4A3IG

Rna polymerase ii binary complex with dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3iG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3iG01
2E2JH 3S2DH 4POFA 3GTJH 4LW1A 2R7ZH 4JYAQ 1YIJA 5HGQA 3A5ZB 3HOVG 2AHOB 3ULJA 4KHPL 4HIDA 5HY6A 4OX9Q 4H02A 1RIPA 4UP7A 2N8NA 3PUYA 2LXKA 4QL5A 2FXQA 2ZJQA 4DR3L 1E1TA 3GTQH 4IFDI 5M5XH 4B3TL 1C7YA 2VNUD 3HOWH 3CCSA 4IOAA 1L1OC 1EQQA 2I0QA 1J5EQ 1Z9FA 4A3EG 2PNHA 2NN6I 4A3LG 4GOPB 4A3CG 2E2HH 1XPOA 3CAMA 2GVBA 3AEVA 1S3OA 2YV5A 2WAQE 5E7NA 4LFCL 5M3FG 1OXXK 4DV0Q 1YZ6A 1Y1WH 1CKMA 2VUMH 5AJ3Q 2JA9A 1N33L 1XNRL 5GAHC 2NZHA 4JI5L 1HR0W 2E8GA 4AQYQ 3I4MH 3FKIG 2DGYA 2QEXA 2Q2IA 1R9TH 3CP0A 1VQPA 2F52A 5C3EH 1G291 4DV5L 2CFMA 5IP9G 2VQFL 1IBLL 3L2PA 1XTDA 2HT1A 2I5MX 2MFIA 1KHIA 3OTOQ 2ZJPA 1FJGQ 3JC66 1WYDA 3KJPA 3RLFA 1C0AA 1BBUA 2ZM6L 1YJWA 1IBKL 2HIVA 2NVYH 2UXDQ 2VQEQ 1PYSB 3M85A 1CKOA 3HOZG 1X54A 3HOVH 1X56A 2PQAA 1QVGA 1V1QA 2I5LX 4DV2L 3E9IA 3CCRA 2UXCQ 2GN5A 1SLJA 4O2DA 1V9PA 1S40A 4JYAL 4JI3L 2MQHA 4JV5Q 4LF9Q 1JJCB 4JBMA 3J80c 3PIPA 3WWVA 2OQ0A 3AQQA 4IFDJ 4OX9L 1PH4A 4YWKA 2IHFA 4YY3L 4A3EH 4DV1Q 4A3LH 2BH8A 4A3CH 4ALPA 4BBSG 2LSSA 1J6QA 4UY8C 4NXNQ 4O0AA 1JE5A 2K75A 5GAGC 5M3FH 2YTYA 1HNXQ 4BY1G 3KDFA 1JJ2A 2D0OA 1B8AA 4GKKQ 1E22A 4BXXG 4DV4Q 4DV6Q 1VQDA 3FKIH 1D7QA 2MO0A 1Q1EA 1SRUA 1ASYA 3GTGH 1HZ9A 1E7ZA 4FDBA 3OW2A 3KYHC 4JG2A 1VQ9A 2BA1A 5IP9H 5K36G 1EUJA 1O7IA 4YWMA 4LF6Q 3F2DA 4L5QA 2VL6A 4JI0Q 1A62A 2CKZB 4X66L 5IYDG 1XMQQ 3F8TA 4YWLA 3UDGA 4JC0A 1P8LA 2ZTCA 2E5LQ 4R4OA 5JJIA 1IBML 3PO2G 3S1MH 1VQCA 1KC8C 3S15H 2Q2UA 4A3BG 3JAMi 2ES2A 2UUBL 4C3JH 4HJ5A 3S24A 2QGQA 3H15A 4L5RC 4JI1Q 4DAMA 2KCMA 4P75A 5FJ8G 4HJ8A 2IT1A 3CCUA 2N3SA 2R93G 3HOYG 2PMZE 4PZ7A 5GADC 1MJCA 3AYHB 2BH2A 1I5FA 4C3IH 1BVSA 4DUZQ 3S14H 3ULLA 4OXPA 4BXXH 5M3MG 3CCEA 5IWAL 4A93H 1KQSA 2UUCQ 4P71A 1M1KC 3UDFA 1QZGA 2IX0A 4WJ3M 4LFBL 4DV4L 4DV6L 4K0KL 4GN4B 1HJPA 4LF4Q 1X65A 2H5XA 2JA6G 1YEZA 4UPAA 4YHHQ 3J81j 4L5SA 3M7NA 4QIWE 4B3RL 5IYDH 1X55A 3GTPH 1C9OA 1ASZA 3KFUA 3I56A 3GTMH 1VQEA 4YCUA 3M3YH 3M4QA 1VQHA 4IPGA 1N9WA 1UE7A 4LF6L 2IY5B 1K8AC 1UE1A 2ASBA 2PI2A 2JEAI 3PO2H 3CCVA 3CPWA 1XMQL 3PCOB 2HQLA 1A63A 3PSIA 4Y52H 3BJUA 4DR6L 2KENA 2E5LL 4RG1A 4DNIA 2ZTEA 3PGZA 1VS0A 2HIXA 1YJNA 5GAEC 1I6HH 4OONA 5FJ8H 1N36Q 3HOUH 5J3BA 2K14A 4JI7Q 4P73A 1I94Q 2R93H 3HOYH 4L5TA 1L0WA 4Y7NH 2K5VA 2WB1G 5LMUL 3G6EA 1VQJA 4BY7G 2UXBL 4NXMQ 3B6YA 2JJQA 3D0FA 2YYZA 4AIMA 4JI2Q 1CSPA 1GVPA 4BBRG 1HZAA 1FGUA 4IJHA 4JOIA 2NVXH 1KL9A 1HH2P 1YHBA 1YNXA 4A75A 1XNQL 3S17H 4PZ6A 1BBWA 1JT8A 1WI5A 4A3KG 1VQOA 3PV0A 1XMOQ 1HNZQ 3M4PA 5C4XG 3J81i 1N34Q 4JI4L 4A3IG 4DR5Q 3PIOA 5C44G 3JAMc 1EIFA 4DR7Q 5M5YH 4JI8Q 2LXJA 1Z47A 3EN2A 1M90C 3IRBA 3RLNA 4B3ML 2ZTDA 4LWCA 1SFOH 1VQ7A 2JA6H 4X62L 5IT9c 1A0IA 4DV3Q 4A4IA 2BA0A 3H3VI 5DLQE 3A0JA 3H0GG 3UE0A 1N8RC 1K9MC 3H3VH 2OQKA 5M5WH 3E0EA 4OWXB 3HOXG 1IYJB 4DUYQ 4LF4L 1Y14B 4DV7Q 4A3DG 3KF6B 3PO3G 2PI2E 3E9HA 3W1GA 2F4VQ 1FVIA 3CQZH 4LFAQ 2B29A 1B7YB 5LMNL 4GOPA 4JI6L 1PH2A 3VDYA 1VQ5A 2XTIA 1NE3A 2Y0SE 3PUVA 1H95A 3S2HH 1VQIA 4IJLA 2GVAA 2B63G 1XPRA 1PHJA 4LF7Q 4MZ9A 3NELA 2CCZA 1IZ6A 3F1ZA 4HIKA 4A3FG 2MO1A 4GNXB 1PH1A 3RN2A 4B3SQ 5C4JH 1WJJA 3MXNB 4IPCA 2EXDA 4DPGA 1XJVA 1YHQA 3U4VA 3HKZG 4BA2I 2OCEA 1EWIA 3S1QH 4JCVE 3T1YQ 1GO3E 5JEAG 1I94L 3W1BA 1PV4A 4DKAC 2UUAQ 4DR2Q 4XTCS 4NB3A 2HHHQ 1J5EL 4C3HH 4DK6C 2QA4A 1X6OA 5C4XH 1AE2A 4NXML 2DUDA 3CXCA 3AFQA 3M4OH 1NBWA 3A5UA 5ELOA 4OO1G 4JBJA 3CCLA 4QJFA 2UU9Q 2D0PA 3CD6A 4DV0L 1XMOL 4GOPC 2RHSB 1Q7YC 1HNZL 1G51A 1QVFA 5AJ3L 4X6AH 1K73C 5GQOA 2D62A 1HNWQ 4AQYL 4JBKA 3DM3A 3H0GH 1K8GA 1PA6A 5IE8A 2VY3A 3CCJA 5JJLA 3HOXH 4EX5A 1VQ4A 3OYYA 2R7FA 1EIYB 1HR0Q 2ATWA 3A74A 4YCVA 1UWVA 3OTOL 2YTVA 3HOZH 1PH5A 5LMNW 2OTLA 1FJGL 3RLOA 4AYBG 3PF5A 3J81c 1Q81C 2F4VL 1I3QH 2UXDL 5GROA 2VQEL 2JQOA 1NY4A 3CW2C 4UP8A 1CKNB 4HJ9A 2C35B 2NZOA 2CWAA 4QY7A 3T1HQ 2RF4A 1TWCH 3RNUA 3GTOH 2WAQG 1N32Q 2UXCL 1YI2A 4QGUA 1KD1C 5IP7G 1W3SA 1X3GA 1X3FA 4MNOA 1WCMG 4R4CA 2MNAA 4LF9L 2R92G 4DR4Q 1VCIA 2AWOA 4BBSH 4JV5L 1VQ8A 1YJ9A 1EOVA 1YVCA 2Z6KA 3K8AA 4KHPQ 1UE6A 5BR8Q 4BY1H 3NENA 4XIGS 1GD7A 1E1OA 4X65Q 5FLXc 4DV1L 1PH3A 1EFWA 2RCNA 1L1OB 4KHZA 4J15A 2ID0A 2CWPA 4DR3Q 3ER0A 2R7ZG 4NXNL 1G6PA 3UE1A 2HHHL 1HNXL 2R6GA 1X9NA 4LF5Q 2KCTA 4GKKL 1Q1BA 1IL2A 3CC4A 2K52A 1CUKA 4RMFA 4IFDG 1PVOA 1Q86C 2ZJRA 1TXYA 2OWOA 3TEHB 2JA8G 1VQAA 1QZHA 1N33Q 1EQRA 1Q82C 4JI0L 4JI5Q 1K3RA 2NVTH 2RHQB 2CQOA 4A3BH 1K0RA 1U5KA 1JMCA 1VQ6A 3HKSA 1K83H 1JJGA 4C2MH 3U50C 2VQFQ 1IBLQ 3CPFA 2R7DA 3I4MG 4QQBX 4HIOA 4EQ5A 4KI0A 3I2ZA 4IPHA 1Y1VG 1OXVA 4A3GG 1KXLA 1GKHA 2L15A 2VZAA 2AWNA 2EQSA 1CSQA 4X64Q 2IX1A 3CC2A 2R92H 2ZM6Q 3S16H 1SN8A 1IBKQ 3TRZA 3KOJA 3CCMA 4JI1L 3L7ZC 3T1HL 1WOCA 2WFWA 4R1JA 1X3EA 5JEAJ 4AH6A 4R4QA 3G4SA 4IO9A 1QUQB 1LUZA 1N32L 4DV2Q 3J7ZC 4DR4L 3KF8B 2K50A 5M3MH 4JI3Q 5JJKA 3ERSX 3PUXA 3Q8DA 3GDEA 1IXRA 3CCQA 4GKJQ 5BR8L 4YCWA 3I4OA 4DUZL 4X65L 3TS2A 4YY3Q 3U58A 2YU9H 1AH9A 3GD7A 2Q2TA 4OWTB 1VQFA 4LUZA 2UUCL 2JEBI 4AYBE 3K80C 4LF5L 1FL0A 2JA8H 3LGJA 1PFSA 1OTCA 3I4NG 1P16A 4A3JG 1NMFA 1TWGH 3SGIA 3J7A5 4YHHL 2PQAB 4LUVA 3S1RH 2K4KA 2N78A 4R4TA 1T9HA 3PF4A 1QUQA 3G48A 5FLMG 4HJAA 4A76A 4JOIC 1PH7A 1XPUA 1E3PA 5EAYA 1SR3A 5C0XG 3M9BA 3GTLH 3BU2A 4P74A 4OWWB 3EIVA 4GN3B 1Y1VH 4A3GH 1EYGA 4X66Q 1VQNA 4KLKA 4LUOA 4A3MG 2B3GA 3KLWA 3L0OA 4BY7H 1B70B 2NVQH 2KHIA 1Q8KA 1IBMQ 3CMAA 3RZDH 1S72A 4PMWA 4BBRH 3MEFA 3TREA 4DAYB 4X64L 1N36L 3KDFB 4IOCA 4JI7L 2OTJA 1NMGA 3I7FA 4P72A 3S1NH 2KBNA 3I55A 4DK3C 4A3KH 2UUBQ 2K5NA 4TQUS 1Q12A 3GO5A 2YTXA 3KF6A 2JA5G 4JI2L 1VQBA 4A3IH 4DR1Q 3CMEA 1U0LA 4NPSA 3K0XA 3EBEA 5C44H 2VS1A 2WP8J 5IYCG 1LTLA 1VQLA 3NBHB 3AFPA 1E24A 1N34L 3PUWA 3STBC 4GKJL 3K7UC 1VQGA 4APVA 4DR5L 5IYBG 2A19A 2Z0SA 1BKBA 4DR7L 3G71A 4JI8L 4JBWA 1NJIC 1TWFH 4GNXA 4A3JH 3I4NH 1DGSA 2IHEA 4A3DH 3PO3H 3NEMA 1V43A 4PZ8A 3U4ZA 5IWAQ 4DV3L 1NTGA 3F2CA 4LF8Q 4TVAB 2XGTA 3HFZB 4DUYL 2WB1E 5FLMH 5C0XI 1MKHA 4DV7L 2V1CC 1LYLA 2JA7G 4K0KQ 4LFBQ 4A93G 3FHWA 1PH6A 2B63H 3K81C 3DLLA 4LFAL 1KRTA 3BZCA 2N49A 4B3RQ 2JE6I 3ZJYC 4A3FH 1MIUA 4WJ4A 1OXUA 1UEBA 1Q46A 4A3MH 5H1SE 5ELNA 1SE8A 1HZCA 3GTKH 4LF7L 1PYBA 1HZBA 3UDXA 4LNQA 1I50H 3CC7A 4MTNA 2K5HA 1VQMA 4IPDA 4B3SL 1UE5A 1YHAA 2JK8A 3CF5A 4DR6Q 1SROA 2AKWB 1AE3A 1SMXA 3FP9A 4GNXC 3RR5A 3T1YL 2JA5H 2VW9A 4UP9A 4OO1I 4B3TQ 1A8VA 3W5OA 4HIMA 4DR2L 3ULPA 1KRSA 1VQKA 2UUAL 5IYCH 4POGA 5LMUQ 1D8LA 1OXTA 2UXBQ 3K7AH 1KAWA 4DR1L 1YITA 5IYBH 3PUZA 2UU9L 2ALYB 3HOUG 3RN5A 1XNQQ 3HOWG 1RL2A 1CKNA 1OXSC 2I5HA 1JB7A 4LFCQ 2Y0SG 1PH8A 3F2BA 1L2FA 2E2IH 1HNWL 3RZOH 3UDIA 1W2BA 2NN6G 1XNRQ 4JI4Q 1WFQA 4GLAC 3ICEA 1TWAH 3BZKA 2AMCB 4BA1I 2F3IA 3HKZE 1LM0A 3KJOA 1Y1WG 2JA7H 2A8VA 2Z6KC 1PH9A 4B3MQ 1HR0L 2VUMG 3TQYA 1YBYA 5C0XJ 4DV5Q 4LF8L 4X62Q 1L1OA 2KHJA 2Q2HA 3J80i 3TS0A 4GS3A 4HJ7A 5IY0A 2A1AA 5C3EG 5IP7H 4GN5A 4R4IA 1WCMH 3STBD 1MJEA 1QVCA 4GLVB 5LMNQ 4ME3A 4PG3A 4GLXA 1GM5A 4JI6Q 2EIFA 1KIXA 1TWHH 3D31A
chains in the Genus database with same CATH superfamily
1JC7A 2J7ZA 2E2JH 4POFA 2ZJTA 5FPRA 2I80A 2R7ZH 2WINB 4O4LF 3A5ZB 2I8CA 3HOVG 2RGRA 4I55F 2Z9HA 4H02A 4UP7A 3RB0A 2NVYB 1EU4A 1KLGD 4IFDI 4LF5H 1Y8OB 1LTID 3HOVB 1B6RA 1TS3A 4J9KA 3HOWH 4Q0FA 4QWBA 1Y1WA 2DNEA 1J5EQ 3OSNA 2EY1A 3CRLC 3NWSA 4RNNA 2E2HH 4EG0A 1SAPA 4O42A 4ED1A 2NYZD 5KKNB 4DK1A 3J81W 4RB0A 2R8JA 2B2UC 2EYPA 1XNRL 1N33L 5KT5A 2EPBA 5GAHC 1HR0W 3I4MH 1IBLH 1R9TH 3CP0A 2G5DA 5IOCA 3M4OB 4R8UB 1G291 2CFMA 3L2PA 2D2CC 3RFCA 3WO1A 1Q8IA 1KHIA 3OTOQ 1ZYRC 2ZJPA 4JUZA 1FJGQ 3GIPA 1WYDA 5G3LD 1V4YA 5I47A 1DXMA 3MFHA 3WO0A 4RAYA 4UCTA 5KFCA 4Q43A 4YR0A 2L5TA 4TUYF 3KXYT 2LMCB 1V1QA 3E9IA 4GKJH 3R2IA 2GN5A 4O2DA 4DL7A 4JYAL 5IT9L 4C3JG 4EGQA 3S1MB 4JV5Q 5KT2A 3RGXA 2OQ0A 1BDOA 2KA7A 3BDCA 4IFDJ 1GSHA 3K57A 4YWKA 4C3JB 1VKZA 2F0GA 3NK9A 4A3CH 1U4LA 1XXGA 2JP1A 2LSSA 1J6QA 4UY8C 4NXNQ 4O0AA 5GAGC 3J7AK 2F0MA 2YTYA 4BY1G 1HNXQ 5A35A 1QE6A 4K2LA 2D0OA 5KGUA 4O3SA 3HXLA 2XRSD 4BY1B 4E6IA 3GTGH 1E7ZA 1HZ9A 4FDBA 2EYFA 1A9XA 1VQ9A 1PXUA 1QILA 3CRKC 4RKLA 1HTLD 5K36G 4LF6Q 3F2DA 1RJRA 3BDLA 4JI0Q 1A15A 2CW0D 2EJMA 4QIWA 1IBMH 3O13A 4PQXA 4YWLA 4H0LC 1FYCA 2BQUA 5LXTF 1GUOA 2L11A 2MGSA 5I9OA 3RB4A 2CH4A 1SCUB 2R84A 1MGSA 2XWJB 2V4RA 4HJ5A 2XN9C 1GLVA 4HJ8A 1DOKA 2L12A 4CGYB 3HOYG 4U673 3EFXD 1HPCA 3VYUA 1AUVA 2GPSA 3AYHB 4RH6A 3HOYB 5IGBA 4RB2C 4C3IH 5ISRA 1BVSA 1A3UA 2PBZA 2WKCA 1DJRD 3NPPA 5IWAL 4DXFA 1KQSA 3EYYA 1Z7TA 2O4XA 4P71A 4GC6A 1JWUD 2K28A 2PVPA 3QZ7A 5C5MA 4WJ3M 4B3RH 2ZXPA 2NWGA 2F0OA 3TMEA 1SYDA 2W9AA 2IW3A 4QIWE 5LP6F 5IYDH 5M5YB 5A2QE 2YU9B 1YNJD 5FLXL 1HFGA 2PYKA 1S5CD 4EYHB 4IPGA 1SFOB 2C22A 1N9WA 1W6JA 4DR6H 5KFJA 5F2DA 4K5XA 3LX0A 2KUMA 3Q23A 2KENA 4RG1A 2F0QA 2QKIC 3S1RB 2NTTA 1YJNA 5GAEC 4OONA 2UXBH 2NVXA 4JVZA 3KTMA 3HOUH 2ICIA 4P73A 3E5NA 4IALA 4DGZA 1JCKB 1IHZA 1D2BA 4LH6A 4M9UA 2K5VA 5A2QW 3A54A 4NXMQ 1U4RA 3B6YA 2JJQA 3D0FA 1JWSD 2EYLA 3SDZA 4AIMA 4LFCH 1FGUA 3DMUA 4JOIA 2M00A 4A75A 1BBWA 5FOBB 4A3KG 5EBCA 1VQOA 1XMOQ 1PK8A 5EKLA 2PNRC 1N34Q 4M8AA 3PIOA 1PRTF 2F0LA 4IUPA 4A3KB 4DR7Q 5KNCA 5GONF 1Z47A 3IRBA 3RLNA 4TSSA 3E3XA 4LWCA 2JA6H 4X62L 5IT9c 2NVYA 2BA0A 2VUGA 3G6JB 3H3VH 3E0EA 1IOVA 4JI6H 1LT5D 3E9HA 1FVIA 4LFAQ 2B29A 5BN4A 3BG5A 5CB4F 3Q22A 1TWFB 4KKSA 1PH2A 3VDYA 1VQ5A 1NE3A 3S2HH 5IGFA 1E2WA 1XPRA 4OX9H 4MZ9A 3NELA 4EGJA 4K6LA 5IGGA 3F1ZA 4A3FG 4GNXB 2MCTA 5ELDA 1EYDA 1PTOF 1CT1D 2EXDA 3KBGA 4R8UA 3V6HA 3T1YQ 4A3FB 2EYHA 1GO3E 4Q44A 1I94L 3OWFA 3W1BA 4WFN3 1PV4A 2UUAQ 4XTCS 4NB3A 1BOSA 3SR1A 4C3HH 1J5EL 2XIGA 1X6OA 4E4TA 5T14A 5IIFA 1IKMA 5D1OB 4JBJA 1CQJB 4QJFA 1ESFA 3I12A 2D0PA 1Z2OX 3CD6A 4GOPC 1HNZL 4O3QA 5KNDA 3SK4A 5KT3A 3BABA 1EWHA 2VA2A 3H0GH 5JJLA 2CZGA 3GIQA 3HOXH 1AZPA 3I73A 2C5CA 2Z4HA 4KY6A 3OYYA 1HR0Q 2KECA 2ATWA 1L2ZA 3OTOL 3HOZH 1PH5A 4A2BA 1FJGL 2OTLA 3RLOA 2E2IB 2F4VL 3MZ5A 1NAPA 1I3QH 4TQSA 3GV7B 3L4JA 3V6JA 2DZDA 2UXCH 4DLKA 2GLTA 1WTWA 4LF9H 2CWAA 1TWCH 4XYQA 2AQ3B 3I4LA 1WCMG 4JV5L 1YNND 1VCIA 2W6MA 2A69C 3QOJA 2OLSA 1VQ8A 5JH7F 3K8AA 5E4XA 4KHPQ 4ECQA 4L1KA 1FD7D 1WCMB 1EQTA 1GD7A 5FLXc 4Q0YA 2VPQA 4DR3Q 4KN4C 2CWPA 2F0PA 1ZHSA 2XGQA 4NXNL 4GKKH 3G6VA 4DV6H 4P2CB 1HNXL 4IHJF 2R6GA 4DNTB 2W8LA 4ILWA 2KCTA 1CTMA 4RFBA 2FMMA 1IL2A 2O03A 2K52A 1XYIA 1PVOA 2JEIA 2JEJA 1TXYA 3WOFA 2OWOA 3J7AV 2EOTA 2JA8G 3GV3A 1XMQH 4FU0A 4ZQ3A 5KT7A 4JI0L 5DEHA 2E5LH 1PMRA 1K3RA 2W9CB 4EQNA 3Q2OA 2JA8B 4I4TF 4UCRA 4A3BH 2CQOA 1TWGB 5D14A 1K83H 2ZDQA 4PNYA 4EBCA 2VQFQ 3CPFA 1A3TA 1FNUA 4EQ5A 4KI0A 4A3GG 4OGQC 1KXLA 1OXVA 1GKHA 3SE7A 2PPBC 1M4VA 1CSQA 2EJGC 3JSLA 1W6KA 5KEEA 1TS5A 4YP3A 2R92H 1DCZA 1IYVA 3S16H 2MPMA 1STBA 3CCMA 4A3GB 4C1NI 3L7ZC 1J8IA 2WFWA 2K33A 4OL7A 4R1JA 1N32L 1KTKA 4AH6A 2FKLA 3H09A 4DV2Q 1KDBA 3QZ8A 5JOBA 2YU9A 3OSPA 2KCCA 1SFOA 2RSOA 5BN3A 2F3VA 4B3MH 5BR8L 4YCWA 3S1NB 1Y8NB 2FPGB 4X65L 1EYZA 3TS2A 2WE6A 1SSOA 1I4HA 3EJIA 2UUCH 4O2BF 2F0SA 4RUCA 4XDXA 5DQHA 3FPUB 4GZYC 2CHBD 4J9OA 1MSHA 1FL0A 4KD3A 5BPHA 1PFSA 3IFDA 3E5SA 3K6OA 3J7A5 4ED7A 1B6SA 4NW2A 1JORA 3PF4A 4JOIC 