4A3EG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 31
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3eG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3eG01
2V1CC 5GADC 3JAMc 3CD6A 1OTCA 4GNXC 1IZ6A 5LMUL 1NY4A 1VQBA 3PF5A 4P73A 1E7ZA 4LF7Q 5JJIA 2NVYH 1YHBA 4IPGA 4JI5L 1PA6A 4A3LG 3CQZH 3OTOL 4X64L 1Y1VG 3J80i 5C3EG 1VQ4A 3W5OA 1SLJA 4BBRH 3S1RH 4LF6L 2WB1E 3EBEA 4HIMA 1Q86C 1IBML 1EWIA 1IBKL 5M3FG 2NVXH 3PO2G 3S1MH 3HOYH 2UXDL 5GROA 4PZ7A 4DR5L 3HOZH 2L15A 1EQRA 3M7NA 1SRUA 1V9PA 2K75A 3J81j 1GM5A 1VQGA 4AQYQ 2EQSA 1L2FA 1BBWA 1Q7YC 1PH7A 3NENA 3PF4A 4RG1A 5IT9c 2KENA 1HNXL 1NE3A 4GN4B 2ASBA 2B29A 3G48A 1J5EL 1HZAA 1I5FA 3KF8B 2AWOA 1Q82C 4LF7L 4DR4L 4YCWA 2ALYB 1KD1C 3S1QH 3TQYA 5BR8L 3RR5A 1VQDA 1PHJA 1VQ8A 1E1TA 4TQUS 3GD7A 2UUCQ 4JI2L 3MXNB 5GAEC 1X9NA 3H15A 4PG3A 2VQFL 1Y1VH 3PIPA 4HIOA 1N34Q 4OWWB 1JT8A 3D0FA 3CC2A 3CPWA 1JB7A 1L0WA 1JE5A 2LXKA 2MO1A 5M3FH 2BH2A 3PO2H 1AE2A 4LF8Q 2Y0SE 3J7ZC 1SE8A 2OQKA 5M3MH 3J81c 1V43A 4IFDG 3W1BA 1HH2P 2ZTCA 4AH6A 2K5VA 4C2MH 2OTJA 2IT1A 4B3MQ 2F3IA 1KHIA 4QL5A 1QZHA 4DR2L 1D8LA 4JI0Q 2NVTH 4GLXA 4DV0Q 3MEFA 4YWKA 1XPOA 4R1JA 4EX5A 3PCOB 1OXXK 4L5SA 3DM3A 3KYHC 3I4NG 1SMXA 1HZBA 4JG2A 3WWVA 1N36L 3S16H 1IBLL 3U58A 2PI2A 1V1QA 2AHOB 2JEBI 4L5QA 4JI8L 4LF4Q 4A3GG 2N8NA 1AE3A 2CCZA 3EIVA 3J7A5 3M4PA 4LF5L 1GO3E 3ULPA 3I56A 3CXCA 4JI1Q 1OXTA 4DV5L 5IP9G 4B3RL 4IPHA 2YTVA 1E1OA 4DR7L 4X66L 3M9BA 3RZOH 4JYAL 1WCMG 2A1AA 2NZOA 5AJ3Q 4YHHL 2RCNA 1VS0A 3CAMA 4LFAL 1YHQA 4YY3Q 1VQNA 3PUZA 2IX1A 5IYCH 2E5LL 4GNXB 1PFSA 4DV6Q 1UEBA 2XGTA 4MZ9A 2IHEA 5JJLA 4DV7Q 1HZ9A 3OYYA 3PO3H 2QGQA 4P72A 1X3GA 2PI2E 3PIOA 4X65L 2HT1A 2OCEA 2JK8A 4BY7G 1GD7A 2F4VL 1QVGA 4C3HH 4DR1Q 5C0XJ 4NXMQ 1X3FA 2ZTDA 5GAHC 1HR0W 3FHWA 1PH9A 1HNZQ 4LF4L 1VQ6A 4BXXG 1C0AA 3AYHB 3AEVA 1IYJB 3I4NH 4IO9A 1O7IA 5LMNW 3RNUA 4R4CA 3T1YL 1Y1WH 2HIVA 3L0OA 4LNQA 4NPSA 2E2HH 1XMOQ 2VL6A 4A3GH 2IX0A 2Z6KC 1HR0L 2MFIA 3CC4A 4K0KQ 2KHIA 1M1KC 5IP9H 1LTLA 4B3SQ 1XMQQ 3G6EA 1WOCA 4IJLA 1PV4A 3A5ZB 3S2DH 4YY3L 4JV5L 1P16A 1HNWQ 4LW1A 1H95A 3UDFA 1TWCH 4B3TQ 2WP8J 4JOIC 3GTKH 1ASYA 1VQFA 2WAQG 4GLAC 4JI3L 4DV3Q 2OWOA 1FJGQ 2VUMG 2F52A 4DAYB 4P75A 4DK3C 2Q2TA 3STBC 1Y14B 1G51A 2QEXA 1K8AC 4NXML 3HFZB 3KOJA 4MNOA 2XTIA 4DV2L 4A3FH 4UP7A 4BY7H 1HNZL 4JOIA 1NTGA 2LSSA 1YJWA 1JJ2A 4A3DG 4IJHA 4R4IA 4PMWA 1OXSC 1N33Q 4BXXH 4IOAA 2D0PA 2A8VA 4GKKQ 4LF9L 1GKHA 4POGA 1E22A 1QVCA 2PQAB 1PH2A 1CKOA 3KDFA 2B63H 5JEAG 1CSPA 5IYDG 2JEAI 1JJGA 1XMQL 3STBD 4OWTB 5M3MG 4GN3B 3S15H 4GNXA 3TRZA 1HNWL 2VNUD 3HOVG 2NZHA 3M3YH 4LFBQ 1JJCB 2MO0A 3ER0A 3RN2A 3ICEA 2UUBL 5C44H 3CMAA 1SN8A 2YU9H 3UDXA 4GKJL 3G71A 1CKNA 4A75A 4DK6C 5C0XI 2YTYA 2YV5A 4FDBA 4L5TA 5IWAL 2UXCQ 1C7YA 1VQCA 2VUMH 5C4JH 1EFWA 5EAYA 5JJKA 1Q8KA 2ZM6Q 1J6QA 5ELOA 3U4ZA 4AYBG 2H5XA 3BJUA 1VQMA 2UXBL 3CC7A 3CP0A 2CWPA 1EOVA 3CCVA 4GKKL 1YHAA 2YTXA 4JI6Q 3FP9A 5DLQE 4NXNQ 4A3DH 3K7AH 4GOPC 1Z9FA 3ULLA 1FGUA 3K7UC 1QVFA 4PZ6A 3RLFA 1YZ6A 3A74A 1VQEA 1FVIA 1GVPA 3M4QA 3CCJA 1SROA 5IYDH 1VQHA 4LFBL 1PH5A 1Z47A 1NBWA 5IYCG 4AQYL 1X55A 3NELA 3JAMi 3F2BA 1LM0A 3HOVH 1WJJA 3HOUH 3CF5A 3T1HQ 1VQ7A 3PO3G 4BA2I 3NEMA 4DR6Q 2UXCL 3L7ZC 2R7DA 2GN5A 1VQ9A 1XNQQ 5HY6A 3K0XA 1SFOH 1MKHA 1YJ9A 1P8LA 4JBWA 4A3IH 1Q12A 2C35B 4GLVB 4RMFA 4HJ5A 4IFDI 2K5NA 4A3MG 2N49A 4OO1I 1Y1WG 2PQAA 3CCQA 1I94Q 2E2JH 3GO5A 2JA7G 1UWVA 4JI7Q 3TS2A 4NXNL 3F1ZA 2UXBQ 2UUCL 2N3SA 2NN6G 1X65A 4UPAA 1N34L 3LGJA 2HHHQ 3UDGA 1KRSA 4QJFA 1YJNA 2WFWA 2D62A 3PGZA 3CCRA 4LF8L 3KDFB 2PNHA 1PH8A 3KJOA 1NMFA 3S17H 1WYDA 4B3ML 2GVBA 1KC8C 4OONA 3CW2C 2KHJA 1K9MC 4JI0L 3HKSA 4DUZQ 1XNQL 4DV0L 4A3FG 1MIUA 1XPUA 4HJ8A 5FLMG 3ZJYC 1CKNB 4IPDA 3ULJA 2VQEQ 5JEAJ 1MJCA 2CQOA 1I94L 3CCMA 2ZJQA 5C4XG 1UE6A 4JI7L 1KAWA 4YCUA 1N32Q 3VDYA 4DV4Q 4P71A 3J81i 4A3MH 4KHPQ 4Y7NH 2B63G 1B8AA 4JI1L 1OXUA 1YITA 1A62A 1K3RA 2JA7H 2IY5B 3GTPH 4DAMA 3S1NH 3AFPA 4LFCQ 3E9HA 4O0AA 3G4SA 4JBMA 3HOWG 1YI2A 4OX9Q 3A0JA 4ME3A 2JA9A 2WB1G 1R9TH 5AJ3L 1EYGA 2DGYA 1TWAH 1IL2A 3CCEA 3IRBA 5C44G 5FJ8G 1E3PA 2AKWB 4DV6L 1A0IA 1TWGH 2HIXA 2BA0A 3PUXA 2Z6KA 3I2ZA 4DV1Q 5IYBG 3E9IA 2K4KA 2UU9Q 4A3BH 4DV7L 1CKMA 2FXQA 5LMUQ 3B6YA 1Q81C 1LYLA 1PH4A 4GOPB 1VQPA 4UP8A 1EIYB 3TREA 1N9WA 4HIDA 1VQAA 3OTOQ 4DR1L 1WFQA 5FLMH 4KI0A 4LF6Q 1X56A 2RF4A 1IBMQ 2I5LX 4HJ7A 2ZJPA 1IBKQ 2A19A 3KJPA 1VCIA 1MJEA 3BU2A 3I4MG 3PSIA 2KCTA 5C4XH 2RHSB 2MQHA 1K83H 2UXDQ 1XMOL 4IFDJ 4X6AH 4DR5Q 3CPFA 5M5XH 2KCMA 1K8GA 4H02A 3GTJH 3EN2A 1LUZA 1VQKA 4K0KL 1PH1A 2ZJRA 2E2IH 4B3SL 3HKZE 1A8VA 1TXYA 3HOWH 2Z0SA 2I5HA 4A4IA 4B3TL 1HJPA 4POFA 3PV0A 4C3JH 4DUYQ 3GTMH 3HOUG 1TWHH 1KRTA 4QQBX 4BA1I 2KBNA 2R92H 2R93H 2Y0SG 2YYZA 4DV3L 4AIMA 5FJ8H 1J5EQ 2UU9L 3AQQA 1FJGL 1VQLA 1EIFA 4O2DA 3PUVA 1Q1EA 4DPGA 1Q1BA 3TS0A 2Q2HA 1T9HA 3AFQA 5E7NA 4DR4Q 4A3IG 3CCSA 4A93H 5IYBH 4HJAA 4IOCA 3I4OA 1EUJA 1UE5A 3S2HH 5K36G 5BR8Q 2R7ZH 1I3QH 4X62Q 3W1GA 3S14H 3S24A 4JI2Q 5IE8A 1I50H 5C0XG 2VQFQ 2EIFA 3UDIA 1N33L 4JCVE 3CCUA 2R93G 1UE7A 1YNXA 3I4MH 4WJ3M 1QUQA 2HQLA 2N78A 2Q2IA 2WAQE 4QGUA 1EQQA 3I55A 1I6HH 1AH9A 1G6PA 3KF6B 3H3VH 4A3JG 2DUDA 2UUAQ 1PVOA 2ATWA 3U4VA 3DLLA 1YIJA 3K81C 4HIKA 4DR2Q 4DUYL 4HJ9A 3OW2A 4OWXB 5H1SE 5J3BA 1TWFH 3D31A 3M85A 4QIWE 1L1OC 1RIPA 3M4OH 5GQOA 4NB3A 4GOPA 5GAGC 4A3EG 3NBHB 3E0EA 4YCVA 4BY1H 4LWCA 5ELNA 4R4TA 1N36Q 5IP7H 1IBLQ 2MNAA 4A3KG 4JI8Q 3F2CA 4QY7A 3F8TA 1G291 3GTLH 3PUWA 4X62L 2ZM6L 2JA8G 1XJVA 4LF5Q 4OXPA 3RLNA 1UE1A 1XPRA 4A3LH 4DV5Q 1L1OA 5C3EH 2R6GA 4B3RQ 2I0QA 2OQ0A 1VQIA 5IY0A 2K50A 3PUYA 1B7YB 4X66Q 1X6OA 2ES2A 4JI6L 4DR7Q 2GVAA 1W3SA 4JC0A 4JYAQ 2K14A 1XNRQ 4IPCA 4YHHQ 1X3EA 4JBKA 3GTQH 1HZCA 4LFAQ 4EQ5A 2UUAL 2JA6G 1S3OA 4LUZA 4OO1G 2E5LQ 2JJQA 2BH8A 3BZKA 1YBYA 1M90C 4MTNA 2I5MX 4A3JH 5HGQA 3Q8DA 1NMGA 4AYBE 1KIXA 4X65Q 4A3BG 2NN6I 3L2PA 2F4VQ 1YVCA 3T1HL 1KXLA 4Y52H 4BBSG 1Q46A 2JA5G 4DR6L 3BZCA 2QA4A 4R4OA 5M5WH 4KLKA 2VS1A 4A3EH 3CCLA 2EXDA 1BBUA 2IHFA 1VQOA 1PH6A 2AMCB 3T1YQ 5M5YH 4A3KH 4JBJA 1VQJA 3GTGH 4DR3Q 4J15A 1HR0Q 2D0OA 2JA8H 4KHZA 4YWLA 1YEZA 2B3GA 2Q2UA 1K0RA 1PH3A 2VW9A 1E24A 1NJIC 5LMNQ 3KF6A 4JI4Q 2CKZB 1S72A 3GDEA 1ASZA 1VQ5A 1XNRL 1SR3A 3TEHB 4JV5Q 1CUKA 2HHHL 1XTDA 3J80c 3ERSX 3H0GG 2CFMA 4TVAB 3FKIG 4JI3Q 4A76A 1QUQB 4DNIA 3JC66 4LUOA 4XIGS 3HOXG 3CMEA 1BVSA 5FLXc 3RN5A 2R92G 3F2DA 2VZAA 3HKZG 1QZGA 3GTOH 1C9OA 3UE0A 4WJ4A 4A3CG 4YWMA 4APVA 4XTCS 1D7QA 4DV2Q 2OTLA 4DKAC 4A93G 4DUZL 4ALPA 1KQSA 1FL0A 2R7ZG 4BBSH 4GN5A 2JA5H 4BBRG 1KL9A 2VQEL 1N8RC 4JI5Q 3RLOA 4DR3L 2NVQH 4X64Q 4LF9Q 2JA6H 3I7FA 1BKBA 4L5RC 3HOYG 2JE6I 4UY8C 3HOZG 2E8GA 2ID0A 4DV4L 4JI4L 1N32L 5LMNL 1JMCA 2K52A 1WI5A 2K5HA 2VY3A 3KLWA 4KHPL 2JQOA 2LXJA 1L1OB 2ZTEA 4LFCL 1OXVA 1WCMH 4OX9L 1U0LA 2AWNA 3K80C 2CWAA 1IXRA 3SGIA 2UUBQ 2RHQB 4GKJQ 4PZ8A 4C3IH 1PYSB 1CSQA 1B70B 1U5KA 1PYBA 3K8AA 3H0GH 5IWAQ 1RL2A 1HNXQ 3U50C 3FKIH 1X54A 3UE1A 4BY1G 1A63A 3HOXH 1W2BA 3H3VI 4GS3A 3KFUA 4P74A 4LUVA 4R4QA 1S40A 1DGSA 2BA1A 4UP9A 2PMZE 5IP7G 4DV1L 1K73C 2R7FA 4A3CH 3A5UA 3RZDH
chains in the Genus database with same CATH superfamily
5GADC 4IUUA 1OTCA 2FPPB 1D5ZC 1PZJD 3DM1A 1YHBA 2W71A 4IUPA 4A3LG 4J9LA 4B3RH 4X64L 5C3EG 2NYZD 3PW7A 1DCZA 3S1RH 1STBA 4LF6L 4JYAH 1Q86C 3ND8A 2NVXH 1EWIA 5M3FG 3PO2G 3HBLA 1BGWA 3RGZA 4KD4A 4YAJB 3NHHA 5KFCA 4ECVA 3K5MA 5KX5F 5IOCA 5KT2A 2K75A 1CI3M 3SDZA 2ICEC 4AQYQ 5KRUA 1DZ1A 1TWAB 3D3RA 1WR2A 1IW7C 2D5DA 1G2TA 3UFXB 1UC8A 4TQSA 2XCPA 5KG2A 2H4OA 3PMFA 4O4IF 3FMCA 1Q82C 4LF7L 3MFHA 1EUCB 4YCWA 1EY5A 2K5DA 3S1QH 2FLLA 2HGSA 1HR0H 1PHJA 3MR5A 1G8ZD 5LMNH 3GD7A 5CV8A 3TBIB 4RAZA 3RUPA 4PG3A 5C4XB 1N34Q 2HCIA 3Q8RB 1VBGA 5M5XB 2D9UA 2LXKA 1KLGD 5A2QE 1CE8A 1SE8A 1HFNA 2AGPA 1V43A 3PZPA 3BAAA 4UAIA 1HH2P 2K5VA 2OTJA 2IT1A 3E3XA 2IMWP 4C3JB 1TWHB 2R93B 4JI0Q 1PMRA 4IRDA 4HSVA 3MEFA 5IODA 4R1JA 3PCOB 3KYHC 4HNTA 3I4NG 1SMXA 3R23A 4JI5H 2FFKB 2ZXOA 3U58A 2VPSA 2PI2A 3CRKC 2BOSA 4PWQA 4LF9H 4H7BA 4MAMA 3J7A5 3M4PA 4LF5L 4HNVA 1I50B 3ULPA 4H44C 4TV9F 4CDDC 2W7OA 2ZDGA 3URYA 1O78A 2A6ED 3E6ZX 1EIHA 4ECRA 3BG5A 1WVLA 3M9BA 3RZOH 2UUBH 1VKZA 1WCMG 2A1AA 2NZOA 1W96A 4RGOS 4LFAL 1YHQA 1X3QA 4YY3Q 3PUZA 1HCZA 4J9NA 1HNXH 1STYA 2IX1A 2CW8A 3IG0A 5KFEA 3GV6A 1GJXA 4ED1A 2AGOA 4IFDH 3DUZA 2XGTA 5JJLA 2K5QA 2IWHA 2WIIB 2PI2E 3GQBA 2J7ZA 3KF8A 4IURA 2OCEA 2JK8A 2A6HC 3K5LA 4Z9CB 4FF2A 2F4VL 4DR1Q 1X3FA 2F0MA 2ZTDA 3VYRA 4DL4A 3DWPA 5GAHC 1VQ6A 1HNZQ 5KFRA 1DOLA 3MXNA 1T3NA 4LNQA 4Q45A 2KECA 3J7AV 5F9NA 5I6YA 1STHA 3GTJA 4RUCA 2GPSA 4H13C 4K0KQ 2OF1A 3BVGA 1LTLA 4B3SQ 4AQYH 4DA2A 1XMQQ 3GTQB 3G6EA 5D1PA 4IJLA 2EDGA 2M2LA 3A5ZB 4RB2C 3GTMA 2NBFA 2R8JA 3LP8A 4KV6A 1B33N 2HDMA 2WP8J 1T36A 3BA9A 2K04A 3GTKH 1ASYA 4K5XA 3DEOA 4JI3L 2OEOA 4DV3Q 4X3TA 2OWOA 4RB0A 1KC7A 4J9KA 4DAYB 4ABNA 4P75A 4DK3C 5FOBB 2F0EA 3TSSA 1G51A 5CV5A 1K8AC 3HFZB 4MNOA 2XTIA 4UP7A 4A3EB 5FKAC 3CVZA 5KFZA 3G7LA 5D1OA 5C5JA 2WTFA 4JV2A 1YJWA 4A3KB 2QF7A 2DN8A 3J7YW 1N34H 4PMWA 4HMJA 4IOAA 1BOSA 3N42B 2D0PA 4LH7A 2A8VA 1D1IA 3I90A 1QVCA 2PQAB 1U4PA 2L0CA 5D65A 5IYZF 1EZ1A 2OXPA 3A54A 4GN3B 4ZKCB 3TRZA 1DV1A 3FRPB 1HNWL 2ASLA 3L3OC 2HD3A 2O2LD 3EFXD 3GIMA 3VYSA 4JI0H 3RN2A 2JA6B 3CMAA 2YU9H 1D6EC 3NTIA 2DNEA 3RTXA 3G71A 1LABA 2DJGC 4IZ8A 4XXEA 4RAYA 4FDBA 4K2LA 5IWAL 1SNQA 2DJFC 2FE3A 1EFWA 1SE2A 3VR5A 5FLXW 2ZM6Q 2QEJC 3U4ZA 4AYBG 5CYUA 1DYQA 3CC7A 3GILA 5F9LA 3AB9A 2FPIB 5I6WA 4NXNQ 4O4LF 4A3DH 3K7AH 2F0PA 4G7OC 1GUGA 1Z9FA 5ELFA 2Z4HA 2C2RA 2CW7A 1CQJB 3RLFA 3A8IE 1FNVA 3HG9A 1VQEA 2A69C 1FVIA 4F7XA 5LXTF 4YY3H 1SROA 5IYDH 1VQHA 1PH5A 3K0YA 4U7CA 5KG3A 3F2BA 1NUCA 1PRTC 3PO3G 3T1HQ 4RHSA 4DR1H 3HOXB 1DONA 2UXCL 3L7ZC 3H4DA 2GN5A 1VQ9A 3C46A 1HNZH 1SFOH 1MKHA 5E1FA 1P8LA 2XSCA 2XWBB 4ED2A 1N56A 2K03A 4GLVB 1PLFA 3A56A 2NVYB 2N49A 4OO1I 3HGBA 4J9OA 1SDFA 1AZPA 3CCQA 1LT5D 1L0XB 2W6PA 3P75A 4K0KH 1ML0D 3BDOA 2LFNA 2UUCL 4B3SH 2N3SA 1XMQH 3GLKA 2L1BA 1XTCD 3JRXA 4KKSA 4EG0A 2VQDA 1NNXA 3PW0A 1HHVA 4ZQIA 2B2VA 1ULZA 1I6HB 4DV3H 5NUCA 4KK7A 3QG1A 2OLSA 1NMFA 2LMCB 5KFLA 2B2TC 3TZDA 1K9MC 3HKSA 2FLPA 2W57A 2B2UC 5IT9W 4HJ8A 5FLMG 1EU3A 1IHZA 4DK0A 1CKNB 4IPDA 3ULJA 1B04A 3F2UA 1MJCA 1CQVA 2BDNA 3CCMA 1ET6A 1KAWA 4YCUA 1N32Q 3VDYA 1KEEA 3RUZA 4O4HF 3PIP3 2B2UA 2NTSA 4KHPQ 1B8AA 2JEIA 5L1LA 1A62A 1JDEA 1WCMA 1YI2A 4OL7A 1MHWC 3BVMA 4ZUJA 2WB1G 1VF5C 3FMAA 1TWAH 1IL2A 3NBHA 3IRBA 4MV6A 1AP0A 5L1IA 2VA2A 2V5AA 1BBXC 2AGQA 1WD0A 3HKZA 2BA0A 5G3LF 4KY6A 5DG9A 3E9IA 2K4KA 2UU9Q 2ZM6H 4DV7L 5KFTA 5KT7A 2FXQA 5LMUQ 2JYOA 3B6YA 1PH4A 5JH7F 3CQZA 4LSAA 3OTOQ 1E4EA 4ED3A 1WFQA 4KI0A 1OO9B 1SNOA 4ZOLF 4EVOA 1YNND 1S10A 3QO2A 5CB4F 1MZBA 5BPFA 2KCTA 5KYIA 4ECXA 3C1FA 5C4XH 2RHSB 1KJQA 5KFSA 4IR1A 2EYFA 4H0LC 1XMOL 3Q23A 4DR5Q 5M5XH 1ESRA 1ILQA 5KFHA 2FB9A 1LUZA 1LTID 1VMPA 4O42A 5IGDA 1RF2D 2I80A 2ZJRA 3HKZE 1A8VA 5KFMA 2R87A 2Z0SA 3T1HH 5DQHA 2GA4B 3MWEA 2NUAB 4C3JH 3NPPA 1LTRD 4XQJA 4DUYQ 2V59A 1TWHH 4QQBX 2R93H 4BA1I 3JSLA 2Y0SG 5IGCA 3PIO3 5FJ8H 1J5EQ 1FJGL 2I87A 2PZUA 1EIFA 3T5JA 2Q2HA 1T9HA 5E7NA 1ZHSA 3N41B 4A93H 5IYBH 2SDFA 4HJAA 3I4OA 2F03A 3RF2A 4K6DA 5BR8Q 2M05A 1SE4A 