3H0GG

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
170
structure length
170
Chain Sequence
FFLKELSLTISLHPSYFGPRMQDYLKAKLLADVEGTCSGQYGYIICVLDSNTIDIDKGRVVPGQGFAEFEVKYRAVLWRPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNYSGEDQVIEKGSNVRLKIVGTRTDATEIFAIATMKEDYLGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit rpb1
total genus 26
structure length 170
sequence length 170
chains with identical sequence S
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h0gG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3h0gG01
1PA6A 2JA8H 2ES2A 3ULPA 3K0XA 3MXNB 1IXRA 3A5ZB 1CKNB 3K7AH 1LYLA 4A3DG 5LMUQ 4DV7L 3PO2G 4DV2L 2K5VA 1K8GA 4R4QA 1IBMQ 1HZAA 4JOIC 1PH1A 4A93H 3UE0A 2A1AA 1WJJA 4LF7Q 1X54A 2WP8J 4OXPA 4A3BG 3K7UC 1N36Q 4GKJQ 4GKJL 4YCUA 2NVQH 2CWPA 1JJCB 4JI3L 1I6HH 4XIGS 2ZM6L 4JYAL 1VQMA 1XNRL 1W2BA 4JI2Q 5JJIA 1Q1EA 5EAYA 2HIVA 2IHEA 2BA0A 1S40A 1K0RA 3HOUG 3KDFA 3KF6A 5AJ3L 4DUZQ 5M3FH 1VQNA 4DR4Q 4GLXA 4DV4Q 4A3CG 1UE7A 1SR3A 5C3EH 3PF4A 3HOWH 2E2IH 3M4PA 2N3SA 5M5WH 5E7NA 2VW9A 1VQFA 1HNWQ 1XJVA 3W1GA 4LFBL 1VQGA 1HNZQ 2LSSA 1C0AA 4L5RC 1VQHA 5GAEC 1IZ6A 3M7NA 1SN8A 1VQJA 3NELA 1N9WA 4TQUS 4C3HH 1VQ5A 1Q8KA 4HJ5A 1O7IA 1GO3E 2PMZE 4HIOA 4DR2Q 4JI7Q 1YEZA 3NBHB 4LWCA 1PYSB 4A3DH 3JAMc 1G6PA 1VQ4A 1E24A 2MNAA 4DV1L 1Q12A 4UY8C 4BXXG 2I5HA 3I4OA 1TWAH 3VDYA 4A75A 1QVGA 2YU9H 2ZTDA 1XTDA 4A3BH 4OO1I 1FGUA 2WAQG 4RMFA 3CCVA 1PH3A 3TQYA 4BA2I 4X64L 2JE6I 4DNIA 3F2CA 1Y14B 1YI2A 4JI8L 4DKAC 2JA7H 1IBLL 1UE6A 1PYBA 3M4QA 2Q2IA 3ULLA 1VQKA 4OO1G 1YZ6A 4YWMA 5ELOA 3F2DA 2VUMG 5M3FG 3KF8B 1U5KA 4PG3A 4NXML 3GTLH 1OXTA 4X66Q 4GOPC 4A3IH 1YBYA 3KJPA 1HJPA 4A3FG 1L1OA 3JC66 1X9NA 2R93G 4QGUA 4YY3L 1HZ9A 1Y1WH 4B3RL 1B8AA 1V43A 2CKZB 4DV0L 2EXDA 3NEMA 1HNWL 2B63H 4IPDA 4GLAC 3GTPH 1Z9FA 1BBUA 3M4OH 1Q1BA 1JB7A 1EIFA 4DV6Q 4PMWA 5JEAJ 2UUBQ 2Z6KC 3PUYA 1HR0Q 3CCRA 3CCSA 1HR0L 2YYZA 1SMXA 3JAMi 2VQEQ 4P72A 4DUYL 3PIPA 2Q2UA 1J5EQ 1UEBA 1PH9A 4EX5A 2HT1A 1D7QA 1KXLA 1D8LA 4GNXB 4HJ8A 4JI2L 4LF6Q 1YHBA 1E3PA 5FJ8G 2H5XA 5JJKA 4JV5L 1M90C 2UUBL 3ERSX 4OWWB 5IYDH 3L7ZC 2NN6G 3F2BA 3RN5A 2R7ZH 2CWAA 2F52A 1XNRQ 4ALPA 3EN2A 2NZOA 1CKMA 2ALYB 4LF6L 3D31A 4LF9Q 4IPCA 2IHFA 3I7FA 4DAYB 1E22A 4DR1Q 1K83H 3K81C 1EOVA 1GD7A 3PUWA 4X62Q 5C3EG 1Q81C 1RL2A 3OYYA 2GVAA 5IWAQ 3PCOB 5BR8L 1Q46A 3KDFB 2K52A 1HNXL 4A3GG 1WI5A 3HKSA 4LF4L 1JJ2A 4A3MG 1E1OA 5C0XI 1IBKQ 1TWGH 1B7YB 1XPUA 1XNQQ 2DGYA 3AFPA 1E7ZA 2ZTCA 4HIKA 3H3VH 1X6OA 2OQ0A 1KRTA 3PF5A 1R9TH 1ASZA 5C4JH 2UXBQ 3HOYH 5J3BA 3K80C 4PZ7A 4J15A 4YWLA 1N34L 1HNZL 2F3IA 2UU9Q 3I4MG 1YIJA 3KJOA 1K8AC 3BJUA 2VL6A 4JCVE 4BXXH 1PVOA 3G6EA 4BBRH 3IRBA 3E9HA 2AWOA 4TVAB 1HZCA 1YJWA 3H0GH 4DV4L 1L0WA 4X64Q 3I4NG 3I56A 2AKWB 1AE2A 1YHAA 5M5YH 3TS2A 1VQIA 4NXNL 2JA5G 2AWNA 3EIVA 2UUAQ 3CC4A 2HHHL 5IP9H 3CMEA 2QA4A 5K36G 1VQCA 5C44H 3RN2A 4JI5L 1BBWA 4QQBX 1FJGQ 2R7FA 3EBEA 3ICEA 1NE3A 3ZJYC 1I94Q 1EIYB 3UDIA 2LXJA 2R6GA 1GVPA 1L1OC 4X62L 2KHJA 2Q2TA 4WJ3M 1X3EA 1TXYA 5IYCG 1KAWA 3S17H 3J81c 4GLVB 3HOXH 1Y1WG 4A3GH 2E2JH 2KCMA 3HKZE 4KHPL 1OXXK 2Q2HA 4A3MH 1BVSA 2CFMA 4X6AH 2I5MX 2BH8A 4LF4Q 4HIMA 2K5NA 3M85A 2MFIA 3CC2A 1YVCA 2CQOA 4JBKA 1H95A 3HOUH 2MQHA 4ME3A 4POGA 4DR7L 2D0OA 1X3GA 3A74A 1G291 3PUVA 1Y1VH 4DV7Q 1UE5A 5H1SE 3HOWG 2RHQB 4GOPB 1QVFA 3PSIA 2JJQA 4AQYQ 1OXSC 3FP9A 1BKBA 3W1BA 3UDGA 4B3MQ 4LF5Q 2UXDL 1JMCA 4B3SL 4JYAQ 4BBSG 4POFA 2R7DA 4BY1H 3B6YA 5HY6A 4A3EG 2PQAA 3A5UA 4DR5L 2OCEA 5GADC 4AYBE 3PIOA 2VQFQ 4JBWA 1XMQQ 4P73A 1IYJB 1LTLA 1XMQL 1KL9A 2KENA 3U4ZA 2ZJQA 1I3QH 5M5XH 2NVXH 4A93G 4R1JA 2CCZA 2AHOB 4WJ4A 3PUXA 3CW2C 4C2MH 1C9OA 3I55A 5JJLA 1MKHA 3U50C 1EFWA 1L1OB 3UDFA 3PO3G 1LUZA 1NMFA 2E8GA 1JE5A 4DR7Q 2KBNA 3DM3A 4HJ9A 3CCEA 3GO5A 3Q8DA 4FDBA 4B3TL 1Q7YC 1CUKA 2YTYA 4A3KG 2GN5A 2N49A 5DLQE 1Q86C 3M3YH 1NJIC 1FJGL 2B63G 3RLOA 2RCNA 2I0QA 1KRSA 4JI7L 1Q82C 3PV0A 3S14H 4KLKA 3HKZG 4JI0L 1Z47A 1RIPA 3GTGH 3I4NH 1K3RA 2Z6KA 3FKIG 4DV2Q 2UXCL 3CXCA 3TRZA 4DR4L 5C44G 4LFCQ 3G48A 5AJ3Q 1U0LA 2JA9A 4P71A 4DUZL 4DV3L 4JI5Q 1N33Q 3DLLA 4YCVA 2LXKA 2AMCB 5HGQA 3KFUA 4APVA 2PQAB 2YV5A 3M9BA 3AQQA 1A63A 5FJ8H 3OTOQ 4JI0Q 4GN5A 3GDEA 1AH9A 2MO1A 4R4IA 3HOXG 3G4SA 1N32Q 2UXBL 4LF9L 3F8TA 1N32L 1VCIA 1YHQA 4DR6Q 4MNOA 5M3MG 2HQLA 2D0PA 4LFBQ 1NTGA 2K4KA 4YWKA 1I5FA 3S2HH 1QUQB 4UP7A 4JI4Q 2NVYH 1CSQA 1ASYA 5C4XG 3CC7A 5IT9c 2OQKA 3HFZB 3AYHB 2PNHA 3U58A 1IBML 3L0OA 4GS3A 3UE1A 5FLMG 4A3FH 1YNXA 3KLWA 2K50A 5LMNW 2R93H 2Y0SE 1PH7A 2HHHQ 2IX0A 1N33L 1WCMG 4JI8Q 2NVTH 2KCTA 4MTNA 2HIXA 3CP0A 4IPHA 1E1TA 3TEHB 5IP7G 4A3EH 3HOVG 1XPOA 4OONA 3HOYG 4QL5A 4L5QA 1OTCA 2K14A 2E2HH 4LFAL 4DV3Q 2JA6H 1KQSA 3CD6A 1HNXQ 4P75A 4DR2L 3HOZG 4Y52H 4GN3B 1CKNA 3OTOL 1QZHA 1K9MC 2VZAA 1KC8C 1IBKL 3J80c 1NY4A 5IYBG 4R4CA 5M3MH 2C35B 1I94L 2Z0SA 1JJGA 1PFSA 3AEVA 3GTOH 4IJLA 2R7ZG 3STBD 3S1NH 5GAGC 5IP9G 2OTJA 2VS1A 3CCLA 2EQSA 2MO0A 4JI6L 3J81j 1NMGA 1CKOA 1N8RC 3GTMH 1AE3A 1TWHH 1G51A 2ZM6Q 3S15H 4A3CH 4X65L 1MJEA 4A3KH 3LGJA 4X65Q 2RF4A 4JOIA 4JV5Q 1X65A 3CPFA 4LF7L 4NXMQ 4LUOA 1TWCH 1WCMH 4JI6Q 3T1HL 2XTIA 2OWOA 1KHIA 2UUAL 4YY3Q 1J5EL 1LM0A 1QZGA 1PH6A 1IBLQ 5IP7H 3S1MH 2YTVA 4JI1L 3RLFA 1SLJA 2BA1A 5IE8A 1VQBA 4GOPA 1KD1C 4BBSH 4GNXC 1KIXA 3E0EA 4OWTB 4O0AA 4IFDI 5ELNA 1EQRA 2YTXA 1SE8A 3L2PA 4DV6L 2I5LX 2R92H 4BY7H 3WWVA 4O2DA 3TS0A 2IT1A 1SROA 4IOAA 4UP8A 1X55A 3HOZH 2VQEL 4JBJA 1UWVA 4B3RQ 2FXQA 5IWAL 3KYHC 1JT8A 4JI1Q 4KHPQ 1EQQA 2L15A 1VQ9A 3U4VA 1XNQL 3BU2A 2JA5H 1SRUA 5GROA 3K8AA 1M1KC 2NN6I 4HJ7A 4K0KQ 1VS0A 2V1CC 4A3IG 2JK8A 1SFOH 3CCQA 3ULJA 3SGIA 1X56A 4LF5L 2VNUD 2B3GA 5FLMH 4R4TA 4AQYL 5IYCH 1GM5A 2UXDQ 3ER0A 1VQEA 4NPSA 3UDXA 1VQ6A 2K5HA 4LFCL 2K75A 4LFAQ 3CCJA 4A76A 4DV5L 4DPGA 4L5SA 4NXNQ 4MZ9A 3MEFA 1P8LA 4YHHL 4LUVA 4L5TA 3CAMA 1S3OA 4C3IH 3S16H 2R92G 4BY7G 4DK3C 1Y1VG 3FHWA 1DGSA 2B29A 1QVCA 1S72A 2IX1A 2WB1E 4NB3A 1YJ9A 2JA6G 4A3LH 4DR3Q 3D0FA 1PH4A 2UU9L 4IFDJ 1P16A 3GD7A 5IYDG 1XMOQ 4DK6C 4HIDA 4GKKQ 3AFQA 4GNXA 5IYBH 4XTCS 1GKHA 4UPAA 3S24A 4AIMA 3CMAA 2WAQE 1VQLA 1EWIA 2PI2A 1PH5A 3FKIH 2BH2A 4KHZA 2JA7G 2E5LL 1PH8A 4IFDG 3S2DH 1TWFH 3S1RH 2E5LQ 3STBC 3NENA 3H3VI 4K0KL 4DUYQ 1A8VA 1J6QA 3RR5A 2ZTEA 1MJCA 4DR6L 4Y7NH 4JI3Q 2ZJPA 3RZDH 3F1ZA 1N34Q 1HR0W 4JG2A 4LF8L 2A8VA 4A3JG 2VY3A 1QUQA 3BZCA 4IPGA 4R4OA 1VQOA 4LF8Q 1K73C 4EQ5A 4LNQA 4JBMA 1W3SA 4PZ8A 3H15A 4C3JH 1CSPA 3CPWA 4IOCA 4GN4B 2UUCL 4IJHA 4H02A 4P74A 4A4IA 1L2FA 2RHSB 2N78A 4YCWA 2OTLA 3PO3H 2UXCQ 4OX9Q 4YHHQ 1WYDA 1X3FA 3GTJH 5JEAG 3S1QH 4QIWE 4AH6A 3I4MH 1V1QA 3J7ZC 4QY7A 4B3ML 3GTQH 3PGZA 5C0XG 2A19A 2ATWA 4BBRG 2JA8G 2ASBA 4PZ6A 4DR3L 3PUZA 4DAMA 2F4VQ 5FLXc 1YITA 1HZBA 4IO9A 2ID0A 1EUJA 1I50H 3I2ZA 5C0XJ 2QGQA 2WB1G 3CQZH 1WOCA 2D62A 4OX9L 3CCMA 2DUDA 4GKKL 1VQAA 1EYGA 1VQDA 3OW2A 1FVIA 3HOVH 3RZOH 4JC0A 2GVBA 1PV4A 2JQOA 5GAHC 4JI4L 3E9IA 1VQPA 5LMNQ 4LUZA 1FL0A 4HJAA 1XPRA 1VQ8A 3W5OA 2F4VL 4DV5Q 4KI0A 4LW1A 5LMUL 4B3TQ 3PO2H 2ZJRA 1OXUA 1WFQA 3BZKA 1N36L 4OWXB 4A3JH 4B3SQ 1NBWA 2XGTA 1C7YA 3KF6B 3T1YQ 1B70B 2PI2E 3TREA 4UP9A 5GQOA 3J81i 4DR1L 3T1YL 3G71A 4DV1Q 1IL2A 1V9PA 2UUCQ 1YJNA 2VQFL 5BR8Q 3CCUA 3CF5A 4DR5Q 3J80i 2VUMH 1VQ7A 2JEAI 1XMOL 3J7A5 2IY5B 2Y0SG 1MIUA 2EIFA 2WFWA 2JEBI 4X66L 5C4XH 5IY0A 3KOJA 3T1HQ 4RG1A 1PHJA 1A62A 1A0IA 1HH2P 1OXVA 5LMNL 3GTKH 1T9HA 4DV0Q 4A3LG 1UE1A 4BA1I 2NZHA 2KHIA 3RLNA 2QEXA 4QJFA 4BY1G 3A0JA 3RNUA 3H0GG 4AYBG 1PH2A 2N8NA
chains in the Genus database with same CATH superfamily
1BQQT 1STYA 4UCSA 2HVRA 1SNOA 3MHBA 1A3TA 3A5ZB 2FPPB 4DV7L 3PIP3 4DV2L 1K8GA 4R4QA 1PH1A 2DJGC 3TZUA 2WP8J 4JW0A 3K7UC 3D4DA 1V1PA 2R87A 4YCUA 2CH4W 5M3FB 2CVRA 4JYAL 1XNRL 4PMCA 2HIVA 1IKLA 3P20A 5KNBA 3ND9A 2ZT9C 3HOUG 3KHLA 2B39A 2R61A 4DN4M 1WTVA 1VQNA 3OSOA 2EY2A 2UVVA 1OO9B 5KYLA 2XNAC 1SR3A 1HUMA 4RAUC 4Q8FA 3RB6A 2N3SA 1H9KA 5F9LA 3MR6A 2VW9A 1XJVA 3K5IA 3PZPA 5I9PA 3RB3A 4O3SA 5DM63 1GXDC 1C0AA 3SVMA 1QE6A 1QILA 4UCUA 4TQUS 1SNPA 3L3OC 5IT9E 1GO3E 2PMZE 3KLSA 3HOUB 3V6HA 4C3IG 5A2QL 1CTMA 4ZYSA 1VQ4A 2XWBB 1F9RA 4LFCH 1Q12A 3KBGA 2AGPA 1UC9A 2I5HA 4F7XA 4A75A 2OH2A 2OT2A 4OO1I 4RMFA 3OTOH 4X64L 2FK2A 1IW7C 2JA7H 3OSPA 5BPFA 1PYBA 4QW9A 2Q2IA 3ND8A 4A3DB 4OO1G 4MIUA 1YZ6A 2VUMG 4V0BA 1U5KA 4PG3A 4LSXA 2W71A 3QZ7A 1WTQA 1HJPA 1U4PA 2E2DC 1Y8PB 4YY3L 1HZ9A 5AFWA 1Y1WH 1B8AA 1V43A 2CKZB 1QCBD 2EXDA 4DV0L 3PO2B 4F50A 3NEMA 3FMCA 4GLAC 3GTPH 1BBUA 4ZUIA 1HNZH 1EIFA 4H44C 1KNAA 4DV6Q 4PMWA 5JEAJ 3A54A 3PUYA 3J7AK 3CCRA 2WINB 3CCSA 2YYZA 1KAAA 4NW2A 1PH9A 3BA8A 1STNA 4KN4C 1WCMB 2HDLA 2HT1A 4M9UA 4R8UB 1KXLA 1SE3A 4GNXB 2YZGA 4LF6Q 1I6VC 5JJKA 1A3VA 5JVG3 3ERSX 5IYDH 1KLUD 4ECWA 1CE8A 1M4VA 4OEMB 5DGAA 3T5KA 1PX2A 4I55F 4MHEA 1XMQH 3BG5A 1CKMA 1HTLD 4DF7A 2ALYB 4LF6L 2IHFA 5KFKA 4EQNA 3R5HA 2AU0A 4X66H 1DV1A 3DXJC 2W9CA 4IQZA 4N8X1 5IWAQ 4CJ2C 2R8IA 4A3GG 2K52A 1PDQA 1HNXL 1E4EA 3HKSA 4LF4L 1JJ2A 1AUXA 2W6ZA 5I2YA 3BVMA 1T36A 2ZDHA 4DV6H 1KNEA 1XPUA 1HHVA 1XNQQ 2KECA 2DGYA 5KFBA 1KRTA 1KDBA 3M4YA 1S5BD 4AYBB 5C4JH 1ASZA 4E4TA 2JP1A 3HOYH 3K80C 4J15A 4JCVE 4PMBA 4G57A 2VPQA 4RU9A 2ASJA 4IRDA 4WD3A 2AQ4A 5FOBB 3S16B 1HZCA 1FNUA 1CI3M 3GP7A 4YBZB 1GUTA 3I56A 1B1ZA 3D4RA 1L2ZA 4K6DA 1VQIA 4NXNL 1C4QA 2TMPA 5C44H 4JI2H 1G6ZA 1BBWA 1FJGQ 2R7FA 4H7BA 3VR6A 3EBEA 2BR0A 1AN7A 4HSVA 3ZJYC 1I94Q 5C3WA 2NU8B 4WJ3M 2Q2TA 3OHBA 5IYCG 1BCPB 1Y8NB 2F0LA 5FK9C 4GLVB 4ZKCB 2HCIA 4OGQC 5JVH3 4GC7A 2P5ZX 2MCTA 2UXDH 3SK8A 2UUCH 1WR2A 1BVSA 1DV2A 3QOLA 2K5NA 3M85A 2MFIA 2CQOA 1GGOA 1F2LA 2MQHA 3HOUH 4ME3A 3PUVA 1G2TA 2GPSA 1G291 1Y1VH 2PZTA 4DV7Q 4DR3H 4MV8A 4QUCA 1I4HA 1SEBD 3FP9A 4B3MQ 5TSSA 3K6OA 4RHSA 3PR4A 3EFXD 4JK1C 1TA8A 4A2BA 1G2SA 3OHXC 2PQAA 4F4ZA 2IJ0A 3S1MB 4J9LA 2XSCA 4AYBE 1VKZA 1XMQQ 4P73A 4U6PA 1LTLA 1XMQL 1K28A 3W2DA 2KENA 1ONLA 5KFOA 2SEBD 3U4ZA 1BF4A 3EPIA 1I3QH 1JQYD 2R8HA 4ECXA 1QG7A 4A93G 1SYXB 4YB8B 4Q8EA 5EJWA 2FLPA 2AHOB 3PUXA 2PYKA 4F4WA 3I55A 3WDNA 4I7HA 2GPWA 4CC6A 2W9CB 1S03G 3RB0A 1VDZA 3UDFA 3OMGA 4XYLB 5JEAH 3K0YA 3J80E 4ZI7F 3PW2A 1WD1A 3Q8DA 4OX9H 2XIWA 2IPKD 3GIPA 1E0BA 3H3VC 2L1BA 3RV4A 2C9OA 2EPBA 1NJIC 2R86A 2WACA 2F3VA 1KRSA 4KLKA 3HKZG 1Z47A 5C4XB 3HG9A 1RF2D 5KFVA 4DR4L 2VQEH 1EYZA 2JA9A 2BQ3A 3KFUA 2AUKA 2JYOA 1A63A 3OTOQ 5KNCA 3K3VA 4GN5A 1L0YB 5L37A 5G3LD 4R4IA 3G4SA 2UXBL 3F8TA 3HOZB 4MNOA 4DAYA 1QB5D 4DV1H 1EEID 4YWKA 3KALA 1DJRD 4DUZH 3S2HH 4JI4Q 4DR4H 3CHBD 2WTFA 4ECUA 4BBSB 4KHVA 5C4HA 3AYHB 3U58A 5DG7A 2PW7A 3UE1A 4A3FH 5FLMG 1J5EH 1YNXA 2R93H 1I50B 2Y0SE 2KVMA 1TWCB 4XXEA 4QB4A 1MD2D 1LLRD 3HZXA 1I4RA 2F0FA 4NXNH 4LMYA 3CQZA 4YY3H 1H9RA 5C5JA 4YR0A 3KTMA 1IBKH 1S0NA 3S15B 4FF2A 4MTNA 2HIXA 2L9HA 1YNND 1CZWA 3GTJB 1XPOA 5FD6A 1SAPA 3HOYG 3FMAA 1GSOA 2Z4HA 1S68A 5M3MB 3CD6A 4P75A 2FLNA 4Y52H 4GN3B 4U673 1V51A 1CKNA 3OTOL 1QZHA 3R23A 3GTOA 4X3SA 1DONA 4HMIA 1ZYRD 5M3MH 4TQRA 1I94L 3J81E 1JJGA 4XQQA 3S1NH 3GTGA 4IJLA 2SNMA 4L1KA 1SYEA 1NMGA 2LS01 3S1RB 1UUPA 5J1ZA 4QWCA 1O7ZA 1LV9A 1TWHH 3URYA 5D1OB 4B9WA 2YRWA 1MJEA 1O7LA 4A3KH 2WB1B 2G9HD 4JOIA 4CKCA 5KFCA 4LF7L 4DXFA 3E5SA 1ZEQX 1TWCH 1WCMH 2EJGC 4R8NA 4YY3Q 1QZGA 1TIID 2X0SA 4LH6A 4CDDC 4MV7A 2D2CC 2F0NA 4JI1L 1SLJA 