4A3EG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 31
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3eG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3eG01
1NY4A 4XIGS 1N33Q 1NE3A 3B6YA 1VQDA 1VQHA 3PUXA 4JV5Q 2IX0A 4X64Q 3RR5A 2Q2IA 1SLJA 3FKIG 2MNAA 4DAYB 4FDBA 2BA1A 4DV4L 1VQBA 5C0XI 3PGZA 2VQFQ 4DV1L 1G51A 3KF8B 2AHOB 3PV0A 4LF8L 2VS1A 2DUDA 1JMCA 1X3GA 2ZM6L 4DV5Q 4IPGA 2E2HH 2R92G 1KIXA 5FLMH 3G71A 1LYLA 4APVA 1E7ZA 1Z9FA 1R9TH 1N34L 2AWOA 4YWMA 4Y52H 4QL5A 3F2BA 1B70B 5C0XJ 3HOUH 4R4OA 1NBWA 1VQOA 4NXMQ 3I4NG 3HOUG 2UXCL 1YJNA 1HZAA 1QZHA 4YCWA 4NXML 4YCUA 4C3HH 2MQHA 5BR8L 4A3GG 4DPGA 2WB1G 2XGTA 1VQ6A 1P8LA 1H95A 4BY1H 4DUYL 2RHQB 2N49A 2GVAA 3T1HL 5IYDH 5IWAQ 1RL2A 3CXCA 4DR7L 1MJEA 1UE7A 4JI8Q 5M5YH 4A3KG 3GTOH 1KXLA 3W1GA 1PH5A 4J15A 4WJ3M 3JAMc 1VQNA 1OXVA 1XMOQ 2UXBL 3RZDH 5H1SE 2PNHA 4GLXA 5FLMG 2UU9L 1LM0A 1X9NA 4K0KL 3LGJA 4YY3L 3K8AA 4HJ8A 1HNWQ 1GM5A 2HQLA 1QVFA 3FKIH 1A63A 5IT9c 3G6EA 1YITA 2A1AA 4DUZQ 4JI7L 5ELNA 4LNQA 4BY1G 3UDIA 4KHPQ 2LXKA 1FGUA 3KOJA 3GTGH 3S2HH 1HNXQ 5IYBG 3HOVG 3KDFA 3S1MH 2PQAB 2N3SA 1HZBA 3CCEA 1EQQA 1IBMQ 4A3LH 3HOXH 4MNOA 2PI2E 2YTYA 3RNUA 3H3VI 2GVBA 2AWNA 1Q82C 1X3EA 1N36Q 2JA8G 1AE3A 4DR6Q 3S16H 1MJCA 3HOYG 3UDGA 1HZ9A 4L5QA 4DR5L 1LTLA 5AJ3Q 4OWWB 5IP9G 3H0GG 1YEZA 1V1QA 1PHJA 1IBLQ 2ZJQA 2K14A 5GAHC 1WI5A 5GQOA 3M9BA 3TEHB 2IX1A 1PH1A 2R6GA 2LSSA 3ER0A 5IWAL 4A3KH 1I94L 1EOVA 2IY5B 1FJGQ 2WAQG 1X65A 1K83H 2AKWB 2Y0SE 3K81C 4NPSA 3UE0A 4JI0Q 1JJCB 4LF7L 4POGA 5JJLA 1TWFH 5LMNW 3M85A 5HY6A 1Y1WG 4C3JH 4OONA 4AQYL 1I3QH 1YIJA 1TWCH 1KL9A 1N8RC 1QVCA 4LFAL 3HOZH 1HR0W 1S72A 3GTQH 4X6AH 2K4KA 3I4MH 1E22A 4JBMA 3VDYA 4B3ML 2D0OA 2E2IH 1ASYA 1PH6A 1Y1VG 4BBSG 2NZOA 3K0XA 1O7IA 2WB1E 4YCVA 1XMOL 2E5LQ 4JI6L 3U4VA 1OXSC 3S15H 3PIOA 1K9MC 4A3EH 2JQOA 1OXTA 1XJVA 1IBML 5IE8A 3A5ZB 2CCZA 2OWOA 4JOIA 1A62A 4UPAA 4MTNA 1XPOA 1IBKL 4QJFA 2R7ZG 2K75A 4GS3A 4GOPB 2UXBQ 4IJLA 1IBLL 4NXNQ 3SGIA 2R7ZH 2BA0A 2CFMA 3CAMA 2PQAA 3ERSX 3BU2A 3MEFA 2VQFL 4OX9Q 4DV6Q 2VZAA 3CQZH 4JBWA 1VCIA 1TWAH 1UE1A 4IJHA 3GTJH 1VQ4A 4JBKA 5IP7G 2UXDL 4DAMA 2EQSA 2B29A 2H5XA 1D8LA 3E0EA 3CCLA 1N32L 1Q12A 1FVIA 2IT1A 3J80i 4IPCA 1E1OA 3TRZA 4R4QA 1GVPA 3ZJYC 5C44H 1PH8A 4LF6Q 2YTXA 3S24A 4GLVB 1WYDA 3GD7A 3G4SA 4R4TA 4QIWE 3KJOA 2UUAL 2VNUD 1YJ9A 1S40A 2K50A 3L0OA 4AQYQ 1XPUA 1HH2P 4OWTB 1VQFA 1G6PA 3U50C 4HIKA 2QGQA 2ATWA 3RLFA 3KJPA 1VQEA 5M3FH 4DV1Q 4LF8Q 5FLXc 3PUYA 3CCRA 4GKKQ 4OXPA 3CD6A 3FP9A 1HZCA 3AFQA 1X6OA 1TWHH 4JI4Q 4B3RQ 3GTLH 1X55A 3G48A 1J5EL 2NVTH 2VUMG 1EIFA 4DV7L 4UP8A 2KCTA 3K7UC 4JI5L 4AIMA 1YJWA 4HJ9A 1I50H 2A19A 4BY7H 4A3IH 4YY3Q 4IO9A 4PG3A 4R1JA 1YZ6A 2VQEL 4LF4Q 1N32Q 1Y14B 4JG2A 3CCMA 3GTMH 2ALYB 1JE5A 1SMXA 2QA4A 3PO2H 3HOYH 3S1QH 4WJ4A 1NTGA 1KRTA 3BZCA 4P74A 3JAMi 2UUCQ 5GADC 1BBUA 4A3BG 5JEAG 3HFZB 5JJKA 4A3DH 2NN6G 4IFDJ 1Q7YC 3D31A 3L7ZC 4GKJL 2E2JH 3EIVA 2JK8A 4HJAA 1VQJA 3TQYA 2ES2A 3PCOB 2I0QA 2ZJRA 1DGSA 1UE5A 4EQ5A 4BA2I 1SN8A 2JJQA 2ID0A 5M5XH 2KHIA 1EQRA 1L1OC 3ULJA 2CWAA 3IRBA 3F8TA 2B63H 4A3CG 2JA9A 3NBHB 1OXUA 4A3LG 1AE2A 4DV5L 2JEAI 1E3PA 3CMEA 3CCUA 4JI5Q 1XNRQ 1XMQL 3WWVA 1PH3A 2JA8H 4PZ7A 5FJ8H 4LUOA 4IOCA 2EXDA 2I5HA 3E9IA 3OYYA 1Q81C 4DV0Q 1UWVA 5E7NA 2K52A 4DV7Q 4A3MG 1SFOH 3AFPA 1VQAA 4IPDA 5IYCH 3PIPA 1IBKQ 4LF6L 1N33L 4A75A 4A3IG 2HIXA 2LXJA 2MFIA 5HGQA 2HIVA 1PH9A 1K8AC 4B3SL 4HIOA 2E8GA 4B3MQ 1QVGA 3AYHB 4A93G 4OO1I 3CP0A 2OTLA 2OQ0A 4AYBE 4A3GH 3KF6B 3STBC 1C7YA 1CUKA 1OTCA 3UE1A 2NVYH 1CSQA 3AEVA 4GKJQ 3HKZE 2JA6H 3KFUA 4LWCA 1SROA 4JI8L 3GDEA 3U58A 1KQSA 3HOXG 2JA5G 3M3YH 1VQ8A 1HNWL 2WFWA 1QUQA 4DR2L 4P71A 1CSPA 3PO2G 3OTOQ 4PMWA 4B3SQ 3W1BA 3I55A 1JJ2A 2BH2A 3OTOL 3S14H 2JEBI 3PO3H 5C4JH 4KI0A 4KHPL 1KRSA 4RG1A 4R4IA 4L5SA 4JBJA 4LF9L 2F4VQ 3HOWG 1QZGA 4QQBX 2R7FA 4R4CA 3CW2C 1EIYB 5GROA 2VUMH 3GTKH 2KBNA 3BZKA 1PA6A 3EBEA 4JI3Q 4BXXH 1YVCA 2KHJA 4JI2Q 4YWLA 4Y7NH 4P73A 3OW2A 4X64L 4A76A 1W3SA 4DR4Q 2KCMA 4IFDI 2K5HA 3PF4A 1NMFA 4LF4L 2YTVA 1PV4A 4PZ8A 1GKHA 2FXQA 1PH7A 3I4MG 1VQGA 1E1TA 1YHBA 3CCVA 4DV2L 4B3TL 1A8VA 1I6HH 3T1HQ 5C4XH 2ZM6Q 5LMUQ 4GOPA 1YI2A 3M4PA 3CCQA 2Q2TA 1L1OB 5K36G 1L0WA 3L2PA 3K7AH 4TQUS 1VQ5A 1XPRA 4LFCL 4K0KQ 1BBWA 1MIUA 4C3IH 1Q1BA 3KYHC 2Z6KC 1W2BA 1Q1EA 2UXCQ 1C0AA 2NN6I 4A4IA 1UE6A 4LUVA 3ULLA 2VQEQ 5BR8Q 1KD1C 4IPHA 2F52A 3S2DH 3U4ZA 1RIPA 1WCMH 4HIDA 1PYBA 1V9PA 4GN3B 4OO1G 2VY3A 2I5LX 1Q86C 4YHHQ 2R7DA 2ZTEA 1VQKA 4B3TQ 4DV6L 2K5NA 2WP8J 2UUCL 1C9OA 2VW9A 1VQ7A 3F1ZA 1SRUA 1P16A 2CQOA 3UDXA 4LF5Q 3S1RH 3KDFB 1YNXA 4GN5A 3I7FA 5C4XG 2V1CC 4DKAC 4JI2L 5M3MG 2DGYA 3MXNB 4TVAB 1PYSB 2UU9Q 1CKNA 4DV3Q 2OTJA 5C0XG 4HJ7A 3DM3A 4DR2Q 4JI6Q 1SE8A 3A74A 3D0FA 3RN2A 4JYAL 4DV2Q 4OX9L 1I94Q 5EAYA 5GAGC 4PZ6A 3CCSA 1HR0Q 3PO3G 4JYAQ 4O2DA 5LMUL 4KLKA 3F2DA 4JCVE 2Q2UA 3PUWA 1T9HA 5C3EG 2JA7G 1V43A 5DLQE 4A3DG 5IP9H 2MO1A 1XNRL 1YHQA 2R93G 1EUJA 4GN4B 1PVOA 1LUZA 1K73C 4B3RL 2E5LL 1GD7A 4RMFA 1FL0A 2CKZB 4JOIC 1VQMA 1PFSA 4GLAC 1NMGA 3CC7A 4LF7Q 1UEBA 3TREA 2A8VA 3KLWA 4QGUA 1J6QA 3CPWA 2IHFA 4JI3L 4IFDG 2JA7H 4A3MH 4X62Q 2OQKA 5GAEC 4X65Q 2RHSB 2MO0A 1HR0L 5IYDG 1IZ6A 4ALPA 4DK6C 4DR7Q 2JE6I 1JB7A 4QY7A 4BBRG 3I56A 1X56A 3RLNA 2B3GA 2AMCB 4A3FH 2HHHQ 1NJIC 1PH2A 1U5KA 5J3BA 1OXXK 1X54A 1VQCA 1EWIA 4NB3A 1KC8C 4JI0L 5LMNQ 1SR3A 2Z0SA 4DR3Q 2HHHL 3H0GH 4EX5A 4DV0L 1WOCA 1CKMA 4DR1L 4A3JG 3T1YL 4A3JH 2ZJPA 4LFAQ 2N8NA 3EN2A 4DV4Q 4YHHL 3AQQA 1B8AA 3KF6A 2F4VL 1YBYA 2PMZE 5AJ3L 4AYBG 4DUZL 5M3MH 1KAWA 1E24A 2JA6G 2NZHA 1CKOA 3PUZA 3CF5A 3CC4A 3ULPA 4L5RC 3J81c 2XTIA 1IL2A 4BY7G 5IYBH 3HOVH 4LFBL 1Y1VH 1HNZQ 3GO5A 4BBRH 1S3OA 3J7A5 4GNXA 5IP7H 1K0RA 4LF5L 3K80C 1JJGA 2N78A 2YV5A 5IY0A 2K5VA 4POFA 1XNQQ 3HOWH 3NELA 2R93H 4X65L 1IXRA 5C44G 3GTPH 4A3BH 5IYCG 4GNXC 2D62A 3HKZG 3JC66 4O0AA 2IHEA 4DR5Q 1EYGA 2Z6KA 1EFWA 4BBSH 1TWGH 3H3VH 2CWPA 3NENA 3Q8DA 1N36L 1VQ9A 3TS0A 2NVXH 1B7YB 4GNXB 4LF9Q 4UP7A 3M4QA 1WJJA 1VQIA 3PSIA 1FJGL 3J81j 3FHWA 4X66L 2KENA 4XTCS 1HNZL 1WCMG 1PH4A 2ASBA 4UY8C 1Z47A 1U0LA 2B63G 1KHIA 3ICEA 4L5TA 3J7ZC 3PF5A 4BA1I 1K3RA 4DR6L 3PUVA 3T1YQ 3STBD 2ZTCA 4A3FG 4NXNL 5C3EH 2UUBQ 3HKSA 3J80c 4A3CH 2Y0SG 2HT1A 1L1OA 4P72A 4GKKL 3BJUA 2WAQE 3RLOA 1WFQA 4X66Q 2UXDQ 3S17H 2YYZA 1K8GA 4LFBQ 1L2FA 3I2ZA 2JA5H 4LFCQ 1D7QA 1BKBA 1MKHA 2PI2A 1XMQQ 1HJPA 2D0PA 4JI1Q 4MZ9A 3W5OA 1M1KC 4BXXG 3M7NA 3CC2A 4DUYQ 1XNQL 2EIFA 4DR3L 3NEMA 4YWKA 4DR1Q 1TXYA 3A0JA 3RN5A 3J81i 3S1NH 2C35B 4A93H 3CCJA 4A3EG 2VL6A 1I5FA 3DLLA 1XTDA 4DK3C 4GOPC 3I4NH 1Q46A 2Q2HA 1YHAA 2RF4A 2RCNA 1QUQB 1M90C 1Q8KA 2ZTDA 3F2CA 2F3IA 3H15A 1AH9A 2QEXA 1BVSA 4LW1A 1N34Q 1HNXL 2R92H 1G291 2BH8A 1Y1WH 1IYJB 1VS0A 4IOAA 4P75A 4OWXB 1GO3E 1X3FA 1N9WA 4AH6A 2UUAQ 3RZOH 3CMAA 3M4OH 3A5UA 3HOZG 2I5MX 4X62L 1ASZA 4DR4L 2NVQH 3CPFA 4LUZA 2UUBL 5JJIA 1VQLA 4HIMA 3TS2A 4JI7Q 1VQPA 4DNIA 4HJ5A 3E9HA 3UDFA 5M5WH 2L15A 4C2MH 4H02A 4ME3A 2GN5A 4JC0A 5ELOA 5JEAJ 1A0IA 4UP9A 5M3FG 3I4OA 5FJ8G 2YU9H 2OCEA 4JI1L 4JI4L 1JT8A 4JV5L 5LMNL 1CKNB 4KHZA 4DV3L 1J5EQ
chains in the Genus database with same CATH superfamily
4XIGS 1NE3A 3L4JA 4PNYA 1SE4A 4IRKA 2ZT9C 4RH6A 3J80L 4DAYB 1BBXC 4H0LC 2BA1A 4DV4L 3GIMA 4B3TH 2EYPA 2QDLA 2FMAA 4J9PA 2BR0A 1C30A 2A6ED 1E4GT 4LSXA 3G71A 1LYLA 4Y52H 1E7ZA 1Z9FA 1UNNC 5BPFA 1XWEA 3F2BA 1VMCA 3HOUH 2RDHA 1NBWA 5C3XA 3I4NG 4O3RA 3TQ1A 5FK9C 1K1QA 4DV7H 4FS1A 4NXML 4YCUA 4C3HH 2FPPB 3OIQA 4WORA 2CQAA 1D5XC 2WB1G 1NSNS 3J80W 1Y8OB 3MA2B 2F0VA 4DUYL 1PRTD 2N49A 1XMOH 2GVAA 5DAUA 3TZUA 3V6HA 1U4PA 5IWAQ 2X0SA 4DL4A 1H9KA 4DR7L 5M5YH 4A3KG 3GTOH 1LT4D 3W1GA 3HOUB 3MTSA 4DL7A 1VF7A 1TU2B 3S17B 4WFN3 2R7NA 4FP5D 1DOKA 4CJ1B 2Q8RE 1X9NA 4K0KL 3SDZA 2F03A 4OL7A 4IWXA 5D14A 4RKBA 4GZYC 3MR5A 1QWYA 5FKAC 3E0JA 4J9MA 1EY6A 2XCPA 4KHVA 1QG7A 4DUZQ 4JI7L 1HTPA 2LXKA 2A69C 3URYA 3GTGH 1HNXQ 5FOBB 1GSAA 1IHZA 1EQQA 4A3LH 1PTOD 4MNOA 1ZHSA 3C3LA 3H3VI 4FU0A 1B04A 4A2AA 2E2HA 4O42A 4B9XA 1AE3A 4G3IA 1MJCA 3UDGA 3C46A 3OIPA 3K59A 4KKTA 1LTLA 1I6HB 1IBLQ 1WI5A 4EG0A 2IX1A 2V9WA 2WKDA 1XX8A 3A7AB 3V05A 5FD6A 1K83H 1EEFD 2AKWB 1QB5D 2QK4A 5LOVF 3K5MA 2DY7A 4JI0Q 5HURA 4ECSA 3RF2A 5LMNW 3BVZA 5KG0A 1I4RA 2L9HA 4AQYL 2HUGA 1S4ZA 3S9WA 2LS01 4LFAL 4ZUIA 1HR0W 3HOWB 5DEHA 2K4KA 3I4MH 1E22A 4H44C 3VDYA 1SDFA 2WB1E 1PDQA 2F0UA 1H9MA 1HA5A 1ZYRD 1XMOL 2E5LQ 4JI6L 3S15H 3GV7B 1K9MC 1XJVA 2DJFC 1OXTA 2OWOA 3PIO3 2AU0A 1DJRD 1IBLL 4QW8A 4C5CA 1W93A 2R7ZH 2PMZA 4OX9Q 1VCIA 4LAAA 1TWAH 1VQ4A 4IJHA 4EQPA 1E2VA 1KJQA 1TKWB 3JAME 4Y8VB 3RB4A 4J0MA 1TWFB 3J80i 4IPCA 3FPPA 4LF6Q 4XQQA 2A68D 2YTXA 3S24A 3GTOA 2MPMA 4GLVB 1WYDA 4ZOLF 3S1MB 2K7VA 4FM9A 4LF7H 2UUAL 3BYTB 1YJ9A 1S40A 2AUJD 5KFEA 2O5JC 1HH2P 1LTID 1VQFA 4OWTB 3U50C 2ATWA 1TS5A 5KFGA 3RLFA 5KEEA 2YS7A 4WD3A 3NK9A 3RIZA 1XDNA 1SEIA 3OMGA 3S15B 1HZCA 4JK1C 2LKVA 1X6OA 1RHPA 3GTLH 4S3SA 1X55A 2BQUA 1EYCA 2K1BA 4JYAH 1UUPA 2VUMG 2YZGA 4YR2A 1E0BA 2ASDA 4HJ9A 2NU6B 2EYMA 3NPPA 2A19A 4BY7H 4FXGC 2K5WA 4PG3A 4R1JA 1KLUD 1XMQH 4KD4A 1YNJD 1JKJB 1S0OA 1JE5A 5LMUH 2FLLA 3PO2H 3HOYH 2O2LD 4P74A 2N88A 5FLXL 2UUCQ 1HNZH 2QCPX 5GADC 1BBUA 4FBUA 2F0MA 4MV7A 3AB9A 3VYTA 4IFDJ 2W6QA 1Q7YC 3TZDA 4GKJL 3PR4A 3KTMA 5DQHA 5CMDA 1V4YA 3MEHA 5K2MA 2L55A 1UE5A 5JVG3 3TP7A 1SN8A 3HKZB 2VB2X 1H9SA 1Q3LA 2ID0A 2KHIA 1EQRA 1RJRA 1TWCB 2CWAA 2B63H 4A3CG 3V4ZA 3NBHB 2RVLA 4PMBA 4A3LG 5FD5A 4OEMB 3CMEA 4JI5Q 4DR1H 2W57A 3WWVA 2WDTA 4B3MH 4LUOA 2R8GA 2I5HA 1Q81C 4DR2H 4YHHH 3NTHA 4LF6L 4IPDA 1VQAA 1IBKQ 1Y1WA 4A3IG 2MFIA 4GKJH 4KN4C 4B3SL 5JVDF 1EY8A 1GJXA 1IOWA 2UVVA 4LF5H 3L9AX 3OMCA 1EIHA 3PQIA 4N8FA 3CP0A 2WTFA 1CHPD 2OQ0A 2YL2A 4DR5H 4ED7A 3EPIA 1CUKA 4GKJQ 2NVYH 5C0XH 2JXMB 2JA6H 1SROA 4FNFA 4X3UA 3RV4A 2JA5G 2UXCH 2H4OA 4EVOA 2TSSA 1HNWL 1H9RA 1QUQA 4RGMA 1CSPA 1E4EA 1A9XA 4K2LA 3TP6A 3K58A 1EYZA 3CHBD 1B9MA 4L6TB 4MV1A 3S14H 1I50B 5C4JH 4KI0A 4IZ8A 4DL2A 4A3IB 1ET9A 4LF9L 2JEGA 3PW5A 4QQBX 2R7FA 3LP8A 4R4CA 1EY4A 5GROA 2XGQA 2RQXA 3BDOA 3KAKA 1RD9D 2DN8A 1W6JA 3JRXA 1Z2OX 3ETHA 4X64L 1GUNA 5D3IB 4DR4Q 4UFZA 4F4YA 3PF4A 2FXQA 1PH7A 3I4MG 3M4YA 1SMYD 1I6HH 3T1HQ 5C4XH 1SYGA 2R6FA 4UCOA 1JORA 5K36G 2Q2TA 2VQEH 4FS2A 4RNOA 3OUZA 5EWGA 4MIUA 3J81E 4K0KQ 3I3CA 4F7XA 5J1ZA 2Z6KC 1WSCA 2XCAA 4RNMA 2RKSA 2V4RA 1K83B 3MHBA 1JXLA 1MSHA 1I4HA 2J0TD 4LUVA 3ULLA 2VQEQ 3GTJB 3MWDA 1DZ1A 3VR5A 1F77A 1S5CD 4HIDA 4LF9H 2I5LX 4OGQC 5FO8B 2R7DA 4QUFA 1NR2A 5KFKA 3P7JA 2WP8J 2UUCL 4YJ3F 1O7ZA 2XIWA 1AW7A 4XYMB 1I4QA 3I12A 1R4PB 3KDFB 1YNXA 4GN5A 1U9RA 1GUGA 5D3DA 5M3MG 1B9NA 2DGYA 4TVAB 2YZNA 3MJFA 2PQEA 4JI3H 5C0XG 4DR2Q 4ED1A 2QKIC 3D0FA 2RDGA 4RZQA 2C2RA 2K6AA 1Y69U 5EWEA 3V6KA 5EBCA 4PZ6A 2WIIB 3PO3G 1AP0A 4DA2A 4KLKA 5KFRA 1DOLA 5T1GA 3OWFA 1V1PB 2CVRA 2KOLA 2L5TA 1YHQA 3N41B 1EUJA 2XIGA 5L9XA 1I94H 2XSCA 4XDXA 2PMZB 2E5LL 1GD7A 4RMFA 1FL0A 1TWGA 4JOIC 1VQMA 3MFIA 2C28A 1PFSA 3TREA 2A8VA 2V4DA 4C3HG 5CV9A 4C2MA 1J6QA 4X3SA 2JA7H 3PZPA 3Q8QB 1JCKB 2W6PA 4X65Q 2AQ1B 3GIJA 2MO0A 1IZ6A 1QJOA 3MFGA 5EKLA 3BAAA 4JUZA 1VAJA 4DR7Q 1I6UA 1JB7A 4QY7A 2JA5B 1X56A 3IN5A 1QCBD 1EQVA 3M4IA 2VA2A 3RZOB 1OXXK 1X54A 1VQCA 1KC8C 