5C3EG

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transferase/dna/rna
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c3eG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c3eG01
1XNQQ 1E3PA 4R1JA 2EQSA 4GS3A 4IJLA 2B63H 4BA2I 3CAMA 2Z0SA 1A63A 1X55A 3PIOA 1B7YB 1E24A 4JI4Q 2HT1A 3IRBA 5GQOA 1QVFA 3GTPH 4DV6Q 4B3MQ 1WI5A 5LMNL 1I94L 1HZ9A 3I4MG 4XTCS 3S1QH 3DM3A 2ES2A 1PH4A 4IO9A 2CKZB 1CSPA 4MTNA 1XMOQ 1KC8C 4X62L 2BH8A 3HKZE 2V1CC 4GNXB 3I4NH 1K83H 5IP7G 3G48A 4JBMA 5IY0A 3I4MH 3GTMH 1E1TA 1PH5A 4JI0L 3NELA 2JA7G 5H1SE 4BXXG 4QJFA 2R93H 5C44H 2A19A 1RL2A 2BA1A 2VW9A 3CCLA 1A8VA 1JJGA 4KLKA 1G51A 1WCMH 1WOCA 1U0LA 2WAQG 3ERSX 4LUZA 4JC0A 4PZ7A 3CF5A 4A3FG 1IBLQ 1Q46A 4DV2L 1KL9A 5FLXc 1J6QA 1HJPA 5JEAG 3S14H 1UE1A 1VS0A 1X3GA 3BJUA 3AFQA 3BZKA 5IE8A 1E7ZA 4DV3L 1YHQA 1VQ8A 1SN8A 2E2JH 4DR6Q 2UXBQ 1HNZQ 1V43A 2VNUD 4JBWA 1QZHA 1KRTA 4YY3L 4JV5L 2UU9L 4LFAQ 4NXNQ 1Y1VG 3M4OH 3MEFA 5M3FH 5IYCH 4DUYQ 4R4QA 2MO0A 3D31A 2RCNA 5JEAJ 3TS2A 4NXNL 4DK6C 5C44G 2NVYH 4B3TL 1VQJA 2F4VQ 4JYAQ 1V1QA 1UE5A 3EN2A 2Q2HA 4KI0A 1XNQL 3RN2A 2UUAL 1HH2P 1YVCA 4GN5A 3TS0A 3HOVH 3OTOQ 1RIPA 1KQSA 4HJ9A 1I3QH 2UUBL 2AWNA 3S1RH 1GKHA 2ZM6Q 2PI2E 4EQ5A 5C3EH 3E0EA 2KHJA 2IHFA 4AQYQ 4JI5L 2NVXH 4B3RQ 2R92H 2C35B 1QVGA 1EOVA 2Q2TA 4A3LH 2CFMA 3NENA 4AQYL 2KHIA 2K50A 1VQHA 4NB3A 1BBUA 4P74A 2K52A 5AJ3Q 4DR5L 1C7YA 4A3DH 4A3GH 4KHPL 1WJJA 5C4XH 3CCJA 5FJ8G 1IL2A 2ID0A 4PZ8A 4DR4Q 2MQHA 4X62Q 3ULPA 3ULJA 4ALPA 2Y0SE 4NXML 2JK8A 4GNXA 1X9NA 4DKAC 1KD1C 5IP7H 2QA4A 1WFQA 3GTKH 4GKJQ 1VQDA 1YHBA 1IBMQ 2UXDL 4P71A 2A1AA 4LF8L 1K8GA 1WCMG 2I5MX 4K0KL 3GTQH 4OXPA 1XMQQ 4DV6L 4B3ML 1HR0L 1TWFH 1YJNA 4IFDI 3W1BA 2AHOB 2JA8H 1YNXA 1N34L 3F2CA 1HNWQ 1SR3A 3U50C 3HOYG 5C0XI 3ICEA 4DV5L 2JA8G 1HNZL 3CCEA 2GN5A 1H95A 2UXCL 4LFBL 1Q7YC 1SFOH 3M3YH 2HHHQ 4LF5Q 1N32L 2NZHA 2PMZE 2K4KA 1QVCA 4IPDA 4JBJA 2I5HA 5IP9G 1X6OA 1LUZA 2AKWB 4A75A 1VQBA 2ZJPA 1XPOA 2YV5A 1E1OA 5FLMG 2UUCL 1VQKA 3G71A 2GVAA 4XIGS 4B3TQ 2R7ZG 1VQ5A 3GTJH 1Q8KA 3UE1A 4A3FH 4JI3Q 4A3DG 1S40A 1PH1A 3CCQA 4JI2L 4BY7G 1KAWA 2WB1E 3K0XA 1L1OA 4DR2L 2ATWA 3J81i 1PYBA 5JJIA 2N78A 2E2IH 3CC7A 5FLMH 4IFDG 4HIDA 3STBC 1AE3A 1SRUA 1CKMA 4DR2Q 4BXXH 2RF4A 1U5KA 2QGQA 4YWLA 4OWXB 3F1ZA 3T1HQ 1I5FA 3AEVA 5JJLA 1Q1EA 3S2DH 4POGA 4JOIA 2KCMA 4KHZA 2D0OA 1S3OA 4JI6L 4Y52H 2Q2IA 3G4SA 1FVIA 1IXRA 4QIWE 3OW2A 4DR7L 2VQEL 2B3GA 4A3CG 2N8NA 4C3IH 2PQAB 2JA7H 2NVTH 2DUDA 2R93G 1KXLA 1YJ9A 3H15A 5IYCG 1D7QA 1VQEA 2A8VA 4IPCA 2D0PA 3M4QA 2IHEA 1Q86C 2B63G 2VZAA 3LGJA 3EBEA 4HJ5A 2UUBQ 3PUWA 4AYBE 4C3HH 1OXSC 4EX5A 1VQGA 1X56A 2JQOA 4UP7A 1QZGA 1HR0W 2OQKA 4OWWB 1HNXL 3KF6B 3CCUA 2UUAQ 3TQYA 3H0GG 2KCTA 1HR0Q 3J80i 2KBNA 3PUVA 1PH9A 5GAHC 1NMGA 3AYHB 3ULLA 3KDFA 5FJ8H 5ELOA 4DR1L 1NE3A 5LMNW 4YY3Q 3GTLH 2R7DA 2ZTEA 2OWOA 4YCVA 1Y1WH 2VQEQ 1XNRQ 4DUYL 4DAYB 4A3LG 1Q1BA 4DPGA 2VQFQ 4IPGA 1Z47A 4R4TA 5C3EG 1PHJA 4LF8Q 1YBYA 3JC66 4HIMA 1M1KC 1OTCA 3FKIG 4GKKQ 4GKJL 3I4NG 4AYBG 1SROA 2HIVA 4YCUA 2WAQE 4DV4Q 3DLLA 1CUKA 4MZ9A 4NXMQ 4DUZL 2OTLA 2IT1A 1HZAA 1Q82C 1MJEA 4P75A 3K7AH 1N34Q 1HNXQ 1IBLL 2Q2UA 1WYDA 4JI2Q 2CCZA 2YU9H 1MKHA 4GN4B 4TQUS 1BBWA 3A0JA 2ZJRA 2EIFA 3RNUA 3HOWG 1VQMA 4K0KQ 2D62A 2IX0A 1FJGQ 1GO3E 5BR8L 4A3IG 3HOUG 4DAMA 4OO1I 1NJIC 3SGIA 4DK3C 2YTYA 3CCVA 4DR4L 3KJPA 1W2BA 3UDFA 2HHHL 2JA5H 4A3BH 1GVPA 1LM0A 3J81c 4A93H 1PA6A 1LTLA 1D8LA 2WB1G 1YITA 1VQFA 2JJQA 4L5TA 3L0OA 4LUOA 3CMEA 3T1HL 5J3BA 3PO3G 5IWAQ 3EIVA 4DV0L 5ELNA 1EUJA 4A3EG 1Q81C 4JI4L 1IZ6A 3HFZB 1EIFA 1A62A 1PH2A 3GO5A 4BBRG 4JI1L 2UXBL 1V9PA 2LXJA 3HOZH 5M5XH 4LNQA 2UXCQ 4LFBQ 3ZJYC 2PQAA 2ZM6L 4A3KG 1VQ7A 2E8GA 2JE6I 1NY4A 3PO2H 3CC2A 3PF4A 3RZOH 2Z6KA 3UDIA 3PF5A 1G291 3S17H 2KENA 2N3SA 2VQFL 1E22A 4A93G 3F2DA 1XNRL 4DR5Q 3CPWA 3RLOA 4AH6A 4JI6Q 3HKSA 1ASYA 1OXUA 1NMFA 3F2BA 2VUMG 3RR5A 3F8TA 1VQPA 2R6GA 2JA6G 5M3MH 4QL5A 2LSSA 3L7ZC 1O7IA 1AE2A 3OTOL 4LF7Q 1XMQL 4LUVA 4APVA 3W1GA 1CKNB 2UXDQ 2Y0SG 1Q12A 1VQNA 1VQ4A 3JAMi 4KHPQ 5AJ3L 4DV3Q 5C0XG 4A3JH 3H3VH 3CXCA 5DLQE 3S24A 1NTGA 1HNWL 3GTOH 4DV1L 4HIOA 2UUCQ 3CC4A 5IT9c 1YEZA 1TWHH 2BA0A 3PUZA 4DR7Q 1MIUA 1X65A 3U4VA 4B3RL 4JOIC 4JI3L 1JT8A 5LMUL 1N33L 4BBSG 2NN6I 4DUZQ 1IBML 1XPUA 1JJCB 3K8AA 3PCOB 4JI0Q 1KIXA 1PH6A 3KYHC 4UP9A 4QY7A 3PUYA 1TXYA 4R4OA 3CP0A 5E7NA 4GOPB 4GN3B 4HJ7A 1N9WA 4A3MH 1N32Q 5IWAL 4DV0Q 1N36Q 5C4XG 3H0GH 1VQLA 1L1OB 1VQ6A 4BY1H 3GTGH 4X66L 3E9HA 4QGUA 3I55A 1PH7A 3HKZG 3I7FA 3PO2G 1GM5A 1HZBA 3A5ZB 4DV7Q 1PYSB 4LFAL 1T9HA 2YTVA 1C0AA 1SMXA 4X65Q 2L15A 2PNHA 4A4IA 2ZTCA 3ER0A 1VQAA 1IYJB 3OYYA 3Q8DA 4C2MH 4A3EH 3J7ZC 2YYZA 4FDBA 2F4VL 1QUQA 4JYAL 5IYDH 1CKNA 4ME3A 2F52A 3S15H 5IYDG 4JI7Q 4OO1G 1P16A 1Y14B 4LFCL 1VQCA 4BBRH 1QUQB 3U58A 1K9MC 1AH9A 2VS1A 4R4CA 3PSIA 3UE0A 3W5OA 1J5EQ 3HOXG 2VL6A 2K14A 3RN5A 3KF6A 3M7NA 5C0XJ 3PUXA 2MFIA 2DGYA 4P73A 2K5HA 3S2HH 5M5YH 2MNAA 4GKKL 2Z6KC 3KDFB 2EXDA 1JB7A 4A3IH 2VUMH 3I2ZA 3STBD 4YHHL 1CSQA 1KRSA 2RHSB 4DV1Q 2R92G 4BBSH 4B3SL 4A76A 3GD7A 3CW2C 4A3MG 2CWPA 5GAEC 3M4PA 4GNXC 3BZCA 4YWKA 2NN6G 4B3SQ 1S72A 3J80c 2OCEA 1B8AA 1VQ9A 2JEBI 1M90C 3HOUH 4YWMA 1YZ6A 1X3EA 4JI8L 4DR3L 3A74A 1XMOL 4PG3A 4LF6Q 2WP8J 4GOPC 4IFDJ 4LF5L 4DR6L 1BVSA 4OX9Q 1I6HH 3NEMA 1FJGL 1B70B 4DV5Q 5LMNQ 4J15A 1UE6A 2XTIA 1UWVA 4HJ8A 1P8LA 1L0WA 1K8AC 3CD6A 3RLFA 4YHHQ 1EFWA 1VQIA 4GLVB 4YCWA 3G6EA 2AMCB 1SLJA 2VY3A 1JJ2A 2RHQB 4HIKA 1HZCA 1OXTA 3FP9A 2JA5G 3L2PA 2E5LQ 2HQLA 3K81C 4PMWA 4GOPA 4DV4L 5GROA 3K80C 5C4JH 4MNOA 4OONA 3TEHB 4OWTB 5M3MG 5LMUQ 4A3KH 1N8RC 2JA6H 4IPHA 4C3JH 3GDEA 1PV4A 4LF9L 1BKBA 1JE5A 2R7ZH 2PI2A 3KF8B 3CCRA 1K0RA 3AQQA 4LF4L 3H3VI 3HOYH 1ASZA 1XJVA 2IY5B 1EWIA 4LF9Q 3UDGA 1UEBA 4RG1A 4OX9L 1EQRA 3S1NH 2OTJA 3TRZA 3T1YQ 2UU9Q 1G6PA 2WFWA 2CWAA 3TREA 3RLNA 1LYLA 1K3RA 4DNIA 4DV7L 4Y7NH 2HIXA 4P72A 5IP9H 2B29A 1TWGH 3PV0A 4A3JG 1A0IA 3HOZG 2NZOA 3I56A 3I4OA 4LWCA 3FKIH 4NPSA 5GADC 2ASBA 4JV5Q 4A3BG 4QQBX 1C9OA 3FHWA 3RZDH 1SE8A 1UE7A 4BY7H 3S1MH 1X54A 4LW1A 2AWOA 1Y1VH 1PFSA 4JI5Q 4UP8A 4JI7L 4JBKA 2ZTDA 4LF4Q 1DGSA 2H5XA 1EIYB 3D0FA 1XTDA 3T1YL 4JCVE 3S16H 5JJKA 3KLWA 1N33Q 2N49A 3JAMc 1I94Q 3UDXA 2NVQH 4R4IA 3HOXH 1NBWA 4UY8C 3AFPA 5M5WH 4X64Q 4WJ3M 1KHIA 4L5RC 1TWAH 2R7FA 3NBHB 3CCMA 4JG2A 4A3CH 4IJHA 2E5LL 1TWCH 2XGTA 5EAYA 3CCSA 3MXNB 1Y1WG 3CPFA 1XPRA 3PO3H 1N36L 3K7UC 2IX1A 1K73C 3HOVG 5HY6A 3WWVA 1YHAA 5GAGC 4JI8Q 4LF7L 1EQQA 1Z9FA 1VCIA 2K75A 4LFCQ 3CQZH 3J7A5 4AIMA 1I50H 4DV2Q 4H02A 3CMAA 3KFUA 2QEXA 1EYGA 1FGUA 1J5EL 2YTXA 2I5LX 4TVAB 4DR3Q 4LF6L 3M85A 1MJCA 2ZJQA 3M9BA 2FXQA 2K5NA 3E9IA 4X64L 5HGQA 4BY1G 4X6AH 1W3SA 4O2DA 2LXKA 1PVOA 4RMFA 4WJ4A 4GLAC 2F3IA 5IYBH 4L5SA 4X65L 1CKOA 2ALYB 1L2FA 2K5VA 1PH8A 1IBKQ 3KOJA 4A3GG 2JA9A 1YI2A 1YIJA 1OXVA 4IOAA 1YJWA 1IBKL 3KJOA 3U4ZA 4X66Q 3VDYA 5BR8Q 1VQOA 1PH3A 2BH2A 3HOWH 5K36G 3J81j 4DR1Q 2GVBA 5M3FG 4BA1I 1FL0A 4L5QA 2OQ0A 1GD7A 3PIPA 3BU2A 4GLXA 4JI1Q 2E2HH 3B6YA 4HJAA 4IOCA 1L1OC 2MO1A 4POFA 1OXXK 4UPAA 1X3FA 5IYBG 3A5UA 4PZ6A 2JEAI 1JMCA 4O0AA 3PGZA 2I0QA 1R9TH 2CQOA
chains in the Genus database with same CATH superfamily
2HCCA 4R1JA 3CAMA 1A63A 1JORA 1E24A 4JI4Q 5EPKA 3MR6A 4M1UB 3EQLC 2ZDHA 1KJ9A 2F4IA 3UQ8A 4QUFA 2F3WA 1CQIB 4JI0H 3E6ZX 2O5IC 1PH4A 2ZT9C 2NTTA 4JI6H 4IO9A 2CKZB 4MTNA 3K3PA 3M9NB 1N48A 1CZWA 5KFIA 3G48A 3LWEA 4N8X1 3I4MH 5D1PA 1B44D 4RZRA 1PH5A 4JI0L 4BXXG 3NELA 2R93H 2EY6A 5C44H 2A19A 3M7GA 1RL2A 2EJMA 1B2TA 3GV7B 1DOLA 1EU4A 1WCMH 4KLKA 1U0LA 1WTVA 5G3LF 1IBLQ 4PZ7A 4FF2A 1N32L 1AN7A 1Q46A 4J9OA 2W9CB 1C30A 4CC5A 4K2KA 4APMA 1GJXA 3BZKA 1PMRA 1VQ8A 1F9PA 2UXBQ 4DR6Q 2NUAB 3M9MB 2MGSA 1HNZQ 4HR7B 2VNUD 3MTSA 3VPBA 2J6SA 2ZJTA 4ECZA 1Y1VG 2QCPX 3MFYA 3MXGA 5G3LD 3DMUA 4DK6C 4V0BA 1JDBB 2J4XA 4B3TL 4MV1A 2F4VQ 4JYAQ 1AUVA 4JI8H 3MXUA 4LFCH 3GV8B 3J80L 1TAEA 4EQNA 3TS0A 4OHJA 4BY1B 3BG5A 4DV1H 4K8IA 1RIPA 1I3QH 1VMCA 3E0JA 5KG7A 1PK8A 2UVVA 2HVSA 3DEOA 4UCSA 3E0EA 2KHJA 3PVXA 4B3SH 4X3TA 4A3LH 2YW2A 2JA5A 2CFMA 4O3PA 1VBGA 1SYBA 3WOFA 2B63B 1KTKA 4AQYL 4B3RL 1VQHA 3OHAA 2SOBA 4A3GH 1SDFA 3CVZA 1WJJA 5C4XH 3TDQA 2ID0A 1D6EC 2MQHA 2XVSA 4ALPA 2Y0SE 1SYCA 4DKAC 3H40A 2EYLA 3SEBA 4O4LF 5L1KA 1IBMQ 5C4XG 5KFQA 2A1AA 4LF8L 1ZYRC 4OXPA 2C00A 1YJNA 5ELCA 2AHOB 1E4FT 1N34L 1M4VA 1JOQA 1HNWQ 1SR3A 3U50C 3JSLA 4C3HB 4KTAA 5FO9B 3HG9A 4LH7A 3V6JA 3CCEA 1KBLA 1Q7YC 4UCUA 2HHHQ 1LT3D 3NQIA 2F0HA 4ABNA 4CKEA 4LF5Q 3J81W 4KN7C 1QVCA 5BN3A 1ET9A 2I5HA 4J9KA 5C4JB 4C2MA 5C5MA 5FLMG 2GVAA 4XIGS 2R7ZG 1VQ5A 1F9QA 4JI3Q 1PH1A 4V190 1KAWA 2EY5A 2ATWA 5CA1F 2EYPA 5K2MA 5JJIA 1KDBA 2J7ZA 3SK5A 2NVYA 2RF4A 1U5KA 3T1HQ 3BA8A 2L1BA 5KFXA 3R2TA 2M9VA 4KHZA 2K5WA 3URYA 1FVIA 2KJXA 3LNNA 3GIMA 2BR0A 5IT9L 4A3CG 3L9AX 4C3IH 2R93G 2W8LA 2DUDA 1YJ9A 1N33H 5IYCG 2F0NA 3GIQA 3M4QA 4UAIA 3V2TA 3LGJA 1JIHA 1EEID 4EX5A 1K1QA 4MV3A 5KFOA 4UP7A 3RBDA 5KFMA 1QZGA 3KF6B 2JP1A 5DM63 3OSOA 3PUVA 1NMGA 3KDFA 5LMNW 1MD2D 4YY3Q 1WD0A 4LMQD 4MAMA 1N36H 4TQRA 2EY2A 4R8IA 4HAEA 2ATLA 4J6HA 2VQEQ 1LTSD 4DUYL 2IPKD 2VQFQ 4F8MA 1Z47A 5C3EG 1KC7A 3JC66 4HIMA 1EY8A 3TMEA 3FKIG 1M1KC 1OTCA 1CE8A 2PN1A 2C28A 1SROA 2HIVA 2WAQE 3Q0AA 1CUKA 1Z2OX 2MPMA 4NXMQ 3QR8A 2R92B 2OTLA 1N34Q 4YJ2F 1HNXQ 1WYDA 2YU9H 3SHLA 4GN4B 3A55A 3A0JA 2A74C 2IX0A 2R7ZB 4ZOLF 2FFKB 4QWEA 2CVRA 1ZHQA 2CH4A 3I90A 2JA5H 4A3BH 1I6UA 4IURA 5KFWA 2W71A 4IHJF 3PMFA 3QB3A 2JJQA 3T13A 1T36A 3L0OA 5FD6A 5E3FA 3PO3G 5IWAQ 4A3EG 3D6WA 4HTHA 1XWEA 4RA8A 1Q81C 3HFZB 2RSOA 1EIFA 2AQ4A 2UVRA 2V9WA 3GV3A 3BS1A 2O5JC 5M5XH 1GHJA 5DGAA 3S1RB 4A3KG 2IBKA 1TIID 5IGDA 3PF4A 3RZOH 4YP3A 1C3OA 5KFAA 5KFGA 3PN1A 1FGBD 3K57A 4CJ2C 3F2DA 1XNRL 4DR5Q 3CPWA 5ELDA 2A68C 3VYSA 4A3IB 2M05A 5M5YB 1NMFA 2VR1A 2VUMG 3F8TA 1U4RA 3R5FA 5EPLA 4N9TA 3SK8A 3Q8PB 5M3MH 4QL5A 1C48A 5C1PA 5I47A 1O7IA 3GIKA 5KIXA 4LUVA 1WVLA 2MJ8A 2UXDQ 2Y0SG 1VQNA 5LMUH 2PCFB 2MP1A 5E1FA 4KHPQ 5KG2A 1WTRA 4DV3Q 5C0XG 4A3JH 2PO4A 3BQ0A 1HNWL 3GTOH 2E2IB 1ULZA 4HIOA 1RK5A 1IKMA 5IT9c 4OIKA 3PUZA 3T1YH 4DR7Q 4YAKB 5LMUL 1V8QA 5EZYF 1IBML 1RCVD 4OEMB 4RFBA 3FRPB 5JH7F 1YNJD 4O2AF 4XQJA 4JI0Q 1EHIA 1PH6A 3TIGA 5DLGA 1ZHSA 1HR0H 3KHRA 4JV5H 2A6HD 1TXYA 4RU9A 5C8YF 2WB1A 5C3EB 5E7NA 1PRTD 2F0GA 3RB0A 4DV0Q 4LMYA 5A2QL 5HURA 3DF7A 1D1IA 3GV6A 2P5ZX 1EYAA 4RAZA 4YR3A 3J81L 4A3MB 4X66L 1WTQA 2R93A 1PH7A 2QYZA 2YRXA 1HPCA 4J9PA 1GM5A 1TWFB 2EJGC 5CR3A 5D14A 3A5ZB 1UEAB 5T1GA 4DV7Q 4KKTA 4LFAL 4BWSC 4LSAA 2NVXA 1V51A 1SMXA 3C1FA 5DEHA 2Z4HA 4A4IA 5JOBA 1VQAA 3PW2A 2V5AA 5FK9C 3J7ZC 3I70A 4FDBA 1DXMA 3C46A 2F4VL 4JYAL 1CKNA 3RFCA 2EZVA 1VKZA 2E2DC 1VQCA 3CQZB 3HOUB 5F9NA 1BNCA 3RIZA 1S4ZA 3GTQA 1XMQH 3RN5A 3KF6A 4F50A 1Y1VA 4A2BA 4ED6A 5C0XJ 1FKAH 2PBZA 4GKKL 5M5YH 2CQAA 3KDFB 2EXDA 2ICEC 1GUSA 1TWAB 3STBD 4RAYA 2RHSB 4DV1Q 2R92G 2FPPB 4B3SL 3I4NB 3GD7A 3CW2C 4QIWB 3PO2B 3M4PA 4MTEA 4B3SQ 1IOVA 1SE4A 5COYA 3J80c 4FXDA 2OCEA 1VQ9A 2JEBI 4HEDA 3J81E 3M4OB 4IRCA 4HNUA 1GUNA 1J8IA 1YZ6A 2EVBA 4JI8L 4IFDJ 3A74A 3L4KA 4OIJA 4ECTA 3EA6A 3F8NA 4B3TH 4DR6L 4IZ8A 5EKIA 2M2LA 4EYHB 4IUNA 1B70B 3BG3A 1K1SA 5JJLA 1K8AC 3RLFA 1Y8OB 2AMCB 2JA5B 2VY3A 2XIWA 4X3SA 