3FMAA

Crystal structure of the gyf domain of smy2 in complex with a proline-rich peptide from bbp/scsf1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
b'SVESSWRYIDTQGQIHGPFTTQMMSQWYIGGYFASTLQISRLGSTPETLGINDIFITLGELMTKLEKYDTDPFTTFDKLHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SMY2
publication title SMY2-type GYF domain recognition in mRNA surveillance complexes
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 18
structure length 81
sequence length 81
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3fmaA00
1L2ZA 1WH2A 1SYXB 1GYFA 3K3VA 4BWSC 3FMAA
chains in the Genus database with same CATH superfamily
3BA8A 1XDNA 5DG8A 4DL4A 5KFFA 3RB3A 4O3QA 3N40P 5LMUH 3HOYG 2KSWA 4O4HF 1P8LA 1B6SA 2R8HA 2JA5G 2YZMA 4ZOLF 5F9NA 4C5BA 2YCHA 2E2IA 3WNZA 4B3SH 2HVRA 1GLVA 3OTOH 4U6PA 1VBGA 4DL7A 1AUXA 2VA3A 2YS6A 1I7NA 3OUZA 4AYBE 5KT4A 5JVLA 2J9GA 5L1IA 3RJ0A 5KG1A 5IYBG 1N56A 1T94A 3BQ2A 4MA5A 4RNOA 1Y1VG 3G8CA 4ZQIA 4ED8A 1S97A 3U9SA 2VUMA 3RF2A 5IP7G 2O03A 2Q2UA 1DV2A 5EZYF 2XGQA 3GIJA 4FBUA 3H20A 3KTMA 2YZNA 3UFXB 4MV9A 4DUZH 4HYKA 5IYDG 4JI7H 1JDEA 1TA8A 4DL2A 1TWGA 4FS2A 1E4GT 2FLPA 1XMOH 4ECVA 2R7NA 1GSHA 3I12A 3MR2A 3QZ7A 3VPBA 2QK4A 4DLKA 1V51A 2YRXA 4X65H 2FPGB 4PWQA 4NXMH 5KT5A 1TWHA 4ED2A 4A3GG 4J9PA 1RK6A 4YP3A 4ETSA 5KFEA 2XCLA 5EWEA 3SE7A 3R23A 2AU0A 5DLFA 5A2QW 4EEQA 2WYOA 5EDWA 1I7LA 3TINA 3GV7B 1S0MA 5D1OB 2VA2A 4BWSC 4PDBA 1JKJB 2UU9H 3WO0A 2HJWA 3KHGA 3RV3A 4O4LF 4IZOA 2FE3A 2W6OA 4M9UA 3TQTA 2BR0A 4HNVA 3MWMA 5KFQA 5KFVA 4CC6A 5FJ8G 3HBLA 4XYMB 2ASLA 3GTJA 3KXYT 4LF7H 2WAQA 4LFAH 3RIZA 4DV3H 3H0GG 5DGBA 1PK8A 2WTFA 2R8GA 3FDSA 1IOVA 4NLGA 4WD3A 3RV4A 5DQIA 3PO2G 1N36H 4ME6A 1GGOA 4DV1H 3RUPA 2GPWA 1GSOA 3JSLA 4LH7A 4ECWA 1VKZA 3J81W 2YYAA 1A0IA 4O2BF 5C3EG 2YZGA 2DPJA 2JA5A 3U9TA 1MZBA 4EFBA 2W6QA 3V6KA 1M0TA 4JI5H 3R5HA 3PN1A 4LMYA 1TWCA 1Z2PX 2R84A 4ECQA 3FMAA 4J9KA 2WB1A 1S03G 2YS7A 4RU9A 5KFZA 1N32H 3BQ0A 5JQWA 2C35B 4QIWA 3G6YA 4DR1H 4K0KH 5KT7A 2W6ZA 3GLKA 3KAKA 3T5KA 4LFBH 4UCRA 5FLXW 1Y1VA 2B63G 4UCSA 2UUAH 5KG2A 2C2RA 1SYXB 3GIMA 5KG0A 4DV4H 3MR5A 2I80A 3K3PA 3PW7A 4IRDA 4ED7A 1W96A 3F8NA 3RB6A 3MWDA 4A3IG 4A3DG 2NVXA 1CS0A 3PW2A 5KFDA 4QW8A 4A2BA 1K83A 2YU9A 2WDTA 3JAMW 4MTDA 4RB0A 4A3FG 4ZI7F 4ECSA 1UNNC 4C5AA 1WH2A 1N34H 1UC8A 3M9NB 2M05A 1JIHA 5C5JA 1KJ9A 2FKLA 3GIQA 2YRWA 5BPHA 5IWAH 4B3MH 5EWFA 4FBTA 2BQ3A 2F4VH 4EEYA 1JX4A 2R7LA 2FK2A 3BA9A 2W57A 4J0MA 4MV6A 2JEGA 4YR0A 4JI2H 3HOZG 2PVPA 4F50A 1L2ZA 1JDBB 5KFPA 4UCTA 2RF4A 3PO3G 2CKZB 