;  2K75 A;  1EQQ A;  1TWH H;  3UE1 A;  5LMU L;  1K8A C;  4P75 A;  4DUY Q;  1XNQ L;  2JA9 A;  1AH9 A;  1PVO A;  4L5T A;  4X65 L;  5M3F H;  1E1O A;  3I56 A;  1VQB A;  2N8N A;  5IWA Q;  1SN8 A;  4DR2 L;  1K3R A;  4BBR G;  4GN3 B;  3J7Z C;  5LMU Q;  2ZTC A;  4DV0 Q;  1I5F A;  4C3J H;  4A3G G;  3PO3 H;  1B7Y B;  1FJG Q;  1WJJ A;  1VQ5 A;  2R92 G;  4NB3 A;  3S1Q H;  4GKK Q;  3M9B A;  1OXU A;  3GTP H;  5IE8 A;  4H02 A;  1CKN A;  1K8G A;  2WFW A;  4LFC Q;  2VUM G;  2VQF L;  2CWA A;  2RHS B;  5FJ8 G;  4A3M H;  4QL5 A;  2KBN A;  1ASY A;  4JI7 L;  2NVX H;  1C9O A;  1V1Q A;  3OTO Q;  3G4S A;  4BXX H;  3L2P A;  1W3S A;  1QVG A;  2UUC Q;  4KHP L;  1CKN B;  2MO1 A;  5M3M G;  3L7Z C;  4JBK A;  5DLQ E;  1QZH A;  3S16 H;  3KYH C;  3HOY H;  3CC7 A;  1JB7 A;  2YTV A;  3RLO A;  1G51 A;  1HR0 Q;  4NXN Q;  4B3R L;  3HOZ G;  1CSQ A;  2ATW A;  2JA6 G;  4L5R C;  4A3C G;  2JEB I;  3GD7 A;  2JJQ A;  1C7Y A;  1KRS A;  4YWL A;  4DR4 Q;  1EIF A;  2WB1 G;  5LMN W;  3MEF A;  3A5Z B;  3D31 A;  1VCI A;  5C3E H;  4DR1 Q;  3OW2 A;  2OWO A;  3HOV G;  4B3R Q;  3HKS A;  4IFD G;  4X64 Q;  5BR8 L;  1E1T A;  4JOI C;  4A3M G;  1HZC A;  2PQA B;  2MFI A;  3W5O A;  4PMW A;  3IRB A;  3F8T A;  1WFQ A;  1S40 A;  4RG1 A;  3ER0 A;  3CF5 A;  1TXY A;  4AQY Q;  1W2B A;  1I50 H;  1UE6 A;  3G71 A;  4WJ3 M;  5JJL A;  1WCM G;  4A3K G;  3GO5 A;  1N8R C;  2R7F A;  5C0X J;  3U58 A;  4DV4 L;  4YWK A;  1HNZ Q;  1TWG H;  1N32 Q;  4HJ9 A;  1GM5 A;  4DR7 L;  1LM0 A;  1KAW A;  1LTL A;  1GVP A;  1YNX A;  3KDF B;  4P74 A;  1XNR Q;  1BBW A;  4K0K Q;  4JCV E;  4DKA C;  3JAM c;  4UPA A;  1K9M C;  2ZJQ A;  2JA8 H;  5FLM H;  5FJ8 H;  3PUY A;  2IX1 A;  1GO3 E;  4YCV A;  2AMC B;  1P16 A;  1QUQ B;  1X56 A;  2GVA A;  1K83 H;  2CFM A;  1PYS B;  2ES2 A;  1TWC H;  2NN6 G;  4O0A A;  3KOJ A;  4QGU A;  3CCR A;  4JI3 L;  4JBM A;  4BBR H;  2HHH Q;  2CKZ B;  3RLF A;  1AE2 A;  3STB C;  1AE3 A;  1T9H A;  3U50 C;  2E2J H;  3M3Y H;  1VQL A;  4LF8 Q;  1OTC A;  2N78 A;  1IZ6 A;  2A19 A;  1L1O C;  4JBW A;  4Y7N H;  2R92 H;  2YU9 H;  1FVI A;  2ALY B;  4OO1 G;  2GVB A;  2Y0S G;  2E2I H;  2JA8 G;  4HIK A;  4HJ7 A;  4X66 L;  1X65 A;  2LXK A;  1XMO L;  2NVQ H;  1K0R A;  4UP7 A;  4YY3 Q;  4LWC A;  3T1H L;  2GN5 A;  1O7I A;  5GQO A;  2IHF A;  2VW9 A;  2JA5 H;  2RCN A;  4JI6 Q;  2K52 A;  2CQO A;  3TQY A;  2QGQ A;  4X62 L;  1WCM H;  2JE6 I;  2VQE Q;  4LFB Q;  1SR3 A;  3AFP A;  4BY1 G;  4KI0 A;  1JMC A;  4IPG A;  1IBK L;  4YY3 L;  4JYA Q;  3KF6 B;  3PUW A;  5C4X H;  1HJP A;  1PH9 A;  2N49 A;  3CPW A;  3OYY A;  1Y1V G;  1HR0 L;  4LF4 Q;  3I4N H;  4R4O A;  1YHA A;  2HHH L;  5IP9 H;  2VS1 A;  3H15 A;  5LMN L;  4BXX G;  1DGS A;  2EXD A;  2F4V Q;  2AWN A;  4UY8 C;  4AYB E;  3HOW G;  3S2D H;  1I94 L;  2VNU D;  2YTX A;  2CWP A;  4DV1 L;  4P72 A;  4GLV B;  2R93 H;  1LYL A;  2Y0S E;  3NEL A;  4L5Q A;  4X65 Q;  4IOA A;  3ULL A;  1C0A A;  3CXC A;  3HOX G;  1A8V A;  2IT1 A;  2IX0 A;  2PNH A;  1OXT A;  4AIM A;  3J81 j;  1QZG A;  1VQ6 A;  4DV0 L;  4ALP A;  1HH2 P;  3JC6 6;  1PH1 A;  4LFB L;  3TRZ A;  2NN6 I;  2QA4 A;  2Z6K C;  1EQR A;  4GNX C;  3S1M H;  1IBL L;  4DAM A;  1QVC A;  5GAH C;  2E5L Q;  1NTG A;  4JV5 Q;  2KHJ A;  4UP9 A;  3U4V A;  4JG2 A;  1KRT A;  1PH5 A;  1PH2 A;  5M5Y H;  1X3G A;  2MNA A;  1B70 B;  2IHE A;  2KCT A;  1NE3 A;  5IYC H;  3K7U C;  4HIO A;  2K5H A;  3D0F A;  4IOC A;  4LF9 L;  2A8V A;  3I4M G;  2E5L L;  2WAQ E;  1HNX Q;  4OX9 L;  1FL0 A;  2MQH A;  1CKO A;  3F2B A;  3GTM H;  3H0G H;  2JA7 H;  4BBS G;  3AQQ A;  4IFD I;  1YJ9 A;  3S1N H;  3GTK H;  4A93 H;  2OQ0 A;  4IO9 A;  1YIT A;  4DR1 L;  5JJI A;  5JEA G;  2JQO A;  2B63 H;  1Q8K A;  1YBY A;  3NBH B;  4IFD J;  1RIP A;  2KHI A;  3G48 A;  2YTY A;  4A3F H;  1NJI C;  1KXL A;  1UEB A;  5ELO A;  1UE7 A;  3DLL A;  1KD1 C;  2DGY A;  5IWA L;  2R93 G;  4LUZ A;  1J5E L;  1VS0 A;  2Q2H A;  3BJU A;  4X6A H;  3SGI A;  4A4I A;  1G29 1;  4DK6 C;  2XGT A;  2IY5 B;  4A3J H;  3RNU A;  1VQP A;  1X9N A;  1KC8 C;  4Y52 H;  3J81 i;  1S3O A;  4NXM Q;  2UXD L;  5C44 G;  1X55 A;  5AJ3 L;  2XTI A;  5HY6 A;  4K0K L;  3CC2 A;  2R7D A;  3HOU H;  4DR5 L;  4DV6 L;  2B63 G;  3G6E A;  2KEN A;  5M5W H;  1XTD A;  3B6Y A;  1UE5 A;  2F4V L;  4AH6 A;  3HOY G;  3KJO A;  2ZJP A;  3M85 A;  3ULJ A;  1YIJ A;  3CC4 A;  1U5K A;  4JI4 Q;  3HOZ H;  1Z9F A;  3PSI A;  1P8L A;  1RL2 A;  3K8A A;  4B3M Q;  1SLJ A;  3I55 A;  1Q12 A;  1EYG A;  1WYD A;  3K81 C;  2FXQ A;  5J3B A;  3I4N G;  3TEH B;  3L0O A;  1I3Q H;  2ZTD A;  1G6P A;  5M5X H;  1X6O A;  1VQK A;  4A93 G;  4YWM A;  1X3F A;  5FLM G;  4LF7 Q;  4DR4 L;  4QJF A;  3I2Z A;  3JAM i;  3K80 C;  3RN2 A;  1IBM L;  4DR3 L;  4KHZ A;  3UDI A;  1JJC B;  4B3T Q;  1H95 A;  4O2D A;  1XPU A;  1S72 A;  4X66 Q;  3PO2 G;  1N33 L;  4JI5 Q;  4MTN A;  4R4T A;  4UP8 A;  5AJ3 Q;  3CD6 A;  4MZ9 A;  2B29 A;  3CQZ H;  4LFA L; 
#chains in the Genus database with same CATH topology
 1BQQ T;  3U9S A;  1IKM A;  3HKZ E;  4A3D G;  1GJX A;  3S1Q B;  1Q86 C;  4ME5 A;  4HJA A;  3LWE A;  1XNR L;  4QIW B;  2J9G A;  1SE4 A;  4XQJ A;  5IGE A;  4HNV A;  3MXP A;  4DAY B;  3CU7 A;  1WOC A;  1LV9 A;  4IJL A;  1SE3 A;  2I5L X;  1O75 A;  2VPQ A;  4PMC A;  3CCU A;  2PQE A;  3KXY T;  4YBZ B;  4BY1 H;  4F4Z A;  4RHS A;  4DR3 Q;  2ZM6 Q;  4I7Z C;  4ID6 A;  4RGM A;  1JE4 A;  4XIG S;  5GAG C;  2CCZ A;  2WB1 E;  4L5S A;  3Q0A A;  3HP3 A;  3PIO 3;  4DUY L;  2UUB H;  3HOU B;  2ZM6 L;  2F3I A;  5GAE C;  2UU9 Q;  3HOX B;  3H3V C;  1VAJ A;  4MV8 A;  2UXB L;  4O4L F;  2K5D A;  1Y14 B;  1SFO H;  4DV3 Q;  2XCL A;  5I2Y A;  1EYC A;  4GOP C;  4MTK A;  4LMQ D;  1FJG L;  1RYS A;  1CUK A;  3BAB A;  2ZJR A;  2Z6K A;  1IKL A;  2L15 A;  4JI0 Q;  3A74 A;  4ME3 A;  5EOY A;  4DPG A;  2E2H H;  4B3T H;  1HNX L;  4ED3 A;  3TS2 A;  1PV4 A;  3TZU A;  1PA6 A;  1H9R A;  3ND9 A;  3GIQ A;  3PUX A;  3RFC A;  4OWW B;  1SMX A;  2R8G A;  2YCH A;  4KHP Q;  