3H0GG

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
170
structure length
170
Chain Sequence
FFLKELSLTISLHPSYFGPRMQDYLKAKLLADVEGTCSGQYGYIICVLDSNTIDIDKGRVVPGQGFAEFEVKYRAVLWRPFRGEVVDAIVTTVNKMGFFANIGPLNVFVSSHLVPPDMKFDPTANPPNYSGEDQVIEKGSNVRLKIVGTRTDATEIFAIATMKEDYLGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit rpb1
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 26
structure length 170
sequence length 170
chains with identical sequence S
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h0gG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3h0gG01
3IRBA 4LUVA 1PYBA 1I5FA 2OTJA 3PUWA 4JOIA 1QUQB 1AH9A 1QVGA 1WOCA 1HZBA 1PH5A 3PO3G 4GKKL 1YZ6A 4DV4L 2K5VA 1XJVA 4DV3L 4J15A 2EXDA 5IYCH 4DR1L 3CF5A 1O7IA 2ZTEA 1YJWA 3PUYA 5FJ8H 2BH2A 5IYDG 3NBHB 3J7A5 3BZCA 4JV5L 2R93G 2QEXA 3A0JA 4GN5A 4AQYL 1IL2A 2OCEA 2AWOA 2VS1A 3BJUA 4P72A 1E3PA 4A3GG 1N9WA 4GLVB 4GS3A 4DV5L 1PH6A 1P8LA 2E5LL 4A3KG 4A3FG 2VQEL 1YJ9A 3DM3A 1XPUA 3UE0A 2IT1A 1E24A 1KXLA 4A93G 4GNXA 1Q46A 4A3IH 3KFUA 1VQEA 1CSQA 1I50H 4YWKA 4LFBQ 1GO3E 1VQ6A 1QVCA 3GTOH 3KDFA 1R9TH 1D7QA 3Q8DA 4BA1I 4JI2Q 2RHQB 2Z6KC 4UY8C 2NVTH 2WP8J 1QVFA 3HOYG 3I4OA 2HHHQ 3I4MH 4HIKA 2Q2HA 1MJEA 3S1NH 1EOVA 1MIUA 2AHOB 4X65L 4A3CG 3K7AH 4MZ9A 3S1MH 1GKHA 3AFPA 4JI7L 1YIJA 3G48A 1FGUA 4A3JH 4IPGA 1XNQQ 1N34Q 4B3SL 4GOPB 5K36G 1W3SA 3EIVA 2UXBQ 4P73A 4R4QA 4GNXB 2ES2A 4GN3B 4JI5L 4LF9L 4DR7Q 3WWVA 3CCJA 1JB7A 2F4VL 4A3EH 2JA6G 2LXKA 4GLAC 4JI3L 3CMEA 4JI2L 3T1YL 5BR8Q 2YTXA 3M9BA 2UUAQ 4TQUS 3KDFB 4LFAL 3S24A 5GAGC 4YY3Q 2D0PA 3I55A 4HIMA 1K73C 1KQSA 3HOUH 3M7NA 4IPDA 1L1OC 2KHJA 4DPGA 2YTVA 3TS2A 4BA2I 5M5WH 1I94Q 4DK3C 2YV5A 4UPAA 3U4VA 3AEVA 1PH8A 4A3MH 2UXBL 3F2BA 2JQOA 5IE8A 2JA8G 4IOAA 1OXTA 1K3RA 2JA9A 2K4KA 1RIPA 4OONA 3T1HQ 1XPOA 2NVXH 4LF5Q 1EIFA 2BA0A 1VQOA 1GVPA 4R4TA 4LF8Q 5BR8L 1IBKL 3CMAA 5HGQA 1MJCA 1SLJA 4AYBG 4YY3L 1Q8KA 2R7ZG 2R92G 1A8VA 2ALYB 4MTNA 4P74A 4JI0Q 4DV7L 5C44G 1LUZA 3M4OH 4BBSH 3I7FA 2B63H 1EUJA 4AIMA 4DUYQ 4ME3A 4UP9A 3CXCA 2FXQA 2CFMA 1Q82C 2PI2E 1I94L 3HOUG 5M3FH 1VQBA 1N32Q 2GVAA 5AJ3Q 4RG1A 4BBRH 1B70B 1UE7A 1RL2A 2K52A 1KC8C 1JJ2A 4LF5L 4A3DH 4JI8Q 4HIOA 3FHWA 5M5XH 2IX0A 1VQDA 4JI6L 4JOIC 2HT1A 2VUMG 2WAQG 1YHBA 3RZOH 1SN8A 1UE6A 2KCTA 3S1RH 3RLOA 1BBWA 1TWFH 3ERSX 1S72A 3M3YH 4IFDI 5LMNL 4B3TQ 4QIWE 4DUYL 5FLMH 1Q81C 1N36Q 1X65A 1LYLA 3PUZA 5JEAJ 3KLWA 3W1GA 5GADC 3RN2A 3FP9A 2JEAI 1NMGA 3NEMA 1N32L 1YVCA 2XTIA 3AFQA 2QA4A 3CP0A 5LMNW 3HOVH 4QQBX 2K50A 3TQYA 3RNUA 3B6YA 1HNZQ 5FLXc 5LMUQ 1EYGA 1HZ9A 4X64L 2GN5A 2LXJA 4JI8L 4B3ML 1NJIC 2CWAA 4GKJL 4BY7G 3CCMA 2AMCB 2PMZE 2JA5H 5C0XJ 5M5YH 4NB3A 4GNXC 5HY6A 1HNXQ 1M90C 4L5QA 1PH9A 2K5NA 3A5ZB 1VQ4A 4A4IA 1KD1C 4JCVE 4X6AH 1WCMG 4FDBA 5DLQE 1C9OA 3H0GG 4EX5A 2JJQA 4IJHA 4XTCS 3ZJYC 1HH2P 1UWVA 5M3MG 1YHAA 3HOWG 2OQKA 1HZCA 2MQHA 1SROA 1X3FA 2JK8A 4NXNQ 1VQGA 1Y1VG 2ZM6L 3FKIG 4QJFA 1KRTA 1KAWA 3U50C 4AYBE 1VQFA 2KBNA 1U5KA 1CSPA 1L2FA 5IYBH 2VZAA 1Q1BA 1NMFA 3J80c 3MXNB 1E1TA 1C7YA 1XMQQ 3HOZH 3PO2G 5C4XG 1XTDA 4GLXA 1JMCA 1IBMQ 1V43A 1JJGA 2ZJRA 4YCVA 4NXMQ 4JBKA 1QZGA 2UUBQ 4LW1A 1ASYA 3E9HA 3J7ZC 4DV1Q 2WAQE 4GOPA 2JE6I 5GQOA 2HIVA 2AKWB 1EQQA 1OXUA 1LTLA 1G291 3CC7A 2EQSA 2Y0SG 2JA7G 4QL5A 2VW9A 4DAYB 2ZJPA 4R1JA 4LFCQ 2ID0A 1Q12A 1XMQL 3DLLA 2PQAA 3NELA 3J81j 1HZAA 2KCMA 3CQZH 1SE8A 1IBML 4IJLA 1BVSA 2UUBL 1X3EA 4A3BG 2OQ0A 4IFDG 3CCSA 3I4NH 1J6QA 5ELOA 2BH8A 1VQ9A 3S16H 3PUXA 1IBLQ 1DGSA 3G6EA 3ULJA 4C2MH 4LF6Q 2NZOA 4DV0Q 1VCIA 3GTMH 4LFBL 3ER0A 4DUZQ 4GN4B 2QGQA 1XPRA 4APVA 4DR3Q 3PV0A 1NE3A 1PH4A 2A8VA 5IP9H 3CCVA 1YBYA 4X66Q 1WI5A 4IPCA 2PQAB 1KHIA 4BY1H 1TWHH 1PH2A 2HHHL 1YITA 2PI2A 2V1CC 5C3EH 2NVQH 4OO1I 3KF8B 2CWPA 4Y7NH 1UE1A 3S1QH 5IP7G 1K8GA 1T9HA 4LF6L 2YU9H 1XNQL 4R4IA 1N34L 1OXSC 1X55A 2CQOA 1Y1WG 4A3LG 4P75A 4BXXH 2A1AA 1M1KC 2UU9Q 4DR7L 2Q2IA 3TEHB 3J81c 4LUZA 3KOJA 3L7ZC 4DNIA 4JG2A 1WFQA 5IWAQ 2I0QA 1I6HH 3UDGA 1N33Q 2UUAL 1V1QA 2CKZB 3UDFA 3S17H 3PO3H 3ULLA 3OTOQ 1VQHA 3HOXH 1SRUA 2GVBA 2Z0SA 1PVOA 5IYCG 2Y0SE 2ATWA 1KL9A 2PNHA 1FL0A 2A19A 5FJ8G 1LM0A 2VQFQ 3RZDH 5IYDH 1PYSB 3JAMi 2K14A 4K0KQ 2R93H 2N78A 1VQPA 4L5TA 1K8AC 1UEBA 4R4CA 3J80i 4A3GH 4LF7Q 2UU9L 3M85A 1L0WA 3T1HL 3M4QA 4A3KH 1JE5A 1OXVA 2BA1A 2R7DA 1AE2A 3KJOA 3TREA 4A3FH 3CAMA 2NZHA 1PV4A 1IXRA 2DUDA 4LF8L 1UE5A 4A93H 4KHZA 1CUKA 4A3IG 4NPSA 1JJCB 4JI0L 1EIYB 2R6GA 1D8LA 1YHQA 4IPHA 2Q2UA 2KENA 2VQFL 3CPFA 4LNQA 3U58A 3CW2C 4PG3A 1TWGH 2L15A 4PMWA 2XGTA 3SGIA 4DK6C 1HNWQ 4YCWA 1B7YB 2UXCQ 1Q1EA 3RN5A 3PIPA 3UE1A 3RR5A 5AJ3L 2MO0A 1FJGQ 4MNOA 4DV6Q 4KI0A 3HOYH 3F2DA 3G4SA 3CC4A 3I4MG 2F3IA 1X6OA 5C0XI 1XNRQ 4B3RL 4A3CH 4GOPC 4POFA 3OW2A 4Y52H 2UUCQ 2RCNA 2UXDQ 4A3JG 3UDIA 4P71A 4DKAC 2E8GA 4HJAA 4B3TL 2K75A 4JBMA 2I5HA 4IOCA 3H3VH 1N36L 3D31A 3K0XA 1CKMA 4OO1G 3CCLA 1CKOA 1Z47A 4QY7A 1VQIA 4PZ8A 4A3EG 2JA6H 1A63A 2RF4A 1FJGL 4C3JH 1NY4A 3JAMc 4DV6L 1HNZL 3EN2A 2E2IH 5LMUL 2RHSB 3L0OA 2VL6A 2EIFA 2K5HA 1PH3A 4DV4Q 1NTGA 1WJJA 4DV3Q 4DR1Q 1G6PA 3NENA 4HJ7A 1E22A 1U0LA 2UUCL 4TVAB 4HJ5A 4PZ6A 4JV5Q 3CCUA 1HNXL 1EWIA 4AQYQ 2MFIA 2MO1A 3VDYA 4HJ9A 4A3MG 4EQ5A 2HQLA 2JA8H 4B3RQ 1G51A 4YCUA 4RMFA 2Q2TA 1K0RA 3GTGH 4DV5Q 4A76A 1HR0Q 2E5LQ 2VQEQ 3W1BA 3S2HH 1NBWA 4NXNL 1VQNA 3U4ZA 2CCZA 2E2HH 2R7ZH 1EQRA 2DGYA 3HOXG 2R92H 3J81i 1N8RC 4LF4Q 1K83H 5C44H 4DR6Q 4BBSG 2B63G 3CPWA 1X56A 1FVIA 2F52A 2AWNA 4R4OA 2KHIA 4OWXB 1MKHA 5EAYA 5M3FG 3W5OA 3CCRA 2R7FA 3TS0A 4L5SA 4NXML 4BBRG 4HJ8A 3PGZA 2NN6I 2IY5B 1CKNA 2WB1G 4A3DG 3F2CA 1ASZA 1TWCH 3HKZG 4DV1L 5JEAG 1HR0L 4DR2Q 2VUMH 1PA6A 1SMXA 4X65Q 4AH6A 1EFWA 5IY0A 1PH7A 5GAEC 2HIXA 3HKSA 4JI1Q 4JI7Q 3UDXA 4LF4L 1HR0W 2IHEA 4DR6L 4B3SQ 4LFCL 3JC66 5FLMG 5GROA 1OTCA 1XMOQ 4LF9Q 4JI5Q 5JJIA 5C0XG 3KYHC 2F4VQ 4O0AA 5ELNA 1VQ5A 1PFSA 3PSIA 1S40A 4JI3Q 3HOVG 3T1YQ 3OYYA 4IO9A 2ASBA 4LFAQ 3F8TA 4H02A 1QZHA 3E0EA 4BY7H 5GAHC 4DR2L 1PHJA 1Q7YC 2N3SA 3L2PA 1IBLL 4JBWA 2ZTCA 5J3BA 2JA5G 4BXXG 1CKNB 4JI1L 3PIOA 4DV0L 3ULPA 4C3IH 4WJ3M 2E2JH 3GTLH 1HJPA 4DUZL 1YNXA 4JI4Q 3ICEA 4YHHQ 4DR3L 4JYAQ 3CCQA 1WCMH 2C35B 5IT9c 1XMOL 3H0GH 1SR3A 5M3MH 1GM5A 3HOWH 3A5UA 4X66L 1J5EQ 1IBKQ 1Y1VH 3FKIH 4OXPA 3CCEA 3GTKH 3AYHB 5E7NA 1IYJB 1BBUA 5IYBG 1YI2A 1BKBA 4DV7Q 3AQQA 4DR5Q 1Z9FA 1H95A 4DR4Q 1VS0A 2D62A 4OX9Q 1B8AA 2WFWA 1P16A 3HOZG 1AE3A 4LWCA 3PO2H 2LSSA 3GD7A 1S3OA 4XIGS 5C4XH 1K9MC 1IZ6A 2NVYH 1W2BA 4JI4L 4YHHL 4A75A 2Z6KA 3KF6A 4JYAL 1KIXA 2YTYA 4DV2Q 1E1OA 1OXXK 1X54A 2WB1E 3I2ZA 3GTJH 5IWAL 2N49A 3HKZE 4POGA 4JI6Q 1N33L 1J5EL 3A74A 3STBC 4X62Q 3OTOL 3S15H 3MEFA 4O2DA 1VQAA 2B29A 4UP8A 2JA7H 4WJ4A 2YYZA 4OWWB 5LMNQ 4DR5L 2IX1A 2NN6G 4DR4L 4PZ7A 3BZKA 2VY3A 4OX9L 3BU2A 3H15A 2OWOA 4K0KL 1X9NA 1Y14B 5H1SE 4OWTB 2OTLA 3GDEA 3CD6A 5JJLA 3K81C 4JC0A 1YEZA 1TWAH 4KHPQ 4LF7L 1I3QH 1PH1A 1C0AA 3D0FA 3K8AA 1YJNA 4DV2L 1VQMA 4A3BH 4X64Q 1GD7A 4UP7A 4B3MQ 3I4NG 3TRZA 4GKJQ 1L1OA 3M4PA 1X3GA 2JEBI 3KF6B 2VNUD 4X62L 4LUOA 1TXYA 2H5XA 4KLKA 3PUVA 5JJKA 1A62A 1JT8A 2ZJQA 3GTPH 2I5MX 4YWLA 4ALPA 2MNAA 2ZTDA 5C4JH 1KRSA 4QGUA 1VQKA 1VQLA 1QUQA 4IFDJ 1Q86C 3RLFA 1VQCA 3PF5A 1VQ7A 1V9PA 5IP9G 1VQ8A 3K7UC 1HNWL 2UXCL 3EBEA 4HIDA 4KHPL 4JBJA 2D0OA 2N8NA 3PF4A 2IHFA 2ZM6Q 4GKKQ 4BY1G 3G71A 1WYDA 3H3VI 4DAMA 3CC2A 5C3EG 1XNRL 3E9IA 5IP7H 1A0IA 2B3GA 3GO5A 3PCOB 1SFOH 4L5RC 3KJPA 3GTQH 2UXDL 3F1ZA 2I5LX 3STBD 1L1OB 3RLNA 3I56A 3LGJA 1E7ZA 1Y1WH 3S14H 4A3LH 4C3HH 3S2DH 3HFZB 4YWMA 3K80C 1VQJA
chains in the Genus database with same CATH superfamily
4LUVA 2RVLA 1I5FA 3HG9A 4C2MA 1EQTA 3IN5A 4JOIA 1AH9A 1BO0A 1PH5A 2EYFA 1AZPA 2W70A 5J2TF 4DV0H 4YAKB 1SYEA 4DUZH 2ZTEA 1YJWA 3PUYA 1DXMA 2HJWA 2MPMA 3BZCA 3DM1A 2R93G 1WTQA 5BPFA 4GN5A 2PO4A 4J9MA 4AQYL 1TWHA 5JAVA 2VS1A 3I8ZA 4P72A 1EY8A 2C22A 1MI2A 5BN5A 4A3GG 4GS3A 4DV5L 3TINA 1YJ9A 1EYDA 1XPUA 5FOBB 1E4EB 4A93G 5KG1A 3MXGA 3J7AK 1I50H 1KJQA 3T5KA 2NVXA 1GO3E 3J7YW 5HBRB 1VQ6A 1RODA 1GUWA 3KDFA 1ZXTA 5C4ZA 4Q8EA 4BA1I 5IWAH 5KFBA 4RZRA 4FBUA 2RHQB 2JN4A 2Z6KC 4Q5VA 2DJFC 4UY8C 1B04A 4CC5A 3GIMA 1N33H 3I4OA 3GV6A 2HHHQ 2W6PA 3I12A 2Z1CA 5C3EB 1MJEA 3H6MA 4A3CG 4Y7NB 2IMWP 1GKHA 2WYOA 1KJIA 1VBGA 3G48A 4K0KH 1XNQQ 2YU9B 2R6FA 5KFUA 1PZJD 4LF9L 4GN3B 4JI5L 5KFWA 1PTOC 4DV2H 3K6OA 4GLAC 3CMEA 1KNEA 4JI2L 4EQPA 3M9BA 2UUAQ 4TQUS 1T5EA 4X62H 2JP1A 3PO3B 3S17B 4HIMA 3N52A 1TS4A 3MEHA 5HGTA 5H80A 5KRUA 3PIP3 3HBLA 4CDCC 1TWGA 3R3OA 1LTAD 2R7NA 2B2WA 1JDEA 3KHRA 3RZDB 3TS2A 2I07B 3JAME 1I94Q 4UCRA 4DK3C 3AEVA 2CW0D 1PH8A 4XYLB 1RYSA 4HCSA 3DF7A 3HP3A 3F2BA 3GQCA 2GA4B 2JQOA 4IOAA 2V4RA 2BQRA 3T1HQ 3FRPB 5DM63 1VQOA 5JPNC 3G7LA 1XNRH 1TS3A 1B6SA 3K58A 2R7ZG 3G6JB 1Q8KA 4YB8B 3OMCA 4P74A 2F4IA 4MTEA 2BQUA 2PI2E 3CRLC 3HOUG 1S10A 2LKVA 4N8FA 2IA6A 5AJ3Q 2KOLA 2K52A 2K7VA 1MD2D 4JI8Q 5DGAA 4DV4H 3X3NA 2VUMG 2VPQA 2BDNA 2FKLA 4J6HA 1I4PA 2FMMA 2DIKA 5EWEA 1SNOA 4J9NA 4IFDI 1RJPA 1HFGA 3U9SA 2VB3X 1N36Q 1X65A 1CA5A 3PUZA 3R23A 2XC9A 1S03G 2JEFA 2R92A 2E5LH 2XTIA 2QA4A 2BE5C 5KFLA 2K50A 2XVSA 4C3JB 4DN4M 3RNUA 1TS2A 1O7LA 2LXJA 4B3ML 4TUYF 1CI3M 5M9OA 3SE7A 2PMZB 5C0XJ 1NNXA 5M5YH 4ZCKA 1HNXQ 4JK1C 5D1PA 1SCUB 1TWCA 4JV2A 2NWGA 5DLQE 3JAML 3H0GG 2JJQA 2PW7A 3HOWG 4J9LA 1HZCA 1SROA 3SK4A 4XYOA 4X65H 1VQGA 2B39A 2ZM6L 3JAMW 1KAWA 3BVGA 2E2HB 4JI7H 1CSPA 3J81E 1K83B 1E1TA 4DU9A 3ORQA 5L1LA 2UVWA 1XTDA 3CU7A 4GLXA 1X32A 4NW2A 1FKAH 1A15A 1IBMQ 4XXEA 4ZQIA 4JBKA 1QZGA 3P7JA 4LFAH 5FPRA 2FLNA 2IP4A 5COYA 2AQ3B 1AN7A 2YU9A 2MUYA 2WAQB 5GQOA 3EVQA 4MV6A 4G3IA 1OXUA 2V58A 3QZ7A 3CC7A 1EY9A 3JZIA 5K2MA 5KG6A 4YIJA 2NN6H 2AQ1B 4RAUC 1FD7D 1XMQL 3NELA 2B8GA 3FKIA 1TAEA 2KCMA 3CQZH 2VOBA 2PW5A 4WJWA 2A69C 4EVOA 1JOOA 3I4NH 5ELOA 2BH8A 4IZOA 1UNSA 3S16H 4BY7B 3KALA 4DR5H 1IBLQ 4LF6Q 1II3A 1VCIA 4UCOA 1STBA 3VR5A 1I94H 2CHBD 3PQIA 2EPBA 3GTLB 3GTJA 5L1JA 4APVA 4DR3Q 3PV0A 3HXLA 4ZKCB 3R5XA 1WCMB 1LTTD 4CJ2C 4WRDA 3MXPA 1KDCA 4ZYSA 1E2ZA 4X66Q 1U9RA 2G5DA 5CGKA 3EFXD 3UQ8A 4BY1H 1Y1VB 1V1PB 3SI8A 2HHHL 1DV1A 3LMLA 1DD2A 2V1CC 3GTKB 4EGJA 2CWPA 4C5CA 3MFIA 4NLGA 3NQTA 1T9HA 1TWAA 5T14A 3Q8SB 1F9QA 3J81L 1PLFA 5JUMA 2B2VC 1XNQL 5C4XB 5KFEA 1OXSC 4ID6A 4DA2A 1Y1WG 2XCPA 2VA3A 4P75A 4KHPH 4C3HG 1KBLA 5JPMC 5ELEA 1K3BC 3Q23A 5IT9W 3RMHA 3TEHB 2CH4A 3J81W 4DNIA 4X64H 4JI8H 2I0QA 3UDGA 2XGPA 1BCPB 2UUAL 4QIWA 1IHZA 2X6LA 2UVRA 1WTVA 1SRUA 2Z0SA 2Y0SB 4L63B 2JA7B 1KL9A 2PNHA 3WNZA 4IZ8A 1JX4A 2A19A 2VQFQ 2D9UA 2V4DA 5KG3A 5DG7A 1CTMA 1FNWA 4I7AA 3UFXB 2PMZA 2UU9L 4GKKH 3T1HL 2R7DA 2MHVA 3IAYA 4B3RQ 2XGQA 1R4PB 2OF1A 1VMPA 1HQRD 2XRSD 3R2TA 4KHZA 3Q0AA 4NPSA 1T94A 4UCUA 1D8LA 4IN3A 3KTMA 2V4QA 3CPFA 3L4JA 3SXHA 2E2HA 2XD4A 3U58A 3CW2C 4NMZA 4O1NA 1O7YA 4HR7A 3C46A 1HNWQ 1Q1EA 3RN5A 1I7LA 1K83A 1F77A 5AJ3L 1IL8A 4KI0A 3HOYH 3BDCA 3CC4A 1CZGA 1RJRA 2F3IA 5KEEA 4GOPC 4O3SA 5ELCA 2A74C 2RCNA 1LTRD 5CV6A 1SFOB 2FJZA 4ECTA 4R7RA 4DKAC 1TIID 2ZXPA 5LP6F 5FD6A 4OGQC 1N36L 3D31A 2WAQA 1IBMH 1ZQ7A 3K5HA 1Q8IA 1PMRA 4U673 4A3EG 3KUPA 4A2AA 4ODGA 1SYDA 2C00A 1TKWB 3KK7A 3J7AF 1NTGA 4K6LA 3V6KA 3R93A 3KHLA 2W6NA 4PZ6A 4JV5Q 5JH7F 1HNXL 1EWIA 2MO1A 4KY6A 4OEMB 4HJ9A 1F2YA 3VDYA 4A3MG 2M05A 5F9LA 5I9PA 4YCUA 4QB4A 