3H0GG

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
170
structure length
170
Chain Sequence
b'FFLKELSLTISLHPSYFGPRMQDYLKAKLLADVEGTCSGQYGYIICVLDSNTIDIDKGRVVPGQGFAEFEVKYRAVLWRPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNYSGEDQVIEKGSNVRLKIVGTRTDATEIFAIATMKEDYLGVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit rpb1
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 26
structure length 170
sequence length 170
chains with identical sequence S
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h0gG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3h0gG01
3BU2A 1VQPA 3L0OA 1JJ2A 3JC66 5IYCH 3T1HL 4JI4L 3K7UC 5LMUQ 1S40A 2MFIA 3KYHC 1EFWA 2JA6H 1RIPA 1Q8KA 3FP9A 4R4CA 4EX5A 4LF5Q 4A3LH 4A3CH 1IBLQ 2YTXA 1K83H 3E9IA 4YY3L 1Z9FA 1PH9A 3RN5A 4JBWA 3VDYA 1W3SA 3CMEA 2UXCL 4BBSH 3KOJA 4DV0Q 3STBD 3FKIG 3HOZH 3I7FA 5GROA 3CCJA 2UXDQ 4LUOA 4PG3A 4A93G 4GKKL 1VQDA 4X64L 1XMOL 3S14H 1X9NA 5JJIA 4MNOA 2R7FA 3J80c 1TWFH 3M4PA 4B3RL 2KHIA 4QJFA 4DV5L 3OW2A 4IPGA 4JI0Q 3RNUA 4GN3B 4NB3A 4HJAA 1JB7A 5IP7G 3KJPA 1PH1A 3EBEA 1WCMG 4DV4L 1WOCA 3J81c 1Z47A 1N34L 4Y52H 4NXMQ 1QUQB 1K3RA 4X62Q 4GNXC 5BR8L 4HIMA 1XPUA 1N32Q 4DR1L 5C0XG 4J15A 1M90C 5IYCG 2Z0SA 2UUBL 1UE7A 1VQCA 3BJUA 5IYDH 2UU9L 2JA6G 4A3LG 3ZJYC 1VQ5A 3RR5A 4B3MQ 4OWWB 2CCZA 2V1CC 3S16H 1HZAA 2Q2IA 4A3CG 3PO2H 1Q12A 2ZM6L 5AJ3L 2AMCB 2XGTA 3TQYA 3A5UA 1XMQQ 2N78A 4XTCS 1IL2A 2B63H 1VQ6A 2OCEA 4JC0A 3KLWA 5M3MH 1OXVA 4BBSG 4WJ4A 1N33Q 1UE1A 3HOZG 3S1NH 3M4QA 1X65A 4DR4Q 1B7YB 5M5YH 1IBML 4P72A 3HOVH 1SROA 2Z6KC 1LYLA 1YJ9A 2OWOA 3MEFA 1PYBA 1QZHA 2IX0A 3F2DA 2ATWA 1VQJA 1VQEA 4DNIA 1JMCA 5GADC 4BY7H 4BXXH 4GKJQ 1L1OB 3TS0A 2ZTDA 4RG1A 4P75A 3G48A 5IWAQ 3L2PA 4DV3L 4DV7L 4A3MH 4DR7Q 4AIMA 3HKZG 3S1MH 1FJGL 4XIGS 4HIDA 5LMUL 3DLLA 1MJCA 3J80i 1VQGA 3RLOA 3D31A 3PCOB 5EAYA 4LF5L 1LUZA 1KD1C 2QA4A 2AKWB 1IBLL 4OX9L 2YTYA 3M3YH 4PZ8A 5IYBH 3I56A 2VUMH 4A3BH 3GTKH 4IJHA 5C0XJ 1PVOA 2VS1A 3AFQA 5C3EH 1PYSB 2BA1A 2YU9H 3S2DH 5IYDG 3UDXA 2EIFA 4JI8L 4DV0L 1G291 4NPSA 3J81i 2VNUD 2K5NA 2R6GA 1X3EA 2UXDL 3PO2G 1YHAA 2B29A 4RMFA 1YITA 1TWCH 4A3DH 4DAMA 4PMWA 4EQ5A 2B63G 4LFAQ 2E2HH 4BA2I 1X6OA 5M3MG 4Y7NH 1XNRQ 3UDIA 1V43A 2CWAA 1HNZL 4JI0L 2IHFA 3J7A5 3KFUA 2E8GA 1EUJA 5LMNL 3HOVG 4KHPL 2KENA 3GD7A 1E3PA 2ALYB 4X65Q 2WAQG 2NZHA 4X66Q 2NZOA 2FXQA 3Q8DA 3CCUA 4A75A 1E1OA 3KJOA 4DR3Q 1XPRA 4BY7G 4BXXG 2CQOA 3SGIA 3T1YL 4A3MG 3W1BA 4NXML 1LTLA 2D0OA 1YI2A 4IOAA 5C4XH 2F4VL 1T9HA 1PA6A 4LFBQ 5M5XH 4JI5Q 3I4MH 2R92H 2Y0SE 4GN4B 5HGQA 3CCVA 1XPOA 4B3ML 3K0XA 1WJJA 1EIFA 1CUKA 4LFCQ 2H5XA 3HOXH 4JCVE 2VUMG 1J5EQ 4A3BG 3F1ZA 2PI2A 2D62A 2I5HA 2YTVA 4JI1Q 4GOPB 5C3EG 3NENA 2A8VA 4P71A 3U58A 3CMAA 3ULPA 1QUQA 1N33L 3MXNB 4IFDJ 2E5LL 1BVSA 4DR4L 2IX1A 3K80C 3KF6B 4TQUS 4UP9A 4A3JH 1HH2P 1YJWA 1SFOH 1K8GA 4BY1H 4A3DG 1GKHA 4IO9A 3GTQH 5DLQE 3CC7A 4DV6Q 1C7YA 3I4NH 5IE8A 1NJIC 5IWAL 1VQNA 2UUAL 3PGZA 4DR7L 1CKNB 4C3IH 1MIUA 2JK8A 1QVGA 1KXLA 3HOUH 1N36Q 4QL5A 1N9WA 4UP7A 2JA5H 4B3SQ 4WJ3M 4QY7A 2DGYA 1HZ9A 1D8LA 2WFWA 4R4IA 1KIXA 1Y1VH 3WWVA 3HOYG 2PI2E 5IY0A 3GTOH 3HOYH 4DUZL 4JI2Q 4DK3C 1HNWL 4YCWA 2E2JH 4LF6Q 3NELA 5HY6A 4JYAQ 2VQFQ 4IPHA 5C4XG 2UUCQ 4DV2L 3CCEA 4L5QA 4LF9Q 4DR6L 1IXRA 3EN2A 2HIXA 1XNQQ 4GLAC 1IZ6A 3I4MG 4DR5Q 1L1OA 1KRTA 1QZGA 3U4VA 2EXDA 2R92G 1NMGA 4JI6Q 4A4IA 2NVTH 3G6EA 3F2CA 5GAHC 1VQKA 3HOXG 2K4KA 1Y1WH 4DKAC 1C0AA 1NE3A 3RLFA 1V9PA 4LFAL 4K0KQ 4YWLA 1XNRL 4DUYL 3ER0A 2UXBQ 3J7ZC 1XTDA 2F3IA 4LW1A 3KF8B 4C2MH 1YNXA 1PH4A 2Q2UA 3NBHB 4BY1G 4A3JG 1HNXQ 5FLXc 2GVAA 3UE1A 4X65L 2RHSB 1SN8A 1BBWA 1SMXA 3BZCA 3PIOA 2ZJRA 4DV1L 4JI7Q 4DR3L 3I4NG 4OWXB 1IBKQ 2KCTA 4R4TA 5IT9c 4HJ8A 2CKZB 1HR0L 3HOUG 2JA5G 4LFBL 3BZKA 2HQLA 3GDEA 5ELOA 1Y1VG 3TRZA 2AHOB 1EIYB 3NEMA 1TWAH 4A3GH 4GN5A 3HKZE 4DPGA 5H1SE 4LF4L 2PQAB 4LFCL 1V1QA 4LUZA 3PSIA 1HZCA 2KCMA 5IP9H 4GLVB 1AH9A 1H95A 3JAMc 4JI1L 3CPFA 4PZ7A 2LXKA 3W1GA 2OTLA 3S1RH 4A3IH 1AE2A 1HJPA 4LWCA 1I94Q 3GTLH 4IPCA 3AFPA 4AQYQ 5M3FH 2MNAA 2YYZA 1I50H 1K73C 4PZ6A 1JJGA 3B6YA 3E0EA 1SRUA 1Y1WG 2WB1G 3D0FA 3T1HQ 5FJ8H 3J81j 3CXCA 4JBMA 4JI4Q 1U0LA 2Q2HA 4DV6L 1VQ7A 4NXNQ 2CWPA 1K8AC 3U4ZA 1N8RC 5JEAG 1YJNA 2K52A 3TS2A 1OXXK 2GVBA 3L7ZC 2K5HA 4O2DA 5C44H 1N36L 4B3SL 3CCRA 4GOPA 2PMZE 4C3JH 4QIWE 3S17H 2BA0A 1GM5A 2N49A 2D0PA 1R9TH 4YWKA 2UXCQ 2EQSA 1Q46A 2ZTEA 1MKHA 3A74A 1IYJB 1WI5A 1BKBA 1B8AA 1YVCA 3KF6A 4OWTB 5LMNW 2VQFL 4LF6L 4JYAL 1UE6A 4LUVA 2UUCL 4LF9L 1S72A 4GKKQ 4KHZA 2WAQE 2NN6I 1XMOQ 3M4OH 4LNQA 1I6HH 1X56A 1U5KA 2LXJA 1XNQL 1EOVA 2WP8J 4DR5L 1ASYA 3S2HH 2HT1A 1CKNA 4JI6L 4O0AA 4A3GG 1TWGH 4B3RQ 5K36G 1A0IA 4FDBA 2R7DA 2A1AA 2K14A 3A5ZB 3CF5A 3CAMA 5GAGC 5IP9G 1VQFA 1L1OC 3PUYA 1B70B 2E2IH 4B3TQ 3I2ZA 3G71A 4KI0A 1E1TA 4GS3A 4X62L 1EQQA 1Q7YC 1PH8A 4A3IG 4BA1I 1N32L 2MO0A 1UEBA 3F2BA 1N34Q 4UP8A 1VQ8A 5M3FG 3AQQA 3PUXA 2UXBL 3OTOQ 3FHWA 1X55A 3KDFB 1X3GA 2JA7G 5BR8Q 4IOCA 1BBUA 4DR1Q 4YCUA 4OO1I 5M5WH 3M85A 5FJ8G 4IFDI 3JAMi 2Q2TA 4JI7L 2UU9Q 1XMQL 1IBKL 3ERSX 1PH3A 2GN5A 2L15A 3I55A 4A3EH 1YEZA 5C44G 1VQBA 4OXPA 3M9BA 2ZM6Q 3H3VI 4AYBE 1VQIA 3ULLA 4LF8Q 2R7ZH 5J3BA 3W5OA 1SR3A 3F8TA 1S3OA 2AWNA 1DGSA 4DR2Q 1GO3E 3S15H 2OTJA 4DAYB 4AYBG 2XTIA 3S1QH 2BH8A 1IBMQ 3GO5A 1CKOA 1RL2A 4IPDA 1QVFA 5ELNA 1EQRA 3PF4A 4JV5Q 4DK6C 4X6AH 2MO1A 4TVAB 2NVQH 2RHQB 3PO3H 4AQYL 4L5TA 1PV4A 4DV7Q 1SE8A 4DV3Q 4HJ9A 4QQBX 4GNXB 1QVCA 4L5RC 4OONA 1FJGQ 1PHJA 3CPWA 3IRBA 1JJCB 3RZOH 3PUVA 3K81C 4A3FH 1YHQA 1FGUA 5GQOA 1VQMA 4R4QA 3K8AA 1K0RA 4NXNL 2OQKA 1C9OA 2PQAA 1ASZA 1UWVA 4OX9Q 1W2BA 2BH2A 3CC2A 2QEXA 4JOIA 4JBJA 3RN2A 4HIKA 2C35B 4JI8Q 4A3KH 1GVPA 2I5LX 3LGJA 5C4JH 1MJEA 4LF7Q 4IJLA 4GOPC 4A3EG 1YHBA 3OYYA 3CP0A 3PUWA 1VQ4A 4YWMA 2LSSA 4MZ9A 3CCLA 1L0WA 1X54A 4HIOA 3AEVA 2R7ZG 1WFQA 3TREA 1OXTA 4JI3Q 1SLJA 1VQLA 4POGA 4BBRH 3GTGH 1E24A 2N8NA 1HR0W 1Q1EA 2JEAI 2I0QA 1KRSA 1YBYA 4KLKA 4X66L 2JJQA 3CCMA 1KC8C 1HNZQ 5E7NA 4JBKA 1EWIA 4KHPQ 2B3GA 5LMNQ 4B3TL 1G6PA 2IT1A 1D7QA 3TEHB 3HOWH 1NTGA 1PFSA 1NMFA 2K50A 2VL6A 2VY3A 3T1YQ 3PF5A 3PO3G 1P8LA 3OTOL 1JE5A 4R4OA 4JI5L 1A62A 2F4VQ 1OTCA 4A3FG 2A19A 4YCVA 1AE3A 2VQEQ 4L5SA 2JA8H 2OQ0A 1P16A 1J5EL 1VS0A 3CCSA 1I5FA 2HHHQ 1PH5A 2R93H 1FL0A 1EYGA 1A63A 2HIVA 1O7IA 2WB1E 2K5VA 1YZ6A 3HFZB 4MTNA 3GTJH 5C0XI 5JJKA 4YHHQ 2AWOA 4LF8L 1TWHH 1PH7A 3K7AH 2JA7H 5JJLA 3H3VH 3UE0A 1K9MC 4A3KG 5GAEC 4HJ5A 1I3QH 3KDFA 4DR2L 1OXUA 1LM0A 1JT8A 2E5LQ 2JA9A 1KHIA 2ASBA 3PUZA 4P73A 2JE6I 2JQOA 1KL9A 2KHJA 4JG2A 1Q81C 1HZBA 4YY3Q 4JV5L 1NBWA 2RCNA 2PNHA 2NN6G 4BBRG 3HKSA 4QGUA 2UUAQ 3DM3A 4H02A 2ID0A 2VW9A 3H15A 4A76A 1M1KC 4GKJL 2I5MX 3S24A 4JI2L 3E9HA 1UE5A 4ME3A 1VQAA 2RF4A 3RLNA 4POFA 3HOWG 4DUZQ 4X64Q 1WYDA 1Q82C 1HNWQ 4UPAA 5FLMH 4P74A 1CSPA 3CC4A 3CQZH 2QGQA 2IHEA 4DV2Q 3H0GH 4DR6Q 2YV5A 4DV5Q 2JA8G 2KBNA 3A0JA 4OO1G 1L2FA 1YIJA 4IFDG 2ZTCA 2CFMA 4LF7L 4JOIC 3ULJA 4GNXA 2R93G 4R1JA 1TXYA 1VQOA 3ICEA 3M7NA 2VZAA 4DV4Q 4HJ7A 4K0KL 1KAWA 2DUDA 4ALPA 2NVXH 3AYHB 4JI3L 1OXSC 3CW2C 1E7ZA 4AH6A 1HNXL 1VQHA 2ZJQA 4DUYQ 1XJVA 3CD6A 3GTMH 2UUBQ 1Q86C 1PH2A 2K75A 1J6QA 1FVIA 1Q1BA 3FKIH 3UDFA 2F52A 4DV1Q 1CSQA 1VCIA 4APVA 4GLXA 5JEAJ 1PH6A 4A93H 5AJ3Q 1E22A 3I4OA 1VQ9A 1A8VA 2JEBI 1KQSA 1X3FA 3UDGA 1HR0Q 1G51A 4C3HH 3PIPA 3U50C 1CKMA 2Z6KA 1GD7A 1Y14B 2VQEL 3PV0A 3CCQA 3STBC 2MQHA 3G4SA 5IP7H 2ZJPA 3RZDH 5FLMG 2HHHL 2ES2A 1WCMH 2N3SA 2NVYH 3EIVA 4LF4Q 4UY8C 1I94L 2IY5B 5IYBG 3GTPH 1NY4A 3H0GG 4YHHL 2Y0SG
chains in the Genus database with same CATH superfamily
1W93A 1H9RA 2E2DC 5E3FA 1TS3A 2X6GA 4A2AA 3JC66 4A3BB 1II3A 4ECYA 5LMUQ 4DU9A 2JA6H 3S2DB 1Q8KA 1N34H 1SBBB 3BVGA 4ZCKA 1IBLQ 2YTXA 1K83H 4WD3A 5KFRA 1FNVA 4RHRA 4DR1H 2WV6D 5DEHA 2AQ3B 1SNMA 2R8GA 5JVH3 3OSNA 4OIKA 2E2HB 3KOJA 1L2ZA 3STBD 2YS7A 3FKIG 1TU2B 2F0TA 3I7FA 5EKKA 4LUOA 4QWEA 4GKKL 1DXMA 2F0MA 3FVQA 4ED2A 2MJ8A 1X9NA 1QWYA 5JJIA 2EYHA 2W8KA 2R8KA 4HNTA 4QJFA 4DV5L 4IRKA 3K5LA 1BOSA 2V59A 4QWAA 1JB7A 3EBEA 2PZTA 5JPNC 1WOCA 1XTCD 3I4MB 3J81c 1QUQB 1IHZA 4PQXA 1RODA 4J15A 1KJQA 3V6JA 2Z0SA 3WDNA 2UUBL 5KFGA 2NU8B 2UU9L 1FYCA 4JW0A 5KYLA 3RR5A 4LF5H 4A3CG 1KAAA 1A2UA 1Q12A 4WBNF 2ZM6L 5AJ3L 4XTCS 3MR6A 2B63H 1CQFA 1UEAB 4RCOA 4UCUA 2RDJA 4FVMA 1N33Q 5CAEB 5EZYF 2LKVA 1IBML 4ZKCB 5FLXE 4C5BA 1GUTA 3MEFA 4OL7A 1JOOA 2PMZA 3A8KE 3KALA 4HYKA 1Y1VB 3L9AX 4XQNA 5GADC 1WTRA 4I4TF 3QJYA 3GTOB 5IWAQ 2W6QA 4P75A 3G48A 1I3QA 1EY5A 4R8IA 5L37A 2BDNA 3HKZG 4RGMA 1C3OA 4N9TA 3U9SA 3MWEA 3DLLA 1MJCA 3J80i 1VQGA 3RLOA 4NW2A 3RUPA 1HA5A 3ERQA 4C56C 1LUZA 2AKWB 4NXMH 4R8UB 4RAYA 3UFXB 3OSOA 4OX9L 3CU7A 4A3BH 4O2AF 5EPKA 1PYSB 3JAME 3S2DH 5IYDG 4HSPA 2KJXA 4QB4A 1WSCA 1G291 1I4GA 4NPSA 1YNNC 3G6VA 2UXDL 1X3EA 2VB3X 1YHAA 3SI8A 3TZDA 2B29A 1YITA 4EQ5A 2F0GA 1SE3A 2E2HH 3MFIA 2W9AA 2YU9A 3A8IE 3KAJA 4Q0FA 1F9SA 3N40P 2Z4HA 4IURA 3Q24A 3PR5B 5L1JA 4DR4H 2IHFA 2PZWA 1C48A 1D5XC 1VF5C 1O7LA 3LMLA 4X66Q 4NLGA 4BXXG 1A3VA 1XPRA 3D3RA 4BY7G 2CQOA 4Z9CB 4A3MG 4YR2A 4A3GB 2HVSA 1STYA 4ECVA 1SNPA 3DMUA 1Z2NX 1YI2A 2F4VL 2JEGA 4J9QA 2R7LA 4LFBQ 3FKIA 2KQ3A 2M9VA 3GIKA 1CFMA 1QG7A 4JI5Q 3I4MH 3GTLB 2JSOA 5HGQA 1XPOA 2CH4W 4B3ML 2AQ4A 4MV8A 4IRCA 1EIFA 4LFCQ 3A7LA 3SK6A 1J5EQ 3F1ZA 4C5CA 2MPMA 3R5XA 1ONLA 3ZYYX 2A68C 2J9GA 2Z1CA 1Y8OB 2KECA 3KHHA 1BVSA 2Z8LA 2IX1A 3K80C 3GTPA 1WVLA 4A3JH 1YJWA 4IO9A 1KDAA 4LFAH 3V4SA 3GQBA 1UAPA 1R9TB 1NJIC 1XNRH 1VQNA 1JC7A 1CKNB 4C3IH 1MIUA 5AFWA 5KG1A 2DGYA 4YJ3F 3GTQA 3M4OB 2LFNA 1Y1VH 4FBTA 2N55A 4KJNA 3GTOH 2CW0D 4DUZL 4DR3H 2W7PA 4DK3C 1HNWL 4CHTB 2IP4A 2ZXRA 3HRZC 4EEQA 2JA5A 2UUCQ 1SNQA 3RUZA 1EYDA 4DR6L 1IOVA 1L1OA 1KRTA 2FJZA 2R92G 2EXDA 2WKDA 3J7AF 2R87A 5JVG3 5EDWA 5DQGA 4LF4H 5GAHC 5ELDA 5J1ZA 5CGKA 4DXGA 5M5WB 3T51B 2EYMA 1EHIA 4DUYL 2PPBC 3J7ZC 3KF8B 3OHXC 2PQEA 4N9PA 1CHQD 4CDFC 1Y8PB 1ILQA 4BY1G 5FLXc 5ELEA 2GVAA 3UE1A 3GP7A 3LWEA 3T13A 3I4NG 4OWXB 4KD3A 5C6AA 1F9QA 2CKZB 1HR0L 3PIO3 5KG5A 2XN9C 1N36H 3K6OA 4LJZC 4B3SH 5KG2A 5ELOA 5KFFA 4RFBA 2PYKA 4MV9A 4A3GH 3TP5A 5K36H 5KFJA 5KNDA 1HZCA 3JAMc 4JI1L 4QWDA 2I46A 1H9MA 4OIJA 3W1GA 2OTLA 3NQTA 3GTLH 4EYIB 1I7NA 5DG9A 1EY6A 1TWAA 5CBAE 2CQYA 2MNAA 1CK1A 4ECSA 1PTOD 4EGQA 3B6YA 3FDSA 4ABNA 1LTBD 3KLSA 1N32H 2CWPA 4A3KB 2FLNA 2B2WA 3G6JB 2UXBH 1B44D 1YJNA 3F2UA 3L7ZC 2XWJB 4GOPA 4Q8FA 2L11A 1KDBA 4QIWE 3VR2A 3TBIB 2XGPA 1BNCA 2ASDA 1EQVA 1IW7D 1R9TH 3DXJC 3NE5B 1IBKH 4J9LA 2VA2A 1S9FA 2K1BA 3A74A 3KF6A 1I4XA 1PZID 3D8GA 4LF6L 4JYAL 2VQFL 4LUVA 1NAPA 3QOLA 5ELCA 4LF9L 1S72A 2WAQE 3M4OH 2LXJA 1XNQL 1ZETA 5IGBA 1Q3LA 4DR5L 4JUZA 1JORA 4Y8VB 2Z6BA 4JI6L 4B3RQ 2WIIB 3C1EA 2XD4A 3A5ZB 1I4HA 4RGNA 5IP9G 1VQFA 1L1OC 2Z9HA 1B70B 4B3TQ 3IKJA 1E1TA 4LAAA 1QNUA 4X62L 1Q7YC 3F2BA 3EVQA 1N34Q 3I12A 4GC6A 2L12A 4ME6A 3OTOQ 1X55A 1V4YA 1DYQA 1VAJA 3TINA 1BBUA 1NSNS 3GLKA 4DR1Q 4MV6A 5J2UF 4YCUA 1F2YA 5M5WH 1KBLA 4G4KA 4CJ1B 2JA7B 4JI7L 2AGPA 1XMQL 1EY8A 2I87A 3ERSX 4NXNH 3M9OB 2GN5A 4CKEA 5I47A 4EGVA 3M9BA 2CVRA 5E4XA 4DAPA 2EY5A 2GPSA 5A35A 4ZI7F 3TMEA 1K8MA 4JVZA 3F8TA 1S3OA 4U673 3K59A 2IMWP 2ZDHA 2X0SA 2XTIA 2BH8A 1CTMA 2FE3A 2R7ZA 1QVFA 3PF4A 1EQRA 2F0HA 4KKTA 4ODGA 4TVAB 3PR4A 2Q8RE 3ND8A 1PV4A 