4A3IG

Rna polymerase ii binary complex with dna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3iG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3iG01
4JG2A 5M5XH 3UDIA 3K8AA 3CP0A 5LMUQ 4BBSG 1YNXA 2UXBQ 1B70B 2B29A 1A0IA 2EQSA 4JI0L 2OQ0A 3GD7A 1YHQA 3GTOH 4DR6Q 3E0EA 3HOXG 1WJJA 4GNXA 3PO3H 1Y1VH 4JI2L 3PSIA 4DV3L 5AJ3L 3CCSA 1VQEA 3CQZH 4NXML 2JEAI 2Y0SE 1FVIA 1IBMQ 4QQBX 1Q1EA 3I55A 1N33L 3W1GA 5GADC 4A3LG 1UWVA 2WB1G 3CXCA 1K9MC 2VNUD 2Z0SA 3HKZE 4B3RL 2LXKA 3I56A 1YIJA 3H15A 4KHPL 2UXCL 2JA7G 3L7ZC 5HGQA 4YHHL 1SE8A 1IBLL 5DLQE 1VQ6A 2R92G 5LMNL 3S1QH 1E24A 1IZ6A 4OWXB 4C3IH 2ZM6Q 1X55A 2NZHA 2QEXA 2YTVA 1WCMH 1WFQA 4A3KG 1N9WA 1XMOL 1MIUA 3W1BA 4ALPA 1D7QA 2D0OA 3IRBA 2KENA 2ZTEA 4R4QA 3CPWA 2R7DA 4YCWA 3G6EA 4BBRH 1Q12A 3RZOH 2YTYA 5IYCH 1E22A 4B3MQ 1C9OA 1MJEA 5C0XJ 2Q2UA 5LMNW 4YY3L 2QA4A 1TWCH 4DAMA 2B63H 2B3GA 4IJLA 2CWAA 1PH4A 1W2BA 1OXVA 3RR5A 2KBNA 5IYBH 3ZJYC 4OO1G 3GTQH 4A3IH 3HKSA 2VQFL 4HIKA 4A3EH 1X9NA 4R4IA 1U5KA 4A3MG 1HNXL 2E2IH 1FJGL 3GTJH 4A3GG 3W5OA 4GNXB 1AH9A 4JI1Q 3NBHB 1PFSA 2R6GA 4P72A 4GNXC 2JA8G 5FLMH 2ES2A 1HZ9A 1NE3A 4PZ8A 4JI0Q 1I3QH 2ZJQA 4BXXG 5GAEC 4LFBL 3Q8DA 4HJ8A 3PO2H 2NZOA 1EIFA 5IYDG 3MXNB 4JI2Q 1GD7A 1OXUA 1VQBA 3EIVA 4GN4B 1L0WA 1MKHA 1YVCA 5AJ3Q 1YEZA 4NB3A 1PHJA 4NXMQ 1JJCB 1PA6A 1N32Q 2EIFA 1N33Q 1EQRA 4HJ9A 5LMUL 4PZ7A 2Z6KA 1VQMA 2MQHA 5J3BA 1VQ8A 1EWIA 4JI4L 2I0QA 1Q8KA 1PYSB 3BJUA 5FJ8H 3PIOA 3MEFA 4FDBA 4C3JH 3KYHC 1Q81C 4DR6L 3T1HQ 3RLFA 1PH2A 2R93H 4GN3B 3RLNA 5IP9H 5C44G 2D62A 1VQAA 3CAMA 3I4MH 5BR8Q 1IBML 3UDGA 2VL6A 1HNWL 2WP8J 4MTNA 1AE3A 1X6OA 2I5HA 2NN6G 1N34Q 3PUYA 2C35B 