5EZYF 1HA6A 4HQ6A 2HHHL 4YAJB 3BG5A 1R4QB 5IYZF 2ASLA 3QIAA 1WOCA 3T1YL 5CB4F 1LT6D 4G4KA 3DHQA 5KX5F 2R82A 1AUXA 3KF6A 2F4VL 3I72A 4A3GB 1KAWA 1JICA 2JA5A 2R7ZA 3ULPA 4BY7G 3ETJA 4IRCA 4RAYA 5IYBH 4TQSA 4F4WA 4NXNH 4CDFC 1E2ZA 3GIQA 4RB3C 3C0FB 4Q0FA 5F9NA 1K0RA 3OSPA 1GHJA 1JJGA 1TR5A 4XXEA 1S10A 1SNDA 2R93H 2KHSA 3NELA 2EY6A 2OXPA 2MHVA 4X65L 4ECQA 1IXRA 2K04A 3IFDA 5IYCG 1SYBA 1ICFB 4O0AA 4EGVA 1EYGA 3H6MA 1M4VA 5JPMC 3G7LA 5BN5A 3BA8A 1VQ9A 3TS0A 4A3FB 3HZXA 1WCMA 3M4QA 1VQIA 2ASJA 4XTCS 1HNZL 3P20A 1BQQT 1WCMG 1PH4A 4KHPH 4UY8C 3HKZA 4F87A 3K3VA 3S2HB 2DNEA 3J7ZC 1CZWA 3PF5A 1SNPA 1K3RA 5KG6A 1KJ8A 3P1HA 4B3RH 2F0DA 2CW0D 2ZTCA 4QMGA 3STBD 4DK0A 1PK8A 2F0QA 4KMUC 1GUTA 2B8GA 2JA6A 5IWAH 1L1OA 3RLOA 2F0SA 1J9OA 2JSOA 4ECWA 3VYUA 4LF4H 3KHHA 4LFCQ 1F9PA 4CC5A 2UUBH 1EU4A 1DONA 1HJPA 3I90A 1SYEA 1M1KC 4BXXG 2SNMA 1GHKA 4KTAA 2B39A 2EIFA 4F4ZA 2AQ3B 3NEMA 3M4OB 3BVGA 1TXYA 1PZID 3A0JA 3J81i 3S1NH 3CCJA 1AFPA 1I5FA 3I4NH 4A3MB 4DL5A 1II3A 1QUQB 3F2CA 2ZTDA 1ZQ7A 5EQ0A 1BVSA 3NHHA 4LW1A 4WRDA 1N34Q 1G291 1EZ6A 4P75A 4G7HC 1M7JA 1KEEA 2UUAQ 5KYIA 4JI2H 3R2IA 4X62L 4DL6A 1WH2A 2ZJTA 3DEOA 4CHTB 3VPCA 3GTKA 2R7ZB 4LSAA 3SVMA 4ID6A 4LH6A 1TAEA 4HIMA 3TS2A 3T1HH 1EY7A 3MFYA 1HQMC 4HJ5A 3K6OA 3HGBA 2VB3X 4HCSA 4ME3A 5JEAJ 2A6HC 1A0IA 4UP9A 1ZEQX 5FJ8G 1JT8A 2ENBA 4DAYA 2MP1A 5LMNL 4OIKA 1LT5D 5CV7A 2E2JH 2WKCA 2NB0A 3B6YA 2W9CA 1VQHA 3PUXA 3Q1KA 1BR9A 2IX0A 4X64Q 2FJZA 2PPBC 4FBTA 4DR7H 5L1JA 3NWSA 1G51A 2VS1A 2NVXB 4GKKH 1JMCA 1X3GA 3BA9A 4JV0A 5IGGA 4DV5Q 4P2CB 1KIXA 3SR1A 5CBEE 1N34L 4APVA 5KKNB 5KYLA 3MR6A 4R4OA 4MTDA 1HFGA 1GUOA 4FXKC 3CRLC 1YJNA 1HZAA 1U4MA 2NTSA 4YCWA 5BR8L 4DPGA 1A3TA 1VQ6A 1MHWC 4M8AA 1H95A 4BY1H 3J81W 3T1HL 3GIKA 2OF1A 4XYOA 4KK7A 4N9TA 3TP8A 1FNWA 1KXLA 2PW7A 4ED0A 5KFSA 5LP6F 2VPQA 4J15A 3JAMc 2ICIA 1XMOQ 4IURA 2QYZA 5H1SE 4GLXA 1YNJC 2UU9L 1VBGA 3OSOA 2J6UA 3WNZA 2F3WA 4HJ8A 1GM5A 5DGBA 2HQLA 2YRWA 4RCOA 1QVFA 4DK1A 3T53B 4DV1H 1A15A 3EPGA 5IGDA 3G6EA 4LNQA 4KHPQ 4M7EA 1FGUA 3MVVA 1B1ZA 3KOJA 1N36H 5IYBG 2J9GA 5K36H 3HXLA 1LT3D 2CZGA 1IBMQ 3HOXH 5IGCA 5KNCA 2PI2E 2YTYA 3RNUA 1B3QA 1I4GA 3OOCA 4B9WA 1C8CA 1E2WA 3HOYG 3RAQA 5C6AA 3GTMB 4DR5L 5IP9G 1K83A 3BVMA 3GV8B 5BN4A 5D1OA 3M9BA 3G6JB 5F9LA 4ED6A 1I4PA 5IWAL 4MV9A 5C1PA 2W7OA 5M3MB 2WAQG 2YZMA 2Y0SE 4NPSA 4ZQ3A 5C5LA 1JJCB 5ELEA 4POGA 1Y1WG 2IX3A 3PMFA 1I3QH 3H0GB 2PZWA 1N8RC 2RGRA 3HOZH 2F0HA 2R93B 4HSVA 2W6OA 4XYLB 3KLSA 3RD4A 4RB1A 3CRKC 1ASYA 1Y1VG 5FO7B 5G3LF 4XT1B 4BBSG 1ZYRC 1O7IA 4YCVA 3N6XA 1TWFA 3U9OA 4DV4H 1W96A 1X32A 4FVMA 3VR3A 3PIOA 1WTOA 4RUAA 1TVXA 3UFXB 1A62A 4UPAA 2WINB 2R7ZG 2K75A 4GS3A 4GOPB 3I4MB 3RB3A 2BA0A 2CFMA 3CAMA 4G57A 3ERSX 3ONAB 5J22A 1I7LA 2K03A 3CQZH 4JBWA 4O2AF 3WOEA 4ZCKA 5IP7G 3K5LA 4DAMA 1T5EA 2EYOA 1N56A 5E1FA 2B2YC 1B3AA 2V5AA 5DQIA 1D6EC 1GVPA 3MC0B 3NE5B 5C44H 1PH8A 4AQYH 2YS6A 2M05A 3F8NA 4QIWE 2NZ1D 2VNUD 4R9WA 4DLKA 2VUMA 3OWEB 2IMWP 3L0OA 4AQYQ 4JI4H 2BCOA 3D6WA 1SXTA 3R8BA 1VQEA 3RBDA 5FLXc 3A8KE 3PUYA 2F0KA 2EJGC 3X3MA 5C3WA 3FP9A 3CCRA 4GKKQ 3QFFA 3QR8A 4ZRZA 4JI4Q 1SYDA 1JLLB 2DNCA 3G48A 3NWTA 2KEDA 3TDQA 1TY2A 1J5EL 4X64H 3LWUA 4K5XA 2EY1A 4NP5A 2KCTA 4UP8A 2Q8IB 4JI5L 5CC4A 2XVSA 1BGWA 3IFTA 2RA4A 1DM0B 4R8NA 3D6CA 5I6WA 2Z1CA 4BWGB 4R8UA 1ONLA 1STYA 2A73B 1YZ6A 4LF4Q 3U9TA 5L1IA 1N32Q 2F0GA 4JG2A 3Q0AA 2FMMA 1ENCA 2ALYB 1SMXA 4Q43A 1DOMA 4C3IB 3JAMi 3PN1A 4CDEC 3J7AK 3FDTA 2NN6G 5KG7A 3EIVA 3I4LA 4HJAA 3TQYA 1LTGD 5M5WB 4YB8B 3OW7A 4R8UB 1KNEA 5E4WC 2JJQA 4RB0A 5KT2A 4JI5H 1FNUA 1PZJD 1TQOA 3IRBA 4ME5A 3C1FA 3F8TA 4PMCA 4YR3A 2YCHA 4IWYA 2EY2A 2E76C 1AE2A 1TT2A 1LTSD 4LFAH 2W70A 3CCUA 1T3NA 2F0NA 1HUNA 3H40A 1XNRQ 4MV8A 4MTEA 5KT4A 1PH3A 2W8KA 4XQNA 1QOHA 5LMNH 1BCPD 5JVLA 4DV0Q 3GIPA 3R5HA 5IYCH 3PIPA 1K8OA 4IQZA 4LF7L 2HIXA 2LXJA 1K8AC 2HIVA 4HIOA 1BO0A 2E8GA 3Q24A 5EGTA 4QCLA 4A3JB 2N55A 4J6HA 5DM73 4LK1C 2W9BB 5JQWA 2C2DA 2ZDHA 3KF6B 3STBC 2Z4IA 1OTCA 1ULZA 3T16A 2R3ZA 1L0XB 2EZVA 4Z9CB 1E4EB 2WAQB 2EYFA 3T56B 1KQSA 1SEBD 4BBRB 2JA7A 4MV3A 4ZUJA 3K0YA 3PO2G 4DR2L 4K14A 4ZHQF 4B3SQ 1X3PA 1HUMA 3OTOL 4C3HB 1DXMA 2JEBI 2HGSA 4JI0H 1NAPA 1QZGA 4PV1C 2QF7A 4IUQA 1QE6A 3CW2C 3I8ZA 2VUMH 1TWAA 1BNCA 3GTKH 2A6EC 3GV6A 2UU9H 3BZKA 3EBEA 5I9PA 1FD7D 4DR6H 1KJJA 2KHJA 4YWLA 4ECYA 2RDIA 3OW2A 4A76A 2SOBA 4N8X1 1O78A 3FRPB 4K5WA 1VQGA 1YHBA 1STEA 2KJXA 3VA7A 1A8VA 1R9TB 2ZM6Q 2YRXA 5LMUQ 1JOOA 1L1OB 3WOFA 4TQUS 1VQ5A 3TQTA 4LFCL 4EYIB 1BBWA 1MIUA 4C3IH 1T36A 3S1RB 2R87A 2JYOA 1CHQD 2UXCQ 1B2TA 1STHA 4KY5A 2BOSA 1KD1C 2LY7A 4YP3A 4PWQA 3U4ZA 1D1KA 1PYBA 1V9PA 1NNXA 5ISRA 1WTWA 3DXJC 1Q86C 4YHHQ 3MWEA 1F2ZA 2ZTEA 3PW2A 1CFMA 1VQKA 4DV6L 3KLRA 1VQ7A 3H0GA 2JEJA 1KAAA 1P16A 4EQOA 3I4NB 2F4IA 4J9KA 3BDLA 2XD4A 3RUPA 4DV2H 1LTRD 1PFNA 4RA8A 1KNAA 4HMJA 1PX2A 4DV3Q 4DFAA 3DM3A 1IOVA 4DV0H 3V6JA 3A74A 4B08A 4C2MB 4EQNA 4ECZA 3U9SA 4JYAL 2F0WA 3TINA 5EAYA 3CCSA 1HR0Q 4O2DA 5LMUL 3F2DA 4OHJA 4MAMA 2X6LA 1I6VC 1XNRL 5C5JA 4Q5VA 1PVOA 1G2TA 1K73C 5L1LA 3FVQA 2RGVA 5KFUA 2C5CA 4U68A 2PZUA 1NMGA 1TWHA 1M0TA 4QGUA 3CPWA 4IALA 2O5IC 2QDBA 5KFXA 3Q22A 3SE7A 1HR0L 3IKJA 1JWMD 5IYDG 1D5ZC 1K3BC 1D2BA 4DK6C 2JE6I 4BBRG 2MGSA 1H9JA 2K28A 3JSNA 1BXRA 2B3GA 4A3FH 4X62H 1IW7C 1NJIC 2HHHQ 1U5KA 3VA5A 2MJ8A 4NB3A 2ZXPA 3NTIA 5KG4A 4DR3Q 4YAKB 2E2HB 4EX5A 4DV0L 2NVQB 2FHTA 2JN4A 5JPNC 4NXMH 4A3JG 4RHSA 4DAVA 2ZJPA 4NMZA 2Z4HA 2N8NA 3EN2A 1L0YB 1SE3A 4DV4Q 2J7ZA 5BPHA 5AJ3L 1H9SB 4DUZL 4CJ0B 4G7ZC 5KFZA 2JA6G 1IYVA 3CF5A 3CC4A 3PUZA 3FMCA 3J81c 2A68C 4LFBL 5KFHA 2R93A 4HNUA 5IP7H 5CV5A 3K80C 4R8IA 2YV5A 2KCNA 5IY0A 3GTLA 4I50F 3HOWH 1RCVD 4UCSA 5C44G 3GTPH 1KC7A 4A3BH 2PZTA 3L4KA 3JC66 4BBSH 2K33A 1TWGH 2FPIB 3Q8DA 3NENA 5CGKA 2NVXH 2GLTA 3KLSX 1B7YB 4GNXB 2KECA 3FHWA 4X66L 3NSWA 3HEJA 3ND9A 5M5XB 1RTNA 3KF8A 1S5DD 1BNZA 1U0LA 2B63G 1STAA 1M0WA 1KABA 4JPBW 1ZHQA 3DMUA 4L5TA 1CT1D 1Y8NB 5KFIA 3MXGA 2PO4A 4IR9A 4BY1B 5JJZA 3ZYYX 3T1YQ 2G9HD 4NXNL 1FGBD 3GTGA 1C4QA 3OHXC 5IGFA 5C3EH 2UUBQ 3HKSA 3TBIB 4A3CH 4I7HA 1GOZA 3J81L 3KALA 4P72A 1STBA 3AU7A 3BJUA 2VUMB 1WFQA 4X66Q 5C44B 3A56A 3QG1A 1K8GA 4X65H 3I2ZA 2I8CA 1BKBA 2PI2A 1B53A 4JI1Q 2UVRA 4J9LA 3M7NA 2FKLA 3Q8RB 1N33H 5EBDA 2L12A 4DR3L 3FDSA 4JV5H 3MWYW 2R8JA 2D5DA 2O4XA 4A93H 2R7KA 3WO1A 1RDPD 2DPIA 2F4VH 5IGEA 1YHAA 2Q8TA 1M90C 1Q8KA 1PFMA 2F3IA 5TSSA 2R92H 1BF4A 3NQTA 2DY8A 4MV6A 2B2UC 3TIGA 5KNBA 4K5VA 2FK3A 1S5ED 4C1NI 4UCVA 2XWBB 4L8JA 4QWDA 4LH7A 1EUCB 1S9FA 4YIJA 2YU9B 2NVQH 1UC8A 3CPFA 1RODA 2EYHA 3EJIA 2UUBL 3AMUA 3N44B 3MAQA 3EA6A 4U7CA 4JI7Q 1WTPA 4DNIA 2SCUB 4F50A 3Q8PB 2HJWA 5M5WH 3UDFA 5HBRB 3KHGA 1CTMA 4GC7A 1JE4A 4IN3A 4LF5Q 2GN5A 5I6YA 1D7QA 3PO3H 5IODA 4JI4L 2YU9H 4JI1L 1I94L 2GA4B 1N33Q 3N40P 3OHAA 3H20A 3TMEA 1OWTA 1IL8A 3R2TA 2MNAA 3RFCA 1KBLA 2ZDGA 1CQVA 4FDBA 1VQBA 4HTHA 4LF8L 2VQFQ 3KF8B 2AHOB 1W6KA 3PV0A 1S0MA 2W9AA 1CM9A 2DUDA 4U6PA 4UDUC 1SCUB 3PW4A 5FLXW 2J4XA 2Z9HA 2E2HH 2I07B 5ELCA 1DV1A 5FLMH 2P0AA 1DYQA 4TUYF 2ZXOA 4DR4H 2AWOA 5KFWA 4QL5A 1G91A 4YJ2F 5C0XJ 3MZ5A 4NXMQ 2AUKA 2UXCL 2KUMA 4J8QA 4RGNA 1QZHA 1EY5A 4A3GG 2XGTA 2HHHH 5COYA 1BJTA 2RHQB 5KFNA 1UC9A 2BE5C 1MJEA 1UE7A 5KG1A 1SSOA 3RAXA 1OXVA 2UXBL 3RZDH 2E2IA 2PNHA 4L1KA 1RJQA 4UAIA 1VDZA 2HDLA 4YY3L 1G2SA 1L2ZA 5KFMA 3K8AA 2SDFA 3EROA 1TWAB 1HNWQ 3JRWA 3QWNA 2KEEA 5KFLA 3FKIH 4LF8H 2AGQA 4OELB 1A63A 2P5ZX 5IT9c 1YITA 1RJTA 2CH4A 5ELNA 1EYDA 3J80E 3RTXA 5I47A 1B4OA 3S2HH 2RDFA 3KDFA 3S1MH 2PQAB 2N3SA 1HZBA 3CCEA 4A3KB 1EYAA 3RJ0A 4BBSB 4ED3A 5FPRA 4QWCA 2AWNA 1Q82C 4ZYSA 1N36Q 2JA8G 4EBDA 3S16H 2WB1B 2SNSA 3I91A 3NBHA 2EOTA 1CE8A 2E2JB 1V1QA 2ZJQA 2K14A 5JVH3 5GQOA 3TEHB 2EYJA 4A3KH 1EOVA 1YNND 1X65A 1U4RA 3K81C 1B6SA 1SJED 5JJLA 3M9MB 5HV6A 5A2QW 3TN2A 4EEYA 4O3SA 1TWFH 3M85A 5HY6A 4DAPA 3HG9A 4C3JH 1RYRA 3FKIB 1FKAH 3BJYA 1TWCH 5DLGA 2XWJB 5EPLA 5FPOA 1F9SA 3D4DA 1B6RA 4IAJA 2NU9B 4QIWB 2D0OA 2E2IH 1I3QA 1PH6A 2NZOA 4RAUC 4HR7A 1Y8PB 2BDOA 1G8ZD 1XYIA 3U4VA 1OXSC 2PNRC 5IT9E 1LV9A 5CBAE 1LACA 4DV3L 4A3EH 1NUCA 5IE8A 3A5ZB 1WD0A 2KCCA 1IBML 2CCZA 4ME6A 4MTNA 3S1NB 2YW2A 4IUPA 4QJFA 3VR2A 2UXBQ 3SK5A 4J9NA 4IJLA 4UHVA 3C2PA 3MEFA 2VQFL 3SEBA 4DV6Q 2EXZA 2F0JA 2W6ZA 4Q44A 3P75A 5CYUA 2UXDL 3KBGA 1MI2A 2B29A 2H5XA 1N32L 3CCLA 1Q12A 1FVIA 1O7YA 2IT1A 2XRSD 4R4QA 3MXNA 4J9SA 5EOYA 4TSSA 2EPBA 4RCNA 4R4TA 3KJOA 4ULLA 4A3DB 3QJYA 1G6PA 1GSOA 1RK6A 5DQGA 3KK7A 3DWAA 1A2TA 1AN7A 5M3FH 4LF8Q 4KY7A 4FF1A 2FP4B 4OXPA 1BCPC 2B8FA 3G6XA 3BDCA 3A8JE 3GTQA 1RTOA 4DL3A 3H09A 2NVTH 3BZDB 3GTJA 5KT5A 4F8MA 1I50H 4KJOA 4NDXA 3V96A 5KFOA 1WTVA 3DWPA 4C5AA 4C3JG 3M9NB 2C2EA 5LYJF 1Y14B 3GTMH 1O75A 1SNOA 2HQEA 4OIJA 2QA4A 2YU9A 4C56C 3RGXA 1CZGA 2NYZD 5EPJA 2B63B 3BZCA 4WJ4A 1NR4A 2IL8A 4A3BG 1SBBB 1AN8A 2K5QA 5JEAG 4I65A 5KRUA 3D31A 3L7ZC 2FE3A 2JK8A 1VQJA 1KLGD 4K6LA 2I0QA 4IUTA 2ZJRA 4EQ5A 4BA2I 5M5XH 3ULJA 1L1OC 5D8DA 2QW7A 3HOZB 4UCUA 2HVQA 4DV5L 2JEAI 3BQ0A 3M9OB 1LTAD 3N42B 3QZ8A 1XMQL 2UVUA 2JA8H 3NGDA 4BY7B 5FJ8H 4RU9A 1Y1VB 2EXDA 3OYYA 5A2QE 4IOCA 4V190 2R86A 1STNA 4DR3H 2K52A 4A3MG 1SFOH 4UCRA 4A75A 1PH9A 2CQYA 1XNRH 3ERQA 3E5NA 3D8GA 4DGZA 1QVGA 4LJZC 2WAQA 4A93G 4YR0A 3SHLA 2OTLA 4ED2A 1V1OA 5CORA 4O2BF 3UE1A 3HKZE 3KFUA 1JOQA 4JI8L 3U58A 4HCEA 3T5KA 4HSPA 3HOXG 4O3PA 1HR0H 4HNVA 1VQ8A 3A55A 5D65A 2BDNA 4LMQD 4P71A 3OTOQ 1RKNA 1C3OA 1CI3M 3I55A 3J7AV 1JJ2A 2E2IB 3FEWX 1PRTF 3GTPB 4ETSA 4GC6A 2B2WA 4KHPL 1KRSA 3HRZC 4H7BA 4KV6A 4JBJA 4R4IA 3J7AF 1SFOA 4IUNA 3H91A 1A3UA 2UVWA 1EWHA 1EIYB 3CQZA 2EE1A 3FKIA 4LMYA 2KBNA 4BXXH 4DV3H 1MSGA 1YVCA 4JI2Q 2F1MA 4Y7NH 4MN3A 4P73A 1GLVA 4IFDI 4ECUA 4DV6H 1NMFA 2FJ2A 4K0KH 4PZ8A 1GKHA 3N43B 4CC6A 3GP7A 1E1TA 3E6ZX 3CCVA 2QILA 2VPSA 3HB9A 1PTOH 1UNSA 4GOPA 1YI2A 3M4PA 3CCQA 1K0SA 1F9QA 3I70A 3K7AH 3NQIA 1S68A 1VKZA 4HNTA 1Q1BA 2PVPA 2R8KA 3QOLA 1W2BA 4OX9H 4C3IG 2JEIA 5JAVA 1G6ZA 2F0FA 3F2UA 1VMPA 5J39A 3SK6A 2J6TA 2KA7A 4IPHA 3S2DH 1WCMH 4ZAIA 4C3JB 1OO9B 3K3PA 2V4QA 5LHY1 3BS1A 2K5NA 3F1ZA 3R5XA 3UDXA 2CQOA 1S0NA 5I9OA 5LL6X 2F3VA 2XGPA 2V1CC 4DKAC 2EJFC 4JI2L 2FB9A 4FF2A 2AGOA 4FYDA 2O03A 1CKNA 5CA1F 2B2UA 4DV2Q 4OX9L 1I94Q 1Q8IA 5GAGC 3HOYB 4F88A 4X66H 1T9HA 5KFJA 3ND8A 2F0OA 5IP9H 2MO1A 1EHIA 4GN4B 4B3RL 1EZ1A 3HOVB 1BOSA 4LF7Q 1UEBA 5C3EB 2W7PA 3ORQA 1PLFA 3KBXA 2IHFA 1CA6A 4RFBA 3GTKB 4IFDG 1ILPA 2ZDQA 3LMLA 1D1IA 4A3MH 2OQKA 3NUCA 3PO2B 1TWGB 1DD2A 4CBVA 3I56A 4EEQA 3CQZB 3RLNA 1LABA 4MA0A 1JWSD 2AMCB 1SNQA 4TKOB 4IR1A 1PH2A 5J3BA 5EKKA 1GUWA 2FINB 4DV5H 4JI0L 2I46A 1EL0A 2HVRA 1SR3A 1KDAA 3H0GH 3HBLA 3H4BA 4DU9A 4JW0A 1O80A 2BE5D 3A54A 1RYSA 4A93B 3GTQB 3PIP3 1QNKA 3LWEA 2R92A 4HN7A 2E5LH 1GYFA 5EPKA 3HOWG 1ILQA 1YBYA 4AYBG 3DF7A 5M3MH 1WTXA 3Q23A 2NZHA 1CKOA 2DPJA 1IL2A 2B2YA 3HOVH 1T5XD 1Y1VH 2LFNA 4ECXA 3GTOB 1I3QB 2G5DA 1J5EH 1GUSA 2KSWA 2B63A 4DN4M 4DR5Q 3DEPA 2W6MA 5L37A 2Z6KA 2FK2A 2CWPA 3PR5B 1NCVA 1PTOF 4H13C 3PW0A 4RGTA 2WV6D 1A3VA 2EVBA 4JVZA 4MHEA 1TS3A 3PSIA 5I4DA 1TWCA 1ZETA 2AGPA 2EYLA 2JP1A 2ASBA 3LNNA 3QB3A 1Z47A 5DM63 1LO5D 4IFDH 1AUVA 4O4IF 4PDBA 3OTOH 1PRTB 1SNMA 3GTGB 1KHIA 4ABNA 4Y7NB 2I87A 1KJIA 