4A3IG

Rna polymerase ii binary complex with dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3iG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3iG01
4IPGA 2ID0A 1K8AC 3F2CA 1PYSB 1EQRA 2N78A 4KHZA 4LF4L 1PYBA 4KHPQ 4JI1Q 4A3GH 2UXCQ 1JMCA 4EQ5A 2LXJA 2DUDA 4LFBQ 3TQYA 1M1KC 3PO3G 4JI0Q 3PUWA 4K0KQ 4LW1A 1EFWA 1IYJB 1OXVA 4JI3L 4YWMA 2AHOB 1IBLQ 2VNUD 2JJQA 4DAMA 1SMXA 1JJ2A 2NVQH 2K75A 4DR2Q 4GNXC 4JCVE 3ULJA 5IYCG 5FLMG 1NTGA 4Y52H 5LMNW 2UUCQ 1OXXK 4OWTB 2RCNA 1QZGA 2KCMA 3RR5A 4X64L 3VDYA 1UE1A 1EIFA 3HKZE 3UE0A 5C4JH 4DR5L 2Q2UA 2E5LL 4LFCQ 2PMZE 5GADC 4A3IG 2E8GA 4HJ8A 1AH9A 4AYBE 4A3EH 1HNZQ 2JE6I 3L2PA 3STBD 3CPWA 5M5YH 4DR7L 4QQBX 1YHQA 3JAMi 2E2HH 4APVA 3M7NA 3S15H 2Q2HA 1W2BA 2UUBL 4BXXH 1XMQQ 5JJLA 2UXDL 1VQDA 1YJWA 3PUVA 4B3TL 3A0JA 5M5WH 1VQKA 2OQKA 2WB1E 1YIJA 5AJ3L 4YHHQ 5GAEC 4A3GG 1SR3A 2Z6KC 1S72A 4B3RQ 2A19A 4GN3B 4QL5A 2OQ0A 5DLQE 3S1NH 3OTOQ 3RN2A 1I5FA 4DR3Q 1PH8A 4JI2Q 1UE5A 3ULLA 2V1CC 3F2BA 2KHJA 1C9OA 3BJUA 2ASBA 4A4IA 5IWAL 1IBMQ 4MNOA 2EQSA 4DUYQ 2JA7H 3K7AH 4IJHA 1K83H 3CCMA 4LF8L 1HNWQ 1VQIA 1S40A 3CCUA 1D7QA 2HHHQ 4IPHA 1OTCA 4RMFA 4IO9A 4AQYQ 2UUAL 3CC2A 1Q86C 4A3EG 2NZOA 3TREA 4DV1Q 1MJEA 1PA6A 1Q8KA 4JYAQ 1IBKQ 1CKNA 4IPDA 2I0QA 4A3FH 4BXXG 4A3JH 1Q1BA 2ZTDA 4BA2I 3PUZA 4WJ3M 3GTGH 2WAQE 2ZTCA 3A74A 4PZ6A 4O2DA 2K50A 4X62Q 1VCIA 2DGYA 2VQFL 4HIOA 1PV4A 1PH5A 2ZJQA 3HKZG 3S24A 3A5ZB 1IXRA 1PH6A 4GKJQ 1QVGA 1N33Q 4JI7Q 4AYBG 4UP8A 3D31A 3KJOA 1K8GA 1VQFA 3CW2C 2UXBL 1BKBA 1WCMH 3S2DH 1VQ5A 1Q46A 4LF6Q 1Q81C 5JEAG 3J7ZC 1HZ9A 5IYBH 4HIDA 2N3SA 1Q12A 2WB1G 1WOCA 1VQCA 1EUJA 3CCRA 5GQOA 1YVCA 3AFQA 4BY1H 3PV0A 2JA7G 1YZ6A 4JBWA 5C44H 3H15A 3RN5A 4A3MH 1W3SA 1E24A 4DV7Q 1KRTA 4KLKA 3ER0A 1KAWA 1EYGA 2R92H 5GAGC 1VQHA 2NVTH 1C7YA 2ZTEA 4C3HH 4NB3A 4A3FG 2K5VA 4A3JG 4IFDG 2IHEA 2RHSB 1G291 5ELNA 3J81i 4A3CG 4A3LH 3G6EA 2F3IA 1R9TH 1KIXA 1V9PA 4O0AA 2OTLA 2BH2A 1L1OA 3KOJA 4P72A 3I7FA 3M4PA 4IOCA 2A8VA 3GTKH 3ZJYC 4X64Q 4PZ7A 3CD6A 2VQEQ 2E5LQ 4JG2A 3KYHC 3FKIH 4OO1I 4MTNA 1JJGA 4DV5L 3BZKA 1FJGL 1HZAA 3M9BA 2N49A 2K5HA 1WCMG 5FJ8H 2F4VL 1A8VA 4NPSA 2LXKA 2GVBA 4LNQA 1XTDA 3HOWH 1VQNA 3I56A 5IYBG 2WAQG 5BR8L 4NXML 2UXDQ 4BY1G 1PH4A 3CP0A 2CKZB 1HNXQ 1E1TA 1EWIA 5C44G 4A3MG 2ES2A 1AE2A 1E1OA 4HJ5A 5K36G 2B3GA 3CCQA 1VQMA 1X9NA 3PUYA 1I3QH 4A93H 2UU9L 4JC0A 1JE5A 4B3SQ 2R92G 1N32L 3U50C 3G71A 3RZDH 4DK3C 4ALPA 4A3LG 1QVCA 4PG3A 4XTCS 1G51A 4DV6L 3PSIA 5JJIA 4A3DH 3TS0A 4LF7L 4GN5A 3KF6A 1V1QA 1PHJA 1EOVA 4GLVB 4RG1A 4GN4B 3A5UA 2Z0SA 3FKIG 3DM3A 3AFPA 3H0GH 5JJKA 3J81c 5IYDH 2GN5A 4A75A 2CWPA 5LMUL 4BBRH 5FJ8G 4DK6C 1A62A 1Z9FA 4DKAC 3ICEA 2YTVA 3HOWG 1WFQA 1VQ7A 3GO5A 4X66Q 1KHIA 3KFUA 4PMWA 1XNRL 1RIPA 4QGUA 4PZ8A 4JI8Q 4GOPA 2VQFQ 1I50H 3HOZH 2JA6H 1YJNA 3UE1A 4C2MH 1MIUA 3HOXH 4YCWA 2PI2A 3I2ZA 4DR6L 4LUZA 1VQPA 2ZM6L 3T1YL 3K81C 1GVPA 2NN6I 4A93G 4X65Q 1L2FA 2QGQA 3OW2A 3TS2A 3CF5A 1YHAA 2AWOA 1QZHA 4OX9L 1UE6A 2BA1A 2CFMA 3AEVA 4A3DG 4R4CA 3EIVA 4L5QA 1OXTA 5C0XG 1Q7YC 4JBMA 3NEMA 3CXCA 1EIYB 2VL6A 3Q8DA 1CSQA 1X6OA 3H0GG 4YY3Q 5HY6A 5IYDG 3S1RH 4R4OA 4BBRG 4BBSH 3H3VI 4GKKL 1VS0A 4B3ML 4L5RC 1O7IA 3T1HQ 4JV5L 3G4SA 4QJFA 3U58A 1TWGH 2WFWA 2KHIA 1X3GA 4P71A 3RLFA 4R4TA 1VQ4A 1WI5A 1B8AA 2Q2IA 3CQZH 2YYZA 3CPFA 3HOZG 1YBYA 1K3RA 1DGSA 1QUQA 2JA6G 4DR4L 3HOXG 4DV4L 4P73A 5ELOA 3KDFA 1CKNB 1HJPA 3LGJA 2HQLA 2NVYH 2XGTA 4OWXB 4A3KH 3UDFA 2Q2TA 3RNUA 4IJLA 1FJGQ 2F4VQ 4UP9A 4JI6L 2OWOA 4KHPL 3PUXA 4JI1L 2JK8A 3RLOA 1ASZA 1UWVA 5BR8Q 4JOIC 3NELA 3JAMc 1PH3A 5IP7H 3GTMH 2H5XA 1HR0L 4JI0L 1P16A 3K0XA 4AIMA 1A0IA 1VQOA 3CMEA 3PF4A 3UDGA 2CWAA 1XMOL 1WJJA 2CQOA 1N36Q 4DR2L 2OTJA 1TWFH 4BBSG 3GTPH 4JI5L 2ALYB 2UUCL 3ULPA 4LF9L 2L15A 1X54A 4BA1I 3CMAA 1KRSA 4XIGS 2MFIA 2IHFA 4DNIA 3I55A 5IP9H 1V43A 1PH7A 4LF4Q 1X55A 3J81j 1YJ9A 3UDIA 1IZ6A 4AH6A 1JT8A 3FP9A 3L0OA 3NBHB 2JQOA 2VZAA 4C3JH 2R7ZH 1MKHA 2AKWB 4JI3Q 4UPAA 1LUZA 4QY7A 4NXNL 5JEAJ 4A3KG 1P8LA 3RLNA 1XMQL 4R4QA 1Q82C 2JA5H 2NVXH 3S14H 1L1OB 5C3EH 4LUOA 4HJAA 4GLXA 2JA8H 3HKSA 2RF4A 1VQ8A 3MXNB 1E3PA 4JI4L 2E2JH 3S16H 5IP7G 3U4VA 4HJ7A 4DR5Q 2E2IH 1GKHA 3PCOB 4LF5L 4JBKA 2ATWA 2B63H 3STBC 2YU9H 4BY7H 3JC66 4GS3A 3PO2H 1G6PA 4FDBA 1CUKA 4J15A 5LMNL 1I94L 1SLJA 4JI2L 4DR7Q 2CCZA 4DR6Q 3ERSX 3J80i 1NJIC 4GNXA 2UUBQ 4IFDJ 2Y0SE 5M3FH 4YWKA 2B29A 1IBML 4P74A 4DUYL 4B3TQ 1BVSA 4YCUA 1VQJA 2VS1A 3I4NH 1K0RA 5AJ3Q 1HNWL 5IP9G 1NE3A 2HHHL 2AWNA 1FL0A 2R7DA 1LM0A 4AQYL 3HOVH 3GTJH 2PQAA 3B6YA 3KF8B 4DV1L 1CKMA 4Y7NH 2KENA 3BZCA 1HZBA 1LTLA 2R7ZG 4UY8C 4DUZL 2RHQB 2YTXA 3AQQA 4OXPA 1SFOH 1IBKL 2JEAI 1KD1C 1D8LA 2IX0A 4A3BH 2JA5G 1N34L 5C3EG 4GKKQ 5IWAQ 3KF6B 2Z6KA 5J3BA 2LSSA 3KLWA 4B3MQ 2JA8G 3M3YH 3RZOH 1VQAA 1N8RC 1KXLA 1IL2A 4LF8Q 4JI7L 1WYDA 3CCVA 2IY5B 2VY3A 2B63G 3I4OA 3GTQH 4POGA 4DV0L 4LUVA 2UUAQ 3PO2G 4BY7G 4DR4Q 4IFDI 5IY0A 1M90C 4DV2L 3NENA 3I4MH 1XPRA 3W1BA 2R7FA 3L7ZC 5M3FG 5EAYA 1PH9A 4GOPB 4R4IA 1VQEA 1I6HH 3M85A 1MJCA 1XNQL 4LFAQ 3I4NG 4JI6Q 2AMCB 2D62A 1EQQA 3F2DA 1J5EL 1CKOA 1L1OC 4EX5A 1B70B 3E9HA 4DV7L 3CC7A 2JA9A 3J80c 1YITA 4DV3L 2VUMH 3HOVG 1HR0Q 3CCEA 3CC4A 1ASYA 1NBWA 4KI0A 3WWVA 1PH1A 1VQLA 2UXBQ 1VQGA 1XMOQ 2Y0SG 1U0LA 3CAMA 4A3BG 3F8TA 2BH8A 4DR1L 3HOUH 1H95A 2EIFA 4YCVA 4JI5Q 5C4XH 1YI2A 3E0EA 3FHWA 4LF9Q 4JOIA 2HT1A 1GM5A 2VQEL 3GD7A 1TWAH 3BU2A 3HFZB 1SE8A 1PH2A 1VQ9A 1X3EA 3EBEA 2K52A 3MEFA 2KCTA 3I4MG 2ZJRA 3UDXA 4HJ9A 3HOYH 1CSPA 1N9WA 4B3RL 1AE3A 3S1MH 4NXNQ 4OONA 2MO1A 4P75A 1VQ6A 1E7ZA 1QUQB 4A76A 1HNXL 5C0XJ 1HH2P 3KDFB 3K7UC 2MNAA 2K5NA 1PFSA 4JI4Q 4LWCA 1TXYA 2I5LX 3PGZA 1E22A 2VUMG 4LF5Q 4IPCA 3D0FA 1U5KA 1Y1VH 1Y1WH 4B3SL 4DV5Q 4A3CH 4LFAL 4TQUS 5LMNQ 1I94Q 2YTYA 2HIXA 4R1JA 2FXQA 2GVAA 3HOUG 2UXCL 5GROA 1Y14B 4NXMQ 4WJ4A 5C4XG 2MO0A 4LFBL 3M4QA 3W1GA 4K0KL 3TRZA 4GOPC 1T9HA 1JJCB 3GDEA 3S1QH 4C3IH 1JB7A 2PI2E 4H02A 1IBLL 3AYHB 3U4ZA 1FGUA 4DPGA 2IT1A 1HZCA 1RL2A 2UU9Q 1N32Q 3PIOA 1L0WA 4YWLA 4DUZQ 3HOYG 1X56A 1GO3E 2C35B 4OO1G 1X3FA 2EXDA 3KJPA 5C0XI 4X66L 4LFCL 4DV6Q 1XPUA 2PNHA 4JI8L 1N34Q 1BBUA 1J6QA 1Z47A 2KBNA 4UP7A 1HNZL 4LF7Q 1TWCH 3CCLA 2NZHA 1YHBA 5M3MH 1FVIA 3K80C 1YEZA 4X65L 1Y1VG 4ME3A 4DV0Q 1Y1WG 1K73C 1KC8C 1KQSA 3S17H 4IOAA 2F52A 2IX1A 4L5SA 5LMUQ 4DV2Q 3GTLH 3M4OH 1VQBA 4POFA 4YHHL 1LYLA 1XJVA 1NMGA 5HGQA 1XPOA 5GAHC 1XNRQ 3EN2A 3OYYA 4QIWE 1XNQQ 1QVFA 1OXUA 4HIKA 2R93H 2MQHA 3OTOL 4DR3L 3DLLA 4GNXB 1J5EQ 2D0OA 5M5XH 2JEBI 3F1ZA 4YY3L 1TWHH 2ZM6Q 4DV3Q 5FLXc 3T1YQ 2K14A 2D0PA 2XTIA 1UE7A 1X65A 4MZ9A 1YNXA 4L5TA 1BBWA 1B7YB 3T1HL 3CCJA 1A63A 1SRUA 3PF5A 4OWWB 3CCSA 5H1SE 1SROA 4DR1Q 2I5HA 1K9MC 4OX9Q 3J7A5 2PQAB 3H3VH 3K8AA 4TVAB 5IT9c 3SGIA 1OXSC 1KL9A 3PO3H 2R6GA 1S3OA 2QA4A 4HIMA 4JYAL 5M3MG 1C0AA 5E7NA 1NY4A 3PIPA 2QEXA 1NMFA 1HR0W 3E9IA 4X6AH 2I5MX 4X62L 1PVOA 5IYCH 1Q1EA 5FLMH 2ZJPA 2A1AA 4JV5Q 2WP8J 1UEBA 2NN6G 3G48A 3IRBA 4DAYB 1SN8A 2BA0A 2HIVA 2K4KA 3GTOH 4GKJL 3TEHB 1GD7A 1N33L 2OCEA 4A3IH 4JBJA 3W5OA 2R93G 2N8NA 4GLAC 2YV5A 4DV4Q 3S2HH 2VW9A 5IE8A 4LF6L 1N36L
chains in the Genus database with same CATH superfamily
3J80E 1CA6A 1VMPA 3OSNA 4LF4L 1PYBA 5CBEE 4EQ5A 2EYFA 3RIZA 2DUDA 2I80A 1M1KC 1LV9A 3PO3G 1FNVA 1GSHA 2WTFA 1FGBD 3Q24A 1IYJB 1WCMB 3S2DB 5CA1F 3CRKC 4YQWA 4LMYA 2WAQB 2K5QA 1JJ2A 2R8JA 2K75A 4DR2Q 4JCVE 4BY1B 3PIO3 1AZQA 1LTSD 3BZDB 5C44B 4ZQIA 3Q0AA 4X64L 1G2SA 1MHWC 3UE0A 3FPPA 4DR5L 4K5XA 2Q2UA 1F2MA 2DPJA 4QQBX 4A3EH 2YZMA 3L2PA 3FDTA 1BXTA 2ZXOA 2A6HD 1AN8A 2MHVA 4GKKH 5JJLA 4R8UB 2PO4A 3BDLA 1YJWA 4KKTA 5CV8A 1NSNS 3VPCA 1STHA 3KXYT 1SR3A 4HEDA 1S72A 1VBGA 4JVZA 3SDZA 3TP7A 2OQ0A 1WTQA 2C2EA 1LT3D 5DLQE 3OTOQ 1JXLA 3NWSA 1SEBD 4HN7A 5LA6F 3ULLA 4IUQA 2L55A 1TWHA 4G7OC 1C9OA 3D4DA 4RKBA 3IKJA 1G91A 5KFRA 2L5TA 4CDFC 3BQ1A 2A5HA 4LF8L 2W57A 1HNWQ 3CCUA 1D7QA 1HR0H 1OTCA 1LABA 2UUAL 3CC2A 4A3EG 4UCUA 5IGDA 3TREA 4DV1Q 1MJEA 4MTDA 3G8CA 4DR2H 4QWEA 5DM63 4A3FH 4JI5H 4ECQA 1ZYRC 2WV6D 2XCPA 1EEID 4O3PA 4X62Q 5KRUA 3GLKA 2D2CC 2ZJQA 1PV4A 1PH5A 3IFTA 3BQ0A 3S24A 3L4KA 1H9MA 2NB0A 1CFMA 4DL7A 2K5DA 1N33Q 4KTAA 2HCIA 2HJWA 4EQNA 5KFYA 5EWGA 1F9PA 5C6AA 1WCMH 3S2DH 1VQ5A 1I6HB 4HIDA 4DLKA 4J9SA 1BCPD 1VQCA 1DONA 4BY1H 3AFQA 2CVRA 4JI4H 5C44H 5H80A 2M9VA 1W3SA 1S5DD 5K36H 2EY1A 2YL2A 5IT9E 3MXUA 4FXGC 3T5KA 1C7YA 5KFXA 4X3KA 4A3FG 4M1UB 2RHSB 5ELNA 1H9SA 5IGGA 2YW2A 4K5WA 1B2TA 1W6JA 2EY5A 2L9HA 1HNWH 2SOBA 4P72A 2W8LA 1KDCA 4BS9A 1WD0A 4DV1H 3CD6A 1MD2D 4IHJF 3MXNA 4B9WA 4UDUC 1SMYC 2C5CA 1SXTA 1JCKB 1QILA 3BZKA 2NTTA 2FINB 2K5HA 1WCMG 5FJ8H 1WTPA 3M9MB 1TWGB 4RNMA 1O7YA 1VQNA 1N34H 2WAQG 5BR8L 4HNVA 4BY1G 3CP0A 1HNXQ 2NTSA 1EWIA 5C44G 1K28A 1YNJC 2IP4A 5KYLA 5K36G 2VA2A 1SDFA 1VQMA 2NYZD 5KFZA 3V6KA 4B08A 1Z2OX 4JC0A 4B3SQ 3N40P 2AUJD 1S0MA 4DK3C 2DNCA 4LMQD 5DG8A 4PG3A 3PSIA 1HA5A 5JJIA 5C0XH 1RTOA 1EOVA 4DV3H 3A5UA 5FK9C 2R8IA 5JJKA 2F0UA 4XQJA 5CR3A 5LMUL 1SJED 5FJ8G 4DK6C 1Z9FA 3QR8A 3ICEA 3J81L 1B44D 4HSPA 4FP5D 5EWEA 1RIPA 3C0FB 4KD4A 4PZ8A 4LK1C 2VQFQ 5FLXW 3Q8SB 2RKSA 3U9OA 5KFFA 2B2UC 2PI2A 4LUZA 4J9OA 2B39A 3BVGA 2ICEC 3S14B 3NSWA 1CZWA 4FXDA 3NXWA 2AWOA 2E2JB 4ZK9B 1MBYA 1HNXH 5DLGA 1UE6A 2CFMA 4RB0A 3EIVA 4L5QA 2LFNA 2L0CA 4NW2A 5C0XG 4JBMA 1E4FT 3WOFA 3LWBA 1TWHB 1EIYB 4B3SH 2F0DA 1LTTD 4B9XA 5KNDA 1MSGA 1EY5A 3H3VI 1VS0A 2Z8LA 3RV4A 1O7IA 2UXCH 4QJFA 2C2DA 4O3OA 5J2TF 1TWGH 4P71A 2CQAA 4IR9A 3VR3A 1WI5A 5ELFA 3E5NA 4K0KH 3CPFA 4DK1A 4Y7NB 4YJ2F 1QUQA 4U68A 5BN3A 5ELOA 2ASJA 1TA8A 3SK4A 3V05A 2Q2TA 4IJLA 3BDCA 2PBZA 2EJFC 3PW0A 4JI1L 3K57A 1UWVA 3NELA 5CC4A 2Q8TA 1LTBD 2H5XA 4JI0L 1A0IA 1VQOA 1V8QA 4O3NA 4UAIA 4RGTA 2SDFA 4YHHH 3ULPA 1SNPA 2XIWA 4LF9L 3CMAA 3OHBA 4LF4Q 3I70A 3VR6A 5IP9H 1HQMC 4PWQA 4A2BA 5KG5A 2MGSA 2V4DA 2NU7B 1I4PA 3ITPA 1U4RA 3FP9A 1FYCA 2JQOA 3MR5A 2WKDA 2AKWB 4XYLB 1H9SB 1JQYD 3RLNA 2NVXH 3S14H 5C4XB 5D3DA 2OT2A 1CA5A 1D5XC 3MXNB 1XWEA 1IL8A 2E2JH 4DR5Q 4HJ7A 4LF5L 2J6TA 1XX8A 2D5DA 1EFID 3JC66 4ILWA 2R7MA 4FF4A 1T36A 1CUKA 1I94L 3RAQA 4O2AF 2CCZA 5E3FA 3ERSX 4DR6Q 2E2HA 2WIIB 3J80i 4GNXA 4IFDJ 1ZQ7A 2Y0SE 4KY7A 1D5MC 5L1JA 4WBNF 2VS1A 1K0RA 3HKZA 5IP9G 1JKJB 1C48A 2F0VA 1ENCA 4DL5A 2W7PA 1A3TA 1FL0A 1WH2A 2Q8IB 1LM0A 4AQYL 4KHVA 4AYBA 3VYSA 2PQAA 4L6TB 1CKMA 4Y7NH 2KENA 1RKNA 4RWSC 3N6RA 2YTXA 3AQQA 4OEMB 1D8LA 2KOLA 5DGAA 3A56A 2R85A 2FLLA 3JAMW 4LF4H 2V9WA 4B3MQ 2XSCA 3FVQA 1BF4A 2WB1A 3CVZA 2AQ1B 1N8RC 1K83A 4LF8Q 4JI7L 4KKUA 1WYDA 5D8DA 4POGA 2UUAQ 1SYFA 4F88A 4IFDI 1FKAH 4J9QA 3NENA 1E2WA 4KN4C 2R7FA 3L7ZC 2F3WA 2WE6A 3MR3A 1VQEA 2JXMB 3OHAA 4DR5H 3Q1KA 2KCCA 2OF1A 5M3MB 3OSOA 1STAA 4DV7L 5M9OA 1B70B 3E9HA 2JA9A 2YZGA 4KKSA 4UCVA 3M4OB 1HA6A 2ASLA 1NBWA 4KI0A 1FD7D 2WINB 3WWVA 1B9MA 3K5MA 4DU9A 1XMOQ 5CAEB 2F0HA 5IODA 3NK9A 5C4XH 3A8JE 3FHWA 2R93B 1S4ZA 1S5FD 2IX3A 5NUCA 3N41B 2FK2A 1CS0A 4KV6A 2W7OA 1GLVA 1VQ9A 1X3EA 1ZKOA 2KCTA 2R92A 2ZJRA 3UDXA 1N9WA 4B3RL 4K6LA 4N9TA 4NXNQ 5FPOA 3H6MA 4P75A 1BCPF 1BDOA 3A8KE 4CC6A 1GUNA 1KJ9A 4FXKC 1E7ZA 1QUQB 1R9TA 3LWUA 4LF8H 1UC8A 3K7UC 2OEOA 4HNTA 3CU7A 4S3SA 2MNAA 2UUAH 2E2IA 1K8OA 1ZHSA 2B63A 4IPCA 3FKIA 1U5KA 4ECTA 4TRDA 5CYUA 2F0TA 1GUOA 