5C3EG

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c3eG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c3eG01
4WJ3M 3JAMi 2BH8A 2V1CC 3U4ZA 4A3LG 1NMFA 2YV5A 4JG2A 4B3RQ 3UDGA 1PH1A 4BBRH 3RN5A 2YU9H 4R4QA 3SGIA 1VQCA 4LF8L 3U4VA 1VQBA 4C3IH 1X9NA 3CCUA 1A0IA 2A19A 1HZCA 4JOIC 4TQUS 5FJ8G 2EIFA 1QVGA 2K5VA 1N34Q 1G291 3HOXG 1HH2P 3S2DH 2VQFQ 3S1NH 4JI3L 5IWAQ 2UXCQ 2K14A 4BBSG 1PH3A 2B63H 3PO3G 1I6HH 1EIFA 1HNZL 3LGJA 3AEVA 4PMWA 1CKOA 1YEZA 4UP9A 1U0LA 1VQ7A 4DUZQ 5J3BA 2HHHQ 4LF5Q 3M4OH 4K0KL 3PV0A 2NVQH 2ZM6Q 1E1OA 3I4MG 4Y52H 2NVXH 4DR1Q 3I4OA 4LF5L 5K36G 2OQKA 2WB1G 4GNXB 3AQQA 4MZ9A 1HR0W 2RHSB 4A75A 4DR6L 5M3FH 4A3IG 1YIJA 2R7FA 2N78A 4HJ5A 2Q2IA 2LSSA 3G71A 1GKHA 4JI7L 4R4TA 3M4QA 1PYBA 4YWKA 4POFA 1I3QH 2Z0SA 3T1YL 3RNUA 3UDIA 1VQDA 4DR4L 2JA6G 3G48A 1SE8A 2IHFA 4LWCA 4DNIA 3H15A 4DR2L 1PH9A 4L5TA 1K9MC 4GKJQ 4DAMA 2WB1E 3FHWA 4PZ7A 4PG3A 2R6GA 2I5MX 1BKBA 2K5HA 4LF6Q 1IXRA 5M5WH 4IOCA 5C0XG 3E9IA 4FDBA 4JI2L 3TEHB 4JI6Q 4JBKA 4DAYB 2R7DA 5C0XI 3CCMA 1VQLA 4O2DA 5C0XJ 3CPWA 4DV6Q 1X65A 1VQ9A 1LYLA 5C3EH 3HOVH 1JJGA 4DK6C 2PMZE 3F1ZA 5H1SE 3MEFA 1KHIA 1UE1A 4DV2Q 3GTPH 1PA6A 3UE1A 4X66Q 1G51A 3KYHC 3CC7A 4DV4L 1K0RA 3HOUH 2AMCB 4GN4B 4P74A 4IPDA 3PF5A 4NPSA 1SFOH 4AIMA 1VQ6A 3CCEA 4LFAL 4DKAC 3PF4A 4GLVB 4A3LH 1FJGQ 4PZ6A 1HNWQ 2Z6KA 1T9HA 1YHBA 4OXPA 4NXNQ 5E7NA 2UUCL 4LFBL 1FL0A 2VL6A 1EUJA 3CP0A 4EX5A 4DV3Q 2JA5G 2B3GA 3AYHB 4DR7Q 3BZCA 4NXML 2UUCQ 1CSQA 1NMGA 2HQLA 3AFQA 3ULLA 4GKKQ 4IFDJ 1VCIA 1UE6A 5GAHC 1YJ9A 3CC4A 3HKSA 3B6YA 4JOIA 4OONA 3I56A 4OWWB 4NXNL 2Q2HA 1VQ5A 3W1BA 4RMFA 1VQJA 5LMNQ 2YTXA 2ASBA 1I94Q 3K80C 3BJUA 4AH6A 3F2CA 4A3JH 3J7A5 2JEAI 4L5QA 3DLLA 4HIKA 1M1KC 4X64L 2PI2E 4X65Q 2PQAB 4KI0A 3D31A 4A4IA 2AHOB 1S72A 1PH2A 4HJAA 3EN2A 1V43A 3HKZG 3T1HL 1YBYA 2HT1A 3I4MH 3ERSX 2CKZB 2ID0A 1WOCA 3STBD 4JYAL 1W3SA 4DV0L 1L1OB 4DUYL 1SLJA 5HY6A 1MKHA 4B3MQ 4C3JH 1GD7A 4LUZA 3HOWH 3F2DA 3IRBA 3NBHB 1K73C 4JC0A 3T1HQ 1K8AC 4BY1H 1G6PA 4LUOA 1AE3A 3U50C 3CMAA 4GOPC 4A3CH 1N33Q 1E3PA 2BA0A 2KCTA 3PUXA 3J80i 1CUKA 3UDXA 5IY0A 3S15H 2JA9A 1IZ6A 1XMOQ 3CCQA 1OXXK 3PIPA 4A3KH 3GO5A 3A5UA 2OWOA 4A93H 1WJJA 3L7ZC 2CFMA 4GLXA 1C0AA 4KHZA 3CQZH 2NN6I 1XMQQ 2R93H 2UXCL 1NBWA 2F52A 3GTOH 4JI3Q 3FKIG 2A1AA 1KQSA 1GVPA 4OX9Q 4C2MH 4JV5Q 1X3FA 5GROA 3MXNB 1QVFA 5AJ3L 3NEMA 1YHQA 1YZ6A 1B70B 4R4IA 4YWLA 5JEAJ 2VW9A 1KIXA 3M9BA 3PUVA 1KXLA 1L0WA 4HIOA 5IYBH 1MIUA 4JI2Q 3HOYH 1TWCH 4LF8Q 3S17H 4YY3Q 4R4CA 2YTVA 1IBMQ 2UUAQ 1NTGA 1Q8KA 3S1RH 1IBKL 1VQ8A 2PNHA 1D7QA 1Y1VG 3KFUA 1ASZA 4P73A 1QUQA 2R7ZG 4QGUA 3M4PA 4P75A 3GTMH 1A63A 4ALPA 4LW1A 2UU9L 3HOWG 1SROA 4X62Q 2JEBI 3VDYA 1Z9FA 4QIWE 5M5XH 4O0AA 2VQEQ 1CKNA 2K4KA 4HIMA 3OYYA 4JI6L 5ELOA 4C3HH 1OTCA 4DV6L 1RL2A 2JA7G 2VUMH 3PO2G 2RHQB 3PO2H 4HJ8A 4DV3L 2E2IH 3H0GG 2E5LQ 1BVSA 4UY8C 3GTLH 1B7YB 1FVIA 5M3MG 1TWHH 4A3DH 5BR8Q 1YITA 1N36L 1XJVA 2AWOA 5JJKA 1LUZA 4XIGS 1W2BA 2XGTA 3CW2C 2AKWB 1HR0L 2OTLA 4GKKL 4GKJL 4AYBE 1JJCB 2Y0SG 1EYGA 4BY1G 1XNQL 2WFWA 5C3EG 2E2JH 1X56A 4YCVA 1VQKA 2F4VL 1RIPA 1AE2A 3CF5A 4BA2I 4BXXH 1AH9A 1CKMA 1TXYA 5C4XG 1EIYB 3L0OA 3U58A 4X6AH 2IY5B 1L1OA 4YHHL 3NELA 4HJ9A 5IYDH 4DR5Q 1KRTA 1LTLA 2Y0SE 2CQOA 3GDEA 2R92H 4X66L 1TWGH 4A3BG 4HJ7A 1YJWA 2MO1A 1N33L 2FXQA 1PFSA 4QL5A 5IP9G 2QGQA 4JBJA 4UP7A 1XNRQ 2K75A 3E9HA 4LUVA 3F2BA 4JI0L 1XMOL 2I0QA 3KDFB 1IBML 1KC8C 3TQYA 4QY7A 1Q1BA 1NJIC 4UPAA 2H5XA 1Y1WH 2E2HH 1EQQA 2ZTEA 2VY3A 2MNAA 3H3VH 3FP9A 4A3KG 1HZAA 1JMCA 4DV1L 1X55A 2JJQA 5EAYA 1XPOA 2DUDA 4A3MH 3GTKH 4X62L 1KD1C 1PH6A 1OXTA 1VQPA 5IE8A 2VZAA 2JA8H 4JI8L 3A5ZB 4A76A 4A3DG 2RF4A 1O7IA 3UDFA 5FJ8H 2XTIA 4DR1L 4OO1I 3GTGH 4R4OA 4IOAA 1GM5A 3CMEA 4JBWA 1PH8A 1SMXA 3HFZB 5LMUQ 3D0FA 3S1MH 3WWVA 1XNQQ 1KL9A 3J81j 3K7UC 4P72A 5LMNW 1HJPA 1SR3A 2HIXA 4GOPB 1Q81C 1HNZQ 2JA8G 2NVTH 2R7ZH 3W1GA 2UUBL 2HHHL 2LXJA 3I7FA 4IO9A 1VQFA 3RLOA 3TS2A 4A3IH 2PQAA 3NENA 5IWAL 4A3FH 1M90C 1L1OC 3HOVG 1SN8A 5IP9H 2E5LL 4IPGA 4GNXC 1FJGL 2NZHA 1C9OA 2JE6I 5LMUL 4DUYQ 1S40A 3CD6A 4BY7H 3KJOA 4LF9L 2OCEA 3KF6B 5IYDG 1HNWL 2UXBQ 2UU9Q 4JI8Q 3KLWA 3S24A 1TWAH 4DR3L 1WYDA 1WFQA 1XTDA 4JI1L 4A3EG 2VQEL 2HIVA 1XPUA 4DR3Q 5HGQA 4AQYL 3J80c 1J5EL 1DGSA 4LF7L 4DV2L 3I55A 1X54A 2JA7H 3EIVA 4DV1Q 4JI4L 1HZBA 3CCVA 1JT8A 1JB7A 1IBKQ 2OTJA 4B3SL 1VS0A 3PSIA 1VQHA 4DV7L 4QQBX 2DGYA 4NXMQ 2KHJA 3BZKA 2IX1A 4P71A 2A8VA 2N8NA 1PYSB 1Y14B 3A0JA 2IX0A 5AJ3Q 3CC2A 4BA1I 2B63G 3PO3H 2D62A 3M7NA 1I50H 1VQIA 3AFPA 4IJHA 1P8LA 4JCVE 4EQ5A 4DV5Q 2I5HA 3OW2A 3RN2A 1VQMA 4JI5Q 1N32L 2CCZA 2ALYB 3T1YQ 1HNXQ 2K5NA 1MJCA 3K8AA 4DR4Q 1XMQL 4GOPA 1YJNA 1HNXL 2JQOA 4XTCS 2QEXA 4DPGA 2B29A 4DUZL 4B3TL 4YWMA 4GN3B 4A3GH 1QZHA 3RZDH 2KHIA 2BH2A 3ZJYC 1JJ2A 3Q8DA 2ZJRA 2BA1A 4B3TQ 2RCNA 5IT9c 1Q7YC 2F3IA 5FLMH 1K3RA 1SRUA 2JA6H 4GS3A 4J15A 4IPHA 3FKIH 2ZJPA 4NB3A 3F8TA 2F4VQ 3G4SA 1Y1VH 4OWTB 3G6EA 3BU2A 4DK3C 1N34L 2N49A 4LFCQ 1IBLQ 1Z47A 2KBNA 5IYCG 2R92G 1NY4A 4MTNA 1X3GA 2VQFL 4DV0Q 4A3EH 4POGA 3HOZH 1CSPA 1JE5A 4DV7Q 4B3ML 5GADC 3S14H 2UXDQ 4IJLA 4R1JA 1YI2A 4IPCA 1IL2A 3KF8B 2MQHA 5BR8L 5IYBG 1N36Q 1QZGA 2WP8J 2K52A 4QJFA 4L5SA 4X64Q 4JYAQ 2EXDA 2ES2A 1EQRA 2GN5A 2VNUD 4JI0Q 1YHAA 4JBMA 1VQOA 5FLXc 1J5EQ 4APVA 3S1QH 1Q12A 1PHJA 1WCMH 2K50A 1PH4A 2D0PA 1I5FA 3KOJA 3CCJA 1R9TH 3OTOQ 5C4JH 1U5KA 2R93G 3PUYA 2JK8A 2KENA 2E8GA 3RLNA 2UUAL 3E0EA 4IFDG 1OXUA 1B8AA 3TRZA 3M85A 1GO3E 1NE3A 1OXVA 1P16A 1TWFH 2CWPA 2N3SA 1Q82C 4GLAC 3CCLA 4LF4Q 2C35B 3UE0A 1VQNA 1EWIA 2UXBL 1A8VA 4H02A 1UWVA 3TREA 2ZM6L 4LF6L 3GD7A 2MO0A 2VUMG 1E7ZA 1D8LA 2WAQE 2UUBQ 2ZTDA 3H3VI 4OO1G 1S3OA 3S16H 4X65L 2QA4A 1Q46A 5C44G 3M3YH 1IYJB 2YYZA 4IFDI 3GTJH 2PI2A 3J81i 1K8GA 1QUQB 1C7YA 2NN6G 2NVYH 3ICEA 4DR7L 3JC66 1E22A 1UE5A 1KAWA 4PZ8A 3PUWA 4DV4Q 5GQOA 2Q2UA 5IP7H 4KHPQ 1X3EA 5GAGC 2WAQG 3CCRA 3HOZG 4LFAQ 2AWNA 3HOYG 1VQAA 3RLFA 3EBEA 3OTOL 4A3FG 1A62A 5JJLA 1HZ9A 4A3BH 3ULJA 2I5LX 4Y7NH 3K81C 2ZJQA 3A74A 5FLMG 1N8RC 2L15A 4ME3A 2CWAA 3J81c 2GVBA 1XPRA 2NZOA 2JA5H 2OQ0A 3H0GH 1N9WA 3ULPA 4DR2Q 1PH7A 2ATWA 5IP7G 2IHEA 4UP8A 2VS1A 1YNXA 3KF6A 5M3FG 3HOUG 4YY3L 1YVCA 3PIOA 4BBSH 3PGZA 1XNRL 1QVCA 1WI5A 1MJEA 1LM0A 3K0XA 3W5OA 1KRSA 4LFCL 4A3MG 4L5RC 4BXXG 4DR6Q 4A3CG 1IBLL 2YTYA 3CPFA 4JI7Q 1EFWA 4OX9L 1PV4A 4JV5L 1Y1WG 4YHHQ 1EOVA 1BBUA 1FGUA 4BBRG 4YCWA 5JEAG 4DR5L 4KHPL 1UEBA 2LXKA 4LF9Q 3ER0A 3J7ZC 3KDFA 4YCUA 5GAEC 5ELNA 3CCSA 1V9PA 1VQEA 3GTQH 3K7AH 1E1TA 3TS0A 4K0KQ 3HKZE 3S2HH 3PCOB 4RG1A 4DV5L 3RZOH 3DM3A 3KJPA 4MNOA 4JI5L 1N32Q 3CAMA 4GNXA 2Q2TA 4HIDA 4LFBQ 1J6QA 3JAMc 1WCMG 2GVAA 4JI4Q 1CKNB 1BBWA 2IT1A 1HR0Q 2Z6KC 5M5YH 4LF4L 4A3JG 1K83H 1L2FA 2MFIA 4KLKA 4A3GG 1H95A 1V1QA 1VQ4A 4AYBG 3PUZA 4OWXB 3I4NG 4LNQA 4B3SQ 1PVOA 4GN5A 3CXCA 4WJ4A 3I4NH 2D0OA 3STBC 4BY7G 1OXSC 3L2PA 1ASYA 1PH5A 5JJIA 4JI1Q 1Q1EA 4B3RL 3I2ZA 1E24A 5C4XH 5IYCH 1UE7A 4AQYQ 2ZTCA 1VQGA 5M3MH 1X6OA 3HOXH 5LMNL 1Q86C 5DLQE 4LF7Q 5C44H 4TVAB 1I94L 2KCMA 2UXDL 2EQSA 3RR5A 4A93G
chains in the Genus database with same CATH superfamily
5G3LD 1TS4A 2BH8A 2FB9A 1I50A 4B3RQ 3U9OA 4YR3A 3RB3A 1EEID 5JEAH 4OELB 3FPUB 1VQCA 2NYZD 3U4VA 1HA6A 1ZXTA 4TQUS 1N34Q 1EY9A 1AZPA 2FMMA 1X3PA 3MZ5A 2UXCQ 2K14A 4BBSG 2W9CB 1K28A 1VAJA 4CC6A 3LGJA 4PMWA 3M4OH 5J3BA 2IW3A 4K0KL 2PZTA 4Y52H 3I4MG 5C5LA 4U68A 1SYEA 4DR1Q 5C44B 4LF5L 1UEAB 2EYPA 5K36G 1KC7A 5BR8H 3AQQA 4A75A 3MFGA 3NSWA 3JAMW 3R5FA 3NUCA 4JI7L 5KG4A 1A3UA 3GIKA 1T3NA 5E4WC 4POFA 1I3QH 4K2LA 3T1YL 5D3DA 1FD7D 1ULZA 3LX0A 4RUCA 2BQRA 4C3IB 4DNIA 5KYIA 4RUAA 1PH9A 4L5TA 3HOYB 4DR1H 1EYZA 1CQIB 3FHWA 5F2DA 3NP8A 1RJPA 3OOCA 3KAJA 4AQYH 1BKBA 1IXRA 1Q8IA 4IOCA 4B3TH 2SNMA 4JBKA 2R7DA 3LWEA 1VQLA 4DV6Q 4X3KA 1X65A 5C3EH 3H0GB 2CH4W 1JJGA 3PN1A 3F1ZA 1QJOA 4HCSA 5H1SE 3EYYA 4O3RA 1PA6A 3KAKA 1MI2A 3HOUH 1SJED 3I72A 4GN4B 5JVH3 1N36H 1SFOH 3H91A 4AIMA 5IWAH 4QW9A 4PWQA 2NU8B 2FLLA 1RJTA 1FJGQ 1HNWQ 2UXDH 2Z6KA 2NVXA 1Z6HA 1RODA 4YR0A 2FP4B 4FM9A 1FL0A 2VL6A 1EUJA 3CP0A 4QWEA 3TZDA 3AYHB 4DR7Q 1NR2A 5IT9E 1JKJB 4ECUA 4PMBA 5EZYF 3SDZA 1VCIA 1JIHA 3T5JA 2RGRA 2X6LA 4CDEC 5FOBB 2F0QA 2ATLA 2R7NA 2JA7B 1YNJC 4ABNA 1TWGA 3HKSA 3B6YA 2GA4B 3RUPA 2IBKA 3EVQA 4ZKBB 5COYA 4ED8A 5L1JA 4RMFA 3C3LA 1VQJA 5LMNQ 2ASBA 1I94Q 3K80C 4AH6A 1KDBA 1T5EA 3J7A5 3DLLA 5C4HA 1M1KC 3DF7A 3G6XA 3F8NA 1DJRD 1HQMC 4ETSA 5KFNA 4JI5H 4HJAA 4F87A 1IBMH 3OSPA 1G2TA 1YBYA 2R61A 3I4MH 2XCPA 2CKZB 4OL7A 2SEBD 1SCUB 5KG5A 3D3RA 4MHEA 4DV0L 1GSHA 1L1OB 1I94H 5HY6A 2FMCA 3T56B 1L2ZA 2FK1A 5ISRA 5KG7A 1LT5D 2X0SA 2R84A 3SR1A 1SYDA 3U50C 1AE3A 4XDXA 4EG0A 1I3QA 1C3OA 4IALA 3UDXA 3MFYA 1LABA 4RHSA 2HGSA 4A3KH 5DG7A 3OW7A 2OWOA 3PW2A 3CVZA 4P2CB 2XGQA 5JVG3 1STGA 2W70A 3JAME 2NN6I 1CK1A 1SNCA 2WINB 1EZ6A 1Y8PB 1DONA 4OX9Q 4L63B 3Q1KA 4RHRA 1QVFA 3DHQA 1I4XA 5AJ3L 1B04A 4DR5H 4JV1A 4LF9H 1YZ6A 2EY2A 4YWLA 3JZIA 4RAUC 3GIMA 1S0MA 3DEOA 3U9TA 2IX3A 4JI2Q 5IYBH 3Q23A 2CQYA 4LF8Q 1TWFB 4QUFA 2ZXRA 3ITPA 1IBMQ 3HKZB 1NTGA 3BQ0A 3ORQA 1EIGA 1IBKL 3S2HB 2PW7A 3O13A 2J6UA 3VR6A 1ASZA 1GSOA 1S5BD 2WIIB 1M0TA 3M4PA 3GTMH 4LFBH 4LW1A 5E3FA 3J80L 2NWGA 2PCFB 2VQEQ 4UCTA 3TN2A 2K4KA 3KTMA 5ELOA 5CV6A 4C3HH 1OTCA 4YB8B 2VUMH 4I7AA 5C1PA 1SE3A 1JOQA 5DM73 3HEJA 2W6OA 3J80W 4EFEA 1SYGA 1B7YB 4EVOA 4A3DH 1DIKA 5JJKA 4XIGS 1DOMA 2M05A 2OTLA 4RNNA 1W93A 5IT9W 4GKJL 4AYBE 4R8UA 4U6PA 4BY1G 4YCVA 4FBTA 3GIIA 1LTAD 3V96A 3GTOB 3X3MA 1AE2A 3CF5A 2KOLA 1CKMA 1TXYA 1JDBB 4ZUJA 4OEMB 4RA8A 2IY5B 5FO8B 3NELA 2MUYA 2VPSA 1KRTA 2JA8B 3GDEA 2YL2A 2FMAA 4A3BG 4CJ1B 1EWCA 3VR2A 1N33L 1V51A 2FXQA 4MV4A 3H6MA 4YY3H 1J9OA 3KBGA 2EY6A 1HTPA 2QCPX 4OIJA 2J7ZA 3F2BA 2RSOA 3M9MB 1HNXH 5K5PA 3RIZA 4IURA 1IOVA 1PX2A 2C28A 5JQWA 2H5XA 3RV3A 5KFFA 4DL6A 2MNAA 2W6MA 4EBDA 1TWAA 1B53A 1X55A 5EAYA 1XPOA 1CQJB 3T5KA 3QJYA 2QILA 1TAEA 4J9QA 3PQIA 1QB5D 3KLRA 4X62L 1TWHA 5KT5A 1VQPA 3BAAA 2JA5A 3GTPB 5KFBA 3BYTB 3A5ZB 5FJ8H 1M4VA 2Q8IB 1OO9B 4B3MH 1SNQA 3VR4A 2G5DA 1TWAB 2H1EA 3IKJA 5I4DA 3E3XA 2YZGA 1SMXA 3CHBD 3HFZB 2PPBC 2F0JA 3S1MH 4DV2H 1PLFA 1HHVA 1EIHA 5LMNW 4GOPB 1HJPA 1SR3A 2E76C 2R7ZH 4QW8A 2HHHL 2V58A 1DZ1A 1VQFA 2EJMA 4WFN3 2DZDA 2JN4A 4O3OA 5IWAL 4A3FH 2E5LL 5M5XB 4GNXC 1SFOB 3CD6A 1C9OA 1KJ8A 1H9JA 3NBHA 2XCAA 1X32A 4FF1A 2BCOA 2BE5C 1B9NA 1HNWH 1FJGH 4H13C 4A2AA 3BVGA 3P1HA 5KFMA 3KLWA 5CV7A 5L9XA 4FF2A 3MWDA 2Z4IA 1DCZA 5IGCA 3JRWA 4EGVA 3GTQB 3TP6A 2EY1A 5A2QL 2VPQA 2CZGA 1DGSA 1B3AA 3H4DA 2CVRA 2JA7H 1STYA 1HZBA 3FMAA 5KFRA 1J5EH 2ZDQA 2OTJA 4XQJA 4B3SL 2IA6A 3H20A 4QQBX 1GHKA 1PYSB 3A0JA 4TRDA 3HOWB 2D9UA 4TV9F 2B63G 3PO3H 2XWJB 3VR5A 3M7NA 4DV5Q 3AFPA 2E2IB 3GQCA 1N32L 4FF3A 4DXGA 1VQMA 4JI5Q 2CCZA 4ECYA 2ALYB 2AGPA 4DFAA 3K8AA 1HFGA 2EDGA 2F0UA 3GIQA 1BR9A 4YWMA 4GN3B 1QZHA 3RZDH 2KHIA 2BH2A 2XGPA 2NU7B 4JV2A 3SE0A 2C9OA 2KJXA 3SK6A 2F3IA 1EZ1A 1SRUA 3VA5A 4J15A 4GS3A 1TT2A 3D6WA 4NB3A 4OWTB 2MPMA 4IZOA 2N49A 2PYKA 4LFCQ 1LTID 2KBNA 2R92G 1NY4A 4MTNA 2VQFL 3NTKA 4A3EH 4POGA 1JORA 5CV9A 1CSPA 1TY0A 4B3ML 1D2BA 5GADC 3S14H 4GC6A 5KG0A 1YI2A 1IL2A 2B8FA 5BR8L 4YIJA 4X64Q 4JYAQ 3RAQA 2F0WA 1YHAA 1VQOA 2F3WA 3V05A 2F0KA 3SXHA 