5C3EG

Crystal structure of a transcribing rna polymerase ii complex reveals a complete transcription bubble
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Crystal Structure of a Transcribing RNA Polymerase II Complex Reveals a Complete Transcription Bubble.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5c3eG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5c3eG01
2NN6G 2D0OA 2UUCL 3FP9A 4KLKA 1YHQA 4JYAQ 4JOIC 2UUAL 4BBSH 3GTJH 4JBWA 1L2FA 1EOVA 1K3RA 1VQ7A 3I4MG 2WP8J 4QIWE 4R4CA 4EQ5A 4IO9A 4B3TL 3MXNB 2LXKA 1EWIA 1VQ8A 1BBWA 4DR3L 2D0PA 1YVCA 2DUDA 2Z6KC 5IY0A 2ATWA 2EQSA 4LF9Q 4LUOA 5IWAQ 1Y1VG 5FLMG 3G6EA 4JBMA 4YHHL 3RR5A 4BBRG 3TRZA 5IYDH 5JJKA 3JAMi 3CQZH 1PH8A 2WB1E 2VUMH 4OXPA 4BA2I 4X66L 3M3YH 3HKZG 2CKZB 2UU9Q 4IJHA 1HZBA 3FHWA 1VQ5A 2CWPA 2FXQA 1OXSC 3RLFA 3U58A 2PQAA 1X3EA 1PH6A 3M4QA 2JA7H 4DR2L 2ZTDA 2I5HA 3TS2A 5JJIA 1X55A 4IPDA 1KQSA 4DV0L 3E9HA 5IE8A 4DV4Q 4DV5L 4AQYL 1Q82C 4OWWB 1LYLA 1A62A 4O2DA 4DV7L 4NB3A 1S40A 5LMUQ 1L1OA 3PO2H 1JT8A 4QGUA 2NZOA 4DR4L 1YZ6A 1CKNB 1UE7A 4DV3Q 4JI6Q 4LFBL 3KDFB 4YWKA 3PIOA 4DR5L 2UXCQ 1G51A 3CXCA 5AJ3L 3HOVG 4C3IH 4JCVE 1IYJB 1YJNA 1DGSA 2PNHA 2H5XA 3RZDH 2UUCQ 1TWAH 4JI8L 3CCQA 4HIDA 2UUAQ 3ZJYC 3HOZG 1KIXA 4LF4L 5IP7H 1UEBA 4YCUA 4YY3L 5FLXc 2PI2E 2NVQH 2K52A 4YCVA 1OXVA 3RLNA 1XPUA 4EX5A 1WFQA 3NENA 2E8GA 4DR3Q 3KJPA 1GKHA 1TWCH 1QZGA 1PFSA 3U4ZA 4LNQA 4WJ3M 1BBUA 4IFDI 1YHBA 4NPSA 4A3CG 5C4XG 4YHHQ 3JAMc 4KI0A 1OXXK 1VQ6A 4RMFA 4HJ7A 3TEHB 1YJWA 4J15A 4X65L 1K73C 4A3KG 1N36L 5M3MH 4X66Q 2NVXH 4A3IG 2YTXA 3S16H 4OO1G 1X65A 3I4OA 1N34L 3JC66 1VQNA 2CQOA 5K36G 1WCMG 1OXUA 2R93H 1QVCA 3GTOH 2NVTH 4A75A 1KXLA 4DR2Q 1K0RA 2ZM6L 1VS0A 1Q81C 2HQLA 2R7ZG 1YHAA 4L5RC 2VY3A 4HIKA 1YITA 2E2IH 4DV0Q 4DV5Q 3CCJA 3H3VH 4B3SL 2IHEA 1VQDA 4DV7Q 2UUBL 4DR1L 3LGJA 4XIGS 4DR4Q 3PF5A 3DM3A 3Q8DA 1VQJA 3DLLA 4GOPC 1JE5A 2KCMA 1X3FA 4DNIA 3KFUA 4DR5Q 1CKNA 1HZAA 3K8AA 3KF6A 2JA6G 2K4KA 3KDFA 3ULPA 1UE6A 3NEMA 1QUQA 5AJ3Q 3FKIG 3M85A 2Z6KA 4LF7L 3D0FA 2PQAB 1GO3E 3NBHB 5ELNA 2AWOA 1FL0A 2AWNA 1T9HA 3HOXH 4JI8Q 1HNXL 1R9TH 2JEBI 4A3FH 4GN5A 4LF4Q 1GD7A 1HNZL 3BJUA 4YY3Q 1XPOA 1SROA 1Z47A 4DK6C 4A3MH 3OYYA 4YWMA 1EYGA 1WYDA 3CC4A 4UP9A 1RL2A 4LFCL 4YCWA 4DUZL 1JB7A 1JMCA 1PH3A 2OWOA 4HJ8A 1HR0L 2WAQG 3RN5A 3CPWA 3OW2A 4BBSG 1I5FA 1PYBA 3K81C 4JI0L 4AYBG 1VQLA 5HY6A 2ZJPA 3CC2A 2B63H 3G48A 3PV0A 3VDYA 3I7FA 4NXML 1N32L 4LFAL 4X65Q 3CF5A 3HFZB 1KRSA 3IRBA 1N36Q 4B3ML 2Q2HA 4K0KL 1UE1A 1PH2A 2F4VL 4KHPL 4A3EH 5GAGC 2WAQE 1S72A 3EN2A 2MO1A 1YI2A 4AYBE 1N34Q 5IYDG 3S2DH 4KHZA 1E22A 1JJ2A 4LUVA 2ZM6Q 2E5LL 4A3BH 4POGA 3GO5A 1Q1EA 4PMWA 4DAYB 1TXYA 4B3SQ 4JG2A 4DKAC 3W1BA 5GAEC 1UE5A 2JA7G 2UUBQ 4A3GH 2ZTEA 4DR1Q 1YIJA 3S1NH 2WFWA 3UE1A 4C2MH 4PZ6A 4A76A 1YJ9A 1QZHA 4JI2L 5E7NA 3PUYA 4DK3C 3J80i 2K5HA 2MO0A 4X64L 1I94L 5LMNW 4HJ5A 4LF7Q 5C0XI 5JEAG 3ULLA 2GVBA 2JK8A 1EIYB 1HNXQ 4ME3A 2AKWB 3PO3H 3WWVA 5M3FH 2UXBL 3H3VI 3I4NH 4R4QA 1HNZQ 2Q2IA 3HKZE 3TQYA 4GN4B 2R92H 2OTJA 4IPGA 4JI4L 1GVPA 4LFCQ 3PF4A 2PMZE 4GNXC 3GTMH 4NXNL 1HR0Q 1Q46A 1Y14B 5M5WH 1C7YA 3UDXA 4JI0Q 5IP7G 1VQGA 4BY1H 4X62L 4NXMQ 3KF6B 4JI3L 4DR7L 3PUVA 1N32Q 4LFAQ 2K5NA 1QUQB 4DV1L 4B3MQ 4K0KQ 4GLVB 2F4VQ 2V1CC 4KHPQ 3HOYH 2Y0SG 3F2CA 3U4VA 1K9MC 3K7AH 3F8TA 1Q1BA 3UDFA 2LXJA 3T1YQ 2F52A 1MKHA 3E9IA 3GTQH 3S14H 2KHIA 4IJLA 2UXDL 3PUWA 1Q86C 5H1SE 2N49A 5M3MG 3CCMA 2E5LQ 1OXTA 4B3TQ 1N9WA 1X3GA 3PSIA 5GADC 1Z9FA 2ALYB 3KF8B 4DV2L 1KD1C 2JA8G 3W1GA 1EQQA 2VQEL 1K8GA 2R93G 4YWLA 4TVAB 1OTCA 2VZAA 1VCIA 2QGQA 5C0XG 1SFOH 3HOUH 4BXXH 2RHSB 2QEXA 1SRUA 1MJCA 3BZKA 4JI1L 5IYBH 1X56A 1WI5A 4LF8L 4JI2Q 3J80c 1XJVA 2LSSA 5FJ8H 4X64Q 1I94Q 3GTKH 4A93H 2JA5H 4IPHA 2NVYH 1I50H 5IYCH 3OTOL 2ES2A 1NE3A 1A63A 1G291 4A3LG 4HIOA 1FJGL 3D31A 4IPCA 1PH7A 2JE6I 1E3PA 2VL6A 3AFPA 2ZJRA 2VQFL 2UXBQ 2C35B 3ERSX 1NMFA 5DLQE 4OWTB 1D7QA 4A3JH 1C0AA 4UP7A 1U5KA 4JI4Q 4AQYQ 3H0GH 1U0LA 4P72A 4R4OA 3HOXG 3BZCA 2ASBA 3PIPA 1BKBA 4NXNQ 1P16A 5M5YH 4A3FG 3S1QH 2K5VA 4JOIA 1J6QA 4OWXB 1SLJA 4A3MG 4HIMA 4XTCS 2L15A 4X62Q 1E1OA 1KAWA 1UWVA 1ASZA 1W3SA 4JI3Q 4LUZA 1NBWA 5GQOA 4DR7Q 1O7IA 4DV1Q 3I56A 3A5ZB 3HOWH 1CKMA 1L1OC 3KJOA 3GDEA 1VQHA 4R1JA 1KRTA 5HGQA 4IOCA 3M4PA 4L5TA 2MQHA 2B63G 4LF5L 2K14A 4A3CH 3AFQA 3CCLA 2UXDQ 4IFDG 1D8LA 3KYHC 1EIFA 5C3EH 4R4TA 4A3EG 2NN6I 2YYZA 1VQBA 2XGTA 1IBLL 1EUJA 2N3SA 4DV2Q 1W2BA 3CMAA 2VQEQ 3U50C 3I55A 1PVOA 4OX9L 1KHIA 3L0OA 1GM5A 1CSQA 4A3DH 4R4IA 1TWFH 2GN5A 5C44H 4A3BG 4JV5L 3W5OA 1HH2P 3PUZA 2I5MX 4JI1Q 3NELA 1C9OA 1E7ZA 3T1HL 3J7ZC 2B29A 3M7NA 2PI2A 4LF8Q 1VQKA 4L5QA 4JI5L 4P73A 2NZHA 5IT9c 2MNAA 2F3IA 1B8AA 1VQFA 2HIXA 1AH9A 4QL5A 4O0AA 3OTOQ 3KOJA 3A74A 2VS1A 3CP0A 3S15H 1I6HH 1VQPA 1L0WA 1KL9A 1FJGQ 3RZOH 2VUMG 5BR8L 1X6OA 1VQEA 3F2DA 5C4JH 4TQUS 2VQFQ 2IX0A 4DV6L 4HJAA 4BY7H 3M9BA 2JA9A 3J81i 3S2HH 1CUKA 4OONA 1RIPA 4Y7NH 3TS0A 3CCSA 4JC0A 3PO3G 5M3FG 5IP9H 2IT1A 2QA4A 4JI6L 1HZ9A 4X6AH 1X54A 1NJIC 2Q2UA 2R92G 1XMOL 3S17H 1P8LA 4POFA 4DAMA 1WJJA 3CCEA 1QVGA 1PH1A 1PH4A 1N33L 5JEAJ 3RNUA 1XMQL 3PO2G 1PHJA 3K7UC 2IY5B 2A19A 2RF4A 5LMNL 2HHHL 3PGZA 1NY4A 4BY1G 1S3OA 2ZTCA 4C3HH 4LF5Q 1VQIA 1V9PA 1Y1WH 3SGIA 1PH5A 2WB1G 2DGYA 1K83H 3HOYG 2CFMA 2OQ0A 1SR3A 2RCNA 4BA1I 1PV4A 1V43A 1IBLQ 1V1QA 4DUZQ 4DR6L 2MFIA 3PUXA 2KCTA 3K0XA 1B70B 1CKOA 3L2PA 4LWCA 5EAYA 3I2ZA 4OX9Q 1IBML 2GVAA 2YTVA 2XTIA 2YTYA 4JV5Q 3I4MH 3T1HQ 3L7ZC 1YNXA 2CCZA 1E1TA 2ID0A 2Z0SA 3CW2C 4P71A 4JI5Q 3J81j 3RLOA 2OQKA 4AIMA 2VNUD 4H02A 4BXXG 1PYSB 3HOUG 3TREA 2JEAI 1Y1VH 5FLMH 1JJCB 4MTNA 5IYBG 2I0QA 3ULJA 1IL2A 1NMGA 2YU9H 4PG3A 5BR8Q 4BBRH 4OO1I 1Q8KA 4GOPA 1SN8A 3J81c 4HJ9A 5FJ8G 5GROA 3EIVA 4DV6Q 2KENA 1IBKL 2N8NA 2Y0SE 3CAMA 2JA5G 4A93G 1TWHH 5IYCG 2KBNA 5ELOA 3CCVA 1KC8C 4IOAA 5C0XJ 2Q2TA 4RG1A 1AE2A 3F1ZA 1PH9A 3S1RH 5JJLA 4MZ9A 2KHJA 4P74A 1LUZA 1IXRA 2JQOA 4A3JG 1BVSA 4LF6L 3CC7A 3STBD 1VQAA 2OTLA 3H0GG 3CCUA 1XMOQ 4GLAC 2HT1A 1HNWQ 4GNXB 1N33Q 2BA0A 4JBKA 1Q12A 3PCOB 4JI7L 3KLWA 2N78A 1XMQQ 3UDIA 1FVIA 4QJFA 1B7YB 5LMNQ 2HHHQ 2HIVA 1HZCA 4DPGA 4B3RL 4GKJL 1MJEA 4GS3A 2R7FA 4LFBQ 4QQBX 4Y52H 1J5EL 4P75A 3HOWG 1LTLA 3MEFA 3HOVH 2D62A 1PA6A 1XNQL 2BH2A 1G6PA 4LW1A 1VQCA 4DR6Q 3E0EA 2JJQA 1MIUA 4GN3B 1HNWL 3GD7A 4DUYL 2K75A 5C3EG 1IBMQ 1VQ9A 3HOZH 3HKSA 3CMEA 2CWAA 4WJ4A 2R7DA 3GTLH 1XPRA 3GTPH 2RHQB 4PZ7A 1XNRL 2JA8H 4GKKL 1HJPA 1AE3A 4JYAL 5J3BA 4AH6A 3H15A 1VQMA 4A3DG 2E2HH 4FDBA 5C44G 4UPAA 4IFDJ 1IZ6A 3CCRA 1A8VA 3G4SA 1CSPA 5C4XH 2VW9A 3F2BA 2I5LX 2AMCB 3J7A5 2OCEA 2ZJQA 1ASYA 3G71A 4A3KH 4QY7A 4A3IH 1IBKQ 1FGUA 4L5SA 1EQRA 4LF9L 2IHFA 5IWAL 2AHOB 3A5UA 3AEVA 1X9NA 1WCMH 2EXDA 1NTGA 4A3LH 1YBYA 1TWGH 2A8VA 1LM0A 1VQOA 2R7ZH 4BY7G 1SMXA 3GTGH 2UU9L 4LF6Q 2B3GA 2BA1A 3BU2A 2BH8A 4A4IA 4ALPA 3UDGA 1VQ4A 3B6YA 5IP9G 3AYHB 4A3GG 3A0JA 4JI7Q 4GNXA 2K50A 4JBJA 3AQQA 1WOCA 4MNOA 5M5XH 1JJGA 2A1AA 3RN2A 1XTDA 1YEZA 1N8RC 5GAHC 4GOPB 4B3RQ 4GKJQ 2EIFA 1SE8A 3K80C 2JA6H 1E24A 4C3JH 2R6GA 4DV4L 4UP8A 1J5EQ 1HR0W 2IX1A 1L1OB 1M1KC 3S24A 1M90C 1H95A 3FKIH 1QVFA 5LMUL 1XNQQ 1A0IA 2YV5A 3EBEA 1I3QH 1Y1WG 3ER0A 3UE0A 4DV3L 4DUYQ 2E2JH 3I4NG 2UXCL 4PZ8A 4APVA 3STBC 1Q7YC 3M4OH 1EFWA 3ICEA 3S1MH 3CPFA 4UY8C 1K8AC 1XNRQ 3CD6A 4GLXA 4GKKQ 3T1YL
chains in the Genus database with same CATH superfamily
2I87A 2D0OA 3R93A 4IR1A 4KLKA 4JYAQ 3ERQA 3PW0A 1PX2A 3GQBA 3M4YA 4IO9A 1B04A 1EZ1A 3TP6A 2FMMA 2LXKA 1M7JA 1FD7D 5L1LA 4DR3L 3T5KA 2ATWA 3LP8A 4DV2H 2H4OA 4LF9Q 2UVVA 2PZTA 4LUOA 5IWAQ 4I50F 4FO2A 4MV7A 1EY9A 4BBRG 1G91A 2JYOA 3RB6A 1PH8A 2WB1E 4OXPA 3M3YH 2UU9Q 4IJHA 3FHWA 2NUCA 1VQ5A 2CWPA 3SK8A 4R7RA 1N48A 5D1OB 3RLFA 2WKDA 5EJWA 3H91A 4DR2L 2ZTDA 1FJGH 5KFDA 1U9RA 1FYCA 4O3PA 5KNBA 1M4VA 2HDMA 3FDTA 2VQFH 5JJIA 1CM9A 3HG9A 4DV0L 4ZKBB 1E4EA 3J80W 4NB3A 5A2QL 1L1OA 4L8JA 1GSOA 4DR4L 4G7HC 1YZ6A 2A6EC 3AB9A 3IFDA 5CV5A 3BQ1A 4UHVA 4JI6Q 3K3PA 1DOKA 2UXCQ 4DR5L 1GGOA 4RB0A 5I2XA 5EBDA 3HOVG 3TINA 1PTOC 1YJNA 2Y0SB 2FPPB 1DGSA 2H5XA 1EYDA 1G8ZD 1QILA 1Z7TA 1T3NA 3HOZG 1O7ZA 1KIXA 5IP7H 1GLVA 4IUQA 4YY3L 4KD3A 5FLXc 3GTLB 2IL8A 4CGYB 2K52A 1DCZA 2FP4B 1Y8NB 4YCVA 5KFSA 1QG7A 1HTPA 5CV7A 4DR3Q 1IBLH 4K8JA 3KJPA 1EY8A 1TWCH 1I7LA 4F7XA 3GTOB 4LNQA 3QOLA 4OX9H 1YHBA 1CFMA 3NPPA 4KKUA 4OEMB 4JV5H 3E3XA 2R7MA 4X65L 1DXMA 3S16H 4GZYC 2F0GA 3BVZA 4JI5H 3I4OA 1N34L 1K8OA 1JXLA 2CQOA 3R5XA 4ZOLF 3GTOH 3Q8QB 4J9QA 4DR2Q 1K0RA 1Q81C 3OOCA 3V2TA 5DGAA 2VR1A 4RGOS 1MI2A 4WORA 4DV0Q 3A56A 3CCJA 4PDBA 3DWPA 1BOSA 4ZK9B 2IHEA 2WIIB 3OSNA 5L1IA 4QCLA 4DR1L 5IT9W 4DV3H 4DR4Q 3PF5A 1VQJA 1JE5A 4DR5Q 4HNUA 4RWSC 4C3JB 1QUQA 5FLXE 5LL6S 1N33H 2PZWA 1TWCA 4LF7L 3PW2A 1IYVA 1GO3E 2Y0SA 5J39A 2HHHH 2B8FA 2JEBI 2QYZA 1ET6A 1GD7A 2KHSA 2O4XA 1HNZL 4YY3Q 5KFZA 4O3SA 4DGZA 3OYYA 3CC4A 4UAIA 4J9LA 2K28A 4YCWA 4DUZL 3GV8B 3RN5A 1RODA 4NKLA 3D4RA 1C8CA 1IBMH 3CC2A 1IOWA 3PV0A 4N8FA 4NXML 3GQCA 4LFAL 4X65Q 2ZDHA 4PWQA 2E76C 3LWEA 5KFMA 1LABA 2R85A 4K0KL 5C5JA 1ENCA 1LLRD 3S1NB 2F0PA 3M7NA 1N34Q 2XWBB 1TS4A 2SNMA 4RAUC 2VPQA 4KHZA 1E22A 2VUMB 4X3KA 1PXUA 2E5LL 4POGA 3Q24A 3AU7A 4PMWA 2YRXA 5F9NA 2FK3A 2YZNA 3SDZA 4B9XA 3PO3B 4K5VA 5GAEC 5M3FB 2VPSA 1LO5D 4DR1Q 1YIJA 3S1NH 2A6HC 4MV3A 3KAKA 4U673 4KV6A 2HVQA 1NNXA 2EE1A 4CDEC 4HR7B 1TA8A 4JI2L 5E7NA 4DK3C 4X64L 4KHVA 2KQ3A 2A73B 5LMNW 4LF7Q 3GIDA 4JI7H 1EU3A 3KBGA 3JRXA 2YRWA 3PO3H 2AUJD 5M3FH 2FLNA 2A68D 4CJ2C 3WO0A 2L9HA 1HNZQ 4GN4B 2VB3X 1HUNA 1PTOF 1B4OA 3NP8A 3GILA 4IPGA 2R8JA 3K7AB 1LTGD 3MFIA 4NXNL 1C7YA 5TSSA 2ATLA 5IP7G 4RB1A 2NVQB 2B39A 4NXMQ 5DEHA 4JI3L 2JSOA 4LFAQ 3OSOA 3F8NA 1Z2OX 3Q22A 4K0KQ 4GLVB 2V1CC 2Y0SG 4GKKH 1SFOB 4ECZA 1RCVD 3G6YA 3K7AH 4K6DA 2KVMA 1I4PA 2LXJA 4XYOA 4IJLA 2UXDL 2RQXA 1Q86C 2R8IA 3CCMA 2E5LQ 5KG5A 2PW5A 3NBIA 4B3TQ 1HXYD 4V0BA 1X3GA 5DLFA 1BBXC 1KD1C 1I50B 4DV2L 2XCLA 2UXBH 4YWLA 4TVAB 2VZAA 4XQJA 1VCIA 1SFOH 4EEQA 1SRUA 4CDCC 4JUZA 1X56A 4WBNF 1QOHA 4JI2Q 3J80c 2MGSA 1KNAA 4X64Q 5JVLA 1I50H 1WR2A 2HDLA 1FJGL 3IKJA 5COYA 2M00A 1KJJA 1AN8A 1E3PA 2ZJRA 2VQFL 2F0WA 3R23A 3OHBA 1NMFA 5DLQE 5F2DA 5IGBA 1NUCA 2AUKA 2R82A 5D8DA 1SCUB 1FNUA 4P72A 5LMUH 3E0JA 3IFTA 4NXNQ 1P16A 4G7ZC 2GLTA 3T5LA 1CT1D 5C3EB 1J6QA 1ZETA 1J9OA 4KY6A 2K03A 2V59A 1AFPA 4KMUC 4JI3Q 3NWSA 1KEEA 4C3JG 4F4WA 1S0NA 5DGBA 1L1OC 4R1JA 1QNUA 5HGQA 4A3DB 4QW8A 1TWFB 4L5TA 4N9TA 2UUAH 3DXJC 1SFOA 2UXDQ 5KFNA 1EUDB 4J9NA 1D8LA 1EIFA 5C3EH 2R3ZA 1U4LA 1AZQA 1G2SA 2XGTA 1IBLL 2MCTA 1EUJA 2SDFA 4S3SA 4DV2Q 4YJ2F 3J80E 3PW4A 3S15B 1CA6A 1R4PB 4OX9L 1GM5A 2JEJA 1KLUD 1CSQA 4A3DH 1TWFH 2B2VA 2GN5A 4JV5L 4Q43A 3S2HB 1HH2P 3PUZA 1E7ZA 1EY4A 5KFYA 3IN5A 2XCPA 4ZUJA 4JI5L 5IT9c 2J4XA 2DLNA 4A3GB 2RGVA 4QL5A 4O0AA 1EFID 3A74A 3TZUA 3S15H 3BZDB 1FJGQ 5JPNC 2VUMG 3PR5B 2IMWP 3RB0A 1VQEA 2VQDA 2FFKB 4TQUS 2IX0A 3WDNA 2VQFQ 4DV6L 3H40A 3S2HH 3M9BA 2JA9A 3BG3A 3SXHA 1S4ZA 4ECVA 2F0DA 4OONA 1RIPA 4DV7H 3MAQA 3PO3G 5M3FG 2IT1A 2EVBA 1X54A 1YNJC 2LS01 4LFBH 3TQ1A 2Q2UA 3LNNA 1IYUA 4ED8A 1P8LA 1WJJA 1QVGA 2FLPA 1N33L 3K6OA 3J81W 1O7YA 1PHJA 3MR5A 1TU2B 2HHHL 1BXTA 1NY4A 1JC7A 1S3OA 5CORA 1TWGA 2FE3A 3CVZA 3A8KE 1TWFA 5I47A 1STNA 2R8HA 4TV8F 