4RMFA 5EWGA 3M9NB 2Q2TA 1EUDB 1UEAB 5AFWA 3Q1KA 3GV8B 2VQEQ 3GTLA 1NBWA 4ECXA 3U4ZA 3HRZC 1B1ZA 3HOXG 1GSOA 1WCMA 3HGBA 4K5XA 2F0VA 4LF4Q 2WV6D 4M8AA 5C44H 2A6EC 3D4WA 4FNFA 2UXBH 4YBZB 3TMEA 1Y1VA 4OWXB 1FVIA 2EXZA 1HFNA 3GTKA 1MKHA 5FK9C 3MWMA 4IHJF 2R7FA 1WTXA 4HSVA 3MC0B 5BR8H 1L0YB 2NVTB 2NN6I 3BG5A 1CKNA 3DEOA 4A3DG 2F0EA 1ASZA 2F1MA 5JEAG 1HR0L 1ET9A 3KHHA 2PNRC 3DMUA 3RB0A 3K7AB 4HNUA 4R8IA 1SE2A 3UDXA 4A3JB 1HR0W 2IHEA 1PRTD 4B3SQ 5C6AA 3JC66 2J6UA 1Y8PB 3WOEA 1JOQA 1LT3D 1DZ1A 1ILQA 5JJIA 3OSPA 2CW7A 2F4VQ 2V9WA 4O0AA 2RGRA 3PSIA 4JI3Q 2Y0SA 4UHVA 1N48A 3T1YQ 2ASBA 4IO9A 4LF8H 1KDAA 3OSNA 2VQDA 3E0EA 3RAXA 3TP5A 3GV3A 2R8GA 2SOBA 1IBLL 4JBWA 3MVVA 2VQFH 1TS5A 2KECA 4JI1L 5KNCA 1LT6D 4C3IH 3PIOA 3K5LA 3CVZA 3OIPA 1S0MA 4JI4Q 3MJFA 4YHHQ 4DR3L 4QWDA 2IW3A 4JYAQ 5L9XA 4ECZA 5C4HA 3WDNA 5L37A 4APMA 5CV7A 5M3MH 1GM5A 3A5UA 1JKJB 4X66L 1JLLB 4B3RH 2FPPB 3BDLA 1IBKQ 3CCEA 2RDGA 3KXYT 1W6JA 2PPBC 1STAA 2F0NA 5IYBG 4DV7Q 1G2TA 4BBSB 1B8AA 3DHQA 1NUCA 5JVDF 2F0TA 1XXGA 4IURA 2EZVA 1K9MC 1QOHA 3PO2H 2X0SA 3RIZA 1IZ6A 5M3FB 4A75A 3KF6A 3VYUA 4BBRB 2YTYA 5LMUH 1X54A 3PMFA 2UVUA 4ZKBB 1ML0D 3HKZB 1WH2A 3D3RA 3QOJA 4JI6Q 3BYTB 4N9TA 3S1RB 1SNCA 3GLKA 1JWMD 5LMNQ 1ZEQX 4DR4L 3BZKA 4OX9L 1DIKA 3BU2A 3GIDA 1L0XB 3LP8A 5KGUA 1Y14B 2O5JC 1RK5A 3K81C 4JC0A 1CQJB 1EQVA 4NXNH 3HOVB 3BA8A 4LJZC 3R5HA 3I70A 1VQMA 1NAPA 4A3BH 4DK1A 2LY7A 5L1KA 1C30A 4GKJQ 3M4PA 3A55A 2W9AA 4IRCA 2K5DA 3GTPH 5LXTF 4YWLA 4ALPA 2JEIA 3NK9A 4K6DA 4ZUIA 2YS6A 1KDBA 3PF5A 5IP9G 3K7UC 3C0FB 1HNWL 4KD3A 2W6MA 3KBXA 2IHFA 3G71A 1WYDA 4DAMA 4F8MA 5C3EG 5JQWA 1GUNA 5IP7H 2B3GA 2K03A 3CQZA 4LFCH 3GTQH 2ZT9C 3F1ZA 4A3LH 1E7ZA 2A73B 4KKTA 3S2DH 4EBDA 1I6VC 1AN8A 3NTHA 4YWMA 4ED1A 1M6VA 1ET6A 1J9OA 3PUWA 4DXGA 5JJZA 1QVGA 1RKNA 4BS9A 1WTRA 1K0SA 3PO3G 3QZ8A 1YZ6A 1W93A 1LV9A 2EVBA 1XJVA 3OUUA 4J15A 2EXDA 4J0MA 1WTPA 5FJ8H 5IYDG 3NBHB 2ZJTA 3J7A5 2IBKA 4JV5L 2QEXA 2LS01 1IL2A 2OCEA 2J6SA 5KFSA 1FGBD 3CRKC 5ELBA 4RNOA 2VR1A 2K32A 1QE6A 1N9WA 3TIIA 3SK6A 1PH6A 4RFBA 3V4SA 1P8LA 4K2KA 2VQEL 4FP5D 1C8CA 4MHEA 5KT7A 3DM3A 1SNDA 2QKIC 1KXLA 2YZMA 4IUNA 4A3IH 3EROA 2BE5D 4C2MB 3KFUA 3S1MB 5DG9A 1O7ZA 3FMAA 2SNMA 4YHHH 4JV0A 1R9TH 2W8KA 2OLSA 4JI2Q 3DWQA 2GPSA 4RNNA 2FE3A 1ZYRC 3I4MH 1TWHB 3RB4A 1A2UA 1EOVA 1MIUA 5DEHA 2NBFA 5LL6X 1RYRA 3AFPA 4HN7A 3DWPA 4N8X1 1FGUA 3RV3A 5FLXE 5E4WC 1N34Q 1IKLA 4B3SL 4P73A 1HUMA 4R4QA 5IODA 1W96A 4KKUA 4DNTB 3WWVA 2F4VL 1U4PA 4JI3L 1CHPD 1KABA 4C3JG 4N9PA 3T1YL 2YTXA 1I6HB 2R7KA 3KDFB 1I6UA 3S24A 2D0PA 1KQSA 2M00A 3HOXB 1H9SB 5KFPA 2FFKB 2AQ2B 1JB3A 3U4VA 2KA7A 2EY1A 2JA8G 2YS7A 1OXTA 3C3LA 1RIPA 3RGZA 1GVPA 4R4TA 4A3KB 4A3FB 1IBKL 3BQ1A 3CMAA 4PMCA 3FDSA 2UUCH 4YY3L 3PR5B 4K8IA 2HGSA 2EE1A 4YR2A 2ALYB 3ONAB 4JI0Q 4JPBW 2LMCB 4DV7L 1ENAA 2F0WA 4JW0A 3I7FA 2B63H 1EUJA 1IKMA 4RGMA 3CXCA 2HVRA 1F9SA 1YNJC 1TWGB 2L0CA 4K14A 1PFBA 4RG1A 1UE7A 1JJ2A 1OWTA 1HTPA 2R3ZA 5DQHA 3PZPA 3NE5B 4ME6A 4JI6L 4JOIC 2WAQG 1YHBA 1D6EC 4Q0YA 4FXDA 3DWAA 4TQSA 2OXPA 4L6TB 1BBWA 3RLOA 2JSOA 3IG0A 3ERSX 5I2XA 1ENFA 1S72A 1Q3LA 3M3YH 4AQYH 5LMNL 1LT5D 4QIWE 2A6HC 1Q81C 1GHKA 2RQXA 1E2WA 5FLXL 5JEAJ 5C0XH 2A68C 3TSSA 1I7NA 3FP9A 2W6QA 4DV5H 1EZ8A 1N32L 3NEMA 3T4AC 3HS0C 4OIJA 5LMNW 2JA6B 1PK8A 3OHAA 4S3SA 3IL8A 3TQYA 1HNZQ 5KFKA 1HZ9A 1NSNS 1GUGA 2R84A 1NJIC 4GKJL 4BY7G 4DGZA 2AMCB 2PMZE 2JA5H 1GYFA 2CZGA 2NTSA 1SBBB 2J7ZA 2IPKD 1EY0A 2DPJA 1M90C 4L5QA 3A5ZB 1KD1C 1WCMG 4FDBA 1XX8A 3CKIB 1RDPD 4EX5A 4Q44A 4IJHA 4XTCS 2AGOA 4LAAA 5IYZF 4IAJA 1WVLA 5FO9B 4DR2H 4ED0A 2W6OA 2PZWA 1Y1VG 1A2TA 4O4LF 2R82A 3U50C 1Y8NB 5CBAE 1L2FA 5IGGA 2R92B 4RB0A 1Q1BA 3G8CA 4NP5A 3J80c 5J22A 3Q8RB 1XMQQ 3HOZH 4LF9H 4JI5H 1SE4A 5C4XG 1BR9A 1ICWA 3ETHA 2FJ2A 1MSGA 3VA5A 4JI2H 2B2YA 4NXMQ 1JR0D 3ERQA 5KG5A 4XT3B 5KFIA 4DV1Q 1TWCB 1LO5D 2FINB 2WAQE 2EOTA 2EYLA 5KYLA 1EQQA 4RZQA 1G8ZD 1G291 2Y0SG 2JA7G 2H4OA 4QL5A 2ZJPA 1DV2A 1M7JA 2FK2A 4O2BF 3L3OC 2QK4A 2ID0A 3L4KA 2B2WC 5EWFA 2PQAA 4MN3A 2MGSA 2YL2A 1H9SA 1TT2A 1AUVA 2FHTA 4IJLA 2CH4W 1V8QA 4X3UA 3RV4A 2UUBL 4RHSA 2X69A 3OHXC 1VQ9A 5KG2A 3G6YA 2B2TC 3BZDB 4RB2C 2ASLA 3GTMH 3ER0A 2F0HA 4DAPA 5CA0F 3ITPA 1GJXA 3K5OA 4C5AA 1PH4A 3CCVA 1YBYA 3W3AA 1BJTA 1R4QB 1STYA 1V1OA 3FKIB 3MXUA 5BPHA 2NVQH 1LTID 4IQZA 3KF8B 3S1QH 4PWQA 1UE1A 3VMMA 1NR2A 1VKZA 1F2ZA 4YR3A 1QB5D 3RZOB 4EQNA 1N34L 4R8UA 1X55A 2NVYB 3Q22A 4EYHB 2UU9Q 2A6ED 2Q2IA 4I65A 3HZXA 2TSSA 4JG2A 4B3MH 3GTJB 4I4TF 4MV3A 5I6YA 2F03A 3OSOA 2B2TA 5EPLA 5I47A 3OTOQ 1VQHA 5KT5A 2RDJA 2UVVA 5IYCG 3N43B 2Y0SE 3SE0A 2JA6A 3A54A 1DOKA 4KJOA 4TV9F 2R93H 1MHWC 2N78A 3I3CA 2AQ4A 4RCOA 1UEBA 3J80i 5KNDA 1TWAB 4LF7Q 4A3GH 5KFJA 2ZM6H 1I3QB 1L0WA 1IOWA 1MBYA 3VR2A 1AZQA 3VYTA 1PV4A 1AE2A 3TREA 3CAMA 1IXRA 2DUDA 5GONF 3H4BA 3MAQA 4DXFA 4A93H 4ETSA 2KUMA 5EDWA 4ED7A 4Q0FA 1RK6A 4JI0L 4IALA 1GSAA 3VA7A 4QIWB 4IPHA 3AU7A 3VR6A 2Q2UA 4HQ6A 4DL7A 4LNQA 2M2LA 3NUCA 2NU6B 4DK6C 2L11A 1STHA 2UXCQ 3PIPA 3UE1A 3RR5A 1JC7A 2MO0A 2PZTA 4QMGA 4ZOLF 5CB4F 3F2DA 1EYAA 4CKEA 2VPSA 4KY7A 5FPOA 5CBEE 5C0XI 4A3CH 3LX0A 4POFA 3N42B 1EOTA 1C4QA 2UXDQ 1U4RA 4A3JG 5KFYA 4HJAA 4JBMA 4BWSC 5KIXA 3JSNA 2XN9C 4Q43A 2JA8B 3RGXA 1CKMA 4OO1G 4C5BA 2KHSA 1Z47A 2NYZD 2IX3A 4NKLA 4IUTA 1FJGL 3I91A 1HXYD 3V4ZA 1HNZL 3NGDA 4DV6L 5KFXA 4RCNA 2E2IH 2AU0A 2RHSB 5LA6F 2EIFA 2K5HA 2B2UA 4HR7B 5IT9E 4DV3Q 3N6XA 4DR1Q 4UCVA 1E22A 4KY5A 1M0WA 1EEFD 5IOCA 1ZHSA 1SEIA 2EY2A 2HQLA 4ECQA 4LSAA 4OIKA 3GTGH 2HHHH 1O80A 2ZDHA 5C5LA 4A76A 1HR0Q 1SJED 3V6JA 3S2HH 2CCZA 2R7ZH 5DGBA 2K04A 3RBEA 2J0TD 5EBDA 4ZHQF 1B33N 2PYKA 1I50B 5DAUA 1XNQH 4E6IA 4BBSG 5KT2A 3W2DA 1CM9A 2R61A 4EQOA 2NZ1D 3CPWA 4GC6A 3HOUH 3M7NA 2AWNA 2E75C 5M3FG 4DFAA 3CCRA 3MWDA 3KF8A 2ALZA 4NXML 4BBRG 2UUAH 3H20A 2IY5B 3URYA 3F2CA 3HKZG 3NHHA 1VAJA 4DV1L 3SEBA 2VUMH 4AH6A 2NVYA 1PH7A 3H3VC 5GAEC 4JI1Q 3HKSA 1B3AA 3GP7A 1A3TA 1EWCA 2HCCA 5D1OB 5FLMG 1OTCA 3T1HH 3E5SA 1VQ5A 1S40A 1N56A 1IW7C 3HOVG 1EHIA 3Q24A 1Q90A 2PBZA 1QZHA 3SDZA 3V2TA 2V59A 1PHJA 1BUVT 1Q7YC 3L2PA 5J3BA 2ZTCA 1D5MC 1CKNB 5IT9L 4X3KA 1I3QA 3ULPA 2E2JH 2W9BB 2WB1A 2JEGA 1GUSA 3ICEA 1WSCA 5KFFA 3MWYW 1XMOL 2D5DA 3H0GH 4LH7A 3HOWH 4KV6A 3U9TA 1W6KA 1B9NA 3RBDA 2ASDA 4OXPA 3AYHB 4KJNA 5E7NA 2K5QA 5C3WA 3AQQA 4JV1A 1H95A 4RB3C 4DR4Q 1N36H 4OX9Q 2DLNA 2LSSA 1CHQD 4XIGS 1D2BA 1PFMA 1GGOA 4M9UA 4QCLA 2I80A 4EEQA 1QG7A 5LL6S 2QILA 3J7AV 2WTFA 2JA5A 1OXXK 1AEXA 3ND8A 2C28A 3HKZE 1CQIB 1J5EL 3STBC 2EYHA 5A2QW 3OTOL 3T51B 3S15H 1DOLA 5KKNB 1ZYRD 4RAYA 4F7XA 1HNXH 2MJ8A 3P1HA 4DR5L 4RUCA 3QOLA 4PZ7A 2VY3A 3H15A 1SYXB 1QILA 3CD6A 5BN4A 5KFOA 4RNMA 2BCOA 4LF7L 1C0AA 3K8AA 3P20A 4UFZA 1L1OA 1X3GA 1B4OA 2JEBI 1GUOA 2XIWA 3KF6B 2H5XA 1S5CD 1NCVA 5M5YB 1A62A 4ZRZA 5C1PA 2F0FA 2ZTDA 5C4JH 4QGUA 3TBIB 1VQLA 1QUQA 5J39A 1KC7A 1VBHA 3RLFA 1VQCA 1VQ8A 3MR2A 2UXCL 1I50A 4KHPL 4JBJA 1BF4A 2N8NA 4QWAA 2KSWA 4LMQD 4O3PA 2L5TA 3E9IA 3T13A 4X3TA 2K33A 3GO5A 3PCOB 4FYDA 4L5RC 2UXDL 2I5LX 1Y1WH 3S14H 1S0OA 4C3HH 1BCPC 4BXXG 3K80C 3G6VA 1JE4A 3IRBA 3BJYA 2X6GA 2OTJA 2KCCA 4J1MA 4NDXA 4IWXA 5D1OA 4GKKL 1X3QA 5CV9A 3FDTA 1S0NA 4F4WA 1IBLH 4LF6H 1D1KA 4EGQA 4DV3L 1SMYC 2EY6A 4DR1L 5KG4A 3LWBA 2BH2A 1K28A 3IFTA 4DR3H 2FP4B 4TRDA 5KFHA 3T5HA 4X66H 3CQZB 4Z9CB 1E3PA 2W6ZA 2F0PA 3T5JA 5FO7B 2A6HD 4GLVB 3BQ0A 3VR3A 2W9BA 4A3KG 1YNND 4A3FG 1U4MA 3ND9A 4K2LA 3I4NB 2A68D 2FLPA 3S16B 3M9OB 2W9CA 4GNXA 3NWTA 5KFRA 1BBXC 4LFBQ 4RUAA 5ELFA 1A9XA 3GIKA 1QVCA 4KHVA 2LFNA 5I6WA 3GTOH 5DLGA 1HPCA 2RDFA 1D7QA 1F9PA 3Q8DA 5BMVF 4YQWA 4XQQA 4FF3A 2WP8J 1QVFA 5KFMA 3K59A 4BY1B 1ZKOA 3U9OA 4L8JA 2ASJA 4IR1A 3S1NH 2NB0A 2ENBA 4DR4H 2R8HA 3BVZA 3S1MH 4OX9H 4J9RA 2C2DA 4IRKA 1SNPA 2W9CB 4IPGA 1ESRA 1KJ9A 2XCAA 5K36G 3EIVA 2K05A 4DR7Q 1TA8A 2BDOA 4A3EH 2JA6G 2LXKA 3PW7A 4XQJA 2Z4HA 5ISRA 1RD9D 1T3NA 1HCZA 4EBCA 2R85A 4YY3Q 3NWSA 1EIHA 4OHJA 2KHJA 5EPKA 4ZLTF 1GLVA 2GPWA 4DPGA 4G57A 1CS0A 2F3VA 4YAJB 4B9XA 5M5WH 2YV5A 2DPIA 1HNWH 4A3MH 1C48A 5JVG3 4FF2A 2UXBL 3K5IA 2K4KA 4OONA 1XPOA 2NVXH 2R7MA 4E4TA 1EIFA 2BA0A 1S4ZA 4FM9A 1AUXA 3NTKA 5BR8L 4F87A 2F0QA 1XTCD 4FS2A 4M1UB 2R92G 2L4NA 1SEBD 1EIGA 2ICIA 3M4OH 4QUCA 4ME3A 4U6PA 2FXQA 2RKSA 2OH2A 2CFMA 4Q45A 2W57A 2W7PA 1VQBA 1N32Q 2GVAA 2O2LD 2WACA 2PQEA 1X3PA 1B70B 4L1KA 1KC8C 3HOYB 4LF5L 5DM73 4A3DH 4MV9A 4HIOA 3FHWA 5M5XH 2DN8A 5JEAH 1CE8A 1PTOD 2HT1A 5KYIA 5F9NA 1UE6A 5DG8A 5CC4A 3MFGA 4EFEA 1TWFH 4K5VA 4JV5H 4XT1B 5KNBA 3QJYA 3PR4A 4I55F 2F0SA 4B3TQ 3C1FA 4HMIA 5KFCA 4UCSA 2BR0A 4X3SA 4DUYL 2F0DA 3KLWA 5KFGA 5GADC 3RN2A 1NMGA 3K0YA 3AFQA 2VQEH 1LTBD 4ED8A 3B6YA 4RH6A 2CWAA 2RGVA 4LF4H 2Q8RE 4J9QA 4CDEC 5F2DA 4HAEA 5HY6A 1AP0A 2O5IC 4EEYA 1PX2A 4MIUA 1VQ4A 2E2DC 4OELB 4A4IA 4JCVE 4HSPA 2HDLA 5D3IB 1RF2D 5CORA 1YHAA 2MQHA 1PZID 1SXTA 1X3FA 2JK8A 1PTOH 1I4HA 1LTGD 1VMCA 2EYOA 3FKIG 4CGYB 4AYBB 1VQFA 4DAVA 1U5KA 5IYBH 2VZAA 1NMFA 3GIQA 5C44B 4B3SH 3QFFA 1S9FA 1B53A 3V96A 2F4VH 4JI3H 2RBMA 1JJGA 3T1YH 2XWJB 2UUBQ 1ASYA 3E9HA 5LYJF 1STNA 3JSLA 2FMCA 1Z2PX 1EU3A 2PCFB 4MV1A 5TSSA 2HIVA 4ZQ3A 3OPOA 3WO1A 5K5PA 2CQYA 2FLLA 3M7GA 2VW9A 4DAYB 1CA6A 4JI4H 1B3QA 3TP8A 4JYAH 3Q8PB 1VDZA 1SE8A 2XCLA 1IBKH 1HTLD 4TV8F 4IFDG 4IR9A 3CCSA 4WORA 3E3XA 4DV7H 4LMYA 3KLSA 2RDIA 1DGSA 4CHTB 2NZOA 3H09A 4DV0Q 2DNCA 4LFBL 1RCVD 2FPIB 4C3IB 4DUZQ 4GN4B 2W71A 1STEA 5JVH3 1G91A 3D6WA 4DL3A 1NE3A 1LT4D 4KN7C 5IP9H 3R8BA 1E4FT 2HCIA 5M3MB 4JI6H 1WI5A 4IPCA 3N41B 2PQAB 1KHIA 1PH2A 3LWEA 1YITA 1BXRA 5C3EH 5CA1F 4Y7NH 4J9OA 2EYMA 5LMNH 1LABA 1AFPA 1PRTF 1PRTB 5LHY1 3PO2B 2YU9H 2DWCA 2DZDA 2R8JA 1ONLA 3OMGA 1EZ6A 3RUPA 2A1AA 3GIIA 2JXMB 1M1KC 4DR7L 3J81c 1LTSD 4LUZA 3D4RA 1WFQA 5IWAQ 4GKJH 1N33Q 1V1QA 1SE3A 3PO3H 3S17H 4CJ0B 3C2PA 2GVBA 1PVOA 1GHJA 1STGA 2A69D 4O3QA 4O3OA 3V6HA 5IYDH 3RZDH 4QWEA 1PYSB 3JAMi 3OWEB 4K0KQ 3QIAA 1EY7A 1VQPA 4QUFA 4DF7A 5D14A 1K8AC 1Z2NX 1H9JA 4OL7A 4R4CA 1HUNA 3FVQA 2YCHA 5HV6A 3M85A 2QDLA 3VYRA 3GIPA 2ATLA 4A3BB 4R8UB 3K5MA 1OXVA 3KJOA 2BA1A 1UAPA 3K3PA 4ECYA 2HUGA 2N88A 4MAMA 2NZHA 5IGCA 4V0BA 3O13A 3ZYYX 1CUKA 5NUCA 2DY7A 1JJCB 3GTPB 2NU7B 1QJOA 1YHQA 1MSHA 1RTNA 2KENA 2ICEC 4EGVA 5KFQA 2HD3A 4R9WA 2QEJC 4AYBA 4PG3A 3SGIA 3MR5A 1EY4A 4YCWA 1B7YB 2B2YC 1FJGQ 1BGWA 3CHBD 4DV6Q 4G7HC 5EQ0A 3TN2A 1XNRQ 5KT3A 1TQOA 4RGOS 4LSXA 3BABA 3TQ1A 2YZGA 3SVMA 3GTQB 2Q8TA 3EJIA 3H91A 2E8GA 4B3TL 2K75A 2NTTA 2I5HA 3H3VH 1PZKD 1M4VA 3S2DB 2R87A 2M9VA 3CCLA 1CKOA 2UUBH 1JCKB 1VQIA 2K1BA 2L9HA 4HNTA 2F0IA 1Z6HA 4C3JH 4DAYA 1T36A 5EKIA 1PTOF 1NY4A 2K01A 3QR8A 3EN2A 3KLSX 3L0OA 2VL6A 3Q2OA 1L2ZA 1PH3A 4DV4Q 3GTOA 2MP1A 1WJJA 1Z7TA 1SNQA 2E74C 3FEWX 4HMJA 3NENA 3T53B 4KN4C 4HJ7A 1FR3A 1SNMA 1U0LA 2UUCL 4TVAB 4BWGB 3CCUA 3H40A 4IWYA 4EQ5A 1ZHQA 1ILPA 2JA8H 1G51A 1G6ZA 3F8NA 2CVRA 3EYYA 2E5LQ 2PVPA 3A8IE 2E2HH 1EQRA 2NUAB 1EL0A 1EZ1A 3NPPA 4MV4A 4A3IB 3DUZA 4FO2A 3J81i 1N8RC 1K83H 1E4GT 3A8JE 1N34H 4RA8A 5A35A 2O4XA 4ILWA 4O3RA 2F52A 4R4OA 2FB9A 2KHIA 4QWCA 5EAYA 1R9TB 4J9SA 1WD1A 1WD0A 2TMPA 3N44B 3LWUA 3I4MB 4RKLA 1SMXA 4X65Q 2YZNA 2R8KA 1RJTA 2HIXA 2XNAC 3E6ZX 3QG1A 1A3VA 4JI7Q 3HB9A 3WO0A 1KTKA 1BNZA 1SYCA 4DR6L 2K5WA 2FK3A 4U68A 3TIGA 3VPCA 3KHGA 1XMOQ 3NSWA 5CYUA 