4A3IG

Rna polymerase ii binary complex with dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3iG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3iG01
5M3FH 4AYBG 3AFPA 1J6QA 3G6EA 4A93H 4LFAQ 4GOPB 2KENA 3W1GA 5E7NA 3GTMH 4NXNL 3L7ZC 4HIKA 3ULPA 1HR0Q 1X6OA 1X65A 3NEMA 3S1MH 3HFZB 1K8GA 4GN5A 2K5VA 4PZ6A 4GKJQ 1IBLL 1LUZA 1PH5A 4LF6L 3GTLH 3PO3G 4K0KL 1S3OA 2HT1A 5HY6A 2E5LL 4B3ML 3CC4A 3A5UA 4QL5A 4POFA 4A3FH 3B6YA 1TWGH 4L5QA 1QVGA 5IE8A 3TQYA 5K36G 4LFAL 1NMGA 3IRBA 1YITA 3KLWA 4C2MH 1YHQA 4JI1L 4JBJA 1S40A 2UUBL 2LXKA 2PQAB 2JA5G 1XNQL 2NVYH 4IO9A 1VQ4A 1Y1WG 1PA6A 3AYHB 4LF5Q 2CFMA 3HOYG 5C0XG 4JI4L 1B8AA 3OTOL 2PQAA 1ASZA 2ALYB 1KL9A 3RZOH 4LF9L 3K7AH 5JJKA 1CSPA 4J15A 3CCRA 4LUZA 2E8GA 1WCMG 4X62L 5IYCH 1JMCA 1X56A 4FDBA 4EQ5A 5IP9G 4DV7L 3CCMA 1N36Q 2UUCL 1YJNA 4LF4Q 2Y0SE 4DUZQ 4DV3L 2AWNA 4JBMA 3F2DA 4JI0L 2MQHA 1L1OC 4TQUS 1PHJA 1C7YA 4A3JH 1L0WA 1VQFA 1R9TH 3CW2C 2AWOA 4HJ5A 1VQKA 4BBSH 4BXXH 5M3FG 4HJ7A 4BBSG 1N9WA 2KCTA 4JOIC 3RN2A 5C3EH 3FP9A 4DUYL 3STBC 4JI3L 3CPFA 3UDFA 2YTVA 4DAYB 4AH6A 2VQFL 1XPRA 4BY1H 4IOAA 4MZ9A 4X66L 2R93G 3EIVA 1YIJA 3S2DH 1BVSA 2ZJPA 4LFBL 1CKMA 2NN6G 1IL2A 3I4OA 3KDFB 3CCSA 1KQSA 4DV1L 1OXUA 4NXMQ 1G6PA 4LFBQ 2WAQG 1K0RA 4A3FG 3U4ZA 4PG3A 3HOZG 3PV0A 4DR1L 3S2HH 4A3IH 4X65Q 2N49A 2YYZA 1E1OA 4PZ8A 2ZJQA 4JI5Q 1KRSA 4BA2I 3CAMA 2HIXA 1HNZL 3JAMi 5JJIA 4P73A 3HOWH 3I4NH 1VQ5A 1I6HH 3F2CA 3D31A 4IPCA 5J3BA 2B29A 3ULJA 4BBRG 5LMUQ 4DV1Q 1VQBA 4JCVE 4BXXG 4O2DA 3UDIA 4P71A 2RHSB 1YHBA 2I5MX 4DR6L 1XPUA 1GO3E 1X54A 2F52A 2KBNA 4R4QA 1Q12A 2AKWB 3UDXA 3J80c 1OTCA 3H15A 1FL0A 2YU9H 4A3EG 3CC7A 1VQDA 3DLLA 1Q86C 1WCMH 4IFDJ 1WFQA 1QVFA 2CQOA 3CQZH 4DR2Q 1A62A 3K0XA 3PUZA 4KHZA 1MJEA 2NZOA 2WP8J 1E3PA 1WI5A 3GDEA 3ZJYC 3M85A 1S72A 2B63H 2PI2E 5GADC 1KAWA 1HZ9A 3BZKA 4A3IG 1IZ6A 1LYLA 2A8VA 2JA7G 5IY0A 4DR5L 2JA7H 4LNQA 3I7FA 2RF4A 1YJWA 3KOJA 4YY3L 5FLMG 5IP7H 3ERSX 1N32Q 3STBD 4GS3A 5IYBH 1JE5A 5M5YH 2JEBI 1VS0A 1OXSC 3F1ZA 4X62Q 2VQEL 1IBLQ 1EIYB 1EWIA 3CP0A 2HHHQ 1V9PA 1VQIA 5C0XJ 4DR5Q 4UPAA 1YNXA 1J5EL 1SROA 4A75A 3VDYA 1D7QA 1KIXA 3JAMc 4GNXB 4A3DG 1V43A 1RIPA 3M4PA 2N3SA 2Q2HA 3E0EA 3ER0A 4C3JH 4DK3C 3CPWA 2UUBQ 4NXML 1HR0L 4DR2L 1BBWA 2QEXA 5M5XH 2HHHL 1X3GA 1TWAH 4JI0Q 2K4KA 1TWFH 5C0XI 3HKZE 3CCQA 4P74A 3I4MH 3TS2A 4DR4L 3KDFA 1CSQA 3FKIG 1PH4A 5C3EG 1C9OA 1XPOA 1K73C 1N34L 3Q8DA 2JE6I 4A3MH 4YCUA 1D8LA 4DR3Q 4JI3Q 4JI8L 4DUYQ 1HNZQ 2EIFA 2WB1G 1CKNA 1N33L 4YCWA 1G291 4LF9Q 4A3EH 1O7IA 2JA6H 4LUOA 1FJGQ 2WAQE 1JJCB 3JC66 3ULLA 4LF5L 3H0GH 1MJCA 1HNWQ 2UUCQ 1KC8C 4DR7Q 1WYDA 1E24A 3PSIA 1Q82C 4JI1Q 3PUWA 4DUZL 2AHOB 3SGIA 4DV3Q 3S17H 4DR6Q 4A3KH 1IYJB 4IJLA 4DV5Q 1VQGA 4XIGS 4LF8Q 3HKSA 2EXDA 2E2HH 5FLMH 1HJPA 3M4QA 2UUAQ 2BA1A 3CD6A 1NJIC 3A0JA 2VUMG 4GN4B 3GTQH 1Y1WH 4HJAA 1XNRL 2NVXH 4HIDA 3S24A 4JI4Q 4A3GH 2Z6KC 4JI2L 1PVOA 4DNIA 3J80i 2JK8A 4OX9L 5GAHC 2MO0A 1OXXK 2R7FA 4YWMA 1E22A 2JJQA 4H02A 1K8AC 2JA8H 1VQHA 1VQOA 2ZTDA 1X3EA 3WWVA 5IWAL 3G71A 5IYDG 2YV5A 2PI2A 2Z6KA 4WJ3M 4JC0A 3S16H 1U0LA 2HIVA 4QGUA 1Q7YC 3CCUA 3HOZH 5DLQE 2MO1A 2VS1A 5M5WH 4IOCA 4GLAC 3GO5A 1B7YB 4APVA 4LF6Q 1QUQB 3CMAA 1VQCA 1C0AA 1W3SA 1MIUA 1X55A 1UE7A 3M7NA 5JEAG 5ELOA 5M3MH 5IWAQ 2ZTEA 3HKZG 2VUMH 4WJ4A 1AE3A 1BKBA 2LSSA 4MTNA 4C3IH 5HGQA 4HJ8A 1PH2A 2NN6I 4NXNQ 2JEAI 2OQKA 1KRTA 4A3GG 1Z9FA 4DR7L 3S1RH 4A3CG 4OO1I 1JJGA 1W2BA 4ME3A 1SRUA 4Y7NH 4R4OA 3H0GG 3PO2G 3S14H 1UE5A 1OXVA 5EAYA 2IX0A 5FJ8H 5C44G 2CKZB 3KF6B 4DV0Q 2R7ZH 4GN3B 2BH2A 3CCLA 3OW2A 1EFWA 4B3SL 1B70B 3I56A 3CC2A 1LTLA 1KXLA 2YTYA 1VQLA 2C35B 2JQOA 4ALPA 2YTXA 4LW1A 4QJFA 5IP7G 3CCJA 1XMOL 1XMQQ 1IBKL 4JI2Q 4DAMA 3L2PA 1IBML 4JG2A 3PIOA 3LGJA 4YHHL 1X9NA 1SN8A 5GAEC 1JB7A 3K7UC 4DV2L 4B3SQ 4R4IA 1GKHA 4B3RL 4JOIA 4A4IA 2KCMA 4Y52H 2KHIA 5IT9c 3H3VI 4JV5L 2H5XA 2JA8G 3RLFA 1Y1VH 4R4CA 2OQ0A 3M4OH 1TXYA 4A3DH 4AQYQ 2OTJA 4NB3A 5IYCG 1UE6A 1L1OA 1G51A 2CWPA 1EQQA 4A3LG 4A3LH 4YHHQ 1QZHA 3DM3A 1KD1C 1A63A 1QVCA 3GTPH 3HOXH 2OTLA 4B3TL 1FJGL 1NY4A 4YY3Q 4JYAQ 5AJ3Q 4BBRH 1YVCA 1CKNB 2PMZE 3FKIH 3NELA 4IPDA 4L5SA 2ATWA 4YWKA 4DKAC 2IY5B 3S15H 1N34Q 4HJ9A 1HZBA 3EBEA 4LF8L 2D0PA 4DV5L 3RN5A 1PFSA 3S1QH 2A19A 4P75A 1N33Q 3NENA 5GQOA 2I5LX 3U4VA 2UXCQ 3MXNB 1YHAA 2VW9A 2R92G 1Q1EA 4PZ7A 1NBWA 3EN2A 1GM5A 2JA9A 2IHFA 2D62A 3I2ZA 3OYYA 2ZM6Q 4LUVA 2N8NA 4A3KG 4GNXA 2RCNA 4BY7H 1K83H 1HNWL 2F4VQ 2UXDL 1FVIA 1VQAA 2ID0A 3TEHB 2E2IH 2QA4A 3HOUG 5LMNW 1IXRA 1X3FA 3AFQA 3PIPA 1WJJA 1QZGA 3PCOB 1PH3A 2UU9L 4KHPQ 3T1HQ 2AMCB 3HOYH 4GKKL 3T1YL 4X6AH 2NVQH 1N32L 3KJPA 4QY7A 4LFCL 1I94L 1HNXL 1N8RC 3M3YH 1AH9A 3U58A 1AE2A 1J5EQ 1M1KC 3FHWA 3KF8B 2KHJA 4UP8A 2XTIA 1SLJA 3J81j 4UY8C 2D0OA 2I5HA 4DR4Q 1P8LA 3TS0A 4KLKA 1TWHH 3NBHB 3PUYA 2K5HA 4RMFA 3GTJH 2VQEQ 1WOCA 3HOVH 3KFUA 4OX9Q 3H3VH 1I50H 4YWLA 1NMFA 3G4SA 3RNUA 2K5NA 1TWCH 1NE3A 2IHEA 1XNRQ 1XJVA 3K8AA 4JI7Q 2Q2UA 4OWXB 3I4MG 1VQ8A 3CF5A 1PH7A 1YI2A 4P72A 2UXBQ 4GLXA 1I3QH 2CWAA 1UE1A 3BZCA 1P16A 4LF7Q 1VQ9A 3HOUH 2GN5A 1CKOA 4A93G 4BY1G 4RG1A 3TRZA 2NZHA 1YJ9A 5BR8L 4X66Q 3UE1A 2JA6G 1Q46A 2MFIA 1Q1BA 1A8VA 2ES2A 2BH8A 3T1HL 1BBUA 4JI7L 4GKKQ 3D0FA 2R92H 4OXPA 2PNHA 4POGA 4QIWE 3HOVG 4IJHA 3KYHC 5FJ8G 4JI8Q 3W5OA 5ELNA 4DR3L 1EUJA 1UEBA 3PGZA 2VY3A 2DGYA 1M90C 2GVBA 4JYAL 1H95A 4OWWB 4B3TQ 4OO1G 1Z47A 1K3RA 1SR3A 5LMUL 4JI6L 4L5RC 1Q81C 3E9HA 2GVAA 4IPHA 2UXBL 3U50C 2DUDA 2R7DA 4JI6Q 1PH9A 2Q2TA 4A3MG 4UP9A 4DPGA 2FXQA 4XTCS 4YCVA 5C4JH 3PF5A 1YEZA 4LF7L 1VQEA 1ASYA 4GKJL 3A5ZB 2F4VL 3PO2H 2EQSA 2UXDQ 1QUQA 4O0AA 2OWOA 3T1YQ 3G48A 2IT1A 2QGQA 2L15A 4HIMA 5C44H 1L2FA 2Q2IA 5IP9H 1Y14B 2B63G 1PYSB 3J81c 4DR1Q 3GTGH 1GVPA 2NVTH 2V1CC 2K50A 4MNOA 5LMNQ 2R6GA 5BR8Q 1VQPA 1RL2A 4EX5A 4A3JG 4OWTB 3HOWG 2CCZA 3I4NG 5M3MG 2JA5H 1SMXA 2E5LQ 2ZTCA 2UU9Q 4B3MQ 1HZAA 4NPSA 4DV0L 2VZAA 1YZ6A 3J7ZC 3OTOQ 4GOPC 3CMEA 3A74A 1SE8A 1PV4A 1I94Q 1HNXQ 4LFCQ 4A3CH 4X64Q 4R1JA 5GAGC 1I5FA 1L1OB 2ZM6L 2R93H 2I0QA 5AJ3L 4X65L 4QQBX 4AYBE 3F2BA 3CXCA 4DV7Q 1N36L 4R4TA 4TVAB 3PUVA 1XNQQ 4JBWA 1EIFA 2R7ZG 4IFDI 1EYGA 3BU2A 4UP7A 1YBYA 1SFOH 1U5KA 1XTDA 2B3GA 3GTOH 1JT8A 2ASBA 4KHPL 4AQYL 3RR5A 2WFWA 4JI5L 2ZJRA 4GOPA 1HZCA 2IX1A 1VCIA 5C4XH 4AIMA 2K14A 1OXTA 3M9BA 3CCVA 3UDGA 1A0IA 5GROA 4B3RQ 2HQLA 3K81C 1HH2P 1Q8KA 3I55A 5JEAJ 1Y1VG 3AQQA 4A76A 1K9MC 4A3BG 4OONA 1VQ6A 1VQ7A 3GD7A 1IBKQ 4LF4L 4K0KQ 1EQRA 5JJLA 3CCEA 1HR0W 2VQFQ 4C3HH 2LXJA 2MNAA 2BA0A 2N78A 4JBKA 1CUKA 2F3IA 3HOXG 1LM0A 4DV2Q 3L0OA 3S1NH 1MKHA 2XGTA 2VL6A 2UUAL 1E7ZA 1FGUA 1VQMA 4L5TA 2E2JH 4JV5Q 4BA1I 3K80C 4LWCA 4GNXC 1T9HA 3RZDH 4DV4L 3KJOA 3E9IA 3AEVA 3ICEA 1UWVA 5H1SE 1PH6A 3TREA 3J81i 1PH1A 1GD7A 4GLVB 2A1AA 5C4XG 1DGSA 3MEFA 1IBMQ 4DV6Q 1NTGA 4PMWA 2K75A 3F8TA 2K52A 4DV6L 1V1QA 1PH8A 3PO3H 2UXCL 4A3BH 1JJ2A 3GTKH 4IFDG 2Y0SG 1VQJA 4KI0A 3PUXA 3W1BA 4HIOA 3J7A5 4IPGA 4X64L 5IYDH 3PF4A 3BJUA 2Z0SA 1KHIA 2RHQB 3KF6A 2VNUD 1EOVA 4DK6C 2OCEA 5FLXc 4BY7G 3RLNA 3RLOA 3UE0A 2WB1E 1E1TA 1PYBA 5LMNL 5IYBG 1VQNA 4DV4Q 1XMQL 1XMOQ
chains in the Genus database with same CATH superfamily
2IWHA 4CGYB 2W70A 2Q8RE 4DNTB 2V4RA 2ZXRA 3JRXA 4BY1B 5M5YB 1ZHSA 2HCIA 2L55A 5HGTA 4PZ6A 4GKJQ 2C2DA 3H91A 3M4YA 5HY6A 3CC4A 1U4MA 4QL5A 5KT3A 2W57A 1QVGA 5IE8A 3VR4A 1TS3A 4FM9A 2ZDQA 1V1PB 3JAME 2GPSA 3ZYYX 2K1BA 2LXKA 2NUCA 2PQAB 2JA5G 4OEMB 4RKBA 2PQAA 1I6VC 2ALYB 1KL9A 2KQ3A 4A3JB 1J5EH 2MJ8A 3U9SA 1BNCA 4ZLTF 3HGBA 4LUZA 2WDTA 1UC8A 5CB4F 2E8GA 1U9RA 3MHBA 4OHJA 2W71A 2A6HD 1N36Q 4F8MA 3CCMA 1WTRA 3T5LA 2KOLA 3QJYA 4DA2A 4KKUA 2Y0SE 4ZYSA 4IR1A 4RAZA 2R61A 5DAUA 3U9TA 3F2DA 1E2ZA 4Q5VA 2MQHA 1PHJA 1QWYA 4K2KA 1DOLA 1Y1WA 4NP5A 4BXXH 5M3FG 5KFHA 5C3EH 3I91A 3TZUA 2VQFL 2L1BA 1XPRA 4IOAA 4X66L 4ED0A 1BVSA 2ZJPA 4EGQA 1T36A 1IL2A 2DPIA 1O7ZA 3CCSA 1SDFA 4HR7A 2H1EA 4KKSA 3HS0C 3K6OA 4X65Q 2N49A 2YYAA 4BA2I 1VDZA 4X3SA 1PZID 2PVPA 5KFIA 3M9NB 1HNZL 3JAMi 3BDLA 1VQ5A 3R5HA 2F0FA 4L63B 3F2CA 4YBZB 3D31A 5BN5A 5J3BA 3ULJA 4RGMA 4BBRG 4DV1Q 4DGZA 4N8X1 4B9WA 1CE8A 3MXPA 4PV1C 3NP8A 2HVRA 4MV4A 5IT9E 1TKWB 2BCOA 1VQDA 3DLLA 3CC7A 2E2HB 4IFDJ 1F2LA 5IIFA 5KFEA 2E76C 3J7AV 1A62A 3K0XA 1MJEA 1J8IA 3GDEA 4ODGA 3ZJYC 5CV8A 3DMUA 1KEEA 1KAWA 1HZ9A 2O5JC 1RTNA 2A8VA 2W6OA 5IY0A 4LH6A 4DR5L 2L11A 2JA7H 3WNZA 2AGPA 4FF4A 2NU6B 3R3OA 2FLPA 2C00A 3D8GA 3T1HH 2C22A 1T5XD 2M00A 3NE5B 1JE5A 4GS3A 2JEBI 5M5YH 1OXSC 4X62Q 5LXTF 2EYOA 4F4YA 1U4RA 4O4LF 1HUNA 1EIYB 1IW7D 1E4GT 1E4EA 4F4ZA 4ECWA 4IUPA 4DR5Q 2Z6BA 3SE7A 4UPAA 2JYOA 3NSWA 5ELEA 3BA9A 1WD1A 1SROA 5D3IB 3VDYA 1D7QA 3JAMc 3TINA 3KLRA 2X6LA 1C30A 3KHRA 3H4DA 4Q8FA 4C3JH 2UUBQ 3OMCA 2XIGA 1B33N 1BBWA 5KG6A 2QW7A 1N48A 4BBRB 3VYTA 2W7PA 4JI0Q 5DGAA 5LMNH 1PTOB 4HR7B 3MWEA 3I4MH 2WACA 3FKIG 5JVLA 1PFNA 5DG8A 3D6CA 4TSSA 2FK3A 4KHPH 4YP3A 1Q8IA 4JI3Q 4JI5H 1EY5A 3FDSA 1HNZQ 2WB1G 1N33L 2F0OA 3CKIB 1ICWA 3TQ1A 2JA6H 2KSWA 4B3TH 1STBA 1I50B 1Y1WB 3ULLA 3JC66 4O3QA 1HNWQ 1GUTA 1MJCA 2NTTA 2R7KA 1HTPA 2EYMA 3TSSA 3VA7A 4Q43A 5H80A 4BBSB 2JA6A 4HMJA 3AMUA 5FLMH 1ILQA 4F4WA 4Q0YA 1LO5D 2BA1A 5KFJA 1NUCA 1KJ9A 4ZOLF 4X62H 1Y1WH 4KHVA 4BWGB 4JI2L 5KNBA 3FMAA 3E5NA 2ZXOA 5GAHC 5DM73 4CDFC 1HNZH 1EU4A 1G2TA 3HKZA 3M4OB 2R7FA 4YWMA 1HCZA 4IQZA 3TN2A 1K8AC 2B63B 1VQOA 3G71A 1LT4D 1IOWA 2YV5A 2PI2A 1UC9A 4DU9A 3HOZH 2OH2A 1Q7YC 3I90A 3GP7A 2MO1A 3KHGA 1ML0D 4CDEC 3MVVA 2UXCH 3PR4A 4JI7H 4LF6Q 1SYCA 4YIJA 4CC6A 4PMBA 3M7NA 1AUXA 3GIPA 1BKBA 4C3IH 3TZDA 1ZKOA 3K7AB 2G9DA 4DR5H 1W2BA 3K0YA 1QJOA 2F0WA 2J6SA 2IP4A 4R4OA 5J2TF 4DXFA 3PO2G 1UEAB 3TQTA 2R87A 3EVQA 5EAYA 5KFXA 3H0GB 2KHSA 1G2SA 1Y8NB 2BE5D 4PQXA 2MGSA 2PMZB 2K33A 4A93B 2YZMA 3GTMB 2YTYA 4I50F 1Q90A 3H09A 4CKCA 4QJFA 4LW1A 3CCJA 1GSHA 3NK9A 5KFVA 2KVMA 3QO2A 1XMOL 4ED8A 2FLNA 4DAMA 2YRXA 4J0MA 3K7UC 5LA6F 3R2TA 2CQAA 4DV2L 1SNCA 2KECA 4R4IA 4JOIA 4A4IA 2KCMA 1A15A 2DZDA 3H3VI 4IR9A 2H5XA 2JA8G 1FKAH 3RLFA 4YY3H 3GTPB 1GJXA 2OTJA 5JJZA 5DLGA 1VF5C 1SE4A 4NB3A 4UCRA 1I4GA 1G51A 2CWPA 2K32A 5LYJF 1M7JA 5CORA 4ECSA 3E0JA 1Y1VA 2OTLA 4MV7A 2F0UA 5KG2A 1RJQA 2HQEA 1TU2B 1A9XA 3ND9A 3C46A 1YVCA 4DV7H 2F1MA 1M8AA 2ATWA 5GONF 4NXNH 1N34Q 4HJ9A 1SNDA 1S4ZA 4ECXA 1PFSA 1TS2A 1BQQT 3NENA 3SXHA 2R92B 4TQRA 2I5LX 3U4VA 4RGNA 1YHAA 2YRWA 2E75C 4QW9A 4JI1H 3BDOA 2W9BB 1NBWA 4ECYA 1DONA 3EYYA 5LOVF 2D62A 1H9JA 2JEGA 1CZGA 2K28A 2ZM6Q 1CA5A 5L1IA 3OSPA 4K5XA 3G6JB 3NXWA 1K83H 4CKEA 2RGRA 1GYFA 2ID0A 3TEHB 3HOUG 1RJPA 4MV1A 3S1RB 2WTFA 2PZWA 1N32L 4QY7A 2B8GA 3EQLC 1N8RC 1SFOA 4LJZC 1AH9A 3U58A 1J5EQ 4R8UA 4EGVA 2XTIA 1BOSA 4UY8C 4FXGC 2D5DA 1P8LA 3TS0A 1TWHH 3GTJH 3HOVH 3KFUA 4O4IF 1SMYD 4A3DB 3M4IA 4K5VA 5TSSA 2K5NA 2IHEA 1SYDA 3P1HA 1XNRQ 2O5IC 1K1QA 4JI7Q 5KFZA 1QNKA 2E2HA 2UXBQ 3BZCA 1P16A 2W9CB 1K83B 4NLGA 3I72A 5C4JB 5KG1A 4DR3H 3MA2B 1D6EC 2A5HA 1YJ9A 4X66Q 1I4QA 2NYZD 5KFSA 5EJWA 1LT5D 2ES2A 2BH8A 4IUQA 2EYHA 3Q0AA 5DNFA 1OO9B 4JI8Q 3VR5A 3W5OA 1PK8A 3T51B 1UEBA 4C3HG 3PGZA 2WKDA 5F9LA 1MI2A 5KG5A 2GVBA 3MWMA 4OO1H 1H95A 4JV0A 3GV6A 3Q2OA 1FJGH 5E4XA 3SK8A 1Z47A 4XQQA 1QB5D 4JI6L 4L5RC 3H3VC 4EBEA 1JWUD 3RD4A 2UXBL 3JSNA 2BQRA 2DUDA 4JV2A 3RB6A 1JE4A 