3FMAA

Crystal structure of the gyf domain of smy2 in complex with a proline-rich peptide from bbp/scsf1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
SVESSWRYIDTQGQIHGPFTTQMMSQWYIGGYFASTLQISRLGSTPETLGINDIFITLGELMTKLEKYDTDPFTTFDKLHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein SMY2
publication title SMY2-type GYF domain recognition in mRNA surveillance complexes
rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 81
sequence length 81
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3fmaA00
1SYXB 1GYFA 4BWSC 1WH2A 3K3VA 3FMAA 1L2ZA
chains in the Genus database with same CATH superfamily
1GSOA 1GYFA 3OHBA 1PX2A 5KFSA 1C30A 1XDNA 4FBTA 4DV6H 3GTOA 3GIQA 5EWEA 2RDJA 4FS2A 4X66H 2J6TA 3H40A 2W6ZA 3H4BA 2FE3A 4AYBE 3RGZA 3MWEA 4TQSA 2CKZB 2ZJTA 3OSNA 5KFPA 4DR5H 4UCUA 4O3SA 4LF4H 3R5FA 1OWTA 3CQZA 3R23A 4XZ3B 3EPGA 2YZNA 1M0WA 5DLGA 5BR8H 3L4JA 3OUUA 3L4KA 3BG5A 4I55F 2I87A 2C22A 4A3GG 2WYOA 2R7ZG 4IR9A 4APMA 4WD3A 5LMUH 1VAJA 2I8CA 4EBCA 1E4FT 3GTPA 2W57A 5KFDA 3HKZA 5KFQA 2WB1A 4DLKA 4HR7A 2RDIA 1RJQA 3FMAA 4MV9A 1S68A 5KFWA 1N34H 4JV2A 4XYMB 4ME6A 3PW2A 4JI0H 1MZBA 3GIKA 2JEFA 4R8UB 3H0GG 3TQ1A 4RB0A 5KFIA 3HOUG 1S0OA 3R5XA 5KFHA 4PWQA 3GTLA 2WAQA 3HKZE 2W9BA 5EOYA 2WB1E 4ZQIA 4RU9A 3FKIG 4B3RH 2R7KA 3OHAA 3K3PA 1TWCA 2RGVA 1W96A 4MV3A 5DQIA 4JV0A 2ASDA 2JA7G 5KT4A 3GIJA 5DG8A 4R8UA 3BAAA 4F4YA 2JA5G 2WAQE 4J9RA 2FK3A 1GGOA 4J9OA 1KC7A 4X65H 4YQWA 5FLMG 4J9SA 1TWHA 2FB9A 3V4SA 2W71A 2VQFH 4JI4H 1Z2NX 5KFRA 3G6VA 5FD5A 1M6VA 1N56A 1S0NA 3Q1KA 1M0TA 3RB3A 5IT9W 4QWAA 1RK6A 2GPWA 4KHPH 1RK5A 4GLXA 5DGBA 2JEJA 4QW8A 2FP4B 2W6QA 2UXDH 4ETSA 4ECXA 3T5JA 1FKAH 1CE8A 3OSPA 3PN1A 1A0IA 3BQ1A 2VPSA 5J2UF 3MFHA 4C5CA 5KFOA 3N43B 1B6RA 5KFZA 4YP3A 2AQ4A 5FPRA 3M9OB 1ZHQA 5KFNA 2BQRA 3PW4A 4GKKH 1RYRA 2W8KA 3U9TA 1I7NA 1P8LA 4ECTA 5IYCG 2C2RA 2NU6B 3TIGA 5F9LA 3ETJA 3SE7A 1UNNC 2J6UA 2E2HA 5KG2A 1T3NA 2ATLA 4CC6A 2R93A 4XX0B 2C2EA 5C1OA 2B63G 2W9CA 4OX9H 1Y1VA 2Y0SA 5EDWA 2IA6A 1V9PA 5J2TF 1DV1A 3RGXA 3QZ8A 3HOYG 4IR1A 1Y1WA 2RF4A 4HNUA 4ED2A 4EBEA 2YU9A 3PVXA 2R92A 4A3CG 1BXRA 2ZDGA 4QJFA 5DQGA 3EYYA 5KG1A 2C2DA 2JA8G 4G3IA 1Z2PX 1HNZH 5IYDG 2J9GA 4JI6H 3GIMA 4A3DG 4QW9A 4RB1A 2Y0SE 3VPDA 2YZMA 1WCMA 2QYZA 3RB0A 2SCUB 4TV8F 2W9AA 2O03A 5L1IA 4A3KG 2DWCA 1JDBB 3BQ0A 4DL6A 2VQDA 1S10A 2R8GA 1VS0A 2UVVA 5KFEA 4EGJA 1BJTA 4DV7H 2R87A 3IG0A 1VKZA 4CC5A 5KFJA 4HQ6A 4UFZA 4RNNA 3MR3A 4DV4H 3PZPA 1DIKA 2NU9B 5LL6b 2FLNA 3M9MB 1IOWA 4LF6H 2FK1A 2R8HA 4ED0A 1ZQ7A 2OLSA 4EFEA 2VOBA 