5ELNA 1PFSA 2NU9B 1JIHA 4RGTA 3BYYB 4LFAQ 1BCPD 3NQIA 4BY7H 4JI0H 4DR2L 3RB6A 4CJ1B 1ULZA 1IYVA 4DV0L 2JEJA 3R5FA 3BS1A 5G3LD 4DUZL 3GTLH 4I50F 2OT2A 1SDFA 3HEJA 5I4DA 1Y69U 1SMYD 4ED3A 1WCMH 1HHVA 2C35B 3M4IA 3BQ2A 2XSCA 2IWHA 3UI2A 1TWFA 4FU0A 1SYGA 3GTPA 2F0KA 1IYUA 1J5EQ 1Y1VH 2QYZA 2HVQA 3S9WA 3H4DA 3FMCA 3GTKH 2ZXRA 5EBCA 4XX0B 1EWHA 1JORA 4DR5Q 1HQMC 2AGQA 2D62A 2B63B 1UC8A 3EPIA 2WFWA 3P75A 1P16A 1AE3A 2RDHA 3KAKA 3GD7A 5C4XH 1DOMA 4IUVA 1ICFB 2WKCA 3VPBA 2HVSA 1FJGH 3MWEA 2Z6KA 5DQGA 1HNZH 4DL2A 2RCFA 1KIXA 2NUCA 4DV6H 2WB1B 4POGA 5IWAL 2N49A 2QW7A 3GTQA 2XIGA 3VYSA 1N33L 3A74A 3BVMA 4HEDA 4EYIB 2YRXA 3F2UA 5CAEB 2W7OA 2B2UC 5CV4A 4F4XA 4O2DA 1VQAA 4UP8A 2JA7H 2YYZA 4OWWB 3M3YB 1DJRD 4B9WA 2NN6G 2K28A 3X3MA 3RFCA 2OWOA 4K0KL 1BOSA 4MA5A 4RB1A 2OTLA 3GDEA 5JJLA 5FD5A 4KHPQ 1YEZA 2XRQD 3E5NA 1PH1A 3D0FA 1YJNA 2I46A 2WINB 4DV2L 3TP6A 4X64Q 1GD7A 2OEOA 5KFDA 3I4NG 5DNFA 3T16A 2SCUB 1ZETA 1E0BA 4X62L 3MHBA 1TXYA 2JA5B 1XMQH 4ED6A 5JJKA 4LK1C 4C1NK 1GXDC 2ZJQA 2I5MX 2MNAA 3QO2A 2C5CA 1A6XA 4IFDJ 2SDFA 4NXMH 3A8KE 1V9PA 2C2RA 1RHPA 4JVZA 4DV1H 1H9RA 3DXJC 2DY8A 4J9KA 2D0OA 4ZI7F 1TVXA 4GKKQ 4BY1G 2QF7A 3H3VI 4YJ3F 2L55A 5KG0A 1HA5A 1KEEA 3DEPA 1CT1D 3CC2A 4F4ZA 4EBEA 4IUUA 4UDUC 1XNRL 5EZYF 1R9TA 1A0IA 1SFOH 3KJPA 3HOZB 1K8OA 1L1OB 3I56A 5CV5A 3K3VA 4R8NA 3HFZB 1VQJA 1QNKA 5JOBA 1E4EA 3BA9A 3EA6A 1SYBA 1PYBA 4XYQA 4EFBA 1QUQB 1WOCA 1HZBA 5J1ZA 3RUZA 2KJXA 2K5VA 4DV4L 5IYCH 2KEEA 3CF5A 1O7IA 1Y8OB 2G9HD 5D65A 3PW4A 1XMOH 5A2QE 3A0JA 5KG7A 4IUQA 1PYWD 2AWOA 1EEID 3BJUA 3K57A 1D1IA 4TQRA 1VF7A 1NR4A 4PNYA 1M0TA 5FO8B 1IOVA 2E5LL 1FYCA 3AB9A 3UE0A 2D2CC 2IT1A 1E24A 2DNEA 1Q46A 1VQEA 1CSQA 4YWKA 3GTMB 3T5LA 3RAQA 5EOYA 3GV5B 1KLGD 4I7ZC 4PDBA 5C3XA 2UU9H 1TY0A 4F88A 2CW8A 3GV7B 3I90A 5E4XA 2AUKA 2E76C 2NVTH 4XYMB 1J5EH 2F0LA 3HOYG 4U7CA 4DK0A 2B63A 3OTOH 4HIKA 2R86A 4UAIA 2Q2HA 2NVQB 4X65L 2AHOB 3MA2B 4YR0A 3S1QB 3K7AH 3Q6SA 4MZ9A 2A5HA 4DNRB 1YIJA 4IUPA 4A3JH 4JI7L 4QWBA 4QW9A 1MZBA 1CQFA 3D8GA 4GOPB 1W3SA 2UXBQ 3H94A 4ULLA 2B8FA 3SR1A 4CBVA 4GNXB 2ES2A 1T5XD 1JWSD 4OO1H 1O75A 2YYAA 3CCJA 4LF7H 1JB7A 1EU4A 3SK5A 4HTHA 4FF1A 5BR8Q 2VXWA 1A3UA 4LFAL 4FBTA 3QB3A 5GAGC 2F0MA 3I55A 2FK1A 3MR3A 1K73C 3R2IA 4IPDA 1BQQT 1L1OC 3N6RA 3I72A 4PV1C 2ZDGA 2YTVA 5CR3A 4BA2I 1I4RA 1EUCB 2R93B 4UPAA 4J9PA 1QCBD 4CKCA 4XDXA 2UXCH 2HQEA 5IE8A 3D6CA 3I4LA 3WOFA 5A2QL 1DYQA 1K3RA 2JA9A 3J80E 1B9MA 4A3GB 4LF5Q 1RTOA 3C1EA 1BCPF 1SSOA 4LF8Q 5HGQA 1MJCA 1SLJA 4PMBA 4TSSA 4AYBG 4A93B 3PN1A 2UXDH 5LOVF 1A8VA 5IGEA 4IRDA 1QNUA 4MTNA 5C44G 1LUZA 5G3LF 4BBSH 4AIMA 1H9MA 4DUYQ 4UP9A 1Q82C 2I87A 5BN3A 1I94L 5M3FH 4BBRH 2F0OA 1CK1A 4ECWA 1RL2A 1K8MA 5HURA 2IX0A 1VQDA 4G7ZC 4O4IF 4DV3H 4KK7A 4DR1H 4DL6A 5IGBA 1FNVA 1SN8A 2KCTA 1D5XC 1EFID 3S1RH 2B2VA 3OUZA 5FLMH 1EYCA 1LYLA 5ELDA 3W1GA 4KTAA 3A56A 2J6TA 1EYZA 1HR0H 1YVCA 3CP0A 3HOVH 4QQBX 2IJ0A 2KVMA 4F50A 5FLXc 5LMUQ 1EYGA 2E2IB 3NTIA 4X64L 2GN5A 4JI8L 2J9GA 2WKDA 1FNUA 1G2SA 2H1EA 3CCMA 4Y8VB 2QCPX 1BXTA 2VB2X 4H44C 4NB3A 4GNXC 3RB3A 4O3NA 4C3IG 4B08A 4TKOB 2G9DA 1PDQA 1I4GA 1KAAA 1F2MA 2K5NA 4RWSC 1PH9A 1B50A 2EY5A 4X6AH 2CQAA 4EG0A 1C9OA 2AUJD 4KMUC 4O42A 3ZJYC 1HH2P 1UWVA 5M3MG 1HA6A 3GTGB 2O03A 2OQKA 1YNJD 3GTMA 3J80L 4C56C 2F3WA 4NXNQ 3S2HB 4QJFA 1KRTA 1DONA 4ZK9B 2R7ZB 3GILA 4AYBE 4JI1H 1S5DD 2HDMA 2KBNA 5KFTA 2L12A 5IGDA 4DL5A 3MXNB 3J80W 1KNAA 1C7YA 3MR6A 2QDBA 4FVMA 4CDFC 3PO2G 2WE6A 3HOUB 3FPPA 4UCTA 1JMCA 1V43A 2ZJRA 2DJGC 4YCVA 3PIO3 4CDDC 1H9KA 4LW1A 3J7ZC 2EYJA 1M8AA 4GOPA 2VUMB 2JE6I 2PN1A 2AKWB 3KAJA 2CW0C 5LL6b 2WDTA 4FXKC 1LTLA 2EQSA 3V05A 4R1JA 4HYKA 4LFCQ 4O4HF 1Q12A 3A7AB 3DLLA 4XQNA 3J81j 1V1PA 2F0JA 3A7LA 1HZAA 1IBML 1JXLA 1BVSA 5DQIA 5I2YA 3MZ5A 5IGFA 4JUZA 1DCZA 1X3EA 4A3BG 2OQ0A 2FPGB 4ECUA 3IFDA 1WR2A 1J6QA 2R93A 5T1GA 3VPDA 3TZUA 2KEDA 3PUXA 5T1IA 2EJFC 3G6EA 3ULJA 3TP7A 4C2MH 5KFAA 1JOKA 4PQXA 5IIFA 3PW0A 2E2JB 2C9OA 2QGQA 1XPRA 5D8DA 2J4XA 4FXGC 2IL8A 2A8VA 3H0GB 1S5ED 5JVLA 1EY5A 4LF5H 2ZDQA 3HOWB 1OO9B 1UUPA 2JA7A 3MFHA 1TWHH 5C5MA 4Q8FA 2PI2A 3N40P 4OO1I 3NXWA 1HRJA 5EKLA 1J8IA 1I4QA 5IP7G 4DUYH 1K8GA 4LF6L 3N8DA 2KCNA 1U4LA 4R4IA 4A3LG 2CQOA 3EQLC 4BXXH 1BNCA 3BAAA 1JWUD 2Z6BA 3KOJA 3L7ZC 2VUGA 3I73A 4LH6A 1S5BD 1I6HH 4QF4A 2CKZB 3UDFA 2Q8IB 3SHLA 2SEBD 3ULLA 3HOXH 1Z2OX 1AW7A 2K6AA 3S15B 4MV7A 4F4YA 2ATWA 4ECSA 1FL0A 5FJ8G 1LM0A 4CC6A 2K14A 3MTSA 2E2IA 1XYIA 4L5TA 4C1NI 3JRWA 1SFOA 1BDOA 3M4QA 4A3KH 1JE5A 2RSNA 4A3FH 2JEAI 3FPUB 1TU2B 4LF8L 4GC7A 4QW8A 4ZAIA 1UE5A 4A3IG 1SJHD 3L9AX 2R7LA 2AGPA 4I7HA 1JICA 2R6GA 1DM0B 1EIYB 5C4JB 3PVXA 3GTGA 1PFNA 2VQFL 4CKBA 2NU8B 2R7ZA 2EDGA 1TWGH 2L15A 4PMWA 2XGTA 3SK8A 5EPJA 4ABNA 4DL4A 3MXNA 4MNOA 4M7EA 3KBGA 4DLKA 1VF5C 4RGNA 3GIJA 3G4SA 3I4MG 3TDQA 4B3RL 1X6OA 3OW2A 4Y52H 2UUCQ 5I9OA 1V51A 3UDIA 4P71A 4FS1A 1LACA 3BG3A 3LNNA 1Y1WB 3S14B 4IOCA 4GZYC 5K36H 2VUMA 4C3HB 3K0XA 4XZ3B 4YP3A 3OIQA 4QY7A 2I8CA 3NBIA 4PZ8A 2JA6H 1A63A 2RF4A 3QWNA 3TZDA 3JAMc 2P0AA 5LMUL 5DLFA 5KFNA 1GSHA 4LFBH 2Z9HA 1G6PA 1E2VA 2W8LA 4HJ5A 1LLRD 1F9RA 1S5FD 2MCTA 4AQYQ 2MFIA 5EKKA 1EY6A 4MV8A 2C2EA 1WTHA 2RA4A 5EGTA 3OWFA 2KQ3A 1K0RA 3JRXA 4DV5Q 3VR4A 3W1BA 4NXNL 1VQNA 2V5AA 1WTWA 1UC9A 2DGYA 2R92H 3K5NA 4KD4A 3H0GA 3OW7A 2Z4IA 1JDBB 4DR6Q 2B63G 4MA0A 1XDNA 3RD4A 4DR7H 3GTOB 1X56A 5KFVA 4L5SA 3PW2A 3W5OA 1KLUD 3TS0A 2SNSA 4HJ8A 3PGZA 4YY3H 2WB1G 1TWCH 2EJGC 4ECVA 4YJ2F 4DR2Q 1PA6A 1SYFA 1EFWA 1XWEA 3PW5A 3S1NB 5IY0A 1UNNC 4WD3A 1TY2A 2L1BA 4LF4L 3M9MB 4LFCL 5GROA 2P5ZX 4H0LC 4JI5Q 4LF9Q 5C0XG 3KYHC 3EPGA 1SAPA 2Z8LA 4RKBA 4A3EB 3Q8QB 1CFMA 1B44D 3OYYA 4HNVA 3F8TA 2EJMA 4H02A 1S68A 3RF2A 1ENCA 1K1SA 5GAHC 2N3SA 4K5WA 3T56B 2JA5G 1ESFA 1TR5A 4WJ3M 1HJPA 5M5WB 1CQVA 1YNXA 3HKZA 1N32H 4ED2A 4RHRA 4A3MB 3CCQA 4ECRA 5IT9c 4HCEA 1SR3A 2NVXB 5FKAC 4MTKA 4WFN3 3FKIH 5KFZA 3BDOA 2VA2A 4WBNF 3RJ0A 1BBUA 1IYJB 1YI2A 3ORRA 1BKBA 3M4OB 2XWBB 4B3TH 1Z9FA 3M4YA 1VS0A 1JQYD 2EYPA 3HOZG 3RZOH 4LWCA 1S3OA 5KT6A 2GLTA 5CV8A 1B2TA 2NVYH 1W2BA 4JI4L 2ZXOA 4KKSA 4YHHL 4JYAL 3GQBA 5D3DA 4DV2Q 1E1OA 1MGSA 1V4YA 2WB1E 3I2ZA 4J8QA 3GTJH 4FF4A 4A3DB 4K8JA 5M5XB 2WIIB 2YW2A 3D4DA 1Y1WA 4X62Q 3MEFA 1IW7D 2BQ3A 1TWFB 2BOSA 2B29A 4WJ4A 4MTDA 4G4KA 2IX1A 1RJQA 1S97A 3TQTA 4H7BA 1WTOA 1X9NA 5H1SE 5C5JA 2PZUA 4OWTB 4P2CB 4RAZA 5KX5F 2R8IA 1TWAH 2YRWA 1QWYA 1KJ8A 1I3QH 4ME5A 3OOCA 4IFDH 5E3FA 2RSOA 4G7OC 1D5ZC 5L1IA 4UP7A 4B3MQ 3TRZA 2VNUD 3IKJA 3ETJA 4LUOA 4RU9A 1I4XA 4KLKA 3PUVA 1JT8A 2FMAA 5J2UF 2JYOA 5EJWA 1F2LA 1KRSA 5CMDA 1VQKA 1Q86C 4V190 1K1QA 1O78A 1YNNC 3KLRA 1VQ7A 1GOZA 4H13C 4ZUJA 3G6XA 2F0GA 1KJJA 3AMUA 1C3OA 3EBEA 4HIDA 3OHBA 3PF4A 2ZM6Q 1PTOB 5C8YF 5E1FA 3NBHA 4A2BA 2F0UA 1PRTC 5FLXW 1B6RA 3NP8A 3MFYA 2N55A 4DR6H 1CZWA 5C1OA 5KT4A 3STBD 3RTXA 3RLNA 1GUTA 3LGJA 3E0JA 4O2AF 1PXUA
chains in the Genus database with same CATH topology
3IRBA 4LUVA 1PYBA 1I5FA 2OTJA 3PUWA 4JOIA 1QUQB 1AH9A 1QVGA 1WOCA 1HZBA 1PH5A 3PO3G 4GKKL 1YZ6A 4DV4L 2K5VA 1XJVA 4DV3L 4J15A 2EXDA 5IYCH 4DR1L 3CF5A 1O7IA 2ZTEA 1YJWA 3PUYA 5FJ8H 2BH2A 5IYDG 3NBHB 3J7A5 3BZCA 4JV5L 2R93G 2QEXA 3A0JA 4GN5A 4AQYL 1IL2A 2OCEA 2AWOA 2VS1A 3BJUA 4P72A 1E3PA 4A3GG 1N9WA 4GLVB 4GS3A 4DV5L 1PH6A 1P8LA 2E5LL 4A3KG 4A3FG 2VQEL 1YJ9A 3DM3A 1XPUA 3UE0A 2IT1A 1E24A 1KXLA 4A93G 4GNXA 1Q46A 4A3IH 3KFUA 1VQEA 1CSQA 1I50H 4YWKA 4LFBQ 1GO3E 1VQ6A 1QVCA 3GTOH 3KDFA 1R9TH 1D7QA 3Q8DA 4BA1I 4JI2Q 2RHQB 2Z6KC 4UY8C 2NVTH 2WP8J 1QVFA 3HOYG 3I4OA 2HHHQ 3I4MH 4HIKA 2Q2HA 1MJEA 3S1NH 1EOVA 1MIUA 2AHOB 4X65L 4A3CG 3K7AH 4MZ9A 3S1MH 1GKHA 3AFPA 4JI7L 1YIJA 3G48A 1FGUA 4A3JH 4IPGA 1XNQQ 1N34Q 4B3SL 4GOPB 5K36G 1W3SA 3EIVA 2UXBQ 4P73A 4R4QA 4GNXB 2ES2A 4GN3B 4JI5L 4LF9L 4DR7Q 3WWVA 3CCJA 1JB7A 2F4VL 4A3EH 2JA6G 2LXKA 4GLAC 4JI3L 3CMEA 4JI2L 3T1YL 5BR8Q 2YTXA 3M9BA 2UUAQ 4TQUS 3KDFB 4LFAL 3S24A 5GAGC 4YY3Q 2D0PA 3I55A 4HIMA 1K73C 1KQSA 3HOUH 3M7NA 4IPDA 1L1OC 2KHJA 4DPGA 2YTVA 3TS2A 4BA2I 5M5WH 1I94Q 4DK3C 2YV5A 4UPAA 3U4VA 3AEVA 1PH8A 4A3MH 2UXBL 3F2BA 2JQOA 5IE8A 2JA8G 4IOAA 1OXTA 1K3RA 2JA9A 2K4KA 1RIPA 4OONA 3T1HQ 1XPOA 2NVXH 4LF5Q 1EIFA 2BA0A 1VQOA 1GVPA 4R4TA 4LF8Q 5BR8L 1IBKL 3CMAA 5HGQA 1MJCA 1SLJA 4AYBG 4YY3L 1Q8KA 2R7ZG 2R92G 1A8VA 2ALYB 4MTNA 4P74A 4JI0Q 4DV7L 5C44G 1LUZA 3M4OH 4BBSH 3I7FA 2B63H 1EUJA 4AIMA 4DUYQ 4ME3A 4UP9A 3CXCA 2FXQA 2CFMA 1Q82C 2PI2E 1I94L 3HOUG 5M3FH 1VQBA 1N32Q 2GVAA 5AJ3Q 4RG1A 4BBRH 1B70B 1UE7A 1RL2A 2K52A 1KC8C 1JJ2A 4LF5L 4A3DH 4JI8Q 4HIOA 3FHWA 5M5XH 2IX0A 1VQDA 4JI6L 4JOIC 2HT1A 2VUMG 2WAQG 1YHBA 3RZOH 1SN8A 1UE6A 2KCTA 3S1RH 3RLOA 1BBWA 1TWFH 3ERSX 1S72A 3M3YH 4IFDI 5LMNL 4B3TQ 4QIWE 4DUYL 5FLMH 1Q81C 1N36Q 1X65A 1LYLA 3PUZA 5JEAJ 3KLWA 3W1GA 5GADC 3RN2A 3FP9A 2JEAI 1NMGA 3NEMA 1N32L 1YVCA 2XTIA 3AFQA 2QA4A 3CP0A 5LMNW 3HOVH 4QQBX 2K50A 3TQYA 3RNUA 3B6YA 1HNZQ 5FLXc 5LMUQ 1EYGA 1HZ9A 4X64L 2GN5A 2LXJA 4JI8L 4B3ML 1NJIC 2CWAA 4GKJL 4BY7G 3CCMA 2AMCB 2PMZE 2JA5H 5C0XJ 5M5YH 4NB3A 4GNXC 5HY6A 1HNXQ 1M90C 4L5QA 1PH9A 2K5NA 3A5ZB 1VQ4A 4A4IA 1KD1C 4JCVE 4X6AH 1WCMG 4FDBA 5DLQE 1C9OA 3H0GG 4EX5A 2JJQA 4IJHA 4XTCS 3ZJYC 1HH2P 1UWVA 5M3MG 1YHAA 3HOWG 2OQKA 1HZCA 2MQHA 1SROA 1X3FA 2JK8A 4NXNQ 1VQGA 1Y1VG 2ZM6L 3FKIG 4QJFA 1KRTA 1KAWA 3U50C 4AYBE 1VQFA 2KBNA 1U5KA 1CSPA 1L2FA 5IYBH 2VZAA 1Q1BA 1NMFA 3J80c 3MXNB 1E1TA 1C7YA 1XMQQ 3HOZH 3PO2G 5C4XG 1XTDA 4GLXA 1JMCA 1IBMQ 1V43A 1JJGA 2ZJRA 4YCVA 4NXMQ 4JBKA 1QZGA 2UUBQ 4LW1A 1ASYA 3E9HA 3J7ZC 4DV1Q 2WAQE 4GOPA 2JE6I 5GQOA 2HIVA 2AKWB 1EQQA 1OXUA 1LTLA 1G291 3CC7A 2EQSA 2Y0SG 2JA7G 4QL5A 2VW9A 4DAYB 2ZJPA 4R1JA 4LFCQ 2ID0A 1Q12A 1XMQL 3DLLA 2PQAA 3NELA 3J81j 1HZAA 2KCMA 3CQZH 1SE8A 1IBML 4IJLA 1BVSA 2UUBL 1X3EA 4A3BG 2OQ0A 4IFDG 3CCSA 3I4NH 1J6QA 5ELOA 2BH8A 1VQ9A 3S16H 3PUXA 1IBLQ 1DGSA 3G6EA 3ULJA 4C2MH 4LF6Q 2NZOA 4DV0Q 1VCIA 3GTMH 4LFBL 3ER0A 4DUZQ 4GN4B 2QGQA 1XPRA 4APVA 4DR3Q 3PV0A 1NE3A 1PH4A 2A8VA 5IP9H 3CCVA 1YBYA 4X66Q 1WI5A 4IPCA 2PQAB 1KHIA 4BY1H 1TWHH 1PH2A 2HHHL 1YITA 2PI2A 2V1CC 5C3EH 2NVQH 4OO1I 3KF8B 2CWPA 4Y7NH 1UE1A 3S1QH 5IP7G 1K8GA 1T9HA 4LF6L 2YU9H 1XNQL 4R4IA 1N34L 1OXSC 1X55A 2CQOA 1Y1WG 4A3LG 4P75A 4BXXH 2A1AA 1M1KC 2UU9Q 4DR7L 2Q2IA 3TEHB 3J81c 4LUZA 3KOJA 3L7ZC 4DNIA 4JG2A 1WFQA 5IWAQ 2I0QA 1I6HH 3UDGA 1N33Q 2UUAL 1V1QA 2CKZB 3UDFA 3S17H 3PO3H 3ULLA 3OTOQ 1VQHA 3HOXH 1SRUA 2GVBA 2Z0SA 1PVOA 5IYCG 2Y0SE 2ATWA 1KL9A 2PNHA 1FL0A 2A19A 5FJ8G 1LM0A 2VQFQ 3RZDH 5IYDH 1PYSB 3JAMi 2K14A 4K0KQ 2R93H 2N78A 1VQPA 4L5TA 1K8AC 1UEBA 4R4CA 3J80i 4A3GH 4LF7Q 2UU9L 3M85A 1L0WA 3T1HL 3M4QA 4A3KH 1JE5A 1OXVA 2BA1A 2R7DA 1AE2A 3KJOA 3TREA 4A3FH 3CAMA 2NZHA 1PV4A 1IXRA 2DUDA 4LF8L 1UE5A 4A93H 4KHZA 1CUKA 4A3IG 4NPSA 1JJCB 4JI0L 1EIYB 2R6GA 1D8LA 1YHQA 4IPHA 2Q2UA 2KENA 2VQFL 3CPFA 4LNQA 3U58A 3CW2C 4PG3A 1TWGH 2L15A 4PMWA 2XGTA 3SGIA 4DK6C 1HNWQ 4YCWA 1B7YB 2UXCQ 1Q1EA 3RN5A 3PIPA 3UE1A 3RR5A 5AJ3L 2MO0A 1FJGQ 4MNOA 4DV6Q 4KI0A 3HOYH 3F2DA 3G4SA 3CC4A 3I4MG 2F3IA 1X6OA 5C0XI 1XNRQ 4B3RL 4A3CH 4GOPC 4POFA 3OW2A 4Y52H 2UUCQ 2RCNA 2UXDQ 4A3JG 3UDIA 4P71A 4DKAC 2E8GA 4HJAA 4B3TL 2K75A 4JBMA 2I5HA 4IOCA 3H3VH 1N36L 3D31A 3K0XA 1CKMA 4OO1G 3CCLA 1CKOA 1Z47A 4QY7A 1VQIA 4PZ8A 