2XIG A;  3GTQ H;  1JB3 A;  1F9Q A;  2YZN A;  4KV6 A;  4MN3 A;  2A68 C;  3TP5 A;  2D0P A;  3NTH A;  1OXX K;  3RR5 A;  4CDD C;  5LL6 b;  4HR7 A;  4GLA C;  5E4X A;  5JEA J;  3HOX H;  3S2H B;  1R9T A;  3RAX A;  1A9X A;  3DUZ A;  5E1F A;  3FHW A;  2UUA L;  4JI2 L;  5NUC A;  4C1N K;  4UHV A;  4EFB A;  1EY4 A;  2SEB D;  4Q0F A;  4I50 F;  2FMA A;  4HCE A;  4TV9 F;  2WAC A;  3T1H Q;  3OHX C;  1V43 A;  2FP4 B;  4A3E G;  3MWM A;  5M3M H;  1XMO Q;  3N6R A;  5KT6 A;  2BH2 A;  4IUT A;  3KF6 A;  5M5X B;  1KHI A;  2JEG A;  5FPO A;  1E2W A;  1DOL A;  1TWF B;  1IBL H;  4XTC S;  4YB8 B;  4DR6 Q;  5KFM A;  2F0V A;  5T1G A;  1B6S A;  3P20 A;  4OX9 Q;  4A3B B;  2HUG A;  1I6V C;  4HJ5 A;  2G9H D;  1MHW C;  1SRO A;  5KFJ A;  3IFT A;  3EPG A;  3GTP A;  3LWU A;  1B1Z A;  4H0L C;  1EY0 A;  3HOU G;  4V0B A;  4WOR A;  3S2H H;  4NXM H;  3JRX A;  4U67 3;  2X69 A;  2BE5 D;  1N56 A;  1DCZ A;  4R4Q A;  1Y8P B;  3NEM A;  4DN4 M;  4EQ5 A;  4NLG A;  1SYX B;  1N33 Q;  1FGU A;  4X64 H;  3PO3 G;  2K5V A;  4DV7 Q;  4R1J A;  1ULZ A;  2TSS A;  4LFA Q;  2JEI A;  1SNM A;  5M3M B;  4POF A;  3RMH A;  5BR8 Q;  4U7C A;  1TS2 A;  2OLS A;  2NVQ B;  2X6G A;  1MZB A;  5I6W A;  5D1O B;  2XC9 A;  2WAQ G;  2R6F A;  4Q8F A;  2R6G A;  4HJ8 A;  3QOJ A;  2EYF A;  4DV5 Q;  2PZU A;  3KHL A;  3W1G A;  1QIL A;  4JV5 L;  4X62 Q;  1CQI B;  1A0I A;  4MHE A;  4FP5 D;  3CW2 C;  5HGQ A;  4A3D B;  3RGZ A;  4J9K A;  1IXR A;  2CW8 A;  1S0O A;  1JT8 A;  2BR0 A;  1U4L A;  3ERO A;  3UDF A;  4JI7 Q;  5M9O A;  3JRW A;  1YHQ A;  3E6Z X;  2OEO A;  2D2C C;  4HED A;  1TWH A;  4EYI B;  4LF5 Q;  4C3H H;  4C2M B;  2EXZ A;  4A3G B;  1TAE A;  4R8N A;  2RDG A;  3WO0 A;  1XJV A;  2B2Y C;  1PK8 A;  4MTE A;  4NXN L;  4WJ4 A;  3WNZ A;  3BDL A;  5L1K A;  1A62 A;  5G3L F;  3T5L A;  3DHQ A;  3QR8 A;  3PVX A;  3CAM A;  5C0X H;  4DV3 L;  2GLT A;  3BDO A;  5H1S E;  2ZJT A;  5CBE E;  3S15 H;  3NTK A;  3U9T A;  1J5E Q;  3TIG A;  2NZH A;  5IY0 A;  4YJ3 F;  2D9U A;  2JEA I;  3EVQ A;  1KJQ A;  2BA1 A;  3CCE A;  2UVU A;  1KBL A;  1BBX C;  4H44 C;  1EWI A;  2WTF A;  1A63 A;  2YU9 A;  5G3L D;  5T1I A;  3FP9 A;  4CKB A;  3TME A;  1RJQ A;  3GV6 A;  4WJW A;  3OUU A;  1JOK A;  4YP3 A;  3M9O B;  4N8F A;  3TZD A;  4TKO B;  3KF8 B;  2JA6 H;  4A3G H;  4BY7 G;  4DV2 H;  3J81 c;  3NBI A;  4RUA A;  3HOV H;  3PF4 A;  1HQM C;  5LHY 1;  2K4K A;  1LTI D;  3ICE A;  4A3L H;  2DUD A;  1Q1B A;  3E5S A;  3NGD A;  3ORQ A;  1HQR D;  3VMM A;  3T1Y Q;  2JA5 A;  1RHP A;  2R7N A;  3Q24 A;  4BA2 I;  1XPR A;  5FPR A;  4RUC A;  1BVS A;  1BOS A;  2VXW A;  3N42 B;  3T1Y L;  2F0M A;  1SJH D;  4YCU A;  1WVL A;  5KFA A;  3LGJ A;  1WTO A;  3QJY A;  3PUZ A;  4DUZ Q;  2MO0 A;  5EDW A;  3VYU A;  4V19 0;  4ED1 A;  2VL6 A;  4C3I B;  3GTP B;  1L0W A;  5D1O A;  4J15 A;  3GTJ H;  4P71 A;  5I9P A;  1Z2N X;  3JSN A;  2W6Q A;  2UXC Q;  1VBH A;  4P2C B;  1KQS A;  1CHQ D;  3W3A A;  4R7R A;  1HZB A;  4ED6 A;  4AYB G;  2VUM H;  1CHP D;  3J80 i;  3X3M A;  1EL0 A;  4ZUI A;  3EPI A;  3KHH A;  4TVA B;  2WII B;  5KGU A;  1EQQ A;  4TSS A;  1S9F A;  1M7J A;  4CKC A;  5LMU L;  1K8O A;  4RGO S;  2JA9 A;  5CA1 F;  1SCU B;  4L5T A;  4X65 L;  2EVB A;  1E1O A;  1Z2P X;  2WAQ A;  4BWS C;  4XQN A;  3I12 A;  4BBR G;  3MWD A;  1MI2 A;  1JIC A;  3C2P A;  3K5N A;  2PYK A;  1UNS A;  2PO4 A;  2XNA C;  2ZTC A;  4KY7 A;  4DV0 Q;  1B7Y B;  1WJJ A;  3S1Q H;  4GKK Q;  3M9B A;  1GOZ A;  2ASD A;  5IE8 A;  1LTT D;  3SE7 A;  4C56 C;  2RHS B;  4JI7 L;  4DR3 H;  2RDF A;  1DOK A;  1BDO A;  4R8I A;  1ENA A;  3OTO Q;  4BXX H;  2R84 A;  4MV7 A;  2UUC Q;  1MBY A;  4B3M H;  5M3M G;  2VQD A;  3AMU A;  3KYH C;  3Q2O A;  3HOY H;  4NXN Q;  4DLK A;  4R8U B;  1PZI D;  3GID A;  3FKI B;  3G7L A;  2CHB D;  1XWE A;  4DR4 Q;  4XYM B;  2PMZ A;  5LMN W;  3KAJ A;  3A5Z B;  5C3E H;  5C6A A;  3OW2 A;  2OWO A;  4ZKB B;  1TS4 A;  2W8L A;  4DL7 A;  4X64 Q;  5BR8 L;  1WTX A;  1E1T A;  4JOI C;  4A3M G;  3T5J A;  2CVR A;  4I7A A;  3W5O A;  4ECZ A;  1S40 A;  1WFQ A;  1KLG D;  1TXY A;  3T56 B;  4AQY Q;  5IGD A;  1UE6 A;  4I65 A;  3MJF A;  1N8R C;  1UNN C;  4DV4 L;  1TWG H;  3A8I E;  1N32 Q;  3PW0 A;  4DR7 L;  1Y1V A;  1GVP A;  4P74 A;  2AQ2 B;  2J6S A;  5FLX E;  3OSO A;  2QIL A;  1XNR Q;  3CQZ A;  1BBW A;  5K5P A;  4K0K Q;  4O3N A;  4JCV E;  1G91 A;  1RTN A;  2IPK D;  1GO3 E;  4UDU C;  4YCV A;  1P16 A;  3VYR A;  5LOV F;  2CFM A;  1FD7 D;  3CKI B;  4IWY A;  1ILQ A;  3MXG A;  4G57 A;  4O0A A;  4QGU A;  4F4X A;  1KJ8 A;  2YRX A;  2PZT A;  1Q3L A;  3M3Y H;  3GTG B;  4EGV A;  4DNT B;  2E5L H;  1STY A;  2EY1 A;  1VQL A;  2A19 A;  1L1O C;  4Y7N H;  2KJX A;  4E4T A;  1BNZ A;  4RB3 C;  2JA7 B;  4OO1 G;  3MR2 A;  2Y0S G;  5ELC A;  1UUP A;  4HIK A;  2NVX B;  4DK1 A;  2NVQ H;  4DFA A;  4LWC A;  2JA5 H;  2GN5 A;  1O7I A;  2HCI A;  5JVH 3;  2JXM B;  5EWE A;  2K52 A;  1F9P A;  2VQE Q;  2QGQ A;  1JOO A;  4LFB Q;  3V6J A;  1KAA A;  4L6T B;  4XX0 B;  4JYA Q;  1TT2 A;  3QIA A;  4J9P A;  1HJP A;  3DF7 A;  1GYF A;  1Y1V G;  5ELB A;  3OPO A;  3I4N H;  1S68 A;  2EDG A;  3H15 A;  1LAC A;  1DGS A;  1AUV A;  5KT5 A;  3C1E A;  3BG5 A;  3BA9 A;  4AYB A;  4LFA H;  1CS0 A;  1I94 L;  3PO3 B;  2CWP A;  3RGX A;  5DQG A;  4P72 A;  3VPC A;  2Q8R E;  4GLV B;  3N40 P;  2R93 H;  4OIK A;  3SR1 A;  4YY3 H;  4X65 Q;  3HZX A;  1I50 A;  3X3N A;  4DU9 A;  3GTQ A;  3KLR A;  4RNM A;  4AIM A;  4QW8 A;  1N33 H;  5IT9 W;  3KBX A;  1HH2 P;  3JC6 6;  5CC4 A;  3RV4 A;  2CH4 A;  2HD3 A;  4K5X A;  2NN6 I;  2Z6K C;  1SXT A;  1VKZ A;  1IBL L;  1NTG A;  3HS0 C;  4UP9 A;  3H20 A;  4Q0Y A;  3IL8 A;  1S5C D;  1KRT A;  3AB9 A;  5M5Y H;  4ZHQ F;  4O4H F;  3K7U C;  2A8V A;  5C8Y F;  2XRQ D;  1FL0 A;  1Z7T A;  4L1K A;  3F2B A;  1PTO B;  3H6M A;  4QWA A;  1QNK A;  1I50 B;  3T16 A;  4K14 A;  2PMZ B;  3I70 A;  2VR1 A;  4ETS A;  3GTK H;  2F0N A;  2QF7 A;  3JAM W;  4DR1 L;  5C5L A;  5KFX A;  1Q8K A;  1YBY A;  3NBH B;  