4A3EG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 31
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3eG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3eG01
1I94Q 2LSSA 4PMWA 4LFCL 4X6AH 4BY1G 1NJIC 3U4VA 3HKZE 1PHJA 2E2JH 1TWFH 4OO1G 4JV5L 1HNXQ 1AH9A 4GS3A 4QL5A 4JI8L 4JYAQ 2Y0SE 2K5HA 3PCOB 5IYDG 3T1YQ 3G48A 4NXNL 4LF8L 4GN5A 2PMZE 4PZ7A 4DR3L 1TWAH 3S17H 4A93G 3T1YL 3ER0A 2LXKA 2ZTDA 5M5YH 1KAWA 1QVFA 3GTJH 1OXUA 1P16A 2NZOA 1M90C 3M4QA 1VCIA 5HY6A 1Z47A 1YJ9A 1HZ9A 3HOYH 1UEBA 3S2HH 1L1OB 2KCMA 1LUZA 4RMFA 1D7QA 1VQLA 1QUQB 2UXBQ 3AYHB 4JI3L 1Q12A 3KYHC 3TS0A 1PH9A 2MNAA 1EIFA 4B3TL 4KHPQ 4X65Q 1VQHA 1OXXK 1MJCA 2D62A 3CMEA 2AHOB 3RN2A 1TWHH 3J81j 3PSIA 4BA2I 4DR6Q 1A8VA 2Z0SA 4A3IH 4OX9Q 2UUCQ 4BY7G 4IFDG 3CAMA 3FKIG 4C3JH 4IO9A 2ZJQA 1NMFA 1PYBA 4R1JA 3GTQH 1SRUA 1IL2A 5C44G 2PNHA 5AJ3L 2CQOA 4IPCA 3CCJA 3GTGH 5FLMG 1ASZA 2WFWA 4YWMA 3J81c 1WI5A 3RLNA 4JI6L 1QVGA 3F8TA 4LW1A 3EBEA 1KRTA 1IBLQ 4C3HH 5C0XG 3KJOA 2XTIA 2BA0A 2JQOA 1EUJA 4DUZL 2UUCL 2OWOA 3S1QH 2HHHL 1K8GA 4JI2L 1KL9A 4X64Q 1N33Q 5LMNW 3F2CA 4GKJL 1VQPA 3I7FA 2PI2E 2IY5B 4YHHQ 3GTPH 3F1ZA 1X3FA 1VS0A 1BVSA 2Q2UA 5C3EG 3K81C 3CCUA 1N32L 1SROA 3HOVG 2UXDQ 2VZAA 1N36Q 4JYAL 1IBKL 2YU9H 3JAMc 4OO1I 3KDFA 5JEAJ 4UY8C 1VQ9A 3NELA 2K75A 1TXYA 4X64L 2V1CC 4HIKA 2R7ZH 1B7YB 1VQGA 4YCUA 5HGQA 3KFUA 1N33L 2DUDA 3AEVA 1HNZQ 2F4VQ 4YHHL 2AWNA 4GKJQ 3U58A 1VQFA 2UXCQ 5J3BA 5FJ8H 3AFPA 1NTGA 4A3EG 1VQ4A 1KIXA 4JI0Q 4LFAL 4QGUA 1XPUA 1LTLA 1PH2A 2WB1E 5GAHC 2IHFA 4DV3L 1IXRA 4A93H 1Y1WH 2LXJA 3J80i 3W5OA 4GNXA 4P71A 4OX9L 2I5LX 1E22A 1X9NA 3I56A 1VQ8A 4LF4L 1K3RA 4MZ9A 4BY1H 1HR0Q 2HQLA 2FXQA 5M3FH 4HJ5A 3PIOA 1L0WA 1LM0A 1HR0L 4R4CA 4R4IA 4JI1L 4A3KH 2ZJRA 4JI0L 5DLQE 1RIPA 4A3GG 2VS1A 2ZTEA 1GM5A 2UUBL 4YY3Q 1FGUA 1VQKA 4JOIC 1L1OC 4GLAC 4BBRH 4L5RC 4HIMA 4KLKA 3TREA 1XPRA 4B3RQ 5ELOA 5IYCG 3JC66 3E0EA 4PZ8A 3S1MH 1G291 4BBRG 1G51A 4HJ7A 1N32Q 3HOUH 2RHQB 4DUYL 1N36L 3G4SA 1EYGA 3S24A 4K0KL 2QGQA 4IPHA 4P72A 4JV5Q 2Q2IA 2ZM6L 3PF4A 4JI7L 1R9TH 4TQUS 4A3IG 3GTOH 2NN6G 2ATWA 3H0GG 4ME3A 4AYBE 1E1OA 2ID0A 3UE1A 4GOPA 3J7ZC 2UUAL 3HOXG 2HHHQ 1PYSB 1X54A 3RN5A 2JA7H 3NEMA 2MQHA 1EIYB 2VQEL 3SGIA 2I5MX 4Y7NH 2CCZA 1MKHA 5GAGC 1FJGL 1XTDA 3HOXH 4LFCQ 4IFDI 3HKSA 4A3BG 2KHJA 3HOZG 5C4XG 3VDYA 1HZBA 3I4MH 1GKHA 2RF4A 3CP0A 4A3GH 2KHIA 5LMNL 3STBC 3CCEA 1VQNA 2R93H 1HZCA 3HOZH 1ASYA 4LF7Q 2HT1A 5JJLA 4A3JH 2JA8G 2WAQE 3KLWA 1YHAA 2NVQH 3ULPA 3GDEA 3PGZA 1TWCH 1U0LA 4DPGA 1VQAA 2JEAI 5EAYA 3T1HL 3S16H 2JA8H 3W1GA 2B63G 5C0XI 4GOPC 3S15H 3CMAA 1A0IA 3BZKA 1SLJA 1PH5A 4P73A 1VQEA 1N34Q 1E7ZA 4X65L 4LF4Q 1VQ5A 1Y1VH 5JEAG 3I55A 4YCVA 3GTLH 2YYZA 4DR6L 1JT8A 4OWXB 1YBYA 2DGYA 3H15A 5GQOA 1XMOQ 2ZTCA 4LUZA 4X62Q 5E7NA 5GROA 2QEXA 4LF7L 1UE7A 2R7ZG 3L2PA 1HNZL 1JJGA 1YITA 1Q1BA 4JOIA 1FL0A 3K7AH 4UP9A 4GNXC 1XMQQ 4DV2Q 1PH4A 4MTNA 1IZ6A 4RG1A 1SMXA 1FVIA 1X3GA 3CCMA 3L0OA 3PUWA 3IRBA 3S1RH 2Z6KC 4A3FH 4DUYQ 5FLXc 1MJEA 2QA4A 1JJ2A 1LYLA 4APVA 1T9HA 1S72A 1EQQA 4AIMA 2JA5G 1A63A 4JI7Q 5JJIA 3D0FA 1I5FA 1NY4A 4L5QA 3HOVH 4JBWA 3HKZG 4LWCA 3GTMH 1HH2P 3PF5A 1YEZA 1V1QA 3UDIA 1XJVA 4QQBX 1YNXA 3AFQA 2UUBQ 3E9HA 3RZOH 4BY7H 3CF5A 4DV5L 2VY3A 4DAYB 5IP9G 4HJ8A 5LMUQ 1B70B 2L15A 4DR4L 4B3RL 1QUQA 3RLFA 2OQ0A 4WJ3M 1BKBA 2UU9Q 1Y14B 4X66Q 4DV3Q 2IX0A 3EN2A 4QJFA 1H95A 3F2BA 1HR0W 1EWIA 4DR2Q 2CKZB 3M9BA 3A5ZB 1CSQA 4PZ6A 3FHWA 2R92G 3PUZA 1TWGH 3S1NH 2N3SA 3T1HQ 4YCWA 5M3FG 4DV6L 1VQOA 1PH3A 1PH8A 4POGA 3KJPA 1OXSC 1L1OA 4LF5Q 2R92H 4OWWB 2K5NA 1VQIA 1SFOH 3CC4A 4XIGS 3PO2H 1UE1A 1Q82C 4LFBQ 4R4OA 1HNWL 4JC0A 4B3TQ 3KF8B 4A3BH 1KRSA 4KHPL 3EIVA 1IBKQ 2OTJA 3DLLA 3FP9A 4EQ5A 5IP7G 1YHQA 4DR7Q 1X6OA 4GLXA 3CW2C 1X55A 2MO1A 4LF8Q 1U5KA 4LF9L 4LNQA 4JI8Q 1AE3A 4DR3Q 3TEHB 1CKMA 4A3JG 4GLVB 3K0XA 5IP7H 3K8AA 4L5SA 1Q81C 2Q2HA 5IY0A 3U50C 4HIOA 1GVPA 3I4NG 1YZ6A 2GN5A 2B63H 2VNUD 2VUMG 4IOAA 1IYJB 4DV2L 1EQRA 3HFZB 4A3EH 3MXNB 2OCEA 1BBUA 1X56A 1N8RC 5IYBH 3LGJA 1S3OA 2JA7G 4A3CG 4DUZQ 1P8LA 3J7A5 2CFMA 4X62L 2AKWB 1J6QA 4A3FG 4DR2L 4JI4L 2BA1A 2PI2A 3DM3A 1HZAA 2K5VA 2Z6KA 4JI5Q 3UE0A 3NBHB 3I4MG 1M1KC 2E8GA 3OTOL 5M5WH 3PUYA 4GN3B 4ALPA 4JI5L 4JBKA 4LF6Q 3RZDH 4HJAA 4C2MH 4TVAB 3KOJA 3OTOQ 1O7IA 4LFAQ 5AJ3Q 4Y52H 4PG3A 2A8VA 1XPOA 3PO3G 2I5HA 2UXCL 4JBJA 2GVBA 2E2HH 1QVCA 2WP8J 1BBWA 2F52A 4UP8A 2K50A 2UXBL 3MEFA 2JK8A 4FDBA 1Q1EA 4YWLA 1XNQQ 5H1SE 2YTXA 3UDGA 1YJNA 4C3IH 4JBMA 2N49A 1YVCA 1AE2A 2RHSB 3H3VH 1SE8A 1YI2A 4R4TA 5BR8L 1WOCA 1KD1C 3BZCA 4IJHA 4BA1I 2JE6I 2E5LQ 1RL2A 5BR8Q 3UDFA 4JG2A 4NB3A 2I0QA 1I6HH 2UXDL 4DR7L 1Q86C 1I94L 4A3LG 4BXXG 1K9MC 5C0XJ 3CC7A 2VQFL 4YWKA 4LF9Q 4UP7A 2IX1A 3ICEA 1XNQL 2VL6A 1UE6A 4OWTB 4A4IA 4A3CH 2JA5H 2OTLA 3CC2A 1E24A 2GVAA 4DV4L 2OQKA 3A0JA 1Q7YC 3K7UC 1K8AC 4EX5A 2ALYB 3KDFB 1S40A 3STBD 5GADC 5IT9c 3J81i 3HOYG 4GKKL 4L5TA 1WCMH 2HIXA 3GTKH 1C0AA 4DV0L 1QZGA 1N9WA 1CSPA 4IPGA 3PO2G 1N34L 1IBLL 2CWPA 5IWAL 1EOVA 4IOCA 3PO3H 4WJ4A 2K4KA 1VQBA 4DR5L 4DV1L 4X66L 1YHBA 5IWAQ 2WB1G 4GOPB 1X65A 4DV1Q 1HJPA 4KI0A 2IHEA 1Q8KA 5IYBG 2NZHA 1WJJA 2A19A 2AMCB 3CCRA 3M4PA 5C44H 1JB7A 4A3DG 3UDXA 3H0GH 2RCNA 5FJ8G 2KENA 1JMCA 4DR4Q 3L7ZC 1I3QH 2B29A 2JJQA 2YTVA 1DGSA 2R7FA 1C9OA 4A3DH 3I4OA 1E3PA 1JE5A 2F3IA 3PV0A 3H3VI 1EFWA 4KHZA 3JAMi 1SN8A 4DNIA 4B3MQ 1E1TA 1GO3E 4IFDJ 1KHIA 3M85A 2BH8A 3KF6B 2VQFQ 1V9PA 2B3GA 2BH2A 1J5EQ 4H02A 2EIFA 4K0KQ 4NXNQ 1PH1A 1K73C 2ZM6Q 4A3KG 3CPFA 4P75A 2R6GA 2UUAQ 3PUXA 2C35B 1K83H 3M7NA 1KC8C 5M5XH 4OONA 1XMQL 2E5LL 5C4JH 1G6PA 3BJUA 1QZHA 1VQ7A 4LFBL 3F2DA 2D0OA 3J80c 4YY3L 1HNWQ 3D31A 1K0RA 5IP9H 4J15A 4BXXH 3I2ZA 2ASBA 2XGTA 3ULJA 1VQ6A 3I4NH 1OXTA 2K14A 4LF5L 4JI2Q 4A3MH 2JA6G 4LUVA 2VUMH 1L2FA 4GNXB 1VQMA 2A1AA 1PH6A 1CKNB 1PFSA 2EXDA 4DV7L 4NXML 1CKOA 4JI1Q 1Z9FA 1I50H 4QIWE 2N8NA 2N78A 4DR1L 1JJCB 1MIUA 1VQDA 3TQYA 1W2BA 3M4OH 5FLMH 3AQQA 4B3SL 1PV4A 3TS2A 4DV6Q 1NMGA 3GO5A 3W1BA 3OW2A 2WAQG 2VW9A 4B3SQ 1IBMQ 1NBWA 4IJLA 3CQZH 1Y1WG 4DV5Q 4DR5Q 3RNUA 3S2DH 4BBSG 3OYYA 5C4XH 5LMUL 4POFA 3U4ZA 4A76A 1OXVA 5ELNA 3K80C 4DV0Q 4JI3Q 4R4QA 4LUOA 1VQJA 3ERSX 2F4VL 4DV7Q 4NXMQ 2EQSA 4JCVE 2HIVA 4AH6A 4DV4Q 4DR1Q 1C7YA 4QY7A 1WFQA 1A62A 1X3EA 1CKNA 3RR5A 5M3MG 3HOWH 5GAEC 4A75A 1YJWA 4AYBG 3B6YA 1PVOA 4A3MG 2JA6H 2CWAA 2KBNA 2MFIA 1GD7A 1D8LA 1B8AA 2JA9A 3G6EA 2H5XA 2KCTA 4AQYQ 3S14H 5M3MH 3HOWG 1FJGQ 2PQAA 3HOUG 2NN6I 2ZJPA 2ES2A 1OTCA 1UE5A 4AQYL 1UWVA 1J5EL 1W3SA 4O2DA 2IT1A 2Y0SG 1HNXL 2PQAB 4B3ML 1WYDA 4DK6C 4IPDA 3CD6A 4A3LH 2NVTH 4P74A 4NPSA 1KQSA 4BBSH 3TRZA 1VQCA 3KF6A 4OXPA 3CCVA 4MNOA 5JJKA 3CCQA 3CCSA 2NVXH 3ZJYC 3BU2A 1PA6A 2E2IH 4JI6Q 3M3YH 1IBML 3WWVA 3CCLA 5IYDH 1Q46A 2Q2TA 4DAMA 3E9IA 1NE3A 1XMOL 2UU9L 1CUKA 1WCMG 4UPAA 3PUVA 2R93G 3CXCA 1KXLA 1YIJA 4GN4B 1XNRQ 3RLOA 3Q8DA 4DK3C 3PIPA 3G71A 3A74A 2YTYA 4XTCS 2NVYH 2YV5A 3FKIH 3CPWA 1XNRL 3GD7A 5K36G 5C3EH 4JI4Q 2JEBI 2AWOA 1PH7A 1SR3A 4GKKQ 2R7DA 5IE8A 4DKAC 4HIDA 5IYCH 4HJ9A 4LF6L 2D0PA 4O0AA 3A5UA 2MO0A 3ULLA 5LMNQ 2K52A 3NENA 1Y1VG 1V43A 2VQEQ
chains in the Genus database with same CATH superfamily
5IT9E 4PMWA 1WTVA 2DJFC 4BY1G 1HHVA 3HKZE 1AH9A 1HNXQ 4UFZA 1SCUB 4YR2A 5EGTA 4JYAQ 1K28A 2K5HA 1EEFD 3PCOB 1WTPA 1CQJB 5AFWA 2SNSA 3PVXA 2F0IA 2E76C 4PZ7A 5G3LF 5D1PA 2AGQA 2ASJA 2LXKA 2ZTDA 1FGBD 3GTJH 4ECYA 1VCIA 1PZJD 1ESRA 3HOYH 1L1OB 4DUZH 2NVYB 4U673 2L5TA 3QZ8A 1PH9A 4IWYA 2MNAA 1EIFA 4RKLA 4X65Q 4YAJB 5I9PA 2D62A 3MA2B 2W9CB 1TWHH 3J81j 1H9SA 4OX9Q 2Z0SA 1EOTA 2YL2A 4IFDG 3PQIA 4TRDA 3CAMA 3FKIG 2ZJQA 1NMFA 3ZYYX 1JWUD 1PYBA 4DGZA 3C2PA 2SEBD 4LFBH 1IL2A 5C44G 3RB4A 2PNHA 5AJ3L 4ECUA 1JX4A 2B2YA 4IPCA 4LMQD 2FLLA 2FK1A 4YWMA 2WIIB 3J81c 1WI5A 1SEIA 4EQPA 4JI6L 5C1OA 1FJGH 2NN6H 4ZAIA 5CYUA 4C3HH 5H80A 2UUCL 2C22A 3KUPA 4XXEA 4X64Q 4KJNA 1PRTF 4GKJL 2NTSA 5D1OB 4Q43A 1TWAB 4UCOA 3JAME 5KT4A 3T5LA 3H3VC 1S5BD 1TWGB 4IN3A 4CBVA 4RGOS 4XX0B 1N32L 2AGPA 1TIID 1Y1VA 1N36Q 5BR8H 4JYAL 4RZRA 1STNA 2YU9H 5JEAJ 3NELA 3KAJA 4KY5A 1WD1A 5D3IB 4A3IB 3AEVA 2KCCA 1VQFA 4C3JG 4QWAA 1KLGD 1GUGA 5F2DA 3TIGA 5BPFA 2IA6A 5C3WA 4RA8A 1PH2A 2NU9B 5COYA 3J81E 3TBIB 4CJ1B 2RSNA 1Y1WH 3RGXA 5JAVA 3BYTB 4P71A 4OX9L 4JUZA 2PZTA 1ZYRD 4BY1H 1HR0Q 1K3BC 4O4IF 2RCFA 1KBLA 1L0WA 3GTMA 2B2TA 4DR7H 1HR0L 2F0QA 2ZJRA 2Z4HA 3V4ZA 4PQXA 2R93B 3K7AB 3AMUA 1FGUA 4JOIC 4DL7A 4H7BA 2A6ED 4DK1A 3RFCA 2FJZA 2GPWA 3R5HA 3FRPB 5IYCG 4ECSA 2DY7A 3H91A 3HOUH 4F8MA 1BF4A 3RV3A 2YZGA 2XIGA 1SE2A 3PIP3 3PF4A 2NN6G 4ME3A 4AYBE 2ID0A 2UUAL 1H9SB 3BA9A 5FO7B 4LF5H 4HR7B 4J9KA 2MQHA 1EIYB 3N42B 2I5MX 4Y7NH 2YW2A 5K2MA 4LFCQ 4IFDI 2AQ3B 4K2LA 3HOZG 3A8JE 2JA6B 2R8KA 1IHZA 4A3GH 2KHIA 3STBC 5A35A 3MXGA 2J7ZA 3HOZH 2MCTA 1KABA 2WAQE 2JA8G 1YHAA 2Q8RE 3Q2OA 5E4XA 2SNMA 2K6AA 4ETSA 1BO0A 3GDEA 5LMUH 3WOFA 5FPRA 5KFLA 4F4XA 2EVBA 2K7VA 3W1GA 4IHJF 4GOPC 3S15H 5JEAH 4LF4H 1A0IA 4BBSB 4R9WA 1K0SA 1TWHA 1A3VA 3RB6A 4RZQA 5KGUA 1N34Q 2FMAA 3NGDA 4J9NA 5CV4A 5JEAG 3I55A 2VR1A 4OHJA 4O3NA 4OWXB 1YBYA 5L1KA 1IOVA 2HHHH 4LUZA 4X62Q 5LYJF 1NR4A 3EROA 5E7NA 5GROA 1M4VA 4LF7L 1GJXA 2K5QA 2EY6A 3L2PA 4O3PA 4C5BA 4EBDA 1JJGA 2PVPA 4IRCA 1B4OA 4L63B 4UP9A 3K7AH 1PH4A 1K83B 4MTKA 3JAMW 2Z6KC 4A3FH 2JA7A 4YP3A 5FLXc 2QA4A 3HS0C 4APVA 2PCFB 3ORQA 3TSSA 1O75A 3A55A 2NUAB 1TWCA 3V96A 3NBIA 4HNTA 5L37A 1Z6HA 3EA6A 3LWUA 4BWSC 3G8CA 4TKOB 1HA5A 3U9OA 3CQZB 3PF5A 3UDIA 1XJVA 2VUGA 1YNXA 2J6UA 3OIPA 3N6RA 2UUBQ 3E9HA 4IFDH 3CF5A 3H0GA 5IP9G 4IR9A 3MR5A 2KECA 3BS1A 1B1ZA 1GOZA 1Q90A 3OHBA 4QMGA 2WKCA 1KEEA 4L6TB 4RCOA 1VMCA 1A2UA 1Y14B 4X66Q 1DV1A 3JRXA 2NYZD 4KHVA 2CKZB 1NCVA 3M9BA 4ZKCB 2D9UA 1RODA 1SDFA 4LK1C 4WFN3 1TWGH 2OF1A 1DYQA 5IWAH 1LO5D 3S1NH 3KBXA 2N3SA 3T1HQ 1B2TA 4XYQA 1PH8A 1FNUA 2G9HD 1VQOA 4FXGC 1WH2A 5KFBA 3QWNA 1OWTA 5F9LA 4LF7H 1WTWA 1BCPC 2I46A 1Q82C 5L9XA 4R4OA 1XYIA 5JVG3 3RJ0A 3PW7A 2C28A 4A3BH 3KF8B 4KHPL 3VR2A 5CORA 2D5DA 3EIVA 2XGPA 2VXWA 5A2QE 3FP9A 4EQ5A 3DLLA 1BGWA 4KKSA 2XVSA 4DR7Q 1X6OA 5BN4A 1X55A 3Q8QB 4LF8Q 4M9UA 2QILA 1PTOB 1AE3A 4DR3Q 5EDWA 3CU7A 4F4ZA 3K0XA 2R8GA 1Q81C 4JPBW 3MZ5A 3T51B 3W3AA 1TA8A 4HIOA 2HQEA 3O13A 1JOOA 1R4QB 5KFCA 4IOAA 1IBMH 4DV2L 1EQRA 3HFZB 4A3EH 4JI0H 1HUNA 5ELDA 3V6KA 3NK9A 1TS5A 3NQTA 4A3CG 2B2WC 4DUZQ 3J7A5 1HTPA 3C3LA 4MAMA 1J6QA 5DLGA 2PI2A 4QIWA 5J2TF 1B33N 3HBLA 1ENFA 2L11A 2EDGA 5FPOA 3PUYA 4NLGA 4JBKA 1BNCA 1RDPD 1Z2NX 1HNWH 1JCKB 4JV1A 1M8AA 1SNDA 3KOJA 4TVAB 4QCLA 2MJ8A 5M9OA 3C0FB 1O7IA 5AJ3Q 4EBCA 2B2UC 2V58A 4RB3C 2A68C 4PG3A 2A8VA 3PO3G 2I5HA 2UXCL 1XWEA 1HRJA 3DHQA 2XGQA 2HUGA 1QVCA 1PK8A 4X62H 2ZM6H 1MSGA 2KEDA 1KJ8A 3DF7A 5KRUA 4RAYA 1YNJD 1Q1EA 4ZYSA 5C1PA 2YTXA 3VA5A 5D8DA 1UAPA 5BN5A 3I90A 1YI2A 1QE6A 1F2ZA 2J6SA 2JE6I 3UDFA 1E0BA 4PNYA 1TS4A 4DR7L 4NP5A 1Q86C 1WTOA 3HOXB 4A3LG 1K9MC 2NU6B 3CC7A 1RJRA 5FLXL 1SYXB 4U6PA 4HSVA 4UP7A 2F03A 3ICEA 3GTJA 5KIXA 4A4IA 2JA5H 2F0DA 1E24A 4QW8A 2Q8TA 3IAYA 3H4DA 3K7UC 4IUQA 3Q6SA 1K8AC 1S40A 2CVRA 2QK4A 3OW7A 4RFBA 5KNBA 4L5TA 1WCMH 3ITPA 4HCEA 3GQBA 2HIXA 3GTKH 1V1PB 1N9WA 2QKIC 4IPGA 2VPQA 5IWAL 4WJ4A 4WD3A 4X66L 2KUMA 1LTSD 5IWAQ 1LT3D 1WD0A 4KI0A 1JB7A 1WJJA 