4BBSH 4IFDI 3BJYA 2HD3A 1KD1C 2PN1A 4PNYA 1JWSD 3E0EA 2HJWA 1I4GA 2YTXA 1SE8A 5CMDA 2HQEA 2D9UA 3A7AB 5D14A 3L2PA 4DV6L 5CV6A 1SROA 3HOZH 5IGDA 5IGBA 1UWVA 4AQYH 2JEIA 1MSGA 2A6HD 4Z9CB 1VQ9A 1EY5A 3U4VA 2K1BA 2SOBA 5KT7A 3NWTA 2JA5H 1SRUA 2LFNA 1W6JA 1ZHQA 2PBZA 1V1PB 2DNCA 4IUUA 5IODA 4QIWB 2V1CC 4B08A 2IA6A 1X56A 2VNUD 2B3GA 2J6UA 1GM5A 3ER0A 2PPBC 3DEOA 1I4XA 4A76A 3A55A 3PIO3 2FP4B 4BY7B 1T5XD 1JIHA 5KFGA 5DQIA 2F03A 3ITPA 2WV6D 4RNOA 1FKAH 3CAMA 2H4OA 1S3OA 3Q6SA 1PFNA 5D3IB 2R92G 1LT4D 4DK3C 1BNCA 4R7RA 4CDCC 4RNNA 2IX1A 1DGSA 1S72A 1QVCA 4B9XA 2VQDA 3J81W 4BWGB 2JA6G 4L6TB 1G8ZD 4A3LH 1DD2A 4I4TF 2W9AA 3ZYYX 5IGEA 1WH2A 4G7ZC 4C5CA 2E75C 5IYDG 2B2UC 4GKKQ 4EYIB 1EY6A 5IYBH 3S24A 4M8AA 4AIMA 3CMAA 2PI2A 2BH2A 4KHZA 4LFBH 3OPOA 1PH8A 3GTMB 3S2DH 2W57A 2NZ1D 3NENA 3STBC 2WAQA 2FJ2A 1A8VA 4RB1A 3RR5A 3J7YW 1MJCA 5J2UF 4DR6L 4Y7NH 3IAYA 3RZDH 1IBMH 3F1ZA 1HRJA 3LWBA 5LOVF 1LTGD 4IPGA 1QUQA 1DIKA 5KG6A 4EQ5A 1W3SA 4PZ8A 5I47A 4TUYF 3CPWA 1D1KA 4IOCA 1EY7A 4A4IA 4P74A 1L2FA 3GV6A 2RHSB 1ENCA 3H4BA 2TSSA 4HAEA 4MTEA 3RIZA 1WYDA 5KFZA 2L4NA 1V1QA 4RHRA 4RA8A 3PGZA 4E6IA 1SNCA 2A19A 2YRXA 3DUZA 3PUZA 5C4ZA 1PTOC 1HZBA 4IO9A 2WB1G 1PK8A 3TP5A 2KJXA 4R8UA 2DUDA 3BG3A 4GKKL 3M9MB 5IGFA 1MGSA 3G6JB 4O4HF 4JC0A 3RD4A 5GAHC 3GV3A 1FJGH 1QWYA 2FHTA 4HSPA 5EBCA 4MV1A 5KFDA 1KEEA 3LWEA 4FS2A 4G4KA 2ZJRA 2NVYA 3BZKA 1B3AA 3UQ8A 2K6AA 3LMLA 1ESFA 1IW7D 1NBWA 3U9OA 3KF8A 2FB9A 2XGTA 4QIWA 1B70B 3TREA 4DR1L 3J81i 3T1YL 1KDAA 3K3PA 1AFPA 3CVZA 3G71A 1IL2A 1V9PA 2QEJC 3HOYB 1A6XA 1I3QA 3MXGA 1I50A 4K6LA 1XMOL 2VPSA 1MIUA 2JEBI 5IY0A 3H6MA 3QZ8A 5IWAH 1BCPF 1PHJA 5KRUA 3QO2A 1HH2P 2MHVA 1PTOD 2W8KA 4BA1I 1B33N 3DEPA 4ZHQF 1B53A 1TY0A 5CB4F 1ZXTA 4QJFA 1XTCD 2E76C 4PDBA 4BBSG 5LP6F 2LMCB 5G3LF 2JA8H 2ZDQA 1F2ZA 1B2TA 1K8MA 2FLLA 4MV9A 3MXNB 5KFHA 1IXRA 2DN8A 2K32A 1CKNB 3GTLA 4DAVA 2V4QA 5LMUQ 3MXPA 3PO2G 2AUJD 2K5VA 3OSNA 4NP5A 1IBMQ 4JOIC 1E2ZA 4A93H 4J9QA 2A1AA 1WJJA 1DOLA 4OXPA 2WAQB 3TBIB 4LF7Q 3GILA 1SNMA 4DL3A 4JI1H 3SK5A 4ZCKA 2NN6H 4JI3L 1I6HH 4XIGS 1D1IA 4ZQIA 1VQMA 1W2BA 2NVXA 1EOTA 5KG1A 5LL6X 1PRTB 1NNXA 2IHEA 2C2DA 1NUCA 3OWEB 3KDFA 4DUZQ 4IHJF 3Q22A 3DWPA 2NU7B 4DV4Q 2VUGA 4X62H 3HKZB 1UE7A 5C3EH 3PF4A 3I8ZA 3M4PA 1BR9A 2F0IA 1WTRA 5KT5A 1JX4A 2DPIA 4JI6H 2MP1A 2X6GA 1VQFA 4JYAH 3W1GA 1HNZQ 2LSSA 2DIKA 2B63A 1VQHA 5GAEC 1SN8A 1LTSD 3NELA 4C3HH 1VQ5A 3TINA 5CA0F 1Q8KA 2QDLA 4CJ0B 4JI7Q 5LA6F 1XDNA 4LWCA 1PYSB 4A3DH 1G6PA 4A2AA 1K83A 2MNAA 3T53B 1STAA 1DM0B 3HP3A 4DV1L 5EKLA 2RDIA 4ECYA 1GLVA 2YU9H 1TWAH 4KJOA 1QVGA 1H9SA 4XT1B 2V5AA 5DLFA 1WVLA 4A3BH 2OEOA 3HOXB 1CQJB 3S17B 3CCVA 1PH3A 3TQYA 3DMUA 1Y69U 4CJ1B 4DNIA 3F2CA 1PTOF 4DNRB 4DKAC 4JUZA 2B8GA 1IBLL 3SE7A 1T94A 5EPKA 1VQKA 4YWMA 5ELOA 1LTAD 4ECVA 5M3FG 3KF8B 4DR5H 3V6JA 5C1PA 4R9WA 4ZRZA 1FNVA 3BAAA 3VYTA 4EGVA 3KJPA 4A3FG 1Z2PX 1X9NA 2R93G 2V9WA 4B3RL 1O7YA 1HNWL 1HPCA 3QJYA 3M4OH 5JQWA 1Q3LA 2UUBQ 3N8DA 4N9TA 3HOVB 4DR7H 3M3YH 1RJPA 1SMXA 3JAMi 3P7JA 4P72A 2R82A 2Q2UA 1D7QA 4I50F 1TVXA 3N6RA 3MFHA 4HJ8A 1S9FA 4RCOA 5A35A 4J0MA 4KY6A 1V1OA 1YHBA 5EKKA 2H5XA 2PZUA 2M2LA 3MEHA 1GSHA 2UUBL 3VPBA 3OUUA 4XZ3B 2KHSA 1PRTD 4MTKA 3TP7A 3RN5A 3S9WA 1SJHD 5LL6b 2CWAA 2F52A 1XNRQ 1Y1WA 3VR4A 3IN5A 4FP5D 1XWEA 3D31A 3GV7B 3I7FA 4RNMA 4DR1Q 1E22A 1K83H 5DQGA 3K81C 1GD7A 4LAAA 3NUCA 1IOWA 3M4IA 1RL2A 2V4RA 2GVAA 3I4LA 1Q46A 3KDFB 1II3A 3D3RA 4Y7NB 4Q44A 5L1JA 4O2AF 1TR5A 4UCVA 3HKZA 3G6YA 1DXMA 2FFKB 2X69A 1IBKQ 1TWGH 3FKIB 2HVSA 2ZTCA 4A3EB 4J6HA 2QKIC 4DK0A 3JAML 2OQ0A 1R9TH 4DNTB 4PZ7A 1N34L 4RUCA 3VYSA 1YIJA 1N56A 2VL6A 4BXXH 1JORA 5KFIA 3GV8B 1YNJC 2C00A 4A3JB 5KYIA 4FYDA 5F9NA 3Q1KA 4DV4L 2Z6BA 1EZ8A 3I4NG 3IL8A 3M9NB 5KG7A 3SK4A 5C1OA 2AKWB 5DLGA 2JA8G 2JA5G 3H40A 4XYQA 5IP9H 3N6XA 1VQCA 5IT9W 1SYDA 4MA0A 3RN2A 3T4AC 2E74C 1EIYB 3UDIA 1VF5C 3RZOB 2LXJA 1L1OC 3SXHA 2EOTA 4X62L 4EEQA 1JOOA 3S17H 3HOXH 2IL8A 1V8QA 1PXUA 2RVLA 2Q2HA 5A2QE 4A3MH 2CFMA 3RAXA 2R7LA 1XXGA 2EJMA 4CDEC 4HIMA 5EWFA 3GTQB 2JA5B 3BZDB 4I65A 1YVCA 3K57A 3FVQA 3JZIA 4DR7L 2EY1A 3QR8A 3C0FB 1X3GA 3A74A 4O3NA 3P1HA 4ECRA 1KABA 4IZOA 2RHQB 3I70A 3FDSA 2PO4A 2JJQA 3PSIA 1OXSC 4BA2I 3UDGA 4LF5Q 4KHPH 3KHHA 4IWYA 4B3SL 4DLKA 4F87A 4POFA 4BY1H 2EXZA 1SNDA 4XT3B 2J6SA 1M0WA 4M7EA 3BA9A 4DR5L 5ELCA 4FXKC 5GADC 4ED1A 2UUAH 3PIOA 4DV5H 4JBWA 5D8DA 3TMEA 2CHBD 3QWNA 2J4XA 5KT6A 2XGQA 1H9MA 5EZYF 4B3TH 2B2YC 1GUOA 5EDWA 1B50A 3CW2C 2NTTA 2NU6B 2RQXA 4K5XA 3WO0A 1MKHA 3U50C 1EQTA 5ELDA 1LUZA 1NMFA 2ASLA 2F0VA 1GJXA 1JE5A 2A6EC 1HR0H 1BO0A 1D5MC 4FDBA 3VR3A 1UEAB 2RSOA 4QWEA 2YTYA 1N48A 1SYCA 2W9BA 3T1HH 1Q86C 1B9NA 2EZVA 3KHRA 2JA6B 1KBLA 2H1EA 1FJGL 3A8JE 2I0QA 4JI7L 5FO7B 2F0QA 4JI0L 4N8FA 3GTGH 1ZQ7A 5FPRA 3TZDA 2Z6KA 3CXCA 1B04A 4LFCQ 3G48A 5AJ3Q 4JI5Q 2W8LA 2G9DA 4P71A 1S5ED 4YCVA 2PQAB 4A3GB 2RGVA 3AQQA 1R4PB 1J9OA 1JDEA 2F4IA 3E6ZX 2UVWA 1S97A 3GIQA 1KJIA 1YHQA 1QOHA 1GUSA 5M3MG 2HQLA 2D0PA 4J9OA 4RZRA 1NTGA 2K4KA 1XNRH 2DLNA 4UP7A 1CSQA 2QF7A 4RZQA 3CC7A 5L1KA 1A3UA 1IBML 3L0OA 4C1NI 5LMNW 2K50A 2IX0A 5E4XA 3PW5A 2ALZA 1WCMG 5EKIA 3SR1A 2JEFA 2EE1A 1SMYD 2KCCA 4KD4A 2NVTH 4A3EH 3NTKA 1U4RA 1SEIA 2EJFC 1TWGB 3F2UA 2W7OA 1Y1VA 4OONA 1ICWA 4QL5A 4FXDA 2K14A 2QK4A 3TIIA 1C8CA 4IRCA 4DV3Q 5JJZA 2EYPA 4CGYB 2MJ8A 1YNJD 3HOZG 1IKMA 4GKJH 2RDHA 2RBMA 5HBRB 3J80c 2JSOA 3RTXA 2E2HB 3CRLC 3AEVA 2R7ZG 1A2UA 3RMHA 3VR5A 5IP9G 1RHPA 2L11A 3D4WA 2DJFC 2EQSA 2VS1A 3CCLA 1PZJD 1N8RC 1TWFB 4JI6L 2ZDGA 3MFIA 1AE3A 4UHVA 2K04A 3KUPA 2ZM6Q 4LF9H 2C2EA 3OOCA 1N36H 4FO2A 4JV5Q 5KGUA 1PFMA 3LNNA 4LUOA 2FMCA 1VAJA 1W93A 4JI6Q 2ICIA 2UUAL 1J5EL 1LM0A 1PH6A 3S1MH 5IE8A 4C3HG 5HGTA 1TWCA 1DOMA 1VQBA 4BS9A 4O0AA 1JB3A 5ELNA 1UAPA 3M4OB 1HFNA 2FMMA 2Z9HA 1I4PA 4OHJA 2R92H 4BWSC 3WWVA 4ABNA 5KFWA 2VQFH 2IT1A 2PZWA 3GTJA 4Q45A 4B3RQ 1JT8A 4JI1Q 1S4ZA 2A5HA 2L15A 1XNQL 2DWCA 3MR2A 4DR6H 3BU2A 1S0OA 3C3LA 3EA6A 3N43B 5IT9L 2VB3X 4HJ7A 4K8IA 1SMYC 1SE2A 1VS0A 5HURA 4C5BA 3CCQA 2ENBA 3TQTA 2R7KA 4R4TA 3T16A 3ERQA 4EEYA 4NPSA 1VQEA 2L55A 5EWGA 1VQ6A 4YQWA 3MFYA 4LFCL 3Q24A 3R2IA 4L5SA 4NXNQ 2C2RA 4MZ9A 1NR4A 1LT6D 1P8LA 4YHHL 4LUVA 2GA4B 5M5YB 3LP8A 2XC9A 3PW7A 1QNKA 2J0TD 2ATLA 2UUBH 3NTIA 1S5FD 1CA6A 2K05A 3FHWA 3E5NA 2WB1E 5JPMC 2Y0SA 2IWHA 3N52A 4O3OA 2E2IB 3HOWB 4DR3Q 3RUZA 3D0FA 3GIDA 1SDFA 2R8JA 4DK6C 1KTKA 1GKHA 5D1PA 2FK1A 2V4DA 1M6VA 1TWHB 2FINB 1TQOA 4J8QA 3S1RH 3L4JA 1CA5A 3VPCA 4K0KL 5C5MA 2NVQB 2ZTEA 4FVMA 2ZJPA 1WTXA 4U7CA 4HTHA 5ELFA 4A93B 4L8JA 3U9TA 2I87A 4R4OA 3TP8A 1FD7D 3A8IE 3RAQA 1F9SA 3H15A 4C3JH 3K7AB 4HEDA 1Q8IA 4UDUC 4H02A 4DFAA 3KHGA 1HCZA 3ONAB 1RD9D 2UXCQ 1E2VA 4YHHQ 1X3FA 3GTJH 3D6WA 3S1QH 4QIWE 4AH6A 4RKLA 2UVRA 3GTQH 4MA5A 3TP6A 1BGWA 2ATWA 4KD3A 1VF7A 1B44D 4ZUJA 2HHHH 1RDPD 3I2ZA 3TQ1A 4LJZC 1WOCA 2FJZA 2W6OA 1MI2A 5FLXL 3RZOH 1Z6HA 1VQDA 3VYUA 4CKBA 2GVBA 4M1UB 1PV4A 1HUNA 2JQOA 4KY5A 4JI7H 3E9IA 2IP4A 4J9KA 4HJAA 4HR7B 1XPRA 1VQ8A 3GTPB 4DV5Q 5LMUL 4B3TQ 5KFLA 3PO2H 1ESRA 4WORA 5CV5A 4OWXB 4A3JH 4B3SQ 4K8JA 1C7YA 2PI2E 1JWUD 4UP9A 4DL5A 1J8IA 2Q8IB 5BR8Q 2JA7B 3CF5A 4X3KA 3J80i 2VUMH 2JEAI 2XIGA 4FS1A 2UXBH 3I72A 5KG2A 5C4XH 2VB2X 2DZDA 3I91A 3NQIA 4YJ2F 4EVOA 1PRTF 1RYRA 2K03A 5J39A 3S14B 2DNEA 3KAJA 1A0IA 3NSWA 5KG0A 4IUNA 2EYFA 4F8MA 5LMNL 4QF4A 1AZQA 3GTKH 1UE1A 2FMAA 3RGXA 4Q5VA 4FF4A 1PH2A 3RLNA 2KOLA 4BY1G 5KFFA 3A0JA 3WOEA 5FO9B 3I4MB 2A6HC 1EWHA 3NTHA 2A6ED 3H09A 4QUFA 3ULPA 1TS5A 3K0XA 4KKSA 2IX3A 3J80W 1LYLA 4A3DG 4UFZA 2DY8A 2M9VA 1TWHA 4EBEA 1HZAA 1CHPD 1X54A 4A3BG 5IGGA 3FPUB 2CWPA 1JJCB 2AGOA 4HNVA 4MTDA 2ZM6L 2UVUA 5IOCA 3QB3A 4JI2Q 2K5WA 3S2DB 5JJIA 1Q1EA 5KT3A 5EAYA 1FNWA 2BA0A 1K0RA 4O2BF 3M3YB 2YS7A 3KF6A 5M3FH 4DR4Q 1W96A 4GLXA 2PNRC 5ELBA 3MR5A 2I46A 4IUPA 4NKLA 3MA2B 2YZNA 1BOSA 1HNWQ 4ED6A 1F9PA 5I6WA 4TQSA 1VQGA 2HDMA 5DNFA 4L5RC 1IZ6A 1VQJA 1WTHA 3EPGA 1N9WA 4PWQA 4HJ5A 1O7IA 1T5EA 3E0JA 4DR2Q 3NBHB 2B2VC 3JAMc 1H9JA 2Q8TA 4UAIA 3R93A 4UY8C 3TSSA 3GTKB 3I4OA 5EQ0A 5KFTA 2ZTDA 3T5HA 1N32H 4Q43A 4A3BB 1FGUA 3G7LA 4KY7A 2YU9B 1HFGA 2JE6I 1GUNA 1Y14B 1YI2A 4JI8L 2VUMB 3PQIA 3T56B 5IIFA 5DEHA 4C56C 1TT2A 5C44B 4PV1C 3F2DA 4LK1C 4K5WA 1EYCA 2K33A 4NXML 3VMMA 1OXTA 4X66Q 4GOPC 3NHHA 4A3IH 1DZ1A 1YBYA 3MWDA 2R6FA 1L1OA 4JV2A 4QGUA 4ZAIA 2C28A 1W6KA 1AUVA 1U4MA 2B63H 5NUCA 1Z9FA 1IBLH 4KV6A 1Q1BA 1JB7A 1F2MA 4QCLA 4ME6A 4JI4H 5CV4A 4IR1A 1KJQA 3PIPA 5EOYA 5CA1F 3CQZB 3ORQA 1UEBA 5JOBA 4RGOS 1D8LA 4KJNA 3Q8SB 1E3PA 5FJ8G 4RAYA 4YAJB 1M90C 1S5CD 4OWWB 2B2YA 3BQ0A 3L7ZC 2W70A 3GIJA 3S1QB 3GV5B 2R7ZH 2G5DA 1K1QA 3PMFA 2F0UA 4ALPA 3GTOB 2NZOA 1O75A 1RYSA 1GOZA 2B2WA 3DWAA 2E5LH 3MR3A 2UXCH 1GHJA 1M8AA 3DF7A 3W3AA 1EOVA 1D5XC 3PUWA 1NCVA 2GLTA 4ED2A 5E1FA 2JA5A 3PCOB 2VOBA 1BXRA 1WI5A 4HNTA 5DGBA 2XRQD 5DG8A 4CC5A 4A3MG 5L9XA 3JSLA 3AFPA 4F88A 4HIKA 5BPHA 3PF5A 1QJOA 3MXUA 5J3BA 4YWLA 2UU9Q 3I4MG 1JICA 3KJOA 2FPIB 3M7GA 3JRXA 3R2TA 5CV7A 2NUCA 3IRBA 3E9HA 2AWOA 4TVAB 3A7LA 1IYUA 2FE3A 1L0WA 2PW5A 4X64Q 4HR7A 5KFQA 2SDFA 4S3SA 1AE2A 1YHAA 5M5YH 1K1SA 4IRKA 3CC4A 2AWNA 3EIVA 2UUAQ 2WYOA 1SSOA 5K36G 3CMEA 2QILA 4K0KH 2MGSA 3AU7A 3MZ5A 4X3UA 5LMNH 3A56A 3SI8A 1KJ9A 2OLSA 3ICEA 1NE3A 3BDLA 1GUGA 4C1NK 1EHIA 1PRTC 3C2PA 1GVPA 1T3NA 4LF8H 2KHJA 1KJ8A 1X3EA 4RFBA 1KAWA 2QCPX 3J81c 1Y1WG 1TS4A 4UCOA 1TWFA 1B3QA 3NBIA 2KCMA 3HKZE 2E2JH 4HNUA 1EZ6A 2RDJA 2AGQA 5LYJF 1CK1A 4EGJA 5CC4A 4X6AH 2BH8A 1CQVA 1C3OA 1UC8A 3L9AX 3PW4A 1WSCA 2N88A 3NQTA 5LXTF 2D0OA 4ILWA 3RB4A 4QWDA 1STGA 5H1SE 1S10A 4GOPB 4ZQ3A 1QVFA 4AQYQ 1DCZA 1CS0A 1BKBA 3H0GA 2XCAA 4FBTA 4JI8H 2CZGA 4JYAQ 2X6LA 3B6YA 1ZHSA 5HY6A 4TKOB 3A5UA 2OCEA 3R8BA 2VQFQ 1ZKOA 5HV6A 5KT4A 1JXLA 3V4SA 1SFOA 5M5XH 3N41B 3RJ0A 1LT3D 3SE0A 4DV4H 4R1JA 3OW7A 2O5JC 4J1MA 2SCUB 3T5LA 4XYMB 1EYDA 3WNZA 5D1OA 4K5VA 4F4XA 3UI2A 2B2WC 4LF4H 3T1YH 1EFWA 1I7LA 2E8GA 2PMZB 2KBNA 3DM3A 2EYMA 3CKIB 4HJ9A 5DM73 4B3TL 4KTAA 1KC7A 4C5AA 2RA4A 4NDXA 1CUKA 4L63B 4A3KG 2FK3A 4YR2A 2MPMA 2N49A 2BCOA 1KDCA 3D8GA 1UNSA 2B63G 1Y1VB 4NMZA 1RJRA 3S14H 4DL6A 1RIPA 1ET6A 3FKIG 4ULLA 4DL7A 1O80A 2UXCL 3GTKA 1I7NA 4H0LC 3RBEA 3E3XA 5C44G 5LMUH 1GUWA 4DV3L 1E4GT 3KXYT 3DLLA 2W6NA 2LXKA 5HGQA 2VA3A 4APVA 2YV5A 2XVSA 1EEFD 1MHWC 3M9BA 5KFAA 5FJ8H 4JI0Q 2E2HA 1WTWA 3GDEA 3IG0A 1U4LA 1AH9A 1N32Q 3OIPA 1LTID 4HYKA 1BJTA 4LFBQ 2NVYB 1ZYRC 4WRDA 3BDCA 2W6PA 4NLGA 3H91A 1PMRA 3EJIA 5CV9A 4FF3A 2W6QA 3IFTA 5C4XG 4MV4A 3MTSA 5IT9c 2EVBA 2OQKA 2PNHA 2XWJB 2ICEC 4GS3A 1RJTA 5CV8A 1PH7A 4ECTA 2F4VH 1JCKB 3V6KA 3R5XA 1N33L 2F3WA 3C1EA 1RKNA 4OIJA 2JEGA 4A3KB 3J7AV 4J9RA 1EY4A 4EFBA 2LY7A 1BDOA 2KCTA 4G7HC 1KLGD 3CP0A 3TEHB 4FF1A 3HOVG 2M05A 2EYOA 3DWQA 5FPOA 4IURA 3PVXA 3S1NB 4LFAL 1QNUA 4KMUC 2JA6H 1HNXQ 5KX5F 3TN2A 1K9MC 1MZBA 5IYZF 1AEXA 2VZAA 5IYBG 4R4CA 2C35B 3N42B 4MV3A 3KBXA 1PFSA 2OTJA 3GTOH 5C3XA 5GAGC 2I07B 5I2XA 1KJJA 2R7ZB 3NP8A 4HCEA 4ODGA 3J81j 2IMWP 3BQ2A 3N40P 3JSNA 1I4QA 2F0WA 3S15H 3Q23A 3IKJA 2NU9B 2B8FA 4X65L 2BE5C 4X65Q 3ORRA 1IHZA 2RDFA 1HA5A 1SCUB 2XGPA 3GTQA 2AQ1B 2PCFB 1CT1D 4J9MA 2NB0A 4OELB 1A2TA 4DL4A 4I7ZC 3T1HL 1KHIA 1IBLQ 4XQJA 5IP7H 4CDFC 4G3IA 3RLFA 3MWYW 4IUQA 1TAEA 1CM9A 1KIXA 