3FMAA

Crystal structure of the gyf domain of smy2 in complex with a proline-rich peptide from bbp/scsf1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
SVESSWRYIDTQGQIHGPFTTQMMSQWYIGGYFASTLQISRLGSTPETLGINDIFITLGELMTKLEKYDTDPFTTFDKLHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SMY2-type GYF domain recognition in mRNA surveillance complexes
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Protein SMY2
total genus 18
structure length 81
sequence length 81
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3fmaA00
1WH2A 1L2ZA 3K3VA 4BWSC 1GYFA 1SYXB 3FMAA
chains in the Genus database with same CATH superfamily
1OWTA 4ZQIA 5F9NA 3BA9A 4MV4A 3RGXA 4RUCA 3HOXG 4JI5H 4DL6A 1VBGA 2FKLA 3RAXA 2JEFA 1KJJA 4DV4H 2UVWA 2NUAB 1P8LA 3F8NA 1S10A 3GTPA 4OX9H 3GILA 1V9PA 1N48A 1I6UA 5KT4A 5KG4A 1E4GT 2YCHA 2XD4A 4YJ2F 2JEIA 1GGOA 1B04A 3V4ZA 5KT6A 4JI0H 4BBSG 4WBNF 5KFSA 2YRWA 2W9BA 4NXMH 1RJPA 3KALA 3SI8A 2FLNA 1RJQA 2V59A 3BAAA 3FKIG 4BY1G 4DV5H 4GC6A 1JXLA 4JI3H 1T36A 2VQDA 5FPOA 3EPIA 2ALZA 5L1KA 2VA3A 4LSAA 4JI1H 4RU9A 2E5LH 1C3OA 4TV9F 4ECTA 4ED0A 1CQJB 2KSWA 2V5AA 5H80A 1DGSA 4X62H 2R92A 3CQZA 1CQIB 3TQTA 4BWSC 4UCUA 2AU0A 1CE8A 4R8UA 2W57A 1E4FT 2V9WA 1E4EA 3MWDA 3GIKA 4UFZA 5L1LA 4MV6A 2WAQE 5EWEA 3KHRA 3OHAA 1JLLB 4ECYA 1EZ1A 1AUXA 1BJTA 4G3IA 2XCPA 3Q2OA 2ASJA 3M9MB 4F50A 4J9LA 1Z2PX 5C3EG 4JV1A 4J9PA 3RAQA 2W6NA 5KG3A 4YR0A 4EG0A 5D1OB 3R5FA 4B3SH 3RB4A 1I50A 5KFKA 2R7NA 5KT5A 1XMOH 2F4VH 1RJRA 3HOWG 3QZ8A 3J7AK 2J6UA 2R93G 3KAJA 2FPIB 2YYAA 3GIIA 5CA1F 2R6FA 2IBKA 2BQ3A 4EYHB 5KFYA 1Z2NX 3RTXA 4DR6H 2NVYA 4YR2A 2JA5A 3PR4A 4GKKH 4ECWA 2GPSA 2YZGA 1ZETA 5DQIA 1Y1WG 1IOVA 3PO3G 4A3DG 4EEQA 4F4YA 2JA6A 4HQ6A 3Q8PB 4DL2A 2OLSA 5D8DA 2WAQA 4JV2A 2JA7A 2XCAA 4A3CG 2NU9B 4O3NA 2FK3A 1UNNC 1M6VA 5IYDG 1M0TA 4NXNH 3DF7A 3BQ0A 3Q1KA 1KC7A 4O3PA 2W7PA 4JI2H 5IP7G 3H0GG 3LWBA 3RGZA 4FM9A 1TWAA 4M9UA 2PVPA 4DUZH 5DGAA 4LFCH 2ZDHA 2UVUA 3VMMA 2I87A 4FS2A 5KFXA 4AQYH 2FJZA 3HOZG 4O3QA 4B3RH 5BPHA 5IWAH 3VPCA 1A0IA 1FVIA 3WNZA 2RGRA 1I7NA 4EBCA 2ASDA 2HVQA 4A3LG 4K0KH 2XIGA 2DPIA 2R7MA 2VQEH 4QWDA 4FU0A 1T94A 2W6PA 5KG1A 1TWHA 4LFAH 3AYHB 1WR2A 2FB9A 3KXYT 5J2UF 5C44G 2HVSA 3HXLA 1UC8A 2W71A 4E4TA 2W70A 1RK5A 5KG7A 1S03G 2V4QA 1SCUB 3U9TA 4FBUA 2Y0SE 1TAEA 4EFEA 3TIGA 4YAKB 1XNRH 3N8DA 5L9XA 2R85A 2YRXA 1B6SA 3V6JA 4MV3A 4I7HA 4RZQA 4XYMB 2AQ4A 2V4RA 4Q44A 4ZI7F 4RNNA 5C4XG 4DV6H 4MV8A 5C8YF 3OTOH 4EEYA 1I3QA 1EUCB 5KFDA 3T5KA 5DG7A 2C2DA 2GPWA 1EHIA 2R82A 1Y14B 4QWAA 1N32H 2BQUA 