1PHJA 4HSPA 2K50A 3V2TA 1ICWA 4Q5VA 1K83A 2QF7A 5C4JH 4KMUC 4EFBA 3Q8QB 2B2VA 3HG9A 2RDGA 3TRZA 3KK7A 1PRTC 1NE3A 1TWFH 2RSNA 3VMMA 4GLAC 3CCLA 1LTGD 1F2YA 1VQNA 2YCHA 1UC8A 4Q8FA 2B39A 5I2YA 3TREA 3HP3A 5BN5A 5LXTF 4OO1G 3M4OB 1S3OA 3BA9A 1DOLA 2EYMA 2M00A 4O42A 5FK9C 3GTJH 1DV1A 2PI2A 4K6LA 3QOLA 1CHPD 5D1PA 4KTAA 3ICEA 2NVYH 1RJRA 2R7LA 4O3QA 1XNQH 4C5CA 1QCBD 3PUWA 3C0FB 4R8UB 5JPMC 1WTHA 4R8NA 3HOYG 2EY5A 5CBEE 1RTNA 4Q45A 3OTOL 4A3FG 1HZ9A 3ULJA 1UNNC 2JYOA 4J0MA 5FLMG 1RK5A 3NHHA 5NUCA 1BF4A 2ALZA 1JR0D 4RGTA 2W57A 1EZ8A 5D14A 4JI1H 2AQ3B 3QO2A 1S0NA 3MVVA 3H0GH 1TY2A 5FLXL 4YJ2F 3ULPA 1IW7D 2BE5D 2Z9HA 1YNXA 2CW0C 4YY3L 2J6TA 1AUVA 2W9BA 1MJEA 5IGDA 3W5OA 4XX0B 2A6EC 4DR6Q 4A3CG 3DUZA 4JI7Q 4L1KA 4CGYB 3L4KA 1PV4A 3K57A 2AGQA 1L0XB 4BBRG 3MWMA 3TIGA 1JWUD 2LXKA 3FRPB 5ELNA 2P5ZX 1EHIA 3VPDA 5IGBA 3TS0A 4K0KQ 4DL5A 4RFBA 5KG3A 2A68C 2PMZB 3DM3A 3KJPA 3CAMA 2DPIA 2Q2TA 1TS3A 4JI4Q 1M8AA 2W6QA 2XVSA 3A7LA 1O7YA 1K83H 3OWEB 4OWXB 2F4IA 3VR3A 3S2DB 4XYLB 3STBC 2RCFA 1EY8A 5EQ0A 1TWFA 4JI1Q 4IUPA 2I80A 2HCCA 3SI8A 3FMCA 5IYCH 4JI4H 2W9CA 3VYTA 3HOXH 1VQGA 3I73A 1X6OA 5DLQE 4KKUA 4LF7Q 5KT7A 2WAQA 3EA6A 4TVAB 1I94L 2KCMA 2XSCA 2EQSA 4BBSB 3GTJA 3J81E 3NQIA 4WJ3M 3JAMi 4FP5D 5JAVA 4IWYA 1SYBA 2YV5A 3QIAA 3UDGA 5BPFA 4IUVA 2YU9H 4R4QA 1TIID 2WYOA 2WB1B 5C4ZA 2A68D 2NU9B 3CCUA 4JOIC 2R3ZA 5C3WA 2FJ2A 4F4YA 1KDCA 3S1NH 1D1KA 1GHJA 2RQXA 4M1UB 3NXWA 4J6HA 1S4ZA 1EIFA 1HNZL 3TZUA 1A3TA 1Q3LA 4LF5Q 4DUZQ 2ZDHA 1N32H 3HRZC 3PV0A 4G7HC 2HDMA 4GNXB 4DV3H 1HR0W 3V6HA 2RHSB 4I65A 4DXFA 3GTMB 1A9XA 4HSVA 4A3IG 1YIJA 3N6XA 4FXDA 3G71A 4R4TA 3M4QA 3VYRA 4YWKA 1EFID 4WJWA 3RNUA 1KJIA 4HNVA 1VQDA 4RGOS 1SE8A 2IHFA 4DR2L 1K9MC 3H15A 4GKJQ 4NP5A 1SE2A 2WB1E 3MFIA 3M9OB 3HOZB 2R6GA 4LF6Q 4DA2A 2XRQD 5C6AA 5M5WH 5C0XG 3K58A 5KFXA 4JI2L 2HVSA 4DAYB 2EPBA 3ND9A 3RZDB 3CCMA 5C0XJ 3DWQA 4F8MA 1F9QA 4UHVA 5CA0F 1LYLA 1HNZH 1BXTA 4MV8A 2W7OA 4ZAIA 4NXNH 3UE1A 4UAIA 4DV4L 4IWXA 1STNA 2J9GA 2YRWA 2AMCB 1IKMA 1K1QA 4NPSA 3R93A 1A15A 1IW7C 5I9PA 1Y8NB 1KJQA 1UAPA 4LFAL 3S14B 4XZ3B 2CW0D 3R2TA 2UVUA 3CU7A 3MXNA 5EGTA 4NXNQ 3RBDA 4DV3Q 4KY6A 5BPHA 3BZCA 2UUCQ 1NMGA 1F2LA 2JXMB 3AFQA 4TUYF 1TA8A 3TBIB 5KFUA 3Q24A 4RB3C 3GV7B 4N9PA 1ESRA 2K7VA 2Q8RE 4C3JB 4N9TA 2CW8A 1YJ9A 3CC4A 2VUMB 2SDFA 3OSOA 4JOIA 2PN1A 1SAPA 3NTHA 2L5TA 1KLGD 2Q2HA 4G7ZC 1VQ5A 2ASJA 3W1BA 2B2WA 2OT2A 4HR7A 2YTXA 2JEGA 3R2IA 3BJUA 3F2CA 4XT1B 3I4NB 3GILA 2PI2E 4KI0A 1S72A 4PQXA 1PH2A 2WE6A 1V43A 5IIFA 3T1HL 5EWEA 4M7EA 1HXYD 3R23A 3OMGA 3K5MA 4CDCC 3BQ2A 4JYAL 4NMZA 1G6ZA 5KT2A 1V4YA 1SLJA 1MKHA 1JXLA 3EFXD 5EPJA 5KFZA 2M9VA 2DNEA 4LUZA 3PW7A 3PIO3 5KNBA 2WKCA 4A3FB 2Y0SA 4IR9A 3FKIB 3W3AA 4B3RH 2F0IA 5ELFA 1K8AC 4I50F 3RD4A 1S0OA 3J80i 1JE4A 4FBUA 3QZ7A 5IY0A 3KLSA 1PXUA 1IZ6A 3TINA 1OXXK 1A6XA 3GO5A 2CFMA 1PTOF 1C0AA 4O3SA 2B2WC 3UFXB 1G2SA 2UXCL 4J9RA 2UVRA 1ZETA 4JI3Q 1XYIA 3FKIG 4AYBA 4WD3A 2RDHA 4C2MH 3BJYA 5GROA 4JI0H 5KFCA 1JB3A 3OTOH 4EEYA 1YHQA 3J7AV 1B70B 4R4IA 1KIXA 5JEAJ 2VW9A 1KXLA 1L0WA 1RHPA 1W6JA 4ECVA 1M0WA 4X62H 2Z1CA 3CRLC 4R4CA 2YTVA 3DM1A 4MA0A 2JA6A 1BDOA 1Q8KA 5EDWA 3J7YW 4XYMB 2F3VA 2IP4A 1S97A 1FNVA 1GYFA 5KG6A 3A7AB 4MN3A 2V9WA 2QYZA 4OO1H 2KEEA 3SK4A 1R9TB 4QWDA 2FLPA 2FINB 5FD6A 4X62Q 1RK6A 3RB4A 1Z9FA 3VA7A 5BN4A 5M5XH 2F03A 1S03G 1CKNA 2YZMA 4HIMA 2YRXA 4J9LA 4DV6L 2RHQB 5JPNC 2WAQB 3R8BA 3H0GG 2E2IH 3N40P 4UY8C 1L0YB 5M3MG 1XXGA 1M6VA 2BDNA 5FPRA 1XJVA 2AWOA 5H80A 2F0PA 3BVMA 3CW2C 1HR0L 4O2AF 2ICEC 1PFNA 1EYGA 2WFWA 1X56A 2EYLA 3MWEA 4Q44A 1RIPA 1S68A 1EIYB 1ILPA 4K6DA 1JDEA 1L1OA 4HJ9A 3EPIA 4DR5Q 1LTLA 1QG7A 2I87A 2R92H 1KEEA 1EY0A 5EKKA 2XN9C 5C3XA 4IN3A 3PO3B 5L1IA 4UCSA 4JBJA 1AP0A 3G7LA 2K75A 4JI0L 4IUNA 2I0QA 4A3DB 3KDFB 4F7XA 3LNNA 3RJ0A 1Q1BA 4LF5H 5HBRB 1NJIC 4RKBA 4UPAA 1PRTB 1Y1WH 5JVLA 2E2HH 2B2TA 3DEPA 3I12A 4A3KG 1WCMA 4EYIB 1HZAA 5CC4A 3IAYA 2K04A 1IYUA 1TR5A 3CQZB 2KUMA 4R9WA 5KFSA 5DQHA 2VXWA 2B2YA 2J4XA 4FO2A 1KD1C 4PV1C 2F0EA 2VZAA 3SVMA 2JA8H 4JI8L 1U9RA 3UDFA 1O7IA 1FGBD 2HVRA 3UQ8A 4DR1L 4OO1I 4K8JA 5KNCA 4BY1B 4RU9A 3UI2A 1SMYC 1SBBB 1MSHA 3WWVA 1KL9A 3J81j 1HNZQ 2A73B 2JA8G 4DN4M 3EROA 5ELEA 2XRSD 3RLOA 3WO0A 2FJZA 4A3IH 1HTLD 2PQAA 1M90C 2RKSA 3MEHA 1SN8A 5EKIA 2NZHA 4DUYQ 4BY7H 2NB0A 2KHSA 3KJOA 3OHBA 1IL8A 1E2ZA 4UCVA 2V4RA 5IYDG 2UXBQ 1R4QB 4M8AA 4JI8Q 3S24A 2UU9Q 1TWAH 2QDLA 1TKWB 1WFQA 1WYDA 4JI1L 4A3EG 3OIQA 2F0FA 2B63B 2NVYB 2IMWP 1AFPA 4DV2L 3I55A 1X54A 2B2TC 1CFMA 3DWPA 4J9KA 1AN8A 2SNSA 5CMDA 3CCVA 4GC7A 4BBRB 1LV9A 2SOBA 3GV3A 2PNRC 3I91A 4HNTA 3GQBA 4LFAH 1VQHA 3QR8A 2IX1A 4CBVA 3N42B 2A8VA 2IX0A 4KD3A 1R9TA 2D62A 1ET6A 4IJHA 1K8OA 1D5MC 4DF7A 3S1MB 1O75A 3T1YQ 3PW4A 1BBXC 5IT9L 1HNXQ 1MJCA 4DR4Q 2SCUB 4K14A 4IR1A 1XMQL 4CC5A 3MJFA 1QNKA 1HNXL 3RF2A 2QEXA 4DUZL 4B3TL 1STHA 3BVZA 2E2HA 3VPCA 4I4TF 3ZJYC 3Q8DA 2ZJRA 4O3PA 2BA1A 4B3TQ 2OF1A 2RCNA 5IT9c 1B2TA 1K3RA 1KNEA 2DY7A 2F0TA 4YBZB 3FKIH 2KCCA 5I47A 1MZBA 2UXBH 3G4SA 1IBLQ 1Z47A 5DNFA 5IYCG 4RH6A 4ZRZA 1RJQA 4IHJF 5K2MA 1SE4A 2JA7A 2F0LA 1C48A 1N36Q 2MGSA 3X3NA 2WP8J 1EY4A 1B50A 1WTXA 2VNUD 4J9PA 4CHTB 4LK1C 1HRJA 3MA2B 1GLVA 3T4AC 5FLXc 1J5EQ 1E4GT 4C2MB 3AMUA 2A6HC 1PH4A 2D0PA 3CCJA 1SNPA 3OTOQ 1RTOA 4YAJB 1U5KA 2N88A 5KFVA 2UUAL 2L11A 1OXUA 5J39A 1B8AA 2B8GA 1GO3E 3I8ZA 1OXVA 1S10A 4LF4Q 1R4PB 4ED6A 3FVQA 2UXBL 1SXTA 3FDTA 4RGMA 1D8LA 2EXZA 1GUSA 2WAQE 2YW2A 2ZTDA 2HVQA 4X65H 1ENCA 1Q46A 4G7OC 3A56A 3LMLA 5DG9A 1IYJB 1GOZA 4OGQC 3J81i 1NSNS 3N43B 1AW7A 1QOHA 1QUQB 1C7YA 2NN6G 5EWFA 3HBLA 4DR7L 3JC66 1RYSA 3R3OA 4YQWA 5A35A 1UE5A 4UDUC 4LSAA 5GQOA 2K01A 2K28A 2W7PA 2DJGC 4DL4A 2WAQG 5C4JB 2C00A 5JH7F 1GJXA 4RNMA 1WTWA 1HR0H 1VQAA 2WV6D 2W8LA 3RUZA 5JJLA 1A62A 3K81C 3A74A 4O3NA 3QB3A 1N8RC 3N44B 3QOJA 4ME3A 3GIPA 1K3BC 4ID6A 3GIJA 2HHHH 1I4PA 4R7RA 2JA5H 1U4LA 2OQ0A 4Y8VB 4HR7B 4XQNA 2IHEA 2VOBA 4UP8A 1Z2PX 3PR5B 5EJWA 1HFNA 3HKZA 1MSGA 4K2KA 1XNRL 4EYHB 1QVCA 5KFAA 3D4DA 3T51B 5C1OA 1A2TA 1LM0A 1SYFA 4ZI7F 4JV5H 1SFOA 4FVMA 1IBLL 4LH7A 2YTYA 3CPFA 3OIPA 1EFWA 2FKLA 4OX9L 4LFCH 1Y1WG 4YHHQ 1EOVA 1H9SB 4DLKA 2RBMA 1U4MA 1Q90A 4YCWA 4I7ZC 1WTVA 4LF9Q 2WDTA 3ER0A 5FKAC 3J7ZC 1YNJD 4RB0A 1I50B 3BYYB 3S1QB 1V9PA 5FD5A 3K7AH 4ECRA 3K3PA 1E1TA 5DGBA 1CTMA 1N48A 2EOTA 2W6NA 4RG1A 3RZOH 4JI5L 1ET9A 4GNXA 3IN5A 3ORRA 4HIDA 2Z4HA 2R8IA 4J1MA 1Z2NX 2X69A 2ZM6H 2IT1A 3RB6A 3T16A 4C5AA 4DR3H 4KLKA 1V1QA 1VQ4A 1PK8A 3I4NG 4DGZA 1PVOA 3GTOA 1KDAA 5HURA 4K5VA 2W6PA 3I4NH 2D0OA 3TDQA 3PO2B 4BY7G 3M4IA 5L1LA 3OWFA 1ASYA 1PH5A 3H0GA 3RMHA 2NUAB 5KFJA 1GUWA 1HPCA 4Q0FA 4K5WA 3QWNA 1I4GA 5M3MH 1IKLA 4GKKH 2E2JB 1SEIA 3RR5A 4X65L 5LYJF 1BXRA 4A93G 1IOWA 2QK4A 2V1CC 1LLRD 3U4ZA 2FPIB 4JG2A 4BY7B 4KKSA 1PH1A 5J2UF 5DQGA 4J8QA 1EYCA 3SGIA 4LF8L 1BQQT 1KJJA 1X9NA 4X66H 1A0IA 2A19A 4JI8H 2K5VA 1G291 3EJIA 4DK0A 1HH2P 1NR4A 3HOXG 3S2DH 2A6HD 3VPBA 4JI3L 4IRKA 1II3A 1ESFA 3MC0B 5KT6A 1PH3A 3N6RA 2B63H 3PO3G 1JWSD 5C5MA 1BCPB 4DNTB 1YEZA 4EQOA 1U0LA 1ZHQA 4CJ2C 5EOYA 2NVQH 2ZM6Q 1E1OA 2OQKA 4MZ9A 2PVPA 5M3FH 4TQSA 2R7FA 2N78A 3MTSA 2Q2IA 4RB1A 2LSSA 2L4NA 3EQLC 1JICA 1EY6A 3NWTA 2Z0SA 2MJ8A 3QFFA 3UDIA 1ENAA 4JI7H 2N55A 4LWCA 2V59A 1EUCB 4PG3A 3M3YB 4ZQ3A 2I5MX 2K5HA 2LMCB 4LF7H 1SDFA 4FDBA 3Q8PB 4XT3B 2F0MA 3TEHB 4CDDC 2RDFA 4JI6Q 4O4IF 4ECTA 5C0XI 1SEBD 2GLTA 1PZKD 4O2DA 3CPWA 1U4RA 4DK6C 1HA5A 2PMZE 2MP1A 1KHIA 3MEFA 1UE1A 4DV2Q 4X66Q 2LFNA 3KYHC 2VUMA 3CC7A 1K0RA 3MWYW 4P74A 2Y0SB 2R92B 1V1OA 2XNAC 1GSAA 5FO9B 1EU3A 3D4RA 3S1NB 1VQ6A 3CCEA 5AFWA 1HCZA 5D3IB 2DN8A 1GUOA 2X6GA 4GLVB 1E0BA 3JAML 2ASDA 3PIP3 5CAEB 3T5HA 1T9HA 3L4JA 1YHBA 4OXPA 1PTOD 4DUZH 5E7NA 2UUCL 4G3IA 4EX5A 5C4XB 3GTQA 4XXEA 3K59A 2NUCA 4NXML 1Y1WB 4IFDJ 2VB2X 2E2HB 2HQLA 3ULLA 3V4ZA 1PRTF 1GGOA 1UE6A 3RAXA 5GAHC 2R93B 3TP8A 4ZYSA 4FU0A 2RGVA 4YJ3F 1B9MA 4OHJA 1CT1D 3GV5B 2FLNA 2OXPA 4OWWB 4NXNL 5E1FA 2WB1A 2R7KA 2OH2A 1RF2D 2AQ4A 4QUCA 2EYFA 1EL0A 3SE7A 2K05A 1KABA 4JI6H 1RKNA 4X65Q 2K33A 2PQAB 5CA1F 2BQUA 3LP8A 2AHOB 3EN2A 4BWSC 3HKZG 2HT1A 2WKDA 3I70A 2PMZA 2ID0A 1SYXB 2DJFC 5KT4A 1NCVA 1W3SA 1QNUA 1RCVD 2F1MA 5M5YB 5CORA 1WR2A 3MHBA 2A74C 1MHWC 2Q8TA 4C3JH 3RGZA 4A3IB 2NTSA 3F2DA 2XIWA 4M9UA 2R8HA 3T1HQ 4BY1H 1G6PA 3MR2A 1XNRH 3CMAA 1LTRD 4C1NK 4A3CH 1N33Q 5KG1A 1E3PA 2BA0A 3PUXA 4GZYC 1W96A 3V6KA 5KFGA 3S15H 2JA9A 1XMOQ 3PIPA 4HNUA 3A5UA 2R7ZA 4A93H 1WJJA 2A5HA 3L7ZC 4DAYA 4KHZA 3CQZH 2W71A 3GLKA 1XMQQ 3AB9A 5LHY1 2IL8A 2VUGA 2C2EA 1H9KA 1KQSA 2A1AA 1F9RA 2NVXB 5KFDA 4JV5Q 1X3FA 2HCIA 2FFKB 3NEMA 3HZXA 3M9BA 2VA2A 1MIUA 5BN3A 3HOYH 1TWCH 4ECWA 4EGQA 3OUUA 4TQRA 1D7QA 2UUBH 4HCEA 4XQQA 3KFUA 4UFZA 2B2VC 4P73A 3TSSA 1IBKH 5JVDF 2UUCH 3WO1A 5EKLA 4ALPA 3K5NA 4JK1C 2XD4A 3HOVB 3VDYA 3H3VC 4Q0YA 4F4XA 3T1HH 2F0NA 3OYYA 3SHLA 4JI6L 4LSXA 2JA7G 4BS9A 3PO2H 4HJ8A 5CV8A 1XMOH 2E5LQ 4JVZA 3GTLH 1XDNA 3BG5A 5IOCA 5F9LA 1FVIA 3ONAB 4DL2A 5BR8Q 1YITA 1UUPA 3AU7A 1W2BA 1SNMA 1VDZA 2Y0SG 4IUUA 3IFDA 1QE6A 2RVLA 3K0YA 1EOTA 2E2JH 1VQKA 5KKNB 4JI3H 1CZGA 2F4VL 4BA2I 1AH9A 5KFWA 3JSLA 3MR3A 2J6SA 5C4XG 3S9WA 3U58A 4MV3A 1BOSA 2VR1A 1ONLA 1Z7TA 4DL3A 1SNOA 2OLSA 2DPJA 4J9OA 2CQOA 3A8KE 1TWGH 3A8JE 4HJ7A 5IYZF 1YJWA 1MBYA 2MO1A 2R6FA 1SYCA 5IP9G 3Q0AA 2PQEA 2QGQA 4UP7A 5A2QW 4TSSA 4FXKC 3CRKC 4ED2A 3KHRA 1XMOL 1WSCA 2I07B 3J80E 4ZOLF 1DM0B 4QY7A 4ECSA 3I4MB 4QWBA 4QIWA 5DG8A 1EQQA 3KALA 3RGXA 5M5WB 3H3VH 1KAAA 3FP9A 1O7ZA 5C8YF 4MTKA 2DNCA 1PZJD 2DUDA 3CQZA 5F9NA 4QWCA 5LMUH 1PH6A 3M4YA 5ELBA 5IE8A 1JLLB 4JW0A 4RCNA 4MV1A 2FHTA 4ZLTF 2RF4A 2PZUA 1SNDA 2XTIA 4A3JB 2IPKD 3GTGH 1GM5A 1EWHA 4MIUA 3CMEA 3PW0A 4K5XA 4B9WA 1PH8A 3S17B 4DV6H 2L0CA 5LMUQ 3S1RB 4NDXA 4PNYA 2NVYA 2R92A 3BDLA 2HIXA 1BCPF 2NVTH 4LH6A 5LMNH 2UUBL 3BA8A 4KN4C 3GTJB 1H9SA 2LXJA 3I7FA 4IO9A 4ED0A 3TS2A 1LTTD 1CQFA 2F0OA 5IP9H 1LTSD 4IPGA 1FJGL 1HNWL 2UXDQ 2JE6I 2EE1A 2EYHA 1I4HA 1F9SA 2K32A 1I4QA 4CKEA 3K5OA 4LF9L 4U673 2OCEA 2W9AA 1CE8A 3KF6B 2W6ZA 5KFTA 3GTLA 4MV9A 3T13A 1Y1VA 1B33N 3TP5A 3L9AX 1I6HB 5HGQA 3J80c 1GXDC 1J5EL 1RD9D 1Y8OB 4LF7L 3SK8A 2F0VA 1NAPA 3D4WA 3EIVA 2AGOA 4DV1Q 3GTMA 1TS5A 2KCNA 3BQ1A 3HB9A 1Y1VB 2FPGB 2DGYA 2KHJA 3BZKA 1I4RA 4G57A 2N8NA 3D8GA 1Y14B 1CA5A 5AJ3Q 3C1EA 4EQNA 3CC2A 3I4LA 1EU4A 4CJ0B 1I50H 4JCVE 3S1QH 4FYDA 1P8LA 4HTHA 1JT8A 3LWBA 4PDBA 3OW2A 2P0AA 2DIKA 5KX5F 1TWHB 1G8ZD 4WBNF 3PR4A 1WTRA 2K5NA 3K5IA 2F4VH 2JEIA 4HN7A 3P20A 1V8QA 5I2XA 3HXLA 2JSOA 1YJNA 2AUJD 5M3MB 4XTCS 4JI2H 2HUGA 1I7NA 4Z9CB 1FNWA 4A3GH 3HGBA 4IRDA 5IGFA 5FLMH 3ZYYX 2JA6H 4IPHA 2ZJPA 3G6VA 1CZWA 5I6WA 3JSNA 2F4VQ 1VF5C 5CV5A 5EPKA 1EUDB 2F0GA 4DK3C 2A69C 1N34L 2V5AA 4DV4H 4APMA 1X3GA 4DV0Q 1TVXA 4N8X1 3IG0A 1JE5A 4KY5A 4DV7Q 1CHQD 3K7AB 4IJLA 4R1JA 2C2DA 1C30A 2MQHA 1RDPD 5IYBG 3V4SA 4QJFA 4L5SA 4LAAA 1ILQA 5E4XA 1ZQ7A 3RV4A 4DV1H 4JBMA 1STEA 4APVA 2L12A 2NVQB 4GKJH 2B2UC 4ME5A 1I5FA 3J7AK 1R9TH 2YU9A 4DR2H 4JV0A 2AU0A 2JK8A 1NUCA 4IFDG 3E0EA 2L9HA 4QIWB 5EBDA 3M85A 1P16A 1Q82C 5T14A 2TSSA 2O4XA 5KNDA 2C22A 1EWIA 3MR6A 1A8VA 2ZM6L 2VUMG 4I55F 4LF6L 2MO0A 2C5CA 1E7ZA 4RCOA 1GUNA 2NTTA 2GPWA 3BZDB 2UUBQ 4MAMA 3R5XA 