1KLGD 2VPSA 4R1JA 5KFIA 1R4PB 2FXQA 3DEPA 3GP7A 1Y14B 4A3IB 4WJ4A 4RB3C 5C4XG 1KJQA 3TRZA 1JJCB 3GDEA 1HUMA 2W9AA 1PRTF 3HRZC 4H02A 1E2VA 1AW7A 4M8AA 4OL7A 1HFGA 3PIOA 2CW7A 4YWLA 1MZBA 2C35B 1CT1D 1JWUD 1GUTA 2B2VA 1BBUA 2RA4A 3K5NA 3IAYA 3K3VA 3M7GA 5M3MH 3K5LA 3F8NA 4J9RA 2F52A 4NXNH 1A2TA 3M4OH 4L5SA 5LMUQ 4DV2Q 1IW7D 1VQBA 5HGQA 4C1NK 2F0LA 2H1EA 1XNQQ 2ALZA 1QVFA 2R93H 3QJYA 3R93A 3OTOL 2E2HB 1XDNA 1TAEA 1V1OA 4GNXB 2A6HC 1J5EQ 2D0OA 3TP6A 3F1ZA 4TV9F 1RF2D 2D0PA 1X65A 3AB9A 5DAUA 1YNXA 5EKIA 1BBWA 1B7YB 5FLXL 5LYJF 3RBDA 3SE0A 5BR8H 3HKZB 3QFFA 3OWEB 2XWBB 3CCSA 4AYBB 4U7CA 5CB4F 2PQAB 3H3VH 3K8AA 2NU8B 4TVAB 1RJRA 4O2BF 3A54A 3FMCA 1S3OA 4A2AA 3EYYA 1B53A 5M3MG 1S0OA 4CKBA 1EUCB 2B2YA 3NP8A 3Q8PB 3PIPA 2QEXA 2F0OA 3EFXD 2BE5C 2WB1B 2HCCA 1IYVA 4X62L 1PVOA 5FLMH 3K7AB 1K83B 1TT2A 3T16A 4CDCC 3N43B 1N33L 1SE2A 2OCEA 3JRXA 5KFOA 5J22A 4A3IH 3EJIA 3W5OA 2R93G 5DQIA 2FMMA 5CORA 5COYA 4Q44A 1B6RA 1AP0A 1SYXB 5DNFA 2ENBA 4EGVA 2QDBA 3PN1A 2R8HA 1GUSA 5LMUH 4I55F 4IPGA 1I4QA 3VR4A 1WTHA 2ID0A 1K8AC 2N78A 2W9BA 4KHZA 3GIQA 1PXUA 4JI1Q 2FP4B 4LFBQ 1E2ZA 4JI0Q 4F4WA 5EDWA 4J9LA 1OXVA 1Q3LA 1Y69U 3NUCA 4YWMA 1KEEA 1VDZA 1IBLQ 3O13A 4JW0A 1SMXA 4DAMA 2CW0D 1BCPC 1GOZA 4C56C 3GTPA 5FLMG 1NTGA 1VKZA 4OWTB 4A3MB 4RNOA 1QZGA 2KCMA 1PYWD 1UE1A 3FDSA 4LFCQ 3DF7A 3UQ8A 1KJIA 1SCUB 4HR7A 4WRDA 5GADC 4A3IG 2E8GA 3OPOA 1HNZQ 1ET9A 1M4VA 2R92B 3CPWA 4ZOLF 2G9DA 2W9CA 1O78A 5C5MA 2VOBA 2E2HH 4K6DA 3M7NA 4YP3A 3S15H 2Q2HA 5ELDA 1W2BA 1GHJA 2HDMA 1R9TB 2JA5A 3PUVA 4B3TL 1VQKA 1MSHA 5AJ3L 4OGQC 1GSOA 2Z6KC 4G4KA 2EDGA 2E2IB 2VPQA 5I2XA 2B63B 2A19A 3FKIB 1PRTC 4GN3B 4QL5A 1V1PA 1EOTA 3I91A 3A7LA 3RTXA 4QF4A 2K01A 1I5FA 1SSOA 3RBEA 1JICA 1SE3A 2V1CC 4ZLTF 5CV7A 2XIGA 4QUFA 4A4IA 4JI1H 1ZETA 2PN1A 3HG9A 4CJ2C 3K7AH 1K83H 2DY7A 1S40A 1NCVA 4JI0H 4IPHA 4RMFA 1KJ8A 3KLRA 1I3QB 4AQYQ 1LO5D 3JZIA 5KFWA 3T51B 1IBLH 3GV7B 1EZ6A 1Q8KA 1JC7A 4JYAQ 3C1EA 4IPDA 4ULLA 1D1IA 3MVVA 2DNEA 1Q1BA 4IFDH 1W93A 2ZDQA 2C28A 4LF9H 2ZTCA 4O2DA 2JN4A 4KJNA 3URYA 2VQFL 3MEHA 1DV2A 2UVWA 1RHPA 3HKZG 1PH6A 3A5ZB 1IXRA 5KG2A 4LAAA 1QVGA 5LL6b 3QWNA 4JI7Q 4N9PA 4AYBG 4ZI7F 5D1OA 5D14A 3JAML 3D31A 3KJOA 1K8GA 4BBRB 1VQFA 1ONLA 2B2WC 1BKBA 2UXBL 4JV0A 1LTGD 1AEXA 4LF6Q 5EKKA 2GPWA 4Q8EA 1HZ9A 2NUAB 4DL2A 2N3SA 2FPPB 2WB1G 2FPIB 1STYA 1YVCA 3K6OA 5EPJA 4EQOA 3HOXB 3OIQA 2KEDA 2V4RA 3H15A 4A3MH 3RN5A 2R87A 4LF5H 2HDLA 4DV7Q 2VUMA 1D6EC 1PZJD 3H40A 2FHTA 4YR2A 4PDBA 1KAWA 3OMCA 1EYGA 2R92H 1M0WA 4RH6A 1TU2B 4C3HH 2TMPA 3T5LA 2K5VA 4IFDG 2IHEA 2M00A 2XC9A 2F3IA 1R9TH 1PTOB 2BQRA 2OTLA 1V9PA 4O0AA 2F0JA 2QK4A 2W8KA 2B8FA 3I7FA 2GPSA 1X3PA 4AQYH 3LNNA 3ZJYC 2I87A 1DIKA 2E5LQ 2ZXRA 3FKIH 4JYAH 3BYTB 4MTNA 4Q5VA 3J7AF 1JJGA 4DV5L 4F4YA 3NBIA 4XYMB 4I7AA 4UCRA 3M9BA 2LXKA 2GVBA 4Q43A 4KJOA 3D6CA 2FFKB 1QE6A 4JI7H 1E1TA 4A3MG 4RZQA 2XD4A 1AE2A 3GIJA 1JLLB 4HJ5A 4A3KB 1SYEA 4HTHA 1I3QH 3QIAA 1Y1VA 2R92G 4ZUJA 3KF8A 3RZDH 3Q8QB 4L8JA 4C3HG 5EGTA 4ALPA 5JAVA 5L37A 2MUYA 3D3RA 1G51A 4DV6L 4MV6A 4G7HC 2UVVA 4DV7H 1J9OA 4MTEA 3QOLA 1V1QA 5HURA 2A6ED 4J6HA 3FKIG 5KT3A 3DM3A 4MIUA 1TS4A 2G9HD 3GTPB 2GN5A 4IALA 2W6MA 4BBRH 3KAJA 3VPBA 3N8DA 4HR7B 3AU7A 3RUZA 1E0BA 3GO5A 4PMWA 4EG0A 4QGUA 2YS7A 1U4PA 2W9CB 1NAPA 1YJNA 2E5LH 4C3JB 1MIUA 3HOXH 2F0IA 5ELCA 2EY2A 1F2YA 3MXPA 4DR6L 2XGPA 1VQPA 4FBUA 2ZM6L 3T1YL 3K81C 2I46A 2JP1A 3DUZA 2JA5B 4NKLA 3OW2A 4B3RH 3TS2A 2PNRC 3GTLA 1FNUA 3S16B 3GIIA 2M05A 1HCZA 1K8MA 4DXFA 4OX9L 1V1PB 2YU9B 4YR3A 3N42B 1PTOH 1OXTA 1O80A 1Q7YC 2QCPX 2SNSA 1B50A 5A2QW 5KT6A 4WD3A 1X6OA 5M3FB 2B2WA 5FOBB 3MA2B 3MJFA 1GHKA 5JVLA 4ECXA 2OH2A 4R4OA 1VF5C 3E0JA 4BBRG 5JOBA 2BE5D 4B3ML 2J9GA 5KFAA 3R2IA 3TIIA 5IGEA 1VQ4A 2WFWA 2KHIA 4R4TA 4J8QA 1B8AA 4DFAA 3GTJB 2R84A 4QIWA 4ECUA 1YBYA 1DGSA 3EA6A 3HOXG 4DV4L 3EPGA 4FM9A 3OSPA 2HQLA 2NBFA 5KG7A 1A9XA 4A3KH 3UDFA 1SNQA 1UUPA 2HUGA 1FJGQ 3PIP3 3M3YB 1E4GT 1GGOA 5IIFA 2OWOA 4KHPL 3PUXA 4U673 3JAMc 5D1OB 4ED0A 5IP7H 2XWJB 2F1MA 3K0XA 5KFMA 4ZQ3A 3I4MB 1SYDA 1S5ED 5L1LA 2D9UA 1CQFA 3UDGA 1XMOL 1WJJA 3RUPA 2XVSA 2CQOA 3TMEA 3GTPH 1HTPA 2UUCL 1EWHA 1EQTA 1VBHA 2L15A 4V190 4M9UA 4XIGS 4QMGA 2VUMB 1X55A 3OTOH 1KC7A 3UDIA 3X3NA 3HXLA 1EWCA 2VZAA 4C3JH 5KFTA 4YBZB 1BO0A 4UPAA 4NXNL 4A3KG 1P8LA 3SHLA 4R4QA 4R9WA 1Q82C 2JA5H 3BG5A 4EBEA 4LUOA 4L1KA 2RF4A 1VQ8A 3S16H 4JV2A 5IP7G 2V4QA 3DMUA 1GKHA 2ATWA 4JBKA 2W71A 3STBC 1PRTD 3TZDA 2YU9H 3RB0A 4IZ8A 1RJQA 2KA7A 4FDBA 4QW9A 4I4TF 1K1QA 4JI2L 1SLJA 4G57A 2R8KA 1FJGH 2L11A 4X62H 1G2TA 5M3FH 3TQTA 4ECZA 1IBML 4RB1A 4P74A 4B3TQ 2K32A 2RDHA 1N33H 5AJ3Q 3VYTA 2BCOA 4J9KA 2HHHL 4CC5A 3RB6A 2AWNA 2J4XA 1Y1VB 3GTJH 3B6YA 3KF8B 5AFWA 2RSOA 3BZCA 3V96A 3RGZA 1RK5A 4C3JG 2F03A 5KEEA 2RHQB 3KUPA 4OXPA 1IBKL 3VA7A 3RB4A 1DYQA 4PV1C 5C1OA 2WACA 2JA5G 3H4BA 3J81E 2E75C 1SAPA 5J3BA 4DF7A 3NWTA 3M3YH 3MWMA 3S1QB 2JA7A 5JJZA 1KXLA 2KHSA 1WTOA 4CDDC 5KFDA 4IRKA 2VY3A 3I4OA 4DR4Q 4LUVA 5IY0A 4DV2L 1BOSA 5KFEA 4Q0FA 3I4MH 3QZ7A 5EBDA 3W1BA 3N44B 5M3FG 5J2UF 2F0GA 2A73B 3VYUA 1I6HH 2V5AA 3GTGA 4IWXA 1XNQL 4JI6Q 2AMCB 2D62A 4IQZA 4U6PA 3F2DA 1J5EL 1CKOA 1L1OC 2K7VA 4EX5A 1ZXTA 3J80c 2VUMH 4GC6A 3K58A 3CCEA 3EPIA 1RYRA 4RHSA 3GTLB 1ASYA 1IW7C 1Q90A 4X3TA 1PH1A 2UXBQ 3GILA 4MV3A 4PQXA 4B3TH 2CH4A 3F8TA 2BH8A 4YCVA 4XQQA 5KG1A 4Q45A 1YI2A 2F0WA 3E0EA 2HT1A 1RD9D 4HSVA 1GM5A 2F0MA 2K1BA 1EIHA 2VQEL 2E74C 1WTRA 1E4EA 5KNBA 4H13C 1SYGA 2K52A 3MEFA 3V6HA 3I4MG 4NDXA 1JDBB 1CQVA 1JIHA 3D6WA 2VB3X 4QIWB 5CV6A 3E6ZX 3ONAB 2QW7A 4EQPA 1PFSA 3GTKA 4DR4H 2MPMA 2O4XA 1TXYA 2VUMG 1E22A 3BDOA 1N48A 3LP8A 5K2MA 1ZHQA 3ERQA 1Y1VH 4DV5Q 4H0LC 1IHZA 2W70A 5LMNQ 3OMGA 1M0TA 3SK6A 5LP6F 2GVAA 2IMWP 5GROA 1O75A 2VQFH 2JEGA 3TBIB 4LFBL 1BUVT 3S2HB 4GOPC 3RMHA 3S1QH 1JB7A 1PX2A 5BPHA 2IBKA 1IBLL 3AYHB 4O1NA 1UC9A 3U4ZA 1BNCA 5ISRA 4DPGA 2EYOA 4FS1A 1TQOA 2UXBH 1S9FA 1RL2A 1ULZA 3MZ5A 1L0WA 2R86A 4DUZQ 5LXTF 3KJPA 4X66L 4LFCL 4DL3A 5G3LF 4DV6Q 1XPUA 4JI8L 2QKIC 1WSCA 1Z47A 2KBNA 4UP7A 1HNZL 2J6UA 4IRCA 2NZHA 5F2DA 4K2LA 1CHQD 2NVQB 2PPBC 2EYHA 3VA5A 1Y1VG 2CW0C 4ME3A 4DV0Q 1KC8C 1IYUA 1AN7A 3H0GA 1KNEA 3P20A 5DEHA 3GTLH 3HBLA 3KK7A 4ECWA 3QZ8A 1LYLA 1B3QA 2P0AA 5KKNB 4HMJA 5FO9B 2W6PA 4RUAA 2IJ0A 5C4ZA 2SEBD 3OYYA 1A3VA 2PYKA 4KY6A 1BGWA 2JA6A 2EVBA 4N8FA 3DLLA 1JOQA 4RAUC 4DV5H 2JEBI 4YY3L 1TWHH 2ZM6Q 1SBBB 3T1YQ 4EFBA 2K14A 5CA0F 2NU6B 3H20A 2AGPA 5M5WB 4V0BA 3T1HL 1SYCA 1EY8A 1SRUA 2QEJC 1RJTA 4RCNA 3WNZA 5KFJA 4DR1Q 2I5HA 1K9MC 4OX9Q 2L4NA 5IT9c 3K0YA 4ID6A 2B2UA 3SGIA 3S1NB 2DJFC 1FR3A 4HIMA 4JYAL 5CGKA 1Z7TA 1OWTA 1NY4A 4C5CA 1TKWB 3BA8A 1M6VA 5IYCH 3SR1A 2JA7B 2ZJPA 2X0SA 2A1AA 3T4AC 4LSAA 1UEBA 4DV6H 5A2QL 5KFPA 3J7AK 3RV3A 2SCUB 3CQZA 2FLNA 4GLAC 5KFQA 4DAPA 4DV4Q 3S2HH 2LY7A 3SVMA 2VW9A 3A7AB 1I4GA 2NVYA 4YAJB 4A3JB 4LF6L 2RDGA 1N36L 4Y8VB 3GTGB 1CTMA 1B6SA 1Y1WA 4OELB 5IGCA 3F2CA 1PYSB 1S68A 3D4RA 3SK8A 4KHPQ 1M7JA 2LXJA 1GXDC 3TQYA 4DGZA 3PUWA 2HVSA 4LW1A 1K0SA 2ZM6H 4DR6H 3T1YH 1CI3M 2HQEA 4JI3L 2AHOB 4QUCA 1NUCA 4ECSA 2K03A 2NVQH 1TY2A 1ZEQX 5LOVF 1GYFA 5IYCG 4Y52H 5LMNW 2UUCQ 1OXXK 4OX9H 2RCNA 1E4EB 3VDYA 1EIFA 2E5LL 2PMZE 3IL8A 4HJ8A 1AH9A 2B2TC 1WTVA 3HGBA 3K5IA 3STBD 4DR7L 2NVTB 1YHQA 3GV8B 1C8CA 1HFNA 2R7ZA 2UUBL 5F9LA 3KHRA 3HP3A 4B3MH 2LS01 5M5WH 1ET6A 2OQKA 1XYIA 4DXGA 1J8IA 3W3AA 3GTKB 1BXRA 2ASDA 3WOEA 1STGA 2VR1A 4YR0A 3V4ZA 4XZ3B 4DV4H 3IN5A 4G7ZC 5JH7F 4DK0A 4NP5A 3S1NH 4DR3Q 4RGMA 4JI2Q 3TP5A 1UE5A 3HOWB 3F2BA 1KBLA 1SNCA 3BJUA 3U9SA 2ASBA 4KHPH 5L9XA 1IBMQ 4MNOA 3P75A 2JA7H 4IJHA 3CCMA 5C3XA 5KFBA 4IWYA 2H4OA 2HHHQ 3GIDA 2LKVA 1KABA 1IKMA 1D2BA 5ELEA 2NZOA 2K05A 1PFBA 1XMOH 3G6YA 4XQNA 4MA0A 1IBKQ 1CKNA 2I0QA 4X3SA 2Y0SA 4A3JH 4F7XA 2UUCH 3VR2A 3C1FA 3RZOB 3GTGH 2P5ZX 2WAQE 3A74A 4HIOA 4LFAL 3J80W 1HQRD 2K50A 2R82A 5KG3A 5EJWA 5KT4A 2A6EC 5BN5A 1ILPA 4RZRA 1T5EA 3H0GB 4CKCA 5BN4A 2OXPA 3R2TA 3GV6A 4ED8A 3Q8RB 5T14A 1PMRA 2HGSA 5KT2A 5TSSA 1SNDA 2KUMA 1Q46A 2ATLA 1I4HA 5IYBH 3J7ZC 5FLXE 2CW8A 1EYAA 1Q12A 3KAKA 1WOCA 4HYKA 1EUJA 3HOZB 1JWSD 2HD3A 5GQOA 2JA6B 5KIXA 3PV0A 2JA7G 3UFXB 3V6JA 4DA2A 1YZ6A 4JBWA 2O5IC 1E24A 1KRTA 3EQLC 5T1IA 1S97A 4KLKA 4JI2H 4E4TA 1A2UA 4XXEA 1UAPA 2X6GA 2NVTH 5D65A 3RD4A 2ZTEA 3NBHA 3PW2A 4NB3A 3I73A 4A3JG 2ZT9C 4A3LH 5JPMC 1IBMH 4TKOB 3J81i 3G6EA 1KIXA 2F0QA 1BNZA 2HHHH 3KOJA 2A8VA 1N56A 3M4PA 5FKAC 4IOCA 3GTKH 4MN3A 4MV7A 1DM0B 5EQ0A 5I4DA 2KEEA 2VQEQ 5KG0A 4JG2A 3KYHC 1HRJA 1TWAA 2PW5A 1IBKH 1FJGL 4RNNA 1KAAA 2EYPA 2N49A 3K59A 3MWYW 4RCOA 2FPGB 2JSOA 3HOWH 1XTDA 4TV8F 3WO0A 2BDNA 1CZGA 5IYBG 3I56A 3CQZB 3P1HA 1K3BC 2UXDQ 1PH4A 4X3UA 2ES2A 2NVYB 1E1OA 4FF1A 3CCQA 1X9NA 2AU0A 4Q0YA 1GSAA 2XGQA 4DV2H 1N32L 5T1GA 3G71A 2OLSA 4ETSA 3PR4A 5KFCA 5C4HA 1LTRD 2F0PA 4A3LG 1XNQH 4ZYSA 4R8NA 2IPKD 3E5SA 2CH4W 2AUKA 4LF7L 2MP1A 4GN5A 3NGDA 1J5EH 4I7ZC 5I47A 4GLVB 2DZDA 2I07B 5JQWA 4RG1A 2EXZA 3H0GH 4MAMA 4O4IF 1HXYD 4A75A 2CWPA 1ICWA 3DEOA 1RYSA 1A62A 4DKAC 3PZPA 3HOWG 1ML0D 3MFGA 1VQ7A 4X66Q 1KHIA 1XNRL 1GUGA 4JI8Q 1EU3A 3HOZH 4YB8B 2JA6H 5EOYA 2VQEH 3UE1A 3MFYA 2R7ZB 3T5JA 4ECVA 3EROA 1KJJA 2FK3A 5LHY1 4LH7A 2JEIA 2K6AA 1EY0A 4MV1A 2JA8B 5IT9W 3ZYYX 2UXDH 1GUWA 3AEVA 4BY7B 2PQEA 4CGYB 5KFNA 3NEMA 4F87A 2E2DC 4MV4A 2C00A 3H0GG 4YY3Q 5HY6A 3QO2A 3BYYB 3PR5B 4ED6A 3I4NB 4FS2A 4L5RC 4JV5L 3T1HQ 1H9JA 2FMAA 2C22A 3MWDA 3HS0C 4LFBH 5DQGA 1S5CD 3GQBA 3CQZH 3RF2A 4C5AA 1FNWA 3HOZG 1PZID 2JA6G 4DR4L 2IWHA 2RBMA 4P73A 2A74C 1CKNB 2KVMA 3LGJA 2NVYH 2Y0SB 2FKLA 3JAME 5EZYF 5EPLA 3X3MA 2XGTA 2EPBA 3AMUA 2QILA 3RNUA 3A55A 4CJ1B 2F4VQ 1ENFA 4UP9A 3NTHA 4JI6L 1W6KA 4H7BA 4X66H 4IR1A 4LFCH 1ASZA 4JI8H 5HV6A 1YNND 4JOIC 3GTOA 2SNMA 4UFZA 1HNZH 5HGTA 1QOHA 4NMZA 1TS3A 3TINA 1PZKD 1P16A 2ZXPA 4YIJA 1VAJA 3KALA 1DD2A 3BA9A 2N88A 5ELBA 3CRLC 3CMEA 1T5XD 1N36Q 4N8X1 3GV5B 3MTSA 3E3XA 2J0TD 4UHVA 4QWDA 5KG4A 3DXJC 1TY0A 1KRSA 1RDPD 2IHFA 1CK1A 2MFIA 3I55A 5I6YA 1V43A 1PH7A 2BR0A 1B04A 1SNMA 3J81j 3T13A 1DZ1A 1B3AA 2PCFB 1Z2PX 1Y8OB 4AH6A 5C5JA 5GONF 4YY3H 3NBHB 2R7ZH 5I2YA 4FF2A 1MKHA 4JI3Q 4QY7A 5JEAJ 3T53B 1XMQL 3T1HH 5JVG3 2K33A 4LJZC 4UCSA 1I6UA 2JA8H 4JV1A 3HKSA 1Z6HA 3WDNA 1TWAB 4KD3A 4KK7A 3U4VA 2E2IH 3PCOB 1JWMD 1QNKA 2B63H 4BY7H 4LH6A 3ETJA 4GS3A 1QJOA 5KFVA 1WVLA 5CV5A 4DR7Q 4J15A 5LMNL 3HOYB 3MFIA 3S1MB 2AQ3B 2UUBQ 3VPDA 4J9MA 1EUDB 4YWKA 4ZKCB 3OWFA 5DG7A 2B29A 3HEJA 4DUYL 2V59A 4YCUA 3I4NH 5G3LD 4ECRA 2BOSA 2BQ3A 2QYZA 3M4IA 4L63B 3OW7A 3GIPA 2W9BB 4K14A 2R7ZG 4LF6H 4DUZL 1N36H 3I8ZA 1KD1C 2UVRA 2G5DA 5I9PA 3DHQA 4ZKBB 4GKKQ 2M2LA 2Z6KA 1G6PA 3KLWA 2JA8G 1TWGA 1IL2A 2I8CA 2E76C 2B63G 4BY7G 2DY8A 2MCTA 4DV0L 4JI3H 3V2TA 4CHTB 3C46A 1M90C 1QB5D 1ICFB 3NTKA 1XPRA 2EYJA 5EAYA 2W6QA 1H9KA 2K5WA 1F9QA 4KY5A 4LFAQ 3I4NG 1UNNC 4QB4A 5DGBA 1DJRD 3MAQA 1AUVA 1I4RA 1ESFA 2Z4IA 1VF7A 3S17B 4DR7H 2PZTA 4DNRB 3BAAA 1HR0Q 3MWEA 4OHJA 3CC4A 2UUBH 4P2CB 3J80L 1VQLA 1VQGA 1A3UA 2Y0SG 3CAMA 5E1FA 3SI8A 4DR1L 1H95A 3RJ0A 2EIFA 3TSSA 2DLNA 1B9NA 3SEBA 4JI5Q 4JOIA 1JB3A 5JPNC 4FU0A 2YRXA 1C30A 1F2LA 5M5XB 1GJXA 1JE4A 1TWAH 3BU2A 3DWQA 3IFDA 4EYIB 4JUZA 4QW8A 3EBEA 4MV8A 5FD5A 3HOYH 1I7LA 