3FMAA

Crystal structure of the gyf domain of smy2 in complex with a proline-rich peptide from bbp/scsf1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
SVESSWRYIDTQGQIHGPFTTQMMSQWYIGGYFASTLQISRLGSTPETLGINDIFITLGELMTKLEKYDTDPFTTFDKLHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SMY2
publication title SMY2-type GYF domain recognition in mRNA surveillance complexes
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 18
structure length 81
sequence length 81
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3fmaA00
3K3VA 1WH2A 1GYFA 4BWSC 3FMAA 1SYXB 1L2ZA
chains in the Genus database with same CATH superfamily
3EPGA 4O3OA 2FE3A 4O3PA 4Y8VB 3LWBA 4RB1A 4ED8A 1HNWH 2V9WA 3PW7A 1SYXB 1VKZA 4EFEA 2AGQA 1IBMH 4FS2A 2MCTA 4YR0A 1IOVA 3SI8A 4LFBH 5FJ8G 1PK8A 4WBNF 3RJ0A 3KHGA 4DR2H 4ED7A 1N56A 2P0AA 4MV6A 4X62H 4A3CG 2R84A 4XYMB 1T3NA 1ULZA 3MWEA 2C35B 2PN1A 3Q8RB 4ME6A 4A2BA 2HVQA 4RUCA 3GLKA 2W8LA 3KTMA 4ECQA 3V6HA 4DL2A 4DV7H 3RBDA 3BAAA 4I50F 2JA5G 4RAZA 1DV2A 4DLKA 5LP6F 4HR7A 5KFVA 1E4EA 4Q0YA 4QWAA 4QW8A 2UVUA 3R5HA 4A3GG 3KHHA 2FP4B 1I3QA 2O03A 3RGZA 3L4KA 3G6VA 2E5LH 2UVRA 4LH7A 4IRDA 2ZDGA 1M7JA 5L9XA 2YZGA 4UCUA 5KFSA 4F4WA 4LF9H 2JEIA 3T1HH 3PW2A 2DIKA 5JVDF 3PW4A 1S9FA 5DG8A 4AYBE 3GIKA 4EEQA 2R92G 3GTLA 4A3FG 2BQ3A 3U9TA 1HNZH 5KG4A 5C44G 2UVVA 4JV5H 1XMOH 1RK5A 1O75A 4YR2A 3PW5A 2RGVA 4LFCH 4DV2H 4G3IA 4I4TF 3PW0A 2AU0A 3GTGA 3FMAA 1S0OA 2R93G 4M7EA 4GC6A 1E4EB 4EYHB 2M05A 5JUMA 1B04A 4JI7H 1WH2A 3R5XA 4ECUA 4DL7A 3FKIA 2HHHH 1C30A 1JKJB 4JI3H 3HXLA 1N48A 1DV1A 4IAJA 4MV9A 3KHRA 4I7HA 2PMZE 2W9CA 3PR4A 2YU9A 1EHIA 3IN5A 3JSLA 1N32H 3MR5A 3Q8SB 2JA6A 1V4YA 5KFGA 4RU9A 4BY7G 2R7KA 4PDBA 4MV1A 4EGJA 4DL6A 5CB4F 4ECTA 3J7AK 3OTOH 5J2TF 2HVRA 2WB1E 2NU9B 2UVWA 1S68A 3DF7A 4O4LF 5KFRA 2Y0SE 1WSCA 5CA0F 1JDBB 5C4XG 1BGWA 5LL6b 1ZETA 3KALA 1I50A 2DLNA 3JSNA 3TIGA 2ATLA 4AQYH 3SE7A 4JYAH 4ETSA 5KFKA 4EG0A 5IP7G 4JI4H 3GTOA 3EPIA 1FVIA 4ECXA 2W70A 3Q8PB 5IYZF 2DWCA 5F9LA 1I6UA 5KFWA 4HNVA 4F4XA 2UXBH 1BXRA 3I4NG 1DIKA 2FPGB 5KFAA 3ORRA 2JA5A 5DG9A 4QWBA 2IP4A 4FM9A 4YAKB 1GSOA 1JIHA 2R7LA 4UCSA 3CVZA 3MR3A 1GYFA 1CQIB 1KJ9A 1KJIA 4LF5H 5FLXW 3GV7B 2R8IA 2RGRA 2XCPA 2C00A 3E5NA 5L1IA 4IRCA 3QZ7A 3K3VA 3GIIA 2RDIA 3N42B 4JI2H 4UCVA 3K5HA 2V4RA 2HJWA 5KFMA 5D1OB 4IRKA 4Q43A 3T5LA 2V58A 2R92A 5IP9G 2FK2A 2CQYA 3VPCA 4DL3A 1FKAH 4A3DG 2B63A 2F4VH 4U7CA 2DPJA 1IOWA 2W7OA 2W9BB 2FMAA 3GTQA 5DLFA 1KJJA 4YJ3F 2RF4A 5DG7A 2OLSA 3N40P 4DL4A 2R93A 2SCUB 4X66H 5DQHA 4J9KA 2VQDA 1I7LA 