3H0GG

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
170
structure length
170
Chain Sequence
FFLKELSLTISLHPSYFGPRMQDYLKAKLLADVEGTCSGQYGYIICVLDSNTIDIDKGRVVPGQGFAEFEVKYRAVLWRPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNYSGEDQVIEKGSNVRLKIVGTRTDATEIFAIATMKEDYLGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit rpb1
total genus 26
structure length 170
sequence length 170
chains with identical sequence S
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h0gG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3h0gG01
3ZJYC 3DM3A 1G291 4IPHA 4B3RQ 3K8AA 2CFMA 4DUYL 1BBUA 1XMOL 4GNXC 4A3GH 2KBNA 4DNIA 3H3VI 4HJ5A 2R7ZG 4NB3A 3S15H 1WI5A 3HOYG 2E8GA 4GKJL 4UP8A 1C0AA 3M7NA 1Y1WG 2HHHL 5C0XJ 5JJIA 3BZKA 3CXCA 1Y1WH 1XPRA 1HR0L 1WJJA 1YNXA 4R4TA 1XMOQ 2NVYH 1GO3E 4PZ6A 5JEAG 4HJAA 2VQEQ 5M5YH 2JA7G 4DKAC 3GTGH 1K0RA 3SGIA 2VQFQ 2CWAA 2JA7H 4JI3L 1XMQL 1VQLA 3ER0A 3CCQA 2N49A 4DR5L 3TQYA 4A3MG 4JI4Q 1CSQA 2VY3A 1Q7YC 1FGUA 3F8TA 4DR4Q 2VQFL 1QVCA 5FJ8G 4NXMQ 3KOJA 4EQ5A 5BR8Q 4JI7L 3ULJA 1XNQQ 3TEHB 4DV2Q 2RF4A 3CD6A 2C35B 4KHZA 4HIKA 1QVFA 1A0IA 3E9IA 3I4NH 4OO1G 3G4SA 1PH4A 4JYAQ 1EQRA 4DV0L 3GTQH 4LF6L 1HR0Q 3BU2A 1PYBA 5ELOA 3S1NH 4YCVA 4GOPB 2Z6KC 3FKIG 2IX0A 2VUMH 1VQAA 4AYBG 3CQZH 2NVQH 5IYCH 2NZOA 2JA5H 1X3GA 2F3IA 4B3MQ 3GTPH 2PI2A 5IE8A 1G6PA 1OXVA 1W3SA 3NBHB 4JCVE 1UE7A 3W5OA 5IP9H 4LF6Q 3S1MH 4JI5L 1KAWA 4RG1A 2MFIA 1I5FA 4DUZL 2BH2A 3J7A5 2AKWB 1L1OB 3UDFA 4B3ML 2QEXA 4JI6L 1XNQL 4DV2L 1Z9FA 2NZHA 2B63H 1VQMA 5FJ8H 2ES2A 4NPSA 3TRZA 4DR2L 4OXPA 1Q82C 2XGTA 4KI0A 4B3RL 1PV4A 2GVAA 3I4OA 3NEMA 4DAMA 3OW2A 2ZJPA 1BVSA 2IHEA 2UUCQ 3CCRA 1YJNA 1U5KA 4TVAB 2RHQB 1WCMH 1Q12A 2UXDL 4GOPC 5IYDH 2UU9Q 3PO2H 1W2BA 4L5SA 3RLNA 4LNQA 1L0WA 1IBMQ 3PIPA 3GTJH 2WB1G 1PH9A 2RHSB 2UUAQ 1XNRQ 2R92H 4A3DH 3F2DA 4MZ9A 5LMUQ 3J7ZC 3CMEA 2VS1A 2XTIA 1VQFA 3A74A 1E7ZA 4YWLA 1VQ4A 5M3MG 3PV0A 2AWOA 4FDBA 4RMFA 3KJPA 2K14A 1YVCA 2JA6H 1K83H 1QVGA 1PH5A 3K7UC 5H1SE 1KRSA 2MO0A 5M5WH 5BR8L 4A3FH 3M9BA 3S24A 4JI7Q 2YTXA 3K0XA 4LFAQ 3TREA 4C3HH 2UXCL 2CWPA 2PQAA 3PUXA 4JI1Q 4BY1H 1QUQB 5GROA 5IWAQ 2OTLA 2F4VQ 2WAQG 3HFZB 4ALPA 2R7ZH 3OTOL 4K0KQ 5IYDG 4UP7A 4DR6Q 2AHOB 1BKBA 2JJQA 1WCMG 5IT9c 4A3JH 1I50H 3PUYA 3G71A 1SFOH 4UY8C 1SR3A 1QUQA 4A3IH 1IL2A 4DR6L 1NY4A 1B8AA 4X62Q 5IP7G 4R4OA 2HQLA 4A3GG 1S72A 1HZAA 2IHFA 2B63G 1HH2P 1SE8A 3WWVA 5C3EG 4AIMA 1JT8A 1JJ2A 4IFDI 4BBRH 1YITA 4DR1L 3I56A 1YJ9A 1N36L 1HNZL 3GTOH 2MO1A 3TS0A 1IBLL 5C4XG 1EOVA 2K5VA 3IRBA 4JI1L 3HOUH 1EUJA 5C44G 1VQ7A 1J5EQ 2VQEL 2H5XA 3NENA 1TWFH 2FXQA 1N32Q 3K80C 4QIWE 3U50C 3F2CA 2YYZA 1IBLQ 1TWAH 4NXNL 4JBWA 5C44H 1N33Q 1SLJA 2UXDQ 1PH6A 5M5XH 3J80c 1EQQA 3K7AH 1HZCA 3M4QA 4IPGA 2UUAL 2ZM6Q 1M1KC 2JK8A 1N33L 4TQUS 2OCEA 1X6OA 2E2HH 5IP7H 3FKIH 5ELNA 2AWNA 3M4PA 4DV0Q 4LUOA 4OX9L 1EYGA 1LM0A 4JC0A 2WFWA 4A3MH 1V1QA 3M4OH 2Y0SE 3HOXG 1K8GA 4LUZA 3AFPA 1LUZA 1XNRL 1TXYA 4GKJQ 4OWWB 5C3EH 4LF5L 2EQSA 4BXXG 3KDFB 4DV4L 4JI0Q 3E9HA 3FHWA 2K75A 3RLOA 1FL0A 3EBEA 3CCJA 1PH1A 3U58A 1PH2A 2Z6KA 3UDIA 3HKZE 3CCSA 4JI6Q 3PCOB 4JI2L 3GO5A 4AQYQ 3CC4A 2ZM6L 5IY0A 4A3EH 2I5LX 4APVA 3CPFA 2L15A 5C4JH 1RIPA 2PI2E 3HOWH 4DR4L 1YHAA 2JA9A 2VZAA 3OTOQ 3T1HQ 2AMCB 4POGA 5JJKA 3CC7A 3CCVA 2R92G 4BBSH 4LWCA 2BA1A 1QZGA 3GTLH 4IFDG 2Q2HA 3CPWA 3RNUA 4IOAA 2NVXH 4X66Q 3PO2G 4JYAL 4X6AH 3ERSX 2JEBI 2PNHA 3L0OA 1OXUA 4IFDJ 1NTGA 4HIDA 3H3VH 2HIXA 3G48A 2N78A 4JBKA 1N32L 4DV1Q 3EN2A 3HOUG 2UXBL 3CCMA 4NXML 1AH9A 3CCEA 1SROA 4GOPA 2Z0SA 3I4MH 4R1JA 4YHHQ 2LXJA 1KIXA 2NVTH 5FLMG 3CMAA 1NE3A 1KXLA 4IJLA 3CF5A 1OTCA 3HOZG 4A3KG 3A5ZB 2GVBA 3HKSA 3M3YH 1JJGA 3I4MG 1T9HA 4DK3C 3UDGA 4L5RC 3KF8B 4B3TQ 1MKHA 1IBKL 2ZJQA 1VQGA 4A3BH 3MEFA 3UE0A 2HHHQ 1VQ6A 5HGQA 4K0KL 3H15A 1HNXQ 2VL6A 1E1OA 2QGQA 1VQKA 3I4NG 1JJCB 1YIJA 1N9WA 4DUZQ 4BA2I 4XIGS 4H02A 2R93G 1KD1C 1U0LA 1OXTA 1UEBA 2LSSA 1NJIC 2E5LL 4A3CG 2Q2TA 4A93G 4IOCA 3S1RH 1X65A 3CCUA 1R9TH 2E2JH 1HZ9A 1X9NA 3FP9A 5M3MH 4DR2Q 3HKZG 1G51A 4JV5Q 3PIOA 1VQOA 4R4CA 4IPDA 2D62A 1NMGA 4BY1G 3PF5A 1HNZQ 1VQNA 3S2DH 2D0PA 3KLWA 4L5QA 1VQ5A 1VQ8A 2JA8G 4A3FG 3JAMi 2UU9L 1Q1EA 2BH8A 1SMXA 1FJGQ 1N34L 1FVIA 4L5TA 1N8RC 1VQHA 1IBML 2K50A 1SN8A 4NXNQ 3HOVG 2A19A 4A3EG 4P72A 1Y1VG 3HOXH 4LF9Q 3KFUA 4JOIC 4LFBQ 4A76A 1FJGL 1VCIA 1I3QH 1CKMA 1BBWA 1E22A 2N8NA 3HOYH 4DV3L 2R93H 4LF4L 4DUYQ 3STBC 4YWMA 2NN6G 2QA4A 4Y7NH 4LF9L 2ZTCA 4JOIA 4JV5L 4QY7A 2OTJA 2KENA 1KQSA 1I94L 2B3GA 1HJPA 1AE2A 1TWHH 2OQKA 3CW2C 1Q1BA 4AYBE 4A3LH 3GTMH 1IXRA 1VS0A 3I2ZA 4JBJA 2ZTDA 4MNOA 2I0QA 4LF8Q 1CKNB 2F52A 4LF7Q 3S17H 3U4ZA 3W1BA 4OO1I 2UXBQ 4LF5Q 4DR1Q 2ZJRA 4KHPL 1N36Q 1B70B 2EIFA 1PA6A 4YHHL 3CC2A 1EFWA 2EXDA 5FLMH 4DR7L 3CP0A 4MTNA 4A3BG 4UP9A 1AE3A 1YI2A 4C3IH 4GLAC 5M3FH 3PUWA 4GS3A 4X65L 3T1YL 1S40A 3AEVA 1UE5A 1WYDA 4A3KH 2I5MX 5IYBH 3W1GA 3J81c 4YCWA 2YU9H 4GKKQ 2UUBL 1HR0W 1WFQA 4DV6Q 5GAEC 1D8LA 1P16A 1PH7A 3DLLA 2VUMG 2KHIA 3NELA 4JG2A 2ASBA 3E0EA 4OONA 4PZ7A 4XTCS 4LF8L 5AJ3L 1P8LA 2DGYA 2UUBQ 2E5LQ 4LFAL 4X66L 5IP9G 2PMZE 2UXCQ 4OX9Q 4YY3L 3H0GG 3BJUA 1A63A 1RL2A 4UPAA 4C2MH 4GNXA 1PFSA 3F2BA 4DV1L 1GM5A 5JEAJ 2MQHA 3ULLA 1KRTA 3A5UA 3B6YA 2Q2UA 1Q8KA 1V43A 2E2IH 5C0XG 2PQAB 1Y1VH 2JA6G 4GKKL 4LFBL 4A3JG 1VQJA 2K4KA 2VW9A 4X62L 2HIVA 1NMFA 3OYYA 4JI2Q 1K73C 2HT1A 2WB1E 4WJ3M 5GAHC 4AH6A 5E7NA 1JB7A 4HIOA 4B3TL 4A93H 1L2FA 2KCTA 4YCUA 2JEAI 1XTDA 1HZBA 4BBSG 5AJ3Q 4EX5A 1YHBA 3BZCA 3D0FA 1I94Q 1IZ6A 4QL5A 3M85A 1H95A 1D7QA 2YTVA 3K81C 1K3RA 1GVPA 4ME3A 1M90C 1HNXL 2KHJA 3CCLA 3D31A 4QJFA 4OWXB 1EIYB 4BXXH 4LF4Q 1XPOA 2JE6I 4JBMA 3PO3G 4BY7H 2OQ0A 4DV5L 1C7YA 3RLFA 3L2PA 1YHQA 1X56A 5J3BA 1CUKA 1L1OC 1X55A 3STBD 3J81i 4LF7L 1B7YB 1PH3A 1J6QA 1YEZA 2CQOA 3PGZA 2GN5A 1K8AC 1PYSB 1CKOA 4LW1A 5IWAL 3AFQA 3TS2A 3AQQA 4DV6L 1JMCA 4DV7Q 5GQOA 1L1OA 4BBRG 5EAYA 4HJ9A 1N34Q 4QGUA 4JI5Q 4X64L 1OXSC 1UWVA 4GN3B 1UE6A 1SRUA 3LGJA 1XMQQ 4JI3Q 1Y14B 1NBWA 2Q2IA 2R7FA 5HY6A 1V9PA 5DLQE 4DR5Q 5C4XH 1YBYA 3RR5A 1MJEA 3U4VA 4HJ7A 4DV3Q 1LYLA 1OXXK 4P71A 3GD7A 2A1AA 1EIFA 1GKHA 2K5HA 3HOZH 1CKNA 3RZOH 1S3OA 2R6GA 4OWTB 2IT1A 4AQYL 2CCZA 5C0XI 5JJLA 2UUCL 2BA0A 5FLXc 4R4IA 5GADC 1KHIA 4DAYB 1K9MC 4JI4L 1VQDA 3UE1A 1Q81C 1KC8C 4LUVA 1MJCA 4QQBX 1GD7A 2KCMA 1LTLA 3PUZA 3J81j 1J5EL 3F1ZA 4P75A 1CSPA 1KL9A 2Y0SG 3PSIA 5LMNW 1XJVA 3Q8DA 3MXNB 3HOVH 4POFA 4Y52H 4R4QA 4PZ8A 2RCNA 3HOWG 4HJ8A 1X54A 4A75A 4KLKA 4WJ4A 3PUVA 5LMUL 4GNXB 3A0JA 1YZ6A 2ALYB 1Q46A 5LMNL 3I55A 2ATWA 3PF4A 4HIMA 4DPGA 4A3IG 4JI8Q 1Z47A 1PHJA 4PG3A 4A3DG 2I5HA 3EIVA 4X65Q 1E1TA 3T1YQ 3S1QH 1TWCH 4GLVB 3ULPA 4IJHA 4J15A 2WP8J 4DV5Q 1VQPA 3KF6B 3RZDH 5LMNQ 5GAGC 2A8VA 4C3JH 3VDYA 4GN4B 1E3PA 1X3EA 3S16H 1Q86C 1WOCA 2R7DA 3GTKH 2F4VL 2JA8H 4A3CH 4A4IA 4B3SQ 1HNWQ 2IY5B 3KF6A 2B29A 2WAQE 4YY3Q 1IBKQ 2K5NA 2V1CC 1O7IA 1VQIA 3AYHB 1VQBA 2K52A 2YTYA 4DR3Q 1VQEA 3UDXA 3KYHC 1MIUA 5IYBG 1A62A 4IPCA 4B3SL 1HNWL 3I7FA 4DK6C 4KHPQ 4JI8L 4X64Q 1A8VA 1VQCA 2NN6I 2VNUD 3GDEA 5M3FG 3S2HH 1I6HH 4YWKA 1DGSA 4DR7Q 1ASZA 4DR3L 2YV5A 1JE5A 1YJWA 1PH8A 2DUDA 1EWIA 3RN2A 3J80i 2IX1A 3JC66 3T1HL 4DV7L 1IYJB 3L7ZC 4IO9A 2JA5G 5IYCG 3KJOA 3H0GH 1UE1A 2ID0A 1C9OA 3S14H 2CKZB 4A3LG 4GLXA 1X3FA 3JAMc 1XPUA 4O0AA 3CAMA 1TWGH 2OWOA 3PO3H 4BY7G 4LFCQ 5K36G 4BA1I 3ICEA 1PVOA 2MNAA 4PMWA 2ZTEA 1QZHA 1ASYA 4P74A 3G6EA 2N3SA 1E24A 2D0OA 4P73A 4DV4Q 4GN5A 1VQ9A 4JI0L 3RN5A 4O2DA 3KDFA 4LFCL 2LXKA 2JQOA
chains in the Genus database with same CATH superfamily
4C3IB 4DLKA 3ZJYC 3DM3A 1MZBA 2R7LA 5FLXL 4B3RQ 3TIIA 2Q8IB 3K8AA 4A3GH 4C5CA 2KVMA 5KFNA 2PQEA 1C0AA 3E5SA 2V58A 3D6CA 3IFDA 4QWBA 3N41B 5JJIA 1S0MA 1A3VA 1WJJA 4R4TA 1O75A 3FDSA 4PZ6A 4HJAA 3GTGH 3A56A 4CDDC 4DKAC 5M5YH 5C4JB 4LMQD 2F4VH 3I72A 1VQLA 1QNKA 3TDQA 1RD9D 4DR5L 1TS3A 3VYTA 1FGUA 4JI4H 3RGXA 5C5JA 3EQLC 4JI7L 4YQWA 3KTMA 1EY8A 3MWYW 4K8IA 4KHZA 1QB5D 4OGQC 5LMNH 2FP4B 4L6TB 4U673 3SK5A 1QILA 2VPSA 4MV3A 2OEOA 5KFIA 3S1NH 2X6GA 4YCVA 4GOPB 3OHXC 1HR0H 5KFAA 3NXWA 1VQAA 5CC4A 3BVGA 2VUMH 4R7RA 4QWEA 2HHHH 1LTAD 1X3GA 4RGMA 3RV4A 1CT1D 1W3SA 4LF6Q 1UE7A 2J0TD 2A6ED 5KFDA 2EZVA 3S1QB 5CV7A 4MV6A 4DUZL 2BH2A 4IR9A 3F2UA 3HRZC 1JWSD 2EYFA 4MV9A 1CE8A 3W3AA 2X69A 3HOWB 3R8BA 2B63H 3SDZA 5LHY1 5BPFA 5JJZA 5BR8H 2CZGA 3EPIA 1STEA 2F0HA 4ZCKA 4IWXA 4OXPA 2NU9B 2R85A 1BBXC 2GVAA 3OW2A 2ZJPA 2UUCQ 2K28A 3CCRA 2QILA 2VUGA 5IGGA 1VKZA 3RZOB 2XRSD 1BCPD 2XGQA 2E2IA 1W2BA 4L5SA 4BWGB 4G7ZC 1IBMQ 2N55A 3PIPA 4A2AA 2JYOA 1VF7A 1B53A 5LMUQ 2XTIA 5EQ0A 5CV8A 3K5OA 2AWOA 1IW7C 2R8KA 2JEIA 3I3CA 4XT1B 1QVGA 2KJXA 1KRSA 2MO0A 4ULLA 3M9BA 4WRDA 3K0XA 2KUMA 1B1ZA 2ALZA 4JV0A 4MN3A 5GROA 2OTLA 2F4VQ 3HFZB 4ALPA 1M6VA 4UP7A 2AHOB 1BKBA 1YNND 2HCIA 4O1NA 1JOKA 5C4ZA 4XX0B 1F9QA 4KN4C 5LL6S 1I4HA 4UY8C 1I3QB 4RCOA 2L12A 4OHJA 4A3IH 1VBHA 5ELBA 4E4TA 2HDLA 2WE6A 4R4OA 2HQLA 4A3GG 1UC9A 1S72A 4LH7A 3I4NB 1EY6A 3I90A 3NTHA 1EWHA 1SE8A 1JJ2A 2F0LA 2IP4A 4IFDI 1YITA 3BS1A 1W93A 1HNZL 4YY3H 1EUJA 1PRTB 5J22A 1EQVA 4QIWE 3F2CA 2YYZA 1IBLQ 2XSCA 3A7LA 5BN4A 2ICIA 2FHTA 5CV4A 1Y1WB 2UXDQ 1ZQ7A 1EQQA 2UXDH 2F0VA 2PPBC 2JA6B 3T1YH 2UUAL 1N33L 1X6OA 5IP7H 3FKIH 5ELNA 2H4OA 2HQEA 4OX9L 1EYGA 3NE5B 3SEBA 3PZPA 4JC0A 2WFWA 1K8MA 5EPKA 3T4AC 1K8GA 4OEMB 5KT6A 4BXXG 4JUZA 4J9NA 4IRDA 1F2MA 4JI0Q 3E9HA 3QOLA 1RJRA 3FHWA 3RLOA 4H7BA 1V51A 3Q8PB 3OHBA 4AQYH 1SYGA 1AP0A 2AUJD 4EBEA 3GO5A 3R93A 4CKBA 2I5LX 4APVA 1TU2B 2PI2E 4HNTA 1GSOA 4LJZC 3T1HQ 2NU6B 2CH4A 4ME5A 5JJKA 1HUMA 1VAJA 5DM63 1HNXH 4IUPA 4IFDG 2UVWA 3OWEB 1KJ8A 2NVXH 4FO2A 3CKIB 1Y8OB 1NTGA 1EFID 2N78A 3TP7A 4JBKA 4TV9F 4ECXA 4M1UB 3HOUG 1WTOA 1N32L 4YP3A 3PR5B 3V96A 4JI3H 2GPSA 1A6XA 3I4MH 1C30A 1F9PA 2IL8A 2NVTH 2J9GA 2EOTA 5KFGA 5D14A 1NE3A 4N8FA 4IJLA 4XYMB 4J9MA 2AU0A 3VA5A 3SK8A 3BZDB 2W6PA 3NUCA 3BG5A 4B3SH 1IKLA 3VR6A 4L5RC 4B3TQ 3PW7A 3VPCA 3BJYA 1VQGA 4HAEA 5FK9C 4DF7A 2B2UC 3D4DA 3UE0A 3S9WA 4A3BH 3H0GA 3EFXD 1TA8A 1HNXQ 2QGQA 1JJCB 4DFAA 4DUZQ 2KEDA 3BQ1A 1R4QB 4IALA 2R93G 1NJIC 2C2DA 2EJGC 3SK4A 2Q2TA 4G7OC 2SNMA 4IOCA 1T5EA 3S15B 3D3RA 3CCUA 1R9TH 5I47A 3OUUA 1EWCA 2DJGC 5EBDA 1LTTD 5C6AA 4JV5Q 1Y1VA 1VQOA 3V4ZA 2D62A 3F8NA 4BY1G 4UHVA 1HNZQ 2Z6BA 4QIWB 2D0PA 3KLWA 1VQ5A 2FE3A 2L1BA 4ZLTF 4ECWA 3R5HA 4XDXA 2R3ZA 4A3FG 1PTOF 3JAMi 4WJWA 2FMAA 1II3A 1SMXA 4OO1H 5KFTA 2PO4A 4NKLA 1IBML 1VQHA 1S0OA 3A55A 5C3EB 2NVTB 3IFTA 3HOXH 3KFUA 2HVSA 4LFBQ 3N43B 1C4QA 1UEAB 1I3QH 1BBWA 2R93H 2A69C 1AUXA 4DUYQ 1UAPA 2OH2A 3HG9A 2QA4A 2XWBB 1TS5A 1EU4A 1V1PB 4QY7A 1GSHA 2KENA 1KQSA 2XD4A 5L1JA 1WCMA 1I7NA 1IXRA 4EBCA 3M9OB 4LF5H 2MCTA 3PQIA 2EVBA 2R7KA 2UXBQ 4YAJB 1N36Q 1B70B 4N8X1 2EIFA 5IWAH 4YHHL 2NU8B 5KFFA 1HFGA 3PW5A 4GLAC 4C1NK 4RA8A 2F0PA 1L2ZA 3GTPA 5KT2A 4H44C 4ECTA 1UE5A 4A3KH 4K5VA 5IYBH 2DY7A 2YU9H 4YCWA 4ME6A 4MV7A 3NQTA 1EYDA 1HR0W 3N6XA 4EFBA 3J81L 4DAYA 2J6TA 4M7EA 4HNVA 3NELA 2ASBA 2UUBH 5BN5A 4LF8L 3TIGA 5AJ3L 1JORA 1A2UA 2E5LQ 1Z2OX 1H9SB 2MPMA 3H0GG 5C5MA 1UNNC 2L0CA 2PYKA 3C2PA 4DR1H 2F0JA 1PFSA 4DR7H 2MQHA 3L9AX 1AN8A 4C3HB 3CRKC 1KRTA 5KFRA 2CH4W 4C5AA 4TQRA 2K01A 2Q2UA 5KFEA 2W8KA 4ED7A 2Z4IA 2JA6G 2PQAB 2XCPA 4GKKL 3RUPA 3H4DA 3V05A 1LO5D 4A3JG 1VQJA 