1CQIB 3S24A 2F0QA 1I50H 1PYWD 3Q2OA 5KFXA 1I4RA 2E2HB 1TT2A 4A3GB 4JCVE 1B9NA 1UE7A 1KNEA 4HTHA 2N78A 3GV3A 3I55A 3KF6B 3H3VH 4A3JG 1QJOA 1PVOA 1XXGA 2FK1A 2KHSA 4A3CH 1AFPA 2W6ZA 2XCLA 3OW2A 4OWXB 3OHAA 3NGDA 3D31A 4GOPA 1MBYA 2L4NA 4JV0A 1K8OA 1HFGA 3EVQA 5ELNA 4AYBA 2HCCA 4JI8Q 3F2CA 5DM73 1F9SA 1BCPD 1STGA 1N32H 3PUWA 4C1NI 1JXLA 3KHGA 4E4TA 4KHPH 2A5HA 3EPIA 2R6GA 1B53A 1A2UA 2I0QA 4MN3A 3NWTA 2K50A 2PW5A 4DXGA 3E5SA 4DR7Q 4R8UB 4JI6L 2F0NA 4J9PA 4K6LA 1I7NA 1PTOD 1Y8OB 1NAPA 4J9MA 4ODGA 3GTQH 1HZCA 4EQ5A 2E76C 1V1PA 3S15B 5JQWA 4LUZA 2DIKA 1RK6A 2E5LQ 2JJQA 1M90C 1E2ZA 5JPNC 3M3YB 4MTNA 4ZCKA 3R5FA 1H9SB 5C44B 1FKAH 1A15A 2YYAA 3LWBA 4F50A 2UU9H 2R8KA 1FNUA 4AYBE 4A3BG 2NN6I 5LMUH 3G6XA 1KXLA 4BBSG 5C5LA 1DJRD 2JA5G 3OTOH 2W6MA 1QWYA 4KLKA 1JICA 2G9DA 4A3EH 3U9SA 3G6VA 4R8NA 2NU6B 5ELEA 4A3KH 1Z2NX 2E74C 3I4LA 2XGQA 2W9CA 4QIWB 4DR5H 2B3GA 1EIGA 4CDFC 2Q2UA 1R9TA 1K0RA 4JI4Q 1E24A 2UXBL 1ASZA 1VQ5A 4CDCC 1EL0A 4JV5Q 2HHHL 2ASJA 1K8MA 4DUYH 3ERSX 1GHKA 4IUQA 4HR7A 2EZVA 4C5CA 4TVAB 3FKIG 3VA5A 2KUMA 2JA6H 3CRLC 2F3VA 4OO1H 1J5EH 1EY9A 1BVSA 1EYCA 4LMQD 5FLXc 2R92G 2VZAA 4WJ4A 4A3CG 3Q24A 3RMHA 3SK5A 4DV2Q 2RSOA 2OTLA 2CZGA 5BR8H 2F0WA 4DUZL 1LTGD 3N6XA 4ALPA 3GV5B 1FL0A 3T5HA 4A3IB 4ZKBB 4RKLA 1K83A 2VQEL 2PMZA 2NVQH 4KHVA 4UY8C 2E2IA 5LMNL 2K5HA 2VY3A 5CV7A 2PPBC 3JSNA 3KAKA 2JQOA 2LXJA 1N48A 1GUSA 2WB1A 3N44B 5KG6A 1S5BD 2RGVA 3MXUA 5E4WC 1OXVA 1SNCA 4XDXA 1WTOA 1G2SA 4UCUA 2R6FA 1U0LA 4ETSA 1IXRA 2HVSA 2RHQB 4GKJQ 4IUNA 1B70B 1PYBA 3TP8A 1WTVA 4KJOA 3HOXH 5KKNB 1QCBD 4JI8H 3MFYA 3KFUA 2L11A 2PMZE 5JJKA 5KG0A 2HVQA 3QIAA 3GIQA 1H9KA 3CD6A 2RDIA 3OSPA 5CA0F 5KFFA 4GNXC 3PF5A 1VQBA 4P73A 1E7ZA 1II3A 2NVYH 4JI5L 5KG1A 2RDFA 4DR7H 2K32A 1SLJA 2WB1E 3EBEA 1B9MA 3K58A 1IBML 3OWEB 2O03A 3SK4A 4Y7NB 2B2WC 3D4DA 2JA7B 4O2AF 3GTPB 2UXDL 2E5LH 5GROA 1CHQD 1V9PA 1ENFA 4V0BA 3OHXC 1EWCA 3SE0A 1L2FA 2YL2A 3PF4A 3NENA 2B39A 4RG1A 5IT9c 2W8KA 2MHVA 2Y0SA 1HNXL 2B2WA 1KBLA 3R5XA 3WO1A 2AQ3B 3GTLA 3TQ1A 2B29A 3G48A 1DD2A 1HZAA 4MV1A 1I5FA 3KF8B 5EKLA 4EBEA 2ALYB 3EROA 4J9SA 3TQYA 3VYTA 4F4ZA 5KNBA 1RTOA 4M1UB 4WBNF 1VQ8A 1IW7D 4JI4H 2YCHA 2EYHA 4QUFA 3MXNB 1X9NA 3MZ5A 1HTLD 3PIPA 4HIOA 4JV5H 2KCCA 3CC2A 2VUGA 1L0WA 4EGVA 1JE5A 1SNPA 3GTJB 5EGTA 2BH2A 2Y0SE 3GIJA 3J7ZC 4UHVA 1RDPD 4IFDG 1EYDA 3W1BA 3D6CA 1KJ9A 4AH6A 3OOCA 1CK1A 4B3MQ 3GTMB 1RJQA 3K3PA 2FPGB 2R7MA 4DR2L 4DV2H 4EEYA 2YRXA 1LT6D 5LL6b 4DV0Q 3L4KA 1OXXK 3I70A 2X69A 2KEEA 3MEHA 4JG2A 1N36L 4YBZB 3V6JA 1I3QB 5TSSA 2N8NA 1AE3A 3S14B 3I12A 4I4TF 3FPUB 5D1OB 4UCSA 2UVRA 4DV5L 1OXTA 5C1OA 2NU7B 3PN1A 1WTPA 1KNAA 5IGEA 1SJED 1PTOH 4X66L 2V4DA 2XWJB 4GKJH 1KDAA 3GTOA 2CVRA 3P1HA 4YHHL 2RCNA 1HUMA 1VQNA 1Y8PB 3VPDA 2YW2A 2J0TD 2WKDA 1SMYC 5IYCH 1T94A 1JE4A 4DV6Q 1KAAA 3PW4A 5KEEA 4LK1C 4PMCA 3ONAB 1TWFB 3HP3A 1I7LA 2JA5A 1X3GA 4O3NA 3PIOA 4X65L 5C0XJ 4NXMQ 1E4GT 2MJ8A 1HR0W 1PH9A 1SFOB 4KJNA 4K2KA 3AEVA 5EPKA 2O4XA 5KFOA 2IW3A 5LMNW 3RNUA 3T1YL 5C3EB 3HEJA 4NPSA 3H6MA 2E2HH 4A3GH 2Z6KC 2H1EA 1NR4A 2MFIA 4OIKA 2NN6H 3TN2A 2DPIA 3BQ0A 1M1KC 2W9BB 2A6HD 5IP9H 1TAEA 4I55F 3M4YA 1PV4A 4RH6A 2DPJA 1AN8A 4YY3L 1BNZA 5EZYF 1H95A 4B3TQ 4JK1C 2R92A 1LTAD 5JOBA 4JOIC 4BS9A 4J6HA 1H9JA 3E0JA 1Y8NB 4ID6A 4O3QA 5I9OA 5EPLA 4U6PA 1D1KA 1U4MA 4FP5D 3STBC 5M5WB 1XDNA 3Q8SB 4F4YA 2QYZA 1HNZL 2NVXA 4TUYF 2K33A 1S5DD 2QDBA 4JOIA 4RGTA 2EPBA 2MUYA 4O1NA 1LTBD 4A3DG 4IJHA 1UAPA 4J9RA 1OXSC 4BXXH 5FK9C 1LTSD 2JA8B 1LT4D 4GKKQ 4ME6A 4POGA 1IKLA 5IGFA 4XX0B 1CKOA 5JEAG 2JEAI 5IYDG 2HJWA 4YJ2F 1JJGA 5DLFA 1XMQL 3BA8A 5EWGA 4OWTB 5M3MG 3S15H 2R86A 1DXMA 4B3MH 3NXWA 3OW7A 3QR8A 3M3YH 4X3KA 1JJCB 3ER0A 3KXYT 2KCNA 3ICEA 3N8DA 5C44H 4DV0H 5I2YA 4J8QA 3Q0AA 1ZYRD 4DK6C 3HB9A 3A7AB 4L5TA 3RD4A 3K5HA 4KD3A 1ICWA 4A2AA 5JVLA 1VQCA 2ZJTA 5KFYA 3RB6A 4EQOA 4C5AA 5BN4A 2VA3A 4YQWA 3H91A 1VQMA 2VPQA 5ELDA 1AZQA 5DGAA 4PMBA 4BWGB 1FGBD 5FLXL 3HRZC 2AQ4A 5DLQE 4QB4A 1UNNC 1FGUA 1PZKD 4IALA 4QW8A 3WOEA 4PZ6A 1YZ6A 3E5NA 2V9WA 1WTRA 3V4SA 4DV6H 5JAVA 4CJ2C 4ED0A 4RKBA 4C3IB 2FK3A 3RAQA 5BN5A 2QK4A 1PFBA 3H0GB 1JOOA 5CC4A 3HOUH 4OGQC 4NXMH 3OPOA 3NBIA 3TP7A 2ZT9C 2R7DA 1XNQQ 1S5ED 3HKZB 1B6SA 4FNFA 2A69D 2MP1A 3SK6A 4A3IH 1Q12A 2C35B 4HJ5A 2FJ2A 2JSOA 3AU7A 4A93B 1Y1WG 2F0FA 1I94Q 1E4EB 1UUPA 3JAMW 4BBRB 5D3IB 2W6NA 1UWVA 3TS2A 4NXNL 4WORA 4DFAA 1X65A 3S1MB 3HOYB 1KRSA 3HOZB 4B3TH 1CZWA 3IL8A 3K3VA 4LF8L 3KDFB 4HEDA 1F9RA 3KJOA 2AUJD 4RB3C 3HS0C 2W6OA 1A3UA 1S5FD 2A74C 4O3RA 2AQ2B 2GVBA 1KC8C 5C1PA 2I8CA 4A3FG 3SE7A 3H09A 1STNA 2PVPA 5JEAJ 5KFNA 4GKKH 2CQOA 5C4XG 2ZJQA 1PK8A 5T14A 5IT9L 4R7RA 3R5HA 4DV4Q 1S9FA 4Y7NH 2B63G 1Y1VB 4JI1L 2IX3A 2JA7H 5HURA 3GTPH 4DAMA 1SYBA 5J1ZA 3G4SA 3GTKA 3A0JA 4ME3A 2L55A 4CKCA 5AJ3L 1EYGA 4QMGA 3CCEA 1TY0A 5FJ8G 4DU9A 1WTHA 2HIXA 3J81W 4DV1Q 5IYBG 4O2BF 4X62H 5KG5A 2F0JA 4I7ZC 1I4GA 1V51A 4GOPB 3DMUA 1EIYB 3BABA 3TREA 1N9WA 3IN5A 1VQAA 2J4XA 1K1QA 3BYYB 4ZRZA 3TINA 4LF6Q 5G3LD 3JRWA 1A3TA 1AEXA 5C6AA 3KJPA 1VCIA 1MJEA 2C00A 3BU2A 3PQIA 3PSIA 3RBEA 2MQHA 1ZKOA 2EYPA 5AFWA 2WDTA 1Z2OX 1I4PA 3GTJH 1TS5A 1PH1A 3T13A 1ZEQX 2L12A 2B2YC 1V1PB 2SNSA 3KBXA 4A4IA 4WD3A 1HJPA 3GTMH 4RFBA 1KRTA 3FDTA 3T5KA 1XNQH 4HNUA 3PO3B 2UU9L 3AQQA 3C1EA 1RKNA 3PUVA 1RJTA 5H80A 1Q1BA 3AFQA 3MWMA 4C3HB 3TP6A 1WD1A 3M4IA 3KBGA 1EUJA 1KTKA 2B2YA 3Q22A 5EWEA 3N43B 1I94H 1I3QH 2F0TA 3S14H 5IE8A 2A68D 2RDJA 1H9MA 1JCKB 1SAPA 2NVQB 1N33L 1B6RA 3RB4A 3KUPA 2W9CB 1YNXA 3V6KA 4WJ3M 1QUQA 4J0MA 1G6PA 4Q0YA 4C2MA 3KAJA 4I65A 3MWYW 4TKOB 3DLLA 4JW0A 4HIKA 4DUYL 4HJ9A 2DY7A 1TWFH 3R2IA 5J39A 3OMCA 1L1OC 3SR1A 3Q1KA 4NB3A 4A3EG 4BY1H 1TKWB 3K5IA 1EEID 4R4TA 4WRDA 5IP7H 4TSSA 1I6UA 1EOTA 4A3KG 3AMUA 1PRTF 4BY7B 4DV4H 4LF5Q 4XQNA 3NWSA 4A3LH 2CW0D 2ZXRA 2R85A 1GLVA 1L1OA 5C3EH 1JIHA 4YR3A 5IY0A 1VQIA 3PUYA 1UEAB 2WACA 2PZWA 4KN7C 2K14A 4I7AA 3NP8A 4RB1A 2WKCA 1X3EA 4LFAQ 2JA6G 5DQGA 2PYKA 4OO1G 2BH8A 1YBYA 3N6RA 2FK2A 4PQXA 5KFAA 2VB3X 1M0TA 2F0UA 4DV1H 3I8ZA 4XZ3B 4YB8B 3IFDA 1NMGA 1KIXA 4MTKA 3L2PA 2F4VQ 1YVCA 2C5CA 3OUZA 2UVVA 2WAQB 3OWFA 1V8QA 4DR6L 3BZCA 4F4WA 2VUMB 1BQQT 1XWEA 4R4OA 5M5WH 1NCVA 2VS1A 5C4JB 3CCLA 2R84A 1HA6A 4LF6H 2JEFA 5FPRA 1Y1WA 4KTAA 4PNYA 5DLGA 1VQJA 4DR3Q 4J15A 1KJIA 2D0OA 2JA8H 4KHZA 4YWLA 1YEZA 3WDNA 2B2TA 1Q8IA 1JB3A 2VW9A 4JI7L 4DL5A 2CKZB 4ZI7F 1ZXTA 1SR3A 3TEHB 1B2TA 2JP1A 4MA5A 4CKEA 1TWCA 1CUKA 4GC7A 1XTDA 2E75C 2HVRA 2F0IA 5EKKA 2N55A 4DK1A 5FLXE 4A76A 4JI3Q 3Q8PB 4LUOA 3HOXG 1RJRA 1VAJA 5DM63 4DNTB 3F2DA 1QZGA 3HOVB 1EUDB 2EJGC 3A8KE 3TIGA 2Y0SB 3KK7A 1SCUB 4XTCS 1D7QA 2RDHA 4YJ3F 2RCFA 3RAXA 1O7ZA 1AUVA 2AQ1B 2R7ZG 4GN5A 5EBDA 2FKLA 1N8RC 4G7ZC 1BCPB 3RLOA 3RBDA 2TSSA 2E2JB 3I7FA 2B63A 1BKBA 3G6JB 2JE6I 3V05A 2E8GA 3VR6A 4JI4L 5EBCA 4O3SA 1WI5A 5KFGA 3OHBA 4LFCL 1PTOB 1WCMH 4OX9L 2DWCA 2PN1A 2AWNA 3GIDA 3RFCA 3OIPA 4C3IH 2PBZA 5M9OA 3H0GH 1SXTA 5IWAQ 4MA0A 4O3OA 5DEHA 1X54A 1UNSA 1A63A 3H3VC 4R4QA 3RV3A 2R7FA 1I50A 2B8FA 1LACA 4LF5H 3JAMc 1I4QA 4CGYB 5T1IA 3QZ8A 3M9MB 3CQZH 3J80i 1VQ4A 1SE3A 3W5OA 4BBRH 1U4LA 1EQVA 1DOMA 1EWHA 5COYA 4A3MB 1IBKL 1UC9A 1RODA 1B50A 2EYJA 4LFAH 3S1MH 3S1NB 3NQIA 2EE1A 3HOYH 4Q44A 2EY2A 3HOZH 3MR2A 2IPKD 3M7NA 3C0FB 1VDZA 2XN9C 5IT9E 1STEA 1PH7A 1SSOA 4DL7A 1MGSA 1BXRA 2F4VH 1R4QB 3SEBA 5ISRA 1NE3A 1F2ZA 1GSAA 1S4ZA 5FO7B 2ASBA 4CKBA 3MXPA 4ME5A 4WJWA 2AWOA 4DR4L 4DR3H 1TS2A 1S0NA 2R61A 2IA6A 3KLSA 3RR5A 4ZHQF 1EY0A 1E1TA 4K8JA 1V1OA 4QW9A 2UUCQ 3GTQA 4JI2L 5LL6X 5GAEC 2VQFL 4LAAA 1Y1VH 3CPWA 2HT1A 4RUAA 2MO1A 4N8FA 1DM0B 1XX8A 2J9GA 4JI3H 3I73A 5DG8A 1LV9A 3J81c 5KFPA 4DAYA 3R93A 1CS0A 4CDEC 3HOWB 2ZTCA 3NK9A 2F3IA 1ENAA 4QL5A 3BZDB 1D8LA 2NVTH 2R92B 1F2LA 4GLXA 2G5DA 4YWKA 1XPOA 4EX5A 3QB3A 1BNCA 4IHJF 4GC6A 3DM3A 4E6IA 4RWSC 1HZBA 3WWVA 1IBLL 1V1QA 2AHOB 2DLNA 3BJYA 4LF4Q 3N40P 5CV6A 4A3GG 2CCZA 3X3MA 1O7YA 1GO3E 4NDXA 1QB5D 2EYLA 2TMPA 4CJ0B 4NW2A 3CXCA 4RAUC 5IP9G 4B3RL 5EDWA 1HUNA 4IPHA 2ZXPA 4IUVA 1E1OA 3I4MB 2AU0A 5C3XA 2CQAA 1MI2A 1F9PA 1ICFB 4HSPA 4JYAL 4M9UA 3DF7A 3GV7B 3EPGA 1TU2B 1VS0A 3GIKA 1I6VC 5IWAH 4IZOA 2FP4B 4EYHB 1L0YB 1TWGA 3KHRA 1PFSA 3MWDA 4X3UA 5LA6F 3MFIA 1FR3A 3GP7A 1HZ9A 4DV7Q 3PO3H 3M4OB 4P72A 3HOUB 4L1KA 2RDGA 1TIID 4C3HH 4IRKA 4ECWA 3FHWA 4BXXG 5KG4A 4DXFA 2JEGA 1JC7A 2K01A 1O7IA 1G6ZA 4R4CA 1SMYD 1NR2A 1DOKA 3L0OA 1XMOQ 2IX0A 1HR0L 1ESFA 2K28A 1JLLB 3V4ZA 2KHIA 4RGMA 2Z8LA 2WINB 1P16A 3IKJA 4LW1A 4KKTA 2UXCH 1KJ8A 2EYMA 4ZUIA 1VQFA 5DGBA 4UFZA 1TR5A 1GXDC 1FJGQ 5T1GA 2ZDHA 5LP6F 1QNKA 2F52A 2NVYA 5JVDF 2F4IA 1Y14B 2QEXA 4NXML 2R7ZA 3TZUA 3KOJA 1V4YA 4BY7H 3DWAA 5FO8B 1NTGA 3R2TA 2UUCH 1O75A 3L9AX 3GQCA 4R4IA 4FS1A 4LF9L 3V96A 5CBAE 1CSPA 1Y69U 4CJ1B 3STBD 4F8MA 1EFID 1GUNA 1CZGA 2FHTA 5KT4A 4GNXA 2NZHA 4LFBQ 4EYIB 5LL6S 2UUBL 5D14A 3UDXA 2I07B 1AN7A 4MTDA 4EBCA 4A75A 1CKNA 1EZ6A 5C0XI 3MR3A 3J80W 2CHBD 1PXUA 2YTYA 2YV5A 1AUXA 3LMLA 3EQLC 5GONF 4TV8F 3DWQA 1EZ8A 3M9NB 1C7YA 3W3AA 2VUMH 5C4JH 4LF4H 4APMA 4ZQ3A 5ELOA 2LY7A 4TQRA 1M8AA 2BQRA 1VF7A 3A8JE 5JVH3 3BQ2A 3BJUA 1GUOA 3CP0A 2CWPA 1M7JA 4GKKL 1YHAA 3OMGA 2YTXA 4JI6Q 1HA5A 3ULLA 3I91A 1BCPC 3WOFA 1LT3D 1IYUA 2NZ1D 3A74A 2ATLA 2PW7A 4FBUA 3M4QA 3CCJA 1CM9A 1B44D 3ETHA 4HMIA 2R7LA 2ENBA 3R3OA 4AQYL 4DV7H 1X55A 3JAMi 1LM0A 4J1MA 3HOVH 1PTOC 1WJJA 1Z7TA 5HV6A 4RNNA 1JQYD 3NEMA 4A2BA 1GGOA 3DEPA 2P0AA 1TS3A 5HY6A 3K0XA 3T16A 1YJ9A 4JBWA 4IFDI 5CBEE 4LH6A 2K5NA 4RZQA 1XMOH 1YNJC 2E2JH 2JA7G 3ETJA 2UXBQ 1GHJA 4UPAA 1N34L 2HHHQ 4KY5A 4QJFA 4J9QA 2V4RA 1YJNA 3JAML 1RHPA 3UQ8A 3GTGA 3CCRA 2PNHA 1FJGH 3IFTA 1RJPA 2CQYA 1HRJA 4DL2A 2K05A 3EA6A 4PV1C 1FYCA 4OONA 3CW2C 2KHJA 2A73B 1TQOA 2HQEA 1JWMD 4RA8A 4DUZQ 1EY8A 3ITPA 4JI0L 1XNQL 1OWTA 4UCOA 2PQEA 2WV6D 5C5MA 4FF1A 3ZJYC 4BY1B 4UCRA 1ONLA 4DN4M 2VQEQ 2XIGA 2SOBA 1I94L 2SNMA 1UE6A 2F0OA 2ICIA 2KVMA 3T53B 1S97A 2RBMA 5KFVA 1F2YA 3J81i 4A3MH 4FBTA 4G3IA 4EGJA 1I4XA 1W93A 1OXUA 2L9HA 4OEMB 1YITA 1JOQA 3S1NH 2SEBD 3BYTB 3AFPA 1F2MA 5E4XA 4O0AA 4JBMA 1A6XA 5M3FB 4LFBH 3FPPA 3PO2B 2WYOA 2JA9A 2NB0A 2XGPA 2DGYA 2NUCA 4C2MB 3FKIA 1D5XC 4RCOA 2AKWB 5A2QW 3SHLA 1SYCA 2B8GA 1A0IA 2CH4W 2Z6KA 3I2ZA 2GLTA 4A3BH 5FD6A 2KA7A 4K14A 3HXLA 1EHIA 1LYLA 2BDOA 3VYUA 4UP8A 1VQPA 4HIDA 4CBVA 3J81L 2PZTA 4DR1L 3S16B 3PR5B 3R8BA 2Z6BA 4R8UA 4JI6H 2R3ZA 1X56A 2RF4A 3CU7A 2I5LX 4B9WA 2ZJPA 1IBMQ 5K2MA 1M4VA 2UXDQ 4IFDJ 4X6AH 4KMUC 4FVMA 4H02A 1B1ZA 1H9SA 1VQKA 4K0KL 4B3SL 4IAJA 2FINB 5KFWA 4RGNA 1BDOA 3HOWH 3VA7A 2I5HA 1LLRD 3PV0A 2YS6A 3NUCA 5CAEB 5CA1F 4RU9A 2R92H 2YYZA 3NQTA 4DV3L 4AIMA 2GPWA 3JZIA 2EJMA 4O2DA 4PDBA 1Q1EA 4JVZA 4DPGA 5EQ0A 1WTXA 4QIWA 1WTQA 4IOCA 3NE5B 3SI8A 1UE5A 3A7LA 4X62Q 1VMCA 3W1GA 3I4NB 2UXBH 1Y1WB 1Z2PX 2EIFA 2HHHH 4MIUA 2F0LA 2K5WA 2AUKA 4O3PA 3VPCA 3I4MH 2BQUA 2HQLA 2Q2IA 2C9OA 4HAEA 4QGUA 2OT2A 5CGKA 4WFN3 2UUAQ 2DUDA 4Y8VB 4FF3A 3U4VA 2CH4A 3S2DB 5J22A 4MV7A 1TWCB 2Q8RE 1A2TA 1YIJA 1WCMB 3MC0B 4DR2Q 5H1SE 4DUZH 1SNMA 3M85A 1T5EA 4QIWE 3H40A 1RIPA 1K3BC 2KJXA 3M4OH 3CHBD 3MA2B 3D4RA 3NBHB 4YCVA 3KTMA 1J8IA 3OSNA 2VQEH 4LWCA 5EPJA 1N36Q 2JXMB 2MNAA 4EQPA 4A3FB 4QY7A 1G291 3HZXA 2RA4A 4G4KA 2E2DC 