1PH7A 5C0XG 1GUTA 1SR3A 2YS6A 1S97A 2OXPA 4P74A 4OWWB 2C9OA 1WTOA 5EBDA 1STHA 5EGTA 1EZ1A 3OUZA 2W9BB 1N36H 1TR5A 4KTAA 1HCZA 4FF3A 4K8JA 4BBRH 4XQJA 4X64L 3M3YH 3RGZA 4DL2A 3KDFB 1PRTD 1NMGA 3I7FA 3BS1A 4I50F 1CA5A 4CDCC 2RQXA 1SE2A 3NXWA 2JA5G 2I87A 1LTRD 4RGOS 5LA6F 2W8KA 2JEFA 4NPSA 5KFSA 3EBEA 1TWFA 4DR5H 5IYCG 3IL8A 4RAUC 2JA5B 1N34L 4JI8H 1I4XA 3PUWA 3STBC 4RAZA 4DV3H 4DR7L 3G71A 2XCAA 2E74C 2HD3A 1NJIC 4GNXA 2TSSA 2HDMA 3I4NH 4EYIB 4YJ3F 3PO3H 2JEGA 5TSSA 3TP6A 3U4ZA 3CKIB 4LF8Q 5CV6A 1SBBB 4CDEC 1SE3A 3HFZB 2OT2A 2B8GA 4G3IA 5C0XI 1MKHA 1PTOD 2V1CC 4LFBQ 3GTKA 4K0KQ 4A93G 2DJFC 5J39A 4LFAL 2NUCA 3K5OA 1EYCA 3AU7A 4KJNA 1KJ8A 5JVLA 2O5JC 4LF7H 2XNAC 1STNA 1OXUA 3OIQA 4A3MH 4A93B 3QJYA 5H1SE 1I6UA 1HZCA 3D6CA 4LNQA 5CV4A 1I50H 4TV8F 2PCFB 2QCPX 2AUJD 4IPDA 4DV1H 2FE3A 5CC4A 4ZUIA 3E6ZX 2AKWB 3ND8A 1A2TA 4DR2H 2HHHH 3FP9A 3T1YL 2W57A 4O2AF 2VW9A 3JRXA 4OO1H 4QF4A 1X32A 4QW9A 1MHWC 1FNWA 5DM73 3ULPA 1L0XB 2UUAL 3T13A 3MXPA 4M1UB 5KX5F 2E2IA 1GXDC 2EVBA 4X3TA 4Z9CB 3K7AH 4FF4A 4DR1L 1VBGA 1HQMC 1ONLA 1R4PB 3PUZA 1I6VC 4UFZA 4RGNA 3TP8A 1XNQQ 2PO4A 1T36A 1B9MA 1S5ED 2WIIB 3LWEA 4YJ2F 1L2FA 4Q5VA 1GUGA 2NN6G 1XNRQ 2K5WA 2HCIA 3J81L 1K1QA 2AMCB 4BA1I 1Y1WG 4DFAA 1PH9A 1HR0L 1DV2A 1WCMA 5C0XJ 5T1IA 3BYTB 2V59A 2Q2HA 2V5AA 1Y1WB 3TS0A 2BQ3A 5C3EG 2EY5A 4GN5A 3GIKA 5JVDF 1S9FA 2E2DC 1QVCA 1HA6A 1SE4A 4DR4H 1KIXA 2I46A 5C3EB 1XDNA 3OIPA 1FNVA 2SEBD 4V190 1YIJA 4JYAQ 2PZWA 4KHPL 2W9CA 5BN5A 1M6VA 1QNKA 3P75A 2K04A 5HBRB 1N56A 4DR3L 3GTQH 1TWGA 5M5XH 1JXLA 4IFDH 3C3LA 2CW0C 1N48A 3KAKA 3N6XA 1PLFA 1L1OC 1EQQA 1M8AA 4A3EG 2NN6I 1X3PA 4A3LG 4GOPB 3CAMA 5F9NA 1QG7A 4A3EB 1YZ6A 3OMCA 3DWPA 5D3DA 4UHVA 1CKMA 2FB9A 1LTGD 1BUVT 2JA9A 1ICFB 3MR5A 2ZDGA 3FKIG 2DGYA 2Q2IA 1XTCD 2VXWA 1VQPA 1IL8A 4UAIA 2DIKA 3TBIB 5IP9G 2VQFL 3FKIB 2HT1A 1WD0A 2I5MX 4DAVA 1G8ZD 3JC66 1BNZA 4JI2H 1BQQT 1BBUA 1UUPA 2RDGA 2NVYH 2W7OA 2UXDQ 2WDTA 3KK7A 1CKOA 1LLRD 1X54A 3HOVH 1FR3A 1QVGA 4DV2L 2HVQA 4HTHA 3V4SA 4HNUA 4QMGA 1TQOA 2MQHA 2NU9B 2A73B 3BQ0A 1FKAH 4ZCKA 1PH4A 4HNVA 1YNJC 2IHFA 3C46A 2GPWA 5EKIA 1V51A 2W9BA 4ZAIA 4DK0A 4BBSG 4RA8A 1SYXB 4OEMB 4HYKA 1EWCA 3KDFA 1GUWA 4BBSB 1B8AA 2G9DA 1VF5C 3WNZA 4JG2A 4TQRA 4V0BA 1F9PA 5KFQA 2WTFA 2J4XA 4YWMA 1D6EC 5L1JA 2VL6A 2JA5A 1A62A 3X3NA 2IX3A 1BNCA 2YS7A 3UDGA 4JC0A 4QWAA 1VDZA 2CQAA 1B4OA 3GTPB 3S1MH 1KC8C 3ITPA 3T53B 1K8MA 5KG0A 2YRXA 2VB3X 1Z2NX 2XCLA 2FK2A 4C3JH 4DNRB 1WSCA 3S24A 2R85A 4JI1Q 4P75A 1JOQA 5FJ8G 4FM9A 5KFBA 2N3SA 2R93G 3BVGA 3V05A 2L9HA 4KK7A 3TN2A 1SNPA 3Q8RB 1I5FA 2R93B 1S5DD 2NUAB 2WYOA 4MN3A 1KDAA 3T56B 2FPPB 1EY7A 5M3MG 3I90A 3S17B 5KFZA 5K5PA 5M3MB 1QZGA 4O4IF 4LFBL 4DV4L 4K0KL 4KN7C 2VR1A 3G8CA 2K32A 4J9SA 4XQQA 4UPAA 3OW7A 3L9AX 2WKDA 1IYUA 3L3OC 2N88A 1GJXA 5CA0F 2W6NA 3PN1A 1DM0B 4J9RA 1UE7A 1K8AC 1UE1A 3IAYA 5JAVA 2JEAI 3K3VA 2RVLA 3PSIA 3BJUA 5CA1F 3J81E 4B3TH 3QOLA 2ZTEA 3CQZB 2B2VA 1QOHA 3PGZA 1I6HH 2K14A 4JI7Q 1I94Q 3HOYH 4ECVA 3QB3A 3MWEA 3RAXA 1PDQA 1D5XC 4ZUJA 1HZAA 3ORRA 2Z1CA 3RD4A 1KL9A 1HH2P 2PZTA 1XNQL 2SNMA 3RBDA 4IRCA 2QF7A 3S1QB 3RZDB 1HNZQ 2W7PA 3RIZA 4A3IG 2ASDA 4DV5H 2KEDA 5C44G 4X62H 2AQ4A 5M5YH 4YQWA 2LXJA 3EN2A 2ASJA 4OHJA 2ZTDA 4A3IB 1SFOH 1VQ7A 1YNNC 5C44B 1A2UA 5JPNC 5DLQE 1K9MC 2ZM6H 5KYLA 1IYJB 4LF4L 3NUCA 3BAAA 4MA0A 2F4VQ 4IUUA 3LP8A 4GOPA 1TY0A 1ZHQA 5DNFA 1H95A 3RAQA 2B63G 2EXZA 2GVAA 1PHJA 1UEAB 5FD5A 1Y69U 1KNEA 1S0NA 1QJOA 2WACA 2B63B 3MXNB 1XJVA 4HN7A 4BA2I 4EBDA 3C1FA 2B8FA 4KY7A 1J5EH 4YIJA 2M9VA 2F0HA 4PMCA 4R9WA 3FKIA 5H80A 5DGAA 4MV8A 4C1NK 2F0TA 4DKAC 1BR9A 1PZID 1MZBA 5KG3A 3DUZA 3DM1A 4HEDA 1AE2A 4DAPA 2C00A 3AFQA 1SNCA 5ELOA 4OIJA 2CW7A 1VMCA 4F4XA 2FLNA 2UU9Q 5EWGA 2RHSB 1Q7YC 3J7AF 1G51A 1QVFA 5EWFA 5NUCA 2EZVA 1LTBD 2D62A 3MJFA 4J9NA 3DM3A 4LH7A 5IE8A 2R86A 1AUXA 4EQOA 4HR7B 5I2XA 3OTOH 5DLGA 2M05A 1EIYB 1FJGH 1ZEQX 1S0MA 3A74A 4YCVA 4ECWA 1I4RA 5LMNW 5I6WA 3QIAA 3PF5A 1WTHA 3A56A 3HEJA 3QG1A 1EY5A 2UXDL 2YZGA 3R5XA 5GROA 5HURA 3GV5B 2JQOA 1NY4A 3CW2C 2NVTB 1DV1A 4O4HF 4ZKCB 1CKNB 2NZOA 3P1HA 4JV5H 1STGA 1N32Q 2RCFA 4IUVA 4KD4A 1X3FA 4MNOA 4IAJA 1DONA 2AWOA 4N8FA 1EEFD 5C5JA 1YJ9A 2LFNA 1GUNA 4DL3A 5KFYA 1WTVA 5BR8Q 1A3VA 4NXNH 3GQCA 4I7AA 4FXGC 1E1OA 4X65Q 2HVRA 1HNXH 1PFNA 2RCNA 1L1OB 2R7ZG 4J15A 3G6XA 1G6PA 3VMMA 3PVXA 3GTPA 3T4AC 2R7ZB 3DEOA 2OEOA 1BO0A 1Q1BA 1CUKA 3VR3A 4RMFA 4RB3C 1NR2A 5D3IB 4LF6H 3TEHB 4JI0H 1BXRA 3QR8A 1RDPD 1QZHA 3SI8A 1EQRA 1Q82C 1K28A 4JI5Q 1II3A 1JX4A 5KFEA 4F87A 2HQEA 2RHQB 3VR4A 1K0RA 4ZYSA 2R93A 1K8OA 2F0UA 2E2HB 3MAQA 1EUCB 1RODA 3ORQA 3AB9A 1KLUD 2R7DA 3I4MG 4HIOA 4IRKA 4IPHA 2LY7A 4ULLA 3D4RA 4X64Q 2EQSA 4ZRZA 1B33N 3I4MB 3RJ0A 3GTLB 1IBKQ 3TRZA 4CJ0B 2FMCA 3KOJA 4RWSC 4JI1L 3JSNA 2XSCA 5ELBA 3T1HL 1WOCA 4IO9A 2QK4A 1TT2A 4R4QA 1F2YA 2BDOA 2B2WA 2JXMB 1WD1A 1PTOC 2K50A 3CU7A 4JI3Q 3RUPA 2A74C 1SNMA 1IXRA 4G57A 4GC7A 4EFEA 3BVZA 3G6YA 4ED3A 4YY3Q 3CQZA 4FBUA 4LUZA 2B2VC 1HFNA 4LF5L 1G2SA 2JA8H 2XC9A 4UCOA 3LNNA 2HVSA 1P16A 1NMFA 1TWGH 2XIWA 5L9XA 1K3BC 1RYSA 2PQAB 4LUVA 4HCEA 5COYA 4OELB 4UDUC 5FLMG 3R23A 3MXGA 5EDWA 1HXYD 1E3PA 5F9LA 2BOSA 3TIGA 3RTXA 4A3GH 4GN3B 3DWAA 3EVQA 4X66Q 1VQNA 2PMZB 4CDFC 2B3GA 4BY7H 3HS0C 2NVQH 3GTGB 1C3OA 3ND9A 5KYIA 4NXMH 3TREA 4DAYB 4JI7L 2B2TC 4P72A 1ILPA 3S1NH 2Z4IA 3GTKB 1BXTA 3OOCA 3I55A 1GHKA 5L1LA 2UUBQ 3QFFA 1NNXA 1XMOH 3MVVA 2CVRA 4DR1Q 3K0YA 2SCUB 5KFDA 4WD3A 4EBEA 2XWBB 3SHLA 3K0XA 4HCSA 2DPIA 2V9WA 3I8ZA 4DL4A 1PZKD 4J9MA 4YB8B 2WP8J 1LTLA 3MXUA 4DR7H 5T1GA 4KV6A 4GKJL 5IYBG 2F4IA 2Z0SA 1BCPF 1K1SA 4JBWA 4QWDA 4N9PA 1GSAA 2IHEA 4A3DH 1RJPA 2B63A 3MXNA 4X3KA 1V43A 4PZ8A 5CV8A 1ZKOA 3EA6A 4LFAH 1STYA 3D4WA 4NMZA 4YAKB 1AN7A 1LYLA 3TP7A 5C0XH 2JA7G 1CQIB 1I7LA 2W6ZA 1EL0A 3BZCA 2N49A 2Z6BA 3ZJYC 1MIUA 4YBZB 2JA7B 1UEBA 1C48A 3PW2A 1TS4A 5C6AA 2YL2A 5KFGA 1B3AA 3NBHA 3CC7A 1HRJA 3BYYB 3GILA 2XD4A 1LTTD 1X3QA 1UAPA 1GHJA 1ENCA 2XVSA 2UVVA 2UUAH 1AE3A 2PN1A 3N42B 4HR7A 3RR5A 2JA5H 3TP5A 2HGSA 1O80A 1RTNA 4UP9A 4F88A 2F0KA 2F0VA 4HIMA 4WRDA 5DLFA 2K01A 5IYCH 3K5MA 4POGA 2W6QA 5LMUQ 1OXTA 4FF2A 5AFWA 3MR2A 2F0FA 1KAWA 3J80E 1YITA 2UU9L 3HOUG 2YYAA 3UQ8A 3MR6A 1EHIA 1RL2A 3T51B 1CKNA 5EPLA 4ECYA 1CZGA 3UI2A 3HOUB 4JI4Q 1WFQA 4EVOA 2LS01 2BCOA 3ICEA 1HR0H 1O78A 5J2TF 3KJOA 4B3MQ 2VUMG 5LHY1 3TQYA 4HNTA 1L1OA 2KHJA 3J80W 3TZUA 3OHAA 2K7VA 1QB5D 2R7KA 2VUMB 4CC6A 2R61A 4MV1A 2R7ZA 5IP7H 4R4IA 3LWUA 2RSNA 1MJEA 3BDOA 4LSXA 2ATLA 5LMNQ 2EIFA 2AQ1B 5BMVF 2J6TA 3S2DH 2RDIA 4MV4A 3GTJH 5L37A 5HGQA 4DR3H 2AHOB 3ULJA 1CE8A 4HIDA 3GIIA 3BVMA 2N8NA 3PUYA 5DG8A 2F3WA 2BE5D 2ZJQA 3C2PA 1E1TA 1KEEA 2E2HA 1H9MA 5J2UF 2FK3A 2A6ED 3S2HB 5DGBA 4IZOA 3T5LA 2I0QA 2Q8RE 1Z9FA 5C4HA 4HSVA 3EROA 2QDBA 3A55A 3VR6A 2NN6H 2OH2A 3MA2B 3GTLA 2GVBA 1E2ZA 1R9TA 1S3OA 3Q8QB 4LFCL 5M3FG 1ULZA 1OXXK 3GQBA 4C3HG 4DV0Q 1Y1WH 3RMHA 5AJ3Q 5CORA 1SEIA 2B2WC 2NZHA 4JI5L 1STAA 1B3QA 4AQYQ 5M3FB 2QEXA 4C3HB 2VQFH 4RZRA 5CGKA 1GOZA 2DJGC 5K2MA 5C3EH 1TA8A 5C5LA 1ESRA 5E3FA 2P0AA 1XTDA 4ZI7F 3IKJA 4QB4A 2PZUA 5FO8B 1EIHA 1EOTA 4H13C 1C0AA 1YJWA 2NTSA 1IBKL 2R8IA 1ZETA 2VQEQ 3M85A 3HOZG 1X56A 2PQAA 1JE4A 2I5LX 5KG2A 1O7ZA 3F2UA 3HRZC 2IPKD 5EPJA 4QUFA 4X3UA 3CCRA 3M9OB 4JI3L 3HOZB 1TU2B 1JJCB 4ME6A 4JBMA 2L55A 1GSOA 1H9JA 1D5ZC 4OX9L 2ASLA 4YY3L 4A3EH 5DQGA 3PZPA 4DV1Q 2PMZA 4A3LH 1W96A 2BH8A 2KSWA 4K5VA 3DF7A 2K5DA 3SEBA 1TWCB 2XCPA 1E2VA 3BA8A 4DV7H 3ETJA 3GTGA 1JE5A 2K75A 1EUDB 2MP1A 1CS0A 4DAYA 1JJ2A 2QILA 1A6XA 4BXXG 4DV4Q 1PRTB 1VQDA 3FKIH 5D1PA 1EZ6A 2MO0A 4CBVA 3I3CA 3JAME 1AW7A 3OW2A 2YRWA 2EY2A 4ZLTF 5IP9H 2F0IA 4L5QA 2VPSA 5IYZF 2R8KA 4X66L 3F8TA 5KT6A 1I4GA 5JJIA 3H91A 3PO2G 2PQEA 3S15H 4EEYA 1SNDA 2Q2UA 3GTMB 4A3BG 3JAMW 1BCPD 2H4OA 4TV9F 1JDEA 2ES2A 2UUBL 3PO2B 3GLKA 4G7ZC 3WDNA 1SYCA 3VYSA 3VPDA 4A3BB 4L5RC 1PTOB 1RD9D 2KCMA 1E0BA 4FP5D 2B39A 4CDDC 1K83B 2IT1A 1Z6HA 1WVLA 4YAJB 1HNWH 2PMZE 2UVWA 2JA7A 1DIKA 1T3NA 2A68D 2BH2A 1ICWA 3EPIA 4Y7NB 4DUZQ 4LF8H 3S14H 3S16B 3ULLA 4O3PA 4OXPA 1SMYD 3GIJA 3K5HA 3HP3A 3NBIA 3CCEA 3H4DA 4BS9A 4ECXA 4LFBH 4K0KH 1M1KC 4MTDA 5EKKA 4RCNA 4DF7A 3UDFA 4CJ2C 1CQFA 4DV6L 5KRUA 2YW2A 4QW8A 1HJPA 4LF4Q 2AGQA 2K5QA 1YEZA 4B9WA 3OMGA 4YHHQ 2G9HD 3J81j 4B08A 4L5SA 3M7NA 3GTPH 4TKOB 3NHHA 1C9OA 1ASZA 3I56A 1SJED 1VQEA 3M4QA 1VQHA 2IY5B 4XX0B 4I7ZC 2W71A 1S03G 1RJQA 1XMQL 5M5WB 2HQLA 1A63A 4Y52H 3H40A 1XX8A 2E5LL 4DNIA 1VS0A 4CJ1B 2HIXA 3M9NB 2M2LA 4J9QA 3FMCA 3TQTA 5FJ8H 2J6UA 2ENBA 2R93H 3KBXA 1JR0D 4JK1C 2WB1G 5LMUL 1VQJA 1XNQH 2VUMA 5KFAA 1VBHA 4JI2Q 1GVPA 4BBRG 3T5HA 5C4JB 2NVXH 1YHBA 1YNXA 2WB1B 3TSSA 3S17H 3KHHA 3OWEB 5KG4A 1XNRH 1NUCA 1N33H 1CFMA 4ECTA 2FK1A 3PV0A 4WJWA 5C4XG 3M3YB 4BBRB 3J81i 5D65A 5FO7B 4JI4L 4XYMB 3D6WA 1B50A 3HBLA 1ENAA 1EIFA 5KFLA 5C4XB 4B3ML 2FP4B 4BWGB 1O75A 1A0IA 3SK8A 3KALA 2JSOA 3N52A 5KG7A 3WOEA 3A0JA 1V1PB 4F50A 4UCUA 2OQKA 4DUYQ 5KFTA 3QWNA 3KF6B 3PO3G 1M0WA 3CQZH 4N8X1 1B7YB 5LMNL 4JYAH 2XTIA 3PO3B 4IZ8A 2BR0A 2AGPA 4MAMA 1F2ZA 4NKLA 3URYA 3R5HA 2CCZA 4A2AA 3T5KA 5C8YF 4B3SQ 2MO1A 1PH1A 2FHTA 3RN2A 4U7CA 1WJJA 1HA5A 5EZYF 1ET6A 1MSGA 3HKZG 1EWIA 3S1QH 4RU9A 1AZQA 4JCVE 1JOKA 3OPOA 1KNAA 5JEAG 3GTOB 4MHEA 4QCLA 3HKZB 3KLSA 2C2RA 4R8NA 4DK6C 2QA4A 1I50B 4EFBA 2HUGA 2DUDA 3M4OH 2IJ0A 4IUTA 5EJWA 2R87A 4OO1G 3CCLA 2RDFA 1SYBA 4DV0L 3A7LA 4LMQD 5AJ3L 1K73C 5GQOA 1GGOA 4AQYL 4JBKA 2GA4B 1K8GA 1PA6A 3CCJA 2VY3A 3ONAB 4O3RA 1BF4A 3MFGA 3MTSA 3K7AB 2FPIB 2FLLA 4ID6A 1AFPA 3GIDA 2SOBA 5EQ0A 2R7FA 1UNNC 3HGBA 2IL8A 1UWVA 4KY5A 2YTVA 2UXDH 3OHBA 1TWCA 2ICEC 2UVRA 1V8QA 3J81c 1EYAA 2YZNA 1UNSA 2KEEA 2VQEL 4HJ9A 3T1HQ 4QY7A 4Q45A 2RF4A 4HMJA 5HV6A 2AU0A 3VYTA 2WAQG 4C2MB 4QGUA 5C1PA 1O7YA 3ERQA 5FK9C 3SXHA 5KFVA 2WAQB 2Z6KA 3NE5B 5IWAH 4BY1H 2O2LD 4DV1L 2QEJC 1EFWA 4JV1A 2JA6A 1IKLA 1EY8A 2NBFA 5DG7A 1KJIA 3SVMA 4C5AA 1WTQA 2HHHL 4DL6A 4MV6A 1X9NA 4LF5Q 3GTMA 3PW7A 1WR2A 5K36H 3CC4A 2EJFC 2PW7A 3H4BA 4IFDG 1JICA 1Q86C 2ZJRA 3D4DA 3AMUA 1CM9A 4ECUA 1DOMA 2P5ZX 4K8IA 3GTQB 3KAJA 3BQ2A 1K83A 2IA6A 3R2TA 1S68A 2A6HD 2KHSA 4UCSA 3NWTA 2NVTH 1U5KA 1JMCA 4FXKC 4PV1C 1CQVA 1PX2A 3U50C 1IBLQ 4QQBX 4APMA 2DNCA 1ZXTA 1CA6A 2RDHA 3I2ZA 1Y1VG 2RBMA 2VZAA 2L15A 5LL6b 2AWNA 2KVMA 4JI1H 2CW8A 1AEXA 1GYFA 3CC2A 2ZM6Q 1S0OA 1VMPA 1Y1VB 1SYEA 5JEAJ 3G4SA 3V96A 1QWYA 1LUZA 3PIP3 3J7ZC 4DR4L 2F0NA 3KF8B 4L63B 2MHVA 3Q8DA 3GDEA 4GKJQ 2J6SA 3V4ZA 3I4OA 3NSWA 4DUZL 2QYZA 1DZ1A 4MV9A 2KJXA 4IQZA 4O1NA 3U58A 2YU9H 2E76C 1AH9A 5DM63 2Q2TA 1DD2A 5FD6A 2JYOA 2B2TA 3K58A 1JQYD 4KKUA 4AYBE 3DXJC 1IW7D 1SDFA 2NZ1D 3LGJA 2X0SA 1KJ9A 4A3JG 3SGIA 3S9WA 1UC8A 4ZHQF 3QO2A 4H44C 4LMYA 4YHHL 3S1RH 2K4KA 2C28A 4ZKBB 4JW0A 4A3JB 1QUQA 3G48A 4HJAA 4A76A 3RV3A 2WB1A 5C1OA 1XPUA 1KABA 4XQNA 2KCNA 3GTLH 3BU2A 3C0FB 1M0TA 3V2TA 4KLKA 4ZOLF 3KLWA 3L0OA 3H3VC 1I94H 2EY6A 4JI7H 4XT1B 1EQVA 2VB2X 3MWMA 2KHIA 1IBMQ 2N55A 3TZDA 1TVXA 4FF1A 4G7OC 3H6MA 3MEFA 2OTJA 4IOCA 4DU9A 3KLRA 1V1PA 1CI3M 1H9KA 2V4DA 3X3MA 4A3KH 2K5NA 5JPMC 3GO5A 3KF6A 4JI2L 5KG1A 1VQBA 1HNZH 3BZDB 4ODGA 3N6RA 3N41B 1F9QA 1TKWB 5ELCA 1VQLA 3NBHB 3AFPA 2Q8IB 4KHVA 1SJHD 3K7UC 1VQGA 4APVA 