2VXWA 1CQIB 1N34H 3OPOA 5CMDA 4J9RA 3IAYA 3QR8A 3RB3A 1IL8A 3RAQA 3NPPA 4IN3A 1QILA 4GKJL 2UXDQ 1KJQA 1HRJA 4KV6A 5J39A 2OWOA 1RYRA 2QGQA 1C48A 2L15A 2PBZA 3DUZA 1G8ZD 4ZHQF 2DWCA 1PYSB 5HBRB 4DR1Q 4RU9A 1GVPA 5JAVA 3T5HA 4OL7A 1ZQ7A 2R6GA 2IPKD 1VQPA 4A3JG 1FNWA 3VYSA 3HOWG 3I4NG 5M3MG 1I7LA 2R6FA 3RGZA 1STGA 1Y1VB 4XYLB 2EJGC 3J80E 1PV4A 4RUCA 4A3CH 3SDZA 2KEEA 1NR4A 2B39A 4C3IB 1JCKB 2ZM6L 1SYFA 5AJ3L 2JP1A 4GKJH 1V1PA 3GTPA 2W6MA 1XWEA 4R4TA 4G4KA 4OIKA 3VPCA 2G5DA 4J9QA 1XNQH 5KYIA 2R7ZG 4R8IA 1E2VA 4UP7A 1YBYA 3Q23A 3OOCA 4JK1C 4H44C 4RZQA 3GIQA 2PQEA 1XTDA 3N44B 2B3GA 2ASJA 3GTOH 2B2TA 3GTMA 4LF5H 3BS1A 2PMZA 5KYLA 5IOCA 5LL6b 3M9BA 1STYA 4A3BB 3UDGA 1A0IA 5GROA 4XXEA 2RSNA 5D14A 1VQ6A 4KJNA 1VQ7A 4EQOA 4LF4L 1YNNC 1HR0W 4FYDA 2P0AA 2LXJA 2M2LA 2BA0A 2N78A 5KT5A 4FNFA 2F3IA 4DV2Q 4LMQD 1CZWA 3GV3A 3L0OA 4IUUA 4U68A 1MKHA 3V05A 2UUAL 4J8QA 2FINB 4ZUJA 3K80C 4GNXC 2DN8A 1FGBD 4DV4L 3Q6SA 3AEVA 3E9IA 1H9SB 3C1EA 5H1SE 3ICEA 1AW7A 3TREA 5FK9C 3J81i 2JEIA 4GC7A 2YU9A 3I4LA 4YHHH 4KD3A 1RHPA 2K52A 1PH8A 4IRCA 4ZI7F 4ECVA 1STHA 2UXCL 1PYWD 1DCZA 1TWGB 1JJ2A 5CBAE 4KI0A 4K0KH 3PUXA 1CHPD 4X64L 1G6ZA 1SNOA 4UAIA 3PF4A 2K6AA 1KHIA 2Z0SA 4XT1B 5KFOA 5DGBA 1KLGD 2C9OA 4C56C 3KF6A 4N9PA 1GGOA 3DM1A 1GUGA 1XMQH 4ECUA 1ZEQX 3K5MA 2PCFB 2FMAA 1E1TA 5LMNL 4DK1A 5M5WB 5IYBG 3NWSA 1LACA 1XMQL 4E6IA 3HG9A 4AYBG 5M3FH 3G6EA 1DIKA 4LFAQ 3R8BA 1O7YA 1JDEA 2KENA 3GTMH 2JEJA 2JA6B 4J9SA 1BXRA 4HIKA 1TR5A 2XNAC 1HR0Q 5I9PA 4DL7A 3NEMA 3S1MH 3HFZB 5FD6A 1PDQA 4K8IA 1K8GA 2K5VA 3Q22A 2I8CA 2VUMA 1LUZA 3V2TA 4LF6L 3BG5A 4K0KL 1WTQA 2HT1A 3D4RA 3A5UA 4L5QA 1AFPA 1W6KA 3TQYA 1S10A 4DV5H 5K36G 4LFAL 1NMGA 4ID6A 2XRQD 3FPPA 1YITA 5KFGA 5EGTA 3CQZA 3KLWA 4C2MH 5KT6A 3I70A 2K03A 1SE3A 3N41B 1AUVA 1S40A 5CV5A 1XNQL 4R8NA 1CT1D 4IO9A 2UU9H 1Y1WG 1EQVA 1PA6A 3TIIA 3PN1A 5C0XG 4FS2A 2VUGA 2PW7A 3C0FB 2RDGA 2EDGA 3G7LA 3R23A 3JAMW 3GTQA 2VOBA 2WE6A 1WCMG 2E2HH 5IYCH 1X56A 4FDBA 4DXGA 1YJNA 3N40P 1C3OA 4F50A 4JBMA 5JOBA 2XD4A 4FXKC 2Z4IA 4JI0L 1C7YA 1UNNC 1R9TH 2RDHA 3CW2C 4HJ5A 1VQKA 1JICA 2YW2A 4HJ7A 2PZUA 2W6QA 1JKJB 4JI3L 4ABNA 2YTVA 4ECQA 4MZ9A 4YAJB 3S17B 5BR8H 3S2DH 2ATLA 1CKMA 2NN6G 2HD3A 1WTXA 2NVXB 2A69C 1JLLB 4ED2A 1KQSA 3OIPA 1WVLA 1OXUA 4WORA 2N55A 2SNMA 1OWTA 3L4JA 2LFNA 4RB0A 4PG3A 1SMYC 2FKLA 4XZ3B 3S2HH 1JQYD 1E1OA 2YYZA 1LLRD 3W3AA 4P73A 3HOWH 3I4NH 1TWCA 1I6HH 1GUWA 4IPCA 4KY5A 2B29A 4ZQ3A 1X3PA 5E4WC 5LMUQ 4JCVE 3I4MB 4AQYH 2RHSB 4DR6L 1GO3E 2DJFC 2J4XA 3H15A 4LSXA 4IHJF 3SI8A 2B2UC 4RCNA 1WCMH 1QVFA 1M0WA 2CQOA 1X3QA 1TQOA 2CH4W 2QKIC 5EWFA 4ECZA 2XCAA 1E3PA 1WI5A 3BQ2A 1S72A 4PMCA 5M3MB 2PI2E 5GADC 3IN5A 3GTJB 3HOVB 1R9TA 2L12A 2JA7G 1PRTD 2F0LA 5KFYA 2FFKB 3I7FA 5I2YA 3RB0A 3BABA 3KOJA 2J9GA 3S1MB 1IBLL 2W6NA 1VS0A 2E2IB 3NWTA 3ORRA 3RBEA 3FRPB 4LFAH 2KA7A 4O3RA 3GIDA 1V9PA 1VQIA 4KJOA 3TMEA 4U6PA 1EZ1A 2NVYB 5FO8B 3W2DA 3CPWA 4MV9A 4DR2L 2VQEH 3HRZC 2LMCB 5C1PA 3QOJA 4Q8EA 3RV4A 1L2ZA 5NUCA 4RNNA 2CW7A 5I6WA 3N42B 1UNSA 3TS2A 1PFMA 4P74A 2UXDH 5C3EG 1C9OA 4G3IA 1K73C 1SEBD 1HR0H 4YCUA 1D8LA 3URYA 4JI8L 1TWFB 2EIFA 5KG7A 2BQUA 4YCWA 1G291 4A3EH 1WTOA 4F87A 1D5ZC 3PIO3 5ISRA 1IHZA 2WAQE 1FJGQ 1EIHA 3N8DA 1JJCB 4O3SA 3H0GH 5KT4A 3J7AK 4O2BF 1WYDA 2MP1A 4TRDA 1EUDB 2FB9A 2F0PA 2TSSA 3RJ0A 5BN3A 3S17H 1BCPD 4A3KH 4DV5Q 1AP0A 4XIGS 4LF8Q 4J9KA 3HKSA 3LNNA 2HJWA 1VMPA 3M4QA 1PX2A 4KMUC 2B2WA 2EXZA 3CD6A 1IW7C 1IYVA 1CQFA 4HJAA 3A8IE 1XNRL 2NVXH 4HIDA 4O4HF 4L8JA 3RB4A 1TS4A 1ONLA 5D3DA 1RF2D 4JPBW 4J9LA 2MO0A 3V4SA 1HUMA 2EPBA 1VMCA 1S5ED 1I6UA 1E22A 4H02A 4A2BA 1TVXA 2AQ4A 1KDCA 2ZTDA 5KGUA 5IWAL 3D6WA 1K1SA 1S5FD 2H4OA 2B2YA 1TY0A 2Z6KA 4WJ3M 1BXTA 3S16H 1N32Q 2YS6A 4MV3A 3CCUA 2OXPA 5DLQE 4GLAC 3FDTA 5L9XA 3KTMA 4XQNA 2B2WC 3MTSA 3KHHA 3V96A 1UE7A 2RQXA 4RWSC 3PW7A 4BWSC 4FXDA 3WDNA 4FF3A 4QB4A 4X3UA 5KFRA 4K6LA 5ELCA 2JEAI 4A3GG 5A2QL 1Z9FA 2B8FA 1RYSA 3KAJA 1SJED 1SRUA 2KEDA 2X6GA 1UE5A 2D9UA 4G7OC 4LFBH 2ZJTA 5FJ8H 4RCOA 5C44G 2CKZB 1KJ8A 3BQ0A 4QWEA 1EFWA 2BQ3A 4B3SL 3NTHA 1A2UA 1LTLA 3CC2A 2JQOA 4ALPA 4ULLA 2W9AA 2RBMA 4O3NA 2K01A 4JG2A 2SOBA 5GAEC 1AZQA 4KKTA 4B3SQ 4B3RL 2KHIA 2BR0A 4JV5L 4R4CA 4A3DH 3M4OH 1XXGA 5IYCG 3R93A 1L1OA 1EQQA 2XCPA 4A3LG 3BDCA 4YR3A 2B2VC 1QZHA 1IBMH 1RK5A 2PNRC 2NTSA 1DOKA 1QVCA 4X65H 4B3TL 5ELDA 4YY3Q 5C6AA 5AJ3Q 2I46A 1STNA 4R9WA 3NELA 3V4ZA 4L5SA 1PXUA 1X32A 1RCVD 4IZ8A 2IY5B 4HN7A 3RN5A 3KXYT 4QWAA 3S1QH 1D5XC 4P75A 2WB1A 3KAKA 5GQOA 5DQGA 3BVMA 3WOFA 3MXNB 4DR4H 3MR5A 4YJ2F 3K5NA 2R92G 2R7ZA 4PZ7A 4HQ6A 4QWCA 1NR2A 3GTLB 2KUMA 4UDUC 2HVSA 5K5PA 3I2ZA 5IT9W 3OYYA 4A3KG 4GNXA 2F0GA 1ZXTA 2MPMA 3Q8SB 2UXDL 1KABA 1VQAA 2CHBD 5I4DA 2E2IH 1QZGA 1X3FA 3PIPA 3V6JA 4JW0A 3NQIA 5L1KA 2AMCB 3OSOA 3GTLA 4X6AH 3KJPA 2R93A 5EDWA 1EZ6A 3KK7A 3M3YH 1GOZA 1AE2A 3FHWA 3KF8B 3PO2B 4JI0H 1D1KA 2I5HA 3SVMA 3WO0A 3I73A 2A69D 1T5EA 4ME6A 4RMFA 2VQEQ 4FP5D 1I3QA 2W7OA 3RNUA 1LV9A 1TWCH 2B2TC 1XJVA 3K5OA 4PNYA 2Q2UA 3I4MG 3P20A 1EYAA 1EYDA 3A8KE 5IGGA 2F0MA 2CWAA 4GLXA 3C1FA 4LF7Q 3HOUH 1GUOA 3RMHA 1VQ9A 5JEAH 4J9MA 3A55A 2EZVA 5L1LA 1TWHA 3K3VA 4BY1G 4IUVA 4RG1A 3GTKB 4O1NA 4J6HA 3S2HB 2V58A 2ZDGA 3M7GA 1EY9A 1XTCD 2PPBC 4JI7L 4YAKB 1XMOH 2UXBH 2R92H 4OXPA 1GHKA 4RAUC 1NNXA 3HOVG 3GILA 3X3NA 4A3KB 2UVUA 1BUVT 2F0KA 5ELNA 3VMMA 1L0XB 2FHTA 1LTTD 4CJ2C 5HURA 2VY3A 1M90C 4F4XA 1GSAA 4OWWB 4TV9F 4B3TQ 1S5DD 4AYBA 1K3RA 1ICFB 2IL8A 1Q81C 4MA0A 1PRTF 1HFNA 3P75A 4A3MG 5CGKA 1Y8OB 4XTCS 3EFXD 3RGXA 1F9SA 4DV6H 1YEZA 3OHAA 1TWAB 5C44H 1L2FA 4CJ0B 4DL5A 1AZPA 3J81c 2AQ2B 2J0TD 3D3RA 5C5MA 3KLSX 2V1CC 5IGBA 1LTBD 2K50A 3N52A 4MNOA 3R5FA 5BR8Q 1RL2A 2GA4B 4OWTB 4LF7H 1EEFD 3PW0A 1SMXA 5C4ZA 4WRDA 3PW4A 2IBKA 3J81W 4NPSA 2VZAA 3OTOQ 2XC9A 3CMEA 2R86A 4TQSA 1I94Q 1HNXQ 4LFCQ 5JPNC 4QIWB 5GAGC 1I5FA 3R2IA 2I0QA 4EBCA 1ET6A 2ZT9C 2XGPA 1I4HA 1DYQA 3CXCA 4DV7Q 3H94A 4Y7NB 3CRKC 1PTOD 1FNUA 1F77A 1EIFA 2IMWP 1EYGA 3ERQA 1BCPC 4EGJA 2NVQB 3GTGA 2NVTB 3NGDA 3C2PA 2R84A 3PVXA 2ICIA 2HVQA 3PR5B 1EZ8A 4NDXA 5EPLA 4AQYL 4KHPL 2ZJRA 2IX1A 4OIJA 1VCIA 5C4XH 1HHVA 1ILPA 2K14A 3RTXA 3CVZA 4DR6H 5IGFA 2HQLA 3K81C 2VB3X 2NB0A 2QCPX 4G7ZC 1JB3A 4A3BG 3I55A 3AQQA 3FKIA 3IL8A 4UCOA 1CM9A 4MA5A 5JJLA 1GXDC 2VQFQ 4C3HH 5A2QW 4DUYH 3QWNA 1QNUA 2DNEA 5K36H 3HOXG 1WTWA 3S1NH 5DQIA 1VQMA 4L5TA 2E2JH 3E5SA 4LWCA 4C5CA 4CC5A 1RTOA 3T1YH 2JA8B 4DLKA 1GD7A 2C5CA 1EY0A 5CYUA 2OT2A 3K5IA 2A1AA 3ETHA 5AFWA 4PMWA 4DV2H 3J7AF 3F8TA 1V4YA 4A3GB 5M9OA 5JQWA 1S0MA 1K8OA 5EBDA 1SJHD 5C5LA 4J9OA 1STAA 3J7A5 3GV8B 4HIOA 4IPGA 4JVZA 3CHBD 2XWBB 2RHQB 5D65A 3OUUA 2A74C 1FD7D 2Q8TA 3U9OA 5LHY1 4ECTA 2VNUD 1EOVA 5KFWA 5FLXc 1M4VA 1B6RA 3RLOA 1KDBA 3OUZA 1RJRA 5FLXL 1VQNA 1R9TB 1DD2A 1WTHA 4GOPB 2RDFA 2FK1A 5FD5A 3ULPA 1X6OA 3ETJA 1EU3A 5M5XB 1DXMA 2XVSA 4GN5A 3MR3A 3PO3G 4ZKCB 2JA7B 1KJJA 2F4IA 4OGQC 2E5LL 4B3ML 4A3FH 3B6YA 1M6VA 1BDOA 3K58A 2HCCA 4L1KA 2R3ZA 1V8QA 5KFNA 2UUBL 5IODA 4O3PA 2ENBA 4ED3A 1B50A 4LF5Q 3AYHB 5C3XA 2WINB 1B8AA 2A68C 3OTOL 1ASZA 3RZOH 4LF9L 3K7AH 3FKIB 1PFBA 2YCHA 1CSPA 2SDFA 4J15A 3CCRA 2AUJD 1S5CD 3S15B 4X62L 2UUCL 4OELB 5IP9G 4LF4Q 4DV7L 4K8JA 4QCLA 2VQFH 4DUZQ 4DV3L 3EJIA 4RUAA 4EYIB 1W96A 5DG9A 5BMVF 1L1OC 5DEHA 4A3JH 1PLFA 1VQFA 2WYOA 2HUGA 2AWOA 1PMRA 1SYXB 4BBSH 3JZIA 3C3LA 2QDBA 4DK0A 1C8CA 4BBSG 2A6EC 4C3HB 2KCTA 4JOIC 3RN2A 5D1OB 3FP9A 3TP6A 3STBC 3VYUA 4DUYL 1T94A 3UDFA 4DAYB 4LF9H 2EVBA 1Z2OX 2VPSA 2J7ZA 1F2YA 1Y8PB 3I4OA 3KDFB 4MHEA 1EUCB 4UCUA 2VA2A 4DV1L 4NXMQ 1G6PA 4NW2A 2WAQG 4A3FG 1JX4A 1CTMA 3S9WA 3U4ZA 3PV0A 4DR1L 1MZBA 2QILA 3BJYA 1KRSA 2R7LA 3S14B 1CQVA 1KTKA 3L9AX 1Z7TA 3QIAA 4O2DA 3UDIA 4P71A 1YHBA 2RDJA 2F52A 3L4KA 4A3EB 1Q12A 3RV3A 2HDLA 1FL0A 3PW5A 4V190 3SE0A 4ZKBB 2SEBD 2YU9H 3TP7A 1EY7A 3L3OC 1DV1A 5LMUH 1UUPA 3CQZH 3QB3A 3PUZA 4KHZA 2NZOA 3M85A 4E4TA 2VPQA 1SAPA 3NTIA 4JUZA 4J9PA 1D5MC 3BZKA 1B44D 1IZ6A 4A3IG 3FMCA 5KFUA 1D2BA 1FNVA 1YJWA 2CW0D 2V4QA 4GZYC 2JEFA 1XX8A 1EWCA 2F0DA 1ENFA 4N9TA 2VQEL 4DR2H 1RKNA 4QUFA 5EPKA 3JRWA 5CBEE 3OMGA 2EYJA 4X64H 2L4NA 1JWSD 2HHHQ 1B53A 2JSOA 2V59A 4UCSA 4HEDA 4LF8H 4QF4A 4Z9CB 2X0SA 1SYGA 3S2DB 2F0TA 3GV7B 1JC7A 1B3QA 1RIPA 1V43A 2N3SA 2Q2HA 3ER0A 1V51A 3SK4A 4EFBA 2YU9B 1HR0L 3S16B 1STEA 2YL2A 3RIZA 2PYKA 4XYQA 5M5XH 2QEXA 2HHHL 1BJTA 3HXLA 1H9SA 3BG3A 2WKCA 1TWAH 2Z8LA 1S68A 4LH7A 2K4KA 1N56A 1TWFH 3CCQA 3HKZE 3KDFA 3MZ5A 1LTGD 1XPOA 1WTVA 1I3QB 1YNJD 4HCEA 4DR3Q 3JSLA 1VBGA 1CKNA 5BN4A 1O7IA 1EYCA 2EJMA 1GHJA 3D4DA 4LUOA 4RNOA 1KC8C 4DR7Q 1Q82C 3GIIA 4JI1Q 4JI2H 1C4QA 5LL6X 4YB8B 2TMPA 2AQ1B 1N33H 2EXDA 5C1OA 4S3SA 2UUAQ 3MFGA 1IKMA 3N6XA 1NJIC 3GTQH 3HZXA 2E74C 1B2TA 1RDPD 3S24A 2B2VA 4JI4Q 2Z6KC 1JWMD 1PVOA 4DNIA 4ZK9B 2JK8A 3LX0A 4OX9L 4I4TF 4DUZH 3QZ8A 3K57A 3MEHA 5D1PA 4LK1C 4HCSA 5C3EB 2JJQA 1NSNS 2YZNA 5IYZF 3ITPA 2HGSA 2IW3A 2UVWA 1B6SA 1F9RA 4Y52H 1Z6HA 2VS1A 5M5WH 4IOCA 2VQDA 5KRUA 1B04A 3KHLA 1A2TA 4NKLA 1QUQB 1W3SA 1MIUA 1KDAA 1X55A 2A6HC 2F0QA 5ELOA 2ZTEA 3HKZG 2VUMH 3Q8RB 2LSSA 3QOLA 5HGQA 1PH2A 3H3VH 4UFZA 5KFFA 2NN6I 4NXNQ 2RGVA 4DR7L 1H9MA 2FP4B 1EQTA 3HOZB 2K05A 3F2UA 3BA8A 2W8KA 4TUYF 3Q1KA 5C4XB 1E2WA 2W8LA 1OXVA 3BZDB 3E3XA 4BS9A 4RKLA 4CBVA 1EEID 2IX0A 1KJIA 3R5XA 3AB9A 2R7ZH 4DL4A 2NU8B 4YR0A 1B70B 1KXLA 1KAAA 2UUAH 2VA3A 2F4VH 1S0NA 4MV8A 1VQLA 2C35B 4UCVA 5IP7G 4HNVA 1IBKL 3I4NB 3HOWB 1IBML 5DQHA 3PIOA 4YHHL 2F0SA 1CFMA 2EYLA 1KLUD 1UAPA 1X9NA 1JB7A 3MFIA 1S9FA 5KT2A 4HNUA 1HTLD 4Q45A 4IZOA 4JYAH 4IFDH 4ILWA 1TIID 2OQ0A 1TXYA 5C3WA 1QOHA 4ME5A 4EVOA 3PO3B 4WFN3 1NAPA 2QK4A 4ZAIA 5EWEA 2F0HA 3BYTB 1K83A 3DM3A 1SYEA 1KD1C 1CS0A 1A63A 4IWYA 3BAAA 5KNCA 1NY4A 1FJGL 2WB1B 4IWXA 4BBRH 2XCLA 1CKNB 2QEJC 1IBKH 4IPDA 1Z2NX 1YNND 1F9QA 4YWKA 2XIWA 4DKAC 4F7XA 4GC6A 1RD9D 4IRKA 1HQMC 1HZBA 5E3FA 1E4FT 2F0NA 4LF8L 4DV5L 1VKZA 2I80A 2A19A 5KX5F 3G8CA 1EL0A 1BBXC 5KIXA 2VW9A 2ZDHA 3MWDA 2AGQA 2XWJB 2UUBH 3MXUA 4EEYA 3KUPA 2UVVA 3RFCA 1GM5A 2IHFA 3BQ1A 4RA8A 2RCNA 1A3TA 4BY7H 1HNWL 3NQTA 2F4VQ 1FVIA 2DJGC 4L6TB 1IXRA 1PH3A 1SYBA 1WJJA 3PCOB 2UU9L 3GLKA 4KHPQ 4IALA 4O2AF 3T1YL 5KG3A 3P7JA 4QIWA 2W9BA 4JV1A 1IYUA 1K3BC 4IRDA 1LT6D 1M1KC 5EKIA 1ET9A 4UP8A 2V9WA 3J81j 4A3IB 4RFBA 2WAQA 3PUYA 2K5HA 1TWFA 1WOCA 5L37A 4C1NI 2W6PA 5KNDA 2XRSD 1RK6A 5E1FA 4YWLA 5FOBB 1NMFA 2L9HA 1I94H 1HNXH 1NE3A 4LFCH 1AN8A 5CC4A 2XN9C 2EY1A 4OWXB 1VQ8A 1SNQA 3CF5A 1PH7A 1S03G 1YI2A 4P72A 4DAPA 1I3QH 5IT9L 3HEJA 1ZETA 2ZXPA 4DV1H 2D2CC 2R8IA 1CKOA 3E6ZX 4EG0A 5BR8L 4UHVA 4C5AA 1EIGA 2JA6G 2NN6H 2J6TA 2MFIA 2CH4A 1A8VA 4AYBB 4DFAA 4DNRB 1DOMA 3J80L 3T1HL 4GKKQ 3CU7A 3K5LA 3NHHA 4POGA 4QIWE 5HV6A 1CQJB 4EQPA 5K2MA 3GV5B 3UI2A 3PIP3 5T1IA 4TV8F 1EUJA 5EPJA 1VAJA 4APMA 1F2MA 2DGYA 4B9XA 1D1IA 3DF7A 4TKOB 3V6KA 1SR3A 5LMUL 1ESRA 4H7BA 3E9HA 3U50C 2R7DA 3RUZA 1PH9A 4I55F 2L5TA 4DPGA 2FXQA 4HTHA 1EY4A 2K5QA 5C4JH 3TDQA 2F0VA 1ASYA 3DXJC 3PO2H 2EQSA 4QW8A 4DL3A 4ZCKA 1QUQA 4O0AA 3T1YQ 1JR0D 1O80A 3SK5A 1KBLA 2R8JA 4HIMA 4MTKA 2Q2IA 5IP9H 1Y14B 2B63G 2F03A 2IX3A 3GTGH 3S1NB 2DPJA 2ZM6H 3A56A 5CV6A 4C3JB 3OWFA 2QYZA 4MN3A 4EX5A 5FO9B 1JOQA 3QFFA 2E5LQ 4B3MQ 2UU9Q 