3SK6A 2RCNA 1X3QA 1CA6A 2RKSA 4DR4Q 2ENBA 3L7ZC 2YTVA 2F3IA 3PV0A 1EFWA 1TWFA 4PWQA 1SN8A 3S14B 5DQGA 2JYOA 4B3MQ 1E1TA 2BE5C 1ILPA 3BAAA 3KF6B 4RH6A 1BQQT 2B2YC 5DQIA 1MHWC 4GC7A 2RDFA 3KHRA 1F9PA 2R6GA 2F3WA 2O2LD 4ZQIA 5D14A 3P75A 2KJXA 4MV9A 1B9MA 3KBGA 1G6PA 2JP1A 2D0OA 1QNUA 3ERQA 4YY3L 1DONA 1ZHSA 2P0AA 2NVYA 1K0RA 5IP9H 2OH2A 1JOKA 4LF5L 2W7OA 2XSCA 5CMDA 2JA6G 4GNXB 1CKNB 3QJYA 5EPLA 4DV7L 1Z9FA 4QIWE 2I80A 4HNUA 3OMGA 1EQTA 3M4OH 1JIHA 3VR3A 1RYSA 3TS2A 4RU9A 4NW2A 5EKIA 3RMHA 2CW0D 3SK4A 1IBMQ 4CHTB 3CQZH 5JJZA 4DV5Q 4HEDA 4BBSG 3OYYA 2SCUB 3D8GA 5LMUL 5ELNA 3R23A 4ZHQF 2M9VA 1VQJA 2F4VL 1EY9A 4NXMQ 2OLSA 4ED3A 2HIVA 4AH6A 4YR3A 4A3KB 5CA1F 1ZYRC 1C3OA 3OUUA 3JZIA 1A62A 3RR5A 3R2IA 5DG8A 2DNCA 1PTOH 5E4WC 1BCPB 4OGQC 1PVOA 5KFXA 3AB9A 4EGJA 3RB0A 1HUMA 1D8LA 2JA9A 3G6EA 3Q0AA 2H5XA 4AQYQ 3S14H 1VF7A 2PQAA 1Y8OB 4F4YA 4AQYL 2F0SA 4IWXA 3SI8A 4OEMB 2NTTA 1TWFB 2L9HA 1R9TA 1V8QA 4Q8EA 3URYA 3L4KA 1HNXL 3FPPA 1SFOB 4DK6C 2R7ZA 1H9RA 2A69D 2ICEC 4RGMA 3MWEA 2NVXH 1W6JA 1U4MA 2E2IH 3M3YH 3A56A 2O5IC 3BQ2A 1EZ6A 2UUBH 4K8IA 2HJWA 2VA2A 3GTKA 1G2TA 2E2IA 2WDTA 2E2HB 2R93G 1KXLA 2BR0A 1YIJA 4GN4B 4GC6A 4DK3C 3DWQA 3G71A 3A74A 3HOYB 3KLSA 2YV5A 3FKIH 3M4OB 1F2MA 4JI4Q 2JEBI 3L4JA 1SR3A 1E2VA 4GKKQ 2R7DA 4HIDA 4DKAC 2I87A 5IYCH 1V4YA 1RHPA 2WE6A 2B39A 3OOCA 4O0AA 3A5UA 2EYLA 2F0EA 1JDBB 3G7LA 1M6VA 3ULLA 5KNDA 5LMNQ 4QWBA 1X3PA 3NENA 3GV8B 2C00A 4QWDA 1I94Q 1LT4D 1EY8A 2X6GA 5C5LA 5T1GA 2F4VH 1PHJA 4K5VA 1ET6A 4GS3A 1O78A 2EOTA 3RD4A 4CJ0B 2H4OA 4LF8L 5KFZA 4GN5A 1JE4A 4DR3L 3BYYB 3R93A 4ILWA 4DR4H 4G57A 5C0XH 1OXUA 1P16A 1D6EC 4K8JA 2E2HA 3ETHA 1GLVA 3GTPA 1Z47A 2YS6A 2VB3X 3R3OA 1VQLA 4KV6A 4JI3L 1PFBA 3BZDB 3KYHC 3S9WA 4B3TL 4HN7A 1OXXK 1SE4A 2AHOB 4WRDA 1A8VA 4A3IH 4N8X1 4IO9A 4C3JH 2YU9A 3RB3A 2M05A 1BXRA 1KDCA 1GUTA 1GHKA 4QF4A 3X3MA 3SE7A 2IBKA 1S0MA 2R86A 3RLNA 4JYAH 4RGTA 1FYCA 2IX3A 1RKNA 3EBEA 4DFAA 1KRTA 5LHY1 5M3FB 3WO0A 5KFEA 2XIWA 3CRLC 3FEWX 2J4XA 3D6WA 1ONLA 2JQOA 1EUJA 4FP5D 4MIUA 1B3AA 4JI2L 2AQ1B 4J9LA 3OMCA 3F2CA 5KT6A 3GTOB 4OELB 1VQPA 5DNFA 4GKJH 3S17B 3T1YH 1W6KA 2Z8LA 3MXPA 4G7ZC 1VS0A 3K5NA 2VUMB 1N48A 2Q2UA 5JUMA 1C4QA 4DAPA 5CC4A 4K5WA 1K83A 4R8UA 3NE5B 4NXNH 5TSSA 4MV6A 1KJIA 3WNZA 2VB2X 5D3DA 1EZ8A 3KDFA 1VQ9A 1TXYA 2F3VA 4X64L 2R7ZH 4J6HA 2HVQA 2UXBH 1B7YB 4CKEA 4NKLA 4QUCA 1PFNA 4C56C 1N33L 1I3QA 3CRKC 2R8IA 4FF1A 5CGKA 3TQTA 5HBRB 3DMUA 5J3BA 4LFAL 4C3HG 4QGUA 3SHLA 3BDCA 2UUAH 1LTLA 2UXCH 3NHHA 3K5IA 3H20A 4A93H 4JI7H 2IJ0A 2LXJA 4H13C 2I5LX 1ICWA 5I2XA 1X9NA 4LF4L 1K8OA 4JI4H 4OO1H 2F0UA 5EPJA 5KYLA 1GXDC 4K0KH 1LM0A 2FLNA 4R4CA 1EY4A 4RNOA 1GM5A 3J7AK 1L1OC 4GLAC 2EJGC 3QB3A 3GV6A 1XPRA 2XC9A 3GILA 1QWYA 1CT1D 3JC66 3MWYW 3J80E 1G291 4HJ7A 2XN9C 3TMEA 4XQNA 2WB1A 1TS2A 1EYGA 2OXPA 1WSCA 3MWDA 3GTGA 4P72A 4XQJA 1R9TH 5EJWA 4A3IG 5DM63 3GTOH 2ATWA 1E1OA 1PYSB 1X54A 2JA7H 4G7HC 3NEMA 4KKTA 2VQEL 3SGIA 1PLFA 1SNQA 4O3RA 4FBUA 1N33H 1PRTD 3BABA 4O4HF 4ED8A 5C4XG 1Q8IA 1VMPA 4B08A 2RF4A 1VQNA 2I8CA 5KX5F 2R93H 2DLNA 2HT1A 4OIKA 5JJLA 3QO2A 3DWAA 1HFNA 3J7AF 2NVQH 2WV6D 3DXJC 5CBAE 1TWCH 5K5PA 5T1IA 1S5ED 3RAXA 3BZKA 1LT5D 1SLJA 1D1IA 1JC7A 2PW7A 5CV5A 4JI2H 5CR3A 1E7ZA 4X65L 2D2CC 4YCVA 1STBA 2YYZA 3J81L 4LMYA 1XMOQ 2DGYA 2A5HA 1A3TA 2R7ZG 3PO3B 3HB9A 1SYCA 5KFYA 1HNZL 3J80W 1YITA 1LT6D 2ASLA 4JOIA 1FL0A 4YIJA 4JV5H 4MTNA 4RG1A 1FVIA 3VA7A 1X3GA 5KFHA 1T36A 3PUWA 3S1RH 5J2UF 5G3LD 1ULZA 3HOZB 1IL8A 2F0VA 1TT2A 1G91A 1LYLA 2JA5G 1CE8A 4KK7A 3GV7B 3GQCA 5KG3A 2V9WA 1GUSA 3K0YA 5IGGA 1Y8PB 2RA4A 5IGCA 3HOVH 4LWCA 1HH2P 3IL8A 4WBNF 1YEZA 1V1QA 4QQBX 2W57A 4U7CA 3N44B 3RZOH 4BY7H 2UUCH 2VY3A 4DAYB 4PDBA 2ZDGA 1LV9A 1O7ZA 2QYZA 1T3NA 4B3RL 4K2KA 1I7LA 4DV7H 4KHPH 3RLFA 3BQ1A 1JQYD 4DK0A 5M5YB 1YNJC 2Y0SA 2IX0A 4E4TA 3EN2A 1EYCA 1STAA 1HR0W 1EWIA 4A3EB 3N52A 1PXUA 3PUZA 1DJRD 4IUPA 1L0YB 1FR3A 2V4RA 2VPSA 4K6LA 3SVMA 3K3VA 4KD4A 4POGA 1L1OA 2NWGA 4KN4C 2FKLA 4OWWB 3GTPB 4B3TH 4R7RA 1S10A 3VYUA 1LTGD 4XIGS 1XX8A 2YYAA 3KHHA 4J9PA 4CKBA 4LFBQ 1HNWL 1GSAA 1SYBA 1KJ9A 3RTXA 4DV4H 2AQ2B 1IBKQ 1ESFA 3K6OA 1LTAD 1CI3M 1QJOA 1PTOD 4X65H 4LNQA 1TY0A 3VR6A 2F1MA 5IP7H 4MV8A 4IALA 2Q2HA 3J80L 3GTLA 3R8BA 1YZ6A 4MV4A 3IG0A 2GN5A 5KT5A 2VUMG 4ME5A 2RDJA 1DD2A 3SXHA 1N8RC 2W9BA 5IYBH 3LGJA 1S3OA 3LWEA 3KALA 1LTBD 4M1UB 3H09A 5GONF 4C1NI 4DR2L 4LF6H 1JDEA 3DM3A 1HZAA 2F0GA 2K5VA 4IUVA 2R7MA 5C4HA 1I4RA 3VMMA 1M1KC 2ZXPA 5C5JA 3HKZA 5M5WH 4GN3B 5DAUA 1KAAA 4O1NA 4C2MH 4H0LC 2L12A 4ED2A 3HXLA 2ZDQA 4LFAQ 5F9NA 4JBJA 2GVBA 2DZDA 4YY3H 1XMOH 3OTOH 5EBCA 5JPMC 3G6XA 2F52A 2ATLA 4UP8A 2K50A 4J9QA 4R8NA 3MEFA 1N36H 1DZ1A 1I6UA 1UNSA 3UDGA 2J0TD 4EGVA 3D3RA 2N49A 1S5CD 1AE2A 3H3VH 2ASDA 4K6DA 2W6MA 5CV7A 1PDQA 1KD1C 4IJHA 4BA1I 2E5LQ 4RNMA 1RL2A 4WORA 4NB3A 1TWHB 2UXDL 4A2BA 1TQOA 1I94L 3S2HB 1JR0D 5C0XJ 4YWKA 2BOSA 2JN4A 4FXKC 3VPBA 2KOLA 1A2TA 2EYJA 2VL6A 4DA2A 5JVH3 3RZDB 3TIIA 4ED0A 1GSHA 2GVAA 4DV4L 2OQKA 4FF2A 1Q7YC 2EPBA 1I4HA 3NUCA 4R8IA 5GADC 3U9TA 5IT9c 2XD4A 3NXWA 3T4AC 3J81i 3HOYG 1JKJB 4DN4M 1SSOA 5FKAC 4EQNA 2R8JA 2BQRA 1C0AA 2C2RA 2R6FA 2Z1CA 1U4PA 1CSPA 3H6MA 1BUVT 1IBLL 3S2DB 2B63B 4DV1L 2DIKA 2R61A 1JXLA 4F50A 2KSWA 3M4YA 1X65A 4DV1Q 4DL2A 1HJPA 3EJIA 4N9PA 5FO8B 5IYBG 3F8NA 2EY2A 2K01A 5KG6A 4A3DG 3UQ8A 3M4PA 1GHJA 4QB4A 4DAVA 4RB1A 3H0GH 4C2MB 1XNQH 3EYYA 1JMCA 4TUYF 1UC8A 2B29A 3RUPA 2LY7A 1DGSA 2R7FA 4A3DH 1TKWB 3QOLA 1TVXA 5KFNA 4KHZA 3JAMi 5CB4F 1V1OA 3ORRA 3HOVB 5IYZF 5C4ZA 2R7KA 1ENAA 2X0SA 1SEBD 1ZKOA 5DG9A 2YS7A 4NXNQ 2IWHA 1PH1A 5L1IA 1N34H 4Q5VA 2R7ZB 2B2VA 3NBHA 2C35B 1K83H 2E5LH 4QWEA 1KC8C 5M5XH 1KNAA 1E2WA 2Z4IA 4HQ6A 5C4JH 4A3FB 1NUCA 1PRTC 3BJUA 3J80c 4UCUA 4RAUC 3SDZA 3MXUA 2R87A 4J15A 1LLRD 1EIHA 1VQ6A 2K14A 4HMJA 4FNFA 3CVZA 3H94A 5LA6F 4LUVA 2UVWA 1PH6A 2A1AA 5LXTF 4JI1Q 5KFMA 1I50H 4J0MA 3T56B 4DR1L 3H40A 2RGVA 4FS1A 3QG1A 5FLMH 3Q1KA 3AQQA 5JVDF 3GIQA 1GSOA 1PTOC 1NMGA 2E75C 3GO5A 3D4DA 1M0TA 1NBWA 1F9RA 4IJLA 3WO1A 1Y1WG 3S2DH 4RB2C 5C4XH 1IBLH 2EZVA 2A68D 2XRSD 3U4ZA 4ODGA 4A76A 4Q0YA 2E2IB 4DV1H 1VBGA 3TP5A 3GV5B 1T94A 4TQRA 2EQSA 4EG0A 4JCVE 1C7YA 3RIZA 4QY7A 3P1HA 1WFQA 1SNCA 1CKNA 3TZUA 1YJWA 2BE5D 4AYBG 4A3MG 1BNZA 2YRWA 2KBNA 2N55A 3BJYA 3FMCA 1FJGQ 4LJZC 4ULLA 1E4EA 4A3BB 1UE5A 3HOUB 1UWVA 2MP1A 3NQIA 2PO4A 3NWSA 1KDBA 4UCVA 3I4NB 1BCPF 2Y0SG 2K05A 2PQAB 4B3ML 1EZ1A 1WTHA 2NVTH 4FXDA 1QOHA 4DV2H 2R92A 1VQCA 3KF6A 4OXPA 1SNOA 3M9MB 2EYPA 3ZJYC 4GZYC 4I7AA 2K5WA 5IYDH 3AU7A 1TS3A 2K32A 2Q2TA 1E4EB 4LAAA 1MI2A 5D65A 1STYA 4JI1H 4KN7C 4EEQA 1X32A 3FPUB 3RLOA 3TDQA 1GYFA 4FBTA 2HD3A 3GD7A 1SYGA 1CHPD 2Z6BA 1J5EH 3S1QB 3OHAA 2QEJC 2B8GA 5IE8A 4HJ9A 1WR2A 3OSPA 4BWGB 1IYUA 1Y1VG 4DNRB 4X3TA 5KFUA 4FF4A 1Y1WA 3S16B 2OT2A 4YAKB 3V6JA 1QG7A 2W6PA 1NJIC 4JV5L 2E2JH 1TWFH 3OWFA 4JVZA 2F0JA 4QL5A 1EY6A 3T1YQ 4NXNL 5EZYF 3G6VA 3S17H 3W2DA 2JEFA 5LOVF 3T1YL 3GIPA 2HDMA 4X3KA 1QVFA 3DEOA 2F0LA 2NZOA 1M90C 3M4QA 5HY6A 2BCOA 2ZXRA 3L3OC 4IR1A 3MHBA 3OWEB 1D7QA 1UEBA 2KCMA 4H44C 4RMFA 3NTKA 1Z2OX 1KC7A 1VDZA 5KFDA 1QUQB 2UXBQ 3T16A 2AUJD 3N8DA 4RKBA 3TS0A 4KHPQ 2YRXA 2CH4W 4O4LF 1VQHA 5JOBA 5JPNC 3RN2A 4BA2I 2W9AA 3QR8A 4DR6Q 5KG7A 4ECZA 4IUUA 1B44D 3K5MA 1ML0D 1KJQA 2F0HA 1IKMA 2CQOA 1EHIA 1ASZA 2WFWA 1CS0A 5IT9W 1SNPA 3Q8PB 3OPOA 4I55F 4LW1A 4I65A 1SE3A 2RVLA 3CQZA 5C0XG 3KJOA 4RAZA 2XTIA 4DUZL 1SXTA 4QIWB 3S1QH 1MGSA 1JB3A 2HHHL 4X3UA 1J8IA 1KL9A 5JQWA 2B8FA 3I7FA 2KHSA 2IP4A 2PI2E 2IY5B 3OSOA 4YHHQ 4EQOA 1X3FA 5CA0F 2F4IA 3E6ZX 1RJTA 3CCUA 4XYMB 4O2AF 1SROA 3HOVG 2UXDQ 4BBRB 1IBKL 2B2TC 3VR4A 3JAMc 5DQHA 4DV6H 1XDNA 2K75A 1F9SA 3S1MB 1CQVA 4B3MH 2AQ4A 5HGQA 3KFUA 5K36H 1UNNC 4GKJQ 2DUDA 5L1JA 3JSNA 5KFAA 3U58A 1ICFB 2WTFA 1PFMA 5HV6A 1FNVA 5FJ8H 4A3EG 4JI0Q 1NTGA 1VQ4A 3GP7A 1XPUA 4DV3H 1JORA 4R8UB 5GAHC 2PZWA 4S3SA 4FVMA 1W96A 1QB5D 1YNNC 3LMLA 4PMCA 3J80i 4L8JA 3VYRA 1E22A 1JOQA 3I56A 1VQ8A 2RDIA 3EPGA 3SK5A 1K3RA 3VYSA 4DL3A 2HQLA 2FXQA 5M3FH 4HJ5A 4RNNA 2C2DA 3MJFA 2I07B 1KDAA 2K1BA 3KLRA 4JK1C 4CDCC 4R4IA 2NVXA 1I4XA 2R3ZA 2ZTEA 2UUBL 3FKIA 4LSAA 1SJHD 2MUYA 1SJED 2MHVA 4KLKA 1I4PA 1TWCB 1CQFA 4ED7A 4PZ8A 3N41B 1G51A 4MV7A 5ELCA 2RHQB 4DUYL 1EEID 1ZEQX 5KNCA 3G4SA 3PW5A 4O2BF 3J7AV 4JV5Q 2ZM6L 1SYDA 3GV3A 2G9DA 3H0GG 3GTLB 4OX9H 3UE1A 4GOPA 2M00A 3NPPA 3HOXG 3PN1A 4Y8VB 1AW7A 1SYEA 2EYOA 1DM0B 3RN5A 1UEAB 1SAPA 4MHEA 1PRTB 3MR3A 3FDSA 2RSOA 4OL7A 1MKHA 1F2YA 5GAGC 1EU3A 1XTDA 4IQZA 4B9XA 3HOXH 3KHLA 2W8KA 2GLTA 1I4GA 4A3BG 3N6XA 1PYWD 3VDYA 3I4MH 1GKHA 3CP0A 3RUZA 3S1NB 3CCEA 2A6HD 4K14A 5FOBB 3ND8A 2KQ3A 1ASYA 4LF7Q 4CDEC 1GUWA 4A3JH 5DGBA 3KLWA 3ULPA 4APMA 3VYTA 4RWSC 5ELFA 2J9GA 3RV4A 3J81W 3MAQA 4DPGA 1VQAA 2JEAI 5KKNB 5FD6A 3S16H 2JA8H 4AYBA 5C0XI 5KFJA 5I6YA 4P73A 1Y1WB 5C3XA 2JA6A 1EL0A 4LF4Q 1VQ5A 1VF5C 1Y1VH 4Z9CB 3G6JB 4J9RA 1JT8A 1B6RA 1RK6A 3H15A 3RF2A 5GQOA 2ZTCA 1L0XB 5C3EB 4HR7A 2QEXA 1UE7A 3VPCA 4YHHH 3FDTA 1Q1BA 1RYRA 2L0CA 5EKLA 1XMQQ 1J9OA 2WAQA 1IZ6A 1SMXA 5DLFA 1KJJA 3FMAA 2FPIB 4ZUIA 1L2ZA 4QWCA 4DUYQ 2WKDA 1MJEA 2R85A 4GKKH 1TWAA 1JJ2A 1T9HA 1S72A 1EQQA 1XTCD 2NVQB 2R8HA 5IOCA 4JW0A 1S97A 2ALZA 1I5FA 1Y8NB 3V6HA 2EE1A 1DOLA 3JAML 3GTMH 5JH7F 1I50B 1DOMA 4CDFC 3GTQA 1K1QA 3AFQA 4ID6A 1D5XC 3RBDA 4HJ8A 4A2AA 3NWTA 1B70B 3ONAB 2F0FA 2XNAC 4ECVA 4WJWA 2UU9Q 3PR4A 2HVSA 4N9TA 4HNVA 2VQDA 1RTOA 1H95A 3F2BA 3Q8SB 4DR2Q 4LFCH 4MV1A 1PX2A 4X66H 4JV0A 4PZ6A 4G7OC 3FHWA 2BDOA 3I4MB 1ILQA 4C3IB 1D5ZC 4IZ8A 1B50A 3Q22A 1B53A 1OXSC 4LF5Q 2XWBB 2K5NA 3KXYT 2JA5A 1SFOH 4IRDA 1RF2D 1Y1VB 2JA5B 4FYDA 2V59A 2OTJA 3SK8A 3MFIA 2PW5A 1GUNA 3CW2C 4ZKBB 4GLXA 1LTID 2MO1A 1D5MC 3G6YA 4LF9L 5ELBA 4A3JG 1CKMA 3QFFA 4GLVB 2MGSA 3K8AA 4L5SA 5IY0A 1JLLB 3RBEA 1GVPA 3TINA 2R7LA 2VNUD 4I7HA 2PZUA 3T5JA 1IYJB 1FJGL 4BXXH 3MXNB 2OCEA 1BBUA 1X56A 2JA7G 4DU9A 1ET9A 4LH7A 3LX0A 3LNNA 1HNXH 4CC5A 1P8LA 4X62L 1S0OA 4A3FG 1UC9A 3E5SA 4M7EA 3NBHB 2E8GA 1HXYD 4KMUC 4ALPA 2VQEH 5KFPA 3RZDH 3ETJA 5BPHA 3GTMB 1AZQA 3F2UA 2E2HH 1BBWA 3HG9A 4C3IG 3M3YB 2QDBA 4YWLA 5KFTA 5HGTA 5H1SE 1XNQQ 4C3IH 2W9CA 1A6XA 5FLXW 5KFWA 1S5FD 5KFRA 2RHSB 4QUFA 3V4SA 1DIKA 2C9OA 4RGNA 3VPDA 1W93A 3BZCA 3BA8A 5T14A 2PYKA 1KNEA 2J6TA 4ED1A 5I47A 3MTSA 4JG2A 4Y7NB 1BOSA 1I6HH 2EXZA 1U9RA 2A6EC 3NTHA 5KEEA 4LF9Q 5KFIA 4AYBB 2IX1A 5M5WB 4A3MB 2NU7B 4OWTB 1AN8A 2GPSA 3CC2A 3A0JA 2UVRA 5CV6A 4EX5A 5KG4A 3KDFB 1DCZA 3UI2A 1EFID 4FU0A 2F0NA 4EVOA 1TY2A 1SNMA 3TP7A 1HCZA 4DV0L 3T53B 1QZGA 2JSOA 1S4ZA 2CWPA 1EOVA 4IOCA 1UUPA 5CBEE 2L1BA 2K4KA 4PMBA 1TR5A 1LTRD 3CCRA 1Q8KA 4JI3H 2NZHA 2A19A 3MFGA 4A3GB 3UDXA 1N56A 2AU0A 3R2TA 5FJ8G 1I3QH 2JJQA 2EY1A 1KLUD 3KAKA 1C9OA 5J39A 1E3PA 3CKIB 4L1KA 2UU9H 3H3VI 2C5CA 4RUCA 2CQYA 1WTRA 5M3MB 2QF7A 1Z7TA 1GO3E 5BN3A 3Q24A 4IFDJ 1BDOA 2VQFQ 1V9PA 2SOBA 2YU9B 4DR5H 2NVXB 2AUKA 2PPBC 1D1KA 4C2MA 1K73C 2ZM6Q 3KTMA 2P5ZX 3PUXA 1IW7D 2R82A 2VOBA 2HCIA 3M7NA 2CW8A 2G5DA 1CTMA 3I3CA 4IUNA 4RHSA 4OONA 1XMQL 5KG1A 2E5LL 2NUCA 1VQ7A 4LH6A 4YJ2F 4LFBL 4V190 1HNWQ 3MFHA 4BS9A 3D31A 3I2ZA 1MSHA 4G4KA 2XGTA 1JWMD 2NBFA 3ULJA 2ASBA 3I4NH 2V4DA 4JI2Q 4A3MH 1LTTD 2VUMH 1VQMA 