3D6CA 2E2IA 1EQRA 5BN4A 2DPJA 1EYAA 2I5LX 3UFXB 2B63B 2QYZA 1C48A 2R3ZA 3I90A 4IOAA 5DG9A 2ZXOA 4UP8A 4DV3H 4LF7H 1CZGA 2W7PA 5T1GA 5IWAL 3KYHC 4X64H 4DAPA 4IR9A 2XN9C 4KHPQ 4LF5H 1EQQA 4GKKH 1JLLB 4YAKB 3DHQA 2JEJA 4DR2H 2EDGA 5DQHA 5I6YA 5GROA 2F0MA 2NN6I 4K0KQ 3QG1A 3K59A 2RKSA 4HMJA 4A3IG 1SFOH 3GQCA 3J81L 3SGIA 5FLMH 4AQYL 4K2KA 2K75A 1HXYD 3CCJA 5C8YF 4IZ8A 2R92B 2K5QA 3NWSA 4DXGA 5KFMA 2F0GA 2JA6A 3Q8PB 1R4QB 3JAMW 3H0GB 4RB0A 5JVDF 4BY7G 5KG5A 2F0JA 2R93A 2B29A 2F1MA 3EVQA 4NB3A 3KLSX 4IFDJ 1P16A 3GD7A 4YP3A 2O2LD 1ILQA 2Z8LA 4U68A 4XYOA 2R85A 1R9TB 2WAQE 1TS3A 5KNDA 4IFDG 3FKIH 2E5LL 4JV0A 4DV2H 1TWFH 2E5LQ 5J22A 1ET9A 3H3VI 5KFEA 4DUYQ 1WD0A 1BCPD 4DR1H 4XQNA 5FD5A 1N34Q 1A15A 1HR0W 1ILPA 2BDNA 1EU4A 5M9OA 4A3JG 2VY3A 3FPPA 1X3QA 1X32A 1K73C 4PQXA 4JBMA 4LNQA 1MSHA 4ED8A 3BYTB 1CSPA 4EYHB 4ED3A 3TDQA 1RJQA 4YCWA 2N78A 2OTLA 3PO3H 2RCFA 4OX9Q 2RDGA 1PTOH 2SNSA 3MVVA 3I4MH 3J7ZC 3K5LA 4B3ML 1M0TA 4EBDA 4APMA 3FKIA 5KFJA 2YCHA 4J9NA 4YJ3F 4DAMA 1D6EC 5FLXc 1YITA 2F4VQ 2E2JB 1TWGA 4F4YA 3I73A 3CCMA 4FBUA 3EROA 1VQAA 1EYGA 1Y8OB 1FVIA 3HOVH 2UU9H 1VQPA 5LMNQ 4XDXA 1FL0A 1JC7A 5T1IA 2F4VL 4LW1A 1B6RA 1OXUA 1WFQA 1X3PA 1YNNC 1TKWB 3G8CA 3I12A 3K5HA 3KF6B 1GSAA 2AQ3B 4DV1Q 4FU0A 3QFFA 2D5DA 1YJNA 1AZPA 1EY9A 5L1IA 4DR5Q 1NR2A 2WFWA 2MUYA 5LL6S 1CFMA 3KOJA 3T1HQ 4RG1A 5KFNA 1RTOA 1A62A 3VA5A 1E2WA 4ZK9B 4DV7H 4A3LG 4DV0Q 4IALA 3SDZA 1RCVD 2KHIA 1HNXH 2F0OA 3RNUA 2O4XA 3NBHA 1GYFA 4B3MH 3H0GG 4ECSA 2ZXRA 1STHA 4C3HB 1PA6A 2A69C 3FRPB 4DU9A 2ES2A 1WTOA 3HGBA 3EYYA 2R84A 3VPDA 1PYWD 3KLRA 4WFN3 3K7AH 2L5TA 3T51B 3T5JA 1N34H 3UE0A 3GTMA 4C2MB 4G7OC 5C3EB 1N36Q 1PLFA 2HUGA 4GKJQ 4J9SA 3GTPA 4O3PA 4GKJL 3I3CA 2NVQH 4RGTA 4DK1A 1ULZA 2XCPA 1EUDB 4X3TA 1C30A 1ENFA 2WB1A 1S40A 1Z2NX 5FKAC 1I94H 5CGKA 5AJ3L 5J2TF 1HTPA 3J7AF 1I6HB 3SEBA 1PZID 2NWGA 4QWAA 1M7JA 4A3CG 1FYCA 2E2IH 4BY1B 3HOWH 4ECZA 2RGRA 1RTNA 3OMCA 5M5WH 4P2CB 4ZKBB 5E7NA 2YYAA 3R5FA 4K14A 4LFBL 2WDTA 2W9BB 2PQEA 3M7NA 2NUAB 2F0SA 2WE6A 2BQRA 1EQVA 4HIOA 4FNFA 2KEEA 3JAME 1YEZA 3OUZA 1VMPA 2YL2A 1ZETA 1EIGA 4R8IA 1E24A 2FKLA 1RK5A 1K3BC 1F9QA 4BXXG 2XD4A 5CR3A 3VDYA 3K5NA 1XTDA 2OF1A 3HBLA 5L1LA 2WAQG 2J6TA 4YR3A 3VR2A 4V190 4IFDH 2NYZD 4EG0A 1UE6A 3M4QA 3ULLA 4JI5H 2VXWA 4IN3A 4CKEA 3K5MA 4DUYH 1E4EB 3GTLH 4X65H 4WJWA 3HEJA 3JC66 1AW7A 2F0DA 2R92A 2XCLA 5CBAE 5BN3A 2PMZA 4IPDA 3GQBA 4BBRB 4IWXA 1VBHA 4MN3A 4RH6A 4IUTA 1CHQD 5CBEE 1GHKA 2Z6KC 1HR0Q 1HR0L 2VQEQ 4YHHH 3MWEA 4DUYL 1Q90A 1J5EQ 1NSNS 1IL8A 4EX5A 1HA6A 2F0EA 4JI2L 1HQRD 1O78A 4FM9A 2EY6A 4RKBA 4JV5L 5D3DA 4ZLTF 2NN6G 3F2BA 1L0XB 2NBFA 2VA2A 5BMVF 3PO3B 4Q0YA 2KQ3A 3EN2A 5K36H 3OHAA 1N33H 2R7NA 2A73B 3BS1A 4LF9Q 4EGQA 4IPCA 2ZM6H 4DAYB 5EPLA 1JWMD 2EYHA 4O1NA 4X62Q 5C3EG 1Q81C 3OYYA 5KFXA 5BR8L 4FXGC 1LACA 2CW7A 3RZDB 2DY7A 3ETHA 3MFGA 1E1OA 5KFUA 1U9RA 5C0XI 1B7YB 4MAMA 3RBDA 1E7ZA 3H3VH 1X6OA 2I8CA 2UXBQ 2ASDA 4ZOLF 4TRDA 3SK6A 2F3IA 1HNZL 5I4DA 4RCNA 1K8AC 3BJUA 1PVOA 3G6EA 4BBRH 1ENAA 3AMUA 1YJWA 3H0GH 1XMOH 3H4DA 3TS2A 3H20A 3G6XA 1IOVA 1F2YA 4RAZA 4O42A 2QA4A 3DM1A 2HHHL 1SYGA 3FEWX 2O03A 3PR5B 2K01A 4JI5L 4QQBX 2C5CA 4RGNA 3GIMA 2J9GA 2R6GA 2CW0C 1TXYA 4GC6A 4NXMH 4A3GH 4KK7A 1Z7TA 4KHPL 3GLKA 1OXXK 1TWAB 5KT2A 3V2TA 1RK6A 2I5MX 1HNWH 4LF4Q 1JOQA 3CC2A 4TV9F 3NK9A 4JBKA 1H95A 3I4NB 4POGA 3G6VA 2M00A 1UE5A 3HOWG 2YS6A 1XX8A 2CH4A 4C3JB 2A74C 2UXDL 3W1BA 4DA2A 3BVGA 1JMCA 2QW7A 2R7DA 3MXNA 4ED7A 2R8KA 4QWBA 4ME5A 4HN7A 2XRSD 4A3EG 3J80L 3VYRA 3H94A 5JAVA 5F2DA 1CQIB 1TU2B 2A69D 5JVLA 1JDBB 1IYJB 4O4LF 3OIQA 1KL9A 3O13A 5FLXE 4TV8F 2ZJQA 2VUMA 4EBCA 1WTPA 2NVXH 1B6SA 2CQAA 4YIJA 2NVXB 1CQFA 3C1FA 2CCZA 1DYQA 3U9SA 4WJ4A 2KCNA 4C2MH 1LTRD 2FPGB 1C9OA 5KG3A 3QOJA 5JJLA 4O3QA 2KEDA 3V96A 1L1OB 2K5DA 3PO3G 1G91A 2VR1A 4C3IB 4KN7C 1XNQH 2F0TA 4LMQD 4DR7Q 2BQUA 1NAPA 2JN4A 3ETJA 3CCEA 5EGTA 3GO5A 1Q7YC 2N55A 2ZXPA 2GN5A 5DLQE 5KFRA 3T13A 3MJFA 4RUAA 2BOSA 3RLOA 2RCNA 4ETSA 3MWMA 1Q82C 3PV0A 5ELEA 1ML0D 2EY5A 3I4NH 1DOKA 4CHTB 3MAQA 3Q2OA 1K3RA 1BNZA 1K0SA 3NGDA 4DV2Q 5C5LA 4ID6A 4TSSA 3TRZA 1JKJB 4DUZL 1U0LA 4A3MB 1N33Q 1VMCA 2HCCA 1BBXC 2AMCB 1R9TA 5C6AA 3HB9A 3VA7A 5CORA 2YW2A 3QIAA 2ZJTA 2MO1A 3HOXG 4CBVA 4LF9L 1N32L 1VCIA 4DR6Q 2EYJA 3BQ1A 1EWCA 2V59A 1I5FA 3M9OB 2B2VA 5EBDA 3KAKA 4RB3C 2AQ2B 1QUQB 2NVYH 1ASYA 5BN5A 3BVZA 3HFZB 2CW8A 5C0XH 3KLWA 1LT5D 2OXPA 1F77A 2HHHQ 1FR3A 4AYBA 5EPJA 3OWFA 1FGBD 4JI8Q 4DV0H 1SNQA 2W6MA 3EQLC 5LHY1 3RUPA 2EYLA 5IP7G 4IPHA 2Y0SB 1E1TA 3F8NA 3IFDA 5E3FA 5GONF 4L5QA 4IAJA 4O3RA 1OTCA 2E2HH 1LABA 1BXTA 1KQSA 3V4ZA 2WIIB 4DR2L 2C22A 3HS0C 2B2TA 1KC8C 1IBKL 2R8GA 1NY4A 3Q0AA 2Z0SA 3TIGA 2F0PA 1S0MA 5JH7F 3STBD 3RGZA 2MO0A 1Z2OX 1CKOA 4MV6A 3GTMH 1G51A 4A3CH 2NVTB 1B9MA 3C46A 2QDBA 4K2LA 4KKUA 3LGJA 3HRZC 2RF4A 4B3SH 1X65A 3CPFA 5M5XB 2I80A 1I3QB 4LH7A 3L4KA 4NXMQ 5KFYA 4C3JG 1SJED 1JR0D 2XTIA 2OWOA 2K28A 5BR8H 2YTVA 2BA1A 1EUCB 3K58A 4GOPA 5EWEA 4GNXC 4OWTB 1PFBA 2A68C 4XX0B 4HQ6A 3P75A 2JXMB 1TS2A 1EY0A 4BY7H 4O2DA 3TS0A 1D2BA 3NE5B 3FDTA 3MC0B 1X55A 1B4OA 4JBJA 2VQEL 5I9OA 3BABA 2FXQA 5KFSA 4EQPA 1SBBB 2CQYA 3GTLB 1RODA 4IUVA 5CAEB 1MBYA 1TY2A 3N44B 1SFOB 1LO5D 4UCRA 4DGZA 2O5IC 1EZ1A 2F0KA 5ISRA 2P0AA 3K8AA 2F0HA 2HGSA 1M1KC 2V58A 2YU9A 4KKTA 3Q8QB 2JK8A 3A8KE 3GTGB 3X3MA 1TWAA 5FLXW 3ULJA 4LF5L 2R7ZA 2UXDQ 5IYCH 1VBGA 2JA7A 3UDXA 2K5HA 3PW0A 4ECQA 4LFAQ 1ICFB 2PVPA 4DV5L 3RV3A 4DPGA 2IBKA 1EY8A 3WOFA 3MEFA 4RWSC 2A68D 1JOKA 1STEA 4L5TA 4EFEA 4C3IH 3S16H 1SE4A 1D5ZC 2KUMA 1Y1VG 5D65A 3V05A 5M5WB 1YJ9A 4LSAA 5E4WC 3RF2A 2Z1CA 1PH4A 2UU9L 3NXWA 1XMOQ 3CRKC 2J7ZA 4HIDA 1WCMA 3AFQA 4GNXA 5C4JB 1UNNC 4XTCS 4UPAA 1VQLA 1IYVA 3RFCA 4N9PA 5A2QW 5T14A 1EWIA 2L0CA 1PH5A 2JA7G 3K5OA 1H9SB 3SHLA 4QW8A 1K8OA 4OO1H 1AN8A 2R7MA 5KEEA 4Y8VB 1J6QA 2KA7A 5KFPA 3AB9A 3R3OA 4JI3Q 3NPPA 5COYA 4JG2A 2L12A 1A9XA 2B2UA 4LF8L 2A8VA 4JI0H 3BZCA 4Q0FA 1VQOA 4LF8Q 5DAUA 3Q8RB 4GN4B 2UUCL 4IJHA 1S5DD 5JUMA 3BDOA 2JA8B 3WO1A 3PN1A 1V4YA 2LKVA 1SXTA 3X3NA 5JEAG 2B2TC 5FO8B 4QY7A 4JV1A 3CU7A 5C0XG 2WKDA 4LF6H 4HCSA 1E4FT 4BBRG 1OWTA 5H80A 2KSWA 4J9PA 2IW3A 4PZ6A 4DR3L 2ASBA 4B3RH 2WKCA 5KIXA 2ID0A 1EU3A 1EUJA 1I50H 2K7VA 2QGQA 5C0XJ 3CQZH 2R93B 4OX9L 2D62A 4A3FB 3HXLA 4QMGA 4H13C 2Q8RE 2HVQA 4O4IF 5JPNC 3OW2A 1JE4A 4JI4L 1HQMC 4LUZA 4C2MA 3S2HB 1LTTD 2YZMA 4GZYC 3LX0A 3W5OA 1EFID 4KI0A 1STBA 4WBNF 1BUVT 2BDOA 4JI3H 1LTBD 4I7AA 3LWUA 1Y1WB 1N36L 4JPBW 2RSNA 5IGCA 5K5PA 4A3IB 4JV5H 5K2MA 3T1YQ 5GQOA 1BCPC 3JRWA 3GIKA 4LFAH 4OIKA 4EQOA 4ED0A 2UUCQ 2VQFL 5KKNB 4RGMA 3CCUA 3GIIA 1EIHA 2IY5B 1VQ7A 3J7A5 1PZKD 2BE5D 2Y0SG 2EIFA 4OL7A 2Z4IA 1SYFA 3BYYB 4X66L 4RB2C 5CYUA 1AP0A 3KK7A 1OXVA 1XYIA 4JVZA 1EL0A 1T9HA 4DL2A 2NZHA 1I6UA 4UCTA 2CW0D 2QEXA 2NTSA 1SYBA 5KG4A 1PTOB 4AYBG 1K83B 2N8NA
chains in the Genus database with same CATH topology
1PA6A 2JA8H 2ES2A 3ULPA 3K0XA 3MXNB 1IXRA 3A5ZB 1CKNB 3K7AH 1LYLA 4A3DG 5LMUQ 4DV7L 3PO2G 4DV2L 2K5VA 1K8GA 4R4QA 1IBMQ 1HZAA 4JOIC 1PH1A 4A93H 3UE0A 2A1AA 1WJJA 4LF7Q 1X54A 2WP8J 4OXPA 4A3BG 3K7UC 1N36Q 4GKJQ 4GKJL 4YCUA 2NVQH 2CWPA 1JJCB 4JI3L 1I6HH 4XIGS 2ZM6L 4JYAL 1VQMA 1XNRL 1W2BA 4JI2Q 5JJIA 1Q1EA 5EAYA 2HIVA 2IHEA 2BA0A 1S40A 1K0RA 3HOUG 3KDFA 3KF6A 5AJ3L 4DUZQ 5M3FH 1VQNA 4DR4Q 4GLXA 4DV4Q 4A3CG 1UE7A 1SR3A 5C3EH 3PF4A 3HOWH 2E2IH 3M4PA 2N3SA 5M5WH 5E7NA 2VW9A 1VQFA 1HNWQ 1XJVA 3W1GA 4LFBL 1VQGA 1HNZQ 2LSSA 1C0AA 4L5RC 1VQHA 5GAEC 1IZ6A 3M7NA 1SN8A 1VQJA 3NELA 1N9WA 4TQUS 4C3HH 1VQ5A 1Q8KA 4HJ5A 1O7IA 1GO3E 2PMZE 4HIOA 4DR2Q 4JI7Q 1YEZA 3NBHB 4LWCA 1PYSB 4A3DH 3JAMc 1G6PA 1VQ4A 1E24A 2MNAA 4DV1L 1Q12A 4UY8C 4BXXG 2I5HA 3I4OA 1TWAH 3VDYA 4A75A 1QVGA 2YU9H 2ZTDA 1XTDA 4A3BH 4OO1I 1FGUA 2WAQG 4RMFA 3CCVA 1PH3A 3TQYA 4BA2I 4X64L 2JE6I 4DNIA 3F2CA 1Y14B 1YI2A 4JI8L 4DKAC 2JA7H 1IBLL 1UE6A 1PYBA 3M4QA 2Q2IA 3ULLA 1VQKA 4OO1G 1YZ6A 4YWMA 5ELOA 3F2DA 2VUMG 5M3FG 3KF8B 1U5KA 4PG3A 4NXML 3GTLH 1OXTA 4X66Q 4GOPC 4A3IH 1YBYA 3KJPA 1HJPA 4A3FG 1L1OA 3JC66 1X9NA 2R93G 4QGUA 4YY3L 1HZ9A 1Y1WH 4B3RL 1B8AA 1V43A 2CKZB 4DV0L 2EXDA 3NEMA 1HNWL 2B63H 4IPDA 4GLAC 3GTPH 1Z9FA 1BBUA 3M4OH 1Q1BA 1JB7A 1EIFA 4DV6Q 4PMWA 5JEAJ 2UUBQ 2Z6KC 3PUYA 1HR0Q 3CCRA 3CCSA 1HR0L 2YYZA 1SMXA 3JAMi 2VQEQ 4P72A 4DUYL 3PIPA 2Q2UA 1J5EQ 1UEBA 1PH9A 4EX5A 2HT1A 1D7QA 1KXLA 1D8LA 4GNXB 4HJ8A 4JI2L 4LF6Q 1YHBA 1E3PA 5FJ8G 2H5XA 5JJKA 4JV5L 1M90C 2UUBL 3ERSX 4OWWB 5IYDH 3L7ZC 2NN6G 3F2BA 3RN5A 2R7ZH 2CWAA 2F52A 1XNRQ 4ALPA 3EN2A 2NZOA 1CKMA 2ALYB 4LF6L 3D31A 4LF9Q 4IPCA 2IHFA 3I7FA 4DAYB 1E22A 4DR1Q 1K83H 3K81C 1EOVA 1GD7A 3PUWA 4X62Q 5C3EG 1Q81C 1RL2A 3OYYA 2GVAA 5IWAQ 3PCOB 5BR8L 1Q46A 3KDFB 2K52A 1HNXL 4A3GG 1WI5A 3HKSA 4LF4L 1JJ2A 4A3MG 1E1OA 5C0XI 1IBKQ 1TWGH 1B7YB 1XPUA 1XNQQ 2DGYA 3AFPA 1E7ZA 2ZTCA 4HIKA 3H3VH 1X6OA 2OQ0A 1KRTA 3PF5A 1R9TH 1ASZA 5C4JH 2UXBQ 3HOYH 5J3BA 3K80C 4PZ7A 4J15A 4YWLA 1N34L 1HNZL 2F3IA 2UU9Q 3I4MG 1YIJA 3KJOA 1K8AC 3BJUA 2VL6A 4JCVE 4BXXH 1PVOA 3G6EA 4BBRH 3IRBA 3E9HA 2AWOA 4TVAB 1HZCA 1YJWA 3H0GH 4DV4L 1L0WA 4X64Q 3I4NG 3I56A 2AKWB 1AE2A 1YHAA 5M5YH 3TS2A 1VQIA 4NXNL 2JA5G 2AWNA 3EIVA 2UUAQ 3CC4A 2HHHL 5IP9H 3CMEA 2QA4A 5K36G 1VQCA 5C44H 3RN2A 4JI5L 1BBWA 4QQBX 1FJGQ 2R7FA 3EBEA 3ICEA 1NE3A 3ZJYC 1I94Q 1EIYB 3UDIA 2LXJA 2R6GA 1GVPA 1L1OC 4X62L 2KHJA 2Q2TA 4WJ3M 1X3EA 1TXYA 5IYCG 1KAWA 3S17H 3J81c 4GLVB 3HOXH 1Y1WG 4A3GH 2E2JH 2KCMA 3HKZE 4KHPL 1OXXK 2Q2HA 4A3MH 1BVSA 2CFMA 4X6AH 2I5MX 2BH8A 4LF4Q 4HIMA 2K5NA 3M85A 2MFIA 3CC2A 1YVCA 2CQOA 4JBKA 1H95A 3HOUH 2MQHA 4ME3A 4POGA 4DR7L 2D0OA 1X3GA 3A74A 1G291 3PUVA 1Y1VH 4DV7Q 1UE5A 5H1SE 3HOWG 2RHQB 4GOPB 1QVFA 3PSIA 2JJQA 4AQYQ 1OXSC 3FP9A 1BKBA 3W1BA 3UDGA 4B3MQ 4LF5Q 2UXDL 1JMCA 4B3SL 4JYAQ 4BBSG 4POFA 2R7DA 4BY1H 3B6YA 5HY6A 4A3EG 2PQAA 3A5UA 4DR5L 2OCEA 5GADC 4AYBE 3PIOA 2VQFQ 4JBWA 1XMQQ 4P73A 1IYJB 1LTLA 1XMQL 1KL9A 2KENA 3U4ZA 2ZJQA 1I3QH 5M5XH 2NVXH 4A93G 4R1JA 2CCZA 2AHOB 4WJ4A 3PUXA 3CW2C 4C2MH 1C9OA 3I55A 5JJLA 1MKHA 3U50C 1EFWA 1L1OB 3UDFA 3PO3G 1LUZA 1NMFA 2E8GA 1JE5A 4DR7Q 2KBNA 3DM3A 4HJ9A 3CCEA 3GO5A 3Q8DA 4FDBA 4B3TL 1Q7YC 1CUKA 2YTYA 4A3KG 2GN5A 2N49A 5DLQE 1Q86C 3M3YH 1NJIC 1FJGL 2B63G 3RLOA 2RCNA 2I0QA 1KRSA 4JI7L 1Q82C 3PV0A 3S14H 4KLKA 3HKZG 4JI0L 1Z47A 1RIPA 3GTGH 3I4NH 1K3RA 2Z6KA 3FKIG 4DV2Q 2UXCL 3CXCA 3TRZA 4DR4L 5C44G 4LFCQ 3G48A 5AJ3Q 1U0LA 2JA9A 4P71A 4DUZL 4DV3L 4JI5Q 1N33Q 3DLLA 4YCVA 2LXKA 2AMCB 5HGQA 3KFUA 4APVA 2PQAB 2YV5A 3M9BA 3AQQA 1A63A 5FJ8H 3OTOQ 4JI0Q 4GN5A 3GDEA 1AH9A 2MO1A 4R4IA 3HOXG 3G4SA 1N32Q 2UXBL 4LF9L 3F8TA 1N32L 1VCIA 1YHQA 4DR6Q 4MNOA 5M3MG 2HQLA 2D0PA 4LFBQ 1NTGA 2K4KA 4YWKA 1I5FA 3S2HH 1QUQB 4UP7A 4JI4Q 2NVYH 1CSQA 1ASYA 5C4XG 3CC7A 5IT9c 2OQKA 3HFZB 3AYHB 2PNHA 3U58A 1IBML 3L0OA 4GS3A 3UE1A 5FLMG 4A3FH 1YNXA 3KLWA 2K50A 5LMNW 2R93H 2Y0SE 1PH7A 2HHHQ 2IX0A 1N33L 1WCMG 4JI8Q 2NVTH 2KCTA 4MTNA 2HIXA 3CP0A 4IPHA 1E1TA 3TEHB 5IP7G 4A3EH 3HOVG 1XPOA 4OONA 3HOYG 4QL5A 4L5QA 1OTCA 2K14A 2E2HH 4LFAL 4DV3Q 2JA6H 1KQSA 3CD6A 1HNXQ 4P75A 4DR2L 3HOZG 4Y52H 4GN3B 1CKNA 3OTOL 1QZHA 1K9MC 2VZAA 1KC8C 1IBKL 3J80c 1NY4A 5IYBG 4R4CA 5M3MH 2C35B 1I94L 2Z0SA 1JJGA 1PFSA 3AEVA 3GTOH 4IJLA 2R7ZG 3STBD 3S1NH 