1HZAA 3A7LA 4C3IG 2K5WA 5FLXE 3J7ZC 4GOPC 5KFMA 1RODA 1SE8A 3LWBA 3Q8QB 2ASLA 1Y69U 4HSVA 3T56B 1N32H 4C2MA 4X65L 4QQBX 2EE1A 1BCPF 3F2BA 2FJZA 5J2UF 2GLTA 3SEBA 1XNQQ 1JOOA 4JBWA 3RAXA 2CZGA 4JI4H 3BU2A 2PN1A 1HFGA 2N88A 4KN7C 1WTPA 1R4QB 1CK1A 2R7ZB 3FVQA 3T13A 5FKAC 4RGTA 1SE2A 1JT8A 2ASBA 1QG7A 3RR5A 5KFDA 4JI5L 4GOPA 1HZCA 4BY7B 3K3PA 2G9HD 4MV6A 4AIMA 3CCVA 5COYA 4UCTA 1I4XA 3AU7A 1PRTC 3GTQB 4F88A 4RHSA 1K9MC 1Q8KA 1Y1VG 5I2XA 4OONA 1A3UA 3GD7A 1IBKQ 4K0KQ 1EQRA 3G6YA 3CCEA 4FVMA 1DV2A 1EY8A 2Y0SA 1CUKA 2QF7A 2K7VA 4LSAA 1VF7A 1CHQD 1U4LA 2RCFA 2VL6A 4ED1A 5EWGA 1E7ZA 1FGUA 2DLNA 2UVRA 4BA1I 5CA0F 1K28A 1T9HA 2DY7A 1LTID 2LS01 1SXTA 1UWVA 2EYFA 2EY6A 4A2AA 5G3LD 1DGSA 3MEFA 1IBMQ 2PO4A 4I7ZC 5C4XG 4HMIA 1HA6A 1TWCB 4M8AA 5IGEA 1PTOC 4A3BH 5I47A 1FR3A 3MFHA 4IFDG 1VQJA 3W1BA 5IYDH 4EQNA 3NBIA 3BJUA 3EPIA 2W6ZA 2HHHH 1BGWA 3H6MA 2NU7B 5BPHA 2DY8A 4LMYA 3VR6A 3G6VA 2RSOA 4DV4Q 2MHVA 5ELFA 4FF1A 3AFPA 1J6QA 4A93H 3V6HA 3W1GA 5E7NA 4NXNL 3L7ZC 4QWBA 4C1NK 1X65A 2R7MA 2NWGA 3GTGB 4X3TA 1PH5A 3GTLH 1TA8A 2ALZA 1S3OA 3N6RA 4XT3B 2NU9B 4POFA 1AN7A 4RB2C 3OTOH 1JDBB 1TWGH 5M3FB 4IAJA 2R85A 3RUPA 3MR2A 3IRBA 4RHRA 5F2DA 3ORQA 4B3RH 4MIUA 2GPWA 1YHQA 3O13A 2UUCH 3GIMA 3MXGA 4JI1L 4JBJA 3S1QB 3M3YB 4YJ3F 2NVYH 5JPMC 3JAML 1EY6A 1VQ4A 3HOYG 2CFMA 2BDOA 4JI4L 4CHTB 5T14A 5C0XH 5KG0A 2L0CA 4PDBA 2E2DC 5JJKA 1K0SA 5KFAA 1JOKA 3CQZB 3NTKA 1ZYRD 1XDNA 1JMCA 1JXLA 4EQ5A 3T53B 5JH7F 3MR6A 1S0OA 4K5WA 5KG4A 2AWNA 2OEOA 3D4WA 3VYRA 4TQUS 1TT2A 4MTEA 1L0WA 5L1JA 2PZTA 1S97A 1GUSA 3BVGA 1N9WA 3G6XA 3TP8A 3EPGA 3CPFA 4ZUIA 4BY1H 4P2CB 4AH6A 2R93G 3EIVA 1YIJA 3M9OB 1KNAA 1HNWH 3WOEA 3T5KA 2F0JA 2OF1A 4LFBQ 1K0RA 1H9RA 2M9VA 1GSOA 3HOZG 1U4PA 1O75A 4A3IH 5DLFA 4PZ8A 3FPUB 5LL6S 2ZJQA 4JI5Q 2FLLA 4JI3H 3CAMA 3DWPA 3VR2A 2HIXA 4X66H 5JJIA 4K2LA 3PMFA 3GQBA 4QMGA 1EWHA 3MWYW 4RAYA 3OHBA 4MAMA 4LFBL 2FMMA 1EOTA 1VQBA 2A68D 4BXXG 3GTKA 3T16A 4X3KA 1TWHB 2I5MX 1GLVA 1E0BA 2Y0SB 1X54A 3J80c 2KBNA 4R4QA 1OTCA 2AKWB 3UDXA 1XPUA 4B3SH 5EKLA 2JXMB 1EFID 4RH6A 4A3EG 3HB9A 4U7CA 1Q86C 1TAEA 1DJRD 4QWDA 1SSOA 1WFQA 1JORA 4DR2Q 2CW8A 1HA5A 3VPDA 2WP8J 4DR1H 3UQ8A 3GTJA 2B63H 3M9MB 4HNTA 2F0IA 1LYLA 1PTOF 4EEQA 5T1GA 5D1OA 4LNQA 1II3A 2RF4A 5KFBA 4YY3L 1TS5A 4ZRZA 5IP7H 2A6ED 3ERSX 5FLMG 1J9OA 3STBD 5IYBH 3F1ZA 2R93B 4C5BA 1IBLQ 3KALA 1M0TA 1EWIA 3CP0A 3CRLC 3SR1A 2V4DA 3J81E 5C0XJ 2LY7A 1ENCA 4K6DA 4CJ1B 1YNXA 1J5EL 2JA5B 4A75A 1KIXA 4GNXB 4A3DG 3M4PA 4DK3C 3E0EA 4NXML 1KC7A 5KKNB 4C2MB 2B2YC 4JI8H 1X3GA 4G57A 1BCPB 3BYYB 2YZGA 3FEWX 1SNMA 2X69A 4EYHB 4DR4L 5C0XI 4XYMB 2A73B 2NVXA 1CSQA 1PH4A 1DZ1A 3LWEA 1N34L 4I7AA 1BF4A 3Q8DA 2JE6I 4A3MH 3HOUB 1I7NA 1ZHQA 4ECRA 1EYZA 1PTOH 4N8FA 4DUYQ 4PWQA 4KTAA 4LF9Q 3QZ7A 1A3VA 2Z1CA 1V1OA 1G91A 2B2UA 3TBIB 2JA7A 3HOXB 4R8UB 4LF5L 2UUCQ 3ONAB 3ND8A 3I3CA 2R8KA 5KFQA 1E24A 3PSIA 4IUNA 4ZQIA 3PUWA 4DUZL 2AHOB 3SGIA 4DV3Q 4FF2A 4DR6Q 4OX9H 1IYJB 4IJLA 2CW0C 5IGDA 1HXYD 1VQGA 5A35A 3N43B 5A2QE 1HJPA 2BE5C 1XYIA 2K5DA 4KN4C 4ETSA 5FLXW 1TY2A 3A0JA 2VUMG 4GN4B 4FBUA 4DAVA 3GIKA 1H9KA 4IURA 1F9PA 5JVG3 4A3GH 2NUAB 3J80i 2ICEC 1I4PA 4Q0FA 4H0LC 5EQ0A 1OXXK 3TIGA 5LP6F 1A6XA 1WH2A 2JA8H 1VQHA 3WWVA 1X3EA 4Y8VB 2VB2X 5IYDG 4J9NA 2RVLA 4Q44A 4JC0A 1U0LA 2HIVA 4XDXA 5I6YA 4QGUA 3A54A 2O4XA 2EY2A 2IJ0A 5CAEB 3PQIA 4XYOA 3GO5A 1B7YB 4APVA 5G3LF 1NCVA 5CV7A 3CMAA 1VQCA 1C0AA 1T3NA 5JEAG 5M3MH 5IWAQ 4WJ4A 5IWAH 1IBLH 1WCMA 4RNMA 1AE3A 4MTNA 3TP5A 4HJ8A 4A3CG 2OQKA 1KRTA 3S1RH 2EYPA 4OO1I 1JJGA 5JUMA 2IA6A 1S5BD 2AGOA 1PRTB 4ME3A 5CV9A 4EFEA 1MSHA 2WAQB 4Y7NH 4A3FB 3LMLA 3KBGA 4FBTA 3H0GG 3DWQA 2DIKA 1EHIA 3S14H 2AU0A 4O42A 3OW7A 4KY6A 2M05A 2ASDA 3KF6B 3GTOA 1ULZA 5KFKA 1AEXA 4DV0Q 4G7HC 1LT3D 1QE6A 4GN3B 2BH2A 3CCLA 3OW2A 4WD3A 1I4RA 2R8HA 3I56A 4RB3C 3OHXC 4NXMH 2YTXA 1RJTA 1XMQQ 3DEOA 3QG1A 4JI2Q 3L2PA 1B1ZA 3LGJA 3H0GA 4DR7H 3T4AC 1SN8A 1W93A 1JIHA 4KK7A 1GKHA 4O3OA 5J1ZA 2O03A 2RDIA 3WO1A 5IT9c 3OWEB 4CDCC 1Y1VH 2WIIB 5IGCA 4AQYQ 4B08A 1UE6A 5I9OA 4A3LH 4YHHQ 2R82A 2XGQA 3GTPH 3HOXH 4A3MB 2R92A 1F2ZA 3RZDB 3A8JE 4JYAQ 4JV5H 3J7YW 2PMZE 3FKIH 2F0EA 2E2JB 2WV6D 3DHQA 3VPBA 5KFLA 4LAAA 2NBFA 4I7HA 3S15H 5EKKA 1ENAA 3EBEA 4EBDA 4IUTA 3NBHA 2PW5A 1LABA 1BO0A 1MHWC 2D0PA 2FE3A 3BVZA 1N33Q 4ED7A 4QUCA 4LF6H 5CV4A 1TWAA 2UXCQ 1ZYRC 4C3JG 2E5LH 4B3MH 3PZPA 3VA5A 3H20A 3IFTA 1Q1EA 2AUKA 2F3VA 3EN2A 3GQCA 4DV0H 2JA9A 3NUCA 2KCNA 2BDNA 2DNCA 5FPOA 5KT7A 1FYCA 3RBDA 4LUVA 2N8NA 2R8GA 1MBYA 3MXNA 2QA4A 4MTDA 5LMNW 3AFQA 2Q8IB 2C2RA 2NZ1D 1MSGA 1Q3LA 3T1HQ 3HOYH 4GKKL 2SNSA 2NVQH 4RGOS 4LFCL 1I94L 1HNXL 4FU0A 2F3WA 2KHJA 3HP3A 4R7RA 5C5JA 1SLJA 3PW2A 2D0OA 2R7NA 4DR4Q 4DV4H 4YR2A 4KLKA 1ESFA 3NBHB 2O2LD 1WSCA 4OX9Q 4M7EA 4DV3H 1I50H 3G4SA 3Q24A 2K04A 1GUNA 4J1MA 3K8AA 5FO7B 4CKBA 3K59A 5KFPA 3A7AB 1UE1A 4GKKH 1R4PB 3EROA 2GN5A 4A93G 4M9UA 5F9NA 3EA6A 3TRZA 2NZHA 3SHLA 4HSPA 2AQ3B 3UE1A 1Q46A 1O7LA 4DL2A 1Q1BA 4FO2A 1BBUA 3IFDA 3KBXA 1HPCA 3D0FA 5C4HA 2PNHA 3OSNA 3KF8A 1E4EB 4K14A 4IJHA 3KYHC 5FJ8G 2V5AA 2SCUB 1W6JA 4DR3L 5J22A 2FPIB 3GIJA 2Z4HA 2B63A 1L0YB 1PZKD 5EBCA 4JYAL 2EOTA 3HKZB 4DF7A 1CA6A 4OO1G 2MCTA 5KFTA 2J6UA 3MFYA 4IPHA 2GVAA 3I8ZA 3DWAA 4JI6Q 2I87A 3GTOB 2OLSA 2Q2TA 3IKJA 1B9NA 5DM63 4UP9A 3X3MA 4NMZA 5JVDF 5DG7A 4YCVA 3PF5A 2YS7A 5CA1F 2EJFC 5CR3A 2W9CA 4LF7L 1VQEA 2KCCA 4XQJA 3A5ZB 2F4VL 3RF2A 3G48A 2FK2A 2IT1A 2FPGB 1LTRD 3Q8PB 3DEPA 1N36H 4XX0B 1QCBD 1WCMB 2QDLA 3SK6A 2NVTH 3J80W 1I50A 3J81L 1MGSA 5LMNQ 1O78A 2CCZA 2BOSA 4RZRA 2JA5H 4KD4A 3RZOB 2ZTCA 2HDMA 4U673 4DV0L 1IKLA 1YZ6A 2RA4A 3A74A 4I65A 1XNRH 1SFOB 4X64Q 5FPRA 2I07B 4R1JA 2R93H 1L1OB 1SCUB 3VR3A 2LKVA 3H4BA 4AYBE 3MJFA 1N36L 4TVAB 1LTSD 2FJ2A 3PUVA 4LF4H 4IFDI 2C2EA 1KNEA 1I6HB 4CDDC 2XSCA 5C44B 1SFOH 3HOYB 2EY5A 2FPPB 2VUMB 3IG0A 1U5KA 1WD0A 5EOYA 3LP8A 4DL6A 1B9MA 1PZJD 2WFWA 4HYKA 2CQYA 1MD2D 3LWUA 4RB1A 1OXTA 2KJXA 1SBBB 4B3RQ 1B4OA 2Z9HA 1HH2P 3I12A 5JEAJ 1K8MA 4A76A 3UFXB 3KLSA 3T5JA 3K5HA 5BPFA 4M1UB 2MUYA 5JVH3 1VBHA 2JN4A 2MNAA 3MAQA 1SEIA 4JBKA 3MC0B 4YQWA 1LM0A 1TWGA 5KFCA 2XGTA 5ELBA 2NVYA 4JV5Q 4ED6A 1SNPA 1B3AA 4WJWA 3RZDH 3KJOA 5C8YF 4JI6H 1PH6A 3F8NA 2RKSA 1PH1A 4GLVB 4DN4M 1Z2PX 4V0BA 5D8DA 4DV6Q 1NTGA 2VR1A 1BR9A 2K75A 2E2IA 4DV6L 1V1QA 2CVRA 2JA5A 4HAEA 3PO3H 1CI3M 4H13C 5EZYF 3GTKH 2Y0SG 2P5ZX 1YNJC 5KEEA 3HBLA 4DAYA 1DM0B 1WR2A 4FS1A 3H40A 2FMCA 2OCEA 4DK6C 4BY7G 2C28A 1HQRD 1LTAD 3RLNA 3UE0A 2WB1E 1BNZA 1PYBA 4WBNF 1IOVA 3OIQA 4KY7A 1XMOQ
chains in the Genus database with same CATH topology
5M3FH 4AYBG 3AFPA 1J6QA 3G6EA 4A93H 4LFAQ 4GOPB 2KENA 3W1GA 5E7NA 3GTMH 4NXNL 3L7ZC 4HIKA 3ULPA 1HR0Q 1X6OA 1X65A 3NEMA 3S1MH 3HFZB 1K8GA 4GN5A 2K5VA 4PZ6A 4GKJQ 1IBLL 1LUZA 1PH5A 4LF6L 3GTLH 3PO3G 4K0KL 1S3OA 2HT1A 5HY6A 2E5LL 4B3ML 3CC4A 3A5UA 4QL5A 4POFA 4A3FH 3B6YA 1TWGH 4L5QA 1QVGA 5IE8A 3TQYA 5K36G 4LFAL 1NMGA 3IRBA 1YITA 3KLWA 4C2MH 1YHQA 4JI1L 4JBJA 1S40A 2UUBL 2LXKA 2PQAB 2JA5G 1XNQL 2NVYH 4IO9A 1VQ4A 1Y1WG 1PA6A 3AYHB 4LF5Q 2CFMA 3HOYG 5C0XG 4JI4L 1B8AA 3OTOL 2PQAA 1ASZA 2ALYB 1KL9A 3RZOH 4LF9L 3K7AH 5JJKA 1CSPA 4J15A 3CCRA 4LUZA 2E8GA 1WCMG 4X62L 5IYCH 1JMCA 1X56A 4FDBA 4EQ5A 5IP9G 4DV7L 3CCMA 1N36Q 2UUCL 1YJNA 4LF4Q 2Y0SE 4DUZQ 4DV3L 2AWNA 4JBMA 3F2DA 4JI0L 2MQHA 1L1OC 4TQUS 1PHJA 1C7YA 4A3JH 1L0WA 1VQFA 1R9TH 3CW2C 2AWOA 4HJ5A 1VQKA 4BBSH 4BXXH 5M3FG 4HJ7A 4BBSG 1N9WA 2KCTA 4JOIC 3RN2A 5C3EH 3FP9A 4DUYL 3STBC 4JI3L 3CPFA 3UDFA 2YTVA 4DAYB 4AH6A 2VQFL 1XPRA 4BY1H 4IOAA 4MZ9A 4X66L 2R93G 3EIVA 1YIJA 3S2DH 1BVSA 2ZJPA 4LFBL 1CKMA 2NN6G 1IL2A 3I4OA 3KDFB 3CCSA 1KQSA 4DV1L 1OXUA 4NXMQ 1G6PA 4LFBQ 2WAQG 1K0RA 4A3FG 3U4ZA 4PG3A 3HOZG 3PV0A 4DR1L 3S2HH 4A3IH 4X65Q 2N49A 2YYZA 1E1OA 4PZ8A 2ZJQA 4JI5Q 1KRSA 4BA2I 3CAMA 2HIXA 1HNZL 3JAMi 5JJIA 4P73A 3HOWH 3I4NH 1VQ5A 1I6HH 3F2CA 3D31A 4IPCA 5J3BA 2B29A 3ULJA 4BBRG 5LMUQ 4DV1Q 1VQBA 4JCVE 4BXXG 4O2DA 3UDIA 4P71A 2RHSB 1YHBA 2I5MX 4DR6L 1XPUA 1GO3E 1X54A 2F52A 2KBNA 4R4QA 1Q12A 2AKWB 3UDXA 3J80c 1OTCA 3H15A 1FL0A 2YU9H 4A3EG 3CC7A 1VQDA 3DLLA 1Q86C 1WCMH 4IFDJ 1WFQA 1QVFA 2CQOA 3CQZH 4DR2Q 1A62A 3K0XA 3PUZA 4KHZA 1MJEA 2NZOA 2WP8J 1E3PA 1WI5A 3GDEA 3ZJYC 3M85A 1S72A 2B63H 2PI2E 5GADC 1KAWA 1HZ9A 3BZKA 4A3IG 1IZ6A 1LYLA 2A8VA 2JA7G 5IY0A 4DR5L 2JA7H 4LNQA 3I7FA 2RF4A 1YJWA 3KOJA 4YY3L 5FLMG 5IP7H 3ERSX 1N32Q 3STBD 4GS3A 5IYBH 1JE5A 5M5YH 2JEBI 1VS0A 1OXSC 3F1ZA 4X62Q 2VQEL 1IBLQ 1EIYB 1EWIA 3CP0A 2HHHQ 1V9PA 1VQIA 5C0XJ 4DR5Q 4UPAA 1YNXA 1J5EL 1SROA 4A75A 3VDYA 1D7QA 1KIXA 3JAMc 4GNXB 4A3DG 1V43A 1RIPA 3M4PA 2N3SA 2Q2HA 3E0EA 3ER0A 4C3JH 4DK3C 3CPWA 2UUBQ 4NXML 1HR0L 4DR2L 1BBWA 2QEXA 5M5XH 2HHHL 1X3GA 1TWAH 4JI0Q 2K4KA 1TWFH 5C0XI 3HKZE 3CCQA 4P74A 3I4MH 3TS2A 4DR4L 3KDFA 1CSQA 3FKIG 1PH4A 5C3EG 1C9OA 1XPOA 1K73C 1N34L 3Q8DA 2JE6I 4A3MH 4YCUA 1D8LA 4DR3Q 4JI3Q 4JI8L 4DUYQ 1HNZQ 2EIFA 2WB1G 1CKNA 1N33L 4YCWA 1G291 4LF9Q 4A3EH 1O7IA 2JA6H 4LUOA 1FJGQ 2WAQE 1JJCB 3JC66 3ULLA 4LF5L 3H0GH 1MJCA 1HNWQ 2UUCQ 1KC8C 4DR7Q 1WYDA 1E24A 3PSIA 1Q82C 4JI1Q 3PUWA 4DUZL 2AHOB 3SGIA 4DV3Q 3S17H 4DR6Q 4A3KH 1IYJB 4IJLA 4DV5Q 1VQGA 4XIGS 4LF8Q 3HKSA 2EXDA 2E2HH 5FLMH 1HJPA 3M4QA 2UUAQ 2BA1A 3CD6A 1NJIC 3A0JA 2VUMG 4GN4B 3GTQH 1Y1WH 4HJAA 1XNRL 2NVXH 4HIDA 3S24A 4JI4Q 4A3GH 2Z6KC 4JI2L 1PVOA 4DNIA 3J80i 2JK8A 4OX9L 5GAHC 2MO0A 1OXXK 2R7FA 4YWMA 1E22A 2JJQA 4H02A 1K8AC 2JA8H 1VQHA 1VQOA 2ZTDA 1X3EA 3WWVA 5IWAL 3G71A 5IYDG 2YV5A 2PI2A 2Z6KA 4WJ3M 4JC0A 3S16H 1U0LA 2HIVA 4QGUA 1Q7YC 3CCUA 3HOZH 5DLQE 2MO1A 2VS1A 5M5WH 4IOCA 4GLAC 3GO5A 1B7YB 4APVA 4LF6Q 1QUQB 3CMAA 1VQCA 1C0AA 1W3SA 1MIUA 1X55A 1UE7A 3M7NA 5JEAG 5ELOA 5M3MH 5IWAQ 2ZTEA 3HKZG 2VUMH 4WJ4A 1AE3A 1BKBA 2LSSA 4MTNA 4C3IH 5HGQA 4HJ8A 1PH2A 2NN6I 4NXNQ 2JEAI 2OQKA 1KRTA 4A3GG 1Z9FA 4DR7L 3S1RH 4A3CG 4OO1I 1JJGA 1W2BA 4ME3A 1SRUA 4Y7NH 4R4OA 3H0GG 3PO2G 3S14H 1UE5A 1OXVA 5EAYA 2IX0A 5FJ8H 5C44G 2CKZB 3KF6B 4DV0Q 2R7ZH 4GN3B 2BH2A 3CCLA 3OW2A 1EFWA 4B3SL 1B70B 3I56A 3CC2A 1LTLA 1KXLA 2YTYA 1VQLA 2C35B 2JQOA 4ALPA 2YTXA 4LW1A 4QJFA 5IP7G 3CCJA 1XMOL 1XMQQ 1IBKL 4JI2Q 4DAMA 3L2PA 1IBML 4JG2A 3PIOA 3LGJA 4YHHL 1X9NA 1SN8A 5GAEC 1JB7A 3K7UC 4DV2L 4B3SQ 4R4IA 1GKHA 4B3RL 4JOIA 4A4IA 2KCMA 4Y52H 2KHIA 5IT9c 3H3VI 4JV5L 2H5XA 2JA8G 3RLFA 1Y1VH 4R4CA 2OQ0A 3M4OH 1TXYA 4A3DH 4AQYQ 2OTJA 4NB3A 5IYCG 1UE6A 1L1OA 1G51A 2CWPA 1EQQA 4A3LG 4A3LH 4YHHQ 1QZHA 3DM3A 1KD1C 1A63A 1QVCA 3GTPH 3HOXH 2OTLA 4B3TL 1FJGL 1NY4A 4YY3Q 4JYAQ 5AJ3Q 4BBRH 1YVCA 1CKNB 2PMZE 3FKIH 3NELA 4IPDA 4L5SA 2ATWA 4YWKA 4DKAC 2IY5B 3S15H 1N34Q 4HJ9A 1HZBA 3EBEA 4LF8L 2D0PA 4DV5L 3RN5A 1PFSA 3S1QH 2A19A 4P75A 1N33Q 3NENA 5GQOA 2I5LX 3U4VA 2UXCQ 3MXNB 1YHAA 2VW9A 2R92G 1Q1EA 4PZ7A 1NBWA 3EN2A 1GM5A 2JA9A 2IHFA 2D62A 3I2ZA 3OYYA 2ZM6Q 4LUVA 2N8NA 4A3KG 4GNXA 2RCNA 4BY7H 1K83H 1HNWL 2F4VQ 2UXDL 1FVIA 1VQAA 2ID0A 3TEHB 2E2IH 2QA4A 3HOUG 5LMNW 1IXRA 1X3FA 3AFQA 3PIPA 1WJJA 1QZGA 3PCOB 1PH3A 2UU9L 4KHPQ 3T1HQ 2AMCB 3HOYH 4GKKL 3T1YL 4X6AH 2NVQH 1N32L 3KJPA 4QY7A 4LFCL 1I94L 1HNXL 1N8RC 3M3YH 1AH9A 3U58A 1AE2A 1J5EQ 1M1KC 3FHWA 3KF8B 2KHJA 4UP8A 2XTIA 1SLJA 3J81j 4UY8C 2D0OA 2I5HA 