2M00A 2Y0SA 4E4TA 4ZI7F 2C22A 3G8CA 3KXYT 2SEBD 1B50A 3PUVA 2ICEC 5BMVF 4KKSA 4A3FG 3MFHA 5CA0F 3J7YW 2HT1A 3JZIA 2WE6A 1AZPA 2K05A 5I2XA 3R93A 2WAQE 5L1KA 1BDOA 2R7LA 3S17H 4LFBQ 3RV3A 1FJGH 3PW7A 2V59A 5K5PA 3NTKA 1XMQQ 4RZRA 2W9CB 3VPDA 4MZ9A 3W5OA 1BCPF 2JA6B 3SK4A 5KGUA 1LTTD 3QZ7A 3DUZA 2R84A 2XC9A 2CW0C 4A3EB 2HD3A 4NLGA 4LFCH 4YWKA 4DR1Q 1BCPB 3RN5A 5EJWA 2C35B 4A3EG 2VL6A 5CR3A 1XTDA 4GOPC 5LL6b 2OH2A 1Q46A 2Q2HA 1DV2A 1GSHA 2RCNA 3BQ1A 5T14A 1HNXL 5CV8A 1IYJB 1SNCA 3E3XA 3CU7A 4IOAA 1X3FA 4R7RA 4JI6H 4AH6A 3CMAA 3T5LA 4MTKA 4DR4L 1JQYD 3A7LA 5KNDA 1Z7TA 1AZQA 4I7AA 1VF5C 2IW3A 3DM1A 3R5FA 1XTCD 4ECTA 5JJIA 1VQLA 5J2TF 5JUMA 3T5HA 3JSLA 1VQPA 3EVQA 2LMCB 2UXDH 3E9HA 4O3NA 3VR6A 5ELOA 1EEID 1PTOB 3LX0A 5LL6S 2EDGA 4RAZA 3I4OA 4LF6H 2OCEA 2Z8LA 2JA7B 2F0PA 4KHZA 4NKLA 4MV4A 1J5EQ 1NY4A 1VQDA 2NUCA 1SJHD 4JV5Q 3H94A 3RR5A 3H3VC 2L1BA 2Q2IA 4O4LF 4KY6A 1SLJA 3FKIG 4ED8A 2FLPA 2X69A 5C0XI 4DV1L 3PGZA 2ZXRA 5IT9L 3E5SA 2RCFA 2ZM6L 4Q45A 4IPGA 2R92G 3Q6SA 1R9TH 4U673 5CV6A 4YWMA 4K6DA 2IBKA 1IKLA 1B70B 1M8AA 3UQ8A 1ENFA 5KT7A 1E4FT 1VQOA 3HOUG 5BN3A 4G7OC 2MQHA 2NVYA 3MXPA 4FXDA 5DG7A 4BWSC 1S03G 3GLKA 1P8LA 4QUCA 5KG2A 1JX4A 5KIXA 3VYSA 5IYDH 1V51A 5CAEB 1RL2A 2AQ2B 3CXCA 3NBIA 1EUDB 2W6NA 4JI8Q 3D4RA 4L63B 1PH5A 3OUUA 3K57A 4WJ3M 5JOBA 1VQNA 1IW7D 3FPUB 4ECRA 5FLMG 1LM0A 1WD1A 2R92B 3LGJA 1N34H 3NP8A 2IPKD 2EY5A 2WB1A 4ZLTF 3RB6A 2KQ3A 4KN7C 2A1AA 1I4XA 3GTLB 4BY1G 2WACA 3TP5A 3UDIA 3GIDA 5BR8H 3RZDB 3HOVG 4O3QA 5KG3A 2E74C 2L11A 2NVXA 1J8IA 1FNVA 3RUZA 3SE0A 1RJPA 2GVBA 2L0CA 3OPOA 4DR6Q 1X3EA 3WO0A 3PO3B 3G6VA 1HZ9A 4L5QA 3SK8A 4OWWB 5AJ3Q 1IBMH 2NBFA 3W2DA 1YEZA 1MD2D 3H0GG 4HMIA 1PHJA 2GPSA 1R9TA 1UAPA 5GAHC 2C9OA 2ALZA 4M9UA 1HCZA 2R6GA 2LSSA 3ER0A 1V1PA 2M9VA 1PH1A 3HOXB 2IY5B 1V8QA 1WTHA 1FJGQ 4JI7H 4DNRB 2OT2A 1EOTA 1DCZA 3GIIA 3UE0A 2D2CC 3DWQA 4IZOA 5DG8A 4OONA 4K8IA 3N8DA 2B2VA 1YIJA 2H1EA 1KL9A 3KAJA 1QVCA 1HNWH 1CS0A 1S72A 3I73A 4CGYB 1QNUA 1WTRA 3GTQH 4X6AH 3OSNA 5IOCA 4JBMA 3GILA 2DLNA 4B3ML 2ATLA 3Q2OA 4DUZH 2NUAB 3A8IE 4DXGA 3GTPA 3K0XA 3FMAA 4JV1A 1HNXH 1SFOB 1HFNA 3S16B 2UUAH 2JQOA 5EDWA 4NW2A 5C4ZA 5KFTA 3H4DA 4JOIA 4RWSC 1XPOA 1IBKL 1A2UA 2R8IA 2R7MA 4NXNQ 1GGOA 3SGIA 4ZKBB 4YY3H 5DG9A 3NXWA 2PQAA 4KJNA 4O4HF 2Y0SB 3BU2A 1GXDC 1JIHA 5C1OA 4ODGA 4BS9A 2VZAA 3QOJA 2R8HA 1UE1A 3GTJH 4QWAA 3M7GA 4JBKA 3MR2A 1ESRA 3VR4A 2WYOA 2EQSA 1WR2A 1D8LA 3E0EA 2JEFA 1E1OA 1EQTA 2K32A 3TRZA 3ZJYC 1Z2PX 1TWHB 4WJWA 2HDMA 2F0LA 3GD7A 3G4SA 4X3KA 2IJ0A 2W8LA 1B33N 1EY9A 5CV4A 1SMYC 2K50A 2RDJA 4KD3A 1K28A 1XPUA 1IKMA 3EYYA 2YYAA 1MGSA 4HIKA 2QGQA 5KFVA 3KJPA 1SYCA 4DV1Q 2RSNA 1RK5A 1VBHA 2PN1A 2F0TA 5KFPA 3CD6A 3GV5B 2XN9C 4EBEA 3BABA 2OEOA 3GQBA 4TQRA 3AFQA 1TWHH 3O13A 4B3RQ 4N9PA 1IBLH 5HGTA 2AQ4A 4KKUA 4HYKA 3T5JA 1F2MA 1EIFA 2DJGC 4DV7L 3K7UC 1EU3A 4AIMA 3K5IA 1YJWA 4IUUA 1MBYA 1ZKOA 2B2TC 2CH4W 4M1UB 3R3OA 1F9RA 5FLXE 4A3IH 5KFAA 4YY3Q 4IO9A 3IL8A 4Q8FA 2VQEL 2HCCA 4AYBB 5EKIA 3CCMA 1TS2A 2E2DC 4A2BA 5IT9W 4HEDA 2VQDA 3S1QH 5A35A 1NTGA 1KRTA 4DUYH 2DWCA 3ORRA 4TV9F 5KT6A 3HFZB 5JJKA 4A3DH 3BQ2A 2KVMA 5J2UF 5JH7F 5NUCA 4QWBA 2NVYB 2ES2A 1HQRD 3PCOB 1A6XA 2GPWA 1DGSA 1YNNC 4JI8H 1KDBA 1C48A 2HCIA 4RNNA 5C4HA 1B44D 3KHRA 2CHBD 3VYRA 1F2YA 3S1QB 4TRDA 2DZDA 2V58A 4OO1H 2VQFH 2JA9A 1OXUA 1ICWA 5C5MA 2VA3A 1E3PA 2X6GA 1SYFA 1S5FD 5D1OB 3GQCA 1O7LA 4PZ7A 1TS4A 3D3RA 4MA5A 3E9IA 5ELBA 3T4AC 1FYCA 1UWVA 5E7NA 1K1SA 4DV7Q 1I7NA 4EFBA 3AFPA 4CJ2C 2R61A 1N33L 5HGQA 3T1YH 3W3AA 3SI8A 4B3MQ 1IYUA 3AYHB 4OO1I 1CQFA 1Y1WB 3IAYA 2F0IA 4AYBE 1C7YA 3V2TA 5C4JB 4A3GH 3RMHA 2FK1A 3RBEA 3AEVA 1CSQA 1N48A 4LWCA 3JAML 3GDEA 5C4XB 3OHBA 2XCLA 2PW5A 1HHVA 1Z6HA 3M3YH 2FLNA 2WFWA 1LLRD 2Z6BA 4XT3B 4PMWA 3W1BA 1F2LA 2BH2A 5M9OA 3CKIB 4RG1A 4L5SA 2F4VQ 1JDBB 2FFKB 4RUCA 1UEAB 4I7ZC 2JA8B 5LXTF 4EBCA 5AFWA 4XQJA 1JDEA 2BQ3A 4DF7A 1PA6A 1ML0D 1FR3A 4JI3Q 3KHLA 5DGAA 2UXBH 2NVTB 5JEAH 1IBKH 4IUVA 4AYBA 2EJMA 2RSOA 5ELDA 2W71A 1W3SA 4I4TF 2KCMA 2BQRA 2K5HA 3EQLC 5LA6F 4LF4L 1I50A 2YTVA 1PV4A 4K2KA 3K5OA 2L4NA 4DV2L 4B3TL 3V4SA 4EFEA 1JWUD 4UCTA 1N32H 1JC7A 2D9UA 5E3FA 4EYHB 1L0WA 1STGA 3L2PA 5C8YF 1ESFA 1XPRA 1CQJB 4K8JA 3KYHC 5I2YA 4A3BB 1XNQH 1Q1EA 1C0AA 3N6RA 2NU7B 2NN6I 4A4IA 1UE6A 5BR8Q 3PVXA 2F52A 3ITPA 1RIPA 4C1NK 1TIID 2CW7A 3TSSA 1PFBA 4HAEA 1JR0D 4GN3B 5F2DA 4OO1G 2VY3A 4J1MA 4B3TQ 3UI2A 1C9OA 2PCFB 1XXGA 2VW9A 2J6SA 1SRUA 3MXUA 3HP3A 1EZ8A 3S1RH 1PTOC 3VMMA 4Q8EA 3I7FA 5C4XG 3C1EA 3KUPA 5DNFA 2A74C 3MXNB 4QWEA 1PYSB 2UU9Q 4CKCA 1HPCA 2OTJA 1S97A 4J9OA 3IG0A 4HJ7A 4JI6Q 5KFFA 1SE8A 3RN2A 3EFXD 2VUGA 1K8MA 1U4LA 4EGQA 1SYXB 2IWHA 4JYAQ 1AEXA 2M2LA 4JCVE 2Q2UA 3PUWA 5C3EG 3K7AB 3RGZA 2JA7G 1V43A 5DLQE 4A3DG 5G3LD 1ZXTA 4RB2C 4B3SH 2PYKA 2HVSA 4XX0B 1PYWD 1LUZA 4JI1H 3VPBA 2CKZB 4EGJA 2NU8B 1WCMB 4GLAC 3CVZA 5E4XA 1PRTC 5A2QL 3CC7A 3K5HA 3KLWA 1BXTA 4CKBA 5DLFA 4JI3L 3K5NA 1JB3A 4ZK9B 1KJ9A 2VOBA 1EWCA 4X62Q 5GAEC 1TA8A 4LFBH 2RHSB 4ALPA 1CA5A 1Q90A 5H80A 4QW9A 1PZKD 3S14B 4FO2A 2B2WC 4ZKCB 2NWGA 2W9BA 3WDNA 1RF2D 2DIKA 1EWIA 3BG3A 5LMNQ 2Z0SA 1MZBA 2NN6H 5D1PA 4QB4A 5IGBA 2B2TA 1Z2NX 4CDCC 1CKMA 4DR1L 4A3JH 4LFAQ 4J9QA 1BUVT 1T94A 3T13A 4YHHL 3AQQA 1B8AA 2R93G 5KG5A 2K5DA 2PMZE 5FO9B 1E24A 1WVLA 3LWBA 4L5RC 2XTIA 3R23A 5GONF 1HNZQ 1EIGA 4YQWA 2F0EA 2UUCH 3GO5A 1JOKA 2MUYA 4BBRH 1S3OA 1CK1A 1WTQA 3J7A5 4GNXA 3GV3A 2CW8A 1SE2A 4LF5L 3T51B 2N78A 1S5BD 2K5VA 4POFA 2MCTA 4CDDC 1XNQQ 3L3OC 2B2VC 1Y1VA 2R85A 2IA6A 1CQIB 4GNXC 2D62A 3HKZG 2C00A 1EFWA 2IHEA 5ELFA 2I80A 5EWFA 4ILWA 3H3VH 3MR3A 4F4XA 4X3TA 4DNTB 1N36L 3RB0A 2XRQD 5KT3A 4LF9Q 1QILA 4UP7A 1WJJA 1KDCA 1FJGL 3J81j 2OLSA 3HS0C 2KENA 1DIKA 2A6HD 4C5BA 2VR1A 1PXUA 3GTMA 4JV2A 2E75C 4PQXA 3ICEA 4FF4A 4BA1I 4WBNF 4QF4A 4DR6L 4J9RA 4O1NA 4RGOS 2XNAC 1KTKA 1SAPA 2FMCA 2G9DA 2Y0SG 3J80c 2FPGB 4TV8F 3G6YA 3D4WA 4CKEA 3TIIA 4GKKL 4YBZB 2ZM6H 4IRDA 1EY0A 5IIFA 2UXDQ 2YYZA 2IP4A 3BYYB 2TMPA 1L2FA 2JA5H 1MKHA 2D0PA 3CC2A 4XYQA 4I55F 1D5MC 1X3QA 2A69D 4DUYQ 1XNQL 4RKLA 3Q8SB 1LTBD 2NTTA 5KFYA 3M3YB 3SXHA 4Q0YA 5T1IA 3DLLA 4DK3C 2RF4A 2A5HA 4ECVA 5KFCA 1AH9A 3H15A 4V0BA 2QEXA 5KFBA 2BH8A 1M6VA 1Y1WH 1VS0A 2RBMA 5KFQA 4OWXB 1GO3E 1EFID 4RHRA 3QO2A 3S2DB 1N9WA 3RZOH 3M4OH 3A5UA 3HOZG 4ZQIA 2I5MX 1ASZA 1HRJA 4IHJF 4QIWA 3N52A 3X3NA 4FF3A 4XZ3B 4LUZA 4HR7B 1HXYD 1TY0A 2VXWA 1ENAA 2PBZA 4APMA 3MWMA 5KFDA 2QEJC 4JV5L 5M3FB 1ET6A 2K01A 3JAMW 2L15A 4C2MH 4H02A 4O3OA 4JC0A 1HTLD 5M5YB 4E6IA 5M3FG 4DXFA 1CKNB 1PMRA
chains in the Genus database with same CATH topology
1NY4A 4XIGS 1N33Q 1NE3A 3B6YA 1VQDA 1VQHA 3PUXA 4JV5Q 2IX0A 4X64Q 3RR5A 2Q2IA 1SLJA 3FKIG 2MNAA 4DAYB 4FDBA 2BA1A 4DV4L 1VQBA 5C0XI 3PGZA 2VQFQ 4DV1L 1G51A 3KF8B 2AHOB 3PV0A 4LF8L 2VS1A 2DUDA 1JMCA 1X3GA 2ZM6L 4DV5Q 4IPGA 2E2HH 2R92G 1KIXA 5FLMH 3G71A 1LYLA 4APVA 1E7ZA 1Z9FA 1R9TH 1N34L 2AWOA 4YWMA 4Y52H 4QL5A 3F2BA 1B70B 5C0XJ 3HOUH 4R4OA 1NBWA 1VQOA 4NXMQ 3I4NG 3HOUG 2UXCL 1YJNA 1HZAA 1QZHA 4YCWA 4NXML 4YCUA 4C3HH 2MQHA 5BR8L 4A3GG 4DPGA 2WB1G 2XGTA 1VQ6A 1P8LA 1H95A 4BY1H 4DUYL 2RHQB 2N49A 2GVAA 3T1HL 5IYDH 5IWAQ 1RL2A 3CXCA 4DR7L 1MJEA 1UE7A 4JI8Q 5M5YH 4A3KG 3GTOH 1KXLA 3W1GA 1PH5A 4J15A 4WJ3M 3JAMc 1VQNA 1OXVA 1XMOQ 2UXBL 3RZDH 5H1SE 2PNHA 4GLXA 5FLMG 2UU9L 1LM0A 1X9NA 4K0KL 3LGJA 4YY3L 3K8AA 4HJ8A 1HNWQ 1GM5A 2HQLA 1QVFA 3FKIH 1A63A 5IT9c 3G6EA 1YITA 2A1AA 4DUZQ 4JI7L 5ELNA 4LNQA 4BY1G 3UDIA 4KHPQ 2LXKA 1FGUA 3KOJA 3GTGH 3S2HH 1HNXQ 5IYBG 3HOVG 3KDFA 3S1MH 2PQAB 2N3SA 1HZBA 3CCEA 1EQQA 1IBMQ 4A3LH 3HOXH 4MNOA 2PI2E 2YTYA 3RNUA 3H3VI 2GVBA 2AWNA 1Q82C 1X3EA 1N36Q 2JA8G 1AE3A 4DR6Q 3S16H 1MJCA 3HOYG 3UDGA 1HZ9A 4L5QA 4DR5L 1LTLA 5AJ3Q 4OWWB 5IP9G 3H0GG 1YEZA 1V1QA 1PHJA 1IBLQ 2ZJQA 2K14A 5GAHC 1WI5A 5GQOA 3M9BA 3TEHB 2IX1A 1PH1A 2R6GA 2LSSA 3ER0A 5IWAL 4A3KH 1I94L 1EOVA 2IY5B 1FJGQ 2WAQG 1X65A 1K83H 2AKWB 2Y0SE 3K81C 4NPSA 3UE0A 4JI0Q 1JJCB 4LF7L 4POGA 5JJLA 1TWFH 5LMNW 3M85A 5HY6A 1Y1WG 4C3JH 4OONA 4AQYL 1I3QH 1YIJA 1TWCH 1KL9A 1N8RC 1QVCA 4LFAL 3HOZH 1HR0W 1S72A 3GTQH 4X6AH 2K4KA 3I4MH 1E22A 4JBMA 3VDYA 4B3ML 2D0OA 2E2IH 1ASYA 1PH6A 1Y1VG 4BBSG 2NZOA 3K0XA 1O7IA 2WB1E 4YCVA 1XMOL 2E5LQ 4JI6L 3U4VA 1OXSC 3S15H 3PIOA 1K9MC 4A3EH 2JQOA 1OXTA 1XJVA 1IBML 5IE8A 3A5ZB 2CCZA 2OWOA 4JOIA 1A62A 4UPAA 4MTNA 1XPOA 1IBKL 4QJFA 2R7ZG 2K75A 4GS3A 4GOPB 2UXBQ 4IJLA 1IBLL 4NXNQ 3SGIA 2R7ZH 2BA0A 2CFMA 3CAMA 2PQAA 3ERSX 3BU2A 3MEFA 2VQFL 4OX9Q 4DV6Q 2VZAA 3CQZH 4JBWA 1VCIA 1TWAH 1UE1A 4IJHA 3GTJH 1VQ4A 4JBKA 5IP7G 2UXDL 4DAMA 2EQSA 2B29A 2H5XA 1D8LA 3E0EA 3CCLA 1N32L 1Q12A 1FVIA 2IT1A 3J80i 4IPCA 1E1OA 3TRZA 4R4QA 1GVPA 3ZJYC 5C44H 1PH8A 4LF6Q 2YTXA 3S24A 4GLVB 1WYDA 3GD7A 3G4SA 4R4TA 4QIWE 3KJOA 2UUAL 2VNUD 1YJ9A 1S40A 2K50A 3L0OA 4AQYQ 1XPUA 1HH2P 4OWTB 1VQFA 1G6PA 3U50C 4HIKA 2QGQA 2ATWA 3RLFA 3KJPA 1VQEA 5M3FH 4DV1Q 4LF8Q 5FLXc 3PUYA 3CCRA 4GKKQ 4OXPA 3CD6A 3FP9A 1HZCA 3AFQA 1X6OA 1TWHH 4JI4Q 4B3RQ 3GTLH 1X55A 3G48A 1J5EL 2NVTH 2VUMG 1EIFA 4DV7L 4UP8A 2KCTA 3K7UC 4JI5L 4AIMA 1YJWA 4HJ9A 1I50H 2A19A 4BY7H 4A3IH 4YY3Q 4IO9A 4PG3A 4R1JA 1YZ6A 2VQEL 4LF4Q 1N32Q 1Y14B 4JG2A 3CCMA 3GTMH 2ALYB 1JE5A 1SMXA 2QA4A 3PO2H 3HOYH 3S1QH 4WJ4A 1NTGA 1KRTA 3BZCA 4P74A 3JAMi 2UUCQ 5GADC 1BBUA 4A3BG 5JEAG 3HFZB 5JJKA 4A3DH 2NN6G 4IFDJ 1Q7YC 3D31A 3L7ZC 4GKJL 2E2JH 3EIVA 2JK8A 4HJAA 1VQJA 3TQYA 2ES2A 3PCOB 2I0QA 2ZJRA 1DGSA 1UE5A 4EQ5A 4BA2I 1SN8A 2JJQA 2ID0A 5M5XH 2KHIA 1EQRA 1L1OC 3ULJA 2CWAA 3IRBA 3F8TA 2B63H 4A3CG 2JA9A 3NBHB 1OXUA 4A3LG 1AE2A 4DV5L 2JEAI 1E3PA 3CMEA 3CCUA 4JI5Q 1XNRQ 1XMQL 3WWVA 1PH3A 2JA8H 4PZ7A 5FJ8H 4LUOA 4IOCA 2EXDA 2I5HA 3E9IA 3OYYA 1Q81C 4DV0Q 1UWVA 5E7NA 2K52A 4DV7Q 4A3MG 1SFOH 3AFPA 1VQAA 4IPDA 5IYCH 3PIPA 1IBKQ 4LF6L 1N33L 4A75A 4A3IG 2HIXA 2LXJA 2MFIA 5HGQA 2HIVA 1PH9A 1K8AC 4B3SL 4HIOA 2E8GA 4B3MQ 1QVGA 3AYHB 4A93G 4OO1I 3CP0A 2OTLA 2OQ0A 4AYBE 4A3GH 3KF6B 3STBC 1C7YA 1CUKA 1OTCA 3UE1A 2NVYH 1CSQA 3AEVA 4GKJQ 3HKZE 2JA6H 3KFUA 4LWCA 1SROA 4JI8L 3GDEA 3U58A 1KQSA 3HOXG 2JA5G 3M3YH 1VQ8A 1HNWL 2WFWA 1QUQA 4DR2L 4P71A 1CSPA 3PO2G 3OTOQ 4PMWA 4B3SQ 3W1BA 3I55A 1JJ2A 2BH2A 3OTOL 3S14H 2JEBI 3PO3H 5C4JH 4KI0A 4KHPL 1KRSA 4RG1A 4R4IA 4L5SA 4JBJA 4LF9L 2F4VQ 3HOWG 1QZGA 4QQBX 2R7FA 4R4CA 3CW2C 1EIYB 5GROA 2VUMH 3GTKH 2KBNA 3BZKA 1PA6A 3EBEA 4JI3Q 4BXXH 1YVCA 2KHJA 4JI2Q 4YWLA 4Y7NH 4P73A 3OW2A 4X64L 4A76A 1W3SA 4DR4Q 2KCMA 4IFDI 2K5HA 3PF4A 1NMFA 4LF4L 2YTVA 1PV4A 4PZ8A 1GKHA 2FXQA 1PH7A 3I4MG 1VQGA 1E1TA 1YHBA 3CCVA 4DV2L 4B3TL 1A8VA 1I6HH 3T1HQ 5C4XH 2ZM6Q 5LMUQ 4GOPA 1YI2A 3M4PA 3CCQA 2Q2TA 1L1OB 5K36G 1L0WA 3L2PA 3K7AH 4TQUS 1VQ5A 1XPRA 4LFCL 4K0KQ 1BBWA 1MIUA 4C3IH 1Q1BA 3KYHC 2Z6KC 1W2BA 1Q1EA 2UXCQ 1C0AA 2NN6I 4A4IA 1UE6A 4LUVA 3ULLA 2VQEQ 5BR8Q 1KD1C 4IPHA 2F52A 3S2DH 3U4ZA 1RIPA 1WCMH 4HIDA 1PYBA 1V9PA 4GN3B 4OO1G 2VY3A 2I5LX 1Q86C 4YHHQ 2R7DA 2ZTEA 1VQKA 4B3TQ 4DV6L 2K5NA 2WP8J 2UUCL 1C9OA 2VW9A 1VQ7A 3F1ZA 1SRUA 1P16A 2CQOA 3UDXA 4LF5Q 3S1RH 3KDFB 1YNXA 4GN5A 3I7FA 5C4XG 2V1CC 4DKAC 4JI2L 5M3MG 2DGYA 3MXNB 4TVAB 1PYSB 2UU9Q 1CKNA 4DV3Q 2OTJA 5C0XG 4HJ7A 3DM3A 4DR2Q 4JI6Q 1SE8A 3A74A 3D0FA 3RN2A 