4A3EG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 31
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3eG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3eG01
5LMUQ 1E3PA 5C3EH 1EUJA 1A8VA 4DAYB 2F3IA 4YWLA 4P74A 1P16A 1Q81C 3KFUA 3GTQH 4ME3A 3NBHB 3T1YQ 4PZ6A 1LM0A 4TVAB 2OCEA 2JA6H 2JQOA 1PH5A 4X62Q 4DR1Q 4AQYQ 4JBWA 4DR7L 3BU2A 2E8GA 3DM3A 1Y1WG 3VDYA 1I94L 3STBC 4JBMA 1UE5A 3PUXA 2K5NA 2Z0SA 1IL2A 5C44G 3CPFA 4PMWA 2HIVA 3H15A 2UXCQ 1X9NA 5IP9G 1N36L 1HH2P 3L2PA 3AYHB 3S24A 1XMQL 2AMCB 3AQQA 3I4MH 4L5RC 5IY0A 4KLKA 3KJOA 3HOUG 4DV4Q 2YU9H 4B3RQ 3F2DA 1QVGA 3RLOA 1PH8A 2YTXA 4YCVA 1VQ6A 3TRZA 4R4QA 2HQLA 2LXKA 3K80C 5EAYA 3UDXA 4DKAC 4GNXB 1SRUA 4HIOA 2OTJA 3GTLH 4BY1H 5GAEC 4LF9Q 4HIMA 2BH8A 2ZTCA 3K7UC 3PV0A 1C7YA 4A3EG 2GN5A 2C35B 1NTGA 4WJ4A 3I4NG 2EIFA 2JA7G 5BR8L 2CWPA 5C4XH 2UU9Q 1Q7YC 1NMGA 4OO1G 1Q8KA 2N49A 4YY3L 2ZM6L 4DV4L 2JEAI 4A3GH 1HNWL 4DR4Q 4OX9L 1NJIC 1YITA 1N9WA 5BR8Q 4UP9A 4RMFA 3F2BA 1V1QA 3G6EA 4UP8A 2AWNA 3S1QH 5GAHC 1VS0A 2OQ0A 4A3CG 1G291 5JJIA 1SFOH 1MKHA 4B3SL 3HOYG 4HJAA 1QVFA 3UE0A 5H1SE 2N78A 5JEAJ 1HNZQ 2F4VQ 4AYBG 3CCUA 1X56A 5IYCH 4AQYL 1D8LA 1A62A 4XIGS 4OWXB 4FDBA 4Y52H 1SROA 1PH7A 1IBMQ 3I7FA 2XTIA 4DV0L 4A3KH 2GVBA 4A3BG 3JAMi 1EIYB 4JI0L 1X6OA 4LF6L 1HJPA 3HKSA 4X65Q 3CCMA 4DV6L 4JI4Q 3S15H 3PUWA 3KDFA 3D31A 1SR3A 1PH9A 4PZ8A 2LSSA 3S16H 4KI0A 4HJ8A 4JC0A 4A3FG 4O2DA 5IWAL 4H02A 1Y14B 4DR3L 1B70B 1A0IA 4YWMA 3AEVA 2VNUD 2WP8J 4DUZQ 3CF5A 4HJ7A 1K8AC 1G51A 1XNQL 2NN6G 3HOZG 4IOCA 3L7ZC 3TEHB 5M3MH 2H5XA 4GOPA 2LXJA 1VQ7A 4BY7G 3B6YA 4JYAQ 4A93H 5IT9c 2GVAA 3MXNB 2MNAA 1X3FA 1I94Q 2OTLA 4GLXA 1HZBA 4A3EH 4JI4L 5M5XH 1N36Q 3S1MH 5FJ8H 2IHEA 3ERSX 3UDFA 4BY1G 1OXTA 1KL9A 1VQ9A 4GOPB 4DR5Q 1GKHA 4LF9L 3S14H 1EQRA 1VQ4A 2K4KA 1BKBA 2MFIA 4B3TL 4LF4Q 2YV5A 4A3IH 1K3RA 1UEBA 5ELNA 1V43A 2R7DA 4JYAL 4JI0Q 3CCVA 2R93G 2JA8G 2YYZA 1S72A 5IYDH 3RNUA 4IJHA 4LF5L 1JJCB 4JV5L 4A75A 3CQZH 4POFA 1L1OB 4JI5L 2Q2UA 4DK6C 2N8NA 5IWAQ 4DUYQ 1YHAA 4JOIC 5DLQE 2A1AA 3HOXH 3UDIA 4A3JG 1PH2A 4JI7L 1TXYA 4LWCA 4DV6Q 2B63G 2ID0A 1HR0W 1B8AA 3F2CA 5IYDG 1WCMG 5GAGC 3PSIA 5IP7H 2ZTDA 1IBML 3KLWA 4BY7H 2HIXA 1Q82C 1AE3A 4YHHQ 1PH4A 2E2HH 4LFCQ 3GTPH 2F4VL 1HR0Q 3HOVH 3CCLA 1OXUA 1PV4A 4GNXC 1N34L 4JI7Q 4KHPL 3M4QA 3DLLA 2CQOA 5C44H 3I4MG 1LUZA 2OWOA 4OWTB 5IP9H 3GTKH 4DR3Q 1N8RC 3M4PA 2PI2E 1EQQA 2VS1A 4JI8Q 1OTCA 1KIXA 2E5LL 3CD6A 4A93G 1Q1BA 3J81c 1VQHA 2QEXA 1KRSA 4B3TQ 4JI5Q 2R92G 4A3KG 3KJPA 4ALPA 3U4ZA 1AH9A 4NB3A 1A63A 2D0PA 1QUQA 3A0JA 2ASBA 3PGZA 1ASZA 1O7IA 4JG2A 2JA5G 2I5HA 5AJ3L 3S1NH 4LW1A 4DR7Q 3CC4A 4A3DH 2HT1A 4K0KL 1LTLA 3K0XA 1VQ5A 4UP7A 1IBLQ 1VQGA 1VQMA 2Z6KC 1IBKL 1JMCA 1YIJA 3J80i 2VY3A 2R7ZH 2R92H 4QIWE 3T1YL 1HZ9A 3A5ZB 3TS0A 1N33Q 1Q1EA 1PYBA 3RZDH 3HOYH 1HR0L 1JJGA 2K52A 2VZAA 2WAQE 1KRTA 4NXNQ 1U5KA 5LMUL 2JK8A 3OTOQ 4DR2L 3CP0A 5M3FG 1YJNA 1HNZL 3HKZG 4BA1I 4B3RL 5IE8A 4DV3L 1VQPA 1YJWA 2CWAA 1K73C 1IYJB 4DV2L 5IYBH 4X6AH 3EBEA 3ULJA 2YTVA 4DV0Q 2I5LX 3CC2A 4GLAC 5GQOA 4GKKL 2Z6KA 1CKNA 1U0LA 3G48A 3OYYA 5FLMG 2WB1G 2UUCQ 3JAMc 1E22A 3A74A 1J5EL 5J3BA 2E2JH 1VQNA 5ELOA 1S40A 4LF7Q 1D7QA 1KHIA 4R1JA 2JE6I 1YHBA 2MO1A 4K0KQ 4A3GG 1OXXK 1R9TH 2VQEL 1XMOL 1CKMA 3CCRA 1QZHA 3Q8DA 1UE7A 2KCMA 2UXDL 4QQBX 4IPDA 3H3VI 3CCQA 4DUYL 1VQJA 4B3ML 1OXVA 5HY6A 2JJQA 1I6HH 1JT8A 5M5WH 4KHPQ 4YWKA 1JB7A 4UY8C 1GVPA 4LF7L 1N32L 2JA9A 4OXPA 1EFWA 3HKZE 4JI1L 4DAMA 3H0GG 2ZJRA 4IO9A 1VCIA 2BA0A 4JI2L 1SE8A 4AIMA 2ZJPA 4R4CA 3WWVA 5JEAG 2VQEQ 2NVTH 4EX5A 1UE1A 3PF5A 1XNRQ 3FKIG 1EOVA 2JA6G 4IFDG 1I5FA 3FHWA 4J15A 4L5SA 4DR5L 3CCSA 1Y1VG 4DV3Q 2IT1A 3S2HH 2D0OA 1FJGQ 1S3OA 1K83H 3BZKA 3M85A 3H0GH 3PO3H 5C4JH 1KXLA 4A4IA 4OO1I 3K7AH 3U50C 1KD1C 1KQSA 4GKKQ 4GKJL 1HZCA 2MQHA 3CAMA 3CMEA 3T1HQ 2F52A 1CKNB 4X62L 1N34Q 2VUMH 1BBWA 1B7YB 3KDFB 1J6QA 1WI5A 4LFAQ 5M5YH 2WFWA 3F8TA 3PUVA 4DV7Q 4GNXA 1XPOA 2QGQA 1FJGL 2PMZE 1TWHH 3OTOL 4A3CH 1WFQA 3FP9A 1HNXQ 1TWFH 2L15A 3GTGH 3ZJYC 2IHFA 3M3YH 4DV5Q 1VQ8A 3TREA 2UUAL 5LMNQ 4C2MH 1MJCA 1M90C 1QZGA 3MEFA 4L5TA 4A3MH 1M1KC 1VQKA 4QJFA 1JE5A 1BBUA 3CC7A 4NXMQ 2R93H 4DK3C 2B3GA 4P73A 5IYBG 3S2DH 2PQAA 4X64L 2DGYA 3RLNA 1L2FA 3CXCA 1XPUA 5LMNW 1H95A 2HHHQ 1N32Q 3H3VH 1FGUA 2B29A 2RHQB 2UUBQ 3KF6B 2BH2A 1EIFA 1SLJA 3HOXG 3I56A 4OONA 2ATWA 4TQUS 4IPGA 1YEZA 5C0XG 3GTOH 3OW2A 3GTMH 3M7NA 5C4XG 2NN6I 4BBRH 5AJ3Q 1VQAA 3F1ZA 1PA6A 1DGSA 2NVYH 4WJ3M 1VQOA 2EXDA 4R4IA 2NVXH 3EIVA 2ZJQA 1TWCH 3KF8B 2RHSB 4DPGA 1IBKQ 1PFSA 2VL6A 1VQBA 2K14A 4LF5Q 2VUMG 3CPWA 1L1OC 1E7ZA 4XTCS 3CCJA 4YCUA 1GO3E 3J80c 1HNXL 4IOAA 1WYDA 2NVQH 4PZ7A 1PH1A 1PVOA 1ASYA 2BA1A 1E1OA 4Y7NH 1YBYA 3PUZA 1FVIA 4R4OA 4A3LH 4OWWB 3UDGA 1VQFA 2MO0A 3BZCA 3E9HA 3L0OA 3CCEA 4A3FH 4DNIA 5FLXc 2Y0SE 4HJ5A 3PF4A 4LFBQ 4LF8L 1PYSB 3J7ZC 3S1RH 4GN3B 2UU9L 1T9HA 1Q46A 2OQKA 2IX0A 3D0FA 4AH6A 4LF4L 4X66Q 4LF8Q 4NXML 1P8LA 2AWOA 3W1GA 3PO2G 2VQFL 2K5HA 4GOPC 3ULLA 3G71A 3W1BA 3RN5A 4GN4B 5IYCG 4GKJQ 1EWIA 4LUOA 1WJJA 1YHQA 1IBLL 1X55A 1Z47A 3K81C 3PCOB 2RF4A 4QY7A 3U4VA 4JCVE 4DV5L 2PNHA 2HHHL 5M3MG 2UXBQ 3GO5A 1Q86C 2K5VA 3ULPA 4A3IG 2IY5B 2ZM6Q 2AHOB 3NEMA 3KOJA 4BBRG 2UUCL 3RN2A 4LFBL 2VW9A 1OXSC 3AFPA 2K50A 2UXBL 1XMQQ 2R7FA 1X3GA 2IX1A 2QA4A 4BA2I 4C3IH 5HGQA 1XJVA 4IPCA 4HIDA 5M3FH 2UUBL 3S17H 3M4OH 1V9PA 3PIOA 4A3JH 3RZOH 3NELA 2JEBI 4LUZA 4RG1A 3I4NH 2PQAB 1CUKA 4X64Q 4JI3L 4P71A 3A5UA 2A8VA 2CFMA 1VQLA 2RCNA 3I4OA 4JBJA 1Z9FA 2PI2A 1NE3A 2KENA 4DUZL 1PH3A 1MJEA 3LGJA 4A3BH 4BXXG 4X66L 2WAQG 5JJKA 1Q12A 1NMFA 3M9BA 4NXNL 1L1OA 2JA5H 1Y1VH 1W3SA 3E9IA 4R4TA 2KBNA 5E7NA 5FJ8G 1WOCA 1K8GA 3PO2H 4JI6Q 2ALYB 1LYLA 1AE2A 3HOWG 4PG3A 4JV5Q 4LF6Q 2R7ZG 4IFDI 2Q2HA 2Q2TA 2D62A 2KHJA 3STBD 3CMAA 2VQFQ 3HOUH 4IJLA 4P72A 1RIPA 1YNXA 4YY3Q 4JI8L 4DV7L 5C3EG 4JI1Q 2CCZA 1UWVA 1K9MC 1JJ2A 4DV1Q 1CKOA 1RL2A 1G6PA 2CKZB 3T1HL 1TWGH 2R6GA 3UE1A 1FL0A 1K0RA 5GADC 1IZ6A 2ES2A 4UPAA 4EQ5A 2UXCL 1C9OA 4LFCL 3HFZB 2K75A 5C0XJ 2E5LQ 5JJLA 1XMOQ 2E2IH 3RLFA 4A3DG 1YZ6A 1KAWA 3G4SA 3W5OA 1W2BA 2B63H 4GS3A 4A76A 4DR1L 4LNQA 1CSPA 5LMNL 4O0AA 1XNRL 3TS2A 4DV1L 2I0QA 4JI3Q 1PHJA 4KHZA 4A3LG 2KHIA 2I5MX 4JI6L 4OX9Q 4IPHA 1E1TA 3GDEA 4QL5A 1SMXA 3HOVG 4JI2Q 3RR5A 3I2ZA 3GD7A 2KCTA 3K8AA 1WCMH 1VQCA 1L0WA 5IP7G 4QGUA 4C3JH 4LFAL 2JA7H 4GN5A 3HOWH 4HJ9A 1N33L 1KC8C 4JBKA 4DR4L 4NPSA 2XGTA 4L5QA 3U58A 1X3EA 3IRBA 4APVA 2FXQA 4YHHL 3J81i 1E24A 1I50H 3ER0A 1SN8A 3NENA 4MNOA 2Y0SG 2N3SA 3GTJH 5C0XI 4BBSH 1HNWQ 1NBWA 1CSQA 3BJUA 3CW2C 1I3QH 3PUYA 1EYGA 4B3MQ 2UUAQ 3J7A5 1X65A 1GD7A 1YVCA 1YI2A 4MZ9A 5GROA 1VQIA 4P75A 4C3HH 3KYHC 1YJ9A 3KF6A 3FKIH 4GLVB 5FLMH 1GM5A 2EQSA 3ICEA 4BXXH 2Q2IA 4JOIA 3PIPA 3TQYA 1MIUA 1VQDA 4YCWA 4DR6L 1XNQQ 2V1CC 4X65L 1TWAH 3AFQA 2ZTEA 1X54A 1XPRA 4HIKA 3SGIA 2YTYA 4MTNA 2WB1E 2A19A 4IFDJ 4DR6Q 1VQEA 1QUQB 3PO3G 2NZHA 2DUDA 1J5EQ 1IXRA 2AKWB 4AYBE 3J81j 2JA8H 2UXDQ 4BBSG 4DR2Q 2NZOA 4A3MG 3HOZH 5K36G 1XTDA 4B3SQ 1PH6A 3E0EA 4DV2Q 4LUVA 3I55A 1BVSA 1UE6A 3EN2A 3JC66 1Y1WH 1C0AA 1NY4A 1HZAA 1QVCA 4POGA
chains in the Genus database with same CATH superfamily
4B9XA 4UDUC 2HDLA 2F0FA 1P16A 3KFUA 3TP5A 2FP4B 3RZDB 1STGA 2SDFA 2WB1B 1SEIA 4QWDA 3OIPA 2JQOA 4A2AA 2C2DA 3HOZB 2E8GA 4JBMA 2AUJD 3S2DB 1UE5A 4DNRB 4DV2H 1EYCA 4B3RH 4RGMA 3GIIA 5C44G 4O3OA 4JK1C 3N41B 1X9NA 1SYGA 5KX5F 4X3UA 4Z9CB 1B3AA 5LHY1 2JEFA 3IL8A 3S24A 1XMQL 2AMCB 1XNQH 2K5QA 5A2QE 2VQFH 4B3RQ 3DM1A 3F2DA 1WCMB 2NWGA 2YTXA 4YCVA 3TRZA 2BDNA 4GZYC 2LXKA 2IA6A 3K80C 4GNXB 3GTLH 5IGDA 2A73B 2BH8A 2ZTCA 3K7UC 3KBXA 1C7YA 4DV4H 2FLNA 1II3A 2IBKA 2CWPA 3BYYB 4FS2A 4YY3L 2NYZD 1XTCD 4DR4Q 4A3JB 1YITA 4C5AA 3H40A 2WV6D 4DXGA 4UP9A 1BXRA 4XT3B 2V9WA 1V1QA 2L1BA 3SK5A 2AWNA 1VS0A 2Z8LA 3DMUA 4B3SL 2RVLA 3UQ8A 1ET6A 4HJAA 5H1SE 5JEAJ 1HNZQ 3JRWA 2F4VQ 4AYBG 5EWFA 5IYCH 4I65A 1D8LA 4O4IF 3HEJA 3IKJA 2CW8A 2XTIA 3Q2OA 3N8DA 1EUDB 2KSWA 4LF6L 3RB6A 1HJPA 3DWAA 3HKSA 3SEBA 4DV6L 1C30A 2V5AA 3BA8A 4DR7H 1RF2D 4NDXA 1PH9A 4G4KA 4PZ8A 1Q3LA 2K03A 4M8AA 2PPBC 4A2BA 5BMVF 1HQRD 4H02A 1TT2A 1RTNA 2VB2X 5J39A 1STYA 4YIJA 2WP8J 4HJ7A 1IBLH 4BWSC 2JEIA 1XNQL 3HOZG 1VQ7A 3PR5B 2LXJA 2DPIA 3Q23A 4A93H 5IGEA 3A54A 3MXNB 1X3FA 2MNAA 1MD2D 4GLXA 1PK8A 2RKSA 3S1MH 2A68D 2IHEA 3ERSX 4ME5A 3SK4A 3NTKA 2FINB 4GOPB 4DR5Q 3S14H 2XIWA 4JYAH 4M9UA 1BKBA 4B3TL 3GTMA 5DQIA 4ECQA 4GC6A 4DV1H 2W7PA 1V43A 2R7DA 2SNMA 5CBEE 2R93G 2BOSA 2B63A 1BNZA 1R4QB 2A6EC 4IJHA 3R2TA 4JUZA 1N48A 2BQUA 5IGBA 4JV5L 1WH2A 1HNZH 1HR0H 1L1OB 2A69C 4JI5L 1N36H 2Q2UA 5IWAQ 4DL4A 1TS3A 4DUYQ 2K04A 5DLQE 3HOXH 2A1AA 4NXNH 4DK0A 4RGNA 3H09A 4DU9A 2F0VA 1QILA 2QCPX 1IBMH 4C3IB 3EYYA 3GIDA 2ZXPA 3MAQA 4IWXA 5KG4A 3F2CA 3PSIA 5BN5A 5KT2A 2JYOA 3DEPA 1RYSA 5C6AA 1I50A 2E2HH 3GTJA 3GV6A 1GSHA 3KHHA 4JI7Q 5A35A 1N34L 4KHPL 3M4QA 2F0MA 3PIO3 1GHKA 1SJHD 4DA2A 5IP9H 3GTKH 3HZXA 3NTHA 5LXTF 3CHBD 5DNFA 2N88A 2XNAC 4A93G 4IUNA 5IGFA 1VQHA 2QEXA 4O4LF 1KRSA 3LWEA 4CDDC 1A9XA 1AH9A 1S0NA 3HOVB 2VB3X 4NB3A 3S9WA 2D0PA 3A0JA 3VMMA 3A7AB 1O7IA 2JA5G 3ETHA 5E4WC 4IQZA 1DXMA 1IHZA 3CC4A 1STNA 1QG7A 2R84A 1KDAA 3K0XA 1VQMA 1W96A 4YJ3F 1BOSA 3TS0A 2A68C 4G7ZC 4CC6A 1XNRH 3M3YB 3WO1A 2JSOA 1HR0L 1BGWA 3VR6A 1B9NA 5KT6A 4ECUA 1Y1VA 4RNOA 1HNZL 2JXMB 3HKZG 4LJZC 1I4HA 4DK1A 2KJXA 3JAML 2CQYA 4TV8F 4DV3L 1I94H 1L0YB 5EKIA 3MR5A 4DV2L 1WTVA 4DR2H 2QF7A 5JPNC 4ECXA 2F1MA 4RNMA 4FF4A 4X66H 2O2LD 2YTVA 4DV0Q 4XYLB 4E4TA 2F0LA 4GKKL 1CKNA 1U0LA 3G48A 5FLMG 1J5EL 2QKIC 3AMUA 4MTKA 3NQIA 4ULLA 1SYCA 4XDXA 5J3BA 2F0JA 2O5IC 1SBBB 5EPJA 1S40A 2EJGC 1AZQA 5LOVF 3TBIB 3RV4A 1SE3A 1E4FT 2NN6H 3NQTA 1TWGA 5CMDA 2YL2A 4ZLTF 1R9TH 3FPUB 4DL7A 5EOYA 3CCRA 1QZHA 3NHHA 3G6YA 4QQBX 3H3VI 1B2TA 4IAJA 4CJ2C 1VQJA 1OXVA 2C2RA 2JJQA 4LFBH 1RYRA 5M5WB 1GVPA 4LF7L 2FK2A 1EFWA 5HURA 2ZJRA 5C5MA 4JI2L 4O3RA 3WWVA 3S1NB 1FD7D 1WCMA 1V1PA 4EX5A 3PF5A 1KJ8A 4O2BF 4Y8VB 1E2WA 2CW7A 1PFBA 2F0DA 5M3MB 4L5SA 3CCSA 4YP3A 3TQTA 2SOBA 2Z1CA 4TV9F 4EQOA 1ICFB 1PZID 3M85A 1KXLA 3OPOA 3CQZB 1SYFA 3T13A 4JV2A 2HD3A 4OELB 2MQHA 3MZ5A 3CMEA 1EOTA 3VPBA 2IW3A 4FVMA 4X62L 1FJGH 1N34Q 1T3NA 4DV3H 1Y8NB 3MR6A 2J6TA 1MHWC 4DV7Q 3F8TA 3PUVA 1EIGA 4GNXA 5M5YB 4EYIB 1WSCA 1J5EH 5K5PA 4Q0FA 1ZEQX 3TREA 4X64H 4C2MH 1M90C 1SFOB 4A3MH 1VQKA 1M1KC 5IYZF 3CC7A 3KALA 3P20A 1VDZA 4P73A 1ESFA 4DK3C 4EQNA 5IYBG 2R93H 3A8IE 3RLNA 3CXCA 2YZMA 3A8KE 2HHHQ 1N32Q 1EYAA 3H3VH 1FGUA 3KLRA 1S5FD 3VA7A 2ATWA 3I56A 3NPPA 4DGZA 3H91A 2HUGA 2KCNA 3OHAA 5C4XG 2B2WA 2NN6I 4IUPA 5JOBA 3W2DA 3RAXA 1TVXA 4DAYA 1Z2PX 3KBGA 2NVYH 3CU7A 1XX8A 1SDFA 5KNBA 3EIVA 2CHBD 2NZ1D 3Q8QB 1VQBA 4LF5Q 3HB9A 2WAQA 2A74C 3SE0A 4IOAA 5LP6F 2Y0SA 4DL2A 5LMUH 3QJYA 3QR8A 4XYMB 1YBYA 5CR3A 4FU0A 2EZVA 3RAQA 1CHQD 5KG7A 1BDOA 3CCEA 2PQEA 4TSSA 1I4PA 4DNIA 4X62H 4FYDA 2Y0SE 1S5ED 3PF4A 4KHPH 2PYKA 1PFNA 3J7ZC 2ZJTA 5CBAE 2UU9L 4RB3C 4YAKB 1L2ZA 1HTLD 1X32A 1P8LA 4KV6A 3PW2A 2DLNA 1PFMA 4CJ1B 3ULLA 1TWHB 3T53B 3W1BA 4F4WA 4GN4B 4K5XA 5IYCG 2X6LA 3K81C 4BBSH 2EYLA 1TAEA 4JCVE 3T5LA 4F88A 3PMFA 4LFCH 4NXMH 1B6SA 3VYTA 3T5KA 1EEID 3KOJA 4LFBL 2E74C 4KD4A 1OXSC 2UUBH 2IX1A 1DOLA 1EY6A 4XX0B 