2ZM6L 1XJVA 2JA8G 2RKSA 3RLNA 4FXDA 4DV5Q 5KT3A 1BO0A 3T4AC 5K36H 3CQZB 1T5XD 1SEIA 2MCTA 2OQ0A 1SBBB 1B7YB 4X66Q 1X6OA 5C0XH 2ES2A 2B63B 1CA6A 4JC0A 3ORQA 1QNUA 1PRTD 1XNRQ 3K5NA 4YHHQ 4JBKA 3H20A 4FM9A 1S3OA 1IOVA 4NKLA 3BZKA 1I4HA 4XYQA 1RTNA 1WH2A 2I5MX 2X0SA 5HGQA 3Q8DA 5KYLA 3WO0A 4Q43A 1E4FT 4X65Q 3I72A 2JEJA 3LWUA 3T1HL 2M9VA 4Y52H 2C22A 5KFJA 4ECQA 2QCPX 2BE5C 1IBMH 5J2TF 1BBUA 4DGZA 3MVVA 1VQOA 1PH6A 2YZNA 2FMAA 5JPMC 1ZETA 3T1YQ 2JA7A 4JPBW 4NMZA 2W7PA 2UVWA 3GTPA 2UXDH 4Q8FA 1QG7A 2P5ZX 2ZDQA 1PDQA 1S72A 1BR9A 2K1BA 3U9OA 1JWSD 4C3IG 3J80c 3H0GG 2W8LA 2CFMA 5I4DA 4C3JG 3P20A 3JC66 4XIGS 3CMEA 2R93G 4OELB 3N52A 3RN5A 3HKZG 1CFMA 3UE0A 3ERQA 2N88A 3FVQA 3TP5A 4APVA 3PW2A 2K6AA 2NVTB 5DAUA 4A93G 4MTEA 2PO4A 2F0DA 4QWBA 4BBRG 4HN7A 3ND9A 4DR3L 1D5MC 4X64Q 5C4HA 5L1KA 3F8NA 4AYBB 4L5RC 4P2CB 5KFBA 3BG3A 3HOYG 1N32L 3HOZG 2ID0A 3KLWA 4KHPL 2UUAH 5KFUA 4YAKB 5KG7A 1JX4A 3MFGA 4DR2H 3K80C 4HYKA 2YU9A 2CWAA 3SGIA 5CR3A 3K57A 1PYSB 1CSQA 1CT1D 3S17B 5KNCA 1JWUD 1RL2A 3T56B 3U50C 2XVSA 1N36H 2RGRA 1BXTA 3H3VI 4DLKA 5C3WA 1I3QA 4P74A 2R7KA 1S40A 1Q3LA 2BA1A 4FYDA 4UP9A 3JAME 4IRCA 2K7VA 1C48A 3A5UA 2V1CC 5KNDA 1IZ6A 5LMUL 1NY4A 2F0HA 3LNNA 4LF7Q 5JJIA 4DV5H 4IPGA 1K28A 1PA6A 3OTOL 1ZYRC 1Y1VG 3KLRA 3LWEA 3KALA 4QWAA 4X66H 1QOHA 5KT5A 4HIMA 1XNRH 2Q8TA 1RYSA 3Q6SA 4YHHH 5KFIA 4YP3A 2F0KA 1K1SA 2LS01 1KDBA 4PZ7A 4DR5L 2L15A 1EQRA 4DL3A 1SRUA 1TWFA 4FO2A 4C5BA 1EEFD 2EY1A 3J81j 1VQGA 1R9TB 1GM5A 2EQSA 1BBWA 1Q7YC 4X65H 2KENA 5L37A 1BUVT 3MXGA 4KKUA 1FD7D 4GN4B 2WE6A 1TWGB 1SFOA 4QF4A 1FNWA 4HR7B 4XT3B 4V190 2VB2X 4R9WA 1J5EL 1RD9D 4ZYSA 3T1YH 2EOTA 5KT6A 1KD1C 4QWCA 4DL6A 5BR8L 1VQDA 2W9BA 3BQ1A 2PCFB 4TQUS 2KEDA 5JUMA 3H15A 1GOZA 4OWWB 1K83B 1TY2A 1EY6A 1JT8A 3D0FA 1KJJA 2PMZB 2XRSD 1JB7A 1VBHA 3FEWX 5JEAH 5M3FH 1F77A 1AE2A 3PO2H 3J81E 4LF8Q 2V58A 4HCSA 2OQKA 5M3MH 5BN3A 2E2IB 3OIQA 5EKIA 1CQFA 4C1NK 4C2MH 4N9TA 1KHIA 1LO5D 2WB1B 3W2DA 1QZHA 2LKVA 2YZGA 1JR0D 2A6EC 4C3HG 4GZYC 4LJZC 1W6JA 4I50F 4L5SA 5EWFA 1ENCA 2IL8A 5I9PA 2IBKA 1EYZA 3S16H 2B2VC 2VR1A 3S2HB 4X64H 2JEBI 4L5QA 1B3QA 4JI8L 2R7ZB 5C8YF 1TA8A 2C28A 4EFBA 1RCVD 1Q90A 3EIVA 4RHRA 3I56A 4JI1Q 1S68A 1HXYD 5DNFA 2BR0A 2YTVA 4NP5A 1JOKA 4G7HC 4DR7L 5KGUA 1TWAA 5AJ3Q 4UDUC 3QWNA 3CAMA 4DNRB 4FF4A 1WSCA 2NU8B 2E5LL 2XRQD 4GNXB 3TMEA 1UEBA 3H4BA 1CTMA 1MSHA 2IHEA 4MZ9A 5IGGA 4JUZA 3OYYA 2QGQA 4BY7G 4LF7H 3D4WA 1GD7A 1PX2A 1SNDA 1QVGA 1M0WA 3QOJA 2KSWA 3CKIB 4Q5VA 2Q8IB 2EXZA 4LF4L 3GTLB 4ILWA 3AYHB 1AW7A 1IYJB 3I4NH 3ZYYX 4IO9A 4M7EA 2C2DA 1KLUD 5BPHA 1Y1WH 2HIVA 1S5CD 1GUWA 4RNMA 1HQRD 2VL6A 3NTKA 2DNCA 3CC4A 5A35A 4IUTA 5L1JA 3H0GA 1WOCA 3S2DH 4JV5L 1HNWQ 2X6LA 3UDFA 1TWCH 1TWHA 5LYJF 2R93A 3K5OA 4Q0FA 4A3JB 2WAQG 4GLAC 3J7AK 2VUMG 3NSWA 1SYFA 4U673 4MV9A 2Q2TA 1SYGA 3D8GA 3KLSX 1ET9A 2DY8A 2MPMA 1HTPA 4DV2L 4A3FH 3I3CA 4NXNH 5CORA 2LSSA 1IOWA 5M5YB 5E3FA 1JJ2A 5ELBA 3MHBA 2EYOA 1N33Q 2RSNA 3D6WA 4EQNA 3T5LA 2R7NA 2NWGA 1MSGA 1GKHA 1E22A 4QUCA 1PH2A 2W9AA 4LF8H 3KDFA 2B63H 2YZMA 3QZ7A 4OHJA 3QFFA 2I46A 3GIPA 1SYEA 4MHEA 2M00A 2A68C 3PR4A 2VNUD 3HOVG 2ASDA 4Q8EA 1X32A 1PFMA 2F1MA 2MO0A 3DHQA 3RB3A 4DF7A 3GTGB 3H94A 4GKJL 1SN8A 2L5TA 4MV8A 3GTOB 2X6GA 4YIJA 4ED7A 5KFKA 1IKMA 2UXCQ 5LHY1 2BQ3A 4A3BB 2XNAC 5EAYA 1Q8KA 3G6YA 1J6QA 3TDQA 4BBSB 3J80L 1SYXB 2JA5B 1EQTA 1Y1VA 2H5XA 4JI1H 2O5JC 5DQIA 3OSOA 3CCVA 1EOVA 5C4ZA 4RZRA 3M7GA 3FP9A 4NLGA 5J2UF 1B3AA 3MTSA 3X3NA 4GOPC 3K7UC 1QVFA 1GVPA 1XYIA 2CW0C 1EY7A 2V4QA 5HBRB 2OH2A 4LFBL 1Z47A 1NBWA 5IYCG 1C4QA 1ILPA 1G91A 4BWSC 3NELA 1F9QA 4XYMB 3C2PA 3P7JA 4N8X1 3G8CA 3CF5A 4X3SA 1VQ7A 3FKIB 4BA2I 2Z9HA 4DR6Q 4FS2A 2HDLA 3RZDB 1B4OA 4RMFA 1SJHD 5CV9A 1WTWA 4A3MG 1PZID 1CHPD 4QCLA 1S0MA 2PQAA 1ZQ7A 1BJTA 3GO5A 1SEBD 3S1RB 5BMVF 2MGSA 4JI7Q 3F1ZA 3LX0A 2NVXB 2R8HA 2NN6G 3Q8QB 1DIKA 5I2XA 3LGJA 1HNWH 3UDGA 2QW7A 1KABA 2WFWA 2D62A 3RJ0A 4ECZA 2RQXA 2JA6A 3PGZA 1PH8A 1O7LA 5CV4A 3S17H 2DZDA 1YNJD 1WYDA 4B3ML 2Z1CA 3DXJC 1LTTD 4U68A 4DV0L 4RNOA 4LSXA 5F2DA 5K5PA 1MIUA 2VXWA 1XPUA 3RIZA 4QWDA 3S1QB 1N33H 1A3VA 1K0SA 3A55A 4CC5A 4F4XA 3BDLA 4MV4A 4P71A 4QWEA 3GV8B 2FMCA 1RK5A 2IY5B 4L6TB 1K3RA 2D2CC 4LFCQ 3E9HA 3HOWG 4OX9Q 2EY6A 4ULLA 5EJWA 1R9TH 2XC9A 1S03G 1R4PB 5C44G 4EFEA 1YNNC 1STAA 3VMMA 1H9RA 1E3PA 3ORRA 3EJIA 2UVUA 3KHHA 4DV6L 1TWGH 3PUXA 2XIWA 4UCVA 5I47A 3L4JA 5EOYA 1CKMA 2QILA 4IQZA 2O5IC 1Q81C 1HPCA 4KY7A 3VR2A 2F0GA 5A2QL 1M6VA 2R8IA 4HQ6A 1MD2D 3K6OA 3PW5A 4LMYA 3MR6A 5FLMH 1E2WA 4HJ7A 1IBKQ 2A19A 3TIIA 2ALZA 2J6SA 3I4MG 1K83H 3CPFA 2YRWA 2KCMA 2RVLA 1JDBB 4JV1A 1K8GA 3EN2A 3RZOB 3SXHA 5LOVF 2EVBA 4K5WA 2E2IH 2F0SA 2IJ0A 1TXYA 1J9OA 2QDLA 2WAQA 5FPOA 5KFQA 4B3TL 2W6QA 4POFA 4DR6H 1GSHA 2YS7A 2VUMA 3HOUG 1JORA 2KBNA 1TVXA 1GSOA 4MV3A 1VQLA 4G57A 3NTHA 1EU4A 3TS0A 4DR4Q 3RB0A 3O13A 4A3IG 3CCSA 4YR0A 2EY5A 1NSNS 3S2HH 3BVZA 5K36G 4UCTA 2R7ZH 2XD4A 2FJZA 5FO9B 3M9OB 4F88A 2W70A 4JI7H 4JI2Q 5C0XG 4K5VA 2VQFQ 3UDIA 2F3WA 3VPBA 5CMDA 2Z4IA 3CCUA 4N9PA 4KN4C 2WAQE 1KDCA 2G9HD 1EQQA 1C8CA 3OUUA 1I6HH 1AH9A 4XT1B 4ZK9B 3S9WA 2ATWA 2PNRC 1EYAA 2R8GA 4ZLTF 5JVG3 1BCPF 3U9TA 3K81C 1GUTA 3GTKB 1DV2A 1HQMC 4DAVA 5J3BA 4TRDA 1C3OA 2J6TA 5GQOA 4IN3A 5GAGC 2SCUB 3E0EA 3K59A 3BDCA 4B08A 1IBLQ 1JKJB 3FDSA 4YR2A 1PTOF 1C30A 3F8TA 3GTLH 2F0VA 4X62L 3WNZA 2C2EA 4OXPA 1XPRA 1UE1A 1BF4A 2IP4A 3TQTA 4EGQA 4DAPA 5IGBA 5JJZA 4B3RQ 4LFCH 1EY4A 5KIXA 4OX9H 2XCAA 1ZHQA 2GVAA 2J6UA 1W3SA 4JYAQ 3GIIA 1E2VA 4IPCA 3V6HA 1E0BA 5ELCA 2UUAL 3C3LA 1CA5A 4CHTB 3VR3A 3QOLA 4A3JH 4OIJA 2YU9B 2HUGA 2JN4A 3BS1A 4FXGC 4ECTA 3PVXA 3MAQA 1D2BA 1Q46A 5L9XA 2QA4A 1U9RA 1RYRA 1O80A 1L2ZA 2EXDA 2IHFA 1IBKH 2AMCB 4B9XA 4M8AA 5M5YH 2BCOA 4JBJA 3IAYA 2VOBA 4I7HA 4CC6A 5KFDA 1S0OA 2E2HA 4HCEA 1HR0Q 4XYLB 4A3DB 3K7AB 1PH3A 1NJIC 5LMNQ 3KF6A 1PFNA 3GDEA 1XNRL 4IWXA 1QE6A 2KOLA 3RV4A 1IL8A 4L8JA 3J80E 1A9XA 2FLNA 2BE5D 1SYDA 2KQ3A 3SK8A 1QILA 5D3DA 3EYYA 5M3MB 4RCNA 3GTGH 1QUQB 4DNIA 3SVMA 3GTOH 2QKIC 1C9OA 5HGTA 4DR4H 4YWMA 3KHLA 4L63B 4XQQA 5D8DA 4ED6A 4XYOA 3UI2A 3MJFA 4DKAC 1W6KA 3QJYA 5IIFA 3V2TA 1IYVA 1KQSA 4C56C 4JI2H 4BBSH 2JA5H 1KL9A 4FXKC 2VQFH 1Z6HA 4JI5Q 4ECYA 4LF9Q 5DG7A 3VR4A 2R82A 4EBDA 3T51B 4DV4L 1JMCA 2K52A 2NTTA 4ZAIA 4EEQA 3J7AF 4S3SA 5FD5A 3RGXA 4K8IA 1L1OB 2ZTEA 2NU9B 1TS4A 1PRTB 4ECSA 2EJFC 4ED8A 2UUBQ 4PZ8A 1U4RA 1U5KA 3K8AA 4IR9A 4F87A 1HNXQ 4ECUA 4FU0A 1GYFA 3FKIH 3UE1A 4BY1G 1IBLH 1W2BA 4GS3A 1X3PA 4LUVA 1DGSA 5IP7G 4DV1L 1K73C 4R8IA 1C0AA 4IWYA 2FMMA 3RZDH
chains in the Genus database with same CATH topology
2V1CC 5GADC 3JAMc 3CD6A 1OTCA 4GNXC 1IZ6A 5LMUL 1NY4A 1VQBA 3PF5A 4P73A 1E7ZA 4LF7Q 5JJIA 2NVYH 1YHBA 4IPGA 4JI5L 1PA6A 4A3LG 3CQZH 3OTOL 4X64L 1Y1VG 3J80i 5C3EG 1VQ4A 3W5OA 1SLJA 4BBRH 3S1RH 4LF6L 2WB1E 3EBEA 4HIMA 1Q86C 1IBML 1EWIA 1IBKL 5M3FG 2NVXH 3PO2G 3S1MH 3HOYH 2UXDL 5GROA 4PZ7A 4DR5L 3HOZH 2L15A 1EQRA 3M7NA 1SRUA 1V9PA 2K75A 3J81j 1GM5A 1VQGA 4AQYQ 2EQSA 1L2FA 1BBWA 1Q7YC 1PH7A 3NENA 3PF4A 4RG1A 5IT9c 2KENA 1HNXL 1NE3A 4GN4B 2ASBA 2B29A 3G48A 1J5EL 1HZAA 1I5FA 3KF8B 2AWOA 1Q82C 4LF7L 4DR4L 4YCWA 2ALYB 1KD1C 3S1QH 3TQYA 5BR8L 3RR5A 1VQDA 1PHJA 1VQ8A 1E1TA 4TQUS 3GD7A 2UUCQ 4JI2L 3MXNB 5GAEC 1X9NA 3H15A 4PG3A 2VQFL 1Y1VH 3PIPA 4HIOA 1N34Q 4OWWB 1JT8A 3D0FA 3CC2A 3CPWA 1JB7A 1L0WA 1JE5A 2LXKA 2MO1A 5M3FH 2BH2A 3PO2H 1AE2A 4LF8Q 2Y0SE 3J7ZC 1SE8A 2OQKA 5M3MH 3J81c 1V43A 4IFDG 3W1BA 1HH2P 2ZTCA 4AH6A 2K5VA 4C2MH 2OTJA 2IT1A 4B3MQ 2F3IA 1KHIA 4QL5A 1QZHA 4DR2L 1D8LA 4JI0Q 2NVTH 4GLXA 4DV0Q 3MEFA 4YWKA 1XPOA 4R1JA 4EX5A 3PCOB 1OXXK 4L5SA 3DM3A 3KYHC 3I4NG 1SMXA 1HZBA 4JG2A 3WWVA 1N36L 3S16H 1IBLL 3U58A 2PI2A 1V1QA 2AHOB 2JEBI 4L5QA 4JI8L 4LF4Q 4A3GG 2N8NA 1AE3A 2CCZA 3EIVA 3J7A5 3M4PA 4LF5L 1GO3E 3ULPA 3I56A 3CXCA 4JI1Q 1OXTA 4DV5L 5IP9G 4B3RL 4IPHA 2YTVA 1E1OA 4DR7L 4X66L 3M9BA 3RZOH 4JYAL 1WCMG 2A1AA 2NZOA 5AJ3Q 4YHHL 2RCNA 1VS0A 3CAMA 4LFAL 1YHQA 4YY3Q 1VQNA 3PUZA 2IX1A 5IYCH 2E5LL 4GNXB 1PFSA 4DV6Q 1UEBA 2XGTA 4MZ9A 2IHEA 5JJLA 4DV7Q 1HZ9A 3OYYA 3PO3H 2QGQA 4P72A 1X3GA 2PI2E 3PIOA 4X65L 2HT1A 2OCEA 2JK8A 4BY7G 1GD7A 2F4VL 1QVGA 4C3HH 4DR1Q 5C0XJ 4NXMQ 1X3FA 2ZTDA 5GAHC 1HR0W 3FHWA 1PH9A 1HNZQ 4LF4L 1VQ6A 4BXXG 1C0AA 3AYHB 3AEVA 1IYJB 3I4NH 4IO9A 1O7IA 5LMNW 3RNUA 4R4CA 3T1YL 1Y1WH 2HIVA 3L0OA 4LNQA 4NPSA 2E2HH 1XMOQ 2VL6A 4A3GH 2IX0A 2Z6KC 1HR0L 2MFIA 3CC4A 4K0KQ 2KHIA 1M1KC 5IP9H 1LTLA 4B3SQ 1XMQQ 3G6EA 1WOCA 4IJLA 1PV4A 3A5ZB 3S2DH 4YY3L 4JV5L 1P16A 1HNWQ 4LW1A 1H95A 3UDFA 1TWCH 4B3TQ 2WP8J 4JOIC 3GTKH 1ASYA 1VQFA 2WAQG 4GLAC 4JI3L 4DV3Q 2OWOA 1FJGQ 2VUMG 2F52A 4DAYB 4P75A 4DK3C 2Q2TA 3STBC 1Y14B 1G51A 2QEXA 1K8AC 4NXML 3HFZB 3KOJA 4MNOA 2XTIA 4DV2L 4A3FH 4UP7A 4BY7H 1HNZL 4JOIA 1NTGA 2LSSA 1YJWA 1JJ2A 4A3DG 4IJHA 4R4IA 4PMWA 1OXSC 1N33Q 4BXXH 4IOAA 2D0PA 2A8VA 4GKKQ 4LF9L 1GKHA 4POGA 1E22A 1QVCA 2PQAB 1PH2A 1CKOA 3KDFA 2B63H 5JEAG 1CSPA 5IYDG 2JEAI 1JJGA 1XMQL 3STBD 4OWTB 5M3MG 4GN3B 3S15H 4GNXA 3TRZA 1HNWL 2VNUD 3HOVG 2NZHA 3M3YH 4LFBQ 1JJCB 2MO0A 3ER0A 3RN2A 3ICEA 2UUBL 5C44H 3CMAA 1SN8A 2YU9H 3UDXA 4GKJL 3G71A 1CKNA 4A75A 4DK6C 5C0XI 2YTYA 2YV5A 4FDBA 4L5TA 5IWAL 2UXCQ 1C7YA 1VQCA 2VUMH 5C4JH 1EFWA 5EAYA 5JJKA 1Q8KA 2ZM6Q 1J6QA 5ELOA 3U4ZA 4AYBG 2H5XA 3BJUA 1VQMA 2UXBL 3CC7A 3CP0A 2CWPA 1EOVA 3CCVA 4GKKL 1YHAA 2YTXA 4JI6Q 3FP9A 5DLQE 4NXNQ 4A3DH 3K7AH 4GOPC 1Z9FA 3ULLA 1FGUA 3K7UC 1QVFA 4PZ6A 3RLFA 1YZ6A 3A74A 1VQEA 1FVIA 1GVPA 3M4QA 3CCJA 1SROA 5IYDH 1VQHA 4LFBL 1PH5A 1Z47A 1NBWA 5IYCG 4AQYL 1X55A 3NELA 3JAMi 3F2BA 1LM0A 3HOVH 1WJJA 3HOUH 3CF5A 3T1HQ 1VQ7A 3PO3G 4BA2I 3NEMA 4DR6Q 2UXCL 3L7ZC 2R7DA 2GN5A 1VQ9A 1XNQQ 5HY6A 3K0XA 1SFOH 1MKHA 1YJ9A 1P8LA 4JBWA 4A3IH 1Q12A 2C35B 4GLVB 4RMFA 4HJ5A 4IFDI 2K5NA 4A3MG 2N49A 4OO1I 1Y1WG 2PQAA 3CCQA 1I94Q 2E2JH 3GO5A 2JA7G 1UWVA 4JI7Q 3TS2A 4NXNL 3F1ZA 2UXBQ 2UUCL 2N3SA 2NN6G 1X65A 4UPAA 1N34L 3LGJA 2HHHQ 3UDGA 1KRSA 4QJFA 1YJNA 2WFWA 2D62A 3PGZA 3CCRA 4LF8L 3KDFB 2PNHA 1PH8A 3KJOA 1NMFA 3S17H 1WYDA 4B3ML 2GVBA 1KC8C 4OONA 3CW2C 2KHJA 1K9MC 4JI0L 3HKSA 4DUZQ 1XNQL 4DV0L 4A3FG 1MIUA 1XPUA 4HJ8A 5FLMG 3ZJYC 1CKNB 4IPDA 3ULJA 2VQEQ 5JEAJ 1MJCA 2CQOA 1I94L 3CCMA 2ZJQA 5C4XG 1UE6A 4JI7L 1KAWA 4YCUA 1N32Q 3VDYA 4DV4Q 4P71A 3J81i 4A3MH 4KHPQ 4Y7NH 2B63G 1B8AA 4JI1L 1OXUA 1YITA 1A62A 1K3RA 2JA7H 2IY5B 3GTPH 4DAMA 3S1NH 3AFPA 4LFCQ 3E9HA 4O0AA 3G4SA 4JBMA 3HOWG 1YI2A 4OX9Q 3A0JA 4ME3A 2JA9A 2WB1G 1R9TH 5AJ3L 1EYGA 2DGYA 1TWAH 1IL2A 3CCEA 3IRBA 5C44G 5FJ8G 1E3PA 2AKWB 4DV6L 1A0IA 1TWGH 2HIXA 2BA0A 3PUXA 2Z6KA 3I2ZA 4DV1Q 5IYBG 3E9IA 2K4KA 2UU9Q 4A3BH 4DV7L 1CKMA 2FXQA 5LMUQ 3B6YA 1Q81C 1LYLA 1PH4A 4GOPB 1VQPA 4UP8A 1EIYB 3TREA 1N9WA 4HIDA 1VQAA 3OTOQ 4DR1L 1WFQA 5FLMH 4KI0A 4LF6Q 1X56A 2RF4A 1IBMQ 2I5LX 4HJ7A 2ZJPA 1IBKQ 2A19A 3KJPA 1VCIA 1MJEA 3BU2A 3I4MG 3PSIA 2KCTA 5C4XH 2RHSB 2MQHA 1K83H 2UXDQ 1XMOL 4IFDJ 4X6AH 4DR5Q 3CPFA 5M5XH 2KCMA 1K8GA 4H02A 3GTJH 3EN2A 1LUZA 1VQKA 4K0KL 1PH1A 2ZJRA 2E2IH 4B3SL 3HKZE 1A8VA 1TXYA 3HOWH 2Z0SA 2I5HA 4A4IA 4B3TL 1HJPA 4POFA 3PV0A 4C3JH 4DUYQ 3GTMH 3HOUG 1TWHH 1KRTA 4QQBX 4BA1I 2KBNA 2R92H 2R93H 2Y0SG 2YYZA 4DV3L 4AIMA 5FJ8H 