5C3EG

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c3eG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c3eG01
5C0XJ 2IHEA 2OCEA 2Q2UA 4HIDA 4NXNL 2D0PA 4DUZL 2UU9Q 4A3IH 3TS2A 1G291 5K36G 1EOVA 2F3IA 1FJGQ 1A62A 2N3SA 4POGA 4R4OA 1TXYA 2R93G 2K50A 1B8AA 1X55A 2KHIA 4IJLA 1I6HH 4LFCQ 4DV6Q 5E7NA 5JJKA 5ELOA 1E22A 2WAQG 3RLOA 2NVYH 2UXDQ 4UPAA 2Q2HA 4POFA 5M5XH 5IYBH 5M3FH 4DR7L 1V9PA 4DV7Q 4DR5Q 1XNRL 2K4KA 1AE2A 4PMWA 5IYDH 2N8NA 4QL5A 1H95A 5IP9H 5JEAG 3BU2A 3CMAA 1UE5A 2HQLA 2PI2A 2B63H 3CCMA 2A19A 4DKAC 1IBKL 1SMXA 2WFWA 1VQIA 4P73A 3F1ZA 1VQ9A 3PO2H 4B3RL 2YYZA 1VQ7A 4K0KL 1Y1VH 1ASYA 2PMZE 2VS1A 4DR3L 3HOYH 4A3FG 3U4ZA 1NTGA 3UDGA 4A3GG 3MEFA 2AKWB 2VQFQ 1Q1EA 2R7FA 4LF9Q 5C0XI 4HJ8A 4A3MH 3CPWA 1X3FA 3RN2A 5LMNQ 3CD6A 1YZ6A 4JI3Q 3PF5A 1HNWQ 1UE1A 5IWAQ 1SFOH 1B7YB 1Q8KA 5JEAJ 2ZJRA 1E3PA 5LMUL 1JJGA 2DUDA 1TWGH 2PQAB 5IP7G 4WJ4A 4A3DG 5BR8L 2Q2TA 1SRUA 1Q12A 4YCUA 4JI7L 4IPHA 1FVIA 1J6QA 1HZBA 1WCMG 1CSQA 1CKOA 5C4XH 5IY0A 1PA6A 4JCVE 1XNQQ 3GTQH 1KIXA 3KJPA 1JE5A 4J15A 4QJFA 4IJHA 2AHOB 1LYLA 4GS3A 3I4NG 4LF5Q 1EWIA 2EQSA 4BBSG 4JG2A 1D8LA 2KHJA 4RG1A 2VUMG 3S24A 1LM0A 4B3MQ 1FL0A 1KRSA 1YBYA 2JA5H 4BY7H 4A3JG 3HOWH 1KRTA 4OO1G 3EBEA 4GLVB 2YV5A 2MO0A 4AYBE 3CMEA 1HNXQ 4IFDJ 1XPUA 3A5UA 3ER0A 4JI1L 3GTGH 1SR3A 1GKHA 1QZGA 2K14A 1VQ8A 4L5SA 3H3VH 2R7ZG 1I94Q 3GTKH 3CCQA 3H15A 2UXCQ 2XGTA 1IYJB 3WWVA 4MZ9A 4DR2L 1X56A 2R7DA 1N34Q 2KBNA 1XPRA 2JA8H 3DLLA 2UU9L 2E2JH 4LF6Q 2K5NA 1VQOA 2F4VQ 4L5TA 1N32Q 1FJGL 2Q2IA 2KCTA 3U58A 3AFPA 5FLMH 2Y0SE 2H5XA 4P75A 3J81c 4LF4Q 4LFCL 4TQUS 4DV6L 1PYSB 1XMOQ 5FJ8G 3K0XA 4L5RC 2UXDL 4DK3C 3NELA 1GVPA 1YI2A 4GNXA 3BZKA 1L1OB 4DV7L 2QEXA 4DR5L 1IBMQ 4GN3B 1IBLQ 4JBWA 5C44H 4A75A 3OTOQ 1QVCA 2JA7H 2FXQA 2I5MX 1LUZA 1XJVA 1VQMA 4LF7Q 3L2PA 3T1HQ 1BBWA 2D0OA 4A4IA 3A5ZB 1E24A 1X3GA 4DV1Q 1VQLA 2JA6G 1VQ6A 4LFBQ 2N78A 4YWMA 2JQOA 4YY3Q 3KF6A 1VQGA 3I4OA 1PH6A 3I4MG 4PG3A 2VQFL 4UP9A 4OWTB 4LF9L 2ES2A 1BVSA 1HZCA 3PUWA 1Y14B 1PH5A 1IL2A 2JEAI 4OONA 2R92G 3NENA 1QVFA 4EX5A 5LMNL 4B3TQ 1VS0A 3M85A 1OTCA 3ULPA 2CFMA 4JI3L 4JOIA 2ZTDA 3UDIA 4HIKA 1HNWL 1UE7A 5IWAL 2UXBQ 2A8VA 4OO1I 1CSPA 4O2DA 1PH4A 2ZJPA 5C4JH 5M3MG 1BBUA 4JC0A 3S1RH 1VQDA 1C7YA 3OYYA 3Q8DA 2K5HA 2A1AA 1Z9FA 2CKZB 3E9HA 3TQYA 1VQFA 3I56A 1XNQL 1PYBA 3TREA 3M4QA 3J81j 1SN8A 1MJCA 4AH6A 1EYGA 4A3LH 4LF5L 1K0RA 4LUOA 1IXRA 1WYDA 4WJ3M 4JOIC 4B3ML 1WFQA 4AYBG 4O0AA 3HOVH 3FKIG 1S40A 2ID0A 1L1OC 4XIGS 1HNXL 3PO3H 1WCMH 2HIVA 4YWKA 1CKMA 3A74A 2WB1E 3F2DA 3HFZB 5IYDG 2N49A 3JAMc 3J81i 4ME3A 3FHWA 1GM5A 4H02A 1J5EQ 4R1JA 4A76A 3RZOH 4A93H 4DV0Q 1I94L 1OXVA 3U4VA 4BBRH 3TEHB 3M7NA 3HKSA 4DR4Q 1N34L 2ZTEA 5M5WH 2UXCL 1UE6A 1VQKA 4JBKA 4OWWB 1CKNA 4BXXH 3K8AA 2Y0SG 4LF6L 2VUMH 5GAHC 3K7UC 1I5FA 2F4VL 1NJIC 1YVCA 2HIXA 3S1QH 1IZ6A 1N32L 2JEBI 3W1BA 4GN4B 4LF4L 4NPSA 1Y1WH 4B3SQ 1U0LA 1Q86C 3CCUA 1SLJA 4C3HH 1XMOL 4GLAC 4JV5Q 2GVAA 3W5OA 3HOXH 2K5VA 3JC66 2E5LQ 3HOUH 4A3CG 2VQEQ 2Z6KC 3G48A 1IBML 4P71A 5GAEC 2E2HH 2R7ZH 4RMFA 3CP0A 1IBLL 4IFDG 1Q46A 1C9OA 3E9IA 4JBMA 3CC7A 1E1TA 3OTOL 4A3KG 4GN5A 2OQ0A 4BY1H 3S15H 3FP9A 2YTXA 4X65Q 3HOZH 1TWFH 2MQHA 5IYCH 2UUCQ 2ZM6Q 1YHAA 3HKZE 4QY7A 3K80C 4A3IG 1JMCA 4R4IA 4LF7L 4DV4Q 3T1HL 3PCOB 1JJ2A 2MNAA 3CC2A 4DV1L 1QUQB 4LFBL 3G6EA 1AH9A 1XTDA 3H0GH 3KDFB 5HY6A 3CCLA 4YY3L 5AJ3Q 4EQ5A 1I50H 4IOAA 1YJ9A 4YWLA 5IYBG 1O7IA 3AYHB 1VQ5A 4R4QA 3SGIA 2LSSA 4R4TA 1PV4A 4R4CA 4BA1I 3RLNA 2PI2E 2YTVA 4GOPB 1S72A 4B3TL 2CCZA 5IP9G 3GDEA 1FGUA 3MXNB 1RL2A 4DUYQ 4JI8Q 1PFSA 1HR0W 2UXBL 4QQBX 5C3EH 5HGQA 1UWVA 2E8GA 2VY3A 3I2ZA 2I0QA 1D7QA 1Y1VG 1PVOA 2PQAA 3HOYG 5GADC 1LTLA 3T1YQ 2BA0A 2V1CC 4PZ7A 3VDYA 1TWHH 3J7A5 1TWCH 1N36Q 4GKJQ 4HJ5A 3CQZH 3L7ZC 3GTLH 3PUVA 4DK6C 5JJIA 4QIWE 1EUJA 3JAMi 1V43A 1OXSC 4C3JH 3D31A 4MNOA 4X6AH 1EIFA 4APVA 2B3GA 2YU9H 3PGZA 2WB1G 5M3MH 5ELNA 2IHFA 2MFIA 4MTNA 1L2FA 3ZJYC 3I7FA 3OW2A 2R6GA 3GTJH 2QGQA 3PIOA 2CWPA 3CXCA 4IPDA 1A8VA 1NE3A 4GOPA 1L0WA 1X3EA 3F2BA 2R93H 2K75A 1J5EL 3EN2A 4IFDI 5C4XG 4LF8Q 4DV0L 3U50C 5EAYA 1JJCB 4A3EG 2IX0A 1YJWA 4DR4L 3L0OA 2BH8A 3GTMH 4KHPQ 4YCVA 4JI6Q 3S17H 1HNZQ 4UY8C 1R9TH 1UEBA 4JBJA 4JYAQ 4X64Q 2JA5G 2NVXH 4BY7G 2HT1A 3HOWG 3S2DH 4B3SL 2GN5A 4DV5Q 1YIJA 4DV2Q 1KAWA 3UDXA 4JV5L 1T9HA 3PUZA 3RNUA 1OXXK 1V1QA 2RHQB 1K73C 2E5LL 3PSIA 5M5YH 4LW1A 2LXKA 2VQEL 4GOPC 1RIPA 2BA1A 4HJ7A 4AQYQ 3F8TA 3UE0A 1K8AC 1KL9A 1L1OA 3A0JA 2C35B 4A3FH 4A3GH 1YNXA 3HKZG 1K9MC 2PNHA 2HHHQ 4LUVA 4X65L 1N33Q 3CCSA 1KD1C 1U5KA 3IRBA 4LFAQ 2UUCL 4JI4Q 2ZM6L 1PH2A 2JA8G 4DV4L 5FLMG 1HJPA 1W2BA 1KC8C 3AEVA 1KXLA 5AJ3L 4YHHQ 4HIMA 2NN6G 3PF4A 4JI5Q 5IP7H 4L5QA 4JI2Q 4A3DH 2E2IH 5DLQE 4X62Q 3PIPA 4A3KH 2EIFA 1N8RC 1HR0Q 3M9BA 4XTCS 5C44G 1Q81C 2YTYA 1P16A 1KHIA 2KCMA 2JA7G 3TRZA 2Z6KA 4A3BG 2NVTH 1YHBA 4DUYL 4JI8L 4NXMQ 3S2HH 1PHJA 3CC4A 1X54A 4IOCA 4OX9Q 1VQCA 3I4NH 1G6PA 4ALPA 2Z0SA 2GVBA 4DAMA 4DV3Q 1XMQQ 3S16H 4BBSH 3UDFA 1VQ4A 3T1YL 4A3JH 1MIUA 1N36L 2KENA 1XPOA 4Y7NH 4GKJL 2RHSB 5IT9c 3J80c 1WJJA 3GTPH 1PH3A 3K81C 1E7ZA 2OQKA 1SE8A 5GROA 1M1KC 2AWNA 4DR6Q 4Y52H 1JT8A 2ASBA 3M4PA 2UUBQ 1PH1A 3PV0A 1E1OA 3CPFA 2AWOA 4X66Q 3KLWA 3K7AH 2K52A 4UP8A 2QA4A 1Q7YC 2UUAQ 4FDBA 3B6YA 1PH7A 1VQNA 3I55A 1MKHA 1X65A 2EXDA 4IO9A 1B70B 3RN5A 3GD7A 4AIMA 4LF8L 3J7ZC 5J3BA 3H3VI 1VCIA 1NBWA 5FJ8H 2B29A 2JJQA 4KHPL 1S3OA 1I3QH 2RF4A 4A3LG 3W1GA 2MO1A 1YHQA 4JI6L 4GKKQ 1SROA 5M3FG 5GQOA 4PZ8A 5GAGC 1HNZL 1C0AA 3PUYA 4P72A 1AE3A 4DR1Q 4JI0Q 1NY4A 1VQHA 4QGUA 4JYAL 4X64L 3HOVG 2CWAA 2DGYA 2IX1A 3ULLA 1K83H 2ALYB 4UP7A 4DV5L 4DV2L 1KQSA 4NXNQ 4DUZQ 3AQQA 3PO3G 2B63G 2NN6I 3UE1A 1HH2P 1EFWA 3STBD 2OTLA 2IY5B 2JA6H 4AQYL 1NMFA 4A3EH 1WI5A 5FLXc 3KYHC 1JB7A 1EIYB 3PO2G 4A93G 4P74A 4GNXB 3S1NH 1K3RA 2NZHA 3AFQA 3ULJA 4BBRG 1PH9A 2HHHL 3I4MH 4C2MH 4C3IH 3KFUA 3ERSX 1Z47A 4DR7Q 1Q1BA 1N33L 1X6OA 2ZTCA 1GD7A 4LFAL 4JI4L 4BXXG 2WAQE 4PZ6A 4DAYB 5H1SE 3BJUA 4HIOA 4LNQA 3GO5A 1XNRQ 3CF5A 2R92H 2VW9A 5JJLA 2IT1A 2JA9A 4A3MG 2XTIA 4HJ9A 1VQPA 3CW2C 1YJNA 4OWXB 4BA2I 1Y1WG 2ATWA 4YHHL 1QUQA 1TWAH 3ICEA 3G4SA 3KDFA 3HOXG 1IBKQ 3HOUG 3D0FA 3TS0A 3STBC 4JI5L 3KF6B 4JI2L 1HZ9A 2WP8J 4X62L 3NEMA 3DM3A 2ZJQA 4B3RQ 4K0KQ 1HR0L 4KI0A 4DR3Q 1OXTA 3KOJA 3LGJA 5IE8A 2VNUD 1A63A 4BY1G 3RLFA 3HOZG 3S14H 2VL6A 4DPGA 5IYCG 3J80i 1OXUA 2CQOA 4NXML 4OX9L 2AMCB 3E0EA 1ASZA 4NB3A 3H0GG 4OXPA 3CCVA 1XMQL 1QVGA 4DV3L 2VZAA 1VQJA 3RZDH 1W3SA 3BZCA 3PUXA 3FKIH 5LMUQ 2I5HA 5LMNW 3KJOA 1A0IA 4YCWA 5BR8Q 1N9WA 3F2CA 4JI7Q 4LUZA 3S1MH 4DR6L 3CCEA 3G71A 4A3BH 2D62A 2UUBL 2NZOA 1NMGA 2L15A 3CCRA 1X9NA 1P8LA 2JE6I 5C0XG 4X66L 5C3EG 2F52A 3KF8B 1G51A 2UUAL 4TVAB 3M4OH 4HJAA 1K8GA 1PH8A 4LWCA 1VQEA 1WOCA 1HZAA 2JK8A 4GNXC 1YITA 4DNIA 1QZHA 1Q82C 2OWOA 2LXJA 4IPGA 1VQAA 1M90C 3GTOH 2OTJA 3CAMA 1EQQA 1EQRA 3NBHB 2NVQH 4A3CH 1DGSA 4KLKA 4JI1Q 1GO3E 3RR5A 4GKKL 4GLXA 2I5LX 4IPCA 1BKBA 1MJEA 4KHZA 4DR1L 4JI0L 2BH2A 3M3YH 1CKNB 1VQBA 2RCNA 3EIVA 1CUKA 3CCJA 4DR2Q 1YEZA
chains in the Genus database with same CATH superfamily
1E2WA 2OCEA 4HIDA 3TS2A 5K36G 2EY5A 4A3IH 2TSSA 4N8FA 1FJGQ 4TV9F 4YR2A 2JXMB 4R4OA 4X64H 3IKJA 3GV7B 1KJJA 2EZVA 3EPGA 3MWMA 2VA3A 1MHWC 4UPAA 4POFA 4F4YA 1ZXTA 1A6XA 4EEQA 4DV7Q 2X6LA 3OHBA 1DJRD 5KFXA 1XNRL 2ZJTA 2A6HD 2N8NA 1A9XA 3PW4A 1H95A 4FXGC 3SE0A 1RK6A 1JIHA 3CMAA 2B63H 4AYBA 5KG1A 3G8CA 4MTDA 5DLFA 1IBKL 4J9LA 1EY0A 1SMXA 1SNOA 3F1ZA 2PQEA 5LHY1 1STNA 1WTRA 3CVZA 2MJ8A 4Q43A 5DQHA 4I50F 2AKWB 4L8JA 2R7FA 4MAMA 3LX0A 3V6HA 4JI2H 3U9OA 5EZYF 1MD2D 1SE2A 2L9HA 2BE5C 2NU6B 3R5FA 1Y8PB 2SCUB 4C1NI 3CD6A 4J9RA 3Q22A 4G7ZC 4KV6A 4WFN3 4WBNF 1FJGH 1UE1A 3K5HA 1B7YB 3HG9A 4LMYA 1JJGA 2DUDA 1TWGH 5IP7G 2F0DA 4OX9H 1CHQD 5A2QE 1SRUA 3RZOB 3TIIA 2BCOA 2WV6D 1FVIA 2L5TA 1FYCA 1WCMG 4K2KA 4DV7H 5FLXL 1XNQQ 1PA6A 3GTQH 4XZ3B 4Q8EA 4QJFA 2N55A 1IW7C 1R4PB 2EYJA 4IJHA 2NU8B 1LYLA 3PZPA 2KCCA 5T1IA 2V4DA 2K28A 4K5XA 4IUNA 4RG1A 2VUMG 2L55A 3S24A 2F03A 3HOXB 3RB0A 4ECTA 3Q24A 2ENBA 3WOFA 3HOWH 1RKNA 5DQGA 4AYBE 3WOEA 4C3HG 2EYFA 4JI1L 3GTGH 1IKLA 3HOZB 1QZGA 3H3VH 3E0JA 2R7ZG 1ZHQA 4PMBA 3GTKH 5EKIA 2XGTA 1IYJB 3H0GB 1A15A 2K5NA 1VQOA 2F4VQ 5EJWA 4JV0A 4EFEA 1WD0A 5FLMH 1EZ1A 1BDOA 1Y1VA 2FJ2A 1MSHA 4LF4Q 1RJRA 2GLTA 4TQUS 4ETSA 2NN6H 3RB6A 1EY4A 4L5RC 2UXDL 1GVPA 1MI2A 3A56A 4GNXA 3SXHA 4F4WA 4PDBA 2PMZB 4HR7A 1GYFA 5KFHA 4MV3A 4FU0A 3E6ZX 4LAAA 5CBAE 3VA7A 1SFOA 5KFLA 1GOZA 3A7AB 3T1HQ 3HGBA 1VQLA 4CGYB 1X3GA 2JA6G 3R5XA 5LP6F 3VR5A 2YYAA 5DGBA 1VQGA 3I4OA 1DV1A 1CQVA 4JV2A 3KBXA 3SE7A 4UP9A 4OWTB 4LF9L 2K7VA 3I90A 1BVSA 2CW8A 4C3JB 2MCTA 1Y14B 2QF7A 1IL2A 2JEAI 2RDFA 3NENA 5FLXE 2K32A 3AMUA 4IHJF 3R2TA 5LMNL 3S9WA 3NXWA 5JAVA 2CFMA 3UDIA 4HIKA 4RAUC 2F4VH 2YW2A 2JA5A 3GTJB 1DZ1A 2OT2A 3E3XA 2R7MA 1Q3LA 4OO1I 1EOTA 1CSPA 4LF4H 1F2ZA 2ZJPA 4YQWA 4O3QA 4FM9A 1T5EA 1VQDA 3OYYA 4CHTB 2FPIB 5JOBA 2K5HA 5LMUH 2CKZB 1PMRA 5KNDA 3M4QA 1DIKA 3D4DA 1MJCA 4RB2C 3AU7A 2NVXB 2DY7A 1K0RA 4LUOA 1VBGA 1DD2A 4HNTA 1WYDA 1ESRA 4DN4M 4WJ3M 3OIQA 5CORA 4IQZA 4AYBG 1HQRD 5M5YB 4L1KA 5BN3A 2QCPX 1L1OC 1CQIB 2KQ3A 4XT1B 3F2DA 3WO0A 5KFPA 1WTPA 3N52A 1GM5A 3QFFA 4A76A 3RZOH 5KFJA 2HCCA 3U4VA 4J9QA 3OHXC 3TEHB 3H4BA 5D8DA 5KT3A 1UE6A 1VQKA 1JOOA 1RD9D 4G3IA 1NJIC 1IZ6A 3KBGA 2OF1A 3NQIA 2WAQA 2HD3A 4NLGA 4NPSA 4B3SQ 1ZEQX 3EFXD 1Q86C 1SLJA 1XMOL 1RK5A 3HOXH 4ED7A 1HA5A 3SDZA 1IBML 1SYFA 1C9OA 4LFCH 1E1TA 2J4XA 3IN5A 1S0MA 2RKSA 4FXKC 3OSPA 2YTXA 3HOZH 3OSNA 3KXYT 3HKZE 4LF7L 3F2UA 1JMCA 4E4TA 4R4IA 2NTSA 3BS1A 5EWEA 4DV1L 4KJOA 1SSOA 2A5HA 3H0GH 5IGBA 1KC7A 5DM63 5HY6A 4IRDA 3CCLA 5AJ3Q 3J7AK 4EQ5A 2B2WC 4BWGB 3FPPA 3AYHB 2EDGA 2J7ZA 2L1BA 4BA1I 3BA9A 1B6RA 2KEDA 3DHQA 1B4OA 2J0TD 3J7YW 4C56C 3MXNB 2C2RA 1V1PA 5C0XH 1D1IA 1T3NA 1PFSA 1EQTA 4XQNA 5G3LF 5HGQA 1UWVA 3L9AX 2VY3A 4QB4A 1O80A 3WO1A 2R84A 4ME5A 5BMVF 1D7QA 1Y1VG 1PVOA 2PQAA 3HOYG 5KT5A 4CC6A 2OEOA 2VXWA 3T1YQ 4FF4A 2W6QA 1I3QB 4UCUA 4GKJQ 5EDWA 3L7ZC 3D4WA 3PUVA 5KFBA 3D4RA 1EUJA 5FD6A 3GQCA 2B2VC 2XN9C 1OXSC 4C3JH 1K83B 3D31A 3LNNA 4X6AH 1RJQA 1Y1WA 1XTCD 2JA6B 4UCRA 4LF5H 4A3EB 5K36H 3V4ZA 3GTJH 2QGQA 3L3OC 3NQTA 4IPDA 1L0WA 1X3EA 5ELEA 1B2TA 5KFVA 1LTSD 2NTTA 1J5EL 4IFDI 4DV0L 3U50C 1KAAA 1YJWA 1TWFA 3L0OA 1PFMA 1PZID 4KHPQ 1FD7D 1VMPA 4LH7A 2ZT9C 2AUJD 1PRTB 5TSSA 2JA5G 1UUPA 2NVXH 4WRDA 2R82A 1I50A 2YRXA 1CK1A 1B6SA 3KTMA 4RKLA 1KAWA 3PUZA 2AGPA 5M5YH 3U9SA 2VQEL 4GOPC 1RIPA 2SNSA 1J9OA 1I4QA 3VYTA 3S14B 3C1EA 4RB0A 5L1IA 1KL9A 2RQXA 3A0JA 1U9RA 1YNXA 3HKZG 1K9MC 2R86A 4X65L 2F3WA 1U5KA 3PIP3 3ETJA 4AYBB 2PN1A 1HJPA 1A2TA 4JK1C 1DOLA 2NB0A 5IT9W 3J80W 3CKIB 1SJED 4YHHQ 1EWHA 4QWEA 5J22A 3Q6SA 1TWCA 3H94A 3CQZA 1U4LA 3FEWX 5IP7H 5KFNA 4L5QA 4U7CA 5KGUA 4PMCA 4YY3H 5K2MA 1GLVA 4KHPH 4A3BG 2YU9A 2P5ZX 3CC4A 4DK1A 3BYTB 1LACA 4CJ1B 1G6PA 1XMQQ 2GVBA 4DV3Q 3KHLA 4FF3A 2CHBD 1ZETA 2R93A 1VQ4A 3W2DA 1YNJC 2Z4IA 1XPOA 1E4FT 3E5NA 4I7HA 5DQIA 1SE8A 2A68D 5GROA 2VOBA 2AWNA 4HNVA 2QDLA 2ASBA 2DJGC 2UUBQ 3MR2A 1PXUA 1SYCA 3Q8SB 1E1OA 3CPFA 3K0YA 3NBIA 3KLWA 2FP4B 2HUGA 3FPUB 1ZYRC 4YHHH 1SYDA 5COYA 1I6HB 1GSHA 3H20A 2RDIA 1SYGA 4F4XA 