4IFDI 2K5VA 4DV7L 4DV6Q 2KCMA 2HHHQ 1HH2P 5H1SE 5K36G 2HIVA 2Q2TA 2IY5B 4GLAC 3HFZB 3M4PA 4IPHA 4LW1A 5C3EG 4JI8L 4YY3Q 1LTLA 2ZM6L 3ULPA 3T1YL 4IOAA 2CQOA 1S3OA 2F52A 2Q2HA 4Y52H 2CFMA 1JMCA 3HOYH 1G51A 3A0JA 2OCEA 2VQFQ 3ULLA 4A3FG 1JJGA 1QZHA 2AHOB 4NPSA 4R4TA 3RN2A 4QL5A 1SFOH 1ASYA 3HOZH 2PQAA 1TXYA 2NVQH 1SRUA 2XTIA 4DR5Q 2ZTDA 4DNIA 4JI5L 2MO1A 4LUOA 2JA6H 3PF4A 4B3TL 2UUAQ 4LF9Q 4DV1Q 4TVAB 3H0GH 5EAYA 5GAGC 1GO3E 4TQUS 1KHIA 2GN5A 2BH8A 2A8VA 2R7ZG 1YHBA 2OWOA 1PH8A 1JB7A 4LFBQ 2N3SA 1Y1WH 3NEMA 1RIPA 2Z6KC 2YU9H 4HIDA 4DV2L 3A5ZB 1VQDA 4XIGS 1B8AA 2IX1A 4QJFA 1VQNA 3J7ZC 2WAQE 4JI1L 1K8GA 1VQLA 3M85A 4LFAQ 1CKOA 4LF6L 4R4OA 1R9TH 2MO0A 1K73C 4OONA 1QUQB 4JI4Q 4RMFA 1T9HA 2ALYB 1Q1BA 4NXNL 1C7YA 4LF7L 2LSSA 4ME3A 2UUCL 2IX0A 5JJKA 1QVGA 3M4QA 2CCZA 4X66Q 1Y1VG 1VCIA 1X65A 4LFCL 3ULJA 2VQEL 2E2JH 3STBD 1GKHA 1RL2A 3J80i 1HNWQ 1N32L 2H5XA 1JJ2A 5IE8A 1GVPA 1TWFH 4UPAA 3CCEA 3U50C 5JEAJ 4DV7Q 3U58A 4DR3L 3RNUA 2N78A 2ATWA 2R7FA 4IO9A 1TWAH 2PI2E 2RHSB 4JBKA 1M1KC 1NMFA 2WFWA 3T1HL 1NBWA 1VQGA 3HOVH 4QIWE 1B7YB 4JI8Q 3T1YQ 3K80C 3TS0A 2ASBA 1LM0A 1UE1A 3HOUH 2Y0SG 2PQAB 5M3MH 3S1RH 1D8LA 4DUZQ 1CKNB 1GM5A 2UXDQ 5BR8L 4WJ3M 3G48A 1WCMG 3E9IA 4AYBE 3HKZG 4EQ5A 4A3BH 1L1OA 1X3FA 4K0KQ 2KCTA 4OWWB 4MZ9A 3PIPA 1N34L 4DR7Q 5C0XG 4A3JH 4A93H 1KL9A 5GROA 4DV6L 4QY7A 2HHHL 4GKJQ 3L0OA 1FL0A 5IYCG 3PV0A 2AWNA 2JA5H 1HZCA 4JI5Q 1VQ9A 3ICEA 4DKAC 4JCVE 3PUZA 3CMEA 1SR3A 4O0AA 4GN5A 4B3TQ 2R92H 3AFQA 4JV5Q 3CPFA 2B63G 5GQOA 5C4XH 2MNAA 2I5MX 2BA0A 4GLXA 1XPOA 1QZGA 3D31A 4IPDA 1YHAA 5IYBG 4UY8C 4A3EG 3FP9A 4A3IG 1OXTA 2F4VL 3AYHB 4DV2Q 1XMQL 1EOVA 4YCVA 