3H0GG

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
170
structure length
170
Chain Sequence
FFLKELSLTISLHPSYFGPRMQDYLKAKLLADVEGTCSGQYGYIICVLDSNTIDIDKGRVVPGQGFAEFEVKYRAVLWRPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNYSGEDQVIEKGSNVRLKIVGTRTDATEIFAIATMKEDYLGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit rpb1
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
total genus 26
structure length 170
sequence length 170
chains with identical sequence S
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h0gG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3h0gG01
4R4TA 3OW2A 1U0LA 4DUYQ 2UUAQ 1YJ9A 2CWAA 2UUBQ 3U4ZA 1Q1BA 1LTLA 2N3SA 4NXNL 5FJ8H 4O0AA 4AYBE 4HJ9A 3CPFA 1EIFA 1O7IA 1VQAA 3D31A 4JV5L 1L1OA 1HNXL 2CQOA 2NVTH 2Q2HA 2PMZE 4R1JA 3TREA 1ASZA 5FJ8G 2UUCQ 1H95A 3H3VI 5IWAQ 2VQFL 4QJFA 1SR3A 4JI5L 3J80c 1XMQQ 2YTYA 3M4QA 4DV1L 3PO3H 4DKAC 4PG3A 3NENA 5IT9c 4IOAA 2ZTEA 1L2FA 2UXBL 5M5WH 1XPOA 3S2HH 4TVAB 1X9NA 1PH9A 1A63A 4A3CG 4X65L 5M5YH 2FXQA 1HNZL 4BXXG 2D62A 1NJIC 3GDEA 3J81j 4JI0L 5GROA 3SGIA 4L5RC 4LF9L 1FVIA 1MJCA 3S17H 4P74A 4YY3Q 2R92G 3I7FA 1GKHA 2DUDA 4HIKA 3GTOH 4A3GH 1PH2A 1VCIA 4A3JH 1B8AA 1X3GA 2GVBA 3EBEA 4GNXC 2JJQA 1K83H 1E7ZA 2L15A 4GN4B 1QZHA 2JA6H 5IP9H 1PHJA 5GAEC 1N32L 2BH8A 3HKZG 3U50C 4R4IA 1X3EA 3FKIG 3L7ZC 5C4XH 2QEXA 4BY7G 4OO1G 1WYDA 4NPSA 3K81C 2CFMA 2IX0A 3EIVA 3B6YA 4AIMA 3F2CA 3CCRA 5LMNQ 1K8GA 2JA6G 5IP9G 4A3FG 3CD6A 4DR4L 4DUZL 1N34L 5C4XG 3D0FA 5GAGC 3M4PA 3K7UC 3JAMc 1Y1VG 5BR8L 4L5SA 3AFPA 4DR6Q 1OXTA 3M3YH 1SN8A 2PI2E 1I50H 5H1SE 3HOXG 1FGUA 4GNXB 1K73C 1JB7A 4LF5Q 2C35B 4A4IA 4GKKQ 4GLAC 3NBHB 3OTOL 2Z6KA 4LFAL 3CCQA 2NVXH 1BKBA 4XIGS 3AEVA 3KFUA 3PCOB 4IPCA 4ALPA 3E9IA 1VQHA 2VUMH 1VQEA 4JI3Q 4JI4L 1VQOA 2UU9Q 4APVA 1EUJA 4DK6C 5JJLA 1G51A 5IE8A 4A75A 4GN5A 3GTJH 4FDBA 3FP9A 5AJ3L 2K5NA 1YVCA 3IRBA 3J80i 3HOUG 1I5FA 1Q81C 1NY4A 1LYLA 1I6HH 4JC0A 4A3IH 4NXML 3TRZA 4DR2Q 1I3QH 1X65A 3A0JA 1EQQA 4P72A 2JE6I 1VQ4A 4X64L 4DR1Q 4OX9Q 1JMCA 2JA5G 2K5HA 2F4VQ 3F8TA 4H02A 3F2BA 4B3TL 1HNWQ 4GOPB 3GTLH 4LF6L 3J81c 4OWTB 4KLKA 3J7ZC 4A3MG 3K7AH 3PIPA 4X66Q 3MEFA 2LXKA 4P75A 4DV4L 1CKNB 3RR5A 4BBRH 2KCTA 1EYGA 3M4OH 4OO1I 1XNQL 5IYCH 4YCWA 4LWCA 1KRSA 1NE3A 2D0OA 4DV2L 4IOCA 4YWKA 1YITA 1HH2P 1QUQB 1E22A 2JEBI 1VQ9A 3CC2A 4LNQA 3GD7A 1XPUA 1UE6A 3RLFA 2UXCQ 1C9OA 4KHPQ 1PH1A 1KXLA 3H0GH 3M85A 1Q1EA 1BVSA 4DV3L 4DV7L 1CUKA 2ATWA 4QQBX 4HJ5A 3PSIA 4DR3L 4J15A 4DK3C 4LFCQ 3JAMi 1TXYA 4DR7Q 1K3RA 2B63H 4NB3A 3HFZB 4A3BH 2HT1A 1X6OA 5FLMH 2HHHQ 4A3LG 2MQHA 1C0AA 4MTNA 1IL2A 4L5QA 3W5OA 1S72A 3HOVH 3I4NH 4JBKA 5LMUQ 3TS0A 4DAMA 4YCUA 4LF7L 1Q86C 1WFQA 2GVAA 1TWGH 5IY0A 3T1HL 3K8AA 4GLVB 2QA4A 5ELNA 3PGZA 1VQ7A 2E2JH 5IWAL 1N36L 1JT8A 2AHOB 3RN5A 3G71A 5C4JH 4DV0Q 3PO2G 2E5LQ 2N8NA 1VQKA 2KBNA 1N33Q 4BBSG 4R4CA 2OTJA 2K14A 2K52A 5HY6A 4OWXB 4LF8Q 1D7QA 4O2DA 3S1NH 1CSQA 3BZCA 2LSSA 4TQUS 3CPWA 2NZHA 3G48A 4IJHA 2IX1A 2R93G 5M5XH 4A3CH 2OQKA 3F1ZA 4JBJA 1OTCA 3J81i 1Q12A 2K5VA 3Q8DA 1G6PA 4BXXH 4JBMA 2ZTDA 3BZKA 4MZ9A 3DLLA 2PQAB 4IPHA 2I5LX 2Y0SE 2BA1A 4OONA 2R92H 1A8VA 4GNXA 2AKWB 4BA1I 1MIUA 1Q82C 4A3EG 3L0OA 3PUVA 2XTIA 2Q2IA 1TWAH 3STBD 2CWPA 4DNIA 5IYDG 4IPDA 4X62Q 4OXPA 4A93H 3HKZE 1PYBA 2JA8G 2I5HA 4JI8L 2A1AA 1VQJA 1YHQA 5C44H 1XMOL 1XNRQ 4GKJQ 4L5TA 2YTVA 4DV5Q 3FKIH 2Y0SG 4BY7H 1VQCA 1GVPA 4LW1A 4DR6L 4A93G 3CQZH 4GN3B 3GO5A 5HGQA 5C44G 3TS2A 4A3FH 4HIOA 3CMAA 2K50A 1WI5A 2NN6I 4LF5L 3S1MH 4GKKL 1X55A 2JA9A 1NMGA 3AFQA 4KHZA 2PNHA 3KF8B 1IYJB 3CCUA 4LUZA 1Y1VH 2VY3A 4PZ6A 4YWLA 3CCVA 4POGA 1J6QA 4AH6A 4JV5Q 3HOXH 1EWIA 1HNXQ 1CKMA 2ALYB 4JG2A 4P71A 5JJIA 1HR0Q 4JI3L 5M3MG 1IBLL 2UU9L 1FL0A 3PUWA 1HZAA 4UPAA 4DV6L 3UE1A 1J5EL 2JA7H 2MNAA 4DAYB 3RZOH 3K80C 1FJGL 1UE1A 2WAQG 4JYAL 5C3EG 4AQYQ 1BBUA 4DV1Q 4IFDI 3CW2C 4LFBL 4C3JH 1C7YA 2R7ZH 2UXBQ 1N8RC 2JA7G 4YCVA 2AMCB 2KHJA 3I4MG 3A74A 1WCMG 3KLWA 4UY8C 4JI1Q 1L1OB 1QVGA 3HOUH 3LGJA 4GOPC 4B3ML 3JC66 3WWVA 4JI0Q 4JI7L 1SROA 2F4VL 3GTPH 2R7ZG 2KENA 1IBKL 4LF9Q 2UXDQ 3M9BA 1X54A 1Z9FA 4QL5A 2VQEQ 4B3SL 1IXRA 1X3FA 3J7A5 1LUZA 1WJJA 3G6EA 3I2ZA 3W1BA 1NMFA 3A5ZB 1VQGA 4RG1A 3F2DA 4B3RL 2VNUD 4X66L 2JA5H 3KYHC 4QIWE 2ZJRA 1CKOA 1K9MC 3E0EA 1N32Q 4DR5L 4A3DH 3NEMA 4IJLA 4MNOA 1JE5A 1LM0A 1V9PA 3UDXA 1YJNA 2BH2A 4A3MH 3H3VH 4C3HH 4HJ8A 4BA2I 2UXCL 2NVYH 3ER0A 1GO3E 3GTGH 4KHPL 4A3DG 4DUZQ 1N34Q 1VQIA 1I94L 1SRUA 2ES2A 2N78A 1E3PA 3KJPA 3KJOA 1EIYB 1QVFA 3ICEA 1KL9A 3T1YL 2Z6KC 2OCEA 4YHHQ 3E9HA 4HJ7A 2Z0SA 4GS3A 3U4VA 4PZ8A 3CCMA 1SFOH 1EQRA 3MXNB 4POFA 5C0XI 4A3KG 1PH7A 3CP0A 2IHFA 3PV0A 1YEZA 4YWMA 1W2BA 4JI6Q 4C3IH 3L2PA 3G4SA 2VL6A 1KQSA 4JCVE 1A0IA 1M90C 3S16H 4A3LH 2F52A 2PI2A 1Y1WG 1VQNA 1KAWA 1AE2A 1YJWA 1PYSB 2WP8J 2UUAL 4JI2Q 4DUYL 1SLJA 4K0KQ 2UUBL 2IHEA 3W1GA 5LMNW 2E5LL 4JOIC 2R7DA 5J3BA 2WFWA 1PFSA 2NN6G 4HJAA 2HIXA 1D8LA 3PF5A 1PH5A 3HKSA 1IZ6A 5GAHC 4LF8L 2I5MX 3PO2H 2UUCL 4B3TQ 1OXXK 1W3SA 4LF6Q 1VQ6A 1PH3A 4BY1H 5GQOA 3PF4A 1XMQL 1WOCA 4BBSH 3PUZA 2NZOA 1Q8KA 1YHBA 5JEAG 1GD7A 2LXJA 2E2HH 2Q2UA 4IFDG 5GADC 1PH4A 1SE8A 4BY1G 2OWOA 1NBWA 2QGQA 2R93H 2RHQB 1M1KC 1N9WA 4UP8A 2VQEL 2Q2TA 1YNXA 2YU9H 2YTXA 4HIDA 4JBWA 3VDYA 1UE7A 4YY3L 5DLQE 4DV7Q 4XTCS 5JJKA 1XNRL 2JEAI 3TEHB 4Y7NH 4LF4Q 3RLNA 2K4KA 4A3EH 3AYHB 1HZ9A 5IYDH 3UDFA 3RN2A 3ZJYC 1EFWA 5FLXc 2JA8H 4Y52H 1RIPA 3U58A 4UP9A 3CMEA 1XPRA 2NVQH 2XGTA 5K36G 3H15A 2HIVA 3KDFB 2YYZA 2ZM6Q 5LMNL 2RF4A 4LF7Q 1E1TA 4A76A 1IBMQ 5IP7H 2KCMA 3RNUA 1HR0L 4QGUA 3T1HQ 5JEAJ 1CSPA 3KF6B 1S40A 1N36Q 1A62A 4IFDJ 1DGSA 1B70B 4LUOA 4AYBG 5IP7G 4AQYL 4EQ5A 3NELA 3S1RH 2ASBA 2R7FA 2ZJQA 2KHIA 1L1OC 3RZDH 2YV5A 3CXCA 1KIXA 5M3MH 2RCNA 2WAQE 4NXNQ 3RLOA 2WB1E 1BBWA 2E8GA 4HIMA 1YI2A 2BA0A 1S3OA 4JI1L 3ULJA 3TQYA 3PO3G 5C3EH 5C0XG 1TWCH 1UE5A 3K0XA 3S24A 4IO9A 1T9HA 1VQLA 2UXDL 3BJUA 1E1OA 3I4MH 2GN5A 2CKZB 4UP7A 3PIOA 2VQFQ 1WCMH 4GOPA 4JI5Q 3PUXA 1JJ2A 2WB1G 1KD1C 1XJVA 5E7NA 1VQDA 2N49A 5IYBH 4DR2L 1CKNA 1HZCA 3GTMH 1PH6A 1TWHH 3M7NA 4X65Q 4A3GG 1HNZQ 4OWWB 4A3JG 1YBYA 4DR1L 4OX9L 1QUQA 1P8LA 2B3GA 2EIFA 3OYYA 5IYBG 2A19A 3I56A 1Q7YC 4JI8Q 3FHWA 1HNWL 1VQMA 2ZTCA 1HZBA 3BU2A 2JQOA 3PUYA 1XMOQ 1MJEA 1X56A 2K75A 1ASYA 1KHIA 2RHSB 4WJ4A 4PMWA 1Y14B 3S1QH 3UE0A 1VQ5A 3UDGA 4WJ3M 1L0WA 1VS0A 4YHHL 3GTQH 1EOVA 2ID0A 5C0XJ 2MO0A 3ULLA 1VQBA 4R4QA 1JJCB 2D0PA 3UDIA 4JI6L 1HJPA 4QY7A 4DR4Q 1P16A 2DGYA 3EN2A 1IBLQ 4DV6Q 1J5EQ 5BR8Q 1PH8A 4LFCL 1Z47A 2VW9A 1V1QA 1YIJA 1FJGQ 4A3KH 4IPGA 3A5UA 4DR7L 4JYAQ 1TWFH 1YZ6A 2F3IA 2HHHL 4LFBQ 4JI2L 2VUMG 4K0KL 2IY5B 1VQPA 1K0RA 4PZ7A 1JJGA 4X6AH 3OTOQ 4LFAQ 1V43A 4C2MH 2A8VA 1VQFA 2AWNA 1KC8C 5LMUL 1NTGA 1Y1WH 3DM3A 4B3MQ 4JI7Q 1UEBA 4JOIA 4A3IG 2I0QA 1OXUA 4JI4Q 3KOJA 1IBKQ 1G291 1VQ8A 4B3SQ 2IT1A 1U5KA 5M3FH 4EX5A 5AJ3Q 1PV4A 4DV0L 4B3RQ 2AWOA 2VS1A 4NXMQ 5EAYA 3HOYH 2B29A 1AH9A 1PA6A 2PQAA 1HR0W 1OXVA 1QVCA 2H5XA 5M3FG 4DR5Q 4X64Q 1N33L 1UWVA 3HOWH 3CCJA 1KRTA 3HOYG 3KDFA 4BBRG 3HOZH 3STBC 5IYCG 1XTDA 1OXSC 4DPGA 3CC7A 4GLXA 1K8AC 1I94Q 3HOWG 2EXDA 3S15H 3S14H 4KI0A 4R4OA 4P73A 1PVOA 3CAMA 4DV4Q 4LF4L 3HOZG 1Q46A 3KF6A 3T1YQ 2ZJPA 3AQQA 3CF5A 1E24A 5ELOA 3H0GG 1XNQQ 1B7YB 2OTLA 2MFIA 4DV2Q 1SMXA 3I4OA 2E2IH 2V1CC 4RMFA 2EQSA 1YHAA 2B63G 4X62L 3GTKH 4A3BG 2MO1A 1R9TH 5FLMG 2ZM6L 3S2DH 2CCZA 3CCEA 1IBML 4ME3A 4DV3Q 2R6GA 4LUVA 3CC4A 4GKJL 4DR3Q 3ULPA 1GM5A 4DV5L 3CCLA 1MKHA 2OQ0A 3ERSX 1QZGA 3HOVG 3I4NG 2HQLA 3I55A 2JK8A 3CCSA 1RL2A 2VZAA 1AE3A
chains in the Genus database with same CATH superfamily
2B2YA 4R4TA 3TP5A 5CA1F 3GIMA 4NXNL 5GONF 4O4LF 3VPCA 1PFNA 1EIFA 4J9SA 3LMLA 1O7IA 3NHHA 3D6CA 1HNXL 4UCOA 3M3YB 4RNNA 2CQOA 3KHHA 4JVZA 1GSOA 2UUCQ 1PFBA 1ASZA 2PQEA 3LWEA 4IWXA 3H3VI 4YJ2F 5JVDF 1AZPA 4Y8VB 4JI5L 2YTYA 3MEHA 1EYCA 1PX2A 2IP4A 5I6WA 4PG3A 4HAEA 1L2FA 4NDXA 5KG1A 1VF7A 1XPOA 1I4HA 4R7RA 1X9NA 1A63A 2R85A 4K0KH 5KFSA 3I12A 4BXXG 1NJIC 3NPPA 3Q2OA 4CDEC 5DGBA 4ZAIA 4XYQA 1HUMA 3MR2A 4LF9L 1MJCA 5LXTF 2R92G 1I6HB 1EY8A 2WV6D 3I7FA 1GKHA 1I3QB 1VCIA 1ENFA 2R6FA 2GVBA 5KFVA 4B3TH 3D6WA 1TR5A 1K83H 2NTTA 1PHJA 1RD9D 1DOLA 2O2LD 3HKZG 1II3A 3FKIG 4LMQD 4R4IA 3OWEB 5ELEA 4NPSA 4DL7A 4E4TA 4X3UA 2IX0A 3E5SA 3F2CA 1KEEA 4J9MA 1I7LA 3SEBA 5IP9G 1BR9A 2BQUA 2A73B 1KDAA 4K5XA 5GAGC 4F4YA 1RTNA 5JUMA 4DV7H 3J7AF 1SN8A 2PI2E 5H1SE 3TINA 4LF4H 2C35B 4A4IA 2B2TC 4GKKQ 3H0GB 3N52A 2AGOA 3T53B 3KXYT 2KJXA 3AEVA 3GLKA 4JI3Q 4JI4L 2XD4A 1VQOA 5KFPA 2EVBA 5JJLA 3J81E 1ESFA 1IBMH 1QCBD 1F2LA 4GN5A 3GTJH 4FDBA 3T1HH 4OGQC 4O1NA 5KFLA 3TRZA 1B3QA 2EYFA 5JVH3 5EOYA 1X65A 3M9MB 1TWGB 4DXFA 2K01A 3NSWA 1TWCA 5A35A 4DR1Q 2FLPA 3R8BA 2R61A 2F4VQ 3F8TA 1WCMA 2D5DA 4H02A 3SDZA 1YNJD 2F0NA 3LP8A 3J7ZC 1SJHD 4A3MG 3K7AH 4C3HG 4X66Q 3PIPA 4P75A 1TWHA 1STHA 2FE3A 2CW0D 3FRPB 2F4IA 4LWCA 3I91A 1NE3A 1L2ZA 4RUAA 4RCNA 1HH2P 4KK7A 5LP6F 1SXTA 1VQ9A 3NK9A 1UE6A 1WTRA 2NU6B 4K14A 1EQTA 4KHPQ 4M7EA 4QQBX 4DV3L 1BVSA 3R2TA 1CUKA 1SYCA 3PSIA 4DGZA 3GV7B 2A5HA 5HV6A 3GTQA 2PVPA 4DR7Q 1EU4A 3EQLC 2VR1A 1XMOH 4NB3A 1ILQA 2PZUA 5EGTA 4JK1C 5FLMH 3VYUA 2DY7A 2HHHQ 4A3LG 1ZETA 4G7ZC 2MQHA 4A93B 1C0AA 1CT1D 4YQWA 5DGAA 3Q8RB 4LH7A 4FXGC 3HOVH 4HNTA 3I4NH 5LMUQ 1GUOA 4YCUA 1UUPA 3P20A 1CQIB 5HGTA 2W6NA 2L12A 3J81L 5I2XA 1BCPC 1EIGA 2E2JH 5IWAL 2VQDA 1E4GT 2FJ2A 1ZYRC 2ENBA 2A6HC 5EQ0A 5C4JH 1J5EH 4OIKA 4FS1A 3VR4A 1PTOF 2KEDA 4KD4A 4JYAH 4FYDA 1N33Q 2JA7B 5KFUA 2I80A 1GHJA 2K52A 1C48A 3G6XA 5EKIA 5BMVF 1DZ1A 1CSQA 3BZCA 2NZHA 4B3MH 3HRZC 1GXDC 5DLGA 2FLNA 4JI4H 1IBKH 3J81i 1Q12A 3TIIA 3Q8DA 4YR0A 4JBMA 5EBDA 3N43B 4F4XA 4FS2A 1S0NA 4X3TA 1RKNA 5KFZA 1A8VA 4X3SA 2AKWB 4BA1I 4GNXA 4FU0A 4YB8B 1PZID 4RGNA 3STBD 1AZQA 1TWAH 2YZMA 1S4ZA 4IPDA 5IODA 3HKZE 2IJ0A 4C1NK 2FKLA 4NLGA 4O3SA 1EZ8A 1YHQA 1SYXB 2B2YC 1XNRQ 4GKJQ 3K3PA 2B63A 1H9KA 4BY7H 2EY1A 4N9PA 5JOBA 1TS2A 3OMCA 3MHBA 4QIWB 4LW1A 4DR6L 4A93G 2OH2A 4GN3B 1I94H 3GO5A 1STEA 1UC9A 4QW9A 3TS2A 3T4AC 4HIOA 4JV1A 2NN6I 3BYYB 3S1MH 5KX5F 2EY2A 5IYZF 1NMGA 3CCVA 4LUZA 1LO5D 2VY3A 2AUJD 4POGA 3G6JB 2DNCA 1HNXQ 4P71A 1TWFB 5FOBB 5DNFA 1JQYD 2JSOA 4DL3A 4DV6L 1HZAA 3UE1A 4CJ0B 1NCVA 4MV9A 4DV3H 1SFOB 3K80C 1FJGL 1H9RA 3TN2A 2ZDHA 4K5VA 4CHTB 3CW2C 4C3JH 3HGBA 4MHEA 3K5LA 1N8RC 2PPBC 2R7ZH 2JA7G 2UUBH 3S16B 4HQ6A 4QUFA 4GOPC 2A6ED 2I07B 1HTLD 4LF9Q 2G9HD 2DIKA 1D1KA 2F0KA 2X6LA 5KFXA 4ZRZA 3I2ZA 3W1BA 1AW7A 5KFOA 1NMFA 2R3ZA 1VQGA 2JEGA 2R92A 3KYHC 5IWAH 4EBCA 4HTHA 1HQMC 4UCRA 1E4EB 4DR5L 4A3DH 3T5HA 3K3VA 1V4YA 3O13A 3VA5A 4MNOA 1JE5A 4RB3C 2UXCL 3H3VH 4HJ8A 4BBSB 3HKZA 2XCPA 3FKIA 1GO3E 2BE5D 3GTGH 1JIHA 4B9WA 2CQAA 3CQZA 3NTIA 3JZIA 3UQ8A 1SNQA 3TDQA 2HCIA 3GP7A 1ZHSA 2F3VA 4KHVA 1CM9A 2N78A 2RSNA 3KJPA 1CA5A 1A2UA 2EY6A 3JRWA 3PR5B 4YHHQ 3PW0A 1DCZA 4HJ7A 1LT6D 4K2KA 3U4VA 4PZ8A 3PW4A 2ICIA 1U4RA 1JWSD 3DUZA 3R2IA 1PH7A 3CP0A 3PV0A 1YEZA 4YWMA 1W2BA 2VUGA 1LLRD 1TVXA 3MR3A 4C3IH 3L2PA 3G4SA 2VL6A 1WR2A 4JCVE 5LMNH 3Q8PB 4CGYB 1SBBB 2W9BB 1E2VA 5KGUA 5L1KA 1HFGA 1VQNA 1PYSB 2UUAL 1Y8OB 4LK1C 1SLJA 4JI2Q 4DUYL 1AUXA 2E5LL 4DR6H 3AMUA 3OSPA 3PQIA 2R7DA 1JX4A 3GTPA 1RYSA 4HJAA 1D8LA 4F7XA 5G3LD 1PH5A 3HKSA 5GAHC 3PO2H 3QZ8A 5H80A 1QOHA 4O4IF 