4JYAL 4DV2Q 4OX9L 1I94Q 5EAYA 5GAGC 4PZ6A 3CCSA 1HR0Q 3PO3G 4JYAQ 4O2DA 5LMUL 4KLKA 3F2DA 4JCVE 2Q2UA 3PUWA 1T9HA 5C3EG 2JA7G 1V43A 5DLQE 4A3DG 5IP9H 2MO1A 1XNRL 1YHQA 2R93G 1EUJA 4GN4B 1PVOA 1LUZA 1K73C 4B3RL 2E5LL 1GD7A 4RMFA 1FL0A 2CKZB 4JOIC 1VQMA 1PFSA 4GLAC 1NMGA 3CC7A 4LF7Q 1UEBA 3TREA 2A8VA 3KLWA 4QGUA 1J6QA 3CPWA 2IHFA 4JI3L 4IFDG 2JA7H 4A3MH 4X62Q 2OQKA 5GAEC 4X65Q 2RHSB 2MO0A 1HR0L 5IYDG 1IZ6A 4ALPA 4DK6C 4DR7Q 2JE6I 1JB7A 4QY7A 4BBRG 3I56A 1X56A 3RLNA 2B3GA 2AMCB 4A3FH 2HHHQ 1NJIC 1PH2A 1U5KA 5J3BA 1OXXK 1X54A 1VQCA 1EWIA 4NB3A 1KC8C 4JI0L 5LMNQ 1SR3A 2Z0SA 4DR3Q 2HHHL 3H0GH 4EX5A 4DV0L 1WOCA 1CKMA 4DR1L 4A3JG 3T1YL 4A3JH 2ZJPA 4LFAQ 2N8NA 3EN2A 4DV4Q 4YHHL 3AQQA 1B8AA 3KF6A 2F4VL 1YBYA 2PMZE 5AJ3L 4AYBG 4DUZL 5M3MH 1KAWA 1E24A 2JA6G 2NZHA 1CKOA 3PUZA 3CF5A 3CC4A 3ULPA 4L5RC 3J81c 2XTIA 1IL2A 4BY7G 5IYBH 3HOVH 4LFBL 1Y1VH 1HNZQ 3GO5A 4BBRH 1S3OA 3J7A5 4GNXA 5IP7H 1K0RA 4LF5L 3K80C 1JJGA 2N78A 2YV5A 5IY0A 2K5VA 4POFA 1XNQQ 3HOWH 3NELA 2R93H 4X65L 1IXRA 5C44G 3GTPH 4A3BH 5IYCG 4GNXC 2D62A 3HKZG 3JC66 4O0AA 2IHEA 4DR5Q 1EYGA 2Z6KA 1EFWA 4BBSH 1TWGH 3H3VH 2CWPA 3NENA 3Q8DA 1N36L 1VQ9A 3TS0A 2NVXH 1B7YB 4GNXB 4LF9Q 4UP7A 3M4QA 1WJJA 1VQIA 3PSIA 1FJGL 3J81j 3FHWA 4X66L 2KENA 4XTCS 1HNZL 1WCMG 1PH4A 2ASBA 4UY8C 1Z47A 1U0LA 2B63G 1KHIA 3ICEA 4L5TA 3J7ZC 3PF5A 4BA1I 1K3RA 4DR6L 3PUVA 3T1YQ 3STBD 2ZTCA 4A3FG 4NXNL 5C3EH 2UUBQ 3HKSA 3J80c 4A3CH 2Y0SG 2HT1A 1L1OA 4P72A 4GKKL 3BJUA 2WAQE 3RLOA 1WFQA 4X66Q 2UXDQ 3S17H 2YYZA 1K8GA 4LFBQ 1L2FA 3I2ZA 2JA5H 4LFCQ 1D7QA 1BKBA 1MKHA 2PI2A 1XMQQ 1HJPA 2D0PA 4JI1Q 4MZ9A 3W5OA 1M1KC 4BXXG 3M7NA 3CC2A 4DUYQ 1XNQL 2EIFA 4DR3L 3NEMA 4YWKA 4DR1Q 1TXYA 3A0JA 3RN5A 3J81i 3S1NH 2C35B 4A93H 3CCJA 4A3EG 2VL6A 1I5FA 3DLLA 1XTDA 4DK3C 4GOPC 3I4NH 1Q46A 2Q2HA 1YHAA 2RF4A 2RCNA 1QUQB 1M90C 1Q8KA 2ZTDA 3F2CA 2F3IA 3H15A 1AH9A 2QEXA 1BVSA 4LW1A 1N34Q 1HNXL 2R92H 1G291 2BH8A 1Y1WH 1IYJB 1VS0A 4IOAA 4P75A 4OWXB 1GO3E 1X3FA 1N9WA 4AH6A 2UUAQ 3RZOH 3CMAA 3M4OH 3A5UA 3HOZG 2I5MX 4X62L 1ASZA 4DR4L 2NVQH 3CPFA 4LUZA 2UUBL 5JJIA 1VQLA 4HIMA 3TS2A 4JI7Q 1VQPA 4DNIA 4HJ5A 3E9HA 3UDFA 5M5WH 2L15A 4C2MH 4H02A 4ME3A 2GN5A 4JC0A 5ELOA 5JEAJ 1A0IA 4UP9A 5M3FG 3I4OA 5FJ8G 2YU9H 2OCEA 4JI1L 4JI4L 1JT8A 4JV5L 5LMNL 1CKNB 4KHZA 4DV3L 1J5EQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NY4 A;  4XIG S;  1N33 Q;  1NE3 A;  3B6Y A;  1VQD A;  1VQH A;  3PUX A;  4JV5 Q;  2IX0 A;  4X64 Q;  3RR5 A;  2Q2I A;  1SLJ A;  3FKI G;  2MNA A;  4DAY B;  4FDB A;  2BA1 A;  4DV4 L;  1VQB A;  5C0X I;  3PGZ A;  2VQF Q;  4DV1 L;  1G51 A;  3KF8 B;  2AHO B;  3PV0 A;  4LF8 L;  2VS1 A;  2DUD A;  1JMC A;  1X3G A;  2ZM6 L;  4DV5 Q;  4IPG A;  2E2H H;  2R92 G;  1KIX A;  5FLM H;  3G71 A;  1LYL A;  4APV A;  1E7Z A;  1Z9F A;  1R9T H;  1N34 L;  2AWO A;  4YWM A;  4Y52 H;  4QL5 A;  3F2B A;  1B70 B;  5C0X J;  3HOU H;  4R4O A;  1NBW A;  1VQO A;  4NXM Q;  3I4N G;  3HOU G;  2UXC L;  1YJN A;  1HZA A;  1QZH A;  4YCW A;  4NXM L;  4YCU A;  4C3H H;  2MQH A;  5BR8 L;  4A3G G;  4DPG A;  2WB1 G;  2XGT A;  1VQ6 A;  1P8L A;  1H95 A;  4BY1 H;  4DUY L;  2RHQ B;  2N49 A;  2GVA A;  3T1H L;  5IYD H;  5IWA Q;  1RL2 A;  3CXC A;  4DR7 L;  1MJE A;  1UE7 A;  4JI8 Q;  5M5Y H;  4A3K G;  3GTO H;  1KXL A;  3W1G A;  1PH5 A;  4J15 A;  4WJ3 M;  3JAM c;  1VQN A;  1OXV A;  1XMO Q;  2UXB L;  3RZD H;  5H1S E;  2PNH A;  4GLX A;  5FLM G;  2UU9 L;  1LM0 A;  1X9N A;  4K0K L;  3LGJ A;  4YY3 L;  3K8A A;  4HJ8 A;  1HNW Q;  1GM5 A;  2HQL A;  1QVF A;  3FKI H;  1A63 A;  5IT9 c;  3G6E A;  1YIT A;  2A1A A;  4DUZ Q;  4JI7 L;  5ELN A;  4LNQ A;  4BY1 G;  3UDI A;  4KHP Q;  2LXK A;  1FGU A;  3KOJ A;  3GTG H;  3S2H H;  1HNX Q;  5IYB G;  3HOV G;  3KDF A;  3S1M H;  2PQA B;  2N3S A;  1HZB A;  3CCE A;  1EQQ A;  1IBM Q;  4A3L H;  3HOX H;  4MNO A;  2PI2 E;  2YTY A;  3RNU A;  3H3V I;  2GVB A;  2AWN A;  1Q82 C;  1X3E A;  1N36 Q;  2JA8 G;  1AE3 A;  4DR6 Q;  3S16 H;  1MJC A;  3HOY G;  3UDG A;  1HZ9 A;  4L5Q A;  4DR5 L;  1LTL A;  5AJ3 Q;  4OWW B;  5IP9 G;  3H0G G;  1YEZ A;  1V1Q A;  1PHJ A;  1IBL Q;  2ZJQ A;  2K14 A;  5GAH C;  1WI5 A;  5GQO A;  3M9B A;  3TEH B;  2IX1 A;  1PH1 A;  2R6G A;  2LSS A;  3ER0 A;  5IWA L;  4A3K H;  1I94 L;  1EOV A;  2IY5 B;  1FJG Q;  2WAQ G;  1X65 A;  1K83 H;  2AKW B;  2Y0S E;  3K81 C;  4NPS A;  3UE0 A;  4JI0 Q;  1JJC B;  4LF7 L;  4POG A;  5JJL A;  1TWF H;  5LMN W;  3M85 A;  5HY6 A;  1Y1W G;  4C3J H;  4OON A;  4AQY L;  1I3Q H;  1YIJ A;  1TWC H;  1KL9 A;  1N8R C;  1QVC A;  4LFA L;  3HOZ H;  1HR0 W;  1S72 A;  3GTQ H;  4X6A H;  2K4K A;  3I4M H;  1E22 A;  4JBM A;  3VDY A;  4B3M L;  2D0O A;  2E2I H;  1ASY A;  1PH6 A;  1Y1V G;  4BBS G;  2NZO A;  3K0X A;  1O7I A;  2WB1 E;  4YCV A;  1XMO L;  2E5L Q;  4JI6 L;  3U4V A;  1OXS C;  3S15 H;  3PIO A;  1K9M C;  4A3E H;  2JQO A;  1OXT A;  1XJV A;  1IBM L;  5IE8 A;  3A5Z B;  2CCZ A;  2OWO A;  4JOI A;  1A62 A;  4UPA A;  4MTN A;  1XPO A;  1IBK L;  4QJF A;  2R7Z G;  2K75 A;  4GS3 A;  4GOP B;  2UXB Q;  4IJL A;  1IBL L;  4NXN Q;  3SGI A;  2R7Z H;  2BA0 A;  2CFM A;  3CAM A;  2PQA A;  3ERS X;  3BU2 A;  3MEF A;  2VQF L;  4OX9 Q;  4DV6 Q;  2VZA A;  3CQZ H;  4JBW A;  1VCI A;  1TWA H;  1UE1 A;  4IJH A;  3GTJ H;  1VQ4 A;  4JBK A;  5IP7 G;  2UXD L;  4DAM A;  2EQS A;  2B29 A;  2H5X A;  1D8L A;  3E0E A;  3CCL A;  1N32 L;  1Q12 A;  1FVI A;  2IT1 A;  3J80 i;  4IPC A;  1E1O A;  3TRZ A;  4R4Q A;  1GVP A;  3ZJY C;  5C44 H;  1PH8 A;  4LF6 Q;  2YTX A;  3S24 A;  4GLV B;  1WYD A;  3GD7 A;  3G4S A;  4R4T A;  4QIW E;  3KJO A;  2UUA L;  2VNU D;  1YJ9 A;  1S40 A;  2K50 A;  3L0O A;  4AQY Q;  1XPU A;  1HH2 P;  4OWT B;  1VQF A;  1G6P A;  3U50 C;  4HIK A;  2QGQ A;  2ATW A;  3RLF A;  3KJP A;  1VQE A;  5M3F H;  4DV1 Q;  4LF8 Q;  5FLX c;  3PUY A;  3CCR A;  4GKK Q;  4OXP A;  3CD6 A;  3FP9 A;  1HZC A;  3AFQ A;  1X6O A;  1TWH H;  4JI4 Q;  4B3R Q;  3GTL H;  1X55 A;  3G48 A;  1J5E L;  2NVT H;  2VUM G;  1EIF A;  4DV7 L;  4UP8 A;  2KCT A;  3K7U C;  4JI5 L;  4AIM A;  1YJW A;  4HJ9 A;  1I50 H;  2A19 A;  4BY7 H;  4A3I H;  4YY3 Q;  4IO9 A;  4PG3 A;  4R1J A;  1YZ6 A;  2VQE L;  4LF4 Q;  1N32 Q;  1Y14 B;  4JG2 A;  3CCM A;  3GTM H;  2ALY B;  1JE5 A;  1SMX A;  2QA4 A;  3PO2 H;  3HOY H;  3S1Q H;  4WJ4 A;  1NTG A;  1KRT A;  3BZC A;  4P74 A;  3JAM i;  2UUC Q;  5GAD C;  1BBU A;  4A3B G;  5JEA G;  3HFZ B;  5JJK A;  4A3D H;  2NN6 G;  4IFD J;  1Q7Y C;  3D31 A;  3L7Z C;  4GKJ L;  2E2J H;  3EIV A;  2JK8 A;  4HJA A;  1VQJ A;  3TQY A;  2ES2 A;  3PCO B;  2I0Q A;  2ZJR A;  1DGS A;  1UE5 A;  4EQ5 A;  4BA2 I;  1SN8 A;  2JJQ A;  2ID0 A;  5M5X H;  2KHI A;  1EQR A;  1L1O C;  3ULJ A;  2CWA A;  3IRB A;  3F8T A;  2B63 H;  4A3C G;  2JA9 A;  3NBH B;  1OXU A;  4A3L G;  1AE2 A;  4DV5 L;  2JEA I;  1E3P A;  3CME A;  3CCU A;  4JI5 Q;  1XNR Q;  1XMQ L;  3WWV A;  1PH3 A;  2JA8 H;  4PZ7 A;  5FJ8 H;  4LUO A;  4IOC A;  2EXD A;  2I5H A;  3E9I A;  3OYY A;  1Q81 C;  4DV0 Q;  1UWV A;  5E7N A;  2K52 A;  4DV7 Q;  4A3M G;  1SFO H;  3AFP A;  1VQA A;  4IPD A;  5IYC H;  3PIP A;  1IBK Q;  4LF6 L;  1N33 L;  4A75 A;  4A3I G;  2HIX A;  2LXJ A;  2MFI A;  5HGQ A;  2HIV A;  1PH9 A;  1K8A C;  4B3S L;  4HIO A;  2E8G A;  4B3M Q;  1QVG A;  3AYH B;  4A93 G;  4OO1 I;  3CP0 A;  2OTL A;  2OQ0 A;  4AYB E;  4A3G H;  3KF6 B;  3STB C;  1C7Y A;  1CUK A;  1OTC A;  3UE1 A;  2NVY H;  1CSQ A;  3AEV A;  4GKJ Q;  3HKZ E;  2JA6 H;  3KFU A;  4LWC A;  1SRO A;  4JI8 L;  3GDE A;  3U58 A;  1KQS A;  3HOX G;  2JA5 G;  3M3Y H;  1VQ8 A;  1HNW L;  2WFW A;  1QUQ A;  4DR2 L;  4P71 A;  1CSP A;  3PO2 G;  3OTO Q;  4PMW A;  4B3S Q;  3W1B A;  3I55 A;  1JJ2 A;  2BH2 A;  3OTO L;  3S14 H;  2JEB I;  3PO3 H;  5C4J H;  4KI0 A;  4KHP L;  1KRS A;  4RG1 A;  4R4I A;  4L5S A;  4JBJ A;  4LF9 L;  2F4V Q;  3HOW G;  1QZG A;  4QQB X;  2R7F A;  4R4C A;  3CW2 C;  1EIY B;  5GRO A;  2VUM H;  3GTK H;  2KBN A;  3BZK A;  1PA6 A;  3EBE A;  4JI3 Q;  4BXX H;  1YVC A;  2KHJ A;  4JI2 Q;  4YWL A;  4Y7N H;  4P73 A;  3OW2 A;  4X64 L;  4A76 A;  1W3S A;  4DR4 Q;  2KCM A;  4IFD I;  2K5H A;  3PF4 A;  1NMF A;  4LF4 L;  2YTV A;  1PV4 A;  4PZ8 A;  1GKH A;  2FXQ A;  1PH7 A;  3I4M G;  1VQG A;  1E1T A;  1YHB A;  3CCV A;  4DV2 L;  4B3T L;  1A8V A;  1I6H H;  3T1H Q;  5C4X H;  2ZM6 Q;  5LMU Q;  4GOP A;  1YI2 A;  3M4P A;  3CCQ A;  2Q2T A;  1L1O B;  5K36 G;  1L0W A;  3L2P A;  3K7A H;  4TQU S;  1VQ5 A;  1XPR A;  4LFC L;  4K0K Q;  1BBW A;  1MIU A;  4C3I H;  1Q1B A;  3KYH C;  2Z6K C;  1W2B A;  1Q1E A;  2UXC Q;  1C0A A;  2NN6 I;  4A4I A;  1UE6 A;  4LUV A;  3ULL A;  2VQE Q;  5BR8 Q;  1KD1 C;  4IPH A;  2F52 A;  3S2D H;  3U4Z A;  1RIP A;  1WCM H;  4HID A;  1PYB A;  1V9P A;  4GN3 B;  4OO1 G;  2VY3 A;  2I5L X;  1Q86 C;  4YHH Q;  2R7D A;  2ZTE A;  1VQK A;  4B3T Q;  4DV6 L;  2K5N A;  2WP8 J;  2UUC L;  1C9O A;  2VW9 A;  1VQ7 A;  3F1Z A;  1SRU A;  1P16 A;  2CQO A;  3UDX A;  4LF5 Q;  3S1R H;  3KDF B;  1YNX A;  4GN5 A;  3I7F A;  5C4X G;  2V1C C;  4DKA C;  4JI2 L;  5M3M G;  2DGY A;  3MXN B;  4TVA B;  1PYS B;  2UU9 Q;  1CKN A;  4DV3 Q;  2OTJ A;  5C0X G;  4HJ7 A;  3DM3 A;  4DR2 Q;  4JI6 Q;  1SE8 A;  3A74 A;  3D0F A;  3RN2 A;  4JYA L;  4DV2 Q;  4OX9 L;  1I94 Q;  5EAY A;  5GAG C;  4PZ6 A;  3CCS A;  1HR0 Q;  3PO3 G;  4JYA Q;  4O2D A;  5LMU L;  4KLK A;  3F2D A;  4JCV E;  2Q2U A;  3PUW A;  1T9H A;  5C3E G;  2JA7 G;  1V43 A;  5DLQ E;  4A3D G;  5IP9 H;  2MO1 A;  1XNR L;  1YHQ A;  2R93 G;  1EUJ A;  4GN4 B;  1PVO A;  1LUZ A;  1K73 C;  4B3R L;  2E5L L;  1GD7 A;  4RMF A;  1FL0 A;  2CKZ B;  4JOI C;  1VQM A;  1PFS A;  4GLA C;  1NMG A;  3CC7 A;  4LF7 Q;  1UEB A;  3TRE A;  2A8V A;  3KLW A;  4QGU A;  1J6Q A;  3CPW A;  2IHF A;  4JI3 L;  4IFD G;  2JA7 H;  4A3M H;  4X62 Q;  2OQK A;  5GAE C;  4X65 Q;  2RHS B;  2MO0 A;  1HR0 L;  5IYD G;  1IZ6 A;  4ALP A;  4DK6 C;  4DR7 Q;  2JE6 I;  1JB7 A;  4QY7 A;  4BBR G;  3I56 A;  1X56 A;  3RLN A;  2B3G A;  2AMC B;  4A3F H;  2HHH Q;  1NJI C;  1PH2 A;  1U5K A;  5J3B A;  1OXX K;  1X54 A;  1VQC A;  1EWI A;  4NB3 A;  1KC8 C;  4JI0 L;  5LMN Q;  1SR3 A;  2Z0S A;  4DR3 Q;  2HHH L;  3H0G H;  4EX5 A;  4DV0 L;  1WOC A;  1CKM A;  4DR1 L;  4A3J G;  3T1Y L;  4A3J H;  2ZJP A;  4LFA Q;  2N8N A;  3EN2 A;  4DV4 Q;  4YHH L;  3AQQ A;  1B8A A;  3KF6 A;  2F4V L;  1YBY A;  2PMZ E;  5AJ3 L;  4AYB G;  4DUZ L;  5M3M H;  1KAW A;  1E24 A;  2JA6 G;  2NZH A;  1CKO A;  3PUZ A;  3CF5 A;  3CC4 A;  3ULP A;  4L5R C;  3J81 c;  2XTI A;  1IL2 A;  4BY7 G;  5IYB H;  3HOV H;  4LFB L;  1Y1V H;  1HNZ Q;  3GO5 A;  4BBR H;  1S3O A;  3J7A 5;  4GNX A;  5IP7 H;  1K0R A;  4LF5 L;  3K80 C;  1JJG A;  2N78 A;  2YV5 A;  5IY0 A;  2K5V A;  4POF A;  1XNQ Q;  3HOW H;  3NEL A;  2R93 H;  4X65 L;  1IXR A;  5C44 G;  3GTP H;  4A3B H;  5IYC G;  4GNX C;  2D62 A;  3HKZ G;  3JC6 6;  4O0A A;  2IHE A;  4DR5 Q;  1EYG A;  2Z6K A;  1EFW A;  4BBS H;  1TWG H;  3H3V H;  2CWP A;  3NEN A;  3Q8D A;  1N36 L;  1VQ9 A;  3TS0 A;  2NVX H;  1B7Y B;  4GNX B;  4LF9 Q;  4UP7 A;  3M4Q A;  1WJJ A;  1VQI A;  3PSI A;  1FJG L;  3J81 j;  3FHW A;  4X66 L;  2KEN A;  4XTC S;  1HNZ L;  1WCM G;  1PH4 A;  2ASB A;  4UY8 C;  1Z47 A;  1U0L A;  2B63 G;  1KHI A;  3ICE A;  4L5T A;  3J7Z C;  3PF5 A;  4BA1 I;  1K3R A;  4DR6 L;  3PUV A;  3T1Y Q;  3STB D;  2ZTC A;  4A3F G;  4NXN L;  5C3E H;  2UUB Q;  3HKS A;  3J80 c;  4A3C H;  2Y0S G;  2HT1 A;  1L1O A;  4P72 A;  4GKK L;  3BJU A;  2WAQ E;  3RLO A;  1WFQ A;  4X66 Q;  2UXD Q;  3S17 H;  2YYZ A;  1K8G A;  4LFB Q;  1L2F A;  3I2Z A;  2JA5 H;  4LFC Q;  1D7Q A;  1BKB A;  1MKH A;  2PI2 A;  1XMQ Q;  1HJP A;  2D0P A;  4JI1 Q;  4MZ9 A;  3W5O A;  1M1K C;  4BXX G;  3M7N A;  3CC2 A;  4DUY Q;  1XNQ L;  2EIF A;  4DR3 L;  3NEM A;  4YWK A;  4DR1 Q;  1TXY A;  3A0J A;  3RN5 A;  3J81 i;  3S1N H;  2C35 B;  4A93 H;  3CCJ A;  4A3E G;  2VL6 A;  1I5F A;  3DLL A;  1XTD A;  4DK3 C;  4GOP C;  3I4N H;  1Q46 A;  2Q2H A;  1YHA A;  2RF4 A;  2RCN A;  1QUQ B;  1M90 C;  1Q8K A;  2ZTD A;  3F2C A;  2F3I A;  3H15 A;  1AH9 A;  2QEX A;  1BVS A;  4LW1 A;  1N34 Q;  1HNX L;  2R92 H;  1G29 1;  2BH8 A;  1Y1W H;  1IYJ B;  1VS0 A;  4IOA A;  4P75 A;  4OWX B;  1GO3 E;  1X3F A;  1N9W A;  4AH6 A;  2UUA Q;  3RZO H;  3CMA A;  3M4O H;  3A5U A;  3HOZ G;  2I5M X;  4X62 L;  1ASZ A;  4DR4 L;  2NVQ H;  3CPF A;  4LUZ A;  2UUB L;  5JJI A;  1VQL A;  4HIM A;  3TS2 A;  4JI7 Q;  1VQP A;  4DNI A;  4HJ5 A;  3E9H A;  3UDF A;  5M5W H;  2L15 A;  4C2M H;  4H02 A;  4ME3 A;  2GN5 A;  4JC0 A;  5ELO A;  5JEA J;  1A0I A;  4UP9 A;  5M3F G;  3I4O A;  5FJ8 G;  2YU9 H;  2OCE A;  4JI1 L;  4JI4 L;  1JT8 A;  4JV5 L;  5LMN L;  1CKN B;  4KHZ A;  4DV3 L;  1J5E Q; 