2PQEA 2DGYA 1SNQA 1TS5A 5CV4A 4J9RA 2IA6A 2CFMA 1IBLQ 1V1QA 2G9HD 1T5EA 3MR2A 3GTQB 4RHSA 2KCTA 3K0XA 5IT9E 4OX9Q 1IBML 2GVAA 4HNTA 2YTVA 5EKIA 4JV5Q 3W2DA 2XGPA 3L7ZC 1BF4A 4F50A 1YNXA 3Q0AA 1E1TA 2Z0SA 3CW2C 4P71A 3HRZC 4YR2A 3GP7A 4JI5Q 4QWEA 2OQKA 2VNUD 1B33N 2JN4A 2PZUA 2V9WA 1RJPA 1JJCB 2I0QA 3ULJA 4PG3A 3RMHA 1KDBA 4IUNA 1UNNC 5C5LA 4GOPA 2WTFA 5G3LD 3RTXA 4DV6Q 3KALA 3KLSA 3CAMA 5A2QW 3HGBA 3VA5A 2KBNA 3E5SA 3CCVA 1KC8C 3NTHA 5KKNB 2UUBH 2TSSA 5JEAH 2Q2TA 3GIJA 4AYBA 1AE2A 3F1ZA 2B2UA 4DNRB 1A3VA 2VA2A 4Q8EA 1I4QA 1LUZA 4P74A 2K05A 1W6JA 2FK1A 4HMIA 2HT1A 4F4XA 1N33Q 2BA0A 1Q12A 4JI7L 3KLWA 2W9BB 5E1FA 1HNXH 1JCKB 2IWHA 3RB4A 2HHHQ 2F0IA 3FVQA 1HZCA 1I6VC 2KJXA 1FNVA 3GTPB 2KCNA 1LTLA 2MJ8A 4X3SA 3BYTB 1PTOB 2D62A 3MEFA 1PA6A 4MV4A 4OIKA 1XNQL 2E2HB 5EWEA 1VQCA 3MWYW 4RNOA 4RCNA 1C4QA 3E0EA 2JJQA 1MIUA 2C2DA 1EWCA 1NAPA 4YP3A 3GD7A 4QWDA 2K75A 5C3EG 1IBMQ 1N32H 5T14A 3HS0C 3Q6SA 3A55A 2PPBC 5M9OA 3MC0B 4XT1B 3M9OB 2F4VH 1XPRA 3GTPH 1ULZA 4GKKL 5KFEA 5KFBA 2EYPA 1TY2A 4A3DG 2E2HH 4UCTA 2R7ZB 4MV1A 3U9SA 2JXMB 3F2BA 2CVRA 2J7ZA 1U4RA 5EPLA 3I90A 4QY7A 5FOBB 1EQRA 1QNKA 1RJTA 2FPIB 2AHOB 4EQPA 5K36H 2A69D 2R86A 4A3LH 1YBYA 2R7ZH 2DZDA 3X3NA 3PZPA 3FKIB 3FMAA 2CW7A 4ZRZA 4QB4A 2BH8A 3C1EA 2QK4A 4A3GG 4Z9CB 4JI7Q 2E75C 2OEOA 4IN3A 5KFXA 1K8MA 1WOCA 3TIIA 4JV0A 5JQWA 2W9BA 4DU9A 2A1AA 3RN2A 2YW2A 1FKAH 4MTEA 1V1OA 4MIUA 2FJ2A 2EIFA 3K80C 1H95A 3GTPA 1KC7A 1M1KC 3FKIH 2WAQB 3EQLC 2XRQD 5LMUL 1XNQQ 2R7KA 3EBEA 1A15A 1EZ8A 2ZXRA 2QCPX 2E2JH 5CA1F 5ELEA 4APVA 4DV1H 5KIXA 4MTKA 4CJ1B 3M4OH 1IKMA 3RIZA 2YYAA 1K8AC 3SE0A 4GKKQ 1Q8IA 3FP9A 1YHQA 4ZQ3A 4EGVA 2UUAL 1D2BA 3CQZB 1EYAA 4JBWA 1EOVA 4KY5A 1VQ7A 2DY8A 5EWGA 4Q45A 3QFFA 2B2WC 5EBCA 2R7ZA 3MXNB 1EWIA 4XQQA 4IUPA 1RTOA 3VR6A 4DXFA 3K5LA 1IBKH 2W8KA 2Z6KC 2DUDA 5IY0A 3R8BA 3PN1A 1TVXA 3MFHA 5JVH3 5CA0F 3K5NA 1HRJA 1R9TA 5BPFA 5I6WA 2C00A 2LFNA 3TRZA 3JAMi 3CQZH 3NQTA 4BA2I 1K1SA 3BYYB 4UDUC 4DFAA 2WYOA 4TRDA 4KKSA 2FXQA 2P5ZX 1OXSC 3FKIA 5CAEB 2QDLA 3U58A 2B2VC 5JJZA 3NUCA 2OF1A 3PIP3 4RAZA 2PW7A 2F03A 4HNVA 3TS2A 2CZGA 1X55A 2EXZA 3DHQA 4IPDA 4KKTA 3RZDB 3RAXA 2NU8B 4O2DA 4DV7L 1S40A 5LMUQ 2NZOA 4KD4A 3R5FA 2Z1CA 1CKNB 4LFBL 4ED7A 3C2PA 3FDSA 3I91A 3Q8PB 1NCVA 1TS2A 5AJ3L 2R7NA 3Q23A 4Q8FA 1IYJB 1H9SA 1SMYC 1UEAB 4KJOA 3TP8A 1PYWD 3RZDH 4HIDA 2UUAQ 2R8GA 4UFZA 3ZJYC 1ILPA 2NVXB 4L63B 1UEBA 4NP5A 3CQZA 2PI2E 2IW3A 1Z6HA 1WVLA 1JOOA 3RLNA 1KJ9A 4EX5A 1WFQA 2NVTB 2W70A 4FP5D 1BBUA 4A3CG 4KI0A 1OXXK 3TEHB 1YJWA 4J15A 1B3AA 5ELFA 2R92A 2NVXH 1CK1A 1X3PA 4FS1A 4YJ3F 3BA9A 4YR3A 1F9PA 1VQNA 5NUCA 5K36G 2F3WA 1EYCA 4RUCA 4ZLTF 1B50A 1QVCA 2NVTH 2AGPA 1KXLA 5DM73 2R7ZG 1VS0A 5C0XH 1YHAA 2VY3A 1ILQA 3QO2A 1BCPB 4Q0FA 2ALZA 2E2IH 4O3QA 3VA7A 4N8X1 2DJGC 5FKAC 2MHVA 2HCIA 4DK0A 4DV7Q 2NWGA 2UUBL 4A3FB 2EYLA 4IUVA 2HQEA 4YBZB 3DM3A 1WTWA 2J6TA 4GOPC 4LFBQ 4YB8B 3KFUA 1CKNA 3KF6A 2BQUA 2L12A 5H80A 2K4KA 4ECQA 4O42A 3LWUA 3NEMA 5AJ3Q 1JIHA 5KG2A 3FKIG 4KTAA 5KT4A 2RDJA 3NTKA 3BQ2A 2IJ0A 3R3OA 1PRTD 1FL0A 3WOFA 2B2UC 1HNXL 1A6XA 4LH6A 2K5QA 4CBVA 3HZXA 5KG4A 2QDBA 4A3FH 2FKLA 1EOTA 3BJUA 4QF4A 4JVZA 4DK6C 1EYGA 1RL2A 5T1GA 1JB7A 2KEDA 3M9NB 2HVRA 1JMCA 2OWOA 4HJ8A 4A2BA 2WAQG 1WTOA 3CPWA 3OW2A 1PYBA 3WNZA 4QW9A 4A3BB 3MXGA 3G48A 2D2CC 1EU4A 1EY7A 1N32L 4ZI7F 3HFZB 4HEDA 2E74C 4RCOA 2K04A 2E2IA 1UE1A 3PQIA 1PH2A 2F4VL 2YL2A 3BDLA 2WAQE 5GAGC 3CRKC 1PFBA 1SNPA 4G7OC 3M3YB 4A3BH 2YZMA 4CKBA 4OL7A 4UCOA 3FPPA 1Q1EA 2BE5D 1GSAA 2X6LA 4O3OA 4RB3C 5KX5F 2F0UA 5K2MA 3ONAB 1UE5A 2UUBQ 1EY0A 1DOMA 3V05A 2WFWA 3UE1A 4YR0A 2DNCA 2QW7A 4QIWB 4A76A 1WTHA 4J9KA 1KJIA 1YJ9A 1VAJA 2Z6BA 3H20A 5DQIA 1XX8A 4LF6H 1K0SA 2K5HA 2P0AA 1RYSA 4JI8H 3EA6A 2GVBA 1EEID 2NTSA 1HNXQ 2WACA 3NXWA 4ME3A 4DXGA 4BY1B 1S68A 3WWVA 3TN2A 4LH7A 4B3RH 1HUMA 3I4NH 3H94A 5D3IB 3TQYA 1R4QB 2OTJA 3BS1A 4O4HF 2PMZE 2HUGA 4LSAA 4TKOB 3I3CA 3UDXA 4DUYH 1VQGA 4HTHA 4BY1H 1DYQA 1MHWC 3N40P 1N32Q 3RGZA 3G7LA 1QUQB 4DV1L 1TQOA 2WDTA 1TWCB 2X0SA 2F4VQ 2EY6A 2N88A 3U4VA 1CI3M 1K9MC 2WKCA 4TQSA 3PR4A 1MKHA 2LMCB 3S14H 2W9CA 3RBDA 4RHRA 4IZOA 3S16B 5ISRA 4XYMB 4O2AF 2NUAB 1N9WA 4A93B 1SEIA 4B3SH 1Z9FA 4EG0A 1IL8A 1K8GA 4CJ0B 1PFMA 1H9JA 2K33A 4XDXA 5KFAA 5C0XG 3HOUH 3EPIA 3DUZA 3UI2A 3BZKA 1Z2PX 1X3QA 4F8MA 4QIWA 1WI5A 1XJVA 3RD4A 5KG6A 5FJ8H 1GUSA 5CB4F 5EKLA 3GTKH 4A93H 2A5HA 5KFOA 2ES2A 1YNNC 5IYCH 1M6VA 2L5TA 4PNYA 4HIOA 2FB9A 3BQ0A 4HQ6A 3HBLA 3HOWB 1D7QA 2UVUA 4IR9A 2F0JA 1HR0H 1BJTA 1U0LA 1AZPA 3PIPA 1BKBA 4A3FG 2K6AA 1C48A 2CW0D 5KNCA 4OWXB 4LK1C 4HIMA 3VR4A 1W3SA 4B3MH 1NBWA 1C3OA 4DV1Q 3I56A 1LTID 1IHZA 3HOWH 3RB3A 2FMCA 4N9PA 1VQHA 3T1YH 2Z4HA 1SXTA 2MQHA 3CCLA 4ED2A 3OUZA 1TAEA 1SE2A 2EYJA 3T16A 4JV2A 3C1FA 3ORRA 5K5PA 2W6MA 5LL6b 2N3SA 3GTKA 3CMAA 1BDOA 5HGTA 5EZYF 1VF7A 4YHHH 3MFYA 4R4IA 5C4JB 1B44D 4EGJA 4A3BG 1GYFA 2B8GA 2F4IA 3SK4A 4BY7B 2F0SA 3OHAA 3NELA 3P1HA 5J2UF 5EPKA 3J7ZC 4ZUIA 4OHJA 3TZDA 2NZHA 4K14A 3RJ0A 3BA8A 3D6WA 3KOJA 1JORA 5EOYA 2ZXPA 1KL9A 5J2TF 1F2LA 5KNDA 2JEGA 4M9UA 3F2DA 4ETSA 5C4JH 5FD5A 4BY7H 4DV5H 3J81i 3J7AV 4AQYH 3PIO3 1CUKA 1HTLD 4ED1A 3G6XA 4MV9A 2W6QA 4JC0A 1EIGA 4H13C 3J7AK 2SEBD 1SYFA 2L11A 3N43B 2JEFA 4NLGA 1W93A 4FYDA 4IWYA 3K58A 4POFA 4DAMA 5KGUA 3OSPA 3DEPA 2BQ3A 3UFXB 3RNUA 4FF2A 5IIFA 2IY5B 1G2TA 2RF4A 1TS3A 4BY1G 4C3HH 1VQIA 4LF4H 1STBA 2XCAA 2F1MA 3SGIA 1PH5A 1MSGA 3K5HA 2F0QA 1WH2A 3KK7A 1CTMA 2I46A 1V43A 1Y8OB 4DUZQ 1Y1VB 4F88A 3L2PA 3BVGA 3I2ZA 5EAYA 2YU9B 3RGXA 3GIKA 1F2MA 2XTIA 2YTYA 3HKZB 2AQ1B 5LA6F 2ID0A 2L0CA 1S5BD 1EY6A 1SNDA 1ZHSA 3T53B 2LY7A 4FM9A 1PYSB 3S1RB 3HOUG 1HQRD 2DPIA 2Q8RE 1Y1VH 5J1ZA 2ZM6H 3ND8A 4MV8A 1NMGA 2YU9H 4EVOA 4OO1I 1Q8KA 2ICIA 2KEEA 3DMUA 4UCUA 4HJ9A 5FJ8G 3KAJA 2N8NA 2Y0SE 4A93G 1TWHH 4F87A 5I4DA 5IYCG 2PVPA 3T51B 5C0XJ 3FRPB 1QE6A 3EJIA 3L9AX 3S1RH 4MZ9A 2KHJA 1IXRA 4EFEA 4LF6L 2W7PA 1BCPC 3K0YA 1CQVA 1SNCA 1VQAA 4RKLA 5T1IA 3STBD 4GNXB 1XWEA 1PLFA 5L1JA 2BR0A 4DL6A 1ESRA 3UDIA 2V4RA 4QJFA 1B1ZA 4R9WA 2KUMA 3VYSA 3JZIA 4B3RL 1MJEA 4QQBX 4IRKA 2OXPA 4Y52H 3HOWG 5KT6A 3TSSA 3JRWA 5C4XB 4JW0A 4C56C 1Y1VA 4DUYL 3ORQA 3ETJA 3TIGA 2YU9A 1TT2A 2V58A 2R7DA 1MSHA 2AU0A 3HKZA 3MXUA 2RHQB 2JA8H 1TWHA 2EY2A 2AQ3B 3NQIA 5C1PA 3H15A 1TWGB 3BDCA 1JOKA 4HCEA 3GTGB 1A8VA 1LT3D 5C4XH 1U4MA 2VW9A 4RB2C 2I5LX 2AMCB 5EWFA 2ZJQA 4U7CA 1ASYA 5KT5A 4F4YA 2R7LA 5FO9B 2W9AA 4O4LF 4OO1H 3T13A 3BDOA 1WSCA 1X9NA 3F2UA 2A6ED 5G3LF 1TWGH 1O75A 3RV4A 2JA6B 2EJMA 4BY7G 1SMXA 1ZYRC 3GTGH 4FS2A 4LF6Q 1VMPA 1ZEQX 3VPBA 3BU2A 4FXDA 1VQ4A 3CKIB 3UDGA 1RJQA 1JX4A 2G5DA 2F0LA 4GNXA 1AP0A 1PMRA 4JBJA 1BGWA 1EWHA 5L9XA 4K6LA 1KAAA 4LSXA 1YEZA 4GOPB 4B3RQ 2EYOA 3S1MB 3QWNA 2JA6H 2XWJB 4UP8A 4HSVA 3S24A 4DR6H 5ELBA 4C5AA 1RKNA 4OELB 4BBSB 5DG8A 1A0IA 4AYBB 1F2YA 3ER0A 3NHHA 3QR8A 5EKKA 4HSPA 4DUYQ 4DV3L 4X62H 4JK1C 4DR7H 4TUYF 3QZ7A 4PZ8A 1JDBB 5I2YA 1EFWA 3S1MH 1PDQA 5IGDA 1H9RA 4GLXA 3T1YL 4NDXA 4BBSH 1K3RA 4YIJA 1EZ6A 2WP8J 1EYZA 4EQ5A 4BWGB 1QWYA 3GTGA 4I65A 1B6SA 1E2WA 1VQ8A 1BBWA 1STYA 4ABNA 3VYUA 1ENFA 5D14A 2VQEH 2EQSA 1SDFA 2F0TA 2JA7B 5CV8A 1Y1VG 1CS0A 4BS9A 4ZKCB 3G6EA 4JBMA 4YHHL 1G6ZA 4RUAA 4JPBW 5BMVF 3R2IA 4JI1H 1VBHA 3GIQA 4J8QA 3HKZG 2JA6A 3IL8A 1HZBA 4BWSC 4XT3B 3SR1A 4J1MA 2XGQA 1GUNA 1X3EA 2PQAA 3M4QA 3OW7A 3ZYYX 1PH6A 1QJOA 2JA7H 1D1IA 2B63A 5JH7F 1FNWA 1L2ZA 4MA5A 3PW7A 4C3IB 1S5DD 1BCPF 1STGA 3V4ZA 4DV5L 4AQYL 2RSOA 1Q82C 4TQRA 4OWWB 3JAML 1LYLA 1SAPA 1A62A 5KG0A 4PV1C 2K01A 3PO2H 4QGUA 4GC6A 3D8GA 4A2AA 4DV3Q 1U4PA 3KXYT 4YWKA 3PIOA 1EUCB 2PBZA 4O1NA 4C3IH 4JCVE 5E3FA 2K5DA 2PNHA 3EROA 4PMBA 4C1NK 3IG0A 4JYAH 1H9KA 1EL0A 3MTSA 3CRLC 3CCQA 4PMCA 2RDFA 4LF4L 4UCVA 5M3MB 4YCUA 1S5ED 4CC6A 5HBRB 4XQNA 3NGDA 3Q2OA 5DG7A 1B9MA 1E4GT 5KFPA 3U4ZA 4EYIB 3D4WA 2JA7A 4NPSA 1LTRD 2FLLA 5C4XG 2A6HD 4YHHQ 5KFKA 4FBUA 3MXPA 1VQ6A 1DV1A 3T1HH 4O2BF 4RU9A 5M3MH 1ZXTA 2YTXA 3EVQA 1LV9A 1O78A 1TY0A 4OO1G 1CZWA 4R8IA 1X65A 3JC66 2C9OA 1OXUA 2Z4IA 1XYIA 3I4LA 2ZM6L 2HQLA 4B08A 5FO7B 3K57A 3N6XA 2M2LA 4HIKA 1KDAA 5E4XA 4DV5Q 1M0TA 3H3VH 1VQDA 2VXWA 2WE6A 1R9TB 2F0OA 1TIID 1OWTA 1S10A 2NBFA 3LGJA 4XIGS 4JI6H 1DOLA 2VUGA 1DZ1A 3DLLA 3KHLA 4NW2A 4DNIA 2KCMA 4QUCA 3K8AA 4ZAIA 2JA6G 3HXLA 3MR3A 3ULPA 1XMOH 3M85A 1SYGA 1B9NA 3I12A 5KT3A 5KG1A 5GONF 1HNWH 1PK8A 1XMQH 1T36A 2AWOA 2CHBD 2AWNA 4XYQA 5JPMC 5BN3A 5KFGA 3N52A 5E4WC 5KG3A 3FEWX 4EBEA 1R9TH 2E2JB 4ECUA 4LF4Q 2NU7B 4IRCA 4XYLB 2RDHA 1XPOA 1SROA 3M4OB 2F3VA 4UP9A 3E5NA 3V6JA 5I6YA 2JA5A 1TKWB 3S2DB 3MFGA 4BBSG 1VBGA 5LP6F 4AYBG 2B2YA 5HY6A 3CU7A 1V8QA 3CHBD 5IGCA 2CQAA 1KRSA 1H9SB 3OWEB 4H7BA 5IGGA 1S72A 4ED6A 3P20A 1ONLA 2MO1A 1YI2A 4AYBE 4C2MB 4M1UB 3S2DH 5KFCA 3MWMA 1A2TA 3URYA 4LUVA 2ZM6Q 4ECXA 1E2VA 1V51A 2AGOA 5C6AA 1TXYA 2X69A 3SHLA 1WTPA 4JG2A 4DKAC 4LAAA 4LMYA 3RF2A 1CHPD 2JA7G 3K5MA 3KUPA 4C2MH 4RKBA 4PZ6A 2R92B 1LTAD 5D1PA 5DQGA 2W57A 3RV3A 1A2UA 3PUYA 2RBMA 3J80i 2O03A 4HJ5A 2D5DA 5C0XI 3QB3A 5JEAG 2JK8A 3EFXD 4ECRA 1L0XB 4GKJH 2WB1B 4R4QA 2DWCA 2Q2IA 4FNFA 4C3IG 4O4IF 1J5EH 2R92H 2RCFA 1PRTF 5CC4A 1GVPA 1SYXB 2EYFA 4GNXC 5C4ZA 3X3MA 3D3RA 3H6MA 2CW0C 2O2LD 1Y14B 3EYYA 4ODGA 1SYBA 1FR3A 1GUOA 4X62L 3KF6B 3IAYA 4DR7L 3PUVA 2C5CA 4DK1A 3HOYH 3F2CA 3N42B 5C4HA 1Q1BA 3UDFA 2F52A 3E9IA 3D6CA 4C2MA 2EDGA 3PUWA 3PMFA 2N49A 5M3MG 3I72A 3VYRA 2F0VA 5GADC 3KF8B 4G4KA 2R87A 4FF4A 1EQQA 5C3WA 1GHJA 2VQEL 2KSWA 4RAYA 4DR1H 1BUVT 2K5WA 1OTCA 2FINB 2QGQA 4I7AA 4BXXH 2EOTA 2J9GA 4Y8VB 2RHSB 1MJCA 1YNJD 4JI1L 1EEFD 4A3JB 2BDNA 4FXGC 1K83A 2E2IB 3TQTA 2LSSA 3V96A 5M5YB 4R8UA 4IPHA 1E4FT 2C2RA 3S9WA 2J6SA 1G291 4A3LG 3KTMA 5KFHA 1HNZH 3D31A 2JE6I 3AFPA 2GA4B 5KFVA 3U9TA 3I73A 4FF1A 4A3JH 2WB1A 4DV4H 5KYIA 1U5KA 3VPDA 5KG7A 4R4OA 3NSWA 1AEXA 4DN4M 3L4JA 5M5YH 1HA5A 4JOIA 4X62Q 1E1OA 1KAWA 4DR7Q 2NU6B 4IHJF 5GQOA 1O7IA 1GSHA 1MZBA 1HFGA 3QOJA 1SE3A 3M7GA 1KRTA 2UUCH 1A3TA 4KJNA 3K3VA 2A68C 4EEYA 2X6GA 1D6EC 1LT5D 4XZ3B 4B3TH 1V4YA 4ECYA 4R4TA 2NN6I 2RVLA 1H9MA 4IAJA 4WFN3 2VQEQ 3KF8A 3U50C 2YS7A 1KHIA 3L0OA 4J6HA 1XDNA 5JUMA 1JE4A 4DL5A 3W5OA 1WD0A 2I5MX 4JI1Q 3T1HL 1C9OA 4X66H 5L1KA 4DL3A 2HVSA 5JVG3 3Q8SB 1VQKA 2KCCA 2F3IA 1VQFA 2HIXA 2QEJC 4TSSA 2BOSA 5EQ0A 1QCBD 1VKZA 2W9CB 3G6VA 3CP0A 4RFBA 4V190 1VQPA 4OGQC 1CA5A 4HJAA 3VYTA 1BR9A 1KNEA 1PFNA 3CCSA 2ASDA 1NSNS 1Y1WB 4ECSA 2QA4A 1JB3A 1HZ9A 4JI6L 4X6AH 3I4NB 1WTQA 1NJIC 2R92G 4Q5VA 4EFBA 1I4GA 3EPGA 2W6OA 4EYHB 5F9LA 1XMOL 1HNWL 1ICWA 1PH4A 5KFTA 5JEAJ 5FD6A 4O3RA 1XMQL 3J81L 1GUTA 2UXDH 3PGZA 2A74C 3I4MB 2M05A 1Q3LA 1V9PA 4I7ZC 1Y1WH 1S0MA 1HA6A 1LTSD 2WB1G 1F2ZA 5JOBA 1HHVA 1B6RA 3HOYG 2OQ0A 2CH4A 2RCNA 4BA1I 1PV4A 3MA2B 3S14B 4FF3A 1B70B 2YS6A 2NN6H 3BABA 3SE7A 1IKLA 1C30A 3Q1KA 4FBTA 1Z2NX 1AUVA 2ZDQA 3I4MH 2MP1A 1JKJB 2GPSA 3T1HQ 2ZJTA 1N36H 1S03G 3GV5B 2CCZA 2FK2A 1LT6D 3C0FB 1F9RA 3J81j 1JQYD 3RLOA 1JOQA 4H02A 1DV2A 3A54A 2JEIA 4BXXG 2B2YC 2B2TA 2NTTA 3HOUB 2JEAI 5FLMH 1CQIB 2DJFC 1F77A 1UC9A 4R8NA 2D9UA 3H3VC 3N41B 1SN8A 3JAMW 4HYKA 4C5CA 4UCRA 2XSCA 1IBKL 3GTKB 3OHXC 1RDPD 4WJWA 4IOAA 3KLSX 4K2LA 2UVRA 4G3IA 1I4XA 3T56B 4RG1A 1PH9A 3MR6A 1Y1WA 2JQOA 2QF7A 1ML0D 4A3JG 3I8ZA 