1VQ6A 1PH3A 3DEOA 4EFEA 3PUZA 4XXEA 5JEAG 5F9NA 1GD7A 5L1JA 2WAQB 2Q2UA 2JP1A 1PH4A 1SE8A 4TRDA 4ZCKA 1F9RA 2OWOA 4IRKA 1NBWA 2R93H 1M1KC 4UP8A 2VQEL 2YU9H 3V4ZA 4WD3A 3IFTA 2O5JC 2V4DA 3VDYA 4QWDA 2L11A 4Z9CB 4Y7NH 4TV8F 5IYDH 1HZ9A 4H7BA 3QWNA 5KFNA 1VBHA 3Q22A 3UDFA 1XYIA 1BGWA 3ZJYC 4DAPA 1EFWA 4Y52H 1KJ8A 1GUSA 2NVQH 3T5KA 2HIVA 4DA2A 2RF4A 4Q0FA 3DMUA 2F0DA 3BJYA 5BPHA 2IBKA 1PDQA 3Q24A 2KCMA 1K1SA 4DL6A 2H4OA 1UNSA 3DWQA 3E6ZX 3RNUA 4QGUA 2UXCH 4JI6H 1CSPA 2AQ4A 4IFDJ 1B70B 4RKLA 4F50A 4DUZH 4PMBA 4EQ5A 3NELA 4LFCH 3RTXA 2R7FA 3RAQA 2KHIA 1KIXA 2YV5A 5M3MH 2RCNA 3V6JA 4HIMA 4EGVA 1TWGA 2R8IA 1VMCA 5C1OA 3S24A 3URYA 5EWFA 4ZKBB 3I4MH 2GN5A 3MVVA 4UP7A 1YNJC 2XRQD 1XJVA 4IUVA 4RWSC 5E7NA 2N49A 3GTMH 2CW0C 1PH6A 5CV6A 1YBYA 4OX9L 5ELCA 3K57A 1P8LA 4QB4A 3OYYA 1JOQA 5JQWA 5KFJA 3I56A 5C5MA 5I9OA 3R5FA 3FHWA 1SCUB 1HNWL 2NU8B 1VQMA 2G5DA 2ZTCA 1MJEA 4C5CA 3RFCA 4PQXA 4PMWA 1Y14B 2GPSA 3UE0A 3UDGA 4HSPA 4WJ3M 5E4WC 3HOZB 1EOVA 2N88A 3G6VA 5C0XJ 1PTOH 1VQBA 3ULLA 1KNAA 4R4QA 4IALA 5C5JA 1O80A 4DR4Q 2QW7A 2VQEH 5EBCA 3RMHA 2FPGB 4DV6Q 3EFXD 2ZM6H 1CHPD 2PO4A 1Z47A 2VW9A 1V1QA 2NTSA 3SVMA 1FJGQ 4IPGA 4RZQA 4O3NA 5KT2A 3H4DA 3GTKB 1VQPA 1CE8A 1K0RA 4PZ7A 3OTOQ 1B1ZA 2JXMB 2A8VA 2P0AA 1KC8C 3BVGA 1NTGA 5EPLA 3DM3A 1Y1WH 5KFMA 2JA7A 1UEBA 4JOIA 3KOJA 1Z2OX 4XQQA 5CYUA 2C5CA 4IUUA 2AWOA 3HOYH 1KDCA 3P7JA 4CDDC 2NVTB 4DR5Q 1QVCA 4DV1H 4ZUJA 4X64Q 4FM9A 4QUCA 3KDFA 3STBC 3N8DA 1JC7A 4HEDA 1OXSC 4JI0H 1FGBD 1O7YA 2J4XA 4H13C 1K8AC 3S2HB 3KBGA 3OIPA 1H95A 4DV4Q 3HOZG 3KF6A 4QIWA 4F88A 4ZUIA 4RAUC 3CU7A 2DNEA 3KAJA 2OTLA 1BCPF 2H1EA 2MFIA 1W6JA 3I4OA 4DV2Q 2VPSA 5A2QW 3N42B 2XC9A 3RAXA 2E2IH 2W6QA 4RMFA 2NZ1D 4ETSA 1ET9A 3D3RA 4BY7B 3Q8SB 4TKOB 5FLMG 4UCUA 2SNSA 4ED1A 5FLXW 1B04A 2C2EA 2IA6A 2Z1CA 4DR3Q 3CCLA 2JA6B 4DV5L 1TWFA 5K36H 2E76C 2OQ0A 1JOOA 5KYLA 3J80E 3HOVG 3I4NG 1TKWB 2K04A 3I55A 5C4XB 4ED8A 4RGMA 1SFOA 5C4ZA 3OW2A 1U0LA 4DUYQ 2UUAQ 5KFDA 5CORA 1Y8NB 5FJ8H 4O0AA 3RGZA 2BR0A 4I7AA 3QOLA 1QNKA 1B9MA 2FMAA 2W6MA 5IT9W 2PMZE 2A6EC 1JICA 2Z4HA 3LWUA 4HCSA 2VQFL 1KJIA 3BQ0A 4TQRA 4RH6A 3M4QA 4IRCA 4DKAC 3GIIA 3RB3A 2UXBL 5IT9c 2VPQA 2VB3X 2K03A 2EYJA 2K32A 1E4EA 3J7AK 4RNMA 3PIO3 2W70A 3GDEA 3ERQA 2VXWA 4O2AF 1J9OA 1JDBB 3DWPA 1MZBA 5KRUA 3S17H 2EJMA 3TQ1A 2DUDA 2BE5C 5D65A 2ZXOA 1PH2A 2KA7A 4K6DA 5KNDA 1C4QA 1X3GA 3EBEA 4XT1B 3G7LA 3AB9A 1GHKA 4GN4B 2OXPA 4GC6A 4BY7G 3GTGB 1WYDA 3GTLB 4APMA 3PW2A 1XNQH 2JA6G 2K28A 4DL5A 1GOZA 3CD6A 4DUZL 5C4XG 4LSXA 4IQZA 4ME6A 5CB4F 3QFFA 3SK4A 4DN4M 1EUDB 3J80L 3JAMc 4L5SA 1OXTA 2W9BA 2EZVA 1I50H 2J6UA 5DAUA 1RYRA 1FGUA 5E1FA 4GNXB 4WJWA 3EPIA 1JB3A 5KG0A 2BOSA 2RDHA 2QK4A 4C3IB 3N40P 2NVXH 5COYA 4XIGS 3WDNA 3KFUA 5KT4A 3PCOB 4C3JG 4J0MA 2B63B 2VUMH 1Y69U 2UU9Q 4APVA 1EUJA 2OF1A 5D1PA 3FPUB 4A75A 2F0VA 5FO7B 1FNVA 2CHBD 1STBA 5AJ3L 2B2VA 3IRBA 3J80i 2RGRA 1Q81C 4ZHQF 1S9FA 2QILA 5HURA 4A3IH 4NXML 1N36H 4GZYC 2HD3A 2QDLA 1BXRA 4P72A 1GUTA 4BWGB 1JMCA 4OX9Q 4XYMB 2K5HA 1EHIA 2W8LA 5FO8B 1A3UA 3ETJA 3E3XA 2NB0A 3QG1A 4B3TL 1HNWQ 2GA4B 3RIZA 4OWTB 4KLKA 1K83A 1YNNC 4ZOLF 3MEFA 4IURA 3DF7A 2LS01 1EZ1A 2VQFH 4BBRH 2KCTA 4QWCA 5IYCH 1FNWA 1ZQ7A 3ORRA 3S1NB 4IOCA 1YITA 1QB5D 1QUQB 4CJ1B 3RLFA 3D4DA 2XIGA 4C56C 3GQCA 1O75A 4MV4A 1PH1A 1KXLA 2V4QA 2KOLA 5EPJA 5IGDA 4DV7L 4OELB 5I4DA 4HJ5A 4J15A 4ZLTF 2YCHA 2Z9HA 2F1MA 2NVQB 1K3RA 4A3BH 2HT1A 4RHRA 1KJ9A 5KFGA 4C3IG 1VBGA 4MTNA 1IL2A 1S72A 3R93A 2Q8RE 3FKIB 3TS0A 2DLNA 3WOEA 4F4ZA 4GKKH 3UI2A 1IKLA 1WFQA 2YZNA 4CJ2C 3T1HL 1TQOA 3BS1A 1DXMA 3PGZA 1STAA 1VQ7A 2B39A 1JT8A 1BO0A 5M3MB 3RN5A 3G71A 1IBLH 1KC7A 3WNZA 3PO2G 1JOKA 1VQKA 1I4XA 3EROA 4PMCA 2QYZA 2KBNA 4LFBH 1Q8IA 2F0HA 3Q23A 5HY6A 1FYCA 1D7QA 2SCUB 2LSSA 1C3OA 1ZXTA 2R93G 5M5XH 5LL6S 3F1ZA 4MA5A 1GUNA 3BDLA 2XCLA 4B3SH 3VYSA 3M7GA 3VYTA 3NWTA 2B2WA 2PQAB 4IPHA 4WRDA 3GTPB 5C8YF 2R8KA 2Y0SE 3TBIB 1K8MA 1RHPA 3NBIA 2L4NA 1K8OA 4NXMH 1Q82C 3KUPA 5JJZA 3L9AX 5IYDG 5T1IA 4B08A 1S0MA 3N44B 4L8JA 5CV9A 2A1AA 1LT4D 5C44H 3K5MA 3VR6A 1XMOL 2ASJA 4L5TA 3DWAA 4DV5Q 2R7NA 4KN4C 1VQCA 2XCAA 4IR1A 1W93A 1XWEA 1PTOB 3L3OC 5KFRA 4A3MB 3K5NA 4C3HB 4A3FH 3GTKA 3QZ7A 4LF5L 3A55A 4KHZA 2PNHA 3KF8B 2F0PA 1Y1VH 1CZWA 1J6QA 3H09A 3HOXH 1EWIA 2RDIA 5KG7A 2ALYB 2EXZA 1E2ZA 3DXJC 4JG2A 1HR0Q 5M3MG 5C4HA 1FL0A 3PUWA 1J5EL 4IZ8A 1CTMA 2EYOA 4JYAL 4HMIA 1EY4A 1ICFB 2UXBQ 3KLSX 3JSLA 4YCVA 4FF2A 1JKJB 3I4MG 2FPIB 1WSCA 3A74A 3OUUA 3KLWA 4JI1Q 1L1OB 3GV3A 1QVGA 3HOUH 1BUVT 4B3ML 5E4XA 3WWVA 3TSSA 2KENA 1IBKL 3KLSA 2ASLA 1X54A 1Z9FA 5F2DA 4WFN3 1BXTA 5T1GA 5LOVF 3G6EA 2YS6A 3TP6A 4IZOA 1ONLA 4RG1A 2A69D 3OUZA 4ECQA 2QCPX 2NU9B 4OIJA 1K9MC 1XMQH 4FBTA 3NP8A 1TWAA 5FPOA 4J9OA 2YW2A 1V9PA 3UDXA 1YJNA 2BH2A 1Y8PB 4BA2I 4BY1B 4M8AA 2NVYH 1NNXA 1SYFA 1TY2A 3ER0A 5KNCA 2C2RA 4DUZQ 1T5EA 2DN8A 1VQIA 1I94L 4RB0A 1SRUA 2ES2A 2JA6A 4I55F 3KJOA 1QVFA 4YY3H 1V1OA 2E2IB 1MGSA 2OCEA 4ZQ3A 1EOTA 3BDOA 4U7CA 4QWAA 2Z0SA 4GS3A 2N55A 4POFA 4A2BA 1WH2A 4YR2A 3BVMA 5J1ZA 3J7YW 4U6PA 3OWFA 3OIQA 2EYMA 5D14A 2B2VC 1A0IA 2NWGA 4X3KA 5CBAE 4Q5VA 2F52A 2PI2A 2XIWA 3Q0AA 1Y1WG 5D1OA 5DG9A 1YJWA 3A8KE 3OHBA 1SYGA 4K0KQ 4EEYA 2UUBL 4P2CB 3EJIA 1E2WA 3GIQA 1M6VA 3K6OA 5BN3A 4H44C 2FFKB 5J3BA 2NN6G 1KJQA 2HIXA 4LF5H 4OHJA 3E5NA 3IL8A 1JWMD 4LF8L 2I5MX 2FK2A 3TZUA 4B3TQ 5I2YA 2R7LA 5GQOA 2CQYA 3PF4A 1WOCA 5DLFA 2BDNA 1Q8KA 5FLXE 2E2HH 3MWMA 2L5TA 5GADC 4C5BA 4BY1G 3T13A 3S17B 3PN1A 5CV5A 2F0TA 2EPBA 1NAPA 1S5ED 1G2SA 2QGQA 3W2DA 3OHAA 4DR2H 3GTLA 3GTGA 1PRTB 1YNXA 3C2PA 1G8ZD 3SK8A 5DLQE 4DV7Q 4XTCS 3BG5A 5JJKA 4M9UA 1I6VC 4LF4Q 1KNEA 4A3EH 5KFHA 3AYHB 3BZDB 4ZKCB 5IGFA 1RIPA 3LWBA 4UCSA 5FD5A 4YIJA 3CMEA 1AUVA 2FPPB 3EPGA 5K36G 1BNZA 3KDFB 5CV8A 1GSAA 5LMNL 1E1TA 4A76A 1IBMQ 5IP7H 1I50B 3T1HQ 1S5CD 3IKJA 5JEAJ 2MJ8A 3KF6B 1S40A 2K5WA 1FR3A 1DGSA 2EY5A 2R8GA 4AYBG 4AQYL 2NVXB 3S1RH 2ZJQA 3RZDH 4NXNQ 2F0EA 3CXCA 2TMPA 1XDNA 2WB1E 4ECXA 2E8GA 5EKLA 2BA0A 2CH4W 4IUPA 4ABNA 3D8GA 4ECUA 5C3EH 3VA7A 4R8IA 1TWCH 4IO9A 1CS0A 1O7ZA 5A2QL 2UXDL 1B2TA 1HA6A 1EEID 1W6KA 3OSNA 1E1OA 1NSNS 2B2WC 1TS3A 1WCMH 4JI5Q 1F2ZA 1JJ2A 1OWTA 1KD1C 5FLXL 1F9PA 5IYBH 2R93A 1HZCA 2ZDGA 2R84A 1TWHH 4J9RA 3M7NA 4DV0H 2YU9A 4KD3A 1IL8A 4OWWB 4JV0A 1D2BA 1QUQA 3MJFA 2DJFC 4YP3A 5LHY1 1Q7YC 3BDCA 2DPJA 2MHVA 3BU2A 1HZBA 3PUYA 1XMOQ 3VR3A 4LF8H 4IR9A 2RHSB 5KFQA 1XX8A 4J1MA 2HDMA 4IWYA 3HOWB 5G3LF 4MV8A 1VS0A 3GTQH 2HQEA 2K05A 2ID0A 4PWQA 2MO0A 1EY6A 3MFIA 1QWYA 2F3WA 1JJCB 3S15B 2BQRA 3UDIA 2AGPA 4JI6L 4Q0YA 4QY7A 2DGYA 5JH7F 1KTKA 5CC4A 4X62H 1J5EQ 1MSHA 4YAKB 1K1QA 4MV3A 4LFCL 2WYOA 4A3KH 2O5IC 4JYAQ 1YZ6A 4YJ3F 2F3IA 2VUMG 2BCOA 2R8HA 1M8AA 1R9TB 4DFAA 4ZK9B 3S2DB 4RA8A 1FNUA 1GYFA 4OEMB 1V43A 1IW7D 4C2MH 3SHLA 4B9XA 4B3MQ 3PW5A 4A3IG 2M00A 2YYAA 4DLKA 4JI4Q 1IBKQ 1EWCA 4JV5H 1TS4A 5EKKA 1U5KA 5M3FH 1VDZA 3RV3A 2HJWA 3GTMA 1PV4A 1M0TA 3GV6A 3GIPA 3I4LA 2VS1A 1JXLA 5EAYA 1V51A 3N6RA 2PQAA 4U68A 4AQYH 5F9LA 1FKAH 2W9CA 2HVSA 1I7NA 2L55A 5M5XB 3SK5A 2PMZB 4BBRG 4QCLA 3OHXC 5IYCG 1SMYD 3M9OB 4G7HC 3OPOA 5AFWA 4GLXA 1I94Q 3M4IA 3HOWG 2SOBA 4KI0A 5C3WA 2UXDH 4P73A 3MA2B 1Q46A 1T5XD 3IG0A 2ZJPA 3KAKA 1E24A 5FKAC 4K8IA 5ELOA 2K6AA 2HGSA 4ILWA 3RUPA 3R5XA 4WBNF 2W6OA 4DXGA 3C46A 3KF8A 4A3BG 5CA0F 1N32H 2ZM6L 1TT2A 2SEBD 2R8JA 4DV3Q 2KSWA 4LUVA 1K83B 1LTID 4R8NA 1EY7A 1GM5A 1S5BD 4EYHB 4O3OA 5KFBA 2LKVA 1N34H 2Z6BA 2JEJA 1AE3A 2O4XA 1S5DD 5C6AA 1Y1VB 2UUBQ 1WD1A 1WVLA 3U4ZA 1DV2A 1LTLA 2N3SA 3HOXB 3NUCA 4C5AA 4J9QA 1Y1WA 4GC7A 1V8QA 4AYBE 3CHBD 3CPFA 3OMGA 4XT3B 2QEJC 3D31A 4V0BA 2F0QA 5KFEA 1L1OA 3V96A 2EOTA 5CAEB 2NUCA 2Q2HA 4EGJA 4R1JA 3TREA 1I4RA 4XQJA 3RV4A 5IWAQ 4RCOA 2AQ3B 3PVXA 4QJFA 5EPKA 2WKDA 3EA6A 1EY5A 4DV1L 3MFGA 3NENA 5CGKA 4IOAA 1S68A 1G6ZA 2R86A 5M5WH 1PRTD 2RKSA 4TVAB 4DNTB 2FB9A 1I4PA 3VPBA 4X65L 5M5YH 1HNZL 1D6EC 2D62A 4O42A 5J2TF 3GTJB 5GROA 4JI0L 5LL6b 5LYJF 4FBUA 5EJWA 1FVIA 5EDWA 1X3QA 4HIKA 1BBXC 4KV6A 3GTOH 4A3GH 2F0OA 1DONA 1EEFD 3T5JA 1B8AA 4GNXC 1Z6HA 3MC0B 4TUYF 2BQ3A 2JJQA 4LF6H 4CC5A 1IYUA 2L15A 1QZHA 2E2IA 1QE6A 5IP9H 3A56A 4FF1A 3QB3A 4DV4H 1X3EA 1BNCA 3K81C 2KVMA 3EIVA 3B6YA 3CCRA 2E2DC 5LMNQ 1K8GA 1D5XC 3K7AB 4A3FG 2W6ZA 5JVLA 3R5HA 1AFPA 1A2TA 1SJED 1Y1VG 2IL8A 5BR8L 4DR6Q 3M3YH 3VPDA 1I4GA 4DU9A 1B3AA 1U4LA 3HOXG 1B50A 4DR3H 2A68D 4KKTA 1K3BC 1EWHA 4FXKC 5KFAA 1JB7A 4GLAC 2ATLA 4AYBA 1MSGA 4LFAL 3FDSA 4KJNA 1CA6A 2K33A 1WTWA 3E9IA 4Q8FA 3R3OA 2WTFA 1CI3M 4E6IA 4LF7H 2Z4IA 1G51A 4XYLB 5IE8A 3BYTB 3H6MA 3VYRA 3HOUG 5EWEA 2K5NA 4L63B 2ZXPA 3HOVB 2FMCA 1LYLA 4FVMA 3I4NB 1I6HH 2JYOA 3K59A 1I3QH 4HNUA 1W96A 1RODA 3A0JA 2C9OA 2F03A 3BABA 1JWUD 4XZ3B 3U9TA 3KHGA 4EYIB 1TU2B 3I73A 1VQ4A 4Q8EA 1AEXA 1LTGD 2E2JB 1S0OA 1SYEA 3A8JE 5C4JB 3V4SA 4GOPB 1JLLB 2XNAC 3J81c 3E0JA 3C0FB 4LMYA 1CKNB 3RR5A 2RQXA 5JVG3 2MGSA 1XNQL 4YCWA 1KRSA 2AQ1B 4QF4A 2D0OA 2ZDQA 2LMCB 1PMRA 4MV6A 2G9DA 1E22A 4LNQA 3CC2A 3GD7A 2UXCQ 2R87A 4DNRB 5KFKA 4X65H 1HNZH 3EYYA 4EG0A 5KFYA 4EQPA 3H0GH 5IIFA 1Q1EA 3M85A 3HEJA 5DQGA 1I50A 1DV1A 1SNCA 3H20A 4JI8H 4LFCQ 3RB6A 1A6XA 2XRSD 2Y0SB 1TWAB 3RB4A 4YAJB 5KT6A 2NVXA 3ORQA 3W5OA 1V1PB 2VUMA 1FD7D 1ULZA 1B6SA 1CK1A 1Q86C 1TWGH 4XDXA 3QIAA 3K8AA 4GLVB 2QA4A 3RBDA 5D3DA 5CBEE 1N36L 3S1MB 1SYDA 1B53A 1DYQA 4CDFC 2L9HA 5BR8H 2E5LQ 2N8NA 2TSSA 5T14A 1HQRD 2F0IA 3Q1KA 1U4MA 5L9XA 4R4CA 2K14A 1A9XA 1K28A 3NGDA 4LFAH 3ETHA 4UDUC 4O2DA 4TV9F 1CQVA 1LTBD 1ESRA 2AUKA 1G2TA 4C3JB 1KJJA 2R7ZB 1T36A 3G48A 4IJHA 4JI7H 5D1OB 4A3CH 4JBJA 3T51B 1OTCA 2SDFA 3BA9A 2K5VA 1T3NA 2JEFA 4ECVA 4LSAA 3BZKA 1CZGA 3K5OA 4F8MA 3N6XA 2K5DA 4RGOS 4B3RH 4I7HA 4A3EG 3PUVA 2VQEQ 2RDGA 4A93H 5JPNC 4ECZA 2I5HA 1VQJA 4R8UB 5DEHA 5ELBA 2YTVA 2Y0SG 4OO1H 2M9VA 4A3DB 3ND8A 4K2LA 5KFTA 2FMMA 1E4FT 5HGQA 3CMAA 3TIGA 1R9TA 3I90A 2V58A 4GKKL 3T1YH 3D4RA 1IOVA 3AFQA 3CCUA 3S14H 3JAMW 3L4JA 4AH6A 1CKMA 2B2TA 4G57A 1HUNA 3I70A 4JI3L 4FF4A 1IBLL 1O7LA 4I7ZC 2JA7H 1N48A 1ZYRD 4OL7A 3RZOH 3KK7A 1UE1A 5C3EG 4DV1Q 4IFDI 4LFBL 3RBEA 4HR7B 1ET6A 1GUGA 2WE6A 3RUZA 4RU9A 2AMCB 2PYKA 2YRXA 1D5ZC 1F77A 3K5IA 1WCMG 4L1KA 3LGJA 2R7ZG 4JI0Q 1SROA 2F4VL 2PMZA 5CV7A 1PK8A 3M4YA 3M9BA 5DG7A 4QL5A 5KFCA 4B3SL 1IXRA 1GLVA 1LUZA 1SMYC 1WJJA 1RJRA 5LA6F 2UUCH 3A5ZB 3F2DA 1TIID 2VNUD 4X66L 2JA5H 2ZJRA 1CKOA 3CRKC 4G7OC 3WO0A 3PO2B 4IRDA 3H4BA 4J9PA 3HG9A 3NEMA 1B33N 1HA5A 2IWHA 2FJZA 1LM0A 1SNPA 2LFNA 2W7OA 4A2AA 2EDGA 5CV4A 3HXLA 2EYPA 5L1LA 1VMPA 3FMAA 4KHPL 4A3DG 2J7ZA 3HZXA 5BPFA 5JAVA 2KHSA 1Q90A 1QILA 1E3PA 1EIYB 4ECWA 5DM73 2R93B 2DZDA 3E9HA 2YU9B 1Y1VA 3MXPA 4O3PA 5KNBA 4I65A 2F0MA 1EQRA 4NKLA 1SEBD 3CCMA 1SFOH 2XGPA 1T94A 5C0XI 4A3KG 2IHFA 4CBVA 4Y7NB 5C5LA 2RDJA 2AU0A 1TY0A 1KQSA 3DEPA 1M90C 3S16H 4CKEA 1SNDA 3SR1A 1SAPA 1IHZA 4EEQA 5KG4A 1KAWA 1AE2A 3H40A 2WP8J 4LAAA 3SE7A 4DL4A 2IHEA 3W1GA 5K5PA 5KG5A 4JOIC 2X6GA 3F2UA 1M0WA 1PRTC 1PFSA 3MAQA 2VB2X 3G8CA 3PF5A 2B8FA 1CQFA 1OO9B 2RVLA 3QO2A 1IZ6A 3GTJA 1SYBA 2C28A 2NUAB 5M5WB 5CMDA 2F0SA 4JI3H 4BBSH 1XMQL 2WACA 5M5YB 2JEIA 2LXJA 2WB1B 4FO2A 2ICEC 4XX0B 2B2UA 3I4MB 1EFID 4ID6A 2Q2TA 5IGCA 3KHLA 3GTOB 5DM63 2YTXA 4A3GB 4HIDA 1NR4A 4DAVA 4JBWA 3N41B 5KT7A 4DR1H 1UE7A 4YY3L 