1FVIA 4DR6H 3N41B 2GPSA 4B3TH 4R7RA 2XIGA 1A9XA 5KFFA 3U9SA 5KKNB 3BABA 4C5BA 3GLKA 3N44B 2M05A 2VA2A 3T1HH 4I7HA 4GC6A 3RFCA 3RV3A 1XMQH 4NXNH 4ZI7F 4LH7A 2AGOA 4QWEA 4I50F 3CVZA 4A3LG 1SCUB 2HGSA 2R7MA 4ECWA 4JI5H 3H20A 1N33H 2YL2A 5BPFA 5FJ8G 2W7OA 4EEYA 2MCTA 2YS7A 2FLLA 1EYZA 5H80A 2V5AA 5C3EG 4J9MA 4YY3H 1JX4A 2R93G 4NXMH 4YBZB 4FBUA 3KXYT 2W6NA 1TWFA 5HBRB 3GV7B 3ORQA 2R82A 4DV1H 4A2AA 4RAYA 1Y1WG 1WH2A 4LFAH 5C5JA 5A2QW 4JV5H 2UXCH 4DL3A 2YW2A 4MV8A 2R92G 4BBRG 3N6XA 3RIZA 2C00A 4LMYA 5LOVF 1S9FA 2E2IA 5KFLA 2CQYA 1HNXH 5FD6A 1RYSA 1WCMG 3T5HA 3UFXB 3RUPA 4MV4A 3Q2OA 3K5HA 1PK8A 3HB9A 2UUBH 3H4DA 4JI7H 4BY7G 4MV6A 5DQHA 3LWBA 5KG5A 2XCAA 2AU0A 3J80W 4RZQA 2FPGB 4C5AA 5D8DA 5IP9G 4UCSA 4A3IG 4Q8FA 3GIDA 4O3QA 4JI3H 1XNRH 1N32H 4O4LF 4IWYA 3RB4A 4JV1A 4RUCA 4BXXG 1IBLH 2E5LH 3WNZA 3JZIA 2VUMA 4JUZA 2R8IA 3JSLA 3T5LA 1CQIB 1GSAA 1O75A 3PR5B 2DPJA 3RTXA 2XD4A 2J6SA 4YR0A 4C2MA 5EWGA 1AN7A 4DL2A 1XMOH 5DG9A 2DPIA 2IP4A 4MAMA 2VA3A 4DUZH 4J9PA 2KSWA 1I6UA 2HVQA 4EEQA 5KT6A 2ZM6H 2W8LA 3MR6A 1DV2A 5EZYF 1N36H 4PDBA 3GV5B 4X62H 5LMNH 1VBGA 4ECSA 1K83A 2WE6A 4FM9A 5KT3A 1XNQH 3MWDA 4TV9F 4RNOA 4IRKA 2DZDA 2ASLA 2FPIB 1TA8A 4MA0A 4BY1G 5KG3A 1KJ9A 4O2BF 4BWSC 2UU9H 2UVWA 4O4HF 5IYBG 1GSHA 4A3JG 1E4EB 4O3PA 2BQUA 2HVSA 4YB8B 1B33N 4Q43A 3K5IA 2FPPB 2V9WA 1FJGH 3H3VH 3KTMA 3KAKA 1SYXB 2XGPA 3MJFA 1EZ1A 4YAKB 1KJ8A 4EBDA 3HOVG 2R8JA 3OTOH 4DR2H 3I4NG 3PW5A 4A2BA 1IOVA 4IWXA 3MFIA 2UXBH 5CB4F 4O3RA 1L2ZA 5C44G 2UUAH 4U6PA 3RB6A 2Q2TA 2NVXA 1KJJA 5JQWA 4DL4A 4Q8EA 3BQ2A 4FS1A 2F4VH 4ED3A 3R5HA 2UVRA 4UCOA 1K1QA 2ZDHA 4O3OA 5KFBA 4ED1A 1E4GT 3GIPA 3VPCA 4J0MA 5KG7A 3GTJA 4ECRA 3VPBA 4EYHB 5IWAH 4LF5H 5K2MA 4J9LA 2C35B 5D1OB 3QZ7A 1EUDB 3GTKA 4HYKA 2ZDQA 4QWBA 3G6XA 2GLTA 2CZGA 5IP7G 5FLXW 2YRXA 3KHRA 4B3SH 5L1LA 2R7NA 1V4YA 1I3QA 3K3VA 2W6PA 2YS6A 5L1KA 2QK4A 3I12A 4RZRA 4F4XA 2IBKA 3LP8A 3TIIA 5EWFA 2WTFA 2R7ZA 4Q45A 3V6JA 5FPOA 1RJRA 2W6OA 5KT5A 5KG0A 4EYIB 2WDTA 1C3OA 4ED6A 3T1YH 4ZOLF 1VBHA 3JSNA 4XYLB 5D1OA 3Q8RB 2W7PA 1TWAA 3Q8SB 3HOWG 1CS0A 3TQTA 2XC9A 3Q8QB 1IBMH 2OH2A 1W93A 4Y8VB 3RF2A 5BMVF 4MTDA 5LA6F 2V4QA 4YR3A 1S97A 3GTMA 3FDSA 5JVDF 1JIHA 5KG4A 5I47A 4EG0A 2PBZA 5LXTF 2YYAA 4HNTA 3G6YA 5HV6A 3FKIA 4LSAA 4M7EA 5T14A 2R86A 1I50A 2NUAB 4E4TA 4DL5A 3E5NA 4RAZA 4DV5H 4DR1H 4F4WA 3QFFA 3RAXA 3KALA 2BR0A 4JI8H 2C28A 2JA7A 3KAJA 3V6HA 4L1KA 1Y1VG 1IBKH 4NLGA 4M9UA 2BQ3A 4LFBH 1GO3E 3V6KA 5KFAA 1CQJB 2JEGA 3JRWA 3EPIA 4A3MG 3WO0A 1S03G 4UCVA 2R8KA 5JH7F 2FK2A 3PR4A 2YZGA 3HBLA 