2EYHA 3MZ5A 3CC7A 3DWQA 5D3DA 2OTLA 1XMOQ 3CCUA 1HNWQ 3PCOB 3C3LA 3JSLA 1XMQQ 1B7YB 4K8IA 1AW7A 4GKJL 2EJGC 1J5EL 4P75A 4QUFA 3V6KA 4LFCH 2PCFB 1PRTB 4I7HA 2BH2A 1G6PA 1WD1A 1SBBB 4IRDA 4RH6A 2E2DC 4JI0H 1O80A 3N8DA 4J9MA 4GN3B 5DNFA 1S97A 3OMCA 1VQ9A 1LT4D 3HKSA 3T4AC 3CMEA 2CWAA 4A3KB 4CC5A 3KLRA 4A3IB 4HCSA 3GTLH 1CHQD 4KHPH 3T5JA 4PZ7A 4ZCKA 5FPRA 1WCMB 1AE3A 5D1OA 2SNSA 5J3BA 4AH6A 3ETHA 1XTCD 3WOEA 1UNSA 4FDBA 4H44C 2EZVA 2RGRA 1IZ6A 4IUUA 2M9VA 2V4DA 4DV6H 5C3XA 2OCEA 3J7A5 2W7OA 4A3KH 4A3IH 2WINB 1FGUA 1IBKQ 4L5SA 2KA7A 5M5XB 3VPCA 1IW7D 3A5UA 4L6TB 3AEVA 1WCMH 2EXDA 1NTGA 5CV9A 1J8IA 1A3UA 3R5HA 2A8VA 1PZKD 3NK9A 3U9OA 4CKEA 2FMAA 4ED0A 3NWTA 3MWEA 3MVVA 3H4BA 2B3GA 2BA1A 5ELCA 4K5WA 1I94H 4MHEA 5CV6A 4ALPA 1SMYD 1I3QB 3TBIB 4UCSA 5I9OA 3AYHB 1GHKA 3K5IA 1MGSA 4IQZA 2K50A 2XIWA 2IBKA 3AQQA 5M5XH 4QMGA 3PVXA 1XXGA 2LKVA 1ESFA 1XTDA 3QJYA 4X3TA 1N8RC 2L4NA 5GAHC 4GKJQ 2W6ZA 4Q0YA 3VR3A 3GTLA 1RJRA 1E24A 4C3JH 2R6GA 4DV4L 1J5EQ 1RYRA 2IX1A 1KBLA 3DF7A 4JI4H 1M90C 3GIPA 3GTJB 5CBEE 4YAKB 3GTOA 4C3HB 2YV5A 4KK7A 1I3QH 1Y1WG 4RZRA 2UVWA 4JV1A 1GUWA 4DAPA 1CE8A 3I4NG 2R84A 1HQMC 4YAJB 3J7AF 4UY8C 3GLKA 3CD6A 2O5IC 2NN6G 2UUCL 2QKIC 4JOIC 3GTJH 1WCMA 1L2FA 3MWDA 4Q44A 3I4MG 1DIKA 4QIWE 4R4CA 2VB2X 4IURA 4B3TL 2W6NA 3DEOA 2K32A 1PZJD 1K1QA 1UAPA 2K7VA 3SK6A 5DQHA 2D0PA 1YVCA 2IP4A 2NYZD 2O5JC 1T5XD 5FLMG 2AGQA 3RR5A 5IYDH 2DNEA 5JJKA 2VUMH 2PN1A 4X66L 1V1PB 2RDIA 2CKZB 4QWCA 3GIMA 4LF8H 3N6RA 1TWHB 2PNRC 2BCOA 2PYKA 1JWMD 3HB9A 5FLXL 2KOLA 3OTOH 1I3QA 4RGTA 5HV6A 4QWBA 2AQ2B 2I5HA 3GIIA 3QZ8A 1DONA 1STHA 4TV9F 5FK9C 1KQSA 3E9HA 5IE8A 4DV4Q 2I8CA 1XNQH 2RKSA 1TWAB 4J9PA 4DAVA 1JT8A 3RUZA 2A69C 3GTJA 2NB0A 4PQXA 4E6IA 3OIPA 3MHBA 1UE7A 3D4DA 3OWFA 3C46A 3KDFB 1LTTD 1G51A 3CXCA 1EQVA 2R6FA 4RNNA 2PO4A 1EY5A 2EY5A 3TP5A 5IOCA 1ZKOA 2UUCQ 1TWAH 4JI8L 5KFQA 4FU0A 4IUTA 4LJZC 4LF5H 4M7EA 5KFJA 4DLKA 2MPMA 1X32A 2NVQH 2VUMA 2F0NA 1OXVA 2XVSA 1XPUA 2JA8B 3NENA 2E8GA 1I4RA 1W6KA 2YCHA 1B3QA 1GKHA 1QZGA 1K3BC 1PFSA 5AFWA 2R93B 3KHHA 1S0OA 4WJ3M 3T5HA 1NR4A 4IFDI 2EPBA 3JAMc 1LACA 1D5XC 4RMFA 4HJ7A 5BPHA 5BN5A 3M9MB 1K73C 4A3KG 1N36L 2DIKA 4X66Q 2V5AA 4A3IG 4KY7A 4HR7A 1RK6A 1V1PA 4J9OA 4EBCA 2SOBA 1JICA 3E6ZX 1WCMG 4DL2A 2R93H 5KRUA 3JSNA 4A75A 5KT7A 5BR8H 4L5RC 2F0KA 1YITA 2WV6D 3J7YW 1RD9D 5I9PA 5KYLA 4B3SL 3HOXB 2B2TC 1TWAA 4ECTA 4I4TF 3Q8DA 4A3MB 4DNTB 4KN4C 2Q8IB 1X3FA 1HZAA 2B2WA 3G6JB 3TMEA 5IGFA 3KDFA 2AQ4A 5ELDA 1UE6A 4K5XA 4ZQIA 4CHTB 2Z6KA 5KFRA 1PTOD 3D0FA 1CQJB 2PQAB 3NBHB 5ELNA 3W3AA 3ND9A 1T9HA 3HOXH 4JI8Q 3A8JE 2B63B 5LMNH 1JR0D 4WD3A 1JLLB 4GN5A 2FHTA 5IYZF 1Z47A 3JAME 4A3MH 4A3EB 4YWMA 1W96A 2C22A 1WYDA 1KTKA 1GJXA 2I07B 4LFCL 4MV6A 1KJ8A 1PH3A 1I50A 1HR0L 1I5FA 2R93A 3K81C 4C3HG 4JI0L 1CQFA 2Q8TA 1VQLA 2ZJPA 2EY1A 2B63H 3M4IA 3VDYA 3I7FA 5D65A 1D1KA 1WTVA 2TMPA 3CF5A 4IFDH 3IRBA 1N36Q 3UQ8A 4B3ML 2Q2HA 2RA4A 4KHPL 4A3EH 3G8CA 1SJED 4ZYSA 3EN2A 1STEA 4ILWA 2NZ1D 1YNND 5IYDG 3LMLA 2J0TD 1JJ2A 2JP1A 1M8AA 1CZGA 1SYDA 4WRDA 3GO5A 3GV3A 4HAEA 3VR2A 4DAYB 1BNZA 4B3SQ 1ICFB 3W1BA 2GPWA 1HPCA 3L4KA 4F4ZA 4A3GH 2ZTEA 1S5CD 4FXKC 3K59A 1Y8PB 1QZHA 5JAVA 4RGMA 4ED3A 1MBYA 3GTMB 2MO0A 1I94L 5M5WB 2YZGA 1N56A 3PO2B 3ULLA 1EIYB 2RSNA 2AKWB 3ITPA 3NBHA 3P75A 1EIHA 2I80A 2G9DA 4RNMA 2HJWA 2UXBL 3H3VI 3HKZE 2ASLA 4JI4L 4LFCQ 3PF4A 5LXTF 1SNMA 3GTMH 1F9SA 2FPGB 1HR0Q 1Q46A 5M5WH 3P7JA 4JI0Q 3J80L 3FMCA 2HCCA 4P2CB 1B2TA 4APMA 2K5NA 1QB5D 4B3MQ 1M0WA 1XNRH 4KHPQ 2ZDGA 1PRTC 2XN9C 3F8TA 3T1YQ 3GTQH 4ME6A 2KHIA 4DL4A 2OLSA 1VDZA 4XX0B 5H1SE 1HFNA 5KFUA 5DAUA 5A35A 1RF2D 1OXTA 3RAQA 3TP7A 3PSIA 5HURA 2JA5B 2ALYB 2NVYB 2JA8G 1SSOA 3W1GA 4LF9H 3HP3A 1AN7A 5JVDF 2R93G 5IWAH 4DAYA 1D5MC 4L1KA 1Y69U 2ICEC 3RUPA 1II3A 2QEXA 2W8LA 4EQNA 1KDCA 2BDOA 5IYBH 2UU9H 4RZQA 3H0GB 3OPOA 4LF8L 3N44B 1KJQA 2Z9HA 1I94Q 3LX0A 3S1QB 1RHPA 2JA5H 3H4DA 1A63A 2NVYH 3OTOL 3GTMA 1NE3A 1GOZA 1UUPA 4IPCA 1PH7A 2VL6A 2UXBQ 3Q8RB 4U6PA 2C35B 1KLGD 2BE5C 2K1BA 3ERSX 4NMZA 4OWTB 2EJFC 4CDFC 4M8AA 2EYMA 4UP7A 1C0AA 1STAA 4JI4Q 4AQYQ 2H1EA 1O7LA 3H0GH 3HOXG 4IWXA 3BZCA 2ASBA 3GTQA 2HD3A 3S1QH 5LHY1 4HN7A 2K5VA 2UXCH 1SLJA 2XNAC 4X3UA 5IT9L 4XTCS 2L15A 4A3MG 1UWVA 1ASZA 2DN8A 1IOVA 5DM63 4LUZA 2L1BA 4G57A 2XIGA 3A5ZB 5BN4A 1CKMA 4EBDA 5LOVF 3KJOA 3GDEA 5KT2A 3V6HA 1PTOH 3O13A 4IOCA 5C44B 3M4PA 3SVMA 4LF5L 2B63G 2K14A 4A3CH 3AFQA 3NE5B 4IFDG 3KYHC 3MEHA 3WO1A 4DF7A 4A3EG 2YYZA 4DR3H 1VQBA 4I55F 1W2BA 5C1OA 2NVYA 3I55A 1PVOA 1Q90A 3RZOB 2IPKD 1I6HB 1UC8A 2HGSA 5C44H 5IODA 1VF5C 1D5ZC 5CGKA 4QWAA 1OO9B 2B29A 4Y7NB 2PI2A 1BCPD 3QIAA 1PZID 4L5QA 1WTRA 4LF8Q 1HCZA 2MNAA 4P73A 3VR5A 1JDEA 3H0GA 1WTXA 1B8AA 3FPUB 1AH9A 2ASJA 3OTOQ 3DM1A 3DWAA 2VS1A 5C5MA 4DR2H 3A7LA 5CMDA 1LTBD 1L0WA 3RZOH 1I6HH 1RTNA 5BR8L 1X6OA 3S17B 5LL6X 5KFIA 2R61A 1L0YB 3H09A 4DV0H 4J9SA 1ET9A 3GV6A 5IGEA 2ZT9C 4Y7NH 3TS0A 1E0BA 3A8IE 1SYCA 2FJZA 2E2HA 2NU9B 4DR4H 5IP9H 1SJHD 4DR5H 1K83B 1GUGA 3KHGA 2ENBA 1BNCA 3S17H 3CCEA 1PH1A 2XRSD 4CKCA 4R8UB 5KFFA 1RK5A 3MJFA 2MUYA 1BO0A 3OMGA 3PO2G 5DLGA 3K7UC 2A19A 5LMNL 4LF5Q 2ZTCA 4ECWA 1ZQ7A 5CYUA 4MA0A 4YY3H 2RDGA 1DD2A 1EQTA 1K83H 3HOYB 1SR3A 3I70A 4DR6L 1I4HA 2MFIA 3PUXA 3TDQA 2F0HA 1CKOA 4LWCA 1E2ZA 4DA2A 4H0LC 4BBRB 2N55A 1AUXA 4X65H 1KABA 2CH4W 4ME5A 1ZYRD 5EDWA 5FLXW 4EGQA 3VMMA 4CDDC 2PMZB 1JWSD 4AIMA 2XD4A 1N34H 2QILA 2V4QA 3TREA 1MD2D 1BXRA 2ZXOA 4MTNA 5IYBG 1IL2A 2DPJA 3SI8A 4ID6A 2F0FA 5BR8Q 4BBRH 3J81c 4DL7A 5GROA 3EIVA 2KENA 1ENAA 2JA5G 1JWUD 1NR2A 3KHRA 1IW7C 3PW5A 5ELOA 4GC7A 2WAQA 5L37A 2L55A 3A7AB 1B53A 3V4SA 5JJLA 3SEBA 4C1NI 3AMUA 1I7NA 1BVSA 3HOVB 4J0MA 5CR3A 3H0GG 1A9XA 4GLAC 4LF7H 3R2TA 4JBKA 2N78A 1FVIA 5FO8B 5LMNQ 3HOZB 2CQYA 2HIVA 2SCUB 1TR5A 1SNOA 4DPGA 4GS3A 2R7FA 5DG9A 3MXNA 1EHIA 1SEBD 4C5BA 4OIJA 3HOVH 4DUZH 5J22A 4LW1A 1ZHQA 4DR6Q 3K5OA 2VA3A 1S5FD 5C8YF 4B9WA 1GXDC 4YQWA 4NXMH 2R8KA 2BQRA 3HOZH 4LFAH 4WJ4A 4ZHQF 4U68A 4K0KH 4RA8A 1VMCA 1I6UA 1XNRL 3HEJA 3J81E 1HJPA 1SE4A 4JYAL 1VQMA 2PMZA 4IZ8A 5KEEA 5C44G 4UPAA 4IFDJ 4MN3A 3CCRA 3G4SA 1CSPA 1FGBD 5KFWA 1S9FA 2E5LH 2OH2A 4K2KA 1K28A 2OT2A 2F0MA 5CBAE 3G71A 5EGTA 2Z8LA 3OUUA 1F9QA 4LF9L 2IHFA 5IWAL 4ULLA 1DJRD 3L3OC 5KFLA 4MAMA 1LM0A 1VQOA 3LWBA 1BQQT 3OIQA 2CW8A 4HMJA 2UU9L 1DM0B 4JI2H 2XC9A 3GV7B 2DY7A 2VOBA 4X64H 2F0EA 4A4IA 2C28A 4O3NA 3QG1A 3B6YA 5IP9G 3RFCA 3A0JA 4MNOA 3BAAA 5LYJF 4FVMA 1JJGA 3RBEA 4IALA 4EQOA 3SK5A 3KBXA 2NVXA 4E4TA 2IX3A 1SE8A 5A2QE 1E4EB 4KN7C 1HR0W 5EPJA 1L1OB 2W6PA 4RGNA 1QVFA 5FPOA 2C2EA 1SYEA 4NXNH 3BVMA 3NTIA 3BG5A 4XXEA 3UE0A 2UXCL 4MTDA 4JI3H 2J6UA 2KECA 3STBC 3BJYA 1Q7YC 2W71A 3ICEA 3CPFA 1T94A 1XNRQ 4LMQD
chains in the Genus database with same CATH topology
2NN6G 2D0OA 2UUCL 3FP9A 4KLKA 1YHQA 4JYAQ 4JOIC 2UUAL 4BBSH 3GTJH 4JBWA 1L2FA 1EOVA 1K3RA 1VQ7A 3I4MG 2WP8J 4QIWE 4R4CA 4EQ5A 4IO9A 4B3TL 3MXNB 2LXKA 1EWIA 1VQ8A 1BBWA 4DR3L 2D0PA 1YVCA 2DUDA 2Z6KC 5IY0A 2ATWA 2EQSA 4LF9Q 4LUOA 5IWAQ 1Y1VG 5FLMG 3G6EA 4JBMA 4YHHL 3RR5A 4BBRG 3TRZA 5IYDH 5JJKA 3JAMi 3CQZH 1PH8A 2WB1E 2VUMH 4OXPA 4BA2I 4X66L 3M3YH 3HKZG 2CKZB 2UU9Q 4IJHA 1HZBA 3FHWA 1VQ5A 2CWPA 2FXQA 1OXSC 3RLFA 3U58A 2PQAA 1X3EA 1PH6A 3M4QA 2JA7H 4DR2L 2ZTDA 2I5HA 3TS2A 5JJIA 1X55A 4IPDA 1KQSA 4DV0L 3E9HA 5IE8A 4DV4Q 4DV5L 4AQYL 1Q82C 4OWWB 1LYLA 1A62A 4O2DA 4DV7L 4NB3A 1S40A 5LMUQ 1L1OA 3PO2H 1JT8A 4QGUA 2NZOA 4DR4L 1YZ6A 1CKNB 1UE7A 4DV3Q 4JI6Q 4LFBL 3KDFB 4YWKA 3PIOA 4DR5L 2UXCQ 1G51A 3CXCA 5AJ3L 3HOVG 4C3IH 4JCVE 1IYJB 1YJNA 1DGSA 2PNHA 2H5XA 3RZDH 2UUCQ 1TWAH 4JI8L 3CCQA 4HIDA 2UUAQ 3ZJYC 3HOZG 1KIXA 4LF4L 5IP7H 1UEBA 4YCUA 4YY3L 5FLXc 2PI2E 2NVQH 2K52A 4YCVA 1OXVA 3RLNA 1XPUA 4EX5A 1WFQA 3NENA 2E8GA 4DR3Q 3KJPA 1GKHA 1TWCH 1QZGA 1PFSA 3U4ZA 4LNQA 4WJ3M 1BBUA 4IFDI 1YHBA 4NPSA 4A3CG 5C4XG 4YHHQ 3JAMc 4KI0A 1OXXK 1VQ6A 4RMFA 4HJ7A 3TEHB 1YJWA 4J15A 4X65L 1K73C 4A3KG 1N36L 5M3MH 4X66Q 2NVXH 4A3IG 2YTXA 3S16H 4OO1G 1X65A 3I4OA 1N34L 3JC66 1VQNA 2CQOA 5K36G 1WCMG 1OXUA 2R93H 1QVCA 3GTOH 2NVTH 4A75A 1KXLA 4DR2Q 1K0RA 2ZM6L 1VS0A 1Q81C 2HQLA 2R7ZG 1YHAA 4L5RC 2VY3A 4HIKA 1YITA 2E2IH 4DV0Q 4DV5Q 3CCJA 3H3VH 4B3SL 2IHEA 1VQDA 4DV7Q 2UUBL 4DR1L 3LGJA 4XIGS 4DR4Q 3PF5A 3DM3A 3Q8DA 1VQJA 3DLLA 4GOPC 1JE5A 2KCMA 1X3FA 4DNIA 3KFUA 4DR5Q 1CKNA 1HZAA 3K8AA 3KF6A 2JA6G 2K4KA 3KDFA 3ULPA 1UE6A 3NEMA 1QUQA 5AJ3Q 3FKIG 3M85A 2Z6KA 4LF7L 3D0FA 2PQAB 1GO3E 3NBHB 5ELNA 2AWOA 1FL0A 2AWNA 1T9HA 3HOXH 4JI8Q 1HNXL 1R9TH 2JEBI 4A3FH 4GN5A 4LF4Q 1GD7A 1HNZL 3BJUA 4YY3Q 1XPOA 1SROA 1Z47A 4DK6C 4A3MH 3OYYA 4YWMA 1EYGA 1WYDA 3CC4A 4UP9A 1RL2A 4LFCL 4YCWA 4DUZL 1JB7A 1JMCA 1PH3A 2OWOA 4HJ8A 1HR0L 2WAQG 3RN5A 3CPWA 3OW2A 4BBSG 1I5FA 1PYBA 3K81C 4JI0L 4AYBG 1VQLA 5HY6A 2ZJPA 3CC2A 2B63H 3G48A 3PV0A 3VDYA 3I7FA 4NXML 1N32L 4LFAL 4X65Q 3CF5A 3HFZB 1KRSA 3IRBA 1N36Q 4B3ML 2Q2HA 4K0KL 1UE1A 1PH2A 2F4VL 4KHPL 4A3EH 5GAGC 2WAQE 1S72A 3EN2A 2MO1A 1YI2A 4AYBE 1N34Q 5IYDG 3S2DH 4KHZA 1E22A 1JJ2A 4LUVA 2ZM6Q 2E5LL 4A3BH 4POGA 3GO5A 1Q1EA 4PMWA 4DAYB 1TXYA 4B3SQ 4JG2A 4DKAC 3W1BA 5GAEC 1UE5A 2JA7G 2UUBQ 4A3GH 2ZTEA 4DR1Q 1YIJA 3S1NH 2WFWA 3UE1A 4C2MH 4PZ6A 4A76A 1YJ9A 1QZHA 4JI2L 5E7NA 3PUYA 4DK3C 3J80i 2K5HA 2MO0A 4X64L 1I94L 5LMNW 4HJ5A 4LF7Q 5C0XI 5JEAG 3ULLA 2GVBA 2JK8A 1EIYB 1HNXQ 4ME3A 2AKWB 3PO3H 3WWVA 5M3FH 2UXBL 3H3VI 3I4NH 4R4QA 1HNZQ 2Q2IA 3HKZE 3TQYA 4GN4B 2R92H 2OTJA 4IPGA 4JI4L 1GVPA 4LFCQ 3PF4A 2PMZE 4GNXC 3GTMH 4NXNL 1HR0Q 1Q46A 1Y14B 5M5WH 1C7YA 3UDXA 4JI0Q 5IP7G 1VQGA 4BY1H 4X62L 4NXMQ 3KF6B 4JI3L 4DR7L 3PUVA 1N32Q 4LFAQ 2K5NA 1QUQB 4DV1L 4B3MQ 4K0KQ 4GLVB 2F4VQ 2V1CC 4KHPQ 3HOYH 2Y0SG 3F2CA 3U4VA 1K9MC 3K7AH 3F8TA 1Q1BA 3UDFA 2LXJA 3T1YQ 2F52A 1MKHA 3E9IA 3GTQH 3S14H 2KHIA 4IJLA 2UXDL 3PUWA 1Q86C 5H1SE 2N49A 5M3MG 3CCMA 2E5LQ 1OXTA 4B3TQ 1N9WA 1X3GA 3PSIA 5GADC 1Z9FA 2ALYB 3KF8B 4DV2L 1KD1C 2JA8G 3W1GA 1EQQA 2VQEL 1K8GA 2R93G 4YWLA 4TVAB 1OTCA 2VZAA 1VCIA 2QGQA 5C0XG 1SFOH 3HOUH 4BXXH 2RHSB 2QEXA 1SRUA 1MJCA 3BZKA 4JI1L 5IYBH 1X56A 1WI5A 4LF8L 4JI2Q 3J80c 1XJVA 2LSSA 5FJ8H 4X64Q 1I94Q 3GTKH 4A93H 2JA5H 4IPHA 2NVYH 1I50H 5IYCH 3OTOL 2ES2A 1NE3A 1A63A 1G291 4A3LG 4HIOA 1FJGL 3D31A 4IPCA 1PH7A 2JE6I 1E3PA 2VL6A 3AFPA 2ZJRA 2VQFL 2UXBQ 2C35B 3ERSX 1NMFA 5DLQE 4OWTB 1D7QA 4A3JH 1C0AA 4UP7A 1U5KA 4JI4Q 4AQYQ 3H0GH 1U0LA 4P72A 4R4OA 3HOXG 3BZCA 2ASBA 3PIPA 1BKBA 4NXNQ 1P16A 5M5YH 4A3FG 3S1QH 2K5VA 4JOIA 1J6QA 4OWXB 1SLJA 4A3MG 4HIMA 4XTCS 2L15A 4X62Q 1E1OA 1KAWA 1UWVA 1ASZA 1W3SA 4JI3Q 4LUZA 1NBWA 5GQOA 4DR7Q 1O7IA 4DV1Q 3I56A 3A5ZB 3HOWH 1CKMA 1L1OC 3KJOA 3GDEA 1VQHA 4R1JA 1KRTA 5HGQA 4IOCA 3M4PA 4L5TA 2MQHA 2B63G 4LF5L 2K14A 4A3CH 3AFQA 3CCLA 2UXDQ 4IFDG 1D8LA 3KYHC 1EIFA 5C3EH 4R4TA 4A3EG 2NN6I 2YYZA 1VQBA 2XGTA 1IBLL 1EUJA 2N3SA 4DV2Q 1W2BA 3CMAA 2VQEQ 3U50C 3I55A 1PVOA 4OX9L 1KHIA 3L0OA 1GM5A 1CSQA 4A3DH 4R4IA 1TWFH 2GN5A 5C44H 4A3BG 4JV5L 3W5OA 1HH2P 3PUZA 2I5MX 4JI1Q 3NELA 1C9OA 1E7ZA 3T1HL 3J7ZC 2B29A 3M7NA 2PI2A 4LF8Q 1VQKA 4L5QA 4JI5L 4P73A 2NZHA 5IT9c 2MNAA 2F3IA 1B8AA 1VQFA 2HIXA 1AH9A 4QL5A 4O0AA 3OTOQ 3KOJA 3A74A 2VS1A 3CP0A 3S15H 1I6HH 1VQPA 1L0WA 1KL9A 1FJGQ 3RZOH 2VUMG 5BR8L 1X6OA 1VQEA 3F2DA 