4DR4Q 1P8LA 3TS0A 4KLKA 1TWHH 3NBHB 3PUYA 2K5HA 4RMFA 3GTJH 2VQEQ 1WOCA 3HOVH 3KFUA 4OX9Q 3H3VH 1I50H 4YWLA 1NMFA 3G4SA 3RNUA 2K5NA 1TWCH 1NE3A 2IHEA 1XNRQ 1XJVA 3K8AA 4JI7Q 2Q2UA 4OWXB 3I4MG 1VQ8A 3CF5A 1PH7A 1YI2A 4P72A 2UXBQ 4GLXA 1I3QH 2CWAA 1UE1A 3BZCA 1P16A 4LF7Q 1VQ9A 3HOUH 2GN5A 1CKOA 4A93G 4BY1G 4RG1A 3TRZA 2NZHA 1YJ9A 5BR8L 4X66Q 3UE1A 2JA6G 1Q46A 2MFIA 1Q1BA 1A8VA 2ES2A 2BH8A 3T1HL 1BBUA 4JI7L 4GKKQ 3D0FA 2R92H 4OXPA 2PNHA 4POGA 4QIWE 3HOVG 4IJHA 3KYHC 5FJ8G 4JI8Q 3W5OA 5ELNA 4DR3L 1EUJA 1UEBA 3PGZA 2VY3A 2DGYA 1M90C 2GVBA 4JYAL 1H95A 4OWWB 4B3TQ 4OO1G 1Z47A 1K3RA 1SR3A 5LMUL 4JI6L 4L5RC 1Q81C 3E9HA 2GVAA 4IPHA 2UXBL 3U50C 2DUDA 2R7DA 4JI6Q 1PH9A 2Q2TA 4A3MG 4UP9A 4DPGA 2FXQA 4XTCS 4YCVA 5C4JH 3PF5A 1YEZA 4LF7L 1VQEA 1ASYA 4GKJL 3A5ZB 2F4VL 3PO2H 2EQSA 2UXDQ 1QUQA 4O0AA 2OWOA 3T1YQ 3G48A 2IT1A 2QGQA 2L15A 4HIMA 5C44H 1L2FA 2Q2IA 5IP9H 1Y14B 2B63G 1PYSB 3J81c 4DR1Q 3GTGH 1GVPA 2NVTH 2V1CC 2K50A 4MNOA 5LMNQ 2R6GA 5BR8Q 1VQPA 1RL2A 4EX5A 4A3JG 4OWTB 3HOWG 2CCZA 3I4NG 5M3MG 2JA5H 1SMXA 2E5LQ 2ZTCA 2UU9Q 4B3MQ 1HZAA 4NPSA 4DV0L 2VZAA 1YZ6A 3J7ZC 3OTOQ 4GOPC 3CMEA 3A74A 1SE8A 1PV4A 1I94Q 1HNXQ 4LFCQ 4A3CH 4X64Q 4R1JA 5GAGC 1I5FA 1L1OB 2ZM6L 2R93H 2I0QA 5AJ3L 4X65L 4QQBX 4AYBE 3F2BA 3CXCA 4DV7Q 1N36L 4R4TA 4TVAB 3PUVA 1XNQQ 4JBWA 1EIFA 2R7ZG 4IFDI 1EYGA 3BU2A 4UP7A 1YBYA 1SFOH 1U5KA 1XTDA 2B3GA 3GTOH 1JT8A 2ASBA 4KHPL 4AQYL 3RR5A 2WFWA 4JI5L 2ZJRA 4GOPA 1HZCA 2IX1A 1VCIA 5C4XH 4AIMA 2K14A 1OXTA 3M9BA 3CCVA 3UDGA 1A0IA 5GROA 4B3RQ 2HQLA 3K81C 1HH2P 1Q8KA 3I55A 5JEAJ 1Y1VG 3AQQA 4A76A 1K9MC 4A3BG 4OONA 1VQ6A 1VQ7A 3GD7A 1IBKQ 4LF4L 4K0KQ 1EQRA 5JJLA 3CCEA 1HR0W 2VQFQ 4C3HH 2LXJA 2MNAA 2BA0A 2N78A 4JBKA 1CUKA 2F3IA 3HOXG 1LM0A 4DV2Q 3L0OA 3S1NH 1MKHA 2XGTA 2VL6A 2UUAL 1E7ZA 1FGUA 1VQMA 4L5TA 2E2JH 4JV5Q 4BA1I 3K80C 4LWCA 4GNXC 1T9HA 3RZDH 4DV4L 3KJOA 3E9IA 3AEVA 3ICEA 1UWVA 5H1SE 1PH6A 3TREA 3J81i 1PH1A 1GD7A 4GLVB 2A1AA 5C4XG 1DGSA 3MEFA 1IBMQ 4DV6Q 1NTGA 4PMWA 2K75A 3F8TA 2K52A 4DV6L 1V1QA 1PH8A 3PO3H 2UXCL 4A3BH 1JJ2A 3GTKH 4IFDG 2Y0SG 1VQJA 4KI0A 3PUXA 3W1BA 4HIOA 3J7A5 4IPGA 4X64L 5IYDH 3PF4A 3BJUA 2Z0SA 1KHIA 2RHQB 3KF6A 2VNUD 1EOVA 4DK6C 2OCEA 5FLXc 4BY7G 3RLNA 3RLOA 3UE0A 2WB1E 1E1TA 1PYBA 5LMNL 5IYBG 1VQNA 4DV4Q 1XMQL 1XMOQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3F H;  4AYB G;  3AFP A;  1J6Q A;  3G6E A;  4A93 H;  4LFA Q;  4GOP B;  2KEN A;  3W1G A;  5E7N A;  3GTM H;  4NXN L;  3L7Z C;  4HIK A;  3ULP A;  1HR0 Q;  1X6O A;  1X65 A;  3NEM A;  3S1M H;  3HFZ B;  1K8G A;  4GN5 A;  2K5V A;  4PZ6 A;  4GKJ Q;  1IBL L;  1LUZ A;  1PH5 A;  4LF6 L;  3GTL H;  3PO3 G;  4K0K L;  1S3O A;  2HT1 A;  5HY6 A;  2E5L L;  4B3M L;  3CC4 A;  3A5U A;  4QL5 A;  4POF A;  4A3F H;  3B6Y A;  1TWG H;  4L5Q A;  1QVG A;  5IE8 A;  3TQY A;  5K36 G;  4LFA L;  1NMG A;  3IRB A;  1YIT A;  3KLW A;  4C2M H;  1YHQ A;  4JI1 L;  4JBJ A;  1S40 A;  2UUB L;  2LXK A;  2PQA B;  2JA5 G;  1XNQ L;  2NVY H;  4IO9 A;  1VQ4 A;  1Y1W G;  1PA6 A;  3AYH B;  4LF5 Q;  2CFM A;  3HOY G;  5C0X G;  4JI4 L;  1B8A A;  3OTO L;  2PQA A;  1ASZ A;  2ALY B;  1KL9 A;  3RZO H;  4LF9 L;  3K7A H;  5JJK A;  1CSP A;  4J15 A;  3CCR A;  4LUZ A;  2E8G A;  1WCM G;  4X62 L;  5IYC H;  1JMC A;  1X56 A;  4FDB A;  4EQ5 A;  5IP9 G;  4DV7 L;  3CCM A;  1N36 Q;  2UUC L;  1YJN A;  4LF4 Q;  2Y0S E;  4DUZ Q;  4DV3 L;  2AWN A;  4JBM A;  3F2D A;  4JI0 L;  2MQH A;  1L1O C;  4TQU S;  1PHJ A;  1C7Y A;  4A3J H;  1L0W A;  1VQF A;  1R9T H;  3CW2 C;  2AWO A;  4HJ5 A;  1VQK A;  4BBS H;  4BXX H;  5M3F G;  4HJ7 A;  4BBS G;  1N9W A;  2KCT A;  4JOI C;  3RN2 A;  5C3E H;  3FP9 A;  4DUY L;  3STB C;  4JI3 L;  3CPF A;  3UDF A;  2YTV A;  4DAY B;  4AH6 A;  2VQF L;  1XPR A;  4BY1 H;  4IOA A;  4MZ9 A;  4X66 L;  2R93 G;  3EIV A;  1YIJ A;  3S2D H;  1BVS A;  2ZJP A;  4LFB L;  1CKM A;  2NN6 G;  1IL2 A;  3I4O A;  3KDF B;  3CCS A;  1KQS A;  4DV1 L;  1OXU A;  4NXM Q;  1G6P A;  4LFB Q;  2WAQ G;  1K0R A;  4A3F G;  3U4Z A;  4PG3 A;  3HOZ G;  3PV0 A;  4DR1 L;  3S2H H;  4A3I H;  4X65 Q;  2N49 A;  2YYZ A;  1E1O A;  4PZ8 A;  2ZJQ A;  4JI5 Q;  1KRS A;  4BA2 I;  3CAM A;  2HIX A;  1HNZ L;  3JAM i;  5JJI A;  4P73 A;  3HOW H;  3I4N H;  1VQ5 A;  1I6H H;  3F2C A;  3D31 A;  4IPC A;  5J3B A;  2B29 A;  3ULJ A;  4BBR G;  5LMU Q;  4DV1 Q;  1VQB A;  4JCV E;  4BXX G;  4O2D A;  3UDI A;  4P71 A;  2RHS B;  1YHB A;  2I5M X;  4DR6 L;  1XPU A;  1GO3 E;  1X54 A;  2F52 A;  2KBN A;  4R4Q A;  1Q12 A;  2AKW B;  3UDX A;  3J80 c;  1OTC A;  3H15 A;  1FL0 A;  2YU9 H;  4A3E G;  3CC7 A;  1VQD A;  3DLL A;  1Q86 C;  1WCM H;  4IFD J;  1WFQ A;  1QVF A;  2CQO A;  3CQZ H;  4DR2 Q;  1A62 A;  3K0X A;  3PUZ A;  4KHZ A;  1MJE A;  2NZO A;  2WP8 J;  1E3P A;  1WI5 A;  3GDE A;  3ZJY C;  3M85 A;  1S72 A;  2B63 H;  2PI2 E;  5GAD C;  1KAW A;  1HZ9 A;  3BZK A;  4A3I G;  1IZ6 A;  1LYL A;  2A8V A;  2JA7 G;  5IY0 A;  4DR5 L;  2JA7 H;  4LNQ A;  3I7F A;  2RF4 A;  1YJW A;  3KOJ A;  4YY3 L;  5FLM G;  5IP7 H;  3ERS X;  1N32 Q;  3STB D;  4GS3 A;  5IYB H;  1JE5 A;  5M5Y H;  2JEB I;  1VS0 A;  1OXS C;  3F1Z A;  4X62 Q;  2VQE L;  1IBL Q;  1EIY B;  1EWI A;  3CP0 A;  2HHH Q;  1V9P A;  1VQI A;  5C0X J;  4DR5 Q;  4UPA A;  1YNX A;  1J5E L;  1SRO A;  4A75 A;  3VDY A;  1D7Q A;  1KIX A;  3JAM c;  4GNX B;  4A3D G;  1V43 A;  1RIP A;  3M4P A;  2N3S A;  2Q2H A;  3E0E A;  3ER0 A;  4C3J H;  4DK3 C;  3CPW A;  2UUB Q;  4NXM L;  1HR0 L;  4DR2 L;  1BBW A;  2QEX A;  5M5X H;  2HHH L;  1X3G A;  1TWA H;  4JI0 Q;  2K4K A;  1TWF H;  5C0X I;  3HKZ E;  3CCQ A;  4P74 A;  3I4M H;  3TS2 A;  4DR4 L;  3KDF A;  1CSQ A;  3FKI G;  1PH4 A;  5C3E G;  1C9O A;  1XPO A;  1K73 C;  1N34 L;  3Q8D A;  2JE6 I;  4A3M H;  4YCU A;  1D8L A;  4DR3 Q;  4JI3 Q;  4JI8 L;  4DUY Q;  1HNZ Q;  2EIF A;  2WB1 G;  1CKN A;  1N33 L;  4YCW A;  1G29 1;  4LF9 Q;  4A3E H;  1O7I A;  2JA6 H;  4LUO A;  1FJG Q;  2WAQ E;  1JJC B;  3JC6 6;  3ULL A;  4LF5 L;  3H0G H;  1MJC A;  1HNW Q;  2UUC Q;  1KC8 C;  4DR7 Q;  1WYD A;  1E24 A;  3PSI A;  1Q82 C;  4JI1 Q;  3PUW A;  4DUZ L;  2AHO B;  3SGI A;  4DV3 Q;  3S17 H;  4DR6 Q;  4A3K H;  1IYJ B;  4IJL A;  4DV5 Q;  1VQG A;  4XIG S;  4LF8 Q;  3HKS A;  2EXD A;  2E2H H;  5FLM H;  1HJP A;  3M4Q A;  2UUA Q;  2BA1 A;  3CD6 A;  1NJI C;  3A0J A;  2VUM G;  4GN4 B;  3GTQ H;  1Y1W H;  4HJA A;  1XNR L;  2NVX H;  4HID A;  3S24 A;  4JI4 Q;  4A3G H;  2Z6K C;  4JI2 L;  1PVO A;  4DNI A;  3J80 i;  2JK8 A;  4OX9 L;  5GAH C;  2MO0 A;  1OXX K;  2R7F A;  4YWM A;  1E22 A;  2JJQ A;  4H02 A;  1K8A C;  2JA8 H;  1VQH A;  1VQO A;  2ZTD A;  1X3E A;  3WWV A;  5IWA L;  3G71 A;  5IYD G;  2YV5 A;  2PI2 A;  2Z6K A;  4WJ3 M;  4JC0 A;  3S16 H;  1U0L A;  2HIV A;  4QGU A;  1Q7Y C;  3CCU A;  3HOZ H;  5DLQ E;  2MO1 A;  2VS1 A;  5M5W H;  4IOC A;  4GLA C;  3GO5 A;  1B7Y B;  4APV A;  4LF6 Q;  1QUQ B;  3CMA A;  1VQC A;  1C0A A;  1W3S A;  1MIU A;  1X55 A;  1UE7 A;  3M7N A;  5JEA G;  5ELO A;  5M3M H;  5IWA Q;  2ZTE A;  3HKZ G;  2VUM H;  4WJ4 A;  1AE3 A;  1BKB A;  2LSS A;  4MTN A;  4C3I H;  5HGQ A;  4HJ8 A;  1PH2 A;  2NN6 I;  4NXN Q;  2JEA I;  2OQK A;  1KRT A;  4A3G G;  1Z9F A;  4DR7 L;  3S1R H;  4A3C G;  4OO1 I;  1JJG A;  1W2B A;  4ME3 A;  1SRU A;  4Y7N H;  4R4O A;  3H0G G;  3PO2 G;  3S14 H;  1UE5 A;  1OXV A;  5EAY A;  2IX0 A;  5FJ8 H;  5C44 G;  2CKZ B;  3KF6 B;  4DV0 Q;  2R7Z H;  4GN3 B;  2BH2 A;  3CCL A;  3OW2 A;  1EFW A;  4B3S L;  1B70 B;  3I56 A;  3CC2 A;  1LTL A;  1KXL A;  2YTY A;  1VQL A;  2C35 B;  2JQO A;  4ALP A;  2YTX A;  4LW1 A;  4QJF A;  5IP7 G;  3CCJ A;  1XMO L;  1XMQ Q;  1IBK L;  4JI2 Q;  4DAM A;  3L2P A;  1IBM L;  4JG2 A;  3PIO A;  3LGJ A;  4YHH L;  1X9N A;  1SN8 A;  5GAE C;  1JB7 A;  3K7U C;  4DV2 L;  4B3S Q;  4R4I A;  1GKH A;  4B3R L;  4JOI A;  4A4I A;  2KCM A;  4Y52 H;  2KHI A;  5IT9 c;  3H3V I;  4JV5 L;  2H5X A;  2JA8 G;  3RLF A;  1Y1V H;  4R4C A;  2OQ0 A;  3M4O H;  1TXY A;  4A3D H;  4AQY Q;  2OTJ A;  4NB3 A;  5IYC G;  1UE6 A;  1L1O A;  1G51 A;  2CWP A;  1EQQ A;  4A3L G;  4A3L H;  4YHH Q;  1QZH A;  3DM3 A;  1KD1 C;  1A63 A;  1QVC A;  3GTP H;  3HOX H;  2OTL A;  4B3T L;  1FJG L;  1NY4 A;  4YY3 Q;  4JYA Q;  5AJ3 Q;  4BBR H;  1YVC A;  1CKN B;  2PMZ E;  3FKI H;  3NEL A;  4IPD A;  4L5S A;  2ATW A;  4YWK A;  4DKA C;  2IY5 B;  3S15 H;  1N34 Q;  4HJ9 A;  1HZB A;  3EBE A;  4LF8 L;  2D0P A;  4DV5 L;  3RN5 A;  1PFS A;  3S1Q H;  2A19 A;  4P75 A;  1N33 Q;  3NEN A;  5GQO A;  2I5L X;  3U4V A;  2UXC Q;  3MXN B;  1YHA A;  2VW9 A;  2R92 G;  1Q1E A;  4PZ7 A;  1NBW A;  3EN2 A;  1GM5 A;  2JA9 A;  2IHF A;  2D62 A;  3I2Z A;  3OYY A;  2ZM6 Q;  4LUV A;  2N8N A;  4A3K G;  4GNX A;  2RCN A;  4BY7 H;  1K83 H;  1HNW L;  2F4V Q;  2UXD L;  1FVI A;  1VQA A;  2ID0 A;  3TEH B;  2E2I H;  2QA4 A;  3HOU G;  5LMN W;  1IXR A;  1X3F A;  3AFQ A;  3PIP A;  1WJJ A;  1QZG A;  3PCO B;  1PH3 A;  2UU9 L;  4KHP Q;  3T1H Q;  2AMC B;  3HOY H;  4GKK L;  3T1Y L;  4X6A H;  2NVQ H;  1N32 L;  3KJP A;  4QY7 A;  4LFC L;  1I94 L;  1HNX L;  1N8R C;  3M3Y H;  1AH9 A;  3U58 A;  1AE2 A;  1J5E Q;  1M1K C;  3FHW A;  3KF8 B;  2KHJ A;  4UP8 A;  2XTI A;  1SLJ A;  3J81 j;  4UY8 C;  2D0O A;  2I5H A;  4DR4 Q;  1P8L A;  3TS0 A;  4KLK A;  1TWH H;  3NBH B;  3PUY A;  2K5H A;  4RMF A;  3GTJ H;  2VQE Q;  1WOC A;  3HOV H;  3KFU A;  4OX9 Q;  3H3V H;  1I50 H;  4YWL A;  1NMF A;  3G4S A;  3RNU A;  2K5N A;  1TWC H;  1NE3 A;  2IHE A;  1XNR Q;  1XJV A;  3K8A A;  4JI7 Q;  2Q2U A;  4OWX B;  3I4M G;  1VQ8 A;  3CF5 A;  1PH7 A;  1YI2 A;  4P72 A;  2UXB Q;  4GLX A;  1I3Q H;  2CWA A;  1UE1 A;  3BZC A;  1P16 A;  4LF7 Q;  1VQ9 A;  3HOU H;  2GN5 A;  1CKO A;  4A93 G;  4BY1 G;  4RG1 A;  3TRZ A;  2NZH A;  1YJ9 A;  5BR8 L;  4X66 Q;  3UE1 A;  2JA6 G;  1Q46 A;  2MFI A;  1Q1B A;  1A8V A;  2ES2 A;  2BH8 A;  3T1H L;  1BBU A;  4JI7 L;  4GKK Q;  3D0F A;  2R92 H;  4OXP A;  2PNH A;  4POG A;  4QIW E;  3HOV G;  4IJH A;  3KYH C;  5FJ8 G;  4JI8 Q;  3W5O A;  5ELN A;  4DR3 L;  1EUJ A;  1UEB A;  3PGZ A;  2VY3 A;  2DGY A;  1M90 C;  2GVB A;  4JYA L;  1H95 A;  4OWW B;  4B3T Q;  4OO1 G;  1Z47 A;  1K3R A;  1SR3 A;  5LMU L;  4JI6 L;  4L5R C;  1Q81 C;  3E9H A;  2GVA A;  4IPH A;  2UXB L;  3U50 C;  2DUD A;  2R7D A;  4JI6 Q;  1PH9 A;  2Q2T A;  4A3M G;  4UP9 A;  4DPG A;  2FXQ A;  4XTC S;  4YCV A;  5C4J H;  3PF5 A;  1YEZ A;  4LF7 L;  1VQE A;  1ASY A;  4GKJ L;  3A5Z B;  2F4V L;  3PO2 H;  2EQS A;  2UXD Q;  1QUQ A;  4O0A A;  2OWO A;  3T1Y Q;  3G48 A;  2IT1 A;  2QGQ A;  2L15 A;  4HIM A;  5C44 H;  1L2F A;  2Q2I A;  5IP9 H;  1Y14 B;  2B63 G;  1PYS B;  3J81 c;  4DR1 Q;  3GTG H;  1GVP A;  2NVT H;  2V1C C;  2K50 A;  4MNO A;  5LMN Q;  2R6G A;  5BR8 Q;  1VQP A;  1RL2 A;  4EX5 A;  4A3J G;  4OWT B;  3HOW G;  2CCZ A;  3I4N G;  5M3M G;  2JA5 H;  1SMX A;  2E5L Q;  2ZTC A;  2UU9 Q;  4B3M Q;  1HZA A;  4NPS A;  4DV0 L;  2VZA A;  1YZ6 A;  3J7Z C;  3OTO Q;  4GOP C;  3CME A;  3A74 A;  1SE8 A;  1PV4 A;  1I94 Q;  1HNX Q;  4LFC Q;  4A3C H;  4X64 Q;  4R1J A;  5GAG C;  1I5F A;  1L1O B;  2ZM6 L;  2R93 H;  2I0Q A;  5AJ3 L;  4X65 L;  4QQB X;  4AYB E;  3F2B A;  3CXC A;  4DV7 Q;  1N36 L;  4R4T A;  4TVA B;  3PUV A;  1XNQ Q;  4JBW A;  1EIF A;  2R7Z G;  4IFD I;  1EYG A;  3BU2 A;  4UP7 A;  1YBY A;  1SFO H;  1U5K A;  1XTD A;  2B3G A;  3GTO H;  1JT8 A;  2ASB A;  4KHP L;  4AQY L;  3RR5 A;  2WFW A;  4JI5 L;  2ZJR A;  4GOP A;  1HZC A;  2IX1 A;  1VCI A;  5C4X H;  4AIM A;  2K14 A;  1OXT A;  3M9B A;  3CCV A;  3UDG A;  1A0I A;  5GRO A;  4B3R Q;  2HQL A;  3K81 C;  1HH2 P;  1Q8K A;  3I55 A;  5JEA J;  1Y1V G;  3AQQ A;  4A76 A;  1K9M C;  4A3B G;  4OON A;  1VQ6 A;  1VQ7 A;  3GD7 A;  1IBK Q;  4LF4 L;  4K0K Q;  1EQR A;  5JJL A;  3CCE A;  1HR0 W;  2VQF Q;  4C3H H;  2LXJ A;  2MNA A;  2BA0 A;  2N78 A;  4JBK A;  1CUK A;  2F3I A;  3HOX G;  1LM0 A;  4DV2 Q;  3L0O A;  3S1N H;  1MKH A;  2XGT A;  2VL6 A;  2UUA L;  1E7Z A;  1FGU A;  1VQM A;  4L5T A;  2E2J H;  4JV5 Q;  4BA1 I;  3K80 C;  4LWC A;  4GNX C;  1T9H A;  3RZD H;  4DV4 L;  3KJO A;  3E9I A;  3AEV A;  3ICE A;  1UWV A;  5H1S E;  1PH6 A;  3TRE A;  3J81 i;  1PH1 A;  1GD7 A;  4GLV B;  2A1A A;  5C4X G;  1DGS A;  3MEF A;  1IBM Q;  4DV6 Q;  1NTG A;  4PMW A;  2K75 A;  3F8T A;  2K52 A;  4DV6 L;  1V1Q A;  1PH8 A;  3PO3 H;  2UXC L;  4A3B H;  1JJ2 A;  3GTK H;  4IFD G;  2Y0S G;  1VQJ A;  4KI0 A;  3PUX A;  3W1B A;  4HIO A;  3J7A 5;  4IPG A;  4X64 L;  5IYD H;  3PF4 A;  3BJU A;  2Z0S A;  1KHI A;  2RHQ B;  3KF6 A;  2VNU D;  1EOV A;  4DK6 C;  2OCE A;  5FLX c;  4BY7 G;  3RLN A;  3RLO A;  3UE0 A;  2WB1 E;  1E1T A;  1PYB A;  5LMN L;  5IYB G;  1VQN A;  4DV4 Q;  1XMQ L;  1XMO Q; 