4IFD J;  5JUM A;  3G48 A;  1X3Q A;  4K6L A;  1CK1 A;  1HFN A;  1UE7 A;  2L12 A;  1WTR A;  3PO2 B;  5IWA L;  3UFX B;  1KEE A;  1K1S A;  1PTO F;  3FDS A;  1O80 A;  3BJU A;  4ZUJ A;  4X6A H;  1X3P A;  4YR0 A;  2IY5 B;  5EQ0 A;  3J81 i;  1S3O A;  4JI8 H;  2RDI A;  1UC9 A;  4KJN A;  2XTI A;  5HY6 A;  4DV4 H;  3CC2 A;  3ETH A;  2IW3 A;  4OGQ C;  3I73 A;  4ZLT F;  4EBE A;  2B63 G;  4FNF A;  3MR5 A;  4GKK H;  4M9U A;  2KEN A;  3V96 A;  1PTO H;  4F87 A;  3HOY G;  1D1I A;  3KJO A;  1YIJ A;  4O2B F;  5KG5 A;  3PSI A;  4B3M Q;  3H40 A;  2W9B A;  4UCU A;  3TQT A;  1Q12 A;  1EYG A;  1PRT B;  3K81 C;  3K5M A;  2R7Z B;  1WTW A;  4CJ1 B;  1I3Q H;  2ZTD A;  3HGB A;  3C1F A;  1G6P A;  4Q43 A;  1B33 N;  5M5X H;  1X6O A;  2MHV A;  1X3F A;  4YWM A;  4LF7 Q;  5L1L A;  4BS9 A;  4DR4 H;  3R3O A;  3UI2 A;  3UDI A;  1H95 A;  2KUM A;  2Y0S A;  4B3S H;  3NHH A;  3PO2 G;  1CQV A;  5IT9 E;  2B29 A;  1SE2 A;  2NTT A;  1IW7 D;  3OSP A;  2F3V A;  3NEN A;  3GQC A;  2SNS A;  1TWA B;  1CA6 A;  1XMQ L;  3VR5 A;  4JI3 H;  3J7A F;  4C5C A;  2VQF Q;  2VUG A;  4DAP A;  2NVT B;  4LJZ C;  3NUC A;  4IRC A;  3SK6 A;  4A3F B;  4RKL A;  1RK5 A;  4RH6 A;  3D6C A;  3A7L A;  3CPF A;  1GHK A;  1HR0 H;  1FGB D;  3EQL C;  4MA0 A;  5LMU H;  2DWC A;  2VOB A;  4XYL B;  2B63 A;  1HZ9 A;  1ZYR D;  4GNX A;  1M0T A;  3Q22 A;  3S17 H;  1M90 C;  4B3T L;  4LF8 L;  3GTQ B;  2A1A A;  3RZO B;  1V9P A;  1EU4 A;  5GON F;  4TUY F;  1E24 A;  4CC5 A;  3D4W A;  1FNV A;  3VA5 A;  1D5X C;  1HTL D;  2F0D A;  1TA8 A;  3FEW X;  4OWX B;  3G6X A;  4R8U A;  4RMF A;  3OUZ A;  1YZ6 A;  2A6E D;  3DWP A;  5KFP A;  3MHB A;  2KED A;  3T5K A;  1PH8 A;  3OIP A;  4RU9 A;  2F0S A;  1TWG B;  2HQL A;  1GKH A;  2Z0S A;  5EKI A;  4FXD A;  1MD2 D;  2YYZ A;  2MCT A;  2PMZ E;  4ECX A;  5EBC A;  3PCO B;  3KK7 A;  2F0K A;  4ECQ A;  1HNW Q;  2EY6 A;  1O7Z A;  3J80 c;  2JSO A;  3KHG A;  3OTO L;  4Q5V A;  4KK7 A;  4CJ0 B;  3I90 A;  1E0B A;  2UUC L;  1JC7 A;  5D3I B;  3RZO H;  1WI5 A;  2UXC L;  3CQZ B;  1IOW A;  1OWT A;  3FKI H;  4BBR B;  3RUZ A;  4EYH B;  5KFD A;  1M0W A;  3KUP A;  1EY5 A;  4LK1 C;  2K03 A;  4YAJ B;  1NY4 A;  3PF5 A;  1N32 H;  4X65 H;  3FMC A;  3NWT A;  2F0O A;  2LSS A;  4HR7 B;  3Q8D A;  5L37 A;  2ASB A;  2QEX A;  5IYZ F;  1LO5 D;  4RGT A;  5FLX c;  4NKL A;  1IBL Q;  2KCM A;  4JV0 A;  4G3I A;  5M3F G;  1HNZ L;  3S9W A;  3M4O H;  2YYA A;  1BKB A;  5DLG A;  1MIU A;  5LL6 X;  3GTM A;  1KTK A;  3H0G A;  4ME6 A;  1QOH A;  4DK3 C;  3FDT A;  2BQR A;  1GHJ A;  4JI1 H;  2I5M X;  1AN8 A;  4IUU A;  1XYI A;  2XN9 C;  4DV3 H;  4RAY A;  5FOB B;  1MJE A;  2Q2T A;  3E0E A;  2Z1C A;  1PYB A;  2E75 C;  1YJW A;  5DLF A;  1U4M A;  4QIW E;  5I9O A;  1B6R A;  4LSX A;  4JI0 H;  3W2D A;  1QUQ A;  4DV7 H;  2B2T A;  3HRZ C;  1C30 A;  4C2M H;  4C3H B;  3GTG H;  1STG A;  4DV6 H;  4HQ6 A;  4NP5 A;  4A3C H;  4DR5 H;  2QYZ A;  2VQE H;  3BU2 A;  2FMM A;  2RBM A;  2XGP A;  4B9X A;  1KNA A;  1VQJ A;  1V1P B;  2ZTE A;  5JJZ A;  3CMA A;  4HMJ A;  3CCS A;  2UXD Q;  2YZG A;  1SRU A;  3M7N A;  4C1N I;  4K8I A;  2ZDQ A;  1W96 A;  1DIK A;  3KLS X;  5KG0 A;  5BPF A;  2B2U C;  1EIY B;  1EFI D;  4DV4 Q;  1N9W A;  4HIM A;  4QF4 A;  2VQE L;  2BQ3 A;  4OHJ A;  2C35 B;  2EY5 A;  2PW7 A;  4DK0 A;  1ZYR C;  3BQ2 A;  2F3W A;  3I72 A;  4KKS A;  4JBJ A;  1Y1V H;  4RGN A;  1DOM A;  5IP7 G;  3CCL A;  2FB9 A;  3OOC A;  3RIZ A;  1YEZ A;  3J81 E;  3CCM A;  4DR6 H;  2EYP A;  4LF8 H;  2OXP A;  1V1P A;  4IWX A;  1I4P A;  2I8C A;  3STB D;  2ASL A;  4LF7 H;  1SNP A;  3SI8 A;  4X3U A;  4QCL A;  5EPL A;  3N8D A;  4FDB A;  5C3W A;  1NBW A;  4B3S Q;  4MV3 A;  2K1B A;  3AYH B;  3D3R A;  5C4X G;  4C3J G;  3S14 B;  2ATL A;  1S10 A;  3HOY B;  5DGA A;  3NTI A;  2BQU A;  4YCW A;  1RKN A;  2R3Z A;  2R85 A;  2C2D A;  1E4E B;  1I4X A;  1IYU A;  5BPH A;  5KFB A;  2VQF H;  2MUY A;  1MKH A;  1S5B D;  1VMP A;  4LUV A;  1JJG A;  4LF6 Q;  4RHR A;  4UCO A;  4LF4 H;  4PMB A;  4ZKC B;  2UUB Q;  2FLP A;  4LFC L;  4ZQI A;  2EY2 A;  4G7Z C;  4C3I H;  1XMQ H;  1DZ1 A;  5C0X I;  2DJF C;  2B3G A;  5KFL A;  4ECR A;  5LMN Q;  1NMF A;  2F0T A;  3BYY B;  4X62 H;  5CB4 F;  1J6Q A;  3RZD H;  4ZYS A;  1KC7 A;  1F9R A;  5C1P A;  2RQX A;  1KDA A;  1WTQ A;  3GTO H;  4QQB X;  3JSL A;  1JX4 A;  1UEA B;  1HUN A;  3D4R A;  1VQ9 A;  4MV4 A;  1E4E A;  3GV5 B;  4MV6 A;  1IHZ A;  2FHT A;  4PG3 A;  4JI5 L;  1L2Z A;  3BQ0 A;  4ZK9 B;  2BA0 A;  1FKA H;  1TWC B;  2H4O A;  4EX5 A;  4YR3 A;  1QG7 A;  1IL2 A;  4JW0 A;  4OON A;  4DR6 L;  5L9X A;  2OCE A;  4BWG B;  3UDG A;  1ROD A;  1X54 A;  2W8K A;  1NCV A;  1LAB A;  2DLN A;  2RVL A;  4QMG A;  2NVT H;  5I2X A;  4UCR A;  2M00 A;  5CMD A;  1F77 A;  4MV1 A;  1G6Z A;  4A3B G;  3KLW A;  1J5E H;  4FF1 A;  5KKN B;  1E7Z A;  4A75 A;  2DZD A;  2LXJ A;  2X0S A;  1AP0 A;  5I4D A;  1WTH A;  3BG3 A;  4IUQ A;  1EY9 A;  3RD4 A;  1EU3 A;  2GPW A;  3OMC A;  5TSS A;  4A3E B;  2J0T D;  3DMU A;  2LFN A;  4GZY C;  2EZV A;  1JXL A;  2R8K A;  4ED7 A;  3BZC A;  2BH8 A;  1EIH A;  2K75 A;  1LTG D;  1HNX H;  3QB3 A;  1K8A C;  2NU7 B;  1CZG A;  4DUY Q;  5K36 H;  1PVO A;  5M3F H;  3I56 A;  1VQB A;  2N8N A;  3FPU B;  4PNY A;  5IWA Q;  1HRJ A;  3QOL A;  1FNU A;  5C44 B;  3HG9 A;  4GN3 B;  1LT6 D;  5A2Q L;  2E2J B;  5E4W C;  1QE6 A;  3CRK C;  5LMU Q;  4A3G G;  1II3 A;  4I55 F;  3LX0 A;  3PO3 H;  2W9A A;  1I4G A;  4NB3 A;  1K8G A;  4H02 A;  1CKN A;  2B2W C;  2VQF L;  4OEL B;  2CWA A;  5FJ8 G;  2ZDG A;  4QL5 A;  3V6H A;  1J9O A;  3TP8 A;  1SMY D;  3G4S A;  3GIK A;  3L2P A;  1W3S A;  1QVG A;  2XWB B;  2MO1 A;  3L7Z C;  2C2R A;  5DLQ E;  1QZH A;  3S16 H;  4IUV A;  3RLO A;  1YNJ D;  1G51 A;  1ICF B;  1HR0 Q;  4B3R L;  1CSQ A;  4PV1 C;  2JA6 G;  4A3C G;  2XD4 A;  2WAQ B;  4JUZ A;  1C7Y A;  1JCK B;  1LTA D;  1F2Z A;  4FS1 A;  1BUV T;  1YNN C;  3HOV G;  3MEF A;  3GII A;  2PW5 A;  4B3R Q;  1F9S A;  3HKS A;  5J39 A;  4IFD