4A3EG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 31
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3eG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3eG01
3PCOB 2VQEQ 1C0AA 3HOYG 1Y1VH 4X62L 2V1CC 4Y7NH 3KF6B 2Z6KA 1N36Q 4PZ7A 4A3MG 4DR6Q 1PVOA 5JJLA 1V43A 4J15A 3HOZH 1DGSA 1J5EL 1OXTA 3H0GG 2N8NA 4YCUA 2N49A 1MJCA 4GN4B 1N32L 4BY7H 1XNRQ 4X6AH 2RHSB 3J80i 4APVA 3PGZA 4DV6Q 3F2CA 1EWIA 3GTPH 4OX9L 2D0OA 2PMZE 4X65L 2E5LL 1OXSC 1X3FA 4KI0A 1Y1WG 2A19A 4JI3Q 4MTNA 5C3EH 3RR5A 3ULPA 1NJIC 2HHHL 4L5QA 1CSPA 2R92H 3JAMi 4YHHQ 1K8AC 1HNZL 4BXXG 3PUYA 3KF6A 1KRTA 4DUYL 2BA1A 3W5OA 2E2IH 5IYBG 4K0KL 1LYLA 4LFBQ 2MO0A 1N33L 4BBSG 1Q82C 2NZHA 2YTYA 5IYDH 2QA4A 5AJ3L 1FL0A 4IPGA 2GVAA 1ASYA 1YI2A 1XMQL 1HR0L 4OWWB 2PQAA 2F3IA 2GN5A 3MXNB 3S1NH 4KHPL 3HKSA 4OWXB 1K83H 1HZBA 1RIPA 4DR1L 1XPUA 3CCQA 3GTKH 4GN5A 1YHQA 4B3MQ 3PUVA 2VUMG 2UXBL 4JOIC 3OTOL 3D31A 4EX5A 3G4SA 2E2HH 4UY8C 2N3SA 1KC8C 5IP7G 4A75A 4A3BH 4DR4Q 5M3MG 4MZ9A 3PO2H 1PH8A 1HZCA 3F2BA 4A3CH 4GS3A 4A4IA 1AE2A 3UE0A 4JOIA 2ZTEA 3M4OH 3BZKA 1FGUA 5GADC 3CCMA 3I4NG 1A8VA 5M3FH 2D0PA 2MQHA 1X54A 4X62Q 2CKZB 4AYBG 1SFOH 1PH3A 2N78A 4GOPC 3CMAA 1VQGA 3H15A 2UUCL 4A3LG 1J5EQ 1N32Q 3D0FA 1Q12A 3S14H 3A5UA 2E2JH 2B29A 3S16H 1GM5A 3UDIA 3KF8B 3S1RH 4HIKA 4OX9Q 2K4KA 4ME3A 4GOPA 1ASZA 2B63H 1HNXL 2E5LQ 1YHAA 3DM3A 1WI5A 3OYYA 2VY3A 4DKAC 3HOYH 2HHHQ 3HOVG 2ZTDA 1Q86C 4QGUA 1X9NA 3NBHB 1HNZQ 3T1HL 4A3MH 2YU9H 4LWCA 4IFDI 2C35B 4K0KQ 3H0GH 3I7FA 2XTIA 1N33Q 4TVAB 1IXRA 1I3QH 3RLFA 5FLMH 2BA0A 2FXQA 2IX0A 2CWPA 5AJ3Q 4JI1L 2IY5B 3EBEA 3W1BA 1EIFA 4POFA 5IP9G 1XMQQ 1Y1WH 1M1KC 1HR0Q 1MIUA 2WP8J 3ER0A 4AIMA 3HOUG 3M7NA 2EIFA 1VQCA 4IO9A 3STBD 4DR1Q 4P72A 2VQFL 4BXXH 2HIXA 2UXBQ 5JEAG 2K75A 3OTOQ 3FKIG 3GTGH 3NEMA 5IYBH 3NELA 3HOXG 1HZAA 2PNHA 3L7ZC 4XIGS 4BBSH 2NN6G 1J6QA 2BH8A 1O7IA 3RLOA 4JCVE 2QEXA 4DAYB 1UE1A 4X64L 2R7FA 2KCMA 3RN2A 4A3EG 4IOAA 3M9BA 5EAYA 3KJOA 2KCTA 1YIJA 2R7ZG 4R4QA 2PI2E 3CCUA 1XMOL 2WFWA 1K3RA 2BH2A 2VUMH 3SGIA 5DLQE 2UUCQ 3KYHC 3PO2G 1X3EA 1X56A 2LXJA 5IP7H 3PO3G 3TS0A 5M3MH 4R4CA 4IFDG 1NBWA 1VS0A 4YWLA 3K80C 1Q1EA 3CCLA 3J80c 2HQLA 1UWVA 2CFMA 4JI6L 3TS2A 1SR3A 4C2MH 2YV5A 2RHQB 1HNXQ 3I4NH 4GN3B 2UUAL 3M4QA 3S2DH 4WJ3M 4JI7L 3CCJA 3JAMc 4JI4L 4DR4L 4DV0L 2F4VL 3T1HQ 3WWVA 4DR2L 1CKOA 2ATWA 4A3LH 3CXCA 3UDGA 1L2FA 1VQMA 4DV2L 1E22A 3AQQA 1P8LA 1U5KA 1AH9A 2ALYB 4JI1Q 4AH6A 1WFQA 4R1JA 4DR5L 1G291 3L2PA 1SMXA 3HOVH 2NVYH 4NPSA 2VQFQ 1K73C 2K5VA 1I6HH 2K14A 4R4IA 4A3KG 5FLMG 1XPOA 2JA9A 3PIOA 4QY7A 1I5FA 3PF4A 2PQAB 2JK8A 1VQKA 2A1AA 2EQSA 4LF6L 3GTLH 3KFUA 3BU2A 4P75A 4X64Q 4OO1G 1YEZA 1YITA 5IP9H 1B7YB 2E8GA 1NE3A 2I0QA 3CC4A 4A76A 1VQNA 1EIYB 3HOUH 1SN8A 4JI5L 1V9PA 3CW2C 4EQ5A 4LUVA 3AFPA 3ZJYC 3GD7A 4RG1A 1XMOQ 1SE8A 4NXML 3H3VH 2MNAA 4LUOA 4JI0L 1YBYA 3FKIH 1PH1A 3F1ZA 3ULLA 1JMCA 3HOXH 1GVPA 5IE8A 5E7NA 2OWOA 3E9HA 1TXYA 3CD6A 2I5MX 3I55A 1H95A 1EOVA 4IJLA 1PH5A 1TWAH 1GD7A 4X66L 4JI6Q 3A74A 3CCSA 3BZCA 4A3EH 1UE6A 2WB1G 3T1YL 4A3IG 5M5WH 3E0EA 2UUAQ 2R7ZH 1M90C 3CC2A 4QIWE 2XGTA 3W1GA 2ZTCA 1SRUA 4JI7Q 4QL5A 1WJJA 4JI4Q 5IYCG 4DV0Q 2F4VQ 2Q2HA 4LW1A 4DR2Q 1I94L 2CWAA 4JV5L 3K7UC 4JBMA 2PI2A 3G71A 4GLVB 4PG3A 4DV2Q 4GOPB 4YY3L 1N34L 3PO3H 2K5NA 4O0AA 1TWGH 4UP9A 1X3GA 1MJEA 4DR7L 2R93G 2RCNA 4UPAA 1Q46A 3TEHB 2AHOB 4DR5Q 3M3YH 2KBNA 4ALPA 4NXNL 1W3SA 4DV7L 3S15H 1E3PA 1C7YA 2ZJRA 5BR8L 2UUBQ 3KDFB 2YTXA 2JEBI 2AKWB 1VQBA 4DK3C 1B70B 3K0XA 4A93G 1VQLA 2NZOA 3A5ZB 2VS1A 2K52A 3PUZA 3CC7A 1BKBA 3GTQH 4GKJL 2Y0SE 4LF6Q 4RMFA 1QUQB 1U0LA 4LUZA 1VQ9A 2JA6G 3RN5A 3ICEA 4BA2I 4KHPQ 4HJ5A 1E1OA 4JI5Q 3JC66 1Q81C 1VQAA 2Z0SA 1D8LA 4O2DA 4DV4L 4KLKA 1N8RC 1L1OB 1E7ZA 1C9OA 4NXMQ 4JBKA 3HKZG 3KDFA 5JJKA 1UEBA 4JI0Q 4A3KH 1CSQA 1V1QA 1WOCA 4P71A 1GO3E 1PH6A 1A63A 1LTLA 1VQJA 2JA8G 3CPFA 4BA1I 1VQIA 4C3JH 4QJFA 4DR3L 4DV3L 1L1OC 4X66Q 1S40A 2LSSA 1A62A 1HZ9A 1QUQA 4LF7L 2CCZA 3T1YQ 1K0RA 1JJGA 4HIMA 5HY6A 5C0XI 1PYBA 2K50A 3UDXA 4FDBA 4A3GG 1G6PA 1L1OA 3EIVA 2DGYA 4A3FG 1PH2A 1I94Q 2JA5G 4JV5Q 4HJ7A 1Q7YC 3AEVA 2ZJQA 5C4XH 2KHJA 1N34Q 4R4TA 2DUDA 4YY3Q 1OXUA 1KIXA 1PH7A 3F2DA 4P74A 1CUKA 4DR7Q 4LF4L 1TWCH 1B8AA 3F8TA 2AWNA 4P73A 1SLJA 3RLNA 3I4MG 2H5XA 4A3IH 1CKNB 4JBWA 4YCWA 2L15A 1W2BA 2QGQA 2UU9L 4DV7Q 4L5RC 4NXNQ 2JA7G 2OTJA 3RZOH 3L0OA 1NTGA 5JEAJ 1YNXA 5BR8Q 3IRBA 5IYCH 3CF5A 1AE3A 2NVXH 2IX1A 4DV1L 3GDEA 3CQZH 4IPDA 2NVQH 2K5HA 1IBLL 2ASBA 2JEAI 1Z9FA 4B3TL 4GKJQ 1VQ5A 3KJPA 4YCVA 2R93H 4DPGA 1YVCA 2R7DA 2AWOA 4LFCL 3RNUA 3A0JA 4GLAC 5GAEC 2GVBA 1CKNA 3FHWA 4LF5L 4A3DG 5C0XJ 2IT1A 4DV4Q 4JI2L 3I4OA 1KRSA 3MEFA 4IOCA 3S17H 2UXDL 3PUWA 5GAHC 1T9HA 4YWKA 4AYBE 3GTOH 3PF5A 4JC0A 3U4ZA 4GNXC 4A93H 3E9IA 4GLXA 4LNQA 1QVCA 3CMEA 4DR3Q 5J3BA 4DV3Q 4HJ8A 2JA6H 3GTJH 3S2HH 1KD1C 4LF7Q 4GNXA 2B3GA 1PYSB 1YJNA 2Q2TA 4B3SL 3HOWG 4JBJA 5IY0A 1XJVA 1X55A 4MNOA 1WYDA 4HJAA 2JE6I 2MFIA 1EYGA 2AMCB 1EUJA 2JA8H 2Z6KC 5IT9c 3AFQA 1BBUA 3J7ZC 3PIPA 2VW9A 1VQ4A 1IBML 4TQUS 1S72A 1JJCB 4BY1G 4LF4Q 3J7A5 1RL2A 4LFAL 1IZ6A 4IJHA 1LM0A 3PV0A 2UU9Q 3CP0A 2RF4A 1WCMG 2OQ0A 2YTVA 4DNIA 4A3GH 5LMUL 3K81C 5C4XG 4LF8L 2JA5H 3CCVA 3DLLA 4A3FH 5LMNL 4DV5Q 2ES2A 4QQBX 2ZM6L 4DV1Q 1D7QA 2YYZA 3STBC 2WAQG 1IBLQ 5C44G 4B3TQ 3HFZB 4JI8Q 4KHZA 1PHJA 3AYHB 4LFCQ 1HNWL 1KAWA 1I50H 2D62A 2ID0A 4NB3A 2OTLA 3I4MH 1OXXK 4LF5Q 2JA7H 5FJ8G 4JI2Q 2HT1A 1VQHA 2VZAA 2UXDQ 4GKKL 4PZ6A 5JJIA 3S1MH 4IPCA 4YWMA 3BJUA 1JB7A 3CCRA 1VQ7A 2NVTH 3PUXA 2HIVA 4LF9L 3CCEA 1N9WA 1Z47A 3ERSX 4DUZL 4BBRG 4HIDA 1IBKL 4UP7A 2A8VA 2IHFA 4A3JG 4POGA 2R6GA 3I56A 4XTCS 5C4JH 2ZJPA 2VL6A 3PSIA 4A3DH 4OONA 4B3SQ 3B6YA 1PH9A 1K8GA 4PZ8A 1R9TH 4UP8A 5LMNW 1VQPA 1QZGA 1NMFA 4DK6C 1VCIA 1KQSA 5GQOA 1XNQL 2OCEA 5HGQA 1NY4A 1JT8A 2Q2IA 3M4PA 1OXVA 1IBMQ 3VDYA 1JE5A 1HJPA 1MKHA 3J81c 1QZHA 3H3VI 3CPWA 5ELNA 1KHIA 4LFAQ 1K9MC 1VQFA 1UE7A 2NN6I 3J81j 1IL2A 3HOWH 5H1SE 1OTCA 5LMUQ 1A0IA 3FP9A 4LF8Q 1Q8KA 2LXKA 5LMNQ 2Q2UA 1YZ6A 2ZM6Q 4AQYL 1PA6A 1VQ6A 1Y1VG 1Y14B 4X65Q 1KXLA 1TWFH 3U4VA 2KENA 1HR0W 4H02A 4JYAL 5GAGC 3NENA 1UE5A 1VQEA 4BY1H 1XTDA 1HNWQ 3HOZG 3K7AH 1JJ2A 3RZDH 1EFWA 4DUYQ 4BY7G 1IYJB 1WCMH 1FJGL 2UXCL 4IPHA 2EXDA 2I5LX 3UDFA 4GKKQ 2VNUD 1QVGA 3UE1A 1BBWA 5IWAL 3J81i 4B3RL 1E1TA 1FVIA 2UUBL 1BVSA 2VQEL 3K8AA 5M5YH 5C3EG 3Q8DA 5C44H 2R92G 1VQDA 1X6OA 2MO1A 4OWTB 4LF9Q 4C3IH 4DUZQ 1N36L 2OQKA 3TREA 3ULJA 1IBKQ 4L5SA 4DR6L 3G6EA 2WAQE 1NMGA 5IYDG 1XNRL 4DV5L 5FJ8H 4JG2A 3TQYA 2WB1E 3LGJA 3I2ZA 1XPRA 2I5HA 4DV6L 2JQOA 1E24A 4OXPA 1XNQQ 3U50C 4JI3L 1P16A 1CKMA 4JI8L 2KHIA 3KLWA 5K36G 4GNXB 1YJ9A 4YHHL 1EQRA 1PFSA 5FLXc 4BBRH 4HJ9A 2F52A 1SROA 4A3JH 1KL9A 1S3OA 4HIOA 4LFBL 5ELOA 1GKHA 3KOJA 3GTMH 5C0XG 1YJWA 3S24A 4A3BG 3U58A 1LUZA 5M5XH 3EN2A 3OW2A 1EQQA 1L0WA 1PV4A 1QVFA 4IFDJ 4A3CG 3M85A 1Q1BA 4OO1I 3CAMA 4AQYQ 1YHBA 1HH2P 3GO5A 5M3FG 4DAMA 3TRZA 5GROA 4R4OA 4JYAQ 1TWHH 4B3ML 1PH4A 1VQ8A 4PMWA 3S1QH 4Y52H 2Y0SG 1VQOA 1X65A 3G48A 1FJGQ 4C3HH 2UXCQ 2JJQA 2IHEA 2B63G 5IWAQ 4B3RQ 4WJ4A 1G51A 2CQOA 3HKZE 4L5TA
chains in the Genus database with same CATH superfamily
2K32A 3HOYG 2K04A 4X62L 2B8GA 4Y7NH 1WTXA 1XDNA 5CV4A 3KF6B 4R7RA 5KFRA 4GKKH 4HMIA 5JJLA 4RU9A 4J15A 1Z2NX 1J5EL 4KN7C 1OXTA 2N88A 5C4XB 3M9NB 2OT2A 3MVVA 4JV0A 1XNRQ 1AP0A 1CK1A 4F4YA 3F2CA 5KT7A 2WAQB 2PMZE 1TWCB 2E5LL 1X3FA 1SYXB 5C44B 1KDAA 4KN4C 4JI3Q 1TWFA 5C8YF 1NJIC 2HHHL 2R92H 3Q8RB 3GIIA 3JAMi 4YHHQ 4LSXA 4O3SA 3PUYA 3KF6A 2ZDGA 2BA1A 3DWAA 2L5TA 4LFBQ 4RUCA 2MO0A 2NZHA 3HS0C 2QA4A 1FL0A 2WAQA 1JCKB 1XMQL 1HR0L 2PQAA 3MXNB 2GN5A 4OWWB 1HZBA 1RIPA 2PVPA 3DEPA 3VR6A 3GTKH 3TSSA 1I4GA 2K6AA 1ZETA 2UXBL 1ET9A 3OTOL 3GTOB 3M7GA 2N3SA 2I07B 5M3MG 4TQSA 4EQPA 3PO2H 1PH8A 3UE0A 2ZTEA 3BZKA 1EY5A 4LJZC 2QKIC 4FXDA 2DPIA 3UQ8A 5LHY1 4FF1A 3MXNA 4F4ZA 2W70A 5M3FH 3RAQA 1ZEQX 4GOPC 2FHTA 4A3LG 3H15A 4I4TF 3GTOA 2RGVA 3D0FA 2F0OA 2ATLA 1Q12A 2JA8B 3A5UA 4ZRZA 4ZKCB 2BOSA 3BDLA 1EL0A 1UNNC 1D6EC 4C56C 1D1KA 5KFCA 4OX9Q 1KNAA 1YHAA 4EEYA 1PTOH 1WI5A 1W96A 1FNUA 2VY3A 2FE3A 3T4AC 3VA5A 1Q86C 2HDMA 1SNQA 5K5PA 1X9NA 3NBHB 2PYKA 2YU9H 4LWCA 4IFDI 2C35B 4GZYC 3H0GH 4JI3H 2XTIA 4KY7A 3PIO3 1IXRA 1I3QH 4ZUIA 1MHWC 2RCFA 4DNRB 3MAQA 1DIKA 4YHHH 1BGWA 2IX0A 5AJ3Q 4KJOA 2IY5B 2KEDA 5IP9G 2R92B 1G8ZD 1XMOH 1Y1WH 1M0TA 4XYMB 5EWEA 3M7NA 2FP4B 1VQCA 1GYFA 3STBD 2W7OA 2H1EA 5KX5F 3MTSA 3NBHA 3FKIG 4G57A 3NELA 3PN1A 5JPMC 2PNHA 4XIGS 1J6QA 1RKNA 1O7IA 1Y69U 2XSCA 1IYUA 2Z4HA 3PW7A 4X64L 5KFQA 3D6CA 4A3EG 1ZHSA 2F0FA 2BE5C 3E5SA 2R92A 3GTKB 3L3OC 4A3DB 1KJQA 3CCUA 2KOLA 1XMOL 1BNZA 4RNNA 4S3SA 5DM63 3MA2B 3HB9A 2XNAC 1JICA 3PW0A 4EG0A 1PZKD 3BVGA 5E4XA 1STGA 2LXJA 1F2YA 2A69C 3KUPA 1VS0A 1ZYRC 3K80C 4YWLA 3JZIA 1CZGA 1O80A 2HQLA 3PW5A 3TBIB 5M3FB 2C2DA 1I4HA 1IOVA 1RJRA 3GTKA 4JI7L 1EEFD 2JEJA 2F4VL 1SE4A 3T1HQ 2ATWA 1KLUD 3V6HA 2I87A 1BCPF 1VQMA 5KYIA 1E22A 5FK9C 2V9WA 1P8LA 2Z4IA 5EWGA 4RH6A 5M9OA 4QB4A 1YNND 3OMGA 3QO2A 1TU2B 4AH6A 4BY1B 3VR4A 1WFQA 4U68A 3LWUA 2NU6B 3RZDB 1YNJD 4LMYA 5KFYA 3J7AK 2YW2A 3HOVH 3LMLA 5ELEA 2NVYH 4NPSA 3TP7A 5L37A 1T36A 1I6HH 3LP8A 4A3KG 5FLMG 1AZQA 2ICIA 4NP5A 3FDTA 1RTOA 1I5FA 4Q43A 3RMHA 2JK8A 1VQKA 3OWEB 1Y1WB 4LF6L 5KG3A 1EU3A 2MP1A 1ULZA 3TIGA 2W8KA 2BR0A 2E8GA 3CC4A 4KHPL 4A76A 4RAUC 3HOUH 1SN8A 4IQZA 4LUVA 2YU9A 3ZJYC 1CT1D 4RG1A 4M1UB 3H0GA 1U4LA 1YBYA 1JMCA 4UAIA 3NQTA 4IALA 1I3QA 1DV1A 1H95A 1EOVA 1PH5A 4ECSA 1PFMA 2PW5A 4X66L 1K1SA 3A74A 2IA6A 3CCSA 1Y1WA 1UE6A 1MD2D 2R7ZH 3HGBA 4XQQA 2RDHA 2XGTA 3W1GA 1VMPA 2CQYA 2P0AA 4DR2Q 1I94L 1E4EB 1EYDA 3JAML 3BVZA 4JV5L 1TQOA 2W6PA 2F0MA 3ONAB 2PI2A 4DV2Q 1DONA 1SYDA 4PG3A 1G91A 5DQGA 3NTHA 5CR3A 2K5NA 1GUTA 1BJTA 1X3GA 3DWQA 2RCNA 1Q46A 3EJIA 3LX0A 1ENAA 3S1QB 4DV4H 2AUKA 2M05A 4ALPA 1SSOA 4XYQA 1T5EA 1V1OA 2YTXA 1WD0A 1Z7TA 4CJ2C 4DK3C 2RKSA 4Q44A 2NZOA 3VPBA 2VS1A 1SNDA 2A74C 2K52A 3MC0B 3PUZA 3GTQH 3MR3A 2Y0SE 1EZ8A 1PMRA 3DXJC 4RMFA 1VQ9A 3RN5A 3HOVB 3HOZB 3GLKA 5JOBA 1C48A 4AYBA 2Z0SA 2YS6A 4DV4L 1N8RC 5FO8B 5JJKA 3GTPB 1MBYA 4JI0Q 1HHVA 4IWYA 2JA8G 1VQJA 4APMA 5CV8A 4RCOA 2I8CA 1UAPA 1DOMA 1GXDC 5FD6A 3HOUB 4KV6A 2E2IB 2YRWA 4HNUA 1JJGA 3T1YQ 1K0RA 1CHQD 2R7MA 2NVYA 1DCZA 3J81E 5C0XI 4Q45A 4FDBA 2VB2X 4WRDA 1BOSA 2BQRA 1PH2A 2JA5G 3GTPA 1PYWD 1Q7YC 5L9XA 2KHJA 4RHRA 4YY3Q 3Q0AA 4MTDA 5EPLA 4ZCKA 1UEAB 2EXZA 4X3TA 3RD4A 1PH7A 2R7ZB 2SCUB 4DR2H 2MGSA 1B8AA 4P73A 1SLJA 4A3IH 2E2HB 1CKNB 4HSPA 4JBWA 1W2BA 4Q0YA 2CQAA 4DV2H 4DV7Q 3RZOH 1I7LA 1YNXA 5IYCH 1AE3A 1JOOA 3M4OB 5EZYF 1JQYD 2MCTA 4DV1L 3CQZH 4ECZA 2NVQH 2J4XA 4FYDA 2K5HA 1IBLL 2ASBA 2W6MA 1Z9FA 3N44B 4GKJQ 1AW7A 3JSLA 4HNTA 4YR2A 2R7ZA 2R7DA 3IKJA 1AFPA 5J2UF 5GAEC 2E2HA 1CKNA 4A3DG 3R2TA 3CRKC 4MV4A 4KJNA 3I73A 2F0SA 3I4OA 3MFYA 5GAHC 3RTXA 4GNXC 5KFTA 2R87A 4MTEA 4UCTA 4LNQA 4N8FA 4MN3A 5C4ZA 4DR3Q 5J3BA 3T51B 2VOBA 4U6PA 3P1HA 1VF7A 4J6HA 4HJ8A 4A3MB 1GSOA 4JI0H 4LF7Q 1D5ZC 2IX3A 4MV8A 1YJNA 1M0WA 1ONLA 2D9UA 2ZM6H 3GV7B 1KBLA 2G5DA 2CW8A 3RB4A 1WYDA 4RB3C 2JE6I 2MFIA 1JB3A 2GA4B 1B1ZA 1RCVD 1DD2A 5IGEA 1VBHA 5CA1F 3GTQA 1WTOA 1IBML 4TQUS 3ERQA 5TSSA 2R6FA 1JJCB 4BY1G 3L4JA 1D2BA 