1CSPA 4ABNA 1I7NA 1AE3A 3S1MH 5I6WA 4J0MA 2NVXA 1VQ6A 1S03G 4A76A 3LWEA 2BQUA 1S0NA 2XCLA 2QF7A 2K5NA 3R23A 4JI4Q 2PW7A 1AFPA 3Q23A 3D0FA 4MTKA 4ED2A 4RB2C 2R8GA 2YTYA 3GTOB 3VMMA 4LFAH 1UNSA 3MHBA 4JK1C 2MO0A 4MA5A 2AGOA 3NPPA 3C2PA 4XYOA 4RU9A 4F4ZA 2KJXA 2PI2E 4O42A 5L1IA 3GV3A 1FGUA 1HHVA 1AUXA 5D3IB 2IT1A 3IG0A 1N32Q 3TDQA 3HOYG 1X56A 5KNCA 1GO3E 4A3GB 4FNFA 3PQIA 3KHHA 1N34Q 2VQDA 3KLSX 1QCBD 4LF7Q 5C5LA 1A6XA 3SXHA 3K3PA 4ED1A 3SE7A 1YEZA 4GC7A 4X65L 3S17H 1PLFA 1K73C 2IX1A 4J9NA 1HPCA 1JOKA 4O3QA 2FJZA 4RAZA 1PK8A 1EQVA 5C4JB 2ZDGA 4WJWA 1XJVA 1EYZA 4F50A 5KFKA 4K8IA 5GAHC 1XNRQ 3EN2A 5M5YB 1OXUA 3M4YA 4HIKA 3H3VC 1I50A 4RAYA 4C2MA 2PZUA 4DR3L 4QCLA 1BCPB 5M5XH 3G6JB 4DV3Q 1KDAA 1MI2A 1L2ZA 2EJMA 1EY6A 4OWWB 2R6FA 5E4WC 4GZYC 1L0XB 2YS6A 2ICIA 2A69D 1EZ8A 4HCEA 2QA4A 1CQIB 4J9PA 5IT9L 5E7NA 1N32H 2B8GA 3PVXA 4PMCA 1NMFA 3DWPA 3E9IA 1HR0W 1WTXA 1Q1EA 4IRDA 1PRTB 4JV5Q 2WYOA 2WP8J 4APMA 3IRBA 1SN8A 2BA0A 2K4KA 3NQIA 3GTOH 1K1SA 4LF7H 1GD7A 3N52A 1NR2A 4IUTA 4JBJA 4KMUC 2YV5A 3WO1A 1RCVD 1Z2NX 3T56B 4ZRZA 5IE8A 1I6VC 4OIJA 4EYHB 1Y8NB 2RGVA 1F9RA 1EQRA 2K28A 2RSNA 1XNRH 4A3GH 2UXCQ 1JMCA 1WD1A 4ED7A 5BMVF 3GTMA 4K0KQ 3OHXC 5IGBA 1EFWA 2W6OA 2L1BA 5C8YF 3G6XA 3KHLA 4O3SA 1PFMA 2FK1A 2VNUD 2JJQA 1EY9A 3PW4A 2NWGA 1CM9A 2CHBD 4GNXC 3ULJA 1TWFA 5D1PA 1EYDA 3BVZA 2FJ2A 5JVH3 3RR5A 4IOAA 3BQ2A 3HKZE 5C4JH 5IOCA 2NZ1D 4AYBE 1WTWA 2JE6I 1JR0D 2EYLA 3KLSA 5M5YH 3ORQA 3JAMi 1EHIA 4IUVA 4APVA 4DNTB 4J1MA 2NVXB 4BXXH 1XMQQ 4JV5H 4E6IA 2UXDL 1VQDA 3A0JA 3K5HA 5CBAE 3TQ1A 2WB1E 1YIJA 4YHHQ 5GAEC 4A3GG 1V51A 1ENAA 5EWFA 3GIMA 1HTLD 1KLUD 4KN7C 3RAXA 2R93A 3RN2A 1PTOF 4UCOA 2IW3A 1IOVA 3H94A 3VYRA 1PH8A 2Z1CA 1JORA 5CV4A 5KT5A 2KHJA 5JEAH 4JI6H 2EZVA 5IWAL 2EQSA 4DUYQ 3OUUA 4YJ3F 1VMCA 1VQIA 1STBA 5CV9A 5KFUA 1EY4A 4IO9A 4A93B 1Q86C 2XRSD 4DL4A 1RJPA 1PA6A 2YCHA 1SFOA 4BXXG 1EEFD 2ZTDA 4BA2I 2VB2X 3PUZA 4CBVA 4A3DB 4WJ3M 4PZ6A 2EY6A 1VCIA 2DGYA 2R3ZA 1QWYA 3PW5A 4GKJQ 3KTMA 2FE3A 4UP8A 3P7JA 4QWAA 3GTQA 2C9OA 3JSLA 3CW2C 4MV9A 5KFSA 5I9OA 5HBRB 1XMQH 1STEA 3BABA 2XN9C 1LLRD 3SK5A 5JEAG 1Q81C 1CQJB 3CCRA 1I50B 1RODA 2A68C 4C2MB 3RGXA 2TSSA 1O7ZA 4ME6A 2X6LA 1PFNA 3H91A 3LX0A 1S10A 4MHEA 5LL6X 4TUYF 5LMNH 3ER0A 5GAGC 1VQHA 1LT5D 2VXWA 2FB9A 3Q22A 4YAKB 1G291 4X6AH 4DUYH 4HAEA 2RDJA 3R5FA 2BH2A 3RB3A 3MFHA 5A2QE 3FMAA 1I4XA 1L1OA 1HUNA 2R7NA 4X64Q 2CZGA 4PZ7A 1MGSA 4WORA 4TQRA 4XDXA 4OO1I 4EEYA 1T3NA 3S1RB 4QWBA 1UEAB 4BBSB 4DUZH 4EVOA 3W2DA 1HZAA 3BS1A 4I50F 2F4VL 1A8VA 4NPSA 4LNQA 4BWSC 1LTAD 4NXML 4HCSA 3DM1A 4GKJH 2CKZB 2Z4HA 2B2VC 4IAJA 1A15A 2VUGA 1Q8IA 4DV0H 3L4JA 2B3GA 5A35A 5K5PA 3PUYA 2DPIA 4A93H 2ZJTA 2UU9L 1JE5A 4QWCA 3U50C 3H4DA 4C1NI 1M8AA 1YNNC 1QVCA 4XTCS 3GTMB 1ZYRD 4R7RA 4A3DH 1D5ZC 3TS0A 2JEJA 4H44C 4CJ0B 3BG3A 1NNXA 3KF6A 1EZ1A 1PHJA 4XYQA 4GN4B 2Z0SA 4C5BA 3NHHA 3G7LA 4F8MA 3AFPA 1TWFB 3J81c 2X69A 5IYDH 2RCFA 4DR1H 2YTVA 3H09A 1WFQA 2KECA 3KFUA 1V4YA 2EOTA 4EGQA 5EPKA 4GOPA 4X64H 1W96A 1I50H 1AZPA 5E4XA 4C2MH 1TWCA 2FMCA 4YCWA 1PTOC 4OIKA 3I2ZA 2LMCB 1GVPA 2NN6I 4ODGA 4A93G 4X65Q 1L2FA 2QGQA 2B2YC 5C3EB 3S9WA 3CF5A 4IUNA 1YHAA 2HVQA 4M7EA 1QZHA 1RTNA 2GLTA 2BA1A 2R7LA 1TVXA 2IA6A 4A3DG 4R4CA 3PO2B 2N55A 4RUCA 2DN8A 3CXCA 4I65A 1JOOA 3MR2A 2O2LD 5DLFA 1DOLA 2RDFA 2F0FA 2VL6A 3Q8DA 1CSQA 3QG1A 1EU4A 2O5JC 1SMYD 4EBDA 5IYDG 3S1RH 3Q6SA 4BBSH 4GKKL 1LACA 3D4WA 3TZUA 3I90A 2KCNA 3G4SA 3U58A 1RK6A 1G6ZA 3I12A 3J7YW 2K04A 1B1ZA 3RLFA 2YYAA 3JSNA 1X3GA 4ZAIA 2ZDHA 1X32A 3HOVB 2Q2IA 4R8IA 2YYZA 5KX5F 1IOWA 1K3RA 4K8JA 3T5HA 3KDFA 1SFOB 1HJPA 1YNJD 2J6SA 5C3WA 4A3BB 2DWCA 4OWXB 4TSSA 1DOKA 1BBXC 3OIPA 1WR2A 2JK8A 3RLOA 3DWAA 5BR8Q 2XNAC 3GTQB 1PH3A 3GTMH 1II3A 1B33N 1XTCD 1HR0L 4AIMA 3K5OA 4X65H 3PF4A 2CWAA 1T94A 4XT1B 2F0EA 1I3QA 4DR2L 2OTJA 1TWFH 4BBSG 1TS2A 2NU9B 4JI5L 1C3OA 2FLPA 2ALYB 3VR5A 3D8GA 1X54A 4BA1I 3OOCA 4DNIA 2Q8RE 4RGOS 1YJ9A 4K2KA 1QNUA 4DR3H 1IZ6A 1JT8A 2YRWA 3L0OA 1R4QB 2BDOA 3TN2A 4IUPA 3KHGA 1LUZA 3BJYA 2Z9HA 3HOUB 2AGQA 2F0SA 2DIKA 4XX0B 1NR4A 2QDLA 1BR9A 1O7LA 2F3VA 1L1OB 5C3EH 2W6ZA 4GLXA 4HJAA 4Q8FA 2UVUA 2YZNA 1BQQT 1E3PA 1F77A 1EIGA 4JI4L 2V58A 3L3OC 1QG7A 3MR6A 1SEIA 2WKCA 5KT7A 3PO2H 3PMFA 2VA3A 1XXGA 3S15B 5DM73 2XRQD 3ORRA 3ND9A 3MXGA 4ZHQF 1NJIC 2GA4B 4DN4M 1DV1A 3QB3A 4EGJA 4PMBA 1X3QA 3NTIA 1BVSA 1VQJA 1HNWL 1NE3A 4EEQA 2B2TA 5EKLA 2R7DA 1OO9B 1TS5A 2PMZA 2C2RA 4RHRA 3HOVH 1G8ZD 1Y1WB 5C1PA 4DV1L 4IN3A 2RGRA 1HZBA 1LTLA 4BWGB 4UY8C 5FPRA 3G6VA 1SFOH 1EY7A 2O03A 2JEAI 4UCTA 3F2UA 4CDEC 2AQ2B 1CE8A 1F9SA 2IX0A 3FPUB 4A3BH 1N34L 5C3EG 3I4LA 3KF6B 5IWAQ 3RZOH 2LSSA 2EJGC 4IZOA 4C3IB 3I72A 1VQAA 4FVMA 4Z9CB 4DAYA 2IY5B 3CCVA 3GTQH 1F2ZA 3TP8A 3KBXA 3PO2G 3TIGA 5L1KA 5FO8B 4O4HF 3GIKA 1EYCA 2JYOA 1KDBA 1SE4A 5FO7B 1S5BD 1PH9A 4GOPB 4FO2A 4R4IA 1JDEA 3M85A 1MJCA 1TWCB 2A68D 4JPBW 2RDIA 1SNOA 1DCZA 2F0KA 1EQQA 4O3RA 3CC7A 3HOVG 2CQYA 1YITA 4DV3L 5DG9A 3MC0B 2JEFA 4RA8A 5IYZF 2RVLA 1B4OA 3FRPB 1WCMA 3JRWA 3QOJA 1U0LA 4A3BG 3HB9A 1DXMA 3HOUH 2WAQA 1U4LA 1PDQA 5IGFA 2PVPA 3ND8A 3NQTA 4LF9Q 3ETHA 4TQSA 2IL8A 4O4LF 4ED3A 2DJGC 3GD7A 3HFZB 4F4XA 1SE8A 4HNUA 1PH2A 2WDTA 4C3HB 3C3LA 1D1KA 4HJ9A 4IUUA 2R61A 4OO1H 4ZUIA 1U9RA 5IWAH 4OONA 2MO1A 3CKIB 5KGUA 5CMDA 3M9NB 2KQ3A 4CKEA 4R8UA 1HNXL 3PO3B 4ZCKA 5C0XJ 5KFHA 1HH2P 2A69C 3KDFB 3R5XA 4PNYA 3OUZA 4FYDA 3R8BA 4LWCA 3PGZA 2I5LX 1JX4A 3V4SA 4LF5Q 2YU9A 4A3CH 4B3SL 1Y1WH 5JVDF 1TIID 1BJTA 1ILQA 3FEWX 4TQUS 1I94Q 5KG6A 4DL6A 3A8IE 1C4QA 1Y8PB 2HIXA 3N6XA 2UXCL 3HOUG 3PW7A 2F0NA 4NXMQ 1SJHD 4EFEA 3M4QA 5EBCA 3W1GA 4K0KL 5F9NA 4LSXA 1T9HA 3J81W 4C3IH 2HVRA 1CHPD 5KFLA 3GTJA 3Q2OA 1U4MA 1ESRA 5KYIA 3RZDB 3GQCA 1HZCA 2UU9Q 3RFCA 4OO1G 2L12A 4RKLA 5DQHA 1X3FA 2EXDA 5C0XI 1IKLA 4RGNA 2PNHA 1SYBA 1J6QA 1KTKA 3R5HA 1EL0A 1TR5A 1TWCH 3CCLA 3M9OB 1YHBA 1FVIA 1PTOD 3K80C 3UI2A 2EE1A 4ECYA 3NE5B 1KQSA 1Y1WG 4A3CG 2AQ4A 1L0YB 1LT4D 3LMLA 4POFA 4YHHL 5BPFA 2NN6H 4I7HA 1NMGA 2PZWA 1XPOA 1H9RA 3BVMA 4A3EB 4QIWE 4DAVA 2Z6BA 3J7AV 2MQHA 2EYMA 3R3OA 4C3IG 4IURA 2NUCA 3CHBD 3HZXA 5FLXc 4HQ6A 2XTIA 1I94H 1UE7A 3KBGA 4EBCA 2F4VH 2RQXA 4MZ9A 4L5TA 1A63A 3L9AX 3CCJA 4NXMH 3PF5A 1DOMA 1KNAA 2PMZB 5H1SE 1SROA 3J7A5 3I3CA 2W6NA 5JUMA 4ME5A 4NLGA 3U9TA 5KFGA 1OXSC 1KL9A 3PO3H 2R6GA 1LTID 4G3IA 1C0AA 4WFN3 4HMIA 2UU9H 2KSWA 5FD6A 2J7ZA 2I5MX 5LL6S 2MJ8A 3EVQA 4DAYB 2NN6G 3G48A 4RFBA 4B3RQ 2HIVA 4GKJL 4FBTA 2R7KA 2F4IA 5J1ZA 3TEHB 5J39A 1STNA 4XT3B 2XCAA 2N8NA 4K5VA 4FF3A 4A3FB 1LT6D
chains in the Genus database with same CATH topology
4IPGA 2ID0A 1K8AC 3F2CA 1PYSB 1EQRA 2N78A 4KHZA 4LF4L 1PYBA 4KHPQ 4JI1Q 4A3GH 2UXCQ 1JMCA 4EQ5A 2LXJA 2DUDA 4LFBQ 3TQYA 1M1KC 3PO3G 4JI0Q 3PUWA 4K0KQ 4LW1A 1EFWA 1IYJB 1OXVA 4JI3L 4YWMA 2AHOB 1IBLQ 2VNUD 2JJQA 4DAMA 1SMXA 1JJ2A 2NVQH 2K75A 4DR2Q 4GNXC 4JCVE 3ULJA 5IYCG 5FLMG 1NTGA 4Y52H 5LMNW 2UUCQ 1OXXK 4OWTB 2RCNA 1QZGA 2KCMA 3RR5A 4X64L 3VDYA 1UE1A 1EIFA 3HKZE 3UE0A 5C4JH 4DR5L 2Q2UA 2E5LL 4LFCQ 2PMZE 5GADC 4A3IG 2E8GA 4HJ8A 1AH9A 4AYBE 4A3EH 1HNZQ 2JE6I 3L2PA 3STBD 3CPWA 5M5YH 4DR7L 4QQBX 1YHQA 3JAMi 2E2HH 4APVA 3M7NA 3S15H 2Q2HA 1W2BA 2UUBL 4BXXH 1XMQQ 5JJLA 2UXDL 1VQDA 1YJWA 3PUVA 4B3TL 3A0JA 5M5WH 1VQKA 2OQKA 2WB1E 1YIJA 5AJ3L 4YHHQ 5GAEC 4A3GG 1SR3A 2Z6KC 1S72A 4B3RQ 2A19A 4GN3B 4QL5A 2OQ0A 5DLQE 3S1NH 3OTOQ 3RN2A 1I5FA 4DR3Q 1PH8A 4JI2Q 1UE5A 3ULLA 2V1CC 3F2BA 2KHJA 1C9OA 3BJUA 2ASBA 4A4IA 5IWAL 1IBMQ 4MNOA 2EQSA 4DUYQ 2JA7H 3K7AH 4IJHA 1K83H 3CCMA 4LF8L 1HNWQ 1VQIA 1S40A 3CCUA 1D7QA 2HHHQ 4IPHA 1OTCA 4RMFA 4IO9A 4AQYQ 2UUAL 3CC2A 1Q86C 4A3EG 2NZOA 3TREA 4DV1Q 1MJEA 1PA6A 1Q8KA 4JYAQ 1IBKQ 1CKNA 4IPDA 2I0QA 4A3FH 4BXXG 4A3JH 1Q1BA 2ZTDA 4BA2I 3PUZA 4WJ3M 3GTGH 2WAQE 2ZTCA 3A74A 4PZ6A 4O2DA 2K50A 4X62Q 1VCIA 2DGYA 2VQFL 4HIOA 1PV4A 1PH5A 2ZJQA 3HKZG 3S24A 3A5ZB 1IXRA 1PH6A 4GKJQ 1QVGA 1N33Q 4JI7Q 4AYBG 4UP8A 3D31A 3KJOA 1K8GA 1VQFA 3CW2C 2UXBL 1BKBA 1WCMH 3S2DH 1VQ5A 1Q46A 4LF6Q 1Q81C 5JEAG 3J7ZC 1HZ9A 5IYBH 4HIDA 2N3SA 1Q12A 2WB1G 1WOCA 1VQCA 1EUJA 3CCRA 5GQOA 1YVCA 3AFQA 4BY1H 3PV0A 2JA7G 1YZ6A 4JBWA 5C44H 3H15A 3RN5A 4A3MH 1W3SA 1E24A 4DV7Q 1KRTA 4KLKA 3ER0A 1KAWA 1EYGA 2R92H 5GAGC 1VQHA 2NVTH 1C7YA 2ZTEA 4C3HH 4NB3A 4A3FG 2K5VA 4A3JG 4IFDG 2IHEA 2RHSB 1G291 5ELNA 3J81i 4A3CG 4A3LH 3G6EA 2F3IA 1R9TH 1KIXA 1V9PA 4O0AA 2OTLA 2BH2A 1L1OA 3KOJA 4P72A 3I7FA 3M4PA 4IOCA 2A8VA 3GTKH 3ZJYC 4X64Q 4PZ7A 3CD6A 2VQEQ 2E5LQ 4JG2A 3KYHC 3FKIH 4OO1I 4MTNA 1JJGA 4DV5L 3BZKA 1FJGL 1HZAA 3M9BA 2N49A 2K5HA 1WCMG 5FJ8H 2F4VL 1A8VA 4NPSA 2LXKA 2GVBA 4LNQA 1XTDA 3HOWH 1VQNA 3I56A 5IYBG 2WAQG 5BR8L 4NXML 2UXDQ 4BY1G 1PH4A 3CP0A 2CKZB 1HNXQ 1E1TA 1EWIA 5C44G 4A3MG 2ES2A 1AE2A 1E1OA 4HJ5A 5K36G 2B3GA 3CCQA 1VQMA 1X9NA 3PUYA 1I3QH 4A93H 2UU9L 4JC0A 1JE5A 4B3SQ 2R92G 1N32L 3U50C 3G71A 3RZDH 4DK3C 4ALPA 4A3LG 1QVCA 4PG3A 4XTCS 1G51A 4DV6L 3PSIA 5JJIA 4A3DH 3TS0A 4LF7L 4GN5A 3KF6A 1V1QA 1PHJA 1EOVA 4GLVB 4RG1A 4GN4B 3A5UA 2Z0SA 3FKIG 3DM3A 3AFPA 3H0GH 5JJKA 3J81c 5IYDH 2GN5A 4A75A 2CWPA 5LMUL 4BBRH 5FJ8G 4DK6C 1A62A 1Z9FA 4DKAC 3ICEA 2YTVA 3HOWG 1WFQA 1VQ7A 3GO5A 4X66Q 1KHIA 3KFUA 4PMWA 1XNRL 1RIPA 4QGUA 4PZ8A 4JI8Q 4GOPA 2VQFQ 1I50H 3HOZH 2JA6H 1YJNA 3UE1A 4C2MH 1MIUA 3HOXH 4YCWA 2PI2A 3I2ZA 4DR6L 4LUZA 1VQPA 2ZM6L 3T1YL 3K81C 1GVPA 2NN6I 4A93G 4X65Q 1L2FA 2QGQA 3OW2A 3TS2A 3CF5A 1YHAA 2AWOA 1QZHA 4OX9L 1UE6A 2BA1A 2CFMA 3AEVA 4A3DG 4R4CA 3EIVA 4L5QA 1OXTA 5C0XG 1Q7YC 4JBMA 3NEMA 3CXCA 1EIYB 2VL6A 3Q8DA 1CSQA 1X6OA 3H0GG 4YY3Q 5HY6A 5IYDG 3S1RH 4R4OA 4BBRG 4BBSH 3H3VI 4GKKL 1VS0A 4B3ML 4L5RC 1O7IA 3T1HQ 4JV5L 3G4SA 4QJFA 3U58A 1TWGH 2WFWA 2KHIA 1X3GA 4P71A 3RLFA 4R4TA 1VQ4A 1WI5A 1B8AA 2Q2IA 3CQZH 2YYZA 3CPFA 3HOZG 1YBYA 1K3RA 1DGSA 1QUQA 2JA6G 4DR4L 3HOXG 4DV4L 4P73A 5ELOA 3KDFA 1CKNB 1HJPA 3LGJA 2HQLA 2NVYH 2XGTA 4OWXB 4A3KH 3UDFA 2Q2TA 3RNUA 4IJLA 1FJGQ 2F4VQ 4UP9A 4JI6L 2OWOA 4KHPL 3PUXA 4JI1L 2JK8A 3RLOA 1ASZA 1UWVA 5BR8Q 4JOIC 3NELA 3JAMc 1PH3A 5IP7H 3GTMH 2H5XA 1HR0L 4JI0L 1P16A 3K0XA 4AIMA 1A0IA 1VQOA 3CMEA 3PF4A 3UDGA 2CWAA 1XMOL 1WJJA 2CQOA 1N36Q 4DR2L 2OTJA 1TWFH 4BBSG 3GTPH 4JI5L 2ALYB 2UUCL 3ULPA 4LF9L 2L15A 1X54A 4BA1I 3CMAA 1KRSA 4XIGS 2MFIA 2IHFA 4DNIA 3I55A 5IP9H 1V43A 1PH7A 4LF4Q 1X55A 3J81j 1YJ9A 3UDIA 1IZ6A 4AH6A 1JT8A 3FP9A 3L0OA 3NBHB 2JQOA 2VZAA 4C3JH 2R7ZH 1MKHA 2AKWB 4JI3Q 4UPAA 1LUZA 4QY7A 4NXNL 5JEAJ 4A3KG 1P8LA 3RLNA 1XMQL 4R4QA 1Q82C 2JA5H 2NVXH 3S14H 1L1OB 5C3EH 4LUOA 4HJAA 4GLXA 2JA8H 3HKSA 2RF4A 1VQ8A 3MXNB 1E3PA 4JI4L 2E2JH 3S16H 5IP7G 3U4VA 4HJ7A 4DR5Q 2E2IH 1GKHA 3PCOB 4LF5L 4JBKA 2ATWA 2B63H 3STBC 2YU9H 4BY7H 3JC66 4GS3A 3PO2H 1G6PA 4FDBA 1CUKA 4J15A 5LMNL 1I94L 1SLJA 4JI2L 4DR7Q 2CCZA 4DR6Q 3ERSX 3J80i 1NJIC 4GNXA 2UUBQ 4IFDJ 2Y0SE 5M3FH 4YWKA 2B29A 1IBML 4P74A 4DUYL 4B3TQ 1BVSA 4YCUA 1VQJA 2VS1A 3I4NH 1K0RA 5AJ3Q 1HNWL 5IP9G 1NE3A 2HHHL 2AWNA 1FL0A 2R7DA 1LM0A 4AQYL 3HOVH 3GTJH 2PQAA 3B6YA 3KF8B 4DV1L 1CKMA 4Y7NH 2KENA 3BZCA 1HZBA 1LTLA 2R7ZG 4UY8C 4DUZL 2RHQB 2YTXA 3AQQA 4OXPA 1SFOH 1IBKL 2JEAI 1KD1C 1D8LA 2IX0A 4A3BH 2JA5G 1N34L 5C3EG 4GKKQ 5IWAQ 3KF6B 2Z6KA 5J3BA 2LSSA 3KLWA 4B3MQ 2JA8G 3M3YH 