#chains in the Genus database with same CATH topology
 4XIG S;  1NE3 A;  3L4J A;  4PNY A;  1SE4 A;  4IRK A;  2ZT9 C;  4RH6 A;  3J80 L;  4DAY B;  1BBX C;  4H0L C;  2BA1 A;  4DV4 L;  3GIM A;  4B3T H;  2EYP A;  2QDL A;  2FMA A;  4J9P A;  2BR0 A;  1C30 A;  2A6E D;  1E4G T;  4LSX A;  3G71 A;  1LYL A;  4Y52 H;  1E7Z A;  1Z9F A;  1UNN C;  5BPF A;  1XWE A;  3F2B A;  1VMC A;  3HOU H;  2RDH A;  1NBW A;  5C3X A;  3I4N G;  4O3R A;  3TQ1 A;  5FK9 C;  1K1Q A;  4DV7 H;  4FS1 A;  4NXM L;  4YCU A;  4C3H H;  2FPP B;  3OIQ A;  4WOR A;  2CQA A;  1D5X C;  2WB1 G;  1NSN S;  3J80 W;  1Y8O B;  3MA2 B;  2F0V A;  4DUY L;  1PRT D;  2N49 A;  1XMO H;  2GVA A;  5DAU A;  3TZU A;  3V6H A;  1U4P A;  5IWA Q;  2X0S A;  4DL4 A;  1H9K A;  4DR7 L;  5M5Y H;  4A3K G;  3GTO H;  1LT4 D;  3W1G A;  3HOU B;  3MTS A;  4DL7 A;  1VF7 A;  1TU2 B;  3S17 B;  4WFN 3;  2R7N A;  4FP5 D;  1DOK A;  4CJ1 B;  2Q8R E;  1X9N A;  4K0K L;  3SDZ A;  2F03 A;  4OL7 A;  4IWX A;  5D14 A;  4RKB A;  4GZY C;  3MR5 A;  1QWY A;  5FKA C;  3E0J A;  4J9M A;  1EY6 A;  2XCP A;  4KHV A;  1QG7 A;  4DUZ Q;  4JI7 L;  1HTP A;  2LXK A;  2A69 C;  3URY A;  3GTG H;  1HNX Q;  5FOB B;  1GSA A;  1IHZ A;  1EQQ A;  4A3L H;  1PTO D;  4MNO A;  1ZHS A;  3C3L A;  3H3V I;  4FU0 A;  1B04 A;  4A2A A;  2E2H A;  4O42 A;  4B9X A;  1AE3 A;  4G3I A;  1MJC A;  3UDG A;  3C46 A;  3OIP A;  3K59 A;  4KKT A;  1LTL A;  1I6H B;  1IBL Q;  1WI5 A;  4EG0 A;  2IX1 A;  2V9W A;  2WKD A;  1XX8 A;  3A7A B;  3V05 A;  5FD6 A;  1K83 H;  1EEF D;  2AKW B;  1QB5 D;  2QK4 A;  5LOV F;  3K5M A;  2DY7 A;  4JI0 Q;  5HUR A;  4ECS A;  3RF2 A;  5LMN W;  3BVZ A;  5KG0 A;  1I4R A;  2L9H A;  4AQY L;  2HUG A;  1S4Z A;  3S9W A;  2LS0 1;  4LFA L;  4ZUI A;  1HR0 W;  3HOW B;  5DEH A;  2K4K A;  3I4M H;  1E22 A;  4H44 C;  3VDY A;  1SDF A;  2WB1 E;  1PDQ A;  2F0U A;  1H9M A;  1HA5 A;  1ZYR D;  1XMO L;  2E5L Q;  4JI6 L;  3S15 H;  3GV7 B;  1K9M C;  1XJV A;  2DJF C;  1OXT A;  2OWO A;  3PIO 3;  2AU0 A;  1DJR D;  1IBL L;  4QW8 A;  4C5C A;  1W93 A;  2R7Z H;  2PMZ A;  4OX9 Q;  1VCI A;  4LAA A;  1TWA H;  1VQ4 A;  4IJH A;  4EQP A;  1E2V A;  1KJQ A;  1TKW B;  3JAM E;  4Y8V B;  3RB4 A;  4J0M A;  1TWF B;  3J80 i;  4IPC A;  3FPP A;  4LF6 Q;  4XQQ A;  2A68 D;  2YTX A;  3S24 A;  3GTO A;  2MPM A;  4GLV B;  1WYD A;  4ZOL F;  3S1M B;  2K7V A;  4FM9 A;  4LF7 H;  2UUA L;  3BYT B;  1YJ9 A;  1S40 A;  2AUJ D;  5KFE A;  2O5J C;  1HH2 P;  1LTI D;  1VQF A;  4OWT B;  3U50 C;  2ATW A;  1TS5 A;  5KFG A;  3RLF A;  5KEE A;  2YS7 A;  4WD3 A;  3NK9 A;  3RIZ A;  1XDN A;  1SEI A;  3OMG A;  3S15 B;  1HZC A;  4JK1 C;  2LKV A;  1X6O A;  1RHP A;  3GTL H;  4S3S A;  1X55 A;  2BQU A;  1EYC A;  2K1B A;  4JYA H;  1UUP A;  2VUM G;  2YZG A;  4YR2 A;  1E0B A;  2ASD A;  4HJ9 A;  2NU6 B;  2EYM A;  3NPP A;  2A19 A;  4BY7 H;  4FXG C;  2K5W A;  4PG3 A;  4R1J A;  1KLU D;  1XMQ H;  4KD4 A;  1YNJ D;  1JKJ B;  1S0O A;  1JE5 A;  5LMU H;  2FLL A;  3PO2 H;  3HOY H;  2O2L D;  4P74 A;  2N88 A;  5FLX L;  2UUC Q;  1HNZ H;  2QCP X;  5GAD C;  1BBU A;  4FBU A;  2F0M A;  4MV7 A;  3AB9 A;  3VYT A;  4IFD J;  2W6Q A;  1Q7Y C;  3TZD A;  4GKJ L;  3PR4 A;  3KTM A;  5DQH A;  5CMD A;  1V4Y A;  3MEH A;  5K2M A;  2L55 A;  1UE5 A;  5JVG 3;  3TP7 A;  1SN8 A;  3HKZ B;  2VB2 X;  1H9S A;  1Q3L A;  2ID0 A;  2KHI A;  1EQR A;  1RJR A;  1TWC B;  2CWA A;  2B63 H;  4A3C G;  3V4Z A;  3NBH B;  2RVL A;  4PMB A;  4A3L G;  5FD5 A;  4OEM B;  3CME A;  4JI5 Q;  4DR1 H;  2W57 A;  3WWV A;  2WDT A;  4B3M H;  4LUO A;  2R8G A;  2I5H A;  1Q81 C;  4DR2 H;  4YHH H;  3NTH A;  4LF6 L;  4IPD A;  1VQA A;  1IBK Q;  1Y1W A;  4A3I G;  2MFI A;  4GKJ H;  4KN4 C;  4B3S L;  5JVD F;  1EY8 A;  1GJX A;  1IOW A;  2UVV A;  4LF5 H;  3L9A X;  3OMC A;  1EIH A;  3PQI A;  4N8F A;  3CP0 A;  2WTF A;  1CHP D;  2OQ0 A;  2YL2 A;  4DR5 H;  4ED7 A;  3EPI A;  1CUK A;  4GKJ Q;  2NVY H;  5C0X H;  2JXM B;  2JA6 H;  1SRO A;  4FNF A;  4X3U A;  3RV4 A;  2JA5 G;  2UXC H;  2H4O A;  4EVO A;  2TSS A;  1HNW L;  1H9R A;  1QUQ A;  4RGM A;  1CSP A;  1E4E A;  1A9X A;  4K2L A;  3TP6 A;  3K58 A;  1EYZ A;  3CHB D;  1B9M A;  4L6T B;  4MV1 A;  3S14 H;  1I50 B;  5C4J H;  4KI0 A;  4IZ8 A;  4DL2 A;  4A3I B;  1ET9 A;  4LF9 L;  2JEG A;  3PW5 A;  4QQB X;  2R7F A;  3LP8 A;  4R4C A;  1EY4 A;  5GRO A;  2XGQ A;  2RQX A;  3BDO A;  3KAK A;  1RD9 D;  2DN8 A;  1W6J A;  3JRX A;  1Z2O X;  3ETH A;  4X64 L;  1GUN A;  5D3I B;  4DR4 Q;  4UFZ A;  4F4Y A;  3PF4 A;  2FXQ A;  1PH7 A;  3I4M G;  3M4Y A;  1SMY D;  1I6H H;  3T1H Q;  5C4X H;  1SYG A;  2R6F A;  4UCO A;  1JOR A;  5K36 G;  2Q2T A;  2VQE H;  4FS2 A;  4RNO A;  3OUZ A;  5EWG A;  4MIU A;  3J81 E;  4K0K Q;  3I3C A;  4F7X A;  5J1Z A;  2Z6K C;  1WSC A;  2XCA A;  4RNM A;  2RKS A;  2V4R A;  1K83 B;  3MHB A;  1JXL A;  1MSH A;  1I4H A;  2J0T D;  4LUV A;  3ULL A;  2VQE Q;  3GTJ B;  3MWD A;  1DZ1 A;  3VR5 A;  1F77 A;  1S5C D;  4HID A;  4LF9 H;  2I5L X;  4OGQ C;  5FO8 B;  2R7D A;  4QUF A;  1NR2 A;  5KFK A;  3P7J A;  2WP8 J;  2UUC L;  4YJ3 F;  1O7Z A;  2XIW A;  1AW7 A;  4XYM B;  1I4Q A;  3I12 A;  1R4P B;  3KDF B;  1YNX A;  4GN5 A;  1U9R A;  1GUG A;  5D3D A;  5M3M G;  1B9N A;  2DGY A;  4TVA B;  2YZN A;  3MJF A;  2PQE A;  4JI3 H;  5C0X G;  4DR2 Q;  4ED1 A;  2QKI C;  3D0F A;  2RDG A;  4RZQ A;  2C2R A;  2K6A A;  1Y69 U;  5EWE A;  3V6K A;  5EBC A;  4PZ6 A;  2WII B;  3PO3 G;  1AP0 A;  4DA2 A;  4KLK A;  5KFR A;  1DOL A;  5T1G A;  3OWF A;  1V1P B;  2CVR A;  2KOL A;  2L5T A;  1YHQ A;  3N41 B;  1EUJ A;  2XIG A;  5L9X A;  1I94 H;  2XSC A;  4XDX A;  2PMZ B;  2E5L L;  1GD7 A;  4RMF A;  1FL0 A;  1TWG A;  4JOI C;  1VQM A;  3MFI A;  2C28 A;  1PFS A;  3TRE A;  2A8V A;  2V4D A;  4C3H G;  5CV9 A;  4C2M A;  1J6Q A;  4X3S A;  2JA7 H;  3PZP A;  3Q8Q B;  1JCK B;  2W6P A;  4X65 Q;  2AQ1 B;  3GIJ A;  2MO0 A;  1IZ6 A;  1QJO A;  3MFG A;  5EKL A;  3BAA A;  4JUZ A;  1VAJ A;  4DR7 Q;  1I6U A;  1JB7 A;  4QY7 A;  2JA5 B;  1X56 A;  3IN5 A;  1QCB D;  1EQV A;  3M4I A;  2VA2 A;  3RZO B;  1OXX K;  1X54 A;  1VQC A;  1KC8 C;  5EZY F;  1HA6 A;  4HQ6 A;  2HHH L;  4YAJ B;  3BG5 A;  1R4Q B;  5IYZ F;  2ASL A;  3QIA A;  1WOC A;  3T1Y L;  5CB4 F;  1LT6 D;  4G4K A;  3DHQ A;  5KX5 F;  2R82 A;  1AUX A;  3KF6 A;  2F4V L;  3I72 A;  4A3G B;  1KAW A;  1JIC A;  2JA5 A;  2R7Z A;  3ULP A;  4BY7 G;  3ETJ A;  4IRC A;  4RAY A;  5IYB H;  4TQS A;  4F4W A;  4NXN H;  4CDF C;  1E2Z A;  3GIQ A;  4RB3 C;  3C0F B;  4Q0F A;  5F9N A;  1K0R A;  3OSP A;  1GHJ A;  1JJG A;  1TR5 A;  4XXE A;  1S10 A;  1SND A;  2R93 H;  2KHS A;  3NEL A;  2EY6 A;  2OXP A;  2MHV A;  4X65 L;  4ECQ A;  1IXR A;  2K04 A;  3IFD A;  5IYC G;  1SYB A;  1ICF B;  4O0A A;  4EGV A;  1EYG A;  3H6M A;  1M4V A;  5JPM C;  3G7L A;  5BN5 A;  3BA8 A;  1VQ9 A;  3TS0 A;  4A3F B;  3HZX A;  1WCM A;  3M4Q A;  1VQI A;  2ASJ A;  4XTC S;  1HNZ L;  3P20 A;  1BQQ T;  1WCM G;  1PH4 A;  4KHP H;  4UY8 C;  3HKZ A;  4F87 A;  3K3V A;  3S2H B;  2DNE A;  3J7Z C;  1CZW A;  3PF5 A;  1SNP A;  1K3R A;  5KG6 A;  1KJ8 A;  3P1H A;  4B3R H;  2F0D A;  2CW0 D;  2ZTC A;  4QMG A;  3STB D;  4DK0 A;  1PK8 A;  2F0Q A;  4KMU C;  1GUT A;  2B8G A;  2JA6 A;  5IWA H;  1L1O A;  3RLO A;  2F0S A;  1J9O A;  2JSO A;  4ECW A;  3VYU A;  4LF4 H;  3KHH A;  4LFC Q;  1F9P A;  4CC5 A;  2UUB H;  1EU4 A;  1DON A;  1HJP A;  3I90 A;  1SYE A;  1M1K C;  4BXX G;  2SNM A;  1GHK A;  4KTA A;  2B39 A;  2EIF A;  4F4Z A;  2AQ3 B;  3NEM A;  3M4O B;  3BVG A;  1TXY A;  1PZI D;  3A0J A;  3J81 i;  3S1N H;  3CCJ A;  1AFP A;  1I5F A;  3I4N H;  4A3M B;  4DL5 A;  1II3 A;  1QUQ B;  3F2C A;  2ZTD A;  1ZQ7 A;  5EQ0 A;  1BVS A;  3NHH A;  4LW1 A;  4WRD A;  1N34 Q;  1G29 1;  1EZ6 A;  4P75 A;  4G7H C;  1M7J A;  1KEE A;  2UUA Q;  5KYI A;  4JI2 H;  3R2I A;  4X62 L;  4DL6 A;  1WH2 A;  2ZJT A;  3DEO A;  4CHT B;  3VPC A;  3GTK A;  2R7Z B;  4LSA A;  3SVM A;  4ID6 A;  4LH6 A;  1TAE A;  4HIM A;  3TS2 A;  3T1H H;  1EY7 A;  3MFY A;  1HQM C;  4HJ5 A;  3K6O A;  3HGB A;  2VB3 X;  4HCS A;  4ME3 A;  5JEA J;  2A6H C;  1A0I A;  4UP9 A;  1ZEQ X;  5FJ8 G;  1JT8 A;  2ENB A;  4DAY A;  2MP1 A;  5LMN L;  4OIK A;  1LT5 D;  5CV7 A;  2E2J H;  2WKC A;  2NB0 A;  3B6Y A;  2W9C A;  1VQH A;  3PUX A;  3Q1K A;  1BR9 A;  2IX0 A;  4X64 Q;  2FJZ A;  2PPB C;  4FBT A;  4DR7 H;  5L1J A;  3NWS A;  1G51 A;  2VS1 A;  2NVX B;  4GKK H;  1JMC A;  1X3G A;  3BA9 A;  4JV0 A;  5IGG A;  4DV5 Q;  4P2C B;  1KIX A;  3SR1 A;  5CBE E;  1N34 L;  4APV A;  5KKN B;  5KYL A;  3MR6 A;  4R4O A;  4MTD A;  1HFG A;  1GUO A;  4FXK C;  3CRL C;  1YJN A;  1HZA A;  1U4M A;  2NTS A;  4YCW A;  5BR8 L;  4DPG A;  1A3T A;  1VQ6 A;  1MHW C;  4M8A A;  1H95 A;  4BY1 H;  3J81 W;  3T1H L;  3GIK A;  2OF1 A;  4XYO A;  4KK7 A;  4N9T A;  3TP8 A;  1FNW A;  1KXL A;  2PW7 A;  4ED0 A;  5KFS A;  5LP6 F;  2VPQ A;  4J15 A;  3JAM c;  2ICI A;  1XMO Q;  4IUR A;  2QYZ A;  5H1S E;  4GLX A;  1YNJ C;  2UU9 L;  1VBG A;  3OSO A;  2J6U A;  3WNZ A;  2F3W A;  4HJ8 A;  1GM5 A;  5DGB A;  2HQL A;  2YRW A;  4RCO A;  1QVF A;  4DK1 A;  3T53 B;  4DV1 H;  1A15 A;  3EPG A;  5IGD A;  3G6E A;  4LNQ A;  4KHP Q;  4M7E A;  1FGU A;  3MVV A;  1B1Z A;  3KOJ A;  1N36 H;  5IYB G;  2J9G A;  5K36 H;  3HXL A;  1LT3 D;  2CZG A;  1IBM Q;  3HOX H;  5IGC A;  5KNC A;  2PI2 E;  2YTY A;  3RNU A;  1B3Q A;  1I4G A;  3OOC A;  4B9W A;  1C8C A;  1E2W A;  3HOY G;  3RAQ A;  5C6A A;  3GTM B;  4DR5 L;  5IP9 G;  1K83 A;  3BVM A;  3GV8 B;  5BN4 A;  5D1O A;  3M9B A;  3G6J B;  5F9L A;  4ED6 A;  1I4P A;  5IWA L;  4MV9 A;  5C1P A;  2W7O A;  5M3M B;  2WAQ G;  