4A3IG

Rna polymerase ii binary complex with dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3iG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3iG01
3H0GH 4BY1G 4GLXA 1CUKA 3RR5A 4LFCL 3MEFA 3ICEA 3ZJYC 1YEZA 4NB3A 3B6YA 2B29A 4LF4Q 1JE5A 2LXJA 2E2JH 2K14A 3AEVA 1OXXK 5C0XJ 2WB1E 4GN3B 4BA2I 4WJ4A 2WAQG 5E7NA 2RF4A 1VQGA 1YNXA 1WOCA 5C4XH 5J3BA 4A4IA 4YWLA 1IBKL 1Q1EA 3NBHB 4OXPA 1HNZQ 3ULLA 3VDYA 1JMCA 5M3MG 5DLQE 4HJ9A 3KF8B 2BA1A 2KENA 4EQ5A 2Q2TA 2Z6KA 4LFCQ 3UDGA 1JT8A 4PZ7A 3PUVA 4DV1L 1TWGH 1PH1A 4UPAA 1YJNA 2RHQB 1E22A 3J7ZC 4DAMA 1I50H 1VQLA 2JA5H 2KHJA 1I94Q 4A3CH 2JE6I 4IFDJ 1L1OC 1AE3A 2AHOB 1FL0A 2IHFA 1IBKQ 4JOIA 4LUZA 4R4OA 2R7ZG 1A63A 4JI1L 5FLMG 4BY7G 2VL6A 2UXBL 2WB1G 5AJ3L 1Y1VH 5HY6A 5C44H 4DV1Q 4ME3A 1VQEA 4IOAA 4DR2L 2ZJPA 4B3RL 4JI0L 2IT1A 1NMFA 5GAHC 2NVXH 4NXNL 3PO3G 5IY0A 1K73C 2ZJQA 2R7FA 4JYAQ 4YWMA 3HFZB 3I4NH 3S1QH 4JI1Q 1X55A 2K5NA 4MZ9A 2PMZE 4A3MH 3M3YH 4FDBA 1PH7A 3G48A 2NZHA 1PYBA 4DV3L 4DV5L 2A19A 2D0OA 4DR2Q 1VQOA 4B3RQ 1HNWL 2VY3A 3CCRA 4BXXG 1EIYB 4DV6L 1X3GA 4YCWA 4NXNQ 3GD7A 1VS0A 4OWTB 3RLNA 1NJIC 1Q8KA 2HQLA 3RN5A 2AWNA 1YJWA 3OYYA 3UE1A 3L7ZC 5FLXc 1TWCH 3CC2A 3KJOA 4TQUS 1QZGA 1YHBA 3CC4A 4LWCA 4L5RC 1OXVA 2OQ0A 2RCNA 3U4VA 1V9PA 4HJ8A 4A3JH 1KRTA 2E8GA 1SLJA 2EXDA 4B3SL 4WJ3M 3G6EA 4AIMA 1C7YA 1IZ6A 3FKIH 5IE8A 1Z9FA 1Q82C 1ASYA 4A3LG 2R93H 4DK3C 1N9WA 4IPHA 4LF7L 1UWVA 5JEAG 5GADC 1KD1C 5FJ8H 3K8AA 2ZTDA 2D62A 4A3DG 1CKOA 2UUCQ 1VQNA 4OWWB 1NMGA 3PUWA 4LUOA 4L5TA 4A3FG 2BH8A 5M5YH 1YI2A 1QUQA 4B3SQ 5JJLA 1X56A 4YCUA 3T1YQ 1CSQA 1X54A 3M4PA 4P73A 1B8AA 2R93G 3HOXG 5IWAL 3CAMA 3J81i 4IOCA 3RZOH 5IYDG 5GAEC 2EIFA 1RL2A 1E24A 1YIJA 2A8VA 4JI4L 4HJAA 3IRBA 5H1SE 1OXTA 3ERSX 2JA9A 2ALYB 2JJQA 4A3IH 5IYCG 1N8RC 3GTQH 4OX9L 3GTOH 5HGQA 1FVIA 3E0EA 5IWAQ 3PCOB 5JJKA 2V1CC 3OW2A 2K5VA 4LF5L 2ID0A 3I4MH 5C4JH 3CMEA 4JI4Q 1T9HA 3D0FA 3EN2A 3PO2H 2AKWB 1VQ5A 4DUYL 4A3EH 2UUBL 3HOWG 3TREA 4QJFA 4NXML 4Y52H 3T1HL 1LM0A 1PFSA 1C9OA 4DUZL 1U0LA 1VQPA 4X66Q 2I0QA 1XTDA 3KOJA 3OTOQ 4HJ7A 4PZ6A 4DR1L 3S15H 2RHSB 3HOZG 4BBSH 2K5HA 4LF5Q 4A3KG 4LFBQ 3RN2A 1Z47A 2UXCL 3CCSA 4R4IA 4LF4L 4DK6C 1IBLQ 2K4KA 3W1BA 4JG2A 4DUYQ 1QVFA 2PI2A 3TRZA 2N78A 2UUBQ 1PVOA 1AH9A 3T1HQ 1X9NA 5M3MH 1FGUA 4P75A 4DUZQ 4GNXC 3KDFA 5GQOA 1HNZL 1IYJB 1VQBA 2PQAA 4DKAC 4DR1Q 3RNUA 2F4VQ 1E1TA 4JI3L 2I5MX 4A76A 1YZ6A 3BJUA 3GDEA 4HIDA 1PH5A 4LNQA 2N49A 3HOVH 4A93G 2UXCQ 1TWHH 1VQHA 4GN4B 3UE0A 2VQEL 4GOPB 2KHIA 1KHIA 4BBRG 2JEAI 2R7ZH 2R92H 2K75A 1I94L 4PZ8A 4BY7H 1UE1A 2CFMA 4IPDA 3M85A 2KCTA 4GS3A 2VUMG 2VNUD 5C3EG 4JI3Q 4HIKA 1WFQA 2JA7G 1QZHA 2FXQA 5C0XG 2VS1A 3ULJA 2VQEQ 1YBYA 2Y0SE 3PO3H 3M4OH 3S2HH 4XTCS 1PYSB 2NVYH 1EQQA 3GTGH 3PUXA 1NE3A 1ASZA 1BVSA 4POGA 5IP7G 2NVTH 4JYAL 1V1QA 1BKBA 4O2DA 3UDIA 2MNAA 3ULPA 2JA8H 1VQMA 1I5FA 4BXXH 3NENA 1SRUA 3S1MH 4MTNA 3CCUA 1W2BA 4GNXA 3W5OA 1OTCA 4TVAB 4LW1A 2ZM6Q 1PHJA 3CD6A 4IFDG 1Q46A 1WCMH 2R6GA 1X6OA 4Y7NH 4A3MG 1UEBA 4H02A 3H0GG 4JV5L 3HKSA 4AYBE 5IT9c 1CKNB 1LTLA 3CPFA 2Y0SG 1W3SA 4OO1G 2HIXA 1K83H 4QIWE 3W1GA 4R4QA 2VQFL 4JBWA 1SN8A 3S14H 2CKZB 1G6PA 1KAWA 1X3EA 4JCVE 3E9HA 1O7IA 1IL2A 3STBD 1EOVA 4A3LH 1K0RA 3U50C 3L2PA 3HOYG 4JV5Q 4KI0A 4PMWA 3GTJH 3K0XA 3S16H 5JJIA 1N36Q 1PA6A 2D0PA 3S1NH 1A0IA 1L1OA 3NEMA 2VQFQ 1L0WA 4JI7Q 2JEBI 4AYBG 1WI5A 4DV7L 3CCEA 2UUCL 4DR3L 1MJEA 1FJGL 3PF4A 1GVPA 2GN5A 3KFUA 2WP8J 1B7YB 3DM3A 2B63G 4C3JH 4RG1A 1YJ9A 1XMOQ 1NY4A 2JA6G 3HOXH 1HZBA 2Q2HA 1BBWA 3FP9A 3CXCA 3CMAA 1K9MC 1QVCA 1SE8A 3MXNB 3UDXA 1HZ9A 4IO9A 2QA4A 5C44G 3T1YL 4IJHA 1Y14B 3BZCA 1VQ4A 1PV4A 1TXYA 1N32L 2ASBA 2H5XA 2ZTEA 1E1OA 3PIOA 4DV7Q 5IYCH 4DR3Q 1FJGQ 1XPUA 2Q2IA 1HZAA 3HOUG 3J81j 4OWXB 2HT1A 3BZKA 4A75A 1N34Q 3STBC 1N33L 1AE2A 1S3OA 1PH2A 4R4TA 2KCMA 2OQKA 1PH6A 1YHQA 3F2BA 1N32Q 4X65L 3M4QA 1WYDA 3PUYA 4IPGA 3HOWH 2UXDL 1JB7A 4C3HH 3TQYA 1E7ZA 1QUQB 2XGTA 1Y1WG 4JC0A 1N33Q 1R9TH 1LUZA 3HOZH 5EAYA 4A3GH 4A3KH 1JJCB 2GVBA 4X66L 4JBMA 3OTOL 4DAYB 4X65Q 3FHWA 4LFBL 3TEHB 1MKHA 1UE7A 2GVAA 4J15A 4JI8Q 1SROA 4B3TL 2UXDQ 4P74A 1IBLL 4UY8C 3WWVA 4DV4L 4GOPC 1X3FA 2B3GA 5GAGC 4X62Q 4UP8A 1KQSA 1HZCA 4BY1H 1VQDA 5C0XI 1TWAH 2F3IA 1PH3A 2LSSA 4YY3L 4HIOA 3JC66 1E3PA 2OWOA 3GTLH 1M1KC 2F4VL 3SGIA 3DLLA 1DGSA 4PG3A 1KIXA 3PUZA 4KLKA 1VQ7A 2XTIA 4A3BG 1HR0Q 4BBRH 2PNHA 5LMNL 1S40A 4B3TQ 4O0AA 4DV2Q 1XPRA 4DV4Q 2QEXA 2R7DA 1BBUA 4NPSA 1VQAA 5BR8L 3G71A 4JI6Q 5K36G 2IHEA 3GO5A 1KRSA 3TS0A 2DGYA 2NN6G 5C3EH 1PH4A 4YHHL 1VQKA 1XJVA 4IFDI 4YY3Q 3CP0A 2CQOA 4XIGS 2AMCB 2N8NA 5IYBG 4MNOA 3CPWA 5M3FG 4QY7A 5LMNQ 2NZOA 2JQOA 3L0OA 1NTGA 3KF6A 3AFPA 1K8AC 2ZJRA 2UU9L 4OO1I 2K50A 1VQIA 5IP7H 1QVGA 5BR8Q 4QQBX 4AQYL 4JI2Q 1TWFH 1G291 2WAQE 3F1ZA 4C3IH 5FLMH 3A5ZB 4LFAL 1HJPA 3K7UC 4YHHQ 1IBMQ 3KDFB 4DNIA 4R1JA 2PQAB 3BU2A 3NELA 4DV0L 2HHHQ 4B3MQ 1XNRL 1MJCA 1VQCA 3S24A 5M5XH 2YU9H 3EIVA 3GTMH 4K0KL 1M90C 1LYLA 2UU9Q 2UXBQ 3RLFA 5IP9G 4POFA 2VW9A 2ZM6L 4AQYQ 2YTXA 1Q81C 3AYHB 4LFAQ 1Q12A 3F8TA 3I56A 3CF5A 3CCJA 1KC8C 4GLAC 4P72A 3CCVA 2MFIA 4AH6A 3PF5A 4DV0Q 1EYGA 4BBSG 2YTYA 3E9IA 4UP7A 2UUAL 1NBWA 1XNRQ 3F2DA 1KXLA 4K0KQ 2AWOA 4DPGA 4YCVA 1XNQL 1IXRA 3HOYH 1XPOA 1CSPA 2YTVA 5LMUL 4QL5A 3EBEA 4IPCA 4RMFA 3M7NA 2IX0A 1GD7A 3HOVG 2I5LX 1N36L 2UUAQ 1P8LA 1UE5A 1K3RA 4JI7L 4GNXB 1XNQQ 4HJ5A 1GM5A 2B63H 2CWPA 2R92G 3TS2A 1CKNA 1VQFA 3ER0A 3I2ZA 1J5EL 4JBKA 2JA6H 1WJJA 5LMUQ 3J7A5 4X6AH 5C4XG 4HIMA 1GKHA 1XMOL 3PIPA 2E2HH 2E2IH 4JI5L 3U4ZA 3CCMA 4A3DH 2ES2A 1EIFA 1H95A 1HH2P 1J6QA 4IJLA 3HOUH 4ALPA 3PGZA 2IX1A 4A3FH 2JA5G 4UP9A 2I5HA 3CQZH 4X64L 4DR5L 3RZDH 1J5EQ 4A3CG 5AJ3Q 1SR3A 2HIVA 3A0JA 3M9BA 3PSIA 3S2DH 4GKKL 2K52A 3HKZE 3K80C 1I3QH 1N34L 4LF8L 2JA8G 3KLWA 1Y1VG 2F52A 4JI0Q 4JI5Q 2PI2E 3Q8DA 5IYDH 1U5KA 4LUVA 1P16A 1L1OB 4L5SA 3I4OA 3JAMi 2Z0SA 1D8LA 1WCMG 5ELOA 2QGQA 3LGJA 4X64Q 1B70B 4GLVB 3A74A 4DR5Q 1Y1WH 3CC7A 1MIUA 2MO1A 4EX5A 2BH2A 4DV3Q 2EQSA 4DV5Q 3I4NG 4GKJL 1KL9A 1HR0W 5JEAJ 1VQ8A 4GKKQ 4LF8Q 1HNWQ 2A1AA 4OONA 4DR7L 1YHAA 4DV6Q 1CKMA 1G51A 2YYZA 3S17H 1OXUA 3HKZG 3K81C 1A8VA 2LXKA 2NN6I 4JI8L 3J80i 4R4CA 1EQRA 2MO0A 2C35B 1RIPA 2OCEA 3K7AH 1YITA 4GKJQ 5LMNW 4X62L 5GROA 3A5UA 1EWIA 4GN5A 1JJ2A 2KBNA 4A3BH 4DR7Q 2YV5A 1YVCA 2JK8A 2WFWA 2MQHA 3S1RH 4LF9L 3KYHC 1HR0L 1PH9A 3GTKH 4A3JG 3H3VI 4DR4L 4LF7Q 4KHPL 3JAMc 4DV2L 3F2CA 4LF6L 3CCLA 4JI6L 3FKIG 2DUDA 3PV0A 2N3SA 1Q86C 5IYBH 1PH8A 1Q1BA 1GO3E 5M3FH 5FJ8G 1XMQL 2Q2UA 3AQQA 1A62A 5ELNA 4A93H 1SFOH 3RLOA 4LF9Q 4DR6L 3GTPH 2IY5B 3UDFA 1Q7YC 4DR4Q 4KHPQ 1VQ9A 4LF6Q 1I6HH 3I7FA 3G4SA 2CCZA 4JBJA 4JI2L 2ATWA 3J80c 1C0AA 1JJGA 3H3VH 1VCIA 3I55A 2VUMH 1HNXL 2OTLA 1IBML 1XMQQ 2JA7H 4B3ML 2HHHL 1K8GA 4DR6Q 4YWKA 2Z6KC 2E5LL 5IP9H 4OX9Q 3CCQA 4A3IG 1S72A 4BA1I 1OXSC 3AFQA 2NVQH 4C2MH 3U58A 4A3GG 2CWAA 4KHZA 3H15A 4P71A 3CW2C 1HNXQ 2ZTCA 4APVA 3J81c 1EUJA 4JOIC 2BA0A 3KJPA 3D31A 1X65A 3I4MG 2L15A 4GOPA 1V43A 4QGUA 1L2FA 2E5LQ 4NXMQ 2OTJA 3PO2G 4L5QA 1EFWA 5M5WH 1UE6A 1VQ6A 3KF6B 4A3EG 1SMXA 2VZAA 1VQJA 1D7QA
chains in the Genus database with same CATH superfamily
4C3JB 2EVBA 4GLXA 3RR5A 3HOXB 1TWCA 4LFCL 3E5SA 3ICEA 5KT7A 4YQWA 2Q8IB 4NB3A 3B6YA 5IOCA 1MD2D 4JI7H 4O3NA 4FBUA 5E7NA 1UAPA 1VQGA 5KGUA 1Q1EA 4YIJA 4ED2A 1HNZQ 5M3MG 4HJ9A 2KENA 3OIPA 3NPPA 3DWPA 1TWGH 2RSNA 2QK4A 2RHQB 1EU3A 4GZYC 4DAMA 1VQLA 4DR3H 1FJGH 2KHJA 3FEWX 2AGOA 2JE6I 3NBIA 3SHLA 2D2CC 2HGSA 4NLGA 1A63A 2L9HA 5KG4A 1ZQ7A 2E76C 2VL6A 2X6LA 1R9TB 3RBDA 4A3KB 2ZJPA 4ZKBB 5KFQA 4JI0L 4R8UB 1SFOA 5DGBA 5D8DA 5KFTA 1JICA 1K73C 2ZJQA 5L1LA 2BQRA 1WTXA 5L1IA 3I4NH 2K5NA 3DMUA 2PMZE 3M3YH 4FDBA 1EY6A 4A2AA 2NZHA 5KFBA 3GV7B 1SAPA 4RCNA 3VR2A 1JR0D 1TWAB 3QR8A 5IIFA 4B3RQ 4A93B 3GIKA 2JA7A 1EIYB 4ED1A 5JJZA 5FLXE 1X3GA 4YCWA 3C2PA 3VR4A 4BBRB 3RV4A 3BS1A 4OWTB 1PK8A 1EU4A 3OOCA 2XIWA 3AU7A 1BF4A 2AWNA 4O2BF 4ED8A 4FM9A 3MXNA 3RFCA 2XIGA 1ICWA 3DM1A 2YZMA 3CVZA 3CC2A 5EWGA 2R61A 5G3LD 5E1FA 3CC4A 2IJ0A 4DL6A 4L5RC 1Y8NB 2RCNA 3U4VA 1V9PA 2IPKD 1M7JA 2W8LA 4QUCA 3TDQA 2E8GA 2V4RA 5EPKA 2KUMA 4XQJA 3G6EA 5IE8A 3FKIH 1C7YA 2YW2A 5KT4A 3I70A 4CDCC 1KD1C 2W9CA 2LFNA 1JX4A 2L1BA 4K14A 4ULLA 2B2YA 2UUCQ 3PUWA 3NP8A 3RIZA 4FXGC 5LMNH 3BA8A 3D4RA 4A3FG 5M5WB 1STHA 2D5DA 2KA7A 2MHVA 1X56A 4JI2H 3M4PA 4UCUA 4V0BA 1H9SB 5IYDG 4DAYA 2F03A 2R7LA 1OO9B 2O5JC 2EIFA 2XNAC 4G3IA 1PRTC 1I4HA 1EIGA 2OEOA 1CE8A 2F0KA 5C1PA 3J80W 2KSWA 2F0WA 1OXTA 4DA2A 1PLFA 1N8RC 1CFMA 3HOYB 3PR5B 4I7ZC 4NW2A 5IWAQ 5JJKA 3NK9A 2K5VA 5KFUA 4LF5L 5DG8A 2DWCA 3CMEA 1T5XD 4XT3B 4LK1C 3EN2A 4ZQIA 1VQ5A 2NVXA 2UUBL 2B63B 1CQJB 4C3HG 4H0LC 1V1PA 4X66Q 2EY1A 2FHTA 5LOVF 3OTOQ 3KOJA 3GIDA 1I6HH 4PZ6A 2F0QA 4F4WA 3HOZG 2W6MA 4BBSH 2K5HA 1QCBD 3U9TA 4ED6A 1JC7A 3GIQA 4R4IA 4DUYQ 4JG2A 4DGZA 4F88A 3HOUB 2N78A 1PVOA 4HMJA 5JOBA 3T1HQ 3RZDB 1PRTF 4P75A 5GONF 5GQOA 3M4IA 1LABA 5G3LF 5KG2A 2Z4IA 2KCNA 1S9FA 5KFDA 1PH5A 5J39A 2R82A 3KHRA 4RHRA 2ICEC 1TWHH 1VQHA 4GN4B 2EY2A 1S5ED 2R7ZH 1J5EH 3Q1KA 4BY7H 1HXYD 2F3WA 4KY6A 2CFMA 4DK1A 1BNCA 2PBZA 1CHPD 3K5NA 1GOZA 1EFID 4GS3A 2XN9C 5EDWA 1EEID 1TT2A 1NAPA 2B2TC 2C9OA 3E6ZX 4JI3Q 1HQMC 4HIKA 3OUZA 5KT3A 4ZLTF 1QZHA 1TY0A 4DFAA 2KHSA 1LTBD 2KJXA 4QB4A 3S2HH 2NVYH 3GTGH 5L1KA 1ASZA 2NVTH 4DV3H 4JYAL 4IUNA 2A6ED 3K7AB 1V1QA 4O2DA 3ULPA 1HNWH 2XRSD 5CYUA 4DV6H 3NENA 3NHHA 1SRUA 1HA6A 3JRXA 3W5OA 2LMCB 4TVAB 3CD6A 1JWMD 1WCMH 1C30A 5J2TF 4MHEA 3H0GG 3R2TA 1F9SA 4ME5A 4AYBE 5IT9c 2Y0SG 3MC0B 4YP3A 1NCVA 1K83H 4DR7H 3W1GA 4V190 1GHKA 2CKZB 2B2WC 3V6JA 1DD2A 3GTPB 5D1OA 4PNYA 4MV3A 2QF7A 3H94A 1K0RA 4I50F 2GPSA 3IKJA 2YS6A 1ET6A 5JJIA 3GV5B 2VB3X 2R85A 1PA6A 4ME6A 4S3SA 2VUMB 1L1OA 1ZYRC 4DV7L 4K5VA 4BWSC 3BJYA 1YNND 5J2UF 2OH2A 1DCZA 3IFDA 1B7YB 3BQ0A 2R86A 1XMOQ 2R93H 3O13A 2BOSA 3CXCA 3CMAA 1VBGA 3R23A 2X0SA 1E4GT 1HZ9A 4IJHA 4BBSB 3NTKA 4ZAIA 1N32L 2F1MA 4UCOA 2DNCA 3RMHA 5CB4F 3R2IA 3RBEA 1QE6A 4DR6H 5IYCH 1XPUA 1SE2A 4FO2A 2FLNA 5M9OA 2C22A 1DIKA 1QJOA 2K5DA 1KJIA 3N43B 1BDOA 4ZCKA 1N33L 3EQLC 1AE2A 1UNSA 4DNRB 2KCMA 2OQKA 5EWFA 1S10A 2RCFA 5A2QL 3M4QA 5FKAC 1VDZA 5T1IA 2E2JB 4IPGA 2E5LH 4G7ZC 3HOWH 5JQWA 1TS3A 2JEGA 1JB7A 2VPSA 4IZOA 3TQYA 1JDBB 1E7ZA 2XGTA 5KFRA 3OMGA 4CKCA 1LUZA 4ED7A 1S97A 3NGDA 4F50A 4LF4H 2XRQD 4IRKA 3J7YW 2PPBC 3TEHB 5DG7A 2GVAA 4JI8Q 4F87A 4EEYA 1IL8A 3KLRA 1CA6A 4UY8C 4GOPC 2WDTA 4QIWB 4X62Q 4IALA 5LA6F 4LFCH 4JI3H 1RTOA 3CRKC 1EUCB 2OWOA 1Y1VB 3GTLH 4ED0A 5C44B 2F4VL 1IOWA 2XD4A 1KIXA 4PG3A 4KLKA 4A3BG 4KD4A 4HN7A 1B44D 1XX8A 1HR0Q 1S40A 1SEIA 2WKDA 2L4NA 3MFGA 2N55A 4DV4Q 5BR8L 3Q23A 4JI6Q 5KG5A 1KABA 4U673 1KRSA 3TS0A 5LL6S 4IFDI 4YY3Q 2K1BA 1GXDC 3CPWA 3GV6A 4YB8B 5CR3A 3H40A 3HKZB 3L0OA 3AB9A 4JW0A 3KF6A 1K8AC 5JVH3 4QCLA 2K50A 4QQBX 1QVGA 5LP6F 3LWUA 1TWFH 2Z9HA 4LFAL 1PFNA 3JZIA 4YHHQ 2MGSA 2TSSA 3CKIB 4R1JA 3S24A 3GTMH 1M90C 5KFIA 2I80A 2UU9Q 4KKUA 3RLFA 1ZKOA 4R8IA 4A3JB 4NMZA 1L0YB 4CJ0B 1WTOA 4XXEA 1Q12A 3F8TA 4OO1H 3I56A 2AQ3B 5HURA 1W93A 3CCJA 1KNEA 2QYZA 1MBYA 3PF5A 2MFIA 4AH6A 1EYGA 4DV0Q 2YTYA 5KYLA 1NBWA 1XNRQ 4K0KQ 1GUSA 2DY8A 1XNQL 3MWEA 1XPOA 4QL5A 1R9TA 3EBEA 1SNPA 4IPCA 3M7NA 2O5IC 