4AYBA 4IHJF 2NU7B 1CE8A 5T14A 3HOZG 2NUAB 4LF4H 4LF8H 5EDWA 2BR0A 1B33N 1EUCB 1VBHA 1VBGA 3F8NA 2XC9A 5L1JA 4F50A 4ED0A 4EYIB 3RB3A 4A3LG 2X0SA 5KFUA 2ASJA 4JUZA 3HBLA 1Y1WA 1C3OA 3GTPA 4RAYA 5KFJA 3MWMA 3GIPA 3Q1KA 4MAMA 3ETJA 5KFBA 3UQ8A 5LA6F 2VQFH 2FPIB 2ZDHA 5D1PA 2R8JA 2CZGA 4ZHQF 4EBDA 4JV1A 4J9PA 2VA3A 2WYOA 3NGDA 1Y14B 3MJFA 4HQ6A 2C2RA 1N34H 3JAMW 4ED6A 1B6SA 4RB3C 4DUYH 5BPHA 4J0MA 1K1SA 2W71A 2W6PA 2WTFA 4YP3A 2PMZA 4TQSA 1HR0H 3TIIA 3GV8B 3HB9A 5KX5F 4R8UB 5F9NA 2W9AA 4LF6H 2R7ZG 4A3BG 5L1LA 1KEEA 5BMVF 4X65H 1IBLH 3LMLA 4B3MH 4ZQIA 3U9SA 3RFCA 3H4DA 3V6JA 2WB1A 2E2IA 3QFFA 4UCTA 1B6RA 1M0TA 2XGQA 3HOWG 5CA1F 2Y0SA 1BNCA 3PR5B 5IYDG 2R7MA 3RBEA 3BG5A 5LYJF 3M9MB 1KJQA 1TWCA 1SEIA 4IR1A 4LFAH 4DV1H 3MWDA 4UFZA 4J9SA 2WAQE 4NLGA 4DR3H 2B63G 2R82A 4ECSA 4JV0A 1XNQH 1EZ1A 2YS6A 5C5JA 2FK3A 5KG2A 1DGSA 3G6XA 3T5KA 4RNNA 5C1PA 4J9OA 2FKLA 4BBSG 1RK6A 2YCHA 3H40A 4DL5A 4I55F 4APMA 2ALZA 4MV4A 5KT6A 4Q45A 4LH6A 2ASLA 3H0GA 3L2PA 4K0KH 4TV8F 1S0MA 4EFBA 4DV4H 4LMYA 3PZPA 4JI6H 3KXYT 5KG6A 2GPSA 5KFPA 5IYBG 5A2QW 3PO3G 1TWAA 2ZDQA 3TQTA 5IYCG 3LP8A 5KT2A 5KT5A 2JEGA 4TV9F 1AUVA 1Y1WG 4O2AF 2R87A 4X64H 4YQWA 4B3SH 5KFXA 3MFIA 3GIDA 3MFHA 2VA2A 1KJ8A 3BQ1A 3GTJA 1TA8A 3N8DA 4CC5A 3PN1A 4OX9H 5DGAA 4DR7H 3ETHA 1M0WA 2YW2A 2AGPA 3RB4A 1ZHQA 4WD3A 4LSXA 5JQWA 3RGXA 1Y1VG 1RJPA 3FDSA 5LMNH 2V4QA 4DR6H 3T5HA 2VOBA 1UNNC 5KFOA 2DPIA 1T36A 4XX0B 3H4BA 1N36H 3BA9A 5D1OA 3VPBA 4QWCA 4Q44A 1W96A 1K83A 4XZ3B 3G8CA 1AUXA 1TWHA 2W9BA 4GLXA 2C2EA 2R7ZA 2R7NA 2AQ4A 2UUCH 4IR9A 3V4ZA 1E4FT 5DLGA 2W6ZA 5KFHA 4RB0A 4QWEA 2FK1A 4GKJH 2XCAA 1N33H 2GPWA 1GSAA 2PBZA 5EWFA 2UUBH 4MTEA 3UFXB 5FPRA 4J9QA 1I94H 4GKKH 1L2ZA 3N44B 3VPDA 2W7PA 5FD6A 4L1KA 5KG3A 3RAXA 2NVYA 2WE6A 1VS0A 2W8KA 4ECYA 4MV8A 2VUGA 3H0GG 4LSAA 2FLNA 4IWYA 1TWGA 1RJRA 1A0IA 4QIWE 4DV6H 1GO3E 1WCMG 1SFOA 4TUYF 3I12A 1Z2OX 3RV3A 4FBUA 3KHLA 3GTMA 4RB2C 1W93A 5KFNA 2IA6A 3K3PA 1ZHSA 1JXLA 1E4GT 4U6PA 4DR4H 1KBLA 4O4IF 4BWSC 1JX4A 2HGSA 4JI1H 4TQRA 1M6VA 2XD4A 2FLLA 1Z2NX 4DUZH 2BQUA 2BQRA 2WAQA 5HV6A 2R86A 2I80A 3N41B 2W6QA 5KT7A 2CW8A 4R8UA 3RB6A 3J80W 4DV0H 3OUZA 4HNTA 3HOYG 4A3EG 4JI0H 3HKZE 2C22A 4RZQA 5K2MA 5I47A 5KFCA 4ZOLF 5GONF 2FPPB 4MV7A 4O3NA 3V6KA 2WDTA 5D8DA 2I87A 5KFTA 3OSPA 5JH7F 4RZRA 5KT3A 1PX2A 3C0FB 4HYKA 2VUMG 3AYHB 3JRWA 5KG7A 4RNMA 1GLVA 3JRXA 5EZYF 4E4TA 2VPSA 1Y1VA 4UCRA 1CS0A 1GGOA 3RAQA 2NVXA 3R23A 3GQCA 1RJQA 2C2DA 2R8KA 2YL2A 2ZM6H 4A93G 2XGPA 3PVXA 5H80A 1RYSA 2E2HA 3Q8QB 5FD5A 3TQ1A 3M9NB 4KHPH 4J9RA 2AGOA 