4EBDA 4LSXA 5L1JA 4A3KG 2AGPA 2O03A 5KFNA 5DGBA 4DR5H 3BA8A 1S97A 2FLPA 1WSCA 5KFAA 3PW0A 2ZDQA 2C2EA 2JEGA 3N43B 4ECQA 4ZHQF 1VAJA 3RBDA 2DIKA 4R8UB 2Y0SA 5KFUA 1PX2A 4ECVA 4J9KA 3NGDA 3GV5B 5FJ8G 1ZHQA 2AGOA 2QYZA 2RF4A 4QJFA 2V58A 2J6TA 4UCOA 2GLTA 4BY7G 3UFXB 1EUDB 3G8CA 1HR0H 4O2AF 4QWEA 4MAMA 1O75A 1SEIA 5KFMA 4KHPH 2FP4B 2YS7A 2P0AA 1XNQH 3K5IA 3PW4A 2UXCH 3R5XA 1BXRA 5KFOA 4J0MA 2NVXA 4DV7H 4DL3A 4YJ3F 1SYXB 2ATLA 4LF9H 4JI8H 3M9NB 5DG9A 1DV2A 1S0MA 3GIMA 1CS0A 1BNCA 1ZQ7A 3GTLA 4IWYA 3H4BA 5KG5A 2PN1A 2YW2A 2DZDA 3PW2A 3H20A 1TWFA 2I80A 4A2BA 4J9RA 5EWGA 3G6VA 4LF6H 5J2TF 3GTKA 4DR4H 3PN1A 1WCMG 2C00A 1VBHA 3T5LA 3GIJA 5C1OA 3SE7A 4HNVA 1JDEA 3MR2A 4J9OA 4O3SA 5GONF 2C22A 5IYBG 4ED2A 5HBRB 1FJGH 4QIWA 1DV1A 2HJWA 4APMA 3ETJA 2E2HA 3ORRA 3BG5A 5FPRA 4QW8A 1UC9A 1HNXH 4X64H 1A9XA 3LMLA 4MV9A 3TQ1A 3EPGA 2CZGA 2OH2A 5IYCG 2R7ZG 4LFBH 1DIKA 2FK1A 2C35B 3GIQA 3JRWA 4RUAA 4ED3A 2UUAH 3RB3A 2R93A 1N34H 2VUMA 3L4JA 2WYOA 3N42B 3OSPA 1KEEA 1SFOA 1GSAA 3Q8RB 3FMAA 2R8JA 4GKJH 1IBKH 4DV3H 3JSLA 3FDSA 5KFVA 5DLGA 5DQGA 1M7JA 5L1IA 2W6ZA 1GO3E 1ZHSA 3V6HA 3I4MG 3JSNA 3L2PA 1RK6A 2JEJA 1KJ8A 2UUBH 2MCTA 3HB9A 4LH7A 2WDTA 4XYLB 1B33N 4JUZA 4A2AA 3MR6A 2FLLA 4WD3A 4NLGA 3I4NG 4BBRG 4IR1A 3MR5A 4DL4A 2CW8A 3CVZA 5D1OA 5D1PA 3K3VA 5LA6F 3RF2A 3BQ2A 4X66H 1B6RA 5BPFA 4J9MA 3GTMA 2VUGA 5IP9G 5KFQA 4RB1A 4A3JG 2YL2A 1XDNA 5EZYF 2HGSA 2QK4A 3PVXA 3KAKA 1N36H 4A3GG 4R7RA 3HBLA 2DPJA 2R86A 1HNWH 4A3EG 1Y1VA 5A2QW 3H0GA 4A3BG 4Y8VB 2NU6B 1GYFA 4BXXG 4TQSA 2I8CA 2CKZB 3PR5B 4IAJA 3T5JA 2W9BB 2HVRA 1N56A 1WH2A 4UCVA 3GLKA 5KFBA 3N44B 2W6OA 4IRKA 2OWOA 2WE6A 4IHJF 5LL6b 4ECUA 3PW7A 5CA0F 2B63G 3I12A 1TA8A 1Y1WA 3R23A 5FD6A 1GSHA 5KFTA 2UVVA 4MA0A 5KFCA 5JH7F 3GV7B 5KKNB 2W7OA 2VPQA 1L2ZA 3K3PA 5HV6A 2ASLA 1JIHA 4MA5A 4DV0H 5IYZF 1J5EH 4QW9A 5KFEA 3HOUG 2J6SA 2VUMG 4YB8B 4F4WA 4EYIB 4ECRA 5JVDF 2C28A 3U9SA 1IOWA 5KT2A 1E4EB 4C2MA 3RV4A 3VPBA 1RYRA 2R7ZA 2PMZE 5LOVF 3Q8SB 2Q2TA 4I55F 5KFIA 5LMNH 4EGJA 2WB1E 5LMUH 4JV0A 3RV3A 2NU7B 3KHHA 5KG2A 3IN5A 2NU8B 2IA6A 3J80W 4QWBA 4FBTA 3C0FB 3RB0A 4JI6H 4JI4H 3G6XA 3OSNA 4DV1H 3KTMA 1K83A 2UU9H 5BR8H 4UCRA 5DLFA 4F4XA 4IR9A 3RBEA 2AGQA 3H3VH 3HOVG 4RNMA 5JQWA 4EFBA 5KFJA 5IT9W 4HNUA 5I47A 1TWCA 2WTFA 2E2IA 1K1QA 4ETSA 1I94H 5KFWA 4ED7A 2R92G 4IZOA 5K2MA 2W8LA 5EOYA 4A3MG 4DR7H 2W6MA 4YBZB 2UXDH 5DG8A 1AN7A 3WO1A 3JAMW 4HR7A 2IMWP 4RB0A 5KFGA 3GQCA 4PDBA 1HNZH 4O4IF 1ULZA 4ECSA 3PW5A 4FS1A 3JZIA 4YHHH 4RB3C 4X65H 2FE3A 1R9TA 1V51A 3MR3A 4O3OA 4A3IG 3T1YH 3H40A 