1NUCA 3RZOB 5DQIA 4R8UA 2Z8LA 3RB6A 4O4LF 4KD3A 3CU7A 4A2BA 3EVQA 1GYFA 2LS01 1UE5A 4JI7L 1H9MA 1RD9D 2CWPA 4EVOA 1CKNA 1SNOA 1VQFA 2F0JA 4A3IB 2JA6H 4X6AH 3J7A5 1R4QB 2EY6A 3Q24A 2EE1A 2AQ2B 5EWEA 3PW2A 3MVVA 1SYEA 3IAYA 1TWAA 5LYJF 2E2IH 4JI5L 2IP4A 4RB2C 4TUYF 3N52A 2LY7A 4J6HA 1TIID 1OWTA 4GC7A 4A3FH 1EZ6A 4X64L 2B2YC 1T3NA 5A2QW 1SR3A 3M9BA 1CA5A 3HKZE 4RUCA 5IYDH 2Z4HA 2OT2A 1SBBB 2FINB 4LUVA 4J9KA 2Z0SA 4PWQA 1D8LA 3TP6A 1B70B 3A74A 1MIUA 4J9QA 3VYUA 2EQSA 5M3MB 4DV5Q 3I4NG 4GKKQ 1VQ8A 5JEAJ 1PFMA 4LF8Q 5KFAA 4LFBH 3HP3A 4LF5H 2A1AA 4OONA 4RAYA 3BZDB 2Q8RE 1CKMA 1G51A 3HOVB 1OXUA 1IBLH 5K2MA 4M9UA 2F0GA 1A8VA 2UUBH 3J80i 4CGYB 2I87A 1EOTA 1RIPA 2R92B 1ILQA 1S0NA 5KFXA 1H9SA 4XYQA 1GUNA 3A5UA 4GN5A 1BO0A 3ND9A 5FO7B 1G8ZD 2MQHA 4LF9L 3KYHC 3RGZA 1RK5A 3GV3A 3M4OB 4DR4L 5K36H 2V5AA 4IR1A 4LF7Q 1D6EC 3CCLA 3FKIG 2W70A 3MWYW 3SK8A 4X3SA 1BXTA 2N3SA 5JVLA 1Q1BA 1GO3E 5M3FH 2JA8B 4NKLA 3ERQA 2WTFA 1U4MA 3KHGA 5ELNA 3J80E 2RDJA 4KKSA 3MEHA 3Q8QB 2B63A 3UDFA 4RKBA 4I55F 4KHPQ 4KHVA 4ZUIA 3JAML 4LF6Q 3EFXD 4JI2L 1AFPA 4JV0A 4IR9A 4B9WA 3H3VH 3I55A 2BQUA 1HNXL 1XMQQ 1C48A 3GIJA 3NTIA 4CJ2C 2ZM6H 3S14B 5IP9H 4OX9Q 3CCQA 2EYOA 2W7PA 3I72A 4C2MH 3U58A 1XWEA 1SYCA 2CWAA 3H15A 4YJ2F 3S16B 5KFZA 4APVA 3J81c 3KJPA 4JOIC 2BA0A 4XDXA 1BCPD 1FYCA 2HQEA 3KK7A 3R3OA 3FDSA 2EPBA 4NXMQ 1M0TA 2FJZA 4JUZA 4L5QA 1WR2A 1VQ6A 2F3VA 2EYMA 3P75A 4DN4M 3H0GH 4BY1G 2RGVA 1DOLA 1FR3A 2NUCA 2K14A 3AEVA 5C0XJ 4BA2I 1PZJD 3A8KE 1Z2NX 3H3VC 1VKZA 1WTHA 2QDLA 1YNXA 5I2YA 4YWLA 3P1HA 1D1IA 3N6RA 4TKOB 3ULLA 2NWGA 2Q2TA 2NU7B 2Z6KA 3UDGA 2K01A 1YJNA 1E22A 4DV7H 1HCZA 2JA5H 1I94Q 4WJWA 1AE3A 1L1OC 2AHOB 3N40P 4C3HB 1A2TA 2R7ZG 1N34H 4LF8H 2ZDQA 5FLMG 4BY7G 2WB1G 4RKLA 5AJ3L 4X3KA 3T5KA 1N32H 5HY6A 2FMMA 3HOZB 4KY7A 4XZ3B 4UHVA 4TQRA 4B3RL 2YL2A 2F0VA 3OIQA 3GTPA 1STEA 2RDHA 2R7FA 2NUAB 4E4TA 4FS1A 3HFZB 3S1QH 4JI1Q 1X55A 4MZ9A 4ZRZA 4ECYA 1HTPA 1BGWA 1PH7A 3T13A 4DV3L 4HQ6A 2VUMA 5C3XA 4U7CA 2D0OA 1HNWL 2VY3A 2ZDGA 3BG3A 4DV6L 2VQDA 1K1SA 4ZYSA 2MJ8A 5KX5F 3RLNA 3RN5A 3BQ2A 3OYYA 1A15A 4HSPA 2IL8A 5FLXc 1MI2A 4FS2A 3PW7A 1TQOA 3I91A 4LWCA 1OXVA 2OQ0A 4F4ZA 1LTRD 4HJ8A 4DV2H 5D3DA 1ASYA 4AIMA 2H1EA 2IW3A 5D1PA 4DL5A 1Z9FA 3FMCA 3RD4A 4ZQ3A 4IHJF 1N9WA 1UWVA 2ZTDA 1VF5C 3R5FA 1GUGA 2KCCA 2SCUB 4A3DG 3JAMW 3RF2A 5KFFA 4FF1A 5M5XB 1TS2A 2G9HD 1K1QA 4K2KA 2BH8A 1YI2A 1SYFA 3MXPA 4B3SQ 5BR8H 4RGOS 3SXHA 3PQIA 3T1YQ 1CSQA 1X54A 2NBFA 2J9GA 4JK1C 2R93G 5F9NA 2Y0SB 5IWAL 1IBMH 3J81i 4O3RA 1M4VA 4HJAA 4QWBA 3GTGA 5H1SE 5IODA 2JA9A 1ESFA 2JJQA 3RV3A 3NTHA 5IYCG 4QIWA 3IFTA 4HMIA 4LFAH 3KAJA 1ENFA 2SNSA 1Y1VA 3PCOB 2HD3A 5C4ZA 2ID0A 3I4MH 4IUQA 5C4JH 4C5BA 4JI4Q 3D0FA 1D1KA 1E4EB 1TKWB 4DUYL 2PMZB 2ALZA 3Q8SB 3V05A 1NSNS 3TREA 3HOWG 3T1HL 1RODA 4GC6A 1U0LA 2FP4B 1XTDA 4HJ7A 1QOHA 4H7BA 3JSLA 2A68C 4O4HF 3HKZA 2JP1A 4LF4L 4DK6C 4QWDA 1QVFA 1XNQH 4J0MA 1IHZA 1AH9A 1H9RA 1X9NA 3VYSA 1FGUA 3MA2B 4M7EA 4GNXC 4DR1Q 1VQBA 3S2DB 3NUCA 3EJIA 1I3QB 3FRPB 4JI3L 2I5MX 4A76A 3GDEA 1JWUD 2UXCQ 5CC4A 3FPUB 2NU9B 2JYOA 4IQZA 2VOBA 2KHIA 1KHIA 3RGXA 2JEAI 4E6IA 1C8CA 2CW0C 4IPDA 4H44C 4IZ8A 1RF2D 3IN5A 4JI5H 2VNUD 4EFEA 2OF1A 2FPIB 1Q8IA 3RJ0A 2W9AA 1WFQA 2EYHA 2JA7G 5KFPA 2FXQA 2J4XA 2VQEQ 3PO3H 5CA1F 2Y0SE 1V51A 1JB3A 4X64H 4XTCS 5CV7A 5BN4A 1EQQA 3GV8B 3PUXA 5C8YF 1BVSA 5T14A 4RGTA 1EYDA 1G6ZA 5C5MA 1MZBA 4N8X1 3K5OA 2W6NA 4BXXH 2UVRA 4A3BB 4O3SA 4MTNA 4KN7C 1W2BA 4U6PA 1JDEA 4RNMA 4LW1A 1DXMA 3S1RB 1BXRA 2RGRA 1X6OA 1SEBD 2A73B 4H02A 3GTKB 2RDIA 1DONA 3E3XA 5C3WA 1CKNB 3CPFA 2KEEA 1Y69U 4OO1G 2J6SA 5CMDA 5I2XA 1BQQT 4JBWA 3MR2A 4ZK9B 2EZVA 1KAWA 2C2EA 4RA8A 2I46A 3E9HA 3HBLA 3D4DA 3STBD 2IBKA 1HHVA 1MGSA 2C00A 5JEAH 4JV5Q 2JEJA 3GTJH 3K0XA 4Q44A 1N36Q 4CKEA 1B3AA 1LTAD 3P7JA 1A2UA 1PRTD 3S1NH 4UCTA 2VQFQ 4LF9H 3CCEA 1YNJC 1MJEA 1E2VA 3PF4A 3BDCA 2GN5A 5A2QE 4DR4H 2WP8J 4BWGB 1EQTA 3W3AA 1YJ9A 2JA6G 2NVQB 1A3UA 1V8QA 1SE8A 1JOQA 2ATLA 2HCIA 2QA4A 3RB3A 1EZ1A 4HSVA 1KDAA 2ZTEA 2R8GA 3ORQA 2L11A 2WV6D 4JV2A 2HT1A 2R92A 4A3MB 3K5MA 2R8IA 3STBC 4O3QA 2M00A 5KFGA 1PH2A 1HNXH 4ECZA 3GTMA 3F2BA 2EJGC 1C4QA 3BVZA 2PW7A 4DF7A 1KNAA 4NDXA 1STNA 2QCPX 1ONLA 2AU0A 1GSOA 5I6YA 5JVDF 4C5AA 1Z6HA 1PTOH 5FOBB 3TQ1A 4C5CA 4RAUC 4FNFA 4X65Q 1PTOD 3R8BA 4LFBL 1TWGB 2W6ZA 4J15A 1AEXA 4O3OA 1CQIB 5FD6A 2UXDQ 1L0XB 3DEPA 4AYBB 1EHIA 2PW5A 1IBLL 3WWVA 4DV4L 4KY5A 4MTDA 4ECQA 1Y8OB 1HNZH 4UP8A 1KQSA 4IN3A 4BY1H 3LWBA 5EZYF 3QG1A 5CAEB 1WTQA 4YY3L 2JSOA 3A54A 3SGIA 4N9TA 5T1GA 2YZGA 1JIHA 3C0FB 2ZXOA 1LTTD 4B3TQ 3GIPA 3OSPA 2ICIA 2QEXA 1BBUA 2EYPA 4NPSA 2J7ZA 3G71A 5K36G 3AMUA 3HS0C 3I4NB 3TMEA 3M3YB 2R8JA 3M9OB 5C3EH 1VQKA 4YHHL 3CP0A 2SEBD 5LXTF 1TA8A 5C0XH 2HDLA 1K28A 5M3FG 4QY7A 4FF4A 2L0CA 3N8DA 4RZRA 1PTOC 2UU9L 1SXTA 5IP7H 1G291 2WAQE 3F1ZA 4C3IH 5FLMH 3A5ZB 4LH6A 1CQVA 3I12A 4DNIA 2RA4A 2PQAB 4DV0L 2HHHQ 4B3MQ 4HNVA 4IUTA 5ELBA 5FO9B 1XNRL 2V4QA 4B3RH 2YU9H 1SYGA 3KALA 4K0KL 1AZPA 3H4DA 2UXBQ 3QZ7A 2R6FA 2HVQA 5IP9G 4POFA 2VW9A 2ZM6L 5JAVA 2YTXA 4AQYQ 3AYHB 4FBTA 2VUGA 1FNVA 3FKIB 5BMVF 2PZWA 3I90A 1ZHQA 3CF5A 3U9SA 3H91A 5KFLA 1LT5D 3E9IA 3F2DA 3MFHA 1GUOA 1ZYRD 3QB3A 3VPBA 4DPGA 3FDTA 3BYYB 4I65A 4YCVA 2V59A 5L37A 1CSPA 3FVQA 1GHJA 5AFWA 4MV8A 1PTOF 2F0SA 2IX0A 1GD7A 4N9PA 3DUZA 2UUAQ 2UUCH 4UFZA 1JWSD 2WINB 2DPJA 2W6OA 4DL2A 2F4IA 3TS2A 1GM5A 1I7NA 1F77A 1S5BD 3ER0A 1BR9A 3K3VA 2EOTA 1DOKA 3KTMA 4HR7B 5EPJA 1ZXTA 3PIPA 2E2HH 3TP8A 4CC5A 3U4ZA 3L4KA 4K8JA 2B2VA 3CCMA 4MV6A 4A3DH 4JVZA 2IA6A 2ES2A 1J6QA 4IJLA 2B2UA 5COYA 3V96A 3PGZA 2IX1A 5DQGA 3PIO3 2JA5G 2BE5C 4CJ1B 3CQZH 4IURA 2NYZD 1X3QA 1HUMA 2XC9A 2HIVA 3PSIA 3A0JA 4GKKL 5IWAH 2K52A 1TAEA 3K80C 1N34L 4LF8L 4LF7H 1QNKA 1O75A 2F52A 4JI0Q 1I6HB 1LT4D 2HUGA 1JORA 4L5SA 3ONAB 2PCFB 3A8JE 4H13C 3JAMi 2DIKA 2P0AA 2PN1A 2XCLA 5KFCA 5C5JA 4DR5Q 4J9SA 3DEOA 2FMAA 1Y1WH 4X66H 1HR0W 1KAAA 4BS9A 3T51B 4DLKA 4Q5VA 3OTOH 3N44B 1KJQA 4R7RA 1VF7A 3MFYA 5ELEA 3OWEB 1YHAA 4B3TH 3S17H 3MWMA 2I07B 4DUYH 1TWHB 3L3OC 4O4IF 3OUUA 2LXKA 2F0UA 4XYMB 1AN7A 3T1HH 2R7ZB 3K6OA 2C35B 4ZHQF 4BY7B 1G2TA 2FK3A 2Y0SA 4GKJQ 1SNQA 2WB1B 4LAAA 3R5HA 3JAME 1EWIA 3Q2OA 3NWTA 1M6VA 1YVCA 2WFWA 3GIMA 2RSOA 3OMCA 2PQEA 1PH9A 3HG9A 4C3JG 5EKIA 4KHPL 3S2HB 2NVYB 3L9AX 3GTGB 4DV2L 4F8MA 3FMAA 5IGDA 4LF6L 2NN6H 2NVTB 3MXGA 4EFBA 3PV0A 2C2RA 2MPMA 1AN8A 5D14A 1SYDA 1PH8A 5KG6A 1K3BC 1XMQL 1V4YA 1IYVA 1E4EA 3T4AC 1A3VA 1GUTA 1SFOH 2PMZA 5HBRB 4L8JA 1RJTA 1FD7D 1Q7YC 5FD5A 1WCMB 3I7FA 1G91A 4MV9A 1EY0A 1C0AA 3J80c 4MA5A 2OLSA 3C46A 1VCIA 1IBML 1K83B 4HTHA 2PO4A 2ZXPA 2JA7H 1K8GA 2F0FA 3VR6A 1OXSC 1I3QA 4P71A 3CW2C 1BUVT 3WNZA 1B4OA 4ECTA 3D31A 3I4MG 3KXYT 3A7LA 3J7AF 5E3FA 2C5CA 4XT1B 1VQJA 4JC0A 3H4BA 2EY5A 2R93B 1CUKA 3MEFA 3G6YA 1BNZA 3ITPA 4RGMA 2R7NA 2WB1E 3R93A 2WAQG 1PMRA 2RF4A 3BA9A 4R8NA 5C4XH 4A4IA 1AP0A 1XMOH 4ZOLF 3NBHB 4KV6A 2VA3A 1B53A 2ZXRA 5DLQE 1JT8A 1Y8PB 2B8GA 4PZ7A 2H4OA 2F0IA 4RHSA 4DXFA 1PH1A 1EWCA 5KNCA 3ZYYX 2I8CA 1I50H 4K5WA 1PZID 2VB2X 1EYCA 4IFDJ 3HOWB 1FL0A 3GTKA 2IHFA 1IBKQ 4JI1L 5KIXA 2YCHA 4EYHB 2K05A 4DV1Q 1VQEA 4IOAA 3T5JA 2FFKB 2IT1A 1NMFA 1CZWA 4FP5D 2NVXH 3PO3G 1A6XA 4JYAQ 2K04A 4YWMA 3MHBA 3M9MB 5EQ0A 1IYUA 1PYBA 3M7GA 4XYOA 3E0JA 2A19A 3N41B 3QOJA 4DR2Q 1VQOA 3GTLB 4QWEA 1I4RA 2D9UA 3G6VA 4BXXG 3CCRA 4YAKB 4JI8H 4Q8EA 3IG0A 5L9XA 5KFEA 4NXNQ 3GD7A 3PW0A 4X62H 2CW7A 1KEEA 4YJ3F 5FO8B 3GIIA 3VMMA 1EUDB 2F0HA 2EYLA 4TQUS 1QZGA 1ENCA 1YHBA 2EJMA 3NSWA 5JVG3 1IOVA 1HR0H 3PZPA 4DV4H 1KRTA 4LMYA 4QWAA 4JI6H 2EXDA 4B3SL 1DV2A 2R7KA 1KBLA 1IZ6A 2FK2A 1TWFB 4DK3C 1SNMA 4IPHA 5JEAG 4YY3H 3EROA 1S4ZA 2D62A 4EQOA 3N42B 2FKLA 1F2MA 5CV6A 3W2DA 4OWWB 1NMGA 1XXGA 2KQ3A 2B8FA 4LUOA 2F0TA 3MXUA 3GTMB 2FE3A 5M5YH 4HYKA 3KUPA 5JJLA 1AW7A 4RH6A 3G6XA 2F0LA 4P73A 5A35A 4HCSA 4KTAA 4YHHH 3CAMA 1H9JA 5E4XA 1TS5A 1N48A 1TWGA 4J9RA 1YIJA 4DL7A 4JI4L 4AYBA 5DM63 2UU9H 3IRBA 2CH4A 3ERSX 4QW8A 1A3TA 5NUCA 2XCAA 1CK1A 3GTQH 2AUJD 3GTOH 4RB1A 5HGQA 3E0EA 4ID6A 1II3A 4UAIA 4DV0H 1U9RA 1E2ZA 3X3NA 1XNRH 4K0KH 1T9HA 3PO2H 2AKWB 3V4SA 1FNWA 4A3EH 4Y52H 5KFYA 1LM0A 4ZUJA 3Q0AA 5I47A 2JA6B 2XWJB 1C9OA 3GQCA 4G7HC 2I0QA 1IKLA 4DR1L 2PZUA 3S15H 2A5HA 3RN2A 2E2IB 5IGGA 4FF2A 2UXCL 3CCSA 1H9KA 1HFGA 1LV9A 1STYA 4QWCA 2NTTA 2DJGC 1F9QA 3TRZA 5KG0A 3L4JA 3RB4A 4A3FB 3I3CA 1O7ZA 4DUZQ 2HDMA 1HNZL 1IYJB 2PQAA 1RKNA 1V1OA 2F4VQ 3RNUA 2K5WA 2XVSA 1DJRD 1YZ6A 3BJUA 3HXLA 4LNQA 2N49A 5EKLA 1A9XA 1W6JA 1EY9A 2VQEL 3OWFA 1XDNA 2K75A 4PZ8A 3FKIA 1UE1A 2W8KA 3K5HA 3M85A 3K5LA 1LTSD 1TVXA 2KCTA 2PVPA 4KJNA 1ULZA 2VUMG 5C3EG 1E4FT 3Q8RB 1EWHA 3T5LA 4RCOA 5C0XG 2VS1A 3PIP3 1YBYA 4KN4C 2B39A 3I4LA 1F9RA 1C3OA 1PYSB 4IRDA 4DU9A 4PQXA 1NE3A 5LHY1 3PR4A 5IP7G 4DV5H 4FU0A 4GKKH 5KKNB 5CBAE 1WD1A 3UDIA 2MNAA 4C3IG 4MIUA 2WE6A 1RYRA 3D6CA 5CV4A 1I5FA 3RTXA 3X3MA 3S1MH 3RAXA 1TS4A 5M5YB 2DLNA 5DQHA 4Y7NH 2WYOA 2F0EA 1S0MA 1UEBA 4JV5L 3HKSA 4HR7A 3TIIA 1W3SA 4XYLB 3OSOA 4RB0A 1NR2A 5IGEA 2VQFL 5M3FB 3NXWA 3SK4A 1EY7A 1G6PA 1X3EA 4JCVE 1B1ZA 2G5DA 4X3TA 2B2TA 1O7IA 3VYRA 1JLLB 1EOVA 3KBXA 3GTQB 4OHJA 4WFN3 1F9PA 4K6DA 1F2YA 3SVMA 3GTOB 2V4DA 3L2PA 4A3LH 3VPDA 4DAPA 5IT9L 3LMLA 3MFIA 3TSSA 3QZ8A 3I8ZA 5EJWA 1A0IA 2G9DA 2A6HD 2ZT9C 3C3LA 4O42A 1L0WA 4JI7Q 1PDQA 2JEBI 2JEIA 5IGCA 3PN1A 2UUCL 4IAJA 3UFXB 1W6KA 4HEDA 4J9PA 1FGBD 4KHPH 2FJ2A 2JN4A 4C3JH 1T5EA 1E2WA 5EOYA 4LF6H 1NY4A 3HOXH 1HZBA 2Q2HA 3FP9A 3F8NA 2RQXA 1QVCA 4C2MB 4ECRA 3UDXA 5C44G 4Q0YA 3IL8A 1BCPB 3BZCA 1VQ4A 1TXYA 1XMQH 2EJFC 2ASBA 3J7AV 1Q90A 2H5XA 1TWHA 2E75C 3PIOA 1RJQA 3M9NB 4DR3Q 2P5ZX 1WTPA 1FJGQ 4OX9H 2Q2IA 2R7ZA 1HPCA 4OWXB 2XCPA 2R8KA 3MR6A 4CDEC 2LKVA 2VR1A 4A75A 1JKJB 2WB1A 2O2LD 5ELCA 3K5IA 3Q6SA 3V2TA 5KT2A 3H0GB 2VXWA 3D4WA 3BAAA 4YAJB 4R4TA 1DOMA 2A68D 1PH6A 1YHQA 4X65L 1PFBA 2GPWA 1WYDA 2XSCA 4NXMH 2A6HC 3QWNA 4I7AA 2UXDL 4L1KA 2NVYA 3QIAA 1DYQA 5DAUA 1IKMA 1QUQB 3Q8PB 5EPLA 1Y1WG 1R9TH 5EAYA 5BN5A 4A3KH 4X66L 3OTOL 3FHWA 1O7LA 4QUFA 5ELFA 2UVUA 1SROA 4B3TL 3RUZA 2JA5B 1WCMA 2CW0D 3ETHA 2O4XA 1VMCA 4TV8F 1X3FA 5GAGC 2KVMA 4F7XA 1G2SA 1VQDA 1B6RA 5KFNA 1TWAH 1PH3A 2LSSA 4HIOA 1K83A 1R4PB 2L55A 5KNBA 3DLLA 1DV1A 1DGSA 1WSCA 4BBRH 1K8OA 4IWYA 1I94H 4OELB 4F4YA 1ZETA 2R84A 3K57A 5CA0F 3H6MA 3S1QB 5BPHA 3S9WA 2DGYA 2NN6G 1XJVA 2CQOA 4XIGS 3MR3A 2N8NA 2SDFA 4JPBW 4B08A 4MNOA 4IRCA 4EQPA 5LMNQ 3F2UA 5KT6A 2NZOA 1NTGA 4OO1I 2ZJRA 2UXBL 3GILA 2FLLA 4AQYL 4JI1H 4JI2Q 2IMWP 5KEEA 2YYAA 2R93A 2K7VA 2KEDA 3KDFB 2HCCA 3BU2A 3NELA 4G57A 2ASJA 1MJCA 1HQRD 3EIVA 2BDOA 1VMPA 4M1UB 3NBHA 4APMA 4TRDA 5FPOA 3K3PA 1WVLA 3R5XA 3A56A 5ELDA 2RDGA 3CCVA 4RZQA 5DG9A 4ILWA 4UP7A 2UUAL 1YNJD 2AWOA 5IT9W 3LNNA 3DXJC 1IXRA 1T94A 4RAZA 3HOYH 2YTVA 4RMFA 3VYTA 1KLUD 2UVWA 3HOVG 2I5LX 3GP7A 2V9WA 2UVVA 1KDBA 1CT1D 2F0DA 1K3RA 4GNXB 2B63H 4B3SH 4NP5A 2R92G 3T1YH 5LMUQ 5C4XG 4QW9A 2AGPA 1ZEQX 1MSHA 1GKHA 1XMOL 1GJXA 3GTLA 4RGNA 3I4MB 1EIFA 5C4JB 1HH2P 3HOUH 1GSHA 4ALPA 3G8CA 5CGKA 3RZDH 2I5HA 5I6WA 4DR5L 1J5EQ 5KRUA 3BABA 5AJ3Q 2GLTA 4KKTA 3BG5A 1S5DD 2JA8G 4RUAA 1HUNA 1B04A 2PI2E 2FLPA 4PMBA 4JI4H 3C1EA 4WBNF 1P16A 3WO1A 4L63B 2WAQB 