3I55A 1LTGD 1MKHA 1X65A 5EKLA 5KFMA 4TQSA 1EYCA 5M3FB 2DNEA 4I7AA 4IUPA 4AIMA 2FINB 1VCIA 4X3UA 1NUCA 1CT1D 1I4GA 1UC8A 3TINA 4RNNA 3RB4A 1I3QH 1STBA 3PW5A 2XCPA 4JI6L 2VA2A 1HTLD 3MXUA 1C0AA 5GAGC 1WTHA 5EPJA 1VQHA 2RDJA 2X69A 2F0QA 2L12A 2IX1A 2WYOA 1I4RA 2EOTA 1K83H 3PO2B 2ASLA 1XMQH 3OUZA 4UP7A 2YL2A 4DV2L 1TAEA 1Y1VB 2B63G 1ML0D 3N40P 2Z4HA 3HOYB 1HH2P 2WKDA 2JA6H 3TQ1A 3VR3A 4A3EH 1EIYB 5FLXc 3IFTA 3KYHC 3IL8A 5JJKA 4GNXB 1XX8A 2HHHL 3ERSX 1Q1BA 1N33L 1X6OA 4HR7B 5C5LA 4JI4L 3RUZA 4KN4C 2F0KA 2XSCA 4PZ6A 1XNRQ 2A73B 4QW9A 1YJNA 1SFOB 4HJ9A 1VQPA 1BCPD 4HQ6A 1Y1WG 1EYDA 4XXEA 5FK9C 2CW0C 2W6PA 1IBKQ 3HOUG 1MZBA 1ZKOA 4LSAA 4YAKB 2M00A 5LL6X 5IGFA 4IRKA 4KI0A 3KOJA 1CM9A 3LGJA 4M8AA 5ELFA 2VNUD 3SK8A 2FK2A 5LXTF 5LYJF 1LT6D 4MA0A 3DMUA 3S14H 2K01A 5EOYA 3N8DA 5IYCG 2CQAA 1M0WA 4K5WA 4NXML 1F2YA 2R3ZA 5KG4A 2JA5B 1ASZA 3E0EA 1D2BA 4OXPA 3OMGA 4O3PA 4MV7A 2VZAA 1VQJA 4DUYH 3BZCA 3PUXA 3UI2A 5KT7A 4F4ZA 2I5HA 4YCWA 4J9KA 4EVOA 1GSOA 1H9KA 2DLNA 4E6IA 2D62A 3ND9A 5KG2A 4KY6A 3WNZA 5KFOA 4FS2A 4IURA 4X66L 5D3IB 5DM73 5ELBA 4CKCA 4XDXA 3QJYA 2FMMA 4OHJA 3C46A 1YITA 3Q8QB 2FB9A 1SEIA 4IZ8A 2OTJA 3HZXA 4C2MA 3VPDA 1EQQA 4EFBA 1YNNC 4I4TF 4HN7A 1DGSA 4JI1Q 2KSWA 1KBLA 2R92A 3RR5A 1MJEA 2BH2A 3OWFA 4DR1L 4JI0L 4LF8H 1QCBD 1VQBA 1M6VA 1EZ8A 1TWAA 5C0XJ 3EYYA 4R9WA 2Q2UA 2EY6A 4NXNL 3T53B 2WAQB 3BG3A 2F0EA 4JYAH 1TXYA 2R93G 3BABA 2B2UC 4IJLA 1X55A 1I6HH 1VBHA 4DV5H 1GSAA 2K04A 3RLOA 4J9SA 2UXDQ 4DR7L 1I4PA 5M3FH 1KJ8A 1EY6A 5IT9L 3J80L 5KKNB 2MHVA 1BGWA 1JLLB 3BQ1A 1BR9A 1S68A 4PMWA 3GIKA 1QWYA 2BE5D 1HFNA 5KFAA 3UQ8A 4ECWA 2EYOA 4ILWA 5JEAG 1H9RA 2HQLA 2PI2A 5C6AA 4KY7A 2A19A 4FBTA 4M1UB 5ELCA 3TDQA 4IZOA 4DXFA 3H3VC 4CBVA 1VQIA 3PO2H 5KIXA 3MHBA 4ZUJA 2L0CA 1VQ7A 1Y1VH 4ZYSA 4GC6A 2PMZE 4DR3L 3HOYH 1AN8A 2XRQD 5DNFA 3MFHA 1MSGA 4LF9Q 2XC9A 3EROA 4JI5H 5L1KA 5D14A 1O7YA 2BQ3A 5LMNQ 2XCAA 1V1PB 3TP5A 2A68C 2RDHA 2UVRA 2ICEC 2PO4A 4QIWA 1EUDB 2W9AA 4MV4A 1EFID 3MFGA 2EJGC 1SFOH 1SNDA 1SYBA 4EG0A 2FLLA 2PQAB 4WJ4A 5BR8L 4QW8A 4N8X1 4DAVA 1Q12A 4LMQD 4YCUA 2UXDH 4IPHA 3FDTA 4EQNA 1J6QA 1HUMA 1LTRD 2DPIA 1CSQA 1QOHA 4KTAA 3G6VA 4JCVE 1KIXA 1JE5A 4NP5A 2W7OA 1LT3D 2AHOB 3J7AF 4GS3A 4YJ2F 3I4NG 1EWIA 2EQSA 4ULLA 4BBSG 1Y1WB 1B33N 2KHJA 1C48A 1JC7A 2B8FA 4DAPA 1FL0A 4HNUA 3RB3A 1IL8A 3HOUB 2JA5H 4A3JG 1KRTA 1ET9A 2UUAH 2Z1CA 3CMEA 2W9CA 1TA8A 1M4VA 3I3CA 5L37A 1XPUA 1S5DD 3DWAA 3A5UA 2LMCB 1DONA 1VQ8A 1GXDC 1TWFB 2K14A 1O78A 5I6WA 5KFGA 3CCQA 5IT9E 5LMNH 4DR2L 4Q44A 1JCKB 4HEDA 3L4KA 2HGSA 3EJIA 1DYQA 2UU9L 4RCNA 2YZNA 4DLKA 1I50B 2Q2IA 5E3FA 2H5XA 5E4XA 2W9BA 1BCPC 4DV6L 2XGQA 1XMOQ 4FF1A 5FJ8G 1SDFA 3VMMA 1X3PA 4ODGA 4RAYA 1RYRA 3BZKA 5CV5A 1IBMQ 5ELDA 5KG7A 4GN3B 1PK8A 4JBWA 3VR6A 1V8QA 1G2SA 2YZMA 4QMGA 5DGAA 1EIGA 1JWUD 3OOCA 5F9NA 2FLNA 2JSOA 3OSOA 1XJVA 1VQMA 4LF7Q 3L2PA 1SMYD 2D0OA 4A4IA 4FF2A 4DV1Q 1TWCB 4YWMA 2JQOA 1ICFB 3KF6A 3CQZB 2EE1A 2F0OA 3VR4A 5CA1F 5KFWA 2V9WA 2I80A 2F0PA 2X6GA 4OONA 2R92G 2M05A 1BBXC 1QVFA 1G2TA 2YU9B 1MBYA 1HA6A 1OTCA 4RB3C 4JI3L 4KHVA 1WVLA 4O2DA 2R93B 1EYZA 1RODA 4YBZB 4H13C 5C8YF 1GUSA 1BBUA 1M0TA 1XMOH 4F7XA 1GUWA 4XYQA 1H9JA 3BJYA 1CA6A 1C7YA 4XT3B 1C3OA 3I72A 1IBMH 3LWBA 1EQVA 2A1AA 1Z9FA 5C1OA 5HV6A 3MWDA 4DA2A 1AN7A 2O5IC 5C3WA 3BZDB 3QIAA 3V96A 4DK0A 3RGXA 1LO5D 1O7LA 1QNKA 4JOIC 4LF7H 1EHIA 3KUPA 4B3ML 3VYRA 2M9VA 1PDQA 5CR3A 2WE6A 2QEJC 2B39A 2KVMA 2JEFA 4XIGS 1HNXL 1E4GT 3Q8RB 3RAXA 2HIVA 2ALZA 3MFYA 2N49A 4G4KA 3J81i 3NBHA 3MZ5A 5JVH3 1J5EQ 1MGSA 4DV0Q 1I94L 2UXCL 5C4ZA 1N34L 2VPSA 3GV5B 2DN8A 4OWWB 5CV8A 3K7UC 4G7OC 2K5WA 1N32L 2WTFA 2JEBI 2CZGA 3W1BA 1Y1WH 2F1MA 1U0LA 4XYMB 3G6YA 4DL6A 4A3KB 4GLAC 2GVAA 1EEFD 1TR5A 3HOUH 4QWAA 4A3CG 2VQEQ 3T56B 3EVQA 2Z6KC 3RV4A 1JB3A 5BN5A 4RMFA 1Q46A 2F0UA 3CC7A 2W57A 2CH4W 1PTOB 4GN5A 3RD4A 5FOBB 4X65Q 1TWFH 1VF5C 3I4NB 5IYCH 2I8CA 4BBSB 1KLGD 4WD3A 3K80C 2V4QA 2MP1A 1PYWD 1EZ6A 2MNAA 3G6EA 1AH9A 4A3JB 5JJZA 2CVRA 5T1GA 1I50H 3K58A 4IOAA 3DF7A 1YJ9A 1LTBD 2UVWA 1LV9A 2XD4A 1B1ZA 2LSSA 4R4TA 1AZQA 1S72A 1WSCA 2CCZA 2NZ1D 2C00A 4EEYA 2R8KA 4ED8A 3PW7A 1NAPA 3OMCA 4DNTB 3IFDA 3PMFA 5L1LA 3TZUA 2EPBA 3FVQA 2YS6A 2NUCA 1ICWA 2AQ3B 2VQEH 2BA0A 2V1CC 2E2DC 1RTNA 3VDYA 1TWCH 1UAPA 3HP3A 1RDPD 3CQZH 1BXTA 1C4QA 3RJ0A 1BNZA 2VPQA 3JAMi 4X65H 1T5XD 1XNQH 2K5QA 1EIFA 2PYKA 1S4ZA 2L4NA 1JDBB 2YU9H 5CV6A 3FMAA 3ZJYC 4Q45A 1K1QA 1E2VA 2E2HA 3H91A 1NE3A 3VA5A 1U4MA 4C2MB 4GOPA 2R93H 4ZQIA 2K75A 5C4XG 4JW0A 5EAYA 4KY5A 4A3EG 2R92B 2B2TA 4DR4L 3LMLA 3TMEA 3OWEB 5DEHA 3GIJA 4JI6Q 4TSSA 5FKAC 3HBLA 1I4XA 2WDTA 1TWAB 1A3TA 4DL5A 4ZKBB 5BN4A 4BY7G 2HT1A 5JEAH 5J39A 2I46A 5IGEA 1YIJA 4DV2Q 3NWSA 1T9HA 5I6YA 1XYIA 2RGVA 1OXXK 2PZWA 2E5LL 2FJZA 2K6AA 3C1FA 2LXKA 4LW1A 3KALA 1SMYC 1K8AC 5LA6F 3F8TA 3OW7A 2C35B 1FGBD 2HHHQ 4IR1A 3H40A 2ASJA 1N33Q 4RZRA 3CCSA 2JA8G 3IRBA 4JI4Q 1PH2A 4DV4L 1CZWA 3AEVA 1JOKA 2JN4A 4O2BF 2R61A 2IP4A 1TWHA 1Y69U 2V4RA 2AGQA 3DWPA 1YNJD 1GUNA 3TP7A 4IFDH 3T1HH 3GTLA 4R8NA 5DLQE 1RF2D 2EIFA 4A3KH 5KFYA 3M9BA 5C44G 2F0SA 4DU9A 2YTYA 1P16A 1B3AA 3SK5A 5JVDF 1V4YA 1TIID 3TRZA 1YHBA 1PZKD 4JI8L 1PTOH 4NXMQ 1NNXA 1X54A 1VQCA 3I4NH 1SE3A 1ZYRD 1R4QB 4DAMA 4BBSH 4DV2H 5IIFA 5LOVF 3G6JB 3GIQA 1VDZA 4A3JH 3KK7A 2KENA 3OHAA 4RKBA 1FNWA 5IT9c 3J80c 1CA5A 3M3YB 2JEGA 3NTIA 1WJJA 3SK6A 2HHHH 1PRTC 1M1KC 2C22A 1JT8A 3M4PA 4JI4H 1TS4A 2ZDHA 5D1OA 2H1EA 4X66Q 1ESFA 1PFBA 2K52A 1Q7YC 3M9MB 1PH7A 1VQNA 2EJMA 4ZHQF 1L2ZA 5M5XB 4IO9A 1HQMC 1B70B 3GD7A 3H3VI 4MN3A 5J3BA 1NBWA 5FJ8H 2JJQA 2EJFC 1S3OA 1AUXA 4A3LG 3W1GA 3N41B 2PBZA 2QILA 1JE4A 5M3FG 1GUOA 2KCNA 3BVZA 1F77A 1HNZL 2BQUA 4DR1Q 4P72A 2K5DA 4JI0Q 4QGUA 4P2CB 4X64L 1NR2A 1S5CD 2CWAA 2DGYA 5BPFA 3I91A 3ULLA 5IGDA 5HURA 4BWSC 1KQSA 4L63B 4NXNQ 3PO3G 1JWMD 2NN6I 2CW0D 3BYYB 3UE1A 2W9BB 1EFWA 2PPBC 4LK1C 4DL7A 4AQYL 5M9OA 3PO2G 1DM0B 4B3SH 4J9MA 1HUNA 1KEEA 4XQQA 4BBRG 1GJXA 5HBRB 1JR0D 4O42A 4C2MH 5FPOA 4DR7Q 4H0LC 5EPLA 4LFAL 2F0MA 3NHHA 2WAQE 2W7PA 2R92H 3O13A 3K5IA 5JJLA 4X66H 2VW9A 3WDNA 4KKTA 4ZOLF 3RUPA 1TWAH 2D5DA 3GQBA 2EYLA 3R8BA 3ZYYX 2FE3A 2B2YA 3KF6B 4JI2L 2F0WA 3DXJC 1LT5D 4N9TA 5C4XB 2C28A 1BCPF 1BQQT 4DR3Q 5CV9A 3N6RA 5KNCA 1A2UA 1SAPA 4BY1G 2DJFC 1N56A 2K03A 4DPGA 2MGSA 4JI0H 1BNCA 3VYUA 4OX9L 2AMCB 4BY7B 3NGDA 2YZGA 3I12A 4ECZA 3CCVA 4NXNH 4EGQA 1UC9A 1A0IA 5BR8Q 4KKUA 1JOQA 1PX2A 1N9WA 4KN7C 4M7EA 5AFWA 4LUZA 2QK4A 1YNND 4TKOB 3T1YH 1NMGA 2JA8B 3RF2A 3PVXA 1BUVT 2E2JB 4GKJH 5C3EG 2F52A 1EYAA 1G51A 1SNCA 4HJAA 2R8HA 1PH8A 2O03A 4LWCA 3GTQA 1WOCA 5F2DA 4GNXC 4O3NA 3Q8PB 2XVSA 2B2UA 4IPGA 2VB2X 4QCLA 4DR3H 3V05A 1KNEA 3NBHB 5C44B 3R2IA 4A3CH 3A8IE 2R7KA 4GLXA 2J6TA 3M3YH 4KHZA 2HCIA 3NPPA 2RCNA 3EQLC 3EIVA 1CUKA 1CQFA 5JH7F 3CCJA 4DR2Q 4XYOA 2VR1A 1CHPD 2DWCA 3GTGA 1A3UA 2UU9Q 2D0PA 2IX3A 4DUZL 1G291 4QUFA 2F3IA 1A62A 4ZLTF 3EA6A 4K8IA 5BR8H 2KHIA 5EBCA 4DL2A 4FS1A 4DV6Q 5E7NA 5ELOA 2WAQG 1SNQA 1IKMA 2F0HA 2Q2HA 5M5XH 4YR0A 3ND8A 3BDOA 2K4KA 3LWEA 4MTKA 4QL5A 4DF7A 4DNRB 1UE5A 5C4JB 3BVMA 3FKIA 2O4XA 5D3DA 4RB1A 3S1RB 4KKSA 4YB8B 3MR5A 2UVUA 4Q0FA 3RFCA 2WFWA 4P73A 1QE6A 4K0KL 3JRWA 1ASYA 2IBKA 2VS1A 1EY8A 2G9HD 4A3FG 3U4ZA 1NTGA 3UDGA 3GIIA 2Z9HA 3MEFA 2R7NA 5C0XI 1DXMA 4ABNA 3RN2A 4DR2H 2RA4A 3CRKC 1YZ6A 4CDFC 5HGTA 4Q5VA 4IUUA 3H09A 4JI3Q 2V59A 3BG5A 3PO3B 1TS2A 3GTOA 1V1OA 1Q8KA 3T4AC 5JEAJ 2ZJRA 5LMUL 1N48A 1ENFA 4CJ2C 4DV6H 2Q2TA 4DV3H 4JI7L 1C30A 4ZCKA 3T5JA 4BBRB 3A54A 3HRZC 5KG3A 1W6JA 1SJHD 5CGKA 5JPMC 5M5WB 1AP0A 1PZJD 5C4XH 1CKOA 4PQXA 5IY0A 4EQOA 3KJPA 4J15A 1DOKA 3S1QB 4QWDA 2O5JC 1SYEA 1WTQA 3J81W 4R8IA 2W6OA 2UUBH 4JG2A 1OWTA 4B3MQ 2P0AA 4QF4A 1KRSA 4F8MA 4BY7H 4OO1G 2R7LA 3W3AA 3EBEA 2E2HB 4GLVB 4Y8VB 2NVYA 2YV5A 4RFBA 1HNXQ 4IFDJ 1G6ZA 2VB3X 1SYXB 4BY1B 1HFGA 3S15B 1KDBA 1RYSA 1STHA 1I94Q 4X3KA 4RH6A 3ORRA 2UXCQ 3WWVA 1N34Q 1X56A 2R7DA 1ONLA 2SNMA 2JA8H 3DLLA 4JI3H 2E2JH 3Q1KA 4L5TA 4I55F 1N32Q 4X3SA 1PTOD 2SOBA 3U58A 3AFPA 2DPJA 3NE5B 2I87A 4ECSA 4LFCL 5JPNC 3K0XA 4TV8F 1TU2B 1YI2A 4CC5A 2QEXA 4DR5L 1KJQA 3K3PA 1S10A 4QUCA 3D8GA 5C44H 4A75A 3VPBA 1HTPA 1QVCA 5E4WC 2F0VA 4DAYA 5C3EB 2FXQA 2I5MX 1LUZA 3T5LA 3C2PA 3A8KE 2WB1A 1STYA 4HCSA 1XNRH 4O1NA 1E24A 1TWHB 2D9UA 2N78A 4K8JA 4PV1C 1DV2A 5A2QW 1JKJB 3GTLB 5IODA 1IBKH 3L4JA 4PG3A 2VQFL 2ES2A 5IYZF 2F0GA 3X3NA 1PH5A 1I94H 1TKWB 4TQRA 1N34H 3GIMA 4EX5A 3K5OA 5M3MB 3ULPA 4JOIA 1HNWL 1UE7A 4ZQ3A 5IWAL 3RTXA 2A8VA 3JAMW 3K59A 2KECA 1PH4A 2KOLA 1EY7A 1ENCA 5C4JH 3KLSA 2PZUA 3S1RH 1E4EA 3GV6A 4C5CA 1K3BC 3KHRA 3TQYA 3I56A 1VQFA 5H80A 4ECQA 2F4IA 1PYBA 3J81j 4R8UA 1SN8A 1GHJA 1EYGA 4A3LH 5D1OB 2W8LA 4LF5L 2Q8TA 3S2DB 1IXRA 3KF8A 3OUUA 3TIGA 3FKIG 3M9OB 2HVRA 2UVVA 3RIZA 3DUZA 4G57A 2Z6BA 3PO3H 5GONF 4NDXA 3V2TA 1CKMA 3A74A 2BDNA 2WB1E 4RA8A 4A3FB 5LL6b 2IA6A 5KFFA 3QZ7A 1WTOA 4R1JA 3TP6A 1E2ZA 3GV3A 2I07B 1OXVA 4BBRH 5KFSA 3GILA 2NBFA 3D6CA 4DR4Q 2JA7A 2ZTEA 5M5WH 1PRTF 3SVMA 1CKNA 2HJWA 3K8AA 4JI1H 4LF6L 5GAHC 2NYZD 4O4IF 1YVCA 3S1QH 4IWXA 2VQDA 5KFZA 2RSOA 2KJXA 1AW7A 4GN4B 3D6WA 3CCUA 3MR3A 4YP3A 3RMHA 2ZXOA 3JC66 2E5LQ 3R5HA 2LY7A 5FD5A 3G48A 2E2HH 5GAEC 4LSXA 1IBLL 4A3IB 4IFDG 1PLFA 4JBMA 1QILA 2WIIB 2XNAC 3OTOL 4A3KG 3S2HB 2EYHA 2OQ0A 5KNBA 4BY1H 2A69C 1BJTA 3S15H 1STGA 2MQHA 2LKVA 1V51A 4OGQC 4DV4Q 1JJ2A 3CC2A 4RU9A 1HRJA 4LFBL 2X0SA 4MA5A 4Y7NB 4YY3L 1UEAB 5EKKA 1S5ED 1IYUA 4IN3A 4HYKA 4YWLA 1S5FD 2LS01 1O7IA 5IYBG 1WTWA 4DL4A 5FO7B 3V6KA 2MUYA 4IRCA 2NWGA 1WR2A 4DR4H 4R4CA 3RLNA 2PI2E 2ZXPA 4FP5D 4B3TL 4Q8FA 3DEPA 5IP9G 3GDEA 3PW0A 1FGUA 4LF9H 4O4LF 3FDSA 4JI8Q 1HR0W 1ILQA 2UXBL 5C3EH 4TRDA 1SE4A 4MV6A 3J80E 1WCMA 3I2ZA 2I0QA 4UAIA 1WTXA 1A3VA 2SDFA 4MV9A 1LTTD 2E5LH 1LTLA 3J81L 4CDEC 3RV3A 3M4IA 3KLRA 1TWHH 3QOJA 3J7A5 2K1BA 3MTSA 4HJ5A 4RWSC 3GTLH 5JJIA 4DK6C 1KNAA 4QIWE 2VUMA 1JORA 5CV4A 3JZIA 3P75A 3HXLA 2G5DA 3NP8A 1RHPA 3PQIA 4ZI7F 2B3GA 5CBEE 3PGZA 2WB1G 1KTKA 3BVGA 5M3MH 2IHFA 2MFIA 1L2FA 1VKZA 1CFMA 3I7FA 2R6GA 3S1NB 2HQEA 2R7ZA 1KJIA 1PTOC 4NMZA 5C5MA 3F2BA 5KG6A 1CI3M 3HEJA 2FPPB 4QWCA 2Z8LA 3N6XA 4MTEA 1TQOA 2BH8A 4JPBW 4TUYF 3MEHA 3HB9A 3K5NA 1HNZQ 4A2BA 4A2AA 4JI8H 1UEBA 4J6HA 3TN2A 4GC7A 4X64Q 5I2XA 4ECRA 3R3OA 3KHGA 3S2DH 2OLSA 3TSSA 2GN5A 5CMDA 1WD1A 1I3QA 2W70A 3UDXA 4JV5L 3N43B 3BQ2A 3PF4A 1V1QA 2C5CA 3PSIA 2R87A 4AQYQ 3MC0B 1B3QA 4OELB 1G91A 4EGJA 1L1OA 5NUCA 4A3FH 3DEOA 4LUVA 1KD1C 4LFAQ 5A2QL 2UUCL 2K33A 5DG8A 4B9WA 2ZM6L 3IAYA 4OIKA 4ECXA 2YRWA 2AQ4A 3FKIB 1KC8C 1NR4A 1TT2A 3CRLC 4HIMA 4ZAIA 4DV1H 4JI2Q 2JYOA 2ATLA 1ZHSA 3J81E 1U4PA 4OEMB 3JAML 1PRTD 2B8GA 2IL8A 1EU4A 1GHKA 2JA7G 1HNZH 4RCOA 3J7AV 4DUYL 2XWBB 5CYUA 3S2HH 4IOCA 4OX9Q 3GTOB 4EBEA 5KRUA 1ULZA 3P1HA 5FO8B 2BR0A 4OO1H 1MIUA 1N36L 4AQYH 4Y7NH 2OXPA 4O3RA 3GTMA 2B2WA 1PH3A 4GZYC 1PFNA 1E7ZA 2OQKA 5A35A 1R9TA 4RGMA 4LFAH 4KD3A 1PH1A 3ERQA 3PR5B 1B53A 2XIWA 2QA4A 1I6VC 2JP1A 1CS0A 3KAJA 1LABA 2WACA 1BCPB 5CC4A 2NVYB 2Q8IB 5CV7A 2FMAA 4LF8L 3J7ZC 2XCLA 3BAAA 1II3A 1Z2OX 4M9UA 5JVG3 2W6ZA 1F9RA 3I8ZA 2RF4A 2MO1A 1YHQA 3C3LA 2ZXRA 1J5EH 1G8ZD 2EYPA 4KJNA 4DV0H 4JYAL 3HOVG 2ALYB 2B2VA 4DV5L 4DUZQ 4LJZC 