4FS1A 1HNXH 2XIGA 3GV5B 4RUAA 2ZJTA 3GIMA 2J6TA 3M4IA 3MR2A 3ORQA 4EEYA 4BBRG 4YB8B 1RYRA 2CW7A 5KG1A 3V4SA 2UUAH 1CQJB 1S0NA 5IWAH 3BQ0A 3HOVG 3MR6A 5JVLA 2R6FA 3H3VH 2FLPA 2HVSA 1OWTA 3IG0A 4A2AA 5DQIA 5FPOA 5LMUH 4QWDA 4EGQA 1J5EH 4JI8H 4MTDA 2R85A 3M9OB 2W6NA 1WCMA 5C1OA 4JI5H 2UXDH 2R8GA 5KT4A 5CAEB 3J81W 2IMWP 5BR8H 5C3EG 1XDNA 2W57A 3Q2OA 4ECVA 4CC6A 3BJYA 3K5IA 4YAJB 4O2BF 2V59A 4HNUA 5EWEA 3OHAA 4NXMH 5KFYA 3HOXG 1UC9A 2VQEH 2UU9H 2XCLA 4ECZA 3RIZA 1K1QA 4QIWA 4BXXG 1UC8A 3OUUA 3TINA 5BPFA 5HBRB 2IBKA 2Q2UA 2VR1A 3RV4A 2FB9A 2JA7A 2JEFA 4J9LA 3R5FA 2JEJA 1A9XA 4ED3A 4IZOA 3KAKA 2I8CA 1VAJA 2J6UA 4ED2A 3RTXA 1AN7A 4B3RH 2YS7A 3RUPA 2YZMA 1FJGH 4M9UA 4F4ZA 5KG5A 2PVPA 3JZIA 5KG0A 5KFDA 2YRWA 5J2UF 4LF7H 4R7RA 1V51A 4XYLB 5KFIA 1S97A 1EUDB 4C5BA 4ZI7F 2VUMA 1R9TA 4ED1A 5C8YF 2W6OA 2C28A 3BQ2A 5EWGA 4B3TH 4O3SA 5KFQA 1XMQH 1TWFA 3HKZA 5IT9W 4C5AA 4YR3A 4O4HF 2NU8B 5DGBA 4YJ2F 2FJZA 2OWOA 1Z2PX 1EYZA 3RF2A 5KFEA 1GSHA 4MA5A 1KC7A 5DQGA 3G6YA 3WNZA 2CKZB 1SCUB 2OH2A 3HOUG 2YYAA 4MV3A 3RB0A 3GIQA 2GLTA 4Q8FA 2W9CB 5FLMG 1S10A 2R8HA 4A3JG 1X9NA 1T94A 5KFLA 5L1KA 2Q2TA 5EOYA 1S03G 4QW9A 4DV5H 1WR2A 5KFFA 3QZ8A 3OHBA 3GILA 3WO1A 4YHHH 4ECWA 3CQZA 2ASDA 4NXNH 3GIJA 2V5AA 4C5CA 2YZNA 3N6XA 1ZQ7A 3H20A 5KKNB 4YY3H 3L4JA 2W6MA 4F4YA 2KSWA 4YBZB 1BJTA 4FBTA 3VMMA 2QK4A 2NU6B 2UXCH 2DZDA 3I4MG 3BA8A 3N43B 2YRXA 1JDEA 2JA8G 4J9MA 2VPQA 2QYZA 4IWXA 4O3QA 2JA7G 3PO2G 4DR1H 4RNOA 3FKIG 3EYYA 3OSNA 4EBEA 1I7NA 5LXTF 3KAJA 2J9GA 4EBCA 1IBKH 4DR5H 4GC7A 5KFZA 4O3RA 3GTKA 1MZBA 1TAEA 4A3KG 2J6SA 1XNRH 3WO0A 3T5JA 2RDJA 4PWQA 4Q8EA 4DV3H 4A3MG 4QJFA 1V9PA 4UCOA 1P8LA 4JV2A 4BY1G 5LOVF 2JA6G 4MA0A 3T1YH 4A3IG 4J9NA 4ECRA 3BABA 1JLLB 4C2MA 4FU0A
chains in the Genus database with same CATH topology
5IWAH 1ZHQA 3K3VA 2FE3A 4LSXA 3RGXA 4RB1A 1HNWH 3N42B 4JI2H 1SYXB 4UCVA 2HVSA 5LMNH 3IG0A 4A2AA 4EFEA 5FPOA 4DR6H 5D1OB 1IBMH 5LMUH 2MCTA 4JI8H 1J5EH 2VOBA 4MTDA 4LFBH 4JI5H 3RJ0A 2UXDH 4DR2H 1FKAH 1N36H 3BA9A 3J81W 5D1OA 5BR8H 4X62H 2F4VH 1XDNA 2W57A 4CC6A 4NXMH 3N40P 2HVQA 4A2BA 4GLXA 2VQEH 4X66H 2UU9H 4DV7H 2UUCH 3BAAA 3RIZA 1E4FT 4RB0A 4RAZA 2Q2UA 4GKJH 4LF4H 1N33H 4LF8H 2UUBH 4MTEA 3F8NA 4Q0YA 3KAKA 5FPRA 1I94H 4GKKH 1L2ZA 3N44B 3RTXA 3L4KA 1AN7A 2O03A 3RGZA 5FD6A 4B3RH 2E5LH 4LH7A 1FJGH 2WE6A 1VS0A 4UCUA 4LF9H 3T1HH 2VUGA 4RAYA 4R7RA 3MWMA 4LSAA 4LF7H 4DR7H 1A0IA 4EEQA 3UQ8A 2VQFH 4DV6H 5D1PA 1Z2OX 1HNZH 2WYOA 4JV5H 4RB2C 1XMOH 1O75A 4B3TH 1ZHSA 1N34H 1E4GT 3JAMW 1XMQH 2RGVA 4RB3C 4DUYH 4DV2H 4J0MA 