5GAGC 5IP9G 2OTJA 2VS1A 3CCLA 2EQSA 2MO0A 4JI6L 3J81j 1NMGA 1CKOA 1N8RC 3GTMH 1AE3A 1TWHH 1G51A 2ZM6Q 3S15H 4A3CH 4X65L 1MJEA 4A3KH 3LGJA 4X65Q 2RF4A 4JOIA 4JV5Q 1X65A 3CPFA 4LF7L 4NXMQ 4LUOA 1TWCH 1WCMH 4JI6Q 3T1HL 2XTIA 2OWOA 1KHIA 2UUAL 4YY3Q 1J5EL 1LM0A 1QZGA 1PH6A 1IBLQ 5IP7H 3S1MH 2YTVA 4JI1L 3RLFA 1SLJA 2BA1A 5IE8A 1VQBA 4GOPA 1KD1C 4BBSH 4GNXC 1KIXA 3E0EA 4OWTB 4O0AA 4IFDI 5ELNA 1EQRA 2YTXA 1SE8A 3L2PA 4DV6L 2I5LX 2R92H 4BY7H 3WWVA 4O2DA 3TS0A 2IT1A 1SROA 4IOAA 4UP8A 1X55A 3HOZH 2VQEL 4JBJA 1UWVA 4B3RQ 2FXQA 5IWAL 3KYHC 1JT8A 4JI1Q 4KHPQ 1EQQA 2L15A 1VQ9A 3U4VA 1XNQL 3BU2A 2JA5H 1SRUA 5GROA 3K8AA 1M1KC 2NN6I 4HJ7A 4K0KQ 1VS0A 2V1CC 4A3IG 2JK8A 1SFOH 3CCQA 3ULJA 3SGIA 1X56A 4LF5L 2VNUD 2B3GA 5FLMH 4R4TA 4AQYL 5IYCH 1GM5A 2UXDQ 3ER0A 1VQEA 4NPSA 3UDXA 1VQ6A 2K5HA 4LFCL 2K75A 4LFAQ 3CCJA 4A76A 4DV5L 4DPGA 4L5SA 4NXNQ 4MZ9A 3MEFA 1P8LA 4YHHL 4LUVA 4L5TA 3CAMA 1S3OA 4C3IH 3S16H 2R92G 4BY7G 4DK3C 1Y1VG 3FHWA 1DGSA 2B29A 1QVCA 1S72A 2IX1A 2WB1E 4NB3A 1YJ9A 2JA6G 4A3LH 4DR3Q 3D0FA 1PH4A 2UU9L 4IFDJ 1P16A 3GD7A 5IYDG 1XMOQ 4DK6C 4HIDA 4GKKQ 3AFQA 4GNXA 5IYBH 4XTCS 1GKHA 4UPAA 3S24A 4AIMA 3CMAA 2WAQE 1VQLA 1EWIA 2PI2A 1PH5A 3FKIH 2BH2A 4KHZA 2JA7G 2E5LL 1PH8A 4IFDG 3S2DH 1TWFH 3S1RH 2E5LQ 3STBC 3NENA 3H3VI 4K0KL 4DUYQ 1A8VA 1J6QA 3RR5A 2ZTEA 1MJCA 4DR6L 4Y7NH 4JI3Q 2ZJPA 3RZDH 3F1ZA 1N34Q 1HR0W 4JG2A 4LF8L 2A8VA 4A3JG 2VY3A 1QUQA 3BZCA 4IPGA 4R4OA 1VQOA 4LF8Q 1K73C 4EQ5A 4LNQA 4JBMA 1W3SA 4PZ8A 3H15A 4C3JH 1CSPA 3CPWA 4IOCA 4GN4B 2UUCL 4IJHA 4H02A 4P74A 4A4IA 1L2FA 2RHSB 2N78A 4YCWA 2OTLA 3PO3H 2UXCQ 4OX9Q 4YHHQ 1WYDA 1X3FA 3GTJH 5JEAG 3S1QH 4QIWE 4AH6A 3I4MH 1V1QA 3J7ZC 4QY7A 4B3ML 3GTQH 3PGZA 5C0XG 2A19A 2ATWA 4BBRG 2JA8G 2ASBA 4PZ6A 4DR3L 3PUZA 4DAMA 2F4VQ 5FLXc 1YITA 1HZBA 4IO9A 2ID0A 1EUJA 1I50H 3I2ZA 5C0XJ 2QGQA 2WB1G 3CQZH 1WOCA 2D62A 4OX9L 3CCMA 2DUDA 4GKKL 1VQAA 1EYGA 1VQDA 3OW2A 1FVIA 3HOVH 3RZOH 4JC0A 2GVBA 1PV4A 2JQOA 5GAHC 4JI4L 3E9IA 1VQPA 5LMNQ 4LUZA 1FL0A 4HJAA 1XPRA 1VQ8A 3W5OA 2F4VL 4DV5Q 4KI0A 4LW1A 5LMUL 4B3TQ 3PO2H 2ZJRA 1OXUA 1WFQA 3BZKA 1N36L 4OWXB 4A3JH 4B3SQ 1NBWA 2XGTA 1C7YA 3KF6B 3T1YQ 1B70B 2PI2E 3TREA 4UP9A 5GQOA 3J81i 4DR1L 3T1YL 3G71A 4DV1Q 1IL2A 1V9PA 2UUCQ 1YJNA 2VQFL 5BR8Q 3CCUA 3CF5A 4DR5Q 3J80i 2VUMH 1VQ7A 2JEAI 1XMOL 3J7A5 2IY5B 2Y0SG 1MIUA 2EIFA 2WFWA 2JEBI 4X66L 5C4XH 5IY0A 3KOJA 3T1HQ 4RG1A 1PHJA 1A62A 1A0IA 1HH2P 1OXVA 5LMNL 3GTKH 1T9HA 4DV0Q 4A3LG 1UE1A 4BA1I 2NZHA 2KHIA 3RLNA 2QEXA 4QJFA 4BY1G 3A0JA 3RNUA 3H0GG 4AYBG 1PH2A 2N8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PA6 A;  2JA8 H;  2ES2 A;  3ULP A;  3K0X A;  3MXN B;  1IXR A;  3A5Z B;  1CKN B;  3K7A H;  1LYL A;  4A3D G;  5LMU Q;  4DV7 L;  3PO2 G;  4DV2 L;  2K5V A;  1K8G A;  4R4Q A;  1IBM Q;  1HZA A;  4JOI C;  1PH1 A;  4A93 H;  3UE0 A;  2A1A A;  1WJJ A;  4LF7 Q;  1X54 A;  2WP8 J;  4OXP A;  4A3B G;  3K7U C;  1N36 Q;  4GKJ Q;  4GKJ L;  4YCU A;  2NVQ H;  2CWP A;  1JJC B;  4JI3 L;  1I6H H;  4XIG S;  2ZM6 L;  4JYA L;  1VQM A;  1XNR L;  1W2B A;  4JI2 Q;  5JJI A;  1Q1E A;  5EAY A;  2HIV A;  2IHE A;  2BA0 A;  1S40 A;  1K0R A;  3HOU G;  3KDF A;  3KF6 A;  5AJ3 L;  4DUZ Q;  5M3F H;  1VQN A;  4DR4 Q;  4GLX A;  4DV4 Q;  4A3C G;  1UE7 A;  1SR3 A;  5C3E H;  3PF4 A;  3HOW H;  2E2I H;  3M4P A;  2N3S A;  5M5W H;  5E7N A;  2VW9 A;  1VQF A;  1HNW Q;  1XJV A;  3W1G A;  4LFB L;  1VQG A;  1HNZ Q;  2LSS A;  1C0A A;  4L5R C;  1VQH A;  5GAE C;  1IZ6 A;  3M7N A;  1SN8 A;  1VQJ A;  3NEL A;  1N9W A;  4TQU S;  4C3H H;  1VQ5 A;  1Q8K A;  4HJ5 A;  1O7I A;  1GO3 E;  2PMZ E;  4HIO A;  4DR2 Q;  4JI7 Q;  1YEZ A;  3NBH B;  4LWC A;  1PYS B;  4A3D H;  3JAM c;  1G6P A;  1VQ4 A;  1E24 A;  2MNA A;  4DV1 L;  1Q12 A;  4UY8 C;  4BXX G;  2I5H A;  3I4O A;  1TWA H;  3VDY A;  4A75 A;  1QVG A;  2YU9 H;  2ZTD A;  1XTD A;  4A3B H;  4OO1 I;  1FGU A;  2WAQ G;  4RMF A;  3CCV A;  1PH3 A;  3TQY A;  4BA2 I;  4X64 L;  2JE6 I;  4DNI A;  3F2C A;  1Y14 B;  1YI2 A;  4JI8 L;  4DKA C;  2JA7 H;  1IBL L;  1UE6 A;  1PYB A;  3M4Q A;  2Q2I A;  3ULL A;  1VQK A;  4OO1 G;  1YZ6 A;  4YWM A;  5ELO A;  3F2D A;  2VUM G;  5M3F G;  3KF8 B;  1U5K A;  4PG3 A;  4NXM L;  3GTL H;  1OXT A;  4X66 Q;  4GOP C;  4A3I H;  1YBY A;  3KJP A;  1HJP A;  4A3F G;  1L1O A;  3JC6 6;  1X9N A;  2R93 G;  4QGU A;  4YY3 L;  1HZ9 A;  1Y1W H;  4B3R L;  1B8A A;  1V43 A;  2CKZ B;  4DV0 L;  2EXD A;  3NEM A;  1HNW L;  2B63 H;  4IPD A;  4GLA C;  3GTP H;  1Z9F A;  1BBU A;  3M4O H;  1Q1B A;  1JB7 A;  1EIF A;  4DV6 Q;  4PMW A;  5JEA J;  2UUB Q;  2Z6K C;  3PUY A;  1HR0 Q;  3CCR A;  3CCS A;  1HR0 L;  2YYZ A;  1SMX A;  3JAM i;  2VQE Q;  4P72 A;  4DUY L;  3PIP A;  2Q2U A;  1J5E Q;  1UEB A;  1PH9 A;  4EX5 A;  2HT1 A;  1D7Q A;  1KXL A;  1D8L A;  4GNX B;  4HJ8 A;  4JI2 L;  4LF6 Q;  1YHB A;  1E3P A;  5FJ8 G;  2H5X A;  5JJK A;  4JV5 L;  1M90 C;  2UUB L;  3ERS X;  4OWW B;  5IYD H;  3L7Z C;  2NN6 G;  3F2B A;  3RN5 A;  2R7Z H;  2CWA A;  2F52 A;  1XNR Q;  4ALP A;  3EN2 A;  2NZO A;  1CKM A;  2ALY B;  4LF6 L;  3D31 A;  4LF9 Q;  4IPC A;  2IHF A;  3I7F A;  4DAY B;  1E22 A;  4DR1 Q;  1K83 H;  3K81 C;  1EOV A;  1GD7 A;  3PUW A;  4X62 Q;  5C3E G;  1Q81 C;  1RL2 A;  3OYY A;  2GVA A;  5IWA Q;  3PCO B;  5BR8 L;  1Q46 A;  3KDF B;  2K52 A;  1HNX L;  4A3G G;  1WI5 A;  3HKS A;  4LF4 L;  1JJ2 A;  4A3M G;  1E1O A;  5C0X I;  1IBK Q;  1TWG H;  1B7Y B;  1XPU A;  1XNQ Q;  2DGY A;  3AFP A;  1E7Z A;  2ZTC A;  4HIK A;  3H3V H;  1X6O A;  2OQ0 A;  1KRT A;  3PF5 A;  1R9T H;  1ASZ A;  5C4J H;  2UXB Q;  3HOY H;  5J3B A;  3K80 C;  4PZ7 A;  4J15 A;  4YWL A;  1N34 L;  1HNZ L;  2F3I A;  2UU9 Q;  3I4M G;  1YIJ A;  3KJO A;  1K8A C;  3BJU A;  2VL6 A;  4JCV E;  4BXX H;  1PVO A;  3G6E A;  4BBR H;  3IRB A;  3E9H A;  2AWO A;  4TVA B;  1HZC A;  1YJW A;  3H0G H;  4DV4 L;  1L0W A;  4X64 Q;  3I4N G;  3I56 A;  2AKW B;  1AE2 A;  1YHA A;  5M5Y H;  3TS2 A;  1VQI A;  4NXN L;  2JA5 G;  2AWN A;  3EIV A;  2UUA Q;  3CC4 A;  2HHH L;  5IP9 H;  3CME A;  2QA4 A;  5K36 G;  1VQC A;  5C44 H;  3RN2 A;  4JI5 L;  1BBW A;  4QQB X;  1FJG Q;  2R7F A;  3EBE A;  3ICE A;  1NE3 A;  3ZJY C;  1I94 Q;  1EIY B;  3UDI A;  2LXJ A;  2R6G A;  1GVP A;  1L1O C;  4X62 L;  2KHJ A;  2Q2T A;  4WJ3 M;  1X3E A;  1TXY A;  5IYC G;  1KAW A;  3S17 H;  3J81 c;  4GLV B;  3HOX H;  1Y1W G;  4A3G H;  2E2J H;  2KCM A;  3HKZ E;  4KHP L;  1OXX K;  2Q2H A;  4A3M H;  1BVS A;  2CFM A;  4X6A H;  2I5M X;  2BH8 A;  4LF4 Q;  4HIM A;  2K5N A;  3M85 A;  2MFI A;  3CC2 A;  1YVC A;  2CQO A;  4JBK A;  1H95 A;  3HOU H;  2MQH A;  4ME3 A;  4POG A;  4DR7 L;  2D0O A;  1X3G A;  3A74 A;  1G29 1;  3PUV A;  1Y1V H;  4DV7 Q;  1UE5 A;  5H1S E;  3HOW G;  2RHQ B;  4GOP B;  1QVF A;  3PSI A;  2JJQ A;  4AQY Q;  1OXS C;  3FP9 A;  1BKB A;  3W1B A;  3UDG A;  4B3M Q;  4LF5 Q;  2UXD L;  1JMC A;  4B3S L;  4JYA Q;  4BBS G;  4POF A;  2R7D A;  4BY1 H;  3B6Y A;  5HY6 A;  4A3E G;  2PQA A;  3A5U A;  4DR5 L;  2OCE A;  5GAD C;  4AYB E;  3PIO A;  2VQF Q;  4JBW A;  1XMQ Q;  4P73 A;  1IYJ B;  1LTL A;  1XMQ L;  1KL9 A;  2KEN A;  3U4Z A;  2ZJQ A;  1I3Q H;  5M5X H;  2NVX H;  4A93 G;  4R1J A;  2CCZ A;  2AHO B;  4WJ4 A;  3PUX A;  3CW2 C;  4C2M H;  1C9O A;  3I55 A;  5JJL A;  1MKH A;  3U50 C;  1EFW A;  1L1O B;  3UDF A;  3PO3 G;  1LUZ A;  1NMF A;  2E8G A;  1JE5 A;  4DR7 Q;  2KBN A;  3DM3 A;  4HJ9 A;  3CCE A;  3GO5 A;  3Q8D A;  4FDB A;  4B3T L;  1Q7Y C;  1CUK A;  2YTY A;  4A3K G;  2GN5 A;  2N49 A;  5DLQ E;  1Q86 C;  3M3Y H;  1NJI C;  1FJG L;  2B63 G;  3RLO A;  2RCN A;  2I0Q A;  1KRS A;  4JI7 L;  1Q82 C;  3PV0 A;  3S14 H;  4KLK A;  3HKZ G;  4JI0 L;  1Z47 A;  1RIP A;  3GTG H;  3I4N H;  1K3R A;  2Z6K A;  3FKI G;  4DV2 Q;  2UXC L;  3CXC A;  3TRZ A;  4DR4 L;  5C44 G;  4LFC Q;  3G48 A;  5AJ3 Q;  1U0L A;  2JA9 A;  4P71 A;  4DUZ L;  4DV3 L;  4JI5 Q;  1N33 Q;  3DLL A;  4YCV A;  2LXK A;  2AMC B;  5HGQ A;  3KFU A;  4APV A;  2PQA B;  2YV5 A;  3M9B A;  3AQQ A;  1A63 A;  5FJ8 H;  3OTO Q;  4JI0 Q;  4GN5 A;  3GDE A;  1AH9 A;  2MO1 A;  4R4I A;  3HOX G;  3G4S A;  1N32 Q;  2UXB L;  4LF9 L;  3F8T A;  1N32 L;  1VCI A;  1YHQ A;  4DR6 Q;  4MNO A;  5M3M G;  2HQL A;  2D0P A;  4LFB Q;  1NTG A;  2K4K A;  4YWK A;  1I5F A;  3S2H H;  1QUQ B;  4UP7 A;  4JI4 Q;  2NVY H;  1CSQ A;  1ASY A;  5C4X G;  3CC7 A;  5IT9 c;  2OQK A;  3HFZ B;  3AYH B;  2PNH A;  3U58 A;  1IBM L;  3L0O A;  4GS3 A;  3UE1 A;  5FLM G;  4A3F H;  1YNX A;  3KLW A;  2K50 A;  5LMN W;  2R93 H;  2Y0S E;  1PH7 A;  2HHH Q;  2IX0 A;  1N33 L;  1WCM G;  4JI8 Q;  2NVT H;  2KCT A;  4MTN A;  2HIX A;  3CP0 A;  4IPH A;  1E1T A;  3TEH B;  5IP7 G;  4A3E H;  3HOV G;  1XPO A;  4OON A;  3HOY G;  4QL5 A;  4L5Q A;  1OTC A;  2K14 A;  2E2H H;  4LFA L;  4DV3 Q;  2JA6 H;  1KQS A;  3CD6 A;  1HNX Q;  4P75 A;  4DR2 L;  3HOZ G;  4Y52 H;  4GN3 B;  1CKN A;  3OTO L;  1QZH A;  1K9M C;  2VZA A;  1KC8 C;  1IBK L;  3J80 c;  1NY4 A;  5IYB G;  4R4C A;  5M3M H;  2C35 B;  1I94 L;  2Z0S A;  1JJG A;  1PFS A;  3AEV A;  3GTO H;  4IJL A;  2R7Z G;  3STB D;  3S1N H;  5GAG C;  5IP9 G;  2OTJ A;  2VS1 A;  3CCL A;  2EQS A;  2MO0 A;  4JI6 L;  3J81 j;  1NMG A;  1CKO A;  1N8R C;  3GTM H;  1AE3 A;  1TWH H;  1G51 A;  2ZM6 Q;  3S15 H;  4A3C H;  4X65 L;  1MJE A;  4A3K H;  3LGJ A;  4X65 Q;  2RF4 A;  4JOI A;  4JV5 Q;  1X65 A;  3CPF A;  4LF7 L;  4NXM Q;  4LUO A;  1TWC H;  1WCM H;  4JI6 Q;  3T1H L;  2XTI A;  2OWO A;  1KHI A;  2UUA L;  4YY3 Q;  1J5E L;  1LM0 A;  1QZG A;  1PH6 A;  1IBL Q;  5IP7 H;  3S1M H;  2YTV A;  4JI1 L;  3RLF A;  1SLJ A;  2BA1 A;  5IE8 A;  1VQB A;  4GOP A;  1KD1 C;  4BBS H;  4GNX C;  1KIX A;  3E0E A;  4OWT B;  4O0A A;  4IFD I;  5ELN A;  1EQR A;  2YTX A;  1SE8 A;  3L2P A;  4DV6 L;  2I5L X;  2R92 H;  4BY7 H;  3WWV A;  4O2D A;  3TS0 A;  2IT1 A;  1SRO A;  4IOA A;  4UP8 A;  1X55 A;  3HOZ H;  2VQE L;  4JBJ A;  1UWV A;  4B3R Q;  2FXQ A;  5IWA L;  3KYH C;  1JT8 A;  4JI1 Q;  4KHP Q;  1EQQ A;  2L15 A;  1VQ9 A;  3U4V A;  1XNQ L;  3BU2 A;  2JA5 H;  1SRU A;  5GRO A;  3K8A A;  1M1K C;  2NN6 I;  4HJ7 A;  4K0K Q;  1VS0 A;  2V1C C;  4A3I G;  2JK8 A;  1SFO H;  3CCQ A;  3ULJ A;  3SGI A;  1X56 A;  4LF5 L;  2VNU D;  2B3G A;  5FLM H;  4R4T A;  4AQY L;  5IYC H;  1GM5 A;  2UXD Q;  3ER0 A;  1VQE A;  4NPS A;  3UDX A;  1VQ6 A;  2K5H A;  4LFC L;  2K75 A;  4LFA Q;  3CCJ A;  4A76 A;  4DV5 L;  4DPG A;  4L5S A;  4NXN Q;  4MZ9 A;  3MEF A;  1P8L A;  4YHH L;  4LUV A;  4L5T A;  3CAM A;  1S3O A;  4C3I H;  3S16 H;  2R92 G;  4BY7 G;  4DK3 C;  1Y1V G;  3FHW A;  1DGS A;  2B29 A;  1QVC A;  1S72 A;  2IX1 A;  2WB1 E;  4NB3 A;  1YJ9 A;  2JA6 G;  4A3L H;  4DR3 Q;  3D0F A;  1PH4 A;  2UU9 L;  4IFD J;  1P16 A;  3GD7 A;  5IYD G;  1XMO Q;  4DK6 C;  4HID A;  4GKK Q;  3AFQ A;  4GNX A;  5IYB H;  4XTC S;  1GKH A;  4UPA A;  3S24 A;  4AIM A;  3CMA A;  2WAQ E;  1VQL A;  1EWI A;  2PI2 A;  1PH5 A;  3FKI H;  2BH2 A;  4KHZ A;  2JA7 G;  2E5L L;  1PH8 A;  4IFD G;  3S2D H;  1TWF H;  3S1R H;  2E5L Q;  3STB C;  3NEN A;  3H3V I;  4K0K L;  4DUY Q;  1A8V A;  1J6Q A;  3RR5 A;  2ZTE A;  1MJC A;  4DR6 L;  4Y7N H;  4JI3 Q;  2ZJP A;  3RZD H;  3F1Z A;  1N34 Q;  1HR0 W;  4JG2 A;  