2QDLA 3JRWA 2O5JC 3E3XA 2F0OA 4NXML 3OSNA 4J8QA 5DM73 3ND9A 3X3NA 3BVMA 1JJCB 5A2QL 4A3DB 1MIUA 3TQYA 1W2BA 2PN1A 4DR1H 4B3SL 1SMYD 1EUDB 1H9JA 1FD7D 2O4XA 4DV6Q 1I94H 2ZJTA 3W1BA 2WAQG 2VW9A 4B3SQ 1IYVA 1EYAA 1C48A 4EGQA 3LWBA 1RK5A 4XYOA 5FO9B 5EWGA 4POFA 4ECRA 1BCPD 4JI8H 1S68A 5I4DA 1WCMB 3K80C 4JI3Q 4R4QA 2F0PA 3GTKB 3ERSX 4IAJA 4DV7Q 5KFQA 1EIGA 4QW9A 5KT7A 5M3MG 3HOWH 4AQYH 1Z2PX 2CWAA 1M7JA 1QCBD 1B8AA 2FFKB 4U68A 3DUZA 3T5HA 5M3MH 3HOWG 2W71A 1H9MA 3LP8A 2NN6I 2V5AA 1OTCA 1W3SA 4O2DA 3A7AB 2IT1A 3BQ0A 1II3A 2XRQD 3CD6A 4IUTA 3C46A 1FKAH 4NPSA 4A3JB 5C4XB 5DGAA 1CA5A 3CCQA 2M2LA 3BU2A 1PA6A 2KEEA 4JI6Q 3MFYA 4HMIA 1AZPA 1RJPA 2FP4B 2IW3A 3WWVA 3CCLA 5I9OA 1A9XA 2KVMA 2FHTA 3MVVA 3E9IA 4CGYB 3EVQA 4LF9H 1C30A 2UU9L 2JA7B 3K5LA 1XNRQ 1CZWA 3PW4A 3PIPA 2CW0C 2NVYH 4MA5A 3CPWA 1XNRL 2EY5A 2UVUA 4Q8FA 1EY7A 5NUCA 1GUOA 3VR5A 5C3EH 2AWOA 5LL6X 3GIMA 5ISRA 4YR0A 1ZETA 3BVGA 2D0PA 4UCSA 2MO0A 2QCPX 1XMQH 2K52A 1K8MA 4DL5A 1V43A 4GNXA 1I4QA 3MEHA 2LFNA 2LSSA 4LFCL 4EYHB 1BJTA 4X6AH 4OO1G 3U4VA 2JEJA 3NP8A 2ICIA 1S5DD 4JI8L 3SR1A 2Y0SE 5IYDG 3SE0A 3G48A 1RCVD 4V0BA 2ZDHA 2PMZE 1LABA 1TWAH 4A93G 1EY5A 3ER0A 2EYMA 3BG3A 5M5YH 3NSWA 1KAWA 1HQRD 1G2SA 2DN8A 2WYOA 1YJ9A 1HZ9A 3S2HH 1LUZA 1T5EA 3AYHB 4ZRZA 2JXMB 4TQSA 1Q12A 4P2CB 4LF8H 3CMEA 1MJCA 3D6CA 3MC0B 1G6ZA 1IOWA 5DG7A 3PSIA 2A69C 2R92B 3UFXB 4CKCA 4NDXA 2UUCQ 4BY7G 4CC6A 5LL6S 1I7NA 3K58A 4R1JA 3GTQH 1SRUA 5C5MA 1D2BA 3EPIA 3PIO3 4F87A 1A3UA 5EBDA 2W6ZA 2CQAA 3CCJA 3GTGH 5FLMG 1A15A 1V51A 2JEGA 3I8ZA 2RBMA 1QVGA 3F8TA 3MXNA 2GA4B 4B3RH 2FB9A 2PQEA 1IBLQ 1I50A 2R93A 4XQQA 1QNKA 2BA0A 3N43B 2OWOA 1S0NA 1K8GA 3H4BA 1N33Q 5LMNW 1Y69U 1NNXA 1ZQ7A 4ECQA 3IN5A 3GTPH 3F1ZA 2KCNA 1E4FT 4ED6A 1WTQA 1BVSA 3M9NB 4RCNA 4E6IA 5C3EG 2NB0A 3K81C 4XT3B 5LL6b 1U4LA 1B6SA 2YZMA 4IZOA 2VZAA 3HP3A 4YB8B 4JV2A 4OO1I 5LMNH 4UY8C 3PR5B 2V1CC 4HIKA 2MPMA 1VQGA 3TQ1A 4YCUA 5IGDA 3MWMA 1HNZQ 2F4VQ 4YHHL 2AWNA 3HGBA 3OIQA 4X3SA 2UXCQ 3AFPA 4ZOLF 1KIXA 5J1ZA 2DPIA 4C3HB 3J7YW 2AGOA 1XNRH 2WB1E 4DV3L 2IHFA 1EQVA 1IXRA 2A73B 3W5OA 2RDHA 1TWGA 5C8YF 4DF7A 4UDUC 1IW7C 4MZ9A 3V2TA 2V4QA 3T1HH 2Q8IB 5D1OA 1HPCA 4IURA 3PIOA 3P20A 2PBZA 1B3QA 3D4RA 3S1RB 4C5CA 4JI1L 4A3KH 1STGA 3GTQB 4XYLB 4JI0L 5DLQE 1RIPA 4A3GG 2F0KA 2VS1A 1SYFA 3S15B 2O03A 3GTGB 5EQ0A 4YY3Q 1VQKA 4BBRH 4DLKA 5BMVF 3PZPA 1CQIB 4L5RC 4HIMA 3TREA 5J22A 4B3RQ 5ELOA 3E0EA 3S1MH 3E5NA 4BBRG 1N32Q 1MBYA 4RB0A 1O7YA 3PMFA 1HFGA 1N36L 1S9FA 3S24A 4K0KL 2FMMA 2QGQA 4I7ZC 4IPHA 2Q2IA 1M0WA 4JI7L 4TQUS 3DEPA 2PMZA 4I4TF 4TV9F 4F88A 1RD9D 3J7ZC 5KG5A 2HHHQ 5CAEB 4HAEA 3KLSX 4HSPA 2CCZA 2BDNA 3HOWB 3HKSA 3FKIB 2KHJA 4MTDA 3KF8A 1HZBA 1OO9B 3C1FA 5C44B 2FLPA 5LMNL 2FINB 2HGSA 3R5XA 1HZCA 4J9OA 1EU4A 5IODA 5KFFA 3BDLA 2YZNA 1PZID 2W6QA 3M4IA 4KTAA 3TP6A 3PGZA 1BBXC 1HR0H 4ZQ3A 1U0LA 4ZCKA 2L4NA 4DL6A 5EAYA 3T1HL 2B63G 3P7JA 3CMAA 4YJ3F 4J9MA 1PH5A 2BQ3A 1VQEA 3HEJA 4B3SH 2XCPA 1ZXTA 3MR6A 1T5XD 3M7GA 3GTLH 1RJQA 4DR6L 4G3IA 2RQXA 5KFGA 1CM9A 4DL4A 2EYFA 5C4JB 4CDDC 1CHQD 4EFBA 4O42A 3H0GB 2BQUA 1IKLA 4GNXC 2PMZB 3K3PA 4DV2Q 3CCMA 3L0OA 4PV1C 3IRBA 5KG2A 5EWEA 3M9OB 3I91A 2B2WA 5IGBA 4AIMA 4DAYA 1A63A 4JI7Q 2E2JB 5JJIA 4C3JB 1EYZA 3D0FA 3OUZA 3PW0A 1NY4A 2TSSA 2A6HC 4L5QA 4JBWA 3HKZG 2L55A 4Q44A 2VA3A 2VQFH 4FF3A 4DV5L 2WINB 1R9TB 2E74C 2EJFC 4F7XA 5LMUQ 4DUYH 4ECWA 2UVVA 2L15A 4DR4L 3A7LA 4DR3H 4TV8F 4IRKA 4NXMH 1QUQA 3A8IE 3Q8RB 2OQ0A 4WJ3M 1BKBA 4K5XA 1K1SA 2CW7A 2PNRC 5ELEA 4DV3Q 5C6AA 4QJFA 4ABNA 3KK7A 3A5ZB 1CSQA 2TMPA 2R92G 4OIJA 1EYDA 1H9KA 4YBZB 1DOKA 1XXGA 1AUXA 4YCWA 5M3FG 4DV6L 1PH3A 3KJPA 2R92H 1ZHQA 2W6OA 4UCRA 1VBHA 2SDFA 1VQIA 2W6NA 4J1MA 1PTOF 3CC4A 4N8FA 3PO2H 1UE1A 3I72A 2NVTB 1HA6A 4O3OA 4JC0A 4B3TQ 1KRSA 1B04A 2K5DA 2EYHA 1F77A 2XWJB 5IP7G 1YHQA 1VKZA 1WTXA 3TN2A 1U5KA 3JSLA 1STHA 2K04A 5EPKA 4JI8Q 1E4GT 3TEHB 4O3SA 5IIFA 3WOEA 3U50C 1SBBB 3E0JA 5LP6F 3I4NG 3K59A 4UHVA 4ME6A 2Y0SB 5I2YA 2B63H 5L1LA 1BR9A 4CJ2C 5JVLA 1N32H 4EYIB 4ECTA 3I73A 3BDOA 5IT9L 4HTHA 1AP0A 3GIIA 4EFEA 2CFMA 2ZXOA 2H1EA 4DV0H 2AKWB 4JI4L 2BA1A 2NU8B 1CK1A 5EKKA 2Z6KA 1C8CA 4JI5Q 3UE0A 3I4MG 4UCTA 2FPPB 3RZOB 4BY7B 3OTOL 4DXGA 2RGRA 5FD5A 4LF6Q 4JI5L 4XDXA 2WB1B 2Z9HA 4HJAA 4C5AA 3OTOQ 1FNWA 2HDLA 4Y52H 1XPOA 1WVLA 4KD3A 2DPJA 2WP8J 4LFAH 5KFSA 2K33A 3CHBD 2FK2A 2R7NA 5CV9A 2DNEA 1NSNS 1U4RA 2UXDH 2UXBL 1CZGA 2R84A 4X64H 2JK8A 2WAQB 4FDBA 1O7LA 1NAPA 2LS01 1EWHA 1YJNA 4JBMA 4RHRA 3R5FA 3T5KA 1YVCA 4KKUA 1DV2A 1SE8A 4R4TA 5BR8L 1WOCA 2W70A 5M5XB 2C2EA 2K03A 5BR8Q 2QW7A 2FPGB 1CFMA 2I0QA 1TU2B 2FK3A 2XCAA 1V1PA 4MN3A 4BXXG 2EJMA 3WDNA 2VQFL 3I12A 5EWFA 4I50F 1XNQL 2IL8A 1UE6A 2XCLA 4A3CH 3GIJA 2OTLA 4MTEA 5E3FA 3K57A 5DEHA 3HZXA 3D4WA 2ALYB 2LKVA 3EQLC 4NMZA 3STBD 3GTJB 1F2LA 5KFKA 4ECXA 4GKKL 1JICA 1QILA 2B2VC 4FO2A 2W8LA 1EY0A 4MA0A 3PO2G 1N34L 2VUMA 3IFDA 1NR2A 3PO3H 3BVZA 3NTIA 3PW2A 1EWCA 2KA7A 1VQBA 4DR5L 4XZ3B 5A2QW 1YHBA 2WB1G 2DWCA 1IBKH 5KFVA 3GTOA 3K5OA 4M8AA 4GOPB 3MR2A 1TAEA 3GLKA 2IHEA 2AMCB 2HCCA 4Q45A 5C44H 4C1NK 1O80A 2RDGA 3DWPA 5KFOA 2KENA 4Q0FA 5KYIA 2DJGC 2F0MA 3I4OA 1JE5A 5HURA 1GGOA 3K5HA 2B2UA 4HYKA 1MZBA 2YCHA 4DNIA 1I6HB 2K28A 1KHIA 3M85A 2BH8A 3RGZA 3BG5A 4KY7A 3KHGA 4F4WA 2JEIA 4ZK9B 2B3GA 4TSSA 1AEXA 3DM1A 4ZUJA 2BH2A 2DY8A 2NZ1D 2EIFA 1HQMC 3EFXD 4H02A 1J5EQ 4K0KQ 3GIDA 1B9NA 4A3KG 3CPFA 4P75A 3OHXC 2UUAQ 4FM9A 4DNTB 1STEA 5E1FA 2F0TA 5IGFA 1QZHA 1HNZH 3F2DA 2B63A 4RUAA 4J9SA 1VAJA 1WCMA 1OXTA 1SMYC 4A93B 4KJOA 1L2FA 2FJ2A 4JI5H 1PFSA 2EXDA 5I6WA 1CKOA 4UAIA 1I3QB 2N78A 1KTKA 2N8NA 2X6LA 1VQDA 4HCSA 1AUVA 1PV4A 3PO2B 2A74C 2FE3A 2FMCA 5KT3A 3OW2A 2N88A 4EBEA 1BXTA 3TZDA 3RNUA 4DR5Q 2IMWP 2X69A 5KG0A 2HVRA 4B9WA 1HTLD 3N40P 1OXVA 1ENCA 1AN7A 4DV0Q 4FS2A 1F9QA 4LUOA 3QOJA 2E2DC 1YNND 4DV4Q 2W7PA 4DR1Q 1G8ZD 1X3EA 2LMCB 3TP8A 5GAEC 4A75A 2CHBD 3B6YA 4BY1B 1JWSD 2JA6H 2MFIA 1GD7A 4MV3A 2KCTA 1EUCB 3HOUG 2ZJPA 1R4PB 2ES2A 3FVQA 4DR6H 2ZT9C 5FK9C 5FLXE 1J5EL 4DXFA 2F0WA 2CH4A 3A54A 1WYDA 4IPDA 5CV8A 1RTNA 4A3LH 2JA8B 4DR2H 4P74A 1KQSA 3HKZB 3U9SA 4BBSH 5EOYA 3TRZA 3QIAA 5JJKA 3CCVA 1DXMA 4MNOA 5KT2A 3CCSA 1PZKD 1E2ZA 3T13A 4YQWA 1IBML 5IGEA 1Q46A 4DAMA 3V05A 2OEOA 4LSXA 1SFOA 1NE3A 3Q23A 1XMOL 2W9BB 4ZI7F 1CUKA 1WCMG 4UPAA 3PUVA 4DV5H 3CXCA 3Q8DA 1S03G 2YTYA 4XTCS 3QZ7A 3RAQA 2IPKD 3I4LA 5K36G 3A8KE 3IKJA 4XT1B 4EEYA 1PH7A 1I6VC 2CZGA 4ZLTF 1PMRA 4JI6H 4LF6L 4KY6A 1LACA 3C1EA 3I70A 3GIKA 1AFPA 3SEBA 1MD2D 3L9AX 1Q3LA 3IFTA 3HRZC 4O3QA 2WACA 2VQEQ
chains in the Genus database with same CATH topology
1I94Q 2LSSA 4PMWA 4LFCL 4X6AH 4BY1G 1NJIC 3U4VA 3HKZE 1PHJA 2E2JH 1TWFH 4OO1G 4JV5L 1HNXQ 1AH9A 4GS3A 4QL5A 4JI8L 4JYAQ 2Y0SE 2K5HA 3PCOB 5IYDG 3T1YQ 3G48A 4NXNL 4LF8L 4GN5A 2PMZE 4PZ7A 4DR3L 1TWAH 3S17H 4A93G 3T1YL 3ER0A 2LXKA 2ZTDA 5M5YH 1KAWA 1QVFA 3GTJH 1OXUA 1P16A 2NZOA 1M90C 3M4QA 1VCIA 5HY6A 1Z47A 1YJ9A 1HZ9A 3HOYH 1UEBA 3S2HH 1L1OB 2KCMA 1LUZA 4RMFA 1D7QA 1VQLA 1QUQB 2UXBQ 3AYHB 4JI3L 1Q12A 3KYHC 3TS0A 1PH9A 2MNAA 1EIFA 4B3TL 4KHPQ 4X65Q 1VQHA 1OXXK 1MJCA 2D62A 3CMEA 2AHOB 3RN2A 1TWHH 3J81j 3PSIA 4BA2I 4DR6Q 1A8VA 2Z0SA 4A3IH 4OX9Q 2UUCQ 4BY7G 4IFDG 3CAMA 3FKIG 4C3JH 4IO9A 2ZJQA 1NMFA 1PYBA 4R1JA 3GTQH 1SRUA 1IL2A 5C44G 2PNHA 5AJ3L 2CQOA 4IPCA 3CCJA 3GTGH 5FLMG 1ASZA 2WFWA 4YWMA 3J81c 1WI5A 3RLNA 4JI6L 1QVGA 3F8TA 4LW1A 3EBEA 1KRTA 1IBLQ 4C3HH 5C0XG 3KJOA 2XTIA 2BA0A 2JQOA 1EUJA 4DUZL 2UUCL 2OWOA 3S1QH 2HHHL 1K8GA 4JI2L 1KL9A 4X64Q 1N33Q 5LMNW 3F2CA 4GKJL 1VQPA 3I7FA 2PI2E 2IY5B 4YHHQ 3GTPH 3F1ZA 1X3FA 1VS0A 1BVSA 2Q2UA 5C3EG 3K81C 3CCUA 1N32L 1SROA 3HOVG 2UXDQ 2VZAA 1N36Q 4JYAL 1IBKL 2YU9H 3JAMc 4OO1I 3KDFA 5JEAJ 4UY8C 1VQ9A 3NELA 2K75A 1TXYA 4X64L 2V1CC 4HIKA 2R7ZH 1B7YB 1VQGA 4YCUA 5HGQA 3KFUA 1N33L 2DUDA 3AEVA 1HNZQ 2F4VQ 4YHHL 2AWNA 4GKJQ 3U58A 1VQFA 2UXCQ 5J3BA 5FJ8H 3AFPA 1NTGA 4A3EG 1VQ4A 1KIXA 4JI0Q 4LFAL 4QGUA 1XPUA 1LTLA 1PH2A 2WB1E 5GAHC 2IHFA 4DV3L 1IXRA 4A93H 1Y1WH 2LXJA 3J80i 3W5OA 4GNXA 4P71A 4OX9L 2I5LX 1E22A 1X9NA 3I56A 1VQ8A 4LF4L 1K3RA 4MZ9A 4BY1H 1HR0Q 2HQLA 2FXQA 5M3FH 4HJ5A 3PIOA 1L0WA 1LM0A 1HR0L 4R4CA 4R4IA 4JI1L 4A3KH 2ZJRA 4JI0L 5DLQE 1RIPA 4A3GG 2VS1A 2ZTEA 1GM5A 2UUBL 4YY3Q 1FGUA 1VQKA 4JOIC 1L1OC 4GLAC 4BBRH 4L5RC 4HIMA 4KLKA 3TREA 1XPRA 4B3RQ 5ELOA 5IYCG 3JC66 3E0EA 4PZ8A 3S1MH 1G291 4BBRG 1G51A 4HJ7A 1N32Q 3HOUH 2RHQB 4DUYL 1N36L 3G4SA 1EYGA 3S24A 4K0KL 2QGQA 4IPHA 4P72A 4JV5Q 2Q2IA 2ZM6L 3PF4A 4JI7L 1R9TH 4TQUS 4A3IG 3GTOH 2NN6G 2ATWA 3H0GG 4ME3A 4AYBE 1E1OA 2ID0A 3UE1A 4GOPA 3J7ZC 2UUAL 3HOXG 2HHHQ 1PYSB 1X54A 3RN5A 2JA7H 3NEMA 2MQHA 1EIYB 2VQEL 3SGIA 2I5MX 4Y7NH 2CCZA 1MKHA 5GAGC 1FJGL 1XTDA 3HOXH 4LFCQ 4IFDI 3HKSA 4A3BG 2KHJA 3HOZG 5C4XG 3VDYA 1HZBA 3I4MH 1GKHA 2RF4A 3CP0A 4A3GH 2KHIA 5LMNL 3STBC 3CCEA 1VQNA 2R93H 1HZCA 3HOZH 1ASYA 4LF7Q 2HT1A 5JJLA 4A3JH 2JA8G 2WAQE 3KLWA 1YHAA 2NVQH 3ULPA 3GDEA 3PGZA 1TWCH 1U0LA 4DPGA 1VQAA 2JEAI 5EAYA 3T1HL 3S16H 2JA8H 3W1GA 2B63G 5C0XI 4GOPC 3S15H 3CMAA 1A0IA 3BZKA 1SLJA 1PH5A 4P73A 1VQEA 1N34Q 1E7ZA 4X65L 4LF4Q 1VQ5A 1Y1VH 5JEAG 3I55A 4YCVA 3GTLH 2YYZA 4DR6L 1JT8A 4OWXB 1YBYA 2DGYA 3H15A 5GQOA 1XMOQ 2ZTCA 4LUZA 4X62Q 5E7NA 5GROA 2QEXA 4LF7L 1UE7A 2R7ZG 3L2PA 1HNZL 1JJGA 1YITA 1Q1BA 4JOIA 1FL0A 3K7AH 4UP9A 4GNXC 1XMQQ 4DV2Q 1PH4A 4MTNA 1IZ6A 4RG1A 1SMXA 1FVIA 1X3GA 3CCMA 3L0OA 3PUWA 3IRBA 3S1RH 2Z6KC 4A3FH 4DUYQ 5FLXc 1MJEA 2QA4A 1JJ2A 1LYLA 4APVA 1T9HA 1S72A 1EQQA 4AIMA 2JA5G 1A63A 4JI7Q 5JJIA 3D0FA 1I5FA 1NY4A 4L5QA 3HOVH 4JBWA 3HKZG 4LWCA 3GTMH 1HH2P 3PF5A 1YEZA 1V1QA 3UDIA 1XJVA 4QQBX 1YNXA 3AFQA 2UUBQ 3E9HA 3RZOH 4BY7H 3CF5A 4DV5L 2VY3A 4DAYB 5IP9G 4HJ8A 5LMUQ 1B70B 2L15A 4DR4L 4B3RL 1QUQA 3RLFA 2OQ0A 4WJ3M 1BKBA 2UU9Q 1Y14B 4X66Q 4DV3Q 2IX0A 3EN2A 4QJFA 1H95A 3F2BA 1HR0W 1EWIA 4DR2Q 2CKZB 3M9BA 3A5ZB 1CSQA 4PZ6A 3FHWA 2R92G 3PUZA 1TWGH 3S1NH 2N3SA 3T1HQ 4YCWA 5M3FG 4DV6L 1VQOA 1PH3A 1PH8A 4POGA 3KJPA 1OXSC 1L1OA 4LF5Q 2R92H 4OWWB 2K5NA 1VQIA 1SFOH 3CC4A 4XIGS 3PO2H 1UE1A 1Q82C 4LFBQ 4R4OA 1HNWL 4JC0A 4B3TQ 3KF8B 4A3BH 1KRSA 4KHPL 3EIVA 1IBKQ 2OTJA 3DLLA 3FP9A 4EQ5A 5IP7G 1YHQA 4DR7Q 1X6OA 4GLXA 3CW2C 1X55A 2MO1A 4LF8Q 1U5KA 4LF9L 4LNQA 4JI8Q 1AE3A 4DR3Q 3TEHB 1CKMA 4A3JG 4GLVB 3K0XA 5IP7H 3K8AA 4L5SA 1Q81C 2Q2HA 5IY0A 3U50C 4HIOA 1GVPA 3I4NG 1YZ6A 2GN5A 2B63H 2VNUD 2VUMG 4IOAA 1IYJB 4DV2L 1EQRA 3HFZB 4A3EH 3MXNB 2OCEA 1BBUA 1X56A 1N8RC 5IYBH 3LGJA 1S3OA 2JA7G 4A3CG 4DUZQ 1P8LA 3J7A5 2CFMA 4X62L 2AKWB 1J6QA 4A3FG 4DR2L 4JI4L 2BA1A 2PI2A 3DM3A 1HZAA 2K5VA 2Z6KA 4JI5Q 3UE0A 3NBHB 3I4MG 1M1KC 2E8GA 3OTOL 5M5WH 3PUYA 4GN3B 4ALPA 4JI5L 4JBKA 4LF6Q 3RZDH 4HJAA 4C2MH 4TVAB 3KOJA 3OTOQ 1O7IA 4LFAQ 5AJ3Q 4Y52H 4PG3A 2A8VA 1XPOA 3PO3G 2I5HA 2UXCL 4JBJA 2GVBA 2E2HH 1QVCA 2WP8J 1BBWA 2F52A 4UP8A 2K50A 2UXBL 3MEFA 2JK8A 4FDBA 1Q1EA 4YWLA 1XNQQ 5H1SE 2YTXA 3UDGA 1YJNA 4C3IH 4JBMA 2N49A 1YVCA 1AE2A 2RHSB 3H3VH 1SE8A 1YI2A 4R4TA 5BR8L 1WOCA 1KD1C 3BZCA 4IJHA 4BA1I 2JE6I 2E5LQ 1RL2A 5BR8Q 3UDFA 4JG2A 4NB3A 2I0QA 1I6HH 2UXDL 4DR7L 1Q86C 1I94L 4A3LG 4BXXG 1K9MC 5C0XJ 3CC7A 2VQFL 4YWKA 4LF9Q 4UP7A 2IX1A 3ICEA 1XNQL 2VL6A 1UE6A 4OWTB 4A4IA 