5C4JH 4TQUS 2VQFQ 2IX0A 4DV6L 4HJAA 4BY7H 3M9BA 2JA9A 3J81i 3S2HH 1CUKA 4OONA 1RIPA 4Y7NH 3TS0A 3CCSA 4JC0A 3PO3G 5M3FG 5IP9H 2IT1A 2QA4A 4JI6L 1HZ9A 4X6AH 1X54A 1NJIC 2Q2UA 2R92G 1XMOL 3S17H 1P8LA 4POFA 4DAMA 1WJJA 3CCEA 1QVGA 1PH1A 1PH4A 1N33L 5JEAJ 3RNUA 1XMQL 3PO2G 1PHJA 3K7UC 2IY5B 2A19A 2RF4A 5LMNL 2HHHL 3PGZA 1NY4A 4BY1G 1S3OA 2ZTCA 4C3HH 4LF5Q 1VQIA 1V9PA 1Y1WH 3SGIA 1PH5A 2WB1G 2DGYA 1K83H 3HOYG 2CFMA 2OQ0A 1SR3A 2RCNA 4BA1I 1PV4A 1V43A 1IBLQ 1V1QA 4DUZQ 4DR6L 2MFIA 3PUXA 2KCTA 3K0XA 1B70B 1CKOA 3L2PA 4LWCA 5EAYA 3I2ZA 4OX9Q 1IBML 2GVAA 2YTVA 2XTIA 2YTYA 4JV5Q 3I4MH 3T1HQ 3L7ZC 1YNXA 2CCZA 1E1TA 2ID0A 2Z0SA 3CW2C 4P71A 4JI5Q 3J81j 3RLOA 2OQKA 4AIMA 2VNUD 4H02A 4BXXG 1PYSB 3HOUG 3TREA 2JEAI 1Y1VH 5FLMH 1JJCB 4MTNA 5IYBG 2I0QA 3ULJA 1IL2A 1NMGA 2YU9H 4PG3A 5BR8Q 4BBRH 4OO1I 1Q8KA 4GOPA 1SN8A 3J81c 4HJ9A 5FJ8G 5GROA 3EIVA 4DV6Q 2KENA 1IBKL 2N8NA 2Y0SE 3CAMA 2JA5G 4A93G 1TWHH 5IYCG 2KBNA 5ELOA 3CCVA 1KC8C 4IOAA 5C0XJ 2Q2TA 4RG1A 1AE2A 3F1ZA 1PH9A 3S1RH 5JJLA 4MZ9A 2KHJA 4P74A 1LUZA 1IXRA 2JQOA 4A3JG 1BVSA 4LF6L 3CC7A 3STBD 1VQAA 2OTLA 3H0GG 3CCUA 1XMOQ 4GLAC 2HT1A 1HNWQ 4GNXB 1N33Q 2BA0A 4JBKA 1Q12A 3PCOB 4JI7L 3KLWA 2N78A 1XMQQ 3UDIA 1FVIA 4QJFA 1B7YB 5LMNQ 2HHHQ 2HIVA 1HZCA 4DPGA 4B3RL 4GKJL 1MJEA 4GS3A 2R7FA 4LFBQ 4QQBX 4Y52H 1J5EL 4P75A 3HOWG 1LTLA 3MEFA 3HOVH 2D62A 1PA6A 1XNQL 2BH2A 1G6PA 4LW1A 1VQCA 4DR6Q 3E0EA 2JJQA 1MIUA 4GN3B 1HNWL 3GD7A 4DUYL 2K75A 5C3EG 1IBMQ 1VQ9A 3HOZH 3HKSA 3CMEA 2CWAA 4WJ4A 2R7DA 3GTLH 1XPRA 3GTPH 2RHQB 4PZ7A 1XNRL 2JA8H 4GKKL 1HJPA 1AE3A 4JYAL 5J3BA 4AH6A 3H15A 1VQMA 4A3DG 2E2HH 4FDBA 5C44G 4UPAA 4IFDJ 1IZ6A 3CCRA 1A8VA 3G4SA 1CSPA 5C4XH 2VW9A 3F2BA 2I5LX 2AMCB 3J7A5 2OCEA 2ZJQA 1ASYA 3G71A 4A3KH 4QY7A 4A3IH 1IBKQ 1FGUA 4L5SA 1EQRA 4LF9L 2IHFA 5IWAL 2AHOB 3A5UA 3AEVA 1X9NA 1WCMH 2EXDA 1NTGA 4A3LH 1YBYA 1TWGH 2A8VA 1LM0A 1VQOA 2R7ZH 4BY7G 1SMXA 3GTGH 2UU9L 4LF6Q 2B3GA 2BA1A 3BU2A 2BH8A 4A4IA 4ALPA 3UDGA 1VQ4A 3B6YA 5IP9G 3AYHB 4A3GG 3A0JA 4JI7Q 4GNXA 2K50A 4JBJA 3AQQA 1WOCA 4MNOA 5M5XH 1JJGA 2A1AA 3RN2A 1XTDA 1YEZA 1N8RC 5GAHC 4GOPB 4B3RQ 4GKJQ 2EIFA 1SE8A 3K80C 2JA6H 1E24A 4C3JH 2R6GA 4DV4L 4UP8A 1J5EQ 1HR0W 2IX1A 1L1OB 1M1KC 3S24A 1M90C 1H95A 3FKIH 1QVFA 5LMUL 1XNQQ 1A0IA 2YV5A 3EBEA 1I3QH 1Y1WG 3ER0A 3UE0A 4DV3L 4DUYQ 2E2JH 3I4NG 2UXCL 4PZ8A 4APVA 3STBC 1Q7YC 3M4OH 1EFWA 3ICEA 3S1MH 3CPFA 4UY8C 1K8AC 1XNRQ 3CD6A 4GLXA 4GKKQ 3T1YL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 G;  2D0O A;  2UUC L;  3FP9 A;  4KLK A;  1YHQ A;  4JYA Q;  4JOI C;  2UUA L;  4BBS H;  3GTJ H;  4JBW A;  1L2F A;  1EOV A;  1K3R A;  1VQ7 A;  3I4M G;  2WP8 J;  4QIW E;  4R4C A;  4EQ5 A;  4IO9 A;  4B3T L;  3MXN B;  2LXK A;  1EWI A;  1VQ8 A;  1BBW A;  4DR3 L;  2D0P A;  1YVC A;  2DUD A;  2Z6K C;  5IY0 A;  2ATW A;  2EQS A;  4LF9 Q;  4LUO A;  5IWA Q;  1Y1V G;  5FLM G;  3G6E A;  4JBM A;  4YHH L;  3RR5 A;  4BBR G;  3TRZ A;  5IYD H;  5JJK A;  3JAM i;  3CQZ H;  1PH8 A;  2WB1 E;  2VUM H;  4OXP A;  4BA2 I;  4X66 L;  3M3Y H;  3HKZ G;  2CKZ B;  2UU9 Q;  4IJH A;  1HZB A;  3FHW A;  1VQ5 A;  2CWP A;  2FXQ A;  1OXS C;  3RLF A;  3U58 A;  2PQA A;  1X3E A;  1PH6 A;  3M4Q A;  2JA7 H;  4DR2 L;  2ZTD A;  2I5H A;  3TS2 A;  5JJI A;  1X55 A;  4IPD A;  1KQS A;  4DV0 L;  3E9H A;  5IE8 A;  4DV4 Q;  4DV5 L;  4AQY L;  1Q82 C;  4OWW B;  1LYL A;  1A62 A;  4O2D A;  4DV7 L;  4NB3 A;  1S40 A;  5LMU Q;  1L1O A;  3PO2 H;  1JT8 A;  4QGU A;  2NZO A;  4DR4 L;  1YZ6 A;  1CKN B;  1UE7 A;  4DV3 Q;  4JI6 Q;  4LFB L;  3KDF B;  4YWK A;  3PIO A;  4DR5 L;  2UXC Q;  1G51 A;  3CXC A;  5AJ3 L;  3HOV G;  4C3I H;  4JCV E;  1IYJ B;  1YJN A;  1DGS A;  2PNH A;  2H5X A;  3RZD H;  2UUC Q;  1TWA H;  4JI8 L;  3CCQ A;  4HID A;  2UUA Q;  3ZJY C;  3HOZ G;  1KIX A;  4LF4 L;  5IP7 H;  1UEB A;  4YCU A;  4YY3 L;  5FLX c;  2PI2 E;  2NVQ H;  2K52 A;  4YCV A;  1OXV A;  3RLN A;  1XPU A;  4EX5 A;  1WFQ A;  3NEN A;  2E8G A;  4DR3 Q;  3KJP A;  1GKH A;  1TWC H;  1QZG A;  1PFS A;  3U4Z A;  4LNQ A;  4WJ3 M;  1BBU A;  4IFD I;  1YHB A;  4NPS A;  4A3C G;  5C4X G;  4YHH Q;  3JAM c;  4KI0 A;  1OXX K;  1VQ6 A;  4RMF A;  4HJ7 A;  3TEH B;  1YJW A;  4J15 A;  4X65 L;  1K73 C;  4A3K G;  1N36 L;  5M3M H;  4X66 Q;  2NVX H;  4A3I G;  2YTX A;  3S16 H;  4OO1 G;  1X65 A;  3I4O A;  1N34 L;  3JC6 6;  1VQN A;  2CQO A;  5K36 G;  1WCM G;  1OXU A;  2R93 H;  1QVC A;  3GTO H;  2NVT H;  4A75 A;  1KXL A;  4DR2 Q;  1K0R A;  2ZM6 L;  1VS0 A;  1Q81 C;  2HQL A;  2R7Z G;  1YHA A;  4L5R C;  2VY3 A;  4HIK A;  1YIT A;  2E2I H;  4DV0 Q;  4DV5 Q;  3CCJ A;  3H3V H;  4B3S L;  2IHE A;  1VQD A;  4DV7 Q;  2UUB L;  4DR1 L;  3LGJ A;  4XIG S;  4DR4 Q;  3PF5 A;  3DM3 A;  3Q8D A;  1VQJ A;  3DLL A;  4GOP C;  1JE5 A;  2KCM A;  1X3F A;  4DNI A;  3KFU A;  4DR5 Q;  1CKN A;  1HZA A;  3K8A A;  3KF6 A;  2JA6 G;  2K4K A;  3KDF A;  3ULP A;  1UE6 A;  3NEM A;  1QUQ A;  5AJ3 Q;  3FKI G;  3M85 A;  2Z6K A;  4LF7 L;  3D0F A;  2PQA B;  1GO3 E;  3NBH B;  5ELN A;  2AWO A;  1FL0 A;  2AWN A;  1T9H A;  3HOX H;  4JI8 Q;  1HNX L;  1R9T H;  2JEB I;  4A3F H;  4GN5 A;  4LF4 Q;  1GD7 A;  1HNZ L;  3BJU A;  4YY3 Q;  1XPO A;  1SRO A;  1Z47 A;  4DK6 C;  4A3M H;  3OYY A;  4YWM A;  1EYG A;  1WYD A;  3CC4 A;  4UP9 A;  1RL2 A;  4LFC L;  4YCW A;  4DUZ L;  1JB7 A;  1JMC A;  1PH3 A;  2OWO A;  4HJ8 A;  1HR0 L;  2WAQ G;  3RN5 A;  3CPW A;  3OW2 A;  4BBS G;  1I5F A;  1PYB A;  3K81 C;  4JI0 L;  4AYB G;  1VQL A;  5HY6 A;  2ZJP A;  3CC2 A;  2B63 H;  3G48 A;  3PV0 A;  3VDY A;  3I7F A;  4NXM L;  1N32 L;  4LFA L;  4X65 Q;  3CF5 A;  3HFZ B;  1KRS A;  3IRB A;  1N36 Q;  4B3M L;  2Q2H A;  4K0K L;  1UE1 A;  1PH2 A;  2F4V L;  4KHP L;  4A3E H;  5GAG C;  2WAQ E;  1S72 A;  3EN2 A;  2MO1 A;  1YI2 A;  4AYB E;  1N34 Q;  5IYD G;  3S2D H;  4KHZ A;  1E22 A;  1JJ2 A;  4LUV A;  2ZM6 Q;  2E5L L;  4A3B H;  4POG A;  3GO5 A;  1Q1E A;  4PMW A;  4DAY B;  1TXY A;  4B3S Q;  4JG2 A;  4DKA C;  3W1B A;  5GAE C;  1UE5 A;  2JA7 G;  2UUB Q;  4A3G H;  2ZTE A;  4DR1 Q;  1YIJ A;  3S1N H;  2WFW A;  3UE1 A;  4C2M H;  4PZ6 A;  4A76 A;  1YJ9 A;  1QZH A;  4JI2 L;  5E7N A;  3PUY A;  4DK3 C;  3J80 i;  2K5H A;  2MO0 A;  4X64 L;  1I94 L;  5LMN W;  4HJ5 A;  4LF7 Q;  5C0X I;  5JEA G;  3ULL A;  2GVB A;  2JK8 A;  1EIY B;  1HNX Q;  4ME3 A;  2AKW B;  3PO3 H;  3WWV A;  5M3F H;  2UXB L;  3H3V I;  3I4N H;  4R4Q A;  1HNZ Q;  2Q2I A;  3HKZ E;  3TQY A;  4GN4 B;  2R92 H;  2OTJ A;  4IPG A;  4JI4 L;  1GVP A;  4LFC Q;  3PF4 A;  2PMZ E;  4GNX C;  3GTM H;  4NXN L;  1HR0 Q;  1Q46 A;  1Y14 B;  5M5W H;  1C7Y A;  3UDX A;  4JI0 Q;  5IP7 G;  1VQG A;  4BY1 H;  4X62 L;  4NXM Q;  3KF6 B;  4JI3 L;  4DR7 L;  3PUV A;  1N32 Q;  4LFA Q;  2K5N A;  1QUQ B;  4DV1 L;  4B3M Q;  4K0K Q;  4GLV B;  2F4V Q;  2V1C C;  4KHP Q;  3HOY H;  2Y0S G;  3F2C A;  3U4V A;  1K9M C;  3K7A H;  3F8T A;  1Q1B A;  3UDF A;  2LXJ A;  3T1Y Q;  2F52 A;  1MKH A;  3E9I A;  3GTQ H;  3S14 H;  2KHI A;  4IJL A;  2UXD L;  3PUW A;  1Q86 C;  5H1S E;  2N49 A;  5M3M G;  3CCM A;  2E5L Q;  1OXT A;  4B3T Q;  1N9W A;  1X3G A;  3PSI A;  5GAD C;  1Z9F A;  2ALY B;  3KF8 B;  4DV2 L;  1KD1 C;  2JA8 G;  3W1G A;  1EQQ A;  2VQE L;  1K8G A;  2R93 G;  4YWL A;  4TVA B;  1OTC A;  2VZA A;  1VCI A;  2QGQ A;  5C0X G;  1SFO H;  3HOU H;  4BXX H;  2RHS B;  2QEX A;  1SRU A;  1MJC A;  3BZK A;  4JI1 L;  5IYB H;  1X56 A;  1WI5 A;  4LF8 L;  4JI2 Q;  3J80 c;  1XJV A;  2LSS A;  5FJ8 H;  4X64 Q;  1I94 Q;  3GTK H;  4A93 H;  2JA5 H;  4IPH A;  2NVY H;  1I50 H;  5IYC H;  3OTO L;  2ES2 A;  1NE3 A;  1A63 A;  1G29 1;  4A3L G;  4HIO A;  1FJG L;  3D31 A;  4IPC A;  1PH7 A;  2JE6 I;  1E3P A;  2VL6 A;  3AFP A;  2ZJR A;  2VQF L;  2UXB Q;  2C35 B;  3ERS X;  1NMF A;  5DLQ E;  4OWT B;  1D7Q A;  4A3J H;  1C0A A;  4UP7 A;  1U5K A;  4JI4 Q;  4AQY Q;  3H0G H;  1U0L A;  4P72 A;  4R4O A;  3HOX G;  3BZC A;  2ASB A;  3PIP A;  1BKB A;  4NXN Q;  1P16 A;  5M5Y H;  4A3F G;  3S1Q H;  2K5V A;  4JOI A;  1J6Q A;  4OWX B;  1SLJ A;  4A3M G;  4HIM A;  4XTC S;  2L15 A;  4X62 Q;  1E1O A;  1KAW A;  1UWV A;  1ASZ A;  1W3S A;  4JI3 Q;  4LUZ A;  1NBW A;  5GQO A;  4DR7 Q;  1O7I A;  4DV1 Q;  3I56 A;  3A5Z B;  3HOW H;  1CKM A;  1L1O C;  3KJO A;  3GDE A;  1VQH A;  4R1J A;  1KRT A;  5HGQ A;  4IOC A;  3M4P A;  4L5T A;  2MQH A;  2B63 G;  4LF5 L;  2K14 A;  4A3C H;  3AFQ A;  3CCL A;  2UXD Q;  4IFD G;  1D8L A;  3KYH C;  1EIF A;  5C3E H;  4R4T A;  4A3E G;  2NN6 I;  2YYZ A;  1VQB A;  2XGT A;  1IBL L;  1EUJ A;  2N3S A;  4DV2 Q;  1W2B A;  3CMA A;  2VQE Q;  3U50 C;  3I55 A;  1PVO A;  4OX9 L;  1KHI A;  3L0O A;  1GM5 A;  1CSQ A;  4A3D H;  4R4I A;  1TWF H;  2GN5 A;  5C44 H;  4A3B G;  4JV5 L;  3W5O A;  1HH2 P;  3PUZ A;  2I5M X;  4JI1 Q;  3NEL A;  1C9O A;  1E7Z A;  3T1H L;  3J7Z C;  2B29 A;  3M7N A;  2PI2 A;  4LF8 Q;  1VQK A;  4L5Q A;  4JI5 L;  4P73 A;  2NZH A;  5IT9 c;  2MNA A;  2F3I A;  1B8A A;  1VQF A;  2HIX A;  1AH9 A;  4QL5 A;  4O0A A;  3OTO Q;  3KOJ A;  3A74 A;  2VS1 A;  3CP0 A;  3S15 H;  1I6H H;  1VQP A;  1L0W A;  1KL9 A;  1FJG Q;  3RZO H;  2VUM G;  5BR8 L;  1X6O A;  1VQE A;  3F2D A;  5C4J H;  4TQU S;  2VQF Q;  2IX0 A;  4DV6 L;  4HJA A;  4BY7 H;  3M9B A;  2JA9 A;  3J81 i;  3S2H H;  1CUK A;  4OON A;  1RIP A;  4Y7N H;  3TS0 A;  3CCS A;  4JC0 A;  3PO3 G;  5M3F G;  5IP9 H;  2IT1 A;  2QA4 A;  4JI6 L;  1HZ9 A;  4X6A H;  1X54 A;  1NJI C;  2Q2U A;  2R92 G;  1XMO L;  3S17 H;  1P8L A;  4POF A;  4DAM A;  1WJJ A;  3CCE A;  1QVG A;  1PH1 A;  1PH4 A;  1N33 L;  5JEA J;  3RNU A;  1XMQ L;  3PO2 G;  1PHJ A;  3K7U C;  2IY5 B;  2A19 A;  2RF4 A;  5LMN L;  2HHH L;  3PGZ A;  1NY4 A;  4BY1 G;  1S3O A;  2ZTC A;  4C3H H;  4LF5 Q;  1VQI A;  1V9P A;  1Y1W H;  3SGI A;  1PH5 A;  2WB1 G;  2DGY A;  1K83 H;  3HOY G;  2CFM A;  2OQ0 A;  1SR3 A;  2RCN A;  4BA1 I;  1PV4 A;  1V43 A;  1IBL Q;  1V1Q A;  4DUZ Q;  4DR6 L;  2MFI A;  3PUX A;  2KCT A;  3K0X A;  1B70 B;  1CKO A;  3L2P A;  4LWC A;  5EAY A;  3I2Z A;  4OX9 Q;  1IBM L;  2GVA A;  2YTV A;  2XTI A;  2YTY A;  4JV5 Q;  3I4M H;  3T1H Q;  3L7Z C;  1YNX A;  2CCZ A;  1E1T A;  2ID0 A;  2Z0S A;  3CW2 C;  4P71 A;  4JI5 Q;  3J81 j;  3RLO A;  2OQK A;  4AIM A;  2VNU D;  4H02 A;  4BXX G;  1PYS B;  3HOU G;  3TRE A;  2JEA I;  1Y1V H;  5FLM H;  1JJC B;  4MTN A;  5IYB G;  2I0Q A;  3ULJ A;  1IL2 A;  1NMG A;  2YU9 H;  4PG3 A;  5BR8 Q;  4BBR H;  4OO1 I;  1Q8K A;  4GOP A;  1SN8 A;  3J81 c;  4HJ9 A;  5FJ8 G;  5GRO A;  3EIV A;  4DV6 Q;  2KEN A;  1IBK L;  2N8N A;  2Y0S E;  3CAM A;  2JA5 G;  4A93 G;  1TWH H;  5IYC G;  2KBN A;  5ELO A;  3CCV A;  1KC8 C;  4IOA A;  5C0X J;  2Q2T A;  4RG1 A;  1AE2 A;  3F1Z A;  1PH9 A;  3S1R H;  5JJL A;  4MZ9 A;  2KHJ A;  4P74 A;  1LUZ A;  1IXR A;  2JQO A;  4A3J G;  1BVS A;  4LF6 L;  3CC7 A;  3STB D;  1VQA A;  2OTL A;  3H0G G;  3CCU A;  1XMO Q;  4GLA C;  2HT1 A;  1HNW Q;  4GNX B;  1N33 Q;  2BA0 A;  4JBK A;  1Q12 A;  3PCO B;  4JI7 L;  3KLW A;  2N78 A;  1XMQ Q;  3UDI A;  1FVI A;  4QJF A;  1B7Y B;  5LMN Q;  2HHH Q;  2HIV A;  1HZC A;  4DPG A;  4B3R L;  4GKJ L;  1MJE A;  4GS3 A;  2R7F A;  4LFB Q;  4QQB X;  4Y52 H;  1J5E L;  4P75 A;  3HOW G;  1LTL A;  3MEF A;  3HOV H;  2D62 A;  1PA6 A;  1XNQ L;  2BH2 A;  1G6P A;  4LW1 A;  1VQC A;  4DR6 Q;  3E0E A;  2JJQ A;  1MIU A;  4GN3 B;  1HNW L;  3GD7 A;  4DUY L;  2K75 A;  5C3E G;  1IBM Q;  1VQ9 A;  3HOZ H;  3HKS A;  3CME A;  2CWA A;  4WJ4 A;  2R7D A;  3GTL H;  1XPR A;  3GTP H;  2RHQ B;  4PZ7 A;  1XNR L;  2JA8 H;  4GKK L;  1HJP A;  1AE3 A;  4JYA L;  5J3B A;  4AH6 A;  3H15 A;  1VQM A;  4A3D G;  2E2H H;  4FDB A;  5C44 G;  4UPA A;  4IFD J;  1IZ6 A;  3CCR A;  1A8V A;  3G4S A;  1CSP A;  5C4X H;  2VW9 A;  3F2B A;  2I5L X;  2AMC B;  3J7A 5;  2OCE A;  2ZJQ A;  1ASY A;  3G71 A;  4A3K H;  4QY7 A;  4A3I H;  1IBK Q;  1FGU A;  4L5S A;  1EQR A;  4LF9 L;  2IHF A;  5IWA L;  2AHO B;  3A5U A;  3AEV A;  1X9N A;  1WCM H;  2EXD A;  1NTG A;  4A3L H;  1YBY A;  1TWG H;  2A8V A;  1LM0 A;  1VQO A;  2R7Z H;  4BY7 G;  1SMX A;  3GTG H;  2UU9 L;  4LF6 Q;  2B3G A;  2BA1 A;  3BU2 A;  2BH8 A;  4A4I A;  4ALP A;  3UDG A;  1VQ4 A;  3B6Y A;  5IP9 G;  3AYH B;  4A3G G;  3A0J A;  4JI7 Q;  4GNX A;  2K50 A;  4JBJ A;  3AQQ A;  1WOC A;  4MNO A;  5M5X H;  1JJG A;  2A1A A;  3RN2 A;  1XTD A;  1YEZ A;  1N8R C;  5GAH C;  4GOP B;  4B3R Q;  4GKJ Q;  2EIF A;  1SE8 A;  3K80 C;  2JA6 H;  1E24 A;  4C3J H;  2R6G A;  4DV4 L;  4UP8 A;  1J5E Q;  1HR0 W;  2IX1 A;  1L1O B;  1M1K C;  3S24 A;  1M90 C;  1H95 A;  3FKI H;  1QVF A;  5LMU L;  1XNQ Q;  1A0I A;  2YV5 A;  3EBE A;  1I3Q H;  1Y1W G;  3ER0 A;  3UE0 A;  4DV3 L;  4DUY Q;  2E2J H;  3I4N G;  2UXC L;  4PZ8 A;  4APV A;  3STB C;  1Q7Y C;  3M4O H;  1EFW A;  3ICE A;  3S1M H;  3CPF A;  4UY8 C;  1K8A C;  1XNR Q;  3CD6 A;  4GLX A;  4GKK Q;  3T1Y L; 