4A3EG 2JA6H 1A63A 2RF4A 1FJGL 4C3JH 1NY4A 3JAMc 4DV6L 1HNZL 3EN2A 2E2IH 5LMUL 2RHSB 3L0OA 2VL6A 2EIFA 2K5HA 1PH3A 4DV4Q 1NTGA 1WJJA 4DV3Q 4DR1Q 1G6PA 3NENA 4HJ7A 1E22A 1U0LA 2UUCL 4TVAB 4HJ5A 4PZ6A 4JV5Q 3CCUA 1HNXL 1EWIA 4AQYQ 2MFIA 2MO1A 3VDYA 4HJ9A 4A3MG 4EQ5A 2HQLA 2JA8H 4B3RQ 1G51A 4YCUA 4RMFA 2Q2TA 1K0RA 3GTGH 4DV5Q 4A76A 1HR0Q 2E5LQ 2VQEQ 3W1BA 3S2HH 1NBWA 4NXNL 1VQNA 3U4ZA 2CCZA 2E2HH 2R7ZH 1EQRA 2DGYA 3HOXG 2R92H 3J81i 1N8RC 4LF4Q 1K83H 5C44H 4DR6Q 4BBSG 2B63G 3CPWA 1X56A 1FVIA 2F52A 2AWNA 4R4OA 2KHIA 4OWXB 1MKHA 5EAYA 5M3FG 3W5OA 3CCRA 2R7FA 3TS0A 4L5SA 4NXML 4BBRG 4HJ8A 3PGZA 2NN6I 2IY5B 1CKNA 2WB1G 4A3DG 3F2CA 1ASZA 1TWCH 3HKZG 4DV1L 5JEAG 1HR0L 4DR2Q 2VUMH 1PA6A 1SMXA 4X65Q 4AH6A 1EFWA 5IY0A 1PH7A 5GAEC 2HIXA 3HKSA 4JI1Q 4JI7Q 3UDXA 4LF4L 1HR0W 2IHEA 4DR6L 4B3SQ 4LFCL 3JC66 5FLMG 5GROA 1OTCA 1XMOQ 4LF9Q 4JI5Q 5JJIA 5C0XG 3KYHC 2F4VQ 4O0AA 5ELNA 1VQ5A 1PFSA 3PSIA 1S40A 4JI3Q 3HOVG 3T1YQ 3OYYA 4IO9A 2ASBA 4LFAQ 3F8TA 4H02A 1QZHA 3E0EA 4BY7H 5GAHC 4DR2L 1PHJA 1Q7YC 2N3SA 3L2PA 1IBLL 4JBWA 2ZTCA 5J3BA 2JA5G 4BXXG 1CKNB 4JI1L 3PIOA 4DV0L 3ULPA 4C3IH 4WJ3M 2E2JH 3GTLH 1HJPA 4DUZL 1YNXA 4JI4Q 3ICEA 4YHHQ 4DR3L 4JYAQ 3CCQA 1WCMH 2C35B 5IT9c 1XMOL 3H0GH 1SR3A 5M3MH 1GM5A 3HOWH 3A5UA 4X66L 1J5EQ 1IBKQ 1Y1VH 3FKIH 4OXPA 3CCEA 3GTKH 3AYHB 5E7NA 1IYJB 1BBUA 5IYBG 1YI2A 1BKBA 4DV7Q 3AQQA 4DR5Q 1Z9FA 1H95A 4DR4Q 1VS0A 2D62A 4OX9Q 1B8AA 2WFWA 1P16A 3HOZG 1AE3A 4LWCA 3PO2H 2LSSA 3GD7A 1S3OA 4XIGS 5C4XH 1K9MC 1IZ6A 2NVYH 1W2BA 4JI4L 4YHHL 4A75A 2Z6KA 3KF6A 4JYAL 1KIXA 2YTYA 4DV2Q 1E1OA 1OXXK 1X54A 2WB1E 3I2ZA 3GTJH 5IWAL 2N49A 3HKZE 4POGA 4JI6Q 1N33L 1J5EL 3A74A 3STBC 4X62Q 3OTOL 3S15H 3MEFA 4O2DA 1VQAA 2B29A 4UP8A 2JA7H 4WJ4A 2YYZA 4OWWB 5LMNQ 4DR5L 2IX1A 2NN6G 4DR4L 4PZ7A 3BZKA 2VY3A 4OX9L 3BU2A 3H15A 2OWOA 4K0KL 1X9NA 1Y14B 5H1SE 4OWTB 2OTLA 3GDEA 3CD6A 5JJLA 3K81C 4JC0A 1YEZA 1TWAH 4KHPQ 4LF7L 1I3QH 1PH1A 1C0AA 3D0FA 3K8AA 1YJNA 4DV2L 1VQMA 4A3BH 4X64Q 1GD7A 4UP7A 4B3MQ 3I4NG 3TRZA 4GKJQ 1L1OA 3M4PA 1X3GA 2JEBI 3KF6B 2VNUD 4X62L 4LUOA 1TXYA 2H5XA 4KLKA 3PUVA 5JJKA 1A62A 1JT8A 2ZJQA 3GTPH 2I5MX 4YWLA 4ALPA 2MNAA 2ZTDA 5C4JH 1KRSA 4QGUA 1VQKA 1VQLA 1QUQA 4IFDJ 1Q86C 3RLFA 1VQCA 3PF5A 1VQ7A 1V9PA 5IP9G 1VQ8A 3K7UC 1HNWL 2UXCL 3EBEA 4HIDA 4KHPL 4JBJA 2D0OA 2N8NA 3PF4A 2IHFA 2ZM6Q 4GKKQ 4BY1G 3G71A 1WYDA 3H3VI 4DAMA 3CC2A 5C3EG 1XNRL 3E9IA 5IP7H 1A0IA 2B3GA 3GO5A 3PCOB 1SFOH 4L5RC 3KJPA 3GTQH 2UXDL 3F1ZA 2I5LX 3STBD 1L1OB 3RLNA 3I56A 3LGJA 1E7ZA 1Y1WH 3S14H 4A3LH 4C3HH 3S2DH 3HFZB 4YWMA 3K80C 1VQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IRB A;  4LUV A;  1PYB A;  1I5F A;  2OTJ A;  3PUW A;  4JOI A;  1QUQ B;  1AH9 A;  1QVG A;  1WOC A;  1HZB A;  1PH5 A;  3PO3 G;  4GKK L;  1YZ6 A;  4DV4 L;  2K5V A;  1XJV A;  4DV3 L;  4J15 A;  2EXD A;  5IYC H;  4DR1 L;  3CF5 A;  1O7I A;  2ZTE A;  1YJW A;  3PUY A;  5FJ8 H;  2BH2 A;  5IYD G;  3NBH B;  3J7A 5;  3BZC A;  4JV5 L;  2R93 G;  2QEX A;  3A0J A;  4GN5 A;  4AQY L;  1IL2 A;  2OCE A;  2AWO A;  2VS1 A;  3BJU A;  4P72 A;  1E3P A;  4A3G G;  1N9W A;  4GLV B;  4GS3 A;  4DV5 L;  1PH6 A;  1P8L A;  2E5L L;  4A3K G;  4A3F G;  2VQE L;  1YJ9 A;  3DM3 A;  1XPU A;  3UE0 A;  2IT1 A;  1E24 A;  1KXL A;  4A93 G;  4GNX A;  1Q46 A;  4A3I H;  3KFU A;  1VQE A;  1CSQ A;  1I50 H;  4YWK A;  4LFB Q;  1GO3 E;  1VQ6 A;  1QVC A;  3GTO H;  3KDF A;  1R9T H;  1D7Q A;  3Q8D A;  4BA1 I;  4JI2 Q;  2RHQ B;  2Z6K C;  4UY8 C;  2NVT H;  2WP8 J;  1QVF A;  3HOY G;  3I4O A;  2HHH Q;  3I4M H;  4HIK A;  2Q2H A;  1MJE A;  3S1N H;  1EOV A;  1MIU A;  2AHO B;  4X65 L;  4A3C G;  3K7A H;  4MZ9 A;  3S1M H;  1GKH A;  3AFP A;  4JI7 L;  1YIJ A;  3G48 A;  1FGU A;  4A3J H;  4IPG A;  1XNQ Q;  1N34 Q;  4B3S L;  4GOP B;  5K36 G;  1W3S A;  3EIV A;  2UXB Q;  4P73 A;  4R4Q A;  4GNX B;  2ES2 A;  4GN3 B;  4JI5 L;  4LF9 L;  4DR7 Q;  3WWV A;  3CCJ A;  1JB7 A;  2F4V L;  4A3E H;  2JA6 G;  2LXK A;  4GLA C;  4JI3 L;  3CME A;  4JI2 L;  3T1Y L;  5BR8 Q;  2YTX A;  3M9B A;  2UUA Q;  4TQU S;  3KDF B;  4LFA L;  3S24 A;  5GAG C;  4YY3 Q;  2D0P A;  3I55 A;  4HIM A;  1K73 C;  1KQS A;  3HOU H;  3M7N A;  4IPD A;  1L1O C;  2KHJ A;  4DPG A;  2YTV A;  3TS2 A;  4BA2 I;  5M5W H;  1I94 Q;  4DK3 C;  2YV5 A;  4UPA A;  3U4V A;  3AEV A;  1PH8 A;  4A3M H;  2UXB L;  3F2B A;  2JQO A;  5IE8 A;  2JA8 G;  4IOA A;  1OXT A;  1K3R A;  2JA9 A;  2K4K A;  1RIP A;  4OON A;  3T1H Q;  1XPO A;  2NVX H;  4LF5 Q;  1EIF A;  2BA0 A;  1VQO A;  1GVP A;  4R4T A;  4LF8 Q;  5BR8 L;  1IBK L;  3CMA A;  5HGQ A;  1MJC A;  1SLJ A;  4AYB G;  4YY3 L;  1Q8K A;  2R7Z G;  2R92 G;  1A8V A;  2ALY B;  4MTN A;  4P74 A;  4JI0 Q;  4DV7 L;  5C44 G;  1LUZ A;  3M4O H;  4BBS H;  3I7F A;  2B63 H;  1EUJ A;  4AIM A;  4DUY Q;  4ME3 A;  4UP9 A;  3CXC A;  2FXQ A;  2CFM A;  1Q82 C;  2PI2 E;  1I94 L;  3HOU G;  5M3F H;  1VQB A;  1N32 Q;  2GVA A;  5AJ3 Q;  4RG1 A;  4BBR H;  1B70 B;  1UE7 A;  1RL2 A;  2K52 A;  1KC8 C;  1JJ2 A;  4LF5 L;  4A3D H;  4JI8 Q;  4HIO A;  3FHW A;  5M5X H;  2IX0 A;  1VQD A;  4JI6 L;  4JOI C;  2HT1 A;  2VUM G;  2WAQ G;  1YHB A;  3RZO H;  1SN8 A;  1UE6 A;  2KCT A;  3S1R H;  3RLO A;  1BBW A;  1TWF H;  3ERS X;  1S72 A;  3M3Y H;  4IFD I;  5LMN L;  4B3T Q;  4QIW E;  4DUY L;  5FLM H;  1Q81 C;  1N36 Q;  1X65 A;  1LYL A;  3PUZ A;  5JEA J;  3KLW A;  3W1G A;  5GAD C;  3RN2 A;  3FP9 A;  2JEA I;  1NMG A;  3NEM A;  1N32 L;  1YVC A;  2XTI A;  3AFQ A;  2QA4 A;  3CP0 A;  5LMN W;  3HOV H;  4QQB X;  2K50 A;  3TQY A;  3RNU A;  3B6Y A;  1HNZ Q;  5FLX c;  5LMU Q;  1EYG A;  1HZ9 A;  4X64 L;  2GN5 A;  2LXJ A;  4JI8 L;  4B3M L;  1NJI C;  2CWA A;  4GKJ L;  4BY7 G;  3CCM A;  2AMC B;  2PMZ E;  2JA5 H;  5C0X J;  5M5Y H;  4NB3 A;  4GNX C;  5HY6 A;  1HNX Q;  1M90 C;  4L5Q A;  1PH9 A;  2K5N A;  3A5Z B;  1VQ4 A;  4A4I A;  1KD1 C;  4JCV E;  4X6A H;  1WCM G;  4FDB A;  5DLQ E;  1C9O A;  3H0G G;  4EX5 A;  2JJQ A;  4IJH A;  4XTC S;  3ZJY C;  1HH2 P;  1UWV A;  5M3M G;  1YHA A;  3HOW G;  2OQK A;  1HZC A;  2MQH A;  1SRO A;  1X3F A;  2JK8 A;  4NXN Q;  1VQG A;  1Y1V G;  2ZM6 L;  3FKI G;  4QJF A;  1KRT A;  1KAW A;  3U50 C;  4AYB E;  1VQF A;  2KBN A;  1U5K A;  1CSP A;  1L2F A;  5IYB H;  2VZA A;  1Q1B A;  1NMF A;  3J80 c;  3MXN B;  1E1T A;  1C7Y A;  1XMQ Q;  3HOZ H;  3PO2 G;  5C4X G;  1XTD A;  4GLX A;  1JMC A;  1IBM Q;  1V43 A;  1JJG A;  2ZJR A;  4YCV A;  4NXM Q;  4JBK A;  1QZG A;  2UUB Q;  4LW1 A;  1ASY A;  3E9H A;  3J7Z C;  4DV1 Q;  2WAQ E;  4GOP A;  2JE6 I;  5GQO A;  2HIV A;  2AKW B;  1EQQ A;  1OXU A;  1LTL A;  1G29 1;  3CC7 A;  2EQS A;  2Y0S G;  2JA7 G;  4QL5 A;  2VW9 A;  4DAY B;  2ZJP A;  4R1J A;  4LFC Q;  2ID0 A;  1Q12 A;  1XMQ L;  3DLL A;  2PQA A;  3NEL A;  3J81 j;  1HZA A;  2KCM A;  3CQZ H;  1SE8 A;  1IBM L;  4IJL A;  1BVS A;  2UUB L;  1X3E A;  4A3B G;  2OQ0 A;  4IFD G;  3CCS A;  3I4N H;  1J6Q A;  5ELO A;  2BH8 A;  1VQ9 A;  3S16 H;  3PUX A;  1IBL Q;  1DGS A;  3G6E A;  3ULJ A;  4C2M H;  4LF6 Q;  2NZO A;  4DV0 Q;  1VCI A;  3GTM H;  4LFB L;  3ER0 A;  4DUZ Q;  4GN4 B;  2QGQ A;  1XPR A;  4APV A;  4DR3 Q;  3PV0 A;  1NE3 A;  1PH4 A;  2A8V A;  5IP9 H;  3CCV A;  1YBY A;  4X66 Q;  1WI5 A;  4IPC A;  2PQA B;  1KHI A;  4BY1 H;  1TWH H;  1PH2 A;  2HHH L;  1YIT A;  2PI2 A;  2V1C C;  5C3E H;  2NVQ H;  4OO1 I;  3KF8 B;  2CWP A;  4Y7N H;  1UE1 A;  3S1Q H;  5IP7 G;  1K8G A;  1T9H A;  4LF6 L;  2YU9 H;  1XNQ L;  4R4I A;  1N34 L;  1OXS C;  1X55 A;  2CQO A;  1Y1W G;  4A3L G;  4P75 A;  4BXX H;  2A1A A;  1M1K C;  2UU9 Q;  4DR7 L;  2Q2I A;  3TEH B;  3J81 c;  4LUZ A;  3KOJ A;  3L7Z C;  4DNI A;  4JG2 A;  1WFQ A;  5IWA Q;  2I0Q A;  1I6H H;  3UDG A;  1N33 Q;  2UUA L;  1V1Q A;  2CKZ B;  3UDF A;  3S17 H;  3PO3 H;  3ULL A;  3OTO Q;  1VQH A;  3HOX H;  1SRU A;  2GVB A;  2Z0S A;  1PVO A;  5IYC G;  2Y0S E;  2ATW A;  1KL9 A;  2PNH A;  1FL0 A;  2A19 A;  5FJ8 G;  1LM0 A;  2VQF Q;  3RZD H;  5IYD H;  1PYS B;  3JAM i;  2K14 A;  4K0K Q;  2R93 H;  2N78 A;  1VQP A;  4L5T A;  1K8A C;  1UEB A;  4R4C A;  3J80 i;  4A3G H;  4LF7 Q;  2UU9 L;  3M85 A;  1L0W A;  3T1H L;  3M4Q A;  4A3K H;  1JE5 A;  1OXV A;  2BA1 A;  2R7D A;  1AE2 A;  3KJO A;  3TRE A;  4A3F H;  3CAM A;  2NZH A;  1PV4 A;  1IXR A;  2DUD A;  4LF8 L;  1UE5 A;  4A93 H;  4KHZ A;  1CUK A;  4A3I G;  4NPS A;  1JJC B;  4JI0 L;  1EIY B;  2R6G A;  1D8L A;  1YHQ A;  4IPH A;  2Q2U A;  2KEN A;  2VQF L;  3CPF A;  4LNQ A;  3U58 A;  3CW2 C;  4PG3 A;  1TWG H;  2L15 A;  4PMW A;  2XGT A;  3SGI A;  4DK6 C;  1HNW Q;  4YCW A;  1B7Y B;  2UXC Q;  1Q1E A;  3RN5 A;  3PIP A;  3UE1 A;  3RR5 A;  5AJ3 L;  2MO0 A;  1FJG Q;  4MNO A;  4DV6 Q;  4KI0 A;  3HOY H;  3F2D A;  3G4S A;  3CC4 A;  3I4M G;  2F3I A;  1X6O A;  5C0X I;  1XNR Q;  4B3R L;  4A3C H;  4GOP C;  4POF A;  3OW2 A;  4Y52 H;  2UUC Q;  2RCN A;  2UXD Q;  4A3J G;  3UDI A;  4P71 A;  4DKA C;  2E8G A;  4HJA A;  4B3T L;  2K75 A;  4JBM A;  2I5H A;  4IOC A;  3H3V H;  1N36 L;  3D31 A;  3K0X A;  1CKM A;  4OO1 G;  3CCL A;  1CKO A;  1Z47 A;  4QY7 A;  1VQI A;  4PZ8 A;  4A3E G;  2JA6 H;  1A63 A;  2RF4 A;  1FJG L;  4C3J H;  1NY4 A;  3JAM c;  4DV6 L;  1HNZ L;  3EN2 A;  2E2I H;  5LMU L;  2RHS B;  3L0O A;  2VL6 A;  2EIF A;  2K5H A;  1PH3 A;  4DV4 Q;  1NTG A;  1WJJ A;  4DV3 Q;  4DR1 Q;  1G6P A;  3NEN A;  4HJ7 A;  1E22 A;  1U0L A;  2UUC L;  4TVA B;  4HJ5 A;  4PZ6 A;  4JV5 Q;  3CCU A;  1HNX L;  1EWI A;  4AQY Q;  2MFI A;  2MO1 A;  3VDY A;  4HJ9 A;  4A3M G;  4EQ5 A;  2HQL A;  2JA8 H;  4B3R Q;  1G51 A;  4YCU A;  4RMF A;  2Q2T A;  1K0R A;  3GTG H;  4DV5 Q;  4A76 A;  1HR0 Q;  2E5L Q;  2VQE Q;  3W1B A;  3S2H H;  1NBW A;  4NXN L;  1VQN A;  3U4Z A;  2CCZ A;  2E2H H;  2R7Z H;  1EQR A;  2DGY A;  3HOX G;  2R92 H;  3J81 i;  1N8R C;  4LF4 Q;  1K83 H;  5C44 H;  4DR6 Q;  4BBS G;  2B63 G;  3CPW A;  1X56 A;  1FVI A;  2F52 A;  2AWN A;  4R4O A;  2KHI A;  4OWX B;  1MKH A;  5EAY A;  5M3F G;  3W5O A;  3CCR A;  2R7F A;  3TS0 A;  4L5S A;  4NXM L;  4BBR G;  4HJ8 A;  3PGZ A;  2NN6 I;  2IY5 B;  1CKN A;  2WB1 G;  4A3D G;  3F2C A;  1ASZ A;  1TWC H;  3HKZ G;  4DV1 L;  5JEA G;  1HR0 L;  4DR2 Q;  2VUM H;  1PA6 A;  1SMX A;  4X65 Q;  4AH6 A;  1EFW A;  5IY0 A;  1PH7 A;  5GAE C;  2HIX A;  3HKS A;  4JI1 Q;  4JI7 Q;  3UDX A;  4LF4 L;  1HR0 W;  2IHE A;  4DR6 L;  4B3S Q;  4LFC L;  3JC6 6;  5FLM G;  5GRO A;  1OTC A;  1XMO Q;  4LF9 Q;  4JI5 Q;  5JJI A;  5C0X G;  3KYH C;  2F4V Q;  4O0A A;  5ELN A;  1VQ5 A;  1PFS A;  3PSI A;  1S40 A;  4JI3 Q;  3HOV G;  3T1Y Q;  3OYY A;  4IO9 A;  2ASB A;  4LFA Q;  3F8T A;  4H02 A;  1QZH A;  3E0E A;  4BY7 H;  5GAH C;  4DR2 L;  1PHJ A;  1Q7Y C;  2N3S A;  3L2P A;  1IBL L;  4JBW A;  2ZTC A;  5J3B A;  2JA5 G;  4BXX G;  1CKN B;  4JI1 L;  3PIO A;  4DV0 L;  3ULP A;  4C3I H;  4WJ3 M;  2E2J H;  3GTL H;  1HJP A;  4DUZ L;  1YNX A;  4JI4 Q;  3ICE A;  4YHH Q;  4DR3 L;  4JYA Q;  3CCQ A;  1WCM H;  2C35 B;  5IT9 c;  1XMO L;  3H0G H;  1SR3 A;  5M3M H;  1GM5 A;  3HOW H;  3A5U A;  4X66 L;  1J5E Q;  1IBK Q;  1Y1V H;  3FKI H;  4OXP A;  3CCE A;  3GTK H;  3AYH B;  5E7N A;  1IYJ B;  1BBU A;  5IYB G;  1YI2 A;  1BKB A;  4DV7 Q;  3AQQ A;  4DR5 Q;  1Z9F A;  1H95 A;  4DR4 Q;  