2YZM A;  2Y0S E;  4NPS A;  4ZQ3 A;  5C5L A;  1JJC B;  5ELE A;  4POG A;  1Y1W G;  2IX3 A;  3PMF A;  1I3Q H;  3H0G B;  2PZW A;  1N8R C;  2RGR A;  3HOZ H;  2F0H A;  2R93 B;  4HSV A;  2W6O A;  4XYL B;  3KLS A;  3RD4 A;  4RB1 A;  3CRK C;  1ASY A;  1Y1V G;  5FO7 B;  5G3L F;  4XT1 B;  4BBS G;  1ZYR C;  1O7I A;  4YCV A;  3N6X A;  1TWF A;  3U9O A;  4DV4 H;  1W96 A;  1X32 A;  4FVM A;  3VR3 A;  3PIO A;  1WTO A;  4RUA A;  1TVX A;  3UFX B;  1A62 A;  4UPA A;  2WIN B;  2R7Z G;  2K75 A;  4GS3 A;  4GOP B;  3I4M B;  3RB3 A;  2BA0 A;  2CFM A;  3CAM A;  4G57 A;  3ERS X;  3ONA B;  5J22 A;  1I7L A;  2K03 A;  3CQZ H;  4JBW A;  4O2A F;  3WOE A;  4ZCK A;  5IP7 G;  3K5L A;  4DAM A;  1T5E A;  2EYO A;  1N56 A;  5E1F A;  2B2Y C;  1B3A A;  2V5A A;  5DQI A;  1D6E C;  1GVP A;  3MC0 B;  3NE5 B;  5C44 H;  1PH8 A;  4AQY H;  2YS6 A;  2M05 A;  3F8N A;  4QIW E;  2NZ1 D;  2VNU D;  4R9W A;  4DLK A;  2VUM A;  3OWE B;  2IMW P;  3L0O A;  4AQY Q;  4JI4 H;  2BCO A;  3D6W A;  1SXT A;  3R8B A;  1VQE A;  3RBD A;  5FLX c;  3A8K E;  3PUY A;  2F0K A;  2EJG C;  3X3M A;  5C3W A;  3FP9 A;  3CCR A;  4GKK Q;  3QFF A;  3QR8 A;  4ZRZ A;  4JI4 Q;  1SYD A;  1JLL B;  2DNC A;  3G48 A;  3NWT A;  2KED A;  3TDQ A;  1TY2 A;  1J5E L;  4X64 H;  3LWU A;  4K5X A;  2EY1 A;  4NP5 A;  2KCT A;  4UP8 A;  2Q8I B;  4JI5 L;  5CC4 A;  2XVS A;  1BGW A;  3IFT A;  2RA4 A;  1DM0 B;  4R8N A;  3D6C A;  5I6W A;  2Z1C A;  4BWG B;  4R8U A;  1ONL A;  1STY A;  2A73 B;  1YZ6 A;  4LF4 Q;  3U9T A;  5L1I A;  1N32 Q;  2F0G A;  4JG2 A;  3Q0A A;  2FMM A;  1ENC A;  2ALY B;  1SMX A;  4Q43 A;  1DOM A;  4C3I B;  3JAM i;  3PN1 A;  4CDE C;  3J7A K;  3FDT A;  2NN6 G;  5KG7 A;  3EIV A;  3I4L A;  4HJA A;  3TQY A;  1LTG D;  5M5W B;  4YB8 B;  3OW7 A;  4R8U B;  1KNE A;  5E4W C;  2JJQ A;  4RB0 A;  5KT2 A;  4JI5 H;  1FNU A;  1PZJ D;  1TQO A;  3IRB A;  4ME5 A;  3C1F A;  3F8T A;  4PMC A;  4YR3 A;  2YCH A;  4IWY A;  2EY2 A;  2E76 C;  1AE2 A;  1TT2 A;  1LTS D;  4LFA H;  2W70 A;  3CCU A;  1T3N A;  2F0N A;  1HUN A;  3H40 A;  1XNR Q;  4MV8 A;  4MTE A;  5KT4 A;  1PH3 A;  2W8K A;  4XQN A;  1QOH A;  5LMN H;  1BCP D;  5JVL A;  4DV0 Q;  3GIP A;  3R5H A;  5IYC H;  3PIP A;  1K8O A;  4IQZ A;  4LF7 L;  2HIX A;  2LXJ A;  1K8A C;  2HIV A;  4HIO A;  1BO0 A;  2E8G A;  3Q24 A;  5EGT A;  4QCL A;  4A3J B;  2N55 A;  4J6H A;  5DM7 3;  4LK1 C;  2W9B B;  5JQW A;  2C2D A;  2ZDH A;  3KF6 B;  3STB C;  2Z4I A;  1OTC A;  1ULZ A;  3T16 A;  2R3Z A;  1L0X B;  2EZV A;  4Z9C B;  1E4E B;  2WAQ B;  2EYF A;  3T56 B;  1KQS A;  1SEB D;  4BBR B;  2JA7 A;  4MV3 A;  4ZUJ A;  3K0Y A;  3PO2 G;  4DR2 L;  4K14 A;  4ZHQ F;  4B3S Q;  1X3P A;  1HUM A;  3OTO L;  4C3H B;  1DXM A;  2JEB I;  2HGS A;  4JI0 H;  1NAP A;  1QZG A;  4PV1 C;  2QF7 A;  4IUQ A;  1QE6 A;  3CW2 C;  3I8Z A;  2VUM H;  1TWA A;  1BNC A;  3GTK H;  2A6E C;  3GV6 A;  2UU9 H;  3BZK A;  3EBE A;  5I9P A;  1FD7 D;  4DR6 H;  1KJJ A;  2KHJ A;  4YWL A;  4ECY A;  2RDI A;  3OW2 A;  4A76 A;  2SOB A;  4N8X 1;  1O78 A;  3FRP B;  4K5W A;  1VQG A;  1YHB A;  1STE A;  2KJX A;  3VA7 A;  1A8V A;  1R9T B;  2ZM6 Q;  2YRX A;  5LMU Q;  1JOO A;  1L1O B;  3WOF A;  4TQU S;  1VQ5 A;  3TQT A;  4LFC L;  4EYI B;  1BBW A;  1MIU A;  4C3I H;  1T36 A;  3S1R B;  2R87 A;  2JYO A;  1CHQ D;  2UXC Q;  1B2T A;  1STH A;  4KY5 A;  2BOS A;  1KD1 C;  2LY7 A;  4YP3 A;  4PWQ A;  3U4Z A;  1D1K A;  1PYB A;  1V9P A;  1NNX A;  5ISR A;  1WTW A;  3DXJ C;  1Q86 C;  4YHH Q;  3MWE A;  1F2Z A;  2ZTE A;  3PW2 A;  1CFM A;  1VQK A;  4DV6 L;  3KLR A;  1VQ7 A;  3H0G A;  2JEJ A;  1KAA A;  1P16 A;  4EQO A;  3I4N B;  2F4I A;  4J9K A;  3BDL A;  2XD4 A;  3RUP A;  4DV2 H;  1LTR D;  1PFN A;  4RA8 A;  1KNA A;  4HMJ A;  1PX2 A;  4DV3 Q;  4DFA A;  3DM3 A;  1IOV A;  4DV0 H;  3V6J A;  3A74 A;  4B08 A;  4C2M B;  4EQN A;  4ECZ A;  3U9S A;  4JYA L;  2F0W A;  3TIN A;  5EAY A;  3CCS A;  1HR0 Q;  4O2D A;  5LMU L;  3F2D A;  4OHJ A;  4MAM A;  2X6L A;  1I6V C;  1XNR L;  5C5J A;  4Q5V A;  1PVO A;  1G2T A;  1K73 C;  5L1L A;  3FVQ A;  2RGV A;  5KFU A;  2C5C A;  4U68 A;  2PZU A;  1NMG A;  1TWH A;  1M0T A;  4QGU A;  3CPW A;  4IAL A;  2O5I C;  2QDB A;  5KFX A;  3Q22 A;  3SE7 A;  1HR0 L;  3IKJ A;  1JWM D;  5IYD G;  1D5Z C;  1K3B C;  1D2B A;  4DK6 C;  2JE6 I;  4BBR G;  2MGS A;  1H9J A;  2K28 A;  3JSN A;  1BXR A;  2B3G A;  4A3F H;  4X62 H;  1IW7 C;  1NJI C;  2HHH Q;  1U5K A;  3VA5 A;  2MJ8 A;  4NB3 A;  2ZXP A;  3NTI A;  5KG4 A;  4DR3 Q;  4YAK B;  2E2H B;  4EX5 A;  4DV0 L;  2NVQ B;  2FHT A;  2JN4 A;  5JPN C;  4NXM H;  4A3J G;  4RHS A;  4DAV A;  2ZJP A;  4NMZ A;  2Z4H A;  2N8N A;  3EN2 A;  1L0Y B;  1SE3 A;  4DV4 Q;  2J7Z A;  5BPH A;  5AJ3 L;  1H9S B;  4DUZ L;  4CJ0 B;  4G7Z C;  5KFZ A;  2JA6 G;  1IYV A;  3CF5 A;  3CC4 A;  3PUZ A;  3FMC A;  3J81 c;  2A68 C;  4LFB L;  5KFH A;  2R93 A;  4HNU A;  5IP7 H;  5CV5 A;  3K80 C;  4R8I A;  2YV5 A;  2KCN A;  5IY0 A;  3GTL A;  4I50 F;  3HOW H;  1RCV D;  4UCS A;  5C44 G;  3GTP H;  1KC7 A;  4A3B H;  2PZT A;  3L4K A;  3JC6 6;  4BBS H;  2K33 A;  1TWG H;  2FPI B;  3Q8D A;  3NEN A;  5CGK A;  2NVX H;  2GLT A;  3KLS X;  1B7Y B;  4GNX B;  2KEC A;  3FHW A;  4X66 L;  3NSW A;  3HEJ A;  3ND9 A;  5M5X B;  1RTN A;  3KF8 A;  1S5D D;  1BNZ A;  1U0L A;  2B63 G;  1STA A;  1M0W A;  1KAB A;  4JPB W;  1ZHQ A;  3DMU A;  4L5T A;  1CT1 D;  1Y8N B;  5KFI A;  3MXG A;  2PO4 A;  4IR9 A;  4BY1 B;  5JJZ A;  3ZYY X;  3T1Y Q;  2G9H D;  4NXN L;  1FGB D;  3GTG A;  1C4Q A;  3OHX C;  5IGF A;  5C3E H;  2UUB Q;  3HKS A;  3TBI B;  4A3C H;  4I7H A;  1GOZ A;  3J81 L;  3KAL A;  4P72 A;  1STB A;  3AU7 A;  3BJU A;  2VUM B;  1WFQ A;  4X66 Q;  5C44 B;  3A56 A;  3QG1 A;  1K8G A;  4X65 H;  3I2Z A;  2I8C A;  1BKB A;  2PI2 A;  1B53 A;  4JI1 Q;  2UVR A;  4J9L A;  3M7N A;  2FKL A;  3Q8R B;  1N33 H;  5EBD A;  2L12 A;  4DR3 L;  3FDS A;  4JV5 H;  3MWY W;  2R8J A;  2D5D A;  2O4X A;  4A93 H;  2R7K A;  3WO1 A;  1RDP D;  2DPI A;  2F4V H;  5IGE A;  1YHA A;  2Q8T A;  1M90 C;  1Q8K A;  1PFM A;  2F3I A;  5TSS A;  2R92 H;  1BF4 A;  3NQT A;  2DY8 A;  4MV6 A;  2B2U C;  3TIG A;  5KNB A;  4K5V A;  2FK3 A;  1S5E D;  4C1N I;  4UCV A;  2XWB B;  4L8J A;  4QWD A;  4LH7 A;  1EUC B;  1S9F A;  4YIJ A;  2YU9 B;  2NVQ H;  1UC8 A;  3CPF A;  1ROD A;  2EYH A;  3EJI A;  2UUB L;  3AMU A;  3N44 B;  3MAQ A;  3EA6 A;  4U7C A;  4JI7 Q;  1WTP A;  4DNI A;  2SCU B;  4F50 A;  3Q8P B;  2HJW A;  5M5W H;  3UDF A;  5HBR B;  3KHG A;  1CTM A;  4GC7 A;  1JE4 A;  4IN3 A;  4LF5 Q;  2GN5 A;  5I6Y A;  1D7Q A;  3PO3 H;  5IOD A;  4JI4 L;  2YU9 H;  4JI1 L;  1I94 L;  2GA4 B;  1N33 Q;  3N40 P;  3OHA A;  3H20 A;  3TME A;  1OWT A;  1IL8 A;  3R2T A;  2MNA A;  3RFC A;  1KBL A;  2ZDG A;  1CQV A;  4FDB A;  1VQB A;  4HTH A;  4LF8 L;  2VQF Q;  3KF8 B;  2AHO B;  1W6K A;  3PV0 A;  1S0M A;  2W9A A;  1CM9 A;  2DUD A;  4U6P A;  4UDU C;  1SCU B;  3PW4 A;  5FLX W;  2J4X A;  2Z9H A;  2E2H H;  2I07 B;  5ELC A;  1DV1 A;  5FLM H;  2P0A A;  1DYQ A;  4TUY F;  2ZXO A;  4DR4 H;  2AWO A;  5KFW A;  4QL5 A;  1G91 A;  4YJ2 F;  5C0X J;  3MZ5 A;  4NXM Q;  2AUK A;  2UXC L;  2KUM A;  4J8Q A;  4RGN A;  1QZH A;  1EY5 A;  4A3G G;  2XGT A;  2HHH H;  5COY A;  1BJT A;  2RHQ B;  5KFN A;  1UC9 A;  2BE5 C;  1MJE A;  1UE7 A;  5KG1 A;  1SSO A;  3RAX A;  1OXV A;  2UXB L;  3RZD H;  2E2I A;  2PNH A;  4L1K A;  1RJQ A;  4UAI A;  1VDZ A;  2HDL A;  4YY3 L;  1G2S A;  1L2Z A;  5KFM A;  3K8A A;  2SDF A;  3ERO A;  1TWA B;  1HNW Q;  3JRW A;  3QWN A;  2KEE A;  5KFL A;  3FKI H;  4LF8 H;  2AGQ A;  4OEL B;  1A63 A;  2P5Z X;  5IT9 c;  1YIT A;  1RJT A;  2CH4 A;  5ELN A;  1EYD A;  3J80 E;  3RTX A;  5I47 A;  1B4O A;  3S2H H;  2RDF A;  3KDF A;  3S1M H;  2PQA B;  2N3S A;  1HZB A;  3CCE A;  4A3K B;  1EYA A;  3RJ0 A;  4BBS B;  4ED3 A;  5FPR A;  4QWC A;  2AWN A;  1Q82 C;  4ZYS A;  1N36 Q;  2JA8 G;  4EBD A;  3S16 H;  2WB1 B;  2SNS A;  3I91 A;  3NBH A;  2EOT A;  1CE8 A;  2E2J B;  1V1Q A;  2ZJQ A;  2K14 A;  5JVH 3;  5GQO A;  3TEH B;  2EYJ A;  4A3K H;  1EOV A;  1YNN D;  1X65 A;  1U4R A;  3K81 C;  1B6S A;  1SJE D;  5JJL A;  3M9M B;  5HV6 A;  5A2Q W;  3TN2 A;  4EEY A;  4O3S A;  1TWF H;  3M85 A;  5HY6 A;  4DAP A;  3HG9 A;  4C3J H;  1RYR A;  3FKI B;  1FKA H;  3BJY A;  1TWC H;  5DLG A;  2XWJ B;  5EPL A;  5FPO A;  1F9S A;  3D4D A;  1B6R A;  4IAJ A;  2NU9 B;  4QIW B;  2D0O A;  2E2I H;  1I3Q A;  1PH6 A;  2NZO A;  4RAU C;  4HR7 A;  1Y8P B;  2BDO A;  1G8Z D;  1XYI A;  3U4V A;  1OXS C;  2PNR C;  5IT9 E;  1LV9 A;  5CBA E;  1LAC A;  4DV3 L;  4A3E H;  1NUC A;  5IE8 A;  3A5Z B;  1WD0 A;  2KCC A;  1IBM L;  2CCZ A;  4ME6 A;  4MTN A;  3S1N B;  2YW2 A;  4IUP A;  4QJF A;  3VR2 A;  2UXB Q;  3SK5 A;  4J9N A;  4IJL A;  4UHV A;  3C2P A;  3MEF A;  2VQF L;  3SEB A;  4DV6 Q;  2EXZ A;  2F0J A;  2W6Z A;  4Q44 A;  3P75 A;  5CYU A;  2UXD L;  3KBG A;  1MI2 A;  2B29 A;  2H5X A;  1N32 L;  3CCL A;  1Q12 A;  1FVI A;  1O7Y A;  2IT1 A;  2XRS D;  4R4Q A;  3MXN A;  4J9S A;  5EOY A;  4TSS A;  2EPB A;  4RCN A;  4R4T A;  3KJO A;  4ULL A;  4A3D B;  3QJY A;  1G6P A;  1GSO A;  1RK6 A;  5DQG A;  3KK7 A;  3DWA A;  1A2T A;  1AN7 A;  5M3F H;  4LF8 Q;  4KY7 A;  4FF1 A;  2FP4 B;  4OXP A;  1BCP C;  2B8F A;  3G6X A;  3BDC A;  3A8J E;  3GTQ A;  1RTO A;  4DL3 A;  3H09 A;  2NVT H;  3BZD B;  3GTJ A;  5KT5 A;  4F8M A;  1I50 H;  4KJO A;  4NDX A;  3V96 A;  5KFO A;  1WTV A;  3DWP A;  4C5A A;  4C3J G;  3M9N B;  2C2E A;  5LYJ F;  1Y14 B;  3GTM H;  1O75 A;  1SNO A;  2HQE A;  4OIJ A;  2QA4 A;  2YU9 A;  4C56 C;  3RGX A;  1CZG A;  2NYZ D;  5EPJ A;  2B63 B;  3BZC A;  4WJ4 A;  1NR4 A;  2IL8 A;  4A3B G;  1SBB B;  1AN8 A;  2K5Q A;  5JEA G;  4I65 A;  5KRU A;  3D31 A;  3L7Z C;  2FE3 A;  2JK8 A;  1VQJ A;  1KLG D;  4K6L A;  2I0Q A;  4IUT A;  2ZJR A;  4EQ5 A;  4BA2 I;  5M5X H;  3ULJ A;  1L1O C;  5D8D A;  2QW7 A;  3HOZ B;  4UCU A;  2HVQ A;  4DV5 L;  2JEA I;  3BQ0 A;  3M9O B;  1LTA D;  3N42 B;  3QZ8 A;  1XMQ L;  2UVU A;  2JA8 H;  3NGD A;  4BY7 B;  5FJ8 H;  4RU9 A;  1Y1V B;  2EXD A;  3OYY A;  5A2Q E;  4IOC A;  4V19 0;  2R86 A;  1STN A;  4DR3 H;  2K52 A;  4A3M G;  1SFO H;  4UCR A;  4A75 A;  1PH9 A;  2CQY A;  1XNR H;  3ERQ A;  3E5N A;  3D8G A;  4DGZ A;  1QVG A;  4LJZ C;  2WAQ A;  4A93 G;  4YR0 A;  3SHL A;  2OTL A;  4ED2 A;  1V1O A;  5COR A;  4O2B F;  3UE1 A;  3HKZ E;  3KFU A;  1JOQ A;  4JI8 L;  3U58 A;  4HCE A;  3T5K A;  4HSP A;  3HOX G;  4O3P A;  1HR0 H;  4HNV A;  1VQ8 A;  3A55 A;  5D65 A;  2BDN A;  4LMQ D;  4P71 A;  3OTO Q;  1RKN A;  1C3O A;  1CI3 M;  3I55 A;  3J7A V;  1JJ2 A;  2E2I B;  3FEW X;  1PRT F;  3GTP B;  4ETS A;  4GC6 A;  2B2W A;  4KHP L;  1KRS A;  3HRZ C;  4H7B A;  4KV6 A;  4JBJ A;  4R4I A;  3J7A F;  1SFO A;  4IUN A;  3H91 A;  1A3U A;  2UVW A;  1EWH A;  1EIY B;  3CQZ A;  2EE1 A;  3FKI A;  4LMY A;  2KBN A;  4BXX H;  4DV3 H;  1MSG A;  1YVC A;  4JI2 Q;  2F1M A;  4Y7N H;  4MN3 A;  4P73 A;  1GLV A;  4IFD I;  4ECU A;  4DV6 H;  1NMF A;  2FJ2 A;  4K0K H;  4PZ8 A;  1GKH A;  3N43 B;  4CC6 A;  3GP7 A;  1E1T A;  3E6Z X;  3CCV A;  2QIL A;  2VPS A;  3HB9 A;  1PTO H;  1UNS A;  4GOP A;  1YI2 