5KT4A 3RGZA 1HUNA 1D5XC 1TWCA 2HIVA 4JI2Q 2IJ0A 4WJ3M 5EPLA 4FF4A 4B3TL 2PVPA 1PTOD 1RK6A 4PWQA 4JV5H 4BBSG 4RNMA 1JX4A 3BZCA 1QG7A 1I4QA 1DCZA 1A2TA 1HNXL 4LF4H 5EWEA 1RYSA 3KHLA 3Q8SB 3D31A 2LMCB 4OWXB 1EIYB 1EY4A 4BXXH 2HGSA 2JE6I 1TS2A 1TWGB 1PFNA 3K0YA 4DV5L 3OOCA 3L2PA 1YHQA 2R82A 4LFBH 4G4KA 4FF2A 2E75C 2WV6D 4B08A 2B8FA 1S0NA 3IG0A 2FMCA 1PH3A 4XYOA 4RHRA 1J6QA 1M4VA 1PMRA 3Q2OA 5KG6A 4J8QA 3TS2A 1SAPA 4HCEA 4DV6L 3A7AB 4DV7Q 4DR6H 4QGUA 3D4WA 3SHLA 1UE6A 4F50A 1LTRD 4JI3Q 1Y14B 2Q2IA 4CGYB 4IZOA 3S1NB 4DL6A 1YBYA 2RDGA 3RR5A 1MJEA 1GUNA 1OXXK 5IYZF 1LT5D 1EIFA 4ECYA 1CI3M 2RBMA 4MA5A 4KTAA 1S3OA 2K5WA 5AFWA 1B04A 5C0XI 5GADC 5FLXc 2SDFA 4DAYB 4YR0A 4O3SA 2W9CA 3ERQA 1VQDA 2RA4A 2WACA 1KC8C 1A3UA 4I4TF 3BQ0A 3EVQA 1CSPA 3L4KA 1XJVA 2YCHA 2DWCA 3HOVH 5EPJA 1LTGD 4R4QA 1HQRD 1U4MA 3M4OB 4XT3B 4F87A 1MI2A 4QWCA 1YZ6A 2ATWA 3PF4A 1ICFB 1STAA 1VMPA 4JI8Q 1PHJA 4PG3A 2VA3A 1E1TA 3H09A 2QYZA 2EYHA 1VQPA 3RZDH 2E74C 5GAGC 5KFVA 1O7LA 4C3JH 3QIAA 4IUVA 1X3EA 2L4NA 3NWTA 5DG8A 2QDLA 1Q86C 2W6NA 4IUQA 3GTKH 1PTOC 5C4XB 4ECVA 4I7ZC 3KF6A 2W7PA 2WAQE 4MV4A 3NTIA 2K05A 5I9PA 3G7LA 3GTQA 2K5NA 1E2ZA 1O7IA 4KD4A 1VQIA 2K52A 1CZWA 2YTYA 1VQEA 3UDXA 5IOCA 1IBKH 1AUVA 3R5FA 4YAKB 1AFPA 2E2IB 3I7FA 4DK6C 5IGEA 2AGPA 3NBHA 1VQCA 2VNUD 3GIJA 4XXEA 3P1HA 2YV5A 1JE5A 2MP1A 3J80i 2IX1A 1STBA 4QWAA 5ELCA 5M5YB 2A68D 2NVYB 4FBUA 2ID0A 5E1FA 4RGOS 1EY0A 3GIQA 2BOSA 3JAMc 1XPUA 5NUCA 2PCFB 3TINA 1PTOB 4BA1I 3V4SA 2MNAA 3TP8A 4P74A 5KNBA 3G6EA 1I6UA 5JPNC 2L11A 4RH6A 4O2DA 2PNRC 4YR3A 2JQOA 3FMAA 1VBGA 1G291 1LTID 3GTKB 2XIGA 2D9UA 3N40P 4EQNA 4LMYA 4DV6H 2RDHA 3N8DA 2CFMA 2CW0D 2KBNA 5CA0F 2R7ZG 4UDUC 4HJ5A 4NB3A 4K8JA 2J6SA 3QO2A 4UP8A 5I6YA 3M7NA 2HHHL 5C0XJ 3T1HH 5I2XA 1XPRA 1HR0L 1K83A 2EJMA 1XMOQ 4L63B 1GO3E 4ECUA 3JAML 3SGIA 3BYYB 2CWAA 3I12A 4JI3L 5KX5F 4O3NA 2F0WA 3CCQA 2BQUA 3Q8QB 1SYBA 1CSQA 3MFYA 1U9RA 2E2HA 2F0KA 4DR4Q 2LY7A 4BS9A 4DV2H 5FJ8G 4NXMQ 3M3YB 2NTTA 1NR4A 3C46A 3ULJA 1XNQQ 4DV2Q 3T5HA 2RF4A 4IHJF 2C35B 1QVFA 3HOZB 2B2WA 1RF2D 3T51B 3I4MB 3FVQA 4APMA 4JYAQ 4NP5A 4ABNA 1STGA 4LF6L 1T3NA 4ILWA 3E6ZX 1I4RA 3MR5A 2G9DA 1D5MC 2Z6KC 2OF1A 4QW9A 4AYBG 4ED8A 1EY9A 5IYCH 2YYAA 4PDBA 5IE8A 4DU9A 1D1KA 5IP9H 4B9XA 3NBHB 3GQBA 4TSSA 5IGDA 2E2JB 2FLPA 4JI5L 4HYKA 4RG1A 3K7AB 1PFMA 1I5FA 5KRUA 3J7A5 2AKWB 1K0SA 3UDFA 3UFXB 2I80A 1KBLA 1TWAB 2KHSA 2YZNA 3HKZB 5KFUA 5FJ8H 1EEID 3U9SA 1HCZA 4KI0A 2O4XA 4GC6A 4O3OA 1KDAA 3I4OA 2Q8TA 4A3DB 1G2SA 2PMZB 3C0FB 3A8IE 5DQIA 4KJNA 4BBRB 2RHQB 4XYLB 2UU9H 5HBRB 5IT9L 2DPIA 1Q12A 2UXDL 4GOPC 1IW7D 1Z2NX 1FKAH 2UU9Q 3VR2A 3PO2H 4EGQA 3RLNA 1H9RA 1L0WA 2UUAQ 1MBYA 1PH9A 1FNVA 4A3DH 3F2DA 2R7MA 4MZ9A 5KFSA 3J7ZC 3LNNA 2B2YA 2VS1A 1SFOB 2EE1A 1BNCA 3A74A 3NK9A 4ZKCB 1CS0A 4ZRZA 2WAQA 4YWLA 1KABA 3R2TA 4RMFA 3KJPA 5I2YA 4IWYA 2K14A 3V6JA 2NUAB 1K83H 5BPHA 3K7UC 4A3FH 5BR8L 4R8IA 2V9WA 3P75A 2BE5C 2UXCL 2W70A 4MTKA 4JI1Q 4BY1H 2EYPA 3D8GA 1EYCA 4YJ2F 4K0KQ 5IYDG 1M8AA 3G71A 1EIGA 1NCVA 1SR3A 3QZ7A 1JXLA 1IBMH 1C3OA 2DNCA 4KMUC 4DR6L 1HZAA 2IHFA 3KBGA 2B63G 3JZIA 4NXMH 3WWVA 5C3EG 3URYA 3KHHA 1GLVA 4MV8A 1I4GA 1IBLL 2K5VA 3HOUH 1VQ7A 1J5EQ 3SK6A 3OW7A 1TWFH 5CMDA 1N32Q 3DHQA 5CB4F 1R9TB 1TWAH 1VF5C 2F0EA 5C44H 1N33Q 1ENCA 1SLJA 1TY0A 4QF4A 1BCPB 3CHBD 4A3FB 5KT5A 1HZCA 2A5HA 3OUZA 4X65H 2FFKB 1M1KC 2JA5B 2R6FA 4TQUS 4O4IF 4YBZB 2RDJA 2AWNA 1CQIB 3M4PA 4KD3A 4A2BA 2EXZA 5CYUA 2H1EA 2XCAA 1LUZA 1XNRL 4OWWB 3I73A 2EQSA 4O3QA 3KDFB 4TKOB 1ULZA 3M4IA 1EZ6A 1N32H 1V8QA 1SYCA 3RBDA 3U58A 1PH2A 5JVH3 3QFFA 3CCSA 3PMFA 3MR6A 1WSCA 3FKIB 2ZM6L 2PMZA 5IY0A 4A3EH 4L8JA 1J8IA 3CPFA 2L15A 3PR4A 1RIPA 4WFN3 3FPPA 3T56B 3HOWH 5EZYF 3CVZA 3S1RB 2VA2A 2EY1A 1H9KA 3RUZA 3TZUA 3OTOQ 4POGA 3GTLB 1B4OA 3CCVA 1I6HB 4BBSH 1N34H 1B44D 4IRCA 4GZYC 1DONA 1EU3A 5KFXA 3CPWA 3RNUA 4YJ3F 3PO2G 3GTKA 5KG3A 2XGPA 2EYLA 1CQJB 4Y7NB 2PNHA 1OXUA 2VUMB 1Y8NB 1RTNA 2UXBL 4NXML 2FLLA 4J6HA 4KN7C 3MA2B 5KFZA 4YHHQ 1Y69U 2LXJA 3CMAA 1EUDB 4ED0A 2HCCA 3MFIA 1KXLA 3CF5A 2F0UA 4A3KG 2M00A 1WCMB 5ISRA 3HKSA 3M3YH 1GHKA 3PO3B 4YB8B 4HNUA 4CBVA 4LSXA 4KK7A 3UDGA 2D5DA 1IBKL 1UUPA 3FRPB 5KFMA 3MZ5A 3NHHA 1KJQA 4K0KL 3H15A 4MAMA 2VL6A 3N6RA 3K59A 2K04A 2JN4A 1FGBD 1VQKA 3I4NG 2YS6A 3DF7A 4RAYA 2L5TA 3EROA 1GUGA 2NN6H 4BA2I 5E3FA 4XIGS 1SNDA 4DGZA 1Z6HA 4CJ1B 5LL6X 4RB1A 1U0LA 1UEBA 2E5LL 3OHAA 4A93G 1W96A 4Q8EA 5JOBA 5EWGA 1S4ZA 1X65A 3IKJA 1X9NA 3FP9A 4I7AA 3T13A 2EPBA 3GILA 4I65A 3CQZB 1HNZH 1GOZA 1SMYC 1LT6D 1NMGA 2KA7A 3PF5A 3S2DH 2YRXA 1RK5A 3WOEA 2R92B 1VQ8A 3TZDA 2UU9L 2B2TC 1N34L 3PO2B 2PZWA 3HEJA 3KLRA 4DNTB 2C2RA 4KY6A 2A19A 2XCLA 3H91A 1BUVT 1RKNA 1ILPA 4CHTB 1CKMA 3NBIA 3WDNA 4EYHB 1E22A 1M0TA 1XTCD 4FS1A 2HVRA 1DJRD 4Y7NH 4JPBW 4CDCC 4JOIA 2K32A 4DK1A 1ESFA 2OTJA 1SNOA 3VPDA 1TWHH 1EOTA 3WNZA 1Q1BA 4AYBE 4A3LH 1ET6A 4F4ZA 3QOJA 3I2ZA 1PRTC 2V5AA 1UNSA 4MNOA 2I0QA 3S17H 2SEBD 4OO1I 2WAQB 4KHPL 2I87A 1PA6A 4Q44A 4CKCA 3VA7A 2VQDA 4MTNA 4A3BG 3GTGA 4UP9A 4CKEA 2L55A 2JA7A 1DOMA 2YL2A 3GTQB 1A9XA 4JVZA 5M3FH 3GTOB 2I8CA 4C3IG 1S40A 4X65L 2CHBD 4MV1A 4DV3H 1PLFA 2I5MX 3J81c 3W1GA 1HQMC 1TS4A 2IMWP 3J7AV 4DV6Q 1BR9A 1PH7A 1ESRA 5FPOA 1JCKB 4JG2A 3P20A 1EY5A 4CDEC 4KY5A 1CHPD 4IURA 2W9AA 1Q3LA 4OIJA 2O03A 2WYOA 2XN9C 4FNFA 2UUBQ 4OX9Q 3RB0A 2JA7B 1IBLH 5EGTA 2I46A 3BJUA 2F0MA 2EYOA 3FEWX 3J7AF 2QKIC 4X3SA 2JP1A 4XQQA 3F2BA 4TRDA 1GM5A 1Z2PX 1WTRA 2JEFA 3ULLA 3B6YA 2TSSA 2E2IH 1Y1VH 5FKAC 2VW9A 2MJ8A 2F0IA 5LXTF 2VB2X 3MXUA 3K57A 5T1GA 1K73C 1NAPA 4O4HF 3M9NB 4AH6A 3K5MA 5E7NA 4A93H 4HIOA 4IFDH 1F2LA 2C22A 1RJPA 2RDIA 1RCVD 1I94Q 3D0FA 1H95A 1IZ6A 4QL5A 2X6LA 3G6VA 2YTVA 3CCLA 1K3RA 1GVPA 5A2QE 2JA6A 2A6HD 3U9OA 4ZOLF 4LF4Q 5C8YF 4BY7H 5J39A 1ONLA 1O7YA 4KKTA 4EQPA 4J9SA 3RLFA 5CA1F 2D2CC 3ORQA 1CUKA 3I70A 3T5KA 2K33A 1H9SA 2R92A 3NPPA 4LF7L 4ECRA 2CQOA 3PGZA 1SEBD 1PYSB 4R9WA 4LF7H 4LW1A 3DWAA 5IWAL 1DM0B 1WD1A 3K5IA 2A74C 1SMYD 1JMCA 3GIIA 4HJ9A 1N34Q 1OXSC 5KFHA 1SRUA 3QR8A 3LGJA 1XMQQ 2RSOA 5DLQE 5C4XH 1MGSA 3MFGA 3LMLA 4P71A 1JDBB 3GD7A 3P7JA 2K5HA 1GYFA 3OSNA 1B33N 3RZOH 4OWTB 2IT1A 2BA0A 1PTOH 3EJIA 4H0LC 4EQOA 1TWCB 3UE1A 3Q23A 1Q81C 1HFNA 4LUVA 3Q8RB 2NU7B 3PUZA 2F4IA 4P75A 4J1MA 4K5XA 4FXKC 5FPRA 2Y0SG 5LMNW 3OMCA 2Z1CA 4V0BA 4HJ8A 3BG3A 4LF6H 4LH6A 4YIJA 3LP8A 5D3IB 4KLKA 4WJ4A 1TY2A 2M05A 1XWEA 2C00A 2ALYB 1Q46A 4K6LA 4IRKA 4O4LF 4A3IG 3M9MB 1Z47A 2I5HA 4X65Q 1TWCH 1WTHA 4UCUA 1SEIA 4Y8VB 3NTKA 4IJHA 5L1IA 3KHRA 3LWUA 4J9QA 3KF6B 4G57A 5LMNQ 4A3GB 3RMHA 5LA6F 4R8UB 4DV5H 1E3PA 4I7HA 5JQWA 3GIPA 3I8ZA 3CRLC 1W6JA 2JA8H 2V59A 1ILQA 3GIDA 1DV1A 2F0DA 2XRQD 3FKIA 5A35A 2MHVA 1ZYRD 1WTWA 1PYWD 1KNAA 3T5JA 1DYQA 2V1CC 5CV5A 3H6MA 4IPCA 4B3SL 4Q0YA 4Q8FA 4X64Q 2NN6I 2WDTA 3RN2A 5L37A 3H0GB 4RUAA 2RGVA 3H94A 1EEFD 4WD3A 4HQ6A 4UCVA 1A15A 2DNEA 4A3LG 3S14H 5KFCA 4O0AA 3EYYA 3OWFA 1EYAA 5KEEA 4ED3A 2B2WC 3BDOA 2ZTEA 5KG1A 2FPPB 4LFCH 2N3SA 4DR5H 2JXMB 3K5LA 4P73A 4Q5VA 4LFCL 5KT3A 2K03A 2LXKA 4X3KA 1KJ9A 2PN1A 4C3JB 4DUYL 2N88A 1BBUA 1XMOL 4RAUC 4GNXC 4O3PA 3SI8A 4DNIA 1SYXB 4Q45A 3S15H 2E8GA 2KECA 4GKJL 3RV3A 1BOSA 3BZKA 3CXCA 4EGVA 1Y1WH 4G7HC 1YNXA 1HA5A 5JEAG 1IKMA 2VQEQ 2JA7G 2ICEC 1YNNC 2TMPA 2IA6A 1XMQL 1SBBB 3PIP3 3ER0A 5I4DA 2R7ZA 2N49A 4ECZA 3TQYA 1KNEA 4DN4M 1ZXTA 3F8TA 2HDMA 4JK1C 2VQFL 5CORA 1QVCA 3KOJA 5BR8Q 2KEEA 4HIKA 4JV2A 3E9IA 1I4PA 2W9CB 5DQGA 1U4LA 4DA2A 3G4SA 1PH4A 1SNCA 2FINB 4DV0L 3MXGA 1PYBA 5ELOA 3V2TA 5D1OB 3RB6A 5G3LD 4Q0FA 3FKIG 2F0NA 2IX0A 3NP8A 2JA5H 2PI2A 1G6PA 5KKNB 3W5OA 3S1MH 2YU9A 1KAWA 2MFIA 2BR0A 4L1KA 1F2YA 1E2VA 4B3ML 1CK1A 1Y8PB 1WTVA 3HP3A 1PFBA 2NZHA 1B2TA 1VQMA 1B9MA 3DWQA 2QEJC 3JAME 5T1IA 2C5CA 5FLXE 2ES2A 4HEDA 4NPSA 1Q82C 2YS7A 2XGTA 2X0SA 5KFQA 2SOBA 1E4FT 2F0FA 4FM9A 1E4EB 3NEMA 4PQXA 1RDPD 2NB0A 4HSPA 5LL6b 1AZPA 4TV8F 3J81E 1WCMH 3AMUA 4RGNA 3J80E 4A3KB 4RZRA 1CQFA 1KEEA 3ND9A 3BAAA 3GTJH 2RKSA 2RHSB 2DN8A 1XNRQ 3KBXA 3TBIB 5KYIA 3MC0B 4DUYH 5CAEB 1XNRH 3J7AK 4C2MA 1VQFA 1I50B 3JAMW 1E7ZA 1TQOA 1E4EA 5M3MG 5KNCA 5CV6A 3OPOA 3DM1A 4B3RH 5IGBA 1DZ1A 2DPJA 1PH5A 2W6ZA 5H1SE 3C3LA 3S24A 2YTXA 3JSNA 4LFAQ 3OTOH 1BCPF 4IAJA 2CWPA 1S03G 2PQAA 3PUXA 1O80A 2F1MA 3R3OA 1PX2A 1PRTF 3OTOL 4DR6Q 1WCMG 1JICA 1I50H 2EY5A 3PUYA 2ZT9C 3PVXA 1SFOH 3HOYB 2ASLA 5HURA 4RU9A 1CFMA 1QUQA 1IL2A 4GKKH 5C4HA 4X62Q 4OIKA 5IP7G 2HJWA 3H3VC 4EG0A 1D5ZC 1CM9A 3ETJA 5KFKA 1NR2A 4AIMA 1UC8A 4BBRH 5JH7F 4DR1L 2UVVA 2MGSA 1YJ9A 2MO1A 3IRBA 4RB3C 2EDGA 3U9TA 5C44G 5KFJA 4JW0A 2VQEL 2H5XA 3E3XA 2FXQA 5JVLA 1I3QA 3U50C 1PZJD 2R7ZB 2ZJTA 4U68A 5L9XA 1K3BC 5JAVA 1N33H 3K7AH 3BA9A 4J9OA 3M4QA 2VPQA 3ETHA 1O78A 3T16A 1LTBD 4K14A 2FPIB 3HBLA 2I07B 4DAPA 3L3OC 3KUPA 3T53B 2GLTA 3WOFA 1TVXA 4A3BB 4DV0Q 3W2DA 1DXMA 5FO9B 3M4OH 4A3MH 1V1QA 4QCLA 2V4RA 4IUTA 3HOXG 4EEYA 4LUZA 2F0GA 3GV5B 4LF5L 2K75A 5F2DA 4DV1H 5K2MA 3EBEA 3CCJA 1PH1A 2J6UA 5D8DA 2Z6KA 1K1SA 3RF2A 1I4XA 5IIFA 4QUFA 4AQYQ 5C4JH 4X3UA 4DR4L 3JRXA 3BVMA 1YHAA 2JA9A 2VZAA 2AMCB 2CW8A 2FJZA 1CHQD 3RFCA 3DWPA 1IOVA 4ZKBB 1QZGA 1B50A 4EFEA 4IOAA 1YNJC 4JYAL 4X6AH 2GPWA 2UXBH 4E6IA 4GKJH 2JEBI 2XVSA 3L0OA 4JI5H 1LACA 3H3VH 4HIDA 2HIXA 2J4XA 3G48A 3SR1A 2F3WA 3EN2A 3CCMA 4DV4H 1AH9A 3TQ1A 4RCNA 4GOPA 2FKLA 2Z0SA 4R1JA 1WD0A 1PXUA 1DIKA 2R8IA 2ENBA 5K5PA 4H13C 4ED6A 4BWSC 1OTCA 4EGJA 2GVBA 3KLSX 4DK3C 5K36H 2VXWA 2IBKA 1MKHA 1J9OA 2KOLA 2ZJQA 2AQ4A 4PV1C 4WORA 4JYAH 1AW7A 2HHHQ 3RD4A 5ELDA 4KY7A 4PMCA 1GHJA 4ETSA 1YIJA 2B63B 4GC7A 3PN1A 4RB2C 1XXGA 4NMZA 4H02A 2UVRA 1KD1C 1OXTA 2LKVA 2LSSA 4A3CG 1B9NA 1RODA 3MWEA 2BQRA 3S1MB 2IWHA 3S1RH 2E2JH 2V4QA 4HTHA 4CC5A 1NNXA 1WH2A 3BDLA 2GA4B 4YR2A 5CBAE 3C1FA 4R4CA 4IPDA 2WKCA 3NSWA 5FO8B 1I6VC 3LX0A 3RB4A 1X3QA 1VQNA 2UUCH 2XWJB 3NGDA 3MVVA 3K3PA 2JA5A 2DJFC 5KFPA 1Q1EA 2BH8A 4L5TA 1EZ1A 1N8RC 2E76C 1J5EH 2C2EA 3RZDB 4A3EG 4F4YA 5J1ZA 1Y1VG 3GP7A 1SE3A 4A76A 1FJGL 1N56A 1VCIA 2HVQA 4DV3L 4LF4L 4LF9L 1SJED 4JV5L 1SXTA 1B6SA 1JOOA 1I94L 1B3QA 5JEAH 1AE2A 2OQKA 5C1PA 4BBSB 2QDBA 3GTMH 1VS0A 4JBJA 4KKSA 2ZTDA 4LF8Q 1CKNB 2F52A 4LF7Q 3V6KA 3U4ZA 4LF5Q 3J80W 1Y1WA 2B39A 4K6DA 3CC2A 1EFWA 2EXDA 5FLMH 4DR7L 3CP0A 2WKDA 2B63A 4ZUJA 4C3IH 4FBTA 3PUWA 3X3MA 2UUAH 4GS3A 3T1YL 4NW2A 1WYDA 1Q8IA 4ID6A 4GKKQ 4KHVA 2UUBL 1XX8A 5GAEC 2VUMG 2KHIA 2K7VA 2R8HA 3E0EA 5I9OA 4WBNF 4J9KA 1HRJA 4HCSA 1P8LA 2IX3A 1ENFA 2UXCQ 4TUYF 4DL3A 1SFOA 4YY3L 5J2UF 3SVMA 5DGAA 1EL0A 4GNXA 2FMMA 5JEAJ 3N42B 1TIID 4KJOA 3A5UA 1Q8KA 4Q43A 1HPCA 3PW2A 2K4KA 3RAXA 1NMFA 3OYYA 3AU7A 1M0WA 1CTMA 1EUCB 5IT9E 5DM73 1JB7A 1V1PA 3RIZA 2BCOA 1L2FA 1XTDA 1HZBA 2K6AA 3HS0C 3VYRA 5AJ3Q 1I7LA 1S5ED 1YHBA 1QNUA 3O13A 5JPMC 3M85A 4J9PA 2LFNA 3K81C 1M90C 1D7QA 1TWAA 3VMMA 4QJFA 1BNZA 5C3WA 1QCBD 4X64H 4DAVA 3PO3G 2PW7A 2OQ0A 2JEGA 3KK7A 3N52A 1E4GT 1C7YA 4XQJA 2M2LA 2BQ3A 1L1OC 2EY2A 4ZK9B 1BCPC 1X55A 3MEHA 4I50F 1C48A 2RSNA 4HMJA 3HOVB 1SE2A 1YEZA 3DEPA 1WR2A 4MA0A 1L0XB 3MR3A 2KCNA 3AQQA 4BBRG 4ZQIA 4X64L 3WO0A 4GN3B 1JQYD 3G6JB 1NBWA 1G91A 5HY6A 1V9PA 2WB1B 5M3FB 1TWFA 3U4VA 2JA8B 4DV3Q 2A1AA 3K6OA 2C28A 5C1OA 3MWMA 1K8OA 3VYSA 2CW0C 4MTDA 5JJLA 2AQ1B 2UUCL 3KHGA 3BQ2A 2G9HD 1SYEA 3GTLA 3CQZA 