1VS0 A;  2D62 A;  4OX9 Q;  1B8A A;  2WFW A;  1P16 A;  3HOZ G;  1AE3 A;  4LWC A;  3PO2 H;  2LSS A;  3GD7 A;  1S3O A;  4XIG S;  5C4X H;  1K9M C;  1IZ6 A;  2NVY H;  1W2B A;  4JI4 L;  4YHH L;  4A75 A;  2Z6K A;  3KF6 A;  4JYA L;  1KIX A;  2YTY A;  4DV2 Q;  1E1O A;  1OXX K;  1X54 A;  2WB1 E;  3I2Z A;  3GTJ H;  5IWA L;  2N49 A;  3HKZ E;  4POG A;  4JI6 Q;  1N33 L;  1J5E L;  3A74 A;  3STB C;  4X62 Q;  3OTO L;  3S15 H;  3MEF A;  4O2D A;  1VQA A;  2B29 A;  4UP8 A;  2JA7 H;  4WJ4 A;  2YYZ A;  4OWW B;  5LMN Q;  4DR5 L;  2IX1 A;  2NN6 G;  4DR4 L;  4PZ7 A;  3BZK A;  2VY3 A;  4OX9 L;  3BU2 A;  3H15 A;  2OWO A;  4K0K L;  1X9N A;  1Y14 B;  5H1S E;  4OWT B;  2OTL A;  3GDE A;  3CD6 A;  5JJL A;  3K81 C;  4JC0 A;  1YEZ A;  1TWA H;  4KHP Q;  4LF7 L;  1I3Q H;  1PH1 A;  1C0A A;  3D0F A;  3K8A A;  1YJN A;  4DV2 L;  1VQM A;  4A3B H;  4X64 Q;  1GD7 A;  4UP7 A;  4B3M Q;  3I4N G;  3TRZ A;  4GKJ Q;  1L1O A;  3M4P A;  1X3G A;  2JEB I;  3KF6 B;  2VNU D;  4X62 L;  4LUO A;  1TXY A;  2H5X A;  4KLK A;  3PUV A;  5JJK A;  1A62 A;  1JT8 A;  2ZJQ A;  3GTP H;  2I5M X;  4YWL A;  4ALP A;  2MNA A;  2ZTD A;  5C4J H;  1KRS A;  4QGU A;  1VQK A;  1VQL A;  1QUQ A;  4IFD J;  1Q86 C;  3RLF A;  1VQC A;  3PF5 A;  1VQ7 A;  1V9P A;  5IP9 G;  1VQ8 A;  3K7U C;  1HNW L;  2UXC L;  3EBE A;  4HID A;  4KHP L;  4JBJ A;  2D0O A;  2N8N A;  3PF4 A;  2IHF A;  2ZM6 Q;  4GKK Q;  4BY1 G;  3G71 A;  1WYD A;  3H3V I;  4DAM A;  3CC2 A;  5C3E G;  1XNR L;  3E9I A;  5IP7 H;  1A0I A;  2B3G A;  3GO5 A;  3PCO B;  1SFO H;  4L5R C;  3KJP A;  3GTQ H;  2UXD L;  3F1Z A;  2I5L X;  3STB D;  1L1O B;  3RLN A;  3I56 A;  3LGJ A;  1E7Z A;  1Y1W H;  3S14 H;  4A3L H;  4C3H H;  3S2D H;  3HFZ B;  4YWM A;  3K80 C;  1VQJ A; 
#chains in the Genus database with same CATH topology
 4LUV A;  2RVL A;  1I5F A;  3HG9 A;  4C2M A;  1EQT A;  3IN5 A;  4JOI A;  1AH9 A;  1BO0 A;  1PH5 A;  2EYF A;  1AZP A;  2W70 A;  5J2T F;  4DV0 H;  4YAK B;  1SYE A;  4DUZ H;  2ZTE A;  1YJW A;  3PUY A;  1DXM A;  2HJW A;  2MPM A;  3BZC A;  3DM1 A;  2R93 G;  1WTQ A;  5BPF A;  4GN5 A;  2PO4 A;  4J9M A;  4AQY L;  1TWH A;  5JAV A;  2VS1 A;  3I8Z A;  4P72 A;  1EY8 A;  2C22 A;  1MI2 A;  5BN5 A;  4A3G G;  4GS3 A;  4DV5 L;  3TIN A;  1YJ9 A;  1EYD A;  1XPU A;  5FOB B;  1E4E B;  4A93 G;  5KG1 A;  3MXG A;  3J7A K;  1I50 H;  1KJQ A;  3T5K A;  2NVX A;  1GO3 E;  3J7Y W;  5HBR B;  1VQ6 A;  1ROD A;  1GUW A;  3KDF A;  1ZXT A;  5C4Z A;  4Q8E A;  4BA1 I;  5IWA H;  5KFB A;  4RZR A;  4FBU A;  2RHQ B;  2JN4 A;  2Z6K C;  4Q5V A;  2DJF C;  4UY8 C;  1B04 A;  4CC5 A;  3GIM A;  1N33 H;  3I4O A;  3GV6 A;  2HHH Q;  2W6P A;  3I12 A;  2Z1C A;  5C3E B;  1MJE A;  3H6M A;  4A3C G;  4Y7N B;  2IMW P;  1GKH A;  2WYO A;  1KJI A;  1VBG A;  3G48 A;  4K0K H;  1XNQ Q;  2YU9 B;  2R6F A;  5KFU A;  1PZJ D;  4LF9 L;  4GN3 B;  4JI5 L;  5KFW A;  1PTO C;  4DV2 H;  3K6O A;  4GLA C;  3CME A;  1KNE A;  4JI2 L;  4EQP A;  3M9B A;  2UUA Q;  4TQU S;  1T5E A;  4X62 H;  2JP1 A;  3PO3 B;  3S17 B;  4HIM A;  3N52 A;  1TS4 A;  3MEH A;  5HGT A;  5H80 A;  5KRU A;  3PIP 3;  3HBL A;  4CDC C;  1TWG A;  3R3O A;  1LTA D;  2R7N A;  2B2W A;  1JDE A;  3KHR A;  3RZD B;  3TS2 A;  2I07 B;  3JAM E;  1I94 Q;  4UCR A;  4DK3 C;  3AEV A;  2CW0 D;  1PH8 A;  4XYL B;  1RYS A;  4HCS A;  3DF7 A;  3HP3 A;  3F2B A;  3GQC A;  2GA4 B;  2JQO A;  4IOA A;  2V4R A;  2BQR A;  3T1H Q;  3FRP B;  5DM6 3;  1VQO A;  5JPN C;  3G7L A;  1XNR H;  1TS3 A;  1B6S A;  3K58 A;  2R7Z G;  3G6J B;  1Q8K A;  4YB8 B;  3OMC A;  4P74 A;  2F4I A;  4MTE A;  2BQU A;  2PI2 E;  3CRL C;  3HOU G;  1S10 A;  2LKV A;  4N8F A;  2IA6 A;  5AJ3 Q;  2KOL A;  2K52 A;  2K7V A;  1MD2 D;  4JI8 Q;  5DGA A;  4DV4 H;  3X3N A;  2VUM G;  2VPQ A;  2BDN A;  2FKL A;  4J6H A;  1I4P A;  2FMM A;  2DIK A;  5EWE A;  1SNO A;  4J9N A;  4IFD I;  1RJP A;  1HFG A;  3U9S A;  2VB3 X;  1N36 Q;  1X65 A;  1CA5 A;  3PUZ A;  3R23 A;  2XC9 A;  1S03 G;  2JEF A;  2R92 A;  2E5L H;  2XTI A;  2QA4 A;  2BE5 C;  5KFL A;  2K50 A;  2XVS A;  4C3J B;  4DN4 M;  3RNU A;  1TS2 A;  1O7L A;  2LXJ A;  4B3M L;  4TUY F;  1CI3 M;  5M9O A;  3SE7 A;  2PMZ B;  5C0X J;  1NNX A;  5M5Y H;  4ZCK A;  1HNX Q;  4JK1 C;  5D1P A;  1SCU B;  1TWC A;  4JV2 A;  2NWG A;  5DLQ E;  3JAM L;  3H0G G;  2JJQ A;  2PW7 A;  3HOW G;  4J9L A;  1HZC A;  1SRO A;  3SK4 A;  4XYO A;  4X65 H;  1VQG A;  2B39 A;  2ZM6 L;  3JAM W;  1KAW A;  3BVG A;  2E2H B;  4JI7 H;  1CSP A;  3J81 E;  1K83 B;  1E1T A;  4DU9 A;  3ORQ A;  5L1L A;  2UVW A;  1XTD A;  3CU7 A;  4GLX A;  1X32 A;  4NW2 A;  1FKA H;  1A15 A;  1IBM Q;  4XXE A;  4ZQI A;  4JBK A;  1QZG A;  3P7J A;  4LFA H;  5FPR A;  2FLN A;  2IP4 A;  5COY A;  2AQ3 B;  1AN7 A;  2YU9 A;  2MUY A;  2WAQ B;  5GQO A;  3EVQ A;  4MV6 A;  4G3I A;  1OXU A;  2V58 A;  3QZ7 A;  3CC7 A;  1EY9 A;  3JZI A;  5K2M A;  5KG6 A;  4YIJ A;  2NN6 H;  2AQ1 B;  4RAU C;  1FD7 D;  1XMQ L;  3NEL A;  2B8G A;  3FKI A;  1TAE A;  2KCM A;  3CQZ H;  2VOB A;  2PW5 A;  4WJW A;  2A69 C;  4EVO A;  1JOO A;  3I4N H;  5ELO A;  2BH8 A;  4IZO A;  1UNS A;  3S16 H;  4BY7 B;  3KAL A;  4DR5 H;  1IBL Q;  4LF6 Q;  1II3 A;  1VCI A;  4UCO A;  1STB A;  3VR5 A;  1I94 H;  2CHB D;  3PQI A;  2EPB A;  3GTL B;  3GTJ A;  5L1J A;  4APV A;  4DR3 Q;  3PV0 A;  3HXL A;  4ZKC B;  3R5X A;  1WCM B;  1LTT D;  4CJ2 C;  4WRD A;  3MXP A;  1KDC A;  4ZYS A;  1E2Z A;  4X66 Q;  1U9R A;  2G5D A;  5CGK A;  3EFX D;  3UQ8 A;  4BY1 H;  1Y1V B;  1V1P B;  3SI8 A;  2HHH L;  1DV1 A;  3LML A;  1DD2 A;  2V1C C;  3GTK B;  4EGJ A;  2CWP A;  4C5C A;  3MFI A;  4NLG A;  3NQT A;  1T9H A;  1TWA A;  5T14 A;  3Q8S B;  1F9Q A;  3J81 L;  1PLF A;  5JUM A;  2B2V C;  1XNQ L;  5C4X B;  5KFE A;  1OXS C;  4ID6 A;  4DA2 A;  1Y1W G;  2XCP A;  2VA3 A;  4P75 A;  4KHP H;  4C3H G;  1KBL A;  5JPM C;  5ELE A;  1K3B C;  3Q23 A;  5IT9 W;  3RMH A;  3TEH B;  2CH4 A;  3J81 W;  4DNI A;  4X64 H;  4JI8 H;  2I0Q A;  3UDG A;  2XGP A;  1BCP B;  2UUA L;  4QIW A;  1IHZ A;  2X6L A;  2UVR A;  1WTV A;  1SRU A;  2Z0S A;  2Y0S B;  4L63 B;  2JA7 B;  1KL9 A;  2PNH A;  3WNZ A;  4IZ8 A;  1JX4 A;  2A19 A;  2VQF Q;  2D9U A;  2V4D A;  5KG3 A;  5DG7 A;  1CTM A;  1FNW A;  4I7A A;  3UFX B;  2PMZ A;  2UU9 L;  4GKK H;  3T1H L;  2R7D A;  2MHV A;  3IAY A;  4B3R Q;  2XGQ A;  1R4P B;  2OF1 A;  1VMP A;  1HQR D;  2XRS D;  3R2T A;  4KHZ A;  3Q0A A;  4NPS A;  1T94 A;  4UCU A;  1D8L A;  4IN3 A;  3KTM A;  2V4Q A;  3CPF A;  3L4J A;  3SXH A;  2E2H A;  2XD4 A;  3U58 A;  3CW2 C;  4NMZ A;  4O1N A;  1O7Y A;  4HR7 A;  3C46 A;  1HNW Q;  1Q1E A;  3RN5 A;  1I7L A;  1K83 A;  1F77 A;  5AJ3 L;  1IL8 A;  4KI0 A;  3HOY H;  3BDC A;  3CC4 A;  1CZG A;  1RJR A;  2F3I A;  5KEE A;  4GOP C;  4O3S A;  5ELC A;  2A74 C;  2RCN A;  1LTR D;  5CV6 A;  1SFO B;  2FJZ A;  4ECT A;  4R7R A;  4DKA C;  1TII D;  2ZXP A;  5LP6 F;  5FD6 A;  4OGQ C;  1N36 L;  3D31 A;  2WAQ A;  1IBM H;  1ZQ7 A;  3K5H A;  1Q8I A;  1PMR A;  4U67 3;  4A3E G;  3KUP A;  4A2A A;  4ODG A;  1SYD A;  2C00 A;  1TKW B;  3KK7 A;  3J7A F;  1NTG A;  4K6L A;  3V6K A;  3R93 A;  3KHL A;  2W6N A;  4PZ6 A;  4JV5 Q;  5JH7 F;  1HNX L;  1EWI A;  2MO1 A;  4KY6 A;  4OEM B;  4HJ9 A;  1F2Y A;  3VDY A;  4A3M G;  2M05 A;  5F9L A;  5I9P A;  4YCU A;  4QB4 A;  4RMF A;  5EWG A;  3M9N B;  2Q2T A;  1EUD B;  1UEA B;  5AFW A;  3Q1K A;  3GV8 B;  2VQE Q;  3GTL A;  1NBW A;  4ECX A;  3U4Z A;  3HRZ C;  1B1Z A;  3HOX G;  1GSO A;  1WCM A;  3HGB A;  4K5X A;  2F0V A;  4LF4 Q;  2WV6 D;  4M8A A;  5C44 H;  2A6E C;  3D4W A;  4FNF A;  2UXB H;  4YBZ B;  3TME A;  1Y1V A;  4OWX B;  1FVI A;  2EXZ A;  1HFN A;  3GTK A;  1MKH A;  5FK9 C;  3MWM A;  4IHJ F;  2R7F A;  1WTX A;  4HSV A;  3MC0 B;  5BR8 H;  1L0Y B;  2NVT B;  2NN6 I;  3BG5 A;  1CKN A;  3DEO A;  4A3D G;  2F0E A;  1ASZ A;  2F1M A;  5JEA G;  1HR0 L;  1ET9 A;  3KHH A;  2PNR C;  3DMU A;  3RB0 A;  3K7A B;  4HNU A;  4R8I A;  1SE2 A;  3UDX A;  4A3J B;  1HR0 W;  2IHE A;  1PRT D;  4B3S Q;  5C6A A;  3JC6 6;  2J6U A;  1Y8P B;  3WOE A;  1JOQ A;  1LT3 D;  1DZ1 A;  1ILQ A;  5JJI A;  3OSP A;  2CW7 A;  2F4V Q;  2V9W A;  4O0A A;  2RGR A;  3PSI A;  4JI3 Q;  2Y0S A;  4UHV A;  1N48 A;  3T1Y Q;  2ASB A;  4IO9 A;  4LF8 H;  1KDA A;  3OSN A;  2VQD A;  3E0E A;  3RAX A;  3TP5 A;  3GV3 A;  2R8G A;  2SOB A;  1IBL L;  4JBW A;  3MVV A;  2VQF H;  1TS5 A;  2KEC A;  4JI1 L;  5KNC A;  1LT6 D;  4C3I H;  3PIO A;  3K5L A;  3CVZ A;  3OIP A;  1S0M A;  4JI4 Q;  3MJF A;  4YHH Q;  4DR3 L;  4QWD A;  2IW3 A;  4JYA Q;  5L9X A;  4ECZ A;  5C4H A;  3WDN A;  5L37 A;  4APM A;  5CV7 A;  5M3M H;  1GM5 A;  3A5U A;  1JKJ B;  4X66 L;  1JLL B;  4B3R H;  2FPP B;  3BDL A;  1IBK Q;  3CCE A;  2RDG A;  3KXY T;  1W6J A;  2PPB C;  1STA A;  2F0N A;  5IYB G;  4DV7 Q;  1G2T A;  4BBS B;  1B8A A;  3DHQ A;  1NUC A;  5JVD F;  2F0T A;  1XXG A;  4IUR A;  2EZV A;  1K9M C;  1QOH A;  3PO2 H;  2X0S A;  3RIZ A;  1IZ6 A;  5M3F B;  4A75 A;  3KF6 A;  3VYU A;  4BBR B;  2YTY A;  5LMU H;  1X54 A;  3PMF A;  2UVU A;  4ZKB B;  1ML0 D;  3HKZ B;  1WH2 A;  3D3R A;  3QOJ A;  4JI6 Q;  3BYT B;  4N9T A;  3S1R B;  1SNC A;  3GLK A;  1JWM D;  5LMN Q;  1ZEQ X;  4DR4 L;  3BZK A;  4OX9 L;  1DIK A;  3BU2 A;  3GID A;  1L0X B;  3LP8 A;  5KGU A;  1Y14 B;  2O5J C;  1RK5 A;  3K81 C;  4JC0 A;  1CQJ B;  1EQV A;  4NXN H;  3HOV B;  3BA8 A;  4LJZ C;  3R5H A;  3I70 A;  1VQM A;  1NAP A;  4A3B H;  4DK1 A;  2LY7 A;  5L1K A;  1C30 A;  4GKJ Q;  3M4P A;  3A55 A;  2W9A A;  4IRC A;  2K5D A;  3GTP H;  5LXT F;  4YWL A;  4ALP A;  2JEI A;  3NK9 A;  4K6D A;  4ZUI A;  2YS6 A;  1KDB A;  3PF5 A;  5IP9 G;  3K7U C;  3C0F B;  1HNW L;  4KD3 A;  2W6M A;  3KBX A;  2IHF A;  3G71 A;  1WYD A;  4DAM A;  4F8M A;  5C3E G;  5JQW A;  1GUN A;  5IP7 H;  2B3G A;  2K03 A;  3CQZ A;  4LFC H;  3GTQ H;  2ZT9 C;  3F1Z A;  4A3L H;  1E7Z A;  2A73 B;  4KKT A;  3S2D H;  4EBD A;  1I6V C;  1AN8 A;  3NTH A;  4YWM A;  4ED1 A;  1M6V A;  1ET6 A;  1J9O A;  3PUW A;  4DXG A;  5JJZ A;  1QVG A;  1RKN A;  4BS9 A;  1WTR A;  1K0S A;  3PO3 G;  3QZ8 A;  1YZ6 A;  1W93 A;  1LV9 A;  2EVB A;  1XJV A;  3OUU A;  4J15 A;  2EXD A;  4J0M A;  1WTP A;  5FJ8 H;  5IYD G;  3NBH B;  2ZJT A;  3J7A 5;  2IBK A;  4JV5 L;  2QEX A;  2LS0 1;  1IL2 A;  2OCE A;  2J6S A;  5KFS A;  1FGB D;  3CRK C;  5ELB A;  4RNO A;  2VR1 A;  2K32 A;  1QE6 A;  1N9W A;  3TII A;  3SK6 A;  1PH6 A;  4RFB A;  3V4S A;  1P8L A;  4K2K A;  2VQE L;  4FP5 D;  1C8C A;  4MHE A;  5KT7 A;  3DM3 A;  1SND A;  2QKI C;  1KXL A;  2YZM A;  4IUN A;  4A3I H;  3ERO A;  2BE5 D;  4C2M B;  3KFU A;  3S1M B;  5DG9 A;  1O7Z A;  3FMA A;  2SNM A;  4YHH H;  4JV0 A;  1R9T H;  2W8K A;  2OLS A;  4JI2 Q;  3DWQ A;  2GPS A;  4RNN A;  2FE3 A;  1ZYR C;  3I4M H;  1TWH B;  3RB4 A;  1A2U A;  1EOV A;  1MIU A;  5DEH A;  2NBF A;  5LL6 X;  1RYR A;  3AFP A;  4HN7 A;  3DWP A;  4N8X 1;  1FGU A;  3RV3 A;  5FLX E;  5E4W C;  1N34 Q;  1IKL A;  4B3S L;  4P73 A;  1HUM A;  4R4Q A;  5IOD A;  1W96 A;  4KKU A;  4DNT B;  3WWV A;  2F4V L;  1U4P A;  4JI3 L;  1CHP D;  1KAB A;  4C3J G;  4N9P A;  3T1Y L;  2YTX A;  1I6H B;  2R7K A;  3KDF B;  1I6U A;  3S24 A;  2D0P A;  1KQS A;  2M00 A;  3HOX B;  1H9S B;  5KFP A;  