3RZOH 1VQAA 1N8RC 1KXLA 1IL2A 4LF8Q 4JI7L 1WYDA 3CCVA 2IY5B 2VY3A 2B63G 3I4OA 3GTQH 4POGA 4DV0L 4LUVA 2UUAQ 3PO2G 4BY7G 4DR4Q 4IFDI 5IY0A 1M90C 4DV2L 3NENA 3I4MH 1XPRA 3W1BA 2R7FA 3L7ZC 5M3FG 5EAYA 1PH9A 4GOPB 4R4IA 1VQEA 1I6HH 3M85A 1MJCA 1XNQL 4LFAQ 3I4NG 4JI6Q 2AMCB 2D62A 1EQQA 3F2DA 1J5EL 1CKOA 1L1OC 4EX5A 1B70B 3E9HA 4DV7L 3CC7A 2JA9A 3J80c 1YITA 4DV3L 2VUMH 3HOVG 1HR0Q 3CCEA 3CC4A 1ASYA 1NBWA 4KI0A 3WWVA 1PH1A 1VQLA 2UXBQ 1VQGA 1XMOQ 2Y0SG 1U0LA 3CAMA 4A3BG 3F8TA 2BH8A 4DR1L 3HOUH 1H95A 2EIFA 4YCVA 4JI5Q 5C4XH 1YI2A 3E0EA 3FHWA 4LF9Q 4JOIA 2HT1A 1GM5A 2VQEL 3GD7A 1TWAH 3BU2A 3HFZB 1SE8A 1PH2A 1VQ9A 1X3EA 3EBEA 2K52A 3MEFA 2KCTA 3I4MG 2ZJRA 3UDXA 4HJ9A 3HOYH 1CSPA 1N9WA 4B3RL 1AE3A 3S1MH 4NXNQ 4OONA 2MO1A 4P75A 1VQ6A 1E7ZA 1QUQB 4A76A 1HNXL 5C0XJ 1HH2P 3KDFB 3K7UC 2MNAA 2K5NA 1PFSA 4JI4Q 4LWCA 1TXYA 2I5LX 3PGZA 1E22A 2VUMG 4LF5Q 4IPCA 3D0FA 1U5KA 1Y1VH 1Y1WH 4B3SL 4DV5Q 4A3CH 4LFAL 4TQUS 5LMNQ 1I94Q 2YTYA 2HIXA 4R1JA 2FXQA 2GVAA 3HOUG 2UXCL 5GROA 1Y14B 4NXMQ 4WJ4A 5C4XG 2MO0A 4LFBL 3M4QA 3W1GA 4K0KL 3TRZA 4GOPC 1T9HA 1JJCB 3GDEA 3S1QH 4C3IH 1JB7A 2PI2E 4H02A 1IBLL 3AYHB 3U4ZA 1FGUA 4DPGA 2IT1A 1HZCA 1RL2A 2UU9Q 1N32Q 3PIOA 1L0WA 4YWLA 4DUZQ 3HOYG 1X56A 1GO3E 2C35B 4OO1G 1X3FA 2EXDA 3KJPA 5C0XI 4X66L 4LFCL 4DV6Q 1XPUA 2PNHA 4JI8L 1N34Q 1BBUA 1J6QA 1Z47A 2KBNA 4UP7A 1HNZL 4LF7Q 1TWCH 3CCLA 2NZHA 1YHBA 5M3MH 1FVIA 3K80C 1YEZA 4X65L 1Y1VG 4ME3A 4DV0Q 1Y1WG 1K73C 1KC8C 1KQSA 3S17H 4IOAA 2F52A 2IX1A 4L5SA 5LMUQ 4DV2Q 3GTLH 3M4OH 1VQBA 4POFA 4YHHL 1LYLA 1XJVA 1NMGA 5HGQA 1XPOA 5GAHC 1XNRQ 3EN2A 3OYYA 4QIWE 1XNQQ 1QVFA 1OXUA 4HIKA 2R93H 2MQHA 3OTOL 4DR3L 3DLLA 4GNXB 1J5EQ 2D0OA 5M5XH 2JEBI 3F1ZA 4YY3L 1TWHH 2ZM6Q 4DV3Q 5FLXc 3T1YQ 2K14A 2D0PA 2XTIA 1UE7A 1X65A 4MZ9A 1YNXA 4L5TA 1BBWA 1B7YB 3T1HL 3CCJA 1A63A 1SRUA 3PF5A 4OWWB 3CCSA 5H1SE 1SROA 4DR1Q 2I5HA 1K9MC 4OX9Q 3J7A5 2PQAB 3H3VH 3K8AA 4TVAB 5IT9c 3SGIA 1OXSC 1KL9A 3PO3H 2R6GA 1S3OA 2QA4A 4HIMA 4JYAL 5M3MG 1C0AA 5E7NA 1NY4A 3PIPA 2QEXA 1NMFA 1HR0W 3E9IA 4X6AH 2I5MX 4X62L 1PVOA 5IYCH 1Q1EA 5FLMH 2ZJPA 2A1AA 4JV5Q 2WP8J 1UEBA 2NN6G 3G48A 3IRBA 4DAYB 1SN8A 2BA0A 2HIVA 2K4KA 3GTOH 4GKJL 3TEHB 1GD7A 1N33L 2OCEA 4A3IH 4JBJA 3W5OA 2R93G 2N8NA 4GLAC 2YV5A 4DV4Q 3S2HH 2VW9A 5IE8A 4LF6L 1N36L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPG A;  2ID0 A;  1K8A C;  3F2C A;  1PYS B;  1EQR A;  2N78 A;  4KHZ A;  4LF4 L;  1PYB A;  4KHP Q;  4JI1 Q;  4A3G H;  2UXC Q;  1JMC A;  4EQ5 A;  2LXJ A;  2DUD A;  4LFB Q;  3TQY A;  1M1K C;  3PO3 G;  4JI0 Q;  3PUW A;  4K0K Q;  4LW1 A;  1EFW A;  1IYJ B;  1OXV A;  4JI3 L;  4YWM A;  2AHO B;  1IBL Q;  2VNU D;  2JJQ A;  4DAM A;  1SMX A;  1JJ2 A;  2NVQ H;  2K75 A;  4DR2 Q;  4GNX C;  4JCV E;  3ULJ A;  5IYC G;  5FLM G;  1NTG A;  4Y52 H;  5LMN W;  2UUC Q;  1OXX K;  4OWT B;  2RCN A;  1QZG A;  2KCM A;  3RR5 A;  4X64 L;  3VDY A;  1UE1 A;  1EIF A;  3HKZ E;  3UE0 A;  5C4J H;  4DR5 L;  2Q2U A;  2E5L L;  4LFC Q;  2PMZ E;  5GAD C;  4A3I G;  2E8G A;  4HJ8 A;  1AH9 A;  4AYB E;  4A3E H;  1HNZ Q;  2JE6 I;  3L2P A;  3STB D;  3CPW A;  5M5Y H;  4DR7 L;  4QQB X;  1YHQ A;  3JAM i;  2E2H H;  4APV A;  3M7N A;  3S15 H;  2Q2H A;  1W2B A;  2UUB L;  4BXX H;  1XMQ Q;  5JJL A;  2UXD L;  1VQD A;  1YJW A;  3PUV A;  4B3T L;  3A0J A;  5M5W H;  1VQK A;  2OQK A;  2WB1 E;  1YIJ A;  5AJ3 L;  4YHH Q;  5GAE C;  4A3G G;  1SR3 A;  2Z6K C;  1S72 A;  4B3R Q;  2A19 A;  4GN3 B;  4QL5 A;  2OQ0 A;  5DLQ E;  3S1N H;  3OTO Q;  3RN2 A;  1I5F A;  4DR3 Q;  1PH8 A;  4JI2 Q;  1UE5 A;  3ULL A;  2V1C C;  3F2B A;  2KHJ A;  1C9O A;  3BJU A;  2ASB A;  4A4I A;  5IWA L;  1IBM Q;  4MNO A;  2EQS A;  4DUY Q;  2JA7 H;  3K7A H;  4IJH A;  1K83 H;  3CCM A;  4LF8 L;  1HNW Q;  1VQI A;  1S40 A;  3CCU A;  1D7Q A;  2HHH Q;  4IPH A;  1OTC A;  4RMF A;  4IO9 A;  4AQY Q;  2UUA L;  3CC2 A;  1Q86 C;  4A3E G;  2NZO A;  3TRE A;  4DV1 Q;  1MJE A;  1PA6 A;  1Q8K A;  4JYA Q;  1IBK Q;  1CKN A;  4IPD A;  2I0Q A;  4A3F H;  4BXX G;  4A3J H;  1Q1B A;  2ZTD A;  4BA2 I;  3PUZ A;  4WJ3 M;  3GTG H;  2WAQ E;  2ZTC A;  3A74 A;  4PZ6 A;  4O2D A;  2K50 A;  4X62 Q;  1VCI A;  2DGY A;  2VQF L;  4HIO A;  1PV4 A;  1PH5 A;  2ZJQ A;  3HKZ G;  3S24 A;  3A5Z B;  1IXR A;  1PH6 A;  4GKJ Q;  1QVG A;  1N33 Q;  4JI7 Q;  4AYB G;  4UP8 A;  3D31 A;  3KJO A;  1K8G A;  1VQF A;  3CW2 C;  2UXB L;  1BKB A;  1WCM H;  3S2D H;  1VQ5 A;  1Q46 A;  4LF6 Q;  1Q81 C;  5JEA G;  3J7Z C;  1HZ9 A;  5IYB H;  4HID A;  2N3S A;  1Q12 A;  2WB1 G;  1WOC A;  1VQC A;  1EUJ A;  3CCR A;  5GQO A;  1YVC A;  3AFQ A;  4BY1 H;  3PV0 A;  2JA7 G;  1YZ6 A;  4JBW A;  5C44 H;  3H15 A;  3RN5 A;  4A3M H;  1W3S A;  1E24 A;  4DV7 Q;  1KRT A;  4KLK A;  3ER0 A;  1KAW A;  1EYG A;  2R92 H;  5GAG C;  1VQH A;  2NVT H;  1C7Y A;  2ZTE A;  4C3H H;  4NB3 A;  4A3F G;  2K5V A;  4A3J G;  4IFD G;  2IHE A;  2RHS B;  1G29 1;  5ELN A;  3J81 i;  4A3C G;  4A3L H;  3G6E A;  2F3I A;  1R9T H;  1KIX A;  1V9P A;  4O0A A;  2OTL A;  2BH2 A;  1L1O A;  3KOJ A;  4P72 A;  3I7F A;  3M4P A;  4IOC A;  2A8V A;  3GTK H;  3ZJY C;  4X64 Q;  4PZ7 A;  3CD6 A;  2VQE Q;  2E5L Q;  4JG2 A;  3KYH C;  3FKI H;  4OO1 I;  4MTN A;  1JJG A;  4DV5 L;  3BZK A;  1FJG L;  1HZA A;  3M9B A;  2N49 A;  2K5H A;  1WCM G;  5FJ8 H;  2F4V L;  1A8V A;  4NPS A;  2LXK A;  2GVB A;  4LNQ A;  1XTD A;  3HOW H;  1VQN A;  3I56 A;  5IYB G;  2WAQ G;  5BR8 L;  4NXM L;  2UXD Q;  4BY1 G;  1PH4 A;  3CP0 A;  2CKZ B;  1HNX Q;  1E1T A;  1EWI A;  5C44 G;  4A3M G;  2ES2 A;  1AE2 A;  1E1O A;  4HJ5 A;  5K36 G;  2B3G A;  3CCQ A;  1VQM A;  1X9N A;  3PUY A;  1I3Q H;  4A93 H;  2UU9 L;  4JC0 A;  1JE5 A;  4B3S Q;  2R92 G;  1N32 L;  3U50 C;  3G71 A;  3RZD H;  4DK3 C;  4ALP A;  4A3L G;  1QVC A;  4PG3 A;  4XTC S;  1G51 A;  4DV6 L;  3PSI A;  5JJI A;  4A3D H;  3TS0 A;  4LF7 L;  4GN5 A;  3KF6 A;  1V1Q A;  1PHJ A;  1EOV A;  4GLV B;  4RG1 A;  4GN4 B;  3A5U A;  2Z0S A;  3FKI G;  3DM3 A;  3AFP A;  3H0G H;  5JJK A;  3J81 c;  5IYD H;  2GN5 A;  4A75 A;  2CWP A;  5LMU L;  4BBR H;  5FJ8 G;  4DK6 C;  1A62 A;  1Z9F A;  4DKA C;  3ICE A;  2YTV A;  3HOW G;  1WFQ A;  1VQ7 A;  3GO5 A;  4X66 Q;  1KHI A;  3KFU A;  4PMW A;  1XNR L;  1RIP A;  4QGU A;  4PZ8 A;  4JI8 Q;  4GOP A;  2VQF Q;  1I50 H;  3HOZ H;  2JA6 H;  1YJN A;  3UE1 A;  4C2M H;  1MIU A;  3HOX H;  4YCW A;  2PI2 A;  3I2Z A;  4DR6 L;  4LUZ A;  1VQP A;  2ZM6 L;  3T1Y L;  3K81 C;  1GVP A;  2NN6 I;  4A93 G;  4X65 Q;  1L2F A;  2QGQ A;  3OW2 A;  3TS2 A;  3CF5 A;  1YHA A;  2AWO A;  1QZH A;  4OX9 L;  1UE6 A;  2BA1 A;  2CFM A;  3AEV A;  4A3D G;  4R4C A;  3EIV A;  4L5Q A;  1OXT A;  5C0X G;  1Q7Y C;  4JBM A;  3NEM A;  3CXC A;  1EIY B;  2VL6 A;  3Q8D A;  1CSQ A;  1X6O A;  3H0G G;  4YY3 Q;  5HY6 A;  5IYD G;  3S1R H;  4R4O A;  4BBR G;  4BBS H;  3H3V I;  4GKK L;  1VS0 A;  4B3M L;  4L5R C;  1O7I A;  3T1H Q;  4JV5 L;  3G4S A;  4QJF A;  3U58 A;  1TWG H;  2WFW A;  2KHI A;  1X3G A;  4P71 A;  3RLF A;  4R4T A;  1VQ4 A;  1WI5 A;  1B8A A;  2Q2I A;  3CQZ H;  2YYZ A;  3CPF A;  3HOZ G;  1YBY A;  1K3R A;  1DGS A;  1QUQ A;  2JA6 G;  4DR4 L;  3HOX G;  4DV4 L;  4P73 A;  5ELO A;  3KDF A;  1CKN B;  1HJP A;  3LGJ A;  2HQL A;  2NVY H;  2XGT A;  4OWX B;  4A3K H;  3UDF A;  2Q2T A;  3RNU A;  4IJL A;  1FJG Q;  2F4V Q;  4UP9 A;  4JI6 L;  2OWO A;  4KHP L;  3PUX A;  4JI1 L;  2JK8 A;  3RLO A;  1ASZ A;  1UWV A;  5BR8 Q;  4JOI C;  3NEL A;  3JAM c;  1PH3 A;  5IP7 H;  3GTM H;  2H5X A;  1HR0 L;  4JI0 L;  1P16 A;  3K0X A;  4AIM A;  1A0I A;  1VQO A;  3CME A;  3PF4 A;  3UDG A;  2CWA A;  1XMO L;  1WJJ A;  2CQO A;  1N36 Q;  4DR2 L;  2OTJ A;  1TWF H;  4BBS G;  3GTP H;  4JI5 L;  2ALY B;  2UUC L;  3ULP A;  4LF9 L;  2L15 A;  1X54 A;  4BA1 I;  3CMA A;  1KRS A;  4XIG S;  2MFI A;  2IHF A;  4DNI A;  3I55 A;  5IP9 H;  1V43 A;  1PH7 A;  4LF4 Q;  1X55 A;  3J81 j;  1YJ9 A;  3UDI A;  1IZ6 A;  4AH6 A;  1JT8 A;  3FP9 A;  3L0O A;  3NBH B;  2JQO A;  2VZA A;  4C3J H;  2R7Z H;  1MKH A;  2AKW B;  4JI3 Q;  4UPA A;  1LUZ A;  4QY7 A;  4NXN L;  5JEA J;  4A3K G;  1P8L A;  3RLN A;  1XMQ L;  4R4Q A;  1Q82 C;  2JA5 H;  2NVX H;  3S14 H;  1L1O B;  5C3E H;  4LUO A;  4HJA A;  4GLX A;  2JA8 H;  3HKS A;  2RF4 A;  1VQ8 A;  3MXN B;  1E3P A;  4JI4 L;  2E2J H;  3S16 H;  5IP7 G;  3U4V A;  4HJ7 A;  4DR5 Q;  2E2I H;  1GKH A;  3PCO B;  4LF5 L;  4JBK A;  2ATW A;  2B63 H;  3STB C;  2YU9 H;  4BY7 H;  3JC6 6;  4GS3 A;  3PO2 H;  1G6P A;  4FDB A;  1CUK A;  4J15 A;  5LMN L;  1I94 L;  1SLJ A;  4JI2 L;  4DR7 Q;  2CCZ A;  4DR6 Q;  3ERS X;  3J80 i;  1NJI C;  4GNX A;  2UUB Q;  4IFD J;  2Y0S E;  5M3F H;  4YWK A;  2B29 A;  1IBM L;  4P74 A;  4DUY L;  4B3T Q;  1BVS A;  4YCU A;  1VQJ A;  2VS1 A;  3I4N H;  1K0R A;  5AJ3 Q;  1HNW L;  5IP9 G;  1NE3 A;  2HHH L;  2AWN A;  1FL0 A;  2R7D A;  1LM0 A;  4AQY L;  3HOV H;  3GTJ H;  2PQA A;  3B6Y A;  3KF8 B;  4DV1 L;  1CKM A;  4Y7N H;  2KEN A;  3BZC A;  1HZB A;  1LTL A;  2R7Z G;  4UY8 C;  4DUZ L;  2RHQ B;  2YTX A;  3AQQ A;  4OXP A;  1SFO H;  1IBK L;  2JEA I;  1KD1 C;  1D8L A;  2IX0 A;  4A3B H;  2JA5 G;  1N34 L;  5C3E G;  4GKK Q;  5IWA Q;  3KF6 B;  2Z6K A;  5J3B A;  2LSS A;  3KLW A;  4B3M Q;  2JA8 G;  3M3Y H;  3RZO H;  1VQA A;  1N8R C;  1KXL A;  1IL2 A;  4LF8 Q;  4JI7 L;  1WYD A;  3CCV A;  2IY5 B;  2VY3 A;  2B63 G;  3I4O A;  3GTQ H;  4POG A;  4DV0 L;  4LUV A;  2UUA Q;  3PO2 G;  4BY7 G;  4DR4 Q;  4IFD I;  5IY0 A;  1M90 C;  4DV2 L;  3NEN A;  3I4M H;  1XPR A;  3W1B A;  2R7F A;  3L7Z C;  5M3F G;  5EAY A;  1PH9 A;  4GOP B;  4R4I A;  1VQE A;  1I6H H;  3M85 A;  1MJC A;  1XNQ L;  4LFA Q;  3I4N G;  4JI6 Q;  2AMC B;  2D62 A;  1EQQ A;  3F2D A;  1J5E L;  1CKO A;  1L1O C;  4EX5 A;  1B70 B;  3E9H A;  4DV7 L;  3CC7 A;  2JA9 A;  3J80 c;  1YIT A;  4DV3 L;  2VUM H;  3HOV G;  1HR0 Q;  3CCE A;  3CC4 A;  1ASY A;  1NBW A;  4KI0 A;  3WWV A;  1PH1 A;  1VQL A;  2UXB Q;  1VQG A;  1XMO Q;  2Y0S G;  1U0L A;  3CAM A;  4A3B G;  3F8T A;  2BH8 A;  4DR1 L;  3HOU H;  1H95 A;  2EIF A;  4YCV A;  4JI5 Q;  5C4X H;  1YI2 A;  3E0E A;  3FHW A;  4LF9 Q;  4JOI A;  2HT1 A;  1GM5 A;  2VQE L;  3GD7 A;  1TWA H;  3BU2 A;  3HFZ B;  1SE8 A;  1PH2 A;  1VQ9 A;  1X3E A;  3EBE A;  2K52 A;  3MEF A;  2KCT A;  3I4M G;  2ZJR A;  3UDX A;  4HJ9 A;  3HOY H;  1CSP A;  1N9W A;  4B3R L;  1AE3 A;  3S1M H;  4NXN Q;  4OON A;  2MO1 A;  4P75 A;  1VQ6 A;  1E7Z A;  1QUQ B;  4A76 A;  1HNX L;  5C0X J;  1HH2 P;  3KDF B;  3K7U C;  2MNA A;  2K5N A;  1PFS A;  4JI4 Q;  4LWC A;  1TXY A;  2I5L X;  3PGZ A;  1E22 A;  2VUM G;  4LF5 Q;  4IPC A;  3D0F A;  1U5K A;  1Y1V H;  1Y1W H;  4B3S L;  4DV5 Q;  4A3C H;  4LFA L;  4TQU S;  5LMN Q;  1I94 Q;  2YTY A;  2HIX A;  4R1J A;  2FXQ A;  2GVA A;  3HOU G;  2UXC L;  5GRO A;  1Y14 B;  4NXM Q;  4WJ4 A;  5C4X G;  2MO0 A;  4LFB L;  3M4Q A;  3W1G A;  4K0K L;  3TRZ A;  4GOP C;  1T9H A;  1JJC B;  3GDE A;  3S1Q H;  4C3I H;  1JB7 A;  2PI2 E;  4H02 A;  1IBL L;  3AYH B;  3U4Z A;  1FGU A;  4DPG A;  2IT1 A;  1HZC A;  1RL2 A;  2UU9 Q;  1N32 Q;  3PIO A;  1L0W A;  4YWL A;  4DUZ Q;  3HOY G;  1X56 A;  1GO3 E;  2C35 B;  4OO1 G;  1X3F A;  2EXD A;  3KJP A;  5C0X I;  4X66 L;  4LFC L;  4DV6 Q;  1XPU A;  2PNH A;  4JI8 L;  1N34 Q;  1BBU A;  1J6Q A;  1Z47 A;  2KBN A;  4UP7 A;  1HNZ L;  4LF7 Q;  1TWC H;  3CCL A;  2NZH A;  1YHB A;  5M3M H;  1FVI A;  3K80 C;  1YEZ A;  4X65 L;  1Y1V G;  4ME3 A;  4DV0 Q;  1Y1W G;  1K73 C;  1KC8 C;  1KQS A;  3S17 H;  4IOA A;  2F52 A;  2IX1 A;  4L5S A;  5LMU Q;  4DV2 Q;  3GTL H;  3M4O H;  1VQB A;  4POF A;  4YHH L;  1LYL A;  1XJV A;  1NMG A;  5HGQ A;  1XPO A;  5GAH C;  1XNR Q;  3EN2 A;  3OYY A;  4QIW E;  1XNQ Q;  1QVF A;  1OXU A;  4HIK A;  2R93 H;  2MQH A;  3OTO L;  4DR3 L;  3DLL A;  4GNX B;  1J5E Q;  2D0O A;  5M5X H;  2JEB I;  3F1Z A;  4YY3 L;  1TWH H;  2ZM6 Q;  4DV3 Q;  5FLX c;  3T1Y Q;  2K14 A;  2D0P A;  2XTI A;  1UE7 A;  1X65 A;  4MZ9 A;  1YNX A;  4L5T A;  1BBW A;  1B7Y B;  3T1H L;  3CCJ A;  1A63 A;  1SRU A;  3PF5 A;  4OWW B;  3CCS A;  5H1S E;  1SRO A;  4DR1 Q;  2I5H A;  1K9M C;  4OX9 Q;  3J7A 5;  2PQA B;  3H3V H;  3K8A A;  4TVA B;  5IT9 c;  3SGI A;  1OXS C;  1KL9 A;  3PO3 H;  2R6G A;  1S3O A;  2QA4 A;  4HIM A;  4JYA L;  5M3M G;  1C0A A;  5E7N A;  1NY4 A;  3PIP A;  2QEX A;  1NMF A;  1HR0 W;  3E9I A;  4X6A H;  2I5M X;  4X62 L;  1PVO A;  5IYC H;  1Q1E A;  5FLM H;  2ZJP A;  2A1A A;  4JV5 Q;  2WP8 J;  1UEB A;  2NN6 G;  3G48 A;  3IRB A;  4DAY B;  1SN8 A;  2BA0 A;  2HIV A;  2K4K A;  3GTO H;  4GKJ L;  3TEH B;  1GD7 A;  1N33 L;  2OCE A;  4A3I H;  4JBJ A;  3W5O A;  2R93 G;  2N8N A;  4GLA C;  2YV5 A;  4DV4 Q;  3S2H H;  2VW9 A;  5IE8 A;  4LF6 L;  1N36 L; 