2V58A 2F0LA 3PV0A 1X32A 3CP0A 2IWHA 1ZQ7A 3CRLC 4LH6A 4A3GH 4DL6A 4O1NA 2FKLA 4QQBX 2ZM6L 1D7QA 3FDSA 2G9HD 4DV7H 3TIIA 1E0BA 1B4OA 3KLSX 2O5IC 4KHZA 5LL6X 2XC9A 2OTLA 4J1MA 3RZOB 2A68C 5A2QW 4JV2A 1OXXK 2BE5D 1EY4A 1UNSA 4JI2Q 4GKJH 1VQHA 1XNQH 2UXDQ 3S1MH 2NVQB 4YWMA 2DY8A 3BJUA 3WO0A 2R8IA 1VQ7A 3G6YA 2HIVA 3DEOA 4CDDC 2A69D 1ZYRD 2WB1A 1MI2A 4ECRA 3W2DA 3ND9A 4A2AA 4POGA 3I56A 5C4JH 2J6SA 4IZ8A 3TMEA 2F0NA 4B3SQ 1GLVA 4L63B 4DR3H 1S10A 1F9QA 1QILA 1QOHA 4CBVA 1VQPA 3GILA 2V4RA 1LT6D 5KNBA 4DK6C 1KQSA 1XNQL 1CE8A 1CZWA 2OCEA 1JT8A 2Q2IA 2EYHA 1RK6A 4IRDA 2OLSA 3J81c 5IT9L 4XT1B 1QZHA 3CPWA 4U673 5C5JA 1K9MC 3V05A 1UE7A 2NN6I 3HKZB 1IL2A 2R8KA 2IW3A 1H9KA 2KQ3A 1YZ6A 1FNVA 1B9MA 5IGBA 3Q1KA 4AQYL 2A73B 2KENA 5KG5A 4JYAL 2KSWA 2FFKB 3BZDB 1VQEA 1JDEA 2M00A 3HOZG 4A3GB 3K7AH 4ZK9B 4EGQA 4DV6H 1S0NA 1KJ9A 2HVRA 2UUAH 1KJIA 4BY7G 1IYJB 3HKZA 1FJGL 2PN1A 2EXDA 5D1OA 2I5LX 4WFN3 3UE1A 3J81i 5IWAL 4B3RL 4CDFC 3MEHA 3BVMA 1E1TA 5M5WB 2VQEL 1WSCA 4JI2H 4E4TA 1VQDA 1X6OA 5I6WA 4LF9Q 5ISRA 4C3IH 5KT3A 1QJOA 4DUZQ 3TREA 1IBKQ 4L5SA 3EYYA 2UXDH 5DNFA 1PFNA 5DG9A 2X6GA 2PMZA 5DM73 1NMGA 1PDQA 3PO3B 2VA3A 3S1MB 5FJ8H 4JG2A 3TQYA 1TT2A 3I2ZA 3Q6SA 4DV6L 2JQOA 4XT3B 3U50C 5K36G 3NSWA 4B3SH 3S15B 3DUZA 4O2BF 1EQRA 5CYUA 4BBRH 5C4JB 2F52A 3FEWX 2Z8LA 1JIHA 3N41B 3GTMH 5C0XG 3I90A 2J9GA 1LUZA 2WACA 1PV4A 4IFDJ 1L0WA 4FS2A 3M85A 2KCCA 4OO1I 2QDLA 2DNCA 3GO5A 4RB0A 2Q8TA 3K5LA 4CC6A 2RDJA 4IRCA 3K59A 3SEBA 1VQ8A 4PMWA 2KUMA 3NHHA 2XCAA 3NP8A 5LXTF 4PNYA 2B2VC 3G48A 2UXCQ 4C1NI 2K01A 1ILPA 2JJQA 1ET6A 1KLGD 2P5ZX 3K3VA 2XGQA 1A3TA 3HP3A 1HUNA 1A2TA 1CFMA 2C22A 3T13A 5DEHA 2W6QA 2Z6KA 4DR6Q 4A3MG 4O3QA 2FB9A 1AEXA 2N8NA 3JAME 2X0SA 3J80i 3PZPA 4LF9H 4DUZH 1IBKH 4M7EA 1EWIA 2D0OA 1BUVT 2HQEA 4C1NK 1OXSC 1J8IA 4ID6A 1D1IA 3MXUA 1GOZA 3N6XA 5C3EH 5JQWA 5JVH3 4L5QA 1CSPA 4IR9A 3A8IE 2I80A 1K8AC 3JRXA 4BXXG 2FK1A 1HA5A 1Y8OB 1RTNA 2UVVA 2IMWP 2KVMA 1I4RA 4KY6A 2NU9B 3N42B 4TUYF 2AQ4A 3DMUA 3I12A 3SI8A 3GV3A 4IPGA 3Q8SB 1B3AA 2NUCA 5KG6A 1YI2A 1S4ZA 4RKLA 4A2BA 1XYIA 4BBRB 4OWXB 3QR8A 2KA7A 1GUSA 4RCNA 3PUVA 4B3MQ 2VUMG 3GTMB 3D31A 4O3RA 5IGCA 3G4SA 4HAEA 4A75A 4DR4Q 2PO4A 4F7XA 3R8BA 5DG8A 1JR0D 5FO7B 2AGPA 4GS3A 5EPKA 3Q23A 4JOIA 3GTJB 1FGUA 4J9MA 2JEFA 2NBFA 3RAXA 2D0PA 2WKDA 5IGFA 3KALA 4X62Q 2GPWA 3D4DA 5KFDA 3N40P 1SFOH 1JORA 4B9XA 2N78A 4J9SA 3CMAA 5A35A 2D5DA 3GTMA 1J5EQ 1ESFA 4QUFA 5KFNA 1LTGD 5C6AA 2DN8A 4XDXA 1K0SA 4DR6H 3NWSA 3SK4A 4HIKA 2B63H 2E5LQ 1JX4A 3UI2A 4XX0B 5CB4F 3GTJA 2W9BB 5G3LF 3GQBA 2HHHQ 2ZTDA 2AGQA 4QGUA 1A2UA 2KJXA 3BQ2A 1M6VA 4BS9A 3P75A 3RLFA 4K14A 5FLMH 2BA0A 4XYLB 2FXQA 1D5XC 4JI1L 5JJZA 3W1BA 4CKCA 1EIFA 4POFA 3I4MB 1XMQQ 2L12A 1HR0Q 1I4PA 2BDOA 1MIUA 5H80A 5T1GA 2W9BA 4O3OA 3E3XA 2JA7B 2FJ2A 4IO9A 2QK4A 4P72A 1ZKOA 4HCSA 2UXBQ 3OTOQ 3GTGH 5IYBH 3HOXG 2CHBD 2DIKA 4BBSH 3RB6A 2NN6G 1SEIA 3P7JA 5L1IA 2A68D 3J7AF 5KFJA 2BH8A 3PMFA 3RLOA 3D4WA 5E4WC 3QZ8A 1TR5A 4B3MH 4JCVE 2QEXA 1EQTA 4DAYB 4XQJA 2SEBD 2SDFA 2KCTA 3VYTA 1T5XD 1YIJA 1RJTA 4JI4H 4DR4H 3IAYA 3J81L 1DM0B 1RF2D 2F0UA 2WFWA 2IP4A 4I7HA 5DLQE 2H4OA 3C46A 2MPMA 1QNUA 1W93A 4ILWA 1EWCA 5IP7H 3PO3G 4F4XA 3CCLA 1UWVA 1WH2A 1CTMA 3TS2A 1SR3A 3KK7A 5CV9A 2VB3X 2RHQB 1J5EH 3I4NH 2XCPA 1PX2A 5C1OA 3VYRA 3M4QA 1DOKA 2B2TA 4O4IF 3JAMc 4JI4L 4DR4L 4EFEA 1Z6HA 3AB9A 5KG0A 2E5LH 1S5FD 3UDGA 1L2FA 4FVMA 4MTKA 3M4IA 2HHHH 1I6VC 4EEQA 4I65A 1CA6A 1TWFB 2NYZD 1B2TA 5CMDA 5KFVA 2B39A 4OHJA 4KD3A 2EY1A 1SFOA 1UC9A 1FNWA 2SNMA 2PBZA 5EWFA 3MR2A 2V4DA 3IFTA 2K5VA 4TRDA 2Y0SA 2K14A 3HG9A 1I4XA 1XMQH 1N48A 1HR0H 2YYAA 2JSOA 3QB3A 3PIOA 5DG7A 4QY7A 1S68A 2PQAB 3IG0A 4C3JG 2B63A 1TY2A 3GTLH 2EQSA 2OXPA 3KFUA 4X64Q 4OO1G 2UXBH 2DNEA 3OTOH 4YR3A 2YCHA 1B7YB 1NE3A 1VQNA 1WTHA 3CW2C 3AFPA 4GC6A 1XMOQ 2RA4A 3OOCA 3H3VH 5KFMA 5CV7A 1GHKA 4V190 5JEAH 1GUGA 4FS1A 3F1ZA 5E7NA 1LLRD 4EFBA 3E9HA 3CD6A 2KEEA 2IPKD 1TWAH 1GD7A 4OELB 5LL6b 5KIXA 3J80L 2BQUA 3A7AB 4A3JB 1C3OA 5IT9E 4IRKA 1S5ED 1EQVA 1M90C 2D2CC 4UCSA 5M5XB 1BCPC 4JI7Q 3GTGA 2F4VQ 3SHLA 4Q8FA 4DK0A 3K7UC 5DAUA 2XWBB 3G71A 4GLVB 4IFDH 1RDPD 4UP9A 4UPAA 4IUQA 4F88A 4EBDA 2W9CA 4TV9F 4RA8A 2KBNA 3H4BA 1U4PA 2F0PA 4NXNL 5G3LD 3KDFB 2SNSA 4DA2A 5HGTA 3U9TA 2B2UC 3K0XA 2R7LA 2EYOA 3EPIA 1R4QB 2UVUA 3ORRA 1BKBA 4Y7NB 3CHBD 2QW7A 3HRZC 4F8MA 2PPBC 4LF6Q 1LTAD 3ICEA 4KHPQ 1XWEA 4HJ5A 1E1OA 4O2DA 1D8LA 1EHIA 1L1OB 3BA9A 4X3KA 5KT4A 4X64H 3KDFA 4FF3A 5DLGA 2SOBA 2B2YC 4P71A 5KRUA 3K57A 4KHVA 4HSVA 4QJFA 1WD1A 3NGDA 4DV3L 5EDWA 4F50A 4X66Q 2YZGA 2LSSA 1A62A 3AMUA 1HZ9A 2EJFC 1F2LA 4HIMA 4NLGA 1PYBA 2K50A 5KG2A 2EDGA 1Q90A 1L1OA 2F4IA 1I94Q 3R5FA 2IBKA 4JV5Q 4HJ7A 3M4YA 1TWAB 5KFSA 3GTLA 1KJJA 4ED6A 4JI7H 2JYOA 5JVG3 2F4VH 1CUKA 3BDOA 4RNMA 4IN3A 4LF5H 1E2VA 2K05A 3F8TA 2AWNA 2DWCA 3I4MG 5BPHA 1QE6A 3O13A 2JXMB 2UU9L 2L15A 2QGQA 2JA7G 1EY8A 3L0OA 3PO2B 1NTGA 2A6HC 2EY5A 3VR3A 2IL8A 2NVXH 4K2KA 1TWAA 5IYZF 1SYBA 1BBXC 4YAKB 3KJPA 4CDCC 2R93H 2RGRA 1YVCA 2YS7A 1BDOA 4LF5L 1FD7D 4DV4Q 2L9HA 3KHLA 2F0DA 3MEFA 4TKOB 1NCVA 4LF6H 3KAJA 1KTKA 4J9RA 5ELDA 3PF5A 1VMCA 5KFFA 3U4ZA 4KHPH 1PTOB 4A93H 3E9IA 1HUMA 3GIJA 5FPRA 3ORQA 4MV9A 2XCLA 1LV9A 4DU9A 2G9DA 3I3CA 1MSHA 2YU9B 2JA6H 2WINB 1JLLB 3H0GB 4LF8H 5J22A 2Q2TA 1I3QB 2FMAA 4X66H 1A3VA 3QIAA 2AMCB 2Z6KC 5IT9c 1DYQA 3PIPA 2VW9A 1VQ4A 3T5KA 3N52A 2F0VA 2PQEA 1EZ1A 1I94H 3OWFA 4JV5H 3V4ZA 3MWEA 4UCOA 4G7ZC 1LM0A 3TZUA 2OQ0A 2EY6A 3HXLA 5LMUL 5L1JA 4DL5A 5C4XG 1H9RA 3SR1A 4LF8L 4UCRA 4A3FH 3DLLA 4DV5Q 2EYMA 4DV1Q 1F9RA 4LAAA 2WAQG 3OHXC 1SAPA 2AU0A 1IBLQ 5C44G 3C0FB 3M9MB 4DAVA 4JI8Q 3U9OA 1HNWL 4FM9A 5GONF 3RB3A 4RKBA 3NUCA 2HT1A 2VZAA 5JJIA 4FU0A 4IPCA 5F2DA 5EJWA 5D14A 1S5DD 2R93B 4MA0A 1F2MA 5CORA 2OEOA 4AYBB 4CJ0B 3A56A 1Z47A 3ERSX 3CCEA 3GIDA 4UP7A 4A3JG 2FLNA 4XTCS 5EKIA 1PZID 4ABNA 3PSIA 2PNRC 1IKLA 2NVXA 1GJXA 1S97A 1R9TH 5LMNW 3DWPA 4FNFA 2FINB 4J9PA 1UUPA 1NMFA 3MZ5A 5GQOA 1T94A 2VA2A 1NY4A 1EWHA 5E1FA 1ESRA 2R93A 1IBMQ 5J39A 2RDFA 2NVYB 1HJPA 4QWAA 2J6UA 4O3NA 2L55A 2WTFA 1KHIA 1I6HB 1VQFA 4DL3A 1NAPA 4RGOS 3HOWH 2DY7A 3K58A 3TQTA 4X3UA 2LXKA 5T1IA 1G2SA 1R4PB 2ZM6Q 1VQ6A 3SK6A 1Y14B 4X65Q 5KFLA 2QEJC 3U4VA 5F9LA 3MFIA 1HR0W 3EQLC 2JA6A 1UE5A 3WOFA 1XTDA 4DV5H 4DV1H 1JJ2A 1EFWA 4KKUA 4A3FB 1IBLH 1WCMH 4K2LA 4IPHA 2C2EA 3UDFA 4JI8H 3IN5A 1QVGA 3CKIB 1BBWA 1VDZA 2BCOA 2UUBL 2V5AA 1BVSA 3SK8A 3K8AA 5CA0F 1BO0A 2R92G 2YZMA 1EIHA 2MO1A 4OWTB 2ZT9C 4HCEA 1N36L 3QZ7A 5BN3A 4FXGC 2WAQE 5CGKA 4DV5L 4X3SA 1AUXA 3V96A 2PZTA 4XZ3B 3QFFA 1BCPD 1E24A 5KG1A 1KC7A 3K5IA 1XNQQ 4JI8L 1CKMA 2C28A 4I50F 3KLWA 3V4SA 3RJ0A 5KFIA 1F9PA 2R8JA 1PFSA 1CQVA 1U4RA 2EJGC 1SROA 1GUOA 4H44C 5CAEB 5KEEA 4UHVA 1GKHA 3S24A 3NBIA 1IBMH 1F2ZA 2CVRA 3GTQB 1BXRA 2VUGA 2ASJA 2FMCA 1TA8A 1Q1BA 2ZXPA 2B2TC 1WR2A 4K6DA 2X6LA 4AQYQ 1YHBA 2TMPA 1HH2P 1MGSA 2XIWA 5M3FG 4G7OC 5LYJF 3EVQA 4R4OA 4DXFA 4JYAQ 4DAPA 4BWSC 1PH4A 3G7LA 3HOWB 1VQOA 3RIZA 4X65H 1FJGQ 4C3HH 1R9TA 1V4YA 3PR4A 2DLNA 4ECWA 4OIKA 4PDBA 2NWGA 4ECXA 5IWAQ 3TP8A 4B3RQ 4L5TA 3J80E 3LNNA 2VQEQ 1C0AA 1Y1VH 4K0KH 2V1CC 3TDQA 2WDTA 1ICFB 4EQNA 4DLKA 1PVOA 3OHAA 3QOJA 1WCMB 1DGSA 3H0GG 1N32L 4YCUA 4DF7A 2N49A 1MJCA 2F0GA 4GN4B 1IYVA 4YJ3F 4X6AH 2OH2A 4KTAA 3ETHA 4APVA 3PGZA 4DV6Q 4O2AF 4QWDA 2BQ3A 3VR2A 3RV4A 2ZXRA 4X65L 4DR1H 4KI0A 2WB1B 1Y1WG 2A19A 1RHPA 3SDZA 4A3IB 4DL4A 2JEIA 4MTNA 3G8CA 3VYSA 2C00A 1HNZL 1PXUA 3GV6A 2YL2A 1KRTA 3W5OA 2RVLA 5FLXL 4K0KL 1LYLA 1WCMA 3J7YW 2R7KA 1DJRD 1N33L 3CQZB 3BDCA 3I72A 1Q82C 5IYDH 3K0YA 2O03A 1KEEA 1KABA 1CS0A 5FOBB 4PQXA 1HQRD 1RJQA 2A6HD 2AQ3B 2GVAA 3BQ1A 5ELFA 3KXYT 3D6WA 2F3IA 3HZXA 3S1NH 4F4WA 2UUCH 1K83H 4DR1L 4K6LA 3CCQA 5KFPA 1MSGA 4GN5A 3FVQA 3A7LA 4EX5A 4AQYH 3N6RA 4UY8C 4A3BH 3CQZA 4MZ9A 4RNOA 4CKBA 1B3QA 1I7NA 2HJWA 4JYAH 1HTPA 1HZCA 3F2BA 1KDBA 3MXPA 5IGGA 4A3CH 4U7CA 3L9AX 5JH7F 1EYZA 3CCMA 2PW7A 1A8VA 3C1FA 3OSNA 1JWUD 3NTKA 2MQHA 1FJGH 1X54A 2CKZB 2CW0C 4AYBG 2F0IA 3FRPB 3OSPA 1EU4A 3PW2A 2UUCL 1VQGA 5DGBA 5IWAH 4B3RH 4C3HB 5D1OB 4G4KA 4N9PA 3S16H 2VQEH 3I4LA 4PMCA 2NTSA 1GM5A 5KFXA 5CV5A 3UDIA 2WV6D 5IOCA 3S1RH 1LO5D 2WKCA 4ME3A 4GOPA 1HNXL 1ZXTA 3DM3A 3M9OB 4KMUC 5FO9B 4KY5A 2W7PA 4DKAC 3HOYH 3HOVG 1GGOA 2PMZB 1DOLA 4FF2A 4J9NA 3EROA 2FPIB 3R5XA 2L1BA 1TS2A 1JXLA 1HXYD 3JAMW 4C5AA 1RODA 1BR9A 2CWPA 3EBEA 4J9OA 1M1KC 3ER0A 3HOUG 4AIMA 3RV3A 2HVQA 4TV8F 2VQFL 2HIXA 2NU7B 4QW8A 2K75A 1TIID 3NEMA 4RGTA 5KKNB 1HZAA 1A15A 4N9TA 4JV1A 1CQIB 1AZPA 1JC7A 1UE1A 2A5HA 2RQXA 3S1NB 3HBLA 3Q8PB 1PK8A 3RN2A 4EYIB 4ED0A 3M9BA 2R7ZG 3NQIA 1BF4A 4RZRA 4ECVA 2PCFB 2PI2E 2W57A 5KFAA 1K3RA 1B04A 3SGIA 4A3BB 3TINA 1CQJB 1SEBD 3KYHC 1LTBD 1X56A 4OIJA 4HTHA 5M3MH 1QB5D 4DR5H 3J80c 2KECA 4JI6L 4ECYA 4R8IA 1QG7A 4ZYSA 3P20A 2YV5A 4C2MH 3SE7A 1K83A 4GN3B 2UUAL 4HMJA 4ME5A 3S2DH 5JAVA 4WJ3M 4RB2C 3CCJA 4DV0L 3BG5A 4A3LH 3CXCA 4MV1A 5KFKA 3S1RB 4ZUJA 5KNDA 3AQQA 1AH9A 3G6XA 2ALYB 4JI1Q 2FK3A 4DR5L 4UCUA 3T5HA 2C9OA 4FXKC 3K7AB 4NXMH 2M2LA 1SMXA 1TS5A 3BS1A 4IUVA 4ETSA 3AU7A 4WBNF 5JUMA 2QILA 3CVZA 1PTOC 2O4XA 1K73C 4O3PA 3MWYW 4QUCA 2JA9A 2F0TA 4KKSA 1K3BC 2K5QA 1SNMA 3PF4A 2LFNA 4YBZB 3N43B 5J1ZA 4C3IB 3BU2A 4P75A 2FJZA 5IP9H 2I0QA 4G7HC 1EIYB 4JI5L 4EQ5A 1EIGA 3GD7A 4NXML 2R61A 2NUAB 3FKIH 1PH1A 2LS01 3ULLA 1GVPA 2OWOA 1Z2PX 3HEJA 3JSNA 5L1KA 2K1BA 4Q8EA 3MFGA 1K28A 3BZCA 4A3EH 1NSNS 2HCIA 2WB1G 2E2DC 4A3IG 4QIWE 4HQ6A 3TP6A 4JI4Q 5IYCG 3VR5A 4IAJA 2Q2HA 3BYTB 4LW1A 5M3MB 2CWAA 2QYZA 3EPGA 2HUGA 3GP7A 2ENBA 1N34L 1ML0D 3VPDA 4RUAA 1CHPD 3MXGA 4DR7L 1B6SA 2XIGA 2AUJD 1KDCA 2AHOB 3M3YH 2XVSA 3IFDA 2VR1A 4QWBA 1EY9A 1VBGA 1J9OA 1SJHD 2JP1A 4H13C 5BR8L 4JI1H 5LOVF 2QCPX 2JEBI 1VQBA 2R84A 4I7AA 1B70B 2KHSA 4P2CB 4C2MA 2ALZA 1HA6A 1QUQB 3URYA 4LUZA 5KG7A 3G6VA 5JVDF 2K28A 5JPNC 3JC66 3X3MA 3BJYA 3KHRA 2GLTA 4KLKA 2HGSA 1E7ZA 1C9OA 3HKZG 1UEBA 3KLRA 4A3KH 3BA8A 1CSQA 1V1QA 1GO3E 1LTLA 3E5NA 3CPFA 5C3EB 1VQIA 4IUPA 4FP5D 5I47A 1DXMA 1QUQA 3R5HA 1XXGA 5IIFA 2WE6A 1PRTB 5HY6A 5DGAA 3FKIB 4A3GG 3WDNA 3F8NA 1PTOF 2DGYA 3S9WA 3AEVA 5C4XH 2GPSA 4R4TA 2DUDA 4J9QA 4LFCH 5CV6A 1KIXA 4A3EB 2XRSD 4P74A 4LF4L 1TWCH 2LKVA 1STBA 2EE1A 3E0JA 3FPPA 5IT9W 4L5RC 3Q8QB 4NXNQ 2WYOA 2OTJA 3FKIA 3IRBA 1HQMC 3F2UA 4XXEA 1H9SB 1FGBD 3BG3A 1IL8A 2IX1A 2RDGA 2ZDHA 3OHBA 1E2WA 3I8ZA 3SE0A 2JEAI 4B3TL 3M3YB 1VQ5A 5I4DA 4ZKBB 3GV5B 1SFOB 4DPGA 4LFCL 1EY7A 2AWOA 3RNUA 3A0JA 2RDIA 5EBCA 2E75C 2ASLA 1TKWB 2GVBA 2Y0SB 2Q8IB 5C0XJ 4E6IA 1KRSA 4Y8VB 2JN4A 2C5CA 2CW0D 3PUWA 2W6NA 5IODA 1T9HA 4YWKA 2NTTA 2B63B 3GTOH 1H9SA 1SE3A 2FLPA 4QMGA 2EY2A 5L1LA 1LTTD 1QVCA 4K5XA 4DV3Q 5HBRB 4DXGA 3S2HH 1K1QA 2F0QA 4H7BA 4GNXA 1PYSB 1SNPA 5FLXE 3KAKA 4JBJA 4A3KB 1XJVA 4G3IA 3TP5A 3GIPA 5KFOA 4R9WA 1EYGA 4O4HF 1EUJA 1F77A 2JA8H 1STYA 2K5WA 3SXHA 3TN2A 4ED3A 3T53B 1I4QA 3U9SA 4YR0A 2CH4A 3J7A5 1RL2A 4LFAL 1IZ6A 2BDNA 2WIIB 3GTGB 3MHBA 1ZHQA 2UU9Q 4BBSB 2A6EC 1CM9A 1Y8PB 1SYEA 2YTVA 1OWTA 3K81C 4YIJA 2JA5H 3CCVA 4FBUA 5LMNL 2YYZA 4NXNH 2W9CB 4RFBA 2W6OA 4IZOA 4NDXA 4C3IG 1Q3LA 3MWMA 1VAJA 1KAWA 2D62A 2ID0A 4NB3A 2B8FA 2CZGA 3BQ0A 1LT3D 3C1EA 4LF5Q 3OW7A 5FJ8G 1C30A 