4A3EG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 31
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3eG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3eG01
4BXXH 2NZHA 4DV7L 1KXLA 3HOVG 1EQRA 3K81C 3OTOL 2K14A 4IPGA 4JI3L 1B7YB 1X3FA 1SN8A 5IYCH 5C0XJ 1OXXK 3STBD 1WCMH 1X9NA 1PH5A 3K0XA 3L7ZC 3RN2A 1HR0W 2D0PA 4LF7Q 1RIPA 1X6OA 3D0FA 5EAYA 4A76A 3HKZG 4DV3Q 4DR2L 2PQAB 4B3SQ 5IYBG 1MKHA 1N36L 4DUZQ 4JI1Q 4JI2Q 2VS1A 2L15A 3S1RH 3TRZA 1YI2A 5IP7G 1XMQL 4GNXB 3CMAA 4DUYL 1UWVA 1WOCA 3UDGA 4GLVB 1PH4A 2AKWB 2Y0SG 4NB3A 2PMZE 4A3JG 1YVCA 5BR8Q 3KJOA 5IWAL 1PYSB 3I7FA 3AYHB 2F52A 3RR5A 3CXCA 4OX9Q 4X64L 1PH1A 4UY8C 3H3VI 2VQEL 2V1CC 2WAQE 1KRSA 1VQAA 1VS0A 4BY7G 4JI0Q 4OXPA 4K0KQ 5FJ8G 5JJIA 2K5VA 3PCOB 3D31A 3CCVA 3S1NH 1YZ6A 3GTOH 4DR5Q 1IYJB 2EQSA 4YY3Q 1BBUA 2JQOA 4P71A 2A19A 3I56A 1SE8A 4BBSG 1QUQA 2IX0A 3WWVA 3J81c 1XPOA 4B3TL 2FXQA 4C2MH 4TVAB 1N9WA 3PUYA 4L5TA 3FKIH 3CC7A 1QZHA 4DR7Q 2UXBL 1NMGA 3PO3H 4P74A 2UXDL 4GOPA 2JA6H 3KOJA 1A62A 5E7NA 1L2FA 1HNZQ 3I4NH 3S17H 1OXVA 3RLFA 5IYDH 2ZJRA 3HFZB 4DV5L 1WI5A 1WJJA 3J80i 4A3KH 1KHIA 5FLMG 2OCEA 3T1YL 3GTPH 1XPUA 3KFUA 1VQ6A 1UEBA 2K5NA 2NVYH 2B63G 1MJCA 3E9HA 5GQOA 1GD7A 2YTVA 2JK8A 1PA6A 4DV4L 1Q81C 1TWAH 1X3EA 2CWPA 1YHAA 4EQ5A 1UE6A 2D0OA 4JI8Q 4JBKA 1K8GA 2F3IA 3H15A 1L1OC 1N8RC 1CKMA 4LF7L 2F4VQ 1E1OA 3PF4A 1D8LA 1OXUA 1PYBA 4HJ8A 1V9PA 4JOIA 1HNXQ 4LFAQ 4DUZL 1EIYB 2JA5G 3F8TA 4DV7Q 4JI2L 3T1HQ 2VQFQ 2DGYA 3DM3A 4C3HH 3CCUA 1NBWA 1VQHA 2CQOA 4R4QA 3CPFA 3GDEA 1LTLA 2AMCB 3K7UC 5C0XG 4JI3Q 3PUZA 1VQ8A 4JYAL 4DR1Q 1TWCH 5JEAG 4OX9L 3PO2G 1I5FA 1Q86C 3RN5A 4YWLA 4BBRG 5GADC 2ES2A 1LM0A 2NVXH 3J7ZC 1MJEA 5LMNW 4JI7Q 2N49A 1PH3A 3M9BA 5C4XG 4JI5L 4DNIA 4HJAA 4DR2Q 3ULLA 1WYDA 4LF6Q 2CCZA 5FLXc 1CKOA 4BY1G 4YY3L 4DR5L 1XMQQ 5M5XH 1XMOL 4Y52H 3STBC 2ZJQA 2IX1A 4IFDJ 2OQKA 4A3LH 2CFMA 1G51A 3HOUG 4X6AH 1K83H 1O7IA 1GM5A 2K52A 2B29A 4MTNA 1PV4A 4R4IA 2Q2HA 2N8NA 5IWAQ 3GTQH 5HY6A 2VQEQ 3I4MG 2WB1E 4A3IH 1VCIA 4DK6C 3CCQA 5IY0A 2IHEA 4A93H 2KHIA 1VQIA 3S1MH 4EX5A 1H95A 1K8AC 3HOYH 1NMFA 3E9IA 4PZ8A 4POFA 1GVPA 4DV0Q 3H3VH 4YCUA 1TXYA 5M3FH 4P75A 1XPRA 1Q82C 4UP8A 1E22A 4C3JH 4GLAC 2HQLA 4JC0A 1EQQA 2R92G 1IBKL 3UE1A 2UXDQ 3IRBA 2JA7G 2K50A 4YWKA 3L2PA 3CCEA 5IYCG 1UE5A 4RMFA 3HOWH 2MQHA 1P8LA 3H0GH 4DV5Q 4L5RC 2F4VL 1B8AA 3JC66 2NVTH 4AIMA 1N34L 1HZ9A 4QY7A 4OO1I 5C3EH 1J5EL 1HNXL 3KLWA 3F2DA 3G4SA 3F2BA 3T1HL 2VQFL 3T1YQ 1VQLA 3UE0A 2Q2TA 1SLJA 1AE3A 4A3MH 2VZAA 1X54A 3M85A 2MNAA 1QUQB 4DV4Q 4HJ9A 4DR1L 2D62A 5J3BA 2ZM6Q 3W1GA 1HR0Q 5LMNL 1JT8A 2PI2A 1XNQQ 4JI7L 2LXKA 3U4VA 1V1QA 1W3SA 4IJLA 3UDIA 3TS0A 4KHPL 5M3MH 2IT1A 1EOVA 2NN6G 1I94L 1SROA 2N78A 4LF6L 1YIJA 2WP8J 3BZCA 4LF4L 4HIOA 4HJ7A 4GOPC 2UU9Q 4Y7NH 2Y0SE 4JYAQ 3FKIG 3ERSX 1T9HA 2KENA 3U50C 3PO3G 4IJHA 4PZ7A 3PUWA 2IHFA 4IPHA 4DV2Q 4R4OA 5IYDG 1E1TA 4QGUA 3I4NG 4UPAA 4A3BH 4R4CA 4JBMA 1Q1BA 3KF6A 3CCLA 1SRUA 4JI5Q 4JI4Q 1AH9A 3PUXA 5GROA 3I4OA 4DV0L 1K9MC 2R93H 4IFDG 1B70B 4KI0A 4A3KG 4P73A 4QIWE 1A63A 1XMOQ 1X3GA 1QVFA 4PMWA 3TEHB 2E2HH 2KCMA 2ZTEA 1BKBA 1I50H 1PHJA 3NENA 4X62L 3PF5A 2MFIA 1Q8KA 2ALYB 1HJPA 4OWXB 1SR3A 1Z9FA 2R6GA 3Q8DA 3HOXH 1M1KC 3GTLH 4AQYQ 4A3GH 4DPGA 4WJ3M 1JMCA 2HHHQ 4JOIC 3CCRA 1VQ4A 1EYGA 2IY5B 5IP9G 4A3CH 2A8VA 3RLOA 1JJ2A 4HJ5A 1OXSC 3AFQA 4YWMA 1MIUA 3KDFB 1TWGH 2LSSA 2RF4A 4UP9A 3BZKA 1QZGA 5HGQA 4UP7A 1C0AA 1YJWA 3GTGH 1L1OB 4JI6L 3K80C 4L5SA 4A3FH 5IT9c 1IBKQ 1CKNA 3PV0A 1Z47A 1N32Q 3S1QH 4X66Q 2PNHA 1ASYA 3BJUA 3S2HH 3CD6A 1Q12A 4HIDA 2LXJA 2ZM6L 1KC8C 1HR0L 4LF8L 3S16H 1YNXA 4XIGS 4A3EG 3HKSA 1XNQL 4HIMA 1V43A 1SMXA 1FVIA 4HIKA 2HT1A 1IBLL 2VW9A 3GO5A 1N34Q 2OTJA 1J5EQ 2JEAI 4DR3Q 3NELA 5JJKA 2VUMG 2ZJPA 5LMUQ 3I2ZA 1NTGA 2BA0A 2E2IH 1CSQA 1NY4A 1VQJA 1VQGA 4ME3A 4R1JA 3GTJH 2UU9L 2EIFA 4A4IA 1PH6A 4A3LG 4LUZA 3G6EA 2JJQA 3TQYA 3W1BA 2AWNA 3CPWA 5LMNQ 2AWOA 4DV2L 4GKKL 3G48A 2JE6I 4DK3C 1BBWA 4A3IG 3W5OA 4KHPQ 4B3RL 2VNUD 4GN3B 4A93G 1I94Q 4JI4L 3CP0A 1HZBA 3F1ZA 4YHHL 3CC2A 1YBYA 2I5LX 3CAMA 3JAMc 4LF4Q 3LGJA 4R4TA 5M3FG 1U5KA 2XGTA 3ICEA 3U58A 3U4ZA 5C44H 3NEMA 1K0RA 1PFSA 4LFCL 1VQPA 4B3MQ 1E24A 3PSIA 3A5ZB 1ASZA 4OWTB 4AQYL 4DKAC 1Y1VH 2HHHL 1KQSA 3E0EA 4NXNL 2QEXA 3H0GG 3HOWG 4BY7H 1X55A 3B6YA 4OWWB 1Q1EA 2JA5H 2KHJA 5C3EG 2JA8H 4BXXG 2KCTA 3M4OH 5JJLA 4YCWA 1CUKA 2R7DA 4DR4Q 1YHQA 3ULJA 3G71A 1K3RA 4A3MG 2OTLA 2B3GA 4DAMA 4OONA 4X62Q 4A3DH 4GKJL 1N32L 2YYZA 4X66L 1NJIC 1P16A 1VQNA 3PO2H 2MO1A 2I5MX 2RCNA 2K75A 2WB1G 1C9OA 4IPCA 1WCMG 5ELOA 3OW2A 4GN5A 2E2JH 3ER0A 4DV6Q 2OWOA 2Z6KC 4AYBG 4LF5Q 4NPSA 1VQ7A 2E5LL 1YHBA 5M3MG 4DR3L 4JBJA 4MNOA 5LMUL 1KIXA 2QGQA 3FHWA 1JB7A 4ALPA 3I55A 4JI6Q 1A0IA 4POGA 2UUCL 4C3IH 2RHQB 3RZOH 2KBNA 1PVOA 3S24A 1J6QA 3VDYA 4LF9Q 3ULPA 5H1SE 4JG2A 1RL2A 3TREA 4LFBL 3MXNB 3CC4A 1YJNA 3S14H 4LF8Q 1Q7YC 5GAGC 1WFQA 4GOPB 1IBLQ 2R7ZH 4A3BG 1VQEA 3HOZH 5AJ3Q 3HKZE 1G291 3BU2A 2RHSB 1Y1WH 2EXDA 2Z6KA 4PZ6A 4IOAA 2XTIA 2R93G 5GAEC 5C4JH 3GD7A 1IZ6A 1HH2P 1X56A 2YTXA 4FDBA 4DV1L 2I0QA 1N33Q 2UXCQ 2YTYA 3J80c 2R92H 2GN5A 1HNWQ 4B3ML 4NXMQ 2JA7H 1VQMA 1XNRQ 1FJGL 2JA6G 4JBWA 4GKKQ 1CKNB 1DGSA 4A3GG 3HOXG 5JEAJ 3CMEA 3S2DH 3PGZA 4B3RQ 4LUVA 2GVAA 3CCSA 5C0XI 3PIPA 3CW2C 4LWCA 4YHHQ 4A3CG 4J15A 1LUZA 3HOVH 1FGUA 4L5QA 1VQOA 4PG3A 3J7A5 4DR4L 3L0OA 1G6PA 4MZ9A 3EN2A 3CQZH 4QQBX 1A8VA 4LFCQ 4A3FG 1KL9A 1VQCA 2BA1A 1C7YA 4APVA 4RG1A 3UDXA 2NZOA 4LNQA 3DLLA 1KD1C 3UDFA 1UE7A 2WAQG 1EIFA 2UUBL 2HIXA 2OQ0A 4DV6L 4GNXC 1CSPA 1VQ9A 4NXNQ 4LF5L 3AEVA 5IYBH 3A0JA 2ZTCA 5IP7H 1R9TH 1IL2A 3RZDH 4O0AA 2ASBA 2K5HA 4AH6A 3K7AH 1IBMQ 1QVGA 4A3JH 3RLNA 1VQFA 2YV5A 4LF9L 4GKJQ 5DLQE 4OO1G 4KLKA 4O2DA 3EIVA 2UUAL 3TS2A 1YEZA 3ZJYC 3GTMH 2PQAA 2WFWA 5FJ8H 1XTDA 3GTKH 2E5LQ 4DR6Q 1L0WA 5AJ3L 4GNXA 3PIOA 2DUDA 4JV5Q 2GVBA 3CCJA 3K8AA 4BBSH 1OXTA 1JE5A 1X65A 2UUCQ 1IXRA 3CCMA 2UXCL 3FP9A 1N33L 1FL0A 2JA9A 4X65Q 2CWAA 1S72A 4BA1I 1HNWL 4NXML 2ID0A 5C44G 4LFBQ 4H02A 1XNRL 4QJFA 1NE3A 2QA4A 4GS3A 2HIVA 1GO3E 1VQKA 1KAWA 3J81i 1Y1VG 5IP9H 1TWFH 1VQBA 5FLMH 1PH9A 3HOYG 4DV3L 1HZCA 1PH2A 4B3SL 1XJVA 4JI1L 2JA8G 3OTOQ 2B63H 4DV1Q 1GKHA 2VY3A 3J81j 3CF5A 5K36G 3SGIA 3AQQA 1Q46A 2CKZB 1E3PA 2NN6I 1K73C 5BR8L 4XTCS 4A3DG 2AHOB 1FJGQ 3M7NA 1TWHH 4A3EH 4BA2I 2A1AA 3RNUA 2JEBI 4YCVA 1PH8A 1EUJA 4K0KL 1OTCA 4JI0L 3KDFA 3KJPA 1M90C 4A75A 1AE2A 4WJ4A 1L1OA 2VUMH 3AFPA 3PUVA 1N36Q 4IO9A 3S15H 4TQUS 4P72A 2PI2E 1IBML 2E8GA 4DUYQ 2ZTDA 2N3SA 1YJ9A 4DR7L 1UE1A 3F2CA 3KF8B 4BBRH 3NBHB 4IPDA 4IFDI 2I5HA 1SFOH 4QL5A 4X64Q 2UUBQ 1I6HH 1HNZL 1EWIA 4GN4B 1I3QH 5C4XH 4DR6L 3KYHC 5M5YH 1VQDA 3M3YH 1S3OA 4AYBE 1HZAA 1Y14B 2R7ZG 1EFWA 4BY1H 1E7ZA 3HOZG 1Y1WG 2R7FA 4JV5L 3KF6B 2BH2A 2ATWA 1QVCA 1U0LA 4B3TQ 3A74A 1KRTA 4KHZA 3HOUH 4X65L 1VQ5A 2VL6A 4JCVE 2C35B 1BVSA 2H5XA 3M4PA 5GAHC 3EBEA 2UXBQ 4LUOA 3MEFA 2UUAQ 3I4MH 5ELNA 1LYLA 1S40A 3OYYA 4JI8L 2Q2IA 4DAYB 5IE8A 4GLXA 4LW1A 2Q2UA 4IOCA 1D7QA 3JAMi 1W2BA 5M5WH 1JJGA 1JJCB 3A5UA 1YITA 1PH7A 2NVQH 2YU9H 3M4QA 2Z0SA 2BH8A 2K4KA 2MO0A 4LFAL
chains in the Genus database with same CATH superfamily
2NZHA 3FKIB 1U4LA 3V4SA 3JRWA 1FD7D 1E2ZA 2R7ZA 1U9RA 1B7YB 1H9MA 1X3FA 2M2LA 3S17B 1MD2D 1Y8NB 3D8GA 4KJOA 2PPBC 5FPOA 5JH7F 4F4YA 4LFAH 1Y1WA 4FF4A 1QG7A 3KAJA 3STBD 3SI8A 1X9NA 3K0XA 3RN2A 3RJ0A 4LF7Q 1Z2PX 2OLSA 5EAYA 1BCPD 3BQ0A 4B3SQ 1MKHA 1N36L 3MXGA 4RNNA 2NVYB 3S1RH 2F0MA 1YI2A 1SJED 3K5LA 4JI7H 4OELB 1YNND 4GLVB 2WAQB 1JOQA 4A3JG 5HBRB 2YYAA 1PYSB 3AYHB 3SE0A 3RR5A 4X64L 2F0JA 3JAML 5EKIA 4BY7G 4K0KQ 5FJ8G 3D31A 3CQZA 3HRZC 3S1NH 4QF4A 1AZPA 1DM0B 3MAQA 2EQSA 1AN7A 4C1NK 1JWUD 1SE8A 2KOLA 3WWVA 2IX0A 2FXQA 4IUUA 2WINB 4TVAB 3MXNA 2UXBL 2ATLA 5KFRA 4RUAA 2R87A 2B2YC 4GOPA 3EJIA 5E7NA 3BDLA 1SYEA 3IN5A 2ASJA 3N43B 2W70A 1WI5A 2UXDH 1JOOA 3J80i 1V1PA 1GOZA 2PO4A 4RCOA 1HHVA 5DQHA 3EQLC 3K5NA 4R7RA 3KFUA 4DV5H 1BXRA 4B9XA 3PW2A 3VR3A 2B63G 5EGTA 1MJCA 1HXYD 5GQOA 4DV4L 4XXEA 4QIWA 3T1YH 4YB8B 2CWPA 1YHAA 4EQ5A 5L1JA 2XC9A 5KNDA 5KG1A 1L1OC 4PMBA 1CKMA 1TVXA 3P1HA 3TIIA 3PF4A 2CQAA 3FVQA 4BS9A 4ZLTF 1PYBA 4HJ8A 3NQIA 1V9PA 1STEA 1UNSA 4RGOS 4DUZL 1ZKOA 2JA5G 3F8TA 4JI2L 1PVOA 2EY2A 5LOVF 2ZM6H 2VQFQ 1HR0H 2DGYA 2W7OA 1K8MA 1VQHA 3DEOA 3QR8A 1VQ8A 2A68D 1E0BA 4X3SA 3H6MA 4OX9L 5JEAG 4F50A 4U6PA 5GADC 5KFKA 1LM0A 3J7ZC 2B63A 4JYAH 3M9BA 2Q8IB 2CW0D 2XRSD 4HJAA 2RKSA 2W9CB 2RVLA 2KEDA 1LABA 1CKOA 3RZOB 5ELCA 4YJ2F 4CJ2C 4A3LH 5KFIA 2OQKA 5KFGA 4B08A 2WB1B 2BDOA 1G51A 1CK1A 1KJQA 5KT5A 1O7IA 4MTNA 1PV4A 1RK6A 2PZWA 1STBA 4NMZA 4ULLA 5HY6A 1M0TA 2DY8A 3I4MG 2QW7A 5KG3A 3RAXA 2UVUA 3DWAA 4DK6C 3CCQA 2NU9B 2DNEA 4EX5A 5LL6b 1ONLA 4J8QA 5FO7B 3R2TA 4PZ8A 5I2YA 5JVLA 5A35A 2OF1A 4YCUA 1BXTA 1XYIA 4Y7NB 4TRDA 4P75A 1Q82C 4Q43A 1HTPA 4EYIB 1E22A 2PNRC 5ELFA 1G2TA 2N88A 1B6SA 3E6ZX 2K5DA 4CC6A 4G7ZC 5KFXA 2K50A 4YWKA 1PDQA 1UE5A 1GUNA 1GHJA 3HOWH 3VMMA 2JYOA 1RK5A 2F4VL 1IBKH 3JC66 1N34L 5JJZA 5C3EH 2E2HB 2FE3A 4JVZA 1EQVA 3G4SA 1VQLA 2BE5C 4DL6A 3ND9A 4PDBA 4KY7A 2AUKA 1X54A 2MNAA 5A2QW 1J5EH 2BCOA 1Z6HA 4DV4Q 4DR1L 5C8YF 2D62A 1S97A 2Z8LA 3K5OA 1SYCA 3GV3A 5KFNA 2LXKA 4YJ3F 1V1QA 1TWGB 3TS0A 2IT1A 1EOVA 5F9LA 1I94L 3RZDB 2N78A 4LF6L 4JUZA 5BPFA 1EZ6A 2Y0SB 4ODGA 5LMNH 2R7LA 2WP8J 3S1QB 4HIOA 1WCMA 4KHPH 1C3OA 2GA4B 4ZYSA 4HJ7A 2W7PA 4DU9A 2C2RA 5EQ0A 1WVLA 1NUCA 1T9HA 3U50C 1E4EA 3N40P 5KEEA 2IHFA 4LF4H 2I46A 3S9WA 4DV2Q 5IYDG 1E1TA 4QGUA 3I4NG 4A3BH 1WH2A 1Q1BA 3KF6A 3CCLA 4JI4Q 2E2IB 2EY1A 4DV0L 2XWJB 1ILQA 1B70B 4A3KG 4QIWE 2HQEA 2XRQD 3TMEA 5DG7A 3BJYA 1PHJA 3GIKA 3PF5A 1RF2D 1Z2OX 2NUAB 4A3GH 3GTLH 3TZDA 4RB0A 3IAYA 4Y8VB 1VQ4A 1EYGA 2IY5B 2ENBA 4IN3A 5IP9G 3ETJA 3M9MB 4A3CH 5CBEE 1JJ2A 3MXPA 1OXSC 4YWMA 4DK0A 5EKKA 5FD5A 3GTGH 2F0UA 4ZOLF 1I4RA 3I4LA 4C3HG 3K80C 4LF5H 5A2QL 3UI2A 3PV0A 4HMIA 1ASYA 3CD6A 3CU7A 4LF8L 1XNQL 2VW9A 1N34Q 3M4OB 1PRTC 2OTJA 4FF2A 4IRDA 2B8FA 3NELA 1B44D 2J7ZA 4NW2A 5LMUQ 1TWAA 3HBLA 2MGSA 1BUVT 5FOBB 1A3VA 4XYQA 4R1JA 3GTJH 2UU9L 4A4IA 1SFOB 2VPSA 2OT2A 2DY7A 3CPWA 3BABA 2UXCH 1KLGD 3PW5A 1STNA 3G48A 2QDBA 4BY1B 4B3RL 4A93G 1I94Q 3OIPA 1ZHSA 5IT9W 3A8JE 4YHHL 2A73B 4C3IB 1XNRH 3TINA 2O4XA 3HOUB 1I6UA 2A6HD 3GIQA 4R4TA 2QCPX 5M3FG 5LP6F 2NVXA 4EQNA 3ICEA 4G3IA 5C44H 1LT6D 3NEMA 1O75A 4RAYA 2L11A 4OWTB 3R5HA 1EYDA 4L6TB 4AQYL 1EY8A 1NR2A 1Y1WB 2JEFA 1Y1VH 1KQSA 4CDDC 4LFCH 3H0GG 1B50A 3H4BA 3TBIB 3Q8SB 1X55A 3H91A 1EFID 4ZK9B 5BN4A 2PCFB 2ZDHA 5J2UF 1HRJA 4FXKC 2F3WA 5JJLA 3MTSA 4DR4Q 3ULJA 2JA7B 1B53A 1K3RA 4A3MG 2OTLA 2HVSA 1R4PB 3RV3A 2YYZA 3NP8A 4X66L 1CI3M 3VPDA 4RB1A 1PMRA 3S2DB 3DMUA 1PTOF 4IPCA 3KBGA 3OSOA 1IBMH 5ELOA 3ER0A 1BNCA 1K3BC 4AYBG 4NPSA 2K6AA 4JBJA 5I4DA 1XDNA 4FNFA 1FR3A 4HSVA 2RHQB 4PQXA 3H0GA 4KK7A 3TREA 2YS6A 3MXNB 3S14H 4LF8Q 5CAEB 4GOPB 4FYDA 2A69C 2EE1A 4OL7A 3S1NB 5C4ZA 1MZBA 4TQSA 3ITPA 3K6OA 3LWEA 5AJ3Q 4RUCA 4LFBH 2Z6KA 4P2CB 4A3JB 2XTIA 2W71A 1V1PB 1CHQD 3J80c 3GIDA 4AYBA 1CFMA 2AQ3B 3NBIA 5CB4F 2RA4A 3SR1A 4ECTA 4DV1H 1DGSA 1G2SA 2KUMA 4LMQD 5JEAJ 2H4OA 4B3RQ 2IP4A 5C6AA 4LUVA 2GVAA 4LWCA 4YHHQ 4J15A 3OHAA 1FJGH 2F0DA 2YZGA 1FGUA 1VQOA 1C48A 3SHLA 3L0OA 