3BDLA 4OEMB 5ELOA 4J9MA 2QGQA 3LGJA 4GLVB 1TWFA 3CC7A 4EX5A 2BH2A 4EGJA 4DV3Q 4GKJL 1KL9A 1WTWA 1HNWQ 1O7YA 3RB0A 1LT3D 4ABNA 4ECWA 4DV6Q 2YYZA 1I7LA 3DHQA 4B9XA 2F0OA 1HFNA 3K81C 4JI8L 3TP7A 5TSSA 4R4CA 1Y1WA 1EQRA 4FXKC 2MO0A 3K7AH 1QILA 1SYBA 4ODGA 5HV6A 1UC9A 1RTNA 1B50A 4K5XA 2AQ1B 4X62L 4DR1H 5GROA 2CHBD 2N88A 1JJ2A 2KBNA 4DR7Q 2UXCH 2YV5A 2X69A 3PO3B 4YBZB 5KG1A 1HR0L 4J9NA 3H3VI 1Z2PX 3JAMc 2HVSA 3TP5A 4JI6L 4CKBA 2DUDA 3TIGA 4YR3A 1EEFD 1Q86C 5IYBH 2FPPB 2AQ4A 4P2CB 1I50A 4ECVA 1K8MA 3AQQA 5DGAA 1RJRA 2VQEH 3RLOA 5I4DA 4Y8VB 1M8AA 3OW7A 3GTPH 2JA6A 1QNUA 3NQTA 3LWEA 1VQ9A 3A8IE 2CCZA 3SI8A 2ATWA 1K0SA 4ZKCB 5HGTA 1PX2A 2YS7A 2E2IA 2VUMH 2Z1CA 2OTLA 1JQYD 5C1OA 1GGOA 5KFOA 1T36A 3MR5A 2EXZA 4DR6Q 4YWKA 2Z6KC 2DZDA 1EY4A 3VR5A 5BPFA 2NTSA 1S72A 1AUVA 3KLSA 2IX3A 3LP8A 4A3GG 3GQBA 3GTJB 1PRTB 1EUJA 3SE0A 3S1NB 4QGUA 1L2FA 3URYA 2E5LQ 2QKIC 3SE7A 5LMUH 3PO2G 4EGVA 1UE6A 4A3EG 2VZAA 1CTMA 4JV5H 1D7QA 1KLGD 1FNUA 4C1NK 4ECSA 1N36H 3ZJYC 4TSSA 1YEZA 3J81L 2B29A 2WKCA 4J1MA 1KJ9A 3OSNA 4LF4Q 1JE5A 2LXJA 2OXPA 4C1NI 2E2JH 4MTKA 5DLGA 2VQFH 1OXXK 4WJ4A 4UCVA 4GN3B 4OGQC 4JV1A 1TY2A 2BE5D 2W9BB 5KFHA 1WOCA 3TZDA 4CDDC 5J3BA 1IBKL 4MN3A 4OXPA 2CQAA 3VDYA 1JMCA 3Q22A 5H80A 3KF8B 2BA1A 4EQ5A 4LFCQ 2ASLA 2JXMB 3PUVA 4DV1L 4EYIB 1ET9A 1KDCA 2L5TA 4UPAA 3PW4A 3TINA 3J7ZC 1HRJA 5KT5A 3ND8A 2WIIB 3UQ8A 4A3CH 1HTLD 3PW5A 5CV8A 3SEBA 5KNDA 4JOIA 4LUZA 4R4OA 1I6UA 2A69D 1B9NA 1D5ZC 2W57A 5EBDA 5K5PA 1Y1VH 3OHBA 5C44H 1PTOB 3E5NA 4ME3A 5KFJA 4WD3A 4DR2L 2DJFC 2FPGB 1JOKA 5FK9C 2VPQA 2R7MA 4ECUA 1DM0B 4IUPA 5GAHC 4NXNL 2NZ1D 1Z2OX 5IY0A 3GTQA 3GTOA 2DY7A 3BDOA 5IGFA 3G48A 3EYYA 4DV5L 4BY1B 4EBDA 3QJYA 1CQFA 5LL6b 4HCEA 2Q8TA 1EYAA 4X65H 5D3IB 3GLKA 4O1NA 2CZGA 1UC8A 2ZJTA 1PZKD 1LTGD 3UI2A 2UXDH 1VS0A 3G7LA 3WDNA 5I9OA 4HNTA 2K03A 1NJIC 1Q8KA 2HQLA 2K33A 4CHTB 1YJWA 2O03A 4C2MA 5KFWA 2A6EC 3DWQA 3UE1A 3L7ZC 3PMFA 1UEAB 4QF4A 2A69C 1ICFB 1TWCH 5C3EB 3KJOA 3V4ZA 5KFMA 1EL0A 3BYTB 4C56C 1S0OA 5BN3A 4M8AA 4UCRA 4IUVA 2ASDA 4O2AF 2FMCA 4A3JH 1SLJA 4WJ3M 4XQQA 1Q82C 2CW8A 3H0GA 4A3LG 1I4QA 1SSOA 2QILA 1TU2B 2QW7A 4C3IB 3C1FA 1PXUA 5FLXL 5GADC 4LF7L 1EIHA 3T5HA 3SK6A 3K8AA 5FJ8H 4IWXA 4I7HA 1I4GA 1UUPA 1CKOA 1VQNA 4OIJA 5CORA 4FYDA 1RJPA 4L5TA 2YU9B 5JPMC 2L12A 3DF7A 4CBVA 1QUQA 3NE5B 4Q8FA 2J0TD 4F4XA 4YCUA 1B2TA 1EY5A 1QWYA 1B8AA 3HOXG 1CHQD 2C28A 4IOCA 3RZOH 5GAEC 2K32A 4B3MH 2HHHH 1NNXA 1I4PA 1RL2A 1E24A 2A8VA 1STGA 4ETSA 2FK1A 2W6PA 2JA5A 1B33N 4TV9F 2ALYB 4A3IH 2UXBH 1YNNC 4AQYH 4OX9L 1ML0D 4EBCA 2SOBA 1FVIA 2NU6B 1CM9A 2V1CC 3OW2A 5CBEE 1QG7A 3KLSX 3J81W 4QJFA 4WORA 4NXML 1WTVA 1PFSA 2BQ3A 4PV1C 3SDZA 4DUZL 1VQPA 1KJJA 5JUMA 2FB9A 4LFBQ 2RHSB 2E2HB 4LF5Q 4A3KG 2UUAH 4ED3A 1Z47A 5L1JA 3I73A 4A3DB 1IBLQ 2K4KA 1MSGA 3W1BA 2ZDHA 3ORRA 4Z9CB 1MHWC 2PI2A 2UUBQ 2R87A 2SNMA 5C4HA 2ENBA 2J6UA 5M3MH 3CQZB 3WOFA 5F9LA 1ENAA 3KDFA 2E74C 4DKAC 2BR0A 1E1TA 3HOVH 4HIDA 1S5FD 1Q3LA 4I4TF 3FPPA 4A93G 3BVMA 2XGPA 4EEQA 3UE0A 3KHHA 5CV9A 4J8QA 4R9WA 4GOPB 4BBRG 2R92H 1I94L 3MZ5A 1Y1WB 1GSAA 2X6GA 1TWCB 4CC6A 4JI0H 1SMYD 2RKSA 2PZTA 5DLFA 1WD0A 3ULJA 3S17B 2VA2A 3M4OH 4DR5H 1PYWD 3VPCA 4POGA 3D8GA 1AZQA 1BKBA 2R3ZA 2JA8H 1VQMA 1RCVD 5IT9E 2J6TA 3CCUA 4MTEA 4GNXA 3T56B 1OTCA 1S5CD 2ZM6Q 1PHJA 4IFDG 4UCSA 1X3PA 1Q46A 2R6GA 4A3MG 3WOEA 1CI3M 4GKJH 3HZXA 1GUWA 1IW7D 3TZUA 1LTLA 5JPNC 3PVXA 1SJED 2HIXA 4QIWE 1LLRD 2EYFA 3U9OA 1RK6A 1X32A 4R4QA 1SMYC 1SN8A 3S14H 1SFOB 5FLXW 5EGTA 5KYIA 1IL2A 4EQNA 2A74C 3N6XA 3U50C 3HOYG 3OPOA 4KI0A 3VR3A 4PMWA 3S16H 3OHAA 3RUPA 4RNOA 3ETJA 2D0PA 4EGQA 1SYXB 3NEMA 2IWHA 2WAQA 4AYBG 4K8IA 1WI5A 4RFBA 2JA7B 4LJZC 4DR3L 1FJGL 4EG0A 1GVPA 3KFUA 2F0PA 3DM3A 2YRXA 2B63G 1D5MC 4RG1A 4Q43A 2DNEA 1K9MC 1BBWA 3HGBA 3LX0A 2RVLA 3MXNB 3T1YL 4IO9A 4HNUA 1Y14B 1PV4A 4EBEA 1IW7C 2KOLA 1TR5A 4IUUA 5KFVA 1E1OA 4DV7Q 1Z7TA 1HZAA 3HOUG 3J81j 3K0YA 3BZKA 1RHPA 1F2ZA 4LMQD 4DXGA 1N34Q 1JE4A 3A55A 2YZNA 1S3OA 1J8IA 1N32Q 2W9CB 2AUKA 4N8FA 1ZHSA 2K28A 2F0NA 3PUYA 5KFSA 1KJ8A 5DM73 4C3HH 3V6KA 2HVRA 1VBHA 2EYJA 2RDFA 5C4XB 4PDBA 2BDNA 1B9MA 3MJFA 1N33Q 3HOZH 4L6TB 4A3GH 4UDUC 1JJCB 2GVBA 4JBMA 4RU9A 3QO2A 4DAYB 1O80A 4XX0B 2PNRC 1MKHA 1UE7A 5KG3A 4P74A 2JEFA 1I50B 2QDBA 1I6VC 2B3GA 1L2ZA 1O78A 1HZCA 1JOOA 5C0XI 2F3IA 1SCUB 3JC66 1E3PA 1RDPD 1M1KC 5C5LA 1VQ7A 3PUZA 4X3UA 3JRWA 2XTIA 1S68A 5LMNL 2PNHA 2M9VA 1D5XC 4O0AA 4DV2Q 1XPRA 2NVXB 1BBXC 2YRWA 1IBKH 2R7DA 1U4LA 1SJHD 1EY8A 1VQAA 1GLVA 1N56A 3QOLA 2IHEA 3GTJA 1S03G 1V1PB 3GO5A 1PH4A 4TQSA 5FPRA 4DV1H 4ZI7F 2AMCB 1SE4A 5IYBG 4HAEA 1ILPA 5EKKA 2JQOA 4O3PA 3AFPA 4JYAH 5LL6X 1VQIA 5BR8Q 3CHBD 1LTID 1HJPA 1SDFA 1I4XA 3G6JB 2E2DC 3K7UC 4QMGA 1IBMQ 4MAMA 5ISRA 4DR2H 4PMCA 4J9OA 1STAA 1VQCA 3A7AB 5M5XH 2W9BA 1LYLA 4KJOA 1KC7A 4NXNH 4CDFC 3RAQA 1U4RA 2CVRA 2B2VC 1Q81C 4K2LA 4OIKA 5DNFA 3KF8A 4LFAQ 3VA5A 3KAKA 3HEJA 3K58A 2B2UC 3SR1A 2K6AA 1KC8C 4GLAC 4P72A 4BBSG 1KXLA 1SE3A 1NR4A 2F0MA 3TBIB 3JSNA 2C2DA 2W7OA 1KTKA 2DN8A 2MUYA 2XWBB 5LMUL 3SK5A 4MV7A 2NB0A 1WH2A 2CH4W 4WRDA 1VAJA 2MCTA 1N36L 3EPIA 1BCPC 3D6WA 1P8LA 4DL4A 5CV5A 4HJ5A 1XNQQ 3M4YA 5C6AA 4FXDA 4OL7A 3I2ZA 4Q0FA 1J5EL 4JBKA 1WJJA 1D2BA 3BQ1A 4HIMA 3J7AK 4A3GB 3MWDA 3CRLC 4G4KA 4DK0A 4MV4A 3D3RA 1H95A 3TN2A 1E0BA 3KHLA 3PO2B 4UP9A 1DZ1A 4A3CG 4A3EB 1N33H 2PYKA 2W71A 5D1OB 2R8HA 3S2DH 1J9OA 1I3QH 3MTSA 3KLWA 1Y1VG 4JI5Q 2GA4B 2Z6BA 3Q8DA 3S15B 1M0WA 5JH7F 2XGQA 1U5KA 4K6LA 1L1OB 5F2DA 5J1ZA 3HB9A 1SNDA 2KECA 3I4OA 4FF3A 4LH7A 1WCMG 1W96A 4X64Q 4Q45A 2RBMA 2MO1A 1BCPF 4DL3A 4ECXA 4FVMA 2B2WA 1HA5A 3BVGA 4DR7L 4RNNA 2YU9A 2EDGA 3T53B 3HKZG 2NN6I 1EZ8A 4G7OC 4LSAA 4RB3C 1ESRA 2OCEA 3QFFA 5I9PA 3TQTA 1YITA 5EBCA 2HJWA 4DUZH 5LMNW 2F4VH 3H20A 4J9LA 1LO5D 3EA6A 2K5QA 4A3BH 2AGQA 2JK8A 2W6QA 3VA7A 3P20A 3S1RH 3HRZC 1CS0A 2M2LA 4KK7A 3GTKH 4A3JG 5D65A 3MAQA 3F2CA 1JXLA 1EYZA 1SNCA 1AUXA 2M05A 4DAVA 4MV1A 5KFKA 5FJ8G 2Q2UA 1B6SA 3DWAA 1A62A 4A93H 2NU8B 1RYSA 3S1MB 2DPIA 4LF9Q 4DR6L 4RWSC 2QEJC 2IY5B 5KG7A 3WO0A 4DR4Q 1LT6D 4YR2A 1WTRA 4Y7NB 3V6HA 4DNTB 1F2LA 3K59A 4MA0A 3G4SA 4JBJA 1BJTA 3OHXC 1JJGA 2E2HA 4LSXA 1BOSA 5J22A 3EPGA 1LACA 4KMUC 1B3QA 3T16A 2HHHL 4B3ML 4U68A 3J81E 2E5LL 3CQZA 1EQVA 1XTCD 4A3IG 4BA1I 1STBA 2NVQH 3AFQA 5IYZF 4YR0A 3J80L 1JCKB 4XQNA 4KHZA 3KBGA 1HNXQ 2ZTCA 1FKAH 1QB5D 2BCOA 3NWSA 3H09A 2V58A 5DEHA 1X65A 1UNNC 2L15A 2WACA 1V43A 4GOPA 1XYIA 2CQYA 1CZGA 2TMPA 4IFDH 2OTJA 2MP1A 1EFWA 5M5WH 1U4PA 3KF6B 4A3MH 1SMXA 5IGBA 3NQIA 5E4WC
chains in the Genus database with same CATH topology
3H0GH 4BY1G 4GLXA 1CUKA 3RR5A 4LFCL 3MEFA 3ICEA 3ZJYC 1YEZA 4NB3A 3B6YA 2B29A 4LF4Q 1JE5A 2LXJA 2E2JH 2K14A 3AEVA 1OXXK 5C0XJ 2WB1E 4GN3B 4BA2I 4WJ4A 2WAQG 5E7NA 2RF4A 1VQGA 1YNXA 1WOCA 5C4XH 5J3BA 4A4IA 4YWLA 1IBKL 1Q1EA 3NBHB 4OXPA 1HNZQ 3ULLA 3VDYA 1JMCA 5M3MG 5DLQE 4HJ9A 3KF8B 2BA1A 2KENA 4EQ5A 2Q2TA 2Z6KA 4LFCQ 3UDGA 1JT8A 4PZ7A 3PUVA 4DV1L 1TWGH 1PH1A 4UPAA 1YJNA 2RHQB 1E22A 3J7ZC 4DAMA 1I50H 1VQLA 2JA5H 2KHJA 1I94Q 4A3CH 2JE6I 4IFDJ 1L1OC 1AE3A 2AHOB 1FL0A 2IHFA 1IBKQ 4JOIA 4LUZA 4R4OA 2R7ZG 1A63A 4JI1L 5FLMG 4BY7G 2VL6A 2UXBL 2WB1G 5AJ3L 1Y1VH 5HY6A 5C44H 4DV1Q 4ME3A 1VQEA 4IOAA 4DR2L 2ZJPA 4B3RL 4JI0L 2IT1A 1NMFA 5GAHC 2NVXH 4NXNL 3PO3G 5IY0A 1K73C 2ZJQA 2R7FA 4JYAQ 4YWMA 3HFZB 3I4NH 3S1QH 4JI1Q 1X55A 2K5NA 4MZ9A 2PMZE 4A3MH 3M3YH 4FDBA 1PH7A 3G48A 2NZHA 1PYBA 4DV3L 4DV5L 2A19A 2D0OA 4DR2Q 1VQOA 4B3RQ 1HNWL 2VY3A 3CCRA 4BXXG 1EIYB 4DV6L 1X3GA 4YCWA 4NXNQ 3GD7A 1VS0A 4OWTB 3RLNA 1NJIC 1Q8KA 2HQLA 3RN5A 2AWNA 1YJWA 3OYYA 3UE1A 3L7ZC 5FLXc 1TWCH 3CC2A 3KJOA 4TQUS 1QZGA 1YHBA 3CC4A 4LWCA 4L5RC 1OXVA 2OQ0A 2RCNA 3U4VA 1V9PA 4HJ8A 4A3JH 1KRTA 2E8GA 1SLJA 2EXDA 4B3SL 4WJ3M 3G6EA 4AIMA 1C7YA 1IZ6A 3FKIH 5IE8A 1Z9FA 1Q82C 1ASYA 4A3LG 2R93H 4DK3C 1N9WA 4IPHA 4LF7L 1UWVA 5JEAG 5GADC 1KD1C 5FJ8H 3K8AA 2ZTDA 2D62A 4A3DG 1CKOA 2UUCQ 1VQNA 4OWWB 1NMGA 3PUWA 4LUOA 4L5TA 4A3FG 2BH8A 5M5YH 1YI2A 1QUQA 4B3SQ 5JJLA 1X56A 4YCUA 3T1YQ 1CSQA 1X54A 3M4PA 4P73A 1B8AA 2R93G 3HOXG 5IWAL 3CAMA 3J81i 4IOCA 3RZOH 5IYDG 5GAEC 2EIFA 1RL2A 1E24A 1YIJA 2A8VA 4JI4L 4HJAA 3IRBA 5H1SE 1OXTA 3ERSX 2JA9A 2ALYB 2JJQA 4A3IH 5IYCG 1N8RC 3GTQH 4OX9L 3GTOH 5HGQA 1FVIA 3E0EA 5IWAQ 3PCOB 5JJKA 2V1CC 3OW2A 2K5VA 4LF5L 2ID0A 3I4MH 5C4JH 3CMEA 4JI4Q 1T9HA 3D0FA 3EN2A 3PO2H 2AKWB 1VQ5A 4DUYL 4A3EH 2UUBL 3HOWG 3TREA 4QJFA 4NXML 4Y52H 3T1HL 1LM0A 1PFSA 1C9OA 4DUZL 1U0LA 1VQPA 4X66Q 2I0QA 1XTDA 3KOJA 3OTOQ 4HJ7A 4PZ6A 4DR1L 3S15H 2RHSB 3HOZG 4BBSH 2K5HA 4LF5Q 4A3KG 4LFBQ 3RN2A 1Z47A 2UXCL 3CCSA 4R4IA 4LF4L 4DK6C 1IBLQ 2K4KA 3W1BA 4JG2A 4DUYQ 1QVFA 2PI2A 3TRZA 2N78A 2UUBQ 1PVOA 1AH9A 3T1HQ 1X9NA 5M3MH 1FGUA 4P75A 4DUZQ 4GNXC 3KDFA 5GQOA 1HNZL 1IYJB 1VQBA 2PQAA 4DKAC 4DR1Q 3RNUA 2F4VQ 1E1TA 4JI3L 2I5MX 4A76A 1YZ6A 3BJUA 3GDEA 4HIDA 1PH5A 4LNQA 2N49A 3HOVH 4A93G 2UXCQ 1TWHH 1VQHA 4GN4B 3UE0A 2VQEL 4GOPB 2KHIA 1KHIA 4BBRG 2JEAI 2R7ZH 2R92H 2K75A 1I94L 4PZ8A 4BY7H 1UE1A 2CFMA 4IPDA 3M85A 2KCTA 4GS3A 2VUMG 2VNUD 5C3EG 4JI3Q 4HIKA 1WFQA 2JA7G 1QZHA 2FXQA 5C0XG 2VS1A 3ULJA 2VQEQ 1YBYA 2Y0SE 3PO3H 3M4OH 3S2HH 4XTCS 1PYSB 2NVYH 1EQQA 3GTGH 3PUXA 1NE3A 1ASZA 1BVSA 4POGA 5IP7G 2NVTH 4JYAL 1V1QA 1BKBA 4O2DA 3UDIA 2MNAA 3ULPA 2JA8H 1VQMA 1I5FA 4BXXH 3NENA 1SRUA 3S1MH 4MTNA 3CCUA 1W2BA 4GNXA 3W5OA 1OTCA 4TVAB 4LW1A 2ZM6Q 1PHJA 3CD6A 4IFDG 1Q46A 1WCMH 2R6GA 1X6OA 4Y7NH 4A3MG 1UEBA 4H02A 3H0GG 4JV5L 3HKSA 4AYBE 5IT9c 1CKNB 1LTLA 3CPFA 2Y0SG 1W3SA 4OO1G 2HIXA 1K83H 4QIWE 3W1GA 4R4QA 2VQFL 4JBWA 1SN8A 3S14H 2CKZB 1G6PA 1KAWA 1X3EA 4JCVE 3E9HA 1O7IA 1IL2A 3STBD 1EOVA 4A3LH 1K0RA 3U50C 3L2PA 3HOYG 4JV5Q 4KI0A 4PMWA 3GTJH 3K0XA 3S16H 5JJIA 1N36Q 1PA6A 2D0PA 3S1NH 1A0IA 1L1OA 3NEMA 2VQFQ 1L0WA 4JI7Q 2JEBI 4AYBG 1WI5A 4DV7L 3CCEA 2UUCL 4DR3L 1MJEA 1FJGL 3PF4A 1GVPA 2GN5A 3KFUA 2WP8J 1B7YB 3DM3A 2B63G 4C3JH 4RG1A 1YJ9A 1XMOQ 1NY4A 2JA6G 3HOXH 1HZBA 2Q2HA 1BBWA 3FP9A 3CXCA 3CMAA 1K9MC 1QVCA 1SE8A 3MXNB 3UDXA 1HZ9A 4IO9A 2QA4A 5C44G 3T1YL 4IJHA 1Y14B 3BZCA 1VQ4A 1PV4A 1TXYA 1N32L 2ASBA 2H5XA 2ZTEA 1E1OA 3PIOA 4DV7Q 5IYCH 4DR3Q 1FJGQ 1XPUA 2Q2IA 1HZAA 3HOUG 3J81j 4OWXB 2HT1A 3BZKA 4A75A 1N34Q 3STBC 1N33L 1AE2A 1S3OA 1PH2A 4R4TA 2KCMA 2OQKA 1PH6A 1YHQA 3F2BA 1N32Q 4X65L 3M4QA 1WYDA 3PUYA 4IPGA 3HOWH 2UXDL 1JB7A 4C3HH 3TQYA 1E7ZA 1QUQB 2XGTA 1Y1WG 4JC0A 1N33Q 1R9TH 1LUZA 3HOZH 5EAYA 4A3GH 4A3KH 1JJCB 2GVBA 4X66L 4JBMA 3OTOL 4DAYB 4X65Q 3FHWA 4LFBL 3TEHB 1MKHA 1UE7A 2GVAA 4J15A 4JI8Q 1SROA 4B3TL 2UXDQ 4P74A 1IBLL 4UY8C 3WWVA 4DV4L 4GOPC 1X3FA 2B3GA 5GAGC 4X62Q 4UP8A 1KQSA 1HZCA 4BY1H 1VQDA 5C0XI 1TWAH 2F3IA 1PH3A 2LSSA 4YY3L 4HIOA 3JC66 1E3PA 2OWOA 3GTLH 1M1KC 2F4VL 3SGIA 3DLLA 1DGSA 4PG3A 1KIXA 3PUZA 4KLKA 1VQ7A 2XTIA 4A3BG 1HR0Q 4BBRH 2PNHA 5LMNL 1S40A 4B3TQ 4O0AA 4DV2Q 1XPRA 4DV4Q 2QEXA 2R7DA 1BBUA 4NPSA 1VQAA 5BR8L 3G71A 4JI6Q 5K36G 2IHEA 3GO5A 1KRSA 3TS0A 2DGYA 2NN6G 5C3EH 1PH4A 4YHHL 1VQKA 1XJVA 4IFDI 4YY3Q 3CP0A 2CQOA 4XIGS 2AMCB 2N8NA 5IYBG 4MNOA 3CPWA 5M3FG 4QY7A 5LMNQ 2NZOA 2JQOA 3L0OA 1NTGA 3KF6A 3AFPA 1K8AC 2ZJRA 2UU9L 4OO1I 2K50A 1VQIA 5IP7H 1QVGA 5BR8Q 4QQBX 4AQYL 4JI2Q 1TWFH 