3S16H 1FNUA 2QA4A 5C44G 3M3YH 4QF4A 5I6YA 1TS2A 2YYZA 4MTDA 5L1KA 4H7BA 2A69D 1K8GA 1JWMD 2FPPB 5GONF 1E22A 1I6VC 1N56A 2KEDA 2K5WA 4PZ8A 4DV4Q 1E4FT 2PW5A 5IP7H 4ZCKA 1X3EA 1ZEQX 5GAGC 3CCRA 1BNZA 1BGWA 3Q2OA 2M2LA 3E5SA 4LFAQ 3EBEA 4E4TA 3KHGA 3HS0C 2Z6BA 2I5LX 5A2QE 3WOEA 5T1IA 3G6JB 3GP7A 2L15A 1O78A 3D6CA 1QWYA 2EVBA 2UU9H 2GVBA 2NZOA 3GV8B 1PRTD 2L1BA 3Q22A 3FEWX 4DR2Q 1EQVA 1PTOH 1SSOA 4ULLA 2VS1A 3KF6A 3HOUG 3R5HA 2UVWA 3A8IE 4CKBA 3PGZA 4O2BF 1B44D 4MA5A 3PVXA 1CQVA 2J0TD 5KYLA 1KRSA 4L5RC 4BXXG 1VKZA 5J1ZA 5DGAA 2D2CC 3QZ8A 1BBUA 4KHPL 2LS01 2GPSA 1KTKA 4A3KB 2R87A 1N34H 3CCSA 1XX8A 4DR7H 2CH4A 4J9MA 4LMQD 3HKZE 1PYWD 4DV5L 3N41B 4MNOA 4NW2A 1FKAH 2NBFA 4IAJA 5J2TF 5L37A 2R7MA 3NE5B 1AEXA 1J6QA 3JAMc 1WCMG 1CKNB 1HR0Q 2Z6KC 5M5YH 5D8DA 5KFHA 1ZYRD 2G9DA 1L2FA 2MFIA 4KHVA 4FF4A 1H95A 3PW5A 4LNQA 2NZ1D 2KSWA 4LF4H 1OXSC 2HD3A 2ZT9C 3L2PA 3RTXA 2K1BA 1BNCA 1IBLH 1E24A 5C4XH 2K03A 2JA5B 2EJFC 2ZJTA 1UE7A 4AQYQ 4YP3A 2A6ED 4DAPA 1Q86C 1IHZA 3Q6SA 3WOFA 5C44H 1LTBD 1WD0A 3BS1A 5D1OA 4O4HF 4DV5H 4NLGA 5EPLA 4A3LG 1NMFA 5C3EB 2QEJC 3H4BA 2F0DA 3MXPA 2AQ1B 5KG2A 3G6YA 4BBRH 3RN5A 3VYSA 1WVLA 1VQBA 3C46A 4C3IH 4YHHH 1T5XD 1HZCA 3NQTA 4QMGA 5FJ8G 2EIFA 1QVGA 5LL6X 2VQFQ 2R82A 1TWCB 5IWAQ 3NTIA 4A3BB 2W9BB 2RDJA 5JUMA 1U4PA 4IZ8A 3TP7A 3QG1A 4A93B 1I6HH 1EY7A 1HUMA 1ZYRC 3RZOB 2MCTA 3AEVA 2HHHQ 1CKOA 1VQ7A 4UP9A 1B6SA 1WCMB 2F0HA 2NVXH 3I4OA 2WB1G 2FE3A 2KECA 4DR6L 1PMRA 3DXJC 4HJ5A 1AUXA 1GKHA 1EYDA 4X64H 2WTFA 5KFOA 1PYBA 2KVMA 2BQ3A 2R8KA 4DR4L 5FO7B 2JA6G 3G48A 4O1NA 1S9FA 4Q8EA 2JP1A 3GTLB 4DAMA 4QCLA 3MFHA 3J81L 3P7JA 4PZ7A 2ZDGA 2O5JC 4KY7A 1V1PA 2F0SA 1T36A 3G8CA 2PO4A 3E9IA 3BDCA 1W6KA 1Z2OX 4UCUA 1O80A 2VQEH 1VQ9A 3HOVH 1DYQA 1F2ZA 5KFYA 3NPPA 3W2DA 3GTPH 5G3LF 5ELCA 4MV6A 1G51A 4DK1A 3M9NB 1VMPA 1V1PB 5M3FB 3GIDA 3TQTA 5KFQA 5IGGA 4IPDA 1WH2A 2VQFH 3K5LA 2ICIA 4XYOA 3PF5A 3SEBA 4C3JG 4Y7NB 1PFBA 4DV7H 2TMPA 4DKAC 4TKOB 4C3HG 3PF4A 2E2IA 4A3LH 3WDNA 4EBCA 4PZ6A 2Z8LA 4RKLA 2VQDA 5DM63 3NWSA 4LFBL 4KV6A 2R7ZB 5LP6F 1X3QA 4HMJA 2JA5G 2B3GA 3TQ1A 1CSQA 2RDIA 3KHHA 5M9OA 4GKKQ 4DAVA 1B6RA 3KHLA 3BG3A 5C0XH 1TWGB 4ZUIA 4OONA 3I56A 4K8IA 2XCLA 4YR2A 4ZHQF 4IUQA 3L3OC 5JOBA 3H94A 4A3JH 2JEAI 4L5QA 4AYBB 4HIKA 4L6TB 4J9SA 4DL7A 4X64L 4JUZA 1K0SA 4UCRA 3D31A 4A4IA 5FLXE 4E6IA 1WD1A 4EGJA 4O4LF 4DR6H 1F9PA 2OEOA 4EEQA 2E75C 3ERSX 4HQ6A 3PZPA 1WOCA 3STBD 1HQRD 5LL6b 3E5NA 4DUYL 5I9OA 3OPOA 2K5QA 4B3MQ 2WACA 4ZKCB 4MV7A 4FXGC 1DXMA 1GD7A 3OMCA 3HOWH 4I7HA 3OSNA 2XWBB 3IRBA 1DOKA 3NBHB 4WORA 1K73C 4JC0A 2VB3X 4KJOA 4LUOA 2I46A 2E74C 4GOPC 1I3QB 1MD2D 5CBAE 2ASLA 3A54A 1JOKA 2KCTA 5BMVF 1CUKA 4R8IA 3CCQA 1KJ9A 4G4KA 5T1GA 4CDFC 2XC9A 1D6EC 3FDSA 4KKTA 3FPPA 2O03A 4RB2C 4ECZA 4GLXA 1KNAA 3NBIA 4ED1A 1D1IA 2EZVA 2FK3A 1A2UA 2R8JA 2RA4A 3N52A 2R93H 3GTKA 1NBWA 2F52A 3GTOH 2R8GA 1GVPA 1QILA 5HV6A 3OHAA 3T1YH 3MXNB 3J7AF 5EBCA 5K36H 3GTPA 4DR4H 3MXUA 1T94A 3PUVA 4HIOA 2YS7A 3F2UA 3S17H 2XIGA 4YY3Q 1E4EA 3RB0A 3Q8RB 2UUAQ 1ML0D 3K6OA 3S1RH 1JX4A 2YS6A 1VQ8A 4X3UA 2PNHA 3S15B 4ED3A 2BOSA 5CGKA 2NVTB 1Y1VG 2ENBA 2O5IC 1VMCA 4C5BA 1QUQA 5TSSA 4QGUA 2R7ZG 4P75A 2D5DA 1A63A 3HOWG 2UU9L 1E4EB 1SROA 2JEBI 3Q8SB 4QIWE 4A3GB 4O0AA 3OHXC 2B63A 1RL2A 4X3TA 3PO2G 1E2WA 4KHPH 2H4OA 3M7GA 4DV3L 1BVSA 1EY5A 3P75A 1TWHH 3KLSX 1N36L 1G91A 2R85A 3BABA 1LUZA 2XGTA 4GKKL 2AKWB 3V6JA 2JEFA 1JJCB 2QW7A 1XNQL 2L55A 2EYJA 5KGUA 5C3EG 1MGSA 2YZNA 3BDOA 4BXXH 3OUZA 1CM9A 1J8IA 4IQZA 1VF7A 3L0OA 2O2LD 4X6AH 2LY7A 4JPBW 4KD4A 4YHHL 5IYDH 1TWCA 3HOUB 2Y0SE 3ETHA 1LT4D 4X66L 3U9SA 4RNOA 1PFSA 5IGEA 5LL6S 4QL5A 5DLGA 1XNRQ 1YNNC 3E9HA 4LUVA 2CHBD 2B2UA 1N33H 1IBML 1KC8C 3TQYA 1WTOA 4BWGB 2ZTEA 2VY3A 4B9XA 3S16B 5DQIA 5D1OB 3T5LA 1JMCA 1RYRA 4DV1L 2JJQA 4IFDH 4A3MH 3GTKH 2R93A 1S5DD 1OXTA 1BJTA 4Q43A 5CB4F 4A76A 4A3DG 1K1SA 4LF6H 4S3SA 1KLUD 2W8KA 4R4OA 3SK5A 4IOAA 4B3SH 1M7JA 1I6UA 1F77A 4NXMH 4JBWA 4ILWA 1D5XC 3NK9A 1O7LA 3D0FA 1XTCD 5FPOA 4JYAH 1WTQA 1XNQQ 4F4WA 1DD2A 3K7UC 4P72A 1Q81C 2BR0A 1JC7A 4CKCA 1WTPA 4F4ZA 3W1GA 2B2YC 4B08A 4RZRA 1PTOB 4OIKA 1XMQH 3IL8A 3TMEA 3NENA 5C5JA 3HOVG 1L1OC 2ZXOA 3ETJA 5KT3A 5LMUL 2AUKA 1S40A 5KFKA 1S5CD 4C3HB 2E5LH 1I7LA 1BCPC 2HQEA 3KBXA 3CKIB 1GUGA 4DR3L 1AZQA 1XTDA 2LKVA 3HOXB 5LA6F 4IRCA 1HUNA 5DAUA 2VQEL 2NN6H 2HIVA 2UXCH 3I90A 1XPUA 1H9MA 4DR3Q 5FLXW 4AQYL 3C2PA 2QDBA 3H40A 2NU6B 1CA6A 4ODGA 2CQAA 4JI4L 5CV4A 2YU9B 1JB7A 1IBKQ 4FS1A 1E2VA 4RGNA 1BUVT 1VS0A 3NGDA 3PSIA 4DV7L 5KIXA 4NXMQ 2K6AA 2AQ2B 4P71A 5CR3A 4C1NI 4A3EB 4ZK9B 3C1FA 3T53B 1UC9A 4XYQA 3ERQA 4BA1I 4IUTA 1ZHSA 4FS2A 1OWTA 1B4OA 4ED7A 1VQIA 4EQ5A 1AN7A 1JOOA 2V4DA 3RN2A 1C8CA 2I5HA 4K0KH 4NKLA 1KBLA 3LWUA 3ND8A 4EBEA 4C3IG 4GOPA 3URYA 2JQOA 2MHVA 5ELDA 4DPGA 2B29A 3N8DA 3WNZA 3J81W 4QWAA 1BCPD 2G9HD 1JJ2A 4MTEA 1VBGA 2R86A 5J22A 1ZKOA 4LJZC 2KQ3A 1Q7YC 4YAKB 4ME6A 3GV6A 3F8TA 4TV8F 1Y1VH 3G6EA 3BU2A 5IODA 3K3VA 4C56C 1DV2A 4X3SA 4F88A 2CW7A 3HOZH 1CS0A 4ECXA 1SJHD 4HYKA 4WRDA 1B1ZA 1IYVA 2PBZA 1CI3M 4IPCA 5DLFA 2IJ0A 3KF8B 3RBEA 1QZGA 1LT3D 2K52A 5KEEA 2YYAA 2EXDA 1PFMA 1EQRA 3DWAA 2GN5A 2ES2A 4JI0Q 3PMFA 1Y1WA 2PZWA 4U7CA 2FK2A 1Q12A 4KK7A 1YNND 1WCMH 1PDQA 4RAZA 3KOJA 2DLNA 2HDLA 2R93G 3KF8A 3PUYA 1EQTA 2KENA 2E8GA 3RLNA 5EWGA 2DY8A 2CWPA 2N3SA 2C2RA 1LACA 2C35B 3UE0A 2UUAH 4H02A 1UWVA 5KFPA 3GD7A 3H09A 2V4QA 2EJGC 4FNFA 2K5DA 3H3VI 4RWSC 1EYAA 1NNXA 4IFDI 1STBA 1C4QA 4PMCA 4A2BA 3K5HA 5LOVF 2JA6B 4H44C 4RAYA 5HGTA 4J9NA 1KAWA 1SMYD 2KA7A 2Q2UA 4KHPQ 3HOZG 2DWCA 2AWNA 4DV0H 1PZID 3IFTA 4H0LC 3RLFA 3JRXA 1FYCA 1EEFD 3VYUA 4DU9A 5KRUA 3EPGA 4LMYA 4A3BH 2VA3A 4Y7NH 2ZJQA 1Y69U 1H9RA 1UNSA 4ZQIA 1JQYD 2CWAA 1STAA 3J81c 1XPRA 1N9WA 1TQOA 1PH7A 2ATWA 5IP7G 5M3FG 3GTGA 4KN7C 1YVCA 3PIOA 4UCOA 1S5ED 4BBSH 4F50A 1K83B 1XWEA 1K8MA 1WI5A 1ICFB 1LO5D 1D5ZC 1PTOC 3K0XA 4LFCL 4EQPA 4A3MG 1BO0A 2UVVA 4OX9H 4V190 2IWHA 3RFCA 3E0JA 2BDOA 3I3CA 1VBHA 4N8FA 4JV5L 3MAQA 4RZQA 1FGUA 5JEAG 4DR5L 3GTGB 4LF8H 1UEBA 3TIIA 3KDFA 4YCUA 5GAEC 4QB4A 1VQEA 3GTQH 2ZXPA 5CYUA 2QKIC 1A3VA 4DUYH 1ENFA 3S2HH 3PCOB 5KFEA 2EYOA 1S5FD 4A3MB 4ECQA 3KUPA 3GTKB 1B3QA 1N32Q 4LFBQ 4HMIA 4V0BA 1TU2B 2GVAA 2I8CA 2JEJA 1BBWA 1JCKB 4LF4L 3E6ZX 1F2MA 4A3JG 4A3GG 4HEDA 4AYBG 3PUZA 3FKIA 4B3SQ 4L8JA 4GN5A 3CXCA 5DEHA 4WJ4A 2E2DC 5KFIA 1GUTA 3MR5A 4C2MA 5JJIA 3MXGA 5D65A 3KXYT 1Q1EA 4KJNA 4B3RL 3I2ZA 2HJWA 4DNRB 5KFLA 5JJZA 3A55A 3DMUA 2ZTCA 1FR3A 5LMNL 1LT6D 2UXDL 4HAEA
chains in the Genus database with same CATH topology
4WJ3M 3JAMi 2BH8A 2V1CC 3U4ZA 4A3LG 1NMFA 2YV5A 4JG2A 4B3RQ 3UDGA 1PH1A 4BBRH 3RN5A 2YU9H 4R4QA 3SGIA 1VQCA 4LF8L 3U4VA 1VQBA 4C3IH 1X9NA 3CCUA 1A0IA 2A19A 1HZCA 4JOIC 4TQUS 5FJ8G 2EIFA 1QVGA 2K5VA 1N34Q 1G291 3HOXG 1HH2P 3S2DH 2VQFQ 3S1NH 4JI3L 5IWAQ 2UXCQ 2K14A 4BBSG 1PH3A 2B63H 3PO3G 1I6HH 1EIFA 1HNZL 3LGJA 3AEVA 4PMWA 1CKOA 1YEZA 4UP9A 1U0LA 1VQ7A 4DUZQ 5J3BA 2HHHQ 4LF5Q 3M4OH 4K0KL 3PV0A 2NVQH 2ZM6Q 1E1OA 3I4MG 4Y52H 2NVXH 4DR1Q 3I4OA 4LF5L 5K36G 2OQKA 2WB1G 4GNXB 3AQQA 4MZ9A 1HR0W 2RHSB 4A75A 4DR6L 5M3FH 4A3IG 1YIJA 2R7FA 2N78A 4HJ5A 2Q2IA 2LSSA 3G71A 1GKHA 4JI7L 4R4TA 3M4QA 1PYBA 4YWKA 4POFA 1I3QH 2Z0SA 3T1YL 3RNUA 3UDIA 1VQDA 4DR4L 2JA6G 3G48A 1SE8A 2IHFA 4LWCA 4DNIA 3H15A 4DR2L 1PH9A 4L5TA 1K9MC 4GKJQ 4DAMA 2WB1E 3FHWA 4PZ7A 4PG3A 2R6GA 2I5MX 1BKBA 2K5HA 4LF6Q 1IXRA 5M5WH 4IOCA 5C0XG 3E9IA 4FDBA 4JI2L 3TEHB 4JI6Q 4JBKA 4DAYB 2R7DA 5C0XI 3CCMA 1VQLA 4O2DA 5C0XJ 3CPWA 4DV6Q 1X65A 1VQ9A 1LYLA 5C3EH 3HOVH 1JJGA 4DK6C 2PMZE 3F1ZA 5H1SE 3MEFA 1KHIA 1UE1A 4DV2Q 3GTPH 1PA6A 3UE1A 4X66Q 1G51A 3KYHC 3CC7A 4DV4L 1K0RA 3HOUH 2AMCB 4GN4B 4P74A 4IPDA 3PF5A 4NPSA 1SFOH 4AIMA 1VQ6A 3CCEA 4LFAL 4DKAC 3PF4A 4GLVB 4A3LH 1FJGQ 4PZ6A 1HNWQ 2Z6KA 1T9HA 1YHBA 4OXPA 4NXNQ 5E7NA 2UUCL 4LFBL 1FL0A 2VL6A 1EUJA 3CP0A 4EX5A 4DV3Q 2JA5G 2B3GA 3AYHB 4DR7Q 3BZCA 4NXML 2UUCQ 1CSQA 1NMGA 2HQLA 3AFQA 3ULLA 4GKKQ 4IFDJ 1VCIA 1UE6A 5GAHC 1YJ9A 3CC4A 3HKSA 3B6YA 4JOIA 4OONA 3I56A 4OWWB 4NXNL 2Q2HA 1VQ5A 3W1BA 4RMFA 1VQJA 5LMNQ 2YTXA 2ASBA 1I94Q 3K80C 3BJUA 4AH6A 3F2CA 4A3JH 3J7A5 2JEAI 4L5QA 3DLLA 4HIKA 1M1KC 4X64L 2PI2E 4X65Q 2PQAB 4KI0A 3D31A 4A4IA 2AHOB 1S72A 1PH2A 4HJAA 3EN2A 1V43A 3HKZG 3T1HL 1YBYA 2HT1A 3I4MH 3ERSX 2CKZB 2ID0A 1WOCA 3STBD 4JYAL 1W3SA 4DV0L 1L1OB 4DUYL 1SLJA 5HY6A 1MKHA 4B3MQ 4C3JH 1GD7A 4LUZA 3HOWH 3F2DA 3IRBA 3NBHB 1K73C 4JC0A 3T1HQ 1K8AC 4BY1H 1G6PA 4LUOA 1AE3A 3U50C 3CMAA 4GOPC 4A3CH 1N33Q 1E3PA 2BA0A 2KCTA 3PUXA 3J80i 1CUKA 3UDXA 5IY0A 3S15H 2JA9A 1IZ6A 1XMOQ 3CCQA 1OXXK 3PIPA 4A3KH 3GO5A 3A5UA 2OWOA 4A93H 1WJJA 3L7ZC 2CFMA 4GLXA 1C0AA 4KHZA 3CQZH 2NN6I 1XMQQ 2R93H 2UXCL 1NBWA 2F52A 3GTOH 4JI3Q 3FKIG 2A1AA 1KQSA 1GVPA 4OX9Q 4C2MH 4JV5Q 1X3FA 5GROA 3MXNB 1QVFA 5AJ3L 3NEMA 1YHQA 1YZ6A 1B70B 4R4IA 4YWLA 5JEAJ 2VW9A 1KIXA 3M9BA 3PUVA 1KXLA 1L0WA 4HIOA 5IYBH 1MIUA 4JI2Q 3HOYH 1TWCH 4LF8Q 3S17H 4YY3Q 4R4CA 2YTVA 1IBMQ 2UUAQ 1NTGA 1Q8KA 3S1RH 1IBKL 1VQ8A 2PNHA 1D7QA 1Y1VG 3KFUA 1ASZA 4P73A 1QUQA 2R7ZG 4QGUA 3M4PA 4P75A 3GTMH 1A63A 4ALPA 4LW1A 2UU9L 3HOWG 1SROA 4X62Q 2JEBI 3VDYA 1Z9FA 4QIWE 5M5XH 4O0AA 2VQEQ 1CKNA 2K4KA 4HIMA 3OYYA 4JI6L 5ELOA 4C3HH 1OTCA 4DV6L 1RL2A 2JA7G 2VUMH 3PO2G 2RHQB 3PO2H 4HJ8A 4DV3L 2E2IH 3H0GG 2E5LQ 1BVSA 4UY8C 3GTLH 1B7YB 1FVIA 5M3MG 1TWHH 4A3DH 5BR8Q 1YITA 1N36L 1XJVA 2AWOA 5JJKA 1LUZA 4XIGS 1W2BA 2XGTA 3CW2C 2AKWB 1HR0L 2OTLA 4GKKL 4GKJL 4AYBE 1JJCB 2Y0SG 1EYGA 4BY1G 1XNQL 2WFWA 5C3EG 2E2JH 1X56A 4YCVA 1VQKA 2F4VL 1RIPA 1AE2A 3CF5A 4BA2I 4BXXH 1AH9A 1CKMA 1TXYA 5C4XG 1EIYB 3L0OA 3U58A 4X6AH 2IY5B 1L1OA 4YHHL 3NELA 4HJ9A 5IYDH 4DR5Q 1KRTA 1LTLA 2Y0SE 2CQOA 3GDEA 2R92H 4X66L 1TWGH 4A3BG 4HJ7A 1YJWA 2MO1A 1N33L 2FXQA 1PFSA 4QL5A 5IP9G 2QGQA 4JBJA 4UP7A 1XNRQ 2K75A 3E9HA 4LUVA 3F2BA 4JI0L 1XMOL 2I0QA 3KDFB 1IBML 1KC8C 3TQYA 4QY7A 1Q1BA 1NJIC 4UPAA 2H5XA 1Y1WH 2E2HH 1EQQA 2ZTEA 2VY3A 2MNAA 3H3VH 3FP9A 4A3KG 1HZAA 1JMCA 4DV1L 1X55A 2JJQA 5EAYA 1XPOA 2DUDA 4A3MH 3GTKH 4X62L 1KD1C 1PH6A 1OXTA 1VQPA 5IE8A 2VZAA 2JA8H 4JI8L 3A5ZB 4A76A 4A3DG 2RF4A 1O7IA 3UDFA 5FJ8H 2XTIA 4DR1L 4OO1I 3GTGH 4R4OA 4IOAA 1GM5A 3CMEA 4JBWA 1PH8A 1SMXA 3HFZB 5LMUQ 3D0FA 3S1MH 3WWVA 1XNQQ 1KL9A 3J81j 3K7UC 4P72A 5LMNW 1HJPA 1SR3A 2HIXA 4GOPB 1Q81C 1HNZQ 2JA8G 2NVTH 2R7ZH 3W1GA 2UUBL 2HHHL 2LXJA 3I7FA 4IO9A 1VQFA 3RLOA 3TS2A 4A3IH 2PQAA 3NENA 5IWAL 4A3FH 1M90C 1L1OC 3HOVG 1SN8A 5IP9H 2E5LL 4IPGA 4GNXC 1FJGL 2NZHA 1C9OA 2JE6I 5LMUL 4DUYQ 1S40A 3CD6A 4BY7H 3KJOA 4LF9L 2OCEA 3KF6B 5IYDG 1HNWL 2UXBQ 2UU9Q 4JI8Q 3KLWA 3S24A 1TWAH 4DR3L 1WYDA 1WFQA 1XTDA 4JI1L 4A3EG 2VQEL 2HIVA 1XPUA 4DR3Q 5HGQA 4AQYL 3J80c 1J5EL 1DGSA 4LF7L 4DV2L 3I55A 1X54A 2JA7H 3EIVA 4DV1Q 4JI4L 1HZBA 3CCVA 1JT8A 1JB7A 1IBKQ 2OTJA 4B3SL 1VS0A 3PSIA 1VQHA 4DV7L 4QQBX 2DGYA 4NXMQ 2KHJA 3BZKA 2IX1A 4P71A 2A8VA 2N8NA 1PYSB 1Y14B 3A0JA 2IX0A 5AJ3Q 3CC2A 4BA1I 2B63G 3PO3H 2D62A 3M7NA 1I50H 1VQIA 3AFPA 4IJHA 1P8LA 4JCVE 4EQ5A 4DV5Q 2I5HA 3OW2A 3RN2A 1VQMA 4JI5Q 1N32L 2CCZA 2ALYB 3T1YQ 1HNXQ 2K5NA 1MJCA 3K8AA 4DR4Q 1XMQL 4GOPA 1YJNA 1HNXL 2JQOA 4XTCS 2QEXA 4DPGA 2B29A 4DUZL 4B3TL 4YWMA 4GN3B 4A3GH 