4A3CH 2JA5H 2OTLA 3CC2A 1E24A 2GVAA 4DV4L 2OQKA 3A0JA 1Q7YC 3K7UC 1K8AC 4EX5A 2ALYB 3KDFB 1S40A 3STBD 5GADC 5IT9c 3J81i 3HOYG 4GKKL 4L5TA 1WCMH 2HIXA 3GTKH 1C0AA 4DV0L 1QZGA 1N9WA 1CSPA 4IPGA 3PO2G 1N34L 1IBLL 2CWPA 5IWAL 1EOVA 4IOCA 3PO3H 4WJ4A 2K4KA 1VQBA 4DR5L 4DV1L 4X66L 1YHBA 5IWAQ 2WB1G 4GOPB 1X65A 4DV1Q 1HJPA 4KI0A 2IHEA 1Q8KA 5IYBG 2NZHA 1WJJA 2A19A 2AMCB 3CCRA 3M4PA 5C44H 1JB7A 4A3DG 3UDXA 3H0GH 2RCNA 5FJ8G 2KENA 1JMCA 4DR4Q 3L7ZC 1I3QH 2B29A 2JJQA 2YTVA 1DGSA 2R7FA 1C9OA 4A3DH 3I4OA 1E3PA 1JE5A 2F3IA 3PV0A 3H3VI 1EFWA 4KHZA 3JAMi 1SN8A 4DNIA 4B3MQ 1E1TA 1GO3E 4IFDJ 1KHIA 3M85A 2BH8A 3KF6B 2VQFQ 1V9PA 2B3GA 2BH2A 1J5EQ 4H02A 2EIFA 4K0KQ 4NXNQ 1PH1A 1K73C 2ZM6Q 4A3KG 3CPFA 4P75A 2R6GA 2UUAQ 3PUXA 2C35B 1K83H 3M7NA 1KC8C 5M5XH 4OONA 1XMQL 2E5LL 5C4JH 1G6PA 3BJUA 1QZHA 1VQ7A 4LFBL 3F2DA 2D0OA 3J80c 4YY3L 1HNWQ 3D31A 1K0RA 5IP9H 4J15A 4BXXH 3I2ZA 2ASBA 2XGTA 3ULJA 1VQ6A 3I4NH 1OXTA 2K14A 4LF5L 4JI2Q 4A3MH 2JA6G 4LUVA 2VUMH 1L2FA 4GNXB 1VQMA 2A1AA 1PH6A 1CKNB 1PFSA 2EXDA 4DV7L 4NXML 1CKOA 4JI1Q 1Z9FA 1I50H 4QIWE 2N8NA 2N78A 4DR1L 1JJCB 1MIUA 1VQDA 3TQYA 1W2BA 3M4OH 5FLMH 3AQQA 4B3SL 1PV4A 3TS2A 4DV6Q 1NMGA 3GO5A 3W1BA 3OW2A 2WAQG 2VW9A 4B3SQ 1IBMQ 1NBWA 4IJLA 3CQZH 1Y1WG 4DV5Q 4DR5Q 3RNUA 3S2DH 4BBSG 3OYYA 5C4XH 5LMUL 4POFA 3U4ZA 4A76A 1OXVA 5ELNA 3K80C 4DV0Q 4JI3Q 4R4QA 4LUOA 1VQJA 3ERSX 2F4VL 4DV7Q 4NXMQ 2EQSA 4JCVE 2HIVA 4AH6A 4DV4Q 4DR1Q 1C7YA 4QY7A 1WFQA 1A62A 1X3EA 1CKNA 3RR5A 5M3MG 3HOWH 5GAEC 4A75A 1YJWA 4AYBG 3B6YA 1PVOA 4A3MG 2JA6H 2CWAA 2KBNA 2MFIA 1GD7A 1D8LA 1B8AA 2JA9A 3G6EA 2H5XA 2KCTA 4AQYQ 3S14H 5M3MH 3HOWG 1FJGQ 2PQAA 3HOUG 2NN6I 2ZJPA 2ES2A 1OTCA 1UE5A 4AQYL 1UWVA 1J5EL 1W3SA 4O2DA 2IT1A 2Y0SG 1HNXL 2PQAB 4B3ML 1WYDA 4DK6C 4IPDA 3CD6A 4A3LH 2NVTH 4P74A 4NPSA 1KQSA 4BBSH 3TRZA 1VQCA 3KF6A 4OXPA 3CCVA 4MNOA 5JJKA 3CCQA 3CCSA 2NVXH 3ZJYC 3BU2A 1PA6A 2E2IH 4JI6Q 3M3YH 1IBML 3WWVA 3CCLA 5IYDH 1Q46A 2Q2TA 4DAMA 3E9IA 1NE3A 1XMOL 2UU9L 1CUKA 1WCMG 4UPAA 3PUVA 2R93G 3CXCA 1KXLA 1YIJA 4GN4B 1XNRQ 3RLOA 3Q8DA 4DK3C 3PIPA 3G71A 3A74A 2YTYA 4XTCS 2NVYH 2YV5A 3FKIH 3CPWA 1XNRL 3GD7A 5K36G 5C3EH 4JI4Q 2JEBI 2AWOA 1PH7A 1SR3A 4GKKQ 2R7DA 5IE8A 4DKAC 4HIDA 5IYCH 4HJ9A 4LF6L 2D0PA 4O0AA 3A5UA 2MO0A 3ULLA 5LMNQ 2K52A 3NENA 1Y1VG 1V43A 2VQEQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 Q;  2LSS A;  4PMW A;  4LFC L;  4X6A H;  4BY1 G;  1NJI C;  3U4V A;  3HKZ E;  1PHJ A;  2E2J H;  1TWF H;  4OO1 G;  4JV5 L;  1HNX Q;  1AH9 A;  4GS3 A;  4QL5 A;  4JI8 L;  4JYA Q;  2Y0S E;  2K5H A;  3PCO B;  5IYD G;  3T1Y Q;  3G48 A;  4NXN L;  4LF8 L;  4GN5 A;  2PMZ E;  4PZ7 A;  4DR3 L;  1TWA H;  3S17 H;  4A93 G;  3T1Y L;  3ER0 A;  2LXK A;  2ZTD A;  5M5Y H;  1KAW A;  1QVF A;  3GTJ H;  1OXU A;  1P16 A;  2NZO A;  1M90 C;  3M4Q A;  1VCI A;  5HY6 A;  1Z47 A;  1YJ9 A;  1HZ9 A;  3HOY H;  1UEB A;  3S2H H;  1L1O B;  2KCM A;  1LUZ A;  4RMF A;  1D7Q A;  1VQL A;  1QUQ B;  2UXB Q;  3AYH B;  4JI3 L;  1Q12 A;  3KYH C;  3TS0 A;  1PH9 A;  2MNA A;  1EIF A;  4B3T L;  4KHP Q;  4X65 Q;  1VQH A;  1OXX K;  1MJC A;  2D62 A;  3CME A;  2AHO B;  3RN2 A;  1TWH H;  3J81 j;  3PSI A;  4BA2 I;  4DR6 Q;  1A8V A;  2Z0S A;  4A3I H;  4OX9 Q;  2UUC Q;  4BY7 G;  4IFD G;  3CAM A;  3FKI G;  4C3J H;  4IO9 A;  2ZJQ A;  1NMF A;  1PYB A;  4R1J A;  3GTQ H;  1SRU A;  1IL2 A;  5C44 G;  2PNH A;  5AJ3 L;  2CQO A;  4IPC A;  3CCJ A;  3GTG H;  5FLM G;  1ASZ A;  2WFW A;  4YWM A;  3J81 c;  1WI5 A;  3RLN A;  4JI6 L;  1QVG A;  3F8T A;  4LW1 A;  3EBE A;  1KRT A;  1IBL Q;  4C3H H;  5C0X G;  3KJO A;  2XTI A;  2BA0 A;  2JQO A;  1EUJ A;  4DUZ L;  2UUC L;  2OWO A;  3S1Q H;  2HHH L;  1K8G A;  4JI2 L;  1KL9 A;  4X64 Q;  1N33 Q;  5LMN W;  3F2C A;  4GKJ L;  1VQP A;  3I7F A;  2PI2 E;  2IY5 B;  4YHH Q;  3GTP H;  3F1Z A;  1X3F A;  1VS0 A;  1BVS A;  2Q2U A;  5C3E G;  3K81 C;  3CCU A;  1N32 L;  1SRO A;  3HOV G;  2UXD Q;  2VZA A;  1N36 Q;  4JYA L;  1IBK L;  2YU9 H;  3JAM c;  4OO1 I;  3KDF A;  5JEA J;  4UY8 C;  1VQ9 A;  3NEL A;  2K75 A;  1TXY A;  4X64 L;  2V1C C;  4HIK A;  2R7Z H;  1B7Y B;  1VQG A;  4YCU A;  5HGQ A;  3KFU A;  1N33 L;  2DUD A;  3AEV A;  1HNZ Q;  2F4V Q;  4YHH L;  2AWN A;  4GKJ Q;  3U58 A;  1VQF A;  2UXC Q;  5J3B A;  5FJ8 H;  3AFP A;  1NTG A;  4A3E G;  1VQ4 A;  1KIX A;  4JI0 Q;  4LFA L;  4QGU A;  1XPU A;  1LTL A;  1PH2 A;  2WB1 E;  5GAH C;  2IHF A;  4DV3 L;  1IXR A;  4A93 H;  1Y1W H;  2LXJ A;  3J80 i;  3W5O A;  4GNX A;  4P71 A;  4OX9 L;  2I5L X;  1E22 A;  1X9N A;  3I56 A;  1VQ8 A;  4LF4 L;  1K3R A;  4MZ9 A;  4BY1 H;  1HR0 Q;  2HQL A;  2FXQ A;  5M3F H;  4HJ5 A;  3PIO A;  1L0W A;  1LM0 A;  1HR0 L;  4R4C A;  4R4I A;  4JI1 L;  4A3K H;  2ZJR A;  4JI0 L;  5DLQ E;  1RIP A;  4A3G G;  2VS1 A;  2ZTE A;  1GM5 A;  2UUB L;  4YY3 Q;  1FGU A;  1VQK A;  4JOI C;  1L1O C;  4GLA C;  4BBR H;  4L5R C;  4HIM A;  4KLK A;  3TRE A;  1XPR A;  4B3R Q;  5ELO A;  5IYC G;  3JC6 6;  3E0E A;  4PZ8 A;  3S1M H;  1G29 1;  4BBR G;  1G51 A;  4HJ7 A;  1N32 Q;  3HOU H;  2RHQ B;  4DUY L;  1N36 L;  3G4S A;  1EYG A;  3S24 A;  4K0K L;  2QGQ A;  4IPH A;  4P72 A;  4JV5 Q;  2Q2I A;  2ZM6 L;  3PF4 A;  4JI7 L;  1R9T H;  4TQU S;  4A3I G;  3GTO H;  2NN6 G;  2ATW A;  3H0G G;  4ME3 A;  4AYB E;  1E1O A;  2ID0 A;  3UE1 A;  4GOP A;  3J7Z C;  2UUA L;  3HOX G;  2HHH Q;  1PYS B;  1X54 A;  3RN5 A;  2JA7 H;  3NEM A;  2MQH A;  1EIY B;  2VQE L;  3SGI A;  2I5M X;  4Y7N H;  2CCZ A;  1MKH A;  5GAG C;  1FJG L;  1XTD A;  3HOX H;  4LFC Q;  4IFD I;  3HKS A;  4A3B G;  2KHJ A;  3HOZ G;  5C4X G;  3VDY A;  1HZB A;  3I4M H;  1GKH A;  2RF4 A;  3CP0 A;  4A3G H;  2KHI A;  5LMN L;  3STB C;  3CCE A;  1VQN A;  2R93 H;  1HZC A;  3HOZ H;  1ASY A;  4LF7 Q;  2HT1 A;  5JJL A;  4A3J H;  2JA8 G;  2WAQ E;  3KLW A;  1YHA A;  2NVQ H;  3ULP A;  3GDE A;  3PGZ A;  1TWC H;  1U0L A;  4DPG A;  1VQA A;  2JEA I;  5EAY A;  3T1H L;  3S16 H;  2JA8 H;  3W1G A;  2B63 G;  5C0X I;  4GOP C;  3S15 H;  3CMA A;  1A0I A;  3BZK A;  1SLJ A;  1PH5 A;  4P73 A;  1VQE A;  1N34 Q;  1E7Z A;  4X65 L;  4LF4 Q;  1VQ5 A;  1Y1V H;  5JEA G;  3I55 A;  4YCV A;  3GTL H;  2YYZ A;  4DR6 L;  1JT8 A;  4OWX B;  1YBY A;  2DGY A;  3H15 A;  5GQO A;  1XMO Q;  2ZTC A;  4LUZ A;  4X62 Q;  5E7N A;  5GRO A;  2QEX A;  4LF7 L;  1UE7 A;  2R7Z G;  3L2P A;  1HNZ L;  1JJG A;  1YIT A;  1Q1B A;  4JOI A;  1FL0 A;  3K7A H;  4UP9 A;  4GNX C;  1XMQ Q;  4DV2 Q;  1PH4 A;  4MTN A;  1IZ6 A;  4RG1 A;  1SMX A;  1FVI A;  1X3G A;  3CCM A;  3L0O A;  3PUW A;  3IRB A;  3S1R H;  2Z6K C;  4A3F H;  4DUY Q;  5FLX c;  1MJE A;  2QA4 A;  1JJ2 A;  1LYL A;  4APV A;  1T9H A;  1S72 A;  1EQQ A;  4AIM A;  2JA5 G;  1A63 A;  4JI7 Q;  5JJI A;  3D0F A;  1I5F A;  1NY4 A;  4L5Q A;  3HOV H;  4JBW A;  3HKZ G;  4LWC A;  3GTM H;  1HH2 P;  3PF5 A;  1YEZ A;  1V1Q A;  3UDI A;  1XJV A;  4QQB X;  1YNX A;  3AFQ A;  2UUB Q;  3E9H A;  3RZO H;  4BY7 H;  3CF5 A;  4DV5 L;  2VY3 A;  4DAY B;  5IP9 G;  4HJ8 A;  5LMU Q;  1B70 B;  2L15 A;  4DR4 L;  4B3R L;  1QUQ A;  3RLF A;  2OQ0 A;  4WJ3 M;  1BKB A;  2UU9 Q;  1Y14 B;  4X66 Q;  4DV3 Q;  2IX0 A;  3EN2 A;  4QJF A;  1H95 A;  3F2B A;  1HR0 W;  1EWI A;  4DR2 Q;  2CKZ B;  3M9B A;  3A5Z B;  1CSQ A;  4PZ6 A;  3FHW A;  2R92 G;  3PUZ A;  1TWG H;  3S1N H;  2N3S A;  3T1H Q;  4YCW A;  5M3F G;  4DV6 L;  1VQO A;  1PH3 A;  1PH8 A;  4POG A;  3KJP A;  1OXS C;  1L1O A;  4LF5 Q;  2R92 H;  4OWW B;  2K5N A;  1VQI A;  1SFO H;  3CC4 A;  4XIG S;  3PO2 H;  1UE1 A;  1Q82 C;  4LFB Q;  4R4O A;  1HNW L;  4JC0 A;  4B3T Q;  3KF8 B;  4A3B H;  1KRS A;  4KHP L;  3EIV A;  1IBK Q;  2OTJ A;  3DLL A;  3FP9 A;  4EQ5 A;  5IP7 G;  1YHQ A;  4DR7 Q;  1X6O A;  4GLX A;  3CW2 C;  1X55 A;  2MO1 A;  4LF8 Q;  1U5K A;  4LF9 L;  4LNQ A;  4JI8 Q;  1AE3 A;  4DR3 Q;  3TEH B;  1CKM A;  4A3J G;  4GLV B;  3K0X A;  5IP7 H;  3K8A A;  4L5S A;  1Q81 C;  2Q2H A;  5IY0 A;  3U50 C;  4HIO A;  1GVP A;  3I4N G;  1YZ6 A;  2GN5 A;  2B63 H;  2VNU D;  2VUM G;  4IOA A;  1IYJ B;  4DV2 L;  1EQR A;  3HFZ B;  4A3E H;  3MXN B;  2OCE A;  1BBU A;  1X56 A;  1N8R C;  5IYB H;  3LGJ A;  1S3O A;  2JA7 G;  4A3C G;  4DUZ Q;  1P8L A;  3J7A 5;  2CFM A;  4X62 L;  2AKW B;  1J6Q A;  4A3F G;  4DR2 L;  4JI4 L;  2BA1 A;  2PI2 A;  3DM3 A;  1HZA A;  2K5V A;  2Z6K A;  4JI5 Q;  3UE0 A;  3NBH B;  3I4M G;  1M1K C;  2E8G A;  3OTO L;  5M5W H;  3PUY A;  4GN3 B;  4ALP A;  4JI5 L;  4JBK A;  4LF6 Q;  3RZD H;  4HJA A;  4C2M H;  4TVA B;  3KOJ A;  3OTO Q;  1O7I A;  4LFA Q;  5AJ3 Q;  4Y52 H;  4PG3 A;  2A8V A;  1XPO A;  3PO3 G;  2I5H A;  2UXC L;  4JBJ A;  2GVB A;  2E2H H;  1QVC A;  2WP8 J;  1BBW A;  2F52 A;  4UP8 A;  2K50 A;  2UXB L;  3MEF A;  2JK8 A;  4FDB A;  1Q1E A;  4YWL A;  1XNQ Q;  5H1S E;  2YTX A;  3UDG A;  1YJN A;  4C3I H;  4JBM A;  2N49 A;  1YVC A;  1AE2 A;  2RHS B;  3H3V H;  1SE8 A;  1YI2 A;  4R4T A;  5BR8 L;  1WOC A;  1KD1 C;  3BZC A;  4IJH A;  4BA1 I;  2JE6 I;  2E5L Q;  1RL2 A;  5BR8 Q;  3UDF A;  4JG2 A;  4NB3 A;  2I0Q A;  1I6H H;  2UXD L;  4DR7 L;  1Q86 C;  1I94 L;  4A3L G;  4BXX G;  1K9M C;  5C0X J;  3CC7 A;  2VQF L;  4YWK A;  4LF9 Q;  4UP7 A;  2IX1 A;  3ICE A;  1XNQ L;  2VL6 A;  1UE6 A;  4OWT B;  4A4I A;  4A3C H;  2JA5 H;  2OTL A;  3CC2 A;  1E24 A;  2GVA A;  4DV4 L;  2OQK A;  3A0J A;  1Q7Y C;  3K7U C;  1K8A C;  4EX5 A;  2ALY B;  3KDF B;  1S40 A;  3STB D;  5GAD C;  5IT9 c;  3J81 i;  3HOY G;  4GKK L;  4L5T A;  1WCM H;  2HIX A;  3GTK H;  1C0A A;  4DV0 L;  1QZG A;  1N9W A;  1CSP A;  4IPG A;  3PO2 G;  1N34 L;  1IBL L;  2CWP A;  5IWA L;  1EOV A;  4IOC A;  3PO3 H;  4WJ4 A;  2K4K A;  1VQB A;  4DR5 L;  4DV1 L;  4X66 L;  1YHB A;  5IWA Q;  2WB1 G;  4GOP B;  1X65 A;  4DV1 Q;  1HJP A;  4KI0 A;  2IHE A;  1Q8K A;  5IYB G;  2NZH A;  1WJJ A;  2A19 A;  2AMC B;  3CCR A;  3M4P A;  5C44 H;  1JB7 A;  4A3D G;  3UDX A;  3H0G H;  2RCN A;  5FJ8 G;  2KEN A;  1JMC A;  4DR4 Q;  3L7Z C;  1I3Q H;  2B29 A;  2JJQ A;  2YTV A;  1DGS A;  2R7F A;  1C9O A;  4A3D H;  3I4O A;  1E3P A;  1JE5 A;  2F3I A;  3PV0 A;  3H3V I;  1EFW A;  4KHZ A;  3JAM i;  1SN8 A;  4DNI A;  4B3M Q;  1E1T A;  1GO3 E;  4IFD J;  1KHI A;  3M85 A;  2BH8 A;  3KF6 B;  2VQF Q;  1V9P A;  2B3G A;  2BH2 A;  1J5E Q;  4H02 A;  2EIF A;  4K0K Q;  4NXN Q;  1PH1 A;  1K73 C;  2ZM6 Q;  4A3K G;  3CPF A;  4P75 A;  2R6G A;  2UUA Q;  3PUX A;  2C35 B;  1K83 H;  3M7N A;  1KC8 C;  5M5X H;  4OON A;  1XMQ L;  2E5L L;  5C4J H;  1G6P A;  3BJU A;  1QZH A;  1VQ7 A;  4LFB L;  3F2D A;  2D0O A;  3J80 c;  4YY3 L;  1HNW Q;  3D31 A;  1K0R A;  5IP9 H;  4J15 A;  4BXX H;  3I2Z A;  2ASB A;  2XGT A;  3ULJ A;  1VQ6 A;  3I4N H;  1OXT A;  2K14 A;  4LF5 L;  4JI2 Q;  4A3M H;  2JA6 G;  4LUV A;  2VUM H;  1L2F A;  4GNX B;  1VQM A;  2A1A A;  1PH6 A;  1CKN B;  1PFS A;  2EXD A;  4DV7 L;  4NXM L;  1CKO A;  4JI1 Q;  1Z9F A;  1I50 H;  4QIW E;  2N8N A;  2N78 A;  4DR1 L;  1JJC B;  1MIU A;  1VQD A;  3TQY A;  1W2B A;  3M4O H;  5FLM H;  3AQQ A;  4B3S L;  1PV4 A;  3TS2 A;  4DV6 Q;  1NMG A;  3GO5 A;  3W1B A;  3OW2 A;  2WAQ G;  2VW9 A;  4B3S Q;  1IBM Q;  1NBW A;  4IJL A;  3CQZ H;  1Y1W G;  4DV5 Q;  4DR5 Q;  3RNU A;  3S2D H;  4BBS G;  3OYY A;  5C4X H;  5LMU L;  4POF A;  3U4Z A;  4A76 A;  1OXV A;  5ELN A;  3K80 C;  4DV0 Q;  4JI3 Q;  4R4Q A;  4LUO A;  1VQJ A;  3ERS X;  2F4V L;  4DV7 Q;  4NXM Q;  2EQS A;  4JCV E;  2HIV A;  4AH6 A;  4DV4 Q;  4DR1 Q;  1C7Y A;  4QY7 A;  1WFQ A;  1A62 A;  1X3E A;  1CKN A;  3RR5 A;  5M3M G;  3HOW H;  5GAE C;  4A75 A;  1YJW A;  4AYB G;  3B6Y A;  1PVO A;  4A3M G;  2JA6 H;  2CWA A;  2KBN A;  2MFI A;  1GD7 A;  1D8L A;  1B8A A;  2JA9 A;  3G6E A;  2H5X A;  2KCT A;  4AQY Q;  3S14 H;  5M3M H;  3HOW G;  1FJG Q;  2PQA A;  3HOU G;  2NN6 I;  2ZJP A;  2ES2 A;  1OTC A;  1UE5 A;  4AQY L;  1UWV A;  1J5E L;  1W3S A;  4O2D A;  2IT1 A;  2Y0S G;  1HNX L;  2PQA B;  4B3M L;  1WYD A;  4DK6 C;  4IPD A;  3CD6 A;  4A3L H;  2NVT H;  4P74 A;  4NPS A;  1KQS A;  4BBS H;  3TRZ A;  1VQC A;  3KF6 A;  4OXP A;  3CCV A;  4MNO A;  5JJK A;  3CCQ A;  3CCS A;  2NVX H;  3ZJY C;  3BU2 A;  1PA6 A;  2E2I H;  4JI6 Q;  3M3Y H;  1IBM L;  3WWV A;  3CCL A;  5IYD H;  1Q46 A;  2Q2T A;  4DAM A;  3E9I A;  1NE3 A;  1XMO L;  2UU9 L;  1CUK A;  1WCM G;  4UPA A;  3PUV A;  2R93 G;  3CXC A;  1KXL A;  1YIJ A;  4GN4 B;  1XNR Q;  3RLO A;  3Q8D A;  4DK3 C;  3PIP A;  3G71 A;  3A74 A;  2YTY A;  4XTC S;  2NVY H;  2YV5 A;  3FKI H;  3CPW A;  1XNR L;  3GD7 A;  5K36 G;  5C3E H;  4JI4 Q;  2JEB I;  2AWO A;  1PH7 A;  1SR3 A;  4GKK Q;  2R7D A;  5IE8 A;  4DKA C;  4HID A;  5IYC H;  4HJ9 A;  4LF6 L;  2D0P A;  4O0A A;  3A5U A;  2MO0 A;  3ULL A;  5LMN Q;  2K52 A;  3NEN A;  1Y1V G;  1V43 A;  2VQE Q; 