G;  2O03 A;  2AUK A;  3OSN A;  5DG9 A;  4LFC H;  1JOR A;  3F8T A;  4RG1 A;  2I80 A;  3M9N B;  5JJL A;  3K58 A;  2L1B A;  1VBG A;  1R9T B;  5C0X J;  3U58 A;  2B8F A;  4K0K H;  2AGO A;  4U6P A;  4OEM B;  1LTL A;  1YNX A;  3PZP A;  1ENF A;  4J9M A;  2F0G A;  4DKA C;  4FVM A;  2JA8 H;  4EEQ A;  3S1R B;  2NU9 B;  2IX1 A;  2AQ1 B;  5FD5 A;  5D3D A;  5JVD F;  2R87 A;  5C4X B;  2GVA A;  3Q23 A;  4A3J B;  1QNU A;  4KD3 A;  1PYS B;  3GIP A;  2BDN A;  3KTM A;  3KOJ A;  5CBA E;  3MWE A;  2VA3 A;  1Y1W A;  4JBM A;  4J9N A;  4BBR H;  3STB C;  3RLF A;  3U50 C;  1T9H A;  1SNC A;  5JPN C;  2BCO A;  4LF8 Q;  4PDB A;  1JWS D;  2N78 A;  3QWN A;  2NUA B;  1JDE A;  3J7Y W;  1UAP A;  1QJO A;  5CV9 A;  2Z8L A;  5EWG A;  3J80 W;  1FVI A;  2ALY B;  2GVB A;  5KFW A;  4HJ7 A;  4DL2 A;  1X65 A;  1XMO L;  2HJW A;  4DL3 A;  4LFB H;  4DV0 H;  2BOS A;  2RSO A;  4J8Q A;  3T1H L;  4X3T A;  3OWE B;  2VW9 A;  1Q8I A;  1K8M A;  2XCP A;  4DR7 H;  3TQY A;  1WCM H;  2B39 A;  3L3O C;  1SR3 A;  3AFP A;  4QUF A;  1JMC A;  5KNC A;  3NE5 B;  2LY7 A;  1IBK L;  3PUW A;  5C4X H;  1KDC A;  3OYY A;  3CPW A;  2PVP A;  2V9W A;  4LF4 Q;  5KFC A;  1D5M C;  4LF6 H;  1YHA A;  2NTS A;  2HHH L;  1O7L A;  1A2U A;  2J7Z A;  2VS1 A;  5IP9 H;  5LMN L;  1DON A;  4BXX G;  2WE6 A;  4XXE A;  2ZXO A;  2CW7 A;  3HOW G;  3S2D H;  4DV1 H;  4XYO A;  3K59 A;  2UXD H;  2KQ3 A;  3D6W A;  3J80 L;  3EA6 A;  3NEL A;  1ICW A;  1C0A A;  2R61 A;  3CXC A;  2A69 C;  2HGS A;  4KMU C;  3E5N A;  3DM1 A;  4DV0 L;  1PH1 A;  2E76 C;  5EZY F;  4B08 A;  1WCM B;  3VPD A;  2K33 A;  2CZG A;  1EQR A;  4GNX C;  2NU6 B;  4JV5 Q;  2E5L Q;  2K5Q A;  3J81 W;  4JG2 A;  1PH2 A;  1F2Y A;  1R4P B;  2M2L A;  2CW0 C;  3WOF A;  4YIJ A;  4IOC A;  1HTP A;  5IYC H;  3D0F A;  4LF9 L;  2E5L L;  2WAQ E;  3V6K A;  2MQH A;  5BN5 A;  1XNQ H;  1EY8 A;  5FLX L;  3GTM H;  3H0G H;  2JA7 H;  4BBS G;  2FJZ A;  2FPP B;  1YJ9 A;  1BGW A;  1UC8 A;  2PN1 A;  4A93 H;  2OQ0 A;  5CV7 A;  5CV5 A;  5ISR A;  2JQO A;  1D5Z C;  1NJI C;  1I3Q B;  5ELO A;  1DV1 A;  1SYD A;  1IBK H;  4TRD A;  4ILW A;  4ABN A;  1BXT A;  1ET6 A;  2DGY A;  1DYQ A;  3OTO H;  4BY7 B;  4M8A A;  4HNU A;  4CBV A;  1VS0 A;  2XIW A;  3SGI A;  4A4I A;  3GTG A;  3RNU A;  3Q6S A;  3K5L A;  1A6X A;  3V05 A;  2UXD L;  5C4H A;  5C44 G;  1BJT A;  2R92 A;  5AJ3 L;  4K0K L;  3BA8 A;  4M1U B;  2F0W A;  1SMY C;  2JN4 A;  2MJ8 A;  4H7B A;  2FLL A;  1HA5 A;  3BZD B;  1S5E D;  1XTD A;  3B6Y A;  2IWH A;  5M5W H;  2R92 B;  2F4V L;  1MGS A;  3GTM B;  3NBH A;  5KFZ A;  4AH6 A;  1B2T A;  3T51 B;  3M85 A;  2E2H A;  3CRL C;  1U5K A;  5KFV A;  1Z9F A;  4IR9 A;  3SK8 A;  1SLJ A;  2R7K A;  5FO8 B;  5KFG A;  5J3B A;  3I4N G;  3VYS A;  1EZ8 A;  4DAV A;  2JEJ A;  1ONL A;  1CZW A;  1VQK A;  2YL2 A;  5FLX W;  3JAM i;  3K80 C;  1G2T A;  4J9L A;  4DR3 L;  4ECS A;  4UCV A;  4AYB B;  1S72 A;  1XPU A;  5C3X A;  3CD6 A;  2F4I A;  3L4J A;  3VA7 A;  2W6Z A;  2W57 A;  1EUC B;  2J4X A;  3IKJ A;  1ZXT A;  5A35 A;  5CV6 A;  2UU9 L;  4X3K A;  2V4R A;  4IRK A;  4DUZ L;  4JI2 H;  2UUA H;  2HIV A;  1T94 A;  4A76 A;  3U4Z A;  1PH3 A;  2W70 A;  3R5F A;  3PR4 A;  4BBS B;  5HGT A;  4GKK L;  5I47 A;  1M8A A;  3NSW A;  1VQ8 A;  1OO9 B;  1VQN A;  4K6D A;  5E3F A;  3G6J B;  1AUX A;  5E7N A;  3V4Z A;  2LS0 1;  4YQW A;  5KFI A;  3BQ1 A;  2N3S A;  2OQK A;  4LF6 L;  1KIX A;  2W6M A;  2Q8I B;  5H80 A;  4WBN F;  3MVV A;  2PI2 E;  1FR3 A;  3BVZ A;  3CP0 A;  4MV9 A;  4X66 H;  1VQI A;  4QB4 A;  2I87 A;  3RB6 A;  3F2U A;  3VR4 A;  4GC6 A;  2D62 A;  5KFE A;  4GNX B;  3SE0 A;  1GLV A;  4A3D H;  2KA7 A;  4DNR B;  1FNW A;  1QB5 D;  1PDQ A;  3MR3 A;  2Z6B A;  1STH A;  4DR2 Q;  1PH7 A;  4A3K H;  5KFF A;  1Y1V B;  5K36 G;  5KX5 F;  2SDF A;  3J80 E;  4KY5 A;  5DQH A;  3T53 B;  1U9R A;  1Q7Y C;  1ASZ A;  5BN3 A;  3M7G A;  2UVV A;  3HOZ B;  4C3J B;  1GGO A;  2AKW B;  3ERS X;  2B63 B;  2R7Z H;  3RN5 A;  3M4O B;  3PV0 A;  4P73 A;  4DR7 Q;  1Q1E A;  1NR2 A;  4BA1 I;  5JJK A;  4A2A A;  1IW7 C;  1JR0 D;  4XQQ A;  4EBD A;  5IP9 G;  4O3O A;  3TQ1 A;  1T3N A;  2KEE A;  5KT4 A;  1YI2 A;  2H1E A;  2VY3 A;  5KG2 A;  5JPM C;  5EBD A;  3CCQ A;  5DNF A;  1W93 A;  4JI3 Q;  2NYZ D;  1EQV A;  1VQ7 A;  5DG7 A;  5FK9 C;  3F8N A;  2NZ1 D;  4GC7 A;  1W6K A;  2IP4 A;  4DV1 Q;  2JA7 A;  1TWA H;  3PW2 A;  1PH4 A;  3TS0 A;  3A55 A;  4X64 L;  1CSP A;  1B44 D;  3M4Q A;  4NMZ A;  3BZK A;  3RAQ A;  5DEH A;  3J7A 5;  3ZJY C;  4IFD H;  4IZO A;  2WKD A;  5DGB A;  2H5X A;  4POG A;  1SYC A;  1TR5 A;  3U9O A;  1EUJ A;  4A2B A;  4CDC C;  1C48 A;  1KJJ A;  4XT1 B;  2OH2 A;  1VQC A;  3UQ8 A;  5IYD G;  2EOT A;  1GD7 A;  1ZET A;  1C4Q A;  4RWS C;  5IYC G;  2HQE A;  3N44 B;  2XRS D;  3MXN B;  2F0E A;  4RB0 A;  2K01 A;  4HID A;  1T5X D;  3GTO B;  4JK1 C;  4B3M L;  4CC6 A;  4A3I H;  1PLF A;  3H0G G;  2W7P A;  5J2T F;  4C3H G;  1I6U A;  4LW1 A;  3HFZ B;  1JWU D;  1QWY A;  3PGZ A;  4R4C A;  1ESR A;  5LL6 S;  5IT9 c;  2M05 A;  3MFH A;  4F50 A;  2KCC A;  2HIX A;  4WFN 3;  3RB0 A;  1SNO A;  1ENC A;  3S2D B;  1ZEQ X;  4HMI A;  3WWV A;  4JI8 Q;  3GTL B;  3QZ8 A;  2W9B B;  1N36 L;  1I94 H;  1IL8 A;  1HR0 W;  1PYW D;  1HNW H;  2L11 A;  1VMC A;  3I3C A;  4IUR A;  4J1M A;  3A7A B;  4EQP A;  2NVY B;  4RB1 A;  5IIF A;  1N36 Q;  3HOV B;  2K05 A;  4APM A;  3H4B A;  2YW2 A;  5D65 A;  1RDP D;  2SOB A;  5KFH A;  4JI6 L;  3GTJ A;  5F9L A;  1VF7 A;  4FYD A;  3DM3 A;  4EGQ A;  1BCP F;  4R9W A;  1GUG A;  4A3E H;  2NVX A;  1M1K C;  4TQU S;  3I7F A;  1HXY D;  2B2W A;  5KFQ A;  4DR1 H;  3K0Y A;  4IPC A;  2A6H C;  1N34 Q;  3GV7 B;  4J9Q A;  1VQF A;  2FFK B;  1PRT F;  2O2L D;  4IPH A;  2HCC A;  5IYB G;  1E3P A;  4GOP B;  4IAJ A;  1Z2O X;  4F4Y A;  2HVQ A;  5I6Y A;  4MA5 A;  2EYL A;  5C44 H;  4FF4 A;  5JEA H;  1WR2 A;  3KHR A;  1A2T A;  5KND A;  1BCP D;  4HAE A;  1MSH A;  5ELD A;  4DV7 L;  3QG1 A;  1Y1W G;  4I7H A;  1C3O A;  1BCP C;  