1RF2D 3GTMB 1XNRL 1S97A 2F4VH 1ILPA 3TEHB 3MWDA 3PR4A 4N8X1 2K4KA 3RLNA 4LH6A 2EYHA 3RN2A 2JA8H 5ISRA 2W9CB 2A68C 4U673 4UP9A 1XPRA 1S5FD 4X66H 3H15A 2OEOA 1PYWD 3MXUA 1F9SA 4ECSA 3I72A 1Z2NX 3VMMA 3BVZA 3V6HA 1DD2A 3FDTA 4KHPH 1N36Q 1WTOA 5KFIA 3FVQA 4K5WA 4LUOA 1D5MC 3D4WA 4O4HF 4XYOA 5IGEA 1S03G 4DR7H 3GIDA 1EL0A 2F0WA 2HHHH 2L0CA 1YI2A 4ED0A 4KTAA 1NUCA 3ULJA 4J9LA 3MR5A 3HP3A 4G4KA 1R4PB 2ZT9C 5JPMC 1GGOA 5LMUH 3BJUA 5KKNB 3PIOA 2CKZB 2VQFQ 4GOPA 4O3QA 3G6YA 2E2HA 3PUXA 3MXGA 2WB1G 1Y1WB 4DR2L 1CKNA 3KHRA 2Q8IB 2CW8A 3A54A 4A3GG 2V9WA 3A7LA 3V6KA 2FHTA 2ALZA 4HN7A 3MXNA 2EIFA 2B3GA 2RA4A 3QJYA 2A19A 3MTSA 1N33H 3OW7A 1LTRD 3HOYB 2ZJTA 2JQOA 1X56A 2HCCA 1KHIA 4WJ4A 4FXDA 4HMJA 3S1QH 2FK1A 1HRJA 1VQ5A 2CZGA 4Q43A 1EUCB 4YHHL 2Y0SA 3TP8A 4EBEA 1Z2PX 4ZYSA 2R7KA 2WINB 1V1PA 1F9QA 1HJPA 4KMUC 4MTEA 1P16A 2EJFC 1DOMA 2X0SA 3EN2A 1IBLQ 3WO1A 1U4PA 3JRXA 5KIXA 1ZKOA 2F0GA 3A5UA 1ENCA 1XNRH 4GKJH 5J2UF 5KG6A 4LFBQ 3GIJA 4JI2L 2HUGA 1JJGA 3S9WA 3BQ1A 1VQFA 3A8IE 2AWNA 5I6YA 4NXNH 4QWBA 1WTPA 1OXUA 1B44D 2KECA 3SE0A 1VQ8A 1AP0A 4B3SQ 1HNXH 2R7ZA 2IT1A 5AJ3Q 4QMGA 3ZYYX 4DV0L 1AH9A 4NXMQ 1BF4A 2P5ZX 2RCFA 2KUMA 4ULLA 1PA6A 4JI5H 4AYBB 2GPWA 1HR0W 4CKBA 2O03A 3K5HA 2H5XA 2J0TD 4ODGA 5K2MA 2XWJB 1UWVA 1KRTA 3V2TA 5D8DA 3HOYG 1ML0D 3HOZH 4KJOA 5A2QE 1JORA 2HVRA 4QW8A 4IFDH 4XQNA 3CC7A 1IOWA 4R8UA 3GIKA 2EXDA 4LF9H 1UAPA 1J8IA 1HFNA 1TAEA 3DM1A 3H0GG 4RFBA 1XXGA 3FPPA 1H9MA 1F2MA 2V1CC 3K0YA 3T16A 2D2CC 1MD2D 1YHAA 4X62L 3GTKH 2V5AA 2MO1A 1B9NA 2CCZA 1NR2A 4ME3A 3SXHA 2R6GA 4MTDA 3ULPA 1LTAD 1MKHA 3ERSX 3NWSA 4NP5A 1QZGA 2JK8A 1X32A 1RL2A 5IT9E 3S14B 1ZEQX 2IMWP 2MPMA 1YJ9A 1JE4A 2CWAA 5KFFA 4I4TF 4C2MA 1Q1BA 1SNMA 3HS0C 4HR7A 2DJGC 1WTQA 4UFZA 4JPBW 4HJ9A 4YHHH 2C22A 1VQAA 3J80W 1CFMA 4JV5L 2F0JA 2EE1A 1BJTA 3RF2A 3RZOB 1SEIA 1JR0D 5KG3A 2NVTH 3KTMA 1UC8A 1KDBA 1K0SA 5FJ8G 1BDOA 1EIHA 4F4WA 1XTCD 1L0YB 2PW5A 3LX0A 1H9SA 1SR3A 1B4OA 1U9RA 3J80c 1XMQQ 5CR3A 3PO3H 4IUNA 5C0XH 2B2UC 2ZTEA 5DQIA 3S2HH 2VUMB 1PH9A 4JI2H 3C3LA 4A3CG 1WD0A 2FXQA 5HBRB 3I3CA 3J81j 3FEWX 2F0LA 3SGIA 2J6TA 4L5RC 2RBMA 2R82A 2JA5B 2IPKD 4P74A 4YY3Q 4A3IB 1WTVA 3H94A 3JAME 1EQVA 4ECRA 5I9PA 1PZJD 2E74C 3C1EA 4A3JH 4IUTA 4FNFA 2W7PA 1E7ZA 3NQTA 3MR6A 2JA6H 3PW7A 1WTHA 3NTHA 5GAEC 1N32L 2BH8A 3BAAA 3U50C 5C4XH 3L7ZC 2QEXA 4OO1G 4EBDA 1BOSA 2CFMA 3ND9A 4AIMA 2I87A 2KCCA 3R23A 3C1FA 1PTOD 4K6LA 4DR4L 1N34L 4BBRB 3D0FA 2V59A 3M4PA 2FP4B 5KFWA 3K7UC 3AFPA 2DPIA 1F2YA 5IT9L 4F87A 2GLTA 2PNRC 1RTOA 3GV5B 1K73C 4LF5Q 3UFXB 1H9JA 3ONAB 5LL6X 3NBHB 3OTOL 2Z6KA 5ELFA 4EGQA 4ECTA 2ASDA 3CCQA 1BKBA 3Q6SA 2Q8TA 4IPCA 1I4QA 4ALPA 5FPRA 1VQHA 1VQEA 4A3BB 1LTTD 4IUQA 4HSVA 1LT5D 4DK6C 3SI8A 3FP9A 4NMZA 1YVCA 1I5FA 1NY4A 5EZYF 4JC0A 4DR2Q 4IHJF 2QKIC 4MIUA 1UNNC 2WB1A 4J9NA 1EQQA 2M05A 2JE6I 4X64L 2JA5G 1AN8A 3GTOA 2IX3A 2F0FA 3TP7A 3FMCA 3F2BA 4H0LC 3GTLH 5D3IB 3JAML 4LF6L 3BA8A 1QNUA 4EFBA 3H91A 4DV4L 2LXKA 4RAYA 2L1BA 1EYGA 4S3SA 2VA3A 3M4OH 1MBYA 4OO1I 5KG2A 3P75A 4O3RA 4DV2L 4YWKA 1UEAB 2JEBI 1HCZA 3DHQA 3MFYA 1XPUA 4PDBA 1AN7A 3CVZA 1C9OA 1R4QB 1A3VA 3PZPA 3LNNA 2ATWA 1PRTF 4J6HA 1LABA 3SK6A 4DR3L 2JA8B 4MAMA 2KQ3A 5ELDA 4N8FA 4DK3C 4DF7A 4HNVA 1GUWA 3JAMi 3MFHA 1TXYA 4ED2A 2B63H 4ED7A 3HFZB 3TMEA 4IAJA 1X6OA 4RB1A 1DIKA 1LTSD 2V4RA 1KABA 4L5QA 5C44B 3I8ZA 4JBKA 5KYIA 3T5LA 4NW2A 4DAMA 4LF7L 4MA0A 2OT2A 2GVAA 4BS9A 5IY0A 4V190 2DWCA 3TQTA 4A3FB 5ELNA 4DR4H 2AHOB 1I3QA 4DV0Q 4DV6H 1O78A 2A74C 1FJGH 3U9SA 1EZ6A 1EU3A 2XSCA 1L0XB 4BBSG 2OTJA 1HXYD 4OWXB 3OTOH 3HBLA 4LF8Q 3S1NH 4TQUS 3CPWA 2IX1A 2EYLA 3X3NA 2NBFA 1KLGD 1YNND 2OQKA 1IYVA 4ED6A 5J22A 3H3VC 1G6PA 2HVQA 2I46A 2LY7A 1BCPB 4BXXH 5FD6A 1BQQT 2ZTDA 4MZ9A 1S10A 3HOUB 3DLLA 2A69C 1M7JA 2I5LX 2W71A 4J9KA 1KLUD 1PXUA 2BA1A 4OONA 2R92H 1MIUA 3QOJA 3NXWA 3L0OA 4DNIA 2XTIA 1DOKA 2Q2IA 4X62Q 2CWPA 3H0GA 2UVVA 4DR5H 4CKCA 4OXPA 2X69A 3U9OA 4JV2A 1PYBA 5BN4A 2JA8G 4JI8L 4X64H 3S1QB 3K58A 3F8NA 3IFDA 3FKIH 1GVPA 2XGQA 3CQZH 4FP5D 2WKCA 5C44G 2K50A 2NVYB 4LJZC 1WI5A 1HHVA 2WDTA 1X55A 3BQ2A 2JA9A 1SSOA 1E0BA 1IYJB 4L6TB 4RUCA 3L4KA 1STGA 4PZ6A 4YWLA 5L37A 4JV5Q 4DV2H 4DL2A 1A15A 4KKSA 5JJIA 1I6UA 3M9NB 2D9UA 2UU9L 4UPAA 4UAIA 2K7VA 2MNAA 4I50F 4DAYB 2VA2A 1EYDA 2WAQG 4AQYQ 1BBUA 3T56B 1C7YA 2FINB 3PMFA 2EJGC 2KHJA 2VOBA 3MZ5A 2UUAH 4DUYH 4UY8C 3WOFA 3KLRA 2E5LH 1TA8A 4O2BF 3CRLC 1EY9A 2PW7A 3JC66 4MN3A 4JI7L 4TSSA 3A7AB 3GTPH 2XVSA 2UXDQ 4FF3A 4C1NI 3J7A5 4JW0A 1X3FA 4DK1A 3MWYW 2PZTA 3X3MA 1QG7A 4RKBA 1Z7TA 4B3RL 4QIWE 2Z8LA 3E0EA 1SDFA 1N32Q 2IW3A 5IOCA 5EWGA 3J81W 4IJLA 3KALA 2RDFA 4A3MH 4C3HH 5KT3A 3HB9A 2YL2A 3Q8QB 1N34Q 2E2HB 3VR5A 1STNA 3MWEA 3W3AA 4UHVA 1ICWA 3ICEA 1QJOA 1KL9A 3T1YL 3OSOA 2Z6KC 1MI2A 4CDCC 2MUYA 1HTPA 2QDBA 1EYAA 3MXNB 1SNOA 3GV8B 3IN5A 4JI6Q 4PNYA 3TZDA 4A3EB 4MTKA 3OOCA 4A3LH 1CQJB 2YZGA 1VKZA 4ZQIA 4EQOA 4IN3A 2NN6H 1C30A 2UVRA 1LV9A 5LMNW 5FO9B 1B6RA 2F0UA 4Q44A 2WFWA 5TSSA 5BN5A 4RAZA 2K5QA 2PCFB 1RCVD 2YS7A 2UUCL 4KY5A 2E75C 1OXXK 3PO3B 2JN4A 3S1RB 2JA5A 1VF5C 1W3SA 3RZDB 4LF6Q 1G91A 4M1UB 2I8CA 4BY1H 2UU9H 5DG8A 2NZOA 1YHBA 1RJTA 3J7AV 2B8GA 3RGXA 5C3EB 4IFDG 1TWCB 4K8JA 1JDEA 2RHQB 1M4VA 1N9WA 2R7MA 1STYA 1D1IA 1WCMB 3GQBA 4MV1A 2AGQA 2FK3A 4A3JB 4OX9H 5I47A 4EVOA 3V05A 1PTOC 2JEAI 2OLSA 2PN1A 1TWHB 4YBZB 1HNWH 2W9AA 2C00A 4J8QA 5IGGA 5FLXc 4G3IA 1DM0B 3U58A 1LACA 1X3PA 2XGTA 4EQNA 1MHWC 3NBHA 2YYZA 3EVQA 2ZM6Q 1RK5A 4LF7Q 1A3TA 1HR0L 4N9TA 3GTQB 4HYKA 5KEEA 1JCKB 3VR2A 1TS5A 2BDOA 1A62A 2CW7A 4WORA 5IP7G 2FLLA 2SNMA 2ASBA 3AU7A 1L1OC 2WAQE 1WTXA 3RLOA 1BBWA 3JSNA 4MV7A 1S3OA 2MCTA 4JI1L 1IW7C 3TQYA 3PO3G 2J9GA 4UCVA 5C0XG 4A3KB 2W57A 1UE5A 3K0XA 5KT5A 1BCPD 1GSHA 2CVRA 1T9HA 1VQLA 1VAJA 3RJ0A 1EY0A 2A6HD 1RK6A 5DQHA 4RHSA 4C2MB 5FK9C 2AQ2B 4Q45A 1VQDA 2HDLA 2W8KA 3P1HA 1DJRD 4X65Q 1HNZQ 4A3JG 4DR1L 5M9OA 4DK0A 5M3FB 5IYBG 1ENAA 2ZXRA 4JI8Q 3QR8A 1H9SB 2W6PA 4ZI7F 3M4OB 2K75A 1ASYA 4KY7A 4RNOA 1C8CA 4KKUA 4TQSA 1L0WA 1KAAA 2UVWA 1SE3A 3NTKA 1RJPA 4UCTA 2D0PA 3PIP3 4KN7C 4CC6A 4ME5A 1CHQD 1KBLA 5C1PA 3BG3A 4QWEA 2CH4A 5BR8Q 1YIJA 4DR7L 1TWFH 4DV5H 2HHHL 4K0KL 5J39A 2IY5B 5C3XA 1SE4A 4X6AH 2WAQA 4LFAQ 4BWSC 4PV1C 2K1BA 4RB2C 1SE2A 2NYZD 5LMUL 4JI7Q 2I0QA 4KY6A 4JUZA 1G291 2M2LA 4RGTA 1PZKD 1Q3LA 3NE5B 2RGVA 1GJXA 4EX5A 4RZRA 1RJQA 1HR0H 3KBXA 4B3RQ 2B29A 4HCEA 2UVUA 2XN9C 1OXVA 5M3FG 2NU7B 2UXBH 4ECYA 1N33L 3RB0A 3HOWH 3CCJA 5JEAH 4ED3A 3IAYA 2QF7A 2MP1A 5NUCA 5L1IA 4JI1H 1XTDA 4YR3A 1PFMA 4DPGA 2DY8A 1EYZA 5IGBA 3S15H 2J6SA 1ZHQA 2R92B 4R4OA 1PVOA 1IKMA 3CAMA 4LF4L 3T1YQ 3CF5A 3AQQA 2XWBB 3RD4A 2YRWA 2WIIB 1XNQQ 1B7YB 2PBZA 1SMXA 1PLFA 2NVYA 1LT3D 2EQSA 3GILA 2C2DA 2B63G 3HKZB 3CKIB 4R9WA 1R9TH 3S2DH 2PZWA 3CCEA 1IBML 1HPCA 2KEEA 3CQZB 3CC4A 3ITPA 4GKJL 1RDPD 2RSOA 1N56A 2HQLA 2KCNA 1PH8A 3CCSA 4DAYA 2VZAA 3NQIA 5E3FA
chains in the Genus database with same CATH topology
4R4TA 3OW2A 1U0LA 4DUYQ 2UUAQ 1YJ9A 2CWAA 2UUBQ 3U4ZA 1Q1BA 1LTLA 2N3SA 4NXNL 5FJ8H 4O0AA 4AYBE 4HJ9A 3CPFA 1EIFA 1O7IA 1VQAA 3D31A 4JV5L 1L1OA 1HNXL 2CQOA 2NVTH 2Q2HA 2PMZE 4R1JA 3TREA 1ASZA 5FJ8G 2UUCQ 1H95A 3H3VI 5IWAQ 2VQFL 4QJFA 1SR3A 4JI5L 3J80c 1XMQQ 2YTYA 3M4QA 4DV1L 3PO3H 4DKAC 4PG3A 3NENA 5IT9c 4IOAA 2ZTEA 1L2FA 2UXBL 5M5WH 1XPOA 3S2HH 4TVAB 1X9NA 1PH9A 1A63A 4A3CG 4X65L 5M5YH 2FXQA 1HNZL 4BXXG 2D62A 1NJIC 3GDEA 3J81j 4JI0L 5GROA 3SGIA 4L5RC 4LF9L 1FVIA 1MJCA 3S17H 4P74A 4YY3Q 2R92G 3I7FA 1GKHA 2DUDA 4HIKA 3GTOH 4A3GH 1PH2A 1VCIA 4A3JH 1B8AA 1X3GA 2GVBA 3EBEA 4GNXC 2JJQA 1K83H 1E7ZA 2L15A 4GN4B 1QZHA 2JA6H 5IP9H 1PHJA 5GAEC 1N32L 2BH8A 3HKZG 3U50C 4R4IA 1X3EA 3FKIG 3L7ZC 5C4XH 2QEXA 4BY7G 4OO1G 1WYDA 4NPSA 3K81C 2CFMA 2IX0A 3EIVA 3B6YA 4AIMA 3F2CA 3CCRA 5LMNQ 1K8GA 2JA6G 5IP9G 4A3FG 3CD6A 4DR4L 4DUZL 1N34L 5C4XG 3D0FA 5GAGC 3M4PA 3K7UC 3JAMc 1Y1VG 5BR8L 4L5SA 3AFPA 4DR6Q 1OXTA 3M3YH 1SN8A 2PI2E 1I50H 5H1SE 3HOXG 1FGUA 4GNXB 1K73C 1JB7A 4LF5Q 2C35B 4A4IA 4GKKQ 4GLAC 3NBHB 3OTOL 2Z6KA 4LFAL 3CCQA 2NVXH 1BKBA 4XIGS 3AEVA 3KFUA 3PCOB 4IPCA 4ALPA 3E9IA 1VQHA 2VUMH 1VQEA 4JI3Q 4JI4L 1VQOA 2UU9Q 4APVA 1EUJA 4DK6C 5JJLA 1G51A 5IE8A 4A75A 4GN5A 3GTJH 4FDBA 3FP9A 5AJ3L 2K5NA 1YVCA 3IRBA 3J80i 3HOUG 1I5FA 1Q81C 1NY4A 1LYLA 1I6HH 4JC0A 4A3IH 4NXML 3TRZA 4DR2Q 1I3QH 1X65A 3A0JA 1EQQA 4P72A 2JE6I 1VQ4A 4X64L 4DR1Q 4OX9Q 1JMCA 2JA5G 2K5HA 2F4VQ 3F8TA 4H02A 3F2BA 4B3TL 1HNWQ 4GOPB 3GTLH 4LF6L 3J81c 4OWTB 4KLKA 3J7ZC 4A3MG 3K7AH 3PIPA 4X66Q 3MEFA 2LXKA 4P75A 4DV4L 1CKNB 3RR5A 4BBRH 2KCTA 1EYGA 3M4OH 4OO1I 1XNQL 5IYCH 4YCWA 4LWCA 1KRSA 1NE3A 2D0OA 4DV2L 4IOCA 4YWKA 1YITA 1HH2P 1QUQB 1E22A 2JEBI 1VQ9A 3CC2A 4LNQA 3GD7A 1XPUA 1UE6A 3RLFA 2UXCQ 1C9OA 4KHPQ 1PH1A 1KXLA 3H0GH 3M85A 1Q1EA 1BVSA 4DV3L 4DV7L 1CUKA 2ATWA 4QQBX 4HJ5A 3PSIA 4DR3L 4J15A 4DK3C 4LFCQ 3JAMi 1TXYA 4DR7Q 1K3RA 2B63H 4NB3A 3HFZB 4A3BH 2HT1A 1X6OA 5FLMH 2HHHQ 4A3LG 2MQHA 1C0AA 4MTNA 1IL2A 4L5QA 3W5OA 1S72A 3HOVH 3I4NH 4JBKA 5LMUQ 3TS0A 4DAMA 4YCUA 4LF7L 1Q86C 1WFQA 2GVAA 1TWGH 5IY0A 3T1HL 3K8AA 4GLVB 2QA4A 5ELNA 3PGZA 1VQ7A 2E2JH 5IWAL 1N36L 1JT8A 2AHOB 3RN5A 3G71A 5C4JH 4DV0Q 3PO2G 2E5LQ 2N8NA 1VQKA 2KBNA 1N33Q 4BBSG 4R4CA 2OTJA 2K14A 2K52A 5HY6A 4OWXB 4LF8Q 1D7QA 4O2DA 3S1NH 1CSQA 3BZCA 2LSSA 4TQUS 3CPWA 2NZHA 3G48A 4IJHA 2IX1A 2R93G 5M5XH 4A3CH 2OQKA 3F1ZA 4JBJA 1OTCA 3J81i 1Q12A 2K5VA 3Q8DA 1G6PA 4BXXH 4JBMA 2ZTDA 3BZKA 4MZ9A 3DLLA 2PQAB 4IPHA 2I5LX 2Y0SE 2BA1A 4OONA 2R92H 1A8VA 4GNXA 2AKWB 4BA1I 1MIUA 1Q82C 4A3EG 3L0OA 3PUVA 2XTIA 2Q2IA 1TWAH 3STBD 2CWPA 4DNIA 5IYDG 4IPDA 4X62Q 4OXPA 4A93H 3HKZE 1PYBA 2JA8G 2I5HA 4JI8L 2A1AA 1VQJA 1YHQA 5C44H 1XMOL 1XNRQ 4GKJQ 4L5TA 2YTVA 4DV5Q 3FKIH 2Y0SG 4BY7H 1VQCA 1GVPA 4LW1A 4DR6L 4A93G 3CQZH 4GN3B 3GO5A 5HGQA 5C44G 3TS2A 4A3FH 4HIOA 3CMAA 2K50A 1WI5A 2NN6I 4LF5L 3S1MH 4GKKL 1X55A 2JA9A 1NMGA 3AFQA 4KHZA 2PNHA 3KF8B 1IYJB 3CCUA 4LUZA 1Y1VH 2VY3A 4PZ6A 4YWLA 3CCVA 4POGA 1J6QA 4AH6A 4JV5Q 3HOXH 1EWIA 1HNXQ 1CKMA 2ALYB 4JG2A 4P71A 5JJIA 1HR0Q 4JI3L 5M3MG 1IBLL 2UU9L 1FL0A 3PUWA 1HZAA 4UPAA 4DV6L 3UE1A 1J5EL 2JA7H 2MNAA 4DAYB 3RZOH 3K80C 1FJGL 1UE1A 2WAQG 4JYAL 5C3EG 4AQYQ 1BBUA 4DV1Q 4IFDI 3CW2C 4LFBL 4C3JH 1C7YA 2R7ZH 2UXBQ 1N8RC 2JA7G 4YCVA 2AMCB 2KHJA 3I4MG 3A74A 1WCMG 3KLWA 4UY8C 4JI1Q 1L1OB 1QVGA 3HOUH 3LGJA 4GOPC 4B3ML 3JC66 3WWVA 4JI0Q 4JI7L 1SROA 2F4VL 3GTPH 2R7ZG 2KENA 1IBKL 4LF9Q 2UXDQ 3M9BA 1X54A 1Z9FA 4QL5A 2VQEQ 4B3SL 1IXRA 1X3FA 3J7A5 1LUZA 1WJJA 3G6EA 3I2ZA 3W1BA 1NMFA 3A5ZB 1VQGA 4RG1A 3F2DA 4B3RL 2VNUD 4X66L 2JA5H 3KYHC 4QIWE 2ZJRA 1CKOA 1K9MC 3E0EA 1N32Q 4DR5L 4A3DH 3NEMA 4IJLA 4MNOA 1JE5A 1LM0A 1V9PA 3UDXA 1YJNA 2BH2A 4A3MH 3H3VH 4C3HH 4HJ8A 4BA2I 2UXCL 2NVYH 3ER0A 1GO3E 3GTGH 4KHPL 4A3DG 4DUZQ 1N34Q 1VQIA 1I94L 1SRUA 2ES2A 2N78A 1E3PA 3KJPA 3KJOA 1EIYB 1QVFA 3ICEA 1KL9A 3T1YL 2Z6KC 2OCEA 4YHHQ 3E9HA 4HJ7A 2Z0SA 4GS3A 3U4VA 4PZ8A 3CCMA 1SFOH 1EQRA 3MXNB 4POFA 5C0XI 4A3KG 1PH7A 3CP0A 2IHFA 3PV0A 1YEZA 4YWMA 1W2BA 4JI6Q 4C3IH 3L2PA 3G4SA 2VL6A 1KQSA 4JCVE 1A0IA 1M90C 3S16H 4A3LH 2F52A 2PI2A 1Y1WG 1VQNA 1KAWA 1AE2A 1YJWA 1PYSB 2WP8J 2UUAL 4JI2Q 4DUYL 1SLJA 4K0KQ 2UUBL 2IHEA 3W1GA 5LMNW 2E5LL 4JOIC 2R7DA 5J3BA 2WFWA 1PFSA 2NN6G 4HJAA 