A;  3M4P A;  3CCQ A;  1K0S A;  1F9Q A;  3I70 A;  3K7A H;  3NQI A;  1S68 A;  1VKZ A;  4HNT A;  1Q1B A;  2PVP A;  2R8K A;  3QOL A;  1W2B A;  4OX9 H;  4C3I G;  2JEI A;  5JAV A;  1G6Z A;  2F0F A;  3F2U A;  1VMP A;  5J39 A;  3SK6 A;  2J6T A;  2KA7 A;  4IPH A;  3S2D H;  1WCM H;  4ZAI A;  4C3J B;  1OO9 B;  3K3P A;  2V4Q A;  5LHY 1;  3BS1 A;  2K5N A;  3F1Z A;  3R5X A;  3UDX A;  2CQO A;  1S0N A;  5I9O A;  5LL6 X;  2F3V A;  2XGP A;  2V1C C;  4DKA C;  2EJF C;  4JI2 L;  2FB9 A;  4FF2 A;  2AGO A;  4FYD A;  2O03 A;  1CKN A;  5CA1 F;  2B2U A;  4DV2 Q;  4OX9 L;  1I94 Q;  1Q8I A;  5GAG C;  3HOY B;  4F88 A;  4X66 H;  1T9H A;  5KFJ A;  3ND8 A;  2F0O A;  5IP9 H;  2MO1 A;  1EHI A;  4GN4 B;  4B3R L;  1EZ1 A;  3HOV B;  1BOS A;  4LF7 Q;  1UEB A;  5C3E B;  2W7P A;  3ORQ A;  1PLF A;  3KBX A;  2IHF A;  1CA6 A;  4RFB A;  3GTK B;  4IFD G;  1ILP A;  2ZDQ A;  3LML A;  1D1I A;  4A3M H;  2OQK A;  3NUC A;  3PO2 B;  1TWG B;  1DD2 A;  4CBV A;  3I56 A;  4EEQ A;  3CQZ B;  3RLN A;  1LAB A;  4MA0 A;  1JWS D;  2AMC B;  1SNQ A;  4TKO B;  4IR1 A;  1PH2 A;  5J3B A;  5EKK A;  1GUW A;  2FIN B;  4DV5 H;  4JI0 L;  2I46 A;  1EL0 A;  2HVR A;  1SR3 A;  1KDA A;  3H0G H;  3HBL A;  3H4B A;  4DU9 A;  4JW0 A;  1O80 A;  2BE5 D;  3A54 A;  1RYS A;  4A93 B;  3GTQ B;  3PIP 3;  1QNK A;  3LWE A;  2R92 A;  4HN7 A;  2E5L H;  1GYF A;  5EPK A;  3HOW G;  1ILQ A;  1YBY A;  4AYB G;  3DF7 A;  5M3M H;  1WTX A;  3Q23 A;  2NZH A;  1CKO A;  2DPJ A;  1IL2 A;  2B2Y A;  3HOV H;  1T5X D;  1Y1V H;  2LFN A;  4ECX A;  3GTO B;  1I3Q B;  2G5D A;  1J5E H;  1GUS A;  2KSW A;  2B63 A;  4DN4 M;  4DR5 Q;  3DEP A;  2W6M A;  5L37 A;  2Z6K A;  2FK2 A;  2CWP A;  3PR5 B;  1NCV A;  1PTO F;  4H13 C;  3PW0 A;  4RGT A;  2WV6 D;  1A3V A;  2EVB A;  4JVZ A;  4MHE A;  1TS3 A;  3PSI A;  5I4D A;  1TWC A;  1ZET A;  2AGP A;  2EYL A;  2JP1 A;  2ASB A;  3LNN A;  3QB3 A;  1Z47 A;  5DM6 3;  1LO5 D;  4IFD H;  1AUV A;  4O4I F;  4PDB A;  3OTO H;  1PRT B;  1SNM A;  3GTG B;  1KHI A;  4ABN A;  4Y7N B;  2I87 A;  1KJI A;  2M00 A;  2Y0S A;  4E4T A;  4ZI7 F;  2C22 A;  3G8C A;  3KXY T;  2SEB D;  1B50 A;  3PUV A;  2ICE C;  5BMV F;  4KKS A;  4A3F G;  3MFH A;  5CA0 F;  3J7Y W;  2HT1 A;  3JZI A;  2WE6 A;  1AZP A;  2K05 A;  5I2X A;  3R93 A;  2WAQ E;  5L1K A;  1BDO A;  2R7L A;  3S17 H;  4LFB Q;  3RV3 A;  1FJG H;  3PW7 A;  2V59 A;  5K5P A;  3NTK A;  1XMQ Q;  4RZR A;  2W9C B;  3VPD A;  4MZ9 A;  3W5O A;  1BCP F;  2JA6 B;  3SK4 A;  5KGU A;  1LTT D;  3QZ7 A;  3DUZ A;  2R84 A;  2XC9 A;  2CW0 C;  4A3E B;  2HD3 A;  4NLG A;  4LFC H;  4YWK A;  4DR1 Q;  1BCP B;  3RN5 A;  5EJW A;  2C35 B;  4A3E G;  2VL6 A;  5CR3 A;  1XTD A;  4GOP C;  5LL6 b;  2OH2 A;  1Q46 A;  2Q2H A;  1DV2 A;  1GSH A;  2RCN A;  3BQ1 A;  5T14 A;  1HNX L;  5CV8 A;  1IYJ B;  1SNC A;  3E3X A;  3CU7 A;  4IOA A;  1X3F A;  4R7R A;  4JI6 H;  4AH6 A;  3CMA A;  3T5L A;  4MTK A;  4DR4 L;  1JQY D;  3A7L A;  5KND A;  1Z7T A;  1AZQ A;  4I7A A;  1VF5 C;  2IW3 A;  3DM1 A;  3R5F A;  1XTC D;  4ECT A;  5JJI A;  1VQL A;  5J2T F;  5JUM A;  3T5H A;  3JSL A;  1VQP A;  3EVQ A;  2LMC B;  2UXD H;  3E9H A;  4O3N A;  3VR6 A;  5ELO A;  1EEI D;  1PTO B;  3LX0 A;  5LL6 S;  2EDG A;  4RAZ A;  3I4O A;  4LF6 H;  2OCE A;  2Z8L A;  2JA7 B;  2F0P A;  4KHZ A;  4NKL A;  4MV4 A;  1J5E Q;  1NY4 A;  1VQD A;  2NUC A;  1SJH D;  4JV5 Q;  3H94 A;  3RR5 A;  3H3V C;  2L1B A;  2Q2I A;  4O4L F;  4KY6 A;  1SLJ A;  3FKI G;  4ED8 A;  2FLP A;  2X69 A;  5C0X I;  4DV1 L;  3PGZ A;  2ZXR A;  5IT9 L;  3E5S A;  2RCF A;  2ZM6 L;  4Q45 A;  4IPG A;  2R92 G;  3Q6S A;  1R9T H;  4U67 3;  5CV6 A;  4YWM A;  4K6D A;  2IBK A;  1IKL A;  1B70 B;  1M8A A;  3UQ8 A;  1ENF A;  5KT7 A;  1E4F T;  1VQO A;  3HOU G;  5BN3 A;  4G7O C;  2MQH A;  2NVY A;  3MXP A;  4FXD A;  5DG7 A;  4BWS C;  1S03 G;  3GLK A;  1P8L A;  4QUC A;  5KG2 A;  1JX4 A;  5KIX A;  3VYS A;  5IYD H;  1V51 A;  5CAE B;  1RL2 A;  2AQ2 B;  3CXC A;  3NBI A;  1EUD B;  2W6N A;  4JI8 Q;  3D4R A;  4L63 B;  1PH5 A;  3OUU A;  3K57 A;  4WJ3 M;  5JOB A;  1VQN A;  1IW7 D;  3FPU B;  4ECR A;  5FLM G;  1LM0 A;  1WD1 A;  2R92 B;  3LGJ A;  1N34 H;  3NP8 A;  2IPK D;  2EY5 A;  2WB1 A;  4ZLT F;  3RB6 A;  2KQ3 A;  4KN7 C;  2A1A A;  1I4X A;  3GTL B;  4BY1 G;  2WAC A;  3TP5 A;  3UDI A;  3GID A;  5BR8 H;  3RZD B;  3HOV G;  4O3Q A;  5KG3 A;  2E74 C;  2L11 A;  2NVX A;  1J8I A;  1FNV A;  3RUZ A;  3SE0 A;  1RJP A;  2GVB A;  2L0C A;  3OPO A;  4DR6 Q;  1X3E A;  3WO0 A;  3PO3 B;  3G6V A;  1HZ9 A;  4L5Q A;  3SK8 A;  4OWW B;  5AJ3 Q;  1IBM H;  2NBF A;  3W2D A;  1YEZ A;  1MD2 D;  3H0G G;  4HMI A;  1PHJ A;  2GPS A;  1R9T A;  1UAP A;  5GAH C;  2C9O A;  2ALZ A;  4M9U A;  1HCZ A;  2R6G A;  2LSS A;  3ER0 A;  1V1P A;  2M9V A;  1PH1 A;  3HOX B;  2IY5 B;  1V8Q A;  1WTH A;  1FJG Q;  4JI7 H;  4DNR B;  2OT2 A;  1EOT A;  1DCZ A;  3GII A;  3UE0 A;  2D2C C;  3DWQ A;  4IZO A;  5DG8 A;  4OON A;  4K8I A;  3N8D A;  2B2V A;  1YIJ A;  2H1E A;  1KL9 A;  3KAJ A;  1QVC A;  1HNW H;  1CS0 A;  1S72 A;  3I73 A;  4CGY B;  1QNU A;  1WTR A;  3GTQ H;  4X6A H;  3OSN A;  5IOC A;  4JBM A;  3GIL A;  2DLN A;  4B3M L;  2ATL A;  3Q2O A;  4DUZ H;  2NUA B;  3A8I E;  4DXG A;  3GTP A;  3K0X A;  3FMA A;  4JV1 A;  1HNX H;  1SFO B;  1HFN A;  3S16 B;  2UUA H;  2JQO A;  5EDW A;  4NW2 A;  5C4Z A;  5KFT A;  3H4D A;  4JOI A;  4RWS C;  1XPO A;  1IBK L;  1A2U A;  2R8I A;  2R7M A;  4NXN Q;  1GGO A;  3SGI A;  4ZKB B;  4YY3 H;  5DG9 A;  3NXW A;  2PQA A;  4KJN A;  4O4H F;  2Y0S B;  3BU2 A;  1GXD C;  1JIH A;  5C1O A;  4ODG A;  4BS9 A;  2VZA A;  3QOJ A;  2R8H A;  1UE1 A;  3GTJ H;  4QWA A;  3M7G A;  4JBK A;  3MR2 A;  1ESR A;  3VR4 A;  2WYO A;  2EQS A;  1WR2 A;  1D8L A;  3E0E A;  2JEF A;  1E1O A;  1EQT A;  2K32 A;  3TRZ A;  3ZJY C;  1Z2P X;  1TWH B;  4WJW A;  2HDM A;  2F0L A;  3GD7 A;  3G4S A;  4X3K A;  2IJ0 A;  2W8L A;  1B33 N;  1EY9 A;  5CV4 A;  1SMY C;  2K50 A;  2RDJ A;  4KD3 A;  1K28 A;  1XPU A;  1IKM A;  3EYY A;  2YYA A;  1MGS A;  4HIK A;  2QGQ A;  5KFV A;  3KJP A;  1SYC A;  4DV1 Q;  2RSN A;  1RK5 A;  1VBH A;  2PN1 A;  2F0T A;  5KFP A;  3CD6 A;  3GV5 B;  2XN9 C;  4EBE A;  3BAB A;  2OEO A;  3GQB A;  4TQR A;  3AFQ A;  1TWH H;  3O13 A;  4B3R Q;  4N9P A;  1IBL H;  5HGT A;  2AQ4 A;  4KKU A;  4HYK A;  3T5J A;  1F2M A;  1EIF A;  2DJG C;  4DV7 L;  3K7U C;  1EU3 A;  4AIM A;  3K5I A;  1YJW A;  4IUU A;  1MBY A;  1ZKO A;  2B2T C;  2CH4 W;  4M1U B;  3R3O A;  1F9R A;  5FLX E;  4A3I H;  5KFA A;  4YY3 Q;  4IO9 A;  3IL8 A;  4Q8F A;  2VQE L;  2HCC A;  4AYB B;  5EKI A;  3CCM A;  1TS2 A;  2E2D C;  4A2B A;  5IT9 W;  4HED A;  2VQD A;  3S1Q H;  5A35 A;  1NTG A;  1KRT A;  4DUY H;  2DWC A;  3ORR A;  4TV9 F;  5KT6 A;  3HFZ B;  5JJK A;  4A3D H;  3BQ2 A;  2KVM A;  5J2U F;  5JH7 F;  5NUC A;  4QWB A;  2NVY B;  2ES2 A;  1HQR D;  3PCO B;  1A6X A;  2GPW A;  1DGS A;  1YNN C;  4JI8 H;  1KDB A;  1C48 A;  2HCI A;  4RNN A;  5C4H A;  1B44 D;  3KHR A;  2CHB D;  3VYR A;  1F2Y A;  3S1Q B;  4TRD A;  2DZD A;  2V58 A;  4OO1 H;  2VQF H;  2JA9 A;  1OXU A;  1ICW A;  5C5M A;  2VA3 A;  1E3P A;  2X6G A;  1SYF A;  1S5F D;  5D1O B;  3GQC A;  1O7L A;  4PZ7 A;  1TS4 A;  3D3R A;  4MA5 A;  3E9I A;  5ELB A;  3T4A C;  1FYC A;  1UWV A;  5E7N A;  1K1S A;  4DV7 Q;  1I7N A;  4EFB A;  3AFP A;  4CJ2 C;  2R61 A;  1N33 L;  5HGQ A;  3T1Y H;  3W3A A;  3SI8 A;  4B3M Q;  1IYU A;  3AYH B;  4OO1 I;  1CQF A;  1Y1W B;  3IAY A;  2F0I A;  4AYB E;  1C7Y A;  3V2T A;  5C4J B;  4A3G H;  3RMH A;  2FK1 A;  3RBE A;  3AEV A;  1CSQ A;  1N48 A;  4LWC A;  3JAM L;  3GDE A;  5C4X B;  3OHB A;  2XCL A;  2PW5 A;  1HHV A;  1Z6H A;  3M3Y H;  2FLN A;  2WFW A;  1LLR D;  2Z6B A;  4XT3 B;  4PMW A;  3W1B A;  1F2L A;  2BH2 A;  5M9O A;  3CKI B;  4RG1 A;  4L5S A;  2F4V Q;  1JDB B;  2FFK B;  4RUC A;  1UEA B;  4I7Z C;  2JA8 B;  5LXT F;  4EBC A;  5AFW A;  4XQJ A;  1JDE A;  2BQ3 A;  4DF7 A;  1PA6 A;  1ML0 D;  1FR3 A;  4JI3 Q;  3KHL A;  5DGA A;  2UXB H;  2NVT B;  5JEA H;  1IBK H;  4IUV A;  4AYB A;  2EJM A;  2RSO A;  5ELD A;  2W71 A;  1W3S A;  4I4T F;  2KCM A;  2BQR A;  2K5H A;  3EQL C;  5LA6 F;  4LF4 L;  1I50 A;  2YTV A;  1PV4 A;  4K2K A;  3K5O A;  2L4N A;  4DV2 L;  4B3T L;  3V4S A;  4EFE A;  1JWU D;  4UCT A;  1N32 H;  1JC7 A;  2D9U A;  5E3F A;  4EYH B;  1L0W A;  1STG A;  3L2P A;  5C8Y F;  1ESF A;  1XPR A;  1CQJ B;  4K8J A;  3KYH C;  5I2Y A;  4A3B B;  1XNQ H;  1Q1E A;  1C0A A;  3N6R A;  2NU7 B;  2NN6 I;  4A4I A;  1UE6 A;  5BR8 Q;  3PVX A;  2F52 A;  3ITP A;  1RIP A;  4C1N K;  1TII D;  2CW7 A;  3TSS A;  1PFB A;  4HAE A;  1JR0 D;  4GN3 B;  5F2D A;  4OO1 G;  2VY3 A;  4J1M A;  4B3T Q;  3UI2 A;  1C9O A;  2PCF B;  1XXG A;  2VW9 A;  2J6S A;  1SRU A;  3MXU A;  3HP3 A;  1EZ8 A;  3S1R H;  1PTO C;  3VMM A;  4Q8E A;  3I7F A;  5C4X G;  3C1E A;  3KUP A;  5DNF A;  2A74 C;  3MXN B;  4QWE A;  1PYS B;  2UU9 Q;  4CKC A;  1HPC A;  2OTJ A;  1S97 A;  4J9O A;  3IG0 A;  4HJ7 A;  4JI6 Q;  5KFF A;  1SE8 A;  3RN2 A;  3EFX D;  2VUG A;  1K8M A;  1U4L A;  4EGQ A;  1SYX B;  2IWH A;  4JYA Q;  1AEX A;  2M2L A;  4JCV E;  2Q2U A;  3PUW A;  5C3E G;  3K7A B;  3RGZ A;  2JA7 G;  1V43 A;  5DLQ E;  4A3D G;  5G3L D;  1ZXT A;  4RB2 C;  4B3S H;  2PYK A;  2HVS A;  4XX0 B;  1PYW D;  1LUZ A;  4JI1 H;  3VPB A;  2CKZ B;  4EGJ A;  2NU8 B;  1WCM B;  4GLA C;  3CVZ A;  5E4X A;  1PRT C;  5A2Q L;  3CC7 A;  3K5H A;  3KLW A;  1BXT A;  4CKB A;  5DLF A;  4JI3 L;  3K5N A;  1JB3 A;  4ZK9 B;  1KJ9 A;  2VOB A;  1EWC A;  4X62 Q;  5GAE C;  1TA8 A;  4LFB H;  2RHS B;  4ALP A;  1CA5 A;  1Q90 A;  5H80 A;  4QW9 A;  1PZK D;  3S14 B;  4FO2 A;  2B2W C;  4ZKC B;  2NWG A;  2W9B A;  3WDN A;  1RF2 D;  2DIK A;  1EWI A;  3BG3 A;  5LMN Q;  2Z0S A;  1MZB A;  2NN6 H;  5D1P A;  4QB4 A;  5IGB A;  2B2T A;  1Z2N X;  4CDC C;  1CKM A;  4DR1 L;  4A3J H;  4LFA Q;  4J9Q A;  1BUV T;  1T94 A;  3T13 A;  4YHH L;  3AQQ A;  1B8A A;  2R93 G;  5KG5 A;  2K5D A;  2PMZ E;  5FO9 B;  1E24 A;  1WVL A;  3LWB A;  4L5R C;  2XTI A;  3R23 A;  5GON F;  1HNZ Q;  1EIG A;  4YQW A;  2F0E A;  2UUC H;  3GO5 A;  1JOK A;  2MUY A;  4BBR H;  1S3O A;  1CK1 A;  1WTQ A;  3J7A 5;  4GNX A;  3GV3 A;  2CW8 A;  1SE2 A;  4LF5 L;  3T51 B;  2N78 A;  1S5B D;  2K5V A;  4POF A;  2MCT A;  4CDD C;  1XNQ Q;  3L3O C;  2B2V C;  1Y1V A;  2R85 A;  2IA6 A;  1CQI B;  4GNX C;  2D62 A;  3HKZ G;  2C00 A;  1EFW A;  2IHE A;  5ELF A;  2I80 A;  5EWF A;  4ILW A;  3H3V H;  3MR3 A;  4F4X A;  4X3T A;  4DNT B;  1N36 L;  3RB0 A;  2XRQ D;  5KT3 A;  4LF9 Q;  1QIL A;  4UP7 A;  1WJJ A;  1KDC A;  1FJG L;  3J81 j;  2OLS A;  3HS0 C;  2KEN A;  1DIK A;  2A6H D;  4C5B A;  2VR1 A;  1PXU A;  3GTM A;  4JV2 A;  2E75 C;  4PQX A;  3ICE A;  4FF4 A;  4BA1 I;  4WBN F;  4QF4 A;  4DR6 L;  4J9R A;  4O1N A;  4RGO S;  2XNA C;  1KTK A;  1SAP A;  2FMC A;  2G9D A;  2Y0S G;  3J80 c;  2FPG B;  4TV8 F;  3G6Y A;  3D4W A;  4CKE A;  3TII A;  4GKK L;  4YBZ B;  2ZM6 H;  4IRD A;  1EY0 A;  5IIF A;  2UXD Q;  2YYZ A;  2IP4 A;  3BYY B;  2TMP A;  1L2F A;  2JA5 H;  1MKH A;  2D0P A;  3CC2 A;  4XYQ A;  4I55 F;  1D5M C;  1X3Q A;  2A69 D;  4DUY Q;  1XNQ L;  4RKL A;  3Q8S B;  1LTB D;  2NTT A;  5KFY A;  3M3Y B;  3SXH A;  4Q0Y A;  5T1I A;  3DLL A;  4DK3 C;  2RF4 A;  2A5H A;  4ECV A;  5KFC A;  1AH9 A;  3H15 A;  4V0B A;  2QEX A;  5KFB A;  2BH8 A;  1M6V A;  1Y1W H;  1VS0 A;  2RBM A;  5KFQ A;  4OWX B;  1GO3 E;  1EFI D;  4RHR A;  3QO2 A;  3S2D B;  1N9W A;  3RZO H;  3M4O H;  3A5U A;  3HOZ G;  4ZQI A;  2I5M X;  1ASZ A;  1HRJ A;  4IHJ F;  4QIW A;  3N52 A;  3X3N A;  4FF3 A;  4XZ3 B;  4LUZ A;  4HR7 B;  1HXY D;  1TY0 A;  2VXW A;  1ENA A;  2PBZ A;  4APM A;  3MWM A;  5KFD A;  2QEJ C;  4JV5 L;  5M3F B;  1ET6 A;  2K01 A;  3JAM W;  2L15 A;  4C2M H;  4H02 A;  4O3O A;  4JC0 A;  1HTL D;  5M5Y B;  4E6I A;  5M3F G;  4DXF A;  1CKN B;  1PMR A; 