1VKZA 1I7LA 1JDBB 4YP3A 1S68A 5JVLA 1KBLA 1FKAH 4Q8EA 1W96A 2UUCH 1JKJB 2FMAA 2XGQA 2XGPA 3RB6A 2DWCA 2VPSA 4RAZA 1V4YA 3LP8A 3VPDA 3ETHA 4AYBA 2B63A 4TUYF 4U7CA 4LF7H 4A3FG 5T14A 2R87A 1T3NA 4GLXA 5KFRA 5FLXW 3GIDA 4LF4H 3PZPA 3MFIA 2W8KA 4CC6A 2VQFH 4O2BF 3OHBA 4J9NA 2PMZA 2VA2A 2JA8G 3K5HA 3QZ7A 3GTJA 2WB1A 4DLKA 3BABA 3Q8QB 5KFPA 1MZBA 1VS0A 3HKZE 5EDWA 2Q2UA 5EWFA 2YU9A 1Y1VG 5CB4F 2RDIA 4J9QA 3WO0A 1C30A 5LP6F 3MWEA 3V6KA 2ZM6H 3UQ8A 4RAYA 2C2RA 1AUVA 4QIWE 4Q0YA 3M9OB 3OUUA 5KFZA 3TINA 1KJIA 1X9NA 4LMYA 4A93G 4XX0B 3MFHA 3TIIA 3BQ1A 4YR3A 4L1KA 4ED6A 4AYBE 4UCSA 4MTDA 4JV5H 2DLNA 3N6XA 2IP4A 4I50F 5KG6A 2YS6A 2R8HA 2YZNA 4MV1A 3GV8B 2R8GA 5BMVF 5KG0A 5FD5A 2R7LA 4CC5A 4MV7A 4LH6A 1S0OA 4O3RA 3MJFA 3GTOA 4RB2C 2VOBA 3ORQA 1Z2OX 2W6QA 4MTEA 4F4ZA 2HHHH 1JX4A 1W93A 3HKZA 4ZOLF 4IRCA 3EYYA 5KT3A 4ED8A 4YY3H 2XCLA 2SCUB 4HNTA 1KJ9A 2R84A 5KT7A 4EBEA 4ED1A 4B3TH 2JA7G 4B3MH 4J9SA 4DR1H 5KFFA 4EGQA 1BGWA 2JA6G 1S9FA 4DUYH 4DR2H 3R5HA 4YQWA 1EYZA 5F9LA 1RYSA 4C5AA 4DV2H 3GTGA 4QWCA 2JA5G 2VR1A 2W9CB 1WCMA 2FPGB 1KJQA 3T5HA 1K1SA 2W9CA 2R8KA 2ZJTA 5C5JA 5KFLA 4HYKA 3E5NA 3MWMA 3RJ0A 5CAEB 1IBMH 4LF5H 5LYJF 3KHGA 4GC7A 3RIZA 2ZDGA 2RDJA 3H4DA 1IBLH 2UXBH 4UCTA 3L4KA 4I4TF 3N41B 2XC9A 4DR3H 2X0SA 5C1PA 4JYAH 2BR0A 5JUMA 4XZ3B 1TWGA 2R7KA 3GIPA 4C5BA 4RZRA 1XMQH 4LF8H 2YZMA 4IWXA 3HOYG 4DL7A 4Q43A 2R8IA 5DQHA 5FLMG 3IG0A 2BQRA 5LXTF 4JI7H 3J81W 3T1HH 1GSOA 2CW7A 4M7EA 2FPPB 4IRDA 1GLVA 2CQYA 4C5CA 3G6YA 3JRXA 4TQRA 3PO2G 2RGVA 4O4LF 5KFHA 3RFCA 1M0WA 4YAJB 5KX5F 4ECXA 1S0NA 4O4HF 1N33H 2PBZA 3V4SA 4Q8FA 4RNOA 3N40P 1PK8A 2FK2A 4PWQA 2M05A 3GTQA 3RUPA 3FKIA 2W9AA 2UVRA 4Q45A 4ECZA 2J9GA 4DL5A 3BJYA 3M4IA 4U6PA 3QFFA 4ME6A 3KHLA 4TV8F 3OUZA
chains in the Genus database with same CATH topology
2Q2UA 2CW8A 3BA9A 3CVZA 5D1OA 3K3VA 5D1PA 3RF2A 3RGXA 4JI5H 4X66H 2HVSA 3KXYT 2VUGA 3HXLA 4RB1A 4DV4H 2ZM6H 1XDNA 1N36H 1P8LA 2HGSA 3F8NA 3KAKA 4RAYA 1TAEA 4EFEA 3UQ8A 4R7RA 4Q0YA 1XNRH 4OX9H 1V9PA 1HNWH 1I6UA 5A2QW 4I7HA 4RZQA 1X9NA 4LMYA 1GYFA 1E4GT 2YCHA 4DV6H 3OTOH 4IAJA 2HVRA 1B04A 1N32H 1WH2A 4UCVA 4UCSA 4JI0H 4MTDA 4JV5H 3N6XA 4LSXA 3N44B 4NXMH 3KALA 2O03A 3BAAA 4DV5H 4DR5H 3BA8A 4A2AA 2WE6A 2OWOA 5LL6b 4JI3H 5FPOA 1TA8A 3N43B 4LSAA 5FD6A 4JI1H 2E5LH 5FD5A 2KSWA 4CC5A 4X62H 4MV7A 4LH6A 1DGSA 1L2ZA 4BWSC 4DV0H 4UCUA 1ZHQA 1J5EH 4RB2C 2VOBA 1Z2OX 2W57A 1E4FT 4UCOA 4MTEA 2HHHH 4UFZA 1HR0H 4KHPH 1O75A 1SEIA 3EYYA 2Q2TA 4YY3H 1XNQH 1BJTA 5LMNH 2UXCH 5LMUH 4B3TH 4J0MA 4B3MH 4DV7H 4DR1H 1SYXB 1Z2PX 4LF9H 