4A3CG 1OXXK 2VZAA 4DR5L 2JEBI 4JC0A 2NVXH 4IFDJ 3GDEA 2UUAL 4LF6Q 2ID0A 1BVSA 4YCUA 3J80c 4DV1L 4LF9L 3GTGH 1H95A 1JT8A 1UEBA 3U4VA 5FLMG 4LUVA 4LF7Q 1JE5A 1NMGA 4NXNQ 3L2PA 2UUCQ 4QGUA 4H02A 5GAHC 3AEVA 1WYDA 3TRZA 4LFCQ 3F8TA 3UE0A 3ER0A 2VQEQ 2VUMH 1VQOA 1CSQA 3B6YA 5ELNA 3CCUA 4A3GH 3OTOL 3K0XA 4LFAL 4DR4Q 4P73A 4LF8L 4JBWA 2PMZE 4DR3Q 1SN8A 1EYGA 3HOWH 5FJ8G 2IHFA 2CKZB 1P16A 3CW2C 1L1OB 4BA1I 1FGUA 1Q82C 5E7NA 2JA8H 1NJIC 3E9HA 4X66L 4DAYB 2R93G 2HIXA 1L1OC 3FKIH 5IP9G 5FLXc 3PGZA 4C3HH 1XPUA 1UE5A 4WJ4A 5M5YH 1VQJA 1QUQA 2JK8A 3I4MG 3G4SA 3I4NG 4HIOA 4X62Q 2HT1A 4DR2L 2D0PA 1I94L 3J81c 1SLJA 1VQPA 1CUKA 3AQQA 4PMWA 2LXJA 4LWCA 1SROA 1V1QA 1LYLA 3K81C 3RLOA 1Z9FA 1J6QA 4DUYL 1XJVA 1PVOA 3F2CA 3VDYA 1EUJA 3A74A 4DUZL 2UXDL 3KF6A 4DV0L 1C0AA 4K0KL 3HOYG 1EQQA 4OX9Q 3PCOB 1A62A 2VS1A 4DV5Q 2F4VQ 4GKJL 1X3GA 4EX5A 1XMQQ 4A3DH 2EXDA 3CD6A 1CKNA 4OO1I 1KC8C 2K5HA 3I2ZA 2JA6G 4HJAA 3CMAA 3S2DH 2Q2IA 2JJQA 4MNOA 4LF4L 3EBEA 3H0GG 4JV5L 2QGQA 4J15A 1XNQL 4OWTB 3GTPH 4GOPB 1G291 1Q46A 1BBWA 1L2FA 3EN2A 5IP7H 3CCMA 1TWGH 1Y1WG 4A76A 3S24A 2UUBQ 1VQ4A 1HZBA 2RF4A 4KHZA 5M3FH 4BY1H 3F1ZA 2GVBA 4JOIA 3CCRA 1K0RA 1VS0A 3UDFA 3S16H 2GVAA 3GTLH 3OTOQ 2MFIA 5IY0A 4LF8Q 1KRTA 3PUWA 4JI6Q 2JQOA 2N49A 1PYBA 4L5QA 4B3SL 4JBJA 1IBKL 4JYAQ 2KHIA 4YWKA 4AIMA 3PO3G 2FXQA 4BY7H 1PH7A 4LUZA 5JEAG 4DV4L 1N8RC 2WAQG 1KD1C 3PUVA 4DR2Q 4IOCA 1PH1A 1I94Q 1BKBA 1CSPA 4JBMA 4DR4L 4AQYL 3KF8B 3CCJA 3NELA 1XPRA 3KF6B 1PH3A 1KAWA 3DM3A 2PI2A 5HY6A 3F2BA 2ZJPA 3KLWA 3RN5A 1BBUA 5IWAQ 2RCNA 3JAMi 4BBSH 3OW2A 2WB1E 2NN6I 4C2MH 4DUYQ 3HOVG 1W3SA 1PV4A 3KDFA 3G71A 1PH6A 3HOUG 