3VR5A 2A19A 3U9TA 4O3OA 1TWFH 3NEMA 1SNOA 3KUPA 2F0WA 2KQ3A 4G7HC 5C3XA 3F2CA 2F4VH 4TVAB 5KFHA 2XGTA 3MC0B 3N8DA 4DUYL 2WB1E 5FLMH 3GTOA 4QUCA 3KHGA 3RZOB 1WTXA 2BE5C 2VOBA 3HKZA 3FHWA 3Q8SB 3J80L 3K81C 3DLLA 1I50A 1TWAB 4RGMA 4DA2A 3OUUA 2A6EC 4B3RQ 2JE6I 4A3FH 4RNMA 5KFXA 3E0JA 2UVUA 2FINB 2RA4A 4O3NA 3GTKH 3I70A 1PYBA 1HZBA 1F2MA 1VQMA 4B3SL 1UE5A 3NQIA 2JK8A 3CF5A 3W3AA 5CYUA 1CK1A 4DR6Q 5CV9A 4YR2A 1SROA 3HB9A 4LSAA 3K5NA 5KIXA 1TWHB 2EYJA 2LKVA 1RF2D 2E2JB 2UU9H 3A8IE 1D8LA 2UXBQ 3UFXB 5IGEA 3LWBA 1Q3LA 5IYBH 5KFUA 1RK5A 1QNUA 2ALYB 3MEHA 5CV7A 3RN5A 3HOWG 2I5HA 1JB7A 1I6HB 1PRTC 2Y0SG 3KLSX 4TRDA 4LFCQ 1PH8A 5KFNA 2KOLA 2E2IH 4C2MA 4DXGA 1W2BA 3JRWA 5L1IA 3HOWB 4GLAC 5L1KA 3NP8A 2Y0SB 2WAQA 5I2YA 3HKZE 4JV0A 2JA7H 4FYDA 2Z6KC 1YBYA 2F0DA 3J80i 2A5HA 4H7BA 4HJ7A 4CC5A 5IY0A 4FNFA 3JZIA 1HQRD 1N32H 3R3OA 1WCMH 1R9TB 3TINA 2QW7A 1S10A 4GLVB 4ME3A 4PG3A 1GM5A 2NU6B 4JI6Q 2X6GA 3N40P 1SEBD 3PW5A 4RKBA 3GTQA 3P7JA 4LW1A 2DY8A 5BR8H 2L0CA 1G2TA 4CKEA 4X65H 3FVQA 4C5BA 2K1BA 4QWEA 1LTSD 5HY6A 4OX9Q 1RIPA 2LXKA 4QL5A 4XYLB 1F2LA 2FXQA 4C5CA 1K0SA 3N43B 2K03A 4B3TL 1AP0A 5KT4A 1U4PA 4F7XA 1C7YA 2VNUD 3CCSA 3NTKA 4IOAA 4J9LA 4Y8VB 4ETSA 3L4KA 2PNHA 2CH4W 4A3CG 1XPOA 4FS1A 1B1ZA 3AEVA 1JKJB 1Y1VA 2WAQE 2YV5A 1S4ZA 3Q6SA 5E7NA 4BWSC 4JI5H 1BCPC 5E1FA 2VUMH 4XYOA 3K3PA 3KF8A 2E8GA 1VAJA 5KFPA 5KFWA 4Q8FA 1BGWA 2F52A 4DV5L 1IBLL 4X64H 1EY9A 4CHTB 2A68C 1JDBB 1I7NA 1TIID 2FJ2A 2MFIA 1IBKH 3MFIA 3KJPA 3RLFA 1SMYC 2ZM6L 2HIVA 1PYSB 3T5JA 3MFYA 3JAML 4JI3H 1N34H 2UXCQ 1SLJA 1S40A 1V9PA 3RB6A 2WV6D 3FDTA 4LF9Q 4YY3H 3J80c 3PIPA 3WWVA 4C56C 3AQQA 1PFMA 2RKSA 1EY4A 3NTHA 4ED0A 1ENFA 4ALPA 2R82A 1C30A 1I4QA 3SE0A 3BG3A 5M3FH 1LT4D 4C3IG 4CKCA 2AQ2B 5J22A 3EPGA 4GKKQ 1E22A 2H1EA 4DV6Q 1O7LA 1LO5D 4RHRA 3U9OA 1D7QA 1Q1EA 4C3IB 1RHPA 1SRUA 1ASYA 3M9MB 1ILQA 1HHVA 5DG9A 4JV2A 3KYHC 1EY6A 2BA1A 3J7YW 4KJOA 4X66H 1HUNA 4J1MA 1EUJA 1O7IA 5IT9E 2CKZB 2DPJA 5IYDG 1XMQQ 2BDNA 3C1EA 2NU7B 3T1YH 4RCOA 2E5LQ 1P8LA 2ZTCA 5C3WA 5IGDA 4R4OA 1IBML 1VQCA 4DN4M 2UUBH 1NSNS 4MIUA 4DR1H 3JAMi 5J1ZA 3VYRA 5IT9W 2QGQA 3H15A 3VPBA 4DAMA 1T94A 1TWAA 4FVMA 3CCUA 5EWEA 5FO9B 2X69A 4PZ7A 5GADC 1RJTA 1MJCA 5CBAE 4RZQA 5I9PA 1ZYRD 1NCVA 3HG9A 4J6HA 4J9PA 4BXXH 4A93H 4DL5A 2ZT9C 4RNOA 2UUCQ 5DQIA 2R8GA 3T16A 4IN3A 1TWHA 2IX0A 1STEA 2VQDA 1LABA 4GN4B 4K2KA 1X65A 2H5XA 2JA6G 3M4YA 4B3RL 3RB3A 1X55A 3KFUA 4MV7A 3GTMH 4YCUA 2R6FA 1OO9B 2JA6B 4LF6L 2TMPA 3ZYYX 3OSOA 2ASBA 4KHPH 2PI2A 2F0JA 3PO2H 1GUSA 3CCVA 3GV8B 4FS2A 3CPWA 3TQ1A 4HMIA 3PCOB 1U9RA 1PTOH 2R8HA 4DR6L 1ET9A 3A8KE 3Q1KA 2Y0SA 3VA5A 3MWDA 1ZQ7A 2B2YA 1QCBD 5LMUH 1H9SB 1RKNA 3RF2A 3A8JE 1N36Q 5J3BA 4IURA 1WTPA 4L5TA 1L0WA 4Y7NH 2R7MA 3R8BA 4BY7G 3G6EA 2UXBL 5EPKA 5IGCA 2YYZA 1CSPA 1LT3D 4IJHA 4I65A 4BY7B 2BQRA 1T5EA 4PZ6A 5IODA 2NVQB 2D9UA 1JT8A 4JI4H 5FLXE 1WI5A 3M4PA 3CVZA 3R93A 3M4IA 4DR5Q 3JAMc 4JI8Q 1RK6A 1M90C 2Q8TA 2W70A 4DV3Q 5BPFA 4A4IA 4NP5A 2R7NA 4ED8A 3H3VI 3H0GG 2DY7A 2K6AA 3UE0A 1N8RC 5M5WH 3RBEA 4OWXB 3HOXG 5LMNH 1Y14B 2EDGA 4DV7Q 3VR2A 4A3DG 2PI2E 1J9OA 3W1GA 5FPOA 5FLXW 5LOVF 3PR5B 3IFTA 1H9RA 3H0GB 4DV2H 4JPBW 4Q8EA 1KAAA 5HGTA 3HOXB 4JI6L 3CHBD 5EOYA 3N44B 4OIKA 4A3DB 5KFRA 2Y0SE 3PUVA 1HUMA 1VQIA 2OF1A 4IJLA 4LF7Q 1AN8A 4MV3A 1IZ6A 1C8CA 2D5DA 3Q0AA 4HIKA 1Z2PX 5C4JH 4I7HA 1I3QB 3I91A 5LL6S 4IPCA 1YHQA 4DPGA 4MA5A 1LT6D 3U4VA 2OCEA 2MJ8A 2A6HC 2SNSA 4DR2Q 2HHHQ 1E4EB 3F8NA 4NXML 5C4XH 1OWTA 3K59A 3CXCA 4DV0H 1NBWA 3U9SA 3A5UA 1KBLA 1CZWA 1T5XD 3RUZA 4RGTA 1XMOL 4RUAA 4AQYH 4J8QA 4NDXA 3DHQA 4FXDA 4X6AH 2W6OA 4EEQA 1HNWQ 2V4QA 3DWQA 4ECSA 2X6LA 3W2DA 3IN5A 4EX5A 2EE1A 5DAUA 1VQ4A 1F77A 5CR3A 5JQWA 5KG6A 1F9RA 1F9SA 1JIHA 4J0MA 4K5WA 2FJZA 2VQEH 4F8MA 4PWQA 4AYBG 1Q81C 1MD2D 3KHLA 1C4QA 2W6PA 4UP8A 2F0EA 4RB1A 5D1OA 2C35B 4AYBB 1IW7C 3GTOH 2ZXRA 3RNUA 2RDJA 3NGDA 2UXCL 1YI2A 1KD1C 5IP7G 2XRQD 1W3SA 1X3GA 2MNAA 4R4CA 4LF9L 2R92G 4DR4Q 1CHPD 4ECZA 4BBSH 3NTIA 5JEAH 4IUNA 1EOVA 1YVCA 1UE6A 3TDQA 5CBEE 4XZ3B 5KFOA 2C2EA 3NENA 2R92B 3PW0A 4XIGS 1B53A 1JWMD 1PH3A 3PW4A 4KHZA 2ID0A 2DN8A 3ER0A 2FMAA 5KFKA 1L0YB 3UE1A 4DV4H 5E4WC 2DLNA 3S2DB 1BBXC 3GTJB 2Z8LA 1S5BD 2I07B 4GKKL 1BCPB 2EYOA 2YCHA 4ME5A 1E4GT 3Q8PB 2HCCA 5FKAC 5JVH3 2IP4A 3VPCA 3M7GA 1SYGA 4K14A 3BQ1A 1DYQA 1EEID 1JB3A 1VQAA 4G4KA 4HSPA 4U68A 4WORA 1N33Q 2V58A 5D8DA 2PW5A 1S5FD 3V6KA 3P20A 2AUKA 4FO2A 4L8JA 2ALZA 1VQ6A 3RV4A 5JUMA 2F03A 3HKSA 4R8IA 1JJGA 4C2MH 3KHRA 5JJZA 4B9XA 1D1IA 2IX1A 4K6DA 1B44D 1RCVD 3H94A 2K05A 1D1KA 1W93A 4NLGA 1SN8A 4EGVA 3K5IA 3SK6A 2L1BA 1SNQA 2B2UA 1X3EA 1QUQB 3PMFA 1TAEA 2YZMA 3IG0A 4YR3A 1HTPA 1LACA 4DUZH 1LV9A 4HAEA 3G7LA 5M3MH 5JJKA 3ERSX 3PUXA 1XWEA 4F4WA 2VA3A 2L4NA 4KMUC 3CCQA 2RGVA 2IWHA 5I6YA 2IBKA 4LK1C 2ZXOA 5G3LF 4CKBA 1KDCA 4ED2A 5CMDA 1G6ZA 2R7LA 3GD7A 4OWTB 1VQFA 1RTOA 2UUCL 1TY2A 2JEBI 3K5LA 3BA9A 4LF4H 3K80C 1ML0D 4ED6A 1H9SA 4YHHH 2B2YC 1OTCA 3I4NG 3VA7A 2DWCA 2A69D 4FBTA 3H20A 2N78A 2ZDHA 4R4TA 1T9HA 3GV6A 3I4NB 1WTRA 4ZQIA 5KNBA 4IUQA 2MUYA 5EAYA 1E4FT 3M9BA 5KFMA 2SDFA 4L6TB 1PYWD 3EIVA 3MR3A 1Y1VH 4RHSA 1LTAD 1EYGA 4HQ6A 5KG5A 4PDBA 3MHBA 4U6PA 3GIMA 3A7AB 4LUOA 4A3MG 1B70B 1VF7A 1Q8KA 3CMAA 3RZDH 1S72A 4PMWA 1N36L 1KC7A 4A3MB 1CHQD 1Y8PB 1SXTA 4PMBA 3LMLA 2KBNA 4DK3C 4TQUS 4EQPA 1Q12A 1V1OA 2YTXA 4UCVA 2HDLA 4A3IH 3CMEA 1EU3A 1U0LA 3H0GA 2FFKB 5C44H 3D8GA 2VS1A 2IMWP 4ABNA 3TIIA 3S15B 1E24A 4QIWB 4DR5L 1EY0A 2EYMA 1BKBA 2HJWA 1B2TA 4JI8L 3I72A 4A3JH 1DGSA 1I3QA 4DUYH 5IWAQ 4DV3L 1D5MC 1NTGA 4IR1A 2E75C 3D3RA 2JN4A 4LAAA 1U4MA 5ELFA 1Q90A 4DV7L 4XT3B 3FMAA 3FEWX 1E4EA 2B63H 1PH6A 1SYFA 2NB0A 1NR4A 2QDLA 1KRTA 5M9OA 2O5IC 4M7EA 3S14B 3BJYA 5KFIA 1PFBA 1R4QB 4ZK9B 4WJ4A 1MBYA 1Q46A 2C2DA 5ELNA 4B3SH 1I4PA 1SE8A 1B04A 1EZ8A 4LF7L 3UDXA 1KJJA 1B9NA 4MTNA 3ETHA 2K5HA 5CV5A 2CQYA 3FRPB 1YHAA 4QWCA 1PZJD 2F1MA 1RYRA 1MI2A 5ELEA 1EIGA 1SMXA 4GNXC 4OO1I 2FLPA 3R5FA 3HZXA 4B3TQ 3FPPA 2J9GA 1WH2A 1A8VA 3W5OA 2J0TD 4DR2L 1VQKA 1KRSA 3FDSA 4F4YA 1IOWA 4KKTA 3GP7A 5LYJF 5KFFA 4IRDA 1KJQA 4N9TA 1JLLB 5LL6X 4LJZC 4XXEA 5A2QL 4S3SA 2NU8B 4IWXA 2R3ZA 1OXSC 4AYBA 3PIO3 3OHXC 5M5XB 3F2BA 1HNWL 3RZOH 3UDIA 4R7RA 4MTEA 4IWYA 1TWAH 3BZKA 4X3SA 1UC9A 1JOOA 1M7JA 2F3IA 1TS2A 4F4ZA 2AGOA 1LM0A 3NQTA 1G91A 4IR9A 3EQLC 4MTKA 2A8VA 5CAEB 4WBNF 2R92A 4DV5Q 2NVXB 4LF8L 4X62Q 3PR4A 3Q24A 5I4DA 1DOLA 4GS3A 5C4ZA 5JVG3 2A1AA 3GTJA 3T1HH 3SK5A 1BJTA 4ECRA 1EFID 3MWYW 3PQIA 3STBD 2XGPA 4GLXA 3DEPA 1FGBD 1TWHH 3D31A
chains in the Genus database with same CATH topology
2E2JH 3S2DH 4POFA 3GTJH 4LW1A 2R7ZH 4JYAQ 1YIJA 5HGQA 3A5ZB 3HOVG 2AHOB 3ULJA 4KHPL 4HIDA 5HY6A 4OX9Q 4H02A 1RIPA 4UP7A 2N8NA 3PUYA 2LXKA 4QL5A 2FXQA 2ZJQA 4DR3L 1E1TA 3GTQH 4IFDI 5M5XH 4B3TL 1C7YA 2VNUD 3HOWH 3CCSA 4IOAA 1L1OC 1EQQA 2I0QA 1J5EQ 1Z9FA 4A3EG 2PNHA 2NN6I 4A3LG 4GOPB 4A3CG 2E2HH 1XPOA 3CAMA 2GVBA 3AEVA 1S3OA 2YV5A 2WAQE 5E7NA 4LFCL 5M3FG 1OXXK 4DV0Q 1YZ6A 1Y1WH 1CKMA 2VUMH 5AJ3Q 2JA9A 1N33L 1XNRL 5GAHC 2NZHA 4JI5L 1HR0W 2E8GA 4AQYQ 3I4MH 3FKIG 2DGYA 2QEXA 2Q2IA 1R9TH 3CP0A 1VQPA 2F52A 5C3EH 1G291 4DV5L 2CFMA 5IP9G 2VQFL 1IBLL 3L2PA 1XTDA 2HT1A 2I5MX 2MFIA 1KHIA 3OTOQ 2ZJPA 1FJGQ 3JC66 1WYDA 3KJPA 3RLFA 1C0AA 1BBUA 2ZM6L 1YJWA 1IBKL 2HIVA 2NVYH 2UXDQ 2VQEQ 1PYSB 3M85A 1CKOA 3HOZG 1X54A 3HOVH 1X56A 2PQAA 1QVGA 1V1QA 2I5LX 4DV2L 3E9IA 3CCRA 2UXCQ 2GN5A 1SLJA 4O2DA 1V9PA 1S40A 4JYAL 4JI3L 2MQHA 4JV5Q 4LF9Q 1JJCB 4JBMA 3J80c 3PIPA 3WWVA 2OQ0A 3AQQA 4IFDJ 4OX9L 1PH4A 4YWKA 2IHFA 4YY3L 4A3EH 4DV1Q 4A3LH 2BH8A 4A3CH 4ALPA 4BBSG 2LSSA 1J6QA 4UY8C 4NXNQ 4O0AA 1JE5A 2K75A 5GAGC 5M3FH 2YTYA 1HNXQ 4BY1G 3KDFA 1JJ2A 2D0OA 1B8AA 4GKKQ 1E22A 4BXXG 4DV4Q 4DV6Q 1VQDA 3FKIH 1D7QA 2MO0A 1Q1EA 1SRUA 1ASYA 3GTGH 1HZ9A 1E7ZA 4FDBA 3OW2A 3KYHC 4JG2A 1VQ9A 2BA1A 5IP9H 5K36G 1EUJA 1O7IA 4YWMA 4LF6Q 3F2DA 4L5QA 2VL6A 4JI0Q 1A62A 2CKZB 4X66L 5IYDG 1XMQQ 3F8TA 4YWLA 3UDGA 4JC0A 1P8LA 2ZTCA 2E5LQ 4R4OA 5JJIA 1IBML 3PO2G 3S1MH 1VQCA 1KC8C 3S15H 2Q2UA 4A3BG 3JAMi 2ES2A 2UUBL 4C3JH 4HJ5A 3S24A 2QGQA 3H15A 4L5RC 4JI1Q 4DAMA 2KCMA 4P75A 5FJ8G 4HJ8A 2IT1A 3CCUA 2N3SA 2R93G 3HOYG 2PMZE 4PZ7A 5GADC 1MJCA 3AYHB 2BH2A 1I5FA 4C3IH 1BVSA 4DUZQ 3S14H 3ULLA 4OXPA 4BXXH 5M3MG 3CCEA 5IWAL 4A93H 1KQSA 2UUCQ 4P71A 1M1KC 3UDFA 1QZGA 2IX0A 4WJ3M 4LFBL 4DV4L 4DV6L 4K0KL 4GN4B 1HJPA 4LF4Q 1X65A 2H5XA 2JA6G 1YEZA 4UPAA 4YHHQ 3J81j 4L5SA 3M7NA 4QIWE 4B3RL 5IYDH 1X55A 3GTPH 1C9OA 1ASZA 3KFUA 3I56A 3GTMH 1VQEA 4YCUA 3M3YH 3M4QA 1VQHA 4IPGA 1N9WA 1UE7A 4LF6L 2IY5B 1K8AC 1UE1A 2ASBA 2PI2A 2JEAI 3PO2H 3CCVA 3CPWA 1XMQL 3PCOB 2HQLA 1A63A 3PSIA 4Y52H 3BJUA 4DR6L 2KENA 2E5LL 4RG1A 4DNIA 2ZTEA 3PGZA 1VS0A 2HIXA 1YJNA 5GAEC 1I6HH 4OONA 5FJ8H 1N36Q 3HOUH 5J3BA 2K14A 4JI7Q 4P73A 1I94Q 2R93H 3HOYH 4L5TA 1L0WA 4Y7NH 2K5VA 2WB1G 5LMUL 3G6EA 1VQJA 4BY7G 2UXBL 4NXMQ 3B6YA 2JJQA 3D0FA 2YYZA 4AIMA 4JI2Q 1CSPA 1GVPA 4BBRG 1HZAA 1FGUA 4IJHA 4JOIA 2NVXH 1KL9A 1HH2P 1YHBA 1YNXA 4A75A 1XNQL 3S17H 4PZ6A 1BBWA 1JT8A 1WI5A 4A3KG 1VQOA 3PV0A 1XMOQ 1HNZQ 3M4PA 5C4XG 3J81i 1N34Q 4JI4L 4A3IG 4DR5Q 3PIOA 5C44G 3JAMc 1EIFA 4DR7Q 5M5YH 4JI8Q 2LXJA 1Z47A 3EN2A 1M90C 3IRBA 3RLNA 4B3ML 2ZTDA 4LWCA 1SFOH 1VQ7A 2JA6H 4X62L 5IT9c 1A0IA 4DV3Q 4A4IA 2BA0A 3H3VI 5DLQE 3A0JA 3H0GG 3UE0A 1N8RC 1K9MC 3H3VH 2OQKA 5M5WH 3E0EA 4OWXB 3HOXG 1IYJB 4DUYQ 4LF4L 1Y14B 4DV7Q 4A3DG 3KF6B 3PO3G 2PI2E 3E9HA 3W1GA 2F4VQ 1FVIA 3CQZH 4LFAQ 2B29A 1B7YB 5LMNL 4GOPA 4JI6L 1PH2A 3VDYA 1VQ5A 2XTIA 1NE3A 2Y0SE 3PUVA 1H95A 3S2HH 1VQIA 4IJLA 2GVAA 2B63G 1XPRA 1PHJA 4LF7Q 4MZ9A 3NELA 2CCZA 1IZ6A 3F1ZA 4HIKA 4A3FG 2MO1A 4GNXB 1PH1A 3RN2A 4B3SQ 5C4JH 1WJJA 3MXNB 4IPCA 2EXDA 4DPGA 1XJVA 1YHQA 3U4VA 3HKZG 4BA2I 2OCEA 1EWIA 3S1QH 4JCVE 3T1YQ 1GO3E 5JEAG 1I94L 3W1BA 1PV4A 4DKAC 2UUAQ 4DR2Q 4XTCS 4NB3A 2HHHQ 1J5EL 4C3HH 4DK6C 2QA4A 1X6OA 5C4XH 1AE2A 4NXML 2DUDA 3CXCA 3AFQA 3M4OH 1NBWA 3A5UA 5ELOA 4OO1G 4JBJA 3CCLA 4QJFA 2UU9Q 2D0PA 3CD6A 4DV0L 1XMOL 4GOPC 2RHSB 1Q7YC 1HNZL 1G51A 1QVFA 5AJ3L 4X6AH 1K73C 5GQOA 2D62A 1HNWQ 4AQYL 4JBKA 3DM3A 3H0GH 1K8GA 1PA6A 5IE8A 2VY3A 3CCJA 5JJLA 3HOXH 4EX5A 1VQ4A 3OYYA 2R7FA 1EIYB 1HR0Q 2ATWA 3A74A 4YCVA 1UWVA 3OTOL 2YTVA 3HOZH 1PH5A 5LMNW 2OTLA 1FJGL 3RLOA 4AYBG 3PF5A 3J81c 1Q81C 2F4VL 1I3QH 2UXDL 5GROA 2VQEL 2JQOA 1NY4A 3CW2C 4UP8A 1CKNB 4HJ9A 2C35B 2NZOA 2CWAA 4QY7A 3T1HQ 2RF4A 1TWCH 3RNUA 3GTOH 2WAQG 1N32Q 2UXCL 1YI2A 4QGUA 1KD1C 5IP7G 1W3SA 1X3GA 1X3FA 4MNOA 1WCMG 4R4CA 2MNAA 4LF9L 2R92G 4DR4Q 1VCIA 2AWOA 4BBSH 4JV5L 1VQ8A 1YJ9A 1EOVA 1YVCA 2Z6KA 3K8AA 4KHPQ 1UE6A 5BR8Q 4BY1H 3NENA 4XIGS 1GD7A 1E1OA 4X65Q 5FLXc 4DV1L 1PH3A 1EFWA 2RCNA 1L1OB 4KHZA 4J15A 2ID0A 2CWPA 4DR3Q 3ER0A 2R7ZG 4NXNL 1G6PA 3UE1A 2HHHL 1HNXL 2R6GA 1X9NA 4LF5Q 2KCTA 4GKKL 1Q1BA 1IL2A 3CC4A 2K52A 1CUKA 4RMFA 4IFDG 1PVOA 1Q86C 2ZJRA 1TXYA 2OWOA 3TEHB 2JA8G 1VQAA 1QZHA 1N33Q 1EQRA 1Q82C 4JI0L 4JI5Q 1K3RA 2NVTH 2RHQB 2CQOA 4A3BH 1K0RA 1U5KA 1JMCA 1VQ6A 3HKSA 1K83H 1JJGA 4C2MH 3U50C 2VQFQ 1IBLQ 3CPFA 2R7DA 3I4MG 4QQBX 4HIOA 4EQ5A 4KI0A 3I2ZA 4IPHA 1Y1VG 1OXVA 4A3GG 1KXLA 1GKHA 2L15A 2VZAA 2AWNA 2EQSA 1CSQA 4X64Q 2IX1A 3CC2A 2R92H 