1QZHA 3RZDH 2KHIA 2BH2A 3ZJYC 1JJ2A 3Q8DA 2ZJRA 2BA1A 4B3TQ 2RCNA 5IT9c 1Q7YC 2F3IA 5FLMH 1K3RA 1SRUA 2JA6H 4GS3A 4J15A 4IPHA 3FKIH 2ZJPA 4NB3A 3F8TA 2F4VQ 3G4SA 1Y1VH 4OWTB 3G6EA 3BU2A 4DK3C 1N34L 2N49A 4LFCQ 1IBLQ 1Z47A 2KBNA 5IYCG 2R92G 1NY4A 4MTNA 1X3GA 2VQFL 4DV0Q 4A3EH 4POGA 3HOZH 1CSPA 1JE5A 4DV7Q 4B3ML 5GADC 3S14H 2UXDQ 4IJLA 4R1JA 1YI2A 4IPCA 1IL2A 3KF8B 2MQHA 5BR8L 5IYBG 1N36Q 1QZGA 2WP8J 2K52A 4QJFA 4L5SA 4X64Q 4JYAQ 2EXDA 2ES2A 1EQRA 2GN5A 2VNUD 4JI0Q 1YHAA 4JBMA 1VQOA 5FLXc 1J5EQ 4APVA 3S1QH 1Q12A 1PHJA 1WCMH 2K50A 1PH4A 2D0PA 1I5FA 3KOJA 3CCJA 1R9TH 3OTOQ 5C4JH 1U5KA 2R93G 3PUYA 2JK8A 2KENA 2E8GA 3RLNA 2UUAL 3E0EA 4IFDG 1OXUA 1B8AA 3TRZA 3M85A 1GO3E 1NE3A 1OXVA 1P16A 1TWFH 2CWPA 2N3SA 1Q82C 4GLAC 3CCLA 4LF4Q 2C35B 3UE0A 1VQNA 1EWIA 2UXBL 1A8VA 4H02A 1UWVA 3TREA 2ZM6L 4LF6L 3GD7A 2MO0A 2VUMG 1E7ZA 1D8LA 2WAQE 2UUBQ 2ZTDA 3H3VI 4OO1G 1S3OA 3S16H 4X65L 2QA4A 1Q46A 5C44G 3M3YH 1IYJB 2YYZA 4IFDI 3GTJH 2PI2A 3J81i 1K8GA 1QUQB 1C7YA 2NN6G 2NVYH 3ICEA 4DR7L 3JC66 1E22A 1UE5A 1KAWA 4PZ8A 3PUWA 4DV4Q 5GQOA 2Q2UA 5IP7H 4KHPQ 1X3EA 5GAGC 2WAQG 3CCRA 3HOZG 4LFAQ 2AWNA 3HOYG 1VQAA 3RLFA 3EBEA 3OTOL 4A3FG 1A62A 5JJLA 1HZ9A 4A3BH 3ULJA 2I5LX 4Y7NH 3K81C 2ZJQA 3A74A 5FLMG 1N8RC 2L15A 4ME3A 2CWAA 3J81c 2GVBA 1XPRA 2NZOA 2JA5H 2OQ0A 3H0GH 1N9WA 3ULPA 4DR2Q 1PH7A 2ATWA 5IP7G 2IHEA 4UP8A 2VS1A 1YNXA 3KF6A 5M3FG 3HOUG 4YY3L 1YVCA 3PIOA 4BBSH 3PGZA 1XNRL 1QVCA 1WI5A 1MJEA 1LM0A 3K0XA 3W5OA 1KRSA 4LFCL 4A3MG 4L5RC 4BXXG 4DR6Q 4A3CG 1IBLL 2YTYA 3CPFA 4JI7Q 1EFWA 4OX9L 1PV4A 4JV5L 1Y1WG 4YHHQ 1EOVA 1BBUA 1FGUA 4BBRG 4YCWA 5JEAG 4DR5L 4KHPL 1UEBA 2LXKA 4LF9Q 3ER0A 3J7ZC 3KDFA 4YCUA 5GAEC 5ELNA 3CCSA 1V9PA 1VQEA 3GTQH 3K7AH 1E1TA 3TS0A 4K0KQ 3HKZE 3S2HH 3PCOB 4RG1A 4DV5L 3RZOH 3DM3A 3KJPA 4MNOA 4JI5L 1N32Q 3CAMA 4GNXA 2Q2TA 4HIDA 4LFBQ 1J6QA 3JAMc 1WCMG 2GVAA 4JI4Q 1CKNB 1BBWA 2IT1A 1HR0Q 2Z6KC 5M5YH 4LF4L 4A3JG 1K83H 1L2FA 2MFIA 4KLKA 4A3GG 1H95A 1V1QA 1VQ4A 4AYBG 3PUZA 4OWXB 3I4NG 4LNQA 4B3SQ 1PVOA 4GN5A 3CXCA 4WJ4A 3I4NH 2D0OA 3STBC 4BY7G 1OXSC 3L2PA 1ASYA 1PH5A 5JJIA 4JI1Q 1Q1EA 4B3RL 3I2ZA 1E24A 5C4XH 5IYCH 1UE7A 4AQYQ 2ZTCA 1VQGA 5M3MH 1X6OA 3HOXH 5LMNL 1Q86C 5DLQE 4LF7Q 5C44H 4TVAB 1I94L 2KCMA 2UXDL 2EQSA 3RR5A 4A93G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJ3 M;  3JAM i;  2BH8 A;  2V1C C;  3U4Z A;  4A3L G;  1NMF A;  2YV5 A;  4JG2 A;  4B3R Q;  3UDG A;  1PH1 A;  4BBR H;  3RN5 A;  2YU9 H;  4R4Q A;  3SGI A;  1VQC A;  4LF8 L;  3U4V A;  1VQB A;  4C3I H;  1X9N A;  3CCU A;  1A0I A;  2A19 A;  1HZC A;  4JOI C;  4TQU S;  5FJ8 G;  2EIF A;  1QVG A;  2K5V A;  1N34 Q;  1G29 1;  3HOX G;  1HH2 P;  3S2D H;  2VQF Q;  3S1N H;  4JI3 L;  5IWA Q;  2UXC Q;  2K14 A;  4BBS G;  1PH3 A;  2B63 H;  3PO3 G;  1I6H H;  1EIF A;  1HNZ L;  3LGJ A;  3AEV A;  4PMW A;  1CKO A;  1YEZ A;  4UP9 A;  1U0L A;  1VQ7 A;  4DUZ Q;  5J3B A;  2HHH Q;  4LF5 Q;  3M4O H;  4K0K L;  3PV0 A;  2NVQ H;  2ZM6 Q;  1E1O A;  3I4M G;  4Y52 H;  2NVX H;  4DR1 Q;  3I4O A;  4LF5 L;  5K36 G;  2OQK A;  2WB1 G;  4GNX B;  3AQQ A;  4MZ9 A;  1HR0 W;  2RHS B;  4A75 A;  4DR6 L;  5M3F H;  4A3I G;  1YIJ A;  2R7F A;  2N78 A;  4HJ5 A;  2Q2I A;  2LSS A;  3G71 A;  1GKH A;  4JI7 L;  4R4T A;  3M4Q A;  1PYB A;  4YWK A;  4POF A;  1I3Q H;  2Z0S A;  3T1Y L;  3RNU A;  3UDI A;  1VQD A;  4DR4 L;  2JA6 G;  3G48 A;  1SE8 A;  2IHF A;  4LWC A;  4DNI A;  3H15 A;  4DR2 L;  1PH9 A;  4L5T A;  1K9M C;  4GKJ Q;  4DAM A;  2WB1 E;  3FHW A;  4PZ7 A;  4PG3 A;  2R6G A;  2I5M X;  1BKB A;  2K5H A;  4LF6 Q;  1IXR A;  5M5W H;  4IOC A;  5C0X G;  3E9I A;  4FDB A;  4JI2 L;  3TEH B;  4JI6 Q;  4JBK A;  4DAY B;  2R7D A;  5C0X I;  3CCM A;  1VQL A;  4O2D A;  5C0X J;  3CPW A;  4DV6 Q;  1X65 A;  1VQ9 A;  1LYL A;  5C3E H;  3HOV H;  1JJG A;  4DK6 C;  2PMZ E;  3F1Z A;  5H1S E;  3MEF A;  1KHI A;  1UE1 A;  4DV2 Q;  3GTP H;  1PA6 A;  3UE1 A;  4X66 Q;  1G51 A;  3KYH C;  3CC7 A;  4DV4 L;  1K0R A;  3HOU H;  2AMC B;  4GN4 B;  4P74 A;  4IPD A;  3PF5 A;  4NPS A;  1SFO H;  4AIM A;  1VQ6 A;  3CCE A;  4LFA L;  4DKA C;  3PF4 A;  4GLV B;  4A3L H;  1FJG Q;  4PZ6 A;  1HNW Q;  2Z6K A;  1T9H A;  1YHB A;  4OXP A;  4NXN Q;  5E7N A;  2UUC L;  4LFB L;  1FL0 A;  2VL6 A;  1EUJ A;  3CP0 A;  4EX5 A;  4DV3 Q;  2JA5 G;  2B3G A;  3AYH B;  4DR7 Q;  3BZC A;  4NXM L;  2UUC Q;  1CSQ A;  1NMG A;  2HQL A;  3AFQ A;  3ULL A;  4GKK Q;  4IFD J;  1VCI A;  1UE6 A;  5GAH C;  1YJ9 A;  3CC4 A;  3HKS A;  3B6Y A;  4JOI A;  4OON A;  3I56 A;  4OWW B;  4NXN L;  2Q2H A;  1VQ5 A;  3W1B A;  4RMF A;  1VQJ A;  5LMN Q;  2YTX A;  2ASB A;  1I94 Q;  3K80 C;  3BJU A;  4AH6 A;  3F2C A;  4A3J H;  3J7A 5;  2JEA I;  4L5Q A;  3DLL A;  4HIK A;  1M1K C;  4X64 L;  2PI2 E;  4X65 Q;  2PQA B;  4KI0 A;  3D31 A;  4A4I A;  2AHO B;  1S72 A;  1PH2 A;  4HJA A;  3EN2 A;  1V43 A;  3HKZ G;  3T1H L;  1YBY A;  2HT1 A;  3I4M H;  3ERS X;  2CKZ B;  2ID0 A;  1WOC A;  3STB D;  4JYA L;  1W3S A;  4DV0 L;  1L1O B;  4DUY L;  1SLJ A;  5HY6 A;  1MKH A;  4B3M Q;  4C3J H;  1GD7 A;  4LUZ A;  3HOW H;  3F2D A;  3IRB A;  3NBH B;  1K73 C;  4JC0 A;  3T1H Q;  1K8A C;  4BY1 H;  1G6P A;  4LUO A;  1AE3 A;  3U50 C;  3CMA A;  4GOP C;  4A3C H;  1N33 Q;  1E3P A;  2BA0 A;  2KCT A;  3PUX A;  3J80 i;  1CUK A;  3UDX A;  5IY0 A;  3S15 H;  2JA9 A;  1IZ6 A;  1XMO Q;  3CCQ A;  1OXX K;  3PIP A;  4A3K H;  3GO5 A;  3A5U A;  2OWO A;  4A93 H;  1WJJ A;  3L7Z C;  2CFM A;  4GLX A;  1C0A A;  4KHZ A;  3CQZ H;  2NN6 I;  1XMQ Q;  2R93 H;  2UXC L;  1NBW A;  2F52 A;  3GTO H;  4JI3 Q;  3FKI G;  2A1A A;  1KQS A;  1GVP A;  4OX9 Q;  4C2M H;  4JV5 Q;  1X3F A;  5GRO A;  3MXN B;  1QVF A;  5AJ3 L;  3NEM A;  1YHQ A;  1YZ6 A;  1B70 B;  4R4I A;  4YWL A;  5JEA J;  2VW9 A;  1KIX A;  3M9B A;  3PUV A;  1KXL A;  1L0W A;  4HIO A;  5IYB H;  1MIU A;  4JI2 Q;  3HOY H;  1TWC H;  4LF8 Q;  3S17 H;  4YY3 Q;  4R4C A;  2YTV A;  1IBM Q;  2UUA Q;  1NTG A;  1Q8K A;  3S1R H;  1IBK L;  1VQ8 A;  2PNH A;  1D7Q A;  1Y1V G;  3KFU A;  1ASZ A;  4P73 A;  1QUQ A;  2R7Z G;  4QGU A;  3M4P A;  4P75 A;  3GTM H;  1A63 A;  4ALP A;  4LW1 A;  2UU9 L;  3HOW G;  1SRO A;  4X62 Q;  2JEB I;  3VDY A;  1Z9F A;  4QIW E;  5M5X H;  4O0A A;  2VQE Q;  1CKN A;  2K4K A;  4HIM A;  3OYY A;  4JI6 L;  5ELO A;  4C3H H;  1OTC A;  4DV6 L;  1RL2 A;  2JA7 G;  2VUM H;  3PO2 G;  2RHQ B;  3PO2 H;  4HJ8 A;  4DV3 L;  2E2I H;  3H0G G;  2E5L Q;  1BVS A;  4UY8 C;  3GTL H;  1B7Y B;  1FVI A;  5M3M G;  1TWH H;  4A3D H;  5BR8 Q;  1YIT A;  1N36 L;  1XJV A;  2AWO A;  5JJK A;  1LUZ A;  4XIG S;  1W2B A;  2XGT A;  3CW2 C;  2AKW B;  1HR0 L;  2OTL A;  4GKK L;  4GKJ L;  4AYB E;  1JJC B;  2Y0S G;  1EYG A;  4BY1 G;  1XNQ L;  2WFW A;  5C3E G;  2E2J H;  1X56 A;  4YCV A;  1VQK A;  2F4V L;  1RIP A;  1AE2 A;  3CF5 A;  4BA2 I;  4BXX H;  1AH9 A;  1CKM A;  1TXY A;  5C4X G;  1EIY B;  3L0O A;  3U58 A;  4X6A H;  2IY5 B;  1L1O A;  4YHH L;  3NEL A;  4HJ9 A;  5IYD H;  4DR5 Q;  1KRT A;  1LTL A;  2Y0S E;  2CQO A;  3GDE A;  2R92 H;  4X66 L;  1TWG H;  4A3B G;  4HJ7 A;  1YJW A;  2MO1 A;  1N33 L;  2FXQ A;  1PFS A;  4QL5 A;  5IP9 G;  2QGQ A;  4JBJ A;  4UP7 A;  1XNR Q;  2K75 A;  3E9H A;  4LUV A;  3F2B A;  4JI0 L;  1XMO L;  2I0Q A;  3KDF B;  1IBM L;  1KC8 C;  3TQY A;  4QY7 A;  1Q1B A;  1NJI C;  4UPA A;  2H5X A;  1Y1W H;  2E2H H;  1EQQ A;  2ZTE A;  2VY3 A;  2MNA A;  3H3V H;  3FP9 A;  4A3K G;  1HZA A;  1JMC A;  4DV1 L;  1X55 A;  2JJQ A;  5EAY A;  1XPO A;  2DUD A;  4A3M H;  3GTK H;  4X62 L;  1KD1 C;  1PH6 A;  1OXT A;  1VQP A;  5IE8 A;  2VZA A;  2JA8 H;  4JI8 L;  3A5Z B;  4A76 A;  4A3D G;  2RF4 A;  1O7I A;  3UDF A;  5FJ8 H;  2XTI A;  4DR1 L;  4OO1 I;  3GTG H;  4R4O A;  4IOA A;  1GM5 A;  3CME A;  4JBW A;  1PH8 A;  1SMX A;  3HFZ B;  5LMU Q;  3D0F A;  3S1M H;  3WWV A;  1XNQ Q;  1KL9 A;  3J81 j;  3K7U C;  4P72 A;  5LMN W;  1HJP A;  1SR3 A;  2HIX A;  4GOP B;  1Q81 C;  1HNZ Q;  2JA8 G;  2NVT H;  2R7Z H;  3W1G A;  2UUB L;  2HHH L;  2LXJ A;  3I7F A;  4IO9 A;  1VQF A;  3RLO A;  3TS2 A;  4A3I H;  2PQA A;  3NEN A;  5IWA L;  4A3F H;  1M90 C;  1L1O C;  3HOV G;  1SN8 A;  5IP9 H;  2E5L L;  4IPG A;  4GNX C;  1FJG L;  2NZH A;  1C9O A;  2JE6 I;  5LMU L;  4DUY Q;  1S40 A;  3CD6 A;  4BY7 H;  3KJO A;  4LF9 L;  2OCE A;  3KF6 B;  5IYD G;  1HNW L;  2UXB Q;  2UU9 Q;  4JI8 Q;  3KLW A;  3S24 A;  1TWA H;  4DR3 L;  1WYD A;  1WFQ A;  1XTD A;  4JI1 L;  4A3E G;  2VQE L;  2HIV A;  1XPU A;  4DR3 Q;  5HGQ A;  4AQY L;  3J80 c;  1J5E L;  1DGS A;  4LF7 L;  4DV2 L;  3I55 A;  1X54 A;  2JA7 H;  3EIV A;  4DV1 Q;  4JI4 L;  1HZB A;  3CCV A;  1JT8 A;  1JB7 A;  1IBK Q;  2OTJ A;  4B3S L;  1VS0 A;  3PSI A;  1VQH A;  4DV7 L;  4QQB X;  2DGY A;  4NXM Q;  2KHJ A;  3BZK A;  2IX1 A;  4P71 A;  2A8V A;  2N8N A;  1PYS B;  1Y14 B;  3A0J A;  2IX0 A;  5AJ3 Q;  3CC2 A;  4BA1 I;  2B63 G;  3PO3 H;  2D62 A;  3M7N A;  1I50 H;  1VQI A;  3AFP A;  4IJH A;  1P8L A;  4JCV E;  4EQ5 A;  4DV5 Q;  2I5H A;  3OW2 A;  3RN2 A;  1VQM A;  4JI5 Q;  1N32 L;  2CCZ A;  2ALY B;  3T1Y Q;  1HNX Q;  2K5N A;  1MJC A;  3K8A A;  4DR4 Q;  1XMQ L;  4GOP A;  1YJN A;  1HNX L;  2JQO A;  4XTC S;  2QEX A;  4DPG A;  2B29 A;  4DUZ L;  4B3T L;  4YWM A;  4GN3 B;  4A3G H;  1QZH A;  3RZD H;  2KHI A;  2BH2 A;  3ZJY C;  1JJ2 A;  3Q8D A;  2ZJR A;  2BA1 A;  4B3T Q;  2RCN A;  5IT9 c;  1Q7Y C;  2F3I A;  5FLM H;  1K3R A;  1SRU A;  2JA6 H;  4GS3 A;  4J15 A;  4IPH A;  3FKI H;  2ZJP A;  4NB3 A;  3F8T A;  2F4V Q;  3G4S A;  1Y1V H;  4OWT B;  3G6E A;  3BU2 A;  4DK3 C;  1N34 L;  2N49 A;  4LFC Q;  1IBL Q;  1Z47 A;  2KBN A;  5IYC G;  2R92 G;  1NY4 A;  4MTN A;  1X3G A;  2VQF L;  4DV0 Q;  4A3E H;  4POG A;  3HOZ H;  1CSP A;  1JE5 A;  4DV7 Q;  4B3M L;  5GAD C;  3S14 H;  2UXD Q;  4IJL A;  4R1J A;  1YI2 A;  4IPC A;  1IL2 A;  3KF8 B;  2MQH A;  5BR8 L;  5IYB G;  1N36 Q;  1QZG A;  2WP8 J;  2K52 A;  4QJF A;  4L5S A;  4X64 Q;  4JYA Q;  2EXD A;  2ES2 A;  1EQR A;  2GN5 A;  2VNU D;  4JI0 Q;  1YHA A;  4JBM A;  1VQO A;  5FLX c;  1J5E Q;  4APV A;  3S1Q H;  1Q12 A;  1PHJ A;  1WCM H;  2K50 A;  1PH4 A;  2D0P A;  1I5F A;  3KOJ A;  3CCJ A;  1R9T H;  3OTO Q;  5C4J H;  1U5K A;  2R93 G;  3PUY A;  2JK8 A;  2KEN A;  2E8G A;  3RLN A;  2UUA L;  3E0E A;  4IFD G;  1OXU A;  1B8A A;  3TRZ A;  3M85 A;  1GO3 E;  1NE3 A;  1OXV A;  1P16 A;  1TWF H;  2CWP A;  2N3S A;  1Q82 C;  4GLA C;  3CCL A;  4LF4 Q;  2C35 B;  3UE0 A;  1VQN A;  1EWI A;  2UXB L;  1A8V A;  4H02 A;  1UWV A;  3TRE A;  2ZM6 L;  4LF6 L;  3GD7 A;  2MO0 A;  2VUM G;  1E7Z A;  1D8L A;  2WAQ E;  2UUB Q;  2ZTD A;  3H3V I;  4OO1 G;  1S3O A;  3S16 H;  4X65 L;  2QA4 A;  1Q46 A;  5C44 G;  3M3Y H;  1IYJ B;  2YYZ A;  4IFD I;  3GTJ H;  2PI2 A;  3J81 i;  1K8G A;  1QUQ B;  1C7Y A;  2NN6 G;  2NVY H;  3ICE A;  4DR7 L;  3JC6 6;  1E22 A;  1UE5 A;  1KAW A;  4PZ8 A;  3PUW A;  4DV4 Q;  5GQO A;  2Q2U A;  5IP7 H;  4KHP Q;  1X3E A;  5GAG C;  2WAQ G;  3CCR A;  3HOZ G;  4LFA Q;  2AWN A;  3HOY G;  1VQA A;  3RLF A;  3EBE A;  3OTO L;  4A3F G;  1A62 A;  5JJL A;  1HZ9 A;  4A3B H;  3ULJ A;  2I5L X;  4Y7N H;  3K81 C;  2ZJQ A;  3A74 A;  5FLM G;  1N8R C;  2L15 A;  4ME3 A;  2CWA A;  3J81 c;  2GVB A;  1XPR A;  2NZO A;  2JA5 H;  2OQ0 A;  3H0G H;  1N9W A;  3ULP A;  4DR2 Q;  1PH7 A;  2ATW A;  5IP7 G;  2IHE A;  4UP8 A;  2VS1 A;  1YNX A;  3KF6 A;  5M3F G;  3HOU G;  4YY3 L;  1YVC A;  3PIO A;  4BBS H;  3PGZ A;  1XNR L;  1QVC A;  1WI5 A;  1MJE A;  1LM0 A;  3K0X A;  3W5O A;  1KRS A;  4LFC L;  4A3M G;  4L5R C;  4BXX G;  4DR6 Q;  4A3C G;  1IBL L;  2YTY A;  3CPF A;  4JI7 Q;  1EFW A;  4OX9 L;  1PV4 A;  4JV5 L;  1Y1W G;  4YHH Q;  1EOV A;  1BBU A;  1FGU A;  4BBR G;  4YCW A;  5JEA G;  4DR5 L;  4KHP L;  1UEB A;  2LXK A;  4LF9 Q;  3ER0 A;  3J7Z C;  3KDF A;  4YCU A;  5GAE C;  5ELN A;  3CCS A;  1V9P A;  1VQE A;  3GTQ H;  3K7A H;  1E1T A;  3TS0 A;  4K0K Q;  3HKZ E;  3S2H H;  3PCO B;  4RG1 A;  4DV5 L;  3RZO H;  3DM3 A;  3KJP A;  4MNO A;  4JI5 L;  1N32 Q;  3CAM A;  4GNX A;  2Q2T A;  4HID A;  4LFB Q;  1J6Q A;  3JAM c;  1WCM G;  2GVA A;  4JI4 Q;  1CKN B;  1BBW A;  2IT1 A;  1HR0 Q;  2Z6K C;  5M5Y H;  4LF4 L;  4A3J G;  1K83 H;  1L2F A;  2MFI A;  4KLK A;  4A3G G;  1H95 A;  1V1Q A;  1VQ4 A;  4AYB G;  3PUZ A;  4OWX B;  3I4N G;  4LNQ A;  4B3S Q;  1PVO A;  4GN5 A;  3CXC A;  4WJ4 A;  3I4N H;  2D0O A;  3STB C;  4BY7 G;  1OXS C;  3L2P A;  1ASY A;  1PH5 A;  5JJI A;  4JI1 Q;  1Q1E A;  4B3R L;  3I2Z A;  1E24 A;  5C4X H;  5IYC H;  1UE7 A;  4AQY Q;  2ZTC A;  1VQG A;  5M3M H;  1X6O A;  3HOX H;  5LMN L;  1Q86 C;  5DLQ E;  4LF7 Q;  5C44 H;  4TVA B;  1I94 L;  2KCM A;  2UXD L;  2EQS A;  3RR5 A;  4A93 G; 