2DNEA 1RTOA 3MFIA 1SFOA 1WTOA 1HA5A 1V9PA 3J80L 1PDQA 3SR1A 2ZM6H 1CK1A 4KY7A 2A69D 5COYA 3RD4A 2W9AA 1PX2A 4NLGA 4APMA 2W6OA 1AUVA 2CFMA 2RGRA 1Z9FA 2PI2A 2WAQG 3ORRA 1NMFA 2FB9A 3R2IA 4HN7A 4EEYA 1F9SA 5M9OA 1Y1VH 3E9IA 3M7GA 4ED0A 5EDWA 1D1KA 4WRDA 2HVSA 2R8HA 4GKKH 1AE2A 1B1ZA 3BYTB 4PG3A 4KMUC 2Q2TA 3NXWA 1V8QA 2Q8IB 3HOUH 2W6MA 3RFCA 4CDEC 4HNUA 2NVTB 1JJ2A 3RUPA 3EFXD 1EEFD 5KIXA 2A6HC 5KG5A 4IALA 3TP8A 1XWEA 3H6MA 4M7EA 4DV7H 3TP7A 4J9PA 4F7XA 4UPAA 1C9OA 4RHRA 5DQHA 2R7LA 1XMOQ 3R8BA 3JAME 3G4SA 3CRLC 2B2TA 3C1EA 4DR1L 3QIAA 2MGSA 1CSPA 1D5MC 4JI3Q 4OHJA 2I5MX 4JVZA 1EY4A 2MUYA 1JCKB 4KKUA 1SMXA 5KT7A 4RZQA 2R92B 3MWEA 3K8AA 5ELBA 4DFAA 4QGUA 4C3JH 2HCIA 4P2CB 4GN5A 4HJ9A 4OO1H 3A55A 3NTIA 2RGVA 5BPFA 1KC8C 5KFGA 1HQMC 1HNXH 1DCZA 3I90A 3IRBA 3K3VA 4APVA 4YQWA 3GTPA 3NENA 2Y0SG 2AGOA 5C0XI 1G91A 4K5VA 5C4HA 3VPDA 3Q8PB 1CSQA 5FLXW 3RBEA 5F2DA 2YCHA 2UUAQ 3J7A5 4DLKA 2F0QA 2R82A 1YVCA 3Q1KA 4C3HH 3S15B 1YJ9A 5FD5A 5LL6S 3FKIH 5C1OA 1RJTA 1SEBD 1Y1WB 3ICEA 3NBHA 3V6KA 3TQYA 1TWFA 4QWCA 1XNQQ 2O4XA 3DF7A 1XPRA 1BBXC 5DG7A 2WB1E 3LX0A 2F3WA 1VQEA 1QUQB 3PO3G 3I4MB 1TY2A 1S5CD 2K6AA 1W93A 1IXRA 5FKAC 3T51B 4AYBE 4BBSG 2B2UC 4DR2Q 4LF9H 4RAYA 1A3UA 1V1PB 3HOZH 4FBTA 3FMCA 2KOLA 4A3EB 4B3TH 4DUYH 2QDBA 4B3SQ 1PH6A 3E0EA 1JQYD 2LKVA 2FHTA 4KHVA 4JV5H 5J22A 1C0AA 1STHA 1NY4A 1QVCA 4POGA 5LMUQ 2O5JC 2EY5A 5JQWA 2AQ1B 4JI2H 4GC7A 2KUMA 1S5BD 3D4RA 4YWLA 5EPLA 4YJ2F 1Q8IA 4KKSA 2NVXA 1LM0A 3IG0A 4TVAB 1TWCA 3RB4A 3NUCA 3E5NA 4UCSA 3DUZA 3BU2A 1Y1WG 2DIKA 1F2MA 1V1OA 3VDYA 4EGQA 1X3PA 3HS0C 4YR0A 5JVG3 2UXCQ 1RD9D 5DG8A 4DAPA 2UU9H 3I4MH 2L11A 4QIWB 4L5RC 4C3JG 3KJOA 3H4DA 4UAIA 2B2YC 5CV9A 2CW0D 4KK7A 2WAQB 4R4QA 2HQLA 2M05A 3KHLA 1BCPF 3UDXA 2ENBA 4DKAC 3HXLA 1KC7A 2OTJA 4EBEA 4G7HC 4BY1H 5GAEC 3KHGA 1JXLA 1A2TA 5KFOA 4DNTB 2AQ2B 2XWBB 3PV0A 4K2LA 5KYLA 1H9JA 4HR7B 2L9HA 4WFN3 2KVMA 4ECSA 1EY5A 3WO0A 4DR6H 2EIFA 2K5DA 2JA7G 2UU9Q 4PMCA 4OO1G 4A3GH 1SMYC 3P75A 5L1KA 3WOEA 2XCAA 4QUFA 4ZUJA 4RMFA 3F2BA 4FXGC 3G6EA 2BQ3A 3S1QH 1S97A 1HA6A 3BS1A 2OQ0A 2XN9C 5JJIA 2VQDA 1F2LA 3K5MA 1EWCA 3UE0A 3H94A 2YW2A 4DUZH 1EZ1A 3BJYA 4ECZA 5I9PA 4Y52H 1PH7A 1W6JA 4M1UB 3KUPA 4A3KH 1RK5A 5EJWA 4Q0YA 2Z4HA 5CV4A 3CCMA 4JI4Q 3VYSA 2LSSA 4PV1C 2QDLA 4JC0A 1TWHA 5IWAL 1DYQA 3GIJA 2JP1A 3KK7A 1ZQ7A 1G51A 1SAPA 3N6RA 4IOCA 3L7ZC 2QILA 3J80E 3RZOB 5KFWA 3B6YA 4MN3A 1FYCA 4YBZB 5KFPA 1I94Q 2KHSA 2OTLA 4JI4L 1HZBA 4A3EH 1IW7D 3A7LA 3S1QB 4X65H 5C0XH 1UNNC 1VQ9A 1EWHA 3HOUB 4FM9A 1WTQA 1KJ9A 1GKHA 4LF9L 4K6LA 3UFXB 1VQ4A 5CAEB 2IX3A 4LF4Q 4WBNF 4JV1A 4HTHA 2FPGB 1S72A 5FPOA 4ECTA 4YR2A 5IT9W 4TQRA 5KT5A 4ZYSA 3S1MB 2HCCA 2A6HD 3DWQA 4FF2A 3FMAA 1QB5D 3G6JB 3JSNA 1TXYA 2XRSD 4DV6Q 1UUPA 4F4XA 3GIMA 1M7JA 2VPSA 1Y8OB 5IYDG 3FVQA 3IAYA 3GTGB 5KFTA 1D5XC 1PTOF 1I4GA 4YHHQ 1PH4A 3GTPH 2EJMA 2F4VL 1OXUA 4GNXC 1U4PA 2W8KA 3I4MG 1I3QA 3IN5A 1LUZA 3V2TA 2CZGA 1N8RC 1RHPA 1EY0A 2WE6A 2PI2E 2VS1A 1KIXA 2R7ZB 2HJWA 3FKIA 1Q1BA 2C9OA 1X3QA 1U4LA 3N43B 4DF7A 3MC0B 3KJPA 1XDNA 1B3QA 3X3NA 3U4ZA 1A63A 4AYBA 4H0LC 4JI4H 3D6CA 2ASBA 2E2HB 2UVRA 2IL8A 2B2TC 1ASZA 1QJOA 3SHLA 2RQXA 1NUCA 1MSHA 5AJ3L 4XZ3B 4MV8A 4RA8A 4H44C 1B50A 4UP7A 2R7ZH 1IBKL 3R5XA 3J80i 2B8FA 4O1NA 1N33Q 1Q1EA 2V4RA 2XGQA 3C0FB 4O3PA 4NXNQ 2VA3A 3TP6A 5LMUL 4DR2L 2VA2A 2JA5A 5M3FG 5L37A 4BA1I 4B3RL 1GUOA 1CQFA 1K73C 2EY1A 3EVQA 5IYBH 1GUGA 4RB0A 4X6AH 3EBEA 4FF1A 1I50B 2I5LX 4EGJA 4Q5VA 1GHJA 1NSNS 2WB1G 4G57A 3JAMc 3A74A 4DR3H 2E2JH 1QNUA 1SNMA 1D7QA 1N34H 4R1JA 1I7NA 1F77A 2B2VC 1WTXA 3E5SA 2BE5C 4EVOA 5C3XA 1YHBA 3GIPA 4K0KQ 4UHVA 3N44B 3D8GA 3PW5A 3K5OA 1Y1VB 3SVMA 1PZKD 4DUYL 5HBRB 1ML0D 4OEMB 5HY6A 5F9LA 5M5WH 4KHPQ 3BA9A 4YWKA 4V0BA 4I50F 5A2QW 2L0CA 4NP5A 4JI1L 4DAMA 2W6ZA 2BA0A 3Q6SA 4A3BB 1DM0B 4Q8FA 3BDLA 1EYDA 2KEDA 2EDGA 1UE1A 1E2VA 1CQVA 4IFDG 2JA6G 4IHJF 1I5FA 3FHWA 4J15A 4UCUA 4DR5L 2Q8RE 3OOCA 1ZHSA 3V4ZA 2IT1A 2X6GA 5EZYF 2D0OA 4LK1C 1IBKH 1S3OA 2ICEC 3ERQA 3RF2A 3BVGA 2YZGA 2J6SA 1PRTF 1H9KA 2AGPA 5C4ZA 4I55F 3U50C 1KQSA 4GKJL 3CAMA 1CKNB 2MCTA 3EQLC 5ELCA 4RB1A 4RU9A 4DR4H 2KQ3A 1JB3A 3EA6A 3ND8A 1J6QA 1XPOA 2WFWA 2OF1A 4CKEA 1WFQA 3FP9A 1HNXQ 2ASDA 3ZJYC 1TA8A 3M3YH 1M0WA 1GUWA 3TN2A 1K83B 3BABA 2RSOA 2XIGA 4ED1A 1F2YA 3MEFA 5DAUA 1T36A 4ODGA 4QJFA 1NAPA 1K8OA 1JE5A 4NXMQ 4QWAA 3GV5B 2C2EA 3MXNA 3QB3A 3ETJA 2DGYA 1XPUA 4H13C 2E76C 2J6UA 1D6EC 1STAA 1GSOA 2OH2A 1SNPA 2B29A 2RHQB 5C4XB 5M3FB 4DL6A 2BH2A 1SLJA 4LF5H 2EXZA 1DD2A 1J9OA 3KF8A 1YEZA 1KTKA 3VPCA 5DGAA 2R85A 2TMPA 5AJ3Q 2B63B 1PA6A 5IIFA 4WJ3M 4R8IA 3BG5A 2EXDA 4R4IA 3GTQA 1ZXTA 2W9BB 1IBKQ 2VUMG 2K14A 3CPWA 1L1OC 1FGBD 3CCJA 5KRUA 1GO3E 1JKJB 4UCTA 4LSAA 3M9MB 1SE4A 1WYDA 3L9AX 1RCVD 1BO0A 4EBCA 4DR5H 4KD3A 2BA1A 1YNNC 1RJRA 3R93A 3FEWX 4S3SA 4Y7NH 1EZ8A 3UDGA 3G6XA 3J81L 3BZCA 3E9HA 3QO2A 1DOKA 2PCFB 1PMRA 4LFBQ 5KFHA 1EU4A 1PYSB 3K58A 5IGGA 4GN3B 2R7KA 4JI8H 3X3MA 1B33N 2KEEA 1A6XA 1SSOA 3QZ7A 4NXML 3MFGA 1AN7A 3G71A 3RN5A 4K6DA 2G9DA 1EWIA 3MWYW 4J6HA 1YHQA 1X55A 1RODA 4TUYF 1SCUB 1I6VC 2DWCA 5M3MG 4IURA 1Q86C 3ULPA 5JUMA 4PDBA 2ZM6Q 3NEMA 2UUCL 2X0SA 1K28A 1O7ZA 2K50A 1XMQQ 2UXBL 4B3MH 1LTAD 1U4MA 1HPCA 2C22A 2AUKA 4C3IH 3PZPA 5HGQA 3VYUA 4RGTA 2W70A 4FNFA 3KAJA 5LA6F 4F4ZA 2V4QA 3PIOA 3RZOH 2ASLA 3ND9A 2R61A 4N9TA 4I7ZC 2JEBI 3NELA 4OIKA 4RG1A 1JOOA 1Z6HA 5EKLA 1I7LA 3MFHA 2V59A 2R7ZA 3D4WA 2R7NA 5KFFA 3MTSA 1MJEA 3LGJA 2CW0C 4X66L 1ZHQA 2IP4A 1Q12A 3H20A 3M9BA 2ZDHA 1I4RA 1PTOD 3DEOA 5E7NA 3PO2H 1UC8A 1TIID 1GGOA 2KECA 4XQQA 2L4NA 1WD1A 4JV5Q 2F0HA 5JAVA 2D62A 2VQFQ 4IJLA 1RIPA 1IYUA 4JI8L 4DV7L 4JI1Q 3W3AA 5KGUA 1K9MC 2WTFA 2OEOA 3KAKA 2EYOA 4I7AA 3OMGA 3K5IA 1BQQT 2CKZB 1CA6A 3M4OB 5GADC 4XYQA 2ES2A 2E5LQ 4LFCL 1CZWA 2NU9B 4UCOA 3RLFA 1KJIA 4K14A 5BR8H 2ZT9C 2B63H 1CQJB 4A76A 3RB3A 5LYJF 5LMNL 4O0AA 3J81W 5EKKA 1HXYD 3I72A 2I0QA 3CQZA 2JA5B 4A3LG 2KHIA 2J9GA 5KFQA 4IPHA 3HOVG 4JI2Q 4EYHB 4LAAA 3HKZB 2KCTA 3GTOB 1VQCA 4RFBA 1JE4A 2JA7H 3I4NB 1LO5D 3H0GB 1RJQA 5CORA 3T5HA 5G3LF 1N33L 3QFFA 2QW7A 4ZQIA 3JAMW 3HOXB 4JBKA 3IFDA 4LF6H 4GKJH 1X3EA 2K1BA 4F87A 4I7HA 4RKBA 3T5JA 4DAVA 1I50H 4O42A 4IRKA 3GTJH 2W6QA 5KKNB 1NBWA 3RB0A 4A3GB 4CC5A 3BJUA 3V05A 1BR9A 3BDCA 5KFIA 4RGOS 1EYGA 2RDIA 1ICWA 3DHQA 4KTAA 1VBHA 1GD7A 4C1NK 1YI2A 4MZ9A 4P75A 4GLVB 2B2VA 5FLMH 1S68A 2PMZA 3PIPA 2B2YA 2F0WA 4DR6L 4C5BA 2V1CC 4X65L 3AFQA 1TY0A 1TS4A 2K01A 4HIKA 5DGBA 5TSSA 4MTNA 4DR6Q 2NZHA 2FJZA 1J5EQ 1DV2A 5D3IB 5KFKA 4TQSA 2AKWB 2FLLA 2W9CA 2UXDQ 1YNJC 4NW2A 2FJ2A 1KNAA 1AN8A 4RH6A 3PVXA 2YYAA 5K36G 3BQ0A 3FDTA 3RV3A 4DV2Q 1BVSA 1Y1WH 2K32A 4AQYH 5JVLA 1N36L 1BJTA 2W71A 4JI5H 1PTOC 2K05A 1E3PA 5C3EH 4DAYB 1C4QA 2F3IA 2XGPA 3HG9A 4O2AF 1Q81C 2EY6A 3GTQH 4ME3A 3NBHB 3GQCA 4PZ6A 2OCEA 4BBSB 1PH5A 4R8UB 1G8ZD 3OSPA 3AU7A 3DM3A 4IRCA 1ENFA 1Y69U 1G6ZA 3PUXA 4G3IA 2K5NA 2Z0SA 1IL2A 1LT6D 3H15A 1HHVA 1XYIA 5IP9G 5DM73 1IW7C 4TRDA 3AYHB 2ASJA 5IY0A 1JDEA 4ZHQF 4DV4Q 2YU9H 4B08A 1Z2NX 3C2PA 2YZNA 2Z4IA 3RLOA 1QVGA 2XCPA 4J9RA 1JWMD 4IZ8A 5EWEA 2A6ED 3I91A 1MZBA 5KFSA 4LF9Q 4HIMA 3QOLA 3GQBA 4J9OA 1MI2A 2UUCH 2NVXB 4CJ0B 4A3EG 1EHIA 1VBGA 1NTGA 3I4NG 5BR8L 5C4XH 3HRZC 1DV1A 1BNCA 3TIGA 4MV1A 3J7AK 1Q8KA 2N49A 2JEAI 2I87A 2ALZA 5KFDA 1NJIC 3T4AC 1N9WA 5BR8Q 1LT4D 4FBUA 5GAHC 3TIIA 4LMYA 1ZYRD 4EFEA 5KG0A 2K33A 3HOYG 4JI6H 2XWJB 1QVFA 1HTPA 3GV3A 1PZJD 2N78A 4QIWA 1KBLA 5KFCA 4YR3A 2WKCA 3CCUA 4AQYL 5BN3A 4OWXB 4ZAIA 4DV6H 2RDGA 1IBMQ 3I7FA 3LP8A 3PO2B 4CKCA 2GVBA 5EBCA 1I6UA 2VUMA 3Q22A 1EIYB 1X6OA 2O03A 4HR7A 2W7OA 1K3BC 3J7AF 4ZKBB 1V51A 2F4VH 1B44D 4LH7A 4K8JA 2PO4A 3KDFA 1ULZA 1SR3A 4ETSA 4KI0A 4HJ8A 1LLRD 4A3FG 5EBDA 4FP5D 3OHXC 4CGYB 3S14B 1Y14B 4MV9A 4DR3L 2QEJC 4YWMA 4V190 3J7AV 2VNUD 1B6RA 1K8AC 4C2MA 1IKLA 1PRTD 2NN6G 4JPBW 4RWSC 3TEHB 1CS0A 2H5XA 2Z6BA 4GOPA 4BY7G 1KAAA 4JYAQ 1O7YA 2C5CA 2DJFC 3TZUA 2GVAA 5IT9c 2IWHA 3N40P 3HOWB 3N52A 3BDOA 5M5XH 1N36Q 5FJ8H 4BY1G 1OXTA 4OIJA 5I2YA 3TSSA 4L1KA 1SNDA 1SYDA 5KG6A 4JW0A 1G2SA 4K8IA 3BAAA 5KFBA 4HNTA 1K3RA 1UEBA 5FO7B 4HCSA 1ONLA 3CCVA 2NVYA 2JA8G 4IWYA 3MWMA 2H4OA 1JLLB 3CRKC 4A75A 3GTMB 1RKNA 3CQZH 3K6OA 4POFA 4O3QA 4BBRB 1YHAA 3OSNA 3M9OB 3UDIA 4RAUC 2QK4A 1CHPD 4N9PA 2JA7A 3QWNA 1SXTA 1K1QA 2B63G 1B8AA 1WCMG 5IP7H 1D1IA 3KLSX 2P5ZX 1JDBB 1S03G 1RK6A 3S17B 2F4IA 4ED6A 2YRXA 4YAJB 1VKZA 1HR0Q 1HUMA 3HOVH 1SNOA 1DZ1A 3J80W 2W57A 1CT1D 3OMCA 1K8MA 5C44B 1QE6A 2L12A 4B9WA 3A56A 5CC4A 1C48A 4O4HF 4IUTA 4LSXA 2PBZA 4PWQA 4OWTB 1LABA 4DR3Q 2UXCH 3OHBA 3CD6A 2F0GA 1WVLA 3J81c 2HHHH 1LTSD 1N32H 4U68A 4A3KG 5K2MA 4ALPA 2P0AA 1QUQA 3V6JA 3TQ1A 1CTMA 2I5HA 3HKZA 1UAPA 1SYBA 3GV8B 4LW1A 3VR5A 4LFAH 4A3DH 3EPIA 1LTLA 1VQ5A 1IBLQ 1JMCA 1VQGA 3R5HA 1EZ6A 2WIIB 5FO8B 1WTWA 3RTXA 2L55A 4QIWE 1HZ9A 3A5ZB 5KFVA 5FLXL 3RZDH 1PYBA 3HOYH 1I6HB 5C5JA 2Q8TA 2K52A 2VZAA 2WAQE 1KRTA 4UCVA 2K5WA 1YJNA 4K2KA 3CP0A 3GILA 3FKIB 5IE8A 1WD0A 1S0MA 2K28A 2CWAA 1BUVT 2MP1A 1N33H 2HDMA 5J1ZA 3ULJA 4MTEA 3CC2A 4A3IB 4RUAA 2Z6KA 4RKLA 1U9RA 3OYYA 4WD3A 1HRJA 1SMYD 1VQNA 1AUXA 5NUCA 1PLFA 2DZDA 2UUAH 3ZYYX 1TR5A 4FO2A 2MO1A 3RMHA 1XMOL 4N8X1 3Q8DA 1UE7A 2WKDA 3VR2A 5K36H 4IPDA 3GTLA 3CCQA 2GA4B 1E0BA 2WDTA 3HOYB 1FNWA 2JA6B 1I6HH 2JA9A 4U673 4OXPA 5L9XA 2R86A 1PRTB 4AIMA 4EGVA 5J2UF 2ZJPA 4R4CA 5JEAG 3LWBA 5D1OA 5KFJA 3RIZA 1XNRQ 1B53A 3NK9A 4F4YA 1Y1VG 1JWUD 5E4XA 3S2HH 1FJGQ 1GLVA 1K83H 2NB0A 5KFZA 1F2ZA 3R5FA 3PO3H 5C4JH 2XC9A 2F0IA 1LV9A 5ELEA 4GKKQ 1KD1C 5HV6A 4IUVA 1C3OA 3MA2B 3SE7A 2NTTA 1LT5D 2VUMH 2OT2A 1BBWA 5CV6A 2X69A 1B7YB 1WI5A 2PW5A 4LFAQ 1JORA 2PMZE 4A3CH 5KFUA 1TWFH 2PZWA 1VQ8A 4F50A 2GPSA 2NU6B 3KHRA 1MJCA 4QWBA 1QZGA 4A3FB 3K5HA 5EWGA 2UXBH 1EFID 2B3GA 1JWSD 3S2DH 4EBDA 4XXEA 1XMOH 3OWEB 3TZDA 1AEXA 4HCEA 5ISRA 5LMNW 1STBA 4HEDA 5T14A 5T1GA 2RDFA 1BXTA 2NTSA 2BQRA 2UUBQ 4QF4A 1YNND 3KF6B 3H4BA 3I73A 1QCBD 3GTOH 3T56B 4JI1H 3OW2A 3GTMH 3M7NA 1KDCA 4LMQD 2PZTA 4QW9A 4BBRH 4RUCA 1KLUD 1VQAA 3F1ZA 5DM63 1PRTC 1VQOA 4O3SA 2NVXH 2ZJQA 1TWCH 2F0TA 2JA6A 1PFSA 1ZYRC 2VL6A 5FPRA 5KNDA 1HNWH 4XYOA 2I46A 1CA5A 1E7ZA 3MWDA 1HNXL 3WDNA 2NVQH 1I3QB 4FF3A 1I4XA 3I12A 2DY7A 3C3LA 1ASYA 4EQPA 5D1PA 4A3LH 3ORQA 3QZ8A 2RDHA 5BN4A 4A3FH 4H7BA 5FLXc 4HJ5A 4LF8L 5C1PA 1CM9A 5KFRA 4QMGA 1B4OA 1Q46A 2E2HA 4AH6A 3D0FA 4LF4L 2KCCA 2R6FA 2EY2A 4RAZA 2VQFL 4GOPC 5KG3A 4KN4C 5I9OA 5KT4A 2VQEH 4GKJQ 2W6NA 4MV4A 1Z47A 2HHHL 1N32L 3U4VA 3GTKA 2FKLA 1FKAH 2PNHA 5KEEA 4A3IG 2NVYB 2AHOB 1HFNA 5CV8A 4QWEA 3F8NA 1HCZA 2R7FA 1X3GA 5EGTA 3MEHA 2QA4A 1CE8A 1KEEA 4J0MA 4BA2I 1ENAA 2N55A 1XJVA 4IPCA 4HIDA 5M3FH 2YRWA 2AQ4A 4A93B 2JN4A 3I4NH 2JA7B 3BVMA 2F0SA 4X64Q 1W6KA 4JI3L 4LH6A 3A5UA 2A8VA 2PZUA 1VQLA 2RCNA 4XQJA 4JBJA 1NE3A 5CB4F 2CH4W 1EY9A 4BXXG 4EG0A 4ED8A 1W3SA 2AU0A 4ECRA 2KBNA 1E4GT 1WOCA 1O7LA 1K8GA 4JI6Q 2IMWP 4J8QA 2ALYB 1CQIB 3HOWG 3RGZA 1SYEA 5L1JA 1QNKA 4LF6Q 5T1IA 2Q2HA 5L1IA 2XCLA 4CBVA 4RB2C 3M4IA 1EQVA 2KHJA 2E2IB 3STBD 1B04A 3OTOH 5L1LA 4PQXA 3FRPB 2E5LH 5KFMA 2SNSA 4J9QA 1GXDC 5C3EG 1ENCA 2CCZA 1UWVA 4LF8H 1PXUA 2UVWA 4DV1Q 2BR0A 4KKTA 2EJFC 3BZDB 3T1HL 1TWGH 2F0NA 2R6GA 3UE1A 1K0RA 