1BGWA 4JI8H 4DUYH 4DR2H 5D1OB 3J80W 3C0FB 4JI6H 4B3SH 4JI4H 4DV1H 2F4VH 2UU9H 4DV2H 1XMOH 5BR8H 4UCRA 3H20A 2VQEH 3J7AK 4A2BA 4EFBA 4LF6H 4DR4H 5IT9W 3KAJA 3PN1A 2ZJTA 3MWMA 4ETSA 3RJ0A 1Z2NX 3RTXA 1I94H 1IBMH 4LF5H 4LFAH 4DR6H 3RIZA 5EOYA 4GKKH 4DR7H 1IBLH 2UXBH 1FJGH 2UXDH 4UCTA 3L4KA 1AN7A 4EEQA 3N41B 4APMA 3JAMW 4DR3H 5FPRA 4RB0A 4PDBA 4JYAH 1HNXH 4X64H 1HNZH 3LMLA 4MV9A 1XMQH 4LF8H 4YHHH 4RB3C 4X65H 1M0TA 2FE3A 4LFBH 3IG0A 3DF7A 2UUAH 4NXNH 4JI7H 1N34H 3T1YH 3J81W 3L4JA 4JI2H 3T1HH 2WYOA 2CW7A 4M7EA 3N42B 1S03G 3RGZA 1S68A 4FM9A 1FKAH 4LH7A 2UUCH 4DUZH 4LFCH 2RGVA 2VPSA 4RAZA 3FMAA 4AQYH 1M0WA 4B3RH 4GKJH 1IBKH 4DV3H 3JSLA 4LF7H 1N33H 3N40P 4GLXA 5FLXW 4LF4H 5IWAH 1FVIA 1A0IA 1ZHSA 4CC6A 2VQFH 2RGRA 2HVQA 3JSNA 3L2PA 4K0KH 3M4IA 2XIGA 2MCTA 2UUBH 3BABA 2WDTA 1MZBA 1VS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH2 A;  1L2Z A;  3K3V A;  4BWS C;  1GYF A;  1SYX B;  3FMA A; 
#chains in the Genus database with same CATH topology
 1OWT A;  4ZQI A;  5F9N A;  3BA9 A;  4MV4 A;  3RGX A;  4RUC A;  3HOX G;  4JI5 H;  4DL6 A;  1VBG A;  2FKL A;  3RAX A;  2JEF A;  1KJJ A;  4DV4 H;  2UVW A;  2NUA B;  1P8L A;  3F8N A;  1S10 A;  3GTP A;  4OX9 H;  3GIL A;  1V9P A;  1N48 A;  1I6U A;  5KT4 A;  5KG4 A;  1E4G T;  2YCH A;  2XD4 A;  4YJ2 F;  2JEI A;  1GGO A;  1B04 A;  3V4Z A;  5KT6 A;  4JI0 H;  4BBS G;  4WBN F;  5KFS A;  2YRW A;  2W9B A;  4NXM H;  1RJP A;  3KAL A;  3SI8 A;  2FLN A;  1RJQ A;  2V59 A;  3BAA A;  3FKI G;  4BY1 G;  4DV5 H;  4GC6 A;  1JXL A;  4JI3 H;  1T36 A;  2VQD A;  5FPO A;  3EPI A;  2ALZ A;  5L1K A;  2VA3 A;  4LSA A;  4JI1 H;  4RU9 A;  2E5L H;  1C3O A;  4TV9 F;  4ECT A;  4ED0 A;  1CQJ B;  2KSW A;  2V5A A;  5H80 A;  1DGS A;  4X62 H;  2R92 A;  3CQZ A;  1CQI B;  3TQT A;  4BWS C;  4UCU A;  2AU0 A;  1CE8 A;  4R8U A;  2W57 A;  1E4F T;  2V9W A;  1E4E A;  3MWD A;  3GIK A;  4UFZ A;  5L1L A;  4MV6 A;  2WAQ E;  5EWE A;  3KHR A;  3OHA A;  1JLL B;  4ECY A;  1EZ1 A;  1AUX A;  1BJT A;  4G3I A;  2XCP A;  3Q2O A;  2ASJ A;  3M9M B;  4F50 A;  4J9L A;  1Z2P X;  5C3E G;  4JV1 A;  4J9P A;  3RAQ A;  2W6N A;  5KG3 A;  4YR0 A;  4EG0 A;  5D1O B;  3R5F A;  4B3S H;  3RB4 A;  1I50 A;  5KFK A;  2R7N A;  5KT5 A;  1XMO H;  2F4V H;  1RJR A;  3HOW G;  3QZ8 A;  3J7A K;  2J6U A;  2R93 G;  3KAJ A;  2FPI B;  2YYA A;  3GII A;  5CA1 F;  2R6F A;  2IBK A;  2BQ3 A;  4EYH B;  5KFY A;  1Z2N X;  3RTX A;  4DR6 H;  2NVY A;  4YR2 A;  2JA5 A;  3PR4 A;  4GKK H;  4ECW A;  2GPS A;  2YZG A;  1ZET A;  5DQI A;  1Y1W G;  1IOV A;  