5C3EG

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Transferase/dna/rna
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c3eG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c3eG01
2V1CC 1VS0A 3A0JA 2BH8A 3FKIG 4APVA 1PH8A 1VCIA 4NPSA 1DGSA 1XPOA 4B3TL 4LFBL 4PZ7A 4IOCA 3J81j 3ULJA 4DV7Q 1NJIC 4LUVA 4LF4L 2PMZE 3E0EA 3TREA 4HJ8A 5EAYA 1MJCA 5HY6A 1NE3A 4DR4L 5K36G 2B63G 2D62A 4BXXH 4A93H 3CPWA 3S2DH 2R93H 4UP8A 2UUCQ 4IO9A 4LF5Q 4KI0A 4JI2L 5IT9c 3PIOA 5J3BA 4B3RQ 4L5QA 1N8RC 1KHIA 1I50H 3E9HA 1B70B 2I0QA 1JMCA 4R1JA 4KHPL 2UUAL 2UUBQ 1QUQA 5IP7H 3LGJA 4A3FH 3M9BA 4JI0L 1PH7A 2R6GA 4UP7A 4A3IG 4IOAA 2RCNA 4TQUS 1HH2P 3EIVA 3RLNA 1N34L 4LF7L 1Z47A 4DK6C 3PGZA 3K81C 4DAMA 3KJPA 1Q82C 3F8TA 5IP9H 4YY3L 4IPDA 4A3DH 2EIFA 3CCRA 1CKNA 2DGYA 1EIYB 4LF6Q 4OO1G 2GN5A 1HNWQ 1X3FA 2VY3A 3JC66 3L7ZC 1N9WA 3KLWA 3FKIH 3CMEA 1IBKQ 3S16H 2CQOA 1V1QA 3ICEA 1W3SA 4BA1I 3CD6A 1Q86C 3Q8DA 3S14H 1YHQA 1W2BA 2JA5G 1XNQQ 1PH4A 2B3GA 1E1OA 4NXNQ 2B63H 1S3OA 1PVOA 5M3MG 4X62Q 1Y14B 4A3MG 4KLKA 2YTXA 3G48A 1AE3A 1WYDA 4YWKA 2UUCL 4DV0L 3DLLA 4DR2Q 1X9NA 4LF5L 2IX0A 2OQ0A 1K3RA 2K50A 4X65Q 4ALPA 4QQBX 3CP0A 4HIMA 1I94Q 1L1OB 3TS0A 4JI5L 1J5EQ 1OXTA 4PZ6A 2ASBA 3PF4A 2UUBL 5LMNQ 3HOXG 3S1QH 5M5YH 2VS1A 2E2IH 3I56A 4DV3L 2VL6A 1YHBA 4A3IH 1VQHA 4TVAB 3BU2A 3KF8B 4DAYB 2QA4A 2EQSA 4JI6L 2A19A 2VZAA 1A62A 1PFSA 1NBWA 3UDIA 1HR0W 2MO0A 4JI7L 1HNWL 3FP9A 5JEAG 4GLXA 2GVBA 3PO2G 3K8AA 2K5VA 4A4IA 2JA6G 1UE7A 1IBKL 4K0KQ 1RL2A 3H3VI 1T9HA 3F2DA 3CW2C 1PYSB 2VW9A 4B3SQ 1VQ6A 4BY7G 4Y52H 2Q2HA 3HOVH 3RLFA 2YYZA 1P16A 4JI4Q 1K9MC 3U4VA 4GOPB 1K73C 1KAWA 2WFWA 1YJ9A 4X62L 1PH6A 1IYJB 1WFQA 1VQOA 5JJKA 4A3LG 5M3MH 1SRUA 2ALYB 1E1TA 3IRBA 4YWMA 3F2CA 4DR2L 1YITA 1PH2A 1SMXA 3EN2A 4HIDA 1B7YB 4EX5A 5HGQA 4X65L 3M85A 5GAEC 1I94L 4LF4Q 4LUZA 1J5EL 1TXYA 1B8AA 3OTOQ 5C0XG 5LMNL 3CCVA 4A3KG 3SGIA 5FJ8G 3RN5A 1GM5A 2VUMG 1UWVA 3HOXH 1Q7YC 2R92G 1EIFA 4DR1L 3H3VH 1PYBA 4MTNA 1U0LA 3AQQA 3HOUH 4DR6Q 1KIXA 3AFPA 4JI2Q 3STBD 3CC4A 4JI1Q 2BH2A 4EQ5A 2MQHA 4X64Q 2K52A 2ZTCA 1YHAA 1Y1VH 1N36L 4HIKA 2JA9A 2NVXH 2VQEL 1XTDA 2Q2TA 1OXXK 4K0KL 3S24A 5C0XI 4A3BG 3TQYA 1L1OC 2GVAA 4JI0Q 4B3SL 1PV4A 2C35B 4DUYQ 1CKOA 3HKZE 2HHHQ 1EYGA 4JI4L 4BY7H 4O2DA 4DNIA 2VQFQ 1XPUA 1KRTA 4B3ML 3T1YL 3H15A 2UXCQ 3S1MH 3M4PA 1QVFA 4DR7Q 4WJ3M 1TWHH 4DUZL 2XTIA 4A3LH 3TS2A 3OYYA 1EQQA 2MFIA 3UE0A 3BZKA 2NVYH 4PZ8A 3A74A 1VQGA 1EFWA 4QJFA 1GKHA 4GN3B 1OXVA 2IT1A 5DLQE 3OTOL 1A0IA 4DV6Q 1JE5A 3GD7A 1GO3E 2JA7G 2E5LQ 2D0OA 2ATWA 2YTYA 1A63A 1CSPA 4A3KH 3B6YA 4GNXB 3PO3G 2QEXA 2R92H 5C3EH 5JJIA 1Q12A 4L5TA 2CCZA 4DR6L 4X66Q 1M90C 2NVQH 4AYBE 4DV0Q 1D7QA 4JI1L 4GLAC 3CAMA 4X64L 5C44G 3RN2A 1NMGA 4JI5Q 2AWNA 2K75A 4HJAA 2KCTA 4POFA 2L15A 2IX1A 4L5RC 3D0FA 4LF8Q 3HKZG 4DUYL 5H1SE 1X56A 1LTLA 2B29A 2WP8J 1Q1BA 3DM3A 4DV3Q 1KC8C 2HHHL 4X6AH 2JEBI 4BBRG 2Q2UA 3GTQH 3PF5A 2NN6G 1SFOH 1IBLQ 1K83H 1SE8A 4AQYL 3W1GA 4JI6Q 3H0GG 4OXPA 1Q46A 1VQBA 1HZ9A 1L1OA 2AMCB 1VQ4A 1ASZA 1R9TH 1C0AA 4DR7L 1HZBA 3I55A 2LXKA 4JI7Q 1L2FA 5IYCG 2VNUD 2I5HA 4XIGS 1QVCA 1MJEA 1VQDA 1BVSA 1EUJA 4IFDG 5ELOA 4QL5A 3BJUA 5IWAQ 4JCVE 3HFZB 1AE2A 1X55A 1I6HH 3M7NA 2UXCL 4JC0A 4DV6L 1QVGA 2E5LL 2JA7H 1VQKA 5M3FG 5C4XG 1IL2A 4GN5A 1TWFH 3KF6B 2Z0SA 1P8LA 2CFMA 2EXDA 1GD7A 3PUVA 2JA8G 4AYBG 1YZ6A 4X66L 4OO1I 3ULPA 2CKZB 3I4NG 3CCLA 3GTPH 1N32L 2AHOB 2RHQB 2RHSB 2JJQA 1WOCA 5FLXc 4IFDI 2ES2A 2AWOA 3U50C 5C44H 5C0XJ 3KOJA 1VQ5A 1KXLA 2ZJQA 2A8VA 5M5WH 4LF8L 4DR1Q 3W5OA 3PUZA 1YJWA 3BZCA 2K4KA 1C7YA 1IXRA 1SN8A 3RLOA 3J81i 1MKHA 1ASYA 3UDXA 1XPRA 1IBLL 1N33L 1QUQB 4UPAA 4GNXC 3CC2A 4BY1G 3CCUA 4DR3Q 2F52A 3F2BA 3H0GH 1JT8A 4YWLA 2IY5B 5FLMG 1N36Q 3HOYG 5IYDG 3ER0A 2VQEQ 3PUXA 1HR0Q 4L5SA 3MXNB 5IYCH 3I7FA 1LYLA 1VQPA 3PUYA 5BR8Q 1QZHA 4DV1Q 5IWAL 4LUOA 5IYBG 1K0RA 1JJ2A 3F1ZA 3G71A 1X3EA 4IPCA 3CC7A 2PQAB 1PH3A 1PH9A 4JBKA 1NTGA 4AH6A 1PH5A 2JA5H 5E7NA 4B3MQ 1BBUA 3T1YQ 1BBWA 4LF9Q 4LW1A 1V43A 4YCUA 4DK3C 1M1KC 5M3FH 2H5XA 2ZJRA 4A3MH 3TEHB 4DUZQ 3GTKH 1A8VA 3K80C 2Z6KC 4MZ9A 1IBML 2UXDQ 4JBWA 4NB3A 2FXQA 3U4ZA 4FDBA 4R4OA 3I2ZA 1Q1EA 3M4QA 1XMOQ 1KQSA 4IJHA 2F4VL 3HOWG 2YU9H 1D8LA 2MNAA 1G51A 1G291 5GQOA 2JEAI 1FJGQ 4LFAQ 1TWCH 3ZJYC 4DR3L 2LXJA 4BY1H 2WAQE 2NZHA 3L0OA 3CCQA 3KDFB 1RIPA 3RR5A 3CQZH 2ZJPA 1HR0L 4A3GG 5JJLA 5FLMH 4GN4B 4P71A 3J7A5 2KBNA 5IYDH 1UE6A 4GNXA 3PO2H 2R7ZG 5BR8L 4GKJQ 1E22A 1PH1A 5IY0A 4DV1L 2JA6H 4A75A 1NMFA 1UE1A 1Y1WG 2K5NA 1OTCA 3WWVA 4BXXG 2N3SA 4A93G 1CUKA 4P75A 4C3HH 5AJ3L 4DV4Q 3ERSX 4AQYQ 3E9IA 1LUZA 3CCEA 4LF9L 1PHJA 2K5HA 4HJ9A 3M3YH 4OWTB 1VQFA 1X6OA 4KHZA 4P73A 4JI3Q 3RZDH 1NY4A 3S1RH 4J15A 4IFDJ 1J6QA 2OCEA 1VQ8A 3NELA 1S40A 1JJGA 4LNQA 1Q81C 4HJ7A 3AFQA 5IP7G 2E2HH 1LM0A 2N8NA 3HOZG 2HIXA 1V9PA 3EBEA 1YVCA 5GROA 1SR3A 2Z6KA 5FJ8H 1WCMG 1XMOL 2E2JH 2VUMH 3TRZA 4MNOA 4HIOA 5IP9G 1XMQL 4H02A 3GTLH 4GOPC 1Z9FA 3CPFA 1KRSA 4LFAL 2PNHA 1FJGL 3GTOH 1N32Q 2WAQG 4BA2I 2KCMA 5GAGC 2D0PA 2PI2E 3T1HQ 1I3QH 1FGUA 4A3CG 1GVPA 1HNZQ 4A3GH 4UY8C 1YIJA 3KF6A 4GKJL 4IJLA 3K0XA 5GADC 1HNXQ 4A3BH 2R7ZH 3KJOA 2AKWB 2NVTH 4PMWA 1N33Q 1Y1WH 1VQLA 2UXDL 1I5FA 3CCMA 4DV4L 2QGQA 4RMFA 2UU9Q 4DV2L 2ZM6Q 2OQKA 5JEAJ 2N78A 1WJJA 4AIMA 3D31A 2DUDA 4JI3L 3ULLA 2I5MX 3S17H 3MEFA 3J81c 4JYAQ 3A5UA 1XNRQ 3NEMA 2YTVA 1VQMA 2I5LX 1PA6A 1QZGA 3I4MG 2NN6I 3HKSA 4RG1A 3HOZH 4LWCA 4YHHQ 1EWIA 1CKMA 3UDFA 4A3JG 3PO3H 1SLJA 1WCMH 4POGA 4JV5Q 4Y7NH 4HJ5A 4YCWA 2CWAA 4DV5L 1VQEA 3GTMH 1IBMQ 4JBJA 2F3IA 2VQFL 1VQIA 2PQAA 4C2MH 3KFUA 1WI5A 3T1HL 1YEZA 1YBYA 4GOPA 1HNZL 1VQAA 3GO5A 4DV7L 3S2HH 5ELNA 3HOVG 3I4OA 4A3CH 1XJVA 2YV5A 1HNXL 3PIPA 2XGTA 4R4CA 4DPGA 2F4VQ 1EQRA 4BBSG 4OWXB 4JI8Q 1G6PA 1AH9A 4BBRH 4OWWB 3K7UC 2OTLA 2UU9L 2ZM6L 1CSQA 2JE6I 2JQOA 4ME3A 5M5XH 4DKAC 3UE1A 3S15H 5IE8A 4QGUA 1X65A 1E3PA 4OONA 3G4SA 1IZ6A 3CF5A 4YCVA 1X3GA 4NXMQ 5LMNW 4JYAL 1CKNB 3CXCA 4C3IH 1XNRL 2OTJA 2CWPA 1HZCA 2KHJA 3GDEA 5AJ3Q 2Q2IA 4QIWE 2KENA 3HOUG 2WB1E 3NBHB 4YHHL 2PI2A 1E24A 2MO1A 3AYHB 3KDFA 5C4XH 1VQCA 2Y0SE 4UP9A 2LSSA 4A3EG 2KHIA 2ZTDA 4JV5L 3L2PA 1BKBA 1SROA 4A3JH 2JA8H 3KYHC 1YJNA 2IHEA 4R4IA 4P72A 1Y1VG 4LFCQ 1C9OA 3I4NH 1FL0A 2ID0A 2JK8A 4LF6L 4JOIC 3J80c 4GS3A 3CMAA 3CCJA 3RNUA 2UXBQ 1O7IA 3CCSA 4DR5Q 2IHFA 3PSIA 3FHWA 2A1AA 1Q8KA 4P74A 3K7AH 3M4OH 4GKKQ 2R7DA 4OX9Q 1OXUA 1JJCB 3W1BA 1XMQQ 4GLVB 1XNQL 4JI8L 3I4MH 4C3JH 4JBMA 2HQLA 4PG3A 1E7ZA 4BBSH 1HJPA 4NXNL 1H95A 1FVIA 2BA1A 3GTGH 3S1NH 3OW2A 4IPGA 3STBC 1KL9A 5LMUQ 1UEBA 4B3TQ 3J7ZC 3UDGA 3GTJH 1VQNA 4LFBQ 3HOYH 3U58A 1K8AC 1VQJA 4NXML 1OXSC 4DR4Q 5IYBH 1JB7A 1EOVA 1VQ7A 2OWOA 3JAMc 2WB1G 3J80i 4XTCS 5C3EG 1KD1C 3RZOH 4R4TA 2Y0SG 2R93G 4B3RL 4DV2Q 1L0WA 2E8GA 4JG2A 4IPHA 2BA0A 1S72A 4A3EH 3AEVA 1HZAA 1YNXA 1UE5A 4LFCL 1MIUA 1TWGH 5C4JH 2UXBL 4A3FG 4KHPQ 2UUAQ 3G6EA 4DR5L 1VQ9A 2N49A 1TWAH 5GAHC 3NENA 4O0AA 4A76A 4GKKL 4OX9L 4LF7Q 2NZOA 1YI2A 1N34Q 4WJ4A 3PCOB 4JOIA 3A5ZB 4QY7A 1K8GA 3HOWH 2HIVA 2R7FA 1X54A 4YY3Q 4A3DG 2ZTEA 4DV5Q 1U5KA 2RF4A 4R4QA 2HT1A 3VDYA 3PV0A 3PUWA 2K14A 5LMUL 3JAMi
chains in the Genus database with same CATH superfamily
2Q8IB 3MWYW 4APVA 5EBCA 2JSOA 4B3TL 4LFBL 2B2VA 4PZ7A 4QIWA 2EY2A 4LF4L 4K2LA 3RGXA 4CGYB 2IMWP 1II3A 1STNA 4K8IA 4DAPA 1JORA 4DN4M 2HHHH 4BXXH 2BOSA 2NTSA 2HQEA 4UP8A 2UUCQ 3RGZA 2NWGA 4MV3A 4KI0A 4L5QA 1N8RC 2FK2A 2K32A 4N9TA 3DEOA 2JEGA 1WTVA 1IL8A 3N42B 5L1JA 3M9BA 3TMEA 1PTOH 2PQEA 4UP7A 1N34L 2KEEA 3DWPA 1Z47A 5I47A 3KJPA 3K81C 1CA6A 4IRCA 3MXNA 3FKIA 4XT3B 5KFLA 1CKNA 4CDCC 1T5XD 2VA3A 2RDHA 3BS1A 2AGOA 3L7ZC 4E6IA 1N9WA 5IT9E 4ECUA 4IRKA 1T36A 3BABA 1IBKQ 4RB2C 1V1QA 1BCPB 1GUGA 1FNUA 3NBHA 1KDBA 3IFTA 2R7ZB 2R6FA 1Q86C 3RIZA 3S14H 1YHQA 2R7NA 1V51A 2KUMA 2GPSA 3H3VC 5K36H 3J7AK 3JAMW 2B63H 4H0LC 1N33H 3VYRA 5M3MG 4X62Q 4KLKA 4JI6H 3KLSA 1AE3A 5CGKA 3MR3A 2NUCA 1RF2D 2UUCL 3S17B 1X9NA 4GC6A 2OQ0A 2XCPA 4ALPA 1L1OB 4WJWA 2ASBA 4CBVA 3TINA 3S1QH 2ENBA 2A6EC 3MAQA 2VS1A 2E2IH 4EEQA 4RGTA 3I56A 2VL6A 4FXKC 1YHBA 2ATLA 5D3IB 1VQHA 4TVAB 2WYOA 2QA4A 2V5AA 1A6XA 3T56B 5IIFA 1A62A 1NBWA 2XGQA 1J8IA 1KLGD 2XIGA 4JI7L 4ED0A 2B2UA 4IURA 4C2MB 2NU9B 1ONLA 2GVBA 2JA5A 1EY8A 4A4IA 1UE7A 1IBKL 4ZCKA 3GQCA 1HUNA 1VQ6A 3M9MB 1EY7A 2Q2HA 3T5JA 3FMAA 5KFEA 1K9MC 1K8OA 3U4VA 1YJ9A 4X62L 4I55F 2R86A 2F3WA 3H0GB 1BBXC 4A3LG 4YAKB 3V4SA 1E1TA 4K5XA 4YWMA 3F2UA 4HIDA 1N36H 1HR0H 4XXEA 4RKBA 4TUYF 4LUZA 1TQOA 4J9SA 2FLNA 2XD4A 1OWTA 1TWCA 4R8UA 2R8KA 3HOXH 4DL2A 4DR1L 2XCLA 1F2YA 4B3MH 5C4XB 3AQQA 4Q0FA 5KFRA 3OWEB 1HFNA 4NW2A 1CHQD 2F0MA 1STYA 2BH2A 3Q1KA 4IWYA 3I4NB 2XNAC 3URYA 4DGZA 2NVXH 2VQEL 1OXXK 1IW7D 4IUPA 3TQYA 1EUDB 4QWBA 4GC7A 4DUYQ 2Z1CA 5DNFA 2HUGA 2W57A 1XMOH 1Z2NX 5FO7B 3T1YL 3OSPA 4BY1B 1QVFA 4DR7Q 4O1NA 1E2ZA 1TVXA 4DUZL 3BDCA 4OIKA 1KJIA 3TS2A 5KT7A 2MFIA 2XRSD 3UE0A 2X69A 1IOWA 2FKLA 2Y0SA 1GKHA 3H4DA 1TT2A 2UXCQ 5DLQE 4DV6Q 1A0IA 2JA7G 1JE5A 4CJ2C 1CSPA 2K03A 1I4HA 1E4EB 3CRKC 2UVWA 4L5TA 4X66Q 1S0MA 1SE3A 3S1RB 4FO2A 4JI3H 1GUOA 1VMCA 1Q8IA 3D4RA 5C44G 3HRZC 2A73B 1O7ZA 2K75A 4POFA 2L15A 2IJ0A 5DGAA 2UVUA 4DUYL 4S3SA 1GSOA 4J8QA 4ZK9B 1KC8C 4BBRG 2Q2UA 3GTQH 4HR7A 3PF5A 1LV9A 2NN6G 1SFOH 1SCUB 1SE8A 3W1GA 4OXPA 2V58A 2ZXOA 1L1OA 2AMCB 1D1KA 2J6SA 3JRXA 4DR7L 1D6EC 1HZBA 3U9TA 3TQ1A 2R82A 3VR5A 4I50F 4A3GB 3T1HH 2C28A 1NAPA 2JXMB 1L0XB 5ELOA 1HNZH 3M7NA 2UXCL 4DV6L 3AB9A 1HXYD 5CV8A 1QVGA 5KFKA 2F0WA 4Z9CB 4ZUJA 2EYJA 3NK9A 1LTSD 5M3FG 1VQKA 4KKTA 3S2DB 2CFMA 4O3RA 2R93B 1YZ6A 4X66L 4YR2A 3R2IA 1B6SA 5C5JA 2FFKB 4DXFA 3GTPH 1N32L 1EZ1A 2RHSB 4IUQA 2C5CA 5ELBA 4FU0A 3MJFA 3KOJA 1VQ5A 4JYAH 4EYHB 2W71A 1XNRH 2A8VA 1HFGA 3H0GA 3MWMA 4CDDC 1I4PA 2ZT9C 1IXRA 4ED1A 4ILWA 3RLOA 1MKHA 5CYUA 5JUMA 2F0QA 4J9KA 2RSNA 3CU7A 1WTHA 3CRLC 3PMFA 2F52A 3QFFA 3VR2A 2LFNA 1IBMH 3R5HA 1I7NA 2L1BA 5IYDG 3HOYG 4ZYSA 1UEAB 1RDPD 3TIIA 1LYLA 5BR8Q 5IYBG 1JJ2A 4YAJB 5NUCA 4C5CA 3PIP3 2CH4W 1X3EA 1S0NA 2A6ED 3MEHA 2M2LA 2PZTA 4C3HG 3H6MA 1PH3A 1H9JA 1NTGA 4JBKA 5A2QL 1FKAH 1GYFA 1PK8A 4M8AA 1YNJC 2B8FA 1SEIA 3NBIA 3S15B 2KOLA 1A8VA 4HCSA 1M8AA 2EY6A 1SMYD 1X32A 4ME5A 2KA7A 4MN3A 4R4OA 3I2ZA 4KJNA 1BCPC 4RCOA 4HNVA 3M9NB 3GIMA 2DNEA 3M4QA 1KQSA 2F4VL 2R8JA 1SYFA 1D8LA 2SEBD 3RAXA 2JEAI 1FJGQ 1XDNA 1KAAA 4IR9A 1B44D 1NSNS 2LXJA 3NTHA 5EQ0A 1GUTA 3RR5A 3Q0AA 3CQZH 5LL6S 4KY5A 4O4HF 1UE6A 2PZUA 5BR8L 1PH1A 4GKJQ 2A69C 3NPPA 1PRTD 3HOVB 5KFAA 3K3PA 4A93G 1CUKA 4P75A 4KJOA 4DK1A 4DV4Q 1LUZA 1SYXB 4U6PA 5M3MB 3VPBA 1VQFA 5BPHA 2Z4IA 3RZDH 1BDOA 1UNSA 5D1OB 2NUAB 2OCEA 4B3TH 2F0UA 1TAEA 4LFBH 4LNQA 4YB8B 4PMCA 3HOZG 5KFQA 2E2JH 4F88A 4MNOA 3HOUB 4H02A 4V0BA 4DV2H 2F4IA 3CPFA 1JOQA 1LTGD 1FJGL 4BA2I 2KCMA 2Z6BA 3C3LA 4MAMA 2D0PA 1LACA 1RJQA 1I3QH 4A2BA 4A3CG 2R61A 2FJZA 4JVZA 4GKJL 3K0XA 4RU9A 2E2DC 3KJOA 1N34H 3EFXD 4PMWA 1A9XA 5KYIA 1HQMC 1Y1WH 1N33Q 5DG8A 3J7YW 3CCMA 4DV4L 2I87A 3PVXA 4MTEA 3P75A 2JEIA 1TWHB 2DUDA 5BN3A 3IL8A 3Q8SB 5IGCA 4DFAA 1IYVA 1CT1D 3PZPA 3NUCA 1SSOA 1CI3M 1WCMA 3S1NB 1SJHD 4DAYA 2YTVA 4U68A 1SE2A 2G9DA 2I07B 1KABA 5C6AA 5KT4A 3RJ0A 4HYKA 3HKSA 2MCTA 2WB1B 4V190 5KFUA 4A3JG 2LS01 2UUCH 1SDFA 5C5LA 