#chains in the Genus database with same CATH topology
 2IWH A;  4CGY B;  2W70 A;  2Q8R E;  4DNT B;  2V4R A;  2ZXR A;  3JRX A;  4BY1 B;  5M5Y B;  1ZHS A;  2HCI A;  2L55 A;  5HGT A;  4PZ6 A;  4GKJ Q;  2C2D A;  3H91 A;  3M4Y A;  5HY6 A;  3CC4 A;  1U4M A;  4QL5 A;  5KT3 A;  2W57 A;  1QVG A;  5IE8 A;  3VR4 A;  1TS3 A;  4FM9 A;  2ZDQ A;  1V1P B;  3JAM E;  2GPS A;  3ZYY X;  2K1B A;  2LXK A;  2NUC A;  2PQA B;  2JA5 G;  4OEM B;  4RKB A;  2PQA A;  1I6V C;  2ALY B;  1KL9 A;  2KQ3 A;  4A3J B;  1J5E H;  2MJ8 A;  3U9S A;  1BNC A;  4ZLT F;  3HGB A;  4LUZ A;  2WDT A;  1UC8 A;  5CB4 F;  2E8G A;  1U9R A;  3MHB A;  4OHJ A;  2W71 A;  2A6H D;  1N36 Q;  4F8M A;  3CCM A;  1WTR A;  3T5L A;  2KOL A;  3QJY A;  4DA2 A;  4KKU A;  2Y0S E;  4ZYS A;  4IR1 A;  4RAZ A;  2R61 A;  5DAU A;  3U9T A;  3F2D A;  1E2Z A;  4Q5V A;  2MQH A;  1PHJ A;  1QWY A;  4K2K A;  1DOL A;  1Y1W A;  4NP5 A;  4BXX H;  5M3F G;  5KFH A;  5C3E H;  3I91 A;  3TZU A;  2VQF L;  2L1B A;  1XPR A;  4IOA A;  4X66 L;  4ED0 A;  1BVS A;  2ZJP A;  4EGQ A;  1T36 A;  1IL2 A;  2DPI A;  1O7Z A;  3CCS A;  1SDF A;  4HR7 A;  2H1E A;  4KKS A;  3HS0 C;  3K6O A;  4X65 Q;  2N49 A;  2YYA A;  4BA2 I;  1VDZ A;  4X3S A;  1PZI D;  2PVP A;  5KFI A;  3M9N B;  1HNZ L;  3JAM i;  3BDL A;  1VQ5 A;  3R5H A;  2F0F A;  4L63 B;  3F2C A;  4YBZ B;  3D31 A;  5BN5 A;  5J3B A;  3ULJ A;  4RGM A;  4BBR G;  4DV1 Q;  4DGZ A;  4N8X 1;  4B9W A;  1CE8 A;  3MXP A;  4PV1 C;  3NP8 A;  2HVR A;  4MV4 A;  5IT9 E;  1TKW B;  2BCO A;  1VQD A;  3DLL A;  3CC7 A;  2E2H B;  4IFD J;  1F2L A;  5IIF A;  5KFE A;  2E76 C;  3J7A V;  1A62 A;  3K0X A;  1MJE A;  1J8I A;  3GDE A;  4ODG A;  3ZJY C;  5CV8 A;  3DMU A;  1KEE A;  1KAW A;  1HZ9 A;  2O5J C;  1RTN A;  2A8V A;  2W6O A;  5IY0 A;  4LH6 A;  4DR5 L;  2L11 A;  2JA7 H;  3WNZ A;  2AGP A;  4FF4 A;  2NU6 B;  3R3O A;  2FLP A;  2C00 A;  3D8G A;  3T1H H;  2C22 A;  1T5X D;  2M00 A;  3NE5 B;  1JE5 A;  4GS3 A;  2JEB I;  5M5Y H;  1OXS C;  4X62 Q;  5LXT F;  2EYO A;  4F4Y A;  1U4R A;  4O4L F;  1HUN A;  1EIY B;  1IW7 D;  1E4G T;  1E4E A;  4F4Z A;  4ECW A;  4IUP A;  4DR5 Q;  2Z6B A;  3SE7 A;  4UPA A;  2JYO A;  3NSW A;  5ELE A;  3BA9 A;  1WD1 A;  1SRO A;  5D3I B;  3VDY A;  1D7Q A;  3JAM c;  3TIN A;  3KLR A;  2X6L A;  1C30 A;  3KHR A;  3H4D A;  4Q8F A;  4C3J H;  2UUB Q;  3OMC A;  2XIG A;  1B33 N;  1BBW A;  5KG6 A;  2QW7 A;  1N48 A;  4BBR B;  3VYT A;  2W7P A;  4JI0 Q;  5DGA A;  5LMN H;  1PTO B;  4HR7 B;  3MWE A;  3I4M H;  2WAC A;  3FKI G;  5JVL A;  1PFN A;  5DG8 A;  3D6C A;  4TSS A;  2FK3 A;  4KHP H;  4YP3 A;  1Q8I A;  4JI3 Q;  4JI5 H;  1EY5 A;  3FDS A;  1HNZ Q;  2WB1 G;  1N33 L;  2F0O A;  3CKI B;  1ICW A;  3TQ1 A;  2JA6 H;  2KSW A;  4B3T H;  1STB A;  1I50 B;  1Y1W B;  3ULL A;  3JC6 6;  4O3Q A;  1HNW Q;  1GUT A;  1MJC A;  2NTT A;  2R7K A;  1HTP A;  2EYM A;  3TSS A;  3VA7 A;  4Q43 A;  5H80 A;  4BBS B;  2JA6 A;  4HMJ A;  3AMU A;  5FLM H;  1ILQ A;  4F4W A;  4Q0Y A;  1LO5 D;  2BA1 A;  5KFJ A;  1NUC A;  1KJ9 A;  4ZOL F;  4X62 H;  1Y1W H;  4KHV A;  4BWG B;  4JI2 L;  5KNB A;  3FMA A;  3E5N A;  2ZXO A;  5GAH C;  5DM7 3;  4CDF C;  1HNZ H;  1EU4 A;  1G2T A;  3HKZ A;  3M4O B;  2R7F A;  4YWM A;  1HCZ A;  4IQZ A;  3TN2 A;  1K8A C;  2B63 B;  1VQO A;  3G71 A;  1LT4 D;  1IOW A;  2YV5 A;  2PI2 A;  1UC9 A;  4DU9 A;  3HOZ H;  2OH2 A;  1Q7Y C;  3I90 A;  3GP7 A;  2MO1 A;  3KHG A;  1ML0 D;  4CDE C;  3MVV A;  2UXC H;  3PR4 A;  4JI7 H;  4LF6 Q;  1SYC A;  4YIJ A;  4CC6 A;  4PMB A;  3M7N A;  1AUX A;  3GIP A;  1BKB A;  4C3I H;  3TZD A;  1ZKO A;  3K7A B;  2G9D A;  4DR5 H;  1W2B A;  3K0Y A;  1QJO A;  2F0W A;  2J6S A;  2IP4 A;  4R4O A;  5J2T F;  4DXF A;  3PO2 G;  1UEA B;  3TQT A;  2R87 A;  3EVQ A;  5EAY A;  5KFX A;  3H0G B;  2KHS A;  1G2S A;  1Y8N B;  2BE5 D;  4PQX A;  2MGS A;  2PMZ B;  2K33 A;  4A93 B;  2YZM A;  3GTM B;  2YTY A;  4I50 F;  1Q90 A;  3H09 A;  4CKC A;  4QJF A;  4LW1 A;  3CCJ A;  1GSH A;  3NK9 A;  5KFV A;  2KVM A;  3QO2 A;  1XMO L;  4ED8 A;  2FLN A;  4DAM A;  2YRX A;  4J0M A;  3K7U C;  5LA6 F;  3R2T A;  2CQA A;  4DV2 L;  1SNC A;  2KEC A;  4R4I A;  4JOI A;  4A4I A;  2KCM A;  1A15 A;  2DZD A;  3H3V I;  4IR9 A;  2H5X A;  2JA8 G;  1FKA H;  3RLF A;  4YY3 H;  3GTP B;  1GJX A;  2OTJ A;  5JJZ A;  5DLG A;  1VF5 C;  1SE4 A;  4NB3 A;  4UCR A;  1I4G A;  1G51 A;  2CWP A;  2K32 A;  5LYJ F;  1M7J A;  5COR A;  4ECS A;  3E0J A;  1Y1V A;  2OTL A;  4MV7 A;  2F0U A;  5KG2 A;  1RJQ A;  2HQE A;  1TU2 B;  1A9X A;  3ND9 A;  3C46 A;  1YVC A;  4DV7 H;  2F1M A;  1M8A A;  2ATW A;  5GON F;  4NXN H;  1N34 Q;  4HJ9 A;  1SND A;  1S4Z A;  4ECX A;  1PFS A;  1TS2 A;  1BQQ T;  3NEN A;  3SXH A;  2R92 B;  4TQR A;  2I5L X;  3U4V A;  4RGN A;  1YHA A;  2YRW A;  2E75 C;  4QW9 A;  4JI1 H;  3BDO A;  2W9B B;  1NBW A;  4ECY A;  1DON A;  3EYY A;  5LOV F;  2D62 A;  1H9J A;  2JEG A;  1CZG A;  2K28 A;  2ZM6 Q;  1CA5 A;  5L1I A;  3OSP A;  4K5X A;  3G6J B;  3NXW A;  1K83 H;  4CKE A;  2RGR A;  1GYF A;  2ID0 A;  3TEH B;  3HOU G;  1RJP A;  4MV1 A;  3S1R B;  2WTF A;  2PZW A;  1N32 L;  4QY7 A;  2B8G A;  3EQL C;  1N8R C;  1SFO A;  4LJZ C;  1AH9 A;  3U58 A;  1J5E Q;  4R8U A;  4EGV A;  2XTI A;  1BOS A;  4UY8 C;  4FXG C;  2D5D A;  1P8L A;  3TS0 A;  1TWH H;  3GTJ H;  3HOV H;  3KFU A;  4O4I F;  1SMY D;  4A3D B;  3M4I A;  4K5V A;  5TSS A;  2K5N A;  2IHE A;  1SYD A;  3P1H A;  1XNR Q;  2O5I C;  1K1Q A;  4JI7 Q;  5KFZ A;  1QNK A;  2E2H A;  2UXB Q;  3BZC A;  1P16 A;  2W9C B;  1K83 B;  4NLG A;  3I72 A;  5C4J B;  5KG1 A;  4DR3 H;  3MA2 B;  1D6E C;  2A5H A;  1YJ9 A;  4X66 Q;  1I4Q A;  2NYZ D;  5KFS A;  5EJW A;  1LT5 D;  2ES2 A;  2BH8 A;  4IUQ A;  2EYH A;  3Q0A A;  5DNF A;  1OO9 B;  4JI8 Q;  3VR5 A;  3W5O A;  1PK8 A;  3T51 B;  1UEB A;  4C3H G;  3PGZ A;  2WKD A;  5F9L A;  1MI2 A;  5KG5 A;  2GVB A;  3MWM A;  4OO1 H;  1H95 A;  4JV0 A;  3GV6 A;  3Q2O A;  1FJG H;  5E4X A;  3SK8 A;  1Z47 A;  4XQQ A;  1QB5 D;  4JI6 L;  4L5R C;  3H3V C;  4EBE A;  1JWU D;  3RD4 A;  2UXB L;  3JSN A;  2BQR A;  2DUD A;  4JV2 A;  3RB6 A;  1JE4 A;  2VXW A;  1CQI B;  1N34 H;  3OPO A;  5CMD A;  4J9R A;  3IAY A;  3QR8 A;  3RB3 A;  1IL8 A;  3RAQ A;  3NPP A;  4IN3 A;  1QIL A;  4GKJ L;  2UXD Q;  1KJQ A;  1HRJ A;  4KV6 A;  5J39 A;  2OWO A;  1RYR A;  2QGQ A;  1C48 A;  2L15 A;  2PBZ A;  3DUZ A;  1G8Z D;  4ZHQ F;  2DWC A;  1PYS B;  5HBR B;  4DR1 Q;  4RU9 A;  1GVP A;  5JAV A;  3T5H A;  4OL7 A;  1ZQ7 A;  2R6G A;  2IPK D;  1VQP A;  4A3J G;  1FNW A;  3VYS A;  3HOW G;  3I4N G;  5M3M G;  1I7L A;  2R6F A;  3RGZ A;  1STG A;  1Y1V B;  4XYL B;  2EJG C;  3J80 E;  1PV4 A;  4RUC A;  4A3C H;  3SDZ A;  2KEE A;  1NR4 A;  2B39 A;  4C3I B;  1JCK B;  2ZM6 L;  1SYF A;  5AJ3 L;  2JP1 A;  4GKJ H;  1V1P A;  3GTP A;  2W6M A;  1XWE A;  4R4T A;  4G4K A;  4OIK A;  3VPC A;  2G5D A;  4J9Q A;  1XNQ H;  5KYI A;  2R7Z G;  4R8I A;  1E2V A;  4UP7 A;  1YBY A;  3Q23 A;  3OOC A;  4JK1 C;  4H44 C;  4RZQ A;  3GIQ A;  2PQE A;  1XTD A;  3N44 B;  2B3G A;  2ASJ A;  3GTO H;  2B2T A;  3GTM A;  4LF5 H;  3BS1 A;  2PMZ A;  5KYL A;  5IOC A;  5LL6 b;  3M9B A;  1STY A;  4A3B B;  3UDG A;  1A0I A;  5GRO A;  4XXE A;  2RSN A;  5D14 A;  1VQ6 A;  4KJN A;  1VQ7 A;  4EQO A;  4LF4 L;  1YNN C;  1HR0 W;  4FYD A;  2P0A A;  2LXJ A;  2M2L A;  2BA0 A;  2N78 A;  5KT5 A;  4FNF A;  2F3I A;  4DV2 Q;  4LMQ D;  1CZW A;  3GV3 A;  3L0O A;  4IUU A;  4U68 A;  1MKH A;  3V05 A;  2UUA L;  4J8Q A;  2FIN B;  4ZUJ A;  3K80 C;  4GNX C;  2DN8 A;  1FGB D;  4DV4 L;  3Q6S A;  3AEV A;  3E9I A;  1H9S B;  3C1E A;  5H1S E;  3ICE A;  1AW7 A;  3TRE A;  5FK9 C;  3J81 i;  2JEI A;  4GC7 A;  2YU9 A;  3I4L A;  4YHH H;  4KD3 A;  1RHP A;  2K52 A;  1PH8 A;  4IRC A;  4ZI7 F;  4ECV A;  1STH A;  2UXC L;  1PYW D;  1DCZ A;  1TWG B;  1JJ2 A;  5CBA E;  4KI0 A;  4K0K H;  3PUX A;  1CHP D;  4X64 L;  1G6Z A;  1SNO A;  4UAI A;  3PF4 A;  2K6A A;  1KHI A;  2Z0S A;  4XT1 B;  5KFO A;  5DGB A;  1KLG D;  2C9O A;  4C56 C;  3KF6 A;  4N9P A;  1GGO A;  3DM1 A;  1GUG A;  1XMQ H;  4ECU A;  1ZEQ X;  3K5M A;  2PCF B;  2FMA A;  1E1T A;  5LMN L;  4DK1 A;  5M5W B;  5IYB G;  3NWS A;  1LAC A;  1XMQ L;  4E6I A;  3HG9 A;  4AYB G;  5M3F H;  3G6E A;  1DIK A;  4LFA Q;  3R8B A;  1O7Y A;  1JDE A;  2KEN A;  3GTM H;  2JEJ A;  2JA6 B;  4J9S A;  1BXR A;  4HIK A;  1TR5 A;  2XNA C;  1HR0 Q;  5I9P A;  4DL7 A;  3NEM A;  3S1M H;  3HFZ B;  5FD6 A;  1PDQ A;  4K8I A;  1K8G A;  2K5V A;  3Q22 A;  2I8C A;  2VUM A;  1LUZ A;  3V2T A;  4LF6 L;  3BG5 A;  4K0K L;  1WTQ A;  2HT1 A;  3D4R A;  3A5U A;  4L5Q A;  1AFP A;  1W6K A;  3TQY A;  1S10 A;  4DV5 H;  5K36 G;  4LFA L;  1NMG A;  4ID6 A;  2XRQ D;  3FPP A;  1YIT A;  5KFG A;  5EGT A;  3CQZ A;  3KLW A;  4C2M H;  5KT6 A;  3I70 A;  2K03 A;  1SE3 A;  3N41 B;  1AUV A;  1S40 A;  5CV5 A;  1XNQ L;  4R8N A;  1CT1 D;  4IO9 A;  2UU9 H;  1Y1W G;  1EQV A;  1PA6 A;  3TII A;  3PN1 A;  5C0X G;  4FS2 A;  2VUG A;  2PW7 A;  3C0F B;  2RDG A;  2EDG A;  3G7L A;  3R23 A;  3JAM W;  3GTQ A;  2VOB A;  2WE6 A;  1WCM G;  2E2H H;  5IYC H;  1X56 A;  4FDB A;  4DXG A;  1YJN A;  3N40 P;  1C3O A;  4F50 A;  4JBM A;  5JOB A;  2XD4 A;  4FXK C;  2Z4I A;  4JI0 L;  1C7Y A;  1UNN C;  1R9T H;  2RDH A;  3CW2 C;  4HJ5 A;  1VQK A;  1JIC A;  2YW2 A;  4HJ7 A;  2PZU A;  2W6Q A;  1JKJ B;  4JI3 L;  4ABN A;  2YTV A;  4ECQ A;  4MZ9 A;  4YAJ B;  3S17 B;  5BR8 H;  3S2D H;  2ATL A;  1CKM A;  2NN6 G;  2HD3 A;  1WTX A;  2NVX B;  2A69 C;  1JLL B;  4ED2 A;  1KQS A;  3OIP A;  1WVL A;  1OXU A;  4WOR A;  2N55 A;  2SNM A;  1OWT A;  3L4J A;  2LFN A;  4RB0 