2UXCL 1R9TA 3HFZB 4C3JB 4DR1H 1F9PA 2E2IH 5LMNH 3CVZA 4A3DG 1F9RA 1KAWA 3W5OA 5I6WA 4BWGB 4IZOA 3L4JA 4GS3A 4BY1B 3MXGA 1EY8A 2MHVA 1OO9B 1KABA 4KHZA 3GTKB 1GYFA 2JEGA 1O78A 5CGKA 3L4KA 1CI3M 3I2ZA 1L0WA 1WCMH 5IP7G 1O80A 4LFAL 2E2JB 2NU7B 4ECVA 4K0KH 1FNUA 1PTOB 3HOWH 4ZI7F 3D4DA 4JI7H 2SCUB 3JRXA 1GUSA 3SDZA 4DR4L 3NGDA 4KY6A 4C5CA 3K5NA 2FMAA 4DV0H 1K83A 4YHHL 5CV7A 3J81i 3J81E 1UC9A 1SN8A 3MR3A 5EQ0A 4O3NA 4MNOA 3M9NB 3GLKA 1ESRA 5DLFA 1KDBA 5IOCA 3CW2C 3BQ1A 5D65A 1I3QH 3OW7A 3PUYA 4KJNA 4TKOB 2D5DA 4X3TA 4B3MQ 1XMQH 3EROA 2UVUA 1X65A 2FK3A 2W6PA 5GROA 2WACA 1GJXA 4IFDH 1J8IA 3GTLB 1GM5A 2EQSA 1T94A 2UXDH 2Q2IA 4JOIA 5FO9B 4J9MA 3NSWA 4YCWA 3E6ZX 4E6IA 4FS1A 3RBDA 1V4YA 1TWAH 3ITPA 1X54A 1CZGA 3SGIA 3LNNA 4IFDJ 2F0PA 3OIQA 2A19A 1VAJA 2Z9HA 2DUDA 1DONA 2R93A 2BDOA 5A2QL 2JA8H 3EPGA 3T1HH 2R8GA 2M9VA 1EQTA 4BS9A 3KTMA 4MA5A 1IOVA 3JSLA 1XTDA 1ILQA 1D5ZC 2EYFA 3I55A 1GOZA 2ATLA 3EN2A 1TWCB 4L5TA 1HZAA 3GTOA 2G5DA 1QOHA 1EUJA 1A8VA 1MGSA 2NBFA 4P74A 2W9BA 5FK9C 3T1YQ 1JX4A 2JA6H 2EYMA 1K0SA 4X62Q 1SYXB 2F3VA 4DR1Q 3F2UA 4AQYQ 3KXYT 4JBWA 4DR7L 5KFEA 4ZQ3A 1I94L 3STBC 3GIKA 4YHHH 3CPFA 5AFWA 2HIVA 4PMWA 2LFNA 5E1FA 2FPPB 4Q43A 1HH2P 3L2PA 2AQ3B 4C1NI 2PW7A 3WNZA 3AQQA 4KLKA 3PIP3 3HOUG 1NR4A 1PH8A 2F0EA 3PN1A 1VQ6A 2E75C 1ZKOA 4HIOA 5EAYA 2R3ZA 1SRUA 3GV7B 4HNVA 3K5LA 1ILPA 2FMMA 2GN5A 2C35B 1R4PB 2F0OA 1AFPA 2QYZA 4MHEA 2XD4A 1GUTA 4HSVA 2I80A 2DN8A 1Q7YC 1A3VA 1NMGA 2V4DA 2ZM6L 4DV4L 5FD6A 4R7RA 2WYOA 4OX9L 2DPJA 1YNJD 4ME6A 2B2WC 4UP8A 5H80A 4A3CG 1HFGA 3OUUA 3E3XA 5KFYA 1G291 1SFOH 1GUNA 1MKHA 5C5LA 2MPMA 1NNXA 1K1SA 1TS5A 2R93B 1TS2A 1HUNA 5CA1F 1JOKA 5JVDF 1F9QA 1X56A 4EEQA 2BE5D 1A62A 4XIGS 4FDBA 3RGXA 1SROA 5D14A 1E2ZA 2CQAA 4DV0L 1GSAA 1Y8PB 1VF7A 2D2CC 2R8IA 4ECWA 3JAMi 2J7ZA 1M4VA 4JI0L 5KYIA 1IKMA 1LTTD 4IR1A 4J9NA 4X65Q 4CHTB 4MV6A 3S15H 3PUWA 4NKLA 3L3OC 3D31A 3UI2A 1TU2B 4IUUA 1LTRD 4C3IG 3S16H 2G9HD 4O2DA 4ZRZA 1B70B 1A0IA 4YB8B 3AEVA 4DL3A 4DUZQ 3CF5A 4QB4A 1VMPA 5M3MH 1M6VA 1A3TA 3GIQA 3V6HA 5M5XB 4LF4H 1WTHA 4HMJA 5DG9A 1OWTA 3BG3A 5HGTA 3UDFA 3HBLA 1KL9A 5JH7F 5FOBB 1AP0A 1EQRA 3EJIA 2K4KA 3SK6A 2TSSA 2MFIA 1DOMA 2OXPA 3K57A 2FE3A 2B39A 2YV5A 1JC7A 3BVZA 4A3IH 3TINA 4HYKA 3VA5A 2E2IA 5ELNA 5KG2A 4JYAL 4JI0Q 5JPMC 4DN4M 2YYZA 4U7CA 5IYDH 3RNUA 4FXDA 4YY3H 4LF5L 1JJCB 3N42B 2GPWA 2F03A 3PO3B 4DK6C 2N8NA 4JOIC 4J9SA 4JI7L 4X3KA 4A3JG 1PH2A 1FR3A 2LMCB 4I4TF 3Q8RB 3S1RB 3DXJC 4LWCA 4IR9A 1E4EB 4XQNA 4ID6A 4NMZA 4ZKCB 4EFBA 4L8JA 3I4LA 2ID0A 2LS01 1HR0W 4RHSA 5GAGC 1AZPA 3PR4A 2ZTDA 1IBML 3KLWA 4BY7H 4JI0H 2HIXA 3G7LA 1Q82C 1KJQA 3R3OA 3PW7A 2VXWA 4IUQA 5JVH3 1AE3A 4LFCQ 2RBMA 2RCFA 2RA4A 1PV4A 4MV3A 2R87A 5KFXA 2Y0SB 3D3RA 4QW8A 3DLLA 2CQOA 5C44H 4Q44A 2C28A 2OWOA 5KT3A 3P7JA 1R9TB 2XRQD 3GP7A 3OSOA 3M4PA 4CDFC 2EVBA 3MFYA 1EQQA 2E5LL 4JI8Q 1TWGB 1OTCA 2PVPA 4XT1B 2YS7A 5CYUA 1EUCB 3PW0A 2HVRA 4JI5Q 4B3TQ 2R92G 5KFLA 1TWAA 5DLGA 1MBYA 3MHBA 2OLSA 3MR2A 3V96A 3PGZA 1DIKA 4JG2A 3HGBA 1LTGD 4MTDA 2NUAB 3NE5B 2W9CB 3S1NH 4R8UA 1BCPD 1RDPD 3C46A 4DR7Q 4ILWA 2HT1A 4K0KL 3IFTA 4AYBB 4ZOLF 5KFNA 2Z6KC 1YIJA 2JEJA 2VY3A 2R92H 2M00A 3OWFA 3T1YL 4DXFA 4Y7NB 4ECYA 2A5HA 2W8LA 2ZDGA 1JJGA 3NWTA 1U5KA 3CCLA 2JK8A 3OTOQ 3S16B 1KJJA 3BQ2A 1Z7TA 4N8FA 1VQPA 1YJWA 4HQ6A 1IYJB 1S5DD 2MJ8A 4ABNA 2CH4A 1PYWD 3NP8A 1FNVA 4GLAC 5GQOA 2UUCQ 4WJ4A 1E22A 1BF4A 2FMCA 5ELOA 4LF7Q 1KHIA 1PTOH 3I70A 5ELFA 5EPKA 2HGSA 3G8CA 1WTRA 3K59A 2JE6I 1UNSA 2B8GA 4R9WA 4OL7A 4A3GG 3JZIA 1OXXK 2VQEL 4PMBA 1CKMA 1TQOA 2UXDL 2KCMA 5C3EB 5LL6X 4IN3A 4RCOA 2EYPA 4R8NA 4B3ML 4HMIA 1JT8A 3PQIA 1JB7A 4UY8C 2DNCA 4KJOA 5C4JB 5I2XA 3KLSA 1STEA 4DL5A 2E2DC 3HKZE 3I3CA 3P1HA 2D9UA 3H0GG 3LWUA 4IO9A 1VCIA 1SE8A 2VUMB 3U9OA 1IL8A 2VQEQ 2NVTH 1EL0A 4Q45A 1H9SA 3FKIG 1EOVA 4A3DB 3T1YH 2EOTA 2YU9B 4DV3Q 2NVQB 3PW4A 1SNQA 5JJZA 3S2HB 1QWYA 3BZKA 4C2MB 1IYVA 1EYZA 5CA0F 3H0GH 2NU8B 3C1FA 4A3MB 5FLXE 4A4IA 2VR1A 4OO1I 3K7AH 5IWAH 1HZCA 5IGCA 3T1HQ 2F52A 2WB1A 1M8AA 2NUCA 1AW7A 3KDFB 5M5YH 4MAMA 2QGQA 3MXPA 1FJGL 1TWHH 3OTOL 3Q8SB 2H1EA 2L15A 1U4RA 3GTGH 2IHFA 4DV5Q 1S0OA 4J1MA 2UUAL 5LMNQ 4F8MA 3U9SA 1XXGA 4ZCKA 1H9RA 1JOQA 1BBUA 4UCRA 2PQAA 4X64L 2J4XA 3FDSA 1S4ZA 1L2FA 3ONAB 4OX9H 5D3DA 1H95A 2ZXOA 5D8DA 4J9KA 2XVSA 1S10A 2EYHA 1WR2A 3I8ZA 4QUCA 1RJPA 3GTQB 1EIFA 4KN7C 5G3LD 3HOXG 4OONA 1Y1WA 2ZXRA 4TQUS 4IPGA 5C0XG 3M4YA 2VPQA 5I6YA 2CVRA 2J0TD 4C56C 3D6WA 3QG1A 3NBIA 4LF7H 2AGQA 1N56A 1DGSA 2R8KA 2IPKD 1KNEA 5ELDA 3KF8B 2RHSB 4DPGA 4A3BG 2HQEA 3NWSA 3V4SA 4CKBA 4XTCS 4MA0A 5IT9L 4YCUA 3J80c 1UEAB 3VR3A 2FPIB 4PZ7A 1PH1A 1PVOA 3T16A 4BY7B 1D2BA 1E1OA 3PUZA 4R4OA 1FVIA 3R23A 4OWWB 2ICIA 5I47A 1T5XD 2ZDQA 1VQFA 2MO0A 5KNCA 1KLGD 2LY7A 3L0OA 3URYA 4K5WA 1BCPC 4CDCC 2PN1A 5E3FA 2YU9A 1VMCA 3S1RH 1T9HA 2OQKA 4FXKC 1I4QA 2IX0A 4X66Q 1T5EA 5DQGA 4LF8Q 3SK8A 3PO2G 2AWOA 3W1GA 2K5HA 2DY8A 4J9LA 1EIHA 4UFZA 4LUOA 1WJJA 1IBLL 3PCOB 4QY7A 2RF4A 1LACA 4DV5L 3H3VC 2UXBQ 3GO5A 3N6XA 2K5VA 1Z2OX 2IY5B 4ZUIA 4BBRG 3K3PA 3RN2A 5CV5A 4RZRA 2F0UA 2VW9A 3AFPA 3MJFA 5C8YF 3TDQA 1S9FA 1JICA 3HP3A 3SXHA 3K0YA 4JI3H 3AB9A 3U9TA 2UUBL 4MV7A 4ED3A 1EY7A 3S17H 3M4OH 4ED2A 1ET9A 2EYJA 4A3JH 4LUZA 3TMEA 3J7YW 2PQAB 1CUKA 1VF5C 1E4EA 3Q24A 4G7OC 4HAEA 4P71A 3Q0AA 3CKIB 4RCNA 2M2LA 3I4OA 2R92A 3RJ0A 1PH3A 4A3BH 2KENA 4DUZL 3OUZA 1LT3D 3A8JE 3E0JA 4U6PA 4RNNA 3SI8A 5JJKA 1A2UA 1O75A 4NXNL 1L1OA 2JA5H 4R4TA 5FJ8G 1SNCA 4WJWA 3WOFA 1L0XB 1NR2A 5C3WA 1LYLA 4HSPA 5IT9E 3GTPB 1H9MA 2R7ZG 4IFDI 3DWPA 4L63B 2HVQA 4L6TB 3CMAA 4P72A 1NCVA 1YNXA 3K7AB 4YY3Q 2KA7A 4MIUA 1A15A 3O13A 5F9NA 2GLTA 1TWAB 2PNRC 1IOWA 1CKOA 1RL2A 2BCOA 5KG1A 1G6PA 1ZETA 5I4DA 1EU3A 2FLPA 1TWFB 2I07B 1FL0A 1IZ6A 4EQ5A 4ED7A 2K75A 5C0XJ 5JJLA 5JEAH 3VYRA 1YZ6A 4DV5H 1G2TA 1MSGA 4QCLA 1W2BA 2R8JA 3LMLA 2SEBD 2B2UA 4LNQA 2EPBA 1LTID 4PNYA 1XNRL 4DV1L 3TS2A 1PHJA 5LL6b 3GTJB 1TKWB 4JI6L 4OX9Q 1E1TA 3GDEA 4QL5A 2FK1A 2XSCA 3RR5A 1SE2A 2RSNA 3GD7A 4B3SH 4A3KB 2EE1A 2WINB 5D1OB 3QOJA 3G6VA 5GONF 5IODA 4KY5A 4NPSA 4C3HG 2XGTA 4L5QA 3VR4A 1Q90A 2FFKB 3U58A 3RUZA 5BPHA 2RDJA 1WTPA 2FXQA 1M0TA 1E24A 3ER0A 2R7MA 3H0GA 2N3SA 1HNWQ 4ZK9B 1BCPB 5J2TF 2L5TA 2PMZB 1C8CA 2F0KA 2YS6A 1DJRD 2C00A 1VQIA 1SJED 3KYHC 1B9MA 3KF6A 2I8CA 4C3HB 2V58A 4BXXH 1MIUA 1VQDA 2IJ0A 3GTGA 1CFMA 2UVVA 2ZTEA 4Q8EA 2YTYA 1JR0D 5KFAA 5DEHA 2K7VA 3J81j 2JA8B 2NZOA 4A3MG 1LTBD 1H9SB 4IRDA 2DJGC 4WORA 2VUGA 4JV0A 4LUVA 1JIHA 4OGQC 3MVVA 1UE6A 3JC66 3FPPA 1HNWL 4X3SA 3MXUA 2VOBA
chains in the Genus database with same CATH topology
5LMUQ 1E3PA 5C3EH 1EUJA 1A8VA 4DAYB 2F3IA 4YWLA 4P74A 1P16A 1Q81C 3KFUA 3GTQH 4ME3A 3NBHB 3T1YQ 4PZ6A 1LM0A 4TVAB 2OCEA 2JA6H 2JQOA 1PH5A 4X62Q 4DR1Q 4AQYQ 4JBWA 4DR7L 3BU2A 2E8GA 3DM3A 1Y1WG 3VDYA 1I94L 3STBC 4JBMA 1UE5A 3PUXA 2K5NA 2Z0SA 1IL2A 5C44G 3CPFA 4PMWA 2HIVA 3H15A 2UXCQ 1X9NA 5IP9G 1N36L 1HH2P 3L2PA 3AYHB 3S24A 1XMQL 2AMCB 3AQQA 3I4MH 4L5RC 5IY0A 4KLKA 3KJOA 3HOUG 4DV4Q 2YU9H 4B3RQ 3F2DA 1QVGA 3RLOA 1PH8A 2YTXA 4YCVA 1VQ6A 3TRZA 4R4QA 2HQLA 2LXKA 3K80C 5EAYA 3UDXA 4DKAC 4GNXB 1SRUA 4HIOA 2OTJA 3GTLH 4BY1H 5GAEC 4LF9Q 4HIMA 2BH8A 2ZTCA 3K7UC 3PV0A 1C7YA 4A3EG 2GN5A 2C35B 1NTGA 4WJ4A 3I4NG 2EIFA 2JA7G 5BR8L 2CWPA 5C4XH 2UU9Q 1Q7YC 1NMGA 4OO1G 1Q8KA 2N49A 4YY3L 2ZM6L 4DV4L 2JEAI 4A3GH 1HNWL 4DR4Q 4OX9L 1NJIC 1YITA 1N9WA 5BR8Q 4UP9A 4RMFA 3F2BA 1V1QA 3G6EA 4UP8A 2AWNA 3S1QH 5GAHC 1VS0A 2OQ0A 4A3CG 1G291 5JJIA 1SFOH 1MKHA 4B3SL 3HOYG 4HJAA 1QVFA 3UE0A 5H1SE 2N78A 5JEAJ 1HNZQ 2F4VQ 4AYBG 3CCUA 1X56A 5IYCH 4AQYL 1D8LA 1A62A 4XIGS 4OWXB 4FDBA 4Y52H 1SROA 1PH7A 1IBMQ 3I7FA 2XTIA 4DV0L 4A3KH 2GVBA 4A3BG 3JAMi 1EIYB 4JI0L 1X6OA 4LF6L 1HJPA 3HKSA 4X65Q 3CCMA 4DV6L 4JI4Q 3S15H 3PUWA 3KDFA 3D31A 1SR3A 1PH9A 4PZ8A 2LSSA 3S16H 4KI0A 4HJ8A 4JC0A 4A3FG 4O2DA 5IWAL 4H02A 1Y14B 4DR3L 1B70B 1A0IA 4YWMA 3AEVA 2VNUD 2WP8J 4DUZQ 3CF5A 4HJ7A 1K8AC 1G51A 1XNQL 2NN6G 3HOZG 4IOCA 3L7ZC 3TEHB 5M3MH 2H5XA 4GOPA 2LXJA 1VQ7A 4BY7G 3B6YA 4JYAQ 4A93H 5IT9c 2GVAA 3MXNB 2MNAA 1X3FA 1I94Q 2OTLA 4GLXA 1HZBA 4A3EH 4JI4L 5M5XH 1N36Q 3S1MH 5FJ8H 2IHEA 3ERSX 3UDFA 4BY1G 1OXTA 1KL9A 1VQ9A 4GOPB 4DR5Q 1GKHA 4LF9L 3S14H 1EQRA 1VQ4A 2K4KA 1BKBA 2MFIA 4B3TL 4LF4Q 2YV5A 4A3IH 1K3RA 1UEBA 5ELNA 1V43A 2R7DA 4JYAL 4JI0Q 3CCVA 2R93G 2JA8G 2YYZA 1S72A 5IYDH 3RNUA 4IJHA 4LF5L 1JJCB 4JV5L 4A75A 3CQZH 4POFA 1L1OB 4JI5L 2Q2UA 4DK6C 2N8NA 5IWAQ 4DUYQ 1YHAA 4JOIC 5DLQE 2A1AA 3HOXH 3UDIA 4A3JG 1PH2A 4JI7L 1TXYA 4LWCA 4DV6Q 2B63G 2ID0A 1HR0W 1B8AA 3F2CA 5IYDG 1WCMG 5GAGC 3PSIA 5IP7H 2ZTDA 1IBML 3KLWA 4BY7H 2HIXA 1Q82C 1AE3A 4YHHQ 1PH4A 2E2HH 4LFCQ 3GTPH 2F4VL 1HR0Q 3HOVH 3CCLA 1OXUA 1PV4A 4GNXC 1N34L 4JI7Q 4KHPL 3M4QA 3DLLA 2CQOA 5C44H 3I4MG 1LUZA 2OWOA 4OWTB 5IP9H 3GTKH 4DR3Q 1N8RC 3M4PA 2PI2E 1EQQA 2VS1A 4JI8Q 1OTCA 1KIXA 2E5LL 3CD6A 4A93G 1Q1BA 3J81c 1VQHA 2QEXA 1KRSA 4B3TQ 4JI5Q 2R92G 4A3KG 3KJPA 4ALPA 3U4ZA 1AH9A 4NB3A 1A63A 2D0PA 1QUQA 3A0JA 2ASBA 3PGZA 1ASZA 1O7IA 4JG2A 2JA5G 2I5HA 5AJ3L 3S1NH 4LW1A 4DR7Q 3CC4A 4A3DH 2HT1A 4K0KL 1LTLA 3K0XA 1VQ5A 4UP7A 1IBLQ 1VQGA 1VQMA 2Z6KC 1IBKL 1JMCA 1YIJA 3J80i 2VY3A 2R7ZH 2R92H 4QIWE 3T1YL 1HZ9A 3A5ZB 3TS0A 1N33Q 1Q1EA 1PYBA 3RZDH 3HOYH 1HR0L 1JJGA 2K52A 2VZAA 2WAQE 1KRTA 4NXNQ 1U5KA 5LMUL 2JK8A 3OTOQ 4DR2L 3CP0A 5M3FG 1YJNA 1HNZL 3HKZG 4BA1I 4B3RL 5IE8A 4DV3L 1VQPA 1YJWA 2CWAA 1K73C 1IYJB 4DV2L 5IYBH 4X6AH 3EBEA 3ULJA 2YTVA 4DV0Q 2I5LX 3CC2A 4GLAC 5GQOA 4GKKL 2Z6KA 1CKNA 1U0LA 3G48A 3OYYA 5FLMG 2WB1G 2UUCQ 3JAMc 1E22A 3A74A 1J5EL 5J3BA 2E2JH 1VQNA 5ELOA 1S40A 4LF7Q 1D7QA 1KHIA 4R1JA 2JE6I 1YHBA 2MO1A 4K0KQ 4A3GG 1OXXK 1R9TH 2VQEL 1XMOL 1CKMA 3CCRA 1QZHA 3Q8DA 1UE7A 2KCMA 2UXDL 4QQBX 4IPDA 3H3VI 3CCQA 4DUYL 1VQJA 4B3ML 1OXVA 5HY6A 2JJQA 1I6HH 1JT8A 5M5WH 4KHPQ 4YWKA 1JB7A 4UY8C 1GVPA 4LF7L 1N32L 2JA9A 4OXPA 1EFWA 3HKZE 4JI1L 4DAMA 3H0GG 2ZJRA 4IO9A 1VCIA 2BA0A 4JI2L 1SE8A 4AIMA 2ZJPA 4R4CA 3WWVA 5JEAG 2VQEQ 2NVTH 4EX5A 1UE1A 3PF5A 1XNRQ 3FKIG 1EOVA 2JA6G 4IFDG 1I5FA 3FHWA 4J15A 4L5SA 4DR5L 3CCSA 1Y1VG 4DV3Q 2IT1A 3S2HH 2D0OA 1FJGQ 1S3OA 1K83H 3BZKA 3M85A 3H0GH 3PO3H 5C4JH 1KXLA 4A4IA 4OO1I 3K7AH 3U50C 1KD1C 1KQSA 4GKKQ 4GKJL 1HZCA 2MQHA 3CAMA 3CMEA 3T1HQ 2F52A 1CKNB 4X62L 1N34Q 2VUMH 1BBWA 1B7YB 3KDFB 1J6QA 1WI5A 4LFAQ 5M5YH 2WFWA 3F8TA 3PUVA 4DV7Q 4GNXA 1XPOA 2QGQA 1FJGL 2PMZE 1TWHH 3OTOL 4A3CH 1WFQA 3FP9A 1HNXQ 1TWFH 2L15A 3GTGH 3ZJYC 2IHFA 3M3YH 4DV5Q 1VQ8A 3TREA 2UUAL 5LMNQ 4C2MH 1MJCA 1M90C 1QZGA 3MEFA 4L5TA 4A3MH 1M1KC 1VQKA 4QJFA 1JE5A 1BBUA 3CC7A 4NXMQ 2R93H 4DK3C 2B3GA 4P73A 5IYBG 3S2DH 2PQAA 4X64L 2DGYA 3RLNA 1L2FA 3CXCA 1XPUA 5LMNW 1H95A 2HHHQ 1N32Q 3H3VH 1FGUA 2B29A 2RHQB 2UUBQ 3KF6B 2BH2A 1EIFA 1SLJA 3HOXG 3I56A 4OONA 2ATWA 4TQUS 4IPGA 1YEZA 5C0XG 3GTOH 3OW2A 3GTMH 3M7NA 5C4XG 2NN6I 4BBRH 5AJ3Q 1VQAA 3F1ZA 1PA6A 1DGSA 2NVYH 4WJ3M 1VQOA 2EXDA 4R4IA 2NVXH 3EIVA 2ZJQA 1TWCH 3KF8B 2RHSB 4DPGA 1IBKQ 1PFSA 2VL6A 1VQBA 2K14A 4LF5Q 2VUMG 3CPWA 1L1OC 1E7ZA 4XTCS 3CCJA 4YCUA 1GO3E 3J80c 1HNXL 4IOAA 1WYDA 2NVQH 4PZ7A 1PH1A 1PVOA 1ASYA 2BA1A 1E1OA 4Y7NH 1YBYA 3PUZA 1FVIA 4R4OA 4A3LH 4OWWB 3UDGA 1VQFA 2MO0A 