2LKVA 5KG5A 4YBZB 1BUVT 1U4MA 4JK1C 2VQFL 1RJTA 1B6RA 2W6NA 2BQRA 1PZJD 1YBYA 1VQAA 3GO5A 4DV7L 3S2HH 3J81E 3I4OA 2AU0A 4OL7A 4DPGA 3GV7B 4BBSG 4OWXB 1K83B 2ASDA 4BBRH 4OWWB 2XVSA 4A3DB 2JE6I 4FYDA 4P2CB 3UE1A 2YS7A 4JI7H 3VR4A 1I4RA 1E3PA 5E3FA 2VB2X 3J7AV 1IBKH 3CXCA 1T3NA 1EZ6A 2R8IA 5HV6A 2JA7B 1KJJA 5KFOA 1TWFB 2EVBA 2WB1E 3QZ8A 4G3IA 3I4MH 3GTMH 3N52A 1DCZA 4X62H 1B9MA 1SROA 3V6KA 1QNKA 2IHEA 1N56A 4NXNH 2ID0A 4LF6L 2W8KA 5C44B 3E6ZX 4DR5Q 2DY8A 1KBLA 4GKKQ 4O3OA 3ND9A 1Z2OX 3MZ5A 2JN4A 1S0OA 3EJIA 4CKEA 1CA5A 3W1BA 1JCKB 3QB3A 3GTJA 1E7ZA 1YNJD 4I7ZC 4R8NA 1S03G 2N55A 1JWMD 2BA1A 1H95A 5CORA 4N9PA 3OW2A 3STBC 3BG3A 1DONA 5KG7A 1HQRD 1BOSA 4B9XA 1VQNA 3HOYH 2VQEH 5L1LA 2BR0A 1VQJA 2PMZB 1WTRA 1EYAA 1Z6HA 4EGQA 3G6VA 1OXSC 5JVH3 5IYBH 5EOYA 4ED3A 1JOKA 5IGDA 2Y0SG 5KFWA 4ZKCB 2E8GA 2R7MA 1S9FA 4IPHA 2BA0A 2TSSA 1I7LA 3FDTA 5ELDA 1NNXA 1TKWB 1YNXA 3I8ZA 3NTKA 1UE5A 1EOTA 1IHZA 1JOOA 2UUAQ 2QF7A 3PR4A 4DR5L 1JB3A 1ET6A 4GKKL 1M0TA 4WJ4A 1KTKA 1LTBD 3PCOB 4CHTB 3JAME 2R7FA 3VR3A 4R4QA 2WV6D 1S5CD 3EQLC 3EPIA 3E5SA 2EYMA 1VS0A 3FMCA 1VCIA 1DGSA 2FK1A 1NJIC 4OGQC 3ULJA 5KFVA 3PO2B 4LUVA 2WB1A 2JA6B 2PMZE 3TREA 4DUYH 1L2ZA 1NE3A 3OOCA 3BVGA 5K36G 2B63G 1PZID 4IWXA 5KG3A 1LT6D 4EVOA 4A93H 3CPWA 3LWUA 2G9HD 2W9CB 3HGBA 3SR1A 3VA7A 3OW7A 4EGJA 3WOFA 4IO9A 4DR7H 4Q43A 3PW4A 2NVYB 1I50H 2I0QA 1JMCA 3K59A 2UUAL 1K83A 2UXCH 4DV6H 4IOAA 3BQ0A 4J6HA 4TQUS 4ZOLF 1ZKOA 1U4RA 1A3UA 3GTLB 1EZ8A 1K3BC 4X66H 1ML0D 2PBZA 4CDEC 4XZ3B 2EIFA 3CCRA 1DYQA 1HNWQ 1S5FD 1U4PA 3MXGA 3FKIH 3TP5A 3CMEA 3QJYA 2VXWA 3T16A 4BA1I 5IGGA 3KBGA 1D2BA 3Q8DA 4HSVA 2ZDHA 3GV5B 3KBXA 1W2BA 2NVTB 1XNQQ 4H44C 2OF1A 2FMAA 4RHRA 1S3OA 2EZVA 5LHY1 4A3MG 4O3PA 2YW2A 3G48A 2F0IA 5DM63 4YWKA 2K33A 4DV0L 5I4DA 3EPGA 2IX0A 2J6TA 1C30A 4UCSA 4UCTA 2KCNA 1RHPA 2RDFA 4JI5L 2QW7A 3PF4A 5LMNQ 3HOXG 5M5YH 1C48A 3HOZB 4DV3L 5I9OA 4A3IH 5D65A 3TP7A 1LTRD 4Y7NB 4CJ1B 4TV8F 3Q6SA 4FM9A 2PMZA 3UDIA 2MO0A 3X3NA 3OHAA 4HEDA 1HNWL 1G6ZA 4TRDA 4OO1H 1RTNA 2K5VA 4A2AA 1ZXTA 4G57A 1T9HA 4B3SQ 1NR4A 1PYSB 1CE8A 4ZQIA 2AQ1B 4QW8A 3R5FA 4QWAA 2F4VH 4GOPB 1K73C 5CV5A 4IQZA 1PH6A 1IYJB 1VQOA 5M5XB 5KFJA 3F2CA 3IRBA 5CV4A 1YITA 5DQGA 3EN2A 1JC7A 3OMGA 1ZEQX 2E74C 3L4KA 4LF4Q 5LXTF 2W6OA 4Q44A 4R8IA 3K0YA 5BR8H 1JIHA 5LMNL 3CCVA 1O80A 2VUMG 3RN5A 3RB0A 4HTHA 1Q7YC 3I3CA 2ZXPA 1PYBA 1Q3LA 1TU2B 4MTNA 1U0LA 4RAUC 5K5PA 1KJ8A 1Y1VA 4DR6Q 4JUZA 1KIXA 2DJGC 4ZQ3A 4FNFA 3GTKB 3STBD 4CDFC 3ETHA 2K52A 3DEPA 1YHAA 4F7XA 2DJFC 1XTDA 1EY0A 2EYLA 1UC8A 3DF7A 1O78A 3S24A 4A3BG 1O7LA 5LL6X 4B3SL 1BXTA 2W9CA 2VR1A 3F8NA 3OUUA 5EWGA 1EYGA 1FYCA 2YU9B 4O2DA 3C1EA 4BBSB 1XPUA 4YQWA 2E76C 1EFID 2NVYA 1PTOF 3M4PA 1FJGH 1S5DD 3GV3A 4MV4A 3Q8QB 3OYYA 2KQ3A 3T13A 3BZKA 5D3DA 5L1IA 1EY4A 2R92A 3OIPA 5FO8B 1VQGA 4O3SA 3GTLA 4QJFA 4GKJH 1H9MA 3E3XA 4FF1A 3MC0B 2WTFA 2O5IC 2E5LQ 1RK5A 2D0OA 1A63A 3IN5A 3HP3A 1GUNA 3B6YA 3PO3G 3D4WA 4DV4H 5JVG3 1ZQ7A 5KNDA 5EPLA 4DR6L 1VMPA 4JV0A 2L5TA 2NVQH 5JPMC 2ASLA 3RV3A 2CHBD 3D4DA 1SNCA 3H40A 3AU7A 1ILQA 2MP1A 2E2HB 1AUVA 2AWNA 4HJAA 5D1PA 4CJ0B 5FLXL 4L5RC 3D0FA 3ITPA 2AQ3B 3HKZG 5KFIA 1R9TA 1LTLA 2WKCA 1A3VA 2WP8J 1Q1BA 4G7HC 4QCLA 1B33N 2JEBI 3D6WA 1IBLQ 2F0EA 4AQYL 2XGPA 3RUZA 4IUTA 4JI7Q 3I55A 3RTXA 1L2FA 2I5HA 3KXYT 5F9LA 5E1FA 2VQFH 1QVCA 1CFMA 2YRXA 1EUJA 1ZYRC 1MD2D 4HN7A 4QL5A 4DV7H 4RUAA 3MFYA 4JCVE 2CQYA 3HFZB 1I6HH 5T1GA 4JC0A 5J2UF 1EIHA 1ULZA 1CQFA 2E5LL 1JLLB 5G3LF 3HZXA 1IL2A 5CA0F 4GN5A 4HNUA 4H13C 2Z0SA 2JA8G 3PUVA 4AYBG 5LA6F 2FLPA 4FXDA 5FLXc 4Y8VB 2A68C 5C0XJ 3VR6A 2NU6B 1JICA 1W6JA 2ZJQA 2HJWA 5M5WH 1PTOB 3K57A 4DR1Q 1QB5D 3W5OA 1EL0A 1YJWA 4C3JG 1V1OA 3J81i 4G7ZC 3UDXA 1IBLL 1QUQB 4UPAA 1SXTA 3CC2A 4IR1A 2K7VA 3CCUA 4O4IF 3H0GH 5EKIA 1HCZA 1SJED 3KALA 3PW0A 3NHHA 1H9KA 3SK4A 2VQEQ 5IYCH 1DV2A 3P20A 2PW7A 3I7FA 3T53B 3PUYA 3RFCA 5IGFA 4YJ2F 2SOBA 3MTSA 4LUOA 3R5XA 3S14B 2W6QA 1FR3A 3GTKA 2PO4A 2IPKD 2DWCA 3G6XA 3T1YQ 4R9WA 1AUXA 1EUCB 5KNCA 2WACA 2H5XA 2J6UA 1M6VA 3E0JA 4A3MH 2MPMA 1XXGA 4J9QA 4DUZQ 2VB3X 4TSSA 2OEOA 5KYLA 4XDXA 2CH4A 5KFPA 3KUPA 4NB3A 5KFBA 1SNOA 2YU9A 1ZETA 3WOEA 3U4ZA 4C3IB 3S1QB 5ELCA 3BG5A 1NR2A 1SYDA 2E2IB 1X3QA 3KAKA 5KG4A 2PW5A 4NLGA 1A15A 3HOWG 2C22A 4K6LA 1GLVA 4NP5A 4WD3A 2MNAA 4DL4A 4JW0A 2IW3A 4DAVA 4LFAQ 2RCFA 5EJWA 1ILPA 4BY1H 1HTPA 5CV6A 1UC9A 4R7RA 2R85A 2I80A 2HVRA 3J7A5 2KBNA 5EWEA 4DR5H 3M4OB 2K1BA 4DF7A 1NMFA 1H9SB 4GKKH 1Y1WG 1OTCA 3WWVA 1ENCA 2N3SA 3R2TA 5AJ3L 1Y8NB 4PMBA 2XWJB 3E9IA 3T5KA 3GTGB 5BN5A 1SYBA 2VQDA 1IKLA 4RGNA 4ECQA 3SVMA 2E2HA 4P73A 4RKLA 3E5NA 3M7GA 3M9OB 1NY4A 3S1RH 1D5MC 4K2KA 4J15A 1EYCA 1J6QA 4IFDJ 1JJGA 3NELA 3AFQA 4F50A 2N8NA 1BNZA 3MR2A 3RZOB 1V9PA 2VUMH 1MSHA 1XMQL 4FF2A 4GOPC 5CV7A 2BQUA 4DU9A 2P0AA 3CVZA 4LFAL 2PNHA 5J39A 1N32Q 1DIKA 2WAQG 2JP1A 2R7ZA 2NTTA 1K8MA 1EU3A 5C4JB 2NVXB 2RBMA 4FBTA 1FGUA 1RYSA 4A3GH 2UUAH 1EWHA 1TWAB 1YIJA 3O13A 4A3BH 5ELEA 1C3OA 1XX8A 1SNDA 5CA1F 5EPKA 3WDNA 1VQLA 5FPOA 1JQYD 4MTDA 4ED7A 5C8YF 2ZM6Q 3A56A 5AFWA 4HMIA 2I5MX 4RNMA 1T94A 1W96A 2V9WA 1Y69U 3A5UA 1J9OA 2CW0C 3ERQA 3VA5A 5JVLA 3I4MG 2NN6I 2HD3A 4J1MA 1CKMA 2F0SA 2H1EA 3UDFA 1SYGA 3PO3H 3FVQA 1WCMH 4C2MA 4QWDA 3IG0A 2N88A 3PW7A 4HJ5A 2F1MA 4YCWA 5GONF 4DL3A 3I90A 3RAQA 1VQEA 3K5OA 2F3IA 2M00A 1AW7A 1HUMA 4KV6A 1WI5A 1ZYRD 1WSCA 4RB1A 4JI5H 4EBDA 2W6ZA 3KHHA 1XJVA 5KFYA 2XGTA 2F4VQ 1S4ZA 3GTQB 3C2PA 3R3OA 1G6PA 2X6LA 2FK3A 2W8LA 1CM9A 5K2MA 2XRQD 3UQ8A 4EQOA 1T5EA 2ZM6L 3AMUA 5FD5A 5KG6A 3HB9A 1U4LA 4ECWA 1LTTD 4HMJA 3S15H 1HNWH 1KEEA 2C2EA 2ZXRA 4QGUA 1BQQT 1X65A 4XYMB 1DD2A 2VA2A 3G4SA 4I65A 1X3GA 3QZ7A 3T5LA 4K8JA 2CWPA 4KD3A 4ZLTF 3VPCA 5DQHA 1XNQH 3OUZA 3MXPA 2KENA 4C56C 4B3RQ 1B4OA 1N48A 3TP8A 1AEXA 3TDQA 1RODA 2WIIB 1TY2A 3L2PA 2JA8H 3N8DA 4P72A 1Y1VG 2F0NA 4LFCQ 3HG9A 4JOIC 4UFZA 4GS3A 3CMAA 1CQJB 2UXBQ 3PSIA 3FHWA 4FXGC 1Q8KA 5LMNH 3GTGA 3S9WA 2HGSA 2R7DA 1DZ1A 1A3TA 1RTOA 4CKBA 4C3JH 2ASJA 3RUPA 4NXNL 4EBCA 4XQJA 1QWYA 2W6MA 5KT2A 2RGRA 5KT6A 2J4XA 3OHXC 1F77A 1UEBA 2J9GA 5KEEA 3GTJH 3U58A 1K8AC 3BAAA 1AZQA 3GIJA 1E4EA 3ORRA 1TIID 4B3SH 1O7YA 1D5ZC 1LABA 5KKNB 4DR4Q 1GXDC 4ZAIA 1EOVA 1VQ7A 4QMGA 3QO2A 2JEJA 1PTOC 2V4QA 2A6HC 5C3EG 5DG9A 4C5AA 4B3RL 2L0CA 4JG2A 2VPQA 1UNNC 5JOBA 3I4LA 4A3EH 2GA4B 1VF5C 3AEVA 2FPIB 2PYKA 1MZBA 5HGTA 1TWAA 2NU8B 4ODGA 4LFCL 3A8KE 3KLRA 1MIUA 3G7LA 2AGQA 4LF4H 5IT9L 2UXBL 5T14A 3ETJA 3OMCA 3NGDA 2RDJA 2NU7B 2N49A 3NENA 1WH2A 4LF7Q 4QB4A 5JJZA 1EQTA 3A5ZB 2ICEC 1K8GA 3HOWH 4DR6H 3BVZA 3DM1A 1M4VA 3PV0A 2K14A 2VQFQ 1MHWC 2PVPA 3FKIG 3CQZB 3A0JA 1FNWA 2BH8A 2R84A 3KHGA 4NPSA 4B08A 1XPOA 3J81j 4DV7Q 4KY7A 3TIGA 4MTKA 3E0EA 2R93A 4HJ8A 1S5BD 4RWSC 5EAYA 5HY6A 4DR4L 3N40P 5FD6A 3BQ1A 2AQ4A 2K28A 1G2TA 1ESRA 4NMZA 1WR2A 1EQVA 5FKAC 5I6WA 4AQYH 1R4QB 3IKJA 4E4TA 1F9QA 1LO5D 1EWCA 3RZDB 1I4XA 1V4YA 4JI2L 5IT9c 3PIOA 2CW8A 5LYJF 1KHIA 2B2WC 4I7HA 3IAYA 1B70B 2O03A 2XC9A 3H94A 3GTQA 3SHLA 1TS4A 3LGJA 1B53A 4A3FH 4JI0L 4PV1C 4WBNF 4QWEA 2QILA 2R6GA 4A3IG 2E5LH 2RCNA 4WORA 1HH2P 3RLNA 2SNMA 4LF7L 2E2JB 1DV1A 1RJPA 4DAMA 3Q2OA 2NZ1D 4Q8EA 3WNZA 4UHVA 4DL7A 4IPDA 1DXMA 1SEBD 2K01A 4A3DH 2C00A 1SBBB 1SNMA 2DGYA 4LF6Q 4OO1G 2GN5A 3L4JA 1X3FA 2F0DA 3JC66 4O4LF 3NP8A 3KLWA 5F2DA 3RF2A 1TS2A 5BN4A 3S16H 2CQOA 1WTQA 1GHKA 4L8JA 1GJXA 3PR5B 2CW0D 3GV6A 3CD6A 1VKZA 4O2AF 2JA5G 2W7OA 5KG1A 4DNTB 2B3GA 1Y1WB 5KFDA 2K04A 5KFTA 1IBLH 3QWNA 1YNNC 2DNCA 3BA8A 1JDBB 2PZWA 1K3RA 3KK7A 4X65Q 3HS0C 4XQQA 4QQBX 2RDIA 4HIMA 1I94Q 5CAEB 1B1ZA 4K6DA 5J2TF 1PFBA 3TS0A 1OXTA 4PZ6A 4PNYA 5KFFA 2ZDQA 1JXLA 3OSOA 3SDZA 3GIIA 3KF8B 2EQSA 4JI6L 2A19A 1GGOA 2FPPB 1B50A 1PFSA 1KJ9A 1HR0W 3EVQA 1ICWA 3FP9A 1EYDA 2RGVA 4GLXA 2JEFA 5JVDF 4K0KQ 3S2HB 2QDBA 2KSWA 4EYIB 1QE6A 2X6GA 2KCCA 2F0GA 2D9UA 2VW9A 3F2DA 4Y52H 4MV8A 1PMRA 1S5ED 3RBEA 3RLFA 4DR1H 1P16A 3DHQA 3N41B 4BBRB 5D1OA 2X0SA 5DGBA 2EJMA 4QW9A 4K5VA 4FS1A 1WFQA 5JJKA 3TP6A 2IP4A 1SRUA 1PH2A 3RB6A 2YRWA 3N6RA 3MFHA 1B7YB 2BE5C 5HGQA 4X65L 4EFBA 5GAEC 1I94L 3FPUB 5KT3A 1BCPD 1TXYA 5DG7A 1B8AA 1EY5A 5FJ8G 2FMMA 1GM5A 3NSWA 1UWVA 4ME6A 5KFZA 3H3VH 2F0KA 2OLSA 3GTMB 5M3FB 3T1YH 3MWEA 3R93A 1CZGA 4UCOA 5ISRA 1U9RA 4YJ3F 4KN7C 4EQ5A 2MQHA 1OO9B 4X64Q 4IHJF 4LH6A 4DUZH 1Y1VH 1N36L 3KLSX 2JA9A 5CMDA 2K6AA 2KVMA 2B2TC 4K0KL 2A69D 4RH6A 3BQ2A 4RB0A 1PV4A 5I9PA 1PTOD 1TWHA 1IYUA 2A6HD 4BY7H 4B3ML 1C8CA 3S1MH 4LFAH 4WJ3M 1UAPA 2GLTA 3SK8A 3HOYB 1EQQA 4ZRZA 3ONAB 3N44B 2NVYH 1I4QA 4GN3B 1OXVA 4M7EA 2W9BB 3GD7A 4X3KA 1GO3E 4MV6A 4C3HB 3C46A 5C0XH 4A3KH 4UCUA 2F0LA 4C1NK 5KNBA 2R92H 5C3EH 3M3YB 1Q12A 5JJIA 1IOVA 2FLLA 3LX0A 1M90C 2E75C 2Q8TA 4DV0Q 4GLAC 1HRJA 1ESFA 4X64L 1NMGA 4JI5Q 2R7LA 3J80W 2W70A 2KCTA 2V4DA 2IX1A 4LF8Q 1X56A 3L3OC 4DV3Q 3DM3A 4X6AH 3NWTA 1B04A 3BVMA 3A7LA 3H0GG 3GTOB 1Q46A 1ASZA 1R9TH 3MFGA 2VNUD 1N32H 2LXKA 5IYCG 4EQPA 4YP3A 2EYHA 1MJEA 2JA7A 1BVSA 2ZJTA 1TWFA 4BWSC 4DA2A 5KGUA 5IWAQ 2OXPA 1AE2A 2CZGA 3KF8A 4DL6A 1CS0A 3SE0A 5C4XG 4C5BA 3GV8B 3M4IA 4A93B 1P8LA 1XWEA 2EXDA 5C3WA 3MVVA 4JPBW 3MA2B 2ZM6H 2L12A 3SE7A 2CKZB 3I4NG 1EIGA 5DLGA 3CCLA 2CW7A 2AHOB 4J9RA 2JJQA 1WOCA 1I50B 2LMCB 2XSCA 2FHTA 1EY9A 4LF8L 5CV9A 2K4KA 1EHIA 1E4GT 3WO1A 4EBEA 1X3PA 1ASYA 1DOKA 1XPRA 2EJFC 4GNXC 4BY1G 4O2BF 2UVRA 4DR3Q 3F2BA 1JT8A 4YWLA 2IY5B 4J9LA 3OWFA 4J0MA 3TSSA 1BJTA 1F2LA 3MXNB 3QOJA 1VQPA 4GZYC 3A55A 3GTMA 4DV1Q 5IWAL 4IFDH 3F1ZA 3CC7A 1ENAA 2PQAB 3FEWX 1PH9A 5JH7F 1KJQA 4AH6A 1PH5A 2JA5H 5E7NA 3K5IA 2QEJC 3SEBA 1M1KC 4LF9Q 4DK3C 5KG0A 4B9WA 2ZJRA 4Q8FA 2B8GA 3QR8A 5EGTA 2OH2A 3TEHB 2Z9HA 3GTKH 3TZUA 4F4ZA 5JPNC 1RCVD 1DOMA 3DUZA 2Z6KC 3K80C 1IBML 4JBWA 2R87A 2FMCA 1QNUA 1EU4A 2M05A 4FDBA 4KN4C 2EDGA 3BZDB 3KHLA 2YYAA 4K5WA 4IJHA 4OEMB 3H20A 2EYPA 2YU9H 3V6HA 2MJ8A 4B3RH 5FOBB 4A3JB 1G51A 1G291 1LTAD 1HPCA 1TWCH 3OHBA 2JA6A 4DR3L 3NQTA 5D14A 4LFCH 2NZHA 2BE5D 3KDFB 4A3GG 3A54A 5FLMH 3V2TA 4GN4B 4RUCA 2UXBH 4EG0A 5IYZF 4H7BA 3K7AB 5IY0A 4DV1L 1QOHA 1JE4A 4RNNA 4ZKBB 5CB4F 4IN3A 2UXDQ 4AQYQ 3ERSX 4LF9L 1PHJA 2K5HA 4U7CA 4OWTB 4RNOA 2HDMA 1RK6A 1X6OA 1C4QA 2RVLA 2Q8RE 1Q81C 3U9OA 5FLXW 4I4TF 1PFMA 5IP7G 2E2HH 2NYZD 4IRDA 1KLUD 3KHRA 1LM0A 3J81L 4DR4H 3GTOA 4KHVA 1SR3A 5FJ8H 1WCMG 1ZHSA 1H9RA 3BYYB 3TRZA 4HIOA 5IP9G 1Z9FA 2O2LD 1GUSA 3LP8A 4MV7A 1KRSA 2PI2E 1TWGB 1RYRA 3NWSA 1GVPA 2BCOA 5CC4A 4UY8C 1SE4A 4IJLA 5GADC 1HNXQ 4JI0H 1CTMA 2R7ZH 4LF7H 4F8MA 4XT1B 2UXDL 1AN7A 2F03A 1I50A 1STAA 2EJGC 2UU9Q 4DV2L 1K0SA 2R8GA 2D5DA 2OQKA 5JEAJ 2N78A 1WJJA 2WKDA 3D31A 5HBRB 3S17H 3K58A 1WTWA 3CHBD 3J81c 2R3ZA 5F9NA 4Q0YA 5EBDA 5ELFA 3NEMA 1EEID 1PA6A 2WINB 1QZGA 1F2ZA 3EROA 2RQXA 4RG1A 4LWCA 4YHHQ 5COYA 2Y0SB 2XWBB 1WTOA 4POGA 4JV5Q 2NVQB 5IGBA 2CWAA 4DV5L 3PIO3 2V59A 4JBJA 4RGMA 3BDOA 1TR5A 2PQAA 4C2MH 3KFUA 4UCRA 1S10A 1TS5A 1YEZA 4J9OA 4GOPA 3HOVG 2YV5A 2H4OA 1HNXL 4R4CA 1ZHQA 2F0OA 4M1UB 1EQRA 1KDCA 4JI8Q 5EZYF 4LJZC 1K1QA 2KJXA 2UU9L 3Q24A 1CSQA 1KDAA 2JQOA 3LWBA 1DOLA 4KMUC 4LF6H 1TA8A 4M9UA 4HR7B 3CF5A 1IZ6A 4YCVA 4NXMQ 3RB3A 3C0FB 1I6HB 2RDGA 4C3IH 3UI2A 2AUKA 2K5DA 2RA4A 5AJ3Q 2B63B 5I2YA 1KC7A 3HOUG 4LSAA 3MR6A 1DM0B 4YHHL 2PI2A 