1FVIA 1XNRH 4F4ZA 3GILA 2RDJA 4LF4H 2XC9A 4DV2H 3MR6A 1FJGH 4JV2A 1JXLA 1E4FT 5CB4F 4J9RA 4JI6H 1HNZH 1DIKA 1PX2A 5F9LA 4J9LA 4HQ6A 2VOBA 3VMMA 3H0GA 5CA0F 1B6RA 2FB9A 4UCOA 2R7ZA 1BNCA 4J9SA 5IP9G 3GTKA 3KHRA 2R87A 3N6XA 5GONF 3T5JA 4JI1H 1HNWH 4A3CG 3GTOA 3K3VA 4DUYH 3GIKA 4F4YA 2JA6G 3JSNA 3OSNA 2R7KA 2VQDA 4QWEA 1I50A 5JVDF 2AGOA 5D1PA 5LP6F 5IYZF 2W6NA 3K5IA 4CC5A 2R8KA 2V4QA 2AGQA 3J7AK 1KJIA 2VPSA 4E4TA 2W9BA 5KFIA 4XYLB 3QZ8A 2RGVA 4YBZB 2ZDQA 2E5LH 1RJQA 1N33H 1T3NA 4Q45A 1KJJA 4JV0A 4IR9A 1I94H 3T5LA 1BGWA 3EYYA 3L4KA 4O4IF 4EBEA 3G6VA 1IBLH 1ZETA 1CQIB 4TQRA 1RJPA 2I8CA 2W8LA 3VPDA 5BR8H 2W71A 1N48A 5JUMA 3T1HH 1B04A 3J80W 4I4TF 4F4WA 4A3JG 2UVVA 2CZGA 5KX5F 3VPCA 1RJRA 3MWEA 3L4JA 4RB2C 3L2PA 2B63A 4YJ3F 1AUVA 3EPGA 3FKIG 3Q8QB 2WAQE 2JA7G 2CQYA 1M0WA 3BQ1A 3OHBA 3Q1KA 5KFYA 1OWTA 1V9PA 5L1KA 4MA0A 1VS0A 3HOXG 2W7PA 4RUAA 4AQYH 2VQEH 1KJQA 2JEJA 3AYHB 4Q43A 5DLGA 3GV5B 2NU8B 5KFBA 3IG0A 4YHHH 4TV9F 4DR3H 4J9OA 2VQFH 4GLXA 4L1KA 3ETJA 3JRXA 5FPOA 3RBDA 4MV4A 2J6TA 4Q8EA 5J2UF 1XNQH 2X0SA 3H4DA 3IN5A 2R8IA 4ED6A 1WCMG 2WB1E 1S10A 4DV6H 3C0FB 4YR3A 2W70A 1IBMH 4HNTA 4QIWE 4A3KG 4FM9A 2Y0SA 2R93G 5KFRA 1M7JA 3MJFA 3TIGA 1W93A 4DV0H 3R5FA 2C2DA 4ECXA 4EYIB 4X66H 1RYSA 4LFCH 2FPPB 2JEFA 2V9WA 4B3TH 4A3BG 2W9BB 3Q8SB 2V59A 3KALA 4IWYA 2W7OA 1Z2NX 4MV8A 5L1LA 3GIDA 2JA8G 1S68A 3BG5A 4JI3H 1SFOA 4OX9H 1AN7A 2W8KA 3GTMA 2R85A 5KFJA 3MFHA 4YB8B 5FD6A 4R7RA 1JLLB 4I55F 3M9MB 2NU7B 4TUYF 5FLMG 3SI8A 2ZM6H 1T36A 2DWCA 1EZ1A 1KEEA 3QFFA 5KFMA 5EWGA 2UVUA 2IMWP 3GTQA 3UQ8A 2IBKA 1HR0H 3GIPA 5KG7A 3HB9A 3HKZA 1WSCA 2QYZA 4TQSA 2R8JA 1CQJB 4A2AA 3K5HA 2OWOA 4O3OA 2PN1A 4R8UA 1A9XA 2V4RA 2ZJTA 2DPIA 1BXRA 1VAJA 2C28A 1TWAA 2W9CA 5J2TF 4DL6A 2CW8A 2SCUB 4O3SA 1Y14B 4BY1G 3G6XA 2NU6B 5K2MA 4QWBA 3GTLA 1I6UA 2OH2A 4A3EG 3M4IA 5KFLA 1ZHQA 3OSPA 1GSAA 4Q0YA 4IRKA 4GKKH 1O75A 2XIGA 5FPRA 3GIIA 4RNNA 1KC7A 1KJ8A 4ED3A 4ECZA 2HHHH 1Y1WG 5LOVF 4LF5H 2J6SA 4LSXA 2FK3A 3HOUG 1DGSA 5HBRB 4Q8FA 4ED1A 5IYCG 3T5HA 2E2HA 1C3OA 5C8YF 4ECYA 3PVXA 5KFTA 1EYZA 4MV7A 3KAJA 4QJFA 5I47A 4BBRG 1M6VA 3N41B 4RB3C 3M9OB 3ORRA 2GLTA 4MTEA 3HOVG 3EPIA 1KBLA 3V4ZA 5DG9A 3BABA 4ED0A 4EBDA 1UC9A 3H40A 4JV1A 1WCMA 2XGPA 5FD5A 4QW9A 1S0OA 2W9AA 1R9TA 4JI0H 4Y8VB 4NXNH 3GV8B 4YJ2F 3LWBA 4DV5H 5BPFA 3CVZA 2R93A 3RAXA 2UXBH 2UXDH 4EG0A 3MR3A 4FS1A 4JYAH 3GQCA 4G3IA 2XD4A 4LF8H 2PMZA 5LL6b 2R92G 2DIKA 3E5NA 2ASJA 4MV3A 5T14A 3N44B 5KFGA 4BY7G 2YL2A 2P0AA 5KFKA 2HGSA 5IT9W 5EOYA 4C5CA 3TQ1A 2HVSA 4YAJB 1EUDB 4YAKB 3MFIA 4J9MA 