4XQJA 1LT3D 1ZYRC 4QQBX 2B39A 1KL9A 1VQCA 1C7YA 1N36H 4E6IA 4RCNA 2MP1A 1F2YA 2K01A 3A56A 3KLSX 3UDXA 5IODA 3UDFA 3MFGA 2WAQG 2UUBL 4MV7A 5C3WA 4ZKCB 3RGXA 5ELDA 3AEVA 3CVZA 5IYBH 1C4QA 4DL4A 3A0JA 2B63B 2CZGA 5IP7H 1R9TH 4X64H 3OSNA 2R6FA 3K3PA 2YZMA 4N8X1 3K7AH 1QVGA 1EY9A 3R8BA 4LF9L 1EU3A 1RYSA 1E4GT 4RKBA 4X3TA 2UUAL 3TS2A 1KJIA 1O7LA 3Q6SA 3GTMH 5CV5A 4M9UA 3MR2A 3GTKH 4DR6Q 2C2EA 1L0WA 1SMYC 2UXBH 5CV9A 1B04A 3E3XA 4JV2A 4WFN3 1HTLD 5D1OB 4ME5A 4A2AA 1X65A 3CCMA 4WJWA 2SCUB 2BR0A 2CWAA 1I6HB 1UC8A 4NXML 3P7JA 1ESFA 1EEID 1I6VC 5J1ZA 1KC7A 1DOLA 1NE3A 4GS3A 3L4JA 5KFYA 5M9OA 1KAWA 5EWFA 3FEWX 1VQBA 1PH9A 1HZCA 5KYIA 1FNVA 4IRKA 4JI1L 1JB3A 3Q8RB 4ED6A 2EYLA 3I4MB 4DV3H 1S5DD 5EKLA 1E3PA 2NN6I 4DUZH 4XTCS 3BVMA 1EWCA 2JEBI 1PH8A 5I6YA 5C3EB 1OTCA 1DOMA 1K28A 4K2KA 1AE2A 5BR8H 2F0KA 4OX9H 1L1OA 1CM9A 3AFPA 5FO8B 4IO9A 3QIAA 3VYSA 1S0NA 4N8FA 5I2XA 4JI0H 2X69A 4DR7L 1WCMB 2K05A 2N55A 4CDCC 4K14A 2OXPA 2I5HA 2UUBQ 4QL5A 4C1NI 5CA1F 2HVRA 2KQ3A 1HNZL 5C4XH 5CV6A 3QOLA 4YP3A 4AYBE 1ZXTA 1Y14B 1E7ZA 1N56A 3KF6B 4HQ6A 2WACA 1QVCA 4K5XA 3QOJA 1EU4A 1EY4A 5KFAA 4KHZA 4X65L 1VQ5A 4JCVE 4RH6A 1BVSA 3KUPA 4JV1A 1DZ1A 1D2BA 4GZYC 2UUAQ 4A3BB 2B2WC 1S40A 2R8IA 2W9AA 3JAMi 4F8MA 1ESRA 1GUWA 1YITA 1S5BD 2NVQH 4C2MB 4BXXH 4JI8H 1KXLA 1EQRA 4RHRA 5KT2A 3SK5A 1S03G 2F4VH 5L37A 2J4XA 2JA6B 4RZQA 2NTTA 4JI3L 2JP1A 3I4NB 1GHKA 2PBZA 3EFXD 4DV7H 3FRPB 4YR0A 2KJXA 3A55A 1EIHA 3VPCA 4HCSA 1JWSD 3C1EA 3L7ZC 2VPQA 2F0FA 1RIPA 1X6OA 4HN7A 2R92A 4DR1H 3HKZG 3RUZA 3GTGB 2PMZB 1IOVA 4TKOB 4JI1Q 3MJFA 1RTNA 1UAPA 4DUYL 2Z9HA 1UWVA 1TWAB 1WOCA 2AUJD 1DJRD 4O3NA 2Y0SG 3AB9A 4DR2H 4LF6H 1H9SB 2RDGA 5T1IA 1S68A 3E5NA 3KJOA 3HGBA 3MR5A 2F52A 5JPNC 2RSNA 3U9TA 1XMQH 2G9DA 2VQEL 2V1CC 2WAQE 1JLLB 1KRSA 4OXPA 3PZPA 2NN6H 1SDFA 3M4YA 5JJIA 5IWAH 3GTOH 3T16A 4DL7A 4LMYA 4XYOA 3GTJB 2A19A 3OMCA 3LWUA 1XPOA 3DF7A 1D1IA 1QZHA 3PUYA 4DR7Q 4RWSC 3HKZA 1T94A 3PO3H 4DV0H 2NVXB 2FP4B 4P74A 4EBCA 2AGQA 3KOJA 3BA9A 1A62A 4WD3A 1HNZQ 2GLTA 1OXVA 5KFZA 1EYAA 3Q24A 1RJQA 4L1KA 2PVPA 2Y0SA 1O80A 1S4ZA 3C3LA 4K8IA 4A2BA 1WJJA 1EZ8A 2K32A 1KHIA 2PQEA 3BQ1A 2EYFA 4XX0B 1K83B 5C44B 3GTPH 1XPUA 1EL0A 1UEBA 3SK8A 5D1PA 1GD7A 2YTVA 2JK8A 4U7CA 4XDXA 2K03A 2R7MA 1Y1VB 4A93B 2IX3A 4CJ0B 1AUXA 4OIKA 2RQXA 4CHTB 4LF7L 1CA5A 3JSLA 2DJGC 1D8LA 2B2UC 5M3FB 1OXUA 1TY2A 1RD9D 4MV8A 3T1HQ 2W8KA 4DGZA 1NBWA 3CPFA 5C0XG 4JI3Q 2LS01 1H9JA 1TWCH 1Q86C 3RN5A 4BBRG 1ICFB 4I7AA 3PIP3 4Q5VA 1MJEA 1S5CD 2N49A 3ULLA 2L12A 1Z2NX 4ECXA 5FLXc 4BY1G 3I12A 5DG8A 4ZQ3A 5M5XH 4H0LC 3P20A 1XMOL 1TWHA 3STBC 2ZJQA 2IX1A 4IFDJ 1V51A 4EGQA 3MFIA 4JI5H 2JXMB 3HOUG 4ED3A 2FLNA 1T5EA 3D4WA 2XGPA 1BCPC 1E2WA 3GTQH 2VUMA 1CQFA 1TS3A 4MTKA 2VQEQ 2WB1E 5JQWA 1VCIA 2EYJA 4J6HA 5C1PA 2IHEA 3S1MH 1ENAA 1K8AC 3HOYH 1NMFA 1QILA 5COYA 4IALA 3VR2A 4RU9A 1TXYA 4IZOA 4DXGA 3RBEA 4ZUJA 2YZNA 4J1MA 4AQYH 1XPRA 4RB3C 1SFOA 5BN5A 5I9OA 4C3JH 3H20A 2NBFA 2HQLA 1I3QA 5KFBA 3VA7A 3TN2A 2EXZA 2F3VA 2JA7G 3L2PA 5T14A 3CCEA 4RMFA 4MA5A 3PIO3 1HCZA 3WOEA 4X66H 2CW7A 4UFZA 3T13A 5LA6F 1PYWD 3HS0C 1SYBA 1WTPA 2VQFL 1SLJA 3TP7A 1AE3A 2RDJA 3MWMA 4X3KA 1WTOA 1KEEA 1PZJD 1QUQB 1BR9A 2A5HA 3CRKC 3P75A 3HZXA 3BAAA 4ZHQF 2FPGB 4QMGA 2HCIA 2YU9A 3EA6A 3W1GA 1PFBA 1SEBD 3U9OA 3BG3A 3U4VA 3UDIA 3NK9A 1WTWA 5TSSA 1E4FT 4F4XA 3I73A 3I3CA 3N8DA 3IL8A 2JA7A 1S10A 3G6XA 3ORRA 3KLRA 1JE4A 3S2HB 3KF8A 2YRXA 2A74C 2Y0SE 3S16B 1YNJC 4HMJA 2RGRA 2KENA 4IJHA 4PZ7A 3PUWA 4CKBA 3GTKB 4R4OA 1A15A 3NE5B 4XQNA 4UPAA 1EYZA 4R4CA 5CMDA 5A2QE 2EJFC 3M9OB 4ED7A 4B9WA 4YAKB 5GROA 2A68C 1K9MC 2R93H 3GV8B 4KI0A 4P73A 1I4GA 2EDGA 1X3GA 5ELEA 1XMOQ 4CKCA 5IYZF 1GLVA 2WIIB 3GILA 1KNAA 2KCMA 4QWDA 2ZTEA 4MV6A 1BKBA 4QUFA 4X62L 1SCUB 2CW0C 3GIPA 4DAYA 1TA8A 1Z9FA 3HOXH 1GUTA 4QWBA 3NPPA 1JMCA 2HHHQ 3CCRA 4O3PA 2ALZA 3FMCA 5E3FA 1RODA 3AFQA 2V5AA 2LSSA 4UP9A 1IW7D 1S0MA 1X32A 1L1OB 2I8CA 2XD4A 4JI6L 1U4PA 4A3FH 1N32Q 1GSOA 3MEHA 2Z4IA 3RIZA 4ECRA 2R7NA 1K8OA 1YNXA 4XIGS 3AMUA 3HKSA 4BY7H 4EGJA 3J81W 3GIIA 3CKIB 2HT1A 4CDFC 1IBLL 2R84A 5FD6A 4LF9H 5G3LF 4DR3Q 1CA6A 2HDLA 1NTGA 2BA0A 4ZI7F 1CSQA 2KA7A 1Q90A 1UEAB 2F0OA 3PO2B 1VQJA 5BPHA 4ME3A 3GV7B 2EIFA 1SE3A 1B4OA 1PH6A 4A3LG 4RNMA 2L1BA 2E2JB 3TQYA 1WD0A 2AWNA 4DV2L 4GKKL 2AWOA 3WO0A 4DLKA 3T51B 5KG6A 1BBWA 5JVDF 2LFNA 3URYA 4JI4L 3DEPA 1AP0A 4NXMH 2CH4A 4DNTB 2XIWA 2I5LX 1K1SA 4CC5A 3JAMc 4QCLA 4TUYF 2XGQA 5KG4A 1PFNA 3U58A 3U4ZA 4DNRB 1JDBB 5D3IB 2HD3A 1K0RA 1VQPA 1WTXA 4B3MQ 1E24A 4K6DA 3PSIA 3Q8PB 3R5FA 4KY5A 4QW9A 1JXLA 4QUCA 3HOWG 1PZID 4NXNL 5D1OA 4XT3B 3KXYT 2EOTA 2W9BB 2JA5H 2SNMA 5CV8A 3OUZA 5C3EG 2JA8H 4H13C 1WTVA 2R92B 1CUKA 2R85A 3SK4A 3KK7A 4Q8FA 1LT5D 2B3GA 1J9OA 4HSPA 4JW0A 4LJZC 3D3RA 4X62Q 5IT9E 4GKJL 5JEAH 1LO5D 4N9PA 2KECA 3SDZA 2I5MX 3VR5A 2EYPA 1TAEA 3DWPA 1O78A 1JWMD 2X6GA 1WCMG 3J81L 1ULZA 4DV6Q 4O42A 4ABNA 2OWOA 2Z4HA 2KVMA 4KD4A 5LMUL 1KIXA 2QGQA 4JI6Q 1A0IA 1EY0A 2WYOA 2E5LH 4J9NA 2KBNA 2J6SA 3S24A 3VDYA 3ULPA 5H1SE 5KFPA 4FF3A 2R82A 1V4YA 3CC4A 3N41B 4DL5A 3HKZB 4V190 2ASDA 2UUCH 2F0PA 2LKVA 3HXLA 3V6KA 1M7JA 1TU2B 1IBLQ 1EIGA 4X65H 3GTOB 4A3BG 4MA0A 3NWTA 3HOZH 1AUVA 1I7LA 2FKLA 4IOAA 5C4JH 1KTKA 4CBVA 1IZ6A 1HH2P 4KKSA 3PO3B 2I80A 4FDBA 2I0QA 1N33Q 2YTYA 1KJ9A 3HB9A 1HNWQ 1PX2A 5DM73 2ZDGA 2G5DA 2WTFA 2JA6G 1LTRD 1M6VA 4GKKQ 1CKNB 3KHGA 4A3GG 5C4HA 4UCTA 3CMEA 2B2WA 3D4DA 3CCSA 3PIPA 3CW2C 1GSAA 3UFXB 4A3CG 1TQOA 3HOVH 3DWQA 4FBUA 2F0EA 4L5QA 4PG3A 3E5SA 3J7A5 4DR4L 3MZ5A 5BN3A 3EN2A 4GC6A 1DV1A 2F0HA 2FJZA 2KSWA 2K5QA 4APVA 1W96A 2NZOA 1KD1C 4O2AF 5KYLA 5DG9A 4DUYH 1MBYA 4C2MA 4GNXC 2E76C 1VQ9A 1DOKA 4NXNQ 2L9HA 5CV7A 2DJFC 1DD2A 4OGQC 2JA6A 4RGTA 2ASBA 2K5HA 4AH6A 3GTLA 1IKLA 4X3UA 2FHTA 2K33A 1PRTB 1TWHB 1VQFA 2YV5A 3CRLC 5DLQE 4A3EB 4GKJQ 4KY6A 3LP8A 4KLKA 4O2DA 3T4AC 3BDOA 1YEZA 1HQMC 2BE5D 3GTGA 1S9FA 2VUMB 4HAEA 1EHIA 2PMZA 4K6LA 2YS7A 3KTMA 5AJ3L 1F9RA 3PIOA 4JV5Q 1PTOH 2O2LD 3CCJA 1S5FD 4BBSH 2YW2A 2AGPA 1CTMA 1H9SA 2NU6B 1STHA 4BBRB 1D5ZC 1SBBB 2JA9A 2NWGA 3U9SA 5DQIA 2F0IA 4BA1I 3V6JA 5C44G 4ECUA 2PZTA 1I3QB 2PYKA 4ZAIA 2XCPA 1VBGA 2QA4A 3M3YB 2HIVA 1Y1VG 5IP9H 1TWFH 5KFQA 3GTJA 2DIKA 3RV4A 5FLMH 1CZGA 5F9NA 2B2TA 3OTOQ 3C2PA 4LF7H 1JIHA 1DYQA 2R8HA 1Y8PB 5DQGA 4B3SH 1K73C 2UVVA 4EVOA 4BA2I 3BDCA 3RNUA 3WOFA 2CHBD 3HEJA 2R8GA 2YU9B 4H44C 3KDFA 3KJPA 4A75A 1K83A 1D5MC 1I4XA 4FXDA 5L1KA 3OW7A 3PUVA 4UCSA 4K0KH 4TQUS 1UNNC 4QWCA 3TP6A 3Q22A 1Y1VA 3QJYA 3GV6A 4APMA 5KG0A 3F2CA 4G4KA 3KF8B 1FKAH 4J9KA 4IPDA 2IPKD 4ME6A 4IFDI 1JX4A 3EYYA 1V8QA 3G6JB 3OWFA 4G57A 4FVMA 5KFTA 3QZ8A 3EPIA 2C9OA 3S1RB 4DR6L 5M5YH 1HZAA 2E75C 2NU8B 1EFWA 5KFOA 4ED8A 5CC4A 2R7FA 3QG1A 1BBXC 2MCTA 2QDLA 2EY6A 1K1QA 1U0LA 1UUPA 4B3TQ 2C35B 4TV8F 2H5XA 3EBEA 2TSSA 3TQ1A 2F03A 2EVBA 2AU0A 2JEGA 2F0QA 4IHJF 3OYYA 4GLXA 4DAYB 1WTHA 5KFFA 2Z1CA 5M5WH 3QZ7A 2IBKA 3TSSA 1JJCB 5IT9L 1PH7A 3M4QA 5JUMA 4O4IF 2MO0A 4LFAL 2PW7A 4YQWA 2Q8RE 3K81C 1IL8A 2K14A 2V4RA 3OSPA 3O13A 1B6RA 2XSCA 1VMCA 5IYCH 2VQFH 5JPMC 1OXXK 1HR0W 2D0PA 3CHBD 2PQAB 5IYBG 1EEFD 2EYOA 4DL2A 3TRZA 2GPWA 4A3FB 5IP7G 2EY5A 3MVVA 2C5CA 2YCHA 1S0OA 1PH4A 2AKWB 4NB3A 2PMZE 1A2UA 1S5ED 3TP8A 5JVH3 2PZUA 3MR3A 2V4DA 3H3VI 4C5BA 1EUCB 3NGDA 4F4WA 5ISRA 2K5VA 3WNZA 4L63B 2B2VC 3MWYW 1YZ6A 2X6LA 1AZQA 4DR5Q 1IYJB 4YY3Q 1BBUA 4P71A 1SE2A 2LMCB 5G3LD 1QUQA 4ECVA 1NAPA 1I4QA 4PMCA 3FKIH 5F2DA 4MN3A 1KDAA 2HDMA 3H40A 2UXDL 4PWQA 1ZHQA 1R9TA 3GLKA 3S17H 1TKWB 3RLFA 2ZJRA 4DV5L 4ILWA 3VYUA 4IFDH 5KX5F 2RDFA 3T1YL 1F9PA 1MSGA 4HTHA 5C5LA 4DFAA 3K5MA 1HFGA 1VQ6A 2A69D 3GTMA 3FDSA 2L5TA 2K5NA 2NVYH 3E9HA 1M4VA 3H4DA 3GTKA 3H09A 1Q81C 4IUTA 5J2TF 4XYMB 1UE6A 2D0OA 2B2YA 4JBKA 4IWXA 1N8RC 1E1OA 3G6VA 2JA8B 4DV4H 4HEDA 4KMUC 1IOWA 5IOCA 4C5CA 1IHZA 1KAAA 3AU7A 4LFAQ 1HNXQ 1EIYB 2KCCA 3PQIA 4ECYA 3DM1A 3CCUA 1VF5C 4R4QA 5J39A 2R8KA 4UHVA 3K7UC 3LMLA 4I7ZC 4JYAL 4JI2H 1SEIA 3HOWB 3EROA 3PO2G 3OHBA 3N52A 2V58A 3RB3A 5LMNW 4FM9A 2XCLA 4JI7Q 3V05A 1ZYRD 1GJXA 5DEHA 5C4XG 4DNIA 3MA2B 3BQ2A 2ASLA 1WTQA 3T5KA 4YBZB 4DV2H 2J9GA 1W6KA 1JORA 4BWGB 5KG5A 3A7LA 2F0SA 3IKJA 2CFMA 1Q8IA 4JI4H 2K7VA 2N8NA 1ET6A 3RTXA 5CR3A 3HOZB 4A3IH 1EY5A 4CDEC 2KHIA 1H95A 4POFA 2X0SA 3L4KA 3H3VH 1CQVA 5EWEA 4EQOA 3J7AK 3SVMA 1A2TA 3A8IE 4IURA 2L55A 4HNUA 4JC0A 2R92G 4YIJA 1IBKL 1HUNA 1QCBD 5E4XA 5KRUA 2UXDQ 2F0TA 5D8DA 4RNOA 5ELBA 1TR5A 1LTAD 5EOYA 1P8LA 4L5RC 4DV5Q 1B8AA 5IGDA 4ED0A 1LTBD 4AIMA 2NVTH 1HZ9A 1TS2A 4K5VA 1HQRD 4OO1I 1J5EL 3HP3A 1SXTA 3KLWA 1TIID 3R2IA 3F2BA 3T1HL 3T1YQ 5KIXA 2EZVA 3UE0A 2Q2TA 2PN1A 3QO2A 4NP5A 5D65A 4TSSA 5KFUA 1IKMA 1N34H 4QW8A 3RFCA 4A3GB 2C28A 3GTLB 4TQRA 1A6XA 5LMUH 1TS4A 5J3BA 2ZM6Q 1Q3LA 5LMNL 1RJTA 2PI2A 1HR0Q 4MV4A 2W9BA 4V0BA 3RGZA 4Q8EA 4IJLA 4DF7A 2IL8A 4KHPL 2W8LA 1IYUA 5M3MH 2NN6G 4O3OA 2MHVA 3BZCA 4LF4L 5NUCA 4WRDA 2EJGC 3NBHA 1I94H 1F2ZA 4Y7NH 4JYAQ 1WD1A 3ERSX 3PO3G 2YRWA 4O4HF 1QNUA 2VQDA 4LSXA 4Q45A 1SRUA 4BBSB 3D4RA 3I4OA 4KN7C 3R3OA 1A63A 1VF7A 1I4PA 3TEHB 2E2HH 1W6JA 3FMAA 4LSAA 1PTOC 1I50H 2MFIA 2ALYB 3C46A 1HJPA 3GTOA 1SR3A 2R6GA 1XXGA 3RB0A 1M1KC 4DR4H 4DPGA 3PW4A 4M7EA 4JOIC 3T5HA 1SYDA 3I90A 2NYZD 2A8VA 3RLOA 4HJ5A 4IUNA 1Y69U 3KDFB 1TWGH 1C0AA 2BQ3A 3BZKA 2F0LA 5HGQA 5D14A 5EPKA 4L5SA 2BQUA 1EWHA 1IBKQ 1CKNA 3S1QH 2PNHA 3BJUA 1Q12A 4HIDA 2LXJA 1A9XA 1KC8C 4A3EG 2J0TD 2XWBB 1V43A 1SNOA 1FVIA 1SMXA 5IGEA 3K57A 4HIKA 3GTPA 3IFTA 2XCAA 1SNDA 1J5EQ 2JEAI 2VUMG 3V4ZA 4LF8H 2ZJPA 1XNQH 3I2ZA 2E2IH 4UDUC 1MSHA 3K5IA 1G91A 4OO1H 1MGSA 1PK8A 2B8GA 3G7LA 3G6EA 1O7YA 2IA6A 1D1KA 2JJQA 2VUGA 3RB6A 5LMNQ 1ENFA 5KFEA 1TY0A 2SNSA 2UU9H 3T53B 2JE6I 3SXHA 4KHPQ 3N42B 5JVG3 1SSOA 4GN3B 1GYFA 1BCPB 4WBNF 3F1ZA 3CC2A 4J9SA 1YBYA 5LL6X 1LV9A 1TWCA 3CAMA 4DXFA 3I8ZA 3FDTA 3J81E 4LF4Q 5EDWA 4B3RH 1FYCA 2ZT9C 5KFVA 4C3JG 3S14B 1NNXA 3QFFA 4IR9A 1F9SA 4YHHH 2W6NA 4LFCL 2NUCA 1B9MA 4RGMA 1EUDB 2IWHA 3E0JA 1ASZA 5EPLA 2DPIA 2XN9C 1JQYD 2HHHL 5IGCA 3LX0A 1YNNC 1G6ZA 2QEXA 3IFDA 2VR1A 3B6YA 4OWWB 4Q44A 1Q1EA 1EY7A 2W6QA 2KHJA 3GTQA 3MXUA 2KCTA 3M4OH 4YCWA 3OMGA 1XX8A 5K36H 5AFWA 2RCFA 1GUGA 4DAMA 1N32L 4A3DH 3KBXA 5EBDA 1NJIC 4O2BF 1KLUD 4PNYA 4RGNA 3RB4A 2RCNA 2F0NA 4LAAA 4GN5A 4UCUA 2Z6KC 4LF5Q 3L9AX 1VQ7A 2AQ1B 4DR3L 2DWCA 2A6ED 2I07B 1DONA 3FHWA 3SK6A 5EWGA 3J7AV 2WKCA 3I55A 2IMWP 4C3IH 2DLNA 5DLGA 4DR6H 2QYZA 5FPRA 1KJJA 5CYUA 3T5JA 3V6HA 3A7AB 3NWSA 4IUVA 4LFBL 3M9NB 3ETHA 4N9TA 1HFNA 1BQQT 1WFQA 4MV9A 3NQTA 2R7ZH 1R9TB 1SYFA 1RDPD 1VQEA 4MIUA 3HKZE 1Y1WH 2RHSB 2EXDA 3K7AB 4PZ6A 2R93G 4DL3A 1PRTF 1X56A 4DV1L 2UXCQ 2BQRA 3PR5B 4M1UB 2ZXPA 4B3ML 3GTMB 3HG9A 2JA7H 5KFMA 1XNRQ 1FJGL 2R7KA 2E2DC 4JBWA 1B9NA 1M8AA 5KFWA 3HOXG 2FLLA 4J9QA 3S2DH 2E74C 4FS1A 2EYHA 1LUZA 1BDOA 4ECQA 5J22A 3G8CA 1G6PA 4F88A 3BS1A 5JOBA 3CQZH 3ND8A 4LFCQ 4A3FG 2BA1A 4KKUA 4O4LF 4IRCA 1LTID 4FBTA 4RG1A 4LNQA 2R93A 3DLLA 1RKNA 4HR7B 1C30A 1EIFA 2R3ZA 4EGVA 2GPSA 3Q1KA 4DV6L 3WO1A 1CSPA 1AEXA 1RJRA 5LHY1 1STYA 1H9KA 2SEBD 3W3AA 4DAVA 1ZQ7A 2UUBH 2ZTCA 4WORA 3RMHA 4O0AA 5E1FA 4O1NA 2FMAA 1IBMQ 4EEQA 4CKEA 3MHBA 4A3JH 1JC7A 1PLFA 2BOSA 1C8CA 4CGYB 3EIVA 4RHSA 2PQAA 