2RHQB 2BCOA 1DV1A 4HYKA 2HQLA 4PMWA 1RF2D 1IHZA 1GHKA 1VF7A 4MNOA 4OWTB 2JA6H 1N8RC 1RJPA 3R3OA 4B08A 2CW7A 3HOYB 3H3VI 2IY5B 1E2ZA 1EWIA 4H7BA 4WFN3 5GONF 4QWCA 3Q8RB 1F2LA 2LFNA 1UEBA 4RG1A 1EQRA 4OO1H 4RGTA 3TRZA 1G6PA 1S97A 2F0TA 2UUBH 1S10A 4MA5A 3RLNA 2R84A 1NR2A 5EGTA 4Y7NH 1FR3A 2HIXA 4PMCA 2B29A 2NZOA 3A7AB 2NTSA 4BY7B 4NPSA 5GADC 1I4QA 1SE8A 1I7NA 4DLKA 4BY7H 3T1HH 4IR1A 4Q45A 3H6MA 4J9QA 4JBKA 2WINB 2A6HC 4LF4Q 1BGWA 5KFZA 5JVLA 1PZID 3VR6A 3R93A 2RCFA 1EIYB 5JAVA 1XTDA 2L4NA 1EYDA 3S16H 3SDZA 4C3HG 1D5MC 1N33Q 5CORA 1AFPA 2DZDA 1I94Q 1S0NA 4R4IA 3AFPA 5M5WH 4O2BF 4RB3C 5BN5A 1TWAH 4JVZA 4LFAH 3CCMA 2ZDQA 4JG2A 5BN4A 2E5LL 1O80A 2XGTA 5EAYA 2NVTB 4HCSA 1WTXA 1CHQD 4KY5A 1N36L 3WWVA 3OWEB 4IUPA 3OMGA 2Q8IB 3KK7A 4QWAA 2BDNA 2R8GA 2KOLA 5CYUA 1EYGA 2VQFH 1X32A 2EYMA 2I5LX 3N6RA 1G2TA 4DR3Q 4LF6L 2ZJQA 1BXTA 5KYIA 3I12A 1JOKA 2RDHA 3E9IA 4OGQC 3TP7A 5HGQA 4X64L 4Y8VB 1KEEA 4YR2A 4N9PA 1EY5A 3C2PA 2H1EA 1IW7C 4AYBA 5IYBH 3OHBA 5LL6S 2B8FA 4R8UB 3CRKC 3HRZC 1IBKQ 5JVH3 3KHHA 3IFDA 4A3GG 2PQEA 5KGUA 4IOAA 1IBKL 4GKJH 4DV5H 4IAJA 4J0MA 3KLRA 1PH3A 2BH2A 2JEJA 3HOWH 5K36G 2GVBA 1STHA 4BA1I 3BDCA 4RCNA 2V4QA 2OQ0A 1GD7A 1SNDA 5EPJA 3TINA 3B6YA 4KK7A 4HJAA 3Q8QB 2WAQB 1OXXK 4R9WA 3A5UA 5IWAH 1EFID 1EY7A 1LTRD 3I3CA 5F2DA 2I0QA 3GTOB 3IAYA 4IALA 2B63H 4LF9H 3NTIA 1EWCA 1D1KA 1YNND 4CBVA 3SK4A 3PIO3 3PIOA 2I87A 2EJFC 4B3MQ 1KLUD 1WI5A 3K5MA 1SNCA 1LTBD 2FHTA 3BVZA 1E0BA 4YB8B 4XTCS 4ZK9B 1PLFA 2YS6A 3HXLA 3SR1A 1CSPA 2F0DA 1XMOQ 1KC8C 4YJ3F 4DU9A 5L1JA 1N32H 4H0LC 2LKVA 2V1CC 3NWSA 4GNXB 4NLGA 2KEEA 3OPOA 1H9SA 4JBMA 1ML0D 1NCVA 5IY0A 4JI5H 3DWQA 1RKNA 3S17B 4JUZA 3JAMW 4DXFA 3K0YA 1GSAA 1A3TA 1SEIA 3CCLA 4KHPH 1A8VA 5M5XB 4NP5A 3RB4A 1KNEA 2KEDA 2RBMA 4K2LA 4OL7A 4A3FG 4JC0A 4RH6A 5FLXc 2SCUB 5HBRB 1SYEA 2CHBD 4X65H 4RB2C 1UE1A 1EYCA 1I6HB 5TSSA 3BQ2A 1X3GA 1DJRD 1Q90A 4DR7H 1E7ZA 1YHQA 2E2JH 1SN8A 4UCRA 1ZQ7A 1V43A 1XXGA 4YY3L 3GQCA 2OLSA 4JV5L 2UU9L 2EY1A 2XN9C 3MEFA 1PTOC 4DUYQ 2AQ2B 2L5TA 4R4QA 5KFNA 3D31A 3TS2A 1BNZA 2A69D 1CS0A 5JVG3 3MWMA 2HDLA 3GTMB 5KNCA 3RN2A 3M3YB 4LJZC 3ORQA 4PWQA 1YVCA 4GN5A 2TMPA 4DA2A 1KQSA 1B3AA 4HJ9A 3U9TA 2UUBL 4RGOS 3S1RH 4FBUA 3A8IE 1PFMA 3TN2A 3Q2OA 2PI2E 5C3EH 4AQYQ 4B3RQ 4JW0A 3D6CA 3TZUA 1QVGA 1EOVA 5J39A 2Q2TA 1GLVA 1SNQA 1Z2PX 4XYMB 2J0TD 2KHIA 4P74A 1C7YA 1H9JA 1BBUA 1S0OA 2K52A 4A3DH 4LF6H 1TU2B 3CCJA 1JICA 1GUTA 3PIP3 4DR4Q 3ULPA 4TV9F 1B04A 2JK8A 5DG7A 1NSNS 2F1MA 4CDEC 5IP7H 2BOSA 2QA4A 2E2HB 4F4ZA 2R8HA 1KLGD 1WCMG 2I5MX 4K0KL 3GTQH 1XMQQ 3TP8A 4B3ML 2OH2A 2B39A 1TWFH 2X0SA 3R2IA 5EWGA 2C2RA 1Y1WA 4MV6A 1KABA 2R8IA 4HN7A 4IWYA 2IP4A 4JI1H 3BJYA 5C0XI 4O1NA 1HNZL 3EPIA 3EJIA 5M3MB 3F2UA 2WYOA 4ZLTF 4U673 5J22A 1LTGD 3H91A 4XQQA 2C2DA 1SJED 1X6OA 2AKWB 5EBCA 1XPOA 1E1OA 3RZOB 1VQKA 2C2EA 1ESRA 2QILA 5C4ZA 1KJJA 4M9UA 4B3TQ 2EE1A 4FVMA 4A3DG 4DAPA 3CCQA 2CQYA 1PDQA 1DYQA 4WRDA 1E2WA 1KJ8A 1L2ZA 1PYBA 3MZ5A 2E2IH 2Y0SA 2DWCA 5FLMH 3JRWA 2DJGC 3K5HA 1AE3A 4WORA 1CKMA 4OWXB 3F1ZA 5ELFA 1KDAA 2VUMA 1B4OA 2F0KA 2KCMA 4Y52H 2D0OA 4JI6L 4IN3A 3G4SA 2QKIC 3OW2A 4DR7L 2VQEL 4X3UA 5KFSA 1WTOA 5K5PA 4M8AA 5C4HA 2JA7H 1HA5A 1ILPA 1B6RA 5EOYA 3K5IA 5FPRA 1VQEA 4IPCA 2RKSA 2ICIA 2D0PA 2SNMA 4C3JG 5LL6b 1Q86C 2IA6A 2D2CC 2UUBQ 4HJ5A 4JK1C 4C3HH 1OXSC 2OXPA 1VQGA 1X56A 2OQKA 2VPSA 3VA7A 2UUAQ 3TQYA 4K5XA 2KBNA 3AYHB 1NAPA 2EPBA 4G7OC 4Q0FA 4EEYA 1NE3A 2WDTA 2OWOA 4CDDC 5EKKA 4R8NA 4A3LG 4IPGA 4R4TA 1E4GT 4GKKQ 5L1IA 4EBEA 4KY6A 4CDFC 4PNYA 3G8CA 2HVRA 4U68A 4DV4Q 4GZYC 3VR2A 3R8BA 1TR5A 2YS7A 2KCNA 4P75A 4G57A 2BDOA 2YU9A 1UNSA 2CCZA 1I94H 2ZJRA 4TQUS 2K6AA 2EIFA 4I55F 1VQMA 1FJGQ 4A3IG 2GPWA 3PR5B 3KAJA 2BQ3A 1QCBD 1TS5A 4OO1I 1CM9A 2QK4A 2WV6D 2YTYA 3CCVA 4DR4L 3KJPA 1W2BA 2Q8TA 5IT9W 5L9XA 1GVPA 1K83A 4A93H 2YCHA 1PA6A 3GILA 3QOLA 5EDWA 5J3BA 3EIVA 1ILQA 2DJFC 1IZ6A 1A62A 3GO5A 4A3JB 5FOBB 1PTOB 2N55A 2XWJB 4G4KA 1KJIA 1SE2A 1V9PA 1XTCD 2LXJA 4L1KA 1SNOA 3E5SA 4LFBQ 1VQ7A 2E8GA 5L1LA 1IKLA 2HDMA 3MWEA 5C44B 1A9XA 1SYGA 1ICWA 3BDOA 2RDJA 2VQFL 5DLFA 4HCEA 4A93G 3RLOA 5LMNH 4AH6A 3HKSA 3H20A 1HRJA 5D3IB 5KFVA 2R6GA 2JA6G 4DR2H 3J7YW 2LSSA 3L7ZC 3QZ8A 3CHBD 2E5LH 1JWMD 2B2UA 3W1GA 4ECSA 4C1NK 1AP0A 4MHEA 2Z4IA 2K03A 3CRLC 4PMBA 3CXCA 4A2AA 3S24A 2DY8A 4IUTA 1B33N 2UUCQ 3RZDB 3ORRA 4EGQA 4R7RA 2PMZA 5KG6A 1TWHH 3CU7A 5E4XA 1X65A 3EROA 4JOIC 1JT8A 1N33L 1GGOA 4DUZQ 2F0JA 2K5QA 1JJCB 1XPUA 5C4XB 2VB2X 1EUCB 4QUCA 4DAVA 3NP8A 4TRDA 3I4MB 3GIJA 1PTOF 1EZ8A 3KYHC 1AW7A 4QY7A 3PUYA 3N42B 4S3SA 4R4OA 4GOPB 4A3MH 1N32Q 1CTMA 1DD2A 3N6XA 5IWAL 1O7LA 2IL8A 3KHGA 4DL2A 4BY1H 2A6EC 4O3NA 3GTGH 3OTOH 3E9HA 3I55A 3PO2G 3HKZG 1HTLD 2NUCA 3OOCA 5C3WA 2HJWA 1TQOA 3P1HA 1O7ZA 1BCPD 2E76C 2RDIA 4X65Q 2L15A 1KDCA 2PNHA 3ER0A 2VA2A 3Q8DA 1VF5C 4IUVA 5IYDH 1H9SB 2H4OA 4ME3A 4X62H 1LT4D 3S15H 3MAQA 4JI7Q 4A3GB 4OO1G 1Y14B 5KT4A 4BBRH 1QUQB 3U58A 2WB1B 2VS1A 4R4CA 3K5NA 3V4SA 1R9TA 4Q43A 2VL6A 4O3OA 1BQQT 1RJTA 3S9WA 2FLLA 3PUXA 3T51B 2DGYA 3JAME 2K5HA 2YL2A 2MNAA 5IYZF 1R4PB 1JB7A 2B2WA 2L55A 3DXJC 1SSOA 3NE5B 2VUMH 2R93B 1WD1A 3MR5A 1CSQA 1KRSA 3VYRA 4BBSH 1D2BA 4A76A 2TSSA 5GAEC 3BZCA 4YWKA 3KUPA 5I6YA 1EUDB 5J2TF 2SDFA 1A2TA 4BBRB 2EYHA 2XWBB 4YWMA 1PRTB 3SE0A 4DR3L 4LF6Q 3GTMA 5A2QE 2WP8J 4JPBW 4C3IG 1T94A 4DR4H 2W6PA 2CW0C 1BVSA 4XYOA 4FYDA 4OX9Q 2R7KA 3NEMA 4NKLA 3S1MB 1SYDA 4UDUC 1N56A 1UE6A 4K6LA 4ZRZA 4U7CA 1VQIA 4RWSC 4YCWA 2W9BA 1SLJA 1A15A 2BE5C 1QNKA 2JA5G 4RB1A 3L2PA 3D4RA 4F4WA 4GOPA 1LO5D 1JQYD 4DV4L 2FK1A 3KBGA 4OONA 5M3MG 1K83B 3T56B 4C3JH 1BKBA 1JE5A 2R7ZH 2F0QA 2KCCA 1G6ZA 4C5AA 1K0RA 4LF4L 1H9RA 1ASZA 1XJVA 5CV7A 3TSSA 3QOJA 5IGGA 5IODA 4DL5A 1T3NA 4Q8FA 4C3JB 2BQRA 2CWAA 2F0UA 2C9OA 2ASDA 1LYLA 4F87A 2R86A 4DNIA 4DV7L 1Q3LA 1TWGH 3ND9A 3HOZG 3J7AF 3I56A 3FKIH 1SYFA 3RZDH 1RODA 1SMYD 2CH4W 3S1MH 1X54A 2ZTDA 2EXZA 4LF8H 2H5XA 4ZQ3A 1K28A 3RB6A 3T1YL 2F3VA 3HKZB 3TBIB 2NVXB 2F0LA 3GP7A 1G2SA 4BS9A 3DM1A 3UDXA 4DR6H 3HOXH 1HNZH 1NBWA 4UY8C 5CGKA 4X64Q 1KHIA 4L5RC 2VUMB 5KNBA 3NBHB 3S2HB 4C3IB 3Q22A 1Y1WG 3CPFA 4DL6A 2B2UC 1IL8A 1BCPF 2FMAA 2F4VH 5HY6A 4JYAH 1PTOH 5GAGC 4JI8Q 1S5DD 1EQQA 1V1PB 2K75A 2KQ3A 4LFCQ 5M9OA 5KFPA 2D9UA 1SYXB 2ENBA 4ED8A 3PW5A 1J5EL 2YTXA 3GTJA 3P75A 2F0WA 3LX0A 3SK6A 2RGVA 3SE7A 4TVAB 4EGVA 5A2QW 5KT3A 4GKKH 3NSWA 3TIIA 4A3EB 1HTPA 1BF4A 3PW0A 1GYFA 1HFNA 4UFZA 1GUOA 2W6NA 1G8ZD 2LXKA 4IWXA 2E74C 1HHVA 4LK1C 2NU6B 2ALYB 3GQBA 4RHSA 3MWYW 1KNAA 2JA9A 3RJ0A 2J6UA 3H0GB 5KYLA 5EQ0A 1M0TA 4X66Q 1VQOA 5I9OA 5D65A 3ND8A 4ED0A 3GIDA 5M3FG 1EQTA 5A35A 3PIPA 2E2HH 1HCZA 5CA0F 2MO1A 2CW0D 3KTMA 5IYBG 1C4QA 1VBHA 5IIFA 4O0AA 5IP9H 2CQOA 5IGFA 1XNQQ 5KNDA 5LA6F 4HSPA 1B7YB 2KECA 2HT1A 2FLNA 4LFBH 3GTPH 5GQOA 3QZ7A 2UU9H 4DV6Q 2M00A 3G6JB 2Z6BA 3GTGB 1I4XA 4JI3H 4LSXA 1I94L 1S03G 5KT6A 3Q6SA 4J9NA 3DM3A 4ZI7F 2ES2A 3A7LA 4DAYA 1IYUA 4X62L 2BH8A 1QE6A 3G6YA 2F0SA 1K83H 3WNZA 1DONA 2E75C 4M7EA 4ED7A 4NMZA 1LT6D 5H1SE 2Q8RE 2LY7A 2BA1A 1JWUD 3H3VC 2AGPA 1HQRD 1G51A 3ERSX 2AGOA 4EYIB 3CF5A 4UCTA 1VMPA 1LLRD 4ZYSA 1KL9A 1RTNA 5JEAG 3S14H 1VS0A 2DY7A 4CKCA 2GA4B 5JPNC 3BJUA 3AFQA 1EIHA 4DV3L 4JBWA 5FO7B 1QZHA 1KRTA 3S14B 1TKWB 4F7XA 1F2ZA 4NXNQ 1JE4A 4A93B 5KT7A 5M3FH 5IYCH 3H09A 2MO0A 2A6ED 3GTOA 4Q5VA 4NXNL 5LL6X 5C44G 1J5EH 2NVYH 2DNEA 1CQJB 3K5LA 1V1QA 5JUMA 5KG1A 3EN2A 4RNNA 2Q2HA 3Q24A 4KI0A 3KAKA 5CBAE 4RHRA 2UUAL 3HOVH 1BO0A 1TWGA 1E4EB 3OTOQ 3LMLA 2RGRA 2JA8B 4K5WA 4NXMH 4CDCC 2NVXH 2IHFA 5JEAH 2J6TA 2C35B 2K33A 3ITPA 2NYZD 2W70A 4NB3A 2B2VA 3R23A 2YYAA 5FJ8G 3N40P 4X62Q 3ULJA 2B2WC 4NXML 2CW8A 5EWEA 4HSVA 3M4YA 3H94A 3V05A 1WFQA 4A3DB 3FKIB 2HUGA 4YHHH 1VQDA 4KY7A 4QCLA 2OEOA 2HGSA 4DV6L 2BE5D 1HR0L 4IFDI 3EVQA 3LWBA 3VYUA 2A69C 4RUAA 3HOYG 3QG1A 3ICEA 4DV5L 1EIGA 5CV8A 2DNCA 2V4DA 1SFOH 3M3YH 3L3OC 2PVPA 3K3VA 4WD3A 2NZHA 2DLNA 4IPDA 2K4KA 4O3SA 4I50F 4XZ3B 3K5OA 5IP9G 1VQBA 2AUJD 1BXRA 4KD4A 2WIIB 2UUCL 1BDOA 3HS0C 3G71A 2FK2A 1VAJA 5NUCA 3UE1A 3GTJH 4A3FH 1S40A 3HOZB 4DR5H 1RYSA 2O2LD 2WB1E 5I9PA 3J81i 3CC7A 4IFDG 4HIDA 1SRUA 2RSNA 1M7JA 1CQVA 1SBBB 2QGQA 3AEVA 4YWLA 1QOHA 5KFDA 5KT2A 1I5FA 3IN5A 2JEFA 2R8KA 1Q1EA 3S2DH 3HEJA 4POGA 5FLXW 2UXDH 3A54A 4C1NI 3G7LA 3RMHA 2NN6H 1IXRA 4ED3A 4RNMA 1MBYA 4DV3H 1I4HA 2B3GA 4MA0A 2N8NA 1JB3A 1K0SA 2PQAB 1QJOA 2EYFA 3H15A 4BBSB 2VPQA 1I6VC 2W6QA 3HOXB 5LP6F 2B63G 5ELEA 4AYBE 3I91A 1RK6A 3I72A 3TZDA 2ZDGA 4OWWB 2LS01 1HNXL 4RNOA 1HR0Q 2KCTA 3J80i 1PH9A 1Z7TA 2Y0SB 5KFBA 3GTLA 3GTLH 2R7DA 2ZTEA 2GLTA 2JEGA 4EBDA 3T5JA 4YCVA 3I4LA 1Y1WH 3T4AC 1HA6A 3ETHA 4DAYB 4EFBA 4E6IA 4YR0A 3UFXB 1A6XA 4LF8Q 1XYIA 1JXLA 5BPFA 4TV8F 5EBDA 4AYBG 4YCUA 2J9GA 4DV7H 1F9SA 4I7HA 1MJEA 1HZAA 3HOWB 3K7AH 1IBLL 2I46A 2XCLA 1EY4A 1H9MA 1QG7A 4X64H 5C5LA 1GO3E 5BR8L 1JWSD 2K7VA 3HOUG 1RHPA 5LYJF 1AZQA 4EQOA 3RAXA 1SAPA 1D5ZC 4J9SA 1NJIC 4DK3C 1U4LA 5BR8H 1WTPA 3OMCA 5KRUA 3Q23A 5KFFA 3HB9A 3J81c 2UVWA 1LTLA 1D8LA 4FNFA 1CHPD 1VQFA 2G5DA 2VUGA 4L5TA 2QDLA 3CMEA 4ECUA 1TWHB 3T1HL 3G6VA 4B9WA 4U6PA 5ELNA 5EKLA 1EUJA 2AUKA 1JLLB 5CC4A 3EYYA 1PH2A 4LF5H 1MSHA 1AUXA 1NUCA 2FJZA 2XGQA 1STBA 4JI1L 1TS4A 2UXCQ 3ZJYC 2PQAA 4QF4A 3PO2H 2JE6I 1IOWA 3CC2A 4FS2A 2Z6KA 3UDIA 3S17H 5JQWA 1LABA 4XQNA 3VR4A 4QW9A 3OUUA 1RJRA 1B53A 1OXUA 3F2BA 2JA7B 4ID6A 1VQPA 2FPIB 2B2YA 2L0CA 1SMYC 3CQZA 4DL7A 1EY9A 4JV0A 3OTOL 2F0MA 1XMQL 1B9NA 4MV8A 2I80A 2JXMB 3GIIA 4ME6A 2K04A 4RKLA 4EVOA 3JAMi 3JSNA 1KAAA 4FBTA 3I8ZA 1CZGA 5IGCA 3KXYT 1U9RA 1I4PA 5DLQE 4IUQA 1XNQH 3SXHA 1V1OA 2D5DA 1YEZA 4MV4A 2NB0A 1MIUA 3KLSX 4JI3L 3VMMA 4BBSG 3OHXC 2R7NA 3V6KA 3NTHA 3K8AA 3PCOB 4J1MA 1UC8A 4DNTB 5AFWA 2K1BA 3FMAA 3RD4A 1JKJB 4UP9A 3P20A 4YY3H 4HJ7A 1JX4A 1MI2A 1N36Q 2C5CA 3S1QB 1VQ6A 1O7YA 4DGZA 3TQ1A 5H80A 2CZGA 3MEHA 1S5FD 2RA4A 3I7FA 4L6TB 2ZM6H 4K14A 1TVXA 1S68A 1PYSB 4F4XA 3C0FB 3GTKB 5D8DA 2HQEA 1N34H 1HNXH 3K6OA 3OYYA 5D1OA 2O4XA 2NU7B 1LACA 5D3DA 4Z9CB 1QB5D 3C3LA 1PXUA 5T1IA 4UCOA 1CI3M 3DUZA 4LFCL 2JA6A 1CA6A 1ENFA 4WJWA 3MWDA 1XX8A 3PSIA 1J5EQ 2K14A 4YIJA 2SEBD 2NU8B 4QWDA 4G3IA 4P73A 1QWYA 1DM0B 2JEIA 4ECXA 2Z6KC 4A3IH 4DL3A 2FP4B 2G9DA 3E3XA 5CAEB 4DR3H 1M6VA 3DEPA 3W2DA 2CWPA 2FJ2A 4GNXC 2NN6G 4UCVA 1I7LA 2XD4A 3HOUH 2W7PA 1X3EA 2F0FA 4PG3A 1BJTA 4GOPC 2V4RA 1IBKH 4LF5L 2RQXA 2PZWA 1FNWA 1I6HH 5I4DA 3MVVA 1UNNC 1JR0D 3V4ZA 5DQIA 3H4BA 4DV5Q 1B3QA 1EZ1A 1R9TB 1UWVA 1P8LA 3MFGA 1WSCA 4YHHQ 1EY0A 3G6EA 4XX0B 3AU7A 4O4IF 1E2VA 1JJ2A 1TWFA 1HZCA 1OXTA 3FP9A 3IFTA 1S0MA 1Q8IA 2RVLA 3K81C 1K8MA 3RF2A 4YAJB 3GV5B 5LMUQ 5JPMC 2JSOA 2NBFA 1YNJC 3KF8B 3RGXA 3HOYH 4MN3A 4K8JA 3S16B 1TWHA 4LF9Q 2EYOA 2OTJA 3S1NH 4K6DA 1F2MA 3T1YQ 5KFEA 3MJFA 4B3MH 5DM73 2F0PA 3TREA 1L0YB 2VQDA 3RUZA 3VYTA 3X3MA 4P72A 4KJNA 4RGNA 5C0XH 4A3JG 3GTQB 5KFCA 1A0IA 1Y1VB 4EEQA 3FVQA 3MXNA 2ASBA 4JV5Q 5C1OA 2W8KA 4QQBX 1XMOH 3BVMA 2B2VC 3J80W 3FHWA 1GOZA 4EFEA 1DOMA 1UE7A 2YZMA 4LW1A 4DV0H 4H13C 1Y1VH 4QIWA 4JI5Q 4JI7L 3NK9A 1TA8A 2LMCB 1IYVA 1RDPD 2A68D 1PTOD 2ZXRA 4IFDH 5JJKA 1SXTA 1EY6A 3KLWA 4O4HF 4F4YA 2WAQA 2MUYA 3JAMc 4MV9A 2DPJA 1PZKD 4JI2H 3M9OB 1QNUA 3NPPA 5KFUA 2IMWP 2JN4A 3BYTB 