1M8AA 5D65A 2E2IA 2QDBA 2OTLA 3V4SA 1SNMA 3P20A 2IWHA 1WI5A 1JB7A 4A93G 4HMIA 4CDCC 3S1NH 2NZHA 4CJ0B 3ULJA 4A3MB 1PH9A 1TVXA 2R8JA 1O7ZA 4BXXG 2ZTCA 1GD7A 4U673 3JAME 4YAJB 5CA0F 4DAYB 5H1SE 1UNNC 3CF5A 2XTIA 2BOSA 2WB1B 4JVZA 5KFTA 2ATWA 2RBMA 5C4HA 1QUQA 1ET6A 5L9XA 3G4SA 3KDFA 1T36A 4FO2A 1CTMA 3TS0A 5DG9A 3STBC 4JI5L 3GTPA 1HZ9A 4X62L 4IWYA 3NEMA 3DM3A 4K0KQ 2FPGB 5FO9B 1HR0L 1EUCB 3MFIA 1AUVA 5KT4A 1OXTA 3R93A 5KYLA 1ILPA 5IE8A 1XWEA 5DAUA 4FBUA 1T94A 4G7HC 2VL6A 3OPOA 4PNYA 2CQOA 3MXPA 4V190 2C9OA 1CQJB 4RUAA 2O2LD 4DXGA 4DUZH 3H6MA 5J2UF 2V58A 1W3SA 4IUQA 2HVSA 3FKIH 5LMUQ 2AUKA 5JUMA 1E4EB 4LH6A 4EBCA 2ZDGA 3KLSX 4JI7Q 4NKLA 1S0OA 3RGZA 2KEEA 4IR9A 1S03G 1LLRD 4DR6L 3G71A 2IW3A 2L15A 4R8UB 4RAZA 2JEIA 4BS9A 3K6OA 2LFNA 4JV1A 1FNUA 2J6SA 5KT6A 3KF8B 2UUAL 2XGPA 2E74C 2XRSD 1M7JA 1K8GA 4J8QA 4ECYA 1HZAA 2JK8A 1QZHA 3GV8B 4DNIA 1Z6HA 4WJWA 1M90C 1VQAA 3GTOH 2AGOA 4K0KH 2IJ0A 3K57A 1VMCA 1EQRA 1F2MA 4FNFA 2PNRC 2FK1A 1Y8NB 4KLKA 1RTOA 4GKKL 2JA7B 2I5LX 4IPCA 5DLGA 5IOCA 1CKNB 1HPCA 4RZQA 1YEZA 2IHEA 4JI6H 2DNCA 3BDLA 1EOVA 4NW2A 4F88A 5EGTA 2N3SA 2FKLA 4POGA 1L0XB 2W6NA 3HKZA 2K50A 4QIWB 1B8AA 4LFCQ 4JI7H 1E22A 5E1FA 2NVYH 1JICA 5C3XA 5IYBH 1I4HA 3GLKA 1V9PA 5C1PA 4ECUA 4DR5Q 2VUGA 4FXDA 1AE2A 4RHRA 5KG0A 5FPRA 1EIHA 4PWQA 4RNOA 5IP9H 5KG5A 3BU2A 3QWNA 1N33H 1H9MA 3ONAB 3CCMA 4DKAC 4OL7A 2RDGA 3M7GA 2ZDQA 1FNVA 3PR4A 4B3RL 1VQ9A 2YYZA 4K6DA 4V0BA 4A3GG 2YS7A 4QWBA 3I70A 1QJOA 2VQFQ 1Q1EA 5K5PA 4DL3A 1QB5D 2W9CB 4HJ8A 2KA7A 1IYVA 2FFKB 4A3MH 3A8JE 2A6HC 2N88A 1D5ZC 1X3FA 3CPWA 2Y0SA 3KHHA 3HOVB 3Q2OA 5EPKA 2NUAB 1IOVA 4WORA 1EWCA 3PF5A 4K14A 1HNWQ 4KK7A 1WCMB 5IWAQ 1O75A 4NXMH 1E3PA 1Q8IA 1TY2A 3MAQA 2AQ1B 4UCVA 4A3DG 1K0SA 3N44B 4A93B 4YR3A 3QR8A 2IMWP 1HZBA 3X3MA 4O3OA 3G6XA 4DR5H 4FYDA 4ED3A 2YCHA 2VUMB 4RGOS 3NK9A 5JVLA 3I4LA 5I9OA 2WINB 4LF5Q 3G7LA 1D8LA 2CW7A 5JQWA 4C3HB 1I7LA 1LM0A 2RCFA 2FK3A 2RVLA 1Z2NX 2W71A 1YBYA 4J9OA 4HSVA 2CH4A 1X32A 2R7ZB 4EBDA 1B9MA 2MO0A 3TP8A 2ICIA 3TBIB 3ER0A 2VQFH 1L0YB 1SR3A 1GKHA 1K28A 4L5SA 3PW2A 3MVVA 3H15A 2B63A 4HCEA 1SNPA 4DFAA 4MZ9A 3URYA 2KBNA 1XPRA 2QW7A 4LF6Q 1HNWH 1KDAA 5IWAH 5C5JA 1AFPA 4DR1H 1FJGL 2KCTA 4HSPA 4EQPA 2Y0SE 4P75A 3J81c 3PIO3 1GUGA 1PYSB 1IOWA 1LTAD 1QG7A 3ITPA 4DK3C 3NELA 2C2DA 1HXYD 4DV7L 1L1OB 4DGZA 1PTOF 2EY1A 1IBLQ 5KFRA 4FVMA 4C5AA 1FR3A 3JSNA 2J9GA 3OTOQ 2FHTA 3K5MA 1FKAH 4DR7H 2JA7H 3EPIA 2JEJA 3SI8A 1TWGA 2GA4B 1BBWA 1VQ6A 3A5ZB 2ASDA 4LFBQ 4X3TA 5KFIA 4YY3Q 1S9FA 3SHLA 4JUZA 1PH6A 3I4MG 4C3IG 1SEBD 5I47A 1H9SA 1NCVA 1HZCA 3PUWA 4KMUC 2R6FA 4B3TQ 1VS0A 1X3QA 4HMJA 3M85A 4LF6H 2ZTDA 1W96A 4EYIB 4IALA 2UXBQ 3QG1A 1AZPA 3P7JA 5BPHA 1UNSA 5M3MG 2B2TC 3LWUA 4JC0A 5CB4F 3V6JA 4U6PA 3RBDA 2PZTA 3Q8DA 4KD4A 1B9NA 3GTMB 3E9HA 1XNQL 3GTKA 1U4RA 1IBLH 3JRXA 3S17B 3TREA 4J9PA 1R9TB 3OTOH 3E5SA 3GIPA 5KFKA 4AH6A 2FLPA 2HVQA 4CKEA 2BQRA 1WFQA 4O0AA 3HOVH 1S40A 4LFBH 5KYIA 4ZKCB 1EEID 3T51B 4MV8A 3HS0C 4C1NK 2ID0A 4OIJA 1WCMH 1HCZA 2Q8RE 4YWKA 3Q23A 4A3GB 1XDNA 2PVPA 1J8IA 3HFZB 5IYDG 3JAMc 4ME3A 3FHWA 3VR2A 4H02A 3SR1A 3A55A 4A93H 4RNMA 4YIJA 2IPKD 1WH2A 4EYHB 3M7NA 1K8MA 3HKSA 4B3TH 2A69D 5IGGA 4RGNA 4JBKA 3TZDA 4BXXH 2Y0SG 2VUMH 4K2LA 1KDCA 1Y8OB 1I5FA 2F4VL 2V5AA 2HIXA 2UXBH 1HHVA 2D2CC 4LF4L 4A3DB 2E2IB 3SK4A 2EVBA 4C3HH 4JV5Q 2UU9H 3W5OA 2K5VA 1RJPA 4P71A 2R7ZH 3CP0A 4ED6A 2NVTB 3E9IA 3DM1A 1TS3A 3FP9A 2UUCQ 3S16B 5LL6S 2ZM6Q 1JQYD 1YHAA 4QY7A 4A3IG 2R85A 4APMA 2J6UA 3IG0A 3T1HL 3PCOB 1GUTA 4I65A 3K3VA 1QUQB 5KFCA 2F3VA 5EWGA 1XTDA 3KDFB 1BXRA 4ED2A 5EBDA 2QKIC 2QYZA 3Q0AA 3TQTA 3MJFA 3GTPB 4ZRZA 4S3SA 2K05A 3D3RA 5G3LD 4R4QA 1VQ5A 1Z2PX 3SGIA 4UCSA 1PV4A 4GOPB 2YTVA 1D1KA 1W93A 3K7AB 5IGCA 1B04A 1JX4A 1RL2A 3LP8A 4DUYQ 1AEXA 4QQBX 4K5VA 3GIDA 4RUCA 2HDLA 2E8GA 1XXGA 4ME6A 4JV5H 5L1JA 3FRPB 5GADC 3FMCA 2HDMA 4ECVA 4PZ7A 1N36Q 1CE8A 2SEBD 4J9NA 4UHVA 4R7RA 5KT2A 1V43A 4J1MA 4Z9CB 1JWSD 1B50A 3T5KA 2UUCH 4MNOA 1LTID 2ZM6H 5J1ZA 3K5LA 4APVA 3VYSA 2A6ED 1TY0A 4K6LA 3NTKA 2F0TA 5ELNA 4MTNA 3OW2A 3PIOA 3T13A 2CWPA 3CXCA 4B3MH 1A8VA 4F87A 3I4MB 4C3IB 4XX0B 3R23A 2E76C 3EN2A 2F0FA 4LF8Q 2NU9B 1K8OA 1JJCB 2IX0A 1WTVA 5I2YA 1HNXH 1TS5A 4IUVA 3GTMH 4YCVA 1I7NA 2WKCA 4ED0A 3S17H 2BDOA 3H4DA 4UY8C 2PCFB 1R9TH 4JBJA 3H0GA 4JYAQ 2B2YC 2UXCH 2DZDA 2RSNA 3HOWG 4UFZA 4B3SL 4DV5Q 3RBEA 3T16A 3HKZB 1JXLA 3RNUA 1K73C 2RHQB 1N32H 1EU3A 2PW7A 3MA2B 1N36H 2BA1A 4UCTA 4HJ7A 3UE0A 2EY2A 2XIGA 3BQ0A 4A3GH 4XYLB 4B9XA 3KAKA 5KFUA 2PNHA 1IHZA 4J0MA 2PMZA 1Q90A 1DOMA 3RZDB 1STAA 5FLMG 4MHEA 1W2BA 3MR6A 1KXLA 5AJ3L 4Q0YA 2W8KA 1EL0A 2TMPA 1KABA 2KHSA 2NN6G 2AQ2B 5CAEB 3S1MB 1CZGA 4JI5Q 4A3BB 4CKBA 4A3DH 2GPSA 1RJTA 2E2IH 4X62Q 3PIPA 1N8RC 1HR0Q 2G9DA 4XTCS 1Q81C 4O2AF 2OH2A 2F0LA 3ORQA 1KHIA 1SXTA 2KCMA 4H7BA 2R8IA 2Z6KA 2Y0SB 5KEEA 2NVTH 3M4OB 1D5MC 1D6EC 1QNUA 4HTHA 1PHJA 2CQYA 2GPWA 3QO2A 5DG7A 3GTJA 3M9NB 1S5BD 2Z0SA 4ALPA 3S16H 1LT4D 3UDFA 2EYMA 3T1YL 2NVQB 3NTHA 1SBBB 4GKJL 2RHSB 1I6UA 3GTPH 3K81C 1OO9B 2DY8A 4N9PA 1BO0A 5I9PA 2AU0A 2RGRA 4DR6Q 4Y52H 1B44D 5T14A 4UCOA 3PV0A 4ID6A 1S97A 2NVXA 2AWOA 2FMCA 5I4DA 3K7AH 4UP8A 4ZUIA 2UUAQ 4H44C 4FDBA 3B6YA 5FLXW 5D1PA 1STEA 1C8CA 4RHSA 1F9SA 2EXZA 3NWTA 2EXDA 3F8NA 3BA8A 3RN5A 4X62H 2KUMA 2E75C 1IW7D 1D5XC 3MWYW 3ETHA 1HR0H 2B29A 1VF7A 4KHPL 4IAJA 1VAJA 3MXGA 1SROA 3DWQA 5GQOA 4PZ8A 2B63B 4GKKQ 1SCUB 3PUYA 1AE3A 1EY9A 1NY4A 2M2LA 2DIKA 3C0FB 4O4HF 5EQ0A 3MWEA 1BF4A 5ISRA 3AQQA 2MPMA 1ZQ7A 3N42B 4ED1A 5KX5F 3VPCA 3STBD 2IY5B 1ENAA 3PN1A 2L11A 4YJ3F 1NMFA 1W6KA 1EY5A 4P74A 3A7LA 1K3RA 3AFQA 4F50A 3KFUA 3I4MH 4DR6H 4C3IH 1Z47A 1F9QA 2H4OA 2C2EA 4LNQA 4HIOA 3BJUA 3GO5A 2IT1A 2JA9A 4A3MG 3RAQA 3CW2C 3NSWA 4OWXB 1TWGB 4BA2I 4YHHL 4I7ZC 3ICEA 5KFDA 3HOXG 4MIUA 3D0FA 3JSLA 3GP7A 4DV4H 3I73A 2WP8J 4B3RQ 3GTQB 2ZJQA 1RCVD 4IUTA 4ZK9B 1H9SB 1A63A 1BOSA 3T5HA 2PW5A 4EGVA 1DCZA 3RLFA 3HOZG 4GKKH 5J2TF 4U68A 3J80i 4B08A 1OXUA 2R8GA 4O3SA 4L6TB 3AB9A 3MXNA 2XWJB 1Z7TA 3QZ8A 4NB3A 3H0GG 1QVGA 3HOWB 1XMQL 4DV3L 2A74C 3RZDH 5EWFA 3SEBA 2A6EC 3M4YA 3U9TA 4MV1A 5LMNW 3KJOA 3GTGB 5KFQA 3F2CA 4CDDC 1E0BA 4XQJA 3OIPA 3GTKB 3S1MH 2NU7B 1F9PA 1KLUD 3NUCA 4HAEA 3CCEA 4A3BH 5IYDH 2UUBL 2NZOA 1X9NA 1F2LA 3CCRA 1P8LA 2JE6I 4UDUC 5C0XG 4RGTA 1K83A 1NSNS 4TVAB 5KFEA 3M4OH 2JA6A 5F9LA 1VQEA 3QB3A 1Q82C 2OWOA 4C5BA 4B3RH 2LXJA 1S0NA 3CU7A 3QOLA 3CAMA 1JDEA 1K1SA 2NVQH 3UFXB 3CHBD 2F0JA 1GO3E 4C3JG 2W6MA 2F0NA 1BKBA 1KJ9A 1GGOA 2F0IA 3BDCA
chains in the Genus database with same CATH topology
5C0XJ 2IHEA 2OCEA 2Q2UA 4HIDA 4NXNL 2D0PA 4DUZL 2UU9Q 4A3IH 3TS2A 1G291 5K36G 1EOVA 2F3IA 1FJGQ 1A62A 2N3SA 4POGA 4R4OA 1TXYA 2R93G 2K50A 1B8AA 1X55A 2KHIA 4IJLA 1I6HH 4LFCQ 4DV6Q 5E7NA 5JJKA 5ELOA 1E22A 2WAQG 3RLOA 2NVYH 2UXDQ 4UPAA 2Q2HA 4POFA 5M5XH 5IYBH 5M3FH 4DR7L 1V9PA 4DV7Q 4DR5Q 1XNRL 2K4KA 1AE2A 4PMWA 5IYDH 2N8NA 4QL5A 1H95A 5IP9H 5JEAG 3BU2A 3CMAA 1UE5A 2HQLA 2PI2A 2B63H 3CCMA 2A19A 4DKAC 1IBKL 1SMXA 2WFWA 1VQIA 4P73A 3F1ZA 1VQ9A 3PO2H 4B3RL 2YYZA 1VQ7A 4K0KL 1Y1VH 1ASYA 2PMZE 2VS1A 4DR3L 3HOYH 4A3FG 3U4ZA 1NTGA 3UDGA 4A3GG 3MEFA 2AKWB 2VQFQ 1Q1EA 2R7FA 4LF9Q 5C0XI 4HJ8A 4A3MH 3CPWA 1X3FA 3RN2A 5LMNQ 3CD6A 1YZ6A 4JI3Q 3PF5A 1HNWQ 1UE1A 5IWAQ 1SFOH 1B7YB 1Q8KA 5JEAJ 2ZJRA 1E3PA 5LMUL 1JJGA 2DUDA 1TWGH 2PQAB 5IP7G 4WJ4A 4A3DG 5BR8L 2Q2TA 1SRUA 1Q12A 4YCUA 4JI7L 4IPHA 1FVIA 1J6QA 1HZBA 1WCMG 1CSQA 1CKOA 5C4XH 5IY0A 1PA6A 4JCVE 1XNQQ 3GTQH 1KIXA 3KJPA 1JE5A 4J15A 4QJFA 4IJHA 2AHOB 1LYLA 4GS3A 3I4NG 4LF5Q 1EWIA 2EQSA 4BBSG 4JG2A 1D8LA 2KHJA 4RG1A 2VUMG 3S24A 1LM0A 4B3MQ 1FL0A 1KRSA 1YBYA 2JA5H 4BY7H 4A3JG 3HOWH 1KRTA 4OO1G 3EBEA 4GLVB 2YV5A 2MO0A 4AYBE 3CMEA 1HNXQ 4IFDJ 1XPUA 3A5UA 3ER0A 4JI1L 3GTGH 1SR3A 1GKHA 1QZGA 2K14A 1VQ8A 4L5SA 3H3VH 2R7ZG 1I94Q 3GTKH 3CCQA 3H15A 2UXCQ 2XGTA 1IYJB 3WWVA 4MZ9A 4DR2L 1X56A 2R7DA 1N34Q 2KBNA 1XPRA 2JA8H 3DLLA 2UU9L 2E2JH 4LF6Q 2K5NA 1VQOA 2F4VQ 4L5TA 1N32Q 1FJGL 2Q2IA 2KCTA 3U58A 3AFPA 5FLMH 2Y0SE 2H5XA 4P75A 3J81c 4LF4Q 4LFCL 4TQUS 4DV6L 1PYSB 1XMOQ 5FJ8G 3K0XA 4L5RC 2UXDL 4DK3C 3NELA 1GVPA 1YI2A 4GNXA 3BZKA 1L1OB 4DV7L 2QEXA 4DR5L 1IBMQ 4GN3B 1IBLQ 4JBWA 5C44H 4A75A 3OTOQ 1QVCA 2JA7H 2FXQA 2I5MX 1LUZA 1XJVA 1VQMA 4LF7Q 3L2PA 3T1HQ 1BBWA 2D0OA 4A4IA 3A5ZB 1E24A 1X3GA 4DV1Q 1VQLA 2JA6G 1VQ6A 4LFBQ 2N78A 4YWMA 2JQOA 4YY3Q 3KF6A 1VQGA 3I4OA 1PH6A 3I4MG 4PG3A 2VQFL 4UP9A 4OWTB 4LF9L 2ES2A 1BVSA 1HZCA 3PUWA 1Y14B 1PH5A 1IL2A 2JEAI 4OONA 2R92G 3NENA 1QVFA 4EX5A 5LMNL 4B3TQ 1VS0A 3M85A 1OTCA 3ULPA 2CFMA 4JI3L 4JOIA 2ZTDA 3UDIA 4HIKA 1HNWL 1UE7A 5IWAL 2UXBQ 2A8VA 4OO1I 1CSPA 4O2DA 1PH4A 2ZJPA 5C4JH 5M3MG 1BBUA 4JC0A 3S1RH 1VQDA 1C7YA 3OYYA 3Q8DA 2K5HA 2A1AA 1Z9FA 2CKZB 3E9HA 3TQYA 1VQFA 3I56A 1XNQL 1PYBA 3TREA 3M4QA 3J81j 1SN8A 1MJCA 4AH6A 1EYGA 4A3LH 4LF5L 1K0RA 4LUOA 1IXRA 1WYDA 4WJ3M 4JOIC 4B3ML 1WFQA 4AYBG 4O0AA 3HOVH 3FKIG 1S40A 2ID0A 1L1OC 4XIGS 1HNXL 3PO3H 1WCMH 2HIVA 4YWKA 1CKMA 3A74A 2WB1E 3F2DA 3HFZB 5IYDG 2N49A 3JAMc 3J81i 4ME3A 3FHWA 1GM5A 4H02A 1J5EQ 4R1JA 4A76A 3RZOH 4A93H 4DV0Q 1I94L 1OXVA 3U4VA 4BBRH 3TEHB 3M7NA 3HKSA 4DR4Q 1N34L 2ZTEA 5M5WH 2UXCL 1UE6A 1VQKA 4JBKA 4OWWB 1CKNA 4BXXH 3K8AA 2Y0SG 4LF6L 2VUMH 5GAHC 3K7UC 1I5FA 2F4VL 1NJIC 1YVCA 2HIXA 3S1QH 1IZ6A 1N32L 2JEBI 3W1BA 4GN4B 4LF4L 4NPSA 1Y1WH 4B3SQ 1U0LA 1Q86C 3CCUA 1SLJA 4C3HH 1XMOL 4GLAC 4JV5Q 2GVAA 3W5OA 3HOXH 2K5VA 3JC66 2E5LQ 3HOUH 4A3CG 2VQEQ 2Z6KC 3G48A 1IBML 4P71A 5GAEC 2E2HH 2R7ZH 4RMFA 3CP0A 1IBLL 4IFDG 1Q46A 1C9OA 3E9IA 4JBMA 3CC7A 1E1TA 3OTOL 4A3KG 4GN5A 2OQ0A 4BY1H 3S15H 3FP9A 2YTXA 4X65Q 3HOZH 1TWFH 2MQHA 5IYCH 2UUCQ 2ZM6Q 1YHAA 3HKZE 4QY7A 3K80C 4A3IG 1JMCA 4R4IA 4LF7L 4DV4Q 3T1HL 3PCOB 1JJ2A 2MNAA 3CC2A 4DV1L 1QUQB 4LFBL 3G6EA 1AH9A 1XTDA 3H0GH 3KDFB 5HY6A 3CCLA 4YY3L 5AJ3Q 4EQ5A 1I50H 4IOAA 1YJ9A 4YWLA 5IYBG 1O7IA 3AYHB 1VQ5A 4R4QA 3SGIA 2LSSA 4R4TA 1PV4A 4R4CA 4BA1I 3RLNA 2PI2E 2YTVA 4GOPB 1S72A 4B3TL 2CCZA 5IP9G 3GDEA 1FGUA 3MXNB 1RL2A 4DUYQ 4JI8Q 1PFSA 1HR0W 2UXBL 4QQBX 5C3EH 5HGQA 1UWVA 2E8GA 2VY3A 3I2ZA 2I0QA 1D7QA 1Y1VG 1PVOA 2PQAA 3HOYG 5GADC 1LTLA 3T1YQ 2BA0A 2V1CC 4PZ7A 3VDYA 1TWHH 3J7A5 1TWCH 1N36Q 4GKJQ 4HJ5A 3CQZH 3L7ZC 3GTLH 3PUVA 4DK6C 5JJIA 4QIWE 1EUJA 3JAMi 1V43A 1OXSC 4C3JH 3D31A 4MNOA 4X6AH 1EIFA 4APVA 2B3GA 2YU9H 3PGZA 2WB1G 5M3MH 5ELNA 2IHFA 2MFIA 4MTNA 1L2FA 3ZJYC 3I7FA 3OW2A 2R6GA 3GTJH 2QGQA 3PIOA 2CWPA 3CXCA 4IPDA 1A8VA 1NE3A 4GOPA 1L0WA 1X3EA 3F2BA 2R93H 2K75A 1J5EL 3EN2A 4IFDI 5C4XG 4LF8Q 4DV0L 3U50C 5EAYA 1JJCB 4A3EG 2IX0A 1YJWA 4DR4L 3L0OA 2BH8A 3GTMH 4KHPQ 4YCVA 4JI6Q 3S17H 1HNZQ 4UY8C 1R9TH 1UEBA 4JBJA 4JYAQ 4X64Q 2JA5G 2NVXH 4BY7G 2HT1A 3HOWG 3S2DH 4B3SL 2GN5A 4DV5Q 1YIJA 4DV2Q 1KAWA 3UDXA 4JV5L 1T9HA 3PUZA 3RNUA 1OXXK 1V1QA 2RHQB 1K73C 2E5LL 3PSIA 5M5YH 4LW1A 2LXKA 2VQEL 4GOPC 1RIPA 2BA1A 4HJ7A 4AQYQ 3F8TA 3UE0A 1K8AC 1KL9A 1L1OA 3A0JA 2C35B 4A3FH 4A3GH 1YNXA 3HKZG 1K9MC 2PNHA 2HHHQ 4LUVA 4X65L 1N33Q 3CCSA 1KD1C 1U5KA 3IRBA 4LFAQ 2UUCL 4JI4Q 2ZM6L 1PH2A 2JA8G 4DV4L 5FLMG 1HJPA 1W2BA 1KC8C 3AEVA 1KXLA 5AJ3L 4YHHQ 4HIMA 2NN6G 3PF4A 4JI5Q 5IP7H 4L5QA 4JI2Q 4A3DH 2E2IH 5DLQE 4X62Q 