4M9UA 5KG4A 1ENCA 4GKKL 4PZ6A 4ZI7F 4PV1C 1BNCA 5FKAC 3I4NB 3CCRA 4GC7A 3PUXA 4J9LA 4ZQ3A 3T16A 2Z1CA 1TWCA 1N9WA 4EBCA 4BBRG 2A8VA 4R8UB 1B44D 1AUVA 2EYFA 2R86A 1EOTA 5EOYA 1GSAA 4ECTA 1SDFA 3OSOA 3WOEA 2VL6A 4A3DH 3DF7A 3B6YA 3D8GA 1V8QA 1PH9A 1RJPA 4DV3H 4PZ8A 1IW7C 1QZGA 1QCBD 1LTID 1VCIA 1DV2A 3V6KA 1PFBA 3NK9A 3FPUB 3VDYA 3S2HB 1JE5A 1STEA 3H3VI 2ICEC 1JWSD 2MJ8A 4MHEA 4R8UA 3FMAA 1E2ZA 3J81j 1IKMA 5H1SE 1OTCA 5LMUQ 3GTLB 4CHTB 4LF8Q 3ZYYX 1WVLA 1L0YB 2Q2UA 1PTOD 4K5VA 1WTVA 2UU9H 2KCNA 2AQ2B 2OF1A 1B53A 1S9FA 4H02A 5KFGA 4C5CA 3NENA 4NMZA 4BY1H 1HNWQ 1XNRH 4N8X1 1EY6A 2XRQD 4EYHB 3RZDH 4DUYQ 2JA5B 4DK1A 2NB0A 1EFID 1C8CA 4I7ZC 2VNUD 1U9RA 5KYLA 1B50A 1SYCA 1H9JA 4OEMB 5M5YH 5C3EG 4MV7A 4LFBH 3NE5B 1STHA 4EVOA 3ULJA 4ED7A 2MUYA 3G6EA 1XNRL 4MV3A 4B9WA 2JA5A 2I5HA 4OGQC 2JEGA 4JI3L 4HEDA 1HFGA 1YJ9A 4R8NA 4YHHL 5FLXc 4QW9A 1SJED 2W71A 5C5LA 3RB0A 1S3OA 4HIOA 1M4VA 3PVXA 3KLSA 5ELOA 4LFBL 1W6KA 3NXWA 3OMCA 3U58A 3OW2A 2J0TD 1STAA 1QVFA 2R8HA 4CGYB 1S5BD 3RBEA 4YP3A 4DAMA 1LTRD 5A2QL 1PZJD 5FPOA 5LMUH 1TWHH 4CKEA 3Q24A 3WO1A 3V2TA 3T56B 3S1QH 3KHHA 2FK2A 5DQHA 2Y0SG 4OX9H 5EPJA 1O7LA 2CH4W 2F0JA 3VA7A 1HNWH 2IHEA 3PR5B 2B63G 2VPQA 3H91A 4WJ4A 1G51A 2CQOA 2UUBQ 3MR5A 2ASDA 4DUYH 2B2VA 3PCOB 1G2TA 5D3DA 1N36Q 4PZ7A 2R7NA 3J81W 1V43A 3HOZH 1JOKA 5EKKA 4BY7H 2B2WA 1AN8A 1M7JA 4ZAIA 2RHSB 3K5OA 3GTPH 4OX9L 5M5YB 2F0EA 3K3PA 4EQOA 5T14A 3RR5A 2IJ0A 3ULPA 1Q8IA 1XX8A 4DUYL 2E2IH 5C3WA 3RUPA 5IYBG 2NVXB 5LP6F 1WTPA 3QJYA 4BBSG 2YTYA 4RGNA 3C3LA 3OUUA 5AJ3L 1ASYA 1FYCA 2XWJB 4DFAA 5I9OA 5K36H 3HKSA 1XPUA 1HCZA 1YHQA 5C5MA 4RHSA 1JDBB 4RAYA 2XGPA 3BYYB 4JOIC 1L2ZA 3X3NA 2E2HH 1NNXA 1KC8C 5IP7G 5C0XH 4A93B 2UVWA 2E74C 1HRJA 5AFWA 1W6JA 4A4IA 1AE2A 1NUCA 2JA6B 3M4OH 5GADC 3I4NG 1UC8A 5EKLA 1TWHB 3T1HH 5HURA 5KFUA 4KKTA 2O2LD 1HTLD 1PH3A 5EQ0A 1II3A 3R93A 1N32Q 2LMCB 1AN7A 1EY0A 4RZQA 2UUBH 2F1MA 2E2JH 3S14H 2B29A 5I2YA 4Z9CB 1E4EA 1B33N 2F0WA 3KF8B 1N36H 2K4KA 1ASZA 4BWGB 4HR7B 2J6TA 2K7VA 2W9AA 4KD4A 3OYYA 1TWHA 4V0BA 5D3IB 3Q2OA 3W3AA 3J80W 2F3VA 4NW2A 1HNZQ 3EFXD 5KFBA 3T1HL 4A3MH 4BY7B 3MJFA 3J7AV 3K5NA 4K0KQ 3A54A 3MWDA 3I7FA 2V59A 2R8GA 1N33Q 2HCCA 4L1KA 2NZ1D 4TVAB 2A6ED 5F9NA 1BQQT 1EYCA 3KF8A 3EA6A 3PIP3 4HR7A 2F03A 2L4NA 2DZDA 2R85A 2WP8J 2EIFA 4J9KA 4DR1Q 4WJWA 4O42A 4BXXH 3BABA 1EUDB 5JEAG 2QDBA 3A8KE 1RK5A 1JKJB 5FD5A 3TZDA 4K8JA 3L7ZC 4ZQIA 1NR2A 2RBMA 3FMCA 4QIWB 1IOWA 3K5HA 2E76C 3MFHA 4ME6A 1PRTC 2R7FA 2KCMA 4NKLA 4IOAA 5EAYA 3KJOA 5DQIA 4ZLTF 4ZOLF 4R4QA 4ZHQF 2E2IA 4YB8B 1O75A 2XN9C 3V6JA 2VUMH 2BH2A 3VYUA 1R9TB 2UUCQ 3PO2G 1X3EA 4XYOA 5CC4A 3SVMA 1EUCB 5D8DA 3TS0A 2EYPA 1H9MA 4R4CA 4CDEC 1NBWA 4IFDG 1Q1EA 5D1PA 4EGJA 1MZBA 1PLFA 4QIWA 4EBEA 2CFMA 5KFZA 1LTSD 1HNXQ 1N32H 1IW7D 1LABA 2XD4A 3RGXA 1GSHA 1M8AA 1WTRA 3WWVA 1SBBB 1CKOA 4XQNA 4DR2L 3C2PA 3S14B 2E2JB 3GQCA 2ZDQA 4DV2L 1Z2OX 3KBGA 4K5WA 1U5KA 1HNZH 2EOTA 4R1JA 1G291 4OL7A 1N33H 3L2PA 1O78A 4IWXA 2VQFQ 5LA6F 1ICWA 1TY0A 4Q0FA 1X3QA 4R4IA 1XPOA 2RSNA 3LWBA 3WNZA 3T1YH 1LT4D 2A1AA 4ULLA 1YEZA 5LL6S 1YITA 2K5DA 1A6XA 2UVRA 3KBXA 2EZVA 1LT5D 1V9PA 3GIKA 4IUNA 5IGDA 1SE8A 4O4LF 2MNAA 3H4DA 4YY3H 1SMYC 4LUOA 4JI0L 1WTQA 3HOXH 5IE8A 2NN6H 1E4GT 1TXYA 1TVXA 2I5MX 3I55A 1BCPB 3GIMA 4IJLA 4M8AA 4MA5A 4JI6Q 3RFCA 1C4QA 5KGUA 1O7ZA 4UCVA 1JWMD 5ELBA 3T1YL 5KT5A 5M5WH 1LACA 3E0EA 2UUAQ 2VUMB 3CC2A 5KFHA 1VF5C 2ZTCA 1SRUA 4JPBW 4QL5A 1WJJA 5EGTA 2F0HA 4DV0Q 3VPCA 2O5JC 1HNXH 1CI3M 3T5LA 4JBMA 4GOPB 3PO3H 4YY3L 1A3UA 1RYSA 1BXTA 4O0AA 3PW4A 1KNEA 1TWGH 1MJEA 2R93G 1PRTF 3TEHB 4DR5Q 3E6ZX 1W3SA 4DV7L 3S15H 2VUMA 1E3PA 1C7YA 2ZJRA 1RYRA 3T5JA 2C2RA 2AKWB 4QF4A 3RGZA 5I6YA 4A93G 1VQLA 3A5ZB 1Y1VB 3CC7A 2R82A 4LF7H 4GKJL 4K8IA 2VQFH 5I9PA 1U0LA 2JA6G 1OO9B 5CBAE 3OIPA 2B2UA 4BA2I 4TQRA 4J0MA 1KAAA 4JI5Q 1Q81C 1VQAA 1JE4A 4F87A 4MIUA 4NXMQ 4JBKA 1U4MA 1D5MC 4ECQA 1B6RA 1PH6A 1WOCA 1A63A 5HV6A 1S03G 5KT6A 2YZNA 4BA1I 1ENFA 3RBDA 3NWTA 3OPOA 1Y1VA 3CU7A 4C3JH 4DR3L 2DPJA 1TAEA 1L1OC 1S40A 4OO1H 4LF7L 2CCZA 2B2YA 1GUNA 1FR3A 3UDXA 3R23A 3HOXB 3GV8B 4JI6H 1G6PA 3EIVA 3QOLA 1EEID 4A3FG 3OUZA 4MAMA 5BN5A 1JOQA 2I46A 2HD3A 1ILQA 1K8MA 3D4RA 5COYA 2ZJQA 1SXTA 4FF4A 1N34Q 3H3VC 1OXUA 1K83B 5E3FA 1N56A 3F2DA 4DV0H 4DR7Q 3RLNA 5A2QE 2H5XA 3LWEA 4YCWA 4HYKA 3NTIA 4JW0A 1QWYA 5JVLA 5JEAJ 5BR8Q 1TS4A 3IL8A 1IHZA 4IURA 3CF5A 4L6TB 2W8LA 4PWQA 4HN7A 3GDEA 1TWGB 1V1PB 4IPDA 4ED1A 2VXWA 1CA5A 4QWEA 4ED2A 3TQ1A 4IUTA 4YCVA 3R3OA 4GLAC 2EJMA 2NU8B 3FHWA 3S16B 1SYFA 2IT1A 4JI2L 2F3WA 4J8QA 5C4HA 4IOCA 3S17H 2UXDL 1SNCA 4AYBE 4DL2A 2X69A 4JC0A 1TWGA 4GLXA 1V1PA 4JI5H 3HOYB 2HDLA 3CMEA 2EVBA 4YJ2F 4RWSC 2Q8RE 3GTJH 2QF7A 1KD1C 2EYLA 2B3GA 2FMMA 3A55A 2MHVA 4QCLA 1X3PA 4B3SL 3HOWG 4ED8A 2L0CA 4I55F 5IY0A 2DJGC 2R3ZA 1X55A 4MNOA 4HJAA 4QWCA 1WTWA 2ZJTA 4C3JB 4C5BA 4DGZA 3PQIA 3AFQA 1BBUA 3J7ZC 2YRXA 2FLLA 5NUCA 4ECUA 4CJ1B 1S72A 3MR6A 1L0XB 4DL7A 4LF4Q 2TSSA 2B2WC 1B9NA 2N55A 4IJHA 4MV6A 1N34H 4EGVA 1F9SA 5BN4A 2RF4A 1WCMG 4DNIA 3UFXB 1E4FT 1QNKA 3RUZA 4DR7H 3DHQA 5C3XA 3JRWA 3KTMA 2ES2A 3KHGA 5KNCA 3STBC 1S0OA 4LH7A 2EPBA 3ND8A 4B3TQ 3HFZB 3R2IA 1XTCD 5BR8H 2AGOA 4TSSA 1PHJA 3AYHB 4LFCQ 1EZ6A 1I50H 3I4MH 2DJFC 1PRTD 2JA7H 3NPPA 4C2MB 1JB7A 2NVTH 2EYJA 3H09A 4FO2A 5CBEE 3S2DB 1HPCA 4IHJF 4LF9L 4HNVA 1NR4A 4HIDA 3K5MA 4DUZL 1IBKL 3K6OA 2W6ZA 2L11A 2IHFA 2K33A 2R6GA 3S17B 2ZJPA 4OONA 2PZUA 1K8GA 4CC5A 4UP8A 3Q22A 2HVSA 3G6JB 1RD9D 5I2XA 5HGQA 5KFWA 3M4PA 1OXVA 4B08A 1I6UA 1MKHA 3QG1A 2V4QA 1SE2A 5ELNA 1SCUB 2UXCH 4LFAQ 3SK5A 4KK7A 4C3HG 1YNNC 4H0LC 3OIQA 5FLXW 1A0IA 1CQFA 3FP9A 1VKZA 4LMQD 1Q8KA 4LF4H 5LMNQ 1A9XA 1T3NA 2Z9HA 1YNJC 1G6ZA 1V51A 3QWNA 1PA6A 5BMVF 1Y1VG 1KXLA 4ODGA 1TWFH 2VQDA 4L8JA 5GAGC 4IUUA 4UFZA 5D65A 4RB1A 1KJ8A 3ETJA 1FKAH 2UXCL 5DLFA 2ZXOA 4B3TH 2J7ZA 5KT2A 5K2MA 4FBTA 4GKKQ 1EYAA 5ELCA 2FPGB 1S5CD 1SMYD 3L4KA 1FVIA 1K8OA 4WD3A 3Q8DA 4PMBA 5C44H 4DN4M 1I50B 5KFEA 4YQWA 4JUZA 2OQKA 4DR6L 4JK1C 2F0KA 1S0MA 1SNOA 4LSAA 3ITPA 5IYDG 1DZ1A 2WB1E 3LGJA 1XPRA 3H40A 3BAAA 4UDUC 3DM1A 3I91A 2NVTB 4OXPA 3VMMA 1Y8NB 1HFNA 1P16A 1O7YA 2PZWA 2KHIA 2M9VA 3D3RA 2LY7A 4GNXB 3I70A 5J2TF 5EBDA 1I50A 4HJ9A 3N8DA 4A3JH 3RF2A 1KL9A 2Z6BA 5BPFA 4RAZA 3GIQA 2JA7A 3KOJA 4A3BG 1YJWA 5M5XH 3EN2A 1EQQA 3H20A 3H94A 4A3CG 2CW7A 3H6MA 2AQ1B 4LFAH 4X62H 3CAMA 1STNA 4DAYA 3TRZA 2VPSA 1TS3A 4IR1A 5GROA 4YAJB 1SYGA 4DNTB 4B3ML 4Q5VA 5LMNH 4RGMA 3A8JE 4JVZA 4WORA 4Y52H 2FPPB 4LK1C 1X65A 2K03A 1GHJA 1GUWA 2RSOA 5C1PA 3HKZE
chains in the Genus database with same CATH topology
3PCOB 2VQEQ 1C0AA 3HOYG 1Y1VH 4X62L 2V1CC 4Y7NH 3KF6B 2Z6KA 1N36Q 4PZ7A 4A3MG 4DR6Q 1PVOA 5JJLA 1V43A 4J15A 3HOZH 1DGSA 1J5EL 1OXTA 3H0GG 2N8NA 4YCUA 2N49A 1MJCA 4GN4B 1N32L 4BY7H 1XNRQ 4X6AH 2RHSB 3J80i 4APVA 3PGZA 4DV6Q 3F2CA 1EWIA 3GTPH 4OX9L 2D0OA 2PMZE 4X65L 2E5LL 1OXSC 1X3FA 4KI0A 1Y1WG 2A19A 4JI3Q 4MTNA 5C3EH 3RR5A 3ULPA 1NJIC 2HHHL 4L5QA 1CSPA 2R92H 3JAMi 4YHHQ 1K8AC 1HNZL 4BXXG 3PUYA 3KF6A 1KRTA 4DUYL 2BA1A 3W5OA 2E2IH 5IYBG 4K0KL 1LYLA 4LFBQ 2MO0A 1N33L 4BBSG 1Q82C 2NZHA 2YTYA 5IYDH 2QA4A 5AJ3L 1FL0A 4IPGA 2GVAA 1ASYA 1YI2A 1XMQL 1HR0L 4OWWB 2PQAA 2F3IA 2GN5A 3MXNB 3S1NH 4KHPL 3HKSA 4OWXB 1K83H 1HZBA 1RIPA 4DR1L 1XPUA 3CCQA 3GTKH 4GN5A 1YHQA 4B3MQ 3PUVA 2VUMG 2UXBL 4JOIC 3OTOL 3D31A 4EX5A 3G4SA 2E2HH 4UY8C 2N3SA 1KC8C 5IP7G 4A75A 4A3BH 4DR4Q 5M3MG 4MZ9A 3PO2H 1PH8A 1HZCA 3F2BA 4A3CH 4GS3A 4A4IA 1AE2A 3UE0A 4JOIA 2ZTEA 3M4OH 3BZKA 1FGUA 5GADC 3CCMA 3I4NG 1A8VA 5M3FH 2D0PA 2MQHA 1X54A 4X62Q 2CKZB 4AYBG 1SFOH 1PH3A 2N78A 4GOPC 3CMAA 1VQGA 3H15A 2UUCL 4A3LG 1J5EQ 1N32Q 3D0FA 1Q12A 3S14H 3A5UA 2E2JH 2B29A 3S16H 1GM5A 3UDIA 3KF8B 3S1RH 4HIKA 4OX9Q 2K4KA 4ME3A 4GOPA 1ASZA 2B63H 1HNXL 2E5LQ 1YHAA 3DM3A 1WI5A 3OYYA 2VY3A 4DKAC 3HOYH 2HHHQ 3HOVG 2ZTDA 1Q86C 4QGUA 1X9NA 3NBHB 1HNZQ 3T1HL 4A3MH 2YU9H 4LWCA 4IFDI 2C35B 4K0KQ 3H0GH 3I7FA 2XTIA 1N33Q 4TVAB 1IXRA 1I3QH 3RLFA 5FLMH 2BA0A 2FXQA 2IX0A 2CWPA 5AJ3Q 4JI1L 2IY5B 3EBEA 3W1BA 1EIFA 4POFA 5IP9G 1XMQQ 1Y1WH 1M1KC 1HR0Q 1MIUA 2WP8J 3ER0A 4AIMA 3HOUG 3M7NA 2EIFA 1VQCA 4IO9A 3STBD 4DR1Q 4P72A 2VQFL 4BXXH 2HIXA 2UXBQ 5JEAG 2K75A 3OTOQ 3FKIG 3GTGH 3NEMA 5IYBH 3NELA 3HOXG 1HZAA 2PNHA 3L7ZC 4XIGS 4BBSH 2NN6G 1J6QA 2BH8A 1O7IA 3RLOA 4JCVE 2QEXA 4DAYB 1UE1A 4X64L 2R7FA 2KCMA 3RN2A 4A3EG 4IOAA 3M9BA 5EAYA 3KJOA 2KCTA 1YIJA 2R7ZG 4R4QA 2PI2E 3CCUA 1XMOL 2WFWA 1K3RA 2BH2A 2VUMH 3SGIA 5DLQE 2UUCQ 3KYHC 3PO2G 1X3EA 1X56A 2LXJA 5IP7H 3PO3G 3TS0A 5M3MH 4R4CA 4IFDG 1NBWA 1VS0A 4YWLA 3K80C 1Q1EA 3CCLA 3J80c 2HQLA 1UWVA 2CFMA 4JI6L 3TS2A 1SR3A 4C2MH 2YV5A 2RHQB 1HNXQ 3I4NH 4GN3B 2UUAL 3M4QA 3S2DH 4WJ3M 4JI7L 3CCJA 3JAMc 4JI4L 4DR4L 4DV0L 2F4VL 3T1HQ 3WWVA 4DR2L 1CKOA 2ATWA 4A3LH 3CXCA 3UDGA 1L2FA 1VQMA 4DV2L 1E22A 3AQQA 1P8LA 1U5KA 1AH9A 2ALYB 4JI1Q 4AH6A 1WFQA 4R1JA 4DR5L 1G291 3L2PA 1SMXA 3HOVH 2NVYH 4NPSA 2VQFQ 1K73C 2K5VA 1I6HH 2K14A 4R4IA 4A3KG 5FLMG 1XPOA 2JA9A 3PIOA 4QY7A 1I5FA 3PF4A 2PQAB 2JK8A 1VQKA 2A1AA 2EQSA 4LF6L 3GTLH 3KFUA 3BU2A 4P75A 4X64Q 4OO1G 1YEZA 1YITA 5IP9H 1B7YB 2E8GA 1NE3A 2I0QA 3CC4A 4A76A 1VQNA 1EIYB 3HOUH 1SN8A 4JI5L 1V9PA 3CW2C 4EQ5A 4LUVA 3AFPA 3ZJYC 3GD7A 4RG1A 1XMOQ 1SE8A 4NXML 3H3VH 2MNAA 4LUOA 4JI0L 1YBYA 3FKIH 1PH1A 3F1ZA 3ULLA 1JMCA 3HOXH 1GVPA 5IE8A 5E7NA 2OWOA 3E9HA 1TXYA 3CD6A 2I5MX 3I55A 1H95A 1EOVA 4IJLA 1PH5A 1TWAH 1GD7A 4X66L 4JI6Q 3A74A 3CCSA 3BZCA 4A3EH 1UE6A 2WB1G 3T1YL 4A3IG 5M5WH 3E0EA 2UUAQ 2R7ZH 1M90C 3CC2A 4QIWE 2XGTA 3W1GA 2ZTCA 1SRUA 4JI7Q 4QL5A 1WJJA 4JI4Q 5IYCG 4DV0Q 2F4VQ 2Q2HA 4LW1A 4DR2Q 1I94L 2CWAA 4JV5L 3K7UC 4JBMA 2PI2A 3G71A 4GLVB 4PG3A 4DV2Q 4GOPB 4YY3L 1N34L 3PO3H 2K5NA 4O0AA 1TWGH 4UP9A 1X3GA 1MJEA 4DR7L 2R93G 2RCNA 4UPAA 1Q46A 3TEHB 2AHOB 4DR5Q 3M3YH 2KBNA 4ALPA 4NXNL 1W3SA 4DV7L 3S15H 1E3PA 1C7YA 2ZJRA 5BR8L 2UUBQ 3KDFB 2YTXA 2JEBI 2AKWB 1VQBA 4DK3C 1B70B 3K0XA 4A93G 1VQLA 2NZOA 3A5ZB 2VS1A 2K52A 3PUZA 3CC7A 1BKBA 3GTQH 4GKJL 2Y0SE 4LF6Q 4RMFA 1QUQB 1U0LA 4LUZA 1VQ9A 2JA6G 3RN5A 3ICEA 4BA2I 4KHPQ 4HJ5A 1E1OA 4JI5Q 3JC66 1Q81C 1VQAA 2Z0SA 1D8LA 4O2DA 4DV4L 4KLKA 1N8RC 1L1OB 1E7ZA 1C9OA 4NXMQ 4JBKA 3HKZG 3KDFA 5JJKA 1UEBA 4JI0Q 4A3KH 1CSQA 1V1QA 1WOCA 4P71A 1GO3E 1PH6A 1A63A 1LTLA 1VQJA 2JA8G 3CPFA 4BA1I 1VQIA 4C3JH 4QJFA 4DR3L 4DV3L 1L1OC 4X66Q 1S40A 2LSSA 1A62A 1HZ9A 1QUQA 4LF7L 2CCZA 3T1YQ 1K0RA 1JJGA 4HIMA 5HY6A 5C0XI 1PYBA 2K50A 3UDXA 4FDBA 4A3GG 1G6PA 1L1OA 3EIVA 2DGYA 4A3FG 1PH2A 1I94Q 2JA5G 4JV5Q 4HJ7A 1Q7YC 3AEVA 2ZJQA 5C4XH 2KHJA 1N34Q 4R4TA 2DUDA 4YY3Q 1OXUA 1KIXA 1PH7A 3F2DA 4P74A 1CUKA 4DR7Q 4LF4L 1TWCH 1B8AA 3F8TA 2AWNA 4P73A 1SLJA 3RLNA 3I4MG 2H5XA 4A3IH 1CKNB 4JBWA 4YCWA 2L15A 1W2BA 2QGQA 2UU9L 4DV7Q 4L5RC 4NXNQ 2JA7G 2OTJA 3RZOH 3L0OA 1NTGA 5JEAJ 1YNXA 5BR8Q 3IRBA 5IYCH 3CF5A 1AE3A 2NVXH 2IX1A 4DV1L 3GDEA 3CQZH 4IPDA 2NVQH 2K5HA 1IBLL 2ASBA 2JEAI 1Z9FA 4B3TL 4GKJQ 1VQ5A 3KJPA 4YCVA 2R93H 4DPGA 1YVCA 2R7DA 2AWOA 4LFCL 3RNUA 3A0JA 4GLAC 5GAEC 2GVBA 1CKNA 3FHWA 4LF5L 4A3DG 5C0XJ 2IT1A 4DV4Q 4JI2L 3I4OA 1KRSA 3MEFA 4IOCA 3S17H 2UXDL 3PUWA 5GAHC 1T9HA 4YWKA 4AYBE 3GTOH 3PF5A 4JC0A 3U4ZA 4GNXC 4A93H 