3NTKA 5FJ8H 1PXUA 1XTDA 2ICEC 1WSCA 3R23A 2QEJC 3C1FA 4EQPA 2UUAH 2QKIC 2GVBA 4EBDA 4MTDA 2B2VA 1OXTA 1JE5A 3KHHA 1IXRA 3IG0A 1N33L 1VBHA 1FL0A 3EVQA 3J80E 1HNWL 1JDEA 1HPCA 1ML0D 4LFBQ 1B3QA 4H02A 4A3IB 5C4XB 4QJFA 1CS0A 3VPBA 3TQTA 1VMPA 1M0WA 1PZKD 4KN4C 4IUPA 1RJPA 1VDZA 1CQJB 1YNJD 4DV3L 1PH2A 3KALA 1II3A 2ZDQA 2JA8G 1A3UA 5KNBA 2B63H 4DV1Q 2VY3A 3CF5A 3H3VC 2J6UA 4ECSA 4FP5D 2Z6BA 4J9PA 2CKZB 2WE6A 4JI1H 5BR8L 1FJGQ 3M7NA 2FB9A 2FK1A 3MR6A 4HCEA 2NVTB 2NVQB 3ZYYX 3PN1A 4JI0L 5KFDA 1JCKB 5KT7A 5IGGA 1OWTA 1N36Q 3K59A 3S15H 3OWEB 3ORQA 3MWEA 2N3SA 5KT4A 2L4NA 4GC7A 2W6ZA 4FS2A 2RDIA 3NBHB 1QJOA 4NKLA 2JA5A 4X64Q 1I6HH 5M3MB 5CBAE 2I87A 4DR7H 5FKAC 2DNCA 3R93A 1VQDA 1S3OA 3A8KE 4FU0A 4JV5L 3HOZG 1DCZA 1XTCD 4MHEA 2BH2A 1HNZH 1FNUA 3BYYB 3TP5A 3A74A 3Q8QB 2XIGA 2VL6A 3M4PA 2UXBQ 4FF1A 1IYVA 1SNPA 3I4MH 3BA8A 5ELNA 1LYLA 4JI8L 5IE8A 2Q2UA 4JPBW 1JJGA 4IOCA 1D7QA 4S3SA 5I6WA 3D6WA 3A5UA 2HJWA 3PCOB 2BH8A 2K4KA 4NDXA 2R8JA 4DV7L 2JSOA 4XQQA 3HOVG 3OTOL 1I50B 3Q2OA 1A3TA 4IPGA 1F77A 2RBMA 2WV6D 3J7YW 1VAJA 1EQTA 2M9VA 3NSWA 1GUSA 1SN8A 3T1HH 4ZCKA 4F4ZA 5C0XJ 4G7OC 1WCMH 4YAJB 1PH5A 4QWAA 3KAKA 5JAVA 3PW7A 2P5ZX 4JI3H 5T1GA 3X3MA 3VR4A 3D0FA 2DN8A 5E4WC 5IGBA 4A76A 3GTPB 4DV3Q 4DR2L 1O7ZA 4DUZQ 4JI2Q 2VS1A 2L15A 2NZ1D 1XMQL 4GNXB 3CMAA 3JSNA 4UCRA 4ETSA 2D5DA 3UDGA 3M4IA 3ERQA 4RA8A 4ZRZA 3NHHA 1YVCA 5BR8Q 5IWAL 3I7FA 3OPOA 4OX9Q 1H9RA 1L0XB 3LNNA 3CXCA 2VB3X 1PH1A 4UY8C 3NUCA 3K5HA 2A6HC 3GQCA 3VR6A 3PW0A 5I9PA 1VQAA 1VS0A 5C5JA 4JI0Q 5KFCA 3J80W 3UQ8A 5C1OA 3CCVA 1WR2A 2R61A 4FXGC 2VQEH 3GQBA 2JQOA 3I56A 4BBSG 4F7XA 4B3TL 3J81c 1TWCB 4C2MH 2OEOA 5DGAA 1N9WA 3CC7A 4L5TA 1NMGA 2Q8TA 5KFHA 4DA2A 2JA6H 1V1OA 5HV6A 4RZRA 3OIQA 3I4NH 5IYDH 1L2FA 1U4RA 2F4IA 3F2UA 4KTAA 3HFZB 5M5XB 4A3KH 5FLMG 2OCEA 1X3PA 2NU7B 4EYHB 1BNZA 1VKZA 1BGWA 5H80A 3GTQB 3QB3A 2AGOA 2AQ4A 1PA6A 4RB2C 1TWAH 1X3EA 2NB0A 5KNCA 2H1EA 3S1MB 4I4TF 3X3NA 1GUOA 2TMPA 4JI8Q 4OIJA 1EYCA 3HOYB 1K8GA 2F3IA 5LL6S 3H15A 1SJHD 4QWEA 5CORA 2F4VQ 1DV2A 3Q0AA 3OOCA 4C3JB 1D6EC 4JOIA 5IIFA 4IAJA 4K8JA 3TIGA 4DV7Q 1QOHA 4C3HH 3DM3A 5BMVF 4J9LA 4A3DB 2CQOA 3GDEA 1LTLA 2AMCB 3RD4A 4IZ8A 3PUZA 1TWFA 3I70A 2RGVA 4DR1Q 3R5XA 4RAZA 4J0MA 1I5FA 4YWLA 2ES2A 4O3RA 2MJ8A 1T3NA 5LYJF 2NVXH 2O5IC 1JR0D 1NR4A 3J80L 1PH3A 2KEEA 1EZ1A 4JI5L 4DR2Q 4LF6Q 1WYDA 1NCVA 5KG2A 2CCZA 4DR5L 2B2UA 4YY3L 1OO9B 1XMQQ 4Y52H 2W6MA 4L8JA 4X6AH 1K83H 2BDNA 1GM5A 2K52A 2B29A 4UCVA 4R4IA 2Q2HA 5IWAQ 4MTEA 1XMOH 2MUYA 2R7ZB 4KHVA 5IY0A 4A93H 4UCOA 1VQIA 1ZETA 4R8UA 3E9IA 4HNTA 1GVPA 4DV0Q 2SDFA 5M3FH 4MV3A 2HHHH 4UP8A 1TT2A 1SAPA 2QILA 4GLAC 1EQQA 1PRTD 3UE1A 5C5MA 4O3QA 5L1LA 3IRBA 5IYCG 5GONF 1TS5A 2R93B 1XWEA 2MQHA 3H0GH 1B33N 2JEIA 2C22A 1JICA 1SYXB 3OHXC 4IUQA 1N32H 4R8IA 1BJTA 2CW8A 4QY7A 4U673 1HNXL 3F2DA 4ID6A 2W57A 3CQZB 2P0AA 4A3MH 1RHPA 4EEYA 2MPMA 2VZAA 1W93A 2M00A 3M85A 4M8AA 3BZDB 3HOXB 4DR3H 2FLPA 4HJ9A 3G6YA 2DPJA 3M7GA 4IWYA 1JOKA 5FK9C 1JT8A 1XNQQ 4JI7L 3VYTA 1W3SA 3EPGA 2LY7A 3PVXA 1SROA 1GXDC 2CH4W 1YIJA 1BOSA 5FLXE 2C2DA 3KHLA 1I4HA 3JZIA 4GOPC 2UU9Q 1JKJB 4KD3A 2CQYA 1KNEA 4BY7B 1I7NA 3FKIG 3RAQA 2FFKB 4IPHA 4UAIA 3T5LA 4QIWB 4JBMA 2JEJA 4J9OA 4JI5Q 4B3MH 1AH9A 5I47A 1KDCA 3PUXA 4JV0A 4IFDG 2DZDA 1KJ8A 1QVFA 4PMWA 2FK2A 1HA5A 3NENA 3J7AF 2F1MA 1Q8KA 1MHWC 5KGUA 4OWXB 3MFHA 1U4MA 1LT4D 3Q8DA 5CV4A 1ENCA 4AQYQ 4MAMA 1BCPF 2XVSA 4WJ3M 1CQIB 3I72A 3SEBA 4X62H 1SNCA 5DNFA 3FKIA 1QZGA 1MIUA 5K2MA 2RF4A 5KKNB 4UP7A 1YJWA 2JN4A 3N6XA 1J8IA 4DV6H 2VA3A 4O3SA 2AQ2B 3TZUA 5IT9c 2FK3A 1Z47A 4X66Q 1T5XD 3S2HH 5KG7A 2OH2A 2ZM6L 3S16H 1HR0L 4JI6H 4HIMA 2JA5B 1AW7A 3GO5A 1SE4A 3DHQA 2NVYA 3S15B 1QB5D 2HCCA 3V2TA 1RCVD 4R8NA 1NSNS 1G8ZD 5JJKA 1SYGA 4XZ3B 4ED2A 2WAQA 1NY4A 1IBLH 4JK1C 2HVQA 1VQGA 3MFYA 5K5PA 2FPIB 4HR7A 4LUZA 3N44B 3K58A 2VXWA 1F2MA 2O5JC 3MWDA 4LH6A 3W1BA 1UC9A 3KLSA 4E4TA 3GV5B 2C00A 1N33H 4DAPA 4DK3C 1R4QB 1ZEQX 3W5OA 4A3IG 3BVZA 3GP7A 2VNUD 3SE7A 1B3AA 2J6TA 3CP0A 1HZBA 1HNWH 1F2LA 2FMMA 4C56C 2WDTA 1ILPA 1GGOA 4GKKH 4KKTA 2SOBA 3LGJA 1U5KA 2XGTA 3FPUB 2RDHA 1PFSA 4ED1A 2WKDA 3A5ZB 4DKAC 4G7HC 4TV9F 1KDBA 3E0EA 1ICWA 5C4JB 2D9UA 1D5XC 2R86A 2F0WA 3DUZA 4BXXG 1B1ZA 3C0FB 4XYLB 1ET9A 2R7DA 4OEMB 2FJ2A 1LACA 1STGA 5EBCA 5CGKA 2EYMA 5EJWA 3G71A 1CT1D 1YHQA 3K3VA 1SMYD 3K0YA 4BWSC 4OONA 4ECWA 3BG5A 4PV1C 1VQNA 1P16A 3PO2H 5FLXW 2MO1A 2K75A 2WB1G 1C9OA 3NTHA 4K2LA 3OW2A 2E2JH 1E4EB 4GKJH 3H94A 1Z7TA 3HOVB 5KFSA 4DN4M 2E5LL 1YHBA 2FPPB 2NTSA 5FO9B 5M3MG 1FGBD 4MNOA 5EZYF 4Z9CB 2EPBA 3I91A 1JB7A 5DM63 4ALPA 2G9HD 4POGA 2UUCL 3RZOH 3PMFA 1HA6A 4LF9Q 1J6QA 4JV5H 1L0YB 4JG2A 1RL2A 3GIMA 1CE8A 1DXMA 2VB2X 1YJNA 1Q7YC 5GAGC 3GIJA 2FMCA 5KT3A 2CVRA 2W9CA 1Y8OB 3WDNA 3W2DA 1G291 3BU2A 1DIKA 5DLFA 2M05A 1QNKA 2ZXOA 4I7HA 5GAEC 3D6CA 3GD7A 2WB1A 4IQZA 3JAME 4LH7A 2ZXRA 2YTXA 4KV6A 4RFBA 2R92H 5DAUA 1LTSD 2F0GA 3BVGA 2GN5A 4NXMQ 1LLRD 3NTIA 2QK4A 2D2CC 1VQMA 4I50F 4EFBA 3OTOH 2IW3A 1PTOB 4ZKBB 4A3KB 1HNXH 3PGZA 2ICIA 2K04A 5C0XI 1B2TA 1F9QA 2V9WA 4J9MA 1L2ZA 4KJNA 4NXNH 4EG0A 4MZ9A 3RUPA 1MI2A 1SNMA 3L3OC 1T36A 2W6OA 3MC0B 1A8VA 4RKLA 5L9XA 5FLXL 1TWFB 2UVWA 1UE7A 2HIXA 2OQ0A 2E2HA 3Q23A 4LF5L 1CZWA 3T56B 3F8NA 1PFMA 2L0CA 1I50A 4C3HB 4CJ1B 4EFEA 1IL2A 3RZDH 1BO0A 5C3XA 4HNVA 5HURA 4R9WA 3RLNA 1N48A 4OO1G 2W6PA 4ZUIA 3V96A 4Q0YA 4EBEA 1TWGA 4B3TH 3ZJYC 2VA2A 2WFWA 2K1BA 3VYRA 5IGFA 2E5LQ 2IJ0A 5KFJA 4GNXA 2DUDA 2EJMA 2B2TC 3OUUA 4R8UB 4QB4A 3K8AA 2K28A 1BF4A 5L1IA 3TDQA 3PR4A 2UUCQ 4NLGA 2UXCL 4FO2A 3FP9A 2XNAC 2O03A 4X65Q 5KT6A 1S72A 2ID0A 1EY6A 1XNRL 4ZQIA 2A6EC 5KFLA 4YR3A 5M5YB 1GO3E 2E2IA 1VQKA 3JRXA 2HGSA 3J81i 3BYTB 4HYKA 1RYRA 3RBDA 3HOYG 1KABA 4B3SL 3N6RA 1XJVA 1EOTA 4OHJA 1HUMA 1STAA 2KHSA 1RTOA 1GKHA 3J81j 5K36G 3SGIA 1E2VA 1QE6A 3A54A 2QF7A 4H7BA 3AQQA 1Q46A 2F0VA 4A3DG 2AHOB 3H0GB 5M5WB 1TWHH 2V4QA 4A3EH 4YR2A 2A1AA 4YCVA 3FPPA 3DXJC 1EUJA 4K0KL 2RSOA 1M90C 1PTOD 5HGTA 4WJ4A 1GSHA 3RF2A 1AN8A 2VUMH 3LWBA 4A3MB 2V59A 4Q0FA 2KCNA 4P72A 2PI2E 1IBML 2E8GA 5C0XH 4DUYQ 2ZTDA 1YJ9A 4C3IG 2VOBA 4I65A 1UE1A 5LXTF 4BBRH 4U68A 4DR5H 2K5WA 4YY3H 4ECZA 4RAUC 4AYBB 2PW5A 1SNQA 1SFOH 1EWIA 4GN4B 1WTRA 3JAMW 5DGBA 1QWYA 4XT1B 1I3QH 3VA5A 3KYHC 4J9RA 4C5AA 3M3YH 2R7ZG 2UVRA 4BY1H 1Y1WG 1K0SA 3QWNA 4K5WA 2ATWA 1AFPA 4F87A 4I55F 5CA0F 3KHRA 5EPJA 2HUGA 1KRTA 3HOUH 4IR1A 3ONAB 5GAHC 4LUOA 4MV1A 3MEFA 1KBLA 1X3QA 1IW7C 4DK1A 1FNWA 2Q2IA 4LW1A 2YL2A 2FINB 1W2BA 1CHPD 2ZJTA 3NXWA 5D3DA 2Z0SA 4LK1C 1LTTD 2YU9H 1LTGD
chains in the Genus database with same CATH topology
4BXXH 2NZHA 4DV7L 1KXLA 3HOVG 1EQRA 3K81C 3OTOL 2K14A 4IPGA 4JI3L 1B7YB 1X3FA 1SN8A 5IYCH 5C0XJ 1OXXK 3STBD 1WCMH 1X9NA 1PH5A 3K0XA 3L7ZC 3RN2A 1HR0W 2D0PA 4LF7Q 1RIPA 1X6OA 3D0FA 5EAYA 4A76A 3HKZG 4DV3Q 4DR2L 2PQAB 4B3SQ 5IYBG 1MKHA 1N36L 4DUZQ 4JI1Q 4JI2Q 2VS1A 2L15A 3S1RH 3TRZA 1YI2A 5IP7G 1XMQL 4GNXB 3CMAA 4DUYL 1UWVA 1WOCA 3UDGA 4GLVB 1PH4A 2AKWB 2Y0SG 4NB3A 2PMZE 4A3JG 1YVCA 5BR8Q 3KJOA 5IWAL 1PYSB 3I7FA 3AYHB 2F52A 3RR5A 3CXCA 4OX9Q 4X64L 1PH1A 4UY8C 3H3VI 2VQEL 2V1CC 2WAQE 1KRSA 1VQAA 1VS0A 4BY7G 4JI0Q 4OXPA 4K0KQ 5FJ8G 5JJIA 2K5VA 3PCOB 3D31A 3CCVA 3S1NH 1YZ6A 3GTOH 4DR5Q 1IYJB 2EQSA 4YY3Q 1BBUA 2JQOA 4P71A 2A19A 3I56A 1SE8A 4BBSG 1QUQA 2IX0A 3WWVA 3J81c 1XPOA 4B3TL 2FXQA 4C2MH 4TVAB 1N9WA 3PUYA 4L5TA 3FKIH 3CC7A 1QZHA 4DR7Q 2UXBL 1NMGA 3PO3H 4P74A 2UXDL 4GOPA 2JA6H 3KOJA 1A62A 5E7NA 1L2FA 1HNZQ 3I4NH 3S17H 1OXVA 3RLFA 5IYDH 2ZJRA 3HFZB 4DV5L 1WI5A 1WJJA 3J80i 4A3KH 1KHIA 5FLMG 2OCEA 3T1YL 3GTPH 1XPUA 3KFUA 1VQ6A 1UEBA 2K5NA 2NVYH 2B63G 1MJCA 3E9HA 5GQOA 1GD7A 2YTVA 2JK8A 1PA6A 4DV4L 1Q81C 1TWAH 1X3EA 2CWPA 1YHAA 4EQ5A 1UE6A 2D0OA 4JI8Q 4JBKA 1K8GA 2F3IA 3H15A 1L1OC 1N8RC 1CKMA 4LF7L 2F4VQ 1E1OA 3PF4A 1D8LA 1OXUA 1PYBA 4HJ8A 1V9PA 4JOIA 1HNXQ 4LFAQ 4DUZL 1EIYB 2JA5G 3F8TA 4DV7Q 4JI2L 3T1HQ 2VQFQ 2DGYA 3DM3A 4C3HH 3CCUA 1NBWA 1VQHA 2CQOA 4R4QA 3CPFA 3GDEA 1LTLA 2AMCB 3K7UC 5C0XG 4JI3Q 3PUZA 1VQ8A 4JYAL 4DR1Q 1TWCH 5JEAG 4OX9L 3PO2G 1I5FA 1Q86C 3RN5A 4YWLA 4BBRG 5GADC 2ES2A 1LM0A 2NVXH 3J7ZC 1MJEA 5LMNW 4JI7Q 2N49A 1PH3A 3M9BA 5C4XG 4JI5L 4DNIA 4HJAA 4DR2Q 3ULLA 1WYDA 4LF6Q 2CCZA 5FLXc 1CKOA 4BY1G 4YY3L 4DR5L 1XMQQ 5M5XH 1XMOL 4Y52H 3STBC 2ZJQA 2IX1A 4IFDJ 2OQKA 4A3LH 2CFMA 1G51A 3HOUG 4X6AH 1K83H 1O7IA 1GM5A 2K52A 2B29A 4MTNA 1PV4A 4R4IA 2Q2HA 2N8NA 5IWAQ 3GTQH 5HY6A 2VQEQ 3I4MG 2WB1E 4A3IH 1VCIA 4DK6C 3CCQA 5IY0A 2IHEA 4A93H 2KHIA 1VQIA 3S1MH 4EX5A 1H95A 1K8AC 3HOYH 1NMFA 3E9IA 4PZ8A 4POFA 1GVPA 4DV0Q 3H3VH 4YCUA 1TXYA 5M3FH 4P75A 1XPRA 1Q82C 4UP8A 1E22A 4C3JH 4GLAC 2HQLA 4JC0A 1EQQA 2R92G 1IBKL 3UE1A 2UXDQ 3IRBA 2JA7G 2K50A 4YWKA 3L2PA 3CCEA 5IYCG 1UE5A 4RMFA 3HOWH 2MQHA 1P8LA 3H0GH 4DV5Q 4L5RC 2F4VL 1B8AA 3JC66 2NVTH 4AIMA 1N34L 1HZ9A 4QY7A 4OO1I 5C3EH 1J5EL 1HNXL 3KLWA 3F2DA 3G4SA 3F2BA 3T1HL 2VQFL 3T1YQ 1VQLA 3UE0A 2Q2TA 1SLJA 1AE3A 4A3MH 2VZAA 1X54A 3M85A 2MNAA 1QUQB 4DV4Q 4HJ9A 4DR1L 2D62A 5J3BA 2ZM6Q 3W1GA 1HR0Q 5LMNL 1JT8A 2PI2A 1XNQQ 4JI7L 2LXKA 3U4VA 1V1QA 1W3SA 4IJLA 3UDIA 3TS0A 4KHPL 5M3MH 2IT1A 1EOVA 2NN6G 1I94L 1SROA 2N78A 4LF6L 1YIJA 2WP8J 3BZCA 4LF4L 4HIOA 4HJ7A 4GOPC 2UU9Q 4Y7NH 2Y0SE 4JYAQ 3FKIG 3ERSX 1T9HA 2KENA 3U50C 3PO3G 4IJHA 4PZ7A 3PUWA 2IHFA 4IPHA 4DV2Q 4R4OA 5IYDG 1E1TA 4QGUA 3I4NG 4UPAA 4A3BH 4R4CA 4JBMA 1Q1BA 3KF6A 3CCLA 1SRUA 4JI5Q 4JI4Q 1AH9A 3PUXA 5GROA 3I4OA 4DV0L 1K9MC 2R93H 4IFDG 1B70B 4KI0A 4A3KG 4P73A 4QIWE 1A63A 1XMOQ 1X3GA 1QVFA 4PMWA 3TEHB 2E2HH 2KCMA 2ZTEA 1BKBA 1I50H 1PHJA 3NENA 4X62L 3PF5A 2MFIA 1Q8KA 2ALYB 1HJPA 4OWXB 1SR3A 1Z9FA 2R6GA 3Q8DA 3HOXH 1M1KC 3GTLH 4AQYQ 4A3GH 4DPGA 4WJ3M 1JMCA 2HHHQ 4JOIC 3CCRA 1VQ4A 1EYGA 2IY5B 5IP9G 4A3CH 2A8VA 3RLOA 1JJ2A 4HJ5A 1OXSC 3AFQA 4YWMA 1MIUA 3KDFB 1TWGH 2LSSA 2RF4A 4UP9A 3BZKA 1QZGA 5HGQA 4UP7A 1C0AA 1YJWA 3GTGH 1L1OB 4JI6L 3K80C 4L5SA 4A3FH 5IT9c 1IBKQ 1CKNA 3PV0A 1Z47A 1N32Q 3S1QH 4X66Q 2PNHA 1ASYA 3BJUA 3S2HH 3CD6A 1Q12A 4HIDA 2LXJA 2ZM6L 1KC8C 1HR0L 4LF8L 3S16H 1YNXA 4XIGS 4A3EG 3HKSA 1XNQL 4HIMA 1V43A 1SMXA 1FVIA 4HIKA 2HT1A 1IBLL 2VW9A 3GO5A 1N34Q 2OTJA 1J5EQ 2JEAI 4DR3Q 3NELA 5JJKA 2VUMG 2ZJPA 5LMUQ 3I2ZA 1NTGA 2BA0A 2E2IH 1CSQA 1NY4A 1VQJA 1VQGA 4ME3A 4R1JA 3GTJH 2UU9L 2EIFA 4A4IA 1PH6A 4A3LG 4LUZA 3G6EA 2JJQA 3TQYA 3W1BA 2AWNA 3CPWA 5LMNQ 2AWOA 4DV2L 4GKKL 3G48A 2JE6I 4DK3C 1BBWA 4A3IG 3W5OA 4KHPQ 4B3RL 2VNUD 4GN3B 4A93G 1I94Q 4JI4L 3CP0A 1HZBA 3F1ZA 4YHHL 3CC2A 1YBYA 2I5LX 3CAMA 3JAMc 4LF4Q 3LGJA 4R4TA 5M3FG 1U5KA 2XGTA 3ICEA 3U58A 3U4ZA 5C44H 3NEMA 1K0RA 1PFSA 4LFCL 1VQPA 4B3MQ 1E24A 3PSIA 3A5ZB 1ASZA 4OWTB 4AQYL 4DKAC 1Y1VH 2HHHL 1KQSA 3E0EA 4NXNL 2QEXA 3H0GG 3HOWG 4BY7H 1X55A 3B6YA 4OWWB 1Q1EA 2JA5H 2KHJA 5C3EG 2JA8H 4BXXG 2KCTA 3M4OH 5JJLA 4YCWA 1CUKA 2R7DA 4DR4Q 1YHQA 3ULJA 3G71A 1K3RA 4A3MG 2OTLA 2B3GA 4DAMA 4OONA 4X62Q 4A3DH 4GKJL 1N32L 2YYZA 4X66L 1NJIC 1P16A 1VQNA 3PO2H 2MO1A 2I5MX 2RCNA 2K75A 2WB1G 1C9OA 4IPCA 1WCMG 5ELOA 3OW2A 4GN5A 2E2JH 3ER0A 4DV6Q 2OWOA 2Z6KC 4AYBG 4LF5Q 4NPSA 1VQ7A 2E5LL 1YHBA 5M3MG 4DR3L 4JBJA 4MNOA 5LMUL 1KIXA 2QGQA 3FHWA 1JB7A 4ALPA 3I55A 4JI6Q 1A0IA 4POGA 2UUCL 4C3IH 2RHQB 3RZOH 2KBNA 1PVOA 3S24A 1J6QA 3VDYA 4LF9Q 3ULPA 5H1SE 4JG2A 1RL2A 3TREA 4LFBL 3MXNB 3CC4A 1YJNA 3S14H 4LF8Q 1Q7YC 5GAGC 1WFQA 4GOPB 1IBLQ 2R7ZH 4A3BG 1VQEA 3HOZH 5AJ3Q 3HKZE 1G291 3BU2A 2RHSB 1Y1WH 2EXDA 2Z6KA 4PZ6A 4IOAA 2XTIA 2R93G 5GAEC 5C4JH 3GD7A 1IZ6A 1HH2P 1X56A 2YTXA 4FDBA 4DV1L 2I0QA 1N33Q 2UXCQ 2YTYA 3J80c 2R92H 2GN5A 1HNWQ 4B3ML 4NXMQ 2JA7H 1VQMA 1XNRQ 1FJGL 2JA6G 4JBWA 4GKKQ 1CKNB 1DGSA 4A3GG 3HOXG 5JEAJ 3CMEA 3S2DH 3PGZA 4B3RQ 4LUVA 2GVAA 3CCSA 5C0XI 3PIPA 3CW2C 4LWCA 4YHHQ 4A3CG 4J15A 1LUZA 3HOVH 1FGUA 4L5QA 1VQOA 4PG3A 3J7A5 4DR4L 3L0OA 1G6PA 4MZ9A 3EN2A 3CQZH 4QQBX 1A8VA 4LFCQ 4A3FG 1KL9A 1VQCA 2BA1A 1C7YA 4APVA 4RG1A 3UDXA 2NZOA 4LNQA 3DLLA 1KD1C 3UDFA 1UE7A 2WAQG 1EIFA 2UUBL 2HIXA 2OQ0A 4DV6L 4GNXC 1CSPA 1VQ9A 4NXNQ 4LF5L 3AEVA 5IYBH 3A0JA 2ZTCA 5IP7H 1R9TH 1IL2A 3RZDH 4O0AA 2ASBA 2K5HA 4AH6A 3K7AH 1IBMQ 1QVGA 4A3JH 3RLNA 1VQFA 2YV5A 4LF9L 4GKJQ 5DLQE 4OO1G 4KLKA 4O2DA 3EIVA 2UUAL 3TS2A 1YEZA 3ZJYC 3GTMH 2PQAA 2WFWA 5FJ8H 1XTDA 3GTKH 2E5LQ 4DR6Q 1L0WA 5AJ3L 4GNXA 3PIOA 2DUDA 4JV5Q 2GVBA 3CCJA 3K8AA 4BBSH 1OXTA 1JE5A 1X65A 2UUCQ 1IXRA 3CCMA 2UXCL 3FP9A 1N33L 1FL0A 2JA9A 4X65Q 2CWAA 1S72A 4BA1I 1HNWL 4NXML 2ID0A 5C44G 4LFBQ 4H02A 1XNRL 4QJFA 1NE3A 2QA4A 4GS3A 2HIVA 1GO3E 1VQKA 1KAWA 3J81i 1Y1VG 5IP9H 1TWFH 1VQBA 5FLMH 1PH9A 3HOYG 4DV3L 1HZCA 1PH2A 4B3SL 1XJVA 4JI1L 2JA8G 3OTOQ 2B63H 4DV1Q 1GKHA 2VY3A 3J81j 3CF5A 5K36G 3SGIA 3AQQA 1Q46A 2CKZB 1E3PA 2NN6I 1K73C 5BR8L 4XTCS 4A3DG 2AHOB 1FJGQ 3M7NA 1TWHH 4A3EH 4BA2I 2A1AA 3RNUA 2JEBI 4YCVA 1PH8A 1EUJA 4K0KL 1OTCA 4JI0L 3KDFA 3KJPA 1M90C 4A75A 1AE2A 4WJ4A 1L1OA 2VUMH 3AFPA 3PUVA 1N36Q 4IO9A 3S15H 4TQUS 4P72A 2PI2E 1IBML 2E8GA 4DUYQ 2ZTDA 2N3SA 1YJ9A 4DR7L 1UE1A 3F2CA 3KF8B 4BBRH 3NBHB 4IPDA 4IFDI 2I5HA 1SFOH 4QL5A 4X64Q 2UUBQ 1I6HH 1HNZL 1EWIA 4GN4B 1I3QH 5C4XH 4DR6L 3KYHC 5M5YH 1VQDA 3M3YH 1S3OA 4AYBE 1HZAA 1Y14B 2R7ZG 1EFWA 4BY1H 1E7ZA 3HOZG 1Y1WG 2R7FA 4JV5L 3KF6B 2BH2A 2ATWA 1QVCA 1U0LA 4B3TQ 3A74A 1KRTA 4KHZA 3HOUH 4X65L 1VQ5A 2VL6A 4JCVE 2C35B 1BVSA 2H5XA 3M4PA 5GAHC 3EBEA 2UXBQ 4LUOA 3MEFA 2UUAQ 3I4MH 5ELNA 1LYLA 1S40A 3OYYA 4JI8L 2Q2IA 4DAYB 5IE8A 4GLXA 4LW1A 2Q2UA 4IOCA 1D7QA 3JAMi 1W2BA 5M5WH 1JJGA 1JJCB 3A5UA 1YITA 1PH7A 2NVQH 2YU9H 3M4QA 2Z0SA 2BH8A 2K4KA 2MO0A 4LFAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX H;  2NZH A;  4DV7 L;  1KXL A;  3HOV G;  1EQR A;  3K81 C;  3OTO L;  2K14 A;  4IPG A;  4JI3 L;  1B7Y B;  1X3F A;  1SN8 A;  5IYC H;  5C0X J;  1OXX K;  3STB D;  1WCM H;  1X9N A;  1PH5 A;  3K0X A;  3L7Z C;  3RN2 A;  1HR0 W;  2D0P A;  4LF7 Q;  1RIP A;  1X6O A;  3D0F A;  5EAY A;  4A76 A;  3HKZ G;  4DV3 Q;  4DR2 L;  2PQA B;  4B3S Q;  5IYB G;  1MKH A;  1N36 L;  4DUZ Q;  4JI1 Q;  4JI2 Q;  2VS1 A;  2L15 A;  3S1R H;  3TRZ A;  1YI2 A;  5IP7 G;  1XMQ L;  4GNX B;  3CMA A;  4DUY L;  1UWV A;  1WOC A;  3UDG A;  4GLV B;  1PH4 A;  2AKW B;  2Y0S G;  4NB3 A;  2PMZ E;  4A3J G;  1YVC A;  5BR8 Q;  3KJO A;  5IWA L;  1PYS B;  3I7F A;  3AYH B;  2F52 A;  3RR5 A;  3CXC A;  4OX9 Q;  4X64 L;  1PH1 A;  4UY8 C;  3H3V I;  2VQE L;  2V1C C;  2WAQ E;  1KRS A;  1VQA A;  1VS0 A;  4BY7 G;  4JI0 Q;  4OXP A;  4K0K Q;  5FJ8 G;  5JJI A;  2K5V A;  3PCO B;  3D31 A;  3CCV A;  3S1N H;  1YZ6 A;  3GTO H;  4DR5 Q;  1IYJ B;  2EQS A;  4YY3 Q;  1BBU A;  2JQO A;  4P71 A;  2A19 A;  3I56 A;  1SE8 A;  4BBS G;  1QUQ A;  2IX0 A;  3WWV A;  3J81 c;  1XPO A;  4B3T L;  2FXQ A;  4C2M H;  4TVA B;  1N9W A;  3PUY A;  4L5T A;  3FKI H;  3CC7 A;  1QZH A;  4DR7 Q;  2UXB L;  1NMG A;  3PO3 H;  4P74 A;  2UXD L;  4GOP A;  2JA6 H;  3KOJ A;  1A62 A;  5E7N A;  1L2F A;  1HNZ Q;  3I4N H;  3S17 H;  1OXV A;  3RLF A;  5IYD H;  2ZJR A;  3HFZ B;  4DV5 L;  1WI5 A;  1WJJ A;  3J80 i;  4A3K H;  1KHI A;  5FLM G;  2OCE A;  3T1Y L;  3GTP H;  1XPU A;  3KFU A;  1VQ6 A;  1UEB A;  2K5N A;  2NVY H;  2B63 G;  1MJC A;  3E9H A;  5GQO A;  1GD7 A;  2YTV A;  2JK8 A;  1PA6 A;  4DV4 L;  1Q81 C;  1TWA H;  1X3E A;  2CWP A;  1YHA A;  4EQ5 A;  1UE6 A;  2D0O A;  4JI8 Q;  4JBK A;  1K8G A;  2F3I A;  3H15 A;  1L1O C;  1N8R C;  1CKM A;  4LF7 L;  2F4V Q;  1E1O A;  3PF4 A;  1D8L A;  1OXU A;  1PYB A;  4HJ8 A;  1V9P A;  4JOI A;  1HNX Q;  4LFA Q;  4DUZ L;  1EIY B;  2JA5 G;  3F8T A;  4DV7 Q;  4JI2 L;  3T1H Q;  2VQF Q;  2DGY A;  3DM3 A;  4C3H H;  3CCU A;  1NBW A;  1VQH A;  2CQO A;  4R4Q A;  3CPF A;  3GDE A;  1LTL A;  2AMC B;  3K7U C;  5C0X G;  4JI3 Q;  3PUZ A;  1VQ8 A;  4JYA L;  4DR1 Q;  1TWC H;  5JEA G;  4OX9 L;  3PO2 G;  1I5F A;  1Q86 C;  3RN5 A;  4YWL A;  4BBR G;  5GAD C;  2ES2 A;  1LM0 A;  2NVX H;  3J7Z C;  1MJE A;  5LMN W;  4JI7 Q;  2N49 A;  1PH3 A;  3M9B A;  5C4X G;  4JI5 L;  4DNI A;  4HJA A;  4DR2 Q;  3ULL A;  1WYD A;  4LF6 Q;  2CCZ A;  5FLX c;  1CKO A;  4BY1 G;  4YY3 L;  4DR5 L;  1XMQ Q;  5M5X H;  1XMO L;  4Y52 H;  3STB C;  2ZJQ A;  2IX1 A;  4IFD J;  2OQK A;  4A3L H;  2CFM A;  1G51 A;  3HOU G;  4X6A H;  1K83 H;  1O7I A;  1GM5 A;  2K52 A;  2B29 A;  4MTN A;  1PV4 A;  4R4I A;  2Q2H A;  2N8N A;  5IWA Q;  3GTQ H;  5HY6 A;  2VQE Q;  3I4M G;  2WB1 E;  4A3I H;  1VCI A;  4DK6 C;  3CCQ A;  5IY0 A;  2IHE A;  4A93 H;  2KHI A;  1VQI A;  3S1M H;  4EX5 A;  1H95 A;  1K8A C;  3HOY H;  1NMF A;  3E9I A;  4PZ8 A;  4POF A;  1GVP A;  4DV0 Q;  3H3V H;  4YCU A;  1TXY A;  5M3F H;  4P75 A;  1XPR A;  1Q82 C;  4UP8 A;  1E22 A;  4C3J H;  4GLA C;  2HQL A;  4JC0 A;  1EQQ A;  2R92 G;  1IBK L;  3UE1 A;  2UXD Q;  3IRB A;  2JA7 G;  2K50 A;  4YWK A;  3L2P A;  3CCE A;  5IYC G;  1UE5 A;  4RMF A;  3HOW H;  2MQH A;  1P8L A;  3H0G H;  4DV5 Q;  4L5R C;  2F4V L;  1B8A A;  3JC6 6;  2NVT H;  4AIM A;  1N34 L;  1HZ9 A;  4QY7 A;  4OO1 I;  5C3E H;  1J5E L;  1HNX L;  3KLW A;  3F2D A;  3G4S A;  3F2B A;  3T1H L;  2VQF L;  3T1Y Q;  1VQL A;  3UE0 A;  2Q2T A;  1SLJ A;  1AE3 A;  4A3M H;  2VZA A;  1X54 A;  3M85 A;  2MNA A;  1QUQ B;  4DV4 Q;  4HJ9 A;  4DR1 L;  2D62 A;  5J3B A;  2ZM6 Q;  3W1G A;  1HR0 Q;  5LMN L;  1JT8 A;  2PI2 A;  1XNQ Q;  4JI7 L;  2LXK A;  3U4V A;  1V1Q A;  1W3S A;  4IJL A;  3UDI A;  3TS0 A;  4KHP L;  5M3M H;  2IT1 A;  1EOV A;  2NN6 G;  1I94 L;  1SRO A;  2N78 A;  4LF6 L;  1YIJ A;  2WP8 J;  3BZC A;  4LF4 L;  4HIO A;  4HJ7 A;  4GOP C;  2UU9 Q;  4Y7N H;  2Y0S E;  4JYA Q;  3FKI G;  3ERS X;  1T9H A;  2KEN A;  3U50 C;  3PO3 G;  4IJH A;  4PZ7 A;  3PUW A;  2IHF A;  4IPH A;  4DV2 Q;  4R4O A;  5IYD G;  1E1T A;  4QGU A;  3I4N G;  4UPA A;  4A3B H;  4R4C A;  4JBM A;  1Q1B A;  3KF6 A;  3CCL A;  1SRU A;  4JI5 Q;  4JI4 Q;  1AH9 A;  3PUX A;  5GRO A;  3I4O A;  4DV0 L;  1K9M C;  2R93 H;  4IFD G;  1B70 B;  4KI0 A;  4A3K G;  4P73 A;  4QIW E;  1A63 A;  1XMO Q;  1X3G A;  1QVF A;  4PMW A;  3TEH B;  2E2H H;  2KCM A;  2ZTE A;  1BKB A;  1I50 H;  1PHJ A;  3NEN A;  4X62 L;  3PF5 A;  2MFI A;  1Q8K A;  2ALY B;  1HJP A;  4OWX B;  1SR3 A;  1Z9F A;  2R6G A;  3Q8D A;  3HOX H;  1M1K C;  3GTL H;  4AQY Q;  4A3G H;  4DPG A;  4WJ3 M;  1JMC A;  2HHH Q;  4JOI C;  3CCR A;  1VQ4 A;  1EYG A;  2IY5 B;  5IP9 G;  4A3C H;  2A8V A;  3RLO A;  1JJ2 A;  4HJ5 A;  1OXS C;  3AFQ A;  4YWM A;  1MIU A;  3KDF B;  1TWG H;  2LSS A;  2RF4 A;  4UP9 A;  3BZK A;  1QZG A;  5HGQ A;  4UP7 A;  1C0A A;  1YJW A;  3GTG H;  1L1O B;  4JI6 L;  3K80 C;  4L5S A;  4A3F H;  5IT9 c;  1IBK Q;  1CKN A;  3PV0 A;  1Z47 A;  1N32 Q;  3S1Q H;  4X66 Q;  2PNH A;  1ASY A;  3BJU A;  3S2H H;  3CD6 A;  1Q12 A;  4HID A;  2LXJ A;  2ZM6 L;  1KC8 C;  1HR0 L;  4LF8 L;  3S16 H;  1YNX A;  4XIG S;  4A3E G;  3HKS A;  1XNQ L;  4HIM A;  1V43 A;  1SMX A;  1FVI A;  4HIK A;  2HT1 A;  1IBL L;  2VW9 A;  3GO5 A;  1N34 Q;  2OTJ A;  1J5E Q;  2JEA I;  4DR3 Q;  3NEL A;  5JJK A;  2VUM G;  2ZJP A;  5LMU Q;  3I2Z A;  1NTG A;  2BA0 A;  2E2I H;  1CSQ A;  1NY4 A;  1VQJ A;  1VQG A;  4ME3 A;  4R1J A;  3GTJ H;  2UU9 L;  2EIF A;  4A4I A;  1PH6 A;  4A3L G;  4LUZ A;  3G6E A;  2JJQ A;  3TQY A;  3W1B A;  2AWN A;  3CPW A;  5LMN Q;  2AWO A;  4DV2 L;  4GKK L;  3G48 A;  2JE6 I;  4DK3 C;  1BBW A;  4A3I G;  3W5O A;  4KHP Q;  4B3R L;  2VNU D;  4GN3 B;  4A93 G;  1I94 Q;  4JI4 L;  3CP0 A;  1HZB A;  3F1Z A;  4YHH L;  3CC2 A;  1YBY A;  2I5L X;  3CAM A;  3JAM c;  4LF4 Q;  3LGJ A;  4R4T A;  5M3F G;  1U5K A;  2XGT A;  3ICE A;  3U58 A;  3U4Z A;  5C44 H;  3NEM A;  1K0R A;  1PFS A;  4LFC L;  1VQP A;  4B3M Q;  1E24 A;  3PSI A;  3A5Z B;  1ASZ A;  4OWT B;  4AQY L;  4DKA C;  1Y1V H;  2HHH L;  1KQS A;  3E0E A;  4NXN L;  2QEX A;  3H0G G;  3HOW G;  4BY7 H;  1X55 A;  3B6Y A;  4OWW B;  1Q1E A;  2JA5 H;  2KHJ A;  5C3E G;  2JA8 H;  4BXX G;  2KCT A;  3M4O H;  5JJL A;  4YCW A;  1CUK A;  2R7D A;  4DR4 Q;  1YHQ A;  3ULJ A;  3G71 A;  1K3R A;  4A3M G;  2OTL A;  2B3G A;  4DAM A;  4OON A;  4X62 Q;  4A3D H;  4GKJ L;  1N32 L;  2YYZ A;  4X66 L;  1NJI C;  1P16 A;  1VQN A;  3PO2 H;  2MO1 A;  2I5M X;  2RCN A;  2K75 A;  2WB1 G;  1C9O A;  4IPC A;  1WCM G;  5ELO A;  3OW2 A;  4GN5 A;  2E2J H;  3ER0 A;  4DV6 Q;  2OWO A;  2Z6K C;  4AYB G;  4LF5 Q;  4NPS A;  1VQ7 A;  2E5L L;  1YHB A;  5M3M G;  4DR3 L;  4JBJ A;  4MNO A;  5LMU L;  1KIX A;  2QGQ A;  3FHW A;  1JB7 A;  4ALP A;  3I55 A;  4JI6 Q;  1A0I A;  4POG A;  2UUC L;  4C3I H;  2RHQ B;  3RZO H;  2KBN A;  1PVO A;  3S24 A;  1J6Q A;  3VDY A;  4LF9 Q;  3ULP A;  5H1S E;  4JG2 A;  1RL2 A;  3TRE A;  4LFB L;  3MXN B;  3CC4 A;  1YJN A;  3S14 H;  4LF8 Q;  1Q7Y C;  5GAG C;  1WFQ A;  4GOP B;  1IBL Q;  2R7Z H;  4A3B G;  1VQE A;  3HOZ H;  5AJ3 Q;  3HKZ E;  1G29 1;  3BU2 A;  2RHS B;  1Y1W H;  2EXD A;  2Z6K A;  4PZ6 A;  4IOA A;  2XTI A;  2R93 G;  5GAE C;  5C4J H;  3GD7 A;  1IZ6 A;  1HH2 P;  1X56 A;  2YTX A;  4FDB A;  4DV1 L;  2I0Q A;  1N33 Q;  2UXC Q;  2YTY A;  3J80 c;  2R92 H;  2GN5 A;  1HNW Q;  4B3M L;  4NXM Q;  2JA7 H;  1VQM A;  1XNR Q;  1FJG L;  2JA6 G;  4JBW A;  4GKK Q;  1CKN B;  1DGS A;  4A3G G;  3HOX G;  5JEA J;  3CME A;  3S2D H;  3PGZ A;  4B3R Q;  4LUV A;  2GVA A;  3CCS A;  5C0X I;  3PIP A;  3CW2 C;  4LWC A;  4YHH Q;  4A3C G;  4J15 A;  1LUZ A;  3HOV H;  1FGU A;  4L5Q A;  1VQO A;  4PG3 A;  3J7A 5;  4DR4 L;  3L0O A;  1G6P A;  4MZ9 A;  3EN2 A;  3CQZ H;  4QQB X;  1A8V A;  4LFC Q;  4A3F G;  1KL9 A;  1VQC A;  2BA1 A;  1C7Y A;  4APV A;  4RG1 A;  3UDX A;  2NZO A;  4LNQ A;  3DLL A;  1KD1 C;  3UDF A;  1UE7 A;  2WAQ G;  1EIF A;  2UUB L;  2HIX A;  2OQ0 A;  4DV6 L;  4GNX C;  1CSP A;  1VQ9 A;  4NXN Q;  4LF5 L;  3AEV A;  5IYB H;  3A0J A;  2ZTC A;  5IP7 H;  1R9T H;  1IL2 A;  3RZD H;  4O0A A;  2ASB A;  2K5H A;  4AH6 A;  3K7A H;  1IBM Q;  1QVG A;  4A3J H;  3RLN A;  1VQF A;  2YV5 A;  4LF9 L;  4GKJ Q;  5DLQ E;  4OO1 G;  4KLK A;  4O2D A;  3EIV A;  2UUA L;  3TS2 A;  1YEZ A;  3ZJY C;  3GTM H;  2PQA A;  2WFW A;  5FJ8 H;  1XTD A;  3GTK H;  2E5L Q;  4DR6 Q;  1L0W A;  5AJ3 L;  4GNX A;  3PIO A;  2DUD A;  4JV5 Q;  2GVB A;  3CCJ A;  3K8A A;  4BBS H;  1OXT A;  1JE5 A;  1X65 A;  2UUC Q;  1IXR A;  3CCM A;  2UXC L;  3FP9 A;  1N33 L;  1FL0 A;  2JA9 A;  4X65 Q;  2CWA A;  1S72 A;  4BA1 I;  1HNW L;  4NXM L;  2ID0 A;  5C44 G;  4LFB Q;  4H02 A;  1XNR L;  4QJF A;  1NE3 A;  2QA4 A;  4GS3 A;  2HIV A;  1GO3 E;  1VQK A;  1KAW A;  3J81 i;  1Y1V G;  5IP9 H;  1TWF H;  1VQB A;  5FLM H;  1PH9 A;  3HOY G;  4DV3 L;  1HZC A;  1PH2 A;  4B3S L;  1XJV A;  4JI1 L;  2JA8 G;  3OTO Q;  2B63 H;  4DV1 Q;  1GKH A;  2VY3 A;  3J81 j;  3CF5 A;  5K36 G;  3SGI A;  3AQQ A;  1Q46 A;  2CKZ B;  1E3P A;  2NN6 I;  1K73 C;  5BR8 L;  4XTC S;  4A3D G;  2AHO B;  1FJG Q;  3M7N A;  1TWH H;  4A3E H;  4BA2 I;  2A1A A;  3RNU A;  2JEB I;  4YCV A;  1PH8 A;  1EUJ A;  4K0K L;  1OTC A;  4JI0 L;  3KDF A;  3KJP A;  1M90 C;  4A75 A;  1AE2 A;  4WJ4 A;  1L1O A;  2VUM H;  3AFP A;  3PUV A;  1N36 Q;  4IO9 A;  3S15 H;  4TQU S;  4P72 A;  2PI2 E;  1IBM L;  2E8G A;  4DUY Q;  2ZTD A;  2N3S A;  1YJ9 A;  4DR7 L;  1UE1 A;  3F2C A;  3KF8 B;  4BBR H;  3NBH B;  4IPD A;  4IFD I;  2I5H A;  1SFO H;  4QL5 A;  4X64 Q;  2UUB Q;  1I6H H;  1HNZ L;  1EWI A;  4GN4 B;  1I3Q H;  5C4X H;  4DR6 L;  3KYH C;  5M5Y H;  1VQD A;  3M3Y H;  1S3O A;  4AYB E;  1HZA A;  1Y14 B;  2R7Z G;  1EFW A;  4BY1 H;  1E7Z A;  3HOZ G;  1Y1W G;  2R7F A;  4JV5 L;  3KF6 B;  2BH2 A;  2ATW A;  1QVC A;  1U0L A;  4B3T Q;  3A74 A;  1KRT A;  4KHZ A;  3HOU H;  4X65 L;  1VQ5 A;  2VL6 A;  4JCV E;  2C35 B;  1BVS A;  2H5X A;  3M4P A;  5GAH C;  3EBE A;  2UXB Q;  4LUO A;  3MEF A;  2UUA Q;  3I4M H;  5ELN A;  1LYL A;  1S40 A;  3OYY A;  4JI8 L;  2Q2I A;  4DAY B;  5IE8 A;  4GLX A;  4LW1 A;  2Q2U A;  4IOC A;  1D7Q A;  3JAM i;  1W2B A;  5M5W H;  1JJG A;  1JJC B;  3A5U A;  1YIT A;  1PH7 A;  2NVQ H;  2YU9 H;  3M4Q A;  2Z0S A;  2BH8 A;  2K4K A;  2MO0 A;  4LFA L; 