1J5EQ 2UU9L 3AQQA 1FJGL 1VQLA 1EIFA 4O2DA 3PUVA 1Q1EA 4DPGA 1Q1BA 3TS0A 2Q2HA 1T9HA 3AFQA 5E7NA 4DR4Q 4A3IG 3CCSA 4A93H 5IYBH 4HJAA 4IOCA 3I4OA 1EUJA 1UE5A 3S2HH 5K36G 5BR8Q 2R7ZH 1I3QH 4X62Q 3W1GA 3S14H 3S24A 4JI2Q 5IE8A 1I50H 5C0XG 2VQFQ 2EIFA 3UDIA 1N33L 4JCVE 3CCUA 2R93G 1UE7A 1YNXA 3I4MH 4WJ3M 1QUQA 2HQLA 2N78A 2Q2IA 2WAQE 4QGUA 1EQQA 3I55A 1I6HH 1AH9A 1G6PA 3KF6B 3H3VH 4A3JG 2DUDA 2UUAQ 1PVOA 2ATWA 3U4VA 3DLLA 1YIJA 3K81C 4HIKA 4DR2Q 4DUYL 4HJ9A 3OW2A 4OWXB 5H1SE 5J3BA 1TWFH 3D31A 3M85A 4QIWE 1L1OC 1RIPA 3M4OH 5GQOA 4NB3A 4GOPA 5GAGC 4A3EG 3NBHB 3E0EA 4YCVA 4BY1H 4LWCA 5ELNA 4R4TA 1N36Q 5IP7H 1IBLQ 2MNAA 4A3KG 4JI8Q 3F2CA 4QY7A 3F8TA 1G291 3GTLH 3PUWA 4X62L 2ZM6L 2JA8G 1XJVA 4LF5Q 4OXPA 3RLNA 1UE1A 1XPRA 4A3LH 4DV5Q 1L1OA 5C3EH 2R6GA 4B3RQ 2I0QA 2OQ0A 1VQIA 5IY0A 2K50A 3PUYA 1B7YB 4X66Q 1X6OA 2ES2A 4JI6L 4DR7Q 2GVAA 1W3SA 4JC0A 4JYAQ 2K14A 1XNRQ 4IPCA 4YHHQ 1X3EA 4JBKA 3GTQH 1HZCA 4LFAQ 4EQ5A 2UUAL 2JA6G 1S3OA 4LUZA 4OO1G 2E5LQ 2JJQA 2BH8A 3BZKA 1YBYA 1M90C 4MTNA 2I5MX 4A3JH 5HGQA 3Q8DA 1NMGA 4AYBE 1KIXA 4X65Q 4A3BG 2NN6I 3L2PA 2F4VQ 1YVCA 3T1HL 1KXLA 4Y52H 4BBSG 1Q46A 2JA5G 4DR6L 3BZCA 2QA4A 4R4OA 5M5WH 4KLKA 2VS1A 4A3EH 3CCLA 2EXDA 1BBUA 2IHFA 1VQOA 1PH6A 2AMCB 3T1YQ 5M5YH 4A3KH 4JBJA 1VQJA 3GTGH 4DR3Q 4J15A 1HR0Q 2D0OA 2JA8H 4KHZA 4YWLA 1YEZA 2B3GA 2Q2UA 1K0RA 1PH3A 2VW9A 1E24A 1NJIC 5LMNQ 3KF6A 4JI4Q 2CKZB 1S72A 3GDEA 1ASZA 1VQ5A 1XNRL 1SR3A 3TEHB 4JV5Q 1CUKA 2HHHL 1XTDA 3J80c 3ERSX 3H0GG 2CFMA 4TVAB 3FKIG 4JI3Q 4A76A 1QUQB 4DNIA 3JC66 4LUOA 4XIGS 3HOXG 3CMEA 1BVSA 5FLXc 3RN5A 2R92G 3F2DA 2VZAA 3HKZG 1QZGA 3GTOH 1C9OA 3UE0A 4WJ4A 4A3CG 4YWMA 4APVA 4XTCS 1D7QA 4DV2Q 2OTLA 4DKAC 4A93G 4DUZL 4ALPA 1KQSA 1FL0A 2R7ZG 4BBSH 4GN5A 2JA5H 4BBRG 1KL9A 2VQEL 1N8RC 4JI5Q 3RLOA 4DR3L 2NVQH 4X64Q 4LF9Q 2JA6H 3I7FA 1BKBA 4L5RC 3HOYG 2JE6I 4UY8C 3HOZG 2E8GA 2ID0A 4DV4L 4JI4L 1N32L 5LMNL 1JMCA 2K52A 1WI5A 2K5HA 2VY3A 3KLWA 4KHPL 2JQOA 2LXJA 1L1OB 2ZTEA 4LFCL 1OXVA 1WCMH 4OX9L 1U0LA 2AWNA 3K80C 2CWAA 1IXRA 3SGIA 2UUBQ 2RHQB 4GKJQ 4PZ8A 4C3IH 1PYSB 1CSQA 1B70B 1U5KA 1PYBA 3K8AA 3H0GH 5IWAQ 1RL2A 1HNXQ 3U50C 3FKIH 1X54A 3UE1A 4BY1G 1A63A 3HOXH 1W2BA 3H3VI 4GS3A 3KFUA 4P74A 4LUVA 4R4QA 1S40A 1DGSA 2BA1A 4UP9A 2PMZE 5IP7G 4DV1L 1K73C 2R7FA 4A3CH 3A5UA 3RZDH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1C C;  5GAD C;  3JAM c;  3CD6 A;  1OTC A;  4GNX C;  1IZ6 A;  5LMU L;  1NY4 A;  1VQB A;  3PF5 A;  4P73 A;  1E7Z A;  4LF7 Q;  5JJI A;  2NVY H;  1YHB A;  4IPG A;  4JI5 L;  1PA6 A;  4A3L G;  3CQZ H;  3OTO L;  4X64 L;  1Y1V G;  3J80 i;  5C3E G;  1VQ4 A;  3W5O A;  1SLJ A;  4BBR H;  3S1R H;  4LF6 L;  2WB1 E;  3EBE A;  4HIM A;  1Q86 C;  1IBM L;  1EWI A;  1IBK L;  5M3F G;  2NVX H;  3PO2 G;  3S1M H;  3HOY H;  2UXD L;  5GRO A;  4PZ7 A;  4DR5 L;  3HOZ H;  2L15 A;  1EQR A;  3M7N A;  1SRU A;  1V9P A;  2K75 A;  3J81 j;  1GM5 A;  1VQG A;  4AQY Q;  2EQS A;  1L2F A;  1BBW A;  1Q7Y C;  1PH7 A;  3NEN A;  3PF4 A;  4RG1 A;  5IT9 c;  2KEN A;  1HNX L;  1NE3 A;  4GN4 B;  2ASB A;  2B29 A;  3G48 A;  1J5E L;  1HZA A;  1I5F A;  3KF8 B;  2AWO A;  1Q82 C;  4LF7 L;  4DR4 L;  4YCW A;  2ALY B;  1KD1 C;  3S1Q H;  3TQY A;  5BR8 L;  3RR5 A;  1VQD A;  1PHJ A;  1VQ8 A;  1E1T A;  4TQU S;  3GD7 A;  2UUC Q;  4JI2 L;  3MXN B;  5GAE C;  1X9N A;  3H15 A;  4PG3 A;  2VQF L;  1Y1V H;  3PIP A;  4HIO A;  1N34 Q;  4OWW B;  1JT8 A;  3D0F A;  3CC2 A;  3CPW A;  1JB7 A;  1L0W A;  1JE5 A;  2LXK A;  2MO1 A;  5M3F H;  2BH2 A;  3PO2 H;  1AE2 A;  4LF8 Q;  2Y0S E;  3J7Z C;  1SE8 A;  2OQK A;  5M3M H;  3J81 c;  1V43 A;  4IFD G;  3W1B A;  1HH2 P;  2ZTC A;  4AH6 A;  2K5V A;  4C2M H;  2OTJ A;  2IT1 A;  4B3M Q;  2F3I A;  1KHI A;  4QL5 A;  1QZH A;  4DR2 L;  1D8L A;  4JI0 Q;  2NVT H;  4GLX A;  4DV0 Q;  3MEF A;  4YWK A;  1XPO A;  4R1J A;  4EX5 A;  3PCO B;  1OXX K;  4L5S A;  3DM3 A;  3KYH C;  3I4N G;  1SMX A;  1HZB A;  4JG2 A;  3WWV A;  1N36 L;  3S16 H;  1IBL L;  3U58 A;  2PI2 A;  1V1Q A;  2AHO B;  2JEB I;  4L5Q A;  4JI8 L;  4LF4 Q;  4A3G G;  2N8N A;  1AE3 A;  2CCZ A;  3EIV A;  3J7A 5;  3M4P A;  4LF5 L;  1GO3 E;  3ULP A;  3I56 A;  3CXC A;  4JI1 Q;  1OXT A;  4DV5 L;  5IP9 G;  4B3R L;  4IPH A;  2YTV A;  1E1O A;  4DR7 L;  4X66 L;  3M9B A;  3RZO H;  4JYA L;  1WCM G;  2A1A A;  2NZO A;  5AJ3 Q;  4YHH L;  2RCN A;  1VS0 A;  3CAM A;  4LFA L;  1YHQ A;  4YY3 Q;  1VQN A;  3PUZ A;  2IX1 A;  5IYC H;  2E5L L;  4GNX B;  1PFS A;  4DV6 Q;  1UEB A;  2XGT A;  4MZ9 A;  2IHE A;  5JJL A;  4DV7 Q;  1HZ9 A;  3OYY A;  3PO3 H;  2QGQ A;  4P72 A;  1X3G A;  2PI2 E;  3PIO A;  4X65 L;  2HT1 A;  2OCE A;  2JK8 A;  4BY7 G;  1GD7 A;  2F4V L;  1QVG A;  4C3H H;  4DR1 Q;  5C0X J;  4NXM Q;  1X3F A;  2ZTD A;  5GAH C;  1HR0 W;  3FHW A;  1PH9 A;  1HNZ Q;  4LF4 L;  1VQ6 A;  4BXX G;  1C0A A;  3AYH B;  3AEV A;  1IYJ B;  3I4N H;  4IO9 A;  1O7I A;  5LMN W;  3RNU A;  4R4C A;  3T1Y L;  1Y1W H;  2HIV A;  3L0O A;  4LNQ A;  4NPS A;  2E2H H;  1XMO Q;  2VL6 A;  4A3G H;  2IX0 A;  2Z6K C;  1HR0 L;  2MFI A;  3CC4 A;  4K0K Q;  2KHI A;  1M1K C;  5IP9 H;  1LTL A;  4B3S Q;  1XMQ Q;  3G6E A;  1WOC A;  4IJL A;  1PV4 A;  3A5Z B;  3S2D H;  4YY3 L;  4JV5 L;  1P16 A;  1HNW Q;  4LW1 A;  1H95 A;  3UDF A;  1TWC H;  4B3T Q;  2WP8 J;  4JOI C;  3GTK H;  1ASY A;  1VQF A;  2WAQ G;  4GLA C;  4JI3 L;  4DV3 Q;  2OWO A;  1FJG Q;  2VUM G;  2F52 A;  4DAY B;  4P75 A;  4DK3 C;  2Q2T A;  3STB C;  1Y14 B;  1G51 A;  2QEX A;  1K8A C;  4NXM L;  3HFZ B;  3KOJ A;  4MNO A;  2XTI A;  4DV2 L;  4A3F H;  4UP7 A;  4BY7 H;  1HNZ L;  4JOI A;  1NTG A;  2LSS A;  1YJW A;  1JJ2 A;  4A3D G;  4IJH A;  4R4I A;  4PMW A;  1OXS C;  1N33 Q;  4BXX H;  4IOA A;  2D0P A;  2A8V A;  4GKK Q;  4LF9 L;  1GKH A;  4POG A;  1E22 A;  1QVC A;  2PQA B;  1PH2 A;  1CKO A;  3KDF A;  2B63 H;  5JEA G;  1CSP A;  5IYD G;  2JEA I;  1JJG A;  1XMQ L;  3STB D;  4OWT B;  5M3M G;  4GN3 B;  3S15 H;  4GNX A;  3TRZ A;  1HNW L;  2VNU D;  3HOV G;  2NZH A;  3M3Y H;  4LFB Q;  1JJC B;  2MO0 A;  3ER0 A;  3RN2 A;  3ICE A;  2UUB L;  5C44 H;  3CMA A;  1SN8 A;  2YU9 H;  3UDX A;  4GKJ L;  3G71 A;  1CKN A;  4A75 A;  4DK6 C;  5C0X I;  2YTY A;  2YV5 A;  4FDB A;  4L5T A;  5IWA L;  2UXC Q;  1C7Y A;  1VQC A;  2VUM H;  5C4J H;  1EFW A;  5EAY A;  5JJK A;  1Q8K A;  2ZM6 Q;  1J6Q A;  5ELO A;  3U4Z A;  4AYB G;  2H5X A;  3BJU A;  1VQM A;  2UXB L;  3CC7 A;  3CP0 A;  2CWP A;  1EOV A;  3CCV A;  4GKK L;  1YHA A;  2YTX A;  4JI6 Q;  3FP9 A;  5DLQ E;  4NXN Q;  4A3D H;  3K7A H;  4GOP C;  1Z9F A;  3ULL A;  1FGU A;  3K7U C;  1QVF A;  4PZ6 A;  3RLF A;  1YZ6 A;  3A74 A;  1VQE A;  1FVI A;  1GVP A;  3M4Q A;  3CCJ A;  1SRO A;  5IYD H;  1VQH A;  4LFB L;  1PH5 A;  1Z47 A;  1NBW A;  5IYC G;  4AQY L;  1X55 A;  3NEL A;  3JAM i;  3F2B A;  1LM0 A;  3HOV H;  1WJJ A;  3HOU H;  3CF5 A;  3T1H Q;  1VQ7 A;  3PO3 G;  4BA2 I;  3NEM A;  4DR6 Q;  2UXC L;  3L7Z C;  2R7D A;  2GN5 A;  1VQ9 A;  1XNQ Q;  5HY6 A;  3K0X A;  1SFO H;  1MKH A;  1YJ9 A;  1P8L A;  4JBW A;  4A3I H;  1Q12 A;  2C35 B;  4GLV B;  4RMF A;  4HJ5 A;  4IFD I;  2K5N A;  4A3M G;  2N49 A;  4OO1 I;  1Y1W G;  2PQA A;  3CCQ A;  1I94 Q;  2E2J H;  3GO5 A;  2JA7 G;  1UWV A;  4JI7 Q;  3TS2 A;  4NXN L;  3F1Z A;  2UXB Q;  2UUC L;  2N3S A;  2NN6 G;  1X65 A;  4UPA A;  1N34 L;  3LGJ A;  2HHH Q;  3UDG A;  1KRS A;  4QJF A;  1YJN A;  2WFW A;  2D62 A;  3PGZ A;  3CCR A;  4LF8 L;  3KDF B;  2PNH A;  1PH8 A;  3KJO A;  1NMF A;  3S17 H;  1WYD A;  4B3M L;  2GVB A;  1KC8 C;  4OON A;  3CW2 C;  2KHJ A;  1K9M C;  4JI0 L;  3HKS A;  4DUZ Q;  1XNQ L;  4DV0 L;  4A3F G;  1MIU A;  1XPU A;  4HJ8 A;  5FLM G;  3ZJY C;  1CKN B;  4IPD A;  3ULJ A;  2VQE Q;  5JEA J;  1MJC A;  2CQO A;  1I94 L;  3CCM A;  2ZJQ A;  5C4X G;  1UE6 A;  4JI7 L;  1KAW A;  4YCU A;  1N32 Q;  3VDY A;  4DV4 Q;  4P71 A;  3J81 i;  4A3M H;  4KHP Q;  4Y7N H;  2B63 G;  1B8A A;  4JI1 L;  1OXU A;  1YIT A;  1A62 A;  1K3R A;  2JA7 H;  2IY5 B;  3GTP H;  4DAM A;  3S1N H;  3AFP A;  4LFC Q;  3E9H A;  4O0A A;  3G4S A;  4JBM A;  3HOW G;  1YI2 A;  4OX9 Q;  3A0J A;  4ME3 A;  2JA9 A;  2WB1 G;  1R9T H;  5AJ3 L;  1EYG A;  2DGY A;  1TWA H;  1IL2 A;  3CCE A;  3IRB A;  5C44 G;  5FJ8 G;  1E3P A;  2AKW B;  4DV6 L;  1A0I A;  1TWG H;  2HIX A;  2BA0 A;  3PUX A;  2Z6K A;  3I2Z A;  4DV1 Q;  5IYB G;  3E9I A;  2K4K A;  2UU9 Q;  4A3B H;  4DV7 L;  1CKM A;  2FXQ A;  5LMU Q;  3B6Y A;  1Q81 C;  1LYL A;  1PH4 A;  4GOP B;  1VQP A;  4UP8 A;  1EIY B;  3TRE A;  1N9W A;  4HID A;  1VQA A;  3OTO Q;  4DR1 L;  1WFQ A;  5FLM H;  4KI0 A;  4LF6 Q;  1X56 A;  2RF4 A;  1IBM Q;  2I5L X;  4HJ7 A;  2ZJP A;  1IBK Q;  2A19 A;  3KJP A;  1VCI A;  1MJE A;  3BU2 A;  3I4M G;  3PSI A;  2KCT A;  5C4X H;  2RHS B;  2MQH A;  1K83 H;  2UXD Q;  1XMO L;  4IFD J;  4X6A H;  4DR5 Q;  3CPF A;  5M5X H;  2KCM A;  1K8G A;  4H02 A;  3GTJ H;  3EN2 A;  1LUZ A;  1VQK A;  4K0K L;  1PH1 A;  2ZJR A;  2E2I H;  4B3S L;  3HKZ E;  1A8V A;  1TXY A;  3HOW H;  2Z0S A;  2I5H A;  4A4I A;  4B3T L;  1HJP A;  4POF A;  3PV0 A;  4C3J H;  4DUY Q;  3GTM H;  3HOU G;  1TWH H;  1KRT A;  4QQB X;  4BA1 I;  2KBN A;  2R92 H;  2R93 H;  2Y0S G;  2YYZ A;  4DV3 L;  4AIM A;  5FJ8 H;  1J5E Q;  2UU9 L;  3AQQ A;  1FJG L;  1VQL A;  1EIF A;  4O2D A;  3PUV A;  1Q1E A;  4DPG A;  1Q1B A;  3TS0 A;  2Q2H A;  1T9H A;  3AFQ A;  5E7N A;  4DR4 Q;  4A3I G;  3CCS A;  4A93 H;  5IYB H;  4HJA A;  4IOC A;  3I4O A;  1EUJ A;  1UE5 A;  3S2H H;  5K36 G;  5BR8 Q;  2R7Z H;  1I3Q H;  4X62 Q;  3W1G A;  3S14 H;  3S24 A;  4JI2 Q;  5IE8 A;  1I50 H;  5C0X G;  2VQF Q;  2EIF A;  3UDI A;  1N33 L;  4JCV E;  3CCU A;  2R93 G;  1UE7 A;  1YNX A;  3I4M H;  4WJ3 M;  1QUQ A;  2HQL A;  2N78 A;  2Q2I A;  2WAQ E;  4QGU A;  1EQQ A;  3I55 A;  1I6H H;  1AH9 A;  1G6P A;  3KF6 B;  3H3V H;  4A3J G;  2DUD A;  2UUA Q;  1PVO A;  2ATW A;  3U4V A;  3DLL A;  1YIJ A;  3K81 C;  4HIK A;  4DR2 Q;  4DUY L;  4HJ9 A;  3OW2 A;  4OWX B;  5H1S E;  5J3B A;  1TWF H;  3D31 A;  3M85 A;  4QIW E;  1L1O C;  1RIP A;  3M4O H;  5GQO A;  4NB3 A;  4GOP A;  5GAG C;  4A3E G;  3NBH B;  3E0E A;  4YCV A;  4BY1 H;  4LWC A;  5ELN A;  4R4T A;  1N36 Q;  5IP7 H;  1IBL Q;  2MNA A;  4A3K G;  4JI8 Q;  3F2C A;  4QY7 A;  3F8T A;  1G29 1;  3GTL H;  3PUW A;  4X62 L;  2ZM6 L;  2JA8 G;  1XJV A;  4LF5 Q;  4OXP A;  3RLN A;  1UE1 A;  1XPR A;  4A3L H;  4DV5 Q;  1L1O A;  5C3E H;  2R6G A;  4B3R Q;  2I0Q A;  2OQ0 A;  1VQI A;  5IY0 A;  2K50 A;  3PUY A;  1B7Y B;  4X66 Q;  1X6O A;  2ES2 A;  4JI6 L;  4DR7 Q;  2GVA A;  1W3S A;  4JC0 A;  4JYA Q;  2K14 A;  1XNR Q;  4IPC A;  4YHH Q;  1X3E A;  4JBK A;  3GTQ H;  1HZC A;  4LFA Q;  4EQ5 A;  2UUA L;  2JA6 G;  1S3O A;  4LUZ A;  4OO1 G;  2E5L Q;  2JJQ A;  2BH8 A;  3BZK A;  1YBY A;  1M90 C;  4MTN A;  2I5M X;  4A3J H;  5HGQ A;  3Q8D A;  1NMG A;  4AYB E;  1KIX A;  4X65 Q;  4A3B G;  2NN6 I;  3L2P A;  2F4V Q;  1YVC A;  3T1H L;  1KXL A;  4Y52 H;  4BBS G;  1Q46 A;  2JA5 G;  4DR6 L;  3BZC A;  2QA4 A;  4R4O A;  5M5W H;  4KLK A;  2VS1 A;  4A3E H;  3CCL A;  2EXD A;  1BBU A;  2IHF A;  1VQO A;  1PH6 A;  2AMC B;  3T1Y Q;  5M5Y H;  4A3K H;  4JBJ A;  1VQJ A;  3GTG H;  4DR3 Q;  4J15 A;  1HR0 Q;  2D0O A;  2JA8 H;  4KHZ A;  4YWL A;  1YEZ A;  2B3G A;  2Q2U A;  1K0R A;  1PH3 A;  2VW9 A;  1E24 A;  1NJI C;  5LMN Q;  3KF6 A;  4JI4 Q;  2CKZ B;  1S72 A;  3GDE A;  1ASZ A;  1VQ5 A;  1XNR L;  1SR3 A;  3TEH B;  4JV5 Q;  1CUK A;  2HHH L;  1XTD A;  3J80 c;  3ERS X;  3H0G G;  2CFM A;  4TVA B;  3FKI G;  4JI3 Q;  4A76 A;  1QUQ B;  4DNI A;  3JC6 6;  4LUO A;  4XIG S;  3HOX G;  3CME A;  1BVS A;  5FLX c;  3RN5 A;  2R92 G;  3F2D A;  2VZA A;  3HKZ G;  1QZG A;  3GTO H;  1C9O A;  3UE0 A;  4WJ4 A;  4A3C G;  4YWM A;  4APV A;  4XTC S;  1D7Q A;  4DV2 Q;  2OTL A;  4DKA C;  4A93 G;  4DUZ L;  4ALP A;  1KQS A;  1FL0 A;  2R7Z G;  4BBS H;  4GN5 A;  2JA5 H;  4BBR G;  1KL9 A;  2VQE L;  1N8R C;  4JI5 Q;  3RLO A;  4DR3 L;  2NVQ H;  4X64 Q;  4LF9 Q;  2JA6 H;  3I7F A;  1BKB A;  4L5R C;  3HOY G;  2JE6 I;  4UY8 C;  3HOZ G;  2E8G A;  2ID0 A;  4DV4 L;  4JI4 L;  1N32 L;  5LMN L;  1JMC A;  2K52 A;  1WI5 A;  2K5H A;  2VY3 A;  3KLW A;  4KHP L;  2JQO A;  2LXJ A;  1L1O B;  2ZTE A;  4LFC L;  1OXV A;  1WCM H;  4OX9 L;  1U0L A;  2AWN A;  3K80 C;  2CWA A;  1IXR A;  3SGI A;  2UUB Q;  2RHQ B;  4GKJ Q;  4PZ8 A;  4C3I H;  1PYS B;  1CSQ A;  1B70 B;  1U5K A;  1PYB A;  3K8A A;  3H0G H;  5IWA Q;  1RL2 A;  1HNX Q;  3U50 C;  3FKI H;  1X54 A;  3UE1 A;  4BY1 G;  1A63 A;  3HOX H;  1W2B A;  3H3V I;  4GS3 A;  3KFU A;  4P74 A;  4LUV A;  4R4Q A;  1S40 A;  1DGS A;  2BA1 A;  4UP9 A;  2PMZ E;  5IP7 G;  4DV1 L;  1K73 C;  2R7F A;  4A3C H;  3A5U A;  3RZD H; 