2I8CA 1SE8A 4HJ9A 1EU4A 1PHJA 2FHTA 3H0GB 3MFHA 2FK1A 1FGUA 5GQOA 5D8DA 2HCIA 3K8AA 1A6XA 1PZJD 1JXLA 2IWHA 3ND9A 1XYIA 2ICEC 1F2ZA 4XYQA 2YS6A 2B2WC 3GIIA 4HIKA 2C35B 4A3KH 1V1OA 4X3KA 1F2MA 1U4PA 4IJLA 4GOPC 2XCPA 3VYRA 4O3RA 4EBDA 1QCBD 3H94A 4YWMA 2LSSA 2NTSA 4MZ9A 3KXYT 3RJ0A 1S0NA 3TP7A 1WFQA 4JI3Q 1LACA 3GTGH 5JVDF 3Q8QB 1TY2A 2JEAI 2I0QA 1SNDA 1G6ZA 2KEEA 1EUDB 1D7QA 1WTOA 4XYMB 3EA6A 2R84A 4F4WA 4FU0A 3SHLA 1TVXA 1A2TA 1JE5A 1WCMB 2EYPA 2NU7B 1OTCA 4A3FG 2W71A 1AE3A 1G8ZD 4CDDC 2VQEQ 1A3TA 3LWBA 1V8QA 1P16A 2HD3A 3BVZA 4IUQA 2MHVA 3RBDA 2X69A 5DGAA 1I5FA 2HHHQ 2R93H 4K2LA 3J81L 1EYGA 2HIVA 5D1OB 1FGBD 2AU0A 4IRDA 3H4BA 5C0XI 1CHPD 2SDFA 4QW9A 4OHJA 2JA7H 2VQDA 3UE0A 1K9MC 2A6EC 4FP5D 2ZDQA 4DR2L 1OXUA 2JA9A 3H6MA 4K5WA 4K0KH 3RV3A 2YZGA 3PUZA 1TY0A 2JE6I 1KL9A 3HOZB 3J7YW 3MVVA 1HNXH 5IT9L 5CMDA 3IL8A 2B2VC 4H02A 1M1KC 3V2TA 4GKJL 2DIKA 4DNRB 4X3SA 3EYYA 1RTOA 1VQAA 3RLNA 3PW7A 3N42B 2FLPA 4X64Q 1CZGA 2GA4B 1G2TA 3I3CA 2HDLA 4ED0A 5BPFA 1MBYA 2B8GA 2KCNA 3H0GH 2D5DA 1M0TA 5KFWA 2EJFC 3ONAB 4KY6A 2NU9B 4GNXA 3CQZA 5L1LA 1VQOA 4N8FA 4DV4Q 5HV6A 1I94H 1HQRD 2DUDA 4OELB 2RSNA 2XSCA 3AYHB 1RJPA 2O2LD 4HSVA 4AH6A 4EFBA 2E2IA 1Z7TA 2EDGA 2JXMB 1XJVA 5J2TF 4QIWB 3MWDA 4ILWA 5IIFA 3UDFA 2NVXA 2QDBA 1RDPD 1VCIA 2HUGA 4GLXA 1EYZA 3MEHA 5EPLA 5JEAJ 1D2BA 2CH4A 4B9XA 1ZYRC 5K5PA 3FPUB 1VMCA 5KIXA 1A8VA 1KQSA 3UDGA 2WAQB 1G51A 2W9CA 1E2VA 5LL6X 1S4ZA 1SMYD 1B3AA 2F0JA 3IFDA 2J0TD 4GKKH 3G4SA 3JSNA 2JYOA 1WCMH 2N3SA 2ES2A 4LF4Q 5C1PA 4XQQA 1X3QA 2NBFA 2PBZA 2Y0SG 4DV5H 5JQWA 3BU2A 1VQPA 2CHBD 3M3YB 1JJ2A 2VUMB 1LTTD 5IYCH 3T1HL 4RCNA 3K7UC 1TAEA 3PW4A 1TS4A 4A3LH 3FP9A 5I2XA 4ZRZA 4EX5A 1ILPA 4EG0A 1S5ED 1KJJA 3U9TA 3E9IA 4YY3L 2FK2A 4KK7A 1PH9A 4JBWA 3VDYA 2QF7A 4A3DB 3Q23A 1MSGA 2UUBH 3CMEA 2JA6A 4H44C 2UXCL 4DV0Q 2UU9H 4RH6A 3GTMB 3HOZH 3MWMA 1K83A 3CCJA 4PG3A 1RYSA 4A93G 4OEMB 3KBXA 2ZM6H 3LP8A 1XMOL 2R7FA 5CV9A 1S0MA 1B1ZA 4C3HG 4F4XA 1B9NA 4EFEA 3R93A 4IPGA 1AUVA 4JI0Q 4UCTA 2JEJA 4Q5VA 1IBMH 2EYOA 5C4XB 2JEFA 2L4NA 5DLFA 1PH1A 3MR3A 2W57A 5A2QW 4JV5H 2SEBD 2SNMA 1Z47A 5CR3A 3NHHA 3M9MB 5KFEA 1NR2A 4GNXC 4UHVA 4HIMA 2IX3A 3KHRA 1N32Q 5C0XG 3HOXB 4V190 5CORA 1K1QA 4MV7A 1DOKA 4FXKC 2FB9A 1VQCA 3Q8SB 5IODA 4ED7A 3ZJYC 2A69D 3SK8A 4APMA 2V1CC 4FS2A 1HZAA 2BE5C 4OX9H 4G57A 4R9WA 3A5UA 2G9DA 3TQYA 5FLXW 1H9KA 5LL6b 1VQ6A 4JC0A 3KLWA 4BBSG 4PWQA 4WJ4A 4GC7A 1UE1A 4XQJA 1EY9A 3S1NH 1KDCA 4JPBW 4CC6A 3FMAA 1B7YB 1JX4A 4RUCA 2UXDH 4I7AA 3NTIA 3HB9A 4P72A 3GTJA 5KFXA 2B63A 1LYLA 5JUMA 2HGSA 3TZUA 1QZHA 1LABA 4WRDA 1HRJA 1HUNA 1JMCA 1C4QA 3TS0A 2ZTDA 5JPMC 3L2PA 4DR7Q 4DV7L 2E2JB 2A5HA 3DWAA 4AIMA 2MCTA 3P20A 5IT9E 4HIDA 1K3BC 3JAMW 5LMUL 2RCFA 1ZEQX 5T14A 3QG1A 4DAYA 1E4EB 1IBLL 5IYZF 5C1OA 3M3YH 5IYBH 2VUMH 4YQWA 2F4VH 4U7CA 4DNTB 1Y1WB 5JVLA 5C0XJ 1I4QA 5HBRB 2VS1A 2XRSD 2BA1A 3P1HA 5C4ZA 5BN4A 3J81i 4B3MH 2O5JC 2VNUD 2K5NA 1Y69U 1ENAA 3PO2G 1RKNA 4A3DH 1X32A 3QOJA 4PMWA 3MR2A 3KLRA 1SYGA 3T5LA 4TV9F 2L9HA 5M3MG 1PRTB 3UDIA 5J22A 1SJED 1HNZL 1VMPA 2VR1A 4DL3A 3HOVG 3KAKA 4X65Q 5DLGA 2NZHA 3Q8DA 2NZOA 3EROA 3CCUA 1E1OA 1KNAA 3W1BA 1PFBA 1LTLA 1STGA 2YZNA 4RZRA 2D0OA 2W6OA 5KG0A 5C4XH 4J9PA 2RDIA 1MHWC 2JP1A 3X3MA 1PZKD 1YNND 4RKBA 1JICA 4DUZH 3K0XA 1WJJA 1HNWH 5M3FB 4QWCA 1I50B 2FFKB 3HOXH 1GSOA 2N88A 4I50F 2PI2A 2D62A 2YTVA 5C3EG 4DR6H 2A8VA 3U58A 1Y8NB 3CMAA 2R7MA 2SNSA 3MR5A 2B2YA 2LY7A 1N33L 1QUQA 5EBCA 4XX0B 4IFDJ 2E5LL 2Z4IA 2ASLA 3FMCA 1HH2P 2A74C 5FO9B 4C3JB 5CV8A 3S17B 4MHEA 4DV6Q 1C7YA 3TN2A 5KG6A 4O4IF 4DUYH 2FINB 4BWGB 5IWAL 2C22A 2UUAL 3PGZA 2OF1A 4B9WA 4AYBB 4WJ3M 1HZ9A 3DHQA 2HQEA 2QILA 4FXGC 3GV5B 1SDFA 2A69C 3S2HB 2IJ0A 2E2JH 4J9OA 1TWGB 3NELA 5HY6A 1S97A 4KMUC 4IPHA 1B33N 1HR0H 4DV2L 2A68D 4L5QA 4ZUJA 1Y1VA 5CV7A 3GILA 2IA6A 3GTOA 3Q8PB 3U4VA 4YBZB 1NR4A 2B8FA 2C28A 3F2CA 2KUMA 1VQKA 4MV3A 1TWFA 2M00A 1Y1WH 4DKAC 2DNEA 4PV1C 1WTHA 4JI1H 1KJ9A 5EWGA 4IQZA 4K0KQ 4YWLA 1XTDA 2F3IA 4QF4A 4R8UA 5JEAH 2GLTA 4QUFA 1WD0A 4Q8EA 3NBHB 1RJQA 1HNXQ 1CE8A 1I6VC 3I90A 4IHJF 1UNSA 5BN5A 4A3JB 2KCTA 1GGOA 1BNZA 1O78A 5IT9c 3S15B 3MZ5A 1EEID 1EQTA 1HTPA 3VA7A 3HOUG 3S1QB 4G7HC 2JA5G 3C3LA 3BQ2A 1XWEA 1GSHA 4LFBL 5C5MA 3GDEA 3OUZA 4L8JA 3HZXA 4TQSA 3TRZA 4C3IB 2FPIB 2UVRA 1EIYB 3NEMA 5M9OA 4GN5A 2MP1A 3VR5A 3HKZE 4DPGA 5H1SE 4LF6H 3V05A 4LFCL 1V1QA 4LUZA 4JYAH 2VQFH 4GLVB 1AH9A 3ETJA 4YB8B 1PFMA 5KFUA 1BCPB 3CPFA 1WTXA 4PZ7A 2VUGA 2YW2A 1XNQH 1HJPA 4LWCA 1I94Q 4DR5H 4IPCA 3AFPA 2PW7A 3VYSA 4AQYQ 4JI6H 5M3FH 3URYA 2YYZA 1I50H 3S9WA 3C46A 5DQIA 3CVZA 4K8JA 4DK0A 3E0EA 1HA6A 1QILA 3W3AA 2B2YC 2WB1G 4JBMA 3CXCA 1EY4A 2PCFB 1U0LA 4X62H 3Q0AA 4ZYSA 5FO8B 2KVMA 5C4JB 2HDMA 2K52A 3TS2A 2L5TA 4K8IA 4G7OC 4E6IA 4C3JH 3E3XA 3E5NA 3S17H 1O7ZA 4ECXA 2RGVA 4JI7H 4YWKA 4RB3C 1T3NA 3GTKA 1XMQH 4BBRB 2W6MA 2QEJC 1IYJB 1JOKA 1WI5A 1GYFA 1B8AA 3I70A 5F9LA 1UE6A 2UUCL 4GKKQ 4UCOA 4KHZA 4O3NA 5KG4A 2NN6I 5KFCA 1BXTA 4LNQA 1X56A 2KSWA 3HOWB 1R9TA 3S2HH 2J6TA 4EBCA 2F3VA 1CKNA 1TWGH 4PMCA 1EWHA 2A1AA 4XZ3B 3CAMA 4LH6A 4O3OA 4KI0A 2VPSA 3H40A 3DWQA 1EQQA 1PH8A 4ECTA 4A3IG 4BA1I 2JA8B 2MO0A 5KGUA 4ETSA 3PN1A 1VQ8A 1DV2A 3PUXA 3KDFB 2JA7G 1ULZA 3Q1KA 1B9MA 1SSOA 3M85A 3K5NA 5FJ8G 1JKJB 2OEOA 2ZXPA 3JAMi 3N44B 3K7AB 2UU9Q 1AEXA 3OHBA 5D3IB 4F7XA 1AZQA 2L15A 2XC9A 5C44G 1S10A 1VQBA 1JB3A 1PXUA 2J7ZA 2ZM6Q 3H3VI 1VQIA 4LF8Q 2EJGC 3T16A 3KF8A 1GO3E 3S15H 2H4OA 1ML0D 3E0JA 3S1QH 1IBMQ 4MIUA 2DY8A 1ICFB 2W6ZA 4I65A 3TP8A 5D14A 4JV5Q 1SFOA 4DK6C 1DZ1A 3QR8A 2RHQB 4L5TA 4ED6A 4L5RC 3IRBA 1SNOA 1JWSD 2WYOA 1BJTA 2K5WA 2K28A 2CZGA 2R7KA 4TUYF 1K0RA 3HG9A 1A9XA 2R86A 3GV3A 2F0PA 3OPOA 4OX9Q 5JAVA 3CC2A 5EWEA 1DD2A 3KBGA 4JOIA 4QCLA 3FRPB 4LF7Q 5C4JH 1JCKB 4A3EG 1JOQA 5C3XA 3CCLA 2R7ZG 1OXTA 1GXDC 2D2CC 3PMFA 4BBRH 3NQIA 2WB1A 1HR0W 4J9MA 4DR2H 4KLKA 1KC8C 4ID6A 4JBKA 1KABA 5E7NA 1EWIA 1EIGA 4TKOB 5KKNB 4B3TL 2UXCH 1PX2A 2IT1A 3MXGA 3HOWH 3TQ1A 1NMFA 2R8HA 1ENFA 2EPBA 2VY3A 3PO3G 1GJXA 3LX0A 3K0YA 3OTOL 4RU9A 1CA5A 4R4OA 4RGOS 1A62A 2NVYB 3MA2B 2F4VQ 1AUXA 3J7AK 4GKJH 2RDGA 3GTPB 2V58A 1ZQ7A 1JWMD 4L5SA 1AN7A 2JA8H 3HP3A 4HAEA 4OO1H 4DLKA 4IFDH 1HTLD 3AB9A 4CGYB 1FL0A 4J8QA 1S5CD 4YHHQ 1DJRD 2W6PA 5BMVF 4UCVA 3K7AH 5JJLA 1DCZA 5GAEC 4HJ5A 2OT2A 1ESFA 1I3QH 1KHIA 2L0CA 4XT3B 2WINB 2F0WA 1EUCB 3SXHA 1V1PA 2JQOA 2JA7A 2KHJA 1HCZA 1NBWA 1SXTA 5KFAA 2NN6G 3UQ8A 1T5XD 5G3LF 2VW9A 3OHAA 1QJOA 5LOVF 1JWUD 2RA4A 3RMHA 1ZXTA 1FNUA 4ZK9B 3GIPA 3GTGB 3IN5A 4JI2L 3E9HA 1UE5A 4ME3A 2KOLA 1SNCA 2K03A 1D5ZC 1DV1A 5L1KA 3HKZB 5KFLA 4DUZQ 4MA5A 1HNWQ 1CSPA 3NPPA 2QGQA 2IHEA 3SK4A 2A6ED 4C5AA 4DR6Q 5KT4A 1M7JA 1B3QA 2YV5A 4EBEA 1B6SA 2KBNA 2XVSA 5LA6F 1YIJA 1E4GT 4JOIC 1LT3D 2F4IA 5CYUA 1TXYA 5IGEA 3I72A 2VZAA 4HJ7A 3OIPA 3H0GA 4IUTA 4N8X1 2R93B 4JI3L 1OXSC 4ED3A 2ZJQA 4DUYQ 2O4XA 3KUPA 3T1HH 4UFZA 4WFN3 1PH2A 2K75A 3BQ0A 1E0BA 3DM1A 3FKIH 4S3SA 2C2DA 4YY3H 5KX5F 2ALZA 1LLRD 3G7LA 1LT6D 1SYDA 5I6YA 3RTXA 1AP0A 1Z2PX 4KV6A 2YCHA 3T5KA 1HR0Q 1O80A 4MN3A 1CKMA 2Z6KA 1GUOA 1GD7A 3U50C 4BY7B 4FS1A 4O4HF 4A3MB 2VQEL 3CCQA 3OWEB 1CQVA 3L4JA 1SE4A 4LMQD 5TSSA 3K58A 5FLMG 4RHSA 2HHHL 1XMOH 2NVYH 3N41B 2IY5B 5IYBG 3GTPH 4FYDA 4ED1A 1FD7D 2B39A 1UC8A 1WH2A 1U4MA 1LT4D 4JI4L 1JDBB 1S40A 1WCMA 4XYOA 2MFIA 2NYZD 1R4QB 3KYHC 1ZKOA 2ZT9C 1RIPA 4R4CA 4LF5Q 5DGBA 1MZBA 4DN4M 3M4IA 1ZYRD 4M8AA 4A3CH 5FD6A 1PTOB 3VYTA 3G6XA 1Z9FA 4QMGA 1TWCB 3RN5A 5D1OA 2NZ1D 4F87A 5IGDA 4Y7NB 4L1KA 1FNWA 5GROA 3A54A 4HTHA 4O3PA 4IR1A 5HURA 4X64L 2EXZA 4ECQA 4MV4A 3N6RA 1JR0D 5KFYA 3M4PA 2WKCA 3ETHA 1LV9A 3OW2A 1IOWA 2XWBB 3HBLA 3RNUA 4GN3B 4TRDA 1STHA 2AQ2B 5IP7G 1ET6A 2K01A 4ZUIA 5C8YF 5DQHA 1B4OA 2PO4A 2V4RA 4U68A 5M5XB 4DV4L 4IUUA 3RB6A 2R92B 4Y52H 3C1FA 4NXMQ 1K3RA 2RQXA 4X62Q 2F03A 1O75A 4DV7H 5BR8L 1XPUA 1JQYD 5KFOA 3J81W 1RK5A 2W9BA 4NKLA 4RKLA 5KNCA 2RBMA 5LMUH 2B2TA 2JA6G 5IYDH 1T5EA 2CCZA 1IBLH 2NWGA 4EQOA 1XMQQ 4BY1B 2N78A 4IN3A 4HNVA 2OCEA 1VKZA 2DLNA 4CC5A 1GOZA 5DNFA 3I4NB 5D3DA 1LTRD 4DR4Q 3FEWX 5IT9W 2GPWA 2Z6KC 1YJ9A 2BR0A 3P75A 4QIWA 2IX0A 4BXXH 1VQJA 1VQEA 4DNIA 1WTWA 1C0AA 4BY7H 4RG1A 4A3MH 4DV3L 4BWSC 1EEFD 4HNUA 1HNZH 1FJGL 2XCAA 3BJYA 3SDZA 5I6WA 2YRWA 1N56A 2WAQA 3WO1A 4DL2A 2BE5D 2QW7A 3D31A 5EAYA 5T1GA 2F0IA 2JEIA 2YTYA 3A55A 4Q45A 4IUNA 5LL6S 3I56A 3AU7A 1CZWA 1PVOA 5DAUA 1ICWA 4IZOA 4A2BA 4JI8L 4DV0L 5JOBA 1PTOH 1BQQT 1H9SB 2EJMA 4C2MB 2XGQA 2VUMA 3KHGA 4RMFA 4NDXA 1TWCH 1E4FT 1GUSA 4DAMA 5FOBB 2B63G 2A6HC 2IW3A 4LFAQ 4BA2I 4Y7NH 1XNRQ 2XIWA 2F1MA 4ULLA 1N33H 1V43A 1PFNA 5LYJF 2E5LH 3NTHA 4KY7A 4C1NK 4JI0L 3KFUA 2E8GA 4KHPL 5LMNL 1KEEA 1EY0A 2R82A 3S1NB 4HEDA 5KFKA 1RD9D 3H09A 4A75A 2FK3A 2R7NA 3KJOA 1MGSA 3O13A 4KY5A 5EGTA 4DR3Q 1Z2OX 3MXUA 3SGIA 5KYIA 3T1YL 2W7OA 3GTMA 1F77A 5IWAH 2UUAH 2E76C 4RZQA 4IOAA 2XIGA 2BQRA 1T9HA 3EPIA 3SR1A 4OGQC 1GUGA 2F3WA 5M5XH 4H13C 2ZXOA 3RAQA 3QIAA 2R92H 3PIP3 2Y0SE 1G2SA 2PNRC 4GN4B 4P2CB 4X3TA 3AMUA 2H5XA 2B2TC 4JCVE 2AUJD 4A3BG 4DV2H 2Q8TA 3LNNA 5EBDA 3JRWA 3ORRA 3NENA 4P71A 4EQNA 2EY2A 3Q8RB 4R7RA 3MXNB 2H1EA 2C5CA 3VPCA 4B08A 4EGJA 1K8GA 4BY1H 2G9HD 5ISRA 5CV6A 3KLSX 5DLQE 4HR7B 3CC7A 2IPKD 3I4NH 3TP6A 5KT3A 4DR7L 1BUVT 1QVGA 1N36Q 3H3VC 4QL5A 4GZYC 1HXYD 4UP7A 4B3SQ 3K57A 1N48A 2WFWA 1I6HB 1KIXA 3VPDA 4YR3A 2MGSA 3WWVA 2PI2E 4F50A 3MTSA 3OMGA 1RCVD 2D9UA 4YCWA 1BGWA 2C2EA 3HOYB 1L0XB 3TSSA 3CCEA 2E2IB 4LK1C 4LFBH 3EN2A 2HIXA 2ENBA 1B04A 5KT5A 4I7ZC 3I4MG 3MHBA 1NMGA 2AQ1B 2F0EA 3G6EA 2FLLA 4LFCH 5ELFA 2K4KA 3NP8A 5CB4F 4IUPA 4J9RA 1NE3A 3RLFA 3OUUA 1V9PA 1Z6HA 1PMRA 2NUAB 4DFAA 4O3QA 4V0BA 2UXBQ 4LW1A 3D4WA 4C2MH 3G8CA 3QZ8A 1S03G 2V4QA 4A3JG 4J1MA 3BYYB 3NXWA 1B50A 1PTOF 5L1IA 2OLSA 3M4YA 3VYUA 4X65L 1SN8A 1BBWA 1SMXA 3BZCA 1TS5A 3PIOA 2ZJRA 4DV1L 4J9NA 3R23A 1IBKQ 4R4TA 4F8MA 1NCVA 3OOCA 4C3IG 4K6LA 3R5FA 3K5MA 3J80L 3LWUA 4C1NI 2HQLA 4YAJB 1D5MC 1Y1VG 2AHOB 4I7HA 1L0YB 1CT1D 2FMCA 2QKIC 2YRXA 2ICIA 2PQAB 4PMBA 2IBKA 5IP9H 2UUCH 4ECZA 3RZOB 2DJFC 1AE2A 1VBHA 3OSPA 2PN1A 2M2LA 2NTTA 2QK4A 4BS9A 3TDQA 1JJGA 1SRUA 3QZ7A 3D0FA 3T1HQ 3J81j 4DV6L 5KEEA 2RGRA 1VQ7A 2F0DA 5L9XA 1YNJC 4F88A 3A7AB 1AZPA 4NXNQ 3U4ZA 4Q44A 5CA1F 1I50A 5FPRA 5DM73 2F0VA 3CCRA 4G7ZC 2PMZE 1ZHQA 4HCSA 2RDFA 2VB2X 4R8NA 1GM5A 1SEIA 2N49A 2UXCQ 2EQSA 1QOHA 3IFTA 1B53A 1BKBA 3BG3A 3VA5A 2B2UA 1TIID 3EQLC 1I6HH 1XMOQ 3SVMA 4UCRA 3VR4A 4YJ2F 2E74C 5DM63 1ASYA 2HT1A 2HVRA 4A3GG 4O0AA 2F0NA 2E2HA 5K36G 1A0IA 4ZKBB 4AYBA 1U4RA 3CF5A 3HOYH 3OMCA 2E2IH 5GAGC 1LT5D 3I2ZA 1AFPA 2R3ZA 1S5BD 2R8JA 2FP4B 3VMMA 5C4HA 3Q6SA 3K5OA 1TWGA 4UP8A 3BG5A 3AQQA 2FPPB 4YIJA 4IOCA 5LP6F 5G3LD 3OWFA 4O2BF 2YYAA 4CJ0B 3GTJB 1STNA 1TWHB 1F2LA 2K04A 2QDLA 1EOTA 1RHPA 2F0OA 2KCCA 4ZQ3A 5KFZA 2ASJA 3K3PA 1TS2A 1LTGD 2OH2A 3ITPA 5J3BA 3W5OA 1SR3A 4DF7A 2AWNA 2L55A 1S5FD 2OTJA 1F9RA 3OIQA 3NBHA 4DAYB 1AN8A 2K5DA 5EWFA 3GO5A 3A8JE 1CKOA 1RL2A 1RJTA 4IPDA 5ELNA 5I9OA 4X6AH 5F2DA 5FPOA 4O4LF 4AQYL 4DV7Q 4QQBX 1XX8A 1QVCA 1G6PA 4OONA 4RB2C 3CPWA 3RZOH 4A3FH 1YHQA 4B3TH 3GIMA 1KTKA 2Y0SB 1ESRA 5FD5A 3U9OA 1JIHA 1UWVA 3OTOH 3TIIA 2QEXA 4IWXA 2PZUA 4JBJA 1SCUB 2XRQD 1KJ8A 1GVPA 2I5LX 2TSSA 5EQ0A 3WOEA 2VXWA 2WACA 1IYVA 2CW8A 3RAXA 3OYYA 