1YBYA 4JI7L 4RG1A 2BH2A 4BA2I 5M3MG 3HOXH 3PUXA 3H3VI 1HJPA 4DV0Q 1G6PA 4X62L 4OXPA 3J7A5 4A3BG 4L5TA 1KIXA 1Q86C 3GTKH 1OTCA 4A3JG 4A93G 3ERSX 5JJIA 2IT1A 2NVYH 4BBRG 4A3LH 1VQ7A 4GKKL 2AWOA 2ZJRA 2JA5G 2JA7H 3A5UA 3M3YH 1PH5A 4LF4Q 2YV5A 1HNZL 1YJ9A 2YTXA 4AYBG 3KOJA 1XNQQ 1X3EA 5C4XG 3J81i 1EIYB 4IFDG 4JOIC 4DV5L 4A3KH 4APVA 4KI0A 4UP7A 3SGIA 3CCQA 3S17H 1P8LA 3CF5A 2OTJA 3M9BA 1E7ZA 1V43A 4IPCA 3UDXA 3KJPA 2UU9L 1X54A 5M5WH 1KXLA 3S1NH 3FHWA 1HR0L 2ZTCA 2YYZA 1IL2A 4YWLA 4GLVB 1XNRQ 3KFUA 3S14H 1X56A 1J5EL 1U0LA 4UP9A 4KLKA 1E1TA 4B3SQ 3TEHB 1XNRL 4DR7L 1IBKQ 4DR1Q 3PO2G 2UUBL 1VQ5A 1YI2A 3JAMc 1ASZA 4XTCS 2JE6I 4X64L 4L5SA 2VUMG 3TS2A 4DV4Q 4A3MH 3TQYA 4X65Q 2CWPA 1S40A 1NY4A 4IPGA 4GOPA 3KDFB 2DUDA 3WWVA 4A3CH 4AQYQ 1VQFA 1HR0W 4JI6L 4JYAL 2HQLA 1Z47A 3GTMH 1WOCA 4IJHA 3HOWG 3S2HH 1A63A 4X6AH 4HJ7A 4OX9L 1I5FA 2A19A 5C4JH 4HJ5A 1N36L 1HZAA 3FKIG 2N8NA 2VY3A 1KQSA 3CC2A 4LF5L 4BXXH 1I6HH 4JI7Q 2K52A 2K50A 4P74A 1QVFA 2E5LL 3J81j 5IYDH 1TWHH 4P71A 4JI3L 3TREA 4DV3Q 3BU2A 3S1MH 1OXSC 1VQKA 1VQHA 1UE6A 3M7NA 4GS3A 1XTDA 2E2HH 4A4IA 5IWAL 3F2DA 4GKKQ 4B3RQ 2DGYA 4DK6C 2UXBL 4LNQA 5JJLA 5C0XI 4KHPQ 2UXCQ 1IBLQ 4YHHQ 2VW9A 1HNZQ 4POFA 5LMNQ 3BZKA 5C44H 3STBC 2RHQB 2IHEA 1AE2A 3I4NH 3PF5A 1WI5A 1XMOQ 4PG3A 1VQCA 2A1AA 3LGJA 1M90C 3HOZG 1VQIA 2BA1A 3CCVA 4A3DG 1EFWA 4DK3C 2UU9Q 1DGSA 4P75A 4R1JA 1O7IA 1E1OA 2AKWB 2OTLA 1Y14B 3CCLA 2NVTH 1QVCA 4UP8A 1HR0Q 3H3VH 2PNHA 1PH9A 3CC4A 3K7UC 1NTGA 3U4ZA 5C3EH 1J5EQ 4A75A 2K14A 5IP7G 1IYJB 1YZ6A 2AMCB 4YWMA 4Y7NH 3RZDH 4GOPC 3I7FA 3I4OA 1LUZA 5IT9c 3D0FA 2L15A 5M3FG 4DPGA 1YITA 4BY1G 4X64Q 4A3FH 1HNXQ 3S15H 