#chains in the Genus database with same CATH topology
 3J80 E;  1CA6 A;  1VMP A;  3OSN A;  4LF4 L;  1PYB A;  5CBE E;  4EQ5 A;  2EYF A;  3RIZ A;  2DUD A;  2I80 A;  1M1K C;  1LV9 A;  3PO3 G;  1FNV A;  1GSH A;  2WTF A;  1FGB D;  3Q24 A;  1IYJ B;  1WCM B;  3S2D B;  5CA1 F;  3CRK C;  4YQW A;  4LMY A;  2WAQ B;  2K5Q A;  1JJ2 A;  2R8J A;  2K75 A;  4DR2 Q;  4JCV E;  4BY1 B;  3PIO 3;  1AZQ A;  1LTS D;  3BZD B;  5C44 B;  4ZQI A;  3Q0A A;  4X64 L;  1G2S A;  1MHW C;  3UE0 A;  3FPP A;  4DR5 L;  4K5X A;  2Q2U A;  1F2M A;  2DPJ A;  4QQB X;  4A3E H;  2YZM A;  3L2P A;  3FDT A;  1BXT A;  2ZXO A;  2A6H D;  1AN8 A;  2MHV A;  4GKK H;  5JJL A;  4R8U B;  2PO4 A;  3BDL A;  1YJW A;  4KKT A;  5CV8 A;  1NSN S;  3VPC A;  1STH A;  3KXY T;  1SR3 A;  4HED A;  1S72 A;  1VBG A;  4JVZ A;  3SDZ A;  3TP7 A;  2OQ0 A;  1WTQ A;  2C2E A;  1LT3 D;  5DLQ E;  3OTO Q;  1JXL A;  3NWS A;  1SEB D;  4HN7 A;  5LA6 F;  3ULL A;  4IUQ A;  2L55 A;  1TWH A;  4G7O C;  1C9O A;  3D4D A;  4RKB A;  3IKJ A;  1G91 A;  5KFR A;  2L5T A;  4CDF C;  3BQ1 A;  2A5H A;  4LF8 L;  2W57 A;  1HNW Q;  3CCU A;  1D7Q A;  1HR0 H;  1OTC A;  1LAB A;  2UUA L;  3CC2 A;  4A3E G;  4UCU A;  5IGD A;  3TRE A;  4DV1 Q;  1MJE A;  4MTD A;  3G8C A;  4DR2 H;  4QWE A;  5DM6 3;  4A3F H;  4JI5 H;  4ECQ A;  1ZYR C;  2WV6 D;  2XCP A;  1EEI D;  4O3P A;  4X62 Q;  5KRU A;  3GLK A;  2D2C C;  2ZJQ A;  1PV4 A;  1PH5 A;  3IFT A;  3BQ0 A;  3S24 A;  3L4K A;  1H9M A;  2NB0 A;  1CFM A;  4DL7 A;  2K5D A;  1N33 Q;  4KTA A;  2HCI A;  2HJW A;  4EQN A;  5KFY A;  5EWG A;  1F9P A;  5C6A A;  1WCM H;  3S2D H;  1VQ5 A;  1I6H B;  4HID A;  4DLK A;  4J9S A;  1BCP D;  1VQC A;  1DON A;  4BY1 H;  3AFQ A;  2CVR A;  4JI4 H;  5C44 H;  5H80 A;  2M9V A;  1W3S A;  1S5D D;  5K36 H;  2EY1 A;  2YL2 A;  5IT9 E;  3MXU A;  4FXG C;  3T5K A;  1C7Y A;  5KFX A;  4X3K A;  4A3F G;  4M1U B;  2RHS B;  5ELN A;  1H9S A;  5IGG A;  2YW2 A;  4K5W A;  1B2T A;  1W6J A;  2EY5 A;  2L9H A;  1HNW H;  2SOB A;  4P72 A;  2W8L A;  1KDC A;  4BS9 A;  1WD0 A;  4DV1 H;  3CD6 A;  1MD2 D;  4IHJ F;  3MXN A;  4B9W A;  4UDU C;  1SMY C;  2C5C A;  1SXT A;  1JCK B;  1QIL A;  3BZK A;  2NTT A;  2FIN B;  2K5H A;  1WCM G;  5FJ8 H;  1WTP A;  3M9M B;  1TWG B;  4RNM A;  1O7Y A;  1VQN A;  1N34 H;  2WAQ G;  5BR8 L;  4HNV A;  4BY1 G;  3CP0 A;  1HNX Q;  2NTS A;  1EWI A;  5C44 G;  1K28 A;  1YNJ C;  2IP4 A;  5KYL A;  5K36 G;  2VA2 A;  1SDF A;  1VQM A;  2NYZ D;  5KFZ A;  3V6K A;  4B08 A;  1Z2O X;  4JC0 A;  4B3S Q;  3N40 P;  2AUJ D;  1S0M A;  4DK3 C;  2DNC A;  4LMQ D;  5DG8 A;  4PG3 A;  3PSI A;  1HA5 A;  5JJI A;  5C0X H;  1RTO A;  1EOV A;  4DV3 H;  3A5U A;  5FK9 C;  2R8I A;  5JJK A;  2F0U A;  4XQJ A;  5CR3 A;  5LMU L;  1SJE D;  5FJ8 G;  4DK6 C;  1Z9F A;  3QR8 A;  3ICE A;  3J81 L;  1B44 D;  4HSP A;  4FP5 D;  5EWE A;  1RIP A;  3C0F B;  4KD4 A;  4PZ8 A;  4LK1 C;  2VQF Q;  5FLX W;  3Q8S B;  2RKS A;  3U9O A;  5KFF A;  2B2U C;  2PI2 A;  4LUZ A;  4J9O A;  2B39 A;  3BVG A;  2ICE C;  3S14 B;  3NSW A;  1CZW A;  4FXD A;  3NXW A;  2AWO A;  2E2J B;  4ZK9 B;  1MBY A;  1HNX H;  5DLG A;  1UE6 A;  2CFM A;  4RB0 A;  3EIV A;  4L5Q A;  2LFN A;  2L0C A;  4NW2 A;  5C0X G;  4JBM A;  1E4F T;  3WOF A;  3LWB A;  1TWH B;  1EIY B;  4B3S H;  2F0D A;  1LTT D;  4B9X A;  5KND A;  1MSG A;  1EY5 A;  3H3V I;  1VS0 A;  2Z8L A;  3RV4 A;  1O7I A;  2UXC H;  4QJF A;  2C2D A;  4O3O A;  5J2T F;  1TWG H;  4P71 A;  2CQA A;  4IR9 A;  3VR3 A;  1WI5 A;  5ELF A;  3E5N A;  4K0K H;  3CPF A;  4DK1 A;  4Y7N B;  4YJ2 F;  1QUQ A;  4U68 A;  5BN3 A;  5ELO A;  2ASJ A;  1TA8 A;  3SK4 A;  3V05 A;  2Q2T A;  4IJL A;  3BDC A;  2PBZ A;  2EJF C;  3PW0 A;  4JI1 L;  3K57 A;  1UWV A;  3NEL A;  5CC4 A;  2Q8T A;  1LTB D;  2H5X A;  4JI0 L;  1A0I A;  1VQO A;  1V8Q A;  4O3N A;  4UAI A;  4RGT A;  2SDF A;  4YHH H;  3ULP A;  1SNP A;  2XIW A;  4LF9 L;  3CMA A;  3OHB A;  4LF4 Q;  3I70 A;  3VR6 A;  5IP9 H;  1HQM C;  4PWQ A;  4A2B A;  5KG5 A;  2MGS A;  2V4D A;  2NU7 B;  1I4P A;  3ITP A;  1U4R A;  3FP9 A;  1FYC A;  2JQO A;  3MR5 A;  2WKD A;  2AKW B;  4XYL B;  1H9S B;  1JQY D;  3RLN A;  2NVX H;  3S14 H;  5C4X B;  5D3D A;  2OT2 A;  1CA5 A;  1D5X C;  3MXN B;  1XWE A;  1IL8 A;  2E2J H;  4DR5 Q;  4HJ7 A;  4LF5 L;  2J6T A;  1XX8 A;  2D5D A;  1EFI D;  3JC6 6;  4ILW A;  2R7M A;  4FF4 A;  1T36 A;  1CUK A;  1I94 L;  3RAQ A;  4O2A F;  2CCZ A;  5E3F A;  3ERS X;  4DR6 Q;  2E2H A;  2WII B;  3J80 i;  4GNX A;  4IFD J;  1ZQ7 A;  2Y0S E;  4KY7 A;  1D5M C;  5L1J A;  4WBN F;  2VS1 A;  1K0R A;  3HKZ A;  5IP9 G;  1JKJ B;  1C48 A;  2F0V A;  1ENC A;  4DL5 A;  2W7P A;  1A3T A;  1FL0 A;  1WH2 A;  2Q8I B;  1LM0 A;  4AQY L;  4KHV A;  4AYB A;  3VYS A;  2PQA A;  4L6T B;  1CKM A;  4Y7N H;  2KEN A;  1RKN A;  4RWS C;  3N6R A;  2YTX A;  3AQQ A;  4OEM B;  1D8L A;  2KOL A;  5DGA A;  3A56 A;  2R85 A;  2FLL A;  3JAM W;  4LF4 H;  2V9W A;  4B3M Q;  2XSC A;  3FVQ A;  1BF4 A;  2WB1 A;  3CVZ A;  2AQ1 B;  1N8R C;  1K83 A;  4LF8 Q;  4JI7 L;  4KKU A;  1WYD A;  5D8D A;  4POG A;  2UUA Q;  1SYF A;  4F88 A;  4IFD I;  1FKA H;  4J9Q A;  3NEN A;  1E2W A;  4KN4 C;  2R7F A;  3L7Z C;  2F3W A;  2WE6 A;  3MR3 A;  1VQE A;  2JXM B;  3OHA A;  4DR5 H;  3Q1K A;  2KCC A;  2OF1 A;  5M3M B;  3OSO A;  1STA A;  4DV7 L;  5M9O A;  1B70 B;  3E9H A;  2JA9 A;  2YZG A;  4KKS A;  4UCV A;  3M4O B;  1HA6 A;  2ASL A;  1NBW A;  4KI0 A;  1FD7 D;  2WIN B;  3WWV A;  1B9M A;  3K5M A;  4DU9 A;  1XMO Q;  5CAE B;  2F0H A;  5IOD A;  3NK9 A;  5C4X H;  3A8J E;  3FHW A;  2R93 B;  1S4Z A;  1S5F D;  2IX3 A;  5NUC A;  3N41 B;  2FK2 A;  1CS0 A;  4KV6 A;  2W7O A;  1GLV A;  1VQ9 A;  1X3E A;  1ZKO A;  2KCT A;  2R92 A;  2ZJR A;  3UDX A;  1N9W A;  4B3R L;  4K6L A;  4N9T A;  4NXN Q;  5FPO A;  3H6M A;  4P75 A;  1BCP F;  1BDO A;  3A8K E;  4CC6 A;  1GUN A;  1KJ9 A;  4FXK C;  1E7Z A;  1QUQ B;  1R9T A;  3LWU A;  4LF8 H;  1UC8 A;  3K7U C;  2OEO A;  4HNT A;  3CU7 A;  4S3S A;  2MNA A;  2UUA H;  2E2I A;  1K8O A;  1ZHS A;  2B63 A;  4IPC A;  3FKI A;  1U5K A;  4ECT A;  4TRD A;  5CYU A;  2F0T A;  1GUO A;  1KLG D;  2VPS A;  4R1J A;  5KFI A;  1R4P B;  2FXQ A;  3DEP A;  3GP7 A;  1Y14 B;  4A3I B;  4WJ4 A;  4RB3 C;  5C4X G;  1KJQ A;  3TRZ A;  1JJC B;  3GDE A;  1HUM A;  2W9A A;  1PRT F;  3HRZ C;  4H02 A;  1E2V A;  1AW7 A;  4M8A A;  4OL7 A;  1HFG A;  3PIO A;  2CW7 A;  4YWL A;  1MZB A;  2C35 B;  1CT1 D;  1JWU D;  1GUT A;  2B2V A;  1BBU A;  2RA4 A;  3K5N A;  3IAY A;  3K3V A;  3M7G A;  5M3M H;  3K5L A;  3F8N A;  4J9R A;  2F52 A;  4NXN H;  1A2T A;  3M4O H;  4L5S A;  5LMU Q;  4DV2 Q;  1IW7 D;  1VQB A;  5HGQ A;  4C1N K;  2F0L A;  2H1E A;  1XNQ Q;  2ALZ A;  1QVF A;  2R93 H;  3QJY A;  3R93 A;  3OTO L;  2E2H B;  1XDN A;  1TAE A;  1V1O A;  4GNX B;  2A6H C;  1J5E Q;  2D0O A;  3TP6 A;  3F1Z A;  4TV9 F;  1RF2 D;  2D0P A;  1X65 A;  3AB9 A;  5DAU A;  1YNX A;  5EKI A;  1BBW A;  1B7Y B;  5FLX L;  5LYJ F;  3RBD A;  3SE0 A;  5BR8 H;  3HKZ B;  3QFF A;  3OWE B;  2XWB B;  3CCS A;  4AYB B;  4U7C A;  5CB4 F;  2PQA B;  3H3V H;  3K8A A;  2NU8 B;  4TVA B;  1RJR A;  4O2B F;  3A54 A;  3FMC A;  1S3O A;  4A2A A;  3EYY A;  1B53 A;  5M3M G;  1S0O A;  4CKB A;  1EUC B;  2B2Y A;  3NP8 A;  3Q8P B;  3PIP A;  2QEX A;  2F0O A;  3EFX D;  2BE5 C;  2WB1 B;  2HCC A;  1IYV A;  4X62 L;  1PVO A;  5FLM H;  3K7A B;  1K83 B;  1TT2 A;  3T16 A;  4CDC C;  3N43 B;  1N33 L;  1SE2 A;  2OCE A;  3JRX A;  5KFO A;  5J22 A;  4A3I H;  3EJI A;  3W5O A;  2R93 G;  5DQI A;  2FMM A;  5COR A;  5COY A;  4Q44 A;  1B6R A;  1AP0 A;  1SYX B;  5DNF A;  2ENB A;  4EGV A;  2QDB A;  3PN1 A;  2R8H A;  1GUS A;  5LMU H;  4I55 F;  4IPG A;  1I4Q A;  3VR4 A;  1WTH A;  2ID0 A;  1K8A C;  2N78 A;  2W9B A;  4KHZ A;  3GIQ A;  1PXU A;  4JI1 Q;  2FP4 B;  4LFB Q;  1E2Z A;  4JI0 Q;  4F4W A;  5EDW A;  4J9L A;  1OXV A;  1Q3L A;  1Y69 U;  3NUC A;  4YWM A;  1KEE A;  1VDZ A;  1IBL Q;  3O13 A;  4JW0 A;  1SMX A;  4DAM A;  2CW0 D;  1BCP C;  1GOZ A;  4C56 C;  3GTP A;  5FLM G;  1NTG A;  1VKZ A;  4OWT B;  4A3M B;  4RNO A;  1QZG A;  2KCM A;  1PYW D;  1UE1 A;  3FDS A;  4LFC Q;  3DF7 A;  3UQ8 A;  1KJI A;  1SCU B;  4HR7 A;  4WRD A;  5GAD C;  4A3I G;  2E8G A;  3OPO A;  1HNZ Q;  1ET9 A;  1M4V A;  2R92 B;  3CPW A;  4ZOL F;  2G9D A;  2W9C A;  1O78 A;  5C5M A;  2VOB A;  2E2H H;  4K6D A;  3M7N A;  4YP3 A;  3S15 H;  2Q2H A;  5ELD A;  1W2B A;  1GHJ A;  2HDM A;  1R9T B;  2JA5 A;  3PUV A;  4B3T L;  1VQK A;  1MSH A;  5AJ3 L;  4OGQ C;  1GSO A;  2Z6K C;  4G4K A;  2EDG A;  2E2I B;  2VPQ A;  5I2X A;  2B63 B;  2A19 A;  3FKI B;  1PRT C;  4GN3 B;  4QL5 A;  1V1P A;  1EOT A;  3I91 A;  3A7L A;  3RTX A;  4QF4 A;  2K01 A;  1I5F A;  1SSO A;  3RBE A;  1JIC A;  1SE3 A;  2V1C C;  4ZLT F;  5CV7 A;  2XIG A;  4QUF A;  4A4I A;  4JI1 H;  1ZET A;  2PN1 A;  3HG9 A;  4CJ2 C;  3K7A H;  1K83 H;  2DY7 A;  1S40 A;  1NCV A;  4JI0 H;  4IPH A;  4RMF A;  1KJ8 A;  3KLR A;  1I3Q B;  4AQY Q;  1LO5 D;  3JZI A;  5KFW A;  3T51 B;  1IBL H;  3GV7 B;  1EZ6 A;  1Q8K A;  1JC7 A;  4JYA Q;  3C1E A;  4IPD A;  4ULL A;  1D1I A;  3MVV A;  2DNE A;  1Q1B A;  4IFD H;  1W93 A;  2ZDQ A;  2C28 A;  4LF9 H;  2ZTC A;  4O2D A;  2JN4 A;  4KJN A;  3URY A;  2VQF L;  3MEH A;  1DV2 A;  2UVW A;  1RHP A;  3HKZ G;  1PH6 A;  3A5Z B;  1IXR A;  5KG2 A;  4LAA A;  1QVG A;  5LL6 b;  3QWN A;  4JI7 Q;  4N9P A;  4AYB G;  4ZI7 F;  5D1O A;  5D14 A;  3JAM L;  3D31 A;  3KJO A;  1K8G A;  4BBR B;  1VQF A;  1ONL A;  2B2W C;  1BKB A;  2UXB L;  4JV0 A;  1LTG D;  1AEX A;  4LF6 Q;  5EKK A;  2GPW A;  4Q8E A;  1HZ9 A;  2NUA B;  4DL2 A;  2N3S