3CP0A 3PUWA 1VQ4A 3BA8A 3ORQA 5KFBA 1L0WA 1X54A 3AEVA 1EU3A 4IWYA 5KFQA 2Q8IB 4EEYA 2CW7A 1VQLA 4WJWA 4POGA 1NNXA 1EFID 2N8NA 4A93B 3C0FB 2FJ2A 2B2UC 4G3IA 3MXPA 3L4KA 4X66L 1YBYA 3CCMA 2OXPA 1HNZQ 2NB0A 4C3HB 3SE7A 1NTGA 2DNCA 4U6PA 3EPGA 3CKIB 3PF5A 1E2WA 1WTQA 1P8LA 2DZDA 3K5HA 4JI5L 1K8OA 4XXEA 3J80E 1C30A 3A56A 1WTPA 2WDTA 3HGBA 1QB5D 1STAA 4JI2H 2A19A 1CQIB 4XT1B 2OQ0A 1EZ1A 1J5EL 5A2QE 3I91A 4LF9H 1I7LA 4RB0A 2QYZA 3NUCA 1O7IA 2WB1E 3T56B 1OWTA 5KG7A 2K5VA 4K6DA 1X3PA 4MTNA 3GTJH 5JJKA 4LF8L 3VPBA 1TWHH 2I07B 1EY7A 2W70A 4A3KG 2BOSA 4HCEA 3KDFA 5KFDA 1LM0A 3E5SA 2E5LQ 3GTLA 1BBXC 3BDCA 5D65A 4BBSB 2YZMA 4P73A 2BQUA 4JG2A 1Q81C 2XCLA 2EOTA 4JV5L 4JI3H 4QGUA 2UUAQ 3DM3A 3H15A 4A76A 3S14B 2P5ZX 1Q90A 1H9JA 4UCSA 2L1BA 1TWFB 1I4RA 5FKAC 2LMCB 3GIDA 5CC4A 4ZQIA 2F0QA 2F0LA 3R8BA 2QCPX 1JDEA 2R61A 4DV2Q 4ECWA 4DV5Q 3A0JA 2VQEH 3MFGA 3RD4A 2ZTCA 3CHBD 4LF7L 3DF7A 1BCPC 3RB0A 2R93G 3GQCA 4R1JA 2HHHH 3ICEA 3M7NA 4LH7A 1KAWA 1KJIA 3V6HA 3VR3A 2UVVA 1K1SA 4ALPA 4FXDA 3S16B 4J0MA 3FDTA 3PO2B 4FF2A 5DG8A 3CD6A 2LS01 2UUBQ 4JI4H 4RAZA 2PMZB 4TQRA 3W2DA 1J6QA 3H20A 5M3MB 4HMIA 2C2RA 1DONA 3Q2OA 1I3QB 2F52A 4APVA 1PH6A 2K7VA 4A93H 4IR9A 1I4PA 1MI2A 5AJ3Q 5M5YB 1E22A 3I4OA 1C8CA 4IUVA 3HOVB 3X3NA 3RB3A 2AGOA 1VQ9A 2JEBI 1X3FA 4YAKB 1CA6A 4C3HH 1KLGD 3PIPA 1Y14B 1KC7A 1PRTF 1PYWD 1GSAA 3STBC 3S1MB 2ZJPA 4X64H 4FF4A 3GV6A 3EIVA 1OO9B 3MJFA 4E4TA 1M6VA 3H0GG 5J39A 3SK5A 4YHHL 3TIGA 3KTMA 1A3UA 3L0OA 5C0XH 1ZHSA 1MD2D 5D1PA 3R2TA 3GTKB 5IOCA 2NVYA 5C3EB 1EFWA 4Q0YA 2YU9B 4PNYA 1TKWB 4DV4H 2NU6B 5I4DA 3UI2A 3FPPA 1M8AA 4RB1A 3N52A 1DOLA 5BR8H 2ZJTA 4DL4A 5IGGA 3V96A 3K5IA 1W3SA 5NUCA 4BBSH 5EPJA 3Q22A 2J6UA 2G5DA 4FBUA 4ME5A 2DWCA 3RBEA 2UXDQ 2PW5A 3J7AV 1WR2A 1VQDA 4FO2A 3S14H 3FKIB 1CM9A 4MNOA 3J80c 4KN4C 1TWFH 1EZ8A 4B3RL 1RTNA 1HHVA 3RV4A 2KHIA 3T4AC 1PK8A 4NB3A 1O7YA 4HJAA 3I4LA 3KJPA 1V51A 1WCMG 1ENCA 3GTGA 4TSSA 1N34L 1PDQA 4ECUA 1JE4A 4DV3H 4LSAA 3HKZA 2DN8A 4CKCA 4MAMA 2DPJA 4DR1L 1FJGH 1M90C 2RSOA 1F9PA 5IYCG 1G91A 2W8LA 1UE7A 2F0SA 2X6LA 1KNEA 3BJUA 4K5VA 4A3LG 4OWWB 1VQ5A 4B3MQ 1U9RA 1S68A 3S16H 1VBGA 2Q2IA 3PO2H 1S5DD 2AMCB 2XGTA 4RGTA 1SFOB 4MTEA 1SAPA 1IL2A 3GTQB 1EZ6A 5M3MH 1OXVA 2K32A 3R2IA 4DV0H 4JI8H 1DOMA 3HOZG 5CA0F 2R93A 3M4QA 1X65A 3TQTA 5F9NA 1D6EC 5EOYA 5M5YH 3HOUB 3HOVH 4FF1A 1SROA 2JA5B 3NWTA 1DIKA 5IGFA 2OWOA 5JH7F 1UUPA 1PYBA 3F2DA 2ATWA 2YL2A 2EY6A 2K5QA 1L1OB 4KTAA 4YP3A 3V6KA 1J9OA 2MUYA 2BDOA 3S1MH 4JI0H 4XIGS 4KHPH 3VR6A 5LMNH 3PCOB 1ET9A 4LF5L 3GIJA 1KD1C 3T1YH 2QA4A 1LTAD 1W96A 2NVTB 3KHLA 4PZ8A 3NBIA 3GTKH 4IJHA 3DEOA 2WB1B 3AFQA 5C3EH 2YU9H 3UDXA 2EIFA 1BCPF 2RDHA 1QE6A 4DAVA 2R6GA 4JK1C 2WE6A 3WNZA 3M7GA 4XDXA 2M05A 4RAUC 1EYAA 1X6OA 3NGDA 4J6HA 3PZPA 3WOFA 3G6YA 1UC9A 2CWAA 4ZHQF 4H0LC 3N8DA 3J7A5 4UAIA 1TWCA 1TR5A 1EUJA 2KENA 3GD7A 1E3PA 4K5XA 2ALYB 1A15A 2WAQG 3HS0C 2FXQA 1BO0A 3T5HA 3E6ZX 4NXML 1TWAB 4DR7H 1QNKA 3DEPA 1RJRA 2F0KA 1PA6A 5GONF 2KHSA 3EJIA 1K28A 4RA8A 2AGQA 2K6AA 1IKLA 4A3IB 3S1RB 2J6SA 3CCVA 1EIHA 1HPCA 1CUKA 2A6HD 1Q8IA 1V1PB 2CW0C 2VUMG 4HQ6A 2I5HA 4JI1Q 1B2TA 4GOPB 3BA9A 1SEBD 2XNAC 4RNNA 2R92A 3ULPA 3BZDB 4NP5A 2V4DA 1BF4A 4DR4L 5KG3A 3KF6B 4TQUS 4UP9A 5C44B 1SFOH 1GUNA 5LHY1 4A3DG 3PW2A 1GKHA 4DA2A 3GTQH 2K05A 2EYLA 5IE8A 1CI3M 1SE2A 1HFNA 5KNBA 2B2VA 1KXLA 2JK8A 3HOUH 1N9WA 2JA5H 4QY7A 1D8LA 4R4IA 5I2YA 4X65H 4DV1H 3HOYG 5IY0A 4JI2Q 3D6CA 3T53B 3N6XA 4LF6Q 1T36A 2C9OA 4K2KA 4JYAQ 2VQFQ 5C4XG 2C00A 1S0OA 4LF9Q 2A73B 3JZIA 1IXRA 1GHKA 1XNQQ 4GLAC 1IZ6A 5HGTA 4DR5Q 1WTVA 1QZGA 1UNNC 1BDOA 4JI6Q 4A4IA 2NVTH 3HEJA 3DWPA 3JSLA 3HOXG 4IAJA 4LFAL 4FF3A 5H80A 3I73A 3T5JA 1XNRL 3RFCA 3ER0A 1RF2D 1PH4A 1YNXA 4A3EB 2Q2UA 4CDCC 5CBEE 3GIQA 4F4ZA 1PTOC 2RHSB 3RGXA 3CRKC 2R7ZB 4JI7Q 4DV6H 4DR3L 1H9SA 1HQMC 3BYTB 4C2MA 1R4PB 4HJ8A 4QUCA 4J9KA 4KKSA 3BZKA 4ECRA 1SJHD 2TMPA 1EYCA 2DJGC 2SOBA 5T1IA 5EKIA 2NVQB 1TWAH 2F0UA 5KFTA 3PO3B 3RGZA 4LF4L 1IW7C 2WTFA 1LTSD 2EE1A 3P7JA 1D1KA 3PSIA 2KCMA 1H95A 1KLUD 2LXKA 3BQ1A 3S1RH 4A3IH 4EQPA 1STEA 1VDZA 1K73C 4PZ6A 5CV4A 2SCUB 3GV8B 1I6UA 1Y1WG 4JV2A 5FJ8H 4JI4Q 2ZDGA 2Q2HA 5FK9C 3HXLA 1K8AC 4ZOLF 1N8RC 5JEAG 1SYBA 4M7EA 1OXXK 2GVBA 5C44H 2K5HA 4O2DA 1N36L 4B3SL 4QW8A 1RK6A 2ATLA 4KN7C 5KFIA 3D4DA 2BA0A 3QB3A 4X3UA 5IGCA 3D4RA 5CV5A 2D0PA 3NWSA 3MXNA 1Q46A 2ZTEA 1LTID 1MKHA 4J9SA 4PDBA 1YVCA 5LMNW 4OWTB 3SE0A 4QWBA 2HCCA 4HN7A 4HR7A 2UVUA 2FPGB 1U5KA 2W9BB 4FNFA 1EOVA 2WP8J 3EFXD 3DUZA 2KA7A 3BABA 4CBVA 4FDBA 2R7DA 2K14A 3N43B 3MC0B 2EY1A 1M4VA 3PUYA 2VPQA 2JN4A 3NSWA 2DPIA 3G71A 1YNJD 4KKUA 4GS3A 5DG7A 1XDNA 4DL7A 1N32L 2R8IA 5EKLA 1UEBA 4DGZA 2UXBL 1U4LA 5M3FG 2CQAA 4AQYH 3FHWA 1X3GA 5BR8Q 4UDUC 4OO1I 4IFDI 1HUMA 2Q2TA 3JRXA 4MTDA 2I80A 3GV7B 1IBKL 1PH3A 4A3EH 3I55A 1YEZA 4OXPA 4I55F 4C3JG 4AYBE 3ULLA 4F4YA 3QO2A 2R7ZH 5KFNA 2IL8A 1DGSA 4DR2Q 1GHJA 3BAAA 3PQIA 4H7BA 4AYBG 3RIZA 1J8IA 2V5AA 2AUKA 1SYCA 2VA3A 1NUCA 2K33A 4O42A 2MO1A 2NVQH 2EVBA 1EWCA 1E2ZA 2NUCA 3PO3H 4RUAA 3M9NB 3MWYW 4DV3Q 4X66H 4GNXB 3CQZB 4GKJQ 5ELBA 1FJGQ 3PW5A 1JJCB 5KFPA 3PUVA 3K81C 4Q43A 4KHVA 1VQMA 4R4QA 4RNOA 4NXNL 2OQKA 1C9OA 4LMYA 1VF7A 4KD4A 2PQAA 4ZLTF 1ASZA 1W2BA 2BH2A 2EYJA 4JI5H 3IG0A 4HMJA 3BDLA 1GUWA 3RN2A 2NVXB 4JI8Q 1PRTD 3MAQA 3LGJA 1MJEA 1J5EH 5KT2A 4O3SA 1YHBA 5JJZA 3QFFA 3WO0A 1FKAH 1E4EA 2O5IC 2HVQA 4DL6A 1TT2A 4CKBA 4HIOA 2W9CB 4LF8H 3TREA 4JV1A 1STBA 1DM0B 1SYXB 2VOBA 1SLJA 3H91A 2FKLA 2FMAA 1W6JA 2NN6H 1E24A 4DXFA 2PVPA 1Q1EA 1Y1WA 2UVWA 1KRSA 1TQOA 5KFHA 3J80W 2JJQA 4ZAIA 5C5JA 4KHPQ 2B3GA 5LMNQ 3QWNA 4IZ8A 3TEHB 2O03A 1PFSA 2V9WA 2R6FA 1LO5D 3V4ZA 2KEDA 2K50A 1HFGA 5FO7B 5BN3A 1PLFA 2VL6A 3T1YQ 3F8NA 3K3VA 3RZDB 2J4XA 1CQJB 4CDEC 1MSHA 4TV8F 3PVXA 5A2QL 4YCVA 1BXRA 1TA8A 4EYHB 1XXGA 1VS0A 2RVLA 3CCSA 2DY7A 4IALA 4A3FB 1PH5A 1A63A 2W6NA 1B6RA 3HFZB 1YZ6A 2JA6B 1IYUA 3IAYA 5C5LA 2AWOA 3J81E 3NK9A 1PH7A 3H3VH 3I8ZA 5BPHA 1K83B 4DK1A 5E4WC 1EL0A 1K0SA 1JT8A 4LF7H 1SYFA 4M1UB 5KRUA 2HJWA 5FLXL 4WORA 4M9UA 3R5HA 1WD1A 4CJ2C 2ASBA 1D1IA 1SYEA 1TWHA 4L63B 4YR0A 5E1FA 2FMMA 1HZBA 3D6WA 4YY3Q 2RCNA 2PNHA 4BBRG 4ED8A 3HKSA 1M0WA 4DL5A 4KJOA 2ID0A 2R85A 2F0FA 2I5MX 5KFSA 5K2MA 4RNMA 3S24A 5LXTF 3BDOA 2RF4A 4POFA 3L3OC 3HOWG 5KT7A 1Q82C 1WYDA 4UPAA 4EVOA 4P74A 5FLMH 3CC4A 3CQZH 1GLVA 5KFVA 1RYRA 3JAML 4MV1A 1T94A 5EJWA 2JA8G 4OO1G 1L2FA 1SMYC 4IFDG 2CFMA 3MFYA 5COYA 4JV0A 3ULJA 3RB4A 4K0KL 3BVMA 3NTKA 5I9PA 2Y0SA 4RWSC 2NVXH 4YHHH 3CW2C 1E7ZA 1FR3A 5C3WA 2EYFA 1HNXL 1VQHA 2P0AA 1IL8A 3GTMH 2BCOA 4K14A 3OW7A 2B63B 1Q86C 1FVIA 3RF2A 4FM9A 1Q1BA 4MTKA 4DV1Q 1CSQA 4MA0A 2EZVA 2BQ3A 4NMZA 1AW7A 1CS0A 3BS1A 3C2PA 1W6KA 4LSXA 5KFMA 2E75C 4XYLB 5KT6A 1BCPD 3PV0A 1PRTC 1JLLB 3R3OA 3H4DA 3KK7A 3SEBA 2MQHA 4O1NA 5IP7H 1IKMA 4L6TB 3RZDH 4UY8C 3PW0A 1BR9A 1I94L 1NY4A 4B3RH 3CRLC 2RKSA
chains in the Genus database with same CATH topology
3BU2A 1VQPA 3L0OA 1JJ2A 3JC66 5IYCH 3T1HL 4JI4L 3K7UC 5LMUQ 1S40A 2MFIA 3KYHC 1EFWA 2JA6H 1RIPA 1Q8KA 3FP9A 4R4CA 4EX5A 4LF5Q 4A3LH 4A3CH 1IBLQ 2YTXA 1K83H 3E9IA 4YY3L 1Z9FA 1PH9A 3RN5A 4JBWA 3VDYA 1W3SA 3CMEA 2UXCL 4BBSH 3KOJA 4DV0Q 3STBD 3FKIG 3HOZH 3I7FA 5GROA 3CCJA 2UXDQ 4LUOA 4PG3A 4A93G 4GKKL 1VQDA 4X64L 1XMOL 3S14H 1X9NA 5JJIA 4MNOA 2R7FA 3J80c 1TWFH 3M4PA 4B3RL 2KHIA 4QJFA 4DV5L 3OW2A 4IPGA 4JI0Q 3RNUA 4GN3B 4NB3A 4HJAA 1JB7A 5IP7G 3KJPA 1PH1A 3EBEA 1WCMG 4DV4L 1WOCA 3J81c 1Z47A 1N34L 4Y52H 4NXMQ 1QUQB 1K3RA 4X62Q 4GNXC 5BR8L 4HIMA 1XPUA 1N32Q 4DR1L 5C0XG 4J15A 1M90C 5IYCG 2Z0SA 2UUBL 1UE7A 1VQCA 3BJUA 5IYDH 2UU9L 2JA6G 4A3LG 3ZJYC 1VQ5A 3RR5A 4B3MQ 4OWWB 2CCZA 2V1CC 3S16H 1HZAA 2Q2IA 4A3CG 3PO2H 1Q12A 2ZM6L 5AJ3L 2AMCB 2XGTA 3TQYA 3A5UA 1XMQQ 2N78A 4XTCS 1IL2A 2B63H 1VQ6A 2OCEA 4JC0A 3KLWA 5M3MH 1OXVA 4BBSG 4WJ4A 1N33Q 1UE1A 3HOZG 3S1NH 3M4QA 1X65A 4DR4Q 1B7YB 5M5YH 1IBML 4P72A 3HOVH 1SROA 2Z6KC 1LYLA 1YJ9A 2OWOA 3MEFA 1PYBA 1QZHA 2IX0A 3F2DA 2ATWA 1VQJA 1VQEA 4DNIA 1JMCA 5GADC 4BY7H 4BXXH 4GKJQ 1L1OB 3TS0A 2ZTDA 4RG1A 4P75A 3G48A 5IWAQ 3L2PA 4DV3L 4DV7L 4A3MH 4DR7Q 4AIMA 3HKZG 3S1MH 1FJGL 4XIGS 4HIDA 5LMUL 3DLLA 1MJCA 3J80i 1VQGA 3RLOA 3D31A 3PCOB 5EAYA 4LF5L 1LUZA 1KD1C 2QA4A 2AKWB 1IBLL 4OX9L 2YTYA 3M3YH 4PZ8A 5IYBH 3I56A 2VUMH 4A3BH 3GTKH 4IJHA 5C0XJ 1PVOA 2VS1A 3AFQA 5C3EH 1PYSB 2BA1A 2YU9H 3S2DH 5IYDG 3UDXA 2EIFA 4JI8L 4DV0L 1G291 4NPSA 3J81i 2VNUD 2K5NA 2R6GA 1X3EA 2UXDL 3PO2G 1YHAA 2B29A 4RMFA 1YITA 1TWCH 4A3DH 4DAMA 4PMWA 4EQ5A 2B63G 4LFAQ 2E2HH 4BA2I 1X6OA 5M3MG 4Y7NH 1XNRQ 3UDIA 1V43A 2CWAA 1HNZL 4JI0L 2IHFA 3J7A5 3KFUA 2E8GA 1EUJA 5LMNL 3HOVG 4KHPL 2KENA 3GD7A 1E3PA 2ALYB 4X65Q 2WAQG 2NZHA 4X66Q 2NZOA 2FXQA 3Q8DA 3CCUA 4A75A 1E1OA 3KJOA 4DR3Q 1XPRA 4BY7G 4BXXG 2CQOA 3SGIA 3T1YL 4A3MG 3W1BA 4NXML 1LTLA 2D0OA 1YI2A 4IOAA 5C4XH 2F4VL 1T9HA 1PA6A 4LFBQ 5M5XH 4JI5Q 3I4MH 2R92H 2Y0SE 4GN4B 5HGQA 3CCVA 1XPOA 4B3ML 3K0XA 1WJJA 1EIFA 1CUKA 4LFCQ 2H5XA 3HOXH 4JCVE 2VUMG 1J5EQ 4A3BG 3F1ZA 2PI2A 2D62A 2I5HA 2YTVA 4JI1Q 4GOPB 5C3EG 3NENA 2A8VA 4P71A 3U58A 3CMAA 3ULPA 1QUQA 1N33L 3MXNB 4IFDJ 2E5LL 1BVSA 4DR4L 2IX1A 3K80C 3KF6B 4TQUS 4UP9A 4A3JH 1HH2P 1YJWA 1SFOH 1K8GA 4BY1H 4A3DG 1GKHA 4IO9A 3GTQH 5DLQE 3CC7A 4DV6Q 1C7YA 3I4NH 5IE8A 1NJIC 5IWAL 1VQNA 2UUAL 3PGZA 4DR7L 1CKNB 4C3IH 1MIUA 2JK8A 1QVGA 1KXLA 3HOUH 1N36Q 4QL5A 1N9WA 4UP7A 2JA5H 4B3SQ 4WJ3M 4QY7A 2DGYA 1HZ9A 1D8LA 2WFWA 4R4IA 1KIXA 1Y1VH 3WWVA 3HOYG 2PI2E 5IY0A 3GTOH 3HOYH 4DUZL 4JI2Q 4DK3C 1HNWL 4YCWA 2E2JH 4LF6Q 3NELA 5HY6A 4JYAQ 2VQFQ 4IPHA 5C4XG 2UUCQ 4DV2L 3CCEA 4L5QA 4LF9Q 4DR6L 1IXRA 3EN2A 2HIXA 1XNQQ 4GLAC 1IZ6A 3I4MG 4DR5Q 1L1OA 1KRTA 1QZGA 3U4VA 2EXDA 2R92G 1NMGA 4JI6Q 4A4IA 2NVTH 3G6EA 3F2CA 5GAHC 1VQKA 3HOXG 2K4KA 1Y1WH 4DKAC 1C0AA 1NE3A 3RLFA 1V9PA 4LFAL 4K0KQ 4YWLA 1XNRL 4DUYL 3ER0A 2UXBQ 3J7ZC 1XTDA 2F3IA 4LW1A 3KF8B 4C2MH 1YNXA 1PH4A 2Q2UA 3NBHB 4BY1G 4A3JG 1HNXQ 5FLXc 2GVAA 3UE1A 4X65L 2RHSB 1SN8A 1BBWA 1SMXA 3BZCA 3PIOA 2ZJRA 4DV1L 4JI7Q 4DR3L 3I4NG 4OWXB 1IBKQ 2KCTA 4R4TA 5IT9c 4HJ8A 2CKZB 1HR0L 3HOUG 2JA5G 4LFBL 3BZKA 2HQLA 3GDEA 5ELOA 1Y1VG 3TRZA 2AHOB 1EIYB 3NEMA 1TWAH 4A3GH 4GN5A 3HKZE 4DPGA 5H1SE 4LF4L 2PQAB 4LFCL 1V1QA 4LUZA 3PSIA 1HZCA 2KCMA 5IP9H 4GLVB 1AH9A 1H95A 3JAMc 4JI1L 3CPFA 4PZ7A 2LXKA 3W1GA 2OTLA 3S1RH 4A3IH 1AE2A 1HJPA 4LWCA 1I94Q 3GTLH 4IPCA 3AFPA 4AQYQ 5M3FH 2MNAA 2YYZA 1I50H 1K73C 4PZ6A 1JJGA 3B6YA 3E0EA 1SRUA 1Y1WG 2WB1G 3D0FA 3T1HQ 5FJ8H 3J81j 3CXCA 4JBMA 4JI4Q 1U0LA 2Q2HA 4DV6L 1VQ7A 4NXNQ 2CWPA 1K8AC 3U4ZA 1N8RC 5JEAG 1YJNA 2K52A 3TS2A 1OXXK 2GVBA 3L7ZC 2K5HA 4O2DA 5C44H 1N36L 4B3SL 3CCRA 4GOPA 2PMZE 4C3JH 4QIWE 3S17H 2BA0A 1GM5A 2N49A 2D0PA 1R9TH 4YWKA 2UXCQ 2EQSA 1Q46A 2ZTEA 1MKHA 3A74A 1IYJB 1WI5A 1BKBA 1B8AA 1YVCA 3KF6A 4OWTB 5LMNW 2VQFL 4LF6L 4JYAL 1UE6A 4LUVA 2UUCL 4LF9L 1S72A 4GKKQ 4KHZA 2WAQE 2NN6I 1XMOQ 3M4OH 4LNQA 1I6HH 1X56A 1U5KA 2LXJA 1XNQL 1EOVA 2WP8J 4DR5L 1ASYA 3S2HH 2HT1A 1CKNA 4JI6L 4O0AA 4A3GG 1TWGH 4B3RQ 5K36G 1A0IA 4FDBA 2R7DA 2A1AA 2K14A 3A5ZB 3CF5A 3CAMA 5GAGC 5IP9G 1VQFA 1L1OC 3PUYA 1B70B 2E2IH 4B3TQ 3I2ZA 3G71A 4KI0A 1E1TA 4GS3A 4X62L 1EQQA 1Q7YC 1PH8A 4A3IG 4BA1I 1N32L 2MO0A 1UEBA 3F2BA 1N34Q 4UP8A 1VQ8A 5M3FG 3AQQA 