3PIPA 4A3KH 2EIFA 1N8RC 1HR0Q 3M9BA 4XTCS 5C44G 1Q81C 2YTYA 1P16A 1KHIA 2KCMA 2JA7G 3TRZA 2Z6KA 4A3BG 2NVTH 1YHBA 4DUYL 4JI8L 4NXMQ 3S2HH 1PHJA 3CC4A 1X54A 4IOCA 4OX9Q 1VQCA 3I4NH 1G6PA 4ALPA 2Z0SA 2GVBA 4DAMA 4DV3Q 1XMQQ 3S16H 4BBSH 3UDFA 1VQ4A 3T1YL 4A3JH 1MIUA 1N36L 2KENA 1XPOA 4Y7NH 4GKJL 2RHSB 5IT9c 3J80c 1WJJA 3GTPH 1PH3A 3K81C 1E7ZA 2OQKA 1SE8A 5GROA 1M1KC 2AWNA 4DR6Q 4Y52H 1JT8A 2ASBA 3M4PA 2UUBQ 1PH1A 3PV0A 1E1OA 3CPFA 2AWOA 4X66Q 3KLWA 3K7AH 2K52A 4UP8A 2QA4A 1Q7YC 2UUAQ 4FDBA 3B6YA 1PH7A 1VQNA 3I55A 1MKHA 1X65A 2EXDA 4IO9A 1B70B 3RN5A 3GD7A 4AIMA 4LF8L 3J7ZC 5J3BA 3H3VI 1VCIA 1NBWA 5FJ8H 2B29A 2JJQA 4KHPL 1S3OA 1I3QH 2RF4A 4A3LG 3W1GA 2MO1A 1YHQA 4JI6L 4GKKQ 1SROA 5M3FG 5GQOA 4PZ8A 5GAGC 1HNZL 1C0AA 3PUYA 4P72A 1AE3A 4DR1Q 4JI0Q 1NY4A 1VQHA 4QGUA 4JYAL 4X64L 3HOVG 2CWAA 2DGYA 2IX1A 3ULLA 1K83H 2ALYB 4UP7A 4DV5L 4DV2L 1KQSA 4NXNQ 4DUZQ 3AQQA 3PO3G 2B63G 2NN6I 3UE1A 1HH2P 1EFWA 3STBD 2OTLA 2IY5B 2JA6H 4AQYL 1NMFA 4A3EH 1WI5A 5FLXc 3KYHC 1JB7A 1EIYB 3PO2G 4A93G 4P74A 4GNXB 3S1NH 1K3RA 2NZHA 3AFQA 3ULJA 4BBRG 1PH9A 2HHHL 3I4MH 4C2MH 4C3IH 3KFUA 3ERSX 1Z47A 4DR7Q 1Q1BA 1N33L 1X6OA 2ZTCA 1GD7A 4LFAL 4JI4L 4BXXG 2WAQE 4PZ6A 4DAYB 5H1SE 3BJUA 4HIOA 4LNQA 3GO5A 1XNRQ 3CF5A 2R92H 2VW9A 5JJLA 2IT1A 2JA9A 4A3MG 2XTIA 4HJ9A 1VQPA 3CW2C 1YJNA 4OWXB 4BA2I 1Y1WG 2ATWA 4YHHL 1QUQA 1TWAH 3ICEA 3G4SA 3KDFA 3HOXG 1IBKQ 3HOUG 3D0FA 3TS0A 3STBC 4JI5L 3KF6B 4JI2L 1HZ9A 2WP8J 4X62L 3NEMA 3DM3A 2ZJQA 4B3RQ 4K0KQ 1HR0L 4KI0A 4DR3Q 1OXTA 3KOJA 3LGJA 5IE8A 2VNUD 1A63A 4BY1G 3RLFA 3HOZG 3S14H 2VL6A 4DPGA 5IYCG 3J80i 1OXUA 2CQOA 4NXML 4OX9L 2AMCB 3E0EA 1ASZA 4NB3A 3H0GG 4OXPA 3CCVA 1XMQL 1QVGA 4DV3L 2VZAA 1VQJA 3RZDH 1W3SA 3BZCA 3PUXA 3FKIH 5LMUQ 2I5HA 5LMNW 3KJOA 1A0IA 4YCWA 5BR8Q 1N9WA 3F2CA 4JI7Q 4LUZA 3S1MH 4DR6L 3CCEA 3G71A 4A3BH 2D62A 2UUBL 2NZOA 1NMGA 2L15A 3CCRA 1X9NA 1P8LA 2JE6I 5C0XG 4X66L 5C3EG 2F52A 3KF8B 1G51A 2UUAL 4TVAB 3M4OH 4HJAA 1K8GA 1PH8A 4LWCA 1VQEA 1WOCA 1HZAA 2JK8A 4GNXC 1YITA 4DNIA 1QZHA 1Q82C 2OWOA 2LXJA 4IPGA 1VQAA 1M90C 3GTOH 2OTJA 3CAMA 1EQQA 1EQRA 3NBHB 2NVQH 4A3CH 1DGSA 4KLKA 4JI1Q 1GO3E 3RR5A 4GKKL 4GLXA 2I5LX 4IPCA 1BKBA 1MJEA 4KHZA 4DR1L 4JI0L 2BH2A 3M3YH 1CKNB 1VQBA 2RCNA 3EIVA 1CUKA 3CCJA 4DR2Q 1YEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X J;  2IHE A;  2OCE A;  2Q2U A;  4HID A;  4NXN L;  2D0P A;  4DUZ L;  2UU9 Q;  4A3I H;  3TS2 A;  1G29 1;  5K36 G;  1EOV A;  2F3I A;  1FJG Q;  1A62 A;  2N3S A;  4POG A;  4R4O A;  1TXY A;  2R93 G;  2K50 A;  1B8A A;  1X55 A;  2KHI A;  4IJL A;  1I6H H;  4LFC Q;  4DV6 Q;  5E7N A;  5JJK A;  5ELO A;  1E22 A;  2WAQ G;  3RLO A;  2NVY H;  2UXD Q;  4UPA A;  2Q2H A;  4POF A;  5M5X H;  5IYB H;  5M3F H;  4DR7 L;  1V9P A;  4DV7 Q;  4DR5 Q;  1XNR L;  2K4K A;  1AE2 A;  4PMW A;  5IYD H;  2N8N A;  4QL5 A;  1H95 A;  5IP9 H;  5JEA G;  3BU2 A;  3CMA A;  1UE5 A;  2HQL A;  2PI2 A;  2B63 H;  3CCM A;  2A19 A;  4DKA C;  1IBK L;  1SMX A;  2WFW A;  1VQI A;  4P73 A;  3F1Z A;  1VQ9 A;  3PO2 H;  4B3R L;  2YYZ A;  1VQ7 A;  4K0K L;  1Y1V H;  1ASY A;  2PMZ E;  2VS1 A;  4DR3 L;  3HOY H;  4A3F G;  3U4Z A;  1NTG A;  3UDG A;  4A3G G;  3MEF A;  2AKW B;  2VQF Q;  1Q1E A;  2R7F A;  4LF9 Q;  5C0X I;  4HJ8 A;  4A3M H;  3CPW A;  1X3F A;  3RN2 A;  5LMN Q;  3CD6 A;  1YZ6 A;  4JI3 Q;  3PF5 A;  1HNW Q;  1UE1 A;  5IWA Q;  1SFO H;  1B7Y B;  1Q8K A;  5JEA J;  2ZJR A;  1E3P A;  5LMU L;  1JJG A;  2DUD A;  1TWG H;  2PQA B;  5IP7 G;  4WJ4 A;  4A3D G;  5BR8 L;  2Q2T A;  1SRU A;  1Q12 A;  4YCU A;  4JI7 L;  4IPH A;  1FVI A;  1J6Q A;  1HZB A;  1WCM G;  1CSQ A;  1CKO A;  5C4X H;  5IY0 A;  1PA6 A;  4JCV E;  1XNQ Q;  3GTQ H;  1KIX A;  3KJP A;  1JE5 A;  4J15 A;  4QJF A;  4IJH A;  2AHO B;  1LYL A;  4GS3 A;  3I4N G;  4LF5 Q;  1EWI A;  2EQS A;  4BBS G;  4JG2 A;  1D8L A;  2KHJ A;  4RG1 A;  2VUM G;  3S24 A;  1LM0 A;  4B3M Q;  1FL0 A;  1KRS A;  1YBY A;  2JA5 H;  4BY7 H;  4A3J G;  3HOW H;  1KRT A;  4OO1 G;  3EBE A;  4GLV B;  2YV5 A;  2MO0 A;  4AYB E;  3CME A;  1HNX Q;  4IFD J;  1XPU A;  3A5U A;  3ER0 A;  4JI1 L;  3GTG H;  1SR3 A;  1GKH A;  1QZG A;  2K14 A;  1VQ8 A;  4L5S A;  3H3V H;  2R7Z G;  1I94 Q;  3GTK H;  3CCQ A;  3H15 A;  2UXC Q;  2XGT A;  1IYJ B;  3WWV A;  4MZ9 A;  4DR2 L;  1X56 A;  2R7D A;  1N34 Q;  2KBN A;  1XPR A;  2JA8 H;  3DLL A;  2UU9 L;  2E2J H;  4LF6 Q;  2K5N A;  1VQO A;  2F4V Q;  4L5T A;  1N32 Q;  1FJG L;  2Q2I A;  2KCT A;  3U58 A;  3AFP A;  5FLM H;  2Y0S E;  2H5X A;  4P75 A;  3J81 c;  4LF4 Q;  4LFC L;  4TQU S;  4DV6 L;  1PYS B;  1XMO Q;  5FJ8 G;  3K0X A;  4L5R C;  2UXD L;  4DK3 C;  3NEL A;  1GVP A;  1YI2 A;  4GNX A;  3BZK A;  1L1O B;  4DV7 L;  2QEX A;  4DR5 L;  1IBM Q;  4GN3 B;  1IBL Q;  4JBW A;  5C44 H;  4A75 A;  3OTO Q;  1QVC A;  2JA7 H;  2FXQ A;  2I5M X;  1LUZ A;  1XJV A;  1VQM A;  4LF7 Q;  3L2P A;  3T1H Q;  1BBW A;  2D0O A;  4A4I A;  3A5Z B;  1E24 A;  1X3G A;  4DV1 Q;  1VQL A;  2JA6 G;  1VQ6 A;  4LFB Q;  2N78 A;  4YWM A;  2JQO A;  4YY3 Q;  3KF6 A;  1VQG A;  3I4O A;  1PH6 A;  3I4M G;  4PG3 A;  2VQF L;  4UP9 A;  4OWT B;  4LF9 L;  2ES2 A;  1BVS A;  1HZC A;  3PUW A;  1Y14 B;  1PH5 A;  1IL2 A;  2JEA I;  4OON A;  2R92 G;  3NEN A;  1QVF A;  4EX5 A;  5LMN L;  4B3T Q;  1VS0 A;  3M85 A;  1OTC A;  3ULP A;  2CFM A;  4JI3 L;  4JOI A;  2ZTD A;  3UDI A;  4HIK A;  1HNW L;  1UE7 A;  5IWA L;  2UXB Q;  2A8V A;  4OO1 I;  1CSP A;  4O2D A;  1PH4 A;  2ZJP A;  5C4J H;  5M3M G;  1BBU A;  4JC0 A;  3S1R H;  1VQD A;  1C7Y A;  3OYY A;  3Q8D A;  2K5H A;  2A1A A;  1Z9F A;  2CKZ B;  3E9H A;  3TQY A;  1VQF A;  3I56 A;  1XNQ L;  1PYB A;  3TRE A;  3M4Q A;  3J81 j;  1SN8 A;  1MJC A;  4AH6 A;  1EYG A;  4A3L H;  4LF5 L;  1K0R A;  4LUO A;  1IXR A;  1WYD A;  4WJ3 M;  4JOI C;  4B3M L;  1WFQ A;  4AYB G;  4O0A A;  3HOV H;  3FKI G;  1S40 A;  2ID0 A;  1L1O C;  4XIG S;  1HNX L;  3PO3 H;  1WCM H;  2HIV A;  4YWK A;  1CKM A;  3A74 A;  2WB1 E;  3F2D A;  3HFZ B;  5IYD G;  2N49 A;  3JAM c;  3J81 i;  4ME3 A;  3FHW A;  1GM5 A;  4H02 A;  1J5E Q;  4R1J A;  4A76 A;  3RZO H;  4A93 H;  4DV0 Q;  1I94 L;  1OXV A;  3U4V A;  4BBR H;  3TEH B;  3M7N A;  3HKS A;  4DR4 Q;  1N34 L;  2ZTE A;  5M5W H;  2UXC L;  1UE6 A;  1VQK A;  4JBK A;  4OWW B;  1CKN A;  4BXX H;  3K8A A;  2Y0S G;  4LF6 L;  2VUM H;  5GAH C;  3K7U C;  1I5F A;  2F4V L;  1NJI C;  1YVC A;  2HIX A;  3S1Q H;  1IZ6 A;  1N32 L;  2JEB I;  3W1B A;  4GN4 B;  4LF4 L;  4NPS A;  1Y1W H;  4B3S Q;  1U0L A;  1Q86 C;  3CCU A;  1SLJ A;  4C3H H;  1XMO L;  4GLA C;  4JV5 Q;  2GVA A;  3W5O A;  3HOX H;  2K5V A;  3JC6 6;  2E5L Q;  3HOU H;  4A3C G;  2VQE Q;  2Z6K C;  3G48 A;  1IBM L;  4P71 A;  5GAE C;  2E2H H;  2R7Z H;  4RMF A;  3CP0 A;  1IBL L;  4IFD G;  1Q46 A;  1C9O A;  3E9I A;  4JBM A;  3CC7 A;  1E1T A;  3OTO L;  4A3K G;  4GN5 A;  2OQ0 A;  4BY1 H;  3S15 H;  3FP9 A;  2YTX A;  4X65 Q;  3HOZ H;  1TWF H;  2MQH A;  5IYC H;  2UUC Q;  2ZM6 Q;  1YHA A;  3HKZ E;  4QY7 A;  3K80 C;  4A3I G;  1JMC A;  4R4I A;  4LF7 L;  4DV4 Q;  3T1H L;  3PCO B;  1JJ2 A;  2MNA A;  3CC2 A;  4DV1 L;  1QUQ B;  4LFB L;  3G6E A;  1AH9 A;  1XTD A;  3H0G H;  3KDF B;  5HY6 A;  3CCL A;  4YY3 L;  5AJ3 Q;  4EQ5 A;  1I50 H;  4IOA A;  1YJ9 A;  4YWL A;  5IYB G;  1O7I A;  3AYH B;  1VQ5 A;  4R4Q A;  3SGI A;  2LSS A;  4R4T A;  1PV4 A;  4R4C A;  4BA1 I;  3RLN A;  2PI2 E;  2YTV A;  4GOP B;  1S72 A;  4B3T L;  2CCZ A;  5IP9 G;  3GDE A;  1FGU A;  3MXN B;  1RL2 A;  4DUY Q;  4JI8 Q;  1PFS A;  1HR0 W;  2UXB L;  4QQB X;  5C3E H;  5HGQ A;  1UWV A;  2E8G A;  2VY3 A;  3I2Z A;  2I0Q A;  1D7Q A;  1Y1V G;  1PVO A;  2PQA A;  3HOY G;  5GAD C;  1LTL A;  3T1Y Q;  2BA0 A;  2V1C C;  4PZ7 A;  3VDY A;  1TWH H;  3J7A 5;  1TWC H;  1N36 Q;  4GKJ Q;  4HJ5 A;  3CQZ H;  3L7Z C;  3GTL H;  3PUV A;  4DK6 C;  5JJI A;  4QIW E;  1EUJ A;  3JAM i;  1V43 A;  1OXS C;  4C3J H;  3D31 A;  4MNO A;  4X6A H;  1EIF A;  4APV A;  2B3G A;  2YU9 H;  3PGZ A;  2WB1 G;  5M3M H;  5ELN A;  2IHF A;  2MFI A;  4MTN A;  1L2F A;  3ZJY C;  3I7F A;  3OW2 A;  2R6G A;  3GTJ H;  2QGQ A;  3PIO A;  2CWP A;  3CXC A;  4IPD A;  1A8V A;  1NE3 A;  4GOP A;  1L0W A;  1X3E A;  3F2B A;  2R93 H;  2K75 A;  1J5E L;  3EN2 A;  4IFD I;  5C4X G;  4LF8 Q;  4DV0 L;  3U50 C;  5EAY A;  1JJC B;  4A3E G;  2IX0 A;  1YJW A;  4DR4 L;  3L0O A;  2BH8 A;  3GTM H;  4KHP Q;  4YCV A;  4JI6 Q;  3S17 H;  1HNZ Q;  4UY8 C;  1R9T H;  1UEB A;  4JBJ A;  4JYA Q;  4X64 Q;  2JA5 G;  2NVX H;  4BY7 G;  2HT1 A;  3HOW G;  3S2D H;  4B3S L;  2GN5 A;  4DV5 Q;  1YIJ A;  4DV2 Q;  1KAW A;  3UDX A;  4JV5 L;  1T9H A;  3PUZ A;  3RNU A;  1OXX K;  1V1Q A;  2RHQ B;  1K73 C;  2E5L L;  3PSI A;  5M5Y H;  4LW1 A;  2LXK A;  2VQE L;  4GOP C;  1RIP A;  2BA1 A;  4HJ7 A;  4AQY Q;  3F8T A;  3UE0 A;  1K8A C;  1KL9 A;  1L1O A;  3A0J A;  2C35 B;  4A3F H;  4A3G H;  1YNX A;  3HKZ G;  1K9M C;  2PNH A;  2HHH Q;  4LUV A;  4X65 L;  1N33 Q;  3CCS A;  1KD1 C;  1U5K A;  3IRB A;  4LFA Q;  2UUC L;  4JI4 Q;  2ZM6 L;  1PH2 A;  2JA8 G;  4DV4 L;  5FLM G;  1HJP A;  1W2B A;  1KC8 C;  3AEV A;  1KXL A;  5AJ3 L;  4YHH Q;  4HIM A;  2NN6 G;  3PF4 A;  4JI5 Q;  5IP7 H;  4L5Q A;  4JI2 Q;  4A3D H;  2E2I H;  5DLQ E;  4X62 Q;  3PIP A;  4A3K H;  2EIF A;  1N8R C;  1HR0 Q;  3M9B A;  4XTC S;  5C44 G;  1Q81 C;  2YTY A;  1P16 A;  1KHI A;  2KCM A;  2JA7 G;  3TRZ A;  2Z6K A;  4A3B G;  2NVT H;  1YHB A;  4DUY L;  4JI8 L;  4NXM Q;  3S2H H;  1PHJ A;  3CC4 A;  1X54 A;  4IOC A;  4OX9 Q;  1VQC A;  3I4N H;  1G6P A;  4ALP A;  2Z0S A;  2GVB A;  4DAM A;  4DV3 Q;  1XMQ Q;  3S16 H;  4BBS H;  3UDF A;  1VQ4 A;  3T1Y L;  4A3J H;  1MIU A;  1N36 L;  2KEN A;  1XPO A;  4Y7N H;  4GKJ L;  2RHS B;  5IT9 c;  3J80 c;  1WJJ A;  3GTP H;  1PH3 A;  3K81 C;  1E7Z A;  2OQK A;  1SE8 A;  5GRO A;  1M1K C;  2AWN A;  4DR6 Q;  4Y52 H;  1JT8 A;  2ASB A;  3M4P A;  2UUB Q;  1PH1 A;  3PV0 A;  1E1O A;  3CPF A;  2AWO A;  4X66 Q;  3KLW A;  3K7A H;  2K52 A;  4UP8 A;  2QA4 A;  1Q7Y C;  2UUA Q;  4FDB A;  3B6Y A;  1PH7 A;  1VQN A;  3I55 A;  1MKH A;  1X65 A;  2EXD A;  4IO9 A;  1B70 B;  3RN5 A;  3GD7 A;  4AIM A;  4LF8 L;  3J7Z C;  5J3B A;  3H3V I;  1VCI A;  1NBW A;  5FJ8 H;  2B29 A;  2JJQ A;  4KHP L;  1S3O A;  1I3Q H;  2RF4 A;  4A3L G;  3W1G A;  2MO1 A;  1YHQ A;  4JI6 L;  4GKK Q;  1SRO A;  5M3F G;  5GQO A;  4PZ8 A;  5GAG C;  1HNZ L;  1C0A A;  3PUY A;  4P72 A;  1AE3 A;  4DR1 Q;  4JI0 Q;  1NY4 A;  1VQH A;  4QGU A;  4JYA L;  4X64 L;  3HOV G;  2CWA A;  2DGY A;  2IX1 A;  3ULL A;  1K83 H;  2ALY B;  4UP7 A;  4DV5 L;  4DV2 L;  1KQS A;  4NXN Q;  4DUZ Q;  3AQQ A;  3PO3 G;  2B63 G;  2NN6 I;  3UE1 A;  1HH2 P;  1EFW A;  3STB D;  2OTL A;  2IY5 B;  2JA6 H;  4AQY L;  1NMF A;  4A3E H;  1WI5 A;  5FLX c;  3KYH C;  1JB7 A;  1EIY B;  3PO2 G;  4A93 G;  4P74 A;  4GNX B;  3S1N H;  1K3R A;  2NZH A;  3AFQ A;  3ULJ A;  4BBR G;  1PH9 A;  2HHH L;  3I4M H;  4C2M H;  4C3I H;  3KFU A;  3ERS X;  1Z47 A;  4DR7 Q;  1Q1B A;  1N33 L;  1X6O A;  2ZTC A;  1GD7 A;  4LFA L;  4JI4 L;  4BXX G;  2WAQ E;  4PZ6 A;  4DAY B;  5H1S E;  3BJU A;  4HIO A;  4LNQ A;  3GO5 A;  1XNR Q;  3CF5 A;  2R92 H;  2VW9 A;  5JJL A;  2IT1 A;  2JA9 A;  4A3M G;  2XTI A;  4HJ9 A;  1VQP A;  3CW2 C;  1YJN A;  4OWX B;  4BA2 I;  1Y1W G;  2ATW A;  4YHH L;  1QUQ A;  1TWA H;  3ICE A;  3G4S A;  3KDF A;  3HOX G;  1IBK Q;  3HOU G;  3D0F A;  3TS0 A;  3STB C;  4JI5 L;  3KF6 B;  4JI2 L;  1HZ9 A;  2WP8 J;  4X62 L;  3NEM A;  3DM3 A;  2ZJQ A;  4B3R Q;  4K0K Q;  1HR0 L;  4KI0 A;  4DR3 Q;  1OXT A;  3KOJ A;  3LGJ A;  5IE8 A;  2VNU D;  1A63 A;  4BY1 G;  3RLF A;  3HOZ G;  3S14 H;  2VL6 A;  4DPG A;  5IYC G;  3J80 i;  1OXU A;  2CQO A;  4NXM L;  4OX9 L;  2AMC B;  3E0E A;  1ASZ A;  4NB3 A;  3H0G G;  4OXP A;  3CCV A;  1XMQ L;  1QVG A;  4DV3 L;  2VZA A;  1VQJ A;  3RZD H;  1W3S A;  3BZC A;  3PUX A;  3FKI H;  5LMU Q;  2I5H A;  5LMN W;  3KJO A;  1A0I A;  4YCW A;  5BR8 Q;  1N9W A;  3F2C A;  4JI7 Q;  4LUZ A;  3S1M H;  4DR6 L;  3CCE A;  3G71 A;  4A3B H;  2D62 A;  2UUB L;  2NZO A;  1NMG A;  2L15 A;  3CCR A;  1X9N A;  1P8L A;  2JE6 I;  5C0X G;  4X66 L;  5C3E G;  2F52 A;  3KF8 B;  1G51 A;  2UUA L;  4TVA B;  3M4O H;  4HJA A;  1K8G A;  1PH8 A;  4LWC A;  1VQE A;  1WOC A;  1HZA A;  2JK8 A;  4GNX C;  1YIT A;  4DNI A;  1QZH A;  1Q82 C;  2OWO A;  2LXJ A;  4IPG A;  1VQA A;  1M90 C;  3GTO H;  2OTJ A;  3CAM A;  1EQQ A;  1EQR A;  3NBH B;  2NVQ H;  4A3C H;  1DGS A;  4KLK A;  4JI1 Q;  1GO3 E;  3RR5 A;  4GKK L;  4GLX A;  2I5L X;  4IPC A;  1BKB A;  1MJE A;  4KHZ A;  4DR1 L;  4JI0 L;  2BH2 A;  3M3Y H;  1CKN B;  1VQB A;  2RCN A;  3EIV A;  1CUK A;  3CCJ A;  4DR2 Q;  1YEZ A; 