2ZM6Q 3S16H 1SN8A 1IBKQ 3TRZA 3KOJA 3CCMA 4JI1L 3L7ZC 3T1HL 1WOCA 2WFWA 4R1JA 1X3EA 5JEAJ 4AH6A 4R4QA 3G4SA 4IO9A 1QUQB 1LUZA 1N32L 4DV2Q 3J7ZC 4DR4L 3KF8B 2K50A 5M3MH 4JI3Q 5JJKA 3ERSX 3PUXA 3Q8DA 3GDEA 1IXRA 3CCQA 4GKJQ 5BR8L 4YCWA 3I4OA 4DUZL 4X65L 3TS2A 4YY3Q 3U58A 2YU9H 1AH9A 3GD7A 2Q2TA 4OWTB 1VQFA 4LUZA 2UUCL 2JEBI 4AYBE 3K80C 4LF5L 1FL0A 2JA8H 3LGJA 1PFSA 1OTCA 3I4NG 1P16A 4A3JG 1NMFA 1TWGH 3SGIA 3J7A5 4YHHL 2PQAB 4LUVA 3S1RH 2K4KA 2N78A 4R4TA 1T9HA 3PF4A 1QUQA 3G48A 5FLMG 4HJAA 4A76A 4JOIC 1PH7A 1XPUA 1E3PA 5EAYA 1SR3A 5C0XG 3M9BA 3GTLH 3BU2A 4P74A 4OWWB 3EIVA 4GN3B 1Y1VH 4A3GH 1EYGA 4X66Q 1VQNA 4KLKA 4LUOA 4A3MG 2B3GA 3KLWA 3L0OA 4BY7H 1B70B 2NVQH 2KHIA 1Q8KA 1IBMQ 3CMAA 3RZDH 1S72A 4PMWA 4BBRH 3MEFA 3TREA 4DAYB 4X64L 1N36L 3KDFB 4IOCA 4JI7L 2OTJA 1NMGA 3I7FA 4P72A 3S1NH 2KBNA 3I55A 4DK3C 4A3KH 2UUBQ 2K5NA 4TQUS 1Q12A 3GO5A 2YTXA 3KF6A 2JA5G 4JI2L 1VQBA 4A3IH 4DR1Q 3CMEA 1U0LA 4NPSA 3K0XA 3EBEA 5C44H 2VS1A 2WP8J 5IYCG 1LTLA 1VQLA 3NBHB 3AFPA 1E24A 1N34L 3PUWA 3STBC 4GKJL 3K7UC 1VQGA 4APVA 4DR5L 5IYBG 2A19A 2Z0SA 1BKBA 4DR7L 3G71A 4JI8L 4JBWA 1NJIC 1TWFH 4GNXA 4A3JH 3I4NH 1DGSA 2IHEA 4A3DH 3PO3H 3NEMA 1V43A 4PZ8A 3U4ZA 5IWAQ 4DV3L 1NTGA 3F2CA 4LF8Q 4TVAB 2XGTA 3HFZB 4DUYL 2WB1E 5FLMH 5C0XI 1MKHA 4DV7L 2V1CC 1LYLA 2JA7G 4K0KQ 4LFBQ 4A93G 3FHWA 1PH6A 2B63H 3K81C 3DLLA 4LFAL 1KRTA 3BZCA 2N49A 4B3RQ 2JE6I 3ZJYC 4A3FH 1MIUA 4WJ4A 1OXUA 1UEBA 1Q46A 4A3MH 5H1SE 5ELNA 1SE8A 1HZCA 3GTKH 4LF7L 1PYBA 1HZBA 3UDXA 4LNQA 1I50H 3CC7A 4MTNA 2K5HA 1VQMA 4IPDA 4B3SL 1UE5A 1YHAA 2JK8A 3CF5A 4DR6Q 1SROA 2AKWB 1AE3A 1SMXA 3FP9A 4GNXC 3RR5A 3T1YL 2JA5H 2VW9A 4UP9A 4OO1I 4B3TQ 1A8VA 3W5OA 4HIMA 4DR2L 3ULPA 1KRSA 1VQKA 2UUAL 5IYCH 4POGA 5LMUQ 1D8LA 1OXTA 2UXBQ 3K7AH 1KAWA 4DR1L 1YITA 5IYBH 3PUZA 2UU9L 2ALYB 3HOUG 3RN5A 1XNQQ 3HOWG 1RL2A 1CKNA 1OXSC 2I5HA 1JB7A 4LFCQ 2Y0SG 1PH8A 3F2BA 1L2FA 2E2IH 1HNWL 3RZOH 3UDIA 1W2BA 2NN6G 1XNRQ 4JI4Q 1WFQA 4GLAC 3ICEA 1TWAH 3BZKA 2AMCB 4BA1I 2F3IA 3HKZE 1LM0A 3KJOA 1Y1WG 2JA7H 2A8VA 2Z6KC 1PH9A 4B3MQ 1HR0L 2VUMG 3TQYA 1YBYA 5C0XJ 4DV5Q 4LF8L 4X62Q 1L1OA 2KHJA 2Q2HA 3J80i 3TS0A 4GS3A 4HJ7A 5IY0A 2A1AA 5C3EG 5IP7H 4GN5A 4R4IA 1WCMH 3STBD 1MJEA 1QVCA 4GLVB 5LMNQ 4ME3A 4PG3A 4GLXA 1GM5A 4JI6Q 2EIFA 1KIXA 1TWHH 3D31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2J H;  3S2D H;  4POF A;  3GTJ H;  4LW1 A;  2R7Z H;  4JYA Q;  1YIJ A;  5HGQ A;  3A5Z B;  3HOV G;  2AHO B;  3ULJ A;  4KHP L;  4HID A;  5HY6 A;  4OX9 Q;  4H02 A;  1RIP A;  4UP7 A;  2N8N A;  3PUY A;  2LXK A;  4QL5 A;  2FXQ A;  2ZJQ A;  4DR3 L;  1E1T A;  3GTQ H;  4IFD I;  5M5X H;  4B3T L;  1C7Y A;  2VNU D;  3HOW H;  3CCS A;  4IOA A;  1L1O C;  1EQQ A;  2I0Q A;  1J5E Q;  1Z9F A;  4A3E G;  2PNH A;  2NN6 I;  4A3L G;  4GOP B;  4A3C G;  2E2H H;  1XPO A;  3CAM A;  2GVB A;  3AEV A;  1S3O A;  2YV5 A;  2WAQ E;  5E7N A;  4LFC L;  5M3F G;  1OXX K;  4DV0 Q;  1YZ6 A;  1Y1W H;  1CKM A;  2VUM H;  5AJ3 Q;  2JA9 A;  1N33 L;  1XNR L;  5GAH C;  2NZH A;  4JI5 L;  1HR0 W;  2E8G A;  4AQY Q;  3I4M H;  3FKI G;  2DGY A;  2QEX A;  2Q2I A;  1R9T H;  3CP0 A;  1VQP A;  2F52 A;  5C3E H;  1G29 1;  4DV5 L;  2CFM A;  5IP9 G;  2VQF L;  1IBL L;  3L2P A;  1XTD A;  2HT1 A;  2I5M X;  2MFI A;  1KHI A;  3OTO Q;  2ZJP A;  1FJG Q;  3JC6 6;  1WYD A;  3KJP A;  3RLF A;  1C0A A;  1BBU A;  2ZM6 L;  1YJW A;  1IBK L;  2HIV A;  2NVY H;  2UXD Q;  2VQE Q;  1PYS B;  3M85 A;  1CKO A;  3HOZ G;  1X54 A;  3HOV H;  1X56 A;  2PQA A;  1QVG A;  1V1Q A;  2I5L X;  4DV2 L;  3E9I A;  3CCR A;  2UXC Q;  2GN5 A;  1SLJ A;  4O2D A;  1V9P A;  1S40 A;  4JYA L;  4JI3 L;  2MQH A;  4JV5 Q;  4LF9 Q;  1JJC B;  4JBM A;  3J80 c;  3PIP A;  3WWV A;  2OQ0 A;  3AQQ A;  4IFD J;  4OX9 L;  1PH4 A;  4YWK A;  2IHF A;  4YY3 L;  4A3E H;  4DV1 Q;  4A3L H;  2BH8 A;  4A3C H;  4ALP A;  4BBS G;  2LSS A;  1J6Q A;  4UY8 C;  4NXN Q;  4O0A A;  1JE5 A;  2K75 A;  5GAG C;  5M3F H;  2YTY A;  1HNX Q;  4BY1 G;  3KDF A;  1JJ2 A;  2D0O A;  1B8A A;  4GKK Q;  1E22 A;  4BXX G;  4DV4 Q;  4DV6 Q;  1VQD A;  3FKI H;  1D7Q A;  2MO0 A;  1Q1E A;  1SRU A;  1ASY A;  3GTG H;  1HZ9 A;  1E7Z A;  4FDB A;  3OW2 A;  3KYH C;  4JG2 A;  1VQ9 A;  2BA1 A;  5IP9 H;  5K36 G;  1EUJ A;  1O7I A;  4YWM A;  4LF6 Q;  3F2D A;  4L5Q A;  2VL6 A;  4JI0 Q;  1A62 A;  2CKZ B;  4X66 L;  5IYD G;  1XMQ Q;  3F8T A;  4YWL A;  3UDG A;  4JC0 A;  1P8L A;  2ZTC A;  2E5L Q;  4R4O A;  5JJI A;  1IBM L;  3PO2 G;  3S1M H;  1VQC A;  1KC8 C;  3S15 H;  2Q2U A;  4A3B G;  3JAM i;  2ES2 A;  2UUB L;  4C3J H;  4HJ5 A;  3S24 A;  2QGQ A;  3H15 A;  4L5R C;  4JI1 Q;  4DAM A;  2KCM A;  4P75 A;  5FJ8 G;  4HJ8 A;  2IT1 A;  3CCU A;  2N3S A;  2R93 G;  3HOY G;  2PMZ E;  4PZ7 A;  5GAD C;  1MJC A;  3AYH B;  2BH2 A;  1I5F A;  4C3I H;  1BVS A;  4DUZ Q;  3S14 H;  3ULL A;  4OXP A;  4BXX H;  5M3M G;  3CCE A;  5IWA L;  4A93 H;  1KQS A;  2UUC Q;  4P71 A;  1M1K C;  3UDF A;  1QZG A;  2IX0 A;  4WJ3 M;  4LFB L;  4DV4 L;  4DV6 L;  4K0K L;  4GN4 B;  1HJP A;  4LF4 Q;  1X65 A;  2H5X A;  2JA6 G;  1YEZ A;  4UPA A;  4YHH Q;  3J81 j;  4L5S A;  3M7N A;  4QIW E;  4B3R L;  5IYD H;  1X55 A;  3GTP H;  1C9O A;  1ASZ A;  3KFU A;  3I56 A;  3GTM H;  1VQE A;  4YCU A;  3M3Y H;  3M4Q A;  1VQH A;  4IPG A;  1N9W A;  1UE7 A;  4LF6 L;  2IY5 B;  1K8A C;  1UE1 A;  2ASB A;  2PI2 A;  2JEA I;  3PO2 H;  3CCV A;  3CPW A;  1XMQ L;  3PCO B;  2HQL A;  1A63 A;  3PSI A;  4Y52 H;  3BJU A;  4DR6 L;  2KEN A;  2E5L L;  4RG1 A;  4DNI A;  2ZTE A;  3PGZ A;  1VS0 A;  2HIX A;  1YJN A;  5GAE C;  1I6H H;  4OON A;  5FJ8 H;  1N36 Q;  3HOU H;  5J3B A;  2K14 A;  4JI7 Q;  4P73 A;  1I94 Q;  2R93 H;  3HOY H;  4L5T A;  1L0W A;  4Y7N H;  2K5V A;  2WB1 G;  5LMU L;  3G6E A;  1VQJ A;  4BY7 G;  2UXB L;  4NXM Q;  3B6Y A;  2JJQ A;  3D0F A;  2YYZ A;  4AIM A;  4JI2 Q;  1CSP A;  1GVP A;  4BBR G;  1HZA A;  1FGU A;  4IJH A;  4JOI A;  2NVX H;  1KL9 A;  1HH2 P;  1YHB A;  1YNX A;  4A75 A;  1XNQ L;  3S17 H;  4PZ6 A;  1BBW A;  1JT8 A;  1WI5 A;  4A3K G;  1VQO A;  3PV0 A;  1XMO Q;  1HNZ Q;  3M4P A;  5C4X G;  3J81 i;  1N34 Q;  4JI4 L;  4A3I G;  4DR5 Q;  3PIO A;  5C44 G;  3JAM c;  1EIF A;  4DR7 Q;  5M5Y H;  4JI8 Q;  2LXJ A;  1Z47 A;  3EN2 A;  1M90 C;  3IRB A;  3RLN A;  4B3M L;  2ZTD A;  4LWC A;  1SFO H;  1VQ7 A;  2JA6 H;  4X62 L;  5IT9 c;  1A0I A;  4DV3 Q;  4A4I A;  2BA0 A;  3H3V I;  5DLQ E;  3A0J A;  3H0G G;  3UE0 A;  1N8R C;  1K9M C;  3H3V H;  2OQK A;  5M5W H;  3E0E A;  4OWX B;  3HOX G;  1IYJ B;  4DUY Q;  4LF4 L;  1Y14 B;  4DV7 Q;  4A3D G;  3KF6 B;  3PO3 G;  2PI2 E;  3E9H A;  3W1G A;  2F4V Q;  1FVI A;  3CQZ H;  4LFA Q;  2B29 A;  1B7Y B;  5LMN L;  4GOP A;  4JI6 L;  1PH2 A;  3VDY A;  1VQ5 A;  2XTI A;  1NE3 A;  2Y0S E;  3PUV A;  1H95 A;  3S2H H;  1VQI A;  4IJL A;  2GVA A;  2B63 G;  1XPR A;  1PHJ A;  4LF7 Q;  4MZ9 A;  3NEL A;  2CCZ A;  1IZ6 A;  3F1Z A;  4HIK A;  4A3F G;  2MO1 A;  4GNX B;  1PH1 A;  3RN2 A;  4B3S Q;  5C4J H;  1WJJ A;  3MXN B;  4IPC A;  2EXD A;  4DPG A;  1XJV A;  1YHQ A;  3U4V A;  3HKZ G;  4BA2 I;  2OCE A;  1EWI A;  3S1Q H;  4JCV E;  3T1Y Q;  1GO3 E;  5JEA G;  1I94 L;  3W1B A;  1PV4 A;  4DKA C;  2UUA Q;  4DR2 Q;  4XTC S;  4NB3 A;  2HHH Q;  1J5E L;  4C3H H;  4DK6 C;  2QA4 A;  1X6O A;  5C4X H;  1AE2 A;  4NXM L;  2DUD A;  3CXC A;  3AFQ A;  3M4O H;  1NBW A;  3A5U A;  5ELO A;  4OO1 G;  4JBJ A;  3CCL A;  4QJF A;  2UU9 Q;  2D0P A;  3CD6 A;  4DV0 L;  1XMO L;  4GOP C;  2RHS B;  1Q7Y C;  1HNZ L;  1G51 A;  1QVF A;  5AJ3 L;  4X6A H;  1K73 C;  5GQO A;  2D62 A;  1HNW Q;  4AQY L;  4JBK A;  3DM3 A;  3H0G H;  1K8G A;  1PA6 A;  5IE8 A;  2VY3 A;  3CCJ A;  5JJL A;  3HOX H;  4EX5 A;  1VQ4 A;  3OYY A;  2R7F A;  1EIY B;  1HR0 Q;  2ATW A;  3A74 A;  4YCV A;  1UWV A;  3OTO L;  2YTV A;  3HOZ H;  1PH5 A;  5LMN W;  2OTL A;  1FJG L;  3RLO A;  4AYB G;  3PF5 A;  3J81 c;  1Q81 C;  2F4V L;  1I3Q H;  2UXD L;  5GRO A;  2VQE L;  2JQO A;  1NY4 A;  3CW2 C;  4UP8 A;  1CKN B;  4HJ9 A;  2C35 B;  2NZO A;  2CWA A;  4QY7 A;  3T1H Q;  2RF4 A;  1TWC H;  3RNU A;  3GTO H;  2WAQ G;  1N32 Q;  2UXC L;  1YI2 A;  4QGU A;  1KD1 C;  5IP7 G;  1W3S A;  1X3G A;  1X3F A;  4MNO A;  1WCM G;  4R4C A;  2MNA A;  4LF9 L;  2R92 G;  4DR4 Q;  1VCI A;  2AWO A;  4BBS H;  4JV5 L;  1VQ8 A;  1YJ9 A;  1EOV A;  1YVC A;  2Z6K A;  3K8A A;  4KHP Q;  1UE6 A;  5BR8 Q;  4BY1 H;  3NEN A;  4XIG S;  1GD7 A;  1E1O A;  4X65 Q;  5FLX c;  4DV1 L;  1PH3 A;  1EFW A;  2RCN A;  1L1O B;  4KHZ A;  4J15 A;  2ID0 A;  2CWP A;  4DR3 Q;  3ER0 A;  2R7Z G;  4NXN L;  1G6P A;  3UE1 A;  2HHH L;  1HNX L;  2R6G A;  1X9N A;  4LF5 Q;  2KCT A;  4GKK L;  1Q1B A;  1IL2 A;  3CC4 A;  2K52 A;  1CUK A;  4RMF A;  4IFD G;  1PVO A;  1Q86 C;  2ZJR A;  1TXY A;  2OWO A;  3TEH B;  2JA8 G;  1VQA A;  1QZH A;  1N33 Q;  1EQR A;  1Q82 C;  4JI0 L;  4JI5 Q;  1K3R A;  2NVT H;  2RHQ B;  2CQO A;  4A3B H;  1K0R A;  1U5K A;  1JMC A;  1VQ6 A;  3HKS A;  1K83 H;  1JJG A;  4C2M H;  3U50 C;  2VQF Q;  1IBL Q;  3CPF A;  2R7D A;  3I4M G;  4QQB X;  4HIO A;  4EQ5 A;  4KI0 A;  3I2Z A;  4IPH A;  1Y1V G;  1OXV A;  4A3G G;  1KXL A;  1GKH A;  2L15 A;  2VZA A;  2AWN A;  2EQS A;  1CSQ A;  4X64 Q;  2IX1 A;  3CC2 A;  2R92 H;  2ZM6 Q;  3S16 H;  1SN8 A;  1IBK Q;  3TRZ A;  3KOJ A;  3CCM A;  4JI1 L;  3L7Z C;  3T1H L;  1WOC A;  2WFW A;  4R1J A;  1X3E A;  5JEA J;  4AH6 A;  4R4Q A;  3G4S A;  4IO9 A;  1QUQ B;  1LUZ A;  1N32 L;  4DV2 Q;  3J7Z C;  4DR4 L;  3KF8 B;  2K50 A;  5M3M H;  4JI3 Q;  5JJK A;  3ERS X;  3PUX A;  3Q8D A;  3GDE A;  1IXR A;  3CCQ A;  4GKJ Q;  5BR8 L;  4YCW A;  3I4O A;  4DUZ L;  4X65 L;  3TS2 A;  4YY3 Q;  3U58 A;  2YU9 H;  1AH9 A;  3GD7 A;  2Q2T A;  4OWT B;  1VQF A;  4LUZ A;  2UUC L;  2JEB I;  4AYB E;  3K80 C;  4LF5 L;  1FL0 A;  2JA8 H;  3LGJ A;  1PFS A;  1OTC A;  3I4N G;  1P16 A;  4A3J G;  1NMF A;  1TWG H;  3SGI A;  3J7A 5;  4YHH L;  2PQA B;  4LUV A;  3S1R H;  2K4K A;  2N78 A;  4R4T A;  1T9H A;  3PF4 A;  1QUQ A;  3G48 A;  5FLM G;  4HJA A;  4A76 A;  4JOI C;  1PH7 A;  1XPU A;  1E3P A;  5EAY A;  1SR3 A;  5C0X G;  3M9B A;  3GTL H;  3BU2 A;  4P74 A;  4OWW B;  3EIV A;  4GN3 B;  1Y1V H;  4A3G H;  1EYG A;  4X66 Q;  1VQN A;  4KLK A;  4LUO A;  4A3M G;  2B3G A;  3KLW A;  3L0O A;  4BY7 H;  1B70 B;  2NVQ H;  2KHI A;  1Q8K A;  1IBM Q;  3CMA A;  3RZD H;  1S72 A;  4PMW A;  4BBR H;  3MEF A;  3TRE A;  4DAY B;  4X64 L;  1N36 L;  3KDF B;  4IOC A;  4JI7 L;  2OTJ A;  1NMG A;  3I7F A;  4P72 A;  3S1N H;  2KBN A;  3I55 A;  4DK3 C;  4A3K H;  2UUB Q;  2K5N A;  4TQU S;  1Q12 A;  3GO5 A;  2YTX A;  3KF6 A;  2JA5 G;  4JI2 L;  1VQB A;  4A3I H;  4DR1 Q;  3CME A;  1U0L A;  4NPS A;  3K0X A;  3EBE A;  5C44 H;  2VS1 A;  2WP8 J;  5IYC G;  1LTL A;  1VQL A;  3NBH B;  3AFP A;  1E24 A;  1N34 L;  3PUW A;  3STB C;  4GKJ L;  3K7U C;  1VQG A;  4APV A;  4DR5 L;  5IYB G;  2A19 A;  2Z0S A;  1BKB A;  4DR7 L;  3G71 A;  4JI8 L;  4JBW A;  1NJI C;  1TWF H;  4GNX A;  4A3J H;  3I4N H;  1DGS A;  2IHE A;  4A3D H;  3PO3 H;  3NEM A;  1V43 A;  4PZ8 A;  3U4Z A;  5IWA Q;  4DV3 L;  1NTG A;  3F2C A;  4LF8 Q;  4TVA B;  2XGT A;  3HFZ B;  4DUY L;  2WB1 E;  5FLM H;  5C0X I;  1MKH A;  4DV7 L;  2V1C C;  1LYL A;  2JA7 G;  4K0K Q;  4LFB Q;  4A93 G;  3FHW A;  1PH6 A;  2B63 H;  3K81 C;  3DLL A;  4LFA L;  1KRT A;  3BZC A;  2N49 A;  4B3R Q;  2JE6 I;  3ZJY C;  4A3F H;  1MIU A;  4WJ4 A;  1OXU A;  1UEB A;  1Q46 A;  4A3M H;  5H1S E;  5ELN A;  1SE8 A;  1HZC A;  3GTK H;  4LF7 L;  1PYB A;  1HZB A;  3UDX A;  4LNQ A;  1I50 H;  3CC7 A;  4MTN A;  2K5H A;  1VQM A;  4IPD A;  4B3S L;  1UE5 A;  1YHA A;  2JK8 A;  3CF5 A;  4DR6 Q;  1SRO A;  2AKW B;  1AE3 A;  1SMX A;  3FP9 A;  4GNX C;  3RR5 A;  3T1Y L;  2JA5 H;  2VW9 A;  4UP9 A;  4OO1 I;  4B3T Q;  1A8V A;  3W5O A;  4HIM A;  4DR2 L;  3ULP A;  1KRS A;  1VQK A;  2UUA L;  5IYC H;  4POG A;  5LMU Q;  1D8L A;  1OXT A;  2UXB Q;  3K7A H;  1KAW A;  4DR1 L;  1YIT A;  5IYB H;  3PUZ A;  2UU9 L;  2ALY B;  3HOU G;  3RN5 A;  1XNQ Q;  3HOW G;  1RL2 A;  1CKN A;  1OXS C;  2I5H A;  1JB7 A;  4LFC Q;  2Y0S G;  1PH8 A;  3F2B A;  1L2F A;  2E2I H;  1HNW L;  3RZO H;  3UDI A;  1W2B A;  2NN6 G;  1XNR Q;  4JI4 Q;  1WFQ A;  4GLA C;  3ICE A;  1TWA H;  3BZK A;  2AMC B;  4BA1 I;  2F3I A;  3HKZ E;  1LM0 A;  3KJO A;  1Y1W G;  2JA7 H;  2A8V A;  2Z6K C;  1PH9 A;  4B3M Q;  1HR0 L;  2VUM G;  3TQY A;  1YBY A;  5C0X J;  4DV5 Q;  4LF8 L;  4X62 Q;  1L1O A;  2KHJ A;  2Q2H A;  3J80 i;  3TS0 A;  4GS3 A;  4HJ7 A;  5IY0 A;  2A1A A;  5C3E G;  5IP7 H;  4GN5 A;  4R4I A;  1WCM H;  3STB D;  1MJE A;  1QVC A;  4GLV B;  5LMN Q;  4ME3 A;  4PG3 A;  4GLX A;  1GM5 A;  4JI6 Q;  2EIF A;  1KIX A;  1TWH H;  3D31 A; 