1WTQA 3LWBA 1MJCA 2BDOA 1GD7A 2KCMA 1LTLA 3J81j 3A8KE 3F1ZA 2VQEH 1KL9A 4RAZA 4Y52H 4POFA 4P2CB 4PZ8A 3HOWG 5HV6A 1X54A 1RYRA 5COYA 3D6WA 5LMUL 4JI8H 3A0JA 5LMNL 3I55A 4DPGA 2O5JC 1ZYRC 3T1YQ 2AGOA 2A73B 1EYZA 1BJTA 1L0YB 3NQIA 2WP8J 1LT3D 1NUCA 1ENAA 2R8GA 2EJFC 1PZKD 2NUCA 2O2LD 5ELFA 4DR2H 1WOCA 2F4VL 1I94H 4A3CH 3TN2A 4A4IA 3Q1KA 5CBEE 4NDXA 4B3SQ 4F4XA 2JSOA 4FYDA 2IY5B 2B29A 3M7GA 3PW0A 1IBKQ 4YY3Q 2V4DA 3K3VA 3FDTA 3ORRA 1B6RA 1SYDA 4UCRA 1FJGH 5IODA 1QOHA 1HNWL 5A2QL 3S17B 1IYUA 4JI8L 4KHPQ 5KFLA 3QZ8A 5LMUH 1A8VA 1R9TA 3GDEA 5M3FG 1DGSA 4X3TA 5KG2A 4DR3L 5KG0A 4ZI7F 1PH8A 2DUDA 3MXNA 1JR0D 2MUYA 1C8CA 3JC66 3Q22A 1EZ8A 3T1HL 1KDCA 1IYJB 3L7ZC 2JA5G 4ZUIA 1VQ6A 2NYZD 3KJOA 1UE1A 3H20A 2ATLA 2P5ZX 5KIXA 1OO9B 3GV6A 4DNRB 2QW7A 1C9OA 1M7JA 2CKZB 2OT2A 4GLXA 2NBFA 3Q0AA 4X66H 2FB9A 3PO3H 2F3VA 5K36G 4LFCQ 3ICEA 3VYUA 4PMWA 1RTOA 1QZHA 1ASYA 1S68A 3KALA 2WINB 2YU9B 5DAUA 4PNYA 1E24A 2JEJA 4DV4Q 5FLXW 3RN5A 3KDFA 5EWFA 4X62H 5KG4A 3IAYA 1SNMA 1S9FA 1SNPA 4IN3A 2R8JA 4IPHA 3KAKA 1TWHA 4ZQ3A 2KCCA 3H3VI 4RZQA 1WI5A 3HOYG 2O5IC 3QWNA 2CW7A 2VOBA 3DEOA 1Y1WG 5CGKA 2DZDA 3GV8B 1JOQA 3T5LA 4QB4A 1TWHB 4LFAH 2NVYH 1V4YA 2ZDHA 2W6OA 1K0RA 4U7CA 1HTLD 2VQFQ 2JA7H 1R4PB 2NTSA 1JLLB 5BMVF 1EHIA 1W6KA 4A3MG 4JI4Q 2YZMA 2VY3A 1Q7YC 5LP6F 2ZM6H 4O42A 3QB3A 5EOYA 4EQ5A 5D1PA 1D1IA 4HMIA 3TEHB 3UI2A 3CD6A 4R8NA 3I4NH 1A0IA 4OO1G 5BN3A 3VR3A 3MWDA 3GIKA 4DL2A 1EQRA 2XC9A 3GTQH 1MSGA 1HR0Q 3HKZA 3BU2A 5F9LA 3FMCA 4DR3H 1LV9A 3CQZH 2NVQH 3L4JA 2NZOA 2F3IA 4B3MQ 3GTPH 5T14A 2NVXB 3GTMA 1OXVA 4JCVE 2K5DA 1DV2A 5CR3A 2Q8RE 2B2VA 3QG1A 3KLSA 5IGFA 4IZ8A 1L1OB 4JI6L 2QEXA 3VR5A 1XNQL 1TT2A 4DV2L 1Z9FA 2ZXRA 4FVMA 1AZQA 2R93A 1JWMD 2A68C 3TRZA 3ITPA 4DR2L 1WTPA 3TP6A 4KV6A 5G3LF 1PV4A 3BYTB 4B3RL 2A6EC 3HOUB 4DAMA 1BVSA 2IHEA 2R84A 5A2QW 5EKIA 3K58A 1YJNA 1U5KA 4TVAB 1G2TA 4RUCA 1BDOA 1S5CD 2B2YC 5IYDH 3GIMA 2BDNA 3X3NA 1EQTA 1ZKOA 4LNQA 1JE4A 1O7ZA 2WB1G 1S5FD 5L1LA 4A3MB 2R92H 5IT9W 3SE7A 4RGTA 3CMEA 5FO7B 3Q24A 1STNA 3H40A 3TQTA 5L1KA 1PZID 1VQ4A 1S97A 3PV0A 2Z4HA 4FDBA 3ZYYX 1XDNA 2FK1A 2YRWA 5EKKA 1JDEA 1YVCA 3R5XA 2JA6H 4UAIA 2FPGB 5M5WH 4JI7Q 4C3HH 2F0SA 3TREA 4J9RA 3DMUA 3C1EA 1QUQB 2KQ3A 5IWAQ 1D6EC 2WAQG 2R7ZH 3HZXA 4AYBB 5M9OA 3IL8A 1KTKA 2W7OA 2JJQA 5KFWA 3V6HA 1TWFB 5C3XA 5IT9c 4A3JH 4O3RA 3K5HA 4TQSA 5DNFA 4DXFA 2R86A 1NSNS 4F4WA 4V190 4F8MA 2SCUB 1NY4A 2W6MA 1B8AA 3BVZA 4XYQA 4XZ3B 4HR7A 3JSLA 2NZ1D 1HH2P 1U4PA 1H9JA 3HB9A 1JT8A 5KFYA 4B3TH 5KNDA 5FD6A 2OXPA 4MHEA 1LLRD 2AQ2B 3I56A 1N36L 3GTOH 1HHVA 3TS0A 1SDFA 4HR7B 1EOVA 1QE6A 5C4XG 4JI1L 3NENA 5FOBB 2E2HB 2C9OA 5GONF 3K80C 1KAAA 1PDQA 3G6YA 4UCOA 4NXNL 4JBWA 4DL4A 4BY1B 2W9BA 1X32A 1PH6A 1T36A 1IL8A 3GTMB 4OELB 2QK4A 5M5XH 3J80c 3A8JE 5M5WB 5KFBA 4IPGA 2XNAC 4JI2H 2ZM6Q 3SXHA 2JK8A 2OCEA 2NVQB 4A3EB 1PRTD 2E2HH 3GQCA 1FR3A 4LUOA 1GSAA 1LM0A 2FLNA 2K1BA 3AB9A 2Y0SE 3EPGA 3AFPA 1SJHD 2W57A 1TXYA 4GKJQ 5C3EH 2Z9HA 1SYFA 1JB3A 4DV4L 4O2AF 2AGQA 2YW2A 1FL0A 2R87A 1JC7A 2UVUA 4YHHH 3UDIA 3HKZE 4JI6Q 3PCOB 4JI2L 4CDFC 3CC4A 4ED1A 5DLFA 1TKWB 3J7YW 2FJ2A 2PW5A 1JIHA 2IW3A 3I91A 3H4BA 1A3TA 3GV3A 4FXDA 4G3IA 4S3SA 3CC7A 2R92G 4LWCA 2BA1A 2BE5D 3GTLH 5KFOA 5DQHA 4EBDA 4NLGA 4K0KH 2Q2HA 1G8ZD 4K2LA 1XYIA 3ND8A 1BF4A 4X66Q 4QWDA 3ERSX 4CC6A 4DUZH 4JI1H 1N36H 2AUKA 4IFDJ 3BA8A 1GUTA 4JV1A 4DV1Q 1XMQH 4B9WA 3CCEA 1SROA 3MTSA 1MHWC 2W8LA 1T5XD 1KIXA 1DOLA 4DL7A 5FLMG 3GTJA 4EEQA 1HA6A 1YNJD 4J0MA 3HOZG 3A5ZB 4LK1C 5EJWA 1JJGA 3I4MG 1T9HA 1HNWH 4RKBA 4OL7A 3KAJA 3KF8B 1GUOA 4JI7H 3S2DB 1JKJB 2EYMA 1GUSA 2Y0SB 3MEFA 4K2KA 5HGQA 4UFZA 4DR4H 4A3JB 1E1OA 5EDWA 3RAQA 1N9WA 1RJTA 1EY7A 2FK2A 1TWGA 3MR2A 1STHA 1DOKA 1MD2D 3TSSA 5DGBA 4ZHQF 1ICWA 1TR5A 3EA6A 5C44B 3TMEA 1HZ9A 5M3MH 4DR2Q 3HKZG 1GUWA 1G51A 1QJOA 2B2TA 3PIOA 2ZXPA 1GGOA 4L5QA 2R61A 4J9LA 2JA8G 4C5BA 2ZXOA 1FJGQ 1ZHQA 1FVIA 2PZTA 2K50A 1SN8A 4NXNQ 4I55F 3HOVG 4P72A 4LF9Q 4N9PA 4JOIC 4MTEA 1CZGA 2M9VA 3S14B 1KJJA 3IN5A 2LS01 3HOYH 2N8NA 1CQVA 4RB0A 3RB3A 1F9RA 3STBC 4YWMA 2NN6G 2CVRA 1WTXA 2NWGA 2ZTCA 2G5DA 1KJIA 2B3GA 1HJPA 3CW2C 5E4WC 5FD5A 4R8UA 4DV7H 3MXPA 5I6WA 5TSSA 3W1BA 1LT4D 4BY7B 2CQYA 4DR1Q 2ZJRA 1Q90A 1SE4A 1IHZA 3GTPB 2CQAA 3RTXA 2VB3X 4M8AA 2F0TA 2L9HA 2WTFA 3VPBA 4K5WA 2W71A 1FYCA 1YI2A 1AE3A 1VMCA 4RWSC 2DIKA 4IR1A 1ZETA 2E2DC 4A93B 3AEVA 2K5QA 5ELEA 1HTPA 1WFQA 1P16A 1D8LA 4RHSA 3DLLA 5JVG3 3KXYT 3R2IA 5LYJF 2QF7A 4N9TA 2ZDGA 3R23A 4MIUA 4OONA 1CA6A 4PZ7A 4XTCS 4CJ2C 5IGCA 1BO0A 2DGYA 4DK0A 4X66L 5IP9G 2PMZE 4PMBA 4LFAL 1IOWA 2P0AA 3E5NA 1ML0D 4UCTA 4RNNA 1A63A 1RL2A 3I4LA 3OSPA 2UXCH 1V1OA 4UPAA 4C2MH 4RNOA 5EKLA 2VUMA 2AQ3B 3MHBA 4DV1L 2RGRA 4ECQA 3LWEA 5M5XB 4AYBA 1BGWA 2NVXA 4FF3A 1S5BD 3RJ0A 5D3DA 5F9NA 1STYA 3MJFA 1S5DD 1V43A 1K83B 5C0XG 1AEXA 4LFBL 1MSHA 4LSAA 4X62L 4DV0H 4QW8A 2HT1A 1KC7A 2WB1E 4QMGA 4FU0A 5GAHC 2VR1A 3MAQA 1B3AA 5KG5A 2JEAI 2KCTA 4YCUA 3OIQA 4UCSA 4RKLA 4FP5D 4LAAA 2J7ZA 4EX5A 1SNQA 3K5NA 3GTJB 4M9UA 1AN7A 2ZDQA 3ONAB 3CU7A 4ME3A 3S16B 5KT7A 2KHJA 1FD7D 3GV7B 1GXDC 3E0JA 1XPOA 3DUZA 2RQXA 4JBMA 5DEHA 1H9MA 3OIPA 2W6QA 4A3IB 1DD2A 5D1OA 4ZYSA 1X56A 1T94A 5J3BA 4KHPH 5D65A 1ZEQX 3G8CA 3STBD 1GJXA 3J81i 4IUNA 1B7YB 5C5LA 2NVYA 5JUMA 4FS2A 2GN5A 2R93B 3GLKA 1K8AC 4C56C 1CKOA 1VDZA 1XMOH 3AFQA 1HXYD 1PK8A 1QWYA 2B2VC 4DXGA 1JWUD 5GQOA 3BABA 1L1OA 2F0QA 3DXJC 5EAYA 5HGTA 4FXGC 4JI5Q 4LF8H 4F7XA 3NWSA 1UWVA 1SSOA 1SCUB 2YZGA 2R7FA 5E4XA 1Z7TA 3Q6SA 4DR5Q 5LOVF 5EBCA 4HJ7A 4LF9H 1LYLA 2B2UA 2Y0SA 1N48A 2PZUA 1XNQH 4RFBA 1GKHA 2R7NA 4JI6H 3HOZH 5J2TF 1CKNA 3KF8A 2R6GA 3TP5A 4QIWA 5DG9A 5M3MB 3J80L 4AQYL 2CCZA 1RJQA 2OLSA 1K9MC 2KSWA 4R4IA 1KHIA 1Y1VB 2RCFA 3N44B 3FPUB 4QQBX 4XQNA 1J5EL 1G6ZA 5H80A 4ODGA 2QCPX 3WO1A 3G6XA 1E2WA 1K1QA 2EY6A 3PSIA 3Q8DA 3MXNB 5KGUA 3GTOA 4C2MB 1WVLA 1LABA 2B8GA 2RCNA 3BDCA 4A75A 1IYVA 1KLUD 2E5LH 3PUVA 3GTGB 4OX9H 4GNXB 4O2BF 4F88A 4FF1A 4HIMA 5DG7A 4CJ0B 1RHPA 3OMGA 4HSVA 2DY8A 3EIVA 2HD3A 4A3DG 3S1QH 3J81W 4GLVB 3ULPA 5CV9A 4J15A 4DV5Q 1KDBA 1KLGD 2PBZA 4C3JG 5JVDF 3RBEA 2Z8LA 4C1NI 2A8VA 3VDYA 3HXLA 3PIO3 4GN4B 4ED2A 1FNWA 3S16H 1F2ZA 1F77A 3VR4A 3HGBA 2R7DA 4ZAIA 4IUUA 4C3HG 1HNWQ 4DL5A 2ASDA 4EVOA 1FNUA 4B3MH 1D2BA 4JI4L 1OWTA 3AYHB 1BXTA 1VQBA 1ET9A 2A6HC 4KKUA 2SNSA 4DR3Q 3KYHC 4QUCA 3MFHA 1MIUA 5IYBG 4ECSA 3PW4A 4HN7A 1A62A 5C0XH 1EIHA 2FK3A 1U4RA 1LTSD 3UQ8A 1ZHSA 4Z9CB 3S2HH 1I6HH 4YWKA 1TAEA 4U6PA 4DR7Q 1ASZA 1YJWA 2DLNA 1EWIA 4IQZA 5KYLA 5DLGA 2EYJA 2WIIB 4DV7L 4IO9A 1F9SA 5IYCG 3H0GH 1S10A 3M4YA 4EYIB 3A54A 2F0OA 3D4RA 3SE0A 3S2HB 2XIWA 1X3PA 1I50A 2IPKD 1X3FA 3HOXB 3CAMA 1TWGH 2OWOA 4BY7G 5KG7A 3JRWA 2VQFH 3OSOA 1CA5A 1PVOA 2A69D 1K28A 2W9BB 2WB1A 2D0OA 4JI0H 1BQQT 2HUGA 2RVLA 1E0BA 3QJYA 4GN5A 1VQ9A 2F03A 4JI0L 2ASJA 2RDFA 4NXNH 1BXRA
chains in the Genus database with same CATH topology
3ZJYC 3DM3A 1G291 4IPHA 4B3RQ 3K8AA 2CFMA 4DUYL 1BBUA 1XMOL 4GNXC 4A3GH 2KBNA 4DNIA 3H3VI 4HJ5A 2R7ZG 4NB3A 3S15H 1WI5A 3HOYG 2E8GA 4GKJL 4UP8A 1C0AA 3M7NA 1Y1WG 2HHHL 5C0XJ 5JJIA 3BZKA 3CXCA 1Y1WH 1XPRA 1HR0L 1WJJA 1YNXA 4R4TA 1XMOQ 2NVYH 1GO3E 4PZ6A 5JEAG 4HJAA 2VQEQ 5M5YH 2JA7G 4DKAC 3GTGH 1K0RA 3SGIA 2VQFQ 2CWAA 2JA7H 4JI3L 1XMQL 1VQLA 3ER0A 3CCQA 2N49A 4DR5L 3TQYA 4A3MG 4JI4Q 1CSQA 2VY3A 1Q7YC 1FGUA 3F8TA 4DR4Q 2VQFL 1QVCA 5FJ8G 4NXMQ 3KOJA 4EQ5A 5BR8Q 4JI7L 3ULJA 1XNQQ 3TEHB 4DV2Q 2RF4A 3CD6A 2C35B 4KHZA 4HIKA 1QVFA 1A0IA 3E9IA 3I4NH 4OO1G 3G4SA 1PH4A 4JYAQ 1EQRA 4DV0L 3GTQH 4LF6L 1HR0Q 3BU2A 1PYBA 5ELOA 3S1NH 4YCVA 4GOPB 2Z6KC 3FKIG 2IX0A 2VUMH 1VQAA 4AYBG 3CQZH 2NVQH 5IYCH 2NZOA 2JA5H 1X3GA 2F3IA 4B3MQ 3GTPH 2PI2A 5IE8A 1G6PA 1OXVA 1W3SA 3NBHB 4JCVE 1UE7A 3W5OA 5IP9H 4LF6Q 3S1MH 4JI5L 1KAWA 4RG1A 2MFIA 1I5FA 4DUZL 2BH2A 3J7A5 2AKWB 1L1OB 3UDFA 4B3ML 2QEXA 4JI6L 1XNQL 4DV2L 1Z9FA 2NZHA 2B63H 1VQMA 5FJ8H 2ES2A 4NPSA 3TRZA 4DR2L 4OXPA 1Q82C 2XGTA 4KI0A 4B3RL 1PV4A 2GVAA 3I4OA 3NEMA 4DAMA 3OW2A 2ZJPA 1BVSA 2IHEA 2UUCQ 3CCRA 1YJNA 1U5KA 4TVAB 2RHQB 1WCMH 1Q12A 2UXDL 4GOPC 5IYDH 2UU9Q 3PO2H 1W2BA 4L5SA 3RLNA 4LNQA 1L0WA 1IBMQ 3PIPA 3GTJH 2WB1G 1PH9A 2RHSB 2UUAQ 1XNRQ 2R92H 4A3DH 3F2DA 4MZ9A 5LMUQ 3J7ZC 3CMEA 2VS1A 2XTIA 1VQFA 3A74A 1E7ZA 4YWLA 1VQ4A 5M3MG 3PV0A 2AWOA 4FDBA 4RMFA 3KJPA 2K14A 1YVCA 2JA6H 1K83H 1QVGA 1PH5A 3K7UC 5H1SE 1KRSA 2MO0A 5M5WH 5BR8L 4A3FH 3M9BA 3S24A 4JI7Q 2YTXA 3K0XA 4LFAQ 3TREA 4C3HH 2UXCL 2CWPA 2PQAA 3PUXA 4JI1Q 4BY1H 1QUQB 5GROA 5IWAQ 2OTLA 2F4VQ 2WAQG 3HFZB 4ALPA 2R7ZH 3OTOL 4K0KQ 5IYDG 4UP7A 4DR6Q 2AHOB 1BKBA 2JJQA 1WCMG 5IT9c 4A3JH 1I50H 3PUYA 3G71A 1SFOH 4UY8C 1SR3A 1QUQA 4A3IH 1IL2A 4DR6L 1NY4A 1B8AA 4X62Q 5IP7G 4R4OA 2HQLA 4A3GG 1S72A 1HZAA 2IHFA 2B63G 1HH2P 1SE8A 3WWVA 5C3EG 4AIMA 1JT8A 1JJ2A 4IFDI 4BBRH 1YITA 4DR1L 3I56A 1YJ9A 1N36L 1HNZL 3GTOH 2MO1A 3TS0A 1IBLL 5C4XG 1EOVA 2K5VA 3IRBA 4JI1L 3HOUH 1EUJA 5C44G 1VQ7A 1J5EQ 2VQEL 2H5XA 3NENA 1TWFH 2FXQA 1N32Q 3K80C 4QIWE 3U50C 3F2CA 2YYZA 1IBLQ 1TWAH 4NXNL 4JBWA 5C44H 1N33Q 1SLJA 2UXDQ 1PH6A 5M5XH 3J80c 1EQQA 3K7AH 1HZCA 3M4QA 4IPGA 2UUAL 2ZM6Q 1M1KC 2JK8A 1N33L 4TQUS 2OCEA 1X6OA 2E2HH 5IP7H 3FKIH 5ELNA 2AWNA 3M4PA 4DV0Q 4LUOA 4OX9L 1EYGA 1LM0A 4JC0A 2WFWA 4A3MH 1V1QA 3M4OH 2Y0SE 3HOXG 1K8GA 4LUZA 3AFPA 1LUZA 1XNRL 1TXYA 4GKJQ 4OWWB 5C3EH 4LF5L 2EQSA 4BXXG 3KDFB 4DV4L 4JI0Q 3E9HA 3FHWA 2K75A 3RLOA 1FL0A 3EBEA 3CCJA 1PH1A 3U58A 1PH2A 2Z6KA 3UDIA 3HKZE 3CCSA 4JI6Q 3PCOB 4JI2L 3GO5A 4AQYQ 3CC4A 2ZM6L 5IY0A 4A3EH 2I5LX 4APVA 3CPFA 2L15A 5C4JH 1RIPA 2PI2E 3HOWH 4DR4L 1YHAA 2JA9A 2VZAA 3OTOQ 3T1HQ 2AMCB 4POGA 5JJKA 3CC7A 3CCVA 2R92G 4BBSH 4LWCA 2BA1A 1QZGA 3GTLH 4IFDG 2Q2HA 3CPWA 3RNUA 4IOAA 2NVXH 4X66Q 3PO2G 4JYAL 4X6AH 3ERSX 2JEBI 2PNHA 3L0OA 1OXUA 4IFDJ 1NTGA 4HIDA 3H3VH 2HIXA 3G48A 2N78A 4JBKA 1N32L 4DV1Q 3EN2A 3HOUG 2UXBL 3CCMA 4NXML 1AH9A 3CCEA 1SROA 4GOPA 2Z0SA 3I4MH 4R1JA 4YHHQ 2LXJA 1KIXA 2NVTH 5FLMG 3CMAA 1NE3A 1KXLA 4IJLA 3CF5A 1OTCA 3HOZG 4A3KG 3A5ZB 2GVBA 3HKSA 3M3YH 1JJGA 3I4MG 1T9HA 4DK3C 3UDGA 4L5RC 3KF8B 4B3TQ 1MKHA 1IBKL 2ZJQA 1VQGA 4A3BH 3MEFA 3UE0A 2HHHQ 1VQ6A 5HGQA 4K0KL 3H15A 1HNXQ 2VL6A 1E1OA 2QGQA 1VQKA 3I4NG 1JJCB 1YIJA 1N9WA 4DUZQ 4BA2I 4XIGS 4H02A 2R93G 1KD1C 1U0LA 1OXTA 1UEBA 2LSSA 1NJIC 2E5LL 4A3CG 2Q2TA 4A93G 4IOCA 3S1RH 1X65A 3CCUA 1R9TH 2E2JH 1HZ9A 1X9NA 3FP9A 5M3MH 4DR2Q 3HKZG 1G51A 4JV5Q 3PIOA 1VQOA 4R4CA 4IPDA 2D62A 1NMGA 4BY1G 3PF5A 1HNZQ 1VQNA 3S2DH 2D0PA 3KLWA 4L5QA 1VQ5A 1VQ8A 2JA8G 4A3FG 3JAMi 2UU9L 1Q1EA 2BH8A 1SMXA 1FJGQ 1N34L 1FVIA 4L5TA 1N8RC 1VQHA 1IBML 2K50A 1SN8A 4NXNQ 3HOVG 2A19A 4A3EG 4P72A 1Y1VG 3HOXH 4LF9Q 3KFUA 4JOIC 4LFBQ 4A76A 1FJGL 1VCIA 1I3QH 1CKMA 1BBWA 1E22A 2N8NA 3HOYH 4DV3L 2R93H 4LF4L 4DUYQ 3STBC 4YWMA 2NN6G 2QA4A 4Y7NH 4LF9L 2ZTCA 4JOIA 4JV5L 4QY7A 2OTJA 2KENA 1KQSA 1I94L 2B3GA 1HJPA 1AE2A 1TWHH 2OQKA 3CW2C 1Q1BA 4AYBE 4A3LH 3GTMH 1IXRA 1VS0A 3I2ZA 4JBJA 2ZTDA 4MNOA 2I0QA 4LF8Q 1CKNB 2F52A 4LF7Q 3S17H 3U4ZA 3W1BA 4OO1I 2UXBQ 4LF5Q 4DR1Q 2ZJRA 4KHPL 1N36Q 1B70B 2EIFA 1PA6A 4YHHL 3CC2A 1EFWA 2EXDA 5FLMH 4DR7L 3CP0A 4MTNA 4A3BG 4UP9A 1AE3A 1YI2A 4C3IH 4GLAC 5M3FH 3PUWA 4GS3A 4X65L 3T1YL 1S40A 3AEVA 1UE5A 1WYDA 4A3KH 2I5MX 5IYBH 3W1GA 3J81c 4YCWA 