#chains in the Genus database with same CATH topology
 1E2W A;  2OCE A;  4HID A;  3TS2 A;  5K36 G;  2EY5 A;  4A3I H;  2TSS A;  4N8F A;  1FJG Q;  4TV9 F;  4YR2 A;  2JXM B;  4R4O A;  4X64 H;  3IKJ A;  3GV7 B;  1KJJ A;  2EZV A;  3EPG A;  3MWM A;  2VA3 A;  1MHW C;  4UPA A;  4POF A;  4F4Y A;  1ZXT A;  1A6X A;  4EEQ A;  4DV7 Q;  2X6L A;  3OHB A;  1DJR D;  5KFX A;  1XNR L;  2ZJT A;  2A6H D;  2N8N A;  1A9X A;  3PW4 A;  1H95 A;  4FXG C;  3SE0 A;  1RK6 A;  1JIH A;  3CMA A;  2B63 H;  4AYB A;  5KG1 A;  3G8C A;  4MTD A;  5DLF A;  1IBK L;  4J9L A;  1EY0 A;  1SMX A;  1SNO A;  3F1Z A;  2PQE A;  5LHY 1;  1STN A;  1WTR A;  3CVZ A;  2MJ8 A;  4Q43 A;  5DQH A;  4I50 F;  2AKW B;  4L8J A;  2R7F A;  4MAM A;  3LX0 A;  3V6H A;  4JI2 H;  3U9O A;  5EZY F;  1MD2 D;  1SE2 A;  2L9H A;  2BE5 C;  2NU6 B;  3R5F A;  1Y8P B;  2SCU B;  4C1N I;  3CD6 A;  4J9R A;  3Q22 A;  4G7Z C;  4KV6 A;  4WFN 3;  4WBN F;  1FJG H;  1UE1 A;  3K5H A;  1B7Y B;  3HG9 A;  4LMY A;  1JJG A;  2DUD A;  1TWG H;  5IP7 G;  2F0D A;  4OX9 H;  1CHQ D;  5A2Q E;  1SRU A;  3RZO B;  3TII A;  2BCO A;  2WV6 D;  1FVI A;  2L5T A;  1FYC A;  1WCM G;  4K2K A;  4DV7 H;  5FLX L;  1XNQ Q;  1PA6 A;  3GTQ H;  4XZ3 B;  4Q8E A;  4QJF A;  2N55 A;  1IW7 C;  1R4P B;  2EYJ A;  4IJH A;  2NU8 B;  1LYL A;  3PZP A;  2KCC A;  5T1I A;  2V4D A;  2K28 A;  4K5X A;  4IUN A;  4RG1 A;  2VUM G;  2L55 A;  3S24 A;  2F03 A;  3HOX B;  3RB0 A;  4ECT A;  3Q24 A;  2ENB A;  3WOF A;  3HOW H;  1RKN A;  5DQG A;  4AYB E;  3WOE A;  4C3H G;  2EYF A;  4JI1 L;  3GTG H;  1IKL A;  3HOZ B;  1QZG A;  3H3V H;  3E0J A;  2R7Z G;  1ZHQ A;  4PMB A;  3GTK H;  5EKI A;  2XGT A;  1IYJ B;  3H0G B;  1A15 A;  2K5N A;  1VQO A;  2F4V Q;  5EJW A;  4JV0 A;  4EFE A;  1WD0 A;  5FLM H;  1EZ1 A;  1BDO A;  1Y1V A;  2FJ2 A;  1MSH A;  4LF4 Q;  1RJR A;  2GLT A;  4TQU S;  4ETS A;  2NN6 H;  3RB6 A;  1EY4 A;  4L5R C;  2UXD L;  1GVP A;  1MI2 A;  3A56 A;  4GNX A;  3SXH A;  4F4W A;  4PDB A;  2PMZ B;  4HR7 A;  1GYF A;  5KFH A;  4MV3 A;  4FU0 A;  3E6Z X;  4LAA A;  5CBA E;  3VA7 A;  1SFO A;  5KFL A;  1GOZ A;  3A7A B;  3T1H Q;  3HGB A;  1VQL A;  4CGY B;  1X3G A;  2JA6 G;  3R5X A;  5LP6 F;  3VR5 A;  2YYA A;  5DGB A;  1VQG A;  3I4O A;  1DV1 A;  1CQV A;  4JV2 A;  3KBX A;  3SE7 A;  4UP9 A;  4OWT B;  4LF9 L;  2K7V A;  3I90 A;  1BVS A;  2CW8 A;  4C3J B;  2MCT A;  1Y14 B;  2QF7 A;  1IL2 A;  2JEA I;  2RDF A;  3NEN A;  5FLX E;  2K32 A;  3AMU A;  4IHJ F;  3R2T A;  5LMN L;  3S9W A;  3NXW A;  5JAV A;  2CFM A;  3UDI A;  4HIK A;  4RAU C;  2F4V H;  2YW2 A;  2JA5 A;  3GTJ B;  1DZ1 A;  2OT2 A;  3E3X A;  2R7M A;  1Q3L A;  4OO1 I;  1EOT A;  1CSP A;  4LF4 H;  1F2Z A;  2ZJP A;  4YQW A;  4O3Q A;  4FM9 A;  1T5E A;  1VQD A;  3OYY A;  4CHT B;  2FPI B;  5JOB A;  2K5H A;  5LMU H;  2CKZ B;  1PMR A;  5KND A;  3M4Q A;  1DIK A;  3D4D A;  1MJC A;  4RB2 C;  3AU7 A;  2NVX B;  2DY7 A;  1K0R A;  4LUO A;  1VBG A;  1DD2 A;  4HNT A;  1WYD A;  1ESR A;  4DN4 M;  4WJ3 M;  3OIQ A;  5COR A;  4IQZ A;  4AYB G;  1HQR D;  5M5Y B;  4L1K A;  5BN3 A;  2QCP X;  1L1O C;  1CQI B;  2KQ3 A;  4XT1 B;  3F2D A;  3WO0 A;  5KFP A;  1WTP A;  3N52 A;  1GM5 A;  3QFF A;  4A76 A;  3RZO H;  5KFJ A;  2HCC A;  3U4V A;  4J9Q A;  3OHX C;  3TEH B;  3H4B A;  5D8D A;  5KT3 A;  1UE6 A;  1VQK A;  1JOO A;  1RD9 D;  4G3I A;  1NJI C;  1IZ6 A;  3KBG A;  2OF1 A;  3NQI A;  2WAQ A;  2HD3 A;  4NLG A;  4NPS A;  4B3S Q;  1ZEQ X;  3EFX D;  1Q86 C;  1SLJ A;  1XMO L;  1RK5 A;  3HOX H;  4ED7 A;  1HA5 A;  3SDZ A;  1IBM L;  1SYF A;  1C9O A;  4LFC H;  1E1T A;  2J4X A;  3IN5 A;  1S0M A;  2RKS A;  4FXK C;  3OSP A;  2YTX A;  3HOZ H;  3OSN A;  3KXY T;  3HKZ E;  4LF7 L;  3F2U A;  1JMC A;  4E4T A;  4R4I A;  2NTS A;  3BS1 A;  5EWE A;  4DV1 L;  4KJO A;  1SSO A;  2A5H A;  3H0G H;  5IGB A;  1KC7 A;  5DM6 3;  5HY6 A;  4IRD A;  3CCL A;  5AJ3 Q;  3J7A K;  4EQ5 A;  2B2W C;  4BWG B;  3FPP A;  3AYH B;  2EDG A;  2J7Z A;  2L1B A;  4BA1 I;  3BA9 A;  1B6R A;  2KED A;  3DHQ A;  1B4O A;  2J0T D;  3J7Y W;  4C56 C;  3MXN B;  2C2R A;  1V1P A;  5C0X H;  1D1I A;  1T3N A;  1PFS A;  1EQT A;  4XQN A;  5G3L F;  5HGQ A;  1UWV A;  3L9A X;  2VY3 A;  4QB4 A;  1O80 A;  3WO1 A;  2R84 A;  4ME5 A;  5BMV F;  1D7Q A;  1Y1V G;  1PVO A;  2PQA A;  3HOY G;  5KT5 A;  4CC6 A;  2OEO A;  2VXW A;  3T1Y Q;  4FF4 A;  2W6Q A;  1I3Q B;  4UCU A;  4GKJ Q;  5EDW A;  3L7Z C;  3D4W A;  3PUV A;  5KFB A;  3D4R A;  1EUJ A;  5FD6 A;  3GQC A;  2B2V C;  2XN9 C;  1OXS C;  4C3J H;  1K83 B;  3D31 A;  3LNN A;  4X6A H;  1RJQ A;  1Y1W A;  1XTC D;  2JA6 B;  4UCR A;  4LF5 H;  4A3E B;  5K36 H;  3V4Z A;  3GTJ H;  2QGQ A;  3L3O C;  3NQT A;  4IPD A;  1L0W A;  1X3E A;  5ELE A;  1B2T A;  5KFV A;  1LTS D;  2NTT A;  1J5E L;  4IFD I;  4DV0 L;  3U50 C;  1KAA A;  1YJW A;  1TWF A;  3L0O A;  1PFM A;  1PZI D;  4KHP Q;  1FD7 D;  1VMP A;  4LH7 A;  2ZT9 C;  2AUJ D;  1PRT B;  5TSS A;  2JA5 G;  1UUP A;  2NVX H;  4WRD A;  2R82 A;  1I50 A;  2YRX A;  1CK1 A;  1B6S A;  3KTM A;  4RKL A;  1KAW A;  3PUZ A;  2AGP A;  5M5Y H;  3U9S A;  2VQE L;  4GOP C;  1RIP A;  2SNS A;  1J9O A;  1I4Q A;  3VYT A;  3S14 B;  3C1E A;  4RB0 A;  5L1I A;  1KL9 A;  2RQX A;  3A0J A;  1U9R A;  1YNX A;  3HKZ G;  1K9M C;  2R86 A;  4X65 L;  2F3W A;  1U5K A;  3PIP 3;  3ETJ A;  4AYB B;  2PN1 A;  1HJP A;  1A2T A;  4JK1 C;  1DOL A;  2NB0 A;  5IT9 W;  3J80 W;  3CKI B;  1SJE D;  4YHH Q;  1EWH A;  4QWE A;  5J22 A;  3Q6S A;  1TWC A;  3H94 A;  3CQZ A;  1U4L A;  3FEW X;  5IP7 H;  5KFN A;  4L5Q A;  4U7C A;  5KGU A;  4PMC A;  4YY3 H;  5K2M A;  1GLV A;  4KHP H;  4A3B G;  2YU9 A;  2P5Z X;  3CC4 A;  4DK1 A;  3BYT B;  1LAC A;  4CJ1 B;  1G6P A;  1XMQ Q;  2GVB A;  4DV3 Q;  3KHL A;  4FF3 A;  2CHB D;  1ZET A;  2R93 A;  1VQ4 A;  3W2D A;  1YNJ C;  2Z4I A;  1XPO A;  1E4F T;  3E5N A;  4I7H A;  5DQI A;  1SE8 A;  2A68 D;  5GRO A;  2VOB A;  2AWN A;  4HNV A;  2QDL A;  2ASB A;  2DJG C;  2UUB Q;  3MR2 A;  1PXU A;  1SYC A;  3Q8S B;  1E1O A;  3CPF A;  3K0Y A;  3NBI A;  3KLW A;  2FP4 B;  2HUG A;  3FPU B;  1ZYR C;  4YHH H;  1SYD A;  5COY A;  1I6H B;  1GSH A;  3H20 A;  2RDI A;  1SYG A;  4F4X A;  3I55 A;  1LTG D;  1MKH A;  1X65 A;  5EKL A;  5KFM A;  4TQS A;  1EYC A;  5M3F B;  2DNE A;  4I7A A;  4IUP A;  4AIM A;  2FIN B;  1VCI A;  4X3U A;  1NUC A;  1CT1 D;  1I4G A;  1UC8 A;  3TIN A;  4RNN A;  3RB4 A;  1I3Q H;  1STB A;  3PW5 A;  2XCP A;  4JI6 L;  2VA2 A;  1HTL D;  3MXU A;  1C0A A;  5GAG C;  1WTH A;  5EPJ A;  1VQH A;  2RDJ A;  2X69 A;  2F0Q A;  2L12 A;  2IX1 A;  2WYO A;  1I4R A;  2EOT A;  1K83 H;  3PO2 B;  2ASL A;  1XMQ H;  3OUZ A;  4UP7 A;  2YL2 A;  4DV2 L;  1TAE A;  1Y1V B;  2B63 G;  1ML0 D;  3N40 P;  2Z4H A;  3HOY B;  1HH2 P;  2WKD A;  2JA6 H;  3TQ1 A;  3VR3 A;  4A3E H;  1EIY B;  5FLX c;  3IFT A;  3KYH C;  3IL8 A;  5JJK A;  4GNX B;  1XX8 A;  2HHH L;  3ERS X;  1Q1B A;  1N33 L;  1X6O A;  4HR7 B;  5C5L A;  4JI4 L;  3RUZ A;  4KN4 C;  2F0K A;  2XSC A;  4PZ6 A;  1XNR Q;  2A73 B;  4QW9 A;  1YJN A;  1SFO B;  4HJ9 A;  1VQP A;  1BCP D;  4HQ6 A;  1Y1W G;  1EYD A;  4XXE A;  5FK9 C;  2CW0 C;  2W6P A;  1IBK Q;  3HOU G;  1MZB A;  1ZKO A;  4LSA A;  4YAK B;  2M00 A;  5LL6 X;  5IGF A;  4IRK A;  4KI0 A;  3KOJ A;  1CM9 A;  3LGJ A;  4M8A A;  5ELF A;  2VNU D;  3SK8 A;  2FK2 A;  5LXT F;  5LYJ F;  1LT6 D;  4MA0 A;  3DMU A;  3S14 H;  2K01 A;  5EOY A;  3N8D A;  5IYC G;  2CQA A;  1M0W A;  4K5W A;  4NXM L;  1F2Y A;  2R3Z A;  5KG4 A;  2JA5 B;  1ASZ A;  3E0E A;  1D2B A;  4OXP A;  3OMG A;  4O3P A;  4MV7 A;  2VZA A;  1VQJ A;  4DUY H;  3BZC A;  3PUX A;  3UI2 A;  5KT7 A;  4F4Z A;  2I5H A;  4YCW A;  4J9K A;  4EVO A;  1GSO A;  1H9K A;  2DLN A;  4E6I A;  2D62 A;  3ND9 A;  5KG2 A;  4KY6 A;  3WNZ A;  5KFO A;  4FS2 A;  4IUR A;  4X66 L;  5D3I B;  5DM7 3;  5ELB A;  4CKC A;  4XDX A;  3QJY A;  2FMM A;  4OHJ A;  3C46 A;  1YIT A;  3Q8Q B;  2FB9 A;  1SEI A;  4IZ8 A;  2OTJ A;  3HZX A;  4C2M A;  3VPD A;  1EQQ A;  4EFB A;  1YNN C;  4I4T F;  4HN7 A;  1DGS A;  4JI1 Q;  2KSW A;  1KBL A;  2R92 A;  3RR5 A;  1MJE A;  2BH2 A;  3OWF A;  4DR1 L;  4JI0 L;  4LF8 H;  1QCB D;  1VQB A;  1M6V A;  1EZ8 A;  1TWA A;  5C0X J;  3EYY A;  4R9W A;  2Q2U A;  2EY6 A;  4NXN L;  3T53 B;  2WAQ B;  3BG3 A;  2F0E A;  4JYA H;  1TXY A;  2R93 G;  3BAB A;  2B2U C;  4IJL A;  1X55 A;  1I6H H;  1VBH A;  4DV5 H;  1GSA A;  2K04 A;  3RLO A;  4J9S A;  2UXD Q;  4DR7 L;  1I4P A;  5M3F H;  1KJ8 A;  1EY6 A;  5IT9 L;  3J80 L;  5KKN B;  2MHV A;  1BGW A;  1JLL B;  3BQ1 A;  1BR9 A;  1S68 A;  4PMW A;  3GIK A;  1QWY A;  2BE5 D;  1HFN A;  5KFA A;  3UQ8 A;  4ECW A;  2EYO A;  4ILW A;  5JEA G;  1H9R A;  2HQL A;  2PI2 A;  5C6A A;  4KY7 A;  2A19 A;  4FBT A;  4M1U B;  5ELC A;  3TDQ A;  4IZO A;  4DXF A;  3H3V C;  4CBV A;  1VQI A;  3PO2 H;  5KIX A;  3MHB A;  4ZUJ A;  2L0C A;  1VQ7 A;  1Y1V H;  4ZYS A;  4GC6 A;  2PMZ E;  4DR3 L;  3HOY H;  1AN8 A;  2XRQ D;  5DNF A;  3MFH A;  1MSG A;  4LF9 Q;  2XC9 A;  3ERO A;  4JI5 H;  5L1K A;  5D14 A;  1O7Y A;  2BQ3 A;  5LMN Q;  2XCA A;  1V1P B;  3TP5 A;  2A68 C;  2RDH A;  2UVR A;  2ICE C;  2PO4 A;  4QIW A;  1EUD B;  2W9A A;  4MV4 A;  1EFI D;  3MFG A;  2EJG C;  1SFO H;  1SND A;  1SYB A;  4EG0 A;  2FLL A;  2PQA B;  4WJ4 A;  5BR8 L;  4QW8 A;  4N8X 1;  4DAV A;  1Q12 A;  4LMQ D;  4YCU A;  2UXD H;  4IPH A;  3FDT A;  4EQN A;  1J6Q A;  1HUM A;  1LTR D;  2DPI A;  1CSQ A;  1QOH A;  4KTA A;  3G6V A;  4JCV E;  1KIX A;  1JE5 A;  4NP5 A;  2W7O A;  1LT3 D;  2AHO B;  3J7A F;  4GS3 A;  4YJ2 F;  3I4N G;  1EWI A;  2EQS A;  4ULL A;  4BBS G;  1Y1W B;  1B33 N;  2KHJ A;  1C48 A;  