A;  4PG3 A;  1SMY C;  2FKL A;  4XZ3 B;  3S2H H;  1JQY D;  1E1O A;  2YYZ A;  1LLR D;  3W3A A;  4P73 A;  3HOW H;  3I4N H;  1TWC A;  1I6H H;  1GUW A;  4IPC A;  4KY5 A;  2B29 A;  4ZQ3 A;  1X3P A;  5E4W C;  5LMU Q;  4JCV E;  3I4M B;  4AQY H;  2RHS B;  4DR6 L;  1GO3 E;  2DJF C;  2J4X A;  3H15 A;  4LSX A;  4IHJ F;  3SI8 A;  2B2U C;  4RCN A;  1WCM H;  1QVF A;  1M0W A;  2CQO A;  1X3Q A;  1TQO A;  2CH4 W;  2QKI C;  5EWF A;  4ECZ A;  2XCA A;  1E3P A;  1WI5 A;  3BQ2 A;  1S72 A;  4PMC A;  5M3M B;  2PI2 E;  5GAD C;  3IN5 A;  3GTJ B;  3HOV B;  1R9T A;  2L12 A;  2JA7 G;  1PRT D;  2F0L A;  5KFY A;  2FFK B;  3I7F A;  5I2Y A;  3RB0 A;  3BAB A;  3KOJ A;  2J9G A;  3S1M B;  1IBL L;  2W6N A;  1VS0 A;  2E2I B;  3NWT A;  3ORR A;  3RBE A;  3FRP B;  4LFA H;  2KA7 A;  4O3R A;  3GID A;  1V9P A;  1VQI A;  4KJO A;  3TME A;  4U6P A;  1EZ1 A;  2NVY B;  5FO8 B;  3W2D A;  3CPW A;  4MV9 A;  4DR2 L;  2VQE H;  3HRZ C;  2LMC B;  5C1P A;  3QOJ A;  4Q8E A;  3RV4 A;  1L2Z A;  5NUC A;  4RNN A;  2CW7 A;  5I6W A;  3N42 B;  1UNS A;  3TS2 A;  1PFM A;  4P74 A;  2UXD H;  5C3E G;  1C9O A;  4G3I A;  1K73 C;  1SEB D;  1HR0 H;  4YCU A;  1D8L A;  3URY A;  4JI8 L;  1TWF B;  2EIF A;  5KG7 A;  2BQU A;  4YCW A;  1G29 1;  4A3E H;  1WTO A;  4F87 A;  1D5Z C;  3PIO 3;  5ISR A;  1IHZ A;  2WAQ E;  1FJG Q;  1EIH A;  3N8D A;  1JJC B;  4O3S A;  3H0G H;  5KT4 A;  3J7A K;  4O2B F;  1WYD A;  2MP1 A;  4TRD A;  1EUD B;  2FB9 A;  2F0P A;  2TSS A;  3RJ0 A;  5BN3 A;  3S17 H;  1BCP D;  4A3K H;  4DV5 Q;  1AP0 A;  4XIG S;  4LF8 Q;  4J9K A;  3HKS A;  3LNN A;  2HJW A;  1VMP A;  3M4Q A;  1PX2 A;  4KMU C;  2B2W A;  2EXZ A;  3CD6 A;  1IW7 C;  1IYV A;  1CQF A;  4HJA A;  3A8I E;  1XNR L;  2NVX H;  4HID A;  4O4H F;  4L8J A;  3RB4 A;  1TS4 A;  1ONL A;  5D3D A;  1RF2 D;  4JPB W;  4J9L A;  2MO0 A;  3V4S A;  1HUM A;  2EPB A;  1VMC A;  1S5E D;  1I6U A;  1E22 A;  4H02 A;  4A2B A;  1TVX A;  2AQ4 A;  1KDC A;  2ZTD A;  5KGU A;  5IWA L;  3D6W A;  1K1S A;  1S5F D;  2H4O A;  2B2Y A;  1TY0 A;  2Z6K A;  4WJ3 M;  1BXT A;  3S16 H;  1N32 Q;  2YS6 A;  4MV3 A;  3CCU A;  2OXP A;  5DLQ E;  4GLA C;  3FDT A;  5L9X A;  3KTM A;  4XQN A;  2B2W C;  3MTS A;  3KHH A;  3V96 A;  1UE7 A;  2RQX A;  4RWS C;  3PW7 A;  4BWS C;  4FXD A;  3WDN A;  4FF3 A;  4QB4 A;  4X3U A;  5KFR A;  4K6L A;  5ELC A;  2JEA I;  4A3G G;  5A2Q L;  1Z9F A;  2B8F A;  1RYS A;  3KAJ A;  1SJE D;  1SRU A;  2KED A;  2X6G A;  1UE5 A;  2D9U A;  4G7O C;  4LFB H;  2ZJT A;  5FJ8 H;  4RCO A;  5C44 G;  2CKZ B;  1KJ8 A;  3BQ0 A;  4QWE A;  1EFW A;  2BQ3 A;  4B3S L;  3NTH A;  1A2U A;  1LTL A;  3CC2 A;  2JQO A;  4ALP A;  4ULL A;  2W9A A;  2RBM A;  4O3N A;  2K01 A;  4JG2 A;  2SOB A;  5GAE C;  1AZQ A;  4KKT A;  4B3S Q;  4B3R L;  2KHI A;  2BR0 A;  4JV5 L;  4R4C A;  4A3D H;  3M4O H;  1XXG A;  5IYC G;  3R93 A;  1L1O A;  1EQQ A;  2XCP A;  4A3L G;  3BDC A;  4YR3 A;  2B2V C;  1QZH A;  1IBM H;  1RK5 A;  2PNR C;  2NTS A;  1DOK A;  1QVC A;  4X65 H;  4B3T L;  5ELD A;  4YY3 Q;  5C6A A;  5AJ3 Q;  2I46 A;  1STN A;  4R9W A;  3NEL A;  3V4Z A;  4L5S A;  1PXU A;  1X32 A;  1RCV D;  4IZ8 A;  2IY5 B;  4HN7 A;  3RN5 A;  3KXY T;  4QWA A;  3S1Q H;  1D5X C;  4P75 A;  2WB1 A;  3KAK A;  5GQO A;  5DQG A;  3BVM A;  3WOF A;  3MXN B;  4DR4 H;  3MR5 A;  4YJ2 F;  3K5N A;  2R92 G;  2R7Z A;  4PZ7 A;  4HQ6 A;  4QWC A;  1NR2 A;  3GTL B;  2KUM A;  4UDU C;  2HVS A;  5K5P A;  3I2Z A;  5IT9 W;  3OYY A;  4A3K G;  4GNX A;  2F0G A;  1ZXT A;  2MPM A;  3Q8S B;  2UXD L;  1KAB A;  1VQA A;  2CHB D;  5I4D A;  2E2I H;  1QZG A;  1X3F A;  3PIP A;  3V6J A;  4JW0 A;  3NQI A;  5L1K A;  2AMC B;  3OSO A;  3GTL A;  4X6A H;  3KJP A;  2R93 A;  5EDW A;  1EZ6 A;  3KK7 A;  3M3Y H;  1GOZ A;  1AE2 A;  3FHW A;  3KF8 B;  3PO2 B;  4JI0 H;  1D1K A;  2I5H A;  3SVM A;  3WO0 A;  3I73 A;  2A69 D;  1T5E A;  4ME6 A;  4RMF A;  2VQE Q;  4FP5 D;  1I3Q A;  2W7O A;  3RNU A;  1LV9 A;  1TWC H;  2B2T C;  1XJV A;  3K5O A;  4PNY A;  2Q2U A;  3I4M G;  3P20 A;  1EYA A;  1EYD A;  3A8K E;  5IGG A;  2F0M A;  2CWA A;  4GLX A;  3C1F A;  4LF7 Q;  3HOU H;  1GUO A;  3RMH A;  1VQ9 A;  5JEA H;  4J9M A;  3A55 A;  2EZV A;  5L1L A;  1TWH A;  3K3V A;  4BY1 G;  4IUV A;  4RG1 A;  3GTK B;  4O1N A;  4J6H A;  3S2H B;  2V58 A;  2ZDG A;  3M7G A;  1EY9 A;  1XTC D;  2PPB C;  4JI7 L;  4YAK B;  1XMO H;  2UXB H;  2R92 H;  4OXP A;  1GHK A;  4RAU C;  1NNX A;  3HOV G;  3GIL A;  3X3N A;  4A3K B;  2UVU A;  1BUV T;  2F0K A;  5ELN A;  3VMM A;  1L0X B;  2FHT A;  1LTT D;  4CJ2 C;  5HUR A;  2VY3 A;  1M90 C;  4F4X A;  1GSA A;  4OWW B;  4TV9 F;  4B3T Q;  1S5D D;  4AYB A;  1K3R A;  1ICF B;  2IL8 A;  1Q81 C;  4MA0 A;  1PRT F;  1HFN A;  3P75 A;  4A3M G;  5CGK A;  1Y8O B;  4XTC S;  3EFX D;  3RGX A;  1F9S A;  4DV6 H;  1YEZ A;  3OHA A;  1TWA B;  5C44 H;  1L2F A;  4CJ0 B;  4DL5 A;  1AZP A;  3J81 c;  2AQ2 B;  2J0T D;  3D3R A;  5C5M A;  3KLS X;  2V1C C;  5IGB A;  1LTB D;  2K50 A;  3N52 A;  4MNO A;  3R5F A;  5BR8 Q;  1RL2 A;  2GA4 B;  4OWT B;  4LF7 H;  1EEF D;  3PW0 A;  1SMX A;  5C4Z A;  4WRD A;  3PW4 A;  2IBK A;  3J81 W;  4NPS A;  2VZA A;  3OTO Q;  2XC9 A;  3CME A;  2R86 A;  4TQS A;  1I94 Q;  1HNX Q;  4LFC Q;  5JPN C;  4QIW B;  5GAG C;  1I5F A;  3R2I A;  2I0Q A;  4EBC A;  1ET6 A;  2ZT9 C;  2XGP A;  1I4H A;  1DYQ A;  3CXC A;  4DV7 Q;  3H94 A;  4Y7N B;  3CRK C;  1PTO D;  1FNU A;  1F77 A;  1EIF A;  2IMW P;  1EYG A;  3ERQ A;  1BCP C;  4EGJ A;  2NVQ B;  3GTG A;  2NVT B;  3NGD A;  3C2P A;  2R84 A;  3PVX A;  2ICI A;  2HVQ A;  3PR5 B;  1EZ8 A;  4NDX A;  5EPL A;  4AQY L;  4KHP L;  2ZJR A;  2IX1 A;  4OIJ A;  1VCI A;  5C4X H;  1HHV A;  1ILP A;  2K14 A;  3RTX A;  3CVZ A;  4DR6 H;  5IGF A;  2HQL A;  3K81 C;  2VB3 X;  2NB0 A;  2QCP X;  4G7Z C;  1JB3 A;  4A3B G;  3I55 A;  3AQQ A;  3FKI A;  3IL8 A;  4UCO A;  1CM9 A;  4MA5 A;  5JJL A;  1GXD C;  2VQF Q;  4C3H H;  5A2Q W;  4DUY H;  3QWN A;  1QNU A;  2DNE A;  5K36 H;  3HOX G;  1WTW A;  3S1N H;  5DQI A;  1VQM A;  4L5T A;  2E2J H;  3E5S A;  4LWC A;  4C5C A;  4CC5 A;  1RTO A;  3T1Y H;  2JA8 B;  4DLK A;  1GD7 A;  2C5C A;  1EY0 A;  5CYU A;  2OT2 A;  3K5I A;  2A1A A;  3ETH A;  5AFW A;  4PMW A;  4DV2 H;  3J7A F;  3F8T A;  1V4Y A;  4A3G B;  5M9O A;  5JQW A;  1S0M A;  1K8O A;  5EBD A;  1SJH D;  5C5L A;  4J9O A;  1STA A;  3J7A 5;  3GV8 B;  4HIO A;  4IPG A;  4JVZ A;  3CHB D;  2XWB B;  2RHQ B;  5D65 A;  3OUU A;  2A74 C;  1FD7 D;  2Q8T A;  3U9O A;  5LHY 1;  4ECT A;  2VNU D;  1EOV A;  5KFW A;  5FLX c;  1M4V A;  1B6R A;  3RLO A;  1KDB A;  3OUZ A;  1RJR A;  5FLX L;  1VQN A;  1R9T B;  1DD2 A;  1WTH A;  4GOP B;  2RDF A;  2FK1 A;  5FD5 A;  3ULP A;  1X6O A;  3ETJ A;  1EU3 A;  5M5X B;  1DXM A;  2XVS A;  4GN5 A;  3MR3 A;  3PO3 G;  4ZKC B;  2JA7 B;  1KJJ A;  2F4I A;  4OGQ C;  2E5L L;  4B3M L;  4A3F H;  3B6Y A;  1M6V A;  1BDO A;  3K58 A;  2HCC A;  4L1K A;  2R3Z A;  1V8Q A;  5KFN A;  2UUB L;  5IOD A;  4O3P A;  2ENB A;  4ED3 A;  1B50 A;  4LF5 Q;  3AYH B;  5C3X A;  2WIN B;  1B8A A;  2A68 C;  3OTO L;  1ASZ A;  3RZO H;  4LF9 L;  3K7A H;  3FKI B;  1PFB A;  2YCH A;  1CSP A;  2SDF A;  4J15 A;  3CCR A;  2AUJ D;  1S5C D;  3S15 B;  4X62 L;  2UUC L;  4OEL B;  5IP9 G;  4LF4 Q;  4DV7 L;  4K8J A;  4QCL A;  2VQF H;  4DUZ Q;  4DV3 L;  3EJI A;  4RUA A;  4EYI B;  1W96 A;  5DG9 A;  5BMV F;  1L1O C;  5DEH A;  4A3J H;  1PLF A;  1VQF A;  2WYO A;  2HUG A;  2AWO A;  1PMR A;  1SYX B;  4BBS H;  3JZI A;  3C3L A;  2QDB A;  4DK0 A;  1C8C A;  4BBS G;  2A6E C;  4C3H B;  2KCT A;  4JOI C;  3RN2 A;  5D1O B;  3FP9 A;  3TP6 A;  3STB C;  3VYU A;  4DUY L;  1T94 A;  3UDF A;  4DAY B;  4LF9 H;  2EVB A;  1Z2O X;  2VPS A;  2J7Z A;  1F2Y A;  1Y8P B;  3I4O A;  3KDF B;  4MHE A;  1EUC B;  4UCU A;  2VA2 A;  4DV1 L;  4NXM Q;  1G6P A;  4NW2 A;  2WAQ G;  4A3F G;  1JX4 A;  1CTM A;  3S9W A;  3U4Z A;  3PV0 A;  4DR1 L;  1MZB A;  2QIL A;  3BJY A;  1KRS A;  2R7L A;  3S14 B;  1CQV A;  1KTK A;  3L9A X;  1Z7T A;  3QIA A;  4O2D A;  3UDI A;  4P71 A;  1YHB A;  2RDJ A;  2F52 A;  3L4K A;  4A3E B;  1Q12 A;  3RV3 A;  2HDL A;  1FL0 A;  3PW5 A;  4V19 0;  3SE0 A;  4ZKB B;  2SEB D;  2YU9 H;  3TP7 A;  1EY7 A;  3L3O C;  1DV1 A;  5LMU H;  1UUP A;  3CQZ H;  3QB3 A;  3PUZ A;  4KHZ A;  2NZO A;  3M85 A;  4E4T A;  2VPQ A;  1SAP A;  3NTI A;  4JUZ A;  4J9P A;  1D5M C;  3BZK A;  1B44 D;  1IZ6 A;  4A3I G;  3FMC A;  5KFU A;  1D2B A;  1FNV A;  1YJW A;  2CW0 D;  2V4Q A;  4GZY C;  2JEF A;  1XX8 A;  1EWC A;  2F0D A;  1ENF A;  4N9T A;  2VQE L;  4DR2 H;  1RKN A;  4QUF A;  5EPK A;  3JRW A;  5CBE E;  3OMG A;  2EYJ A;  4X64 H;  2L4N A;  1JWS D;  2HHH Q;  1B53 A;  2JSO A;  2V59 A;  4UCS A;  4HED A;  4LF8 H;  4QF4 A;  4Z9C B;  2X0S A;  1SYG A;  3S2D B;  2F0T A;  3GV7 B;  1JC7 A;  1B3Q A;  1RIP A;  1V43 A;  2N3S A;  2Q2H A;  3ER0 A;  1V51 A;  3SK4 A;  4EFB A;  2YU9 B;  1HR0 L;  3S16 B;  1STE A;  2YL2 A;  3RIZ A;  2PYK A;  4XYQ A;  5M5X H;  2QEX A;  2HHH L;  1BJT A;  3HXL A;  1H9S A;  3BG3 A;  2WKC A;  1TWA H;  2Z8L A;  1S68 A;  4LH7 A;  2K4K A;  1N56 A;  1TWF H;  3CCQ A;  3HKZ E;  3KDF A;  3MZ5 A;  1LTG D;  1XPO A;  1WTV A;  1I3Q B;  1YNJ D;  4HCE A;  4DR3 Q;  3JSL A;  1VBG A;  1CKN A;  5BN4 A;  1O7I A;  1EYC A;  2EJM A;  1GHJ A;  3D4D A;  4LUO A;  4RNO A;  1KC8 C;  4DR7 Q;  1Q82 C;  3GII A;  4JI1 Q;  4JI2 H;  1C4Q A;  5LL6 X;  4YB8 B;  2TMP A;  2AQ1 B;  1N33 H;  2EXD A;  5C1O A;  4S3S A;  2UUA Q;  3MFG A;  1IKM A;  3N6X A;  1NJI C;  3GTQ H;  3HZX A;  2E74 C;  1B2T A;  1RDP D;  3S24 A;  2B2V A;  4JI4 Q;  2Z6K C;  1JWM D;  1PVO A;  4DNI A;  4ZK9 B;  2JK8 A;  3LX0 A;  4OX9 L;  4I4T F;  4DUZ H;  3QZ8 A;  3K57 A;  3MEH A;  5D1P A;  4LK1 C;  4HCS A;  5C3E B;  2JJQ A;  1NSN S;  2YZN A;  5IYZ F;  3ITP A;  2HGS A;  2IW3 A;  2UVW A;  1B6S A;  1F9R A;  4Y52 H;  1Z6H A;  2VS1 A;  5M5W H;  4IOC A;  2VQD A;  5KRU A;  1B04 A;  3KHL A;  1A2T A;  4NKL A;  1QUQ B;  1W3S A;  1MIU A;  1KDA A;  1X55 A;  2A6H C;  2F0Q A;  5ELO A;  2ZTE A;  3HKZ G;  2VUM H;  3Q8R B;  2LSS A;  3QOL A;  5HGQ A;  1PH2 A;  3H3V H;  4UFZ A;  5KFF A;  2NN6 I;  4NXN Q;  2RGV A;  4DR7 L;  1H9M A;  2FP4 B;  1EQT A;  3HOZ B;  2K05 A;  3F2U A;  3BA8 A;  2W8K A;  4TUY F;  3Q1K A;  5C4X B;  1E2W A;  2W8L A;  1OXV A;  3BZD B;  3E3X A;  4BS9 A;  4RKL A;  4CBV A;  1EEI D;  2IX0 A;  1KJI A;  3R5X A;  3AB9 A;  2R7Z H;  4DL4 A;  2NU8 B;  4YR0 A;  1B70 B;  1KXL A;  1KAA A;  2UUA H;  2VA3 A;  2F4V H;  1S0N A;  4MV8 A;  1VQL A;  2C35 B;  4UCV A;  5IP7 G;  4HNV A;  1IBK L;  3I4N B;  3HOW B;  1IBM L;  5DQH A;  3PIO A;  4YHH L;  2F0S A;  1CFM A;  2EYL A;  1KLU D;  1UAP A;  1X9N A;  1JB7 A;  3MFI A;  1S9F A;  5KT2 A;  4HNU A;  1HTL D;  4Q45 A;  4IZO A;  4JYA H;  4IFD H;  4ILW A;  1TII D;  2OQ0 A;  1TXY A;  5C3W A;  1QOH A;  4ME5 A;  4EVO A;  3PO3 B;  4WFN 3;  1NAP A;  2QK4 A;  4ZAI A;  5EWE A;  2F0H A;  3BYT B;  1K83 A;  3DM3 A;  1SYE A;  1KD1 C;  1CS0 A;  1A63 A;  4IWY A;  3BAA A;  5KNC A;  1NY4 A;  1FJG L;  2WB1 B;  4IWX A;  4BBR H;  2XCL A;  1CKN B;  2QEJ C;  1IBK H;  4IPD A;  1Z2N X;  1YNN D;  1F9Q A;  4YWK A;  2XIW A;  