2HIXA 1D8LA 3PF5A 1PH5A 3HKSA 1IZ6A 5GAHC 4LF8L 2I5MX 3PO2H 2UUCL 4B3TQ 1OXXK 1W3SA 4LF6Q 1VQ6A 1PH3A 4BY1H 5GQOA 3PF4A 1XMQL 1WOCA 4BBSH 3PUZA 2NZOA 1Q8KA 1YHBA 5JEAG 1GD7A 2LXJA 2E2HH 2Q2UA 4IFDG 5GADC 1PH4A 1SE8A 4BY1G 2OWOA 1NBWA 2QGQA 2R93H 2RHQB 1M1KC 1N9WA 4UP8A 2VQEL 2Q2TA 1YNXA 2YU9H 2YTXA 4HIDA 4JBWA 3VDYA 1UE7A 4YY3L 5DLQE 4DV7Q 4XTCS 5JJKA 1XNRL 2JEAI 3TEHB 4Y7NH 4LF4Q 3RLNA 2K4KA 4A3EH 3AYHB 1HZ9A 5IYDH 3UDFA 3RN2A 3ZJYC 1EFWA 5FLXc 2JA8H 4Y52H 1RIPA 3U58A 4UP9A 3CMEA 1XPRA 2NVQH 2XGTA 5K36G 3H15A 2HIVA 3KDFB 2YYZA 2ZM6Q 5LMNL 2RF4A 4LF7Q 1E1TA 4A76A 1IBMQ 5IP7H 2KCMA 3RNUA 1HR0L 4QGUA 3T1HQ 5JEAJ 1CSPA 3KF6B 1S40A 1N36Q 1A62A 4IFDJ 1DGSA 1B70B 4LUOA 4AYBG 5IP7G 4AQYL 4EQ5A 3NELA 3S1RH 2ASBA 2R7FA 2ZJQA 2KHIA 1L1OC 3RZDH 2YV5A 3CXCA 1KIXA 5M3MH 2RCNA 2WAQE 4NXNQ 3RLOA 2WB1E 1BBWA 2E8GA 4HIMA 1YI2A 2BA0A 1S3OA 4JI1L 3ULJA 3TQYA 3PO3G 5C3EH 5C0XG 1TWCH 1UE5A 3K0XA 3S24A 4IO9A 1T9HA 1VQLA 2UXDL 3BJUA 1E1OA 3I4MH 2GN5A 2CKZB 4UP7A 3PIOA 2VQFQ 1WCMH 4GOPA 4JI5Q 3PUXA 1JJ2A 2WB1G 1KD1C 1XJVA 5E7NA 1VQDA 2N49A 5IYBH 4DR2L 1CKNA 1HZCA 3GTMH 1PH6A 1TWHH 3M7NA 4X65Q 4A3GG 1HNZQ 4OWWB 4A3JG 1YBYA 4DR1L 4OX9L 1QUQA 1P8LA 2B3GA 2EIFA 3OYYA 5IYBG 2A19A 3I56A 1Q7YC 4JI8Q 3FHWA 1HNWL 1VQMA 2ZTCA 1HZBA 3BU2A 2JQOA 3PUYA 1XMOQ 1MJEA 1X56A 2K75A 1ASYA 1KHIA 2RHSB 4WJ4A 4PMWA 1Y14B 3S1QH 3UE0A 1VQ5A 3UDGA 4WJ3M 1L0WA 1VS0A 4YHHL 3GTQH 1EOVA 2ID0A 5C0XJ 2MO0A 3ULLA 1VQBA 4R4QA 1JJCB 2D0PA 3UDIA 4JI6L 1HJPA 4QY7A 4DR4Q 1P16A 2DGYA 3EN2A 1IBLQ 4DV6Q 1J5EQ 5BR8Q 1PH8A 4LFCL 1Z47A 2VW9A 1V1QA 1YIJA 1FJGQ 4A3KH 4IPGA 3A5UA 4DR7L 4JYAQ 1TWFH 1YZ6A 2F3IA 2HHHL 4LFBQ 4JI2L 2VUMG 4K0KL 2IY5B 1VQPA 1K0RA 4PZ7A 1JJGA 4X6AH 3OTOQ 4LFAQ 1V43A 4C2MH 2A8VA 1VQFA 2AWNA 1KC8C 5LMUL 1NTGA 1Y1WH 3DM3A 4B3MQ 4JI7Q 1UEBA 4JOIA 4A3IG 2I0QA 1OXUA 4JI4Q 3KOJA 1IBKQ 1G291 1VQ8A 4B3SQ 2IT1A 1U5KA 5M3FH 4EX5A 5AJ3Q 1PV4A 4DV0L 4B3RQ 2AWOA 2VS1A 4NXMQ 5EAYA 3HOYH 2B29A 1AH9A 1PA6A 2PQAA 1HR0W 1OXVA 1QVCA 2H5XA 5M3FG 4DR5Q 4X64Q 1N33L 1UWVA 3HOWH 3CCJA 1KRTA 3HOYG 3KDFA 4BBRG 3HOZH 3STBC 5IYCG 1XTDA 1OXSC 4DPGA 3CC7A 4GLXA 1K8AC 1I94Q 3HOWG 2EXDA 3S15H 3S14H 4KI0A 4R4OA 4P73A 1PVOA 3CAMA 4DV4Q 4LF4L 3HOZG 1Q46A 3KF6A 3T1YQ 2ZJPA 3AQQA 3CF5A 1E24A 5ELOA 3H0GG 1XNQQ 1B7YB 2OTLA 2MFIA 4DV2Q 1SMXA 3I4OA 2E2IH 2V1CC 4RMFA 2EQSA 1YHAA 2B63G 4X62L 3GTKH 4A3BG 2MO1A 1R9TH 5FLMG 2ZM6L 3S2DH 2CCZA 3CCEA 1IBML 4ME3A 4DV3Q 2R6GA 4LUVA 3CC4A 4GKJL 4DR3Q 3ULPA 1GM5A 4DV5L 3CCLA 1MKHA 2OQ0A 3ERSX 1QZGA 3HOVG 3I4NG 2HQLA 3I55A 2JK8A 3CCSA 1RL2A 2VZAA 1AE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4T A;  3OW2 A;  1U0L A;  4DUY Q;  2UUA Q;  1YJ9 A;  2CWA A;  2UUB Q;  3U4Z A;  1Q1B A;  1LTL A;  2N3S A;  4NXN L;  5FJ8 H;  4O0A A;  4AYB E;  4HJ9 A;  3CPF A;  1EIF A;  1O7I A;  1VQA A;  3D31 A;  4JV5 L;  1L1O A;  1HNX L;  2CQO A;  2NVT H;  2Q2H A;  2PMZ E;  4R1J A;  3TRE A;  1ASZ A;  5FJ8 G;  2UUC Q;  1H95 A;  3H3V I;  5IWA Q;  2VQF L;  4QJF A;  1SR3 A;  4JI5 L;  3J80 c;  1XMQ Q;  2YTY A;  3M4Q A;  4DV1 L;  3PO3 H;  4DKA C;  4PG3 A;  3NEN A;  5IT9 c;  4IOA A;  2ZTE A;  1L2F A;  2UXB L;  5M5W H;  1XPO A;  3S2H H;  4TVA B;  1X9N A;  1PH9 A;  1A63 A;  4A3C G;  4X65 L;  5M5Y H;  2FXQ A;  1HNZ L;  4BXX G;  2D62 A;  1NJI C;  3GDE A;  3J81 j;  4JI0 L;  5GRO A;  3SGI A;  4L5R C;  4LF9 L;  1FVI A;  1MJC A;  3S17 H;  4P74 A;  4YY3 Q;  2R92 G;  3I7F A;  1GKH A;  2DUD A;  4HIK A;  3GTO H;  4A3G H;  1PH2 A;  1VCI A;  4A3J H;  1B8A A;  1X3G A;  2GVB A;  3EBE A;  4GNX C;  2JJQ A;  1K83 H;  1E7Z A;  2L15 A;  4GN4 B;  1QZH A;  2JA6 H;  5IP9 H;  1PHJ A;  5GAE C;  1N32 L;  2BH8 A;  3HKZ G;  3U50 C;  4R4I A;  1X3E A;  3FKI G;  3L7Z C;  5C4X H;  2QEX A;  4BY7 G;  4OO1 G;  1WYD A;  4NPS A;  3K81 C;  2CFM A;  2IX0 A;  3EIV A;  3B6Y A;  4AIM A;  3F2C A;  3CCR A;  5LMN Q;  1K8G A;  2JA6 G;  5IP9 G;  4A3F G;  3CD6 A;  4DR4 L;  4DUZ L;  1N34 L;  5C4X G;  3D0F A;  5GAG C;  3M4P A;  3K7U C;  3JAM c;  1Y1V G;  5BR8 L;  4L5S A;  3AFP A;  4DR6 Q;  1OXT A;  3M3Y H;  1SN8 A;  2PI2 E;  1I50 H;  5H1S E;  3HOX G;  1FGU A;  4GNX B;  1K73 C;  1JB7 A;  4LF5 Q;  2C35 B;  4A4I A;  4GKK Q;  4GLA C;  3NBH B;  3OTO L;  2Z6K A;  4LFA L;  3CCQ A;  2NVX H;  1BKB A;  4XIG S;  3AEV A;  3KFU A;  3PCO B;  4IPC A;  4ALP A;  3E9I A;  1VQH A;  2VUM H;  1VQE A;  4JI3 Q;  4JI4 L;  1VQO A;  2UU9 Q;  4APV A;  1EUJ A;  4DK6 C;  5JJL A;  1G51 A;  5IE8 A;  4A75 A;  4GN5 A;  3GTJ H;  4FDB A;  3FP9 A;  5AJ3 L;  2K5N A;  1YVC A;  3IRB A;  3J80 i;  3HOU G;  1I5F A;  1Q81 C;  1NY4 A;  1LYL A;  1I6H H;  4JC0 A;  4A3I H;  4NXM L;  3TRZ A;  4DR2 Q;  1I3Q H;  1X65 A;  3A0J A;  1EQQ A;  4P72 A;  2JE6 I;  1VQ4 A;  4X64 L;  4DR1 Q;  4OX9 Q;  1JMC A;  2JA5 G;  2K5H A;  2F4V Q;  3F8T A;  4H02 A;  3F2B A;  4B3T L;  1HNW Q;  4GOP B;  3GTL H;  4LF6 L;  3J81 c;  4OWT B;  4KLK A;  3J7Z C;  4A3M G;  3K7A H;  3PIP A;  4X66 Q;  3MEF A;  2LXK A;  4P75 A;  4DV4 L;  1CKN B;  3RR5 A;  4BBR H;  2KCT A;  1EYG A;  3M4O H;  4OO1 I;  1XNQ L;  5IYC H;  4YCW A;  4LWC A;  1KRS A;  1NE3 A;  2D0O A;  4DV2 L;  4IOC A;  4YWK A;  1YIT A;  1HH2 P;  1QUQ B;  1E22 A;  2JEB I;  1VQ9 A;  3CC2 A;  4LNQ A;  3GD7 A;  1XPU A;  1UE6 A;  3RLF A;  2UXC Q;  1C9O A;  4KHP Q;  1PH1 A;  1KXL A;  3H0G H;  3M85 A;  1Q1E A;  1BVS A;  4DV3 L;  4DV7 L;  1CUK A;  2ATW A;  4QQB X;  4HJ5 A;  3PSI A;  4DR3 L;  4J15 A;  4DK3 C;  4LFC Q;  3JAM i;  1TXY A;  4DR7 Q;  1K3R A;  2B63 H;  4NB3 A;  3HFZ B;  4A3B H;  2HT1 A;  1X6O A;  5FLM H;  2HHH Q;  4A3L G;  2MQH A;  1C0A A;  4MTN A;  1IL2 A;  4L5Q A;  3W5O A;  1S72 A;  3HOV H;  3I4N H;  4JBK A;  5LMU Q;  3TS0 A;  4DAM A;  4YCU A;  4LF7 L;  1Q86 C;  1WFQ A;  2GVA A;  1TWG H;  5IY0 A;  3T1H L;  3K8A A;  4GLV B;  2QA4 A;  5ELN A;  3PGZ A;  1VQ7 A;  2E2J H;  5IWA L;  1N36 L;  1JT8 A;  2AHO B;  3RN5 A;  3G71 A;  5C4J H;  4DV0 Q;  3PO2 G;  2E5L Q;  2N8N A;  1VQK A;  2KBN A;  1N33 Q;  4BBS G;  4R4C A;  2OTJ A;  2K14 A;  2K52 A;  5HY6 A;  4OWX B;  4LF8 Q;  1D7Q A;  4O2D A;  3S1N H;  1CSQ A;  3BZC A;  2LSS A;  4TQU S;  3CPW A;  2NZH A;  3G48 A;  4IJH A;  2IX1 A;  2R93 G;  5M5X H;  4A3C H;  2OQK A;  3F1Z A;  4JBJ A;  1OTC A;  3J81 i;  1Q12 A;  2K5V A;  3Q8D A;  1G6P A;  4BXX H;  4JBM A;  2ZTD A;  3BZK A;  4MZ9 A;  3DLL A;  2PQA B;  4IPH A;  2I5L X;  2Y0S E;  2BA1 A;  4OON A;  2R92 H;  1A8V A;  4GNX A;  2AKW B;  4BA1 I;  1MIU A;  1Q82 C;  4A3E G;  3L0O A;  3PUV A;  2XTI A;  2Q2I A;  1TWA H;  3STB D;  2CWP A;  4DNI A;  5IYD G;  4IPD A;  4X62 Q;  4OXP A;  4A93 H;  3HKZ E;  1PYB A;  2JA8 G;  2I5H A;  4JI8 L;  2A1A A;  1VQJ A;  1YHQ A;  5C44 H;  1XMO L;  1XNR Q;  4GKJ Q;  4L5T A;  2YTV A;  4DV5 Q;  3FKI H;  2Y0S G;  4BY7 H;  1VQC A;  1GVP A;  4LW1 A;  4DR6 L;  4A93 G;  3CQZ H;  4GN3 B;  3GO5 A;  5HGQ A;  5C44 G;  3TS2 A;  4A3F H;  4HIO A;  3CMA A;  2K50 A;  1WI5 A;  2NN6 I;  4LF5 L;  3S1M H;  4GKK L;  1X55 A;  2JA9 A;  1NMG A;  3AFQ A;  4KHZ A;  2PNH A;  3KF8 B;  1IYJ B;  3CCU A;  4LUZ A;  1Y1V H;  2VY3 A;  4PZ6 A;  4YWL A;  3CCV A;  4POG A;  1J6Q A;  4AH6 A;  4JV5 Q;  3HOX H;  1EWI A;  1HNX Q;  1CKM A;  2ALY B;  4JG2 A;  4P71 A;  5JJI A;  1HR0 Q;  4JI3 L;  5M3M G;  1IBL L;  2UU9 L;  1FL0 A;  3PUW A;  1HZA A;  4UPA A;  4DV6 L;  3UE1 A;  1J5E L;  2JA7 H;  2MNA A;  4DAY B;  3RZO H;  3K80 C;  1FJG L;  1UE1 A;  2WAQ G;  4JYA L;  5C3E G;  4AQY Q;  1BBU A;  4DV1 Q;  4IFD I;  3CW2 C;  4LFB L;  4C3J H;  1C7Y A;  2R7Z H;  2UXB Q;  1N8R C;  2JA7 G;  4YCV A;  2AMC B;  2KHJ A;  3I4M G;  3A74 A;  1WCM G;  3KLW A;  4UY8 C;  4JI1 Q;  1L1O B;  1QVG A;  3HOU H;  3LGJ A;  4GOP C;  4B3M L;  3JC6 6;  3WWV A;  4JI0 Q;  4JI7 L;  1SRO A;  2F4V L;  3GTP H;  2R7Z G;  2KEN A;  1IBK L;  4LF9 Q;  2UXD Q;  3M9B A;  1X54 A;  1Z9F A;  4QL5 A;  2VQE Q;  4B3S L;  1IXR A;  1X3F A;  3J7A 5;  1LUZ A;  1WJJ A;  3G6E A;  3I2Z A;  3W1B A;  1NMF A;  3A5Z B;  1VQG A;  4RG1 A;  3F2D A;  4B3R L;  2VNU D;  4X66 L;  2JA5 H;  3KYH C;  4QIW E;  2ZJR A;  1CKO A;  1K9M C;  3E0E A;  1N32 Q;  4DR5 L;  4A3D H;  3NEM A;  4IJL A;  4MNO A;  1JE5 A;  1LM0 A;  1V9P A;  3UDX A;  1YJN A;  2BH2 A;  4A3M H;  3H3V H;  4C3H H;  4HJ8 A;  4BA2 I;  2UXC L;  2NVY H;  3ER0 A;  1GO3 E;  3GTG H;  4KHP L;  4A3D G;  4DUZ Q;  1N34 Q;  1VQI A;  1I94 L;  1SRU A;  2ES2 A;  2N78 A;  1E3P A;  3KJP A;  3KJO A;  1EIY B;  1QVF A;  3ICE A;  1KL9 A;  3T1Y L;  2Z6K C;  2OCE A;  4YHH Q;  3E9H A;  4HJ7 A;  2Z0S A;  4GS3 A;  3U4V A;  4PZ8 A;  3CCM A;  1SFO H;  1EQR A;  3MXN B;  4POF A;  5C0X I;  4A3K G;  1PH7 A;  3CP0 A;  2IHF A;  3PV0 A;  1YEZ A;  4YWM A;  1W2B A;  4JI6 Q;  4C3I H;  3L2P A;  3G4S A;  2VL6 A;  1KQS A;  4JCV E;  1A0I A;  1M90 C;  3S16 H;  4A3L H;  2F52 A;  2PI2 A;  1Y1W G;  1VQN A;  1KAW A;  1AE2 A;  1YJW A;  1PYS B;  2WP8 J;  2UUA L;  4JI2 Q;  4DUY L;  1SLJ A;  4K0K Q;  2UUB L;  2IHE A;  3W1G A;  5LMN W;  2E5L L;  4JOI C;  2R7D A;  5J3B A;  2WFW A;  1PFS A;  2NN6 G;  4HJA A;  2HIX A;  1D8L A;  3PF5 A;  1PH5 A;  3HKS A;  1IZ6 A;  5GAH C;  4LF8 L;  2I5M X;  3PO2 H;  2UUC L;  4B3T Q;  1OXX K;  1W3S A;  4LF6 Q;  1VQ6 A;  1PH3 A;  4BY1 H;  5GQO A;  3PF4 A;  1XMQ L;  1WOC A;  4BBS H;  3PUZ A;  2NZO A;  1Q8K A;  1YHB A;  5JEA G;  1GD7 A;  2LXJ A;  2E2H H;  2Q2U A;  4IFD G;  5GAD C;  1PH4 A;  1SE8 A;  4BY1 G;  2OWO A;  1NBW A;  2QGQ A;  2R93 H;  2RHQ B;  1M1K C;  1N9W A;  4UP8 A;  2VQE L;  2Q2T A;  1YNX A;  2YU9 H;  2YTX A;  4HID A;  4JBW A;  3VDY A;  1UE7 A;  4YY3 L;  5DLQ E;  4DV7 Q;  4XTC S;  5JJK A;  1XNR L;  2JEA I;  3TEH B;  4Y7N H;  4LF4 Q;  3RLN A;  2K4K A;  4A3E H;  3AYH B;  1HZ9 A;  5IYD H;  3UDF A;  3RN2 A;  3ZJY C;  1EFW A;  5FLX c;  2JA8 H;  4Y52 H;  1RIP A;  3U58 A;  4UP9 A;  3CME A;  1XPR A;  2NVQ H;  2XGT A;  5K36 G;  3H15 A;  2HIV A;  3KDF B;  2YYZ A;  2ZM6 Q;  5LMN L;  2RF4 A;  4LF7 Q;  1E1T A;  4A76 A;  1IBM Q;  5IP7 H;  2KCM A;  3RNU A;  1HR0 L;  4QGU A;  3T1H Q;  5JEA J;  1CSP A;  3KF6 B;  1S40 A;  1N36 Q;  1A62 A;  4IFD J;  1DGS A;  1B70 B;  4LUO A;  4AYB G;  5IP7 G;  4AQY L;  4EQ5 A;  3NEL A;  3S1R H;  2ASB A;  2R7F A;  2ZJQ A;  2KHI A;  1L1O C;  3RZD H;  2YV5 A;  3CXC A;  1KIX A;  5M3M H;  2RCN A;  2WAQ E;  4NXN Q;  3RLO A;  2WB1 E;  1BBW A;  2E8G A;  4HIM A;  1YI2 A;  2BA0 A;  1S3O A;  4JI1 L;  3ULJ A;  3TQY A;  3PO3 G;  5C3E H;  5C0X G;  1TWC H;  1UE5 A;  3K0X A;  3S24 A;  4IO9 A;  1T9H A;  1VQL A;  2UXD L;  3BJU A;  1E1O A;  3I4M H;  2GN5 A;  2CKZ B;  4UP7 A;  3PIO A;  2VQF Q;  1WCM H;  4GOP A;  4JI5 Q;  3PUX A;  1JJ2 A;  2WB1 G;  1KD1 C;  1XJV A;  5E7N A;  1VQD A;  2N49 A;  5IYB H;  4DR2 L;  1CKN A;  1HZC A;  3GTM H;  1PH6 A;  1TWH H;  3M7N A;  4X65 Q;  4A3G G;  1HNZ Q;  4OWW B;  4A3J G;  1YBY A;  4DR1 L;  4OX9 L;  1QUQ A;  1P8L A;  2B3G A;  2EIF A;  3OYY A;  5IYB G;  2A19 A;  3I56 A;  1Q7Y C;  4JI8 Q;  3FHW A;  1HNW L;  1VQM A;  2ZTC A;  1HZB A;  3BU2 A;  2JQO A;  3PUY A;  1XMO Q;  1MJE A;  1X56 A;  2K75 A;  1ASY A;  1KHI A;  2RHS B;  4WJ4 A;  4PMW A;  1Y14 B;  3S1Q H;  3UE0 A;  1VQ5 A;  3UDG A;  4WJ3 M;  1L0W A;  1VS0 A;  4YHH L;  3GTQ H;  1EOV A;  2ID0 A;  5C0X J;  2MO0 A;  3ULL A;  1VQB A;  4R4Q A;  1JJC B;  2D0P A;  3UDI A;  4JI6 L;  1HJP A;  4QY7 A;  4DR4 Q;  1P16 A;  2DGY A;  3EN2 A;  1IBL Q;  4DV6 Q;  1J5E Q;  5BR8 Q;  1PH8 A;  4LFC L;  1Z47 A;  2VW9 A;  1V1Q A;  1YIJ A;  1FJG Q;  4A3K H;  4IPG A;  3A5U A;  4DR7 L;  4JYA Q;  1TWF H;  1YZ6 A;  2F3I A;  2HHH L;  4LFB Q;  4JI2 L;  2VUM G;  4K0K L;  2IY5 B;  1VQP A;  1K0R A;  4PZ7 A;  1JJG A;  4X6A H;  3OTO Q;  4LFA Q;  1V43 A;  4C2M H;  2A8V A;  1VQF A;  2AWN A;  1KC8 C;  5LMU L;  1NTG A;  1Y1W H;  3DM3 A;  4B3M Q;  4JI7 Q;  1UEB A;  4JOI A;  4A3I G;  2I0Q A;  1OXU A;  4JI4 Q;  3KOJ A;  1IBK Q;  1G29 1;  1VQ8 A;  4B3S Q;  2IT1 A;  1U5K A;  5M3F H;  4EX5 A;  5AJ3 Q;  1PV4 A;  4DV0 L;  4B3R Q;  2AWO A;  2VS1 A;  4NXM Q;  5EAY A;  3HOY H;  2B29 A;  1AH9 A;  1PA6 A;  2PQA A;  1HR0 W;  1OXV A;  1QVC A;  2H5X A;  5M3F G;  4DR5 Q;  4X64 Q;  1N33 L;  1UWV A;  3HOW H;  3CCJ A;  1KRT A;  3HOY G;  3KDF A;  4BBR G;  3HOZ H;  3STB C;  5IYC G;  1XTD A;  1OXS C;  4DPG A;  3CC7 A;  4GLX A;  1K8A C;  1I94 Q;  3HOW G;  2EXD A;  3S15 H;  3S14 H;  4KI0 A;  4R4O A;  4P73 A;  1PVO A;  3CAM A;  4DV4 Q;  4LF4 L;  3HOZ G;  1Q46 A;  3KF6 A;  3T1Y Q;  2ZJP A;  3AQQ A;  3CF5 A;  1E24 A;  5ELO A;  3H0G G;  1XNQ Q;  1B7Y B;  2OTL A;  2MFI A;  4DV2 Q;  1SMX A;  3I4O A;  2E2I H;  2V1C C;  4RMF A;  2EQS A;  1YHA A;  2B63 G;  4X62 L;  3GTK H;  4A3B G;  2MO1 A;  1R9T H;  5FLM G;  2ZM6 L;  3S2D H;  2CCZ A;  3CCE A;  1IBM L;  4ME3 A;  4DV3 Q;  2R6G A;  4LUV A;  3CC4 A;  4GKJ L;  4DR3 Q;  3ULP A;  1GM5 A;  4DV5 L;  3CCL A;  1MKH A;  2OQ0 A;  3ERS X;  1QZG A;  3HOV G;  3I4N G;  2HQL A;  3I55 A;  2JK8 A;  3CCS A;  1RL2 A;  2VZA A;  1AE3 A; 
#chains in the Genus database with same CATH topology
 2B2Y A;  4R4T A;  3TP5 A;  5CA1 F;  3GIM A;  4NXN L;  5GON F;  4O4L F;  3VPC A;  1PFN A;  1EIF A;  4J9S A;  3LML A;  1O7I A;  3NHH A;  3D6C A;  1HNX L;  4UCO A;  3M3Y B;  4RNN A;  2CQO A;  3KHH A;  4JVZ A;  1GSO A;  2UUC Q;  1PFB A;  1ASZ A;  2PQE A;  3LWE A;  4IWX A;  3H3V I;  4YJ2 F;  5JVD F;  1AZP A;  4Y8V B;  4JI5 L;  2YTY A;  3MEH A;  1EYC A;  1PX2 A;  2IP4 A;  5I6W A;  4PG3 A;  4HAE A;  1L2F A;  4NDX A;  5KG1 A;  1VF7 A;  1XPO A;  1I4H A;  4R7R A;  1X9N A;  1A63 A;  2R85 A;  4K0K H;  5KFS A;  3I12 A;  4BXX G;  1NJI C;  3NPP A;  3Q2O A;  4CDE C;  5DGB A;  4ZAI A;  4XYQ A;  1HUM A;  3MR2 A;  4LF9 L;  1MJC A;  5LXT F;  2R92 G;  1I6H B;  1EY8 A;  2WV6 D;  3I7F A;  1GKH A;  1I3Q B;  1VCI A;  1ENF A;  2R6F A;  2GVB A;  5KFV A;  4B3T H;  3D6W A;  1TR5 A;  1K83 H;  2NTT A;  1PHJ A;  1RD9 D;  1DOL A;  2O2L D;  3HKZ G;  1II3 A;  3FKI G;  4LMQ D;  4R4I A;  3OWE B;  5ELE A;  4NPS A;  4DL7 A;  4E4T A;  4X3U A;  2IX0 A;  3E5S A;  3F2C A;  1KEE A;  4J9M A;  1I7L A;  3SEB A;  5IP9 G;  1BR9 A;  2BQU A;  2A73 B;  1KDA A;  4K5X A;  5GAG C;  4F4Y A;  1RTN A;  5JUM A;  4DV7 H;  3J7A F;  1SN8 A;  2PI2 E;  5H1S E;  3TIN A;  4LF4 H;  2C35 B;  4A4I A;  2B2T C;  4GKK Q;  3H0G B;  3N52 A;  2AGO A;  3T53 B;  3KXY T;  2KJX A;  3AEV A;  3GLK A;  4JI3 Q;  4JI4 L;  2XD4 A;  1VQO A;  5KFP A;  2EVB A;  5JJL A;  3J81 E;  1ESF A;  1IBM H;  1QCB D;  1F2L A;  4GN5 A;  3GTJ H;  4FDB A;  3T1H H;  4OGQ C;  4O1N A;  5KFL A;  3TRZ A;  1B3Q A;  2EYF A;  5JVH 3;  5EOY A;  1X65 A;  3M9M B;  1TWG B;  4DXF A;  2K01 A;  3NSW A;  1TWC A;  5A35 A;  4DR1 Q;  2FLP A;  3R8B A;  2R61 A;  2F4V Q;  3F8T A;  1WCM A;  2D5D A;  4H02 A;  3SDZ A;  1YNJ D;  2F0N A;  3LP8 A;  3J7Z C;  1SJH D;  4A3M G;  3K7A H;  4C3H G;  4X66 Q;  3PIP A;  4P75 A;  1TWH A;  1STH A;  2FE3 A;  2CW0 D;  3FRP B;  2F4I A;  4LWC A;  3I91 A;  1NE3 A;  1L2Z A;  4RUA A;  4RCN A;  1HH2 P;  4KK7 A;  5LP6 F;  1SXT A;  1VQ9 A;  3NK9 A;  1UE6 A;  1WTR A;  2NU6 B;  4K14 A;  1EQT A;  4KHP Q;  4M7E A;  4QQB X;  4DV3 L;  1BVS A;  3R2T A;  1CUK A;  1SYC A;  3PSI A;  4DGZ A;  3GV7 B;  2A5H A;  5HV6 A;  3GTQ A;  2PVP A;  4DR7 Q;  1EU4 A;  3EQL C;  2VR1 A;  1XMO H;  4NB3 A;  1ILQ A;  2PZU A;  5EGT A;  4JK1 C;  5FLM H;  3VYU A;  2DY7 A;  2HHH Q;  4A3L G;  1ZET A;  4G7Z C;  2MQH A;  4A93 B;  1C0A A;  1CT1 D;  4YQW A;  5DGA A;  3Q8R B;  4LH7 A;  4FXG C;  3HOV H;  4HNT A;  3I4N H;  5LMU Q;  1GUO A;  4YCU A;  1UUP A;  3P20 A;  1CQI B;  5HGT A;  2W6N A;  2L12 A;  3J81 L;  5I2X A;  1BCP C;  1EIG A;  2E2J H;  5IWA L;  2VQD A;  1E4G T;  2FJ2 A;  1ZYR C;  2ENB A;  2A6H C;  5EQ0 A;  5C4J H;  1J5E H;  4OIK A;  4FS1 A;  3VR4 A;  1PTO F;  2KED A;  4KD4 A;  4JYA H;  4FYD A;  1N33 Q;  2JA7 B;  5KFU A;  2I80 A;  1GHJ A;  2K52 A;  1C48 A;  3G6X A;  5EKI A;  5BMV F;  1DZ1 A;  1CSQ A;  3BZC A;  2NZH A;  4B3M H;  3HRZ C;  1GXD C;  5DLG A;  2FLN A;  4JI4 H;  1IBK H;  3J81 i;  1Q12 A;  3TII A;  3Q8D A;  4YR0 A;  4JBM A;  5EBD A;  3N43 B;  4F4X A;  4FS2 A;  1S0N A;  4X3T A;  1RKN A;  5KFZ A;  1A8V A;  4X3S A;  2AKW B;  4BA1 I;  4GNX A;  4FU0 A;  4YB8 B;  1PZI D;  4RGN A;  3STB D;  1AZQ A;  1TWA H;  2YZM A;  1S4Z A;  4IPD A;  5IOD A;  3HKZ E;  2IJ0 A;  4C1N K;  2FKL A;  4NLG A;  4O3S A;  1EZ8 A;  1YHQ A;  1SYX B;  2B2Y C;  1XNR Q;  4GKJ Q;  3K3P A;  2B63 A;  1H9K A;  4BY7 H;  2EY1 A;  4N9P A;  5JOB A;  1TS2 A;  3OMC A;  3MHB A;  4QIW B;  4LW1 A;  4DR6 L;  4A93 G;  2OH2 A;  4GN3 B;  1I94 H;  3GO5 A;  1STE A;  1UC9 A;  4QW9 A;  3TS2 A;  3T4A C;  4HIO A;  4JV1 A;  2NN6 I;  3BYY B;  3S1M H;  5KX5 F;  2EY2 A;  5IYZ F;  1NMG A;  3CCV A;  4LUZ A;  1LO5 D;  2VY3 A;  2AUJ D;  4POG A;  3G6J B;  2DNC A;  1HNX Q;  4P71 A;  1TWF B;  5FOB B;  5DNF A;  1JQY D;  2JSO A;  4DL3 A;  4DV6 L;  1HZA A;  3UE1 A;  4CJ0 B;  1NCV A;  4MV9 A;  4DV3 H;  1SFO B;  3K80 C;  1FJG L;  1H9R A;  3TN2 A;  2ZDH A;  4K5V A;  4CHT B;  3CW2 C;  4C3J H;  3HGB A;  4MHE A;  3K5L A;  1N8R C;  2PPB C;  2R7Z H;  2JA7 G;  2UUB H;  3S16 B;  4HQ6 A;  4QUF A;  4GOP C;  2A6E D;  2I07 B;  1HTL D;  4LF9 Q;  2G9H D;  2DIK A;  1D1K A;  2F0K A;  2X6L A;  5KFX A;  4ZRZ A;  3I2Z A;  3W1B A;  1AW7 A;  5KFO A;  1NMF A;  2R3Z A;  1VQG A;  2JEG A;  2R92 A;  3KYH C;  5IWA H;  4EBC A;  4HTH A;  1HQM C;  4UCR A;  1E4E B;  4DR5 L;  4A3D H;  3T5H A;  3K3V A;  1V4Y A;  3O13 A;  3VA5 A;  4MNO A;  1JE5 A;  4RB3 C;  2UXC L;  3H3V H;  4HJ8 A;  4BBS B;  3HKZ A;  2XCP A;  3FKI A;  1GO3 E;  2BE5 D;  3GTG H;  1JIH A;  4B9W A;  2CQA A;  3CQZ A;  3NTI A;  3JZI A;  3UQ8 A;  1SNQ A;  3TDQ A;  2HCI A;  3GP7 A;  1ZHS A;  2F3V A;  4KHV A;  1CM9 A;  2N78 A;  2RSN A;  3KJP A;  1CA5 A;  1A2U A;  2EY6 A;  3JRW A;  3PR5 B;  4YHH Q;  3PW0 A;  1DCZ A;  4HJ7 A;  1LT6 D;  4K2K A;  3U4V A;  4PZ8 A;  3PW4 A;  2ICI A;  1U4R A;  1JWS D;  3DUZ A;  3R2I A;  1PH7 A;  3CP0 A;  3PV0 A;  1YEZ A;  4YWM A;  1W2B A;  2VUG A;  1LLR D;  1TVX A;  3MR3 A;  4C3I H;  3L2P A;  3G4S A;  2VL6 A;  1WR2 A;  4JCV E;  5LMN H;  3Q8P B;  4CGY B;  1SBB B;  2W9B B;  1E2V A;  5KGU A;  5L1K A;  1HFG A;  1VQN A;  1PYS B;  2UUA L;  1Y8O B;  4LK1 C;  1SLJ A;  4JI2 Q;  4DUY L;  1AUX A;  2E5L L;  4DR6 H;  3AMU A;  3OSP A;  3PQI A;  2R7D A;  1JX4 A;  3GTP A;  1RYS A;  4HJA A;  1D8L A;  4F7X A;  5G3L D;  1PH5 A;  3HKS A;  5GAH C;  3PO2 H;  3QZ8 A;  5H80 A;  1QOH A;  4O4I F;  1VQ6 A;  1PH3 A;  3DEO A;  4EFE A;  3PUZ A;  4XXE A;  5JEA G;  5F9N A;  1GD7 A;  5L1J A;  2WAQ B;  2Q2U A;  2JP1 A;  1PH4 A;  1SE8 A;  4TRD A;  4ZCK A;  1F9R A;  2OWO A;  4IRK A;  1NBW A;  2R93 H;  1M1K C;  4UP8 A;  2VQE L;  2YU9 H;  3V4Z A;  4WD3 A;  3IFT A;  2O5J C;  2V4D A;  3VDY A;  4QWD A;  2L11 A;  4Z9C B;  4Y7N H;  4TV8 F;  5IYD H;  1HZ9 A;  4H7B A;  3QWN A;  5KFN A;  1VBH A;  3Q22 A;  3UDF A;  1XYI A;  1BGW A;  3ZJY C;  4DAP A;  1EFW A;  4Y52 H;  1KJ8 A;  1GUS A;  2NVQ H;  3T5K A;  2HIV A;  4DA2 A;  2RF4 A;  4Q0F A;  3DMU A;  2F0D A;  3BJY A;  5BPH A;  2IBK A;  1PDQ A;  3Q24 A;  2KCM A;  1K1S A;  4DL6 A;  2H4O A;  1UNS A;  3DWQ A;  3E6Z X;  3RNU A;  4QGU A;  2UXC H;  4JI6 H;  1CSP A;  2AQ4 A;  4IFD J;  1B70 B;  4RKL A;  4F50 A;  4DUZ H;  4PMB A;  4EQ5 A;  3NEL A;  4LFC H;  3RTX A;  2R7F A;  3RAQ A;  2KHI A;  1KIX A;  2YV5 A;  5M3M H;  2RCN A;  3V6J A;  4HIM A;  4EGV A;  1TWG A;  2R8I A;  1VMC A;  5C1O A;  3S24 A;  3URY A;  5EWF A;  4ZKB B;  3I4M H;  2GN5 A;  3MVV A;  4UP7 A;  1YNJ C;  2XRQ D;  1XJV A;  4IUV A;  4RWS C;  5E7N A;  2N49 A;  3GTM H;  2CW0 C;  1PH6 A;  5CV6 A;  1YBY A;  4OX9 L;  5ELC A;  3K57 A;  1P8L A;  4QB4 A;  3OYY A;  1JOQ A;  5JQW A;  5KFJ A;  3I56 A;  5C5M A;  5I9O A;  3R5F A;  3FHW A;  1SCU B;  1HNW L;  2NU8 B;  1VQM A;  2G5D A;  2ZTC A;  1MJE A;  4C5C A;  3RFC A;  4PQX A;  4PMW A;  1Y14 B;  2GPS A;  3UE0 A;  3UDG A;  4HSP A;  4WJ3 M;  5E4W C;  3HOZ B;  1EOV A;  2N88 A;  3G6V A;  5C0X J;  1PTO H;  1VQB A;  3ULL A;  1KNA A;  4R4Q A;  4IAL A;  5C5J A;  1O80 A;  4DR4 Q;  2QW7 A;  2VQE H;  5EBC A;  3RMH A;  2FPG B;  4DV6 Q;  3EFX D;  2ZM6 H;  1CHP D;  2PO4 A;  1Z47 A;  2VW9 A;  1V1Q A;  2NTS A;  3SVM A;  1FJG Q;  4IPG A;  4RZQ A;  4O3N A;  5KT2 A;  3H4D A;  3GTK B;  1VQP A;  1CE8 A;  1K0R A;  4PZ7 A;  3OTO Q;  1B1Z A;  2JXM B;  2A8V A;  2P0A A;  1KC8 C;  3BVG A;  1NTG A;  5EPL A;  3DM3 A;  1Y1W H;  5KFM A;  2JA7 A;  1UEB A;  4JOI A;  3KOJ A;  1Z2O X;  4XQQ A;  5CYU A;  2C5C A;  4IUU A;  2AWO A;  3HOY H;  1KDC A;  3P7J A;  4CDD C;  2NVT B;  4DR5 Q;  1QVC A;  4DV1 H;  4ZUJ A;  4X64 Q;  4FM9 A;  4QUC A;  3KDF A;  3STB C;  3N8D A;  1JC7 A;  4HED A;  1OXS C;  4JI0 H;  1FGB D;  1O7Y A;  2J4X A;  4H13 C;  1K8A C;  3S2H B;  3KBG A;  3OIP A;  1H95 A;  4DV4 Q;  3HOZ G;  3KF6 A;  4QIW A;  4F88 A;  4ZUI A;  4RAU C;  3CU7 A;  2DNE A;  3KAJ A;  2OTL A;  1BCP F;  2H1E A;  2MFI A;  1W6J A;  3I4O A;  4DV2 Q;  2VPS A;  5A2Q W;  3N42 B;  2XC9 A;  3RAX A;  2E2I H;  2W6Q A;  4RMF A;  2NZ1 D;  4ETS A;  1ET9 A;  3D3R A;  4BY7 B;  3Q8S B;  4TKO B;  5FLM G;  4UCU A;  2SNS A;  4ED1 A;  5FLX W;  1B04 A;  2C2E A;  2IA6 A;  2Z1C A;  4DR3 Q;  3CCL A;  2JA6 B;  4DV5 L;  1TWF A;  5K36 H;  2E76 C;  2OQ0 A;  1JOO A;  5KYL A;  3J80 E;  3HOV G;  3I4N G;  1TKW B;  2K04 A;  3I55 A;  5C4X B;  4ED8 A;  4RGM A;  1SFO A;  5C4Z A;  3OW2 A;  1U0L A;  4DUY Q;  2UUA Q;  5KFD A;  5COR A;  1Y8N B;  5FJ8 H;  4O0A A;  3RGZ A;  2BR0 A;  4I7A A;  3QOL A;  1QNK A;  1B9M A;  2FMA A;  2W6M A;  5IT9 W;  2PMZ E;  2A6E C;  1JIC A;  2Z4H A;  3LWU A;  4HCS A;  2VQF L;  1KJI A;  3BQ0 A;  4TQR A;  4RH6 A;  3M4Q A;  4IRC A;  4DKA C;  3GII A;  3RB3 A;  2UXB L;  5IT9 c;  2VPQ A;  2VB3 X;  2K03 A;  2EYJ A;  2K32 A;  1E4E A;  3J7A K;  4RNM A;  3PIO 3;  2W70 A;  3GDE A;  3ERQ A;  2VXW A;  4O2A F;  1J9O A;  1JDB B;  3DWP A;  1MZB A;  5KRU A;  3S17 H;  2EJM A;  3TQ1 A;  2DUD A;  2BE5 C;  5D65 A;  2ZXO A;  1PH2 A;  2KA7 A;  4K6D A;  5KND A;  1C4Q A;  1X3G A;  3EBE A;  4XT1 B;  3G7L A;  3AB9 A;  1GHK A;  4GN4 B;  2OXP A;  4GC6 A;  4BY7 G;  3GTG B;  1WYD A;  3GTL B;  4APM A;  3PW2 A;  1XNQ H;  2JA6 G;  2K28 A;  4DL5 A;  1GOZ A;  3CD6 A;  4DUZ L;  5C4X G;  4LSX A;  4IQZ A;  4ME6 A;  5CB4 F;  3QFF A;  3SK4 A;  4DN4 M;  1EUD B;  3J80 L;  3JAM c;  4L5S A;  1OXT A;  2W9B A;  2EZV