3PO3 G;  4A3D G;  4EEQ A;  4F4Y A;  2JA6 A;  4HQ6 A;  3Q8P B;  4DL2 A;  2OLS A;  5D8D A;  2WAQ A;  4JV2 A;  2JA7 A;  2XCA A;  4A3C G;  2NU9 B;  4O3N A;  2FK3 A;  1UNN C;  1M6V A;  5IYD G;  1M0T A;  4NXN H;  3DF7 A;  3BQ0 A;  3Q1K A;  1KC7 A;  4O3P A;  2W7P A;  4JI2 H;  5IP7 G;  3H0G G;  3LWB A;  3RGZ A;  4FM9 A;  1TWA A;  4M9U A;  2PVP A;  4DUZ H;  5DGA A;  4LFC H;  2ZDH A;  2UVU A;  3VMM A;  2I87 A;  4FS2 A;  5KFX A;  4AQY H;  2FJZ A;  3HOZ G;  4O3Q A;  4B3R H;  5BPH A;  5IWA H;  3VPC A;  1A0I A;  1FVI A;  3WNZ A;  2RGR A;  1I7N A;  4EBC A;  2ASD A;  2HVQ A;  4A3L G;  4K0K H;  2XIG A;  2DPI A;  2R7M A;  2VQE H;  4QWD A;  4FU0 A;  1T94 A;  2W6P A;  5KG1 A;  1TWH A;  4LFA H;  3AYH B;  1WR2 A;  2FB9 A;  3KXY T;  5J2U F;  5C44 G;  2HVS A;  3HXL A;  1UC8 A;  2W71 A;  4E4T A;  2W70 A;  1RK5 A;  5KG7 A;  1S03 G;  2V4Q A;  1SCU B;  3U9T A;  4FBU A;  2Y0S E;  1TAE A;  4EFE A;  3TIG A;  4YAK B;  1XNR H;  3N8D A;  5L9X A;  2R85 A;  2YRX A;  1B6S A;  3V6J A;  4MV3 A;  4I7H A;  4RZQ A;  4XYM B;  2AQ4 A;  2V4R A;  4Q44 A;  4ZI7 F;  4RNN A;  5C4X G;  4DV6 H;  4MV8 A;  5C8Y F;  3OTO H;  4EEY A;  1I3Q A;  1EUC B;  5KFD A;  3T5K A;  5DG7 A;  2C2D A;  2GPW A;  1EHI A;  2R82 A;  1Y14 B;  4QWA A;  1N32 H;  2BQU A;  4EBD A;  4LSX A;  5L1J A;  4A3K G;  2AGP A;  2O03 A;  5KFN A;  5DGB A;  4DR5 H;  3BA8 A;  1S97 A;  2FLP A;  1WSC A;  5KFA A;  3PW0 A;  2ZDQ A;  2C2E A;  2JEG A;  3N43 B;  4ECQ A;  4ZHQ F;  1VAJ A;  3RBD A;  2DIK A;  4R8U B;  2Y0S A;  5KFU A;  1PX2 A;  4ECV A;  4J9K A;  3NGD A;  3GV5 B;  5FJ8 G;  1ZHQ A;  2AGO A;  2QYZ A;  2RF4 A;  4QJF A;  2V58 A;  2J6T A;  4UCO A;  2GLT A;  4BY7 G;  3UFX B;  1EUD B;  3G8C A;  1HR0 H;  4O2A F;  4QWE A;  4MAM A;  1O75 A;  1SEI A;  5KFM A;  4KHP H;  2FP4 B;  2YS7 A;  2P0A A;  1XNQ H;  3K5I A;  3PW4 A;  2UXC H;  3R5X A;  1BXR A;  5KFO A;  4J0M A;  2NVX A;  4DV7 H;  4DL3 A;  4YJ3 F;  1SYX B;  2ATL A;  4LF9 H;  4JI8 H;  3M9N B;  5DG9 A;  1DV2 A;  1S0M A;  3GIM A;  1CS0 A;  1BNC A;  1ZQ7 A;  3GTL A;  4IWY A;  3H4B A;  5KG5 A;  2PN1 A;  2YW2 A;  2DZD A;  3PW2 A;  3H20 A;  1TWF A;  2I80 A;  4A2B A;  4J9R A;  5EWG A;  3G6V A;  4LF6 H;  5J2T F;  3GTK A;  4DR4 H;  3PN1 A;  1WCM G;  2C00 A;  1VBH A;  3T5L A;  3GIJ A;  5C1O A;  3SE7 A;  4HNV A;  1JDE A;  3MR2 A;  4J9O A;  4O3S A;  5GON F;  2C22 A;  5IYB G;  4ED2 A;  5HBR B;  1FJG H;  4QIW A;  1DV1 A;  2HJW A;  4APM A;  3ETJ A;  2E2H A;  3ORR A;  3BG5 A;  5FPR A;  4QW8 A;  1UC9 A;  1HNX H;  4X64 H;  1A9X A;  3LML A;  4MV9 