3BZCA 3E9HA 3L0OA 3CCEA 4A3FH 4DNIA 5FLXc 2Y0SE 4HJ5A 3PF4A 4LFBQ 4LF8L 1PYSB 3J7ZC 3S1RH 4GN3B 2UU9L 1T9HA 1Q46A 2OQKA 2IX0A 3D0FA 4AH6A 4LF4L 4X66Q 4LF8Q 4NXML 1P8LA 2AWOA 3W1GA 3PO2G 2VQFL 2K5HA 4GOPC 3ULLA 3G71A 3W1BA 3RN5A 4GN4B 5IYCG 4GKJQ 1EWIA 4LUOA 1WJJA 1YHQA 1IBLL 1X55A 1Z47A 3K81C 3PCOB 2RF4A 4QY7A 3U4VA 4JCVE 4DV5L 2PNHA 2HHHL 5M3MG 2UXBQ 3GO5A 1Q86C 2K5VA 3ULPA 4A3IG 2IY5B 2ZM6Q 2AHOB 3NEMA 3KOJA 4BBRG 2UUCL 3RN2A 4LFBL 2VW9A 1OXSC 3AFPA 2K50A 2UXBL 1XMQQ 2R7FA 1X3GA 2IX1A 2QA4A 4BA2I 4C3IH 5HGQA 1XJVA 4IPCA 4HIDA 5M3FH 2UUBL 3S17H 3M4OH 1V9PA 3PIOA 4A3JH 3RZOH 3NELA 2JEBI 4LUZA 4RG1A 3I4NH 2PQAB 1CUKA 4X64Q 4JI3L 4P71A 3A5UA 2A8VA 2CFMA 1VQLA 2RCNA 3I4OA 4JBJA 1Z9FA 2PI2A 1NE3A 2KENA 4DUZL 1PH3A 1MJEA 3LGJA 4A3BH 4BXXG 4X66L 2WAQG 5JJKA 1Q12A 1NMFA 3M9BA 4NXNL 1L1OA 2JA5H 1Y1VH 1W3SA 3E9IA 4R4TA 2KBNA 5E7NA 5FJ8G 1WOCA 1K8GA 3PO2H 4JI6Q 2ALYB 1LYLA 1AE2A 3HOWG 4PG3A 4JV5Q 4LF6Q 2R7ZG 4IFDI 2Q2HA 2Q2TA 2D62A 2KHJA 3STBD 3CMAA 2VQFQ 3HOUH 4IJLA 4P72A 1RIPA 1YNXA 4YY3Q 4JI8L 4DV7L 5C3EG 4JI1Q 2CCZA 1UWVA 1K9MC 1JJ2A 4DV1Q 1CKOA 1RL2A 1G6PA 2CKZB 3T1HL 1TWGH 2R6GA 3UE1A 1FL0A 1K0RA 5GADC 1IZ6A 2ES2A 4UPAA 4EQ5A 2UXCL 1C9OA 4LFCL 3HFZB 2K75A 5C0XJ 2E5LQ 5JJLA 1XMOQ 2E2IH 3RLFA 4A3DG 1YZ6A 1KAWA 3G4SA 3W5OA 1W2BA 2B63H 4GS3A 4A76A 4DR1L 4LNQA 1CSPA 5LMNL 4O0AA 1XNRL 3TS2A 4DV1L 2I0QA 4JI3Q 1PHJA 4KHZA 4A3LG 2KHIA 2I5MX 4JI6L 4OX9Q 4IPHA 1E1TA 3GDEA 4QL5A 1SMXA 3HOVG 4JI2Q 3RR5A 3I2ZA 3GD7A 2KCTA 3K8AA 1WCMH 1VQCA 1L0WA 5IP7G 4QGUA 4C3JH 4LFAL 2JA7H 4GN5A 3HOWH 4HJ9A 1N33L 1KC8C 4JBKA 4DR4L 4NPSA 2XGTA 4L5QA 3U58A 1X3EA 3IRBA 4APVA 2FXQA 4YHHL 3J81i 1E24A 1I50H 3ER0A 1SN8A 3NENA 4MNOA 2Y0SG 2N3SA 3GTJH 5C0XI 4BBSH 1HNWQ 1NBWA 1CSQA 3BJUA 3CW2C 1I3QH 3PUYA 1EYGA 4B3MQ 2UUAQ 3J7A5 1X65A 1GD7A 1YVCA 1YI2A 4MZ9A 5GROA 1VQIA 4P75A 4C3HH 3KYHC 1YJ9A 3KF6A 3FKIH 4GLVB 5FLMH 1GM5A 2EQSA 3ICEA 4BXXH 2Q2IA 4JOIA 3PIPA 3TQYA 1MIUA 1VQDA 4YCWA 4DR6L 1XNQQ 2V1CC 4X65L 1TWAH 3AFQA 2ZTEA 1X54A 1XPRA 4HIKA 3SGIA 2YTYA 4MTNA 2WB1E 2A19A 4IFDJ 4DR6Q 1VQEA 1QUQB 3PO3G 2NZHA 2DUDA 1J5EQ 1IXRA 2AKWB 4AYBE 3J81j 2JA8H 2UXDQ 4BBSG 4DR2Q 2NZOA 4A3MG 3HOZH 5K36G 1XTDA 4B3SQ 1PH6A 3E0EA 4DV2Q 4LUVA 3I55A 1BVSA 1UE6A 3EN2A 3JC66 1Y1WH 1C0AA 1NY4A 1HZAA 1QVCA 4POGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU Q;  1E3P A;  5C3E H;  1EUJ A;  1A8V A;  4DAY B;  2F3I A;  4YWL A;  4P74 A;  1P16 A;  1Q81 C;  3KFU A;  3GTQ H;  4ME3 A;  3NBH B;  3T1Y Q;  4PZ6 A;  1LM0 A;  4TVA B;  2OCE A;  2JA6 H;  2JQO A;  1PH5 A;  4X62 Q;  4DR1 Q;  4AQY Q;  4JBW A;  4DR7 L;  3BU2 A;  2E8G A;  3DM3 A;  1Y1W G;  3VDY A;  1I94 L;  3STB C;  4JBM A;  1UE5 A;  3PUX A;  2K5N A;  2Z0S A;  1IL2 A;  5C44 G;  3CPF A;  4PMW A;  2HIV A;  3H15 A;  2UXC Q;  1X9N A;  5IP9 G;  1N36 L;  1HH2 P;  3L2P A;  3AYH B;  3S24 A;  1XMQ L;  2AMC B;  3AQQ A;  3I4M H;  4L5R C;  5IY0 A;  4KLK A;  3KJO A;  3HOU G;  4DV4 Q;  2YU9 H;  4B3R Q;  3F2D A;  1QVG A;  3RLO A;  1PH8 A;  2YTX A;  4YCV A;  1VQ6 A;  3TRZ A;  4R4Q A;  2HQL A;  2LXK A;  3K80 C;  5EAY A;  3UDX A;  4DKA C;  4GNX B;  1SRU A;  4HIO A;  2OTJ A;  3GTL H;  4BY1 H;  5GAE C;  4LF9 Q;  4HIM A;  2BH8 A;  2ZTC A;  3K7U C;  3PV0 A;  1C7Y A;  4A3E G;  2GN5 A;  2C35 B;  1NTG A;  4WJ4 A;  3I4N G;  2EIF A;  2JA7 G;  5BR8 L;  2CWP A;  5C4X H;  2UU9 Q;  1Q7Y C;  1NMG A;  4OO1 G;  1Q8K A;  2N49 A;  4YY3 L;  2ZM6 L;  4DV4 L;  2JEA I;  4A3G H;  1HNW L;  4DR4 Q;  4OX9 L;  1NJI C;  1YIT A;  1N9W A;  5BR8 Q;  4UP9 A;  4RMF A;  3F2B A;  1V1Q A;  3G6E A;  4UP8 A;  2AWN A;  3S1Q H;  5GAH C;  1VS0 A;  2OQ0 A;  4A3C G;  1G29 1;  5JJI A;  1SFO H;  1MKH A;  4B3S L;  3HOY G;  4HJA A;  1QVF A;  3UE0 A;  5H1S E;  2N78 A;  5JEA J;  1HNZ Q;  2F4V Q;  4AYB G;  3CCU A;  1X56 A;  5IYC H;  4AQY L;  1D8L A;  1A62 A;  4XIG S;  4OWX B;  4FDB A;  4Y52 H;  1SRO A;  1PH7 A;  1IBM Q;  3I7F A;  2XTI A;  4DV0 L;  4A3K H;  2GVB A;  4A3B G;  3JAM i;  1EIY B;  4JI0 L;  1X6O A;  4LF6 L;  1HJP A;  3HKS A;  4X65 Q;  3CCM A;  4DV6 L;  4JI4 Q;  3S15 H;  3PUW A;  3KDF A;  3D31 A;  1SR3 A;  1PH9 A;  4PZ8 A;  2LSS A;  3S16 H;  4KI0 A;  4HJ8 A;  4JC0 A;  4A3F G;  4O2D A;  5IWA L;  4H02 A;  1Y14 B;  4DR3 L;  1B70 B;  1A0I A;  4YWM A;  3AEV A;  2VNU D;  2WP8 J;  4DUZ Q;  3CF5 A;  4HJ7 A;  1K8A C;  1G51 A;  1XNQ L;  2NN6 G;  3HOZ G;  4IOC A;  3L7Z C;  3TEH B;  5M3M H;  2H5X A;  4GOP A;  2LXJ A;  1VQ7 A;  4BY7 G;  3B6Y A;  4JYA Q;  4A93 H;  5IT9 c;  2GVA A;  3MXN B;  2MNA A;  1X3F A;  1I94 Q;  2OTL A;  4GLX A;  1HZB A;  4A3E H;  4JI4 L;  5M5X H;  1N36 Q;  3S1M H;  5FJ8 H;  2IHE A;  3ERS X;  3UDF A;  4BY1 G;  1OXT A;  1KL9 A;  1VQ9 A;  4GOP B;  4DR5 Q;  1GKH A;  4LF9 L;  3S14 H;  1EQR A;  1VQ4 A;  2K4K A;  1BKB A;  2MFI A;  4B3T L;  4LF4 Q;  2YV5 A;  4A3I H;  1K3R A;  1UEB A;  5ELN A;  1V43 A;  2R7D A;  4JYA L;  4JI0 Q;  3CCV A;  2R93 G;  2JA8 G;  2YYZ A;  1S72 A;  5IYD H;  3RNU A;  4IJH A;  4LF5 L;  1JJC B;  4JV5 L;  4A75 A;  3CQZ H;  4POF A;  1L1O B;  4JI5 L;  2Q2U A;  4DK6 C;  2N8N A;  5IWA Q;  4DUY Q;  1YHA A;  4JOI C;  5DLQ E;  2A1A A;  3HOX H;  3UDI A;  4A3J G;  1PH2 A;  4JI7 L;  1TXY A;  4LWC A;  4DV6 Q;  2B63 G;  2ID0 A;  1HR0 W;  1B8A A;  3F2C A;  5IYD G;  1WCM G;  5GAG C;  3PSI A;  5IP7 H;  2ZTD A;  1IBM L;  3KLW A;  4BY7 H;  2HIX A;  1Q82 C;  1AE3 A;  4YHH Q;  1PH4 A;  2E2H H;  4LFC Q;  3GTP H;  2F4V L;  1HR0 Q;  3HOV H;  3CCL A;  1OXU A;  1PV4 A;  4GNX C;  1N34 L;  4JI7 Q;  4KHP L;  3M4Q A;  3DLL A;  2CQO A;  5C44 H;  3I4M G;  1LUZ A;  2OWO A;  4OWT B;  5IP9 H;  3GTK H;  4DR3 Q;  1N8R C;  3M4P A;  2PI2 E;  1EQQ A;  2VS1 A;  4JI8 Q;  1OTC A;  1KIX A;  2E5L L;  3CD6 A;  4A93 G;  1Q1B A;  3J81 c;  1VQH A;  2QEX A;  1KRS A;  4B3T Q;  4JI5 Q;  2R92 G;  4A3K G;  3KJP A;  4ALP A;  3U4Z A;  1AH9 A;  4NB3 A;  1A63 A;  2D0P A;  1QUQ A;  3A0J A;  2ASB A;  3PGZ A;  1ASZ A;  1O7I A;  4JG2 A;  2JA5 G;  2I5H A;  5AJ3 L;  3S1N H;  4LW1 A;  4DR7 Q;  3CC4 A;  4A3D H;  2HT1 A;  4K0K L;  1LTL A;  3K0X A;  1VQ5 A;  4UP7 A;  1IBL Q;  1VQG A;  1VQM A;  2Z6K C;  1IBK L;  1JMC A;  1YIJ A;  3J80 i;  2VY3 A;  2R7Z H;  2R92 H;  4QIW E;  3T1Y L;  1HZ9 A;  3A5Z B;  3TS0 A;  1N33 Q;  1Q1E A;  1PYB A;  3RZD H;  3HOY H;  1HR0 L;  1JJG A;  2K52 A;  2VZA A;  2WAQ E;  1KRT A;  4NXN Q;  1U5K A;  5LMU L;  2JK8 A;  3OTO Q;  4DR2 L;  3CP0 A;  5M3F G;  1YJN A;  1HNZ L;  3HKZ G;  4BA1 I;  4B3R L;  5IE8 A;  4DV3 L;  1VQP A;  1YJW A;  2CWA A;  1K73 C;  1IYJ B;  4DV2 L;  5IYB H;  4X6A H;  3EBE A;  3ULJ A;  2YTV A;  4DV0 Q;  2I5L X;  3CC2 A;  4GLA C;  5GQO A;  4GKK L;  2Z6K A;  1CKN A;  1U0L A;  3G48 A;  3OYY A;  5FLM G;  2WB1 G;  2UUC Q;  3JAM c;  1E22 A;  3A74 A;  1J5E L;  5J3B A;  2E2J H;  1VQN A;  5ELO A;  1S40 A;  4LF7 Q;  1D7Q A;  1KHI A;  4R1J A;  2JE6 I;  1YHB A;  2MO1 A;  4K0K Q;  4A3G G;  1OXX K;  1R9T H;  2VQE L;  1XMO L;  1CKM A;  3CCR A;  1QZH A;  3Q8D A;  1UE7 A;  2KCM A;  2UXD L;  4QQB X;  4IPD A;  3H3V I;  3CCQ A;  4DUY L;  1VQJ A;  4B3M L;  1OXV A;  5HY6 A;  2JJQ A;  1I6H H;  1JT8 A;  5M5W H;  4KHP Q;  4YWK A;  1JB7 A;  4UY8 C;  1GVP A;  4LF7 L;  1N32 L;  2JA9 A;  4OXP A;  1EFW A;  3HKZ E;  4JI1 L;  4DAM A;  3H0G G;  2ZJR A;  4IO9 A;  1VCI A;  2BA0 A;  4JI2 L;  1SE8 A;  4AIM A;  2ZJP A;  4R4C A;  3WWV A;  5JEA G;  2VQE Q;  2NVT H;  4EX5 A;  1UE1 A;  3PF5 A;  1XNR Q;  3FKI G;  1EOV A;  2JA6 G;  4IFD G;  1I5F A;  3FHW A;  4J15 A;  4L5S A;  4DR5 L;  3CCS A;  1Y1V G;  4DV3 Q;  2IT1 A;  3S2H H;  2D0O A;  1FJG Q;  1S3O A;  1K83 H;  3BZK A;  3M85 A;  3H0G H;  3PO3 H;  5C4J H;  1KXL A;  4A4I A;  4OO1 I;  3K7A H;  3U50 C;  1KD1 C;  1KQS A;  4GKK Q;  4GKJ L;  1HZC A;  2MQH A;  3CAM A;  3CME A;  3T1H Q;  2F52 A;  1CKN B;  4X62 L;  1N34 Q;  2VUM H;  1BBW A;  1B7Y B;  3KDF B;  1J6Q A;  1WI5 A;  4LFA Q;  5M5Y H;  2WFW A;  3F8T A;  3PUV A;  4DV7 Q;  4GNX A;  1XPO A;  2QGQ A;  1FJG L;  2PMZ E;  1TWH H;  3OTO L;  4A3C H;  1WFQ A;  3FP9 A;  1HNX Q;  1TWF H;  2L15 A;  3GTG H;  3ZJY C;  2IHF A;  3M3Y H;  4DV5 Q;  1VQ8 A;  3TRE A;  2UUA L;  5LMN Q;  4C2M H;  1MJC A;  1M90 C;  1QZG A;  3MEF A;  4L5T A;  4A3M H;  1M1K C;  1VQK A;  4QJF A;  1JE5 A;  1BBU A;  3CC7 A;  4NXM Q;  2R93 H;  4DK3 C;  2B3G A;  4P73 A;  5IYB G;  3S2D H;  2PQA A;  4X64 L;  2DGY A;  3RLN A;  1L2F A;  3CXC A;  1XPU A;  5LMN W;  1H95 A;  2HHH Q;  1N32 Q;  3H3V H;  1FGU A;  2B29 A;  2RHQ B;  2UUB Q;  3KF6 B;  2BH2 A;  1EIF A;  1SLJ A;  3HOX G;  3I56 A;  4OON A;  2ATW A;  4TQU S;  4IPG A;  1YEZ A;  5C0X G;  3GTO H;  3OW2 A;  3GTM H;  3M7N A;  5C4X G;  2NN6 I;  4BBR H;  5AJ3 Q;  1VQA A;  3F1Z A;  1PA6 A;  1DGS A;  2NVY H;  4WJ3 M;  1VQO A;  2EXD A;  4R4I A;  2NVX H;  3EIV A;  2ZJQ A;  1TWC H;  3KF8 B;  2RHS B;  4DPG A;  1IBK Q;  1PFS A;  2VL6 A;  1VQB A;  2K14 A;  4LF5 Q;  2VUM G;  3CPW A;  1L1O C;  1E7Z A;  4XTC S;  3CCJ A;  4YCU A;  1GO3 E;  3J80 c;  1HNX L;  4IOA A;  1WYD A;  2NVQ H;  4PZ7 A;  1PH1 A;  1PVO A;  1ASY A;  2BA1 A;  1E1O A;  4Y7N H;  1YBY A;  3PUZ A;  1FVI A;  4R4O A;  4A3L H;  4OWW B;  3UDG A;  1VQF A;  2MO0 A;  3BZC A;  3E9H A;  3L0O A;  3CCE A;  4A3F H;  4DNI A;  5FLX c;  2Y0S E;  4HJ5 A;  3PF4 A;  4LFB Q;  4LF8 L;  1PYS B;  3J7Z C;  3S1R H;  4GN3 B;  2UU9 L;  1T9H A;  1Q46 A;  2OQK A;  2IX0 A;  3D0F A;  4AH6 A;  4LF4 L;  4X66 Q;  4LF8 Q;  4NXM L;  1P8L A;  2AWO A;  3W1G A;  3PO2 G;  2VQF L;  2K5H A;  4GOP C;  3ULL A;  3G71 A;  3W1B A;  3RN5 A;  4GN4 B;  5IYC G;  4GKJ Q;  1EWI A;  4LUO A;  1WJJ A;  1YHQ A;  1IBL L;  1X55 A;  1Z47 A;  3K81 C;  3PCO B;  2RF4 A;  4QY7 A;  3U4V A;  4JCV E;  4DV5 L;  2PNH A;  2HHH L;  5M3M G;  2UXB Q;  3GO5 A;  1Q86 C;  2K5V A;  3ULP A;  4A3I G;  2IY5 B;  2ZM6 Q;  2AHO B;  3NEM A;  3KOJ A;  4BBR G;  2UUC L;  3RN2 A;  4LFB L;  2VW9 A;  1OXS C;  3AFP A;  2K50 A;  2UXB L;  1XMQ Q;  2R7F A;  1X3G A;  2IX1 A;  2QA4 A;  4BA2 I;  4C3I H;  5HGQ A;  1XJV A;  4IPC A;  4HID A;  5M3F H;  2UUB L;  3S17 H;  3M4O H;  1V9P A;  3PIO A;  4A3J H;  3RZO H;  3NEL A;  2JEB I;  4LUZ A;  4RG1 A;  3I4N H;  2PQA B;  1CUK A;  4X64 Q;  4JI3 L;  4P71 A;  3A5U A;  2A8V A;  2CFM A;  1VQL A;  2RCN A;  3I4O A;  4JBJ A;  1Z9F A;  2PI2 A;  1NE3 A;  2KEN A;  4DUZ L;  1PH3 A;  1MJE A;  3LGJ A;  4A3B H;  4BXX G;  4X66 L;  2WAQ G;  5JJK A;  1Q12 A;  1NMF A;  3M9B A;  4NXN L;  1L1O A;  2JA5 H;  1Y1V H;  1W3S A;  3E9I A;  4R4T A;  2KBN A;  5E7N A;  5FJ8 G;  1WOC A;  1K8G A;  3PO2 H;  4JI6 Q;  2ALY B;  1LYL A;  1AE2 A;  3HOW G;  4PG3 A;  4JV5 Q;  4LF6 Q;  2R7Z G;  4IFD I;  2Q2H A;  2Q2T A;  2D62 A;  2KHJ A;  3STB D;  3CMA A;  2VQF Q;  3HOU H;  4IJL A;  4P72 A;  1RIP A;  1YNX A;  4YY3 Q;  4JI8 L;  4DV7 L;  5C3E G;  4JI1 Q;  2CCZ A;  1UWV A;  1K9M C;  1JJ2 A;  4DV1 Q;  1CKO A;  1RL2 A;  1G6P A;  2CKZ B;  3T1H L;  1TWG H;  2R6G A;  3UE1 A;  1FL0 A;  1K0R A;  5GAD C;  1IZ6 A;  2ES2 A;  4UPA A;  4EQ5 A;  2UXC L;  1C9O A;  4LFC L;  3HFZ B;  2K75 A;  5C0X J;  2E5L Q;  5JJL A;  1XMO Q;  2E2I H;  3RLF A;  4A3D G;  1YZ6 A;  1KAW A;  3G4S A;  3W5O A;  1W2B A;  2B63 H;  4GS3 A;  4A76 A;  4DR1 L;  4LNQ A;  1CSP A;  5LMN L;  4O0A A;  1XNR L;  3TS2 A;  4DV1 L;  2I0Q A;  4JI3 Q;  1PHJ A;  4KHZ A;  4A3L G;  2KHI A;  2I5M X;  4JI6 L;  4OX9 Q;  4IPH A;  1E1T A;  3GDE A;  4QL5 A;  1SMX A;  3HOV G;  4JI2 Q;  3RR5 A;  3I2Z A;  3GD7 A;  2KCT A;  3K8A A;  1WCM H;  1VQC A;  1L0W A;  5IP7 G;  4QGU A;  4C3J H;  4LFA L;  2JA7 H;  4GN5 A;  3HOW H;  4HJ9 A;  1N33 L;  1KC8 C;  4JBK A;  4DR4 L;  4NPS A;  2XGT A;  4L5Q A;  3U58 A;  1X3E A;  3IRB A;  4APV A;  2FXQ A;  4YHH L;  3J81 i;  1E24 A;  1I50 H;  3ER0 A;  1SN8 A;  3NEN A;  4MNO A;  2Y0S G;  2N3S A;  3GTJ H;  5C0X I;  4BBS H;  1HNW Q;  1NBW A;  1CSQ A;  3BJU A;  3CW2 C;  1I3Q H;  3PUY A;  1EYG A;  4B3M Q;  2UUA Q;  3J7A 5;  1X65 A;  1GD7 A;  1YVC A;  1YI2 A;  4MZ9 A;  5GRO A;  1VQI A;  4P75 A;  4C3H H;  3KYH C;  1YJ9 A;  3KF6 A;  3FKI H;  4GLV B;  5FLM H;  1GM5 A;  2EQS A;  3ICE A;  4BXX H;  2Q2I A;  4JOI A;  3PIP A;  3TQY A;  1MIU A;  1VQD A;  4YCW A;  4DR6 L;  1XNQ Q;  2V1C C;  4X65 L;  1TWA H;  3AFQ A;  2ZTE A;  1X54 A;  1XPR A;  4HIK A;  3SGI A;  2YTY A;  4MTN A;  2WB1 E;  2A19 A;  4IFD J;  4DR6 Q;  1VQE A;  1QUQ B;  3PO3 G;  2NZH A;  2DUD A;  1J5E Q;  1IXR A;  2AKW B;  4AYB E;  3J81 j;  2JA8 H;  2UXD Q;  4BBS G;  4DR2 Q;  2NZO A;  4A3M G;  3HOZ H;  5K36 G;  1XTD A;  4B3S Q;  1PH6 A;  3E0E A;  4DV2 Q;  4LUV A;  3I55 A;  1BVS A;  1UE6 A;  3EN2 A;  3JC6 6;  1Y1W H;  1C0A A;  1NY4 A;  1HZA A;  1QVC A;  4POG A; 