#chains in the Genus database with same CATH topology
 5G3L D;  1TS4 A;  2BH8 A;  2FB9 A;  1I50 A;  4B3R Q;  3U9O A;  4YR3 A;  3RB3 A;  1EEI D;  5JEA H;  4OEL B;  3FPU B;  1VQC A;  2NYZ D;  3U4V A;  1HA6 A;  1ZXT A;  4TQU S;  1N34 Q;  1EY9 A;  1AZP A;  2FMM A;  1X3P A;  3MZ5 A;  2UXC Q;  2K14 A;  4BBS G;  2W9C B;  1K28 A;  1VAJ A;  4CC6 A;  3LGJ A;  4PMW A;  3M4O H;  5J3B A;  2IW3 A;  4K0K L;  2PZT A;  4Y52 H;  3I4M G;  5C5L A;  4U68 A;  1SYE A;  4DR1 Q;  5C44 B;  4LF5 L;  1UEA B;  2EYP A;  5K36 G;  1KC7 A;  5BR8 H;  3AQQ A;  4A75 A;  3MFG A;  3NSW A;  3JAM W;  3R5F A;  3NUC A;  4JI7 L;  5KG4 A;  1A3U A;  3GIK A;  1T3N A;  5E4W C;  4POF A;  1I3Q H;  4K2L A;  3T1Y L;  5D3D A;  1FD7 D;  1ULZ A;  3LX0 A;  4RUC A;  2BQR A;  4C3I B;  4DNI A;  5KYI A;  4RUA A;  1PH9 A;  4L5T A;  3HOY B;  4DR1 H;  1EYZ A;  1CQI B;  3FHW A;  5F2D A;  3NP8 A;  1RJP A;  3OOC A;  3KAJ A;  4AQY H;  1BKB A;  1IXR A;  1Q8I A;  4IOC A;  4B3T H;  2SNM A;  4JBK A;  2R7D A;  3LWE A;  1VQL A;  4DV6 Q;  4X3K A;  1X65 A;  5C3E H;  3H0G B;  2CH4 W;  1JJG A;  3PN1 A;  3F1Z A;  1QJO A;  4HCS A;  5H1S E;  3EYY A;  4O3R A;  1PA6 A;  3KAK A;  1MI2 A;  3HOU H;  1SJE D;  3I72 A;  4GN4 B;  5JVH 3;  1N36 H;  1SFO H;  3H91 A;  4AIM A;  5IWA H;  4QW9 A;  4PWQ A;  2NU8 B;  2FLL A;  1RJT A;  1FJG Q;  1HNW Q;  2UXD H;  2Z6K A;  2NVX A;  1Z6H A;  1ROD A;  4YR0 A;  2FP4 B;  4FM9 A;  1FL0 A;  2VL6 A;  1EUJ A;  3CP0 A;  4QWE A;  3TZD A;  3AYH B;  4DR7 Q;  1NR2 A;  5IT9 E;  1JKJ B;  4ECU A;  4PMB A;  5EZY F;  3SDZ A;  1VCI A;  1JIH A;  3T5J A;  2RGR A;  2X6L A;  4CDE C;  5FOB B;  2F0Q A;  2ATL A;  2R7N A;  2JA7 B;  1YNJ C;  4ABN A;  1TWG A;  3HKS A;  3B6Y A;  2GA4 B;  3RUP A;  2IBK A;  3EVQ A;  4ZKB B;  5COY A;  4ED8 A;  5L1J A;  4RMF A;  3C3L A;  1VQJ A;  5LMN Q;  2ASB A;  1I94 Q;  3K80 C;  4AH6 A;  1KDB A;  1T5E A;  3J7A 5;  3DLL A;  5C4H A;  1M1K C;  3DF7 A;  3G6X A;  3F8N A;  1DJR D;  1HQM C;  4ETS A;  5KFN A;  4JI5 H;  4HJA A;  4F87 A;  1IBM H;  3OSP A;  1G2T A;  1YBY A;  2R61 A;  3I4M H;  2XCP A;  2CKZ B;  4OL7 A;  2SEB D;  1SCU B;  5KG5 A;  3D3R A;  4MHE A;  4DV0 L;  1GSH A;  1L1O B;  1I94 H;  5HY6 A;  2FMC A;  3T56 B;  1L2Z A;  2FK1 A;  5ISR A;  5KG7 A;  1LT5 D;  2X0S A;  2R84 A;  3SR1 A;  1SYD A;  3U50 C;  1AE3 A;  4XDX A;  4EG0 A;  1I3Q A;  1C3O A;  4IAL A;  3UDX A;  3MFY A;  1LAB A;  4RHS A;  2HGS A;  4A3K H;  5DG7 A;  3OW7 A;  2OWO A;  3PW2 A;  3CVZ A;  4P2C B;  2XGQ A;  5JVG 3;  1STG A;  2W70 A;  3JAM E;  2NN6 I;  1CK1 A;  1SNC A;  2WIN B;  1EZ6 A;  1Y8P B;  1DON A;  4OX9 Q;  4L63 B;  3Q1K A;  4RHR A;  1QVF A;  3DHQ A;  1I4X A;  5AJ3 L;  1B04 A;  4DR5 H;  4JV1 A;  4LF9 H;  1YZ6 A;  2EY2 A;  4YWL A;  3JZI A;  4RAU C;  3GIM A;  1S0M A;  3DEO A;  3U9T A;  2IX3 A;  4JI2 Q;  5IYB H;  3Q23 A;  2CQY A;  4LF8 Q;  1TWF B;  4QUF A;  2ZXR A;  3ITP A;  1IBM Q;  3HKZ B;  1NTG A;  3BQ0 A;  3ORQ A;  1EIG A;  1IBK L;  3S2H B;  2PW7 A;  3O13 A;  2J6U A;  3VR6 A;  1ASZ A;  1GSO A;  1S5B D;  2WII B;  1M0T A;  3M4P A;  3GTM H;  4LFB H;  4LW1 A;  5E3F A;  3J80 L;  2NWG A;  2PCF B;  2VQE Q;  4UCT A;  3TN2 A;  2K4K A;  3KTM A;  5ELO A;  5CV6 A;  4C3H H;  1OTC A;  4YB8 B;  2VUM H;  4I7A A;  5C1P A;  1SE3 A;  1JOQ A;  5DM7 3;  3HEJ A;  2W6O A;  3J80 W;  4EFE A;  1SYG A;  1B7Y B;  4EVO A;  4A3D H;  1DIK A;  5JJK A;  4XIG S;  1DOM A;  2M05 A;  2OTL A;  4RNN A;  1W93 A;  5IT9 W;  4GKJ L;  4AYB E;  4R8U A;  4U6P A;  4BY1 G;  4YCV A;  4FBT A;  3GII A;  1LTA D;  3V96 A;  3GTO B;  3X3M A;  1AE2 A;  3CF5 A;  2KOL A;  1CKM A;  1TXY A;  1JDB B;  4ZUJ A;  4OEM B;  4RA8 A;  2IY5 B;  5FO8 B;  3NEL A;  2MUY A;  2VPS A;  1KRT A;  2JA8 B;  3GDE A;  2YL2 A;  2FMA A;  4A3B G;  4CJ1 B;  1EWC A;  3VR2 A;  1N33 L;  1V51 A;  2FXQ A;  4MV4 A;  3H6M A;  4YY3 H;  1J9O A;  3KBG A;  2EY6 A;  1HTP A;  2QCP X;  4OIJ A;  2J7Z A;  3F2B A;  2RSO A;  3M9M B;  1HNX H;  5K5P A;  3RIZ A;  4IUR A;  1IOV A;  1PX2 A;  2C28 A;  5JQW A;  2H5X A;  3RV3 A;  5KFF A;  4DL6 A;  2MNA A;  2W6M A;  4EBD A;  1TWA A;  1B53 A;  1X55 A;  5EAY A;  1XPO A;  1CQJ B;  3T5K A;  3QJY A;  2QIL A;  1TAE A;  4J9Q A;  3PQI A;  1QB5 D;  3KLR A;  4X62 L;  1TWH A;  5KT5 A;  1VQP A;  3BAA A;  2JA5 A;  3GTP B;  5KFB A;  3BYT B;  3A5Z B;  5FJ8 H;  1M4V A;  2Q8I B;  1OO9 B;  4B3M H;  1SNQ A;  3VR4 A;  2G5D A;  1TWA B;  2H1E A;  3IKJ A;  5I4D A;  3E3X A;  2YZG A;  1SMX A;  3CHB D;  3HFZ B;  2PPB C;  2F0J A;  3S1M H;  4DV2 H;  1PLF A;  1HHV A;  1EIH A;  5LMN W;  4GOP B;  1HJP A;  1SR3 A;  2E76 C;  2R7Z H;  4QW8 A;  2HHH L;  2V58 A;  1DZ1 A;  1VQF A;  2EJM A;  4WFN 3;  2DZD A;  2JN4 A;  4O3O A;  5IWA L;  4A3F H;  2E5L L;  5M5X B;  4GNX C;  1SFO B;  3CD6 A;  1C9O A;  1KJ8 A;  1H9J A;  3NBH A;  2XCA A;  1X32 A;  4FF1 A;  2BCO A;  2BE5 C;  1B9N A;  1HNW H;  1FJG H;  4H13 C;  4A2A A;  3BVG A;  3P1H A;  5KFM A;  3KLW A;  5CV7 A;  5L9X A;  4FF2 A;  3MWD A;  2Z4I A;  1DCZ A;  5IGC A;  3JRW A;  4EGV A;  3GTQ B;  3TP6 A;  2EY1 A;  5A2Q L;  2VPQ A;  2CZG A;  1DGS A;  1B3A A;  3H4D A;  2CVR A;  2JA7 H;  1STY A;  1HZB A;  3FMA A;  5KFR A;  1J5E H;  2ZDQ A;  2OTJ A;  4XQJ A;  4B3S L;  2IA6 A;  3H20 A;  4QQB X;  1GHK A;  1PYS B;  3A0J A;  4TRD A;  3HOW B;  2D9U A;  4TV9 F;  2B63 G;  3PO3 H;  2XWJ B;  3VR5 A;  3M7N A;  4DV5 Q;  3AFP A;  2E2I B;  3GQC A;  1N32 L;  4FF3 A;  4DXG A;  1VQM A;  4JI5 Q;  2CCZ A;  4ECY A;  2ALY B;  2AGP A;  4DFA A;  3K8A A;  1HFG A;  2EDG A;  2F0U A;  3GIQ A;  1BR9 A;  4YWM A;  4GN3 B;  1QZH A;  3RZD H;  2KHI A;  2BH2 A;  2XGP A;  2NU7 B;  4JV2 A;  3SE0 A;  2C9O A;  2KJX A;  3SK6 A;  2F3I A;  1EZ1 A;  1SRU A;  3VA5 A;  4J15 A;  4GS3 A;  1TT2 A;  3D6W A;  4NB3 A;  4OWT B;  2MPM A;  4IZO A;  2N49 A;  2PYK A;  4LFC Q;  1LTI D;  2KBN A;  2R92 G;  1NY4 A;  4MTN A;  2VQF L;  3NTK A;  4A3E H;  4POG A;  1JOR A;  5CV9 A;  1CSP A;  1TY0 A;  4B3M L;  1D2B A;  5GAD C;  3S14 H;  4GC6 A;  5KG0 A;  1YI2 A;  1IL2 A;  2B8F A;  5BR8 L;  4YIJ A;  4X64 Q;  4JYA Q;  3RAQ A;  2F0W A;  1YHA A;  1VQO A;  2F3W A;  3V05 A;  2F0K A;  3SXH A;  1PHJ A;  4HSP A;  2K50 A;  3V2T A;  1ICW A;  4Q5V A;  1K83 A;  2QF7 A;  5C4J H;  4KMU C;  4EFB A;  3Q8Q B;  2B2V A;  3HG9 A;  2RDG A;  3TRZ A;  3KK7 A;  1PRT C;  1NE3 A;  1TWF H;  2RSN A;  3VMM A;  4GLA C;  3CCL A;  1LTG D;  1F2Y A;  1VQN A;  2YCH A;  1UC8 A;  4Q8F A;  2B39 A;  5I2Y A;  3TRE A;  3HP3 A;  5BN5 A;  5LXT F;  4OO1 G;  3M4O B;  1S3O A;  3BA9 A;  1DOL A;  2EYM A;  2M00 A;  4O42 A;  5FK9 C;  3GTJ H;  1DV1 A;  2PI2 A;  4K6L A;  3QOL A;  1CHP D;  5D1P A;  4KTA A;  3ICE A;  2NVY H;  1RJR A;  2R7L A;  4O3Q A;  1XNQ H;  4C5C A;  1QCB D;  3PUW A;  3C0F B;  4R8U B;  5JPM C;  1WTH A;  4R8N A;  3HOY G;  2EY5 A;  5CBE E;  1RTN A;  4Q45 A;  3OTO L;  4A3F G;  1HZ9 A;  3ULJ A;  1UNN C;  2JYO A;  4J0M A;  5FLM G;  1RK5 A;  3NHH A;  5NUC A;  1BF4 A;  2ALZ A;  1JR0 D;  4RGT A;  2W57 A;  1EZ8 A;  5D14 A;  4JI1 H;  2AQ3 B;  3QO2 A;  1S0N A;  3MVV A;  3H0G H;  1TY2 A;  5FLX L;  4YJ2 F;  3ULP A;  1IW7 D;  2BE5 D;  2Z9H A;  1YNX A;  2CW0 C;  4YY3 L;  2J6T A;  1AUV A;  2W9B A;  1MJE A;  5IGD A;  3W5O A;  4XX0 B;  2A6E C;  4DR6 Q;  4A3C G;  3DUZ A;  4JI7 Q;  4L1K A;  4CGY B;  3L4K A;  1PV4 A;  3K57 A;  2AGQ A;  1L0X B;  4BBR G;  3MWM A;  3TIG A;  1JWU D;  2LXK A;  3FRP B;  5ELN A;  2P5Z X;  1EHI A;  3VPD A;  5IGB A;  3TS0 A;  4K0K Q;  4DL5 A;  4RFB A;  5KG3 A;  2A68 C;  2PMZ B;  3DM3 A;  3KJP A;  3CAM A;  2DPI A;  2Q2T A;  1TS3 A;  4JI4 Q;  1M8A A;  2W6Q A;  2XVS A;  3A7L A;  1O7Y A;  1K83 H;  3OWE B;  4OWX B;  2F4I A;  3VR3 A;  3S2D B;  4XYL B;  3STB C;  2RCF A;  1EY8 A;  5EQ0 A;  1TWF A;  4JI1 Q;  4IUP A;  2I80 A;  2HCC A;  3SI8 A;  3FMC A;  5IYC H;  4JI4 H;  2W9C A;  3VYT A;  3HOX H;  1VQG A;  3I73 A;  1X6O A;  5DLQ E;  4KKU A;  4LF7 Q;  5KT7 A;  2WAQ A;  3EA6 A;  4TVA B;  1I94 L;  2KCM A;  2XSC A;  2EQS A;  4BBS B;  3GTJ A;  3J81 E;  3NQI A;  4WJ3 M;  3JAM i;  4FP5 D;  5JAV A;  4IWY A;  1SYB A;  2YV5 A;  3QIA A;  3UDG A;  5BPF A;  4IUV A;  2YU9 H;  4R4Q A;  1TII D;  2WYO A;  2WB1 B;  5C4Z A;  2A68 D;  2NU9 B;  3CCU A;  4JOI C;  2R3Z A;  5C3W A;  2FJ2 A;  4F4Y A;  1KDC A;  3S1N H;  1D1K A;  1GHJ A;  2RQX A;  4M1U B;  3NXW A;  4J6H A;  1S4Z A;  1EIF A;  1HNZ L;  3TZU A;  1A3T A;  1Q3L A;  4LF5 Q;  4DUZ Q;  2ZDH A;  1N32 H;  3HRZ C;  3PV0 A;  4G7H C;  2HDM A;  4GNX B;  4DV3 H;  1HR0 W;  3V6H A;  2RHS B;  4I65 A;  4DXF A;  3GTM B;  1A9X A;  4HSV A;  4A3I G;  1YIJ A;  3N6X A;  4FXD A;  3G71 A;  4R4T A;  3M4Q A;  3VYR A;  4YWK A;  1EFI D;  4WJW A;  3RNU A;  1KJI A;  4HNV A;  1VQD A;  4RGO S;  1SE8 A;  2IHF A;  4DR2 L;  1K9M C;  3H15 A;  4GKJ Q;  4NP5 A;  1SE2 A;  2WB1 E;  3MFI A;  3M9O B;  3HOZ B;  2R6G A;  4LF6 Q;  4DA2 A;  2XRQ D;  5C6A A;  5M5W H;  5C0X G;  3K58 A;  5KFX A;  4JI2 L;  2HVS A;  4DAY B;  2EPB A;  3ND9 A;  3RZD B;  3CCM A;  5C0X J;  3DWQ A;  4F8M A;  1F9Q A;  4UHV A;  5CA0 F;  1LYL A;  1HNZ H;  1BXT A;  4MV8 A;  2W7O A;  4ZAI A;  4NXN H;  3UE1 A;  4UAI A;  4DV4 L;  4IWX A;  1STN A;  2J9G A;  2YRW A;  2AMC B;  1IKM A;  1K1Q A;  4NPS A;  3R93 A;  1A15 A;  1IW7 C;  5I9P A;  1Y8N B;  1KJQ A;  1UAP A;  4LFA L;  3S14 B;  4XZ3 B;  2CW0 D;  3R2T A;  2UVU A;  3CU7 A;  3MXN A;  5EGT A;  4NXN Q;  3RBD A;  4DV3 Q;  4KY6 A;  5BPH A;  3BZC A;  2UUC Q;  1NMG A;  1F2L A;  2JXM B;  3AFQ A;  4TUY F;  1TA8 A;  3TBI B;  5KFU A;  3Q24 A;  4RB3 C;  3GV7 B;  4N9P A;  1ESR A;  2K7V A;  2Q8R E;  4C3J B;  4N9T A;  