4RB2C 4TQRA 3HXLA 2VUGA 3N8DA 1M7JA 2AGPA 2FKLA 4AQYH 2VPQA 2YCHA 5CAEB 4IRCA 3F8NA 3DF7A 4FU0A 4UCRA 2X0SA 1UC9A 3MWMA 4DL7A 5KFCA 3J7AK 4GC7A 3Q8PB 3RJ0A 4QIWA 1ZETA 3BJYA 2HVRA 5KFXA 2AGQA 1HNWH 1T36A 4U7CA 1T94A 4RUAA 2W9BB 3RAQA 1TWGA 3M4IA 3V4ZA 2CW7A 5KX5F 4ED8A 2PVPA 3LMLA 2I80A 3HOXG 2B63A 1KJIA 1B6SA 4ECUA 4QIWE 4O4IF 2CW8A 1WSCA 2HHHH 3VMMA 4F50A 3BA9A 2ASJA 4O3NA 2FMAA 2PMZA 4QWCA 4MTEA 3HOZG 5LYJF 3T5KA 2UUCH 4ED7A 4YHHH 4LF7H 3JRXA 4DR3H 3RBDA 5JUMA 3GILA 4LF9H 3I4MG 2R6FA 4O2AF 3TINA 2V58A 4MA5A 1UC8A 1K1SA 2PMZE 5D1PA 4LSXA 4HNVA 4DR7H 4ZHQF 4JI1H 4UCTA 3MR5A 5C4XG 4RNMA 4IHJF 5KT7A 4J9NA 1KEEA 2R84A 3ORRA 3WO1A 1RJPA 4ECQA 4EFBA 1EUCB 2W70A 3PW7A 2P0AA 3J81W 1SEIA 1TAEA 2IMWP 3L2PA 4A3EG 1DGSA 4IRDA 4YJ3F 1BNCA 4YR2A 4ECYA 4GKJH 1GLVA 5L1JA 5KFUA 3UQ8A 3GV8B 3SI8A 4JYAH 2Q2UA 4EGQA 5JVLA 4MV1A 4Q44A 1B04A 5CA1F 3N40P 2XCLA 3KHLA 1X9NA 1SFOA 1JKJB 1V51A 2NU7B 3GTGA 1E4EA 4LFCH 2JA6A 2V59A 4X64H 1BGWA 2W9CB 4LH6A 5DG7A 3N42B 5KFYA 3MR2A 4DUYH 5DLFA 4B3MH 1ZHSA 4IAJA 5KFVA 2VR1A 1KBLA 1AUXA 1JXLA 5KFTA 5LP6F 1S0MA 5GONF 2PN1A 5C8YF 3OUZA 4ECVA 2RGRA 1N48A 2VUMG 5DGAA 2W6MA 4DV0H 5KFGA 1I7LA 4JI2H 3KHHA 2NU8B 3G8CA 5CA0F 1JDEA 4DV2H 4ECZA 1HR0H 4DR4H 2XCPA 3NGDA 4YJ2F 5BPHA 4YAJB 4Q0YA 2UVUA 3GIIA 3RBEA 2ALZA 5L9XA 1WR2A 1R9TA 4A3BG 5KFMA 2R85A 2HJWA 3PO3G 5KT2A 2DLNA 3PW0A 1J5EH 3GQCA 2XGQA 4A93G 4K0KH 3BA8A 4BBSG 1AUVA 4F4ZA 3JAMW 3KHGA 1Y14B 3H0GA 4QWDA 2JEIA 5KFKA 4TUYF 4MV7A 2FLPA 3AYHB 5F9NA 5KG6A 1JLLB 4J9QA 1EHIA 4DV3H 4I4TF 1I94H 1Z2OX 2NVYA 3GTQA 1KJQA 3PO2G 4J9KA 2R7LA 4IZOA 2VQEH 2YRWA 4LF8H 4A3FG 3RV4A 4RB3C 3IN5A 2OWOA 3C0FB 2FJZA 2JA6G 2DIKA 2JA5A 2V4RA 5C1PA 4AYBA 3M9NB 3ETHA 1ULZA 4WBNF 5IYZF
chains in the Genus database with same CATH topology
1GYFA 1XDNA 2O03A 1FJGH 4DV6H 2CW8A 3KAKA 1VS0A 2HHHH 1SYXB 3BA9A 4X66H 1BJTA 4DV7H 3IG0A 4MTEA 3OTOH 2FE3A 4DR2H 4A2BA 4CC5A 3RGZA 4UFZA 4DV4H 2UUCH 2ZJTA 2UXBH 4YHHH 4UCUA 4DR5H 4LF7H 5LL6b 4DR3H 2UUAH 4LF4H 1L2ZA 2Q2TA 3L4JA 1M0WA 4LF6H 5BR8H 4LF9H 2F4VH 3L4KA 4EFEA 2VOBA 1FVIA 2WYOA 5D1PA 4LSXA 3N41B 4DR7H 4APMA 4UCOA 4B3TH 4UCTA 4R7RA 2XIGA 5LMUH 4JI1H 3BABA 1E4GT 4J0MA 3N44B 3T1HH 4I7HA 1E4FT 2W57A 4EFBA 1XMQH 5IWAH 4NXNH 4LH7A 5D1OB 3FMAA 4MV9A 3J81W 1SEIA 1N34H 1S68A 1TAEA 3CVZA 5FLXW 3L2PA 1DGSA 2HGSA 4JI0H 1MZBA 4JI5H 3H20A 4B3SH 1N33H 4GKJH 4RB0A 2MCTA 3K3VA 3UQ8A 4YY3H 2Q2UA 4JYAH 4NXMH 1B04A 3N40P 3KXYT 1X9NA 5EOYA 5FPOA 4LFCH 4B3RH 4X64H 2WDTA 1BGWA 4LH6A 3N42B 4DV1H 4DUYH 4A2AA 4RAYA 3T1YH 4B3MH 