2FFK B;  2AQ2 B;  1JB3 A;  3U4V A;  2KA7 A;  2EY1 A;  2JA8 G;  2YS7 A;  1OXT A;  3C3L A;  1RIP A;  3RGZ A;  1GVP A;  4R4T A;  4A3K B;  4A3F B;  1IBK L;  3BQ1 A;  3CMA A;  4PMC A;  3FDS A;  2UUC H;  4YY3 L;  3PR5 B;  4K8I A;  2HGS A;  2EE1 A;  4YR2 A;  2ALY B;  3ONA B;  4JI0 Q;  4JPB W;  2LMC B;  4DV7 L;  1ENA A;  2F0W A;  4JW0 A;  3I7F A;  2B63 H;  1EUJ A;  1IKM A;  4RGM A;  3CXC A;  2HVR A;  1F9S A;  1YNJ C;  1TWG B;  2L0C A;  4K14 A;  1PFB A;  4RG1 A;  1UE7 A;  1JJ2 A;  1OWT A;  1HTP A;  2R3Z A;  5DQH A;  3PZP A;  3NE5 B;  4ME6 A;  4JI6 L;  4JOI C;  2WAQ G;  1YHB A;  1D6E C;  4Q0Y A;  4FXD A;  3DWA A;  4TQS A;  2OXP A;  4L6T B;  1BBW A;  3RLO A;  2JSO A;  3IG0 A;  3ERS X;  5I2X A;  1ENF A;  1S72 A;  1Q3L A;  3M3Y H;  4AQY H;  5LMN L;  1LT5 D;  4QIW E;  2A6H C;  1Q81 C;  1GHK A;  2RQX A;  1E2W A;  5FLX L;  5JEA J;  5C0X H;  2A68 C;  3TSS A;  1I7N A;  3FP9 A;  2W6Q A;  4DV5 H;  1EZ8 A;  1N32 L;  3NEM A;  3T4A C;  3HS0 C;  4OIJ A;  5LMN W;  2JA6 B;  1PK8 A;  3OHA A;  4S3S A;  3IL8 A;  3TQY A;  1HNZ Q;  5KFK A;  1HZ9 A;  1NSN S;  1GUG A;  2R84 A;  1NJI C;  4GKJ L;  4BY7 G;  4DGZ A;  2AMC B;  2PMZ E;  2JA5 H;  1GYF A;  2CZG A;  2NTS A;  1SBB B;  2J7Z A;  2IPK D;  1EY0 A;  2DPJ A;  1M90 C;  4L5Q A;  3A5Z B;  1KD1 C;  1WCM G;  4FDB A;  1XX8 A;  3CKI B;  1RDP D;  4EX5 A;  4Q44 A;  4IJH A;  4XTC S;  2AGO A;  4LAA A;  5IYZ F;  4IAJ A;  1WVL A;  5FO9 B;  4DR2 H;  4ED0 A;  2W6O A;  2PZW A;  1Y1V G;  1A2T A;  4O4L F;  2R82 A;  3U50 C;  1Y8N B;  5CBA E;  1L2F A;  5IGG A;  2R92 B;  4RB0 A;  1Q1B A;  3G8C A;  4NP5 A;  3J80 c;  5J22 A;  3Q8R B;  1XMQ Q;  3HOZ H;  4LF9 H;  4JI5 H;  1SE4 A;  5C4X G;  1BR9 A;  1ICW A;  3ETH A;  2FJ2 A;  1MSG A;  3VA5 A;  4JI2 H;  2B2Y A;  4NXM Q;  1JR0 D;  3ERQ A;  5KG5 A;  4XT3 B;  5KFI A;  4DV1 Q;  1TWC B;  1LO5 D;  2FIN B;  2WAQ E;  2EOT A;  2EYL A;  5KYL A;  1EQQ A;  4RZQ A;  1G8Z D;  1G29 1;  2Y0S G;  2JA7 G;  2H4O A;  4QL5 A;  2ZJP A;  1DV2 A;  1M7J A;  2FK2 A;  4O2B F;  3L3O C;  2QK4 A;  2ID0 A;  3L4K A;  2B2W C;  5EWF A;  2PQA A;  4MN3 A;  2MGS A;  2YL2 A;  1H9S A;  1TT2 A;  1AUV A;  2FHT A;  4IJL A;  2CH4 W;  1V8Q A;  4X3U A;  3RV4 A;  2UUB L;  4RHS A;  2X69 A;  3OHX C;  1VQ9 A;  5KG2 A;  3G6Y A;  2B2T C;  3BZD B;  4RB2 C;  2ASL A;  3GTM H;  3ER0 A;  2F0H A;  4DAP A;  5CA0 F;  3ITP A;  1GJX A;  3K5O A;  4C5A A;  1PH4 A;  3CCV A;  1YBY A;  3W3A A;  1BJT A;  1R4Q B;  1STY A;  1V1O A;  3FKI B;  3MXU A;  5BPH A;  2NVQ H;  1LTI D;  4IQZ A;  3KF8 B;  3S1Q H;  4PWQ A;  1UE1 A;  3VMM A;  1NR2 A;  1VKZ A;  1F2Z A;  4YR3 A;  1QB5 D;  3RZO B;  4EQN A;  1N34 L;  4R8U A;  1X55 A;  2NVY B;  3Q22 A;  4EYH B;  2UU9 Q;  2A6E D;  2Q2I A;  4I65 A;  3HZX A;  2TSS A;  4JG2 A;  4B3M H;  3GTJ B;  4I4T F;  4MV3 A;  5I6Y A;  2F03 A;  3OSO A;  2B2T A;  5EPL A;  5I47 A;  3OTO Q;  1VQH A;  5KT5 A;  2RDJ A;  2UVV A;  5IYC G;  3N43 B;  2Y0S E;  3SE0 A;  2JA6 A;  3A54 A;  1DOK A;  4KJO A;  4TV9 F;  2R93 H;  1MHW C;  2N78 A;  3I3C A;  2AQ4 A;  4RCO A;  1UEB A;  3J80 i;  5KND A;  1TWA B;  4LF7 Q;  4A3G H;  5KFJ A;  2ZM6 H;  1I3Q B;  1L0W A;  1IOW A;  1MBY A;  3VR2 A;  1AZQ A;  3VYT A;  1PV4 A;  1AE2 A;  3TRE A;  3CAM A;  1IXR A;  2DUD A;  5GON F;  3H4B A;  3MAQ A;  4DXF A;  4A93 H;  4ETS A;  2KUM A;  5EDW A;  4ED7 A;  4Q0F A;  1RK6 A;  4JI0 L;  4IAL A;  1GSA A;  3VA7 A;  4QIW B;  4IPH A;  3AU7 A;  3VR6 A;  2Q2U A;  4HQ6 A;  4DL7 A;  4LNQ A;  2M2L A;  3NUC A;  2NU6 B;  4DK6 C;  2L11 A;  1STH A;  2UXC Q;  3PIP A;  3UE1 A;  3RR5 A;  1JC7 A;  2MO0 A;  2PZT A;  4QMG A;  4ZOL F;  5CB4 F;  3F2D A;  1EYA A;  4CKE A;  2VPS A;  4KY7 A;  5FPO A;  5CBE E;  5C0X I;  4A3C H;  3LX0 A;  4POF A;  3N42 B;  1EOT A;  1C4Q A;  2UXD Q;  1U4R A;  4A3J G;  5KFY A;  4HJA A;  4JBM A;  4BWS C;  5KIX A;  3JSN A;  2XN9 C;  4Q43 A;  2JA8 B;  3RGX A;  1CKM A;  4OO1 G;  4C5B A;  2KHS A;  1Z47 A;  2NYZ D;  2IX3 A;  4NKL A;  4IUT A;  1FJG L;  3I91 A;  1HXY D;  3V4Z A;  1HNZ L;  3NGD A;  4DV6 L;  5KFX A;  4RCN A;  2E2I H;  2AU0 A;  2RHS B;  5LA6 F;  2EIF A;  2K5H A;  2B2U A;  4HR7 B;  5IT9 E;  4DV3 Q;  3N6X A;  4DR1 Q;  4UCV A;  1E22 A;  4KY5 A;  1M0W A;  1EEF D;  5IOC A;  1ZHS A;  1SEI A;  2EY2 A;  2HQL A;  4ECQ A;  4LSA A;  4OIK A;  3GTG H;  2HHH H;  1O80 A;  2ZDH A;  5C5L A;  4A76 A;  1HR0 Q;  1SJE D;  3V6J A;  3S2H H;  2CCZ A;  2R7Z H;  5DGB A;  2K04 A;  3RBE A;  2J0T D;  5EBD A;  4ZHQ F;  1B33 N;  2PYK A;  1I50 B;  5DAU A;  1XNQ H;  4E6I A;  4BBS G;  5KT2 A;  3W2D A;  1CM9 A;  2R61 A;  4EQO A;  2NZ1 D;  3CPW A;  4GC6 A;  3HOU H;  3M7N A;  2AWN A;  2E75 C;  5M3F G;  4DFA A;  3CCR A;  3MWD A;  3KF8 A;  2ALZ A;  4NXM L;  4BBR G;  2UUA H;  3H20 A;  2IY5 B;  3URY A;  3F2C A;  3HKZ G;  3NHH A;  1VAJ A;  4DV1 L;  3SEB A;  2VUM H;  4AH6 A;  2NVY A;  1PH7 A;  3H3V C;  5GAE C;  4JI1 Q;  3HKS A;  1B3A A;  3GP7 A;  1A3T A;  1EWC A;  2HCC A;  5D1O B;  5FLM G;  1OTC A;  3T1H H;  3E5S A;  1VQ5 A;  1S40 A;  1N56 A;  1IW7 C;  3HOV G;  1EHI A;  3Q24 A;  1Q90 A;  2PBZ A;  1QZH A;  3SDZ A;  3V2T A;  2V59 A;  1PHJ A;  1BUV T;  1Q7Y C;  3L2P A;  5J3B A;  2ZTC A;  1D5M C;  1CKN B;  5IT9 L;  4X3K A;  1I3Q A;  3ULP A;  2E2J H;  2W9B B;  2WB1 A;  2JEG A;  1GUS A;  3ICE A;  1WSC A;  5KFF A;  3MWY W;  1XMO L;  2D5D A;  3H0G H;  4LH7 A;  3HOW H;  4KV6 A;  3U9T A;  1W6K A;  1B9N A;  3RBD A;  2ASD A;  4OXP A;  3AYH B;  4KJN A;  5E7N A;  2K5Q A;  5C3W A;  3AQQ A;  4JV1 A;  1H95 A;  4RB3 C;  4DR4 Q;  1N36 H;  4OX9 Q;  2DLN A;  2LSS A;  1CHQ D;  4XIG S;  1D2B A;  1PFM A;  1GGO A;  4M9U A;  4QCL A;  2I80 A;  4EEQ A;  1QG7 A;  5LL6 S;  2QIL A;  3J7A V;  2WTF A;  2JA5 A;  1OXX K;  1AEX A;  3ND8 A;  2C28 A;  3HKZ E;  1CQI B;  1J5E L;  3STB C;  2EYH A;  5A2Q W;  3OTO L;  3T51 B;  3S15 H;  1DOL A;  5KKN B;  1ZYR D;  4RAY A;  4F7X A;  1HNX H;  2MJ8 A;  3P1H A;  4DR5 L;  4RUC A;  3QOL A;  4PZ7 A;  2VY3 A;  3H15 A;  1SYX B;  1QIL A;  3CD6 A;  5BN4 A;  5KFO A;  4RNM A;  2BCO A;  4LF7 L;  1C0A A;  3K8A A;  3P20 A;  4UFZ A;  1L1O A;  1X3G A;  1B4O A;  2JEB I;  1GUO A;  2XIW A;  3KF6 B;  2H5X A;  1S5C D;  1NCV A;  5M5Y B;  1A62 A;  4ZRZ A;  5C1P A;  2F0F A;  2ZTD A;  5C4J H;  4QGU A;  3TBI B;  1VQL A;  1QUQ A;  5J39 A;  1KC7 A;  1VBH A;  3RLF A;  1VQC A;  1VQ8 A;  3MR2 A;  2UXC L;  1I50 A;  4KHP L;  4JBJ A;  1BF4 A;  2N8N A;  4QWA A;  2KSW A;  4LMQ D;  4O3P A;  2L5T A;  3E9I A;  3T13 A;  4X3T A;  2K33 A;  3GO5 A;  3PCO B;  4FYD A;  4L5R C;  2UXD L;  2I5L X;  1Y1W H;  3S14 H;  1S0O A;  4C3H H;  1BCP C;  4BXX G;  3K80 C;  3G6V A;  1JE4 A;  3IRB A;  3BJY A;  2X6G A;  2OTJ A;  2KCC A;  4J1M A;  4NDX A;  4IWX A;  5D1O A;  4GKK L;  1X3Q A;  5CV9 A;  3FDT A;  1S0N A;  4F4W A;  1IBL H;  4LF6 H;  1D1K A;  4EGQ A;  4DV3 L;  1SMY C;  2EY6 A;  4DR1 L;  5KG4 A;  3LWB A;  2BH2 A;  1K28 A;  3IFT A;  4DR3 H;  2FP4 B;  4TRD A;  5KFH A;  3T5H A;  4X66 H;  3CQZ B;  4Z9C B;  1E3P A;  2W6Z A;  2F0P A;  3T5J A;  5FO7 B;  2A6H D;  4GLV B;  3BQ0 A;  3VR3 A;  2W9B A;  4A3K G;  1YNN D;  4A3F G;  1U4M A;  3ND9 A;  4K2L A;  3I4N B;  2A68 D;  2FLP A;  3S16 B;  3M9O B;  2W9C A;  4GNX A;  3NWT A;  5KFR A;  1BBX C;  4LFB Q;  4RUA A;  5ELF A;  1A9X A;  3GIK A;  1QVC A;  4KHV A;  2LFN A;  5I6W A;  3GTO H;  5DLG A;  1HPC A;  2RDF A;  1D7Q A;  1F9P A;  3Q8D A;  5BMV F;  4YQW A;  4XQQ A;  4FF3 A;  2WP8 J;  1QVF A;  5KFM A;  3K59 A;  4BY1 B;  1ZKO A;  3U9O A;  4L8J A;  2ASJ A;  4IR1 A;  3S1N H;  2NB0 A;  2ENB A;  4DR4 H;  2R8H A;  3BVZ A;  3S1M H;  4OX9 H;  4J9R A;  2C2D A;  4IRK A;  1SNP A;  2W9C B;  4IPG A;  1ESR A;  1KJ9 A;  2XCA A;  5K36 G;  3EIV A;  2K05 A;  4DR7 Q;  1TA8 A;  2BDO A;  4A3E H;  2JA6 G;  2LXK A;  3PW7 A;  4XQJ A;  2Z4H A;  5ISR A;  1RD9 D;  1T3N A;  1HCZ A;  4EBC A;  2R85 A;  4YY3 Q;  3NWS A;  1EIH A;  4OHJ A;  2KHJ A;  5EPK A;  4ZLT F;  1GLV A;  2GPW A;  4DPG A;  4G57 A;  1CS0 A;  2F3V A;  4YAJ B;  4B9X A;  5M5W H;  2YV5 A;  2DPI A;  1HNW H;  4A3M H;  1C48 A;  5JVG 3;  4FF2 A;  2UXB L;  3K5I A;  2K4K A;  4OON A;  1XPO A;  2NVX H;  2R7M A;  4E4T A;  1EIF A;  2BA0 A;  1S4Z A;  4FM9 A;  1AUX A;  3NTK A;  5BR8 L;  4F87 A;  2F0Q A;  1XTC D;  4FS2 A;  4M1U B;  2R92 G;  2L4N A;  1SEB D;  1EIG A;  2ICI A;  3M4O H;  4QUC A;  4ME3 A;  4U6P A;  2FXQ A;  2RKS A;  2OH2 A;  2CFM A;  4Q45 A;  2W57 A;  2W7P A;  1VQB A;  1N32 Q;  2GVA A;  2O2L D;  2WAC A;  2PQE A;  1X3P A;  1B70 B;  4L1K A;  1KC8 C;  3HOY B;  4LF5 L;  5DM7 3;  4A3D H;  4MV9 A;  4HIO A;  3FHW A;  5M5X H;  2DN8 A;  5JEA H;  1CE8 A;  1PTO D;  2HT1 A;  5KYI A;  5F9N A;  1UE6 A;  5DG8 A;  5CC4 A;  3MFG A;  4EFE A;  1TWF H;  4K5V A;  4JV5 H;  4XT1 B;  5KNB A;  3QJY A;  3PR4 A;  4I55 F;  2F0S A;  4B3T Q;  3C1F A;  4HMI A;  5KFC A;  4UCS A;  2BR0 A;  4X3S A;  4DUY L;  2F0D A;  3KLW A;  5KFG A;  5GAD C;  3RN2 A;  1NMG A;  3K0Y A;  3AFQ A;  2VQE H;  1LTB D;  4ED8 A;  3B6Y A;  4RH6 A;  2CWA A;  2RGV A;  4LF4 H;  2Q8R E;  4J9Q A;  4CDE C;  5F2D A;  4HAE A;  5HY6 A;  1AP0 A;  2O5I C;  4EEY A;  1PX2 A;  4MIU A;  1VQ4 A;  2E2D C;  4OEL B;  4A4I A;  4JCV E;  4HSP A;  2HDL A;  5D3I B;  1RF2 D;  5COR A;  1YHA A;  2MQH A;  1PZI D;  1SXT A;  1X3F A;  2JK8 A;  1PTO H;  1I4H A;  1LTG D;  1VMC A;  2EYO A;  3FKI G;  4CGY B;  4AYB B;  1VQF A;  4DAV A;  1U5K A;  5IYB H;  2VZA A;  1NMF A;  3GIQ A;  5C44 B;  4B3S H;  3QFF A;  1S9F A;  1B53 A;  3V96 A;  2F4V H;  4JI3 H;  2RBM A;  1JJG A;  3T1Y H;  2XWJ B;  2UUB Q;  1ASY A;  3E9H A;  5LYJ F;  1STN A;  3JSL A;  2FMC A;  1Z2P X;  1EU3 A;  2PCF B;  4MV1 A;  5TSS A;  2HIV A;  4ZQ3 A;  3OPO A;  3WO1 A;  5K5P A;  2CQY A;  2FLL A;  3M7G A;  2VW9 A;  4DAY B;  1CA6 A;  4JI4 H;  1B3Q A;  3TP8 A;  4JYA H;  3Q8P B;  1VDZ A;  1SE8 A;  2XCL A;  1IBK H;  1HTL D;  4TV8 F;  4IFD G;  4IR9 A;  3CCS A;  4WOR A;  3E3X A;  4DV7 H;  4LMY A;  3KLS A;  2RDI A;  1DGS A;  4CHT B;  2NZO A;  3H09 A;  4DV0 Q;  2DNC A;  4LFB L;  1RCV D;  2FPI B;  4C3I B;  4DUZ Q;  4GN4 B;  2W71 A;  1STE A;  5JVH 3;  1G91 A;  3D6W A;  4DL3 A;  1NE3 A;  1LT4 D;  4KN7 C;  5IP9 H;  3R8B A;  1E4F T;  2HCI A;  5M3M B;  4JI6 H;  1WI5 A;  4IPC A;  3N41 B;  2PQA B;  1KHI A;  1PH2 A;  3LWE A;  1YIT A;  1BXR A;  5C3E H;  5CA1 F;  4Y7N H;  4J9O A;  2EYM A;  5LMN H;  1LAB A;  1AFP A;  1PRT F;  1PRT B;  5LHY 1;  3PO2 B;  2YU9 H;  2DWC A;  2DZD A;  2R8J A;  1ONL A;  3OMG A;  1EZ6 A;  3RUP A;  2A1A A;  3GII A;  2JXM B;  1M1K C;  4DR7 L;  3J81 c;  1LTS D;  4LUZ A;  3D4R A;  1WFQ A;  5IWA Q;  4GKJ H;  1N33 Q;  1V1Q A;  1SE3 A;  3PO3 H;  3S17 H;  4CJ0 B;  3C2P A;  2GVB A;  1PVO A;  1GHJ A;  1STG A;  2A69 D;  4O3Q A;  4O3O A;  3V6H A;  5IYD H;  3RZD H;  4QWE A;  1PYS B;  3JAM i;  3OWE B;  4K0K Q;  3QIA A;  1EY7 A;  1VQP A;  4QUF A;  4DF7 A;  5D14 A;  1K8A C;  1Z2N X;  1H9J A;  4OL7 A;  4R4C A;  1HUN A;  3FVQ A;  2YCH A;  5HV6 A;  3M85 A;  2QDL A;  3VYR A;  3GIP A;  2ATL A;  4A3B B;  4R8U B;  3K5M A;  1OXV A;  3KJO A;  2BA1 A;  1UAP A;  3K3P A;  4ECY A;  2HUG A;  2N88 A;  4MAM A;  2NZH A;  5IGC A;  4V0B A;  3O13 A;  3ZYY X;  1CUK