2CW8 A;  1YJ9 A;  3CC4 A;  2VUM B;  2SDF A;  3OSO A;  4JOI A;  2PN1 A;  1SAP A;  3NTH A;  2L5T A;  1KLG D;  2Q2H A;  4G7Z C;  1VQ5 A;  2ASJ A;  3W1B A;  2B2W A;  2OT2 A;  4HR7 A;  2YTX A;  2JEG A;  3R2I A;  3BJU A;  3F2C A;  4XT1 B;  3I4N B;  3GIL A;  2PI2 E;  4KI0 A;  1S72 A;  4PQX A;  1PH2 A;  2WE6 A;  1V43 A;  5IIF A;  3T1H L;  5EWE A;  4M7E A;  1HXY D;  3R23 A;  3OMG A;  3K5M A;  4CDC C;  3BQ2 A;  4JYA L;  4NMZ A;  1G6Z A;  5KT2 A;  1V4Y A;  1SLJ A;  1MKH A;  1JXL A;  3EFX D;  5EPJ A;  5KFZ A;  2M9V A;  2DNE A;  4LUZ A;  3PW7 A;  3PIO 3;  5KNB A;  2WKC A;  4A3F B;  2Y0S A;  4IR9 A;  3FKI B;  3W3A A;  4B3R H;  2F0I A;  5ELF A;  1K8A C;  4I50 F;  3RD4 A;  1S0O A;  3J80 i;  1JE4 A;  4FBU A;  3QZ7 A;  5IY0 A;  3KLS A;  1PXU A;  1IZ6 A;  3TIN A;  1OXX K;  1A6X A;  3GO5 A;  2CFM A;  1PTO F;  1C0A A;  4O3S A;  2B2W C;  3UFX B;  1G2S A;  2UXC L;  4J9R A;  2UVR A;  1ZET A;  4JI3 Q;  1XYI A;  3FKI G;  4AYB A;  4WD3 A;  2RDH A;  4C2M H;  3BJY A;  5GRO A;  4JI0 H;  5KFC A;  1JB3 A;  3OTO H;  4EEY A;  1YHQ A;  3J7A V;  1B70 B;  4R4I A;  1KIX A;  5JEA J;  2VW9 A;  1KXL A;  1L0W A;  1RHP A;  1W6J A;  4ECV A;  1M0W A;  4X62 H;  2Z1C A;  3CRL C;  4R4C A;  2YTV A;  3DM1 A;  4MA0 A;  2JA6 A;  1BDO A;  1Q8K A;  5EDW A;  3J7Y W;  4XYM B;  2F3V A;  2IP4 A;  1S97 A;  1FNV A;  1GYF A;  5KG6 A;  3A7A B;  4MN3 A;  2V9W A;  2QYZ A;  4OO1 H;  2KEE A;  3SK4 A;  1R9T B;  4QWD A;  2FLP A;  2FIN B;  5FD6 A;  4X62 Q;  1RK6 A;  3RB4 A;  1Z9F A;  3VA7 A;  5BN4 A;  5M5X H;  2F03 A;  1S03 G;  1CKN A;  2YZM A;  4HIM A;  2YRX A;  4J9L A;  4DV6 L;  2RHQ B;  5JPN C;  2WAQ B;  3R8B A;  3H0G G;  2E2I H;  3N40 P;  4UY8 C;  1L0Y B;  5M3M G;  1XXG A;  1M6V A;  2BDN A;  5FPR A;  1XJV A;  2AWO A;  5H80 A;  2F0P A;  3BVM A;  3CW2 C;  1HR0 L;  4O2A F;  2ICE C;  1PFN A;  1EYG A;  2WFW A;  1X56 A;  2EYL A;  3MWE A;  4Q44 A;  1RIP A;  1S68 A;  1EIY B;  1ILP A;  4K6D A;  1JDE A;  1L1O A;  4HJ9 A;  3EPI A;  4DR5 Q;  1LTL A;  1QG7 A;  2I87 A;  2R92 H;  1KEE A;  1EY0 A;  5EKK A;  2XN9 C;  5C3X A;  4IN3 A;  3PO3 B;  5L1I A;  4UCS A;  4JBJ A;  1AP0 A;  3G7L A;  2K75 A;  4JI0 L;  4IUN A;  2I0Q A;  4A3D B;  3KDF B;  4F7X A;  3LNN A;  3RJ0 A;  1Q1B A;  4LF5 H;  5HBR B;  1NJI C;  4RKB A;  4UPA A;  1PRT B;  1Y1W H;  5JVL A;  2E2H H;  2B2T A;  3DEP A;  3I12 A;  4A3K G;  1WCM A;  4EYI B;  1HZA A;  5CC4 A;  3IAY A;  2K04 A;  1IYU A;  1TR5 A;  3CQZ B;  2KUM A;  4R9W A;  5KFS A;  5DQH A;  2VXW A;  2B2Y A;  2J4X A;  4FO2 A;  1KD1 C;  4PV1 C;  2F0E A;  2VZA A;  3SVM A;  2JA8 H;  4JI8 L;  1U9R A;  3UDF A;  1O7I A;  1FGB D;  2HVR A;  3UQ8 A;  4DR1 L;  4OO1 I;  4K8J A;  5KNC A;  4BY1 B;  4RU9 A;  3UI2 A;  1SMY C;  1SBB B;  1MSH A;  3WWV A;  1KL9 A;  3J81 j;  1HNZ Q;  2A73 B;  2JA8 G;  4DN4 M;  3ERO A;  5ELE A;  2XRS D;  3RLO A;  3WO0 A;  2FJZ A;  4A3I H;  1HTL D;  2PQA A;  1M90 C;  2RKS A;  3MEH A;  1SN8 A;  5EKI A;  2NZH A;  4DUY Q;  4BY7 H;  2NB0 A;  2KHS A;  3KJO A;  3OHB A;  1IL8 A;  1E2Z A;  4UCV A;  2V4R A;  5IYD G;  2UXB Q;  1R4Q B;  4M8A A;  4JI8 Q;  3S24 A;  2UU9 Q;  1TWA H;  2QDL A;  1TKW B;  1WFQ A;  1WYD A;  4JI1 L;  4A3E G;  3OIQ A;  2F0F A;  2B63 B;  2NVY B;  2IMW P;  1AFP A;  4DV2 L;  3I55 A;  1X54 A;  2B2T C;  1CFM A;  3DWP A;  4J9K A;  1AN8 A;  2SNS A;  5CMD A;  3CCV A;  4GC7 A;  4BBR B;  1LV9 A;  2SOB A;  3GV3 A;  2PNR C;  3I91 A;  4HNT A;  3GQB A;  4LFA H;  1VQH A;  3QR8 A;  2IX1 A;  4CBV A;  3N42 B;  2A8V A;  2IX0 A;  4KD3 A;  1R9T A;  2D62 A;  1ET6 A;  4IJH A;  1K8O A;  1D5M C;  4DF7 A;  3S1M B;  1O75 A;  3T1Y Q;  3PW4 A;  1BBX C;  5IT9 L;  1HNX Q;  1MJC A;  4DR4 Q;  2SCU B;  4K14 A;  4IR1 A;  1XMQ L;  4CC5 A;  3MJF A;  1QNK A;  1HNX L;  3RF2 A;  2QEX A;  4DUZ L;  4B3T L;  1STH A;  3BVZ A;  2E2H A;  3VPC A;  4I4T F;  3ZJY C;  3Q8D A;  2ZJR A;  4O3P A;  2BA1 A;  4B3T Q;  2OF1 A;  2RCN A;  5IT9 c;  1B2T A;  1K3R A;  1KNE A;  2DY7 A;  2F0T A;  4YBZ B;  3FKI H;  2KCC A;  5I47 A;  1MZB A;  2UXB H;  3G4S A;  1IBL Q;  1Z47 A;  5DNF A;  5IYC G;  4RH6 A;  4ZRZ A;  1RJQ A;  4IHJ F;  5K2M A;  1SE4 A;  2JA7 A;  2F0L A;  1C48 A;  1N36 Q;  2MGS A;  3X3N A;  2WP8 J;  1EY4 A;  1B50 A;  1WTX A;  2VNU D;  4J9P A;  4CHT B;  4LK1 C;  1HRJ A;  3MA2 B;  1GLV A;  3T4A C;  5FLX c;  1J5E Q;  1E4G T;  4C2M B;  3AMU A;  2A6H C;  1PH4 A;  2D0P A;  3CCJ A;  1SNP A;  3OTO Q;  1RTO A;  4YAJ B;  1U5K A;  2N88 A;  5KFV A;  2UUA L;  2L11 A;  1OXU A;  5J39 A;  1B8A A;  2B8G A;  1GO3 E;  3I8Z A;  1OXV A;  1S10 A;  4LF4 Q;  1R4P B;  4ED6 A;  3FVQ A;  2UXB L;  1SXT A;  3FDT A;  4RGM A;  1D8L A;  2EXZ A;  1GUS A;  2WAQ E;  2YW2 A;  2ZTD A;  2HVQ A;  4X65 H;  1ENC A;  1Q46 A;  4G7O C;  3A56 A;  3LML A;  5DG9 A;  1IYJ B;  1GOZ A;  4OGQ C;  3J81 i;  1NSN S;  3N43 B;  1AW7 A;  1QOH A;  1QUQ B;  1C7Y A;  2NN6 G;  5EWF A;  3HBL A;  4DR7 L;  3JC6 6;  1RYS A;  3R3O A;  4YQW A;  5A35 A;  1UE5 A;  4UDU C;  4LSA A;  5GQO A;  2K01 A;  2K28 A;  2W7P A;  2DJG C;  4DL4 A;  2WAQ G;  5C4J B;  2C00 A;  5JH7 F;  1GJX A;  4RNM A;  1WTW A;  1HR0 H;  1VQA A;  2WV6 D;  2W8L A;  3RUZ A;  5JJL A;  1A62 A;  3K81 C;  3A74 A;  4O3N A;  3QB3 A;  1N8R C;  3N44 B;  3QOJ A;  4ME3 A;  3GIP A;  1K3B C;  4ID6 A;  3GIJ A;  2HHH H;  1I4P A;  4R7R A;  2JA5 H;  1U4L A;  2OQ0 A;  4Y8V B;  4HR7 B;  4XQN A;  2IHE A;  2VOB A;  4UP8 A;  1Z2P X;  3PR5 B;  5EJW A;  1HFN A;  3HKZ A;  1MSG A;  4K2K A;  1XNR L;  4EYH B;  1QVC A;  5KFA A;  3D4D A;  3T51 B;  5C1O A;  1A2T A;  1LM0 A;  1SYF A;  4ZI7 F;  4JV5 H;  1SFO A;  4FVM A;  1IBL L;  4LH7 A;  2YTY A;  3CPF A;  3OIP A;  1EFW A;  2FKL A;  4OX9 L;  4LFC H;  1Y1W G;  4YHH Q;  1EOV A;  1H9S B;  4DLK A;  2RBM A;  1U4M A;  1Q90 A;  4YCW A;  4I7Z C;  1WTV A;  4LF9 Q;  2WDT A;  3ER0 A;  5FKA C;  3J7Z C;  1YNJ D;  4RB0 A;  1I50 B;  3BYY B;  3S1Q B;  1V9P A;  5FD5 A;  3K7A H;  4ECR A;  3K3P A;  1E1T A;  5DGB A;  1CTM A;  1N48 A;  2EOT A;  2W6N A;  4RG1 A;  3RZO H;  4JI5 L;  1ET9 A;  4GNX A;  3IN5 A;  3ORR A;  4HID A;  2Z4H A;  2R8I A;  4J1M A;  1Z2N X;  2X69 A;  2ZM6 H;  2IT1 A;  3RB6 A;  3T16 A;  4C5A A;  4DR3 H;  4KLK A;  1V1Q A;  1VQ4 A;  1PK8 A;  3I4N G;  4DGZ A;  1PVO A;  3GTO A;  1KDA A;  5HUR A;  4K5V A;  2W6P A;  3I4N H;  2D0O A;  3TDQ A;  3PO2 B;  4BY7 G;  3M4I A;  5L1L A;  3OWF A;  1ASY A;  1PH5 A;  3H0G A;  3RMH A;  2NUA B;  5KFJ A;  1GUW A;  1HPC A;  4Q0F A;  4K5W A;  3QWN A;  1I4G A;  5M3M H;  1IKL A;  4GKK H;  2E2J B;  1SEI A;  3RR5 A;  4X65 L;  5LYJ F;  1BXR A;  4A93 G;  1IOW A;  2QK4 A;  2V1C C;  1LLR D;  3U4Z A;  2FPI B;  4JG2 A;  4BY7 B;  4KKS A;  1PH1 A;  5J2U F;  5DQG A;  4J8Q A;  1EYC A;  3SGI A;  4LF8 L;  1BQQ T;  1KJJ A;  1X9N A;  4X66 H;  1A0I A;  2A19 A;  4JI8 H;  2K5V A;  1G29 1;  3EJI A;  4DK0 A;  1HH2 P;  1NR4 A;  3HOX G;  3S2D H;  2A6H D;  3VPB A;  4JI3 L;  4IRK A;  1II3 A;  1ESF A;  3MC0 B;  5KT6 A;  1PH3 A;  3N6R A;  2B63 H;  3PO3 G;  1JWS D;  5C5M A;  1BCP B;  4DNT B;  1YEZ A;  4EQO A;  1U0L A;  1ZHQ A;  4CJ2 C;  5EOY A;  2NVQ H;  2ZM6 Q;  1E1O A;  2OQK A;  4MZ9 A;  2PVP A;  5M3F H;  4TQS A;  2R7F A;  2N78 A;  3MTS A;  2Q2I A;  4RB1 A;  2LSS A;  2L4N A;  3EQL C;  1JIC A;  1EY6 A;  3NWT A;  2Z0S A;  2MJ8 A;  3QFF A;  3UDI A;  1ENA A;  4JI7 H;  2N55 A;  4LWC A;  2V59 A;  1EUC B;  4PG3 A;  3M3Y B;  4ZQ3 A;  2I5M X;  2K5H A;  2LMC B;  4LF7 H;  1SDF A;  4FDB A;  3Q8P B;  4XT3 B;  2F0M A;  3TEH B;  4CDD C;  2RDF A;  4JI6 Q;  4O4I F;  4ECT A;  5C0X I;  1SEB D;  2GLT A;  1PZK D;  4O2D A;  3CPW A;  1U4R A;  4DK6 C;  1HA5 A;  2PMZ E;  2MP1 A;  1KHI A;  3MEF A;  1UE1 A;  4DV2 Q;  4X66 Q;  2LFN A;  3KYH C;  2VUM A;  3CC7 A;  1K0R A;  3MWY W;  4P74 A;  2Y0S B;  2R92 B;  1V1O A;  2XNA C;  1GSA A;  5FO9 B;  1EU3 A;  3D4R A;  3S1N B;  1VQ6 A;  3CCE A;  5AFW A;  1HCZ A;  5D3I B;  2DN8 A;  1GUO A;  2X6G A;  4GLV B;  1E0B A;  3JAM L;  2ASD A;  3PIP 3;  5CAE B;  3T5H A;  1T9H A;  3L4J A;  1YHB A;  4OXP A;  1PTO D;  4DUZ H;  5E7N A;  2UUC L;  4G3I A;  4EX5 A;  5C4X B;  3GTQ A;  4XXE A;  3K59 A;  2NUC A;  4NXM L;  1Y1W B;  4IFD J;  2VB2 X;  2E2H B;  2HQL A;  3ULL A;  3V4Z A;  1PRT F;  1GGO A;  1UE6 A;  3RAX A;  5GAH C;  2R93 B;  3TP8 A;  4ZYS A;  4FU0 A;  2RGV A;  4YJ3 F;  1B9M A;  4OHJ A;  1CT1 D;  3GV5 B;  2FLN A;  2OXP A;  4OWW B;  4NXN L;  5E1F A;  2WB1 A;  2R7K A;  2OH2 A;  1RF2 D;  2AQ4 A;  4QUC A;  2EYF A;  1EL0 A;  3SE7 A;  2K05 A;  1KAB A;  4JI6 H;  1RKN A;  4X65 Q;  2K33 A;  2PQA B;  5CA1 F;  2BQU A;  3LP8 A;  2AHO B;  3EN2 A;  4BWS C;  3HKZ G;  2HT1 A;  2WKD A;  3I70 A;  2PMZ A;  2ID0 A;  1SYX B;  2DJF C;  5KT4 A;  1NCV A;  1W3S A;  1QNU A;  1RCV D;  2F1M A;  5M5Y B;  5COR A;  1WR2 A;  3MHB A;  2A74 C;  1MHW C;  2Q8T A;  4C3J H;  3RGZ A;  4A3I B;  2NTS A;  3F2D A;  2XIW A;  4M9U A;  2R8H A;  3T1H Q;  4BY1 H;  1G6P A;  3MR2 A;  1XNR H;  3CMA A;  1LTR D;  4C1N K;  4A3C H;  1N33 Q;  5KG1 A;  1E3P A;  2BA0 A;  3PUX A;  4GZY C;  1W96 A;  3V6K A;  5KFG A;  3S15 H;  2JA9 A;  1XMO Q;  3PIP A;  4HNU A;  3A5U A;  2R7Z A;  4A93 H;  1WJJ A;  2A5H A;  3L7Z C;  4DAY A;  4KHZ A;  3CQZ H;  2W71 A;  3GLK A;  1XMQ Q;  3AB9 A;  5LHY 1;  2IL8 A;  2VUG A;  2C2E A;  1H9K A;  1KQS A;  2A1A A;  1F9R A;  2NVX B;  5KFD A;  4JV5 Q;  1X3F A;  2HCI A;  2FFK B;  3NEM A;  3HZX A;  3M9B A;  2VA2 A;  1MIU A;  5BN3 A;  3HOY H;  1TWC H;  4ECW A;  4EGQ A;  3OUU A;  4TQR A;  1D7Q A;  2UUB H;  4HCE A;  4XQQ A;  3KFU A;  4UFZ A;  2B2V C;  4P73 A;  3TSS A;  1IBK H;  5JVD F;  2UUC H;  3WO1 A;  5EKL A;  4ALP A;  3K5N A;  4JK1 C;  2XD4 A;  3HOV B;  3VDY A;  3H3V C;  4Q0Y A;  4F4X A;  3T1H H;  2F0N A;  3OYY A;  3SHL A;  4JI6 L;  4LSX A;  2JA7 G;  4BS9 A;  3PO2 H;  4HJ8 A;  5CV8 A;  1XMO H;  2E5L Q;  4JVZ A;  3GTL H;  1XDN A;  3BG5 A;  5IOC A;  5F9L A;  1FVI A;  3ONA B;  4DL2 A;  5BR8 Q;  1YIT A;  1UUP A;  3AU7 A;  1W2B A;  1SNM A;  1VDZ A;  2Y0S G;  4IUU A;  3IFD A;  1QE6 A;  2RVL A;  3K0Y A;  1EOT A;  2E2J H;  1VQK A;  5KKN B;  4JI3 H;  1CZG A;  2F4V L;  4BA2 I;  1AH9 A;  5KFW A;  3JSL A;  3MR3 A;  2J6S A;  5C4X G;  3S9W A;  3U58 A;  4MV3 A;  1BOS A;  2VR1 A;  1ONL A;  1Z7T A;  4DL3 A;  1SNO A;  2OLS A;  2DPJ A;  4J9O A;  2CQO A;  3A8K E;  1TWG H;  3A8J E;  4HJ7 A;  5IYZ F;  1YJW A;  1MBY A;  2MO1 A;  2R6F A;  1SYC A;  5IP9 G;  3Q0A A;  2PQE A;  2QGQ A;  4UP7 A;  5A2Q W;  4TSS A;  4FXK C;  3CRK C;  4ED2 A;  3KHR A;  1XMO L;  1WSC A;  2I07 B;  3J80 E;  4ZOL F;  1DM0 B;  4QY7 A;  4ECS A;  3I4M B;  4QWB A;  4QIW A;  5DG8 A;  1EQQ A;  3KAL A;  3RGX A;  5M5W B;  3H3V H;  1KAA A;  3FP9 A;  1O7Z A;  5C8Y F;  4MTK A;  2DNC A;  1PZJ D;  2DUD A;  3CQZ A;  5F9N A;  4QWC A;  5LMU H;  1PH6 A;  3M4Y A;  5ELB A;  5IE8 A;  1JLL B;  4JW0 A;  4RCN A;  4MV1 A;  2FHT A;  4ZLT F;  2RF4 A;  2PZU A;  1SND A;  2XTI A;  4A3J B;  2IPK D;  3GTG H;  1GM5 A;  1EWH A;  4MIU A;  3CME A;  3PW0 A;  4K5X A;  4B9W A;  1PH8 A;  3S17 B;  4DV6 H;  2L0C A;  5LMU Q;  3S1R B;  4NDX A;  4PNY A;  2NVY A;  2R92 A;  3BDL A;  2HIX A;  