A;  1I50 H;  2J6U A;  5DAU A;  1RYR A;  1FGU A;  5E1F A;  4GNX B;  4WJW A;  3EPI A;  1JB3 A;  5KG0 A;  2BOS A;  2RDH A;  2QK4 A;  4C3I B;  3N40 P;  2NVX H;  5COY A;  4XIG S;  3WDN A;  3KFU A;  5KT4 A;  3PCO B;  4C3J G;  4J0M A;  2B63 B;  2VUM H;  1Y69 U;  2UU9 Q;  4APV A;  1EUJ A;  2OF1 A;  5D1P A;  3FPU B;  4A75 A;  2F0V A;  5FO7 B;  1FNV A;  2CHB D;  1STB A;  5AJ3 L;  2B2V A;  3IRB A;  3J80 i;  2RGR A;  1Q81 C;  4ZHQ F;  1S9F A;  2QIL A;  5HUR A;  4A3I H;  4NXM L;  1N36 H;  4GZY C;  2HD3 A;  2QDL A;  1BXR A;  4P72 A;  1GUT A;  4BWG B;  1JMC A;  4OX9 Q;  4XYM B;  2K5H A;  1EHI A;  2W8L A;  5FO8 B;  1A3U A;  3ETJ A;  3E3X A;  2NB0 A;  3QG1 A;  4B3T L;  1HNW Q;  2GA4 B;  3RIZ A;  4OWT B;  4KLK A;  1K83 A;  1YNN C;  4ZOL F;  3MEF A;  4IUR A;  3DF7 A;  2LS0 1;  1EZ1 A;  2VQF H;  4BBR H;  2KCT A;  4QWC A;  5IYC H;  1FNW A;  1ZQ7 A;  3ORR A;  3S1N B;  4IOC A;  1YIT A;  1QB5 D;  1QUQ B;  4CJ1 B;  3RLF A;  3D4D A;  2XIG A;  4C56 C;  3GQC A;  1O75 A;  4MV4 A;  1PH1 A;  1KXL A;  2V4Q A;  2KOL A;  5EPJ A;  5IGD A;  4DV7 L;  4OEL B;  5I4D A;  4HJ5 A;  4J15 A;  4ZLT F;  2YCH A;  2Z9H A;  2F1M A;  2NVQ B;  1K3R A;  4A3B H;  2HT1 A;  4RHR A;  1KJ9 A;  5KFG A;  4C3I G;  1VBG A;  4MTN A;  1IL2 A;  1S72 A;  3R93 A;  2Q8R E;  3FKI B;  3TS0 A;  2DLN A;  3WOE A;  4F4Z A;  4GKK H;  3UI2 A;  1IKL A;  1WFQ A;  2YZN A;  4CJ2 C;  3T1H L;  1TQO A;  3BS1 A;  1DXM A;  3PGZ A;  1STA A;  1VQ7 A;  2B39 A;  1JT8 A;  1BO0 A;  5M3M B;  3RN5 A;  3G71 A;  1IBL H;  1KC7 A;  3WNZ A;  3PO2 G;  1JOK A;  1VQK A;  1I4X A;  3ERO A;  4PMC A;  2QYZ A;  2KBN A;  4LFB H;  1Q8I A;  2F0H A;  3Q23 A;  5HY6 A;  1FYC A;  1D7Q A;  2SCU B;  2LSS A;  1C3O A;  1ZXT A;  2R93 G;  5M5X H;  5LL6 S;  3F1Z A;  4MA5 A;  1GUN A;  3BDL A;  2XCL A;  4B3S H;  3VYS A;  3M7G A;  3VYT A;  3NWT A;  2B2W A;  2PQA B;  4IPH A;  4WRD A;  3GTP B;  5C8Y F;  2R8K A;  2Y0S E;  3TBI B;  1K8M A;  1RHP A;  3NBI A;  2L4N A;  1K8O A;  4NXM H;  1Q82 C;  3KUP A;  5JJZ A;  3L9A X;  5IYD G;  5T1I A;  4B08 A;  1S0M A;  3N44 B;  4L8J A;  5CV9 A;  2A1A A;  1LT4 D;  5C44 H;  3K5M A;  3VR6 A;  1XMO L;  2ASJ A;  4L5T A;  3DWA A;  4DV5 Q;  2R7N A;  4KN4 C;  1VQC A;  2XCA A;  4IR1 A;  1W93 A;  1XWE A;  1PTO B;  3L3O C;  5KFR A;  4A3M B;  3K5N A;  4C3H B;  4A3F H;  3GTK A;  3QZ7 A;  4LF5 L;  3A55 A;  4KHZ A;  2PNH A;  3KF8 B;  2F0P A;  1Y1V H;  1CZW A;  1J6Q A;  3H09 A;  3HOX H;  1EWI A;  2RDI A;  5KG7 A;  2ALY B;  2EXZ A;  1E2Z A;  3DXJ C;  4JG2 A;  1HR0 Q;  5M3M G;  5C4H A;  1FL0 A;  3PUW A;  1J5E L;  4IZ8 A;  1CTM A;  2EYO A;  4JYA L;  4HMI A;  1EY4 A;  1ICF B;  2UXB Q;  3KLS X;  3JSL A;  4YCV A;  4FF2 A;  1JKJ B;  3I4M G;  2FPI B;  1WSC A;  3A74 A;  3OUU A;  3KLW A;  4JI1 Q;  1L1O B;  3GV3 A;  1QVG A;  3HOU H;  1BUV T;  4B3M L;  5E4X A;  3WWV A;  3TSS A;  2KEN A;  1IBK L;  3KLS A;  2ASL A;  1X54 A;  1Z9F A;  5F2D A;  4WFN 3;  1BXT A;  5T1G A;  5LOV F;  3G6E A;  2YS6 A;  3TP6 A;  4IZO A;  1ONL A;  4RG1 A;  2A69 D;  3OUZ A;  4ECQ A;  2QCP X;  2NU9 B;  4OIJ A;  1K9M C;  1XMQ H;  4FBT A;  3NP8 A;  1TWA A;  5FPO A;  4J9O A;  2YW2 A;  1V9P A;  3UDX A;  1YJN A;  2BH2 A;  1Y8P B;  4BA2 I;  4BY1 B;  4M8A A;  2NVY H;  1NNX A;  1SYF A;  1TY2 A;  3ER0 A;  5KNC A;  2C2R A;  4DUZ Q;  1T5E A;  2DN8 A;  1VQI A;  1I94 L;  4RB0 A;  1SRU A;  2ES2 A;  2JA6 A;  4I55 F;  3KJO A;  1QVF A;  4YY3 H;  1V1O A;  2E2I B;  1MGS A;  2OCE A;  4ZQ3 A;  1EOT A;  3BDO A;  4U7C A;  4QWA A;  2Z0S A;  4GS3 A;  2N55 A;  4POF A;  4A2B A;  1WH2 A;  4YR2 A;  3BVM A;  5J1Z A;  3J7Y W;  4U6P A;  3OWF A;  3OIQ A;  2EYM A;  5D14 A;  2B2V C;  1A0I A;  2NWG A;  4X3K A;  5CBA E;  4Q5V A;  2F52 A;  2PI2 A;  2XIW A;  3Q0A A;  1Y1W G;  5D1O A;  5DG9 A;  1YJW A;  3A8K E;  3OHB A;  1SYG A;  4K0K Q;  4EEY A;  2UUB L;  4P2C B;  3EJI A;  1E2W A;  3GIQ A;  1M6V A;  3K6O A;  5BN3 A;  4H44 C;  2FFK B;  5J3B A;  2NN6 G;  1KJQ A;  2HIX A;  4LF5 H;  4OHJ A;  3E5N A;  3IL8 A;  1JWM D;  4LF8 L;  2I5M X;  2FK2 A;  3TZU A;  4B3T Q;  5I2Y A;  2R7L A;  5GQO A;  2CQY A;  3PF4 A;  1WOC A;  5DLF A;  2BDN A;  1Q8K A;  5FLX E;  2E2H H;  3MWM A;  2L5T A;  5GAD C;  4C5B A;  4BY1 G;  3T13 A;  3S17 B;  3PN1 A;  5CV5 A;  2F0T A;  2EPB A;  1NAP A;  1S5E D;  1G2S A;  2QGQ A;  3W2D A;  3OHA A;  4DR2 H;  3GTL A;  3GTG A;  1PRT B;  1YNX A;  3C2P A;  1G8Z D;  3SK8 A;  5DLQ E;  4DV7 Q;  4XTC S;  3BG5 A;  5JJK A;  4M9U A;  1I6V C;  4LF4 Q;  1KNE A;  4A3E H;  5KFH A;  3AYH B;  3BZD B;  4ZKC B;  5IGF A;  1RIP A;  3LWB A;  4UCS A;  5FD5 A;  4YIJ A;  3CME A;  1AUV A;  2FPP B;  3EPG A;  5K36 G;  1BNZ A;  3KDF B;  5CV8 A;  1GSA A;  5LMN L;  1E1T A;  4A76 A;  1IBM Q;  5IP7 H;  1I50 B;  3T1H Q;  1S5C D;  3IKJ A;  5JEA J;  2MJ8 A;  3KF6 B;  1S40 A;  2K5W A;  1FR3 A;  1DGS A;  2EY5 A;  2R8G A;  4AYB G;  4AQY L;  2NVX B;  3S1R H;  2ZJQ A;  3RZD H;  4NXN Q;  2F0E A;  3CXC A;  2TMP A;  1XDN A;  2WB1 E;  4ECX A;  2E8G A;  5EKL A;  2BA0 A;  2CH4 W;  4IUP A;  4ABN A;  3D8G A;  4ECU A;  5C3E H;  3VA7 A;  4R8I A;  1TWC H;  4IO9 A;  1CS0 A;  1O7Z A;  5A2Q L;  2UXD L;  1B2T A;  1HA6 A;  1EEI D;  1W6K A;  3OSN A;  1E1O A;  1NSN S;  2B2W C;  1TS3 A;  1WCM H;  4JI5 Q;  1F2Z A;  1JJ2 A;  1OWT A;  1KD1 C;  5FLX L;  1F9P A;  5IYB H;  2R93 A;  1HZC A;  2ZDG A;  2R84 A;  1TWH H;  4J9R A;  3M7N A;  4DV0 H;  2YU9 A;  4KD3 A;  1IL8 A;  4OWW B;  4JV0 A;  1D2B A;  1QUQ A;  3MJF A;  2DJF C;  4YP3 A;  5LHY 1;  1Q7Y C;  3BDC A;  2DPJ A;  2MHV A;  3BU2 A;  1HZB A;  3PUY A;  1XMO Q;  3VR3 A;  4LF8 H;  4IR9 A;  2RHS B;  5KFQ A;  1XX8 A;  4J1M A;  2HDM A;  4IWY A;  3HOW B;  5G3L F;  4MV8 A;  1VS0 A;  3GTQ H;  2HQE A;  2K05 A;  2ID0 A;  4PWQ A;  2MO0 A;  1EY6 A;  3MFI A;  1QWY A;  2F3W A;  1JJC B;  3S15 B;  2BQR A;  3UDI A;  2AGP A;  4JI6 L;  4Q0Y A;  4QY7 A;  2DGY A;  5JH7 F;  1KTK A;  5CC4 A;  4X62 H;  1J5E Q;  1MSH A;  4YAK B;  1K1Q A;  4MV3 A;  4LFC L;  2WYO A;  4A3K H;  2O5I C;  4JYA Q;  1YZ6 A;  4YJ3 F;  2F3I A;  2VUM G;  2BCO A;  2R8H A;  1M8A A;  1R9T B;  4DFA A;  4ZK9 B;  3S2D B;  4RA8 A;  1FNU A;  1GYF A;  4OEM B;  1V43 A;  1IW7 D;  4C2M H;  3SHL A;  4B9X A;  4B3M Q;  3PW5 A;  4A3I G;  2M00 A;  2YYA A;  4DLK A;  4JI4 Q;  1IBK Q;  1EWC A;  4JV5 H;  1TS4 A;  5EKK A;  1U5K A;  5M3F H;  1VDZ A;  3RV3 A;  2HJW A;  3GTM A;  1PV4 A;  1M0T A;  3GV6 A;  3GIP A;  3I4L A;  2VS1 A;  1JXL A;  5EAY A;  1V51 A;  3N6R A;  2PQA A;  4U68 A;  4AQY H;  5F9L A;  1FKA H;  2W9C A;  2HVS A;  1I7N A;  2L55 A;  5M5X B;  3SK5 A;  2PMZ B;  4BBR G;  4QCL A;  3OHX C;  5IYC G;  1SMY D;  3M9O B;  4G7H C;  3OPO A;  5AFW A;  4GLX A;  1I94 Q;  3M4I A;  3HOW G;  2SOB A;  4KI0 A;  5C3W A;  2UXD H;  4P73 A;  3MA2 B;  1Q46 A;  1T5X D;  3IG0 A;  2ZJP A;  3KAK A;  1E24 A;  5FKA C;  4K8I A;  5ELO A;  2K6A A;  2HGS A;  4ILW A;  3RUP A;  3R5X A;  4WBN F;  2W6O A;  4DXG A;  3C46 A;  3KF8 A;  4A3B G;  5CA0 F;  1N32 H;  2ZM6 L;  1TT2 A;  2SEB D;  2R8J A;  4DV3 Q;  2KSW A;  4LUV A;  1K83 B;  1LTI D;  4R8N A;  1EY7 A;  1GM5 A;  1S5B D;  4EYH B;  4O3O A;  5KFB A;  2LKV A;  1N34 H;  2Z6B A;  2JEJ A;  1AE3 A;  2O4X A;  1S5D D;  5C6A A;  1Y1V B;  2UUB Q;  1WD1 A;  1WVL A;  3U4Z A;  1DV2 A;  1LTL A;  2N3S A;  3HOX B;  3NUC A;  4C5A A;  4J9Q A;  1Y1W A;  4GC7 A;  1V8Q A;  4AYB E;  3CHB D;  3CPF A;  3OMG A;  4XT3 B;  2QEJ C;  3D31 A;  4V0B A;  2F0Q A;  5KFE A;  1L1O A;  3V96 A;  2EOT A;  5CAE B;  2NUC A;  2Q2H A;  4EGJ A;  4R1J A;  3TRE A;  1I4R A;  4XQJ A;  3RV4 A;  5IWA Q;  4RCO A;  2AQ3 B;  3PVX A;  4QJF A;  5EPK A;  2WKD A;  3EA6 A;  1EY5 A;  4DV1 L;  3MFG A;  3NEN A;  5CGK A;  4IOA A;  1S68 A;  1G6Z A;  2R86 A;  5M5W H;  1PRT D;  2RKS A;  4TVA B;  4DNT B;  2FB9 A;  1I4P A;  3VPB A;  4X65 L;  5M5Y H;  1HNZ L;  1D6E C;  2D62 A;  4O42 A;  5J2T F;  3GTJ B;  5GRO A;  4JI0 L;  5LL6 b;  5LYJ F;  4FBU A;  5EJW A;  1FVI A;  5EDW A;  1X3Q A;  4HIK A;  1BBX C;  4KV6 A;  3GTO H;  4A3G H;  2F0O A;  1DON A;  1EEF D;  3T5J A;  1B8A A;  4GNX C;  1Z6H A;  3MC0 B;  4TUY F;  2BQ3 A;  2JJQ A;  4LF6 H;  4CC5 A;  1IYU A;  2L15 A;  1QZH A;  2E2I A;  1QE6 A;  5IP9 H;  3A56 A;  4FF1 A;  3QB3 A;  4DV4 H;  1X3E A;  1BNC A;  3K81 C;  2KVM A;  3EIV A;  3B6Y A;  3CCR A;  2E2D C;  5LMN Q;  1K8G A;  1D5X C;  3K7A B;  4A3F G;  2W6Z A;  5JVL A;  3R5H A;  1AFP A;  1A2T A;  1SJE D;  1Y1V G;  2IL8 A;  5BR8 L;  4DR6 Q;  3M3Y H;  3VPD A;  1I4G A;  4DU9 A;  1B3A A;  1U4L A;  3HOX G;  1B50 A;  4DR3 H;  2A68 D;  4KKT A;  1K3B C;  1EWH A;  4FXK C;  5KFA A;  1JB7 A;  4GLA C;  2ATL A;  4AYB A;  1MSG A;  4LFA L;  3FDS A;  4KJN A;  1CA6 A;  2K33 A;  1WTW A;  3E9I A;  4Q8F A;  3R3O A;  2WTF A;  1CI3 M;  4E6I A;  4LF7 H;  2Z4I A;  1G51 A;  4XYL B;  5IE8 A;  3BYT B;  3H6M A;  3VYR A;  3HOU G;  5EWE A;  2K5N A;  4L63 B;  2ZXP A;  3HOV B;  2FMC A;  1LYL A;  4FVM A;  3I4N B;  1I6H H;  2JYO A;  3K59 A;  1I3Q H;  4HNU A;  1W96 A;  1ROD A;  3A0J A;  2C9O A;  2F03 A;  3BAB A;  1JWU D;  4XZ3 B;  3U9T A;  3KHG A;  4EYI B;  1TU2 B;  3I73 A;  1VQ4 A;  4Q8E A;  1AEX A;  1LTG D;  2E2J B;  1S0O A;  1SYE A;  3A8J E;  5C4J B;  3V4S A;  4GOP B;  1JLL B;  2XNA C;  3J81 c;  3E0J A;  3C0F B;  4LMY A;  1CKN B;  3RR5 A;  2RQX A;  5JVG 3;  2MGS A;  1XNQ L;  4YCW A;  1KRS A;  2AQ1 B;  4QF4 A;  2D0O A;  2ZDQ A;  2LMC B;  1PMR A;  4MV6 A;  2G9D A;  1E22 A;  4LNQ A;  3CC2 A;  3GD7 A;  2UXC Q;  2R87 A;  4DNR B;  5KFK A;  4X65 H;  1HNZ H;  3EYY A;  4EG0 A;  5KFY A;  4EQP A;  3H0G H;  5IIF A;  1Q1E A;  3M85 A;  3HEJ A;  5DQG A;  1I50 A;  1DV1 A;  1SNC A;  3H20 A;  4JI8 H;  4LFC Q;  3RB6 A;  1A6X A;  2XRS D;  2Y0S B;  1TWA B;  3RB4 A;  4YAJ B;  5KT6 A;  2NVX A;  3ORQ A;  3W5O A;  1V1P B;  2VUM A;  1FD7 D;  1ULZ A;  1B6S A;  1CK1 A;  1Q86 C;  1TWG H;  4XDX A;  3QIA A;  3K8A A;  4GLV B;  2QA4 A;  3RBD A;  5D3D A;  5CBE E;  1N36 L;  3S1M B;  1SYD A;  1B53 A;  1DYQ A;  4CDF C;  2L9H A;  5BR8 H;  2E5L Q;  2N8N A;  2TSS A;  5T14 A;  1HQR D;  2F0I A;  3Q1K A;  1U4M A;  5L9X A;  4R4C A;  2K14 A;  1A9X A;  1K28 A;  3NGD A;  4LFA H;  3ETH A;  4UDU C;  4O2D A;  4TV9 F;  1CQV A;  1LTB D;  1ESR A;  2AUK A;  1G2T A;  4C3J B;  1KJJ A;  2R7Z B;  1T36 A;  3G48 A;  4IJH A;  4JI7 H;  5D1O B;  4A3C H;  4JBJ A;  3T51 B;  1OTC A;  2SDF A;  3BA9 A;  2K5V A;  1T3N A;  2JEF A;  4ECV A;  4LSA A;  3BZK A;  1CZG A;  3K5O A;  4F8M A;  3N6X A;  2K5D A;  4RGO S;  4B3R H;  4I7H A;  4A3E G;  3PUV A;  2VQE Q;  2RDG A;  4A93 H;  5JPN C;  4ECZ A;  2I5H A;  1VQJ A;  4R8U B;  5DEH A;  5ELB A;  2YTV A;  2Y0S G;  4OO1 H;  2M9V A;  4A3D B;  3ND8 A;  4K2L A;  5KFT A;  2FMM A;  1E4F T;  5HGQ A;  3CMA A;  3TIG A;  1R9T A;  3I90 A;  2V58 A;  4GKK L;  3T1Y H;  3D4R A;  1IOV A;  3AFQ A;  3CCU A;  3S14 H;  3JAM W;  3L4J A;  4AH6 A;  1CKM A;  2B2T A;  4G57 A;  1HUN A;  3I70 A;  4JI3 L;  4FF4 A;  1IBL L;  1O7L A;  4I7Z C;  2JA7 H;  1N48 A;  1ZYR D;  4OL7 A;  3RZO H;  3KK7 A;  1UE1 A;  5C3E G;  4DV1 Q;  4IFD I;  4LFB L;  3RBE A;  4HR7 B;  1ET6 A;  1GUG A;  2WE6 A;  3RUZ A;  4RU9 A;  2AMC B;  2PYK A;  2YRX A;  1D5Z C;  