1G291 2WAQE 3F1ZA 4C3IH 5FLMH 3A5ZB 4LFAL 1HJPA 3K7UC 4YHHQ 1IBMQ 3KDFB 4DNIA 4R1JA 2PQAB 3BU2A 3NELA 4DV0L 2HHHQ 4B3MQ 1XNRL 1MJCA 1VQCA 3S24A 5M5XH 2YU9H 3EIVA 3GTMH 4K0KL 1M90C 1LYLA 2UU9Q 2UXBQ 3RLFA 5IP9G 4POFA 2VW9A 2ZM6L 4AQYQ 2YTXA 1Q81C 3AYHB 4LFAQ 1Q12A 3F8TA 3I56A 3CF5A 3CCJA 1KC8C 4GLAC 4P72A 3CCVA 2MFIA 4AH6A 3PF5A 4DV0Q 1EYGA 4BBSG 2YTYA 3E9IA 4UP7A 2UUAL 1NBWA 1XNRQ 3F2DA 1KXLA 4K0KQ 2AWOA 4DPGA 4YCVA 1XNQL 1IXRA 3HOYH 1XPOA 1CSPA 2YTVA 5LMUL 4QL5A 3EBEA 4IPCA 4RMFA 3M7NA 2IX0A 1GD7A 3HOVG 2I5LX 1N36L 2UUAQ 1P8LA 1UE5A 1K3RA 4JI7L 4GNXB 1XNQQ 4HJ5A 1GM5A 2B63H 2CWPA 2R92G 3TS2A 1CKNA 1VQFA 3ER0A 3I2ZA 1J5EL 4JBKA 2JA6H 1WJJA 5LMUQ 3J7A5 4X6AH 5C4XG 4HIMA 1GKHA 1XMOL 3PIPA 2E2HH 2E2IH 4JI5L 3U4ZA 3CCMA 4A3DH 2ES2A 1EIFA 1H95A 1HH2P 1J6QA 4IJLA 3HOUH 4ALPA 3PGZA 2IX1A 4A3FH 2JA5G 4UP9A 2I5HA 3CQZH 4X64L 4DR5L 3RZDH 1J5EQ 4A3CG 5AJ3Q 1SR3A 2HIVA 3A0JA 3M9BA 3PSIA 3S2DH 4GKKL 2K52A 3HKZE 3K80C 1I3QH 1N34L 4LF8L 2JA8G 3KLWA 1Y1VG 2F52A 4JI0Q 4JI5Q 2PI2E 3Q8DA 5IYDH 1U5KA 4LUVA 1P16A 1L1OB 4L5SA 3I4OA 3JAMi 2Z0SA 1D8LA 1WCMG 5ELOA 2QGQA 3LGJA 4X64Q 1B70B 4GLVB 3A74A 4DR5Q 1Y1WH 3CC7A 1MIUA 2MO1A 4EX5A 2BH2A 4DV3Q 2EQSA 4DV5Q 3I4NG 4GKJL 1KL9A 1HR0W 5JEAJ 1VQ8A 4GKKQ 4LF8Q 1HNWQ 2A1AA 4OONA 4DR7L 1YHAA 4DV6Q 1CKMA 1G51A 2YYZA 3S17H 1OXUA 3HKZG 3K81C 1A8VA 2LXKA 2NN6I 4JI8L 3J80i 4R4CA 1EQRA 2MO0A 2C35B 1RIPA 2OCEA 3K7AH 1YITA 4GKJQ 5LMNW 4X62L 5GROA 3A5UA 1EWIA 4GN5A 1JJ2A 2KBNA 4A3BH 4DR7Q 2YV5A 1YVCA 2JK8A 2WFWA 2MQHA 3S1RH 4LF9L 3KYHC 1HR0L 1PH9A 3GTKH 4A3JG 3H3VI 4DR4L 4LF7Q 4KHPL 3JAMc 4DV2L 3F2CA 4LF6L 3CCLA 4JI6L 3FKIG 2DUDA 3PV0A 2N3SA 1Q86C 5IYBH 1PH8A 1Q1BA 1GO3E 5M3FH 5FJ8G 1XMQL 2Q2UA 3AQQA 1A62A 5ELNA 4A93H 1SFOH 3RLOA 4LF9Q 4DR6L 3GTPH 2IY5B 3UDFA 1Q7YC 4DR4Q 4KHPQ 1VQ9A 4LF6Q 1I6HH 3I7FA 3G4SA 2CCZA 4JBJA 4JI2L 2ATWA 3J80c 1C0AA 1JJGA 3H3VH 1VCIA 3I55A 2VUMH 1HNXL 2OTLA 1IBML 1XMQQ 2JA7H 4B3ML 2HHHL 1K8GA 4DR6Q 4YWKA 2Z6KC 2E5LL 5IP9H 4OX9Q 3CCQA 4A3IG 1S72A 4BA1I 1OXSC 3AFQA 2NVQH 4C2MH 3U58A 4A3GG 2CWAA 4KHZA 3H15A 4P71A 3CW2C 1HNXQ 2ZTCA 4APVA 3J81c 1EUJA 4JOIC 2BA0A 3KJPA 3D31A 1X65A 3I4MG 2L15A 4GOPA 1V43A 4QGUA 1L2FA 2E5LQ 4NXMQ 2OTJA 3PO2G 4L5QA 1EFWA 5M5WH 1UE6A 1VQ6A 3KF6B 4A3EG 1SMXA 2VZAA 1VQJA 1D7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0G H;  4BY1 G;  4GLX A;  1CUK A;  3RR5 A;  4LFC L;  3MEF A;  3ICE A;  3ZJY C;  1YEZ A;  4NB3 A;  3B6Y A;  2B29 A;  4LF4 Q;  1JE5 A;  2LXJ A;  2E2J H;  2K14 A;  3AEV A;  1OXX K;  5C0X J;  2WB1 E;  4GN3 B;  4BA2 I;  4WJ4 A;  2WAQ G;  5E7N A;  2RF4 A;  1VQG A;  1YNX A;  1WOC A;  5C4X H;  5J3B A;  4A4I A;  4YWL A;  1IBK L;  1Q1E A;  3NBH B;  4OXP A;  1HNZ Q;  3ULL A;  3VDY A;  1JMC A;  5M3M G;  5DLQ E;  4HJ9 A;  3KF8 B;  2BA1 A;  2KEN A;  4EQ5 A;  2Q2T A;  2Z6K A;  4LFC Q;  3UDG A;  1JT8 A;  4PZ7 A;  3PUV A;  4DV1 L;  1TWG H;  1PH1 A;  4UPA A;  1YJN A;  2RHQ B;  1E22 A;  3J7Z C;  4DAM A;  1I50 H;  1VQL A;  2JA5 H;  2KHJ A;  1I94 Q;  4A3C H;  2JE6 I;  4IFD J;  1L1O C;  1AE3 A;  2AHO B;  1FL0 A;  2IHF A;  1IBK Q;  4JOI A;  4LUZ A;  4R4O A;  2R7Z G;  1A63 A;  4JI1 L;  5FLM G;  4BY7 G;  2VL6 A;  2UXB L;  2WB1 G;  5AJ3 L;  1Y1V H;  5HY6 A;  5C44 H;  4DV1 Q;  4ME3 A;  1VQE A;  4IOA A;  4DR2 L;  2ZJP A;  4B3R L;  4JI0 L;  2IT1 A;  1NMF A;  5GAH C;  2NVX H;  4NXN L;  3PO3 G;  5IY0 A;  1K73 C;  2ZJQ A;  2R7F A;  4JYA Q;  4YWM A;  3HFZ B;  3I4N H;  3S1Q H;  4JI1 Q;  1X55 A;  2K5N A;  4MZ9 A;  2PMZ E;  4A3M H;  3M3Y H;  4FDB A;  1PH7 A;  3G48 A;  2NZH A;  1PYB A;  4DV3 L;  4DV5 L;  2A19 A;  2D0O A;  4DR2 Q;  1VQO A;  4B3R Q;  1HNW L;  2VY3 A;  3CCR A;  4BXX G;  1EIY B;  4DV6 L;  1X3G A;  4YCW A;  4NXN Q;  3GD7 A;  1VS0 A;  4OWT B;  3RLN A;  1NJI C;  1Q8K A;  2HQL A;  3RN5 A;  2AWN A;  1YJW A;  3OYY A;  3UE1 A;  3L7Z C;  5FLX c;  1TWC H;  3CC2 A;  3KJO A;  4TQU S;  1QZG A;  1YHB A;  3CC4 A;  4LWC A;  4L5R C;  1OXV A;  2OQ0 A;  2RCN A;  3U4V A;  1V9P A;  4HJ8 A;  4A3J H;  1KRT A;  2E8G A;  1SLJ A;  2EXD A;  4B3S L;  4WJ3 M;  3G6E A;  4AIM A;  1C7Y A;  1IZ6 A;  3FKI H;  5IE8 A;  1Z9F A;  1Q82 C;  1ASY A;  4A3L G;  2R93 H;  4DK3 C;  1N9W A;  4IPH A;  4LF7 L;  1UWV A;  5JEA G;  5GAD C;  1KD1 C;  5FJ8 H;  3K8A A;  2ZTD A;  2D62 A;  4A3D G;  1CKO A;  2UUC Q;  1VQN A;  4OWW B;  1NMG A;  3PUW A;  4LUO A;  4L5T A;  4A3F G;  2BH8 A;  5M5Y H;  1YI2 A;  1QUQ A;  4B3S Q;  5JJL A;  1X56 A;  4YCU A;  3T1Y Q;  1CSQ A;  1X54 A;  3M4P A;  4P73 A;  1B8A A;  2R93 G;  3HOX G;  5IWA L;  3CAM A;  3J81 i;  4IOC A;  3RZO H;  5IYD G;  5GAE C;  2EIF A;  1RL2 A;  1E24 A;  1YIJ A;  2A8V A;  4JI4 L;  4HJA A;  3IRB A;  5H1S E;  1OXT A;  3ERS X;  2JA9 A;  2ALY B;  2JJQ A;  4A3I H;  5IYC G;  1N8R C;  3GTQ H;  4OX9 L;  3GTO H;  5HGQ A;  1FVI A;  3E0E A;  5IWA Q;  3PCO B;  5JJK A;  2V1C C;  3OW2 A;  2K5V A;  4LF5 L;  2ID0 A;  3I4M H;  5C4J H;  3CME A;  4JI4 Q;  1T9H A;  3D0F A;  3EN2 A;  3PO2 H;  2AKW B;  1VQ5 A;  4DUY L;  4A3E H;  2UUB L;  3HOW G;  3TRE A;  4QJF A;  4NXM L;  4Y52 H;  3T1H L;  1LM0 A;  1PFS A;  1C9O A;  4DUZ L;  1U0L A;  1VQP A;  4X66 Q;  2I0Q A;  1XTD A;  3KOJ A;  3OTO Q;  4HJ7 A;  4PZ6 A;  4DR1 L;  3S15 H;  2RHS B;  3HOZ G;  4BBS H;  2K5H A;  4LF5 Q;  4A3K G;  4LFB Q;  3RN2 A;  1Z47 A;  2UXC L;  3CCS A;  4R4I A;  4LF4 L;  4DK6 C;  1IBL Q;  2K4K A;  3W1B A;  4JG2 A;  4DUY Q;  1QVF A;  2PI2 A;  3TRZ A;  2N78 A;  2UUB Q;  1PVO A;  1AH9 A;  3T1H Q;  1X9N A;  5M3M H;  1FGU A;  4P75 A;  4DUZ Q;  4GNX C;  3KDF A;  5GQO A;  1HNZ L;  1IYJ B;  1VQB A;  2PQA A;  4DKA C;  4DR1 Q;  3RNU A;  2F4V Q;  1E1T A;  4JI3 L;  2I5M X;  4A76 A;  1YZ6 A;  3BJU A;  3GDE A;  4HID A;  1PH5 A;  4LNQ A;  2N49 A;  3HOV H;  4A93 G;  2UXC Q;  1TWH H;  1VQH A;  4GN4 B;  3UE0 A;  2VQE L;  4GOP B;  2KHI A;  1KHI A;  4BBR G;  2JEA I;  2R7Z H;  2R92 H;  2K75 A;  1I94 L;  4PZ8 A;  4BY7 H;  1UE1 A;  2CFM A;  4IPD A;  3M85 A;  2KCT A;  4GS3 A;  2VUM G;  2VNU D;  5C3E G;  4JI3 Q;  4HIK A;  1WFQ A;  2JA7 G;  1QZH A;  2FXQ A;  5C0X G;  2VS1 A;  3ULJ A;  2VQE Q;  1YBY A;  2Y0S E;  3PO3 H;  3M4O H;  3S2H H;  4XTC S;  1PYS B;  2NVY H;  1EQQ A;  3GTG H;  3PUX A;  1NE3 A;  1ASZ A;  1BVS A;  4POG A;  5IP7 G;  2NVT H;  4JYA L;  1V1Q A;  1BKB A;  4O2D A;  3UDI A;  2MNA A;  3ULP A;  2JA8 H;  1VQM A;  1I5F A;  4BXX H;  3NEN A;  1SRU A;  3S1M H;  4MTN A;  3CCU A;  1W2B A;  4GNX A;  3W5O A;  1OTC A;  4TVA B;  4LW1 A;  2ZM6 Q;  1PHJ A;  3CD6 A;  4IFD G;  1Q46 A;  1WCM H;  2R6G A;  1X6O A;  4Y7N H;  4A3M G;  1UEB A;  4H02 A;  3H0G G;  4JV5 L;  3HKS A;  4AYB E;  5IT9 c;  1CKN B;  1LTL A;  3CPF A;  2Y0S G;  1W3S A;  4OO1 G;  2HIX A;  1K83 H;  4QIW E;  3W1G A;  4R4Q A;  2VQF L;  4JBW A;  1SN8 A;  3S14 H;  2CKZ B;  1G6P A;  1KAW A;  1X3E A;  4JCV E;  3E9H A;  1O7I A;  1IL2 A;  3STB D;  1EOV A;  4A3L H;  1K0R A;  3U50 C;  3L2P A;  3HOY G;  4JV5 Q;  4KI0 A;  4PMW A;  3GTJ H;  3K0X A;  3S16 H;  5JJI A;  1N36 Q;  1PA6 A;  2D0P A;  3S1N H;  1A0I A;  1L1O A;  3NEM A;  2VQF Q;  1L0W A;  4JI7 Q;  2JEB I;  4AYB G;  1WI5 A;  4DV7 L;  3CCE A;  2UUC L;  4DR3 L;  1MJE A;  1FJG L;  3PF4 A;  1GVP A;  2GN5 A;  3KFU A;  2WP8 J;  1B7Y B;  3DM3 A;  2B63 G;  4C3J H;  4RG1 A;  1YJ9 A;  1XMO Q;  1NY4 A;  2JA6 G;  3HOX H;  1HZB A;  2Q2H A;  1BBW A;  3FP9 A;  3CXC A;  3CMA A;  1K9M C;  1QVC A;  1SE8 A;  3MXN B;  3UDX A;  1HZ9 A;  4IO9 A;  2QA4 A;  5C44 G;  3T1Y L;  4IJH A;  1Y14 B;  3BZC A;  1VQ4 A;  1PV4 A;  1TXY A;  1N32 L;  2ASB A;  2H5X A;  2ZTE A;  1E1O A;  3PIO A;  4DV7 Q;  5IYC H;  4DR3 Q;  1FJG Q;  1XPU A;  2Q2I A;  1HZA A;  3HOU G;  3J81 j;  4OWX B;  2HT1 A;  3BZK A;  4A75 A;  1N34 Q;  3STB C;  1N33 L;  1AE2 A;  1S3O A;  1PH2 A;  4R4T A;  2KCM A;  2OQK A;  1PH6 A;  1YHQ A;  3F2B A;  1N32 Q;  4X65 L;  3M4Q A;  1WYD A;  3PUY A;  4IPG A;  3HOW H;  2UXD L;  1JB7 A;  4C3H H;  3TQY A;  1E7Z A;  1QUQ B;  2XGT A;  1Y1W G;  4JC0 A;  1N33 Q;  1R9T H;  1LUZ A;  3HOZ H;  5EAY A;  4A3G H;  4A3K H;  1JJC B;  2GVB A;  4X66 L;  4JBM A;  3OTO L;  4DAY B;  4X65 Q;  3FHW A;  4LFB L;  3TEH B;  1MKH A;  1UE7 A;  2GVA A;  4J15 A;  4JI8 Q;  1SRO A;  4B3T L;  2UXD Q;  4P74 A;  1IBL L;  4UY8 C;  3WWV A;  4DV4 L;  4GOP C;  1X3F A;  2B3G A;  5GAG C;  4X62 Q;  4UP8 A;  1KQS A;  1HZC A;  4BY1 H;  1VQD A;  5C0X I;  1TWA H;  2F3I A;  1PH3 A;  2LSS A;  4YY3 L;  4HIO A;  3JC6 6;  1E3P A;  2OWO A;  3GTL H;  1M1K C;  2F4V L;  3SGI A;  3DLL A;  1DGS A;  4PG3 A;  1KIX A;  3PUZ A;  4KLK A;  1VQ7 A;  2XTI A;  4A3B G;  1HR0 Q;  4BBR H;  2PNH A;  5LMN L;  1S40 A;  4B3T Q;  4O0A A;  4DV2 Q;  1XPR A;  4DV4 Q;  2QEX A;  2R7D A;  1BBU A;  4NPS A;  1VQA A;  5BR8 L;  3G71 A;  4JI6 Q;  5K36 G;  2IHE A;  3GO5 A;  1KRS A;  3TS0 A;  2DGY A;  2NN6 G;  5C3E H;  1PH4 A;  4YHH L;  1VQK A;  1XJV A;  4IFD I;  4YY3 Q;  3CP0 A;  2CQO A;  4XIG S;  2AMC B;  2N8N A;  5IYB G;  4MNO A;  3CPW A;  5M3F G;  4QY7 A;  5LMN Q;  2NZO A;  2JQO A;  3L0O A;  1NTG A;  3KF6 A;  3AFP A;  1K8A C;  2ZJR A;  2UU9 L;  4OO1 I;  2K50 A;  1VQI A;  5IP7 H;  1QVG A;  5BR8 Q;  4QQB X;  4AQY L;  4JI2 Q;  1TWF H;  1G29 1;  2WAQ E;  3F1Z A;  4C3I H;  5FLM H;  3A5Z B;  4LFA L;  1HJP A;  3K7U C;  4YHH Q;  1IBM Q;  3KDF B;  4DNI A;  4R1J A;  2PQA B;  3BU2 A;  3NEL A;  4DV0 L;  2HHH Q;  4B3M Q;  1XNR L;  1MJC A;  1VQC A;  3S24 A;  5M5X H;  2YU9 H;  3EIV A;  3GTM H;  4K0K L;  1M90 C;  1LYL A;  2UU9 Q;  2UXB Q;  3RLF A;  5IP9 G;  4POF A;  2VW9 A;  2ZM6 L;  4AQY Q;  2YTX A;  1Q81 C;  3AYH B;  4LFA Q;  1Q12 A;  3F8T A;  3I56 A;  3CF5 A;  3CCJ A;  1KC8 C;  4GLA C;  4P72 A;  3CCV A;  2MFI A;  4AH6 A;  3PF5 A;  4DV0 Q;  1EYG A;  4BBS G;  2YTY A;  3E9I A;  4UP7 A;  2UUA L;  1NBW A;  1XNR Q;  3F2D A;  1KXL A;  4K0K Q;  2AWO A;  4DPG A;  4YCV A;  1XNQ L;  1IXR A;  3HOY H;  1XPO A;  1CSP A;  2YTV A;  5LMU L;  4QL5 A;  3EBE A;  4IPC A;  4RMF A;  3M7N A;  2IX0 A;  1GD7 A;  3HOV G;  2I5L X;  1N36 L;  2UUA Q;  1P8L A;  1UE5 A;  1K3R A;  4JI7 L;  4GNX B;  1XNQ Q;  4HJ5 A;  1GM5 A;  2B63 H;  2CWP A;  2R92 G;  3TS2 A;  1CKN A;  1VQF A;  3ER0 A;  3I2Z A;  1J5E L;  4JBK A;  2JA6 H;  1WJJ A;  5LMU Q;  3J7A 5;  4X6A H;  5C4X G;  4HIM A;  1GKH A;  1XMO L;  3PIP A;  2E2H H;  2E2I H;  4JI5 L;  3U4Z A;  3CCM A;  4A3D H;  2ES2 A;  1EIF A;  1H95 A;  1HH2 P;  1J6Q A;  4IJL A;  3HOU H;  4ALP A;  3PGZ A;  2IX1 A;  4A3F H;  2JA5 G;  4UP9 A;  2I5H A;  3CQZ H;  4X64 L;  4DR5 L;  3RZD H;  1J5E Q;  4A3C G;  5AJ3 Q;  1SR3 A;  2HIV A;  3A0J A;  3M9B A;  3PSI A;  3S2D H;  4GKK L;  2K52 A;  3HKZ E;  3K80 C;  1I3Q H;  1N34 L;  4LF8 L;  2JA8 G;  3KLW A;  1Y1V G;  2F52 A;  4JI0 Q;  4JI5 Q;  2PI2 E;  3Q8D A;  5IYD H;  1U5K A;  4LUV A;  1P16 A;  1L1O B;  4L5S A;  3I4O A;  3JAM i;  2Z0S A;  1D8L A;  1WCM G;  5ELO A;  2QGQ A;  3LGJ A;  4X64 Q;  1B70 B;  4GLV B;  3A74 A;  4DR5 Q;  1Y1W H;  3CC7 A;  1MIU A;  2MO1 A;  4EX5 A;  2BH2 A;  4DV3 Q;  2EQS A;  4DV5 Q;  3I4N G;  4GKJ L;  1KL9 A;  1HR0 W;  5JEA J;  1VQ8 A;  4GKK Q;  4LF8 Q;  1HNW Q;  2A1A A;  4OON A;  4DR7 L;  1YHA A;  4DV6 Q;  1CKM A;  1G51 A;  2YYZ A;  3S17 H;  1OXU A;  3HKZ G;  3K81 C;  1A8V A;  2LXK A;  2NN6 I;  4JI8 L;  3J80 i;  4R4C A;  1EQR A;  2MO0 A;  2C35 B;  1RIP A;  2OCE A;  3K7A H;  1YIT A;  4GKJ Q;  5LMN W;  4X62 L;  5GRO A;  3A5U A;  1EWI A;  4GN5 A;  1JJ2 A;  2KBN A;  4A3B H;  4DR7 Q;  2YV5 A;  1YVC A;  2JK8 A;  2WFW A;  2MQH A;  3S1R H;  4LF9 L;  3KYH C;  1HR0 L;  1PH9 A;  3GTK H;  4A3J G;  3H3V I;  4DR4 L;  4LF7 Q;  4KHP L;  3JAM c;  4DV2 L;  3F2C A;  4LF6 L;  3CCL A;  4JI6 L;  3FKI G;  2DUD A;  3PV0 A;  2N3S A;  1Q86 C;  5IYB H;  1PH8 A;  1Q1B A;  1GO3 E;  5M3F H;  5FJ8 G;  1XMQ L;  2Q2U A;  3AQQ A;  1A62 A;  5ELN A;  4A93 H;  1SFO H;  3RLO A;  4LF9 Q;  4DR6 L;  3GTP H;  2IY5 B;  3UDF A;  1Q7Y C;  4DR4 Q;  4KHP Q;  1VQ9 A;  4LF6 Q;  1I6H H;  3I7F A;  3G4S A;  2CCZ A;  4JBJ A;  4JI2 L;  2ATW A;  3J80 c;  1C0A A;  1JJG A;  3H3V H;  1VCI A;  3I55 A;  2VUM H;  1HNX L;  2OTL A;  1IBM L;  1XMQ Q;  2JA7 H;  4B3M L;  2HHH L;  1K8G A;  4DR6 Q;  4YWK A;  2Z6K C;  2E5L L;  5IP9 H;  4OX9 Q;  3CCQ A;  4A3I G;  1S72 A;  4BA1 I;  1OXS C;  3AFQ A;  2NVQ H;  4C2M H;  3U58 A;  4A3G G;  2CWA A;  4KHZ A;  3H15 A;  4P71 A;  3CW2 C;  1HNX Q;  2ZTC A;  4APV A;  3J81 c;  1EUJ A;  4JOI C;  2BA0 A;  3KJP A;  3D31 A;  1X65 A;  3I4M G;  2L15 A;  4GOP A;  1V43 A;  4QGU A;  1L2F A;  2E5L Q;  4NXM Q;  2OTJ A;  3PO2 G;  4L5Q A;  1EFW A;  5M5W H;  1UE6 A;  1VQ6 A;  3KF6 B;  4A3E G;  1SMX A;  2VZA A;  1VQJ A;  1D7Q A; 