1BCP F;  2NVT H;  4LH6 A;  5LMN H;  2UUB L;  3BA8 A;  4KN4 C;  3GTJ B;  1H9S A;  2LXJ A;  3I7F A;  4IO9 A;  4ED0 A;  3TS2 A;  1LTT D;  1CQF A;  2F0O A;  5IP9 H;  1LTS D;  4IPG A;  1FJG L;  1HNW L;  2UXD Q;  2JE6 I;  2EE1 A;  2EYH A;  1I4H A;  1F9S A;  2K32 A;  1I4Q A;  4CKE A;  3K5O A;  4LF9 L;  4U67 3;  2OCE A;  2W9A A;  1CE8 A;  3KF6 B;  2W6Z A;  5KFT A;  3GTL A;  4MV9 A;  3T13 A;  1Y1V A;  1B33 N;  3TP5 A;  3L9A X;  1I6H B;  5HGQ A;  3J80 c;  1GXD C;  1J5E L;  1RD9 D;  1Y8O B;  4LF7 L;  3SK8 A;  2F0V A;  1NAP A;  3D4W A;  3EIV A;  2AGO A;  4DV1 Q;  3GTM A;  1TS5 A;  2KCN A;  3BQ1 A;  3HB9 A;  1Y1V B;  2FPG B;  2DGY A;  2KHJ A;  3BZK A;  1I4R A;  4G57 A;  2N8N A;  3D8G A;  1Y14 B;  1CA5 A;  5AJ3 Q;  3C1E A;  4EQN A;  3CC2 A;  3I4L A;  1EU4 A;  4CJ0 B;  1I50 H;  4JCV E;  3S1Q H;  4FYD A;  1P8L A;  4HTH A;  1JT8 A;  3LWB A;  4PDB A;  3OW2 A;  2P0A A;  2DIK A;  5KX5 F;  1TWH B;  1G8Z D;  4WBN F;  3PR4 A;  1WTR A;  2K5N A;  3K5I A;  2F4V H;  2JEI A;  4HN7 A;  3P20 A;  1V8Q A;  5I2X A;  3HXL A;  2JSO A;  1YJN A;  2AUJ D;  5M3M B;  4XTC S;  4JI2 H;  2HUG A;  1I7N A;  4Z9C B;  1FNW A;  4A3G H;  3HGB A;  4IRD A;  5IGF A;  5FLM H;  3ZYY X;  2JA6 H;  4IPH A;  2ZJP A;  3G6V A;  1CZW A;  5I6W A;  3JSN A;  2F4V Q;  1VF5 C;  5CV5 A;  5EPK A;  1EUD B;  2F0G A;  4DK3 C;  2A69 C;  1N34 L;  2V5A A;  4DV4 H;  4APM A;  1X3G A;  4DV0 Q;  1TVX A;  4N8X 1;  3IG0 A;  1JE5 A;  4KY5 A;  4DV7 Q;  1CHQ D;  3K7A B;  4IJL A;  4R1J A;  2C2D A;  1C30 A;  2MQH A;  1RDP D;  5IYB G;  3V4S A;  4QJF A;  4L5S A;  4LAA A;  1ILQ A;  5E4X A;  1ZQ7 A;  3RV4 A;  4DV1 H;  4JBM A;  1STE A;  4APV A;  2L12 A;  2NVQ B;  4GKJ H;  2B2U C;  4ME5 A;  1I5F A;  3J7A K;  1R9T H;  2YU9 A;  4DR2 H;  4JV0 A;  2AU0 A;  2JK8 A;  1NUC A;  4IFD G;  3E0E A;  2L9H A;  4QIW B;  5EBD A;  3M85 A;  1P16 A;  1Q82 C;  5T14 A;  2TSS A;  2O4X A;  5KND A;  2C22 A;  1EWI A;  3MR6 A;  1A8V A;  2ZM6 L;  2VUM G;  4I55 F;  4LF6 L;  2MO0 A;  2C5C A;  1E7Z A;  4RCO A;  1GUN A;  2NTT A;  2GPW A;  3BZD B;  2UUB Q;  4MAM A;  3R5X A;  3S16 H;  1FNU A;  2QA4 A;  5C44 G;  3M3Y H;  4QF4 A;  5I6Y A;  1TS2 A;  2YYZ A;  4MTD A;  5L1K A;  4H7B A;  2A69 D;  1K8G A;  1JWM D;  2FPP B;  5GON F;  1E22 A;  1I6V C;  1N56 A;  2KED A;  2K5W A;  4PZ8 A;  4DV4 Q;  1E4F T;  2PW5 A;  5IP7 H;  4ZCK A;  1X3E A;  1ZEQ X;  5GAG C;  3CCR A;  1BNZ A;  1BGW A;  3Q2O A;  2M2L A;  3E5S A;  4LFA Q;  3EBE A;  4E4T A;  3KHG A;  3HS0 C;  2Z6B A;  2I5L X;  5A2Q E;  3WOE A;  5T1I A;  3G6J B;  3GP7 A;  2L15 A;  1O78 A;  3D6C A;  1QWY A;  2EVB A;  2UU9 H;  2GVB A;  2NZO A;  3GV8 B;  1PRT D;  2L1B A;  3Q22 A;  3FEW X;  4DR2 Q;  1EQV A;  1PTO H;  1SSO A;  4ULL A;  2VS1 A;  3KF6 A;  3HOU G;  3R5H A;  2UVW A;  3A8I E;  4CKB A;  3PGZ A;  4O2B F;  1B44 D;  4MA5 A;  3PVX A;  1CQV A;  2J0T D;  5KYL A;  1KRS A;  4L5R C;  4BXX G;  1VKZ A;  5J1Z A;  5DGA A;  2D2C C;  3QZ8 A;  1BBU A;  4KHP L;  2LS0 1;  2GPS A;  1KTK A;  4A3K B;  2R87 A;  1N34 H;  3CCS A;  1XX8 A;  4DR7 H;  2CH4 A;  4J9M A;  4LMQ D;  3HKZ E;  1PYW D;  4DV5 L;  3N41 B;  4MNO A;  4NW2 A;  1FKA H;  2NBF A;  4IAJ A;  5J2T F;  5L37 A;  2R7M A;  3NE5 B;  1AEX A;  1J6Q A;  3JAM c;  1WCM G;  1CKN B;  1HR0 Q;  2Z6K C;  5M5Y H;  5D8D A;  5KFH A;  1ZYR D;  2G9D A;  1L2F A;  2MFI A;  4KHV A;  4FF4 A;  1H95 A;  3PW5 A;  4LNQ A;  2NZ1 D;  2KSW A;  4LF4 H;  1OXS C;  2HD3 A;  2ZT9 C;  3L2P A;  3RTX A;  2K1B A;  1BNC A;  1IBL H;  1E24 A;  5C4X H;  2K03 A;  2JA5 B;  2EJF C;  2ZJT A;  1UE7 A;  4AQY Q;  4YP3 A;  2A6E D;  4DAP A;  1Q86 C;  1IHZ A;  3Q6S A;  3WOF A;  5C44 H;  1LTB D;  1WD0 A;  3BS1 A;  5D1O A;  4O4H F;  4DV5 H;  4NLG A;  5EPL A;  4A3L G;  1NMF A;  5C3E B;  2QEJ C;  3H4B A;  2F0D A;  3MXP A;  2AQ1 B;  5KG2 A;  3G6Y A;  4BBR H;  3RN5 A;  3VYS A;  1WVL A;  1VQB A;  3C46 A;  4C3I H;  4YHH H;  1T5X D;  1HZC A;  3NQT A;  4QMG A;  5FJ8 G;  2EIF A;  1QVG A;  5LL6 X;  2VQF Q;  2R82 A;  1TWC B;  5IWA Q;  3NTI A;  4A3B B;  2W9B B;  2RDJ A;  5JUM A;  1U4P A;  4IZ8 A;  3TP7 A;  3QG1 A;  4A93 B;  1I6H H;  1EY7 A;  1HUM A;  1ZYR C;  3RZO B;  2MCT A;  3AEV A;  2HHH Q;  1CKO A;  1VQ7 A;  4UP9 A;  1B6S A;  1WCM B;  2F0H A;  2NVX H;  3I4O A;  2WB1 G;  2FE3 A;  2KEC A;  4DR6 L;  1PMR A;  3DXJ C;  4HJ5 A;  1AUX A;  1GKH A;  1EYD A;  4X64 H;  2WTF A;  5KFO A;  1PYB A;  2KVM A;  2BQ3 A;  2R8K A;  4DR4 L;  5FO7 B;  2JA6 G;  3G48 A;  4O1N A;  1S9F A;  4Q8E A;  2JP1 A;  3GTL B;  4DAM A;  4QCL A;  3MFH A;  3J81 L;  3P7J A;  4PZ7 A;  2ZDG A;  2O5J C;  4KY7 A;  1V1P A;  2F0S A;  1T36 A;  3G8C A;  2PO4 A;  3E9I A;  3BDC A;  1W6K A;  1Z2O X;  4UCU A;  1O80 A;  2VQE H;  1VQ9 A;  3HOV H;  1DYQ A;  1F2Z A;  5KFY A;  3NPP A;  3W2D A;  3GTP H;  5G3L F;  5ELC A;  4MV6 A;  1G51 A;  4DK1 A;  3M9N B;  1VMP A;  1V1P B;  5M3F B;  3GID A;  3TQT A;  5KFQ A;  5IGG A;  4IPD A;  1WH2 A;  2VQF H;  3K5L A;  2ICI A;  4XYO A;  3PF5 A;  3SEB A;  4C3J G;  4Y7N B;  1PFB A;  4DV7 H;  2TMP A;  4DKA C;  4TKO B;  4C3H G;  3PF4 A;  2E2I A;  4A3L H;  3WDN A;  4EBC A;  4PZ6 A;  2Z8L A;  4RKL A;  2VQD A;  5DM6 3;  3NWS A;  4LFB L;  4KV6 A;  2R7Z B;  5LP6 F;  1X3Q A;  4HMJ A;  2JA5 G;  2B3G A;  3TQ1 A;  1CSQ A;  2RDI A;  3KHH A;  5M9O A;  4GKK Q;  4DAV A;  1B6R A;  3KHL A;  3BG3 A;  5C0X H;  1TWG B;  4ZUI A;  4OON A;  3I56 A;  4K8I A;  2XCL A;  4YR2 A;  4ZHQ F;  4IUQ A;  3L3O C;  5JOB A;  3H94 A;  4A3J H;  2JEA I;  4L5Q A;  4AYB B;  4HIK A;  4L6T B;  4J9S A;  4DL7 A;  4X64 L;  4JUZ A;  1K0S A;  4UCR A;  3D31 A;  4A4I A;  5FLX E;  4E6I A;  1WD1 A;  4EGJ A;  4O4L F;  4DR6 H;  1F9P A;  2OEO A;  4EEQ A;  2E75 C;  3ERS X;  4HQ6 A;  3PZP A;  1WOC A;  3STB D;  1HQR D;  5LL6 b;  3E5N A;  4DUY L;  5I9O A;  3OPO A;  2K5Q A;  4B3M Q;  2WAC A;  4ZKC B;  4MV7 A;  4FXG C;  1DXM A;  1GD7 A;  3OMC A;  3HOW H;  4I7H A;  3OSN A;  2XWB B;  3IRB A;  1DOK A;  3NBH B;  4WOR A;  1K73 C;  4JC0 A;  2VB3 X;  4KJO A;  4LUO A;  2I46 A;  2E74 C;  4GOP C;  1I3Q B;  1MD2 D;  5CBA E;  2ASL A;  3A54 A;  1JOK A;  2KCT A;  5BMV F;  1CUK A;  4R8I A;  3CCQ A;  1KJ9 A;  4G4K A;  5T1G A;  4CDF C;  2XC9 A;  1D6E C;  3FDS A;  4KKT A;  3FPP A;  2O03 A;  4RB2 C;  4ECZ A;  4GLX A;  1KNA A;  3NBI A;  4ED1 A;  1D1I A;  2EZV A;  2FK3 A;  1A2U A;  2R8J A;  2RA4 A;  3N52 A;  2R93 H;  3GTK A;  1NBW A;  2F52 A;  3GTO H;  2R8G A;  1GVP A;  1QIL A;  5HV6 A;  3OHA A;  3T1Y H;  3MXN B;  3J7A F;  5EBC A;  5K36 H;  3GTP A;  4DR4 H;  3MXU A;  1T94 A;  3PUV A;  4HIO A;  2YS7 A;  3F2U A;  3S17 H;  2XIG A;  4YY3 Q;  1E4E A;  3RB0 A;  3Q8R B;  2UUA Q;  1ML0 D;  3K6O A;  3S1R H;  1JX4 A;  2YS6 A;  1VQ8 A;  4X3U A;  2PNH A;  3S15 B;  4ED3 A;  2BOS A;  5CGK A;  2NVT B;  1Y1V G;  2ENB A;  2O5I C;  1VMC A;  4C5B A;  1QUQ A;  5TSS A;  4QGU A;  2R7Z G;  4P75 A;  2D5D A;  1A63 A;  3HOW G;  2UU9 L;  1E4E B;  1SRO A;  2JEB I;  3Q8S B;  4QIW E;  4A3G B;  4O0A A;  3OHX C;  2B63 A;  1RL2 A;  4X3T A;  3PO2 G;  1E2W A;  4KHP H;  2H4O A;  3M7G A;  4DV3 L;  1BVS A;  1EY5 A;  3P75 A;  1TWH H;  3KLS X;  1N36 L;  1G91 A;  2R85 A;  3BAB A;  1LUZ A;  2XGT A;  4GKK L;  2AKW B;  3V6J A;  2JEF A;  1JJC B;  2QW7 A;  1XNQ L;  2L55 A;  2EYJ A;  5KGU A;  5C3E G;  1MGS A;  2YZN A;  3BDO A;  4BXX H;  3OUZ A;  1CM9 A;  1J8I A;  4IQZ A;  1VF7 A;  3L0O A;  2O2L D;  4X6A H;  2LY7 A;  4JPB W;  4KD4 A;  4YHH L;  5IYD H;  1TWC A;  3HOU B;  2Y0S E;  3ETH A;  1LT4 D;  4X66 L;  3U9S A;  4RNO A;  1PFS A;  5IGE A;  5LL6 S;  4QL5 A;  5DLG A;  1XNR Q;  1YNN C;  3E9H A;  4LUV A;  2CHB D;  2B2U A;  1N33 H;  1IBM L;  1KC8 C;  3TQY A;  1WTO A;  4BWG B;  2ZTE A;  2VY3 A;  4B9X A;  3S16 B;  5DQI A;  5D1O B;  3T5L A;  1JMC A;  1RYR A;  4DV1 L;  2JJQ A;  4IFD H;  4A3M H;  3GTK H;  2R93 A;  1S5D D;  1OXT A;  1BJT A;  4Q43 A;  5CB4 F;  4A76 A;  4A3D G;  1K1S A;  4LF6 H;  4S3S A;  1KLU D;  2W8K A;  4R4O A;  3SK5 A;  4IOA A;  4B3S H;  1M7J A;  1I6U A;  1F77 A;  4NXM H;  4JBW A;  4ILW A;  1D5X C;  3NK9 A;  1O7L A;  3D0F A;  1XTC D;  5FPO A;  4JYA H;  1WTQ A;  1XNQ Q;  4F4W A;  1DD2 A;  3K7U C;  4P72 A;  1Q81 C;  2BR0 A;  1JC7 A;  4CKC A;  1WTP A;  4F4Z A;  3W1G A;  2B2Y C;  4B08 A;  4RZR A;  1PTO B;  4OIK A;  1XMQ H;  3IL8 A;  3TME A;  3NEN A;  5C5J A;  3HOV G;  1L1O C;  2ZXO A;  3ETJ A;  5KT3 A;  5LMU L;  2AUK A;  1S40 A;  5KFK A;  1S5C D;  4C3H B;  2E5L H;  1I7L A;  1BCP C;  2HQE A;  3KBX A;  3CKI B;  1GUG A;  4DR3 L;  1AZQ A;  1XTD A;  2LKV A;  3HOX B;  5LA6 F;  4IRC A;  1HUN A;  5DAU A;  2VQE L;  2NN6 H;  2HIV A;  2UXC H;  3I90 A;  1XPU A;  1H9M A;  4DR3 Q;  5FLX W;  4AQY L;  3C2P A;  2QDB A;  3H40 A;  2NU6 B;  1CA6 A;  4ODG A;  2CQA A;  4JI4 L;  5CV4 A;  2YU9 B;  1JB7 A;  1IBK Q;  4FS1 A;  1E2V A;  4RGN A;  1BUV T;  1VS0 A;  3NGD A;  3PSI A;  4DV7 L;  5KIX A;  4NXM Q;  2K6A A;  2AQ2 B;  4P71 A;  5CR3 A;  4C1N I;  4A3E B;  4ZK9 B;  3C1F A;  3T53 B;  1UC9 A;  4XYQ A;  3ERQ A;  4BA1 I;  4IUT A;  1ZHS A;  4FS2 A;  1OWT A;  1B4O A;  4ED7 A;  1VQI A;  4EQ5 A;  1AN7 A;  1JOO A;  2V4D A;  3RN2 A;  1C8C A;  2I5H A;  4K0K H;  4NKL A;  1KBL A;  3LWU A;  3ND8 A;  4EBE A;  4C3I G;  4GOP A;  3URY A;  2JQO A;  2MHV A;  5ELD A;  4DPG A;  2B29 A;  3N8D A;  3WNZ A;  3J81 W;  4QWA A;  1BCP D;  2G9H D;  1JJ2 A;  4MTE A;  1VBG A;  2R86 A;  5J22 A;  1ZKO A;  4LJZ C;  2KQ3 A;  1Q7Y C;  4YAK B;  4ME6 A;  3GV6 A;  3F8T A;  4TV8 F;  1Y1V H;  3G6E A;  3BU2 A;  5IOD A;  3K3V A;  4C56 C;  1DV2 A;  4X3S A;  4F88 A;  2CW7 A;  3HOZ H;  1CS0 A;  4ECX A;  1SJH D;  4HYK A;  4WRD A;  1B1Z A;  1IYV A;  2PBZ A;  1CI3 M;  4IPC A;  5DLF A;  2IJ0 A;  3KF8 B;  3RBE A;  1QZG A;  1LT3 D;  2K52 A;  5KEE A;  2YYA A;  2EXD A;  1PFM A;  1EQR A;  3DWA A;  2GN5 A;  2ES2 A;  4JI0 Q;  3PMF A;  1Y1W A;  2PZW A;  4U7C A;  2FK2 A;  1Q12 A;  4KK7 A;  1YNN D;  1WCM H;  1PDQ A;  4RAZ A;  3KOJ A;  2DLN A;  2HDL A;  2R93 G;  3KF8 A;  3PUY A;  1EQT A;  2KEN A;  2E8G A;  3RLN A;  5EWG A;  2DY8 A;  2CWP A;  2N3S A;  2C2R A;  1LAC A;  2C35 B;  3UE0 A;  2UUA H;  4H02 A;  1UWV A;  5KFP A;  3GD7 A;  3H09 A;  2V4Q A;  2EJG C;  4FNF A;  2K5D A;  3H3V I;  4RWS C;  1EYA A;  1NNX A;  4IFD I;  1STB A;  1C4Q A;  4PMC A;  4A2B A;  3K5H A;  5LOV F;  2JA6 B;  4H44 C;  4RAY A;  5HGT A;  4J9N A;  1KAW A;  1SMY D;  2KA7 A;  2Q2U A;  4KHP Q;  3HOZ G;  2DWC A;  2AWN A;  4DV0 H;  1PZI D;  3IFT A;  4H0L C;  3RLF A;  3JRX A;  1FYC A;  1EEF D;  3VYU A;  4DU9 A;  5KRU A;  3EPG A;  4LMY A;  4A3B H;  2VA3 A;  4Y7N H;  2ZJQ A;  1Y69 U;  1H9R A;  1UNS A;  4ZQI A;  1JQY D;  2CWA A;  1STA A;  3J81 c;  1XPR A;  1N9W A;  1TQO A;  1PH7 A;  2ATW A;  5IP7 G;  5M3F G;  3GTG A;  4KN7 C;  1YVC A;  3PIO A;  4UCO A;  1S5E D;  4BBS H;  4F50 A;  1K83 B;  1XWE A;  1K8M A;  1WI5 A;  1ICF B;  1LO5 D;  1D5Z C;  1PTO C;  3K0X A;  4LFC L;  4EQP A;  4A3M G;  1BO0 A;  2UVV A;  4OX9 H;  4V19 0;  2IWH A;  3RFC A;  3E0J A;  2BDO A;  3I3C A;  1VBH A;  4N8F A;  4JV5 L;  3MAQ A;  4RZQ A;  1FGU A;  5JEA G;  4DR5 L;  3GTG B;  4LF8 H;  1UEB A;  3TII A;  3KDF A;  4YCU A;  5GAE C;  4QB4 A;  1VQE A;  3GTQ H;  2ZXP A;  5CYU A;  2QKI C;  1A3V A;  4DUY H;  1ENF A;  3S2H H;  3PCO B;  5KFE A;  2EYO A;  1S5F D;  4A3M B;  4ECQ A;  3KUP A;  3GTK B;  1B3Q A;  1N32 Q;  4LFB Q;  4HMI A;  4V0B A;  1TU2 B;  2GVA A;  2I8C A;  2JEJ A;  1BBW A;  1JCK B;  4LF4 L;  3E6Z X;  1F2M A;  4A3J G;  4A3G G;  4HED A;  4AYB G;  3PUZ A;  3FKI A;  4B3S Q;  4L8J A;  4GN5 A;  3CXC A;  5DEH A;  4WJ4 A;  2E2D C;  5KFI A;  1GUT A;  3MR5 A;  4C2M A;  5JJI A;  3MXG A;  5D65 A;  3KXY T;  1Q1E A;  4KJN A;  4B3R L;  3I2Z A;  2HJW A;  4DNR B;  5KFL A;  5JJZ A;  3A55 A;  3DMU A;  2ZTC A;  1FR3 A;  5LMN L;  1LT6 D;  2UXD L;  4HAE A; 