4GKJH 1BJTA 2NUAB 4U7CA 1CE8A 4Q44A 2J6UA 4R8UB 2W6PA 5KFCA 5KG5A 4J9NA 4F4XA 3TIIA 3V6HA 2W9CB 2V58A 5HV6A 4EGQA 4FU0A 1DV1A 3PR4A 2IP4A 1J5EH 5C4XG 4DL3A 4RAZA 4MV1A 3ORQA 1HNXH 2IA6A 5KFSA 2GPSA 3LP8A 4UCVA 2C2EA 5KKNB 5KT3A 5KFUA 2FJZA 1RK5A 2FLLA 4AYBA 4YY3H 4QWDA 2Y0SE 4A93G 3PZPA 2UXCH 2RDIA 4RZRA 3RB0A 2VR1A 3HOWG 5D8DA 5LA6F 2FLNA 3H3VH 4I7HA 2UVWA 4X64H 1VBHA 3V4SA 4J9QA 2R86A 3PW5A 5DQGA 2FP4B 5C1PA 2YW2A 1ULZA 5CA1F 1V4YA 2I87A 1GO3E 2ZDHA 5KG4A 2HVQA 4IHJF 5KG6A 5KFOA 2VPQA 2V5AA 3RB4A 4EBCA 3KHHA 4MAMA 5KFWA 1ZQ7A 3BAAA 4DR2H 1WR2A 2BQRA 1XMQH 1Y1WA 4IRCA 5L1JA 4DR4H 1C30A 1E4EA 4XX0B 4LF6H 2DLNA 2XCAA 4EFEA 1ZHSA 1TAEA 4RNMA 5H80A 3Q2OA 4O3RA 4ECTA 1K1SA 2UVRA 4DR7H 5KFHA 4JV5H 2JA7A 3HKZE 4JI4H 4A3LG 2JEIA 2UUBH 4IAJA 4BXXG 4DV7H 3HXLA 1EUCB 3R5XA 3H4BA 3ETHA 4ECUA 4JUZA 2R7ZG 4EYHB 3I4NG 2ZDGA 5DGAA 3DF7A 5KG3A 2AGPA 4TV8F 2BQUA 2JA6A 2ASDA 4ECRA 2UUCH 5KFXA 2FMAA 3Q8RB 2Q2TA 2VUMG 3JRWA 4A3MG 3RFCA 1B33N 2DZDA 3JZIA 5C1OA 2R92A 2OLSA 1SEIA 4RUCA 2R7MA 3OHAA 4ZHQF 4M7EA 4LF9H 1S9FA 2NU9B 4RZQA 2XCPA 3V6JA 1I3QA 4I50F 5DQHA 3RGXA 4O3NA 2ATLA 3GTGA 2WE6A 4UCUA 5KT2A 4HR7A 3RGZA 3WO1A 5KT6A 4QWAA 4DR5H 4B3RH 3KHLA 1IBKH 4DR6H 1GYFA 5LXTF 4WBNF 4RB1A 2CW7A 1RYRA 2C22A 4KHPH 1IOWA 3FKIA 1Z2OX 5KFAA 5LYJF 3RBEA 1K1QA 2C00A 5BMVF 4XZ3B 3PR5B 3T1YH 2FPIB 4LSAA 3N43B 2W6MA 4GC7A 1FKAH 3I4MG 2MCTA 3CQZA 3BJYA 3PW4A 4UFZA 5CAEB 3RTXA 4EGJA 4RAYA 5C44G 3PW0A 2R6FA 3NGDA 3N8DA 2RGRA 4YR2A 3LMLA 4APMA 4BBSG 5JH7F 1E4EB 5KFNA 2PMZE 4DL5A 2ALZA 4LH6A 5LMNH 5DG7A 4X62H 2R82A 2NVYA 2AQ4A 1EHIA 2PBZA 4O3PA 5L9XA 4QWCA 1X9NA 4IWXA 1TWFA 4YQWA 4GC6A 3N42B 3OUUA 4O2AF 4JI8H 4IR1A 3RAQA 1S0NA 2VUGA 4C2MA 1SCUB 3Q8PB 5D1OA 4HNUA 2FK1A 3GTPA
chains in the Genus database with same CATH topology
3BA8A 1XDNA 4FM9A 4DV4H 3N40P 5LMUH 2KSWA 4UCVA 4DV0H 3F8NA 1P8LA 4A2BA 4X66H 2YCHA 4LFCH 2WDTA 4B3SH 3JAMW 4YY3H 2HVRA 4MTDA 4B3TH 3OTOH 2UXCH 4RB0A 3KALA 4I7HA 1Z2NX 4X64H 1S68A 1WH2A 4JI3H 1N34H 4OX9H 1AN7A 4B3MH 5IWAH 5FD6A 4R7RA 3RJ0A 2F4VH 3BA9A 2W57A 4J0MA 2ZM6H 2HVQA 4JI2H 1L2ZA 3UQ8A 3RF2A 3BAAA 4DR2H 1HR0H 2O03A 1XMQH 4UCTA 2Q2UA 4DR4H 1FVIA 1XNRH 3H20A 4LF4H 4LF6H 4A2AA 5D1OA 4EFEA 1ZHSA 2OWOA 1TAEA 4MV9A 4DUZH 4DV2H 1FJGH 4JI7H 1TA8A 4DR7H 4JV5H 2ZJTA 1E4GT 1E4FT 1XMOH 4JI4H 2UUBH 4IAJA 2CW8A 1HNZH 4DV7H 4JI6H 3HXLA 2VOBA 4UCOA 4X65H 1I6UA 4NXMH 3M4IA 3DF7A 3N6XA 4JI1H 1HNWH 3K3VA 4DUYH 1ZHQA 4ETSA 3JSNA 4Q0YA 4GKKH 2UUCH 1O75A 2XIGA 5D1PA 5FPRA 4CC5A 5A2QW 2Q2TA 3J7AK 4EEQA 2WYOA 2VPSA 2HHHH 