4LF8 L;  2A8V A;  4A3J G;  2VY3 A;  1QUQ A;  3BZC A;  4IPG A;  4R4O A;  1VQO A;  4LF8 Q;  1K73 C;  4EQ5 A;  4LNQ A;  4JBM A;  1W3S A;  4PZ8 A;  3H15 A;  4C3J H;  1CSP A;  3CPW A;  4IOC A;  4GN4 B;  2UUC L;  4IJH A;  4H02 A;  4P74 A;  4A4I A;  1L2F A;  2RHS B;  2N78 A;  4YCW A;  2OTL A;  3PO3 H;  2UXC Q;  4OX9 Q;  4YHH Q;  1WYD A;  1X3F A;  3GTJ H;  5JEA G;  3S1Q H;  4QIW E;  4AH6 A;  3I4M H;  1V1Q A;  3J7Z C;  4QY7 A;  4B3M L;  3GTQ H;  3PGZ A;  5C0X G;  2A19 A;  2ATW A;  4BBR G;  2JA8 G;  2ASB A;  4PZ6 A;  4DR3 L;  3PUZ A;  4DAM A;  2F4V Q;  5FLX c;  1YIT A;  1HZB A;  4IO9 A;  2ID0 A;  1EUJ A;  1I50 H;  3I2Z A;  5C0X J;  2QGQ A;  2WB1 G;  3CQZ H;  1WOC A;  2D62 A;  4OX9 L;  3CCM A;  2DUD A;  4GKK L;  1VQA A;  1EYG A;  1VQD A;  3OW2 A;  1FVI A;  3HOV H;  3RZO H;  4JC0 A;  2GVB A;  1PV4 A;  2JQO A;  5GAH C;  4JI4 L;  3E9I A;  1VQP A;  5LMN Q;  4LUZ A;  1FL0 A;  4HJA A;  1XPR A;  1VQ8 A;  3W5O A;  2F4V L;  4DV5 Q;  4KI0 A;  4LW1 A;  5LMU L;  4B3T Q;  3PO2 H;  2ZJR A;  1OXU A;  1WFQ A;  3BZK A;  1N36 L;  4OWX B;  4A3J H;  4B3S Q;  1NBW A;  2XGT A;  1C7Y A;  3KF6 B;  3T1Y Q;  1B70 B;  2PI2 E;  3TRE A;  4UP9 A;  5GQO A;  3J81 i;  4DR1 L;  3T1Y L;  3G71 A;  4DV1 Q;  1IL2 A;  1V9P A;  2UUC Q;  1YJN A;  2VQF L;  5BR8 Q;  3CCU A;  3CF5 A;  4DR5 Q;  3J80 i;  2VUM H;  1VQ7 A;  2JEA I;  1XMO L;  3J7A 5;  2IY5 B;  2Y0S G;  1MIU A;  2EIF A;  2WFW A;  2JEB I;  4X66 L;  5C4X H;  5IY0 A;  3KOJ A;  3T1H Q;  4RG1 A;  1PHJ A;  1A62 A;  1A0I A;  1HH2 P;  1OXV A;  5LMN L;  3GTK H;  1T9H A;  4DV0 Q;  4A3L G;  1UE1 A;  4BA1 I;  2NZH A;  2KHI A;  3RLN A;  2QEX A;  4QJF A;  4BY1 G;  3A0J A;  3RNU A;  3H0G G;  4AYB G;  1PH2 A;  2N8N A; 
#chains in the Genus database with same CATH topology
 1BQQ T;  1STY A;  4UCS A;  2HVR A;  1SNO A;  3MHB A;  1A3T A;  3A5Z B;  2FPP B;  4DV7 L;  3PIP 3;  4DV2 L;  1K8G A;  4R4Q A;  1PH1 A;  2DJG C;  3TZU A;  2WP8 J;  4JW0 A;  3K7U C;  3D4D A;  1V1P A;  2R87 A;  4YCU A;  2CH4 W;  5M3F B;  2CVR A;  4JYA L;  1XNR L;  4PMC A;  2HIV A;  1IKL A;  3P20 A;  5KNB A;  3ND9 A;  2ZT9 C;  3HOU G;  3KHL A;  2B39 A;  2R61 A;  4DN4 M;  1WTV A;  1VQN A;  3OSO A;  2EY2 A;  2UVV A;  1OO9 B;  5KYL A;  2XNA C;  1SR3 A;  1HUM A;  4RAU C;  4Q8F A;  3RB6 A;  2N3S A;  1H9K A;  5F9L A;  3MR6 A;  2VW9 A;  1XJV A;  3K5I A;  3PZP A;  5I9P A;  3RB3 A;  4O3S A;  5DM6 3;  1GXD C;  1C0A A;  3SVM A;  1QE6 A;  1QIL A;  4UCU A;  4TQU S;  1SNP A;  3L3O C;  5IT9 E;  1GO3 E;  2PMZ E;  3KLS A;  3HOU B;  3V6H A;  4C3I G;  5A2Q L;  1CTM A;  4ZYS A;  1VQ4 A;  2XWB B;  1F9R A;  4LFC H;  1Q12 A;  3KBG A;  2AGP A;  1UC9 A;  2I5H A;  4F7X A;  4A75 A;  2OH2 A;  2OT2 A;  4OO1 I;  4RMF A;  3OTO H;  4X64 L;  2FK2 A;  1IW7 C;  2JA7 H;  3OSP A;  5BPF A;  1PYB A;  4QW9 A;  2Q2I A;  3ND8 A;  4A3D B;  4OO1 G;  4MIU A;  1YZ6 A;  2VUM G;  4V0B A;  1U5K A;  4PG3 A;  4LSX A;  2W71 A;  3QZ7 A;  1WTQ A;  1HJP A;  1U4P A;  2E2D C;  1Y8P B;  4YY3 L;  1HZ9 A;  5AFW A;  1Y1W H;  1B8A A;  1V43 A;  2CKZ B;  1QCB D;  2EXD A;  4DV0 L;  3PO2 B;  4F50 A;  3NEM A;  3FMC A;  4GLA C;  3GTP H;  1BBU A;  4ZUI A;  1HNZ H;  1EIF A;  4H44 C;  1KNA A;  4DV6 Q;  4PMW A;  5JEA J;  3A54 A;  3PUY A;  3J7A K;  3CCR A;  2WIN B;  3CCS A;  2YYZ A;  1KAA A;  4NW2 A;  1PH9 A;  3BA8 A;  1STN A;  4KN4 C;  1WCM B;  2HDL A;  2HT1 A;  4M9U A;  4R8U B;  1KXL A;  1SE3 A;  4GNX B;  2YZG A;  4LF6 Q;  1I6V C;  5JJK A;  1A3V A;  5JVG 3;  3ERS X;  5IYD H;  1KLU D;  4ECW A;  1CE8 A;  1M4V A;  4OEM B;  5DGA A;  3T5K A;  1PX2 A;  4I55 F;  4MHE A;  1XMQ H;  3BG5 A;  1CKM A;  1HTL D;  4DF7 A;  2ALY B;  4LF6 L;  2IHF A;  5KFK A;  4EQN A;  3R5H A;  2AU0 A;  4X66 H;  1DV1 A;  3DXJ C;  2W9C A;  4IQZ A;  4N8X 1;  5IWA Q;  4CJ2 C;  2R8I A;  4A3G G;  2K52 A;  1PDQ A;  1HNX L;  1E4E A;  3HKS A;  4LF4 L;  1JJ2 A;  1AUX A;  2W6Z A;  5I2Y A;  3BVM A;  1T36 A;  2ZDH A;  4DV6 H;  1KNE A;  1XPU A;  1HHV A;  1XNQ Q;  2KEC A;  2DGY A;  5KFB A;  1KRT A;  1KDB A;  3M4Y A;  1S5B D;  4AYB B;  5C4J H;  1ASZ A;  4E4T A;  2JP1 A;  3HOY H;  3K80 C;  4J15 A;  4JCV E;  4PMB A;  4G57 A;  2VPQ A;  4RU9 A;  2ASJ A;  4IRD A;  4WD3 A;  2AQ4 A;  5FOB B;  3S16 B;  1HZC A;  1FNU A;  1CI3 M;  3GP7 A;  4YBZ B;  1GUT A;  3I56 A;  1B1Z A;  3D4R A;  1L2Z A;  4K6D A;  1VQI A;  4NXN L;  1C4Q A;  2TMP A;  5C44 H;  4JI2 H;  1G6Z A;  1BBW A;  1FJG Q;  2R7F A;  4H7B A;  3VR6 A;  3EBE A;  2BR0 A;  1AN7 A;  4HSV A;  3ZJY C;  1I94 Q;  5C3W A;  2NU8 B;  4WJ3 M;  2Q2T A;  3OHB A;  5IYC G;  1BCP B;  1Y8N B;  2F0L A;  5FK9 C;  4GLV B;  4ZKC B;  2HCI A;  4OGQ C;  5JVH 3;  4GC7 A;  2P5Z X;  2MCT A;  2UXD H;  3SK8 A;  2UUC H;  1WR2 A;  1BVS A;  1DV2 A;  3QOL A;  2K5N A;  3M85 A;  2MFI A;  2CQO A;  1GGO A;  1F2L A;  2MQH A;  3HOU H;  4ME3 A;  3PUV A;  1G2T A;  2GPS A;  1G29 1;  1Y1V H;  2PZT A;  4DV7 Q;  4DR3 H;  4MV8 A;  4QUC A;  1I4H A;  1SEB D;  3FP9 A;  4B3M Q;  5TSS A;  3K6O A;  4RHS A;  3PR4 A;  3EFX D;  4JK1 C;  1TA8 A;  4A2B A;  1G2S A;  3OHX C;  2PQA A;  4F4Z A;  2IJ0 A;  3S1M B;  4J9L A;  2XSC A;  4AYB E;  1VKZ A;  1XMQ Q;  4P73 A;  4U6P A;  1LTL A;  1XMQ L;  1K28 A;  3W2D A;  2KEN A;  1ONL A;  5KFO A;  2SEB D;  3U4Z A;  1BF4 A;  3EPI A;  1I3Q H;  1JQY D;  2R8H A;  4ECX A;  1QG7 A;  4A93 G;  1SYX B;  4YB8 B;  4Q8E A;  5EJW A;  2FLP A;  2AHO B;  3PUX A;  2PYK A;  4F4W A;  3I55 A;  3WDN A;  4I7H A;  2GPW A;  4CC6 A;  2W9C B;  1S03 G;  3RB0 A;  1VDZ A;  3UDF A;  3OMG A;  4XYL B;  5JEA H;  3K0Y A;  3J80 E;  4ZI7 F;  3PW2 A;  1WD1 A;  3Q8D A;  4OX9 H;  2XIW A;  2IPK D;  3GIP A;  1E0B A;  3H3V C;  2L1B A;  3RV4 A;  2C9O A;  2EPB A;  1NJI C;  2R86 A;  2WAC A;  2F3V A;  1KRS A;  4KLK A;  3HKZ G;  1Z47 A;  5C4X B;  3HG9 A;  1RF2 D;  5KFV A;  4DR4 L;  2VQE H;  1EYZ A;  2JA9 A;  2BQ3 A;  3KFU A;  2AUK A;  2JYO A;  1A63 A;  3OTO Q;  5KNC A;  3K3V A;  4GN5 A;  1L0Y B;  5L37 A;  5G3L D;  4R4I A;  3G4S A;  2UXB L;  3F8T A;  3HOZ B;  4MNO A;  4DAY A;  1QB5 D;  4DV1 H;  1EEI D;  4YWK A;  3KAL A;  1DJR D;  4DUZ H;  3S2H H;  4JI4 Q;  4DR4 H;  3CHB D;  2WTF A;  4ECU A;  4BBS B;  4KHV A;  5C4H A;  3AYH B;  3U58 A;  5DG7 A;  2PW7 A;  3UE1 A;  4A3F H;  5FLM G;  1J5E H;  1YNX A;  2R93 H;  1I50 B;  2Y0S E;  2KVM A;  1TWC B;  4XXE A;  4QB4 A;  1MD2 D;  1LLR D;  3HZX A;  1I4R A;  2F0F A;  4NXN H;  4LMY A;  3CQZ A;  4YY3 H;  1H9R A;  5C5J A;  4YR0 A;  3KTM A;  1IBK H;  1S0N A;  3S15 B;  4FF2 A;  4MTN A;  2HIX A;  2L9H A;  1YNN D;  1CZW A;  3GTJ B;  1XPO A;  5FD6 A;  1SAP A;  3HOY G;  3FMA A;  1GSO A;  2Z4H A;  1S68 A;  5M3M B;  3CD6 A;  4P75 A;  2FLN A;  4Y52 H;  4GN3 B;  4U67 3;  1V51 A;  1CKN A;  3OTO L;  1QZH A;  3R23 A;  3GTO A;  4X3S A;  1DON A;  4HMI A;  1ZYR D;  5M3M H;  4TQR A;  1I94 L;  3J81 E;  1JJG A;  4XQQ A;  3S1N H;  3GTG A;  4IJL A;  2SNM A;  4L1K A;  1SYE A;  1NMG A;  2LS0 1;  3S1R B;  1UUP A;  5J1Z A;  4QWC A;  1O7Z A;  1LV9 A;  1TWH H;  3URY A;  5D1O B;  4B9W A;  2YRW A;  1MJE A;  1O7L A;  4A3K H;  2WB1 B;  2G9H D;  4JOI A;  4CKC A;  5KFC A;  4LF7 L;  4DXF A;  3E5S A;  1ZEQ X;  1TWC H;  1WCM H;  2EJG C;  4R8N A;  4YY3 Q;  1QZG A;  1TII D;  2X0S A;  4LH6 A;  4CDD C;  4MV7 A;  2D2C C;  2F0N A;  4JI1 L;  1SLJ A;  4BBS H;  4IFD I;  3BJY A;  2HD3 A;  1KD1 C;  2PN1 A;  4PNY A;  1JWS D;  3E0E A;  2HJW A;  1I4G A;  2YTX A;  1SE8 A;  5CMD A;  2HQE A;  2D9U A;  3A7A B;  5D14 A;  3L2P A;  4DV6 L;  5CV6 A;  1SRO A;  3HOZ H;  5IGD A;  5IGB A;  1UWV A;  4AQY H;  2JEI A;  1MSG A;  2A6H D;  4Z9C B;  1VQ9 A;  1EY5 A;  3U4V A;  2K1B A;  2SOB A;  5KT7 A;  3NWT A;  2JA5 H;  1SRU A;  2LFN A;  1W6J A;  1ZHQ A;  2PBZ A;  1V1P B;  2DNC A;  4IUU A;  5IOD A;  4QIW B;  2V1C C;  4B08 A;  2IA6 A;  1X56 A;  2VNU D;  2B3G A;  2J6U A;  1GM5 A;  3ER0 A;  2PPB C;  3DEO A;  1I4X A;  4A76 A;  3A55 A;  3PIO 3;  2FP4 B;  4BY7 B;  1T5X D;  1JIH A;  5KFG A;  5DQI A;  2F03 A;  3ITP A;  2WV6 D;  4RNO A;  1FKA H;  3CAM A;  2H4O A;  1S3O A;  3Q6S A;  1PFN A;  5D3I B;  2R92 G;  1LT4 D;  4DK3 C;  1BNC A;  4R7R A;  4CDC C;  4RNN A;  2IX1 A;  1DGS A;  1S72 A;  1QVC A;  4B9X A;  2VQD A;  3J81 W;  4BWG B;  2JA6 G;  4L6T B;  1G8Z D;  4A3L H;  1DD2 A;  4I4T F;  2W9A A;  3ZYY X;  5IGE A;  1WH2 A;  4G7Z C;  4C5C A;  2E75 C;  5IYD G;  2B2U C;  4GKK Q;  4EYI B;  1EY6 A;  5IYB H;  3S24 A;  4M8A A;  4AIM A;  3CMA A;  2PI2 A;  2BH2 A;  4KHZ A;  4LFB H;  3OPO A;  1PH8 A;  3GTM B;  3S2D H;  2W57 A;  2NZ1 D;  3NEN A;  3STB C;  2WAQ A;  2FJ2 A;  1A8V A;  4RB1 A;  3RR5 A;  3J7Y W;  1MJC A;  5J2U F;  4DR6 L;  4Y7N H;  3IAY A;  3RZD H;  1IBM H;  3F1Z A;  1HRJ A;  3LWB A;  5LOV F;  1LTG D;  4IPG A;  1QUQ A;  1DIK A;  5KG6 A;  4EQ5 A;  1W3S A;  4PZ8 A;  5I47 A;  4TUY F;  3CPW A;  1D1K A;  4IOC A;  1EY7 A;  4A4I A;  4P74 A;  1L2F A;  3GV6 A;  2RHS B;  1ENC A;  3H4B A;  2TSS A;  4HAE A;  4MTE A;  3RIZ A;  1WYD A;  5KFZ A;  2L4N A;  1V1Q A;  4RHR A;  4RA8 A;  3PGZ A;  4E6I A;  1SNC A;  2A19 A;  2YRX A;  3DUZ A;  3PUZ A;  5C4Z A;  1PTO C;  1HZB A;  4IO9 A;  2WB1 G;  1PK8 A;  3TP5 A;  2KJX A;  4R8U A;  2DUD A;  3BG3 A;  4GKK L;  3M9M B;  5IGF A;  1MGS A;  3G6J B;  4O4H F;  4JC0 A;  3RD4 A;  5GAH C;  3GV3 A;  1FJG H;  1QWY A;  2FHT A;  4HSP A;  5EBC A;  4MV1 A;  5KFD A;  1KEE A;  3LWE A;  4FS2 A;  4G4K A;  2ZJR A;  2NVY A;  3BZK A;  1B3A A;  3UQ8 A;  2K6A A;  3LML A;  1ESF A;  1IW7 D;  1NBW A;  3U9O A;  3KF8 A;  2FB9 A;  2XGT A;  4QIW A;  1B70 B;  3TRE A;  4DR1 L;  3J81 i;  3T1Y L;  1KDA A;  3K3P A;  1AFP A;  3CVZ A;  3G71 A;  1IL2 A;  1V9P A;  2QEJ C;  3HOY B;  1A6X A;  1I3Q A;  3MXG A;  1I50 A;  4K6L A;  1XMO L;  2VPS A;  1MIU A;  2JEB I;  5IY0 A;  3H6M A;  3QZ8 A;  5IWA H;  1BCP F;  1PHJ A;  5KRU A;  3QO2 A;  1HH2 P;  2MHV A;  1PTO D;  2W8K A;  4BA1 I;  1B33 N;  3DEP A;  4ZHQ F;  1B53 A;  1TY0 A;  5CB4 F;  1ZXT A;  4QJF A;  1XTC D;  2E76 C;  4PDB A;  4BBS G;  5LP6 F;  2LMC B;  5G3L F;  2JA8 H;  2ZDQ A;  1F2Z A;  1B2T A;  1K8M A;  2FLL A;  4MV9 A;  3MXN B;  5KFH A;  1IXR A;  2DN8 A;  2K32 A;  1CKN B;  3GTL A;  4DAV A;  2V4Q A;  5LMU Q;  3MXP A;  3PO2 G;  2AUJ D;  2K5V A;  3OSN A;  4NP5 A;  1IBM Q;  4JOI C;  1E2Z A;  4A93 H;  4J9Q A;  2A1A A;  1WJJ A;  1DOL A;  4OXP A;  2WAQ B;  3TBI B;  4LF7 Q;  3GIL A;  1SNM A;  4DL3 A;  4JI1 H;  3SK5 A;  4ZCK A;  2NN6 H;  4JI3 L;  1I6H H;  4XIG S;  1D1I A;  4ZQI A;  1VQM A;  1W2B A;  2NVX A;  1EOT A;  5KG1 A;  5LL6 X;  1PRT B;  1NNX A;  2IHE A;  2C2D A;  1NUC A;  3OWE B;  3KDF A;  4DUZ Q;  4IHJ F;  3Q22 A;  3DWP A;  2NU7 B;  4DV4 Q;  2VUG A;  4X62 H;  3HKZ B;  1UE7 A;  5C3E H;  3PF4 A;  3I8Z A;  3M4P A;  1BR9 A;  2F0I A;  1WTR A;  5KT5 A;  1JX4 A;  2DPI A;  4JI6 H;  2MP1 A;  2X6G A;  1VQF A;  4JYA H;  3W1G A;  1HNZ Q;  2LSS A;  2DIK A;  2B63 A;  1VQH A;  5GAE C;  1SN8 A;  1LTS D;  3NEL A;  4C3H H;  1VQ5 A;  3TIN A;  5CA0 F;  1Q8K A;  2QDL A;  4CJ0 B;  4JI7 Q;  5LA6 F;  1XDN A;  4LWC A;  1PYS B;  4A3D H;  1G6P A;  4A2A A;  1K83 A;  2MNA A;  3T53 B;  1STA A;  1DM0 B;  3HP3 A;  4DV1 L;  5EKL A;  2RDI A;  4ECY A;  1GLV