#chains in the Genus database with same CATH topology
 4B9X A;  4UDU C;  2HDL A;  2F0F A;  1P16 A;  3KFU A;  3TP5 A;  2FP4 B;  3RZD B;  1STG A;  2SDF A;  2WB1 B;  1SEI A;  4QWD A;  3OIP A;  2JQO A;  4A2A A;  2C2D A;  3HOZ B;  2E8G A;  4JBM A;  2AUJ D;  3S2D B;  1UE5 A;  4DNR B;  4DV2 H;  1EYC A;  4B3R H;  4RGM A;  3GII A;  5C44 G;  4O3O A;  4JK1 C;  3N41 B;  1X9N A;  1SYG A;  5KX5 F;  4X3U A;  4Z9C B;  1B3A A;  5LHY 1;  2JEF A;  3IL8 A;  3S24 A;  1XMQ L;  2AMC B;  1XNQ H;  2K5Q A;  5A2Q E;  2VQF H;  4B3R Q;  3DM1 A;  3F2D A;  1WCM B;  2NWG A;  2YTX A;  4YCV A;  3TRZ A;  2BDN A;  4GZY C;  2LXK A;  2IA6 A;  3K80 C;  4GNX B;  3GTL H;  5IGD A;  2A73 B;  2BH8 A;  2ZTC A;  3K7U C;  3KBX A;  1C7Y A;  4DV4 H;  2FLN A;  1II3 A;  2IBK A;  2CWP A;  3BYY B;  4FS2 A;  4YY3 L;  2NYZ D;  1XTC D;  4DR4 Q;  4A3J B;  1YIT A;  4C5A A;  3H40 A;  2WV6 D;  4DXG A;  4UP9 A;  1BXR A;  4XT3 B;  2V9W A;  1V1Q A;  2L1B A;  3SK5 A;  2AWN A;  1VS0 A;  2Z8L A;  3DMU A;  4B3S L;  2RVL A;  3UQ8 A;  1ET6 A;  4HJA A;  5H1S E;  5JEA J;  1HNZ Q;  3JRW A;  2F4V Q;  4AYB G;  5EWF A;  5IYC H;  4I65 A;  1D8L A;  4O4I F;  3HEJ A;  3IKJ A;  2CW8 A;  2XTI A;  3Q2O A;  3N8D A;  1EUD B;  2KSW A;  4LF6 L;  3RB6 A;  1HJP A;  3DWA A;  3HKS A;  3SEB A;  4DV6 L;  1C30 A;  2V5A A;  3BA8 A;  4DR7 H;  1RF2 D;  4NDX A;  1PH9 A;  4G4K A;  4PZ8 A;  1Q3L A;  2K03 A;  4M8A A;  2PPB C;  4A2B A;  5BMV F;  1HQR D;  4H02 A;  1TT2 A;  1RTN A;  2VB2 X;  5J39 A;  1STY A;  4YIJ A;  2WP8 J;  4HJ7 A;  1IBL H;  4BWS C;  2JEI A;  1XNQ L;  3HOZ G;  1VQ7 A;  3PR5 B;  2LXJ A;  2DPI A;  3Q23 A;  4A93 H;  5IGE A;  3A54 A;  3MXN B;  1X3F A;  2MNA A;  1MD2 D;  4GLX A;  1PK8 A;  2RKS A;  3S1M H;  2A68 D;  2IHE A;  3ERS X;  4ME5 A;  3SK4 A;  3NTK A;  2FIN B;  4GOP B;  4DR5 Q;  3S14 H;  2XIW A;  4JYA H;  4M9U A;  1BKB A;  4B3T L;  3GTM A;  5DQI A;  4ECQ A;  4GC6 A;  4DV1 H;  2W7P A;  1V43 A;  2R7D A;  2SNM A;  5CBE E;  2R93 G;  2BOS A;  2B63 A;  1BNZ A;  1R4Q B;  2A6E C;  4IJH A;  3R2T A;  4JUZ A;  1N48 A;  2BQU A;  5IGB A;  4JV5 L;  1WH2 A;  1HNZ H;  1HR0 H;  1L1O B;  2A69 C;  4JI5 L;  1N36 H;  2Q2U A;  5IWA Q;  4DL4 A;  1TS3 A;  4DUY Q;  2K04 A;  5DLQ E;  3HOX H;  2A1A A;  4NXN H;  4DK0 A;  4RGN A;  3H09 A;  4DU9 A;  2F0V A;  1QIL A;  2QCP X;  1IBM H;  4C3I B;  3EYY A;  3GID A;  2ZXP A;  3MAQ A;  4IWX A;  5KG4 A;  3F2C A;  3PSI A;  5BN5 A;  5KT2 A;  2JYO A;  3DEP A;  1RYS A;  5C6A A;  1I50 A;  2E2H H;  3GTJ A;  3GV6 A;  1GSH A;  3KHH A;  4JI7 Q;  5A35 A;  1N34 L;  4KHP L;  3M4Q A;  2F0M A;  3PIO 3;  1GHK A;  1SJH D;  4DA2 A;  5IP9 H;  3GTK H;  3HZX A;  3NTH A;  5LXT F;  3CHB D;  5DNF A;  2N88 A;  2XNA C;  4A93 G;  4IUN A;  5IGF A;  1VQH A;  2QEX A;  4O4L F;  1KRS A;  3LWE A;  4CDD C;  1A9X A;  1AH9 A;  1S0N A;  3HOV B;  2VB3 X;  4NB3 A;  3S9W A;  2D0P A;  3A0J A;  3VMM A;  3A7A B;  1O7I A;  2JA5 G;  3ETH A;  5E4W C;  4IQZ A;  1DXM A;  1IHZ A;  3CC4 A;  1STN A;  1QG7 A;  2R84 A;  1KDA A;  3K0X A;  1VQM A;  1W96 A;  4YJ3 F;  1BOS A;  3TS0 A;  2A68 C;  4G7Z C;  4CC6 A;  1XNR H;  3M3Y B;  3WO1 A;  2JSO A;  1HR0 L;  1BGW A;  3VR6 A;  1B9N A;  5KT6 A;  4ECU A;  1Y1V A;  4RNO A;  1HNZ L;  2JXM B;  3HKZ G;  4LJZ C;  1I4H A;  4DK1 A;  2KJX A;  3JAM L;  2CQY A;  4TV8 F;  4DV3 L;  1I94 H;  1L0Y B;  5EKI A;  3MR5 A;  4DV2 L;  1WTV A;  4DR2 H;  2QF7 A;  5JPN C;  4ECX A;  2F1M A;  4RNM A;  4FF4 A;  4X66 H;  2O2L D;  2YTV A;  4DV0 Q;  4XYL B;  4E4T A;  2F0L A;  4GKK L;  1CKN A;  1U0L A;  3G48 A;  5FLM G;  1J5E L;  2QKI C;  3AMU A;  4MTK A;  3NQI A;  4ULL A;  1SYC A;  4XDX A;  5J3B A;  2F0J A;  2O5I C;  1SBB B;  5EPJ A;  1S40 A;  2EJG C;  1AZQ A;  5LOV F;  3TBI B;  3RV4 A;  1SE3 A;  1E4F T;  2NN6 H;  3NQT A;  1TWG A;  5CMD A;  2YL2 A;  4ZLT F;  1R9T H;  3FPU B;  4DL7 A;  5EOY A;  3CCR A;  1QZH A;  3NHH A;  3G6Y A;  4QQB X;  3H3V I;  1B2T A;  4IAJ A;  4CJ2 C;  1VQJ A;  1OXV A;  2C2R A;  2JJQ A;  4LFB H;  1RYR A;  5M5W B;  1GVP A;  4LF7 L;  2FK2 A;  1EFW A;  5HUR A;  2ZJR A;  5C5M A;  4JI2 L;  4O3R A;  3WWV A;  3S1N B;  1FD7 D;  1WCM A;  1V1P A;  4EX5 A;  3PF5 A;  1KJ8 A;  4O2B F;  4Y8V B;  1E2W A;  2CW7 A;  1PFB A;  2F0D A;  5M3M B;  4L5S A;  3CCS A;  4YP3 A;  3TQT A;  2SOB A;  2Z1C A;  4TV9 F;  4EQO A;  1ICF B;  1PZI D;  3M85 A;  1KXL A;  3OPO A;  3CQZ B;  1SYF A;  3T13 A;  4JV2 A;  2HD3 A;  4OEL B;  2MQH A;  3MZ5 A;  3CME A;  1EOT A;  3VPB A;  2IW3 A;  4FVM A;  4X62 L;  1FJG H;  1N34 Q;  1T3N A;  4DV3 H;  1Y8N B;  3MR6 A;  2J6T A;  1MHW C;  4DV7 Q;  3F8T A;  3PUV A;  1EIG A;  4GNX A;  5M5Y B;  4EYI B;  1WSC A;  1J5E H;  5K5P A;  4Q0F A;  1ZEQ X;  3TRE A;  4X64 H;  4C2M H;  1M90 C;  1SFO B;  4A3M H;  1VQK A;  1M1K C;  5IYZ F;  3CC7 A;  3KAL A;  3P20 A;  1VDZ A;  4P73 A;  1ESF A;  4DK3 C;  4EQN A;  5IYB G;  2R93 H;  3A8I E;  3RLN A;  3CXC A;  2YZM A;  3A8K E;  2HHH Q;  1N32 Q;  1EYA A;  3H3V H;  1FGU A;  3KLR A;  1S5F D;  3VA7 A;  2ATW A;  3I56 A;  3NPP A;  4DGZ A;  3H91 A;  2HUG A;  2KCN A;  3OHA A;  5C4X G;  2B2W A;  2NN6 I;  4IUP A;  5JOB A;  3W2D A;  3RAX A;  1TVX A;  4DAY A;  1Z2P X;  3KBG A;  2NVY H;  3CU7 A;  1XX8 A;  1SDF A;  5KNB A;  3EIV A;  2CHB D;  2NZ1 D;  3Q8Q B;  1VQB A;  4LF5 Q;  3HB9 A;  2WAQ A;  2A74 C;  3SE0 A;  4IOA A;  5LP6 F;  2Y0S A;  4DL2 A;  5LMU H;  3QJY A;  3QR8 A;  4XYM B;  1YBY A;  5CR3 A;  4FU0 A;  2EZV A;  3RAQ A;  1CHQ D;  5KG7 A;  1BDO A;  3CCE A;  2PQE A;  4TSS A;  1I4P A;  4DNI A;  4X62 H;  4FYD A;  2Y0S E;  1S5E D;  3PF4 A;  4KHP H;  2PYK A;  1PFN A;  3J7Z C;  2ZJT A;  5CBA E;  2UU9 L;  4RB3 C;  4YAK B;  1L2Z A;  1HTL D;  1X32 A;  1P8L A;  4KV6 A;  3PW2 A;  2DLN A;  1PFM A;  4CJ1 B;  3ULL A;  1TWH B;  3T53 B;  3W1B A;  4F4W A;  4GN4 B;  4K5X A;  5IYC G;  2X6L A;  3K81 C;  4BBS H;  2EYL A;  1TAE A;  4JCV E;  3T5L A;  4F88 A;  3PMF A;  4LFC H;  4NXM H;  1B6S A;  3VYT A;  3T5K A;  1EEI D;  3KOJ A;  4LFB L;  2E74 C;  4KD4 A;  1OXS C;  2UUB H;  2IX1 A;  1DOL A;  1EY6 A;  4XX0 B;  2DNE A;  1RTO A;  3MFI A;  1SFO A;  1WTO A;  1HA5 A;  1V9P A;  3J80 L;  1PDQ A;  3SR1 A;  2ZM6 H;  1CK1 A;  4KY7 A;  2A69 D;  5COY A;  3RD4 A;  2W9A A;  1PX2 A;  4NLG A;  4APM A;  2W6O A;  1AUV A;  2CFM A;  2RGR A;  1Z9F A;  2PI2 A;  2WAQ G;  3ORR A;  1NMF A;  2FB9 A;  3R2I A;  4HN7 A;  4EEY A;  1F9S A;  5M9O A;  1Y1V H;  3E9I A;  3M7G A;  4ED0 A;  5EDW A;  1D1K A;  4WRD A;  2HVS A;  2R8H A;  4GKK H;  1AE2 A;  1B1Z A;  3BYT B;  4PG3 A;  4KMU C;  2Q2T A;  3NXW A;  1V8Q A;  2Q8I B;  3HOU H;  2W6M A;  3RFC A;  4CDE C;  4HNU A;  2NVT B;  1JJ2 A;  3RUP A;  3EFX D;  1EEF D;  5KIX A;  2A6H C;  5KG5 A;  4IAL A;  3TP8 A;  1XWE A;  3H6M A;  4M7E A;  4DV7 H;  3TP7 A;  4J9P A;  4F7X A;  4UPA A;  1C9O A;  4RHR A;  5DQH A;  2R7L A;  1XMO Q;  3R8B A;  3JAM E;  3G4S A;  3CRL C;  2B2T A;  3C1E A;  4DR1 L;  3QIA A;  2MGS A;  1CSP A;  1D5M C;  4JI3 Q;  4OHJ A;  2I5M X;  4JVZ A;  1EY4 A;  2MUY A;  1JCK B;  4KKU A;  1SMX A;  5KT7 A;  4RZQ A;  2R92 B;  3MWE A;  3K8A A;  5ELB A;  4DFA A;  4QGU A;  4C3J H;  2HCI A;  4P2C B;  4GN5 A;  4HJ9 A;  4OO1 H;  3A55 A;  3NTI A;  2RGV A;  5BPF A;  1KC8 C;  5KFG A;  1HQM C;  1HNX H;  1DCZ A;  3I90 A;  3IRB A;  3K3V A;  4APV A;  4YQW A;  3GTP A;  3NEN A;  2Y0S G;  2AGO A;  5C0X I;  1G91 A;  4K5V A;  5C4H A;  3VPD A;  3Q8P B;  1CSQ A;  5FLX W;  3RBE A;  5F2D A;  2YCH A;  2UUA Q;  3J7A 5;  4DLK A;  2F0Q A;  2R82 A;  1YVC A;  3Q1K A;  4C3H H;  3S15 B;  1YJ9 A;  5FD5 A;  5LL6 S;  3FKI H;  5C1O A;  1RJT A;  1SEB D;  1Y1W B;  3ICE A;  3NBH A;  3V6K A;  3TQY A;  1TWF A;  4QWC A;  1XNQ Q;  2O4X A;  3DF7 A;  1XPR A;  1BBX C;  5DG7 A;  2WB1 E;  3LX0 A;  2F3W A;  1VQE A;  1QUQ B;  3PO3 G;  3I4M B;  1TY2 A;  1S5C D;  2K6A A;  1W93 A;  1IXR A;  5FKA C;  3T51 B;  4AYB E;  4BBS G;  2B2U C;  4DR2 Q;  4LF9 H;  4RAY A;  1A3U A;  1V1P B;  3HOZ H;  4FBT A;  3FMC A;  2KOL A;  4A3E B;  4B3T H;  4DUY H;  2QDB A;  4B3S Q;  1PH6 A;  3E0E A;  1JQY D;  2LKV A;  2FHT A;  4KHV A;  4JV5 H;  5J22 A;  1C0A A;  1STH A;  1NY4 A;  1QVC A;  4POG A;  5LMU Q;  2O5J C;  2EY5 A;  5JQW A;  2AQ1 B;  4JI2 H;  4GC7 A;  2KUM A;  1S5B D;  3D4R A;  4YWL A;  5EPL A;  4YJ2 F;  1Q8I A;  4KKS A;  2NVX A;  1LM0 A;  3IG0 A;  4TVA B;  1TWC A;  3RB4 A;  3NUC A;  3E5N A;  4UCS A;  3DUZ A;  3BU2 A;  1Y1W G;  2DIK A;  1F2M A;  1V1O A;  3VDY A;  4EGQ A;  1X3P A;  3HS0 C;  4YR0 A;  5JVG 3;  2UXC Q;  1RD9 D;  5DG8 A;  4DAP A;  2UU9 H;  3I4M H;  2L11 A;  4QIW B;  4L5R C;  4C3J G;  3KJO A;  3H4D A;  4UAI A;  2B2Y C;  5CV9 A;  2CW0 D;  4KK7 A;  2WAQ B;  4R4Q A;  2HQL A;  2M05 A;  3KHL A;  1BCP F;  3UDX A;  2ENB A;  4DKA C;  3HXL A;  1KC7 A;  2OTJ A;  4EBE A;  4G7H C;  4BY1 H;  5GAE C;  3KHG A;  1JXL A;  1A2T A;  5KFO A;  4DNT B;  2AQ2 B;  2XWB B;  3PV0 A;  4K2L A;  5KYL A;  1H9J A;  4HR7 B;  2L9H A;  4WFN 3;  2KVM A;  4ECS A;  1EY5 A;  3WO0 A;  4DR6 H;  2EIF A;  2K5D A;  2JA7 G;  2UU9 Q;  4PMC A;  4OO1 G;  4A3G H;  1SMY C;  3P75 A;  5L1K A;  3WOE A;  2XCA A;  4QUF A;  4ZUJ A;  4RMF A;  3F2B A;  4FXG C;  3G6E A;  2BQ3 A;  3S1Q H;  1S97 A;  1HA6 A;  3BS1 A;  2OQ0 A;  2XN9 C;  5JJI A;  2VQD A;  1F2L A;  3K5M A;  1EWC A;  3UE0 A;  3H94 A;  2YW2 A;  4DUZ H;  1EZ1 A;  3BJY A;  4ECZ A;  5I9P A;  4Y52 H;  1PH7 A;  1W6J A;  4M1U B;  3KUP A;  4A3K H;  1RK5 A;  5EJW A;  4Q0Y A;  2Z4H A;  5CV4 A;  3CCM A;  4JI4 Q;  3VYS A;  2LSS A;  4PV1 C;  2QDL A;  4JC0 A;  1TWH A;  5IWA L;  1DYQ A;  3GIJ A;  2JP1 A;  