1SEIA 5D1OB 4BWSC 4LF5H 4PDBA 4LSXA 2RGVA 1DGSA 2E5LH 2UU9H 1N33H 4M7EA 4LF9H 4RZQA 2FE3A 1I94H 1BGWA 3KAJA 4MV7A 4RB3C 3EYYA 3MWMA 3N41B 4CC6A 3L4KA 1IBLH 4MTEA 3KXYT 4LF7H 4LFAH 3RIZA 5BR8H 4DV3H 3RGXA 3BABA 2WE6A 3T1HH 4UCUA 1B04A 3J80W 4DR6H 3RGZA 4DR5H 5FD5A 1GYFA 4B3RH 1IBKH 3L4JA 4RB2C 3L2PA 4RB1A 2CW7A 1N36H 4JI0H 4NXNH 4DV1H 4KHPH 1Z2OX 2RGRA 4DV5H 1M0WA 3CVZA 3JSLA 4LH7A 3T1YH 1FKAH 4LSAA 2UXBH 3N43B 2UXDH 3J81W 1V9PA 4JYAH 2MCTA 1A0IA 1VS0A 4UFZA 4LF8H 5LL6b 3RTXA 1MZBA 4AQYH 4RAYA 4EFBA 2VQEH 3N44B 1M0TA 4JI5H 2HGSA 5IT9W 3PN1A 4YHHH 3IG0A 4LMYA 3LMLA 1Z2PX 4APMA 5EOYA 4DR3H 3FMAA 2VQFH 4GLXA 2HVSA 1S03G 4GKJH 4LH6A 5LMNH 1BJTA 5FPOA 1N32H 4X62H 1XNQH 1X9NA 4DR1H 4K0KH 3N42B 3KAKA 4LFBH 4DV6H 3C0FB 4UCRA 1J5EH 4JI8H 5FLXW 2VUGA 4UCSA 1IBMH 4RAZA 2UUAH 1HNXH 1SYXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2Z A;  1WH2 A;  1SYX B;  1GYF A;  3K3V A;  4BWS C;  3FMA A; 
#chains in the Genus database with same CATH topology
 3BA8 A;  1XDN A;  5DG8 A;  4DL4 A;  5KFF A;  3RB3 A;  4O3Q A;  3N40 P;  5LMU H;  3HOY G;  2KSW A;  4O4H F;  1P8L A;  1B6S A;  2R8H A;  2JA5 G;  2YZM A;  4ZOL F;  5F9N A;  4C5B A;  2YCH A;  2E2I A;  3WNZ A;  4B3S H;  2HVR A;  1GLV A;  3OTO H;  4U6P A;  1VBG A;  4DL7 A;  1AUX A;  2VA3 A;  2YS6 A;  1I7N A;  3OUZ A;  4AYB E;  5KT4 A;  5JVL A;  2J9G A;  5L1I A;  3RJ0 A;  5KG1 A;  5IYB G;  1N56 A;  1T94 A;  3BQ2 A;  4MA5 A;  4RNO A;  1Y1V G;  3G8C A;  4ZQI A;  4ED8 A;  1S97 A;  3U9S A;  2VUM A;  3RF2 A;  5IP7 G;  2O03 A;  2Q2U A;  1DV2 A;  5EZY F;  2XGQ A;  3GIJ A;  4FBU A;  3H20 A;  3KTM A;  2YZN A;  3UFX B;  4MV9 A;  4DUZ H;  4HYK A;  5IYD G;  4JI7 H;  1JDE A;  1TA8 A;  4DL2 A;  1TWG A;  4FS2 A;  1E4G T;  2FLP A;  1XMO H;  4ECV A;  2R7N A;  1GSH A;  3I12 A;  3MR2 A;  3QZ7 A;  3VPB A;  2QK4 A;  4DLK A;  1V51 A;  2YRX A;  4X65 H;  2FPG B;  4PWQ A;  4NXM H;  5KT5 A;  1TWH A;  4ED2 A;  4A3G G;  4J9P A;  1RK6 A;  4YP3 A;  4ETS A;  5KFE A;  2XCL A;  5EWE A;  3SE7 A;  3R23 A;  2AU0 A;  5DLF A;  5A2Q W;  4EEQ A;  2WYO A;  5EDW A;  1I7L A;  3TIN A;  3GV7 B;  1S0M A;  5D1O B;  2VA2 A;  4BWS C;  4PDB A;  1JKJ B;  2UU9 H;  3WO0 A;  2HJW A;  3KHG A;  3RV3 A;  4O4L F;  4IZO A;  2FE3 A;  2W6O A;  4M9U A;  3TQT A;  2BR0 A;  4HNV A;  3MWM A;  5KFQ A;  5KFV A;  4CC6 A;  5FJ8 G;  3HBL A;  4XYM B;  2ASL A;  3GTJ A;  3KXY T;  4LF7 H;  2WAQ A;  4LFA H;  3RIZ A;  4DV3 H;  3H0G G;  5DGB A;  1PK8 A;  2WTF A;  2R8G A;  3FDS A;  1IOV A;  4NLG A;  4WD3 A;  3RV4 A;  5DQI A;  