4LFCH 4DR4H 4BWSC 5IT9W 3FMAA 2HGSA 4JI1H 4M7EA 1HR0H 4LF6H 1Z2NX 4DUZH 1B04A 1IBLH 4B3MH 4X65H 2OWOA 1WH2A 3LMLA 1Z2PX 3RF2A 4JI7H 3N41B 2HHHH 2CW8A 4JI3H 3J80W 4UCTA 1M0TA 4DV0H 3HXLA 4IAJA 4JI0H 4MV9A 1X9NA 4RZQA 4I7HA 2Q2TA 5EOYA 1S03G 1SEIA 4DV5H 4MV7A 4LFAH 3JSLA 4DV1H 4YHHH 1N32H 2WDTA 4UFZA 4NXNH 4PDBA 4DR3H 3J7AK 3OTOH 3C0FB 3H20A 3N6XA 4YY3H 2HVRA 3L4JA 1XNQH 1S68A 3DF7A 1DGSA 2VPSA 2KSWA 1BJTA 4UCRA 2YCHA 1BGWA 5LL6b 2UXCH 3KALA 4APMA 3BA8A 3N43B 3JSNA 4LH6A 3L2PA 2ZM6H 4K0KH 4AQYH 4EFBA 4DV4H 4LMYA 4DR1H 4JI6H 4JYAH 4ETSA 3KXYT 3EYYA 4JI4H 5FD5A 3KAJA 1FVIA 5A2QW 5FLXW 4KHPH 1IBKH 4DR5H 1HNXH 1I6UA 1MZBA 1TAEA 2XIGA 1XNRH 4X64H 2ZJTA 2UXBH 4B3SH 3M4IA 4DV3H 4FM9A 4UCSA 1V9PA 1TA8A 1P8LA 3CVZA 4UCOA 3PN1A 4CC5A 4OX9H 1GYFA 3T1YH 2CW7A 4LF5H 3BABA 1M0WA 2RGRA 2UUAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K3V A;  1WH2 A;  1GYF A;  4BWS C;  3FMA A;  1SYX B;  1L2Z A; 
#chains in the Genus database with same CATH topology
 3EPG A;  4O3O A;  2FE3 A;  4O3P A;  4Y8V B;  3LWB A;  4RB1 A;  4ED8 A;  1HNW H;  2V9W A;  3PW7 A;  1SYX B;  1VKZ A;  4EFE A;  2AGQ A;  1IBM H;  4FS2 A;  2MCT A;  4YR0 A;  1IOV A;  3SI8 A;  4LFB H;  5FJ8 G;  1PK8 A;  4WBN F;  3RJ0 A;  3KHG A;  4DR2 H;  4ED7 A;  1N56 A;  2P0A A;  4MV6 A;  4X62 H;  4A3C G;  2R84 A;  4XYM B;  1T3N A;  1ULZ A;  3MWE A;  2C35 B;  2PN1 A;  3Q8R B;  4ME6 A;  4A2B A;  2HVQ A;  4RUC A;  3GLK A;  2W8L A;  3KTM A;  4ECQ A;  3V6H A;  4DL2 A;  4DV7 H;  3RBD A;  3BAA A;  4I50 F;  2JA5 G;  4RAZ A;  1DV2 A;  4DLK A;  5LP6 F;  4HR7 A;  5KFV A;  1E4E A;  4Q0Y A;  4QWA A;  4QW8 A;  2UVU A;  3R5H A;  4A3G G;  3KHH A;  2FP4 B;  1I3Q A;  2O03 A;  3RGZ A;  3L4K A;  3G6V A;  2E5L H;  2UVR A;  4LH7 A;  4IRD A;  2ZDG A;  1M7J A;  5L9X A;  2YZG A;  4UCU A;  5KFS A;  4F4W A;  4LF9 H;  2JEI A;  3T1H H;  3PW2 A;  2DIK A;  5JVD F;  3PW4 A;  1S9F A;  5DG8 A;  4AYB E;  3GIK A;  4EEQ A;  2R92 G;  3GTL A;  4A3F G;  2BQ3 A;  3U9T A;  1HNZ H;  5KG4 A;  5C44 G;  2UVV A;  4JV5 H;  1XMO H;  1RK5 A;  1O75 A;  4YR2 A;  3PW5 A;  2RGV A;  4LFC H;  4DV2 H;  4G3I A;  4I4T F;  3PW0 A;  2AU0 A;  3GTG A;  3FMA A;  1S0O A;  2R93 G;  4M7E A;  4GC6 A;  1E4E B;  4EYH B;  2M05 A;  5JUM A;  1B04 A;  4JI7 H;  1WH2 A;  3R5X A;  4ECU A;  4DL7 A;  3FKI A;  2HHH H;  1C30 A;  1JKJ B;  4JI3 H;  3HXL A;  1N48 A;  1DV1 A;  4IAJ A;  4MV9 A;  3KHR A;  4I7H A;  2PMZ E;  2W9C A;  3PR4 A;  2YU9 A;  1EHI A;  3IN5 A;  3JSL A;  1N32 H;  3MR5 A;  3Q8S B;  2JA6 A;  1V4Y A;  5KFG A;  