1JKJB 5C4XH 1AZPA 3KDFA 4A3EG 4RCNA 2Y0SE 4UP9A 3JAML 4JV5L 1MI2A 4ECZA 3K5LA 2F0JA 4CKCA 3U9SA 3I4NH 1FL0A 4X65H 3H4BA 3CCJA 1I94H 1TY0A 2B2YC 3RNUA 3JZIA 2FE3A 1SMYC 5L37A 2XIWA 2A1AA 5IGEA 4P74A 5M5WB 3M4OH 1S68A 4OX9Q 1D1IA 3I70A 1OXUA 1JJCB 3K5NA 1XMQQ 1VDZA 4JI8L 3V6JA 2B2VC 4JBMA 3RV4A 3LWEA 4PG3A 4F4WA 1HJPA 1FVIA 3GTGH 1WD0A 1SAPA 3J7AF 3JSNA 4RAYA 1KL9A 1LTID 5LMUQ 1PFNA 2FB9A 4NKLA 5I2XA 1V1PB 2IX3A 4K0KH 4EGVA 4NXML 2WDTA 1BGWA 1WD1A 1PRTC 2OWOA 4WFN3 3JAMc 2WB1G 1KD1C 4ECTA 4LMQD 3RZOH 1HA6A 4R4TA 4QUFA 1TWGA 4BS9A 4A3MB 2G5DA 1S72A 1HZAA 5C5MA 3JRWA 1WTXA 1A2TA 5C4JH 3P1HA 4KKSA 3T51B 3BA9A 4A3FG 4KHPQ 1KNEA 2I8CA 3C1FA 1B3QA 4ECRA 3PW2A 3VPDA 1VQ9A 2YZMA 1TWAH 3HOXB 4A76A 4O0AA 3RB4A 2BDNA 4OX9L 5TSSA 2NZOA 3V05A 2ICIA 2PCFB 5EKKA 4JOIA 1JWSD 2XN9C 2QCPX 4QY7A 4YIJA 5T1IA 4YY3Q 4A3DG 2A5HA 1U5KA 2RF4A 4MA5A 2HT1A 3VDYA 1VF7A 3G6YA 1E0BA 3TN2A 3JAMi 5LMUL 2EOTA 4X64H 2NBFA 2V1CC 2DIKA 1PH8A 3I73A 1PX2A 2C2RA 2DPIA 4IOCA 4F87A 3GIQA 3FRPB 5DEHA 3DWAA 1MJCA 2Z8LA 4KD4A 1JR0D 4DXGA 2D62A 4X3UA 4FP5D 3S2DH 2R93H 4DL5A 4F4YA 4LF5Q 1QG7A 5J3BA 3DWQA 4TV9F 1VAJA 3E9HA 5KFGA 2GPWA 3K6OA 3PQIA 4BWGB 4ECVA 3Q8PB 4R1JA 4KHPL 2FPGB 2UUBQ 3V96A 1F9SA 1QUQA 5IP7H 1AP0A 1CQIB 1PH7A 1MGSA 3OIQA 1BO0A 3HEJA 2VUMB 2B2UC 3PW5A 3EIVA 2C2DA 4DK6C 3PGZA 4QUCA 2RSOA 1FNVA 1Q82C 2QK4A 3F8TA 5IP9H 4EFEA 4YY3L 2FJ2A 4DV0H 3NE5B 1QJOA 1EIYB 1B9NA 2YZNA 2VY3A 1SNPA 2YZGA 4X3TA 1VBGA 2K5QA 2B63A 2KHSA 4IAJA 4DNRB 3ICEA 2P5ZX 1W3SA 4LAAA 5J22A 4A3BB 2PN1A 4F4XA 2L55A 4LF8H 1W6KA 3CKIB 5A2QW 4DV3H 1PH4A 1SFOB 1E1OA 4NXNQ 4JV2A 2I46A 4RFBA 1PVOA 3V4ZA 1CQVA 1K28A 1Y14B 2YTXA 2VOBA 1WYDA 4QF4A 5C1PA 4CC5A 4DR2Q 3DLLA 4LF5L 2K50A 2E2IA 2A68D 3CP0A 1J5EQ 5IWAH 3Q22A 2MUYA 3G6JB 2UUBL 1AN8A 2EY5A 1V8QA 3Q23A 2B2WA 4EQNA 3PO3B 4RA8A 1WCMB 3BU2A 4DAYB 4XQNA 1V1PA 3GTPB 2VZAA 2AUJD 1QILA 1H9SA 4YR3A 5JEAG 2QDLA 3PO2G 3K8AA 2JA6G 1GSAA 5KFMA 1RL2A 1I6VC 3GQBA 3H3VI 3CW2C 5C4HA 2HCCA 4BY7G 2DLNA 3HKZB 3HOVH 5EPJA 2YYZA 2F0TA 4JI4Q 3HBLA 1FGBD 3DXJC 4KY6A 1KAWA 2WFWA 1Y8OB 3H91A 2DY7A 5M3MH 4DR3H 2ALYB 4DR2L 1SMXA 3P7JA 4KTAA 4EX5A 5DAUA 1CHPD 3A8JE 2K5WA 3M85A 5IT9W 4RZRA 3J80E 1J5EL 1I6UA 1CK1A 4DV1H 3OTOQ 5C0XG 4A3KG 1NCVA 3SGIA 2R92G 4LH7A 1EIFA 5KX5F 4IALA 1E2WA 1EYZA 3RD4A 3HOUH 4RAZA 4LF9H 2NVXA 5DQIA 2JA8B 1ET9A 1LT3D 3AFPA 3T5HA 4AYBB 2QYZA 4JI2Q 3CC4A 4JI1Q 4J9NA 2ZTCA 4HIKA 2Q2TA 4PQXA 1GHJA 2F0FA 5C0XI 4MV9A 1L1OC 2GVAA 4JI0Q 2C35B 4LK1C 1I4GA 1CKOA 3HKZE 4MIUA 2HHHQ 4JI4L 3N6XA 1PZKD 4ZUIA 4C3JB 2F0PA 2HDLA 4DNIA 1KRTA 1MBYA 1F9RA 3H15A 2M9VA 1GOZA 1TWHH 4A3LH 2XTIA 3GTJB 1STGA 2VUMA 2IL8A 4I7AA 4PZ8A 4IZOA 3A74A 5D8DA 4Q45A 1EFWA 2IT1A 3S1NH 3OTOL 5M9OA 2ATWA 2YTYA 4GNXB 3QOLA 2UXDH 2QEXA 5KFCA 2EXZA 3TQTA 2CCZA 4N8FA 3RMHA 1JX4A 4A3EB 4AYBE 1D7QA 4JV1A 4NDXA 4JI1L 3CAMA 2AQ2B 3BDLA 3RN2A 1RD9D 3T4AC 5IODA 1WVLA 4HSPA 3MWDA 1FD7D 1SFOA 2W7PA 3MFIA 1PDQA 5H1SE 2B29A 2HHHL 5LP6F 4OHJA 5I6YA 3HOWB 3I12A 4APMA 1RKNA 1K83H 2B2TA 5EDWA 3LNNA 4JI6Q 2F3VA 4MA0A 1VQBA 4ETSA 5KFHA 1HZ9A 1VQ4A 2PPBC 5LOVF 5EWFA 4DV5H 1C0AA 3MR5A 3L9AX 4XIGS 1I3QB 2SNSA 1EEFD 1LT4D 1VQDA 4IFDG 2R8HA 3BJUA 4HQ6A 5L1KA 5DLFA 2EPBA 1X55A 3NTIA 1HNXH 5C1OA 1W93A 3EA6A 3GTPA 2JA7H 5FO9B 4N8X1 4J9MA 1EY6A 1TWFH 3KF6B 5JQWA 4X3SA 1GD7A 1BR9A 2UU9H 4OO1I 2IA6A 3ULPA 4KKUA 4FF4A 4HCEA 2DZDA 2RHQB 4U673 3HKZA 4IFDI 3GP7A 3I91A 2ES2A 2A74C 2AWOA 3U50C 5C44H 1G91A 4UAIA 1M7JA 1KXLA 4ID6A 4RZQA 2O4XA 3X3MA 4A3FB 1S97A 2K05A 4L1KA 3PUZA 5BPFA 3BZCA 1BXRA 1PLFA 3VYTA 1C7YA 4YHHH 1SN8A 1B3AA 1N33L 1G2SA 3GIDA 1LT5D 4JV5H 2NN6H 2F0HA 4EEYA 4XYOA 4XYLB 5KT5A 2WAQB 5KRUA 5FLMG 1N36Q 2CVRA 3GILA 1PXUA 3ER0A 1HR0Q 3PUXA 4L5SA 2QKIC 4XYQA 1RJRA 3S16B 3FPPA 2OT2A 5FLXE 1QZHA 3HXLA 4C1NI 3GIPA 1K0RA 2W9AA 3G71A 4IPCA 2KEDA 4RHSA 4AYBA 3QG1A 4B3MQ 4JI8H 1BBUA 1SYCA 1BBWA 5CR3A 4LW1A 1V43A 4YCUA 1B2TA 5M3FH 2VPSA 3NQIA 3BYTB 5FPRA 2YL2A 4IUNA 4IUVA 4MZ9A 1E4FT 2FXQA 1QCBD 4KK7A 1JWUD 4NXMH 1Q90A 3ND8A 3FDSA 1Q1EA 2RKSA 1XMOQ 3I4MB 3CQZA 4ULLA 1GUWA 5GQOA 1Z2PX 2WE6A 3ZJYC 4QWCA 3TZDA 2WAQE 2EYOA 3L0OA 3CCQA 1RIPA 2ZJPA 1HR0L 2EY1A 5JJLA 5KFNA 2LY7A 5J1ZA 4P71A 5JEAH 5IYDH 4RGOS 4GNXA 3PO2H 2R7ZG 2SCUB 1E22A 2JA6H 2MHVA 3MXUA 4HNTA 4A75A 4TQSA 1UE1A 3SK5A 4O3QA 1NUCA 2K5NA 4L63B 4BXXG 4MV1A 1VBHA 4OX9H 4C3HH 3WO0A 1XMQH 3D3RA 1O75A 2VUGA 3CCEA 4ZHQF 2C9OA 1PRTF 3TBIB 5FK9C 5C4ZA 2J0TD 4HJ9A 3M3YH 3W3AA 1GSHA 3VYSA 4ECYA 3SI8A 4JI3Q 4KHZA 1DJRD 4FVMA 5LMUH 1HTLD 2L4NA 3GLKA 5CBAE 3D6CA 1VQ8A 2YCHA 1S40A 1Y8PB 4HJ7A 2EE1A 4IZ8A 1HA5A 4DLKA 1L0YB 2TMPA 2HIXA 5GROA 3EBEA 1YVCA 1XMOL 2Z6KA 2O5JC 4MHEA 5IOCA 3GTLH 4ED8A 1I3QA 1XYIA 1R4PB 5H80A 4OELB 3OSNA 3GTOH 2YS6A 3A8IE 1STBA 4K14A 3A7AB 5GAGC 3SK6A 1BF4A 1Y1VB 1TS3A 1SYEA 3T1HQ 1Y1WA 1HNZQ 4KHPH 3W2DA 3ORQA 3KF6A 1UUPA 3OPOA 1Z7TA 4BY7B 2AKWB 4RB3C 2NVTH 3DMUA 4UCVA 1I5FA 3UFXB 2QGQA 3S1MB 4RMFA 4YY3H 3R23A 1HHVA 1CZWA 4AIMA 3GIKA 4ECSA 4JI3L 3ULLA 4PWQA 2L11A 3MEFA 5G3LD 3QIAA 1SNQA 4C3IG 2EYFA 4JYAQ 4UDUC 2B39A 5CBEE 1XNRQ 1VQMA 2I5LX 3K3VA 4A3KB 2L9HA 4QIWB 3HOZH 2R92B 5C3EB 2WAQA 1EWIA 1SLJA 1XTCD 2HCIA 4Y7NH 5C3XA 2R7KA 4LF5H 1IBMQ 4G4KA 2NB0A 1G8ZD 3EYYA 1VQIA 5HURA 3T1HL 4PDBA 1WTPA 1HNZL 1STEA 1E2VA 1ENFA 3H09A 1PRTB 5ELNA 3J80L 4A3CH 1AFPA 1BNCA 2UUBH 3PIPA 4HAEA 1MSGA 1LLRD 1K1SA 2V4RA 5KIXA 1AH9A 2HVQA 4TKOB 3JSLA 3K7UC 1YNND 2OTLA 5KG2A 3KAJA 1R9TB 5M5XH 4ME3A 4DKAC 5KFXA 5L9XA 3KTMA 5IE8A 3FKIB 3PN1A 3MHBA 4OONA 4FBUA 2XCAA 3IFDA 5LMNW 4JYAL 1CKNB 3RBDA 3VYUA 1XNRL 2D2CC 4FF3A 2OTJA 1HZCA 2JYOA 2KHJA 4L6TB 3GDEA 2Q2IA 4QIWE 5JAVA 3NBHB 1E24A 2MO1A 3AYHB 4Q5VA 3LMLA 1VQCA 5DM73 2DPJA 2LSSA 4FS2A 2KHIA 2ZTDA 4WRDA 5E4WC 1BKBA 4A3JH 1JDEA 3KYHC 1YJNA 4R4IA 3N43B 4OIJA 3D8GA 4DR2H 1STHA 1C9OA 2JK8A 2MGSA 3J80c 4ZI7F 4ECXA 1M0WA 2ALZA 1J5EH 1O7IA 3CCSA 4G7OC 2IHFA 4O42A 5M5YB 3K7AH 4ED2A 3VMMA 2SDFA 4A3IB 4GLVB 1XNQL 4DK0A 2FINB 2HQLA 4BBSH 5BMVF 2F0VA 2CQAA 4IPGA 5E4XA 2HVSA 3M4YA 2FP4B 2W9BA 3BJYA 3K5HA 4B3TQ 3J7ZC 3SXHA 3UDGA 2IWHA 4LFBQ 4ABNA 2IBKA 1ICFB 4LMYA 3J81W 2KECA 4XX0B 1IW7C 3Q8RB 1IKMA 5EKLA 1JB7A 2BQ3A 3R8BA 4JI4H 2PNRC 2JA5B 2BDOA 3J80i 4XTCS 2W6PA 4LSXA 3NXWA 2R93G 1BCPF 4DV2Q 1L0WA 5A35A 1D5XC 1F9PA 3K5MA 4O3NA 3G8CA 1TWGH 3ZYYX 2DN8A 3G6EA 2ZDGA 5KFSA 3OTOH 4IUUA 5GAHC 1PYWD 5A2QE 1YI2A 1KNAA 1N34Q 4ED6A 4CC6A 1A2UA 2Z4HA 4YR0A 4J9PA 2AGPA 2B2YA 2HIVA 4TQRA 1F2MA 1X54A 1TWCB 2ZTEA 4R8UB 4DV5Q 2UVVA 3I72A 4JI2H 2J7ZA 4JI1H 3PUWA 5LL6b
chains in the Genus database with same CATH topology
2V1CC 1VS0A 3A0JA 2BH8A 3FKIG 4APVA 1PH8A 1VCIA 4NPSA 1DGSA 1XPOA 4B3TL 4LFBL 4PZ7A 4IOCA 3J81j 3ULJA 4DV7Q 1NJIC 4LUVA 4LF4L 2PMZE 3E0EA 3TREA 4HJ8A 5EAYA 1MJCA 5HY6A 1NE3A 4DR4L 5K36G 2B63G 2D62A 4BXXH 4A93H 3CPWA 3S2DH 2R93H 4UP8A 2UUCQ 4IO9A 4LF5Q 4KI0A 4JI2L 5IT9c 3PIOA 5J3BA 4B3RQ 4L5QA 1N8RC 1KHIA 1I50H 3E9HA 1B70B 2I0QA 1JMCA 4R1JA 4KHPL 2UUAL 2UUBQ 1QUQA 5IP7H 3LGJA 4A3FH 3M9BA 4JI0L 1PH7A 2R6GA 4UP7A 4A3IG 4IOAA 2RCNA 4TQUS 1HH2P 3EIVA 3RLNA 1N34L 4LF7L 1Z47A 4DK6C 3PGZA 3K81C 4DAMA 3KJPA 1Q82C 3F8TA 5IP9H 4YY3L 4IPDA 4A3DH 2EIFA 3CCRA 1CKNA 2DGYA 1EIYB 4LF6Q 4OO1G 2GN5A 1HNWQ 1X3FA 2VY3A 3JC66 3L7ZC 1N9WA 3KLWA 3FKIH 3CMEA 1IBKQ 3S16H 2CQOA 1V1QA 3ICEA 1W3SA 4BA1I 3CD6A 1Q86C 3Q8DA 3S14H 1YHQA 1W2BA 2JA5G 1XNQQ 1PH4A 2B3GA 1E1OA 4NXNQ 2B63H 1S3OA 1PVOA 5M3MG 4X62Q 1Y14B 4A3MG 4KLKA 2YTXA 3G48A 1AE3A 1WYDA 4YWKA 2UUCL 4DV0L 3DLLA 4DR2Q 1X9NA 4LF5L 2IX0A 2OQ0A 1K3RA 2K50A 4X65Q 4ALPA 4QQBX 3CP0A 4HIMA 1I94Q 1L1OB 3TS0A 4JI5L 1J5EQ 1OXTA 4PZ6A 2ASBA 3PF4A 2UUBL 5LMNQ 3HOXG 3S1QH 5M5YH 2VS1A 2E2IH 3I56A 4DV3L 2VL6A 1YHBA 4A3IH 1VQHA 4TVAB 3BU2A 3KF8B 4DAYB 2QA4A 2EQSA 4JI6L 2A19A 2VZAA 1A62A 1PFSA 1NBWA 3UDIA 1HR0W 2MO0A 4JI7L 1HNWL 3FP9A 5JEAG 4GLXA 2GVBA 3PO2G 3K8AA 2K5VA 4A4IA 2JA6G 1UE7A 1IBKL 4K0KQ 1RL2A 3H3VI 1T9HA 3F2DA 3CW2C 1PYSB 2VW9A 4B3SQ 1VQ6A 4BY7G 4Y52H 2Q2HA 3HOVH 3RLFA 2YYZA 1P16A 4JI4Q 1K9MC 3U4VA 4GOPB 1K73C 1KAWA 2WFWA 1YJ9A 4X62L 1PH6A 1IYJB 1WFQA 1VQOA 5JJKA 4A3LG 5M3MH 1SRUA 2ALYB 1E1TA 3IRBA 4YWMA 3F2CA 4DR2L 1YITA 1PH2A 1SMXA 3EN2A 4HIDA 1B7YB 4EX5A 5HGQA 4X65L 3M85A 5GAEC 1I94L 4LF4Q 4LUZA 1J5EL 1TXYA 1B8AA 3OTOQ 5C0XG 5LMNL 3CCVA 4A3KG 3SGIA 5FJ8G 3RN5A 1GM5A 2VUMG 1UWVA 3HOXH 1Q7YC 2R92G 1EIFA 4DR1L 3H3VH 1PYBA 4MTNA 1U0LA 3AQQA 3HOUH 4DR6Q 1KIXA 3AFPA 4JI2Q 3STBD 3CC4A 4JI1Q 2BH2A 4EQ5A 2MQHA 4X64Q 2K52A 2ZTCA 1YHAA 1Y1VH 1N36L 4HIKA 2JA9A 2NVXH 2VQEL 1XTDA 2Q2TA 1OXXK 4K0KL 3S24A 5C0XI 4A3BG 3TQYA 1L1OC 2GVAA 4JI0Q 4B3SL 1PV4A 2C35B 4DUYQ 1CKOA 3HKZE 2HHHQ 1EYGA 4JI4L 4BY7H 4O2DA 4DNIA 2VQFQ 1XPUA 1KRTA 4B3ML 3T1YL 3H15A 2UXCQ 3S1MH 3M4PA 1QVFA 4DR7Q 4WJ3M 1TWHH 4DUZL 2XTIA 4A3LH 3TS2A 3OYYA 1EQQA 2MFIA 3UE0A 3BZKA 2NVYH 4PZ8A 3A74A 1VQGA 1EFWA 4QJFA 1GKHA 4GN3B 1OXVA 2IT1A 5DLQE 3OTOL 1A0IA 4DV6Q 1JE5A 3GD7A 1GO3E 2JA7G 2E5LQ 2D0OA 2ATWA 2YTYA 1A63A 1CSPA 4A3KH 3B6YA 4GNXB 3PO3G 2QEXA 2R92H 5C3EH 5JJIA 1Q12A 4L5TA 2CCZA 4DR6L 4X66Q 1M90C 2NVQH 4AYBE 4DV0Q 1D7QA 4JI1L 4GLAC 3CAMA 4X64L 5C44G 3RN2A 1NMGA 4JI5Q 2AWNA 2K75A 4HJAA 2KCTA 4POFA 2L15A 2IX1A 4L5RC 3D0FA 4LF8Q 3HKZG 4DUYL 5H1SE 1X56A 1LTLA 2B29A 2WP8J 1Q1BA 3DM3A 4DV3Q 1KC8C 2HHHL 4X6AH 2JEBI 4BBRG 2Q2UA 3GTQH 3PF5A 2NN6G 1SFOH 1IBLQ 1K83H 1SE8A 4AQYL 3W1GA 4JI6Q 3H0GG 4OXPA 1Q46A 1VQBA 1HZ9A 1L1OA 2AMCB 1VQ4A 1ASZA 1R9TH 1C0AA 4DR7L 1HZBA 3I55A 2LXKA 4JI7Q 1L2FA 5IYCG 2VNUD 2I5HA 4XIGS 1QVCA 1MJEA 1VQDA 1BVSA 1EUJA 4IFDG 5ELOA 4QL5A 3BJUA 5IWAQ 4JCVE 3HFZB 1AE2A 1X55A 1I6HH 3M7NA 2UXCL 4JC0A 4DV6L 1QVGA 2E5LL 2JA7H 1VQKA 5M3FG 5C4XG 1IL2A 4GN5A 1TWFH 3KF6B 2Z0SA 1P8LA 2CFMA 2EXDA 1GD7A 3PUVA 2JA8G 4AYBG 1YZ6A 4X66L 4OO1I 3ULPA 2CKZB 3I4NG 3CCLA 3GTPH 1N32L 2AHOB 2RHQB 2RHSB 2JJQA 1WOCA 5FLXc 4IFDI 2ES2A 2AWOA 3U50C 5C44H 5C0XJ 3KOJA 1VQ5A 1KXLA 2ZJQA 2A8VA 5M5WH 4LF8L 4DR1Q 3W5OA 3PUZA 1YJWA 3BZCA 2K4KA 1C7YA 1IXRA 1SN8A 3RLOA 3J81i 1MKHA 1ASYA 3UDXA 1XPRA 1IBLL 1N33L 1QUQB 4UPAA 4GNXC 3CC2A 4BY1G 3CCUA 4DR3Q 2F52A 3F2BA 3H0GH 1JT8A 4YWLA 2IY5B 5FLMG 1N36Q 3HOYG 5IYDG 3ER0A 2VQEQ 3PUXA 1HR0Q 4L5SA 3MXNB 5IYCH 3I7FA 1LYLA 1VQPA 3PUYA 5BR8Q 1QZHA 4DV1Q 5IWAL 4LUOA 5IYBG 1K0RA 1JJ2A 3F1ZA 3G71A 1X3EA 4IPCA 3CC7A 2PQAB 1PH3A 1PH9A 4JBKA 1NTGA 4AH6A 1PH5A 2JA5H 5E7NA 4B3MQ 1BBUA 3T1YQ 1BBWA 4LF9Q 4LW1A 1V43A 4YCUA 4DK3C 1M1KC 5M3FH 2H5XA 2ZJRA 4A3MH 3TEHB 4DUZQ 3GTKH 1A8VA 3K80C 2Z6KC 4MZ9A 1IBML 2UXDQ 4JBWA 4NB3A 2FXQA 3U4ZA 4FDBA 4R4OA 3I2ZA 1Q1EA 3M4QA 1XMOQ 1KQSA 4IJHA 2F4VL 3HOWG 2YU9H 1D8LA 2MNAA 1G51A 1G291 5GQOA 2JEAI 1FJGQ 4LFAQ 1TWCH 3ZJYC 4DR3L 2LXJA 4BY1H 2WAQE 2NZHA 3L0OA 3CCQA 3KDFB 1RIPA 3RR5A 3CQZH 2ZJPA 1HR0L 4A3GG 5JJLA 5FLMH 4GN4B 4P71A 3J7A5 2KBNA 5IYDH 1UE6A 4GNXA 3PO2H 2R7ZG 5BR8L 4GKJQ 1E22A 1PH1A 5IY0A 4DV1L 2JA6H 4A75A 1NMFA 1UE1A 1Y1WG 2K5NA 1OTCA 3WWVA 4BXXG 2N3SA 4A93G 1CUKA 4P75A 4C3HH 5AJ3L 4DV4Q 3ERSX 4AQYQ 3E9IA 1LUZA 3CCEA 4LF9L 1PHJA 2K5HA 4HJ9A 3M3YH 4OWTB 1VQFA 1X6OA 4KHZA 4P73A 4JI3Q 3RZDH 1NY4A 3S1RH 4J15A 4IFDJ 1J6QA 2OCEA 1VQ8A 3NELA 1S40A 1JJGA 4LNQA 1Q81C 4HJ7A 