#chains in the Genus database with same CATH topology
 1JC7 A;  2J7Z A;  2E2J H;  4POF A;  2ZJT A;  5FPR A;  2I80 A;  2R7Z H;  2WIN B;  4O4L F;  3A5Z B;  2I8C A;  3HOV G;  2RGR A;  4I55 F;  2Z9H A;  4H02 A;  4UP7 A;  3RB0 A;  2NVY B;  1EU4 A;  1KLG D;  4IFD I;  4LF5 H;  1Y8O B;  1LTI D;  3HOV B;  1B6R A;  1TS3 A;  4J9K A;  3HOW H;  4Q0F A;  4QWB A;  1Y1W A;  2DNE A;  1J5E Q;  3OSN A;  2EY1 A;  3CRL C;  3NWS A;  4RNN A;  2E2H H;  4EG0 A;  1SAP A;  4O42 A;  4ED1 A;  2NYZ D;  5KKN B;  4DK1 A;  3J81 W;  4RB0 A;  2R8J A;  2B2U C;  2EYP A;  1XNR L;  1N33 L;  5KT5 A;  2EPB A;  5GAH C;  1HR0 W;  3I4M H;  1IBL H;  1R9T H;  3CP0 A;  2G5D A;  5IOC A;  3M4O B;  4R8U B;  1G29 1;  2CFM A;  3L2P A;  2D2C C;  3RFC A;  3WO1 A;  1Q8I A;  1KHI A;  3OTO Q;  1ZYR C;  2ZJP A;  4JUZ A;  1FJG Q;  3GIP A;  1WYD A;  5G3L D;  1V4Y A;  5I47 A;  1DXM A;  3MFH A;  3WO0 A;  4RAY A;  4UCT A;  5KFC A;  4Q43 A;  4YR0 A;  2L5T A;  4TUY F;  3KXY T;  2LMC B;  1V1Q A;  3E9I A;  4GKJ H;  3R2I A;  2GN5 A;  4O2D A;  4DL7 A;  4JYA L;  5IT9 L;  4C3J G;  4EGQ A;  3S1M B;  4JV5 Q;  5KT2 A;  3RGX A;  2OQ0 A;  1BDO A;  2KA7 A;  3BDC A;  4IFD J;  1GSH A;  3K57 A;  4YWK A;  4C3J B;  1VKZ A;  2F0G A;  3NK9 A;  4A3C H;  1U4L A;  1XXG A;  2JP1 A;  2LSS A;  1J6Q A;  4UY8 C;  4NXN Q;  4O0A A;  5GAG C;  3J7A K;  2F0M A;  2YTY A;  4BY1 G;  1HNX Q;  5A35 A;  1QE6 A;  4K2L A;  2D0O A;  5KGU A;  4O3S A;  3HXL A;  2XRS D;  4BY1 B;  4E6I A;  3GTG H;  1E7Z A;  1HZ9 A;  4FDB A;  2EYF A;  1A9X A;  1VQ9 A;  1PXU A;  1QIL A;  3CRK C;  4RKL A;  1HTL D;  5K36 G;  4LF6 Q;  3F2D A;  1RJR A;  3BDL A;  4JI0 Q;  1A15 A;  2CW0 D;  2EJM A;  4QIW A;  1IBM H;  3O13 A;  4PQX A;  4YWL A;  4H0L C;  1FYC A;  2BQU A;  5LXT F;  1GUO A;  2L11 A;  2MGS A;  5I9O A;  3RB4 A;  2CH4 A;  1SCU B;  2R84 A;  1MGS A;  2XWJ B;  2V4R A;  4HJ5 A;  2XN9 C;  1GLV A;  4HJ8 A;  1DOK A;  2L12 A;  4CGY B;  3HOY G;  4U67 3;  3EFX D;  1HPC A;  3VYU A;  1AUV A;  2GPS A;  3AYH B;  4RH6 A;  3HOY B;  5IGB A;  4RB2 C;  4C3I H;  5ISR A;  1BVS A;  1A3U A;  2PBZ A;  2WKC A;  1DJR D;  3NPP A;  5IWA L;  4DXF A;  1KQS A;  3EYY A;  1Z7T A;  2O4X A;  4P71 A;  4GC6 A;  1JWU D;  2K28 A;  2PVP A;  3QZ7 A;  5C5M A;  4WJ3 M;  4B3R H;  2ZXP A;  2NWG A;  2F0O A;  3TME A;  1SYD A;  2W9A A;  2IW3 A;  4QIW E;  5LP6 F;  5IYD H;  5M5Y B;  5A2Q E;  2YU9 B;  1YNJ D;  5FLX L;  1HFG A;  2PYK A;  1S5C D;  4EYH B;  4IPG A;  1SFO B;  2C22 A;  1N9W A;  1W6J A;  4DR6 H;  5KFJ A;  5F2D A;  4K5X A;  3LX0 A;  2KUM A;  3Q23 A;  2KEN A;  4RG1 A;  2F0Q A;  2QKI C;  3S1R B;  2NTT A;  1YJN A;  5GAE C;  4OON A;  2UXB H;  2NVX A;  4JVZ A;  3KTM A;  3HOU H;  2ICI A;  4P73 A;  3E5N A;  4IAL A;  4DGZ A;  1JCK B;  1IHZ A;  1D2B A;  4LH6 A;  4M9U A;  2K5V A;  5A2Q W;  3A54 A;  4NXM Q;  1U4R A;  3B6Y A;  2JJQ A;  3D0F A;  1JWS D;  2EYL A;  3SDZ A;  4AIM A;  4LFC H;  1FGU A;  3DMU A;  4JOI A;  2M00 A;  4A75 A;  1BBW A;  5FOB B;  4A3K G;  5EBC A;  1VQO A;  1XMO Q;  1PK8 A;  5EKL A;  2PNR C;  1N34 Q;  4M8A A;  3PIO A;  1PRT F;  2F0L A;  4IUP A;  4A3K B;  4DR7 Q;  5KNC A;  5GON F;  1Z47 A;  3IRB A;  3RLN A;  4TSS A;  3E3X A;  4LWC A;  2JA6 H;  4X62 L;  5IT9 c;  2NVY A;  2BA0 A;  2VUG A;  3G6J B;  3H3V H;  3E0E A;  1IOV A;  4JI6 H;  1LT5 D;  3E9H A;  1FVI A;  4LFA Q;  2B29 A;  5BN4 A;  3BG5 A;  5CB4 F;  3Q22 A;  1TWF B;  4KKS A;  1PH2 A;  3VDY A;  1VQ5 A;  1NE3 A;  3S2H H;  5IGF A;  1E2W A;  1XPR A;  4OX9 H;  4MZ9 A;  3NEL A;  4EGJ A;  4K6L A;  5IGG A;  3F1Z A;  4A3F G;  4GNX B;  2MCT A;  5ELD A;  1EYD A;  1PTO F;  1CT1 D;  2EXD A;  3KBG A;  4R8U A;  3V6H A;  3T1Y Q;  4A3F B;  2EYH A;  1GO3 E;  4Q44 A;  1I94 L;  3OWF A;  3W1B A;  4WFN 3;  1PV4 A;  2UUA Q;  4XTC S;  4NB3 A;  1BOS A;  3SR1 A;  4C3H H;  1J5E L;  2XIG A;  1X6O A;  4E4T A;  5T14 A;  5IIF A;  1IKM A;  5D1O B;  4JBJ A;  1CQJ B;  4QJF A;  1ESF A;  3I12 A;  2D0P A;  1Z2O X;  3CD6 A;  4GOP C;  1HNZ L;  4O3Q A;  5KND A;  3SK4 A;  5KT3 A;  3BAB A;  1EWH A;  2VA2 A;  3H0G H;  5JJL A;  2CZG A;  3GIQ A;  3HOX H;  1AZP A;  3I73 A;  2C5C A;  2Z4H A;  4KY6 A;  3OYY A;  1HR0 Q;  2KEC A;  2ATW A;  1L2Z A;  3OTO L;  3HOZ H;  1PH5 A;  4A2B A;  1FJG L;  2OTL A;  3RLO A;  2E2I B;  2F4V L;  3MZ5 A;  1NAP A;  1I3Q H;  4TQS A;  3GV7 B;  3L4J A;  3V6J A;  2DZD A;  2UXC H;  4DLK A;  2GLT A;  1WTW A;  4LF9 H;  2CWA A;  1TWC H;  4XYQ A;  2AQ3 B;  3I4L A;  1WCM G;  4JV5 L;  1YNN D;  1VCI A;  2W6M A;  2A69 C;  3QOJ A;  2OLS A;  1VQ8 A;  5JH7 F;  3K8A A;  5E4X A;  4KHP Q;  4ECQ A;  4L1K A;  1FD7 D;  1WCM B;  1EQT A;  1GD7 A;  5FLX c;  4Q0Y A;  2VPQ A;  4DR3 Q;  4KN4 C;  2CWP A;  2F0P A;  1ZHS A;  2XGQ A;  4NXN L;  4GKK H;  3G6V A;  4DV6 H;  4P2C B;  1HNX L;  4IHJ F;  2R6G A;  4DNT B;  2W8L A;  4ILW A;  2KCT A;  1CTM A;  4RFB A;  2FMM A;  1IL2 A;  2O03 A;  2K52 A;  1XYI A;  1PVO A;  2JEI A;  2JEJ A;  1TXY A;  3WOF A;  2OWO A;  3J7A V;  2EOT A;  2JA8 G;  3GV3 A;  1XMQ H;  4FU0 A;  4ZQ3 A;  5KT7 A;  4JI0 L;  5DEH A;  2E5L H;  1PMR A;  1K3R A;  2W9C B;  4EQN A;  3Q2O A;  2JA8 B;  4I4T F;  4UCR A;  4A3B H;  2CQO A;  1TWG B;  5D14 A;  1K83 H;  2ZDQ A;  4PNY A;  4EBC A;  2VQF Q;  3CPF A;  1A3T A;  1FNU A;  4EQ5 A;  4KI0 A;  4A3G G;  4OGQ C;  1KXL A;  1OXV A;  1GKH A;  3SE7 A;  2PPB C;  1M4V A;  1CSQ A;  2EJG C;  3JSL A;  1W6K A;  5KEE A;  1TS5 A;  4YP3 A;  2R92 H;  1DCZ A;  1IYV A;  3S16 H;  2MPM A;  1STB A;  3CCM A;  4A3G B;  4C1N I;  3L7Z C;  1J8I A;  2WFW A;  2K33 A;  4OL7 A;  4R1J A;  1N32 L;  1KTK A;  4AH6 A;  2FKL A;  3H09 A;  4DV2 Q;  1KDB A;  3QZ8 A;  5JOB A;  2YU9 A;  3OSP A;  2KCC A;  1SFO A;  2RSO A;  5BN3 A;  2F3V A;  4B3M H;  5BR8 L;  4YCW A;  3S1N B;  1Y8N B;  2FPG B;  4X65 L;  1EYZ A;  3TS2 A;  2WE6 A;  1SSO A;  1I4H A;  3EJI A;  2UUC H;  4O2B F;  2F0S A;  4RUC A;  4XDX A;  5DQH A;  3FPU B;  4GZY C;  2CHB D;  4J9O A;  1MSH A;  1FL0 A;  4KD3 A;  5BPH A;  1PFS A;  3IFD A;  3E5S A;  3K6O A;  3J7A 5;  4ED7 A;  1B6S A;  4NW2 A;  1JOR A;  3PF4 A;  4JOI C;  1PH7 A;  5C0X G;  1GUT A;  1SR3 A;  2YS6 A;  1S97 A;  2OXP A;  4P74 A;  4OWW B;  2C9O A;  1WTO A;  5EBD A;  1STH A;  5EGT A;  1EZ1 A;  3OUZ A;  2W9B B;  1N36 H;  1TR5 A;  4KTA A;  1HCZ A;  4FF3 A;  4K8J A;  4BBR H;  4XQJ A;  4X64 L;  3M3Y H;  3RGZ A;  4DL2 A;  3KDF B;  1PRT D;  1NMG A;  3I7F A;  3BS1 A;  4I50 F;  1CA5 A;  4CDC C;  2RQX A;  1SE2 A;  3NXW A;  2JA5 G;  2I87 A;  1LTR D;  4RGO S;  5LA6 F;  2W8K A;  2JEF A;  4NPS A;  5KFS A;  3EBE A;  1TWF A;  4DR5 H;  5IYC G;  3IL8 A;  4RAU C;  2JA5 B;  1N34 L;  4JI8 H;  1I4X A;  3PUW A;  3STB C;  4RAZ A;  4DV3 H;  4DR7 L;  3G71 A;  2XCA A;  2E74 C;  2HD3 A;  1NJI C;  4GNX A;  2TSS A;  2HDM A;  3I4N H;  4EYI B;  4YJ3 F;  3PO3 H;  2JEG A;  5TSS A;  3TP6 A;  3U4Z A;  3CKI B;  4LF8 Q;  5CV6 A;  1SBB B;  4CDE C;  1SE3 A;  3HFZ B;  2OT2 A;  2B8G A;  4G3I A;  5C0X I;  1MKH A;  1PTO D;  2V1C C;  4LFB Q;  3GTK A;  4K0K Q;  4A93 G;  2DJF C;  5J39 A;  4LFA L;  2NUC A;  3K5O A;  1EYC A;  3AU7 A;  4KJN A;  1KJ8 A;  5JVL A;  2O5J C;  4LF7 H;  2XNA C;  1STN A;  1OXU A;  3OIQ A;  4A3M H;  4A93 B;  3QJY A;  5H1S E;  1I6U A;  1HZC A;  3D6C A;  4LNQ A;  5CV4 A;  1I50 H;  4TV8 F;  2PCF B;  2QCP X;  2AUJ D;  4IPD A;  4DV1 H;  2FE3 A;  5CC4 A;  4ZUI A;  3E6Z X;  2AKW B;  3ND8 A;  1A2T A;  4DR2 H;  2HHH H;  3FP9 A;  3T1Y L;  2W57 A;  4O2A F;  2VW9 A;  3JRX A;  4OO1 H;  4QF4 A;  1X32 A;  4QW9 A;  1MHW C;  1FNW A;  5DM7 3;  3ULP A;  1L0X B;  2UUA L;  3T13 A;  3MXP A;  4M1U B;  5KX5 F;  2E2I A;  1GXD C;  2EVB A;  4X3T A;  4Z9C B;  3K7A H;  4FF4 A;  4DR1 L;  1VBG A;  1HQM C;  1ONL A;  1R4P B;  3PUZ A;  1I6V C;  4UFZ A;  4RGN A;  3TP8 A;  1XNQ Q;  2PO4 A;  1T36 A;  1B9M A;  1S5E D;  2WII B;  3LWE A;  4YJ2 F;  1L2F A;  4Q5V A;  1GUG A;  2NN6 G;  1XNR Q;  2K5W A;  2HCI A;  3J81 L;  1K1Q A;  2AMC B;  4BA1 I;  1Y1W G;  4DFA A;  1PH9 A;  1HR0 L;  1DV2 A;  1WCM A;  5C0X J;  5T1I A;  3BYT B;  2V59 A;  2Q2H A;  2V5A A;  1Y1W B;  3TS0 A;  2BQ3 A;  5C3E G;  2EY5 A;  4GN5 A;  3GIK A;  5JVD F;  1S9F A;  2E2D C;  1QVC A;  1HA6 A;  1SE4 A;  4DR4 H;  1KIX A;  2I46 A;  5C3E B;  1XDN A;  3OIP A;  1FNV A;  2SEB D;  4V19 0;  1YIJ A;  4JYA Q;  2PZW A;  4KHP L;  2W9C A;  5BN5 A;  1M6V A;  1QNK A;  3P75 A;  2K04 A;  5HBR B;  1N56 A;  4DR3 L;  3GTQ H;  1TWG A;  5M5X H;  1JXL A;  4IFD H;  3C3L A;  2CW0 C;  1N48 A;  3KAK A;  3N6X A;  1PLF A;  1L1O C;  1EQQ A;  1M8A A;  4A3E G;  2NN6 I;  1X3P A;  4A3L G;  4GOP B;  3CAM A;  5F9N A;  1QG7 A;  4A3E B;  1YZ6 A;  3OMC A;  3DWP A;  5D3D A;  4UHV A;  1CKM A;  2FB9 A;  1LTG D;  1BUV T;  2JA9 A;  1ICF B;  3MR5 A;  2ZDG A;  3FKI G;  2DGY A;  2Q2I A;  1XTC D;  2VXW A;  1VQP A;  1IL8 A;  4UAI A;  2DIK A;  3TBI B;  5IP9 G;  2VQF L;  3FKI B;  2HT1 A;  1WD0 A;  2I5M X;  4DAV A;  1G8Z D;  3JC6 6;  1BNZ A;  4JI2 H;  1BQQ T;  1BBU A;  1UUP A;  2RDG A;  2NVY H;  2W7O A;  2UXD Q;  2WDT A;  3KK7 A;  1CKO A;  1LLR D;  1X54 A;  3HOV H;  1FR3 A;  1QVG A;  4DV2 L;  2HVQ A;  4HTH A;  3V4S A;  4HNU A;  4QMG A;  1TQO A;  2MQH A;  2NU9 B;  2A73 B;  3BQ0 A;  1FKA H;  4ZCK A;  1PH4 A;  4HNV A;  1YNJ C;  2IHF A;  3C46 A;  2GPW A;  5EKI A;  1V51 A;  2W9B A;  4ZAI A;  4DK0 A;  4BBS G;  4RA8 A;  1SYX B;  4OEM B;  4HYK A;  1EWC A;  3KDF A;  1GUW A;  4BBS B;  1B8A A;  2G9D A;  1VF5 C;  3WNZ A;  4JG2 A;  4TQR A;  4V0B A;  1F9P A;  5KFQ A;  2WTF A;  2J4X A;  4YWM A;  1D6E C;  5L1J A;  2VL6 A;  2JA5 A;  1A62 A;  3X3N A;  2IX3 