4RU9 A;  4BY7 G;  2R7K A;  4PDB A;  4MV1 A;  4EGJ A;  4DL6 A;  5CB4 F;  4ECT A;  3J7A K;  3OTO H;  5J2T F;  2HVR A;  2WB1 E;  2NU9 B;  2UVW A;  1S68 A;  3DF7 A;  4O4L F;  5KFR A;  2Y0S E;  1WSC A;  5CA0 F;  1JDB B;  5C4X G;  1BGW A;  5LL6 b;  1ZET A;  3KAL A;  1I50 A;  2DLN A;  3JSN A;  3TIG A;  2ATL A;  4AQY H;  3SE7 A;  4JYA H;  4ETS A;  5KFK A;  4EG0 A;  5IP7 G;  4JI4 H;  3GTO A;  3EPI A;  1FVI A;  4ECX A;  2W70 A;  3Q8P B;  5IYZ F;  2DWC A;  5F9L A;  1I6U A;  5KFW A;  4HNV A;  4F4X A;  2UXB H;  1BXR A;  3I4N G;  1DIK A;  2FPG B;  5KFA A;  3ORR A;  2JA5 A;  5DG9 A;  4QWB A;  2IP4 A;  4FM9 A;  4YAK B;  1GSO A;  1JIH A;  2R7L A;  4UCS A;  3CVZ A;  3MR3 A;  1GYF A;  1CQI B;  1KJ9 A;  1KJI A;  4LF5 H;  5FLX W;  3GV7 B;  2R8I A;  2RGR A;  2XCP A;  2C00 A;  3E5N A;  5L1I A;  4IRC A;  3QZ7 A;  3K3V A;  3GII A;  2RDI A;  3N42 B;  4JI2 H;  4UCV A;  3K5H A;  2V4R A;  2HJW A;  5KFM A;  5D1O B;  4IRK A;  4Q43 A;  3T5L A;  2V58 A;  2R92 A;  5IP9 G;  2FK2 A;  2CQY A;  3VPC A;  4DL3 A;  1FKA H;  4A3D G;  2B63 A;  2F4V H;  4U7C A;  2DPJ A;  1IOW A;  2W7O A;  2W9B B;  2FMA A;  3GTQ A;  5DLF A;  1KJJ A;  4YJ3 F;  2RF4 A;  5DG7 A;  2OLS A;  3N40 P;  4DL4 A;  2R93 A;  2SCU B;  4X66 H;  5DQH A;  4J9K A;  2VQD A;  1I7L A;  4AYB A;  4IHJ F;  2NU7 B;  1CE8 A;  5T14 A;  3HOZ G;  2NUA B;  4LF4 H;  4LF8 H;  5EDW A;  2BR0 A;  1B33 N;  1EUC B;  1VBH A;  1VBG A;  3F8N A;  2XC9 A;  5L1J A;  4F50 A;  4ED0 A;  4EYI B;  3RB3 A;  4A3L G;  2X0S A;  5KFU A;  2ASJ A;  4JUZ A;  3HBL A;  1Y1W A;  1C3O A;  3GTP A;  4RAY A;  5KFJ A;  3MWM A;  3GIP A;  3Q1K A;  4MAM A;  3ETJ A;  5KFB A;  3UQ8 A;  5LA6 F;  2VQF H;  2FPI B;  2ZDH A;  5D1P A;  2R8J A;  2CZG A;  4ZHQ F;  4EBD A;  4JV1 A;  4J9P A;  2VA3 A;  2WYO A;  3NGD A;  1Y14 B;  3MJF A;  4HQ6 A;  2C2R A;  1N34 H;  3JAM W;  4ED6 A;  1B6S A;  4RB3 C;  4DUY H;  5BPH A;  4J0M A;  1K1S A;  2W71 A;  2W6P A;  2WTF A;  4YP3 A;  2PMZ A;  4TQS A;  1HR0 H;  3TII A;  3GV8 B;  3HB9 A;  5KX5 F;  4R8U B;  5F9N A;  2W9A A;  4LF6 H;  2R7Z G;  4A3B G;  5L1L A;  1KEE A;  5BMV F;  4X65 H;  1IBL H;  3LML A;  4B3M H;  4ZQI A;  3U9S A;  3RFC A;  3H4D A;  3V6J A;  2WB1 A;  2E2I A;  3QFF A;  4UCT A;  1B6R A;  1M0T A;  2XGQ A;  3HOW G;  5CA1 F;  2Y0S A;  1BNC A;  3PR5 B;  5IYD G;  2R7M A;  3RBE A;  3BG5 A;  5LYJ F;  3M9M B;  1KJQ A;  1TWC A;  1SEI A;  4IR1 A;  4LFA H;  4DV1 H;  3MWD A;  4UFZ A;  4J9S A;  2WAQ E;  4NLG A;  4DR3 H;  2B63 G;  2R82 A;  4ECS A;  4JV0 A;  1XNQ H;  1EZ1 A;  2YS6 A;  5C5J