3AFQA 5IP7G 2E2HH 1LM0A 2N8NA 3HOZG 2HIXA 1V9PA 3EBEA 1YVCA 5GROA 1SR3A 2Z6KA 5FJ8H 1WCMG 1XMOL 2E2JH 2VUMH 3TRZA 4MNOA 4HIOA 5IP9G 1XMQL 4H02A 3GTLH 4GOPC 1Z9FA 3CPFA 1KRSA 4LFAL 2PNHA 1FJGL 3GTOH 1N32Q 2WAQG 4BA2I 2KCMA 5GAGC 2D0PA 2PI2E 3T1HQ 1I3QH 1FGUA 4A3CG 1GVPA 1HNZQ 4A3GH 4UY8C 1YIJA 3KF6A 4GKJL 4IJLA 3K0XA 5GADC 1HNXQ 4A3BH 2R7ZH 3KJOA 2AKWB 2NVTH 4PMWA 1N33Q 1Y1WH 1VQLA 2UXDL 1I5FA 3CCMA 4DV4L 2QGQA 4RMFA 2UU9Q 4DV2L 2ZM6Q 2OQKA 5JEAJ 2N78A 1WJJA 4AIMA 3D31A 2DUDA 4JI3L 3ULLA 2I5MX 3S17H 3MEFA 3J81c 4JYAQ 3A5UA 1XNRQ 3NEMA 2YTVA 1VQMA 2I5LX 1PA6A 1QZGA 3I4MG 2NN6I 3HKSA 4RG1A 3HOZH 4LWCA 4YHHQ 1EWIA 1CKMA 3UDFA 4A3JG 3PO3H 1SLJA 1WCMH 4POGA 4JV5Q 4Y7NH 4HJ5A 4YCWA 2CWAA 4DV5L 1VQEA 3GTMH 1IBMQ 4JBJA 2F3IA 2VQFL 1VQIA 2PQAA 4C2MH 3KFUA 1WI5A 3T1HL 1YEZA 1YBYA 4GOPA 1HNZL 1VQAA 3GO5A 4DV7L 3S2HH 5ELNA 3HOVG 3I4OA 4A3CH 1XJVA 2YV5A 1HNXL 3PIPA 2XGTA 4R4CA 4DPGA 2F4VQ 1EQRA 4BBSG 4OWXB 4JI8Q 1G6PA 1AH9A 4BBRH 4OWWB 3K7UC 2OTLA 2UU9L 2ZM6L 1CSQA 2JE6I 2JQOA 4ME3A 5M5XH 4DKAC 3UE1A 3S15H 5IE8A 4QGUA 1X65A 1E3PA 4OONA 3G4SA 1IZ6A 3CF5A 4YCVA 1X3GA 4NXMQ 5LMNW 4JYAL 1CKNB 3CXCA 4C3IH 1XNRL 2OTJA 2CWPA 1HZCA 2KHJA 3GDEA 5AJ3Q 2Q2IA 4QIWE 2KENA 3HOUG 2WB1E 3NBHB 4YHHL 2PI2A 1E24A 2MO1A 3AYHB 3KDFA 5C4XH 1VQCA 2Y0SE 4UP9A 2LSSA 4A3EG 2KHIA 2ZTDA 4JV5L 3L2PA 1BKBA 1SROA 4A3JH 2JA8H 3KYHC 1YJNA 2IHEA 4R4IA 4P72A 1Y1VG 4LFCQ 1C9OA 3I4NH 1FL0A 2ID0A 2JK8A 4LF6L 4JOIC 3J80c 4GS3A 3CMAA 3CCJA 3RNUA 2UXBQ 1O7IA 3CCSA 4DR5Q 2IHFA 3PSIA 3FHWA 2A1AA 1Q8KA 4P74A 3K7AH 3M4OH 4GKKQ 2R7DA 4OX9Q 1OXUA 1JJCB 3W1BA 1XMQQ 4GLVB 1XNQL 4JI8L 3I4MH 4C3JH 4JBMA 2HQLA 4PG3A 1E7ZA 4BBSH 1HJPA 4NXNL 1H95A 1FVIA 2BA1A 3GTGH 3S1NH 3OW2A 4IPGA 3STBC 1KL9A 5LMUQ 1UEBA 4B3TQ 3J7ZC 3UDGA 3GTJH 1VQNA 4LFBQ 3HOYH 3U58A 1K8AC 1VQJA 4NXML 1OXSC 4DR4Q 5IYBH 1JB7A 1EOVA 1VQ7A 2OWOA 3JAMc 2WB1G 3J80i 4XTCS 5C3EG 1KD1C 3RZOH 4R4TA 2Y0SG 2R93G 4B3RL 4DV2Q 1L0WA 2E8GA 4JG2A 4IPHA 2BA0A 1S72A 4A3EH 3AEVA 1HZAA 1YNXA 1UE5A 4LFCL 1MIUA 1TWGH 5C4JH 2UXBL 4A3FG 4KHPQ 2UUAQ 3G6EA 4DR5L 1VQ9A 2N49A 1TWAH 5GAHC 3NENA 4O0AA 4A76A 4GKKL 4OX9L 4LF7Q 2NZOA 1YI2A 1N34Q 4WJ4A 3PCOB 4JOIA 3A5ZB 4QY7A 1K8GA 3HOWH 2HIVA 2R7FA 1X54A 4YY3Q 4A3DG 2ZTEA 4DV5Q 1U5KA 2RF4A 4R4QA 2HT1A 3VDYA 3PV0A 3PUWA 2K14A 5LMUL 3JAMi
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V1C C;  1VS0 A;  3A0J A;  2BH8 A;  3FKI G;  4APV A;  1PH8 A;  1VCI A;  4NPS A;  1DGS A;  1XPO A;  4B3T L;  4LFB L;  4PZ7 A;  4IOC A;  3J81 j;  3ULJ A;  4DV7 Q;  1NJI C;  4LUV A;  4LF4 L;  2PMZ E;  3E0E A;  3TRE A;  4HJ8 A;  5EAY A;  1MJC A;  5HY6 A;  1NE3 A;  4DR4 L;  5K36 G;  2B63 G;  2D62 A;  4BXX H;  4A93 H;  3CPW A;  3S2D H;  2R93 H;  4UP8 A;  2UUC Q;  4IO9 A;  4LF5 Q;  4KI0 A;  4JI2 L;  5IT9 c;  3PIO A;  5J3B A;  4B3R Q;  4L5Q A;  1N8R C;  1KHI A;  1I50 H;  3E9H A;  1B70 B;  2I0Q A;  1JMC A;  4R1J A;  4KHP L;  2UUA L;  2UUB Q;  1QUQ A;  5IP7 H;  3LGJ A;  4A3F H;  3M9B A;  4JI0 L;  1PH7 A;  2R6G A;  4UP7 A;  4A3I G;  4IOA A;  2RCN A;  4TQU S;  1HH2 P;  3EIV A;  3RLN A;  1N34 L;  4LF7 L;  1Z47 A;  4DK6 C;  3PGZ A;  3K81 C;  4DAM A;  3KJP A;  1Q82 C;  3F8T A;  5IP9 H;  4YY3 L;  4IPD A;  4A3D H;  2EIF A;  3CCR A;  1CKN A;  2DGY A;  1EIY B;  4LF6 Q;  4OO1 G;  2GN5 A;  1HNW Q;  1X3F A;  2VY3 A;  3JC6 6;  3L7Z C;  1N9W A;  3KLW A;  3FKI H;  3CME A;  1IBK Q;  3S16 H;  2CQO A;  1V1Q A;  3ICE A;  1W3S A;  4BA1 I;  3CD6 A;  1Q86 C;  3Q8D A;  3S14 H;  1YHQ A;  1W2B A;  2JA5 G;  1XNQ Q;  1PH4 A;  2B3G A;  1E1O A;  4NXN Q;  2B63 H;  1S3O A;  1PVO A;  5M3M G;  4X62 Q;  1Y14 B;  4A3M G;  4KLK A;  2YTX A;  3G48 A;  1AE3 A;  1WYD A;  4YWK A;  2UUC L;  4DV0 L;  3DLL A;  4DR2 Q;  1X9N A;  4LF5 L;  2IX0 A;  2OQ0 A;  1K3R A;  2K50 A;  4X65 Q;  4ALP A;  4QQB X;  3CP0 A;  4HIM A;  1I94 Q;  1L1O B;  3TS0 A;  4JI5 L;  1J5E Q;  1OXT A;  4PZ6 A;  2ASB A;  3PF4 A;  2UUB L;  5LMN Q;  3HOX G;  3S1Q H;  5M5Y H;  2VS1 A;  2E2I H;  3I56 A;  4DV3 L;  2VL6 A;  1YHB A;  4A3I H;  1VQH A;  4TVA B;  3BU2 A;  3KF8 B;  4DAY B;  2QA4 A;  2EQS A;  4JI6 L;  2A19 A;  2VZA A;  1A62 A;  1PFS A;  1NBW A;  3UDI A;  1HR0 W;  2MO0 A;  4JI7 L;  1HNW L;  3FP9 A;  5JEA G;  4GLX A;  2GVB A;  3PO2 G;  3K8A A;  2K5V A;  4A4I A;  2JA6 G;  1UE7 A;  1IBK L;  4K0K Q;  1RL2 A;  3H3V I;  1T9H A;  3F2D A;  3CW2 C;  1PYS B;  2VW9 A;  4B3S Q;  1VQ6 A;  4BY7 G;  4Y52 H;  2Q2H A;  3HOV H;  3RLF A;  2YYZ A;  1P16 A;  4JI4 Q;  1K9M C;  3U4V A;  4GOP B;  1K73 C;  1KAW A;  2WFW A;  1YJ9 A;  4X62 L;  1PH6 A;  1IYJ B;  1WFQ A;  1VQO A;  5JJK A;  4A3L G;  5M3M H;  1SRU A;  2ALY B;  1E1T A;  3IRB A;  4YWM A;  3F2C A;  4DR2 L;  1YIT A;  1PH2 A;  1SMX A;  3EN2 A;  4HID A;  1B7Y B;  4EX5 A;  5HGQ A;  4X65 L;  3M85 A;  5GAE C;  1I94 L;  4LF4 Q;  4LUZ A;  1J5E L;  1TXY A;  1B8A A;  3OTO Q;  5C0X G;  5LMN L;  3CCV A;  4A3K G;  3SGI A;  5FJ8 G;  3RN5 A;  1GM5 A;  2VUM G;  1UWV A;  3HOX H;  1Q7Y C;  2R92 G;  1EIF A;  4DR1 L;  3H3V H;  1PYB A;  4MTN A;  1U0L A;  3AQQ A;  3HOU H;  4DR6 Q;  1KIX A;  3AFP A;  4JI2 Q;  3STB D;  3CC4 A;  4JI1 Q;  2BH2 A;  4EQ5 A;  2MQH A;  4X64 Q;  2K52 A;  2ZTC A;  1YHA A;  1Y1V H;  1N36 L;  4HIK A;  2JA9 A;  2NVX H;  2VQE L;  1XTD A;  2Q2T A;  1OXX K;  4K0K L;  3S24 A;  5C0X I;  4A3B G;  3TQY A;  1L1O C;  2GVA A;  4JI0 Q;  4B3S L;  1PV4 A;  2C35 B;  4DUY Q;  1CKO A;  3HKZ E;  2HHH Q;  1EYG A;  4JI4 L;  4BY7 H;  4O2D A;  4DNI A;  2VQF Q;  1XPU A;  1KRT A;  4B3M L;  3T1Y L;  3H15 A;  2UXC Q;  3S1M H;  3M4P A;  1QVF A;  4DR7 Q;  4WJ3 M;  1TWH H;  4DUZ L;  2XTI A;  4A3L H;  3TS2 A;  3OYY A;  1EQQ A;  2MFI A;  3UE0 A;  3BZK A;  2NVY H;  4PZ8 A;  3A74 A;  1VQG A;  1EFW A;  4QJF A;  1GKH A;  4GN3 B;  1OXV A;  2IT1 A;  5DLQ E;  3OTO L;  1A0I A;  4DV6 Q;  1JE5 A;  3GD7 A;  1GO3 E;  2JA7 G;  2E5L Q;  2D0O A;  2ATW A;  2YTY A;  1A63 A;  1CSP A;  4A3K H;  3B6Y A;  4GNX B;  3PO3 G;  2QEX A;  2R92 H;  5C3E H;  5JJI A;  1Q12 A;  4L5T A;  2CCZ A;  4DR6 L;  4X66 Q;  1M90 C;  2NVQ H;  4AYB E;  4DV0 Q;  1D7Q A;  4JI1 L;  4GLA C;  3CAM A;  4X64 L;  5C44 G;  3RN2 A;  1NMG A;  4JI5 Q;  2AWN A;  2K75 A;  4HJA A;  2KCT A;  4POF A;  2L15 A;  2IX1 A;  4L5R C;  3D0F A;  4LF8 Q;  3HKZ G;  4DUY L;  5H1S E;  1X56 A;  1LTL A;  2B29 A;  2WP8 J;  1Q1B A;  3DM3 A;  4DV3 Q;  1KC8 C;  2HHH L;  4X6A H;  2JEB I;  4BBR G;  2Q2U A;  3GTQ H;  3PF5 A;  2NN6 G;  1SFO H;  1IBL Q;  1K83 H;  1SE8 A;  4AQY L;  3W1G A;  4JI6 Q;  3H0G G;  4OXP A;  1Q46 A;  1VQB A;  1HZ9 A;  1L1O A;  2AMC B;  1VQ4 A;  1ASZ A;  1R9T H;  1C0A A;  4DR7 L;  1HZB A;  3I55 A;  2LXK A;  4JI7 Q;  1L2F A;  5IYC G;  2VNU D;  2I5H A;  4XIG S;  1QVC A;  1MJE A;  1VQD A;  1BVS A;  1EUJ A;  4IFD G;  5ELO A;  4QL5 A;  3BJU A;  5IWA Q;  4JCV E;  3HFZ B;  1AE2 A;  1X55 A;  1I6H H;  3M7N A;  2UXC L;  4JC0 A;  4DV6 L;  1QVG A;  2E5L L;  2JA7 H;  1VQK A;  5M3F G;  5C4X G;  1IL2 A;  4GN5 A;  1TWF H;  3KF6 B;  2Z0S A;  1P8L A;  2CFM A;  2EXD A;  1GD7 A;  3PUV A;  2JA8 G;  4AYB G;  1YZ6 A;  4X66 L;  4OO1 I;  3ULP A;  2CKZ B;  3I4N G;  3CCL A;  3GTP H;  1N32 L;  2AHO B;  2RHQ B;  2RHS B;  2JJQ A;  1WOC A;  5FLX c;  4IFD I;  2ES2 A;  2AWO A;  3U50 C;  5C44 H;  5C0X J;  3KOJ A;  1VQ5 A;  1KXL A;  2ZJQ A;  2A8V A;  5M5W H;  4LF8 L;  4DR1 Q;  3W5O A;  3PUZ A;  1YJW A;  3BZC A;  2K4K A;  1C7Y A;  1IXR A;  1SN8 A;  3RLO A;  3J81 i;  1MKH A;  1ASY A;  3UDX A;  1XPR A;  1IBL L;  1N33 L;  1QUQ B;  4UPA A;  4GNX C;  3CC2 A;  4BY1 G;  3CCU A;  4DR3 Q;  2F52 A;  3F2B A;  3H0G H;  1JT8 A;  4YWL A;  2IY5 B;  5FLM G;  1N36 Q;  3HOY G;  5IYD G;  3ER0 A;  2VQE Q;  3PUX A;  1HR0 Q;  4L5S A;  3MXN B;  5IYC H;  3I7F A;  1LYL A;  1VQP A;  3PUY A;  5BR8 Q;  1QZH A;  4DV1 Q;  5IWA L;  4LUO A;  5IYB G;  1K0R A;  1JJ2 A;  3F1Z A;  3G71 A;  1X3E A;  4IPC A;  3CC7 A;  2PQA B;  1PH3 A;  1PH9 A;  4JBK A;  1NTG A;  4AH6 A;  1PH5 A;  2JA5 H;  5E7N A;  4B3M Q;  1BBU A;  3T1Y Q;  1BBW A;  4LF9 Q;  4LW1 A;  1V43 A;  4YCU A;  4DK3 C;  1M1K C;  5M3F H;  2H5X A;  2ZJR A;  4A3M H;  3TEH B;  4DUZ Q;  3GTK H;  1A8V A;  3K80 C;  2Z6K C;  4MZ9 A;  1IBM L;  2UXD Q;  4JBW A;  4NB3 A;  2FXQ A;  3U4Z A;  4FDB A;  4R4O A;  3I2Z A;  1Q1E A;  3M4Q A;  1XMO Q;  1KQS A;  4IJH A;  2F4V L;  3HOW G;  2YU9 H;  1D8L A;  2MNA A;  1G51 A;  1G29 1;  5GQO A;  2JEA I;  1FJG Q;  4LFA Q;  1TWC H;  3ZJY C;  4DR3 L;  2LXJ A;  4BY1 H;  2WAQ E;  2NZH A;  3L0O A;  3CCQ A;  3KDF B;  1RIP A;  3RR5 A;  3CQZ H;  2ZJP A;  1HR0 L;  4A3G G;  5JJL A;  5FLM H;  4GN4 B;  4P71 A;  3J7A 5;  2KBN A;  5IYD H;  1UE6 A;  4GNX A;  3PO2 H;  2R7Z G;  5BR8 L;  4GKJ Q;  1E22 A;  1PH1 A;  5IY0 A;  4DV1 L;  2JA6 H;  4A75 A;  1NMF A;  1UE1 A;  1Y1W G;  2K5N A;  1OTC A;  3WWV A;  4BXX G;  2N3S A;  4A93 G;  1CUK A;  4P75 A;  4C3H H;  5AJ3 L;  4DV4 Q;  3ERS X;  4AQY Q;  3E9I A;  1LUZ A;  3CCE A;  4LF9 L;  1PHJ A;  2K5H A;  4HJ9 A;  3M3Y H;  4OWT B;  1VQF A;  1X6O A;  4KHZ A;  4P73 A;  4JI3 Q;  3RZD H;  1NY4 A;  3S1R H;  4J15 A;  4IFD J;  1J6Q A;  2OCE A;  1VQ8 A;  3NEL A;  1S40 A;  1JJG A;  4LNQ A;  1Q81 C;  4HJ7 A;  3AFQ A;  5IP7 G;  2E2H H;  1LM0 A;  2N8N A;  3HOZ G;  2HIX A;  1V9P A;  3EBE A;  1YVC A;  5GRO A;  1SR3 A;  2Z6K A;  5FJ8 H;  1WCM G;  1XMO L;  2E2J H;  2VUM H;  3TRZ A;  4MNO A;  4HIO A;  5IP9 G;  1XMQ L;  4H02 A;  3GTL H;  4GOP C;  1Z9F A;  3CPF A;  1KRS A;  4LFA L;  2PNH A;  1FJG L;  3GTO H;  1N32 Q;  2WAQ G;  4BA2 I;  2KCM A;  5GAG C;  2D0P A;  2PI2 E;  3T1H Q;  1I3Q H;  1FGU A;  4A3C G;  1GVP A;  1HNZ Q;  4A3G H;  4UY8 C;  1YIJ A;  3KF6 A;  4GKJ L;  4IJL A;  3K0X A;  5GAD C;  1HNX Q;  4A3B H;  2R7Z H;  3KJO A;  2AKW B;  2NVT H;  4PMW A;  1N33 Q;  1Y1W H;  1VQL A;  2UXD L;  1I5F A;  3CCM A;  4DV4 L;  2QGQ A;  4RMF A;  2UU9 Q;  4DV2 L;  2ZM6 Q;  2OQK A;  5JEA J;  2N78 A;  1WJJ A;  4AIM A;  3D31 A;  2DUD A;  4JI3 L;  3ULL A;  2I5M X;  3S17 H;  3MEF A;  3J81 c;  4JYA Q;  3A5U A;  1XNR Q;  3NEM A;  2YTV A;  1VQM A;  2I5L X;  1PA6 A;  1QZG A;  3I4M G;  2NN6 I;  3HKS A;  4RG1 A;  3HOZ H;  4LWC A;  4YHH Q;  1EWI A;  1CKM A;  3UDF A;  4A3J G;  3PO3 H;  1SLJ A;  1WCM H;  4POG A;  4JV5 Q;  4Y7N H;  4HJ5 A;  4YCW A;  2CWA A;  4DV5 L;  1VQE A;  3GTM H;  1IBM Q;  4JBJ A;  2F3I A;  2VQF L;  1VQI A;  2PQA A;  4C2M H;  3KFU A;  1WI5 A;  3T1H L;  1YEZ A;  1YBY A;  4GOP A;  1HNZ L;  1VQA A;  3GO5 A;  4DV7 L;  3S2H H;  5ELN A;  3HOV G;  3I4O A;  4A3C H;  1XJV A;  2YV5 A;  1HNX L;  3PIP A;  2XGT A;  4R4C A;  4DPG A;  2F4V Q;  1EQR A;  4BBS G;  4OWX B;  4JI8 Q;  1G6P A;  1AH9 A;  4BBR H;  4OWW B;  3K7U C;  2OTL A;  2UU9 L;  2ZM6 L;  1CSQ A;  2JE6 I;  2JQO A;  4ME3 A;  5M5X H;  4DKA C;  3UE1 A;  3S15 H;  5IE8 A;  4QGU A;  1X65 A;  1E3P A;  4OON A;  3G4S A;  1IZ6 A;  3CF5 A;  4YCV A;  1X3G A;  4NXM Q;  5LMN W;  4JYA L;  1CKN B;  3CXC A;  4C3I H;  1XNR L;  2OTJ A;  2CWP A;  1HZC A;  2KHJ A;  3GDE A;  5AJ3 Q;  2Q2I A;  4QIW E;  2KEN A;  3HOU G;  2WB1 E;  3NBH B;  4YHH L;  2PI2 A;  1E24 A;  2MO1 A;  3AYH B;  3KDF A;  5C4X H;  1VQC A;  2Y0S E;  4UP9 A;  2LSS A;  4A3E G;  2KHI A;  2ZTD A;  4JV5 L;  3L2P A;  1BKB A;  1SRO A;  4A3J H;  2JA8 H;  3KYH C;  1YJN A;  2IHE A;  4R4I A;  4P72 A;  1Y1V G;  4LFC Q;  1C9O A;  3I4N H;  1FL0 A;  2ID0 A;  2JK8 A;  4LF6 L;  4JOI C;  3J80 c;  4GS3 A;  3CMA A;  3CCJ A;  3RNU A;  2UXB Q;  1O7I A;  3CCS A;  4DR5 Q;  2IHF A;  3PSI A;  3FHW A;  2A1A A;  1Q8K A;  4P74 A;  3K7A H;  3M4O H;  4GKK Q;  2R7D A;  4OX9 Q;  1OXU A;  1JJC B;  3W1B A;  1XMQ Q;  4GLV B;  1XNQ L;  4JI8 L;  3I4M H;  4C3J H;  4JBM A;  2HQL A;  4PG3 A;  1E7Z A;  4BBS H;  1HJP A;  4NXN L;  1H95 A;  1FVI A;  2BA1 A;  3GTG H;  3S1N H;  3OW2 A;  4IPG A;  3STB C;  1KL9 A;  5LMU Q;  1UEB A;  4B3T Q;  3J7Z C;  3UDG A;  3GTJ H;  1VQN A;  4LFB Q;  3HOY H;  3U58 A;  1K8A C;  1VQJ A;  4NXM L;  1OXS C;  4DR4 Q;  5IYB H;  1JB7 A;  1EOV A;  1VQ7 A;  2OWO A;  3JAM c;  2WB1 G;  3J80 i;  4XTC S;  5C3E G;  1KD1 C;  3RZO H;  4R4T A;  2Y0S G;  2R93 G;  4B3R L;  4DV2 Q;  1L0W A;  2E8G A;  4JG2 A;  4IPH A;  2BA0 A;  1S72 A;  4A3E H;  3AEV A;  1HZA A;  1YNX A;  1UE5 A;  4LFC L;  1MIU A;  1TWG H;  5C4J H;  2UXB L;  4A3F G;  4KHP Q;  2UUA Q;  3G6E A;  4DR5 L;  1VQ9 A;  2N49 A;  1TWA H;  5GAH C;  3NEN A;  4O0A A;  4A76 A;  4GKK L;  4OX9 L;  4LF7 Q;  2NZO A;  1YI2 A;  1N34 Q;  4WJ4 A;  3PCO B;  4JOI A;  3A5Z B;  4QY7 A;  1K8G A;  3HOW H;  2HIV A;  2R7F A;  1X54 A;  4YY3 Q;  4A3D G;  2ZTE A;  4DV5 Q;  1U5K A;  2RF4 A;  4R4Q A;  2HT1 A;  3VDY A;  3PV0 A;  3PUW A;  2K14 A;  5LMU L;  3JAM i; 