4DKA C;  4F7X A;  4GC6 A;  1RD9 D;  4IRK A;  1HQM C;  1HZB A;  5E3F A;  1E4F T;  2F0N A;  4LF8 L;  4DV5 L;  1VKZ A;  2I80 A;  2A19 A;  5KX5 F;  3G8C A;  1EL0 A;  1BBX C;  5KIX A;  2VW9 A;  2ZDH A;  3MWD A;  2AGQ A;  2XWJ B;  2UUB H;  3MXU A;  4EEY A;  3KUP A;  2UVV A;  3RFC A;  1GM5 A;  2IHF A;  3BQ1 A;  4RA8 A;  2RCN A;  1A3T A;  4BY7 H;  1HNW L;  3NQT A;  2F4V Q;  1FVI A;  2DJG C;  4L6T B;  1IXR A;  1PH3 A;  1SYB A;  1WJJ A;  3PCO B;  2UU9 L;  3GLK A;  4KHP Q;  4IAL A;  4O2A F;  3T1Y L;  5KG3 A;  3P7J A;  4QIW A;  2W9B A;  4JV1 A;  1IYU A;  1K3B C;  4IRD A;  1LT6 D;  1M1K C;  5EKI A;  1ET9 A;  4UP8 A;  2V9W A;  3J81 j;  4A3I B;  4RFB A;  2WAQ A;  3PUY A;  2K5H A;  1TWF A;  1WOC A;  5L37 A;  4C1N I;  2W6P A;  5KND A;  2XRS D;  1RK6 A;  5E1F A;  4YWL A;  5FOB B;  1NMF A;  2L9H A;  1I94 H;  1HNX H;  1NE3 A;  4LFC H;  1AN8 A;  5CC4 A;  2XN9 C;  2EY1 A;  4OWX B;  1VQ8 A;  1SNQ A;  3CF5 A;  1PH7 A;  1S03 G;  1YI2 A;  4P72 A;  4DAP A;  1I3Q H;  5IT9 L;  3HEJ A;  1ZET A;  2ZXP A;  4DV1 H;  2D2C C;  2R8I A;  1CKO A;  3E6Z X;  4EG0 A;  5BR8 L;  4UHV A;  4C5A A;  1EIG A;  2JA6 G;  2NN6 H;  2J6T A;  2MFI A;  2CH4 A;  1A8V A;  4AYB B;  4DFA A;  4DNR B;  1DOM A;  3J80 L;  3T1H L;  4GKK Q;  3CU7 A;  3K5L A;  3NHH A;  4POG A;  4QIW E;  5HV6 A;  1CQJ B;  4EQP A;  5K2M A;  3GV5 B;  3UI2 A;  3PIP 3;  5T1I A;  4TV8 F;  1EUJ A;  5EPJ A;  1VAJ A;  4APM A;  1F2M A;  2DGY A;  4B9X A;  1D1I A;  3DF7 A;  4TKO B;  3V6K A;  1SR3 A;  5LMU L;  1ESR A;  4H7B A;  3E9H A;  3U50 C;  2R7D A;  3RUZ A;  1PH9 A;  4I55 F;  2L5T A;  4DPG A;  2FXQ A;  4HTH A;  1EY4 A;  2K5Q A;  5C4J H;  3TDQ A;  2F0V A;  1ASY A;  3DXJ C;  3PO2 H;  2EQS A;  4QW8 A;  4DL3 A;  4ZCK A;  1QUQ A;  4O0A A;  3T1Y Q;  1JR0 D;  1O80 A;  3SK5 A;  1KBL A;  2R8J A;  4HIM A;  4MTK A;  2Q2I A;  5IP9 H;  1Y14 B;  2B63 G;  2F03 A;  2IX3 A;  3GTG H;  3S1N B;  2DPJ A;  2ZM6 H;  3A56 A;  5CV6 A;  4C3J B;  3OWF A;  2QYZ A;  4MN3 A;  4EX5 A;  5FO9 B;  1JOQ A;  3QFF A;  2E5L Q;  4B3M Q;  2UU9 Q;  1HZA A;  3A7L A;  4C3I G;  2K5W A;  5FLX E;  3J7Z C;  4GOP C;  5KFM A;  1ROD A;  1SE8 A;  3LWB A;  3Q8Q B;  2ASL A;  1Y69 U;  4HSV A;  3T56 B;  1N32 H;  4C2M A;  4X65 L;  4QQB X;  2EE1 A;  1BCP F;  3F2B A;  2FJZ A;  5J2U F;  2GLT A;  3SEB A;  1XNQ Q;  1JOO A;  4JBW A;  3RAX A;  2CZG A;  4JI4 H;  3BU2 A;  2PN1 A;  1HFG A;  2N88 A;  4KN7 C;  1WTP A;  1R4Q B;  1CK1 A;  2R7Z B;  3FVQ A;  3T13 A;  5FKA C;  4RGT A;  1SE2 A;  1JT8 A;  2ASB A;  1QG7 A;  3RR5 A;  5KFD A;  4JI5 L;  4GOP A;  1HZC A;  4BY7 B;  3K3P A;  2G9H D;  4MV6 A;  4AIM A;  3CCV A;  5COY A;  4UCT A;  1I4X A;  3AU7 A;  1PRT C;  3GTQ B;  4F88 A;  4RHS A;  1K9M C;  1Q8K A;  1Y1V G;  5I2X A;  4OON A;  1A3U A;  3GD7 A;  1IBK Q;  4K0K Q;  1EQR A;  3G6Y A;  3CCE A;  4FVM A;  1DV2 A;  1EY8 A;  2Y0S A;  1CUK A;  2QF7 A;  2K7V A;  4LSA A;  1VF7 A;  1CHQ D;  1U4L A;  2RCF A;  2VL6 A;  4ED1 A;  5EWG A;  1E7Z A;  1FGU A;  2DLN A;  2UVR A;  4BA1 I;  5CA0 F;  1K28 A;  1T9H A;  2DY7 A;  1LTI D;  2LS0 1;  1SXT A;  1UWV A;  2EYF A;  2EY6 A;  4A2A A;  5G3L D;  1DGS A;  3MEF A;  1IBM Q;  2PO4 A;  4I7Z C;  5C4X G;  4HMI A;  1HA6 A;  1TWC B;  4M8A A;  5IGE A;  1PTO C;  4A3B H;  5I47 A;  1FR3 A;  3MFH A;  4IFD G;  1VQJ A;  3W1B A;  5IYD H;  4EQN A;  3NBI A;  3BJU A;  3EPI A;  2W6Z A;  2HHH H;  1BGW A;  3H6M A;  2NU7 B;  5BPH A;  2DY8 A;  4LMY A;  3VR6 A;  3G6V A;  2RSO A;  4DV4 Q;  2MHV A;  5ELF A;  4FF1 A;  3AFP A;  1J6Q A;  4A93 H;  3V6H A;  3W1G A;  5E7N A;  4NXN L;  3L7Z C;  4QWB A;  4C1N K;  1X65 A;  2R7M A;  2NWG A;  3GTG B;  4X3T A;  1PH5 A;  3GTL H;  1TA8 A;  2ALZ A;  1S3O A;  3N6R A;  4XT3 B;  2NU9 B;  4POF A;  1AN7 A;  4RB2 C;  3OTO H;  1JDB B;  1TWG H;  5M3F B;  4IAJ A;  2R85 A;  3RUP A;  3MR2 A;  3IRB A;  4RHR A;  5F2D A;  3ORQ A;  4B3R H;  4MIU A;  2GPW A;  1YHQ A;  3O13 A;  2UUC H;  3GIM A;  3MXG A;  4JI1 L;  4JBJ A;  3S1Q B;  3M3Y B;  4YJ3 F;  2NVY H;  5JPM C;  3JAM L;  1EY6 A;  1VQ4 A;  3HOY G;  2CFM A;  2BDO A;  4JI4 L;  4CHT B;  5T14 A;  5C0X H;  5KG0 A;  2L0C A;  4PDB A;  2E2D C;  5JJK A;  1K0S A;  5KFA A;  1JOK A;  3CQZ B;  3NTK A;  1ZYR D;  1XDN A;  1JMC A;  1JXL A;  4EQ5 A;  3T53 B;  5JH7 F;  3MR6 A;  1S0O A;  4K5W A;  5KG4 A;  2AWN A;  2OEO A;  3D4W A;  3VYR A;  4TQU S;  1TT2 A;  4MTE A;  1L0W A;  5L1J A;  2PZT A;  1S97 A;  1GUS A;  3BVG A;  1N9W A;  3G6X A;  3TP8 A;  3EPG A;  3CPF A;  4ZUI A;  4BY1 H;  4P2C B;  4AH6 A;  2R93 G;  3EIV A;  1YIJ A;  3M9O B;  1KNA A;  1HNW H;  3WOE A;  3T5K A;  2F0J A;  2OF1 A;  4LFB Q;  1K0R A;  1H9R A;  2M9V A;  1GSO A;  3HOZ G;  1U4P A;  1O75 A;  4A3I H;  5DLF A;  4PZ8 A;  3FPU B;  5LL6 S;  2ZJQ A;  4JI5 Q;  2FLL A;  4JI3 H;  3CAM A;  3DWP A;  3VR2 A;  2HIX A;  4X66 H;  5JJI A;  4K2L A;  3PMF A;  3GQB A;  4QMG A;  1EWH A;  3MWY W;  4RAY A;  3OHB A;  4MAM A;  4LFB L;  2FMM A;  1EOT A;  1VQB A;  2A68 D;  4BXX G;  3GTK A;  3T16 A;  4X3K A;  1TWH B;  2I5M X;  1GLV A;  1E0B A;  2Y0S B;  1X54 A;  3J80 c;  2KBN A;  4R4Q A;  1OTC A;  2AKW B;  3UDX A;  1XPU A;  4B3S H;  5EKL A;  2JXM B;  1EFI D;  4RH6 A;  4A3E G;  3HB9 A;  4U7C A;  1Q86 C;  1TAE A;  1DJR D;  4QWD A;  1SSO A;  1WFQ A;  1JOR A;  4DR2 Q;  2CW8 A;  1HA5 A;  3VPD A;  2WP8 J;  4DR1 H;  3UQ8 A;  3GTJ A;  2B63 H;  3M9M B;  4HNT A;  2F0I A;  1LYL A;  1PTO F;  4EEQ A;  5T1G A;  5D1O A;  4LNQ A;  1II3 A;  2RF4 A;  5KFB A;  4YY3 L;  1TS5 A;  4ZRZ A;  5IP7 H;  2A6E D;  3ERS X;  5FLM G;  1J9O A;  3STB D;  5IYB H;  3F1Z A;  2R93 B;  4C5B A;  1IBL Q;  3KAL A;  1M0T A;  1EWI A;  3CP0 A;  3CRL C;  3SR1 A;  2V4D A;  3J81 E;  5C0X J;  2LY7 A;  1ENC A;  4K6D A;  4CJ1 B;  1YNX A;  1J5E L;  2JA5 B;  4A75 A;  1KIX A;  4GNX B;  4A3D G;  3M4P A;  4DK3 C;  3E0E A;  4NXM L;  1KC7 A;  5KKN B;  4C2M B;  2B2Y C;  4JI8 H;  1X3G A;  4G57 A;  1BCP B;  3BYY B;  2YZG A;  3FEW X;  1SNM A;  2X69 A;  4EYH B;  4DR4 L;  5C0X I;  4XYM B;  2A73 B;  2NVX A;  1CSQ A;  1PH4 A;  1DZ1 A;  3LWE A;  1N34 L;  4I7A A;  1BF4 A;  3Q8D A;  2JE6 I;  4A3M H;  3HOU B;  1I7N A;  1ZHQ A;  4ECR A;  1EYZ A;  1PTO H;  4N8F A;  4DUY Q;  4PWQ A;  4KTA A;  4LF9 Q;  3QZ7 A;  1A3V A;  2Z1C A;  1V1O A;  1G91 A;  2B2U A;  3TBI B;  2JA7 A;  3HOX B;  4R8U B;  4LF5 L;  2UUC Q;  3ONA B;  3ND8 A;  3I3C A;  2R8K A;  5KFQ A;  1E24 A;  3PSI A;  4IUN A;  4ZQI A;  3PUW A;  4DUZ L;  2AHO B;  3SGI A;  4DV3 Q;  4FF2 A;  4DR6 Q;  4OX9 H;  1IYJ B;  4IJL A;  2CW0 C;  5IGD A;  1HXY D;  1VQG A;  5A35 A;  3N43 B;  5A2Q E;  1HJP A;  2BE5 C;  1XYI A;  2K5D A;  4KN4 C;  4ETS A;  5FLX W;  1TY2 A;  3A0J A;  2VUM G;  4GN4 B;  4FBU A;  4DAV A;  3GIK A;  1H9K A;  4IUR A;  1F9P A;  5JVG 3;  4A3G H;  2NUA B;  3J80 i;  2ICE C;  1I4P A;  4Q0F A;  4H0L C;  5EQ0 A;  1OXX K;  3TIG A;  5LP6 F;  1A6X A;  1WH2 A;  2JA8 H;  1VQH A;  3WWV A;  1X3E A;  4Y8V B;  2VB2 X;  5IYD G;  4J9N A;  2RVL A;  4Q44 A;  4JC0 A;  1U0L A;  2HIV A;  4XDX A;  5I6Y A;  4QGU A;  3A54 A;  2O4X A;  2EY2 A;  2IJ0 A;  5CAE B;  3PQI A;  4XYO A;  3GO5 A;  1B7Y B;  4APV A;  5G3L F;  1NCV A;  5CV7 A;  3CMA A;  1VQC A;  1C0A A;  1T3N A;  5JEA G;  5M3M H;  5IWA Q;  4WJ4 A;  5IWA H;  1IBL H;  1WCM A;  4RNM A;  1AE3 A;  4MTN A;  3TP5 A;  4HJ8 A;  4A3C G;  2OQK A;  1KRT A;  3S1R H;  2EYP A;  4OO1 I;  1JJG A;  5JUM A;  2IA6 A;  1S5B D;  2AGO A;  1PRT B;  4ME3 A;  5CV9 A;  4EFE A;  1MSH A;  2WAQ B;  4Y7N H;  4A3F B;  3LML A;  3KBG A;  4FBT A;  3H0G G;  3DWQ A;  2DIK A;  1EHI A;  3S14 H;  2AU0 A;  4O42 A;  3OW7 A;  4KY6 A;  2M05 A;  2ASD A;  3KF6 B;  3GTO A;  1ULZ A;  5KFK A;  1AEX A;  4DV0 Q;  4G7H C;  1LT3 D;  1QE6 A;  4GN3 B;  2BH2 A;  3CCL A;  3OW2 A;  4WD3 A;  1I4R A;  2R8H A;  3I56 A;  4RB3 C;  3OHX C;  4NXM H;  2YTX A;  1RJT A;  1XMQ Q;  3DEO A;  3QG1 A;  4JI2 Q;  3L2P A;  1B1Z A;  3LGJ A;  3H0G A;  4DR7 H;  3T4A C;  1SN8 A;  1W93 A;  1JIH A;  4KK7 A;  1GKH A;  4O3O A;  5J1Z A;  2O03 A;  2RDI A;  3WO1 A;  5IT9 c;  3OWE B;  4CDC C;  1Y1V H;  2WII B;  5IGC A;  4AQY Q;  4B08 A;  1UE6 A;  5I9O A;  4A3L H;  4YHH Q;  2R82 A;  2XGQ A;  3GTP H;  3HOX H;  4A3M B;  2R92 A;  1F2Z A;  3RZD B;  3A8J E;  4JYA Q;  4JV5 H;  3J7Y W;  2PMZ E;  3FKI H;  2F0E A;  2E2J B;  2WV6 D;  3DHQ A;  3VPB A;  5KFL A;  4LAA A;  2NBF A;  4I7H A;  3S15 H;  5EKK A;  1ENA A;  3EBE A;  4EBD A;  4IUT A;  3NBH A;  2PW5 A;  1LAB A;  1BO0 A;  1MHW C;  2D0P A;  2FE3 A;  3BVZ A;  1N33 Q;  4ED7 A;  4QUC A;  4LF6 H;  5CV4 A;  1TWA A;  2UXC Q;  1ZYR C;  4C3J G;  2E5L H;  4B3M H;  3PZP A;  3VA5 A;  3H20 A;  3IFT A;  1Q1E A;  2AUK A;  2F3V A;  3EN2 A;  3GQC A;  4DV0 H;  2JA9 A;  3NUC A;  2KCN A;  2BDN A;  2DNC A;  5FPO A;  5KT7 A;  1FYC A;  3RBD A;  4LUV A;  2N8N A;  2R8G A;  1MBY A;  3MXN A;  2QA4 A;  4MTD A;  5LMN W;  3AFQ A;  2Q8I B;  2C2R A;  2NZ1 D;  1MSG A;  1Q3L A;  3T1H Q;  3HOY H;  4GKK L;  2SNS A;  2NVQ H;  4RGO S;  4LFC L;  1I94 L;  1HNX L;  4FU0 A;  2F3W A;  2KHJ A;  3HP3 A;  4R7R A;  5C5J A;  1SLJ A;  3PW2 A;  2D0O A;  2R7N A;  4DR4 Q;  4DV4 H;  4YR2 A;  4KLK A;  1ESF A;  3NBH B;  2O2L D;  1WSC A;  4OX9 Q;  4M7E A;  4DV3 H;  1I50 H;  3G4S A;  3Q24 A;  2K04 A;  1GUN A;  4J1M A;  3K8A A;  5FO7 B;  4CKB A;  3K59 A;  5KFP A;  3A7A B;  1UE1 A;  4GKK H;  1R4P B;  3ERO A;  2GN5 A;  4A93 G;  4M9U A;  5F9N A;  3EA6 A;  3TRZ A;  2NZH A;  3SHL A;  4HSP A;  2AQ3 B;  3UE1 A;  1Q46 A;  1O7L A;  4DL2 A;  1Q1B A;  4FO2 A;  1BBU A;  3IFD A;  3KBX A;  1HPC A;  3D0F A;  5C4H A;  2PNH A;  3OSN A;  3KF8 A;  1E4E B;  4K14 A;  4IJH A;  3KYH C;  5FJ8 G;  2V5A A;  2SCU B;  1W6J A;  4DR3 L;  5J22 A;  2FPI B;  3GIJ A;  2Z4H A;  2B63 A;  1L0Y B;  1PZK D;  5EBC A;  4JYA L;  2EOT A;  3HKZ B;  4DF7 A;  1CA6 A;  4OO1 G;  2MCT A;  5KFT A;  2J6U A;  3MFY A;  4IPH A;  2GVA A;  3I8Z A;  3DWA A;  4JI6 Q;  2I87 A;  3GTO B;  2OLS A;  2Q2T A;  3IKJ A;  1B9N A;  5DM6 3;  4UP9 A;  3X3M A;  4NMZ A;  5JVD F;  5DG7 A;  4YCV A;  3PF5 A;  2YS7 A;  5CA1 F;  2EJF C;  5CR3 A;  2W9C A;  4LF7 L;  1VQE A;  2KCC A;  4XQJ A;  3A5Z B;  2F4V L;  3RF2 A;  3G48 A;  2FK2 A;  2IT1 A;  2FPG B;  1LTR D;  3Q8P B;  3DEP A;  1N36 H;  4XX0 B;  1QCB D;  1WCM B;  2QDL A;  3SK6 A;  2NVT H;  3J80 W;  1I50 A;  3J81 L;  1MGS A;  5LMN Q;  1O78 A;  2CCZ A;  2BOS A;  4RZR A;  2JA5 H;  4KD4 A;  3RZO B;  2ZTC A;  2HDM A;  4U67 3;  4DV0 L;  1IKL A;  1YZ6 A;  2RA4 A;  3A74 A;  4I65 A;  1XNR H;  1SFO B;  4X64 Q;  5FPR A;  2I07 B;  4R1J A;  2R93 H;  1L1O B;  1SCU B;  3VR3 A;  2LKV A;  3H4B A;  4AYB E;  3MJF A;  1N36 L;  4TVA B;  1LTS D;  2FJ2 A;  3PUV A;  4LF4 H;  4IFD I;  2C2E A;  1KNE A;  1I6H B;  4CDD C;  2XSC A;  5C44 B;  1SFO H;  3HOY B;  2EY5 A;  2FPP B;  2VUM B;  3IG0 A;  1U5K A;  1WD0 A;  5EOY A;  3LP8 A;  4DL6 A;  1B9M A;  1PZJ D;  2WFW A;  4HYK A;  2CQY A;  1MD2 D;  3LWU A;  4RB1 A;  1OXT A;  2KJX A;  1SBB B;  4B3R Q;  1B4O A;  2Z9H A;  1HH2 P;  3I12 A;  5JEA J;  1K8M A;  4A76 A;  3UFX B;  3KLS A;  3T5J A;  3K5H A;  5BPF A;  4M1U B;  2MUY A;  5JVH 3;  1VBH A;  2JN4 A;  2MNA A;  3MAQ A;  1SEI A;  4JBK A;  3MC0 B;  4YQW A;  1LM0 A;  1TWG A;  5KFC A;  2XGT A;  5ELB A;  2NVY A;  4JV5 Q;  4ED6 A;  1SNP A;  1B3A A;  4WJW A;  3RZD H;  3KJO A;  5C8Y F;  4JI6 H;  1PH6 A;  3F8N A;  2RKS A;  1PH1 A;  4GLV B;  4DN4 M;  1Z2P X;  4V0B A;  5D8D A;  4DV6 Q;  1NTG A;  2VR1 A;  1BR9 A;  2K75 A;  2E2I A;  4DV6 L;  1V1Q A;  2CVR A;  2JA5 A;  4HAE A;  3PO3 H;  1CI3 M;  4H13 C;  5EZY F;  3GTK H;  2Y0S G;  2P5Z X;  1YNJ C;  5KEE A;  3HBL A;  4DAY A;  1DM0 B;  1WR2 A;  4FS1 A;  3H40 A;  2FMC A;  2OCE A;  4DK6 C;  4BY7 G;  2C28 A;  1HQR D;  1LTA D;  3RLN A;  3UE0 A;  2WB1 E;  1BNZ A;  1PYB A;  4WBN F;  1IOV A;  3OIQ A;  4KY7 A;  1XMO Q; 