#chains in the Genus database with same CATH topology
 5IT9 E;  4PMW A;  1WTV A;  2DJF C;  4BY1 G;  1HHV A;  3HKZ E;  1AH9 A;  1HNX Q;  4UFZ A;  1SCU B;  4YR2 A;  5EGT A;  4JYA Q;  1K28 A;  2K5H A;  1EEF D;  3PCO B;  1WTP A;  1CQJ B;  5AFW A;  2SNS A;  3PVX A;  2F0I A;  2E76 C;  4PZ7 A;  5G3L F;  5D1P A;  2AGQ A;  2ASJ A;  2LXK A;  2ZTD A;  1FGB D;  3GTJ H;  4ECY A;  1VCI A;  1PZJ D;  1ESR A;  3HOY H;  1L1O B;  4DUZ H;  2NVY B;  4U67 3;  2L5T A;  3QZ8 A;  1PH9 A;  4IWY A;  2MNA A;  1EIF A;  4RKL A;  4X65 Q;  4YAJ B;  5I9P A;  2D62 A;  3MA2 B;  2W9C B;  1TWH H;  3J81 j;  1H9S A;  4OX9 Q;  2Z0S A;  1EOT A;  2YL2 A;  4IFD G;  3PQI A;  4TRD A;  3CAM A;  3FKI G;  2ZJQ A;  1NMF A;  3ZYY X;  1JWU D;  1PYB A;  4DGZ A;  3C2P A;  2SEB D;  4LFB H;  1IL2 A;  5C44 G;  3RB4 A;  2PNH A;  5AJ3 L;  4ECU A;  1JX4 A;  2B2Y A;  4IPC A;  4LMQ D;  2FLL A;  2FK1 A;  4YWM A;  2WII B;  3J81 c;  1WI5 A;  1SEI A;  4EQP A;  4JI6 L;  5C1O A;  1FJG H;  2NN6 H;  4ZAI A;  5CYU A;  4C3H H;  5H80 A;  2UUC L;  2C22 A;  3KUP A;  4XXE A;  4X64 Q;  4KJN A;  1PRT F;  4GKJ L;  2NTS A;  5D1O B;  4Q43 A;  1TWA B;  4UCO A;  3JAM E;  5KT4 A;  3T5L A;  3H3V C;  1S5B D;  1TWG B;  4IN3 A;  4CBV A;  4RGO S;  4XX0 B;  1N32 L;  2AGP A;  1TII D;  1Y1V A;  1N36 Q;  5BR8 H;  4JYA L;  4RZR A;  1STN A;  2YU9 H;  5JEA J;  3NEL A;  3KAJ A;  4KY5 A;  1WD1 A;  5D3I B;  4A3I B;  3AEV A;  2KCC A;  1VQF A;  4C3J G;  4QWA A;  1KLG D;  1GUG A;  5F2D A;  3TIG A;  5BPF A;  2IA6 A;  5C3W A;  4RA8 A;  1PH2 A;  2NU9 B;  5COY A;  3J81 E;  3TBI B;  4CJ1 B;  2RSN A;  1Y1W H;  3RGX A;  5JAV A;  3BYT B;  4P71 A;  4OX9 L;  4JUZ A;  2PZT A;  1ZYR D;  4BY1 H;  1HR0 Q;  1K3B C;  4O4I F;  2RCF A;  1KBL A;  1L0W A;  3GTM A;  2B2T A;  4DR7 H;  1HR0 L;  2F0Q A;  2ZJR A;  2Z4H A;  3V4Z A;  4PQX A;  2R93 B;  3K7A B;  3AMU A;  1FGU A;  4JOI C;  4DL7 A;  4H7B A;  2A6E D;  4DK1 A;  3RFC A;  2FJZ A;  2GPW A;  3R5H A;  3FRP B;  5IYC G;  4ECS A;  2DY7 A;  3H91 A;  3HOU H;  4F8M A;  1BF4 A;  3RV3 A;  2YZG A;  2XIG A;  1SE2 A;  3PIP 3;  3PF4 A;  2NN6 G;  4ME3 A;  4AYB E;  2ID0 A;  2UUA L;  1H9S B;  3BA9 A;  5FO7 B;  4LF5 H;  4HR7 B;  4J9K A;  2MQH A;  1EIY B;  3N42 B;  2I5M X;  4Y7N H;  2YW2 A;  5K2M A;  4LFC Q;  4IFD I;  2AQ3 B;  4K2L A;  3HOZ G;  3A8J E;  2JA6 B;  2R8K A;  1IHZ A;  4A3G H;  2KHI A;  3STB C;  5A35 A;  3MXG A;  2J7Z A;  3HOZ H;  2MCT A;  1KAB A;  2WAQ E;  2JA8 G;  1YHA A;  2Q8R E;  3Q2O A;  5E4X A;  2SNM A;  2K6A A;  4ETS A;  1BO0 A;  3GDE A;  5LMU H;  3WOF A;  5FPR A;  5KFL A;  4F4X A;  2EVB A;  2K7V A;  3W1G A;  4IHJ F;  4GOP C;  3S15 H;  5JEA H;  4LF4 H;  1A0I A;  4BBS B;  4R9W A;  1K0S A;  1TWH A;  1A3V A;  3RB6 A;  4RZQ A;  5KGU A;  1N34 Q;  2FMA A;  3NGD A;  4J9N A;  5CV4 A;  5JEA G;  3I55 A;  2VR1 A;  4OHJ A;  4O3N A;  4OWX B;  1YBY A;  5L1K A;  1IOV A;  2HHH H;  4LUZ A;  4X62 Q;  5LYJ F;  1NR4 A;  3ERO A;  5E7N A;  5GRO A;  1M4V A;  4LF7 L;  1GJX A;  2K5Q A;  2EY6 A;  3L2P A;  4O3P A;  4C5B A;  4EBD A;  1JJG A;  2PVP A;  4IRC A;  1B4O A;  4L63 B;  4UP9 A;  3K7A H;  1PH4 A;  1K83 B;  4MTK A;  3JAM W;  2Z6K C;  4A3F H;  2JA7 A;  4YP3 A;  5FLX c;  2QA4 A;  3HS0 C;  4APV A;  2PCF B;  3ORQ A;  3TSS A;  1O75 A;  3A55 A;  2NUA B;  1TWC A;  3V96 A;  3NBI A;  4HNT A;  5L37 A;  1Z6H A;  3EA6 A;  3LWU A;  4BWS C;  3G8C A;  4TKO B;  1HA5 A;  3U9O A;  3CQZ B;  3PF5 A;  3UDI A;  1XJV A;  2VUG A;  1YNX A;  2J6U A;  3OIP A;  3N6R A;  2UUB Q;  3E9H A;  4IFD H;  3CF5 A;  3H0G A;  5IP9 G;  4IR9 A;  3MR5 A;  2KEC A;  3BS1 A;  1B1Z A;  1GOZ A;  1Q90 A;  3OHB A;  4QMG A;  2WKC A;  1KEE A;  4L6T B;  4RCO A;  1VMC A;  1A2U A;  1Y14 B;  4X66 Q;  1DV1 A;  3JRX A;  2NYZ D;  4KHV A;  2CKZ B;  1NCV A;  3M9B A;  4ZKC B;  2D9U A;  1ROD A;  1SDF A;  4LK1 C;  4WFN 3;  1TWG H;  2OF1 A;  1DYQ A;  5IWA H;  1LO5 D;  3S1N H;  3KBX A;  2N3S A;  3T1H Q;  1B2T A;  4XYQ A;  1PH8 A;  1FNU A;  2G9H D;  1VQO A;  4FXG C;  1WH2 A;  5KFB A;  3QWN A;  1OWT A;  5F9L A;  4LF7 H;  1WTW A;  1BCP C;  2I46 A;  1Q82 C;  5L9X A;  4R4O A;  1XYI A;  5JVG 3;  3RJ0 A;  3PW7 A;  2C28 A;  4A3B H;  3KF8 B;  4KHP L;  3VR2 A;  5COR A;  2D5D A;  3EIV A;  2XGP A;  2VXW A;  5A2Q E;  3FP9 A;  4EQ5 A;  3DLL A;  1BGW A;  4KKS A;  2XVS A;  4DR7 Q;  1X6O A;  5BN4 A;  1X55 A;  3Q8Q B;  4LF8 Q;  4M9U A;  2QIL A;  1PTO B;  1AE3 A;  4DR3 Q;  5EDW A;  3CU7 A;  4F4Z A;  3K0X A;  2R8G A;  1Q81 C;  4JPB W;  3MZ5 A;  3T51 B;  3W3A A;  1TA8 A;  4HIO A;  2HQE A;  3O13 A;  1JOO A;  1R4Q B;  5KFC A;  4IOA A;  1IBM H;  4DV2 L;  1EQR A;  3HFZ B;  4A3E H;  4JI0 H;  1HUN A;  5ELD A;  3V6K A;  3NK9 A;  1TS5 A;  3NQT A;  4A3C G;  2B2W C;  4DUZ Q;  3J7A 5;  1HTP A;  3C3L A;  4MAM A;  1J6Q A;  5DLG A;  2PI2 A;  4QIW A;  5J2T F;  1B33 N;  3HBL A;  1ENF A;  2L11 A;  2EDG A;  5FPO A;  3PUY A;  4NLG A;  4JBK A;  1BNC A;  1RDP D;  1Z2N X;  1HNW H;  1JCK B;  4JV1 A;  1M8A A;  1SND A;  3KOJ A;  4TVA B;  4QCL A;  2MJ8 A;  5M9O A;  3C0F B;  1O7I A;  5AJ3 Q;  4EBC A;  2B2U C;  2V58 A;  4RB3 C;  2A68 C;  4PG3 A;  2A8V A;  3PO3 G;  2I5H A;  2UXC L;  1XWE A;  1HRJ A;  3DHQ A;  2XGQ A;  2HUG A;  1QVC A;  1PK8 A;  4X62 H;  2ZM6 H;  1MSG A;  2KED A;  1KJ8 A;  3DF7 A;  5KRU A;  4RAY A;  1YNJ D;  1Q1E A;  4ZYS A;  5C1P A;  2YTX A;  3VA5 A;  5D8D A;  1UAP A;  5BN5 A;  3I90 A;  1YI2 A;  1QE6 A;  1F2Z A;  2J6S A;  2JE6 I;  3UDF A;  1E0B A;  4PNY A;  1TS4 A;  4DR7 L;  4NP5 A;  1Q86 C;  1WTO A;  3HOX B;  4A3L G;  1K9M C;  2NU6 B;  3CC7 A;  1RJR A;  5FLX L;  1SYX B;  4U6P A;  4HSV A;  4UP7 A;  2F03 A;  3ICE A;  3GTJ A;  5KIX A;  4A4I A;  2JA5 H;  2F0D A;  1E24 A;  4QW8 A;  2Q8T A;  3IAY A;  3H4D A;  3K7U C;  4IUQ A;  3Q6S A;  1K8A C;  1S40 A;  2CVR A;  2QK4 A;  3OW7 A;  4RFB A;  5KNB A;  4L5T A;  1WCM H;  3ITP A;  4HCE A;  3GQB A;  2HIX A;  3GTK H;  1V1P B;  1N9W A;  2QKI C;  4IPG A;  2VPQ A;  5IWA L;  4WJ4 A;  4WD3 A;  4X66 L;  2KUM A;  1LTS D;  5IWA Q;  1LT3 D;  1WD0 A;  4KI0 A;  1JB7 A;  1WJJ A;  3SK6 A;  2RCN A;  1X3Q A;  1CA6 A;  2RKS A;  4DR4 Q;  2ENB A;  3L7Z C;  2YTV A;  2F3I A;  3PV0 A;  1EFW A;  1TWF A;  4PWQ A;  1SN8 A;  3S14 B;  5DQG A;  2JYO A;  4B3M Q;  1E1T A;  2BE5 C;  1ILP A;  3BAA A;  3KF6 B;  4RH6 A;  1BQQ T;  2B2Y C;  5DQI A;  1MHW C;  4GC7 A;  2RDF A;  3KHR A;  1F9P A;  2R6G A;  2F3W A;  2O2L D;  4ZQI A;  5D14 A;  3P75 A;  2KJX A;  4MV9 A;  1B9M A;  3KBG A;  1G6P A;  2JP1 A;  2D0O A;  1QNU A;  3ERQ A;  4YY3 L;  1DON A;  1ZHS A;  2P0A A;  2NVY A;  1K0R A;  5IP9 H;  2OH2 A;  1JOK A;  4LF5 L;  2W7O A;  2XSC A;  5CMD A;  2JA6 G;  4GNX B;  1CKN B;  3QJY A;  5EPL A;  4DV7 L;  1Z9F A;  4QIW E;  2I80 A;  4HNU A;  3OMG A;  1EQT A;  3M4O H;  1JIH A;  3VR3 A;  1RYS A;  3TS2 A;  4RU9 A;  4NW2 A;  5EKI A;  3RMH A;  2CW0 D;  3SK4 A;  1IBM Q;  4CHT B;  3CQZ H;  5JJZ A;  4DV5 Q;  4HED A;  4BBS G;  3OYY A;  2SCU B;  3D8G A;  5LMU L;  5ELN A;  3R23 A;  4ZHQ F;  2M9V A;  1VQJ A;  2F4V L;  1EY9 A;  4NXM Q;  2OLS A;  4ED3 A;  2HIV A;  4AH6 A;  4YR3 A;  4A3K B;  5CA1 F;  1ZYR C;  1C3O A;  3OUU A;  3JZI A;  1A62 A;  3RR5 A;  3R2I A;  5DG8 A;  2DNC A;  1PTO H;  5E4W C;  1BCP B;  4OGQ C;  1PVO A;  5KFX A;  3AB9 A;  4EGJ A;  3RB0 A;  1HUM A;  1D8L A;  2JA9 A;  3G6E A;  3Q0A A;  2H5X A;  4AQY Q;  3S14 H;  1VF7 A;  2PQA A;  1Y8O B;  4F4Y A;  4AQY L;  2F0S A;  4IWX A;  3SI8 A;  4OEM B;  2NTT A;  1TWF B;  2L9H A;  1R9T A;  1V8Q A;  4Q8E A;  3URY A;  3L4K A;  1HNX L;  3FPP A;  1SFO B;  4DK6 C;  2R7Z A;  1H9R A;  2A69 D;  2ICE C;  4RGM A;  3MWE A;  2NVX H;  1W6J A;  1U4M A;  2E2I H;  3M3Y H;  3A56 A;  2O5I C;  3BQ2 A;  1EZ6 A;  2UUB H;  4K8I A;  2HJW A;  2VA2 A;  3GTK A;  1G2T A;  2E2I A;  2WDT A;  2E2H B;  2R93 G;  1KXL A;  2BR0 A;  1YIJ A;  4GN4 B;  4GC6 A;  4DK3 C;  3DWQ A;  3G71 A;  3A74 A;  3HOY B;  3KLS A;  2YV5 A;  3FKI H;  3M4O B;  1F2M A;  4JI4 Q;  2JEB I;  3L4J A;  1SR3 A;  1E2V A;  4GKK Q;  2R7D A;  4HID A;  4DKA C;  2I87 A;  5IYC H;  1V4Y A;  1RHP A;  2WE6 A;  2B39 A;  3OOC A;  4O0A A;  3A5U A;  2EYL A;  2F0E A;  1JDB B;  3G7L A;  1M6V A;  3ULL A;  5KND A;  5LMN Q;  4QWB A;  1X3P A;  3NEN A;  3GV8 B;  2C00 A;  4QWD A;  1I94 Q;  1LT4 D;  1EY8 A;  2X6G A;  5C5L A;  5T1G A;  2F4V H;  1PHJ A;  4K5V A;  1ET6 A;  4GS3 A;  1O78 A;  2EOT A;  3RD4 A;  4CJ0 B;  2H4O A;  4LF8 L;  5KFZ A;  4GN5 A;  1JE4 A;  4DR3 L;  3BYY B;  3R93 A;  4ILW A;  4DR4 H;  4G57 A;  5C0X H;  1OXU A;  1P16 A;  1D6E C;  4K8J A;  2E2H A;  3ETH A;  1GLV A;  3GTP A;  1Z47 A;  2YS6 A;  2VB3 X;  3R3O A;  1VQL A;  4KV6 A;  4JI3 L;  1PFB A;  3BZD B;  3KYH C;  3S9W A;  4B3T L;  4HN7 A;  1OXX K;  1SE4 A;  2AHO B;  4WRD A;  1A8V A;  4A3I H;  4N8X 1;  4IO9 A;  4C3J H;  2YU9 A;  3RB3 A;  2M05 A;  1BXR A;  1KDC A;  1GUT A;  1GHK A;  4QF4 A;  3X3M A;  3SE7 A;  2IBK A;  1S0M A;  2R86 A;  3RLN A;  4JYA H;  4RGT A;  1FYC A;  2IX3 A;  1RKN A;  3EBE A;  4DFA A;  1KRT A;  5LHY 1;  5M3F B;  3WO0 A;  5KFE A;  2XIW A;  3CRL C;  3FEW X;  2J4X A;  3D6W A;  1ONL A;  2JQO A;  1EUJ A;  4FP5 D;  4MIU A;  1B3A A;  4JI2 L;  2AQ1 B;  4J9L A;  3OMC A;  3F2C A;  5KT6 A;  3GTO B;  4OEL B;  1VQP A;  5DNF A;  4GKJ H;  3S17 B;  3T1Y H;  1W6K A;  2Z8L A;  3MXP A;  4G7Z C;  1VS0 A;  3K5N A;  2VUM B;  1N48 A;  2Q2U A;  5JUM A;  1C4Q A;  4DAP A;  5CC4 A;  4K5W A;  1K83 A;  4R8U A;  3NE5 B;  4NXN H;  5TSS A;  4MV6 A;  1KJI A;  3WNZ A;  2VB2 X;  5D3D A;  1EZ8 A;  3KDF A;  1VQ9 A;  1TXY A;  2F3V A;  4X64 L;  2R7Z H;  