#chains in the Genus database with same CATH topology
 5GAD C;  4IUU A;  1OTC A;  2FPP B;  1D5Z C;  1PZJ D;  3DM1 A;  1YHB A;  2W71 A;  4IUP A;  4A3L G;  4J9L A;  4B3R H;  4X64 L;  5C3E G;  2NYZ D;  3PW7 A;  1DCZ A;  3S1R H;  1STB A;  4LF6 L;  4JYA H;  1Q86 C;  3ND8 A;  2NVX H;  1EWI A;  5M3F G;  3PO2 G;  3HBL A;  1BGW A;  3RGZ A;  4KD4 A;  4YAJ B;  3NHH A;  5KFC A;  4ECV A;  3K5M A;  5KX5 F;  5IOC A;  5KT2 A;  2K75 A;  1CI3 M;  3SDZ A;  2ICE C;  4AQY Q;  5KRU A;  1DZ1 A;  1TWA B;  3D3R A;  1WR2 A;  1IW7 C;  2D5D A;  1G2T A;  3UFX B;  1UC8 A;  4TQS A;  2XCP A;  5KG2 A;  2H4O A;  3PMF A;  4O4I F;  3FMC A;  1Q82 C;  4LF7 L;  3MFH A;  1EUC B;  4YCW A;  1EY5 A;  2K5D A;  3S1Q H;  2FLL A;  2HGS A;  1HR0 H;  1PHJ A;  3MR5 A;  1G8Z D;  5LMN H;  3GD7 A;  5CV8 A;  3TBI B;  4RAZ A;  3RUP A;  4PG3 A;  5C4X B;  1N34 Q;  2HCI A;  3Q8R B;  1VBG A;  5M5X B;  2D9U A;  2LXK A;  1KLG D;  5A2Q E;  1CE8 A;  1SE8 A;  1HFN A;  2AGP A;  1V43 A;  3PZP A;  3BAA A;  4UAI A;  1HH2 P;  2K5V A;  2OTJ A;  2IT1 A;  3E3X A;  2IMW P;  4C3J B;  1TWH B;  2R93 B;  4JI0 Q;  1PMR A;  4IRD A;  4HSV A;  3MEF A;  5IOD A;  4R1J A;  3PCO B;  3KYH C;  4HNT A;  3I4N G;  1SMX A;  3R23 A;  4JI5 H;  2FFK B;  2ZXO A;  3U58 A;  2VPS A;  2PI2 A;  3CRK C;  2BOS A;  4PWQ A;  4LF9 H;  4H7B A;  4MAM A;  3J7A 5;  3M4P A;  4LF5 L;  4HNV A;  1I50 B;  3ULP A;  4H44 C;  4TV9 F;  4CDD C;  2W7O A;  2ZDG A;  3URY A;  1O78 A;  2A6E D;  3E6Z X;  1EIH A;  4ECR A;  3BG5 A;  1WVL A;  3M9B A;  3RZO H;  2UUB H;  1VKZ A;  1WCM G;  2A1A A;  2NZO A;  1W96 A;  4RGO S;  4LFA L;  1YHQ A;  1X3Q A;  4YY3 Q;  3PUZ A;  1HCZ A;  4J9N A;  1HNX H;  1STY A;  2IX1 A;  2CW8 A;  3IG0 A;  5KFE A;  3GV6 A;  1GJX A;  4ED1 A;  2AGO A;  4IFD H;  3DUZ A;  2XGT A;  5JJL A;  2K5Q A;  2IWH A;  2WII B;  2PI2 E;  3GQB A;  2J7Z A;  3KF8 A;  4IUR A;  2OCE A;  2JK8 A;  2A6H C;  3K5L A;  4Z9C B;  4FF2 A;  2F4V L;  4DR1 Q;  1X3F A;  2F0M A;  2ZTD A;  3VYR A;  4DL4 A;  3DWP A;  5GAH C;  1VQ6 A;  1HNZ Q;  5KFR A;  1DOL A;  3MXN A;  1T3N A;  4LNQ A;  4Q45 A;  2KEC A;  3J7A V;  5F9N A;  5I6Y A;  1STH A;  3GTJ A;  4RUC A;  2GPS A;  4H13 C;  4K0K Q;  2OF1 A;  3BVG A;  1LTL A;  4B3S Q;  4AQY H;  4DA2 A;  1XMQ Q;  3GTQ B;  3G6E A;  5D1P A;  4IJL A;  2EDG A;  2M2L A;  3A5Z B;  4RB2 C;  3GTM A;  2NBF A;  2R8J A;  3LP8 A;  4KV6 A;  1B33 N;  2HDM A;  2WP8 J;  1T36 A;  3BA9 A;  2K04 A;  3GTK H;  1ASY A;  4K5X A;  3DEO A;  4JI3 L;  2OEO A;  4DV3 Q;  4X3T A;  2OWO A;  4RB0 A;  1KC7 A;  4J9K A;  4DAY B;  4ABN A;  4P75 A;  4DK3 C;  5FOB B;  2F0E A;  3TSS A;  1G51 A;  5CV5 A;  1K8A C;  3HFZ B;  4MNO A;  2XTI A;  4UP7 A;  4A3E B;  5FKA C;  3CVZ A;  5KFZ A;  3G7L A;  5D1O A;  5C5J A;  2WTF A;  4JV2 A;  1YJW A;  4A3K B;  2QF7 A;  2DN8 A;  3J7Y W;  1N34 H;  4PMW A;  4HMJ A;  4IOA A;  1BOS A;  3N42 B;  2D0P A;  4LH7 A;  2A8V A;  1D1I A;  3I90 A;  1QVC A;  2PQA B;  1U4P A;  2L0C A;  5D65 A;  5IYZ F;  1EZ1 A;  2OXP A;  3A54 A;  4GN3 B;  4ZKC B;  3TRZ A;  1DV1 A;  3FRP B;  1HNW L;  2ASL A;  3L3O C;  2HD3 A;  2O2L D;  3EFX D;  3GIM A;  3VYS A;  4JI0 H;  3RN2 A;  2JA6 B;  3CMA A;  2YU9 H;  1D6E C;  3NTI A;  2DNE A;  3RTX A;  3G71 A;  1LAB A;  2DJG C;  4IZ8 A;  4XXE A;  4RAY A;  4FDB A;  4K2L A;  5IWA L;  1SNQ A;  2DJF C;  2FE3 A;  1EFW A;  1SE2 A;  3VR5 A;  5FLX W;  2ZM6 Q;  2QEJ C;  3U4Z A;  4AYB G;  5CYU A;  1DYQ A;  3CC7 A;  3GIL A;  5F9L A;  3AB9 A;  2FPI B;  5I6W A;  4NXN Q;  4O4L F;  4A3D H;  3K7A H;  2F0P A;  4G7O C;  1GUG A;  1Z9F A;  5ELF A;  2Z4H A;  2C2R A;  2CW7 A;  1CQJ B;  3RLF A;  3A8I E;  1FNV A;  3HG9 A;  1VQE A;  2A69 C;  1FVI A;  4F7X A;  5LXT F;  4YY3 H;  1SRO A;  5IYD H;  1VQH A;  1PH5 A;  3K0Y A;  4U7C A;  5KG3 A;  3F2B A;  1NUC A;  1PRT C;  3PO3 G;  3T1H Q;  4RHS A;  4DR1 H;  3HOX B;  1DON A;  2UXC L;  3L7Z C;  3H4D A;  2GN5 A;  1VQ9 A;  3C46 A;  1HNZ H;  1SFO H;  1MKH A;  5E1F A;  1P8L A;  2XSC A;  2XWB B;  4ED2 A;  1N56 A;  2K03 A;  4GLV B;  1PLF A;  3A56 A;  2NVY B;  2N49 A;  4OO1 I;  3HGB A;  4J9O A;  1SDF A;  1AZP A;  3CCQ A;  1LT5 D;  1L0X B;  2W6P A;  3P75 A;  4K0K H;  1ML0 D;  3BDO A;  2LFN A;  2UUC L;  4B3S H;  2N3S A;  1XMQ H;  3GLK A;  2L1B A;  1XTC D;  3JRX A;  4KKS A;  4EG0 A;  2VQD A;  1NNX A;  3PW0 A;  1HHV A;  4ZQI A;  2B2V A;  1ULZ A;  1I6H B;  4DV3 H;  5NUC A;  4KK7 A;  3QG1 A;  2OLS A;  1NMF A;  2LMC B;  5KFL A;  2B2T C;  3TZD A;  1K9M C;  3HKS A;  2FLP A;  2W57 A;  2B2U C;  5IT9 W;  4HJ8 A;  5FLM G;  1EU3 A;  1IHZ A;  4DK0 A;  1CKN B;  4IPD A;  3ULJ A;  1B04 A;  3F2U A;  1MJC A;  1CQV A;  2BDN A;  3CCM A;  1ET6 A;  1KAW A;  4YCU A;  1N32 Q;  3VDY A;  1KEE A;  3RUZ A;  4O4H F;  3PIP 3;  2B2U A;  2NTS A;  4KHP Q;  1B8A A;  2JEI A;  5L1L A;  1A62 A;  1JDE A;  1WCM A;  1YI2 A;  4OL7 A;  1MHW C;  3BVM A;  4ZUJ A;  2WB1 G;  1VF5 C;  3FMA A;  1TWA H;  1IL2 A;  3NBH A;  3IRB A;  4MV6 A;  1AP0 A;  5L1I A;  2VA2 A;  2V5A A;  1BBX C;  2AGQ A;  1WD0 A;  3HKZ A;  2BA0 A;  5G3L F;  4KY6 A;  5DG9 A;  3E9I A;  2K4K A;  2UU9 Q;  2ZM6 H;  4DV7 L;  5KFT A;  5KT7 A;  2FXQ A;  5LMU Q;  2JYO A;  3B6Y A;  1PH4 A;  5JH7 F;  3CQZ A;  4LSA A;  3OTO Q;  1E4E A;  4ED3 A;  1WFQ A;  4KI0 A;  1OO9 B;  1SNO A;  4ZOL F;  4EVO A;  1YNN D;  1S10 A;  3QO2 A;  5CB4 F;  1MZB A;  5BPF A;  2KCT A;  5KYI A;  4ECX A;  3C1F A;  5C4X H;  2RHS B;  1KJQ A;  5KFS A;  4IR1 A;  2EYF A;  4H0L C;  1XMO L;  3Q23 A;  4DR5 Q;  5M5X H;  1ESR A;  1ILQ A;  5KFH A;  2FB9 A;  1LUZ A;  1LTI D;  1VMP A;  4O42 A;  5IGD A;  1RF2 D;  2I80 A;  2ZJR A;  3HKZ E;  1A8V A;  5KFM A;  2R87 A;  2Z0S A;  3T1H H;  5DQH A;  2GA4 B;  3MWE A;  2NUA B;  4C3J H;  3NPP A;  1LTR D;  4XQJ A;  4DUY Q;  2V59 A;  1TWH H;  4QQB X;  2R93 H;  4BA1 I;  3JSL A;  2Y0S G;  5IGC A;  3PIO 3;  5FJ8 H;  1J5E Q;  1FJG L;  2I87 A;  2PZU A;  1EIF A;  3T5J A;  2Q2H A;  1T9H A;  5E7N A;  1ZHS A;  3N41 B;  4A93 H;  5IYB H;  2SDF A;  4HJA A;  3I4O A;  2F03 A;  3RF2 A;  4K6D A;  5BR8 Q;  2M05 A;  1SE4 A;  1CQI B;  3S24 A;  2F0Q A;  1I50 H;  1PYW D;  3Q2O A;  5KFX A;  1I4R A;  2E2H B;  1TT2 A;  4A3G B;  4JCV E;  1B9N A;  1UE7 A;  1KNE A;  4HTH A;  2N78 A;  3GV3 A;  3I55 A;  3KF6 B;  3H3V H;  4A3J G;  1QJO A;  1PVO A;  1XXG A;  2FK1 A;  2KHS A;  4A3C H;  1AFP A;  2W6Z A;  2XCL A;  3OW2 A;  4OWX B;  3OHA A;  3NGD A;  3D31 A;  4GOP A;  1MBY A;  2L4N A;  4JV0 A;  1K8O A;  1HFG A;  3EVQ A;  5ELN A;  4AYB A;  2HCC A;  4JI8 Q;  3F2C A;  5DM7 3;  1F9S A;  1BCP D;  1STG A;  1N32 H;  3PUW A;  4C1N I;  1JXL A;  3KHG A;  4E4T A;  4KHP H;  2A5H A;  3EPI A;  2R6G A;  1B53 A;  1A2U A;  2I0Q A;  4MN3 A;  3NWT A;  2K50 A;  2PW5 A;  4DXG A;  3E5S A;  4DR7 Q;  4R8U B;  4JI6 L;  2F0N A;  4J9P A;  4K6L A;  1I7N A;  1PTO D;  1Y8O B;  1NAP A;  4J9M A;  4ODG A;  3GTQ H;  1HZC A;  4EQ5 A;  2E76 C;  1V1P A;  3S15 B;  5JQW A;  4LUZ A;  2DIK A;  1RK6 A;  2E5L Q;  2JJQ A;  1M90 C;  1E2Z A;  5JPN C;  3M3Y B;  4MTN A;  4ZCK A;  3R5F A;  1H9S B;  5C44 B;  1FKA H;  1A15 A;  2YYA A;  3LWB A;  4F50 A;  2UU9 H;  2R8K A;  1FNU A;  4AYB E;  4A3B G;  2NN6 I;  5LMU H;  3G6X A;  1KXL A;  4BBS G;  5C5L A;  1DJR D;  2JA5 G;  3OTO H;  2W6M A;  1QWY A;  4KLK A;  1JIC A;  2G9D A;  4A3E H;  3U9S A;  3G6V A;  4R8N A;  2NU6 B;  5ELE A;  4A3K H;  1Z2N X;  2E74 C;  3I4L A;  2XGQ A;  2W9C A;  4QIW B;  4DR5 H;  2B3G A;  1EIG A;  4CDF C;  2Q2U A;  1R9T A;  1K0R A;  4JI4 Q;  1E24 A;  2UXB L;  1ASZ A;  1VQ5 A;  4CDC C;  1EL0 A;  4JV5 Q;  2HHH L;  2ASJ A;  1K8M A;  4DUY H;  3ERS X;  1GHK A;  4IUQ A;  4HR7 A;  2EZV A;  4C5C A;  4TVA B;  3FKI G;  3VA5 A;  2KUM A;  2JA6 H;  3CRL C;  2F3V A;  4OO1 H;  1J5E H;  1EY9 A;  1BVS A;  1EYC A;  4LMQ D;  5FLX c;  2R92 G;  2VZA A;  4WJ4 A;  4A3C G;  3Q24 A;  3RMH A;  3SK5 A;  4DV2 Q;  2RSO A;  2OTL A;  2CZG A;  5BR8 H;  2F0W A;  4DUZ L;  1LTG D;  3N6X A;  4ALP A;  3GV5 B;  1FL0 A;  3T5H A;  4A3I B;  4ZKB B;  4RKL A;  1K83 A;  2VQE L;  2PMZ A;  2NVQ H;  4KHV A;  4UY8 C;  2E2I A;  5LMN L;  2K5H A;  2VY3 A;  5CV7 A;  2PPB C;  3JSN A;  3KAK A;  2JQO A;  2LXJ A;  1N48 A;  1GUS A;  2WB1 A;  3N44 B;  5KG6 A;  1S5B D;  2RGV A;  3MXU A;  5E4W C;  1OXV A;  1SNC A;  4XDX A;  1WTO A;  1G2S A;  4UCU A;  2R6F A;  1U0L A;  4ETS A;  1IXR A;  2HVS A;  2RHQ B;  4GKJ Q;  4IUN A;  1B70 B;  1PYB A;  3TP8 A;  1WTV A;  4KJO A;  3HOX H;  5KKN B;  1QCB D;  4JI8 H;  3MFY A;  3KFU A;  2L11 A;  2PMZ E;  5JJK A;  5KG0 A;  2HVQ A;  3QIA A;  3GIQ A;  1H9K A;  3CD6 A;  2RDI A;  3OSP A;  5CA0 F;  5KFF A;  4GNX C;  3PF5 A;  1VQB A;  4P73 A;  1E7Z A;  1II3 A;  2NVY H;  4JI5 L;  5KG1 A;  2RDF A;  4DR7 H;  2K32 A;  1SLJ A;  2WB1 E;  3EBE A;  1B9M A;  3K58 A;  1IBM L;  3OWE B;  2O03 A;  3SK4 A;  4Y7N B;  2B2W C;  3D4D A;  2JA7 B;  4O2A F;  3GTP B;  2UXD L;  2E5L H;  5GRO A;  1CHQ D;  1V9P A;  1ENF A;  4V0B A;  3OHX C;  1EWC A;  3SE0 A;  1L2F A;  2YL2 A;  3PF4 A;  3NEN A;  2B39 A;  4RG1 A;  5IT9 c;  2W8K A;  2MHV A;  2Y0S A;  1HNX L;  2B2W A;  1KBL A;  3R5X A;  3WO1 A;  2AQ3 B;  3GTL A;  3TQ1 A;  2B29 A;  3G48 A;  1DD2 A;  1HZA A;  4MV1 A;  1I5F A;  3KF8 B;  5EKL A;  4EBE A;  2ALY B;  3ERO A;  4J9S A;  3TQY A;  3VYT A;  4F4Z A;  5KNB A;  1RTO A;  4M1U B;  4WBN F;  1VQ8 A;  1IW7 D;  4JI4 H;  2YCH A;  2EYH A;  4QUF A;  3MXN B;  1X9N A;  3MZ5 A;  1HTL D;  3PIP A;  4HIO A;  4JV5 H;  2KCC A;  3CC2 A;  2VUG A;  1L0W A;  4EGV A;  1JE5 A;  1SNP A;  3GTJ B;  5EGT A;  2BH2 A;  2Y0S E;  3GIJ A;  3J7Z C;  4UHV A;  