3HOW H;  3IAY A;  4K5W A;  4JI1 L;  2DY8 A;  1RCV D;  4DV2 Q;  1I7N A;  4GLX A;  4ZAI A;  1VQO A;  5L1I A;  3PMF A;  4BY7 H;  3F2D A;  1AZQ A;  1O78 A;  1LUZ A;  5FO9 B;  1SNQ A;  3PW5 A;  2RA4 A;  4S3S A;  3V2T A;  3KFU A;  2A6H D;  3ONA B;  2PBZ A;  3G6Y A;  1JKJ B;  1YVC A;  4TQS A;  1Y8O B;  1CFM A;  2F1M A;  2FKL A;  3EN2 A;  4DV6 Q;  3MC0 B;  1F2M A;  4PZ6 A;  2OTJ A;  1L2F A;  1HPC A;  2D0O A;  5C3E B;  3S24 A;  1QVF A;  4GN5 A;  1V8Q A;  3H3V I;  1NSN S;  3VPB A;  4Q45 A;  1K83 A;  2W7O A;  3KBG A;  1HFG A;  2R7Z A;  3KDF A;  3M4P A;  1B8A A;  3L9A X;  4YHH L;  2Q2U A;  4KD4 A;  5JAV A;  1T5E A;  1D7Q A;  5ELN A;  2I5H A;  3TP7 A;  4ZCK A;  1SYG A;  5KT2 A;  5C4J H;  1B9N A;  1A3T A;  4U68 A;  3ITP A;  2IMW P;  4MNO A;  2PQA A;  2W6N A;  2IA6 A;  1HUM A;  2DY7 A;  1XX8 A;  3AFQ A;  1HZA A;  2GPS A;  2EQS A;  4Y8V B;  1E22 A;  2QW7 A;  1Y69 U;  1KJ9 A;  1L1O A;  3RF2 A;  4JI4 H;  4LF7 L;  4J9S A;  5KG4 A;  3HKZ G;  4DXF A;  2CH4 W;  2AQ4 A;  5C5J A;  1STB A;  1BXR A;  1A3V A;  3GIL A;  3GDE A;  1M6V A;  2F4V H;  5T14 A;  4ECT A;  4FXK C;  1CI3 M;  1E2Z A;  3T13 A;  2L5T A;  5KFS A;  1EZ1 A;  2V1C C;  3EBE A;  1YJN A;  5IOD A;  2C9O A;  3K3V A;  2QCP X;  1SYB A;  1BNC A;  4XZ3 B;  3KJP A;  1GSA A;  4PWQ A;  4KN7 C;  4DA2 A;  1H9S B;  2W9C A;  2ICE C;  3M9M B;  1I6H B;  3NK9 A;  2PNR C;  4NW2 A;  4JV2 A;  1PFN A;  2PZW A;  1KNE A;  1L1O B;  3A0J A;  3TIN A;  3VDY A;  3QO2 A;  5EKL A;  3I4M H;  3G6V A;  4PQX A;  1JQY D;  2R7Z G;  4IN3 A;  1PHJ A;  1Z47 A;  5IGB A;  1Q90 A;  3DEO A;  3FPP A;  3H09 A;  2ALZ A;  2AGQ A;  4DL6 A;  3GIJ A;  3CME A;  5DG8 A;  1D1K A;  2HT1 A;  5CAE B;  5ELE A;  1TWH H;  4P75 A;  1XNQ L;  5JVL A;  4O42 A;  2FK3 A;  3I4N B;  4YAK B;  1ILP A;  3FMA A;  2EJG C;  1K3R A;  4QIW A;  4ED8 A;  5LMN H;  4HSP A;  3M3Y B;  4C3I G;  3R8B A;  1I5F A;  4C3J H;  2C2E A;  1FJG Q;  1VQ5 A;  2R92 G;  2UXC H;  1S5F D;  1E2V A;  2R93 B;  2VUM G;  1T36 A;  1ASY A;  4A3M H;  1TY2 A;  4CDF C;  2QDL A;  2NVX H;  1C9O A;  5EGT A;  2V58 A;  5KFO A;  4EFE A;  1CKN B;  1EQT A;  2JA8 B;  2A5H A;  3OW7 A;  3CC7 A;  5J22 A;  2YTV A;  3NP8 A;  5C5M A;  1EWH A;  2ATW A;  3TII A;  3GD7 A;  4DF7 A;  1EY7 A;  2JJQ A;  4ECV A;  2R82 A;  2J6T A;  2DPJ A;  1TWH B;  4YWL A;  1EIF A;  2WB1 G;  4KKT A;  4WJ3 M;  5D14 A;  1VCI A;  4G7H C;  2JA6 A;  4LMY A;  3VYT A;  4IQZ A;  4L63 B;  5CGK A;  3DEP A;  2MFI A;  2DJG C;  3J81 L;  3IRB A;  2VB2 X;  2R93 A;  3ER0 A;  1WD0 A;  1H9J A;  2G9D A;  3H0G B;  5JVG 3;  5EWF A;  1I50 H;  4UAI A;  4E6I A;  3GQB A;  3JAM L;  4ZI7 F;  3H91 A;  3GO5 A;  2F0P A;  4KKU A;  4A3K G;  3TSS A;  2UUC H;  4YWK A;  1S4Z A;  1EUD B;  3KF8 A;  1GM5 A;  1KAW A;  2C00 A;  1RF2 D;  3KDF B;  1CQJ B;  1AEX A;  5BN4 A;  3OHA A;  2QEJ C;  4DL4 A;  1DJR D;  1ZHQ A;  1WTP A;  5FLM H;  5IWA H;  1AW7 A;  3PUY A;  2CQY A;  3E0J A;  1QUQ B;  5KFU A;  2VUM A;  1H9K A;  2RSN A;  1K83 H;  2ES2 A;  2NN6 G;  1RJR A;  1LLR D;  4C5A A;  5M5Y B;  2FIN B;  4JI3 L;  1TKW B;  2HHH Q;  1AE2 A;  1HCZ A;  1AE3 A;  2KHS A;  1RK6 A;  5KFR A;  1SBB B;  2RKS A;  3HKZ A;  1Y1W B;  3GTK A;  1DD2 A;  1ET9 A;  3KAL A;  1PMR A;  1TS5 A;  2AQ3 B;  1EOT A;  2XCA A;  1EIG A;  3GTK B;  2RGV A;  1SDF A;  1YNN D;  3ZYY X;  5F9N A;  1K0R A;  3NWS A;  4UP7 A;  1NUC A;  3SEB A;  1TII D;  4CKE A;  4YY3 Q;  4IHJ F;  3LWB A;  2DNC A;  2JE6 I;  3EYY A;  1TU2 B;  1DV2 A;  4BY1 G;  4KI0 A;  3SDZ A;  2XGQ A;  4IPG A;  3K5H A;  1KLU D;  3KF6 B;  1V51 A;  3BDC A;  1PH9 A;  2A74 C;  2EPB A;  2SNM A;  1RJT A;  4R4O A;  4YHH H;  2CW0 D;  4OO1 H;  2EXD A;  3K7A B;  2AWN A;  3GIM A;  4OL7 A;  2WV6 D;  3D4D A;  2YTX A;  1U4P A;  3RB3 A;  2LMC B;  2R8J A;  1JIH A;  2OT2 A;  2NWG A;  3TN2 A;  1GUT A;  1WTV A;  1Y8N B;  4IOA A;  4N8X 1;  2IJ0 A;  1AN7 A;  2VPS A;  4B3R H;  3R23 A;  2R8I A;  2C28 A;  1B50 A;  1QCB D;  2IT1 A;  1LT4 D;  2IX0 A;  2PNH A;  1OXT A;  1QZG A;  4O2A F;  3K6O A;  4KHP H;  4ALP A;  2WYO A;  3TRZ A;  4F8M A;  1D2B A;  3R5X A;  2K28 A;  2QA4 A;  1RJP A;  1QVC A;  3U4V A;  2IL8 A;  3TP6 A;  4ED2 A;  1LTR D;  3GLK A;  5F2D A;  2IHE A;  2L9H A;  4QUC A;  4KTA A;  2K5H A;  3I4M G;  1HNX Q;  3RBD A;  1CKO A;  5M5W B;  2E74 C;  1TWG A;  2QKI C;  3EJI A;  3ERQ A;  1BF4 A;  3H4D A;  5EJW A;  2B2Y A;  1N34 H;  4Q8E A;  1M4V A;  2FK2 A;  2TMP A;  4IO9 A;  1YIT A;  2B2V A;  5JEA G;  2WB1 A;  2B63 H;  1X32 A;  2ZM6 H;  5JQW A;  3OMG A;  2JA5 B;  2YTY A;  4A3F H;  3WDN A;  5KEE A;  2AGP A;  3DLL A;  2R93 G;  4LUZ A;  2WIN B;  1RTO A;  2R86 A;  1J5E L;  3SVM A;  4BY1 B;  1NAP A;  4B9W A;  2L4N A;  4DK6 C;  3S1M B;  1K3B C;  2JP1 A;  1VQP A;  1KC8 C;  4Y52 H;  4NXM Q;  5J2U F;  4FU0 A;  4F7X A;  4G7O C;  3MFG A;  2R7D A;  3MWY W;  3V4S A;  3HOU H;  2WKC A;  4K2K A;  4DR5 L;  2VA2 A;  4DV6 L;  2YS7 A;  5EPK A;  3JAM E;  3G8C A;  4RAU C;  1UE5 A;  1EWC A;  3N52 A;  3HXL A;  4JV1 A;  2I46 A;  2YU9 B;  1KDB A;  3MXN A;  5BR8 H;  3CC4 A;  3ULJ A;  1XXG A;  2UU9 H;  4JI4 Q;  1RL2 A;  5C4J B;  3I55 A;  5KT3 A;  4XT3 B;  5COY A;  3TEH B;  3L0O A;  5KFK A;  4XYQ A;  4IRD A;  3NXW A;  2UVR A;  2ICI A;  3WOE A;  3D8G A;  3I8Z A;  4RCN A;  4DXG A;  1SJE D;  4TQR A;  4B3T Q;  4KHZ A;  1JJC B;  2V4Q A;  1G8Z D;  1XDN A;  3JZI A;  1N33 L;  4JI5 Q;  4UP8 A;  4MZ9 A;  5BMV F;  4LF5 H;  5KG1 A;  4LFA L;  2UVW A;  4A3K B;  2NU8 B;  1VQM A;  3GTL H;  1S5D D;  1N32 L;  4RA8 A;  3R93 A;  1GUN A;  2EYO A;  2AWO A;  4LF4 L;  4ECY A;  2DNE A;  4A3M B;  4PZ8 A;  4DV5 L;  5L1J A;  3M4I A;  3UDX A;  1VQE A;  1K73 C;  2B8G A;  1I6H H;  4C2M A;  3IN5 A;  1OXV A;  2JEF A;  2NVY H;  4MIU A;  3K0X A;  4KN4 C;  3PO2 H;  3PIP A;  1D8L A;  4KHV A;  3FKI G;  3P75 A;  1TWF H;  4RCO A;  3KAK A;  3UE0 A;  4IPD A;  1I4H A;  1VDZ A;  4NPS A;  3BVG A;  1GXD C;  3C0F B;  3H3V H;  1GUO A;  4RNO A;  1CQF A;  1KL9 A;  2P5Z X;  