4J6H A;  2HVQ A;  2UXB H;  1B7Y B;  4CKE A;  4NKL A;  4QUC A;  1PFN A;  4C56 C;  1N33 L;  1I3Q A;  3CRK C;  2R8I A;  4FF1 A;  5CGK A;  3TQT A;  5HBR B;  3DMU A;  5J3B A;  4LFA L;  4C3H G;  4QGU A;  3SHL A;  3BDC A;  2UUA H;  1LTL A;  2UXC H;  3NHH A;  3K5I A;  3H20 A;  4A93 H;  4JI7 H;  2IJ0 A;  2LXJ A;  4H13 C;  2I5L X;  1ICW A;  5I2X A;  1X9N A;  4LF4 L;  1K8O A;  4JI4 H;  4OO1 H;  2F0U A;  5EPJ A;  5KYL A;  1GXD C;  4K0K H;  1LM0 A;  2FLN A;  4R4C A;  1EY4 A;  4RNO A;  1GM5 A;  3J7A K;  1L1O C;  4GLA C;  2EJG C;  3QB3 A;  3GV6 A;  1XPR A;  2XC9 A;  3GIL A;  1QWY A;  1CT1 D;  3JC6 6;  3MWY W;  3J80 E;  1G29 1;  4HJ7 A;  2XN9 C;  3TME A;  4XQN A;  2WB1 A;  1TS2 A;  1EYG A;  2OXP A;  1WSC A;  3MWD A;  3GTG A;  4P72 A;  4XQJ A;  1R9T H;  5EJW A;  4A3I G;  5DM6 3;  3GTO H;  2ATW A;  1E1O A;  1PYS B;  1X54 A;  2JA7 H;  4G7H C;  3NEM A;  4KKT A;  2VQE L;  3SGI A;  1PLF A;  1SNQ A;  4O3R A;  4FBU A;  1N33 H;  1PRT D;  3BAB A;  4O4H F;  4ED8 A;  5C4X G;  1Q8I A;  1VMP A;  4B08 A;  2RF4 A;  1VQN A;  2I8C A;  5KX5 F;  2R93 H;  2DLN A;  2HT1 A;  4OIK A;  5JJL A;  3QO2 A;  3DWA A;  1HFN A;  3J7A F;  2NVQ H;  2WV6 D;  3DXJ C;  5CBA E;  1TWC H;  5K5P A;  5T1I A;  1S5E D;  3RAX A;  3BZK A;  1LT5 D;  1SLJ A;  1D1I A;  1JC7 A;  2PW7 A;  5CV5 A;  4JI2 H;  5CR3 A;  1E7Z A;  4X65 L;  2D2C C;  4YCV A;  1STB A;  2YYZ A;  3J81 L;  4LMY A;  1XMO Q;  2DGY A;  2A5H A;  1A3T A;  2R7Z G;  3PO3 B;  3HB9 A;  1SYC A;  5KFY A;  1HNZ L;  3J80 W;  1YIT A;  1LT6 D;  2ASL A;  4JOI A;  1FL0 A;  4YIJ A;  4JV5 H;  4MTN A;  4RG1 A;  1FVI A;  3VA7 A;  1X3G A;  5KFH A;  1T36 A;  3PUW A;  3S1R H;  5J2U F;  5G3L D;  1ULZ A;  3HOZ B;  1IL8 A;  2F0V A;  1TT2 A;  1G91 A;  1LYL A;  2JA5 G;  1CE8 A;  4KK7 A;  3GV7 B;  3GQC A;  5KG3 A;  2V9W A;  1GUS A;  3K0Y A;  5IGG A;  1Y8P B;  2RA4 A;  5IGC A;  3HOV H;  4LWC A;  1HH2 P;  3IL8 A;  4WBN F;  1YEZ A;  1V1Q A;  4QQB X;  2W57 A;  4U7C A;  3N44 B;  3RZO H;  4BY7 H;  2UUC H;  2VY3 A;  4DAY B;  4PDB A;  2ZDG A;  1LV9 A;  1O7Z A;  2QYZ A;  1T3N A;  4B3R L;  4K2K A;  1I7L A;  4DV7 H;  4KHP H;  3RLF A;  3BQ1 A;  1JQY D;  4DK0 A;  5M5Y B;  1YNJ C;  2Y0S A;  2IX0 A;  4E4T A;  3EN2 A;  1EYC A;  1STA A;  1HR0 W;  1EWI A;  4A3E B;  3N52 A;  1PXU A;  3PUZ A;  1DJR D;  4IUP A;  1L0Y B;  1FR3 A;  2V4R A;  2VPS A;  4K6L A;  3SVM A;  3K3V A;  4KD4 A;  4POG A;  1L1O A;  2NWG A;  4KN4 C;  2FKL A;  4OWW B;  3GTP B;  4B3T H;  4R7R A;  1S10 A;  3VYU A;  1LTG D;  4XIG S;  1XX8 A;  2YYA A;  3KHH A;  4J9P A;  4CKB A;  4LFB Q;  1HNW L;  1GSA A;  1SYB A;  1KJ9 A;  3RTX A;  4DV4 H;  2AQ2 B;  1IBK Q;  1ESF A;  3K6O A;  1LTA D;  1CI3 M;  1QJO A;  1PTO D;  4X65 H;  4LNQ A;  1TY0 A;  3VR6 A;  2F1M A;  5IP7 H;  4MV8 A;  4IAL A;  2Q2H A;  3J80 L;  3GTL A;  3R8B A;  1YZ6 A;  4MV4 A;  3IG0 A;  2GN5 A;  5KT5 A;  2VUM G;  4ME5 A;  2RDJ A;  1DD2 A;  3SXH A;  1N8R C;  2W9B A;  5IYB H;  3LGJ A;  1S3O A;  3LWE A;  3KAL A;  1LTB D;  4M1U B;  3H09 A;  5GON F;  4C1N I;  4DR2 L;  4LF6 H;  1JDE A;  3DM3 A;  1HZA A;  2F0G A;  2K5V A;  4IUV A;  2R7M A;  5C4H A;  1I4R A;  3VMM A;  1M1K C;  2ZXP A;  5C5J A;  3HKZ A;  5M5W H;  4GN3 B;  5DAU A;  1KAA A;  4O1N A;  4C2M H;  4H0L C;  2L12 A;  4ED2 A;  3HXL A;  2ZDQ A;  4LFA Q;  5F9N A;  4JBJ A;  2GVB A;  2DZD A;  4YY3 H;  1XMO H;  3OTO H;  5EBC A;  5JPM C;  3G6X A;  2F52 A;  2ATL A;  4UP8 A;  2K50 A;  4J9Q A;  4R8N A;  3MEF A;  1N36 H;  1DZ1 A;  1I6U A;  1UNS A;  3UDG A;  2J0T D;  4EGV A;  3D3R A;  2N49 A;  1S5C D;  1AE2 A;  3H3V H;  2ASD A;  4K6D A;  2W6M A;  5CV7 A;  1PDQ A;  1KD1 C;  4IJH A;  4BA1 I;  2E5L Q;  4RNM A;  1RL2 A;  4WOR A;  4NB3 A;  1TWH B;  2UXD L;  4A2B A;  1TQO A;  1I94 L;  3S2H B;  1JR0 D;  5C0X J;  4YWK A;  2BOS A;  2JN4 A;  4FXK C;  3VPB A;  2KOL A;  1A2T A;  2EYJ A;  2VL6 A;  4DA2 A;  5JVH 3;  3RZD B;  3TII A;  4ED0 A;  1GSH A;  2GVA A;  4DV4 L;  2OQK A;  4FF2 A;  1Q7Y C;  2EPB A;  1I4H A;  3NUC A;  4R8I A;  5GAD C;  3U9T A;  5IT9 c;  2XD4 A;  3NXW A;  3T4A C;  3J81 i;  3HOY G;  1JKJ B;  4DN4 M;  1SSO A;  5FKA C;  4EQN A;  2R8J A;  2BQR A;  1C0A A;  2C2R A;  2R6F A;  2Z1C A;  1U4P A;  1CSP A;  3H6M A;  1BUV T;  1IBL L;  3S2D B;  2B63 B;  4DV1 L;  2DIK A;  2R61 A;  1JXL A;  4F50 A;  2KSW A;  3M4Y A;  1X65 A;  4DV1 Q;  4DL2 A;  1HJP A;  3EJI A;  4N9P A;  5FO8 B;  5IYB G;  3F8N A;  2EY2 A;  2K01 A;  5KG6 A;  4A3D G;  3UQ8 A;  3M4P A;  1GHJ A;  4QB4 A;  4DAV A;  4RB1 A;  3H0G H;  4C2M B;  1XNQ H;  3EYY A;  1JMC A;  4TUY F;  1UC8 A;  2B29 A;  3RUP A;  2LY7 A;  1DGS A;  2R7F A;  4A3D H;  1TKW B;  3QOL A;  1TVX A;  5KFN A;  4KHZ A;  3JAM i;  5CB4 F;  1V1O A;  3ORR A;  3HOV B;  5IYZ F;  5C4Z A;  2R7K A;  1ENA A;  2X0S A;  1SEB D;  1ZKO A;  5DG9 A;  2YS7 A;  4NXN Q;  2IWH A;  1PH1 A;  5L1I A;  1N34 H;  4Q5V A;  2R7Z B;  2B2V A;  3NBH A;  2C35 B;  1K83 H;  2E5L H;  4QWE A;  1KC8 C;  5M5X H;  1KNA A;  1E2W A;  2Z4I A;  4HQ6 A;  5C4J H;  4A3F B;  1NUC A;  1PRT C;  3BJU A;  3J80 c;  4UCU A;  4RAU C;  3SDZ A;  3MXU A;  2R87 A;  4J15 A;  1LLR D;  1EIH A;  1VQ6 A;  2K14 A;  4HMJ A;  4FNF A;  3CVZ A;  3H94 A;  5LA6 F;  4LUV A;  2UVW A;  1PH6 A;  2A1A A;  5LXT F;  4JI1 Q;  5KFM A;  1I50 H;  4J0M A;  3T56 B;  4DR1 L;  3H40 A;  2RGV A;  4FS1 A;  3QG1 A;  5FLM H;  3Q1K A;  3AQQ A;  5JVD F;  3GIQ A;  1GSO A;  1PTO C;  1NMG A;  2E75 C;  3GO5 A;  3D4D A;  1M0T A;  1NBW A;  1F9R A;  4IJL A;  3WO1 A;  1Y1W G;  3S2D H;  4RB2 C;  5C4X H;  1IBL H;  2EZV A;  2A68 D;  2XRS D;  3U4Z A;  4ODG A;  4A76 A;  4Q0Y A;  2E2I B;  4DV1 H;  1VBG A;  3TP5 A;  3GV5 B;  1T94 A;  4TQR A;  2EQS A;  4EG0 A;  4JCV E;  1C7Y A;  3RIZ A;  4QY7 A;  3P1H A;  1WFQ A;  1SNC A;  1CKN A;  3TZU A;  1YJW A;  2BE5 D;  4AYB G;  4A3M G;  1BNZ A;  2YRW A;  2KBN A;  2N55 A;  3BJY A;  3FMC A;  1FJG Q;  4LJZ C;  4ULL A;  1E4E A;  4A3B B;  1UE5 A;  3HOU B;  1UWV A;  2MP1 A;  3NQI A;  2PO4 A;  3NWS A;  1KDB A;  4UCV A;  3I4N B;  1BCP F;  2Y0S G;  2K05 A;  2PQA B;  4B3M L;  1EZ1 A;  1WTH A;  2NVT H;  4FXD A;  1QOH A;  4DV2 H;  2R92 A;  1VQC A;  3KF6 A;  4OXP A;  1SNO A;  3M9M B;  2EYP A;  3ZJY C;  4GZY C;  4I7A A;  2K5W A;  5IYD H;  3AU7 A;  1TS3 A;  2K32 A;  2Q2T A;  1E4E B;  4LAA A;  1MI2 A;  5D65 A;  1STY A;  4JI1 H;  4KN7 C;  4EEQ A;  1X32 A;  3FPU B;  3RLO A;  3TDQ A;  1GYF A;  4FBT A;  2HD3 A;  3GD7 A;  1SYG A;  1CHP D;  2Z6B A;  1J5E H;  3S1Q B;  3OHA A;  2QEJ C;  2B8G A;  5IE8 A;  4HJ9 A;  1WR2 A;  3OSP A;  4BWG B;  1IYU A;  1Y1V G;  4DNR B;  4X3T A;  5KFU A;  4FF4 A;  1Y1W A;  3S16 B;  2OT2 A;  4YAK B;  3V6J A;  1QG7 A;  2W6P A;  1NJI C;  4JV5 L;  2E2J H;  1TWF H;  3OWF A;  4JVZ A;  2F0J A;  4QL5 A;  1EY6 A;  3T1Y Q;  4NXN L;  5EZY F;  3G6V A;  3S17 H;  3W2D A;  2JEF A;  5LOV F;  3T1Y L;  3GIP A;  2HDM A;  4X3K A;  1QVF A;  3DEO A;  2F0L A;  2NZO A;  1M90 C;  3M4Q A;  5HY6 A;  2BCO A;  2ZXR A;  3L3O C;  4IR1 A;  3MHB A;  3OWE B;  1D7Q A;  1UEB A;  2KCM A;  4H44 C;  4RMF A;  3NTK A;  1Z2O X;  1KC7 A;  1VDZ A;  5KFD A;  1QUQ B;  2UXB Q;  3T16 A;  2AUJ D;  3N8D A;  4RKB A;  3TS0 A;  4KHP Q;  2YRX A;  2CH4 W;  4O4L F;  1VQH A;  5JOB A;  5JPN C;  3RN2 A;  4BA2 I;  2W9A A;  3QR8 A;  4DR6 Q;  5KG7 A;  4ECZ A;  4IUU A;  1B44 D;  3K5M A;  1ML0 D;  1KJQ A;  2F0H A;  1IKM A;  2CQO A;  1EHI A;  1ASZ A;  2WFW A;  1CS0 A;  5IT9 W;  1SNP A;  3Q8P B;  3OPO A;  4I55 F;  4LW1 A;  4I65 A;  1SE3 A;  2RVL A;  3CQZ A;  5C0X G;  3KJO A;  4RAZ A;  2XTI A;  4DUZ L;  1SXT A;  4QIW B;  3S1Q H;  1MGS A;  1JB3 A;  2HHH L;  4X3U A;  1J8I A;  1KL9 A;  5JQW A;  2B8F A;  3I7F A;  2KHS A;  2IP4 A;  2PI2 E;  2IY5 B;  3OSO A;  4YHH Q;  4EQO A;  1X3F A;  5CA0 F;  2F4I A;  3E6Z X;  1RJT A;  3CCU A;  4XYM B;  4O2A F;  1SRO A;  3HOV G;  2UXD Q;  4BBR B;  1IBK L;  2B2T C;  3VR4 A;  3JAM c;  5DQH A;  4DV6 H;  1XDN A;  2K75 A;  1F9S A;  3S1M B;  1CQV A;  4B3M H;  2AQ4 A;  5HGQ A;  3KFU A;  5K36 H;  1UNN C;  4GKJ Q;  2DUD A;  5L1J A;  3JSN A;  5KFA A;  3U58 A;  1ICF B;  2WTF A;  1PFM A;  5HV6 A;  1FNV A;  5FJ8 H;  4A3E G;  4JI0 Q;  1NTG A;  1VQ4 A;  3GP7 A;  1XPU A;  4DV3 H;  1JOR A;  4R8U B;  5GAH C;  2PZW A;  4S3S A;  4FVM A;  1W96 A;  1QB5 D;  1YNN C;  3LML A;  4PMC A;  3J80 i;  4L8J A;  3VYR A;  1E22 A;  1JOQ A;  3I56 A;  1VQ8 A;  2RDI A;  3EPG A;  3SK5 A;  1K3R A;  3VYS A;  4DL3 A;  2HQL A;  2FXQ A;  5M3F H;  4HJ5 A;  4RNN A;  2C2D A;  3MJF A;  2I07 B;  1KDA A;  2K1B A;  3KLR A;  4JK1 C;  4CDC C;  4R4I A;  2NVX A;  1I4X A;  2R3Z A;  2ZTE A;  2UUB L;  3FKI A;  4LSA A;  1SJH D;  2MUY A;  1SJE D;  2MHV A;  4KLK A;  1I4P A;  1TWC B;  1CQF A;  4ED7 A;  4PZ8 A;  3N41 B;  1G51 A;  4MV7 A;  5ELC A;  2RHQ B;  4DUY L;  1EEI D;  1ZEQ X;  5KNC A;  3G4S A;  3PW5 A;  4O2B F;  3J7A V;  4JV5 Q;  2ZM6 L;  1SYD A;  3GV3 A;  2G9D A;  3H0G G;  3GTL B;  4OX9 H;  3UE1 A;  4GOP A;  2M00 A;  3NPP A;  3HOX G;  3PN1 A;  4Y8V B;  1AW7 A;  1SYE A;  2EYO A;  1DM0 B;  3RN5 A;  1UEA B;  1SAP A;  4MHE A;  1PRT B;  3MR3 A;  3FDS A;  2RSO A;  4OL7 A;  1MKH A;  1F2Y A;  5GAG C;  1EU3 A;  1XTD A;  4IQZ A;  4B9X A;  3HOX H;  3KHL A;  2W8K A;  2GLT A;  1I4G A;  4A3B G;  3N6X A;  1PYW D;  3VDY A;  3I4M H;  1GKH A;  3CP0 A;  3RUZ A;  3S1N B;  3CCE A;  2A6H D;  4K14 A;  5FOB B;  3ND8 A;  2KQ3 A;  1ASY A;  4LF7 Q;  4CDE C;  1GUW A;  4A3J H;  5DGB A;  3KLW A;  3ULP A;  4APM A;  3VYT A;  4RWS C;  5ELF A;  2J9G A;  3RV4 A;  3J81 W;  3MAQ A;  4DPG A;  1VQA A;  2JEA I;  5KKN B;  5FD6 A;  3S16 H;  2JA8 H;  4AYB A;  5C0X I;  5KFJ A;  5I6Y A;  4P73 A;  1Y1W B;  5C3X A;  2JA6 A;  1EL0 A;  4LF4 Q;  1VQ5 A;  1VF5 C;  1Y1V H;  4Z9C B;  3G6J B;  4J9R A;  1JT8 A;  1B6R A;  1RK6 A;  3H15 A;  3RF2 A;  5GQO A;  2ZTC A;  1L0X B;  5C3E B;  4HR7 A;  2QEX A;  1UE7 A;  3VPC A;  4YHH H;  3FDT A;  1Q1B A;  1RYR A;  2L0C A;  5EKL A;  1XMQ Q;  1J9O A;  2WAQ A;  1IZ6 A;  1SMX A;  5DLF A;  1KJJ A;  3FMA A;  2FPI B;  4ZUI A;  1L2Z A;  4QWC A;  4DUY Q;  2WKD A;  1MJE A;  2R85 A;  4GKK H;  1TWA A;  1JJ2 A;  1T9H A;  1S72 A;  1EQQ A;  1XTC D;  2NVQ B;  2R8H A;  5IOC A;  4JW0 A;  1S97 A;  2ALZ A;  1I5F A;  1Y8N B;  3V6H A;  2EE1 A;  1DOL A;  3JAM L;  3GTM H;  5JH7 F;  1I50 B;  1DOM A;  4CDF C;  3GTQ A;  1K1Q A;  3AFQ A;  4ID6 A;  1D5X C;  3RBD A;  4HJ8 A;  4A2A A;  3NWT A;  1B70 B;  3ONA B;  2F0F A;  2XNA C;  4ECV A;  4WJW A;  2UU9 Q;  3PR4 A;  2HVS A;  4N9T A;  4HNV A;  2VQD A;  1RTO A;  1H95 A;  3F2B A;  3Q8S B;  4DR2 Q;  4LFC H;  4MV1 A;  1PX2 A;  4X66 H;  4JV0 A;  4PZ6 A;  4G7O C;  3FHW A;  2BDO A;  3I4M B;  1ILQ A;  4C3I B;  1D5Z C;  4IZ8 A;  1B50 A;  3Q22 A;  1B53 A;  1OXS C;  4LF5 Q;  2XWB B;  2K5N A;  3KXY T;  2JA5 A;  1SFO H;  4IRD A;  1RF2 D;  1Y1V B;  2JA5 B;  4FYD A;  2V59 A;  2OTJ A;  3SK8 A;  3MFI A;  2PW5 A;  1GUN A;  3CW2 C;  4ZKB B;  4GLX A;  1LTI D;  2MO1 A;  1D5M C;  3G6Y A;  4LF9 L;  5ELB A;  4A3J G;  1CKM A;  3QFF A;  4GLV B;  2MGS A;  3K8A A;  4L5S A;  5IY0 A;  1JLL B;  3RBE A;  1GVP A;  3TIN A;  2R7L A;  2VNU