1JC7 A;  2B8F A;  4DAP A;  1FL0 A;  4HNU A;  3RB3 A;  1IL8 A;  3HOU B;  2JA5 H;  4A3J G;  1KRT A;  1ET9 A;  2UUA H;  2Z1C A;  3CME A;  2W9C A;  1TA8 A;  1M4V A;  3I3C A;  5L37 A;  1XPU A;  1S5D D;  3DWA A;  3A5U A;  2LMC B;  1DON A;  1VQ8 A;  1GXD C;  1TWF B;  2K14 A;  1O78 A;  5I6W A;  5KFG A;  3CCQ A;  5IT9 E;  5LMN H;  4DR2 L;  4Q44 A;  1JCK B;  4HED A;  3L4K A;  2HGS A;  3EJI A;  1DYQ A;  2UU9 L;  4RCN A;  2YZN A;  4DLK A;  1I50 B;  2Q2I A;  5E3F A;  2H5X A;  5E4X A;  2W9B A;  1BCP C;  4DV6 L;  2XGQ A;  1XMO Q;  4FF1 A;  5FJ8 G;  1SDF A;  3VMM A;  1X3P A;  4ODG A;  4RAY A;  1RYR A;  3BZK A;  5CV5 A;  1IBM Q;  5ELD A;  5KG7 A;  4GN3 B;  1PK8 A;  4JBW A;  3VR6 A;  1V8Q A;  1G2S A;  2YZM A;  4QMG A;  5DGA A;  1EIG A;  1JWU D;  3OOC A;  5F9N A;  2FLN A;  2JSO A;  3OSO A;  1XJV A;  1VQM A;  4LF7 Q;  3L2P A;  1SMY D;  2D0O A;  4A4I A;  4FF2 A;  4DV1 Q;  1TWC B;  4YWM A;  2JQO A;  1ICF B;  3KF6 A;  3CQZ B;  2EE1 A;  2F0O A;  3VR4 A;  5CA1 F;  5KFW A;  2V9W A;  2I80 A;  2F0P A;  2X6G A;  4OON A;  2R92 G;  2M05 A;  1BBX C;  1QVF A;  1G2T A;  2YU9 B;  1MBY A;  1HA6 A;  1OTC A;  4RB3 C;  4JI3 L;  4KHV A;  1WVL A;  4O2D A;  2R93 B;  1EYZ A;  1ROD A;  4YBZ B;  4H13 C;  5C8Y F;  1GUS A;  1BBU A;  1M0T A;  1XMO H;  4F7X A;  1GUW A;  4XYQ A;  1H9J A;  3BJY A;  1CA6 A;  1C7Y A;  4XT3 B;  1C3O A;  3I72 A;  1IBM H;  3LWB A;  1EQV A;  2A1A A;  1Z9F A;  5C1O A;  5HV6 A;  3MWD A;  4DA2 A;  1AN7 A;  2O5I C;  5C3W A;  3BZD B;  3QIA A;  3V96 A;  4DK0 A;  3RGX A;  1LO5 D;  1O7L A;  1QNK A;  4JOI C;  4LF7 H;  1EHI A;  3KUP A;  4B3M L;  3VYR A;  2M9V A;  1PDQ A;  5CR3 A;  2WE6 A;  2QEJ C;  2B39 A;  2KVM A;  2JEF A;  4XIG S;  1HNX L;  1E4G T;  3Q8R B;  3RAX A;  2HIV A;  2ALZ A;  3MFY A;  2N49 A;  4G4K A;  3J81 i;  3NBH A;  3MZ5 A;  5JVH 3;  1J5E Q;  1MGS A;  4DV0 Q;  1I94 L;  2UXC L;  5C4Z A;  1N34 L;  2VPS A;  3GV5 B;  2DN8 A;  4OWW B;  5CV8 A;  3K7U C;  4G7O C;  2K5W A;  1N32 L;  2WTF A;  2JEB I;  2CZG A;  3W1B A;  1Y1W H;  2F1M A;  1U0L A;  4XYM B;  3G6Y A;  4DL6 A;  4A3K B;  4GLA C;  2GVA A;  1EEF D;  1TR5 A;  3HOU H;  4QWA A;  4A3C G;  2VQE Q;  3T56 B;  3EVQ A;  2Z6K C;  3RV4 A;  1JB3 A;  5BN5 A;  4RMF A;  1Q46 A;  2F0U A;  3CC7 A;  2W57 A;  2CH4 W;  1PTO B;  4GN5 A;  3RD4 A;  5FOB B;  4X65 Q;  1TWF H;  1VF5 C;  3I4N B;  5IYC H;  2I8C A;  4BBS B;  1KLG D;  4WD3 A;  3K80 C;  2V4Q A;  2MP1 A;  1PYW D;  1EZ6 A;  2MNA A;  3G6E A;  1AH9 A;  4A3J B;  5JJZ A;  2CVR A;  5T1G A;  1I50 H;  3K58 A;  4IOA A;  3DF7 A;  1YJ9 A;  1LTB D;  2UVW A;  1LV9 A;  2XD4 A;  1B1Z A;  2LSS A;  4R4T A;  1AZQ A;  1S72 A;  1WSC A;  2CCZ A;  2NZ1 D;  2C00 A;  4EEY A;  2R8K A;  4ED8 A;  3PW7 A;  1NAP A;  3OMC A;  4DNT B;  3IFD A;  3PMF A;  5L1L A;  3TZU A;  2EPB A;  3FVQ A;  2YS6 A;  2NUC A;  1ICW A;  2AQ3 B;  2VQE H;  2BA0 A;  2V1C C;  2E2D C;  1RTN A;  3VDY A;  1TWC H;  1UAP A;  3HP3 A;  1RDP D;  3CQZ H;  1BXT A;  1C4Q A;  3RJ0 A;  1BNZ A;  2VPQ A;  3JAM i;  4X65 H;  1T5X D;  1XNQ H;  2K5Q A;  1EIF A;  2PYK A;  1S4Z A;  2L4N A;  1JDB B;  2YU9 H;  5CV6 A;  3FMA A;  3ZJY C;  4Q45 A;  1K1Q A;  1E2V A;  2E2H A;  3H91 A;  1NE3 A;  3VA5 A;  1U4M A;  4C2M B;  4GOP A;  2R93 H;  4ZQI A;  2K75 A;  5C4X G;  4JW0 A;  5EAY A;  4KY5 A;  4A3E G;  2R92 B;  2B2T A;  4DR4 L;  3LML A;  3TME A;  3OWE B;  5DEH A;  3GIJ A;  4JI6 Q;  4TSS A;  5FKA C;  3HBL A;  1I4X A;  2WDT A;  1TWA B;  1A3T A;  4DL5 A;  4ZKB B;  5BN4 A;  4BY7 G;  2HT1 A;  5JEA H;  5J39 A;  2I46 A;  5IGE A;  1YIJ A;  4DV2 Q;  3NWS A;  1T9H A;  5I6Y A;  1XYI A;  2RGV A;  1OXX K;  2PZW A;  2E5L L;  2FJZ A;  2K6A A;  3C1F A;  2LXK A;  4LW1 A;  3KAL A;  1SMY C;  1K8A C;  5LA6 F;  3F8T A;  3OW7 A;  2C35 B;  1FGB D;  2HHH Q;  4IR1 A;  3H40 A;  2ASJ A;  1N33 Q;  4RZR A;  3CCS A;  2JA8 G;  3IRB A;  4JI4 Q;  1PH2 A;  4DV4 L;  1CZW A;  3AEV A;  1JOK A;  2JN4 A;  4O2B F;  2R61 A;  2IP4 A;  1TWH A;  1Y69 U;  2V4R A;  2AGQ A;  3DWP A;  1YNJ D;  1GUN A;  3TP7 A;  4IFD H;  3T1H H;  3GTL A;  4R8N A;  5DLQ E;  1RF2 D;  2EIF A;  4A3K H;  5KFY A;  3M9B A;  5C44 G;  2F0S A;  4DU9 A;  2YTY A;  1P16 A;  1B3A A;  3SK5 A;  5JVD F;  1V4Y A;  1TII D;  3TRZ A;  1YHB A;  1PZK D;  4JI8 L;  1PTO H;  4NXM Q;  1NNX A;  1X54 A;  1VQC A;  3I4N H;  1SE3 A;  1ZYR D;  1R4Q B;  4DAM A;  4BBS H;  4DV2 H;  5IIF A;  5LOV F;  3G6J B;  3GIQ A;  1VDZ A;  4A3J H;  3KK7 A;  2KEN A;  3OHA A;  4RKB A;  1FNW A;  5IT9 c;  3J80 c;  1CA5 A;  3M3Y B;  2JEG A;  3NTI A;  1WJJ A;  3SK6 A;  2HHH H;  1PRT C;  1M1K C;  2C22 A;  1JT8 A;  3M4P A;  4JI4 H;  1TS4 A;  2ZDH A;  5D1O A;  2H1E A;  4X66 Q;  1ESF A;  1PFB A;  2K52 A;  1Q7Y C;  3M9M B;  1PH7 A;  1VQN A;  2EJM A;  4ZHQ F;  1L2Z A;  5M5X B;  4IO9 A;  1HQM C;  1B70 B;  3GD7 A;  3H3V I;  4MN3 A;  5J3B A;  1NBW A;  5FJ8 H;  2JJQ A;  2EJF C;  1S3O A;  1AUX A;  4A3L G;  3W1G A;  3N41 B;  2PBZ A;  2QIL A;  1JE4 A;  5M3F G;  1GUO A;  2KCN A;  3BVZ A;  1F77 A;  1HNZ L;  2BQU A;  4DR1 Q;  4P72 A;  2K5D A;  4JI0 Q;  4QGU A;  4P2C B;  4X64 L;  1NR2 A;  1S5C D;  2CWA A;  2DGY A;  5BPF A;  3I91 A;  3ULL A;  5IGD A;  5HUR A;  4BWS C;  1KQS A;  4L63 B;  4NXN Q;  3PO3 G;  1JWM D;  2NN6 I;  2CW0 D;  3BYY B;  3UE1 A;  2W9B B;  1EFW A;  2PPB C;  4LK1 C;  4DL7 A;  4AQY L;  5M9O A;  3PO2 G;  1DM0 B;  4B3S H;  4J9M A;  1HUN A;  1KEE A;  4XQQ A;  4BBR G;  1GJX A;  5HBR B;  1JR0 D;  4O42 A;  4C2M H;  5FPO A;  4DR7 Q;  4H0L C;  5EPL A;  4LFA L;  2F0M A;  3NHH A;  2WAQ E;  2W7P A;  2R92 H;  3O13 A;  3K5I A;  5JJL A;  4X66 H;  2VW9 A;  3WDN A;  4KKT A;  4ZOL F;  3RUP A;  1TWA H;  2D5D A;  3GQB A;  2EYL A;  3R8B A;  3ZYY X;  2FE3 A;  2B2Y A;  3KF6 B;  4JI2 L;  2F0W A;  3DXJ C;  1LT5 D;  4N9T A;  5C4X B;  2C28 A;  1BCP F;  1BQQ T;  4DR3 Q;  5CV9 A;  3N6R A;  5KNC A;  1A2U A;  1SAP A;  4BY1 G;  2DJF C;  1N56 A;  2K03 A;  4DPG A;  2MGS A;  4JI0 H;  1BNC A;  3VYU A;  4OX9 L;  2AMC B;  4BY7 B;  3NGD A;  2YZG A;  3I12 A;  4ECZ A;  3CCV A;  4NXN H;  4EGQ A;  1UC9 A;  1A0I A;  5BR8 Q;  4KKU A;  1JOQ A;  1PX2 A;  1N9W A;  4KN7 C;  4M7E A;  5AFW A;  4LUZ A;  2QK4 A;  1YNN D;  4TKO B;  3T1Y H;  1NMG A;  2JA8 B;  3RF2 A;  3PVX A;  1BUV T;  2E2J B;  4GKJ H;  5C3E G;  2F52 A;  1EYA A;  1G51 A;  1SNC A;  4HJA A;  2R8H A;  1PH8 A;  2O03 A;  4LWC A;  3GTQ A;  1WOC A;  5F2D A;  4GNX C;  4O3N A;  3Q8P B;  2XVS A;  2B2U A;  4IPG A;  2VB2 X;  4QCL A;  4DR3 H;  3V05 A;  1KNE A;  3NBH B;  5C44 B;  3R2I A;  4A3C H;  3A8I E;  2R7K A;  4GLX A;  2J6T A;  3M3Y H;  4KHZ A;  2HCI A;  3NPP A;  2RCN A;  3EQL C;  3EIV A;  1CUK A;  1CQF A;  5JH7 F;  3CCJ A;  4DR2 Q;  4XYO A;  2VR1 A;  1CHP D;  2DWC A;  3GTG A;  1A3U A;  2UU9 Q;  2D0P A;  2IX3 A;  4DUZ L;  1G29 1;  4QUF A;  2F3I A;  1A62 A;  4ZLT F;  3EA6 A;  4K8I A;  5BR8 H;  2KHI A;  5EBC A;  4DL2 A;  4FS1 A;  4DV6 Q;  5E7N A;  5ELO A;  2WAQ G;  1SNQ A;  1IKM A;  2F0H A;  2Q2H A;  5M5X H;  4YR0 A;  3ND8 A;  3BDO A;  2K4K A;  3LWE A;  4MTK A;  4QL5 A;  4DF7 A;  4DNR B;  1UE5 A;  5C4J B;  3BVM A;  3FKI A;  2O4X A;  5D3D A;  4RB1 A;  3S1R B;  4KKS A;  4YB8 B;  3MR5 A;  2UVU A;  4Q0F A;  3RFC A;  2WFW A;  4P73 A;  1QE6 A;  4K0K L;  3JRW A;  1ASY A;  2IBK A;  2VS1 A;  1EY8 A;  2G9H D;  4A3F G;  3U4Z A;  1NTG A;  3UDG A;  3GII A;  2Z9H A;  3MEF A;  2R7N A;  5C0X I;  1DXM A;  4ABN A;  3RN2 A;  4DR2 H;  2RA4 A;  3CRK C;  1YZ6 A;  4CDF C;  5HGT A;  4Q5V A;  4IUU A;  3H09 A;  4JI3 Q;  2V59 A;  3BG5 A;  3PO3 B;  1TS2 A;  3GTO A;  1V1O A;  1Q8K A;  3T4A C;  5JEA J;  2ZJR A;  5LMU L;  1N48 A;  1ENF A;  4CJ2 C;  4DV6 H;  2Q2T A;  4DV3 H;  4JI7 L;  1C30 A;  4ZCK A;  3T5J A;  4BBR B;  3A54 A;  3HRZ C;  5KG3 A;  1W6J A;  1SJH D;  5CGK A;  5JPM C;  5M5W B;  1AP0 A;  1PZJ D;  5C4X H;  1CKO A;  4PQX A;  5IY0 A;  4EQO A;  3KJP A;  4J15 A;  1DOK A;  3S1Q B;  4QWD A;  2O5J C;  1SYE A;  1WTQ A;  3J81 W;  4R8I A;  2W6O A;  2UUB H;  4JG2 A;  1OWT A;  4B3M Q;  2P0A A;  4QF4 A;  1KRS A;  4F8M A;  4BY7 H;  4OO1 G;  2R7L A;  3W3A A;  3EBE A;  2E2H B;  4GLV B;  4Y8V B;  2NVY A;  2YV5 A;  4RFB A;  1HNX Q;  4IFD J;  1G6Z A;  2VB3 X;  1SYX B;  4BY1 B;  1HFG A;  3S15 B;  1KDB A;  1RYS A;  1STH A;  1I94 Q;  4X3K A;  4RH6 A;  3ORR A;  2UXC Q;  3WWV A;  1N34 Q;  1X56 A;  2R7D A;  1ONL A;  2SNM A;  2JA8 H;  3DLL A;  4JI3 H;  2E2J H;  3Q1K A;  4L5T A;  4I55 F;  1N32 Q;  4X3S A;  1PTO D;  2SOB A;  3U58 A;  3AFP A;  2DPJ A;  3NE5 B;  2I87 A;  4ECS A;  4LFC L;  5JPN C;  3K0X A;  4TV8 F;  1TU2 B;  1YI2 A;  4CC5 A;  2QEX A;  4DR5 L;  1KJQ A;  3K3P A;  1S10 A;  4QUC A;  3D8G A;  5C44 H;  4A75 A;  3VPB A;  1HTP A;  1QVC A;  5E4W C;  2F0V A;  4DAY A;  5C3E B;  2FXQ A;  2I5M X;  1LUZ A;  3T5L A;  3C2P A;  3A8K E;  2WB1 A;  1STY A;  4HCS A;  1XNR H;  4O1N A;  1E24 A;  1TWH B;  2D9U A;  2N78 A;  4K8J A;  4PV1 C;  1DV2 A;  5A2Q W;  1JKJ B;  3GTL B;  5IOD A;  1IBK H;  3L4J A;  4PG3 A;  2VQF L;  2ES2 A;  5IYZ F;  2F0G A;  3X3N A;  1PH5 A;  1I94 H;  1TKW B;  4TQR A;  1N34 H;  3GIM A;  4EX5 A;  3K5O A;  5M3M B;  3ULP A;  4JOI A;  1HNW L;  1UE7 A;  4ZQ3 A;  5IWA L;  3RTX A;  2A8V A;  3JAM W;  3K59 A;  2KEC A;  1PH4 A;  2KOL A;  1EY7 A;  1ENC A;  5C4J H;  3KLS A;  2PZU A;  3S1R H;  1E4E A;  3GV6 A;  4C5C A;  1K3B C;  3KHR A;  3TQY A;  3I56 A;  1VQF A;  5H80 A;  4ECQ A;  2F4I A;  1PYB A;  3J81 j;  4R8U A;  1SN8 A;  1GHJ A;  1EYG A;  4A3L H;  5D1O B;  2W8L A;  4LF5 L;  2Q8T A;  3S2D B;  1IXR A;  3KF8 A;  3OUU A;  3TIG A;  3FKI G;  3M9O B;  2HVR A;  2UVV A;  3RIZ A;  3DUZ A;  4G57 A;  2Z6B A;  3PO3 H;  5GON F;  4NDX A;  3V2T A;  1CKM A;  3A74 A;  2BDN A;  2WB1 E;  4RA8 A;  4A3F B;  5LL6 b;  2IA6 A;  5KFF A;  3QZ7 A;  1WTO A;  4R1J A;  3TP6 A;  1E2Z A;  3GV3 A;  2I07 B;  1OXV A;  4BBR H;  5KFS A;  3GIL A;  2NBF A;  3D6C A;  4DR4 Q;  2JA7 A;  2ZTE A;  5M5W H;  1PRT F;  3SVM A;  1CKN A;  2HJW A;  3K8A A;  4JI1 H;  4LF6 L;  5GAH C;  2NYZ D;  4O4I F;  1YVC A;  3S1Q H;  4IWX A;  2VQD A;  5KFZ A;  2RSO A;  2KJX A;  1AW7 A;  4GN4 B;  3D6W A;  3CCU A;  3MR3 A;  4YP3 A;  3RMH A;  2ZXO A;  3JC6 6;  2E5L Q;  3R5H A;  2LY7 A;  5FD5 A;  3G48 A;  2E2H H;  5GAE C;  4LSX A;  1IBL L;  4A3I B;  4IFD G;  1PLF A;  4JBM A;  1QIL A;  2WII B;  2XNA C;  3OTO L;  4A3K G;  3S2H B;  2EYH A;  2OQ0 A;  5KNB A;  4BY1 H;  2A69 C;  1BJT A;  3S15 H;  1STG A;  2MQH A;  2LKV A;  1V51 A;  4OGQ C;  4DV4 Q;  1JJ2 A;  3CC2 A;  4RU9 A;  1HRJ A;  4LFB L;  2X0S A;  4MA5 A;  4Y7N B;  4YY3 L;  1UEA B;  5EKK A;  1S5E D;  1IYU A;  4IN3 A;  4HYK A;  4YWL A;  1S5F D;  2LS0 1;  1O7I A;  5IYB G;  1WTW A;  4DL4 A;  5FO7 B;  3V6K A;  2MUY A;  4IRC A;  2NWG A;  1WR2 A;  4DR4 H;  4R4C A;  3RLN A;  2PI2 E;  2ZXP A;  4FP5 D;  4B3T L;  4Q8F A;  3DEP A;  5IP9 G;  3GDE A;  3PW0 A;  1FGU A;  4LF9 H;  4O4L F;  3FDS A;  4JI8 Q;  1HR0 W;  1ILQ A;  2UXB L;  5C3E H;  4TRD A;  1SE4 A;  4MV6 A;  3J80 E;  1WCM A;  3I2Z A;  2I0Q A;  4UAI A;  1WTX A;  1A3V A;  2SDF A;  4MV9 A;  1LTT D;  2E5L H;  1LTL A;  3J81 L;  4CDE C;  