3PUXA 2UXBL 3OTOQ 3FHWA 1X55A 3KDFB 1X3GA 2JA7G 5BR8Q 4IOCA 1BBUA 4DR1Q 4YCUA 4OO1I 5M5WH 3M85A 5FJ8G 4IFDI 3JAMi 2Q2TA 4JI7L 2UU9Q 1XMQL 1IBKL 3ERSX 1PH3A 2GN5A 2L15A 3I55A 4A3EH 1YEZA 5C44G 1VQBA 4OXPA 3M9BA 2ZM6Q 3H3VI 4AYBE 1VQIA 3ULLA 4LF8Q 2R7ZH 5J3BA 3W5OA 1SR3A 3F8TA 1S3OA 2AWNA 1DGSA 4DR2Q 1GO3E 3S15H 2OTJA 4DAYB 4AYBG 2XTIA 3S1QH 2BH8A 1IBMQ 3GO5A 1CKOA 1RL2A 4IPDA 1QVFA 5ELNA 1EQRA 3PF4A 4JV5Q 4DK6C 4X6AH 2MO1A 4TVAB 2NVQH 2RHQB 3PO3H 4AQYL 4L5TA 1PV4A 4DV7Q 1SE8A 4DV3Q 4HJ9A 4QQBX 4GNXB 1QVCA 4L5RC 4OONA 1FJGQ 1PHJA 3CPWA 3IRBA 1JJCB 3RZOH 3PUVA 3K81C 4A3FH 1YHQA 1FGUA 5GQOA 1VQMA 4R4QA 3K8AA 1K0RA 4NXNL 2OQKA 1C9OA 2PQAA 1ASZA 1UWVA 4OX9Q 1W2BA 2BH2A 3CC2A 2QEXA 4JOIA 4JBJA 3RN2A 4HIKA 2C35B 4JI8Q 4A3KH 1GVPA 2I5LX 3LGJA 5C4JH 1MJEA 4LF7Q 4IJLA 4GOPC 4A3EG 1YHBA 3OYYA 3CP0A 3PUWA 1VQ4A 4YWMA 2LSSA 4MZ9A 3CCLA 1L0WA 1X54A 4HIOA 3AEVA 2R7ZG 1WFQA 3TREA 1OXTA 4JI3Q 1SLJA 1VQLA 4POGA 4BBRH 3GTGH 1E24A 2N8NA 1HR0W 1Q1EA 2JEAI 2I0QA 1KRSA 1YBYA 4KLKA 4X66L 2JJQA 3CCMA 1KC8C 1HNZQ 5E7NA 4JBKA 1EWIA 4KHPQ 2B3GA 5LMNQ 4B3TL 1G6PA 2IT1A 1D7QA 3TEHB 3HOWH 1NTGA 1PFSA 1NMFA 2K50A 2VL6A 2VY3A 3T1YQ 3PF5A 3PO3G 1P8LA 3OTOL 1JE5A 4R4OA 4JI5L 1A62A 2F4VQ 1OTCA 4A3FG 2A19A 4YCVA 1AE3A 2VQEQ 4L5SA 2JA8H 2OQ0A 1P16A 1J5EL 1VS0A 3CCSA 1I5FA 2HHHQ 1PH5A 2R93H 1FL0A 1EYGA 1A63A 2HIVA 1O7IA 2WB1E 2K5VA 1YZ6A 3HFZB 4MTNA 3GTJH 5C0XI 5JJKA 4YHHQ 2AWOA 4LF8L 1TWHH 1PH7A 3K7AH 2JA7H 5JJLA 3H3VH 3UE0A 1K9MC 4A3KG 5GAEC 4HJ5A 1I3QH 3KDFA 4DR2L 1OXUA 1LM0A 1JT8A 2E5LQ 2JA9A 1KHIA 2ASBA 3PUZA 4P73A 2JE6I 2JQOA 1KL9A 2KHJA 4JG2A 1Q81C 1HZBA 4YY3Q 4JV5L 1NBWA 2RCNA 2PNHA 2NN6G 4BBRG 3HKSA 4QGUA 2UUAQ 3DM3A 4H02A 2ID0A 2VW9A 3H15A 4A76A 1M1KC 4GKJL 2I5MX 3S24A 4JI2L 3E9HA 1UE5A 4ME3A 1VQAA 2RF4A 3RLNA 4POFA 3HOWG 4DUZQ 4X64Q 1WYDA 1Q82C 1HNWQ 4UPAA 5FLMH 4P74A 1CSPA 3CC4A 3CQZH 2QGQA 2IHEA 4DV2Q 3H0GH 4DR6Q 2YV5A 4DV5Q 2JA8G 2KBNA 3A0JA 4OO1G 1L2FA 1YIJA 4IFDG 2ZTCA 2CFMA 4LF7L 4JOIC 3ULJA 4GNXA 2R93G 4R1JA 1TXYA 1VQOA 3ICEA 3M7NA 2VZAA 4DV4Q 4HJ7A 4K0KL 1KAWA 2DUDA 4ALPA 2NVXH 3AYHB 4JI3L 1OXSC 3CW2C 1E7ZA 4AH6A 1HNXL 1VQHA 2ZJQA 4DUYQ 1XJVA 3CD6A 3GTMH 2UUBQ 1Q86C 1PH2A 2K75A 1J6QA 1FVIA 1Q1BA 3FKIH 3UDFA 2F52A 4DV1Q 1CSQA 1VCIA 4APVA 4GLXA 5JEAJ 1PH6A 4A93H 5AJ3Q 1E22A 3I4OA 1VQ9A 1A8VA 2JEBI 1KQSA 1X3FA 3UDGA 1HR0Q 1G51A 4C3HH 3PIPA 3U50C 1CKMA 2Z6KA 1GD7A 1Y14B 2VQEL 3PV0A 3CCQA 3STBC 2MQHA 3G4SA 5IP7H 2ZJPA 3RZDH 5FLMG 2HHHL 2ES2A 1WCMH 2N3SA 2NVYH 3EIVA 4LF4Q 4UY8C 1I94L 2IY5B 5IYBG 3GTPH 1NY4A 3H0GG 4YHHL 2Y0SG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BU2 A;  1VQP A;  3L0O A;  1JJ2 A;  3JC6 6;  5IYC H;  3T1H L;  4JI4 L;  3K7U C;  5LMU Q;  1S40 A;  2MFI A;  3KYH C;  1EFW A;  2JA6 H;  1RIP A;  1Q8K A;  3FP9 A;  4R4C A;  4EX5 A;  4LF5 Q;  4A3L H;  4A3C H;  1IBL Q;  2YTX A;  1K83 H;  3E9I A;  4YY3 L;  1Z9F A;  1PH9 A;  3RN5 A;  4JBW A;  3VDY A;  1W3S A;  3CME A;  2UXC L;  4BBS H;  3KOJ A;  4DV0 Q;  3STB D;  3FKI G;  3HOZ H;  3I7F A;  5GRO A;  3CCJ A;  2UXD Q;  4LUO A;  4PG3 A;  4A93 G;  4GKK L;  1VQD A;  4X64 L;  1XMO L;  3S14 H;  1X9N A;  5JJI A;  4MNO A;  2R7F A;  3J80 c;  1TWF H;  3M4P A;  4B3R L;  2KHI A;  4QJF A;  4DV5 L;  3OW2 A;  4IPG A;  4JI0 Q;  3RNU A;  4GN3 B;  4NB3 A;  4HJA A;  1JB7 A;  5IP7 G;  3KJP A;  1PH1 A;  3EBE A;  1WCM G;  4DV4 L;  1WOC A;  3J81 c;  1Z47 A;  1N34 L;  4Y52 H;  4NXM Q;  1QUQ B;  1K3R A;  4X62 Q;  4GNX C;  5BR8 L;  4HIM A;  1XPU A;  1N32 Q;  4DR1 L;  5C0X G;  4J15 A;  1M90 C;  5IYC G;  2Z0S A;  2UUB L;  1UE7 A;  1VQC A;  3BJU A;  5IYD H;  2UU9 L;  2JA6 G;  4A3L G;  3ZJY C;  1VQ5 A;  3RR5 A;  4B3M Q;  4OWW B;  2CCZ A;  2V1C C;  3S16 H;  1HZA A;  2Q2I A;  4A3C G;  3PO2 H;  1Q12 A;  2ZM6 L;  5AJ3 L;  2AMC B;  2XGT A;  3TQY A;  3A5U A;  1XMQ Q;  2N78 A;  4XTC S;  1IL2 A;  2B63 H;  1VQ6 A;  2OCE A;  4JC0 A;  3KLW A;  5M3M H;  1OXV A;  4BBS G;  4WJ4 A;  1N33 Q;  1UE1 A;  3HOZ G;  3S1N H;  3M4Q A;  1X65 A;  4DR4 Q;  1B7Y B;  5M5Y H;  1IBM L;  4P72 A;  3HOV H;  1SRO A;  2Z6K C;  1LYL A;  1YJ9 A;  2OWO A;  3MEF A;  1PYB A;  1QZH A;  2IX0 A;  3F2D A;  2ATW A;  1VQJ A;  1VQE A;  4DNI A;  1JMC A;  5GAD C;  4BY7 H;  4BXX H;  4GKJ Q;  1L1O B;  3TS0 A;  2ZTD A;  4RG1 A;  4P75 A;  3G48 A;  5IWA Q;  3L2P A;  4DV3 L;  4DV7 L;  4A3M H;  4DR7 Q;  4AIM A;  3HKZ G;  3S1M H;  1FJG L;  4XIG S;  4HID A;  5LMU L;  3DLL A;  1MJC A;  3J80 i;  1VQG A;  3RLO A;  3D31 A;  3PCO B;  5EAY A;  4LF5 L;  1LUZ A;  1KD1 C;  2QA4 A;  2AKW B;  1IBL L;  4OX9 L;  2YTY A;  3M3Y H;  4PZ8 A;  5IYB H;  3I56 A;  2VUM H;  4A3B H;  3GTK H;  4IJH A;  5C0X J;  1PVO A;  2VS1 A;  3AFQ A;  5C3E H;  1PYS B;  2BA1 A;  2YU9 H;  3S2D H;  5IYD G;  3UDX A;  2EIF A;  4JI8 L;  4DV0 L;  1G29 1;  4NPS A;  3J81 i;  2VNU D;  2K5N A;  2R6G A;  1X3E A;  2UXD L;  3PO2 G;  1YHA A;  2B29 A;  4RMF A;  1YIT A;  1TWC H;  4A3D H;  4DAM A;  4PMW A;  4EQ5 A;  2B63 G;  4LFA Q;  2E2H H;  4BA2 I;  1X6O A;  5M3M G;  4Y7N H;  1XNR Q;  3UDI A;  1V43 A;  2CWA A;  1HNZ L;  4JI0 L;  2IHF A;  3J7A 5;  3KFU A;  2E8G A;  1EUJ A;  5LMN L;  3HOV G;  4KHP L;  2KEN A;  3GD7 A;  1E3P A;  2ALY B;  4X65 Q;  2WAQ G;  2NZH A;  4X66 Q;  2NZO A;  2FXQ A;  3Q8D A;  3CCU A;  4A75 A;  1E1O A;  3KJO A;  4DR3 Q;  1XPR A;  4BY7 G;  4BXX G;  2CQO A;  3SGI A;  3T1Y L;  4A3M G;  3W1B A;  4NXM L;  1LTL A;  2D0O A;  1YI2 A;  4IOA A;  5C4X H;  2F4V L;  1T9H A;  1PA6 A;  4LFB Q;  5M5X H;  4JI5 Q;  3I4M H;  2R92 H;  2Y0S E;  4GN4 B;  5HGQ A;  3CCV A;  1XPO A;  4B3M L;  3K0X A;  1WJJ A;  1EIF A;  1CUK A;  4LFC Q;  2H5X A;  3HOX H;  4JCV E;  2VUM G;  1J5E Q;  4A3B G;  3F1Z A;  2PI2 A;  2D62 A;  2I5H A;  2YTV A;  4JI1 Q;  4GOP B;  5C3E G;  3NEN A;  2A8V A;  4P71 A;  3U58 A;  3CMA A;  3ULP A;  1QUQ A;  1N33 L;  3MXN B;  4IFD J;  2E5L L;  1BVS A;  4DR4 L;  2IX1 A;  3K80 C;  3KF6 B;  4TQU S;  4UP9 A;  4A3J H;  1HH2 P;  1YJW A;  1SFO H;  1K8G A;  4BY1 H;  4A3D G;  1GKH A;  4IO9 A;  3GTQ H;  5DLQ E;  3CC7 A;  4DV6 Q;  1C7Y A;  3I4N H;  5IE8 A;  1NJI C;  5IWA L;  1VQN A;  2UUA L;  3PGZ A;  4DR7 L;  1CKN B;  4C3I H;  1MIU A;  2JK8 A;  1QVG A;  1KXL A;  3HOU H;  1N36 Q;  4QL5 A;  1N9W A;  4UP7 A;  2JA5 H;  4B3S Q;  4WJ3 M;  4QY7 A;  2DGY A;  1HZ9 A;  1D8L A;  2WFW A;  4R4I A;  1KIX A;  1Y1V H;  3WWV A;  3HOY G;  2PI2 E;  5IY0 A;  3GTO H;  3HOY H;  4DUZ L;  4JI2 Q;  4DK3 C;  1HNW L;  4YCW A;  2E2J H;  4LF6 Q;  3NEL A;  5HY6 A;  4JYA Q;  2VQF Q;  4IPH A;  5C4X G;  2UUC Q;  4DV2 L;  3CCE A;  4L5Q A;  4LF9 Q;  4DR6 L;  1IXR A;  3EN2 A;  2HIX A;  1XNQ Q;  4GLA C;  1IZ6 A;  3I4M G;  4DR5 Q;  1L1O A;  1KRT A;  1QZG A;  3U4V A;  2EXD A;  2R92 G;  1NMG A;  4JI6 Q;  4A4I A;  2NVT H;  3G6E A;  3F2C A;  5GAH C;  1VQK A;  3HOX G;  2K4K A;  1Y1W H;  4DKA C;  1C0A A;  1NE3 A;  3RLF A;  1V9P A;  4LFA L;  4K0K Q;  4YWL A;  1XNR L;  4DUY L;  3ER0 A;  2UXB Q;  3J7Z C;  1XTD A;  2F3I A;  4LW1 A;  3KF8 B;  4C2M H;  1YNX A;  1PH4 A;  2Q2U A;  3NBH B;  4BY1 G;  4A3J G;  1HNX Q;  5FLX c;  2GVA A;  3UE1 A;  4X65 L;  2RHS B;  1SN8 A;  1BBW A;  1SMX A;  3BZC A;  3PIO A;  2ZJR A;  4DV1 L;  4JI7 Q;  4DR3 L;  3I4N G;  4OWX B;  1IBK Q;  2KCT A;  4R4T A;  5IT9 c;  4HJ8 A;  2CKZ B;  1HR0 L;  3HOU G;  2JA5 G;  4LFB L;  3BZK A;  2HQL A;  3GDE A;  5ELO A;  1Y1V G;  3TRZ A;  2AHO B;  1EIY B;  3NEM A;  1TWA H;  4A3G H;  4GN5 A;  3HKZ E;  4DPG A;  5H1S E;  4LF4 L;  2PQA B;  4LFC L;  1V1Q A;  4LUZ A;  3PSI A;  1HZC A;  2KCM A;  5IP9 H;  4GLV B;  1AH9 A;  1H95 A;  3JAM c;  4JI1 L;  3CPF A;  4PZ7 A;  2LXK A;  3W1G A;  2OTL A;  3S1R H;  4A3I H;  1AE2 A;  1HJP A;  4LWC A;  1I94 Q;  3GTL H;  4IPC A;  3AFP A;  4AQY Q;  5M3F H;  2MNA A;  2YYZ A;  1I50 H;  1K73 C;  4PZ6 A;  1JJG A;  3B6Y A;  3E0E A;  1SRU A;  1Y1W G;  2WB1 G;  3D0F A;  3T1H Q;  5FJ8 H;  3J81 j;  3CXC A;  4JBM A;  4JI4 Q;  1U0L A;  2Q2H A;  4DV6 L;  1VQ7 A;  4NXN Q;  2CWP A;  1K8A C;  3U4Z A;  1N8R C;  5JEA G;  1YJN A;  2K52 A;  3TS2 A;  1OXX K;  2GVB A;  3L7Z C;  2K5H A;  4O2D A;  5C44 H;  1N36 L;  4B3S L;  3CCR A;  4GOP A;  2PMZ E;  4C3J H;  4QIW E;  3S17 H;  2BA0 A;  1GM5 A;  2N49 A;  2D0P A;  1R9T H;  4YWK A;  2UXC Q;  2EQS A;  1Q46 A;  2ZTE A;  1MKH A;  3A74 A;  1IYJ B;  1WI5 A;  1BKB A;  1B8A A;  1YVC A;  3KF6 A;  4OWT B;  5LMN W;  2VQF L;  4LF6 L;  4JYA L;  1UE6 A;  4LUV A;  2UUC L;  4LF9 L;  1S72 A;  4GKK Q;  4KHZ A;  2WAQ E;  2NN6 I;  1XMO Q;  3M4O H;  4LNQ A;  1I6H H;  1X56 A;  1U5K A;  2LXJ A;  1XNQ L;  1EOV A;  2WP8 J;  4DR5 L;  1ASY A;  3S2H H;  2HT1 A;  1CKN A;  4JI6 L;  4O0A A;  4A3G G;  1TWG H;  4B3R Q;  5K36 G;  1A0I A;  4FDB A;  2R7D A;  2A1A A;  2K14 A;  3A5Z B;  3CF5 A;  3CAM A;  5GAG C;  5IP9 G;  1VQF A;  1L1O C;  3PUY A;  1B70 B;  2E2I H;  4B3T Q;  3I2Z A;  3G71 A;  4KI0 A;  1E1T A;  4GS3 A;  4X62 L;  1EQQ A;  1Q7Y C;  1PH8 A;  4A3I G;  4BA1 I;  1N32 L;  2MO0 A;  1UEB A;  3F2B A;  1N34 Q;  4UP8 A;  1VQ8 A;  5M3F G;  3AQQ A;  3PUX A;  2UXB L;  3OTO Q;  3FHW A;  1X55 A;  3KDF B;  1X3G A;  2JA7 G;  5BR8 Q;  4IOC A;  1BBU A;  4DR1 Q;  4YCU A;  4OO1 I;  5M5W H;  3M85 A;  5FJ8 G;  4IFD I;  3JAM i;  2Q2T A;  4JI7 L;  2UU9 Q;  1XMQ L;  1IBK L;  3ERS X;  1PH3 A;  2GN5 A;  2L15 A;  3I55 A;  4A3E H;  1YEZ A;  5C44 G;  1VQB A;  4OXP A;  3M9B A;  2ZM6 Q;  3H3V I;  4AYB E;  1VQI A;  3ULL A;  4LF8 Q;  2R7Z H;  5J3B A;  3W5O A;  1SR3 A;  3F8T A;  1S3O A;  2AWN A;  1DGS A;  4DR2 Q;  1GO3 E;  3S15 H;  2OTJ A;  4DAY B;  4AYB G;  2XTI A;  3S1Q H;  2BH8 A;  1IBM Q;  3GO5 A;  1CKO A;  1RL2 A;  4IPD A;  1QVF A;  5ELN A;  1EQR A;  3PF4 A;  4JV5 Q;  4DK6 C;  4X6A H;  2MO1 A;  4TVA B;  2NVQ H;  2RHQ B;  3PO3 H;  4AQY L;  4L5T A;  1PV4 A;  4DV7 Q;  1SE8 A;  4DV3 Q;  4HJ9 A;  4QQB X;  4GNX B;  1QVC A;  4L5R C;  4OON A;  1FJG Q;  1PHJ A;  3CPW A;  3IRB A;  1JJC B;  3RZO H;  3PUV A;  3K81 C;  4A3F H;  1YHQ A;  1FGU A;  5GQO A;  1VQM A;  4R4Q A;  3K8A A;  1K0R A;  4NXN L;  2OQK A;  1C9O A;  2PQA A;  1ASZ A;  1UWV A;  4OX9 Q;  1W2B A;  2BH2 A;  3CC2 A;  2QEX A;  4JOI A;  4JBJ A;  3RN2 A;  4HIK A;  2C35 B;  4JI8 Q;  4A3K H;  1GVP A;  2I5L X;  3LGJ A;  5C4J H;  1MJE A;  4LF7 Q;  4IJL A;  4GOP C;  4A3E G;  1YHB A;  3OYY A;  3CP0 A;  3PUW A;  1VQ4 A;  4YWM A;  2LSS A;  4MZ9 A;  3CCL A;  1L0W A;  1X54 A;  4HIO A;  3AEV A;  2R7Z G;  1WFQ A;  3TRE A;  1OXT A;  4JI3 Q;  1SLJ A;  1VQL A;  4POG A;  4BBR H;  3GTG H;  1E24 A;  2N8N A;  1HR0 W;  1Q1E A;  2JEA I;  2I0Q A;  1KRS A;  1YBY A;  4KLK A;  4X66 L;  2JJQ A;  3CCM A;  1KC8 C;  1HNZ Q;  5E7N A;  4JBK A;  1EWI A;  4KHP Q;  2B3G A;  5LMN Q;  4B3T L;  1G6P A;  2IT1 A;  1D7Q A;  3TEH B;  3HOW H;  1NTG A;  1PFS A;  1NMF A;  2K50 A;  2VL6 A;  2VY3 A;  3T1Y Q;  3PF5 A;  3PO3 G;  1P8L A;  3OTO L;  1JE5 A;  4R4O A;  4JI5 L;  1A62 A;  2F4V Q;  1OTC A;  4A3F G;  2A19 A;  4YCV A;  1AE3 A;  2VQE Q;  4L5S A;  2JA8 H;  2OQ0 A;  1P16 A;  1J5E L;  1VS0 A;  3CCS A;  1I5F A;  2HHH Q;  1PH5 A;  2R93 H;  1FL0 A;  1EYG A;  1A63 A;  2HIV A;  1O7I A;  2WB1 E;  2K5V A;  1YZ6 A;  3HFZ B;  4MTN A;  3GTJ H;  5C0X I;  5JJK A;  4YHH Q;  2AWO A;  4LF8 L;  1TWH H;  1PH7 A;  3K7A H;  2JA7 H;  5JJL A;  3H3V H;  3UE0 A;  1K9M C;  4A3K G;  5GAE C;  4HJ5 A;  1I3Q H;  3KDF A;  4DR2 L;  1OXU A;  1LM0 A;  1JT8 A;  2E5L Q;  2JA9 A;  1KHI A;  2ASB A;  3PUZ A;  4P73 A;  2JE6 I;  2JQO A;  1KL9 A;  2KHJ A;  4JG2 A;  1Q81 C;  1HZB A;  4YY3 Q;  4JV5 L;  1NBW A;  2RCN A;  2PNH A;  2NN6 G;  4BBR G;  3HKS A;  4QGU A;  2UUA Q;  3DM3 A;  4H02 A;  2ID0 A;  2VW9 A;  3H15 A;  4A76 A;  1M1K C;  4GKJ L;  2I5M X;  3S24 A;  4JI2 L;  3E9H A;  1UE5 A;  4ME3 A;  1VQA A;  2RF4 A;  3RLN A;  4POF A;  3HOW G;  4DUZ Q;  4X64 Q;  1WYD A;  1Q82 C;  1HNW Q;  4UPA A;  5FLM H;  4P74 A;  1CSP A;  3CC4 A;  3CQZ H;  2QGQ A;  2IHE A;  4DV2 Q;  3H0G H;  4DR6 Q;  2YV5 A;  4DV5 Q;  2JA8 G;  2KBN A;  3A0J A;  4OO1 G;  1L2F A;  1YIJ A;  4IFD G;  2ZTC A;  2CFM A;  4LF7 L;  4JOI C;  3ULJ A;  4GNX A;  2R93 G;  4R1J A;  1TXY A;  1VQO A;  3ICE A;  3M7N A;  2VZA A;  4DV4 Q;  4HJ7 A;  4K0K L;  1KAW A;  2DUD A;  4ALP A;  2NVX H;  3AYH B;  4JI3 L;  1OXS C;  3CW2 C;  1E7Z A;  4AH6 A;  1HNX L;  1VQH A;  2ZJQ A;  4DUY Q;  1XJV A;  3CD6 A;  3GTM H;  2UUB Q;  1Q86 C;  1PH2 A;  2K75 A;  1J6Q A;  1FVI A;  1Q1B A;  3FKI H;  3UDF A;  2F52 A;  4DV1 Q;  1CSQ A;  1VCI A;  4APV A;  4GLX A;  5JEA J;  1PH6 A;  4A93 H;  5AJ3 Q;  1E22 A;  3I4O A;  1VQ9 A;  1A8V A;  2JEB I;  1KQS A;  1X3F A;  3UDG A;  1HR0 Q;  1G51 A;  4C3H H;  3PIP A;  3U50 C;  1CKM A;  2Z6K A;  1GD7 A;  1Y14 B;  2VQE L;  3PV0 A;  3CCQ A;  3STB C;  2MQH A;  3G4S A;  5IP7 H;  2ZJP A;  3RZD H;  5FLM G;  2HHH L;  2ES2 A;  1WCM H;  2N3S A;  2NVY H;  3EIV A;  4LF4 Q;  4UY8 C;  1I94 L;  2IY5 B;  5IYB G;  3GTP H;  1NY4 A;  3H0G G;  4YHH L;  2Y0S G; 
#chains in the Genus database with same CATH topology
 1W93 A;  1H9R A;  2E2D C;  5E3F A;  1TS3 A;  2X6G A;  4A2A A;  3JC6 6;  4A3B B;  1II3 A;  4ECY A;  5LMU Q;  4DU9 A;  2JA6 H;  3S2D B;  1Q8K A;  1N34 H;  1SBB B;  3BVG A;  4ZCK A;  1IBL Q;  2YTX A;  1K83 H;  4WD3 A;  5KFR A;  1FNV A;  4RHR A;  4DR1 H;  2WV6 D;  5DEH A;  2AQ3 B;  1SNM A;  2R8G A;  5JVH 3;  3OSN A;  4OIK A;  2E2H B;  3KOJ A;  1L2Z A;  3STB D;  2YS7 A;  3FKI G;  1TU2 B;  2F0T A;  3I7F A;  5EKK A;  4LUO A;  4QWE A;  4GKK L;  1DXM A;  2F0M A;  3FVQ A;  4ED2 A;  2MJ8 A;  1X9N A;  1QWY A;  5JJI A;  2EYH A;  2W8K A;  2R8K A;  4HNT A;  4QJF A;  4DV5 L;  4IRK A;  3K5L A;  1BOS A;  2V59 A;  4QWA A;  1JB7 A;  3EBE A;  2PZT A;  5JPN C;  1WOC A;  1XTC D;  3I4M B;  3J81 c;  1QUQ B;  1IHZ A;  4PQX A;  1ROD A;  4J15 A;  1KJQ A;  3V6J A;  2Z0S A;  3WDN A;  2UUB L;  5KFG A;  2NU8 B;  2UU9 L;  1FYC A;  4JW0 A;  5KYL A;  3RR5 A;  4LF5 H;  4A3C G;  1KAA A;  1A2U A;  1Q12 A;  4WBN F;  2ZM6 L;  5AJ3 L;  4XTC S;  3MR6 A;  2B63 H;  1CQF A;  1UEA B;  4RCO A;  4UCU A;  2RDJ A;  4FVM A;  1N33 Q;  5CAE B;  5EZY F;  2LKV A;  1IBM L;  4ZKC B;  5FLX E;  4C5B A;  1GUT A;  3MEF A;  4OL7 A;  1JOO A;  2PMZ A;  3A8K E;  3KAL A;  4HYK A;  1Y1V B;  3L9A X;  4XQN A;  5GAD C;  1WTR A;  4I4T F;  3QJY A;  3GTO B;  5IWA Q;  2W6Q A;  4P75 A;  3G48 A;  1I3Q A;  1EY5 A;  4R8I A;  5L37 A;  2BDN A;  3HKZ G;  4RGM A;  1C3O A;  4N9T A;  3U9S A;  3MWE A;  3DLL A;  1MJC A;  3J80 i;  1VQG A;  3RLO A;  4NW2 A;  3RUP A;  1HA5 A;  3ERQ A;  4C56 C;  1LUZ A;  2AKW B;  4NXM H;  4R8U B;  4RAY A;  3UFX B;  3OSO A;  4OX9 L;  3CU7 A;  4A3B H;  4O2A F;  5EPK A;  1PYS B;  3JAM E;  3S2D H;  5IYD G;  4HSP A;  2KJX A;  4QB4 A;  1WSC A;  1G29 1;  1I4G A;  4NPS A;  1YNN C;  3G6V A;  2UXD L;  1X3E A;  2VB3 X;  1YHA A;  3SI8 A;  3TZD A;  2B29 A;  1YIT A;  4EQ5 A;  2F0G A;  1SE3 A;  2E2H H;  3MFI A;  2W9A A;  2YU9 A;  3A8I E;  3KAJ A;  4Q0F A;  1F9S A;  3N40 P;  2Z4H A;  4IUR A;  3Q24 A;  3PR5 B;  5L1J A;  4DR4 H;  2IHF A;  2PZW A;  1C48 A;  1D5X C;  1VF5 C;  1O7L A;  3LML A;  4X66 Q;  4NLG A;  4BXX G;  1A3V A;  1XPR A;  3D3R A;  4BY7 G;  2CQO A;  4Z9C B;  4A3M G;  4YR2 A;  4A3G B;  2HVS A;  1STY A;  4ECV A;  1SNP A;  3DMU A;  1Z2N X;  1YI2 A;  2F4V L;  2JEG A;  4J9Q A;  2R7L A;  4LFB Q;  3FKI A;  2KQ3 A;  2M9V A;  3GIK A;  1CFM A;  1QG7 A;  4JI5 Q;  3I4M H;  3GTL B;  2JSO A;  5HGQ A;  1XPO A;  2CH4 W;  4B3M L;  2AQ4 A;  4MV8 A;  4IRC A;  1EIF A;  4LFC Q;  3A7L A;  3SK6 A;  1J5E Q;  3F1Z A;  4C5C A;  2MPM A;  3R5X A;  1ONL A;  3ZYY X;  2A68 C;  2J9G A;  2Z1C A;  1Y8O B;  2KEC A;  3KHH A;  1BVS A;  2Z8L A;  2IX1 A;  3K80 C;  3GTP A;  1WVL A;  4A3J H;  1YJW A;  4IO9 A;  1KDA A;  4LFA H;  3V4S A;  3GQB A;  1UAP A;  1R9T B;  1NJI C;  1XNR H;  1VQN A;  1JC7 A;  1CKN B;  4C3I H;  1MIU A;  5AFW A;  5KG1 A;  2DGY A;  4YJ3 F;  3GTQ A;  3M4O B;  2LFN A;  1Y1V H;  4FBT A;  2N55 A;  4KJN A;  3GTO H;  2CW0 D;  4DUZ L;  4DR3 H;  2W7P A;  4DK3 C;  1HNW L;  4CHT B;  2IP4 A;  2ZXR A;  3HRZ C;  4EEQ A;  2JA5 A;  2UUC Q;  1SNQ A;  3RUZ A;  1EYD A;  4DR6 L;  1IOV A;  1L1O A;  1KRT A;  2FJZ A;  2R92 G;  2EXD A;  2WKD A;  3J7A F;  2R87 A;  5JVG 3;  5EDW A;  5DQG A;  4LF4 H;  5GAH C;  5ELD A;  5J1Z A;  5CGK A;  4DXG A;  5M5W B;  3T51 B;  2EYM A;  1EHI A;  4DUY L;  2PPB C;  3J7Z C;  3KF8 B;  3OHX C;  2PQE A;  4N9P A;  1CHQ D;  4CDF C;  1Y8P B;  1ILQ A;  4BY1 G;  5FLX c;  5ELE A;  2GVA A;  3UE1 A;  3GP7 A;  3LWE A;  3T13 A;  3I4N G;  4OWX B;  4KD3 A;  5C6A A;  1F9Q A;  2CKZ B;  1HR0 L;  3PIO 3;  5KG5 A;  2XN9 C;  1N36 H;  3K6O A;  4LJZ C;  4B3S H;  5KG2 A;  5ELO A;  5KFF A;  4RFB A;  2PYK A;  4MV9 A;  4A3G H;  3TP5 A;  5K36 H;  5KFJ A;  5KND A;  1HZC A;  3JAM c;  4JI1 L;  4QWD A;  2I46 A;  1H9M A;  4OIJ A;  3W1G A;  2OTL A;  3NQT A;  3GTL H;  4EYI B;  1I7N A;  5DG9 A;  1EY6 A;  1TWA A;  5CBA E;  2CQY A;  2MNA A;  1CK1 A;  4ECS A;  1PTO D;  4EGQ A;  3B6Y A;  3FDS A;  4ABN A;  1LTB D;  3KLS A;  1N32 H;  2CWP A;  4A3K B;  2FLN A;  2B2W A;  3G6J B;  2UXB H;  1B44 D;  1YJN A;  3F2U A;  3L7Z C;  2XWJ B;  4GOP A;  4Q8F A;  2L11 A;  1KDB A;  4QIW E;  3VR2 A;  3TBI B;  2XGP A;  1BNC A;  2ASD A;  1EQV A;  1IW7 D;  1R9T H;  3DXJ C;  3NE5 B;  1IBK H;  4J9L A;  2VA2 A;  1S9F A;  2K1B A;  3A74 A;  3KF6 A;  1I4X A;  1PZI D;  3D8G A;  4LF6 L;  4JYA L;  2VQF L;  4LUV A;  1NAP A;  3QOL A;  5ELC A;  4LF9 L;  1S72 A;  2WAQ E;  3M4O H;  2LXJ A;  1XNQ L;  1ZET A;  5IGB A;  1Q3L A;  4DR5 L;  4JUZ A;  1JOR A;  4Y8V B;  2Z6B A;  4JI6 L;  4B3R Q;  2WII B;  3C1E A;  2XD4 A;  3A5Z B;  1I4H A;  4RGN A;  5IP9 G;  1VQF A;  1L1O C;  2Z9H A;  1B70 B;  4B3T Q;  3IKJ A;  1E1T A;  4LAA A;  1QNU A;  4X62 L;  1Q7Y C;  3F2B A;  3EVQ A;  1N34 Q;  3I12 A;  4GC6 A;  2L12 A;  4ME6 A;  3OTO Q;  1X55 A;  1V4Y A;  1DYQ A;  1VAJ A;  3TIN A;  1BBU A;  1NSN S;  3GLK A;  4DR1 Q;  4MV6 A;  5J2U F;  4YCU A;  1F2Y A;  5M5W H;  1KBL A;  4G4K A;  4CJ1 B;  2JA7 B;  4JI7 L;  2AGP A;  1XMQ L;  1EY8 A;  2I87 A;  3ERS X;  4NXN H;  3M9O B;  2GN5 A;  4CKE A;  5I47 A;  4EGV A;  3M9B A;  2CVR A;  5E4X A;  4DAP A;  2EY5 A;  2GPS A;  5A35 A;  4ZI7 F;  3TME A;  1K8M A;  4JVZ A;  3F8T A;  1S3O A;  4U67 3;  3K59 A;  2IMW P;  2ZDH A;  2X0S A;  2XTI A;  2BH8 A;  1CTM A;  2FE3 A;  2R7Z A;  1QVF A;  3PF4 A;  1EQR A;  2F0H A;  4KKT A;  4ODG A;  4TVA B;  3PR4 A;  2Q8R E;  3ND8 A;  1PV4 A;  2I8C A;  1SE8 A;  4HJ9 A;  1EU4 A;  1PHJ A;  2FHT A;  3H0G B;  3MFH A;  2FK1 A;  1FGU A;  5GQO A;  5D8D A;  2HCI A;  3K8A A;  1A6X A;  1PZJ D;  1JXL A;  2IWH A;  3ND9 A;  1XYI A;  2ICE C;  1F2Z A;  4XYQ A;  2YS6 A;  2B2W C;  3GII A;  4HIK A;  2C35 B;  4A3K H;  1V1O A;  4X3K A;  1F2M A;  1U4P A;  4IJL A;  4GOP C;  2XCP A;  3VYR A;  4O3R A;  4EBD A;  1QCB D;  3H94 A;  4YWM A;  2LSS A;  2NTS A;  4MZ9 A;  3KXY T;  3RJ0 A;  1S0N A;  3TP7 A;  1WFQ A;  4JI3 Q;  1LAC A;  3GTG H;  5JVD F;  3Q8Q B;  1TY2 A;  2JEA I;  2I0Q A;  1SND A;  1G6Z A;  2KEE A;  1EUD B;  1D7Q A;  1WTO A;  4XYM B;  3EA6 A;  2R84 A;  4F4W A;  4FU0 A;  3SHL A;  1TVX A;  1A2T A;  1JE5 A;  1WCM B;  2EYP A;  2NU7 B;  1OTC A;  4A3F G;  2W71 A;  1AE3 A;  1G8Z D;  4CDD C;  2VQE Q;  1A3T A;  3LWB A;  1V8Q A;  1P16 A;  2HD3 A;  3BVZ A;  4IUQ A;  2MHV A;  3RBD A;  2X69 A;  5DGA A;  1I5F A;  2HHH Q;  2R93 H;  4K2L A;  3J81 L;  1EYG A;  2HIV A;  5D1O B;  1FGB D;  2AU0 A;  4IRD A;  3H4B A;  5C0X I;  1CHP D;  2SDF A;  4QW9 A;  4OHJ A;  2JA7 H;  2VQD A;  3UE0 A;  1K9M C;  2A6E C;  4FP5 D;  2ZDQ A;  4DR2 L;  1OXU A;  2JA9 A;  3H6M A;  4K5W A;  4K0K H;  3RV3 A;  2YZG A;  3PUZ A;  1TY0 A;  2JE6 I;  1KL9 A;  3HOZ B;  3J7Y W;  3MVV A;  1HNX H;  5IT9 L;  5CMD A;  3IL8 A;  2B2V C;  4H02 A;  1M1K C;  3V2T A;  4GKJ L;  2DIK A;  4DNR B;  4X3S A;  3EYY A;  1RTO A;  1VQA A;  3RLN A;  3PW7 A;  3N42 B;  2FLP A;  4X64 Q;  1CZG A;  2GA4 B;  1G2T A;  3I3C A;  2HDL A;  4ED0 A;  5BPF A;  1MBY A;  2B8G A;  2KCN A;  3H0G H;  2D5D A;  1M0T A;  5KFW A;  2EJF C;  3ONA B;  4KY6 A;  2NU9 B;  4GNX A;  3CQZ A;  5L1L A;  1VQO A;  4N8F A;  4DV4 Q;  5HV6 A;  1I94 H;  1HQR D;  2DUD A;  4OEL B;  2RSN A;  2XSC A;  3AYH B;  1RJP A;  2O2L D;  4HSV A;  4AH6 A;  4EFB A;  2E2I A;  1Z7T A;  2EDG A;  2JXM B;  1XJV A;  5J2T F;  4QIW B;  3MWD A;  4ILW A;  5IIF A;  3UDF A;  2NVX A;  2QDB A;  1RDP D;  1VCI A;  2HUG A;  4GLX A;  1EYZ A;  3MEH A;  5EPL A;  5JEA J;  1D2B A;  2CH4 A;  4B9X A;  1ZYR C;  5K5P A;  3FPU B;  1VMC A;  5KIX A;  1A8V A;  1KQS A;  3UDG A;  2WAQ B;  1G51 A;  2W9C A;  1E2V A;  5LL6 X;  1S4Z A;  1SMY D;  1B3A A;  2F0J A;  3IFD A;  2J0T D;  4GKK H;  3G4S A;  3JSN A;  2JYO A;  1WCM H;  2N3S A;  2ES2 A;  4LF4 Q;  5C1P A;  4XQQ A;  1X3Q A;  2NBF A;  2PBZ A;  2Y0S G;  4DV5 H;  5JQW A;  3BU2 A;  1VQP A;  2CHB D;  3M3Y B;  1JJ2 A;  2VUM B;  1LTT D;  5IYC H;  3T1H L;  4RCN A;  3K7U C;  1TAE A;  3PW4 A;  1TS4 A;  4A3L H;  3FP9 A;  5I2X A;  4ZRZ A;  4EX5 A;  1ILP A;  4EG0 A;  1S5E D;  1KJJ A;  3U9T A;  3E9I A;  4YY3 L;  2FK2 A;  4KK7 A;  1PH9 A;  4JBW A;  3VDY A;  2QF7 A;  4A3D B;  3Q23 A;  1MSG A;  2UUB H;  3CME A;  2JA6 A;  4H44 C;  2UXC L;  4DV0 Q;  2UU9 H;  4RH6 A;  3GTM B;  3HOZ H;  3MWM A;  1K83 A;  3CCJ A;  4PG3 A;  1RYS A;  4A93 G;  4OEM B;  3KBX A;  2ZM6 H;  3LP8 A;  1XMO L;  2R7F A;  5CV9 A;  1S0M A;  1B1Z A;  4C3H G;  4F4X A;  1B9N A;  4EFE A;  3R93 A;  4IPG A;  1AUV A;  4JI0 Q;  4UCT A;  2JEJ A;  4Q5V A;  1IBM H;  2EYO A;  5C4X B;  2JEF A;  2L4N A;  5DLF A;  1PH1 A;  3MR3 A;  2W57 A;  5A2Q W;  4JV5 H;  2SEB D;  2SNM A;  1Z47 A;  5CR3 A;  3NHH A;  3M9M B;  5KFE A;  1NR2 A;  4GNX C;  4UHV A;  4HIM A;  2IX3 A;  3KHR A;  1N32 Q;  5C0X G;  3HOX B;  4V19 0;  5COR A;  1K1Q A;  4MV7 A;  1DOK A;  4FXK C;  2FB9 A;  1VQC A;  3Q8S B;  5IOD A;  4ED7 A;  3ZJY C;  2A69 D;  3SK8 A;  4APM A;  2V1C C;  4FS2 A;  1HZA A;  2BE5 C;  4OX9 H;  4G57 A;  4R9W A;  3A5U A;  2G9D A;  3TQY A;  5FLX W;  1H9K A;  5LL6 b;  1VQ6 A;  4JC0 A;  3KLW A;  4BBS G;  4PWQ A;  4WJ4 A;  4GC7 A;  1UE1 A;  4XQJ A;  1EY9 A;  3S1N H;  1KDC A;  4JPB W;  4CC6 A;  3FMA A;  1B7Y B;  1JX4 A;  4RUC A;  2UXD H;  4I7A A;  3NTI A;  3HB9 A;  4P72 A;  3GTJ A;  5KFX A;  2B63 A;  1LYL A;  5JUM A;  2HGS A;  3TZU A;  1QZH A;  1LAB A;  4WRD A;  1HRJ A;  1HUN A;  