1RDP D;  4IFD G;  1EYD A;  3W1B A;  3D6C A;  1KJ9 A;  4AH6 A;  3OOC A;  1CK1 A;  4B3M Q;  3GTM B;  1RJQ A;  3K3P A;  2FPG B;  2R7M A;  4DR2 L;  4DV2 H;  4EEY A;  2YRX A;  1LT6 D;  5LL6 b;  4DV0 Q;  3L4K A;  1OXX K;  3I70 A;  2X69 A;  2KEE A;  3MEH A;  4JG2 A;  1N36 L;  4YBZ B;  3V6J A;  1I3Q B;  5TSS A;  2N8N A;  1AE3 A;  3S14 B;  3I12 A;  4I4T F;  3FPU B;  5D1O B;  4UCS A;  2UVR A;  4DV5 L;  1OXT A;  5C1O A;  2NU7 B;  3PN1 A;  1WTP A;  1KNA A;  5IGE A;  1SJE D;  1PTO H;  4X66 L;  2V4D A;  2XWJ B;  4GKJ H;  1KDA A;  3GTO A;  2CVR A;  3P1H A;  4YHH L;  2RCN A;  1HUM A;  1VQN A;  1Y8P B;  3VPD A;  2YW2 A;  2J0T D;  2WKD A;  1SMY C;  5IYC H;  1T94 A;  1JE4 A;  4DV6 Q;  1KAA A;  3PW4 A;  5KEE A;  4LK1 C;  4PMC A;  3ONA B;  1TWF B;  3HP3 A;  1I7L A;  2JA5 A;  1X3G A;  4O3N A;  3PIO A;  4X65 L;  5C0X J;  4NXM Q;  1E4G T;  2MJ8 A;  1HR0 W;  1PH9 A;  1SFO B;  4KJN A;  4K2K A;  3AEV A;  5EPK A;  2O4X A;  5KFO A;  2IW3 A;  5LMN W;  3RNU A;  3T1Y L;  5C3E B;  3HEJ A;  4NPS A;  3H6M A;  2E2H H;  4A3G H;  2Z6K C;  2H1E A;  1NR4 A;  2MFI A;  4OIK A;  2NN6 H;  3TN2 A;  2DPI A;  3BQ0 A;  1M1K C;  2W9B B;  2A6H D;  5IP9 H;  1TAE A;  4I55 F;  3M4Y A;  1PV4 A;  4RH6 A;  2DPJ A;  1AN8 A;  4YY3 L;  1BNZ A;  5EZY F;  1H95 A;  4B3T Q;  4JK1 C;  2R92 A;  1LTA D;  5JOB A;  4JOI C;  4BS9 A;  4J6H A;  1H9J A;  3E0J A;  1Y8N B;  4ID6 A;  4O3Q A;  5I9O A;  5EPL A;  4U6P A;  1D1K A;  1U4M A;  4FP5 D;  3STB C;  5M5W B;  1XDN A;  3Q8S B;  4F4Y A;  2QYZ A;  1HNZ L;  2NVX A;  4TUY F;  2K33 A;  1S5D D;  2QDB A;  4JOI A;  4RGT A;  2EPB A;  2MUY A;  4O1N A;  1LTB D;  4A3D G;  4IJH A;  1UAP A;  4J9R A;  1OXS C;  4BXX H;  5FK9 C;  1LTS D;  2JA8 B;  1LT4 D;  4GKK Q;  4ME6 A;  4POG A;  1IKL A;  5IGF A;  4XX0 B;  1CKO A;  5JEA G;  2JEA I;  5IYD G;  2HJW A;  4YJ2 F;  1JJG A;  5DLF A;  1XMQ L;  3BA8 A;  5EWG A;  4OWT B;  5M3M G;  3S15 H;  2R86 A;  1DXM A;  4B3M H;  3NXW A;  3OW7 A;  3QR8 A;  3M3Y H;  4X3K A;  1JJC B;  3ER0 A;  3KXY T;  2KCN A;  3ICE A;  3N8D A;  5C44 H;  4DV0 H;  5I2Y A;  4J8Q A;  3Q0A A;  1ZYR D;  4DK6 C;  3HB9 A;  3A7A B;  4L5T A;  3RD4 A;  3K5H A;  4KD3 A;  1ICW A;  4A2A A;  5JVL A;  1VQC A;  2ZJT A;  5KFY A;  3RB6 A;  4EQO A;  4C5A A;  5BN4 A;  2VA3 A;  4YQW A;  3H91 A;  1VQM A;  2VPQ A;  5ELD A;  1AZQ A;  5DGA A;  4PMB A;  4BWG B;  1FGB D;  5FLX L;  3HRZ C;  2AQ4 A;  5DLQ E;  4QB4 A;  1UNN C;  1FGU A;  1PZK D;  4IAL A;  4QW8 A;  3WOE A;  4PZ6 A;  1YZ6 A;  3E5N A;  2V9W A;  1WTR A;  3V4S A;  4DV6 H;  5JAV A;  4CJ2 C;  4ED0 A;  4RKB A;  4C3I B;  2FK3 A;  3RAQ A;  5BN5 A;  2QK4 A;  1PFB A;  3H0G B;  1JOO A;  5CC4 A;  3HOU H;  4OGQ C;  4NXM H;  3OPO A;  3NBI A;  3TP7 A;  2ZT9 C;  2R7D A;  1XNQ Q;  1S5E D;  3HKZ B;  1B6S A;  4FNF A;  2A69 D;  2MP1 A;  3SK6 A;  4A3I H;  1Q12 A;  2C35 B;  4HJ5 A;  2FJ2 A;  2JSO A;  3AU7 A;  4A93 B;  1Y1W G;  2F0F A;  1I94 Q;  1E4E B;  1UUP A;  3JAM W;  4BBR B;  5D3I B;  2W6N A;  1UWV A;  3TS2 A;  4NXN L;  4WOR A;  4DFA A;  1X65 A;  3S1M B;  3HOY B;  1KRS A;  3HOZ B;  4B3T H;  1CZW A;  3IL8 A;  3K3V A;  4LF8 L;  3KDF B;  4HED A;  1F9R A;  3KJO A;  2AUJ D;  4RB3 C;  3HS0 C;  2W6O A;  1A3U A;  1S5F D;  2A74 C;  4O3R A;  2AQ2 B;  2GVB A;  1KC8 C;  5C1P A;  2I8C A;  4A3F G;  3SE7 A;  3H09 A;  1STN A;  2PVP A;  5JEA J;  5KFN A;  4GKK H;  2CQO A;  5C4X G;  2ZJQ A;  1PK8 A;  5T14 A;  5IT9 L;  4R7R A;  3R5H A;  4DV4 Q;  1S9F A;  4Y7N H;  2B63 G;  1Y1V B;  4JI1 L;  2IX3 A;  2JA7 H;  5HUR A;  3GTP H;  4DAM A;  1SYB A;  5J1Z A;  3G4S A;  3GTK A;  3A0J A;  4ME3 A;  2L55 A;  4CKC A;  5AJ3 L;  1EYG A;  4QMG A;  3CCE A;  1TY0 A;  5FJ8 G;  4DU9 A;  1WTH A;  2HIX A;  3J81 W;  4DV1 Q;  5IYB G;  4O2B F;  4X62 H;  5KG5 A;  2F0J A;  4I7Z C;  1I4G A;  1V51 A;  4GOP B;  3DMU A;  1EIY B;  3BAB A;  3TRE A;  1N9W A;  3IN5 A;  1VQA A;  2J4X A;  1K1Q A;  3BYY B;  4ZRZ A;  3TIN A;  4LF6 Q;  5G3L D;  3JRW A;  1A3T A;  1AEX A;  5C6A A;  3KJP A;  1VCI A;  1MJE A;  2C00 A;  3BU2 A;  3PQI A;  3PSI A;  3RBE A;  2MQH A;  1ZKO A;  2EYP A;  5AFW A;  2WDT A;  1Z2O X;  1I4P A;  3GTJ H;  1TS5 A;  1PH1 A;  3T13 A;  1ZEQ X;  2L12 A;  2B2Y C;  1V1P B;  2SNS A;  3KBX A;  4A4I A;  4WD3 A;  1HJP A;  3GTM H;  4RFB A;  1KRT A;  3FDT A;  3T5K A;  1XNQ H;  4HNU A;  3PO3 B;  2UU9 L;  3AQQ A;  3C1E A;  1RKN A;  3PUV A;  1RJT A;  5H80 A;  1Q1B A;  3AFQ A;  3MWM A;  4C3H B;  3TP6 A;  1WD1 A;  3M4I A;  3KBG A;  1EUJ A;  1KTK A;  2B2Y A;  3Q22 A;  5EWE A;  3N43 B;  1I94 H;  1I3Q H;  2F0T A;  3S14 H;  5IE8 A;  2A68 D;  2RDJ A;  1H9M A;  1JCK B;  1SAP A;  2NVQ B;  1N33 L;  1B6R A;  3RB4 A;  3KUP A;  2W9C B;  1YNX A;  3V6K A;  4WJ3 M;  1QUQ A;  4J0M A;  1G6P A;  4Q0Y A;  4C2M A;  3KAJ A;  4I65 A;  3MWY W;  4TKO B;  3DLL A;  4JW0 A;  4HIK A;  4DUY L;  4HJ9 A;  2DY7 A;  1TWF H;  3R2I A;  5J39 A;  3OMC A;  1L1O C;  3SR1 A;  3Q1K A;  4NB3 A;  4A3E G;  4BY1 H;  1TKW B;  3K5I A;  1EEI D;  4R4T A;  4WRD A;  5IP7 H;  4TSS A;  1I6U A;  1EOT A;  4A3K G;  3AMU A;  1PRT F;  4BY7 B;  4DV4 H;  4LF5 Q;  4XQN A;  3NWS A;  4A3L H;  2CW0 D;  2ZXR A;  2R85 A;  1GLV A;  1L1O A;  5C3E H;  1JIH A;  4YR3 A;  5IY0 A;  1VQI A;  3PUY A;  1UEA B;  2WAC A;  2PZW A;  4KN7 C;  2K14 A;  4I7A A;  3NP8 A;  4RB1 A;  2WKC A;  1X3E A;  4LFA Q;  2JA6 G;  5DQG A;  2PYK A;  4OO1 G;  2BH8 A;  1YBY A;  3N6R A;  2FK2 A;  4PQX A;  5KFA A;  2VB3 X;  1M0T A;  2F0U A;  4DV1 H;  3I8Z A;  4XZ3 B;  4YB8 B;  3IFD A;  1NMG A;  1KIX A;  4MTK A;  3L2P A;  2F4V Q;  1YVC A;  2C5C A;  3OUZ A;  2UVV A;  2WAQ B;  3OWF A;  1V8Q A;  4DR6 L;  3BZC A;  4F4W A;  2VUM B;  1BQQ T;  1XWE A;  4R4O A;  5M5W H;  1NCV A;  2VS1 A;  5C4J B;  3CCL A;  2R84 A;  1HA6 A;  4LF6 H;  2JEF A;  5FPR A;  1Y1W A;  4KTA A;  4PNY A;  5DLG A;  1VQJ A;  4DR3 Q;  4J15 A;  1KJI A;  2D0O A;  2JA8 H;  4KHZ A;  4YWL A;  1YEZ A;  3WDN A;  2B2T A;  1Q8I A;  1JB3 A;  2VW9 A;  4JI7 L;  4DL5 A;  2CKZ B;  4ZI7 F;  1ZXT A;  1SR3 A;  3TEH B;  1B2T A;  2JP1 A;  4MA5 A;  4CKE A;  1TWC A;  1CUK A;  4GC7 A;  1XTD A;  2E75 C;  2HVR A;  2F0I A;  5EKK A;  2N55 A;  4DK1 A;  5FLX E;  4A76 A;  4JI3 Q;  3Q8P B;  4LUO A;  3HOX G;  1RJR A;  1VAJ A;  5DM6 3;  4DNT B;  3F2D A;  1QZG A;  3HOV B;  1EUD B;  2EJG C;  3A8K E;  3TIG A;  2Y0S B;  3KK7 A;  1SCU B;  4XTC S;  1D7Q A;  2RDH A;  4YJ3 F;  2RCF A;  3RAX A;  1O7Z A;  1AUV A;  2AQ1 B;  2R7Z G;  4GN5 A;  5EBD A;  2FKL A;  1N8R C;  4G7Z C;  1BCP B;  3RLO A;  3RBD A;  2TSS A;  2E2J B;  3I7F A;  2B63 A;  1BKB A;  3G6J B;  2JE6 I;  3V05 A;  2E8G A;  3VR6 A;  4JI4 L;  5EBC A;  4O3S A;  1WI5 A;  5KFG A;  3OHB A;  4LFC L;  1PTO B;  1WCM H;  4OX9 L;  2DWC A;  2PN1 A;  2AWN A;  3GID A;  3RFC A;  3OIP A;  4C3I H;  2PBZ A;  5M9O A;  3H0G H;  1SXT A;  5IWA Q;  4MA0 A;  4O3O A;  5DEH A;  1X54 A;  1UNS A;  1A63 A;  3H3V C;  4R4Q A;  3RV3 A;  2R7F A;  1I50 A;  2B8F A;  1LAC A;  4LF5 H;  3JAM c;  1I4Q A;  4CGY B;  5T1I A;  3QZ8 A;  3M9M B;  3CQZ H;  3J80 i;  1VQ4 A;  1SE3 A;  3W5O A;  4BBR H;  1U4L A;  1EQV A;  1DOM A;  1EWH A;  5COY A;  4A3M B;  1IBK L;  1UC9 A;  1ROD A;  1B50 A;  2EYJ A;  4LFA H;  3S1M H;  3S1N B;  3NQI A;  2EE1 A;  3HOY H;  4Q44 A;  2EY2 A;  3HOZ H;  3MR2 A;  2IPK D;  3M7N A;  3C0F B;  1VDZ A;  2XN9 C;  5IT9 E;  1STE A;  1PH7 A;  1SSO A;  4DL7 A;  1MGS A;  1BXR A;  2F4V H;  1R4Q B;  3SEB A;  5ISR A;  1NE3 A;  1F2Z A;  1GSA A;  1S4Z A;  5FO7 B;  2ASB A;  4CKB A;  3MXP A;  4ME5 A;  4WJW A;  2AWO A;  4DR4 L;  4DR3 H;  1TS2 A;  1S0N A;  2R61 A;  2IA6 A;  3KLS A;  3RR5 A;  4ZHQ F;  1EY0 A;  1E1T A;  4K8J A;  1V1O A;  4QW9 A;  2UUC Q;  3GTQ A;  4JI2 L;  5LL6 X;  5GAE C;  2VQF L;  4LAA A;  1Y1V H;  3CPW A;  2HT1 A;  4RUA A;  2MO1 A;  4N8F A;  1DM0 B;  1XX8 A;  2J9G A;  4JI3 H;  3I73 A;  5DG8 A;  1LV9 A;  3J81 c;  5KFP A;  4DAY A;  3R93 A;  1CS0 A;  4CDE C;  3HOW B;  2ZTC A;  3NK9 A;  2F3I A;  1ENA A;  4QL5 A;  3BZD B;  1D8L A;  2NVT H;  2R92 B;  1F2L A;  4GLX A;  2G5D A;  4YWK A;  1XPO A;  4EX5 A;  3QB3 A;  1BNC A;  4IHJ F;  4GC6 A;  3DM3 A;  4E6I A;  4RWS C;  1HZB A;  3WWV A;  1IBL L;  1V1Q A;  2AHO B;  2DLN A;  3BJY A;  4LF4 Q;  3N40 P;  5CV6 A;  4A3G G;  2CCZ A;  3X3M A;  1O7Y A;  1GO3 E;  4NDX A;  1QB5 D;  2EYL A;  2TMP A;  4CJ0 B;  4NW2 A;  3CXC A;  4RAU C;  5IP9 G;  4B3R L;  5EDW A;  1HUN A;  4IPH A;  2ZXP A;  4IUV A;  1E1O A;  3I4M B;  2AU0 A;  5C3X A;  2CQA A;  1MI2 A;  1F9P A;  1ICF B;  4HSP A;  4JYA L;  4M9U A;  3DF7 A;  3GV7 B;  3EPG A;  1TU2 B;  1VS0 A;  3GIK A;  1I6V C;  5IWA H;  4IZO A;  2FP4 B;  4EYH B;  1L0Y B;  1TWG A;  3KHR A;  1PFS A;  3MWD A;  4X3U A;  5LA6 F;  3MFI A;  1FR3 A;  3GP7 A;  1HZ9 A;  4DV7 Q;  3PO3 H;  3M4O B;  4P72 A;  3HOU B;  4L1K A;  2RDG A;  1TII D;  4C3H H;  4IRK A;  4ECW A;  3FHW A;  4BXX G;  5KG4 A;  4DXF A;  2JEG A;  1JC7 A;  2K01 A;  1O7I A;  1G6Z A;  4R4C A;  1SMY D;  1NR2 A;  1DOK A;  3L0O A;  1XMO Q;  2IX0 A;  1HR0 L;  1ESF A;  2K28 A;  1JLL B;  3V4Z A;  2KHI A;  4RGM A;  2Z8L A;  2WIN B;  1P16 A;  3IKJ A;  4LW1 A;  4KKT A;  2UXC H;  1KJ8 A;  2EYM A;  4ZUI A;  1VQF A;  5DGB A;  4UFZ A;  1TR5 A;  1GXD C;  1FJG Q;  5T1G A;  2ZDH A;  5LP6 F;  1QNK A;  2F52 A;  2NVY A;  5JVD F;  2F4I A;  1Y14 B;  2QEX A;  4NXM L;  2R7Z A;  3TZU A;  3KOJ A;  1V4Y A;  4BY7 H;  3DWA A;  5FO8 B;  1NTG A;  3R2T A;  2UUC H;  1O75 A;  3L9A X;  3GQC A;  4R4I A;  4FS1 A;  4LF9 L;  3V96 A;  5CBA E;  1CSP A;  1Y69 U;  4CJ1 B;  3STB D;  4F8M A;  1EFI D;  1GUN A;  1CZG A;  2FHT A;  5KT4 A;  4GNX A;  2NZH A;  4LFB Q;  4EYI B;  5LL6 S;  2UUB L;  5D14 A;  3UDX A;  2I07 B;  1AN7 A;  4MTD A;  4EBC A;  4A75 A;  1CKN A;  1EZ6 A;  5C0X I;  3MR3 A;  3J80 W;  2CHB D;  1PXU A;  2YTY A;  2YV5 A;  1AUX A;  3LML A;  3EQL C;  5GON F;  4TV8 F;  3DWQ A;  1EZ8 A;  3M9N B;  1C7Y A;  3W3A A;  2VUM H;  5C4J H;  4LF4 H;  4APM A;  4ZQ3 A;  5ELO A;  2LY7 A;  4TQR A;  1M8A A;  2BQR A;  1VF7 A;  3A8J E;  5JVH 3;  3BQ2 A;  3BJU A;  1GUO A;  3CP0 A;  2CWP A;  1M7J A;  4GKK L;  1YHA A;  3OMG A;  2YTX A;  4JI6 Q;  1HA5 A;  3ULL A;  3I91 A;  1BCP C;  3WOF A;  1LT3 D;  1IYU A;  2NZ1 D;  3A74 A;  2ATL A;  2PW7 A;  4FBU A;  3M4Q A;  3CCJ A;  1CM9 A;  1B44 D;  3ETH A;  4HMI A;  2R7L A;  2ENB A;  3R3O A;  4AQY L;  4DV7 H;  1X55 A;  3JAM i;  1LM0 A;  4J1M A;  3HOV H;  1PTO C;  1WJJ A;  1Z7T A;  5HV6 A;  4RNN A;  1JQY D;  3NEM A;  4A2B A;  1GGO A;  3DEP A;  2P0A A;  1TS3 A;  5HY6 A;  3K0X A;  3T16 A;  1YJ9 A;  4JBW A;  4IFD I;  5CBE E;  4LH6 A;  2K5N A;  4RZQ A;  1XMO H;  1YNJ C;  2E2J H;  2JA7 G;  3ETJ A;  2UXB Q;  1GHJ A;  4UPA A;  1N34 L;  2HHH Q;  4KY5 A;  4QJF A;  4J9Q A;  2V4R A;  1YJN A;  3JAM L;  1RHP A;  3UQ8 A;  3GTG A;  3CCR A;  2PNH A;  1FJG H;  3IFT A;  1RJP A;  2CQY A;  1HRJ A;  4DL2 A;  2K05 A;  3EA6 A;  4PV1 C;  1FYC A;  4OON A;  3CW2 C;  2KHJ A;  2A73 B;  1TQO A;  2HQE A;  1JWM D;  4RA8 A;  4DUZ Q;  1EY8 A;  3ITP A;  4JI0 L;  1XNQ L;  1OWT A;  4UCO A;  2PQE A;  2WV6 D;  5C5M A;  4FF1 A;  3ZJY C;  4BY1 B;  4UCR