#chains in the Genus database with same CATH topology
 2I87 A;  2D0O A;  3R93 A;  4IR1 A;  4KLK A;  4JYA Q;  3ERQ A;  3PW0 A;  1PX2 A;  3GQB A;  3M4Y A;  4IO9 A;  1B04 A;  1EZ1 A;  3TP6 A;  2FMM A;  2LXK A;  1M7J A;  1FD7 D;  5L1L A;  4DR3 L;  3T5K A;  2ATW A;  3LP8 A;  4DV2 H;  2H4O A;  4LF9 Q;  2UVV A;  2PZT A;  4LUO A;  5IWA Q;  4I50 F;  4FO2 A;  4MV7 A;  1EY9 A;  4BBR G;  1G91 A;  2JYO A;  3RB6 A;  1PH8 A;  2WB1 E;  4OXP A;  3M3Y H;  2UU9 Q;  4IJH A;  3FHW A;  2NUC A;  1VQ5 A;  2CWP A;  3SK8 A;  4R7R A;  1N48 A;  5D1O B;  3RLF A;  2WKD A;  5EJW A;  3H91 A;  4DR2 L;  2ZTD A;  1FJG H;  5KFD A;  1U9R A;  1FYC A;  4O3P A;  5KNB A;  1M4V A;  2HDM A;  3FDT A;  2VQF H;  5JJI A;  1CM9 A;  3HG9 A;  4DV0 L;  4ZKB B;  1E4E A;  3J80 W;  4NB3 A;  5A2Q L;  1L1O A;  4L8J A;  1GSO A;  4DR4 L;  4G7H C;  1YZ6 A;  2A6E C;  3AB9 A;  3IFD A;  5CV5 A;  3BQ1 A;  4UHV A;  4JI6 Q;  3K3P A;  1DOK A;  2UXC Q;  4DR5 L;  1GGO A;  4RB0 A;  5I2X A;  5EBD A;  3HOV G;  3TIN A;  1PTO C;  1YJN A;  2Y0S B;  2FPP B;  1DGS A;  2H5X A;  1EYD A;  1G8Z D;  1QIL A;  1Z7T A;  1T3N A;  3HOZ G;  1O7Z A;  1KIX A;  5IP7 H;  1GLV A;  4IUQ A;  4YY3 L;  4KD3 A;  5FLX c;  3GTL B;  2IL8 A;  4CGY B;  2K52 A;  1DCZ A;  2FP4 B;  1Y8N B;  4YCV A;  5KFS A;  1QG7 A;  1HTP A;  5CV7 A;  4DR3 Q;  1IBL H;  4K8J A;  3KJP A;  1EY8 A;  1TWC H;  1I7L A;  4F7X A;  3GTO B;  4LNQ A;  3QOL A;  4OX9 H;  1YHB A;  1CFM A;  3NPP A;  4KKU A;  4OEM B;  4JV5 H;  3E3X A;  2R7M A;  4X65 L;  1DXM A;  3S16 H;  4GZY C;  2F0G A;  3BVZ A;  4JI5 H;  3I4O A;  1N34 L;  1K8O A;  1JXL A;  2CQO A;  3R5X A;  4ZOL F;  3GTO H;  3Q8Q B;  4J9Q A;  4DR2 Q;  1K0R A;  1Q81 C;  3OOC A;  3V2T A;  5DGA A;  2VR1 A;  4RGO S;  1MI2 A;  4WOR A;  4DV0 Q;  3A56 A;  3CCJ A;  4PDB A;  3DWP A;  1BOS A;  4ZK9 B;  2IHE A;  2WII B;  3OSN A;  5L1I A;  4QCL A;  4DR1 L;  5IT9 W;  4DV3 H;  4DR4 Q;  3PF5 A;  1VQJ A;  1JE5 A;  4DR5 Q;  4HNU A;  4RWS C;  4C3J B;  1QUQ A;  5FLX E;  5LL6 S;  1N33 H;  2PZW A;  1TWC A;  4LF7 L;  3PW2 A;  1IYV A;  1GO3 E;  2Y0S A;  5J39 A;  2HHH H;  2B8F A;  2JEB I;  2QYZ A;  1ET6 A;  1GD7 A;  2KHS A;  2O4X A;  1HNZ L;  4YY3 Q;  5KFZ A;  4O3S A;  4DGZ A;  3OYY A;  3CC4 A;  4UAI A;  4J9L A;  2K28 A;  4YCW A;  4DUZ L;  3GV8 B;  3RN5 A;  1ROD A;  4NKL A;  3D4R A;  1C8C A;  1IBM H;  3CC2 A;  1IOW A;  3PV0 A;  4N8F A;  4NXM L;  3GQC A;  4LFA L;  4X65 Q;  2ZDH A;  4PWQ A;  2E76 C;  3LWE A;  5KFM A;  1LAB A;  2R85 A;  4K0K L;  5C5J A;  1ENC A;  1LLR D;  3S1N B;  2F0P A;  3M7N A;  1N34 Q;  2XWB B;  1TS4 A;  2SNM A;  4RAU C;  2VPQ A;  4KHZ A;  1E22 A;  2VUM B;  4X3K A;  1PXU A;  2E5L L;  4POG A;  3Q24 A;  3AU7 A;  4PMW A;  2YRX A;  5F9N A;  2FK3 A;  2YZN A;  3SDZ A;  4B9X A;  3PO3 B;  4K5V A;  5GAE C;  5M3F B;  2VPS A;  1LO5 D;  4DR1 Q;  1YIJ A;  3S1N H;  2A6H C;  4MV3 A;  3KAK A;  4U67 3;  4KV6 A;  2HVQ A;  1NNX A;  2EE1 A;  4CDE C;  4HR7 B;  1TA8 A;  4JI2 L;  5E7N A;  4DK3 C;  4X64 L;  4KHV A;  2KQ3 A;  2A73 B;  5LMN W;  4LF7 Q;  3GID A;  4JI7 H;  1EU3 A;  3KBG A;  3JRX A;  2YRW A;  3PO3 H;  2AUJ D;  5M3F H;  2FLN A;  2A68 D;  4CJ2 C;  3WO0 A;  2L9H A;  1HNZ Q;  4GN4 B;  2VB3 X;  1HUN A;  1PTO F;  1B4O A;  3NP8 A;  3GIL A;  4IPG A;  2R8J A;  3K7A B;  1LTG D;  3MFI A;  4NXN L;  1C7Y A;  5TSS A;  2ATL A;  5IP7 G;  4RB1 A;  2NVQ B;  2B39 A;  4NXM Q;  5DEH A;  4JI3 L;  2JSO A;  4LFA Q;  3OSO A;  3F8N A;  1Z2O X;  3Q22 A;  4K0K Q;  4GLV B;  2V1C C;  2Y0S G;  4GKK H;  1SFO B;  4ECZ A;  1RCV D;  3G6Y A;  3K7A H;  4K6D A;  2KVM A;  1I4P A;  2LXJ A;  4XYO A;  4IJL A;  2UXD L;  2RQX A;  1Q86 C;  2R8I A;  3CCM A;  2E5L Q;  5KG5 A;  2PW5 A;  3NBI A;  4B3T Q;  1HXY D;  4V0B A;  1X3G A;  5DLF A;  1BBX C;  1KD1 C;  1I50 B;  4DV2 L;  2XCL A;  2UXB H;  4YWL A;  4TVA B;  2VZA A;  4XQJ A;  1VCI A;  1SFO H;  4EEQ A;  1SRU A;  4CDC C;  4JUZ A;  1X56 A;  4WBN F;  1QOH A;  4JI2 Q;  3J80 c;  2MGS A;  1KNA A;  4X64 Q;  5JVL A;  1I50 H;  1WR2 A;  2HDL A;  1FJG L;  3IKJ A;  5COY A;  2M00 A;  1KJJ A;  1AN8 A;  1E3P A;  2ZJR A;  2VQF L;  2F0W A;  3R23 A;  3OHB A;  1NMF A;  5DLQ E;  5F2D A;  5IGB A;  1NUC A;  2AUK A;  2R82 A;  5D8D A;  1SCU B;  1FNU A;  4P72 A;  5LMU H;  3E0J A;  3IFT A;  4NXN Q;  1P16 A;  4G7Z C;  2GLT A;  3T5L A;  1CT1 D;  5C3E B;  1J6Q A;  1ZET A;  1J9O A;  4KY6 A;  2K03 A;  2V59 A;  1AFP A;  4KMU C;  4JI3 Q;  3NWS A;  1KEE A;  4C3J G;  4F4W A;  1S0N A;  5DGB A;  1L1O C;  4R1J A;  1QNU A;  5HGQ A;  4A3D B;  4QW8 A;  1TWF B;  4L5T A;  4N9T A;  2UUA H;  3DXJ C;  1SFO A;  2UXD Q;  5KFN A;  1EUD B;  4J9N A;  1D8L A;  1EIF A;  5C3E H;  2R3Z A;  1U4L A;  1AZQ A;  1G2S A;  2XGT A;  1IBL L;  2MCT A;  1EUJ A;  2SDF A;  4S3S A;  4DV2 Q;  4YJ2 F;  3J80 E;  3PW4 A;  3S15 B;  1CA6 A;  1R4P B;  4OX9 L;  1GM5 A;  2JEJ A;  1KLU D;  1CSQ A;  4A3D H;  1TWF H;  2B2V A;  2GN5 A;  4JV5 L;  4Q43 A;  3S2H B;  1HH2 P;  3PUZ A;  1E7Z A;  1EY4 A;  5KFY A;  3IN5 A;  2XCP A;  4ZUJ A;  4JI5 L;  5IT9 c;  2J4X A;  2DLN A;  4A3G B;  2RGV A;  4QL5 A;  4O0A A;  1EFI D;  3A74 A;  3TZU A;  3S15 H;  3BZD B;  1FJG Q;  5JPN C;  2VUM G;  3PR5 B;  2IMW P;  3RB0 A;  1VQE A;  2VQD A;  2FFK B;  4TQU S;  2IX0 A;  3WDN A;  2VQF Q;  4DV6 L;  3H40 A;  3S2H H;  3M9B A;  2JA9 A;  3BG3 A;  3SXH A;  1S4Z A;  4ECV A;  2F0D A;  4OON A;  1RIP A;  4DV7 H;  3MAQ A;  3PO3 G;  5M3F G;  2IT1 A;  2EVB A;  1X54 A;  1YNJ C;  2LS0 1;  4LFB H;  3TQ1 A;  2Q2U A;  3LNN A;  1IYU A;  4ED8 A;  1P8L A;  1WJJ A;  1QVG A;  2FLP A;  1N33 L;  3K6O A;  3J81 W;  1O7Y A;  1PHJ A;  3MR5 A;  1TU2 B;  2HHH L;  1BXT A;  1NY4 A;  1JC7 A;  1S3O A;  5COR A;  1TWG A;  2FE3 A;  3CVZ A;  3A8K E;  1TWF A;  5I47 A;  1STN A;  2R8H A;  4TV8 F;  2PQE A;  2DGY A;  1SNQ A;  1TS5 A;  5CV4 A;  4J9R A;  2IA6 A;  2CFM A;  1IBL Q;  1V1Q A;  2G9H D;  1T5E A;  3MR2 A;  3GTQ B;  4RHS A;  2KCT A;  3K0X A;  5IT9 E;  4OX9 Q;  1IBM L;  2GVA A;  4HNT A;  2YTV A;  5EKI A;  4JV5 Q;  3W2D A;  2XGP A;  3L7Z C;  1BF4 A;  4F50 A;  1YNX A;  3Q0A A;  1E1T A;  2Z0S A;  3CW2 C;  4P71 A;  3HRZ C;  4YR2 A;  3GP7 A;  4JI5 Q;  4QWE A;  2OQK A;  2VNU D;  1B33 N;  2JN4 A;  2PZU A;  2V9W A;  1RJP A;  1JJC B;  2I0Q A;  3ULJ A;  4PG3 A;  3RMH A;  1KDB A;  4IUN A;  1UNN C;  5C5L A;  4GOP A;  2WTF A;  5G3L D;  3RTX A;  4DV6 Q;  3KAL A;  3KLS A;  3CAM A;  5A2Q W;  3HGB A;  3VA5 A;  2KBN A;  3E5S A;  3CCV A;  1KC8 C;  3NTH A;  5KKN B;  2UUB H;  2TSS A;  5JEA H;  2Q2T A;  3GIJ A;  4AYB A;  1AE2 A;  3F1Z A;  2B2U A;  4DNR B;  1A3V A;  2VA2 A;  4Q8E A;  1I4Q A;  1LUZ A;  4P74 A;  2K05 A;  1W6J A;  2FK1 A;  4HMI A;  2HT1 A;  4F4X A;  1N33 Q;  2BA0 A;  1Q12 A;  4JI7 L;  3KLW A;  2W9B B;  5E1F A;  1HNX H;  1JCK B;  2IWH A;  3RB4 A;  2HHH Q;  2F0I A;  3FVQ A;  1HZC A;  1I6V C;  2KJX A;  1FNV A;  3GTP B;  2KCN A;  1LTL A;  2MJ8 A;  4X3S A;  3BYT B;  1PTO B;  2D62 A;  3MEF A;  1PA6 A;  4MV4 A;  4OIK A;  1XNQ L;  2E2H B;  5EWE A;  1VQC A;  3MWY W;  4RNO A;  4RCN A;  1C4Q A;  3E0E A;  2JJQ A;  1MIU A;  2C2D A;  1EWC A;  1NAP A;  4YP3 A;  3GD7 A;  4QWD A;  2K75 A;  5C3E G;  1IBM Q;  1N32 H;  5T14 A;  3HS0 C;  3Q6S A;  3A55 A;  2PPB C;  5M9O A;  3MC0 B;  4XT1 B;  3M9O B;  2F4V H;  1XPR A;  3GTP H;  1ULZ A;  4GKK L;  5KFE A;  5KFB A;  2EYP A;  1TY2 A;  4A3D G;  2E2H H;  4UCT A;  2R7Z B;  4MV1 A;  3U9S A;  2JXM B;  3F2B A;  2CVR A;  2J7Z A;  1U4R A;  5EPL A;  3I90 A;  4QY7 A;  5FOB B;  1EQR A;  1QNK A;  1RJT A;  2FPI B;  2AHO B;  4EQP A;  5K36 H;  2A69 D;  2R86 A;  4A3L H;  1YBY A;  2R7Z H;  2DZD A;  3X3N A;  3PZP A;  3FKI B;  3FMA A;  2CW7 A;  4ZRZ A;  4QB4 A;  2BH8 A;  3C1E A;  2QK4 A;  4A3G G;  4Z9C B;  4JI7 Q;  2E75 C;  2OEO A;  4IN3 A;  5KFX A;  1K8M A;  1WOC A;  3TII A;  4JV0 A;  5JQW A;  2W9B A;  4DU9 A;  2A1A A;  3RN2 A;  2YW2 A;  1FKA H;  4MTE A;  1V1O A;  4MIU A;  2FJ2 A;  2EIF A;  3K80 C;  1H95 A;  3GTP A;  1KC7 A;  1M1K C;  3FKI H;  2WAQ B;  3EQL C;  2XRQ D;  5LMU L;  1XNQ Q;  2R7K A;  3EBE A;  1A15 A;  1EZ8 A;  2ZXR A;  2QCP X;  2E2J H;  5CA1 F;  5ELE A;  4APV A;  4DV1 H;  5KIX A;  4MTK A;  4CJ1 B;  3M4O H;  1IKM A;  3RIZ A;  2YYA A;  1K8A C;  3SE0 A;  4GKK Q;  1Q8I A;  3FP9 A;  1YHQ A;  4ZQ3 A;  4EGV A;  2UUA L;  1D2B A;  3CQZ B;  1EYA A;  4JBW A;  1EOV A;  4KY5 A;  1VQ7 A;  2DY8 A;  5EWG A;  4Q45 A;  3QFF A;  2B2W C;  5EBC A;  2R7Z A;  3MXN B;  1EWI A;  4XQQ A;  4IUP A;  1RTO A;  3VR6 A;  4DXF A;  3K5L A;  1IBK H;  2W8K A;  2Z6K C;  2DUD A;  5IY0 A;  3R8B A;  3PN1 A;  1TVX A;  3MFH A;  5JVH 3;  5CA0 F;  3K5N A;  1HRJ A;  1R9T A;  5BPF A;  5I6W A;  2C00 A;  2LFN A;  3TRZ A;  3JAM i;  3CQZ H;  3NQT A;  4BA2 I;  1K1S A;  3BYY B;  4UDU C;  4DFA A;  2WYO A;  4TRD A;  4KKS A;  2FXQ A;  2P5Z X;  1OXS C;  3FKI A;  5CAE B;  2QDL A;  3U58 A;  2B2V C;  5JJZ A;  3NUC A;  2OF1 A;  3PIP 3;  4RAZ A;  2PW7 A;  2F03 A;  4HNV A;  3TS2 A;  2CZG A;  1X55 A;  2EXZ A;  3DHQ A;  4IPD A;  4KKT A;  3RZD B;  3RAX A;  2NU8 B;  4O2D A;  4DV7 L;  1S40 A;  5LMU Q;  2NZO A;  4KD4 A;  3R5F A;  2Z1C A;  1CKN B;  4LFB L;  4ED7 A;  3C2P A;  3FDS A;  3I91 A;  3Q8P B;  1NCV A;  1TS2 A;  5AJ3 L;  2R7N A;  3Q23 A;  4Q8F A;  1IYJ B;  1H9S A;  1SMY C;  1UEA B;  4KJO A;  3TP8 A;  1PYW D;  3RZD H;  4HID A;  2UUA Q;  2R8G A;  4UFZ A;  3ZJY C;  1ILP A;  2NVX B;  4L63 B;  1UEB A;  4NP5 A;  3CQZ A;  2PI2 E;  2IW3 A;  1Z6H A;  1WVL A;  1JOO A;  3RLN A;  1KJ9 