2YU9H 4GKKQ 2UUBL 1HR0W 1WFQA 4DV6Q 5GAEC 1D8LA 1P16A 1PH7A 3DLLA 2VUMG 2KHIA 3NELA 4JG2A 2ASBA 3E0EA 4OONA 4PZ7A 4XTCS 4LF8L 5AJ3L 1P8LA 2DGYA 2UUBQ 2E5LQ 4LFAL 4X66L 5IP9G 2PMZE 2UXCQ 4OX9Q 4YY3L 3H0GG 3BJUA 1A63A 1RL2A 4UPAA 4C2MH 4GNXA 1PFSA 3F2BA 4DV1L 1GM5A 5JEAJ 2MQHA 3ULLA 1KRTA 3A5UA 3B6YA 2Q2UA 1Q8KA 1V43A 2E2IH 5C0XG 2PQAB 1Y1VH 2JA6G 4GKKL 4LFBL 4A3JG 1VQJA 2K4KA 2VW9A 4X62L 2HIVA 1NMFA 3OYYA 4JI2Q 1K73C 2HT1A 2WB1E 4WJ3M 5GAHC 4AH6A 5E7NA 1JB7A 4HIOA 4B3TL 4A93H 1L2FA 2KCTA 4YCUA 2JEAI 1XTDA 1HZBA 4BBSG 5AJ3Q 4EX5A 1YHBA 3BZCA 3D0FA 1I94Q 1IZ6A 4QL5A 3M85A 1H95A 1D7QA 2YTVA 3K81C 1K3RA 1GVPA 4ME3A 1M90C 1HNXL 2KHJA 3CCLA 3D31A 4QJFA 4OWXB 1EIYB 4BXXH 4LF4Q 1XPOA 2JE6I 4JBMA 3PO3G 4BY7H 2OQ0A 4DV5L 1C7YA 3RLFA 3L2PA 1YHQA 1X56A 5J3BA 1CUKA 1L1OC 1X55A 3STBD 3J81i 4LF7L 1B7YB 1PH3A 1J6QA 1YEZA 2CQOA 3PGZA 2GN5A 1K8AC 1PYSB 1CKOA 4LW1A 5IWAL 3AFQA 3TS2A 3AQQA 4DV6L 1JMCA 4DV7Q 5GQOA 1L1OA 4BBRG 5EAYA 4HJ9A 1N34Q 4QGUA 4JI5Q 4X64L 1OXSC 1UWVA 4GN3B 1UE6A 1SRUA 3LGJA 1XMQQ 4JI3Q 1Y14B 1NBWA 2Q2IA 2R7FA 5HY6A 1V9PA 5DLQE 4DR5Q 5C4XH 1YBYA 3RR5A 1MJEA 3U4VA 4HJ7A 4DV3Q 1LYLA 1OXXK 4P71A 3GD7A 2A1AA 1EIFA 1GKHA 2K5HA 3HOZH 1CKNA 3RZOH 1S3OA 2R6GA 4OWTB 2IT1A 4AQYL 2CCZA 5C0XI 5JJLA 2UUCL 2BA0A 5FLXc 4R4IA 5GADC 1KHIA 4DAYB 1K9MC 4JI4L 1VQDA 3UE1A 1Q81C 1KC8C 4LUVA 1MJCA 4QQBX 1GD7A 2KCMA 1LTLA 3PUZA 3J81j 1J5EL 3F1ZA 4P75A 1CSPA 1KL9A 2Y0SG 3PSIA 5LMNW 1XJVA 3Q8DA 3MXNB 3HOVH 4POFA 4Y52H 4R4QA 4PZ8A 2RCNA 3HOWG 4HJ8A 1X54A 4A75A 4KLKA 4WJ4A 3PUVA 5LMUL 4GNXB 3A0JA 1YZ6A 2ALYB 1Q46A 5LMNL 3I55A 2ATWA 3PF4A 4HIMA 4DPGA 4A3IG 4JI8Q 1Z47A 1PHJA 4PG3A 4A3DG 2I5HA 3EIVA 4X65Q 1E1TA 3T1YQ 3S1QH 1TWCH 4GLVB 3ULPA 4IJHA 4J15A 2WP8J 4DV5Q 1VQPA 3KF6B 3RZDH 5LMNQ 5GAGC 2A8VA 4C3JH 3VDYA 4GN4B 1E3PA 1X3EA 3S16H 1Q86C 1WOCA 2R7DA 3GTKH 2F4VL 2JA8H 4A3CH 4A4IA 4B3SQ 1HNWQ 2IY5B 3KF6A 2B29A 2WAQE 4YY3Q 1IBKQ 2K5NA 2V1CC 1O7IA 1VQIA 3AYHB 1VQBA 2K52A 2YTYA 4DR3Q 1VQEA 3UDXA 3KYHC 1MIUA 5IYBG 1A62A 4IPCA 4B3SL 1HNWL 3I7FA 4DK6C 4KHPQ 4JI8L 4X64Q 1A8VA 1VQCA 2NN6I 2VNUD 3GDEA 5M3FG 3S2HH 1I6HH 4YWKA 1DGSA 4DR7Q 1ASZA 4DR3L 2YV5A 1JE5A 1YJWA 1PH8A 2DUDA 1EWIA 3RN2A 3J80i 2IX1A 3JC66 3T1HL 4DV7L 1IYJB 3L7ZC 4IO9A 2JA5G 5IYCG 3KJOA 3H0GH 1UE1A 2ID0A 1C9OA 3S14H 2CKZB 4A3LG 4GLXA 1X3FA 3JAMc 1XPUA 4O0AA 3CAMA 1TWGH 2OWOA 3PO3H 4BY7G 4LFCQ 5K36G 4BA1I 3ICEA 1PVOA 2MNAA 4PMWA 2ZTEA 1QZHA 1ASYA 4P74A 3G6EA 2N3SA 1E24A 2D0OA 4P73A 4DV4Q 4GN5A 1VQ9A 4JI0L 3RN5A 4O2DA 3KDFA 4LFCL 2LXKA 2JQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZJY C;  3DM3 A;  1G29 1;  4IPH A;  4B3R Q;  3K8A A;  2CFM A;  4DUY L;  1BBU A;  1XMO L;  4GNX C;  4A3G H;  2KBN A;  4DNI A;  3H3V I;  4HJ5 A;  2R7Z G;  4NB3 A;  3S15 H;  1WI5 A;  3HOY G;  2E8G A;  4GKJ L;  4UP8 A;  1C0A A;  3M7N A;  1Y1W G;  2HHH L;  5C0X J;  5JJI A;  3BZK A;  3CXC A;  1Y1W H;  1XPR A;  1HR0 L;  1WJJ A;  1YNX A;  4R4T A;  1XMO Q;  2NVY H;  1GO3 E;  4PZ6 A;  5JEA G;  4HJA A;  2VQE Q;  5M5Y H;  2JA7 G;  4DKA C;  3GTG H;  1K0R A;  3SGI A;  2VQF Q;  2CWA A;  2JA7 H;  4JI3 L;  1XMQ L;  1VQL A;  3ER0 A;  3CCQ A;  2N49 A;  4DR5 L;  3TQY A;  4A3M G;  4JI4 Q;  1CSQ A;  2VY3 A;  1Q7Y C;  1FGU A;  3F8T A;  4DR4 Q;  2VQF L;  1QVC A;  5FJ8 G;  4NXM Q;  3KOJ A;  4EQ5 A;  5BR8 Q;  4JI7 L;  3ULJ A;  1XNQ Q;  3TEH B;  4DV2 Q;  2RF4 A;  3CD6 A;  2C35 B;  4KHZ A;  4HIK A;  1QVF A;  1A0I A;  3E9I A;  3I4N H;  4OO1 G;  3G4S A;  1PH4 A;  4JYA Q;  1EQR A;  4DV0 L;  3GTQ H;  4LF6 L;  1HR0 Q;  3BU2 A;  1PYB A;  5ELO A;  3S1N H;  4YCV A;  4GOP B;  2Z6K C;  3FKI G;  2IX0 A;  2VUM H;  1VQA A;  4AYB G;  3CQZ H;  2NVQ H;  5IYC H;  2NZO A;  2JA5 H;  1X3G A;  2F3I A;  4B3M Q;  3GTP H;  2PI2 A;  5IE8 A;  1G6P A;  1OXV A;  1W3S A;  3NBH B;  4JCV E;  1UE7 A;  3W5O A;  5IP9 H;  4LF6 Q;  3S1M H;  4JI5 L;  1KAW A;  4RG1 A;  2MFI A;  1I5F A;  4DUZ L;  2BH2 A;  3J7A 5;  2AKW B;  1L1O B;  3UDF A;  4B3M L;  2QEX A;  4JI6 L;  1XNQ L;  4DV2 L;  1Z9F A;  2NZH A;  2B63 H;  1VQM A;  5FJ8 H;  2ES2 A;  4NPS A;  3TRZ A;  4DR2 L;  4OXP A;  1Q82 C;  2XGT A;  4KI0 A;  4B3R L;  1PV4 A;  2GVA A;  3I4O A;  3NEM A;  4DAM A;  3OW2 A;  2ZJP A;  1BVS A;  2IHE A;  2UUC Q;  3CCR A;  1YJN A;  1U5K A;  4TVA B;  2RHQ B;  1WCM H;  1Q12 A;  2UXD L;  4GOP C;  5IYD H;  2UU9 Q;  3PO2 H;  1W2B A;  4L5S A;  3RLN A;  4LNQ A;  1L0W A;  1IBM Q;  3PIP A;  3GTJ H;  2WB1 G;  1PH9 A;  2RHS B;  2UUA Q;  1XNR Q;  2R92 H;  4A3D H;  3F2D A;  4MZ9 A;  5LMU Q;  3J7Z C;  3CME A;  2VS1 A;  2XTI A;  1VQF A;  3A74 A;  1E7Z A;  4YWL A;  1VQ4 A;  5M3M G;  3PV0 A;  2AWO A;  4FDB A;  4RMF A;  3KJP A;  2K14 A;  1YVC A;  2JA6 H;  1K83 H;  1QVG A;  1PH5 A;  3K7U C;  5H1S E;  1KRS A;  2MO0 A;  5M5W H;  5BR8 L;  4A3F H;  3M9B A;  3S24 A;  4JI7 Q;  2YTX A;  3K0X A;  4LFA Q;  3TRE A;  4C3H H;  2UXC L;  2CWP A;  2PQA A;  3PUX A;  4JI1 Q;  4BY1 H;  1QUQ B;  5GRO A;  5IWA Q;  2OTL A;  2F4V Q;  2WAQ G;  3HFZ B;  4ALP A;  2R7Z H;  3OTO L;  4K0K Q;  5IYD G;  4UP7 A;  4DR6 Q;  2AHO B;  1BKB A;  2JJQ A;  1WCM G;  5IT9 c;  4A3J H;  1I50 H;  3PUY A;  3G71 A;  1SFO H;  4UY8 C;  1SR3 A;  1QUQ A;  4A3I H;  1IL2 A;  4DR6 L;  1NY4 A;  1B8A A;  4X62 Q;  5IP7 G;  4R4O A;  2HQL A;  4A3G G;  1S72 A;  1HZA A;  2IHF A;  2B63 G;  1HH2 P;  1SE8 A;  3WWV A;  5C3E G;  4AIM A;  1JT8 A;  1JJ2 A;  4IFD I;  4BBR H;  1YIT A;  4DR1 L;  3I56 A;  1YJ9 A;  1N36 L;  1HNZ L;  3GTO H;  2MO1 A;  3TS0 A;  1IBL L;  5C4X G;  1EOV A;  2K5V A;  3IRB A;  4JI1 L;  3HOU H;  1EUJ A;  5C44 G;  1VQ7 A;  1J5E Q;  2VQE L;  2H5X A;  3NEN A;  1TWF H;  2FXQ A;  1N32 Q;  3K80 C;  4QIW E;  3U50 C;  3F2C A;  2YYZ A;  1IBL Q;  1TWA H;  4NXN L;  4JBW A;  5C44 H;  1N33 Q;  1SLJ A;  2UXD Q;  1PH6 A;  5M5X H;  3J80 c;  1EQQ A;  3K7A H;  1HZC A;  3M4Q A;  4IPG A;  2UUA L;  2ZM6 Q;  1M1K C;  2JK8 A;  1N33 L;  4TQU S;  2OCE A;  1X6O A;  2E2H H;  5IP7 H;  3FKI H;  5ELN A;  2AWN A;  3M4P A;  4DV0 Q;  4LUO A;  4OX9 L;  1EYG A;  1LM0 A;  4JC0 A;  2WFW A;  4A3M H;  1V1Q A;  3M4O H;  2Y0S E;  3HOX G;  1K8G A;  4LUZ A;  3AFP A;  1LUZ A;  1XNR L;  1TXY A;  4GKJ Q;  4OWW B;  5C3E H;  4LF5 L;  2EQS A;  4BXX G;  3KDF B;  4DV4 L;  4JI0 Q;  3E9H A;  3FHW A;  2K75 A;  3RLO A;  1FL0 A;  3EBE A;  3CCJ A;  1PH1 A;  3U58 A;  1PH2 A;  2Z6K A;  3UDI A;  3HKZ E;  3CCS A;  4JI6 Q;  3PCO B;  4JI2 L;  3GO5 A;  4AQY Q;  3CC4 A;  2ZM6 L;  5IY0 A;  4A3E H;  2I5L X;  4APV A;  3CPF A;  2L15 A;  5C4J H;  1RIP A;  2PI2 E;  3HOW H;  4DR4 L;  1YHA A;  2JA9 A;  2VZA A;  3OTO Q;  3T1H Q;  2AMC B;  4POG A;  5JJK A;  3CC7 A;  3CCV A;  2R92 G;  4BBS H;  4LWC A;  2BA1 A;  1QZG A;  3GTL H;  4IFD G;  2Q2H A;  3CPW A;  3RNU A;  4IOA A;  2NVX H;  4X66 Q;  3PO2 G;  4JYA L;  4X6A H;  3ERS X;  2JEB I;  2PNH A;  3L0O A;  1OXU A;  4IFD J;  1NTG A;  4HID A;  3H3V H;  2HIX A;  3G48 A;  2N78 A;  4JBK A;  1N32 L;  4DV1 Q;  3EN2 A;  3HOU G;  2UXB L;  3CCM A;  4NXM L;  1AH9 A;  3CCE A;  1SRO A;  4GOP A;  2Z0S A;  3I4M H;  4R1J A;  4YHH Q;  2LXJ A;  1KIX A;  2NVT H;  5FLM G;  3CMA A;  1NE3 A;  1KXL A;  4IJL A;  3CF5 A;  1OTC A;  3HOZ G;  4A3K G;  3A5Z B;  2GVB A;  3HKS A;  3M3Y H;  1JJG A;  3I4M G;  1T9H A;  4DK3 C;  3UDG A;  4L5R C;  3KF8 B;  4B3T Q;  1MKH A;  1IBK L;  2ZJQ A;  1VQG A;  4A3B H;  3MEF A;  3UE0 A;  2HHH Q;  1VQ6 A;  5HGQ A;  4K0K L;  3H15 A;  1HNX Q;  2VL6 A;  1E1O A;  2QGQ A;  1VQK A;  3I4N G;  1JJC B;  1YIJ A;  1N9W A;  4DUZ Q;  4BA2 I;  4XIG S;  4H02 A;  2R93 G;  1KD1 C;  1U0L A;  1OXT A;  1UEB A;  2LSS A;  1NJI C;  2E5L L;  4A3C G;  2Q2T A;  4A93 G;  4IOC A;  3S1R H;  1X65 A;  3CCU A;  1R9T H;  2E2J H;  1HZ9 A;  1X9N A;  3FP9 A;  5M3M H;  4DR2 Q;  3HKZ G;  1G51 A;  4JV5 Q;  3PIO A;  1VQO A;  4R4C A;  4IPD A;  2D62 A;  1NMG A;  4BY1 G;  3PF5 A;  1HNZ Q;  1VQN A;  3S2D H;  2D0P A;  3KLW A;  4L5Q A;  1VQ5 A;  1VQ8 A;  2JA8 G;  4A3F G;  3JAM i;  2UU9 L;  1Q1E A;  2BH8 A;  1SMX A;  1FJG Q;  1N34 L;  1FVI A;  4L5T A;  1N8R C;  1VQH A;  1IBM L;  2K50 A;  1SN8 A;  4NXN Q;  3HOV G;  2A19 A;  4A3E G;  4P72 A;  1Y1V G;  3HOX H;  4LF9 Q;  3KFU A;  4JOI C;  4LFB Q;  4A76 A;  1FJG L;  1VCI A;  1I3Q H;  1CKM A;  1BBW A;  1E22 A;  2N8N A;  3HOY H;  4DV3 L;  2R93 H;  4LF4 L;  4DUY Q;  3STB C;  4YWM A;  2NN6 G;  2QA4 A;  4Y7N H;  4LF9 L;  2ZTC A;  4JOI A;  4JV5 L;  4QY7 A;  2OTJ A;  2KEN A;  1KQS A;  1I94 L;  2B3G A;  1HJP A;  1AE2 A;  1TWH H;  2OQK A;  3CW2 C;  1Q1B A;  4AYB E;  4A3L H;  3GTM H;  1IXR A;  1VS0 A;  3I2Z A;  4JBJ A;  2ZTD A;  4MNO A;  2I0Q A;  4LF8 Q;  1CKN B;  2F52 A;  4LF7 Q;  3S17 H;  3U4Z A;  3W1B A;  4OO1 I;  2UXB Q;  4LF5 Q;  4DR1 Q;  2ZJR A;  4KHP L;  1N36 Q;  1B70 B;  2EIF A;  1PA6 A;  4YHH L;  3CC2 A;  1EFW A;  2EXD A;  5FLM H;  4DR7 L;  3CP0 A;  4MTN A;  4A3B G;  4UP9 A;  1AE3 A;  1YI2 A;  4C3I H;  4GLA C;  5M3F H;  3PUW A;  4GS3 A;  4X65 L;  3T1Y L;  1S40 A;  3AEV A;  1UE5 A;  1WYD A;  4A3K H;  2I5M X;  5IYB H;  3W1G A;  3J81 c;  4YCW A;  2YU9 H;  4GKK Q;  2UUB L;  1HR0 W;  1WFQ A;  4DV6 Q;  5GAE C;  1D8L A;  1P16 A;  1PH7 A;  3DLL A;  2VUM G;  2KHI A;  3NEL A;  4JG2 A;  2ASB A;  3E0E A;  4OON A;  4PZ7 A;  4XTC S;  4LF8 L;  5AJ3 L;  1P8L A;  2DGY A;  2UUB Q;  2E5L Q;  4LFA L;  4X66 L;  5IP9 G;  2PMZ E;  2UXC Q;  4OX9 Q;  4YY3 L;  3H0G G;  3BJU A;  1A63 A;  1RL2 A;  4UPA A;  4C2M H;  4GNX A;  1PFS A;  3F2B A;  4DV1 L;  1GM5 A;  5JEA J;  2MQH A;  3ULL A;  1KRT A;  3A5U A;  3B6Y A;  2Q2U A;  1Q8K A;  1V43 A;  2E2I H;  5C0X G;  2PQA B;  1Y1V H;  2JA6 G;  4GKK L;  4LFB L;  4A3J G;  1VQJ A;  2K4K A;  2VW9 A;  4X62 L;  2HIV A;  1NMF A;  3OYY A;  4JI2 Q;  1K73 C;  2HT1 A;  2WB1 E;  4WJ3 M;  5GAH C;  4AH6 A;  5E7N A;  1JB7 A;  4HIO A;  4B3T L;  4A93 H;  1L2F A;  2KCT A;  4YCU A;  2JEA I;  1XTD A;  1HZB A;  4BBS G;  5AJ3 Q;  4EX5 A;  1YHB A;  3BZC A;  3D0F A;  1I94 Q;  1IZ6 A;  4QL5 A;  3M85 A;  1H95 A;  1D7Q A;  2YTV A;  3K81 C;  1K3R A;  1GVP A;  4ME3 A;  1M90 C;  1HNX L;  2KHJ A;  3CCL A;  3D31 A;  4QJF A;  4OWX B;  1EIY B;  4BXX H;  4LF4 Q;  1XPO A;  2JE6 I;  4JBM A;  3PO3 G;  4BY7 H;  2OQ0 A;  4DV5 L;  1C7Y A;  3RLF A;  3L2P A;  1YHQ A;  1X56 A;  5J3B A;  1CUK A;  1L1O C;  1X55 A;  3STB D;  3J81 i;  4LF7 L;  1B7Y B;  1PH3 A;  1J6Q A;  1YEZ A;  2CQO A;  3PGZ A;  2GN5 A;  1K8A C;  1PYS B;  1CKO A;  4LW1 A;  5IWA L;  3AFQ A;  3TS2 A;  3AQQ A;  4DV6 L;  1JMC A;  4DV7 Q;  5GQO A;  1L1O A;  4BBR G;  5EAY A;  4HJ9 A;  1N34 Q;  4QGU A;  4JI5 Q;  4X64 L;  1OXS C;  1UWV A;  4GN3 B;  1UE6 A;  1SRU A;  3LGJ A;  1XMQ Q;  4JI3 Q;  1Y14 B;  1NBW A;  2Q2I A;  2R7F A;  5HY6 A;  1V9P A;  5DLQ E;  4DR5 Q;  5C4X H;  1YBY A;  3RR5 A;  1MJE A;  3U4V A;  4HJ7 A;  4DV3 Q;  1LYL A;  1OXX K;  4P71 A;  3GD7 A;  2A1A A;  1EIF A;  1GKH A;  2K5H A;  3HOZ H;  1CKN A;  3RZO H;  1S3O A;  2R6G A;  4OWT B;  2IT1 A;  4AQY L;  2CCZ A;  5C0X I;  5JJL A;  2UUC L;  2BA0 A;  5FLX c;  4R4I A;  5GAD C;  1KHI A;  4DAY B;  1K9M C;  4JI4 L;  1VQD A;  3UE1 A;  1Q81 C;  1KC8 C;  4LUV A;  1MJC A;  4QQB X;  1GD7 A;  2KCM A;  1LTL A;  