#chains in the Genus database with same CATH topology
 2Q8I B;  3MWY W;  4APV A;  5EBC A;  2JSO A;  4B3T L;  4LFB L;  2B2V A;  4PZ7 A;  4QIW A;  2EY2 A;  4LF4 L;  4K2L A;  3RGX A;  4CGY B;  2IMW P;  1II3 A;  1STN A;  4K8I A;  4DAP A;  1JOR A;  4DN4 M;  2HHH H;  4BXX H;  2BOS A;  2NTS A;  2HQE A;  4UP8 A;  2UUC Q;  3RGZ A;  2NWG A;  4MV3 A;  4KI0 A;  4L5Q A;  1N8R C;  2FK2 A;  2K32 A;  4N9T A;  3DEO A;  2JEG A;  1WTV A;  1IL8 A;  3N42 B;  5L1J A;  3M9B A;  3TME A;  1PTO H;  2PQE A;  4UP7 A;  1N34 L;  2KEE A;  3DWP A;  1Z47 A;  5I47 A;  3KJP A;  3K81 C;  1CA6 A;  4IRC A;  3MXN A;  3FKI A;  4XT3 B;  5KFL A;  1CKN A;  4CDC C;  1T5X D;  2VA3 A;  2RDH A;  3BS1 A;  2AGO A;  3L7Z C;  4E6I A;  1N9W A;  5IT9 E;  4ECU A;  4IRK A;  1T36 A;  3BAB A;  1IBK Q;  4RB2 C;  1V1Q A;  1BCP B;  1GUG A;  1FNU A;  3NBH A;  1KDB A;  3IFT A;  2R7Z B;  2R6F A;  1Q86 C;  3RIZ A;  3S14 H;  1YHQ A;  2R7N A;  1V51 A;  2KUM A;  2GPS A;  3H3V C;  5K36 H;  3J7A K;  3JAM W;  2B63 H;  4H0L C;  1N33 H;  3VYR A;  5M3M G;  4X62 Q;  4KLK A;  4JI6 H;  3KLS A;  1AE3 A;  5CGK A;  3MR3 A;  2NUC A;  1RF2 D;  2UUC L;  3S17 B;  1X9N A;  4GC6 A;  2OQ0 A;  2XCP A;  4ALP A;  1L1O B;  4WJW A;  2ASB A;  4CBV A;  3TIN A;  3S1Q H;  2ENB A;  2A6E C;  3MAQ A;  2VS1 A;  2E2I H;  4EEQ A;  4RGT A;  3I56 A;  2VL6 A;  4FXK C;  1YHB A;  2ATL A;  5D3I B;  1VQH A;  4TVA B;  2WYO A;  2QA4 A;  2V5A A;  1A6X A;  3T56 B;  5IIF A;  1A62 A;  1NBW A;  2XGQ A;  1J8I A;  1KLG D;  2XIG A;  4JI7 L;  4ED0 A;  2B2U A;  4IUR A;  4C2M B;  2NU9 B;  1ONL A;  2GVB A;  2JA5 A;  1EY8 A;  4A4I A;  1UE7 A;  1IBK L;  4ZCK A;  3GQC A;  1HUN A;  1VQ6 A;  3M9M B;  1EY7 A;  2Q2H A;  3T5J A;  3FMA A;  5KFE A;  1K9M C;  1K8O A;  3U4V A;  1YJ9 A;  4X62 L;  4I55 F;  2R86 A;  2F3W A;  3H0G B;  1BBX C;  4A3L G;  4YAK B;  3V4S A;  1E1T A;  4K5X A;  4YWM A;  3F2U A;  4HID A;  1N36 H;  1HR0 H;  4XXE A;  4RKB A;  4TUY F;  4LUZ A;  1TQO A;  4J9S A;  2FLN A;  2XD4 A;  1OWT A;  1TWC A;  4R8U A;  2R8K A;  3HOX H;  4DL2 A;  4DR1 L;  2XCL A;  1F2Y A;  4B3M H;  5C4X B;  3AQQ A;  4Q0F A;  5KFR A;  3OWE B;  1HFN A;  4NW2 A;  1CHQ D;  2F0M A;  1STY A;  2BH2 A;  3Q1K A;  4IWY A;  3I4N B;  2XNA C;  3URY A;  4DGZ A;  2NVX H;  2VQE L;  1OXX K;  1IW7 D;  4IUP A;  3TQY A;  1EUD B;  4QWB A;  4GC7 A;  4DUY Q;  2Z1C A;  5DNF A;  2HUG A;  2W57 A;  1XMO H;  1Z2N X;  5FO7 B;  3T1Y L;  3OSP A;  4BY1 B;  1QVF A;  4DR7 Q;  4O1N A;  1E2Z A;  1TVX A;  4DUZ L;  3BDC A;  4OIK A;  1KJI A;  3TS2 A;  5KT7 A;  2MFI A;  2XRS D;  3UE0 A;  2X69 A;  1IOW A;  2FKL A;  2Y0S A;  1GKH A;  3H4D A;  1TT2 A;  2UXC Q;  5DLQ E;  4DV6 Q;  1A0I A;  2JA7 G;  1JE5 A;  4CJ2 C;  1CSP A;  2K03 A;  1I4H A;  1E4E B;  3CRK C;  2UVW A;  4L5T A;  4X66 Q;  1S0M A;  1SE3 A;  3S1R B;  4FO2 A;  4JI3 H;  1GUO A;  1VMC A;  1Q8I A;  3D4R A;  5C44 G;  3HRZ C;  2A73 B;  1O7Z A;  2K75 A;  4POF A;  2L15 A;  2IJ0 A;  5DGA A;  2UVU A;  4DUY L;  4S3S A;  1GSO A;  4J8Q A;  4ZK9 B;  1KC8 C;  4BBR G;  2Q2U A;  3GTQ H;  4HR7 A;  3PF5 A;  1LV9 A;  2NN6 G;  1SFO H;  1SCU B;  1SE8 A;  3W1G A;  4OXP A;  2V58 A;  2ZXO A;  1L1O A;  2AMC B;  1D1K A;  2J6S A;  3JRX A;  4DR7 L;  1D6E C;  1HZB A;  3U9T A;  3TQ1 A;  2R82 A;  3VR5 A;  4I50 F;  4A3G B;  3T1H H;  2C28 A;  1NAP A;  2JXM B;  1L0X B;  5ELO A;  1HNZ H;  3M7N A;  2UXC L;  4DV6 L;  3AB9 A;  1HXY D;  5CV8 A;  1QVG A;  5KFK A;  2F0W A;  4Z9C B;  4ZUJ A;  2EYJ A;  3NK9 A;  1LTS D;  5M3F G;  1VQK A;  4KKT A;  3S2D B;  2CFM A;  4O3R A;  2R93 B;  1YZ6 A;  4X66 L;  4YR2 A;  3R2I A;  1B6S A;  5C5J A;  2FFK B;  4DXF A;  3GTP H;  1N32 L;  1EZ1 A;  2RHS B;  4IUQ A;  2C5C A;  5ELB A;  4FU0 A;  3MJF A;  3KOJ A;  1VQ5 A;  4JYA H;  4EYH B;  2W71 A;  1XNR H;  2A8V A;  1HFG A;  3H0G A;  3MWM A;  4CDD C;  1I4P A;  2ZT9 C;  1IXR A;  4ED1 A;  4ILW A;  3RLO A;  1MKH A;  5CYU A;  5JUM A;  2F0Q A;  4J9K A;  2RSN A;  3CU7 A;  1WTH A;  3CRL C;  3PMF A;  2F52 A;  3QFF A;  3VR2 A;  2LFN A;  1IBM H;  3R5H A;  1I7N A;  2L1B A;  5IYD G;  3HOY G;  4ZYS A;  1UEA B;  1RDP D;  3TII A;  1LYL A;  5BR8 Q;  5IYB G;  1JJ2 A;  4YAJ B;  5NUC A;  4C5C A;  3PIP 3;  2CH4 W;  1X3E A;  1S0N A;  2A6E D;  3MEH A;  2M2L A;  2PZT A;  4C3H G;  3H6M A;  1PH3 A;  1H9J A;  1NTG A;  4JBK A;  5A2Q L;  1FKA H;  1GYF A;  1PK8 A;  4M8A A;  1YNJ C;  2B8F A;  1SEI A;  3NBI A;  3S15 B;  2KOL A;  1A8V A;  4HCS A;  1M8A A;  2EY6 A;  1SMY D;  1X32 A;  4ME5 A;  2KA7 A;  4MN3 A;  4R4O A;  3I2Z A;  4KJN A;  1BCP C;  4RCO A;  4HNV A;  3M9N B;  3GIM A;  2DNE A;  3M4Q A;  1KQS A;  2F4V L;  2R8J A;  1SYF A;  1D8L A;  2SEB D;  3RAX A;  2JEA I;  1FJG Q;  1XDN A;  1KAA A;  4IR9 A;  1B44 D;  1NSN S;  2LXJ A;  3NTH A;  5EQ0 A;  1GUT A;  3RR5 A;  3Q0A A;  3CQZ H;  5LL6 S;  4KY5 A;  4O4H F;  1UE6 A;  2PZU A;  5BR8 L;  1PH1 A;  4GKJ Q;  2A69 C;  3NPP A;  1PRT D;  3HOV B;  5KFA A;  3K3P A;  4A93 G;  1CUK A;  4P75 A;  4KJO A;  4DK1 A;  4DV4 Q;  1LUZ A;  1SYX B;  4U6P A;  5M3M B;  3VPB A;  1VQF A;  5BPH A;  2Z4I A;  3RZD H;  1BDO A;  1UNS A;  5D1O B;  2NUA B;  2OCE A;  4B3T H;  2F0U A;  1TAE A;  4LFB H;  4LNQ A;  4YB8 B;  4PMC A;  3HOZ G;  5KFQ A;  2E2J H;  4F88 A;  4MNO A;  3HOU B;  4H02 A;  4V0B A;  4DV2 H;  2F4I A;  3CPF A;  1JOQ A;  1LTG D;  1FJG L;  4BA2 I;  2KCM A;  2Z6B A;  3C3L A;  4MAM A;  2D0P A;  1LAC A;  1RJQ A;  1I3Q H;  4A2B A;  4A3C G;  2R61 A;  2FJZ A;  4JVZ A;  4GKJ L;  3K0X A;  4RU9 A;  2E2D C;  3KJO A;  1N34 H;  3EFX D;  4PMW A;  1A9X A;  5KYI A;  1HQM C;  1Y1W H;  1N33 Q;  5DG8 A;  3J7Y W;  3CCM A;  4DV4 L;  2I87 A;  3PVX A;  4MTE A;  3P75 A;  2JEI A;  1TWH B;  2DUD A;  5BN3 A;  3IL8 A;  3Q8S B;  5IGC A;  4DFA A;  1IYV A;  1CT1 D;  3PZP A;  3NUC A;  1SSO A;  1CI3 M;  1WCM A;  3S1N B;  1SJH D;  4DAY A;  2YTV A;  4U68 A;  1SE2 A;  2G9D A;  2I07 B;  1KAB A;  5C6A A;  5KT4 A;  3RJ0 A;  4HYK A;  3HKS A;  2MCT A;  2WB1 B;  4V19 0;  5KFU A;  4A3J G;  2LS0 1;  2UUC H;  1SDF A;  5C5L A;  2LKV A;  5KG5 A;  4YBZ B;  1BUV T;  1U4M A;  4JK1 C;  2VQF L;  1RJT A;  1B6R A;  2W6N A;  2BQR A;  1PZJ D;  1YBY A;  1VQA A;  3GO5 A;  4DV7 L;  3S2H H;  3J81 E;  3I4O A;  2AU0 A;  4OL7 A;  4DPG A;  3GV7 B;  4BBS G;  4OWX B;  1K83 B;  2ASD A;  4BBR H;  4OWW B;  2XVS A;  4A3D B;  2JE6 I;  4FYD A;  4P2C B;  3UE1 A;  2YS7 A;  4JI7 H;  3VR4 A;  1I4R A;  1E3P A;  5E3F A;  2VB2 X;  3J7A V;  1IBK H;  3CXC A;  1T3N A;  1EZ6 A;  2R8I A;  5HV6 A;  2JA7 B;  1KJJ A;  5KFO A;  1TWF B;  2EVB A;  2WB1 E;  3QZ8 A;  4G3I A;  3I4M H;  3GTM H;  3N52 A;  1DCZ A;  4X62 H;  1B9M A;  1SRO A;  3V6K A;  1QNK A;  2IHE A;  1N56 A;  4NXN H;  2ID0 A;  4LF6 L;  2W8K A;  5C44 B;  3E6Z X;  4DR5 Q;  2DY8 A;  1KBL A;  4GKK Q;  4O3O A;  3ND9 A;  1Z2O X;  3MZ5 A;  2JN4 A;  1S0O A;  3EJI A;  4CKE A;  1CA5 A;  3W1B A;  1JCK B;  3QB3 A;  3GTJ A;  1E7Z A;  1YNJ D;  4I7Z C;  4R8N A;  1S03 G;  2N55 A;  1JWM D;  2BA1 A;  1H95 A;  5COR A;  4N9P A;  3OW2 A;  3STB C;  3BG3 A;  1DON A;  5KG7 A;  1HQR D;  1BOS A;  4B9X A;  1VQN A;  3HOY H;  2VQE H;  5L1L A;  2BR0 A;  1VQJ A;  2PMZ B;  1WTR A;  1EYA A;  1Z6H A;  4EGQ A;  3G6V A;  1OXS C;  5JVH 3;  5IYB H;  5EOY A;  4ED3 A;  1JOK A;  5IGD A;  2Y0S G;  5KFW A;  4ZKC B;  2E8G A;  2R7M A;  1S9F A;  4IPH A;  2BA0 A;  2TSS A;  1I7L A;  3FDT A;  5ELD A;  1NNX A;  1TKW B;  1YNX A;  3I8Z A;  3NTK A;  1UE5 A;  1EOT A;  1IHZ A;  1JOO A;  2UUA Q;  2QF7 A;  3PR4 A;  4DR5 L;  1JB3 A;  1ET6 A;  4GKK L;  1M0T A;  4WJ4 A;  1KTK A;  1LTB D;  3PCO B;  4CHT B;  3JAM E;  2R7F A;  3VR3 A;  4R4Q A;  2WV6 D;  1S5C D;  3EQL C;  3EPI A;  3E5S A;  2EYM A;  1VS0 A;  3FMC A;  1VCI A;  1DGS A;  2FK1 A;  1NJI C;  4OGQ C;  3ULJ A;  5KFV A;  3PO2 B;  4LUV A;  2WB1 A;  2JA6 B;  2PMZ E;  3TRE A;  4DUY H;  1L2Z A;  1NE3 A;  3OOC A;  3BVG A;  5K36 G;  2B63 G;  1PZI D;  4IWX A;  5KG3 A;  1LT6 D;  4EVO A;  4A93 H;  3CPW A;  3LWU A;  2G9H D;  2W9C B;  3HGB A;  3SR1 A;  3VA7 A;  3OW7 A;  4EGJ A;  3WOF A;  4IO9 A;  4DR7 H;  4Q43 A;  3PW4 A;  2NVY B;  1I50 H;  2I0Q A;  1JMC A;  3K59 A;  2UUA L;  1K83 A;  2UXC H;  4DV6 H;  4IOA A;  3BQ0 A;  4J6H A;  4TQU S;  4ZOL F;  1ZKO A;  1U4R A;  1A3U A;  3GTL B;  1EZ8 A;  1K3B C;  4X66 H;  1ML0 D;  2PBZ A;  4CDE C;  4XZ3 B;  2EIF A;  3CCR A;  1DYQ A;  1HNW Q;  1S5F D;  1U4P A;  3MXG A;  3FKI H;  3TP5 A;  3CME A;  3QJY A;  2VXW A;  3T16 A;  4BA1 I;  5IGG A;  3KBG A;  1D2B A;  3Q8D A;  4HSV A;  2ZDH A;  3GV5 B;  3KBX A;  1W2B A;  2NVT B;  1XNQ Q;  4H44 C;  2OF1 A;  2FMA A;  4RHR A;  1S3O A;  2EZV A;  5LHY 1;  4A3M G;  4O3P A;  2YW2 A;  3G48 A;  2F0I A;  5DM6 3;  4YWK A;  2K33 A;  4DV0 L;  5I4D A;  3EPG A;  2IX0 A;  2J6T A;  1C30 A;  4UCS A;  4UCT A;  2KCN A;  1RHP A;  2RDF A;  4JI5 L;  2QW7 A;  3PF4 A;  5LMN Q;  3HOX G;  5M5Y H;  1C48 A;  3HOZ B;  4DV3 L;  5I9O A;  4A3I H;  5D65 A;  3TP7 A;  1LTR D;  4Y7N B;  4CJ1 B;  4TV8 F;  3Q6S A;  4FM9 A;  2PMZ A;  3UDI A;  2MO0 A;  3X3N A;  3OHA A;  4HED A;  1HNW L;  1G6Z A;  4TRD A;  4OO1 H;  1RTN A;  2K5V A;  4A2A A;  1ZXT A;  4G57 A;  1T9H A;  4B3S Q;  1NR4 A;  1PYS B;  1CE8 A;  4ZQI A;  2AQ1 B;  4QW8 A;  3R5F A;  4QWA A;  2F4V H;  4GOP B;  1K73 C;  5CV5 A;  4IQZ A;  1PH6 A;  1IYJ B;  1VQO A;  5M5X B;  5KFJ A;  3F2C A;  3IRB A;  5CV4 A;  1YIT A;  5DQG A;  3EN2 A;  1JC7 A;  3OMG A;  1ZEQ X;  2E74 C;  3L4K A;  4LF4 Q;  5LXT F;  2W6O A;  4Q44 A;  4R8I A;  3K0Y A;  5BR8 H;  1JIH A;  5LMN L;  3CCV A;  1O80 A;  2VUM G;  3RN5 A;  