A;  4EX5 A;  1WFQ A;  2NVT B;  2W70 A;  4FP5 D;  1BBU A;  4A3C G;  4KI0 A;  1OXX K;  3TEH B;  1YJW A;  4J15 A;  1B3A A;  5ELF A;  2R92 A;  2NVX H;  1CK1 A;  1X3P A;  4FS1 A;  4YJ3 F;  3BA9 A;  4YR3 A;  1F9P A;  1VQN A;  5NUC A;  5K36 G;  2F3W A;  1EYC A;  4RUC A;  4ZLT F;  1B50 A;  1QVC A;  2NVT H;  2AGP A;  1KXL A;  5DM7 3;  2R7Z G;  1VS0 A;  5C0X H;  1YHA A;  2VY3 A;  1ILQ A;  3QO2 A;  1BCP B;  4Q0F A;  2ALZ A;  2E2I H;  4O3Q A;  3VA7 A;  4N8X 1;  2DJG C;  5FKA C;  2MHV A;  2HCI A;  4DK0 A;  4DV7 Q;  2NWG A;  2UUB L;  4A3F B;  2EYL A;  4IUV A;  2HQE A;  4YBZ B;  3DM3 A;  1WTW A;  2J6T A;  4GOP C;  4LFB Q;  4YB8 B;  3KFU A;  1CKN A;  3KF6 A;  2BQU A;  2L12 A;  5H80 A;  2K4K A;  4ECQ A;  4O42 A;  3LWU A;  3NEM A;  5AJ3 Q;  1JIH A;  5KG2 A;  3FKI G;  4KTA A;  5KT4 A;  2RDJ A;  3NTK A;  3BQ2 A;  2IJ0 A;  3R3O A;  1PRT D;  1FL0 A;  3WOF A;  2B2U C;  1HNX L;  1A6X A;  4LH6 A;  2K5Q A;  4CBV A;  3HZX A;  5KG4 A;  2QDB A;  4A3F H;  2FKL A;  1EOT A;  3BJU A;  4QF4 A;  4JVZ A;  4DK6 C;  1EYG A;  1RL2 A;  5T1G A;  1JB7 A;  2KED A;  3M9N B;  2HVR A;  1JMC A;  2OWO A;  4HJ8 A;  4A2B A;  2WAQ G;  1WTO A;  3CPW A;  3OW2 A;  1PYB A;  3WNZ A;  4QW9 A;  4A3B B;  3MXG A;  3G48 A;  2D2C C;  1EU4 A;  1EY7 A;  1N32 L;  4ZI7 F;  3HFZ B;  4HED A;  2E74 C;  4RCO A;  2K04 A;  2E2I A;  1UE1 A;  3PQI A;  1PH2 A;  2F4V L;  2YL2 A;  3BDL A;  2WAQ E;  5GAG C;  3CRK C;  1PFB A;  1SNP A;  4G7O C;  3M3Y B;  4A3B H;  2YZM A;  4CKB A;  4OL7 A;  4UCO A;  3FPP A;  1Q1E A;  2BE5 D;  1GSA A;  2X6L A;  4O3O A;  4RB3 C;  5KX5 F;  2F0U A;  5K2M A;  3ONA B;  1UE5 A;  2UUB Q;  1EY0 A;  1DOM A;  3V05 A;  2WFW A;  3UE1 A;  4YR0 A;  2DNC A;  2QW7 A;  4QIW B;  4A76 A;  1WTH A;  4J9K A;  1KJI A;  1YJ9 A;  1VAJ A;  2Z6B A;  3H20 A;  5DQI A;  1XX8 A;  4LF6 H;  1K0S A;  2K5H A;  2P0A A;  1RYS A;  4JI8 H;  3EA6 A;  2GVB A;  1EEI D;  2NTS A;  1HNX Q;  2WAC A;  3NXW A;  4ME3 A;  4DXG A;  4BY1 B;  1S68 A;  3WWV A;  3TN2 A;  4LH7 A;  4B3R H;  1HUM A;  3I4N H;  3H94 A;  5D3I B;  3TQY A;  1R4Q B;  2OTJ A;  3BS1 A;  4O4H F;  2PMZ E;  2HUG A;  4LSA A;  4TKO B;  3I3C A;  3UDX A;  4DUY H;  1VQG A;  4HTH A;  4BY1 H;  1DYQ A;  1MHW C;  3N40 P;  1N32 Q;  3RGZ A;  3G7L A;  1QUQ B;  4DV1 L;  1TQO A;  2WDT A;  1TWC B;  2X0S A;  2F4V Q;  2EY6 A;  2N88 A;  3U4V A;  1CI3 M;  1K9M C;  2WKC A;  4TQS A;  3PR4 A;  1MKH A;  2LMC B;  3S14 H;  2W9C A;  3RBD A;  4RHR A;  4IZO A;  3S16 B;  5ISR A;  4XYM B;  4O2A F;  2NUA B;  1N9W A;  4A93 B;  1SEI A;  4B3S H;  1Z9F A;  4EG0 A;  1IL8 A;  1K8G A;  4CJ0 B;  1PFM A;  1H9J A;  2K33 A;  4XDX A;  5KFA A;  5C0X G;  3HOU H;  3EPI A;  3DUZ A;  3UI2 A;  3BZK A;  1Z2P X;  1X3Q A;  4F8M A;  4QIW A;  1WI5 A;  1XJV A;  3RD4 A;  5KG6 A;  5FJ8 H;  1GUS A;  5CB4 F;  5EKL A;  3GTK H;  4A93 H;  2A5H A;  5KFO A;  2ES2 A;  1YNN C;  5IYC H;  1M6V A;  2L5T A;  4PNY A;  4HIO A;  2FB9 A;  3BQ0 A;  4HQ6 A;  3HBL A;  3HOW B;  1D7Q A;  2UVU A;  4IR9 A;  2F0J A;  1HR0 H;  1BJT A;  1U0L A;  1AZP A;  3PIP A;  1BKB A;  4A3F G;  2K6A A;  1C48 A;  2CW0 D;  5KNC A;  4OWX B;  4LK1 C;  4HIM A;  3VR4 A;  1W3S A;  4B3M H;  1NBW A;  1C3O A;  4DV1 Q;  3I56 A;  1LTI D;  1IHZ A;  3HOW H;  3RB3 A;  2FMC A;  4N9P A;  1VQH A;  3T1Y H;  2Z4H A;  1SXT A;  2MQH A;  3CCL A;  4ED2 A;  3OUZ A;  1TAE A;  1SE2 A;  2EYJ A;  3T16 A;  4JV2 A;  3C1F A;  3ORR A;  5K5P A;  2W6M A;  5LL6 b;  2N3S A;  3GTK A;  3CMA A;  1BDO A;  5HGT A;  5EZY F;  1VF7 A;  4YHH H;  3MFY A;  4R4I A;  5C4J B;  1B44 D;  4EGJ A;  4A3B G;  1GYF A;  2B8G A;  2F4I A;  3SK4 A;  4BY7 B;  2F0S A;  3OHA A;  3NEL A;  3P1H A;  5J2U F;  5EPK A;  3J7Z C;  4ZUI A;  4OHJ A;  3TZD A;  2NZH A;  4K14 A;  3RJ0 A;  3BA8 A;  3D6W A;  3KOJ A;  1JOR A;  5EOY A;  2ZXP A;  1KL9 A;  5J2T F;  1F2L A;  5KND A;  2JEG A;  4M9U A;  3F2D A;  4ETS A;  5C4J H;  5FD5 A;  4BY7 H;  4DV5 H;  3J81 i;  3J7A V;  4AQY H;  3PIO 3;  1CUK A;  1HTL D;  4ED1 A;  3G6X A;  4MV9 A;  2W6Q A;  4JC0 A;  1EIG A;  4H13 C;  3J7A K;  2SEB D;  1SYF A;  2L11 A;  3N43 B;  2JEF A;  4NLG A;  1W93 A;  4FYD A;  4IWY A;  3K58 A;  4POF A;  4DAM A;  5KGU A;  3OSP A;  3DEP A;  2BQ3 A;  3UFX B;  3RNU A;  4FF2 A;  5IIF A;  2IY5 B;  1G2T A;  2RF4 A;  1TS3 A;  4BY1 G;  4C3H H;  1VQI A;  4LF4 H;  1STB A;  2XCA A;  2F1M A;  3SGI A;  1PH5 A;  1MSG A;  3K5H A;  2F0Q A;  1WH2 A;  3KK7 A;  1CTM A;  2I46 A;  1V43 A;  1Y8O B;  4DUZ Q;  1Y1V B;  4F88 A;  3L2P A;  3BVG A;  3I2Z A;  5EAY A;  2YU9 B;  3RGX A;  3GIK A;  1F2M A;  2XTI A;  2YTY A;  3HKZ B;  2AQ1 B;  5LA6 F;  2ID0 A;  2L0C A;  1S5B D;  1EY6 A;  1SND A;  1ZHS A;  3T53 B;  2LY7 A;  4FM9 A;  1PYS B;  3S1R B;  3HOU G;  1HQR D;  2DPI A;  2Q8R E;  1Y1V H;  5J1Z A;  2ZM6 H;  3ND8 A;  4MV8 A;  1NMG A;  2YU9 H;  4EVO A;  4OO1 I;  1Q8K A;  2ICI A;  2KEE A;  3DMU A;  4UCU A;  4HJ9 A;  5FJ8 G;  3KAJ A;  2N8N A;  2Y0S E;  4A93 G;  1TWH H;  4F87 A;  5I4D A;  5IYC G;  2PVP A;  3T51 B;  5C0X J;  3FRP B;  1QE6 A;  3EJI A;  3L9A X;  3S1R H;  4MZ9 A;  2KHJ A;  1IXR A;  4EFE A;  4LF6 L;  2W7P A;  1BCP C;  3K0Y A;  1CQV A;  1SNC A;  1VQA A;  4RKL A;  5T1I A;  3STB D;  4GNX B;  1XWE A;  1PLF A;  5L1J A;  2BR0 A;  4DL6 A;  1ESR A;  3UDI A;  2V4R A;  4QJF A;  1B1Z A;  4R9W A;  2KUM A;  3VYS A;  3JZI A;  4B3R L;  1MJE A;  4QQB X;  4IRK A;  2OXP A;  4Y52 H;  3HOW G;  5KT6 A;  3TSS A;  3JRW A;  5C4X B;  4JW0 A;  4C56 C;  1Y1V A;  4DUY L;  3ORQ A;  3ETJ A;  3TIG A;  2YU9 A;  1TT2 A;  2V58 A;  2R7D A;  1MSH A;  2AU0 A;  3HKZ A;  3MXU A;  2RHQ B;  2JA8 H;  1TWH A;  2EY2 A;  2AQ3 B;  3NQI A;  5C1P A;  3H15 A;  1TWG B;  3BDC A;  1JOK A;  4HCE A;  3GTG B;  1A8V A;  1LT3 D;  5C4X H;  1U4M A;  2VW9 A;  4RB2 C;  2I5L X;  2AMC B;  5EWF A;  2ZJQ A;  4U7C A;  1ASY A;  5KT5 A;  4F4Y A;  2R7L A;  5FO9 B;  2W9A A;  4O4L F;  4OO1 H;  3T13 A;  3BDO A;  1WSC A;  1X9N A;  3F2U A;  2A6E D;  5G3L F;  1TWG H;  1O75 A;  3RV4 A;  2JA6 B;  2EJM A;  4BY7 G;  1SMX A;  1ZYR C;  3GTG H;  4FS2 A;  4LF6 Q;  1VMP A;  1ZEQ X;  3VPB A;  3BU2 A;  4FXD A;  1VQ4 A;  3CKI B;  3UDG A;  1RJQ A;  1JX4 A;  2G5D A;  2F0L A;  4GNX A;  1AP0 A;  1PMR A;  4JBJ A;  1BGW A;  1EWH A;  5L9X A;  4K6L A;  1KAA A;  4LSX A;  1YEZ A;  4GOP B;  4B3R Q;  2EYO A;  3S1M B;  3QWN A;  2JA6 H;  2XWJ B;  4UP8 A;  4HSV A;  3S24 A;  4DR6 H;  5ELB A;  4C5A A;  1RKN A;  4OEL B;  4BBS B;  5DG8 A;  1A0I A;  4AYB B;  1F2Y A;  3ER0 A;  3NHH A;  3QR8 A;  5EKK A;  4HSP A;  4DUY Q;  4DV3 L;  4X62 H;  4JK1 C;  4DR7 H;  4TUY F;  3QZ7 A;  4PZ8 A;  1JDB B;  5I2Y A;  1EFW A;  3S1M H;  1PDQ A;  5IGD A;  1H9R A;  4GLX A;  3T1Y L;  4NDX A;  4BBS H;  1K3R A;  4YIJ A;  1EZ6 A;  2WP8 J;  1EYZ A;  4EQ5 A;  4BWG B;  1QWY A;  3GTG A;  4I65 A;  1B6S A;  1E2W A;  1VQ8 A;  1BBW A;  1STY A;  4ABN A;  3VYU A;  1ENF A;  5D14 A;  2VQE H;  2EQS A;  1SDF A;  2F0T A;  2JA7 B;  5CV8 A;  1Y1V G;  1CS0 A;  4BS9 A;  4ZKC B;  3G6E A;  4JBM A;  4YHH L;  1G6Z A;  4RUA A;  4JPB W;  5BMV F;  3R2I A;  4JI1 H;  1VBH A;  3GIQ A;  4J8Q A;  3HKZ G;  2JA6 A;  3IL8 A;  1HZB A;  4BWS C;  4XT3 B;  3SR1 A;  4J1M A;  2XGQ A;  1GUN A;  1X3E A;  2PQA A;  3M4Q A;  3OW7 A;  3ZYY X;  1PH6 A;  1QJO A;  2JA7 H;  1D1I A;  2B63 A;  5JH7 F;  1FNW A;  1L2Z A;  4MA5 A;  3PW7 A;  4C3I B;  1S5D D;  1BCP F;  1STG A;  3V4Z A;  4DV5 L;  4AQY L;  2RSO A;  1Q82 C;  4TQR A;  4OWW B;  3JAM L;  1LYL A;  1SAP A;  1A62 A;  5KG0 A;  4PV1 C;  2K01 A;  3PO2 H;  4QGU A;  4GC6 A;  3D8G A;  4A2A A;  4DV3 Q;  1U4P A;  3KXY T;  4YWK A;  3PIO A;  1EUC B;  2PBZ A;  4O1N A;  4C3I H;  4JCV E;  5E3F A;  2K5D A;  2PNH A;  3ERO A;  4PMB A;  4C1N K;  3IG0 A;  4JYA H;  1H9K A;  1EL0 A;  3MTS A;  3CRL C;  3CCQ A;  4PMC A;  2RDF A;  4LF4 L;  4UCV A;  5M3M B;  4YCU A;  1S5E D;  4CC6 A;  5HBR B;  4XQN A;  3NGD A;  3Q2O A;  5DG7 A;  1B9M A;  1E4G T;  5KFP A;  3U4Z A;  4EYI B;  3D4W A;  2JA7 A;  4NPS A;  1LTR D;  2FLL A;  5C4X G;  2A6H D;  4YHH Q;  5KFK A;  4FBU A;  3MXP A;  1VQ6 A;  1DV1 A;  3T1H H;  4O2B F;  4RU9 A;  5M3M H;  1ZXT A;  2YTX A;  3EVQ A;  1LV9 A;  1O78 A;  1TY0 A;  4OO1 G;  1CZW A;  4R8I A;  1X65 A;  3JC6 6;  2C9O A;  1OXU A;  2Z4I A;  1XYI A;  3I4L A;  2ZM6 L;  2HQL A;  4B08 A;  5FO7 B;  3K57 A;  3N6X A;  2M2L A;  4HIK A;  1KDA A;  5E4X A;  4DV5 Q;  1M0T A;  3H3V H;  1VQD A;  2VXW A;  2WE6 A;  1R9T B;  2F0O A;  1TII D;  1OWT A;  1S10 A;  2NBF A;  3LGJ A;  4XIG S;  4JI6 H;  1DOL A;  2VUG A;  1DZ1 A;  3DLL A;  3KHL A;  4NW2 A;  4DNI A;  2KCM A;  4QUC A;  3K8A A;  4ZAI A;  2JA6 G;  3HXL A;  3MR3 A;  3ULP A;  1XMO H;  3M85 A;  1SYG A;  1B9N A;  3I12 A;  5KT3 A;  5KG1 A;  5GON F;  1HNW H;  1PK8 A;  1XMQ H;  1T36 A;  2AWO A;  2CHB D;  2AWN A;  4XYQ A;  5JPM C;  5BN3 A;  5KFG A;  3N52 A;  5E4W C;  5KG3 A;  3FEW X;  4EBE A;  1R9T H;  2E2J B;  4ECU A;  4LF4 Q;  2NU7 B;  4IRC A;  4XYL B;  2RDH A;  1XPO A;  1SRO A;  3M4O B;  2F3V A;  4UP9 A;  3E5N A;  3V6J A;  5I6Y A;  2JA5 A;  1TKW B;  3S2D B;  3MFG A;  4BBS G;  1VBG A;  5LP6 F;  4AYB G;  2B2Y A;  5HY6 A;  3CU7 A;  1V8Q A;  3CHB D;  5IGC A;  2CQA A;  1KRS A;  1H9S B;  3OWE B;  4H7B A;  5IGG A;  1S72 A;  4ED6 A;  3P20 A;  1ONL A;  2MO1 A;  1YI2 A;  4AYB E;  4C2M B;  4M1U B;  3S2D H;  5KFC A;  3MWM A;  1A2T A;  3URY A;  4LUV A;  2ZM6 Q;  4ECX A;  1E2V A;  1V51 A;  2AGO A;  5C6A A;  1TXY A;  2X69 A;  3SHL A;  1WTP A;  4JG2 A;  4DKA C;  4LAA A;  4LMY A;  3RF2 A;  1CHP D;  2JA7 G;  3K5M A;  3KUP A;  4C2M H;  4RKB A;  4PZ6 A;  2R92 B;  1LTA D;  5D1P A;  5DQG A;  2W57 A;  3RV3 A;  1A2U A;  3PUY A;  2RBM A;  3J80 i;  2O03 A;  4HJ5 A;  2D5D A;  5C0X I;  3QB3 A;  5JEA G;  2JK8 A;  3EFX D;  4ECR A;  1L0X B;  4GKJ H;  2WB1 B;  4R4Q A;  2DWC A;  2Q2I A;  4FNF A;  4C3I G;  4O4I F;  1J5E H;  2R92 H;  2RCF A;  1PRT F;  5CC4 A;  1GVP A;  1SYX B;  2EYF A;  4GNX C;  5C4Z A;  3X3M A;  3D3R A;  3H6M A;  2CW0 C;  2O2L D;  1Y14 B;  3EYY A;  4ODG A;  1SYB A;  1FR3 A;  1GUO A;  4X62 L;  3KF6 B;  3IAY A;  4DR7 L;  3PUV A;  2C5C A;  4DK1 A;  3HOY H;  3F2C A;  3N42 B;  5C4H A;  1Q1B A;  3UDF A;  2F52 A;  3E9I A;  3D6C A;  4C2M A;  2EDG A;  3PUW A;  3PMF A;  2N49 A;  5M3M G;  3I72 A;  3VYR A;  2F0V A;  5GAD C;  3KF8 B;  4G4K A;  2R87 A;  4FF4 A;  1EQQ A;  5C3W A;  1GHJ A;  2VQE L;  2KSW A;  4RAY A;  4DR1 H;  1BUV T;  2K5W A;  1OTC A;  2FIN B;  2QGQ A;  4I7A A;  4BXX H;  2EOT A;  2J9G A;  4Y8V B;  2RHS B;  1MJC A;  1YNJ D;  4JI1 L;  1EEF D;  4A3J B;  2BDN A;  4FXG C;  1K83 A;  2E2I B;  3TQT A;  2LSS A;  3V96 A;  5M5Y B;  4R8U A;  4IPH A;  1E4F T;  2C2R A;  3S9W A;  2J6S A;  1G29 1;  4A3L G;  3KTM A;  5KFH A;  1HNZ H;  3D31 A;  2JE6 I;  3AFP A;  2GA4 B;  5KFV A;  3U9T A;  3I73 A;  4FF1 A;  4A3J H;  2WB1 A;  4DV4 H;  5KYI A;  1U5K A;  3VPD A;  5KG7 A;  4R4O A;  3NSW A;  1AEX A;  4DN4 M;  3L4J A;  5M5Y H;  1HA5 A;  4JOI A;  4X62 Q;  1E1O A;  1KAW A;  4DR7 Q;  2NU6 B;  4IHJ F;  5GQO A;  1O7I A;  1GSH A;  1MZB A;  1HFG A;  3QOJ A;  1SE3 A;  3M7G A;  1KRT A;  2UUC H;  1A3T A;  4KJN A;  3K3V A;  2A68 C;  