A;  2YU9 H;  1TWA H;  4KJO A;  1QVG A;  1H9S A;  4XT1 B;  2V5A A;  5DLF A;  1WVL A;  4A3B H;  2OEO A;  3HOX B;  1CQJ B;  3S17 B;  3CCV A;  1PH3 A;  3TQY A;  3DMU A;  1Y69 U;  4CJ1 B;  4DNI A;  3F2C A;  1PTO F;  4DNR B;  4DKA C;  4JUZ A;  2B8G A;  1IBL L;  3SE7 A;  1T94 A;  5EPK A;  1VQK A;  4YWM A;  5ELO A;  1LTA D;  4ECV A;  5M3F G;  3KF8 B;  4DR5 H;  3V6J A;  5C1P A;  4R9W A;  4ZRZ A;  1FNV A;  3BAA A;  3VYT A;  4EGV A;  3KJP A;  4A3F G;  1Z2P X;  1X9N A;  2R93 G;  2V9W A;  4B3R L;  1O7Y A;  1HNW L;  1HPC A;  3QJY A;  3M4O H;  5JQW A;  1Q3L A;  2UUB Q;  3N8D A;  4N9T A;  3HOV B;  4DR7 H;  3M3Y H;  1RJP A;  1SMX A;  3JAM i;  3P7J A;  4P72 A;  2R82 A;  2Q2U A;  1D7Q A;  4I50 F;  1TVX A;  3N6R A;  3MFH A;  4HJ8 A;  1S9F A;  4RCO A;  5A35 A;  4J0M A;  4KY6 A;  1V1O A;  1YHB A;  5EKK A;  2H5X A;  2PZU A;  2M2L A;  3MEH A;  1GSH A;  2UUB L;  3VPB A;  3OUU A;  4XZ3 B;  2KHS A;  1PRT D;  4MTK A;  3TP7 A;  3RN5 A;  3S9W A;  1SJH D;  5LL6 b;  2CWA A;  2F52 A;  1XNR Q;  1Y1W A;  3VR4 A;  3IN5 A;  4FP5 D;  1XWE A;  3D31 A;  3GV7 B;  3I7F A;  4RNM A;  4DR1 Q;  1E22 A;  1K83 H;  5DQG A;  3K81 C;  1GD7 A;  4LAA A;  3NUC A;  1IOW A;  3M4I A;  1RL2 A;  2V4R A;  2GVA A;  3I4L A;  1Q46 A;  3KDF B;  1II3 A;  3D3R A;  4Y7N B;  4Q44 A;  5L1J A;  4O2A F;  1TR5 A;  4UCV A;  3HKZ A;  3G6Y A;  1DXM A;  2FFK B;  2X69 A;  1IBK Q;  1TWG H;  3FKI B;  2HVS A;  2ZTC A;  4A3E B;  4J6H A;  2QKI C;  4DK0 A;  3JAM L;  2OQ0 A;  1R9T H;  4DNT B;  4PZ7 A;  1N34 L;  4RUC A;  3VYS A;  1YIJ A;  1N56 A;  2VL6 A;  4BXX H;  1JOR A;  5KFI A;  3GV8 B;  1YNJ C;  2C00 A;  4A3J B;  5KYI A;  4FYD A;  5F9N A;  3Q1K A;  4DV4 L;  2Z6B A;  1EZ8 A;  3I4N G;  3IL8 A;  3M9N B;  5KG7 A;  3SK4 A;  5C1O A;  2AKW B;  5DLG A;  2JA8 G;  2JA5 G;  3H40 A;  4XYQ A;  5IP9 H;  3N6X A;  1VQC A;  5IT9 W;  1SYD A;  4MA0 A;  3RN2 A;  3T4A C;  2E74 C;  1EIY B;  3UDI A;  1VF5 C;  3RZO B;  2LXJ A;  1L1O C;  3SXH A;  2EOT A;  4X62 L;  4EEQ A;  1JOO A;  3S17 H;  3HOX H;  2IL8 A;  1V8Q A;  1PXU A;  2RVL A;  2Q2H A;  5A2Q E;  4A3M H;  2CFM A;  3RAX A;  2R7L A;  1XXG A;  2EJM A;  4CDE C;  4HIM A;  5EWF A;  3GTQ B;  2JA5 B;  3BZD B;  4I65 A;  1YVC A;  3K57 A;  3FVQ A;  3JZI A;  4DR7 L;  2EY1 A;  3QR8 A;  3C0F B;  1X3G A;  3A74 A;  4O3N A;  3P1H A;  4ECR A;  1KAB A;  4IZO A;  2RHQ B;  3I70 A;  3FDS A;  2PO4 A;  2JJQ A;  3PSI A;  1OXS C;  4BA2 I;  3UDG A;  4LF5 Q;  4KHP H;  3KHH A;  4IWY A;  4B3S L;  4DLK A;  4F87 A;  4POF A;  4BY1 H;  2EXZ A;  1SND A;  4XT3 B;  2J6S A;  1M0W A;  4M7E A;  3BA9 A;  4DR5 L;  5ELC A;  4FXK C;  5GAD C;  4ED1 A;  2UUA H;  3PIO A;  4DV5 H;  4JBW A;  5D8D A;  3TME A;  2CHB D;  3QWN A;  2J4X A;  5KT6 A;  2XGQ A;  1H9M A;  5EZY F;  4B3T H;  2B2Y C;  1GUO A;  5EDW A;  1B50 A;  3CW2 C;  2NTT A;  2NU6 B;  2RQX A;  4K5X A;  3WO0 A;  1MKH A;  3U50 C;  1EQT A;  5ELD A;  1LUZ A;  1NMF A;  2ASL A;  2F0V A;  1GJX A;  1JE5 A;  2A6E C;  1HR0 H;  1BO0 A;  1D5M C;  4FDB A;  3VR3 A;  1UEA B;  2RSO A;  4QWE A;  2YTY A;  1N48 A;  1SYC A;  2W9B A;  3T1H H;  1Q86 C;  1B9N A;  2EZV A;  3KHR A;  2JA6 B;  1KBL A;  2H1E A;  1FJG L;  3A8J E;  2I0Q A;  4JI7 L;  5FO7 B;  2F0Q A;  4JI0 L;  4N8F A;  3GTG H;  1ZQ7 A;  5FPR A;  3TZD A;  2Z6K A;  3CXC A;  1B04 A;  4LFC Q;  3G48 A;  5AJ3 Q;  4JI5 Q;  2W8L A;  2G9D A;  4P71 A;  1S5E D;  4YCV A;  2PQA B;  4A3G B;  2RGV A;  3AQQ A;  1R4P B;  1J9O A;  1JDE A;  2F4I A;  3E6Z X;  2UVW A;  1S97 A;  3GIQ A;  1KJI A;  1YHQ A;  1QOH A;  1GUS A;  5M3M G;  2HQL A;  2D0P A;  4J9O A;  4RZR A;  1NTG A;  2K4K A;  1XNR H;  2DLN A;  4UP7 A;  1CSQ A;  2QF7 A;  4RZQ A;  3CC7 A;  5L1K A;  1A3U A;  1IBM L;  3L0O A;  4C1N I;  5LMN W;  2K50 A;  2IX0 A;  5E4X A;  3PW5 A;  2ALZ A;  1WCM G;  5EKI A;  3SR1 A;  2JEF A;  2EE1 A;  1SMY D;  2KCC A;  4KD4 A;  2NVT H;  4A3E H;  3NTK A;  1U4R A;  1SEI A;  2EJF C;  1TWG B;  3F2U A;  2W7O A;  1Y1V A;  4OON A;  1ICW A;  4QL5 A;  4FXD A;  2K14 A;  2QK4 A;  3TII A;  1C8C A;  4IRC A;  4DV3 Q;  5JJZ A;  2EYP A;  4CGY B;  2MJ8 A;  1YNJ D;  3HOZ G;  1IKM A;  4GKJ H;  2RDH A;  2RBM A;  5HBR B;  3J80 c;  2JSO A;  3RTX A;  2E2H B;  3CRL C;  3AEV A;  2R7Z G;  1A2U A;  3RMH A;  3VR5 A;  5IP9 G;  1RHP A;  2L11 A;  3D4W A;  2DJF C;  2EQS A;  2VS1 A;  3CCL A;  1PZJ D;  1N8R C;  1TWF B;  4JI6 L;  2ZDG A;  3MFI A;  1AE3 A;  4UHV A;  2K04 A;  3KUP A;  2ZM6 Q;  4LF9 H;  2C2E A;  3OOC A;  1N36 H;  4FO2 A;  4JV5 Q;  5KGU A;  1PFM A;  3LNN A;  4LUO A;  2FMC A;  1VAJ A;  1W93 A;  4JI6 Q;  2ICI A;  2UUA L;  1J5E L;  1LM0 A;  1PH6 A;  3S1M H;  5IE8 A;  4C3H G;  5HGT A;  1TWC A;  1DOM A;  1VQB A;  4BS9 A;  4O0A A;  1JB3 A;  5ELN A;  1UAP A;  3M4O B;  1HFN A;  2FMM A;  2Z9H A;  1I4P A;  4OHJ A;  2R92 H;  4BWS C;  3WWV A;  4ABN A;  5KFW A;  2VQF H;  2IT1 A;  2PZW A;  3GTJ A;  4Q45 A;  4B3R Q;  1JT8 A;  4JI1 Q;  1S4Z A;  2A5H A;  2L15 A;  1XNQ L;  2DWC A;  3MR2 A;  4DR6 H;  3BU2 A;  1S0O A;  3C3L A;  3EA6 A;  3N43 B;  5IT9 L;  2VB3 X;  4HJ7 A;  4K8I A;  1SMY C;  1SE2 A;  1VS0 A;  5HUR A;  4C5B A;  3CCQ A;  2ENB A;  3TQT A;  2R7K A;  4R4T A;  3T16 A;  3ERQ A;  4EEY A;  4NPS A;  1VQE A;  2L55 A;  5EWG A;  1VQ6 A;  4YQW A;  3MFY A;  4LFC L;  3Q24 A;  3R2I A;  4L5S A;  4NXN Q;  2C2R A;  4MZ9 A;  1NR4 A;  1LT6 D;  1P8L A;  4YHH L;  4LUV A;  2GA4 B;  5M5Y B;  3LP8 A;  2XC9 A;  3PW7 A;  1QNK A;  2J0T D;  2ATL A;  2UUB H;  3NTI A;  1S5F D;  1CA6 A;  2K05 A;  3FHW A;  3E5N A;  2WB1 E;  5JPM C;  2Y0S A;  2IWH A;  3N52 A;  4O3O A;  2E2I B;  3HOW B;  4DR3 Q;  3RUZ A;  3D0F A;  3GID A;  1SDF A;  2R8J A;  4DK6 C;  1KTK A;  1GKH A;  5D1P A;  2FK1 A;  2V4D A;  1M6V A;  1TWH B;  2FIN B;  1TQO A;  4J8Q A;  3S1R H;  3L4J A;  1CA5 A;  3VPC A;  4K0K L;  5C5M A;  2NVQ B;  2ZTE A;  4FVM A;  2ZJP A;  1WTX A;  4U7C A;  4HTH A;  5ELF A;  4A93 B;  4L8J A;  3U9T A;  2I87 A;  4R4O A;  3TP8 A;  1FD7 D;  3A8I E;  3RAQ A;  1F9S A;  3H15 A;  4C3J H;  3K7A B;  4HED A;  1Q8I A;  4UDU C;  4H02 A;  4DFA A;  3KHG A;  1HCZ A;  3ONA B;  1RD9 D;  2UXC Q;  1E2V A;  4YHH Q;  1X3F A;  3GTJ H;  3D6W A;  3S1Q H;  4QIW E;  4AH6 A;  4RKL A;  2UVR A;  3GTQ H;  4MA5 A;  3TP6 A;  1BGW A;  2ATW A;  4KD3 A;  1VF7 A;  1B44 D;  4ZUJ A;  2HHH H;  1RDP D;  3I2Z A;  3TQ1 A;  4LJZ C;  1WOC A;  2FJZ A;  2W6O A;  1MI2 A;  5FLX L;  3RZO H;  1Z6H A;  1VQD A;  3VYU A;  4CKB A;  2GVB A;  4M1U B;  1PV4 A;  1HUN A;  2JQO A;  4KY5 A;  4JI7 H;  3E9I A;  2IP4 A;  4J9K A;  4HJA A;  4HR7 B;  1XPR A;  1VQ8 A;  3GTP B;  4DV5 Q;  5LMU L;  4B3T Q;  5KFL A;  3PO2 H;  1ESR A;  4WOR A;  5CV5 A;  4OWX B;  4A3J H;  4B3S Q;  4K8J A;  1C7Y A;  2PI2 E;  1JWU D;  4UP9 A;  4DL5 A;  1J8I A;  2Q8I B;  5BR8 Q;  2JA7 B;  3CF5 A;  4X3K A;  3J80 i;  2VUM H;  2JEA I;  2XIG A;  4FS1 A;  2UXB H;  3I72 A;  5KG2 A;  5C4X H;  2VB2 X;  2DZD A;  3I91 A;  3NQI A;  4YJ2 F;  4EVO A;  1PRT F;  1RYR A;  2K03 A;  5J39 A;  3S14 B;  2DNE A;  3KAJ A;  1A0I A;  3NSW A;  5KG0 A;  4IUN A;  2EYF A;  4F8M A;  5LMN L;  4QF4 A;  1AZQ A;  3GTK H;  1UE1 A;  2FMA A;  3RGX A;  4Q5V A;  4FF4 A;  1PH2 A;  3RLN A;  2KOL A;  4BY1 G;  5KFF A;  3A0J A;  3WOE A;  5FO9 B;  3I4M B;  2A6H C;  1EWH A;  3NTH A;  2A6E D;  3H09 A;  4QUF A;  3ULP A;  1TS5 A;  3K0X A;  4KKS A;  2IX3 A;  3J80 W;  1LYL A;  4A3D G;  4UFZ A;  2DY8 A;  2M9V A;  1TWH A;  4EBE A;  1HZA A;  1CHP D;  1X54 A;  4A3B G;  5IGG A;  3FPU B;  2CWP A;  1JJC B;  2AGO A;  4HNV A;  4MTD A;  2ZM6 L;  2UVU A;  5IOC A;  3QB3 A;  4JI2 Q;  2K5W A;  3S2D B;  5JJI A;  1Q1E A;  5KT3 A;  5EAY A;  1FNW A;  2BA0 A;  1K0R A;  4O2B F;  3M3Y B;  2YS7 A;  3KF6 A;  5M3F H;  4DR4 Q;  1W96 A;  4GLX A;  2PNR C;  5ELB A;  3MR5 A;  2I46 A;  4IUP A;  4NKL A;  3MA2 B;  2YZN A;  1BOS A;  1HNW Q;  4ED6 A;  1F9P A;  5I6W A;  4TQS A;  1VQG A;  2HDM A;  5DNF A;  4L5R C;  1IZ6 A;  1VQJ A;  1WTH A;  3EPG A;  1N9W A;  4PWQ A;  4HJ5 A;  1O7I A;  1T5E A;  3E0J A;  4DR2 Q;  3NBH B;  2B2V C;  3JAM c;  1H9J A;  2Q8T A;  4UAI A;  3R93 A;  4UY8 C;  3TSS A;  3GTK B;  3I4O A;  5EQ0 A;  5KFT A;  2ZTD A;  3T5H A;  1N32 H;  4Q43 A;  4A3B B;  1FGU A;  3G7L A;  4KY7 A;  2YU9 B;  1HFG A;  2JE6 I;  1GUN A;  1Y14 B;  1YI2 A;  4JI8 L;  2VUM B;  3PQI A;  3T56 B;  5IIF A;  5DEH A;  4C56 C;  1TT2 A;  5C44 B;  4PV1 C;  3F2D A;  4LK1 C;  4K5W A;  1EYC A;  2K33 A;  4NXM L;  3VMM A;  1OXT A;  4X66 Q;  4GOP C;  3NHH A;  4A3I H;  1DZ1 A;  1YBY A;  3MWD A;  2R6F A;  1L1O A;  4JV2 A;  4QGU A;  4ZAI A;  2C28 A;  1W6K A;  1AUV A;  1U4M A;  2B63 H;  5NUC A;  1Z9F A;  1IBL H;  4KV6 A;  1Q1B A;  1JB7 A;  1F2M A;  4QCL A;  4ME6 A;  4JI4 H;  5CV4 A;  4IR1 A;  1KJQ A;  3PIP A;  5EOY A;  5CA1 F;  3CQZ B;  3ORQ A;  1UEB A;  5JOB A;  4RGO S;  1D8L A;  4KJN A;  3Q8S B;  1E3P A;  5FJ8 G;  4RAY A;  4YAJ B;  1M90 C;  1S5C D;  4OWW B;  2B2Y A;  3BQ0 A;  3L7Z C;  2W70 A;  3GIJ A;  3S1Q B;  3GV5 B;  2R7Z H;  2G5D A;  1K1Q A;  3PMF A;  2F0U A;  4ALP A;  3GTO B;  2NZO A;  1O75 A;  1RYS A;  1GOZ A;  2B2W A;  3DWA A;  2E5L H;  3MR3 A;  2UXC H;  1GHJ A;  1M8A A;  3DF7 A;  3W3A A;  1EOV A;  1D5X C;  3PUW A;  1NCV A;  2GLT A;  4ED2 A;  5E1F A;  2JA5 A;  3PCO B;  2VOB A;  1BXR A;  1WI5 A;  4HNT A;  5DGB A;  2XRQ D;  5DG8 A;  4CC5 A;  4A3M G;  5L9X A;  3JSL A;  3AFP A;  4F88 A;  4HIK A;  5BPH A;  3PF5 A;  1QJO A;  3MXU A;  5J3B A;  4YWL A;  2UU9 Q;  3I4M G;  1JIC A;  3KJO A;  2FPI B;  3M7G A;  3JRX A;  3R2T A;  5CV7 A;  2NUC A;  3IRB A;  3E9H A;  2AWO A;  4TVA B;  3A7L A;  1IYU A;  2FE3 A;  1L0W A;  2PW5 A;  4X64 Q;  4HR7 A;  5KFQ A;  2SDF A;  4S3S A;  1AE2 A;  1YHA A;  5M5Y H;  1K1S A;  4IRK A;  3CC4 A;  2AWN A;  3EIV A;  2UUA Q;  2WYO A;  1SSO A;  5K36 G;  3CME A;  2QIL A;  4K0K H;  2MGS A;  3AU7 A;  3MZ5 A;  4X3U A;  5LMN H;  3A56 A;  3SI8 A;  1KJ9 A;  2OLS A;  3ICE A;  1NE3 A;  3BDL A;  1GUG A;  4C1N K;  1EHI A;  1PRT C;  3C2P A;  1GVP A;  1T3N A;  4LF8 H;  2KHJ A;  1KJ8 A;  1X3E A;  4RFB A;  1KAW A;  2QCP X;  3J81 c;  1Y1W G;  1TS4 A;  4UCO A;  1TWF A;  1B3Q A;  3NBI A;  2KCM A;  3HKZ E;  2E2J H;  4HNU A;  1EZ6 A;  2RDJ A;  2AGQ A;  5LYJ F;  1CK1 A;  4EGJ A;  5CC4 A;  4X6A H;  2BH8 A;  1CQV A;  1C3O A;  1UC8 A;  3L9A X;  3PW4 A;  1WSC A;  2N88 A;  3NQT A;  5LXT F;  2D0O A;  4ILW A;  3RB4 A;  4QWD A;  1STG A;  5H1S E;  1S10 A;  4GOP B;  4ZQ3 A;  1QVF A;  4AQY Q;  1DCZ A;  1CS0 A;  1BKB A;  3H0G A;  2XCA A;  4FBT A;  4JI8 H;  2CZG A;  4JYA Q;  2X6L A;  3B6Y A;  1ZHS A;  5HY6 A;  4TKO B;  3A5U A;  2OCE A;  3R8B A;  2VQF Q;  1ZKO A;  5HV6 A;  5KT4 A;  1JXL A;  3V4S A;  1SFO A;  5M5X H;  3N41 B;  3RJ0 A;  1LT3 D;  3SE0 A;  4DV4 H;  4R1J A;  3OW7 A;  2O5J C;  4J1M A;  2SCU B;  3T5L A;  4XYM B;  1EYD A;  3WNZ A;  5D1O A;  4K5V A;  4F4X A;  3UI2 A;  2B2W C;  4LF4 H;  3T1Y H;  1EFW A;  1I7L A;  2E8G A;  2PMZ B;  2KBN A;  3DM3 A;  2EYM A;  3CKI B;  4HJ9 A;  5DM7 3;  4B3T L;  4KTA A;  1KC7 A;  4C5A A;  2RA4 A;  4NDX A;  1CUK A;  4L63 B;  4A3K G;  2FK3 A;  4YR2 A;  2MPM A;  2N49 A;  2BCO A;  1KDC A;  3D8G A;  1UNS A;  2B63 G;  1Y1V B;  4NMZ A;  1RJR A;  3S14 H;  4DL6 A;  1RIP A;  1ET6 A;  3FKI G;  4ULL A;  4DL7 A;  1O80 A;  2UXC L;  3GTK A;  1I7N A;  4H0L C;  3RBE A;  3E3X A;  5C44 G;  5LMU H;  1GUW A;  4DV3 L;  1E4G T;  3KXY T;  3DLL A;  2W6N A;  2LXK A;  5HGQ A;  2VA3 A;  4APV A;  2YV5 A;  2XVS A;  1EEF D;  1MHW C;  3M9B A;  5KFA A;  5FJ8 H;  4JI0 Q;  2E2H A;  1WTW A;  3GDE A;  3IG0 A;  1U4L A;  1AH9 A;  1N32 Q;  3OIP A;  1LTI D;  4HYK A;  1BJT A;  4LFB Q;  2NVY B;  1ZYR C;  4WRD A;  3BDC A;  2W6P A;  4NLG A;  3H91 A;  1PMR A;  3EJI A;  5CV9 A;  4FF3 A;  2W6Q A;  3IFT A;  5C4X G;  4MV4 A;  3MTS A;  5IT9 c;  2EVB A;  2OQK A;  2PNH A;  2XWJ B;  2ICE C;  4GS3 A;  1RJT A;  5CV8 A;  1PH7 A;  4ECT A;  2F4V H;  1JCK B;  3V6K A;  3R5X A;  1N33 L;  2F3W A;  3C1E A;  1RKN A;  4OIJ A;  2JEG A;  4A3K B;  3J7A V;  4J9R A;  1EY4 A;  4EFB A;  2LY7 A;  1BDO A;  2KCT A;  4G7H C;  1KLG D;  3CP0 A;  3TEH B;  4FF1 A;  3HOV G;  2M05 A;  2EYO A;  3DWQ A;  5FPO A;  4IUR A;  3PVX A;  3S1N B;  4LFA L;  1QNU A;  4KMU C;  2JA6 H;  1HNX Q;  5KX5 F;  3TN2 A;  1K9M C;  1MZB A;  5IYZ F;  1AEX A;  2VZA A;  5IYB G;  4R4C A;  2C35 B;  3N42 B;  4MV3 A;  3KBX A;  1PFS A;  2OTJ A;  3GTO H;  5C3X A;  5GAG C;  2I07 B;  5I2X A;  1KJJ A;  2R7Z B;  3NP8 A;  4HCE A;  4ODG A;  3J81 j;  2IMW P;  3BQ2 A;  3N40 P;  3JSN A;  1I4Q A;  2F0W A;  3S15 H;  3Q23 A;  3IKJ A;  2NU9 B;  2B8F A;  4X65 L;  2BE5 C;  4X65 Q;  3ORR A;  1IHZ A;  2RDF A;  1HA5 A;  1SCU B;  2XGP A;  3GTQ A;  2AQ1 B;  2PCF B;  1CT1 D;  4J9M A;  2NB0 A;  4OEL B;  1A2T A;  4DL4 A;  4I7Z C;  3T1H L;  1KHI A;  1IBL Q;  4XQJ A;  5IP7 H;  4CDF C;  4G3I A;  3RLF A;  3MWY W;  4IUQ A;  1TAE A;  1CM9 A;  1KIX A;  3D6C A;  2E2I A;  1EQR A;  5BN4 A;  2DPJ A;  1EYA A;  2I5L X;  3UFX B;  2B63 B;  2QYZ A;  1C48 A;  2R3Z A;  3I90 A;  4IOA A;  5DG9 A;  2ZXO A;  4UP8 A;  4DV3 H;  4LF7 H;  1CZG A;  2W7P A;  5T1G A;  5IWA L;  3KYH C;  4X64 H;  4DAP A;  4IR9 A;  2XN9 C;  4KHP Q;  4LF5 H;  1EQQ A;  4GKK H;  1JLL B;  4YAK B;  3DHQ A;  2JEJ A;  4DR2 H;  2EDG A;  5DQH A;  5I6Y A;  5GRO A;  2F0M A;  2NN6 I;  4K0K Q;  3QG1 A;  3K59 A;  2RKS A;  4HMJ A;  4A3I G;  1SFO H;  3GQC A;  3J81 L;  3SGI A;  5FLM H;  4AQY L;  4K2K A;  2K75 A;  1HXY D;  3CCJ A;  5C8Y F;  4IZ8 A;  2R92 B;  2K5Q A;  3NWS A;  4DXG A;  5KFM A;  2F0G A;  2JA6 A;  3Q8P B;  1R4Q B;  3JAM W;  3H0G B;  4RB0 A;  5JVD F;  4BY7 G;  5KG5 A;  2F0J A;  2R93 A;  2B29 A;  2F1M A;  3EVQ A;  4NB3 A;  3KLS X;  4IFD J;  1P16 A;  3GD7 A;  4YP3 A;  2O2L D;  1ILQ A;  2Z8L A;  4U68 A;  4XYO A;  2R85 A;  1R9T B;  2WAQ E;  1TS3 A;  5KND A;  4IFD G;  3FKI H;  2E5L L;  4JV0 A;  4DV2 H;  1TWF H;  2E5L Q;  5J22 A;  1ET9 A;  3H3V I;  5KFE A;  4DUY Q;  1WD0 A;  1BCP D;  4DR1 H;  4XQN A;  5FD5 A;  1N34 Q;  1A15 A;  1HR0 W;  1ILP A;  2BDN A;  1EU4 A;  5M9O A;  4A3J G;  2VY3 A;  3FPP A;  1X3Q A;  1X32 A;  1K73 C;  4PQX A;  4JBM A;  4LNQ A;  1MSH A;  4ED8 A;  3BYT B;  1CSP A;  4EYH B;  4ED3 A;  3TDQ A;  1RJQ A;  4YCW A;  2N78 A;  2OTL A;  3PO3 H;  2RCF A;  4OX9 Q;  2RDG A;  1PTO H;  2SNS A;  3MVV A;  3I4M H;  3J7Z C;  3K5L A;  4B3M L;  1M0T A;  4EBD A;  4APM A;  3FKI A;  5KFJ A;  2YCH A;  4J9N A;  4YJ3 F;  4DAM A;  1D6E C;  5FLX c;  1YIT A;  2F4V Q;  2E2J B;  1TWG A;  4F4Y A;  3I73 A;  3CCM A;  4FBU A;  3ERO A;  1VQA A;  1EYG A;  1Y8O B;  1FVI A;  3HOV H;  2UU9 H;  1VQP A;  5LMN Q;  4XDX A;  1FL0 A;  1JC7 A;  5T1I A;  2F4V L;  4LW1 A;  1B6R A;  1OXU A;  1WFQ A;  1X3P A;  1YNN C;  1TKW B;  3G8C A;  3I12 A;  3K5H A;  3KF6 B;  1GSA A;  2AQ3 B;  4DV1 Q;  4FU0 A;  3QFF A;  2D5D A;  1YJN A;  1AZP A;  1EY9 A;  5L1I A;  4DR5 Q;  1NR2 A;  2WFW A;  2MUY A;  5LL6 S;  1CFM A;  3KOJ A;  3T1H Q;  4RG1 A;  5KFN A;  1RTO A;  1A62 A;  3VA5 A;  1E2W A;  4ZK9 B;  4DV7 H;  4A3L G;  4DV0 Q;  4IAL A;  3SDZ A;  1RCV D;  2KHI A;  1HNX H;  2F0O A;  3RNU A;  2O4X A;  3NBH A;  1GYF A;  4B3M H;  3H0G G;  4ECS A;  2ZXR A;  1STH A;  4C3H B;  1PA6 A;  2A69 C;  3FRP B;  4DU9 A;  2ES2 A;  1WTO A;  3HGB A;  3EYY A;  2R84 A;  3VPD A;  1PYW D;  3KLR A;  4WFN 3;  3K7A H;  2L5T A;  3T51 B;  3T5J A;  1N34 H;  3UE0 A;  3GTM A;  4C2M B;  4G7O C;  5C3E B;  1N36 Q;  1PLF A;  2HUG A;  4GKJ Q;  4J9S A;  3GTP A;  4O3P A;  4GKJ L;  3I3C A;  2NVQ H;  4RGT A;  4DK1 A;  1ULZ A;  2XCP A;  1EUD B;  4X3T A;  1C30 A;  1ENF A;  2WB1 A;  1S40 A;  1Z2N X;  5FKA C;  1I94 H;  5CGK A;  5AJ3 L;  5J2T F;  1HTP A;  3J7A F;  1I6H B;  3SEB A;  1PZI D;  2NWG A;  4QWA A;  1M7J A;  4A3C G;  1FYC A;  2E2I H;  4BY1 B;  3HOW H;  4ECZ A;  2RGR A;  1RTN A;  3OMC A;  5M5W H;  4P2C B;  4ZKB B;  5E7N A;  2YYA A;  3R5F A;  4K14 A;  4LFB L;  2WDT A;  2W9B B;  2PQE A;  3M7N A;  2NUA B;  2F0S A;  2WE6 A;  2BQR A;  1EQV A;  4HIO A;  4FNF A;  2KEE A;  3JAM E;  1YEZ A;  3OUZ A;  1VMP A;  2YL2 A;  1ZET A;  1EIG A;  4R8I A;  1E24 A;  2FKL A;  1RK5 A;  1K3B C;  1F9Q A;  4BXX G;  2XD4 A;  5CR3 A;  3VDY A;  3K5N A;  1XTD A;  2OF1 A;  3HBL A;  5L1L A;  2WAQ G;  2J6T A;  4YR3 A;  3VR2 A;  4V19 0;  4IFD H;  2NYZ D;  4EG0 A;  1UE6 A;  3M4Q A;  3ULL A;  4JI5 H;  2VXW A;  4IN3 A;  4CKE A;  3K5M A;  4DUY H;  1E4E B;  3GTL H;  4X65 H;  4WJW A;  3HEJ A;  3JC6 6;  1AW7 A;  2F0D A;  2R92 A;  2XCL A;  5CBA E;  5BN3 A;  2PMZ A;  4IPD A;  3GQB A;  4BBR B;  4IWX A;  1VBH A;  4MN3 A;  4RH6 A;  4IUT A;  1CHQ D;  5CBE E;  1GHK A;  2Z6K C;  1HR0 Q;  1HR0 L;  2VQE Q;  4YHH H;  3MWE A;  4DUY L;  1Q90 A;  1J5E Q;  1NSN S;  1IL8 A;  4EX5 A;  1HA6 A;  2F0E A;  4JI2 L;  1HQR D;  1O78 A;  4FM9 A;  2EY6 A;  4RKB A;  4JV5 L;  5D3D A;  4ZLT F;  2NN6 G;  3F2B A;  1L0X B;  2NBF A;  2VA2 A;  5BMV F;  3PO3 B;  4Q0Y A;  2KQ3 A;  3EN2 A;  5K36 H;  3OHA A;  1N33 H;  2R7N A;  2A73 B;  3BS1 A;  4LF9 Q;  4EGQ A;  4IPC A;  2ZM6 H;  4DAY B;  5EPL A;  1JWM D;  2EYH A;  4O1N A;  4X62 Q;  5C3E G;  1Q81 C;  3OYY A;  5KFX A;  5BR8 L;  4FXG C;  1LAC A;  2CW7 A;  3RZD B;  2DY7 A;  3ETH A;  3MFG A;  1E1O A;  5KFU A;  1U9R A;  5C0X I;  1B7Y B;  4MAM A;  3RBD A;  1E7Z A;  3H3V H;  1X6O A;  2I8C A;  2UXB Q;  2ASD A;  4ZOL F;  4TRD A;  3SK6 A;  2F3I A;  1HNZ L;  5I4D A;  4RCN A;  1K8A C;  3BJU A;  1PVO A;  3G6E A;  4BBR H;  1ENA A;  3AMU A;  1YJW A;  3H0G H;  1XMO H;  3H4D A;  3TS2 A;  3H20 A;  3G6X A;  1IOV A;  1F2Y A;  4RAZ A;  4O42 A;  2QA4 A;  3DM1 A;  2HHH L;  1SYG A;  3FEW X;  2O03 A;  3PR5 B;  2K01 A;  4JI5 L;  4QQB X;  2C5C A;  4RGN A;  3GIM A;  2J9G A;  2R6G A;  2CW0 C;  1TXY A;  4GC6 A;  4NXM H;  4A3G H;  4KK7 A;  1Z7T A;  4KHP L;  3GLK A;  1OXX K;  1TWA B;  5KT2 A;  3V2T A;  1RK6 A;  2I5M X;  1HNW H;  4LF4 Q;  1JOQ A;  3CC2 A;  4TV9 F;  3NK9 A;  4JBK A;  1H95 A;  3I4N B;  4POG A;  3G6V A;  2M00 A;  1UE5 A;  3HOW G;  2YS6 A;  1XX8 A;  2CH4 A;  4C3J B;  2A74 C;  2UXD L;  3W1B A;  4DA2 A;  3BVG A;  1JMC A;  2QW7 A;  2R7D A;  3MXN A;  4ED7 A;  2R8K A;  4QWB A;  4ME5 A;  4HN7 A;  2XRS D;  4A3E G;  3J80 L;  3VYR A;  3H94 A;  5JAV A;  5F2D A;  1CQI B;  1TU2 B;  2A69 D;  5JVL A;  1JDB B;  1IYJ B;  4O4L F;  3OIQ A;  1KL9 A;  3O13 A;  5FLX E;  4TV8 F;  2ZJQ A;  2VUM A;  4EBC A;  1WTP A;  2NVX H;  1B6S A;  2CQA A;  4YIJ A;  2NVX B;  1CQF A;  3C1F A;  2CCZ A;  1DYQ A;  3U9S A;  4WJ4 A;  2KCN A;  4C2M H;  1LTR D;  2FPG B;  1C9O A;  5KG3 A;  3QOJ A;  5JJL A;  4O3Q A;  2KED A;  3V96 A;  1L1O B;  2K5D A;  3PO3 G;  1G91 A;  2VR1 A;  4C3I B;  4KN7 C;  1XNQ H;  2F0T A;  4LMQ D;  4DR7 Q;  2BQU A;  1NAP A;  2JN4 A;  3ETJ A;  3CCE A;  5EGT A;  3GO5 A;  1Q7Y C;  2N55 A;  2ZXP A;  2GN5 A;  5DLQ E;  5KFR A;  3T13 A;  3MJF A;  4RUA A;  2BOS A;  3RLO A;  2RCN A;  4ETS A;  3MWM A;  1Q82 C;  3PV0 A;  5ELE A;  1ML0 D;  2EY5 A;  3I4N H;  1DOK A;  4CHT B;  3MAQ A;  3Q2O A;  1K3R A;  1BNZ A;  1K0S A;  3NGD A;  4DV2 Q;  5C5L A;  4ID6 A;  4TSS A;  3TRZ A;  1JKJ B;  4DUZ L;  1U0L A;  4A3M B;  1N33 Q;  1VMC A;  2HCC A;  1BBX C;  2AMC B;  1R9T A;  5C6A A;  3HB9 A;  3VA7 A;  5COR A;  2YW2 A;  3QIA A;  2ZJT A;  2MO1 A;  3HOX G;  4CBV A;  4LF9 L;  1N32 L;  1VCI A;  4DR6 Q;  2EYJ A;  3BQ1 A;  1EWC A;  2V59 A;  1I5F A;  3M9O B;  2B2V A;  5EBD A;  3KAK A;  4RB3 C;  2AQ2 B;  1QUQ B;  2NVY H;  1ASY A;  5BN5 A;  3BVZ A;  3HFZ B;  2CW8 A;  5C0X H;  3KLW A;  1LT5 D;  2OXP A;  1F77 A;  2HHH Q;  1FR3 A;  4AYB A;  5EPJ A;  3OWF A;  1FGB D;  4JI8 Q;  4DV0 H;  1SNQ A;  2W6M A;  3EQL C;  5LHY 1;  3RUP A;  2EYL A;  5IP7 G;  4IPH A;  2Y0S B;  1E1T A;  3F8N A;  3IFD A;  5E3F A;  5GON F;  4L5Q A;  4IAJ A;  4O3R A;  1OTC A;  2E2H H;  1LAB A;  1BXT A;  1KQS A;  3V4Z A;  2WII B;  4DR2 L;  2C22 A;  3HS0 C;  2B2T A;  1KC8 C;  1IBK L;  2R8G A;  1NY4 A;  3Q0A A;  2Z0S A;  3TIG A;  2F0P A;  1S0M A;  5JH7 F;  3STB D;  3RGZ A;  2MO0 A;  1Z2O X;  1CKO A;  4MV6 A;  3GTM H;  1G51 A;  4A3C H;  2NVT B;  1B9M A;  3C46 A;  2QDB A;  4K2L A;  4KKU A;  3LGJ A;  3HRZ C;  2RF4 A;  4B3S H;  1X65 A;  3CPF A;  5M5X B;  2I80 A;  1I3Q B;  4LH7 A;  3L4K A;  4NXM Q;  5KFY A;  4C3J G;  1SJE D;  1JR0 D;  2XTI A;  2OWO A;  2K28 A;  5BR8 H;  2YTV A;  2BA1 A;  1EUC B;  3K58 A;  4GOP A;  5EWE A;  4GNX C;  4OWT B;  1PFB A;  2A68 C;  4XX0 B;  4HQ6 A;  3P75 A;  2JXM B;  1TS2 A;  1EY0 A;  4BY7 H;  4O2D A;  3TS0 A;  1D2B A;  3NE5 B;  3FDT A;  3MC0 B;  1X55 A;  1B4O A;  4JBJ A;  2VQE L;  5I9O A;  3BAB A;  2FXQ A;  5KFS A;  4EQP A;  1SBB B;  2CQY A;  3GTL B;  1ROD A;  4IUV A;  5CAE B;  1MBY A;  1TY2 A;  3N44 B;  1SFO B;  1LO5 D;  4UCR A;  4DGZ A;  2O5I C;  1EZ1 A;  2F0K A;  5ISR A;  2P0A A;  3K8A A;  2F0H A;  2HGS A;  1M1K C;  2V58 A;  2YU9 A;  4KKT A;  3Q8Q B;  2JK8 A;  3A8K E;  3GTG B;  3X3M A;  1TWA A;  5FLX W;  3ULJ A;  4LF5 L;  2R7Z A;  2UXD Q;  5IYC H;  1VBG A;  2JA7 A;  3UDX A;  2K5H A;  3PW0 A;  4ECQ A;  4LFA Q;  1ICF B;  2PVP A;  4DV5 L;  3RV3 A;  4DPG A;  2IBK A;  1EY8 A;  3WOF A;  3MEF A;  4RWS C;  2A68 D;  1JOK A;  1STE A;  4L5T A;  4EFE A;  4C3I H;  3S16 H;  1SE4 A;  1D5Z C;  2KUM A;  1Y1V G;  5D65 A;  3V05 A;  5M5W B;  1YJ9 A;  4LSA A;  5E4W C;  3RF2 A;  2Z1C A;  1PH4 A;  2UU9 L;  3NXW A;  1XMO Q;  3CRK C;  2J7Z A;  4HID A;  1WCM A;  3AFQ A;  4GNX A;  5C4J B;  1UNN C;  4XTC S;  4UPA A;  1VQL A;  1IYV A;  3RFC A;  4N9P A;  5A2Q W;  5T14 A;  1EWI A;  2L0C A;  1PH5 A;  2JA7 G;  3K5O A;  1H9S B;  3SHL A;  4QW8 A;  1K8O A;  4OO1 H;  1AN8 A;  2R7M A;  5KEE A;  4Y8V B;  1J6Q A;  2KA7 A;  5KFP A;  3AB9 A;  3R3O A;  4JI3 Q;  3NPP A;  5COY A;  4JG2 A;  2L12 A;  1A9X A;  2B2U A;  4LF8 L;  2A8V A;  4JI0 H;  3BZC A;  4Q0F A;  1VQO A;  4LF8 Q;  5DAU A;  3Q8R B;  4GN4 B;  2UUC L;  4IJH A;  1S5D D;  5JUM A;  3BDO A;  2JA8 B;  3WO1 A;  3PN1 A;  1V4Y A;  2LKV A;  1SXT A;  3X3N A;  5JEA G;  2B2T C;  5FO8 B;  4QY7 A;  4JV1 A;  3CU7 A;  5C0X G;  2WKD A;  4LF6 H;  4HCS A;  1E4F T;  4BBR G;  1OWT A;  5H80 A;  2KSW A;  4J9P A;  2IW3 A;  4PZ6 A;  4DR3 L;  2ASB A;  4B3R H;  2WKC A;  5KIX A;  2ID0 A;  1EU3 A;  1EUJ A;  1I50 H;  2K7V A;  2QGQ A;  5C0X J;  3CQZ H;  2R93 B;  4OX9 L;  2D62 A;  4A3F B;  3HXL A;  4QMG A;  4H13 C;  2Q8R E;  2HVQ A;  4O4I F;  5JPN C;  3OW2 A;  1JE4 A;  4JI4 L;  1HQM C;  4LUZ A;  4C2M A;  3S2H B;  1LTT D;  2YZM A;  4GZY C;  3LX0 A;  3W5O A;  1EFI D;  4KI0 A;  1STB A;  4WBN F;  1BUV T;  2BDO A;  4JI3 H;  1LTB D;  4I7A A;  3LWU A;  1Y1W B;  1N36 L;  4JPB W;  2RSN A;  5IGC A;  5K5P A;  4A3I B;  4JV5 H;  5K2M A;  3T1Y Q;  5GQO A;  1BCP C;  3JRW A;  3GIK A;  4LFA H;  4OIK A;  4EQO A;  4ED0 A;  2UUC Q;  2VQF L;  5KKN B;  4RGM A;  3CCU A;  3GII A;  1EIH A;  2IY5 B;  1VQ7 A;  3J7A 5;  1PZK D;  2BE5 D;  2Y0S G;  2EIF A;  4OL7 A;  2Z4I A;  1SYF A;  3BYY B;  4X66 L;  4RB2 C;  5CYU A;  1AP0 A;  3KK7 A;  1OXV A;  1XYI A;  4JVZ A;  1EL0 A;  1T9H A;  4DL2 A;  2NZH A;  1I6U A;  4UCT A;  2CW0 D;  2QEX A;  2NTS A;  1SYB A;  5KG4 A;  1PTO B;  4AYB G;  1K83 B;  2N8N A; 