3E9IA 4GLXA 4LNQA 1QVCA 3CMEA 4DR3Q 5J3BA 4DV3Q 4HJ8A 2JA6H 3GTJH 3S2HH 1KD1C 4LF7Q 4GNXA 2B3GA 1PYSB 1YJNA 2Q2TA 4B3SL 3HOWG 4JBJA 5IY0A 1XJVA 1X55A 4MNOA 1WYDA 4HJAA 2JE6I 2MFIA 1EYGA 2AMCB 1EUJA 2JA8H 2Z6KC 5IT9c 3AFQA 1BBUA 3J7ZC 3PIPA 2VW9A 1VQ4A 1IBML 4TQUS 1S72A 1JJCB 4BY1G 4LF4Q 3J7A5 1RL2A 4LFAL 1IZ6A 4IJHA 1LM0A 3PV0A 2UU9Q 3CP0A 2RF4A 1WCMG 2OQ0A 2YTVA 4DNIA 4A3GH 5LMUL 3K81C 5C4XG 4LF8L 2JA5H 3CCVA 3DLLA 4A3FH 5LMNL 4DV5Q 2ES2A 4QQBX 2ZM6L 4DV1Q 1D7QA 2YYZA 3STBC 2WAQG 1IBLQ 5C44G 4B3TQ 3HFZB 4JI8Q 4KHZA 1PHJA 3AYHB 4LFCQ 1HNWL 1KAWA 1I50H 2D62A 2ID0A 4NB3A 2OTLA 3I4MH 1OXXK 4LF5Q 2JA7H 5FJ8G 4JI2Q 2HT1A 1VQHA 2VZAA 2UXDQ 4GKKL 4PZ6A 5JJIA 3S1MH 4IPCA 4YWMA 3BJUA 1JB7A 3CCRA 1VQ7A 2NVTH 3PUXA 2HIVA 4LF9L 3CCEA 1N9WA 1Z47A 3ERSX 4DUZL 4BBRG 4HIDA 1IBKL 4UP7A 2A8VA 2IHFA 4A3JG 4POGA 2R6GA 3I56A 4XTCS 5C4JH 2ZJPA 2VL6A 3PSIA 4A3DH 4OONA 4B3SQ 3B6YA 1PH9A 1K8GA 4PZ8A 1R9TH 4UP8A 5LMNW 1VQPA 1QZGA 1NMFA 4DK6C 1VCIA 1KQSA 5GQOA 1XNQL 2OCEA 5HGQA 1NY4A 1JT8A 2Q2IA 3M4PA 1OXVA 1IBMQ 3VDYA 1JE5A 1HJPA 1MKHA 3J81c 1QZHA 3H3VI 3CPWA 5ELNA 1KHIA 4LFAQ 1K9MC 1VQFA 1UE7A 2NN6I 3J81j 1IL2A 3HOWH 5H1SE 1OTCA 5LMUQ 1A0IA 3FP9A 4LF8Q 1Q8KA 2LXKA 5LMNQ 2Q2UA 1YZ6A 2ZM6Q 4AQYL 1PA6A 1VQ6A 1Y1VG 1Y14B 4X65Q 1KXLA 1TWFH 3U4VA 2KENA 1HR0W 4H02A 4JYAL 5GAGC 3NENA 1UE5A 1VQEA 4BY1H 1XTDA 1HNWQ 3HOZG 3K7AH 1JJ2A 3RZDH 1EFWA 4DUYQ 4BY7G 1IYJB 1WCMH 1FJGL 2UXCL 4IPHA 2EXDA 2I5LX 3UDFA 4GKKQ 2VNUD 1QVGA 3UE1A 1BBWA 5IWAL 3J81i 4B3RL 1E1TA 1FVIA 2UUBL 1BVSA 2VQEL 3K8AA 5M5YH 5C3EG 3Q8DA 5C44H 2R92G 1VQDA 1X6OA 2MO1A 4OWTB 4LF9Q 4C3IH 4DUZQ 1N36L 2OQKA 3TREA 3ULJA 1IBKQ 4L5SA 4DR6L 3G6EA 2WAQE 1NMGA 5IYDG 1XNRL 4DV5L 5FJ8H 4JG2A 3TQYA 2WB1E 3LGJA 3I2ZA 1XPRA 2I5HA 4DV6L 2JQOA 1E24A 4OXPA 1XNQQ 3U50C 4JI3L 1P16A 1CKMA 4JI8L 2KHIA 3KLWA 5K36G 4GNXB 1YJ9A 4YHHL 1EQRA 1PFSA 5FLXc 4BBRH 4HJ9A 2F52A 1SROA 4A3JH 1KL9A 1S3OA 4HIOA 4LFBL 5ELOA 1GKHA 3KOJA 3GTMH 5C0XG 1YJWA 3S24A 4A3BG 3U58A 1LUZA 5M5XH 3EN2A 3OW2A 1EQQA 1L0WA 1PV4A 1QVFA 4IFDJ 4A3CG 3M85A 1Q1BA 4OO1I 3CAMA 4AQYQ 1YHBA 1HH2P 3GO5A 5M3FG 4DAMA 3TRZA 5GROA 4R4OA 4JYAQ 1TWHH 4B3ML 1PH4A 1VQ8A 4PMWA 3S1QH 4Y52H 2Y0SG 1VQOA 1X65A 3G48A 1FJGQ 4C3HH 2UXCQ 2JJQA 2IHEA 2B63G 5IWAQ 4B3RQ 4WJ4A 1G51A 2CQOA 3HKZE 4L5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PCO B;  2VQE Q;  1C0A A;  3HOY G;  1Y1V H;  4X62 L;  2V1C C;  4Y7N H;  3KF6 B;  2Z6K A;  1N36 Q;  4PZ7 A;  4A3M G;  4DR6 Q;  1PVO A;  5JJL A;  1V43 A;  4J15 A;  3HOZ H;  1DGS A;  1J5E L;  1OXT A;  3H0G G;  2N8N A;  4YCU A;  2N49 A;  1MJC A;  4GN4 B;  1N32 L;  4BY7 H;  1XNR Q;  4X6A H;  2RHS B;  3J80 i;  4APV A;  3PGZ A;  4DV6 Q;  3F2C A;  1EWI A;  3GTP H;  4OX9 L;  2D0O A;  2PMZ E;  4X65 L;  2E5L L;  1OXS C;  1X3F A;  4KI0 A;  1Y1W G;  2A19 A;  4JI3 Q;  4MTN A;  5C3E H;  3RR5 A;  3ULP A;  1NJI C;  2HHH L;  4L5Q A;  1CSP A;  2R92 H;  3JAM i;  4YHH Q;  1K8A C;  1HNZ L;  4BXX G;  3PUY A;  3KF6 A;  1KRT A;  4DUY L;  2BA1 A;  3W5O A;  2E2I H;  5IYB G;  4K0K L;  1LYL A;  4LFB Q;  2MO0 A;  1N33 L;  4BBS G;  1Q82 C;  2NZH A;  2YTY A;  5IYD H;  2QA4 A;  5AJ3 L;  1FL0 A;  4IPG A;  2GVA A;  1ASY A;  1YI2 A;  1XMQ L;  1HR0 L;  4OWW B;  2PQA A;  2F3I A;  2GN5 A;  3MXN B;  3S1N H;  4KHP L;  3HKS A;  4OWX B;  1K83 H;  1HZB A;  1RIP A;  4DR1 L;  1XPU A;  3CCQ A;  3GTK H;  4GN5 A;  1YHQ A;  4B3M Q;  3PUV A;  2VUM G;  2UXB L;  4JOI C;  3OTO L;  3D31 A;  4EX5 A;  3G4S A;  2E2H H;  4UY8 C;  2N3S A;  1KC8 C;  5IP7 G;  4A75 A;  4A3B H;  4DR4 Q;  5M3M G;  4MZ9 A;  3PO2 H;  1PH8 A;  1HZC A;  3F2B A;  4A3C H;  4GS3 A;  4A4I A;  1AE2 A;  3UE0 A;  4JOI A;  2ZTE A;  3M4O H;  3BZK A;  1FGU A;  5GAD C;  3CCM A;  3I4N G;  1A8V A;  5M3F H;  2D0P A;  2MQH A;  1X54 A;  4X62 Q;  2CKZ B;  4AYB G;  1SFO H;  1PH3 A;  2N78 A;  4GOP C;  3CMA A;  1VQG A;  3H15 A;  2UUC L;  4A3L G;  1J5E Q;  1N32 Q;  3D0F A;  1Q12 A;  3S14 H;  3A5U A;  2E2J H;  2B29 A;  3S16 H;  1GM5 A;  3UDI A;  3KF8 B;  3S1R H;  4HIK A;  4OX9 Q;  2K4K A;  4ME3 A;  4GOP A;  1ASZ A;  2B63 H;  1HNX L;  2E5L Q;  1YHA A;  3DM3 A;  1WI5 A;  3OYY A;  2VY3 A;  4DKA C;  3HOY H;  2HHH Q;  3HOV G;  2ZTD A;  1Q86 C;  4QGU A;  1X9N A;  3NBH B;  1HNZ Q;  3T1H L;  4A3M H;  2YU9 H;  4LWC A;  4IFD I;  2C35 B;  4K0K Q;  3H0G H;  3I7F A;  2XTI A;  1N33 Q;  4TVA B;  1IXR A;  1I3Q H;  3RLF A;  5FLM H;  2BA0 A;  2FXQ A;  2IX0 A;  2CWP A;  5AJ3 Q;  4JI1 L;  2IY5 B;  3EBE A;  3W1B A;  1EIF A;  4POF A;  5IP9 G;  1XMQ Q;  1Y1W H;  1M1K C;  1HR0 Q;  1MIU A;  2WP8 J;  3ER0 A;  4AIM A;  3HOU G;  3M7N A;  2EIF A;  1VQC A;  4IO9 A;  3STB D;  4DR1 Q;  4P72 A;  2VQF L;  4BXX H;  2HIX A;  2UXB Q;  5JEA G;  2K75 A;  3OTO Q;  3FKI G;  3GTG H;  3NEM A;  5IYB H;  3NEL A;  3HOX G;  1HZA A;  2PNH A;  3L7Z C;  4XIG S;  4BBS H;  2NN6 G;  1J6Q A;  2BH8 A;  1O7I A;  3RLO A;  4JCV E;  2QEX A;  4DAY B;  1UE1 A;  4X64 L;  2R7F A;  2KCM A;  3RN2 A;  4A3E G;  4IOA A;  3M9B A;  5EAY A;  3KJO A;  2KCT A;  1YIJ A;  2R7Z G;  4R4Q A;  2PI2 E;  3CCU A;  1XMO L;  2WFW A;  1K3R A;  2BH2 A;  2VUM H;  3SGI A;  5DLQ E;  2UUC Q;  3KYH C;  3PO2 G;  1X3E A;  1X56 A;  2LXJ A;  5IP7 H;  3PO3 G;  3TS0 A;  5M3M H;  4R4C A;  4IFD G;  1NBW A;  1VS0 A;  4YWL A;  3K80 C;  1Q1E A;  3CCL A;  3J80 c;  2HQL A;  1UWV A;  2CFM A;  4JI6 L;  3TS2 A;  1SR3 A;  4C2M H;  2YV5 A;  2RHQ B;  1HNX Q;  3I4N H;  4GN3 B;  2UUA L;  3M4Q A;  3S2D H;  4WJ3 M;  4JI7 L;  3CCJ A;  3JAM c;  4JI4 L;  4DR4 L;  4DV0 L;  2F4V L;  3T1H Q;  3WWV A;  4DR2 L;  1CKO A;  2ATW A;  4A3L H;  3CXC A;  3UDG A;  1L2F A;  1VQM A;  4DV2 L;  1E22 A;  3AQQ A;  1P8L A;  1U5K A;  1AH9 A;  2ALY B;  4JI1 Q;  4AH6 A;  1WFQ A;  4R1J A;  4DR5 L;  1G29 1;  3L2P A;  1SMX A;  3HOV H;  2NVY H;  4NPS A;  2VQF Q;  1K73 C;  2K5V A;  1I6H H;  2K14 A;  4R4I A;  4A3K G;  5FLM G;  1XPO A;  2JA9 A;  3PIO A;  4QY7 A;  1I5F A;  3PF4 A;  2PQA B;  2JK8 A;  1VQK A;  2A1A A;  2EQS A;  4LF6 L;  3GTL H;  3KFU A;  3BU2 A;  4P75 A;  4X64 Q;  4OO1 G;  1YEZ A;  1YIT A;  5IP9 H;  1B7Y B;  2E8G A;  1NE3 A;  2I0Q A;  3CC4 A;  4A76 A;  1VQN A;  1EIY B;  3HOU H;  1SN8 A;  4JI5 L;  1V9P A;  3CW2 C;  4EQ5 A;  4LUV A;  3AFP A;  3ZJY C;  3GD7 A;  4RG1 A;  1XMO Q;  1SE8 A;  4NXM L;  3H3V H;  2MNA A;  4LUO A;  4JI0 L;  1YBY A;  3FKI H;  1PH1 A;  3F1Z A;  3ULL A;  1JMC A;  3HOX H;  1GVP A;  5IE8 A;  5E7N A;  2OWO A;  3E9H A;  1TXY A;  3CD6 A;  2I5M X;  3I55 A;  1H95 A;  1EOV A;  4IJL A;  1PH5 A;  1TWA H;  1GD7 A;  4X66 L;  4JI6 Q;  3A74 A;  3CCS A;  3BZC A;  4A3E H;  1UE6 A;  2WB1 G;  3T1Y L;  4A3I G;  5M5W H;  3E0E A;  2UUA Q;  2R7Z H;  1M90 C;  3CC2 A;  4QIW E;  2XGT A;  3W1G A;  2ZTC A;  1SRU A;  4JI7 Q;  4QL5 A;  1WJJ A;  4JI4 Q;  5IYC G;  4DV0 Q;  2F4V Q;  2Q2H A;  4LW1 A;  4DR2 Q;  1I94 L;  2CWA A;  4JV5 L;  3K7U C;  4JBM A;  2PI2 A;  3G71 A;  4GLV B;  4PG3 A;  4DV2 Q;  4GOP B;  4YY3 L;  1N34 L;  3PO3 H;  2K5N A;  4O0A A;  1TWG H;  4UP9 A;  1X3G A;  1MJE A;  4DR7 L;  2R93 G;  2RCN A;  4UPA A;  1Q46 A;  3TEH B;  2AHO B;  4DR5 Q;  3M3Y H;  2KBN A;  4ALP A;  4NXN L;  1W3S A;  4DV7 L;  3S15 H;  1E3P A;  1C7Y A;  2ZJR A;  5BR8 L;  2UUB Q;  3KDF B;  2YTX A;  2JEB I;  2AKW B;  1VQB A;  4DK3 C;  1B70 B;  3K0X A;  4A93 G;  1VQL A;  2NZO A;  3A5Z B;  2VS1 A;  2K52 A;  3PUZ A;  3CC7 A;  1BKB A;  3GTQ H;  4GKJ L;  2Y0S E;  4LF6 Q;  4RMF A;  1QUQ B;  1U0L A;  4LUZ A;  1VQ9 A;  2JA6 G;  3RN5 A;  3ICE A;  4BA2 I;  4KHP Q;  4HJ5 A;  1E1O A;  4JI5 Q;  3JC6 6;  1Q81 C;  1VQA A;  2Z0S A;  1D8L A;  4O2D A;  4DV4 L;  4KLK A;  1N8R C;  1L1O B;  1E7Z A;  1C9O A;  4NXM Q;  4JBK A;  3HKZ G;  3KDF A;  5JJK A;  1UEB A;  4JI0 Q;  4A3K H;  1CSQ A;  1V1Q A;  1WOC A;  4P71 A;  1GO3 E;  1PH6 A;  1A63 A;  1LTL A;  1VQJ A;  2JA8 G;  3CPF A;  4BA1 I;  1VQI A;  4C3J H;  4QJF A;  4DR3 L;  4DV3 L;  1L1O C;  4X66 Q;  1S40 A;  2LSS A;  1A62 A;  1HZ9 A;  1QUQ A;  4LF7 L;  2CCZ A;  3T1Y Q;  1K0R A;  1JJG A;  4HIM A;  5HY6 A;  5C0X I;  1PYB A;  2K50 A;  3UDX A;  4FDB A;  4A3G G;  1G6P A;  1L1O A;  3EIV A;  2DGY A;  4A3F G;  1PH2 A;  1I94 Q;  2JA5 G;  4JV5 Q;  4HJ7 A;  1Q7Y C;  3AEV A;  2ZJQ A;  5C4X H;  2KHJ A;  1N34 Q;  4R4T A;  2DUD A;  4YY3 Q;  1OXU A;  1KIX A;  1PH7 A;  3F2D A;  4P74 A;  1CUK A;  4DR7 Q;  4LF4 L;  1TWC H;  1B8A A;  3F8T A;  2AWN A;  4P73 A;  1SLJ A;  3RLN A;  3I4M G;  2H5X A;  4A3I H;  1CKN B;  4JBW A;  4YCW A;  2L15 A;  1W2B A;  2QGQ A;  2UU9 L;  4DV7 Q;  4L5R C;  4NXN Q;  2JA7 G;  2OTJ A;  3RZO H;  3L0O A;  1NTG A;  5JEA J;  1YNX A;  5BR8 Q;  3IRB A;  5IYC H;  3CF5 A;  1AE3 A;  2NVX H;  2IX1 A;  4DV1 L;  3GDE A;  3CQZ H;  4IPD A;  2NVQ H;  2K5H A;  1IBL L;  2ASB A;  2JEA I;  1Z9F A;  4B3T L;  4GKJ Q;  1VQ5 A;  3KJP A;  4YCV A;  2R93 H;  4DPG A;  1YVC A;  2R7D A;  2AWO A;  4LFC L;  3RNU A;  3A0J A;  4GLA C;  5GAE C;  2GVB A;  1CKN A;  3FHW A;  4LF5 L;  4A3D G;  5C0X J;  2IT1 A;  4DV4 Q;  4JI2 L;  3I4O A;  1KRS A;  3MEF A;  4IOC A;  3S17 H;  2UXD L;  3PUW A;  5GAH C;  1T9H A;  4YWK A;  4AYB E;  3GTO H;  3PF5 A;  4JC0 A;  3U4Z A;  4GNX C;  4A93 H;  3E9I A;  4GLX A;  4LNQ A;  1QVC A;  3CME A;  4DR3 Q;  5J3B A;  4DV3 Q;  4HJ8 A;  2JA6 H;  3GTJ H;  3S2H H;  1KD1 C;  4LF7 Q;  4GNX A;  2B3G A;  1PYS B;  1YJN A;  2Q2T A;  4B3S L;  3HOW G;  4JBJ A;  5IY0 A;  1XJV A;  1X55 A;  4MNO A;  1WYD A;  4HJA A;  2JE6 I;  2MFI A;  1EYG A;  2AMC B;  1EUJ A;  2JA8 H;  2Z6K C;  5IT9 c;  3AFQ A;  1BBU A;  3J7Z C;  3PIP A;  2VW9 A;  1VQ4 A;  1IBM L;  4TQU S;  1S72 A;  1JJC B;  4BY1 G;  4LF4 Q;  3J7A 5;  1RL2 A;  4LFA L;  1IZ6 A;  4IJH A;  1LM0 A;  3PV0 A;  2UU9 Q;  3CP0 A;  2RF4 A;  1WCM G;  2OQ0 A;  2YTV A;  4DNI A;  4A3G H;  5LMU L;  3K81 C;  5C4X G;  4LF8 L;  2JA5 H;  3CCV A;  3DLL A;  4A3F H;  5LMN L;  4DV5 Q;  2ES2 A;  4QQB X;  2ZM6 L;  4DV1 Q;  1D7Q A;  2YYZ A;  3STB C;  2WAQ G;  1IBL Q;  5C44 G;  4B3T Q;  3HFZ B;  4JI8 Q;  4KHZ A;  1PHJ A;  3AYH B;  4LFC Q;  1HNW L;  1KAW A;  1I50 H;  2D62 A;  2ID0 A;  4NB3 A;  2OTL A;  3I4M H;  1OXX K;  4LF5 Q;  2JA7 H;  5FJ8 G;  4JI2 Q;  2HT1 A;  1VQH A;  2VZA A;  2UXD Q;  4GKK L;  4PZ6 A;  5JJI A;  3S1M H;  4IPC A;  4YWM A;  3BJU A;  1JB7 A;  3CCR A;  1VQ7 A;  2NVT H;  3PUX A;  2HIV A;  4LF9 L;  3CCE A;  1N9W A;  1Z47 A;  3ERS X;  4DUZ L;  4BBR G;  4HID A;  1IBK L;  4UP7 A;  2A8V A;  2IHF A;  4A3J G;  4POG A;  2R6G A;  3I56 A;  4XTC S;  5C4J H;  2ZJP A;  2VL6 A;  3PSI A;  4A3D H;  4OON A;  4B3S Q;  3B6Y A;  1PH9 A;  1K8G A;  4PZ8 A;  1R9T H;  4UP8 A;  5LMN W;  1VQP A;  1QZG A;  1NMF A;  4DK6 C;  1VCI A;  1KQS A;  5GQO A;  1XNQ L;  2OCE A;  5HGQ A;  1NY4 A;  1JT8 A;  2Q2I A;  3M4P A;  1OXV A;  1IBM Q;  3VDY A;  1JE5 A;  1HJP A;  1MKH A;  3J81 c;  1QZH A;  3H3V I;  3CPW A;  5ELN A;  1KHI A;  4LFA Q;  1K9M C;  1VQF A;  1UE7 A;  2NN6 I;  3J81 j;  1IL2 A;  3HOW H;  5H1S E;  1OTC A;  5LMU Q;  1A0I A;  3FP9 A;  4LF8 Q;  1Q8K A;  2LXK A;  5LMN Q;  2Q2U A;  1YZ6 A;  2ZM6 Q;  4AQY L;  1PA6 A;  1VQ6 A;  1Y1V G;  1Y14 B;  4X65 Q;  1KXL A;  1TWF H;  3U4V A;  2KEN A;  1HR0 W;  4H02 A;  4JYA L;  5GAG C;  3NEN A;  1UE5 A;  1VQE A;  4BY1 H;  1XTD A;  1HNW Q;  3HOZ G;  3K7A H;  1JJ2 A;  3RZD H;  1EFW A;  4DUY Q;  4BY7 G;  1IYJ B;  1WCM H;  1FJG L;  2UXC L;  4IPH A;  2EXD A;  2I5L X;  3UDF A;  4GKK Q;  2VNU D;  1QVG A;  3UE1 A;  1BBW A;  5IWA L;  3J81 i;  4B3R L;  1E1T A;  1FVI A;  2UUB L;  1BVS A;  2VQE L;  3K8A A;  5M5Y H;  5C3E G;  3Q8D A;  5C44 H;  2R92 G;  1VQD A;  1X6O A;  2MO1 A;  4OWT B;  4LF9 Q;  4C3I H;  4DUZ Q;  1N36 L;  2OQK A;  3TRE A;  3ULJ A;  1IBK Q;  4L5S A;  4DR6 L;  3G6E A;  2WAQ E;  1NMG A;  5IYD G;  1XNR L;  4DV5 L;  5FJ8 H;  4JG2 A;  3TQY A;  2WB1 E;  3LGJ A;  3I2Z A;  1XPR A;  2I5H A;  4DV6 L;  2JQO A;  1E24 A;  4OXP A;  1XNQ Q;  3U50 C;  4JI3 L;  1P16 A;  1CKM A;  4JI8 L;  2KHI A;  3KLW A;  5K36 G;  4GNX B;  1YJ9 A;  4YHH L;  1EQR A;  1PFS A;  5FLX c;  4BBR H;  4HJ9 A;  2F52 A;  1SRO A;  4A3J H;  1KL9 A;  1S3O A;  4HIO A;  4LFB L;  5ELO A;  1GKH A;  3KOJ A;  3GTM H;  5C0X G;  1YJW A;  3S24 A;  4A3B G;  3U58 A;  1LUZ A;  5M5X H;  3EN2 A;  3OW2 A;  1EQQ A;  1L0W A;  1PV4 A;  1QVF A;  4IFD J;  4A3C G;  3M85 A;  1Q1B A;  4OO1 I;  3CAM A;  4AQY Q;  1YHB A;  1HH2 P;  3GO5 A;  5M3F G;  4DAM A;  3TRZ A;  5GRO A;  4R4O A;  4JYA Q;  1TWH H;  4B3M L;  1PH4 A;  1VQ8 A;  4PMW A;  3S1Q H;  4Y52 H;  2Y0S G;  1VQO A;  1X65 A;  3G48 A;  1FJG Q;  4C3H H;  2UXC Q;  2JJQ A;  2IHE A;  2B63 G;  5IWA Q;  4B3R Q;  4WJ4 A;  1G51 A;  2CQO A;  3HKZ E;  4L5T A; 
#chains in the Genus database with same CATH topology
 2K32 A;  3HOY G;  2K04 A;  4X62 L;  2B8G A;  4Y7N H;  1WTX A;  1XDN A;  5CV4 A;  3KF6 B;  4R7R A;  5KFR A;  4GKK H;  4HMI A;  5JJL A;  4RU9 A;  4J15 A;  1Z2N X;  1J5E L;  4KN7 C;  1OXT A;  2N88 A;  5C4X B;  3M9N B;  2OT2 A;  3MVV A;  4JV0 A;  1XNR Q;  1AP0 A;  1CK1 A;  4F4Y A;  3F2C A;  5KT7 A;  2WAQ B;  2PMZ E;  1TWC B;  2E5L L;  1X3F A;  1SYX B;  5C44 B;  1KDA A;  4KN4 C;  4JI3 Q;  1TWF A;  5C8Y F;  1NJI C;  2HHH L;  2R92 H;  3Q8R B;  3GII A;  3JAM i;  4YHH Q;  4LSX A;  4O3S A;  3PUY A;  3KF6 A;  2ZDG A;  2BA1 A;  3DWA A;  2L5T A;  4LFB Q;  4RUC A;  2MO0 A;  2NZH A;  3HS0 C;  2QA4 A;  1FL0 A;  2WAQ A;  1JCK B;  1XMQ L;  1HR0 L;  2PQA A;  3MXN B;  2GN5 A;  4OWW B;  1HZB A;  1RIP A;  2PVP A;  3DEP A;  3VR6 A;  3GTK H;  3TSS A;  1I4G A;  2K6A A;  1ZET A;  2UXB L;  1ET9 A;  3OTO L;  3GTO B;  3M7G A;  2N3S A;  2I07 B;  5M3M G;  4TQS A;  4EQP A;  3PO2 H;  1PH8 A;  3UE0 A;  2ZTE A;  3BZK A;  1EY5 A;  4LJZ C;  2QKI C;  4FXD A;  2DPI A;  3UQ8 A;  5LHY 1;  4FF1 A;  3MXN A;  4F4Z A;  2W70 A;  5M3F H;  3RAQ A;  1ZEQ X;  4GOP C;  2FHT A;  4A3L G;  3H15 A;  4I4T F;  3GTO A;  2RGV A;  3D0F A;  2F0O A;  2ATL A;  1Q12 A;  2JA8 B;  3A5U A;  4ZRZ A;  4ZKC B;  2BOS A;  3BDL A;  1EL0 A;  1UNN C;  1D6E C;  4C56 C;  1D1K A;  5KFC A;  4OX9 Q;  1KNA A;  1YHA A;  4EEY A;  1PTO H;  1WI5 A;  1W96 A;  1FNU A;  2VY3 A;  2FE3 A;  3T4A C;  3VA5 A;  1Q86 C;  2HDM A;  1SNQ A;  5K5P A;  1X9N A;  3NBH B;  2PYK A;  2YU9 H;  4LWC A;  4IFD I;  2C35 B;  4GZY C;  3H0G H;  4JI3 H;  2XTI A;  4KY7 A;  3PIO 3;  1IXR A;  1I3Q H;  4ZUI A;  1MHW C;  2RCF A;  4DNR B;  3MAQ A;  1DIK A;  4YHH H;  1BGW A;  2IX0 A;  5AJ3 Q;  4KJO A;  2IY5 B;  2KED A;  5IP9 G;  2R92 B;  1G8Z D;  1XMO H;  1Y1W H;  1M0T A;  4XYM B;  5EWE A;  3M7N A;  2FP4 B;  1VQC A;  1GYF A;  3STB D;  2W7O A;  2H1E A;  5KX5 F;  3MTS A;  3NBH A;  3FKI G;  4G57 A;  3NEL A;  3PN1 A;  5JPM C;  2PNH A;  4XIG S;  1J6Q A;  1RKN A;  1O7I A;  1Y69 U;  2XSC A;  1IYU A;  2Z4H A;  3PW7 A;  4X64 L;  5KFQ A;  3D6C A;  4A3E G;  1ZHS A;  2F0F A;  2BE5 C;  3E5S A;  2R92 A;  3GTK B;  3L3O C;  4A3D B;  1KJQ A;  3CCU A;  2KOL A;  1XMO L;  1BNZ A;  4RNN A;  4S3S A;  5DM6 3;  3MA2 B;  3HB9 A;  2XNA C;  1JIC A;  3PW0 A;  4EG0 A;  1PZK D;  3BVG A;  5E4X A;  1STG A;  2LXJ A;  1F2Y A;  2A69 C;  3KUP A;  1VS0 A;  1ZYR C;  3K80 C;  4YWL A;  3JZI A;  1CZG A;  1O80 A;  2HQL A;  3PW5 A;  3TBI B;  5M3F B;  2C2D A;  1I4H A;  1IOV A;  1RJR A;  3GTK A;  4JI7 L;  1EEF D;  2JEJ A;  2F4V L;  1SE4 A;  3T1H Q;  2ATW A;  1KLU D;  3V6H A;  2I87 A;  1BCP F;  1VQM A;  5KYI A;  1E22 A;  5FK9 C;  2V9W A;  1P8L A;  2Z4I A;  5EWG A;  4RH6 A;  5M9O A;  4QB4 A;  1YNN D;  3OMG A;  3QO2 A;  1TU2 B;  4AH6 A;  4BY1 B;  3VR4 A;  1WFQ A;  4U68 A;  3LWU A;  2NU6 B;  3RZD B;  1YNJ D;  4LMY A;  5KFY A;  3J7A K;  2YW2 A;  3HOV H;  3LML A;  5ELE A;  2NVY H;  4NPS A;  3TP7 A;  5L37 A;  1T36 A;  1I6H H;  3LP8 A;  4A3K G;  5FLM G;  1AZQ A;  2ICI A;  4NP5 A;  3FDT A;  1RTO A;  1I5F A;  4Q43 A;  3RMH A;  2JK8 A;  1VQK A;  3OWE B;  1Y1W B;  4LF6 L;  5KG3 A;  1EU3 A;  2MP1 A;  1ULZ A;  3TIG A;  2W8K A;  2BR0 A;  2E8G A;  3CC4 A;  4KHP L;  4A76 A;  4RAU C;  3HOU H;  1SN8 A;  4IQZ A;  4LUV A;  2YU9 A;  3ZJY C;  1CT1 D;  4RG1 A;  4M1U B;  3H0G A;  1U4L A;  1YBY A;  1JMC A;  4UAI A;  3NQT A;  4IAL A;  1I3Q A;  1DV1 A;  1H95 A;  1EOV A;  1PH5 A;  4ECS A;  1PFM A;  2PW5 A;  4X66 L;  1K1S A;  3A74 A;  2IA6 A;  3CCS A;  1Y1W A;  1UE6 A;  1MD2 D;  2R7Z H;  3HGB A;  4XQQ A;  2RDH A;  2XGT A;  3W1G A;  1VMP A;  2CQY A;  2P0A A;  4DR2 Q;  1I94 L;  1E4E B;  1EYD A;  3JAM L;  3BVZ A;  4JV5 L;  1TQO A;  2W6P A;  2F0M A;  3ONA B;  2PI2 A;  4DV2 Q;  1DON A;  1SYD A;  4PG3 A;  1G91 A;  5DQG A;  3NTH A;  5CR3 A;  2K5N A;  1GUT A;  1BJT A;  1X3G A;  3DWQ A;  2RCN A;  1Q46 A;  3EJI A;  3LX0 A;  1ENA A;  3S1Q B;  4DV4 H;  2AUK A;  2M05 A;  4ALP A;  1SSO A;  4XYQ A;  1T5E A;  1V1O A;  2YTX A;  1WD0 A;  1Z7T A;  4CJ2 C;  4DK3 C;  2RKS A;  4Q44 A;  2NZO A;  3VPB A;  2VS1 A;  1SND A;  2A74 C;  2K52 A;  3MC0 B;  3PUZ A;  3GTQ H;  3MR3 A;  2Y0S E;  1EZ8 A;  1PMR A;  3DXJ C;  4RMF A;  1VQ9 A;  3RN5 A;  3HOV B;  3HOZ B;  3GLK A;  5JOB A;  1C48 A;  4AYB A;  2Z0S A;  2YS6 A;  4DV4 L;  1N8R C;  5FO8 B;  5JJK A;  3GTP B;  1MBY A;  4JI0 Q;  1HHV A;  4IWY A;  2JA8 G;  1VQJ A;  4APM A;  5CV8 A;  4RCO A;  2I8C A;  1UAP A;  1DOM A;  1GXD C;  5FD6 A;  3HOU B;  4KV6 A;  2E2I B;  2YRW A;  4HNU A;  1JJG A;  3T1Y Q;  1K0R A;  1CHQ D;  2R7M A;  2NVY A;  1DCZ A;  3J81 E;  5C0X I;  4Q45 A;  4FDB A;  2VB2 X;  4WRD A;  1BOS A;  2BQR A;  1PH2 A;  2JA5 G;  3GTP A;  1PYW D;  1Q7Y C;  5L9X A;  2KHJ A;  4RHR A;  4YY3 Q;  3Q0A A;  4MTD A;  5EPL A;  4ZCK A;  1UEA B;  2EXZ A;  4X3T A;  3RD4 A;  1PH7 A;  2R7Z B;  2SCU B;  4DR2 H;  2MGS A;  1B8A A;  4P73 A;  1SLJ A;  4A3I H;  2E2H B;  1CKN B;  4HSP A;  4JBW A;  1W2B A;  4Q0Y A;  2CQA A;  4DV2 H;  4DV7 Q;  3RZO H;  1I7L A;  1YNX A;  5IYC H;  1AE3 A;  1JOO A;  3M4O B;  5EZY F;  1JQY D;  2MCT A;  4DV1 L;  3CQZ H;  4ECZ A;  2NVQ H;  2J4X A;  4FYD A;  2K5H A;  1IBL L;  2ASB A;  2W6M A;  1Z9F A;  3N44 B;  4GKJ Q;  1AW7 A;  3JSL A;  4HNT A;  4YR2 A;  2R7Z A;  2R7D A;  3IKJ A;  1AFP A;  5J2U F;  5GAE C;  2E2H A;  1CKN A;  4A3D G;  3R2T A;  3CRK C;  4MV4 A;  4KJN A;  3I73 A;  2F0S A;  3I4O A;  3MFY A;  5GAH C;  3RTX A;  4GNX C;  5KFT A;  2R87 A;  4MTE A;  4UCT A;  4LNQ A;  4N8F A;  4MN3 A;  5C4Z A;  4DR3 Q;  5J3B A;  3T51 B;  2VOB A;  4U6P A;  3P1H A;  1VF7 A;  4J6H A;  4HJ8 A;  4A3M B;  1GSO A;  4JI0 H;  4LF7 Q;  1D5Z C;  2IX3 A;  4MV8 A;  1YJN A;  1M0W A;  1ONL A;  2D9U A;  2ZM6 H;  3GV7 B;  1KBL A;  2G5D A;  2CW8 A;  3RB4 A;  1WYD A;  4RB3 C;  2JE6 I;  2MFI A;  1JB3 A;  2GA4 B;  1B1Z A;  1RCV D;  1DD2 A;  5IGE A;  1VBH A;  5CA1 F;  3GTQ A;  1WTO A;  1IBM L;  4TQU S;  3ERQ A;  5TSS A;  2R6F A;  1JJC B;  4BY1 G;  3L4J A;  1D2B A;  2V58 A;  2F0L A;  3PV0 A;  1X32 A;  3CP0 A;  2IWH A;  1ZQ7 A;  3CRL C;  4LH6 A;  4A3G H;  4DL6 A;  4O1N A;  2FKL A;  4QQB X;  2ZM6 L;  1D7Q A;  3FDS A;  2G9H D;  4DV7 H;  3TII A;  1E0B A;  1B4O A;  3KLS X;  2O5I C;  4KHZ A;  5LL6 X;  2XC9 A;  2OTL A;  4J1M A;  3RZO B;  2A68 C;  5A2Q W;  4JV2 A;  1OXX K;  2BE5 D;  1EY4 A;  1UNS A;  4JI2 Q;  4GKJ H;  1VQH A;  1XNQ H;  2UXD Q;  3S1M H;  2NVQ B;  4YWM A;  2DY8 A;  3BJU A;  3WO0 A;  2R8I A;  1VQ7 A;  3G6Y A;  2HIV A;  3DEO A;  4CDD C;  2A69 D;  1ZYR D;  2WB1 A;  1MI2 A;  4ECR A;  3W2D A;  3ND9 A;  4A2A A;  4POG A;  3I56 A;  5C4J H;  2J6S A;  4IZ8 A;  3TME A;  2F0N A;  4B3S Q;  1GLV A;  4L63 B;  4DR3 H;  1S10 A;  1F9Q A;  1QIL A;  1QOH A;  4CBV A;  1VQP A;  3GIL A;  2V4R A;  1LT6 D;  5KNB A;  4DK6 C;  1KQS A;  1XNQ L;  1CE8 A;  1CZW A;  2OCE A;  1JT8 A;  2Q2I A;  2EYH A;  1RK6 A;  4IRD A;  2OLS A;  3J81 c;  5IT9 L;  4XT1 B;  1QZH A;  3CPW A;  4U67 3;  5C5J A;  1K9M C;  3V05 A;  1UE7 A;  2NN6 I;  3HKZ B;  1IL2 A;  2R8K A;  2IW3 A;  1H9K A;  2KQ3 A;  1YZ6 A;  1FNV A;  1B9M A;  5IGB A;  3Q1K A;  4AQY L;  2A73 B;  2KEN A;  5KG5 A;  4JYA L;  2KSW A;  2FFK B;  3BZD B;  1VQE A;  1JDE A;  2M00 A;  3HOZ G;  4A3G B;  3K7A H;  4ZK9 B;  4EGQ A;  4DV6 H;  1S0N A;  1KJ9 A;  2HVR A;  2UUA H;  1KJI A;  4BY7 G;  1IYJ B;  3HKZ A;  1FJG L;  2PN1 A;  2EXD A;  5D1O A;  2I5L X;  4WFN 3;  3UE1 A;  3J81 i;  5IWA L;  4B3R L;  4CDF C;  3MEH A;  3BVM A;  1E1T A;  5M5W B;  2VQE L;  1WSC A;  4JI2 H;  4E4T A;  1VQD A;  1X6O A;  5I6W A;  4LF9 Q;  5ISR A;  4C3I H;  5KT3 A;  1QJO A;  4DUZ Q;  3TRE A;  1IBK Q;  4L5S A;  3EYY A;  2UXD H;  5DNF A;  1PFN A;  5DG9 A;  2X6G A;  2PMZ A;  5DM7 3;  1NMG A;  1PDQ A;  3PO3 B;  2VA3 A;  3S1M B;  5FJ8 H;  4JG2 A;  3TQY A;  1TT2 A;  3I2Z A;  3Q6S A;  4DV6 L;  2JQO A;  4XT3 B;  3U50 C;  5K36 G;  3NSW A;  4B3S H;  3S15 B;  3DUZ A;  4O2B F;  1EQR A;  5CYU A;  4BBR H;  5C4J B;  2F52 A;  3FEW X;  2Z8L A;  1JIH A;  3N41 B;  3GTM H;  5C0X G;  3I90 A;  2J9G A;  1LUZ A;  2WAC A;  1PV4 A;  4IFD J;  1L0W A;  4FS2 A;  3M85 A;  2KCC A;  4OO1 I;  2QDL A;  2DNC A;  3GO5 A;  4RB0 A;  2Q8T A;  3K5L A;  4CC6 A;  2RDJ A;  4IRC A;  3K59 A;  3SEB A;  1VQ8 A;  4PMW A;  2KUM A;  3NHH A;  2XCA A;  3NP8 A;  5LXT F;  4PNY A;  2B2V C;  3G48 A;  2UXC Q;  4C1N I;  2K01 A;  1ILP A;  2JJQ A;  1ET6 A;  1KLG D;  2P5Z X;  3K3V A;  2XGQ A;  1A3T A;  3HP3 A;  1HUN A;  1A2T A;  1CFM A;  2C22 A;  3T13 A;  5DEH A;  2W6Q A;  2Z6K A;  4DR6 Q;  4A3M G;  4O3Q A;  2FB9 A;  1AEX A;  2N8N A;  3JAM E;  2X0S A;  3J80 i;  3PZP A;  4LF9 H;  4DUZ H;  1IBK H;  4M7E A;  1EWI A;  2D0O A;  1BUV T;  2HQE A;  4C1N K;  1OXS C;  1J8I A;  4ID6 A;  1D1I A;  3MXU A;  1GOZ A;  3N6X A;  5C3E H;  5JQW A;  5JVH 3;  4L5Q A;  1CSP A;  4IR9 A;  3A8I E;  2I80 A;  1K8A C;  3JRX A;  4BXX G;  2FK1 A;  1HA5 A;  1Y8O B;  1RTN A;  2UVV A;  2IMW P;  2KVM A;  1I4R A;  4KY6 A;  2NU9 B;  3N42 B;  4TUY F;  2AQ4 A;  3DMU A;  3I12 A;  3SI8 A;  3GV3 A;  4IPG A;  3Q8S B;  1B3A A;  2NUC A;  5KG6 A;  1YI2 A;  1S4Z A;  4RKL A;  4A2B A;  1XYI A;  4BBR B;  4OWX B;  3QR8 A;  2KA7 A;  1GUS A;  4RCN A;  3PUV A;  4B3M Q;  2VUM G;  3GTM B;  3D31 A;  4O3R A;  5IGC A;  3G4S A;  4HAE A;  4A75 A;  4DR4 Q;  2PO4 A;  4F7X A;  3R8B A;  5DG8 A;  1JR0 D;  5FO7 B;  2AGP A;  4GS3 A;  5EPK A;  3Q23 A;  4JOI A;  3GTJ B;  1FGU A;  4J9M A;  2JEF A;  2NBF A;  3RAX A;  2D0P A;  2WKD A;  5IGF A;  3KAL A;  