1F77 A;  3K5I A;  1WCM G;  4L1K A;  3LGJ A;  2R7Z G;  4JI0 Q;  1SRO A;  2F4V L;  2PMZ A;  5CV7 A;  1PK8 A;  3M4Y A;  3M9B A;  5DG7 A;  4QL5 A;  5KFC A;  4B3S L;  1IXR A;  1GLV A;  1LUZ A;  1SMY C;  1WJJ A;  1RJR A;  5LA6 F;  2UUC H;  3A5Z B;  3F2D A;  1TII D;  2VNU D;  4X66 L;  2JA5 H;  2ZJR A;  1CKO A;  3CRK C;  4G7O C;  3WO0 A;  3PO2 B;  4IRD A;  3H4B A;  4J9P A;  3HG9 A;  3NEM A;  1B33 N;  1HA5 A;  2IWH A;  2FJZ A;  1LM0 A;  1SNP A;  2LFN A;  2W7O A;  4A2A A;  2EDG A;  5CV4 A;  3HXL A;  2EYP A;  5L1L A;  1VMP A;  3FMA A;  4KHP L;  4A3D G;  2J7Z A;  3HZX A;  5BPF A;  5JAV A;  2KHS A;  1Q90 A;  1QIL A;  1E3P A;  1EIY B;  4ECW A;  5DM7 3;  2R93 B;  2DZD A;  3E9H A;  2YU9 B;  1Y1V A;  3MXP A;  4O3P A;  5KNB A;  4I65 A;  2F0M A;  1EQR A;  4NKL A;  1SEB D;  3CCM A;  1SFO H;  2XGP A;  1T94 A;  5C0X I;  4A3K G;  2IHF A;  4CBV A;  4Y7N B;  5C5L A;  2RDJ A;  2AU0 A;  1TY0 A;  1KQS A;  3DEP A;  1M90 C;  3S16 H;  4CKE A;  1SND A;  3SR1 A;  1SAP A;  1IHZ A;  4EEQ A;  5KG4 A;  1KAW A;  1AE2 A;  3H40 A;  2WP8 J;  4LAA A;  3SE7 A;  4DL4 A;  2IHE A;  3W1G A;  5K5P A;  5KG5 A;  4JOI C;  2X6G A;  3F2U A;  1M0W A;  1PRT C;  1PFS A;  3MAQ A;  2VB2 X;  3G8C A;  3PF5 A;  2B8F A;  1CQF A;  1OO9 B;  2RVL A;  3QO2 A;  1IZ6 A;  3GTJ A;  1SYB A;  2C28 A;  2NUA B;  5M5W B;  5CMD A;  2F0S A;  4JI3 H;  4BBS H;  1XMQ L;  2WAC A;  5M5Y B;  2JEI A;  2LXJ A;  2WB1 B;  4FO2 A;  2ICE C;  4XX0 B;  2B2U A;  3I4M B;  1EFI D;  4ID6 A;  2Q2T A;  5IGC A;  3KHL A;  3GTO B;  5DM6 3;  2YTX A;  4A3G B;  4HID A;  1NR4 A;  4DAV A;  4JBW A;  3N41 B;  5KT7 A;  4DR1 H;  1UE7 A;  4YY3 L;  1RF2 D;  3GTM B;  1XNR L;  1S97 A;  2F4V H;  1ILP A;  3TEH B;  3MWD A;  3PR4 A;  4N8X 1;  2K4K A;  3RLN A;  4LH6 A;  2EYH A;  3RN2 A;  2JA8 H;  5ISR A;  2W9C B;  2A68 C;  4U67 3;  4UP9 A;  1XPR A;  1S5F D;  4X66 H;  3H15 A;  2OEO A;  1PYW D;  3MXU A;  1F9S A;  4ECS A;  3I72 A;  1Z2N X;  3VMM A;  3BVZ A;  3V6H A;  1DD2 A;  3FDT A;  4KHP H;  1N36 Q;  1WTO A;  5KFI A;  3FVQ A;  4K5W A;  4LUO A;  1D5M C;  3D4W A;  4O4H F;  4XYO A;  5IGE A;  1S03 G;  4DR7 H;  3GID A;  1EL0 A;  2F0W A;  2HHH H;  2L0C A;  1YI2 A;  4ED0 A;  4KTA A;  1NUC A;  3ULJ A;  4J9L A;  3MR5 A;  3HP3 A;  4G4K A;  1R4P B;  2ZT9 C;  5JPM C;  1GGO A;  5LMU H;  3BJU A;  5KKN B;  3PIO A;  2CKZ B;  2VQF Q;  4GOP A;  4O3Q A;  3G6Y A;  2E2H A;  3PUX A;  3MXG A;  2WB1 G;  1Y1W B;  4DR2 L;  1CKN A;  3KHR A;  2Q8I B;  2CW8 A;  3A54 A;  4A3G G;  2V9W A;  3A7L A;  3V6K A;  2FHT A;  2ALZ A;  4HN7 A;  3MXN A;  2EIF A;  2B3G A;  2RA4 A;  3QJY A;  2A19 A;  3MTS A;  1N33 H;  3OW7 A;  1LTR D;  3HOY B;  2ZJT A;  2JQO A;  1X56 A;  2HCC A;  1KHI A;  4WJ4 A;  4FXD A;  4HMJ A;  3S1Q H;  2FK1 A;  1HRJ A;  1VQ5 A;  2CZG A;  4Q43 A;  1EUC B;  4YHH L;  2Y0S A;  3TP8 A;  4EBE A;  1Z2P X;  4ZYS A;  2R7K A;  2WIN B;  1V1P A;  1F9Q A;  1HJP A;  4KMU C;  4MTE A;  1P16 A;  2EJF C;  1DOM A;  2X0S A;  3EN2 A;  1IBL Q;  3WO1 A;  1U4P A;  3JRX A;  5KIX A;  1ZKO A;  2F0G A;  3A5U A;  1ENC A;  1XNR H;  4GKJ H;  5J2U F;  5KG6 A;  4LFB Q;  3GIJ A;  4JI2 L;  2HUG A;  1JJG A;  3S9W A;  3BQ1 A;  1VQF A;  3A8I E;  2AWN A;  5I6Y A;  4NXN H;  4QWB A;  1WTP A;  1OXU A;  1B44 D;  2KEC A;  3SE0 A;  1VQ8 A;  1AP0 A;  4B3S Q;  1HNX H;  2R7Z A;  2IT1 A;  5AJ3 Q;  4QMG A;  3ZYY X;  4DV0 L;  1AH9 A;  4NXM Q;  1BF4 A;  2P5Z X;  2RCF A;  2KUM A;  4ULL A;  1PA6 A;  4JI5 H;  4AYB B;  2GPW A;  1HR0 W;  4CKB A;  2O03 A;  3K5H A;  2H5X A;  2J0T D;  4ODG A;  5K2M A;  2XWJ B;  1UWV A;  1KRT A;  3V2T A;  5D8D A;  3HOY G;  1ML0 D;  3HOZ H;  4KJO A;  5A2Q E;  1JOR A;  2HVR A;  4QW8 A;  4IFD H;  4XQN A;  3CC7 A;  1IOW A;  4R8U A;  3GIK A;  2EXD A;  4LF9 H;  1UAP A;  1J8I A;  1HFN A;  1TAE A;  3DM1 A;  3H0G G;  4RFB A;  1XXG A;  3FPP A;  1H9M A;  1F2M A;  2V1C C;  3K0Y A;  3T16 A;  2D2C C;  1MD2 D;  1YHA A;  4X62 L;  3GTK H;  2V5A A;  2MO1 A;  1B9N A;  2CCZ A;  1NR2 A;  4ME3 A;  3SXH A;  2R6G A;  4MTD A;  3ULP A;  1LTA D;  1MKH A;  3ERS X;  3NWS A;  4NP5 A;  1QZG A;  2JK8 A;  1X32 A;  1RL2 A;  5IT9 E;  3S14 B;  1ZEQ X;  2IMW P;  2MPM A;  1YJ9 A;  1JE4 A;  2CWA A;  5KFF A;  4I4T F;  4C2M A;  1Q1B A;  1SNM A;  3HS0 C;  4HR7 A;  2DJG C;  1WTQ A;  4UFZ A;  4JPB W;  4HJ9 A;  4YHH H;  2C22 A;  1VQA A;  3J80 W;  1CFM A;  4JV5 L;  2F0J A;  2EE1 A;  1BJT A;  3RF2 A;  3RZO B;  1SEI A;  1JR0 D;  5KG3 A;  2NVT H;  3KTM A;  1UC8 A;  1KDB A;  1K0S A;  5FJ8 G;  1BDO A;  1EIH A;  4F4W A;  1XTC D;  1L0Y B;  2PW5 A;  3LX0 A;  1H9S A;  1SR3 A;  1B4O A;  1U9R A;  3J80 c;  1XMQ Q;  5CR3 A;  3PO3 H;  4IUN A;  5C0X H;  2B2U C;  2ZTE A;  5DQI A;  3S2H H;  2VUM B;  1PH9 A;  4JI2 H;  3C3L A;  4A3C G;  1WD0 A;  2FXQ A;  5HBR B;  3I3C A;  3J81 j;  3FEW X;  2F0L A;  3SGI A;  2J6T A;  4L5R C;  2RBM A;  2R82 A;  2JA5 B;  2IPK D;  4P74 A;  4YY3 Q;  4A3I B;  1WTV A;  3H94 A;  3JAM E;  1EQV A;  4ECR A;  5I9P A;  1PZJ D;  2E74 C;  3C1E A;  4A3J H;  4IUT A;  4FNF A;  2W7P A;  1E7Z A;  3NQT A;  3MR6 A;  2JA6 H;  3PW7 A;  1WTH A;  3NTH A;  5GAE C;  1N32 L;  2BH8 A;  3BAA A;  3U50 C;  5C4X H;  3L7Z C;  2QEX A;  4OO1 G;  4EBD A;  1BOS A;  2CFM A;  3ND9 A;  4AIM A;  2I87 A;  2KCC A;  3R23 A;  3C1F A;  1PTO D;  4K6L A;  4DR4 L;  1N34 L;  4BBR B;  3D0F A;  2V59 A;  3M4P A;  2FP4 B;  5KFW A;  3K7U C;  3AFP A;  2DPI A;  1F2Y A;  5IT9 L;  4F87 A;  2GLT A;  2PNR C;  1RTO A;  3GV5 B;  1K73 C;  4LF5 Q;  3UFX B;  1H9J A;  3ONA B;  5LL6 X;  3NBH B;  3OTO L;  2Z6K A;  5ELF A;  4EGQ A;  4ECT A;  2ASD A;  3CCQ A;  1BKB A;  3Q6S A;  2Q8T A;  4IPC A;  1I4Q A;  4ALP A;  5FPR A;  1VQH A;  1VQE A;  4A3B B;  1LTT D;  4IUQ A;  4HSV A;  1LT5 D;  4DK6 C;  3SI8 A;  3FP9 A;  4NMZ A;  1YVC A;  1I5F A;  1NY4 A;  5EZY F;  4JC0 A;  4DR2 Q;  4IHJ F;  2QKI C;  4MIU A;  1UNN C;  2WB1 A;  4J9N A;  1EQQ A;  2M05 A;  2JE6 I;  4X64 L;  2JA5 G;  1AN8 A;  3GTO A;  2IX3 A;  2F0F A;  3TP7 A;  3FMC A;  3F2B A;  4H0L C;  3GTL H;  5D3I B;  3JAM L;  4LF6 L;  3BA8 A;  1QNU A;  4EFB A;  3H91 A;  4DV4 L;  2LXK A;  4RAY A;  2L1B A;  1EYG A;  4S3S A;  2VA3 A;  3M4O H;  1MBY A;  4OO1 I;  5KG2 A;  3P75 A;  4O3R A;  4DV2 L;  4YWK A;  1UEA B;  2JEB I;  1HCZ A;  3DHQ A;  3MFY A;  1XPU A;  4PDB A;  1AN7 A;  3CVZ A;  1C9O A;  1R4Q B;  1A3V A;  3PZP A;  3LNN A;  2ATW A;  1PRT F;  4J6H A;  1LAB A;  3SK6 A;  4DR3 L;  2JA8 B;  4MAM A;  2KQ3 A;  5ELD A;  4N8F A;  4DK3 C;  4DF7 A;  4HNV A;  1GUW A;  3JAM i;  3MFH A;  1TXY A;  4ED2 A;  2B63 H;  4ED7 A;  3HFZ B;  3TME A;  4IAJ A;  1X6O A;  4RB1 A;  1DIK A;  1LTS D;  2V4R A;  1KAB A;  4L5Q A;  5C44 B;  3I8Z A;  4JBK A;  5KYI A;  3T5L A;  4NW2 A;  4DAM A;  4LF7 L;  4MA0 A;  2OT2 A;  2GVA A;  4BS9 A;  5IY0 A;  4V19 0;  2DWC A;  3TQT A;  4A3F B;  5ELN A;  4DR4 H;  2AHO B;  1I3Q A;  4DV0 Q;  4DV6 H;  1O78 A;  2A74 C;  1FJG H;  3U9S A;  1EZ6 A;  1EU3 A;  2XSC A;  1L0X B;  4BBS G;  2OTJ A;  1HXY D;  4OWX B;  3OTO H;  3HBL A;  4LF8 Q;  3S1N H;  4TQU S;  3CPW A;  2IX1 A;  2EYL A;  3X3N A;  2NBF A;  1KLG D;  1YNN D;  2OQK A;  1IYV A;  4ED6 A;  5J22 A;  3H3V C;  1G6P A;  2HVQ A;  2I46 A;  2LY7 A;  1BCP B;  4BXX H;  5FD6 A;  1BQQ T;  2ZTD A;  4MZ9 A;  1S10 A;  3HOU B;  3DLL A;  2A69 C;  1M7J A;  2I5L X;  2W71 A;  4J9K A;  1KLU D;  1PXU A;  2BA1 A;  4OON A;  2R92 H;  1MIU A;  3QOJ A;  3NXW A;  3L0O A;  4DNI A;  2XTI A;  1DOK A;  2Q2I A;  4X62 Q;  2CWP A;  3H0G A;  2UVV A;  4DR5 H;  4CKC A;  4OXP A;  2X69 A;  3U9O A;  4JV2 A;  1PYB A;  5BN4 A;  2JA8 G;  4JI8 L;  4X64 H;  3S1Q B;  3K58 A;  3F8N A;  3IFD A;  3FKI H;  1GVP A;  2XGQ A;  3CQZ H;  4FP5 D;  2WKC A;  5C44 G;  2K50 A;  2NVY B;  4LJZ C;  1WI5 A;  1HHV A;  2WDT A;  1X55 A;  3BQ2 A;  2JA9 A;  1SSO A;  1E0B A;  1IYJ B;  4L6T B;  4RUC A;  3L4K A;  1STG A;  4PZ6 A;  4YWL A;  5L37 A;  4JV5 Q;  4DV2 H;  4DL2 A;  1A15 A;  4KKS A;  5JJI A;  1I6U A;  3M9N B;  2D9U A;  2UU9 L;  4UPA A;  4UAI A;  2K7V A;  2MNA A;  4I50 F;  4DAY B;  2VA2 A;  1EYD A;  2WAQ G;  4AQY Q;  1BBU A;  3T56 B;  1C7Y A;  2FIN B;  3PMF A;  2EJG C;  2KHJ A;  2VOB A;  3MZ5 A;  2UUA H;  4DUY H;  4UY8 C;  3WOF A;  3KLR A;  2E5L H;  1TA8 A;  4O2B F;  3CRL C;  1EY9 A;  2PW7 A;  3JC6 6;  4MN3 A;  4JI7 L;  4TSS A;  3A7A B;  3GTP H;  2XVS A;  2UXD Q;  4FF3 A;  4C1N I;  3J7A 5;  4JW0 A;  1X3F A;  4DK1 A;  3MWY W;  2PZT A;  3X3M A;  1QG7 A;  4RKB A;  1Z7T A;  4B3R L;  4QIW E;  2Z8L A;  3E0E A;  1SDF A;  1N32 Q;  2IW3 A;  5IOC A;  5EWG A;  3J81 W;  4IJL A;  3KAL A;  2RDF A;  4A3M H;  4C3H H;  5KT3 A;  3HB9 A;  2YL2 A;  3Q8Q B;  1N34 Q;  2E2H B;  3VR5 A;  1STN A;  3MWE A;  3W3A A;  4UHV A;  1ICW A;  3ICE A;  1QJO A;  1KL9 A;  3T1Y L;  3OSO A;  2Z6K C;  1MI2 A;  4CDC C;  2MUY A;  1HTP A;  2QDB A;  1EYA A;  3MXN B;  1SNO A;  3GV8 B;  3IN5 A;  4JI6 Q;  4PNY A;  3TZD A;  4A3E B;  4MTK A;  3OOC A;  4A3L H;  1CQJ B;  2YZG A;  1VKZ A;  4ZQI A;  4EQO A;  4IN3 A;  2NN6 H;  1C30 A;  2UVR A;  1LV9 A;  5LMN W;  5FO9 B;  1B6R A;  2F0U A;  4Q44 A;  2WFW A;  5TSS A;  5BN5 A;  4RAZ A;  2K5Q A;  2PCF B;  1RCV D;  2YS7 A;  2UUC L;  4KY5 A;  2E75 C;  1OXX K;  3PO3 B;  2JN4 A;  3S1R B;  2JA5 A;  1VF5 C;  1W3S A;  3RZD B;  4LF6 Q;  1G91 A;  4M1U B;  2I8C A;  4BY1 H;  2UU9 H;  5DG8 A;  2NZO A;  1YHB A;  1RJT A;  3J7A V;  2B8G A;  3RGX A;  5C3E B;  4IFD G;  1TWC B;  4K8J A;  1JDE A;  2RHQ B;  1M4V A;  1N9W A;  2R7M A;  1STY A;  1D1I A;  1WCM B;  3GQB A;  4MV1 A;  2AGQ A;  2FK3 A;  4A3J B;  4OX9 H;  5I47 A;  4EVO A;  3V05 A;  1PTO C;  2JEA I;  2OLS A;  2PN1 A;  1TWH B;  4YBZ B;  1HNW H;  2W9A A;  2C00 A;  4J8Q A;  5IGG A;  5FLX c;  4G3I A;  1DM0 B;  3U58 A;  1LAC A;  1X3P A;  2XGT A;  4EQN A;  1MHW C;  3NBH A;  2YYZ A;  3EVQ A;  2ZM6 Q;  1RK5 A;  4LF7 Q;  1A3T A;  1HR0 L;  4N9T A;  3GTQ B;  4HYK A;  5KEE A;  1JCK B;  3VR2 A;  1TS5 A;  2BDO A;  1A62 A;  2CW7 A;  4WOR A;  5IP7 G;  2FLL A;  2SNM A;  2ASB A;  3AU7 A;  1L1O C;  2WAQ E;  1WTX A;  3RLO A;  1BBW A;  3JSN A;  4MV7 A;  1S3O A;  2MCT A;  4JI1 L;  1IW7 C;  3TQY A;  3PO3 G;  2J9G A;  4UCV A;  5C0X G;  4A3K B;  2W57 A;  1UE5 A;  3K0X A;  5KT5 A;  1BCP D;  1GSH A;  2CVR A;  1T9H A;  1VQL A;  1VAJ A;  3RJ0 A;  1EY0 A;  2A6H D;  1RK6 A;  5DQH A;  4RHS A;  4C2M B;  5FK9 C;  2AQ2 B;  4Q45 A;  1VQD A;  2HDL A;  2W8K A;  3P1H A;  1DJR D;  4X65 Q;  1HNZ Q;  4A3J G;  4DR1 L;  5M9O A;  4DK0 A;  5M3F B;  5IYB G;  1ENA A;  2ZXR A;  4JI8 Q;  3QR8 A;  1H9S B;  2W6P A;  4ZI7 F;  3M4O B;  2K75 A;  1ASY A;  4KY7 A;  4RNO A;  1C8C A;  4KKU A;  4TQS A;  1L0W A;  1KAA A;  2UVW A;  1SE3 A;  3NTK A;  1RJP A;  4UCT A;  2D0P A;  3PIP 3;  4KN7 C;  4CC6 A;  4ME5 A;  1CHQ D;  1KBL A;  5C1P A;  3BG3 A;  4QWE A;  2CH4 A;  5BR8 Q;  1YIJ A;  4DR7 L;  1TWF H;  4DV5 H;  2HHH L;  4K0K L;  5J39 A;  2IY5 B;  5C3X A;  1SE4 A;  4X6A H;  2WAQ A;  4LFA Q;  4BWS C;  4PV1 C;  2K1B A;  4RB2 C;  1SE2 A;  2NYZ D;  5LMU L;  4JI7 Q;  2I0Q A;  4KY6 A;  4JUZ A;  1G29 1;  2M2L A;  4RGT A;  1PZK D;  1Q3L A;  3NE5 B;  2RGV A;  1GJX A;  4EX5 A;  4RZR A;  1RJQ A;  1HR0 H;  3KBX A;  4B3R Q;  2B29 A;  4HCE A;  2UVU A;  2XN9 C;  1OXV A;  5M3F G;  2NU7 B;  2UXB H;  4ECY A;  1N33 L;  3RB0 A;  3HOW H;  3CCJ A;  5JEA H;  4ED3 A;  3IAY A;  2QF7 A;  2MP1 A;  5NUC A;  5L1I A;  4JI1 H;  1XTD A;  4YR3 A;  1PFM A;  4DPG A;  2DY8 A;  1EYZ A;  5IGB A;  3S15 H;  2J6S A;  1ZHQ A;  2R92 B;  4R4O A;  1PVO A;  1IKM A;  3CAM A;  4LF4 L;  3T1Y Q;  3CF5 A;  3AQQ A;  2XWB B;  3RD4 A;  2YRW A;  2WII B;  1XNQ Q;  1B7Y B;  2PBZ A;  1SMX A;  1PLF A;  2NVY A;  1LT3 D;  2EQS A;  3GIL A;  2C2D A;  2B63 G;  3HKZ B;  3CKI B;  4R9W A;  1R9T H;  3S2D H;  2PZW A;  3CCE A;  1IBM L;  1HPC A;  2KEE A;  3CQZ B;  3CC4 A;  3ITP A;  4GKJ L;  1RDP D;  2RSO A;  1N56 A;  2HQL A;  2KCN A;  1PH8 A;  3CCS A;  4DAY A;  2VZA A;  3NQI A;  5E3F A; 