#chains in the Genus database with same CATH homology
 4WJ3 M;  3JAM i;  2BH8 A;  2V1C C;  3U4Z A;  4A3L G;  1NMF A;  2YV5 A;  4JG2 A;  4B3R Q;  3UDG A;  1PH1 A;  4BBR H;  3RN5 A;  2YU9 H;  4R4Q A;  3SGI A;  1VQC A;  4LF8 L;  3U4V A;  1VQB A;  4C3I H;  1X9N A;  3CCU A;  1A0I A;  2A19 A;  1HZC A;  4JOI C;  4TQU S;  5FJ8 G;  2EIF A;  1QVG A;  2K5V A;  1N34 Q;  1G29 1;  3HOX G;  1HH2 P;  3S2D H;  2VQF Q;  3S1N H;  4JI3 L;  5IWA Q;  2UXC Q;  2K14 A;  4BBS G;  1PH3 A;  2B63 H;  3PO3 G;  1I6H H;  1EIF A;  1HNZ L;  3LGJ A;  3AEV A;  4PMW A;  1CKO A;  1YEZ A;  4UP9 A;  1U0L A;  1VQ7 A;  4DUZ Q;  5J3B A;  2HHH Q;  4LF5 Q;  3M4O H;  4K0K L;  3PV0 A;  2NVQ H;  2ZM6 Q;  1E1O A;  3I4M G;  4Y52 H;  2NVX H;  4DR1 Q;  3I4O A;  4LF5 L;  5K36 G;  2OQK A;  2WB1 G;  4GNX B;  3AQQ A;  4MZ9 A;  1HR0 W;  2RHS B;  4A75 A;  4DR6 L;  5M3F H;  4A3I G;  1YIJ A;  2R7F A;  2N78 A;  4HJ5 A;  2Q2I A;  2LSS A;  3G71 A;  1GKH A;  4JI7 L;  4R4T A;  3M4Q A;  1PYB A;  4YWK A;  4POF A;  1I3Q H;  2Z0S A;  3T1Y L;  3RNU A;  3UDI A;  1VQD A;  4DR4 L;  2JA6 G;  3G48 A;  1SE8 A;  2IHF A;  4LWC A;  4DNI A;  3H15 A;  4DR2 L;  1PH9 A;  4L5T A;  1K9M C;  4GKJ Q;  4DAM A;  2WB1 E;  3FHW A;  4PZ7 A;  4PG3 A;  2R6G A;  2I5M X;  1BKB A;  2K5H A;  4LF6 Q;  1IXR A;  5M5W H;  4IOC A;  5C0X G;  3E9I A;  4FDB A;  4JI2 L;  3TEH B;  4JI6 Q;  4JBK A;  4DAY B;  2R7D A;  5C0X I;  3CCM A;  1VQL A;  4O2D A;  5C0X J;  3CPW A;  4DV6 Q;  1X65 A;  1VQ9 A;  1LYL A;  5C3E H;  3HOV H;  1JJG A;  4DK6 C;  2PMZ E;  3F1Z A;  5H1S E;  3MEF A;  1KHI A;  1UE1 A;  4DV2 Q;  3GTP H;  1PA6 A;  3UE1 A;  4X66 Q;  1G51 A;  3KYH C;  3CC7 A;  4DV4 L;  1K0R A;  3HOU H;  2AMC B;  4GN4 B;  4P74 A;  4IPD A;  3PF5 A;  4NPS A;  1SFO H;  4AIM A;  1VQ6 A;  3CCE A;  4LFA L;  4DKA C;  3PF4 A;  4GLV B;  4A3L H;  1FJG Q;  4PZ6 A;  1HNW Q;  2Z6K A;  1T9H A;  1YHB A;  4OXP A;  4NXN Q;  5E7N A;  2UUC L;  4LFB L;  1FL0 A;  2VL6 A;  1EUJ A;  3CP0 A;  4EX5 A;  4DV3 Q;  2JA5 G;  2B3G A;  3AYH B;  4DR7 Q;  3BZC A;  4NXM L;  2UUC Q;  1CSQ A;  1NMG A;  2HQL A;  3AFQ A;  3ULL A;  4GKK Q;  4IFD J;  1VCI A;  1UE6 A;  5GAH C;  1YJ9 A;  3CC4 A;  3HKS A;  3B6Y A;  4JOI A;  4OON A;  3I56 A;  4OWW B;  4NXN L;  2Q2H A;  1VQ5 A;  3W1B A;  4RMF A;  1VQJ A;  5LMN Q;  2YTX A;  2ASB A;  1I94 Q;  3K80 C;  3BJU A;  4AH6 A;  3F2C A;  4A3J H;  3J7A 5;  2JEA I;  4L5Q A;  3DLL A;  4HIK A;  1M1K C;  4X64 L;  2PI2 E;  4X65 Q;  2PQA B;  4KI0 A;  3D31 A;  4A4I A;  2AHO B;  1S72 A;  1PH2 A;  4HJA A;  3EN2 A;  1V43 A;  3HKZ G;  3T1H L;  1YBY A;  2HT1 A;  3I4M H;  3ERS X;  2CKZ B;  2ID0 A;  1WOC A;  3STB D;  4JYA L;  1W3S A;  4DV0 L;  1L1O B;  4DUY L;  1SLJ A;  5HY6 A;  1MKH A;  4B3M Q;  4C3J H;  1GD7 A;  4LUZ A;  3HOW H;  3F2D A;  3IRB A;  3NBH B;  1K73 C;  4JC0 A;  3T1H Q;  1K8A C;  4BY1 H;  1G6P A;  4LUO A;  1AE3 A;  3U50 C;  3CMA A;  4GOP C;  4A3C H;  1N33 Q;  1E3P A;  2BA0 A;  2KCT A;  3PUX A;  3J80 i;  1CUK A;  3UDX A;  5IY0 A;  3S15 H;  2JA9 A;  1IZ6 A;  1XMO Q;  3CCQ A;  1OXX K;  3PIP A;  4A3K H;  3GO5 A;  3A5U A;  2OWO A;  4A93 H;  1WJJ A;  3L7Z C;  2CFM A;  4GLX A;  1C0A A;  4KHZ A;  3CQZ H;  2NN6 I;  1XMQ Q;  2R93 H;  2UXC L;  1NBW A;  2F52 A;  3GTO H;  4JI3 Q;  3FKI G;  2A1A A;  1KQS A;  1GVP A;  4OX9 Q;  4C2M H;  4JV5 Q;  1X3F A;  5GRO A;  3MXN B;  1QVF A;  5AJ3 L;  3NEM A;  1YHQ A;  1YZ6 A;  1B70 B;  4R4I A;  4YWL A;  5JEA J;  2VW9 A;  1KIX A;  3M9B A;  3PUV A;  1KXL A;  1L0W A;  4HIO A;  5IYB H;  1MIU A;  4JI2 Q;  3HOY H;  1TWC H;  4LF8 Q;  3S17 H;  4YY3 Q;  4R4C A;  2YTV A;  1IBM Q;  2UUA Q;  1NTG A;  1Q8K A;  3S1R H;  1IBK L;  1VQ8 A;  2PNH A;  1D7Q A;  1Y1V G;  3KFU A;  1ASZ A;  4P73 A;  1QUQ A;  2R7Z G;  4QGU A;  3M4P A;  4P75 A;  3GTM H;  1A63 A;  4ALP A;  4LW1 A;  2UU9 L;  3HOW G;  1SRO A;  4X62 Q;  2JEB I;  3VDY A;  1Z9F A;  4QIW E;  5M5X H;  4O0A A;  2VQE Q;  1CKN A;  2K4K A;  4HIM A;  3OYY A;  4JI6 L;  5ELO A;  4C3H H;  1OTC A;  4DV6 L;  1RL2 A;  2JA7 G;  2VUM H;  3PO2 G;  2RHQ B;  3PO2 H;  4HJ8 A;  4DV3 L;  2E2I H;  3H0G G;  2E5L Q;  1BVS A;  4UY8 C;  3GTL H;  1B7Y B;  1FVI A;  5M3M G;  1TWH H;  4A3D H;  5BR8 Q;  1YIT A;  1N36 L;  1XJV A;  2AWO A;  5JJK A;  1LUZ A;  4XIG S;  1W2B A;  2XGT A;  3CW2 C;  2AKW B;  1HR0 L;  2OTL A;  4GKK L;  4GKJ L;  4AYB E;  1JJC B;  2Y0S G;  1EYG A;  4BY1 G;  1XNQ L;  2WFW A;  5C3E G;  2E2J H;  1X56 A;  4YCV A;  1VQK A;  2F4V L;  1RIP A;  1AE2 A;  3CF5 A;  4BA2 I;  4BXX H;  1AH9 A;  1CKM A;  1TXY A;  5C4X G;  1EIY B;  3L0O A;  3U58 A;  4X6A H;  2IY5 B;  1L1O A;  4YHH L;  3NEL A;  4HJ9 A;  5IYD H;  4DR5 Q;  1KRT A;  1LTL A;  2Y0S E;  2CQO A;  3GDE A;  2R92 H;  4X66 L;  1TWG H;  4A3B G;  4HJ7 A;  1YJW A;  2MO1 A;  1N33 L;  2FXQ A;  1PFS A;  4QL5 A;  5IP9 G;  2QGQ A;  4JBJ A;  4UP7 A;  1XNR Q;  2K75 A;  3E9H A;  4LUV A;  3F2B A;  4JI0 L;  1XMO L;  2I0Q A;  3KDF B;  1IBM L;  1KC8 C;  3TQY A;  4QY7 A;  1Q1B A;  1NJI C;  4UPA A;  2H5X A;  1Y1W H;  2E2H H;  1EQQ A;  2ZTE A;  2VY3 A;  2MNA A;  3H3V H;  3FP9 A;  4A3K G;  1HZA A;  1JMC A;  4DV1 L;  1X55 A;  2JJQ A;  5EAY A;  1XPO A;  2DUD A;  4A3M H;  3GTK H;  4X62 L;  1KD1 C;  1PH6 A;  1OXT A;  1VQP A;  5IE8 A;  2VZA A;  2JA8 H;  4JI8 L;  3A5Z B;  4A76 A;  4A3D G;  2RF4 A;  1O7I A;  3UDF A;  5FJ8 H;  2XTI A;  4DR1 L;  4OO1 I;  3GTG H;  4R4O A;  4IOA A;  1GM5 A;  3CME A;  4JBW A;  1PH8 A;  1SMX A;  3HFZ B;  5LMU Q;  3D0F A;  3S1M H;  3WWV A;  1XNQ Q;  1KL9 A;  3J81 j;  3K7U C;  4P72 A;  5LMN W;  1HJP A;  1SR3 A;  2HIX A;  4GOP B;  1Q81 C;  1HNZ Q;  2JA8 G;  2NVT H;  2R7Z H;  3W1G A;  2UUB L;  2HHH L;  2LXJ A;  3I7F A;  4IO9 A;  1VQF A;  3RLO A;  3TS2 A;  4A3I H;  2PQA A;  3NEN A;  5IWA L;  4A3F H;  1M90 C;  1L1O C;  3HOV G;  1SN8 A;  5IP9 H;  2E5L L;  4IPG A;  4GNX C;  1FJG L;  2NZH A;  1C9O A;  2JE6 I;  5LMU L;  4DUY Q;  1S40 A;  3CD6 A;  4BY7 H;  3KJO A;  4LF9 L;  2OCE A;  3KF6 B;  5IYD G;  1HNW L;  2UXB Q;  2UU9 Q;  4JI8 Q;  3KLW A;  3S24 A;  1TWA H;  4DR3 L;  1WYD A;  1WFQ A;  1XTD A;  4JI1 L;  4A3E G;  2VQE L;  2HIV A;  1XPU A;  4DR3 Q;  5HGQ A;  4AQY L;  3J80 c;  1J5E L;  1DGS A;  4LF7 L;  4DV2 L;  3I55 A;  1X54 A;  2JA7 H;  3EIV A;  4DV1 Q;  4JI4 L;  1HZB A;  3CCV A;  1JT8 A;  1JB7 A;  1IBK Q;  2OTJ A;  4B3S L;  1VS0 A;  3PSI A;  1VQH A;  4DV7 L;  4QQB X;  2DGY A;  4NXM Q;  2KHJ A;  3BZK A;  2IX1 A;  4P71 A;  2A8V A;  2N8N A;  1PYS B;  1Y14 B;  3A0J A;  2IX0 A;  5AJ3 Q;  3CC2 A;  4BA1 I;  2B63 G;  3PO3 H;  2D62 A;  3M7N A;  1I50 H;  1VQI A;  3AFP A;  4IJH A;  1P8L A;  4JCV E;  4EQ5 A;  4DV5 Q;  2I5H A;  3OW2 A;  3RN2 A;  1VQM A;  4JI5 Q;  1N32 L;  2CCZ A;  2ALY B;  3T1Y Q;  1HNX Q;  2K5N A;  1MJC A;  3K8A A;  4DR4 Q;  1XMQ L;  4GOP A;  1YJN A;  1HNX L;  2JQO A;  4XTC S;  2QEX A;  4DPG A;  2B29 A;  4DUZ L;  4B3T L;  4YWM A;  4GN3 B;  4A3G H;  1QZH A;  3RZD H;  2KHI A;  2BH2 A;  3ZJY C;  1JJ2 A;  3Q8D A;  2ZJR A;  2BA1 A;  4B3T Q;  2RCN A;  5IT9 c;  1Q7Y C;  2F3I A;  5FLM H;  1K3R A;  1SRU A;  2JA6 H;  4GS3 A;  4J15 A;  4IPH A;  3FKI H;  2ZJP A;  4NB3 A;  3F8T A;  2F4V Q;  3G4S A;  1Y1V H;  4OWT B;  3G6E A;  3BU2 A;  4DK3 C;  1N34 L;  2N49 A;  4LFC Q;  1IBL Q;  1Z47 A;  2KBN A;  5IYC G;  2R92 G;  1NY4 A;  4MTN A;  1X3G A;  2VQF L;  4DV0 Q;  4A3E H;  4POG A;  3HOZ H;  1CSP A;  1JE5 A;  4DV7 Q;  4B3M L;  5GAD C;  3S14 H;  2UXD Q;  4IJL A;  4R1J A;  1YI2 A;  4IPC A;  1IL2 A;  3KF8 B;  2MQH A;  5BR8 L;  5IYB G;  1N36 Q;  1QZG A;  2WP8 J;  2K52 A;  4QJF A;  4L5S A;  4X64 Q;  4JYA Q;  2EXD A;  2ES2 A;  1EQR A;  2GN5 A;  2VNU D;  4JI0 Q;  1YHA A;  4JBM A;  1VQO A;  5FLX c;  1J5E Q;  4APV A;  3S1Q H;  1Q12 A;  1PHJ A;  1WCM H;  2K50 A;  1PH4 A;  2D0P A;  1I5F A;  3KOJ A;  3CCJ A;  1R9T H;  3OTO Q;  5C4J H;  1U5K A;  2R93 G;  3PUY A;  2JK8 A;  2KEN A;  2E8G A;  3RLN A;  2UUA L;  3E0E A;  4IFD G;  1OXU A;  1B8A A;  3TRZ A;  3M85 A;  1GO3 E;  1NE3 A;  1OXV A;  1P16 A;  1TWF H;  2CWP A;  2N3S A;  1Q82 C;  4GLA C;  3CCL A;  4LF4 Q;  2C35 B;  3UE0 A;  1VQN A;  1EWI A;  2UXB L;  1A8V A;  4H02 A;  1UWV A;  3TRE A;  2ZM6 L;  4LF6 L;  3GD7 A;  2MO0 A;  2VUM G;  1E7Z A;  1D8L A;  2WAQ E;  2UUB Q;  2ZTD A;  3H3V I;  4OO1 G;  1S3O A;  3S16 H;  4X65 L;  2QA4 A;  1Q46 A;  5C44 G;  3M3Y H;  1IYJ B;  2YYZ A;  4IFD I;  3GTJ H;  2PI2 A;  3J81 i;  1K8G A;  1QUQ B;  1C7Y A;  2NN6 G;  2NVY H;  3ICE A;  4DR7 L;  3JC6 6;  1E22 A;  1UE5 A;  1KAW A;  4PZ8 A;  3PUW A;  4DV4 Q;  5GQO A;  2Q2U A;  5IP7 H;  4KHP Q;  1X3E A;  5GAG C;  2WAQ G;  3CCR A;  3HOZ G;  4LFA Q;  2AWN A;  3HOY G;  1VQA A;  3RLF A;  3EBE A;  3OTO L;  4A3F G;  1A62 A;  5JJL A;  1HZ9 A;  4A3B H;  3ULJ A;  2I5L X;  4Y7N H;  3K81 C;  2ZJQ A;  3A74 A;  5FLM G;  1N8R C;  2L15 A;  4ME3 A;  2CWA A;  3J81 c;  2GVB A;  1XPR A;  2NZO A;  2JA5 H;  2OQ0 A;  3H0G H;  1N9W A;  3ULP A;  4DR2 Q;  1PH7 A;  2ATW A;  5IP7 G;  2IHE A;  4UP8 A;  2VS1 A;  1YNX A;  3KF6 A;  5M3F G;  3HOU G;  4YY3 L;  1YVC A;  3PIO A;  4BBS H;  3PGZ A;  1XNR L;  1QVC A;  1WI5 A;  1MJE A;  1LM0 A;  3K0X A;  3W5O A;  1KRS A;  4LFC L;  4A3M G;  4L5R C;  4BXX G;  4DR6 Q;  4A3C G;  1IBL L;  2YTY A;  3CPF A;  4JI7 Q;  1EFW A;  4OX9 L;  1PV4 A;  4JV5 L;  1Y1W G;  4YHH Q;  1EOV A;  1BBU A;  1FGU A;  4BBR G;  4YCW A;  5JEA G;  4DR5 L;  4KHP L;  1UEB A;  2LXK A;  4LF9 Q;  3ER0 A;  3J7Z C;  3KDF A;  4YCU A;  5GAE C;  5ELN A;  3CCS A;  1V9P A;  1VQE A;  3GTQ H;  3K7A H;  1E1T A;  3TS0 A;  4K0K Q;  3HKZ E;  3S2H H;  3PCO B;  4RG1 A;  4DV5 L;  3RZO H;  3DM3 A;  3KJP A;  4MNO A;  4JI5 L;  1N32 Q;  3CAM A;  4GNX A;  2Q2T A;  4HID A;  4LFB Q;  1J6Q A;  3JAM c;  1WCM G;  2GVA A;  4JI4 Q;  1CKN B;  1BBW A;  2IT1 A;  1HR0 Q;  2Z6K C;  5M5Y H;  4LF4 L;  4A3J G;  1K83 H;  1L2F A;  2MFI A;  4KLK A;  4A3G G;  1H95 A;  1V1Q A;  1VQ4 A;  4AYB G;  3PUZ A;  4OWX B;  3I4N G;  4LNQ A;  4B3S Q;  1PVO A;  4GN5 A;  3CXC A;  4WJ4 A;  3I4N H;  2D0O A;  3STB C;  4BY7 G;  1OXS C;  3L2P A;  1ASY A;  1PH5 A;  5JJI A;  4JI1 Q;  1Q1E A;  4B3R L;  3I2Z A;  1E24 A;  5C4X H;  5IYC H;  1UE7 A;  4AQY Q;  2ZTC A;  1VQG A;  5M3M H;  1X6O A;  3HOX H;  5LMN L;  1Q86 C;  5DLQ E;  4LF7 Q;  5C44 H;  4TVA B;  1I94 L;  2KCM A;  2UXD L;  2EQS A;  3RR5 A;  4A93 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...