3PO2 G;  1N36 H;  4ME6 A;  1GGO A;  4DV1 H;  3RUP A;  2GPW A;  1GSO A;  3JSL A;  4LH7 A;  4ECW A;  1VKZ A;  3J81 W;  2YYA A;  1A0I A;  4O2B F;  5C3E G;  2YZG A;  2DPJ A;  2JA5 A;  3U9T A;  1MZB A;  4EFB A;  2W6Q A;  3V6K A;  1M0T A;  4JI5 H;  3R5H A;  3PN1 A;  4LMY A;  1TWC A;  1Z2P X;  2R84 A;  4ECQ A;  3FMA A;  4J9K A;  2WB1 A;  1S03 G;  2YS7 A;  4RU9 A;  5KFZ A;  1N32 H;  3BQ0 A;  5JQW A;  2C35 B;  4QIW A;  3G6Y A;  4DR1 H;  4K0K H;  5KT7 A;  2W6Z A;  3GLK A;  3KAK A;  3T5K A;  4LFB H;  4UCR A;  5FLX W;  1Y1V A;  2B63 G;  4UCS A;  2UUA H;  5KG2 A;  2C2R A;  1SYX B;  3GIM A;  5KG0 A;  4DV4 H;  3MR5 A;  2I80 A;  3K3P A;  3PW7 A;  4IRD A;  4ED7 A;  1W96 A;  3F8N A;  3RB6 A;  3MWD A;  4A3I G;  4A3D G;  2NVX A;  1CS0 A;  3PW2 A;  5KFD A;  4QW8 A;  4A2B A;  1K83 A;  2YU9 A;  2WDT A;  3JAM W;  4MTD A;  4RB0 A;  4A3F G;  4ZI7 F;  4ECS A;  1UNN C;  4C5A A;  1WH2 A;  1N34 H;  1UC8 A;  3M9N B;  2M05 A;  1JIH A;  5C5J A;  1KJ9 A;  2FKL A;  3GIQ A;  2YRW A;  5BPH A;  5IWA H;  4B3M H;  5EWF A;  4FBT A;  2BQ3 A;  2F4V H;  4EEY A;  1JX4 A;  2R7L A;  2FK2 A;  3BA9 A;  2W57 A;  4J0M A;  4MV6 A;  2JEG A;  4YR0 A;  4JI2 H;  3HOZ G;  2PVP A;  4F50 A;  1L2Z A;  1JDB B;  5KFP A;  4UCT A;  2RF4 A;  3PO3 G;  2CKZ B;  1FVI A;  1XNR H;  4F4Z A;  3GIL A;  2RDJ A;  4LF4 H;  2XC9 A;  4DV2 H;  3MR6 A;  1FJG H;  4JV2 A;  1JXL A;  1E4F T;  5CB4 F;  4J9R A;  4JI6 H;  1HNZ H;  1DIK A;  1PX2 A;  5F9L A;  4J9L A;  4HQ6 A;  2VOB A;  3VMM A;  3H0G A;  5CA0 F;  1B6R A;  2FB9 A;  4UCO A;  2R7Z A;  1BNC A;  4J9S A;  5IP9 G;  3GTK A;  3KHR A;  2R87 A;  3N6X A;  5GON F;  3T5J A;  4JI1 H;  1HNW H;  4A3C G;  3GTO A;  3K3V A;  4DUY H;  3GIK A;  4F4Y A;  2JA6 G;  3JSN A;  3OSN A;  2R7K A;  2VQD A;  4QWE A;  1I50 A;  5JVD F;  2AGO A;  5D1P A;  5LP6 F;  5IYZ F;  2W6N A;  3K5I A;  4CC5 A;  2R8K A;  2V4Q A;  2AGQ A;  3J7A K;  1KJI A;  2VPS A;  4E4T A;  2W9B A;  5KFI A;  4XYL B;  3QZ8 A;  2RGV A;  4YBZ B;  2ZDQ A;  2E5L H;  1RJQ A;  1N33 H;  1T3N A;  4Q45 A;  1KJJ A;  4JV0 A;  4IR9 A;  1I94 H;  3T5L A;  1BGW A;  3EYY A;  3L4K A;  4O4I F;  4EBE A;  3G6V A;  1IBL H;  1ZET A;  1CQI B;  4TQR A;  1RJP A;  2I8C A;  2W8L A;  3VPD A;  5BR8 H;  2W71 A;  1N48 A;  5JUM A;  3T1H H;  1B04 A;  3J80 W;  4I4T F;  4F4W A;  4A3J G;  2UVV A;  2CZG A;  5KX5 F;  3VPC A;  1RJR A;  3MWE A;  3L4J A;  4RB2 C;  3L2P A;  2B63 A;  4YJ3 F;  1AUV A;  3EPG A;  3FKI G;  3Q8Q B;  2WAQ E;  2JA7 G;  2CQY A;  1M0W A;  3BQ1 A;  3OHB A;  3Q1K A;  5KFY A;  1OWT A;  1V9P