1ZEQX 4J9LA 3D4WA 1SNPA 2W6OA 4A3CH 4IJHA 1A3UA 5CV4A 4DUYH 1DCZA 1XPRA 3PO3H 2R87A 1SFOA 3K7UC 4CJ1B 2WE6A 2Z9HA 4LF7L 1Z9FA 1VCIA 4GC7A 4GC6A 3FEWX 3CQZH 1O78A 4AIMA 4DV2Q 3TQTA 4H02A 3CMAA 2QEXA 1B6SA 4TUYF 1ENCA 3MFIA 1FGUA 3HBLA 4A3FB 3HGBA 4ULLA 5IGEA 2R85A 4AYBB 2EDGA 2L9HA 3IG0A 5C6AA 5KG5A 3M9BA 4ODGA 1AN8A 1CA5A 4AQYH 4B3RH 1QILA 4X6AH 2AGQA 2PW7A 2A5HA 1W3SA 2MHVA 2ZXPA 2R61A 1M0WA 4O2DA 1D5XC 1FYCA 1PVOA 4RMFA 4WJ4A 1H9KA 4EGJA 1YNNC 1EYZA 4E4TA 1CKOA 3RB3A 3ZYYX 3FDSA 2K5VA 4KD3A 5M5WB 1PH8A 4Q8EA 3U9OA 3S1NB 3L4JA 4DFAA 1YI2A 3DWPA 1YIJA 1HQMC 5D1OB 4ED2A 1YJWA 3NWTA 1LTID 3K7AB 3VDYA 5BR8Q 2DIKA 2JA6B 4L5QA 1Y8PB 1GXDC 4LF7H 3BU2A 1JDEA 4ILWA 4GLXA 4JI1Q 2X6GA 1LTTD 2VA3A 1L1OC 3BVGA 1CT1D 4FXKC 1TY2A 4FF3A 1BCPB 1X3FA 1GUWA 3PQIA 2K5DA 4PZ6A 4CC6A 2PZTA 1JMCA 1SCUB 2RDFA 1R9TH 1G91A 1E3PA 2R3ZA 2EQSA 3KLSA 4GS3A 4IJLA 4BA2I 1L0XB 2Z0SA 2I07B 1X55A 3U9SA 2UXCH 3AMUA 1HUNA 3IRBA 2V58A 1QVFA 2AQ1B 4HR7A 2XCAA 4ECYA 5LMNL 1HZ9A 3I4MG 3S1QH 1HUMA 1K3BC 4F88A 2XSCA 1XDNA 2R8JA 2QDBA 3MA2B 1M8AA 3HKZE 4XYLB 3I4NH 5IP7G 1GSOA 3OUZA 3OIPA 2VXWA 1X3QA 1PYWD 5FPOA 1S5ED 3GTMH 1E1TA 3WO1A 4TQSA 2JA7G 5KFLA 4QJFA 2KA7A 4LF4H 1W6KA 2VW9A 1JJGA 4LUZA 2FK3A 1WOCA 2WAQG 1UAPA 3BZDB 4DV2L 3KALA 1J6QA 1HJPA 1WR2A 4ECWA 4ED1A 5IE8A 2E2JB 5KFYA 4FS1A 4I65A 1W6JA 3GTGA 4LFAQ 2UUAH 2PPBC 3M4OH 1BBXC 1WCMA 2RCNA 5JEAJ 3PO3B 3QO2A 4RKBA 1VQJA 1UE5A 3FDTA 3RAQA 1PRTC 1XNQL 4MIUA 2F0IA 2B2TC 4CHTB 1CQFA 1HH2P 2EYJA 4HMJA 5FKAC 2ZXOA 2B8GA 2X69A 3D4DA 2AWNA 3EPGA 1GUGA 1GKHA 2ZM6Q 2KVMA 4MTKA 4EQ5A 1STYA 1U4MA 3H4DA 4CJ0B 4JI5L 2R7MA 2R92H 2R92A 1Z6HA 1MZBA 4HQ6A 3NENA 3QFFA 3HZXA 2K50A 2MCTA 4DR5L 4KHPL 3VA5A 5AJ3Q 1FNVA 3GTPA 2NWGA 1IL2A 5KFKA 4PZ8A 3BQ1A 1T5XD 4TSSA 4DXGA 4GNXA 4K5VA 1X9NA 1Y1WB 1KD1C 3WO0A 3GTKH 4GKJQ 1RYRA 1YHBA 2UXDL 4P71A 2K28A 1K8GA 3V6HA 3MC0B 4Y7NB 2R82A 3W1BA 4CGYB 2JA8H 1YNXA 2W6MA 4IZOA 3F2CA 5C5JA 2E2HA 4UHVA 1I3QB 4KKUA 2JA8G 4WBNF 2FMCA 2GN5A 5KFJA 2UXCL 4LFBL 2C22A 3O13A 4QW8A 4HMIA 1UC9A 3PZPA 2W57A 4C5CA 2PMZE 4JBJA 3JZIA 5CMDA 3HP3A 4DF7A 3Q1KA 1LUZA 1S5CD 1FNUA 1PFNA 4P2CB 2ZJPA 4A75A 3CKIB 2RDGA 2YV5A 3QJYA 1BOSA 5KFRA 4FM9A 1E4EA 4KN4C 4YBZB 4QB4A 5I2XA 1Q8KA 4KHVA 4JI2L 5ISRA 2HVQA 4BY7G 3K0XA 1L1OA 4DR2L 3OSNA 4FF4A 2N78A 3N44B 1MHWC 5DQHA 4ECVA 3RBEA 4BXXH 3STBC 3MFHA 4DR2Q 3I73A 3FPPA 2FKLA 1WCMB 1TS2A 1ZXTA 3OWFA 3VPDA 4JOIA 4Q44A 1DIKA 1S3OA 3RV3A 2Q2IA 3VPCA 4QIWE 4XT3B 2KSWA 2FE3A 4RGMA 4DK1A 4Q0YA 3FKIA 2R7ZA 2NVTH 2K01A 4ZUIA 1KXLA 2OF1A 3GIPA 3NHHA 3D8GA 1D7QA 3NXWA 2A8VA 4PV1C 2IHEA 2AU0A 2VZAA 3EBEA 1EZ6A 3PUWA 4MTDA 2JQOA 1HR0W 4FP5D 1U4PA 3NUCA 4I7ZC 1ICFB 3CCUA 2K32A 3H0GG 3GTPB 3S2DB 5GAHC 3ULLA 2PW5A 5FJ8H 5ELOA 4DR1L 4O3QA 3KF8A 1II3A 1EQVA 2HD3A 1CK1A 1WH2A 2Z1CA 1XNRQ 5CV6A 5T14A 5CV9A 1PFBA 1Q1BA 4DPGA 1SNMA 1PHJA 1AEXA 1TWGB 1YBYA 2XNAC 4GKJL 3QIAA 3I4NG 3T5HA 3DLLA 4MZ9A 4KV6A 1A3VA 4DUZL 2IT1A 1Q82C 1IW7D 3NQTA 3ONAB 2Q2UA 4FF1A 4JI2Q 1MKHA 3HOWG 4XXEA 1BBWA 5K36H 4DNRB 4EQPA 3RNUA 4K0KQ 2D62A 4RB0A 4JI7H 1BCPC 2YU9B 4DAMA 2IX3A 4ECRA 4DK0A 2YZGA 5FO8B 1DZ1A 3SGIA 5KT5A 3FPUB 2E2IA 4DR1H 3UDFA 2HHHL 4LH6A 5DG9A 3PW4A 5M3FB 1VDZA 5HV6A 1LM0A 4DV2H 1JC7A 5FLXE 2WB1G 1YITA 4J8QA 1TWAA 4LUOA 4J9RA 2A73B 4EBCA 4DV0L 1B9MA 2B2YC 4JI4L 3GTLB 2WACA 4KKSA 4KJOA 2O03A 3M4IA 4BBRG 3KHLA 1F2YA 2UXBL 1OWTA 3HOZH 4FO2A 4LNQA 5DQGA 4JI4H 1HFGA 2ZM6L 2R7LA 1NY4A 3C1EA 2G9HD 4G7HC 1PX2A 3PF5A 1G291 2KENA 2N3SA 4YQWA 4OX9H 2I8CA 1E22A 1JCKB 3BA9A 2QF7A 2B2TA 2BQUA 1AZPA 3VR3A 4JI6Q 2XRSD 1ASYA 5IT9E 1F77A 4NW2A 5KG3A 3RR5A 2ASLA 3D3RA 3LP8A 2FINB 1AE2A 4LF7Q 4IUUA 3PR4A 1EU3A 4G7ZC 2WKDA 4QMGA 1TS3A 4APVA 1GSHA 4EG0A 1CKNB 1Q12A 3V96A 4ZUJA 1VQ4A 5L37A 2FPGB 3S15B 3MXPA 2OT2A 2KHSA 1I4GA 5AJ3L 4ME5A 5IGBA 1TWCA 2XIGA 3H3VH 1IBLH 3MHBA 2FB9A 3DWAA 1NTGA 3R5XA 2VB3X 4DV1L 1PRTF 3CC4A 5CBEE 1ONLA 1LT5D 2BA0A 4B9XA 3U4VA 3JRXA 3N8DA 2UXBH 1PZJD 2F0VA 2NN6I 2NU9B 2W7OA 1STEA 1UUPA 1RTOA 4A3BB 5DAUA 3BABA 2FLPA 3W3AA 1KIXA 3DHQA 1WTHA 1FD7D 5IOCA 1T5EA 3CP0A 3G6XA 2B63A 4GN3B 1N9WA 3UI2A 4L63B 2FMMA 3H0GH 1VQLA 1L1OB 1EEFD 5I2YA 2X6LA 3HOVB 4NDXA 5BPHA 2QW7A 4X3KA 2W9BB 1B1ZA 4QGUA 3A8KE 4FU0A 3WOEA 1HZBA 2W9AA 2YZNA 5FLXL 4DV4H 4IR9A 1T9HA 2HCIA 2YTVA 4HNVA 1Y8NB 1C0AA 4HNTA 3SI8A 1J9OA 3NBIA 5JJZA 1H95A 2ZTCA 4A3EH 3MR3A 1IYJB 4C2MH 5LXTF 5KFHA 3Q8SB 2YYZA 4TKOB 1QUQA 5I6WA 3TP6A 2Z8LA 2F52A 4DN4M 1FJGH 5IYDG 4H44C 1P16A 1LTAD 5DNFA 1I50B 3ETJA 5KFTA 4IRKA 1K9MC 1EWHA 2N88A 1AH9A 3UE0A 1IBMH 3W5OA 3HOXG 1C8CA 3M7NA 1ZETA 1ESFA 2F0EA 2MFIA 4ZKBB 3S2HH 3J80E 3K58A 1HNWH 4O3RA 3I2ZA 4YHHL 3J7AK 3WDNA 2F03A 1W93A 5C3XA 4ZAIA 2QEJC 2NVQB 2PMZB 1SJHD 4IRDA 4A3MG 2HHHH 4IQZA 3P7JA 2NVYB 3OIQA 4J9MA 1X3PA 4BWGB 1S72A 5ELBA 2ALZA 1B8AA 5LHY1 2WKCA 2ASJA 1DV2A 1RD9D 5KX5F 1ENAA 1S9FA 1XMOL 1STNA 3NTKA 5F9LA 3BYYB 3SVMA 4JV2A 3N43B 1FJGL 3IKJA 1B50A 3RGZA 2XGPA 5LMNQ 4J15A 2XTIA 4HJ8A 3CD6A 4X66H 1L0WA 5CB4F 4RUCA 1EFWA 1RJQA 2JA7A 3N52A 4GLVB 4JV1A 1DOKA 3T53B 4N8FA 2V59A 4HIKA 5KG0A 5CV5A 2UVUA 2E5LQ 1ZYRD 2EOTA 3PW7A 1EOTA 5GROA 3K80C 2W9CA 2AQ3B 5C4JH 3TEHB 4A3KH 4ETSA 1OO9B 1R4QB 4IPHA 5J1ZA 3GDEA 1PV4A 4LF9L 2R6FA 2PI2A 3CCRA 3AQQA 1Z2NX 2UUCH 1BUVT 3UDGA 2IWHA 4OX9L 4ZHQF 1S5BD 4A3KB 1EL0A 2UU9Q 4LAAA 3R5HA 2WFWA 1ZKOA 5KG4A 4QWBA 4DV6H 2XCPA 4DUZH 2PNRC 3TP5A 1WTWA 1STGA 1K3RA 2GPSA 1I3QA 1M90C 3KBXA 5LOVF 3PV0A 5EJWA 1CFMA 3J7AV 3X3NA 3I4OA 1BR9A 4LWCA 3T16A 3T5KA 4A3BG 2XC9A 3ERQA 1C9OA 2DN8A 5FD5A 2NZ1D 3A8JE 3H0GA 4RZQA 3RUPA 2VQEH 3OW7A 5KKNB 1O75A 3GLKA 2AWOA 3K59A 1PFSA 4UP8A 3HKZA 4PQXA 4R8UA 1MSGA 1DGSA 1I4RA 3D0FA 3A56A 2SNSA 1V4YA 4JCVE 2IJ0A 1TY0A 1HXYD 3GTKA 4C5BA 2N49A 3NBHA 3E5NA 1TWCB 4OELB 2VOBA 4RAUC 3RTXA 4ECQA 2NVQH 1MGSA 1ET6A 4WJ3M 4O42A 3NGDA 4KMUC 4XDXA 2L11A 5E4WC 2R7FA 4NXNH 1KJQA 3BAAA 1V1PA 1TWCH 3FMCA 3CCSA 1K8OA 3MXNB 2KUMA 2IW3A 2F0OA 3JAML 1TT2A 2IX1A 1K73C 3HOVG 4ZCKA 4I4TF 5J2UF 2PZUA 2WTFA 1YHAA 2YRWA 3EFXD 3J7A5 3IL8A 1I50H 1XNRH 3KFUA 2K05A 5EWFA 1JOOA 4FXGC 1STAA 1SE3A 4I7AA 4XT1B 5KEEA 4C56C 3M85A 4C2MB 1MJCA 2FXQA 2K5NA 4ZKCB 4BY1G 2L12A 1F9RA 1A2UA 3GTJB 2JYOA 4PDBA 3BDLA 4GLAC 2F3IA 5BMVF 3T5LA 4L5SA 5DG8A 2DPIA 4X65L 3AB9A 4K0KH 1L2FA 2XRQD 3LWUA 3KOJA 4CKBA 1OXVA 3QWNA 4RCOA 1SFOB 3KJOA 3U4ZA 1NNXA 1NR4A 3RV4A 3J81j 4DR1Q 1SEBD 1I50A 4ZQIA 2W6ZA 5JVDF 1FL0A 3N41B 2PYKA 1W96A 2P0AA 3VR5A 5HGTA 3MR2A 5DGBA 4IOCA 4MV7A 1LV9A 4POFA 4UPAA 4DL4A 2JEAI 4XYQA 3OSPA 1Y69U 3PGZA 4L8JA
chains in the Genus database with same CATH topology
1XNQQ 1E3PA 4R1JA 2EQSA 4GS3A 4IJLA 2B63H 4BA2I 3CAMA 2Z0SA 1A63A 1X55A 3PIOA 1B7YB 1E24A 4JI4Q 2HT1A 3IRBA 5GQOA 1QVFA 3GTPH 4DV6Q 4B3MQ 1WI5A 5LMNL 1I94L 1HZ9A 3I4MG 4XTCS 3S1QH 3DM3A 2ES2A 1PH4A 4IO9A 2CKZB 1CSPA 4MTNA 1XMOQ 1KC8C 4X62L 2BH8A 3HKZE 2V1CC 4GNXB 3I4NH 1K83H 5IP7G 3G48A 4JBMA 5IY0A 3I4MH 3GTMH 1E1TA 1PH5A 4JI0L 3NELA 2JA7G 5H1SE 4BXXG 4QJFA 2R93H 5C44H 2A19A 1RL2A 2BA1A 2VW9A 3CCLA 1A8VA 1JJGA 4KLKA 1G51A 1WCMH 1WOCA 1U0LA 2WAQG 3ERSX 4LUZA 4JC0A 4PZ7A 3CF5A 4A3FG 1IBLQ 1Q46A 4DV2L 1KL9A 5FLXc 1J6QA 1HJPA 5JEAG 3S14H 1UE1A 1VS0A 1X3GA 3BJUA 3AFQA 3BZKA 5IE8A 1E7ZA 4DV3L 1YHQA 1VQ8A 1SN8A 2E2JH 4DR6Q 2UXBQ 1HNZQ 1V43A 2VNUD 4JBWA 1QZHA 1KRTA 4YY3L 4JV5L 2UU9L 4LFAQ 4NXNQ 1Y1VG 3M4OH 3MEFA 5M3FH 5IYCH 4DUYQ 4R4QA 2MO0A 3D31A 2RCNA 5JEAJ 3TS2A 4NXNL 4DK6C 5C44G 2NVYH 4B3TL 1VQJA 2F4VQ 4JYAQ 1V1QA 1UE5A 3EN2A 2Q2HA 4KI0A 1XNQL 3RN2A 2UUAL 1HH2P 1YVCA 4GN5A 3TS0A 3HOVH 3OTOQ 1RIPA 1KQSA 4HJ9A 1I3QH 2UUBL 2AWNA 3S1RH 1GKHA 2ZM6Q 2PI2E 4EQ5A 5C3EH 3E0EA 2KHJA 2IHFA 4AQYQ 4JI5L 2NVXH 4B3RQ 2R92H 2C35B 1QVGA 1EOVA 2Q2TA 4A3LH 2CFMA 3NENA 4AQYL 2KHIA 2K50A 1VQHA 4NB3A 1BBUA 4P74A 2K52A 5AJ3Q 4DR5L 1C7YA 4A3DH 4A3GH 4KHPL 1WJJA 5C4XH 3CCJA 5FJ8G 1IL2A 2ID0A 4PZ8A 4DR4Q 2MQHA 4X62Q 3ULPA 3ULJA 4ALPA 2Y0SE 4NXML 2JK8A 4GNXA 1X9NA 4DKAC 1KD1C 5IP7H 2QA4A 1WFQA 3GTKH 4GKJQ 1VQDA 1YHBA 1IBMQ 2UXDL 4P71A 2A1AA 4LF8L 1K8GA 1WCMG 2I5MX 4K0KL 3GTQH 4OXPA 1XMQQ 4DV6L 4B3ML 1HR0L 1TWFH 1YJNA 4IFDI 3W1BA 2AHOB 2JA8H 1YNXA 1N34L 3F2CA 1HNWQ 1SR3A 3U50C 3HOYG 5C0XI 3ICEA 4DV5L 2JA8G 1HNZL 3CCEA 2GN5A 1H95A 2UXCL 4LFBL 1Q7YC 1SFOH 3M3YH 2HHHQ 4LF5Q 1N32L 2NZHA 2PMZE 2K4KA 1QVCA 4IPDA 4JBJA 2I5HA 5IP9G 1X6OA 1LUZA 2AKWB 4A75A 1VQBA 2ZJPA 1XPOA 2YV5A 1E1OA 5FLMG 2UUCL 1VQKA 3G71A 2GVAA 4XIGS 4B3TQ 2R7ZG 1VQ5A 3GTJH 1Q8KA 3UE1A 4A3FH 4JI3Q 4A3DG 1S40A 1PH1A 3CCQA 4JI2L 4BY7G 1KAWA 2WB1E 3K0XA 1L1OA 4DR2L 2ATWA 3J81i 1PYBA 5JJIA 2N78A 2E2IH 3CC7A 5FLMH 4IFDG 4HIDA 3STBC 1AE3A 1SRUA 1CKMA 4DR2Q 4BXXH 2RF4A 1U5KA 2QGQA 4YWLA 4OWXB 3F1ZA 3T1HQ 1I5FA 3AEVA 5JJLA 1Q1EA 3S2DH 4POGA 4JOIA 2KCMA 4KHZA 2D0OA 1S3OA 4JI6L 4Y52H 2Q2IA 3G4SA 1FVIA 1IXRA 4QIWE 3OW2A 4DR7L 2VQEL 2B3GA 4A3CG 2N8NA 4C3IH 2PQAB 2JA7H 2NVTH 2DUDA 2R93G 1KXLA 1YJ9A 3H15A 5IYCG 1D7QA 1VQEA 2A8VA 4IPCA 2D0PA 3M4QA 2IHEA 1Q86C 2B63G 2VZAA 3LGJA 3EBEA 4HJ5A 2UUBQ 3PUWA 4AYBE 4C3HH 1OXSC 4EX5A 1VQGA 1X56A 2JQOA 4UP7A 1QZGA 1HR0W 2OQKA 4OWWB 1HNXL 3KF6B 3CCUA 2UUAQ 3TQYA 3H0GG 2KCTA 1HR0Q 3J80i 2KBNA 3PUVA 1PH9A 5GAHC 1NMGA 3AYHB 3ULLA 3KDFA 5FJ8H 5ELOA 4DR1L 1NE3A 5LMNW 4YY3Q 3GTLH 2R7DA 2ZTEA 2OWOA 4YCVA 1Y1WH 2VQEQ 1XNRQ 4DUYL 4DAYB 4A3LG 1Q1BA 4DPGA 2VQFQ 4IPGA 1Z47A 4R4TA 5C3EG 1PHJA 4LF8Q 1YBYA 3JC66 4HIMA 1M1KC 1OTCA 3FKIG 4GKKQ 4GKJL 3I4NG 4AYBG 1SROA 2HIVA 4YCUA 2WAQE 4DV4Q 3DLLA 1CUKA 4MZ9A 4NXMQ 4DUZL 2OTLA 2IT1A 1HZAA 1Q82C 1MJEA 4P75A 3K7AH 1N34Q 1HNXQ 1IBLL 2Q2UA 1WYDA 4JI2Q 2CCZA 2YU9H 1MKHA 4GN4B 4TQUS 1BBWA 3A0JA 2ZJRA 2EIFA 3RNUA 3HOWG 1VQMA 4K0KQ 2D62A 2IX0A 1FJGQ 1GO3E 5BR8L 4A3IG 3HOUG 4DAMA 4OO1I 1NJIC 3SGIA 4DK3C 2YTYA 3CCVA 4DR4L 3KJPA 1W2BA 3UDFA 2HHHL 2JA5H 4A3BH 1GVPA 1LM0A 3J81c 4A93H 1PA6A 1LTLA 1D8LA 2WB1G 1YITA 1VQFA 2JJQA 4L5TA 3L0OA 4LUOA 3CMEA 3T1HL 5J3BA 3PO3G 5IWAQ 3EIVA 4DV0L 5ELNA 1EUJA 4A3EG 1Q81C 4JI4L 1IZ6A 3HFZB 1EIFA 1A62A 1PH2A 3GO5A 4BBRG 4JI1L 2UXBL 1V9PA 2LXJA 3HOZH 5M5XH 4LNQA 2UXCQ 4LFBQ 3ZJYC 2PQAA 2ZM6L 4A3KG 1VQ7A 2E8GA 2JE6I 1NY4A 3PO2H 3CC2A 3PF4A 3RZOH 2Z6KA 3UDIA 3PF5A 1G291 3S17H 2KENA 2N3SA 2VQFL 1E22A 4A93G 3F2DA 1XNRL 4DR5Q 3CPWA 3RLOA 4AH6A 4JI6Q 3HKSA 1ASYA 1OXUA 1NMFA 3F2BA 2VUMG 3RR5A 3F8TA 1VQPA 2R6GA 2JA6G 5M3MH 4QL5A 2LSSA 3L7ZC 1O7IA 1AE2A 3OTOL 4LF7Q 1XMQL 4LUVA 4APVA 3W1GA 1CKNB 2UXDQ 2Y0SG 1Q12A 1VQNA 1VQ4A 3JAMi 4KHPQ 5AJ3L 4DV3Q 5C0XG 4A3JH 3H3VH 3CXCA 5DLQE 3S24A 1NTGA 1HNWL 3GTOH 4DV1L 4HIOA 2UUCQ 3CC4A 5IT9c 1YEZA 1TWHH 2BA0A 3PUZA 4DR7Q 1MIUA 1X65A 3U4VA 4B3RL 4JOIC 4JI3L 1JT8A 5LMUL 1N33L 4BBSG 2NN6I 4DUZQ 1IBML 1XPUA 1JJCB 3K8AA 3PCOB 4JI0Q 1KIXA 1PH6A 3KYHC 4UP9A 4QY7A 3PUYA 1TXYA 4R4OA 3CP0A 5E7NA 4GOPB 4GN3B 4HJ7A 1N9WA 4A3MH 1N32Q 5IWAL 4DV0Q 1N36Q 5C4XG 3H0GH 1VQLA 1L1OB 1VQ6A 4BY1H 3GTGH 4X66L 3E9HA 4QGUA 3I55A 1PH7A 3HKZG 3I7FA 3PO2G 1GM5A 1HZBA 3A5ZB 4DV7Q 1PYSB 4LFAL 1T9HA 2YTVA 1C0AA 1SMXA 4X65Q 2L15A 2PNHA 4A4IA 2ZTCA 3ER0A 1VQAA 1IYJB 3OYYA 3Q8DA 4C2MH 4A3EH 3J7ZC 2YYZA 4FDBA 2F4VL 1QUQA 4JYAL 5IYDH 1CKNA 4ME3A 2F52A 3S15H 5IYDG 4JI7Q 4OO1G 1P16A 1Y14B 4LFCL 