1JMC A;  1C4Q A;  3TS0 A;  2ZTD A;  5JPM C;  3L2P A;  4DR7 Q;  4DV7 L;  2E2J B;  2A5H A;  3DWA A;  4AIM A;  2MCT A;  3P20 A;  5IT9 E;  4HID A;  1K3B C;  3JAM W;  5LMU L;  2RCF A;  1ZEQ X;  5T14 A;  3QG1 A;  4DAY A;  1E4E B;  1IBL L;  5IYZ F;  5C1O A;  3M3Y H;  5IYB H;  2VUM H;  4YQW A;  2F4V H;  4U7C A;  4DNT B;  1Y1W B;  5JVL A;  5C0X J;  1I4Q A;  5HBR B;  2VS1 A;  2XRS D;  2BA1 A;  3P1H A;  5C4Z A;  5BN4 A;  3J81 i;  4B3M H;  2O5J C;  2VNU D;  2K5N A;  1Y69 U;  1ENA A;  3PO2 G;  1RKN A;  4A3D H;  1X32 A;  3QOJ A;  4PMW A;  3MR2 A;  3KLR A;  1SYG A;  3T5L A;  4TV9 F;  2L9H A;  5M3M G;  1PRT B;  3UDI A;  5J22 A;  1SJE D;  1HNZ L;  1VMP A;  2VR1 A;  4DL3 A;  3HOV G;  3KAK A;  4X65 Q;  5DLG A;  2NZH A;  3Q8D A;  2NZO A;  3ERO A;  3CCU A;  1E1O A;  1KNA A;  3W1B A;  1PFB A;  1LTL A;  1STG A;  2YZN A;  4RZR A;  2D0O A;  2W6O A;  5KG0 A;  5C4X H;  4J9P A;  2RDI A;  1MHW C;  2JP1 A;  3X3M A;  1PZK D;  1YNN D;  4RKB A;  1JIC A;  4DUZ H;  3K0X A;  1WJJ A;  1HNW H;  5M3F B;  4QWC A;  1I50 B;  2FFK B;  3HOX H;  1GSO A;  2N88 A;  4I50 F;  2PI2 A;  2D62 A;  2YTV A;  5C3E G;  4DR6 H;  2A8V A;  3U58 A;  1Y8N B;  3CMA A;  2R7M A;  2SNS A;  3MR5 A;  2B2Y A;  2LY7 A;  1N33 L;  1QUQ A;  5EBC A;  4XX0 B;  4IFD J;  2E5L L;  2Z4I A;  2ASL A;  3FMC A;  1HH2 P;  2A74 C;  5FO9 B;  4C3J B;  5CV8 A;  3S17 B;  4MHE A;  4DV6 Q;  1C7Y A;  3TN2 A;  5KG6 A;  4O4I F;  4DUY H;  2FIN B;  4BWG B;  5IWA L;  2C22 A;  2UUA L;  3PGZ A;  2OF1 A;  4B9W A;  4AYB B;  4WJ3 M;  1HZ9 A;  3DHQ A;  2HQE A;  2QIL A;  4FXG C;  3GV5 B;  1SDF A;  2A69 C;  3S2H B;  2IJ0 A;  2E2J H;  4J9O A;  1TWG B;  3NEL A;  5HY6 A;  1S97 A;  4KMU C;  4IPH A;  1B33 N;  1HR0 H;  4DV2 L;  2A68 D;  4L5Q A;  4ZUJ A;  1Y1V A;  5CV7 A;  3GIL A;  2IA6 A;  3GTO A;  3Q8P B;  3U4V A;  4YBZ B;  1NR4 A;  2B8F A;  2C28 A;  3F2C A;  2KUM A;  1VQK A;  4MV3 A;  1TWF A;  2M00 A;  1Y1W H;  4DKA C;  2DNE A;  4PV1 C;  1WTH A;  4JI1 H;  1KJ9 A;  5EWG A;  4IQZ A;  4K0K Q;  4YWL A;  1XTD A;  2F3I A;  4QF4 A;  4R8U A;  5JEA H;  2GLT A;  4QUF A;  1WD0 A;  4Q8E A;  3NBH B;  1RJQ A;  1HNX Q;  1CE8 A;  1I6V C;  3I90 A;  4IHJ F;  1UNS A;  5BN5 A;  4A3J B;  2KCT A;  1GGO A;  1BNZ A;  1O78 A;  5IT9 c;  3S15 B;  3MZ5 A;  1EEI D;  1EQT A;  1HTP A;  3VA7 A;  3HOU G;  3S1Q B;  4G7H C;  2JA5 G;  3C3L A;  3BQ2 A;  1XWE A;  1GSH A;  4LFB L;  5C5M A;  3GDE A;  3OUZ A;  4L8J A;  3HZX A;  4TQS A;  3TRZ A;  4C3I B;  2FPI B;  2UVR A;  1EIY B;  3NEM A;  5M9O A;  4GN5 A;  2MP1 A;  3VR5 A;  3HKZ E;  4DPG A;  5H1S E;  4LF6 H;  3V05 A;  4LFC L;  1V1Q A;  4LUZ A;  4JYA H;  2VQF H;  4GLV B;  1AH9 A;  3ETJ A;  4YB8 B;  1PFM A;  5KFU A;  1BCP B;  3CPF A;  1WTX A;  4PZ7 A;  2VUG A;  2YW2 A;  1XNQ H;  1HJP A;  4LWC A;  1I94 Q;  4DR5 H;  4IPC A;  3AFP A;  2PW7 A;  3VYS A;  4AQY Q;  4JI6 H;  5M3F H;  3URY A;  2YYZ A;  1I50 H;  3S9W A;  3C46 A;  5DQI A;  3CVZ A;  4K8J A;  4DK0 A;  3E0E A;  1HA6 A;  1QIL A;  3W3A A;  2B2Y C;  2WB1 G;  4JBM A;  3CXC A;  1EY4 A;  2PCF B;  1U0L A;  4X62 H;  3Q0A A;  4ZYS A;  5FO8 B;  2KVM A;  5C4J B;  2HDM A;  2K52 A;  3TS2 A;  2L5T A;  4K8I A;  4G7O C;  4E6I A;  4C3J H;  3E3X A;  3E5N A;  3S17 H;  1O7Z A;  4ECX A;  2RGV A;  4JI7 H;  4YWK A;  4RB3 C;  1T3N A;  3GTK A;  1XMQ H;  4BBR B;  2W6M A;  2QEJ C;  1IYJ B;  1JOK A;  1WI5 A;  1GYF A;  1B8A A;  3I70 A;  5F9L A;  1UE6 A;  2UUC L;  4GKK Q;  4UCO A;  4KHZ A;  4O3N A;  5KG4 A;  2NN6 I;  5KFC A;  1BXT A;  4LNQ A;  1X56 A;  2KSW A;  3HOW B;  1R9T A;  3S2H H;  2J6T A;  4EBC A;  2F3V A;  1CKN A;  1TWG H;  4PMC A;  1EWH A;  2A1A A;  4XZ3 B;  3CAM A;  4LH6 A;  4O3O A;  4KI0 A;  2VPS A;  3H40 A;  3DWQ A;  1EQQ A;  1PH8 A;  4ECT A;  4A3I G;  4BA1 I;  2JA8 B;  2MO0 A;  5KGU A;  4ETS A;  3PN1 A;  1VQ8 A;  1DV2 A;  3PUX A;  3KDF B;  2JA7 G;  1ULZ A;  3Q1K A;  1B9M A;  1SSO A;  3M85 A;  3K5N A;  5FJ8 G;  1JKJ B;  2OEO A;  2ZXP A;  3JAM i;  3N44 B;  3K7A B;  2UU9 Q;  1AEX A;  3OHB A;  5D3I B;  4F7X A;  1AZQ A;  2L15 A;  2XC9 A;  5C44 G;  1S10 A;  1VQB A;  1JB3 A;  1PXU A;  2J7Z A;  2ZM6 Q;  3H3V I;  1VQI A;  4LF8 Q;  2EJG C;  3T16 A;  3KF8 A;  1GO3 E;  3S15 H;  2H4O A;  1ML0 D;  3E0J A;  3S1Q H;  1IBM Q;  4MIU A;  2DY8 A;  1ICF B;  2W6Z A;  4I65 A;  3TP8 A;  5D14 A;  4JV5 Q;  1SFO A;  4DK6 C;  1DZ1 A;  3QR8 A;  2RHQ B;  4L5T A;  4ED6 A;  4L5R C;  3IRB A;  1SNO A;  1JWS D;  2WYO A;  1BJT A;  2K5W A;  2K28 A;  2CZG A;  2R7K A;  4TUY F;  1K0R A;  3HG9 A;  1A9X A;  2R86 A;  3GV3 A;  2F0P A;  3OPO A;  4OX9 Q;  5JAV A;  3CC2 A;  5EWE A;  1DD2 A;  3KBG A;  4JOI A;  4QCL A;  3FRP B;  4LF7 Q;  5C4J H;  1JCK B;  4A3E G;  1JOQ A;  5C3X A;  3CCL A;  2R7Z G;  1OXT A;  1GXD C;  2D2C C;  3PMF A;  4BBR H;  3NQI A;  2WB1 A;  1HR0 W;  4J9M A;  4DR2 H;  4KLK A;  1KC8 C;  4ID6 A;  4JBK A;  1KAB A;  5E7N A;  1EWI A;  1EIG A;  4TKO B;  5KKN B;  4B3T L;  2UXC H;  1PX2 A;  2IT1 A;  3MXG A;  3HOW H;  3TQ1 A;  1NMF A;  2R8H A;  1ENF A;  2EPB A;  2VY3 A;  3PO3 G;  1GJX A;  3LX0 A;  3K0Y A;  3OTO L;  4RU9 A;  1CA5 A;  4R4O A;  4RGO S;  1A62 A;  2NVY B;  3MA2 B;  2F4V Q;  1AUX A;  3J7A K;  4GKJ H;  2RDG A;  3GTP B;  2V58 A;  1ZQ7 A;  1JWM D;  4L5S A;  1AN7 A;  2JA8 H;  3HP3 A;  4HAE A;  4OO1 H;  4DLK A;  4IFD H;  1HTL D;  3AB9 A;  4CGY B;  1FL0 A;  4J8Q A;  1S5C D;  4YHH Q;  1DJR D;  2W6P A;  5BMV F;  4UCV A;  3K7A H;  5JJL A;  1DCZ A;  5GAE C;  4HJ5 A;  2OT2 A;  1ESF A;  1I3Q H;  1KHI A;  2L0C A;  4XT3 B;  2WIN B;  2F0W A;  1EUC B;  3SXH A;  1V1P A;  2JQO A;  2JA7 A;  2KHJ A;  1HCZ A;  1NBW A;  1SXT A;  5KFA A;  2NN6 G;  3UQ8 A;  1T5X D;  5G3L F;  2VW9 A;  3OHA A;  1QJO A;  5LOV F;  1JWU D;  2RA4 A;  3RMH A;  1ZXT A;  1FNU A;  4ZK9 B;  3GIP A;  3GTG B;  3IN5 A;  4JI2 L;  3E9H A;  1UE5 A;  4ME3 A;  2KOL A;  1SNC A;  2K03 A;  1D5Z C;  1DV1 A;  5L1K A;  3HKZ B;  5KFL A;  4DUZ Q;  4MA5 A;  1HNW Q;  1CSP A;  3NPP A;  2QGQ A;  2IHE A;  3SK4 A;  2A6E D;  4C5A A;  4DR6 Q;  5KT4 A;  1M7J A;  1B3Q A;  2YV5 A;  4EBE A;  1B6S A;  2KBN A;  2XVS A;  5LA6 F;  1YIJ A;  1E4G T;  4JOI C;  1LT3 D;  2F4I A;  5CYU A;  1TXY A;  5IGE A;  3I72 A;  2VZA A;  4HJ7 A;  3OIP A;  3H0G A;  4IUT A;  4N8X 1;  2R93 B;  4JI3 L;  1OXS C;  4ED3 A;  2ZJQ A;  4DUY Q;  2O4X A;  3KUP A;  3T1H H;  4UFZ A;  4WFN 3;  1PH2 A;  2K75 A;  3BQ0 A;  1E0B A;  3DM1 A;  3FKI H;  4S3S A;  2C2D A;  4YY3 H;  5KX5 F;  2ALZ A;  1LLR D;  3G7L A;  1LT6 D;  1SYD A;  5I6Y A;  3RTX A;  1AP0 A;  1Z2P X;  4KV6 A;  2YCH A;  3T5K A;  1HR0 Q;  1O80 A;  4MN3 A;  1CKM A;  2Z6K A;  1GUO A;  1GD7 A;  3U50 C;  4BY7 B;  4FS1 A;  4O4H F;  4A3M B;  2VQE L;  3CCQ A;  3OWE B;  1CQV A;  3L4J A;  1SE4 A;  4LMQ D;  5TSS A;  3K58 A;  5FLM G;  4RHS A;  2HHH L;  1XMO H;  2NVY H;  3N41 B;  2IY5 B;  5IYB G;  3GTP H;  4FYD A;  4ED1 A;  1FD7 D;  2B39 A;  1UC8 A;  1WH2 A;  1U4M A;  1LT4 D;  4JI4 L;  1JDB B;  1S40 A;  1WCM A;  4XYO A;  2MFI A;  2NYZ D;  1R4Q B;  3KYH C;  1ZKO A;  2ZT9 C;  1RIP A;  4R4C A;  4LF5 Q;  5DGB A;  1MZB A;  4DN4 M;  3M4I A;  1ZYR D;  4M8A A;  4A3C H;  5FD6 A;  1PTO B;  3VYT A;  3G6X A;  1Z9F A;  4QMG A;  1TWC B;  3RN5 A;  5D1O A;  2NZ1 D;  4F87 A;  5IGD A;  4Y7N B;  4L1K A;  1FNW A;  5GRO A;  3A54 A;  4HTH A;  4O3P A;  4IR1 A;  5HUR A;  4X64 L;  2EXZ A;  4ECQ A;  4MV4 A;  3N6R A;  1JR0 D;  5KFY A;  3M4P A;  2WKC A;  3ETH A;  1LV9 A;  3OW2 A;  1IOW A;  2XWB B;  3HBL A;  3RNU A;  4GN3 B;  4TRD A;  1STH A;  2AQ2 B;  5IP7 G;  1ET6 A;  2K01 A;  4ZUI A;  5C8Y F;  5DQH A;  1B4O A;  2PO4 A;  2V4R A;  4U68 A;  5M5X B;  4DV4 L;  4IUU A;  3RB6 A;  2R92 B;  4Y52 H;  3C1F A;  4NXM Q;  1K3R A;  2RQX A;  4X62 Q;  2F03 A;  1O75 A;  4DV7 H;  5BR8 L;  1XPU A;  1JQY D;  5KFO A;  3J81 W;  1RK5 A;  2W9B A;  4NKL A;  4RKL A;  5KNC A;  2RBM A;  5LMU H;  2B2T A;  2JA6 G;  5IYD H;  1T5E A;  2CCZ A;  1IBL H;  2NWG A;  4EQO A;  1XMQ Q;  4BY1 B;  2N78 A;  4IN3 A;  4HNV A;  2OCE A;  1VKZ A;  2DLN A;  4CC5 A;  1GOZ A;  5DNF A;  3I4N B;  5D3D A;  1LTR D;  4DR4 Q;  3FEW X;  5IT9 W;  2GPW A;  2Z6K C;  1YJ9 A;  2BR0 A;  3P75 A;  4QIW A;  2IX0 A;  4BXX H;  1VQJ A;  1VQE A;  4DNI A;  1WTW A;  1C0A A;  4BY7 H;  4RG1 A;  4A3M H;  4DV3 L;  4BWS C;  1EEF D;  4HNU A;  1HNZ H;  1FJG L;  2XCA A;  3BJY A;  3SDZ A;  5I6W A;  2YRW A;  1N56 A;  2WAQ A;  3WO1 A;  4DL2 A;  2BE5 D;  2QW7 A;  3D31 A;  5EAY A;  5T1G A;  2F0I A;  2JEI A;  2YTY A;  3A55 A;  4Q45 A;  4IUN A;  5LL6 S;  3I56 A;  3AU7 A;  1CZW A;  1PVO A;  5DAU A;  1ICW A;  4IZO A;  4A2B A;  4JI8 L;  4DV0 L;  5JOB A;  1PTO H;  1BQQ T;  1H9S B;  2EJM A;  4C2M B;  2XGQ A;  2VUM A;  3KHG A;  4RMF A;  4NDX A;  1TWC H;  1E4F T;  1GUS A;  4DAM A;  5FOB B;  2B63 G;  2A6H C;  2IW3 A;  4LFA Q;  4BA2 I;  4Y7N H;  1XNR Q;  2XIW A;  2F1M A;  4ULL A;  1N33 H;  1V43 A;  1PFN A;  5LYJ F;  2E5L H;  3NTH A;  4KY7 A;  4C1N K;  4JI0 L;  3KFU A;  2E8G A;  4KHP L;  5LMN L;  1KEE A;  1EY0 A;  2R82 A;  3S1N B;  4HED A;  5KFK A;  1RD9 D;  3H09 A;  4A75 A;  2FK3 A;  2R7N A;  3KJO A;  1MGS A;  3O13 A;  4KY5 A;  5EGT A;  4DR3 Q;  1Z2O X;  3MXU A;  3SGI A;  5KYI A;  3T1Y L;  2W7O A;  3GTM A;  1F77 A;  5IWA H;  2UUA H;  2E76 C;  4RZQ A;  4IOA A;  2XIG A;  2BQR A;  1T9H A;  3EPI A;  3SR1 A;  4OGQ C;  1GUG A;  2F3W A;  5M5X H;  4H13 C;  2ZXO A;  3RAQ A;  3QIA A;  2R92 H;  3PIP 3;  2Y0S E;  1G2S A;  2PNR C;  4GN4 B;  4P2C B;  4X3T A;  3AMU A;  2H5X A;  2B2T C;  4JCV E;  2AUJ D;  4A3B G;  4DV2 H;  2Q8T A;  3LNN A;  5EBD A;  3JRW A;  3ORR A;  3NEN A;  4P71 A;  4EQN A;  2EY2 A;  3Q8R B;  4R7R A;  3MXN B;  2H1E A;  2C5C A;  3VPC A;  4B08 A;  4EGJ A;  1K8G A;  4BY1 H;  2G9H D;  5ISR A;  5CV6 A;  3KLS X;  5DLQ E;  4HR7 B;  3CC7 A;  2IPK D;  3I4N H;  3TP6 A;  5KT3 A;  4DR7 L;  1BUV T;  1QVG A;  1N36 Q;  3H3V C;  4QL5 A;  4GZY C;  1HXY D;  4UP7 A;  4B3S Q;  3K57 A;  1N48 A;  2WFW A;  1I6H B;  1KIX A;  3VPD A;  4YR3 A;  2MGS A;  3WWV A;  2PI2 E;  4F50 A;  3MTS A;  3OMG A;  1RCV D;  2D9U A;  4YCW A;  1BGW A;  2C2E A;  3HOY B;  1L0X B;  3TSS A;  3CCE A;  2E2I B;  4LK1 C;  4LFB H;  3EN2 A;  2HIX A;  2ENB A;  1B04 A;  5KT5 A;  4I7Z C;  3I4M G;  3MHB A;  1NMG A;  2AQ1 B;  2F0E A;  3G6E A;  2FLL A;  4LFC H;  5ELF A;  2K4K A;  3NP8 A;  5CB4 F;  4IUP A;  4J9R A;  1NE3 A;  3RLF A;  3OUU A;  1V9P A;  1Z6H A;  1PMR A;  2NUA B;  4DFA A;  4O3Q A;  4V0B A;  2UXB Q;  4LW1 A;  3D4W A;  4C2M H;  3G8C A;  3QZ8 A;  1S03 G;  2V4Q A;  4A3J G;  4J1M A;  3BYY B;  3NXW A;  1B50 A;  1PTO F;  5L1I A;  2OLS A;  3M4Y A;  3VYU A;  4X65 L;  1SN8 A;  1BBW A;  1SMX A;  3BZC A;  1TS5 A;  3PIO A;  2ZJR A;  4DV1 L;  4J9N A;  3R23 A;  1IBK Q;  4R4T A;  4F8M A;  1NCV A;  3OOC A;  4C3I G;  4K6L A;  3R5F A;  3K5M A;  3J80 L;  3LWU A;  4C1N I;  2HQL A;  4YAJ B;  1D5M C;  1Y1V G;  2AHO B;  4I7H A;  1L0Y B;  1CT1 D;  2FMC A;  2QKI C;  2YRX A;  2ICI A;  2PQA B;  4PMB A;  2IBK A;  5IP9 H;  2UUC H;  4ECZ A;  3RZO B;  2DJF C;  1AE2 A;  1VBH A;  3OSP A;  2PN1 A;  2M2L A;  2NTT A;  2QK4 A;  4BS9 A;  3TDQ A;  1JJG A;  1SRU A;  3QZ7 A;  3D0F A;  3T1H Q;  