3PUZ A;  3J81 j;  1J5E L;  3F1Z A;  4P75 A;  1CSP A;  1KL9 A;  2Y0S G;  3PSI A;  5LMN W;  1XJV A;  3Q8D A;  3MXN B;  3HOV H;  4POF A;  4Y52 H;  4R4Q A;  4PZ8 A;  2RCN A;  3HOW G;  4HJ8 A;  1X54 A;  4A75 A;  4KLK A;  4WJ4 A;  3PUV A;  5LMU L;  4GNX B;  3A0J A;  1YZ6 A;  2ALY B;  1Q46 A;  5LMN L;  3I55 A;  2ATW A;  3PF4 A;  4HIM A;  4DPG A;  4A3I G;  4JI8 Q;  1Z47 A;  1PHJ A;  4PG3 A;  4A3D G;  2I5H A;  3EIV A;  4X65 Q;  1E1T A;  3T1Y Q;  3S1Q H;  1TWC H;  4GLV B;  3ULP A;  4IJH A;  4J15 A;  2WP8 J;  4DV5 Q;  1VQP A;  3KF6 B;  3RZD H;  5LMN Q;  5GAG C;  2A8V A;  4C3J H;  3VDY A;  4GN4 B;  1E3P A;  1X3E A;  3S16 H;  1Q86 C;  1WOC A;  2R7D A;  3GTK H;  2F4V L;  2JA8 H;  4A3C H;  4A4I A;  4B3S Q;  1HNW Q;  2IY5 B;  3KF6 A;  2B29 A;  2WAQ E;  4YY3 Q;  1IBK Q;  2K5N A;  2V1C C;  1O7I A;  1VQI A;  3AYH B;  1VQB A;  2K52 A;  2YTY A;  4DR3 Q;  1VQE A;  3UDX A;  3KYH C;  1MIU A;  5IYB G;  1A62 A;  4IPC A;  4B3S L;  1HNW L;  3I7F A;  4DK6 C;  4KHP Q;  4JI8 L;  4X64 Q;  1A8V A;  1VQC A;  2NN6 I;  2VNU D;  3GDE A;  5M3F G;  3S2H H;  1I6H H;  4YWK A;  1DGS A;  4DR7 Q;  1ASZ A;  4DR3 L;  2YV5 A;  1JE5 A;  1YJW A;  1PH8 A;  2DUD A;  1EWI A;  3RN2 A;  3J80 i;  2IX1 A;  3JC6 6;  3T1H L;  4DV7 L;  1IYJ B;  3L7Z C;  4IO9 A;  2JA5 G;  5IYC G;  3KJO A;  3H0G H;  1UE1 A;  2ID0 A;  1C9O A;  3S14 H;  2CKZ B;  4A3L G;  4GLX A;  1X3F A;  3JAM c;  1XPU A;  4O0A A;  3CAM A;  1TWG H;  2OWO A;  3PO3 H;  4BY7 G;  4LFC Q;  5K36 G;  4BA1 I;  3ICE A;  1PVO A;  2MNA A;  4PMW A;  2ZTE A;  1QZH A;  1ASY A;  4P74 A;  3G6E A;  2N3S A;  1E24 A;  2D0O A;  4P73 A;  4DV4 Q;  4GN5 A;  1VQ9 A;  4JI0 L;  3RN5 A;  4O2D A;  3KDF A;  4LFC L;  2LXK A;  2JQO A; 
#chains in the Genus database with same CATH topology
 4C3I B;  4DLK A;  3ZJY C;  3DM3 A;  1MZB A;  2R7L A;  5FLX L;  4B3R Q;  3TII A;  2Q8I B;  3K8A A;  4A3G H;  4C5C A;  2KVM A;  5KFN A;  2PQE A;  1C0A A;  3E5S A;  2V58 A;  3D6C A;  3IFD A;  4QWB A;  3N41 B;  5JJI A;  1S0M A;  1A3V A;  1WJJ A;  4R4T A;  1O75 A;  3FDS A;  4PZ6 A;  4HJA A;  3GTG H;  3A56 A;  4CDD C;  4DKA C;  5M5Y H;  5C4J B;  4LMQ D;  2F4V H;  3I72 A;  1VQL A;  1QNK A;  3TDQ A;  1RD9 D;  4DR5 L;  1TS3 A;  3VYT A;  1FGU A;  4JI4 H;  3RGX A;  5C5J A;  3EQL C;  4JI7 L;  4YQW A;  3KTM A;  1EY8 A;  3MWY W;  4K8I A;  4KHZ A;  1QB5 D;  4OGQ C;  5LMN H;  2FP4 B;  4L6T B;  4U67 3;  3SK5 A;  1QIL A;  2VPS A;  4MV3 A;  2OEO A;  5KFI A;  3S1N H;  2X6G A;  4YCV A;  4GOP B;  3OHX C;  1HR0 H;  5KFA A;  3NXW A;  1VQA A;  5CC4 A;  3BVG A;  2VUM H;  4R7R A;  4QWE A;  2HHH H;  1LTA D;  1X3G A;  4RGM A;  3RV4 A;  1CT1 D;  1W3S A;  4LF6 Q;  1UE7 A;  2J0T D;  2A6E D;  5KFD A;  2EZV A;  3S1Q B;  5CV7 A;  4MV6 A;  4DUZ L;  2BH2 A;  4IR9 A;  3F2U A;  3HRZ C;  1JWS D;  2EYF A;  4MV9 A;  1CE8 A;  3W3A A;  2X69 A;  3HOW B;  3R8B A;  2B63 H;  3SDZ A;  5LHY 1;  5BPF A;  5JJZ A;  5BR8 H;  2CZG A;  3EPI A;  1STE A;  2F0H A;  4ZCK A;  4IWX A;  4OXP A;  2NU9 B;  2R85 A;  1BBX C;  2GVA A;  3OW2 A;  2ZJP A;  2UUC Q;  2K28 A;  3CCR A;  2QIL A;  2VUG A;  5IGG A;  1VKZ A;  3RZO B;  2XRS D;  1BCP D;  2XGQ A;  2E2I A;  1W2B A;  4L5S A;  4BWG B;  4G7Z C;  1IBM Q;  2N55 A;  3PIP A;  4A2A A;  2JYO A;  1VF7 A;  1B53 A;  5LMU Q;  2XTI A;  5EQ0 A;  5CV8 A;  3K5O A;  2AWO A;  1IW7 C;  2R8K A;  2JEI A;  3I3C A;  4XT1 B;  1QVG A;  2KJX A;  1KRS A;  2MO0 A;  4ULL A;  3M9B A;  4WRD A;  3K0X A;  2KUM A;  1B1Z A;  2ALZ A;  4JV0 A;  4MN3 A;  5GRO A;  2OTL A;  2F4V Q;  3HFZ B;  4ALP A;  1M6V A;  4UP7 A;  2AHO B;  1BKB A;  1YNN D;  2HCI A;  4O1N A;  1JOK A;  5C4Z A;  4XX0 B;  1F9Q A;  4KN4 C;  5LL6 S;  1I4H A;  4UY8 C;  1I3Q B;  4RCO A;  2L12 A;  4OHJ A;  4A3I H;  1VBH A;  5ELB A;  4E4T A;  2HDL A;  2WE6 A;  4R4O A;  2HQL A;  4A3G G;  1UC9 A;  1S72 A;  4LH7 A;  3I4N B;  1EY6 A;  3I90 A;  3NTH A;  1EWH A;  1SE8 A;  1JJ2 A;  2F0L A;  2IP4 A;  4IFD I;  1YIT A;  3BS1 A;  1W93 A;  1HNZ L;  4YY3 H;  1EUJ A;  1PRT B;  5J22 A;  1EQV A;  4QIW E;  3F2C A;  2YYZ A;  1IBL Q;  2XSC A;  3A7L A;  5BN4 A;  2ICI A;  2FHT A;  5CV4 A;  1Y1W B;  2UXD Q;  1ZQ7 A;  1EQQ A;  2UXD H;  2F0V A;  2PPB C;  2JA6 B;  3T1Y H;  2UUA L;  1N33 L;  1X6O A;  5IP7 H;  3FKI H;  5ELN A;  2H4O A;  2HQE A;  4OX9 L;  1EYG A;  3NE5 B;  3SEB A;  3PZP A;  4JC0 A;  2WFW A;  1K8M A;  5EPK A;  3T4A C;  1K8G A;  4OEM B;  5KT6 A;  4BXX G;  4JUZ A;  4J9N A;  4IRD A;  1F2M A;  4JI0 Q;  3E9H A;  3QOL A;  1RJR A;  3FHW A;  3RLO A;  4H7B A;  1V51 A;  3Q8P B;  3OHB A;  4AQY H;  1SYG A;  1AP0 A;  2AUJ D;  4EBE A;  3GO5 A;  3R93 A;  4CKB A;  2I5L X;  4APV A;  1TU2 B;  2PI2 E;  4HNT A;  1GSO A;  4LJZ C;  3T1H Q;  2NU6 B;  2CH4 A;  4ME5 A;  5JJK A;  1HUM A;  1VAJ A;  5DM6 3;  1HNX H;  4IUP A;  4IFD G;  2UVW A;  3OWE B;  1KJ8 A;  2NVX H;  4FO2 A;  3CKI B;  1Y8O B;  1NTG A;  1EFI D;  2N78 A;  3TP7 A;  4JBK A;  4TV9 F;  4ECX A;  4M1U B;  3HOU G;  1WTO A;  1N32 L;  4YP3 A;  3PR5 B;  3V96 A;  4JI3 H;  2GPS A;  1A6X A;  3I4M H;  1C30 A;  1F9P A;  2IL8 A;  2NVT H;  2J9G A;  2EOT A;  5KFG A;  5D14 A;  1NE3 A;  4N8F A;  4IJL A;  4XYM B;  4J9M A;  2AU0 A;  3VA5 A;  3SK8 A;  3BZD B;  2W6P A;  3NUC A;  3BG5 A;  4B3S H;  1IKL A;  3VR6 A;  4L5R C;  4B3T Q;  3PW7 A;  3VPC A;  3BJY A;  1VQG A;  4HAE A;  5FK9 C;  4DF7 A;  2B2U C;  3D4D A;  3UE0 A;  3S9W A;  4A3B H;  3H0G A;  3EFX D;  1TA8 A;  1HNX Q;  2QGQ A;  1JJC B;  4DFA A;  4DUZ Q;  2KED A;  3BQ1 A;  1R4Q B;  4IAL A;  2R93 G;  1NJI C;  2C2D A;  2EJG C;  3SK4 A;  2Q2T A;  4G7O C;  2SNM A;  4IOC A;  1T5E A;  3S15 B;  3D3R A;  3CCU A;  1R9T H;  5I47 A;  3OUU A;  1EWC A;  2DJG C;  5EBD A;  1LTT D;  5C6A A;  4JV5 Q;  1Y1V A;  1VQO A;  3V4Z A;  2D62 A;  3F8N A;  4BY1 G;  4UHV A;  1HNZ Q;  2Z6B A;  4QIW B;  2D0P A;  3KLW A;  1VQ5 A;  2FE3 A;  2L1B A;  4ZLT F;  4ECW A;  3R5H A;  4XDX A;  2R3Z A;  4A3F G;  1PTO F;  3JAM i;  4WJW A;  2FMA A;  1II3 A;  1SMX A;  4OO1 H;  5KFT A;  2PO4 A;  4NKL A;  1IBM L;  1VQH A;  1S0O A;  3A55 A;  5C3E B;  2NVT B;  3IFT A;  3HOX H;  3KFU A;  2HVS A;  4LFB Q;  3N43 B;  1C4Q A;  1UEA B;  1I3Q H;  1BBW A;  2R93 H;  2A69 C;  1AUX A;  4DUY Q;  1UAP A;  2OH2 A;  3HG9 A;  2QA4 A;  2XWB B;  1TS5 A;  1EU4 A;  1V1P B;  4QY7 A;  1GSH A;  2KEN A;  1KQS A;  2XD4 A;  5L1J A;  1WCM A;  1I7N A;  1IXR A;  4EBC A;  3M9O B;  4LF5 H;  2MCT A;  3PQI A;  2EVB A;  2R7K A;  2UXB Q;  4YAJ B;  1N36 Q;  1B70 B;  4N8X 1;  2EIF A;  5IWA H;  4YHH L;  2NU8 B;  5KFF A;  1HFG A;  3PW5 A;  4GLA C;  4C1N K;  4RA8 A;  2F0P A;  1L2Z A;  3GTP A;  5KT2 A;  4H44 C;  4ECT A;  1UE5 A;  4A3K H;  4K5V A;  5IYB H;  2DY7 A;  2YU9 H;  4YCW A;  4ME6 A;  4MV7 A;  3NQT A;  1EYD A;  1HR0 W;  3N6X A;  4EFB A;  3J81 L;  4DAY A;  2J6T A;  4M7E A;  4HNV A;  3NEL A;  2ASB A;  2UUB H;  5BN5 A;  4LF8 L;  3TIG A;  5AJ3 L;  1JOR A;  1A2U A;  2E5L Q;  1Z2O X;  1H9S B;  2MPM A;  3H0G G;  5C5M A;  1UNN C;  2L0C A;  2PYK A;  3C2P A;  4DR1 H;  2F0J A;  1PFS A;  4DR7 H;  2MQH A;  3L9A X;  1AN8 A;  4C3H B;  3CRK C;  1KRT A;  5KFR A;  2CH4 W;  4C5A A;  4TQR A;  2K01 A;  2Q2U A;  5KFE A;  2W8K A;  4ED7 A;  2Z4I A;  2JA6 G;  2PQA B;  2XCP A;  4GKK L;  3RUP A;  3H4D A;  3V05 A;  1LO5 D;  4A3J G;  1VQJ A;  5KT4 A;  3RGZ A;  1HUN A;  1D5X C;  1TWC A;  2HIV A;  4JI2 Q;  2IJ0 A;  4WJ3 M;  5EPL A;  4FF4 A;  4B3T L;  2PVP A;  1PTO D;  1RK6 A;  4PWQ A;  4JV5 H;  4BBS G;  4RNM A;  1JX4 A;  3BZC A;  1QG7 A;  1I4Q A;  1DCZ A;  1A2T A;  1HNX L;  4LF4 H;  5EWE A;  1RYS A;  3KHL A;  3Q8S B;  3D31 A;  2LMC B;  4OWX B;  1EIY B;  1EY4 A;  4BXX H;  2HGS A;  2JE6 I;  1TS2 A;  1TWG B;  1PFN A;  3K0Y A;  4DV5 L;  3OOC A;  3L2P A;  1YHQ A;  2R82 A;  4LFB H;  4G4K A;  4FF2 A;  2E75 C;  2WV6 D;  4B08 A;  2B8F A;  1S0N A;  3IG0 A;  2FMC A;  1PH3 A;  4XYO A;  4RHR A;  1J6Q A;  1M4V A;  1PMR A;  3Q2O A;  5KG6 A;  4J8Q A;  3TS2 A;  1SAP A;  4HCE A;  4DV6 L;  3A7A B;  4DV7 Q;  4DR6 H;  4QGU A;  3D4W A;  3SHL A;  1UE6 A;  4F50 A;  1LTR D;  4JI3 Q;  1Y14 B;  2Q2I A;  4CGY B;  4IZO A;  3S1N B;  4DL6 A;  1YBY A;  2RDG A;  3RR5 A;  1MJE A;  1GUN A;  1OXX K;  5IYZ F;  1LT5 D;  1EIF A;  4ECY A;  1CI3 M;  2RBM A;  4MA5 A;  4KTA A;  1S3O A;  2K5W A;  5AFW A;  1B04 A;  5C0X I;  5GAD C;  5FLX c;  2SDF A;  4DAY B;  4YR0 A;  4O3S A;  2W9C A;  3ERQ A;  1VQD A;  2RA4 A;  2WAC A;  1KC8 C;  1A3U A;  4I4T F;  3BQ0 A;  3EVQ A;  1CSP A;  3L4K A;  1XJV A;  2YCH A;  2DWC A;  3HOV H;  5EPJ A;  1LTG D;  4R4Q A;  1HQR D;  1U4M A;  3M4O B;  4XT3 B;  4F87 A;  1MI2 A;  4QWC A;  1YZ6 A;  2ATW A;  3PF4 A;  1ICF B;  1STA A;  1VMP A;  4JI8 Q;  1PHJ A;  4PG3 A;  2VA3 A;  1E1T A;  3H09 A;  2QYZ A;  2EYH A;  1VQP A;  3RZD H;  2E74 C;  5GAG C;  5KFV A;  1O7L A;  4C3J H;  3QIA A;  4IUV A;  1X3E A;  2L4N A;  3NWT A;  5DG8 A;  2QDL A;  1Q86 C;  2W6N A;  4IUQ A;  3GTK H;  1PTO C;  5C4X B;  4ECV A;  4I7Z C;  3KF6 A;  2W7P A;  2WAQ E;  4MV4 A;  3NTI A;  2K05 A;  5I9P A;  3G7L A;  3GTQ A;  2K5N A;  1E2Z A;  1O7I A;  4KD4 A;  1VQI A;  2K52 A;  1CZW A;  2YTY A;  1VQE A;  3UDX A;  5IOC A;  1IBK H;  1AUV A;  3R5F A;  4YAK B;  1AFP A;  2E2I B;  3I7F A;  4DK6 C;  5IGE A;  2AGP A;  3NBH A;  1VQC A;  2VNU D;  3GIJ A;  4XXE A;  3P1H A;  2YV5 A;  1JE5 A;  2MP1 A;  3J80 i;  2IX1 A;  1STB A;  4QWA A;  5ELC A;  5M5Y B;  2A68 D;  2NVY B;  4FBU A;  2ID0 A;  5E1F A;  4RGO S;  1EY0 A;  3GIQ A;  2BOS A;  3JAM c;  1XPU A;  5NUC A;  2PCF B;  3TIN A;  1PTO B;  4BA1 I;  3V4S A;  2MNA A;  3TP8 A;  4P74 A;  5KNB A;  3G6E A;  1I6U A;  5JPN C;  2L11 A;  4RH6 A;  4O2D A;  2PNR C;  4YR3 A;  2JQO A;  3FMA A;  1VBG A;  1G29 1;  1LTI D;  3GTK B;  2XIG A;  2D9U A;  3N40 P;  4EQN A;  4LMY A;  4DV6 H;  2RDH A;  3N8D A;  2CFM A;  2CW0 D;  2KBN A;  5CA0 F;  2R7Z G;  4UDU C;  4HJ5 A;  4NB3 A;  4K8J A;  2J6S A;  3QO2 A;  4UP8 A;  5I6Y A;  3M7N A;  2HHH L;  5C0X J;  3T1H H;  5I2X A;  1XPR A;  1HR0 L;  1K83 A;  2EJM A;  1XMO Q;  4L63 B;  1GO3 E;  4ECU A;  3JAM L;  3SGI A;  3BYY B;  2CWA A;  3I12 A;  4JI3 L;  5KX5 F;  4O3N A;  2F0W A;  3CCQ A;  2BQU A;  3Q8Q B;  1SYB A;  1CSQ A;  3MFY A;  1U9R A;  2E2H A;  2F0K A;  4DR4 Q;  2LY7 A;  4BS9 A;  4DV2 H;  5FJ8 G;  4NXM Q;  3M3Y B;  2NTT A;  1NR4 A;  3C46 A;  3ULJ A;  1XNQ Q;  4DV2 Q;  3T5H A;  2RF4 A;  4IHJ F;  2C35 B;  1QVF A;  3HOZ B;  2B2W A;  1RF2 D;  3T51 B;  3I4M B;  3FVQ A;  4APM A;  4JYA Q;  4NP5 A;  4ABN A;  1STG A;  4LF6 L;  1T3N A;  4ILW A;  3E6Z X;  1I4R A;  3MR5 A;  2G9D A;  1D5M C;  2Z6K C;  2OF1 A;  4QW9 A;  4AYB G;  4ED8 A;  1EY9 A;  5IYC H;  2YYA A;  4PDB A;  5IE8 A;  4DU9 A;  1D1K A;  5IP9 H;  4B9X A;  3NBH B;  3GQB A;  4TSS A;  5IGD A;  2E2J B;  2FLP A;  4JI5 L;  4HYK A;  4RG1 A;  3K7A B;  1PFM A;  1I5F A;  5KRU A;  3J7A 5;  2AKW B;  1K0S A;  3UDF A;  3UFX B;  2I80 A;  1KBL A;  1TWA B;  2KHS A;  2YZN A;  3HKZ B;  5KFU A;  5FJ8 H;  1EEI D;  3U9S A;  1HCZ A;  4KI0 A;  2O4X A;  4GC6 A;  4O3O A;  1KDA A;  3I4O A;  2Q8T A;  4A3D B;  1G2S A;  2PMZ B;  3C0F B;  3A8I E;  5DQI A;  4KJN A;  4BBR B;  2RHQ B;  4XYL B;  2UU9 H;  5HBR