3JSNA 5D1OA 4DR6H 1WH2A 1ZHSA 2RGVA 4IAJA 4LFAH 5A2QW 4JV5H 2UXCH 1IBMH 3N6XA 3RIZA 3BAAA 4LMYA 3RF2A 4MTDA 2RGRA 4X65H 4DV0H 1HNXH 5FD6A 4JI2H 2VQFH 4JI4H 1Z2NX 5FD5A 4DV2H 1HR0H 4DR4H 1M0TA 5IT9W 4LSAA 4M7EA 2UUBH 4KHPH 4JI7H 4RAZA 4DV5H 4GLXA 4DR1H 3J80W 4Q0YA 4RZQA 3KALA 4ETSA 4JI8H 1FKAH 2UXDH 4UCSA 3KAJA 4JI3H 3PN1A 1A0IA 1XNRH 1N32H 1IBKH 2VPSA 1IBLH 2E5LH 3N43B 4LFBH 3JSLA 5FPRA 1ZHQA 4GKKH 1O75A 1J5EH 3RTXA 4K0KH 1P8LA 3BA8A 1S03G 4UCVA 3JAMW 1AN7A 1XMOH 4RB2C 1I6UA 4MV7A 3HXLA 2KSWA 2VUGA 2HVQA 4DUZH 4EEQA 4CC6A 2ZM6H 4DV3H 1N36H 4AQYH 1I94H 1Z2OX 4X62H 4OX9H 4PDBA 5LMNH 1V9PA 2YCHA 2WE6A 3F8NA 3RGXA 4FM9A 3DF7A 4UCRA 1XNQH 3MWMA 2VQEH 3J7AK 4LF8H 3RJ0A 4RB3C 2OWOA 2HVRA 1TA8A 3C0FB 3EYYA 4BWSC 4LF5H 1HNWH 1Z2PX 1HNZH 2UU9H 4JI6H 4RB1A 3M4IA 2CW7A 3LMLA 2HVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYX B;  1GYF A;  4BWS C;  1WH2 A;  3K3V A;  3FMA A;  1L2Z A; 
#chains in the Genus database with same CATH topology
 1GSO A;  1GYF A;  3OHB A;  1PX2 A;  5KFS A;  1C30 A;  1XDN A;  4FBT A;  4DV6 H;  3GTO A;  3GIQ A;  5EWE A;  2RDJ A;  4FS2 A;  4X66 H;  2J6T A;  3H40 A;  2W6Z A;  3H4B A;  2FE3 A;  4AYB E;  3RGZ A;  3MWE A;  4TQS A;  2CKZ B;  2ZJT A;  3OSN A;  5KFP A;  4DR5 H;  4UCU A;  4O3S A;  4LF4 H;  3R5F A;  1OWT A;  3CQZ A;  3R23 A;  4XZ3 B;  3EPG A;  2YZN A;  1M0W A;  5DLG A;  5BR8 H;  3L4J A;  3OUU A;  3L4K A;  3BG5 A;  4I55 F;  2I87 A;  2C22 A;  4A3G G;  2WYO A;  2R7Z G;  4IR9 A;  4APM A;  4WD3 A;  5LMU H;  1VAJ A;  2I8C A;  4EBC A;  1E4F T;  3GTP A;  2W57 A;  5KFD A;  3HKZ A;  5KFQ A;  2WB1 A;  4DLK A;  4HR7 A;  2RDI A;  1RJQ A;  3FMA A;  4MV9 A;  1S68 A;  5KFW A;  1N34 H;  4JV2 A;  4XYM B;  4ME6 A;  3PW2 A;  4JI0 H;  1MZB A;  3GIK A;  2JEF A;  4R8U B;  3H0G G;  3TQ1 A;  4RB0 A;  5KFI A;  3HOU G;  1S0O A;  3R5X A;  5KFH A;  4PWQ A;  3GTL A;  2WAQ A;  3HKZ E;  2W9B A;  5EOY A;  2WB1 E;  4ZQI A;  4RU9 A;  3FKI G;  4B3R H;  2R7K A;  3OHA A;  3K3P A;  1TWC A;  2RGV A;  1W96 A;  4MV3 A;  5DQI A;  4JV0 A;  2ASD A;  2JA7 G;  5KT4 A;  3GIJ A;  5DG8 A;  4R8U A;  3BAA A;  4F4Y A;  2JA5 G;  2WAQ E;  4J9R A;  2FK3 A;  1GGO A;  4J9O A;  1KC7 A;  4X65 H;  4YQW A;  5FLM G;  4J9S A;  1TWH A;  2FB9 A;  3V4S A;  2W71 A;  2VQF H;  4JI4 H;  1Z2N X;  5KFR A;  3G6V A;  5FD5 A;  1M6V A;  1N56 A;  1S0N A;  3Q1K A;  1M0T A;  3RB3 A;  5IT9 W;  4QWA A;  1RK6 A;  2GPW A;  4KHP H;  1RK5 A;  4GLX A;  5DGB A;  2JEJ A;  4QW8 A;  2FP4 B;  2W6Q A;  2UXD H;  4ETS A;  4ECX A;  3T5J A;  1FKA H;  