A;  2FPP B;  2WB1 G;  2FPI B;  1STY A;  1YVC A;  3K6O A;  5EPJ A;  4EQO A;  3HOX B;  3OIQ A;  2KED A;  2V4R A;  3H15 A;  4A3M H;  3RN5 A;  2R87 A;  4LF5 H;  2HDL A;  4DV7 Q;  2VUM A;  1D6E C;  1PZJ D;  3H40 A;  2FHT A;  4YR2 A;  4PDB A;  1KAW A;  3OMC A;  1EYG A;  2R92 H;  1M0W A;  4RH6 A;  1TU2 B;  4C3H H;  2TMP A;  3T5L A;  2K5V A;  4IFD G;  2IHE A;  2M00 A;  2XC9 A;  2F3I A;  1R9T H;  1PTO B;  2BQR A;  2OTL A;  1V9P A;  4O0A A;  2F0J A;  2QK4 A;  2W8K A;  2B8F A;  3I7F A;  2GPS A;  1X3P A;  4AQY H;  3LNN A;  3ZJY C;  2I87 A;  1DIK A;  2E5L Q;  2ZXR A;  3FKI H;  4JYA H;  3BYT B;  4MTN A;  4Q5V A;  3J7A F;  1JJG A;  4DV5 L;  4F4Y A;  3NBI A;  4XYM B;  4I7A A;  4UCR A;  3M9B A;  2LXK A;  2GVB A;  4Q43 A;  4KJO A;  3D6C A;  2FFK B;  1QE6 A;  4JI7 H;  1E1T A;  4A3M G;  4RZQ A;  2XD4 A;  1AE2 A;  3GIJ A;  1JLL B;  4HJ5 A;  4A3K B;  1SYE A;  4HTH A;  1I3Q H;  3QIA A;  1Y1V A;  2R92 G;  4ZUJ A;  3KF8 A;  3RZD H;  3Q8Q B;  4L8J A;  4C3H G;  5EGT A;  4ALP A;  5JAV A;  5L37 A;  2MUY A;  3D3R A;  1G51 A;  4DV6 L;  4MV6 A;  4G7H C;  2UVV A;  4DV7 H;  1J9O A;  4MTE A;  3QOL A;  1V1Q A;  5HUR A;  2A6E D;  4J6H A;  3FKI G;  5KT3 A;  3DM3 A;  4MIU A;  1TS4 A;  2G9H D;  3GTP B;  2GN5 A;  4IAL A;  2W6M A;  4BBR H;  3KAJ A;  3VPB A;  3N8D A;  4HR7 B;  3AU7 A;  3RUZ A;  1E0B A;  3GO5 A;  4PMW A;  4EG0 A;  4QGU A;  2YS7 A;  1U4P A;  2W9C B;  1NAP A;  1YJN A;  2E5L H;  4C3J B;  1MIU A;  3HOX H;  2F0I A;  5ELC A;  2EY2 A;  1F2Y A;  3MXP A;  4DR6 L;  2XGP A;  1VQP A;  4FBU A;  2ZM6 L;  3T1Y L;  3K81 C;  2I46 A;  2JP1 A;  3DUZ A;  2JA5 B;  4NKL A;  3OW2 A;  4B3R H;  3TS2 A;  2PNR C;  3GTL A;  1FNU A;  3S16 B;  3GII A;  2M05 A;  1HCZ A;  1K8M A;  4DXF A;  4OX9 L;  1V1P B;  2YU9 B;  4YR3 A;  3N42 B;  1PTO H;  1OXT A;  1O80 A;  1Q7Y C;  2QCP X;  2SNS A;  1B50 A;  5A2Q W;  5KT6 A;  4WD3 A;  1X6O A;  5M3F B;  2B2W A;  5FOB B;  3MA2 B;  3MJF A;  1GHK A;  5JVL A;  4ECX A;  2OH2 A;  4R4O A;  1VF5 C;  3E0J A;  4BBR G;  5JOB A;  2BE5 D;  4B3M L;  2J9G A;  5KFA A;  3R2I A;  3TII A;  5IGE A;  1VQ4 A;  2WFW A;  2KHI A;  4R4T A;  4J8Q A;  1B8A A;  4DFA A;  3GTJ B;  2R84 A;  4QIW A;  4ECU A;  1YBY A;  1DGS A;  3EA6 A;  3HOX G;  4DV4 L;  3EPG A;  4FM9 A;  3OSP A;  2HQL A;  2NBF A;  5KG7 A;  1A9X A;  4A3K H;  3UDF A;  1SNQ A;  1UUP A;  2HUG A;  1FJG Q;  3PIP 3;  3M3Y B;  1E4G T;  1GGO A;  5IIF A;  2OWO A;  4KHP L;  3PUX A;  4U67 3;  3JAM c;  5D1O B;  4ED0 A;  5IP7 H;  2XWJ B;  2F1M A;  3K0X A;  5KFM A;  4ZQ3 A;  3I4M B;  1SYD A;  1S5E D;  5L1L A;  2D9U A;  1CQF A;  3UDG A;  1XMO L;  1WJJ A;  3RUP A;  2XVS A;  2CQO A;  3TME A;  3GTP H;  1HTP A;  2UUC L;  1EWH A;  1EQT A;  1VBH A;  2L15 A;  4V19 0;  4M9U A;  4XIG S;  4QMG A;  2VUM B;  1X55 A;  3OTO H;  1KC7 A;  3UDI A;  3X3N A;  3HXL A;  1EWC A;  2VZA A;  4C3J H;  5KFT A;  4YBZ B;  1BO0 A;  4UPA A;  4NXN L;  4A3K G;  1P8L A;  3SHL A;  4R4Q A;  4R9W A;  1Q82 C;  2JA5 H;  3BG5 A;  4EBE A;  4LUO A;  4L1K A;  2RF4 A;  1VQ8 A;  3S16 H;  4JV2 A;  5IP7 G;  2V4Q A;  3DMU A;  1GKH A;  2ATW A;  4JBK A;  2W71 A;  3STB C;  1PRT D;  3TZD A;  2YU9 H;  3RB0 A;  4IZ8 A;  1RJQ A;  2KA7 A;  4FDB A;  4QW9 A;  4I4T F;  1K1Q A;  4JI2 L;  1SLJ A;  4G57 A;  2R8K A;  1FJG H;  2L11 A;  4X62 H;  1G2T A;  5M3F H;  3TQT A;  4ECZ A;  1IBM L;  4RB1 A;  4P74 A;  4B3T Q;  2K32 A;  2RDH A;  1N33 H;  5AJ3 Q;  3VYT A;  2BCO A;  4J9K A;  2HHH L;  4CC5 A;  3RB6 A;  2AWN A;  2J4X A;  1Y1V B;  3GTJ H;  3B6Y A;  3KF8 B;  5AFW A;  2RSO A;  3BZC A;  3V96 A;  3RGZ A;  1RK5 A;  4C3J G;  2F03 A;  5KEE A;  2RHQ B;  3KUP A;  4OXP A;  1IBK L;  3VA7 A;  3RB4 A;  1DYQ A;  4PV1 C;  5C1O A;  2WAC A;  2JA5 G;  3H4B A;  3J81 E;  2E75 C;  1SAP A;  5J3B A;  4DF7 A;  3NWT A;  3M3Y H;  3MWM A;  3S1Q B;  2JA7 A;  5JJZ A;  1KXL A;  2KHS A;  1WTO A;  4CDD C;  5KFD A;  4IRK A;  2VY3 A;  3I4O A;  4DR4 Q;  4LUV A;  5IY0 A;  4DV2 L;  1BOS A;  5KFE A;  4Q0F A;  3I4M H;  3QZ7 A;  5EBD A;  3W1B A;  3N44 B;  5M3F G;  5J2U F;  2F0G A;  2A73 B;  3VYU A;  1I6H H;  2V5A A;  3GTG A;  4IWX A;  1XNQ L;  4JI6 Q;  2AMC B;  2D62 A;  4IQZ A;  4U6P A;  3F2D A;  1J5E L;  1CKO A;  1L1O C;  2K7V A;  4EX5 A;  1ZXT A;  3J80 c;  2VUM H;  4GC6 A;  3K58 A;  3CCE A;  3EPI A;  1RYR A;  4RHS A;  3GTL B;  1ASY A;  1IW7 C;  1Q90 A;  4X3T A;  1PH1 A;  2UXB Q;  3GIL A;  4MV3 A;  4PQX A;  4B3T H;  2CH4 A;  3F8T A;  2BH8 A;  4YCV A;  4XQQ A;  5KG1 A;  4Q45 A;  1YI2 A;  2F0W A;  3E0E A;  2HT1 A;  1RD9 D;  4HSV A;  1GM5 A;  2F0M A;  2K1B A;  1EIH A;  2VQE L;  2E74 C;  1WTR A;  1E4E A;  5KNB A;  4H13 C;  1SYG A;  2K52 A;  3MEF A;  3V6H A;  3I4M G;  4NDX A;  1JDB B;  1CQV A;  1JIH A;  3D6W A;  2VB3 X;  4QIW B;  5CV6 A;  3E6Z X;  3ONA B;  2QW7 A;  4EQP A;  1PFS A;  3GTK A;  4DR4 H;  2MPM A;  2O4X A;  1TXY A;  2VUM G;  1E22 A;  3BDO A;  1N48 A;  3LP8 A;  5K2M A;  1ZHQ A;  3ERQ A;  1Y1V H;  4DV5 Q;  4H0L C;  1IHZ A;  2W70 A;  5LMN Q;  3OMG A;  1M0T A;  3SK6 A;  5LP6 F;  2GVA A;  2IMW P;  5GRO A;  1O75 A;  2VQF H;  2JEG A;  3TBI B;  4LFB L;  1BUV T;  3S2H B;  4GOP C;  3RMH A;  3S1Q H;  1JB7 A;  1PX2 A;  5BPH A;  2IBK A;  1IBL L;  3AYH B;  4O1N A;  1UC9 A;  3U4Z A;  1BNC A;  5ISR A;  4DPG A;  2EYO A;  4FS1 A;  1TQO A;  2UXB H;  1S9F A;  1RL2 A;  1ULZ A;  3MZ5 A;  1L0W A;  2R86 A;  4DUZ Q;  5LXT F;  3KJP A;  4X66 L;  4LFC L;  4DL3 A;  5G3L F;  4DV6 Q;  1XPU A;  4JI8 L;  2QKI C;  1WSC A;  1Z47 A;  2KBN A;  4UP7 A;  1HNZ L;  2J6U A;  4IRC A;  2NZH A;  5F2D A;  4K2L A;  1CHQ D;  2NVQ B;  2PPB C;  2EYH A;  3VA5 A;  1Y1V G;  2CW0 C;  4ME3 A;  4DV0 Q;  1KC8 C;  1IYU A;  1AN7 A;  3H0G A;  1KNE A;  3P20 A;  5DEH A;  3GTL H;  3HBL A;  3KK7 A;  4ECW A;  3QZ8 A;  1LYL A;  1B3Q A;  2P0A A;  5KKN B;  4HMJ A;  5FO9 B;  2W6P A;  4RUA A;  2IJ0 A;  5C4Z A;  2SEB D;  3OYY A;  1A3V A;  2PYK A;  4KY6 A;  1BGW A;  2JA6 A;  2EVB A;  4N8F A;  3DLL A;  1JOQ A;  4RAU C;  4DV5 H;  2JEB I;  4YY3 L;  1TWH H;  2ZM6 Q;  1SBB B;  3T1Y Q;  4EFB A;  2K14 A;  5CA0 F;  2NU6 B;  3H20 A;  2AGP A;  5M5W B;  4V0B A;  3T1H L;  1SYC A;  1EY8 A;  1SRU A;  2QEJ C;  1RJT A;  4RCN A;  3WNZ A;  5KFJ A;  4DR1 Q;  2I5H A;  1K9M C;  4OX9 Q;  2L4N A;  5IT9 c;  3K0Y A;  4ID6 A;  2B2U A;  3SGI A;  3S1N B;  2DJF C;  1FR3 A;  4HIM A;  4JYA L;  5CGK A;  1Z7T A;  1OWT A;  1NY4 A;  4C5C A;  1TKW B;  3BA8 A;  1M6V A;  5IYC H;  3SR1 A;  2JA7 B;  2ZJP A;  2X0S A;  2A1A A;  3T4A C;  4LSA A;  1UEB A;  4DV6 H;  5A2Q L;  5KFP A;  3J7A K;  3RV3 A;  2SCU B;  3CQZ A;  2FLN A;  4GLA C;  5KFQ A;  4DAP A;  4DV4 Q;  3S2H H;  2LY7 A;  3SVM A;  2VW9 A;  3A7A B;  1I4G A;  2NVY A;  4YAJ B;  4A3J B;  4LF6 L;  2RDG A;  1N36 L;  4Y8V B;  3GTG B;  1CTM A;  1B6S A;  1Y1W A;  4OEL B;  5IGC A;  3F2C A;  1PYS B;  1S68 A;  3D4R A;  3SK8 A;  4KHP Q;  1M7J A;  2LXJ A;  1GXD C;  3TQY A;  4DGZ A;  3PUW A;  2HVS A;  4LW1 A;  1K0S A;  2ZM6 H;  4DR6 H;  3T1Y H;  1CI3 M;  2HQE A;  4JI3 L;  2AHO B;  4QUC A;  1NUC A;  4ECS A;  2K03 A;  2NVQ H;  1TY2 A;  1ZEQ X;  5LOV F;  1GYF A;  5IYC G;  4Y52 H;  5LMN W;  2UUC Q;  1OXX K;  4OX9 H;  2RCN A;  1E4E B;  3VDY A;  1EIF A;  2E5L L;  2PMZ E;  3IL8 A;  4HJ8 A;  1AH9 A;  2B2T C;  1WTV A;  3HGB A;  3K5I A;  3STB D;  4DR7 L;  2NVT B;  1YHQ A;  3GV8 B;  1C8C A;  1HFN A;  2R7Z A;  2UUB L;  5F9L A;  3KHR A;  3HP3 A;  4B3M H;  2LS0 1;  5M5W H;  1ET6 A;  2OQK A;  1XYI A;  4DXG A;  1J8I A;  3W3A A;  3GTK B;  1BXR A;  2ASD A;  3WOE A;  1STG A;  2VR1 A;  4YR0 A;  3V4Z A;  4XZ3 B;  4DV4 H;  3IN5 A;  4G7Z C;  5JH7 F;  4DK0 A;  4NP5 A;  3S1N H;  4DR3 Q;  4RGM A;  4JI2 Q;  3TP5 A;  1UE5 A;  3HOW B;  3F2B A;  1KBL A;  1SNC A;  3BJU A;  3U9S A;  2ASB A;  4KHP H;  5L9X A;  1IBM Q;  4MNO A;  3P75 A;  2JA7 H;  4IJH A;  3CCM A;  5C3X A;  5KFB A;  4IWY A;  2H4O A;  2HHH Q;  3GID A;  2LKV A;  1KAB A;  1IKM A;  1D2B A;  5ELE A;  2NZO A;  2K05 A;  1PFB A;  1XMO H;  3G6Y A;  4XQN A;  4MA0 A;  1IBK Q;  1CKN A;  2I0Q A;  4X3S A;  2Y0S A;  4A3J H;  4F7X A;  2UUC H;  3VR2 A;  3C1F A;  3RZO B;  3GTG H;  2P5Z X;  2WAQ E;  3A74 A;  4HIO A;  4LFA L;  3J80 W;  1HQR D;  2K50 A;  2R82 A;  5KG3 A;  5EJW A;  5KT4 A;  2A6E C;  5BN5 A;  1ILP A;  4RZR A;  1T5E A;  3H0G B;  4CKC A;  5BN4 A;  2OXP A;  3R2T A;  3GV6 A;  4ED8 A;  3Q8R B;  5T14 A;  1PMR A;  2HGS A;  5KT2 A;  5TSS A;  1SND A;  2KUM A;  1Q46 A;  2ATL A;  1I4H A;  5IYB H;  3J7Z C;  5FLX E;  2CW8 A;  1EYA A;  1Q12 A;  3KAK A;  1WOC A;  4HYK A;  1EUJ A;  3HOZ B;  1JWS D;  2HD3 A;  5GQO A;  2JA6 B;  5KIX A;  3PV0 A;  2JA7 G;  3UFX B;  3V6J A;  4DA2 A;  1YZ6 A;  4JBW A;  2O5I C;  1E24 A;  1KRT A;  3EQL C;  5T1I A;  1S97 A;  4KLK A;  4JI2 H;  4E4T A;  1A2U A;  4XXE A;  1UAP A;  2X6G A;  2NVT H;  5D65 A;  3RD4 A;  2ZTE A;  3NBH A;  3PW2 A;  4NB3 A;  3I73 A;  4A3J G;  2ZT9 C;  4A3L H;  5JPM C;  1IBM H;  4TKO B;  3J81 i;  3G6E A;  1KIX A;  2F0Q A;  1BNZ A;  2HHH H;  3KOJ A;  2A8V A;  1N56 A;  3M4P A;  5FKA C;  4IOC A;  3GTK H;  4MN3 A;  4MV7 A;  1DM0 B;  5EQ0 A;  5I4D A;  2KEE A;  2VQE Q;  5KG0 A;  4JG2 A;  3KYH C;  1HRJ A;  1TWA A;  2PW5 A;  1IBK H;  1FJG L;  4RNN A;  1KAA A;  2EYP A;  2N49 A;  3K59 A;  3MWY W;  4RCO A;  2FPG B;  2JSO A;  3HOW H;  1XTD A;  4TV8 F;  3WO0 A;  2BDN A;  1CZG A;  5IYB G;  3I56 A;  3CQZ B;  3P1H A;  1K3B C;  2UXD Q;  1PH4 A;  4X3U A;  2ES2 A;  2NVY B;  1E1O A;  4FF1 A;  3CCQ A;  1X9N A;  2AU0 A;  4Q0Y A;  1GSA A;  2XGQ A;  4DV2 H;  1N32 L;  5T1G A;  3G71 A;  2OLS A;  4ETS A;  3PR4 A;  5KFC A;  5C4H A;  1LTR D;  2F0P A;  4A3L G;  1XNQ H;  4ZYS A;  4R8N A;  2IPK D;  3E5S A;  2CH4 W;  2AUK A;  4LF7 L;  2MP1 A;  4GN5 A;  3NGD A;  1J5E H;  4I7Z C;  5I47 A;  4GLV B;  2DZD A;  2I07 B;  5JQW A;  4RG1 A;  2EXZ A;  3H0G H;  4MAM A;  4O4I F;  1HXY D;  4A75 A;  2CWP A;  1ICW A;  3DEO A;  1RYS A;  1A62 A;  4DKA C;  3PZP A;  3HOW G;  1ML0 D;  3MFG A;  1VQ7 A;  4X66 Q;  1KHI A;  1XNR L;  1GUG A;  4JI8 Q;  1EU3 A;  3HOZ H;  4YB8 B;  2JA6 H;  5EOY A;  2VQE H;  3UE1 A;  3MFY A;  2R7Z B;  3T5J A;  4ECV A;  3ERO A;  1KJJ A;  2FK3 A;  5LHY 1;  4LH7 A;  2JEI A;  2K6A A;  1EY0 A;  4MV1 A;  2JA8 B;  5IT9 W;  3ZYY X;  2UXD H;  1GUW A;  3AEV A;  4BY7 B;  2PQE A;  4CGY B;  5KFN A;  3NEM A;  4F87 A;  2E2D C;  4MV4 A;  2C00 A;  3H0G G;  4YY3 Q;  5HY6 A;  3QO2 A;  3BYY B;  3PR5 B;  4ED6 A;  3I4N B;  4FS2 A;  4L5R C;  4JV5 L;  3T1H Q;  1H9J A;  2FMA A;  2C22 A;  3MWD A;  3HS0 C;  4LFB H;  5DQG A;  1S5C D;  3GQB A;  3CQZ H;  3RF2 A;  4C5A A;  1FNW A;  3HOZ G;  1PZI D;  2JA6 G;  4DR4 L;  2IWH A;  2RBM A;  4P73 A;  2A74 C;  1CKN B;  2KVM A;  3LGJ A;  2NVY H;  2Y0S B;  2FKL A;  3JAM E;  5EZY F;  5EPL A;  3X3M A;  2XGT A;  2EPB A;  3AMU A;  2QIL A;  3RNU A;  3A55 A;  4CJ1 B;  2F4V Q;  1ENF A;  4UP9 A;  3NTH A;  4JI6 L;  1W6K A;  4H7B A;  4X66 H;  4IR1 A;  4LFC H;  1ASZ A;  4JI8 H;  5HV6 A;  1YNN D;  4JOI C;  3GTO A;  2SNM A;  4UFZ A;  1HNZ H;  5HGT A;  1QOH A;  4NMZ A;  1TS3 A;  3TIN A;  1PZK D;  1P16 A;  2ZXP A;  4YIJ A;  