A;  1BNC A;  2YS7 A;  3UDG A;  4JC0 A;  4QWA A;  1VDZ A;  2CQA A;  1B4O A;  3GTP B;  3S1M H;  1KC8 C;  3ITP A;  3T53 B;  1K8M A;  5KG0 A;  2YRX A;  2VB3 X;  1Z2N X;  2XCL A;  2FK2 A;  4C3J H;  4DNR B;  1WSC A;  3S24 A;  2R85 A;  4JI1 Q;  4P75 A;  1JOQ A;  5FJ8 G;  4FM9 A;  5KFB A;  2N3S A;  2R93 G;  3BVG A;  3V05 A;  2L9H A;  4KK7 A;  3TN2 A;  1SNP A;  3Q8R B;  1I5F A;  2R93 B;  1S5D D;  2NUA B;  2WYO A;  4MN3 A;  1KDA A;  3T56 B;  2FPP B;  1EY7 A;  5M3M G;  3I90 A;  3S17 B;  5KFZ A;  5K5P A;  5M3M B;  1QZG A;  4O4I F;  4LFB L;  4DV4 L;  4K0K L;  4KN7 C;  2VR1 A;  3G8C A;  2K32 A;  4J9S A;  4XQQ A;  4UPA A;  3OW7 A;  3L9A X;  2WKD A;  1IYU A;  3L3O C;  2N88 A;  1GJX A;  5CA0 F;  2W6N A;  3PN1 A;  1DM0 B;  4J9R A;  1UE7 A;  1K8A C;  1UE1 A;  3IAY A;  5JAV A;  2JEA I;  3K3V A;  2RVL A;  3PSI A;  3BJU A;  5CA1 F;  3J81 E;  4B3T H;  3QOL A;  2ZTE A;  3CQZ B;  2B2V A;  1QOH A;  3PGZ A;  1I6H H;  2K14 A;  4JI7 Q;  1I94 Q;  3HOY H;  4ECV A;  3QB3 A;  3MWE A;  3RAX A;  1PDQ A;  1D5X C;  4ZUJ A;  1HZA A;  3ORR A;  2Z1C A;  3RD4 A;  1KL9 A;  1HH2 P;  2PZT A;  1XNQ L;  2SNM A;  3RBD A;  4IRC A;  2QF7 A;  3S1Q B;  3RZD B;  1HNZ Q;  2W7P A;  3RIZ A;  4A3I G;  2ASD A;  4DV5 H;  2KED A;  5C44 G;  4X62 H;  2AQ4 A;  5M5Y H;  4YQW A;  2LXJ A;  3EN2 A;  2ASJ A;  4OHJ A;  2ZTD A;  4A3I B;  1SFO H;  1VQ7 A;  1YNN C;  5C44 B;  1A2U A;  5JPN C;  5DLQ E;  1K9M C;  2ZM6 H;  5KYL A;  1IYJ B;  4LF4 L;  3NUC A;  3BAA A;  4MA0 A;  2F4V Q;  4IUU A;  3LP8 A;  4GOP A;  1TY0 A;  1ZHQ A;  5DNF A;  1H95 A;  3RAQ A;  2B63 G;  2EXZ A;  2GVA A;  1PHJ A;  1UEA B;  5FD5 A;  1Y69 U;  1KNE A;  1S0N A;  1QJO A;  2WAC A;  2B63 B;  3MXN B;  1XJV A;  4HN7 A;  4BA2 I;  4EBD A;  3C1F A;  2B8F A;  4KY7 A;  1J5E H;  4YIJ A;  2M9V A;  2F0H A;  4PMC A;  4R9W A;  3FKI A;  5H80 A;  5DGA A;  4MV8 A;  4C1N K;  2F0T A;  4DKA C;  1BR9 A;  1PZI D;  1MZB A;  5KG3 A;  3DUZ A;  3DM1 A;  4HED A;  1AE2 A;  4DAP A;  2C00 A;  3AFQ A;  1SNC A;  5ELO A;  4OIJ A;  2CW7 A;  1VMC A;  4F4X A;  2FLN A;  2UU9 Q;  5EWG A;  2RHS B;  1Q7Y C;  3J7A F;  1G51 A;  1QVF A;  5EWF A;  5NUC A;  2EZV A;  1LTB D;  2D62 A;  3MJF A;  4J9N A;  3DM3 A;  4LH7 A;  5IE8 A;  2R86 A;  1AUX A;  4EQO A;  4HR7 B;  5I2X A;  3OTO H;  5DLG A;  2M05 A;  1EIY B;  1FJG H;  1ZEQ X;  1S0M A;  3A74 A;  4YCV A;  4ECW A;  1I4R A;  5LMN W;  5I6W A;  3QIA A;  3PF5 A;  1WTH A;  3A56 A;  3HEJ A;  3QG1 A;  1EY5 A;  2UXD L;  2YZG A;  3R5X A;  5GRO A;  5HUR A;  3GV5 B;  2JQO A;  1NY4 A;  3CW2 C;  2NVT B;  1DV1 A;  4O4H F;  4ZKC B;  1CKN B;  2NZO A;  3P1H A;  4JV5 H;  1STG A;  1N32 Q;  2RCF A;  4IUV A;  4KD4 A;  1X3F A;  4MNO A;  4IAJ A;  1DON A;  2AWO A;  4N8F A;  1EEF D;  5C5J A;  1YJ9 A;  2LFN A;  1GUN A;  4DL3 A;  5KFY A;  1WTV A;  5BR8 Q;  1A3V A;  4NXN H;  3GQC A;  4I7A A;  4FXG C;  1E1O A;  4X65 Q;  2HVR A;  1HNX H;  1PFN A;  2RCN A;  1L1O B;  2R7Z G;  4J15 A;  3G6X A;  1G6P A;  3VMM A;  3PVX A;  3GTP A;  3T4A C;  2R7Z B;  3DEO A;  2OEO A;  1BO0 A;  1Q1B A;  1CUK A;  3VR3 A;  4RMF A;  4RB3 C;  1NR2 A;  5D3I B;  4LF6 H;  3TEH B;  4JI0 H;  1BXR A;  3QR8 A;  1RDP D;  1QZH A;  3SI8 A;  1EQR A;  1Q82 C;  1K28 A;  4JI5 Q;  1II3 A;  1JX4 A;  5KFE A;  4F87 A;  2HQE A;  2RHQ B;  3VR4 A;  1K0R A;  4ZYS A;  2R93 A;  1K8O A;  2F0U A;  2E2H B;  3MAQ A;  1EUC B;  1ROD A;  3ORQ A;  3AB9 A;  1KLU D;  2R7D A;  3I4M G;  4HIO A;  4IRK A;  4IPH A;  2LY7 A;  4ULL A;  3D4R A;  4X64 Q;  2EQS A;  4ZRZ A;  1B33 N;  3I4M B;  3RJ0 A;  3GTL B;  1IBK Q;  3TRZ A;  4CJ0 B;  2FMC A;  3KOJ A;  4RWS C;  4JI1 L;  3JSN A;  2XSC A;  5ELB A;  3T1H L;  1WOC A;  4IO9 A;  2QK4 A;  1TT2 A;  4R4Q A;  1F2Y A;  2BDO A;  2B2W A;  2JXM B;  1WD1 A;  1PTO C;  2K50 A;  3CU7 A;  4JI3 Q;  3RUP A;  2A74 C;  1SNM A;  1IXR A;  4G57 A;  4GC7 A;  4EFE A;  3BVZ A;  3G6Y A;  4ED3 A;  4YY3 Q;  3CQZ A;  4FBU A;  4LUZ A;  2B2V C;  1HFN A;  4LF5 L;  1G2S A;  2JA8 H;  2XC9 A;  4UCO A;  3LNN A;  2HVS A;  1P16 A;  1NMF A;  1TWG H;  2XIW A;  5L9X A;  1K3B C;  1RYS A;  2PQA B;  4LUV A;  4HCE A;  5COY A;  4OEL B;  4UDU C;  5FLM G;  3R23 A;  3MXG A;  5EDW A;  1HXY D;  1E3P A;  5F9L A;  2BOS A;  3TIG A;  3RTX A;  4A3G H;  4GN3 B;  3DWA A;  3EVQ A;  4X66 Q;  1VQN A;  2PMZ B;  4CDF C;  2B3G A;  4BY7 H;  3HS0 C;  2NVQ H;  3GTG B;  1C3O A;  3ND9 A;  5KYI A;  4NXM H;  3TRE A;  4DAY B;  4JI7 L;  2B2T C;  4P72 A;  1ILP A;  3S1N H;  2Z4I A;  3GTK B;  1BXT A;  3OOC A;  3I55 A;  1GHK A;  5L1L A;  2UUB Q;  3QFF A;  1NNX A;  1XMO H;  3MVV A;  2CVR A;  4DR1 Q;  3K0Y A;  2SCU B;  5KFD A;  4WD3 A;  4EBE A;  2XWB B;  3SHL A;  3K0X A;  4HCS A;  2DPI A;  2V9W A;  3I8Z A;  4DL4 A;  1PZK D;  4J9M A;  4YB8 B;  2WP8 J;  1LTL A;  3MXU A;  4DR7 H;  5T1G A;  4KV6 A;  4GKJ L;  5IYB G;  2F4I A;  2Z0S A;  1BCP F;  1K1S A;  4JBW A;  4QWD A;  4N9P A;  1GSA A;  2IHE A;  4A3D H;  1RJP A;  2B63 A;  3MXN A;  4X3K A;  1V43 A;  4PZ8 A;  5CV8 A;  1ZKO A;  3EA6 A;  4LFA H;  1STY A;  3D4W A;  4NMZ A;  4YAK B;  1AN7 A;  1LYL A;  3TP7 A;  5C0X H;  2JA7 G;  1CQI B;  1I7L A;  2W6Z A;  1EL0 A;  3BZC A;  2N49 A;  2Z6B A;  3ZJY C;  1MIU A;  4YBZ B;  2JA7 B;  1UEB A;  1C48 A;  3PW2 A;  1TS4 A;  5C6A A;  2YL2 A;  5KFG A;  1B3A A;  3NBH A;  3CC7 A;  1HRJ A;  3BYY B;  3GIL A;  2XD4 A;  1LTT D;  1X3Q A;  1UAP A;  1GHJ A;  1ENC A;  2XVS A;  2UVV A;  2UUA H;  1AE3 A;  2PN1 A;  3N42 B;  4HR7 A;  3RR5 A;  2JA5 H;  3TP5 A;  2HGS A;  1O80 A;  1RTN A;  4UP9 A;  4F88 A;  2F0K A;  2F0V A;  4HIM A;  4WRD A;  5DLF A;  2K01 A;  5IYC H;  3K5M A;  4POG A;  2W6Q A;  5LMU Q;  1OXT A;  4FF2 A;  5AFW A;  3MR2 A;  2F0F A;  1KAW A;  3J80 E;  1YIT A;  2UU9 L;  3HOU G;  2YYA A;  3UQ8 A;  3MR6 A;  1EHI A;  1RL2 A;  3T51 B;  1CKN A;  5EPL A;  4ECY A;  1CZG A;  3UI2 A;  3HOU B;  4JI4 Q;  1WFQ A;  4EVO A;  2LS0 1;  2BCO A;  3ICE A;  1HR0 H;  1O78 A;  5J2T F;  3KJO A;  4B3M Q;  2VUM G;  5LHY 1;  3TQY A;  4HNT A;  1L1O A;  2KHJ A;  3J80 W;  3TZU A;  3OHA A;  2K7V A;  1QB5 D;  2R7K A;  2VUM B;  4CC6 A;  2R61 A;  4MV1 A;  2R7Z A;  5IP7 H;  4R4I A;  3LWU A;  2RSN A;  1MJE A;  3BDO A;  4LSX A;  2ATL A;  5LMN Q;  2EIF A;  2AQ1 B;  5BMV F;  2J6T A;  3S2D H;  2RDI A;  4MV4 A;  3GTJ H;  5L37 A;  5HGQ A;  4DR3 H;  2AHO B;  3ULJ A;  1CE8 A;  4HID A;  3GII A;  3BVM A;  2N8N A;  3PUY A;  5DG8 A;  2F3W A;  2BE5 D;  2ZJQ A;  3C2P A;  1E1T A;  1KEE A;  2E2H A;  1H9M A;  5J2U F;  2FK3 A;  2A6E D;  3S2H B;  5DGB A;  4IZO A;  3T5L A;  2I0Q A;  2Q8R E;  1Z9F A;  5C4H A;  4HSV A;  3ERO A;  2QDB A;  3A55 A;  3VR6 A;  2NN6 H;  2OH2 A;  3MA2 B;  3GTL A;  2GVB A;  1E2Z A;  1R9T A;  1S3O A;  3Q8Q B;  4LFC L;  5M3F G;  1ULZ A;  1OXX K;  3GQB A;  4C3H G;  4DV0 Q;  1Y1W H;  3RMH A;  5AJ3 Q;  5COR A;  1SEI A;  2B2W C;  2NZH A;  4JI5 L;  1STA A;  1B3Q A;  4AQY Q;  5M3F B;  2QEX A;  4C3H B;  2VQF H;  4RZR A;  5CGK A;  1GOZ A;  2DJG C;  5K2M A;  5C3E H;  1TA8 A;  5C5L A;  1ESR A;  5E3F A;  2P0A A;  1XTD A;  4ZI7 F;  3IKJ A;  4QB4 A;  2PZU A;  5FO8 B;  1EIH A;  1EOT A;  4H13 C;  1C0A A;  1YJW A;  2NTS A;  1IBK L;  2R8I A;  1ZET A;  2VQE Q;  3M85 A;  3HOZ G;  1X56 A;  2PQA A;  1JE4 A;  2I5L X;  5KG2 A;  1O7Z A;  3F2U A;  3HRZ C;  2IPK D;  5EPJ A;  4QUF A;  4X3U A;  3CCR A;  3M9O B;  4JI3 L;  3HOZ B;  1TU2 B;  1JJC B;  4ME6 A;  4JBM A;  2L55 A;  1GSO A;  1H9J A;  1D5Z C;  4OX9 L;  2ASL A;  4YY3 L;  4A3E H;  5DQG A;  3PZP A;  4DV1 Q;  2PMZ A;  4A3L H;  1W96 A;  2BH8 A;  2KSW A;  4K5V A;  3DF7 A;  2K5D A;  3SEB A;  1TWC B;  2XCP A;  1E2V A;  3BA8 A;  4DV7 H;  3ETJ A;  3GTG A;  1JE5 A;  2K75 A;  1EUD B;  2MP1 A;  1CS0 A;  4DAY A;  1JJ2 A;  2QIL A;  1A6X A;  4BXX G;  4DV4 Q;  1PRT B;  1VQD A;  3FKI H;  5D1P A;  1EZ6 A;  2MO0 A;  4CBV A;  3I3C A;  3JAM E;  1AW7 A;  3OW2 A;  2YRW A;  2EY2 A;  4ZLT F;  5IP9 H;  2F0I A;  4L5Q A;  2VPS A;  5IYZ F;  2R8K A;  4X66 L;  3F8T A;  5KT6 A;  1I4G A;  5JJI A;  3H91 A;  3PO2 G;  2PQE A;  3S15 H;  4EEY A;  1SND A;  2Q2U A;  3GTM B;  4A3B G;  3JAM W;  1BCP D;  2H4O A;  4TV9 F;  1JDE A;  2ES2 A;  2UUB L;  3PO2 B;  3GLK A;  4G7Z C;  3WDN A;  1SYC A;  3VYS A;  3VPD A;  4A3B B;  4L5R C;  1PTO B;  1RD9 D;  2KCM A;  1E0B A;  4FP5 D;  2B39 A;  4CDD C;  1K83 B;  2IT1 A;  1Z6H A;  1WVL A;  4YAJ B;  1HNW H;  2PMZ E;  2UVW A;  2JA7 A;  1DIK A;  1T3N A;  2A68 D;  2BH2 A;  1ICW A;  3EPI A;  4Y7N B;  4DUZ Q;  4LF8 H;  3S14 H;  3S16 B;  3ULL A;  4O3P A;  4OXP A;  1SMY D;  3GIJ A;  3K5H A;  3HP3 A;  3NBI A;  3CCE A;  3H4D A;  4BS9 A;  4ECX A;  4LFB H;  4K0K H;  1M1K C;  4MTD A;  5EKK A;  4RCN A;  4DF7 A;  3UDF A;  4CJ2 C;  1CQF A;  4DV6 L;  5KRU A;  2YW2 A;  4QW8 A;  1HJP A;  4LF4 Q;  2AGQ A;  2K5Q A;  1YEZ A;  4B9W A;  3OMG A;  4YHH Q;  2G9H D;  3J81 j;  4B08 A;  4L5S A;  3M7N A;  3GTP H;  4TKO B;  3NHH A;  1C9O A;  1ASZ A;  3I56 A;  1SJE D;  1VQE A;  3M4Q A;  1VQH A;  2IY5 B;  4XX0 B;  4I7Z C;  2W71 A;  1S03 G;  1RJQ A;  1XMQ L;  5M5W B;  2HQL A;  1A63 A;  4Y52 H;  3H40 A;  1XX8 A;  2E5L L;  4DNI A;  1VS0 A;  4CJ1 B;  2HIX A;  3M9N B;  2M2L A;  4J9Q A;  3FMC A;  3TQT A;  5FJ8 H;  2J6U A;  2ENB A;  2R93 H;  3KBX A;  1JR0 D;  4JK1 C;  2WB1 G;  5LMU L;  1VQJ A;  1XNQ H;  2VUM A;  5KFA A;  1VBH A;  4JI2 Q;  1GVP A;  4BBR G;  3T5H A;  5C4J B;  2NVX H;  1YHB A;  1YNX A;  2WB1 B;  3TSS A;  3S17 H;  3KHH A;  3OWE B;  5KG4 A;  1XNR H;  1NUC A;  1N33 H;  1CFM A;  4ECT A;  2FK1 A;  3PV0 A;  4WJW A;  5C4X G;  3M3Y B;  4BBR B;  3J81 i;  5D65 A;  5FO7 B;  4JI4 L;  4XYM B;  3D6W A;  1B50 A;  3HBL A;  1ENA A;  1EIF A;  5KFL A;  5C4X B;  4B3M L;  2FP4 B;  4BWG B;  1O75 A;  1A0I A;  3SK8 A;  3KAL A;  2JSO A;  3N52 A;  5KG7 A;  3WOE A;  3A0J A;  1V1P B;  4F50 A;  4UCU A;  2OQK A;  4DUY Q;  5KFT A;  3QWN A;  3KF6 B;  3PO3 G;  1M0W A;  3CQZ H;  4N8X 1;  1B7Y B;  5LMN L;  4JYA H;  2XTI A;  3PO3 B;  4IZ8 A;  2BR0 A;  2AGP A;  4MAM A;  1F2Z A;  4NKL A;  3URY A;  3R5H A;  2CCZ A;  4A2A A;  3T5K A;  5C8Y F;  4B3S Q;  2MO1 A;  1PH1 A;  2FHT A;  3RN2 A;  4U7C A;  1WJJ A;  1HA5 A;  5EZY F;  1ET6 A;  1MSG A;  3HKZ G;  1EWI A;  3S1Q H;  4RU9 A;  1AZQ A;  4JCV E;  1JOK A;  3OPO A;  1KNA A;  5JEA G;  3GTO B;  4MHE A;  4QCL A;  3HKZ B;  3KLS A;  2C2R A;  4R8N A;  4DK6 C;  2QA4 A;  1I50 B;  4EFB A;  2HUG A;  2DUD A;  3M4O H;  2IJ0 A;  4IUT A;  5EJW A;  2R87 A;  4OO1 G;  3CCL A;  2RDF A;  1SYB A;  4DV0 L;  3A7L A;  4LMQ D;  5AJ3 L;  1K73 C;  5GQO A;  1GGO A;  4AQY L;  4JBK A;  2GA4 B;  1K8G A;  1PA6 A;  3CCJ A;  2VY3 A;  3ONA B;  4O3R A;  1BF4 A;  3MFG A;  3MTS A;  3K7A B;  2FPI B;  2FLL A;  4ID6 A;  1AFP A;  3GID A;  2SOB A;  5EQ0 A;  2R7F A;  1UNN C;  3HGB A;  2IL8 A;  1UWV A;  4KY5 A;  2YTV A;  2UXD H;  3OHB A;  1TWC A;  2ICE C;  2UVR A;  1V8Q A;  3J81 c;  1EYA A;  2YZN A;  1UNS A;  2KEE A;  2VQE L;  4HJ9 A;  3T1H Q;  4QY7 A;  4Q45 A;  2RF4 A;  4HMJ A;  5HV6 A;  2AU0 A;  3VYT A;  2WAQ G;  4C2M B;  4QGU A;  5C1P A;  1O7Y A;  3ERQ A;  5FK9 C;  3SXH A;  5KFV A;  2WAQ B;  2Z6K A;  3NE5 B;  