A;  5L1K A;  4MA0 A;  1VS0 A;  3HOX G;  2W7P A;  4RUA A;  4AQY H;  2VQE H;  1KJQ A;  2JEJ A;  3AYH B;  4Q43 A;  5DLG A;  3GV5 B;  2NU8 B;  5KFB A;  3IG0 A;  4YHH H;  4TV9 F;  4DR3 H;  4J9O A;  2VQF H;  4GLX A;  4L1K A;  3ETJ A;  3JRX A;  5FPO A;  3RBD A;  4MV4 A;  2J6T A;  4Q8E A;  5J2U F;  1XNQ H;  2X0S A;  3H4D A;  3IN5 A;  2R8I A;  4ED6 A;  1WCM G;  2WB1 E;  1S10 A;  4DV6 H;  3C0F B;  4YR3 A;  2W70 A;  1IBM H;  4HNT A;  4QIW E;  4A3K G;  4FM9 A;  2Y0S A;  2R93 G;  5KFR A;  1M7J A;  3MJF A;  3TIG A;  1W93 A;  4DV0 H;  3R5F A;  2C2D A;  4ECX A;  4EYI B;  4X66 H;  1RYS A;  4LFC H;  2FPP B;  2JEF A;  2V9W A;  4B3T H;  4A3B G;  2W9B B;  3Q8S B;  2V59 A;  3KAL A;  4IWY A;  2W7O A;  1Z2N X;  4MV8 A;  5L1L A;  3GID A;  2JA8 G;  1S68 A;  3BG5 A;  4JI3 H;  1SFO A;  4OX9 H;  1AN7 A;  2W8K A;  3GTM A;  2R85 A;  5KFJ A;  3MFH A;  4YB8 B;  5FD6 A;  4R7R A;  1JLL B;  4I55 F;  3M9M B;  2NU7 B;  4TUY F;  5FLM G;  3SI8 A;  2ZM6 H;  1T36 A;  2DWC A;  1EZ1 A;  1KEE A;  3QFF A;  5KFM A;  5EWG A;  2UVU A;  2IMW P;  3GTQ A;  3UQ8 A;  2IBK A;  1HR0 H;  3GIP A;  5KG7 A;  3HB9 A;  3HKZ A;  1WSC A;  2QYZ A;  4TQS A;  2R8J A;  1CQJ B;  4A2A A;  3K5H A;  2OWO A;  4O3O A;  2PN1 A;  4R8U A;  1A9X A;  2V4R A;  2ZJT A;  2DPI A;  1BXR A;  1VAJ A;  2C28 A;  1TWA A;  2W9C A;  5J2T F;  4DL6 A;  2CW8 A;  2SCU B;  4O3S A;  1Y14 B;  4BY1 G;  3G6X A;  2NU6 B;  5K2M A;  4QWB A;  3GTL A;  1I6U A;  2OH2 A;  4A3E G;  3M4I A;  5KFL A;  1ZHQ A;  3OSP A;  1GSA A;  4Q0Y A;  4IRK A;  4GKK H;  1O75 A;  2XIG A;  5FPR A;  3GII A;  4RNN A;  1KC7 A;  1KJ8 A;  4ED3 A;  4ECZ A;  2HHH H;  1Y1W G;  5LOV F;  4LF5 H;  2J6S A;  4LSX A;  2FK3 A;  3HOU G;  1DGS A;  5HBR B;  4Q8F A;  4ED1 A;  5IYC G;  3T5H A;  2E2H A;  1C3O A;  5C8Y F;  4ECY A;  3PVX A;  5KFT A;  1EYZ A;  4MV7 A;  3KAJ A;  4QJF A;  5I47 A;  4BBR G;  1M6V A;  3N41 B;  4RB3 C;  3M9O B;  3ORR A;  2GLT A;  4MTE A;  3HOV G;  3EPI A;  1KBL A;  3V4Z A;  5DG9 A;  3BAB A;  4ED0 A;  4EBD A;  1UC9 A;  3H40 A;  4JV1 A;  1WCM A;  2XGP A;  5FD5 A;  4QW9 A;  1S0O A;  2W9A A;  1R9T A;  4JI0 H;  4Y8V B;  4NXN H;  3GV8 B;  4YJ2 F;  3LWB A;  4DV5 H;  5BPF A;  3CVZ A;  2R93 A;  3RAX A;  2UXB H;  2UXD H;  4EG0 A;  3MR3 A;  4FS1 A;  4JYA H;  3GQC A;  4G3I A;  2XD4 A;  4LF8 H;  2PMZ A;  5LL6 b;  2R92 G;  2DIK A;  3E5N A;  2ASJ A;  4MV3 A;  5T14 A;  3N44 B;  5KFG A;  4BY7 G;  2YL2 A;  2P0A A;  5KFK A;  2HGS A;  5IT9 W;  5EOY A;  4C5C A;  3TQ1 A;  2HVS A;  4YAJ B;  1EUD B;  4YAK B;  3MFI A;  4J9M A;  