1CE8 A;  3OSP A;  3PN1 A;  1A0I A;  3BQ1 A;  2VPS A;  5J2U F;  3MFH A;  4C5C A;  5KFO A;  3N43 B;  1B6R A;  5KFZ A;  4YP3 A;  2AQ4 A;  5FPR A;  3M9O B;  1ZHQ A;  5KFN A;  2BQR A;  3PW4 A;  4GKK H;  1RYR A;  2W8K A;  3U9T A;  1I7N A;  1P8L A;  4ECT A;  5IYC G;  2C2R A;  2NU6 B;  3TIG A;  5F9L A;  3ETJ A;  3SE7 A;  1UNN C;  2J6U A;  2E2H A;  5KG2 A;  1T3N A;  2ATL A;  4CC6 A;  2R93 A;  4XX0 B;  2C2E A;  5C1O A;  2B63 G;  2W9C A;  4OX9 H;  1Y1V A;  2Y0S A;  5EDW A;  2IA6 A;  1V9P A;  5J2T F;  1DV1 A;  3RGX A;  3QZ8 A;  3HOY G;  4IR1 A;  1Y1W A;  2RF4 A;  4HNU A;  4ED2 A;  4EBE A;  2YU9 A;  3PVX A;  2R92 A;  4A3C G;  1BXR A;  2ZDG A;  4QJF A;  5DQG A;  3EYY A;  5KG1 A;  2C2D A;  2JA8 G;  4G3I A;  1Z2P X;  1HNZ H;  5IYD G;  2J9G A;  4JI6 H;  3GIM A;  4A3D G;  4QW9 A;  4RB1 A;  2Y0S E;  3VPD A;  2YZM A;  1WCM A;  2QYZ A;  3RB0 A;  2SCU B;  4TV8 F;  2W9A A;  2O03 A;  5L1I A;  4A3K G;  2DWC A;  1JDB B;  3BQ0 A;  4DL6 A;  2VQD A;  1S10 A;  2R8G A;  1VS0 A;  2UVV A;  5KFE A;  4EGJ A;  1BJT A;  4DV7 H;  2R87 A;  3IG0 A;  1VKZ A;  4CC5 A;  5KFJ A;  4HQ6 A;  4UFZ A;  4RNN A;  3MR3 A;  4DV4 H;  3PZP A;  1DIK A;  2NU9 B;  5LL6 b;  2FLN A;  3M9M B;  1IOW A;  4LF6 H;  2FK1 A;  2R8H A;  4ED0 A;  1ZQ7 A;  2OLS A;  4EFE A;  2VOB A;  1FVI A;  4DR6 H;  3N41 B;  2GPS A;  4B3T H;  4R7R A;  2XIG A;  1A9X A;  5KFF A;  3U9S A;  5KKN B;  3BAB A;  4C5B A;  3GLK A;  3N44 B;  2M05 A;  2VA2 A;  3T1H H;  4I7H A;  4GC6 A;  3RFC A;  3RV3 A;  1XMQ H;  4NXN H;  4ZI7 F;  4LH7 A;  2AGO A;  4QWE A;  4I50 F;  3CVZ A;  4A3L G;  1SCU B;  2HGS A;  2R7M A;  4ECW A;  4JI5 H;  3H20 A;  1N33 H;  2YL2 A;  5BPF A;  5FJ8 G;  2W7O A;  4EEY A;  2MCT A;  2YS7 A;  2FLL A;  1EYZ A;  5H80 A;  2V5A A;  5C3E G;  4J9M A;  4YY3 H;  1JX4 A;  2R93 G;  4NXM H;  4YBZ B;  4FBU A;  3KXY T;  2W6N A;  1TWF A;  5HBR B;  3GV7 B;  3ORQ A;  2R82 A;  4DV1 H;  4A2A A;  4RAY A;  1Y1W G;  1WH2 A;  4LFA H;  5C5J A;  5A2Q W;  4JV5 H;  2UXC H;  4DL3 A;  2YW2 A;  4MV8 A;  2R92 G;  4BBR G;  3N6X A;  3RIZ A;  2C00 A;  4LMY A;  5LOV F;  1S9F A;  2E2I A;  5KFL A;  2CQY A;  1HNX H;  5FD6 A;  1RYS A;  1WCM G;  3T5H A;  3UFX B;  3RUP A;  4MV4 A;  3Q2O A;  3K5H A;  1PK8 A;  3HB9 A;  2UUB H;  3H4D A;  4JI7 H;  4BY7 G;  4MV6 A;  5DQH A;  3LWB A;  5KG5 A;  2XCA A;  2AU0 A;  3J80 W;  4RZQ A;  2FPG B;  4C5A A;  5D8D A;  5IP9 G;  4UCS A;  4A3I G;  4Q8F A;  3GID A;  4O3Q A;  4JI3 H;  1XNR H;  1N32 H;  4O4L F;  4IWY A;  3RB4 A;  4JV1 A;  4RUC A;  4BXX G;  1IBL H;  2E5L H;  3WNZ A;  3JZI A;  2VUM A;  4JUZ A;  2R8I A;  3JSL A;  3T5L A;  1CQI B;  1GSA A;  1O75 A;  3PR5 B;  2DPJ A;  3RTX A;  2XD4 A;  2J6S A;  4YR0 A;  4C2M A;  5EWG A;  1AN7 A;  4DL2 A;  1XMO H;  5DG9 A;  2DPI A;  2IP4 A;  4MAM A;  2VA3 A;  4DUZ H;  4J9P A;  2KSW A;  1I6U A;  2HVQ A;  4EEQ A;  5KT6 A;  2ZM6 H;  2W8L A;  3MR6 A;  1DV2 A;  5EZY F;  1N36 H;  4PDB A;  3GV5 B;  4X62 H;  5LMN H;  1VBG A;  4ECS A;  1K83 A;  2WE6 A;  4FM9 A;  5KT3 A;  1XNQ H;  3MWD A;  4TV9 F;  4RNO A;  4IRK A;  2DZD A;  2ASL A;  2FPI B;  1TA8 A;  4MA0 A;  4BY1 G;  5KG3 A;  1KJ9 A;  4O2B F;  4BWS C;  2UU9 H;  2UVW A;  4O4H F;  5IYB G;  1GSH A;  4A3J G;  1E4E B;  4O3P A;  2BQU A;  2HVS A;  4YB8 B;  1B33 N;  4Q43 A;  3K5I A;  2FPP B;  2V9W A;  1FJG H;  3H3V H;  3KTM A;  3KAK A;  1SYX B;  2XGP A;  3MJF A;  1EZ1 A;  4YAK B;  1KJ8 A;  4EBD A;  3HOV G;  2R8J A;  3OTO H;  4DR2 H;  3I4N G;  3PW5 A;  4A2B A;  1IOV A;  4IWX A;  3MFI A;  2UXB H;  5CB4 F;  4O3R A;  1L2Z A;  5C44 G;  2UUA H;  4U6P A;  3RB6 A;  2Q2T A;  2NVX A;  1KJJ A;  5JQW A;  4DL4 A;  4Q8E A;  3BQ2 A;  4FS1 A;  2F4V H;  4ED3 A;  3R5H A;  2UVR A;  4UCO A;  1K1Q A;  2ZDH A;  4O3O A;  5KFB A;  4ED1 A;  1E4G T;  3GIP A;  3VPC A;  4J0M A;  5KG7 A;  3GTJ A;  4ECR A;  3VPB A;  4EYH B;  5IWA H;  4LF5 H;  5K2M A;  4J9L A;  2C35 B;  5D1O B;  3QZ7 A;  1EUD B;  3GTK A;  4HYK A;  2ZDQ A;  4QWB A;  3G6X A;  2GLT A;  2CZG A;  5IP7 G;  5FLX W;  2YRX A;  3KHR A;  4B3S H;  5L1L A;  2R7N A;  1V4Y A;  1I3Q A;  3K3V A;  2W6P A;  2YS6 A;  5L1K A;  2QK4 A;  3I12 A;  4RZR A;  4F4X A;  2IBK A;  3LP8 A;  3TII A;  5EWF A;  2WTF A;  2R7Z A;  4Q45 A;  3V6J A;  5FPO A;  1RJR A;  2W6O A;  5KT5 A;  5KG0 A;  4EYI B;  2WDT A;  1C3O A;  4ED6 A;  3T1Y H;  4ZOL F;  1VBH A;  3JSN A;  4XYL B;  5D1O A;  3Q8R B;  2W7P A;  1TWA A;  3Q8S B;  3HOW G;  1CS0 A;  3TQT A;  2XC9 A;  3Q8Q B;  1IBM H;  2OH2 A;  1W93 A;  4Y8V B;  3RF2 A;  5BMV F;  4MTD A;  5LA6 F;  2V4Q A;  4YR3 A;  1S97 A;  3GTM A;  3FDS A;  5JVD F;  1JIH A;  5KG4 A;  5I47 A;  4EG0 A;  2PBZ A;  5LXT F;  2YYA A;  4HNT A;  3G6Y A;  5HV6 A;  3FKI A;  4LSA A;  4M7E A;  5T14 A;  2R86 A;  1I50 A;  2NUA B;  4E4T A;  4DL5 A;  3E5N A;  4RAZ A;  4DV5 H;  4DR1 H;  4F4W A;  3QFF A;  3RAX A;  3KAL A;  2BR0 A;  4JI8 H;  2C28 A;  2JA7 A;  3KAJ A;  3V6H A;  4L1K A;  1Y1V G;  1IBK H;  4NLG A;  4M9U A;  2BQ3 A;  4LFB H;  1GO3 E;  3V6K A;  5KFA A;  1CQJ B;  2JEG A;  3JRW A;  3EPI A;  4A3M G;  3WO0 A;  1S03 G;  4UCV A;  2R8K A;  5JH7 F;  2FK2 A;  3PR4 A;  2YZG