#chains in the Genus database with same CATH homology
 4R4T A;  3OW2 A;  1U0L A;  4DUY Q;  2UUA Q;  1YJ9 A;  2CWA A;  2UUB Q;  3U4Z A;  1Q1B A;  1LTL A;  2N3S A;  4NXN L;  5FJ8 H;  4O0A A;  4AYB E;  4HJ9 A;  3CPF A;  1EIF A;  1O7I A;  1VQA A;  3D31 A;  4JV5 L;  1L1O A;  1HNX L;  2CQO A;  2NVT H;  2Q2H A;  2PMZ E;  4R1J A;  3TRE A;  1ASZ A;  5FJ8 G;  2UUC Q;  1H95 A;  3H3V I;  5IWA Q;  2VQF L;  4QJF A;  1SR3 A;  4JI5 L;  3J80 c;  1XMQ Q;  2YTY A;  3M4Q A;  4DV1 L;  3PO3 H;  4DKA C;  4PG3 A;  3NEN A;  5IT9 c;  4IOA A;  2ZTE A;  1L2F A;  2UXB L;  5M5W H;  1XPO A;  3S2H H;  4TVA B;  1X9N A;  1PH9 A;  1A63 A;  4A3C G;  4X65 L;  5M5Y H;  2FXQ A;  1HNZ L;  4BXX G;  2D62 A;  1NJI C;  3GDE A;  3J81 j;  4JI0 L;  5GRO A;  3SGI A;  4L5R C;  4LF9 L;  1FVI A;  1MJC A;  3S17 H;  4P74 A;  4YY3 Q;  2R92 G;  3I7F A;  1GKH A;  2DUD A;  4HIK A;  3GTO H;  4A3G H;  1PH2 A;  1VCI A;  4A3J H;  1B8A A;  1X3G A;  2GVB A;  3EBE A;  4GNX C;  2JJQ A;  1K83 H;  1E7Z A;  2L15 A;  4GN4 B;  1QZH A;  2JA6 H;  5IP9 H;  1PHJ A;  5GAE C;  1N32 L;  2BH8 A;  3HKZ G;  3U50 C;  4R4I A;  1X3E A;  3FKI G;  3L7Z C;  5C4X H;  2QEX A;  4BY7 G;  4OO1 G;  1WYD A;  4NPS A;  3K81 C;  2CFM A;  2IX0 A;  3EIV A;  3B6Y A;  4AIM A;  3F2C A;  3CCR A;  5LMN Q;  1K8G A;  2JA6 G;  5IP9 G;  4A3F G;  3CD6 A;  4DR4 L;  4DUZ L;  1N34 L;  5C4X G;  3D0F A;  5GAG C;  3M4P A;  3K7U C;  3JAM c;  1Y1V G;  5BR8 L;  4L5S A;  3AFP A;  4DR6 Q;  1OXT A;  3M3Y H;  1SN8 A;  2PI2 E;  1I50 H;  5H1S E;  3HOX G;  1FGU A;  4GNX B;  1K73 C;  1JB7 A;  4LF5 Q;  2C35 B;  4A4I A;  4GKK Q;  4GLA C;  3NBH B;  3OTO L;  2Z6K A;  4LFA L;  3CCQ A;  2NVX H;  1BKB A;  4XIG S;  3AEV A;  3KFU A;  3PCO B;  4IPC A;  4ALP A;  3E9I A;  1VQH A;  2VUM H;  1VQE A;  4JI3 Q;  4JI4 L;  1VQO A;  2UU9 Q;  4APV A;  1EUJ A;  4DK6 C;  5JJL A;  1G51 A;  5IE8 A;  4A75 A;  4GN5 A;  3GTJ H;  4FDB A;  3FP9 A;  5AJ3 L;  2K5N A;  1YVC A;  3IRB A;  3J80 i;  3HOU G;  1I5F A;  1Q81 C;  1NY4 A;  1LYL A;  1I6H H;  4JC0 A;  4A3I H;  4NXM L;  3TRZ A;  4DR2 Q;  1I3Q H;  1X65 A;  3A0J A;  1EQQ A;  4P72 A;  2JE6 I;  1VQ4 A;  4X64 L;  4DR1 Q;  4OX9 Q;  1JMC A;  2JA5 G;  2K5H A;  2F4V Q;  3F8T A;  4H02 A;  3F2B A;  4B3T L;  1HNW Q;  4GOP B;  3GTL H;  4LF6 L;  3J81 c;  4OWT B;  4KLK A;  3J7Z C;  4A3M G;  3K7A H;  3PIP A;  4X66 Q;  3MEF A;  2LXK A;  4P75 A;  4DV4 L;  1CKN B;  3RR5 A;  4BBR H;  2KCT A;  1EYG A;  3M4O H;  4OO1 I;  1XNQ L;  5IYC H;  4YCW A;  4LWC A;  1KRS A;  1NE3 A;  2D0O A;  4DV2 L;  4IOC A;  4YWK A;  1YIT A;  1HH2 P;  1QUQ B;  1E22 A;  2JEB I;  1VQ9 A;  3CC2 A;  4LNQ A;  3GD7 A;  1XPU A;  1UE6 A;  3RLF A;  2UXC Q;  1C9O A;  4KHP Q;  1PH1 A;  1KXL A;  3H0G H;  3M85 A;  1Q1E A;  1BVS A;  4DV3 L;  4DV7 L;  1CUK A;  2ATW A;  4QQB X;  4HJ5 A;  3PSI A;  4DR3 L;  4J15 A;  4DK3 C;  4LFC Q;  3JAM i;  1TXY A;  4DR7 Q;  1K3R A;  2B63 H;  4NB3 A;  3HFZ B;  4A3B H;  2HT1 A;  1X6O A;  5FLM H;  2HHH Q;  4A3L G;  2MQH A;  1C0A A;  4MTN A;  1IL2 A;  4L5Q A;  3W5O A;  1S72 A;  3HOV H;  3I4N H;  4JBK A;  5LMU Q;  3TS0 A;  4DAM A;  4YCU A;  4LF7 L;  1Q86 C;  1WFQ A;  2GVA A;  1TWG H;  5IY0 A;  3T1H L;  3K8A A;  4GLV B;  2QA4 A;  5ELN A;  3PGZ A;  1VQ7 A;  2E2J H;  5IWA L;  1N36 L;  1JT8 A;  2AHO B;  3RN5 A;  3G71 A;  5C4J H;  4DV0 Q;  3PO2 G;  2E5L Q;  2N8N A;  1VQK A;  2KBN A;  1N33 Q;  4BBS G;  4R4C A;  2OTJ A;  2K14 A;  2K52 A;  5HY6 A;  4OWX B;  4LF8 Q;  1D7Q A;  4O2D A;  3S1N H;  1CSQ A;  3BZC A;  2LSS A;  4TQU S;  3CPW A;  2NZH A;  3G48 A;  4IJH A;  2IX1 A;  2R93 G;  5M5X H;  4A3C H;  2OQK A;  3F1Z A;  4JBJ A;  1OTC A;  3J81 i;  1Q12 A;  2K5V A;  3Q8D A;  1G6P A;  4BXX H;  4JBM A;  2ZTD A;  3BZK A;  4MZ9 A;  3DLL A;  2PQA B;  4IPH A;  2I5L X;  2Y0S E;  2BA1 A;  4OON A;  2R92 H;  1A8V A;  4GNX A;  2AKW B;  4BA1 I;  1MIU A;  1Q82 C;  4A3E G;  3L0O A;  3PUV A;  2XTI A;  2Q2I A;  1TWA H;  3STB D;  2CWP A;  4DNI A;  5IYD G;  4IPD A;  4X62 Q;  4OXP A;  4A93 H;  3HKZ E;  1PYB A;  2JA8 G;  2I5H A;  4JI8 L;  2A1A A;  1VQJ A;  1YHQ A;  5C44 H;  1XMO L;  1XNR Q;  4GKJ Q;  4L5T A;  2YTV A;  4DV5 Q;  3FKI H;  2Y0S G;  4BY7 H;  1VQC A;  1GVP A;  4LW1 A;  4DR6 L;  4A93 G;  3CQZ H;  4GN3 B;  3GO5 A;  5HGQ A;  5C44 G;  3TS2 A;  4A3F H;  4HIO A;  3CMA A;  2K50 A;  1WI5 A;  2NN6 I;  4LF5 L;  3S1M H;  4GKK L;  1X55 A;  2JA9 A;  1NMG A;  3AFQ A;  4KHZ A;  2PNH A;  3KF8 B;  1IYJ B;  3CCU A;  4LUZ A;  1Y1V H;  2VY3 A;  4PZ6 A;  4YWL A;  3CCV A;  4POG A;  1J6Q A;  4AH6 A;  4JV5 Q;  3HOX H;  1EWI A;  1HNX Q;  1CKM A;  2ALY B;  4JG2 A;  4P71 A;  5JJI A;  1HR0 Q;  4JI3 L;  5M3M G;  1IBL L;  2UU9 L;  1FL0 A;  3PUW A;  1HZA A;  4UPA A;  4DV6 L;  3UE1 A;  1J5E L;  2JA7 H;  2MNA A;  4DAY B;  3RZO H;  3K80 C;  1FJG L;  1UE1 A;  2WAQ G;  4JYA L;  5C3E G;  4AQY Q;  1BBU A;  4DV1 Q;  4IFD I;  3CW2 C;  4LFB L;  4C3J H;  1C7Y A;  2R7Z H;  2UXB Q;  1N8R C;  2JA7 G;  4YCV A;  2AMC B;  2KHJ A;  3I4M G;  3A74 A;  1WCM G;  3KLW A;  4UY8 C;  4JI1 Q;  1L1O B;  1QVG A;  3HOU H;  3LGJ A;  4GOP C;  4B3M L;  3JC6 6;  3WWV A;  4JI0 Q;  4JI7 L;  1SRO A;  2F4V L;  3GTP H;  2R7Z G;  2KEN A;  1IBK L;  4LF9 Q;  2UXD Q;  3M9B A;  1X54 A;  1Z9F A;  4QL5 A;  2VQE Q;  4B3S L;  1IXR A;  1X3F A;  3J7A 5;  1LUZ A;  1WJJ A;  3G6E A;  3I2Z A;  3W1B A;  1NMF A;  3A5Z B;  1VQG A;  4RG1 A;  3F2D A;  4B3R L;  2VNU D;  4X66 L;  2JA5 H;  3KYH C;  4QIW E;  2ZJR A;  1CKO A;  1K9M C;  3E0E A;  1N32 Q;  4DR5 L;  4A3D H;  3NEM A;  4IJL A;  4MNO A;  1JE5 A;  1LM0 A;  1V9P A;  3UDX A;  1YJN A;  2BH2 A;  4A3M H;  3H3V H;  4C3H H;  4HJ8 A;  4BA2 I;  2UXC L;  2NVY H;  3ER0 A;  1GO3 E;  3GTG H;  4KHP L;  4A3D G;  4DUZ Q;  1N34 Q;  1VQI A;  1I94 L;  1SRU A;  2ES2 A;  2N78 A;  1E3P A;  3KJP A;  3KJO A;  1EIY B;  1QVF A;  3ICE A;  1KL9 A;  3T1Y L;  2Z6K C;  2OCE A;  4YHH Q;  3E9H A;  4HJ7 A;  2Z0S A;  4GS3 A;  3U4V A;  4PZ8 A;  3CCM A;  1SFO H;  1EQR A;  3MXN B;  4POF A;  5C0X I;  4A3K G;  1PH7 A;  3CP0 A;  2IHF A;  3PV0 A;  1YEZ A;  4YWM A;  1W2B A;  4JI6 Q;  4C3I H;  3L2P A;  3G4S A;  2VL6 A;  1KQS A;  4JCV E;  1A0I A;  1M90 C;  3S16 H;  4A3L H;  2F52 A;  2PI2 A;  1Y1W G;  1VQN A;  1KAW A;  1AE2 A;  1YJW A;  1PYS B;  2WP8 J;  2UUA L;  4JI2 Q;  4DUY L;  1SLJ A;  4K0K Q;  2UUB L;  2IHE A;  3W1G A;  5LMN W;  2E5L L;  4JOI C;  2R7D A;  5J3B A;  2WFW A;  1PFS A;  2NN6 G;  4HJA A;  2HIX A;  1D8L A;  3PF5 A;  1PH5 A;  3HKS A;  1IZ6 A;  5GAH C;  4LF8 L;  2I5M X;  3PO2 H;  2UUC L;  4B3T Q;  1OXX K;  1W3S A;  4LF6 Q;  1VQ6 A;  1PH3 A;  4BY1 H;  5GQO A;  3PF4 A;  1XMQ L;  1WOC A;  4BBS H;  3PUZ A;  2NZO A;  1Q8K A;  1YHB A;  5JEA G;  1GD7 A;  2LXJ A;  2E2H H;  2Q2U A;  4IFD G;  5GAD C;  1PH4 A;  1SE8 A;  4BY1 G;  2OWO A;  1NBW A;  2QGQ A;  2R93 H;  2RHQ B;  1M1K C;  1N9W A;  4UP8 A;  2VQE L;  2Q2T A;  1YNX A;  2YU9 H;  2YTX A;  4HID A;  4JBW A;  3VDY A;  1UE7 A;  4YY3 L;  5DLQ E;  4DV7 Q;  4XTC S;  5JJK A;  1XNR L;  2JEA I;  3TEH B;  4Y7N H;  4LF4 Q;  3RLN A;  2K4K A;  4A3E H;  3AYH B;  1HZ9 A;  5IYD H;  3UDF A;  3RN2 A;  3ZJY C;  1EFW A;  5FLX c;  2JA8 H;  4Y52 H;  1RIP A;  3U58 A;  4UP9 A;  3CME A;  1XPR A;  2NVQ H;  2XGT A;  5K36 G;  3H15 A;  2HIV A;  3KDF B;  2YYZ A;  2ZM6 Q;  5LMN L;  2RF4 A;  4LF7 Q;  1E1T A;  4A76 A;  1IBM Q;  5IP7 H;  2KCM A;  3RNU A;  1HR0 L;  4QGU A;  3T1H Q;  5JEA J;  1CSP A;  3KF6 B;  1S40 A;  1N36 Q;  1A62 A;  4IFD J;  1DGS A;  1B70 B;  4LUO A;  4AYB G;  5IP7 G;  4AQY L;  4EQ5 A;  3NEL A;  3S1R H;  2ASB A;  2R7F A;  2ZJQ A;  2KHI A;  1L1O C;  3RZD H;  2YV5 A;  3CXC A;  1KIX A;  5M3M H;  2RCN A;  2WAQ E;  4NXN Q;  3RLO A;  2WB1 E;  1BBW A;  2E8G A;  4HIM A;  1YI2 A;  2BA0 A;  1S3O A;  4JI1 L;  3ULJ A;  3TQY A;  3PO3 G;  5C3E H;  5C0X G;  1TWC H;  1UE5 A;  3K0X A;  3S24 A;  4IO9 A;  1T9H A;  1VQL A;  2UXD L;  3BJU A;  1E1O A;  3I4M H;  2GN5 A;  2CKZ B;  4UP7 A;  3PIO A;  2VQF Q;  1WCM H;  4GOP A;  4JI5 Q;  3PUX A;  1JJ2 A;  2WB1 G;  1KD1 C;  1XJV A;  5E7N A;  1VQD A;  2N49 A;  5IYB H;  4DR2 L;  1CKN A;  1HZC A;  3GTM H;  1PH6 A;  1TWH H;  3M7N A;  4X65 Q;  4A3G G;  1HNZ Q;  4OWW B;  4A3J G;  1YBY A;  4DR1 L;  4OX9 L;  1QUQ A;  1P8L A;  2B3G A;  2EIF A;  3OYY A;  5IYB G;  2A19 A;  3I56 A;  1Q7Y C;  4JI8 Q;  3FHW A;  1HNW L;  1VQM A;  2ZTC A;  1HZB A;  3BU2 A;  2JQO A;  3PUY A;  1XMO Q;  1MJE A;  1X56 A;  2K75 A;  1ASY A;  1KHI A;  2RHS B;  4WJ4 A;  4PMW A;  1Y14 B;  3S1Q H;  3UE0 A;  1VQ5 A;  3UDG A;  4WJ3 M;  1L0W A;  1VS0 A;  4YHH L;  3GTQ H;  1EOV A;  2ID0 A;  5C0X J;  2MO0 A;  3ULL A;  1VQB A;  4R4Q A;  1JJC B;  2D0P A;  3UDI A;  4JI6 L;  1HJP A;  4QY7 A;  4DR4 Q;  1P16 A;  2DGY A;  3EN2 A;  1IBL Q;  4DV6 Q;  1J5E Q;  5BR8 Q;  1PH8 A;  4LFC L;  1Z47 A;  2VW9 A;  1V1Q A;  1YIJ A;  1FJG Q;  4A3K H;  4IPG A;  3A5U A;  4DR7 L;  4JYA Q;  1TWF H;  1YZ6 A;  2F3I A;  2HHH L;  4LFB Q;  4JI2 L;  2VUM G;  4K0K L;  2IY5 B;  1VQP A;  1K0R A;  4PZ7 A;  1JJG A;  4X6A H;  3OTO Q;  4LFA Q;  1V43 A;  4C2M H;  2A8V A;  1VQF A;  2AWN A;  1KC8 C;  5LMU L;  1NTG A;  1Y1W H;  3DM3 A;  4B3M Q;  4JI7 Q;  1UEB A;  4JOI A;  4A3I G;  2I0Q A;  1OXU A;  4JI4 Q;  3KOJ A;  1IBK Q;  1G29 1;  1VQ8 A;  4B3S Q;  2IT1 A;  1U5K A;  5M3F H;  4EX5 A;  5AJ3 Q;  1PV4 A;  4DV0 L;  4B3R Q;  2AWO A;  2VS1 A;  4NXM Q;  5EAY A;  3HOY H;  2B29 A;  1AH9 A;  1PA6 A;  2PQA A;  1HR0 W;  1OXV A;  1QVC A;  2H5X A;  5M3F G;  4DR5 Q;  4X64 Q;  1N33 L;  1UWV A;  3HOW H;  3CCJ A;  1KRT A;  3HOY G;  3KDF A;  4BBR G;  3HOZ H;  3STB C;  5IYC G;  1XTD A;  1OXS C;  4DPG A;  3CC7 A;  4GLX A;  1K8A C;  1I94 Q;  3HOW G;  2EXD A;  3S15 H;  3S14 H;  4KI0 A;  4R4O A;  4P73 A;  1PVO A;  3CAM A;  4DV4 Q;  4LF4 L;  3HOZ G;  1Q46 A;  3KF6 A;  3T1Y Q;  2ZJP A;  3AQQ A;  3CF5 A;  1E24 A;  5ELO A;  3H0G G;  1XNQ Q;  1B7Y B;  2OTL A;  2MFI A;  4DV2 Q;  1SMX A;  3I4O A;  2E2I H;  2V1C C;  4RMF A;  2EQS A;  1YHA A;  2B63 G;  4X62 L;  3GTK H;  4A3B G;  2MO1 A;  1R9T H;  5FLM G;  2ZM6 L;  3S2D H;  2CCZ A;  3CCE A;  1IBM L;  4ME3 A;  4DV3 Q;  2R6G A;  4LUV A;  3CC4 A;  4GKJ L;  4DR3 Q;  3ULP A;  1GM5 A;  4DV5 L;  3CCL A;  1MKH A;  2OQ0 A;  3ERS X;  1QZG A;  3HOV G;  3I4N G;  2HQL A;  3I55 A;  2JK8 A;  3CCS A;  1RL2 A;  2VZA A;  1AE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...