A;  2FK3 A;  5KG2 A;  1DGS A;  3G6X A;  3T5K A;  4RNN A;  5C1P A;  4J9O A;  2FKL A;  4BBS G;  1RK6 A;  2YCH A;  3H40 A;  4DL5 A;  4I55 F;  4APM A;  2ALZ A;  4MV4 A;  5KT6 A;  4Q45 A;  4LH6 A;  2ASL A;  3H0G A;  3L2P A;  4K0K H;  4TV8 F;  1S0M A;  4EFB A;  4DV4 H;  4LMY A;  3PZP A;  4JI6 H;  3KXY T;  5KG6 A;  2GPS A;  5KFP A;  5IYB G;  5A2Q W;  3PO3 G;  1TWA A;  2ZDQ A;  3TQT A;  5IYC G;  3LP8 A;  5KT2 A;  5KT5 A;  2JEG A;  4TV9 F;  1AUV A;  1Y1W G;  4O2A F;  2R87 A;  4X64 H;  4YQW A;  4B3S H;  5KFX A;  3MFI A;  3GID A;  3MFH A;  2VA2 A;  1KJ8 A;  3BQ1 A;  3GTJ A;  1TA8 A;  3N8D A;  4CC5 A;  3PN1 A;  4OX9 H;  5DGA A;  4DR7 H;  3ETH A;  1M0W A;  2YW2 A;  2AGP A;  3RB4 A;  1ZHQ A;  4WD3 A;  4LSX A;  5JQW A;  3RGX A;  1Y1V G;  1RJP A;  3FDS A;  5LMN H;  2V4Q A;  4DR6 H;  3T5H A;  2VOB A;  1UNN C;  5KFO A;  2DPI A;  1T36 A;  4XX0 B;  3H4B A;  1N36 H;  3BA9 A;  5D1O A;  3VPB A;  4QWC A;  4Q44 A;  1W96 A;  1K83 A;  4XZ3 B;  3G8C A;  1AUX A;  1TWH A;  2W9B A;  4GLX A;  2C2E A;  2R7Z A;  2R7N A;  2AQ4 A;  2UUC H;  4IR9 A;  3V4Z A;  1E4F T;  5DLG A;  2W6Z A;  5KFH A;  4RB0 A;  4QWE A;  2FK1 A;  4GKJ H;  2XCA A;  1N33 H;  2GPW A;  1GSA A;  2PBZ A;  5EWF A;  2UUB H;  4MTE A;  3UFX B;  5FPR A;  4J9Q A;  1I94 H;  4GKK H;  1L2Z A;  3N44 B;  3VPD A;  2W7P A;  5FD6 A;  4L1K A;  5KG3 A;  3RAX A;  2NVY A;  2WE6 A;  1VS0 A;  2W8K A;  4ECY A;  4MV8 A;  2VUG A;  3H0G G;  4LSA A;  2FLN A;  4IWY A;  1TWG A;  1RJR A;  1A0I A;  4QIW E;  4DV6 H;  1GO3 E;  1WCM G;  1SFO A;  4TUY F;  3I12 A;  1Z2O X;  3RV3 A;  4FBU A;  3KHL A;  3GTM A;  4RB2 C;  1W93 A;  5KFN A;  2IA6 A;  3K3P A;  1ZHS A;  1JXL A;  1E4G T;  4U6P A;  4DR4 H;  1KBL A;  4O4I F;  4BWS C;  1JX4 A;  2HGS A;  4JI1 H;  4TQR A;  1M6V A;  2XD4 A;  2FLL A;  1Z2N X;  4DUZ H;  2BQU A;  2BQR A;  2WAQ A;  5HV6 A;  2R86 A;  2I80 A;  3N41 B;  2W6Q A;  5KT7 A;  2CW8 A;  4R8U A;  3RB6 A;  3J80 W;  4DV0 H;  3OUZ A;  4HNT A;  3HOY G;  4A3E G;  4JI0 H;  3HKZ E;  2C22 A;  4RZQ A;  5K2M A;  5I47 A;  5KFC A;  4ZOL F;  5GON F;  2FPP B;  4MV7 A;  4O3N A;  3V6K A;  2WDT A;  5D8D A;  2I87 A;  5KFT A;  3OSP A;  5JH7 F;  4RZR A;  5KT3 A;  1PX2 A;  3C0F B;  4HYK A;  2VUM G;  3AYH B;  3JRW A;  5KG7 A;  4RNM A;  1GLV A;  3JRX A;  5EZY F;  4E4T A;  2VPS A;  1Y1V A;  4UCR A;  1CS0 A;  1GGO A;  3RAQ A;  2NVX A;  3R23 A;  3GQC A;  1RJQ A;  2C2D A;  2R8K A;  2YL2 A;  2ZM6 H;  4A93 G;  2XGP A;  3PVX A;  5H80 A;  1RYS A;  2E2H A;  3Q8Q B;  5FD5 A;  3TQ1 A;  3M9N B;  4KHP H;  4J9R A;  