3RB0 A;  4HTH A;  1Q7Y C;  3I3C A;  2ZXP A;  1PYB A;  1Q3L A;  1TU2 B;  4MTN A;  1U0L A;  4RAU C;  5K5P A;  1KJ8 A;  1Y1V A;  4DR6 Q;  4JUZ A;  1KIX A;  2DJG C;  4ZQ3 A;  4FNF A;  3GTK B;  3STB D;  4CDF C;  3ETH A;  2K52 A;  3DEP A;  1YHA A;  4F7X A;  2DJF C;  1XTD A;  1EY0 A;  2EYL A;  1UC8 A;  3DF7 A;  1O78 A;  3S24 A;  4A3B G;  1O7L A;  5LL6 X;  4B3S L;  1BXT A;  2W9C A;  2VR1 A;  3F8N A;  3OUU A;  5EWG A;  1EYG A;  1FYC A;  2YU9 B;  4O2D A;  3C1E A;  4BBS B;  1XPU A;  4YQW A;  2E76 C;  1EFI D;  2NVY A;  1PTO F;  3M4P A;  1FJG H;  1S5D D;  3GV3 A;  4MV4 A;  3Q8Q B;  3OYY A;  2KQ3 A;  3T13 A;  3BZK A;  5D3D A;  5L1I A;  1EY4 A;  2R92 A;  3OIP A;  5FO8 B;  1VQG A;  4O3S A;  3GTL A;  4QJF A;  4GKJ H;  1H9M A;  3E3X A;  4FF1 A;  3MC0 B;  2WTF A;  2O5I C;  2E5L Q;  1RK5 A;  2D0O A;  1A63 A;  3IN5 A;  3HP3 A;  1GUN A;  3B6Y A;  3PO3 G;  3D4W A;  4DV4 H;  5JVG 3;  1ZQ7 A;  5KND A;  5EPL A;  4DR6 L;  1VMP A;  4JV0 A;  2L5T A;  2NVQ H;  5JPM C;  2ASL A;  3RV3 A;  2CHB D;  3D4D A;  1SNC A;  3H40 A;  3AU7 A;  1ILQ A;  2MP1 A;  2E2H B;  1AUV A;  2AWN A;  4HJA A;  5D1P A;  4CJ0 B;  5FLX L;  4L5R C;  3D0F A;  3ITP A;  2AQ3 B;  3HKZ G;  5KFI A;  1R9T A;  1LTL A;  2WKC A;  1A3V A;  2WP8 J;  1Q1B A;  4G7H C;  4QCL A;  1B33 N;  2JEB I;  3D6W A;  1IBL Q;  2F0E A;  4AQY L;  2XGP A;  3RUZ A;  4IUT A;  4JI7 Q;  3I55 A;  3RTX A;  1L2F A;  2I5H A;  3KXY T;  5F9L A;  5E1F A;  2VQF H;  1QVC A;  1CFM A;  2YRX A;  1EUJ A;  1ZYR C;  1MD2 D;  4HN7 A;  4QL5 A;  4DV7 H;  4RUA A;  3MFY A;  4JCV E;  2CQY A;  3HFZ B;  1I6H H;  5T1G A;  4JC0 A;  5J2U F;  1EIH A;  1ULZ A;  1CQF A;  2E5L L;  1JLL B;  5G3L F;  3HZX A;  1IL2 A;  5CA0 F;  4GN5 A;  4HNU A;  4H13 C;  2Z0S A;  2JA8 G;  3PUV A;  4AYB G;  5LA6 F;  2FLP A;  4FXD A;  5FLX c;  4Y8V B;  2A68 C;  5C0X J;  3VR6 A;  2NU6 B;  1JIC A;  1W6J A;  2ZJQ A;  2HJW A;  5M5W H;  1PTO B;  3K57 A;  4DR1 Q;  1QB5 D;  3W5O A;  1EL0 A;  1YJW A;  4C3J G;  1V1O A;  3J81 i;  4G7Z C;  3UDX A;  1IBL L;  1QUQ B;  4UPA A;  1SXT A;  3CC2 A;  4IR1 A;  2K7V A;  3CCU A;  4O4I F;  3H0G H;  5EKI A;  1HCZ A;  1SJE D;  3KAL A;  3PW0 A;  3NHH A;  1H9K A;  3SK4 A;  2VQE Q;  5IYC H;  1DV2 A;  3P20 A;  2PW7 A;  3I7F A;  3T53 B;  3PUY A;  3RFC A;  5IGF A;  4YJ2 F;  2SOB A;  3MTS A;  4LUO A;  3R5X A;  3S14 B;  2W6Q A;  1FR3 A;  3GTK A;  2PO4 A;  2IPK D;  2DWC A;  3G6X A;  3T1Y Q;  4R9W A;  1AUX A;  1EUC B;  5KNC A;  2WAC A;  2H5X A;  2J6U A;  1M6V A;  3E0J A;  4A3M H;  2MPM A;  1XXG A;  4J9Q A;  4DUZ Q;  2VB3 X;  4TSS A;  2OEO A;  5KYL A;  4XDX A;  2CH4 A;  5KFP A;  3KUP A;  4NB3 A;  5KFB A;  1SNO A;  2YU9 A;  1ZET A;  3WOE A;  3U4Z A;  4C3I B;  3S1Q B;  5ELC A;  3BG5 A;  1NR2 A;  1SYD A;  2E2I B;  1X3Q A;  3KAK A;  5KG4 A;  2PW5 A;  4NLG A;  1A15 A;  3HOW G;  2C22 A;  4K6L A;  1GLV A;  4NP5 A;  4WD3 A;  2MNA A;  4DL4 A;  4JW0 A;  2IW3 A;  4DAV A;  4LFA Q;  2RCF A;  5EJW A;  1ILP A;  4BY1 H;  1HTP A;  5CV6 A;  1UC9 A;  4R7R A;  2R85 A;  2I80 A;  2HVR A;  3J7A 5;  2KBN A;  5EWE A;  4DR5 H;  3M4O B;  2K1B A;  4DF7 A;  1NMF A;  1H9S B;  4GKK H;  1Y1W G;  1OTC A;  3WWV A;  1ENC A;  2N3S A;  3R2T A;  5AJ3 L;  1Y8N B;  4PMB A;  2XWJ B;  3E9I A;  3T5K A;  3GTG B;  5BN5 A;  1SYB A;  2VQD A;  1IKL A;  4RGN A;  4ECQ A;  3SVM A;  2E2H A;  4P73 A;  4RKL A;  3E5N A;  3M7G A;  3M9O B;  1NY4 A;  3S1R H;  1D5M C;  4K2K A;  4J15 A;  1EYC A;  1J6Q A;  4IFD J;  1JJG A;  3NEL A;  3AFQ A;  4F50 A;  2N8N A;  1BNZ A;  3MR2 A;  3RZO B;  1V9P A;  2VUM H;  1MSH A;  1XMQ L;  4FF2 A;  4GOP C;  5CV7 A;  2BQU A;  4DU9 A;  2P0A A;  3CVZ A;  4LFA L;  2PNH A;  5J39 A;  1N32 Q;  1DIK A;  2WAQ G;  2JP1 A;  2R7Z A;  2NTT A;  1K8M A;  1EU3 A;  5C4J B;  2NVX B;  2RBM A;  4FBT A;  1FGU A;  1RYS A;  4A3G H;  2UUA H;  1EWH A;  1TWA B;  1YIJ A;  3O13 A;  4A3B H;  5ELE A;  1C3O A;  1XX8 A;  1SND A;  5CA1 F;  5EPK A;  3WDN A;  1VQL A;  5FPO A;  1JQY D;  4MTD A;  4ED7 A;  5C8Y F;  2ZM6 Q;  3A56 A;  5AFW A;  4HMI A;  2I5M X;  4RNM A;  1T94 A;  1W96 A;  2V9W A;  1Y69 U;  3A5U A;  1J9O A;  2CW0 C;  3ERQ A;  3VA5 A;  5JVL A;  3I4M G;  2NN6 I;  2HD3 A;  4J1M A;  1CKM A;  2F0S A;  2H1E A;  3UDF A;  1SYG A;  3PO3 H;  3FVQ A;  1WCM H;  4C2M A;  4QWD A;  3IG0 A;  2N88 A;  3PW7 A;  4HJ5 A;  2F1M A;  4YCW A;  5GON F;  4DL3 A;  3I90 A;  3RAQ A;  1VQE A;  3K5O A;  2F3I A;  2M00 A;  1AW7 A;  1HUM A;  4KV6 A;  1WI5 A;  1ZYR D;  1WSC A;  4RB1 A;  4JI5 H;  4EBD A;  2W6Z A;  3KHH A;  1XJV A;  5KFY A;  2XGT A;  2F4V Q;  1S4Z A;  3GTQ B;  3C2P A;  3R3O A;  1G6P A;  2X6L A;  2FK3 A;  2W8L A;  1CM9 A;  5K2M A;  2XRQ D;  3UQ8 A;  4EQO A;  1T5E A;  2ZM6 L;  3AMU A;  5FD5 A;  5KG6 A;  3HB9 A;  1U4L A;  4ECW A;  1LTT D;  4HMJ A;  3S15 H;  1HNW H;  1KEE A;  2C2E A;  2ZXR A;  4QGU A;  1BQQ T;  1X65 A;  4XYM B;  1DD2 A;  2VA2 A;  3G4S A;  4I65 A;  1X3G A;  3QZ7 A;  3T5L A;  4K8J A;  2CWP A;  4KD3 A;  4ZLT F;  3VPC A;  5DQH A;  1XNQ H;  3OUZ A;  3MXP A;  2KEN A;  4C56 C;  4B3R Q;  1B4O A;  1N48 A;  3TP8 A;  1AEX A;  3TDQ A;  1ROD A;  2WII B;  1TY2 A;  3L2P A;  2JA8 H;  3N8D A;  4P72 A;  1Y1V G;  2F0N A;  4LFC Q;  3HG9 A;  4JOI C;  4UFZ A;  4GS3 A;  3CMA A;  1CQJ B;  2UXB Q;  3PSI A;  3FHW A;  4FXG C;  1Q8K A;  5LMN H;  3GTG A;  3S9W A;  2HGS A;  2R7D A;  1DZ1 A;  1A3T A;  1RTO A;  4CKB A;  4C3J H;  2ASJ A;  3RUP A;  4NXN L;  4EBC A;  4XQJ A;  1QWY A;  2W6M A;  5KT2 A;  2RGR A;  5KT6 A;  2J4X A;  3OHX C;  1F77 A;  1UEB A;  2J9G A;  5KEE A;  3GTJ H;  3U58 A;  1K8A C;  3BAA A;  1AZQ A;  3GIJ A;  1E4E A;  3ORR A;  1TII D;  4B3S H;  1O7Y A;  1D5Z C;  1LAB A;  5KKN B;  4DR4 Q;  1GXD C;  4ZAI A;  1EOV A;  1VQ7 A;  4QMG A;  3QO2 A;  2JEJ A;  1PTO C;  2V4Q A;  2A6H C;  5C3E G;  5DG9 A;  4C5A A;  4B3R L;  2L0C A;  4JG2 A;  2VPQ A;  1UNN C;  5JOB A;  3I4L A;  4A3E H;  2GA4 B;  1VF5 C;  3AEV A;  2FPI B;  2PYK A;  1MZB A;  5HGT A;  1TWA A;  2NU8 B;  4ODG A;  4LFC L;  3A8K E;  3KLR A;  1MIU A;  3G7L A;  2AGQ A;  4LF4 H;  5IT9 L;  2UXB L;  5T14 A;  3ETJ A;  3OMC A;  3NGD A;  2RDJ A;  2NU7 B;  2N49 A;  3NEN A;  1WH2 A;  4LF7 Q;  4QB4 A;  5JJZ A;  1EQT A;  3A5Z B;  2ICE C;  1K8G A;  3HOW H;  4DR6 H;  3BVZ A;  3DM1 A;  1M4V A;  3PV0 A;  2K14 A;  2VQF Q;  1MHW C;  2PVP A;  3FKI G;  3CQZ B;  3A0J A;  1FNW A;  2BH8 A;  2R84 A;  3KHG A;  4NPS A;  4B08 A;  1XPO A;  3J81 j;  4DV7 Q;  4KY7 A;  3TIG A;  4MTK A;  3E0E A;  2R93 A;  4HJ8 A;  1S5B D;  4RWS C;  5EAY A;  5HY6 A;  4DR4 L;  3N40 P;  5FD6 A;  3BQ1 A;  2AQ4 A;  2K28 A;  1G2T A;  1ESR A;  4NMZ A;  1WR2 A;  1EQV A;  5FKA C;  5I6W A;  4AQY H;  1R4Q B;  3IKJ A;  4E4T A;  1F9Q A;  1LO5 D;  1EWC A;  3RZD B;  1I4X A;  1V4Y A;  4JI2 L;  5IT9 c;  3PIO A;  2CW8 A;  5LYJ F;  1KHI A;  2B2W C;  4I7H A;  3IAY A;  1B70 B;  2O03 A;  2XC9 A;  3H94 A;  3GTQ A;  3SHL A;  1TS4 A;  3LGJ A;  1B53 A;  4A3F H;  4JI0 L;  4PV1 C;  4WBN F;  4QWE A;  2QIL A;  2R6G A;  4A3I G;  2E5L H;  2RCN A;  4WOR A;  1HH2 P;  3RLN A;  2SNM A;  4LF7 L;  2E2J B;  1DV1 A;  1RJP A;  4DAM A;  3Q2O A;  2NZ1 D;  4Q8E A;  3WNZ A;  4UHV A;  4DL7 A;  4IPD A;  1DXM A;  1SEB D;  2K01 A;  4A3D H;  2C00 A;  1SBB B;  1SNM A;  2DGY A;  4LF6 Q;  4OO1 G;  2GN5 A;  3L4J A;  1X3F A;  2F0D A;  3JC6 6;  4O4L F;  3NP8 A;  3KLW A;  5F2D A;  3RF2 A;  1TS2 A;  5BN4 A;  3S16 H;  2CQO A;  1WTQ A;  1GHK A;  4L8J A;  1GJX A;  3PR5 B;  2CW0 D;  3GV6 A;  3CD6 A;  1VKZ A;  4O2A F;  2JA5 G;  2W7O A;  5KG1 A;  4DNT B;  2B3G A;  1Y1W B;  5KFD A;  2K04 A;  5KFT A;  1IBL H;  3QWN A;  1YNN C;  2DNC A;  3BA8 A;  1JDB B;  2PZW A;  1K3R A;  3KK7 A;  4X65 Q;  3HS0 C;  4XQQ A;  4QQB X;  2RDI A;  4HIM A;  1I94 Q;  5CAE B;  1B1Z A;  4K6D A;  5J2T F;  1PFB A;  3TS0 A;  1OXT A;  4PZ6 A;  4PNY A;  5KFF A;  2ZDQ A;  1JXL A;  3OSO A;  3SDZ A;  3GII A;  3KF8 B;  2EQS A;  4JI6 L;  2A19 A;  1GGO A;  2FPP B;  1B50 A;  1PFS A;  1KJ9 A;  1HR0 W;  3EVQ A;  1ICW A;  3FP9 A;  1EYD A;  2RGV A;  4GLX A;  2JEF A;  5JVD F;  4K0K Q;  3S2H B;  2QDB A;  2KSW A;  4EYI B;  1QE6 A;  2X6G A;  2KCC A;  2F0G A;  2D9U A;  2VW9 A;  3F2D A;  4Y52 H;  4MV8 A;  1PMR A;  1S5E D;  3RBE A;  3RLF A;  4DR1 H;  1P16 A;  3DHQ A;  3N41 B;  4BBR B;  5D1O A;  2X0S A;  5DGB A;  2EJM A;  4QW9 A;  4K5V A;  4FS1 A;  1WFQ A;  5JJK A;  3TP6 A;  2IP4 A;  1SRU A;  1PH2 A;  3RB6 A;  2YRW A;  3N6R A;  3MFH A;  1B7Y B;  2BE5 C;  5HGQ A;  4X65 L;  4EFB A;  5GAE C;  1I94 L;  3FPU B;  5KT3 A;  1BCP D;  1TXY A;  5DG7 A;  1B8A A;  1EY5 A;  5FJ8 G;  2FMM A;  1GM5 A;  3NSW A;  1UWV A;  4ME6 A;  5KFZ A;  3H3V H;  2F0K A;  2OLS A;  3GTM B;  5M3F B;  3T1Y H;  3MWE A;  3R93 A;  1CZG A;  4UCO A;  5ISR A;  1U9R A;  4YJ3 F;  4KN7 C;  4EQ5 A;  2MQH A;  1OO9 B;  4X64 Q;  4IHJ F;  4LH6 A;  4DUZ H;  1Y1V H;  1N36 L;  3KLS X;  2JA9 A;  5CMD A;  2K6A A;  2KVM A;  2B2T C;  4K0K L;  2A69 D;  4RH6 A;  3BQ2 A;  4RB0 A;  1PV4 A;  5I9P A;  1PTO D;  1TWH A;  1IYU A;  2A6H D;  4BY7 H;  4B3M L;  1C8C A;  3S1M H;  4LFA H;  4WJ3 M;  1UAP A;  2GLT A;  3SK8 A;  3HOY B;  1EQQ A;  4ZRZ A;  3ONA B;  3N44 B;  2NVY H;  1I4Q A;  4GN3 B;  1OXV A;  4M7E A;  2W9B B;  3GD7 A;  4X3K A;  1GO3 E;  4MV6 A;  4C3H B;  3C46 A;  5C0X H;  4A3K H;  4UCU A;  2F0L A;  4C1N K;  5KNB A;  2R92 H;  5C3E H;  3M3Y B;  1Q12 A;  5JJI A;  1IOV A;  2FLL A;  3LX0 A;  1M90 C;  2E75 C;  2Q8T A;  4DV0 Q;  4GLA C;  1HRJ A;  1ESF A;  4X64 L;  1NMG A;  4JI5 Q;  2R7L A;  3J80 W;  2W70 A;  2KCT A;  2V4D A;  2IX1 A;  4LF8 Q;  1X56 A;  3L3O C;  4DV3 Q;  3DM3 A;  4X6A H;  3NWT A;  1B04 A;  3BVM A;  3A7L A;  3H0G G;  3GTO B;  1Q46 A;  1ASZ A;  1R9T H;  3MFG A;  2VNU D;  1N32 H;  2LXK A;  5IYC G;  4EQP A;  4YP3 A;  2EYH A;  1MJE A;  2JA7 A;  1BVS A;  2ZJT A;  1TWF A;  4BWS C;  4DA2 A;  5KGU A;  5IWA Q;  2OXP A;  1AE2 A;  2CZG A;  3KF8 A;  4DL6 A;  1CS0 A;  3SE0 A;  5C4X G;  4C5B A;  3GV8 B;  3M4I A;  4A93 B;  1P8L A;  1XWE A;  2EXD A;  5C3W A;  3MVV A;  4JPB W;  3MA2 B;  2ZM6 H;  2L12 A;  3SE7 A;  2CKZ B;  3I4N G;  1EIG A;  5DLG A;  3CCL A;  2CW7 A;  2AHO B;  4J9R A;  2JJQ A;  1WOC A;  1I50 B;  2LMC B;  2XSC A;  2FHT A;  1EY9 A;  4LF8 L;  5CV9 A;  2K4K A;  1EHI A;  1E4G T;  3WO1 A;  4EBE A;  1X3P A;  1ASY A;  1DOK A;  1XPR A;  2EJF C;  4GNX C;  4BY1 G;  4O2B F;  2UVR A;  4DR3 Q;  3F2B A;  1JT8 A;  4YWL A;  2IY5 B;  4J9L A;  3OWF A;  4J0M A;  3TSS A;  1BJT A;  1F2L A;  3MXN B;  3QOJ A;  1VQP A;  4GZY C;  3A55 A;  3GTM A;  4DV1 Q;  5IWA L;  4IFD H;  3F1Z A;  3CC7 A;  1ENA A;  2PQA B;  3FEW X;  1PH9 A;  5JH7 F;  1KJQ A;  4AH6 A;  1PH5 A;  2JA5 H;  5E7N A;  3K5I A;  2QEJ C;  3SEB A;  1M1K C;  4LF9 Q;  4DK3 C;  5KG0 A;  4B9W A;  2ZJR A;  4Q8F A;  2B8G A;  3QR8 A;  5EGT A;  2OH2 A;  3TEH B;  2Z9H A;  3GTK H;  3TZU A;  4F4Z A;  5JPN C;  1RCV D;  1DOM A;  3DUZ A;  2Z6K C;  3K80 C;  1IBM L;  4JBW A;  2R87 A;  2FMC A;  1QNU A;  1EU4 A;  2M05 A;  4FDB A;  4KN4 C;  2EDG A;  3BZD B;  3KHL A;  2YYA A;  4K5W A;  4IJH A;  4OEM B;  3H20 A;  2EYP A;  2YU9 H;  3V6H A;  2MJ8 A;  