A;  3TQ1 A;  3EPG A;  2CZG A;  2OH2 A;  5IYC G;  2R7Z G;  4LFB H;  1DIK A;  2FK1 A;  2C35 B;  3GIQ A;  3JRW A;  4RUA A;  4ED3 A;  2UUA H;  3RB3 A;  2R93 A;  1N34 H;  2VUM A;  3L4J A;  2WYO A;  3N42 B;  3OSP A;  1KEE A;  1SFO A;  1GSA A;  3Q8R B;  3FMA A;  2R8J A;  4GKJ H;  1IBK H;  4DV3 H;  3JSL A;  3FDS A;  5KFV A;  5DLG A;  5DQG A;  1M7J A;  5L1I A;  2W6Z A;  1GO3 E;  1ZHS A;  3V6H A;  3I4M G;  3JSN A;  3L2P A;  1RK6 A;  2JEJ A;  1KJ8 A;  2UUB H;  2MCT A;  3HB9 A;  4LH7 A;  2WDT A;  4XYL B;  1B33 N;  4JUZ A;  4A2A A;  3MR6 A;  2FLL A;  4WD3 A;  4NLG A;  3I4N G;  4BBR G;  4IR1 A;  3MR5 A;  4DL4 A;  2CW8 A;  3CVZ A;  5D1O A;  5D1P A;  3K3V A;  5LA6 F;  3RF2 A;  3BQ2 A;  4X66 H;  1B6R A;  5BPF A;  4J9M A;  3GTM A;  2VUG A;  5IP9 G;  5KFQ A;  4RB1 A;  4A3J G;  2YL2 A;  1XDN A;  5EZY F;  2HGS A;  2QK4 A;  3PVX A;  3KAK A;  1N36 H;  4A3G G;  4R7R A;  3HBL A;  2DPJ A;  2R86 A;  1HNW H;  4A3E G;  1Y1V A;  5A2Q W;  3H0G A;  4A3B G;  4Y8V B;  2NU6 B;  1GYF A;  4BXX G;  4TQS A;  2I8C A;  2CKZ B;  3PR5 B;  4IAJ A;  3T5J A;  2W9B B;  2HVR A;  1N56 A;  1WH2 A;  4UCV A;  3GLK A;  5KFB A;  3N44 B;  2W6O A;  4IRK A;  2OWO A;  2WE6 A;  4IHJ F;  5LL6 b;  4ECU A;  3PW7 A;  5CA0 F;  2B63 G;  3I12 A;  1TA8 A;  1Y1W A;  3R23 A;  5FD6 A;  1GSH A;  5KFT A;  2UVV A;  4MA0 A;  5KFC A;  5JH7 F;  3GV7 B;  5KKN B;  2W7O A;  2VPQ A;  1L2Z A;  3K3P A;  5HV6 A;  2ASL A;  1JIH A;  4MA5 A;  4DV0 H;  5IYZ F;  1J5E H;  4QW9 A;  5KFE A;  3HOU G;  2J6S A;  2VUM G;  4YB8 B;  4F4W A;  4EYI B;  4ECR A;  5JVD F;  2C28 A;  3U9S A;  1IOW A;  5KT2 A;  1E4E B;  4C2M A;  3RV4 A;  3VPB A;  1RYR A;  2R7Z A;  2PMZ E;  5LOV F;  3Q8S B;  2Q2T A;  4I55 F;  5KFI A;  5LMN H;  4EGJ A;  2WB1 E;  5LMU H;  4JV0 A;  3RV3 A;  2NU7 B;  3KHH A;  5KG2 A;  3IN5 A;  2NU8 B;  2IA6 A;  3J80 W;  4QWB A;  4FBT A;  3C0F B;  3RB0 A;  4JI6 H;  4JI4 H;  3G6X A;  3OSN A;  4DV1 H;  3KTM A;  1K83 A;  2UU9 H;  5BR8 H;  4UCR A;  5DLF A;  4F4X A;  4IR9 A;  3RBE A;  2AGQ A;  3H3V H;  3HOV G;  4RNM A;  5JQW A;  4EFB A;  5KFJ A;  5IT9 W;  4HNU A;  5I47 A;  1TWC A;  2WTF A;  2E2I A;  1K1Q A;  4ETS A;  1I94 H;  5KFW A;  4ED7 A;  2R92 G;  4IZO A;  5K2M A;  2W8L A;  5EOY A;  4A3M G;  4DR7 H;  2W6M A;  4YBZ B;  2UXD H;  5DG8 A;  1AN7 A;  3WO1 A;  3JAM W;  4HR7 A;  2IMW P;  4RB0 A;  5KFG A;  3GQC A;  4PDB A;  1HNZ H;  4O4I F;  1ULZ A;  4ECS A;  3PW5 A;  4FS1 A;  3JZI A;  4YHH H;  4RB3 C;  4X65 H;  2FE3 A;  1R9T A;  1V51 A;  3MR3 A;  4O3O A;  4A3I G;  3T1Y H;  3H40 A;  