3KK7 A;  1ZQ7 A;  1G51 A;  1SAP A;  3N6R A;  4IOC A;  3L7Z C;  2QIL A;  3J80 E;  3RZO B;  5KFW A;  3B6Y A;  4MN3 A;  1FYC A;  4YBZ B;  5KFP A;  1I94 Q;  2KHS A;  2OTL A;  4JI4 L;  1HZB A;  4A3E H;  1IW7 D;  3A7L A;  3S1Q B;  4X65 H;  5C0X H;  1UNN C;  1VQ9 A;  1EWH A;  3HOU B;  4FM9 A;  1WTQ A;  1KJ9 A;  1GKH A;  4LF9 L;  4K6L A;  3UFX B;  1VQ4 A;  5CAE B;  2IX3 A;  4LF4 Q;  4WBN F;  4JV1 A;  4HTH A;  2FPG B;  1S72 A;  5FPO A;  4ECT A;  4YR2 A;  5IT9 W;  4TQR A;  5KT5 A;  4ZYS A;  3S1M B;  2HCC A;  2A6H D;  3DWQ A;  4FF2 A;  3FMA A;  1QB5 D;  3G6J B;  3JSN A;  1TXY A;  2XRS D;  4DV6 Q;  1UUP A;  4F4X A;  3GIM A;  1M7J A;  2VPS A;  1Y8O B;  5IYD G;  3FVQ A;  3IAY A;  3GTG B;  5KFT A;  1D5X C;  1PTO F;  1I4G A;  4YHH Q;  1PH4 A;  3GTP H;  2EJM A;  2F4V L;  1OXU A;  4GNX C;  1U4P A;  2W8K A;  3I4M G;  1I3Q A;  3IN5 A;  1LUZ A;  3V2T A;  2CZG A;  1N8R C;  1RHP A;  1EY0 A;  2WE6 A;  2PI2 E;  2VS1 A;  1KIX A;  2R7Z B;  2HJW A;  3FKI A;  1Q1B A;  2C9O A;  1X3Q A;  1U4L A;  3N43 B;  4DF7 A;  3MC0 B;  3KJP A;  1XDN A;  1B3Q A;  3X3N A;  3U4Z A;  1A63 A;  4AYB A;  4H0L C;  4JI4 H;  3D6C A;  2ASB A;  2E2H B;  2UVR A;  2IL8 A;  2B2T C;  1ASZ A;  1QJO A;  3SHL A;  2RQX A;  1NUC A;  1MSH A;  5AJ3 L;  4XZ3 B;  4MV8 A;  4RA8 A;  4H44 C;  1B50 A;  4UP7 A;  2R7Z H;  1IBK L;  3R5X A;  3J80 i;  2B8F A;  4O1N A;  1N33 Q;  1Q1E A;  2V4R A;  2XGQ A;  3C0F B;  4O3P A;  4NXN Q;  2VA3 A;  3TP6 A;  5LMU L;  4DR2 L;  2VA2 A;  2JA5 A;  5M3F G;  5L37 A;  4BA1 I;  4B3R L;  1GUO A;  1CQF A;  1K73 C;  2EY1 A;  3EVQ A;  5IYB H;  1GUG A;  4RB0 A;  4X6A H;  3EBE A;  4FF1 A;  1I50 B;  2I5L X;  4EGJ A;  4Q5V A;  1GHJ A;  1NSN S;  2WB1 G;  4G57 A;  3JAM c;  3A74 A;  4DR3 H;  2E2J H;  1QNU A;  1SNM A;  1D7Q A;  1N34 H;  4R1J A;  1I7N A;  1F77 A;  2B2V C;  1WTX A;  3E5S A;  2BE5 C;  4EVO A;  5C3X A;  1YHB A;  3GIP A;  4K0K Q;  4UHV A;  3N44 B;  3D8G A;  3PW5 A;  3K5O A;  1Y1V B;  3SVM A;  1PZK D;  4DUY L;  5HBR B;  1ML0 D;  4OEM B;  5HY6 A;  5F9L A;  5M5W H;  4KHP Q;  3BA9 A;  4YWK A;  4V0B A;  4I50 F;  5A2Q W;  2L0C A;  4NP5 A;  4JI1 L;  4DAM A;  2W6Z A;  2BA0 A;  3Q6S A;  4A3B B;  1DM0 B;  4Q8F A;  3BDL A;  1EYD A;  2KED A;  2EDG A;  1UE1 A;  1E2V A;  1CQV A;  4IFD G;  2JA6 G;  4IHJ F;  1I5F A;  3FHW A;  4J15 A;  4UCU A;  4DR5 L;  2Q8R E;  3OOC A;  1ZHS A;  3V4Z A;  2IT1 A;  2X6G A;  5EZY F;  2D0O A;  4LK1 C;  1IBK H;  1S3O A;  2ICE C;  3ERQ A;  3RF2 A;  3BVG A;  2YZG A;  2J6S A;  1PRT F;  1H9K A;  2AGP A;  5C4Z A;  4I55 F;  3U50 C;  1KQS A;  4GKJ L;  3CAM A;  1CKN B;  2MCT A;  3EQL C;  5ELC A;  4RB1 A;  4RU9 A;  4DR4 H;  2KQ3 A;  1JB3 A;  3EA6 A;  3ND8 A;  1J6Q A;  1XPO A;  2WFW A;  2OF1 A;  4CKE A;  1WFQ A;  3FP9 A;  1HNX Q;  2ASD A;  3ZJY C;  1TA8 A;  3M3Y H;  1M0W A;  1GUW A;  3TN2 A;  1K83 B;  3BAB A;  2RSO A;  2XIG A;  4ED1 A;  1F2Y A;  3MEF A;  5DAU A;  1T36 A;  4ODG A;  4QJF A;  1NAP A;  1K8O A;  1JE5 A;  4NXM Q;  4QWA A;  3GV5 B;  2C2E A;  3MXN A;  3QB3 A;  3ETJ A;  2DGY A;  1XPU A;  4H13 C;  2E76 C;  2J6U A;  1D6E C;  1STA A;  1GSO A;  2OH2 A;  1SNP A;  2B29 A;  2RHQ B;  5C4X B;  5M3F B;  4DL6 A;  2BH2 A;  1SLJ A;  4LF5 H;  2EXZ A;  1DD2 A;  1J9O A;  3KF8 A;  1YEZ A;  1KTK A;  3VPC A;  5DGA A;  2R85 A;  2TMP A;  5AJ3 Q;  2B63 B;  1PA6 A;  5IIF A;  4WJ3 M;  4R8I A;  3BG5 A;  2EXD A;  4R4I A;  3GTQ A;  1ZXT A;  2W9B B;  1IBK Q;  2VUM G;  2K14 A;  3CPW A;  1L1O C;  1FGB D;  3CCJ A;  5KRU A;  1GO3 E;  1JKJ B;  4UCT A;  4LSA A;  3M9M B;  1SE4 A;  1WYD A;  3L9A X;  1RCV D;  1BO0 A;  4EBC A;  4DR5 H;  4KD3 A;  2BA1 A;  1YNN C;  1RJR A;  3R93 A;  3FEW X;  4S3S A;  4Y7N H;  1EZ8 A;  3UDG A;  3G6X A;  3J81 L;  3BZC A;  3E9H A;  3QO2 A;  1DOK A;  2PCF B;  1PMR A;  4LFB Q;  5KFH A;  1EU4 A;  1PYS B;  3K58 A;  5IGG A;  4GN3 B;  2R7K A;  4JI8 H;  3X3M A;  1B33 N;  2KEE A;  1A6X A;  1SSO A;  3QZ7 A;  4NXM L;  3MFG A;  1AN7 A;  3G71 A;  3RN5 A;  4K6D A;  2G9D A;  1EWI A;  3MWY W;  4J6H A;  1YHQ A;  1X55 A;  1ROD A;  4TUY F;  1SCU B;  1I6V C;  2DWC A;  5M3M G;  4IUR A;  1Q86 C;  3ULP A;  5JUM A;  4PDB A;  2ZM6 Q;  3NEM A;  2UUC L;  2X0S A;  1K28 A;  1O7Z A;  2K50 A;  1XMQ Q;  2UXB L;  4B3M H;  1LTA D;  1U4M A;  1HPC A;  2C22 A;  2AUK A;  4C3I H;  3PZP A;  5HGQ A;  3VYU A;  4RGT A;  2W70 A;  4FNF A;  3KAJ A;  5LA6 F;  4F4Z A;  2V4Q A;  3PIO A;  3RZO H;  2ASL A;  3ND9 A;  2R61 A;  4N9T A;  4I7Z C;  2JEB I;  3NEL A;  4OIK A;  4RG1 A;  1JOO A;  1Z6H A;  5EKL A;  1I7L A;  3MFH A;  2V59 A;  2R7Z A;  3D4W A;  2R7N A;  5KFF A;  3MTS A;  1MJE A;  3LGJ A;  2CW0 C;  4X66 L;  1ZHQ A;  2IP4 A;  1Q12 A;  3H20 A;  3M9B A;  2ZDH A;  1I4R A;  1PTO D;  3DEO A;  5E7N A;  3PO2 H;  1UC8 A;  1TII D;  1GGO A;  2KEC A;  4XQQ A;  2L4N A;  1WD1 A;  4JV5 Q;  2F0H A;  5JAV A;  2D62 A;  2VQF Q;  4IJL A;  1RIP A;  1IYU A;  4JI8 L;  4DV7 L;  4JI1 Q;  3W3A A;  5KGU A;  1K9M C;  2WTF A;  2OEO A;  3KAK A;  2EYO A;  4I7A A;  3OMG A;  3K5I A;  1BQQ T;  2CKZ B;  1CA6 A;  3M4O B;  5GAD C;  4XYQ A;  2ES2 A;  2E5L Q;  4LFC L;  1CZW A;  2NU9 B;  4UCO A;  3RLF A;  1KJI A;  4K14 A;  5BR8 H;  2ZT9 C;  2B63 H;  1CQJ B;  4A76 A;  3RB3 A;  5LYJ F;  5LMN L;  4O0A A;  3J81 W;  5EKK A;  1HXY D;  3I72 A;  2I0Q A;  3CQZ A;  2JA5 B;  4A3L G;  2KHI A;  2J9G A;  5KFQ A;  4IPH A;  3HOV G;  4JI2 Q;  4EYH B;  4LAA A;  3HKZ B;  2KCT A;  3GTO B;  1VQC A;  4RFB A;  1JE4 A;  2JA7 H;  3I4N B;  1LO5 D;  3H0G B;  1RJQ A;  5COR A;  3T5H A;  5G3L F;  1N33 L;  3QFF A;  2QW7 A;  4ZQI A;  3JAM W;  3HOX B;  4JBK A;  3IFD A;  4LF6 H;  4GKJ H;  1X3E A;  2K1B A;  4F87 A;  4I7H A;  4RKB A;  3T5J A;  4DAV A;  1I50 H;  4O42 A;  4IRK A;  3GTJ H;  2W6Q A;  5KKN B;  1NBW A;  3RB0 A;  4A3G B;  4CC5 A;  3BJU A;  3V05 A;  1BR9 A;  3BDC A;  5KFI A;  4RGO S;  1EYG A;  2RDI A;  1ICW A;  3DHQ A;  4KTA A;  1VBH A;  1GD7 A;  4C1N K;  1YI2 A;  4MZ9 A;  4P75 A;  4GLV B;  2B2V A;  5FLM H;  1S68 A;  2PMZ A;  3PIP A;  2B2Y A;  2F0W A;  4DR6 L;  4C5B A;  2V1C C;  4X65 L;  3AFQ A;  1TY0 A;  1TS4 A;  2K01 A;  4HIK A;  5DGB A;  5TSS A;  4MTN A;  4DR6 Q;  2NZH A;  2FJZ A;  1J5E Q;  1DV2 A;  5D3I B;  5KFK A;  4TQS A;  2AKW B;  2FLL A;  2W9C A;  2UXD Q;  1YNJ C;  4NW2 A;  2FJ2 A;  1KNA A;  1AN8 A;  4RH6 A;  3PVX A;  2YYA A;  5K36 G;  3BQ0 A;  3FDT A;  3RV3 A;  4DV2 Q;  1BVS A;  1Y1W H;  2K32 A;  4AQY H;  5JVL A;  1N36 L;  1BJT A;  2W71 A;  4JI5 H;  1PTO C;  2K05 A;  1E3P A;  5C3E H;  4DAY B;  1C4Q A;  2F3I A;  2XGP A;  3HG9 A;  4O2A F;  1Q81 C;  2EY6 A;  3GTQ H;  4ME3 A;  3NBH B;  3GQC A;  4PZ6 A;  2OCE A;  4BBS B;  1PH5 A;  4R8U B;  1G8Z D;  3OSP A;  3AU7 A;  3DM3 A;  4IRC A;  1ENF A;  1Y69 U;  1G6Z A;  3PUX A;  4G3I A;  2K5N A;  2Z0S A;  1IL2 A;  1LT6 D;  3H15 A;  1HHV A;  1XYI A;  5IP9 G;  5DM7 3;  1IW7 C;  4TRD A;  3AYH B;  2ASJ A;  5IY0 A;  1JDE A;  4ZHQ F;  4DV4 Q;  2YU9 H;  4B08 A;  1Z2N X;  3C2P A;  2YZN A;  2Z4I A;  3RLO A;  1QVG A;  2XCP A;  4J9R A;  1JWM D;  4IZ8 A;  5EWE A;  2A6E D;  3I91 A;  1MZB A;  5KFS A;  4LF9 Q;  4HIM A;  3QOL A;  3GQB A;  4J9O A;  1MI2 A;  2UUC H;  2NVX B;  4CJ0 B;  4A3E G;  1EHI A;  1VBG A;  1NTG A;  3I4N G;  5BR8 L;  5C4X H;  3HRZ C;  1DV1 A;  1BNC A;  3TIG A;  4MV1 A;  3J7A K;  1Q8K A;  2N49 A;  2JEA I;  2I87 A;  2ALZ A;  5KFD A;  1NJI C;  3T4A C;  1N9W A;  5BR8 Q;  1LT4 D;  4FBU A;  5GAH C;  3TII A;  4LMY A;  1ZYR D;  4EFE A;  5KG0 A;  2K33 A;  3HOY G;  4JI6 H;  2XWJ B;  1QVF A;  1HTP A;  3GV3 A;  1PZJ D;  2N78 A;  4QIW A;  1KBL A;  5KFC A;  4YR3 A;  2WKC A;  3CCU A;  4AQY L;  5BN3 A;  4OWX B;  4ZAI A;  4DV6 H;  2RDG A;  1IBM Q;  3I7F A;  3LP8 A;  3PO2 B;  4CKC A;  2GVB A;  5EBC A;  1I6U A;  2VUM A;  3Q22 A;  1EIY B;  1X6O A;  2O03 A;  4HR7 A;  2W7O A;  1K3B C;  3J7A F;  4ZKB B;  1V51 A;  2F4V H;  1B44 D;  4LH7 A;  4K8J A;  2PO4 A;  3KDF A;  1ULZ A;  1SR3 A;  4ETS A;  4KI0 A;  4HJ8 A;  1LLR D;  4A3F G;  5EBD A;  4FP5 D;  3OHX C;  4CGY B;  3S14 B;  1Y14 B;  4MV9 A;  4DR3 L;  2QEJ C;  4YWM A;  4V19 0;  3J7A V;  2VNU D;  1B6R A;  1K8A C;  4C2M A;  1IKL A;  1PRT D;  2NN6 G;  4JPB W;  4RWS C;  3TEH B;  1CS0 A;  2H5X A;  2Z6B A;  4GOP A;  4BY7 G;  1KAA A;  4JYA Q;  1O7Y A;  2C5C A;  2DJF C;  3TZU A;  2GVA A;  5IT9 c;  2IWH A;  3N40 P;  3HOW B;  3N52 A;  3BDO A;  5M5X H;  1N36 Q;  5FJ8 H;  4BY1 G;  1OXT A;  4OIJ A;  5I2Y A;  3TSS A;  4L1K A;  1SND A;  1SYD A;  5KG6 A;  4JW0 A;  1G2S A;  4K8I A;  3BAA A;  5KFB A;  4HNT A;  1K3R A;  1UEB A;  5FO7 B;  4HCS A;  1ONL A;  3CCV A;  2NVY A;  2JA8 G;  4IWY A;  3MWM A;  2H4O A;  1JLL B;  3CRK C;  4A75 A;  3GTM B;  1RKN A;  3CQZ H;  3K6O A;  4POF A;  4O3Q A;  4BBR B;  1YHA A;  3OSN A;  3M9O B;  3UDI A;  4RAU C;  2QK4 A;  1CHP D;  4N9P A;  2JA7 A;  3QWN A;  1SXT A;  1K1Q A;  2B63 G;  1B8A A;  1WCM G;  5IP7 H;  1D1I A;  3KLS X;  2P5Z X;  1JDB B;  1S03 G;  1RK6 A;  3S17 B;  2F4I A;  4ED6 A;  2YRX A;  4YAJ B;  1VKZ A;  1HR0 Q;  1HUM A;  3HOV H;  1SNO A;  1DZ1 A;  3J80 W;  2W57 A;  1CT1 D;  3OMC A;  1K8M A;  5C44 B;  1QE6 A;  2L12 A;  4B9W A;  3A56 A;  5CC4 A;  1C48 A;  4O4H F;  4IUT A;  4LSX A;  2PBZ A;  4PWQ A;  4OWT B;  1LAB A;  4DR3 Q;  2UXC H;  3OHB A;  3CD6 A;  2F0G A;  1WVL A;  3J81 c;  2HHH H;  1LTS D;  1N32 H;  4U68 A;  4A3K G;  5K2M A;  4ALP A;  2P0A A;  1QUQ A;  3V6J A;  3TQ1 A;  1CTM A;  2I5H A;  3HKZ A;  1UAP A;  1SYB A;  3GV8 B;  4LW1 A;  3VR5 A;  4LFA H;  4A3D H;  3EPI A;  1LTL A;  1VQ5 A;  1IBL Q;  1JMC A;  1VQG A;  3R5H A;  1EZ6 A;  2WII B;  5FO8 B;  1WTW A;  3RTX A;  2L55 A;  4QIW E;  1HZ9 A;  3A5Z B;  5KFV A;  5FLX L;  3RZD H;  1PYB A;  3HOY H;  1I6H B;  5C5J A;  2Q8T A;  2K52 A;  2VZA A;  2WAQ E;  1KRT A;  4UCV A;  2K5W A;  1YJN A;  4K2K A;  3CP0 A;  3GIL A;  3FKI B;  5IE8 A;  1WD0 A;  1S0M A;  2K28 A;  2CWA A;  1BUV T;  2MP1 A;  1N33 H;  2HDM A;  5J1Z A;  3ULJ A;  4MTE A;  3CC2 A;  4A3I B;  4RUA A;  2Z6K A;  4RKL A;  1U9R A;  3OYY A;  4WD3 A;  1HRJ A;  1SMY D;  1VQN A;  1AUX A;  5NUC A;  1PLF A;  2DZD A;  2UUA H;  3ZYY X;  1TR5 A;  4FO2 A;  2MO1 A;  3RMH A;  1XMO L;  4N8X 1;  3Q8D A;  1UE7 A;  2WKD A;  3VR2 A;  5K36 H;  4IPD A;  3GTL A;  3CCQ A;  2GA4 B;  1E0B A;  2WDT A;  3HOY B;  1FNW A;  2JA6 B;  1I6H H;  2JA9 A;  4U67 3;  4OXP A;  5L9X A;  2R86 A;  1PRT B;  4AIM A;  4EGV A;  5J2U F;  2ZJP A;  4R4C A;  5JEA G;  3LWB A;  5D1O A;  5KFJ A;  3RIZ A;  1XNR Q;  1B53 A;  3NK9 A;  4F4Y A;  1Y1V G;  1JWU D;  5E4X A;  3S2H H;  1FJG Q;  1GLV A;  1K83 H;  2NB0 A;  5KFZ A;  1F2Z A;  3R5F A;  3PO3 H;  5C4J H;  2XC9 A;  2F0I A;  1LV9 A;  5ELE A;  4GKK Q;  1KD1 C;  5HV6 A;  4IUV A;  1C3O A;  3MA2 B;  3SE7 A;  2NTT A;  1LT5 D;  2VUM H;  2OT2 A;  1BBW A;  5CV6 A;  2X69 A;  1B7Y B;  1WI5 A;  2PW5 A;  4LFA Q;  1JOR A;  2PMZ E;  4A3C H;  5KFU A;  1TWF H;  2PZW A;  1VQ8 A;  4F50 A;  2GPS A;  2NU6 B;  3KHR A;  1MJC A;  4QWB A;  1QZG A;  4A3F B;  3K5H A;  5EWG A;  2UXB H;  1EFI D;  2B3G A;  1JWS D;  3S2D H;  4EBD A;  4XXE A;  1XMO H;  3OWE B;  3TZD A;  1AEX