#chains in the Genus database with same CATH topology
 2NZH A;  3FKI B;  1U4L A;  3V4S A;  3JRW A;  1FD7 D;  1E2Z A;  2R7Z A;  1U9R A;  1B7Y B;  1H9M A;  1X3F A;  2M2L A;  3S17 B;  1MD2 D;  1Y8N B;  3D8G A;  4KJO A;  2PPB C;  5FPO A;  5JH7 F;  4F4Y A;  4LFA H;  1Y1W A;  4FF4 A;  1QG7 A;  3KAJ A;  3STB D;  3SI8 A;  1X9N A;  3K0X A;  3RN2 A;  3RJ0 A;  4LF7 Q;  1Z2P X;  2OLS A;  5EAY A;  1BCP D;  3BQ0 A;  4B3S Q;  1MKH A;  1N36 L;  3MXG A;  4RNN A;  2NVY B;  3S1R H;  2F0M A;  1YI2 A;  1SJE D;  3K5L A;  4JI7 H;  4OEL B;  1YNN D;  4GLV B;  2WAQ B;  1JOQ A;  4A3J G;  5HBR B;  2YYA A;  1PYS B;  3AYH B;  3SE0 A;  3RR5 A;  4X64 L;  2F0J A;  3JAM L;  5EKI A;  4BY7 G;  4K0K Q;  5FJ8 G;  3D31 A;  3CQZ A;  3HRZ C;  3S1N H;  4QF4 A;  1AZP A;  1DM0 B;  3MAQ A;  2EQS A;  1AN7 A;  4C1N K;  1JWU D;  1SE8 A;  2KOL A;  3WWV A;  2IX0 A;  2FXQ A;  4IUU A;  2WIN B;  4TVA B;  3MXN A;  2UXB L;  2ATL A;  5KFR A;  4RUA A;  2R87 A;  2B2Y C;  4GOP A;  3EJI A;  5E7N A;  3BDL A;  1SYE A;  3IN5 A;  2ASJ A;  3N43 B;  2W70 A;  1WI5 A;  2UXD H;  1JOO A;  3J80 i;  1V1P A;  1GOZ A;  2PO4 A;  4RCO A;  1HHV A;  5DQH A;  3EQL C;  3K5N A;  4R7R A;  3KFU A;  4DV5 H;  1BXR A;  4B9X A;  3PW2 A;  3VR3 A;  2B63 G;  5EGT A;  1MJC A;  1HXY D;  5GQO A;  4DV4 L;  4XXE A;  4QIW A;  3T1Y H;  4YB8 B;  2CWP A;  1YHA A;  4EQ5 A;  5L1J A;  2XC9 A;  5KND A;  5KG1 A;  1L1O C;  4PMB A;  1CKM A;  1TVX A;  3P1H A;  3TII A;  3PF4 A;  2CQA A;  3FVQ A;  4BS9 A;  4ZLT F;  1PYB A;  4HJ8 A;  3NQI A;  1V9P A;  1STE A;  1UNS A;  4RGO S;  4DUZ L;  1ZKO A;  2JA5 G;  3F8T A;  4JI2 L;  1PVO A;  2EY2 A;  5LOV F;  2ZM6 H;  2VQF Q;  1HR0 H;  2DGY A;  2W7O A;  1K8M A;  1VQH A;  3DEO A;  3QR8 A;  1VQ8 A;  2A68 D;  1E0B A;  4X3S A;  3H6M A;  4OX9 L;  5JEA G;  4F50 A;  4U6P A;  5GAD C;  5KFK A;  1LM0 A;  3J7Z C;  2B63 A;  4JYA H;  3M9B A;  2Q8I B;  2CW0 D;  2XRS D;  4HJA A;  2RKS A;  2W9C B;  2RVL A;  2KED A;  1LAB A;  1CKO A;  3RZO B;  5ELC A;  4YJ2 F;  4CJ2 C;  4A3L H;  5KFI A;  2OQK A;  5KFG A;  4B08 A;  2WB1 B;  2BDO A;  1G51 A;  1CK1 A;  1KJQ A;  5KT5 A;  1O7I A;  4MTN A;  1PV4 A;  1RK6 A;  2PZW A;  1STB A;  4NMZ A;  4ULL A;  5HY6 A;  1M0T A;  2DY8 A;  3I4M G;  2QW7 A;  5KG3 A;  3RAX A;  2UVU A;  3DWA A;  4DK6 C;  3CCQ A;  2NU9 B;  2DNE A;  4EX5 A;  5LL6 b;  1ONL A;  4J8Q A;  5FO7 B;  3R2T A;  4PZ8 A;  5I2Y A;  5JVL A;  5A35 A;  2OF1 A;  4YCU A;  1BXT A;  1XYI A;  4Y7N B;  4TRD A;  4P75 A;  1Q82 C;  4Q43 A;  1HTP A;  4EYI B;  1E22 A;  2PNR C;  5ELF A;  1G2T A;  2N88 A;  1B6S A;  3E6Z X;  2K5D A;  4CC6 A;  4G7Z C;  5KFX A;  2K50 A;  4YWK A;  1PDQ A;  1UE5 A;  1GUN A;  1GHJ A;  3HOW H;  3VMM A;  2JYO A;  1RK5 A;  2F4V L;  1IBK H;  3JC6 6;  1N34 L;  5JJZ A;  5C3E H;  2E2H B;  2FE3 A;  4JVZ A;  1EQV A;  3G4S A;  1VQL A;  2BE5 C;  4DL6 A;  3ND9 A;  4PDB A;  4KY7 A;  2AUK A;  1X54 A;  2MNA A;  5A2Q W;  1J5E H;  2BCO A;  1Z6H A;  4DV4 Q;  4DR1 L;  5C8Y F;  2D62 A;  1S97 A;  2Z8L A;  3K5O A;  1SYC A;  3GV3 A;  5KFN A;  2LXK A;  4YJ3 F;  1V1Q A;  1TWG B;  3TS0 A;  2IT1 A;  1EOV A;  5F9L A;  1I94 L;  3RZD B;  2N78 A;  4LF6 L;  4JUZ A;  5BPF A;  1EZ6 A;  2Y0S B;  4ODG A;  5LMN H;  2R7L A;  2WP8 J;  3S1Q B;  4HIO A;  1WCM A;  4KHP H;  1C3O A;  2GA4 B;  4ZYS A;  4HJ7 A;  2W7P A;  4DU9 A;  2C2R A;  5EQ0 A;  1WVL A;  1NUC A;  1T9H A;  3U50 C;  1E4E A;  3N40 P;  5KEE A;  2IHF A;  4LF4 H;  2I46 A;  3S9W A;  4DV2 Q;  5IYD G;  1E1T A;  4QGU A;  3I4N G;  4A3B H;  1WH2 A;  1Q1B A;  3KF6 A;  3CCL A;  4JI4 Q;  2E2I B;  2EY1 A;  4DV0 L;  2XWJ B;  1ILQ A;  1B70 B;  4A3K G;  4QIW E;  2HQE A;  2XRQ D;  3TME A;  5DG7 A;  3BJY A;  1PHJ A;  3GIK A;  3PF5 A;  1RF2 D;  1Z2O X;  2NUA B;  4A3G H;  3GTL H;  3TZD A;  4RB0 A;  3IAY A;  4Y8V B;  1VQ4 A;  1EYG A;  2IY5 B;  2ENB A;  4IN3 A;  5IP9 G;  3ETJ A;  3M9M B;  4A3C H;  5CBE E;  1JJ2 A;  3MXP A;  1OXS C;  4YWM A;  4DK0 A;  5EKK A;  5FD5 A;  3GTG H;  2F0U A;  4ZOL F;  1I4R A;  3I4L A;  4C3H G;  3K80 C;  4LF5 H;  5A2Q L;  3UI2 A;  3PV0 A;  4HMI A;  1ASY A;  3CD6 A;  3CU7 A;  4LF8 L;  1XNQ L;  2VW9 A;  1N34 Q;  3M4O B;  1PRT C;  2OTJ A;  4FF2 A;  4IRD A;  2B8F A;  3NEL A;  1B44 D;  2J7Z A;  4NW2 A;  5LMU Q;  1TWA A;  3HBL A;  2MGS A;  1BUV T;  5FOB B;  1A3V A;  4XYQ A;  4R1J A;  3GTJ H;  2UU9 L;  4A4I A;  1SFO B;  2VPS A;  2OT2 A;  2DY7 A;  3CPW A;  3BAB A;  2UXC H;  1KLG D;  3PW5 A;  1STN A;  3G48 A;  2QDB A;  4BY1 B;  4B3R L;  4A93 G;  1I94 Q;  3OIP A;  1ZHS A;  5IT9 W;  3A8J E;  4YHH L;  2A73 B;  4C3I B;  1XNR H;  3TIN A;  2O4X A;  3HOU B;  1I6U A;  2A6H D;  3GIQ A;  4R4T A;  2QCP X;  5M3F G;  5LP6 F;  2NVX A;  4EQN A;  3ICE A;  4G3I A;  5C44 H;  1LT6 D;  3NEM A;  1O75 A;  4RAY A;  2L11 A;  4OWT B;  3R5H A;  1EYD A;  4L6T B;  4AQY L;  1EY8 A;  1NR2 A;  1Y1W B;  2JEF A;  1Y1V H;  1KQS A;  4CDD C;  4LFC H;  3H0G G;  1B50 A;  3H4B A;  3TBI B;  3Q8S B;  1X55 A;  3H91 A;  1EFI D;  4ZK9 B;  5BN4 A;  2PCF B;  2ZDH A;  5J2U F;  1HRJ A;  4FXK C;  2F3W A;  5JJL A;  3MTS A;  4DR4 Q;  3ULJ A;  2JA7 B;  1B53 A;  1K3R A;  4A3M G;  2OTL A;  2HVS A;  1R4P B;  3RV3 A;  2YYZ A;  3NP8 A;  4X66 L;  1CI3 M;  3VPD A;  4RB1 A;  1PMR A;  3S2D B;  3DMU A;  1PTO F;  4IPC A;  3KBG A;  3OSO A;  1IBM H;  5ELO A;  3ER0 A;  1BNC A;  1K3B C;  4AYB G;  4NPS A;  2K6A A;  4JBJ A;  5I4D A;  1XDN A;  4FNF A;  1FR3 A;  4HSV A;  2RHQ B;  4PQX A;  3H0G A;  4KK7 A;  3TRE A;  2YS6 A;  3MXN B;  3S14 H;  4LF8 Q;  5CAE B;  4GOP B;  4FYD A;  2A69 C;  2EE1 A;  4OL7 A;  3S1N B;  5C4Z A;  1MZB A;  4TQS A;  3ITP A;  3K6O A;  3LWE A;  5AJ3 Q;  4RUC A;  4LFB H;  2Z6K A;  4P2C B;  4A3J B;  2XTI A;  2W71 A;  1V1P B;  1CHQ D;  3J80 c;  3GID A;  4AYB A;  1CFM A;  2AQ3 B;  3NBI A;  5CB4 F;  2RA4 A;  3SR1 A;  4ECT A;  4DV1 H;  1DGS A;  1G2S A;  2KUM A;  4LMQ D;  5JEA J;  2H4O A;  4B3R Q;  2IP4 A;  5C6A A;  4LUV A;  2GVA A;  4LWC A;  4YHH Q;  4J15 A;  3OHA A;  1FJG H;  2F0D A;  2YZG A;  1FGU A;  1VQO A;  1C48 A;  3SHL A;  3L0O A;  4XQJ A;  1LT3 D;  1ZYR C;  4QQB X;  2B39 A;  1KL9 A;  1VQC A;  1C7Y A;  1N36 H;  4E6I A;  4RCN A;  2MP1 A;  1F2Y A;  2K01 A;  3A56 A;  3KLS X;  3UDX A;  5IOD A;  3UDF A;  3MFG A;  2WAQ G;  2UUB L;  4MV7 A;  5C3W A;  4ZKC B;  3RGX A;  5ELD A;  3AEV A;  3CVZ A;  5IYB H;  1C4Q A;  4DL4 A;  3A0J A;  2B63 B;  2CZG A;  5IP7 H;  1R9T H;  4X64 H;  3OSN A;  2R6F A;  3K3P A;  2YZM A;  4N8X 1;  3K7A H;  1QVG A;  1EY9 A;  3R8B A;  4LF9 L;  1EU3 A;  1RYS A;  1E4G T;  4RKB A;  4X3T A;  2UUA L;  3TS2 A;  1KJI A;  1O7L A;  3Q6S A;  3GTM H;  5CV5 A;  4M9U A;  3MR2 A;  3GTK H;  4DR6 Q;  2C2E A;  1L0W A;  1SMY C;  2UXB H;  5CV9 A;  1B04 A;  3E3X A;  4JV2 A;  4WFN 3;  1HTL D;  5D1O B;  4ME5 A;  4A2A A;  1X65 A;  3CCM A;  4WJW A;  2SCU B;  2BR0 A;  2CWA A;  1I6H B;  1UC8 A;  4NXM L;  3P7J A;  1ESF A;  1EEI D;  1I6V C;  5J1Z A;  1KC7 A;  1DOL A;  1NE3 A;  4GS3 A;  3L4J A;  5KFY A;  5M9O A;  1KAW A;  5EWF A;  3FEW X;  1VQB A;  1PH9 A;  1HZC A;  5KYI A;  1FNV A;  4IRK A;  4JI1 L;  1JB3 A;  3Q8R B;  4ED6 A;  2EYL A;  3I4M B;  4DV3 H;  1S5D D;  5EKL A;  1E3P A;  2NN6 I;  4DUZ H;  4XTC S;  3BVM A;  1EWC A;  2JEB I;  1PH8 A;  5I6Y A;  5C3E B;  1OTC A;  1DOM A;  1K28 A;  4K2K A;  1AE2 A;  5BR8 H;  2F0K A;  4OX9 H;  1L1O A;  1CM9 A;  3AFP A;  5FO8 B;  4IO9 A;  3QIA A;  3VYS A;  1S0N A;  4N8F A;  5I2X A;  4JI0 H;  2X69 A;  4DR7 L;  1WCM B;  2K05 A;  2N55 A;  4CDC C;  4K14 A;  2OXP A;  2I5H A;  2UUB Q;  4QL5 A;  4C1N I;  5CA1 F;  2HVR A;  2KQ3 A;  1HNZ L;  5C4X H;  5CV6 A;  3QOL A;  4YP3 A;  4AYB E;  1ZXT A;  1Y14 B;  1E7Z A;  1N56 A;  3KF6 B;  4HQ6 A;  2WAC A;  1QVC A;  4K5X A;  3QOJ A;  1EU4 A;  1EY4 A;  5KFA A;  4KHZ A;  4X65 L;  1VQ5 A;  4JCV E;  4RH6 A;  1BVS A;  3KUP A;  4JV1 A;  1DZ1 A;  1D2B A;  4GZY C;  2UUA Q;  4A3B B;  2B2W C;  1S40 A;  2R8I A;  2W9A A;  3JAM i;  4F8M A;  1ESR A;  1GUW A;  1YIT A;  1S5B D;  2NVQ H;  4C2M B;  4BXX H;  4JI8 H;  1KXL A;  1EQR A;  4RHR A;  5KT2 A;  3SK5 A;  1S03 G;  2F4V H;  5L37 A;  2J4X A;  2JA6 B;  4RZQ A;  2NTT A;  4JI3 L;  2JP1 A;  3I4N B;  1GHK A;  2PBZ A;  3EFX D;  4DV7 H;  3FRP B;  4YR0 A;  2KJX A;  3A55 A;  1EIH A;  3VPC A;  4HCS A;  1JWS D;  3C1E A;  3L7Z C;  2VPQ A;  2F0F A;  1RIP A;  1X6O A;  4HN7 A;  2R92 A;  4DR1 H;  3HKZ G;  3RUZ A;  3GTG B;  2PMZ B;  1IOV A;  4TKO B;  4JI1 Q;  3MJF A;  1RTN A;  1UAP A;  4DUY L;  2Z9H A;  1UWV A;  1TWA B;  1WOC A;  2AUJ D;  1DJR D;  4O3N A;  2Y0S G;  3AB9 A;  4DR2 H;  4LF6 H;  1H9S B;  2RDG A;  5T1I A;  1S68 A;  3E5N A;  3KJO A;  3HGB A;  3MR5 A;  2F52 A;  5JPN C;  2RSN A;  3U9T A;  1XMQ H;  2G9D A;  2VQE L;  2V1C C;  2WAQ E;  1JLL B;  1KRS A;  4OXP A;  3PZP A;  2NN6 H;  1SDF A;  3M4Y A;  5JJI A;  5IWA H;  3GTO H;  3T16 A;  4DL7 A;  4LMY A;  4XYO A;  3GTJ B;  2A19 A;  3OMC A;  3LWU A;  1XPO A;  3DF7 A;  1D1I A;  1QZH A;  3PUY A;  4DR7 Q;  4RWS C;  3HKZ A;  1T94 A;  3PO3 H;  4DV0 H;  2NVX B;  2FP4 B;  4P74 A;  4EBC A;  2AGQ A;  3KOJ A;  3BA9 A;  1A62 A;  4WD3 A;  1HNZ Q;  2GLT A;  1OXV A;  5KFZ A;  1EYA A;  3Q24 A;  1RJQ A;  4L1K A;  2PVP A;  2Y0S A;  1O80 A;  1S4Z A;  3C3L A;  4K8I A;  4A2B A;  1WJJ A;  1EZ8 A;  2K32 A;  1KHI A;  2PQE A;  3BQ1 A;  2EYF A;  4XX0 B;  1K83 B;  5C44 B;  3GTP H;  1XPU A;  1EL0 A;  1UEB A;  3SK8 A;  5D1P A;  1GD7 A;  2YTV A;  2JK8 A;  4U7C A;  4XDX A;  2K03 A;  2R7M A;  1Y1V B;  4A93 B;  2IX3 A;  4CJ0 B;  1AUX A;  4OIK A;  2RQX A;  4CHT B;  4LF7 L;  1CA5 A;  