4B3R H;  5FOB B;  4A3J B;  1G51 A;  1G29 1;  1LTA D;  1HPC A;  1TWC H;  3OHB A;  2JA6 A;  4DR3 L;  3NQT A;  5D14 A;  4LFC H;  2NZH A;  2BE5 D;  3KDF B;  4A3G G;  3A54 A;  5FLM H;  3V2T A;  4GN4 B;  4RUC A;  2UXB H;  4EG0 A;  5IYZ F;  4H7B A;  3K7A B;  5IY0 A;  4DV1 L;  1QOH A;  1JE4 A;  4RNN A;  4ZKB B;  5CB4 F;  4IN3 A;  2UXD Q;  4AQY Q;  3ERS X;  4LF9 L;  1PHJ A;  2K5H A;  4U7C A;  4OWT B;  4RNO A;  2HDM A;  1RK6 A;  1X6O A;  1C4Q A;  2RVL A;  2Q8R E;  1Q81 C;  3U9O A;  5FLX W;  4I4T F;  1PFM A;  5IP7 G;  2E2H H;  2NYZ D;  4IRD A;  1KLU D;  3KHR A;  1LM0 A;  3J81 L;  4DR4 H;  3GTO A;  4KHV A;  1SR3 A;  5FJ8 H;  1WCM G;  1ZHS A;  1H9R A;  3BYY B;  3TRZ A;  4HIO A;  5IP9 G;  1Z9F A;  2O2L D;  1GUS A;  3LP8 A;  4MV7 A;  1KRS A;  2PI2 E;  1TWG B;  1RYR A;  3NWS A;  1GVP A;  2BCO A;  5CC4 A;  4UY8 C;  1SE4 A;  4IJL A;  5GAD C;  1HNX Q;  4JI0 H;  1CTM A;  2R7Z H;  4LF7 H;  4F8M A;  4XT1 B;  2UXD L;  1AN7 A;  2F03 A;  1I50 A;  1STA A;  2EJG C;  2UU9 Q;  4DV2 L;  1K0S A;  2R8G A;  2D5D A;  2OQK A;  5JEA J;  2N78 A;  1WJJ A;  2WKD A;  3D31 A;  5HBR B;  3S17 H;  3K58 A;  1WTW A;  3CHB D;  3J81 c;  2R3Z A;  5F9N A;  4Q0Y A;  5EBD A;  5ELF A;  3NEM A;  1EEI D;  1PA6 A;  2WIN B;  1QZG A;  1F2Z A;  3ERO A;  2RQX A;  4RG1 A;  4LWC A;  4YHH Q;  5COY A;  2Y0S B;  2XWB B;  1WTO A;  4POG A;  4JV5 Q;  2NVQ B;  5IGB A;  2CWA A;  4DV5 L;  3PIO 3;  2V59 A;  4JBJ A;  4RGM A;  3BDO A;  1TR5 A;  2PQA A;  4C2M H;  3KFU A;  4UCR A;  1S10 A;  1TS5 A;  1YEZ A;  4J9O A;  4GOP A;  3HOV G;  2YV5 A;  2H4O A;  1HNX L;  4R4C A;  1ZHQ A;  2F0O A;  4M1U B;  1EQR A;  1KDC A;  4JI8 Q;  5EZY F;  4LJZ C;  1K1Q A;  2KJX A;  2UU9 L;  3Q24 A;  1CSQ A;  1KDA A;  2JQO A;  3LWB A;  1DOL A;  4KMU C;  4LF6 H;  1TA8 A;  4M9U A;  4HR7 B;  3CF5 A;  1IZ6 A;  4YCV A;  4NXM Q;  3RB3 A;  3C0F B;  1I6H B;  2RDG A;  4C3I H;  3UI2 A;  2AUK A;  2K5D A;  2RA4 A;  5AJ3 Q;  2B63 B;  5I2Y A;  1KC7 A;  3HOU G;  4LSA A;  3MR6 A;  1DM0 B;  4YHH L;  2PI2 A;  1JKJ B;  5C4X H;  1AZP A;  3KDF A;  4A3E G;  4RCN A;  2Y0S E;  4UP9 A;  3JAM L;  4JV5 L;  1MI2 A;  4ECZ A;  3K5L A;  2F0J A;  4CKC A;  3U9S A;  3I4N H;  1FL0 A;  4X65 H;  3H4B A;  3CCJ A;  1I94 H;  1TY0 A;  2B2Y C;  3RNU A;  3JZI A;  2FE3 A;  1SMY C;  5L37 A;  2XIW A;  2A1A A;  5IGE A;  4P74 A;  5M5W B;  3M4O H;  1S68 A;  4OX9 Q;  1D1I A;  3I70 A;  1OXU A;  1JJC B;  3K5N A;  1XMQ Q;  1VDZ A;  4JI8 L;  3V6J A;  2B2V C;  4JBM A;  3RV4 A;  3LWE A;  4PG3 A;  4F4W A;  1HJP A;  1FVI A;  3GTG H;  1WD0 A;  1SAP A;  3J7A F;  3JSN A;  4RAY A;  1KL9 A;  1LTI D;  5LMU Q;  1PFN A;  2FB9 A;  4NKL A;  5I2X A;  1V1P B;  2IX3 A;  4K0K H;  4EGV A;  4NXM L;  2WDT A;  1BGW A;  1WD1 A;  1PRT C;  2OWO A;  4WFN 3;  3JAM c;  2WB1 G;  1KD1 C;  4ECT A;  4LMQ D;  3RZO H;  1HA6 A;  4R4T A;  4QUF A;  1TWG A;  4BS9 A;  4A3M B;  2G5D A;  1S72 A;  1HZA A;  5C5M A;  3JRW A;  1WTX A;  1A2T A;  5C4J H;  3P1H A;  4KKS A;  3T51 B;  3BA9 A;  4A3F G;  4KHP Q;  1KNE A;  2I8C A;  3C1F A;  1B3Q A;  4ECR A;  3PW2 A;  3VPD A;  1VQ9 A;  2YZM A;  1TWA H;  3HOX B;  4A76 A;  4O0A A;  3RB4 A;  2BDN A;  4OX9 L;  5TSS A;  2NZO A;  3V05 A;  2ICI A;  2PCF B;  5EKK A;  4JOI A;  1JWS D;  2XN9 C;  2QCP X;  4QY7 A;  4YIJ A;  5T1I A;  4YY3 Q;  4A3D G;  2A5H A;  1U5K A;  2RF4 A;  4MA5 A;  2HT1 A;  3VDY A;  1VF7 A;  3G6Y A;  1E0B A;  3TN2 A;  3JAM i;  5LMU L;  2EOT A;  4X64 H;  2NBF A;  2V1C C;  2DIK A;  1PH8 A;  3I73 A;  1PX2 A;  2C2R A;  2DPI A;  4IOC A;  4F87 A;  3GIQ A;  3FRP B;  5DEH A;  3DWA A;  1MJC A;  2Z8L A;  4KD4 A;  1JR0 D;  4DXG A;  2D62 A;  4X3U A;  4FP5 D;  3S2D H;  2R93 H;  4DL5 A;  4F4Y A;  4LF5 Q;  1QG7 A;  5J3B A;  3DWQ A;  4TV9 F;  1VAJ A;  3E9H A;  5KFG A;  2GPW A;  3K6O A;  3PQI A;  4BWG B;  4ECV A;  3Q8P B;  4R1J A;  4KHP L;  2FPG B;  2UUB Q;  3V96 A;  1F9S A;  1QUQ A;  5IP7 H;  1AP0 A;  1CQI B;  1PH7 A;  1MGS A;  3OIQ A;  1BO0 A;  3HEJ A;  2VUM B;  2B2U C;  3PW5 A;  3EIV A;  2C2D A;  4DK6 C;  3PGZ A;  4QUC A;  2RSO A;  1FNV A;  1Q82 C;  2QK4 A;  3F8T A;  5IP9 H;  4EFE A;  4YY3 L;  2FJ2 A;  4DV0 H;  3NE5 B;  1QJO A;  1EIY B;  1B9N A;  2YZN A;  2VY3 A;  1SNP A;  2YZG A;  4X3T A;  1VBG A;  2K5Q A;  2B63 A;  2KHS A;  4IAJ A;  4DNR B;  3ICE A;  2P5Z X;  1W3S A;  4LAA A;  5J22 A;  4A3B B;  2PN1 A;  4F4X A;  2L55 A;  4LF8 H;  1W6K A;  3CKI B;  5A2Q W;  4DV3 H;  1PH4 A;  1SFO B;  1E1O A;  4NXN Q;  4JV2 A;  2I46 A;  4RFB A;  1PVO A;  3V4Z A;  1CQV A;  1K28 A;  1Y14 B;  2YTX A;  2VOB A;  1WYD A;  4QF4 A;  5C1P A;  4CC5 A;  4DR2 Q;  3DLL A;  4LF5 L;  2K50 A;  2E2I A;  2A68 D;  3CP0 A;  1J5E Q;  5IWA H;  3Q22 A;  2MUY A;  3G6J B;  2UUB L;  1AN8 A;  2EY5 A;  1V8Q A;  3Q23 A;  2B2W A;  4EQN A;  3PO3 B;  4RA8 A;  1WCM B;  3BU2 A;  4DAY B;  4XQN A;  1V1P A;  3GTP B;  2VZA A;  2AUJ D;  1QIL A;  1H9S A;  4YR3 A;  5JEA G;  2QDL A;  3PO2 G;  3K8A A;  2JA6 G;  1GSA A;  5KFM A;  1RL2 A;  1I6V C;  3GQB A;  3H3V I;  3CW2 C;  5C4H A;  2HCC A;  4BY7 G;  2DLN A;  3HKZ B;  3HOV H;  5EPJ A;  2YYZ A;  2F0T A;  4JI4 Q;  3HBL A;  1FGB D;  3DXJ C;  4KY6 A;  1KAW A;  2WFW A;  1Y8O B;  3H91 A;  2DY7 A;  5M3M H;  4DR3 H;  2ALY B;  4DR2 L;  1SMX A;  3P7J A;  4KTA A;  4EX5 A;  5DAU A;  1CHP D;  3A8J E;  2K5W A;  3M85 A;  5IT9 W;  4RZR A;  3J80 E;  1J5E L;  1I6U A;  1CK1 A;  4DV1 H;  3OTO Q;  5C0X G;  4A3K G;  1NCV A;  3SGI A;  2R92 G;  4LH7 A;  1EIF A;  5KX5 F;  4IAL A;  1E2W A;  1EYZ A;  3RD4 A;  3HOU H;  4RAZ A;  4LF9 H;  2NVX A;  5DQI A;  2JA8 B;  1ET9 A;  1LT3 D;  3AFP A;  3T5H A;  4AYB B;  2QYZ A;  4JI2 Q;  3CC4 A;  4JI1 Q;  4J9N A;  2ZTC A;  4HIK A;  2Q2T A;  4PQX A;  1GHJ A;  2F0F A;  5C0X I;  4MV9 A;  1L1O C;  2GVA A;  4JI0 Q;  2C35 B;  4LK1 C;  1I4G A;  1CKO A;  3HKZ E;  4MIU A;  2HHH Q;  4JI4 L;  3N6X A;  1PZK D;  4ZUI A;  4C3J B;  2F0P A;  2HDL A;  4DNI A;  1KRT A;  1MBY A;  1F9R A;  3H15 A;  2M9V A;  1GOZ A;  1TWH H;  4A3L H;  2XTI A;  3GTJ B;  1STG A;  2VUM A;  2IL8 A;  4I7A A;  4PZ8 A;  4IZO A;  3A74 A;  5D8D A;  4Q45 A;  1EFW A;  2IT1 A;  3S1N H;  3OTO L;  5M9O A;  2ATW A;  2YTY A;  4GNX B;  3QOL A;  2UXD H;  2QEX A;  5KFC A;  2EXZ A;  3TQT A;  2CCZ A;  4N8F A;  3RMH A;  1JX4 A;  4A3E B;  4AYB E;  1D7Q A;  4JV1 A;  4NDX A;  4JI1 L;  3CAM A;  2AQ2 B;  3BDL A;  3RN2 A;  1RD9 D;  3T4A C;  5IOD A;  1WVL A;  4HSP A;  3MWD A;  1FD7 D;  1SFO A;  2W7P A;  3MFI A;  1PDQ A;  5H1S E;  2B29 A;  2HHH L;  5LP6 F;  4OHJ A;  5I6Y A;  3HOW B;  3I12 A;  4APM A;  1RKN A;  1K83 H;  2B2T A;  5EDW A;  3LNN A;  4JI6 Q;  2F3V A;  4MA0 A;  1VQB A;  4ETS A;  5KFH A;  1HZ9 A;  1VQ4 A;  2PPB C;  5LOV F;  5EWF A;  4DV5 H;  1C0A A;  3MR5 A;  3L9A X;  4XIG S;  1I3Q B;  2SNS A;  1EEF D;  1LT4 D;  1VQD A;  4IFD G;  2R8H A;  3BJU A;  4HQ6 A;  5L1K A;  5DLF A;  2EPB A;  1X55 A;  3NTI A;  1HNX H;  5C1O A;  1W93 A;  3EA6 A;  3GTP A;  2JA7 H;  5FO9 B;  4N8X 1;  4J9M A;  1EY6 A;  1TWF H;  3KF6 B;  5JQW A;  4X3S A;  1GD7 A;  1BR9 A;  2UU9 H;  4OO1 I;  2IA6 A;  3ULP A;  4KKU A;  4FF4 A;  4HCE A;  2DZD A;  2RHQ B;  4U67 3;  3HKZ A;  4IFD I;  3GP7 A;  3I91 A;  2ES2 A;  2A74 C;  2AWO A;  3U50 C;  5C44 H;  1G91 A;  4UAI A;  1M7J A;  1KXL A;  4ID6 A;  4RZQ A;  2O4X A;  3X3M A;  4A3F B;  1S97 A;  2K05 A;  4L1K A;  3PUZ A;  5BPF A;  3BZC A;  1BXR A;  1PLF A;  3VYT A;  1C7Y A;  4YHH H;  1SN8 A;  1B3A A;  1N33 L;  1G2S A;  3GID A;  1LT5 D;  4JV5 H;  2NN6 H;  2F0H A;  4EEY A;  4XYO A;  4XYL B;  5KT5 A;  2WAQ B;  5KRU A;  5FLM G;  1N36 Q;  2CVR A;  3GIL A;  1PXU A;  3ER0 A;  1HR0 Q;  3PUX A;  4L5S A;  2QKI C;  4XYQ A;  1RJR A;  3S16 B;  3FPP A;  2OT2 A;  5FLX E;  1QZH A;  3HXL A;  4C1N I;  3GIP A;  1K0R A;  2W9A A;  3G71 A;  4IPC A;  2KED A;  4RHS A;  4AYB A;  3QG1 A;  4B3M Q;  4JI8 H;  1BBU A;  1SYC A;  1BBW A;  5CR3 A;  4LW1 A;  1V43 A;  4YCU A;  1B2T A;  5M3F H;  2VPS A;  3NQI A;  3BYT B;  5FPR A;  2YL2 A;  4IUN A;  4IUV A;  4MZ9 A;  1E4F T;  2FXQ A;  1QCB D;  4KK7 A;  1JWU D;  4NXM H;  1Q90 A;  3ND8 A;  3FDS A;  1Q1E A;  2RKS A;  1XMO Q;  3I4M B;  3CQZ A;  4ULL A;  1GUW A;  5GQO A;  1Z2P X;  2WE6 A;  3ZJY C;  4QWC A;  3TZD A;  2WAQ E;  2EYO A;  3L0O A;  3CCQ A;  1RIP A;  2ZJP A;  1HR0 L;  2EY1 A;  5JJL A;  5KFN A;  2LY7 A;  5J1Z A;  4P71 A;  5JEA H;  5IYD H;  4RGO S;  4GNX A;  3PO2 H;  2R7Z G;  2SCU B;  1E22 A;  2JA6 H;  2MHV A;  3MXU A;  4HNT A;  4A75 A;  4TQS A;  1UE1 A;  3SK5 A;  4O3Q A;  1NUC A;  2K5N A;  4L63 B;  4BXX G;  4MV1 A;  1VBH A;  4OX9 H;  4C3H H;  3WO0 A;  1XMQ H;  3D3R A;  1O75 A;  2VUG A;  3CCE A;  4ZHQ F;  2C9O A;  1PRT F;  3TBI B;  5FK9 C;  5C4Z A;  2J0T D;  4HJ9 A;  3M3Y H;  3W3A A;  1GSH A;  3VYS A;  4ECY A;  3SI8 A;  4JI3 Q;  4KHZ A;  1DJR D;  4FVM A;  5LMU H;  1HTL D;  2L4N A;  3GLK A;  5CBA E;  3D6C A;  1VQ8 A;  2YCH A;  1S40 A;  1Y8P B;  4HJ7 A;  2EE1 A;  4IZ8 A;  1HA5 A;  4DLK A;  1L0Y B;  2TMP A;  2HIX A;  5GRO A;  3EBE A;  1YVC A;  1XMO L;  2Z6K A;  2O5J C;  4MHE A;  5IOC A;  3GTL H;  4ED8 A;  1I3Q A;  1XYI A;  1R4P B;  5H80 A;  4OEL B;  3OSN A;  3GTO H;  2YS6 A;  3A8I E;  1STB A;  4K14 A;  3A7A B;  5GAG C;  3SK6 A;  1BF4 A;  1Y1V B;  1TS3 A;  1SYE A;  3T1H Q;  1Y1W A;  1HNZ Q;  4KHP H;  3W2D A;  3ORQ A;  3KF6 A;  1UUP A;  3OPO A;  1Z7T A;  4BY7 B;  2AKW B;  4RB3 C;  2NVT H;  3DMU A;  4UCV A;  1I5F A;  3UFX B;  2QGQ A;  3S1M B;  4RMF A;  4YY3 H;  3R23 A;  1HHV A;  1CZW A;  4AIM A;  3GIK A;  4ECS A;  4JI3 L;  3ULL A;  4PWQ A;  2L11 A;  3MEF A;  5G3L D;  3QIA A;  1SNQ A;  4C3I G;  2EYF A;  4JYA Q;  4UDU C;  2B39 A;  5CBE E;  1XNR Q;  1VQM A;  2I5L X;  3K3V A;  4A3K B;  2L9H A;  4QIW B;  3HOZ H;  2R92 B;  5C3E B;  2WAQ A;  1EWI A;  1SLJ A;  1XTC D;  2HCI A;  4Y7N H;  5C3X A;  2R7K A;  4LF5 H;  1IBM Q;  4G4K A;  2NB0 A;  1G8Z D;  3EYY A;  1VQI A;  5HUR A;  3T1H L;  4PDB A;  1WTP A;  1HNZ L;  1STE A;  1E2V A;  1ENF A;  3H09 A;  1PRT B;  5ELN A;  3J80 L;  4A3C H;  1AFP A;  1BNC A;  2UUB H;  3PIP A;  4HAE A;  1MSG A;  1LLR D;  1K1S A;  2V4R A;  5KIX A;  1AH9 A;  2HVQ A;  4TKO B;  3JSL A;  3K7U C;  1YNN D;  2OTL A;  5KG2 A;  3KAJ A;  1R9T B;  5M5X H;  4ME3 A;  4DKA C;  5KFX A;  5L9X A;  3KTM A;  5IE8 A;  3FKI B;  3PN1 A;  3MHB A;  4OON A;  4FBU A;  2XCA A;  3IFD A;  5LMN W;  4JYA L;  1CKN B;  3RBD A;  3VYU A;  1XNR L;  2D2C C;  4FF3 A;  2OTJ A;  1HZC A;  2JYO A;  2KHJ A;  4L6T B;  3GDE A;  2Q2I A;  4QIW E;  5JAV A;  3NBH B;  1E24 A;  2MO1 A;  3AYH B;  4Q5V A;  3LML A;  1VQC A;  5DM7 3;  2DPJ A;  2LSS A;  4FS2 A;  2KHI A;  2ZTD A;  4WRD A;  5E4W C;  1BKB A;  4A3J H;  1JDE A;  3KYH C;  1YJN A;  4R4I A;  3N43 B;  4OIJ A;  3D8G A;  4DR2 H;  1STH A;  1C9O A;  2JK8 A;  2MGS A;  3J80 c;  4ZI7 F;  4ECX A;  1M0W A;  2ALZ A;  1J5E H;  1O7I A;  3CCS A;  4G7O C;  2IHF A;  4O42 A;  5M5Y B;  3K7A H;  4ED2 A;  3VMM A;  2SDF A;  4A3I B;  4GLV B;  1XNQ L;  4DK0 A;  2FIN B;  2HQL A;  4BBS H;  5BMV F;  2F0V A;  2CQA A;  4IPG A;  5E4X A;  2HVS A;  3M4Y A;  2FP4 B;  2W9B A;  3BJY A;  3K5H A;  4B3T Q;  3J7Z C;  3SXH A;  3UDG A;  2IWH A;  4LFB Q;  4ABN A;  2IBK A;  1ICF B;  4LMY A;  3J81 W;  2KEC A;  4XX0 B;  1IW7 C;  3Q8R B;  1IKM A;  5EKL A;  1JB7 A;  2BQ3 A;  3R8B A;  4JI4 H;  2PNR C;  2JA5 B;  2BDO A;  3J80 i;  4XTC S;  2W6P A;  4LSX A;  3NXW A;  2R93 G;  1BCP F;  4DV2 Q;  1L0W A;  5A35 A;  1D5X C;  1F9P A;  3K5M A;  4O3N A;  3G8C A;  1TWG H;  3ZYY X;  2DN8 A;  3G6E A;  2ZDG A;  5KFS A;  3OTO H;  4IUU A;  5GAH C;  1PYW D;  5A2Q E;  1YI2 A;  1KNA A;  1N34 Q;  4ED6 A;  4CC6 A;  1A2U A;  2Z4H A;  4YR0 A;  4J9P A;  2AGP A;  2B2Y A;  2HIV A;  4TQR A;  1F2M A;  1X54 A;  1TWC B;  2ZTE A;  4R8U B;  4DV5 Q;  2UVV A;  3I72 A;  4JI2 H;  2J7Z A;  4JI1 H;  3PUW A;  5LL6 b; 