3PIO A;  4OX9 H;  3MFY A;  1JE5 A;  1CKM A;  4ULL A;  3SXH A;  2NN6 H;  5KG6 A;  2WB1 B;  5DAU A;  1S0M A;  2J6U A;  4Z9C B;  3P1H A;  4AQY L;  1B9M A;  1MJC A;  1IYV A;  1B3Q A;  3NQI A;  1IYJ B;  3LNN A;  3TRE A;  1EHI A;  2P0A A;  2Z4I A;  2EE1 A;  1CA5 A;  1LT5 D;  3RUP A;  2A73 B;  2K5N A;  1PFS A;  4IZ8 A;  5CV8 A;  1HNZ H;  1VQA A;  4K8J A;  1Q82 C;  3RLN A;  4A3I B;  3S14 H;  5IGF A;  1YNJ C;  3N41 B;  2Q2I A;  2WP8 J;  4QY7 A;  1PXU A;  4JI2 Q;  2UUA Q;  1B04 A;  1STN A;  1L0Y B;  2MGS A;  2K04 A;  3A5U A;  1EEF D;  2LKV A;  1ZHS A;  4DUZ H;  4JOI A;  1PH6 A;  2UXB Q;  4N9P A;  3BAA A;  3A8J E;  4QWE A;  2F0J A;  4DV5 H;  4GKJ L;  5AFW A;  5EAY A;  4JVZ A;  1E4F T;  4DGZ A;  2A68 D;  3CCJ A;  1U4R A;  2JA7 G;  4BBS H;  2RF4 A;  4EQO A;  1I3Q A;  1PRT C;  2E2I B;  1UE1 A;  3KLS A;  4RFB A;  5KFT A;  1HHV A;  4JI0 L;  1ZQ7 A;  1XNQ Q;  3QFF A;  1JWM D;  3H94 A;  1VQG A;  4EGJ A;  1DXM A;  2KEC A;  2OTL A;  1A15 A;  4DR5 Q;  2E2H B;  4NDX A;  3GV8 B;  4J9O A;  5IT9 L;  2ASJ A;  3T1H H;  2AU0 A;  3PUV A;  5C0X G;  3N43 B;  1UWV A;  2A69 D;  3E9H A;  2K50 A;  1U0L A;  4H13 C;  3MAQ A;  4JI4 L;  4O3R A;  5KYI A;  4FBT A;  1IBK Q;  3BS1 A;  2NBF A;  2N88 A;  3I4O A;  5IP7 H;  2R7M A;  2BE5 C;  3K57 A;  3K3P A;  4XDX A;  4DL5 A;  3GTO A;  3F2C A;  3SHL A;  1VQD A;  4X3S A;  2ZXP A;  3LP8 A;  5HUR A;  3SK4 A;  1I94 Q;  3ULP A;  2NZO A;  2F52 A;  2W6O A;  4IR1 A;  2GA4 B;  4CHT B;  4GN4 B;  3W1B A;  3RJ0 A;  4QW9 A;  4KY6 A;  4KLK A;  2EYM A;  3L4K A;  1EOV A;  1XTC D;  1CE8 A;  4KJO A;  2FK1 A;  5LA6 F;  5KG3 A;  3HOW B;  3AEV A;  2F0L A;  3SK5 A;  2V59 A;  5EKK A;  3EIV A;  2RHQ B;  4O4I F;  4J6H A;  2HDM A;  3PIP 3;  3R2T A;  4JI1 Q;  4LNQ A;  2O5J C;  3ORR A;  4OO1 I;  1JJ2 A;  4ODG A;  4A3L G;  1GSH A;  1I4Q A;  2G5D A;  4A3F G;  2K14 A;  3RZD B;  1JDB B;  1VQ4 A;  3BVM A;  1EZ6 A;  2I0Q A;  1HNW L;  1IOV A;  1O7Y A;  2XSC A;  4WD3 A;  4RZQ A;  1SE8 A;  1PZJ D;  4R4I A;  1WH2 A;  2FE3 A;  2AHO B;  5JH7 F;  5C3E G;  4MTD A;  5M3F B;  3P7J A;  3FKI A;  3T1Y H;  2ID0 A;  3K5O A;  1SFO B;  1Z6H A;  1AFP A;  1EFW A;  1N34 L;  3K7A H;  2FPG B;  5KYL A;  1RYR A;  4YHH Q;  3TBI B;  3E3X A;  3EFX D;  4EQN A;  4RZR A;  5JOB A;  4JC0 A;  3PW4 A;  2D5D A;  4K2L A;  3GTJ B;  3DXJ C;  1YHB A;  4IJH A;  2F0F A;  1OXS C;  1X3E A;  2KOL A;  1CM9 A;  5GRO A;  1V4Y A;  2PI2 A;  4A3J G;  1VF5 C;  3C3L A;  4OXP A;  2Z9H A;  4A3I G;  2PPB C;  4PZ7 A;  4JI6 H;  1JLL B;  4DNI A;  4DV2 L;  2PCF B;  2R7L A;  4GOP A;  1BBU A;  5KG7 A;  4LUO A;  2JYO A;  2L55 A;  2EJM A;  2JK8 A;  1SEI A;  1ESF A;  1KAB A;  3BYT B;  1C8C A;  3TDQ A;  1XPO A;  5IYD H;  1SYF A;  4LF9 Q;  5HV6 A;  1V1O A;  4OWT B;  2V5A A;  4LF5 L;  5CV4 A;  2C22 A;  1N36 H;  4UCS A;  3J7A V;  5FKA C;  1EEI D;  3ND8 A;  1K0S A;  4QWD A;  4GS3 A;  2C5C A;  4DR2 H;  3RBE A;  2YRW A;  1A3U A;  3MEH A;  4RNN A;  4I4T F;  4UFZ A;  5D8D A;  2F0H A;  1W6J A;  4RB2 C;  2R8H A;  2E8G A;  4GKJ Q;  1VQH A;  3VR3 A;  1LTS D;  1PX2 A;  2YV5 A;  1IBM Q;  2F0I A;  2JA5 G;  4B3S L;  3MA2 B;  3R5H A;  4JYA H;  2E2I A;  4APV A;  4A3B H;  3URY A;  1K28 A;  5KIX A;  3HKZ B;  2EIF A;  1SSO A;  3BJY A;  2RCF A;  5KFN A;  5DM6 3;  3C46 A;  3QZ7 A;  3E9I A;  4AQY H;  3I91 A;  1GUW A;  5LYJ F;  4LH7 A;  2NUC A;  1F2L A;  1R4Q B;  2K6A A;  3PN1 A;  5DQI A;  4NXM L;  4NXN H;  1XMQ Q;  2UUB L;  4DUY H;  3RB4 A;  1WD1 A;  5K2M A;  2W6P A;  2EJF C;  3OHB A;  1NMG A;  3VR6 A;  1Y1W H;  4LAA A;  1GSO A;  3PR5 B;  2VB3 X;  3CCV A;  5GAD C;  4LSA A;  4QWB A;  4CDE C;  1R9T H;  3MXU A;  3F1Z A;  4JI8 L;  3Q8S B;  5C1O A;  5IYB H;  3A8K E;  1SND A;  4JI5 H;  1TY0 A;  1ZKO A;  4FS2 A;  2X6L A;  1I7L A;  2IX3 A;  2VZA A;  5IGC A;  1Q46 A;  3S1R H;  2O4X A;  1Q81 C;  4HNT A;  4CJ2 C;  5KRU A;  3UE1 A;  1AZP A;  1WCM A;  3IFD A;  4JPB W;  4HSV A;  1AH9 A;  1B3A A;  1LT3 D;  1S97 A;  1FJG H;  2XVS A;  1SN8 A;  1EYA A;  1SAP A;  3R2I A;  5EPJ A;  4DR2 L;  2YS6 A;  2F0U A;  2MP1 A;  3J7Z C;  3CHB D;  4ZOL F;  4IUN A;  4ED0 A;  2L0C A;  1STE A;  1OXU A;  2B2U A;  3GTP H;  4LFC Q;  3MFI A;  2WFW A;  3MR6 A;  2FJ2 A;  3Q1K A;  2KBN A;  2RGR A;  1PFB A;  1V1Q A;  1SYE A;  1G2S A;  1EYD A;  4KHP L;  3FRP B;  4EVO A;  3S15 B;  3M4Y A;  2K32 A;  4JBK A;  2FPI B;  3VR2 A;  1JB7 A;  4FF2 A;  2B2V C;  5LXT F;  4TV8 F;  4FM9 A;  3HOZ G;  1K83 B;  4HN7 A;  3OWF A;  4L5R C;  2JEB I;  2QK4 A;  1H9M A;  2V4D A;  1KRS A;  4J9R A;  5CYU A;  4O3P A;  4DR1 Q;  3D31 A;  3Q8P B;  2M9V A;  5CA0 F;  4ZRZ A;  1CTM A;  1HZC A;  2PQA B;  5J1Z A;  4PMW A;  3GP7 A;  1TVX A;  3RTX A;  4CGY B;  3CF5 A;  1W2B A;  2HVR A;  4O3S A;  3GV3 A;  3G71 A;  1WCM G;  1EYZ A;  2R7F A;  3I4M B;  1HNZ Q;  1J8I A;  4HJ9 A;  2RDJ A;  4EEY A;  1LM0 A;  4RKB A;  1LTB D;  3PQI A;  5FD6 A;  4WRD A;  2HVS A;  1B4O A;  3MZ5 A;  1K9M C;  3JAM c;  4UPA A;  2ZJQ A;  3ETJ A;  2AUJ D;  5FJ8 H;  2AMC B;  4ECU A;  3DWQ A;  3T5H A;  1GUS A;  1XNR H;  3GTL A;  1X56 A;  4J0M A;  5KNB A;  1TWC H;  4K5V A;  2SCU B;  4OIJ A;  4HTH A;  4F4W A;  4L8J A;  3CCR A;  2CKZ B;  2E2J H;  2NVY A;  1NNX A;  1NR4 A;  3IG0 A;  4C5B A;  2W71 A;  4QWC A;  1PTO D;  1OTC A;  4JBW A;  1IZ6 A;  2R92 H;  2K7V A;  3O13 A;  1MSG A;  2YU9 H;  1TWF A;  4HCS A;  2UXB H;  1TS3 A;  2E2I H;  3RV3 A;  2DN8 A;  2JA8 G;  1ML0 D;  2MPM A;  5IOC A;  4A93 B;  2W9C B;  4X66 L;  2LXK A;  1E4G T;  4JYA L;  2CQA A;  5GQO A;  4JI6 Q;  2IHF A;  2F03 A;  2RCN A;  1S0N A;  2KVM A;  2CQO A;  5ELF A;  4X62 L;  2VUM B;  4JI7 H;  2KCN A;  1EY6 A;  3PW7 A;  5A2Q E;  4YY3 L;  3Q8Q B;  1B53 A;  2N49 A;  1HA6 A;  4M7E A;  1HR0 L;  5KT7 A;  5DM7 3;  2EYH A;  2B2T C;  2F4V Q;  1PFM A;  4UY8 C;  2Y0S B;  4AYB E;  1JOQ A;  2YZM A;  2VNU D;  5LP6 F;  4DV1 L;  5HBR B;  5A2Q W;  4YR2 A;  4Y7N B;  4FO2 A;  4G4K A;  4GKJ H;  1LYL A;  2Y0S E;  4L5Q A;  2DPI