3JSL A;  2DJG C;  1D8L A;  2B2U C;  5M3F B;  1OXU A;  1TY2 A;  1RD9 D;  4MV8 A;  3T1H Q;  2W8K A;  4DGZ A;  1NBW A;  3CPF A;  5C0X G;  4JI3 Q;  2LS0 1;  1H9J A;  1TWC H;  1Q86 C;  3RN5 A;  4BBR G;  1ICF B;  4I7A A;  3PIP 3;  4Q5V A;  1MJE A;  1S5C D;  2N49 A;  3ULL A;  2L12 A;  1Z2N X;  4ECX A;  5FLX c;  4BY1 G;  3I12 A;  5DG8 A;  4ZQ3 A;  5M5X H;  4H0L C;  3P20 A;  1XMO L;  1TWH A;  3STB C;  2ZJQ A;  2IX1 A;  4IFD J;  1V51 A;  4EGQ A;  3MFI A;  4JI5 H;  2JXM B;  3HOU G;  4ED3 A;  2FLN A;  1T5E A;  3D4W A;  2XGP A;  1BCP C;  1E2W A;  3GTQ H;  2VUM A;  1CQF A;  1TS3 A;  4MTK A;  2VQE Q;  2WB1 E;  5JQW A;  1VCI A;  2EYJ A;  4J6H A;  5C1P A;  2IHE A;  3S1M H;  1ENA A;  1K8A C;  3HOY H;  1NMF A;  1QIL A;  5COY A;  4IAL A;  3VR2 A;  4RU9 A;  1TXY A;  4IZO A;  4DXG A;  3RBE A;  4ZUJ A;  2YZN A;  4J1M A;  4AQY H;  1XPR A;  4RB3 C;  1SFO A;  5BN5 A;  5I9O A;  4C3J H;  3H20 A;  2NBF A;  2HQL A;  1I3Q A;  5KFB A;  3VA7 A;  3TN2 A;  2EXZ A;  2F3V A;  2JA7 G;  3L2P A;  5T14 A;  3CCE A;  4RMF A;  4MA5 A;  3PIO 3;  1HCZ A;  3WOE A;  4X66 H;  2CW7 A;  4UFZ A;  3T13 A;  5LA6 F;  1PYW D;  3HS0 C;  1SYB A;  1WTP A;  2VQF L;  1SLJ A;  3TP7 A;  1AE3 A;  2RDJ A;  3MWM A;  4X3K A;  1WTO A;  1KEE A;  1PZJ D;  1QUQ B;  1BR9 A;  2A5H A;  3CRK C;  3P75 A;  3HZX A;  3BAA A;  4ZHQ F;  2FPG B;  4QMG A;  2HCI A;  2YU9 A;  3EA6 A;  3W1G A;  1PFB A;  1SEB D;  3U9O A;  3BG3 A;  3U4V A;  3UDI A;  3NK9 A;  1WTW A;  5TSS A;  1E4F T;  4F4X A;  3I73 A;  3I3C A;  3N8D A;  3IL8 A;  2JA7 A;  1S10 A;  3G6X A;  3ORR A;  3KLR A;  1JE4 A;  3S2H B;  3KF8 A;  2YRX A;  2A74 C;  2Y0S E;  3S16 B;  1YNJ C;  4HMJ A;  2RGR A;  2KEN A;  4IJH A;  4PZ7 A;  3PUW A;  4CKB A;  3GTK B;  4R4O A;  1A15 A;  3NE5 B;  4XQN A;  4UPA A;  1EYZ A;  4R4C A;  5CMD A;  5A2Q E;  2EJF C;  3M9O B;  4ED7 A;  4B9W A;  4YAK B;  5GRO A;  2A68 C;  1K9M C;  2R93 H;  3GV8 B;  4KI0 A;  4P73 A;  1I4G A;  2EDG A;  1X3G A;  5ELE A;  1XMO Q;  4CKC A;  5IYZ F;  1GLV A;  2WII B;  3GIL A;  1KNA A;  2KCM A;  4QWD A;  2ZTE A;  4MV6 A;  1BKB A;  4QUF A;  4X62 L;  1SCU B;  2CW0 C;  3GIP A;  4DAY A;  1TA8 A;  1Z9F A;  3HOX H;  1GUT A;  4QWB A;  3NPP A;  1JMC A;  2HHH Q;  3CCR A;  4O3P A;  2ALZ A;  3FMC A;  5E3F A;  1ROD A;  3AFQ A;  2V5A A;  2LSS A;  4UP9 A;  1IW7 D;  1S0M A;  1X32 A;  1L1O B;  2I8C A;  2XD4 A;  4JI6 L;  1U4P A;  4A3F H;  1N32 Q;  1GSO A;  3MEH A;  2Z4I A;  3RIZ A;  4ECR A;  2R7N A;  1K8O A;  1YNX A;  4XIG S;  3AMU A;  3HKS A;  4BY7 H;  4EGJ A;  3J81 W;  3GII A;  3CKI B;  2HT1 A;  4CDF C;  1IBL L;  2R84 A;  5FD6 A;  4LF9 H;  5G3L F;  4DR3 Q;  1CA6 A;  2HDL A;  1NTG A;  2BA0 A;  4ZI7 F;  1CSQ A;  2KA7 A;  1Q90 A;  1UEA B;  2F0O A;  3PO2 B;  1VQJ A;  5BPH A;  4ME3 A;  3GV7 B;  2EIF A;  1SE3 A;  1B4O A;  1PH6 A;  4A3L G;  4RNM A;  2L1B A;  2E2J B;  3TQY A;  1WD0 A;  2AWN A;  4DV2 L;  4GKK L;  2AWO A;  3WO0 A;  4DLK A;  3T51 B;  5KG6 A;  1BBW A;  5JVD F;  2LFN A;  3URY A;  4JI4 L;  3DEP A;  1AP0 A;  4NXM H;  2CH4 A;  4DNT B;  2XIW A;  2I5L X;  1K1S A;  4CC5 A;  3JAM c;  4QCL A;  4TUY F;  2XGQ A;  5KG4 A;  1PFN A;  3U58 A;  3U4Z A;  4DNR B;  1JDB B;  5D3I B;  2HD3 A;  1K0R A;  1VQP A;  1WTX A;  4B3M Q;  1E24 A;  4K6D A;  3PSI A;  3Q8P B;  3R5F A;  4KY5 A;  4QW9 A;  1JXL A;  4QUC A;  3HOW G;  1PZI D;  4NXN L;  5D1O A;  4XT3 B;  3KXY T;  2EOT A;  2W9B B;  2JA5 H;  2SNM A;  5CV8 A;  3OUZ A;  5C3E G;  2JA8 H;  4H13 C;  1WTV A;  2R92 B;  1CUK A;  2R85 A;  3SK4 A;  3KK7 A;  4Q8F A;  1LT5 D;  2B3G A;  1J9O A;  4HSP A;  4JW0 A;  4LJZ C;  3D3R A;  4X62 Q;  5IT9 E;  4GKJ L;  5JEA H;  1LO5 D;  4N9P A;  2KEC A;  3SDZ A;  2I5M X;  3VR5 A;  2EYP A;  1TAE A;  3DWP A;  1O78 A;  1JWM D;  2X6G A;  1WCM G;  3J81 L;  1ULZ A;  4DV6 Q;  4O42 A;  4ABN A;  2OWO A;  2Z4H A;  2KVM A;  4KD4 A;  5LMU L;  1KIX A;  2QGQ A;  4JI6 Q;  1A0I A;  1EY0 A;  2WYO A;  2E5L H;  4J9N A;  2KBN A;  2J6S A;  3S24 A;  3VDY A;  3ULP A;  5H1S E;  5KFP A;  4FF3 A;  2R82 A;  1V4Y A;  3CC4 A;  3N41 B;  4DL5 A;  3HKZ B;  4V19 0;  2ASD A;  2UUC H;  2F0P A;  2LKV A;  3HXL A;  3V6K A;  1M7J A;  1TU2 B;  1IBL Q;  1EIG A;  4X65 H;  3GTO B;  4A3B G;  4MA0 A;  3NWT A;  3HOZ H;  1AUV A;  1I7L A;  2FKL A;  4IOA A;  5C4J H;  1KTK A;  4CBV A;  1IZ6 A;  1HH2 P;  4KKS A;  3PO3 B;  2I80 A;  4FDB A;  2I0Q A;  1N33 Q;  2YTY A;  1KJ9 A;  3HB9 A;  1HNW Q;  1PX2 A;  5DM7 3;  2ZDG A;  2G5D A;  2WTF A;  2JA6 G;  1LTR D;  1M6V A;  4GKK Q;  1CKN B;  3KHG A;  4A3G G;  5C4H A;  4UCT A;  3CME A;  2B2W A;  3D4D A;  3CCS A;  3PIP A;  3CW2 C;  1GSA A;  3UFX B;  4A3C G;  1TQO A;  3HOV H;  3DWQ A;  4FBU A;  2F0E A;  4L5Q A;  4PG3 A;  3E5S A;  3J7A 5;  4DR4 L;  3MZ5 A;  5BN3 A;  3EN2 A;  4GC6 A;  1DV1 A;  2F0H A;  2FJZ A;  2KSW A;  2K5Q A;  4APV A;  1W96 A;  2NZO A;  1KD1 C;  4O2A F;  5KYL A;  5DG9 A;  4DUY H;  1MBY A;  4C2M A;  4GNX C;  2E76 C;  1VQ9 A;  1DOK A;  4NXN Q;  2L9H A;  5CV7 A;  2DJF C;  1DD2 A;  4OGQ C;  2JA6 A;  4RGT A;  2ASB A;  2K5H A;  4AH6 A;  3GTL A;  1IKL A;  4X3U A;  2FHT A;  2K33 A;  1PRT B;  1TWH B;  1VQF A;  2YV5 A;  3CRL C;  5DLQ E;  4A3E B;  4GKJ Q;  4KY6 A;  3LP8 A;  4KLK A;  4O2D A;  3T4A C;  3BDO A;  1YEZ A;  1HQM C;  2BE5 D;  3GTG A;  1S9F A;  2VUM B;  4HAE A;  1EHI A;  2PMZ A;  4K6L A;  2YS7 A;  3KTM A;  5AJ3 L;  1F9R A;  3PIO A;  4JV5 Q;  1PTO H;  2O2L D;  3CCJ A;  1S5F D;  4BBS H;  2YW2 A;  2AGP A;  1CTM A;  1H9S A;  2NU6 B;  1STH A;  4BBR B;  1D5Z C;  1SBB B;  2JA9 A;  2NWG A;  3U9S A;  5DQI A;  2F0I A;  4BA1 I;  3V6J A;  5C44 G;  4ECU A;  2PZT A;  1I3Q B;  2PYK A;  4ZAI A;  2XCP A;  1VBG A;  2QA4 A;  3M3Y B;  2HIV A;  1Y1V G;  5IP9 H;  1TWF H;  5KFQ A;  3GTJ A;  2DIK A;  3RV4 A;  5FLM H;  1CZG A;  5F9N A;  2B2T A;  3OTO Q;  3C2P A;  4LF7 H;  1JIH A;  1DYQ A;  2R8H A;  1Y8P B;  5DQG A;  4B3S H;  1K73 C;  2UVV A;  4EVO A;  4BA2 I;  3BDC A;  3RNU A;  3WOF A;  2CHB D;  3HEJ A;  2R8G A;  2YU9 B;  4H44 C;  3KDF A;  3KJP A;  4A75 A;  1K83 A;  1D5M C;  1I4X A;  4FXD A;  5L1K A;  3OW7 A;  3PUV A;  4UCS A;  4K0K H;  4TQU S;  1UNN C;  4QWC A;  3TP6 A;  3Q22 A;  1Y1V A;  3QJY A;  3GV6 A;  4APM A;  5KG0 A;  3F2C A;  4G4K A;  3KF8 B;  1FKA H;  4J9K A;  4IPD A;  2IPK D;  4ME6 A;  4IFD I;  1JX4 A;  3EYY A;  1V8Q A;  3G6J B;  3OWF A;  4G57 A;  4FVM A;  5KFT A;  3QZ8 A;  3EPI A;  2C9O A;  3S1R B;  4DR6 L;  5M5Y H;  1HZA A;  2E75 C;  2NU8 B;  1EFW A;  5KFO A;  4ED8 A;  5CC4 A;  2R7F A;  3QG1 A;  1BBX C;  2MCT A;  2QDL A;  2EY6 A;  1K1Q A;  1U0L A;  1UUP A;  4B3T Q;  2C35 B;  4TV8 F;  2H5X A;  3EBE A;  2TSS A;  3TQ1 A;  2F03 A;  2EVB A;  2AU0 A;  2JEG A;  2F0Q A;  4IHJ F;  3OYY A;  4GLX A;  4DAY B;  1WTH A;  5KFF A;  2Z1C A;  5M5W H;  3QZ7 A;  2IBK A;  3TSS A;  1JJC B;  5IT9 L;  1PH7 A;  3M4Q A;  5JUM A;  4O4I F;  2MO0 A;  4LFA L;  2PW7 A;  4YQW A;  2Q8R E;  3K81 C;  1IL8 A;  2K14 A;  2V4R A;  3OSP A;  3O13 A;  1B6R A;  2XSC A;  1VMC A;  5IYC H;  2VQF H;  5JPM C;  1OXX K;  1HR0 W;  2D0P A;  3CHB D;  2PQA B;  5IYB G;  1EEF D;  2EYO A;  4DL2 A;  3TRZ A;  2GPW A;  4A3F B;  5IP7 G;  2EY5 A;  3MVV A;  2C5C A;  2YCH A;  1S0O A;  1PH4 A;  2AKW B;  4NB3 A;  2PMZ E;  1A2U A;  1S5E D;  3TP8 A;  5JVH 3;  2PZU A;  3MR3 A;  2V4D A;  3H3V I;  4C5B A;  1EUC B;  3NGD A;  4F4W A;  5ISR A;  2K5V A;  3WNZ A;  4L63 B;  2B2V C;  3MWY W;  1YZ6 A;  2X6L A;  1AZQ A;  4DR5 Q;  1IYJ B;  4YY3 Q;  1BBU A;  4P71 A;  1SE2 A;  2LMC B;  5G3L D;  1QUQ A;  4ECV A;  1NAP A;  1I4Q A;  4PMC A;  3FKI H;  5F2D A;  4MN3 A;  1KDA A;  2HDM A;  3H40 A;  2UXD L;  4PWQ A;  1ZHQ A;  1R9T A;  3GLK A;  3S17 H;  1TKW B;  3RLF A;  2ZJR A;  4DV5 L;  4ILW A;  3VYU A;  4IFD H;  5KX5 F;  2RDF A;  3T1Y L;  1F9P A;  1MSG A;  4HTH A;  5C5L A;  4DFA A;  3K5M A;  1HFG A;  1VQ6 A;  2A69 D;  3GTM A;  3FDS A;  2L5T A;  2K5N A;  2NVY H;  3E9H A;  1M4V A;  3H4D A;  3GTK A;  3H09 A;  1Q81 C;  4IUT A;  5J2T F;  4XYM B;  1UE6 A;  2D0O A;  2B2Y A;  4JBK A;  4IWX A;  1N8R C;  1E1O A;  3G6V A;  2JA8 B;  4DV4 H;  4HED A;  4KMU C;  1IOW A;  5IOC A;  4C5C A;  1IHZ A;  1KAA A;  3AU7 A;  4LFA Q;  1HNX Q;  1EIY B;  2KCC A;  3PQI A;  4ECY A;  3DM1 A;  3CCU A;  1VF5 C;  4R4Q A;  5J39 A;  2R8K A;  4UHV A;  3K7U C;  3LML A;  4I7Z C;  4JYA L;  4JI2 H;  1SEI A;  3HOW B;  3ERO A;  3PO2 G;  3OHB A;  3N52 A;  2V58 A;  3RB3 A;  5LMN W;  4FM9 A;  2XCL A;  4JI7 Q;  3V05 A;  1ZYR D;  1GJX A;  5DEH A;  5C4X G;  4DNI A;  3MA2 B;  3BQ2 A;  2ASL A;  1WTQ A;  3T5K A;  4YBZ B;  4DV2 H;  2J9G A;  1W6K A;  1JOR A;  4BWG B;  5KG5 A;  3A7L A;  2F0S A;  3IKJ A;  2CFM A;  1Q8I A;  4JI4 H;  2K7V A;  2N8N A;  1ET6 A;  3RTX A;  5CR3 A;  3HOZ B;  4A3I H;  1EY5 A;  4CDE C;  2KHI A;  1H95 A;  4POF A;  2X0S A;  3L4K A;  3H3V H;  1CQV A;  5EWE A;  4EQO A;  3J7A K;  3SVM A;  1A2T A;  3A8I E;  4IUR A;  2L55 A;  4HNU A;  4JC0 A;  2R92 G;  4YIJ A;  1IBK L;  1HUN A;  1QCB D;  5E4X A;  5KRU A;  2UXD Q;  2F0T A;  5D8D A;  4RNO A;  5ELB A;  1TR5 A;  1LTA D;  5EOY A;  1P8L A;  4L5R C;  4DV5 Q;  1B8A A;  5IGD A;  4ED0 A;  1LTB D;  4AIM A;  2NVT H;  1HZ9 A;  1TS2 A;  4K5V A;  1HQR D;  4OO1 I;  1J5E L;  3HP3 A;  1SXT A;  3KLW A;  1TII D;  3R2I A;  3F2B A;  3T1H L;  3T1Y Q;  5KIX A;  2EZV A;  3UE0 A;  2Q2T A;  2PN1 A;  3QO2 A;  4NP5 A;  5D65 A;  4TSS A;  5KFU A;  1IKM A;  1N34 H;  4QW8 A;  3RFC A;  4A3G B;  2C28 A;  3GTL B;  4TQR A;  1A6X A;  5LMU H;  1TS4 A;  5J3B A;  2ZM6 Q;  1Q3L A;  5LMN L;  1RJT A;  2PI2 A;  1HR0 Q;  4MV4 A;  2W9B A;  4V0B A;  3RGZ A;  4Q8E A;  4IJL A;  4DF7 A;  2IL8 A;  4KHP L;  2W8L A;  1IYU A;  5M3M H;  2NN6 G;  4O3O A;  2MHV A;  3BZC A;  4LF4 L;  5NUC A;  4WRD A;  2EJG C;  3NBH A;  1I94 H;  1F2Z A;  4Y7N H;  4JYA Q;  1WD1 A;  3ERS X;  3PO3 G;  2YRW A;  4O4H F;  1QNU A;  2VQD A;  4LSX A;  4Q45 A;  1SRU A;  4BBS B;  3D4R A;  3I4O A;  4KN7 C;  3R3O A;  1A63 A;  1VF7 A;  1I4P A;  3TEH B;  2E2H H;  1W6J A;  3FMA A;  4LSA A;  1PTO C;  1I50 H;  2MFI A;  2ALY B;  3C46 A;  1HJP A;  3GTO A;  1SR3 A;  2R6G A;  1XXG A;  3RB0 A;  1M1K C;  4DR4 H;  4DPG A;  3PW4 A;  4M7E A;  4JOI C;  3T5H A;  1SYD A;  3I90 A;  2NYZ D;  2A8V A;  3RLO A;  4HJ5 A;  4IUN A;  1Y69 U;  3KDF B;  1TWG H;  1C0A A;  2BQ3 A;  3BZK A;  2F0L A;  5HGQ A;  5D14 A;  5EPK A;  4L5S A;  2BQU A;  1EWH A;  1IBK Q;  1CKN A;  3S1Q H;  2PNH A;  3BJU A;  1Q12 A;  4HID A;  2LXJ A;  1A9X A;  1KC8 C;  4A3E G;  2J0T D;  2XWB B;  1V43 A;  1SNO A;  1FVI A;  1SMX A;  5IGE A;  3K57 A;  4HIK A;  3GTP A;  3IFT A;  2XCA A;  1SND A;  1J5E Q;  2JEA I;  2VUM G;  3V4Z A;  4LF8 H;  2ZJP A;  1XNQ H;  3I2Z A;  2E2I H;  4UDU C;  1MSH A;  3K5I A;  1G91 A;  4OO1 H;  1MGS A;  1PK8 A;  2B8G A;  3G7L A;  3G6E A;  1O7Y A;  2IA6 A;  1D1K A;  2JJQ A;  2VUG A;  3RB6 A;  5LMN Q;  1ENF A;  5KFE A;  1TY0 A;  2SNS A;  2UU9 H;  3T53 B;  2JE6 I;  3SXH A;  4KHP Q;  3N42 B;  5JVG 3;  1SSO A;  4GN3 B;  1GYF A;  1BCP B;  4WBN F;  3F1Z A;  3CC2 A;  4J9S A;  1YBY A;  5LL6 X;  1LV9 A;  1TWC A;  3CAM A;  4DXF A;  3I8Z