#chains in the Genus database with same CATH homology
 1NY4 A;  4XIG S;  1N33 Q;  1NE3 A;  3B6Y A;  1VQD A;  1VQH A;  3PUX A;  4JV5 Q;  2IX0 A;  4X64 Q;  3RR5 A;  2Q2I A;  1SLJ A;  3FKI G;  2MNA A;  4DAY B;  4FDB A;  2BA1 A;  4DV4 L;  1VQB A;  5C0X I;  3PGZ A;  2VQF Q;  4DV1 L;  1G51 A;  3KF8 B;  2AHO B;  3PV0 A;  4LF8 L;  2VS1 A;  2DUD A;  1JMC A;  1X3G A;  2ZM6 L;  4DV5 Q;  4IPG A;  2E2H H;  2R92 G;  1KIX A;  5FLM H;  3G71 A;  1LYL A;  4APV A;  1E7Z A;  1Z9F A;  1R9T H;  1N34 L;  2AWO A;  4YWM A;  4Y52 H;  4QL5 A;  3F2B A;  1B70 B;  5C0X J;  3HOU H;  4R4O A;  1NBW A;  1VQO A;  4NXM Q;  3I4N G;  3HOU G;  2UXC L;  1YJN A;  1HZA A;  1QZH A;  4YCW A;  4NXM L;  4YCU A;  4C3H H;  2MQH A;  5BR8 L;  4A3G G;  4DPG A;  2WB1 G;  2XGT A;  1VQ6 A;  1P8L A;  1H95 A;  4BY1 H;  4DUY L;  2RHQ B;  2N49 A;  2GVA A;  3T1H L;  5IYD H;  5IWA Q;  1RL2 A;  3CXC A;  4DR7 L;  1MJE A;  1UE7 A;  4JI8 Q;  5M5Y H;  4A3K G;  3GTO H;  1KXL A;  3W1G A;  1PH5 A;  4J15 A;  4WJ3 M;  3JAM c;  1VQN A;  1OXV A;  1XMO Q;  2UXB L;  3RZD H;  5H1S E;  2PNH A;  4GLX A;  5FLM G;  2UU9 L;  1LM0 A;  1X9N A;  4K0K L;  3LGJ A;  4YY3 L;  3K8A A;  4HJ8 A;  1HNW Q;  1GM5 A;  2HQL A;  1QVF A;  3FKI H;  1A63 A;  5IT9 c;  3G6E A;  1YIT A;  2A1A A;  4DUZ Q;  4JI7 L;  5ELN A;  4LNQ A;  4BY1 G;  3UDI A;  4KHP Q;  2LXK A;  1FGU A;  3KOJ A;  3GTG H;  3S2H H;  1HNX Q;  5IYB G;  3HOV G;  3KDF A;  3S1M H;  2PQA B;  2N3S A;  1HZB A;  3CCE A;  1EQQ A;  1IBM Q;  4A3L H;  3HOX H;  4MNO A;  2PI2 E;  2YTY A;  3RNU A;  3H3V I;  2GVB A;  2AWN A;  1Q82 C;  1X3E A;  1N36 Q;  2JA8 G;  1AE3 A;  4DR6 Q;  3S16 H;  1MJC A;  3HOY G;  3UDG A;  1HZ9 A;  4L5Q A;  4DR5 L;  1LTL A;  5AJ3 Q;  4OWW B;  5IP9 G;  3H0G G;  1YEZ A;  1V1Q A;  1PHJ A;  1IBL Q;  2ZJQ A;  2K14 A;  5GAH C;  1WI5 A;  5GQO A;  3M9B A;  3TEH B;  2IX1 A;  1PH1 A;  2R6G A;  2LSS A;  3ER0 A;  5IWA L;  4A3K H;  1I94 L;  1EOV A;  2IY5 B;  1FJG Q;  2WAQ G;  1X65 A;  1K83 H;  2AKW B;  2Y0S E;  3K81 C;  4NPS A;  3UE0 A;  4JI0 Q;  1JJC B;  4LF7 L;  4POG A;  5JJL A;  1TWF H;  5LMN W;  3M85 A;  5HY6 A;  1Y1W G;  4C3J H;  4OON A;  4AQY L;  1I3Q H;  1YIJ A;  1TWC H;  1KL9 A;  1N8R C;  1QVC A;  4LFA L;  3HOZ H;  1HR0 W;  1S72 A;  3GTQ H;  4X6A H;  2K4K A;  3I4M H;  1E22 A;  4JBM A;  3VDY A;  4B3M L;  2D0O A;  2E2I H;  1ASY A;  1PH6 A;  1Y1V G;  4BBS G;  2NZO A;  3K0X A;  1O7I A;  2WB1 E;  4YCV A;  1XMO L;  2E5L Q;  4JI6 L;  3U4V A;  1OXS C;  3S15 H;  3PIO A;  1K9M C;  4A3E H;  2JQO A;  1OXT A;  1XJV A;  1IBM L;  5IE8 A;  3A5Z B;  2CCZ A;  2OWO A;  4JOI A;  1A62 A;  4UPA A;  4MTN A;  1XPO A;  1IBK L;  4QJF A;  2R7Z G;  2K75 A;  4GS3 A;  4GOP B;  2UXB Q;  4IJL A;  1IBL L;  4NXN Q;  3SGI A;  2R7Z H;  2BA0 A;  2CFM A;  3CAM A;  2PQA A;  3ERS X;  3BU2 A;  3MEF A;  2VQF L;  4OX9 Q;  4DV6 Q;  2VZA A;  3CQZ H;  4JBW A;  1VCI A;  1TWA H;  1UE1 A;  4IJH A;  3GTJ H;  1VQ4 A;  4JBK A;  5IP7 G;  2UXD L;  4DAM A;  2EQS A;  2B29 A;  2H5X A;  1D8L A;  3E0E A;  3CCL A;  1N32 L;  1Q12 A;  1FVI A;  2IT1 A;  3J80 i;  4IPC A;  1E1O A;  3TRZ A;  4R4Q A;  1GVP A;  3ZJY C;  5C44 H;  1PH8 A;  4LF6 Q;  2YTX A;  3S24 A;  4GLV B;  1WYD A;  3GD7 A;  3G4S A;  4R4T A;  4QIW E;  3KJO A;  2UUA L;  2VNU D;  1YJ9 A;  1S40 A;  2K50 A;  3L0O A;  4AQY Q;  1XPU A;  1HH2 P;  4OWT B;  1VQF A;  1G6P A;  3U50 C;  4HIK A;  2QGQ A;  2ATW A;  3RLF A;  3KJP A;  1VQE A;  5M3F H;  4DV1 Q;  4LF8 Q;  5FLX c;  3PUY A;  3CCR A;  4GKK Q;  4OXP A;  3CD6 A;  3FP9 A;  1HZC A;  3AFQ A;  1X6O A;  1TWH H;  4JI4 Q;  4B3R Q;  3GTL H;  1X55 A;  3G48 A;  1J5E L;  2NVT H;  2VUM G;  1EIF A;  4DV7 L;  4UP8 A;  2KCT A;  3K7U C;  4JI5 L;  4AIM A;  1YJW A;  4HJ9 A;  1I50 H;  2A19 A;  4BY7 H;  4A3I H;  4YY3 Q;  4IO9 A;  4PG3 A;  4R1J A;  1YZ6 A;  2VQE L;  4LF4 Q;  1N32 Q;  1Y14 B;  4JG2 A;  3CCM A;  3GTM H;  2ALY B;  1JE5 A;  1SMX A;  2QA4 A;  3PO2 H;  3HOY H;  3S1Q H;  4WJ4 A;  1NTG A;  1KRT A;  3BZC A;  4P74 A;  3JAM i;  2UUC Q;  5GAD C;  1BBU A;  4A3B G;  5JEA G;  3HFZ B;  5JJK A;  4A3D H;  2NN6 G;  4IFD J;  1Q7Y C;  3D31 A;  3L7Z C;  4GKJ L;  2E2J H;  3EIV A;  2JK8 A;  4HJA A;  1VQJ A;  3TQY A;  2ES2 A;  3PCO B;  2I0Q A;  2ZJR A;  1DGS A;  1UE5 A;  4EQ5 A;  4BA2 I;  1SN8 A;  2JJQ A;  2ID0 A;  5M5X H;  2KHI A;  1EQR A;  1L1O C;  3ULJ A;  2CWA A;  3IRB A;  3F8T A;  2B63 H;  4A3C G;  2JA9 A;  3NBH B;  1OXU A;  4A3L G;  1AE2 A;  4DV5 L;  2JEA I;  1E3P A;  3CME A;  3CCU A;  4JI5 Q;  1XNR Q;  1XMQ L;  3WWV A;  1PH3 A;  2JA8 H;  4PZ7 A;  5FJ8 H;  4LUO A;  4IOC A;  2EXD A;  2I5H A;  3E9I A;  3OYY A;  1Q81 C;  4DV0 Q;  1UWV A;  5E7N A;  2K52 A;  4DV7 Q;  4A3M G;  1SFO H;  3AFP A;  1VQA A;  4IPD A;  5IYC H;  3PIP A;  1IBK Q;  4LF6 L;  1N33 L;  4A75 A;  4A3I G;  2HIX A;  2LXJ A;  2MFI A;  5HGQ A;  2HIV A;  1PH9 A;  1K8A C;  4B3S L;  4HIO A;  2E8G A;  4B3M Q;  1QVG A;  3AYH B;  4A93 G;  4OO1 I;  3CP0 A;  2OTL A;  2OQ0 A;  4AYB E;  4A3G H;  3KF6 B;  3STB C;  1C7Y A;  1CUK A;  1OTC A;  3UE1 A;  2NVY H;  1CSQ A;  3AEV A;  4GKJ Q;  3HKZ E;  2JA6 H;  3KFU A;  4LWC A;  1SRO A;  4JI8 L;  3GDE A;  3U58 A;  1KQS A;  3HOX G;  2JA5 G;  3M3Y H;  1VQ8 A;  1HNW L;  2WFW A;  1QUQ A;  4DR2 L;  4P71 A;  1CSP A;  3PO2 G;  3OTO Q;  4PMW A;  4B3S Q;  3W1B A;  3I55 A;  1JJ2 A;  2BH2 A;  3OTO L;  3S14 H;  2JEB I;  3PO3 H;  5C4J H;  4KI0 A;  4KHP L;  1KRS A;  4RG1 A;  4R4I A;  4L5S A;  4JBJ A;  4LF9 L;  2F4V Q;  3HOW G;  1QZG A;  4QQB X;  2R7F A;  4R4C A;  3CW2 C;  1EIY B;  5GRO A;  2VUM H;  3GTK H;  2KBN A;  3BZK A;  1PA6 A;  3EBE A;  4JI3 Q;  4BXX H;  1YVC A;  2KHJ A;  4JI2 Q;  4YWL A;  4Y7N H;  4P73 A;  3OW2 A;  4X64 L;  4A76 A;  1W3S A;  4DR4 Q;  2KCM A;  4IFD I;  2K5H A;  3PF4 A;  1NMF A;  4LF4 L;  2YTV A;  1PV4 A;  4PZ8 A;  1GKH A;  2FXQ A;  1PH7 A;  3I4M G;  1VQG A;  1E1T A;  1YHB A;  3CCV A;  4DV2 L;  4B3T L;  1A8V A;  1I6H H;  3T1H Q;  5C4X H;  2ZM6 Q;  5LMU Q;  4GOP A;  1YI2 A;  3M4P A;  3CCQ A;  2Q2T A;  1L1O B;  5K36 G;  1L0W A;  3L2P A;  3K7A H;  4TQU S;  1VQ5 A;  1XPR A;  4LFC L;  4K0K Q;  1BBW A;  1MIU A;  4C3I H;  1Q1B A;  3KYH C;  2Z6K C;  1W2B A;  1Q1E A;  2UXC Q;  1C0A A;  2NN6 I;  4A4I A;  1UE6 A;  4LUV A;  3ULL A;  2VQE Q;  5BR8 Q;  1KD1 C;  4IPH A;  2F52 A;  3S2D H;  3U4Z A;  1RIP A;  1WCM H;  4HID A;  1PYB A;  1V9P A;  4GN3 B;  4OO1 G;  2VY3 A;  2I5L X;  1Q86 C;  4YHH Q;  2R7D A;  2ZTE A;  1VQK A;  4B3T Q;  4DV6 L;  2K5N A;  2WP8 J;  2UUC L;  1C9O A;  2VW9 A;  1VQ7 A;  3F1Z A;  1SRU A;  1P16 A;  2CQO A;  3UDX A;  4LF5 Q;  3S1R H;  3KDF B;  1YNX A;  4GN5 A;  3I7F A;  5C4X G;  2V1C C;  4DKA C;  4JI2 L;  5M3M G;  2DGY A;  3MXN B;  4TVA B;  1PYS B;  2UU9 Q;  1CKN A;  4DV3 Q;  2OTJ A;  5C0X G;  4HJ7 A;  3DM3 A;  4DR2 Q;  4JI6 Q;  1SE8 A;  3A74 A;  3D0F A;  3RN2 A;  4JYA L;  4DV2 Q;  4OX9 L;  1I94 Q;  5EAY A;  5GAG C;  4PZ6 A;  3CCS A;  1HR0 Q;  3PO3 G;  4JYA Q;  4O2D A;  5LMU L;  4KLK A;  3F2D A;  4JCV E;  2Q2U A;  3PUW A;  1T9H A;  5C3E G;  2JA7 G;  1V43 A;  5DLQ E;  4A3D G;  5IP9 H;  2MO1 A;  1XNR L;  1YHQ A;  2R93 G;  1EUJ A;  4GN4 B;  1PVO A;  1LUZ A;  1K73 C;  4B3R L;  2E5L L;  1GD7 A;  4RMF A;  1FL0 A;  2CKZ B;  4JOI C;  1VQM A;  1PFS A;  4GLA C;  1NMG A;  3CC7 A;  4LF7 Q;  1UEB A;  3TRE A;  2A8V A;  3KLW A;  4QGU A;  1J6Q A;  3CPW A;  2IHF A;  4JI3 L;  4IFD G;  2JA7 H;  4A3M H;  4X62 Q;  2OQK A;  5GAE C;  4X65 Q;  2RHS B;  2MO0 A;  1HR0 L;  5IYD G;  1IZ6 A;  4ALP A;  4DK6 C;  4DR7 Q;  2JE6 I;  1JB7 A;  4QY7 A;  4BBR G;  3I56 A;  1X56 A;  3RLN A;  2B3G A;  2AMC B;  4A3F H;  2HHH Q;  1NJI C;  1PH2 A;  1U5K A;  5J3B A;  1OXX K;  1X54 A;  1VQC A;  1EWI A;  4NB3 A;  1KC8 C;  4JI0 L;  5LMN Q;  1SR3 A;  2Z0S A;  4DR3 Q;  2HHH L;  3H0G H;  4EX5 A;  4DV0 L;  1WOC A;  1CKM A;  4DR1 L;  4A3J G;  3T1Y L;  4A3J H;  2ZJP A;  4LFA Q;  2N8N A;  3EN2 A;  4DV4 Q;  4YHH L;  3AQQ A;  1B8A A;  3KF6 A;  2F4V L;  1YBY A;  2PMZ E;  5AJ3 L;  4AYB G;  4DUZ L;  5M3M H;  1KAW A;  1E24 A;  2JA6 G;  2NZH A;  1CKO A;  3PUZ A;  3CF5 A;  3CC4 A;  3ULP A;  4L5R C;  3J81 c;  2XTI A;  1IL2 A;  4BY7 G;  5IYB H;  3HOV H;  4LFB L;  1Y1V H;  1HNZ Q;  3GO5 A;  4BBR H;  1S3O A;  3J7A 5;  4GNX A;  5IP7 H;  1K0R A;  4LF5 L;  3K80 C;  1JJG A;  2N78 A;  2YV5 A;  5IY0 A;  2K5V A;  4POF A;  1XNQ Q;  3HOW H;  3NEL A;  2R93 H;  4X65 L;  1IXR A;  5C44 G;  3GTP H;  4A3B H;  5IYC G;  4GNX C;  2D62 A;  3HKZ G;  3JC6 6;  4O0A A;  2IHE A;  4DR5 Q;  1EYG A;  2Z6K A;  1EFW A;  4BBS H;  1TWG H;  3H3V H;  2CWP A;  3NEN A;  3Q8D A;  1N36 L;  1VQ9 A;  3TS0 A;  2NVX H;  1B7Y B;  4GNX B;  4LF9 Q;  4UP7 A;  3M4Q A;  1WJJ A;  1VQI A;  3PSI A;  1FJG L;  3J81 j;  3FHW A;  4X66 L;  2KEN A;  4XTC S;  1HNZ L;  1WCM G;  1PH4 A;  2ASB A;  4UY8 C;  1Z47 A;  1U0L A;  2B63 G;  1KHI A;  3ICE A;  4L5T A;  3J7Z C;  3PF5 A;  4BA1 I;  1K3R A;  4DR6 L;  3PUV A;  3T1Y Q;  3STB D;  2ZTC A;  4A3F G;  4NXN L;  5C3E H;  2UUB Q;  3HKS A;  3J80 c;  4A3C H;  2Y0S G;  2HT1 A;  1L1O A;  4P72 A;  4GKK L;  3BJU A;  2WAQ E;  3RLO A;  1WFQ A;  4X66 Q;  2UXD Q;  3S17 H;  2YYZ A;  1K8G A;  4LFB Q;  1L2F A;  3I2Z A;  2JA5 H;  4LFC Q;  1D7Q A;  1BKB A;  1MKH A;  2PI2 A;  1XMQ Q;  1HJP A;  2D0P A;  4JI1 Q;  4MZ9 A;  3W5O A;  1M1K C;  4BXX G;  3M7N A;  3CC2 A;  4DUY Q;  1XNQ L;  2EIF A;  4DR3 L;  3NEM A;  4YWK A;  4DR1 Q;  1TXY A;  3A0J A;  3RN5 A;  3J81 i;  3S1N H;  2C35 B;  4A93 H;  3CCJ A;  4A3E G;  2VL6 A;  1I5F A;  3DLL A;  1XTD A;  4DK3 C;  4GOP C;  3I4N H;  1Q46 A;  2Q2H A;  1YHA A;  2RF4 A;  2RCN A;  1QUQ B;  1M90 C;  1Q8K A;  2ZTD A;  3F2C A;  2F3I A;  3H15 A;  1AH9 A;  2QEX A;  1BVS A;  4LW1 A;  1N34 Q;  1HNX L;  2R92 H;  1G29 1;  2BH8 A;  1Y1W H;  1IYJ B;  1VS0 A;  4IOA A;  4P75 A;  4OWX B;  1GO3 E;  1X3F A;  1N9W A;  4AH6 A;  2UUA Q;  3RZO H;  3CMA A;  3M4O H;  3A5U A;  3HOZ G;  2I5M X;  4X62 L;  1ASZ A;  4DR4 L;  2NVQ H;  3CPF A;  4LUZ A;  2UUB L;  5JJI A;  1VQL A;  4HIM A;  3TS2 A;  4JI7 Q;  1VQP A;  4DNI A;  4HJ5 A;  3E9H A;  3UDF A;  5M5W H;  2L15 A;  4C2M H;  4H02 A;  4ME3 A;  2GN5 A;  4JC0 A;  5ELO A;  5JEA J;  1A0I A;  4UP9 A;  5M3F G;  3I4O A;  5FJ8 G;  2YU9 H;  2OCE A;  4JI1 L;  4JI4 L;  1JT8 A;  4JV5 L;  5LMN L;  1CKN B;  4KHZ A;  4DV3 L;  1J5E Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...