2AGO A;  4FS1 A;  1HNX H;  2XIG A;  3GV5 B;  4RUA A;  2ZJT A;  3GIM A;  2J6T A;  3M4I A;  3MR2 A;  3ORQ A;  4EEY A;  4BBR G;  4YB8 B;  1RYR A;  2CW7 A;  5KG1 A;  3V4S A;  2UUA H;  1CQJ B;  1S0N A;  5IWA H;  3BQ0 A;  3HOV G;  3MR6 A;  5JVL A;  2R6F A;  3H3V H;  2FLP A;  2HVS A;  1OWT A;  3IG0 A;  4A2A A;  5DQI A;  5FPO A;  5LMU H;  4QWD A;  4EGQ A;  1J5E H;  4JI8 H;  4MTD A;  2R85 A;  3M9O B;  2W6N A;  1WCM A;  5C1O A;  4JI5 H;  2UXD H;  2R8G A;  5KT4 A;  5CAE B;  3J81 W;  2IMW P;  5BR8 H;  5C3E G;  1XDN A;  2W57 A;  3Q2O A;  4ECV A;  4CC6 A;  3BJY A;  3K5I A;  4YAJ B;  4O2B F;  2V59 A;  4HNU A;  5EWE A;  3OHA A;  4NXM H;  5KFY A;  3HOX G;  1UC9 A;  2VQE H;  2UU9 H;  2XCL A;  4ECZ A;  3RIZ A;  1K1Q A;  4QIW A;  4BXX G;  1UC8 A;  3OUU A;  3TIN A;  5BPF A;  5HBR B;  2IBK A;  2Q2U A;  2VR1 A;  3RV4 A;  2FB9 A;  2JA7 A;  2JEF A;  4J9L A;  3R5F A;  2JEJ A;  1A9X A;  4ED3 A;  4IZO A;  3KAK A;  2I8C A;  1VAJ A;  2J6U A;  4ED2 A;  3RTX A;  1AN7 A;  4B3R H;  2YS7 A;  3RUP A;  2YZM A;  1FJG H;  4M9U A;  4F4Z A;  5KG5 A;  2PVP A;  3JZI A;  5KG0 A;  5KFD A;  2YRW A;  5J2U F;  4LF7 H;  4R7R A;  1V51 A;  4XYL B;  5KFI A;  1S97 A;  1EUD B;  4C5B A;  4ZI7 F;  2VUM A;  1R9T A;  4ED1 A;  5C8Y F;  2W6O A;  2C28 A;  3BQ2 A;  5EWG A;  4B3T H;  4O3S A;  5KFQ A;  1XMQ H;  1TWF A;  3HKZ A;  5IT9 W;  4C5A A;  4YR3 A;  4O4H F;  2NU8 B;  5DGB A;  4YJ2 F;  2FJZ A;  2OWO A;  1Z2P X;  1EYZ A;  3RF2 A;  5KFE A;  1GSH A;  4MA5 A;  1KC7 A;  5DQG A;  3G6Y A;  3WNZ A;  2CKZ B;  1SCU B;  2OH2 A;  3HOU G;  2YYA A;  4MV3 A;  3RB0 A;  3GIQ A;  2GLT A;  4Q8F A;  2W9C B;  5FLM G;  1S10 A;  2R8H A;  4A3J G;  1X9N A;  1T94 A;  5KFL A;  5L1K A;  2Q2T A;  5EOY A;  1S03 G;  4QW9 A;  4DV5 H;  1WR2 A;  5KFF A;  3QZ8 A;  3OHB A;  3GIL A;  3WO1 A;  4YHH H;  4ECW A;  3CQZ A;  2ASD A;  4NXN H;  3GIJ A;  2V5A A;  4C5C A;  2YZN A;  3N6X A;  1ZQ7 A;  3H20 A;  5KKN B;  4YY3 H;  3L4J A;  2W6M A;  4F4Y A;  2KSW A;  4YBZ B;  1BJT A;  4FBT A;  3VMM A;  2QK4 A;  2NU6 B;  2UXC H;  2DZD A;  3I4M G;  3BA8 A;  3N43 B;  2YRX A;  1JDE A;  2JA8 G;  4J9M A;  2VPQ A;  2QYZ A;  4IWX A;  4O3Q A;  2JA7 G;  3PO2 G;  4DR1 H;  4RNO A;  3FKI G;  3EYY A;  3OSN A;  4EBE A;  1I7N A;  5LXT F;  3KAJ A;  2J9G A;  4EBC A;  1IBK H;  4DR5 H;  4GC7 A;  5KFZ A;  4O3R A;  3GTK A;  1MZB A;  1TAE A;  4A3K G;  2J6S A;  1XNR H;  3WO0 A;  3T5J A;  2RDJ A;  4PWQ A;  4Q8E A;  4DV3 H;  4A3M G;  4QJF A;  1V9P A;  4UCO A;  1P8L A;  4JV2 A;  4BY1 G;  5LOV F;  2JA6 G;  4MA0 A;  3T1Y H;  4A3I G;  4J9N A;  4ECR A;  3BAB A;  1JLL B;  4C2M A;  4FU0 A; 