#chains in the Genus database with same CATH homology
 1PA6 A;  2JA8 H;  2ES2 A;  3ULP A;  3K0X A;  3MXN B;  1IXR A;  3A5Z B;  1CKN B;  3K7A H;  1LYL A;  4A3D G;  5LMU Q;  4DV7 L;  3PO2 G;  4DV2 L;  2K5V A;  1K8G A;  4R4Q A;  1IBM Q;  1HZA A;  4JOI C;  1PH1 A;  4A93 H;  3UE0 A;  2A1A A;  1WJJ A;  4LF7 Q;  1X54 A;  2WP8 J;  4OXP A;  4A3B G;  3K7U C;  1N36 Q;  4GKJ Q;  4GKJ L;  4YCU A;  2NVQ H;  2CWP A;  1JJC B;  4JI3 L;  1I6H H;  4XIG S;  2ZM6 L;  4JYA L;  1VQM A;  1XNR L;  1W2B A;  4JI2 Q;  5JJI A;  1Q1E A;  5EAY A;  2HIV A;  2IHE A;  2BA0 A;  1S40 A;  1K0R A;  3HOU G;  3KDF A;  3KF6 A;  5AJ3 L;  4DUZ Q;  5M3F H;  1VQN A;  4DR4 Q;  4GLX A;  4DV4 Q;  4A3C G;  1UE7 A;  1SR3 A;  5C3E H;  3PF4 A;  3HOW H;  2E2I H;  3M4P A;  2N3S A;  5M5W H;  5E7N A;  2VW9 A;  1VQF A;  1HNW Q;  1XJV A;  3W1G A;  4LFB L;  1VQG A;  1HNZ Q;  2LSS A;  1C0A A;  4L5R C;  1VQH A;  5GAE C;  1IZ6 A;  3M7N A;  1SN8 A;  1VQJ A;  3NEL A;  1N9W A;  4TQU S;  4C3H H;  1VQ5 A;  1Q8K A;  4HJ5 A;  1O7I A;  1GO3 E;  2PMZ E;  4HIO A;  4DR2 Q;  4JI7 Q;  1YEZ A;  3NBH B;  4LWC A;  1PYS B;  4A3D H;  3JAM c;  1G6P A;  1VQ4 A;  1E24 A;  2MNA A;  4DV1 L;  1Q12 A;  4UY8 C;  4BXX G;  2I5H A;  3I4O A;  1TWA H;  3VDY A;  4A75 A;  1QVG A;  2YU9 H;  2ZTD A;  1XTD A;  4A3B H;  4OO1 I;  1FGU A;  2WAQ G;  4RMF A;  3CCV A;  1PH3 A;  3TQY A;  4BA2 I;  4X64 L;  2JE6 I;  4DNI A;  3F2C A;  1Y14 B;  1YI2 A;  4JI8 L;  4DKA C;  2JA7 H;  1IBL L;  1UE6 A;  1PYB A;  3M4Q A;  2Q2I A;  3ULL A;  1VQK A;  4OO1 G;  1YZ6 A;  4YWM A;  5ELO A;  3F2D A;  2VUM G;  5M3F G;  3KF8 B;  1U5K A;  4PG3 A;  4NXM L;  3GTL H;  1OXT A;  4X66 Q;  4GOP C;  4A3I H;  1YBY A;  3KJP A;  1HJP A;  4A3F G;  1L1O A;  3JC6 6;  1X9N A;  2R93 G;  4QGU A;  4YY3 L;  1HZ9 A;  1Y1W H;  4B3R L;  1B8A A;  1V43 A;  2CKZ B;  4DV0 L;  2EXD A;  3NEM A;  1HNW L;  2B63 H;  4IPD A;  4GLA C;  3GTP H;  1Z9F A;  1BBU A;  3M4O H;  1Q1B A;  1JB7 A;  1EIF A;  4DV6 Q;  4PMW A;  5JEA J;  2UUB Q;  2Z6K C;  3PUY A;  1HR0 Q;  3CCR A;  3CCS A;  1HR0 L;  2YYZ A;  1SMX A;  3JAM i;  2VQE Q;  4P72 A;  4DUY L;  3PIP A;  2Q2U A;  1J5E Q;  1UEB A;  1PH9 A;  4EX5 A;  2HT1 A;  1D7Q A;  1KXL A;  1D8L A;  4GNX B;  4HJ8 A;  4JI2 L;  4LF6 Q;  1YHB A;  1E3P A;  5FJ8 G;  2H5X A;  5JJK A;  4JV5 L;  1M90 C;  2UUB L;  3ERS X;  4OWW B;  5IYD H;  3L7Z C;  2NN6 G;  3F2B A;  3RN5 A;  2R7Z H;  2CWA A;  2F52 A;  1XNR Q;  4ALP A;  3EN2 A;  2NZO A;  1CKM A;  2ALY B;  4LF6 L;  3D31 A;  4LF9 Q;  4IPC A;  2IHF A;  3I7F A;  4DAY B;  1E22 A;  4DR1 Q;  1K83 H;  3K81 C;  1EOV A;  1GD7 A;  3PUW A;  4X62 Q;  5C3E G;  1Q81 C;  1RL2 A;  3OYY A;  2GVA A;  5IWA Q;  3PCO B;  5BR8 L;  1Q46 A;  3KDF B;  2K52 A;  1HNX L;  4A3G G;  1WI5 A;  3HKS A;  4LF4 L;  1JJ2 A;  4A3M G;  1E1O A;  5C0X I;  1IBK Q;  1TWG H;  1B7Y B;  1XPU A;  1XNQ Q;  2DGY A;  3AFP A;  1E7Z A;  2ZTC A;  4HIK A;  3H3V H;  1X6O A;  2OQ0 A;  1KRT A;  3PF5 A;  1R9T H;  1ASZ A;  5C4J H;  2UXB Q;  3HOY H;  5J3B A;  3K80 C;  4PZ7 A;  4J15 A;  4YWL A;  1N34 L;  1HNZ L;  2F3I A;  2UU9 Q;  3I4M G;  1YIJ A;  3KJO A;  1K8A C;  3BJU A;  2VL6 A;  4JCV E;  4BXX H;  1PVO A;  3G6E A;  4BBR H;  3IRB A;  3E9H A;  2AWO A;  4TVA B;  1HZC A;  1YJW A;  3H0G H;  4DV4 L;  1L0W A;  4X64 Q;  3I4N G;  3I56 A;  2AKW B;  1AE2 A;  1YHA A;  5M5Y H;  3TS2 A;  1VQI A;  4NXN L;  2JA5 G;  2AWN A;  3EIV A;  2UUA Q;  3CC4 A;  2HHH L;  5IP9 H;  3CME A;  2QA4 A;  5K36 G;  1VQC A;  5C44 H;  3RN2 A;  4JI5 L;  1BBW A;  4QQB X;  1FJG Q;  2R7F A;  3EBE A;  3ICE A;  1NE3 A;  3ZJY C;  1I94 Q;  1EIY B;  3UDI A;  2LXJ A;  2R6G A;  1GVP A;  1L1O C;  4X62 L;  2KHJ A;  2Q2T A;  4WJ3 M;  1X3E A;  1TXY A;  5IYC G;  1KAW A;  3S17 H;  3J81 c;  4GLV B;  3HOX H;  1Y1W G;  4A3G H;  2E2J H;  2KCM A;  3HKZ E;  4KHP L;  1OXX K;  2Q2H A;  4A3M H;  1BVS A;  2CFM A;  4X6A H;  2I5M X;  2BH8 A;  4LF4 Q;  4HIM A;  2K5N A;  3M85 A;  2MFI A;  3CC2 A;  1YVC A;  2CQO A;  4JBK A;  1H95 A;  3HOU H;  2MQH A;  4ME3 A;  4POG A;  4DR7 L;  2D0O A;  1X3G A;  3A74 A;  1G29 1;  3PUV A;  1Y1V H;  4DV7 Q;  1UE5 A;  5H1S E;  3HOW G;  2RHQ B;  4GOP B;  1QVF A;  3PSI A;  2JJQ A;  4AQY Q;  1OXS C;  3FP9 A;  1BKB A;  3W1B A;  3UDG A;  4B3M Q;  4LF5 Q;  2UXD L;  1JMC A;  4B3S L;  4JYA Q;  4BBS G;  4POF A;  2R7D A;  4BY1 H;  3B6Y A;  5HY6 A;  4A3E G;  2PQA A;  3A5U A;  4DR5 L;  2OCE A;  5GAD C;  4AYB E;  3PIO A;  2VQF Q;  4JBW A;  1XMQ Q;  4P73 A;  1IYJ B;  1LTL A;  1XMQ L;  1KL9 A;  2KEN A;  3U4Z A;  2ZJQ A;  1I3Q H;  5M5X H;  2NVX H;  4A93 G;  4R1J A;  2CCZ A;  2AHO B;  4WJ4 A;  3PUX A;  3CW2 C;  4C2M H;  1C9O A;  3I55 A;  5JJL A;  1MKH A;  3U50 C;  1EFW A;  1L1O B;  3UDF A;  3PO3 G;  1LUZ A;  1NMF A;  2E8G A;  1JE5 A;  4DR7 Q;  2KBN A;  3DM3 A;  4HJ9 A;  3CCE A;  3GO5 A;  3Q8D A;  4FDB A;  4B3T L;  1Q7Y C;  1CUK A;  2YTY A;  4A3K G;  2GN5 A;  2N49 A;  5DLQ E;  1Q86 C;  3M3Y H;  1NJI C;  1FJG L;  2B63 G;  3RLO A;  2RCN A;  2I0Q A;  1KRS A;  4JI7 L;  1Q82 C;  3PV0 A;  3S14 H;  4KLK A;  3HKZ G;  4JI0 L;  1Z47 A;  1RIP A;  3GTG H;  3I4N H;  1K3R A;  2Z6K A;  3FKI G;  4DV2 Q;  2UXC L;  3CXC A;  3TRZ A;  4DR4 L;  5C44 G;  4LFC Q;  3G48 A;  5AJ3 Q;  1U0L A;  2JA9 A;  4P71 A;  4DUZ L;  4DV3 L;  4JI5 Q;  1N33 Q;  3DLL A;  4YCV A;  2LXK A;  2AMC B;  5HGQ A;  3KFU A;  4APV A;  2PQA B;  2YV5 A;  3M9B A;  3AQQ A;  1A63 A;  5FJ8 H;  3OTO Q;  4JI0 Q;  4GN5 A;  3GDE A;  1AH9 A;  2MO1 A;  4R4I A;  3HOX G;  3G4S A;  1N32 Q;  2UXB L;  4LF9 L;  3F8T A;  1N32 L;  1VCI A;  1YHQ A;  4DR6 Q;  4MNO A;  5M3M G;  2HQL A;  2D0P A;  4LFB Q;  1NTG A;  2K4K A;  4YWK A;  1I5F A;  3S2H H;  1QUQ B;  4UP7 A;  4JI4 Q;  2NVY H;  1CSQ A;  1ASY A;  5C4X G;  3CC7 A;  5IT9 c;  2OQK A;  3HFZ B;  3AYH B;  2PNH A;  3U58 A;  1IBM L;  3L0O A;  4GS3 A;  3UE1 A;  5FLM G;  4A3F H;  1YNX A;  3KLW A;  2K50 A;  5LMN W;  2R93 H;  2Y0S E;  1PH7 A;  2HHH Q;  2IX0 A;  1N33 L;  1WCM G;  4JI8 Q;  2NVT H;  2KCT A;  4MTN A;  2HIX A;  3CP0 A;  4IPH A;  1E1T A;  3TEH B;  5IP7 G;  4A3E H;  3HOV G;  1XPO A;  4OON A;  3HOY G;  4QL5 A;  4L5Q A;  1OTC A;  2K14 A;  2E2H H;  4LFA L;  4DV3 Q;  2JA6 H;  1KQS A;  3CD6 A;  1HNX Q;  4P75 A;  4DR2 L;  3HOZ G;  4Y52 H;  4GN3 B;  1CKN A;  3OTO L;  1QZH A;  1K9M C;  2VZA A;  1KC8 C;  1IBK L;  3J80 c;  1NY4 A;  5IYB G;  4R4C A;  5M3M H;  2C35 B;  1I94 L;  2Z0S A;  1JJG A;  1PFS A;  3AEV A;  3GTO H;  4IJL A;  2R7Z G;  3STB D;  3S1N H;  5GAG C;  5IP9 G;  2OTJ A;  2VS1 A;  3CCL A;  2EQS A;  2MO0 A;  4JI6 L;  3J81 j;  1NMG A;  1CKO A;  1N8R C;  3GTM H;  1AE3 A;  1TWH H;  1G51 A;  2ZM6 Q;  3S15 H;  4A3C H;  4X65 L;  1MJE A;  4A3K H;  3LGJ A;  4X65 Q;  2RF4 A;  4JOI A;  4JV5 Q;  1X65 A;  3CPF A;  4LF7 L;  4NXM Q;  4LUO A;  1TWC H;  1WCM H;  4JI6 Q;  3T1H L;  2XTI A;  2OWO A;  1KHI A;  2UUA L;  4YY3 Q;  1J5E L;  1LM0 A;  1QZG A;  1PH6 A;  1IBL Q;  5IP7 H;  3S1M H;  2YTV A;  4JI1 L;  3RLF A;  1SLJ A;  2BA1 A;  5IE8 A;  1VQB A;  4GOP A;  1KD1 C;  4BBS H;  4GNX C;  1KIX A;  3E0E A;  4OWT B;  4O0A A;  4IFD I;  5ELN A;  1EQR A;  2YTX A;  1SE8 A;  3L2P A;  4DV6 L;  2I5L X;  2R92 H;  4BY7 H;  3WWV A;  4O2D A;  3TS0 A;  2IT1 A;  1SRO A;  4IOA A;  4UP8 A;  1X55 A;  3HOZ H;  2VQE L;  4JBJ A;  1UWV A;  4B3R Q;  2FXQ A;  5IWA L;  3KYH C;  1JT8 A;  4JI1 Q;  4KHP Q;  1EQQ A;  2L15 A;  1VQ9 A;  3U4V A;  1XNQ L;  3BU2 A;  2JA5 H;  1SRU A;  5GRO A;  3K8A A;  1M1K C;  2NN6 I;  4HJ7 A;  4K0K Q;  1VS0 A;  2V1C C;  4A3I G;  2JK8 A;  1SFO H;  3CCQ A;  3ULJ A;  3SGI A;  1X56 A;  4LF5 L;  2VNU D;  2B3G A;  5FLM H;  4R4T A;  4AQY L;  5IYC H;  1GM5 A;  2UXD Q;  3ER0 A;  1VQE A;  4NPS A;  3UDX A;  1VQ6 A;  2K5H A;  4LFC L;  2K75 A;  4LFA Q;  3CCJ A;  4A76 A;  4DV5 L;  4DPG A;  4L5S A;  4NXN Q;  4MZ9 A;  3MEF A;  1P8L A;  4YHH L;  4LUV A;  4L5T A;  3CAM A;  1S3O A;  4C3I H;  3S16 H;  2R92 G;  4BY7 G;  4DK3 C;  1Y1V G;  3FHW A;  1DGS A;  2B29 A;  1QVC A;  1S72 A;  2IX1 A;  2WB1 E;  4NB3 A;  1YJ9 A;  2JA6 G;  4A3L H;  4DR3 Q;  3D0F A;  1PH4 A;  2UU9 L;  4IFD J;  1P16 A;  3GD7 A;  5IYD G;  1XMO Q;  4DK6 C;  4HID A;  4GKK Q;  3AFQ A;  4GNX A;  5IYB H;  4XTC S;  1GKH A;  4UPA A;  3S24 A;  4AIM A;  3CMA A;  2WAQ E;  1VQL A;  1EWI A;  2PI2 A;  1PH5 A;  3FKI H;  2BH2 A;  4KHZ A;  2JA7 G;  2E5L L;  1PH8 A;  4IFD G;  3S2D H;  1TWF H;  3S1R H;  2E5L Q;  3STB C;  3NEN A;  3H3V I;  4K0K L;  4DUY Q;  1A8V A;  1J6Q A;  3RR5 A;  2ZTE A;  1MJC A;  4DR6 L;  4Y7N H;  4JI3 Q;  2ZJP A;  3RZD H;  3F1Z A;  1N34 Q;  1HR0 W;  4JG2 A;  4LF8 L;  2A8V A;  4A3J G;  2VY3 A;  1QUQ A;  3BZC A;  4IPG A;  4R4O A;  1VQO A;  4LF8 Q;  1K73 C;  4EQ5 A;  4LNQ A;  4JBM A;  1W3S A;  4PZ8 A;  3H15 A;  4C3J H;  1CSP A;  3CPW A;  4IOC A;  4GN4 B;  2UUC L;  4IJH A;  4H02 A;  4P74 A;  4A4I A;  1L2F A;  2RHS B;  2N78 A;  4YCW A;  2OTL A;  3PO3 H;  2UXC Q;  4OX9 Q;  4YHH Q;  1WYD A;  1X3F A;  3GTJ H;  5JEA G;  3S1Q H;  4QIW E;  4AH6 A;  3I4M H;  1V1Q A;  3J7Z C;  4QY7 A;  4B3M L;  3GTQ H;  3PGZ A;  5C0X G;  2A19 A;  2ATW A;  4BBR G;  2JA8 G;  2ASB A;  4PZ6 A;  4DR3 L;  3PUZ A;  4DAM A;  2F4V Q;  5FLX c;  1YIT A;  1HZB A;  4IO9 A;  2ID0 A;  1EUJ A;  1I50 H;  3I2Z A;  5C0X J;  2QGQ A;  2WB1 G;  3CQZ H;  1WOC A;  2D62 A;  4OX9 L;  3CCM A;  2DUD A;  4GKK L;  1VQA A;  1EYG A;  1VQD A;  3OW2 A;  1FVI A;  3HOV H;  3RZO H;  4JC0 A;  2GVB A;  1PV4 A;  2JQO A;  5GAH C;  4JI4 L;  3E9I A;  1VQP A;  5LMN Q;  4LUZ A;  1FL0 A;  4HJA A;  1XPR A;  1VQ8 A;  3W5O A;  2F4V L;  4DV5 Q;  4KI0 A;  4LW1 A;  5LMU L;  4B3T Q;  3PO2 H;  2ZJR A;  1OXU A;  1WFQ A;  3BZK A;  1N36 L;  4OWX B;  4A3J H;  4B3S Q;  1NBW A;  2XGT A;  1C7Y A;  3KF6 B;  3T1Y Q;  1B70 B;  2PI2 E;  3TRE A;  4UP9 A;  5GQO A;  3J81 i;  4DR1 L;  3T1Y L;  3G71 A;  4DV1 Q;  1IL2 A;  1V9P A;  2UUC Q;  1YJN A;  2VQF L;  5BR8 Q;  3CCU A;  3CF5 A;  4DR5 Q;  3J80 i;  2VUM H;  1VQ7 A;  2JEA I;  1XMO L;  3J7A 5;  2IY5 B;  2Y0S G;  1MIU A;  2EIF A;  2WFW A;  2JEB I;  4X66 L;  5C4X H;  5IY0 A;  3KOJ A;  3T1H Q;  4RG1 A;  1PHJ A;  1A62 A;  1A0I A;  1HH2 P;  1OXV A;  5LMN L;  3GTK H;  1T9H A;  4DV0 Q;  4A3L G;  1UE1 A;  4BA1 I;  2NZH A;  2KHI A;  3RLN A;  2QEX A;  4QJF A;  4BY1 G;  3A0J A;  3RNU A;  3H0G G;  4AYB G;  1PH2 A;  2N8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...