D;  4I7H A;  2PZU A;  3T5J A;  1IYJ B;  1FJG L;  4BXX H;  3MXN B;  2OCE A;  1BBU A;  1X56 A;  2JA7 G;  4DU9 A;  1ET9 A;  4LH7 A;  3LX0 A;  3LNN A;  1HNX H;  4CC5 A;  1P8L A;  4X62 L;  1S0O A;  4A3F G;  1UC9 A;  3E5S A;  4M7E A;  3NBH B;  2E8G A;  1HXY D;  4KMU C;  4ALP A;  2VQE H;  5KFP A;  3RZD H;  3ETJ A;  5BPH A;  3GTM B;  1AZQ A;  3F2U A;  2E2H H;  1BBW A;  3HG9 A;  4C3I G;  3M3Y B;  2QDB A;  4YWL A;  5KFT A;  5HGT A;  5H1S E;  1XNQ Q;  4C3I H;  2W9C A;  1A6X A;  5FLX W;  5KFW A;  1S5F D;  5KFR A;  2RHS B;  4QUF A;  3V4S A;  1DIK A;  2C9O A;  4RGN A;  3VPD A;  1W93 A;  3BZC A;  3BA8 A;  5T14 A;  2PYK A;  1KNE A;  2J6T A;  4ED1 A;  5I47 A;  3MTS A;  4JG2 A;  4Y7N B;  1BOS A;  1I6H H;  2EXZ A;  1U9R A;  2A6E C;  3NTH A;  5KEE A;  4LF9 Q;  5KFI A;  4AYB B;  2IX1 A;  5M5W B;  4A3M B;  2NU7 B;  4OWT B;  1AN8 A;  2GPS A;  3CC2 A;  3A0J A;  2UVR A;  5CV6 A;  4EX5 A;  5KG4 A;  3KDF B;  1DCZ A;  3UI2 A;  1EFI D;  4FU0 A;  2F0N A;  4EVO A;  1TY2 A;  1SNM A;  3TP7 A;  1HCZ A;  4DV0 L;  3T53 B;  1QZG A;  2JSO A;  1S4Z A;  2CWP A;  1EOV A;  4IOC A;  1UUP A;  5CBE E;  2L1B A;  2K4K A;  4PMB A;  1TR5 A;  1LTR D;  3CCR A;  1Q8K A;  4JI3 H;  2NZH A;  2A19 A;  3MFG A;  4A3G B;  3UDX A;  1N56 A;  2AU0 A;  3R2T A;  5FJ8 G;  1I3Q H;  2JJQ A;  2EY1 A;  1KLU D;  3KAK A;  1C9O A;  5J39 A;  1E3P A;  3CKI B;  4L1K A;  2UU9 H;  3H3V I;  2C5C A;  4RUC A;  2CQY A;  1WTR A;  5M3M B;  2QF7 A;  1Z7T A;  1GO3 E;  5BN3 A;  3Q24 A;  4IFD J;  1BDO A;  2VQF Q;  1V9P A;  2SOB A;  2YU9 B;  4DR5 H;  2NVX B;  2AUK A;  2PPB C;  1D1K A;  4C2M A;  1K73 C;  2ZM6 Q;  3KTM A;  2P5Z X;  3PUX A;  1IW7 D;  2R82 A;  2VOB A;  2HCI A;  3M7N A;  2CW8 A;  2G5D A;  1CTM A;  3I3C A;  4IUN A;  4RHS A;  4OON A;  1XMQ L;  5KG1 A;  2E5L L;  2NUC A;  1VQ7 A;  4LH6 A;  4YJ2 F;  4LFB L;  4V19 0;  1HNW Q;  3MFH A;  4BS9 A;  3D31 A;  3I2Z A;  1MSH A;  4G4K A;  2XGT A;  1JWM D;  2NBF A;  3ULJ A;  2ASB A;  3I4N H;  2V4D A;  4JI2 Q;  4A3M H;  1LTT D;  2VUM H;  1VQM A;  2QDL A;  3JRW A;  2O5J C;  3E3X A;  2F0O A;  4NXM L;  3OSN A;  4J8Q A;  5DM7 3;  3ND9 A;  3X3N A;  3BVM A;  1JJC B;  5A2Q L;  4A3D B;  1MIU A;  3TQY A;  1W2B A;  2PN1 A;  4DR1 H;  4B3S L;  1SMY D;  1EUD B;  1H9J A;  1FD7 D;  2O4X A;  4DV6 Q;  1I94 H;  2ZJT A;  3W1B A;  2WAQ G;  2VW9 A;  4B3S Q;  1IYV A;  1EYA A;  1C48 A;  4EGQ A;  3LWB A;  1RK5 A;  4XYO A;  5FO9 B;  5EWG A;  4POF A;  4ECR A;  1BCP D;  4JI8 H;  1S68 A;  5I4D A;  1WCM B;  3K80 C;  4JI3 Q;  4R4Q A;  2F0P A;  3GTK B;  3ERS X;  4IAJ A;  4DV7 Q;  5KFQ A;  1EIG A;  4QW9 A;  5KT7 A;  5M3M G;  3HOW H;  4AQY H;  1Z2P X;  2CWA A;  1M7J A;  1QCB D;  1B8A A;  2FFK B;  4U68 A;  3DUZ A;  3T5H A;  5M3M H;  3HOW G;  2W71 A;  1H9M A;  3LP8 A;  2NN6 I;  2V5A A;  1OTC A;  1W3S A;  4O2D A;  3A7A B;  2IT1 A;  3BQ0 A;  1II3 A;  2XRQ D;  3CD6 A;  4IUT A;  3C46 A;  1FKA H;  4NPS A;  4A3J B;  5C4X B;  5DGA A;  1CA5 A;  3CCQ A;  2M2L A;  3BU2 A;  1PA6 A;  2KEE A;  4JI6 Q;  3MFY A;  4HMI A;  1AZP A;  1RJP A;  2FP4 B;  2IW3 A;  3WWV A;  3CCL A;  5I9O A;  1A9X A;  2KVM A;  2FHT A;  3MVV A;  3E9I A;  4CGY B;  3EVQ A;  4LF9 H;  1C30 A;  2UU9 L;  2JA7 B;  3K5L A;  1XNR Q;  1CZW A;  3PW4 A;  3PIP A;  2CW0 C;  2NVY H;  4MA5 A;  3CPW A;  1XNR L;  2EY5 A;  2UVU A;  4Q8F A;  1EY7 A;  5NUC A;  1GUO A;  3VR5 A;  5C3E H;  2AWO A;  5LL6 X;  3GIM A;  5ISR A;  4YR0 A;  1ZET A;  3BVG A;  2D0P A;  4UCS A;  2MO0 A;  2QCP X;  1XMQ H;  2K52 A;  1K8M A;  4DL5 A;  1V43 A;  4GNX A;  1I4Q A;  3MEH A;  2LFN A;  2LSS A;  4LFC L;  4EYH B;  1BJT A;  4X6A H;  4OO1 G;  3U4V A;  2JEJ A;  3NP8 A;  2ICI A;  1S5D D;  4JI8 L;  3SR1 A;  2Y0S E;  5IYD G;  3SE0 A;  3G48 A;  1RCV D;  4V0B A;  2ZDH A;  2PMZ E;  1LAB A;  1TWA H;  4A93 G;  1EY5 A;  3ER0 A;  2EYM A;  3BG3 A;  5M5Y H;  3NSW A;  1KAW A;  1HQR D;  1G2S A;  2DN8 A;  2WYO A;  1YJ9 A;  1HZ9 A;  3S2H H;  1LUZ A;  1T5E A;  3AYH B;  4ZRZ A;  2JXM B;  4TQS A;  1Q12 A;  4P2C B;  4LF8 H;  3CME A;  1MJC A;  3D6C A;  3MC0 B;  1G6Z A;  1IOW A;  5DG7 A;  3PSI A;  2A69 C;  2R92 B;  3UFX B;  4CKC A;  4NDX A;  2UUC Q;  4BY7 G;  4CC6 A;  5LL6 S;  1I7N A;  3K58 A;  4R1J A;  3GTQ H;  1SRU A;  5C5M A;  1D2B A;  3EPI A;  3PIO 3;  4F87 A;  1A3U A;  5EBD A;  2W6Z A;  2CQA A;  3CCJ A;  3GTG H;  5FLM G;  1A15 A;  1V51 A;  2JEG A;  3I8Z A;  2RBM A;  1QVG A;  3F8T A;  3MXN A;  2GA4 B;  4B3R H;  2FB9 A;  2PQE A;  1IBL Q;  1I50 A;  2R93 A;  4XQQ A;  1QNK A;  2BA0 A;  3N43 B;  2OWO A;  1S0N A;  1K8G A;  3H4B A;  1N33 Q;  5LMN W;  1Y69 U;  1NNX A;  1ZQ7 A;  4ECQ A;  3IN5 A;  3GTP H;  3F1Z A;  2KCN A;  1E4F T;  4ED6 A;  1WTQ A;  1BVS A;  3M9N B;  4RCN A;  4E6I A;  5C3E G;  2NB0 A;  3K81 C;  4XT3 B;  5LL6 b;  1U4L A;  1B6S A;  2YZM A;  4IZO A;  2VZA A;  3HP3 A;  4YB8 B;  4JV2 A;  4OO1 I;  5LMN H;  4UY8 C;  3PR5 B;  2V1C C;  4HIK A;  2MPM A;  1VQG A;  3TQ1 A;  4YCU A;  5IGD A;  3MWM A;  1HNZ Q;  2F4V Q;  4YHH L;  2AWN A;  3HGB A;  3OIQ A;  4X3S A;  2UXC Q;  3AFP A;  4ZOL F;  1KIX A;  5J1Z A;  2DPI A;  4C3H B;  3J7Y W;  2AGO A;  1XNR H;  2WB1 E;  4DV3 L;  2IHF A;  1EQV A;  1IXR A;  2A73 B;  3W5O A;  2RDH A;  1TWG A;  5C8Y F;  4DF7 A;  4UDU C;  1IW7 C;  4MZ9 A;  3V2T A;  2V4Q A;  3T1H H;  2Q8I B;  5D1O A;  1HPC A;  4IUR A;  3PIO A;  3P20 A;  2PBZ A;  1B3Q A;  3D4R A;  3S1R B;  4C5C A;  4JI1 L;  4A3K H;  1STG A;  3GTQ B;  4XYL B;  4JI0 L;  5DLQ E;  1RIP A;  4A3G G;  2F0K A;  2VS1 A;  1SYF A;  3S15 B;  2O03 A;  3GTG B;  5EQ0 A;  4YY3 Q;  1VQK A;  4BBR H;  4DLK A;  5BMV F;  3PZP A;  1CQI B;  4L5R C;  4HIM A;  3TRE A;  5J22 A;  4B3R Q;  5ELO A;  3E0E A;  3S1M H;  3E5N A;  4BBR G;  1N32 Q;  1MBY A;  4RB0 A;  1O7Y A;  3PMF A;  1HFG A;  1N36 L;  1S9F A;  3S24 A;  4K0K L;  2FMM A;  2QGQ A;  4I7Z C;  4IPH A;  2Q2I A;  1M0W A;  4JI7 L;  4TQU S;  3DEP A;  2PMZ A;  4I4T F;  4TV9 F;  4F88 A;  1RD9 D;  3J7Z C;  5KG5 A;  2HHH Q;  5CAE B;  4HAE A;  3KLS X;  4HSP A;  2CCZ A;  2BDN A;  3HOW B;  3HKS A;  3FKI B;  2KHJ A;  4MTD A;  3KF8 A;  1HZB A;  1OO9 B;  3C1F A;  5C44 B;  2FLP A;  5LMN L;  2FIN B;  2HGS A;  3R5X A;  1HZC A;  4J9O A;  1EU4 A;  5IOD A;  5KFF A;  3BDL A;  2YZN A;  1PZI D;  2W6Q A;  3M4I A;  4KTA A;  3TP6 A;  3PGZ A;  1BBX C;  1HR0 H;  4ZQ3 A;  1U0L A;  4ZCK A;  2L4N A;  4DL6 A;  5EAY A;  3T1H L;  2B63 G;  3P7J A;  3CMA A;  4YJ3 F;  4J9M A;  1PH5 A;  2BQ3 A;  1VQE A;  3HEJ A;  4B3S H;  2XCP A;  1ZXT A;  3MR6 A;  1T5X D;  3M7G A;  3GTL H;  1RJQ A;  4DR6 L;  4G3I A;  2RQX A;  5KFG A;  1CM9 A;  4DL4 A;  2EYF A;  5C4J B;  4CDD C;  1CHQ D;  4EFB A;  4O42 A;  3H0G B;  2BQU A;  1IKL A;  4GNX C;  2PMZ B;  3K3P A;  4DV2 Q;  3CCM A;  3L0O A;  4PV1 C;  3IRB A;  5KG2 A;  5EWE A;  3M9O B;  3I91 A;  2B2W A;  5IGB A;  4AIM A;  4DAY A;  1A63 A;  4JI7 Q;  2E2J B;  5JJI A;  4C3J B;  1EYZ A;  3D0F A;  3OUZ A;  3PW0 A;  1NY4 A;  2TSS A;  2A6H C;  4L5Q A;  4JBW A;  3HKZ G;  2L55 A;  4Q44 A;  2VA3 A;  2VQF H;  4FF3 A;  4DV5 L;  2WIN B;  1R9T B;  2E74 C;  2EJF C;  4F7X A;  5LMU Q;  4DUY H;  4ECW A;  2UVV A;  2L15 A;  4DR4 L;  3A7L A;  4DR3 H;  4TV8 F;  4IRK A;  4NXM H;  1QUQ A;  3A8I E;  3Q8R B;  2OQ0 A;  4WJ3 M;  1BKB A;  4K5X A;  1K1S A;  2CW7 A;  2PNR C;  5ELE A;  4DV3 Q;  5C6A A;  4QJF A;  4ABN A;  3KK7 A;  3A5Z B;  1CSQ A;  2TMP A;  2R92 G;  4OIJ A;  1EYD A;  1H9K A;  4YBZ B;  1DOK A;  1XXG A;  1AUX A;  4YCW A;  5M3F G;  4DV6 L;  1PH3 A;  3KJP A;  2R92 H;  1ZHQ A;  2W6O A;  4UCR A;  1VBH A;  2SDF A;  1VQI A;  2W6N A;  4J1M A;  1PTO F;  3CC4 A;  4N8F A;  3PO2 H;  1UE1 A;  3I72 A;  2NVT B;  1HA6 A;  4O3O A;  4JC0 A;  4B3T Q;  1KRS A;  1B04 A;  2K5D A;  2EYH A;  1F77 A;  2XWJ B;  5IP7 G;  1YHQ A;  1VKZ A;  1WTX A;  3TN2 A;  1U5K A;  3JSL A;  1STH A;  2K04 A;  5EPK A;  4JI8 Q;  1E4G T;  3TEH B;  4O3S A;  5IIF A;  3WOE A;  3U50 C;  1SBB B;  3E0J A;  5LP6 F;  3I4N G;  3K59 A;  4UHV A;  4ME6 A;  2Y0S B;  5I2Y A;  2B63 H;  5L1L A;  1BR9 A;  4CJ2 C;  5JVL A;  1N32 H;  4EYI B;  4ECT A;  3I73 A;  3BDO A;  5IT9 L;  4HTH A;  1AP0 A;  3GII A;  4EFE A;  2CFM A;  2ZXO A;  2H1E A;  4DV0 H;  2AKW B;  4JI4 L;  2BA1 A;  2NU8 B;  1CK1 A;  5EKK A;  2Z6K A;  1C8C A;  4JI5 Q;  3UE0 A;  3I4M G;  4UCT A;  2FPP B;  3RZO B;  4BY7 B;  3OTO L;  4DXG A;  2RGR A;  5FD5 A;  4LF6 Q;  4JI5 L;  4XDX A;  2WB1 B;  2Z9H A;  4HJA A;  4C5A A;  3OTO Q;  1FNW A;  2HDL A;  4Y52 H;  1XPO A;  1WVL A;  4KD3 A;  2DPJ A;  2WP8 J;  4LFA H;  5KFS A;  2K33 A;  3CHB D;  2FK2 A;  2R7N A;  5CV9 A;  2DNE A;  1NSN S;  1U4R A;  2UXD H;  2UXB L;  1CZG A;  2R84 A;  4X64 H;  2JK8 A;  2WAQ B;  4FDB A;  1O7L A;  1NAP A;  2LS0 1;  1EWH A;  1YJN A;  4JBM A;  4RHR A;  3R5F A;  3T5K A;  1YVC A;  4KKU A;  1DV2 A;  1SE8 A;  4R4T A;  5BR8 L;  1WOC A;  2W70 A;  5M5X B;  2C2E A;  2K03 A;  5BR8 Q;  2QW7 A;  2FPG B;  1CFM A;  2I0Q A;  1TU2 B;  2FK3 A;  2XCA A;  1V1P A;  4MN3 A;  4BXX G;  2EJM A;  3WDN A;  2VQF L;  3I12 A;  5EWF A;  4I50 F;  1XNQ L;  2IL8 A;  1UE6 A;  2XCL A;  4A3C H;  3GIJ A;  2OTL A;  4MTE A;  5E3F A;  3K57 A;  5DEH A;  3HZX A;  3D4W A;  2ALY B;  2LKV A;  3EQL C;  4NMZ A;  3STB D;  3GTJ B;  1F2L A;  5KFK A;  4ECX A;  4GKK L;  1JIC A;  1QIL A;  2B2V C;  4FO2 A;  2W8L A;  1EY0 A;  4MA0 A;  3PO2 G;  1N34 L;  2VUM A;  3IFD A;  1NR2 A;  3PO3 H;  3BVZ A;  3NTI A;  3PW2 A;  1EWC A;  2KA7 A;  1VQB A;  4DR5 L;  4XZ3 B;  5A2Q W;  1YHB A;  2WB1 G;  2DWC A;  1IBK H;  5KFV A;  3GTO A;  3K5O A;  4M8A A;  4GOP B;  3MR2 A;  1TAE A;  3GLK A;  2IHE A;  2AMC B;  2HCC A;  4Q45 A;  5C44 H;  4C1N K;  1O80 A;  2RDG A;  3DWP A;  5KFO A;  2KEN A;  4Q0F A;  5KYI A;  2DJG C;  2F0M A;  3I4O A;  1JE5 A;  5HUR A;  1GGO A;  3K5H A;  2B2U A;  4HYK A;  1MZB A;  2YCH A;  4DNI A;  1I6H B;  2K28 A;  1KHI A;  3M85 A;  2BH8 A;  3RGZ A;  3BG5 A;  4KY7 A;  3KHG A;  4F4W A;  2JEI A;  4ZK9 B;  2B3G A;  4TSS A;  1AEX A;  3DM1 A;  4ZUJ A;  2BH2 A;  2DY8 A;  2NZ1 D;  2EIF A;  1HQM C;  3EFX D;  4H02 A;  1J5E Q;  4K0K Q;  3GID A;  1B9N A;  4A3K G;  3CPF A;  4P75 A;  3OHX C;  2UUA Q;  4FM9 A;  4DNT B;  1STE A;  5E1F A;  2F0T A;  5IGF A;  1QZH A;  1HNZ H;  3F2D A;  2B63 A;  4RUA A;  4J9S A;  1VAJ A;  1WCM A;  1OXT A;  1SMY C;  4A93 B;  4KJO A;  1L2F A;  2FJ2 A;  4JI5 H;  1PFS A;  2EXD A;  5I6W A;  1CKO A;  4UAI A;  1I3Q B;  2N78 A;  1KTK A;  2N8N A;  2X6L A;  1VQD A;  4HCS A;  1AUV A;  1PV4 A;  3PO2 B;  2A74 C;  2FE3 A;  2FMC A;  5KT3 A;  3OW2 A;  2N88 A;  4EBE A;  1BXT A;  3TZD A;  3RNU A;  4DR5 Q;  2IMW P;  2X69 A;  5KG0 A;  2HVR A;  4B9W A;  1HTL D;  3N40 P;  1OXV A;  1ENC A;  1AN7 A;  4DV0 Q;  4FS2 A;  1F9Q A;  4LUO A;  3QOJ A;  2E2D C;  1YNN D;  4DV4 Q;  2W7P A;  4DR1 Q;  1G8Z D;  1X3E A;  2LMC B;  3TP8 A;  5GAE C;  4A75 A;  2CHB D;  3B6Y A;  4BY1 B;  1JWS D;  2JA6 H;  2MFI A;  1GD7 A;  4MV3 A;  2KCT A;  1EUC B;  3HOU G;  2ZJP A;  1R4P B;  2ES2 A;  3FVQ A;  4DR6 H;  2ZT9 C;  5FK9 C;  5FLX E;  1J5E L;  4DXF A;  2F0W A;  2CH4 A;  3A54 A;  1WYD A;  4IPD A;  5CV8 A;  1RTN A;  4A3L H;  2JA8 B;  4DR2 H;  4P74 A;  1KQS A;  3HKZ B;  3U9S A;  4BBS H;  5EOY A;  3TRZ A;  3QIA A;  5JJK A;  3CCV A;  1DXM A;  4MNO A;  5KT2 A;  3CCS A;  1PZK D;  1E2Z A;  3T13 A;  4YQW A;  1IBM L;  5IGE A;  1Q46 A;  4DAM A;  3V05 A;  2OEO A;  4LSX A;  1SFO A;  1NE3 A;  3Q23 A;  1XMO L;  2W9B B;  4ZI7 F;  1CUK A;  1WCM G;  4UPA A;  3PUV A;  4DV5 H;  3CXC A;  3Q8D A;  1S03 G;  2YTY A;  4XTC S;  3QZ7 A;  3RAQ A;  2IPK D;  3I4L A;  5K36 G;  3A8K E;  3IKJ A;  4XT1 B;  4EEY A;  1PH7 A;  1I6V C;  2CZG A;  4ZLT F;  1PMR A;  4JI6 H;  4LF6 L;  4KY6 A;  1LAC A;  3C1E A;  3I70 A;  3GIK A;  1AFP A;  3SEB A;  1MD2 D;  3L9A X;  1Q3L A;  3IFT A;  3HRZ C;  4O3Q A;  2WAC A;  2VQE Q; 