5IWA H;  4BY1 H;  2O2L D;  4DV1 L;  2QEJ C;  1EFW A;  4JV1 A;  2JA6 A;  1IKL A;  1EY8 A;  2NBF A;  5DG7 A;  1KJI A;  3SVM A;  4C5A A;  1WTQ A;  2HHH L;  4DL6 A;  4MV6 A;  1X9N A;  4LF5 Q;  3GTM A;  3PW7 A;  1WR2 A;  5K36 H;  3CC4 A;  2EJF C;  2PW7 A;  3H4B A;  4IFD G;  1JIC A;  1Q86 C;  2ZJR A;  3D4D A;  3AMU A;  1CM9 A;  4ECU A;  1DOM A;  2P5Z X;  4K8I A;  3GTQ B;  3KAJ A;  3BQ2 A;  1K83 A;  2IA6 A;  3R2T A;  1S68 A;  2A6H D;  2KHS A;  4UCS A;  3NWT A;  2NVT H;  1U5K A;  1JMC A;  4FXK C;  4PV1 C;  1CQV A;  1PX2 A;  3U50 C;  1IBL Q;  4QQB X;  4APM A;  2DNC A;  1ZXT A;  1CA6 A;  2RDH A;  3I2Z A;  1Y1V G;  2RBM A;  2VZA A;  2L15 A;  5LL6 b;  2AWN A;  2KVM A;  4JI1 H;  2CW8 A;  1AEX A;  1GYF A;  3CC2 A;  2ZM6 Q;  1S0O A;  1VMP A;  1Y1V B;  1SYE A;  5JEA J;  3G4S A;  3V96 A;  1QWY A;  1LUZ A;  3PIP 3;  3J7Z C;  4DR4 L;  2F0N A;  3KF8 B;  4L63 B;  2MHV A;  3Q8D A;  3GDE A;  4GKJ Q;  2J6S A;  3V4Z A;  3I4O A;  3NSW A;  4DUZ L;  2QYZ A;  1DZ1 A;  4MV9 A;  2KJX A;  4IQZ A;  4O1N A;  3U58 A;  2YU9 H;  2E76 C;  1AH9 A;  5DM6 3;  2Q2T A;  1DD2 A;  5FD6 A;  2JYO A;  2B2T A;  3K58 A;  1JQY D;  4KKU A;  4AYB E;  3DXJ C;  1IW7 D;  1SDF A;  2NZ1 D;  3LGJ A;  2X0S A;  1KJ9 A;  4A3J G;  3SGI A;  3S9W A;  1UC8 A;  4ZHQ F;  3QO2 A;  4H44 C;  4LMY A;  4YHH L;  3S1R H;  2K4K A;  2C28 A;  4ZKB B;  4JW0 A;  4A3J B;  1QUQ A;  3G48 A;  4HJA A;  4A76 A;  3RV3 A;  2WB1 A;  5C1O A;  1XPU A;  1KAB A;  4XQN A;  2KCN A;  3GTL H;  3BU2 A;  3C0F B;  1M0T A;  3V2T A;  4KLK A;  4ZOL F;  3KLW A;  3L0O A;  3H3V C;  1I94 H;  2EY6 A;  4JI7 H;  4XT1 B;  1EQV A;  2VB2 X;  3MWM A;  2KHI A;  1IBM Q;  2N55 A;  3TZD A;  1TVX A;  4FF1 A;  4G7O C;  3H6M A;  3MEF A;  2OTJ A;  4IOC A;  4DU9 A;  3KLR A;  1V1P A;  1CI3 M;  1H9K A;  2V4D A;  3X3M A;  4A3K H;  2K5N A;  5JPM C;  3GO5 A;  3KF6 A;  4JI2 L;  5KG1 A;  1VQB A;  1HNZ H;  3BZD B;  4ODG A;  3N6R A;  3N41 B;  1F9Q A;  1TKW B;  5ELC A;  1VQL A;  3NBH B;  3AFP A;  2Q8I B;  4KHV A;  1SJH D;  3K7U C;  1VQG A;  4APV A;  3VR5 A;  2A19 A;  3U9T A;  4O3O A;  1TWF H;  3NEM A;  1SNO A;  3KUP A;  2F0W A;  2KQ3 A;  4G7H C;  5C3X A;  3F2C A;  2F4V H;  4TVA B;  5KFH A;  2XGT A;  3MC0 B;  3N8D A;  4DUY L;  2WB1 E;  5FLM H;  3GTO A;  4QUC A;  3KHG A;  3RZO B;  1WTX A;  2BE5 C;  2VOB A;  3HKZ A;  3FHW A;  3Q8S B;  3J80 L;  3K81 C;  3DLL A;  1I50 A;  1TWA B;  4RGM A;  4DA2 A;  3OUU A;  2A6E C;  4B3R Q;  2JE6 I;  4A3F H;  4RNM A;  5KFX A;  3E0J A;  2UVU A;  2FIN B;  2RA4 A;  4O3N A;  3GTK H;  3I70 A;  1PYB A;  1HZB A;  1F2M A;  1VQM A;  4B3S L;  1UE5 A;  3NQI A;  2JK8 A;  3CF5 A;  3W3A A;  5CYU A;  1CK1 A;  4DR6 Q;  5CV9 A;  4YR2 A;  1SRO A;  3HB9 A;  4LSA A;  3K5N A;  5KIX A;  1TWH B;  2EYJ A;  2LKV A;  1RF2 D;  2E2J B;  2UU9 H;  3A8I E;  1D8L A;  2UXB Q;  3UFX B;  5IGE A;  3LWB A;  1Q3L A;  5IYB H;  5KFU A;  1RK5 A;  1QNU A;  2ALY B;  3MEH A;  5CV7 A;  3RN5 A;  3HOW G;  2I5H A;  1JB7 A;  1I6H B;  1PRT C;  2Y0S G;  3KLS X;  4TRD A;  4LFC Q;  1PH8 A;  5KFN A;  2KOL A;  2E2I H;  4C2M A;  4DXG A;  1W2B A;  3JRW A;  5L1I A;  3HOW B;  4GLA C;  5L1K A;  3NP8 A;  2Y0S B;  2WAQ A;  5I2Y A;  3HKZ E;  4JV0 A;  2JA7 H;  4FYD A;  2Z6K C;  1YBY A;  2F0D A;  3J80 i;  2A5H A;  4H7B A;  4HJ7 A;  4CC5 A;  5IY0 A;  4FNF A;  3JZI A;  1HQR D;  1N32 H;  3R3O A;  1WCM H;  1R9T B;  3TIN A;  2QW7 A;  1S10 A;  4GLV B;  4ME3 A;  4PG3 A;  1GM5 A;  2NU6 B;  4JI6 Q;  2X6G A;  3N40 P;  1SEB D;  3PW5 A;  4RKB A;  3GTQ A;  3P7J A;  4LW1 A;  2DY8 A;  5BR8 H;  2L0C A;  1G2T A;  4CKE A;  4X65 H;  3FVQ A;  4C5B A;  2K1B A;  4QWE A;  1LTS D;  5HY6 A;  4OX9 Q;  1RIP A;  2LXK A;  4QL5 A;  4XYL B;  1F2L A;  2FXQ A;  4C5C A;  1K0S A;  3N43 B;  2K03 A;  4B3T L;  1AP0 A;  5KT4 A;  1U4P A;  4F7X A;  1C7Y A;  2VNU D;  3CCS A;  3NTK A;  4IOA A;  4J9L A;  4Y8V B;  4ETS A;  3L4K A;  2PNH A;  2CH4 W;  4A3C G;  1XPO A;  4FS1 A;  1B1Z A;  3AEV A;  1JKJ B;  1Y1V A;  2WAQ E;  2YV5 A;  1S4Z A;  3Q6S A;  5E7N A;  4BWS C;  4JI5 H;  1BCP C;  5E1F A;  2VUM H;  4XYO A;  3K3P A;  3KF8 A;  2E8G A;  1VAJ A;  5KFP A;  5KFW A;  4Q8F A;  1BGW A;  2F52 A;  4DV5 L;  1IBL L;  4X64 H;  1EY9 A;  4CHT B;  2A68 C;  1JDB B;  1I7N A;  1TII D;  2FJ2 A;  2MFI A;  1IBK H;  3MFI A;  3KJP A;  3RLF A;  1SMY C;  2ZM6 L;  2HIV A;  1PYS B;  3T5J A;  3MFY A;  3JAM L;  4JI3 H;  1N34 H;  2UXC Q;  1SLJ A;  1S40 A;  1V9P A;  3RB6 A;  2WV6 D;  3FDT A;  4LF9 Q;  4YY3 H;  3J80 c;  3PIP A;  3WWV A;  4C56 C;  3AQQ A;  1PFM A;  2RKS A;  1EY4 A;  3NTH A;  4ED0 A;  1ENF A;  4ALP A;  2R82 A;  1C30 A;  1I4Q A;  3SE0 A;  3BG3 A;  5M3F H;  1LT4 D;  4C3I G;  4CKC A;  2AQ2 B;  5J22 A;  3EPG A;  4GKK Q;  1E22 A;  2H1E A;  4DV6 Q;  1O7L A;  1LO5 D;  4RHR A;  3U9O A;  1D7Q A;  1Q1E A;  4C3I B;  1RHP A;  1SRU A;  1ASY A;  3M9M B;  1ILQ A;  1HHV A;  5DG9 A;  4JV2 A;  3KYH C;  1EY6 A;  2BA1 A;  3J7Y W;  4KJO A;  4X66 H;  1HUN A;  4J1M A;  1EUJ A;  1O7I A;  5IT9 E;  2CKZ B;  2DPJ A;  5IYD G;  1XMQ Q;  2BDN A;  3C1E A;  2NU7 B;  3T1Y H;  4RCO A;  2E5L Q;  1P8L A;  2ZTC A;  5C3W A;  5IGD A;  4R4O A;  1IBM L;  1VQC A;  4DN4 M;  2UUB H;  1NSN S;  4MIU A;  4DR1 H;  3JAM i;  5J1Z A;  3VYR A;  5IT9 W;  2QGQ A;  3H15 A;  3VPB A;  4DAM A;  1T94 A;  1TWA A;  4FVM A;  3CCU A;  5EWE A;  5FO9 B;  2X69 A;  4PZ7 A;  5GAD C;  1RJT A;  1MJC A;  5CBA E;  4RZQ A;  5I9P A;  1ZYR D;  1NCV A;  3HG9 A;  4J6H A;  4J9P A;  4BXX H;  4A93 H;  4DL5 A;  2ZT9 C;  4RNO A;  2UUC Q;  5DQI A;  2R8G A;  3T16 A;  4IN3 A;  1TWH A;  2IX0 A;  1STE A;  2VQD A;  1LAB A;  4GN4 B;  4K2K A;  1X65 A;  2H5X A;  2JA6 G;  3M4Y A;  4B3R L;  3RB3 A;  1X55 A;  3KFU A;  4MV7 A;  3GTM H;  4YCU A;  2R6F A;  1OO9 B;  2JA6 B;  4LF6 L;  2TMP A;  3ZYY X;  3OSO A;  2ASB A;  4KHP H;  2PI2 A;  2F0J A;  3PO2 H;  1GUS A;  3CCV A;  3GV8 B;  4FS2 A;  3CPW A;  3TQ1 A;  4HMI A;  3PCO B;  1U9R A;  1PTO H;  2R8H A;  4DR6 L;  1ET9 A;  3A8K E;  3Q1K A;  2Y0S A;  3VA5 A;  3MWD A;  1ZQ7 A;  2B2Y A;  1QCB D;  5LMU H;  1H9S B;  1RKN A;  3RF2 A;  3A8J E;  1N36 Q;  5J3B A;  4IUR A;  1WTP A;  4L5T A;  1L0W A;  4Y7N H;  2R7M A;  3R8B A;  4BY7 G;  3G6E A;  2UXB L;  5EPK A;  5IGC A;  2YYZ A;  1CSP A;  1LT3 D;  4IJH A;  4I65 A;  4BY7 B;  2BQR A;  1T5E A;  4PZ6 A;  5IOD A;  2NVQ B;  2D9U A;  1JT8 A;  4JI4 H;  5FLX E;  1WI5 A;  3M4P A;  3CVZ A;  3R93 A;  3M4I A;  4DR5 Q;  3JAM c;  4JI8 Q;  1RK6 A;  1M90 C;  2Q8T A;  2W70 A;  4DV3 Q;  5BPF A;  4A4I A;  4NP5 A;  2R7N A;  4ED8 A;  3H3V I;  3H0G G;  2DY7 A;  2K6A A;  3UE0 A;  1N8R C;  5M5W H;  3RBE A;  4OWX B;  3HOX G;  5LMN H;  1Y14 B;  2EDG A;  4DV7 Q;  3VR2 A;  4A3D G;  2PI2 E;  1J9O A;  3W1G A;  5FPO A;  5FLX W;  5LOV F;  3PR5 B;  3IFT A;  1H9R A;  3H0G B;  4DV2 H;  4JPB W;  4Q8E A;  1KAA A;  5HGT A;  3HOX B;  4JI6 L;  3CHB D;  5EOY A;  3N44 B;  4OIK A;  4A3D B;  5KFR A;  2Y0S E;  3PUV A;  1HUM A;  1VQI A;  2OF1 A;  4IJL A;  4LF7 Q;  1AN8 A;  4MV3 A;  1IZ6 A;  1C8C A;  2D5D A;  3Q0A A;  4HIK A;  1Z2P X;  5C4J H;  4I7H A;  1I3Q B;  3I91 A;  5LL6 S;  4IPC A;  1YHQ A;  4DPG A;  4MA5 A;  1LT6 D;  3U4V A;  2OCE A;  2MJ8 A;  2A6H C;  2SNS A;  4DR2 Q;  2HHH Q;  1E4E B;  3F8N A;  4NXM L;  5C4X H;  1OWT A;  3K59 A;  3CXC A;  4DV0 H;  1NBW A;  3U9S A;  3A5U A;  1KBL A;  1CZW A;  1T5X D;  3RUZ A;  4RGT A;  1XMO L;  4RUA A;  4AQY H;  4J8Q A;  4NDX A;  3DHQ A;  4FXD A;  4X6A H;  2W6O A;  4EEQ A;  1HNW Q;  2V4Q A;  3DWQ A;  4ECS A;  2X6L A;  3W2D A;  3IN5 A;  4EX5 A;  2EE1 A;  5DAU A;  1VQ4 A;  1F77 A;  5CR3 A;  5JQW A;  5KG6 A;  1F9R A;  1F9S A;  1JIH A;  4J0M A;  4K5W A;  2FJZ A;  2VQE H;  4F8M A;  4PWQ A;  4AYB G;  1Q81 C;  1MD2 D;  3KHL A;  1C4Q A;  2W6P A;  4UP8 A;  2F0E A;  4RB1 A;  5D1O A;  2C35 B;  4AYB B;  1IW7 C;  3GTO H;  2ZXR A;  3RNU A;  2RDJ A;  3NGD A;  2UXC L;  1YI2 A;  1KD1 C;  5IP7 G;  2XRQ D;  1W3S A;  1X3G A;  2MNA A;  4R4C A;  4LF9 L;  2R92 G;  4DR4 Q;  1CHP D;  4ECZ A;  4BBS H;  3NTI A;  5JEA H;  4IUN A;  1EOV A;  1YVC A;  1UE6 A;  3TDQ A;  5CBE E;  4XZ3 B;  5KFO A;  2C2E A;  3NEN A;  2R92 B;  3PW0 A;  4XIG S;  1B53 A;  1JWM D;  1PH3 A;  3PW4 A;  4KHZ A;  2ID0 A;  2DN8 A;  3ER0 A;  2FMA A;  5KFK A;  1L0Y B;  3UE1 A;  4DV4 H;  5E4W C;  2DLN A;  3S2D B;  1BBX C;  3GTJ B;  2Z8L A;  1S5B D;  2I07 B;  4GKK L;  1BCP B;  2EYO A;  2YCH A;  4ME5 A;  1E4G T;  3Q8P B;  2HCC A;  5FKA C;  5JVH 3;  2IP4 A;  3VPC A;  3M7G A;  1SYG A;  4K14 A;  3BQ1 A;  1DYQ A;  1EEI D;  1JB3 A;  1VQA A;  4G4K A;  4HSP A;  4U68 A;  4WOR A;  1N33 Q;  2V58 A;  5D8D A;  2PW5 A;  1S5F D;  3V6K A;  3P20 A;  2AUK A;  4FO2 A;  4L8J A;  2ALZ A;  1VQ6 A;  3RV4 A;  5JUM A;  2F03 A;  3HKS A;  4R8I A;  1JJG A;  4C2M H;  3KHR A;  5JJZ A;  4B9X A;  1D1I A;  2IX1 A;  4K6D A;  1B44 D;  1RCV D;  3H94 A;  2K05 A;  1D1K A;  1W93 A;  4NLG A;  1SN8 A;  4EGV A;  3K5I A;  3SK6 A;  2L1B A;  1SNQ A;  2B2U A;  1X3E A;  1QUQ B;  3PMF A;  1TAE A;  2YZM A;  3IG0 A;  4YR3 A;  1HTP A;  1LAC A;  4DUZ H;  1LV9 A;  4HAE A;  3G7L A;  5M3M H;  5JJK A;  3ERS X;  3PUX A;  1XWE A;  4F4W A;  2VA3 A;  2L4N A;  4KMU C;  3CCQ A;  2RGV A;  2IWH A;  5I6Y A;  2IBK A;  4LK1 C;  2ZXO A;  5G3L F;  4CKB A;  1KDC A;  4ED2 A;  5CMD A;  1G6Z A;  2R7L A;  3GD7 A;  4OWT B;  1VQF A;  1RTO A;  2UUC L;  1TY2 A;  2JEB I;  3K5L A;  3BA9 A;  4LF4 H;  3K80 C;  1ML0 D;  4ED6 A;  1H9S A;  4YHH H;  2B2Y C;  1OTC A;  3I4N G;  3VA7 A;  2DWC A;  2A69 D;  4FBT A;  3H20 A;  2N78 A;  2ZDH A;  4R4T A;  1T9H A;  3GV6 A;  3I4N B;  1WTR A;  4ZQI A;  5KNB A;  4IUQ A;  2MUY A;  5EAY A;  1E4F T;  3M9B A;  5KFM A;  2SDF A;  4L6T B;  1PYW D;  3EIV A;  3MR3 A;  1Y1V H;  4RHS A;  1LTA D;  1EYG A;  4HQ6 A;  5KG5 A;  4PDB A;  3MHB A;  4U6P A;  3GIM A;  3A7A B;  4LUO A;  4A3M G;  1B70 B;  1VF7 A;  1Q8K A;  3CMA A;  3RZD H;  1S72 A;  4PMW A;  1N36 L;  1KC7 A;  4A3M B;  1CHQ D;  1Y8P B;  1SXT A;  4PMB A;  3LML A;  2KBN A;  4DK3 C;  4TQU S;  4EQP A;  1Q12 A;  1V1O A;  2YTX A;  4UCV A;  2HDL A;  4A3I H;  3CME A;  1EU3 A;  1U0L A;  3H0G A;  2FFK B;  5C44 H;  3D8G A;  2VS1 A;  2IMW P;  4ABN A;  3TII A;  3S15 B;  1E24 A;  4QIW B;  4DR5 L;  1EY0 A;  2EYM A;  1BKB A;  2HJW A;  1B2T A;  4JI8 L;  3I72 A;  4A3J H;  1DGS A;  1I3Q A;  4DUY H;  5IWA Q;  4DV3 L;  1D5M C;  1NTG A;  4IR1 A;  2E75 C;  3D3R A;  2JN4 A;  4LAA A;  1U4M A;  5ELF A;  1Q90 A;  4DV7 L;  4XT3 B;  3FMA A;  3FEW X;  1E4E A;  2B63 H;  1PH6 A;  1SYF A;  2NB0 A;  1NR4 A;  2QDL A;  1KRT A;  5M9O A;  2O5I C;  4M7E A;  3S14 B;  3BJY A;  5KFI A;  1PFB A;  1R4Q B;  4ZK9 B;  4WJ4 A;  1MBY A;  1Q46 A;  2C2D A;  5ELN A;  4B3S H;  1I4P A;  1SE8 A;  1B04 A;  1EZ8 A;  4LF7 L;  3UDX A;  1KJJ A;  1B9N A;  4MTN A;  3ETH A;  2K5H A;  5CV5 A;  2CQY A;  3FRP B;  1YHA A;  4QWC A;  1PZJ D;  2F1M A;  1RYR A;  1MI2 A;  5ELE A;  1EIG A;  1SMX A;  4GNX C;  4OO1 I;  2FLP A;  3R5F A;  3HZX A;  4B3T Q;  3FPP A;  2J9G A;  1WH2 A;  1A8V A;  3W5O A;  2J0T D;  4DR2 L;  1VQK A;  1KRS A;  3FDS A;  4F4Y A;  1IOW A;  4KKT A;  3GP7 A;  5LYJ F;  5KFF A;  4IRD A;  1KJQ A;  4N9T A;  1JLL B;  5LL6 X;  4LJZ C;  4XXE A;  5A2Q L;  4S3S A;  2NU8 B;  4IWX A;  2R3Z A;  1OXS C;  4AYB A;  3PIO 3;  3OHX C;  5M5X B;  3F2B A;  1HNW L;  3RZO H;  3UDI A;  4R7R A;  4MTE A;  4IWY A;  1TWA H;  3BZK A;  4X3S A;  1UC9 A;  1JOO A;  1M7J A;  2F3I A;  1TS2 A;  4F4Z A;  2AGO A;  1LM0 A;  3NQT A;  1G91 A;  4IR9 A;  3EQL C;  4MTK A;  2A8V A;  5CAE B;  4WBN F;  2R92 A;  4DV5 Q;  2NVX B;  4LF8 L;  4X62 Q;  3PR4 A;  3Q24 A;  5I4D A;  1DOL A;  4GS3 A;  5C4Z A;  5JVG 3;  2A1A A;  3GTJ A;  3T1H H;  3SK5 A;  1BJT A;  4ECR A;  1EFI D;  3MWY W;  3PQI A;  3STB D;  2XGP A;  4GLX A;  3DEP A;  1FGB D;  1TWH H;  3D31 A; 