1VKZ A;  1I7L A;  1JDB B;  4YP3 A;  1S68 A;  5JVL A;  1KBL A;  1FKA H;  4Q8E A;  1W96 A;  2UUC H;  1JKJ B;  2FMA A;  2XGQ A;  2XGP A;  3RB6 A;  2DWC A;  2VPS A;  4RAZ A;  1V4Y A;  3LP8 A;  3VPD A;  3ETH A;  4AYB A;  2B63 A;  4TUY F;  4U7C A;  4LF7 H;  4A3F G;  5T14 A;  2R87 A;  1T3N A;  4GLX A;  5KFR A;  5FLX W;  3GID A;  4LF4 H;  3PZP A;  3MFI A;  2W8K A;  4CC6 A;  2VQF H;  4O2B F;  3OHB A;  4J9N A;  2PMZ A;  2VA2 A;  2JA8 G;  3K5H A;  3QZ7 A;  3GTJ A;  2WB1 A;  4DLK A;  3BAB A;  3Q8Q B;  5KFP A;  1MZB A;  1VS0 A;  3HKZ E;  5EDW A;  2Q2U A;  5EWF A;  2YU9 A;  1Y1V G;  5CB4 F;  2RDI A;  4J9Q A;  3WO0 A;  1C30 A;  5LP6 F;  3MWE A;  3V6K A;  2ZM6 H;  3UQ8 A;  4RAY A;  2C2R A;  1AUV A;  4QIW E;  4Q0Y A;  3M9O B;  3OUU A;  5KFZ A;  3TIN A;  1KJI A;  1X9N A;  4LMY A;  4A93 G;  4XX0 B;  3MFH A;  3TII A;  3BQ1 A;  4YR3 A;  4L1K A;  4ED6 A;  4AYB E;  4UCS A;  4MTD A;  4JV5 H;  2DLN A;  3N6X A;  2IP4 A;  4I50 F;  5KG6 A;  2YS6 A;  2R8H A;  2YZN A;  4MV1 A;  3GV8 B;  2R8G A;  5BMV F;  5KG0 A;  5FD5 A;  2R7L A;  4CC5 A;  4MV7 A;  4LH6 A;  1S0O A;  4O3R A;  3MJF A;  3GTO A;  4RB2 C;  2VOB A;  3ORQ A;  1Z2O X;  2W6Q A;  4MTE A;  4F4Z A;  2HHH H;  1JX4 A;  1W93 A;  3HKZ A;  4ZOL F;  4IRC A;  3EYY A;  5KT3 A;  4ED8 A;  4YY3 H;  2XCL A;  2SCU B;  4HNT A;  1KJ9 A;  2R84 A;  5KT7 A;  4EBE A;  4ED1 A;  4B3T H;  2JA7 G;  4B3M H;  4J9S A;  4DR1 H;  5KFF A;  4EGQ A;  1BGW A;  2JA6 G;  1S9F A;  4DUY H;  4DR2 H;  3R5H A;  4YQW A;  1EYZ A;  5F9L A;  1RYS A;  4C5A A;  4DV2 H;  3GTG A;  4QWC A;  2JA5 G;  2VR1 A;  2W9C B;  1WCM A;  2FPG B;  1KJQ A;  3T5H A;  1K1S A;  2W9C A;  2R8K A;  2ZJT A;  5C5J A;  5KFL A;  4HYK A;  3E5N A;  3MWM A;  3RJ0 A;  5CAE B;  1IBM H;  4LF5 H;  5LYJ F;  3KHG A;  4GC7 A;  3RIZ A;  2ZDG A;  2RDJ A;  3H4D A;  1IBL H;  2UXB H;  4UCT A;  3L4K A;  4I4T F;  3N41 B;  2XC9 A;  4DR3 H;  2X0S A;  5C1P A;  4JYA H;  2BR0 A;  5JUM A;  4XZ3 B;  1TWG A;  2R7K A;  3GIP A;  4C5B A;  4RZR A;  1XMQ H;  4LF8 H;  2YZM A;  4IWX A;  3HOY G;  4DL7 A;  4Q43 A;  2R8I A;  5DQH A;  5FLM G;  3IG0 A;  2BQR A;  5LXT F;  4JI7 H;  3J81 W;  3T1H H;  1GSO A;  2CW7 A;  4M7E A;  2FPP B;  4IRD A;  1GLV A;  2CQY A;  4C5C A;  3G6Y A;  3JRX A;  4TQR A;  3PO2 G;  2RGV A;  4O4L F;  5KFH A;  3RFC A;  1M0W A;  4YAJ B;  5KX5 F;  4ECX A;  1S0N A;  4O4H F;  1N33 H;  2PBZ A;  3V4S A;  4Q8F A;  4RNO A;  3N40 P;  1PK8 A;  2FK2 A;  4PWQ A;  2M05 A;  3GTQ A;  3RUP A;  3FKI A;  2W9A A;  2UVR A;  4Q45 A;  4ECZ A;  2J9G A;  4DL5 A;  3BJY A;  3M4I A;  4U6P A;  3QFF A;  4ME6 A;  3KHL A;  4TV8 F;  3OUZ A; 