B;  5IT9 L;  2DPI A;  1Q12 A;  2UXD L;  4GOP C;  1IW7 D;  1Z2N X;  1FKA H;  2UU9 Q;  3VR2 A;  3PO2 H;  4EGQ A;  3RLN A;  1H9R A;  1L0W A;  2UUA Q;  1MBY A;  1PH9 A;  1FNV A;  4A3D H;  3F2D A;  2R7M A;  4MZ9 A;  5KFS A;  3J7Z C;  3LNN A;  2B2Y A;  2VS1 A;  1SFO B;  2EE1 A;  1BNC A;  3A74 A;  3NK9 A;  4ZKC B;  1CS0 A;  4ZRZ A;  2WAQ A;  4YWL A;  1KAB A;  3R2T A;  4RMF A;  3KJP A;  5I2Y A;  4IWY A;  2K14 A;  3V6J A;  2NUA B;  1K83 H;  5BPH A;  3K7U C;  4A3F H;  5BR8 L;  4R8I A;  2V9W A;  3P75 A;  2BE5 C;  2UXC L;  2W70 A;  4MTK A;  4JI1 Q;  4BY1 H;  2EYP A;  3D8G A;  1EYC A;  4YJ2 F;  4K0K Q;  5IYD G;  1M8A A;  3G71 A;  1EIG A;  1NCV A;  1SR3 A;  3QZ7 A;  1JXL A;  1IBM H;  1C3O A;  2DNC A;  4KMU C;  4DR6 L;  1HZA A;  2IHF A;  3KBG A;  2B63 G;  3JZI A;  4NXM H;  3WWV A;  5C3E G;  3URY A;  3KHH A;  1GLV A;  4MV8 A;  1I4G A;  1IBL L;  2K5V A;  3HOU H;  1VQ7 A;  1J5E Q;  3SK6 A;  3OW7 A;  1TWF H;  5CMD A;  1N32 Q;  3DHQ A;  5CB4 F;  1R9T B;  1TWA H;  1VF5 C;  2F0E A;  5C44 H;  1N33 Q;  1ENC A;  1SLJ A;  1TY0 A;  4QF4 A;  1BCP B;  3CHB D;  4A3F B;  5KT5 A;  1HZC A;  2A5H A;  3OUZ A;  4X65 H;  2FFK B;  1M1K C;  2JA5 B;  2R6F A;  4TQU S;  4O4I F;  4YBZ B;  2RDJ A;  2AWN A;  1CQI B;  3M4P A;  4KD3 A;  4A2B A;  2EXZ A;  5CYU A;  2H1E A;  2XCA A;  1LUZ A;  1XNR L;  4OWW B;  3I73 A;  2EQS A;  4O3Q A;  3KDF B;  4TKO B;  1ULZ A;  3M4I A;  1EZ6 A;  1N32 H;  1V8Q A;  1SYC A;  3RBD A;  3U58 A;  1PH2 A;  5JVH 3;  3QFF A;  3CCS A;  3PMF A;  3MR6 A;  1WSC A;  3FKI B;  2ZM6 L;  2PMZ A;  5IY0 A;  4A3E H;  4L8J A;  1J8I A;  3CPF A;  2L15 A;  3PR4 A;  1RIP A;  4WFN 3;  3FPP A;  3T56 B;  3HOW H;  5EZY F;  3CVZ A;  3S1R B;  2VA2 A;  2EY1 A;  1H9K A;  3RUZ A;  3TZU A;  3OTO Q;  4POG A;  3GTL B;  1B4O A;  3CCV A;  1I6H B;  4BBS H;  1N34 H;  1B44 D;  4IRC A;  4GZY C;  1DON A;  1EU3 A;  5KFX A;  3CPW A;  3RNU A;  4YJ3 F;  3PO2 G;  3GTK A;  5KG3 A;  2XGP A;  2EYL A;  1CQJ B;  4Y7N B;  2PNH A;  1OXU A;  2VUM B;  1Y8N B;  1RTN A;  2UXB L;  4NXM L;  2FLL A;  4J6H A;  4KN7 C;  3MA2 B;  5KFZ A;  4YHH Q;  1Y69 U;  2LXJ A;  3CMA A;  1EUD B;  4ED0 A;  2HCC A;  3MFI A;  1KXL A;  3CF5 A;  2F0U A;  4A3K G;  2M00 A;  1WCM B;  5ISR A;  3HKS A;  3M3Y H;  1GHK A;  3PO3 B;  4YB8 B;  4HNU A;  4CBV A;  4LSX A;  4KK7 A;  3UDG A;  2D5D A;  1IBK L;  1UUP A;  3FRP B;  5KFM A;  3MZ5 A;  3NHH A;  1KJQ A;  4K0K L;  3H15 A;  4MAM A;  2VL6 A;  3N6R A;  3K59 A;  2K04 A;  2JN4 A;  1FGB D;  1VQK A;  3I4N G;  2YS6 A;  3DF7 A;  4RAY A;  2L5T A;  3ERO A;  1GUG A;  2NN6 H;  4BA2 I;  5E3F A;  4XIG S;  1SND A;  4DGZ A;  1Z6H A;  4CJ1 B;  5LL6 X;  4RB1 A;  1U0L A;  1UEB A;  2E5L L;  3OHA A;  4A93 G;  1W96 A;  4Q8E A;  5JOB A;  5EWG A;  1S4Z A;  1X65 A;  3IKJ A;  1X9N A;  3FP9 A;  4I7A A;  3T13 A;  2EPB A;  3GIL A;  4I65 A;  3CQZ B;  1HNZ H;  1GOZ A;  1SMY C;  1LT6 D;  1NMG A;  2KA7 A;  3PF5 A;  3S2D H;  2YRX A;  1RK5 A;  3WOE A;  2R92 B;  1VQ8 A;  3TZD A;  2UU9 L;  2B2T C;  1N34 L;  3PO2 B;  2PZW A;  3HEJ A;  3KLR A;  4DNT B;  2C2R A;  4KY6 A;  2A19 A;  2XCL A;  3H91 A;  1BUV T;  1RKN A;  1ILP A;  4CHT B;  1CKM A;  3NBI A;  3WDN A;  4EYH B;  1E22 A;  1M0T A;  1XTC D;  4FS1 A;  2HVR A;  1DJR D;  4Y7N H;  4JPB W;  4CDC C;  4JOI A;  2K32 A;  4DK1 A;  1ESF A;  2OTJ A;  1SNO A;  3VPD A;  1TWH H;  1EOT A;  3WNZ A;  1Q1B A;  4AYB E;  4A3L H;  1ET6 A;  4F4Z A;  3QOJ A;  3I2Z A;  1PRT C;  2V5A A;  1UNS A;  4MNO A;  2I0Q A;  3S17 H;  2SEB D;  4OO1 I;  2WAQ B;  4KHP L;  2I87 A;  1PA6 A;  4Q44 A;  4CKC A;  3VA7 A;  2VQD A;  4MTN A;  4A3B G;  3GTG A;  4UP9 A;  4CKE A;  2L55 A;  2JA7 A;  1DOM A;  2YL2 A;  3GTQ B;  1A9X A;  4JVZ A;  5M3F H;  3GTO B;  2I8C A;  4C3I G;  1S40 A;  4X65 L;  2CHB D;  4MV1 A;  4DV3 H;  1PLF A;  2I5M X;  3J81 c;  3W1G A;  1HQM C;  1TS4 A;  2IMW P;  3J7A V;  4DV6 Q;  1BR9 A;  1PH7 A;  1ESR A;  5FPO A;  1JCK B;  4JG2 A;  3P20 A;  1EY5 A;  4CDE C;  4KY5 A;  1CHP D;  4IUR A;  2W9A A;  1Q3L A;  4OIJ A;  2O03 A;  2WYO A;  2XN9 C;  4FNF A;  2UUB Q;  4OX9 Q;  3RB0 A;  2JA7 B;  1IBL H;  5EGT A;  2I46 A;  3BJU A;  2F0M A;  2EYO A;  3FEW X;  3J7A F;  2QKI C;  4X3S A;  2JP1 A;  4XQQ A;  3F2B A;  4TRD A;  1GM5 A;  1Z2P X;  1WTR A;  2JEF A;  3ULL A;  3B6Y A;  2TSS A;  2E2I H;  1Y1V H;  5FKA C;  2VW9 A;  2MJ8 A;  2F0I A;  5LXT F;  2VB2 X;  3MXU A;  3K57 A;  5T1G A;  1K73 C;  1NAP A;  4O4H F;  3M9N B;  4AH6 A;  3K5M A;  5E7N A;  4A93 H;  4HIO A;  4IFD H;  1F2L A;  2C22 A;  1RJP A;  2RDI A;  1RCV D;  1I94 Q;  3D0F A;  1H95 A;  1IZ6 A;  4QL5 A;  2X6L A;  3G6V A;  2YTV A;  3CCL A;  1K3R A;  1GVP A;  5A2Q E;  2JA6 A;  2A6H D;  3U9O A;  4ZOL F;  4LF4 Q;  5C8Y F;  4BY7 H;  5J39 A;  1ONL A;  1O7Y A;  4KKT A;  4EQP A;  4J9S A;  3RLF A;  5CA1 F;  2D2C C;  3ORQ A;  1CUK A;  3I70 A;  3T5K A;  2K33 A;  1H9S A;  2R92 A;  3NPP A;  4LF7 L;  4ECR A;  2CQO A;  3PGZ A;  1SEB D;  1PYS B;  4R9W A;  4LF7 H;  4LW1 A;  3DWA A;  5IWA L;  1DM0 B;  1WD1 A;  3K5I A;  2A74 C;  1SMY D;  1JMC A;  3GII A;  4HJ9 A;  1N34 Q;  1OXS C;  5KFH A;  1SRU A;  3QR8 A;  3LGJ A;  1XMQ Q;  2RSO A;  5DLQ E;  5C4X H;  1MGS A;  3MFG A;  3LML A;  4P71 A;  1JDB B;  3GD7 A;  3P7J A;  2K5H A;  1GYF A;  3OSN A;  1B33 N;  3RZO H;  4OWT B;  2IT1 A;  2BA0 A;  1PTO H;  3EJI A;  4H0L C;  4EQO A;  1TWC B;  3UE1 A;  3Q23 A;  1Q81 C;  1HFN A;  4LUV A;  3Q8R B;  2NU7 B;  3PUZ A;  2F4I A;  4P75 A;  4J1M A;  4K5X A;  4FXK C;  5FPR A;  2Y0S G;  5LMN W;  3OMC A;  2Z1C A;  4V0B A;  4HJ8 A;  3BG3 A;  4LF6 H;  4LH6 A;  4YIJ A;  3LP8 A;  5D3I B;  4KLK A;  4WJ4 A;  1TY2 A;  2M05 A;  1XWE A;  2C00 A;  2ALY B;  1Q46 A;  4K6L A;  4IRK A;  4O4L F;  4A3I G;  3M9M B;  1Z47 A;  2I5H A;  4X65 Q;  1TWC H;  1WTH A;  4UCU A;  1SEI A;  4Y8V B;  3NTK A;  4IJH A;  5L1I A;  3KHR A;  3LWU A;  4J9Q A;  3KF6 B;  4G57 A;  5LMN Q;  4A3G B;  3RMH A;  5LA6 F;  4R8U B;  4DV5 H;  1E3P A;  4I7H A;  5JQW A;  3GIP A;  3I8Z A;  3CRL C;  1W6J A;  2JA8 H;  2V59 A;  1ILQ A;  3GID A;  1DV1 A;  2F0D A;  2XRQ D;  3FKI A;  5A35 A;  2MHV A;  1ZYR D;  1WTW A;  1PYW D;  1KNA A;  3T5J A;  1DYQ A;  2V1C C;  5CV5 A;  3H6M A;  4IPC A;  4B3S L;  4Q0Y A;  4Q8F A;  4X64 Q;  2NN6 I;  2WDT A;  3RN2 A;  5L37 A;  3H0G B;  4RUA A;  2RGV A;  3H94 A;  1EEF D;  4WD3 A;  4HQ6 A;  4UCV A;  1A15 A;  2DNE A;  4A3L G;  3S14 H;  5KFC A;  4O0A A;  3EYY A;  3OWF A;  1EYA A;  5KEE A;  4ED3 A;  2B2W C;  3BDO A;  2ZTE A;  5KG1 A;  2FPP B;  4LFC H;  2N3S A;  4DR5 H;  2JXM B;  3K5L A;  4P73 A;  4Q5V A;  4LFC L;  5KT3 A;  2K03 A;  2LXK A;  4X3K A;  1KJ9 A;  2PN1 A;  4C3J B;  4DUY L;  2N88 A;  1BBU A;  1XMO L;  4RAU C;  4GNX C;  4O3P A;  3SI8 A;  4DNI A;  1SYX B;  4Q45 A;  3S15 H;  2E8G A;  2KEC A;  4GKJ L;  3RV3 A;  1BOS A;  3BZK A;  3CXC A;  4EGV A;  1Y1W H;  4G7H C;  1YNX A;  1HA5 A;  5JEA G;  1IKM A;  2VQE Q;  2JA7 G;  2ICE C;  1YNN C;  2TMP A;  2IA6 A;  1XMQ L;  1SBB B;  3PIP 3;  3ER0 A;  5I4D A;  2R7Z A;  2N49 A;  4ECZ A;  3TQY A;  1KNE A;  4DN4 M;  1ZXT A;  3F8T A;  2HDM A;  4JK1 C;  2VQF L;  5COR A;  1QVC A;  3KOJ A;  5BR8 Q;  2KEE A;  4HIK A;  4JV2 A;  3E9I A;  1I4P A;  2W9C B;  5DQG A;  1U4L A;  4DA2 A;  3G4S A;  1PH4 A;  1SNC A;  2FIN B;  4DV0 L;  3MXG A;  1PYB A;  5ELO A;  3V2T A;  5D1O B;  3RB6 A;  5G3L D;  4Q0F A;  3FKI G;  2F0N A;  2IX0 A;  3NP8 A;  2JA5 H;  2PI2 A;  1G6P A;  5KKN B;  3W5O A;  3S1M H;  2YU9 A;  1KAW A;  2MFI A;  2BR0 A;  4L1K A;  1F2Y A;  1E2V A;  4B3M L;  1CK1 A;  1Y8P B;  1WTV A;  3HP3 A;  1PFB A;  2NZH A;  1B2T A;  1VQM A;  1B9M A;  3DWQ A;  2QEJ C;  3JAM E;  5T1I A;  2C5C A;  5FLX E;  2ES2 A;  4HED A;  4NPS A;  1Q82 C;  2YS7 A;  2XGT A;  2X0S A;  5KFQ A;  2SOB A;  1E4F T;  2F0F A;  4FM9 A;  1E4E B;  3NEM A;  4PQX A;  1RDP D;  2NB0 A;  4HSP A;  5LL6 b;  1AZP A;  4TV8 F;  3J81 E;  1WCM H;  3AMU A;  4RGN A;  3J80 E;  4A3K B;  4RZR A;  1CQF A;  1KEE A;  3ND9 A;  3BAA A;  3GTJ H;  2RKS A;  2RHS B;  2DN8 A;  1XNR Q;  3KBX A;  3TBI B;  5KYI A;  3MC0 B;  4DUY H;  5CAE B;  1XNR H;  3J7A K;  4C2M A;  1VQF A;  1I50 B;  3JAM W;  1E7Z A;  1TQO A;  1E4E A;  5M3M G;  5KNC A;  5CV6 A;  3OPO A;  3DM1 A;  4B3R H;  5IGB A;  1DZ1 A;  2DPJ A;  1PH5 A;  2W6Z A;  5H1S E;  3C3L A;  3S24 A;  2YTX A;  3JSN A;  4LFA Q;  3OTO H;  1BCP F;  4IAJ A;  2CWP A;  1S03 G;  2PQA A;  3PUX A;  1O80 A;  2F1M A;  3R3O A;  1PX2 A;  1PRT F;  3OTO L;  4DR6 Q;  1WCM G;  1JIC A;  1I50 H;  2EY5 A;  3PUY A;  2ZT9 C;  3PVX A;  1SFO H;  3HOY B;  2ASL A;  5HUR A;  4RU9 A;  1CFM A;  1QUQ A;  1IL2 A;  4GKK H;  5C4H A;  4X62 Q;  4OIK A;  5IP7 G;  2HJW A;  3H3V C;  4EG0 A;  1D5Z C;  1CM9 A;  3ETJ A;  5KFK A;  1NR2 A;  4AIM A;  1UC8 A;  4BBR H;  5JH7 F;  4DR1 L;  2UVV A;  2MGS A;  1YJ9 A;  2MO1 A;  3IRB A;  4RB3 C;  2EDG A;  3U9T A;  5C44 G;  5KFJ A;  4JW0 A;  2VQE L;  2H5X A;  3E3X A;  2FXQ A;  5JVL A;  1I3Q A;  3U50 C;  1PZJ D;  2R7Z B;  2ZJT A;  4U68 A;  5L9X A;  1K3B C;  5JAV A;  1N33 H;  3K7A H;  3BA9 A;  4J9O A;  3M4Q A;  2VPQ A;  3ETH A;  1O78 A;  3T16 A;  1LTB D;  4K14 A;  2FPI B;  3HBL A;  2I07 B;  4DAP A;  3L3O C;  3KUP A;  3T53 B;  2GLT A;  3WOF A;  1TVX A;  4A3B B;  4DV0 Q;  3W2D A;  1DXM A;  5FO9 B;  3M4O H;  4A3M H;  1V1Q A;  4QCL A;  2V4R A;  4IUT A;  3HOX G;  4EEY A;  4LUZ A;  2F0G A;  3GV5 B;  4LF5 L;  2K75 A;  5F2D A;  4DV1 H;  5K2M A;  3EBE A;  3CCJ A;  1PH1 A;  2J6U A;  5D8D A;  2Z6K A;  1K1S A;  3RF2 A;  1I4X A;  5IIF A;  4QUF A;  4AQY Q;  5C4J H;  4X3U A;  4DR4 L;  3JRX A;  3BVM A;  1YHA A;  2JA9 A;  2VZA A;  2AMC B;  2CW8 A;  2FJZ A;  1CHQ D;  3RFC A;  3DWP A;  1IOV A;  4ZKB B;  1QZG A;  1B50 A;  4EFE A;  4IOA A;  1YNJ C;  4JYA L;  4X6A H;  2GPW A;  2UXB H;  4E6I A;  4GKJ H;  2JEB I;  2XVS A;  3L0O A;  4JI5 H;  1LAC A;  3H3V H;  4HID A;  2HIX A;  2J4X A;  3G48 A;  3SR1 A;  2F3W A;  3EN2 A;  3CCM A;  4DV4 H;  1AH9 A;  3TQ1 A;  4RCN A;  4GOP A;  2FKL A;  2Z0S A;  4R1J A;  1WD0 A;  1PXU A;  1DIK A;  2R8I A;  2ENB A;  5K5P A;  4H13 C;  4ED6 A;  4BWS C;  1OTC A;  4EGJ A;  2GVB A;  3KLS X;  4DK3 C;  5K36 H;  2VXW A;  2IBK A;  1MKH A;  1J9O A;  2KOL A;  2ZJQ A;  2AQ4 A;  4PV1 C;  4WOR A;  4JYA H;  1AW7 A;  2HHH Q;  3RD4 A;  5ELD A;  4KY7 A;  4PMC A;  1GHJ A;  4ETS A;  1YIJ A;  2B63 B;  4GC7 A;  3PN1 A;  4RB2 C;  1XXG A;  4NMZ A;  4H02 A;  2UVR A;  1KD1 C;  1OXT A;  2LKV A;  2LSS A;  4A3C G;  1B9N A;  1ROD A;  3MWE A;  2BQR A;  3S1M B;  2IWH A;  3S1R H;  2E2J H;  2V4Q A;  4HTH A;  4CC5 A;  1NNX A;  1WH2 A;  3BDL A;  2GA4 B;  4YR2 A;  5CBA E;  3C1F A;  4R4C A;  4IPD A;  2WKC A;  3NSW A;  5FO8 B;  1I6V C;  3LX0 A;  3RB4 A;  1X3Q A;  1VQN A;  2UUC H;  2XWJ B;  3NGD A;  3MVV A;  3K3P A;  2JA5 A;  2DJF C;  5KFP A;  1Q1E A;  2BH8 A;  4L5T A;  1EZ1 A;  1N8R C;  2E76 C;  1J5E H;  2C2E A;  3RZD B;  4A3E G;  4F4Y A;  5J1Z A;  1Y1V G;  3GP7 A;  1SE3 A;  4A76 A;  1FJG L;  1N56 A;  1VCI A;  2HVQ A;  4DV3 L;  4LF4 L;  4LF9 L;  1SJE D;  4JV5 L;  1SXT A;  1B6S A;  1JOO A;  1I94 L;  1B3Q A;  5JEA H;  1AE2 A;  2OQK A;  5C1P A;  4BBS B;  2QDB A;  3GTM H;  1VS0 