1VQCA 4BBRH 1QUQB 3U58A 1K9MC 1AH9A 2VS1A 4R4CA 3PSIA 3UE0A 3W5OA 1J5EQ 3HOXG 2VL6A 2K14A 3RN5A 3KF6A 3M7NA 5C0XJ 3PUXA 2MFIA 2DGYA 4P73A 2K5HA 3S2HH 5M5YH 2MNAA 4GKKL 2Z6KC 3KDFB 2EXDA 1JB7A 4A3IH 2VUMH 3I2ZA 3STBD 4YHHL 1CSQA 1KRSA 2RHSB 4DV1Q 2R92G 4BBSH 4B3SL 4A76A 3GD7A 3CW2C 4A3MG 2CWPA 5GAEC 3M4PA 4GNXC 3BZCA 4YWKA 2NN6G 4B3SQ 1S72A 3J80c 2OCEA 1B8AA 1VQ9A 2JEBI 1M90C 3HOUH 4YWMA 1YZ6A 1X3EA 4JI8L 4DR3L 3A74A 1XMOL 4PG3A 4LF6Q 2WP8J 4GOPC 4IFDJ 4LF5L 4DR6L 1BVSA 4OX9Q 1I6HH 3NEMA 1FJGL 1B70B 4DV5Q 5LMNQ 4J15A 1UE6A 2XTIA 1UWVA 4HJ8A 1P8LA 1L0WA 1K8AC 3CD6A 3RLFA 4YHHQ 1EFWA 1VQIA 4GLVB 4YCWA 3G6EA 2AMCB 1SLJA 2VY3A 1JJ2A 2RHQB 4HIKA 1HZCA 1OXTA 3FP9A 2JA5G 3L2PA 2E5LQ 2HQLA 3K81C 4PMWA 4GOPA 4DV4L 5GROA 3K80C 5C4JH 4MNOA 4OONA 3TEHB 4OWTB 5M3MG 5LMUQ 4A3KH 1N8RC 2JA6H 4IPHA 4C3JH 3GDEA 1PV4A 4LF9L 1BKBA 1JE5A 2R7ZH 2PI2A 3KF8B 3CCRA 1K0RA 3AQQA 4LF4L 3H3VI 3HOYH 1ASZA 1XJVA 2IY5B 1EWIA 4LF9Q 3UDGA 1UEBA 4RG1A 4OX9L 1EQRA 3S1NH 2OTJA 3TRZA 3T1YQ 2UU9Q 1G6PA 2WFWA 2CWAA 3TREA 3RLNA 1LYLA 1K3RA 4DNIA 4DV7L 4Y7NH 2HIXA 4P72A 5IP9H 2B29A 1TWGH 3PV0A 4A3JG 1A0IA 3HOZG 2NZOA 3I56A 3I4OA 4LWCA 3FKIH 4NPSA 5GADC 2ASBA 4JV5Q 4A3BG 4QQBX 1C9OA 3FHWA 3RZDH 1SE8A 1UE7A 4BY7H 3S1MH 1X54A 4LW1A 2AWOA 1Y1VH 1PFSA 4JI5Q 4UP8A 4JI7L 4JBKA 2ZTDA 4LF4Q 1DGSA 2H5XA 1EIYB 3D0FA 1XTDA 3T1YL 4JCVE 3S16H 5JJKA 3KLWA 1N33Q 2N49A 3JAMc 1I94Q 3UDXA 2NVQH 4R4IA 3HOXH 1NBWA 4UY8C 3AFPA 5M5WH 4X64Q 4WJ3M 1KHIA 4L5RC 1TWAH 2R7FA 3NBHB 3CCMA 4JG2A 4A3CH 4IJHA 2E5LL 1TWCH 2XGTA 5EAYA 3CCSA 3MXNB 1Y1WG 3CPFA 1XPRA 3PO3H 1N36L 3K7UC 2IX1A 1K73C 3HOVG 5HY6A 3WWVA 1YHAA 5GAGC 4JI8Q 4LF7L 1EQQA 1Z9FA 1VCIA 2K75A 4LFCQ 3CQZH 3J7A5 4AIMA 1I50H 4DV2Q 4H02A 3CMAA 3KFUA 2QEXA 1EYGA 1FGUA 1J5EL 2YTXA 2I5LX 4TVAB 4DR3Q 4LF6L 3M85A 1MJCA 2ZJQA 3M9BA 2FXQA 2K5NA 3E9IA 4X64L 5HGQA 4BY1G 4X6AH 1W3SA 4O2DA 2LXKA 1PVOA 4RMFA 4WJ4A 4GLAC 2F3IA 5IYBH 4L5SA 4X65L 1CKOA 2ALYB 1L2FA 2K5VA 1PH8A 1IBKQ 3KOJA 4A3GG 2JA9A 1YI2A 1YIJA 1OXVA 4IOAA 1YJWA 1IBKL 3KJOA 3U4ZA 4X66Q 3VDYA 5BR8Q 1VQOA 1PH3A 2BH2A 3HOWH 5K36G 3J81j 4DR1Q 2GVBA 5M3FG 4BA1I 1FL0A 4L5QA 2OQ0A 1GD7A 3PIPA 3BU2A 4GLXA 4JI1Q 2E2HH 3B6YA 4HJAA 4IOCA 1L1OC 2MO1A 4POFA 1OXXK 4UPAA 1X3FA 5IYBG 3A5UA 4PZ6A 2JEAI 1JMCA 4O0AA 3PGZA 2I0QA 1R9TH 2CQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ Q;  1E3P A;  4R1J A;  2EQS A;  4GS3 A;  4IJL A;  2B63 H;  4BA2 I;  3CAM A;  2Z0S A;  1A63 A;  1X55 A;  3PIO A;  1B7Y B;  1E24 A;  4JI4 Q;  2HT1 A;  3IRB A;  5GQO A;  1QVF A;  3GTP H;  4DV6 Q;  4B3M Q;  1WI5 A;  5LMN L;  1I94 L;  1HZ9 A;  3I4M G;  4XTC S;  3S1Q H;  3DM3 A;  2ES2 A;  1PH4 A;  4IO9 A;  2CKZ B;  1CSP A;  4MTN A;  1XMO Q;  1KC8 C;  4X62 L;  2BH8 A;  3HKZ E;  2V1C C;  4GNX B;  3I4N H;  1K83 H;  5IP7 G;  3G48 A;  4JBM A;  5IY0 A;  3I4M H;  3GTM H;  1E1T A;  1PH5 A;  4JI0 L;  3NEL A;  2JA7 G;  5H1S E;  4BXX G;  4QJF A;  2R93 H;  5C44 H;  2A19 A;  1RL2 A;  2BA1 A;  2VW9 A;  3CCL A;  1A8V A;  1JJG A;  4KLK A;  1G51 A;  1WCM H;  1WOC A;  1U0L A;  2WAQ G;  3ERS X;  4LUZ A;  4JC0 A;  4PZ7 A;  3CF5 A;  4A3F G;  1IBL Q;  1Q46 A;  4DV2 L;  1KL9 A;  5FLX c;  1J6Q A;  1HJP A;  5JEA G;  3S14 H;  1UE1 A;  1VS0 A;  1X3G A;  3BJU A;  3AFQ A;  3BZK A;  5IE8 A;  1E7Z A;  4DV3 L;  1YHQ A;  1VQ8 A;  1SN8 A;  2E2J H;  4DR6 Q;  2UXB Q;  1HNZ Q;  1V43 A;  2VNU D;  4JBW A;  1QZH A;  1KRT A;  4YY3 L;  4JV5 L;  2UU9 L;  4LFA Q;  4NXN Q;  1Y1V G;  3M4O H;  3MEF A;  5M3F H;  5IYC H;  4DUY Q;  4R4Q A;  2MO0 A;  3D31 A;  2RCN A;  5JEA J;  3TS2 A;  4NXN L;  4DK6 C;  5C44 G;  2NVY H;  4B3T L;  1VQJ A;  2F4V Q;  4JYA Q;  1V1Q A;  1UE5 A;  3EN2 A;  2Q2H A;  4KI0 A;  1XNQ L;  3RN2 A;  2UUA L;  1HH2 P;  1YVC A;  4GN5 A;  3TS0 A;  3HOV H;  3OTO Q;  1RIP A;  1KQS A;  4HJ9 A;  1I3Q H;  2UUB L;  2AWN A;  3S1R H;  1GKH A;  2ZM6 Q;  2PI2 E;  4EQ5 A;  5C3E H;  3E0E A;  2KHJ A;  2IHF A;  4AQY Q;  4JI5 L;  2NVX H;  4B3R Q;  2R92 H;  2C35 B;  1QVG A;  1EOV A;  2Q2T A;  4A3L H;  2CFM A;  3NEN A;  4AQY L;  2KHI A;  2K50 A;  1VQH A;  4NB3 A;  1BBU A;  4P74 A;  2K52 A;  5AJ3 Q;  4DR5 L;  1C7Y A;  4A3D H;  4A3G H;  4KHP L;  1WJJ A;  5C4X H;  3CCJ A;  5FJ8 G;  1IL2 A;  2ID0 A;  4PZ8 A;  4DR4 Q;  2MQH A;  4X62 Q;  3ULP A;  3ULJ A;  4ALP A;  2Y0S E;  4NXM L;  2JK8 A;  4GNX A;  1X9N A;  4DKA C;  1KD1 C;  5IP7 H;  2QA4 A;  1WFQ A;  3GTK H;  4GKJ Q;  1VQD A;  1YHB A;  1IBM Q;  2UXD L;  4P71 A;  2A1A A;  4LF8 L;  1K8G A;  1WCM G;  2I5M X;  4K0K L;  3GTQ H;  4OXP A;  1XMQ Q;  4DV6 L;  4B3M L;  1HR0 L;  1TWF H;  1YJN A;  4IFD I;  3W1B A;  2AHO B;  2JA8 H;  1YNX A;  1N34 L;  3F2C A;  1HNW Q;  1SR3 A;  3U50 C;  3HOY G;  5C0X I;  3ICE A;  4DV5 L;  2JA8 G;  1HNZ L;  3CCE A;  2GN5 A;  1H95 A;  2UXC L;  4LFB L;  1Q7Y C;  1SFO H;  3M3Y H;  2HHH Q;  4LF5 Q;  1N32 L;  2NZH A;  2PMZ E;  2K4K A;  1QVC A;  4IPD A;  4JBJ A;  2I5H A;  5IP9 G;  1X6O A;  1LUZ A;  2AKW B;  4A75 A;  1VQB A;  2ZJP A;  1XPO A;  2YV5 A;  1E1O A;  5FLM G;  2UUC L;  1VQK A;  3G71 A;  2GVA A;  4XIG S;  4B3T Q;  2R7Z G;  1VQ5 A;  3GTJ H;  1Q8K A;  3UE1 A;  4A3F H;  4JI3 Q;  4A3D G;  1S40 A;  1PH1 A;  3CCQ A;  4JI2 L;  4BY7 G;  1KAW A;  2WB1 E;  3K0X A;  1L1O A;  4DR2 L;  2ATW A;  3J81 i;  1PYB A;  5JJI A;  2N78 A;  2E2I H;  3CC7 A;  5FLM H;  4IFD G;  4HID A;  3STB C;  1AE3 A;  1SRU A;  1CKM A;  4DR2 Q;  4BXX H;  2RF4 A;  1U5K A;  2QGQ A;  4YWL A;  4OWX B;  3F1Z A;  3T1H Q;  1I5F A;  3AEV A;  5JJL A;  1Q1E A;  3S2D H;  4POG A;  4JOI A;  2KCM A;  4KHZ A;  2D0O A;  1S3O A;  4JI6 L;  4Y52 H;  2Q2I A;  3G4S A;  1FVI A;  1IXR A;  4QIW E;  3OW2 A;  4DR7 L;  2VQE L;  2B3G A;  4A3C G;  2N8N A;  4C3I H;  2PQA B;  2JA7 H;  2NVT H;  2DUD A;  2R93 G;  1KXL A;  1YJ9 A;  3H15 A;  5IYC G;  1D7Q A;  1VQE A;  2A8V A;  4IPC A;  2D0P A;  3M4Q A;  2IHE A;  1Q86 C;  2B63 G;  2VZA A;  3LGJ A;  3EBE A;  4HJ5 A;  2UUB Q;  3PUW A;  4AYB E;  4C3H H;  1OXS C;  4EX5 A;  1VQG A;  1X56 A;  2JQO A;  4UP7 A;  1QZG A;  1HR0 W;  2OQK A;  4OWW B;  1HNX L;  3KF6 B;  3CCU A;  2UUA Q;  3TQY A;  3H0G G;  2KCT A;  1HR0 Q;  3J80 i;  2KBN A;  3PUV A;  1PH9 A;  5GAH C;  1NMG A;  3AYH B;  3ULL A;  3KDF A;  5FJ8 H;  5ELO A;  4DR1 L;  1NE3 A;  5LMN W;  4YY3 Q;  3GTL H;  2R7D A;  2ZTE A;  2OWO A;  4YCV A;  1Y1W H;  2VQE Q;  1XNR Q;  4DUY L;  4DAY B;  4A3L G;  1Q1B A;  4DPG A;  2VQF Q;  4IPG A;  1Z47 A;  4R4T A;  5C3E G;  1PHJ A;  4LF8 Q;  1YBY A;  3JC6 6;  4HIM A;  1M1K C;  1OTC A;  3FKI G;  4GKK Q;  4GKJ L;  3I4N G;  4AYB G;  1SRO A;  2HIV A;  4YCU A;  2WAQ E;  4DV4 Q;  3DLL A;  1CUK A;  4MZ9 A;  4NXM Q;  4DUZ L;  2OTL A;  2IT1 A;  1HZA A;  1Q82 C;  1MJE A;  4P75 A;  3K7A H;  1N34 Q;  1HNX Q;  1IBL L;  2Q2U A;  1WYD A;  4JI2 Q;  2CCZ A;  2YU9 H;  1MKH A;  4GN4 B;  4TQU S;  1BBW A;  3A0J A;  2ZJR A;  2EIF A;  3RNU A;  3HOW G;  1VQM A;  4K0K Q;  2D62 A;  2IX0 A;  1FJG Q;  1GO3 E;  5BR8 L;  4A3I G;  3HOU G;  4DAM A;  4OO1 I;  1NJI C;  3SGI A;  4DK3 C;  2YTY A;  3CCV A;  4DR4 L;  3KJP A;  1W2B A;  3UDF A;  2HHH L;  2JA5 H;  4A3B H;  1GVP A;  1LM0 A;  3J81 c;  4A93 H;  1PA6 A;  1LTL A;  1D8L A;  2WB1 G;  1YIT A;  1VQF A;  2JJQ A;  4L5T A;  3L0O A;  4LUO A;  3CME A;  3T1H L;  5J3B A;  3PO3 G;  5IWA Q;  3EIV A;  4DV0 L;  5ELN A;  1EUJ A;  4A3E G;  1Q81 C;  4JI4 L;  1IZ6 A;  3HFZ B;  1EIF A;  1A62 A;  1PH2 A;  3GO5 A;  4BBR G;  4JI1 L;  2UXB L;  1V9P A;  2LXJ A;  3HOZ H;  5M5X H;  4LNQ A;  2UXC Q;  4LFB Q;  3ZJY C;  2PQA A;  2ZM6 L;  4A3K G;  1VQ7 A;  2E8G A;  2JE6 I;  1NY4 A;  3PO2 H;  3CC2 A;  3PF4 A;  3RZO H;  2Z6K A;  3UDI A;  3PF5 A;  1G29 1;  3S17 H;  2KEN A;  2N3S A;  2VQF L;  1E22 A;  4A93 G;  3F2D A;  1XNR L;  4DR5 Q;  3CPW A;  3RLO A;  4AH6 A;  4JI6 Q;  3HKS A;  1ASY A;  1OXU A;  1NMF A;  3F2B A;  2VUM G;  3RR5 A;  3F8T A;  1VQP A;  2R6G A;  2JA6 G;  5M3M H;  4QL5 A;  2LSS A;  3L7Z C;  1O7I A;  1AE2 A;  3OTO L;  4LF7 Q;  1XMQ L;  4LUV A;  4APV A;  3W1G A;  1CKN B;  2UXD Q;  2Y0S G;  1Q12 A;  1VQN A;  1VQ4 A;  3JAM i;  4KHP Q;  5AJ3 L;  4DV3 Q;  5C0X G;  4A3J H;  3H3V H;  3CXC A;  5DLQ E;  3S24 A;  1NTG A;  1HNW L;  3GTO H;  4DV1 L;  4HIO A;  2UUC Q;  3CC4 A;  5IT9 c;  1YEZ A;  1TWH H;  2BA0 A;  3PUZ A;  4DR7 Q;  1MIU A;  1X65 A;  3U4V A;  4B3R L;  4JOI C;  4JI3 L;  1JT8 A;  5LMU L;  1N33 L;  4BBS G;  2NN6 I;  4DUZ Q;  1IBM L;  1XPU A;  1JJC B;  3K8A A;  3PCO B;  4JI0 Q;  1KIX A;  1PH6 A;  3KYH C;  4UP9 A;  4QY7 A;  3PUY A;  1TXY A;  4R4O A;  3CP0 A;  5E7N A;  4GOP B;  4GN3 B;  4HJ7 A;  1N9W A;  4A3M H;  1N32 Q;  5IWA L;  4DV0 Q;  1N36 Q;  5C4X G;  3H0G H;  1VQL A;  1L1O B;  1VQ6 A;  4BY1 H;  3GTG H;  4X66 L;  3E9H A;  4QGU A;  3I55 A;  1PH7 A;  3HKZ G;  3I7F A;  3PO2 G;  1GM5 A;  1HZB A;  3A5Z B;  4DV7 Q;  1PYS B;  4LFA L;  1T9H A;  2YTV A;  1C0A A;  1SMX A;  4X65 Q;  2L15 A;  2PNH A;  4A4I A;  2ZTC A;  3ER0 A;  1VQA A;  1IYJ B;  3OYY A;  3Q8D A;  4C2M H;  4A3E H;  3J7Z C;  2YYZ A;  4FDB A;  2F4V L;  1QUQ A;  4JYA L;  5IYD H;  1CKN A;  4ME3 A;  2F52 A;  3S15 H;  5IYD G;  4JI7 Q;  4OO1 G;  1P16 A;  1Y14 B;  4LFC L;  1VQC A;  4BBR H;  1QUQ B;  3U58 A;  1K9M C;  1AH9 A;  2VS1 A;  4R4C A;  3PSI A;  3UE0 A;  3W5O A;  1J5E Q;  3HOX G;  2VL6 A;  2K14 A;  3RN5 A;  3KF6 A;  3M7N A;  5C0X J;  3PUX A;  2MFI A;  2DGY A;  4P73 A;  2K5H A;  3S2H H;  5M5Y H;  2MNA A;  4GKK L;  2Z6K C;  3KDF B;  2EXD A;  1JB7 A;  4A3I H;  2VUM H;  3I2Z A;  3STB D;  4YHH L;  1CSQ A;  1KRS A;  2RHS B;  4DV1 Q;  2R92 G;  4BBS H;  4B3S L;  4A76 A;  3GD7 A;  3CW2 C;  4A3M G;  2CWP A;  5GAE C;  3M4P A;  4GNX C;  3BZC A;  4YWK A;  2NN6 G;  4B3S Q;  1S72 A;  3J80 c;  2OCE A;  1B8A A;  1VQ9 A;  2JEB I;  1M90 C;  3HOU H;  4YWM A;  1YZ6 A;  1X3E A;  4JI8 L;  4DR3 L;  3A74 A;  1XMO L;  4PG3 A;  4LF6 Q;  2WP8 J;  4GOP C;  4IFD J;  4LF5 L;  4DR6 L;  1BVS A;  4OX9 Q;  1I6H H;  3NEM A;  1FJG L;  1B70 B;  4DV5 Q;  5LMN Q;  4J15 A;  1UE6 A;  2XTI A;  1UWV A;  4HJ8 A;  1P8L A;  1L0W A;  1K8A C;  3CD6 A;  3RLF A;  4YHH Q;  1EFW A;  1VQI A;  4GLV B;  4YCW A;  3G6E A;  2AMC B;  1SLJ A;  2VY3 A;  1JJ2 A;  2RHQ B;  4HIK A;  1HZC A;  1OXT A;  3FP9 A;  2JA5 G;  3L2P A;  2E5L Q;  2HQL A;  3K81 C;  4PMW A;  4GOP A;  4DV4 L;  5GRO A;  3K80 C;  5C4J H;  4MNO A;  4OON A;  3TEH B;  4OWT B;  5M3M G;  5LMU Q;  4A3K H;  1N8R C;  2JA6 H;  4IPH A;  4C3J H;  3GDE A;  1PV4 A;  4LF9 L;  1BKB A;  1JE5 A;  2R7Z H;  2PI2 A;  3KF8 B;  3CCR A;  1K0R A;  3AQQ A;  4LF4 L;  3H3V I;  3HOY H;  1ASZ A;  1XJV A;  2IY5 B;  1EWI A;  4LF9 Q;  3UDG A;  1UEB A;  4RG1 A;  4OX9 L;  1EQR A;  3S1N H;  2OTJ A;  3TRZ A;  3T1Y Q;  2UU9 Q;  1G6P A;  2WFW A;  2CWA A;  3TRE A;  3RLN A;  1LYL A;  1K3R A;  4DNI A;  4DV7 L;  4Y7N H;  2HIX A;  4P72 A;  5IP9 H;  2B29 A;  1TWG H;  3PV0 A;  4A3J G;  1A0I A;  3HOZ G;  2NZO A;  3I56 A;  3I4O A;  4LWC A;  3FKI H;  4NPS A;  5GAD C;  2ASB A;  4JV5 Q;  4A3B G;  4QQB X;  1C9O A;  3FHW A;  3RZD H;  1SE8 A;  1UE7 A;  4BY7 H;  3S1M H;  1X54 A;  4LW1 A;  2AWO A;  1Y1V H;  1PFS A;  4JI5 Q;  4UP8 A;  4JI7 L;  4JBK A;  2ZTD A;  4LF4 Q;  1DGS A;  2H5X A;  1EIY B;  3D0F A;  1XTD A;  3T1Y L;  4JCV E;  3S16 H;  5JJK A;  3KLW A;  1N33 Q;  2N49 A;  3JAM c;  1I94 Q;  3UDX A;  2NVQ H;  4R4I A;  3HOX H;  1NBW A;  4UY8 C;  3AFP A;  5M5W H;  4X64 Q;  4WJ3 M;  1KHI A;  4L5R C;  1TWA H;  2R7F A;  3NBH B;  3CCM A;  4JG2 A;  4A3C H;  4IJH A;  2E5L L;  1TWC H;  2XGT A;  5EAY A;  3CCS A;  3MXN B;  1Y1W G;  3CPF A;  1XPR A;  3PO3 H;  1N36 L;  3K7U C;  2IX1 A;  1K73 C;  3HOV G;  5HY6 A;  3WWV A;  1YHA A;  5GAG C;  4JI8 Q;  4LF7 L;  1EQQ A;  1Z9F A;  1VCI A;  2K75 A;  4LFC Q;  3CQZ H;  3J7A 5;  4AIM A;  1I50 H;  4DV2 Q;  4H02 A;  3CMA A;  3KFU A;  2QEX A;  1EYG A;  1FGU A;  1J5E L;  2YTX A;  2I5L X;  4TVA B;  4DR3 Q;  4LF6 L;  3M85 A;  1MJC A;  2ZJQ A;  3M9B A;  2FXQ A;  2K5N A;  3E9I A;  4X64 L;  5HGQ A;  4BY1 G;  4X6A H;  1W3S A;  4O2D A;  2LXK A;  1PVO A;  4RMF A;  4WJ4 A;  4GLA C;  2F3I A;  5IYB H;  4L5S A;  4X65 L;  1CKO A;  2ALY B;  1L2F A;  2K5V A;  1PH8 A;  1IBK Q;  3KOJ A;  4A3G G;  2JA9 A;  1YI2 A;  1YIJ A;  1OXV A;  4IOA A;  1YJW A;  1IBK L;  3KJO A;  3U4Z A;  4X66 Q;  3VDY A;  5BR8 Q;  1VQO A;  1PH3 A;  2BH2 A;  3HOW H;  5K36 G;  3J81 j;  4DR1 Q;  2GVB A;  5M3F G;  4BA1 I;  1FL0 A;  4L5Q A;  2OQ0 A;  1GD7 A;  3PIP A;  3BU2 A;  4GLX A;  4JI1 Q;  2E2H H;  3B6Y A;  4HJA A;  4IOC A;  1L1O C;  2MO1 A;  4POF A;  1OXX K;  4UPA A;  1X3F A;  5IYB G;  3A5U A;  4PZ6 A;  2JEA I;  1JMC A;  4O0A A;  3PGZ A;  2I0Q A;  1R9T H;  2CQO A; 