#chains in the Genus database with same CATH topology
 4C3J B;  2EVB A;  4GLX A;  3RR5 A;  3HOX B;  1TWC A;  4LFC L;  3E5S A;  3ICE A;  5KT7 A;  4YQW A;  2Q8I B;  4NB3 A;  3B6Y A;  5IOC A;  1MD2 D;  4JI7 H;  4O3N A;  4FBU A;  5E7N A;  1UAP A;  1VQG A;  5KGU A;  1Q1E A;  4YIJ A;  4ED2 A;  1HNZ Q;  5M3M G;  4HJ9 A;  2KEN A;  3OIP A;  3NPP A;  3DWP A;  1TWG H;  2RSN A;  2QK4 A;  2RHQ B;  1EU3 A;  4GZY C;  4DAM A;  1VQL A;  4DR3 H;  1FJG H;  2KHJ A;  3FEW X;  2AGO A;  2JE6 I;  3NBI A;  3SHL A;  2D2C C;  2HGS A;  4NLG A;  1A63 A;  2L9H A;  5KG4 A;  1ZQ7 A;  2E76 C;  2VL6 A;  2X6L A;  1R9T B;  3RBD A;  4A3K B;  2ZJP A;  4ZKB B;  5KFQ A;  4JI0 L;  4R8U B;  1SFO A;  5DGB A;  5D8D A;  5KFT A;  1JIC A;  1K73 C;  2ZJQ A;  5L1L A;  2BQR A;  1WTX A;  5L1I A;  3I4N H;  2K5N A;  3DMU A;  2PMZ E;  3M3Y H;  4FDB A;  1EY6 A;  4A2A A;  2NZH A;  5KFB A;  3GV7 B;  1SAP A;  4RCN A;  3VR2 A;  1JR0 D;  1TWA B;  3QR8 A;  5IIF A;  4B3R Q;  4A93 B;  3GIK A;  2JA7 A;  1EIY B;  4ED1 A;  5JJZ A;  5FLX E;  1X3G A;  4YCW A;  3C2P A;  3VR4 A;  4BBR B;  3RV4 A;  3BS1 A;  4OWT B;  1PK8 A;  1EU4 A;  3OOC A;  2XIW A;  3AU7 A;  1BF4 A;  2AWN A;  4O2B F;  4ED8 A;  4FM9 A;  3MXN A;  3RFC A;  2XIG A;  1ICW A;  3DM1 A;  2YZM A;  3CVZ A;  3CC2 A;  5EWG A;  2R61 A;  5G3L D;  5E1F A;  3CC4 A;  2IJ0 A;  4DL6 A;  4L5R C;  1Y8N B;  2RCN A;  3U4V A;  1V9P A;  2IPK D;  1M7J A;  2W8L A;  4QUC A;  3TDQ A;  2E8G A;  2V4R A;  5EPK A;  2KUM A;  4XQJ A;  3G6E A;  5IE8 A;  3FKI H;  1C7Y A;  2YW2 A;  5KT4 A;  3I70 A;  4CDC C;  1KD1 C;  2W9C A;  2LFN A;  1JX4 A;  2L1B A;  4K14 A;  4ULL A;  2B2Y A;  2UUC Q;  3PUW A;  3NP8 A;  3RIZ A;  4FXG C;  5LMN H;  3BA8 A;  3D4R A;  4A3F G;  5M5W B;  1STH A;  2D5D A;  2KA7 A;  2MHV A;  1X56 A;  4JI2 H;  3M4P A;  4UCU A;  4V0B A;  1H9S B;  5IYD G;  4DAY A;  2F03 A;  2R7L A;  1OO9 B;  2O5J C;  2EIF A;  2XNA C;  4G3I A;  1PRT C;  1I4H A;  1EIG A;  2OEO A;  1CE8 A;  2F0K A;  5C1P A;  3J80 W;  2KSW A;  2F0W A;  1OXT A;  4DA2 A;  1PLF A;  1N8R C;  1CFM A;  3HOY B;  3PR5 B;  4I7Z C;  4NW2 A;  5IWA Q;  5JJK A;  3NK9 A;  2K5V A;  5KFU A;  4LF5 L;  5DG8 A;  2DWC A;  3CME A;  1T5X D;  4XT3 B;  4LK1 C;  3EN2 A;  4ZQI A;  1VQ5 A;  2NVX A;  2UUB L;  2B63 B;  1CQJ B;  4C3H G;  4H0L C;  1V1P A;  4X66 Q;  2EY1 A;  2FHT A;  5LOV F;  3OTO Q;  3KOJ A;  3GID A;  1I6H H;  4PZ6 A;  2F0Q A;  4F4W A;  3HOZ G;  2W6M A;  4BBS H;  2K5H A;  1QCB D;  3U9T A;  4ED6 A;  1JC7 A;  3GIQ A;  4R4I A;  4DUY Q;  4JG2 A;  4DGZ A;  4F88 A;  3HOU B;  2N78 A;  1PVO A;  4HMJ A;  5JOB A;  3T1H Q;  3RZD B;  1PRT F;  4P75 A;  5GON F;  5GQO A;  3M4I A;  1LAB A;  5G3L F;  5KG2 A;  2Z4I A;  2KCN A;  1S9F A;  5KFD A;  1PH5 A;  5J39 A;  2R82 A;  3KHR A;  4RHR A;  2ICE C;  1TWH H;  1VQH A;  4GN4 B;  2EY2 A;  1S5E D;  2R7Z H;  1J5E H;  3Q1K A;  4BY7 H;  1HXY D;  2F3W A;  4KY6 A;  2CFM A;  4DK1 A;  1BNC A;  2PBZ A;  1CHP D;  3K5N A;  1GOZ A;  1EFI D;  4GS3 A;  2XN9 C;  5EDW A;  1EEI D;  1TT2 A;  1NAP A;  2B2T C;  2C9O A;  3E6Z X;  4JI3 Q;  1HQM C;  4HIK A;  3OUZ A;  5KT3 A;  4ZLT F;  1QZH A;  1TY0 A;  4DFA A;  2KHS A;  1LTB D;  2KJX A;  4QB4 A;  3S2H H;  2NVY H;  3GTG H;  5L1K A;  1ASZ A;  2NVT H;  4DV3 H;  4JYA L;  4IUN A;  2A6E D;  3K7A B;  1V1Q A;  4O2D A;  3ULP A;  1HNW H;  2XRS D;  5CYU A;  4DV6 H;  3NEN A;  3NHH A;  1SRU A;  1HA6 A;  3JRX A;  3W5O A;  2LMC B;  4TVA B;  3CD6 A;  1JWM D;  1WCM H;  1C30 A;  5J2T F;  4MHE A;  3H0G G;  3R2T A;  1F9S A;  4ME5 A;  4AYB E;  5IT9 c;  2Y0S G;  3MC0 B;  4YP3 A;  1NCV A;  1K83 H;  4DR7 H;  3W1G A;  4V19 0;  1GHK A;  2CKZ B;  2B2W C;  3V6J A;  1DD2 A;  3GTP B;  5D1O A;  4PNY A;  4MV3 A;  2QF7 A;  3H94 A;  1K0R A;  4I50 F;  2GPS A;  3IKJ A;  2YS6 A;  1ET6 A;  5JJI A;  3GV5 B;  2VB3 X;  2R85 A;  1PA6 A;  4ME6 A;  4S3S A;  2VUM B;  1L1O A;  1ZYR C;  4DV7 L;  4K5V A;  4BWS C;  3BJY A;  1YNN D;  5J2U F;  2OH2 A;  1DCZ A;  3IFD A;  1B7Y B;  3BQ0 A;  2R86 A;  1XMO Q;  2R93 H;  3O13 A;  2BOS A;  3CXC A;  3CMA A;  1VBG A;  3R23 A;  2X0S A;  1E4G T;  1HZ9 A;  4IJH A;  4BBS B;  3NTK A;  4ZAI A;  1N32 L;  2F1M A;  4UCO A;  2DNC A;  3RMH A;  5CB4 F;  3R2I A;  3RBE A;  1QE6 A;  4DR6 H;  5IYC H;  1XPU A;  1SE2 A;  4FO2 A;  2FLN A;  5M9O A;  2C22 A;  1DIK A;  1QJO A;  2K5D A;  1KJI A;  3N43 B;  1BDO A;  4ZCK A;  1N33 L;  3EQL C;  1AE2 A;  1UNS A;  4DNR B;  2KCM A;  2OQK A;  5EWF A;  1S10 A;  2RCF A;  5A2Q L;  3M4Q A;  5FKA C;  1VDZ A;  5T1I A;  2E2J B;  4IPG A;  2E5L H;  4G7Z C;  3HOW H;  5JQW A;  1TS3 A;  2JEG A;  1JB7 A;  2VPS A;  4IZO A;  3TQY A;  1JDB B;  1E7Z A;  2XGT A;  5KFR A;  3OMG A;  4CKC A;  1LUZ A;  4ED7 A;  1S97 A;  3NGD A;  4F50 A;  4LF4 H;  2XRQ D;  4IRK A;  3J7Y W;  2PPB C;  3TEH B;  5DG7 A;  2GVA A;  4JI8 Q;  4F87 A;  4EEY A;  1IL8 A;  3KLR A;  1CA6 A;  4UY8 C;  4GOP C;  2WDT A;  4QIW B;  4X62 Q;  4IAL A;  5LA6 F;  4LFC H;  4JI3 H;  1RTO A;  3CRK C;  1EUC B;  2OWO A;  1Y1V B;  3GTL H;  4ED0 A;  5C44 B;  2F4V L;  1IOW A;  2XD4 A;  1KIX A;  4PG3 A;  4KLK A;  4A3B G;  4KD4 A;  4HN7 A;  1B44 D;  1XX8 A;  1HR0 Q;  1S40 A;  1SEI A;  2WKD A;  2L4N A;  3MFG A;  2N55 A;  4DV4 Q;  5BR8 L;  3Q23 A;  4JI6 Q;  5KG5 A;  1KAB A;  4U67 3;  1KRS A;  3TS0 A;  5LL6 S;  4IFD I;  4YY3 Q;  2K1B A;  1GXD C;  3CPW A;  3GV6 A;  4YB8 B;  5CR3 A;  3H40 A;  3HKZ B;  3L0O A;  3AB9 A;  4JW0 A;  3KF6 A;  1K8A C;  5JVH 3;  4QCL A;  2K50 A;  4QQB X;  1QVG A;  5LP6 F;  3LWU A;  1TWF H;  2Z9H A;  4LFA L;  1PFN A;  3JZI A;  4YHH Q;  2MGS A;  2TSS A;  3CKI B;  4R1J A;  3S24 A;  3GTM H;  1M90 C;  5KFI A;  2I80 A;  2UU9 Q;  4KKU A;  3RLF A;  1ZKO A;  4R8I A;  4A3J B;  4NMZ A;  1L0Y B;  4CJ0 B;  1WTO A;  4XXE A;  1Q12 A;  3F8T A;  4OO1 H;  3I56 A;  2AQ3 B;  5HUR A;  1W93 A;  3CCJ A;  1KNE A;  2QYZ A;  1MBY A;  3PF5 A;  2MFI A;  4AH6 A;  1EYG A;  4DV0 Q;  2YTY A;  5KYL A;  1NBW A;  1XNR Q;  4K0K Q;  1GUS A;  2DY8 A;  1XNQ L;  3MWE A;  1XPO A;  4QL5 A;  1R9T A;  3EBE A;  1SNP A;  4IPC A;  3M7N A;  2O5I C;  1NUC A;  3RZO B;  5DQI A;  4R8U A;  2Z8L A;  3RB6 A;  4O4L F;  4KD3 A;  3CU7 A;  4A2B A;  3EVQ A;  1GYF A;  2LS0 1;  1UE5 A;  4JI7 L;  1H9M A;  1RD9 D;  2CWP A;  4EVO A;  1CKN A;  1SNO A;  1VQF A;  2F0J A;  4A3I B;  2JA6 H;  4X6A H;  3J7A 5;  1R4Q B;  2EY6 A;  3Q24 A;  2EE1 A;  2AQ2 B;  5EWE A;  3PW2 A;  3MVV A;  1SYE A;  3IAY A;  1TWA A;  5LYJ F;  2E2I H;  4JI5 L;  2IP4 A;  4RB2 C;  4TUY F;  3N52 A;  2LY7 A;  4J6H A;  1TII D;  1OWT A;  4GC7 A;  4A3F H;  1EZ6 A;  4X64 L;  2B2Y C;  1T3N A;  5A2Q W;  1SR3 A;  3M9B A;  1CA5 A;  3HKZ E;  4RUC A;  5IYD H;  2Z4H A;  2OT2 A;  1SBB B;  2FIN B;  4LUV A;  4J9K A;  2Z0S A;  4PWQ A;  1D8L A;  3TP6 A;  1B70 B;  3A74 A;  1MIU A;  4J9Q A;  3VYU A;  2EQS A;  5M3M B;  4DV5 Q;  3I4N G;  4GKK Q;  1VQ8 A;  5JEA J;  1PFM A;  4LF8 Q;  5KFA A;  4LFB H;  3HP3 A;  4LF5 H;  2A1A A;  4OON A;  4RAY A;  3BZD B;  2Q8R E;  1CKM A;  1G51 A;  3HOV B;  1OXU A;  1IBL H;  5K2M A;  4M9U A;  2F0G A;  1A8V A;  2UUB H;  3J80 i;  4CGY B;  2I87 A;  1EOT A;  1RIP A;  2R92 B;  1ILQ A;  1S0N A;  5KFX A;  1H9S A;  4XYQ A;  1GUN A;  3A5U A;  4GN5 A;  1BO0 A;  3ND9 A;  5FO7 B;  1G8Z D;  2MQH A;  4LF9 L;  3KYH C;  3RGZ A;  1RK5 A;  3GV3 A;  3M4O B;  4DR4 L;  5K36 H;  2V5A A;  4IR1 A;  4LF7 Q;  1D6E C;  3CCL A;  3FKI G;  2W70 A;  3MWY W;  3SK8 A;  4X3S A;  1BXT A;  2N3S A;  5JVL A;  1Q1B A;  1GO3 E;  5M3F H;  2JA8 B;  4NKL A;  3ERQ A;  2WTF A;  1U4M A;  3KHG A;  5ELN A;  3J80 E;  2RDJ A;  4KKS A;  3MEH A;  3Q8Q B;  2B63 A;  3UDF A;  4RKB A;  4I55 F;  4KHP Q;  4KHV A;  4ZUI A;  3JAM L;  4LF6 Q;  3EFX D;  4JI2 L;  1AFP A;  4JV0 A;  4IR9 A;  4B9W A;  3H3V H;  3I55 A;  2BQU A;  1HNX L;  1XMQ Q;  1C48 A;  3GIJ A;  3NTI A;  4CJ2 C;  2ZM6 H;  3S14 B;  5IP9 H;  4OX9 Q;  3CCQ A;  2EYO A;  2W7P A;  3I72 A;  4C2M H;  3U58 A;  1XWE A;  1SYC A;  2CWA A;  3H15 A;  4YJ2 F;  3S16 B;  5KFZ A;  4APV A;  3J81 c;  3KJP A;  4JOI C;  2BA0 A;  4XDX A;  1BCP D;  1FYC A;  2HQE A;  3KK7 A;  3R3O A;  3FDS A;  2EPB A;  4NXM Q;  1M0T A;  2FJZ A;  4JUZ A;  4L5Q A;  1WR2 A;  1VQ6 A;  2F3V A;  2EYM A;  3P75 A;  4DN4 M;  3H0G H;  4BY1 G;  2RGV A;  1DOL A;  1FR3 A;  2NUC A;  2K14 A;  3AEV A;  5C0X J;  4BA2 I;  1PZJ D;  3A8K E;  1Z2N X;  3H3V C;  1VKZ A;  1WTH A;  2QDL A;  1YNX A;  5I2Y A;  4YWL A;  3P1H A;  1D1I A;  3N6R A;  4TKO B;  3ULL A;  2NWG A;  2Q2T A;  2NU7 B;  2Z6K A;  3UDG A;  2K01 A;  1YJN A;  1E22 A;  4DV7 H;  1HCZ A;  2JA5 H;  1I94 Q;  4WJW A;  1AE3 A;  1L1O C;  2AHO B;  3N40 P;  4C3H B;  1A2T A;  2R7Z G;  1N34 H;  4LF8 H;  2ZDQ A;  5FLM G;  4BY7 G;  2WB1 G;  4RKL A;  5AJ3 L;  4X3K A;  3T5K A;  1N32 H;  5HY6 A;  2FMM A;  3HOZ B;  4KY7 A;  4XZ3 B;  4UHV A;  4TQR A;  4B3R L;  2YL2 A;  2F0V A;  3OIQ A;  3GTP A;  1STE A;  2RDH A;  2R7F A;  2NUA B;  4E4T A;  4FS1 A;  3HFZ B;  3S1Q H;  4JI1 Q;  1X55 A;  4MZ9 A;  4ZRZ A;  4ECY A;  1HTP A;  1BGW A;  1PH7 A;  3T13 A;  4DV3 L;  4HQ6 A;  2VUM A;  5C3X A;  4U7C A;  2D0O A;  1HNW L;  2VY3 A;  2ZDG A;  3BG3 A;  4DV6 L;  2VQD A;  1K1S A;  4ZYS A;  2MJ8 A;  5KX5 F;  3RLN A;  3RN5 A;  3BQ2 A;  3OYY A;  1A15 A;  4HSP A;  2IL8 A;  5FLX c;  1MI2 A;  4FS2 A;  3PW7 A;  1TQO A;  3I91 A;  4LWC A;  1OXV A;  2OQ0 A;  4F4Z A;  1LTR D;  4HJ8 A;  4DV2 H;  5D3D A;  1ASY A;  4AIM A;  2H1E A;  2IW3 A;  5D1P A;  4DL5 A;  1Z9F A;  3FMC A;  3RD4 A;  4ZQ3 A;  4IHJ F;  1N9W A;  1UWV A;  2ZTD A;  1VF5 C;  3R5F A;  1GUG A;  2KCC A;  2SCU