#chains in the Genus database with same CATH homology
 5IWA H;  1ZHQ A;  3K3V A;  2FE3 A;  4LSX A;  3RGX A;  4RB1 A;  1HNW H;  3N42 B;  4JI2 H;  1SYX B;  4UCV A;  2HVS A;  5LMN H;  3IG0 A;  4A2A A;  4EFE A;  5FPO A;  4DR6 H;  5D1O B;  1IBM H;  5LMU H;  2MCT A;  4JI8 H;  1J5E H;  2VOB A;  4MTD A;  4LFB H;  4JI5 H;  3RJ0 A;  2UXD H;  4DR2 H;  1FKA H;  1N36 H;  3BA9 A;  3J81 W;  5D1O A;  5BR8 H;  4X62 H;  2F4V H;  1XDN A;  2W57 A;  4CC6 A;  4NXM H;  3N40 P;  2HVQ A;  4A2B A;  4GLX A;  2VQE H;  4X66 H;  2UU9 H;  4DV7 H;  2UUC H;  3BAA A;  3RIZ A;  1E4F T;  4RB0 A;  4RAZ A;  2Q2U A;  4GKJ H;  4LF4 H;  1N33 H;  4LF8 H;  2UUB H;  4MTE A;  3F8N A;  4Q0Y A;  3KAK A;  5FPR A;  1I94 H;  4GKK H;  1L2Z A;  3N44 B;  3RTX A;  3L4K A;  1AN7 A;  2O03 A;  3RGZ A;  5FD6 A;  4B3R H;  2E5L H;  4LH7 A;  1FJG H;  2WE6 A;  1VS0 A;  4UCU A;  4LF9 H;  3T1H H;  2VUG A;  4RAY A;  4R7R A;  3MWM A;  4LSA A;  4LF7 H;  4DR7 H;  1A0I A;  4EEQ A;  3UQ8 A;  2VQF H;  4DV6 H;  5D1P A;  1Z2O X;  1HNZ H;  2WYO A;  4JV5 H;  4RB2 C;  1XMO H;  1O75 A;  4B3T H;  1ZHS A;  1N34 H;  1E4G T;  3JAM W;  1XMQ H;  2RGV A;  4RB3 C;  4DUY H;  4DV2 H;  4J0M A;  4LFC H;  4DR4 H;  4BWS C;  5IT9 W;  3FMA A;  2HGS A;  4JI1 H;  4M7E A;  1HR0 H;  4LF6 H;  1Z2N X;  4DUZ H;  1B04 A;  1IBL H;  4B3M H;  4X65 H;  2OWO A;  1WH2 A;  3LML A;  1Z2P X;  3RF2 A;  4JI7 H;  3N41 B;  2HHH H;  2CW8 A;  4JI3 H;  3J80 W;  4UCT A;  1M0T A;  4DV0 H;  3HXL A;  4IAJ A;  4JI0 H;  4MV9 A;  1X9N A;  4RZQ A;  4I7H A;  2Q2T A;  5EOY A;  1S03 G;  1SEI A;  4DV5 H;  4MV7 A;  4LFA H;  3JSL A;  4DV1 H;  4YHH H;  1N32 H;  2WDT A;  4UFZ A;  4NXN H;  4PDB A;  4DR3 H;  3J7A K;  3OTO H;  3C0F B;  3H20 A;  3N6X A;  4YY3 H;  2HVR A;  3L4J A;  1XNQ H;  1S68 A;  3DF7 A;  1DGS A;  2VPS A;  2KSW A;  1BJT A;  4UCR A;  2YCH A;  1BGW A;  5LL6 b;  2UXC H;  3KAL A;  4APM A;  3BA8 A;  3N43 B;  3JSN A;  4LH6 A;  3L2P A;  2ZM6 H;  4K0K H;  4AQY H;  4EFB A;  4DV4 H;  4LMY A;  4DR1 H;  4JI6 H;  4JYA H;  4ETS A;  3KXY T;  3EYY A;  4JI4 H;  5FD5 A;  3KAJ A;  1FVI A;  5A2Q W;  5FLX W;  4KHP H;  1IBK H;  4DR5 H;  1HNX H;  1I6U A;  1MZB A;  1TAE A;  2XIG A;  1XNR H;  4X64 H;  2ZJT A;  2UXB H;  4B3S H;  3M4I A;  4DV3 H;  4FM9 A;  4UCS A;  1V9P A;  1TA8 A;  1P8L A;  3CVZ A;  4UCO A;  3PN1 A;  4CC5 A;  4OX9 H;  1GYF A;  3T1Y H;  2CW7 A;  4LF5 H;  3BAB A;  1M0W A;  2RGR A;  2UUA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...