4EEY A;  2X6G A;  1D6E C;  1LT5 D;  4XZ3 B;  4B3T H;  1V4Y A;  4ECY A;  4R4T A;  2NN6 I;  2RVL A;  1H9M A;  4IAJ A;  4WFN 3;  2VQE Q;  3KF8 A;  3U50 C;  2YS7 A;  1KHI A;  3L0O A;  4J6H A;  1XDN A;  5JUM A;  1JE4 A;  4DL5 A;  3W5O A;  1WD0 A;  2I5M X;  4JI1 Q;  3T1H L;  1C9O A;  4X66 H;  5L1K A;  4DL3 A;  2HVS A;  5JVG 3;  3Q8S B;  1VQK A;  2KCC A;  2F3I A;  1VQF A;  2HIX A;  2QEJ C;  4TSS A;  2BOS A;  5EQ0 A;  1QCB D;  1VKZ A;  2W9C B;  3G6V A;  3CP0 A;  4RFB A;  4V19 0;  1VQP A;  4OGQ C;  1CA5 A;  4HJA A;  3VYT A;  1BR9 A;  1KNE A;  1PFN A;  3CCS A;  2ASD A;  1NSN S;  1Y1W B;  4ECS A;  2QA4 A;  1JB3 A;  1HZ9 A;  4JI6 L;  4X6A H;  3I4N B;  1WTQ A;  1NJI C;  2R92 G;  4Q5V A;  4EFB A;  1I4G A;  3EPG A;  2W6O A;  4EYH B;  5F9L A;  1XMO L;  1HNW L;  1ICW A;  1PH4 A;  5KFT A;  5JEA J;  5FD6 A;  4O3R A;  1XMQ L;  3J81 L;  1GUT A;  2UXD H;  3PGZ A;  2A74 C;  3I4M B;  2M05 A;  1Q3L A;  1V9P A;  4I7Z C;  1Y1W H;  1S0M A;  1HA6 A;  1LTS D;  2WB1 G;  1F2Z A;  5JOB A;  1HHV A;  1B6R A;  3HOY G;  2OQ0 A;  2CH4 A;  2RCN A;  4BA1 I;  1PV4 A;  3MA2 B;  3S14 B;  4FF3 A;  1B70 B;  2YS6 A;  2NN6 H;  3BAB A;  3SE7 A;  1IKL A;  1C30 A;  3Q1K A;  4FBT A;  1Z2N X;  1AUV A;  2ZDQ A;  3I4M H;  2MP1 A;  1JKJ B;  2GPS A;  3T1H Q;  2ZJT A;  1N36 H;  1S03 G;  3GV5 B;  2CCZ A;  2FK2 A;  1LT6 D;  3C0F B;  1F9R A;  3J81 j;  1JQY D;  3RLO A;  1JOQ A;  4H02 A;  1DV2 A;  3A54 A;  2JEI A;  4BXX G;  2B2Y C;  2B2T A;  2NTT A;  3HOU B;  2JEA I;  5FLM H;  1CQI B;  2DJF C;  1F77 A;  1UC9 A;  4R8N A;  2D9U A;  3H3V C;  3N41 B;  1SN8 A;  3JAM W;  4HYK A;  4C5C A;  4UCR A;  2XSC A;  1IBK L;  3GTK B;  3OHX C;  1RDP D;  4WJW A;  4IOA A;  3KLS X;  4K2L A;  2UVR A;  4G3I A;  1I4X A;  3T56 B;  4RG1 A;  1PH9 A;  3MR6 A;  1Y1W A;  2JQO A;  2QF7 A;  1ML0 D;  4A3J G;  3I8Z A;  2EYH A;  3MZ5 A;  3CC7 A;  3DWQ A;  5D3D A;  2OTL A;  1XMO Q;  3CCU A;  1HNW Q;  3PCO B;  3C3L A;  3JSL A;  1XMQ Q;  1B7Y B;  4K8I A;  1AW7 A;  4GKJ L;  2EJG C;  1J5E L;  4P75 A;  4QUF A;  3V6K A;  4LFC H;  2PCF B;  1PRT B;  4I7H A;  2BH2 A;  1G6P A;  1WD1 A;  1SBB B;  4IRD A;  4RH6 A;  2E2D C;  4JI0 H;  1O80 A;  3N8D A;  4J9M A;  4GN3 B;  5DNF A;  1S97 A;  3OMC A;  1VQ9 A;  1LT4 D;  3HKS A;  3T4A C;  3CME A;  2CWA A;  4A3K B;  4CC5 A;  3KLR A;  4A3I B;  4HCS A;  3GTL H;  1CHQ D;  4KHP H;  3T5J A;  4PZ7 A;  4ZCK A;  5FPR A;  1WCM B;  1AE3 A;  5D1O A;  2SNS A;  5J3B A;  4AH6 A;  3ETH A;  1XTC D;  3WOE A;  1UNS A;  4FDB A;  4H44 C;  2EZV A;  2RGR A;  1IZ6 A;  4IUU A;  2M9V A;  2V4D A;  4DV6 H;  5C3X A;  2OCE A;  3J7A 5;  2W7O A;  4A3K H;  4A3I H;  2WIN B;  1FGU A;  1IBK Q;  4L5S A;  2KA7 A;  5M5X B;  3VPC A;  1IW7 D;  3A5U A;  4L6T B;  3AEV A;  1WCM H;  2EXD A;  1NTG A;  5CV9 A;  1J8I A;  1A3U A;  3R5H A;  2A8V A;  1PZK D;  3NK9 A;  3U9O A;  4CKE A;  2FMA A;  4ED0 A;  3NWT A;  3MWE A;  3MVV A;  3H4B A;  2B3G A;  2BA1 A;  5ELC A;  4K5W A;  1I94 H;  4MHE A;  5CV6 A;  4ALP A;  1SMY D;  1I3Q B;  3TBI B;  4UCS A;  5I9O A;  3AYH B;  1GHK A;  3K5I A;  1MGS A;  4IQZ A;  2K50 A;  2XIW A;  2IBK A;  3AQQ A;  5M5X H;  4QMG A;  3PVX A;  1XXG A;  2LKV A;  1ESF A;  1XTD A;  3QJY A;  4X3T A;  1N8R C;  2L4N A;  5GAH C;  4GKJ Q;  2W6Z A;  4Q0Y A;  3VR3 A;  3GTL A;  1RJR A;  1E24 A;  4C3J H;  2R6G A;  4DV4 L;  1J5E Q;  1RYR A;  2IX1 A;  1KBL A;  3DF7 A;  4JI4 H;  1M90 C;  3GIP A;  3GTJ B;  5CBE E;  4YAK B;  3GTO A;  4C3H B;  2YV5 A;  4KK7 A;  1I3Q H;  1Y1W G;  4RZR A;  2UVW A;  4JV1 A;  1GUW A;  4DAP A;  1CE8 A;  3I4N G;  2R84 A;  1HQM C;  4YAJ B;  3J7A F;  4UY8 C;  3GLK A;  3CD6 A;  2O5I C;  2NN6 G;  2UUC L;  2QKI C;  4JOI C;  3GTJ H;  1WCM A;  1L2F A;  3MWD A;  4Q44 A;  3I4M G;  1DIK A;  4QIW E;  4R4C A;  2VB2 X;  4IUR A;  4B3T L;  2W6N A;  3DEO A;  2K32 A;  1PZJ D;  1K1Q A;  1UAP A;  2K7V A;  3SK6 A;  5DQH A;  2D0P A;  1YVC A;  2IP4 A;  2NYZ D;  2O5J C;  1T5X D;  5FLM G;  2AGQ A;  3RR5 A;  5IYD H;  2DNE A;  5JJK A;  2VUM H;  2PN1 A;  4X66 L;  1V1P B;  2RDI A;  2CKZ B;  4QWC A;  3GIM A;  4LF8 H;  3N6R A;  1TWH B;  2PNR C;  2BCO A;  2PYK A;  1JWM D;  3HB9 A;  5FLX L;  2KOL A;  3OTO H;  1I3Q A;  4RGT A;  5HV6 A;  4QWB A;  2AQ2 B;  2I5H A;  3GII A;  3QZ8 A;  1DON A;  1STH A;  4TV9 F;  5FK9 C;  1KQS A;  3E9H A;  5IE8 A;  4DV4 Q;  2I8C A;  1XNQ H;  2RKS A;  1TWA B;  4J9P A;  4DAV A;  1JT8 A;  3RUZ A;  2A69 C;  3GTJ A;  2NB0 A;  4PQX A;  4E6I A;  3OIP A;  3MHB A;  1UE7 A;  3D4D A;  3OWF A;  3C46 A;  3KDF B;  1LTT D;  1G51 A;  3CXC A;  1EQV A;  2R6F A;  4RNN A;  2PO4 A;  1EY5 A;  2EY5 A;  3TP5 A;  5IOC A;  1ZKO A;  2UUC Q;  1TWA H;  4JI8 L;  5KFQ A;  4FU0 A;  4IUT A;  4LJZ C;  4LF5 H;  4M7E A;  5KFJ A;  4DLK A;  2MPM A;  1X32 A;  2NVQ H;  2VUM A;  2F0N A;  1OXV A;  2XVS A;  1XPU A;  2JA8 B;  3NEN A;  2E8G A;  1I4R A;  1W6K A;  2YCH A;  1B3Q A;  1GKH A;  1QZG A;  1K3B C;  1PFS A;  5AFW A;  2R93 B;  3KHH A;  1S0O A;  4WJ3 M;  3T5H A;  1NR4 A;  4IFD I;  2EPB A;  3JAM c;  1LAC A;  1D5X C;  4RMF A;  4HJ7 A;  5BPH A;  5BN5 A;  3M9M B;  1K73 C;  4A3K G;  1N36 L;  2DIK A;  4X66 Q;  2V5A A;  4A3I G;  4KY7 A;  4HR7 A;  1RK6 A;  1V1P A;  4J9O A;  4EBC A;  2SOB A;  1JIC A;  3E6Z X;  1WCM G;  4DL2 A;  2R93 H;  5KRU A;  3JSN A;  4A75 A;  5KT7 A;  5BR8 H;  4L5R C;  2F0K A;  1YIT A;  2WV6 D;  3J7Y W;  1RD9 D;  5I9P A;  5KYL A;  4B3S L;  3HOX B;  2B2T C;  1TWA A;  4ECT A;  4I4T F;  3Q8D A;  4A3M B;  4DNT B;  4KN4 C;  2Q8I B;  1X3F A;  1HZA A;  2B2W A;  3G6J B;  3TME A;  5IGF A;  3KDF A;  2AQ4 A;  5ELD A;  1UE6 A;  4K5X A;  4ZQI A;  4CHT B;  2Z6K A;  5KFR A;  1PTO D;  3D0F A;  1CQJ B;  2PQA B;  3NBH B;  5ELN A;  3W3A A;  3ND9 A;  1T9H A;  3HOX H;  4JI8 Q;  3A8J E;  2B63 B;  5LMN H;  1JR0 D;  4WD3 A;  1JLL B;  4GN5 A;  2FHT A;  5IYZ F;  1Z47 A;  3JAM E;  4A3M H;  4A3E B;  4YWM A;  1W96 A;  2C22 A;  1WYD A;  1KTK A;  1GJX A;  2I07 B;  4LFC L;  4MV6 A;  1KJ8 A;  1PH3 A;  1I50 A;  1HR0 L;  1I5F A;  2R93 A;  3K81 C;  4C3H G;  4JI0 L;  1CQF A;  2Q8T A;  1VQL A;  2ZJP A;  2EY1 A;  2B63 H;  3M4I A;  3VDY A;  3I7F A;  5D65 A;  1D1K A;  1WTV A;  2TMP A;  3CF5 A;  4IFD H;  3IRB A;  1N36 Q;  3UQ8 A;  4B3M L;  2Q2H A;  2RA4 A;  4KHP L;  4A3E H;  3G8C A;  1SJE D;  4ZYS A;  3EN2 A;  1STE A;  4ILW A;  2NZ1 D;  1YNN D;  5IYD G;  3LML A;  2J0T D;  1JJ2 A;  2JP1 A;  1M8A A;  1CZG A;  1SYD A;  4WRD A;  3GO5 A;  3GV3 A;  4HAE A;  3VR2 A;  4DAY B;  1BNZ A;  4B3S Q;  1ICF B;  3W1B A;  2GPW A;  1HPC A;  3L4K A;  4F4Z A;  4A3G H;  2ZTE A;  1S5C D;  4FXK C;  3K59 A;  1Y8P B;  1QZH A;  5JAV A;  4RGM A;  4ED3 A;  1MBY A;  3GTM B;  2MO0 A;  1I94 L;  5M5W B;  2YZG A;  1N56 A;  3PO2 B;  3ULL A;  1EIY B;  2RSN A;  2AKW B;  3ITP A;  3NBH A;  3P75 A;  1EIH A;  2I80 A;  2G9D A;  4RNM A;  2HJW A;  2UXB L;  3H3V I;  3HKZ E;  2ASL A;  4JI4 L;  4LFC Q;  3PF4 A;  5LXT F;  1SNM A;  3GTM H;  1F9S A;  2FPG B;  1HR0 Q;  1Q46 A;  5M5W H;  3P7J A;  4JI0 Q;  3J80 L;  3FMC A;  2HCC A;  4P2C B;  1B2T A;  4APM A;  2K5N A;  1QB5 D;  4B3M Q;  1M0W A;  1XNR H;  4KHP Q;  2ZDG A;  1PRT C;  2XN9 C;  3F8T A;  3T1Y Q;  3GTQ H;  4ME6 A;  2KHI A;  4DL4 A;  2OLS A;  1VDZ A;  4XX0 B;  5H1S E;  1HFN A;  5KFU A;  5DAU A;  5A35 A;  1RF2 D;  1OXT A;  3RAQ A;  3TP7 A;  3PSI A;  5HUR A;  2JA5 B;  2ALY B;  2NVY B;  2JA8 G;  1SSO A;  3W1G A;  4LF9 H;  3HP3 A;  1AN7 A;  5JVD F;  2R93 G;  5IWA H;  4DAY A;  1D5M C;  4L1K A;  1Y69 U;  2ICE C;  3RUP A;  1II3 A;  2QEX A;  2W8L A;  4EQN A;  1KDC A;  2BDO A;  5IYB H;  2UU9 H;  4RZQ A;  3H0G B;  3OPO A;  4LF8 L;  3N44 B;  1KJQ A;  2Z9H A;  1I94 Q;  3LX0 A;  3S1Q B;  1RHP A;  2JA5 H;  3H4D A;  1A63 A;  2NVY H;  3OTO L;  3GTM A;  1NE3 A;  1GOZ A;  1UUP A;  4IPC A;  1PH7 A;  2VL6 A;  2UXB Q;  3Q8R B;  4U6P A;  2C35 B;  1KLG D;  2BE5 C;  2K1B A;  3ERS X;  4NMZ A;  4OWT B;  2EJF C;  4CDF C;  4M8A A;  2EYM A;  4UP7 A;  1C0A A;  1STA A;  4JI4 Q;  4AQY Q;  2H1E A;  1O7L A;  3H0G H;  3HOX G;  4IWX A;  3BZC A;  2ASB A;  3GTQ A;  2HD3 A;  3S1Q H;  5LHY 1;  4HN7 A;  2K5V A;  2UXC H;  1SLJ A;  2XNA C;  4X3U A;  5IT9 L;  4XTC S;  2L15 A;  4A3M G;  1UWV A;  1ASZ A;  2DN8 A;  1IOV A;  5DM6 3;  4LUZ A;  2L1B A;  4G57 A;  2XIG A;  3A5Z B;  5BN4 A;  1CKM A;  4EBD A;  5LOV F;  3KJO A;  3GDE A;  5KT2 A;  3V6H A;  1PTO H;  3O13 A;  4IOC A;  5C44 B;  3M4P A;  3SVM A;  4LF5 L;  2B63 G;  2K14 A;  4A3C H;  3AFQ A;  3NE5 B;  4IFD G;  3KYH C;  3MEH A;  3WO1 A;  4DF7 A;  4A3E G;  2YYZ A;  4DR3 H;  1VQB A;  4I55 F;  1W2B A;  5C1O A;  2NVY A;  3I55 A;  1PVO A;  1Q90 A;  3RZO B;  2IPK D;  1I6H B;  1UC8 A;  2HGS A;  5C44 H;  5IOD A;  1VF5 C;  1D5Z C;  5CGK A;  4QWA A;  1OO9 B;  2B29 A;  4Y7N B;  2PI2 A;  1BCP D;  3QIA A;  1PZI D;  4L5Q A;  1WTR A;  4LF8 Q;  1HCZ A;  2MNA A;  4P73 A;  3VR5 A;  1JDE A;  3H0G A;  1WTX A;  1B8A A;  3FPU B;  1AH9 A;  2ASJ A;  3OTO Q;  3DM1 A;  3DWA A;  2VS1 A;  5C5M A;  4DR2 H;  3A7L A;  5CMD A;  1LTB D;  1L0W A;  3RZO H;  1I6H H;  1RTN A;  5BR8 L;  1X6O A;  3S17 B;  5LL6 X;  5KFI A;  2R61 A;  1L0Y B;  3H09 A;  4DV0 H;  4J9S A;  1ET9 A;  3GV6 A;  5IGE A;  2ZT9 C;  4Y7N H;  3TS0 A;  1E0B A;  3A8I E;  1SYC A;  2FJZ A;  2E2H A;  2NU9 B;  4DR4 H;  5IP9 H;  1SJH D;  4DR5 H;  1K83 B;  1GUG A;  3KHG A;  2ENB A;  1BNC A;  3S17 H;  3CCE A;  1PH1 A;  2XRS D;  4CKC A;  4R8U B;  5KFF A;  1RK5 A;  3MJF A;  2MUY A;  1BO0 A;  3OMG A;  3PO2 G;  5DLG A;  3K7U C;  2A19 A;  5LMN L;  4LF5 Q;  2ZTC A;  4ECW A;  1ZQ7 A;  5CYU A;  4MA0 A;  4YY3 H;  2RDG A;  1DD2 A;  1EQT A;  1K83 H;  3HOY B;  1SR3 A;  3I70 A;  4DR6 L;  1I4H A;  2MFI A;  3PUX A;  3TDQ A;  2F0H A;  1CKO A;  4LWC A;  1E2Z A;  4DA2 A;  4H0L C;  4BBR B;  2N55 A;  1AUX A;  4X65 H;  1KAB A;  2CH4 W;  4ME5 A;  1ZYR D;  5EDW A;  5FLX W;  4EGQ A;  3VMM A;  4CDD C;  2PMZ B;  1JWS D;  4AIM A;  2XD4 A;  1N34 H;  2QIL A;  2V4Q A;  3TRE A;  1MD2 D;  1BXR A;  2ZXO A;  4MTN A;  5IYB G;  1IL2 A;  2DPJ A;  3SI8 A;  4ID6 A;  2F0F A;  5BR8 Q;  4BBR H;  3J81 c;  4DL7 A;  5GRO A;  3EIV A;  2KEN A;  1ENA A;  2JA5 G;  1JWU D;  1NR2 A;  3KHR A;  1IW7 C;  3PW5 A;  5ELO A;  4GC7 A;  2WAQ A;  5L37 A;  2L55 A;  3A7A B;  1B53 A;  3V4S A;  5JJL A;  3SEB A;  4C1N I;  3AMU A;  1I7N A;  1BVS A;  3HOV B;  4J0M A;  5CR3 A;  3H0G G;  1A9X A;  4GLA C;  4LF7 H;  3R2T A;  4JBK A;  2N78 A;  1FVI A;  5FO8 B;  5LMN Q;  3HOZ B;  2CQY A;  2HIV A;  2SCU B;  1TR5 A;  1SNO A;  4DPG A;  4GS3 A;  2R7F A;  5DG9 A;  3MXN A;  1EHI A;  1SEB D;  4C5B A;  4OIJ A;  3HOV H;  4DUZ H;  5J22 A;  4LW1 A;  1ZHQ A;  4DR6 Q;  3K5O A;  2VA3 A;  1S5F D;  5C8Y F;  4B9W A;  1GXD C;  4YQW A;  4NXM H;  2R8K A;  2BQR A;  3HOZ H;  4LFA H;  4WJ4 A;  4ZHQ F;  4U68 A;  4K0K H;  4RA8 A;  1VMC A;  1I6U A;  1XNR L;  3HEJ A;  3J81 E;  1HJP A;  1SE4 A;  4JYA L;  1VQM A;  2PMZ A;  4IZ8 A;  5KEE A;  5C44 G;  4UPA A;  4IFD J;  4MN3 A;  3CCR A;  3G4S A;  1CSP A;  1FGB D;  5KFW A;  1S9F A;  2E5L H;  2OH2 A;  4K2K A;  1K28 A;  2OT2 A;  2F0M A;  5CBA E;  3G71 A;  5EGT A;  2Z8L A;  3OUU A;  1F9Q A;  4LF9 L;  2IHF A;  5IWA L;  4ULL A;  1DJR D;  3L3O C;  5KFL A;  4MAM A;  1LM0 A;  1VQO A;  3LWB A;  1BQQ T;  3OIQ A;  2CW8 A;  4HMJ A;  2UU9 L;  1DM0 B;  4JI2 H;  2XC9 A;  3GV7 B;  2DY7 A;  2VOB A;  4X64 H;  2F0E A;  4A4I A;  2C28 A;  4O3N A;  3QG1 A;  3B6Y A;  5IP9 G;  3RFC A;  3A0J A;  4MNO A;  3BAA A;  5LYJ F;  4FVM A;  1JJG A;  3RBE A;  4IAL A;  4EQO A;  3SK5 A;  3KBX A;  2NVX A;  4E4T A;  2IX3 A;  1SE8 A;  5A2Q E;  1E4E B;  4KN7 C;  1HR0 W;  5EPJ A;  1L1O B;  2W6P A;  4RGN A;  1QVF A;  5FPO A;  2C2E A;  1SYE A;  4NXN H;  3BVM A;  3NTI A;  3BG5 A;  4XXE A;  3UE0 A;  2UXC L;  4MTD A;  4JI3 H;  2J6U A;  2KEC A;  3STB C;  3BJY A;  1Q7Y C;  2W71 A;  3ICE A;  3CPF A;  1T94 A;  1XNR Q;  4LMQ D; 