#chains in the Genus database with same CATH homology
 2E2J H;  3S2D H;  4POF A;  3GTJ H;  4LW1 A;  2R7Z H;  4JYA Q;  1YIJ A;  5HGQ A;  3A5Z B;  3HOV G;  2AHO B;  3ULJ A;  4KHP L;  4HID A;  5HY6 A;  4OX9 Q;  4H02 A;  1RIP A;  4UP7 A;  2N8N A;  3PUY A;  2LXK A;  4QL5 A;  2FXQ A;  2ZJQ A;  4DR3 L;  1E1T A;  3GTQ H;  4IFD I;  5M5X H;  4B3T L;  1C7Y A;  2VNU D;  3HOW H;  3CCS A;  4IOA A;  1L1O C;  1EQQ A;  2I0Q A;  1J5E Q;  1Z9F A;  4A3E G;  2PNH A;  2NN6 I;  4A3L G;  4GOP B;  4A3C G;  2E2H H;  1XPO A;  3CAM A;  2GVB A;  3AEV A;  1S3O A;  2YV5 A;  2WAQ E;  5E7N A;  4LFC L;  5M3F G;  1OXX K;  4DV0 Q;  1YZ6 A;  1Y1W H;  1CKM A;  2VUM H;  5AJ3 Q;  2JA9 A;  1N33 L;  1XNR L;  5GAH C;  2NZH A;  4JI5 L;  1HR0 W;  2E8G A;  4AQY Q;  3I4M H;  3FKI G;  2DGY A;  2QEX A;  2Q2I A;  1R9T H;  3CP0 A;  1VQP A;  2F52 A;  5C3E H;  1G29 1;  4DV5 L;  2CFM A;  5IP9 G;  2VQF L;  1IBL L;  3L2P A;  1XTD A;  2HT1 A;  2I5M X;  2MFI A;  1KHI A;  3OTO Q;  2ZJP A;  1FJG Q;  3JC6 6;  1WYD A;  3KJP A;  3RLF A;  1C0A A;  1BBU A;  2ZM6 L;  1YJW A;  1IBK L;  2HIV A;  2NVY H;  2UXD Q;  2VQE Q;  1PYS B;  3M85 A;  1CKO A;  3HOZ G;  1X54 A;  3HOV H;  1X56 A;  2PQA A;  1QVG A;  1V1Q A;  2I5L X;  4DV2 L;  3E9I A;  3CCR A;  2UXC Q;  2GN5 A;  1SLJ A;  4O2D A;  1V9P A;  1S40 A;  4JYA L;  4JI3 L;  2MQH A;  4JV5 Q;  4LF9 Q;  1JJC B;  4JBM A;  3J80 c;  3PIP A;  3WWV A;  2OQ0 A;  3AQQ A;  4IFD J;  4OX9 L;  1PH4 A;  4YWK A;  2IHF A;  4YY3 L;  4A3E H;  4DV1 Q;  4A3L H;  2BH8 A;  4A3C H;  4ALP A;  4BBS G;  2LSS A;  1J6Q A;  4UY8 C;  4NXN Q;  4O0A A;  1JE5 A;  2K75 A;  5GAG C;  5M3F H;  2YTY A;  1HNX Q;  4BY1 G;  3KDF A;  1JJ2 A;  2D0O A;  1B8A A;  4GKK Q;  1E22 A;  4BXX G;  4DV4 Q;  4DV6 Q;  1VQD A;  3FKI H;  1D7Q A;  2MO0 A;  1Q1E A;  1SRU A;  1ASY A;  3GTG H;  1HZ9 A;  1E7Z A;  4FDB A;  3OW2 A;  3KYH C;  4JG2 A;  1VQ9 A;  2BA1 A;  5IP9 H;  5K36 G;  1EUJ A;  1O7I A;  4YWM A;  4LF6 Q;  3F2D A;  4L5Q A;  2VL6 A;  4JI0 Q;  1A62 A;  2CKZ B;  4X66 L;  5IYD G;  1XMQ Q;  3F8T A;  4YWL A;  3UDG A;  4JC0 A;  1P8L A;  2ZTC A;  2E5L Q;  4R4O A;  5JJI A;  1IBM L;  3PO2 G;  3S1M H;  1VQC A;  1KC8 C;  3S15 H;  2Q2U A;  4A3B G;  3JAM i;  2ES2 A;  2UUB L;  4C3J H;  4HJ5 A;  3S24 A;  2QGQ A;  3H15 A;  4L5R C;  4JI1 Q;  4DAM A;  2KCM A;  4P75 A;  5FJ8 G;  4HJ8 A;  2IT1 A;  3CCU A;  2N3S A;  2R93 G;  3HOY G;  2PMZ E;  4PZ7 A;  5GAD C;  1MJC A;  3AYH B;  2BH2 A;  1I5F A;  4C3I H;  1BVS A;  4DUZ Q;  3S14 H;  3ULL A;  4OXP A;  4BXX H;  5M3M G;  3CCE A;  5IWA L;  4A93 H;  1KQS A;  2UUC Q;  4P71 A;  1M1K C;  3UDF A;  1QZG A;  2IX0 A;  4WJ3 M;  4LFB L;  4DV4 L;  4DV6 L;  4K0K L;  4GN4 B;  1HJP A;  4LF4 Q;  1X65 A;  2H5X A;  2JA6 G;  1YEZ A;  4UPA A;  4YHH Q;  3J81 j;  4L5S A;  3M7N A;  4QIW E;  4B3R L;  5IYD H;  1X55 A;  3GTP H;  1C9O A;  1ASZ A;  3KFU A;  3I56 A;  3GTM H;  1VQE A;  4YCU A;  3M3Y H;  3M4Q A;  1VQH A;  4IPG A;  1N9W A;  1UE7 A;  4LF6 L;  2IY5 B;  1K8A C;  1UE1 A;  2ASB A;  2PI2 A;  2JEA I;  3PO2 H;  3CCV A;  3CPW A;  1XMQ L;  3PCO B;  2HQL A;  1A63 A;  3PSI A;  4Y52 H;  3BJU A;  4DR6 L;  2KEN A;  2E5L L;  4RG1 A;  4DNI A;  2ZTE A;  3PGZ A;  1VS0 A;  2HIX A;  1YJN A;  5GAE C;  1I6H H;  4OON A;  5FJ8 H;  1N36 Q;  3HOU H;  5J3B A;  2K14 A;  4JI7 Q;  4P73 A;  1I94 Q;  2R93 H;  3HOY H;  4L5T A;  1L0W A;  4Y7N H;  2K5V A;  2WB1 G;  5LMU L;  3G6E A;  1VQJ A;  4BY7 G;  2UXB L;  4NXM Q;  3B6Y A;  2JJQ A;  3D0F A;  2YYZ A;  4AIM A;  4JI2 Q;  1CSP A;  1GVP A;  4BBR G;  1HZA A;  1FGU A;  4IJH A;  4JOI A;  2NVX H;  1KL9 A;  1HH2 P;  1YHB A;  1YNX A;  4A75 A;  1XNQ L;  3S17 H;  4PZ6 A;  1BBW A;  1JT8 A;  1WI5 A;  4A3K G;  1VQO A;  3PV0 A;  1XMO Q;  1HNZ Q;  3M4P A;  5C4X G;  3J81 i;  1N34 Q;  4JI4 L;  4A3I G;  4DR5 Q;  3PIO A;  5C44 G;  3JAM c;  1EIF A;  4DR7 Q;  5M5Y H;  4JI8 Q;  2LXJ A;  1Z47 A;  3EN2 A;  1M90 C;  3IRB A;  3RLN A;  4B3M L;  2ZTD A;  4LWC A;  1SFO H;  1VQ7 A;  2JA6 H;  4X62 L;  5IT9 c;  1A0I A;  4DV3 Q;  4A4I A;  2BA0 A;  3H3V I;  5DLQ E;  3A0J A;  3H0G G;  3UE0 A;  1N8R C;  1K9M C;  3H3V H;  2OQK A;  5M5W H;  3E0E A;  4OWX B;  3HOX G;  1IYJ B;  4DUY Q;  4LF4 L;  1Y14 B;  4DV7 Q;  4A3D G;  3KF6 B;  3PO3 G;  2PI2 E;  3E9H A;  3W1G A;  2F4V Q;  1FVI A;  3CQZ H;  4LFA Q;  2B29 A;  1B7Y B;  5LMN L;  4GOP A;  4JI6 L;  1PH2 A;  3VDY A;  1VQ5 A;  2XTI A;  1NE3 A;  2Y0S E;  3PUV A;  1H95 A;  3S2H H;  1VQI A;  4IJL A;  2GVA A;  2B63 G;  1XPR A;  1PHJ A;  4LF7 Q;  4MZ9 A;  3NEL A;  2CCZ A;  1IZ6 A;  3F1Z A;  4HIK A;  4A3F G;  2MO1 A;  4GNX B;  1PH1 A;  3RN2 A;  4B3S Q;  5C4J H;  1WJJ A;  3MXN B;  4IPC A;  2EXD A;  4DPG A;  1XJV A;  1YHQ A;  3U4V A;  3HKZ G;  4BA2 I;  2OCE A;  1EWI A;  3S1Q H;  4JCV E;  3T1Y Q;  1GO3 E;  5JEA G;  1I94 L;  3W1B A;  1PV4 A;  4DKA C;  2UUA Q;  4DR2 Q;  4XTC S;  4NB3 A;  2HHH Q;  1J5E L;  4C3H H;  4DK6 C;  2QA4 A;  1X6O A;  5C4X H;  1AE2 A;  4NXM L;  2DUD A;  3CXC A;  3AFQ A;  3M4O H;  1NBW A;  3A5U A;  5ELO A;  4OO1 G;  4JBJ A;  3CCL A;  4QJF A;  2UU9 Q;  2D0P A;  3CD6 A;  4DV0 L;  1XMO L;  4GOP C;  2RHS B;  1Q7Y C;  1HNZ L;  1G51 A;  1QVF A;  5AJ3 L;  4X6A H;  1K73 C;  5GQO A;  2D62 A;  1HNW Q;  4AQY L;  4JBK A;  3DM3 A;  3H0G H;  1K8G A;  1PA6 A;  5IE8 A;  2VY3 A;  3CCJ A;  5JJL A;  3HOX H;  4EX5 A;  1VQ4 A;  3OYY A;  2R7F A;  1EIY B;  1HR0 Q;  2ATW A;  3A74 A;  4YCV A;  1UWV A;  3OTO L;  2YTV A;  3HOZ H;  1PH5 A;  5LMN W;  2OTL A;  1FJG L;  3RLO A;  4AYB G;  3PF5 A;  3J81 c;  1Q81 C;  2F4V L;  1I3Q H;  2UXD L;  5GRO A;  2VQE L;  2JQO A;  1NY4 A;  3CW2 C;  4UP8 A;  1CKN B;  4HJ9 A;  2C35 B;  2NZO A;  2CWA A;  4QY7 A;  3T1H Q;  2RF4 A;  1TWC H;  3RNU A;  3GTO H;  2WAQ G;  1N32 Q;  2UXC L;  1YI2 A;  4QGU A;  1KD1 C;  5IP7 G;  1W3S A;  1X3G A;  1X3F A;  4MNO A;  1WCM G;  4R4C A;  2MNA A;  4LF9 L;  2R92 G;  4DR4 Q;  1VCI A;  2AWO A;  4BBS H;  4JV5 L;  1VQ8 A;  1YJ9 A;  1EOV A;  1YVC A;  2Z6K A;  3K8A A;  4KHP Q;  1UE6 A;  5BR8 Q;  4BY1 H;  3NEN A;  4XIG S;  1GD7 A;  1E1O A;  4X65 Q;  5FLX c;  4DV1 L;  1PH3 A;  1EFW A;  2RCN A;  1L1O B;  4KHZ A;  4J15 A;  2ID0 A;  2CWP A;  4DR3 Q;  3ER0 A;  2R7Z G;  4NXN L;  1G6P A;  3UE1 A;  2HHH L;  1HNX L;  2R6G A;  1X9N A;  4LF5 Q;  2KCT A;  4GKK L;  1Q1B A;  1IL2 A;  3CC4 A;  2K52 A;  1CUK A;  4RMF A;  4IFD G;  1PVO A;  1Q86 C;  2ZJR A;  1TXY A;  2OWO A;  3TEH B;  2JA8 G;  1VQA A;  1QZH A;  1N33 Q;  1EQR A;  1Q82 C;  4JI0 L;  4JI5 Q;  1K3R A;  2NVT H;  2RHQ B;  2CQO A;  4A3B H;  1K0R A;  1U5K A;  1JMC A;  1VQ6 A;  3HKS A;  1K83 H;  1JJG A;  4C2M H;  3U50 C;  2VQF Q;  1IBL Q;  3CPF A;  2R7D A;  3I4M G;  4QQB X;  4HIO A;  4EQ5 A;  4KI0 A;  3I2Z A;  4IPH A;  1Y1V G;  1OXV A;  4A3G G;  1KXL A;  1GKH A;  2L15 A;  2VZA A;  2AWN A;  2EQS A;  1CSQ A;  4X64 Q;  2IX1 A;  3CC2 A;  2R92 H;  2ZM6 Q;  3S16 H;  1SN8 A;  1IBK Q;  3TRZ A;  3KOJ A;  3CCM A;  4JI1 L;  3L7Z C;  3T1H L;  1WOC A;  2WFW A;  4R1J A;  1X3E A;  5JEA J;  4AH6 A;  4R4Q A;  3G4S A;  4IO9 A;  1QUQ B;  1LUZ A;  1N32 L;  4DV2 Q;  3J7Z C;  4DR4 L;  3KF8 B;  2K50 A;  5M3M H;  4JI3 Q;  5JJK A;  3ERS X;  3PUX A;  3Q8D A;  3GDE A;  1IXR A;  3CCQ A;  4GKJ Q;  5BR8 L;  4YCW A;  3I4O A;  4DUZ L;  4X65 L;  3TS2 A;  4YY3 Q;  3U58 A;  2YU9 H;  1AH9 A;  3GD7 A;  2Q2T A;  4OWT B;  1VQF A;  4LUZ A;  2UUC L;  2JEB I;  4AYB E;  3K80 C;  4LF5 L;  1FL0 A;  2JA8 H;  3LGJ A;  1PFS A;  1OTC A;  3I4N G;  1P16 A;  4A3J G;  1NMF A;  1TWG H;  3SGI A;  3J7A 5;  4YHH L;  2PQA B;  4LUV A;  3S1R H;  2K4K A;  2N78 A;  4R4T A;  1T9H A;  3PF4 A;  1QUQ A;  3G48 A;  5FLM G;  4HJA A;  4A76 A;  4JOI C;  1PH7 A;  1XPU A;  1E3P A;  5EAY A;  1SR3 A;  5C0X G;  3M9B A;  3GTL H;  3BU2 A;  4P74 A;  4OWW B;  3EIV A;  4GN3 B;  1Y1V H;  4A3G H;  1EYG A;  4X66 Q;  1VQN A;  4KLK A;  4LUO A;  4A3M G;  2B3G A;  3KLW A;  3L0O A;  4BY7 H;  1B70 B;  2NVQ H;  2KHI A;  1Q8K A;  1IBM Q;  3CMA A;  3RZD H;  1S72 A;  4PMW A;  4BBR H;  3MEF A;  3TRE A;  4DAY B;  4X64 L;  1N36 L;  3KDF B;  4IOC A;  4JI7 L;  2OTJ A;  1NMG A;  3I7F A;  4P72 A;  3S1N H;  2KBN A;  3I55 A;  4DK3 C;  4A3K H;  2UUB Q;  2K5N A;  4TQU S;  1Q12 A;  3GO5 A;  2YTX A;  3KF6 A;  2JA5 G;  4JI2 L;  1VQB A;  4A3I H;  4DR1 Q;  3CME A;  1U0L A;  4NPS A;  3K0X A;  3EBE A;  5C44 H;  2VS1 A;  2WP8 J;  5IYC G;  1LTL A;  1VQL A;  3NBH B;  3AFP A;  1E24 A;  1N34 L;  3PUW A;  3STB C;  4GKJ L;  3K7U C;  1VQG A;  4APV A;  4DR5 L;  5IYB G;  2A19 A;  2Z0S A;  1BKB A;  4DR7 L;  3G71 A;  4JI8 L;  4JBW A;  1NJI C;  1TWF H;  4GNX A;  4A3J H;  3I4N H;  1DGS A;  2IHE A;  4A3D H;  3PO3 H;  3NEM A;  1V43 A;  4PZ8 A;  3U4Z A;  5IWA Q;  4DV3 L;  1NTG A;  3F2C A;  4LF8 Q;  4TVA B;  2XGT A;  3HFZ B;  4DUY L;  2WB1 E;  5FLM H;  5C0X I;  1MKH A;  4DV7 L;  2V1C C;  1LYL A;  2JA7 G;  4K0K Q;  4LFB Q;  4A93 G;  3FHW A;  1PH6 A;  2B63 H;  3K81 C;  3DLL A;  4LFA L;  1KRT A;  3BZC A;  2N49 A;  4B3R Q;  2JE6 I;  3ZJY C;  4A3F H;  1MIU A;  4WJ4 A;  1OXU A;  1UEB A;  1Q46 A;  4A3M H;  5H1S E;  5ELN A;  1SE8 A;  1HZC A;  3GTK H;  4LF7 L;  1PYB A;  1HZB A;  3UDX A;  4LNQ A;  1I50 H;  3CC7 A;  4MTN A;  2K5H A;  1VQM A;  4IPD A;  4B3S L;  1UE5 A;  1YHA A;  2JK8 A;  3CF5 A;  4DR6 Q;  1SRO A;  2AKW B;  1AE3 A;  1SMX A;  3FP9 A;  4GNX C;  3RR5 A;  3T1Y L;  2JA5 H;  2VW9 A;  4UP9 A;  4OO1 I;  4B3T Q;  1A8V A;  3W5O A;  4HIM A;  4DR2 L;  3ULP A;  1KRS A;  1VQK A;  2UUA L;  5IYC H;  4POG A;  5LMU Q;  1D8L A;  1OXT A;  2UXB Q;  3K7A H;  1KAW A;  4DR1 L;  1YIT A;  5IYB H;  3PUZ A;  2UU9 L;  2ALY B;  3HOU G;  3RN5 A;  1XNQ Q;  3HOW G;  1RL2 A;  1CKN A;  1OXS C;  2I5H A;  1JB7 A;  4LFC Q;  2Y0S G;  1PH8 A;  3F2B A;  1L2F A;  2E2I H;  1HNW L;  3RZO H;  3UDI A;  1W2B A;  2NN6 G;  1XNR Q;  4JI4 Q;  1WFQ A;  4GLA C;  3ICE A;  1TWA H;  3BZK A;  2AMC B;  4BA1 I;  2F3I A;  3HKZ E;  1LM0 A;  3KJO A;  1Y1W G;  2JA7 H;  2A8V A;  2Z6K C;  1PH9 A;  4B3M Q;  1HR0 L;  2VUM G;  3TQY A;  1YBY A;  5C0X J;  4DV5 Q;  4LF8 L;  4X62 Q;  1L1O A;  2KHJ A;  2Q2H A;  3J80 i;  3TS0 A;  4GS3 A;  4HJ7 A;  5IY0 A;  2A1A A;  5C3E G;  5IP7 H;  4GN5 A;  4R4I A;  1WCM H;  3STB D;  1MJE A;  1QVC A;  4GLV B;  5LMN Q;  4ME3 A;  4PG3 A;  4GLX A;  1GM5 A;  4JI6 Q;  2EIF A;  1KIX A;  1TWH H;  3D31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...