A;  1ONL A;  4DN4 M;  2VQE Q;  2XIG A;  2SOB A;  1I94 L;  2SNM A;  1UE6 A;  2F0O A;  2ICI A;  2KVM A;  3T53 B;  1S97 A;  2RBM A;  5KFV A;  1F2Y A;  3J81 i;  4A3M H;  4FBT A;  4G3I A;  4EGJ A;  1I4X A;  1W93 A;  1OXU A;  2L9H A;  4OEM B;  1YIT A;  1JOQ A;  3S1N H;  2SEB D;  3BYT B;  3AFP A;  1F2M A;  5E4X A;  4O0A A;  4JBM A;  1A6X A;  5M3F B;  4LFB H;  3FPP A;  3PO2 B;  2WYO A;  2JA9 A;  2NB0 A;  2XGP A;  2DGY A;  2NUC A;  4C2M B;  3FKI A;  1D5X C;  4RCO A;  2AKW B;  5A2Q W;  3SHL A;  1SYC A;  2B8G A;  1A0I A;  2CH4 W;  2Z6K A;  3I2Z A;  2GLT A;  4A3B H;  5FD6 A;  2KA7 A;  4K14 A;  3HXL A;  1EHI A;  1LYL A;  2BDO A;  3VYU A;  4UP8 A;  1VQP A;  4HID A;  4CBV A;  3J81 L;  2PZT A;  4DR1 L;  3S16 B;  3PR5 B;  3R8B A;  2Z6B A;  4R8U A;  4JI6 H;  2R3Z A;  1X56 A;  2RF4 A;  3CU7 A;  2I5L X;  4B9W A;  2ZJP A;  1IBM Q;  5K2M A;  1M4V A;  2UXD Q;  4IFD J;  4X6A H;  4KMU C;  4FVM A;  4H02 A;  1B1Z A;  1H9S A;  1VQK A;  4K0K L;  4B3S L;  4IAJ A;  2FIN B;  5KFW A;  4RGN A;  1BDO A;  3HOW H;  3VA7 A;  2I5H A;  1LLR D;  3PV0 A;  2YS6 A;  3NUC A;  5CAE B;  5CA1 F;  4RU9 A;  2R92 H;  2YYZ A;  3NQT A;  4DV3 L;  4AIM A;  2GPW A;  3JZI A;  2EJM A;  4O2D A;  4PDB A;  1Q1E A;  4JVZ A;  4DPG A;  5EQ0 A;  1WTX A;  4QIW A;  1WTQ A;  4IOC A;  3NE5 B;  3SI8 A;  1UE5 A;  3A7L A;  4X62 Q;  1VMC A;  3W1G A;  3I4N B;  2UXB H;  1Y1W B;  1Z2P X;  2EIF A;  2HHH H;  4MIU A;  2F0L A;  2K5W A;  2AUK A;  4O3P A;  3VPC A;  3I4M H;  2BQU A;  2HQL A;  2Q2I A;  2C9O A;  4HAE A;  4QGU A;  2OT2 A;  5CGK A;  4WFN 3;  2UUA Q;  2DUD A;  4Y8V B;  4FF3 A;  3U4V A;  2CH4 A;  3S2D B;  5J22 A;  4MV7 A;  1TWC B;  2Q8R E;  1A2T A;  1YIJ A;  1WCM B;  3MC0 B;  4DR2 Q;  5H1S E;  4DUZ H;  1SNM A;  3M85 A;  1T5E A;  4QIW E;  3H40 A;  1RIP A;  1K3B C;  2KJX A;  3M4O H;  3CHB D;  3MA2 B;  3D4R A;  3NBH B;  4YCV A;  3KTM A;  1J8I A;  3OSN A;  2VQE H;  4LWC A;  5EPJ A;  1N36 Q;  2JXM B;  2MNA A;  4EQP A;  4A3F B;  4QY7 A;  1G29 1;  3HZX A;  2RA4 A;  4G4K A;  2E2D C;  2ZM6 L;  1XJV A;  2JA8 G;  2RKS A;  3RLN A;  4FXD A;  4DV5 Q;  5KT3 A;  1BO0 A;  3T4A C;  5K36 H;  3CQZ B;  1T5X D;  1SEI A;  2MCT A;  2OQ0 A;  1SBB B;  1B7Y B;  4X66 Q;  1X6O A;  5C0X H;  2ES2 A;  2B63 B;  1CA6 A;  4JC0 A;  3ORQ A;  1QNU A;  1PRT D;  1XNR Q;  3K5N A;  4YHH Q;  4JBK A;  3H20 A;  4FM9 A;  1S3O A;  1IOV A;  4NKL A;  3BZK A;  1I4H A;  4XYQ A;  1RTN A;  1WH2 A;  2I5M X;  2X0S A;  5HGQ A;  3Q8D A;  5KYL A;  3WO0 A;  4Q43 A;  1E4F T;  4X65 Q;  3I72 A;  2JEJ A;  3LWU A;  3T1H L;  2M9V A;  4Y52 H;  2C22 A;  5KFJ A;  4ECQ A;  2QCP X;  2BE5 C;  1IBM H;  5J2T F;  1BBU A;  4DGZ A;  3MVV A;  1VQO A;  1PH6 A;  2YZN A;  2FMA A;  5JPM C;  1ZET A;  3T1Y Q;  2JA7 A;  4JPB W;  4NMZ A;  2W7P A;  2UVW A;  3GTP A;  2UXD H;  4Q8F A;  1QG7 A;  2P5Z X;  2ZDQ A;  1PDQ A;  1S72 A;  1BR9 A;  2K1B A;  3U9O A;  1JWS D;  4C3I G;  3J80 c;  3H0G G;  2W8L A;  2CFM A;  5I4D A;  4C3J G;  3P20 A;  3JC6 6;  4XIG S;  3CME A;  2R93 G;  4OEL B;  3N52 A;  3RN5 A;  3HKZ G;  1CFM A;  3UE0 A;  3ERQ A;  2N88 A;  3FVQ A;  3TP5 A;  4APV A;  3PW2 A;  2K6A A;  2NVT B;  5DAU A;  4A93 G;  4MTE A;  2PO4 A;  2F0D A;  4QWB A;  4BBR G;  4HN7 A;  3ND9 A;  4DR3 L;  1D5M C;  4X64 Q;  5C4H A;  5L1K A;  3F8N A;  4AYB B;  4L5R C;  4P2C B;  5KFB A;  3BG3 A;  3HOY G;  1N32 L;  3HOZ G;  2ID0 A;  3KLW A;  4KHP L;  2UUA H;  5KFU A;  4YAK B;  5KG7 A;  1JX4 A;  3MFG A;  4DR2 H;  3K80 C;  4HYK A;  2YU9 A;  2CWA A;  3SGI A;  5CR3 A;  3K57 A;  1PYS B;  1CSQ A;  1CT1 D;  3S17 B;  5KNC A;  1JWU D;  1RL2 A;  3T56 B;  3U50 C;  2XVS A;  1N36 H;  2RGR A;  1BXT A;  3H3V I;  4DLK A;  5C3W A;  1I3Q A;  4P74 A;  2R7K A;  1S40 A;  1Q3L A;  2BA1 A;  4FYD A;  4UP9 A;  3JAM E;  4IRC A;  2K7V A;  1C48 A;  3A5U A;  2V1C C;  5KND A;  1IZ6 A;  5LMU L;  1NY4 A;  2F0H A;  3LNN A;  4LF7 Q;  5JJI A;  4DV5 H;  4IPG A;  1K28 A;  1PA6 A;  3OTO L;  1ZYR C;  1Y1V G;  3KLR A;  3LWE A;  3KAL A;  4QWA A;  4X66 H;  1QOH A;  5KT5 A;  4HIM A;  1XNR H;  2Q8T A;  1RYS A;  3Q6S A;  4YHH H;  5KFI A;  4YP3 A;  2F0K A;  1K1S A;  2LS0 1;  1KDB A;  4PZ7 A;  4DR5 L;  2L15 A;  1EQR A;  4DL3 A;  1SRU A;  1TWF A;  4FO2 A;  4C5B A;  1EEF D;  2EY1 A;  3J81 j;  1VQG A;  1R9T B;  1GM5 A;  2EQS A;  1BBW A;  1Q7Y C;  4X65 H;  2KEN A;  5L37 A;  1BUV T;  3MXG A;  4KKU A;  1FD7 D;  4GN4 B;  2WE6 A;  1TWG B;  1SFO A;  4QF4 A;  1FNW A;  4HR7 B;  4XT3 B;  4V19 0;  2VB2 X;  4R9W A;  1J5E L;  1RD9 D;  4ZYS A;  3T1Y H;  2EOT A;  5KT6 A;  1KD1 C;  4QWC A;  4DL6 A;  5BR8 L;  1VQD A;  2W9B A;  3BQ1 A;  2PCF B;  4TQU S;  2KED A;  5JUM A;  3H15 A;  1GOZ A;  4OWW B;  1K83 B;  1TY2 A;  1EY6 A;  1JT8 A;  3D0F A;  1KJJ A;  2PMZ B;  2XRS D;  1JB7 A;  1VBH A;  3FEW X;  5JEA H;  5M3F H;  1F77 A;  1AE2 A;  3PO2 H;  3J81 E;  4LF8 Q;  2V58 A;  4HCS A;  2OQK A;  5M3M H;  5BN3 A;  2E2I B;  3OIQ A;  5EKI A;  1CQF A;  4C1N K;  4C2M H;  4N9T A;  1KHI A;  1LO5 D;  2WB1 B;  3W2D A;  1QZH A;  2LKV A;  2YZG A;  1JR0 D;  2A6E C;  4C3H G;  4GZY C;  4LJZ C;  1W6J A;  4I50 F;  4L5S A;  5EWF A;  1ENC A;  2IL8 A;  5I9P A;  2IBK A;  1EYZ A;  3S16 H;  2B2V C;  2VR1 A;  3S2H B;  4X64 H;  2JEB I;  4L5Q A;  1B3Q A;  4JI8 L;  2R7Z B;  5C8Y F;  1TA8 A;  2C28 A;  4EFB A;  1RCV D;  1Q90 A;  3EIV A;  4RHR A;  3I56 A;  4JI1 Q;  1S68 A;  1HXY D;  5DNF A;  2BR0 A;  2YTV A;  4NP5 A;  1JOK A;  4G7H C;  4DR7 L;  5KGU A;  1TWA A;  5AJ3 Q;  4UDU C;  3QWN A;  3CAM A;  4DNR B;  4FF4 A;  1WSC A;  2NU8 B;  2E5L L;  2XRQ D;  4GNX B;  3TME A;  1UEB A;  3H4B A;  1CTM A;  1MSH A;  2IHE A;  4MZ9 A;  5IGG A;  4JUZ A;  3OYY A;  2QGQ A;  4BY7 G;  4LF7 H;  3D4W A;  1GD7 A;  1PX2 A;  1SND A;  1QVG A;  1M0W A;  3QOJ A;  2KSW A;  3CKI B;  4Q5V A;  2Q8I B;  2EXZ A;  4LF4 L;  3GTL B;  4ILW A;  3AYH B;  1AW7 A;  1IYJ B;  3I4N H;  3ZYY X;  4IO9 A;  4M7E A;  2C2D A;  1KLU D;  5BPH A;  1Y1W H;  2HIV A;  1S5C D;  1GUW A;  4RNM A;  1HQR D;  2VL6 A;  3NTK A;  2DNC A;  3CC4 A;  5A35 A;  4IUT A;  5L1J A;  3H0G A;  1WOC A;  3S2D H;  4JV5 L;  1HNW Q;  2X6L A;  3UDF A;  1TWC H;  1TWH A;  5LYJ F;  2R93 A;  3K5O A;  4Q0F A;  4A3J B;  2WAQ G;  4GLA C;  3J7A K;  2VUM G;  3NSW A;  1SYF A;  4U67 3;  4MV9 A;  2Q2T A;  1SYG A;  3D8G A;  3KLS X;  1ET9 A;  2DY8 A;  2MPM A;  1HTP A;  4DV2 L;  4A3F H;  3I3C A;  4NXN H;  5COR A;  2LSS A;  1IOW A;  5M5Y B;  5E3F A;  1JJ2 A;  5ELB A;  3MHB A;  2EYO A;  1N33 Q;  2RSN A;  3D6W A;  4EQN A;  3T5L A;  2R7N A;  2NWG A;  1MSG A;  1GKH A;  1E22 A;  4QUC A;  1PH2 A;  2W9A A;  4LF8 H;  3KDF A;  2B63 H;  2YZM A;  3QZ7 A;  4OHJ A;  3QFF A;  2I46 A;  3GIP A;  1SYE A;  4MHE A;  2M00 A;  2A68 C;  3PR4 A;  2VNU D;  3HOV G;  2ASD A;  4Q8E A;  1X32 A;  1PFM A;  2F1M A;  2MO0 A;  3DHQ A;  3RB3 A;  4DF7 A;  3GTG B;  3H94 A;  4GKJ L;  1SN8 A;  2L5T A;  4MV8 A;  3GTO B;  2X6G A;  4YIJ A;  4ED7 A;  5KFK A;  1IKM A;  2UXC Q;  5LHY 1;  2BQ3 A;  4A3B B;  2XNA C;  5EAY A;  1Q8K A;  3G6Y A;  1J6Q A;  3TDQ A;  4BBS B;  3J80 L;  1SYX B;  2JA5 B;  1EQT A;  1Y1V A;  2H5X A;  4JI1 H;  2O5J C;  5DQI A;  3OSO A;  3CCV A;  1EOV A;  5C4Z A;  4RZR A;  3M7G A;  3FP9 A;  4NLG A;  5J2U F;  1B3A A;  3MTS A;  3X3N A;  4GOP C;  3K7U C;  1QVF A;  1GVP A;  1XYI A;  2CW0 C;  1EY7 A;  2V4Q A;  5HBR B;  2OH2 A;  4LFB L;  1Z47 A;  1NBW A;  5IYC G;  1C4Q A;  1ILP A;  1G91 A;  4BWS C;  3NEL A;  1F9Q A;  4XYM B;  3C2P A;  3P7J A;  4N8X 1;  3G8C A;  3CF5 A;  4X3S A;  1VQ7 A;  3FKI B;  4BA2 I;  2Z9H A;  4DR6 Q;  4FS2 A;  2HDL A;  3RZD B;  1B4O A;  4RMF A;  1SJH D;  5CV9 A;  1WTW A;  4A3M G;  1PZI D;  1CHP D;  4QCL A;  1S0M A;  2PQA A;  1ZQ7 A;  1BJT A;  3GO5 A;  1SEB D;  3S1R B;  5BMV F;  2MGS A;  4JI7 Q;  3F1Z A;  3LX0 A;  2NVX B;  2R8H A;  2NN6 G;  3Q8Q B;  1DIK A;  5I2X A;  3LGJ A;  1HNW H;  3UDG A;  2QW7 A;  1KAB A;  2WFW A;  2D62 A;  3RJ0 A;  4ECZ A;  2RQX A;  2JA6 A;  3PGZ A;  1PH8 A;  1O7L A;  5CV4 A;  3S17 H;  2DZD A;  1YNJ D;  1WYD A;  4B3M L;  2Z1C A;  3DXJ C;  1LTT D;  4U68 A;  4DV0 L;  4RNO A;  4LSX A;  5F2D A;  5K5P A;  1MIU A;  2VXW A;  1XPU A;  3RIZ A;  4QWD A;  3S1Q B;  1N33 H;  1A3V A;  1K0S A;  3A55 A;  4CC5 A;  4F4X A;  3BDL A;  4MV4 A;  4P71 A;  4QWE A;  3GV8 B;  2FMC A;  1RK5 A;  2IY5 B;  4L6T B;  1K3R A;  2D2C C;  4LFC Q;  3E9H A;  3HOW G;  4OX9 Q;  2EY6 A;  4ULL A;  5EJW A;  1R9T H;  2XC9 A;  1S03 G;  1R4P B;  5C44 G;  4EFE A;  1YNN C;  1STA A;  3VMM A;  1H9R A;  1E3P A;  3ORR A;  3EJI A;  2UVU A;  3KHH A;  4DV6 L;  1TWG H;  3PUX A;  2XIW A;  4UCV A;  5I47 A;  3L4J A;  5EOY A;  1CKM A;  2QIL A;  4IQZ A;  2O5I C;  1Q81 C;  1HPC A;  4KY7 A;  3VR2 A;  2F0G A;  5A2Q L;  1M6V A;  2R8I A;  4HQ6 A;  1MD2 D;  3K6O A;  3PW5 A;  4LMY A;  3MR6 A;  5FLM H;  1E2W A;  4HJ7 A;  1IBK Q;  2A19 A;  3TII A;  2ALZ A;  2J6S A;  3I4M G;  1K83 H;  3CPF A;  2YRW A;  2KCM A;  2RVL A;  1JDB B;  4JV1 A;  1K8G A;  3EN2 A;  3RZO B;  3SXH A;  5LOV F;  2EVB A;  4K5W A;  2E2I H;  2F0S A;  2IJ0 A;  1TXY A;  1J9O A;  2QDL A;  2WAQ A;  5FPO A;  5KFQ A;  4B3T L;  2W6Q A;  4POF A;  4DR6 H;  1GSH A;  2YS7 A;  2VUM A;  3HOU G;  1JOR A;  2KBN A;  1TVX A;  1GSO A;  4MV3 A;  1VQL A;  4G57 A;  3NTH A;  1EU4 A;  3TS0 A;  4DR4 Q;  3RB0 A;  3O13 A;  4A3I G;  3CCS A;  4YR0 A;  2EY5 A;  1NSN S;  3S2H H;  3BVZ A;  5K36 G;  4UCT A;  2R7Z H;  2XD4 A;  2FJZ A;  5FO9 B;  3M9O B;  4F88 A;  2W70 A;  4JI7 H;  4JI2 Q;  5C0X G;  4K5V A;  2VQF Q;  3UDI A;  2F3W A;  3VPB A;  5CMD A;  2Z4I A;  3CCU A;  4N9P A;  4KN4 C;  2WAQ E;  1KDC A;  2G9H D;  1EQQ A;  1C8C A;  3OUU A;  1I6H H;  1AH9 A;  4XT1 B;  4ZK9 B;  3S9W A;  2ATW A;  2PNR C;  1EYA A;  2R8G A;  4ZLT F;  5JVG 3;  1BCP F;  3U9T A;  3K81 C;  1GUT A;  3GTK B;  1DV2 A;  1HQM C;  4DAV A;  5J3B A;  4TRD A;  1C3O A;  2J6T A;  5GQO A;  4IN3 A;  5GAG C;  2SCU B;  3E0E A;  3K59 A;  3BDC A;  4B08 A;  1IBL Q;  1JKJ B;  3FDS A;  4YR2 A;  1PTO F;  1C30 A;  3F8T A;  3GTL H;  2F0V A;  4X62 L;  3WNZ A;  2C2E A;  4OXP A;  1XPR A;  1UE1 A;  1BF4 A;  2IP4 A;  3TQT A;  4EGQ A;  4DAP A;  5IGB A;  5JJZ A;  4B3R Q;  4LFC H;  1EY4 A;  5KIX A;  4OX9 H;  2XCA A;  1ZHQ A;  2GVA A;  2J6U A;  1W3S A;  4JYA Q;  3GII A;  1E2V A;  4IPC A;  3V6H A;  1E0B A;  5ELC A;  2UUA L;  3C3L A;  1CA5 A;  4CHT B;  3VR3 A;  3QOL A;  4A3J H;  4OIJ A;  2YU9 B;  2HUG A;  2JN4 A;  3BS1 A;  4FXG C;  4ECT A;  3PVX A;  3MAQ A;  1D2B A;  1Q46 A;  5L9X A;  2QA4 A;  1U9R A;  1RYR A;  1O80 A;  1L2Z A;  2EXD A;  2IHF A;  1IBK H;  2AMC B;  4B9X A;  4M8A A;  5M5Y H;  2BCO A;  4JBJ A;  3IAY A;  2VOB A;  4I7H A;  4CC6 A;  5KFD A;  1S0O A;  2E2H A;  4HCE A;  1HR0 Q;  4XYL B;  4A3D B;  3K7A B;  1PH3 A;  1NJI C;  5LMN Q;  3KF6 A;  1PFN A;  3GDE A;  1XNR L;  4IWX A;  1QE6 A;  2KOL A;  3RV4 A;  1IL8 A;  4L8J A;  3J80 E;  1A9X A;  2FLN A;  2BE5 D;  1SYD A;  2KQ3 A;  3SK8 A;  1QIL A;  5D3D A;  3EYY A;  5M3M B;  4RCN A;  3GTG H;  1QUQ B;  4DNI A;  3SVM A;  3GTO H;  2QKI C;  1C9O A;  5HGT A;  4DR4 H;  4YWM A;  3KHL A;  4L63 B;  4XQQ A;  5D8D A;  4ED6 A;  4XYO A;  3UI2 A;  3MJF A;  4DKA C;  1W6K A;  3QJY A;  5IIF A;  3V2T A;  1IYV A;  1KQS A;  4C56 C;  4JI2 H;  4BBS H;  2JA5 H;  1KL9 A;  4FXK C;  2VQF H;  1Z6H A;  4JI5 Q;  4ECY A;  4LF9 Q;  5DG7 A;  3VR4 A;  2R82 A;  4EBD A;  3T51 B;  4DV4 L;  1JMC A;  2K52 A;  2NTT A;  4ZAI A;  4EEQ A;  3J7A F;  4S3S A;  5FD5 A;  3RGX A;  4K8I A;  1L1O B;  2ZTE A;  2NU9 B;  1TS4 A;  1PRT B;  4ECS A;  2EJF C;  4ED8 A;  2UUB Q;  4PZ8 A;  1U4R A;  1U5K A;  3K8A A;  4IR9 A;  4F87 A;  1HNX Q;  4ECU A;  4FU0 A;  1GYF A;  3FKI H;  3UE1 A;  4BY1 G;  1IBL H;  1W2B A;  4GS3 A;  1X3P A;  4LUV A;  1DGS A;  5IP7 G;  4DV1 L;  1K73 C;  4R8I A;  1C0A A;  4IWY A;  2FMM A;  3RZD H; 