A;  4UCT A;  3ULL A;  1IBM H;  1SFO A;  1BCP B;  2E2D C;  2K5W A;  3HBL A;  2DIK A;  3HOX G;  1SEB D;  1A8V A;  4N9T A;  4F88 A;  2RDH A;  3A56 A;  4O1N A;  2OF1 A;  2NB0 A;  3J81 j;  1VQ6 A;  1CT1 D;  1DM0 B;  4LFB L;  1XMO H;  3S16 B;  1PRT D;  2ZXR A;  3OIQ A;  4DAY A;  3S1M H;  5KFY A;  4ECW A;  4DAM A;  5GAH C;  2KHJ A;  2XWJ B;  2WDT A;  3LML A;  1PH5 A;  5C4Z A;  1STA A;  1D6E C;  1X3G A;  2MNA A;  1B70 B;  1PZK D;  2KCT A;  3NPP A;  1NE3 A;  2ZT9 C;  4HIO A;  4FF3 A;  4O3Q A;  1WSC A;  4OX9 L;  4EG0 A;  3AU7 A;  3CVZ A;  2JA6 B;  3AQQ A;  2Q8T A;  2Z4H A;  2O5I C;  4HYK A;  4IFD I;  3S1N H;  5D1P A;  3HEJ A;  1PTO C;  2I07 B;  4IAL A;  2HHH H;  5JJI A;  1RD9 D;  3WO1 A;  1FYC A;  1RIP A;  2KHI A;  1KXL A;  1UEB A;  4YJ2 F;  2HDL A;  3T4A C;  1KD1 C;  2ZDH A;  3HB9 A;  4JV5 H;  1I4R A;  1BO0 A;  1L0X B;  2Q2H A;  3S17 B;  3DWA A;  1G29 1;  2ENB A;  4FBU A;  2XGT A;  1S03 G;  3MTS A;  4A3J H;  1X9N A;  1N48 A;  1KJI A;  1X55 A;  2A6E C;  1BR9 A;  3K5I A;  2IBK A;  4LH6 A;  1TQO A;  3G6E A;  5FO7 B;  2QDB A;  4ZQ3 A;  3I4L A;  1TWA A;  3N6X A;  5COR A;  2ZJP A;  3S1N B;  3J7A K;  3HOZ H;  2N55 A;  1P8L A;  4LF9 H;  3K8A A;  4MAM A;  2KSW A;  5IGG A;  1WYD A;  2FMC A;  2FXQ A;  2FLN A;  1K1Q A;  3A54 A;  1H9S A;  4FXG C;  4A93 G;  3FVQ A;  2BDO A;  5FLM G;  4DR4 L;  1TWC A;  4QJF A;  3I2Z A;  4RAZ A;  3RN2 A;  1IBM L;  3Q8R B;  5CR3 A;  4EBC A;  4O2D A;  4X66 Q;  2F0Q A;  4MTN A;  4R4T A;  3NQT A;  5AJ3 Q;  4IUP A;  4Q44 A;  3CQZ H;  2EYJ A; 
#chains in the Genus database with same CATH homology
 3NEN A;  2UU9 L;  1XMQ L;  1VQM A;  3GTL H;  3HKZ E;  4A3D G;  4DUZ L;  1N32 L;  2HIV A;  2VQF Q;  4A76 A;  3U4Z A;  1PH3 A;  1Q86 C;  2AWO A;  4HJA A;  4LF4 L;  4GKK L;  1VQ8 A;  4PZ8 A;  4DV5 L;  1XNR L;  1VQN A;  3UDX A;  1VQE A;  5E7N A;  1K73 C;  1I6H H;  3CPF A;  1OXV A;  2NVY H;  2N3S A;  4DAY B;  2OQK A;  4LF6 L;  1WOC A;  1KIX A;  1HZ9 A;  3K0X A;  3PO2 H;  4IJL A;  2PI2 E;  2I5L X;  3PIP A;  1D8L A;  3FKI G;  3CP0 A;  3CCU A;  4GNX A;  4BY1 H;  3S17 H;  1TWF H;  1VQI A;  4DR3 Q;  1M90 C;  4B3T L;  2ZM6 Q;  3UE0 A;  4IPD A;  4LF8 L;  2A1A A;  1V9P A;  2D62 A;  4NPS A;  4XIG S;  5GAG C;  4GNX B;  2WB1 E;  2CCZ A;  4L5S A;  3H3V H;  4A3D H;  1E24 A;  1KL9 A;  4DUY L;  3PIO A;  2ZM6 L;  2F3I A;  5GAE C;  4OWX B;  2UU9 Q;  1JE5 A;  1CKM A;  2UXB L;  1Y14 B;  4RMF A;  1YZ6 A;  4DR2 Q;  1PH7 A;  4A3K H;  1SFO H;  5K36 G;  4DV3 Q;  4GOP C;  4AQY L;  1ASZ A;  1Q7Y C;  1PH8 A;  1FJG L;  1CUK A;  1MJC A;  2ZJR A;  2HQL A;  1GKH A;  2AKW B;  3ERS X;  2Z6K A;  2L15 A;  2Z0S A;  1IYJ B;  3A74 A;  4ME3 A;  3RN5 A;  4JI0 Q;  3PV0 A;  4P73 A;  3TRE A;  1Q1E A;  4DPG A;  4BA1 I;  1HNX L;  2E2H H;  2YYZ A;  4DR7 Q;  5JJK A;  2PMZ E;  3TS2 A;  3PCO B;  1PV4 A;  5IP9 G;  1PA6 A;  1HNW Q;  2K5N A;  1PFS A;  3PUX A;  3J80 c;  4OWW B;  1SMX A;  3OTO L;  1YI2 A;  1VQA A;  2VY3 A;  1Q82 C;  3RLN A;  2UUC L;  4KHP Q;  3S14 H;  3CCQ A;  2Q2I A;  3GTQ H;  2WP8 J;  4JI3 Q;  3RZO H;  4QY7 A;  1WI5 A;  1VQ7 A;  2UXC L;  4JI2 Q;  2UUA Q;  2D0P A;  1OXX K;  3FKI H;  3RR5 A;  3A5U A;  4DV1 Q;  4JOI A;  1PH6 A;  1TWA H;  2UXB Q;  4GLA C;  5JEA J;  3HOX H;  1PH4 A;  3TS0 A;  4GKJ L;  4X64 L;  1NY4 A;  1CSP A;  3FHW A;  3M4Q A;  5EAY A;  3PF5 A;  3BZK A;  3CCJ A;  2UUA L;  4JI2 L;  2JA7 G;  2ASB A;  2LSS A;  2RF4 A;  4BBS H;  3Q8D A;  3J7A 5;  3ZJY C;  1UE1 A;  2QEX A;  2H5X A;  5FLX c;  4JI0 L;  4POG A;  1XNQ Q;  3T1H Q;  1EUJ A;  1V43 A;  4A3E G;  1VQG A;  2KCM A;  1IBL Q;  5M3M H;  5M3F G;  1XMO Q;  1HNZ L;  2OTL A;  4DR5 Q;  1VQC A;  3M4O H;  5IYD G;  1BKB A;  1GD7 A;  2BH2 A;  1MIU A;  3KF6 A;  1KHI A;  5IYC G;  3PUV A;  5C0X G;  4XTC S;  4DK3 C;  1UWV A;  3MXN B;  3E9H A;  4DR6 Q;  2K50 A;  1U0L A;  4HID A;  2I5M X;  4OX9 Q;  4JI4 L;  2R7Z H;  1IBK Q;  4B3M L;  4A3I H;  3H0G G;  3I4O A;  5IP7 H;  4HJ5 A;  1SRO A;  4LW1 A;  3HFZ B;  3PGZ A;  4R4C A;  3E0E A;  5IT9 c;  1PYB A;  3F2C A;  1MJE A;  1VQD A;  2Q2T A;  1YJW A;  1I94 Q;  3ULP A;  2NZO A;  2F52 A;  2HIX A;  3HOU G;  4GN4 B;  3W1B A;  4QIW E;  3S2H H;  3WWV A;  4JI8 Q;  1QUQ A;  4KLK A;  4R4Q A;  4C2M H;  3NEM A;  4EQ5 A;  1N36 L;  3GTG H;  1HR0 W;  1EOV A;  1N33 Q;  1FGU A;  4A3C H;  3PO3 G;  2K5V A;  4A3L H;  4DV7 Q;  4R1J A;  3AEV A;  3BU2 A;  3EIV A;  2RHQ B;  4LFA Q;  4POF A;  1N36 Q;  4JI1 Q;  4LNQ A;  5BR8 Q;  4OO1 I;  1VQJ A;  1JJ2 A;  2UXD Q;  2ZTE A;  3CMA A;  3CCS A;  1SRU A;  4JI6 L;  3M7N A;  2WAQ G;  4A3L G;  2R6G A;  4A3F G;  4HJ8 A;  2K14 A;  3DM3 A;  1VQ4 A;  4A3E H;  4DV5 Q;  1M1K C;  4TQU S;  3I7F A;  3W1G A;  1EIY B;  2I0Q A;  4JV5 L;  1HNW L;  4IPC A;  1N9W A;  4DV4 Q;  4X62 Q;  2VQE L;  4HIM A;  1A0I A;  5HGQ A;  3CW2 C;  1SE8 A;  1N34 Q;  4R4I A;  1IXR A;  2C35 B;  1VQF A;  1JT8 A;  4IPH A;  2AHO B;  5IYB G;  1E3P A;  4GOP B;  5C3E G;  3UDF A;  4JI7 Q;  1YHQ A;  2ID0 A;  4JBJ A;  1Y1V H;  5C44 H;  1EFW A;  5IP7 G;  1N34 L;  3K7A H;  3CCL A;  4LF5 Q;  4C3H H;  1YEZ A;  4YHH Q;  4DV7 L;  3CCM A;  1Y1W G;  1XJV A;  3HOW H;  4JC0 A;  4NXN L;  4WJ4 A;  1A62 A;  4JI1 L;  3STB D;  1YHB A;  4IJH A;  4DV2 Q;  4GLX A;  3CAM A;  1OXS C;  4DV3 L;  1X3E A;  1VQO A;  5GRO A;  5H1S E;  2PI2 A;  3F2D A;  4FDB A;  4A3J G;  1NBW A;  1LUZ A;  4B3S Q;  3S15 H;  4BY7 H;  5C4X G;  3AYH B;  1J5E Q;  4OXP A;  4A3I G;  2NZH A;  4PZ7 A;  3KFU A;  5IY0 A;  4DNI A;  2JEA I;  4DV2 L;  1YVC A;  4GOP A;  1BBU A;  4YCW A;  2BA1 A;  4LUO A;  3CCE A;  1EWI A;  1A63 A;  3EN2 A;  4DV6 Q;  2JK8 A;  4PZ6 A;  3FP9 A;  2OTJ A;  1L2F A;  5IYD H;  2D0O A;  3S24 A;  1XPO A;  1MKH A;  4GN5 A;  1QVF A;  4LF9 Q;  3H3V I;  4LUV A;  4OWT B;  1JJG A;  4LF6 Q;  4LF5 L;  2UUB Q;  3KDF A;  3M4P A;  1B8A A;  4LFC L;  4YHH L;  2Q2U A;  1D7Q A;  5ELN A;  2I5H A;  4C3I H;  3KF8 B;  2JA6 H;  4A3G H;  5C4J H;  5C0X I;  4GS3 A;  4BY7 G;  