#chains in the Genus database with same CATH homology
 2Q2U A;  2CW8 A;  3BA9 A;  3CVZ A;  5D1O A;  3K3V A;  5D1P A;  3RF2 A;  3RGX A;  4JI5 H;  4X66 H;  2HVS A;  3KXY T;  2VUG A;  3HXL A;  4RB1 A;  4DV4 H;  2ZM6 H;  1XDN A;  1N36 H;  1P8L A;  2HGS A;  3F8N A;  3KAK A;  4RAY A;  1TAE A;  4EFE A;  3UQ8 A;  4R7R A;  4Q0Y A;  1XNR H;  4OX9 H;  1V9P A;  1HNW H;  1I6U A;  5A2Q W;  4I7H A;  4RZQ A;  1X9N A;  4LMY A;  1GYF A;  1E4G T;  2YCH A;  4DV6 H;  3OTO H;  4IAJ A;  2HVR A;  1B04 A;  1N32 H;  1WH2 A;  4UCV A;  4UCS A;  4JI0 H;  4MTD A;  4JV5 H;  3N6X A;  4LSX A;  3N44 B;  4NXM H;  3KAL A;  2O03 A;  3BAA A;  4DV5 H;  4DR5 H;  3BA8 A;  4A2A A;  2WE6 A;  2OWO A;  5LL6 b;  4JI3 H;  5FPO A;  1TA8 A;  3N43 B;  4LSA A;  5FD6 A;  4JI1 H;  2E5L H;  5FD5 A;  2KSW A;  4CC5 A;  4X62 H;  4MV7 A;  4LH6 A;  1DGS A;  1L2Z A;  4BWS C;  4DV0 H;  4UCU A;  1ZHQ A;  1J5E H;  4RB2 C;  2VOB A;  1Z2O X;  2W57 A;  1E4F T;  4UCO A;  4MTE A;  2HHH H;  4UFZ A;  1HR0 H;  4KHP H;  1O75 A;  1SEI A;  3EYY A;  2Q2T A;  4YY3 H;  1XNQ H;  1BJT A;  5LMN H;  2UXC H;  5LMU H;  4B3T H;  4J0M A;  4B3M H;  4DV7 H;  4DR1 H;  1SYX B;  1Z2P X;  4LF9 H;  1BGW A;  4JI8 H;  4DUY H;  4DR2 H;  5D1O B;  3J80 W;  3C0F B;  4JI6 H;  4B3S H;  4JI4 H;  4DV1 H;  2F4V H;  2UU9 H;  4DV2 H;  1XMO H;  5BR8 H;  4UCR A;  3H20 A;  2VQE H;  3J7A K;  4A2B A;  4EFB A;  4LF6 H;  4DR4 H;  5IT9 W;  3KAJ A;  3PN1 A;  2ZJT A;  3MWM A;  4ETS A;  3RJ0 A;  1Z2N X;  3RTX A;  1I94 H;  1IBM H;  4LF5 H;  4LFA H;  4DR6 H;  3RIZ A;  5EOY A;  4GKK H;  4DR7 H;  1IBL H;  2UXB H;  1FJG H;  2UXD H;  4UCT A;  3L4K A;  1AN7 A;  4EEQ A;  3N41 B;  4APM A;  3JAM W;  4DR3 H;  5FPR A;  4RB0 A;  4PDB A;  4JYA H;  1HNX H;  4X64 H;  1HNZ H;  3LML A;  4MV9 A;  1XMQ H;  4LF8 H;  4YHH H;  4RB3 C;  4X65 H;  1M0T A;  2FE3 A;  4LFB H;  3IG0 A;  3DF7 A;  2UUA H;  4NXN H;  4JI7 H;  1N34 H;  3T1Y H;  3J81 W;  3L4J A;  4JI2 H;  3T1H H;  2WYO A;  2CW7 A;  4M7E A;  3N42 B;  1S03 G;  3RGZ A;  1S68 A;  4FM9 A;  1FKA H;  4LH7 A;  2UUC H;  4DUZ H;  4LFC H;  2RGV A;  2VPS A;  4RAZ A;  3FMA A;  4AQY H;  1M0W A;  4B3R H;  4GKJ H;  1IBK H;  4DV3 H;  3JSL A;  4LF7 H;  1N33 H;  3N40 P;  4GLX A;  5FLX W;  4LF4 H;  5IWA H;  1FVI A;  1A0I A;  1ZHS A;  4CC6 A;  2VQF H;  2RGR A;  2HVQ A;  3JSN A;  3L2P A;  4K0K H;  3M4I A;  2XIG A;  2MCT A;  2UUB H;  3BAB A;  2WDT A;  1MZB A;  1VS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...