#chains in the Genus database with same CATH topology
 2HCC A;  4R1J A;  3CAM A;  1A63 A;  1JOR A;  1E24 A;  4JI4 Q;  5EPK A;  3MR6 A;  4M1U B;  3EQL C;  2ZDH A;  1KJ9 A;  2F4I A;  3UQ8 A;  4QUF A;  2F3W A;  1CQI B;  4JI0 H;  3E6Z X;  2O5I C;  1PH4 A;  2ZT9 C;  2NTT A;  4JI6 H;  4IO9 A;  2CKZ B;  4MTN A;  3K3P A;  3M9N B;  1N48 A;  1CZW A;  5KFI A;  3G48 A;  3LWE A;  4N8X 1;  3I4M H;  5D1P A;  1B44 D;  4RZR A;  1PH5 A;  4JI0 L;  4BXX G;  3NEL A;  2R93 H;  2EY6 A;  5C44 H;  2A19 A;  3M7G A;  1RL2 A;  2EJM A;  1B2T A;  3GV7 B;  1DOL A;  1EU4 A;  1WCM H;  4KLK A;  1U0L A;  1WTV A;  5G3L F;  1IBL Q;  4PZ7 A;  4FF2 A;  1N32 L;  1AN7 A;  1Q46 A;  4J9O A;  2W9C B;  1C30 A;  4CC5 A;  4K2K A;  4APM A;  1GJX A;  3BZK A;  1PMR A;  1VQ8 A;  1F9P A;  2UXB Q;  4DR6 Q;  2NUA B;  3M9M B;  2MGS A;  1HNZ Q;  4HR7 B;  2VNU D;  3MTS A;  3VPB A;  2J6S A;  2ZJT A;  4ECZ A;  1Y1V G;  2QCP X;  3MFY A;  3MXG A;  5G3L D;  3DMU A;  4DK6 C;  4V0B A;  1JDB B;  2J4X A;  4B3T L;  4MV1 A;  2F4V Q;  4JYA Q;  1AUV A;  4JI8 H;  3MXU A;  4LFC H;  3GV8 B;  3J80 L;  1TAE A;  4EQN A;  3TS0 A;  4OHJ A;  4BY1 B;  3BG5 A;  4DV1 H;  4K8I A;  1RIP A;  1I3Q H;  1VMC A;  3E0J A;  5KG7 A;  1PK8 A;  2UVV A;  2HVS A;  3DEO A;  4UCS A;  3E0E A;  2KHJ A;  3PVX A;  4B3S H;  4X3T A;  4A3L H;  2YW2 A;  2JA5 A;  2CFM A;  4O3P A;  1VBG A;  1SYB A;  3WOF A;  2B63 B;  1KTK A;  4AQY L;  4B3R L;  1VQH A;  3OHA A;  2SOB A;  4A3G H;  1SDF A;  3CVZ A;  1WJJ A;  5C4X H;  3TDQ A;  2ID0 A;  1D6E C;  2MQH A;  2XVS A;  4ALP A;  2Y0S E;  1SYC A;  4DKA C;  3H40 A;  2EYL A;  3SEB A;  4O4L F;  5L1K A;  1IBM Q;  5C4X G;  5KFQ A;  2A1A A;  4LF8 L;  1ZYR C;  4OXP A;  2C00 A;  1YJN A;  5ELC A;  2AHO B;  1E4F T;  1N34 L;  1M4V A;  1JOQ A;  1HNW Q;  1SR3 A;  3U50 C;  3JSL A;  4C3H B;  4KTA A;  5FO9 B;  3HG9 A;  4LH7 A;  3V6J A;  3CCE A;  1KBL A;  1Q7Y C;  4UCU A;  2HHH Q;  1LT3 D;  3NQI A;  2F0H A;  4ABN A;  4CKE A;  4LF5 Q;  3J81 W;  4KN7 C;  1QVC A;  5BN3 A;  1ET9 A;  2I5H A;  4J9K A;  5C4J B;  4C2M A;  5C5M A;  5FLM G;  2GVA A;  4XIG S;  2R7Z G;  1VQ5 A;  1F9Q A;  4JI3 Q;  1PH1 A;  4V19 0;  1KAW A;  2EY5 A;  2ATW A;  5CA1 F;  2EYP A;  5K2M A;  5JJI A;  1KDB A;  2J7Z A;  3SK5 A;  2NVY A;  2RF4 A;  1U5K A;  3T1H Q;  3BA8 A;  2L1B A;  5KFX A;  3R2T A;  2M9V A;  4KHZ A;  2K5W A;  3URY A;  1FVI A;  2KJX A;  3LNN A;  3GIM A;  2BR0 A;  5IT9 L;  4A3C G;  3L9A X;  4C3I H;  2R93 G;  2W8L A;  2DUD A;  1YJ9 A;  1N33 H;  5IYC G;  2F0N A;  3GIQ A;  3M4Q A;  4UAI A;  3V2T A;  3LGJ A;  1JIH A;  1EEI D;  4EX5 A;  1K1Q A;  4MV3 A;  5KFO A;  4UP7 A;  3RBD A;  5KFM A;  1QZG A;  3KF6 B;  2JP1 A;  5DM6 3;  3OSO A;  3PUV A;  1NMG A;  3KDF A;  5LMN W;  1MD2 D;  4YY3 Q;  1WD0 A;  4LMQ D;  4MAM A;  1N36 H;  4TQR A;  2EY2 A;  4R8I A;  4HAE A;  2ATL A;  4J6H A;  2VQE Q;  1LTS D;  4DUY L;  2IPK D;  2VQF Q;  4F8M A;  1Z47 A;  5C3E G;  1KC7 A;  3JC6 6;  4HIM A;  1EY8 A;  3TME A;  3FKI G;  1M1K C;  1OTC A;  1CE8 A;  2PN1 A;  2C28 A;  1SRO A;  2HIV A;  2WAQ E;  3Q0A A;  1CUK A;  1Z2O X;  2MPM A;  4NXM Q;  3QR8 A;  2R92 B;  2OTL A;  1N34 Q;  4YJ2 F;  1HNX Q;  1WYD A;  2YU9 H;  3SHL A;  4GN4 B;  3A55 A;  3A0J A;  2A74 C;  2IX0 A;  2R7Z B;  4ZOL F;  2FFK B;  4QWE A;  2CVR A;  1ZHQ A;  2CH4 A;  3I90 A;  2JA5 H;  4A3B H;  1I6U A;  4IUR A;  5KFW A;  2W71 A;  4IHJ F;  3PMF A;  3QB3 A;  2JJQ A;  3T13 A;  1T36 A;  3L0O A;  5FD6 A;  5E3F A;  3PO3 G;  5IWA Q;  4A3E G;  3D6W A;  4HTH A;  1XWE A;  4RA8 A;  1Q81 C;  3HFZ B;  2RSO A;  1EIF A;  2AQ4 A;  2UVR A;  2V9W A;  3GV3 A;  3BS1 A;  2O5J C;  5M5X H;  1GHJ A;  5DGA A;  3S1R B;  4A3K G;  2IBK A;  1TII D;  5IGD A;  3PF4 A;  3RZO H;  4YP3 A;  1C3O A;  5KFA A;  5KFG A;  3PN1 A;  1FGB D;  3K57 A;  4CJ2 C;  3F2D A;  1XNR L;  4DR5 Q;  3CPW A;  5ELD A;  2A68 C;  3VYS A;  4A3I B;  2M05 A;  5M5Y B;  1NMF A;  2VR1 A;  2VUM G;  3F8T A;  1U4R A;  3R5F A;  5EPL A;  4N9T A;  3SK8 A;  3Q8P B;  5M3M H;  4QL5 A;  1C48 A;  5C1P A;  5I47 A;  1O7I A;  3GIK A;  5KIX A;  4LUV A;  1WVL A;  2MJ8 A;  2UXD Q;  2Y0S G;  1VQN A;  5LMU H;  2PCF B;  2MP1 A;  5E1F A;  4KHP Q;  5KG2 A;  1WTR A;  4DV3 Q;  5C0X G;  4A3J H;  2PO4 A;  3BQ0 A;  1HNW L;  3GTO H;  2E2I B;  1ULZ A;  4HIO A;  1RK5 A;  1IKM A;  5IT9 c;  4OIK A;  3PUZ A;  3T1Y H;  4DR7 Q;  4YAK B;  5LMU L;  1V8Q A;  5EZY F;  1IBM L;  1RCV D;  4OEM B;  4RFB A;  3FRP B;  5JH7 F;  1YNJ D;  4O2A F;  4XQJ A;  4JI0 Q;  1EHI A;  1PH6 A;  3TIG A;  5DLG A;  1ZHS A;  1HR0 H;  3KHR A;  4JV5 H;  2A6H D;  1TXY A;  4RU9 A;  5C8Y F;  2WB1 A;  5C3E B;  5E7N A;  1PRT D;  2F0G A;  3RB0 A;  4DV0 Q;  4LMY A;  5A2Q L;  5HUR A;  3DF7 A;  1D1I A;  3GV6 A;  2P5Z X;  1EYA A;  4RAZ A;  4YR3 A;  3J81 L;  4A3M B;  4X66 L;  1WTQ A;  2R93 A;  1PH7 A;  2QYZ A;  2YRX A;  1HPC A;  4J9P A;  1GM5 A;  1TWF B;  2EJG C;  5CR3 A;  5D14 A;  3A5Z B;  1UEA B;  5T1G A;  4DV7 Q;  4KKT A;  4LFA L;  4BWS C;  4LSA A;  2NVX A;  1V51 A;  1SMX A;  3C1F A;  5DEH A;  2Z4H A;  4A4I A;  5JOB A;  1VQA A;  3PW2 A;  2V5A A;  5FK9 C;  3J7Z C;  3I70 A;  4FDB A;  1DXM A;  3C46 A;  2F4V L;  4JYA L;  1CKN A;  3RFC A;  2EZV A;  1VKZ A;  2E2D C;  1VQC A;  3CQZ B;  3HOU B;  5F9N A;  1BNC A;  3RIZ A;  1S4Z A;  3GTQ A;  1XMQ H;  3RN5 A;  3KF6 A;  4F50 A;  1Y1V A;  4A2B A;  4ED6 A;  5C0X J;  1FKA H;  2PBZ A;  4GKK L;  5M5Y H;  2CQA A;  3KDF B;  2EXD A;  2ICE C;  1GUS A;  1TWA B;  3STB D;  4RAY A;  2RHS B;  4DV1 Q;  2R92 G;  2FPP B;  4B3S L;  3I4N B;  3GD7 A;  3CW2 C;  4QIW B;  3PO2 B;  3M4P A;  4MTE A;  4B3S Q;  1IOV A;  1SE4 A;  5COY A;  3J80 c;  4FXD A;  2OCE A;  1VQ9 A;  2JEB I;  4HED A;  3J81 E;  3M4O B;  4IRC A;  4HNU A;  1GUN A;  1J8I A;  1YZ6 A;  2EVB A;  4JI8 L;  4IFD J;  3A74 A;  3L4K A;  4OIJ A;  4ECT A;  3EA6 A;  3F8N A;  4B3T H;  4DR6 L;  4IZ8 A;  5EKI A;  2M2L A;  4EYH B;  4IUN A;  1B70 B;  3BG3 A;  1K1S A;  5JJL A;  1K8A C;  3RLF A;  1Y8O B;  2AMC B;  2JA5 B;  2VY3 A;  2XIW A;  4X3S A;  2RHQ B;  2BCO A;  1DV1 A;  4HYK A;  2HQL A;  4PMW A;  1RF2 D;  1IHZ A;  1GHK A;  1VF7 A;  4MNO A;  4OWT B;  2JA6 H;  1N8R C;  1RJP A;  3R3O A;  4B08 A;  2CW7 A;  3HOY B;  3H3V I;  2IY5 B;  1E2Z A;  1EWI A;  4H7B A;  4WFN 3;  5GON F;  4QWC A;  3Q8R B;  1F2L A;  2LFN A;  1UEB A;  4RG1 A;  1EQR A;  4OO1 H;  4RGT A;  3TRZ A;  1G6P A;  1S97 A;  2F0T A;  2UUB H;  1S10 A;  4MA5 A;  3RLN A;  2R84 A;  1NR2 A;  5EGT A;  4Y7N H;  1FR3 A;  2HIX A;  4PMC A;  2B29 A;  2NZO A;  3A7A B;  2NTS A;  4BY7 B;  4NPS A;  5GAD C;  1I4Q A;  1SE8 A;  1I7N A;  4DLK A;  4BY7 H;  3T1H H;  4IR1 A;  4Q45 A;  3H6M A;  4J9Q A;  4JBK A;  2WIN B;  2A6H C;  4LF4 Q;  1BGW A;  5KFZ A;  5JVL A;  1PZI D;  3VR6 A;  3R93 A;  2RCF A;  1EIY B;  5JAV A;  1XTD A;  2L4N A;  1EYD A;  3S16 H;  3SDZ A;  4C3H G;  1D5M C;  1N33 Q;  5COR A;  1AFP A;  2DZD A;  1I94 Q;  1S0N A;  4R4I A;  3AFP A;  5M5W H;  4O2B F;  4RB3 C;  5BN5 A;  1TWA H;  4JVZ A;  4LFA H;  3CCM A;  2ZDQ A;  4JG2 A;  5BN4 A;  2E5L L;  1O80 A;  2XGT A;  5EAY A;  2NVT B;  4HCS A;  1WTX A;  1CHQ D;  4KY5 A;  1N36 L;  3WWV A;  3OWE B;  4IUP A;  3OMG A;  2Q8I B;  3KK7 A;  4QWA A;  2BDN A;  2R8G A;  2KOL A;  5CYU A;  1EYG A;  2VQF H;  1X32 A;  2EYM A;  2I5L X;  3N6R A;  1G2T A;  4DR3 Q;  4LF6 L;  2ZJQ A;  1BXT A;  5KYI A;  3I12 A;  1JOK A;  2RDH A;  3E9I A;  4OGQ C;  3TP7 A;  5HGQ A;  4X64 L;  4Y8V B;  1KEE A;  4YR2 A;  4N9P A;  1EY5 A;  3C2P A;  2H1E A;  1IW7 C;  4AYB A;  5IYB H;  3OHB A;  5LL6 S;  2B8F A;  4R8U B;  3CRK C;  3HRZ C;  1IBK Q;  5JVH 3;  3KHH A;  3IFD A;  4A3G G;  2PQE A;  5KGU A;  4IOA A;  1IBK L;  4GKJ H;  4DV5 H;  4IAJ A;  4J0M A;  3KLR A;  1PH3 A;  2BH2 A;  2JEJ A;  3HOW H;  5K36 G;  2GVB A;  1STH A;  4BA1 I;  3BDC A;  4RCN A;  2V4Q A;  2OQ0 A;  1GD7 A;  1SND A;  5EPJ A;  3TIN A;  3B6Y A;  4KK7 A;  4HJA A;  3Q8Q B;  2WAQ B;  1OXX K;  4R9W A;  3A5U A;  5IWA H;  1EFI D;  1EY7 A;  1LTR D;  3I3C A;  5F2D A;  2I0Q A;  3GTO B;  3IAY A;  4IAL A;  2B63 H;  4LF9 H;  3NTI A;  1EWC A;  1D1K A;  1YNN D;  4CBV A;  3SK4 A;  3PIO 3;  3PIO A;  2I87 A;  2EJF C;  4B3M Q;  1KLU D;  1WI5 A;  3K5M A;  1SNC A;  1LTB D;  2FHT A;  3BVZ A;  1E0B A;  4YB8 B;  4XTC S;  4ZK9 B;  1PLF A;  2YS6 A;  3HXL A;  3SR1 A;  1CSP A;  2F0D A;  1XMO Q;  1KC8 C;  4YJ3 F;  4DU9 A;  5L1J A;  1N32 H;  4H0L C;  2LKV A;  2V1C C;  3NWS A;  4GNX B;  4NLG A;  2KEE A;  3OPO A;  1H9S A;  4JBM A;  1ML0 D;  1NCV A;  5IY0 A;  4JI5 H;  3DWQ A;  1RKN A;  3S17 B;  4JUZ A;  3JAM W;  4DXF A;  3K0Y A;  1GSA A;  1A3T A;  1SEI A;  3CCL A;  4KHP H;  1A8V A;  5M5X B;  4NP5 A;  3RB4 A;  1KNE A;  2KED A;  2RBM A;  4K2L A;  4OL7 A;  4A3F G;  4JC0 A;  4RH6 A;  5FLX c;  2SCU B;  5HBR B;  1SYE A;  2CHB D;  4X65 H;  4RB2 C;  1UE1 A;  1EYC A;  1I6H B;  5TSS A;  3BQ2 A;  1X3G A;  1DJR D;  1Q90 A;  4DR7 H;  1E7Z A;  1YHQ A;  2E2J H;  1SN8 A;  4UCR A;  1ZQ7 A;  1V43 A;  1XXG A;  4YY3 L;  3GQC A;  2OLS A;  4JV5 L;  2UU9 L;  2EY1 A;  2XN9 C;  3MEF A;  1PTO C;  4DUY Q;  2AQ2 B;  2L5T A;  4R4Q A;  5KFN A;  3D31 A;  3TS2 A;  1BNZ A;  2A69 D;  1CS0 A;  5JVG 3;  3MWM A;  2HDL A;  3GTM B;  5KNC A;  3RN2 A;  3M3Y B;  4LJZ C;  3ORQ A;  4PWQ A;  1YVC A;  4GN5 A;  2TMP A;  4DA2 A;  1KQS A;  1B3A A;  4HJ9 A;  3U9T A;  2UUB L;  4RGO S;  3S1R H;  4FBU A;  3A8I E;  1PFM A;  3TN2 A;  3Q2O A;  2PI2 E;  5C3E H;  4AQY Q;  4B3R Q;  4JW0 A;  3D6C A;  3TZU A;  1QVG A;  1EOV A;  5J39 A;  2Q2T A;  1GLV A;  1SNQ A;  1Z2P X;  4XYM B;  