A;  3HBL A;  4RB2 C;  4TQR A;  3HXL A;  2VUG A;  3N8D A;  1M7J A;  2AGP A;  2FKL A;  4AQY H;  2VPQ A;  2YCH A;  5CAE B;  4IRC A;  3F8N A;  3DF7 A;  4FU0 A;  4UCR A;  2X0S A;  1UC9 A;  3MWM A;  4DL7 A;  5KFC A;  3J7A K;  4GC7 A;  3Q8P B;  3RJ0 A;  4QIW A;  1ZET A;  3BJY A;  2HVR A;  5KFX A;  2AGQ A;  1HNW H;  1T36 A;  4U7C A;  1T94 A;  4RUA A;  2W9B B;  3RAQ A;  1TWG A;  3M4I A;  3V4Z A;  2CW7 A;  5KX5 F;  4ED8 A;  2PVP A;  3LML A;  2I80 A;  3HOX G;  2B63 A;  1KJI A;  1B6S A;  4ECU A;  4QIW E;  4O4I F;  2CW8 A;  1WSC A;  2HHH H;  3VMM A;  4F50 A;  3BA9 A;  2ASJ A;  4O3N A;  2FMA A;  2PMZ A;  4QWC A;  4MTE A;  3HOZ G;  5LYJ F;  3T5K A;  2UUC H;  4ED7 A;  4YHH H;  4LF7 H;  3JRX A;  4DR3 H;  3RBD A;  5JUM A;  3GIL A;  4LF9 H;  3I4M G;  2R6F A;  4O2A F;  3TIN A;  2V58 A;  4MA5 A;  1UC8 A;  1K1S A;  2PMZ E;  5D1P A;  4LSX A;  4HNV A;  4DR7 H;  4ZHQ F;  4JI1 H;  4UCT A;  3MR5 A;  5C4X G;  4RNM A;  4IHJ F;  5KT7 A;  4J9N A;  1KEE A;  2R84 A;  3ORR A;  3WO1 A;  1RJP A;  4ECQ A;  4EFB A;  1EUC B;  2W70 A;  3PW7 A;  2P0A A;  3J81 W;  1SEI A;  1TAE A;  2IMW P;  3L2P A;  4A3E G;  1DGS A;  4IRD A;  4YJ3 F;  1BNC A;  4YR2 A;  4ECY A;  4GKJ H;  1GLV A;  5L1J A;  5KFU A;  3UQ8 A;  3GV8 B;  3SI8 A;  4JYA H;  2Q2U A;  4EGQ A;  5JVL A;  4MV1 A;  4Q44 A;  1B04 A;  5CA1 F;  3N40 P;  2XCL A;  3KHL A;  1X9N A;  1SFO A;  1JKJ B;  1V51 A;  2NU7 B;  3GTG A;  1E4E A;  4LFC H;  2JA6 A;  2V59 A;  4X64 H;  1BGW A;  2W9C B;  4LH6 A;  5DG7 A;  3N42 B;  5KFY A;  3MR2 A;  4DUY H;  5DLF A;  4B3M H;  1ZHS A;  4IAJ A;  5KFV A;  2VR1 A;  1KBL A;  1AUX A;  1JXL A;  5KFT A;  5LP6 F;  1S0M A;  5GON F;  2PN1 A;  5C8Y F;  3OUZ A;  4ECV A;  2RGR A;  1N48 A;  2VUM G;  5DGA A;  2W6M A;  4DV0 H;  5KFG A;  1I7L A;  4JI2 H;  3KHH A;  2NU8 B;  3G8C A;  5CA0 F;  1JDE A;  4DV2 H;  4ECZ A;  1HR0 H;  4DR4 H;  2XCP A;  3NGD A;  4YJ2 F;  5BPH A;  4YAJ B;  4Q0Y A;  2UVU A;  3GII A;  3RBE A;  2ALZ A;  5L9X A;  1WR2 A;  1R9T A;  4A3B G;  5KFM A;  2R85 A;  2HJW A;  3PO3 G;  5KT2 A;  2DLN A;  3PW0 A;  1J5E H;  3GQC A;  2XGQ A;  4A93 G;  4K0K H;  3BA8 A;  4BBS G;  1AUV A;  4F4Z A;  3JAM W;  3KHG A;  1Y14 B;  3H0G A;  4QWD A;  2JEI A;  5KFK A;  4TUY F;  4MV7 A;  2FLP A;  3AYH B;  5F9N A;  5KG6 A;  1JLL B;  4J9Q A;  1EHI A;  4DV3 H;  4I4T F;  1I94 H;  1Z2O X;  2NVY A;  3GTQ A;  1KJQ A;  3PO2 G;  4J9K A;  2R7L A;  4IZO A;  2VQE H;  2YRW A;  4LF8 H;  4A3F G;  3RV4 A;  4RB3 C;  3IN5 A;  2OWO A;  3C0F B;  2FJZ A;  2JA6 G;  2DIK A;  2JA5 A;  2V4R A;  5C1P A;  4AYB A;  3M9N B;  3ETH A;  1ULZ A;  4WBN F;  5IYZ F; 