#chains in the Genus database with same CATH homology
 2NN6 G;  2D0O A;  2UUC L;  3FP9 A;  4KLK A;  1YHQ A;  4JYA Q;  4JOI C;  2UUA L;  4BBS H;  3GTJ H;  4JBW A;  1L2F A;  1EOV A;  1K3R A;  1VQ7 A;  3I4M G;  2WP8 J;  4QIW E;  4R4C A;  4EQ5 A;  4IO9 A;  4B3T L;  3MXN B;  2LXK A;  1EWI A;  1VQ8 A;  1BBW A;  4DR3 L;  2D0P A;  1YVC A;  2DUD A;  2Z6K C;  5IY0 A;  2ATW A;  2EQS A;  4LF9 Q;  4LUO A;  5IWA Q;  1Y1V G;  5FLM G;  3G6E A;  4JBM A;  4YHH L;  3RR5 A;  4BBR G;  3TRZ A;  5IYD H;  5JJK A;  3JAM i;  3CQZ H;  1PH8 A;  2WB1 E;  2VUM H;  4OXP A;  4BA2 I;  4X66 L;  3M3Y H;  3HKZ G;  2CKZ B;  2UU9 Q;  4IJH A;  1HZB A;  3FHW A;  1VQ5 A;  2CWP A;  2FXQ A;  1OXS C;  3RLF A;  3U58 A;  2PQA A;  1X3E A;  1PH6 A;  3M4Q A;  2JA7 H;  4DR2 L;  2ZTD A;  2I5H A;  3TS2 A;  5JJI A;  1X55 A;  4IPD A;  1KQS A;  4DV0 L;  3E9H A;  5IE8 A;  4DV4 Q;  4DV5 L;  4AQY L;  1Q82 C;  4OWW B;  1LYL A;  1A62 A;  4O2D A;  4DV7 L;  4NB3 A;  1S40 A;  5LMU Q;  1L1O A;  3PO2 H;  1JT8 A;  4QGU A;  2NZO A;  4DR4 L;  1YZ6 A;  1CKN B;  1UE7 A;  4DV3 Q;  4JI6 Q;  4LFB L;  3KDF B;  4YWK A;  3PIO A;  4DR5 L;  2UXC Q;  1G51 A;  3CXC A;  5AJ3 L;  3HOV G;  4C3I H;  4JCV E;  1IYJ B;  1YJN A;  1DGS A;  2PNH A;  2H5X A;  3RZD H;  2UUC Q;  1TWA H;  4JI8 L;  3CCQ A;  4HID A;  2UUA Q;  3ZJY C;  3HOZ G;  1KIX A;  4LF4 L;  5IP7 H;  1UEB A;  4YCU A;  4YY3 L;  5FLX c;  2PI2 E;  2NVQ H;  2K52 A;  4YCV A;  1OXV A;  3RLN A;  1XPU A;  4EX5 A;  1WFQ A;  3NEN A;  2E8G A;  4DR3 Q;  3KJP A;  1GKH A;  1TWC H;  1QZG A;  1PFS A;  3U4Z A;  4LNQ A;  4WJ3 M;  1BBU A;  4IFD I;  1YHB A;  4NPS A;  4A3C G;  5C4X G;  4YHH Q;  3JAM c;  4KI0 A;  1OXX K;  1VQ6 A;  4RMF A;  4HJ7 A;  3TEH B;  1YJW A;  4J15 A;  4X65 L;  1K73 C;  4A3K G;  1N36 L;  5M3M H;  4X66 Q;  2NVX H;  4A3I G;  2YTX A;  3S16 H;  4OO1 G;  1X65 A;  3I4O A;  1N34 L;  3JC6 6;  1VQN A;  2CQO A;  5K36 G;  1WCM G;  1OXU A;  2R93 H;  1QVC A;  3GTO H;  2NVT H;  4A75 A;  1KXL A;  4DR2 Q;  1K0R A;  2ZM6 L;  1VS0 A;  1Q81 C;  2HQL A;  2R7Z G;  1YHA A;  4L5R C;  2VY3 A;  4HIK A;  1YIT A;  2E2I H;  4DV0 Q;  4DV5 Q;  3CCJ A;  3H3V H;  4B3S L;  2IHE A;  1VQD A;  4DV7 Q;  2UUB L;  4DR1 L;  3LGJ A;  4XIG S;  4DR4 Q;  3PF5 A;  3DM3 A;  3Q8D A;  1VQJ A;  3DLL A;  4GOP C;  1JE5 A;  2KCM A;  1X3F A;  4DNI A;  3KFU A;  4DR5 Q;  1CKN A;  1HZA A;  3K8A A;  3KF6 A;  2JA6 G;  2K4K A;  3KDF A;  3ULP A;  1UE6 A;  3NEM A;  1QUQ A;  5AJ3 Q;  3FKI G;  3M85 A;  2Z6K A;  4LF7 L;  3D0F A;  2PQA B;  1GO3 E;  3NBH B;  5ELN A;  2AWO A;  1FL0 A;  2AWN A;  1T9H A;  3HOX H;  4JI8 Q;  1HNX L;  1R9T H;  2JEB I;  4A3F H;  4GN5 A;  4LF4 Q;  1GD7 A;  1HNZ L;  3BJU A;  4YY3 Q;  1XPO A;  1SRO A;  1Z47 A;  4DK6 C;  4A3M H;  3OYY A;  4YWM A;  1EYG A;  1WYD A;  3CC4 A;  4UP9 A;  1RL2 A;  4LFC L;  4YCW A;  4DUZ L;  1JB7 A;  1JMC A;  1PH3 A;  2OWO A;  4HJ8 A;  1HR0 L;  2WAQ G;  3RN5 A;  3CPW A;  3OW2 A;  4BBS G;  1I5F A;  1PYB A;  3K81 C;  4JI0 L;  4AYB G;  1VQL A;  5HY6 A;  2ZJP A;  3CC2 A;  2B63 H;  3G48 A;  3PV0 A;  3VDY A;  3I7F A;  4NXM L;  1N32 L;  4LFA L;  4X65 Q;  3CF5 A;  3HFZ B;  1KRS A;  3IRB A;  1N36 Q;  4B3M L;  2Q2H A;  4K0K L;  1UE1 A;  1PH2 A;  2F4V L;  4KHP L;  4A3E H;  5GAG C;  2WAQ E;  1S72 A;  3EN2 A;  2MO1 A;  1YI2 A;  4AYB E;  1N34 Q;  5IYD G;  3S2D H;  4KHZ A;  1E22 A;  1JJ2 A;  4LUV A;  2ZM6 Q;  2E5L L;  4A3B H;  4POG A;  3GO5 A;  1Q1E A;  4PMW A;  4DAY B;  1TXY A;  4B3S Q;  4JG2 A;  4DKA C;  3W1B A;  5GAE C;  1UE5 A;  2JA7 G;  2UUB Q;  4A3G H;  2ZTE A;  4DR1 Q;  1YIJ A;  3S1N H;  2WFW A;  3UE1 A;  4C2M H;  4PZ6 A;  4A76 A;  1YJ9 A;  1QZH A;  4JI2 L;  5E7N A;  3PUY A;  4DK3 C;  3J80 i;  2K5H A;  2MO0 A;  4X64 L;  1I94 L;  5LMN W;  4HJ5 A;  4LF7 Q;  5C0X I;  5JEA G;  3ULL A;  2GVB A;  2JK8 A;  1EIY B;  1HNX Q;  4ME3 A;  2AKW B;  3PO3 H;  3WWV A;  5M3F H;  2UXB L;  3H3V I;  3I4N H;  4R4Q A;  1HNZ Q;  2Q2I A;  3HKZ E;  3TQY A;  4GN4 B;  2R92 H;  2OTJ A;  4IPG A;  4JI4 L;  1GVP A;  4LFC Q;  3PF4 A;  2PMZ E;  4GNX C;  3GTM H;  4NXN L;  1HR0 Q;  1Q46 A;  1Y14 B;  5M5W H;  1C7Y A;  3UDX A;  4JI0 Q;  5IP7 G;  1VQG A;  4BY1 H;  4X62 L;  4NXM Q;  3KF6 B;  4JI3 L;  4DR7 L;  3PUV A;  1N32 Q;  4LFA Q;  2K5N A;  1QUQ B;  4DV1 L;  4B3M Q;  4K0K Q;  4GLV B;  2F4V Q;  2V1C C;  4KHP Q;  3HOY H;  2Y0S G;  3F2C A;  3U4V A;  1K9M C;  3K7A H;  3F8T A;  1Q1B A;  3UDF A;  2LXJ A;  3T1Y Q;  2F52 A;  1MKH A;  3E9I A;  3GTQ H;  3S14 H;  2KHI A;  4IJL A;  2UXD L;  3PUW A;  1Q86 C;  5H1S E;  2N49 A;  5M3M G;  3CCM A;  2E5L Q;  1OXT A;  4B3T Q;  1N9W A;  1X3G A;  3PSI A;  5GAD C;  1Z9F A;  2ALY B;  3KF8 B;  4DV2 L;  1KD1 C;  2JA8 G;  3W1G A;  1EQQ A;  2VQE L;  1K8G A;  2R93 G;  4YWL A;  4TVA B;  1OTC A;  2VZA A;  1VCI A;  2QGQ A;  5C0X G;  1SFO H;  3HOU H;  4BXX H;  2RHS B;  2QEX A;  1SRU A;  1MJC A;  3BZK A;  4JI1 L;  5IYB H;  1X56 A;  1WI5 A;  4LF8 L;  4JI2 Q;  3J80 c;  1XJV A;  2LSS A;  5FJ8 H;  4X64 Q;  1I94 Q;  3GTK H;  4A93 H;  2JA5 H;  4IPH A;  2NVY H;  1I50 H;  5IYC H;  3OTO L;  2ES2 A;  1NE3 A;  1A63 A;  1G29 1;  4A3L G;  4HIO A;  1FJG L;  3D31 A;  4IPC A;  1PH7 A;  2JE6 I;  1E3P A;  2VL6 A;  3AFP A;  2ZJR A;  2VQF L;  2UXB Q;  2C35 B;  3ERS X;  1NMF A;  5DLQ E;  4OWT B;  1D7Q A;  4A3J H;  1C0A A;  4UP7 A;  1U5K A;  4JI4 Q;  4AQY Q;  3H0G H;  1U0L A;  4P72 A;  4R4O A;  3HOX G;  3BZC A;  2ASB A;  3PIP A;  1BKB A;  4NXN Q;  1P16 A;  5M5Y H;  4A3F G;  3S1Q H;  2K5V A;  4JOI A;  1J6Q A;  4OWX B;  1SLJ A;  4A3M G;  4HIM A;  4XTC S;  2L15 A;  4X62 Q;  1E1O A;  1KAW A;  1UWV A;  1ASZ A;  1W3S A;  4JI3 Q;  4LUZ A;  1NBW A;  5GQO A;  4DR7 Q;  1O7I A;  4DV1 Q;  3I56 A;  3A5Z B;  3HOW H;  1CKM A;  1L1O C;  3KJO A;  3GDE A;  1VQH A;  4R1J A;  1KRT A;  5HGQ A;  4IOC A;  3M4P A;  4L5T A;  2MQH A;  2B63 G;  4LF5 L;  2K14 A;  4A3C H;  3AFQ A;  3CCL A;  2UXD Q;  4IFD G;  1D8L A;  3KYH C;  1EIF A;  5C3E H;  4R4T A;  4A3E G;  2NN6 I;  2YYZ A;  1VQB A;  2XGT A;  1IBL L;  1EUJ A;  2N3S A;  4DV2 Q;  1W2B A;  3CMA A;  2VQE Q;  3U50 C;  3I55 A;  1PVO A;  4OX9 L;  1KHI A;  3L0O A;  1GM5 A;  1CSQ A;  4A3D H;  4R4I A;  1TWF H;  2GN5 A;  5C44 H;  4A3B G;  4JV5 L;  3W5O A;  1HH2 P;  3PUZ A;  2I5M X;  4JI1 Q;  3NEL A;  1C9O A;  1E7Z A;  3T1H L;  3J7Z C;  2B29 A;  3M7N A;  2PI2 A;  4LF8 Q;  1VQK A;  4L5Q A;  4JI5 L;  4P73 A;  2NZH A;  5IT9 c;  2MNA A;  2F3I A;  1B8A A;  1VQF A;  2HIX A;  1AH9 A;  4QL5 A;  4O0A A;  3OTO Q;  3KOJ A;  3A74 A;  2VS1 A;  3CP0 A;  3S15 H;  1I6H H;  1VQP A;  1L0W A;  1KL9 A;  1FJG Q;  3RZO H;  2VUM G;  5BR8 L;  1X6O A;  1VQE A;  3F2D A;  5C4J H;  4TQU S;  2VQF Q;  2IX0 A;  4DV6 L;  4HJA A;  4BY7 H;  3M9B A;  2JA9 A;  3J81 i;  3S2H H;  1CUK A;  4OON A;  1RIP A;  4Y7N H;  3TS0 A;  3CCS A;  4JC0 A;  3PO3 G;  5M3F G;  5IP9 H;  2IT1 A;  2QA4 A;  4JI6 L;  1HZ9 A;  4X6A H;  1X54 A;  1NJI C;  2Q2U A;  2R92 G;  1XMO L;  3S17 H;  1P8L A;  4POF A;  4DAM A;  1WJJ A;  3CCE A;  1QVG A;  1PH1 A;  1PH4 A;  1N33 L;  5JEA J;  3RNU A;  1XMQ L;  3PO2 G;  1PHJ A;  3K7U C;  2IY5 B;  2A19 A;  2RF4 A;  5LMN L;  2HHH L;  3PGZ A;  1NY4 A;  4BY1 G;  1S3O A;  2ZTC A;  4C3H H;  4LF5 Q;  1VQI A;  1V9P A;  1Y1W H;  3SGI A;  1PH5 A;  2WB1 G;  2DGY A;  1K83 H;  3HOY G;  2CFM A;  2OQ0 A;  1SR3 A;  2RCN A;  4BA1 I;  1PV4 A;  1V43 A;  1IBL Q;  1V1Q A;  4DUZ Q;  4DR6 L;  2MFI A;  3PUX A;  2KCT A;  3K0X A;  1B70 B;  1CKO A;  3L2P A;  4LWC A;  5EAY A;  3I2Z A;  4OX9 Q;  1IBM L;  2GVA A;  2YTV A;  2XTI A;  2YTY A;  4JV5 Q;  3I4M H;  3T1H Q;  3L7Z C;  1YNX A;  2CCZ A;  1E1T A;  2ID0 A;  2Z0S A;  3CW2 C;  4P71 A;  4JI5 Q;  3J81 j;  3RLO A;  2OQK A;  4AIM A;  2VNU D;  4H02 A;  4BXX G;  1PYS B;  3HOU G;  3TRE A;  2JEA I;  1Y1V H;  5FLM H;  1JJC B;  4MTN A;  5IYB G;  2I0Q A;  3ULJ A;  1IL2 A;  1NMG A;  2YU9 H;  4PG3 A;  5BR8 Q;  4BBR H;  4OO1 I;  1Q8K A;  4GOP A;  1SN8 A;  3J81 c;  4HJ9 A;  5FJ8 G;  5GRO A;  3EIV A;  4DV6 Q;  2KEN A;  1IBK L;  2N8N A;  2Y0S E;  3CAM A;  2JA5 G;  4A93 G;  1TWH H;  5IYC G;  2KBN A;  5ELO A;  3CCV A;  1KC8 C;  4IOA A;  5C0X J;  2Q2T A;  4RG1 A;  1AE2 A;  3F1Z A;  1PH9 A;  3S1R H;  5JJL A;  4MZ9 A;  2KHJ A;  4P74 A;  1LUZ A;  1IXR A;  2JQO A;  4A3J G;  1BVS A;  4LF6 L;  3CC7 A;  3STB D;  1VQA A;  2OTL A;  3H0G G;  3CCU A;  1XMO Q;  4GLA C;  2HT1 A;  1HNW Q;  4GNX B;  1N33 Q;  2BA0 A;  4JBK A;  1Q12 A;  3PCO B;  4JI7 L;  3KLW A;  2N78 A;  1XMQ Q;  3UDI A;  1FVI A;  4QJF A;  1B7Y B;  5LMN Q;  2HHH Q;  2HIV A;  1HZC A;  4DPG A;  4B3R L;  4GKJ L;  1MJE A;  4GS3 A;  2R7F A;  4LFB Q;  4QQB X;  4Y52 H;  1J5E L;  4P75 A;  3HOW G;  1LTL A;  3MEF A;  3HOV H;  2D62 A;  1PA6 A;  1XNQ L;  2BH2 A;  1G6P A;  4LW1 A;  1VQC A;  4DR6 Q;  3E0E A;  2JJQ A;  1MIU A;  4GN3 B;  1HNW L;  3GD7 A;  4DUY L;  2K75 A;  5C3E G;  1IBM Q;  1VQ9 A;  3HOZ H;  3HKS A;  3CME A;  2CWA A;  4WJ4 A;  2R7D A;  3GTL H;  1XPR A;  3GTP H;  2RHQ B;  4PZ7 A;  1XNR L;  2JA8 H;  4GKK L;  1HJP A;  1AE3 A;  4JYA L;  5J3B A;  4AH6 A;  3H15 A;  1VQM A;  4A3D G;  2E2H H;  4FDB A;  5C44 G;  4UPA A;  4IFD J;  1IZ6 A;  3CCR A;  1A8V A;  3G4S A;  1CSP A;  5C4X H;  2VW9 A;  3F2B A;  2I5L X;  2AMC B;  3J7A 5;  2OCE A;  2ZJQ A;  1ASY A;  3G71 A;  4A3K H;  4QY7 A;  4A3I H;  1IBK Q;  1FGU A;  4L5S A;  1EQR A;  4LF9 L;  2IHF A;  5IWA L;  2AHO B;  3A5U A;  3AEV A;  1X9N A;  1WCM H;  2EXD A;  1NTG A;  4A3L H;  1YBY A;  1TWG H;  2A8V A;  1LM0 A;  1VQO A;  2R7Z H;  4BY7 G;  1SMX A;  3GTG H;  2UU9 L;  4LF6 Q;  2B3G A;  2BA1 A;  3BU2 A;  2BH8 A;  4A4I A;  4ALP A;  3UDG A;  1VQ4 A;  3B6Y A;  5IP9 G;  3AYH B;  4A3G G;  3A0J A;  4JI7 Q;  4GNX A;  2K50 A;  4JBJ A;  3AQQ A;  1WOC A;  4MNO A;  5M5X H;  1JJG A;  2A1A A;  3RN2 A;  1XTD A;  1YEZ A;  1N8R C;  5GAH C;  4GOP B;  4B3R Q;  4GKJ Q;  2EIF A;  1SE8 A;  3K80 C;  2JA6 H;  1E24 A;  4C3J H;  2R6G A;  4DV4 L;  4UP8 A;  1J5E Q;  1HR0 W;  2IX1 A;  1L1O B;  1M1K C;  3S24 A;  1M90 C;  1H95 A;  3FKI H;  1QVF A;  5LMU L;  1XNQ Q;  1A0I A;  2YV5 A;  3EBE A;  1I3Q H;  1Y1W G;  3ER0 A;  3UE0 A;  4DV3 L;  4DUY Q;  2E2J H;  3I4N G;  2UXC L;  4PZ8 A;  4APV A;  3STB C;  1Q7Y C;  3M4O H;  1EFW A;  3ICE A;  3S1M H;  3CPF A;  4UY8 C;  1K8A C;  1XNR Q;  3CD6 A;  4GLX A;  4GKK Q;  3T1Y L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...