3RV3 A;  3M4I A;  3KLR A;  1TWH H;  3QOJ A;  3J7A 5;  2K1B A;  3MTS A;  4HJ5 A;  4RWS C;  3GTL H;  5JJI A;  4DK6 C;  1KNA A;  4QIW E;  2VUM A;  1JOR A;  5CV4 A;  3JZI A;  3P75 A;  3HXL A;  2G5D A;  3NP8 A;  1RHP A;  3PQI A;  4ZI7 F;  2B3G A;  5CBE E;  3PGZ A;  2WB1 G;  1KTK A;  3BVG A;  5M3M H;  2IHF A;  2MFI A;  1L2F A;  1VKZ A;  1CFM A;  3I7F A;  2R6G A;  3S1N B;  2HQE A;  2R7Z A;  1KJI A;  1PTO C;  4NMZ A;  5C5M A;  3F2B A;  5KG6 A;  1CI3 M;  3HEJ A;  2FPP B;  4QWC A;  2Z8L A;  3N6X A;  4MTE A;  1TQO A;  2BH8 A;  4JPB W;  4TUY F;  3MEH A;  3HB9 A;  3K5N A;  1HNZ Q;  4A2B A;  4A2A A;  4JI8 H;  1UEB A;  4J6H A;  3TN2 A;  4GC7 A;  4X64 Q;  5I2X A;  4ECR A;  3R3O A;  3KHG A;  3S2D H;  2OLS A;  3TSS A;  2GN5 A;  5CMD A;  1WD1 A;  1I3Q A;  2W70 A;  3UDX A;  4JV5 L;  3N43 B;  3BQ2 A;  3PF4 A;  1V1Q A;  2C5C A;  3PSI A;  2R87 A;  4AQY Q;  3MC0 B;  1B3Q A;  4OEL B;  1G91 A;  4EGJ A;  1L1O A;  5NUC A;  4A3F H;  3DEO A;  4LUV A;  1KD1 C;  4LFA Q;  5A2Q L;  2UUC L;  2K33 A;  5DG8 A;  4B9W A;  2ZM6 L;  3IAY A;  4OIK A;  4ECX A;  2YRW A;  2AQ4 A;  3FKI B;  1KC8 C;  1NR4 A;  1TT2 A;  3CRL C;  4HIM A;  4ZAI A;  4DV1 H;  4JI2 Q;  2JYO A;  2ATL A;  1ZHS A;  3J81 E;  1U4P A;  4OEM B;  3JAM L;  1PRT D;  2B8G A;  2IL8 A;  1EU4 A;  1GHK A;  2JA7 G;  1HNZ H;  4RCO A;  3J7A V;  4DUY L;  2XWB B;  5CYU A;  3S2H H;  4IOC A;  4OX9 Q;  3GTO B;  4EBE A;  5KRU A;  1ULZ A;  3P1H A;  5FO8 B;  2BR0 A;  4OO1 H;  1MIU A;  1N36 L;  4AQY H;  4Y7N H;  2OXP A;  4O3R A;  3GTM A;  2B2W A;  1PH3 A;  4GZY C;  1PFN A;  1E7Z A;  2OQK A;  5A35 A;  1R9T A;  4RGM A;  4LFA H;  4KD3 A;  1PH1 A;  3ERQ A;  3PR5 B;  1B53 A;  2XIW A;  2QA4 A;  1I6V C;  2JP1 A;  1CS0 A;  3KAJ A;  1LAB A;  2WAC A;  1BCP B;  5CC4 A;  2NVY B;  2Q8I B;  5CV7 A;  2FMA A;  4LF8 L;  3J7Z C;  2XCL A;  3BAA A;  1II3 A;  1Z2O X;  4M9U A;  5JVG 3;  2W6Z A;  1F9R A;  3I8Z A;  2RF4 A;  2MO1 A;  1YHQ A;  3C3L A;  2ZXR A;  1J5E H;  1G8Z D;  2EYP A;  4KJN A;  4DV0 H;  4JYA L;  3HOV G;  2ALY B;  2B2V A;  4DV5 L;  4DUZ Q;  4LJZ C;  1M8A A;  5D65 A;  2E2I A;  2QDB A;  2OTL A;  3V4S A;  1SNM A;  3P20 A;  2IWH A;  1WI5 A;  1JB7 A;  4A93 G;  4HMI A;  4CDC C;  3S1N H;  2NZH A;  4CJ0 B;  3ULJ A;  4A3M B;  1PH9 A;  1TVX A;  2R8J A;  1O7Z A;  4BXX G;  2ZTC A;  1GD7 A;  4U67 3;  3JAM E;  4YAJ B;  5CA0 F;  4DAY B;  5H1S E;  1UNN C;  3CF5 A;  2XTI A;  2BOS A;  2WB1 B;  4JVZ A;  5KFT A;  2ATW A;  2RBM A;  5C4H A;  1QUQ A;  1ET6 A;  5L9X A;  3G4S A;  3KDF A;  1T36 A;  4FO2 A;  1CTM A;  3TS0 A;  5DG9 A;  3STB C;  4JI5 L;  3GTP A;  1HZ9 A;  4X62 L;  4IWY A;  3NEM A;  3DM3 A;  4K0K Q;  2FPG B;  5FO9 B;  1HR0 L;  1EUC B;  3MFI A;  1AUV A;  5KT4 A;  1OXT A;  3R93 A;  5KYL A;  1ILP A;  5IE8 A;  1XWE A;  5DAU A;  4FBU A;  1T94 A;  4G7H C;  2VL6 A;  3OPO A;  4PNY A;  2CQO A;  3MXP A;  4V19 0;  2C9O A;  1CQJ B;  4RUA A;  2O2L D;  4DXG A;  4DUZ H;  3H6M A;  5J2U F;  2V58 A;  1W3S A;  4IUQ A;  2HVS A;  3FKI H;  5LMU Q;  2AUK A;  5JUM A;  1E4E B;  4LH6 A;  4EBC A;  2ZDG A;  3KLS X;  4JI7 Q;  4NKL A;  1S0O A;  3RGZ A;  2KEE A;  4IR9 A;  1S03 G;  1LLR D;  4DR6 L;  3G71 A;  2IW3 A;  2L15 A;  4R8U B;  4RAZ A;  2JEI A;  4BS9 A;  3K6O A;  2LFN A;  4JV1 A;  1FNU A;  2J6S A;  5KT6 A;  3KF8 B;  2UUA L;  2XGP A;  2E74 C;  2XRS D;  1M7J A;  1K8G A;  4J8Q A;  4ECY A;  1HZA A;  2JK8 A;  1QZH A;  3GV8 B;  4DNI A;  1Z6H A;  4WJW A;  1M90 C;  1VQA A;  3GTO H;  2AGO A;  4K0K H;  2IJ0 A;  3K57 A;  1VMC A;  1EQR A;  1F2M A;  4FNF A;  2PNR C;  2FK1 A;  1Y8N B;  4KLK A;  1RTO A;  4GKK L;  2JA7 B;  2I5L X;  4IPC A;  5DLG A;  5IOC A;  1CKN B;  1HPC A;  4RZQ A;  1YEZ A;  2IHE A;  4JI6 H;  2DNC A;  3BDL A;  1EOV A;  4NW2 A;  4F88 A;  5EGT A;  2N3S A;  2FKL A;  4POG A;  1L0X B;  2W6N A;  3HKZ A;  2K50 A;  4QIW B;  1B8A A;  4LFC Q;  4JI7 H;  1E22 A;  5E1F A;  2NVY H;  1JIC A;  5C3X A;  5IYB H;  1I4H A;  3GLK A;  1V9P A;  5C1P A;  4ECU A;  4DR5 Q;  2VUG A;  4FXD A;  1AE2 A;  4RHR A;  5KG0 A;  5FPR A;  1EIH A;  4PWQ A;  4RNO A;  5IP9 H;  5KG5 A;  3BU2 A;  3QWN A;  1N33 H;  1H9M A;  3ONA B;  3CCM A;  4DKA C;  4OL7 A;  2RDG A;  3M7G A;  2ZDQ A;  1FNV A;  3PR4 A;  4B3R L;  1VQ9 A;  2YYZ A;  4K6D A;  4V0B A;  4A3G G;  2YS7 A;  4QWB A;  3I70 A;  1QJO A;  2VQF Q;  1Q1E A;  5K5P A;  4DL3 A;  1QB5 D;  2W9C B;  4HJ8 A;  2KA7 A;  1IYV A;  2FFK B;  4A3M H;  3A8J E;  2A6H C;  2N88 A;  1D5Z C;  1X3F A;  3CPW A;  2Y0S A;  3KHH A;  3HOV B;  3Q2O A;  5EPK A;  2NUA B;  1IOV A;  4WOR A;  1EWC A;  3PF5 A;  4K14 A;  1HNW Q;  4KK7 A;  1WCM B;  5IWA Q;  1O75 A;  4NXM H;  1E3P A;  1Q8I A;  1TY2 A;  3MAQ A;  2AQ1 B;  4UCV A;  4A3D G;  1K0S A;  3N44 B;  4A93 B;  4YR3 A;  3QR8 A;  2IMW P;  1HZB A;  3X3M A;  4O3O A;  3G6X A;  4DR5 H;  4FYD A;  4ED3 A;  2YCH A;  2VUM B;  4RGO S;  3NK9 A;  5JVL A;  3I4L A;  5I9O A;  2WIN B;  4LF5 Q;  3G7L A;  1D8L A;  2CW7 A;  5JQW A;  4C3H B;  1I7L A;  1LM0 A;  2RCF A;  2FK3 A;  2RVL A;  1Z2N X;  2W71 A;  1YBY A;  4J9O A;  4HSV A;  2CH4 A;  1X32 A;  2R7Z B;  4EBD A;  1B9M A;  2MO0 A;  3TP8 A;  2ICI A;  3TBI B;  3ER0 A;  2VQF H;  1L0Y B;  1SR3 A;  1GKH A;  1K28 A;  4L5S A;  3PW2 A;  3MVV A;  3H15 A;  2B63 A;  4HCE A;  1SNP A;  4DFA A;  4MZ9 A;  3URY A;  2KBN A;  1XPR A;  2QW7 A;  4LF6 Q;  1HNW H;  1KDA A;  5IWA H;  5C5J A;  1AFP A;  4DR1 H;  1FJG L;  2KCT A;  4HSP A;  4EQP A;  2Y0S E;  4P75 A;  3J81 c;  3PIO 3;  1GUG A;  1PYS B;  1IOW A;  1LTA D;  1QG7 A;  3ITP A;  4DK3 C;  3NEL A;  2C2D A;  1HXY D;  4DV7 L;  1L1O B;  4DGZ A;  1PTO F;  2EY1 A;  1IBL Q;  5KFR A;  4FVM A;  4C5A A;  1FR3 A;  3JSN A;  2J9G A;  3OTO Q;  2FHT A;  3K5M A;  1FKA H;  4DR7 H;  2JA7 H;  3EPI A;  2JEJ A;  3SI8 A;  1TWG A;  2GA4 B;  1BBW A;  1VQ6 A;  3A5Z B;  2ASD A;  4LFB Q;  4X3T A;  5KFI A;  4YY3 Q;  1S9F A;  3SHL A;  4JUZ A;  1PH6 A;  3I4M G;  4C3I G;  1SEB D;  5I47 A;  1H9S A;  1NCV A;  1HZC A;  3PUW A;  4KMU C;  2R6F A;  4B3T Q;  1VS0 A;  1X3Q A;  4HMJ A;  3M85 A;  4LF6 H;  2ZTD A;  1W96 A;  4EYI B;  4IAL A;  2UXB Q;  3QG1 A;  1AZP A;  3P7J A;  5BPH A;  1UNS A;  5M3M G;  2B2T C;  3LWU A;  4JC0 A;  5CB4 F;  3V6J A;  4U6P A;  3RBD A;  2PZT A;  3Q8D A;  4KD4 A;  1B9N A;  3GTM B;  3E9H A;  1XNQ L;  3GTK A;  1U4R A;  1IBL H;  3JRX A;  3S17 B;  3TRE A;  4J9P A;  1R9T B;  3OTO H;  3E5S A;  3GIP A;  5KFK A;  4AH6 A;  2FLP A;  2HVQ A;  4CKE A;  2BQR A;  1WFQ A;  4O0A A;  3HOV H;  1S40 A;  4LFB H;  5KYI A;  4ZKC B;  1EEI D;  3T51 B;  4MV8 A;  3HS0 C;  4C1N K;  2ID0 A;  4OIJ A;  1WCM H;  1HCZ A;  2Q8R E;  4YWK A;  3Q23 A;  4A3G B;  1XDN A;  2PVP A;  1J8I A;  3HFZ B;  5IYD G;  3JAM c;  4ME3 A;  3FHW A;  3VR2 A;  4H02 A;  3SR1 A;  3A55 A;  4A93 H;  4RNM A;  4YIJ A;  2IPK D;  1WH2 A;  4EYH B;  3M7N A;  1K8M A;  3HKS A;  4B3T H;  2A69 D;  5IGG A;  4RGN A;  4JBK A;  3TZD A;  4BXX H;  2Y0S G;  2VUM H;  4K2L A;  1KDC A;  1Y8O B;  1I5F A;  2F4V L;  2V5A A;  2HIX A;  2UXB H;  1HHV A;  2D2C C;  4LF4 L;  4A3D B;  2E2I B;  3SK4 A;  2EVB A;  4C3H H;  4JV5 Q;  2UU9 H;  3W5O A;  2K5V A;  1RJP A;  4P71 A;  2R7Z H;  3CP0 A;  4ED6 A;  2NVT B;  3E9I A;  3DM1 A;  1TS3 A;  3FP9 A;  2UUC Q;  3S16 B;  5LL6 S;  2ZM6 Q;  1JQY D;  1YHA A;  4QY7 A;  4A3I G;  2R85 A;  4APM A;  2J6U A;  3IG0 A;  3T1H L;  3PCO B;  1GUT A;  4I65 A;  3K3V A;  1QUQ B;  5KFC A;  2F3V A;  5EWG A;  1XTD A;  3KDF B;  1BXR A;  4ED2 A;  5EBD A;  2QKI C;  2QYZ A;  3Q0A A;  3TQT A;  3MJF A;  3GTP B;  4ZRZ A;  4S3S A;  2K05 A;  3D3R A;  5G3L D;  4R4Q A;  1VQ5 A;  1Z2P X;  3SGI A;  4UCS A;  1PV4 A;  4GOP B;  2YTV A;  1D1K A;  1W93 A;  3K7A B;  5IGC A;  1B04 A;  1JX4 A;  1RL2 A;  3LP8 A;  4DUY Q;  1AEX A;  4QQB X;  4K5V A;  3GID A;  4RUC A;  2HDL A;  2E8G A;  1XXG A;  4ME6 A;  4JV5 H;  5L1J A;  3FRP B;  5GAD C;  3FMC A;  2HDM A;  4ECV A;  4PZ7 A;  1N36 Q;  1CE8 A;  2SEB D;  4J9N A;  4UHV A;  4R7R A;  5KT2 A;  1V43 A;  4J1M A;  4Z9C B;  1JWS D;  1B50 A;  3T5K A;  2UUC H;  4MNO A;  1LTI D;  2ZM6 H;  5J1Z A;  3K5L A;  4APV A;  3VYS A;  2A6E D;  1TY0 A;  4K6L A;  3NTK A;  2F0T A;  5ELN A;  4MTN A;  3OW2 A;  3PIO A;  3T13 A;  2CWP A;  3CXC A;  4B3M H;  1A8V A;  4F87 A;  3I4M B;  4C3I B;  4XX0 B;  3R23 A;  2E76 C;  3EN2 A;  2F0F A;  4LF8 Q;  2NU9 B;  1K8O A;  1JJC B;  2IX0 A;  1WTV A;  5I2Y A;  1HNX H;  1TS5 A;  4IUV A;  3GTM H;  4YCV A;  1I7N A;  2WKC A;  4ED0 A;  3S17 H;  2BDO A;  3H4D A;  4UY8 C;  2PCF B;  1R9T H;  4JBJ A;  3H0G A;  4JYA Q;  2B2Y C;  2UXC H;  2DZD A;  2RSN A;  3HOW G;  4UFZ A;  4B3S L;  4DV5 Q;  3RBE A;  3T16 A;  3HKZ B;  1JXL A;  3RNU A;  1K73 C;  2RHQ B;  1N32 H;  1EU3 A;  2PW7 A;  3MA2 B;  1N36 H;  2BA1 A;  4UCT A;  4HJ7 A;  3UE0 A;  2EY2 A;  2XIG A;  3BQ0 A;  4A3G H;  4XYL B;  4B9X A;  3KAK A;  5KFU A;  2PNH A;  1IHZ A;  4J0M A;  2PMZ A;  1Q90 A;  1DOM A;  3RZD B;  1STA A;  5FLM G;  4MHE A;  1W2B A;  3MR6 A;  1KXL A;  5AJ3 L;  4Q0Y A;  2W8K A;  1EL0 A;  2TMP A;  1KAB A;  2KHS A;  2NN6 G;  2AQ2 B;  5CAE B;  3S1M B;  1CZG A;  4JI5 Q;  4A3B B;  4CKB A;  4A3D H;  2GPS A;  1RJT A;  2E2I H;  4X62 Q;  3PIP A;  1N8R C;  1HR0 Q;  2G9D A;  4XTC S;  1Q81 C;  4O2A F;  2OH2 A;  2F0L A;  3ORQ A;  1KHI A;  1SXT A;  2KCM A;  4H7B A;  2R8I A;  2Z6K A;  2Y0S B;  5KEE A;  2NVT H;  3M4O B;  1D5M C;  1D6E C;  1QNU A;  4HTH A;  1PHJ A;  2CQY A;  2GPW A;  3QO2 A;  5DG7 A;  3GTJ A;  3M9N B;  1S5B D;  2Z0S A;  4ALP A;  3S16 H;  1LT4 D;  3UDF A;  2EYM A;  3T1Y L;  2NVQ B;  3NTH A;  1SBB B;  4GKJ L;  2RHS B;  1I6U A;  3GTP H;  3K81 C;  1OO9 B;  2DY8 A;  4N9P A;  1BO0 A;  5I9P A;  2AU0 A;  2RGR A;  4DR6 Q;  4Y52 H;  1B44 D;  5T14 A;  4UCO A;  3PV0 A;  4ID6 A;  1S97 A;  2NVX A;  2AWO A;  2FMC A;  5I4D A;  3K7A H;  4UP8 A;  4ZUI A;  2UUA Q;  4H44 C;  4FDB A;  3B6Y A;  5FLX W;  5D1P A;  1STE A;  1C8C A;  4RHS A;  1F9S A;  2EXZ A;  3NWT A;  2EXD A;  3F8N A;  3BA8 A;  3RN5 A;  4X62 H;  2KUM A;  2E75 C;  1IW7 D;  1D5X C;  3MWY W;  3ETH A;  1HR0 H;  2B29 A;  1VF7 A;  4KHP L;  4IAJ A;  1VAJ A;  3MXG A;  1SRO A;  3DWQ A;  5GQO A;  4PZ8 A;  2B63 B;  4GKK Q;  1SCU B;  3PUY A;  1AE3 A;  1EY9 A;  1NY4 A;  2M2L A;  2DIK A;  3C0F B;  4O4H F;  5EQ0 A;  3MWE A;  1BF4 A;  5ISR A;  3AQQ A;  2MPM A;  1ZQ7 A;  3N42 B;  4ED1 A;  5KX5 F;  3VPC A;  3STB D;  2IY5 B;  1ENA A;  3PN1 A;  2L11 A;  4YJ3 F;  1NMF A;  1W6K A;  1EY5 A;  4P74 A;  3A7L A;  1K3R A;  3AFQ A;  4F50 A;  3KFU A;  3I4M H;  4DR6 H;  4C3I H;  1Z47 A;  1F9Q A;  2H4O A;  2C2E A;  4LNQ A;  4HIO A;  3BJU A;  3GO5 A;  2IT1 A;  2JA9 A;  4A3M G;  3RAQ A;  3CW2 C;  3NSW A;  4OWX B;  1TWG B;  4BA2 I;  4YHH L;  4I7Z C;  3ICE A;  5KFD A;  3HOX G;  4MIU A;  3D0F A;  3JSL A;  3GP7 A;  4DV4 H;  3I73 A;  2WP8 J;  4B3R Q;  3GTQ B;  2ZJQ A;  1RCV D;  4IUT A;  4ZK9 B;  1H9S B;  1A63 A;  1BOS A;  3T5H A;  2PW5 A;  4EGV A;  1DCZ A;  3RLF A;  3HOZ G;  4GKK H;  5J2T F;  4U68 A;  3J80 i;  4B08 A;  1OXU A;  2R8G A;  4O3S A;  4L6T B;  3AB9 A;  3MXN A;  2XWJ B;  1Z7T A;  3QZ8 A;  4NB3 A;  3H0G G;  1QVG A;  3HOW B;  1XMQ L;  4DV3 L;  2A74 C;  3RZD H;  5EWF A;  3SEB A;  2A6E C;  3M4Y A;  3U9T A;  4MV1 A;  5LMN W;  3KJO A;  3GTG B;  5KFQ A;  3F2C A;  4CDD C;  1E0B A;  4XQJ A;  3OIP A;  3GTK B;  3S1M H;  2NU7 B;  1F9P A;  1KLU D;  3NUC A;  4HAE A;  3CCE A;  4A3B H;  5IYD H;  2UUB L;  2NZO A;  1X9N A;  1F2L A;  3CCR A;  1P8L A;  2JE6 I;  4UDU C;  5C0X G;  4RGT A;  1K83 A;  1NSN S;  4TVA B;  5KFE A;  3M4O H;  2JA6 A;  5F9L A;  1VQE A;  3QB3 A;  1Q82 C;  2OWO A;  4C5B A;  4B3R H;  2LXJ A;  1S0N A;  3CU7 A;  3QOL A;  3CAM A;  1JDE A;  1K1S A;  2NVQ H;  3UFX B;  3CHB D;  2F0J A;  1GO3 E;  4C3J G;  2W6M A;  2F0N A;  1BKB A;  1KJ9 A;  1GGO A;  2F0I A;  3BDC A; 