A;  5NUC A;  2DY7 A;  1JJC B;  3GTP B;  2NU7 B;  1QJO A;  1YHQ A;  1MSH A;  1RTN A;  2KEN A;  2ICE C;  4EGV A;  5KFQ A;  2HD3 A;  4R9W A;  2QEJ C;  4AYB A;  4PG3 A;  3SGI A;  3MR5 A;  1EY4 A;  4YCW A;  1B7Y B;  2B2Y C;  1FJG Q;  1BGW A;  3CHB D;  4DV6 Q;  4G7H C;  5EQ0 A;  3TN2 A;  1XNR Q;  5KT3 A;  1TQO A;  4RGO S;  4LSX A;  3BAB A;  3TQ1 A;  2YZG A;  3SVM A;  3GTQ B;  2Q8T A;  3EJI A;  3H91 A;  2E8G A;  4B3T L;  2K75 A;  2NTT A;  2I5H A;  3H3V H;  1PZK D;  1M4V A;  3S2D B;  2R87 A;  2M9V A;  3CCL A;  1CKO A;  2UUB H;  1JCK B;  1VQI A;  2K1B A;  2L9H A;  4HNT A;  2F0I A;  1Z6H A;  4C3J H;  4DAY A;  1T36 A;  5EKI A;  1PTO F;  1NY4 A;  2K01 A;  3QR8 A;  3EN2 A;  3KLS X;  3L0O A;  2VL6 A;  3Q2O A;  1L2Z A;  1PH3 A;  4DV4 Q;  3GTO A;  2MP1 A;  1WJJ A;  1Z7T A;  1SNQ A;  2E74 C;  3FEW X;  4HMJ A;  3NEN A;  3T53 B;  4KN4 C;  4HJ7 A;  1FR3 A;  1SNM A;  1U0L A;  2UUC L;  4TVA B;  4BWG B;  3CCU A;  3H40 A;  4IWY A;  4EQ5 A;  1ZHQ A;  1ILP A;  2JA8 H;  1G51 A;  1G6Z A;  3F8N A;  2CVR A;  3EYY A;  2E5L Q;  2PVP A;  3A8I E;  2E2H H;  1EQR A;  2NUA B;  1EL0 A;  1EZ1 A;  3NPP A;  4MV4 A;  4A3I B;  3DUZ A;  4FO2 A;  3J81 i;  1N8R C;  1K83 H;  1E4G T;  3A8J E;  1N34 H;  4RA8 A;  5A35 A;  2O4X A;  4ILW A;  4O3R A;  2F52 A;  4R4O A;  2FB9 A;  2KHI A;  4QWC A;  5EAY A;  1R9T B;  4J9S A;  1WD1 A;  1WD0 A;  2TMP A;  3N44 B;  3LWU A;  3I4M B;  4RKL A;  1SMX A;  4X65 Q;  2YZN A;  2R8K A;  1RJT A;  2HIX A;  2XNA C;  3E6Z X;  3QG1 A;  1A3V A;  4JI7 Q;  3HB9 A;  3WO0 A;  1KTK A;  1BNZ A;  1SYC A;  4DR6 L;  2K5W A;  2FK3 A;  4U68 A;  3TIG A;  3VPC A;  3KHG A;  1XMO Q;  3NSW A;  5CYU A;  5ELN A;  1PFS A;  2NU9 B;  1JIH A;  4RGT A;  3BYY B;  4LFA Q;  1BCP D;  3NQI A;  4BY7 H;  4JI0 H;  4DR2 L;  3RB6 A;  4CJ1 B;  1ULZ A;  1IYV A;  4DV0 L;  2JEJ A;  3R5F A;  3BS1 A;  5G3L D;  4DUZ L;  3GTL H;  4I50 F;  2OT2 A;  1SDF A;  3HEJ A;  5I4D A;  1Y69 U;  1SMY D;  4ED3 A;  1WCM H;  1HHV A;  2C35 B;  3M4I A;  3BQ2 A;  2XSC A;  2IWH A;  3UI2 A;  1TWF A;  4FU0 A;  1SYG A;  3GTP A;  2F0K A;  1IYU A;  1J5E Q;  1Y1V H;  2QYZ A;  2HVQ A;  3S9W A;  3H4D A;  3FMC A;  3GTK H;  2ZXR A;  5EBC A;  4XX0 B;  1EWH A;  1JOR A;  4DR5 Q;  1HQM C;  2AGQ A;  2D62 A;  2B63 B;  1UC8 A;  3EPI A;  2WFW A;  3P75 A;  1P16 A;  1AE3 A;  2RDH A;  3KAK A;  3GD7 A;  5C4X H;  1DOM A;  4IUV A;  1ICF B;  2WKC A;  3VPB A;  2HVS A;  1FJG H;  3MWE A;  2Z6K A;  5DQG A;  1HNZ H;  4DL2 A;  2RCF A;  1KIX A;  2NUC A;  4DV6 H;  2WB1 B;  4POG A;  5IWA L;  2N49 A;  2QW7 A;  3GTQ A;  2XIG A;  3VYS A;  1N33 L;  3A74 A;  3BVM A;  4HED A;  4EYI B;  2YRX A;  3F2U A;  5CAE B;  2W7O A;  2B2U C;  5CV4 A;  4F4X A;  4O2D A;  1VQA A;  4UP8 A;  2JA7 H;  2YYZ A;  4OWW B;  3M3Y B;  1DJR D;  4B9W A;  2NN6 G;  2K28 A;  3X3M A;  3RFC A;  2OWO A;  4K0K L;  1BOS A;  4MA5 A;  4RB1 A;  2OTL A;  3GDE A;  5JJL A;  5FD5 A;  4KHP Q;  1YEZ A;  2XRQ D;  3E5N A;  1PH1 A;  3D0F A;  1YJN A;  2I46 A;  2WIN B;  4DV2 L;  3TP6 A;  4X64 Q;  1GD7 A;  2OEO A;  5KFD A;  3I4N G;  5DNF A;  3T16 A;  2SCU B;  1ZET A;  1E0B A;  4X62 L;  3MHB A;  1TXY A;  2JA5 B;  1XMQ H;  4ED6 A;  5JJK A;  4LK1 C;  4C1N K;  1GXD C;  2ZJQ A;  2I5M X;  2MNA A;  3QO2 A;  2C5C A;  1A6X A;  4IFD J;  2SDF A;  4NXM H;  3A8K E;  1V9P A;  2C2R A;  1RHP A;  4JVZ A;  4DV1 H;  1H9R A;  3DXJ C;  2DY8 A;  4J9K A;  2D0O A;  4ZI7 F;  1TVX A;  4GKK Q;  4BY1 G;  2QF7 A;  3H3V I;  4YJ3 F;  2L55 A;  5KG0 A;  1HA5 A;  1KEE A;  3DEP A;  1CT1 D;  3CC2 A;  4F4Z A;  4EBE A;  4IUU A;  4UDU C;  1XNR L;  5EZY F;  1R9T A;  1A0I A;  1SFO H;  3KJP A;  3HOZ B;  1K8O A;  1L1O B;  3I56 A;  5CV5 A;  3K3V A;  4R8N A;  3HFZ B;  1VQJ A;  1QNK A;  5JOB A;  1E4E A;  3BA9 A;  3EA6 A;  1SYB A;  1PYB A;  4XYQ A;  4EFB A;  1QUQ B;  1WOC A;  1HZB A;  5J1Z A;  3RUZ A;  2KJX A;  2K5V A;  4DV4 L;  5IYC H;  2KEE A;  3CF5 A;  1O7I A;  1Y8O B;  2G9H D;  5D65 A;  3PW4 A;  1XMO H;  5A2Q E;  3A0J A;  5KG7 A;  4IUQ A;  1PYW D;  2AWO A;  1EEI D;  3BJU A;  3K57 A;  1D1I A;  4TQR A;  1VF7 A;  1NR4 A;  4PNY A;  1M0T A;  5FO8 B;  1IOV A;  2E5L L;  1FYC A;  3AB9 A;  3UE0 A;  2D2C C;  2IT1 A;  1E24 A;  2DNE A;  1Q46 A;  1VQE A;  1CSQ A;  4YWK A;  3GTM B;  3T5L A;  3RAQ A;  5EOY A;  3GV5 B;  1KLG D;  4I7Z C;  4PDB A;  5C3X A;  2UU9 H;  1TY0 A;  4F88 A;  2CW8 A;  3GV7 B;  3I90 A;  5E4X A;  2AUK A;  2E76 C;  2NVT H;  4XYM B;  1J5E H;  2F0L A;  3HOY G;  4U7C A;  4DK0 A;  2B63 A;  3OTO H;  4HIK A;  2R86 A;  4UAI A;  2Q2H A;  2NVQ B;  4X65 L;  2AHO B;  3MA2 B;  4YR0 A;  3S1Q B;  3K7A H;  3Q6S A;  4MZ9 A;  2A5H A;  4DNR B;  1YIJ A;  4IUP A;  4A3J H;  4JI7 L;  4QWB A;  4QW9 A;  1MZB A;  1CQF A;  3D8G A;  4GOP B;  1W3S A;  2UXB Q;  3H94 A;  4ULL A;  2B8F A;  3SR1 A;  4CBV A;  4GNX B;  2ES2 A;  1T5X D;  1JWS D;  4OO1 H;  1O75 A;  2YYA A;  3CCJ A;  4LF7 H;  1JB7 A;  1EU4 A;  3SK5 A;  4HTH A;  4FF1 A;  5BR8 Q;  2VXW A;  1A3U A;  4LFA L;  4FBT A;  3QB3 A;  5GAG C;  2F0M A;  3I55 A;  2FK1 A;  3MR3 A;  1K73 C;  3R2I A;  4IPD A;  1BQQ T;  1L1O C;  3N6R A;  3I72 A;  4PV1 C;  2ZDG A;  2YTV A;  5CR3 A;  4BA2 I;  1I4R A;  1EUC B;  2R93 B;  4UPA A;  4J9P A;  1QCB D;  4CKC A;  4XDX A;  2UXC H;  2HQE A;  5IE8 A;  3D6C A;  3I4L A;  3WOF A;  5A2Q L;  1DYQ A;  1K3R A;  2JA9 A;  3J80 E;  1B9M A;  4A3G B;  4LF5 Q;  1RTO A;  3C1E A;  1BCP F;  1SSO A;  4LF8 Q;  5HGQ A;  1MJC A;  1SLJ A;  4PMB A;  4TSS A;  4AYB G;  4A93 B;  3PN1 A;  2UXD H;  5LOV F;  1A8V A;  5IGE A;  4IRD A;  1QNU A;  4MTN A;  5C44 G;  1LUZ A;  5G3L F;  4BBS H;  4AIM A;  1H9M A;  4DUY Q;  4UP9 A;  1Q82 C;  2I87 A;  5BN3 A;  1I94 L;  5M3F H;  4BBR H;  2F0O A;  1CK1 A;  4ECW A;  1RL2 A;  1K8M A;  5HUR A;  2IX0 A;  1VQD A;  4G7Z C;  4O4I F;  4DV3 H;  4KK7 A;  4DR1 H;  4DL6 A;  5IGB A;  1FNV A;  1SN8 A;  2KCT A;  1D5X C;  1EFI D;  3S1R H;  2B2V A;  3OUZ A;  5FLM H;  1EYC A;  1LYL A;  5ELD A;  3W1G A;  4KTA A;  3A56 A;  2J6T A;  1EYZ A;  1HR0 H;  1YVC A;  3CP0 A;  3HOV H;  4QQB X;  2IJ0 A;  2KVM A;  4F50 A;  5FLX c;  5LMU Q;  1EYG A;  2E2I B;  3NTI A;  4X64 L;  2GN5 A;  4JI8 L;  2J9G A;  2WKD A;  1FNU A;  1G2S A;  2H1E A;  3CCM A;  4Y8V B;  2QCP X;  1BXT A;  2VB2 X;  4H44 C;  4NB3 A;  4GNX C;  3RB3 A;  4O3N A;  4C3I G;  4B08 A;  4TKO B;  2G9D A;  1PDQ A;  1I4G A;  1KAA A;  1F2M A;  2K5N A;  4RWS C;  1PH9 A;  1B50 A;  2EY5 A;  4X6A H;  2CQA A;  4EG0 A;  1C9O A;  2AUJ D;  4KMU C;  4O42 A;  3ZJY C;  1HH2 P;  1UWV A;  5M3M G;  1HA6 A;  3GTG B;  2O03 A;  2OQK A;  1YNJ D;  3GTM A;  3J80 L;  4C56 C;  2F3W A;  4NXN Q;  3S2H B;  4QJF A;  1KRT A;  1DON A;  4ZK9 B;  2R7Z B;  3GIL A;  4AYB E;  4JI1 H;  1S5D D;  2HDM A;  2KBN A;  5KFT A;  2L12 A;  5IGD A;  4DL5 A;  3MXN B;  3J80 W;  1KNA A;  1C7Y A;  3MR6 A;  2QDB A;  4FVM A;  4CDF C;  3PO2 G;  2WE6 A;  3HOU B;  3FPP A;  4UCT A;  1JMC A;  1V43 A;  2ZJR A;  2DJG C;  4YCV A;  3PIO 3;  4CDD C;  1H9K A;  4LW1 A;  3J7Z C;  2EYJ A;  1M8A A;  4GOP A;  2VUM B;  2JE6 I;  2PN1 A;  2AKW B;  3KAJ A;  2CW0 C;  5LL6 b;  2WDT A;  4FXK C;  1LTL A;  2EQS A;  3V05 A;  4R1J A;  4HYK A;  4LFC Q;  4O4H F;  1Q12 A;  3A7A B;  3DLL A;  4XQN A;  3J81 j;  1V1P A;  2F0J A;  3A7L A;  1HZA A;  1IBM L;  1JXL A;  1BVS A;  5DQI A;  5I2Y A;  3MZ5 A;  5IGF A;  4JUZ A;  1DCZ A;  1X3E A;  4A3B G;  2OQ0 A;  2FPG B;  4ECU A;  3IFD A;  1WR2 A;  1J6Q A;  2R93 A;  5T1G A;  3VPD A;  3TZU A;  2KED A;  3PUX A;  5T1I A;  2EJF C;  3G6E A;  3ULJ A;  3TP7 A;  4C2M H;  5KFA A;  1JOK A;  4PQX A;  5IIF A;  3PW0 A;  2E2J B;  2C9O A;  2QGQ A;  1XPR A;  5D8D A;  2J4X A;  4FXG C;  2IL8 A;  2A8V A;  3H0G B;  1S5E D;  5JVL A;  1EY5 A;  4LF5 H;  2ZDQ A;  3HOW B;  1OO9 B;  1UUP A;  2JA7 A;  3MFH A;  1TWH H;  5C5M A;  4Q8F A;  2PI2 A;  3N40 P;  4OO1 I;  3NXW A;  1HRJ A;  5EKL A;  1J8I A;  1I4Q A;  5IP7 G;  4DUY H;  1K8G A;  4LF6 L;  3N8D A;  2KCN A;  1U4L A;  4R4I A;  4A3L G;  2CQO A;  3EQL C;  4BXX H;  1BNC A;  3BAA A;  1JWU D;  2Z6B A;  3KOJ A;  3L7Z C;  2VUG A;  3I73 A;  4LH6 A;  1S5B D;  1I6H H;  4QF4 A;  2CKZ B;  3UDF A;  2Q8I B;  3SHL A;  2SEB D;  3ULL A;  3HOX H;  1Z2O X;  1AW7 A;  2K6A A;  3S15 B;  4MV7 A;  4F4Y A;  2ATW A;  4ECS A;  1FL0 A;  5FJ8 G;  1LM0 A;  4CC6 A;  2K14 A;  3MTS A;  2E2I A;  1XYI A;  4L5T A;  4C1N I;  3JRW A;  1SFO A;  1BDO A;  3M4Q A;  4A3K H;  1JE5 A;  2RSN A;  4A3F H;  2JEA I;  3FPU B;  1TU2 B;  4LF8 L;  4GC7 A;  4QW8 A;  4ZAI A;  1UE5 A;  4A3I G;  1SJH D;  3L9A X;  2R7L A;  2AGP A;  4I7H A;  1JIC A;  2R6G A;  1DM0 B;  1EIY B;  5C4J B;  3PVX A;  3GTG A;  1PFN A;  2VQF L;  4CKB A;  2NU8 B;  2R7Z A;  2EDG A;  1TWG H;  2L15 A;  4PMW A;  2XGT A;  3SK8 A;  5EPJ A;  4ABN A;  4DL4 A;  3MXN A;  4MNO A;  4M7E A;  3KBG A;  4DLK A;  1VF5 C;  4RGN A;  3GIJ A;  3G4S A;  3I4M G;  3TDQ A;  4B3R L;  1X6O A;  3OW2 A;  4Y52 H;  2UUC Q;  5I9O A;  1V51 A;  3UDI A;  4P71 A;  4FS1 A;  1LAC A;  3BG3 A;  3LNN A;  1Y1W B;  3S14 B;  4IOC A;  4GZY C;  5K36 H;  2VUM A;  4C3H B;  3K0X A;  4XZ3 B;  4YP3 A;  3OIQ A;  4QY7 A;  2I8C A;  3NBI A;  4PZ8 A;  2JA6 H;  1A63 A;  2RF4 A;  3QWN A;  3TZD A;  3JAM c;  2P0A A;  5LMU L;  5DLF A;  5KFN A;  1GSH A;  4LFB H;  2Z9H A;  1G6P A;  1E2V A;  2W8L A;  4HJ5 A;  1LLR D;  1F9R A;  1S5F D;  2MCT A;  4AQY Q;  2MFI A;  5EKK A;  1EY6 A;  4MV8 A;  2C2E A;  1WTH A;  2RA4 A;  5EGT A;  3OWF A;  2KQ3 A;  1K0R A;  3JRX A;  4DV5 Q;  3VR4 A;  3W1B A;  4NXN L;  1VQN A;  2V5A A;  1WTW A;  1UC9 A;  2DGY A;  2R92 H;  3K5N A;  4KD4 A;  3H0G A;  3OW7 A;  2Z4I A;  1JDB B;  4DR6 Q;  2B63 G;  4MA0 A;  1XDN A;  3RD4 A;  4DR7 H;  3GTO B;  1X56 A;  5KFV A;  4L5S A;  3PW2 A;  3W5O A;  1KLU D;  3TS0 A;  2SNS A;  4HJ8 A;  3PGZ A;  4YY3 H;  2WB1 G;  1TWC H;  2EJG C;  4ECV A;  4YJ2 F;  4DR2 Q;  1PA6 A;  1SYF A;  1EFW A;  1XWE A;  3PW5 A;  3S1N B;  5IY0 A;  1UNN C;  4WD3 A;  1TY2 A;  2L1B A;  4LF4 L;  3M9M B;  4LFC L;  5GRO A;  2P5Z X;  4H0L C;  4JI5 Q;  4LF9 Q;  5C0X G;  3KYH C;  3EPG A;  1SAP A;  2Z8L A;  4RKB A;  4A3E B;  3Q8Q B;  1CFM A;  1B44 D;  3OYY A;  4HNV A;  3F8T A;  2EJM A;  4H02 A;  1S68 A;  3RF2 A;  1ENC A;  1K1S A;  5GAH C;  2N3S A;  4K5W A;  3T56 B;  2JA5 G;  1ESF A;  1TR5 A;  4WJ3 M;  1HJP A;  5M5W B;  1CQV A;  1YNX A;  3HKZ A;  1N32 H;  4ED2 A;  4RHR A;  4A3M B;  3CCQ A;  4ECR A;  5IT9 c;  4HCE A;  1SR3 A;  2NVX B;  5FKA C;  4MTK A;  4WFN 3;  3FKI H;  5KFZ A;  3BDO A;  2VA2 A;  4WBN F;  3RJ0 A;  1BBU A;  1IYJ B;  1YI2 A;  3ORR A;  1BKB A;  3M4O B;  2XWB B;  4B3T H;  1Z9F A;  3M4Y A;  1VS0 A;  1JQY D;  2EYP A;  3HOZ G;  3RZO H;  4LWC A;  1S3O A;  5KT6 A;  2GLT A;  5CV8 A;  1B2T A;  2NVY H;  1W2B A;  4JI4 L;  2ZXO A;  4KKS A;  4YHH L;  4JYA L;  3GQB A;  5D3D A;  4DV2 Q;  1E1O A;  1MGS A;  1V4Y A;  2WB1 E;  3I2Z A;  4J8Q A;  3GTJ H;  4FF4 A;  4A3D B;  4K8J A;  5M5X B;  2WII B;  2YW2 A;  3D4D A;  1Y1W A;  4X62 Q;  3MEF A;  1IW7 D;  2BQ3 A;  1TWF B;  2BOS A;  2B29 A;  4WJ4 A;  4MTD A;  4G4K A;  2IX1 A;  1RJQ A;  1S97 A;  3TQT A;  4H7B A;  1WTO A;  1X9N A;  5H1S E;  5C5J A;  2PZU A;  4OWT B;  4P2C B;  4RAZ A;  5KX5 F;  2R8I A;  1TWA H;  2YRW A;  1QWY A;  1KJ8 A;  1I3Q H;  4ME5 A;  3OOC A;  4IFD H;  5E3F A;  2RSO A;  4G7O C;  1D5Z C;  5L1I A;  4UP7 A;  4B3M Q;  3TRZ A;  2VNU D;  3IKJ A;  3ETJ A;  4LUO A;  4RU9 A;  1I4X A;  4KLK A;  3PUV A;  1JT8 A;  2FMA A;  5J2U F;  2JYO A;  5EJW A;  1F2L A;  1KRS A;  5CMD A;  1VQK A;  1Q86 C;  4V19 0;  1K1Q A;  1O78 A;  1YNN C;  3KLR A;  1VQ7 A;  1GOZ A;  4H13 C;  4ZUJ A;  3G6X A;  2F0G A;  1KJJ A;  3AMU A;  1C3O A;  3EBE A;  4HID A;  3OHB A;  3PF4 A;  2ZM6 Q;  1PTO B;  5C8Y F;  5E1F A;  3NBH A;  4A2B A;  2F0U A;  1PRT C;  5FLX W;  1B6R A;  3NP8 A;  3MFY A;  2N55 A;  4DR6 H;  1CZW A;  5C1O A;  5KT4 A;  3STB D;  3RTX A;  3RLN A;  1GUT A;  3LGJ A;  3E0J A;  4O2A F;  1PXU A; 