4X62 Q;  2GPW A;  3D4D A;  5KFD A;  3N40 P;  1SFO H;  1JOR A;  4B9X A;  2N78 A;  4J9S A;  3CMA A;  5A35 A;  2D5D A;  3GTM A;  1J5E Q;  1ESF A;  4QUF A;  5KFN A;  1LTG D;  5C6A A;  2DN8 A;  4XDX A;  1K0S A;  4DR6 H;  3NWS A;  3SK4 A;  4HIK A;  2B63 H;  2E5L Q;  1JX4 A;  3UI2 A;  4XX0 B;  5CB4 F;  3GTJ A;  2W9B B;  5G3L F;  3GQB A;  2HHH Q;  2ZTD A;  2AGQ A;  4QGU A;  1A2U A;  2KJX A;  3BQ2 A;  1M6V A;  4BS9 A;  3P75 A;  3RLF A;  4K14 A;  5FLM H;  2BA0 A;  4XYL B;  2FXQ A;  1D5X C;  4JI1 L;  5JJZ A;  3W1B A;  4CKC A;  1EIF A;  4POF A;  3I4M B;  1XMQ Q;  2L12 A;  1HR0 Q;  1I4P A;  2BDO A;  1MIU A;  5H80 A;  5T1G A;  2W9B A;  4O3O A;  3E3X A;  2JA7 B;  2FJ2 A;  4IO9 A;  2QK4 A;  4P72 A;  1ZKO A;  4HCS A;  2UXB Q;  3OTO Q;  3GTG H;  5IYB H;  3HOX G;  2CHB D;  2DIK A;  4BBS H;  3RB6 A;  2NN6 G;  1SEI A;  3P7J A;  5L1I A;  2A68 D;  3J7A F;  5KFJ A;  2BH8 A;  3PMF A;  3RLO A;  3D4W A;  5E4W C;  3QZ8 A;  1TR5 A;  4B3M H;  4JCV E;  2QEX A;  1EQT A;  4DAY B;  4XQJ A;  2SEB D;  2SDF A;  2KCT A;  3VYT A;  1T5X D;  1YIJ A;  1RJT A;  4JI4 H;  4DR4 H;  3IAY A;  3J81 L;  1DM0 B;  1RF2 D;  2F0U A;  2WFW A;  2IP4 A;  4I7H A;  5DLQ E;  2H4O A;  3C46 A;  2MPM A;  1QNU A;  1W93 A;  4ILW A;  1EWC A;  5IP7 H;  3PO3 G;  4F4X A;  3CCL A;  1UWV A;  1WH2 A;  1CTM A;  3TS2 A;  1SR3 A;  3KK7 A;  5CV9 A;  2VB3 X;  2RHQ B;  1J5E H;  3I4N H;  2XCP A;  1PX2 A;  5C1O A;  3VYR A;  3M4Q A;  1DOK A;  2B2T A;  4O4I F;  3JAM c;  4JI4 L;  4DR4 L;  4EFE A;  1Z6H A;  3AB9 A;  5KG0 A;  2E5L H;  1S5F D;  3UDG A;  1L2F A;  4FVM A;  4MTK A;  3M4I A;  2HHH H;  1I6V C;  4EEQ A;  4I65 A;  1CA6 A;  1TWF B;  2NYZ D;  1B2T A;  5CMD A;  5KFV A;  2B39 A;  4OHJ A;  4KD3 A;  2EY1 A;  1SFO A;  1UC9 A;  1FNW A;  2SNM A;  2PBZ A;  5EWF A;  3MR2 A;  2V4D A;  3IFT A;  2K5V A;  4TRD A;  2Y0S A;  2K14 A;  3HG9 A;  1I4X A;  1XMQ H;  1N48 A;  1HR0 H;  2YYA A;  2JSO A;  3QB3 A;  3PIO A;  5DG7 A;  4QY7 A;  1S68 A;  2PQA B;  3IG0 A;  4C3J G;  2B63 A;  1TY2 A;  3GTL H;  2EQS A;  2OXP A;  3KFU A;  4X64 Q;  4OO1 G;  2UXB H;  2DNE A;  3OTO H;  4YR3 A;  2YCH A;  1B7Y B;  1NE3 A;  1VQN A;  1WTH A;  3CW2 C;  3AFP A;  4GC6 A;  1XMO Q;  2RA4 A;  3OOC A;  3H3V H;  5KFM A;  5CV7 A;  1GHK A;  4V19 0;  5JEA H;  1GUG A;  4FS1 A;  3F1Z A;  5E7N A;  1LLR D;  4EFB A;  3E9H A;  3CD6 A;  2KEE A;  2IPK D;  1TWA H;  1GD7 A;  4OEL B;  5LL6 b;  5KIX A;  3J80 L;  2BQU A;  3A7A B;  4A3J B;  1C3O A;  5IT9 E;  4IRK A;  1S5E D;  1EQV A;  1M90 C;  2D2C C;  4UCS A;  5M5X B;  1BCP C;  4JI7 Q;  3GTG A;  2F4V Q;  3SHL A;  4Q8F A;  4DK0 A;  3K7U C;  5DAU A;  2XWB B;  3G71 A;  4GLV B;  4IFD H;  1RDP D;  4UP9 A;  4UPA A;  4IUQ A;  4F88 A;  4EBD A;  2W9C A;  4TV9 F;  4RA8 A;  2KBN A;  3H4B A;  1U4P A;  2F0P A;  4NXN L;  5G3L D;  3KDF B;  2SNS A;  4DA2 A;  5HGT A;  3U9T A;  2B2U C;  3K0X A;  2R7L A;  2EYO A;  3EPI A;  1R4Q B;  2UVU A;  3ORR A;  1BKB A;  4Y7N B;  3CHB D;  2QW7 A;  3HRZ C;  4F8M A;  2PPB C;  4LF6 Q;  1LTA D;  3ICE A;  4KHP Q;  1XWE A;  4HJ5 A;  1E1O A;  4O2D A;  1D8L A;  1EHI A;  1L1O B;  3BA9 A;  4X3K A;  5KT4 A;  4X64 H;  3KDF A;  4FF3 A;  5DLG A;  2SOB A;  2B2Y C;  4P71 A;  5KRU A;  3K57 A;  4KHV A;  4HSV A;  4QJF A;  1WD1 A;  3NGD A;  4DV3 L;  5EDW A;  4F50 A;  4X66 Q;  2YZG A;  2LSS A;  1A62 A;  3AMU A;  1HZ9 A;  2EJF C;  1F2L A;  4HIM A;  4NLG A;  1PYB A;  2K50 A;  5KG2 A;  2EDG A;  1Q90 A;  1L1O A;  2F4I A;  1I94 Q;  3R5F A;  2IBK A;  4JV5 Q;  4HJ7 A;  3M4Y A;  1TWA B;  5KFS A;  3GTL A;  1KJJ A;  4ED6 A;  4JI7 H;  2JYO A;  5JVG 3;  2F4V H;  1CUK A;  3BDO A;  4RNM A;  4IN3 A;  4LF5 H;  1E2V A;  2K05 A;  3F8T A;  2AWN A;  2DWC A;  3I4M G;  5BPH A;  1QE6 A;  3O13 A;  2JXM B;  2UU9 L;  2L15 A;  2QGQ A;  2JA7 G;  1EY8 A;  3L0O A;  3PO2 B;  1NTG A;  2A6H C;  2EY5 A;  3VR3 A;  2IL8 A;  2NVX H;  4K2K A;  1TWA A;  5IYZ F;  1SYB A;  1BBX C;  4YAK B;  3KJP A;  4CDC C;  2R93 H;  2RGR A;  1YVC A;  2YS7 A;  1BDO A;  4LF5 L;  1FD7 D;  4DV4 Q;  2L9H A;  3KHL A;  2F0D A;  3MEF A;  4TKO B;  1NCV A;  4LF6 H;  3KAJ A;  1KTK A;  4J9R A;  5ELD A;  3PF5 A;  1VMC A;  5KFF A;  3U4Z A;  4KHP H;  1PTO B;  4A93 H;  3E9I A;  1HUM A;  3GIJ A;  5FPR A;  3ORQ A;  4MV9 A;  2XCL A;  1LV9 A;  4DU9 A;  2G9D A;  3I3C A;  1MSH A;  2YU9 B;  2JA6 H;  2WIN B;  1JLL B;  3H0G B;  4LF8 H;  5J22 A;  2Q2T A;  1I3Q B;  2FMA A;  4X66 H;  1A3V A;  3QIA A;  2AMC B;  2Z6K C;  5IT9 c;  1DYQ A;  3PIP A;  2VW9 A;  1VQ4 A;  3T5K A;  3N52 A;  2F0V A;  2PQE A;  1EZ1 A;  1I94 H;  3OWF A;  4JV5 H;  3V4Z A;  3MWE A;  4UCO A;  4G7Z C;  1LM0 A;  3TZU A;  2OQ0 A;  2EY6 A;  3HXL A;  5LMU L;  5L1J A;  4DL5 A;  5C4X G;  1H9R A;  3SR1 A;  4LF8 L;  4UCR A;  4A3F H;  3DLL A;  4DV5 Q;  2EYM A;  4DV1 Q;  1F9R A;  4LAA A;  2WAQ G;  3OHX C;  1SAP A;  2AU0 A;  1IBL Q;  5C44 G;  3C0F B;  3M9M B;  4DAV A;  4JI8 Q;  3U9O A;  1HNW L;  4FM9 A;  5GON F;  3RB3 A;  4RKB A;  3NUC A;  2HT1 A;  2VZA A;  5JJI A;  4FU0 A;  4IPC A;  5F2D A;  5EJW A;  5D14 A;  1S5D D;  2R93 B;  4MA0 A;  1F2M A;  5COR A;  2OEO A;  4AYB B;  4CJ0 B;  3A56 A;  1Z47 A;  3ERS X;  3CCE A;  3GID A;  4UP7 A;  4A3J G;  2FLN A;  4XTC S;  5EKI A;  1PZI D;  4ABN A;  3PSI A;  2PNR C;  1IKL A;  2NVX A;  1GJX A;  1S97 A;  1R9T H;  5LMN W;  3DWP A;  4FNF A;  2FIN B;  4J9P A;  1UUP A;  1NMF A;  3MZ5 A;  5GQO A;  1T94 A;  2VA2 A;  1NY4 A;  1EWH A;  5E1F A;  1ESR A;  2R93 A;  1IBM Q;  5J39 A;  2RDF A;  2NVY B;  1HJP A;  4QWA A;  2J6U A;  4O3N A;  2L55 A;  2WTF A;  1KHI A;  1I6H B;  1VQF A;  4DL3 A;  1NAP A;  4RGO S;  3HOW H;  2DY7 A;  3K58 A;  3TQT A;  4X3U A;  2LXK A;  5T1I A;  1G2S A;  1R4P B;  2ZM6 Q;  1VQ6 A;  3SK6 A;  1Y14 B;  4X65 Q;  5KFL A;  2QEJ C;  3U4V A;  5F9L A;  3MFI A;  1HR0 W;  3EQL C;  2JA6 A;  1UE5 A;  3WOF A;  1XTD A;  4DV5 H;  4DV1 H;  1JJ2 A;  1EFW A;  4KKU A;  4A3F B;  1IBL H;  1WCM H;  4K2L A;  4IPH A;  2C2E A;  3UDF A;  4JI8 H;  3IN5 A;  1QVG A;  3CKI B;  1BBW A;  1VDZ A;  2BCO A;  2UUB L;  2V5A A;  1BVS A;  3SK8 A;  3K8A A;  5CA0 F;  1BO0 A;  2R92 G;  2YZM A;  1EIH A;  2MO1 A;  4OWT B;  2ZT9 C;  4HCE A;  1N36 L;  3QZ7 A;  5BN3 A;  4FXG C;  2WAQ E;  5CGK A;  4DV5 L;  4X3S A;  1AUX A;  3V96 A;  2PZT A;  4XZ3 B;  3QFF A;  1BCP D;  1E24 A;  5KG1 A;  1KC7 A;  3K5I A;  1XNQ Q;  4JI8 L;  1CKM A;  2C28 A;  4I50 F;  3KLW A;  3V4S A;  3RJ0 A;  5KFI A;  1F9P A;  2R8J A;  1PFS A;  1CQV A;  1U4R A;  2EJG C;  1SRO A;  1GUO A;  4H44 C;  5CAE B;  5KEE A;  4UHV A;  1GKH A;  3S24 A;  3NBI A;  1IBM H;  1F2Z A;  2CVR A;  3GTQ B;  1BXR A;  2VUG A;  2ASJ A;  2FMC A;  1TA8 A;  1Q1B A;  2ZXP A;  2B2T C;  1WR2 A;  4K6D A;  2X6L A;  4AQY Q;  1YHB A;  2TMP A;  1HH2 P;  1MGS A;  2XIW A;  5M3F G;  4G7O C;  5LYJ F;  3EVQ A;  4R4O A;  4DXF A;  4JYA Q;  4DAP A;  4BWS C;  1PH4 A;  3G7L A;  3HOW B;  1VQO A;  3RIZ A;  4X65 H;  1FJG Q;  4C3H H;  1R9T A;  1V4Y A;  3PR4 A;  2DLN A;  4ECW A;  4OIK A;  4PDB A;  2NWG A;  4ECX A;  5IWA Q;  3TP8 A;  4B3R Q;  4L5T A;  3J80 E;  3LNN A;  2VQE Q;  1C0A A;  1Y1V H;  4K0K H;  2V1C C;  3TDQ A;  2WDT A;  1ICF B;  4EQN A;  4DLK A;  1PVO A;  3OHA A;  3QOJ A;  1WCM B;  1DGS A;  3H0G G;  1N32 L;  4YCU A;  4DF7 A;  2N49 A;  1MJC A;  2F0G A;  4GN4 B;  1IYV A;  4YJ3 F;  4X6A H;  2OH2 A;  4KTA A;  3ETH A;  4APV A;  3PGZ A;  4DV6 Q;  4O2A F;  4QWD A;  2BQ3 A;  3VR2 A;  3RV4 A;  2ZXR A;  4X65 L;  4DR1 H;  4KI0 A;  2WB1 B;  1Y1W G;  2A19 A;  1RHP A;  3SDZ A;  4A3I B;  4DL4 A;  2JEI A;  4MTN A;  3G8C A;  3VYS A;  2C00 A;  1HNZ L;  1PXU A;  3GV6 A;  2YL2 A;  1KRT A;  3W5O A;  2RVL A;  5FLX L;  4K0K L;  1LYL A;  1WCM A;  3J7Y W;  2R7K A;  1DJR D;  1N33 L;  3CQZ B;  3BDC A;  3I72 A;  1Q82 C;  5IYD H;  3K0Y A;  2O03 A;  1KEE A;  1KAB A;  1CS0 A;  5FOB B;  4PQX A;  1HQR D;  1RJQ A;  2A6H D;  2AQ3 B;  2GVA A;  3BQ1 A;  5ELF A;  3KXY T;  3D6W A;  2F3I A;  3HZX A;  3S1N H;  4F4W A;  2UUC H;  1K83 H;  4DR1 L;  4K6L A;  3CCQ A;  5KFP A;  1MSG A;  4GN5 A;  3FVQ A;  3A7L A;  4EX5 A;  4AQY H;  3N6R A;  4UY8 C;  4A3B H;  3CQZ A;  4MZ9 A;  4RNO A;  4CKB A;  1B3Q A;  1I7N A;  2HJW A;  4JYA H;  1HTP A;  1HZC A;  3F2B A;  1KDB A;  3MXP A;  5IGG A;  4A3C H;  4U7C A;  3L9A X;  5JH7 F;  1EYZ A;  3CCM A;  2PW7 A;  1A8V A;  3C1F A;  3OSN A;  1JWU D;  3NTK A;  2MQH A;  1FJG H;  1X54 A;  2CKZ B;  2CW0 C;  4AYB G;  2F0I A;  3FRP B;  3OSP A;  1EU4 A;  3PW2 A;  2UUC L;  1VQG A;  5DGB A;  5IWA H;  4B3R H;  4C3H B;  5D1O B;  4G4K A;  4N9P A;  3S16 H;  2VQE H;  3I4L A;  4PMC A;  2NTS A;  1GM5 A;  5KFX A;  5CV5 A;  3UDI A;  2WV6 D;  5IOC A;  3S1R H;  1LO5 D;  2WKC A;  4ME3 A;  4GOP A;  1HNX L;  1ZXT A;  3DM3 A;  3M9O B;  4KMU C;  5FO9 B;  4KY5 A;  2W7P A;  4DKA C;  3HOY H;  3HOV G;  1GGO A;  2PMZ B;  1DOL A;  4FF2 A;  4J9N A;  3ERO A;  2FPI B;  3R5X A;  2L1B A;  1TS2 A;  1JXL A;  1HXY D;  3JAM W;  4C5A A;  1ROD A;  1BR9 A;  2CWP A;  3EBE A;  4J9O A;  1M1K C;  3ER0 A;  3HOU G;  4AIM A;  3RV3 A;  2HVQ A;  4TV8 F;  2VQF L;  2HIX A;  2NU7 B;  4QW8 A;  2K75 A;  1TII D;  3NEM A;  4RGT A;  5KKN B;  1HZA A;  1A15 A;  4N9T A;  4JV1 A;  1CQI B;  1AZP A;  1JC7 A;  1UE1 A;  2A5H A;  2RQX A;  3S1N B;  3HBL A;  3Q8P B;  1PK8 A;  3RN2 A;  4EYI B;  4ED0 A;  3M9B A;  2R7Z G;  3NQI A;  1BF4 A;  4RZR A;  4ECV A;  2PCF B;  2PI2 E;  2W57 A;  5KFA A;  1K3R A;  1B04 A;  3SGI A;  4A3B B;  3TIN A;  1CQJ B;  1SEB D;  3KYH C;  1LTB D;  1X56 A;  4OIJ A;  4HTH A;  5M3M H;  1QB5 D;  4DR5 H;  3J80 c;  2KEC A;  4JI6 L;  4ECY A;  4R8I A;  1QG7 A;  4ZYS A;  3P20 A;  2YV5 A;  4C2M H;  3SE7 A;  1K83 A;  4GN3 B;  2UUA L;  4HMJ A;  4ME5 A;  3S2D H;  5JAV A;  4WJ3 M;  4RB2 C;  3CCJ A;  4DV0 L;  3BG5 A;  4A3L H;  3CXC A;  4MV1 A;  5KFK A;  3S1R B;  4ZUJ A;  5KND A;  3AQQ A;  1AH9 A;  3G6X A;  2ALY B;  4JI1 Q;  2FK3 A;  4DR5 L;  4UCU A;  3T5H A;  2C9O A;  4FXK C;  3K7A B;  4NXM H;  2M2L A;  1SMX A;  1TS5 A;  3BS1 A;  4IUV A;  4ETS A;  3AU7 A;  4WBN F;  5JUM A;  2QIL A;  3CVZ A;  1PTO C;  2O4X A;  1K73 C;  4O3P A;  3MWY W;  4QUC A;  2JA9 A;  2F0T A;  4KKS A;  1K3B C;  2K5Q A;  1SNM A;  3PF4 A;  2LFN A;  4YBZ B;  3N43 B;  5J1Z A;  4C3I B;  3BU2 A;  4P75 A;  2FJZ A;  5IP9 H;  2I0Q A;  4G7H C;  1EIY B;  4JI5 L;  4EQ5 A;  1EIG A;  3GD7 A;  4NXM L;  2R61 A;  2NUA B;  3FKI H;  1PH1 A;  2LS0 1;  3ULL A;  1GVP A;  2OWO A;  1Z2P X;  3HEJ A;  3JSN A;  5L1K A;  2K1B A;  4Q8E A;  3MFG A;  1K28 A;  3BZC A;  4A3E H;  1NSN S;  2HCI A;  2WB1 G;  2E2D C;  4A3I G;  4QIW E;  4HQ6 A;  3TP6 A;  4JI4 Q;  5IYC G;  3VR5 A;  4IAJ A;  2Q2H A;  3BYT B;  4LW1 A;  5M3M B;  2CWA A;  2QYZ A;  3EPG A;  2HUG A;  3GP7 A;  2ENB A;  1N34 L;  1ML0 D;  3VPD A;  4RUA A;  1CHP D;  3MXG A;  4DR7 L;  1B6S A;  2XIG A;  2AUJ D;  1KDC A;  2AHO B;  3M3Y H;  2XVS A;  3IFD A;  2VR1 A;  4QWB A;  1EY9 A;  1VBG A;  1J9O A;  1SJH D;  2JP1 A;  4H13 C;  5BR8 L;  4JI1 H;  5LOV F;  2QCP X;  2JEB I;  1VQB A;  2R84 A;  4I7A A;  1B70 B;  2KHS A;  4P2C B;  4C2M A;  2ALZ A;  1HA6 A;  1QUQ B;  3URY A;  4LUZ A;  5KG7 A;  3G6V A;  5JVD F;  2K28 A;  5JPN C;  3JC6 6;  3X3M A;  3BJY A;  3KHR A;  2GLT A;  4KLK A;  2HGS A;  1E7Z A;  1C9O A;  3HKZ G;  1UEB A;  3KLR A;  4A3K H;  3BA8 A;  1CSQ A;  1V1Q A;  1GO3 E;  1LTL A;  3E5N A;  3CPF A;  5C3E B;  1VQI A;  4IUP A;  4FP5 D;  5I47 A;  1DXM A;  1QUQ A;  3R5H A;  1XXG A;  5IIF A;  2WE6 A;  1PRT B;  5HY6 A;  5DGA A;  3FKI B;  4A3G G;  3WDN A;  3F8N A;  1PTO F;  2DGY A;  3S9W A;  3AEV A;  5C4X H;  2GPS A;  4R4T A;  2DUD A;  4J9Q A;  4LFC H;  5CV6 A;  1KIX A;  4A3E B;  2XRS D;  4P74 A;  4LF4 L;  1TWC H;  2LKV A;  1STB A;  2EE1 A;  3E0J A;  3FPP A;  5IT9 W;  4L5R C;  3Q8Q B;  4NXN Q;  2WYO A;  2OTJ A;  3FKI A;  3IRB A;  1HQM C;  3F2U A;  4XXE A;  1H9S B;  1FGB D;  3BG3 A;  1IL8 A;  2IX1 A;  2RDG A;  2ZDH A;  3OHB A;  1E2W A;  3I8Z A;  3SE0 A;  2JEA I;  4B3T L;  3M3Y B;  1VQ5 A;  5I4D A;  4ZKB B;  3GV5 B;  1SFO B;  4DPG A;  4LFC L;  1EY7 A;  2AWO A;  3RNU A;  3A0J A;  2RDI A;  5EBC A;  2E75 C;  2ASL A;  1TKW B;  2GVB A;  2Y0S B;  2Q8I B;  5C0X J;  4E6I A;  1KRS A;  4Y8V B;  2JN4 A;  2C5C A;  2CW0 D;  3PUW A;  2W6N A;  5IOD A;  1T9H A;  4YWK A;  2NTT A;  2B63 B;  3GTO H;  1H9S A;  1SE3 A;  2FLP A;  4QMG A;  2EY2 A;  5L1L A;  1LTT D;  1QVC A;  4K5X A;  4DV3 Q;  5HBR B;  4DXG A;  3S2H H;  1K1Q A;  2F0Q A;  4H7B A;  4GNX A;  1PYS B;  1SNP A;  5FLX E;  3KAK A;  4JBJ A;  4A3K B;  1XJV A;  4G3I A;  3TP5 A;  3GIP A;  5KFO A;  4R9W A;  1EYG A;  4O4H F;  1EUJ A;  1F77 A;  2JA8 H;  1STY A;  2K5W A;  3SXH A;  3TN2 A;  4ED3 A;  3T53 B;  1I4Q A;  3U9S A;  4YR0 A;  2CH4 A;  3J7A 5;  1RL2 A;  4LFA L;  1IZ6 A;  2BDN A;  2WII B;  3GTG B;  3MHB A;  1ZHQ A;  2UU9 Q;  4BBS B;  2A6E C;  1CM9 A;  1Y8P B;  1SYE A;  2YTV A;  1OWT A;  3K81 C;  4YIJ A;  2JA5 H;  3CCV A;  4FBU A;  5LMN L;  2YYZ A;  4NXN H;  2W9C B;  4RFB A;  2W6O A;  4IZO A;  4NDX A;  4C3I G;  1Q3L A;  3MWM A;  1VAJ A;  1KAW A;  2D62 A;  2ID0 A;  4NB3 A;  2B8F A;  2CZG A;  3BQ0 A;  1LT3 D;  3C1E A;  4LF5 Q;  3OW7 A;  5FJ8 G;  1C30 A;  4M9U A;  5KG4 A;  1ENC A;  4GKK L;  4PZ6 A;  4ZI7 F;  4PV1 C;  1BNC A;  5FKA C;  3I4N B;  3CCR A;  4GC7 A;  3PUX A;  4J9L A;  4ZQ3 A;  3T16 A;  2Z1C A;  1TWC A;  1N9W A;  4EBC A;  4BBR G;  2A8V A;  4R8U B;  1B44 D;  1AUV A;  2EYF A;  2R86 A;  1EOT A;  5EOY A;  1GSA A;  4ECT A;  1SDF A;  3OSO A;  3WOE A;  2VL6 A;  4A3D H;  3DF7 A;  3B6Y A;  3D8G A;  1V8Q A;  1PH9 A;  1RJP A;  4DV3 H;  4PZ8 A;  1IW7 C;  1QZG A;  1QCB D;  1LTI D;  1VCI A;  1DV2 A;  3V6K A;  1PFB A;  3NK9 A;  3FPU B;  3VDY A;  3S2H B;  1JE5 A;  1STE A;  3H3V I;  2ICE C;  1JWS D;  2MJ8 A;  4MHE A;  4R8U A;  3FMA A;  1E2Z A;  3J81 j;  1IKM A;  5H1S E;  1OTC A;  5LMU Q;  3GTL B;  4CHT B;  4LF8 Q;  3ZYY X;  1WVL A;  1L0Y B;  2Q2U A;  1PTO D;  4K5V A;  1WTV A;  2UU9 H;  2KCN A;  2AQ2 B;  2OF1 A;  1B53 A;  1S9F A;  4H02 A;  5KFG A;  4C5C A;  3NEN A;  4NMZ A;  4BY1 H;  1HNW Q;  1XNR H;  4N8X 1;  1EY6 A;  2XRQ D;  4EYH B;  3RZD H;  4DUY Q;  2JA5 B;  4DK1 A;  2NB0 A;  1EFI D;  1C8C A;  4I7Z C;  2VNU D;  1U9R A;  5KYL A;  1B50 A;  1SYC A;  1H9J A;  4OEM B;  5M5Y H;  5C3E G;  4MV7 A;  4LFB H;  3NE5 B;  1STH A;  4EVO A;  3ULJ A;  4ED7 A;  2MUY A;  3G6E A;  1XNR L;  4MV3 A;  4B9W A;  2JA5 A;  2I5H A;  4OGQ C;  2JEG A;  4JI3 L;  4HED A;  1HFG A;  1YJ9 A;  4R8N A;  4YHH L;  5FLX c;  4QW9 A;  1SJE D;  2W71 A;  5C5L A;  3RB0 A;  1S3O A;  4HIO A;  1M4V A;  3PVX A;  3KLS A;  5ELO A;  4LFB L;  1W6K A;  3NXW A;  3OMC A;  3U58 A;  3OW2 A;  2J0T D;  1STA A;  1QVF A;  2R8H A;  4CGY B;  1S5B D;  3RBE A;  4YP3 A;  4DAM A;  1LTR D;  5A2Q L;  1PZJ D;  5FPO A;  5LMU H;  1TWH H;  4CKE A;  3Q24 A;  3WO1 A;  3V2T A;  3T56 B;  3S1Q H;  3KHH A;  2FK2 A;  5DQH A;  2Y0S G;  4OX9 H;  5EPJ A;  1O7L A;  2CH4 W;  2F0J A;  3VA7 A;  1HNW H;  2IHE A;  3PR5 B;  2B63 G;  2VPQ A;  3H91 A;  4WJ4 A;  1G51 A;  2CQO A;  2UUB Q;  3MR5 A;  2ASD A;  4DUY H;  2B2V A;  3PCO B;  1G2T A;  5D3D A;  1N36 Q;  4PZ7 A;  2R7N A;  3J81 W;  1V43 A;  3HOZ H;  1JOK A;  5EKK A;  4BY7 H;  2B2W A;  1AN8 A;  1M7J A;  4ZAI A;  2RHS B;  3K5O A;  3GTP H;  4OX9 L;  5M5Y B;  2F0E A;  3K3P A;  4EQO A;  5T14 A;  3RR5 A;  2IJ0 A;  3ULP A;  1Q8I A;  1XX8 A;  4DUY L;  2E2I H;  5C3W A;  3RUP A;  5IYB G;  2NVX B;  5LP6 F;  1WTP A;  3QJY A;  4BBS G;  2YTY A;  4RGN A;  3C3L A;  3OUU A;  5AJ3 L;  1ASY A;  1FYC A;  2XWJ B;  4DFA A;  5I9O A;  5K36 H;  3HKS A;  1XPU A;  1HCZ A;  1YHQ A;  5C5M A;  4RHS A;  1JDB B;  4RAY A;  2XGP A;  3BYY B;  4JOI C;  1L2Z A;  3X3N A;  2E2H H;  1NNX A;  1KC8 C;  5IP7 G;  5C0X H;  4A93 B;  2UVW A;  2E74 C;  1HRJ A;  5AFW A;  1W6J A;  4A4I A;  1AE2 A;  1NUC A;  2JA6 B;  3M4O H;  5GAD C;  3I4N G;  1UC8 A;  5EKL A;  1TWH B;  3T1H H;  5HUR A;  5KFU A;  4KKT A;  2O2L D;  1HTL D;  1PH3 A;  5EQ0 A;  1II3 A;  3R93 A;  1N32 Q;  2LMC B;  1AN7 A;  1EY0 A;  4RZQ A;  2UUB H;  2F1M A;  2E2J H;  3S14 H;  2B29 A;  5I2Y A;  4Z9C B;  1E4E A;  1B33 N;  2F0W A;  3KF8 B;  1N36 H;  2K4K A;  1ASZ A;  4BWG B;  4HR7 B;  2J6T A;  2K7V A;  2W9A A;  4KD4 A;  3OYY A;  1TWH A;  4V0B A;  5D3I B;  3Q2O A;  3W3A A;  3J80 W;  2F3V A;  4NW2 A;  1HNZ Q;  3EFX D;  5KFB A;  3T1H L;  4A3M H;  4BY7 B;  3MJF A;  3J7A V;  3K5N A;  4K0K Q;  3A54 A;  3MWD A;  3I7F A;  2V59 A;  2R8G A;  1N33 Q;  2HCC A;  4L1K A;  2NZ1 D;  4TVA B;  2A6E D;  5F9N A;  1BQQ T;  1EYC A;  3KF8 A;  3EA6 A;  3PIP 3;  4HR7 A;  2F03 A;  2L4N A;  2DZD A;  2R85 A;  2WP8 J;  2EIF A;  4J9K A;  4DR1 Q;  4WJW A;  4O42 A;  4BXX H;  3BAB A;  1EUD B;  5JEA G;  2QDB A;  3A8K E;  1RK5 A;  1JKJ B;  5FD5 A;  3TZD A;  4K8J A;  3L7Z C;  4ZQI A;  1NR2 A;  2RBM A;  3FMC A;  4QIW B;  1IOW A;  3K5H A;  2E76 C;  3MFH A;  4ME6 A;  1PRT C;  2R7F A;  2KCM A;  4NKL A;  4IOA A;  5EAY A;  3KJO A;  5DQI A;  4ZLT F;  4ZOL F;  4R4Q A;  4ZHQ F;  2E2I A;  4YB8 B;  1O75 A;  2XN9 C;  3V6J A;  2VUM H;  2BH2 A;  3VYU A;  1R9T B;  2UUC Q;  3PO2 G;  1X3E A;  4XYO A;  5CC4 A;  3SVM A;  1EUC B;  5D8D A;  3TS0 A;  2EYP A;  1H9M A;  4R4C A;  4CDE C;  1NBW A;  4IFD G;  1Q1E A;  5D1P A;  4EGJ A;  1MZB A;  1PLF A;  4QIW A;  4EBE A;  2CFM A;  5KFZ A;  1LTS D;  1HNX Q;  1N32 H;  1IW7 D;  1LAB A;  2XD4 A;  3RGX A;  1GSH A;  1M8A A;  1WTR A;  3WWV A;  1SBB B;  1CKO A;  4XQN A;  4DR2 L;  3C2P A;  3S14 B;  2E2J B;  3GQC A;  2ZDQ A;  4DV2 L;  1Z2O X;  3KBG A;  4K5W A;  1U5K A;  1HNZ H;  2EOT A;  4R1J A;  1G29 1;  4OL7 A;  1N33 H;  3L2P A;  1O78 A;  4IWX A;  2VQF Q;  5LA6 F;  1ICW A;  1TY0 A;  4Q0F A;  1X3Q A;  4R4I A;  1XPO A;  2RSN A;  3LWB A;  3WNZ A;  3T1Y H;  1LT4 D;  2A1A A;  4ULL A;  1YEZ A;  5LL6 S;  1YIT A;  2K5D A;  1A6X A;  2UVR A;  3KBX A;  2EZV A;  1LT5 D;  1V9P A;  3GIK A;  4IUN A;  5IGD A;  1SE8 A;  4O4L F;  2MNA A;  3H4D A;  4YY3 H;  1SMY C;  4LUO A;  4JI0 L;  1WTQ A;  3HOX H;  5IE8 A;  2NN6 H;  1E4G T;  1TXY A;  1TVX A;  2I5M X;  3I55 A;  1BCP B;  3GIM A;  4IJL A;  4M8A A;  4MA5 A;  4JI6 Q;  3RFC A;  1C4Q A;  5KGU A;  1O7Z A;  4UCV A;  1JWM D;  5ELB A;  3T1Y L;  5KT5 A;  5M5W H;  1LAC A;  3E0E A;  2UUA Q;  2VUM B;  3CC2 A;  5KFH A;  1VF5 C;  2ZTC A;  1SRU A;  4JPB W;  4QL5 A;  1WJJ A;  5EGT A;  2F0H A;  4DV0 Q;  3VPC A;  2O5J C;  1HNX H;  1CI3 M;  3T5L A;  4JBM A;  4GOP B;  3PO3 H;  4YY3 L;  1A3U A;  1RYS A;  1BXT A;  4O0A A;  3PW4 A;  1KNE A;  1TWG H;  1MJE A;  2R93 G;  1PRT F;  3TEH B;  4DR5 Q;  3E6Z X;  1W3S A;  4DV7 L;  3S15 H;  2VUM A;  1E3P A;  1C7Y A;  2ZJR A;  1RYR A;  3T5J A;  2C2R A;  2AKW B;  4QF4 A;  3RGZ A;  5I6Y A;  4A93 G;  1VQL A;  3A5Z B;  1Y1V B;  3CC7 A;  2R82 A;  4LF7 H;  4GKJ L;  4K8I A;  2VQF H;  5I9P A;  1U0L A;  2JA6 G;  1OO9 B;  5CBA E;  3OIP A;  2B2U A;  4BA2 I;  4TQR A;  4J0M A;  1KAA A;  4JI5 Q;  1Q81 C;  1VQA A;  1JE4 A;  4F87 A;  4MIU A;  4NXM Q;  4JBK A;  1U4M A;  1D5M C;  4ECQ A;  1B6R A;  1PH6 A;  1WOC A;  1A63 A;  5HV6 A;  1S03 G;  5KT6 A;  2YZN A;  4BA1 I;  1ENF A;  3RBD A;  3NWT A;  3OPO A;  1Y1V A;  3CU7 A;  4C3J H;  4DR3 L;  2DPJ A;  1TAE A;  1L1O C;  1S40 A;  4OO1 H;  4LF7 L;  2CCZ A;  2B2Y A;  1GUN A;  1FR3 A;  3UDX A;  3R23 A;  3HOX B;  3GV8 B;  4JI6 H;  1G6P A;  3EIV A;  3QOL A;  1EEI D;  4A3F G;  3OUZ A;  4MAM A;  5BN5 A;  1JOQ A;  2I46 A;  2HD3 A;  1ILQ A;  1K8M A;  3D4R A;  5COY A;  2ZJQ A;  1SXT A;  4FF4 A;  1N34 Q;  3H3V C;  1OXU A;  1K83 B;  5E3F A;  1N56 A;  3F2D A;  4DV0 H;  4DR7 Q;  3RLN A;  5A2Q E;  2H5X A;  3LWE A;  4YCW A;  4HYK A;  3NTI A;  4JW0 A;  1QWY A;  5JVL A;  5JEA J;  5BR8 Q;  1TS4 A;  3IL8 A;  1IHZ A;  4IUR A;  3CF5 A;  4L6T B;  2W8L A;  4PWQ A;  4HN7 A;  3GDE A;  1TWG B;  1V1P B;  4IPD A;  4ED1 A;  2VXW A;  1CA5 A;  4QWE A;  4ED2 A;  3TQ1 A;  4IUT A;  4YCV A;  3R3O A;  4GLA C;  2EJM A;  2NU8 B;  3FHW A;  3S16 B;  1SYF A;  2IT1 A;  4JI2 L;  2F3W A;  4J8Q A;  5C4H A;  4IOC A;  3S17 H;  2UXD L;  1SNC A;  4AYB E;  4DL2 A;  2X69 A;  4JC0 A;  1TWG A;  4GLX A;  1V1P A;  4JI5 H;  3HOY B;  2HDL A;  3CME A;  2EVB A;  4YJ2 F;  4RWS C;  2Q8R E;  3GTJ H;  2QF7 A;  1KD1 C;  2EYL A;  2B3G A;  2FMM A;  3A55 A;  2MHV A;  4QCL A;  1X3P A;  4B3S L;  3HOW G;  4ED8 A;  2L0C A;  4I55 F;  5IY0 A;  2DJG C;  2R3Z A;  1X55 A;  4MNO A;  4HJA A;  4QWC A;  1WTW A;  2ZJT A;  4C3J B;  4C5B A;  4DGZ A;  3PQI A;  3AFQ A;  1BBU A;  3J7Z C;  2YRX A;  2FLL A;  5NUC A;  4ECU A;  4CJ1 B;  1S72 A;  3MR6 A;  1L0X B;  4DL7 A;  4LF4 Q;  2TSS A;  2B2W C;  1B9N A;  2N55 A;  4IJH A;  4MV6 A;  1N34 H;  4EGV A;  1F9S A;  5BN4 A;  2RF4 A;  1WCM G;  4DNI A;  3UFX B;  1E4F T;  1QNK A;  3RUZ A;  4DR7 H;  3DHQ A;  5C3X A;  3JRW A;  3KTM A;  2ES2 A;  3KHG A;  5KNC A;  3STB C;  1S0O A;  4LH7 A;  2EPB A;  3ND8 A;  4B3T Q;  3HFZ B;  3R2I A;  1XTC D;  5BR8 H;  2AGO A;  4TSS A;  1PHJ A;  3AYH B;  4LFC Q;  1EZ6 A;  1I50 H;  3I4M H;  2DJF C;  1PRT D;  2JA7 H;  3NPP A;  4C2M B;  1JB7 A;  2NVT H;  2EYJ A;  3H09 A;  4FO2 A;  5CBE E;  3S2D B;  1HPC A;  4IHJ F;  4LF9 L;  4HNV A;  1NR4 A;  4HID A;  3K5M A;  4DUZ L;  1IBK L;  3K6O A;  2W6Z A;  2L11 A;  2IHF A;  2K33 A;  2R6G A;  3S17 B;  2ZJP A;  4OON A;  2PZU A;  1K8G A;  4CC5 A;  4UP8 A;  3Q22 A;  2HVS A;  3G6J B;  1RD9 D;  5I2X A;  5HGQ A;  5KFW A;  3M4P A;  1OXV A;  4B08 A;  1I6U A;  1MKH A;  3QG1 A;  2V4Q A;  1SE2 A;  5ELN A;  1SCU B;  2UXC H;  4LFA Q;  3SK5 A;  4KK7 A;  4C3H G;  1YNN C;  4H0L C;  3OIQ A;  5FLX W;  1A0I A;  1CQF A;  3FP9 A;  1VKZ A;  4LMQ D;  1Q8K A;  4LF4 H;  5LMN Q;  1A9X A;  1T3N A;  2Z9H A;  1YNJ C;  1G6Z A;  1V51 A;  3QWN A;  1PA6 A;  5BMV F;  1Y1V G;  1KXL A;  4ODG A;  1TWF H;  2VQD A;  4L8J A;  5GAG C;  4IUU A;  4UFZ A;  5D65 A;  4RB1 A;  1KJ8 A;  3ETJ A;  1FKA H;  2UXC L;  5DLF A;  2ZXO A;  4B3T H;  2J7Z A;  5KT2 A;  5K2M A;  4FBT A;  4GKK Q;  1EYA A;  5ELC A;  2FPG B;  1S5C D;  1SMY D;  3L4K A;  1FVI A;  1K8O A;  4WD3 A;  3Q8D A;  4PMB A;  5C44 H;  4DN4 M;  1I50 B;  5KFE A;  4YQW A;  4JUZ A;  2OQK A;  4DR6 L;  4JK1 C;  2F0K A;  1S0M A;  1SNO A;  4LSA A;  3ITP A;  5IYD G;  1DZ1 A;  2WB1 E;  3LGJ A;  1XPR A;  3H40 A;  3BAA A;  4UDU C;  3DM1 A;  3I91 A;  2NVT B;  4OXP A;  3VMM A;  1Y8N B;  1HFN A;  1P16 A;  1O7Y A;  2PZW A;  2KHI A;  2M9V A;  3D3R A;  2LY7 A;  4GNX B;  3I70 A;  5J2T F;  5EBD A;  1I50 A;  4HJ9 A;  3N8D A;  4A3J H;  3RF2 A;  1KL9 A;  2Z6B A;  5BPF A;  4RAZ A;  3GIQ A;  2JA7 A;  3KOJ A;  4A3B G;  1YJW A;  5M5X H;  3EN2 A;  1EQQ A;  3H20 A;  3H94 A;  4A3C G;  2CW7 A;  3H6M A;  2AQ1 B;  4LFA H;  4X62 H;  3CAM A;  1STN A;  4DAY A;  3TRZ A;  2VPS A;  1TS3 A;  4IR1 A;  5GRO A;  4YAJ B;  1SYG A;  4DNT B;  4B3M L;  4Q5V A;  5LMN H;  4RGM A;  3A8J E;  4JVZ A;  4WOR A;  4Y52 H;  2FPP B;  4LK1 C;  1X65 A;  2K03 A;  1GHJ A;  1GUW A;  2RSO A;  5C1P A;  3HKZ E; 