A;  4HCE A;  5ISR A;  5LMN W;  1STB A;  4HED A;  5T14 A;  5T1G A;  2RDF A;  1BXT A;  2NTS A;  2BQR A;  2UUB Q;  4QF4 A;  1YNN D;  3KF6 B;  3H4B A;  3I73 A;  1QCB D;  3GTO H;  3T56 B;  4JI1 H;  3OW2 A;  3GTM H;  3M7N A;  1KDC A;  4LMQ D;  2PZT A;  4QW9 A;  4BBR H;  4RUC A;  1KLU D;  1VQA A;  3F1Z A;  5DM6 3;  1PRT C;  1VQO A;  4O3S A;  2NVX H;  2ZJQ A;  1TWC H;  2F0T A;  2JA6 A;  1PFS A;  1ZYR C;  2VL6 A;  5FPR A;  5KND A;  1HNW H;  4XYO A;  2I46 A;  1CA5 A;  1E7Z A;  3MWD A;  1HNX L;  3WDN A;  2NVQ H;  1I3Q B;  4FF3 A;  1I4X A;  3I12 A;  2DY7 A;  3C3L A;  1ASY A;  4EQP A;  5D1P A;  4A3L H;  3ORQ A;  3QZ8 A;  2RDH A;  5BN4 A;  4A3F H;  4H7B A;  5FLX c;  4HJ5 A;  4LF8 L;  5C1P A;  1CM9 A;  5KFR A;  4QMG A;  1B4O A;  1Q46 A;  2E2H A;  4AH6 A;  3D0F A;  4LF4 L;  2KCC A;  2R6F A;  2EY2 A;  4RAZ A;  2VQF L;  4GOP C;  5KG3 A;  4KN4 C;  5I9O A;  5KT4 A;  2VQE H;  4GKJ Q;  2W6N A;  4MV4 A;  1Z47 A;  2HHH L;  1N32 L;  3U4V A;  3GTK A;  2FKL A;  1FKA H;  2PNH A;  5KEE A;  4A3I G;  2NVY B;  2AHO B;  1HFN A;  5CV8 A;  4QWE A;  3F8N A;  1HCZ A;  2R7F A;  1X3G A;  5EGT A;  3MEH A;  2QA4 A;  1CE8 A;  1KEE A;  4J0M A;  4BA2 I;  1ENA A;  2N55 A;  1XJV A;  4IPC A;  4HID A;  5M3F H;  2YRW A;  2AQ4 A;  4A93 B;  2JN4 A;  3I4N H;  2JA7 B;  3BVM A;  2F0S A;  4X64 Q;  1W6K A;  4JI3 L;  4LH6 A;  3A5U A;  2A8V A;  2PZU A;  1VQL A;  2RCN A;  4XQJ A;  4JBJ A;  1NE3 A;  5CB4 F;  2CH4 W;  1EY9 A;  4BXX G;  4EG0 A;  4ED8 A;  1W3S A;  2AU0 A;  4ECR A;  2KBN A;  1E4G T;  1WOC A;  1O7L A;  1K8G A;  4JI6 Q;  2IMW P;  4J8Q A;  2ALY B;  1CQI B;  3HOW G;  3RGZ A;  1SYE A;  5L1J A;  1QNK A;  4LF6 Q;  5T1I A;  2Q2H A;  5L1I A;  2XCL A;  4CBV A;  4RB2 C;  3M4I A;  1EQV A;  2KHJ A;  2E2I B;  3STB D;  1B04 A;  3OTO H;  5L1L A;  4PQX A;  3FRP B;  2E5L H;  5KFM A;  2SNS A;  4J9Q A;  1GXD C;  5C3E G;  1ENC A;  2CCZ A;  1UWV A;  4LF8 H;  1PXU A;  2UVW A;  4DV1 Q;  2BR0 A;  4KKT A;  2EJF C;  3BZD B;  3T1H L;  1TWG H;  2F0N A;  2R6G A;  3UE1 A;  1K0R A;  2UXC L;  1R9T A;  3HFZ B;  4C3J B;  4DR1 H;  1F9P A;  2E2I H;  5LMN H;  3CVZ A;  4A3D G;  1F9R A;  1KAW A;  3W5O A;  5I6W A;  4BWG B;  4IZO A;  3L4J A;  4GS3 A;  4BY1 B;  3MXG A;  1EY8 A;  2MHV A;  1OO9 B;  1KAB A;  4KHZ A;  3GTK B;  1GYF A;  2JEG A;  1O78 A;  5CGK A;  3L4K A;  1CI3 M;  3I2Z A;  1L0W A;  1WCM H;  5IP7 G;  1O80 A;  4LFA L;  2E2J B;  2NU7 B;  4ECV A;  4K0K H;  1FNU A;  1PTO B;  3HOW H;  4ZI7 F;  3D4D A;  4JI7 H;  2SCU B;  3JRX A;  1GUS A;  3SDZ A;  4DR4 L;  3NGD A;  4KY6 A;  4C5C A;  3K5N A;  2FMA A;  4DV0 H;  1K83 A;  4YHH L;  5CV7 A;  3J81 i;  3J81 E;  1UC9 A;  1SN8 A;  3MR3 A;  5EQ0 A;  4O3N A;  4MNO A;  3M9N B;  3GLK A;  1ESR A;  5DLF A;  1KDB A;  5IOC A;  3CW2 C;  3BQ1 A;  5D65 A;  1I3Q H;  3OW7 A;  3PUY A;  4KJN A;  4TKO B;  2D5D A;  4X3T A;  4B3M Q;  1XMQ H;  3ERO A;  2UVU A;  1X65 A;  2FK3 A;  2W6P A;  5GRO A;  2WAC A;  1GJX A;  4IFD H;  1J8I A;  3GTL B;  1GM5 A;  2EQS A;  1T94 A;  2UXD H;  2Q2I A;  4JOI A;  5FO9 B;  4J9M A;  3NSW A;  4YCW A;  3E6Z X;  4E6I A;  4FS1 A;  3RBD A;  1V4Y A;  1TWA H;  3ITP A;  1X54 A;  1CZG A;  3SGI A;  3LNN A;  4IFD J;  2F0P A;  3OIQ A;  2A19 A;  1VAJ A;  2Z9H A;  2DUD A;  1DON A;  2R93 A;  2BDO A;  5A2Q L;  2JA8 H;  3EPG A;  3T1H H;  2R8G A;  2M9V A;  1EQT A;  4BS9 A;  3KTM A;  4MA5 A;  1IOV A;  3JSL A;  1XTD A;  1ILQ A;  1D5Z C;  2EYF A;  3I55 A;  1GOZ A;  2ATL A;  3EN2 A;  1TWC B;  4L5T A;  1HZA A;  3GTO A;  2G5D A;  1QOH A;  1EUJ A;  1A8V A;  1MGS A;  2NBF A;  4P74 A;  2W9B A;  5FK9 C;  3T1Y Q;  1JX4 A;  2JA6 H;  2EYM A;  1K0S A;  4X62 Q;  1SYX B;  2F3V A;  4DR1 Q;  3F2U A;  4AQY Q;  3KXY T;  4JBW A;  4DR7 L;  5KFE A;  4ZQ3 A;  1I94 L;  3STB C;  3GIK A;  4YHH H;  3CPF A;  5AFW A;  2HIV A;  4PMW A;  2LFN A;  5E1F A;  2FPP B;  4Q43 A;  1HH2 P;  3L2P A;  2AQ3 B;  4C1N I;  2PW7 A;  3WNZ A;  3AQQ A;  4KLK A;  3PIP 3;  3HOU G;  1NR4 A;  1PH8 A;  2F0E A;  3PN1 A;  1VQ6 A;  2E75 C;  1ZKO A;  4HIO A;  5EAY A;  2R3Z A;  1SRU A;  3GV7 B;  4HNV A;  3K5L A;  1ILP A;  2FMM A;  2GN5 A;  2C35 B;  1R4P B;  2F0O A;  1AFP A;  2QYZ A;  4MHE A;  2XD4 A;  1GUT A;  4HSV A;  2I80 A;  2DN8 A;  1Q7Y C;  1A3V A;  1NMG A;  2V4D A;  2ZM6 L;  4DV4 L;  5FD6 A;  4R7R A;  2WYO A;  4OX9 L;  2DPJ A;  1YNJ D;  4ME6 A;  2B2W C;  4UP8 A;  5H80 A;  4A3C G;  1HFG A;  3OUU A;  3E3X A;  5KFY A;  1G29 1;  1SFO H;  1GUN A;  1MKH A;  5C5L A;  2MPM A;  1NNX A;  1K1S A;  1TS5 A;  2R93 B;  1TS2 A;  1HUN A;  5CA1 F;  1JOK A;  5JVD F;  1F9Q A;  1X56 A;  4EEQ A;  2BE5 D;  1A62 A;  4XIG S;  4FDB A;  3RGX A;  1SRO A;  5D14 A;  1E2Z A;  2CQA A;  4DV0 L;  1GSA A;  1Y8P B;  1VF7 A;  2D2C C;  2R8I A;  4ECW A;  3JAM i;  2J7Z A;  1M4V A;  4JI0 L;  5KYI A;  1IKM A;  1LTT D;  4IR1 A;  4J9N A;  4X65 Q;  4CHT B;  4MV6 A;  3S15 H;  3PUW A;  4NKL A;  3L3O C;  3D31 A;  3UI2 A;  1TU2 B;  4IUU A;  1LTR D;  4C3I G;  3S16 H;  2G9H D;  4O2D A;  4ZRZ A;  1B70 B;  1A0I A;  4YB8 B;  3AEV A;  4DL3 A;  4DUZ Q;  3CF5 A;  4QB4 A;  1VMP A;  5M3M H;  1M6V A;  1A3T A;  3GIQ A;  3V6H A;  5M5X B;  4LF4 H;  1WTH A;  4HMJ A;  5DG9 A;  1OWT A;  3BG3 A;  5HGT A;  3UDF A;  3HBL A;  1KL9 A;  5JH7 F;  5FOB B;  1AP0 A;  1EQR A;  3EJI A;  2K4K A;  3SK6 A;  2TSS A;  2MFI A;  1DOM A;  2OXP A;  3K57 A;  2FE3 A;  2B39 A;  2YV5 A;  1JC7 A;  3BVZ A;  4A3I H;  3TIN A;  4HYK A;  3VA5 A;  2E2I A;  5ELN A;  5KG2 A;  4JYA L;  4JI0 Q;  5JPM C;  4DN4 M;  2YYZ A;  4U7C A;  5IYD H;  3RNU A;  4FXD A;  4YY3 H;  4LF5 L;  1JJC B;  3N42 B;  2GPW A;  2F03 A;  3PO3 B;  4DK6 C;  2N8N A;  4JOI C;  4J9S A;  4JI7 L;  4X3K A;  4A3J G;  1PH2 A;  1FR3 A;  2LMC B;  4I4T F;  3Q8R B;  3S1R B;  3DXJ C;  4LWC A;  4IR9 A;  1E4E B;  4XQN A;  4ID6 A;  4NMZ A;  4ZKC B;  4EFB A;  4L8J A;  3I4L A;  2ID0 A;  2LS0 1;  1HR0 W;  4RHS A;  5GAG C;  1AZP A;  3PR4 A;  2ZTD A;  1IBM L;  3KLW A;  4BY7 H;  4JI0 H;  2HIX A;  3G7L A;  1Q82 C;  1KJQ A;  3R3O A;  3PW7 A;  2VXW A;  4IUQ A;  5JVH 3;  1AE3 A;  4LFC Q;  2RBM A;  2RCF A;  2RA4 A;  1PV4 A;  4MV3 A;  2R87 A;  5KFX A;  2Y0S B;  3D3R A;  4QW8 A;  3DLL A;  2CQO A;  5C44 H;  4Q44 A;  2C28 A;  2OWO A;  5KT3 A;  3P7J A;  1R9T B;  2XRQ D;  3GP7 A;  3OSO A;  3M4P A;  4CDF C;  2EVB A;  3MFY A;  1EQQ A;  2E5L L;  4JI8 Q;  1TWG B;  1OTC A;  2PVP A;  4XT1 B;  2YS7 A;  5CYU A;  1EUC B;  3PW0 A;  2HVR A;  4JI5 Q;  4B3T Q;  2R92 G;  5KFL A;  1TWA A;  5DLG A;  1MBY A;  3MHB A;  2OLS A;  3MR2 A;  3V96 A;  3PGZ A;  1DIK A;  4JG2 A;  3HGB A;  1LTG D;  4MTD A;  2NUA B;  3NE5 B;  2W9C B;  3S1N H;  4R8U A;  1BCP D;  1RDP D;  3C46 A;  4DR7 Q;  4ILW A;  2HT1 A;  4K0K L;  3IFT A;  4AYB B;  4ZOL F;  5KFN A;  2Z6K C;  1YIJ A;  2JEJ A;  2VY3 A;  2R92 H;  2M00 A;  3OWF A;  3T1Y L;  4DXF A;  4Y7N B;  4ECY A;  2A5H A;  2W8L A;  2ZDG A;  1JJG A;  3NWT A;  1U5K A;  3CCL A;  2JK8 A;  3OTO Q;  3S16 B;  1KJJ A;  3BQ2 A;  1Z7T A;  4N8F A;  1VQP A;  1YJW A;  4HQ6 A;  1IYJ B;  1S5D D;  2MJ8 A;  4ABN A;  2CH4 A;  1PYW D;  3NP8 A;  1FNV A;  4GLA C;  5GQO A;  2UUC Q;  4WJ4 A;  1E22 A;  1BF4 A;  2FMC A;  5ELO A;  4LF7 Q;  1KHI A;  1PTO H;  3I70 A;  5ELF A;  5EPK A;  2HGS A;  3G8C A;  1WTR A;  3K59 A;  2JE6 I;  1UNS A;  2B8G A;  4R9W A;  4OL7 A;  4A3G G;  3JZI A;  1OXX K;  2VQE L;  4PMB A;  1CKM A;  1TQO A;  2UXD L;  2KCM A;  5C3E B;  5LL6 X;  4IN3 A;  4RCO A;  2EYP A;  4R8N A;  4B3M L;  4HMI A;  1JT8 A;  3PQI A;  1JB7 A;  4UY8 C;  2DNC A;  4KJO A;  5C4J B;  5I2X A;  3KLS A;  1STE A;  4DL5 A;  2E2D C;  3HKZ E;  3I3C A;  3P1H A;  2D9U A;  3H0G G;  3LWU A;  4IO9 A;  1VCI A;  1SE8 A;  2VUM B;  3U9O A;  1IL8 A;  2VQE Q;  2NVT H;  1EL0 A;  4Q45 A;  1H9S A;  3FKI G;  1EOV A;  4A3D B;  3T1Y H;  2EOT A;  2YU9 B;  4DV3 Q;  2NVQ B;  3PW4 A;  1SNQ A;  5JJZ A;  3S2H B;  1QWY A;  3BZK A;  4C2M B;  1IYV A;  1EYZ A;  5CA0 F;  3H0G H;  2NU8 B;  3C1F A;  4A3M B;  5FLX E;  4A4I A;  2VR1 A;  4OO1 I;  3K7A H;  5IWA H;  1HZC A;  5IGC A;  3T1H Q;  2F52 A;  2WB1 A;  1M8A A;  2NUC A;  1AW7 A;  3KDF B;  5M5Y H;  4MAM A;  2QGQ A;  3MXP A;  1FJG L;  1TWH H;  3OTO L;  3Q8S B;  2H1E A;  2L15 A;  1U4R A;  3GTG H;  2IHF A;  4DV5 Q;  1S0O A;  4J1M A;  2UUA L;  5LMN Q;  4F8M A;  3U9S A;  1XXG A;  4ZCK A;  1H9R A;  1JOQ A;  1BBU A;  4UCR A;  2PQA A;  4X64 L;  2J4X A;  3FDS A;  1S4Z A;  1L2F A;  3ONA B;  4OX9 H;  5D3D A;  1H95 A;  2ZXO A;  5D8D A;  4J9K A;  2XVS A;  1S10 A;  2EYH A;  1WR2 A;  3I8Z A;  4QUC A;  1RJP A;  3GTQ B;  1EIF A;  4KN7 C;  5G3L D;  3HOX G;  4OON A;  1Y1W A;  2ZXR A;  4TQU S;  4IPG A;  5C0X G;  3M4Y A;  2VPQ A;  5I6Y A;  2CVR A;  2J0T D;  4C56 C;  3D6W A;  3QG1 A;  3NBI A;  4LF7 H;  2AGQ A;  1N56 A;  1DGS A;  2R8K A;  2IPK D;  1KNE A;  5ELD A;  3KF8 B;  2RHS B;  4DPG A;  4A3B G;  2HQE A;  3NWS A;  3V4S A;  4CKB A;  4XTC S;  4MA0 A;  5IT9 L;  4YCU A;  3J80 c;  1UEA B;  3VR3 A;  2FPI B;  4PZ7 A;  1PH1 A;  1PVO A;  3T16 A;  4BY7 B;  1D2B A;  1E1O A;  3PUZ A;  4R4O A;  1FVI A;  3R23 A;  4OWW B;  2ICI A;  5I47 A;  1T5X D;  2ZDQ A;  1VQF A;  2MO0 A;  5KNC A;  1KLG D;  2LY7 A;  3L0O A;  3URY A;  4K5W A;  1BCP C;  4CDC C;  2PN1 A;  5E3F A;  2YU9 A;  1VMC A;  3S1R H;  1T9H A;  2OQK A;  4FXK C;  1I4Q A;  2IX0 A;  4X66 Q;  1T5E A;  5DQG A;  4LF8 Q;  3SK8 A;  3PO2 G;  2AWO A;  3W1G A;  2K5H A;  2DY8 A;  4J9L A;  1EIH A;  4UFZ A;  4LUO A;  1WJJ A;  1IBL L;  3PCO B;  4QY7 A;  2RF4 A;  1LAC A;  4DV5 L;  3H3V C;  2UXB Q;  3GO5 A;  3N6X A;  2K5V A;  1Z2O X;  2IY5 B;  4ZUI A;  4BBR G;  3K3P A;  3RN2 A;  5CV5 A;  4RZR A;  2F0U A;  2VW9 A;  3AFP A;  3MJF A;  5C8Y F;  3TDQ A;  1S9F A;  1JIC A;  3HP3 A;  3SXH A;  3K0Y A;  4JI3 H;  3AB9 A;  3U9T A;  2UUB L;  4MV7 A;  4ED3 A;  1EY7 A;  3S17 H;  3M4O H;  4ED2 A;  1ET9 A;  2EYJ A;  4A3J H;  4LUZ A;  3TME A;  3J7Y W;  2PQA B;  1CUK A;  1VF5 C;  1E4E A;  3Q24 A;  4G7O C;  4HAE A;  4P71 A;  3Q0A A;  3CKI B;  4RCN A;  2M2L A;  3I4O A;  2R92 A;  3RJ0 A;  1PH3 A;  4A3B H;  2KEN A;  4DUZ L;  3OUZ A;  1LT3 D;  3A8J E;  3E0J A;  4U6P A;  4RNN A;  3SI8 A;  5JJK A;  1A2U A;  1O75 A;  4NXN L;  1L1O A;  2JA5 H;  4R4T A;  5FJ8 G;  1SNC A;  4WJW A;  3WOF A;  1L0X B;  1NR2 A;  5C3W A;  1LYL A;  4HSP A;  5IT9 E;  3GTP B;  1H9M A;  2R7Z G;  4IFD I;  3DWP A;  4L63 B;  2HVQ A;  4L6T B;  3CMA A;  4P72 A;  1NCV A;  1YNX A;  3K7A B;  4YY3 Q;  2KA7 A;  4MIU A;  1A15 A;  3O13 A;  5F9N A;  2GLT A;  1TWA B;  2PNR C;  1IOW A;  1CKO A;  1RL2 A;  2BCO A;  5KG1 A;  1G6P A;  1ZET A;  5I4D A;  1EU3 A;  2FLP A;  1TWF B;  2I07 B;  1FL0 A;  1IZ6 A;  4EQ5 A;  4ED7 A;  2K75 A;  5C0X J;  5JJL A;  5JEA H;  3VYR A;  1YZ6 A;  4DV5 H;  1G2T A;  1MSG A;  4QCL A;  1W2B A;  2R8J A;  3LML A;  2SEB D;  2B2U A;  4LNQ A;  2EPB A;  1LTI D;  4PNY A;  1XNR L;  4DV1 L;  3TS2 A;  1PHJ A;  5LL6 b;  3GTJ B;  1TKW B;  4JI6 L;  4OX9 Q;  1E1T A;  3GDE A;  4QL5 A;  2FK1 A;  2XSC A;  3RR5 A;  1SE2 A;  2RSN A;  3GD7 A;  4B3S H;  4A3K B;  2EE1 A;  2WIN B;  5D1O B;  3QOJ A;  3G6V A;  5GON F;  5IOD A;  4KY5 A;  4NPS A;  4C3H G;  2XGT A;  4L5Q A;  3VR4 A;  1Q90 A;  2FFK B;  3U58 A;  3RUZ A;  5BPH A;  2RDJ A;  1WTP A;  2FXQ A;  1M0T A;  1E24 A;  3ER0 A;  2R7M A;  3H0G A;  2N3S A;  1HNW Q;  4ZK9 B;  1BCP B;  5J2T F;  2L5T A;  2PMZ B;  1C8C A;  2F0K A;  2YS6 A;  1DJR D;  2C00 A;  1VQI A;  1SJE D;  3KYH C;  1B9M A;  3KF6 A;  2I8C A;  4C3H B;  2V58 A;  4BXX H;  1MIU A;  1VQD A;  2IJ0 A;  3GTG A;  1CFM A;  2UVV A;  2ZTE A;  4Q8E A;  2YTY A;  1JR0 D;  5KFA A;  5DEH A;  2K7V A;  3J81 j;  2JA8 B;  2NZO A;  4A3M G;  1LTB D;  1H9S B;  4IRD A;  2DJG C;  4WOR A;  2VUG A;  4JV0 A;  4LUV A;  1JIH A;  4OGQ C;  3MVV A;  1UE6 A;  3JC6 6;  3FPP A;  1HNW L;  4X3S A;  3MXU A;  2VOB A; 