2J0T D;  2KHI A;  4P74 A;  1C7Y A;  1H9J A;  1BBU A;  1S0O A;  2K52 A;  4A3D H;  4LF6 H;  1TU2 B;  3CCJ A;  1JIC A;  1GUT A;  3PIP 3;  4DR4 Q;  3ULP A;  4TV9 F;  1B04 A;  2JK8 A;  5DG7 A;  1NSN S;  2F1M A;  4CDE C;  5IP7 H;  2BOS A;  2QA4 A;  2E2H B;  4F4Z A;  2R8H A;  1KLG D;  1WCM G;  2I5M X;  4K0K L;  3GTQ H;  1XMQ Q;  3TP8 A;  4B3M L;  2OH2 A;  2B39 A;  1TWF H;  2X0S A;  3R2I A;  5EWG A;  2C2R A;  1Y1W A;  4MV6 A;  1KAB A;  2R8I A;  4HN7 A;  4IWY A;  2IP4 A;  4JI1 H;  3BJY A;  5C0X I;  4O1N A;  1HNZ L;  3EPI A;  3EJI A;  5M3M B;  3F2U A;  2WYO A;  4ZLT F;  4U67 3;  5J22 A;  1LTG D;  3H91 A;  4XQQ A;  2C2D A;  1SJE D;  1X6O A;  2AKW B;  5EBC A;  1XPO A;  1E1O A;  3RZO B;  1VQK A;  2C2E A;  1ESR A;  2QIL A;  5C4Z A;  1KJJ A;  4M9U A;  4B3T Q;  2EE1 A;  4FVM A;  4A3D G;  4DAP A;  3CCQ A;  2CQY A;  1PDQ A;  1DYQ A;  4WRD A;  1E2W A;  1KJ8 A;  1L2Z A;  1PYB A;  3MZ5 A;  2E2I H;  2Y0S A;  2DWC A;  5FLM H;  3JRW A;  2DJG C;  3K5H A;  1AE3 A;  4WOR A;  1CKM A;  4OWX B;  3F1Z A;  5ELF A;  1KDA A;  2VUM A;  1B4O A;  2F0K A;  2KCM A;  4Y52 H;  2D0O A;  4JI6 L;  4IN3 A;  3G4S A;  2QKI C;  3OW2 A;  4DR7 L;  2VQE L;  4X3U A;  5KFS A;  1WTO A;  5K5P A;  4M8A A;  5C4H A;  2JA7 H;  1HA5 A;  1ILP A;  1B6R A;  5EOY A;  3K5I A;  5FPR A;  1VQE A;  4IPC A;  2RKS A;  2ICI A;  2D0P A;  2SNM A;  4C3J G;  5LL6 b;  1Q86 C;  2IA6 A;  2D2C C;  2UUB Q;  4HJ5 A;  4JK1 C;  4C3H H;  1OXS C;  2OXP A;  1VQG A;  1X56 A;  2OQK A;  2VPS A;  3VA7 A;  2UUA Q;  3TQY A;  4K5X A;  2KBN A;  3AYH B;  1NAP A;  2EPB A;  4G7O C;  4Q0F A;  4EEY A;  1NE3 A;  2WDT A;  2OWO A;  4CDD C;  5EKK A;  4R8N A;  4A3L G;  4IPG A;  4R4T A;  1E4G T;  4GKK Q;  5L1I A;  4EBE A;  4KY6 A;  4CDF C;  4PNY A;  3G8C A;  2HVR A;  4U68 A;  4DV4 Q;  4GZY C;  3VR2 A;  3R8B A;  1TR5 A;  2YS7 A;  2KCN A;  4P75 A;  4G57 A;  2BDO A;  2YU9 A;  1UNS A;  2CCZ A;  1I94 H;  2ZJR A;  4TQU S;  2K6A A;  2EIF A;  4I55 F;  1VQM A;  1FJG Q;  4A3I G;  2GPW A;  3PR5 B;  3KAJ A;  2BQ3 A;  1QCB D;  1TS5 A;  4OO1 I;  1CM9 A;  2QK4 A;  2WV6 D;  2YTY A;  3CCV A;  4DR4 L;  3KJP A;  1W2B A;  2Q8T A;  5IT9 W;  5L9X A;  1GVP A;  1K83 A;  4A93 H;  2YCH A;  1PA6 A;  3GIL A;  3QOL A;  5EDW A;  5J3B A;  3EIV A;  1ILQ A;  2DJF C;  1IZ6 A;  1A62 A;  3GO5 A;  4A3J B;  5FOB B;  1PTO B;  2N55 A;  2XWJ B;  4G4K A;  1KJI A;  1SE2 A;  1V9P A;  1XTC D;  2LXJ A;  4L1K A;  1SNO A;  3E5S A;  4LFB Q;  1VQ7 A;  2E8G A;  5L1L A;  1IKL A;  2HDM A;  3MWE A;  5C44 B;  1A9X A;  1SYG A;  1ICW A;  3BDO A;  2RDJ A;  2VQF L;  5DLF A;  4HCE A;  4A93 G;  3RLO A;  5LMN H;  4AH6 A;  3HKS A;  3H20 A;  1HRJ A;  5D3I B;  5KFV A;  2R6G A;  2JA6 G;  4DR2 H;  3J7Y W;  2LSS A;  3L7Z C;  3QZ8 A;  3CHB D;  2E5L H;  1JWM D;  2B2U A;  3W1G A;  4ECS A;  4C1N K;  1AP0 A;  4MHE A;  2Z4I A;  2K03 A;  3CRL C;  4PMB A;  3CXC A;  4A2A A;  3S24 A;  2DY8 A;  4IUT A;  1B33 N;  2UUC Q;  3RZD B;  3ORR A;  4EGQ A;  4R7R A;  2PMZ A;  5KG6 A;  1TWH H;  3CU7 A;  5E4X A;  1X65 A;  3ERO A;  4JOI C;  1JT8 A;  1N33 L;  1GGO A;  4DUZ Q;  2F0J A;  2K5Q A;  1JJC B;  1XPU A;  5C4X B;  2VB2 X;  1EUC B;  4QUC A;  4DAV A;  3NP8 A;  4TRD A;  3I4M B;  3GIJ A;  1PTO F;  1EZ8 A;  3KYH C;  1AW7 A;  4QY7 A;  3PUY A;  3N42 B;  4S3S A;  4R4O A;  4GOP B;  4A3M H;  1N32 Q;  1CTM A;  1DD2 A;  3N6X A;  5IWA L;  1O7L A;  2IL8 A;  3KHG A;  4DL2 A;  4BY1 H;  2A6E C;  4O3N A;  3GTG H;  3OTO H;  3E9H A;  3I55 A;  3PO2 G;  3HKZ G;  1HTL D;  2NUC A;  3OOC A;  5C3W A;  2HJW A;  1TQO A;  3P1H A;  1O7Z A;  1BCP D;  2E76 C;  2RDI A;  4X65 Q;  2L15 A;  1KDC A;  2PNH A;  3ER0 A;  2VA2 A;  3Q8D A;  1VF5 C;  4IUV A;  5IYD H;  1H9S B;  2H4O A;  4ME3 A;  4X62 H;  1LT4 D;  3S15 H;  3MAQ A;  4JI7 Q;  4A3G B;  4OO1 G;  1Y14 B;  5KT4 A;  4BBR H;  1QUQ B;  3U58 A;  2WB1 B;  2VS1 A;  4R4C A;  3K5N A;  3V4S A;  1R9T A;  4Q43 A;  2VL6 A;  4O3O A;  1BQQ T;  1RJT A;  3S9W A;  2FLL A;  3PUX A;  3T51 B;  2DGY A;  3JAM E;  2K5H A;  2YL2 A;  2MNA A;  5IYZ F;  1R4P B;  1JB7 A;  2B2W A;  2L55 A;  3DXJ C;  1SSO A;  3NE5 B;  2VUM H;  2R93 B;  1WD1 A;  3MR5 A;  1CSQ A;  1KRS A;  3VYR A;  4BBS H;  1D2B A;  4A76 A;  2TSS A;  5GAE C;  3BZC A;  4YWK A;  3KUP A;  5I6Y A;  1EUD B;  5J2T F;  2SDF A;  1A2T A;  4BBR B;  2EYH A;  2XWB B;  4YWM A;  1PRT B;  3SE0 A;  4DR3 L;  4LF6 Q;  3GTM A;  5A2Q E;  2WP8 J;  4JPB W;  4C3I G;  1T94 A;  4DR4 H;  2W6P A;  2CW0 C;  1BVS A;  4XYO A;  4FYD A;  4OX9 Q;  2R7K A;  3NEM A;  4NKL A;  3S1M B;  1SYD A;  4UDU C;  1N56 A;  1UE6 A;  4K6L A;  4ZRZ A;  4U7C A;  1VQI A;  4RWS C;  4YCW A;  2W9B A;  1SLJ A;  1A15 A;  2BE5 C;  1QNK A;  2JA5 G;  4RB1 A;  3L2P A;  3D4R A;  4F4W A;  4GOP A;  1LO5 D;  1JQY D;  4DV4 L;  2FK1 A;  3KBG A;  4OON A;  5M3M G;  1K83 B;  3T56 B;  4C3J H;  1BKB A;  1JE5 A;  2R7Z H;  2F0Q A;  2KCC A;  1G6Z A;  4C5A A;  1K0R A;  4LF4 L;  1H9R A;  1ASZ A;  1XJV A;  5CV7 A;  3TSS A;  3QOJ A;  5IGG A;  5IOD A;  4DL5 A;  1T3N A;  4Q8F A;  4C3J B;  2BQR A;  2CWA A;  2F0U A;  2C9O A;  2ASD A;  1LYL A;  4F87 A;  2R86 A;  4DNI A;  4DV7 L;  1Q3L A;  1TWG H;  3ND9 A;  3HOZ G;  3J7A F;  3I56 A;  3FKI H;  1SYF A;  3RZD H;  1ROD A;  1SMY D;  2CH4 W;  3S1M H;  1X54 A;  2ZTD A;  2EXZ A;  4LF8 H;  2H5X A;  4ZQ3 A;  1K28 A;  3RB6 A;  3T1Y L;  2F3V A;  3HKZ B;  3TBI B;  2NVX B;  2F0L A;  3GP7 A;  1G2S A;  4BS9 A;  3DM1 A;  3UDX A;  4DR6 H;  3HOX H;  1HNZ H;  1NBW A;  4UY8 C;  5CGK A;  4X64 Q;  1KHI A;  4L5R C;  2VUM B;  5KNB A;  3NBH B;  3S2H B;  4C3I B;  3Q22 A;  1Y1W G;  3CPF A;  4DL6 A;  2B2U C;  1IL8 A;  1BCP F;  2FMA A;  2F4V H;  5HY6 A;  4JYA H;  1PTO H;  5GAG C;  4JI8 Q;  1S5D D;  1EQQ A;  1V1P B;  2K75 A;  2KQ3 A;  4LFC Q;  5M9O A;  5KFP A;  2D9U A;  1SYX B;  2ENB A;  4ED8 A;  3PW5 A;  1J5E L;  2YTX A;  3GTJ A;  3P75 A;  2F0W A;  3LX0 A;  3SK6 A;  2RGV A;  3SE7 A;  4TVA B;  4EGV A;  5A2Q W;  5KT3 A;  4GKK H;  3NSW A;  3TII A;  4A3E B;  1HTP A;  1BF4 A;  3PW0 A;  1GYF A;  1HFN A;  4UFZ A;  1GUO A;  2W6N A;  1G8Z D;  2LXK A;  4IWX A;  2E74 C;  1HHV A;  4LK1 C;  2NU6 B;  2ALY B;  3GQB A;  4RHS A;  3MWY W;  1KNA A;  2JA9 A;  3RJ0 A;  2J6U A;  3H0G B;  5KYL A;  5EQ0 A;  1M0T A;  4X66 Q;  1VQO A;  5I9O A;  5D65 A;  3ND8 A;  4ED0 A;  3GID A;  5M3F G;  1EQT A;  5A35 A;  3PIP A;  2E2H H;  1HCZ A;  5CA0 F;  2MO1 A;  2CW0 D;  3KTM A;  5IYB G;  1C4Q A;  1VBH A;  5IIF A;  4O0A A;  5IP9 H;  2CQO A;  5IGF A;  1XNQ Q;  5KND A;  5LA6 F;  4HSP A;  1B7Y B;  2KEC A;  2HT1 A;  2FLN A;  4LFB H;  3GTP H;  5GQO A;  3QZ7 A;  2UU9 H;  4DV6 Q;  2M00 A;  3G6J B;  2Z6B A;  3GTG B;  1I4X A;  4JI3 H;  4LSX A;  1I94 L;  1S03 G;  5KT6 A;  3Q6S A;  4J9N A;  3DM3 A;  4ZI7 F;  2ES2 A;  3A7L A;  4DAY A;  1IYU A;  4X62 L;  2BH8 A;  1QE6 A;  3G6Y A;  2F0S A;  1K83 H;  3WNZ A;  1DON A;  2E75 C;  4M7E A;  4ED7 A;  4NMZ A;  1LT6 D;  5H1S E;  2Q8R E;  2LY7 A;  2BA1 A;  1JWU D;  3H3V C;  2AGP A;  1HQR D;  1G51 A;  3ERS X;  2AGO A;  4EYI B;  3CF5 A;  4UCT A;  1VMP A;  1LLR D;  4ZYS A;  1KL9 A;  1RTN A;  5JEA G;  3S14 H;  1VS0 A;  2DY7 A;  4CKC A;  2GA4 B;  5JPN C;  3BJU A;  3AFQ A;  1EIH A;  4DV3 L;  4JBW A;  5FO7 B;  1QZH A;  1KRT A;  3S14 B;  1TKW B;  4F7X A;  1F2Z A;  4NXN Q;  1JE4 A;  4A93 B;  5KT7 A;  5M3F H;  5IYC H;  3H09 A;  2MO0 A;  2A6E D;  3GTO A;  4Q5V A;  4NXN L;  5LL6 X;  5C44 G;  1J5E H;  2NVY H;  2DNE A;  1CQJ B;  3K5L A;  1V1Q A;  5JUM A;  5KG1 A;  3EN2 A;  4RNN A;  2Q2H A;  3Q24 A;  4KI0 A;  3KAK A;  5CBA E;  4RHR A;  2UUA L;  3HOV H;  1BO0 A;  1TWG A;  1E4E B;  3OTO Q;  3LML A;  2RGR A;  2JA8 B;  4K5W A;  4NXM H;  4CDC C;  2NVX H;  2IHF A;  5JEA H;  2J6T A;  2C35 B;  2K33 A;  3ITP A;  2NYZ D;  2W70 A;  4NB3 A;  2B2V A;  3R23 A;  2YYA A;  5FJ8 G;  3N40 P;  4X62 Q;  3ULJ A;  2B2W C;  4NXM L;  2CW8 A;  5EWE A;  4HSV A;  3M4Y A;  3H94 A;  3V05 A;  1WFQ A;  4A3D B;  3FKI B;  2HUG A;  4YHH H;  1VQD A;  4KY7 A;  4QCL A;  2OEO A;  2HGS A;  4DV6 L;  2BE5 D;  1HR0 L;  4IFD I;  3EVQ A;  3LWB A;  3VYU A;  2A69 C;  4RUA A;  3HOY G;  3QG1 A;  3ICE A;  4DV5 L;  1EIG A;  5CV8 A;  2DNC A;  2V4D A;  1SFO H;  3M3Y H;  3L3O C;  2PVP A;  3K3V A;  4WD3 A;  2NZH A;  2DLN A;  4IPD A;  2K4K A;  4O3S A;  4I50 F;  4XZ3 B;  3K5O A;  5IP9 G;  1VQB A;  2AUJ D;  1BXR A;  4KD4 A;  2WII B;  2UUC L;  1BDO A;  3HS0 C;  3G71 A;  2FK2 A;  1VAJ A;  5NUC A;  3UE1 A;  3GTJ H;  4A3F H;  1S40 A;  3HOZ B;  4DR5 H;  1RYS A;  2O2L D;  2WB1 E;  5I9P A;  3J81 i;  3CC7 A;  4IFD G;  4HID A;  1SRU A;  2RSN A;  1M7J A;  1CQV A;  1SBB B;  2QGQ A;  3AEV A;  4YWL A;  1QOH A;  5KFD A;  5KT2 A;  1I5F A;  3IN5 A;  2JEF A;  2R8K A;  1Q1E A;  3S2D H;  3HEJ A;  4POG A;  5FLX W;  2UXD H;  3A54 A;  4C1N I;  3G7L A;  3RMH A;  2NN6 H;  1IXR A;  4ED3 A;  4RNM A;  1MBY A;  4DV3 H;  1I4H A;  2B3G A;  4MA0 A;  2N8N A;  1JB3 A;  1K0S A;  2PQA B;  1QJO A;  2EYF A;  3H15 A;  4BBS B;  2VPQ A;  1I6V C;  2W6Q A;  3HOX B;  5LP6 F;  2B63 G;  5ELE A;  4AYB E;  3I91 A;  1RK6 A;  3I72 A;  3TZD A;  2ZDG A;  4OWW B;  2LS0 1;  1HNX L;  4RNO A;  1HR0 Q;  2KCT A;  3J80 i;  1PH9 A;  1Z7T A;  2Y0S B;  5KFB A;  3GTL A;  3GTL H;  2R7D A;  2ZTE A;  2GLT A;  2JEG A;  4EBD A;  3T5J A;  4YCV A;  3I4L A;  1Y1W H;  3T4A C;  1HA6 A;  3ETH A;  4DAY B;  4EFB A;  4E6I A;  4YR0 A;  3UFX B;  1A6X A;  4LF8 Q;  1XYI A;  1JXL A;  5BPF A;  4TV8 F;  5EBD A;  4AYB G;  4YCU A;  2J9G A;  4DV7 H;  1F9S A;  4I7H A;  1MJE A;  1HZA A;  3HOW B;  3K7A H;  1IBL L;  2I46 A;  2XCL A;  1EY4 A;  1H9M A;  1QG7 A;  4X64 H;  5C5L A;  1GO3 E;  5BR8 L;  1JWS D;  2K7V A;  3HOU G;  1RHP A;  5LYJ F;  1AZQ A;  4EQO A;  3RAX A;  1SAP A;  1D5Z C;  4J9S A;  1NJI C;  4DK3 C;  1U4L A;  5BR8 H;  1WTP A;  3OMC A;  5KRU A;  3Q23 A;  5KFF A;  3HB9 A;  3J81 c;  2UVW A;  1LTL A;  1D8L A;  4FNF A;  1CHP D;  1VQF A;  2G5D A;  2VUG A;  4L5T A;  2QDL A;  3CME A;  4ECU A;  1TWH B;  3T1H L;  3G6V A;  4B9W A;  4U6P A;  5ELN A;  5EKL A;  1EUJ A;  2AUK A;  1JLL B;  5CC4 A;  3EYY A;  1PH2 A;  4LF5 H;  1MSH A;  1AUX A;  1NUC A;  2FJZ A;  2XGQ A;  1STB A;  4JI1 L;  1TS4 A;  2UXC Q;  3ZJY C;  2PQA A;  4QF4 A;  3PO2 H;  2JE6 I;  1IOW A;  3CC2 A;  4FS2 A;  2Z6K A;  3UDI A;  3S17 H;  5JQW A;  1LAB A;  4XQN A;  3VR4 A;  4QW9 A;  3OUU A;  1RJR A;  1B53 A;  1OXU A;  3F2B A;  2JA7 B;  4ID6 A;  1VQP A;  2FPI B;  2B2Y A;  2L0C A;  1SMY C;  3CQZ A;  4DL7 A;  1EY9 A;  4JV0 A;  3OTO L;  2F0M A;  1XMQ L;  1B9N A;  4MV8 A;  2I80 A;  2JXM B;  3GII A;  4ME6 A;  2K04 A;  4RKL A;  4EVO A;  3JAM i;  3JSN A;  1KAA A;  4FBT A;  3I8Z A;  1CZG A;  5IGC A;  3KXY T;  1U9R A;  1I4P A;  5DLQ E;  4IUQ A;  1XNQ H;  3SXH A;  1V1O A;  2D5D A;  1YEZ A;  4MV4 A;  2NB0 A;  1MIU A;  3KLS X;  4JI3 L;  3VMM A;  4BBS G;  3OHX C;  2R7N A;  3V6K A;  3NTH A;  3K8A A;  3PCO B;  4J1M A;  1UC8 A;  4DNT B;  5AFW A;  2K1B A;  3FMA A;  3RD4 A;  1JKJ B;  4UP9 A;  3P20 A;  4YY3 H;  4HJ7 A;  1JX4 A;  1MI2 A;  1N36 Q;  2C5C A;  3S1Q B;  1VQ6 A;  1O7Y A;  4DGZ A;  3TQ1 A;  5H80 A;  2CZG A;  