#chains in the Genus database with same CATH homology
 3PCO B;  2VQE Q;  1C0A A;  3HOY G;  1Y1V H;  4X62 L;  2V1C C;  4Y7N H;  3KF6 B;  2Z6K A;  1N36 Q;  4PZ7 A;  4A3M G;  4DR6 Q;  1PVO A;  5JJL A;  1V43 A;  4J15 A;  3HOZ H;  1DGS A;  1J5E L;  1OXT A;  3H0G G;  2N8N A;  4YCU A;  2N49 A;  1MJC A;  4GN4 B;  1N32 L;  4BY7 H;  1XNR Q;  4X6A H;  2RHS B;  3J80 i;  4APV A;  3PGZ A;  4DV6 Q;  3F2C A;  1EWI A;  3GTP H;  4OX9 L;  2D0O A;  2PMZ E;  4X65 L;  2E5L L;  1OXS C;  1X3F A;  4KI0 A;  1Y1W G;  2A19 A;  4JI3 Q;  4MTN A;  5C3E H;  3RR5 A;  3ULP A;  1NJI C;  2HHH L;  4L5Q A;  1CSP A;  2R92 H;  3JAM i;  4YHH Q;  1K8A C;  1HNZ L;  4BXX G;  3PUY A;  3KF6 A;  1KRT A;  4DUY L;  2BA1 A;  3W5O A;  2E2I H;  5IYB G;  4K0K L;  1LYL A;  4LFB Q;  2MO0 A;  1N33 L;  4BBS G;  1Q82 C;  2NZH A;  2YTY A;  5IYD H;  2QA4 A;  5AJ3 L;  1FL0 A;  4IPG A;  2GVA A;  1ASY A;  1YI2 A;  1XMQ L;  1HR0 L;  4OWW B;  2PQA A;  2F3I A;  2GN5 A;  3MXN B;  3S1N H;  4KHP L;  3HKS A;  4OWX B;  1K83 H;  1HZB A;  1RIP A;  4DR1 L;  1XPU A;  3CCQ A;  3GTK H;  4GN5 A;  1YHQ A;  4B3M Q;  3PUV A;  2VUM G;  2UXB L;  4JOI C;  3OTO L;  3D31 A;  4EX5 A;  3G4S A;  2E2H H;  4UY8 C;  2N3S A;  1KC8 C;  5IP7 G;  4A75 A;  4A3B H;  4DR4 Q;  5M3M G;  4MZ9 A;  3PO2 H;  1PH8 A;  1HZC A;  3F2B A;  4A3C H;  4GS3 A;  4A4I A;  1AE2 A;  3UE0 A;  4JOI A;  2ZTE A;  3M4O H;  3BZK A;  1FGU A;  5GAD C;  3CCM A;  3I4N G;  1A8V A;  5M3F H;  2D0P A;  2MQH A;  1X54 A;  4X62 Q;  2CKZ B;  4AYB G;  1SFO H;  1PH3 A;  2N78 A;  4GOP C;  3CMA A;  1VQG A;  3H15 A;  2UUC L;  4A3L G;  1J5E Q;  1N32 Q;  3D0F A;  1Q12 A;  3S14 H;  3A5U A;  2E2J H;  2B29 A;  3S16 H;  1GM5 A;  3UDI A;  3KF8 B;  3S1R H;  4HIK A;  4OX9 Q;  2K4K A;  4ME3 A;  4GOP A;  1ASZ A;  2B63 H;  1HNX L;  2E5L Q;  1YHA A;  3DM3 A;  1WI5 A;  3OYY A;  2VY3 A;  4DKA C;  3HOY H;  2HHH Q;  3HOV G;  2ZTD A;  1Q86 C;  4QGU A;  1X9N A;  3NBH B;  1HNZ Q;  3T1H L;  4A3M H;  2YU9 H;  4LWC A;  4IFD I;  2C35 B;  4K0K Q;  3H0G H;  3I7F A;  2XTI A;  1N33 Q;  4TVA B;  1IXR A;  1I3Q H;  3RLF A;  5FLM H;  2BA0 A;  2FXQ A;  2IX0 A;  2CWP A;  5AJ3 Q;  4JI1 L;  2IY5 B;  3EBE A;  3W1B A;  1EIF A;  4POF A;  5IP9 G;  1XMQ Q;  1Y1W H;  1M1K C;  1HR0 Q;  1MIU A;  2WP8 J;  3ER0 A;  4AIM A;  3HOU G;  3M7N A;  2EIF A;  1VQC A;  4IO9 A;  3STB D;  4DR1 Q;  4P72 A;  2VQF L;  4BXX H;  2HIX A;  2UXB Q;  5JEA G;  2K75 A;  3OTO Q;  3FKI G;  3GTG H;  3NEM A;  5IYB H;  3NEL A;  3HOX G;  1HZA A;  2PNH A;  3L7Z C;  4XIG S;  4BBS H;  2NN6 G;  1J6Q A;  2BH8 A;  1O7I A;  3RLO A;  4JCV E;  2QEX A;  4DAY B;  1UE1 A;  4X64 L;  2R7F A;  2KCM A;  3RN2 A;  4A3E G;  4IOA A;  3M9B A;  5EAY A;  3KJO A;  2KCT A;  1YIJ A;  2R7Z G;  4R4Q A;  2PI2 E;  3CCU A;  1XMO L;  2WFW A;  1K3R A;  2BH2 A;  2VUM H;  3SGI A;  5DLQ E;  2UUC Q;  3KYH C;  3PO2 G;  1X3E A;  1X56 A;  2LXJ A;  5IP7 H;  3PO3 G;  3TS0 A;  5M3M H;  4R4C A;  4IFD G;  1NBW A;  1VS0 A;  4YWL A;  3K80 C;  1Q1E A;  3CCL A;  3J80 c;  2HQL A;  1UWV A;  2CFM A;  4JI6 L;  3TS2 A;  1SR3 A;  4C2M H;  2YV5 A;  2RHQ B;  1HNX Q;  3I4N H;  4GN3 B;  2UUA L;  3M4Q A;  3S2D H;  4WJ3 M;  4JI7 L;  3CCJ A;  3JAM c;  4JI4 L;  4DR4 L;  4DV0 L;  2F4V L;  3T1H Q;  3WWV A;  4DR2 L;  1CKO A;  2ATW A;  4A3L H;  3CXC A;  3UDG A;  1L2F A;  1VQM A;  4DV2 L;  1E22 A;  3AQQ A;  1P8L A;  1U5K A;  1AH9 A;  2ALY B;  4JI1 Q;  4AH6 A;  1WFQ A;  4R1J A;  4DR5 L;  1G29 1;  3L2P A;  1SMX A;  3HOV H;  2NVY H;  4NPS A;  2VQF Q;  1K73 C;  2K5V A;  1I6H H;  2K14 A;  4R4I A;  4A3K G;  5FLM G;  1XPO A;  2JA9 A;  3PIO A;  4QY7 A;  1I5F A;  3PF4 A;  2PQA B;  2JK8 A;  1VQK A;  2A1A A;  2EQS A;  4LF6 L;  3GTL H;  3KFU A;  3BU2 A;  4P75 A;  4X64 Q;  4OO1 G;  1YEZ A;  1YIT A;  5IP9 H;  1B7Y B;  2E8G A;  1NE3 A;  2I0Q A;  3CC4 A;  4A76 A;  1VQN A;  1EIY B;  3HOU H;  1SN8 A;  4JI5 L;  1V9P A;  3CW2 C;  4EQ5 A;  4LUV A;  3AFP A;  3ZJY C;  3GD7 A;  4RG1 A;  1XMO Q;  1SE8 A;  4NXM L;  3H3V H;  2MNA A;  4LUO A;  4JI0 L;  1YBY A;  3FKI H;  1PH1 A;  3F1Z A;  3ULL A;  1JMC A;  3HOX H;  1GVP A;  5IE8 A;  5E7N A;  2OWO A;  3E9H A;  1TXY A;  3CD6 A;  2I5M X;  3I55 A;  1H95 A;  1EOV A;  4IJL A;  1PH5 A;  1TWA H;  1GD7 A;  4X66 L;  4JI6 Q;  3A74 A;  3CCS A;  3BZC A;  4A3E H;  1UE6 A;  2WB1 G;  3T1Y L;  4A3I G;  5M5W H;  3E0E A;  2UUA Q;  2R7Z H;  1M90 C;  3CC2 A;  4QIW E;  2XGT A;  3W1G A;  2ZTC A;  1SRU A;  4JI7 Q;  4QL5 A;  1WJJ A;  4JI4 Q;  5IYC G;  4DV0 Q;  2F4V Q;  2Q2H A;  4LW1 A;  4DR2 Q;  1I94 L;  2CWA A;  4JV5 L;  3K7U C;  4JBM A;  2PI2 A;  3G71 A;  4GLV B;  4PG3 A;  4DV2 Q;  4GOP B;  4YY3 L;  1N34 L;  3PO3 H;  2K5N A;  4O0A A;  1TWG H;  4UP9 A;  1X3G A;  1MJE A;  4DR7 L;  2R93 G;  2RCN A;  4UPA A;  1Q46 A;  3TEH B;  2AHO B;  4DR5 Q;  3M3Y H;  2KBN A;  4ALP A;  4NXN L;  1W3S A;  4DV7 L;  3S15 H;  1E3P A;  1C7Y A;  2ZJR A;  5BR8 L;  2UUB Q;  3KDF B;  2YTX A;  2JEB I;  2AKW B;  1VQB A;  4DK3 C;  1B70 B;  3K0X A;  4A93 G;  1VQL A;  2NZO A;  3A5Z B;  2VS1 A;  2K52 A;  3PUZ A;  3CC7 A;  1BKB A;  3GTQ H;  4GKJ L;  2Y0S E;  4LF6 Q;  4RMF A;  1QUQ B;  1U0L A;  4LUZ A;  1VQ9 A;  2JA6 G;  3RN5 A;  3ICE A;  4BA2 I;  4KHP Q;  4HJ5 A;  1E1O A;  4JI5 Q;  3JC6 6;  1Q81 C;  1VQA A;  2Z0S A;  1D8L A;  4O2D A;  4DV4 L;  4KLK A;  1N8R C;  1L1O B;  1E7Z A;  1C9O A;  4NXM Q;  4JBK A;  3HKZ G;  3KDF A;  5JJK A;  1UEB A;  4JI0 Q;  4A3K H;  1CSQ A;  1V1Q A;  1WOC A;  4P71 A;  1GO3 E;  1PH6 A;  1A63 A;  1LTL A;  1VQJ A;  2JA8 G;  3CPF A;  4BA1 I;  1VQI A;  4C3J H;  4QJF A;  4DR3 L;  4DV3 L;  1L1O C;  4X66 Q;  1S40 A;  2LSS A;  1A62 A;  1HZ9 A;  1QUQ A;  4LF7 L;  2CCZ A;  3T1Y Q;  1K0R A;  1JJG A;  4HIM A;  5HY6 A;  5C0X I;  1PYB A;  2K50 A;  3UDX A;  4FDB A;  4A3G G;  1G6P A;  1L1O A;  3EIV A;  2DGY A;  4A3F G;  1PH2 A;  1I94 Q;  2JA5 G;  4JV5 Q;  4HJ7 A;  1Q7Y C;  3AEV A;  2ZJQ A;  5C4X H;  2KHJ A;  1N34 Q;  4R4T A;  2DUD A;  4YY3 Q;  1OXU A;  1KIX A;  1PH7 A;  3F2D A;  4P74 A;  1CUK A;  4DR7 Q;  4LF4 L;  1TWC H;  1B8A A;  3F8T A;  2AWN A;  4P73 A;  1SLJ A;  3RLN A;  3I4M G;  2H5X A;  4A3I H;  1CKN B;  4JBW A;  4YCW A;  2L15 A;  1W2B A;  2QGQ A;  2UU9 L;  4DV7 Q;  4L5R C;  4NXN Q;  2JA7 G;  2OTJ A;  3RZO H;  3L0O A;  1NTG A;  5JEA J;  1YNX A;  5BR8 Q;  3IRB A;  5IYC H;  3CF5 A;  1AE3 A;  2NVX H;  2IX1 A;  4DV1 L;  3GDE A;  3CQZ H;  4IPD A;  2NVQ H;  2K5H A;  1IBL L;  2ASB A;  2JEA I;  1Z9F A;  4B3T L;  4GKJ Q;  1VQ5 A;  3KJP A;  4YCV A;  2R93 H;  4DPG A;  1YVC A;  2R7D A;  2AWO A;  4LFC L;  3RNU A;  3A0J A;  4GLA C;  5GAE C;  2GVB A;  1CKN A;  3FHW A;  4LF5 L;  4A3D G;  5C0X J;  2IT1 A;  4DV4 Q;  4JI2 L;  3I4O A;  1KRS A;  3MEF A;  4IOC A;  3S17 H;  2UXD L;  3PUW A;  5GAH C;  1T9H A;  4YWK A;  4AYB E;  3GTO H;  3PF5 A;  4JC0 A;  3U4Z A;  4GNX C;  4A93 H;  3E9I A;  4GLX A;  4LNQ A;  1QVC A;  3CME A;  4DR3 Q;  5J3B A;  4DV3 Q;  4HJ8 A;  2JA6 H;  3GTJ H;  3S2H H;  1KD1 C;  4LF7 Q;  4GNX A;  2B3G A;  1PYS B;  1YJN A;  2Q2T A;  4B3S L;  3HOW G;  4JBJ A;  5IY0 A;  1XJV A;  1X55 A;  4MNO A;  1WYD A;  4HJA A;  2JE6 I;  2MFI A;  1EYG A;  2AMC B;  1EUJ A;  2JA8 H;  2Z6K C;  5IT9 c;  3AFQ A;  1BBU A;  3J7Z C;  3PIP A;  2VW9 A;  1VQ4 A;  1IBM L;  4TQU S;  1S72 A;  1JJC B;  4BY1 G;  4LF4 Q;  3J7A 5;  1RL2 A;  4LFA L;  1IZ6 A;  4IJH A;  1LM0 A;  3PV0 A;  2UU9 Q;  3CP0 A;  2RF4 A;  1WCM G;  2OQ0 A;  2YTV A;  4DNI A;  4A3G H;  5LMU L;  3K81 C;  5C4X G;  4LF8 L;  2JA5 H;  3CCV A;  3DLL A;  4A3F H;  5LMN L;  4DV5 Q;  2ES2 A;  4QQB X;  2ZM6 L;  4DV1 Q;  1D7Q A;  2YYZ A;  3STB C;  2WAQ G;  1IBL Q;  5C44 G;  4B3T Q;  3HFZ B;  4JI8 Q;  4KHZ A;  1PHJ A;  3AYH B;  4LFC Q;  1HNW L;  1KAW A;  1I50 H;  2D62 A;  2ID0 A;  4NB3 A;  2OTL A;  3I4M H;  1OXX K;  4LF5 Q;  2JA7 H;  5FJ8 G;  4JI2 Q;  2HT1 A;  1VQH A;  2VZA A;  2UXD Q;  4GKK L;  4PZ6 A;  5JJI A;  3S1M H;  4IPC A;  4YWM A;  3BJU A;  1JB7 A;  3CCR A;  1VQ7 A;  2NVT H;  3PUX A;  2HIV A;  4LF9 L;  3CCE A;  1N9W A;  1Z47 A;  3ERS X;  4DUZ L;  4BBR G;  4HID A;  1IBK L;  4UP7 A;  2A8V A;  2IHF A;  4A3J G;  4POG A;  2R6G A;  3I56 A;  4XTC S;  5C4J H;  2ZJP A;  2VL6 A;  3PSI A;  4A3D H;  4OON A;  4B3S Q;  3B6Y A;  1PH9 A;  1K8G A;  4PZ8 A;  1R9T H;  4UP8 A;  5LMN W;  1VQP A;  1QZG A;  1NMF A;  4DK6 C;  1VCI A;  1KQS A;  5GQO A;  1XNQ L;  2OCE A;  5HGQ A;  1NY4 A;  1JT8 A;  2Q2I A;  3M4P A;  1OXV A;  1IBM Q;  3VDY A;  1JE5 A;  1HJP A;  1MKH A;  3J81 c;  1QZH A;  3H3V I;  3CPW A;  5ELN A;  1KHI A;  4LFA Q;  1K9M C;  1VQF A;  1UE7 A;  2NN6 I;  3J81 j;  1IL2 A;  3HOW H;  5H1S E;  1OTC A;  5LMU Q;  1A0I A;  3FP9 A;  4LF8 Q;  1Q8K A;  2LXK A;  5LMN Q;  2Q2U A;  1YZ6 A;  2ZM6 Q;  4AQY L;  1PA6 A;  1VQ6 A;  1Y1V G;  1Y14 B;  4X65 Q;  1KXL A;  1TWF H;  3U4V A;  2KEN A;  1HR0 W;  4H02 A;  4JYA L;  5GAG C;  3NEN A;  1UE5 A;  1VQE A;  4BY1 H;  1XTD A;  1HNW Q;  3HOZ G;  3K7A H;  1JJ2 A;  3RZD H;  1EFW A;  4DUY Q;  4BY7 G;  1IYJ B;  1WCM H;  1FJG L;  2UXC L;  4IPH A;  2EXD A;  2I5L X;  3UDF A;  4GKK Q;  2VNU D;  1QVG A;  3UE1 A;  1BBW A;  5IWA L;  3J81 i;  4B3R L;  1E1T A;  1FVI A;  2UUB L;  1BVS A;  2VQE L;  3K8A A;  5M5Y H;  5C3E G;  3Q8D A;  5C44 H;  2R92 G;  1VQD A;  1X6O A;  2MO1 A;  4OWT B;  4LF9 Q;  4C3I H;  4DUZ Q;  1N36 L;  2OQK A;  3TRE A;  3ULJ A;  1IBK Q;  4L5S A;  4DR6 L;  3G6E A;  2WAQ E;  1NMG A;  5IYD G;  1XNR L;  4DV5 L;  5FJ8 H;  4JG2 A;  3TQY A;  2WB1 E;  3LGJ A;  3I2Z A;  1XPR A;  2I5H A;  4DV6 L;  2JQO A;  1E24 A;  4OXP A;  1XNQ Q;  3U50 C;  4JI3 L;  1P16 A;  1CKM A;  4JI8 L;  2KHI A;  3KLW A;  5K36 G;  4GNX B;  1YJ9 A;  4YHH L;  1EQR A;  1PFS A;  5FLX c;  4BBR H;  4HJ9 A;  2F52 A;  1SRO A;  4A3J H;  1KL9 A;  1S3O A;  4HIO A;  4LFB L;  5ELO A;  1GKH A;  3KOJ A;  3GTM H;  5C0X G;  1YJW A;  3S24 A;  4A3B G;  3U58 A;  1LUZ A;  5M5X H;  3EN2 A;  3OW2 A;  1EQQ A;  1L0W A;  1PV4 A;  1QVF A;  4IFD J;  4A3C G;  3M85 A;  1Q1B A;  4OO1 I;  3CAM A;  4AQY Q;  1YHB A;  1HH2 P;  3GO5 A;  5M3F G;  4DAM A;  3TRZ A;  5GRO A;  4R4O A;  4JYA Q;  1TWH H;  4B3M L;  1PH4 A;  1VQ8 A;  4PMW A;  3S1Q H;  4Y52 H;  2Y0S G;  1VQO A;  1X65 A;  3G48 A;  1FJG Q;  4C3H H;  2UXC Q;  2JJQ A;  2IHE A;  2B63 G;  5IWA Q;  4B3R Q;  4WJ4 A;  1G51 A;  2CQO A;  3HKZ E;  4L5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...