A;  4JBJ A;  4KKS A;  2ZTD A;  4LF8 Q;  1CKN B;  2F52 A;  4LF7 Q;  3V6K A;  3U4Z A;  4LF5 Q;  3J80 W;  1Y1W A;  2B39 A;  4K6D A;  3CC2 A;  1EFW A;  2EXD A;  5FLM H;  4DR7 L;  3CP0 A;  2WKD A;  2B63 A;  4ZUJ A;  4C3I H;  4FBT A;  3PUW A;  3X3M A;  2UUA H;  4GS3 A;  3T1Y L;  4NW2 A;  1WYD A;  1Q8I A;  4ID6 A;  4GKK Q;  4KHV A;  2UUB L;  1XX8 A;  5GAE C;  2VUM G;  2KHI A;  2K7V A;  2R8H A;  3E0E A;  5I9O A;  4WBN F;  4J9K A;  1HRJ A;  4HCS A;  1P8L A;  2IX3 A;  1ENF A;  2UXC Q;  4TUY F;  4DL3 A;  1SFO A;  4YY3 L;  5J2U F;  3SVM A;  5DGA A;  1EL0 A;  4GNX A;  2FMM A;  5JEA J;  3N42 B;  1TII D;  4KJO A;  3A5U A;  1Q8K A;  4Q43 A;  1HPC A;  3PW2 A;  2K4K A;  3RAX A;  1NMF A;  3OYY A;  3AU7 A;  1M0W A;  1CTM A;  1EUC B;  5IT9 E;  5DM7 3;  1JB7 A;  1V1P A;  3RIZ A;  2BCO A;  1L2F A;  1XTD A;  1HZB A;  2K6A A;  3HS0 C;  3VYR A;  5AJ3 Q;  1I7L A;  1S5E D;  1YHB A;  1QNU A;  3O13 A;  5JPM C;  3M85 A;  4J9P A;  2LFN A;  3K81 C;  1M90 C;  1D7Q A;  1TWA A;  3VMM A;  4QJF A;  1BNZ A;  5C3W A;  1QCB D;  4X64 H;  4DAV A;  3PO3 G;  2PW7 A;  2OQ0 A;  2JEG A;  3KK7 A;  3N52 A;  1E4G T;  1C7Y A;  4XQJ A;  2M2L A;  2BQ3 A;  1L1O C;  2EY2 A;  4ZK9 B;  1BCP C;  1X55 A;  3MEH A;  4I50 F;  1C48 A;  2RSN A;  4HMJ A;  3HOV B;  1SE2 A;  1YEZ A;  3DEP A;  1WR2 A;  4MA0 A;  1L0X B;  3MR3 A;  2KCN A;  3AQQ A;  4BBR G;  4ZQI A;  4X64 L;  3WO0 A;  4GN3 B;  1JQY D;  3G6J B;  1NBW A;  1G91 A;  5HY6 A;  1V9P A;  2WB1 B;  5M3F B;  1TWF A;  3U4V A;  2JA8 B;  4DV3 Q;  2A1A A;  3K6O A;  2C28 A;  5C1O A;  3MWM A;  1K8O A;  3VYS A;  2CW0 C;  4MTD A;  5JJL A;  2AQ1 B;  2UUC L;  3KHG A;  3BQ2 A;  2G9H D;  1SYE A;  3GTL A;  3CQZ A;  1WTQ A;  3LWB A;  1MJC A;  2BDO A;  1GD7 A;  2KCM A;  1LTL A;  3J81 j;  3A8K E;  3F1Z A;  2VQE H;  1KL9 A;  4RAZ A;  4Y52 H;  4POF A;  4P2C B;  4PZ8 A;  3HOW G;  5HV6 A;  1X54 A;  1RYR A;  5COY A;  3D6W A;  5LMU L;  4JI8 H;  3A0J A;  5LMN L;  3I55 A;  4DPG A;  2O5J C;  1ZYR C;  3T1Y Q;  2AGO A;  2A73 B;  1EYZ A;  1BJT A;  1L0Y B;  3NQI A;  2WP8 J;  1LT3 D;  1NUC A;  1ENA A;  2R8G A;  2EJF C;  1PZK D;  2NUC A;  2O2L D;  5ELF A;  4DR2 H;  1WOC A;  2F4V L;  1I94 H;  4A3C H;  3TN2 A;  4A4I A;  3Q1K A;  5CBE E;  4NDX A;  4B3S Q;  4F4X A;  2JSO A;  4FYD A;  2IY5 B;  2B29 A;  3M7G A;  3PW0 A;  1IBK Q;  4YY3 Q;  2V4D A;  3K3V A;  3FDT A;  3ORR A;  1B6R A;  1SYD A;  4UCR A;  1FJG H;  5IOD A;  1QOH A;  1HNW L;  5A2Q L;  3S17 B;  1IYU A;  4JI8 L;  4KHP Q;  5KFL A;  3QZ8 A;  5LMU H;  1A8V A;  1R9T A;  3GDE A;  5M3F G;  1DGS A;  4X3T A;  5KG2 A;  4DR3 L;  5KG0 A;  4ZI7 F;  1PH8 A;  2DUD A;  3MXN A;  1JR0 D;  2MUY A;  1C8C A;  3JC6 6;  3Q22 A;  1EZ8 A;  3T1H L;  1KDC A;  1IYJ B;  3L7Z C;  2JA5 G;  4ZUI A;  1VQ6 A;  2NYZ D;  3KJO A;  1UE1 A;  3H20 A;  2ATL A;  2P5Z X;  5KIX A;  1OO9 B;  3GV6 A;  4DNR B;  2QW7 A;  1C9O A;  1M7J A;  2CKZ B;  2OT2 A;  4GLX A;  2NBF A;  3Q0A A;  4X66 H;  2FB9 A;  3PO3 H;  2F3V A;  5K36 G;  4LFC Q;  3ICE A;  3VYU A;  4PMW A;  1RTO A;  1QZH A;  1ASY A;  1S68 A;  3KAL A;  2WIN B;  2YU9 B;  5DAU A;  4PNY A;  1E24 A;  2JEJ A;  4DV4 Q;  5FLX W;  3RN5 A;  3KDF A;  5EWF A;  4X62 H;  5KG4 A;  3IAY A;  1SNM A;  1S9F A;  1SNP A;  4IN3 A;  2R8J A;  4IPH A;  3KAK A;  1TWH A;  4ZQ3 A;  2KCC A;  3H3V I;  4RZQ A;  1WI5 A;  3HOY G;  2O5I C;  3QWN A;  2CW7 A;  2VOB A;  3DEO A;  1Y1W G;  5CGK A;  2DZD A;  3GV8 B;  1JOQ A;  3T5L A;  4QB4 A;  1TWH B;  4LFA H;  2NVY H;  1V4Y A;  2ZDH A;  2W6O A;  1K0R A;  4U7C A;  1HTL D;  2VQF Q;  2JA7 H;  1R4P B;  2NTS A;  1JLL B;  5BMV F;  1EHI A;  1W6K A;  4A3M G;  4JI4 Q;  2YZM A;  2VY3 A;  1Q7Y C;  5LP6 F;  2ZM6 H;  4O42 A;  3QB3 A;  5EOY A;  4EQ5 A;  5D1P A;  1D1I A;  4HMI A;  3TEH B;  3UI2 A;  3CD6 A;  4R8N A;  3I4N H;  1A0I A;  4OO1 G;  5BN3 A;  3VR3 A;  3MWD A;  3GIK A;  4DL2 A;  1EQR A;  2XC9 A;  3GTQ H;  1MSG A;  1HR0 Q;  3HKZ A;  3BU2 A;  5F9L A;  3FMC A;  4DR3 H;  1LV9 A;  3CQZ H;  2NVQ H;  3L4J A;  2NZO A;  2F3I A;  4B3M Q;  3GTP H;  5T14 A;  2NVX B;  3GTM A;  1OXV A;  4JCV E;  2K5D A;  1DV2 A;  5CR3 A;  2Q8R E;  2B2V A;  3QG1 A;  3KLS A;  5IGF A;  4IZ8 A;  1L1O B;  4JI6 L;  2QEX A;  3VR5 A;  1XNQ L;  1TT2 A;  4DV2 L;  1Z9F A;  2ZXR A;  4FVM A;  1AZQ A;  2R93 A;  1JWM D;  2A68 C;  3TRZ A;  3ITP A;  4DR2 L;  1WTP A;  3TP6 A;  4KV6 A;  5G3L F;  1PV4 A;  3BYT B;  4B3R L;  2A6E C;  3HOU B;  4DAM A;  1BVS A;  2IHE A;  2R84 A;  5A2Q W;  5EKI A;  3K58 A;  1YJN A;  1U5K A;  4TVA B;  1G2T A;  4RUC A;  1BDO A;  1S5C D;  2B2Y C;  5IYD H;  3GIM A;  2BDN A;  3X3N A;  1EQT A;  1ZKO A;  4LNQ A;  1JE4 A;  1O7Z A;  2WB1 G;  1S5F D;  5L1L A;  4A3M B;  2R92 H;  5IT9 W;  3SE7 A;  4RGT A;  3CME A;  5FO7 B;  3Q24 A;  1STN A;  3H40 A;  3TQT A;  5L1K A;  1PZI D;  1VQ4 A;  1S97 A;  3PV0 A;  2Z4H A;  4FDB A;  3ZYY X;  1XDN A;  2FK1 A;  2YRW A;  5EKK A;  1JDE A;  1YVC A;  3R5X A;  2JA6 H;  4UAI A;  2FPG B;  5M5W H;  4JI7 Q;  4C3H H;  2F0S A;  3TRE A;  4J9R A;  3DMU A;  3C1E A;  1QUQ B;  2KQ3 A;  5IWA Q;  1D6E C;  2WAQ G;  2R7Z H;  3HZX A;  4AYB B;  5M9O A;  3IL8 A;  1KTK A;  2W7O A;  2JJQ A;  5KFW A;  3V6H A;  1TWF B;  5C3X A;  5IT9 c;  4A3J H;  4O3R A;  3K5H A;  4TQS A;  5DNF A;  4DXF A;  2R86 A;  1NSN S;  4F4W A;  4V19 0;  4F8M A;  2SCU B;  1NY4 A;  2W6M A;  1B8A A;  3BVZ A;  4XYQ A;  4XZ3 B;  4HR7 A;  3JSL A;  2NZ1 D;  1HH2 P;  1U4P A;  1H9J A;  3HB9 A;  1JT8 A;  5KFY A;  4B3T H;  5KND A;  5FD6 A;  2OXP A;  4MHE A;  1LLR D;  2AQ2 B;  3I56 A;  1N36 L;  3GTO H;  1HHV A;  3TS0 A;  1SDF A;  4HR7 B;  1EOV A;  1QE6 A;  5C4X G;  4JI1 L;  3NEN A;  5FOB B;  2E2H B;  2C9O A;  5GON F;  3K80 C;  1KAA A;  1PDQ A;  3G6Y A;  4UCO A;  4NXN L;  4JBW A;  4DL4 A;  4BY1 B;  2W9B A;  1X32 A;  1PH6 A;  1T36 A;  1IL8 A;  3GTM B;  4OEL B;  2QK4 A;  5M5X H;  3J80 c;  3A8J E;  5M5W B;  5KFB A;  4IPG A;  2XNA C;  4JI2 H;  2ZM6 Q;  3SXH A;  2JK8 A;  2OCE A;  2NVQ B;  4A3E B;  1PRT D;  2E2H H;  3GQC A;  1FR3 A;  4LUO A;  1GSA A;  1LM0 A;  2FLN A;  2K1B A;  3AB9 A;  2Y0S E;  3EPG A;  3AFP A;  1SJH D;  2W57 A;  1TXY A;  4GKJ Q;  5C3E H;  2Z9H A;  1SYF A;  1JB3 A;  4DV4 L;  4O2A F;  2AGQ A;  2YW2 A;  1FL0 A;  2R87 A;  1JC7 A;  2UVU A;  4YHH H;  3UDI A;  3HKZ E;  4JI6 Q;  3PCO B;  4JI2 L;  4CDF C;  3CC4 A;  4ED1 A;  5DLF A;  1TKW B;  3J7Y W;  2FJ2 A;  2PW5 A;  1JIH A;  2IW3 A;  3I91 A;  3H4B A;  1A3T A;  3GV3 A;  4FXD A;  4G3I A;  4S3S A;  3CC7 A;  2R92 G;  4LWC A;  2BA1 A;  2BE5 D;  3GTL H;  5KFO A;  5DQH A;  4EBD A;  4NLG A;  4K0K H;  2Q2H A;  1G8Z D;  4K2L A;  1XYI A;  3ND8 A;  1BF4 A;  4X66 Q;  4QWD A;  3ERS X;  4CC6 A;  4DUZ H;  4JI1 H;  1N36 H;  2AUK A;  4IFD J;  3BA8 A;  1GUT A;  4JV1 A;  4DV1 Q;  1XMQ H;  4B9W A;  3CCE A;  1SRO A;  3MTS A;  1MHW C;  2W8L A;  1T5X D;  1KIX A;  1DOL A;  4DL7 A;  5FLM G;  3GTJ A;  4EEQ A;  1HA6 A;  1YNJ D;  4J0M A;  3HOZ G;  3A5Z B;  4LK1 C;  5EJW A;  1JJG A;  3I4M G;  1T9H A;  1HNW H;  4RKB A;  4OL7 A;  3KAJ A;  3KF8 B;  1GUO A;  4JI7 H;  3S2D B;  1JKJ B;  2EYM A;  1GUS A;  2Y0S B;  3MEF A;  4K2K A;  5HGQ A;  4UFZ A;  4DR4 H;  4A3J B;  1E1O A;  5EDW A;  3RAQ A;  1N9W A;  1RJT A;  1EY7 A;  2FK2 A;  1TWG A;  3MR2 A;  1STH A;  1DOK A;  1MD2 D;  3TSS A;  5DGB A;  4ZHQ F;  1ICW A;  1TR5 A;  3EA6 A;  5C44 B;  3TME A;  1HZ9 A;  5M3M H;  4DR2 Q;  3HKZ G;  1GUW A;  1G51 A;  1QJO A;  2B2T A;  3PIO A;  2ZXP A;  1GGO A;  4L5Q A;  2R61 A;  4J9L A;  2JA8 G;  4C5B A;  2ZXO A;  1FJG Q;  1ZHQ A;  1FVI A;  2PZT A;  2K50 A;  1SN8 A;  4NXN Q;  4I55 F;  3HOV G;  4P72 A;  4LF9 Q;  4N9P A;  4JOI C;  4MTE A;  1CZG A;  2M9V A;  3S14 B;  1KJJ A;  3IN5 A;  2LS0 1;  3HOY H;  2N8N A;  1CQV A;  4RB0 A;  3RB3 A;  1F9R A;  3STB C;  4YWM A;  2NN6 G;  2CVR A;  1WTX A;  2NWG A;  2ZTC A;  2G5D A;  1KJI A;  2B3G A;  1HJP A;  3CW2 C;  5E4W C;  5FD5 A;  4R8U A;  4DV7 H;  3MXP A;  5I6W A;  5TSS A;  3W1B A;  1LT4 D;  4BY7 B;  2CQY A;  4DR1 Q;  2ZJR A;  1Q90 A;  1SE4 A;  1IHZ A;  3GTP B;  2CQA A;  3RTX A;  2VB3 X;  4M8A A;  2F0T A;  2L9H A;  2WTF A;  3VPB A;  4K5W A;  2W71 A;  1FYC A;  1YI2 A;  1AE3 A;  1VMC A;  4RWS C;  2DIK A;  4IR1 A;  1ZET A;  2E2D C;  4A93 B;  3AEV A;  2K5Q A;  5ELE A;  1HTP A;  1WFQ A;  1P16 A;  1D8L A;  4RHS A;  3DLL A;  5JVG 3;  3KXY T;  3R2I A;  5LYJ F;  2QF7 A;  4N9T A;  2ZDG A;  3R23 A;  4MIU A;  4OON A;  1CA6 A;  4PZ7 A;  4XTC S;  4CJ2 C;  5IGC A;  1BO0 A;  2DGY A;  4DK0 A;  4X66 L;  5IP9 G;  2PMZ E;  4PMB A;  4LFA L;  1IOW A;  2P0A A;  3E5N A;  1ML0 D;  4UCT A;  4RNN A;  1A63 A;  1RL2 A;  3I4L A;  3OSP A;  2UXC H;  1V1O A;  4UPA A;  4C2M H;  4RNO A;  5EKL A;  2VUM A;  2AQ3 B;  3MHB A;  4DV1 L;  2RGR A;  4ECQ A;  3LWE A;  5M5X B;  4AYB A;  1BGW A;  2NVX A;  4FF3 A;  1S5B D;  3RJ0 A;  5D3D A;  5F9N A;  1STY A;  3MJF A;  1S5D D;  1V43 A;  1K83 B;  5C0X G;  1AEX A;  4LFB L;  1MSH A;  4LSA A;  4X62 L;  4DV0 H;  4QW8 A;  2HT1 A;  1KC7 A;  2WB1 E;  4QMG A;  4FU0 A;  5GAH C;  2VR1 A;  3MAQ A;  1B3A A;  5KG5 A;  2JEA I;  2KCT A;  4YCU A;  3OIQ A;  4UCS A;  4RKL A;  4FP5 D;  4LAA A;  2J7Z A;  4EX5 A;  1SNQ A;  3K5N A;  3GTJ B;  4M9U A;  1AN7 A;  2ZDQ A;  3ONA B;  3CU7 A;  4ME3 A;  3S16 B;  5KT7 A;  2KHJ A;  1FD7 D;  3GV7 B;  1GXD C;  3E0J A;  1XPO A;  3DUZ A;  2RQX A;  4JBM A;  5DEH A;  1H9M A;  3OIP A;  2W6Q A;  4A3I B;  1DD2 A;  5D1O A;  4ZYS A;  1X56 A;  1T94 A;  5J3B A;  4KHP H;  5D65 A;  1ZEQ X;  3G8C A;  3STB D;  1GJX A;  3J81 i;  4IUN A;  1B7Y B;  5C5L A;  2NVY A;  5JUM A;  4FS2 A;  2GN5 A;  2R93 B;  3GLK A;  1K8A C;  4C56 C;  1CKO A;  1VDZ A;  1XMO H;  3AFQ A;  1HXY D;  1PK8 A;  1QWY A;  2B2V C;  4DXG A;  1JWU D;  5GQO A;  3BAB A;  1L1O A;  2F0Q A;  3DXJ C;  5EAY A;  5HGT A;  4FXG C;  4JI5 Q;  4LF8 H;  4F7X A;  3NWS A;  1UWV A;  1SSO A;  1SCU B;  2YZG A;  2R7F A;  5E4X A;  1Z7T A;  3Q6S A;  4DR5 Q;  5LOV F;  5EBC A;  4HJ7 A;  4LF9 H;  1LYL A;  2B2U A;  2Y0S A;  1N48 A;  2PZU A;  1XNQ H;  4RFB A;  1GKH A;  2R7N A;  4JI6 H;  3HOZ H;  5J2T F;  1CKN A;  3KF8 A;  2R6G A;  3TP5 A;  4QIW A;  5DG9 A;  5M3M B;  3J80 L;  4AQY L;  2CCZ A;  1RJQ A;  2OLS A;  1K9M C;  2KSW A;  4R4I A;  1KHI A;  1Y1V B;  2RCF A;  3N44 B;  3FPU B;  4QQB X;  4XQN A;  1J5E L;  1G6Z A;  5H80 A;  4ODG A;  2QCP X;  3WO1 A;  3G6X A;  1E2W A;  1K1Q A;  2EY6 A;  3PSI A;  3Q8D A;  3MXN B;  5KGU A;  3GTO A;  4C2M B;  1WVL A;  1LAB A;  2B8G A;  2RCN A;  3BDC A;  4A75 A;  1IYV A;  1KLU D;  2E5L H;  3PUV A;  3GTG B;  4OX9 H;  4GNX B;  4O2B F;  4F88 A;  4FF1 A;  4HIM A;  5DG7 A;  4CJ0 B;  1RHP A;  3OMG A;  4HSV A;  2DY8 A;  3EIV A;  2HD3 A;  4A3D G;  3S1Q H;  3J81 W;  4GLV B;  3ULP A;  5CV9 A;  4J15 A;  4DV5 Q;  1KDB A;  1KLG D;  2PBZ A;  4C3J G;  5JVD F;  3RBE A;  2Z8L A;  4C1N I;  2A8V A;  3VDY A;  3HXL A;  3PIO 3;  4GN4 B;  4ED2 A;  1FNW A;  3S16 H;  1F2Z A;  1F77 A;  3VR4 A;  3HGB A;  2R7D A;  4ZAI A;  4IUU A;  4C3H G;  1HNW Q;  4DL5 A;  2ASD A;  4EVO A;  1FNU A;  4B3M H;  1D2B A;  4JI4 L;  1OWT A;  3AYH B;  1BXT A;  1VQB A;  1ET9 A;  2A6H C;  4KKU A;  2SNS A;  4DR3 Q;  3KYH C;  4QUC A;  3MFH A;  1MIU A;  5IYB G;  4ECS A;  3PW4 A;  4HN7 A;  1A62 A;  5C0X H;  1EIH A;  2FK3 A;  1U4R A;  1LTS D;  3UQ8 A;  1ZHS A;  4Z9C B;  3S2H H;  1I6H H;  4YWK A;  1TAE A;  4U6P A;  4DR7 Q;  1ASZ A;  1YJW A;  2DLN A;  1EWI A;  4IQZ A;  5KYL A;  5DLG A;  2EYJ A;  2WII B;  4DV7 L;  4IO9 A;  1F9S A;  5IYC G;  3H0G H;  1S10 A;  3M4Y A;  4EYI B;  3A54 A;  2F0O A;  3D4R A;  3SE0 A;  3S2H B;  2XIW A;  1X3P A;  1I50 A;  2IPK D;  1X3F A;  3HOX B;  3CAM A;  1TWG H;  2OWO A;  4BY7 G;  5KG7 A;  3JRW A;  2VQF H;  3OSO A;  1CA5 A;  1PVO A;  2A69 D;  1K28 A;  2W9B B;  2WB1 A;  2D0O A;  4JI0 H;  1BQQ T;  2HUG A;  2RVL A;  1E0B A;  3QJY A;  4GN5 A;  1VQ9 A;  2F03 A;  4JI0 L;  2ASJ A;  2RDF A;  4NXN H;  1BXR A; 