1VAJ A;  3KAL A;  1DD2 A;  3BA9 A;  2N88 A;  5ELB A;  3CRL C;  3CME A;  1T5X D;  1N36 Q;  4N8X 1;  3GV5 B;  3MTS A;  3E3X A;  2J0T D;  4UHV A;  4QWD A;  5KG4 A;  3DXJ C;  1TY0 A;  1KRS A;  1RDP D;  2IHF A;  1CK1 A;  2MFI A;  3I55 A;  5I6Y A;  1V43 A;  1PH7 A;  2BR0 A;  1B04 A;  1SNM A;  3J81 j;  3T13 A;  1DZ1 A;  1B3A A;  2PCF B;  1Z2P X;  1Y8O B;  4AH6 A;  5C5J A;  5GON F;  4YY3 H;  3NBH B;  2R7Z H;  5I2Y A;  4FF2 A;  1MKH A;  4JI3 Q;  4QY7 A;  5JEA J;  3T53 B;  1XMQ L;  3T1H H;  5JVG 3;  2K33 A;  4LJZ C;  4UCS A;  1I6U A;  2JA8 H;  4JV1 A;  3HKS A;  1Z6H A;  3WDN A;  1TWA B;  4KD3 A;  4KK7 A;  3U4V A;  2E2I H;  3PCO B;  1JWM D;  1QNK A;  2B63 H;  4BY7 H;  4LH6 A;  3ETJ A;  4GS3 A;  1QJO A;  5KFV A;  1WVL A;  5CV5 A;  4DR7 Q;  4J15 A;  5LMN L;  3HOY B;  3MFI A;  3S1M B;  2AQ3 B;  2UUB Q;  3VPD A;  4J9M A;  1EUD B;  4YWK A;  4ZKC B;  3OWF A;  5DG7 A;  2B29 A;  3HEJ A;  4DUY L;  2V59 A;  4YCU A;  3I4N H;  5G3L D;  4ECR A;  2BOS A;  2BQ3 A;  2QYZ A;  3M4I A;  4L63 B;  3OW7 A;  3GIP A;  2W9B B;  4K14 A;  2R7Z G;  4LF6 H;  4DUZ L;  1N36 H;  3I8Z A;  1KD1 C;  2UVR A;  2G5D A;  5I9P A;  3DHQ A;  4ZKB B;  4GKK Q;  2M2L A;  2Z6K A;  1G6P A;  3KLW A;  2JA8 G;  1TWG A;  1IL2 A;  2I8C A;  2E76 C;  2B63 G;  4BY7 G;  2DY8 A;  2MCT A;  4DV0 L;  4JI3 H;  3V2T A;  4CHT B;  3C46 A;  1M90 C;  1QB5 D;  1ICF B;  3NTK A;  1XPR A;  2EYJ A;  5EAY A;  2W6Q A;  1H9K A;  2K5W A;  1F9Q A;  4KY5 A;  4LFA Q;  3I4N G;  1UNN C;  4QB4 A;  5DGB A;  1DJR D;  3MAQ A;  1AUV A;  1I4R A;  1ESF A;  2Z4I A;  1VF7 A;  3S17 B;  4DR7 H;  2PZT A;  4DNR B;  3BAA A;  1HR0 Q;  3MWE A;  4OHJ A;  3CC4 A;  2UUB H;  4P2C B;  3J80 L;  1VQL A;  1VQG A;  1A3U A;  2Y0S G;  3CAM A;  5E1F A;  3SI8 A;  4DR1 L;  1H95 A;  3RJ0 A;  2EIF A;  3TSS A;  2DLN A;  1B9N A;  3SEB A;  4JI5 Q;  4JOI A;  1JB3 A;  5JPN C;  4FU0 A;  2YRX A;  1C30 A;  1F2L A;  5M5X B;  1GJX A;  1JE4 A;  1TWA H;  3BU2 A;  3DWQ A;  3IFD A;  4EYI B;  4JUZ A;  4QW8 A;  3EBE A;  4MV8 A;  5FD5 A;  3HOY H;  1I7L A;  1CSP A;  4ABN A;  1I7N A;  1AE3 A;  3S1M H;  5I6W A;  4J0M A;  2NVX A;  1VQ6 A;  1S03 G;  4A76 A;  3LWE A;  2BQU A;  1S0N A;  2XCL A;  2QF7 A;  2K5N A;  3R23 A;  4JI4 Q;  2PW7 A;  1AFP A;  3Q23 A;  3D0F A;  4MTK A;  4ED2 A;  4RB2 C;  2R8G A;  2YTY A;  3GTO B;  3VMM A;  4LFA H;  1UNS A;  3MHB A;  4JK1 C;  2MO0 A;  4MA5 A;  2AGO A;  3NPP A;  3C2P A;  4XYO A;  4RU9 A;  4F4Z A;  2KJX A;  2PI2 E;  4O42 A;  5L1I A;  3GV3 A;  1FGU A;  1HHV A;  1AUX A;  5D3I B;  2IT1 A;  3IG0 A;  1N32 Q;  3TDQ A;  3HOY G;  1X56 A;  5KNC A;  1GO3 E;  4A3G B;  4FNF A;  3PQI A;  3KHH A;  1N34 Q;  2VQD A;  3KLS X;  1QCB D;  4LF7 Q;  5C5L A;  1A6X A;  3SXH A;  3K3P A;  4ED1 A;  3SE7 A;  1YEZ A;  4GC7 A;  4X65 L;  3S17 H;  1PLF A;  1K73 C;  2IX1 A;  4J9N A;  1HPC A;  1JOK A;  4O3Q A;  2FJZ A;  4RAZ A;  1PK8 A;  1EQV A;  5C4J B;  2ZDG A;  4WJW A;  1XJV A;  1EYZ A;  4F50 A;  5KFK A;  4K8I A;  5GAH C;  1XNR Q;  3EN2 A;  5M5Y B;  1OXU A;  3M4Y A;  4HIK A;  3H3V C;  1I50 A;  4RAY A;  4C2M A;  2PZU A;  4DR3 L;  4QCL A;  1BCP B;  5M5X H;  3G6J B;  4DV3 Q;  1KDA A;  1MI2 A;  1L2Z A;  2EJM A;  1EY6 A;  4OWW B;  2R6F A;  5E4W C;  4GZY C;  1L0X B;  2YS6 A;  2ICI A;  2A69 D;  1EZ8 A;  4HCE A;  2QA4 A;  1CQI B;  4J9P A;  5IT9 L;  5E7N A;  1N32 H;  2B8G A;  3PVX A;  4PMC A;  1NMF A;  3DWP A;  3E9I A;  1HR0 W;  1WTX A;  1Q1E A;  4IRD A;  1PRT B;  4JV5 Q;  2WYO A;  2WP8 J;  4APM A;  3IRB A;  1SN8 A;  2BA0 A;  2K4K A;  3NQI A;  3GTO H;  1K1S A;  4LF7 H;  1GD7 A;  3N52 A;  1NR2 A;  4IUT A;  4JBJ A;  4KMU C;  2YV5 A;  3WO1 A;  1RCV D;  1Z2N X;  3T56 B;  4ZRZ A;  5IE8 A;  1I6V C;  4OIJ A;  4EYH B;  1Y8N B;  2RGV A;  1F9R A;  1EQR A;  2K28 A;  2RSN A;  1XNR H;  4A3G H;  2UXC Q;  1JMC A;  1WD1 A;  4ED7 A;  5BMV F;  3GTM A;  4K0K Q;  3OHX C;  5IGB A;  1EFW A;  2W6O A;  2L1B A;  5C8Y F;  3G6X A;  3KHL A;  4O3S A;  1PFM A;  2FK1 A;  2VNU D;  2JJQ A;  1EY9 A;  3PW4 A;  2NWG A;  1CM9 A;  2CHB D;  4GNX C;  3ULJ A;  1TWF A;  5D1P A;  1EYD A;  3BVZ A;  2FJ2 A;  5JVH 3;  3RR5 A;  4IOA A;  3BQ2 A;  3HKZ E;  5C4J H;  5IOC A;  2NZ1 D;  4AYB E;  1WTW A;  2JE6 I;  1JR0 D;  2EYL A;  3KLS A;  5M5Y H;  3ORQ A;  3JAM i;  1EHI A;  4IUV A;  4APV A;  4DNT B;  4J1M A;  2NVX B;  4BXX H;  1XMQ Q;  4JV5 H;  4E6I A;  2UXD L;  1VQD A;  3A0J A;  3K5H A;  5CBA E;  3TQ1 A;  2WB1 E;  1YIJ A;  4YHH Q;  5GAE C;  4A3G G;  1V51 A;  1ENA A;  5EWF A;  3GIM A;  1HTL D;  1KLU D;  4KN7 C;  3RAX A;  2R93 A;  3RN2 A;  1PTO F;  4UCO A;  2IW3 A;  1IOV A;  3H94 A;  3VYR A;  1PH8 A;  2Z1C A;  1JOR A;  5CV4 A;  5KT5 A;  2KHJ A;  5JEA H;  4JI6 H;  2EZV A;  5IWA L;  2EQS A;  4DUY Q;  3OUU A;  4YJ3 F;  1VMC A;  1VQI A;  1STB A;  5CV9 A;  5KFU A;  1EY4 A;  4IO9 A;  4A93 B;  1Q86 C;  2XRS D;  4DL4 A;  1RJP A;  1PA6 A;  2YCH A;  1SFO A;  4BXX G;  1EEF D;  2ZTD A;  4BA2 I;  2VB2 X;  3PUZ A;  4CBV A;  4A3D B;  4WJ3 M;  4PZ6 A;  2EY6 A;  1VCI A;  2DGY A;  2R3Z A;  1QWY A;  3PW5 A;  4GKJ Q;  3KTM A;  2FE3 A;  4UP8 A;  3P7J A;  4QWA A;  3GTQ A;  2C9O A;  3JSL A;  3CW2 C;  4MV9 A;  5KFS A;  5I9O A;  5HBR B;  1XMQ H;  1STE A;  3BAB A;  2XN9 C;  1LLR D;  3SK5 A;  5JEA G;  1Q81 C;  1CQJ B;  3CCR A;  1I50 B;  1ROD A;  2A68 C;  4C2M B;  3RGX A;  2TSS A;  1O7Z A;  4ME6 A;  2X6L A;  1PFN A;  3H91 A;  3LX0 A;  1S10 A;  4MHE A;  5LL6 X;  4TUY F;  5LMN H;  3ER0 A;  5GAG C;  1VQH A;  1LT5 D;  2VXW A;  2FB9 A;  3Q22 A;  4YAK B;  1G29 1;  4X6A H;  4DUY H;  4HAE A;  2RDJ A;  3R5F A;  2BH2 A;  3RB3 A;  3MFH A;  5A2Q E;  3FMA A;  1I4X A;  1L1O A;  1HUN A;  2R7N A;  4X64 Q;  2CZG A;  4PZ7 A;  1MGS A;  4WOR A;  4TQR A;  4XDX A;  4OO1 I;  4EEY A;  1T3N A;  3S1R B;  4QWB A;  1UEA B;  4BBS B;  4DUZ H;  4EVO A;  3W2D A;  1HZA A;  3BS1 A;  4I50 F;  2F4V L;  1A8V A;  4NPS A;  4LNQ A;  4BWS C;  1LTA D;  4NXM L;  4HCS A;  3DM1 A;  4GKJ H;  2CKZ B;  2Z4H A;  2B2V C;  4IAJ A;  1A15 A;  2VUG A;  1Q8I A;  4DV0 H;  3L4J A;  2B3G A;  5A35 A;  5K5P A;  3PUY A;  2DPI A;  4A93 H;  2ZJT A;  2UU9 L;  1JE5 A;  4QWC A;  3U50 C;  3H4D A;  4C1N I;  1M8A A;  1YNN C;  1QVC A;  4XTC S;  3GTM B;  1ZYR D;  4R7R A;  4A3D H;  1D5Z C;  3TS0 A;  2JEJ A;  4H44 C;  4CJ0 B;  3BG3 A;  1NNX A;  3KF6 A;  1EZ1 A;  1PHJ A;  4XYQ A;  4GN4 B;  2Z0S A;  4C5B A;  3NHH A;  3G7L A;  4F8M A;  3AFP A;  1TWF B;  3J81 c;  2X69 A;  5IYD H;  2RCF A;  4DR1 H;  2YTV A;  3H09 A;  1WFQ A;  2KEC A;  3KFU A;  1V4Y A;  2EOT A;  4EGQ A;  5EPK A;  4GOP A;  4X64 H;  1W96 A;  1I50 H;  1AZP A;  5E4X A;  4C2M H;  1TWC A;  2FMC A;  4YCW A;  1PTO C;  4OIK A;  3I2Z A;  2LMC B;  1GVP A;  2NN6 I;  4ODG A;  4A93 G;  4X65 Q;  1L2F A;  2QGQ A;  2B2Y C;  5C3E B;  3S9W A;  3CF5 A;  4IUN A;  1YHA A;  2HVQ A;  4M7E A;  1QZH A;  1RTN A;  2GLT A;  2BA1 A;  2R7L A;  1TVX A;  2IA6 A;  4A3D G;  4R4C A;  3PO2 B;  2N55 A;  4RUC A;  2DN8 A;  3CXC A;  4I65 A;  1JOO A;  3MR2 A;  2O2L D;  5DLF A;  1DOL A;  2RDF A;  2F0F A;  2VL6 A;  3Q8D A;  1CSQ A;  3QG1 A;  1EU4 A;  2O5J C;  1SMY D;  4EBD A;  5IYD G;  3S1R H;  3Q6S A;  4BBS H;  4GKK L;  1LAC A;  3D4W A;  3TZU A;  3I90 A;  2KCN A;  3G4S A;  3U58 A;  1RK6 A;  1G6Z A;  3I12 A;  3J7Y W;  2K04 A;  1B1Z A;  3RLF A;  2YYA A;  3JSN A;  1X3G A;  4ZAI A;  2ZDH A;  1X32 A;  3HOV B;  2Q2I A;  4R8I A;  2YYZ A;  5KX5 F;  1IOW A;  1K3R A;  4K8J A;  3T5H A;  3KDF A;  1SFO B;  1HJP A;  1YNJ D;  2J6S A;  5C3W A;  4A3B B;  2DWC A;  4OWX B;  4TSS A;  1DOK A;  1BBX C;  3OIP A;  1WR2 A;  2JK8 A;  3RLO A;  3DWA A;  5BR8 Q;  2XNA C;  3GTQ B;  1PH3 A;  3GTM H;  1II3 A;  1B33 N;  1XTC D;  1HR0 L;  4AIM A;  3K5O A;  4X65 H;  3PF4 A;  2CWA A;  1T94 A;  4XT1 B;  2F0E A;  1I3Q A;  4DR2 L;  2OTJ A;  1TWF H;  4BBS G;  1TS2 A;  2NU9 B;  4JI5 L;  1C3O A;  2FLP A;  2ALY B;  3VR5 A;  3D8G A;  1X54 A;  4BA1 I;  3OOC A;  4DNI A;  2Q8R E;  4RGO S;  1YJ9 A;  4K2K A;  1QNU A;  4DR3 H;  1IZ6 A;  1JT8 A;  2YRW A;  3L0O A;  1R4Q B;  2BDO A;  3TN2 A;  4IUP A;  3KHG A;  1LUZ A;  3BJY A;  2Z9H A;  3HOU B;  2AGQ A;  2F0S A;  2DIK A;  4XX0 B;  1NR4 A;  2QDL A;  1BR9 A;  1O7L A;  2F3V A;  1L1O B;  5C3E H;  2W6Z A;  4GLX A;  4HJA A;  4Q8F A;  2UVU A;  2YZN A;  1BQQ T;  1E3P A;  1F77 A;  1EIG A;  4JI4 L;  2V58 A;  3L3O C;  1QG7 A;  3MR6 A;  1SEI A;  2WKC A;  5KT7 A;  3PO2 H;  3PMF A;  2VA3 A;  1XXG A;  3S15 B;  5DM7 3;  2XRQ D;  3ORR A;  3ND9 A;  3MXG A;  4ZHQ F;  1NJI C;  2GA4 B;  4DN4 M;  1DV1 A;  3QB3 A;  4EGJ A;  4PMB A;  1X3Q A;  3NTI A;  1BVS A;  1VQJ A;  1HNW L;  1NE3 A;  4EEQ A;  2B2T A;  5EKL A;  2R7D A;  1OO9 B;  1TS5 A;  2PMZ A;  2C2R A;  4RHR A;  3HOV H;  1G8Z D;  1Y1W B;  5C1P A;  4DV1 L;  4IN3 A;  2RGR A;  1HZB A;  1LTL A;  4BWG B;  4UY8 C;  5FPR A;  3G6V A;  1SFO H;  1EY7 A;  2O03 A;  2JEA I;  4UCT A;  3F2U A;  4CDE C;  2AQ2 B;  1CE8 A;  1F9S A;  2IX0 A;  3FPU B;  4A3B H;  1N34 L;  5C3E G;  3I4L A;  3KF6 B;  5IWA Q;  3RZO H;  2LSS A;  2EJG C;  4IZO A;  4C3I B;  3I72 A;  1VQA A;  4FVM A;  4Z9C B;  4DAY A;  2IY5 B;  3CCV A;  3GTQ H;  1F2Z A;  3TP8 A;  3KBX A;  3PO2 G;  3TIG A;  5L1K A;  5FO8 B;  4O4H F;  3GIK A;  1EYC A;  2JYO A;  1KDB A;  1SE4 A;  5FO7 B;  1S5B D;  1PH9 A;  4GOP B;  4FO2 A;  4R4I A;  1JDE A;  3M85 A;  1MJC A;  1TWC B;  2A68 D;  4JPB W;  2RDI A;  1SNO A;  1DCZ A;  2F0K A;  1EQQ A;  4O3R A;  3CC7 A;  3HOV G;  2CQY A;  1YIT A;  4DV3 L;  5DG9 A;  3MC0 B;  2JEF A;  4RA8 A;  5IYZ F;  2RVL A;  1B4O A;  3FRP B;  1WCM A;  3JRW A;  3QOJ A;  1U0L A;  4A3B G;  3HB9 A;  1DXM A;  3HOU H;  2WAQ A;  1U4L A;  1PDQ A;  5IGF A;  2PVP A;  3ND8 A;  3NQT A;  4LF9 Q;  3ETH A;  4TQS A;  2IL8 A;  4O4L F;  4ED3 A;  2DJG C;  3GD7 A;  3HFZ B;  4F4X A;  1SE8 A;  4HNU A;  1PH2 A;  2WDT A;  4C3H B;  3C3L A;  1D1K A;  4HJ9 A;  4IUU A;  2R61 A;  4OO1 H;  4ZUI A;  1U9R A;  5IWA H;  4OON A;  2MO1 A;  3CKI B;  5KGU A;  5CMD A;  3M9N B;  2KQ3 A;  4CKE A;  4R8U A;  1HNX L;  3PO3 B;  4ZCK A;  5C0X J;  5KFH A;  1HH2 P;  2A69 C;  3KDF B;  3R5X A;  4PNY A;  3OUZ A;  4FYD A;  3R8B A;  4LWC A;  3PGZ A;  2I5L X;  1JX4 A;  3V4S A;  4LF5 Q;  2YU9 A;  4A3C H;  4B3S L;  1Y1W H;  5JVD F;  1TII D;  1BJT A;  1ILQ A;  3FEW X;  4TQU S;  1I94 Q;  5KG6 A;  4DL6 A;  3A8I E;  1C4Q A;  1Y8P B;  2HIX A;  3N6X A;  2UXC L;  3HOU G;  3PW7 A;  2F0N A;  4NXM Q;  1SJH D;  4EFE A;  3M4Q A;  5EBC A;  3W1G A;  4K0K L;  5F9N A;  4LSX A;  1T9H A;  3J81 W;  4C3I H;  2HVR A;  1CHP D;  5KFL A;  3GTJ A;  3Q2O A;  1U4M A;  1ESR A;  5KYI A;  3RZD B;  3GQC A;  1HZC A;  2UU9 Q;  3RFC A;  4OO1 G;  2L12 A;  4RKL A;  5DQH A;  1X3F A;  2EXD A;  5C0X I;  1IKL A;  4RGN A;  2PNH A;  1SYB A;  1J6Q A;  1KTK A;  3R5H A;  1EL0 A;  1TR5 A;  1TWC H;  3CCL A;  3M9O B;  1YHB A;  1FVI A;  1PTO D;  3K80 C;  3UI2 A;  2EE1 A;  4ECY A;  3NE5 B;  1KQS A;  1Y1W G;  4A3C G;  2AQ4 A;  1L0Y B;  1LT4 D;  3LML A;  4POF A;  4YHH L;  5BPF A;  2NN6 H;  4I7H A;  1NMG A;  2PZW A;  1XPO A;  1H9R A;  3BVM A;  4A3E B;  4QIW E;  4DAV A;  2Z6B A;  3J7A V;  2MQH A;  2EYM A;  3R3O A;  4C3I G;  4IUR A;  2NUC A;  3CHB D;  3HZX A;  5FLX c;  4HQ6 A;  2XTI A;  1I94 H;  1UE7 A;  3KBG A;  4EBC A;  2F4V H;  2RQX A;  4MZ9 A;  4L5T A;  1A63 A;  3L9A X;  3CCJ A;  4NXM H;  3PF5 A;  1DOM A;  1KNA A;  2PMZ B;  5H1S E;  1SRO A;  3J7A 5;  3I3C A;  2W6N A;  5JUM A;  4ME5 A;  4NLG A;  3U9T A;  5KFG A;  1OXS C;  1KL9 A;  3PO3 H;  2R6G A;  1LTI D;  4G3I A;  1C0A A;  4WFN 3;  4HMI A;  2UU9 H;  2KSW A;  5FD6 A;  2J7Z A;  2I5M X;  5LL6 S;  2MJ8 A;  3EVQ A;  4DAY B;  2NN6 G;  3G48 A;  4RFB A;  4B3R Q;  2HIV A;  4GKJ L;  4FBT A;  2R7K A;  2F4I A;  5J1Z A;  3TEH B;  5J39 A;  1STN A;  4XT3 B;  2XCA A;  2N8N A;  4K5V A;  4FF3 A;  4A3F B;  1LT6 D; 