#chains in the Genus database with same CATH homology
 5C0X J;  2IHE A;  2OCE A;  2Q2U A;  4HID A;  4NXN L;  2D0P A;  4DUZ L;  2UU9 Q;  4A3I H;  3TS2 A;  1G29 1;  5K36 G;  1EOV A;  2F3I A;  1FJG Q;  1A62 A;  2N3S A;  4POG A;  4R4O A;  1TXY A;  2R93 G;  2K50 A;  1B8A A;  1X55 A;  2KHI A;  4IJL A;  1I6H H;  4LFC Q;  4DV6 Q;  5E7N A;  5JJK A;  5ELO A;  1E22 A;  2WAQ G;  3RLO A;  2NVY H;  2UXD Q;  4UPA A;  2Q2H A;  4POF A;  5M5X H;  5IYB H;  5M3F H;  4DR7 L;  1V9P A;  4DV7 Q;  4DR5 Q;  1XNR L;  2K4K A;  1AE2 A;  4PMW A;  5IYD H;  2N8N A;  4QL5 A;  1H95 A;  5IP9 H;  5JEA G;  3BU2 A;  3CMA A;  1UE5 A;  2HQL A;  2PI2 A;  2B63 H;  3CCM A;  2A19 A;  4DKA C;  1IBK L;  1SMX A;  2WFW A;  1VQI A;  4P73 A;  3F1Z A;  1VQ9 A;  3PO2 H;  4B3R L;  2YYZ A;  1VQ7 A;  4K0K L;  1Y1V H;  1ASY A;  2PMZ E;  2VS1 A;  4DR3 L;  3HOY H;  4A3F G;  3U4Z A;  1NTG A;  3UDG A;  4A3G G;  3MEF A;  2AKW B;  2VQF Q;  1Q1E A;  2R7F A;  4LF9 Q;  5C0X I;  4HJ8 A;  4A3M H;  3CPW A;  1X3F A;  3RN2 A;  5LMN Q;  3CD6 A;  1YZ6 A;  4JI3 Q;  3PF5 A;  1HNW Q;  1UE1 A;  5IWA Q;  1SFO H;  1B7Y B;  1Q8K A;  5JEA J;  2ZJR A;  1E3P A;  5LMU L;  1JJG A;  2DUD A;  1TWG H;  2PQA B;  5IP7 G;  4WJ4 A;  4A3D G;  5BR8 L;  2Q2T A;  1SRU A;  1Q12 A;  4YCU A;  4JI7 L;  4IPH A;  1FVI A;  1J6Q A;  1HZB A;  1WCM G;  1CSQ A;  1CKO A;  5C4X H;  5IY0 A;  1PA6 A;  4JCV E;  1XNQ Q;  3GTQ H;  1KIX A;  3KJP A;  1JE5 A;  4J15 A;  4QJF A;  4IJH A;  2AHO B;  1LYL A;  4GS3 A;  3I4N G;  4LF5 Q;  1EWI A;  2EQS A;  4BBS G;  4JG2 A;  1D8L A;  2KHJ A;  4RG1 A;  2VUM G;  3S24 A;  1LM0 A;  4B3M Q;  1FL0 A;  1KRS A;  1YBY A;  2JA5 H;  4BY7 H;  4A3J G;  3HOW H;  1KRT A;  4OO1 G;  3EBE A;  4GLV B;  2YV5 A;  2MO0 A;  4AYB E;  3CME A;  1HNX Q;  4IFD J;  1XPU A;  3A5U A;  3ER0 A;  4JI1 L;  3GTG H;  1SR3 A;  1GKH A;  1QZG A;  2K14 A;  1VQ8 A;  4L5S A;  3H3V H;  2R7Z G;  1I94 Q;  3GTK H;  3CCQ A;  3H15 A;  2UXC Q;  2XGT A;  1IYJ B;  3WWV A;  4MZ9 A;  4DR2 L;  1X56 A;  2R7D A;  1N34 Q;  2KBN A;  1XPR A;  2JA8 H;  3DLL A;  2UU9 L;  2E2J H;  4LF6 Q;  2K5N A;  1VQO A;  2F4V Q;  4L5T A;  1N32 Q;  1FJG L;  2Q2I A;  2KCT A;  3U58 A;  3AFP A;  5FLM H;  2Y0S E;  2H5X A;  4P75 A;  3J81 c;  4LF4 Q;  4LFC L;  4TQU S;  4DV6 L;  1PYS B;  1XMO Q;  5FJ8 G;  3K0X A;  4L5R C;  2UXD L;  4DK3 C;  3NEL A;  1GVP A;  1YI2 A;  4GNX A;  3BZK A;  1L1O B;  4DV7 L;  2QEX A;  4DR5 L;  1IBM Q;  4GN3 B;  1IBL Q;  4JBW A;  5C44 H;  4A75 A;  3OTO Q;  1QVC A;  2JA7 H;  2FXQ A;  2I5M X;  1LUZ A;  1XJV A;  1VQM A;  4LF7 Q;  3L2P A;  3T1H Q;  1BBW A;  2D0O A;  4A4I A;  3A5Z B;  1E24 A;  1X3G A;  4DV1 Q;  1VQL A;  2JA6 G;  1VQ6 A;  4LFB Q;  2N78 A;  4YWM A;  2JQO A;  4YY3 Q;  3KF6 A;  1VQG A;  3I4O A;  1PH6 A;  3I4M G;  4PG3 A;  2VQF L;  4UP9 A;  4OWT B;  4LF9 L;  2ES2 A;  1BVS A;  1HZC A;  3PUW A;  1Y14 B;  1PH5 A;  1IL2 A;  2JEA I;  4OON A;  2R92 G;  3NEN A;  1QVF A;  4EX5 A;  5LMN L;  4B3T Q;  1VS0 A;  3M85 A;  1OTC A;  3ULP A;  2CFM A;  4JI3 L;  4JOI A;  2ZTD A;  3UDI A;  4HIK A;  1HNW L;  1UE7 A;  5IWA L;  2UXB Q;  2A8V A;  4OO1 I;  1CSP A;  4O2D A;  1PH4 A;  2ZJP A;  5C4J H;  5M3M G;  1BBU A;  4JC0 A;  3S1R H;  1VQD A;  1C7Y A;  3OYY A;  3Q8D A;  2K5H A;  2A1A A;  1Z9F A;  2CKZ B;  3E9H A;  3TQY A;  1VQF A;  3I56 A;  1XNQ L;  1PYB A;  3TRE A;  3M4Q A;  3J81 j;  1SN8 A;  1MJC A;  4AH6 A;  1EYG A;  4A3L H;  4LF5 L;  1K0R A;  4LUO A;  1IXR A;  1WYD A;  4WJ3 M;  4JOI C;  4B3M L;  1WFQ A;  4AYB G;  4O0A A;  3HOV H;  3FKI G;  1S40 A;  2ID0 A;  1L1O C;  4XIG S;  1HNX L;  3PO3 H;  1WCM H;  2HIV A;  4YWK A;  1CKM A;  3A74 A;  2WB1 E;  3F2D A;  3HFZ B;  5IYD G;  2N49 A;  3JAM c;  3J81 i;  4ME3 A;  3FHW A;  1GM5 A;  4H02 A;  1J5E Q;  4R1J A;  4A76 A;  3RZO H;  4A93 H;  4DV0 Q;  1I94 L;  1OXV A;  3U4V A;  4BBR H;  3TEH B;  3M7N A;  3HKS A;  4DR4 Q;  1N34 L;  2ZTE A;  5M5W H;  2UXC L;  1UE6 A;  1VQK A;  4JBK A;  4OWW B;  1CKN A;  4BXX H;  3K8A A;  2Y0S G;  4LF6 L;  2VUM H;  5GAH C;  3K7U C;  1I5F A;  2F4V L;  1NJI C;  1YVC A;  2HIX A;  3S1Q H;  1IZ6 A;  1N32 L;  2JEB I;  3W1B A;  4GN4 B;  4LF4 L;  4NPS A;  1Y1W H;  4B3S Q;  1U0L A;  1Q86 C;  3CCU A;  1SLJ A;  4C3H H;  1XMO L;  4GLA C;  4JV5 Q;  2GVA A;  3W5O A;  3HOX H;  2K5V A;  3JC6 6;  2E5L Q;  3HOU H;  4A3C G;  2VQE Q;  2Z6K C;  3G48 A;  1IBM L;  4P71 A;  5GAE C;  2E2H H;  2R7Z H;  4RMF A;  3CP0 A;  1IBL L;  4IFD G;  1Q46 A;  1C9O A;  3E9I A;  4JBM A;  3CC7 A;  1E1T A;  3OTO L;  4A3K G;  4GN5 A;  2OQ0 A;  4BY1 H;  3S15 H;  3FP9 A;  2YTX A;  4X65 Q;  3HOZ H;  1TWF H;  2MQH A;  5IYC H;  2UUC Q;  2ZM6 Q;  1YHA A;  3HKZ E;  4QY7 A;  3K80 C;  4A3I G;  1JMC A;  4R4I A;  4LF7 L;  4DV4 Q;  3T1H L;  3PCO B;  1JJ2 A;  2MNA A;  3CC2 A;  4DV1 L;  1QUQ B;  4LFB L;  3G6E A;  1AH9 A;  1XTD A;  3H0G H;  3KDF B;  5HY6 A;  3CCL A;  4YY3 L;  5AJ3 Q;  4EQ5 A;  1I50 H;  4IOA A;  1YJ9 A;  4YWL A;  5IYB G;  1O7I A;  3AYH B;  1VQ5 A;  4R4Q A;  3SGI A;  2LSS A;  4R4T A;  1PV4 A;  4R4C A;  4BA1 I;  3RLN A;  2PI2 E;  2YTV A;  4GOP B;  1S72 A;  4B3T L;  2CCZ A;  5IP9 G;  3GDE A;  1FGU A;  3MXN B;  1RL2 A;  4DUY Q;  4JI8 Q;  1PFS A;  1HR0 W;  2UXB L;  4QQB X;  5C3E H;  5HGQ A;  1UWV A;  2E8G A;  2VY3 A;  3I2Z A;  2I0Q A;  1D7Q A;  1Y1V G;  1PVO A;  2PQA A;  3HOY G;  5GAD C;  1LTL A;  3T1Y Q;  2BA0 A;  2V1C C;  4PZ7 A;  3VDY A;  1TWH H;  3J7A 5;  1TWC H;  1N36 Q;  4GKJ Q;  4HJ5 A;  3CQZ H;  3L7Z C;  3GTL H;  3PUV A;  4DK6 C;  5JJI A;  4QIW E;  1EUJ A;  3JAM i;  1V43 A;  1OXS C;  4C3J H;  3D31 A;  4MNO A;  4X6A H;  1EIF A;  4APV A;  2B3G A;  2YU9 H;  3PGZ A;  2WB1 G;  5M3M H;  5ELN A;  2IHF A;  2MFI A;  4MTN A;  1L2F A;  3ZJY C;  3I7F A;  3OW2 A;  2R6G A;  3GTJ H;  2QGQ A;  3PIO A;  2CWP A;  3CXC A;  4IPD A;  1A8V A;  1NE3 A;  4GOP A;  1L0W A;  1X3E A;  3F2B A;  2R93 H;  2K75 A;  1J5E L;  3EN2 A;  4IFD I;  5C4X G;  4LF8 Q;  4DV0 L;  3U50 C;  5EAY A;  1JJC B;  4A3E G;  2IX0 A;  1YJW A;  4DR4 L;  3L0O A;  2BH8 A;  3GTM H;  4KHP Q;  4YCV A;  4JI6 Q;  3S17 H;  1HNZ Q;  4UY8 C;  1R9T H;  1UEB A;  4JBJ A;  4JYA Q;  4X64 Q;  2JA5 G;  2NVX H;  4BY7 G;  2HT1 A;  3HOW G;  3S2D H;  4B3S L;  2GN5 A;  4DV5 Q;  1YIJ A;  4DV2 Q;  1KAW A;  3UDX A;  4JV5 L;  1T9H A;  3PUZ A;  3RNU A;  1OXX K;  1V1Q A;  2RHQ B;  1K73 C;  2E5L L;  3PSI A;  5M5Y H;  4LW1 A;  2LXK A;  2VQE L;  4GOP C;  1RIP A;  2BA1 A;  4HJ7 A;  4AQY Q;  3F8T A;  3UE0 A;  1K8A C;  1KL9 A;  1L1O A;  3A0J A;  2C35 B;  4A3F H;  4A3G H;  1YNX A;  3HKZ G;  1K9M C;  2PNH A;  2HHH Q;  4LUV A;  4X65 L;  1N33 Q;  3CCS A;  1KD1 C;  1U5K A;  3IRB A;  4LFA Q;  2UUC L;  4JI4 Q;  2ZM6 L;  1PH2 A;  2JA8 G;  4DV4 L;  5FLM G;  1HJP A;  1W2B A;  1KC8 C;  3AEV A;  1KXL A;  5AJ3 L;  4YHH Q;  4HIM A;  2NN6 G;  3PF4 A;  4JI5 Q;  5IP7 H;  4L5Q A;  4JI2 Q;  4A3D H;  2E2I H;  5DLQ E;  4X62 Q;  3PIP A;  4A3K H;  2EIF A;  1N8R C;  1HR0 Q;  3M9B A;  4XTC S;  5C44 G;  1Q81 C;  2YTY A;  1P16 A;  1KHI A;  2KCM A;  2JA7 G;  3TRZ A;  2Z6K A;  4A3B G;  2NVT H;  1YHB A;  4DUY L;  4JI8 L;  4NXM Q;  3S2H H;  1PHJ A;  3CC4 A;  1X54 A;  4IOC A;  4OX9 Q;  1VQC A;  3I4N H;  1G6P A;  4ALP A;  2Z0S A;  2GVB A;  4DAM A;  4DV3 Q;  1XMQ Q;  3S16 H;  4BBS H;  3UDF A;  1VQ4 A;  3T1Y L;  4A3J H;  1MIU A;  1N36 L;  2KEN A;  1XPO A;  4Y7N H;  4GKJ L;  2RHS B;  5IT9 c;  3J80 c;  1WJJ A;  3GTP H;  1PH3 A;  3K81 C;  1E7Z A;  2OQK A;  1SE8 A;  5GRO A;  1M1K C;  2AWN A;  4DR6 Q;  4Y52 H;  1JT8 A;  2ASB A;  3M4P A;  2UUB Q;  1PH1 A;  3PV0 A;  1E1O A;  3CPF A;  2AWO A;  4X66 Q;  3KLW A;  3K7A H;  2K52 A;  4UP8 A;  2QA4 A;  1Q7Y C;  2UUA Q;  4FDB A;  3B6Y A;  1PH7 A;  1VQN A;  3I55 A;  1MKH A;  1X65 A;  2EXD A;  4IO9 A;  1B70 B;  3RN5 A;  3GD7 A;  4AIM A;  4LF8 L;  3J7Z C;  5J3B A;  3H3V I;  1VCI A;  1NBW A;  5FJ8 H;  2B29 A;  2JJQ A;  4KHP L;  1S3O A;  1I3Q H;  2RF4 A;  4A3L G;  3W1G A;  2MO1 A;  1YHQ A;  4JI6 L;  4GKK Q;  1SRO A;  5M3F G;  5GQO A;  4PZ8 A;  5GAG C;  1HNZ L;  1C0A A;  3PUY A;  4P72 A;  1AE3 A;  4DR1 Q;  4JI0 Q;  1NY4 A;  1VQH A;  4QGU A;  4JYA L;  4X64 L;  3HOV G;  2CWA A;  2DGY A;  2IX1 A;  3ULL A;  1K83 H;  2ALY B;  4UP7 A;  4DV5 L;  4DV2 L;  1KQS A;  4NXN Q;  4DUZ Q;  3AQQ A;  3PO3 G;  2B63 G;  2NN6 I;  3UE1 A;  1HH2 P;  1EFW A;  3STB D;  2OTL A;  2IY5 B;  2JA6 H;  4AQY L;  1NMF A;  4A3E H;  1WI5 A;  5FLX c;  3KYH C;  1JB7 A;  1EIY B;  3PO2 G;  4A93 G;  4P74 A;  4GNX B;  3S1N H;  1K3R A;  2NZH A;  3AFQ A;  3ULJ A;  4BBR G;  1PH9 A;  2HHH L;  3I4M H;  4C2M H;  4C3I H;  3KFU A;  3ERS X;  1Z47 A;  4DR7 Q;  1Q1B A;  1N33 L;  1X6O A;  2ZTC A;  1GD7 A;  4LFA L;  4JI4 L;  4BXX G;  2WAQ E;  4PZ6 A;  4DAY B;  5H1S E;  3BJU A;  4HIO A;  4LNQ A;  3GO5 A;  1XNR Q;  3CF5 A;  2R92 H;  2VW9 A;  5JJL A;  2IT1 A;  2JA9 A;  4A3M G;  2XTI A;  4HJ9 A;  1VQP A;  3CW2 C;  1YJN A;  4OWX B;  4BA2 I;  1Y1W G;  2ATW A;  4YHH L;  1QUQ A;  1TWA H;  3ICE A;  3G4S A;  3KDF A;  3HOX G;  1IBK Q;  3HOU G;  3D0F A;  3TS0 A;  3STB C;  4JI5 L;  3KF6 B;  4JI2 L;  1HZ9 A;  2WP8 J;  4X62 L;  3NEM A;  3DM3 A;  2ZJQ A;  4B3R Q;  4K0K Q;  1HR0 L;  4KI0 A;  4DR3 Q;  1OXT A;  3KOJ A;  3LGJ A;  5IE8 A;  2VNU D;  1A63 A;  4BY1 G;  3RLF A;  3HOZ G;  3S14 H;  2VL6 A;  4DPG A;  5IYC G;  3J80 i;  1OXU A;  2CQO A;  4NXM L;  4OX9 L;  2AMC B;  3E0E A;  1ASZ A;  4NB3 A;  3H0G G;  4OXP A;  3CCV A;  1XMQ L;  1QVG A;  4DV3 L;  2VZA A;  1VQJ A;  3RZD H;  1W3S A;  3BZC A;  3PUX A;  3FKI H;  5LMU Q;  2I5H A;  5LMN W;  3KJO A;  1A0I A;  4YCW A;  5BR8 Q;  1N9W A;  3F2C A;  4JI7 Q;  4LUZ A;  3S1M H;  4DR6 L;  3CCE A;  3G71 A;  4A3B H;  2D62 A;  2UUB L;  2NZO A;  1NMG A;  2L15 A;  3CCR A;  1X9N A;  1P8L A;  2JE6 I;  5C0X G;  4X66 L;  5C3E G;  2F52 A;  3KF8 B;  1G51 A;  2UUA L;  4TVA B;  3M4O H;  4HJA A;  1K8G A;  1PH8 A;  4LWC A;  1VQE A;  1WOC A;  1HZA A;  2JK8 A;  4GNX C;  1YIT A;  4DNI A;  1QZH A;  1Q82 C;  2OWO A;  2LXJ A;  4IPG A;  1VQA A;  1M90 C;  3GTO H;  2OTJ A;  3CAM A;  1EQQ A;  1EQR A;  3NBH B;  2NVQ H;  4A3C H;  1DGS A;  4KLK A;  4JI1 Q;  1GO3 E;  3RR5 A;  4GKK L;  4GLX A;  2I5L X;  4IPC A;  1BKB A;  1MJE A;  4KHZ A;  4DR1 L;  4JI0 L;  2BH2 A;  3M3Y H;  1CKN B;  1VQB A;  2RCN A;  3EIV A;  1CUK A;  3CCJ A;  4DR2 Q;  1YEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...