3J81 j;  4DV6 L;  5KEE A;  2RGR A;  1VQ7 A;  2F0D A;  5L9X A;  1YNJ C;  4F88 A;  3A7A B;  1AZP A;  4NXN Q;  3U4Z A;  4Q44 A;  5CA1 F;  1I50 A;  5FPR A;  5DM7 3;  2F0V A;  3CCR A;  4G7Z C;  2PMZ E;  1ZHQ A;  4HCS A;  2RDF A;  2VB2 X;  4R8N A;  1GM5 A;  1SEI A;  2N49 A;  2UXC Q;  2EQS A;  1QOH A;  3IFT A;  1B53 A;  1BKB A;  3BG3 A;  3VA5 A;  2B2U A;  1TII D;  3EQL C;  1I6H H;  1XMO Q;  3SVM A;  4UCR A;  3VR4 A;  4YJ2 F;  2E74 C;  5DM6 3;  1ASY A;  2HT1 A;  2HVR A;  4A3G G;  4O0A A;  2F0N A;  2E2H A;  5K36 G;  1A0I A;  4ZKB B;  4AYB A;  1U4R A;  3CF5 A;  3HOY H;  3OMC A;  2E2I H;  5GAG C;  1LT5 D;  3I2Z A;  1AFP A;  2R3Z A;  1S5B D;  2R8J A;  2FP4 B;  3VMM A;  5C4H A;  3Q6S A;  3K5O A;  1TWG A;  4UP8 A;  3BG5 A;  3AQQ A;  2FPP B;  4YIJ A;  4IOC A;  5LP6 F;  5G3L D;  3OWF A;  4O2B F;  2YYA A;  4CJ0 B;  3GTJ B;  1STN A;  1TWH B;  1F2L A;  2K04 A;  2QDL A;  1EOT A;  1RHP A;  2F0O A;  2KCC A;  4ZQ3 A;  5KFZ A;  2ASJ A;  3K3P A;  1TS2 A;  1LTG D;  2OH2 A;  3ITP A;  5J3B A;  3W5O A;  1SR3 A;  4DF7 A;  2AWN A;  2L55 A;  1S5F D;  2OTJ A;  1F9R A;  3OIQ A;  3NBH A;  4DAY B;  1AN8 A;  2K5D A;  5EWF A;  3GO5 A;  3A8J E;  1CKO A;  1RL2 A;  1RJT A;  4IPD A;  5ELN A;  5I9O A;  4X6A H;  5F2D A;  5FPO A;  4O4L F;  4AQY L;  4DV7 Q;  4QQB X;  1XX8 A;  1QVC A;  1G6P A;  4OON A;  4RB2 C;  3CPW A;  3RZO H;  4A3F H;  1YHQ A;  4B3T H;  3GIM A;  1KTK A;  2Y0S B;  1ESR A;  5FD5 A;  3U9O A;  1JIH A;  1UWV A;  3OTO H;  3TII A;  2QEX A;  4IWX A;  2PZU A;  4JBJ A;  1SCU B;  2XRQ D;  1KJ8 A;  1GVP A;  2I5L X;  2TSS A;  5EQ0 A;  3WOE A;  2VXW A;  2WAC A;  1IYV A;  2CW8 A;  3RAX A;  3OYY A;  3CP0 A;  3PUW A;  1VQ4 A;  3BA8 A;  3ORQ A;  5KFB A;  1L0W A;  1X54 A;  3AEV A;  1EU3 A;  4IWY A;  5KFQ A;  2Q8I B;  4EEY A;  2CW7 A;  1VQL A;  4WJW A;  4POG A;  1NNX A;  1EFI D;  2N8N A;  4A93 B;  3C0F B;  2FJ2 A;  2B2U C;  4G3I A;  3MXP A;  3L4K A;  4X66 L;  1YBY A;  3CCM A;  2OXP A;  1HNZ Q;  2NB0 A;  4C3H B;  3SE7 A;  1NTG A;  2DNC A;  4U6P A;  3EPG A;  3CKI B;  3PF5 A;  1E2W A;  1WTQ A;  1P8L A;  2DZD A;  3K5H A;  4JI5 L;  1K8O A;  4XXE A;  3J80 E;  1C30 A;  3A56 A;  1WTP A;  2WDT A;  3HGB A;  1QB5 D;  1STA A;  4JI2 H;  2A19 A;  1CQI B;  4XT1 B;  2OQ0 A;  1EZ1 A;  1J5E L;  5A2Q E;  3I91 A;  4LF9 H;  1I7L A;  4RB0 A;  2QYZ A;  3NUC A;  1O7I A;  2WB1 E;  3T56 B;  1OWT A;  5KG7 A;  2K5V A;  4K6D A;  1X3P A;  4MTN A;  3GTJ H;  5JJK A;  4LF8 L;  3VPB A;  1TWH H;  2I07 B;  1EY7 A;  2W70 A;  4A3K G;  2BOS A;  4HCE A;  3KDF A;  5KFD A;  1LM0 A;  3E5S A;  2E5L Q;  3GTL A;  1BBX C;  3BDC A;  5D65 A;  4BBS B;  2YZM A;  4P73 A;  2BQU A;  4JG2 A;  1Q81 C;  2XCL A;  2EOT A;  4JV5 L;  4JI3 H;  4QGU A;  2UUA Q;  3DM3 A;  3H15 A;  4A76 A;  3S14 B;  2P5Z X;  1Q90 A;  1H9J A;  4UCS A;  2L1B A;  1TWF B;  1I4R A;  5FKA C;  2LMC B;  3GID A;  5CC4 A;  4ZQI A;  2F0Q A;  2F0L A;  3R8B A;  2QCP X;  1JDE A;  2R61 A;  4DV2 Q;  4ECW A;  4DV5 Q;  3A0J A;  2VQE H;  3MFG A;  3RD4 A;  2ZTC A;  3CHB D;  4LF7 L;  3DF7 A;  1BCP C;  3RB0 A;  2R93 G;  3GQC A;  4R1J A;  2HHH H;  3ICE A;  3M7N A;  4LH7 A;  1KAW A;  1KJI A;  3V6H A;  3VR3 A;  2UVV A;  1K1S A;  4ALP A;  4FXD A;  3S16 B;  4J0M A;  3FDT A;  3PO2 B;  4FF2 A;  5DG8 A;  3CD6 A;  2LS0 1;  2UUB Q;  4JI4 H;  4RAZ A;  2PMZ B;  4TQR A;  3W2D A;  1J6Q A;  3H20 A;  5M3M B;  4HMI A;  2C2R A;  1DON A;  3Q2O A;  1I3Q B;  2F52 A;  4APV A;  1PH6 A;  2K7V A;  4A93 H;  4IR9 A;  1I4P A;  1MI2 A;  5AJ3 Q;  5M5Y B;  1E22 A;  3I4O A;  1C8C A;  4IUV A;  3HOV B;  3X3N A;  3RB3 A;  2AGO A;  1VQ9 A;  2JEB I;  1X3F A;  4YAK B;  1CA6 A;  4C3H H;  1KLG D;  3PIP A;  1Y14 B;  1KC7 A;  1PRT F;  1PYW D;  1GSA A;  3STB C;  3S1M B;  2ZJP A;  4X64 H;  4FF4 A;  3GV6 A;  3EIV A;  1OO9 B;  3MJF A;  4E4T A;  1M6V A;  3H0G G;  5J39 A;  3SK5 A;  4YHH L;  3TIG A;  3KTM A;  1A3U A;  3L0O A;  5C0X H;  1ZHS A;  1MD2 D;  5D1P A;  3R2T A;  3GTK B;  5IOC A;  2NVY A;  5C3E B;  1EFW A;  4Q0Y A;  2YU9 B;  4PNY A;  1TKW B;  4DV4 H;  2NU6 B;  5I4D A;  3UI2 A;  3FPP A;  1M8A A;  4RB1 A;  3N52 A;  1DOL A;  5BR8 H;  2ZJT A;  4DL4 A;  5IGG A;  3V96 A;  3K5I A;  1W3S A;  5NUC A;  4BBS H;  5EPJ A;  3Q22 A;  2J6U A;  2G5D A;  4FBU A;  4ME5 A;  2DWC A;  3RBE A;  2UXD Q;  2PW5 A;  3J7A V;  1WR2 A;  1VQD A;  4FO2 A;  3S14 H;  3FKI B;  1CM9 A;  4MNO A;  3J80 c;  4KN4 C;  1TWF H;  1EZ8 A;  4B3R L;  1RTN A;  1HHV A;  3RV4 A;  2KHI A;  3T4A C;  1PK8 A;  4NB3 A;  1O7Y A;  4HJA A;  3I4L A;  3KJP A;  1V51 A;  1WCM G;  1ENC A;  3GTG A;  4TSS A;  1N34 L;  1PDQ A;  4ECU A;  1JE4 A;  4DV3 H;  4LSA A;  3HKZ A;  2DN8 A;  4CKC A;  4MAM A;  2DPJ A;  4DR1 L;  1FJG H;  1M90 C;  2RSO A;  1F9P A;  5IYC G;  1G91 A;  2W8L A;  1UE7 A;  2F0S A;  2X6L A;  1KNE A;  3BJU A;  4K5V A;  4A3L G;  4OWW B;  1VQ5 A;  4B3M Q;  1U9R A;  1S68 A;  3S16 H;  1VBG A;  2Q2I A;  3PO2 H;  1S5D D;  2AMC B;  2XGT A;  4RGT A;  1SFO B;  4MTE A;  1SAP A;  1IL2 A;  3GTQ B;  1EZ6 A;  5M3M H;  1OXV A;  2K32 A;  3R2I A;  4DV0 H;  4JI8 H;  1DOM A;  3HOZ G;  5CA0 F;  2R93 A;  3M4Q A;  1X65 A;  3TQT A;  5F9N A;  1D6E C;  5EOY A;  5M5Y H;  3HOU B;  3HOV H;  4FF1 A;  1SRO A;  2JA5 B;  3NWT A;  1DIK A;  5IGF A;  2OWO A;  5JH7 F;  1UUP A;  1PYB A;  3F2D A;  2ATW A;  2YL2 A;  2EY6 A;  2K5Q A;  1L1O B;  4KTA A;  4YP3 A;  3V6K A;  1J9O A;  2MUY A;  2BDO A;  3S1M H;  4JI0 H;  4XIG S;  4KHP H;  3VR6 A;  5LMN H;  3PCO B;  1ET9 A;  4LF5 L;  3GIJ A;  1KD1 C;  3T1Y H;  2QA4 A;  1LTA D;  1W96 A;  2NVT B;  3KHL A;  4PZ8 A;  3NBI A;  3GTK H;  4IJH A;  3DEO A;  2WB1 B;  3AFQ A;  5C3E H;  2YU9 H;  3UDX A;  2EIF A;  1BCP F;  2RDH A;  1QE6 A;  4DAV A;  2R6G A;  4JK1 C;  2WE6 A;  3WNZ A;  3M7G A;  4XDX A;  2M05 A;  4RAU C;  1EYA A;  1X6O A;  3NGD A;  4J6H A;  3PZP A;  3WOF A;  3G6Y A;  1UC9 A;  2CWA A;  4ZHQ F;  4H0L C;  3N8D A;  3J7A 5;  4UAI A;  1TWC A;  1TR5 A;  1EUJ A;  2KEN A;  3GD7 A;  1E3P A;  4K5X A;  2ALY B;  1A15 A;  2WAQ G;  3HS0 C;  2FXQ A;  1BO0 A;  3T5H A;  3E6Z X;  4NXM L;  1TWA B;  4DR7 H;  1QNK A;  3DEP A;  1RJR A;  2F0K A;  1PA6 A;  5GON F;  2KHS A;  3EJI A;  1K28 A;  4RA8 A;  2AGQ A;  2K6A A;  1IKL A;  4A3I B;  3S1R B;  2J6S A;  3CCV A;  1EIH A;  1HPC A;  1CUK A;  2A6H D;  1Q8I A;  1V1P B;  2CW0 C;  2VUM G;  4HQ6 A;  2I5H A;  4JI1 Q;  1B2T A;  4GOP B;  3BA9 A;  1SEB D;  2XNA C;  4RNN A;  2R92 A;  3ULP A;  3BZD B;  4NP5 A;  2V4D A;  1BF4 A;  4DR4 L;  5KG3 A;  3KF6 B;  4TQU S;  4UP9 A;  5C44 B;  1SFO H;  1GUN A;  5LHY 1;  4A3D G;  3PW2 A;  1GKH A;  4DA2 A;  3GTQ H;  2K05 A;  2EYL A;  5IE8 A;  1CI3 M;  1SE2 A;  1HFN A;  5KNB A;  2B2V A;  1KXL A;  2JK8 A;  3HOU H;  1N9W A;  2JA5 H;  4QY7 A;  1D8L A;  4R4I A;  5I2Y A;  4X65 H;  4DV1 H;  3HOY G;  5IY0 A;  4JI2 Q;  3D6C A;  3T53 B;  3N6X A;  4LF6 Q;  1T36 A;  2C9O A;  4K2K A;  4JYA Q;  2VQF Q;  5C4X G;  2C00 A;  1S0O A;  4LF9 Q;  2A73 B;  3JZI A;  1IXR A;  1GHK A;  1XNQ Q;  4GLA C;  1IZ6 A;  5HGT A;  4DR5 Q;  1WTV A;  1QZG A;  1UNN C;  1BDO A;  4JI6 Q;  4A4I A;  2NVT H;  3HEJ A;  3DWP A;  3JSL A;  3HOX G;  4IAJ A;  4LFA L;  4FF3 A;  5H80 A;  3I73 A;  3T5J A;  1XNR L;  3RFC A;  3ER0 A;  1RF2 D;  1PH4 A;  1YNX A;  4A3E B;  2Q2U A;  4CDC C;  5CBE E;  3GIQ A;  4F4Z A;  1PTO C;  2RHS B;  3RGX A;  3CRK C;  2R7Z B;  4JI7 Q;  4DV6 H;  4DR3 L;  1H9S A;  1HQM C;  3BYT B;  4C2M A;  1R4P B;  4HJ8 A;  4QUC A;  4J9K A;  4KKS A;  3BZK A;  4ECR A;  1SJH D;  2TMP A;  1EYC A;  2DJG C;  2SOB A;  5T1I A;  5EKI A;  2NVQ B;  1TWA H;  2F0U A;  5KFT A;  3PO3 B;  3RGZ A;  4LF4 L;  1IW7 C;  2WTF A;  1LTS D;  2EE1 A;  3P7J A;  1D1K A;  3PSI A;  2KCM A;  1H95 A;  1KLU D;  2LXK A;  3BQ1 A;  3S1R H;  4A3I H;  4EQP A;  1STE A;  1VDZ A;  1K73 C;  4PZ6 A;  5CV4 A;  2SCU B;  3GV8 B;  1I6U A;  1Y1W G;  4JV2 A;  5FJ8 H;  4JI4 Q;  2ZDG A;  2Q2H A;  5FK9 C;  3HXL A;  1K8A C;  4ZOL F;  1N8R C;  5JEA G;  1SYB A;  4M7E A;  1OXX K;  2GVB A;  5C44 H;  2K5H A;  4O2D A;  1N36 L;  4B3S L;  4QW8 A;  1RK6 A;  2ATL A;  4KN7 C;  5KFI A;  3D4D A;  2BA0 A;  3QB3 A;  4X3U A;  5IGC A;  3D4R A;  5CV5 A;  2D0P A;  3NWS A;  3MXN A;  1Q46 A;  2ZTE A;  1LTI D;  1MKH A;  4J9S A;  4PDB A;  1YVC A;  5LMN W;  4OWT B;  3SE0 A;  4QWB A;  2HCC A;  4HN7 A;  4HR7 A;  2UVU A;  2FPG B;  1U5K A;  2W9B B;  4FNF A;  1EOV A;  2WP8 J;  3EFX D;  3DUZ A;  2KA7 A;  3BAB A;  4CBV A;  4FDB A;  2R7D A;  2K14 A;  3N43 B;  3MC0 B;  2EY1 A;  1M4V A;  3PUY A;  2VPQ A;  2JN4 A;  3NSW A;  2DPI A;  3G71 A;  1YNJ D;  4KKU A;  4GS3 A;  5DG7 A;  1XDN A;  4DL7 A;  1N32 L;  2R8I A;  5EKL A;  1UEB A;  4DGZ A;  2UXB L;  1U4L A;  5M3F G;  2CQA A;  4AQY H;  3FHW A;  1X3G A;  5BR8 Q;  4UDU C;  4OO1 I;  4IFD I;  1HUM A;  2Q2T A;  3JRX A;  4MTD A;  2I80 A;  3GV7 B;  1IBK L;  1PH3 A;  4A3E H;  3I55 A;  1YEZ A;  4OXP A;  4I55 F;  4C3J G;  4AYB E;  3ULL A;  4F4Y A;  3QO2 A;  2R7Z H;  5KFN A;  2IL8 A;  1DGS A;  4DR2 Q;  1GHJ A;  3BAA A;  3PQI A;  4H7B A;  4AYB G;  3RIZ A;  1J8I A;  2V5A A;  2AUK A;  1SYC A;  2VA3 A;  1NUC A;  2K33 A;  4O42 A;  2MO1 A;  2NVQ H;  2EVB A;  1EWC A;  1E2Z A;  2NUC A;  3PO3 H;  4RUA A;  3M9N B;  3MWY W;  4DV3 Q;  4X66 H;  4GNX B;  3CQZ B;  4GKJ Q;  5ELB A;  1FJG Q;  3PW5 A;  1JJC B;  5KFP A;  3PUV A;  3K81 C;  4Q43 A;  4KHV A;  1VQM A;  4R4Q A;  4RNO A;  4NXN L;  2OQK A;  1C9O A;  4LMY A;  1VF7 A;  4KD4 A;  2PQA A;  4ZLT F;  1ASZ A;  1W2B A;  2BH2 A;  2EYJ A;  4JI5 H;  3IG0 A;  4HMJ A;  3BDL A;  1GUW A;  3RN2 A;  2NVX B;  4JI8 Q;  1PRT D;  3MAQ A;  3LGJ A;  1MJE A;  1J5E H;  5KT2 A;  4O3S A;  1YHB A;  5JJZ A;  3QFF A;  3WO0 A;  1FKA H;  1E4E A;  2O5I C;  2HVQ A;  4DL6 A;  1TT2 A;  4CKB A;  4HIO A;  2W9C B;  4LF8 H;  3TRE A;  4JV1 A;  1STB A;  1DM0 B;  1SYX B;  2VOB A;  1SLJ A;  3H91 A;  2FKL A;  2FMA A;  1W6J A;  2NN6 H;  1E24 A;  4DXF A;  2PVP A;  1Q1E A;  1Y1W A;  2UVW A;  1KRS A;  1TQO A;  5KFH A;  3J80 W;  2JJQ A;  4ZAI A;  5C5J A;  4KHP Q;  2B3G A;  5LMN Q;  3QWN A;  4IZ8 A;  3TEH B;  2O03 A;  1PFS A;  2V9W A;  2R6F A;  1LO5 D;  3V4Z A;  2KED A;  2K50 A;  1HFG A;  5FO7 B;  5BN3 A;  1PLF A;  2VL6 A;  3T1Y Q;  3F8N A;  3K3V A;  3RZD B;  2J4X A;  1CQJ B;  4CDE C;  1MSH A;  4TV8 F;  3PVX A;  5A2Q L;  4YCV A;  1BXR A;  1TA8 A;  4EYH B;  1XXG A;  1VS0 A;  2RVL A;  3CCS A;  2DY7 A;  4IAL A;  4A3F B;  1PH5 A;  1A63 A;  2W6N A;  1B6R A;  3HFZ B;  1YZ6 A;  2JA6 B;  1IYU A;  3IAY A;  5C5L A;  2AWO A;  3J81 E;  3NK9 A;  1PH7 A;  3H3V H;  3I8Z A;  5BPH A;  1K83 B;  4DK1 A;  5E4W C;  1EL0 A;  1K0S A;  1JT8 A;  4LF7 H;  1SYF A;  4M1U B;  5KRU A;  2HJW A;  5FLX L;  4WOR A;  4M9U A;  3R5H A;  1WD1 A;  4CJ2 C;  2ASB A;  1D1I A;  1SYE A;  1TWH A;  4L63 B;  4YR0 A;  5E1F A;  2FMM A;  1HZB A;  3D6W A;  4YY3 Q;  2RCN A;  2PNH A;  4BBR G;  4ED8 A;  3HKS A;  1M0W A;  4DL5 A;  4KJO A;  2ID0 A;  2R85 A;  2F0F A;  2I5M X;  5KFS A;  5K2M A;  4RNM A;  3S24 A;  5LXT F;  3BDO A;  2RF4 A;  4POF A;  3L3O C;  3HOW G;  5KT7 A;  1Q82 C;  1WYD A;  4UPA A;  4EVO A;  4P74 A;  5FLM H;  3CC4 A;  3CQZ H;  1GLV A;  5KFV A;  1RYR A;  3JAM L;  4MV1 A;  1T94 A;  5EJW A;  2JA8 G;  4OO1 G;  1L2F A;  1SMY C;  4IFD G;  2CFM A;  3MFY A;  5COY A;  4JV0 A;  3ULJ A;  3RB4 A;  4K0K L;  3BVM A;  3NTK A;  5I9P A;  2Y0S A;  4RWS C;  2NVX H;  4YHH H;  3CW2 C;  1E7Z A;  1FR3 A;  5C3W A;  2EYF A;  1HNX L;  1VQH A;  2P0A A;  1IL8 A;  3GTM H;  2BCO A;  4K14 A;  3OW7 A;  2B63 B;  1Q86 C;  1FVI A;  3RF2 A;  4FM9 A;  1Q1B A;  4MTK A;  4DV1 Q;  1CSQ A;  4MA0 A;  2EZV A;  2BQ3 A;  4NMZ A;  1AW7 A;  1CS0 A;  3BS1 A;  3C2P A;  1W6K A;  4LSX A;  5KFM A;  2E75 C;  4XYL B;  5KT6 A;  1BCP D;  3PV0 A;  1PRT C;  1JLL B;  3R3O A;  3H4D A;  3KK7 A;  3SEB A;  2MQH A;  4O1N A;  5IP7 H;  1IKM A;  4L6T B;  3RZD H;  4UY8 C;  3PW0 A;  1BR9 A;  1I94 L;  1NY4 A;  4B3R H;  3CRL C;  2RKS A; 