#chains in the Genus database with same CATH homology
 2V1C C;  5GAD C;  3JAM c;  3CD6 A;  1OTC A;  4GNX C;  1IZ6 A;  5LMU L;  1NY4 A;  1VQB A;  3PF5 A;  4P73 A;  1E7Z A;  4LF7 Q;  5JJI A;  2NVY H;  1YHB A;  4IPG A;  4JI5 L;  1PA6 A;  4A3L G;  3CQZ H;  3OTO L;  4X64 L;  1Y1V G;  3J80 i;  5C3E G;  1VQ4 A;  3W5O A;  1SLJ A;  4BBR H;  3S1R H;  4LF6 L;  2WB1 E;  3EBE A;  4HIM A;  1Q86 C;  1IBM L;  1EWI A;  1IBK L;  5M3F G;  2NVX H;  3PO2 G;  3S1M H;  3HOY H;  2UXD L;  5GRO A;  4PZ7 A;  4DR5 L;  3HOZ H;  2L15 A;  1EQR A;  3M7N A;  1SRU A;  1V9P A;  2K75 A;  3J81 j;  1GM5 A;  1VQG A;  4AQY Q;  2EQS A;  1L2F A;  1BBW A;  1Q7Y C;  1PH7 A;  3NEN A;  3PF4 A;  4RG1 A;  5IT9 c;  2KEN A;  1HNX L;  1NE3 A;  4GN4 B;  2ASB A;  2B29 A;  3G48 A;  1J5E L;  1HZA A;  1I5F A;  3KF8 B;  2AWO A;  1Q82 C;  4LF7 L;  4DR4 L;  4YCW A;  2ALY B;  1KD1 C;  3S1Q H;  3TQY A;  5BR8 L;  3RR5 A;  1VQD A;  1PHJ A;  1VQ8 A;  1E1T A;  4TQU S;  3GD7 A;  2UUC Q;  4JI2 L;  3MXN B;  5GAE C;  1X9N A;  3H15 A;  4PG3 A;  2VQF L;  1Y1V H;  3PIP A;  4HIO A;  1N34 Q;  4OWW B;  1JT8 A;  3D0F A;  3CC2 A;  3CPW A;  1JB7 A;  1L0W A;  1JE5 A;  2LXK A;  2MO1 A;  5M3F H;  2BH2 A;  3PO2 H;  1AE2 A;  4LF8 Q;  2Y0S E;  3J7Z C;  1SE8 A;  2OQK A;  5M3M H;  3J81 c;  1V43 A;  4IFD G;  3W1B A;  1HH2 P;  2ZTC A;  4AH6 A;  2K5V A;  4C2M H;  2OTJ A;  2IT1 A;  4B3M Q;  2F3I A;  1KHI A;  4QL5 A;  1QZH A;  4DR2 L;  1D8L A;  4JI0 Q;  2NVT H;  4GLX A;  4DV0 Q;  3MEF A;  4YWK A;  1XPO A;  4R1J A;  4EX5 A;  3PCO B;  1OXX K;  4L5S A;  3DM3 A;  3KYH C;  3I4N G;  1SMX A;  1HZB A;  4JG2 A;  3WWV A;  1N36 L;  3S16 H;  1IBL L;  3U58 A;  2PI2 A;  1V1Q A;  2AHO B;  2JEB I;  4L5Q A;  4JI8 L;  4LF4 Q;  4A3G G;  2N8N A;  1AE3 A;  2CCZ A;  3EIV A;  3J7A 5;  3M4P A;  4LF5 L;  1GO3 E;  3ULP A;  3I56 A;  3CXC A;  4JI1 Q;  1OXT A;  4DV5 L;  5IP9 G;  4B3R L;  4IPH A;  2YTV A;  1E1O A;  4DR7 L;  4X66 L;  3M9B A;  3RZO H;  4JYA L;  1WCM G;  2A1A A;  2NZO A;  5AJ3 Q;  4YHH L;  2RCN A;  1VS0 A;  3CAM A;  4LFA L;  1YHQ A;  4YY3 Q;  1VQN A;  3PUZ A;  2IX1 A;  5IYC H;  2E5L L;  4GNX B;  1PFS A;  4DV6 Q;  1UEB A;  2XGT A;  4MZ9 A;  2IHE A;  5JJL A;  4DV7 Q;  1HZ9 A;  3OYY A;  3PO3 H;  2QGQ A;  4P72 A;  1X3G A;  2PI2 E;  3PIO A;  4X65 L;  2HT1 A;  2OCE A;  2JK8 A;  4BY7 G;  1GD7 A;  2F4V L;  1QVG A;  4C3H H;  4DR1 Q;  5C0X J;  4NXM Q;  1X3F A;  2ZTD A;  5GAH C;  1HR0 W;  3FHW A;  1PH9 A;  1HNZ Q;  4LF4 L;  1VQ6 A;  4BXX G;  1C0A A;  3AYH B;  3AEV A;  1IYJ B;  3I4N H;  4IO9 A;  1O7I A;  5LMN W;  3RNU A;  4R4C A;  3T1Y L;  1Y1W H;  2HIV A;  3L0O A;  4LNQ A;  4NPS A;  2E2H H;  1XMO Q;  2VL6 A;  4A3G H;  2IX0 A;  2Z6K C;  1HR0 L;  2MFI A;  3CC4 A;  4K0K Q;  2KHI A;  1M1K C;  5IP9 H;  1LTL A;  4B3S Q;  1XMQ Q;  3G6E A;  1WOC A;  4IJL A;  1PV4 A;  3A5Z B;  3S2D H;  4YY3 L;  4JV5 L;  1P16 A;  1HNW Q;  4LW1 A;  1H95 A;  3UDF A;  1TWC H;  4B3T Q;  2WP8 J;  4JOI C;  3GTK H;  1ASY A;  1VQF A;  2WAQ G;  4GLA C;  4JI3 L;  4DV3 Q;  2OWO A;  1FJG Q;  2VUM G;  2F52 A;  4DAY B;  4P75 A;  4DK3 C;  2Q2T A;  3STB C;  1Y14 B;  1G51 A;  2QEX A;  1K8A C;  4NXM L;  3HFZ B;  3KOJ A;  4MNO A;  2XTI A;  4DV2 L;  4A3F H;  4UP7 A;  4BY7 H;  1HNZ L;  4JOI A;  1NTG A;  2LSS A;  1YJW A;  1JJ2 A;  4A3D G;  4IJH A;  4R4I A;  4PMW A;  1OXS C;  1N33 Q;  4BXX H;  4IOA A;  2D0P A;  2A8V A;  4GKK Q;  4LF9 L;  1GKH A;  4POG A;  1E22 A;  1QVC A;  2PQA B;  1PH2 A;  1CKO A;  3KDF A;  2B63 H;  5JEA G;  1CSP A;  5IYD G;  2JEA I;  1JJG A;  1XMQ L;  3STB D;  4OWT B;  5M3M G;  4GN3 B;  3S15 H;  4GNX A;  3TRZ A;  1HNW L;  2VNU D;  3HOV G;  2NZH A;  3M3Y H;  4LFB Q;  1JJC B;  2MO0 A;  3ER0 A;  3RN2 A;  3ICE A;  2UUB L;  5C44 H;  3CMA A;  1SN8 A;  2YU9 H;  3UDX A;  4GKJ L;  3G71 A;  1CKN A;  4A75 A;  4DK6 C;  5C0X I;  2YTY A;  2YV5 A;  4FDB A;  4L5T A;  5IWA L;  2UXC Q;  1C7Y A;  1VQC A;  2VUM H;  5C4J H;  1EFW A;  5EAY A;  5JJK A;  1Q8K A;  2ZM6 Q;  1J6Q A;  5ELO A;  3U4Z A;  4AYB G;  2H5X A;  3BJU A;  1VQM A;  2UXB L;  3CC7 A;  3CP0 A;  2CWP A;  1EOV A;  3CCV A;  4GKK L;  1YHA A;  2YTX A;  4JI6 Q;  3FP9 A;  5DLQ E;  4NXN Q;  4A3D H;  3K7A H;  4GOP C;  1Z9F A;  3ULL A;  1FGU A;  3K7U C;  1QVF A;  4PZ6 A;  3RLF A;  1YZ6 A;  3A74 A;  1VQE A;  1FVI A;  1GVP A;  3M4Q A;  3CCJ A;  1SRO A;  5IYD H;  1VQH A;  4LFB L;  1PH5 A;  1Z47 A;  1NBW A;  5IYC G;  4AQY L;  1X55 A;  3NEL A;  3JAM i;  3F2B A;  1LM0 A;  3HOV H;  1WJJ A;  3HOU H;  3CF5 A;  3T1H Q;  1VQ7 A;  3PO3 G;  4BA2 I;  3NEM A;  4DR6 Q;  2UXC L;  3L7Z C;  2R7D A;  2GN5 A;  1VQ9 A;  1XNQ Q;  5HY6 A;  3K0X A;  1SFO H;  1MKH A;  1YJ9 A;  1P8L A;  4JBW A;  4A3I H;  1Q12 A;  2C35 B;  4GLV B;  4RMF A;  4HJ5 A;  4IFD I;  2K5N A;  4A3M G;  2N49 A;  4OO1 I;  1Y1W G;  2PQA A;  3CCQ A;  1I94 Q;  2E2J H;  3GO5 A;  2JA7 G;  1UWV A;  4JI7 Q;  3TS2 A;  4NXN L;  3F1Z A;  2UXB Q;  2UUC L;  2N3S A;  2NN6 G;  1X65 A;  4UPA A;  1N34 L;  3LGJ A;  2HHH Q;  3UDG A;  1KRS A;  4QJF A;  1YJN A;  2WFW A;  2D62 A;  3PGZ A;  3CCR A;  4LF8 L;  3KDF B;  2PNH A;  1PH8 A;  3KJO A;  1NMF A;  3S17 H;  1WYD A;  4B3M L;  2GVB A;  1KC8 C;  4OON A;  3CW2 C;  2KHJ A;  1K9M C;  4JI0 L;  3HKS A;  4DUZ Q;  1XNQ L;  4DV0 L;  4A3F G;  1MIU A;  1XPU A;  4HJ8 A;  5FLM G;  3ZJY C;  1CKN B;  4IPD A;  3ULJ A;  2VQE Q;  5JEA J;  1MJC A;  2CQO A;  1I94 L;  3CCM A;  2ZJQ A;  5C4X G;  1UE6 A;  4JI7 L;  1KAW A;  4YCU A;  1N32 Q;  3VDY A;  4DV4 Q;  4P71 A;  3J81 i;  4A3M H;  4KHP Q;  4Y7N H;  2B63 G;  1B8A A;  4JI1 L;  1OXU A;  1YIT A;  1A62 A;  1K3R A;  2JA7 H;  2IY5 B;  3GTP H;  4DAM A;  3S1N H;  3AFP A;  4LFC Q;  3E9H A;  4O0A A;  3G4S A;  4JBM A;  3HOW G;  1YI2 A;  4OX9 Q;  3A0J A;  4ME3 A;  2JA9 A;  2WB1 G;  1R9T H;  5AJ3 L;  1EYG A;  2DGY A;  1TWA H;  1IL2 A;  3CCE A;  3IRB A;  5C44 G;  5FJ8 G;  1E3P A;  2AKW B;  4DV6 L;  1A0I A;  1TWG H;  2HIX A;  2BA0 A;  3PUX A;  2Z6K A;  3I2Z A;  4DV1 Q;  5IYB G;  3E9I A;  2K4K A;  2UU9 Q;  4A3B H;  4DV7 L;  1CKM A;  2FXQ A;  5LMU Q;  3B6Y A;  1Q81 C;  1LYL A;  1PH4 A;  4GOP B;  1VQP A;  4UP8 A;  1EIY B;  3TRE A;  1N9W A;  4HID A;  1VQA A;  3OTO Q;  4DR1 L;  1WFQ A;  5FLM H;  4KI0 A;  4LF6 Q;  1X56 A;  2RF4 A;  1IBM Q;  2I5L X;  4HJ7 A;  2ZJP A;  1IBK Q;  2A19 A;  3KJP A;  1VCI A;  1MJE A;  3BU2 A;  3I4M G;  3PSI A;  2KCT A;  5C4X H;  2RHS B;  2MQH A;  1K83 H;  2UXD Q;  1XMO L;  4IFD J;  4X6A H;  4DR5 Q;  3CPF A;  5M5X H;  2KCM A;  1K8G A;  4H02 A;  3GTJ H;  3EN2 A;  1LUZ A;  1VQK A;  4K0K L;  1PH1 A;  2ZJR A;  2E2I H;  4B3S L;  3HKZ E;  1A8V A;  1TXY A;  3HOW H;  2Z0S A;  2I5H A;  4A4I A;  4B3T L;  1HJP A;  4POF A;  3PV0 A;  4C3J H;  4DUY Q;  3GTM H;  3HOU G;  1TWH H;  1KRT A;  4QQB X;  4BA1 I;  2KBN A;  2R92 H;  2R93 H;  2Y0S G;  2YYZ A;  4DV3 L;  4AIM A;  5FJ8 H;  1J5E Q;  2UU9 L;  3AQQ A;  1FJG L;  1VQL A;  1EIF A;  4O2D A;  3PUV A;  1Q1E A;  4DPG A;  1Q1B A;  3TS0 A;  2Q2H A;  1T9H A;  3AFQ A;  5E7N A;  4DR4 Q;  4A3I G;  3CCS A;  4A93 H;  5IYB H;  4HJA A;  4IOC A;  3I4O A;  1EUJ A;  1UE5 A;  3S2H H;  5K36 G;  5BR8 Q;  2R7Z H;  1I3Q H;  4X62 Q;  3W1G A;  3S14 H;  3S24 A;  4JI2 Q;  5IE8 A;  1I50 H;  5C0X G;  2VQF Q;  2EIF A;  3UDI A;  1N33 L;  4JCV E;  3CCU A;  2R93 G;  1UE7 A;  1YNX A;  3I4M H;  4WJ3 M;  1QUQ A;  2HQL A;  2N78 A;  2Q2I A;  2WAQ E;  4QGU A;  1EQQ A;  3I55 A;  1I6H H;  1AH9 A;  1G6P A;  3KF6 B;  3H3V H;  4A3J G;  2DUD A;  2UUA Q;  1PVO A;  2ATW A;  3U4V A;  3DLL A;  1YIJ A;  3K81 C;  4HIK A;  4DR2 Q;  4DUY L;  4HJ9 A;  3OW2 A;  4OWX B;  5H1S E;  5J3B A;  1TWF H;  3D31 A;  3M85 A;  4QIW E;  1L1O C;  1RIP A;  3M4O H;  5GQO A;  4NB3 A;  4GOP A;  5GAG C;  4A3E G;  3NBH B;  3E0E A;  4YCV A;  4BY1 H;  4LWC A;  5ELN A;  4R4T A;  1N36 Q;  5IP7 H;  1IBL Q;  2MNA A;  4A3K G;  4JI8 Q;  3F2C A;  4QY7 A;  3F8T A;  1G29 1;  3GTL H;  3PUW A;  4X62 L;  2ZM6 L;  2JA8 G;  1XJV A;  4LF5 Q;  4OXP A;  3RLN A;  1UE1 A;  1XPR A;  4A3L H;  4DV5 Q;  1L1O A;  5C3E H;  2R6G A;  4B3R Q;  2I0Q A;  2OQ0 A;  1VQI A;  5IY0 A;  2K50 A;  3PUY A;  1B7Y B;  4X66 Q;  1X6O A;  2ES2 A;  4JI6 L;  4DR7 Q;  2GVA A;  1W3S A;  4JC0 A;  4JYA Q;  2K14 A;  1XNR Q;  4IPC A;  4YHH Q;  1X3E A;  4JBK A;  3GTQ H;  1HZC A;  4LFA Q;  4EQ5 A;  2UUA L;  2JA6 G;  1S3O A;  4LUZ A;  4OO1 G;  2E5L Q;  2JJQ A;  2BH8 A;  3BZK A;  1YBY A;  1M90 C;  4MTN A;  2I5M X;  4A3J H;  5HGQ A;  3Q8D A;  1NMG A;  4AYB E;  1KIX A;  4X65 Q;  4A3B G;  2NN6 I;  3L2P A;  2F4V Q;  1YVC A;  3T1H L;  1KXL A;  4Y52 H;  4BBS G;  1Q46 A;  2JA5 G;  4DR6 L;  3BZC A;  2QA4 A;  4R4O A;  5M5W H;  4KLK A;  2VS1 A;  4A3E H;  3CCL A;  2EXD A;  1BBU A;  2IHF A;  1VQO A;  1PH6 A;  2AMC B;  3T1Y Q;  5M5Y H;  4A3K H;  4JBJ A;  1VQJ A;  3GTG H;  4DR3 Q;  4J15 A;  1HR0 Q;  2D0O A;  2JA8 H;  4KHZ A;  4YWL A;  1YEZ A;  2B3G A;  2Q2U A;  1K0R A;  1PH3 A;  2VW9 A;  1E24 A;  1NJI C;  5LMN Q;  3KF6 A;  4JI4 Q;  2CKZ B;  1S72 A;  3GDE A;  1ASZ A;  1VQ5 A;  1XNR L;  1SR3 A;  3TEH B;  4JV5 Q;  1CUK A;  2HHH L;  1XTD A;  3J80 c;  3ERS X;  3H0G G;  2CFM A;  4TVA B;  3FKI G;  4JI3 Q;  4A76 A;  1QUQ B;  4DNI A;  3JC6 6;  4LUO A;  4XIG S;  3HOX G;  3CME A;  1BVS A;  5FLX c;  3RN5 A;  2R92 G;  3F2D A;  2VZA A;  3HKZ G;  1QZG A;  3GTO H;  1C9O A;  3UE0 A;  4WJ4 A;  4A3C G;  4YWM A;  4APV A;  4XTC S;  1D7Q A;  4DV2 Q;  2OTL A;  4DKA C;  4A93 G;  4DUZ L;  4ALP A;  1KQS A;  1FL0 A;  2R7Z G;  4BBS H;  4GN5 A;  2JA5 H;  4BBR G;  1KL9 A;  2VQE L;  1N8R C;  4JI5 Q;  3RLO A;  4DR3 L;  2NVQ H;  4X64 Q;  4LF9 Q;  2JA6 H;  3I7F A;  1BKB A;  4L5R C;  3HOY G;  2JE6 I;  4UY8 C;  3HOZ G;  2E8G A;  2ID0 A;  4DV4 L;  4JI4 L;  1N32 L;  5LMN L;  1JMC A;  2K52 A;  1WI5 A;  2K5H A;  2VY3 A;  3KLW A;  4KHP L;  2JQO A;  2LXJ A;  1L1O B;  2ZTE A;  4LFC L;  1OXV A;  1WCM H;  4OX9 L;  1U0L A;  2AWN A;  3K80 C;  2CWA A;  1IXR A;  3SGI A;  2UUB Q;  2RHQ B;  4GKJ Q;  4PZ8 A;  4C3I H;  1PYS B;  1CSQ A;  1B70 B;  1U5K A;  1PYB A;  3K8A A;  3H0G H;  5IWA Q;  1RL2 A;  1HNX Q;  3U50 C;  3FKI H;  1X54 A;  3UE1 A;  4BY1 G;  1A63 A;  3HOX H;  1W2B A;  3H3V I;  4GS3 A;  3KFU A;  4P74 A;  4LUV A;  4R4Q A;  1S40 A;  1DGS A;  2BA1 A;  4UP9 A;  2PMZ E;  5IP7 G;  4DV1 L;  1K73 C;  2R7F A;  4A3C H;  3A5U A;  3RZD H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...