B;  4A3D G;  3JAM W;  3RF2 A;  5KFF A;  4FF1 A;  5M5X B;  1TS2 A;  2G9H D;  1K1Q A;  4K2K A;  2BH8 A;  1YI2 A;  1SYF A;  3MXP A;  4B3S Q;  5BR8 H;  4RGO S;  3SXH A;  3PQI A;  3T1Y Q;  1CSQ A;  1X54 A;  2NBF A;  2J9G A;  4JK1 C;  2R93 G;  5F9N A;  2Y0S B;  5IWA L;  1IBM H;  3J81 i;  4O3R A;  1M4V A;  4HJA A;  4QWB A;  3GTG A;  5H1S E;  5IOD A;  2JA9 A;  1ESF A;  2JJQ A;  3RV3 A;  3NTH A;  5IYC G;  4QIW A;  3IFT A;  4HMI A;  4LFA H;  3KAJ A;  1ENF A;  2SNS A;  1Y1V A;  3PCO B;  2HD3 A;  5C4Z A;  2ID0 A;  3I4M H;  4IUQ A;  5C4J H;  4C5B A;  4JI4 Q;  3D0F A;  1D1K A;  1E4E B;  1TKW B;  4DUY L;  2PMZ B;  2ALZ A;  3Q8S B;  3V05 A;  1NSN S;  3TRE A;  3HOW G;  3T1H L;  1ROD A;  4GC6 A;  1U0L A;  2FP4 B;  1XTD A;  4HJ7 A;  1QOH A;  4H7B A;  3JSL A;  2A68 C;  4O4H F;  3HKZ A;  2JP1 A;  4LF4 L;  4DK6 C;  4QWD A;  1QVF A;  1XNQ H;  4J0M A;  1IHZ A;  1AH9 A;  1H9R A;  1X9N A;  3VYS A;  1FGU A;  3MA2 B;  4M7E A;  4GNX C;  4DR1 Q;  1VQB A;  3S2D B;  3NUC A;  3EJI A;  1I3Q B;  3FRP B;  4JI3 L;  2I5M X;  4A76 A;  3GDE A;  1JWU D;  2UXC Q;  5CC4 A;  3FPU B;  2NU9 B;  2JYO A;  4IQZ A;  2VOB A;  2KHI A;  1KHI A;  3RGX A;  2JEA I;  4E6I A;  1C8C A;  2CW0 C;  4IPD A;  4H44 C;  4IZ8 A;  1RF2 D;  3IN5 A;  4JI5 H;  2VNU D;  4EFE A;  2OF1 A;  2FPI B;  1Q8I A;  3RJ0 A;  2W9A A;  1WFQ A;  2EYH A;  2JA7 G;  5KFP A;  2FXQ A;  2J4X A;  2VQE Q;  3PO3 H;  5CA1 F;  2Y0S E;  1V51 A;  1JB3 A;  4X64 H;  4XTC S;  5CV7 A;  5BN4 A;  1EQQ A;  3GV8 B;  3PUX A;  5C8Y F;  1BVS A;  5T14 A;  4RGT A;  1EYD A;  1G6Z A;  5C5M A;  1MZB A;  4N8X 1;  3K5O A;  2W6N A;  4BXX H;  2UVR A;  4A3B B;  4O3S A;  4MTN A;  4KN7 C;  1W2B A;  4U6P A;  1JDE A;  4RNM A;  4LW1 A;  1DXM A;  3S1R B;  1BXR A;  2RGR A;  1X6O A;  1SEB D;  2A73 B;  4H02 A;  3GTK B;  2RDI A;  1DON A;  3E3X A;  5C3W A;  1CKN B;  3CPF A;  2KEE A;  1Y69 U;  4OO1 G;  2J6S A;  5CMD A;  5I2X A;  1BQQ T;  4JBW A;  3MR2 A;  4ZK9 B;  2EZV A;  1KAW A;  2C2E A;  4RA8 A;  2I46 A;  3E9H A;  3HBL A;  3D4D A;  3STB D;  2IBK A;  1HHV A;  1MGS A;  2C00 A;  5JEA H;  4JV5 Q;  2JEJ A;  3GTJ H;  3K0X A;  4Q44 A;  1N36 Q;  4CKE A;  1B3A A;  1LTA D;  3P7J A;  1A2U A;  1PRT D;  3S1N H;  4UCT A;  2VQF Q;  4LF9 H;  3CCE A;  1YNJ C;  1MJE A;  1E2V A;  3PF4 A;  3BDC A;  2GN5 A;  5A2Q E;  4DR4 H;  2WP8 J;  4BWG B;  1EQT A;  3W3A A;  1YJ9 A;  2JA6 G;  2NVQ B;  1A3U A;  1V8Q A;  1SE8 A;  1JOQ A;  2ATL A;  2HCI A;  2QA4 A;  3RB3 A;  1EZ1 A;  4HSV A;  1KDA A;  2ZTE A;  2R8G A;  3ORQ A;  2L11 A;  2WV6 D;  4JV2 A;  2HT1 A;  2R92 A;  4A3M B;  3K5M A;  2R8I A;  3STB C;  4O3Q A;  2M00 A;  5KFG A;  1PH2 A;  1HNX H;  4ECZ A;  3GTM A;  3F2B A;  2EJG C;  1C4Q A;  3BVZ A;  2PW7 A;  4DF7 A;  1KNA A;  4NDX A;  1STN A;  2QCP X;  1ONL A;  2AU0 A;  1GSO A;  5I6Y A;  5JVD F;  4C5A A;  1Z6H A;  1PTO H;  5FOB B;  3TQ1 A;  4C5C A;  4RAU C;  4FNF A;  4X65 Q;  1PTO D;  3R8B A;  4LFB L;  1TWG B;  2W6Z A;  4J15 A;  1AEX A;  4O3O A;  1CQI B;  5FD6 A;  2UXD Q;  1L0X B;  3DEP A;  4AYB B;  1EHI A;  2PW5 A;  1IBL L;  3WWV A;  4DV4 L;  4KY5 A;  4MTD A;  4ECQ A;  1Y8O B;  1HNZ H;  4UP8 A;  1KQS A;  4IN3 A;  4BY1 H;  3LWB A;  5EZY F;  3QG1 A;  5CAE B;  1WTQ A;  4YY3 L;  2JSO A;  3A54 A;  3SGI A;  4N9T A;  5T1G A;  2YZG A;  1JIH A;  3C0F B;  2ZXO A;  1LTT D;  4B3T Q;  3GIP A;  3OSP A;  2ICI A;  2QEX A;  1BBU A;  2EYP A;  4NPS A;  2J7Z A;  3G71 A;  5K36 G;  3AMU A;  3HS0 C;  3I4N B;  3TME A;  3M3Y B;  2R8J A;  3M9O B;  5C3E H;  1VQK A;  4YHH L;  3CP0 A;  2SEB D;  5LXT F;  1TA8 A;  5C0X H;  2HDL A;  1K28 A;  5M3F G;  4QY7 A;  4FF4 A;  2L0C A;  3N8D A;  4RZR A;  1PTO C;  2UU9 L;  1SXT A;  5IP7 H;  1G29 1;  2WAQ E;  3F1Z A;  4C3I H;  5FLM H;  3A5Z B;  4LH6 A;  1CQV A;  3I12 A;  4DNI A;  2RA4 A;  2PQA B;  4DV0 L;  2HHH Q;  4B3M Q;  4HNV A;  4IUT A;  5ELB A;  5FO9 B;  1XNR L;  2V4Q A;  4B3R H;  2YU9 H;  1SYG A;  3KAL A;  4K0K L;  1AZP A;  3H4D A;  2UXB Q;  3QZ7 A;  2R6F A;  2HVQ A;  5IP9 G;  4POF A;  2VW9 A;  2ZM6 L;  5JAV A;  2YTX A;  4AQY Q;  3AYH B;  4FBT A;  2VUG A;  1FNV A;  3FKI B;  5BMV F;  2PZW A;  3I90 A;  1ZHQ A;  3CF5 A;  3U9S A;  3H91 A;  5KFL A;  1LT5 D;  3E9I A;  3F2D A;  3MFH A;  1GUO A;  1ZYR D;  3QB3 A;  3VPB A;  4DPG A;  3FDT A;  3BYY B;  4I65 A;  4YCV A;  2V59 A;  5L37 A;  1CSP A;  3FVQ A;  1GHJ A;  5AFW A;  4MV8 A;  1PTO F;  2F0S A;  2IX0 A;  1GD7 A;  4N9P A;  3DUZ A;  2UUA Q;  2UUC H;  4UFZ A;  1JWS D;  2WIN B;  2DPJ A;  2W6O A;  4DL2 A;  2F4I A;  3TS2 A;  1GM5 A;  1I7N A;  1F77 A;  1S5B D;  3ER0 A;  1BR9 A;  3K3V A;  2EOT A;  1DOK A;  3KTM A;  4HR7 B;  5EPJ A;  1ZXT A;  3PIP A;  2E2H H;  3TP8 A;  4CC5 A;  3U4Z A;  3L4K A;  4K8J A;  2B2V A;  3CCM A;  4MV6 A;  4A3D H;  4JVZ A;  2IA6 A;  2ES2 A;  1J6Q A;  4IJL A;  2B2U A;  5COY A;  3V96 A;  3PGZ A;  2IX1 A;  5DQG A;  3PIO 3;  2JA5 G;  2BE5 C;  4CJ1 B;  3CQZ H;  4IUR A;  2NYZ D;  1X3Q A;  1HUM A;  2XC9 A;  2HIV A;  3PSI A;  3A0J A;  4GKK L;  5IWA H;  2K52 A;  1TAE A;  3K80 C;  1N34 L;  4LF8 L;  4LF7 H;  1QNK A;  1O75 A;  2F52 A;  4JI0 Q;  1I6H B;  1LT4 D;  2HUG A;  1JOR A;  4L5S A;  3ONA B;  2PCF B;  3A8J E;  4H13 C;  3JAM i;  2DIK A;  2P0A A;  2PN1 A;  2XCL A;  5KFC A;  5C5J A;  4DR5 Q;  4J9S A;  3DEO A;  2FMA A;  1Y1W H;  4X66 H;  1HR0 W;  1KAA A;  4BS9 A;  3T51 B;  4DLK A;  4Q5V A;  3OTO H;  3N44 B;  1KJQ A;  4R7R A;  1VF7 A;  3MFY A;  5ELE A;  3OWE B;  1YHA A;  4B3T H;  3S17 H;  3MWM A;  2I07 B;  4DUY H;  1TWH B;  3L3O C;  4O4I F;  3OUU A;  2LXK A;  2F0U A;  4XYM B;  1AN7 A;  3T1H H;  2R7Z B;  3K6O A;  2C35 B;  4ZHQ F;  4BY7 B;  1G2T A;  2FK3 A;  2Y0S A;  4GKJ Q;  1SNQ A;  2WB1 B;  4LAA A;  3R5H A;  3JAM E;  1EWI A;  3Q2O A;  3NWT A;  1M6V A;  1YVC A;  2WFW A;  3GIM A;  2RSO A;  3OMC A;  2PQE A;  1PH9 A;  3HG9 A;  4C3J G;  5EKI A;  4KHP L;  3S2H B;  2NVY B;  3L9A X;  3GTG B;  4DV2 L;  4F8M A;  3FMA A;  5IGD A;  4LF6 L;  2NN6 H;  2NVT B;  3MXG A;  4EFB A;  3PV0 A;  2C2R A;  2MPM A;  1AN8 A;  5D14 A;  1SYD A;  1PH8 A;  5KG6 A;  1K3B C;  1XMQ L;  1V4Y A;  1IYV A;  1E4E A;  3T4A C;  1A3V A;  1GUT A;  1SFO H;  2PMZ A;  5HBR B;  4L8J A;  1RJT A;  1FD7 D;  1Q7Y C;  5FD5 A;  1WCM B;  3I7F A;  1G91 A;  4MV9 A;  1EY0 A;  1C0A A;  3J80 c;  4MA5 A;  2OLS A;  3C46 A;  1VCI A;  1IBM L;  1K83 B;  4HTH A;  2PO4 A;  2ZXP A;  2JA7 H;  1K8G A;  2F0F A;  3VR6 A;  1OXS C;  1I3Q A;  4P71 A;  3CW2 C;  1BUV T;  3WNZ A;  1B4O A;  4ECT A;  3D31 A;  3I4M G;  3KXY T;  3A7L A;  3J7A F;  5E3F A;  2C5C A;  4XT1 B;  1VQJ A;  4JC0 A;  3H4B A;  2EY5 A;  2R93 B;  1CUK A;  3MEF A;  3G6Y A;  1BNZ A;  3ITP A;  4RGM A;  2R7N A;  2WB1 E;  3R93 A;  2WAQ G;  1PMR A;  2RF4 A;  3BA9 A;  4R8N A;  5C4X H;  4A4I A;  1AP0 A;  1XMO H;  4ZOL F;  3NBH B;  4KV6 A;  2VA3 A;  1B53 A;  2ZXR A;  5DLQ E;  1JT8 A;  1Y8P B;  2B8G A;  4PZ7 A;  2H4O A;  2F0I A;  4RHS A;  4DXF A;  1PH1 A;  1EWC A;  5KNC A;  3ZYY X;  2I8C A;  1I50 H;  4K5W A;  1PZI D;  2VB2 X;  1EYC A;  4IFD J;  3HOW B;  1FL0 A;  3GTK A;  2IHF A;  1IBK Q;  4JI1 L;  5KIX A;  2YCH A;  4EYH B;  2K05 A;  4DV1 Q;  1VQE A;  4IOA A;  3T5J A;  2FFK B;  2IT1 A;  1NMF A;  1CZW A;  4FP5 D;  2NVX H;  3PO3 G;  1A6X A;  4JYA Q;  2K04 A;  4YWM A;  3MHB A;  3M9M B;  5EQ0 A;  1IYU A;  1PYB A;  3M7G A;  4XYO A;  3E0J A;  2A19 A;  3N41 B;  3QOJ A;  4DR2 Q;  1VQO A;  3GTL B;  4QWE A;  1I4R A;  2D9U A;  3G6V A;  4BXX G;  3CCR A;  4YAK B;  4JI8 H;  4Q8E A;  3IG0 A;  5L9X A;  5KFE A;  4NXN Q;  3GD7 A;  3PW0 A;  4X62 H;  2CW7 A;  1KEE A;  4YJ3 F;  5FO8 B;  3GII A;  3VMM A;  1EUD B;  2F0H A;  2EYL A;  4TQU S;  1QZG A;  1ENC A;  1YHB A;  2EJM A;  3NSW A;  5JVG 3;  1IOV A;  1HR0 H;  3PZP A;  4DV4 H;  1KRT A;  4LMY A;  4QWA A;  4JI6 H;  2EXD A;  4B3S L;  1DV2 A;  2R7K A;  1KBL A;  1IZ6 A;  2FK2 A;  1TWF B;  4DK3 C;  1SNM A;  4IPH A;  5JEA G;  4YY3 H;  3ERO A;  1S4Z A;  2D62 A;  4EQO A;  3N42 B;  2FKL A;  1F2M A;  5CV6 A;  3W2D A;  4OWW B;  1NMG A;  1XXG A;  2KQ3 A;  2B8F A;  4LUO A;  2F0T A;  3MXU A;  3GTM B;  2FE3 A;  5M5Y H;  4HYK A;  3KUP A;  5JJL A;  1AW7 A;  4RH6 A;  3G6X A;  2F0L A;  4P73 A;  5A35 A;  4HCS A;  4KTA A;  4YHH H;  3CAM A;  1H9J A;  5E4X A;  1TS5 A;  1N48 A;  1TWG A;  4J9R A;  1YIJ A;  4DL7 A;  4JI4 L;  4AYB A;  5DM6 3;  2UU9 H;  3IRB A;  2CH4 A;  3ERS X;  4QW8 A;  1A3T A;  5NUC A;  2XCA A;  1CK1 A;  3GTQ H;  2AUJ D;  3GTO H;  4RB1 A;  5HGQ A;  3E0E A;  4ID6 A;  1II3 A;  4UAI A;  4DV0 H;  1U9R A;  1E2Z A;  3X3N A;  1XNR H;  4K0K H;  1T9H A;  3PO2 H;  2AKW B;  3V4S A;  1FNW A;  4A3E H;  4Y52 H;  5KFY A;  1LM0 A;  4ZUJ A;  3Q0A A;  5I47 A;  2JA6 B;  2XWJ B;  1C9O A;  3GQC A;  4G7H C;  2I0Q A;  1IKL A;  4DR1 L;  2PZU A;  3S15 H;  2A5H A;  3RN2 A;  2E2I B;  5IGG A;  4FF2 A;  2UXC L;  3CCS A;  1H9K A;  1HFG A;  1LV9 A;  1STY A;  4QWC A;  2NTT A;  2DJG C;  1F9Q A;  3TRZ A;  5KG0 A;  3L4J A;  3RB4 A;  4A3F B;  3I3C A;  1O7Z A;  4DUZ Q;  2HDM A;  1HNZ L;  1IYJ B;  2PQA A;  1RKN A;  1V1O A;  2F4V Q;  3RNU A;  2K5W A;  2XVS A;  1DJR D;  1YZ6 A;  3BJU A;  3HXL A;  4LNQ A;  2N49 A;  5EKL A;  1A9X A;  1W6J A;  1EY9 A;  2VQE L;  3OWF A;  1XDN A;  2K75 A;  4PZ8 A;  3FKI A;  1UE1 A;  2W8K A;  3K5H A;  3M85 A;  3K5L A;  1LTS D;  1TVX A;  2KCT A;  2PVP A;  4KJN A;  1ULZ A;  2VUM G;  5C3E G;  1E4F T;  3Q8R B;  1EWH A;  3T5L A;  4RCO A;  5C0X G;  2VS1 A;  3PIP 3;  1YBY A;  4KN4 C;  2B39 A;  3I4L A;  1F9R A;  1C3O A;  1PYS B;  4IRD A;  4DU9 A;  4PQX A;  1NE3 A;  5LHY 1;  3PR4 A;  5IP7 G;  4DV5 H;  4FU0 A;  4GKK H;  5KKN B;  5CBA E;  1WD1 A;  3UDI A;  2MNA A;  4C3I G;  4MIU A;  2WE6 A;  1RYR A;  3D6C A;  5CV4 A;  1I5F A;  3RTX A;  3X3M A;  3S1M H;  3RAX A;  1TS4 A;  5M5Y B;  2DLN A;  5DQH A;  4Y7N H;  2WYO A;  2F0E A;  1S0M A;  1UEB A;  4JV5 L;  3HKS A;  4HR7 A;  3TII A;  1W3S A;  4XYL B;  3OSO A;  4RB0 A;  1NR2 A;  5IGE A;  2VQF L;  5M3F B;  3NXW A;  3SK4 A;  1EY7 A;  1G6P A;  1X3E A;  4JCV E;  1B1Z A;  2G5D A;  4X3T A;  2B2T A;  1O7I A;  3VYR A;  1JLL B;  1EOV A;  3KBX A;  3GTQ B;  4OHJ A;  4WFN 3;  1F9P A;  4K6D A;  1F2Y A;  3SVM A;  3GTO B;  2V4D A;  3L2P A;  4A3L H;  3VPD A;  4DAP A;  5IT9 L;  3LML A;  3MFI A;  3TSS A;  3QZ8 A;  3I8Z A;  5EJW A;  1A0I A;  2G9D A;  2A6H D;  2ZT9 C;  3C3L A;  4O42 A;  1L0W A;  4JI7 Q;  1PDQ A;  2JEB I;  2JEI A;  5IGC A;  3PN1 A;  2UUC L;  4IAJ A;  3UFX B;  1W6K A;  4HED A;  4J9P A;  1FGB D;  4KHP H;  2FJ2 A;  2JN4 A;  4C3J H;  1T5E A;  1E2W A;  5EOY A;  4LF6 H;  1NY4 A;  3HOX H;  1HZB A;  2Q2H A;  3FP9 A;  3F8N A;  2RQX A;  1QVC A;  4C2M B;  4ECR A;  3UDX A;  5C44 G;  4Q0Y A;  3IL8 A;  1BCP B;  3BZC A;  1VQ4 A;  1TXY A;  1XMQ H;  2EJF C;  2ASB A;  3J7A V;  1Q90 A;  2H5X A;  1TWH A;  2E75 C;  3PIO A;  1RJQ A;  3M9N B;  4DR3 Q;  2P5Z X;  1WTP A;  1FJG Q;  4OX9 H;  2Q2I A;  2R7Z A;  1HPC A;  4OWX B;  2XCP A;  2R8K A;  3MR6 A;  4CDE C;  2LKV A;  2VR1 A;  4A75 A;  1JKJ B;  2WB1 A;  2O2L D;  5ELC A;  3K5I A;  3Q6S A;  3V2T A;  5KT2 A;  3H0G B;  2VXW A;  3D4W A;  