#chains in the Genus database with same CATH homology
 5LMU Q;  1E3P A;  5C3E H;  1EUJ A;  1A8V A;  4DAY B;  2F3I A;  4YWL A;  4P74 A;  1P16 A;  1Q81 C;  3KFU A;  3GTQ H;  4ME3 A;  3NBH B;  3T1Y Q;  4PZ6 A;  1LM0 A;  4TVA B;  2OCE A;  2JA6 H;  2JQO A;  1PH5 A;  4X62 Q;  4DR1 Q;  4AQY Q;  4JBW A;  4DR7 L;  3BU2 A;  2E8G A;  3DM3 A;  1Y1W G;  3VDY A;  1I94 L;  3STB C;  4JBM A;  1UE5 A;  3PUX A;  2K5N A;  2Z0S A;  1IL2 A;  5C44 G;  3CPF A;  4PMW A;  2HIV A;  3H15 A;  2UXC Q;  1X9N A;  5IP9 G;  1N36 L;  1HH2 P;  3L2P A;  3AYH B;  3S24 A;  1XMQ L;  2AMC B;  3AQQ A;  3I4M H;  4L5R C;  5IY0 A;  4KLK A;  3KJO A;  3HOU G;  4DV4 Q;  2YU9 H;  4B3R Q;  3F2D A;  1QVG A;  3RLO A;  1PH8 A;  2YTX A;  4YCV A;  1VQ6 A;  3TRZ A;  4R4Q A;  2HQL A;  2LXK A;  3K80 C;  5EAY A;  3UDX A;  4DKA C;  4GNX B;  1SRU A;  4HIO A;  2OTJ A;  3GTL H;  4BY1 H;  5GAE C;  4LF9 Q;  4HIM A;  2BH8 A;  2ZTC A;  3K7U C;  3PV0 A;  1C7Y A;  4A3E G;  2GN5 A;  2C35 B;  1NTG A;  4WJ4 A;  3I4N G;  2EIF A;  2JA7 G;  5BR8 L;  2CWP A;  5C4X H;  2UU9 Q;  1Q7Y C;  1NMG A;  4OO1 G;  1Q8K A;  2N49 A;  4YY3 L;  2ZM6 L;  4DV4 L;  2JEA I;  4A3G H;  1HNW L;  4DR4 Q;  4OX9 L;  1NJI C;  1YIT A;  1N9W A;  5BR8 Q;  4UP9 A;  4RMF A;  3F2B A;  1V1Q A;  3G6E A;  4UP8 A;  2AWN A;  3S1Q H;  5GAH C;  1VS0 A;  2OQ0 A;  4A3C G;  1G29 1;  5JJI A;  1SFO H;  1MKH A;  4B3S L;  3HOY G;  4HJA A;  1QVF A;  3UE0 A;  5H1S E;  2N78 A;  5JEA J;  1HNZ Q;  2F4V Q;  4AYB G;  3CCU A;  1X56 A;  5IYC H;  4AQY L;  1D8L A;  1A62 A;  4XIG S;  4OWX B;  4FDB A;  4Y52 H;  1SRO A;  1PH7 A;  1IBM Q;  3I7F A;  2XTI A;  4DV0 L;  4A3K H;  2GVB A;  4A3B G;  3JAM i;  1EIY B;  4JI0 L;  1X6O A;  4LF6 L;  1HJP A;  3HKS A;  4X65 Q;  3CCM A;  4DV6 L;  4JI4 Q;  3S15 H;  3PUW A;  3KDF A;  3D31 A;  1SR3 A;  1PH9 A;  4PZ8 A;  2LSS A;  3S16 H;  4KI0 A;  4HJ8 A;  4JC0 A;  4A3F G;  4O2D A;  5IWA L;  4H02 A;  1Y14 B;  4DR3 L;  1B70 B;  1A0I A;  4YWM A;  3AEV A;  2VNU D;  2WP8 J;  4DUZ Q;  3CF5 A;  4HJ7 A;  1K8A C;  1G51 A;  1XNQ L;  2NN6 G;  3HOZ G;  4IOC A;  3L7Z C;  3TEH B;  5M3M H;  2H5X A;  4GOP A;  2LXJ A;  1VQ7 A;  4BY7 G;  3B6Y A;  4JYA Q;  4A93 H;  5IT9 c;  2GVA A;  3MXN B;  2MNA A;  1X3F A;  1I94 Q;  2OTL A;  4GLX A;  1HZB A;  4A3E H;  4JI4 L;  5M5X H;  1N36 Q;  3S1M H;  5FJ8 H;  2IHE A;  3ERS X;  3UDF A;  4BY1 G;  1OXT A;  1KL9 A;  1VQ9 A;  4GOP B;  4DR5 Q;  1GKH A;  4LF9 L;  3S14 H;  1EQR A;  1VQ4 A;  2K4K A;  1BKB A;  2MFI A;  4B3T L;  4LF4 Q;  2YV5 A;  4A3I H;  1K3R A;  1UEB A;  5ELN A;  1V43 A;  2R7D A;  4JYA L;  4JI0 Q;  3CCV A;  2R93 G;  2JA8 G;  2YYZ A;  1S72 A;  5IYD H;  3RNU A;  4IJH A;  4LF5 L;  1JJC B;  4JV5 L;  4A75 A;  3CQZ H;  4POF A;  1L1O B;  4JI5 L;  2Q2U A;  4DK6 C;  2N8N A;  5IWA Q;  4DUY Q;  1YHA A;  4JOI C;  5DLQ E;  2A1A A;  3HOX H;  3UDI A;  4A3J G;  1PH2 A;  4JI7 L;  1TXY A;  4LWC A;  4DV6 Q;  2B63 G;  2ID0 A;  1HR0 W;  1B8A A;  3F2C A;  5IYD G;  1WCM G;  5GAG C;  3PSI A;  5IP7 H;  2ZTD A;  1IBM L;  3KLW A;  4BY7 H;  2HIX A;  1Q82 C;  1AE3 A;  4YHH Q;  1PH4 A;  2E2H H;  4LFC Q;  3GTP H;  2F4V L;  1HR0 Q;  3HOV H;  3CCL A;  1OXU A;  1PV4 A;  4GNX C;  1N34 L;  4JI7 Q;  4KHP L;  3M4Q A;  3DLL A;  2CQO A;  5C44 H;  3I4M G;  1LUZ A;  2OWO A;  4OWT B;  5IP9 H;  3GTK H;  4DR3 Q;  1N8R C;  3M4P A;  2PI2 E;  1EQQ A;  2VS1 A;  4JI8 Q;  1OTC A;  1KIX A;  2E5L L;  3CD6 A;  4A93 G;  1Q1B A;  3J81 c;  1VQH A;  2QEX A;  1KRS A;  4B3T Q;  4JI5 Q;  2R92 G;  4A3K G;  3KJP A;  4ALP A;  3U4Z A;  1AH9 A;  4NB3 A;  1A63 A;  2D0P A;  1QUQ A;  3A0J A;  2ASB A;  3PGZ A;  1ASZ A;  1O7I A;  4JG2 A;  2JA5 G;  2I5H A;  5AJ3 L;  3S1N H;  4LW1 A;  4DR7 Q;  3CC4 A;  4A3D H;  2HT1 A;  4K0K L;  1LTL A;  3K0X A;  1VQ5 A;  4UP7 A;  1IBL Q;  1VQG A;  1VQM A;  2Z6K C;  1IBK L;  1JMC A;  1YIJ A;  3J80 i;  2VY3 A;  2R7Z H;  2R92 H;  4QIW E;  3T1Y L;  1HZ9 A;  3A5Z B;  3TS0 A;  1N33 Q;  1Q1E A;  1PYB A;  3RZD H;  3HOY H;  1HR0 L;  1JJG A;  2K52 A;  2VZA A;  2WAQ E;  1KRT A;  4NXN Q;  1U5K A;  5LMU L;  2JK8 A;  3OTO Q;  4DR2 L;  3CP0 A;  5M3F G;  1YJN A;  1HNZ L;  3HKZ G;  4BA1 I;  4B3R L;  5IE8 A;  4DV3 L;  1VQP A;  1YJW A;  2CWA A;  1K73 C;  1IYJ B;  4DV2 L;  5IYB H;  4X6A H;  3EBE A;  3ULJ A;  2YTV A;  4DV0 Q;  2I5L X;  3CC2 A;  4GLA C;  5GQO A;  4GKK L;  2Z6K A;  1CKN A;  1U0L A;  3G48 A;  3OYY A;  5FLM G;  2WB1 G;  2UUC Q;  3JAM c;  1E22 A;  3A74 A;  1J5E L;  5J3B A;  2E2J H;  1VQN A;  5ELO A;  1S40 A;  4LF7 Q;  1D7Q A;  1KHI A;  4R1J A;  2JE6 I;  1YHB A;  2MO1 A;  4K0K Q;  4A3G G;  1OXX K;  1R9T H;  2VQE L;  1XMO L;  1CKM A;  3CCR A;  1QZH A;  3Q8D A;  1UE7 A;  2KCM A;  2UXD L;  4QQB X;  4IPD A;  3H3V I;  3CCQ A;  4DUY L;  1VQJ A;  4B3M L;  1OXV A;  5HY6 A;  2JJQ A;  1I6H H;  1JT8 A;  5M5W H;  4KHP Q;  4YWK A;  1JB7 A;  4UY8 C;  1GVP A;  4LF7 L;  1N32 L;  2JA9 A;  4OXP A;  1EFW A;  3HKZ E;  4JI1 L;  4DAM A;  3H0G G;  2ZJR A;  4IO9 A;  1VCI A;  2BA0 A;  4JI2 L;  1SE8 A;  4AIM A;  2ZJP A;  4R4C A;  3WWV A;  5JEA G;  2VQE Q;  2NVT H;  4EX5 A;  1UE1 A;  3PF5 A;  1XNR Q;  3FKI G;  1EOV A;  2JA6 G;  4IFD G;  1I5F A;  3FHW A;  4J15 A;  4L5S A;  4DR5 L;  3CCS A;  1Y1V G;  4DV3 Q;  2IT1 A;  3S2H H;  2D0O A;  1FJG Q;  1S3O A;  1K83 H;  3BZK A;  3M85 A;  3H0G H;  3PO3 H;  5C4J H;  1KXL A;  4A4I A;  4OO1 I;  3K7A H;  3U50 C;  1KD1 C;  1KQS A;  4GKK Q;  4GKJ L;  1HZC A;  2MQH A;  3CAM A;  3CME A;  3T1H Q;  2F52 A;  1CKN B;  4X62 L;  1N34 Q;  2VUM H;  1BBW A;  1B7Y B;  3KDF B;  1J6Q A;  1WI5 A;  4LFA Q;  5M5Y H;  2WFW A;  3F8T A;  3PUV A;  4DV7 Q;  4GNX A;  1XPO A;  2QGQ A;  1FJG L;  2PMZ E;  1TWH H;  3OTO L;  4A3C H;  1WFQ A;  3FP9 A;  1HNX Q;  1TWF H;  2L15 A;  3GTG H;  3ZJY C;  2IHF A;  3M3Y H;  4DV5 Q;  1VQ8 A;  3TRE A;  2UUA L;  5LMN Q;  4C2M H;  1MJC A;  1M90 C;  1QZG A;  3MEF A;  4L5T A;  4A3M H;  1M1K C;  1VQK A;  4QJF A;  1JE5 A;  1BBU A;  3CC7 A;  4NXM Q;  2R93 H;  4DK3 C;  2B3G A;  4P73 A;  5IYB G;  3S2D H;  2PQA A;  4X64 L;  2DGY A;  3RLN A;  1L2F A;  3CXC A;  1XPU A;  5LMN W;  1H95 A;  2HHH Q;  1N32 Q;  3H3V H;  1FGU A;  2B29 A;  2RHQ B;  2UUB Q;  3KF6 B;  2BH2 A;  1EIF A;  1SLJ A;  3HOX G;  3I56 A;  4OON A;  2ATW A;  4TQU S;  4IPG A;  1YEZ A;  5C0X G;  3GTO H;  3OW2 A;  3GTM H;  3M7N A;  5C4X G;  2NN6 I;  4BBR H;  5AJ3 Q;  1VQA A;  3F1Z A;  1PA6 A;  1DGS A;  2NVY H;  4WJ3 M;  1VQO A;  2EXD A;  4R4I A;  2NVX H;  3EIV A;  2ZJQ A;  1TWC H;  3KF8 B;  2RHS B;  4DPG A;  1IBK Q;  1PFS A;  2VL6 A;  1VQB A;  2K14 A;  4LF5 Q;  2VUM G;  3CPW A;  1L1O C;  1E7Z A;  4XTC S;  3CCJ A;  4YCU A;  1GO3 E;  3J80 c;  1HNX L;  4IOA A;  1WYD A;  2NVQ H;  4PZ7 A;  1PH1 A;  1PVO A;  1ASY A;  2BA1 A;  1E1O A;  4Y7N H;  1YBY A;  3PUZ A;  1FVI A;  4R4O A;  4A3L H;  4OWW B;  3UDG A;  1VQF A;  2MO0 A;  3BZC A;  3E9H A;  3L0O A;  3CCE A;  4A3F H;  4DNI A;  5FLX c;  2Y0S E;  4HJ5 A;  3PF4 A;  4LFB Q;  4LF8 L;  1PYS B;  3J7Z C;  3S1R H;  4GN3 B;  2UU9 L;  1T9H A;  1Q46 A;  2OQK A;  2IX0 A;  3D0F A;  4AH6 A;  4LF4 L;  4X66 Q;  4LF8 Q;  4NXM L;  1P8L A;  2AWO A;  3W1G A;  3PO2 G;  2VQF L;  2K5H A;  4GOP C;  3ULL A;  3G71 A;  3W1B A;  3RN5 A;  4GN4 B;  5IYC G;  4GKJ Q;  1EWI A;  4LUO A;  1WJJ A;  1YHQ A;  1IBL L;  1X55 A;  1Z47 A;  3K81 C;  3PCO B;  2RF4 A;  4QY7 A;  3U4V A;  4JCV E;  4DV5 L;  2PNH A;  2HHH L;  5M3M G;  2UXB Q;  3GO5 A;  1Q86 C;  2K5V A;  3ULP A;  4A3I G;  2IY5 B;  2ZM6 Q;  2AHO B;  3NEM A;  3KOJ A;  4BBR G;  2UUC L;  3RN2 A;  4LFB L;  2VW9 A;  1OXS C;  3AFP A;  2K50 A;  2UXB L;  1XMQ Q;  2R7F A;  1X3G A;  2IX1 A;  2QA4 A;  4BA2 I;  4C3I H;  5HGQ A;  1XJV A;  4IPC A;  4HID A;  5M3F H;  2UUB L;  3S17 H;  3M4O H;  1V9P A;  3PIO A;  4A3J H;  3RZO H;  3NEL A;  2JEB I;  4LUZ A;  4RG1 A;  3I4N H;  2PQA B;  1CUK A;  4X64 Q;  4JI3 L;  4P71 A;  3A5U A;  2A8V A;  2CFM A;  1VQL A;  2RCN A;  3I4O A;  4JBJ A;  1Z9F A;  2PI2 A;  1NE3 A;  2KEN A;  4DUZ L;  1PH3 A;  1MJE A;  3LGJ A;  4A3B H;  4BXX G;  4X66 L;  2WAQ G;  5JJK A;  1Q12 A;  1NMF A;  3M9B A;  4NXN L;  1L1O A;  2JA5 H;  1Y1V H;  1W3S A;  3E9I A;  4R4T A;  2KBN A;  5E7N A;  5FJ8 G;  1WOC A;  1K8G A;  3PO2 H;  4JI6 Q;  2ALY B;  1LYL A;  1AE2 A;  3HOW G;  4PG3 A;  4JV5 Q;  4LF6 Q;  2R7Z G;  4IFD I;  2Q2H A;  2Q2T A;  2D62 A;  2KHJ A;  3STB D;  3CMA A;  2VQF Q;  3HOU H;  4IJL A;  4P72 A;  1RIP A;  1YNX A;  4YY3 Q;  4JI8 L;  4DV7 L;  5C3E G;  4JI1 Q;  2CCZ A;  1UWV A;  1K9M C;  1JJ2 A;  4DV1 Q;  1CKO A;  1RL2 A;  1G6P A;  2CKZ B;  3T1H L;  1TWG H;  2R6G A;  3UE1 A;  1FL0 A;  1K0R A;  5GAD C;  1IZ6 A;  2ES2 A;  4UPA A;  4EQ5 A;  2UXC L;  1C9O A;  4LFC L;  3HFZ B;  2K75 A;  5C0X J;  2E5L Q;  5JJL A;  1XMO Q;  2E2I H;  3RLF A;  4A3D G;  1YZ6 A;  1KAW A;  3G4S A;  3W5O A;  1W2B A;  2B63 H;  4GS3 A;  4A76 A;  4DR1 L;  4LNQ A;  1CSP A;  5LMN L;  4O0A A;  1XNR L;  3TS2 A;  4DV1 L;  2I0Q A;  4JI3 Q;  1PHJ A;  4KHZ A;  4A3L G;  2KHI A;  2I5M X;  4JI6 L;  4OX9 Q;  4IPH A;  1E1T A;  3GDE A;  4QL5 A;  1SMX A;  3HOV G;  4JI2 Q;  3RR5 A;  3I2Z A;  3GD7 A;  2KCT A;  3K8A A;  1WCM H;  1VQC A;  1L0W A;  5IP7 G;  4QGU A;  4C3J H;  4LFA L;  2JA7 H;  4GN5 A;  3HOW H;  4HJ9 A;  1N33 L;  1KC8 C;  4JBK A;  4DR4 L;  4NPS A;  2XGT A;  4L5Q A;  3U58 A;  1X3E A;  3IRB A;  4APV A;  2FXQ A;  4YHH L;  3J81 i;  1E24 A;  1I50 H;  3ER0 A;  1SN8 A;  3NEN A;  4MNO A;  2Y0S G;  2N3S A;  3GTJ H;  5C0X I;  4BBS H;  1HNW Q;  1NBW A;  1CSQ A;  3BJU A;  3CW2 C;  1I3Q H;  3PUY A;  1EYG A;  4B3M Q;  2UUA Q;  3J7A 5;  1X65 A;  1GD7 A;  1YVC A;  1YI2 A;  4MZ9 A;  5GRO A;  1VQI A;  4P75 A;  4C3H H;  3KYH C;  1YJ9 A;  3KF6 A;  3FKI H;  4GLV B;  5FLM H;  1GM5 A;  2EQS A;  3ICE A;  4BXX H;  2Q2I A;  4JOI A;  3PIP A;  3TQY A;  1MIU A;  1VQD A;  4YCW A;  4DR6 L;  1XNQ Q;  2V1C C;  4X65 L;  1TWA H;  3AFQ A;  2ZTE A;  1X54 A;  1XPR A;  4HIK A;  3SGI A;  2YTY A;  4MTN A;  2WB1 E;  2A19 A;  4IFD J;  4DR6 Q;  1VQE A;  1QUQ B;  3PO3 G;  2NZH A;  2DUD A;  1J5E Q;  1IXR A;  2AKW B;  4AYB E;  3J81 j;  2JA8 H;  2UXD Q;  4BBS G;  4DR2 Q;  2NZO A;  4A3M G;  3HOZ H;  5K36 G;  1XTD A;  4B3S Q;  1PH6 A;  3E0E A;  4DV2 Q;  4LUV A;  3I55 A;  1BVS A;  1UE6 A;  3EN2 A;  3JC6 6;  1Y1W H;  1C0A A;  1NY4 A;  1HZA A;  1QVC A;  4POG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...