3MEH A;  1S5F D;  2RA4 A;  3I7F A;  4L6T B;  2ZM6 H;  4K14 A;  1TVX A;  1S68 A;  1PYS B;  4F4X A;  3C0F B;  3GTK B;  5D8D A;  2HQE A;  1N34 H;  1HNX H;  3K6O A;  3OYY A;  5D1O A;  2O4X A;  2NU7 B;  1LAC A;  5D3D A;  4Z9C B;  1QB5 D;  3C3L A;  1PXU A;  5T1I A;  4UCO A;  1CI3 M;  3DUZ A;  4LFC L;  2JA6 A;  1CA6 A;  1ENF A;  4WJW A;  3MWD A;  1XX8 A;  3PSI A;  1J5E Q;  2K14 A;  4YIJ A;  2SEB D;  2NU8 B;  4QWD A;  4G3I A;  4P73 A;  1QWY A;  1DM0 B;  2JEI A;  4ECX A;  2Z6K C;  4A3I H;  4DL3 A;  2FP4 B;  2G9D A;  3E3X A;  5CAE B;  4DR3 H;  1M6V A;  3DEP A;  3W2D A;  2CWP A;  2FJ2 A;  4GNX C;  2NN6 G;  4UCV A;  1I7L A;  2XD4 A;  3HOU H;  2W7P A;  1X3E A;  2F0F A;  4PG3 A;  1BJT A;  4GOP C;  2V4R A;  1IBK H;  4LF5 L;  2RQX A;  2PZW A;  1FNW A;  1I6H H;  5I4D A;  3MVV A;  1UNN C;  1JR0 D;  3V4Z A;  5DQI A;  3H4B A;  4DV5 Q;  1B3Q A;  1EZ1 A;  1R9T B;  1UWV A;  1P8L A;  3MFG A;  1WSC A;  4YHH Q;  1EY0 A;  3G6E A;  4XX0 B;  3AU7 A;  4O4I F;  1E2V A;  1JJ2 A;  1TWF A;  1HZC A;  1OXT A;  3FP9 A;  3IFT A;  1S0M A;  1Q8I A;  2RVL A;  3K81 C;  1K8M A;  3RF2 A;  4YAJ B;  3GV5 B;  5LMU Q;  5JPM C;  2JSO A;  2NBF A;  1YNJ C;  3KF8 B;  3RGX A;  3HOY H;  4MN3 A;  4K8J A;  3S16 B;  1TWH A;  4LF9 Q;  2EYO A;  2OTJ A;  3S1N H;  4K6D A;  1F2M A;  3T1Y Q;  5KFE A;  3MJF A;  4B3M H;  5DM7 3;  2F0P A;  3TRE A;  1L0Y B;  2VQD A;  3RUZ A;  3VYT A;  3X3M A;  4P72 A;  4KJN A;  4RGN A;  5C0X H;  4A3J G;  3GTQ B;  5KFC A;  1A0I A;  1Y1V B;  4EEQ A;  3FVQ A;  3MXN A;  2ASB A;  4JV5 Q;  5C1O A;  2W8K A;  4QQB X;  1XMO H;  3BVM A;  2B2V C;  3J80 W;  3FHW A;  1GOZ A;  4EFE A;  1DOM A;  1UE7 A;  2YZM A;  4LW1 A;  4DV0 H;  4H13 C;  1Y1V H;  4QIW A;  4JI5 Q;  4JI7 L;  3NK9 A;  1TA8 A;  2LMC B;  1IYV A;  1RDP D;  2A68 D;  1PTO D;  2ZXR A;  4IFD H;  5JJK A;  1SXT A;  1EY6 A;  3KLW A;  4O4H F;  4F4Y A;  2WAQ A;  2MUY A;  3JAM c;  4MV9 A;  2DPJ A;  1PZK D;  4JI2 H;  3M9O B;  1QNU A;  3NPP A;  5KFU A;  2IMW P;  2JN4 A;  3BYT B;  1ZEQ X;  4J9L A;  3D4W A;  1SNP A;  2W6O A;  4A3C H;  4IJH A;  1A3U A;  5CV4 A;  4DUY H;  1DCZ A;  1XPR A;  3PO3 H;  2R87 A;  1SFO A;  3K7U C;  4CJ1 B;  2WE6 A;  2Z9H A;  4LF7 L;  1Z9F A;  1VCI A;  4GC7 A;  4GC6 A;  3FEW X;  3CQZ H;  1O78 A;  4AIM A;  4DV2 Q;  3TQT A;  4H02 A;  3CMA A;  2QEX A;  1B6S A;  4TUY F;  1ENC A;  3MFI A;  1FGU A;  3HBL A;  4A3F B;  3HGB A;  4ULL A;  5IGE A;  2R85 A;  4AYB B;  2EDG A;  2L9H A;  3IG0 A;  5C6A A;  5KG5 A;  3M9B A;  4ODG A;  1AN8 A;  1CA5 A;  4AQY H;  4B3R H;  1QIL A;  4X6A H;  2AGQ A;  2PW7 A;  2A5H A;  1W3S A;  2MHV A;  2ZXP A;  2R61 A;  1M0W A;  4O2D A;  1D5X C;  1FYC A;  1PVO A;  4RMF A;  4WJ4 A;  1H9K A;  4EGJ A;  1YNN C;  1EYZ A;  4E4T A;  1CKO A;  3RB3 A;  3ZYY X;  3FDS A;  2K5V A;  4KD3 A;  5M5W B;  1PH8 A;  4Q8E A;  3U9O A;  3S1N B;  3L4J A;  4DFA A;  1YI2 A;  3DWP A;  1YIJ A;  1HQM C;  5D1O B;  4ED2 A;  1YJW A;  3NWT A;  1LTI D;  3K7A B;  3VDY A;  5BR8 Q;  2DIK A;  2JA6 B;  4L5Q A;  1Y8P B;  1GXD C;  4LF7 H;  3BU2 A;  1JDE A;  4ILW A;  4GLX A;  4JI1 Q;  2X6G A;  1LTT D;  2VA3 A;  1L1O C;  3BVG A;  1CT1 D;  4FXK C;  1TY2 A;  4FF3 A;  1BCP B;  1X3F A;  1GUW A;  3PQI A;  2K5D A;  4PZ6 A;  4CC6 A;  2PZT A;  1JMC A;  1SCU B;  2RDF A;  1R9T H;  1G91 A;  1E3P A;  2R3Z A;  2EQS A;  3KLS A;  4GS3 A;  4IJL A;  4BA2 I;  1L0X B;  2Z0S A;  2I07 B;  1X55 A;  3U9S A;  2UXC H;  3AMU A;  1HUN A;  3IRB A;  2V58 A;  1QVF A;  2AQ1 B;  4HR7 A;  2XCA A;  4ECY A;  5LMN L;  1HZ9 A;  3I4M G;  3S1Q H;  1HUM A;  1K3B C;  4F88 A;  2XSC A;  1XDN A;  2R8J A;  2QDB A;  3MA2 B;  1M8A A;  3HKZ E;  4XYL B;  3I4N H;  5IP7 G;  1GSO A;  3OUZ A;  3OIP A;  2VXW A;  1X3Q A;  1PYW D;  5FPO A;  1S5E D;  3GTM H;  1E1T A;  3WO1 A;  4TQS A;  2JA7 G;  5KFL A;  4QJF A;  2KA7 A;  4LF4 H;  1W6K A;  2VW9 A;  1JJG A;  4LUZ A;  2FK3 A;  1WOC A;  2WAQ G;  1UAP A;  3BZD B;  4DV2 L;  3KAL A;  1J6Q A;  1HJP A;  1WR2 A;  4ECW A;  4ED1 A;  5IE8 A;  2E2J B;  5KFY A;  4FS1 A;  4I65 A;  1W6J A;  3GTG A;  4LFA Q;  2UUA H;  2PPB C;  3M4O H;  1BBX C;  1WCM A;  2RCN A;  5JEA J;  3PO3 B;  3QO2 A;  4RKB A;  1VQJ A;  1UE5 A;  3FDT A;  3RAQ A;  1PRT C;  1XNQ L;  4MIU A;  2F0I A;  2B2T C;  4CHT B;  1CQF A;  1HH2 P;  2EYJ A;  4HMJ A;  5FKA C;  2ZXO A;  2B8G A;  2X69 A;  3D4D A;  2AWN A;  3EPG A;  1GUG A;  1GKH A;  2ZM6 Q;  2KVM A;  4MTK A;  4EQ5 A;  1STY A;  1U4M A;  3H4D A;  4CJ0 B;  4JI5 L;  2R7M A;  2R92 H;  2R92 A;  1Z6H A;  1MZB A;  4HQ6 A;  3NEN A;  3QFF A;  3HZX A;  2K50 A;  2MCT A;  4DR5 L;  4KHP L;  3VA5 A;  5AJ3 Q;  1FNV A;  3GTP A;  2NWG A;  1IL2 A;  5KFK A;  4PZ8 A;  3BQ1 A;  1T5X D;  4TSS A;  4DXG A;  4GNX A;  4K5V A;  1X9N A;  1Y1W B;  1KD1 C;  3WO0 A;  3GTK H;  4GKJ Q;  1RYR A;  1YHB A;  2UXD L;  4P71 A;  2K28 A;  1K8G A;  3V6H A;  3MC0 B;  4Y7N B;  2R82 A;  3W1B A;  4CGY B;  2JA8 H;  1YNX A;  2W6M A;  4IZO A;  3F2C A;  5C5J A;  2E2H A;  4UHV A;  1I3Q B;  4KKU A;  2JA8 G;  4WBN F;  2FMC A;  2GN5 A;  5KFJ A;  2UXC L;  4LFB L;  2C22 A;  3O13 A;  4QW8 A;  4HMI A;  1UC9 A;  3PZP A;  2W57 A;  4C5C A;  2PMZ E;  4JBJ A;  3JZI A;  5CMD A;  3HP3 A;  4DF7 A;  3Q1K A;  1LUZ A;  1S5C D;  1FNU A;  1PFN A;  4P2C B;  2ZJP A;  4A75 A;  3CKI B;  2RDG A;  2YV5 A;  3QJY A;  1BOS A;  5KFR A;  4FM9 A;  1E4E A;  4KN4 C;  4YBZ B;  4QB4 A;  5I2X A;  1Q8K A;  4KHV A;  4JI2 L;  5ISR A;  2HVQ A;  4BY7 G;  3K0X A;  1L1O A;  4DR2 L;  3OSN A;  4FF4 A;  2N78 A;  3N44 B;  1MHW C;  5DQH A;  4ECV A;  3RBE A;  4BXX H;  3STB C;  3MFH A;  4DR2 Q;  3I73 A;  3FPP A;  2FKL A;  1WCM B;  1TS2 A;  1ZXT A;  3OWF A;  3VPD A;  4JOI A;  4Q44 A;  1DIK A;  1S3O A;  3RV3 A;  2Q2I A;  3VPC A;  4QIW E;  4XT3 B;  2KSW A;  2FE3 A;  4RGM A;  4DK1 A;  4Q0Y A;  3FKI A;  2R7Z A;  2NVT H;  2K01 A;  4ZUI A;  1KXL A;  2OF1 A;  3GIP A;  3NHH A;  3D8G A;  1D7Q A;  3NXW A;  2A8V A;  4PV1 C;  2IHE A;  2AU0 A;  2VZA A;  3EBE A;  1EZ6 A;  3PUW A;  4MTD A;  2JQO A;  1HR0 W;  4FP5 D;  1U4P A;  3NUC A;  4I7Z C;  1ICF B;  3CCU A;  2K32 A;  3H0G G;  3GTP B;  3S2D B;  5GAH C;  3ULL A;  2PW5 A;  5FJ8 H;  5ELO A;  4DR1 L;  4O3Q A;  3KF8 A;  1II3 A;  1EQV A;  2HD3 A;  1CK1 A;  1WH2 A;  2Z1C A;  1XNR Q;  5CV6 A;  5T14 A;  5CV9 A;  1PFB A;  1Q1B A;  4DPG A;  1SNM A;  1PHJ A;  1AEX A;  1TWG B;  1YBY A;  2XNA C;  4GKJ L;  3QIA A;  3I4N G;  3T5H A;  3DLL A;  4MZ9 A;  4KV6 A;  1A3V A;  4DUZ L;  2IT1 A;  1Q82 C;  1IW7 D;  3NQT A;  3ONA B;  2Q2U A;  4FF1 A;  4JI2 Q;  1MKH A;  3HOW G;  4XXE A;  1BBW A;  5K36 H;  4DNR B;  4EQP A;  3RNU A;  4K0K Q;  2D62 A;  4RB0 A;  4JI7 H;  1BCP C;  2YU9 B;  4DAM A;  2IX3 A;  4ECR A;  4DK0 A;  2YZG A;  5FO8 B;  1DZ1 A;  3SGI A;  5KT5 A;  3FPU B;  2E2I A;  4DR1 H;  3UDF A;  2HHH L;  4LH6 A;  5DG9 A;  3PW4 A;  5M3F B;  1VDZ A;  5HV6 A;  1LM0 A;  4DV2 H;  1JC7 A;  5FLX E;  2WB1 G;  1YIT A;  4J8Q A;  1TWA A;  4LUO A;  4J9R A;  2A73 B;  4EBC A;  4DV0 L;  1B9M A;  2B2Y C;  4JI4 L;  3GTL B;  2WAC A;  4KKS A;  4KJO A;  2O03 A;  3M4I A;  4BBR G;  3KHL A;  1F2Y A;  2UXB L;  1OWT A;  3HOZ H;  4FO2 A;  4LNQ A;  5DQG A;  4JI4 H;  1HFG A;  2ZM6 L;  2R7L A;  1NY4 A;  3C1E A;  2G9H D;  4G7H C;  1PX2 A;  3PF5 A;  1G29 1;  2KEN A;  2N3S A;  4YQW A;  4OX9 H;  2I8C A;  1E22 A;  1JCK B;  3BA9 A;  2QF7 A;  2B2T A;  2BQU A;  1AZP A;  3VR3 A;  4JI6 Q;  2XRS D;  1ASY A;  5IT9 E;  1F77 A;  4NW2 A;  5KG3 A;  3RR5 A;  2ASL A;  3D3R A;  3LP8 A;  2FIN B;  1AE2 A;  4LF7 Q;  4IUU A;  3PR4 A;  1EU3 A;  4G7Z C;  2WKD A;  4QMG A;  1TS3 A;  4APV A;  1GSH A;  4EG0 A;  1CKN B;  1Q12 A;  3V96 A;  4ZUJ A;  1VQ4 A;  5L37 A;  2FPG B;  3S15 B;  3MXP A;  2OT2 A;  2KHS A;  1I4G A;  5AJ3 L;  4ME5 A;  5IGB A;  1TWC A;  2XIG A;  3H3V H;  1IBL H;  3MHB A;  2FB9 A;  3DWA A;  1NTG A;  3R5X A;  2VB3 X;  4DV1 L;  1PRT F;  3CC4 A;  5CBE E;  1ONL A;  1LT5 D;  2BA0 A;  4B9X A;  3U4V A;  3JRX A;  3N8D A;  2UXB H;  1PZJ D;  2F0V A;  2NN6 I;  2NU9 B;  2W7O A;  1STE A;  1UUP A;  1RTO A;  4A3B B;  5DAU A;  3BAB A;  2FLP A;  3W3A A;  1KIX A;  3DHQ A;  1WTH A;  1FD7 D;  5IOC A;  1T5E A;  3CP0 A;  3G6X A;  2B63 A;  4GN3 B;  1N9W A;  3UI2 A;  4L63 B;  2FMM A;  3H0G H;  1VQL A;  1L1O B;  1EEF D;  5I2Y A;  2X6L A;  3HOV B;  4NDX A;  5BPH A;  2QW7 A;  4X3K A;  2W9B B;  1B1Z A;  4QGU A;  3A8K E;  4FU0 A;  3WOE A;  1HZB A;  2W9A A;  2YZN A;  5FLX L;  4DV4 H;  4IR9 A;  1T9H A;  2HCI A;  2YTV A;  4HNV A;  1Y8N B;  1C0A A;  4HNT A;  3SI8 A;  1J9O A;  3NBI A;  5JJZ A;  1H95 A;  2ZTC A;  4A3E H;  3MR3 A;  1IYJ B;  4C2M H;  5LXT F;  5KFH A;  3Q8S B;  2YYZ A;  4TKO B;  1QUQ A;  5I6W A;  3TP6 A;  2Z8L A;  2F52 A;  4DN4 M;  1FJG H;  5IYD G;  4H44 C;  1P16 A;  1LTA D;  5DNF A;  1I50 B;  3ETJ A;  5KFT A;  4IRK A;  1K9M C;  1EWH A;  2N88 A;  1AH9 A;  3UE0 A;  1IBM H;  3W5O A;  3HOX G;  1C8C A;  3M7N A;  1ZET A;  1ESF A;  2F0E A;  2MFI A;  4ZKB B;  3S2H H;  3J80 E;  3K58 A;  1HNW H;  4O3R A;  3I2Z A;  4YHH L;  3J7A K;  3WDN A;  2F03 A;  1W93 A;  5C3X A;  4ZAI A;  2QEJ C;  2NVQ B;  2PMZ B;  1SJH D;  4IRD A;  4A3M G;  2HHH H;  4IQZ A;  3P7J A;  2NVY B;  3OIQ A;  4J9M A;  1X3P A;  4BWG B;  1S72 A;  5ELB A;  2ALZ A;  1B8A A;  5LHY 1;  2WKC A;  2ASJ A;  1DV2 A;  1RD9 D;  5KX5 F;  1ENA A;  1S9F A;  1XMO L;  1STN A;  3NTK A;  5F9L A;  3BYY B;  3SVM A;  4JV2 A;  3N43 B;  1FJG L;  3IKJ A;  1B50 A;  3RGZ A;  2XGP A;  5LMN Q;  4J15 A;  2XTI A;  4HJ8 A;  3CD6 A;  4X66 H;  1L0W A;  5CB4 F;  4RUC A;  1EFW A;  1RJQ A;  2JA7 A;  3N52 A;  4GLV B;  4JV1 A;  1DOK A;  3T53 B;  4N8F A;  2V59 A;  4HIK A;  5KG0 A;  5CV5 A;  2UVU A;  2E5L Q;  1ZYR D;  2EOT A;  3PW7 A;  1EOT A;  5GRO A;  3K80 C;  2W9C A;  2AQ3 B;  5C4J H;  3TEH B;  4A3K H;  4ETS A;  1OO9 B;  1R4Q B;  4IPH A;  5J1Z A;  3GDE A;  1PV4 A;  4LF9 L;  2R6F A;  2PI2 A;  3CCR A;  3AQQ A;  1Z2N X;  2UUC H;  1BUV T;  3UDG A;  2IWH A;  4OX9 L;  4ZHQ F;  1S5B D;  4A3K B;  1EL0 A;  2UU9 Q;  4LAA A;  3R5H A;  2WFW A;  1ZKO A;  5KG4 A;  4QWB A;  4DV6 H;  2XCP A;  4DUZ H;  2PNR C;  3TP5 A;  1WTW A;  1STG A;  1K3R A;  2GPS A;  1I3Q A;  1M90 C;  3KBX A;  5LOV F;  3PV0 A;  5EJW A;  1CFM A;  3J7A V;  3X3N A;  3I4O A;  1BR9 A;  4LWC A;  3T16 A;  3T5K A;  4A3B G;  2XC9 A;  3ERQ A;  1C9O A;  2DN8 A;  5FD5 A;  2NZ1 D;  3A8J E;  3H0G A;  4RZQ A;  3RUP A;  2VQE H;  3OW7 A;  5KKN B;  1O75 A;  3GLK A;  2AWO A;  3K59 A;  1PFS A;  4UP8 A;  3HKZ A;  4PQX A;  4R8U A;  1MSG A;  1DGS A;  1I4R A;  3D0F A;  3A56 A;  2SNS A;  1V4Y A;  4JCV E;  2IJ0 A;  1TY0 A;  1HXY D;  3GTK A;  4C5B A;  2N49 A;  3NBH A;  3E5N A;  1TWC B;  4OEL B;  2VOB A;  4RAU C;  3RTX A;  4ECQ A;  2NVQ H;  1MGS A;  1ET6 A;  4WJ3 M;  4O42 A;  3NGD A;  4KMU C;  4XDX A;  2L11 A;  5E4W C;  2R7F A;  4NXN H;  1KJQ A;  3BAA A;  1V1P A;  1TWC H;  3FMC A;  3CCS A;  1K8O A;  3MXN B;  2KUM A;  2IW3 A;  2F0O A;  3JAM L;  1TT2 A;  2IX1 A;  1K73 C;  3HOV G;  4ZCK A;  4I4T F;  5J2U F;  2PZU A;  2WTF A;  1YHA A;  2YRW A;  3EFX D;  3J7A 5;  3IL8 A;  1I50 H;  1XNR H;  3KFU A;  2K05 A;  5EWF A;  1JOO A;  4FXG C;  1STA A;  1SE3 A;  4I7A A;  4XT1 B;  5KEE A;  4C56 C;  3M85 A;  4C2M B;  1MJC A;  2FXQ A;  2K5N A;  4ZKC B;  4BY1 G;  2L12 A;  1F9R A;  1A2U A;  3GTJ B;  2JYO A;  4PDB A;  3BDL A;  4GLA C;  2F3I A;  5BMV F;  3T5L A;  4L5S A;  5DG8 A;  2DPI A;  4X65 L;  3AB9 A;  4K0K H;  1L2F A;  2XRQ D;  3LWU A;  3KOJ A;  4CKB A;  1OXV A;  3QWN A;  4RCO A;  1SFO B;  3KJO A;  3U4Z A;  1NNX A;  1NR4 A;  3RV4 A;  3J81 j;  4DR1 Q;  1SEB D;  1I50 A;  4ZQI A;  2W6Z A;  5JVD F;  1FL0 A;  3N41 B;  2PYK A;  1W96 A;  2P0A A;  3VR5 A;  5HGT A;  3MR2 A;  5DGB A;  4IOC A;  4MV7 A;  1LV9 A;  4POF A;  4UPA A;  4DL4 A;  2JEA I;  4XYQ A;  3OSP A;  1Y69 U;  3PGZ A;  4L8J A; 