#chains in the Genus database with same CATH homology
 5M3F H;  4AYB G;  3AFP A;  1J6Q A;  3G6E A;  4A93 H;  4LFA Q;  4GOP B;  2KEN A;  3W1G A;  5E7N A;  3GTM H;  4NXN L;  3L7Z C;  4HIK A;  3ULP A;  1HR0 Q;  1X6O A;  1X65 A;  3NEM A;  3S1M H;  3HFZ B;  1K8G A;  4GN5 A;  2K5V A;  4PZ6 A;  4GKJ Q;  1IBL L;  1LUZ A;  1PH5 A;  4LF6 L;  3GTL H;  3PO3 G;  4K0K L;  1S3O A;  2HT1 A;  5HY6 A;  2E5L L;  4B3M L;  3CC4 A;  3A5U A;  4QL5 A;  4POF A;  4A3F H;  3B6Y A;  1TWG H;  4L5Q A;  1QVG A;  5IE8 A;  3TQY A;  5K36 G;  4LFA L;  1NMG A;  3IRB A;  1YIT A;  3KLW A;  4C2M H;  1YHQ A;  4JI1 L;  4JBJ A;  1S40 A;  2UUB L;  2LXK A;  2PQA B;  2JA5 G;  1XNQ L;  2NVY H;  4IO9 A;  1VQ4 A;  1Y1W G;  1PA6 A;  3AYH B;  4LF5 Q;  2CFM A;  3HOY G;  5C0X G;  4JI4 L;  1B8A A;  3OTO L;  2PQA A;  1ASZ A;  2ALY B;  1KL9 A;  3RZO H;  4LF9 L;  3K7A H;  5JJK A;  1CSP A;  4J15 A;  3CCR A;  4LUZ A;  2E8G A;  1WCM G;  4X62 L;  5IYC H;  1JMC A;  1X56 A;  4FDB A;  4EQ5 A;  5IP9 G;  4DV7 L;  3CCM A;  1N36 Q;  2UUC L;  1YJN A;  4LF4 Q;  2Y0S E;  4DUZ Q;  4DV3 L;  2AWN A;  4JBM A;  3F2D A;  4JI0 L;  2MQH A;  1L1O C;  4TQU S;  1PHJ A;  1C7Y A;  4A3J H;  1L0W A;  1VQF A;  1R9T H;  3CW2 C;  2AWO A;  4HJ5 A;  1VQK A;  4BBS H;  4BXX H;  5M3F G;  4HJ7 A;  4BBS G;  1N9W A;  2KCT A;  4JOI C;  3RN2 A;  5C3E H;  3FP9 A;  4DUY L;  3STB C;  4JI3 L;  3CPF A;  3UDF A;  2YTV A;  4DAY B;  4AH6 A;  2VQF L;  1XPR A;  4BY1 H;  4IOA A;  4MZ9 A;  4X66 L;  2R93 G;  3EIV A;  1YIJ A;  3S2D H;  1BVS A;  2ZJP A;  4LFB L;  1CKM A;  2NN6 G;  1IL2 A;  3I4O A;  3KDF B;  3CCS A;  1KQS A;  4DV1 L;  1OXU A;  4NXM Q;  1G6P A;  4LFB Q;  2WAQ G;  1K0R A;  4A3F G;  3U4Z A;  4PG3 A;  3HOZ G;  3PV0 A;  4DR1 L;  3S2H H;  4A3I H;  4X65 Q;  2N49 A;  2YYZ A;  1E1O A;  4PZ8 A;  2ZJQ A;  4JI5 Q;  1KRS A;  4BA2 I;  3CAM A;  2HIX A;  1HNZ L;  3JAM i;  5JJI A;  4P73 A;  3HOW H;  3I4N H;  1VQ5 A;  1I6H H;  3F2C A;  3D31 A;  4IPC A;  5J3B A;  2B29 A;  3ULJ A;  4BBR G;  5LMU Q;  4DV1 Q;  1VQB A;  4JCV E;  4BXX G;  4O2D A;  3UDI A;  4P71 A;  2RHS B;  1YHB A;  2I5M X;  4DR6 L;  1XPU A;  1GO3 E;  1X54 A;  2F52 A;  2KBN A;  4R4Q A;  1Q12 A;  2AKW B;  3UDX A;  3J80 c;  1OTC A;  3H15 A;  1FL0 A;  2YU9 H;  4A3E G;  3CC7 A;  1VQD A;  3DLL A;  1Q86 C;  1WCM H;  4IFD J;  1WFQ A;  1QVF A;  2CQO A;  3CQZ H;  4DR2 Q;  1A62 A;  3K0X A;  3PUZ A;  4KHZ A;  1MJE A;  2NZO A;  2WP8 J;  1E3P A;  1WI5 A;  3GDE A;  3ZJY C;  3M85 A;  1S72 A;  2B63 H;  2PI2 E;  5GAD C;  1KAW A;  1HZ9 A;  3BZK A;  4A3I G;  1IZ6 A;  1LYL A;  2A8V A;  2JA7 G;  5IY0 A;  4DR5 L;  2JA7 H;  4LNQ A;  3I7F A;  2RF4 A;  1YJW A;  3KOJ A;  4YY3 L;  5FLM G;  5IP7 H;  3ERS X;  1N32 Q;  3STB D;  4GS3 A;  5IYB H;  1JE5 A;  5M5Y H;  2JEB I;  1VS0 A;  1OXS C;  3F1Z A;  4X62 Q;  2VQE L;  1IBL Q;  1EIY B;  1EWI A;  3CP0 A;  2HHH Q;  1V9P A;  1VQI A;  5C0X J;  4DR5 Q;  4UPA A;  1YNX A;  1J5E L;  1SRO A;  4A75 A;  3VDY A;  1D7Q A;  1KIX A;  3JAM c;  4GNX B;  4A3D G;  1V43 A;  1RIP A;  3M4P A;  2N3S A;  2Q2H A;  3E0E A;  3ER0 A;  4C3J H;  4DK3 C;  3CPW A;  2UUB Q;  4NXM L;  1HR0 L;  4DR2 L;  1BBW A;  2QEX A;  5M5X H;  2HHH L;  1X3G A;  1TWA H;  4JI0 Q;  2K4K A;  1TWF H;  5C0X I;  3HKZ E;  3CCQ A;  4P74 A;  3I4M H;  3TS2 A;  4DR4 L;  3KDF A;  1CSQ A;  3FKI G;  1PH4 A;  5C3E G;  1C9O A;  1XPO A;  1K73 C;  1N34 L;  3Q8D A;  2JE6 I;  4A3M H;  4YCU A;  1D8L A;  4DR3 Q;  4JI3 Q;  4JI8 L;  4DUY Q;  1HNZ Q;  2EIF A;  2WB1 G;  1CKN A;  1N33 L;  4YCW A;  1G29 1;  4LF9 Q;  4A3E H;  1O7I A;  2JA6 H;  4LUO A;  1FJG Q;  2WAQ E;  1JJC B;  3JC6 6;  3ULL A;  4LF5 L;  3H0G H;  1MJC A;  1HNW Q;  2UUC Q;  1KC8 C;  4DR7 Q;  1WYD A;  1E24 A;  3PSI A;  1Q82 C;  4JI1 Q;  3PUW A;  4DUZ L;  2AHO B;  3SGI A;  4DV3 Q;  3S17 H;  4DR6 Q;  4A3K H;  1IYJ B;  4IJL A;  4DV5 Q;  1VQG A;  4XIG S;  4LF8 Q;  3HKS A;  2EXD A;  2E2H H;  5FLM H;  1HJP A;  3M4Q A;  2UUA Q;  2BA1 A;  3CD6 A;  1NJI C;  3A0J A;  2VUM G;  4GN4 B;  3GTQ H;  1Y1W H;  4HJA A;  1XNR L;  2NVX H;  4HID A;  3S24 A;  4JI4 Q;  4A3G H;  2Z6K C;  4JI2 L;  1PVO A;  4DNI A;  3J80 i;  2JK8 A;  4OX9 L;  5GAH C;  2MO0 A;  1OXX K;  2R7F A;  4YWM A;  1E22 A;  2JJQ A;  4H02 A;  1K8A C;  2JA8 H;  1VQH A;  1VQO A;  2ZTD A;  1X3E A;  3WWV A;  5IWA L;  3G71 A;  5IYD G;  2YV5 A;  2PI2 A;  2Z6K A;  4WJ3 M;  4JC0 A;  3S16 H;  1U0L A;  2HIV A;  4QGU A;  1Q7Y C;  3CCU A;  3HOZ H;  5DLQ E;  2MO1 A;  2VS1 A;  5M5W H;  4IOC A;  4GLA C;  3GO5 A;  1B7Y B;  4APV A;  4LF6 Q;  1QUQ B;  3CMA A;  1VQC A;  1C0A A;  1W3S A;  1MIU A;  1X55 A;  1UE7 A;  3M7N A;  5JEA G;  5ELO A;  5M3M H;  5IWA Q;  2ZTE A;  3HKZ G;  2VUM H;  4WJ4 A;  1AE3 A;  1BKB A;  2LSS A;  4MTN A;  4C3I H;  5HGQ A;  4HJ8 A;  1PH2 A;  2NN6 I;  4NXN Q;  2JEA I;  2OQK A;  1KRT A;  4A3G G;  1Z9F A;  4DR7 L;  3S1R H;  4A3C G;  4OO1 I;  1JJG A;  1W2B A;  4ME3 A;  1SRU A;  4Y7N H;  4R4O A;  3H0G G;  3PO2 G;  3S14 H;  1UE5 A;  1OXV A;  5EAY A;  2IX0 A;  5FJ8 H;  5C44 G;  2CKZ B;  3KF6 B;  4DV0 Q;  2R7Z H;  4GN3 B;  2BH2 A;  3CCL A;  3OW2 A;  1EFW A;  4B3S L;  1B70 B;  3I56 A;  3CC2 A;  1LTL A;  1KXL A;  2YTY A;  1VQL A;  2C35 B;  2JQO A;  4ALP A;  2YTX A;  4LW1 A;  4QJF A;  5IP7 G;  3CCJ A;  1XMO L;  1XMQ Q;  1IBK L;  4JI2 Q;  4DAM A;  3L2P A;  1IBM L;  4JG2 A;  3PIO A;  3LGJ A;  4YHH L;  1X9N A;  1SN8 A;  5GAE C;  1JB7 A;  3K7U C;  4DV2 L;  4B3S Q;  4R4I A;  1GKH A;  4B3R L;  4JOI A;  4A4I A;  2KCM A;  4Y52 H;  2KHI A;  5IT9 c;  3H3V I;  4JV5 L;  2H5X A;  2JA8 G;  3RLF A;  1Y1V H;  4R4C A;  2OQ0 A;  3M4O H;  1TXY A;  4A3D H;  4AQY Q;  2OTJ A;  4NB3 A;  5IYC G;  1UE6 A;  1L1O A;  1G51 A;  2CWP A;  1EQQ A;  4A3L G;  4A3L H;  4YHH Q;  1QZH A;  3DM3 A;  1KD1 C;  1A63 A;  1QVC A;  3GTP H;  3HOX H;  2OTL A;  4B3T L;  1FJG L;  1NY4 A;  4YY3 Q;  4JYA Q;  5AJ3 Q;  4BBR H;  1YVC A;  1CKN B;  2PMZ E;  3FKI H;  3NEL A;  4IPD A;  4L5S A;  2ATW A;  4YWK A;  4DKA C;  2IY5 B;  3S15 H;  1N34 Q;  4HJ9 A;  1HZB A;  3EBE A;  4LF8 L;  2D0P A;  4DV5 L;  3RN5 A;  1PFS A;  3S1Q H;  2A19 A;  4P75 A;  1N33 Q;  3NEN A;  5GQO A;  2I5L X;  3U4V A;  2UXC Q;  3MXN B;  1YHA A;  2VW9 A;  2R92 G;  1Q1E A;  4PZ7 A;  1NBW A;  3EN2 A;  1GM5 A;  2JA9 A;  2IHF A;  2D62 A;  3I2Z A;  3OYY A;  2ZM6 Q;  4LUV A;  2N8N A;  4A3K G;  4GNX A;  2RCN A;  4BY7 H;  1K83 H;  1HNW L;  2F4V Q;  2UXD L;  1FVI A;  1VQA A;  2ID0 A;  3TEH B;  2E2I H;  2QA4 A;  3HOU G;  5LMN W;  1IXR A;  1X3F A;  3AFQ A;  3PIP A;  1WJJ A;  1QZG A;  3PCO B;  1PH3 A;  2UU9 L;  4KHP Q;  3T1H Q;  2AMC B;  3HOY H;  4GKK L;  3T1Y L;  4X6A H;  2NVQ H;  1N32 L;  3KJP A;  4QY7 A;  4LFC L;  1I94 L;  1HNX L;  1N8R C;  3M3Y H;  1AH9 A;  3U58 A;  1AE2 A;  1J5E Q;  1M1K C;  3FHW A;  3KF8 B;  2KHJ A;  4UP8 A;  2XTI A;  1SLJ A;  3J81 j;  4UY8 C;  2D0O A;  2I5H A;  4DR4 Q;  1P8L A;  3TS0 A;  4KLK A;  1TWH H;  3NBH B;  3PUY A;  2K5H A;  4RMF A;  3GTJ H;  2VQE Q;  1WOC A;  3HOV H;  3KFU A;  4OX9 Q;  3H3V H;  1I50 H;  4YWL A;  1NMF A;  3G4S A;  3RNU A;  2K5N A;  1TWC H;  1NE3 A;  2IHE A;  1XNR Q;  1XJV A;  3K8A A;  4JI7 Q;  2Q2U A;  4OWX B;  3I4M G;  1VQ8 A;  3CF5 A;  1PH7 A;  1YI2 A;  4P72 A;  2UXB Q;  4GLX A;  1I3Q H;  2CWA A;  1UE1 A;  3BZC A;  1P16 A;  4LF7 Q;  1VQ9 A;  3HOU H;  2GN5 A;  1CKO A;  4A93 G;  4BY1 G;  4RG1 A;  3TRZ A;  2NZH A;  1YJ9 A;  5BR8 L;  4X66 Q;  3UE1 A;  2JA6 G;  1Q46 A;  2MFI A;  1Q1B A;  1A8V A;  2ES2 A;  2BH8 A;  3T1H L;  1BBU A;  4JI7 L;  4GKK Q;  3D0F A;  2R92 H;  4OXP A;  2PNH A;  4POG A;  4QIW E;  3HOV G;  4IJH A;  3KYH C;  5FJ8 G;  4JI8 Q;  3W5O A;  5ELN A;  4DR3 L;  1EUJ A;  1UEB A;  3PGZ A;  2VY3 A;  2DGY A;  1M90 C;  2GVB A;  4JYA L;  1H95 A;  4OWW B;  4B3T Q;  4OO1 G;  1Z47 A;  1K3R A;  1SR3 A;  5LMU L;  4JI6 L;  4L5R C;  1Q81 C;  3E9H A;  2GVA A;  4IPH A;  2UXB L;  3U50 C;  2DUD A;  2R7D A;  4JI6 Q;  1PH9 A;  2Q2T A;  4A3M G;  4UP9 A;  4DPG A;  2FXQ A;  4XTC S;  4YCV A;  5C4J H;  3PF5 A;  1YEZ A;  4LF7 L;  1VQE A;  1ASY A;  4GKJ L;  3A5Z B;  2F4V L;  3PO2 H;  2EQS A;  2UXD Q;  1QUQ A;  4O0A A;  2OWO A;  3T1Y Q;  3G48 A;  2IT1 A;  2QGQ A;  2L15 A;  4HIM A;  5C44 H;  1L2F A;  2Q2I A;  5IP9 H;  1Y14 B;  2B63 G;  1PYS B;  3J81 c;  4DR1 Q;  3GTG H;  1GVP A;  2NVT H;  2V1C C;  2K50 A;  4MNO A;  5LMN Q;  2R6G A;  5BR8 Q;  1VQP A;  1RL2 A;  4EX5 A;  4A3J G;  4OWT B;  3HOW G;  2CCZ A;  3I4N G;  5M3M G;  2JA5 H;  1SMX A;  2E5L Q;  2ZTC A;  2UU9 Q;  4B3M Q;  1HZA A;  4NPS A;  4DV0 L;  2VZA A;  1YZ6 A;  3J7Z C;  3OTO Q;  4GOP C;  3CME A;  3A74 A;  1SE8 A;  1PV4 A;  1I94 Q;  1HNX Q;  4LFC Q;  4A3C H;  4X64 Q;  4R1J A;  5GAG C;  1I5F A;  1L1O B;  2ZM6 L;  2R93 H;  2I0Q A;  5AJ3 L;  4X65 L;  4QQB X;  4AYB E;  3F2B A;  3CXC A;  4DV7 Q;  1N36 L;  4R4T A;  4TVA B;  3PUV A;  1XNQ Q;  4JBW A;  1EIF A;  2R7Z G;  4IFD I;  1EYG A;  3BU2 A;  4UP7 A;  1YBY A;  1SFO H;  1U5K A;  1XTD A;  2B3G A;  3GTO H;  1JT8 A;  2ASB A;  4KHP L;  4AQY L;  3RR5 A;  2WFW A;  4JI5 L;  2ZJR A;  4GOP A;  1HZC A;  2IX1 A;  1VCI A;  5C4X H;  4AIM A;  2K14 A;  1OXT A;  3M9B A;  3CCV A;  3UDG A;  1A0I A;  5GRO A;  4B3R Q;  2HQL A;  3K81 C;  1HH2 P;  1Q8K A;  3I55 A;  5JEA J;  1Y1V G;  3AQQ A;  4A76 A;  1K9M C;  4A3B G;  4OON A;  1VQ6 A;  1VQ7 A;  3GD7 A;  1IBK Q;  4LF4 L;  4K0K Q;  1EQR A;  5JJL A;  3CCE A;  1HR0 W;  2VQF Q;  4C3H H;  2LXJ A;  2MNA A;  2BA0 A;  2N78 A;  4JBK A;  1CUK A;  2F3I A;  3HOX G;  1LM0 A;  4DV2 Q;  3L0O A;  3S1N H;  1MKH A;  2XGT A;  2VL6 A;  2UUA L;  1E7Z A;  1FGU A;  1VQM A;  4L5T A;  2E2J H;  4JV5 Q;  4BA1 I;  3K80 C;  4LWC A;  4GNX C;  1T9H A;  3RZD H;  4DV4 L;  3KJO A;  3E9I A;  3AEV A;  3ICE A;  1UWV A;  5H1S E;  1PH6 A;  3TRE A;  3J81 i;  1PH1 A;  1GD7 A;  4GLV B;  2A1A A;  5C4X G;  1DGS A;  3MEF A;  1IBM Q;  4DV6 Q;  1NTG A;  4PMW A;  2K75 A;  3F8T A;  2K52 A;  4DV6 L;  1V1Q A;  1PH8 A;  3PO3 H;  2UXC L;  4A3B H;  1JJ2 A;  3GTK H;  4IFD G;  2Y0S G;  1VQJ A;  4KI0 A;  3PUX A;  3W1B A;  4HIO A;  3J7A 5;  4IPG A;  4X64 L;  5IYD H;  3PF4 A;  3BJU A;  2Z0S A;  1KHI A;  2RHQ B;  3KF6 A;  2VNU D;  1EOV A;  4DK6 C;  2OCE A;  5FLX c;  4BY7 G;  3RLN A;  3RLO A;  3UE0 A;  2WB1 E;  1E1T A;  1PYB A;  5LMN L;  5IYB G;  1VQN A;  4DV4 Q;  1XMQ L;  1XMO Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...