3BAA A;  4YAJ B;  4R4T A;  1DOM A;  2A68 D;  1PH6 A;  1YHQ A;  4X65 L;  1PFB A;  2GPW A;  1WYD A;  2XSC A;  4NXM H;  2A6H C;  3QWN A;  4I7A A;  2UXD L;  4L1K A;  2NVY A;  3QIA A;  1DYQ A;  5DAU A;  1IKM A;  1QUQ B;  3Q8P B;  5EPL A;  1Y1W G;  1R9T H;  5EAY A;  5BN5 A;  4A3K H;  4X66 L;  3OTO L;  3FHW A;  1O7L A;  4QUF A;  5ELF A;  2UVU A;  1SRO A;  4B3T L;  3RUZ A;  2JA5 B;  1WCM A;  2CW0 D;  3ETH A;  2O4X A;  1VMC A;  4TV8 F;  1X3F A;  5GAG C;  2KVM A;  4F7X A;  1G2S A;  1VQD A;  1B6R A;  5KFN A;  1TWA H;  1PH3 A;  2LSS A;  4HIO A;  1K83 A;  1R4P B;  2L55 A;  5KNB A;  3DLL A;  1DV1 A;  1DGS A;  1WSC A;  4BBR H;  1K8O A;  4IWY A;  1I94 H;  4OEL B;  4F4Y A;  1ZET A;  2R84 A;  3K57 A;  5CA0 F;  3H6M A;  3S1Q B;  5BPH A;  3S9W A;  2DGY A;  2NN6 G;  1XJV A;  2CQO A;  4XIG S;  3MR3 A;  2N8N A;  2SDF A;  4JPB W;  4B08 A;  4MNO A;  4IRC A;  4EQP A;  5LMN Q;  3F2U A;  5KT6 A;  2NZO A;  1NTG A;  4OO1 I;  2ZJR A;  2UXB L;  3GIL A;  2FLL A;  4AQY L;  4JI1 H;  4JI2 Q;  2IMW P;  5KEE A;  2YYA A;  2R93 A;  2K7V A;  2KED A;  3KDF B;  2HCC A;  3BU2 A;  3NEL A;  4G57 A;  2ASJ A;  1MJC A;  1HQR D;  3EIV A;  2BDO A;  1VMP A;  4M1U B;  3NBH A;  4APM A;  4TRD A;  5FPO A;  3K3P A;  1WVL A;  3R5X A;  3A56 A;  5ELD A;  2RDG A;  3CCV A;  4RZQ A;  5DG9 A;  4ILW A;  4UP7 A;  2UUA L;  1YNJ D;  2AWO A;  5IT9 W;  3LNN A;  3DXJ C;  1IXR A;  1T94 A;  4RAZ A;  3HOY H;  2YTV A;  4RMF A;  3VYT A;  1KLU D;  2UVW A;  3HOV G;  2I5L X;  3GP7 A;  2V9W A;  2UVV A;  1KDB A;  1CT1 D;  2F0D A;  1K3R A;  4GNX B;  2B63 H;  4B3S H;  4NP5 A;  2R92 G;  3T1Y H;  5LMU Q;  5C4X G;  4QW9 A;  2AGP A;  1ZEQ X;  1MSH A;  1GKH A;  1XMO L;  1GJX A;  3GTL A;  4RGN A;  3I4M B;  1EIF A;  5C4J B;  1HH2 P;  3HOU H;  1GSH A;  4ALP A;  3G8C A;  5CGK A;  3RZD H;  2I5H A;  5I6W A;  4DR5 L;  1J5E Q;  5KRU A;  3BAB A;  5AJ3 Q;  2GLT A;  4KKT A;  3BG5 A;  1S5D D;  2JA8 G;  4RUA A;  1HUN A;  1B04 A;  2PI2 E;  2FLP A;  4PMB A;  4JI4 H;  3C1E A;  4WBN F;  1P16 A;  3WO1 A;  4L63 B;  2WAQ B;  3BDL A;  4OEM B;  5ELO A;  4J9M A;  2QGQ A;  3LGJ A;  4GLV B;  1TWF A;  3CC7 A;  4EX5 A;  2BH2 A;  4EGJ A;  4DV3 Q;  4GKJ L;  1KL9 A;  1WTW A;  1HNW Q;  1O7Y A;  3RB0 A;  1LT3 D;  4ABN A;  4ECW A;  4DV6 Q;  2YYZ A;  1I7L A;  3DHQ A;  4B9X A;  2F0O A;  1HFN A;  3K81 C;  4JI8 L;  3TP7 A;  5TSS A;  4R4C A;  1Y1W A;  1EQR A;  4FXK C;  2MO0 A;  3K7A H;  1QIL A;  1SYB A;  4ODG A;  5HV6 A;  1UC9 A;  1RTN A;  1B50 A;  4K5X A;  2AQ1 B;  4X62 L;  4DR1 H;  5GRO A;  2CHB D;  2N88 A;  1JJ2 A;  2KBN A;  4DR7 Q;  2UXC H;  2YV5 A;  2X69 A;  3PO3 B;  4YBZ B;  5KG1 A;  1HR0 L;  4J9N A;  3H3V I;  1Z2P X;  3JAM c;  2HVS A;  3TP5 A;  4JI6 L;  4CKB A;  2DUD A;  3TIG A;  4YR3 A;  1EEF D;  1Q86 C;  5IYB H;  2FPP B;  2AQ4 A;  4P2C B;  1I50 A;  4ECV A;  1K8M A;  3AQQ A;  5DGA A;  1RJR A;  2VQE H;  3RLO A;  5I4D A;  4Y8V B;  1M8A A;  3OW7 A;  3GTP H;  2JA6 A;  1QNU A;  3NQT A;  3LWE A;  1VQ9 A;  3A8I E;  2CCZ A;  3SI8 A;  2ATW A;  1K0S A;  4ZKC B;  5HGT A;  1PX2 A;  2YS7 A;  2E2I A;  2VUM H;  2Z1C A;  2OTL A;  1JQY D;  5C1O A;  1GGO A;  5KFO A;  1T36 A;  3MR5 A;  2EXZ A;  4DR6 Q;  4YWK A;  2Z6K C;  2DZD A;  1EY4 A;  3VR5 A;  5BPF A;  2NTS A;  1S72 A;  1AUV A;  3KLS A;  2IX3 A;  3LP8 A;  4A3G G;  3GQB A;  3GTJ B;  1PRT B;  1EUJ A;  3SE0 A;  3S1N B;  4QGU A;  1L2F A;  3URY A;  2E5L Q;  2QKI C;  3SE7 A;  5LMU H;  3PO2 G;  4EGV A;  1UE6 A;  4A3E G;  2VZA A;  1CTM A;  4JV5 H;  1D7Q A;  1KLG D;  1FNU A;  4C1N K;  4ECS A;  1N36 H;  3ZJY C;  4TSS A;  1YEZ A;  3J81 L;  2B29 A;  2WKC A;  4J1M A;  1KJ9 A;  3OSN A;  4LF4 Q;  1JE5 A;  2LXJ A;  2OXP A;  4C1N I;  2E2J H;  4MTK A;  5DLG A;  2VQF H;  1OXX K;  4WJ4 A;  4UCV A;  4GN3 B;  4OGQ C;  4JV1 A;  1TY2 A;  2BE5 D;  2W9B B;  5KFH A;  1WOC A;  3TZD A;  4CDD C;  5J3B A;  1IBK L;  4MN3 A;  4OXP A;  2CQA A;  3VDY A;  1JMC A;  3Q22 A;  5H80 A;  3KF8 B;  2BA1 A;  4EQ5 A;  4LFC Q;  2ASL A;  2JXM B;  3PUV A;  4DV1 L;  4EYI B;  1ET9 A;  1KDC A;  2L5T A;  4UPA A;  3PW4 A;  3TIN A;  3J7Z C;  1HRJ A;  5KT5 A;  3ND8 A;  2WII B;  3UQ8 A;  4A3C H;  1HTL D;  3PW5 A;  5CV8 A;  3SEB A;  5KND A;  4JOI A;  4LUZ A;  4R4O A;  1I6U A;  2A69 D;  1B9N A;  1D5Z C;  2W57 A;  5EBD A;  5K5P A;  1Y1V H;  3OHB A;  5C44 H;  1PTO B;  3E5N A;  4ME3 A;  5KFJ A;  4WD3 A;  4DR2 L;  2DJF C;  2FPG B;  1JOK A;  5FK9 C;  2VPQ A;  2R7M A;  4ECU A;  1DM0 B;  4IUP A;  5GAH C;  4NXN L;  2NZ1 D;  1Z2O X;  5IY0 A;  3GTQ A;  3GTO A;  2DY7 A;  3BDO A;  5IGF A;  3G48 A;  3EYY A;  4DV5 L;  4BY1 B;  4EBD A;  3QJY A;  1CQF A;  5LL6 b;  4HCE A;  2Q8T A;  1EYA A;  4X65 H;  5D3I B;  3GLK A;  4O1N A;  2CZG A;  1UC8 A;  2ZJT A;  1PZK D;  1LTG D;  3UI2 A;  2UXD H;  1VS0 A;  3G7L A;  3WDN A;  5I9O A;  4HNT A;  2K03 A;  1NJI C;  1Q8K A;  2HQL A;  2K33 A;  4CHT B;  1YJW A;  2O03 A;  4C2M A;  5KFW A;  2A6E C;  3DWQ A;  3UE1 A;  3L7Z C;  3PMF A;  1UEA B;  4QF4 A;  2A69 C;  1ICF B;  1TWC H;  5C3E B;  3KJO A;  3V4Z A;  5KFM A;  1EL0 A;  3BYT B;  4C56 C;  1S0O A;  5BN3 A;  4M8A A;  4UCR A;  4IUV A;  2ASD A;  4O2A F;  2FMC A;  4A3J H;  1SLJ A;  4WJ3 M;  4XQQ A;  1Q82 C;  2CW8 A;  3H0G A;  4A3L G;  1I4Q A;  1SSO A;  2QIL A;  1TU2 B;  2QW7 A;  4C3I B;  3C1F A;  1PXU A;  5FLX L;  5GAD C;  4LF7 L;  1EIH A;  3T5H A;  3SK6 A;  3K8A A;  5FJ8 H;  4IWX A;  4I7H A;  1I4G A;  1UUP A;  1CKO A;  1VQN A;  4OIJ A;  5COR A;  4FYD A;  1RJP A;  4L5T A;  2YU9 B;  5JPM C;  2L12 A;  3DF7 A;  4CBV A;  1QUQ A;  3NE5 B;  4Q8F A;  2J0T D;  4F4X A;  4YCU A;  1B2T A;  1EY5 A;  1QWY A;  1B8A A;  3HOX G;  1CHQ D;  2C28 A;  4IOC A;  3RZO H;  5GAE C;  2K32 A;  4B3M H;  2HHH H;  1NNX A;  1I4P A;  1RL2 A;  1E24 A;  2A8V A;  1STG A;  4ETS A;  2FK1 A;  2W6P A;  2JA5 A;  1B33 N;  4TV9 F;  2ALY B;  4A3I H;  2UXB H;  1YNN C;  4AQY H;  4OX9 L;  1ML0 D;  4EBC A;  2SOB A;  1FVI A;  2NU6 B;  1CM9 A;  2V1C C;  3OW2 A;  5CBE E;  1QG7 A;  3KLS X;  3J81 W;  4QJF A;  4WOR A;  4NXM L;  1WTV A;  1PFS A;  2BQ3 A;  4PV1 C;  3SDZ A;  4DUZ L;  1VQP A;  1KJJ A;  5JUM A;  2FB9 A;  4LFB Q;  2RHS B;  2E2H B;  4LF5 Q;  4A3K G;  2UUA H;  4ED3 A;  1Z47 A;  5L1J A;  3I73 A;  4A3D B;  1IBL Q;  2K4K A;  1MSG A;  3W1B A;  2ZDH A;  3ORR A;  4Z9C B;  1MHW C;  2PI2 A;  2UUB Q;  2R87 A;  2SNM A;  5C4H A;  2ENB A;  2J6U A;  5M3M H;  3CQZ B;  3WOF A;  5F9L A;  1ENA A;  3KDF A;  2E74 C;  4DKA C;  2BR0 A;  1E1T A;  3HOV H;  4HID A;  1S5F D;  1Q3L A;  4I4T F;  3FPP A;  4A93 G;  3BVM A;  2XGP A;  4EEQ A;  3UE0 A;  3KHH A;  5CV9 A;  4J8Q A;  4R9W A;  4GOP B;  4BBR G;  2R92 H;  1I94 L;  3MZ5 A;  1Y1W B;  1GSA A;  2X6G A;  1TWC B;  4CC6 A;  4JI0 H;  1SMY D;  2RKS A;  2PZT A;  5DLF A;  1WD0 A;  3ULJ A;  3S17 B;  2VA2 A;  3M4O H;  4DR5 H;  1PYW D;  3VPC A;  4POG A;  3D8G A;  1AZQ A;  1BKB A;  2R3Z A;  2JA8 H;  1VQM A;  1RCV D;  5IT9 E;  2J6T A;  3CCU A;  4MTE A;  4GNX A;  3T56 B;  1OTC A;  1S5C D;  2ZM6 Q;  1PHJ A;  4IFD G;  4UCS A;  1X3P A;  1Q46 A;  2R6G A;  4A3M G;  3WOE A;  1CI3 M;  4GKJ H;  3HZX A;  1GUW A;  1IW7 D;  3TZU A;  1LTL A;  5JPN C;  3PVX A;  1SJE D;  2HIX A;  4QIW E;  1LLR D;  2EYF A;  3U9O A;  1RK6 A;  1X32 A;  4R4Q A;  1SMY C;  1SN8 A;  3S14 H;  1SFO B;  5FLX W;  5EGT A;  5KYI A;  1IL2 A;  4EQN A;  2A74 C;  3N6X A;  3U50 C;  3HOY G;  3OPO A;  4KI0 A;  3VR3 A;  4PMW A;  3S16 H;  3OHA A;  3RUP A;  4RNO A;  3ETJ A;  2D0P A;  4EGQ A;  1SYX B;  3NEM A;  2IWH A;  2WAQ A;  4AYB G;  4K8I A;  1WI5 A;  4RFB A;  2JA7 B;  4LJZ C;  4DR3 L;  1FJG L;  4EG0 A;  1GVP A;  3KFU A;  2F0P A;  3DM3 A;  2YRX A;  2B63 G;  1D5M C;  4RG1 A;  4Q43 A;  2DNE A;  1K9M C;  1BBW A;  3HGB A;  3LX0 A;  2RVL A;  3MXN B;  3T1Y L;  4IO9 A;  4HNU A;  1Y14 B;  1PV4 A;  4EBE A;  1IW7 C;  2KOL A;  1TR5 A;  4IUU A;  5KFV A;  1E1O A;  4DV7 Q;  1Z7T A;  1HZA A;  3HOU G;  3J81 j;  3K0Y A;  3BZK A;  1RHP A;  1F2Z A;  4LMQ D;  4DXG A;  1N34 Q;  1JE4 A;  3A55 A;  2YZN A;  1S3O A;  1J8I A;  1N32 Q;  2W9C B;  2AUK A;  4N8F A;  1ZHS A;  2K28 A;  2F0N A;  3PUY A;  5KFS A;  1KJ8 A;  5DM7 3;  4C3H H;  3V6K A;  2HVR A;  1VBH A;  2EYJ A;  2RDF A;  5C4X B;  4PDB A;  2BDN A;  1B9M A;  3MJF A;  1N33 Q;  3HOZ H;  4L6T B;  4A3G H;  4UDU C;  1JJC B;  2GVB A;  4JBM A;  4RU9 A;  3QO2 A;  4DAY B;  1O80 A;  4XX0 B;  2PNR C;  1MKH A;  1UE7 A;  5KG3 A;  4P74 A;  2JEF A;  1I50 B;  2QDB A;  1I6V C;  2B3G A;  1L2Z A;  1O78 A;  1HZC A;  1JOO A;  5C0X I;  2F3I A;  1SCU B;  3JC6 6;  1E3P A;  1RDP D;  1M1K C;  5C5L A;  1VQ7 A;  3PUZ A;  4X3U A;  3JRW A;  2XTI A;  1S68 A;  5LMN L;  2PNH A;  2M9V A;  1D5X C;  4O0A A;  4DV2 Q;  1XPR A;  2NVX B;  1BBX C;  2YRW A;  1IBK H;  2R7D A;  1U4L A;  1SJH D;  1EY8 A;  1VQA A;  1GLV A;  1N56 A;  3QOL A;  2IHE A;  3GTJ A;  1S03 G;  1V1P B;  3GO5 A;  1PH4 A;  4TQS A;  5FPR A;  4DV1 H;  4ZI7 F;  2AMC B;  1SE4 A;  5IYB G;  4HAE A;  1ILP A;  5EKK A;  2JQO A;  4O3P A;  3AFP A;  4JYA H;  5LL6 X;  1VQI A;  5BR8 Q;  3CHB D;  1LTI D;  1HJP A;  1SDF A;  1I4X A;  3G6J B;  2E2D C;  3K7U C;  4QMG A;  1IBM Q;  4MAM A;  5ISR A;  4DR2 H;  4PMC A;  4J9O A;  1STA A;  1VQC A;  3A7A B;  5M5X H;  2W9B A;  1LYL A;  4KJO A;  1KC7 A;  4NXN H;  4CDF C;  3RAQ A;  1U4R A;  2CVR A;  2B2V C;  1Q81 C;  4K2L A;  4OIK A;  5DNF A;  3KF8 A;  4LFA Q;  3VA5 A;  3KAK A;  3HEJ A;  3K58 A;  2B2U C;  3SR1 A;  2K6A A;  1KC8 C;  4GLA C;  4P72 A;  4BBS G;  1KXL A;  1SE3 A;  1NR4 A;  2F0M A;  3TBI B;  3JSN A;  2C2D A;  2W7O A;  1KTK A;  2DN8 A;  2MUY A;  2XWB B;  5LMU L;  3SK5 A;  4MV7 A;  2NB0 A;  1WH2 A;  2CH4 W;  4WRD A;  1VAJ A;  2MCT A;  1N36 L;  3EPI A;  1BCP C;  3D6W A;  1P8L A;  4DL4 A;  5CV5 A;  4HJ5 A;  1XNQ Q;  3M4Y A;  5C6A A;  4FXD A;  4OL7 A;  3I2Z A;  4Q0F A;  1J5E L;  4JBK A;  1WJJ A;  1D2B A;  3BQ1 A;  4HIM A;  3J7A K;  4A3G B;  3MWD A;  3CRL C;  4G4K A;  4DK0 A;  4MV4 A;  3D3R A;  1H95 A;  3TN2 A;  1E0B A;  3KHL A;  3PO2 B;  4UP9 A;  1DZ1 A;  4A3C G;  4A3E B;  1N33 H;  2PYK A;  2W71 A;  5D1O B;  2R8H A;  3S2D H;  1J9O A;  1I3Q H;  3MTS A;  3KLW A;  1Y1V G;  4JI5 Q;  2GA4 B;  2Z6B A;  3Q8D A;  3S15 B;  1M0W A;  5JH7 F;  2XGQ A;  1U5K A;  4K6L A;  1L1O B;  5F2D A;  5J1Z A;  3HB9 A;  1SND A;  2KEC A;  3I4O A;  4FF3 A;  4LH7 A;  1WCM G;  1W96 A;  4X64 Q;  4Q45 A;  2RBM A;  2MO1 A;  1BCP F;  4DL3 A;  4ECX A;  4FVM A;  2B2W A;  1HA5 A;  3BVG A;  4DR7 L;  4RNN A;  2YU9 A;  2EDG A;  3T53 B;  3HKZ G;  2NN6 I;  1EZ8 A;  4G7O C;  4LSA A;  4RB3 C;  1ESR A;  2OCE A;  3QFF A;  5I9P A;  3TQT A;  1YIT A;  5EBC A;  2HJW A;  4DUZ H;  5LMN W;  2F4V H;  3H20 A;  4J9L A;  1LO5 D;  3EA6 A;  2K5Q A;  4A3B H;  2AGQ A;  2JK8 A;  2W6Q A;  3VA7 A;  3P20 A;  3S1R H;  3HRZ C;  1CS0 A;  2M2L A;  4KK7 A;  3GTK H;  4A3J G;  5D65 A;  3MAQ A;  3F2C A;  1JXL A;  1EYZ A;  1SNC A;  1AUX A;  2M05 A;  4DAV A;  4MV1 A;  5KFK A;  5FJ8 G;  2Q2U A;  1B6S A;  3DWA A;  1A62 A;  4A93 H;  2NU8 B;  1RYS A;  3S1M B;  2DPI A;  4LF9 Q;  4DR6 L;  4RWS C;  2QEJ C;  2IY5 B;  5KG7 A;  3WO0 A;  4DR4 Q;  1LT6 D;  4YR2 A;  1WTR A;  4Y7N B;  3V6H A;  4DNT B;  1F2L A;  3K59 A;  4MA0 A;  3G4S A;  4JBJ A;  1BJT A;  3OHX C;  1JJG A;  2E2H A;  4LSX A;  1BOS A;  5J22 A;  3EPG A;  1LAC A;  4KMU C;  1B3Q A;  3T16 A;  2HHH L;  4B3M L;  4U68 A;  3J81 E;  2E5L L;  3CQZ A;  1EQV A;  1XTC D;  4A3I G;  4BA1 I;  1STB A;  2NVQ H;  3AFQ A;  5IYZ F;  4YR0 A;  3J80 L;  1JCK B;  4XQN A;  4KHZ A;  3KBG A;  1HNX Q;  2ZTC A;  1FKA H;  1QB5 D;  2BCO A;  3NWS A;  3H09 A;  2V58 A;  5DEH A;  1X65 A;  1UNN C;  2L15 A;  2WAC A;  1V43 A;  4GOP A;  1XYI A;  2CQY A;  1CZG A;  2TMP A;  4IFD H;  2OTJ A;  2MP1 A;  1EFW A;  5M5W H;  1U4P A;  3KF6 B;  4A3M H;  1SMX A;  5IGB A;  3NQI A;  5E4W C; 