3J81 c;  2B3G A;  4MNO A;  2PQA A;  5LMN Q;  3HOV H;  3PF4 A;  1NMF A;  2E8G A;  2K4K A;  3ICE A;  4GKJ Q;  1VQH A;  3AFQ A;  1J6Q A;  1HZA A;  2DUD A;  2EQS A;  1E22 A;  2YV5 A;  1Q1B A;  3RZD H;  1IBM Q;  2JA5 G;  4B3S L;  1L1O A;  4LF7 L;  4APV A;  3GTO H;  4A3B H;  4QQB X;  3HKZ G;  1VQ9 A;  3T1Y Q;  4PG3 A;  3GDE A;  2EIF A;  4JI5 L;  4BA2 I;  1XPR A;  2BA0 A;  1BVS A;  3E9I A;  4EX5 A;  1IL2 A;  2V1C C;  3EBE A;  4OON A;  1YJN A;  4DR6 L;  2OCE A;  3UDG A;  3T1Y L;  4YCU A;  4NXM L;  1XMQ Q;  2UUB L;  1X54 A;  3LGJ A;  3PUZ A;  4DUZ Q;  2MO0 A;  3KJP A;  2NVT H;  1NMG A;  1Y1W H;  2VL6 A;  3CCV A;  1L0W A;  4J15 A;  3GTJ H;  4P71 A;  3KLW A;  5GAD C;  4A3B G;  1E7Z A;  3A0J A;  1L1O B;  2LXJ A;  4A75 A;  3VDY A;  1R9T H;  2UXC Q;  3F1Z A;  4JI8 L;  3I4M H;  1KQS A;  5IYB H;  2R7Z G;  1PHJ A;  1HZB A;  1Z47 A;  4AYB G;  2VUM H;  2VZA A;  1Q46 A;  3J80 i;  3CME A;  3BZC A;  2BH8 A;  3S1R H;  1Q81 C;  2HT1 A;  4JYA L;  4TVA B;  2K75 A;  1EQQ A;  1TWH H;  3UE1 A;  5LMU L;  1K8A C;  4P75 A;  4DUY Q;  1XNQ L;  2JA9 A;  1AH9 A;  1PVO A;  4L5T A;  4X65 L;  5M3F H;  1E1O A;  3I56 A;  1VQB A;  2N8N A;  5IWA Q;  1SN8 A;  4DR2 L;  1K3R A;  4BBR G;  4GN3 B;  3J7Z C;  5LMU Q;  2ZTC A;  4DV0 Q;  1I5F A;  4C3J H;  4A3G G;  3PO3 H;  1B7Y B;  1FJG Q;  1WJJ A;  1VQ5 A;  2R92 G;  4NB3 A;  3S1Q H;  4GKK Q;  3M9B A;  1OXU A;  3GTP H;  5IE8 A;  4H02 A;  1CKN A;  1K8G A;  2WFW A;  4LFC Q;  2VUM G;  2VQF L;  2CWA A;  2RHS B;  5FJ8 G;  4A3M H;  4QL5 A;  2KBN A;  1ASY A;  4JI7 L;  2NVX H;  1C9O A;  1V1Q A;  3OTO Q;  3G4S A;  4BXX H;  3L2P A;  1W3S A;  1QVG A;  2UUC Q;  4KHP L;  1CKN B;  2MO1 A;  5M3M G;  3L7Z C;  4JBK A;  5DLQ E;  1QZH A;  3S16 H;  3KYH C;  3HOY H;  3CC7 A;  1JB7 A;  2YTV A;  3RLO A;  1G51 A;  1HR0 Q;  4NXN Q;  4B3R L;  3HOZ G;  1CSQ A;  2ATW A;  2JA6 G;  4L5R C;  4A3C G;  2JEB I;  3GD7 A;  2JJQ A;  1C7Y A;  1KRS A;  4YWL A;  4DR4 Q;  1EIF A;  2WB1 G;  5LMN W;  3MEF A;  3A5Z B;  3D31 A;  1VCI A;  5C3E H;  4DR1 Q;  3OW2 A;  2OWO A;  3HOV G;  4B3R Q;  3HKS A;  4IFD G;  4X64 Q;  5BR8 L;  1E1T A;  4JOI C;  4A3M G;  1HZC A;  2PQA B;  2MFI A;  3W5O A;  4PMW A;  3IRB A;  3F8T A;  1WFQ A;  1S40 A;  4RG1 A;  3ER0 A;  3CF5 A;  1TXY A;  4AQY Q;  1W2B A;  1I50 H;  1UE6 A;  3G71 A;  4WJ3 M;  5JJL A;  1WCM G;  4A3K G;  3GO5 A;  1N8R C;  2R7F A;  5C0X J;  3U58 A;  4DV4 L;  4YWK A;  1HNZ Q;  1TWG H;  1N32 Q;  4HJ9 A;  1GM5 A;  4DR7 L;  1LM0 A;  1KAW A;  1LTL A;  1GVP A;  1YNX A;  3KDF B;  4P74 A;  1XNR Q;  1BBW A;  4K0K Q;  4JCV E;  4DKA C;  3JAM c;  4UPA A;  1K9M C;  2ZJQ A;  2JA8 H;  5FLM H;  5FJ8 H;  3PUY A;  2IX1 A;  1GO3 E;  4YCV A;  2AMC B;  1P16 A;  1QUQ B;  1X56 A;  2GVA A;  1K83 H;  2CFM A;  1PYS B;  2ES2 A;  1TWC H;  2NN6 G;  4O0A A;  3KOJ A;  4QGU A;  3CCR A;  4JI3 L;  4JBM A;  4BBR H;  2HHH Q;  2CKZ B;  3RLF A;  1AE2 A;  3STB C;  1AE3 A;  1T9H A;  3U50 C;  2E2J H;  3M3Y H;  1VQL A;  4LF8 Q;  1OTC A;  2N78 A;  1IZ6 A;  2A19 A;  1L1O C;  4JBW A;  4Y7N H;  2R92 H;  2YU9 H;  1FVI A;  2ALY B;  4OO1 G;  2GVB A;  2Y0S G;  2E2I H;  2JA8 G;  4HIK A;  4HJ7 A;  4X66 L;  1X65 A;  2LXK A;  1XMO L;  2NVQ H;  1K0R A;  4UP7 A;  4YY3 Q;  4LWC A;  3T1H L;  2GN5 A;  1O7I A;  5GQO A;  2IHF A;  2VW9 A;  2JA5 H;  2RCN A;  4JI6 Q;  2K52 A;  2CQO A;  3TQY A;  2QGQ A;  4X62 L;  1WCM H;  2JE6 I;  2VQE Q;  4LFB Q;  1SR3 A;  3AFP A;  4BY1 G;  4KI0 A;  1JMC A;  4IPG A;  1IBK L;  4YY3 L;  4JYA Q;  3KF6 B;  3PUW A;  5C4X H;  1HJP A;  1PH9 A;  2N49 A;  3CPW A;  3OYY A;  1Y1V G;  1HR0 L;  4LF4 Q;  3I4N H;  4R4O A;  1YHA A;  2HHH L;  5IP9 H;  2VS1 A;  3H15 A;  5LMN L;  4BXX G;  1DGS A;  2EXD A;  2F4V Q;  2AWN A;  4UY8 C;  4AYB E;  3HOW G;  3S2D H;  1I94 L;  2VNU D;  2YTX A;  2CWP A;  4DV1 L;  4P72 A;  4GLV B;  2R93 H;  1LYL A;  2Y0S E;  3NEL A;  4L5Q A;  4X65 Q;  4IOA A;  3ULL A;  1C0A A;  3CXC A;  3HOX G;  1A8V A;  2IT1 A;  2IX0 A;  2PNH A;  1OXT A;  4AIM A;  3J81 j;  1QZG A;  1VQ6 A;  4DV0 L;  4ALP A;  1HH2 P;  3JC6 6;  1PH1 A;  4LFB L;  3TRZ A;  2NN6 I;  2QA4 A;  2Z6K C;  1EQR A;  4GNX C;  3S1M H;  1IBL L;  4DAM A;  1QVC A;  5GAH C;  2E5L Q;  1NTG A;  4JV5 Q;  2KHJ A;  4UP9 A;  3U4V A;  4JG2 A;  1KRT A;  1PH5 A;  1PH2 A;  5M5Y H;  1X3G A;  2MNA A;  1B70 B;  2IHE A;  2KCT A;  1NE3 A;  5IYC H;  3K7U C;  4HIO A;  2K5H A;  3D0F A;  4IOC A;  4LF9 L;  2A8V A;  3I4M G;  2E5L L;  2WAQ E;  1HNX Q;  4OX9 L;  1FL0 A;  2MQH A;  1CKO A;  3F2B A;  3GTM H;  3H0G H;  2JA7 H;  4BBS G;  3AQQ A;  4IFD I;  1YJ9 A;  3S1N H;  3GTK H;  4A93 H;  2OQ0 A;  4IO9 A;  1YIT A;  4DR1 L;  5JJI A;  5JEA G;  2JQO A;  2B63 H;  1Q8K A;  1YBY A;  3NBH B;  4IFD J;  1RIP A;  2KHI A;  3G48 A;  2YTY A;  4A3F H;  1NJI C;  1KXL A;  1UEB A;  5ELO A;  1UE7 A;  3DLL A;  1KD1 C;  2DGY A;  5IWA L;  2R93 G;  4LUZ A;  1J5E L;  1VS0 A;  2Q2H A;  3BJU A;  4X6A H;  3SGI A;  4A4I A;  1G29 1;  4DK6 C;  2XGT A;  2IY5 B;  4A3J H;  3RNU A;  1VQP A;  1X9N A;  1KC8 C;  4Y52 H;  3J81 i;  1S3O A;  4NXM Q;  2UXD L;  5C44 G;  1X55 A;  5AJ3 L;  2XTI A;  5HY6 A;  4K0K L;  3CC2 A;  2R7D A;  3HOU H;  4DR5 L;  4DV6 L;  2B63 G;  3G6E A;  2KEN A;  5M5W H;  1XTD A;  3B6Y A;  1UE5 A;  2F4V L;  4AH6 A;  3HOY G;  3KJO A;  2ZJP A;  3M85 A;  3ULJ A;  1YIJ A;  3CC4 A;  1U5K A;  4JI4 Q;  3HOZ H;  1Z9F A;  3PSI A;  1P8L A;  1RL2 A;  3K8A A;  4B3M Q;  1SLJ A;  3I55 A;  1Q12 A;  1EYG A;  1WYD A;  3K81 C;  2FXQ A;  5J3B A;  3I4N G;  3TEH B;  3L0O A;  1I3Q H;  2ZTD A;  1G6P A;  5M5X H;  1X6O A;  1VQK A;  4A93 G;  4YWM A;  1X3F A;  5FLM G;  4LF7 Q;  4DR4 L;  4QJF A;  3I2Z A;  3JAM i;  3K80 C;  3RN2 A;  1IBM L;  4DR3 L;  4KHZ A;  3UDI A;  1JJC B;  4B3T Q;  1H95 A;  4O2D A;  1XPU A;  1S72 A;  4X66 Q;  3PO2 G;  1N33 L;  4JI5 Q;  4MTN A;  4R4T A;  4UP8 A;  5AJ3 Q;  3CD6 A;  4MZ9 A;  2B29 A;  3CQZ H;  4LFA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...