#chains in the Genus database with same CATH homology
 4IPG A;  2ID0 A;  1K8A C;  3F2C A;  1PYS B;  1EQR A;  2N78 A;  4KHZ A;  4LF4 L;  1PYB A;  4KHP Q;  4JI1 Q;  4A3G H;  2UXC Q;  1JMC A;  4EQ5 A;  2LXJ A;  2DUD A;  4LFB Q;  3TQY A;  1M1K C;  3PO3 G;  4JI0 Q;  3PUW A;  4K0K Q;  4LW1 A;  1EFW A;  1IYJ B;  1OXV A;  4JI3 L;  4YWM A;  2AHO B;  1IBL Q;  2VNU D;  2JJQ A;  4DAM A;  1SMX A;  1JJ2 A;  2NVQ H;  2K75 A;  4DR2 Q;  4GNX C;  4JCV E;  3ULJ A;  5IYC G;  5FLM G;  1NTG A;  4Y52 H;  5LMN W;  2UUC Q;  1OXX K;  4OWT B;  2RCN A;  1QZG A;  2KCM A;  3RR5 A;  4X64 L;  3VDY A;  1UE1 A;  1EIF A;  3HKZ E;  3UE0 A;  5C4J H;  4DR5 L;  2Q2U A;  2E5L L;  4LFC Q;  2PMZ E;  5GAD C;  4A3I G;  2E8G A;  4HJ8 A;  1AH9 A;  4AYB E;  4A3E H;  1HNZ Q;  2JE6 I;  3L2P A;  3STB D;  3CPW A;  5M5Y H;  4DR7 L;  4QQB X;  1YHQ A;  3JAM i;  2E2H H;  4APV A;  3M7N A;  3S15 H;  2Q2H A;  1W2B A;  2UUB L;  4BXX H;  1XMQ Q;  5JJL A;  2UXD L;  1VQD A;  1YJW A;  3PUV A;  4B3T L;  3A0J A;  5M5W H;  1VQK A;  2OQK A;  2WB1 E;  1YIJ A;  5AJ3 L;  4YHH Q;  5GAE C;  4A3G G;  1SR3 A;  2Z6K C;  1S72 A;  4B3R Q;  2A19 A;  4GN3 B;  4QL5 A;  2OQ0 A;  5DLQ E;  3S1N H;  3OTO Q;  3RN2 A;  1I5F A;  4DR3 Q;  1PH8 A;  4JI2 Q;  1UE5 A;  3ULL A;  2V1C C;  3F2B A;  2KHJ A;  1C9O A;  3BJU A;  2ASB A;  4A4I A;  5IWA L;  1IBM Q;  4MNO A;  2EQS A;  4DUY Q;  2JA7 H;  3K7A H;  4IJH A;  1K83 H;  3CCM A;  4LF8 L;  1HNW Q;  1VQI A;  1S40 A;  3CCU A;  1D7Q A;  2HHH Q;  4IPH A;  1OTC A;  4RMF A;  4IO9 A;  4AQY Q;  2UUA L;  3CC2 A;  1Q86 C;  4A3E G;  2NZO A;  3TRE A;  4DV1 Q;  1MJE A;  1PA6 A;  1Q8K A;  4JYA Q;  1IBK Q;  1CKN A;  4IPD A;  2I0Q A;  4A3F H;  4BXX G;  4A3J H;  1Q1B A;  2ZTD A;  4BA2 I;  3PUZ A;  4WJ3 M;  3GTG H;  2WAQ E;  2ZTC A;  3A74 A;  4PZ6 A;  4O2D A;  2K50 A;  4X62 Q;  1VCI A;  2DGY A;  2VQF L;  4HIO A;  1PV4 A;  1PH5 A;  2ZJQ A;  3HKZ G;  3S24 A;  3A5Z B;  1IXR A;  1PH6 A;  4GKJ Q;  1QVG A;  1N33 Q;  4JI7 Q;  4AYB G;  4UP8 A;  3D31 A;  3KJO A;  1K8G A;  1VQF A;  3CW2 C;  2UXB L;  1BKB A;  1WCM H;  3S2D H;  1VQ5 A;  1Q46 A;  4LF6 Q;  1Q81 C;  5JEA G;  3J7Z C;  1HZ9 A;  5IYB H;  4HID A;  2N3S A;  1Q12 A;  2WB1 G;  1WOC A;  1VQC A;  1EUJ A;  3CCR A;  5GQO A;  1YVC A;  3AFQ A;  4BY1 H;  3PV0 A;  2JA7 G;  1YZ6 A;  4JBW A;  5C44 H;  3H15 A;  3RN5 A;  4A3M H;  1W3S A;  1E24 A;  4DV7 Q;  1KRT A;  4KLK A;  3ER0 A;  1KAW A;  1EYG A;  2R92 H;  5GAG C;  1VQH A;  2NVT H;  1C7Y A;  2ZTE A;  4C3H H;  4NB3 A;  4A3F G;  2K5V A;  4A3J G;  4IFD G;  2IHE A;  2RHS B;  1G29 1;  5ELN A;  3J81 i;  4A3C G;  4A3L H;  3G6E A;  2F3I A;  1R9T H;  1KIX A;  1V9P A;  4O0A A;  2OTL A;  2BH2 A;  1L1O A;  3KOJ A;  4P72 A;  3I7F A;  3M4P A;  4IOC A;  2A8V A;  3GTK H;  3ZJY C;  4X64 Q;  4PZ7 A;  3CD6 A;  2VQE Q;  2E5L Q;  4JG2 A;  3KYH C;  3FKI H;  4OO1 I;  4MTN A;  1JJG A;  4DV5 L;  3BZK A;  1FJG L;  1HZA A;  3M9B A;  2N49 A;  2K5H A;  1WCM G;  5FJ8 H;  2F4V L;  1A8V A;  4NPS A;  2LXK A;  2GVB A;  4LNQ A;  1XTD A;  3HOW H;  1VQN A;  3I56 A;  5IYB G;  2WAQ G;  5BR8 L;  4NXM L;  2UXD Q;  4BY1 G;  1PH4 A;  3CP0 A;  2CKZ B;  1HNX Q;  1E1T A;  1EWI A;  5C44 G;  4A3M G;  2ES2 A;  1AE2 A;  1E1O A;  4HJ5 A;  5K36 G;  2B3G A;  3CCQ A;  1VQM A;  1X9N A;  3PUY A;  1I3Q H;  4A93 H;  2UU9 L;  4JC0 A;  1JE5 A;  4B3S Q;  2R92 G;  1N32 L;  3U50 C;  3G71 A;  3RZD H;  4DK3 C;  4ALP A;  4A3L G;  1QVC A;  4PG3 A;  4XTC S;  1G51 A;  4DV6 L;  3PSI A;  5JJI A;  4A3D H;  3TS0 A;  4LF7 L;  4GN5 A;  3KF6 A;  1V1Q A;  1PHJ A;  1EOV A;  4GLV B;  4RG1 A;  4GN4 B;  3A5U A;  2Z0S A;  3FKI G;  3DM3 A;  3AFP A;  3H0G H;  5JJK A;  3J81 c;  5IYD H;  2GN5 A;  4A75 A;  2CWP A;  5LMU L;  4BBR H;  5FJ8 G;  4DK6 C;  1A62 A;  1Z9F A;  4DKA C;  3ICE A;  2YTV A;  3HOW G;  1WFQ A;  1VQ7 A;  3GO5 A;  4X66 Q;  1KHI A;  3KFU A;  4PMW A;  1XNR L;  1RIP A;  4QGU A;  4PZ8 A;  4JI8 Q;  4GOP A;  2VQF Q;  1I50 H;  3HOZ H;  2JA6 H;  1YJN A;  3UE1 A;  4C2M H;  1MIU A;  3HOX H;  4YCW A;  2PI2 A;  3I2Z A;  4DR6 L;  4LUZ A;  1VQP A;  2ZM6 L;  3T1Y L;  3K81 C;  1GVP A;  2NN6 I;  4A93 G;  4X65 Q;  1L2F A;  2QGQ A;  3OW2 A;  3TS2 A;  3CF5 A;  1YHA A;  2AWO A;  1QZH A;  4OX9 L;  1UE6 A;  2BA1 A;  2CFM A;  3AEV A;  4A3D G;  4R4C A;  3EIV A;  4L5Q A;  1OXT A;  5C0X G;  1Q7Y C;  4JBM A;  3NEM A;  3CXC A;  1EIY B;  2VL6 A;  3Q8D A;  1CSQ A;  1X6O A;  3H0G G;  4YY3 Q;  5HY6 A;  5IYD G;  3S1R H;  4R4O A;  4BBR G;  4BBS H;  3H3V I;  4GKK L;  1VS0 A;  4B3M L;  4L5R C;  1O7I A;  3T1H Q;  4JV5 L;  3G4S A;  4QJF A;  3U58 A;  1TWG H;  2WFW A;  2KHI A;  1X3G A;  4P71 A;  3RLF A;  4R4T A;  1VQ4 A;  1WI5 A;  1B8A A;  2Q2I A;  3CQZ H;  2YYZ A;  3CPF A;  3HOZ G;  1YBY A;  1K3R A;  1DGS A;  1QUQ A;  2JA6 G;  4DR4 L;  3HOX G;  4DV4 L;  4P73 A;  5ELO A;  3KDF A;  1CKN B;  1HJP A;  3LGJ A;  2HQL A;  2NVY H;  2XGT A;  4OWX B;  4A3K H;  3UDF A;  2Q2T A;  3RNU A;  4IJL A;  1FJG Q;  2F4V Q;  4UP9 A;  4JI6 L;  2OWO A;  4KHP L;  3PUX A;  4JI1 L;  2JK8 A;  3RLO A;  1ASZ A;  1UWV A;  5BR8 Q;  4JOI C;  3NEL A;  3JAM c;  1PH3 A;  5IP7 H;  3GTM H;  2H5X A;  1HR0 L;  4JI0 L;  1P16 A;  3K0X A;  4AIM A;  1A0I A;  1VQO A;  3CME A;  3PF4 A;  3UDG A;  2CWA A;  1XMO L;  1WJJ A;  2CQO A;  1N36 Q;  4DR2 L;  2OTJ A;  1TWF H;  4BBS G;  3GTP H;  4JI5 L;  2ALY B;  2UUC L;  3ULP A;  4LF9 L;  2L15 A;  1X54 A;  4BA1 I;  3CMA A;  1KRS A;  4XIG S;  2MFI A;  2IHF A;  4DNI A;  3I55 A;  5IP9 H;  1V43 A;  1PH7 A;  4LF4 Q;  1X55 A;  3J81 j;  1YJ9 A;  3UDI A;  1IZ6 A;  4AH6 A;  1JT8 A;  3FP9 A;  3L0O A;  3NBH B;  2JQO A;  2VZA A;  4C3J H;  2R7Z H;  1MKH A;  2AKW B;  4JI3 Q;  4UPA A;  1LUZ A;  4QY7 A;  4NXN L;  5JEA J;  4A3K G;  1P8L A;  3RLN A;  1XMQ L;  4R4Q A;  1Q82 C;  2JA5 H;  2NVX H;  3S14 H;  1L1O B;  5C3E H;  4LUO A;  4HJA A;  4GLX A;  2JA8 H;  3HKS A;  2RF4 A;  1VQ8 A;  3MXN B;  1E3P A;  4JI4 L;  2E2J H;  3S16 H;  5IP7 G;  3U4V A;  4HJ7 A;  4DR5 Q;  2E2I H;  1GKH A;  3PCO B;  4LF5 L;  4JBK A;  2ATW A;  2B63 H;  3STB C;  2YU9 H;  4BY7 H;  3JC6 6;  4GS3 A;  3PO2 H;  1G6P A;  4FDB A;  1CUK A;  4J15 A;  5LMN L;  1I94 L;  1SLJ A;  4JI2 L;  4DR7 Q;  2CCZ A;  4DR6 Q;  3ERS X;  3J80 i;  1NJI C;  4GNX A;  2UUB Q;  4IFD J;  2Y0S E;  5M3F H;  4YWK A;  2B29 A;  1IBM L;  4P74 A;  4DUY L;  4B3T Q;  1BVS A;  4YCU A;  1VQJ A;  2VS1 A;  3I4N H;  1K0R A;  5AJ3 Q;  1HNW L;  5IP9 G;  1NE3 A;  2HHH L;  2AWN A;  1FL0 A;  2R7D A;  1LM0 A;  4AQY L;  3HOV H;  3GTJ H;  2PQA A;  3B6Y A;  3KF8 B;  4DV1 L;  1CKM A;  4Y7N H;  2KEN A;  3BZC A;  1HZB A;  1LTL A;  2R7Z G;  4UY8 C;  4DUZ L;  2RHQ B;  2YTX A;  3AQQ A;  4OXP A;  1SFO H;  1IBK L;  2JEA I;  1KD1 C;  1D8L A;  2IX0 A;  4A3B H;  2JA5 G;  1N34 L;  5C3E G;  4GKK Q;  5IWA Q;  3KF6 B;  2Z6K A;  5J3B A;  2LSS A;  3KLW A;  4B3M Q;  2JA8 G;  3M3Y H;  3RZO H;  1VQA A;  1N8R C;  1KXL A;  1IL2 A;  4LF8 Q;  4JI7 L;  1WYD A;  3CCV A;  2IY5 B;  2VY3 A;  2B63 G;  3I4O A;  3GTQ H;  4POG A;  4DV0 L;  4LUV A;  2UUA Q;  3PO2 G;  4BY7 G;  4DR4 Q;  4IFD I;  5IY0 A;  1M90 C;  4DV2 L;  3NEN A;  3I4M H;  1XPR A;  3W1B A;  2R7F A;  3L7Z C;  5M3F G;  5EAY A;  1PH9 A;  4GOP B;  4R4I A;  1VQE A;  1I6H H;  3M85 A;  1MJC A;  1XNQ L;  4LFA Q;  3I4N G;  4JI6 Q;  2AMC B;  2D62 A;  1EQQ A;  3F2D A;  1J5E L;  1CKO A;  1L1O C;  4EX5 A;  1B70 B;  3E9H A;  4DV7 L;  3CC7 A;  2JA9 A;  3J80 c;  1YIT A;  4DV3 L;  2VUM H;  3HOV G;  1HR0 Q;  3CCE A;  3CC4 A;  1ASY A;  1NBW A;  4KI0 A;  3WWV A;  1PH1 A;  1VQL A;  2UXB Q;  1VQG A;  1XMO Q;  2Y0S G;  1U0L A;  3CAM A;  4A3B G;  3F8T A;  2BH8 A;  4DR1 L;  3HOU H;  1H95 A;  2EIF A;  4YCV A;  4JI5 Q;  5C4X H;  1YI2 A;  3E0E A;  3FHW A;  4LF9 Q;  4JOI A;  2HT1 A;  1GM5 A;  2VQE L;  3GD7 A;  1TWA H;  3BU2 A;  3HFZ B;  1SE8 A;  1PH2 A;  1VQ9 A;  1X3E A;  3EBE A;  2K52 A;  3MEF A;  2KCT A;  3I4M G;  2ZJR A;  3UDX A;  4HJ9 A;  3HOY H;  1CSP A;  1N9W A;  4B3R L;  1AE3 A;  3S1M H;  4NXN Q;  4OON A;  2MO1 A;  4P75 A;  1VQ6 A;  1E7Z A;  1QUQ B;  4A76 A;  1HNX L;  5C0X J;  1HH2 P;  3KDF B;  3K7U C;  2MNA A;  2K5N A;  1PFS A;  4JI4 Q;  4LWC A;  1TXY A;  2I5L X;  3PGZ A;  1E22 A;  2VUM G;  4LF5 Q;  4IPC A;  3D0F A;  1U5K A;  1Y1V H;  1Y1W H;  4B3S L;  4DV5 Q;  4A3C H;  4LFA L;  4TQU S;  5LMN Q;  1I94 Q;  2YTY A;  2HIX A;  4R1J A;  2FXQ A;  2GVA A;  3HOU G;  2UXC L;  5GRO A;  1Y14 B;  4NXM Q;  4WJ4 A;  5C4X G;  2MO0 A;  4LFB L;  3M4Q A;  3W1G A;  4K0K L;  3TRZ A;  4GOP C;  1T9H A;  1JJC B;  3GDE A;  3S1Q H;  4C3I H;  1JB7 A;  2PI2 E;  4H02 A;  1IBL L;  3AYH B;  3U4Z A;  1FGU A;  4DPG A;  2IT1 A;  1HZC A;  1RL2 A;  2UU9 Q;  1N32 Q;  3PIO A;  1L0W A;  4YWL A;  4DUZ Q;  3HOY G;  1X56 A;  1GO3 E;  2C35 B;  4OO1 G;  1X3F A;  2EXD A;  3KJP A;  5C0X I;  4X66 L;  4LFC L;  4DV6 Q;  1XPU A;  2PNH A;  4JI8 L;  1N34 Q;  1BBU A;  1J6Q A;  1Z47 A;  2KBN A;  4UP7 A;  1HNZ L;  4LF7 Q;  1TWC H;  3CCL A;  2NZH A;  1YHB A;  5M3M H;  1FVI A;  3K80 C;  1YEZ A;  4X65 L;  1Y1V G;  4ME3 A;  4DV0 Q;  1Y1W G;  1K73 C;  1KC8 C;  1KQS A;  3S17 H;  4IOA A;  2F52 A;  2IX1 A;  4L5S A;  5LMU Q;  4DV2 Q;  3GTL H;  3M4O H;  1VQB A;  4POF A;  4YHH L;  1LYL A;  1XJV A;  1NMG A;  5HGQ A;  1XPO A;  5GAH C;  1XNR Q;  3EN2 A;  3OYY A;  4QIW E;  1XNQ Q;  1QVF A;  1OXU A;  4HIK A;  2R93 H;  2MQH A;  3OTO L;  4DR3 L;  3DLL A;  4GNX B;  1J5E Q;  2D0O A;  5M5X H;  2JEB I;  3F1Z A;  4YY3 L;  1TWH H;  2ZM6 Q;  4DV3 Q;  5FLX c;  3T1Y Q;  2K14 A;  2D0P A;  2XTI A;  1UE7 A;  1X65 A;  4MZ9 A;  1YNX A;  4L5T A;  1BBW A;  1B7Y B;  3T1H L;  3CCJ A;  1A63 A;  1SRU A;  3PF5 A;  4OWW B;  3CCS A;  5H1S E;  1SRO A;  4DR1 Q;  2I5H A;  1K9M C;  4OX9 Q;  3J7A 5;  2PQA B;  3H3V H;  3K8A A;  4TVA B;  5IT9 c;  3SGI A;  1OXS C;  1KL9 A;  3PO3 H;  2R6G A;  1S3O A;  2QA4 A;  4HIM A;  4JYA L;  5M3M G;  1C0A A;  5E7N A;  1NY4 A;  3PIP A;  2QEX A;  1NMF A;  1HR0 W;  3E9I A;  4X6A H;  2I5M X;  4X62 L;  1PVO A;  5IYC H;  1Q1E A;  5FLM H;  2ZJP A;  2A1A A;  4JV5 Q;  2WP8 J;  1UEB A;  2NN6 G;  3G48 A;  3IRB A;  4DAY B;  1SN8 A;  2BA0 A;  2HIV A;  2K4K A;  3GTO H;  4GKJ L;  3TEH B;  1GD7 A;  1N33 L;  2OCE A;  4A3I H;  4JBJ A;  3W5O A;  2R93 G;  2N8N A;  4GLA C;  2YV5 A;  4DV4 Q;  3S2H H;  2VW9 A;  5IE8 A;  4LF6 L;  1N36 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...