#chains in the Genus database with same CATH homology
 3ZJY C;  3DM3 A;  1G29 1;  4IPH A;  4B3R Q;  3K8A A;  2CFM A;  4DUY L;  1BBU A;  1XMO L;  4GNX C;  4A3G H;  2KBN A;  4DNI A;  3H3V I;  4HJ5 A;  2R7Z G;  4NB3 A;  3S15 H;  1WI5 A;  3HOY G;  2E8G A;  4GKJ L;  4UP8 A;  1C0A A;  3M7N A;  1Y1W G;  2HHH L;  5C0X J;  5JJI A;  3BZK A;  3CXC A;  1Y1W H;  1XPR A;  1HR0 L;  1WJJ A;  1YNX A;  4R4T A;  1XMO Q;  2NVY H;  1GO3 E;  4PZ6 A;  5JEA G;  4HJA A;  2VQE Q;  5M5Y H;  2JA7 G;  4DKA C;  3GTG H;  1K0R A;  3SGI A;  2VQF Q;  2CWA A;  2JA7 H;  4JI3 L;  1XMQ L;  1VQL A;  3ER0 A;  3CCQ A;  2N49 A;  4DR5 L;  3TQY A;  4A3M G;  4JI4 Q;  1CSQ A;  2VY3 A;  1Q7Y C;  1FGU A;  3F8T A;  4DR4 Q;  2VQF L;  1QVC A;  5FJ8 G;  4NXM Q;  3KOJ A;  4EQ5 A;  5BR8 Q;  4JI7 L;  3ULJ A;  1XNQ Q;  3TEH B;  4DV2 Q;  2RF4 A;  3CD6 A;  2C35 B;  4KHZ A;  4HIK A;  1QVF A;  1A0I A;  3E9I A;  3I4N H;  4OO1 G;  3G4S A;  1PH4 A;  4JYA Q;  1EQR A;  4DV0 L;  3GTQ H;  4LF6 L;  1HR0 Q;  3BU2 A;  1PYB A;  5ELO A;  3S1N H;  4YCV A;  4GOP B;  2Z6K C;  3FKI G;  2IX0 A;  2VUM H;  1VQA A;  4AYB G;  3CQZ H;  2NVQ H;  5IYC H;  2NZO A;  2JA5 H;  1X3G A;  2F3I A;  4B3M Q;  3GTP H;  2PI2 A;  5IE8 A;  1G6P A;  1OXV A;  1W3S A;  3NBH B;  4JCV E;  1UE7 A;  3W5O A;  5IP9 H;  4LF6 Q;  3S1M H;  4JI5 L;  1KAW A;  4RG1 A;  2MFI A;  1I5F A;  4DUZ L;  2BH2 A;  3J7A 5;  2AKW B;  1L1O B;  3UDF A;  4B3M L;  2QEX A;  4JI6 L;  1XNQ L;  4DV2 L;  1Z9F A;  2NZH A;  2B63 H;  1VQM A;  5FJ8 H;  2ES2 A;  4NPS A;  3TRZ A;  4DR2 L;  4OXP A;  1Q82 C;  2XGT A;  4KI0 A;  4B3R L;  1PV4 A;  2GVA A;  3I4O A;  3NEM A;  4DAM A;  3OW2 A;  2ZJP A;  1BVS A;  2IHE A;  2UUC Q;  3CCR A;  1YJN A;  1U5K A;  4TVA B;  2RHQ B;  1WCM H;  1Q12 A;  2UXD L;  4GOP C;  5IYD H;  2UU9 Q;  3PO2 H;  1W2B A;  4L5S A;  3RLN A;  4LNQ A;  1L0W A;  1IBM Q;  3PIP A;  3GTJ H;  2WB1 G;  1PH9 A;  2RHS B;  2UUA Q;  1XNR Q;  2R92 H;  4A3D H;  3F2D A;  4MZ9 A;  5LMU Q;  3J7Z C;  3CME A;  2VS1 A;  2XTI A;  1VQF A;  3A74 A;  1E7Z A;  4YWL A;  1VQ4 A;  5M3M G;  3PV0 A;  2AWO A;  4FDB A;  4RMF A;  3KJP A;  2K14 A;  1YVC A;  2JA6 H;  1K83 H;  1QVG A;  1PH5 A;  3K7U C;  5H1S E;  1KRS A;  2MO0 A;  5M5W H;  5BR8 L;  4A3F H;  3M9B A;  3S24 A;  4JI7 Q;  2YTX A;  3K0X A;  4LFA Q;  3TRE A;  4C3H H;  2UXC L;  2CWP A;  2PQA A;  3PUX A;  4JI1 Q;  4BY1 H;  1QUQ B;  5GRO A;  5IWA Q;  2OTL A;  2F4V Q;  2WAQ G;  3HFZ B;  4ALP A;  2R7Z H;  3OTO L;  4K0K Q;  5IYD G;  4UP7 A;  4DR6 Q;  2AHO B;  1BKB A;  2JJQ A;  1WCM G;  5IT9 c;  4A3J H;  1I50 H;  3PUY A;  3G71 A;  1SFO H;  4UY8 C;  1SR3 A;  1QUQ A;  4A3I H;  1IL2 A;  4DR6 L;  1NY4 A;  1B8A A;  4X62 Q;  5IP7 G;  4R4O A;  2HQL A;  4A3G G;  1S72 A;  1HZA A;  2IHF A;  2B63 G;  1HH2 P;  1SE8 A;  3WWV A;  5C3E G;  4AIM A;  1JT8 A;  1JJ2 A;  4IFD I;  4BBR H;  1YIT A;  4DR1 L;  3I56 A;  1YJ9 A;  1N36 L;  1HNZ L;  3GTO H;  2MO1 A;  3TS0 A;  1IBL L;  5C4X G;  1EOV A;  2K5V A;  3IRB A;  4JI1 L;  3HOU H;  1EUJ A;  5C44 G;  1VQ7 A;  1J5E Q;  2VQE L;  2H5X A;  3NEN A;  1TWF H;  2FXQ A;  1N32 Q;  3K80 C;  4QIW E;  3U50 C;  3F2C A;  2YYZ A;  1IBL Q;  1TWA H;  4NXN L;  4JBW A;  5C44 H;  1N33 Q;  1SLJ A;  2UXD Q;  1PH6 A;  5M5X H;  3J80 c;  1EQQ A;  3K7A H;  1HZC A;  3M4Q A;  4IPG A;  2UUA L;  2ZM6 Q;  1M1K C;  2JK8 A;  1N33 L;  4TQU S;  2OCE A;  1X6O A;  2E2H H;  5IP7 H;  3FKI H;  5ELN A;  2AWN A;  3M4P A;  4DV0 Q;  4LUO A;  4OX9 L;  1EYG A;  1LM0 A;  4JC0 A;  2WFW A;  4A3M H;  1V1Q A;  3M4O H;  2Y0S E;  3HOX G;  1K8G A;  4LUZ A;  3AFP A;  1LUZ A;  1XNR L;  1TXY A;  4GKJ Q;  4OWW B;  5C3E H;  4LF5 L;  2EQS A;  4BXX G;  3KDF B;  4DV4 L;  4JI0 Q;  3E9H A;  3FHW A;  2K75 A;  3RLO A;  1FL0 A;  3EBE A;  3CCJ A;  1PH1 A;  3U58 A;  1PH2 A;  2Z6K A;  3UDI A;  3HKZ E;  3CCS A;  4JI6 Q;  3PCO B;  4JI2 L;  3GO5 A;  4AQY Q;  3CC4 A;  2ZM6 L;  5IY0 A;  4A3E H;  2I5L X;  4APV A;  3CPF A;  2L15 A;  5C4J H;  1RIP A;  2PI2 E;  3HOW H;  4DR4 L;  1YHA A;  2JA9 A;  2VZA A;  3OTO Q;  3T1H Q;  2AMC B;  4POG A;  5JJK A;  3CC7 A;  3CCV A;  2R92 G;  4BBS H;  4LWC A;  2BA1 A;  1QZG A;  3GTL H;  4IFD G;  2Q2H A;  3CPW A;  3RNU A;  4IOA A;  2NVX H;  4X66 Q;  3PO2 G;  4JYA L;  4X6A H;  3ERS X;  2JEB I;  2PNH A;  3L0O A;  1OXU A;  4IFD J;  1NTG A;  4HID A;  3H3V H;  2HIX A;  3G48 A;  2N78 A;  4JBK A;  1N32 L;  4DV1 Q;  3EN2 A;  3HOU G;  2UXB L;  3CCM A;  4NXM L;  1AH9 A;  3CCE A;  1SRO A;  4GOP A;  2Z0S A;  3I4M H;  4R1J A;  4YHH Q;  2LXJ A;  1KIX A;  2NVT H;  5FLM G;  3CMA A;  1NE3 A;  1KXL A;  4IJL A;  3CF5 A;  1OTC A;  3HOZ G;  4A3K G;  3A5Z B;  2GVB A;  3HKS A;  3M3Y H;  1JJG A;  3I4M G;  1T9H A;  4DK3 C;  3UDG A;  4L5R C;  3KF8 B;  4B3T Q;  1MKH A;  1IBK L;  2ZJQ A;  1VQG A;  4A3B H;  3MEF A;  3UE0 A;  2HHH Q;  1VQ6 A;  5HGQ A;  4K0K L;  3H15 A;  1HNX Q;  2VL6 A;  1E1O A;  2QGQ A;  1VQK A;  3I4N G;  1JJC B;  1YIJ A;  1N9W A;  4DUZ Q;  4BA2 I;  4XIG S;  4H02 A;  2R93 G;  1KD1 C;  1U0L A;  1OXT A;  1UEB A;  2LSS A;  1NJI C;  2E5L L;  4A3C G;  2Q2T A;  4A93 G;  4IOC A;  3S1R H;  1X65 A;  3CCU A;  1R9T H;  2E2J H;  1HZ9 A;  1X9N A;  3FP9 A;  5M3M H;  4DR2 Q;  3HKZ G;  1G51 A;  4JV5 Q;  3PIO A;  1VQO A;  4R4C A;  4IPD A;  2D62 A;  1NMG A;  4BY1 G;  3PF5 A;  1HNZ Q;  1VQN A;  3S2D H;  2D0P A;  3KLW A;  4L5Q A;  1VQ5 A;  1VQ8 A;  2JA8 G;  4A3F G;  3JAM i;  2UU9 L;  1Q1E A;  2BH8 A;  1SMX A;  1FJG Q;  1N34 L;  1FVI A;  4L5T A;  1N8R C;  1VQH A;  1IBM L;  2K50 A;  1SN8 A;  4NXN Q;  3HOV G;  2A19 A;  4A3E G;  4P72 A;  1Y1V G;  3HOX H;  4LF9 Q;  3KFU A;  4JOI C;  4LFB Q;  4A76 A;  1FJG L;  1VCI A;  1I3Q H;  1CKM A;  1BBW A;  1E22 A;  2N8N A;  3HOY H;  4DV3 L;  2R93 H;  4LF4 L;  4DUY Q;  3STB C;  4YWM A;  2NN6 G;  2QA4 A;  4Y7N H;  4LF9 L;  2ZTC A;  4JOI A;  4JV5 L;  4QY7 A;  2OTJ A;  2KEN A;  1KQS A;  1I94 L;  2B3G A;  1HJP A;  1AE2 A;  1TWH H;  2OQK A;  3CW2 C;  1Q1B A;  4AYB E;  4A3L H;  3GTM H;  1IXR A;  1VS0 A;  3I2Z A;  4JBJ A;  2ZTD A;  4MNO A;  2I0Q A;  4LF8 Q;  1CKN B;  2F52 A;  4LF7 Q;  3S17 H;  3U4Z A;  3W1B A;  4OO1 I;  2UXB Q;  4LF5 Q;  4DR1 Q;  2ZJR A;  4KHP L;  1N36 Q;  1B70 B;  2EIF A;  1PA6 A;  4YHH L;  3CC2 A;  1EFW A;  2EXD A;  5FLM H;  4DR7 L;  3CP0 A;  4MTN A;  4A3B G;  4UP9 A;  1AE3 A;  1YI2 A;  4C3I H;  4GLA C;  5M3F H;  3PUW A;  4GS3 A;  4X65 L;  3T1Y L;  1S40 A;  3AEV A;  1UE5 A;  1WYD A;  4A3K H;  2I5M X;  5IYB H;  3W1G A;  3J81 c;  4YCW A;  2YU9 H;  4GKK Q;  2UUB L;  1HR0 W;  1WFQ A;  4DV6 Q;  5GAE C;  1D8L A;  1P16 A;  1PH7 A;  3DLL A;  2VUM G;  2KHI A;  3NEL A;  4JG2 A;  2ASB A;  3E0E A;  4OON A;  4PZ7 A;  4XTC S;  4LF8 L;  5AJ3 L;  1P8L A;  2DGY A;  2UUB Q;  2E5L Q;  4LFA L;  4X66 L;  5IP9 G;  2PMZ E;  2UXC Q;  4OX9 Q;  4YY3 L;  3H0G G;  3BJU A;  1A63 A;  1RL2 A;  4UPA A;  4C2M H;  4GNX A;  1PFS A;  3F2B A;  4DV1 L;  1GM5 A;  5JEA J;  2MQH A;  3ULL A;  1KRT A;  3A5U A;  3B6Y A;  2Q2U A;  1Q8K A;  1V43 A;  2E2I H;  5C0X G;  2PQA B;  1Y1V H;  2JA6 G;  4GKK L;  4LFB L;  4A3J G;  1VQJ A;  2K4K A;  2VW9 A;  4X62 L;  2HIV A;  1NMF A;  3OYY A;  4JI2 Q;  1K73 C;  2HT1 A;  2WB1 E;  4WJ3 M;  5GAH C;  4AH6 A;  5E7N A;  1JB7 A;  4HIO A;  4B3T L;  4A93 H;  1L2F A;  2KCT A;  4YCU A;  2JEA I;  1XTD A;  1HZB A;  4BBS G;  5AJ3 Q;  4EX5 A;  1YHB A;  3BZC A;  3D0F A;  1I94 Q;  1IZ6 A;  4QL5 A;  3M85 A;  1H95 A;  1D7Q A;  2YTV A;  3K81 C;  1K3R A;  1GVP A;  4ME3 A;  1M90 C;  1HNX L;  2KHJ A;  3CCL A;  3D31 A;  4QJF A;  4OWX B;  1EIY B;  4BXX H;  4LF4 Q;  1XPO A;  2JE6 I;  4JBM A;  3PO3 G;  4BY7 H;  2OQ0 A;  4DV5 L;  1C7Y A;  3RLF A;  3L2P A;  1YHQ A;  1X56 A;  5J3B A;  1CUK A;  1L1O C;  1X55 A;  3STB D;  3J81 i;  4LF7 L;  1B7Y B;  1PH3 A;  1J6Q A;  1YEZ A;  2CQO A;  3PGZ A;  2GN5 A;  1K8A C;  1PYS B;  1CKO A;  4LW1 A;  5IWA L;  3AFQ A;  3TS2 A;  3AQQ A;  4DV6 L;  1JMC A;  4DV7 Q;  5GQO A;  1L1O A;  4BBR G;  5EAY A;  4HJ9 A;  1N34 Q;  4QGU A;  4JI5 Q;  4X64 L;  1OXS C;  1UWV A;  4GN3 B;  1UE6 A;  1SRU A;  3LGJ A;  1XMQ Q;  4JI3 Q;  1Y14 B;  1NBW A;  2Q2I A;  2R7F A;  5HY6 A;  1V9P A;  5DLQ E;  4DR5 Q;  5C4X H;  1YBY A;  3RR5 A;  1MJE A;  3U4V A;  4HJ7 A;  4DV3 Q;  1LYL A;  1OXX K;  4P71 A;  3GD7 A;  2A1A A;  1EIF A;  1GKH A;  2K5H A;  3HOZ H;  1CKN A;  3RZO H;  1S3O A;  2R6G A;  4OWT B;  2IT1 A;  4AQY L;  2CCZ A;  5C0X I;  5JJL A;  2UUC L;  2BA0 A;  5FLX c;  4R4I A;  5GAD C;  1KHI A;  4DAY B;  1K9M C;  4JI4 L;  1VQD A;  3UE1 A;  1Q81 C;  1KC8 C;  4LUV A;  1MJC A;  4QQB X;  1GD7 A;  2KCM A;  1LTL A;  3PUZ A;  3J81 j;  1J5E L;  3F1Z A;  4P75 A;  1CSP A;  1KL9 A;  2Y0S G;  3PSI A;  5LMN W;  1XJV A;  3Q8D A;  3MXN B;  3HOV H;  4POF A;  4Y52 H;  4R4Q A;  4PZ8 A;  2RCN A;  3HOW G;  4HJ8 A;  1X54 A;  4A75 A;  4KLK A;  4WJ4 A;  3PUV A;  5LMU L;  4GNX B;  3A0J A;  1YZ6 A;  2ALY B;  1Q46 A;  5LMN L;  3I55 A;  2ATW A;  3PF4 A;  4HIM A;  4DPG A;  4A3I G;  4JI8 Q;  1Z47 A;  1PHJ A;  4PG3 A;  4A3D G;  2I5H A;  3EIV A;  4X65 Q;  1E1T A;  3T1Y Q;  3S1Q H;  1TWC H;  4GLV B;  3ULP A;  4IJH A;  4J15 A;  2WP8 J;  4DV5 Q;  1VQP A;  3KF6 B;  3RZD H;  5LMN Q;  5GAG C;  2A8V A;  4C3J H;  3VDY A;  4GN4 B;  1E3P A;  1X3E A;  3S16 H;  1Q86 C;  1WOC A;  2R7D A;  3GTK H;  2F4V L;  2JA8 H;  4A3C H;  4A4I A;  4B3S Q;  1HNW Q;  2IY5 B;  3KF6 A;  2B29 A;  2WAQ E;  4YY3 Q;  1IBK Q;  2K5N A;  2V1C C;  1O7I A;  1VQI A;  3AYH B;  1VQB A;  2K52 A;  2YTY A;  4DR3 Q;  1VQE A;  3UDX A;  3KYH C;  1MIU A;  5IYB G;  1A62 A;  4IPC A;  4B3S L;  1HNW L;  3I7F A;  4DK6 C;  4KHP Q;  4JI8 L;  4X64 Q;  1A8V A;  1VQC A;  2NN6 I;  2VNU D;  3GDE A;  5M3F G;  3S2H H;  1I6H H;  4YWK A;  1DGS A;  4DR7 Q;  1ASZ A;  4DR3 L;  2YV5 A;  1JE5 A;  1YJW A;  1PH8 A;  2DUD A;  1EWI A;  3RN2 A;  3J80 i;  2IX1 A;  3JC6 6;  3T1H L;  4DV7 L;  1IYJ B;  3L7Z C;  4IO9 A;  2JA5 G;  5IYC G;  3KJO A;  3H0G H;  1UE1 A;  2ID0 A;  1C9O A;  3S14 H;  2CKZ B;  4A3L G;  4GLX A;  1X3F A;  3JAM c;  1XPU A;  4O0A A;  3CAM A;  1TWG H;  2OWO A;  3PO3 H;  4BY7 G;  4LFC Q;  5K36 G;  4BA1 I;  3ICE A;  1PVO A;  2MNA A;  4PMW A;  2ZTE A;  1QZH A;  1ASY A;  4P74 A;  3G6E A;  2N3S A;  1E24 A;  2D0O A;  4P73 A;  4DV4 Q;  4GN5 A;  1VQ9 A;  4JI0 L;  3RN5 A;  4O2D A;  3KDF A;  4LFC L;  2LXK A;  2JQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...