A;  3FDT A;  3J81 E;  4LF4 Q;  5EDW A;  4B3R H;  1FYC A;  2ZT9 C;  5KFV A;  4C3J G;  3S14 B;  1NNX A;  3QFF A;  4IR9 A;  1F9S A;  4YHH H;  2W6N A;  4LFC L;  2NUC A;  1B9M A;  4RGM A;  1EUD B;  2IWH A;  3E0J A;  1ASZ A;  5EPL A;  2DPI A;  2XN9 C;  1JQY D;  2HHH L;  5IGC A;  3LX0 A;  1YNN C;  1G6Z A;  2QEX A;  3IFD A;  2VR1 A;  3B6Y A;  4OWW B;  4Q44 A;  1Q1E A;  1EY7 A;  2W6Q A;  2KHJ A;  3GTQ A;  3MXU A;  2KCT A;  3M4O H;  4YCW A;  3OMG A;  1XX8 A;  5K36 H;  5AFW A;  2RCF A;  1GUG A;  4DAM A;  1N32 L;  4A3D H;  3KBX A;  5EBD A;  1NJI C;  4O2B F;  1KLU D;  4PNY A;  4RGN A;  3RB4 A;  2RCN A;  2F0N A;  4LAA A;  4GN5 A;  4UCU A;  2Z6K C;  4LF5 Q;  3L9A X;  1VQ7 A;  2AQ1 B;  4DR3 L;  2DWC A;  2A6E D;  2I07 B;  1DON A;  3FHW A;  3SK6 A;  5EWG A;  3J7A V;  2WKC A;  3I55 A;  2IMW P;  4C3I H;  2DLN A;  5DLG A;  4DR6 H;  2QYZ A;  5FPR A;  1KJJ A;  5CYU A;  3T5J A;  3V6H A;  3A7A B;  3NWS A;  4IUV A;  4LFB L;  3M9N B;  3ETH A;  4N9T A;  1HFN A;  1BQQ T;  1WFQ A;  4MV9 A;  3NQT A;  2R7Z H;  1R9T B;  1SYF A;  1RDP D;  1VQE A;  4MIU A;  3HKZ E;  1Y1W H;  2RHS B;  2EXD A;  3K7A B;  4PZ6 A;  2R93 G;  4DL3 A;  1PRT F;  1X56 A;  4DV1 L;  2UXC Q;  2BQR A;  3PR5 B;  4M1U B;  2ZXP A;  4B3M L;  3GTM B;  3HG9 A;  2JA7 H;  5KFM A;  1XNR Q;  1FJG L;  2R7K A;  2E2D C;  4JBW A;  1B9N A;  1M8A A;  5KFW A;  3HOX G;  2FLL A;  4J9Q A;  3S2D H;  2E74 C;  4FS1 A;  2EYH A;  1LUZ A;  1BDO A;  4ECQ A;  5J22 A;  3G8C A;  1G6P A;  4F88 A;  3BS1 A;  5JOB A;  3CQZ H;  3ND8 A;  4LFC Q;  4A3F G;  2BA1 A;  4KKU A;  4O4L F;  4IRC A;  1LTI D;  4FBT A;  4RG1 A;  4LNQ A;  2R93 A;  3DLL A;  1RKN A;  4HR7 B;  1C30 A;  1EIF A;  2R3Z A;  4EGV A;  2GPS A;  3Q1K A;  4DV6 L;  3WO1 A;  1CSP A;  1AEX A;  1RJR A;  5LHY 1;  1STY A;  1H9K A;  2SEB D;  3W3A A;  4DAV A;  1ZQ7 A;  2UUB H;  2ZTC A;  4WOR A;  3RMH A;  4O0A A;  5E1F A;  4O1N A;  2FMA A;  1IBM Q;  4EEQ A;  4CKE A;  3MHB A;  4A3J H;  1JC7 A;  1PLF A;  2BOS A;  1C8C A;  4CGY B;  3EIV A;  4RHS A;  2PQA A;  3NTK A;  5FJ8 H;  1PXU A;  1XTD A;  2ICE C;  1WSC A;  3R23 A;  2QEJ C;  3C1F A;  4EQP A;  2UUA H;  2QKI C;  2GVB A;  4EBD A;  4MTD A;  2B2V A;  1OXT A;  1JE5 A;  3KHH A;  1IXR A;  3IG0 A;  1N33 L;  1VBH A;  1FL0 A;  3EVQ A;  3J80 E;  1HNW L;  1JDE A;  1HPC A;  1ML0 D;  4LFB Q;  1B3Q A;  4H02 A;  4A3I B;  5C4X B;  4QJF A;  1CS0 A;  3VPB A;  3TQT A;  1VMP A;  1M0W A;  1PZK D;  4KN4 C;  4IUP A;  1RJP A;  1VDZ A;  1CQJ B;  1YNJ D;  4DV3 L;  1PH2 A;  3KAL A;  1II3 A;  2ZDQ A;  2JA8 G;  1A3U A;  5KNB A;  2B63 H;  4DV1 Q;  2VY3 A;  3CF5 A;  3H3V C;  2J6U A;  4ECS A;  4FP5 D;  2Z6B A;  4J9P A;  2CKZ B;  2WE6 A;  4JI1 H;  5BR8 L;  1FJG Q;  3M7N A;  2FB9 A;  2FK1 A;  3MR6 A;  4HCE A;  2NVT B;  2NVQ B;  3ZYY X;  3PN1 A;  4JI0 L;  5KFD A;  1JCK B;  5KT7 A;  5IGG A;  1OWT A;  1N36 Q;  3K59 A;  3S15 H;  3OWE B;  3ORQ A;  3MWE A;  2N3S A;  5KT4 A;  2L4N A;  4GC7 A;  2W6Z A;  4FS2 A;  2RDI A;  3NBH B;  1QJO A;  4NKL A;  2JA5 A;  4X64 Q;  1I6H H;  5M3M B;  5CBA E;  2I87 A;  4DR7 H;  5FKA C;  2DNC A;  3R93 A;  1VQD A;  1S3O A;  3A8K E;  4FU0 A;  4JV5 L;  3HOZ G;  1DCZ A;  1XTC D;  4MHE A;  2BH2 A;  1HNZ H;  1FNU A;  3BYY B;  3TP5 A;  3A74 A;  3Q8Q B;  2XIG A;  2VL6 A;  3M4P A;  2UXB Q;  4FF1 A;  1IYV A;  1SNP A;  3I4M H;  3BA8 A;  5ELN A;  1LYL A;  4JI8 L;  5IE8 A;  2Q2U A;  4JPB W;  1JJG A;  4IOC A;  1D7Q A;  4S3S A;  5I6W A;  3D6W A;  3A5U A;  2HJW A;  3PCO B;  2BH8 A;  2K4K A;  4NDX A;  2R8J A;  4DV7 L;  2JSO A;  4XQQ A;  3HOV G;  3OTO L;  1I50 B;  3Q2O A;  1A3T A;  4IPG A;  1F77 A;  2RBM A;  2WV6 D;  3J7Y W;  1VAJ A;  1EQT A;  2M9V A;  3NSW A;  1GUS A;  1SN8 A;  3T1H H;  4ZCK A;  4F4Z A;  5C0X J;  4G7O C;  1WCM H;  4YAJ B;  1PH5 A;  4QWA A;  3KAK A;  5JAV A;  3PW7 A;  2P5Z X;  4JI3 H;  5T1G A;  3X3M A;  3VR4 A;  3D0F A;  2DN8 A;  5E4W C;  5IGB A;  4A76 A;  3GTP B;  4DV3 Q;  4DR2 L;  1O7Z A;  4DUZ Q;  4JI2 Q;  2VS1 A;  2L15 A;  2NZ1 D;  1XMQ L;  4GNX B;  3CMA A;  3JSN A;  4UCR A;  4ETS A;  2D5D A;  3UDG A;  3M4I A;  3ERQ A;  4RA8 A;  4ZRZ A;  3NHH A;  1YVC A;  5BR8 Q;  5IWA L;  3I7F A;  3OPO A;  4OX9 Q;  1H9R A;  1L0X B;  3LNN A;  3CXC A;  2VB3 X;  1PH1 A;  4UY8 C;  3NUC A;  3K5H A;  2A6H C;  3GQC A;  3VR6 A;  3PW0 A;  5I9P A;  1VQA A;  1VS0 A;  5C5J A;  4JI0 Q;  5KFC A;  3J80 W;  3UQ8 A;  5C1O A;  3CCV A;  1WR2 A;  2R61 A;  4FXG C;  2VQE H;  3GQB A;  2JQO A;  3I56 A;  4BBS G;  4F7X A;  4B3T L;  3J81 c;  1TWC B;  4C2M H;  2OEO A;  5DGA A;  1N9W A;  3CC7 A;  4L5T A;  1NMG A;  2Q8T A;  5KFH A;  4DA2 A;  2JA6 H;  1V1O A;  5HV6 A;  4RZR A;  3OIQ A;  3I4N H;  5IYD H;  1L2F A;  1U4R A;  2F4I A;  3F2U A;  4KTA A;  3HFZ B;  5M5X B;  4A3K H;  5FLM G;  2OCE A;  1X3P A;  2NU7 B;  4EYH B;  1BNZ A;  1VKZ A;  1BGW A;  5H80 A;  3GTQ B;  3QB3 A;  2AGO A;  2AQ4 A;  1PA6 A;  4RB2 C;  1TWA H;  1X3E A;  2NB0 A;  5KNC A;  2H1E A;  3S1M B;  4I4T F;  3X3N A;  1GUO A;  2TMP A;  4JI8 Q;  4OIJ A;  1EYC A;  3HOY B;  1K8G A;  2F3I A;  5LL6 S;  3H15 A;  1SJH D;  4QWE A;  5COR A;  2F4V Q;  1DV2 A;  3Q0A A;  3OOC A;  4C3J B;  1D6E C;  4JOI A;  5IIF A;  4IAJ A;  4K8J A;  3TIG A;  4DV7 Q;  1QOH A;  4C3H H;  3DM3 A;  5BMV F;  4J9L A;  4A3D B;  2CQO A;  3GDE A;  1LTL A;  2AMC B;  3RD4 A;  4IZ8 A;  3PUZ A;  1TWF A;  3I70 A;  2RGV A;  4DR1 Q;  3R5X A;  4RAZ A;  4J0M A;  1I5F A;  4YWL A;  2ES2 A;  4O3R A;  2MJ8 A;  1T3N A;  5LYJ F;  2NVX H;  2O5I C;  1JR0 D;  1NR4 A;  3J80 L;  1PH3 A;  2KEE A;  1EZ1 A;  4JI5 L;  4DR2 Q;  4LF6 Q;  1WYD A;  1NCV A;  5KG2 A;  2CCZ A;  4DR5 L;  2B2U A;  4YY3 L;  1OO9 B;  1XMQ Q;  4Y52 H;  2W6M A;  4L8J A;  4X6A H;  1K83 H;  2BDN A;  1GM5 A;  2K52 A;  2B29 A;  4UCV A;  4R4I A;  2Q2H A;  5IWA Q;  4MTE A;  1XMO H;  2MUY A;  2R7Z B;  4KHV A;  5IY0 A;  4A93 H;  4UCO A;  1VQI A;  1ZET A;  4R8U A;  3E9I A;  4HNT A;  1GVP A;  4DV0 Q;  2SDF A;  5M3F H;  4MV3 A;  2HHH H;  4UP8 A;  1TT2 A;  1SAP A;  2QIL A;  4GLA C;  1EQQ A;  1PRT D;  3UE1 A;  5C5M A;  4O3Q A;  5L1L A;  3IRB A;  5IYC G;  5GON F;  1TS5 A;  2R93 B;  1XWE A;  2MQH A;  3H0G H;  1B33 N;  2JEI A;  2C22 A;  1JIC A;  1SYX B;  3OHX C;  4IUQ A;  1N32 H;  4R8I A;  1BJT A;  2CW8 A;  4QY7 A;  4U67 3;  1HNX L;  3F2D A;  4ID6 A;  2W57 A;  3CQZ B;  2P0A A;  4A3M H;  1RHP A;  4EEY A;  2MPM A;  2VZA A;  1W93 A;  2M00 A;  3M85 A;  4M8A A;  3BZD B;  3HOX B;  4DR3 H;  2FLP A;  4HJ9 A;  3G6Y A;  2DPJ A;  3M7G A;  4IWY A;  1JOK A;  5FK9 C;  1JT8 A;  1XNQ Q;  4JI7 L;  3VYT A;  1W3S A;  3EPG A;  2LY7 A;  3PVX A;  1SRO A;  1GXD C;  2CH4 W;  1YIJ A;  1BOS A;  5FLX E;  2C2D A;  3KHL A;  1I4H A;  3JZI A;  4GOP C;  2UU9 Q;  1JKJ B;  4KD3 A;  2CQY A;  1KNE A;  4BY7 B;  1I7N A;  3FKI G;  3RAQ A;  2FFK B;  4IPH A;  4UAI A;  3T5L A;  4QIW B;  4JBM A;  2JEJ A;  4J9O A;  4JI5 Q;  4B3M H;  1AH9 A;  5I47 A;  1KDC A;  3PUX A;  4JV0 A;  4IFD G;  2DZD A;  1KJ8 A;  1QVF A;  4PMW A;  2FK2 A;  1HA5 A;  3NEN A;  3J7A F;  2F1M A;  1Q8K A;  1MHW C;  5KGU A;  4OWX B;  3MFH A;  1U4M A;  1LT4 D;  3Q8D A;  5CV4 A;  1ENC A;  4AQY Q;  4MAM A;  1BCP F;  2XVS A;  4WJ3 M;  1CQI B;  3I72 A;  3SEB A;  4X62 H;  1SNC A;  5DNF A;  3FKI A;  1QZG A;  1MIU A;  5K2M A;  2RF4 A;  5KKN B;  4UP7 A;  1YJW A;  2JN4 A;  3N6X A;  1J8I A;  4DV6 H;  2VA3 A;  4O3S A;  2AQ2 B;  3TZU A;  5IT9 c;  2FK3 A;  1Z47 A;  4X66 Q;  1T5X D;  3S2H H;  5KG7 A;  2OH2 A;  2ZM6 L;  3S16 H;  1HR0 L;  4JI6 H;  4HIM A;  2JA5 B;  1AW7 A;  3GO5 A;  1SE4 A;  3DHQ A;  2NVY A;  3S15 B;  1QB5 D;  2HCC A;  3V2T A;  1RCV D;  4R8N A;  1NSN S;  1G8Z D;  5JJK A;  1SYG A;  4XZ3 B;  4ED2 A;  2WAQ A;  1NY4 A;  1IBL H;  4JK1 C;  2HVQ A;  1VQG A;  3MFY A;  5K5P A;  2FPI B;  4HR7 A;  4LUZ A;  3N44 B;  3K58 A;  2VXW A;  1F2M A;  2O5J C;  3MWD A;  4LH6 A;  3W1B A;  1UC9 A;  3KLS A;  4E4T A;  3GV5 B;  2C00 A;  1N33 H;  4DAP A;  4DK3 C;  1R4Q B;  1ZEQ X;  3W5O A;  4A3I G;  3BVZ A;  3GP7 A;  2VNU D;  3SE7 A;  1B3A A;  2J6T A;  3CP0 A;  1HZB A;  1HNW H;  1F2L A;  2FMM A;  4C56 C;  2WDT A;  1ILP A;  1GGO A;  4GKK H;  4KKT A;  2SOB A;  3LGJ A;  1U5K A;  2XGT A;  3FPU B;  2RDH A;  1PFS A;  4ED1 A;  2WKD A;  3A5Z B;  4DKA C;  4G7H C;  4TV9 F;  1KDB A;  3E0E A;  1ICW A;  5C4J B;  2D9U A;  1D5X C;  2R86 A;  2F0W A;  3DUZ A;  4BXX G;  1B1Z A;  3C0F B;  4XYL B;  1ET9 A;  2R7D A;  4OEM B;  2FJ2 A;  1LAC A;  1STG A;  5EBC A;  5CGK A;  2EYM A;  5EJW A;  3G71 A;  1CT1 D;  1YHQ A;  3K3V A;  1SMY D;  3K0Y A;  4BWS C;  4OON A;  4ECW A;  3BG5 A;  4PV1 C;  1VQN A;  1P16 A;  3PO2 H;  5FLX W;  2MO1 A;  2K75 A;  2WB1 G;  1C9O A;  3NTH A;  4K2L A;  3OW2 A;  2E2J H;  1E4E B;  4GKJ H;  3H94 A;  1Z7T A;  3HOV B;  5KFS A;  4DN4 M;  2E5L L;  1YHB A;  2FPP B;  2NTS A;  5FO9 B;  5M3M G;  1FGB D;  4MNO A;  5EZY F;  4Z9C B;  2EPB A;  3I91 A;  1JB7 A;  5DM6 3;  4ALP A;  2G9H D;  4POG A;  2UUC L;  3RZO H;  3PMF A;  1HA6 A;  4LF9 Q;  1J6Q A;  4JV5 H;  1L0Y B;  4JG2 A;  1RL2 A;  3GIM A;  1CE8 A;  1DXM A;  2VB2 X;  1YJN A;  1Q7Y C;  5GAG C;  3GIJ A;  2FMC A;  5KT3 A;  2CVR A;  2W9C A;  1Y8O B;  3WDN A;  3W2D A;  1G29 1;  3BU2 A;  1DIK A;  5DLF A;  2M05 A;  1QNK A;  2ZXO A;  4I7H A;  5GAE C;  3D6C A;  3GD7 A;  2WB1 A;  4IQZ A;  3JAM E;  4LH7 A;  2ZXR A;  2YTX A;  4KV6 A;  4RFB A;  2R92 H;  5DAU A;  1LTS D;  2F0G A;  3BVG A;  2GN5 A;  4NXM Q;  1LLR D;  3NTI A;  2QK4 A;  2D2C C;  1VQM A;  4I50 F;  4EFB A;  3OTO H;  2IW3 A;  1PTO B;  4ZKB B;  4A3K B;  1HNX H;  3PGZ A;  2ICI A;  2K04 A;  5C0X I;  1B2T A;  1F9Q A;  2V9W A;  4J9M A;  1L2Z A;  4KJN A;  4NXN H;  4EG0 A;  4MZ9 A;  3RUP A;  1MI2 A;  1SNM A;  3L3O C;  1T36 A;  2W6O A;  3MC0 B;  1A8V A;  4RKL A;  5L9X A;  5FLX L;  1TWF B;  2UVW A;  1UE7 A;  2HIX A;  2OQ0 A;  2E2H A;  3Q23 A;  4LF5 L;  1CZW A;  3T56 B;  3F8N A;  1PFM A;  2L0C A;  1I50 A;  4C3H B;  4CJ1 B;  4EFE A;  1IL2 A;  3RZD H;  1BO0 A;  5C3X A;  4HNV A;  5HUR A;  4R9W A;  3RLN A;  1N48 A;  4OO1 G;  2W6P A;  4ZUI A;  3V96 A;  4Q0Y A;  4EBE A;  1TWG A;  4B3T H;  3ZJY C;  2VA2 A;  2WFW A;  2K1B A;  3VYR A;  5IGF A;  2E5L Q;  2IJ0 A;  5KFJ A;  4GNX A;  2DUD A;  2EJM A;  2B2T C;  3OUU A;  4R8U B;  4QB4 A;  3K8A A;  2K28 A;  1BF4 A;  5L1I A;  3TDQ A;  3PR4 A;  2UUC Q;  4NLG A;  2UXC L;  4FO2 A;  3FP9 A;  2XNA C;  2O03 A;  4X65 Q;  5KT6 A;  1S72 A;  2ID0 A;  1EY6 A;  1XNR L;  4ZQI A;  2A6E C;  5KFL A;  4YR3 A;  5M5Y B;  1GO3 E;  2E2I A;  1VQK A;  3JRX A;  2HGS A;  3J81 i;  3BYT B;  4HYK A;  1RYR A;  3RBD A;  3HOY G;  1KAB A;  4B3S L;  3N6R A;  1XJV A;  1EOT A;  4OHJ A;  1HUM A;  1STA A;  2KHS A;  1RTO A;  1GKH A;  3J81 j;  5K36 G;  3SGI A;  1E2V A;  1QE6 A;  3A54 A;  2QF7 A;  4H7B A;  3AQQ A;  1Q46 A;  2F0V A;  4A3D G;  2AHO B;  3H0G B;  5M5W B;  1TWH H;  2V4Q A;  4A3E H;  4YR2 A;  2A1A A;  4YCV A;  3FPP A;  3DXJ C;  1EUJ A;  4K0K L;  2RSO A;  1M90 C;  1PTO D;  5HGT A;  4WJ4 A;  1GSH A;  3RF2 A;  1AN8 A;  2VUM H;  3LWB A;  4A3M B;  2V59 A;  4Q0F A;  2KCN A;  4P72 A;  2PI2 E;  1IBM L;  2E8G A;  5C0X H;  4DUY Q;  2ZTD A;  1YJ9 A;  4C3I G;  2VOB A;  4I65 A;  1UE1 A;  5LXT F;  4BBR H;  4U68 A;  4DR5 H;  2K5W A;  4YY3 H;  4ECZ A;  4RAU C;  4AYB B;  2PW5 A;  1SNQ A;  1SFO H;  1EWI A;  4GN4 B;  1WTR A;  3JAM W;  5DGB A;  1QWY A;  4XT1 B;  1I3Q H;  3VA5 A;  3KYH C;  4J9R A;  4C5A A;  3M3Y H;  2R7Z G;  2UVR A;  4BY1 H;  1Y1W G;  1K0S A;  3QWN A;  4K5W A;  2ATW A;  1AFP A;  4F87 A;  4I55 F;  5CA0 F;  3KHR A;  5EPJ A;  2HUG A;  1KRT A;  3HOU H;  4IR1 A;  3ONA B;  5GAH C;  4LUO A;  4MV1 A;  3MEF A;  1KBL A;  1X3Q A;  1IW7 C;  4DK1 A;  1FNW A;  2Q2I A;  4LW1 A;  2YL2 A;  2FIN B;  1W2B A;  1CHP D;  2ZJT A;  3NXW A;  5D3D A;  2Z0S A;  4LK1 C;  1LTT D;  2YU9 H;  1LTG D; 
#chains in the Genus database with same CATH homology
 4BXX H;  2NZH A;  4DV7 L;  1KXL A;  3HOV G;  1EQR A;  3K81 C;  3OTO L;  2K14 A;  4IPG A;  4JI3 L;  1B7Y B;  1X3F A;  1SN8 A;  5IYC H;  5C0X J;  1OXX K;  3STB D;  1WCM H;  1X9N A;  1PH5 A;  3K0X A;  3L7Z C;  3RN2 A;  1HR0 W;  2D0P A;  4LF7 Q;  1RIP A;  1X6O A;  3D0F A;  5EAY A;  4A76 A;  3HKZ G;  4DV3 Q;  4DR2 L;  2PQA B;  4B3S Q;  5IYB G;  1MKH A;  1N36 L;  4DUZ Q;  4JI1 Q;  4JI2 Q;  2VS1 A;  2L15 A;  3S1R H;  3TRZ A;  1YI2 A;  5IP7 G;  1XMQ L;  4GNX B;  3CMA A;  4DUY L;  1UWV A;  1WOC A;  3UDG A;  4GLV B;  1PH4 A;  2AKW B;  2Y0S G;  4NB3 A;  2PMZ E;  4A3J G;  1YVC A;  5BR8 Q;  3KJO A;  5IWA L;  1PYS B;  3I7F A;  3AYH B;  2F52 A;  3RR5 A;  3CXC A;  4OX9 Q;  4X64 L;  1PH1 A;  4UY8 C;  3H3V I;  2VQE L;  2V1C C;  2WAQ E;  1KRS A;  1VQA A;  1VS0 A;  4BY7 G;  4JI0 Q;  4OXP A;  4K0K Q;  5FJ8 G;  5JJI A;  2K5V A;  3PCO B;  3D31 A;  3CCV A;  3S1N H;  1YZ6 A;  3GTO H;  4DR5 Q;  1IYJ B;  2EQS A;  4YY3 Q;  1BBU A;  2JQO A;  4P71 A;  2A19 A;  3I56 A;  1SE8 A;  4BBS G;  1QUQ A;  2IX0 A;  3WWV A;  3J81 c;  1XPO A;  4B3T L;  2FXQ A;  4C2M H;  4TVA B;  1N9W A;  3PUY A;  4L5T A;  3FKI H;  3CC7 A;  1QZH A;  4DR7 Q;  2UXB L;  1NMG A;  3PO3 H;  4P74 A;  2UXD L;  4GOP A;  2JA6 H;  3KOJ A;  1A62 A;  5E7N A;  1L2F A;  1HNZ Q;  3I4N H;  3S17 H;  1OXV A;  3RLF A;  5IYD H;  2ZJR A;  3HFZ B;  4DV5 L;  1WI5 A;  1WJJ A;  3J80 i;  4A3K H;  1KHI A;  5FLM G;  2OCE A;  3T1Y L;  3GTP H;  1XPU A;  3KFU A;  1VQ6 A;  1UEB A;  2K5N A;  2NVY H;  2B63 G;  1MJC A;  3E9H A;  5GQO A;  1GD7 A;  2YTV A;  2JK8 A;  1PA6 A;  4DV4 L;  1Q81 C;  1TWA H;  1X3E A;  2CWP A;  1YHA A;  4EQ5 A;  1UE6 A;  2D0O A;  4JI8 Q;  4JBK A;  1K8G A;  2F3I A;  3H15 A;  1L1O C;  1N8R C;  1CKM A;  4LF7 L;  2F4V Q;  1E1O A;  3PF4 A;  1D8L A;  1OXU A;  1PYB A;  4HJ8 A;  1V9P A;  4JOI A;  1HNX Q;  4LFA Q;  4DUZ L;  1EIY B;  2JA5 G;  3F8T A;  4DV7 Q;  4JI2 L;  3T1H Q;  2VQF Q;  2DGY A;  3DM3 A;  4C3H H;  3CCU A;  1NBW A;  1VQH A;  2CQO A;  4R4Q A;  3CPF A;  3GDE A;  1LTL A;  2AMC B;  3K7U C;  5C0X G;  4JI3 Q;  3PUZ A;  1VQ8 A;  4JYA L;  4DR1 Q;  1TWC H;  5JEA G;  4OX9 L;  3PO2 G;  1I5F A;  1Q86 C;  3RN5 A;  4YWL A;  4BBR G;  5GAD C;  2ES2 A;  1LM0 A;  2NVX H;  3J7Z C;  1MJE A;  5LMN W;  4JI7 Q;  2N49 A;  1PH3 A;  3M9B A;  5C4X G;  4JI5 L;  4DNI A;  4HJA A;  4DR2 Q;  3ULL A;  1WYD A;  4LF6 Q;  2CCZ A;  5FLX c;  1CKO A;  4BY1 G;  4YY3 L;  4DR5 L;  1XMQ Q;  5M5X H;  1XMO L;  4Y52 H;  3STB C;  2ZJQ A;  2IX1 A;  4IFD J;  2OQK A;  4A3L H;  2CFM A;  1G51 A;  3HOU G;  4X6A H;  1K83 H;  1O7I A;  1GM5 A;  2K52 A;  2B29 A;  4MTN A;  1PV4 A;  4R4I A;  2Q2H A;  2N8N A;  5IWA Q;  3GTQ H;  5HY6 A;  2VQE Q;  3I4M G;  2WB1 E;  4A3I H;  1VCI A;  4DK6 C;  3CCQ A;  5IY0 A;  2IHE A;  4A93 H;  2KHI A;  1VQI A;  3S1M H;  4EX5 A;  1H95 A;  1K8A C;  3HOY H;  1NMF A;  3E9I A;  4PZ8 A;  4POF A;  1GVP A;  4DV0 Q;  3H3V H;  4YCU A;  1TXY A;  5M3F H;  4P75 A;  1XPR A;  1Q82 C;  4UP8 A;  1E22 A;  4C3J H;  4GLA C;  2HQL A;  4JC0 A;  1EQQ A;  2R92 G;  1IBK L;  3UE1 A;  2UXD Q;  3IRB A;  2JA7 G;  2K50 A;  4YWK A;  3L2P A;  3CCE A;  5IYC G;  1UE5 A;  4RMF A;  3HOW H;  2MQH A;  1P8L A;  3H0G H;  4DV5 Q;  4L5R C;  2F4V L;  1B8A A;  3JC6 6;  2NVT H;  4AIM A;  1N34 L;  1HZ9 A;  4QY7 A;  4OO1 I;  5C3E H;  1J5E L;  1HNX L;  3KLW A;  3F2D A;  3G4S A;  3F2B A;  3T1H L;  2VQF L;  3T1Y Q;  1VQL A;  3UE0 A;  2Q2T A;  1SLJ A;  1AE3 A;  4A3M H;  2VZA A;  1X54 A;  3M85 A;  2MNA A;  1QUQ B;  4DV4 Q;  4HJ9 A;  4DR1 L;  2D62 A;  5J3B A;  2ZM6 Q;  3W1G A;  1HR0 Q;  5LMN L;  1JT8 A;  2PI2 A;  1XNQ Q;  4JI7 L;  2LXK A;  3U4V A;  1V1Q A;  1W3S A;  4IJL A;  3UDI A;  3TS0 A;  4KHP L;  5M3M H;  2IT1 A;  1EOV A;  2NN6 G;  1I94 L;  1SRO A;  2N78 A;  4LF6 L;  1YIJ A;  2WP8 J;  3BZC A;  4LF4 L;  4HIO A;  4HJ7 A;  4GOP C;  2UU9 Q;  4Y7N H;  2Y0S E;  4JYA Q;  3FKI G;  3ERS X;  1T9H A;  2KEN A;  3U50 C;  3PO3 G;  4IJH A;  4PZ7 A;  3PUW A;  2IHF A;  4IPH A;  4DV2 Q;  4R4O A;  5IYD G;  1E1T A;  4QGU A;  3I4N G;  4UPA A;  4A3B H;  4R4C A;  4JBM A;  1Q1B A;  3KF6 A;  3CCL A;  1SRU A;  4JI5 Q;  4JI4 Q;  1AH9 A;  3PUX A;  5GRO A;  3I4O A;  4DV0 L;  1K9M C;  2R93 H;  4IFD G;  1B70 B;  4KI0 A;  4A3K G;  4P73 A;  4QIW E;  1A63 A;  1XMO Q;  1X3G A;  1QVF A;  4PMW A;  3TEH B;  2E2H H;  2KCM A;  2ZTE A;  1BKB A;  1I50 H;  1PHJ A;  3NEN A;  4X62 L;  3PF5 A;  2MFI A;  1Q8K A;  2ALY B;  1HJP A;  4OWX B;  1SR3 A;  1Z9F A;  2R6G A;  3Q8D A;  3HOX H;  1M1K C;  3GTL H;  4AQY Q;  4A3G H;  4DPG A;  4WJ3 M;  1JMC A;  2HHH Q;  4JOI C;  3CCR A;  1VQ4 A;  1EYG A;  2IY5 B;  5IP9 G;  4A3C H;  2A8V A;  3RLO A;  1JJ2 A;  4HJ5 A;  1OXS C;  3AFQ A;  4YWM A;  1MIU A;  3KDF B;  1TWG H;  2LSS A;  2RF4 A;  4UP9 A;  3BZK A;  1QZG A;  5HGQ A;  4UP7 A;  1C0A A;  1YJW A;  3GTG H;  1L1O B;  4JI6 L;  3K80 C;  4L5S A;  4A3F H;  5IT9 c;  1IBK Q;  1CKN A;  3PV0 A;  1Z47 A;  1N32 Q;  3S1Q H;  4X66 Q;  2PNH A;  1ASY A;  3BJU A;  3S2H H;  3CD6 A;  1Q12 A;  4HID A;  2LXJ A;  2ZM6 L;  1KC8 C;  1HR0 L;  4LF8 L;  3S16 H;  1YNX A;  4XIG S;  4A3E G;  3HKS A;  1XNQ L;  4HIM A;  1V43 A;  1SMX A;  1FVI A;  4HIK A;  2HT1 A;  1IBL L;  2VW9 A;  3GO5 A;  1N34 Q;  2OTJ A;  1J5E Q;  2JEA I;  4DR3 Q;  3NEL A;  5JJK A;  2VUM G;  2ZJP A;  5LMU Q;  3I2Z A;  1NTG A;  2BA0 A;  2E2I H;  1CSQ A;  1NY4 A;  1VQJ A;  1VQG A;  4ME3 A;  4R1J A;  3GTJ H;  2UU9 L;  2EIF A;  4A4I A;  1PH6 A;  4A3L G;  4LUZ A;  3G6E A;  2JJQ A;  3TQY A;  3W1B A;  2AWN A;  3CPW A;  5LMN Q;  2AWO A;  4DV2 L;  4GKK L;  3G48 A;  2JE6 I;  4DK3 C;  1BBW A;  4A3I G;  3W5O A;  4KHP Q;  4B3R L;  2VNU D;  4GN3 B;  4A93 G;  1I94 Q;  4JI4 L;  3CP0 A;  1HZB A;  3F1Z A;  4YHH L;  3CC2 A;  1YBY A;  2I5L X;  3CAM A;  3JAM c;  4LF4 Q;  3LGJ A;  4R4T A;  5M3F G;  1U5K A;  2XGT A;  3ICE A;  3U58 A;  3U4Z A;  5C44 H;  3NEM A;  1K0R A;  1PFS A;  4LFC L;  1VQP A;  4B3M Q;  1E24 A;  3PSI A;  3A5Z B;  1ASZ A;  4OWT B;  4AQY L;  4DKA C;  1Y1V H;  2HHH L;  1KQS A;  3E0E A;  4NXN L;  2QEX A;  3H0G G;  3HOW G;  4BY7 H;  1X55 A;  3B6Y A;  4OWW B;  1Q1E A;  2JA5 H;  2KHJ A;  5C3E G;  2JA8 H;  4BXX G;  2KCT A;  3M4O H;  5JJL A;  4YCW A;  1CUK A;  2R7D A;  4DR4 Q;  1YHQ A;  3ULJ A;  3G71 A;  1K3R A;  4A3M G;  2OTL A;  2B3G A;  4DAM A;  4OON A;  4X62 Q;  4A3D H;  4GKJ L;  1N32 L;  2YYZ A;  4X66 L;  1NJI C;  1P16 A;  1VQN A;  3PO2 H;  2MO1 A;  2I5M X;  2RCN A;  2K75 A;  2WB1 G;  1C9O A;  4IPC A;  1WCM G;  5ELO A;  3OW2 A;  4GN5 A;  2E2J H;  3ER0 A;  4DV6 Q;  2OWO A;  2Z6K C;  4AYB G;  4LF5 Q;  4NPS A;  1VQ7 A;  2E5L L;  1YHB A;  5M3M G;  4DR3 L;  4JBJ A;  4MNO A;  5LMU L;  1KIX A;  2QGQ A;  3FHW A;  1JB7 A;  4ALP A;  3I55 A;  4JI6 Q;  1A0I A;  4POG A;  2UUC L;  4C3I H;  2RHQ B;  3RZO H;  2KBN A;  1PVO A;  3S24 A;  1J6Q A;  3VDY A;  4LF9 Q;  3ULP A;  5H1S E;  4JG2 A;  1RL2 A;  3TRE A;  4LFB L;  3MXN B;  3CC4 A;  1YJN A;  3S14 H;  4LF8 Q;  1Q7Y C;  5GAG C;  1WFQ A;  4GOP B;  1IBL Q;  2R7Z H;  4A3B G;  1VQE A;  3HOZ H;  5AJ3 Q;  3HKZ E;  1G29 1;  3BU2 A;  2RHS B;  1Y1W H;  2EXD A;  2Z6K A;  4PZ6 A;  4IOA A;  2XTI A;  2R93 G;  5GAE C;  5C4J H;  3GD7 A;  1IZ6 A;  1HH2 P;  1X56 A;  2YTX A;  4FDB A;  4DV1 L;  2I0Q A;  1N33 Q;  2UXC Q;  2YTY A;  3J80 c;  2R92 H;  2GN5 A;  1HNW Q;  4B3M L;  4NXM Q;  2JA7 H;  1VQM A;  1XNR Q;  1FJG L;  2JA6 G;  4JBW A;  4GKK Q;  1CKN B;  1DGS A;  4A3G G;  3HOX G;  5JEA J;  3CME A;  3S2D H;  3PGZ A;  4B3R Q;  4LUV A;  2GVA A;  3CCS A;  5C0X I;  3PIP A;  3CW2 C;  4LWC A;  4YHH Q;  4A3C G;  4J15 A;  1LUZ A;  3HOV H;  1FGU A;  4L5Q A;  1VQO A;  4PG3 A;  3J7A 5;  4DR4 L;  3L0O A;  1G6P A;  4MZ9 A;  3EN2 A;  3CQZ H;  4QQB X;  1A8V A;  4LFC Q;  4A3F G;  1KL9 A;  1VQC A;  2BA1 A;  1C7Y A;  4APV A;  4RG1 A;  3UDX A;  2NZO A;  4LNQ A;  3DLL A;  1KD1 C;  3UDF A;  1UE7 A;  2WAQ G;  1EIF A;  2UUB L;  2HIX A;  2OQ0 A;  4DV6 L;  4GNX C;  1CSP A;  1VQ9 A;  4NXN Q;  4LF5 L;  3AEV A;  5IYB H;  3A0J A;  2ZTC A;  5IP7 H;  1R9T H;  1IL2 A;  3RZD H;  4O0A A;  2ASB A;  2K5H A;  4AH6 A;  3K7A H;  1IBM Q;  1QVG A;  4A3J H;  3RLN A;  1VQF A;  2YV5 A;  4LF9 L;  4GKJ Q;  5DLQ E;  4OO1 G;  4KLK A;  4O2D A;  3EIV A;  2UUA L;  3TS2 A;  1YEZ A;  3ZJY C;  3GTM H;  2PQA A;  2WFW A;  5FJ8 H;  1XTD A;  3GTK H;  2E5L Q;  4DR6 Q;  1L0W A;  5AJ3 L;  4GNX A;  3PIO A;  2DUD A;  4JV5 Q;  2GVB A;  3CCJ A;  3K8A A;  4BBS H;  1OXT A;  1JE5 A;  1X65 A;  2UUC Q;  1IXR A;  3CCM A;  2UXC L;  3FP9 A;  1N33 L;  1FL0 A;  2JA9 A;  4X65 Q;  2CWA A;  1S72 A;  4BA1 I;  1HNW L;  4NXM L;  2ID0 A;  5C44 G;  4LFB Q;  4H02 A;  1XNR L;  4QJF A;  1NE3 A;  2QA4 A;  4GS3 A;  2HIV A;  1GO3 E;  1VQK A;  1KAW A;  3J81 i;  1Y1V G;  5IP9 H;  1TWF H;  1VQB A;  5FLM H;  1PH9 A;  3HOY G;  4DV3 L;  1HZC A;  1PH2 A;  4B3S L;  1XJV A;  4JI1 L;  2JA8 G;  3OTO Q;  2B63 H;  4DV1 Q;  1GKH A;  2VY3 A;  3J81 j;  3CF5 A;  5K36 G;  3SGI A;  3AQQ A;  1Q46 A;  2CKZ B;  1E3P A;  2NN6 I;  1K73 C;  5BR8 L;  4XTC S;  4A3D G;  2AHO B;  1FJG Q;  3M7N A;  1TWH H;  4A3E H;  4BA2 I;  2A1A A;  3RNU A;  2JEB I;  4YCV A;  1PH8 A;  1EUJ A;  4K0K L;  1OTC A;  4JI0 L;  3KDF A;  3KJP A;  1M90 C;  4A75 A;  1AE2 A;  4WJ4 A;  1L1O A;  2VUM H;  3AFP A;  3PUV A;  1N36 Q;  4IO9 A;  3S15 H;  4TQU S;  4P72 A;  2PI2 E;  1IBM L;  2E8G A;  4DUY Q;  2ZTD A;  2N3S A;  1YJ9 A;  4DR7 L;  1UE1 A;  3F2C A;  3KF8 B;  4BBR H;  3NBH B;  4IPD A;  4IFD I;  2I5H A;  1SFO H;  4QL5 A;  4X64 Q;  2UUB Q;  1I6H H;  1HNZ L;  1EWI A;  4GN4 B;  1I3Q H;  5C4X H;  4DR6 L;  3KYH C;  5M5Y H;  1VQD A;  3M3Y H;  1S3O A;  4AYB E;  1HZA A;  1Y14 B;  2R7Z G;  1EFW A;  4BY1 H;  1E7Z A;  3HOZ G;  1Y1W G;  2R7F A;  4JV5 L;  3KF6 B;  2BH2 A;  2ATW A;  1QVC A;  1U0L A;  4B3T Q;  3A74 A;  1KRT A;  4KHZ A;  3HOU H;  4X65 L;  1VQ5 A;  2VL6 A;  4JCV E;  2C35 B;  1BVS A;  2H5X A;  3M4P A;  5GAH C;  3EBE A;  2UXB Q;  4LUO A;  3MEF A;  2UUA Q;  3I4M H;  5ELN A;  1LYL A;  1S40 A;  3OYY A;  4JI8 L;  2Q2I A;  4DAY B;  5IE8 A;  4GLX A;  4LW1 A;  2Q2U A;  4IOC A;  1D7Q A;  3JAM i;  1W2B A;  5M5W H;  1JJG A;  1JJC B;  3A5U A;  1YIT A;  1PH7 A;  2NVQ H;  2YU9 H;  3M4Q A;  2Z0S A;  2BH8 A;  2K4K A;  2MO0 A;  4LFA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...