4GKJ H;  1BJT A;  2NUA B;  4U7C A;  1CE8 A;  4Q44 A;  2J6U A;  4R8U B;  2W6P A;  5KFC A;  5KG5 A;  4J9N A;  4F4X A;  3TII A;  3V6H A;  2W9C B;  2V58 A;  5HV6 A;  4EGQ A;  4FU0 A;  1DV1 A;  3PR4 A;  2IP4 A;  1J5E H;  5C4X G;  4DL3 A;  4RAZ A;  4MV1 A;  3ORQ A;  1HNX H;  2IA6 A;  5KFS A;  2GPS A;  3LP8 A;  4UCV A;  2C2E A;  5KKN B;  5KT3 A;  5KFU A;  2FJZ A;  1RK5 A;  2FLL A;  4AYB A;  4YY3 H;  4QWD A;  2Y0S E;  4A93 G;  3PZP A;  2UXC H;  2RDI A;  4RZR A;  3RB0 A;  2VR1 A;  3HOW G;  5D8D A;  5LA6 F;  2FLN A;  3H3V H;  4I7H A;  2UVW A;  4X64 H;  1VBH A;  3V4S A;  4J9Q A;  2R86 A;  3PW5 A;  5DQG A;  2FP4 B;  5C1P A;  2YW2 A;  1ULZ A;  5CA1 F;  1V4Y A;  2I87 A;  1GO3 E;  2ZDH A;  5KG4 A;  2HVQ A;  4IHJ F;  5KG6 A;  5KFO A;  2VPQ A;  2V5A A;  3RB4 A;  4EBC A;  3KHH A;  4MAM A;  5KFW A;  1ZQ7 A;  3BAA A;  4DR2 H;  1WR2 A;  2BQR A;  1XMQ H;  1Y1W A;  4IRC A;  5L1J A;  4DR4 H;  1C30 A;  1E4E A;  4XX0 B;  4LF6 H;  2DLN A;  2XCA A;  4EFE A;  1ZHS A;  1TAE A;  4RNM A;  5H80 A;  3Q2O A;  4O3R A;  4ECT A;  1K1S A;  2UVR A;  4DR7 H;  5KFH A;  4JV5 H;  2JA7 A;  3HKZ E;  4JI4 H;  4A3L G;  2JEI A;  2UUB H;  4IAJ A;  4BXX G;  4DV7 H;  3HXL A;  1EUC B;  3R5X A;  3H4B A;  3ETH A;  4ECU A;  4JUZ A;  2R7Z G;  4EYH B;  3I4N G;  2ZDG A;  5DGA A;  3DF7 A;  5KG3 A;  2AGP A;  4TV8 F;  2BQU A;  2JA6 A;  2ASD A;  4ECR A;  2UUC H;  5KFX A;  2FMA A;  3Q8R B;  2Q2T A;  2VUM G;  3JRW A;  4A3M G;  3RFC A;  1B33 N;  2DZD A;  3JZI A;  5C1O A;  2R92 A;  2OLS A;  1SEI A;  4RUC A;  2R7M A;  3OHA A;  4ZHQ F;  4M7E A;  4LF9 H;  1S9F A;  2NU9 B;  4RZQ A;  2XCP A;  3V6J A;  1I3Q A;  4I50 F;  5DQH A;  3RGX A;  4O3N A;  2ATL A;  3GTG A;  2WE6 A;  4UCU A;  5KT2 A;  4HR7 A;  3RGZ A;  3WO1 A;  5KT6 A;  4QWA A;  4DR5 H;  4B3R H;  3KHL A;  1IBK H;  4DR6 H;  1GYF A;  5LXT F;  4WBN F;  4RB1 A;  2CW7 A;  1RYR A;  2C22 A;  4KHP H;  1IOW A;  3FKI A;  1Z2O X;  5KFA A;  5LYJ F;  3RBE A;  1K1Q A;  2C00 A;  5BMV F;  4XZ3 B;  3PR5 B;  3T1Y H;  2FPI B;  4LSA A;  3N43 B;  2W6M A;  4GC7 A;  1FKA H;  3I4M G;  2MCT A;  3CQZ A;  3BJY A;  3PW4 A;  4UFZ A;  5CAE B;  3RTX A;  4EGJ A;  4RAY A;  5C44 G;  3PW0 A;  2R6F A;  3NGD A;  3N8D A;  2RGR A;  4YR2 A;  3LML A;  4APM A;  4BBS G;  5JH7 F;  1E4E B;  5KFN A;  2PMZ E;  4DL5 A;  2ALZ A;  4LH6 A;  5LMN H;  5DG7 A;  4X62 H;  2R82 A;  2NVY A;  2AQ4 A;  1EHI A;  2PBZ A;  4O3P A;  5L9X A;  4QWC A;  1X9N A;  4IWX A;  1TWF A;  4YQW A;  4GC6 A;  3N42 B;  3OUU A;  4O2A F;  4JI8 H;  4IR1 A;  3RAQ A;  1S0N A;  2VUG A;  4C2M A;  1SCU B;  3Q8P B;  5D1O A;  4HNU A;  2FK1 A;  3GTP A; 