#chains in the Genus database with same CATH homology
 3H0G H;  4BY1 G;  4GLX A;  1CUK A;  3RR5 A;  4LFC L;  3MEF A;  3ICE A;  3ZJY C;  1YEZ A;  4NB3 A;  3B6Y A;  2B29 A;  4LF4 Q;  1JE5 A;  2LXJ A;  2E2J H;  2K14 A;  3AEV A;  1OXX K;  5C0X J;  2WB1 E;  4GN3 B;  4BA2 I;  4WJ4 A;  2WAQ G;  5E7N A;  2RF4 A;  1VQG A;  1YNX A;  1WOC A;  5C4X H;  5J3B A;  4A4I A;  4YWL A;  1IBK L;  1Q1E A;  3NBH B;  4OXP A;  1HNZ Q;  3ULL A;  3VDY A;  1JMC A;  5M3M G;  5DLQ E;  4HJ9 A;  3KF8 B;  2BA1 A;  2KEN A;  4EQ5 A;  2Q2T A;  2Z6K A;  4LFC Q;  3UDG A;  1JT8 A;  4PZ7 A;  3PUV A;  4DV1 L;  1TWG H;  1PH1 A;  4UPA A;  1YJN A;  2RHQ B;  1E22 A;  3J7Z C;  4DAM A;  1I50 H;  1VQL A;  2JA5 H;  2KHJ A;  1I94 Q;  4A3C H;  2JE6 I;  4IFD J;  1L1O C;  1AE3 A;  2AHO B;  1FL0 A;  2IHF A;  1IBK Q;  4JOI A;  4LUZ A;  4R4O A;  2R7Z G;  1A63 A;  4JI1 L;  5FLM G;  4BY7 G;  2VL6 A;  2UXB L;  2WB1 G;  5AJ3 L;  1Y1V H;  5HY6 A;  5C44 H;  4DV1 Q;  4ME3 A;  1VQE A;  4IOA A;  4DR2 L;  2ZJP A;  4B3R L;  4JI0 L;  2IT1 A;  1NMF A;  5GAH C;  2NVX H;  4NXN L;  3PO3 G;  5IY0 A;  1K73 C;  2ZJQ A;  2R7F A;  4JYA Q;  4YWM A;  3HFZ B;  3I4N H;  3S1Q H;  4JI1 Q;  1X55 A;  2K5N A;  4MZ9 A;  2PMZ E;  4A3M H;  3M3Y H;  4FDB A;  1PH7 A;  3G48 A;  2NZH A;  1PYB A;  4DV3 L;  4DV5 L;  2A19 A;  2D0O A;  4DR2 Q;  1VQO A;  4B3R Q;  1HNW L;  2VY3 A;  3CCR A;  4BXX G;  1EIY B;  4DV6 L;  1X3G A;  4YCW A;  4NXN Q;  3GD7 A;  1VS0 A;  4OWT B;  3RLN A;  1NJI C;  1Q8K A;  2HQL A;  3RN5 A;  2AWN A;  1YJW A;  3OYY A;  3UE1 A;  3L7Z C;  5FLX c;  1TWC H;  3CC2 A;  3KJO A;  4TQU S;  1QZG A;  1YHB A;  3CC4 A;  4LWC A;  4L5R C;  1OXV A;  2OQ0 A;  2RCN A;  3U4V A;  1V9P A;  4HJ8 A;  4A3J H;  1KRT A;  2E8G A;  1SLJ A;  2EXD A;  4B3S L;  4WJ3 M;  3G6E A;  4AIM A;  1C7Y A;  1IZ6 A;  3FKI H;  5IE8 A;  1Z9F A;  1Q82 C;  1ASY A;  4A3L G;  2R93 H;  4DK3 C;  1N9W A;  4IPH A;  4LF7 L;  1UWV A;  5JEA G;  5GAD C;  1KD1 C;  5FJ8 H;  3K8A A;  2ZTD A;  2D62 A;  4A3D G;  1CKO A;  2UUC Q;  1VQN A;  4OWW B;  1NMG A;  3PUW A;  4LUO A;  4L5T A;  4A3F G;  2BH8 A;  5M5Y H;  1YI2 A;  1QUQ A;  4B3S Q;  5JJL A;  1X56 A;  4YCU A;  3T1Y Q;  1CSQ A;  1X54 A;  3M4P A;  4P73 A;  1B8A A;  2R93 G;  3HOX G;  5IWA L;  3CAM A;  3J81 i;  4IOC A;  3RZO H;  5IYD G;  5GAE C;  2EIF A;  1RL2 A;  1E24 A;  1YIJ A;  2A8V A;  4JI4 L;  4HJA A;  3IRB A;  5H1S E;  1OXT A;  3ERS X;  2JA9 A;  2ALY B;  2JJQ A;  4A3I H;  5IYC G;  1N8R C;  3GTQ H;  4OX9 L;  3GTO H;  5HGQ A;  1FVI A;  3E0E A;  5IWA Q;  3PCO B;  5JJK A;  2V1C C;  3OW2 A;  2K5V A;  4LF5 L;  2ID0 A;  3I4M H;  5C4J H;  3CME A;  4JI4 Q;  1T9H A;  3D0F A;  3EN2 A;  3PO2 H;  2AKW B;  1VQ5 A;  4DUY L;  4A3E H;  2UUB L;  3HOW G;  3TRE A;  4QJF A;  4NXM L;  4Y52 H;  3T1H L;  1LM0 A;  1PFS A;  1C9O A;  4DUZ L;  1U0L A;  1VQP A;  4X66 Q;  2I0Q A;  1XTD A;  3KOJ A;  3OTO Q;  4HJ7 A;  4PZ6 A;  4DR1 L;  3S15 H;  2RHS B;  3HOZ G;  4BBS H;  2K5H A;  4LF5 Q;  4A3K G;  4LFB Q;  3RN2 A;  1Z47 A;  2UXC L;  3CCS A;  4R4I A;  4LF4 L;  4DK6 C;  1IBL Q;  2K4K A;  3W1B A;  4JG2 A;  4DUY Q;  1QVF A;  2PI2 A;  3TRZ A;  2N78 A;  2UUB Q;  1PVO A;  1AH9 A;  3T1H Q;  1X9N A;  5M3M H;  1FGU A;  4P75 A;  4DUZ Q;  4GNX C;  3KDF A;  5GQO A;  1HNZ L;  1IYJ B;  1VQB A;  2PQA A;  4DKA C;  4DR1 Q;  3RNU A;  2F4V Q;  1E1T A;  4JI3 L;  2I5M X;  4A76 A;  1YZ6 A;  3BJU A;  3GDE A;  4HID A;  1PH5 A;  4LNQ A;  2N49 A;  3HOV H;  4A93 G;  2UXC Q;  1TWH H;  1VQH A;  4GN4 B;  3UE0 A;  2VQE L;  4GOP B;  2KHI A;  1KHI A;  4BBR G;  2JEA I;  2R7Z H;  2R92 H;  2K75 A;  1I94 L;  4PZ8 A;  4BY7 H;  1UE1 A;  2CFM A;  4IPD A;  3M85 A;  2KCT A;  4GS3 A;  2VUM G;  2VNU D;  5C3E G;  4JI3 Q;  4HIK A;  1WFQ A;  2JA7 G;  1QZH A;  2FXQ A;  5C0X G;  2VS1 A;  3ULJ A;  2VQE Q;  1YBY A;  2Y0S E;  3PO3 H;  3M4O H;  3S2H H;  4XTC S;  1PYS B;  2NVY H;  1EQQ A;  3GTG H;  3PUX A;  1NE3 A;  1ASZ A;  1BVS A;  4POG A;  5IP7 G;  2NVT H;  4JYA L;  1V1Q A;  1BKB A;  4O2D A;  3UDI A;  2MNA A;  3ULP A;  2JA8 H;  1VQM A;  1I5F A;  4BXX H;  3NEN A;  1SRU A;  3S1M H;  4MTN A;  3CCU A;  1W2B A;  4GNX A;  3W5O A;  1OTC A;  4TVA B;  4LW1 A;  2ZM6 Q;  1PHJ A;  3CD6 A;  4IFD G;  1Q46 A;  1WCM H;  2R6G A;  1X6O A;  4Y7N H;  4A3M G;  1UEB A;  4H02 A;  3H0G G;  4JV5 L;  3HKS A;  4AYB E;  5IT9 c;  1CKN B;  1LTL A;  3CPF A;  2Y0S G;  1W3S A;  4OO1 G;  2HIX A;  1K83 H;  4QIW E;  3W1G A;  4R4Q A;  2VQF L;  4JBW A;  1SN8 A;  3S14 H;  2CKZ B;  1G6P A;  1KAW A;  1X3E A;  4JCV E;  3E9H A;  1O7I A;  1IL2 A;  3STB D;  1EOV A;  4A3L H;  1K0R A;  3U50 C;  3L2P A;  3HOY G;  4JV5 Q;  4KI0 A;  4PMW A;  3GTJ H;  3K0X A;  3S16 H;  5JJI A;  1N36 Q;  1PA6 A;  2D0P A;  3S1N H;  1A0I A;  1L1O A;  3NEM A;  2VQF Q;  1L0W A;  4JI7 Q;  2JEB I;  4AYB G;  1WI5 A;  4DV7 L;  3CCE A;  2UUC L;  4DR3 L;  1MJE A;  1FJG L;  3PF4 A;  1GVP A;  2GN5 A;  3KFU A;  2WP8 J;  1B7Y B;  3DM3 A;  2B63 G;  4C3J H;  4RG1 A;  1YJ9 A;  1XMO Q;  1NY4 A;  2JA6 G;  3HOX H;  1HZB A;  2Q2H A;  1BBW A;  3FP9 A;  3CXC A;  3CMA A;  1K9M C;  1QVC A;  1SE8 A;  3MXN B;  3UDX A;  1HZ9 A;  4IO9 A;  2QA4 A;  5C44 G;  3T1Y L;  4IJH A;  1Y14 B;  3BZC A;  1VQ4 A;  1PV4 A;  1TXY A;  1N32 L;  2ASB A;  2H5X A;  2ZTE A;  1E1O A;  3PIO A;  4DV7 Q;  5IYC H;  4DR3 Q;  1FJG Q;  1XPU A;  2Q2I A;  1HZA A;  3HOU G;  3J81 j;  4OWX B;  2HT1 A;  3BZK A;  4A75 A;  1N34 Q;  3STB C;  1N33 L;  1AE2 A;  1S3O A;  1PH2 A;  4R4T A;  2KCM A;  2OQK A;  1PH6 A;  1YHQ A;  3F2B A;  1N32 Q;  4X65 L;  3M4Q A;  1WYD A;  3PUY A;  4IPG A;  3HOW H;  2UXD L;  1JB7 A;  4C3H H;  3TQY A;  1E7Z A;  1QUQ B;  2XGT A;  1Y1W G;  4JC0 A;  1N33 Q;  1R9T H;  1LUZ A;  3HOZ H;  5EAY A;  4A3G H;  4A3K H;  1JJC B;  2GVB A;  4X66 L;  4JBM A;  3OTO L;  4DAY B;  4X65 Q;  3FHW A;  4LFB L;  3TEH B;  1MKH A;  1UE7 A;  2GVA A;  4J15 A;  4JI8 Q;  1SRO A;  4B3T L;  2UXD Q;  4P74 A;  1IBL L;  4UY8 C;  3WWV A;  4DV4 L;  4GOP C;  1X3F A;  2B3G A;  5GAG C;  4X62 Q;  4UP8 A;  1KQS A;  1HZC A;  4BY1 H;  1VQD A;  5C0X I;  1TWA H;  2F3I A;  1PH3 A;  2LSS A;  4YY3 L;  4HIO A;  3JC6 6;  1E3P A;  2OWO A;  3GTL H;  1M1K C;  2F4V L;  3SGI A;  3DLL A;  1DGS A;  4PG3 A;  1KIX A;  3PUZ A;  4KLK A;  1VQ7 A;  2XTI A;  4A3B G;  1HR0 Q;  4BBR H;  2PNH A;  5LMN L;  1S40 A;  4B3T Q;  4O0A A;  4DV2 Q;  1XPR A;  4DV4 Q;  2QEX A;  2R7D A;  1BBU A;  4NPS A;  1VQA A;  5BR8 L;  3G71 A;  4JI6 Q;  5K36 G;  2IHE A;  3GO5 A;  1KRS A;  3TS0 A;  2DGY A;  2NN6 G;  5C3E H;  1PH4 A;  4YHH L;  1VQK A;  1XJV A;  4IFD I;  4YY3 Q;  3CP0 A;  2CQO A;  4XIG S;  2AMC B;  2N8N A;  5IYB G;  4MNO A;  3CPW A;  5M3F G;  4QY7 A;  5LMN Q;  2NZO A;  2JQO A;  3L0O A;  1NTG A;  3KF6 A;  3AFP A;  1K8A C;  2ZJR A;  2UU9 L;  4OO1 I;  2K50 A;  1VQI A;  5IP7 H;  1QVG A;  5BR8 Q;  4QQB X;  4AQY L;  4JI2 Q;  1TWF H;  1G29 1;  2WAQ E;  3F1Z A;  4C3I H;  5FLM H;  3A5Z B;  4LFA L;  1HJP A;  3K7U C;  4YHH Q;  1IBM Q;  3KDF B;  4DNI A;  4R1J A;  2PQA B;  3BU2 A;  3NEL A;  4DV0 L;  2HHH Q;  4B3M Q;  1XNR L;  1MJC A;  1VQC A;  3S24 A;  5M5X H;  2YU9 H;  3EIV A;  3GTM H;  4K0K L;  1M90 C;  1LYL A;  2UU9 Q;  2UXB Q;  3RLF A;  5IP9 G;  4POF A;  2VW9 A;  2ZM6 L;  4AQY Q;  2YTX A;  1Q81 C;  3AYH B;  4LFA Q;  1Q12 A;  3F8T A;  3I56 A;  3CF5 A;  3CCJ A;  1KC8 C;  4GLA C;  4P72 A;  3CCV A;  2MFI A;  4AH6 A;  3PF5 A;  4DV0 Q;  1EYG A;  4BBS G;  2YTY A;  3E9I A;  4UP7 A;  2UUA L;  1NBW A;  1XNR Q;  3F2D A;  1KXL A;  4K0K Q;  2AWO A;  4DPG A;  4YCV A;  1XNQ L;  1IXR A;  3HOY H;  1XPO A;  1CSP A;  2YTV A;  5LMU L;  4QL5 A;  3EBE A;  4IPC A;  4RMF A;  3M7N A;  2IX0 A;  1GD7 A;  3HOV G;  2I5L X;  1N36 L;  2UUA Q;  1P8L A;  1UE5 A;  1K3R A;  4JI7 L;  4GNX B;  1XNQ Q;  4HJ5 A;  1GM5 A;  2B63 H;  2CWP A;  2R92 G;  3TS2 A;  1CKN A;  1VQF A;  3ER0 A;  3I2Z A;  1J5E L;  4JBK A;  2JA6 H;  1WJJ A;  5LMU Q;  3J7A 5;  4X6A H;  5C4X G;  4HIM A;  1GKH A;  1XMO L;  3PIP A;  2E2H H;  2E2I H;  4JI5 L;  3U4Z A;  3CCM A;  4A3D H;  2ES2 A;  1EIF A;  1H95 A;  1HH2 P;  1J6Q A;  4IJL A;  3HOU H;  4ALP A;  3PGZ A;  2IX1 A;  4A3F H;  2JA5 G;  4UP9 A;  2I5H A;  3CQZ H;  4X64 L;  4DR5 L;  3RZD H;  1J5E Q;  4A3C G;  5AJ3 Q;  1SR3 A;  2HIV A;  3A0J A;  3M9B A;  3PSI A;  3S2D H;  4GKK L;  2K52 A;  3HKZ E;  3K80 C;  1I3Q H;  1N34 L;  4LF8 L;  2JA8 G;  3KLW A;  1Y1V G;  2F52 A;  4JI0 Q;  4JI5 Q;  2PI2 E;  3Q8D A;  5IYD H;  1U5K A;  4LUV A;  1P16 A;  1L1O B;  4L5S A;  3I4O A;  3JAM i;  2Z0S A;  1D8L A;  1WCM G;  5ELO A;  2QGQ A;  3LGJ A;  4X64 Q;  1B70 B;  4GLV B;  3A74 A;  4DR5 Q;  1Y1W H;  3CC7 A;  1MIU A;  2MO1 A;  4EX5 A;  2BH2 A;  4DV3 Q;  2EQS A;  4DV5 Q;  3I4N G;  4GKJ L;  1KL9 A;  1HR0 W;  5JEA J;  1VQ8 A;  4GKK Q;  4LF8 Q;  1HNW Q;  2A1A A;  4OON A;  4DR7 L;  1YHA A;  4DV6 Q;  1CKM A;  1G51 A;  2YYZ A;  3S17 H;  1OXU A;  3HKZ G;  3K81 C;  1A8V A;  2LXK A;  2NN6 I;  4JI8 L;  3J80 i;  4R4C A;  1EQR A;  2MO0 A;  2C35 B;  1RIP A;  2OCE A;  3K7A H;  1YIT A;  4GKJ Q;  5LMN W;  4X62 L;  5GRO A;  3A5U A;  1EWI A;  4GN5 A;  1JJ2 A;  2KBN A;  4A3B H;  4DR7 Q;  2YV5 A;  1YVC A;  2JK8 A;  2WFW A;  2MQH A;  3S1R H;  4LF9 L;  3KYH C;  1HR0 L;  1PH9 A;  3GTK H;  4A3J G;  3H3V I;  4DR4 L;  4LF7 Q;  4KHP L;  3JAM c;  4DV2 L;  3F2C A;  4LF6 L;  3CCL A;  4JI6 L;  3FKI G;  2DUD A;  3PV0 A;  2N3S A;  1Q86 C;  5IYB H;  1PH8 A;  1Q1B A;  1GO3 E;  5M3F H;  5FJ8 G;  1XMQ L;  2Q2U A;  3AQQ A;  1A62 A;  5ELN A;  4A93 H;  1SFO H;  3RLO A;  4LF9 Q;  4DR6 L;  3GTP H;  2IY5 B;  3UDF A;  1Q7Y C;  4DR4 Q;  4KHP Q;  1VQ9 A;  4LF6 Q;  1I6H H;  3I7F A;  3G4S A;  2CCZ A;  4JBJ A;  4JI2 L;  2ATW A;  3J80 c;  1C0A A;  1JJG A;  3H3V H;  1VCI A;  3I55 A;  2VUM H;  1HNX L;  2OTL A;  1IBM L;  1XMQ Q;  2JA7 H;  4B3M L;  2HHH L;  1K8G A;  4DR6 Q;  4YWK A;  2Z6K C;  2E5L L;  5IP9 H;  4OX9 Q;  3CCQ A;  4A3I G;  1S72 A;  4BA1 I;  1OXS C;  3AFQ A;  2NVQ H;  4C2M H;  3U58 A;  4A3G G;  2CWA A;  4KHZ A;  3H15 A;  4P71 A;  3CW2 C;  1HNX Q;  2ZTC A;  4APV A;  3J81 c;  1EUJ A;  4JOI C;  2BA0 A;  3KJP A;  3D31 A;  1X65 A;  3I4M G;  2L15 A;  4GOP A;  1V43 A;  4QGU A;  1L2F A;  2E5L Q;  4NXM Q;  2OTJ A;  3PO2 G;  4L5Q A;  1EFW A;  5M5W H;  1UE6 A;  1VQ6 A;  3KF6 B;  4A3E G;  1SMX A;  2VZA A;  1VQJ A;  1D7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...