#chains in the Genus database with same CATH homology
 1I94 Q;  2LSS A;  4PMW A;  4LFC L;  4X6A H;  4BY1 G;  1NJI C;  3U4V A;  3HKZ E;  1PHJ A;  2E2J H;  1TWF H;  4OO1 G;  4JV5 L;  1HNX Q;  1AH9 A;  4GS3 A;  4QL5 A;  4JI8 L;  4JYA Q;  2Y0S E;  2K5H A;  3PCO B;  5IYD G;  3T1Y Q;  3G48 A;  4NXN L;  4LF8 L;  4GN5 A;  2PMZ E;  4PZ7 A;  4DR3 L;  1TWA H;  3S17 H;  4A93 G;  3T1Y L;  3ER0 A;  2LXK A;  2ZTD A;  5M5Y H;  1KAW A;  1QVF A;  3GTJ H;  1OXU A;  1P16 A;  2NZO A;  1M90 C;  3M4Q A;  1VCI A;  5HY6 A;  1Z47 A;  1YJ9 A;  1HZ9 A;  3HOY H;  1UEB A;  3S2H H;  1L1O B;  2KCM A;  1LUZ A;  4RMF A;  1D7Q A;  1VQL A;  1QUQ B;  2UXB Q;  3AYH B;  4JI3 L;  1Q12 A;  3KYH C;  3TS0 A;  1PH9 A;  2MNA A;  1EIF A;  4B3T L;  4KHP Q;  4X65 Q;  1VQH A;  1OXX K;  1MJC A;  2D62 A;  3CME A;  2AHO B;  3RN2 A;  1TWH H;  3J81 j;  3PSI A;  4BA2 I;  4DR6 Q;  1A8V A;  2Z0S A;  4A3I H;  4OX9 Q;  2UUC Q;  4BY7 G;  4IFD G;  3CAM A;  3FKI G;  4C3J H;  4IO9 A;  2ZJQ A;  1NMF A;  1PYB A;  4R1J A;  3GTQ H;  1SRU A;  1IL2 A;  5C44 G;  2PNH A;  5AJ3 L;  2CQO A;  4IPC A;  3CCJ A;  3GTG H;  5FLM G;  1ASZ A;  2WFW A;  4YWM A;  3J81 c;  1WI5 A;  3RLN A;  4JI6 L;  1QVG A;  3F8T A;  4LW1 A;  3EBE A;  1KRT A;  1IBL Q;  4C3H H;  5C0X G;  3KJO A;  2XTI A;  2BA0 A;  2JQO A;  1EUJ A;  4DUZ L;  2UUC L;  2OWO A;  3S1Q H;  2HHH L;  1K8G A;  4JI2 L;  1KL9 A;  4X64 Q;  1N33 Q;  5LMN W;  3F2C A;  4GKJ L;  1VQP A;  3I7F A;  2PI2 E;  2IY5 B;  4YHH Q;  3GTP H;  3F1Z A;  1X3F A;  1VS0 A;  1BVS A;  2Q2U A;  5C3E G;  3K81 C;  3CCU A;  1N32 L;  1SRO A;  3HOV G;  2UXD Q;  2VZA A;  1N36 Q;  4JYA L;  1IBK L;  2YU9 H;  3JAM c;  4OO1 I;  3KDF A;  5JEA J;  4UY8 C;  1VQ9 A;  3NEL A;  2K75 A;  1TXY A;  4X64 L;  2V1C C;  4HIK A;  2R7Z H;  1B7Y B;  1VQG A;  4YCU A;  5HGQ A;  3KFU A;  1N33 L;  2DUD A;  3AEV A;  1HNZ Q;  2F4V Q;  4YHH L;  2AWN A;  4GKJ Q;  3U58 A;  1VQF A;  2UXC Q;  5J3B A;  5FJ8 H;  3AFP A;  1NTG A;  4A3E G;  1VQ4 A;  1KIX A;  4JI0 Q;  4LFA L;  4QGU A;  1XPU A;  1LTL A;  1PH2 A;  2WB1 E;  5GAH C;  2IHF A;  4DV3 L;  1IXR A;  4A93 H;  1Y1W H;  2LXJ A;  3J80 i;  3W5O A;  4GNX A;  4P71 A;  4OX9 L;  2I5L X;  1E22 A;  1X9N A;  3I56 A;  1VQ8 A;  4LF4 L;  1K3R A;  4MZ9 A;  4BY1 H;  1HR0 Q;  2HQL A;  2FXQ A;  5M3F H;  4HJ5 A;  3PIO A;  1L0W A;  1LM0 A;  1HR0 L;  4R4C A;  4R4I A;  4JI1 L;  4A3K H;  2ZJR A;  4JI0 L;  5DLQ E;  1RIP A;  4A3G G;  2VS1 A;  2ZTE A;  1GM5 A;  2UUB L;  4YY3 Q;  1FGU A;  1VQK A;  4JOI C;  1L1O C;  4GLA C;  4BBR H;  4L5R C;  4HIM A;  4KLK A;  3TRE A;  1XPR A;  4B3R Q;  5ELO A;  5IYC G;  3JC6 6;  3E0E A;  4PZ8 A;  3S1M H;  1G29 1;  4BBR G;  1G51 A;  4HJ7 A;  1N32 Q;  3HOU H;  2RHQ B;  4DUY L;  1N36 L;  3G4S A;  1EYG A;  3S24 A;  4K0K L;  2QGQ A;  4IPH A;  4P72 A;  4JV5 Q;  2Q2I A;  2ZM6 L;  3PF4 A;  4JI7 L;  1R9T H;  4TQU S;  4A3I G;  3GTO H;  2NN6 G;  2ATW A;  3H0G G;  4ME3 A;  4AYB E;  1E1O A;  2ID0 A;  3UE1 A;  4GOP A;  3J7Z C;  2UUA L;  3HOX G;  2HHH Q;  1PYS B;  1X54 A;  3RN5 A;  2JA7 H;  3NEM A;  2MQH A;  1EIY B;  2VQE L;  3SGI A;  2I5M X;  4Y7N H;  2CCZ A;  1MKH A;  5GAG C;  1FJG L;  1XTD A;  3HOX H;  4LFC Q;  4IFD I;  3HKS A;  4A3B G;  2KHJ A;  3HOZ G;  5C4X G;  3VDY A;  1HZB A;  3I4M H;  1GKH A;  2RF4 A;  3CP0 A;  4A3G H;  2KHI A;  5LMN L;  3STB C;  3CCE A;  1VQN A;  2R93 H;  1HZC A;  3HOZ H;  1ASY A;  4LF7 Q;  2HT1 A;  5JJL A;  4A3J H;  2JA8 G;  2WAQ E;  3KLW A;  1YHA A;  2NVQ H;  3ULP A;  3GDE A;  3PGZ A;  1TWC H;  1U0L A;  4DPG A;  1VQA A;  2JEA I;  5EAY A;  3T1H L;  3S16 H;  2JA8 H;  3W1G A;  2B63 G;  5C0X I;  4GOP C;  3S15 H;  3CMA A;  1A0I A;  3BZK A;  1SLJ A;  1PH5 A;  4P73 A;  1VQE A;  1N34 Q;  1E7Z A;  4X65 L;  4LF4 Q;  1VQ5 A;  1Y1V H;  5JEA G;  3I55 A;  4YCV A;  3GTL H;  2YYZ A;  4DR6 L;  1JT8 A;  4OWX B;  1YBY A;  2DGY A;  3H15 A;  5GQO A;  1XMO Q;  2ZTC A;  4LUZ A;  4X62 Q;  5E7N A;  5GRO A;  2QEX A;  4LF7 L;  1UE7 A;  2R7Z G;  3L2P A;  1HNZ L;  1JJG A;  1YIT A;  1Q1B A;  4JOI A;  1FL0 A;  3K7A H;  4UP9 A;  4GNX C;  1XMQ Q;  4DV2 Q;  1PH4 A;  4MTN A;  1IZ6 A;  4RG1 A;  1SMX A;  1FVI A;  1X3G A;  3CCM A;  3L0O A;  3PUW A;  3IRB A;  3S1R H;  2Z6K C;  4A3F H;  4DUY Q;  5FLX c;  1MJE A;  2QA4 A;  1JJ2 A;  1LYL A;  4APV A;  1T9H A;  1S72 A;  1EQQ A;  4AIM A;  2JA5 G;  1A63 A;  4JI7 Q;  5JJI A;  3D0F A;  1I5F A;  1NY4 A;  4L5Q A;  3HOV H;  4JBW A;  3HKZ G;  4LWC A;  3GTM H;  1HH2 P;  3PF5 A;  1YEZ A;  1V1Q A;  3UDI A;  1XJV A;  4QQB X;  1YNX A;  3AFQ A;  2UUB Q;  3E9H A;  3RZO H;  4BY7 H;  3CF5 A;  4DV5 L;  2VY3 A;  4DAY B;  5IP9 G;  4HJ8 A;  5LMU Q;  1B70 B;  2L15 A;  4DR4 L;  4B3R L;  1QUQ A;  3RLF A;  2OQ0 A;  4WJ3 M;  1BKB A;  2UU9 Q;  1Y14 B;  4X66 Q;  4DV3 Q;  2IX0 A;  3EN2 A;  4QJF A;  1H95 A;  3F2B A;  1HR0 W;  1EWI A;  4DR2 Q;  2CKZ B;  3M9B A;  3A5Z B;  1CSQ A;  4PZ6 A;  3FHW A;  2R92 G;  3PUZ A;  1TWG H;  3S1N H;  2N3S A;  3T1H Q;  4YCW A;  5M3F G;  4DV6 L;  1VQO A;  1PH3 A;  1PH8 A;  4POG A;  3KJP A;  1OXS C;  1L1O A;  4LF5 Q;  2R92 H;  4OWW B;  2K5N A;  1VQI A;  1SFO H;  3CC4 A;  4XIG S;  3PO2 H;  1UE1 A;  1Q82 C;  4LFB Q;  4R4O A;  1HNW L;  4JC0 A;  4B3T Q;  3KF8 B;  4A3B H;  1KRS A;  4KHP L;  3EIV A;  1IBK Q;  2OTJ A;  3DLL A;  3FP9 A;  4EQ5 A;  5IP7 G;  1YHQ A;  4DR7 Q;  1X6O A;  4GLX A;  3CW2 C;  1X55 A;  2MO1 A;  4LF8 Q;  1U5K A;  4LF9 L;  4LNQ A;  4JI8 Q;  1AE3 A;  4DR3 Q;  3TEH B;  1CKM A;  4A3J G;  4GLV B;  3K0X A;  5IP7 H;  3K8A A;  4L5S A;  1Q81 C;  2Q2H A;  5IY0 A;  3U50 C;  4HIO A;  1GVP A;  3I4N G;  1YZ6 A;  2GN5 A;  2B63 H;  2VNU D;  2VUM G;  4IOA A;  1IYJ B;  4DV2 L;  1EQR A;  3HFZ B;  4A3E H;  3MXN B;  2OCE A;  1BBU A;  1X56 A;  1N8R C;  5IYB H;  3LGJ A;  1S3O A;  2JA7 G;  4A3C G;  4DUZ Q;  1P8L A;  3J7A 5;  2CFM A;  4X62 L;  2AKW B;  1J6Q A;  4A3F G;  4DR2 L;  4JI4 L;  2BA1 A;  2PI2 A;  3DM3 A;  1HZA A;  2K5V A;  2Z6K A;  4JI5 Q;  3UE0 A;  3NBH B;  3I4M G;  1M1K C;  2E8G A;  3OTO L;  5M5W H;  3PUY A;  4GN3 B;  4ALP A;  4JI5 L;  4JBK A;  4LF6 Q;  3RZD H;  4HJA A;  4C2M H;  4TVA B;  3KOJ A;  3OTO Q;  1O7I A;  4LFA Q;  5AJ3 Q;  4Y52 H;  4PG3 A;  2A8V A;  1XPO A;  3PO3 G;  2I5H A;  2UXC L;  4JBJ A;  2GVB A;  2E2H H;  1QVC A;  2WP8 J;  1BBW A;  2F52 A;  4UP8 A;  2K50 A;  2UXB L;  3MEF A;  2JK8 A;  4FDB A;  1Q1E A;  4YWL A;  1XNQ Q;  5H1S E;  2YTX A;  3UDG A;  1YJN A;  4C3I H;  4JBM A;  2N49 A;  1YVC A;  1AE2 A;  2RHS B;  3H3V H;  1SE8 A;  1YI2 A;  4R4T A;  5BR8 L;  1WOC A;  1KD1 C;  3BZC A;  4IJH A;  4BA1 I;  2JE6 I;  2E5L Q;  1RL2 A;  5BR8 Q;  3UDF A;  4JG2 A;  4NB3 A;  2I0Q A;  1I6H H;  2UXD L;  4DR7 L;  1Q86 C;  1I94 L;  4A3L G;  4BXX G;  1K9M C;  5C0X J;  3CC7 A;  2VQF L;  4YWK A;  4LF9 Q;  4UP7 A;  2IX1 A;  3ICE A;  1XNQ L;  2VL6 A;  1UE6 A;  4OWT B;  4A4I A;  4A3C H;  2JA5 H;  2OTL A;  3CC2 A;  1E24 A;  2GVA A;  4DV4 L;  2OQK A;  3A0J A;  1Q7Y C;  3K7U C;  1K8A C;  4EX5 A;  2ALY B;  3KDF B;  1S40 A;  3STB D;  5GAD C;  5IT9 c;  3J81 i;  3HOY G;  4GKK L;  4L5T A;  1WCM H;  2HIX A;  3GTK H;  1C0A A;  4DV0 L;  1QZG A;  1N9W A;  1CSP A;  4IPG A;  3PO2 G;  1N34 L;  1IBL L;  2CWP A;  5IWA L;  1EOV A;  4IOC A;  3PO3 H;  4WJ4 A;  2K4K A;  1VQB A;  4DR5 L;  4DV1 L;  4X66 L;  1YHB A;  5IWA Q;  2WB1 G;  4GOP B;  1X65 A;  4DV1 Q;  1HJP A;  4KI0 A;  2IHE A;  1Q8K A;  5IYB G;  2NZH A;  1WJJ A;  2A19 A;  2AMC B;  3CCR A;  3M4P A;  5C44 H;  1JB7 A;  4A3D G;  3UDX A;  3H0G H;  2RCN A;  5FJ8 G;  2KEN A;  1JMC A;  4DR4 Q;  3L7Z C;  1I3Q H;  2B29 A;  2JJQ A;  2YTV A;  1DGS A;  2R7F A;  1C9O A;  4A3D H;  3I4O A;  1E3P A;  1JE5 A;  2F3I A;  3PV0 A;  3H3V I;  1EFW A;  4KHZ A;  3JAM i;  1SN8 A;  4DNI A;  4B3M Q;  1E1T A;  1GO3 E;  4IFD J;  1KHI A;  3M85 A;  2BH8 A;  3KF6 B;  2VQF Q;  1V9P A;  2B3G A;  2BH2 A;  1J5E Q;  4H02 A;  2EIF A;  4K0K Q;  4NXN Q;  1PH1 A;  1K73 C;  2ZM6 Q;  4A3K G;  3CPF A;  4P75 A;  2R6G A;  2UUA Q;  3PUX A;  2C35 B;  1K83 H;  3M7N A;  1KC8 C;  5M5X H;  4OON A;  1XMQ L;  2E5L L;  5C4J H;  1G6P A;  3BJU A;  1QZH A;  1VQ7 A;  4LFB L;  3F2D A;  2D0O A;  3J80 c;  4YY3 L;  1HNW Q;  3D31 A;  1K0R A;  5IP9 H;  4J15 A;  4BXX H;  3I2Z A;  2ASB A;  2XGT A;  3ULJ A;  1VQ6 A;  3I4N H;  1OXT A;  2K14 A;  4LF5 L;  4JI2 Q;  4A3M H;  2JA6 G;  4LUV A;  2VUM H;  1L2F A;  4GNX B;  1VQM A;  2A1A A;  1PH6 A;  1CKN B;  1PFS A;  2EXD A;  4DV7 L;  4NXM L;  1CKO A;  4JI1 Q;  1Z9F A;  1I50 H;  4QIW E;  2N8N A;  2N78 A;  4DR1 L;  1JJC B;  1MIU A;  1VQD A;  3TQY A;  1W2B A;  3M4O H;  5FLM H;  3AQQ A;  4B3S L;  1PV4 A;  3TS2 A;  4DV6 Q;  1NMG A;  3GO5 A;  3W1B A;  3OW2 A;  2WAQ G;  2VW9 A;  4B3S Q;  1IBM Q;  1NBW A;  4IJL A;  3CQZ H;  1Y1W G;  4DV5 Q;  4DR5 Q;  3RNU A;  3S2D H;  4BBS G;  3OYY A;  5C4X H;  5LMU L;  4POF A;  3U4Z A;  4A76 A;  1OXV A;  5ELN A;  3K80 C;  4DV0 Q;  4JI3 Q;  4R4Q A;  4LUO A;  1VQJ A;  3ERS X;  2F4V L;  4DV7 Q;  4NXM Q;  2EQS A;  4JCV E;  2HIV A;  4AH6 A;  4DV4 Q;  4DR1 Q;  1C7Y A;  4QY7 A;  1WFQ A;  1A62 A;  1X3E A;  1CKN A;  3RR5 A;  5M3M G;  3HOW H;  5GAE C;  4A75 A;  1YJW A;  4AYB G;  3B6Y A;  1PVO A;  4A3M G;  2JA6 H;  2CWA A;  2KBN A;  2MFI A;  1GD7 A;  1D8L A;  1B8A A;  2JA9 A;  3G6E A;  2H5X A;  2KCT A;  4AQY Q;  3S14 H;  5M3M H;  3HOW G;  1FJG Q;  2PQA A;  3HOU G;  2NN6 I;  2ZJP A;  2ES2 A;  1OTC A;  1UE5 A;  4AQY L;  1UWV A;  1J5E L;  1W3S A;  4O2D A;  2IT1 A;  2Y0S G;  1HNX L;  2PQA B;  4B3M L;  1WYD A;  4DK6 C;  4IPD A;  3CD6 A;  4A3L H;  2NVT H;  4P74 A;  4NPS A;  1KQS A;  4BBS H;  3TRZ A;  1VQC A;  3KF6 A;  4OXP A;  3CCV A;  4MNO A;  5JJK A;  3CCQ A;  3CCS A;  2NVX H;  3ZJY C;  3BU2 A;  1PA6 A;  2E2I H;  4JI6 Q;  3M3Y H;  1IBM L;  3WWV A;  3CCL A;  5IYD H;  1Q46 A;  2Q2T A;  4DAM A;  3E9I A;  1NE3 A;  1XMO L;  2UU9 L;  1CUK A;  1WCM G;  4UPA A;  3PUV A;  2R93 G;  3CXC A;  1KXL A;  1YIJ A;  4GN4 B;  1XNR Q;  3RLO A;  3Q8D A;  4DK3 C;  3PIP A;  3G71 A;  3A74 A;  2YTY A;  4XTC S;  2NVY H;  2YV5 A;  3FKI H;  3CPW A;  1XNR L;  3GD7 A;  5K36 G;  5C3E H;  4JI4 Q;  2JEB I;  2AWO A;  1PH7 A;  1SR3 A;  4GKK Q;  2R7D A;  5IE8 A;  4DKA C;  4HID A;  5IYC H;  4HJ9 A;  4LF6 L;  2D0P A;  4O0A A;  3A5U A;  2MO0 A;  3ULL A;  5LMN Q;  2K52 A;  3NEN A;  1Y1V G;  1V43 A;  2VQE Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...