#chains in the Genus database with same CATH homology
 3BA8 A;  1XDN A;  4FM9 A;  4DV4 H;  3N40 P;  5LMU H;  2KSW A;  4UCV A;  4DV0 H;  3F8N A;  1P8L A;  4A2B A;  4X66 H;  2YCH A;  4LFC H;  2WDT A;  4B3S H;  3JAM W;  4YY3 H;  2HVR A;  4MTD A;  4B3T H;  3OTO H;  2UXC H;  4RB0 A;  3KAL A;  4I7H A;  1Z2N X;  4X64 H;  1S68 A;  1WH2 A;  4JI3 H;  1N34 H;  4OX9 H;  1AN7 A;  4B3M H;  5IWA H;  5FD6 A;  4R7R A;  3RJ0 A;  2F4V H;  3BA9 A;  2W57 A;  4J0M A;  2ZM6 H;  2HVQ A;  4JI2 H;  1L2Z A;  3UQ8 A;  3RF2 A;  3BAA A;  4DR2 H;  1HR0 H;  2O03 A;  1XMQ H;  4UCT A;  2Q2U A;  4DR4 H;  1FVI A;  1XNR H;  3H20 A;  4LF4 H;  4LF6 H;  4A2A A;  5D1O A;  4EFE A;  1ZHS A;  2OWO A;  1TAE A;  4MV9 A;  4DUZ H;  4DV2 H;  1FJG H;  4JI7 H;  1TA8 A;  4DR7 H;  4JV5 H;  2ZJT A;  1E4G T;  1E4F T;  1XMO H;  4JI4 H;  2UUB H;  4IAJ A;  2CW8 A;  1HNZ H;  4DV7 H;  4JI6 H;  3HXL A;  2VOB A;  4UCO A;  4X65 H;  1I6U A;  4NXM H;  3M4I A;  3DF7 A;  3N6X A;  4JI1 H;  1HNW H;  3K3V A;  4DUY H;  1ZHQ A;  4ETS A;  3JSN A;  4Q0Y A;  4GKK H;  2UUC H;  1O75 A;  2XIG A;  5D1P A;  5FPR A;  4CC5 A;  5A2Q W;  2Q2T A;  3J7A K;  4EEQ A;  2WYO A;  2VPS A;  2HHH H;  1SEI A;  5D1O B;  4BWS C;  4LF5 H;  4PDB A;  4LSX A;  2RGV A;  1DGS A;  2E5L H;  2UU9 H;  1N33 H;  4M7E A;  4LF9 H;  4RZQ A;  2FE3 A;  1I94 H;  1BGW A;  3KAJ A;  4MV7 A;  4RB3 C;  3EYY A;  3MWM A;  3N41 B;  4CC6 A;  3L4K A;  1IBL H;  4MTE A;  3KXY T;  4LF7 H;  4LFA H;  3RIZ A;  5BR8 H;  4DV3 H;  3RGX A;  3BAB A;  2WE6 A;  3T1H H;  4UCU A;  1B04 A;  3J80 W;  4DR6 H;  3RGZ A;  4DR5 H;  5FD5 A;  1GYF A;  4B3R H;  1IBK H;  3L4J A;  4RB2 C;  3L2P A;  4RB1 A;  2CW7 A;  1N36 H;  4JI0 H;  4NXN H;  4DV1 H;  4KHP H;  1Z2O X;  2RGR A;  4DV5 H;  1M0W A;  3CVZ A;  3JSL A;  4LH7 A;  3T1Y H;  1FKA H;  4LSA A;  2UXB H;  3N43 B;  2UXD H;  3J81 W;  1V9P A;  4JYA H;  2MCT A;  1A0I A;  1VS0 A;  4UFZ A;  4LF8 H;  5LL6 b;  3RTX A;  1MZB A;  4AQY H;  4RAY A;  4EFB A;  2VQE H;  3N44 B;  1M0T A;  4JI5 H;  2HGS A;  5IT9 W;  3PN1 A;  4YHH H;  3IG0 A;  4LMY A;  3LML A;  1Z2P X;  4APM A;  5EOY A;  4DR3 H;  3FMA A;  2VQF H;  4GLX A;  2HVS A;  1S03 G;  4GKJ H;  4LH6 A;  5LMN H;  1BJT A;  5FPO A;  1N32 H;  4X62 H;  1XNQ H;  1X9N A;  4DR1 H;  4K0K H;  3N42 B;  3KAK A;  4LFB H;  4DV6 H;  3C0F B;  4UCR A;  1J5E H;  4JI8 H;  5FLX W;  2VUG A;  4UCS A;  1IBM H;  4RAZ A;  2UUA H;  1HNX H;  1SYX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...