#chains in the Genus database with same CATH homology
 3IRB A;  4LUV A;  1PYB A;  1I5F A;  2OTJ A;  3PUW A;  4JOI A;  1QUQ B;  1AH9 A;  1QVG A;  1WOC A;  1HZB A;  1PH5 A;  3PO3 G;  4GKK L;  1YZ6 A;  4DV4 L;  2K5V A;  1XJV A;  4DV3 L;  4J15 A;  2EXD A;  5IYC H;  4DR1 L;  3CF5 A;  1O7I A;  2ZTE A;  1YJW A;  3PUY A;  5FJ8 H;  2BH2 A;  5IYD G;  3NBH B;  3J7A 5;  3BZC A;  4JV5 L;  2R93 G;  2QEX A;  3A0J A;  4GN5 A;  4AQY L;  1IL2 A;  2OCE A;  2AWO A;  2VS1 A;  3BJU A;  4P72 A;  1E3P A;  4A3G G;  1N9W A;  4GLV B;  4GS3 A;  4DV5 L;  1PH6 A;  1P8L A;  2E5L L;  4A3K G;  4A3F G;  2VQE L;  1YJ9 A;  3DM3 A;  1XPU A;  3UE0 A;  2IT1 A;  1E24 A;  1KXL A;  4A93 G;  4GNX A;  1Q46 A;  4A3I H;  3KFU A;  1VQE A;  1CSQ A;  1I50 H;  4YWK A;  4LFB Q;  1GO3 E;  1VQ6 A;  1QVC A;  3GTO H;  3KDF A;  1R9T H;  1D7Q A;  3Q8D A;  4BA1 I;  4JI2 Q;  2RHQ B;  2Z6K C;  4UY8 C;  2NVT H;  2WP8 J;  1QVF A;  3HOY G;  3I4O A;  2HHH Q;  3I4M H;  4HIK A;  2Q2H A;  1MJE A;  3S1N H;  1EOV A;  1MIU A;  2AHO B;  4X65 L;  4A3C G;  3K7A H;  4MZ9 A;  3S1M H;  1GKH A;  3AFP A;  4JI7 L;  1YIJ A;  3G48 A;  1FGU A;  4A3J H;  4IPG A;  1XNQ Q;  1N34 Q;  4B3S L;  4GOP B;  5K36 G;  1W3S A;  3EIV A;  2UXB Q;  4P73 A;  4R4Q A;  4GNX B;  2ES2 A;  4GN3 B;  4JI5 L;  4LF9 L;  4DR7 Q;  3WWV A;  3CCJ A;  1JB7 A;  2F4V L;  4A3E H;  2JA6 G;  2LXK A;  4GLA C;  4JI3 L;  3CME A;  4JI2 L;  3T1Y L;  5BR8 Q;  2YTX A;  3M9B A;  2UUA Q;  4TQU S;  3KDF B;  4LFA L;  3S24 A;  5GAG C;  4YY3 Q;  2D0P A;  3I55 A;  4HIM A;  1K73 C;  1KQS A;  3HOU H;  3M7N A;  4IPD A;  1L1O C;  2KHJ A;  4DPG A;  2YTV A;  3TS2 A;  4BA2 I;  5M5W H;  1I94 Q;  4DK3 C;  2YV5 A;  4UPA A;  3U4V A;  3AEV A;  1PH8 A;  4A3M H;  2UXB L;  3F2B A;  2JQO A;  5IE8 A;  2JA8 G;  4IOA A;  1OXT A;  1K3R A;  2JA9 A;  2K4K A;  1RIP A;  4OON A;  3T1H Q;  1XPO A;  2NVX H;  4LF5 Q;  1EIF A;  2BA0 A;  1VQO A;  1GVP A;  4R4T A;  4LF8 Q;  5BR8 L;  1IBK L;  3CMA A;  5HGQ A;  1MJC A;  1SLJ A;  4AYB G;  4YY3 L;  1Q8K A;  2R7Z G;  2R92 G;  1A8V A;  2ALY B;  4MTN A;  4P74 A;  4JI0 Q;  4DV7 L;  5C44 G;  1LUZ A;  3M4O H;  4BBS H;  3I7F A;  2B63 H;  1EUJ A;  4AIM A;  4DUY Q;  4ME3 A;  4UP9 A;  3CXC A;  2FXQ A;  2CFM A;  1Q82 C;  2PI2 E;  1I94 L;  3HOU G;  5M3F H;  1VQB A;  1N32 Q;  2GVA A;  5AJ3 Q;  4RG1 A;  4BBR H;  1B70 B;  1UE7 A;  1RL2 A;  2K52 A;  1KC8 C;  1JJ2 A;  4LF5 L;  4A3D H;  4JI8 Q;  4HIO A;  3FHW A;  5M5X H;  2IX0 A;  1VQD A;  4JI6 L;  4JOI C;  2HT1 A;  2VUM G;  2WAQ G;  1YHB A;  3RZO H;  1SN8 A;  1UE6 A;  2KCT A;  3S1R H;  3RLO A;  1BBW A;  1TWF H;  3ERS X;  1S72 A;  3M3Y H;  4IFD I;  5LMN L;  4B3T Q;  4QIW E;  4DUY L;  5FLM H;  1Q81 C;  1N36 Q;  1X65 A;  1LYL A;  3PUZ A;  5JEA J;  3KLW A;  3W1G A;  5GAD C;  3RN2 A;  3FP9 A;  2JEA I;  1NMG A;  3NEM A;  1N32 L;  1YVC A;  2XTI A;  3AFQ A;  2QA4 A;  3CP0 A;  5LMN W;  3HOV H;  4QQB X;  2K50 A;  3TQY A;  3RNU A;  3B6Y A;  1HNZ Q;  5FLX c;  5LMU Q;  1EYG A;  1HZ9 A;  4X64 L;  2GN5 A;  2LXJ A;  4JI8 L;  4B3M L;  1NJI C;  2CWA A;  4GKJ L;  4BY7 G;  3CCM A;  2AMC B;  2PMZ E;  2JA5 H;  5C0X J;  5M5Y H;  4NB3 A;  4GNX C;  5HY6 A;  1HNX Q;  1M90 C;  4L5Q A;  1PH9 A;  2K5N A;  3A5Z B;  1VQ4 A;  4A4I A;  1KD1 C;  4JCV E;  4X6A H;  1WCM G;  4FDB A;  5DLQ E;  1C9O A;  3H0G G;  4EX5 A;  2JJQ A;  4IJH A;  4XTC S;  3ZJY C;  1HH2 P;  1UWV A;  5M3M G;  1YHA A;  3HOW G;  2OQK A;  1HZC A;  2MQH A;  1SRO A;  1X3F A;  2JK8 A;  4NXN Q;  1VQG A;  1Y1V G;  2ZM6 L;  3FKI G;  4QJF A;  1KRT A;  1KAW A;  3U50 C;  4AYB E;  1VQF A;  2KBN A;  1U5K A;  1CSP A;  1L2F A;  5IYB H;  2VZA A;  1Q1B A;  1NMF A;  3J80 c;  3MXN B;  1E1T A;  1C7Y A;  1XMQ Q;  3HOZ H;  3PO2 G;  5C4X G;  1XTD A;  4GLX A;  1JMC A;  1IBM Q;  1V43 A;  1JJG A;  2ZJR A;  4YCV A;  4NXM Q;  4JBK A;  1QZG A;  2UUB Q;  4LW1 A;  1ASY A;  3E9H A;  3J7Z C;  4DV1 Q;  2WAQ E;  4GOP A;  2JE6 I;  5GQO A;  2HIV A;  2AKW B;  1EQQ A;  1OXU A;  1LTL A;  1G29 1;  3CC7 A;  2EQS A;  2Y0S G;  2JA7 G;  4QL5 A;  2VW9 A;  4DAY B;  2ZJP A;  4R1J A;  4LFC Q;  2ID0 A;  1Q12 A;  1XMQ L;  3DLL A;  2PQA A;  3NEL A;  3J81 j;  1HZA A;  2KCM A;  3CQZ H;  1SE8 A;  1IBM L;  4IJL A;  1BVS A;  2UUB L;  1X3E A;  4A3B G;  2OQ0 A;  4IFD G;  3CCS A;  3I4N H;  1J6Q A;  5ELO A;  2BH8 A;  1VQ9 A;  3S16 H;  3PUX A;  1IBL Q;  1DGS A;  3G6E A;  3ULJ A;  4C2M H;  4LF6 Q;  2NZO A;  4DV0 Q;  1VCI A;  3GTM H;  4LFB L;  3ER0 A;  4DUZ Q;  4GN4 B;  2QGQ A;  1XPR A;  4APV A;  4DR3 Q;  3PV0 A;  1NE3 A;  1PH4 A;  2A8V A;  5IP9 H;  3CCV A;  1YBY A;  4X66 Q;  1WI5 A;  4IPC A;  2PQA B;  1KHI A;  4BY1 H;  1TWH H;  1PH2 A;  2HHH L;  1YIT A;  2PI2 A;  2V1C C;  5C3E H;  2NVQ H;  4OO1 I;  3KF8 B;  2CWP A;  4Y7N H;  1UE1 A;  3S1Q H;  5IP7 G;  1K8G A;  1T9H A;  4LF6 L;  2YU9 H;  1XNQ L;  4R4I A;  1N34 L;  1OXS C;  1X55 A;  2CQO A;  1Y1W G;  4A3L G;  4P75 A;  4BXX H;  2A1A A;  1M1K C;  2UU9 Q;  4DR7 L;  2Q2I A;  3TEH B;  3J81 c;  4LUZ A;  3KOJ A;  3L7Z C;  4DNI A;  4JG2 A;  1WFQ A;  5IWA Q;  2I0Q A;  1I6H H;  3UDG A;  1N33 Q;  2UUA L;  1V1Q A;  2CKZ B;  3UDF A;  3S17 H;  3PO3 H;  3ULL A;  3OTO Q;  1VQH A;  3HOX H;  1SRU A;  2GVB A;  2Z0S A;  1PVO A;  5IYC G;  2Y0S E;  2ATW A;  1KL9 A;  2PNH A;  1FL0 A;  2A19 A;  5FJ8 G;  1LM0 A;  2VQF Q;  3RZD H;  5IYD H;  1PYS B;  3JAM i;  2K14 A;  4K0K Q;  2R93 H;  2N78 A;  1VQP A;  4L5T A;  1K8A C;  1UEB A;  4R4C A;  3J80 i;  4A3G H;  4LF7 Q;  2UU9 L;  3M85 A;  1L0W A;  3T1H L;  3M4Q A;  4A3K H;  1JE5 A;  1OXV A;  2BA1 A;  2R7D A;  1AE2 A;  3KJO A;  3TRE A;  4A3F H;  3CAM A;  2NZH A;  1PV4 A;  1IXR A;  2DUD A;  4LF8 L;  1UE5 A;  4A93 H;  4KHZ A;  1CUK A;  4A3I G;  4NPS A;  1JJC B;  4JI0 L;  1EIY B;  2R6G A;  1D8L A;  1YHQ A;  4IPH A;  2Q2U A;  2KEN A;  2VQF L;  3CPF A;  4LNQ A;  3U58 A;  3CW2 C;  4PG3 A;  1TWG H;  2L15 A;  4PMW A;  2XGT A;  3SGI A;  4DK6 C;  1HNW Q;  4YCW A;  1B7Y B;  2UXC Q;  1Q1E A;  3RN5 A;  3PIP A;  3UE1 A;  3RR5 A;  5AJ3 L;  2MO0 A;  1FJG Q;  4MNO A;  4DV6 Q;  4KI0 A;  3HOY H;  3F2D A;  3G4S A;  3CC4 A;  3I4M G;  2F3I A;  1X6O A;  5C0X I;  1XNR Q;  4B3R L;  4A3C H;  4GOP C;  4POF A;  3OW2 A;  4Y52 H;  2UUC Q;  2RCN A;  2UXD Q;  4A3J G;  3UDI A;  4P71 A;  4DKA C;  2E8G A;  4HJA A;  4B3T L;  2K75 A;  4JBM A;  2I5H A;  4IOC A;  3H3V H;  1N36 L;  3D31 A;  3K0X A;  1CKM A;  4OO1 G;  3CCL A;  1CKO A;  1Z47 A;  4QY7 A;  1VQI A;  4PZ8 A;  4A3E G;  2JA6 H;  1A63 A;  2RF4 A;  1FJG L;  4C3J H;  1NY4 A;  3JAM c;  4DV6 L;  1HNZ L;  3EN2 A;  2E2I H;  5LMU L;  2RHS B;  3L0O A;  2VL6 A;  2EIF A;  2K5H A;  1PH3 A;  4DV4 Q;  1NTG A;  1WJJ A;  4DV3 Q;  4DR1 Q;  1G6P A;  3NEN A;  4HJ7 A;  1E22 A;  1U0L A;  2UUC L;  4TVA B;  4HJ5 A;  4PZ6 A;  4JV5 Q;  3CCU A;  1HNX L;  1EWI A;  4AQY Q;  2MFI A;  2MO1 A;  3VDY A;  4HJ9 A;  4A3M G;  4EQ5 A;  2HQL A;  2JA8 H;  4B3R Q;  1G51 A;  4YCU A;  4RMF A;  2Q2T A;  1K0R A;  3GTG H;  4DV5 Q;  4A76 A;  1HR0 Q;  2E5L Q;  2VQE Q;  3W1B A;  3S2H H;  1NBW A;  4NXN L;  1VQN A;  3U4Z A;  2CCZ A;  2E2H H;  2R7Z H;  1EQR A;  2DGY A;  3HOX G;  2R92 H;  3J81 i;  1N8R C;  4LF4 Q;  1K83 H;  5C44 H;  4DR6 Q;  4BBS G;  2B63 G;  3CPW A;  1X56 A;  1FVI A;  2F52 A;  2AWN A;  4R4O A;  2KHI A;  4OWX B;  1MKH A;  5EAY A;  5M3F G;  3W5O A;  3CCR A;  2R7F A;  3TS0 A;  4L5S A;  4NXM L;  4BBR G;  4HJ8 A;  3PGZ A;  2NN6 I;  2IY5 B;  1CKN A;  2WB1 G;  4A3D G;  3F2C A;  1ASZ A;  1TWC H;  3HKZ G;  4DV1 L;  5JEA G;  1HR0 L;  4DR2 Q;  2VUM H;  1PA6 A;  1SMX A;  4X65 Q;  4AH6 A;  1EFW A;  5IY0 A;  1PH7 A;  5GAE C;  2HIX A;  3HKS A;  4JI1 Q;  4JI7 Q;  3UDX A;  4LF4 L;  1HR0 W;  2IHE A;  4DR6 L;  4B3S Q;  4LFC L;  3JC6 6;  5FLM G;  5GRO A;  1OTC A;  1XMO Q;  4LF9 Q;  4JI5 Q;  5JJI A;  5C0X G;  3KYH C;  2F4V Q;  4O0A A;  5ELN A;  1VQ5 A;  1PFS A;  3PSI A;  1S40 A;  4JI3 Q;  3HOV G;  3T1Y Q;  3OYY A;  4IO9 A;  2ASB A;  4LFA Q;  3F8T A;  4H02 A;  1QZH A;  3E0E A;  4BY7 H;  5GAH C;  4DR2 L;  1PHJ A;  1Q7Y C;  2N3S A;  3L2P A;  1IBL L;  4JBW A;  2ZTC A;  5J3B A;  2JA5 G;  4BXX G;  1CKN B;  4JI1 L;  3PIO A;  4DV0 L;  3ULP A;  4C3I H;  4WJ3 M;  2E2J H;  3GTL H;  1HJP A;  4DUZ L;  1YNX A;  4JI4 Q;  3ICE A;  4YHH Q;  4DR3 L;  4JYA Q;  3CCQ A;  1WCM H;  2C35 B;  5IT9 c;  1XMO L;  3H0G H;  1SR3 A;  5M3M H;  1GM5 A;  3HOW H;  3A5U A;  4X66 L;  1J5E Q;  1IBK Q;  1Y1V H;  3FKI H;  4OXP A;  3CCE A;  3GTK H;  3AYH B;  5E7N A;  1IYJ B;  1BBU A;  5IYB G;  1YI2 A;  1BKB A;  4DV7 Q;  3AQQ A;  4DR5 Q;  1Z9F A;  1H95 A;  4DR4 Q;  1VS0 A;  2D62 A;  4OX9 Q;  1B8A A;  2WFW A;  1P16 A;  3HOZ G;  1AE3 A;  4LWC A;  3PO2 H;  2LSS A;  3GD7 A;  1S3O A;  4XIG S;  5C4X H;  1K9M C;  1IZ6 A;  2NVY H;  1W2B A;  4JI4 L;  4YHH L;  4A75 A;  2Z6K A;  3KF6 A;  4JYA L;  1KIX A;  2YTY A;  4DV2 Q;  1E1O A;  1OXX K;  1X54 A;  2WB1 E;  3I2Z A;  3GTJ H;  5IWA L;  2N49 A;  3HKZ E;  4POG A;  4JI6 Q;  1N33 L;  1J5E L;  3A74 A;  3STB C;  4X62 Q;  3OTO L;  3S15 H;  3MEF A;  4O2D A;  1VQA A;  2B29 A;  4UP8 A;  2JA7 H;  4WJ4 A;  2YYZ A;  4OWW B;  5LMN Q;  4DR5 L;  2IX1 A;  2NN6 G;  4DR4 L;  4PZ7 A;  3BZK A;  2VY3 A;  4OX9 L;  3BU2 A;  3H15 A;  2OWO A;  4K0K L;  1X9N A;  1Y14 B;  5H1S E;  4OWT B;  2OTL A;  3GDE A;  3CD6 A;  5JJL A;  3K81 C;  4JC0 A;  1YEZ A;  1TWA H;  4KHP Q;  4LF7 L;  1I3Q H;  1PH1 A;  1C0A A;  3D0F A;  3K8A A;  1YJN A;  4DV2 L;  1VQM A;  4A3B H;  4X64 Q;  1GD7 A;  4UP7 A;  4B3M Q;  3I4N G;  3TRZ A;  4GKJ Q;  1L1O A;  3M4P A;  1X3G A;  2JEB I;  3KF6 B;  2VNU D;  4X62 L;  4LUO A;  1TXY A;  2H5X A;  4KLK A;  3PUV A;  5JJK A;  1A62 A;  1JT8 A;  2ZJQ A;  3GTP H;  2I5M X;  4YWL A;  4ALP A;  2MNA A;  2ZTD A;  5C4J H;  1KRS A;  4QGU A;  1VQK A;  1VQL A;  1QUQ A;  4IFD J;  1Q86 C;  3RLF A;  1VQC A;  3PF5 A;  1VQ7 A;  1V9P A;  5IP9 G;  1VQ8 A;  3K7U C;  1HNW L;  2UXC L;  3EBE A;  4HID A;  4KHP L;  4JBJ A;  2D0O A;  2N8N A;  3PF4 A;  2IHF A;  2ZM6 Q;  4GKK Q;  4BY1 G;  3G71 A;  1WYD A;  3H3V I;  4DAM A;  3CC2 A;  5C3E G;  1XNR L;  3E9I A;  5IP7 H;  1A0I A;  2B3G A;  3GO5 A;  3PCO B;  1SFO H;  4L5R C;  3KJP A;  3GTQ H;  2UXD L;  3F1Z A;  2I5L X;  3STB D;  1L1O B;  3RLN A;  3I56 A;  3LGJ A;  1E7Z A;  1Y1W H;  3S14 H;  4A3L H;  4C3H H;  3S2D H;  3HFZ B;  4YWM A;  3K80 C;  1VQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...