#chains in the Genus database with same CATH homology
 1XNQ Q;  1E3P A;  4R1J A;  2EQS A;  4GS3 A;  4IJL A;  2B63 H;  4BA2 I;  3CAM A;  2Z0S A;  1A63 A;  1X55 A;  3PIO A;  1B7Y B;  1E24 A;  4JI4 Q;  2HT1 A;  3IRB A;  5GQO A;  1QVF A;  3GTP H;  4DV6 Q;  4B3M Q;  1WI5 A;  5LMN L;  1I94 L;  1HZ9 A;  3I4M G;  4XTC S;  3S1Q H;  3DM3 A;  2ES2 A;  1PH4 A;  4IO9 A;  2CKZ B;  1CSP A;  4MTN A;  1XMO Q;  1KC8 C;  4X62 L;  2BH8 A;  3HKZ E;  2V1C C;  4GNX B;  3I4N H;  1K83 H;  5IP7 G;  3G48 A;  4JBM A;  5IY0 A;  3I4M H;  3GTM H;  1E1T A;  1PH5 A;  4JI0 L;  3NEL A;  2JA7 G;  5H1S E;  4BXX G;  4QJF A;  2R93 H;  5C44 H;  2A19 A;  1RL2 A;  2BA1 A;  2VW9 A;  3CCL A;  1A8V A;  1JJG A;  4KLK A;  1G51 A;  1WCM H;  1WOC A;  1U0L A;  2WAQ G;  3ERS X;  4LUZ A;  4JC0 A;  4PZ7 A;  3CF5 A;  4A3F G;  1IBL Q;  1Q46 A;  4DV2 L;  1KL9 A;  5FLX c;  1J6Q A;  1HJP A;  5JEA G;  3S14 H;  1UE1 A;  1VS0 A;  1X3G A;  3BJU A;  3AFQ A;  3BZK A;  5IE8 A;  1E7Z A;  4DV3 L;  1YHQ A;  1VQ8 A;  1SN8 A;  2E2J H;  4DR6 Q;  2UXB Q;  1HNZ Q;  1V43 A;  2VNU D;  4JBW A;  1QZH A;  1KRT A;  4YY3 L;  4JV5 L;  2UU9 L;  4LFA Q;  4NXN Q;  1Y1V G;  3M4O H;  3MEF A;  5M3F H;  5IYC H;  4DUY Q;  4R4Q A;  2MO0 A;  3D31 A;  2RCN A;  5JEA J;  3TS2 A;  4NXN L;  4DK6 C;  5C44 G;  2NVY H;  4B3T L;  1VQJ A;  2F4V Q;  4JYA Q;  1V1Q A;  1UE5 A;  3EN2 A;  2Q2H A;  4KI0 A;  1XNQ L;  3RN2 A;  2UUA L;  1HH2 P;  1YVC A;  4GN5 A;  3TS0 A;  3HOV H;  3OTO Q;  1RIP A;  1KQS A;  4HJ9 A;  1I3Q H;  2UUB L;  2AWN A;  3S1R H;  1GKH A;  2ZM6 Q;  2PI2 E;  4EQ5 A;  5C3E H;  3E0E A;  2KHJ A;  2IHF A;  4AQY Q;  4JI5 L;  2NVX H;  4B3R Q;  2R92 H;  2C35 B;  1QVG A;  1EOV A;  2Q2T A;  4A3L H;  2CFM A;  3NEN A;  4AQY L;  2KHI A;  2K50 A;  1VQH A;  4NB3 A;  1BBU A;  4P74 A;  2K52 A;  5AJ3 Q;  4DR5 L;  1C7Y A;  4A3D H;  4A3G H;  4KHP L;  1WJJ A;  5C4X H;  3CCJ A;  5FJ8 G;  1IL2 A;  2ID0 A;  4PZ8 A;  4DR4 Q;  2MQH A;  4X62 Q;  3ULP A;  3ULJ A;  4ALP A;  2Y0S E;  4NXM L;  2JK8 A;  4GNX A;  1X9N A;  4DKA C;  1KD1 C;  5IP7 H;  2QA4 A;  1WFQ A;  3GTK H;  4GKJ Q;  1VQD A;  1YHB A;  1IBM Q;  2UXD L;  4P71 A;  2A1A A;  4LF8 L;  1K8G A;  1WCM G;  2I5M X;  4K0K L;  3GTQ H;  4OXP A;  1XMQ Q;  4DV6 L;  4B3M L;  1HR0 L;  1TWF H;  1YJN A;  4IFD I;  3W1B A;  2AHO B;  2JA8 H;  1YNX A;  1N34 L;  3F2C A;  1HNW Q;  1SR3 A;  3U50 C;  3HOY G;  5C0X I;  3ICE A;  4DV5 L;  2JA8 G;  1HNZ L;  3CCE A;  2GN5 A;  1H95 A;  2UXC L;  4LFB L;  1Q7Y C;  1SFO H;  3M3Y H;  2HHH Q;  4LF5 Q;  1N32 L;  2NZH A;  2PMZ E;  2K4K A;  1QVC A;  4IPD A;  4JBJ A;  2I5H A;  5IP9 G;  1X6O A;  1LUZ A;  2AKW B;  4A75 A;  1VQB A;  2ZJP A;  1XPO A;  2YV5 A;  1E1O A;  5FLM G;  2UUC L;  1VQK A;  3G71 A;  2GVA A;  4XIG S;  4B3T Q;  2R7Z G;  1VQ5 A;  3GTJ H;  1Q8K A;  3UE1 A;  4A3F H;  4JI3 Q;  4A3D G;  1S40 A;  1PH1 A;  3CCQ A;  4JI2 L;  4BY7 G;  1KAW A;  2WB1 E;  3K0X A;  1L1O A;  4DR2 L;  2ATW A;  3J81 i;  1PYB A;  5JJI A;  2N78 A;  2E2I H;  3CC7 A;  5FLM H;  4IFD G;  4HID A;  3STB C;  1AE3 A;  1SRU A;  1CKM A;  4DR2 Q;  4BXX H;  2RF4 A;  1U5K A;  2QGQ A;  4YWL A;  4OWX B;  3F1Z A;  3T1H Q;  1I5F A;  3AEV A;  5JJL A;  1Q1E A;  3S2D H;  4POG A;  4JOI A;  2KCM A;  4KHZ A;  2D0O A;  1S3O A;  4JI6 L;  4Y52 H;  2Q2I A;  3G4S A;  1FVI A;  1IXR A;  4QIW E;  3OW2 A;  4DR7 L;  2VQE L;  2B3G A;  4A3C G;  2N8N A;  4C3I H;  2PQA B;  2JA7 H;  2NVT H;  2DUD A;  2R93 G;  1KXL A;  1YJ9 A;  3H15 A;  5IYC G;  1D7Q A;  1VQE A;  2A8V A;  4IPC A;  2D0P A;  3M4Q A;  2IHE A;  1Q86 C;  2B63 G;  2VZA A;  3LGJ A;  3EBE A;  4HJ5 A;  2UUB Q;  3PUW A;  4AYB E;  4C3H H;  1OXS C;  4EX5 A;  1VQG A;  1X56 A;  2JQO A;  4UP7 A;  1QZG A;  1HR0 W;  2OQK A;  4OWW B;  1HNX L;  3KF6 B;  3CCU A;  2UUA Q;  3TQY A;  3H0G G;  2KCT A;  1HR0 Q;  3J80 i;  2KBN A;  3PUV A;  1PH9 A;  5GAH C;  1NMG A;  3AYH B;  3ULL A;  3KDF A;  5FJ8 H;  5ELO A;  4DR1 L;  1NE3 A;  5LMN W;  4YY3 Q;  3GTL H;  2R7D A;  2ZTE A;  2OWO A;  4YCV A;  1Y1W H;  2VQE Q;  1XNR Q;  4DUY L;  4DAY B;  4A3L G;  1Q1B A;  4DPG A;  2VQF Q;  4IPG A;  1Z47 A;  4R4T A;  5C3E G;  1PHJ A;  4LF8 Q;  1YBY A;  3JC6 6;  4HIM A;  1M1K C;  1OTC A;  3FKI G;  4GKK Q;  4GKJ L;  3I4N G;  4AYB G;  1SRO A;  2HIV A;  4YCU A;  2WAQ E;  4DV4 Q;  3DLL A;  1CUK A;  4MZ9 A;  4NXM Q;  4DUZ L;  2OTL A;  2IT1 A;  1HZA A;  1Q82 C;  1MJE A;  4P75 A;  3K7A H;  1N34 Q;  1HNX Q;  1IBL L;  2Q2U A;  1WYD A;  4JI2 Q;  2CCZ A;  2YU9 H;  1MKH A;  4GN4 B;  4TQU S;  1BBW A;  3A0J A;  2ZJR A;  2EIF A;  3RNU A;  3HOW G;  1VQM A;  4K0K Q;  2D62 A;  2IX0 A;  1FJG Q;  1GO3 E;  5BR8 L;  4A3I G;  3HOU G;  4DAM A;  4OO1 I;  1NJI C;  3SGI A;  4DK3 C;  2YTY A;  3CCV A;  4DR4 L;  3KJP A;  1W2B A;  3UDF A;  2HHH L;  2JA5 H;  4A3B H;  1GVP A;  1LM0 A;  3J81 c;  4A93 H;  1PA6 A;  1LTL A;  1D8L A;  2WB1 G;  1YIT A;  1VQF A;  2JJQ A;  4L5T A;  3L0O A;  4LUO A;  3CME A;  3T1H L;  5J3B A;  3PO3 G;  5IWA Q;  3EIV A;  4DV0 L;  5ELN A;  1EUJ A;  4A3E G;  1Q81 C;  4JI4 L;  1IZ6 A;  3HFZ B;  1EIF A;  1A62 A;  1PH2 A;  3GO5 A;  4BBR G;  4JI1 L;  2UXB L;  1V9P A;  2LXJ A;  3HOZ H;  5M5X H;  4LNQ A;  2UXC Q;  4LFB Q;  3ZJY C;  2PQA A;  2ZM6 L;  4A3K G;  1VQ7 A;  2E8G A;  2JE6 I;  1NY4 A;  3PO2 H;  3CC2 A;  3PF4 A;  3RZO H;  2Z6K A;  3UDI A;  3PF5 A;  1G29 1;  3S17 H;  2KEN A;  2N3S A;  2VQF L;  1E22 A;  4A93 G;  3F2D A;  1XNR L;  4DR5 Q;  3CPW A;  3RLO A;  4AH6 A;  4JI6 Q;  3HKS A;  1ASY A;  1OXU A;  1NMF A;  3F2B A;  2VUM G;  3RR5 A;  3F8T A;  1VQP A;  2R6G A;  2JA6 G;  5M3M H;  4QL5 A;  2LSS A;  3L7Z C;  1O7I A;  1AE2 A;  3OTO L;  4LF7 Q;  1XMQ L;  4LUV A;  4APV A;  3W1G A;  1CKN B;  2UXD Q;  2Y0S G;  1Q12 A;  1VQN A;  1VQ4 A;  3JAM i;  4KHP Q;  5AJ3 L;  4DV3 Q;  5C0X G;  4A3J H;  3H3V H;  3CXC A;  5DLQ E;  3S24 A;  1NTG A;  1HNW L;  3GTO H;  4DV1 L;  4HIO A;  2UUC Q;  3CC4 A;  5IT9 c;  1YEZ A;  1TWH H;  2BA0 A;  3PUZ A;  4DR7 Q;  1MIU A;  1X65 A;  3U4V A;  4B3R L;  4JOI C;  4JI3 L;  1JT8 A;  5LMU L;  1N33 L;  4BBS G;  2NN6 I;  4DUZ Q;  1IBM L;  1XPU A;  1JJC B;  3K8A A;  3PCO B;  4JI0 Q;  1KIX A;  1PH6 A;  3KYH C;  4UP9 A;  4QY7 A;  3PUY A;  1TXY A;  4R4O A;  3CP0 A;  5E7N A;  4GOP B;  4GN3 B;  4HJ7 A;  1N9W A;  4A3M H;  1N32 Q;  5IWA L;  4DV0 Q;  1N36 Q;  5C4X G;  3H0G H;  1VQL A;  1L1O B;  1VQ6 A;  4BY1 H;  3GTG H;  4X66 L;  3E9H A;  4QGU A;  3I55 A;  1PH7 A;  3HKZ G;  3I7F A;  3PO2 G;  1GM5 A;  1HZB A;  3A5Z B;  4DV7 Q;  1PYS B;  4LFA L;  1T9H A;  2YTV A;  1C0A A;  1SMX A;  4X65 Q;  2L15 A;  2PNH A;  4A4I A;  2ZTC A;  3ER0 A;  1VQA A;  1IYJ B;  3OYY A;  3Q8D A;  4C2M H;  4A3E H;  3J7Z C;  2YYZ A;  4FDB A;  2F4V L;  1QUQ A;  4JYA L;  5IYD H;  1CKN A;  4ME3 A;  2F52 A;  3S15 H;  5IYD G;  4JI7 Q;  4OO1 G;  1P16 A;  1Y14 B;  4LFC L;  1VQC A;  4BBR H;  1QUQ B;  3U58 A;  1K9M C;  1AH9 A;  2VS1 A;  4R4C A;  3PSI A;  3UE0 A;  3W5O A;  1J5E Q;  3HOX G;  2VL6 A;  2K14 A;  3RN5 A;  3KF6 A;  3M7N A;  5C0X J;  3PUX A;  2MFI A;  2DGY A;  4P73 A;  2K5H A;  3S2H H;  5M5Y H;  2MNA A;  4GKK L;  2Z6K C;  3KDF B;  2EXD A;  1JB7 A;  4A3I H;  2VUM H;  3I2Z A;  3STB D;  4YHH L;  1CSQ A;  1KRS A;  2RHS B;  4DV1 Q;  2R92 G;  4BBS H;  4B3S L;  4A76 A;  3GD7 A;  3CW2 C;  4A3M G;  2CWP A;  5GAE C;  3M4P A;  4GNX C;  3BZC A;  4YWK A;  2NN6 G;  4B3S Q;  1S72 A;  3J80 c;  2OCE A;  1B8A A;  1VQ9 A;  2JEB I;  1M90 C;  3HOU H;  4YWM A;  1YZ6 A;  1X3E A;  4JI8 L;  4DR3 L;  3A74 A;  1XMO L;  4PG3 A;  4LF6 Q;  2WP8 J;  4GOP C;  4IFD J;  4LF5 L;  4DR6 L;  1BVS A;  4OX9 Q;  1I6H H;  3NEM A;  1FJG L;  1B70 B;  4DV5 Q;  5LMN Q;  4J15 A;  1UE6 A;  2XTI A;  1UWV A;  4HJ8 A;  1P8L A;  1L0W A;  1K8A C;  3CD6 A;  3RLF A;  4YHH Q;  1EFW A;  1VQI A;  4GLV B;  4YCW A;  3G6E A;  2AMC B;  1SLJ A;  2VY3 A;  1JJ2 A;  2RHQ B;  4HIK A;  1HZC A;  1OXT A;  3FP9 A;  2JA5 G;  3L2P A;  2E5L Q;  2HQL A;  3K81 C;  4PMW A;  4GOP A;  4DV4 L;  5GRO A;  3K80 C;  5C4J H;  4MNO A;  4OON A;  3TEH B;  4OWT B;  5M3M G;  5LMU Q;  4A3K H;  1N8R C;  2JA6 H;  4IPH A;  4C3J H;  3GDE A;  1PV4 A;  4LF9 L;  1BKB A;  1JE5 A;  2R7Z H;  2PI2 A;  3KF8 B;  3CCR A;  1K0R A;  3AQQ A;  4LF4 L;  3H3V I;  3HOY H;  1ASZ A;  1XJV A;  2IY5 B;  1EWI A;  4LF9 Q;  3UDG A;  1UEB A;  4RG1 A;  4OX9 L;  1EQR A;  3S1N H;  2OTJ A;  3TRZ A;  3T1Y Q;  2UU9 Q;  1G6P A;  2WFW A;  2CWA A;  3TRE A;  3RLN A;  1LYL A;  1K3R A;  4DNI A;  4DV7 L;  4Y7N H;  2HIX A;  4P72 A;  5IP9 H;  2B29 A;  1TWG H;  3PV0 A;  4A3J G;  1A0I A;  3HOZ G;  2NZO A;  3I56 A;  3I4O A;  4LWC A;  3FKI H;  4NPS A;  5GAD C;  2ASB A;  4JV5 Q;  4A3B G;  4QQB X;  1C9O A;  3FHW A;  3RZD H;  1SE8 A;  1UE7 A;  4BY7 H;  3S1M H;  1X54 A;  4LW1 A;  2AWO A;  1Y1V H;  1PFS A;  4JI5 Q;  4UP8 A;  4JI7 L;  4JBK A;  2ZTD A;  4LF4 Q;  1DGS A;  2H5X A;  1EIY B;  3D0F A;  1XTD A;  3T1Y L;  4JCV E;  3S16 H;  5JJK A;  3KLW A;  1N33 Q;  2N49 A;  3JAM c;  1I94 Q;  3UDX A;  2NVQ H;  4R4I A;  3HOX H;  1NBW A;  4UY8 C;  3AFP A;  5M5W H;  4X64 Q;  4WJ3 M;  1KHI A;  4L5R C;  1TWA H;  2R7F A;  3NBH B;  3CCM A;  4JG2 A;  4A3C H;  4IJH A;  2E5L L;  1TWC H;  2XGT A;  5EAY A;  3CCS A;  3MXN B;  1Y1W G;  3CPF A;  1XPR A;  3PO3 H;  1N36 L;  3K7U C;  2IX1 A;  1K73 C;  3HOV G;  5HY6 A;  3WWV A;  1YHA A;  5GAG C;  4JI8 Q;  4LF7 L;  1EQQ A;  1Z9F A;  1VCI A;  2K75 A;  4LFC Q;  3CQZ H;  3J7A 5;  4AIM A;  1I50 H;  4DV2 Q;  4H02 A;  3CMA A;  3KFU A;  2QEX A;  1EYG A;  1FGU A;  1J5E L;  2YTX A;  2I5L X;  4TVA B;  4DR3 Q;  4LF6 L;  3M85 A;  1MJC A;  2ZJQ A;  3M9B A;  2FXQ A;  2K5N A;  3E9I A;  4X64 L;  5HGQ A;  4BY1 G;  4X6A H;  1W3S A;  4O2D A;  2LXK A;  1PVO A;  4RMF A;  4WJ4 A;  4GLA C;  2F3I A;  5IYB H;  4L5S A;  4X65 L;  1CKO A;  2ALY B;  1L2F A;  2K5V A;  1PH8 A;  1IBK Q;  3KOJ A;  4A3G G;  2JA9 A;  1YI2 A;  1YIJ A;  1OXV A;  4IOA A;  1YJW A;  1IBK L;  3KJO A;  3U4Z A;  4X66 Q;  3VDY A;  5BR8 Q;  1VQO A;  1PH3 A;  2BH2 A;  3HOW H;  5K36 G;  3J81 j;  4DR1 Q;  2GVB A;  5M3F G;  4BA1 I;  1FL0 A;  4L5Q A;  2OQ0 A;  1GD7 A;  3PIP A;  3BU2 A;  4GLX A;  4JI1 Q;  2E2H H;  3B6Y A;  4HJA A;  4IOC A;  1L1O C;  2MO1 A;  4POF A;  1OXX K;  4UPA A;  1X3F A;  5IYB G;  3A5U A;  4PZ6 A;  2JEA I;  1JMC A;  4O0A A;  3PGZ A;  2I0Q A;  1R9T H;  2CQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...