#chains in the Genus database with same CATH homology
 2V1C C;  1VS0 A;  3A0J A;  2BH8 A;  3FKI G;  4APV A;  1PH8 A;  1VCI A;  4NPS A;  1DGS A;  1XPO A;  4B3T L;  4LFB L;  4PZ7 A;  4IOC A;  3J81 j;  3ULJ A;  4DV7 Q;  1NJI C;  4LUV A;  4LF4 L;  2PMZ E;  3E0E A;  3TRE A;  4HJ8 A;  5EAY A;  1MJC A;  5HY6 A;  1NE3 A;  4DR4 L;  5K36 G;  2B63 G;  2D62 A;  4BXX H;  4A93 H;  3CPW A;  3S2D H;  2R93 H;  4UP8 A;  2UUC Q;  4IO9 A;  4LF5 Q;  4KI0 A;  4JI2 L;  5IT9 c;  3PIO A;  5J3B A;  4B3R Q;  4L5Q A;  1N8R C;  1KHI A;  1I50 H;  3E9H A;  1B70 B;  2I0Q A;  1JMC A;  4R1J A;  4KHP L;  2UUA L;  2UUB Q;  1QUQ A;  5IP7 H;  3LGJ A;  4A3F H;  3M9B A;  4JI0 L;  1PH7 A;  2R6G A;  4UP7 A;  4A3I G;  4IOA A;  2RCN A;  4TQU S;  1HH2 P;  3EIV A;  3RLN A;  1N34 L;  4LF7 L;  1Z47 A;  4DK6 C;  3PGZ A;  3K81 C;  4DAM A;  3KJP A;  1Q82 C;  3F8T A;  5IP9 H;  4YY3 L;  4IPD A;  4A3D H;  2EIF A;  3CCR A;  1CKN A;  2DGY A;  1EIY B;  4LF6 Q;  4OO1 G;  2GN5 A;  1HNW Q;  1X3F A;  2VY3 A;  3JC6 6;  3L7Z C;  1N9W A;  3KLW A;  3FKI H;  3CME A;  1IBK Q;  3S16 H;  2CQO A;  1V1Q A;  3ICE A;  1W3S A;  4BA1 I;  3CD6 A;  1Q86 C;  3Q8D A;  3S14 H;  1YHQ A;  1W2B A;  2JA5 G;  1XNQ Q;  1PH4 A;  2B3G A;  1E1O A;  4NXN Q;  2B63 H;  1S3O A;  1PVO A;  5M3M G;  4X62 Q;  1Y14 B;  4A3M G;  4KLK A;  2YTX A;  3G48 A;  1AE3 A;  1WYD A;  4YWK A;  2UUC L;  4DV0 L;  3DLL A;  4DR2 Q;  1X9N A;  4LF5 L;  2IX0 A;  2OQ0 A;  1K3R A;  2K50 A;  4X65 Q;  4ALP A;  4QQB X;  3CP0 A;  4HIM A;  1I94 Q;  1L1O B;  3TS0 A;  4JI5 L;  1J5E Q;  1OXT A;  4PZ6 A;  2ASB A;  3PF4 A;  2UUB L;  5LMN Q;  3HOX G;  3S1Q H;  5M5Y H;  2VS1 A;  2E2I H;  3I56 A;  4DV3 L;  2VL6 A;  1YHB A;  4A3I H;  1VQH A;  4TVA B;  3BU2 A;  3KF8 B;  4DAY B;  2QA4 A;  2EQS A;  4JI6 L;  2A19 A;  2VZA A;  1A62 A;  1PFS A;  1NBW A;  3UDI A;  1HR0 W;  2MO0 A;  4JI7 L;  1HNW L;  3FP9 A;  5JEA G;  4GLX A;  2GVB A;  3PO2 G;  3K8A A;  2K5V A;  4A4I A;  2JA6 G;  1UE7 A;  1IBK L;  4K0K Q;  1RL2 A;  3H3V I;  1T9H A;  3F2D A;  3CW2 C;  1PYS B;  2VW9 A;  4B3S Q;  1VQ6 A;  4BY7 G;  4Y52 H;  2Q2H A;  3HOV H;  3RLF A;  2YYZ A;  1P16 A;  4JI4 Q;  1K9M C;  3U4V A;  4GOP B;  1K73 C;  1KAW A;  2WFW A;  1YJ9 A;  4X62 L;  1PH6 A;  1IYJ B;  1WFQ A;  1VQO A;  5JJK A;  4A3L G;  5M3M H;  1SRU A;  2ALY B;  1E1T A;  3IRB A;  4YWM A;  3F2C A;  4DR2 L;  1YIT A;  1PH2 A;  1SMX A;  3EN2 A;  4HID A;  1B7Y B;  4EX5 A;  5HGQ A;  4X65 L;  3M85 A;  5GAE C;  1I94 L;  4LF4 Q;  4LUZ A;  1J5E L;  1TXY A;  1B8A A;  3OTO Q;  5C0X G;  5LMN L;  3CCV A;  4A3K G;  3SGI A;  5FJ8 G;  3RN5 A;  1GM5 A;  2VUM G;  1UWV A;  3HOX H;  1Q7Y C;  2R92 G;  1EIF A;  4DR1 L;  3H3V H;  1PYB A;  4MTN A;  1U0L A;  3AQQ A;  3HOU H;  4DR6 Q;  1KIX A;  3AFP A;  4JI2 Q;  3STB D;  3CC4 A;  4JI1 Q;  2BH2 A;  4EQ5 A;  2MQH A;  4X64 Q;  2K52 A;  2ZTC A;  1YHA A;  1Y1V H;  1N36 L;  4HIK A;  2JA9 A;  2NVX H;  2VQE L;  1XTD A;  2Q2T A;  1OXX K;  4K0K L;  3S24 A;  5C0X I;  4A3B G;  3TQY A;  1L1O C;  2GVA A;  4JI0 Q;  4B3S L;  1PV4 A;  2C35 B;  4DUY Q;  1CKO A;  3HKZ E;  2HHH Q;  1EYG A;  4JI4 L;  4BY7 H;  4O2D A;  4DNI A;  2VQF Q;  1XPU A;  1KRT A;  4B3M L;  3T1Y L;  3H15 A;  2UXC Q;  3S1M H;  3M4P A;  1QVF A;  4DR7 Q;  4WJ3 M;  1TWH H;  4DUZ L;  2XTI A;  4A3L H;  3TS2 A;  3OYY A;  1EQQ A;  2MFI A;  3UE0 A;  3BZK A;  2NVY H;  4PZ8 A;  3A74 A;  1VQG A;  1EFW A;  4QJF A;  1GKH A;  4GN3 B;  1OXV A;  2IT1 A;  5DLQ E;  3OTO L;  1A0I A;  4DV6 Q;  1JE5 A;  3GD7 A;  1GO3 E;  2JA7 G;  2E5L Q;  2D0O A;  2ATW A;  2YTY A;  1A63 A;  1CSP A;  4A3K H;  3B6Y A;  4GNX B;  3PO3 G;  2QEX A;  2R92 H;  5C3E H;  5JJI A;  1Q12 A;  4L5T A;  2CCZ A;  4DR6 L;  4X66 Q;  1M90 C;  2NVQ H;  4AYB E;  4DV0 Q;  1D7Q A;  4JI1 L;  4GLA C;  3CAM A;  4X64 L;  5C44 G;  3RN2 A;  1NMG A;  4JI5 Q;  2AWN A;  2K75 A;  4HJA A;  2KCT A;  4POF A;  2L15 A;  2IX1 A;  4L5R C;  3D0F A;  4LF8 Q;  3HKZ G;  4DUY L;  5H1S E;  1X56 A;  1LTL A;  2B29 A;  2WP8 J;  1Q1B A;  3DM3 A;  4DV3 Q;  1KC8 C;  2HHH L;  4X6A H;  2JEB I;  4BBR G;  2Q2U A;  3GTQ H;  3PF5 A;  2NN6 G;  1SFO H;  1IBL Q;  1K83 H;  1SE8 A;  4AQY L;  3W1G A;  4JI6 Q;  3H0G G;  4OXP A;  1Q46 A;  1VQB A;  1HZ9 A;  1L1O A;  2AMC B;  1VQ4 A;  1ASZ A;  1R9T H;  1C0A A;  4DR7 L;  1HZB A;  3I55 A;  2LXK A;  4JI7 Q;  1L2F A;  5IYC G;  2VNU D;  2I5H A;  4XIG S;  1QVC A;  1MJE A;  1VQD A;  1BVS A;  1EUJ A;  4IFD G;  5ELO A;  4QL5 A;  3BJU A;  5IWA Q;  4JCV E;  3HFZ B;  1AE2 A;  1X55 A;  1I6H H;  3M7N A;  2UXC L;  4JC0 A;  4DV6 L;  1QVG A;  2E5L L;  2JA7 H;  1VQK A;  5M3F G;  5C4X G;  1IL2 A;  4GN5 A;  1TWF H;  3KF6 B;  2Z0S A;  1P8L A;  2CFM A;  2EXD A;  1GD7 A;  3PUV A;  2JA8 G;  4AYB G;  1YZ6 A;  4X66 L;  4OO1 I;  3ULP A;  2CKZ B;  3I4N G;  3CCL A;  3GTP H;  1N32 L;  2AHO B;  2RHQ B;  2RHS B;  2JJQ A;  1WOC A;  5FLX c;  4IFD I;  2ES2 A;  2AWO A;  3U50 C;  5C44 H;  5C0X J;  3KOJ A;  1VQ5 A;  1KXL A;  2ZJQ A;  2A8V A;  5M5W H;  4LF8 L;  4DR1 Q;  3W5O A;  3PUZ A;  1YJW A;  3BZC A;  2K4K A;  1C7Y A;  1IXR A;  1SN8 A;  3RLO A;  3J81 i;  1MKH A;  1ASY A;  3UDX A;  1XPR A;  1IBL L;  1N33 L;  1QUQ B;  4UPA A;  4GNX C;  3CC2 A;  4BY1 G;  3CCU A;  4DR3 Q;  2F52 A;  3F2B A;  3H0G H;  1JT8 A;  4YWL A;  2IY5 B;  5FLM G;  1N36 Q;  3HOY G;  5IYD G;  3ER0 A;  2VQE Q;  3PUX A;  1HR0 Q;  4L5S A;  3MXN B;  5IYC H;  3I7F A;  1LYL A;  1VQP A;  3PUY A;  5BR8 Q;  1QZH A;  4DV1 Q;  5IWA L;  4LUO A;  5IYB G;  1K0R A;  1JJ2 A;  3F1Z A;  3G71 A;  1X3E A;  4IPC A;  3CC7 A;  2PQA B;  1PH3 A;  1PH9 A;  4JBK A;  1NTG A;  4AH6 A;  1PH5 A;  2JA5 H;  5E7N A;  4B3M Q;  1BBU A;  3T1Y Q;  1BBW A;  4LF9 Q;  4LW1 A;  1V43 A;  4YCU A;  4DK3 C;  1M1K C;  5M3F H;  2H5X A;  2ZJR A;  4A3M H;  3TEH B;  4DUZ Q;  3GTK H;  1A8V A;  3K80 C;  2Z6K C;  4MZ9 A;  1IBM L;  2UXD Q;  4JBW A;  4NB3 A;  2FXQ A;  3U4Z A;  4FDB A;  4R4O A;  3I2Z A;  1Q1E A;  3M4Q A;  1XMO Q;  1KQS A;  4IJH A;  2F4V L;  3HOW G;  2YU9 H;  1D8L A;  2MNA A;  1G51 A;  1G29 1;  5GQO A;  2JEA I;  1FJG Q;  4LFA Q;  1TWC H;  3ZJY C;  4DR3 L;  2LXJ A;  4BY1 H;  2WAQ E;  2NZH A;  3L0O A;  3CCQ A;  3KDF B;  1RIP A;  3RR5 A;  3CQZ H;  2ZJP A;  1HR0 L;  4A3G G;  5JJL A;  5FLM H;  4GN4 B;  4P71 A;  3J7A 5;  2KBN A;  5IYD H;  1UE6 A;  4GNX A;  3PO2 H;  2R7Z G;  5BR8 L;  4GKJ Q;  1E22 A;  1PH1 A;  5IY0 A;  4DV1 L;  2JA6 H;  4A75 A;  1NMF A;  1UE1 A;  1Y1W G;  2K5N A;  1OTC A;  3WWV A;  4BXX G;  2N3S A;  4A93 G;  1CUK A;  4P75 A;  4C3H H;  5AJ3 L;  4DV4 Q;  3ERS X;  4AQY Q;  3E9I A;  1LUZ A;  3CCE A;  4LF9 L;  1PHJ A;  2K5H A;  4HJ9 A;  3M3Y H;  4OWT B;  1VQF A;  1X6O A;  4KHZ A;  4P73 A;  4JI3 Q;  3RZD H;  1NY4 A;  3S1R H;  4J15 A;  4IFD J;  1J6Q A;  2OCE A;  1VQ8 A;  3NEL A;  1S40 A;  1JJG A;  4LNQ A;  1Q81 C;  4HJ7 A;  3AFQ A;  5IP7 G;  2E2H H;  1LM0 A;  2N8N A;  3HOZ G;  2HIX A;  1V9P A;  3EBE A;  1YVC A;  5GRO A;  1SR3 A;  2Z6K A;  5FJ8 H;  1WCM G;  1XMO L;  2E2J H;  2VUM H;  3TRZ A;  4MNO A;  4HIO A;  5IP9 G;  1XMQ L;  4H02 A;  3GTL H;  4GOP C;  1Z9F A;  3CPF A;  1KRS A;  4LFA L;  2PNH A;  1FJG L;  3GTO H;  1N32 Q;  2WAQ G;  4BA2 I;  2KCM A;  5GAG C;  2D0P A;  2PI2 E;  3T1H Q;  1I3Q H;  1FGU A;  4A3C G;  1GVP A;  1HNZ Q;  4A3G H;  4UY8 C;  1YIJ A;  3KF6 A;  4GKJ L;  4IJL A;  3K0X A;  5GAD C;  1HNX Q;  4A3B H;  2R7Z H;  3KJO A;  2AKW B;  2NVT H;  4PMW A;  1N33 Q;  1Y1W H;  1VQL A;  2UXD L;  1I5F A;  3CCM A;  4DV4 L;  2QGQ A;  4RMF A;  2UU9 Q;  4DV2 L;  2ZM6 Q;  2OQK A;  5JEA J;  2N78 A;  1WJJ A;  4AIM A;  3D31 A;  2DUD A;  4JI3 L;  3ULL A;  2I5M X;  3S17 H;  3MEF A;  3J81 c;  4JYA Q;  3A5U A;  1XNR Q;  3NEM A;  2YTV A;  1VQM A;  2I5L X;  1PA6 A;  1QZG A;  3I4M G;  2NN6 I;  3HKS A;  4RG1 A;  3HOZ H;  4LWC A;  4YHH Q;  1EWI A;  1CKM A;  3UDF A;  4A3J G;  3PO3 H;  1SLJ A;  1WCM H;  4POG A;  4JV5 Q;  4Y7N H;  4HJ5 A;  4YCW A;  2CWA A;  4DV5 L;  1VQE A;  3GTM H;  1IBM Q;  4JBJ A;  2F3I A;  2VQF L;  1VQI A;  2PQA A;  4C2M H;  3KFU A;  1WI5 A;  3T1H L;  1YEZ A;  1YBY A;  4GOP A;  1HNZ L;  1VQA A;  3GO5 A;  4DV7 L;  3S2H H;  5ELN A;  3HOV G;  3I4O A;  4A3C H;  1XJV A;  2YV5 A;  1HNX L;  3PIP A;  2XGT A;  4R4C A;  4DPG A;  2F4V Q;  1EQR A;  4BBS G;  4OWX B;  4JI8 Q;  1G6P A;  1AH9 A;  4BBR H;  4OWW B;  3K7U C;  2OTL A;  2UU9 L;  2ZM6 L;  1CSQ A;  2JE6 I;  2JQO A;  4ME3 A;  5M5X H;  4DKA C;  3UE1 A;  3S15 H;  5IE8 A;  4QGU A;  1X65 A;  1E3P A;  4OON A;  3G4S A;  1IZ6 A;  3CF5 A;  4YCV A;  1X3G A;  4NXM Q;  5LMN W;  4JYA L;  1CKN B;  3CXC A;  4C3I H;  1XNR L;  2OTJ A;  2CWP A;  1HZC A;  2KHJ A;  3GDE A;  5AJ3 Q;  2Q2I A;  4QIW E;  2KEN A;  3HOU G;  2WB1 E;  3NBH B;  4YHH L;  2PI2 A;  1E24 A;  2MO1 A;  3AYH B;  3KDF A;  5C4X H;  1VQC A;  2Y0S E;  4UP9 A;  2LSS A;  4A3E G;  2KHI A;  2ZTD A;  4JV5 L;  3L2P A;  1BKB A;  1SRO A;  4A3J H;  2JA8 H;  3KYH C;  1YJN A;  2IHE A;  4R4I A;  4P72 A;  1Y1V G;  4LFC Q;  1C9O A;  3I4N H;  1FL0 A;  2ID0 A;  2JK8 A;  4LF6 L;  4JOI C;  3J80 c;  4GS3 A;  3CMA A;  3CCJ A;  3RNU A;  2UXB Q;  1O7I A;  3CCS A;  4DR5 Q;  2IHF A;  3PSI A;  3FHW A;  2A1A A;  1Q8K A;  4P74 A;  3K7A H;  3M4O H;  4GKK Q;  2R7D A;  4OX9 Q;  1OXU A;  1JJC B;  3W1B A;  1XMQ Q;  4GLV B;  1XNQ L;  4JI8 L;  3I4M H;  4C3J H;  4JBM A;  2HQL A;  4PG3 A;  1E7Z A;  4BBS H;  1HJP A;  4NXN L;  1H95 A;  1FVI A;  2BA1 A;  3GTG H;  3S1N H;  3OW2 A;  4IPG A;  3STB C;  1KL9 A;  5LMU Q;  1UEB A;  4B3T Q;  3J7Z C;  3UDG A;  3GTJ H;  1VQN A;  4LFB Q;  3HOY H;  3U58 A;  1K8A C;  1VQJ A;  4NXM L;  1OXS C;  4DR4 Q;  5IYB H;  1JB7 A;  1EOV A;  1VQ7 A;  2OWO A;  3JAM c;  2WB1 G;  3J80 i;  4XTC S;  5C3E G;  1KD1 C;  3RZO H;  4R4T A;  2Y0S G;  2R93 G;  4B3R L;  4DV2 Q;  1L0W A;  2E8G A;  4JG2 A;  4IPH A;  2BA0 A;  1S72 A;  4A3E H;  3AEV A;  1HZA A;  1YNX A;  1UE5 A;  4LFC L;  1MIU A;  1TWG H;  5C4J H;  2UXB L;  4A3F G;  4KHP Q;  2UUA Q;  3G6E A;  4DR5 L;  1VQ9 A;  2N49 A;  1TWA H;  5GAH C;  3NEN A;  4O0A A;  4A76 A;  4GKK L;  4OX9 L;  4LF7 Q;  2NZO A;  1YI2 A;  1N34 Q;  4WJ4 A;  3PCO B;  4JOI A;  3A5Z B;  4QY7 A;  1K8G A;  3HOW H;  2HIV A;  2R7F A;  1X54 A;  4YY3 Q;  4A3D G;  2ZTE A;  4DV5 Q;  1U5K A;  2RF4 A;  4R4Q A;  2HT1 A;  3VDY A;  3PV0 A;  3PUW A;  2K14 A;  5LMU L;  3JAM i; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...