#chains in the Genus database with same CATH homology
 1GYF A;  1XDN A;  2O03 A;  1FJG H;  4DV6 H;  2CW8 A;  3KAK A;  1VS0 A;  2HHH H;  1SYX B;  3BA9 A;  4X66 H;  1BJT A;  4DV7 H;  3IG0 A;  4MTE A;  3OTO H;  2FE3 A;  4DR2 H;  4A2B A;  4CC5 A;  3RGZ A;  4UFZ A;  4DV4 H;  2UUC H;  2ZJT A;  2UXB H;  4YHH H;  4UCU A;  4DR5 H;  4LF7 H;  5LL6 b;  4DR3 H;  2UUA H;  4LF4 H;  1L2Z A;  2Q2T A;  3L4J A;  1M0W A;  4LF6 H;  5BR8 H;  4LF9 H;  2F4V H;  3L4K A;  4EFE A;  2VOB A;  1FVI A;  2WYO A;  5D1P A;  4LSX A;  3N41 B;  4DR7 H;  4APM A;  4UCO A;  4B3T H;  4UCT A;  4R7R A;  2XIG A;  5LMU H;  4JI1 H;  3BAB A;  1E4G T;  4J0M A;  3N44 B;  3T1H H;  4I7H A;  1E4F T;  2W57 A;  4EFB A;  1XMQ H;  5IWA H;  4NXN H;  4LH7 A;  5D1O B;  3FMA A;  4MV9 A;  3J81 W;  1SEI A;  1N34 H;  1S68 A;  1TAE A;  3CVZ A;  5FLX W;  3L2P A;  1DGS A;  2HGS A;  4JI0 H;  1MZB A;  4JI5 H;  3H20 A;  4B3S H;  1N33 H;  4GKJ H;  4RB0 A;  2MCT A;  3K3V A;  3UQ8 A;  4YY3 H;  2Q2U A;  4JYA H;  4NXM H;  1B04 A;  3N40 P;  3KXY T;  1X9N A;  5EOY A;  5FPO A;  4LFC H;  4B3R H;  4X64 H;  2WDT A;  1BGW A;  4LH6 A;  3N42 B;  4DV1 H;  4DUY H;  4A2A A;  4RAY A;  3T1Y H;  4B3M H;  3JSN A;  5D1O A;  4DR6 H;  1WH2 A;  1ZHS A;  2RGV A;  4IAJ A;  4LFA H;  5A2Q W;  4JV5 H;  2UXC H;  1IBM H;  3N6X A;  3RIZ A;  3BAA A;  4LMY A;  3RF2 A;  4MTD A;  2RGR A;  4X65 H;  4DV0 H;  1HNX H;  5FD6 A;  4JI2 H;  2VQF H;  4JI4 H;  1Z2N X;  5FD5 A;  4DV2 H;  1HR0 H;  4DR4 H;  1M0T A;  5IT9 W;  4LSA A;  4M7E A;  2UUB H;  4KHP H;  4JI7 H;  4RAZ A;  4DV5 H;  4GLX A;  4DR1 H;  3J80 W;  4Q0Y A;  4RZQ A;  3KAL A;  4ETS A;  4JI8 H;  1FKA H;  2UXD H;  4UCS A;  3KAJ A;  4JI3 H;  3PN1 A;  1A0I A;  1XNR H;  1N32 H;  1IBK H;  2VPS A;  1IBL H;  2E5L H;  3N43 B;  4LFB H;  3JSL A;  5FPR A;  1ZHQ A;  4GKK H;  1O75 A;  1J5E H;  3RTX A;  4K0K H;  1P8L A;  3BA8 A;  1S03 G;  4UCV A;  3JAM W;  1AN7 A;  1XMO H;  4RB2 C;  1I6U A;  4MV7 A;  3HXL A;  2KSW A;  2VUG A;  2HVQ A;  4DUZ H;  4EEQ A;  4CC6 A;  2ZM6 H;  4DV3 H;  1N36 H;  4AQY H;  1I94 H;  1Z2O X;  4X62 H;  4OX9 H;  4PDB A;  5LMN H;  1V9P A;  2YCH A;  2WE6 A;  3F8N A;  3RGX A;  4FM9 A;  3DF7 A;  4UCR A;  1XNQ H;  3MWM A;  2VQE H;  3J7A K;  4LF8 H;  3RJ0 A;  4RB3 C;  2OWO A;  2HVR A;  1TA8 A;  3C0F B;  3EYY A;  4BWS C;  4LF5 H;  1HNW H;  1Z2P X;  1HNZ H;  2UU9 H;  4JI6 H;  4RB1 A;  3M4I A;  2CW7 A;  3LML A;  2HVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...