#chains in the Genus database with same CATH homology
 3BU2 A;  1VQP A;  3L0O A;  1JJ2 A;  3JC6 6;  5IYC H;  3T1H L;  4JI4 L;  3K7U C;  5LMU Q;  1S40 A;  2MFI A;  3KYH C;  1EFW A;  2JA6 H;  1RIP A;  1Q8K A;  3FP9 A;  4R4C A;  4EX5 A;  4LF5 Q;  4A3L H;  4A3C H;  1IBL Q;  2YTX A;  1K83 H;  3E9I A;  4YY3 L;  1Z9F A;  1PH9 A;  3RN5 A;  4JBW A;  3VDY A;  1W3S A;  3CME A;  2UXC L;  4BBS H;  3KOJ A;  4DV0 Q;  3STB D;  3FKI G;  3HOZ H;  3I7F A;  5GRO A;  3CCJ A;  2UXD Q;  4LUO A;  4PG3 A;  4A93 G;  4GKK L;  1VQD A;  4X64 L;  1XMO L;  3S14 H;  1X9N A;  5JJI A;  4MNO A;  2R7F A;  3J80 c;  1TWF H;  3M4P A;  4B3R L;  2KHI A;  4QJF A;  4DV5 L;  3OW2 A;  4IPG A;  4JI0 Q;  3RNU A;  4GN3 B;  4NB3 A;  4HJA A;  1JB7 A;  5IP7 G;  3KJP A;  1PH1 A;  3EBE A;  1WCM G;  4DV4 L;  1WOC A;  3J81 c;  1Z47 A;  1N34 L;  4Y52 H;  4NXM Q;  1QUQ B;  1K3R A;  4X62 Q;  4GNX C;  5BR8 L;  4HIM A;  1XPU A;  1N32 Q;  4DR1 L;  5C0X G;  4J15 A;  1M90 C;  5IYC G;  2Z0S A;  2UUB L;  1UE7 A;  1VQC A;  3BJU A;  5IYD H;  2UU9 L;  2JA6 G;  4A3L G;  3ZJY C;  1VQ5 A;  3RR5 A;  4B3M Q;  4OWW B;  2CCZ A;  2V1C C;  3S16 H;  1HZA A;  2Q2I A;  4A3C G;  3PO2 H;  1Q12 A;  2ZM6 L;  5AJ3 L;  2AMC B;  2XGT A;  3TQY A;  3A5U A;  1XMQ Q;  2N78 A;  4XTC S;  1IL2 A;  2B63 H;  1VQ6 A;  2OCE A;  4JC0 A;  3KLW A;  5M3M H;  1OXV A;  4BBS G;  4WJ4 A;  1N33 Q;  1UE1 A;  3HOZ G;  3S1N H;  3M4Q A;  1X65 A;  4DR4 Q;  1B7Y B;  5M5Y H;  1IBM L;  4P72 A;  3HOV H;  1SRO A;  2Z6K C;  1LYL A;  1YJ9 A;  2OWO A;  3MEF A;  1PYB A;  1QZH A;  2IX0 A;  3F2D A;  2ATW A;  1VQJ A;  1VQE A;  4DNI A;  1JMC A;  5GAD C;  4BY7 H;  4BXX H;  4GKJ Q;  1L1O B;  3TS0 A;  2ZTD A;  4RG1 A;  4P75 A;  3G48 A;  5IWA Q;  3L2P A;  4DV3 L;  4DV7 L;  4A3M H;  4DR7 Q;  4AIM A;  3HKZ G;  3S1M H;  1FJG L;  4XIG S;  4HID A;  5LMU L;  3DLL A;  1MJC A;  3J80 i;  1VQG A;  3RLO A;  3D31 A;  3PCO B;  5EAY A;  4LF5 L;  1LUZ A;  1KD1 C;  2QA4 A;  2AKW B;  1IBL L;  4OX9 L;  2YTY A;  3M3Y H;  4PZ8 A;  5IYB H;  3I56 A;  2VUM H;  4A3B H;  3GTK H;  4IJH A;  5C0X J;  1PVO A;  2VS1 A;  3AFQ A;  5C3E H;  1PYS B;  2BA1 A;  2YU9 H;  3S2D H;  5IYD G;  3UDX A;  2EIF A;  4JI8 L;  4DV0 L;  1G29 1;  4NPS A;  3J81 i;  2VNU D;  2K5N A;  2R6G A;  1X3E A;  2UXD L;  3PO2 G;  1YHA A;  2B29 A;  4RMF A;  1YIT A;  1TWC H;  4A3D H;  4DAM A;  4PMW A;  4EQ5 A;  2B63 G;  4LFA Q;  2E2H H;  4BA2 I;  1X6O A;  5M3M G;  4Y7N H;  1XNR Q;  3UDI A;  1V43 A;  2CWA A;  1HNZ L;  4JI0 L;  2IHF A;  3J7A 5;  3KFU A;  2E8G A;  1EUJ A;  5LMN L;  3HOV G;  4KHP L;  2KEN A;  3GD7 A;  1E3P A;  2ALY B;  4X65 Q;  2WAQ G;  2NZH A;  4X66 Q;  2NZO A;  2FXQ A;  3Q8D A;  3CCU A;  4A75 A;  1E1O A;  3KJO A;  4DR3 Q;  1XPR A;  4BY7 G;  4BXX G;  2CQO A;  3SGI A;  3T1Y L;  4A3M G;  3W1B A;  4NXM L;  1LTL A;  2D0O A;  1YI2 A;  4IOA A;  5C4X H;  2F4V L;  1T9H A;  1PA6 A;  4LFB Q;  5M5X H;  4JI5 Q;  3I4M H;  2R92 H;  2Y0S E;  4GN4 B;  5HGQ A;  3CCV A;  1XPO A;  4B3M L;  3K0X A;  1WJJ A;  1EIF A;  1CUK A;  4LFC Q;  2H5X A;  3HOX H;  4JCV E;  2VUM G;  1J5E Q;  4A3B G;  3F1Z A;  2PI2 A;  2D62 A;  2I5H A;  2YTV A;  4JI1 Q;  4GOP B;  5C3E G;  3NEN A;  2A8V A;  4P71 A;  3U58 A;  3CMA A;  3ULP A;  1QUQ A;  1N33 L;  3MXN B;  4IFD J;  2E5L L;  1BVS A;  4DR4 L;  2IX1 A;  3K80 C;  3KF6 B;  4TQU S;  4UP9 A;  4A3J H;  1HH2 P;  1YJW A;  1SFO H;  1K8G A;  4BY1 H;  4A3D G;  1GKH A;  4IO9 A;  3GTQ H;  5DLQ E;  3CC7 A;  4DV6 Q;  1C7Y A;  3I4N H;  5IE8 A;  1NJI C;  5IWA L;  1VQN A;  2UUA L;  3PGZ A;  4DR7 L;  1CKN B;  4C3I H;  1MIU A;  2JK8 A;  1QVG A;  1KXL A;  3HOU H;  1N36 Q;  4QL5 A;  1N9W A;  4UP7 A;  2JA5 H;  4B3S Q;  4WJ3 M;  4QY7 A;  2DGY A;  1HZ9 A;  1D8L A;  2WFW A;  4R4I A;  1KIX A;  1Y1V H;  3WWV A;  3HOY G;  2PI2 E;  5IY0 A;  3GTO H;  3HOY H;  4DUZ L;  4JI2 Q;  4DK3 C;  1HNW L;  4YCW A;  2E2J H;  4LF6 Q;  3NEL A;  5HY6 A;  4JYA Q;  2VQF Q;  4IPH A;  5C4X G;  2UUC Q;  4DV2 L;  3CCE A;  4L5Q A;  4LF9 Q;  4DR6 L;  1IXR A;  3EN2 A;  2HIX A;  1XNQ Q;  4GLA C;  1IZ6 A;  3I4M G;  4DR5 Q;  1L1O A;  1KRT A;  1QZG A;  3U4V A;  2EXD A;  2R92 G;  1NMG A;  4JI6 Q;  4A4I A;  2NVT H;  3G6E A;  3F2C A;  5GAH C;  1VQK A;  3HOX G;  2K4K A;  1Y1W H;  4DKA C;  1C0A A;  1NE3 A;  3RLF A;  1V9P A;  4LFA L;  4K0K Q;  4YWL A;  1XNR L;  4DUY L;  3ER0 A;  2UXB Q;  3J7Z C;  1XTD A;  2F3I A;  4LW1 A;  3KF8 B;  4C2M H;  1YNX A;  1PH4 A;  2Q2U A;  3NBH B;  4BY1 G;  4A3J G;  1HNX Q;  5FLX c;  2GVA A;  3UE1 A;  4X65 L;  2RHS B;  1SN8 A;  1BBW A;  1SMX A;  3BZC A;  3PIO A;  2ZJR A;  4DV1 L;  4JI7 Q;  4DR3 L;  3I4N G;  4OWX B;  1IBK Q;  2KCT A;  4R4T A;  5IT9 c;  4HJ8 A;  2CKZ B;  1HR0 L;  3HOU G;  2JA5 G;  4LFB L;  3BZK A;  2HQL A;  3GDE A;  5ELO A;  1Y1V G;  3TRZ A;  2AHO B;  1EIY B;  3NEM A;  1TWA H;  4A3G H;  4GN5 A;  3HKZ E;  4DPG A;  5H1S E;  4LF4 L;  2PQA B;  4LFC L;  1V1Q A;  4LUZ A;  3PSI A;  1HZC A;  2KCM A;  5IP9 H;  4GLV B;  1AH9 A;  1H95 A;  3JAM c;  4JI1 L;  3CPF A;  4PZ7 A;  2LXK A;  3W1G A;  2OTL A;  3S1R H;  4A3I H;  1AE2 A;  1HJP A;  4LWC A;  1I94 Q;  3GTL H;  4IPC A;  3AFP A;  4AQY Q;  5M3F H;  2MNA A;  2YYZ A;  1I50 H;  1K73 C;  4PZ6 A;  1JJG A;  3B6Y A;  3E0E A;  1SRU A;  1Y1W G;  2WB1 G;  3D0F A;  3T1H Q;  5FJ8 H;  3J81 j;  3CXC A;  4JBM A;  4JI4 Q;  1U0L A;  2Q2H A;  4DV6 L;  1VQ7 A;  4NXN Q;  2CWP A;  1K8A C;  3U4Z A;  1N8R C;  5JEA G;  1YJN A;  2K52 A;  3TS2 A;  1OXX K;  2GVB A;  3L7Z C;  2K5H A;  4O2D A;  5C44 H;  1N36 L;  4B3S L;  3CCR A;  4GOP A;  2PMZ E;  4C3J H;  4QIW E;  3S17 H;  2BA0 A;  1GM5 A;  2N49 A;  2D0P A;  1R9T H;  4YWK A;  2UXC Q;  2EQS A;  1Q46 A;  2ZTE A;  1MKH A;  3A74 A;  1IYJ B;  1WI5 A;  1BKB A;  1B8A A;  1YVC A;  3KF6 A;  4OWT B;  5LMN W;  2VQF L;  4LF6 L;  4JYA L;  1UE6 A;  4LUV A;  2UUC L;  4LF9 L;  1S72 A;  4GKK Q;  4KHZ A;  2WAQ E;  2NN6 I;  1XMO Q;  3M4O H;  4LNQ A;  1I6H H;  1X56 A;  1U5K A;  2LXJ A;  1XNQ L;  1EOV A;  2WP8 J;  4DR5 L;  1ASY A;  3S2H H;  2HT1 A;  1CKN A;  4JI6 L;  4O0A A;  4A3G G;  1TWG H;  4B3R Q;  5K36 G;  1A0I A;  4FDB A;  2R7D A;  2A1A A;  2K14 A;  3A5Z B;  3CF5 A;  3CAM A;  5GAG C;  5IP9 G;  1VQF A;  1L1O C;  3PUY A;  1B70 B;  2E2I H;  4B3T Q;  3I2Z A;  3G71 A;  4KI0 A;  1E1T A;  4GS3 A;  4X62 L;  1EQQ A;  1Q7Y C;  1PH8 A;  4A3I G;  4BA1 I;  1N32 L;  2MO0 A;  1UEB A;  3F2B A;  1N34 Q;  4UP8 A;  1VQ8 A;  5M3F G;  3AQQ A;  3PUX A;  2UXB L;  3OTO Q;  3FHW A;  1X55 A;  3KDF B;  1X3G A;  2JA7 G;  5BR8 Q;  4IOC A;  1BBU A;  4DR1 Q;  4YCU A;  4OO1 I;  5M5W H;  3M85 A;  5FJ8 G;  4IFD I;  3JAM i;  2Q2T A;  4JI7 L;  2UU9 Q;  1XMQ L;  1IBK L;  3ERS X;  1PH3 A;  2GN5 A;  2L15 A;  3I55 A;  4A3E H;  1YEZ A;  5C44 G;  1VQB A;  4OXP A;  3M9B A;  2ZM6 Q;  3H3V I;  4AYB E;  1VQI A;  3ULL A;  4LF8 Q;  2R7Z H;  5J3B A;  3W5O A;  1SR3 A;  3F8T A;  1S3O A;  2AWN A;  1DGS A;  4DR2 Q;  1GO3 E;  3S15 H;  2OTJ A;  4DAY B;  4AYB G;  2XTI A;  3S1Q H;  2BH8 A;  1IBM Q;  3GO5 A;  1CKO A;  1RL2 A;  4IPD A;  1QVF A;  5ELN A;  1EQR A;  3PF4 A;  4JV5 Q;  4DK6 C;  4X6A H;  2MO1 A;  4TVA B;  2NVQ H;  2RHQ B;  3PO3 H;  4AQY L;  4L5T A;  1PV4 A;  4DV7 Q;  1SE8 A;  4DV3 Q;  4HJ9 A;  4QQB X;  4GNX B;  1QVC A;  4L5R C;  4OON A;  1FJG Q;  1PHJ A;  3CPW A;  3IRB A;  1JJC B;  3RZO H;  3PUV A;  3K81 C;  4A3F H;  1YHQ A;  1FGU A;  5GQO A;  1VQM A;  4R4Q A;  3K8A A;  1K0R A;  4NXN L;  2OQK A;  1C9O A;  2PQA A;  1ASZ A;  1UWV A;  4OX9 Q;  1W2B A;  2BH2 A;  3CC2 A;  2QEX A;  4JOI A;  4JBJ A;  3RN2 A;  4HIK A;  2C35 B;  4JI8 Q;  4A3K H;  1GVP A;  2I5L X;  3LGJ A;  5C4J H;  1MJE A;  4LF7 Q;  4IJL A;  4GOP C;  4A3E G;  1YHB A;  3OYY A;  3CP0 A;  3PUW A;  1VQ4 A;  4YWM A;  2LSS A;  4MZ9 A;  3CCL A;  1L0W A;  1X54 A;  4HIO A;  3AEV A;  2R7Z G;  1WFQ A;  3TRE A;  1OXT A;  4JI3 Q;  1SLJ A;  1VQL A;  4POG A;  4BBR H;  3GTG H;  1E24 A;  2N8N A;  1HR0 W;  1Q1E A;  2JEA I;  2I0Q A;  1KRS A;  1YBY A;  4KLK A;  4X66 L;  2JJQ A;  3CCM A;  1KC8 C;  1HNZ Q;  5E7N A;  4JBK A;  1EWI A;  4KHP Q;  2B3G A;  5LMN Q;  4B3T L;  1G6P A;  2IT1 A;  1D7Q A;  3TEH B;  3HOW H;  1NTG A;  1PFS A;  1NMF A;  2K50 A;  2VL6 A;  2VY3 A;  3T1Y Q;  3PF5 A;  3PO3 G;  1P8L A;  3OTO L;  1JE5 A;  4R4O A;  4JI5 L;  1A62 A;  2F4V Q;  1OTC A;  4A3F G;  2A19 A;  4YCV A;  1AE3 A;  2VQE Q;  4L5S A;  2JA8 H;  2OQ0 A;  1P16 A;  1J5E L;  1VS0 A;  3CCS A;  1I5F A;  2HHH Q;  1PH5 A;  2R93 H;  1FL0 A;  1EYG A;  1A63 A;  2HIV A;  1O7I A;  2WB1 E;  2K5V A;  1YZ6 A;  3HFZ B;  4MTN A;  3GTJ H;  5C0X I;  5JJK A;  4YHH Q;  2AWO A;  4LF8 L;  1TWH H;  1PH7 A;  3K7A H;  2JA7 H;  5JJL A;  3H3V H;  3UE0 A;  1K9M C;  4A3K G;  5GAE C;  4HJ5 A;  1I3Q H;  3KDF A;  4DR2 L;  1OXU A;  1LM0 A;  1JT8 A;  2E5L Q;  2JA9 A;  1KHI A;  2ASB A;  3PUZ A;  4P73 A;  2JE6 I;  2JQO A;  1KL9 A;  2KHJ A;  4JG2 A;  1Q81 C;  1HZB A;  4YY3 Q;  4JV5 L;  1NBW A;  2RCN A;  2PNH A;  2NN6 G;  4BBR G;  3HKS A;  4QGU A;  2UUA Q;  3DM3 A;  4H02 A;  2ID0 A;  2VW9 A;  3H15 A;  4A76 A;  1M1K C;  4GKJ L;  2I5M X;  3S24 A;  4JI2 L;  3E9H A;  1UE5 A;  4ME3 A;  1VQA A;  2RF4 A;  3RLN A;  4POF A;  3HOW G;  4DUZ Q;  4X64 Q;  1WYD A;  1Q82 C;  1HNW Q;  4UPA A;  5FLM H;  4P74 A;  1CSP A;  3CC4 A;  3CQZ H;  2QGQ A;  2IHE A;  4DV2 Q;  3H0G H;  4DR6 Q;  2YV5 A;  4DV5 Q;  2JA8 G;  2KBN A;  3A0J A;  4OO1 G;  1L2F A;  1YIJ A;  4IFD G;  2ZTC A;  2CFM A;  4LF7 L;  4JOI C;  3ULJ A;  4GNX A;  2R93 G;  4R1J A;  1TXY A;  1VQO A;  3ICE A;  3M7N A;  2VZA A;  4DV4 Q;  4HJ7 A;  4K0K L;  1KAW A;  2DUD A;  4ALP A;  2NVX H;  3AYH B;  4JI3 L;  1OXS C;  3CW2 C;  1E7Z A;  4AH6 A;  1HNX L;  1VQH A;  2ZJQ A;  4DUY Q;  1XJV A;  3CD6 A;  3GTM H;  2UUB Q;  1Q86 C;  1PH2 A;  2K75 A;  1J6Q A;  1FVI A;  1Q1B A;  3FKI H;  3UDF A;  2F52 A;  4DV1 Q;  1CSQ A;  1VCI A;  4APV A;  4GLX A;  5JEA J;  1PH6 A;  4A93 H;  5AJ3 Q;  1E22 A;  3I4O A;  1VQ9 A;  1A8V A;  2JEB I;  1KQS A;  1X3F A;  3UDG A;  1HR0 Q;  1G51 A;  4C3H H;  3PIP A;  3U50 C;  1CKM A;  2Z6K A;  1GD7 A;  1Y14 B;  2VQE L;  3PV0 A;  3CCQ A;  3STB C;  2MQH A;  3G4S A;  5IP7 H;  2ZJP A;  3RZD H;  5FLM G;  2HHH L;  2ES2 A;  1WCM H;  2N3S A;  2NVY H;  3EIV A;  4LF4 Q;  4UY8 C;  1I94 L;  2IY5 B;  5IYB G;  3GTP H;  1NY4 A;  3H0G G;  4YHH L;  2Y0S G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...