2F3IA 1IXRA 1FJGQ 2K75A 3CC7A 2KHJA 4O2DA 3K7AH 1K3RA 4AH6A 4B3ML 1K8AC 3GO5A 1I50H 1YJNA 4R4CA 1MJCA 4L5RC 1E3PA 3NENA 1CKMA 1K83H 2V1CC 1KRSA 4PZ6A 4DR1L 1S72A 1Q7YC 1N36Q 3OYYA 3KJOA 2R7ZH 3M4OH 3BZCA 4LF5Q 2OQKA 4BY7G 2I5LX 1UE7A 3AFPA 1SMXA 2JA9A 2K5NA 2E5LQ 3UE1A 5ELOA 4X65L 2XGTA 2E8GA 4JI3Q 1A8VA 1V9PA 2K4KA 3DLLA 4HIMA 4POGA 3JC66 1YJWA
chains in the Genus database with same CATH superfamily
1C30A 3UDIA 3UFXB 3EJIA 1JCKB 5CA1F 3E5SA 5I47A 5LHY1 2QILA 3Q22A 4J9OA 5KT5A 3C1FA 2EYFA 4GC6A 1N36H 2LY7A 2R8JA 4NXML 2JEAI 1PZID 2Y0SE 1FVIA 1IBMQ 3KTMA 5F2DA 5COYA 3MA2B 5LL6b 3CXCA 4B3RL 3I56A 2YCHA 2NVXA 2L11A 3MXNA 1YIJA 3M9MB 2I80A 1ZXTA 5HGQA 4OELB 2ALZA 2R92G 3NWTA 5LMNL 1SE2A 2WV6D 3OIQA 3J7AV 5C4HA 3J81E 2ZM6Q 1RYSA 1JOOA 4JPBW 4NLGA 4WBNF 4IR9A 2YTVA 4A3KG 1N9WA 1PRTB 2JEFA 1EL0A 3IG0A 3IRBA 1L0XB 1V4YA 1KBLA 1LT3D 4RGOS 3G6EA 2UVVA 4U673 3MXGA 1SSOA 4K6DA 1Q12A 3D8GA 5EJWA 3RZOH 1E22A 4L63B 5KFJA 1C9OA 1MJEA 3HOXB 3EPIA 5C0XJ 3HEJA 2H1EA 4UCUA 2ZJTA 2VA3A 3I8ZA 2VXWA 3QIAA 4LF4H 1FNUA 2RSNA 2B3GA 1JR0D 3GTKB 1XNQH 3RR5A 1PYWD 3MJFA 3ZJYC 4OO1G 3GTQH 2CH4A 1HNXL 4K5WA 4UCRA 3GIIA 3GTJH 4A3GG 5FO9B 3ETHA 2Z4HA 1ILQA 3CHBD 3CRLC 2EDGA 1M4VA 3LMLA 3NBHB 2R6GA 4P72A 4GNXC 4QW8A 5LOVF 2E2HA 5FLMH 4WORA 4RWSC 1I3QH 2ZJQA 4K8IA 2EYJA 4E6IA 2NZOA 2NZ1D 1EIFA 3R5FA 5IYDG 3MXNB 1LTGD 3ITPA 4CC6A 1VQBA 4DR1H 3EIVA 1L0WA 1YEZA 4NXMQ 3RAQA 1SXTA 2J6SA 4HJ9A 1VQMA 1GUTA 5H80A 1Y8OB 1TWCB 5J3BA 1STAA 1QWYA 5FJ8H 4ZK9B 4AQYH 3M4YA 4FO2A 3KYHC 1EYZA 3T51B 4DR6L 2R85A 3PZPA 3C46A 3NUCA 4EBCA 3A8KE 2KVMA 5C44G 2D62A 1BCPD 1UNSA 1M8AA 1MGSA 2B2VC 3I4MH 2ZXRA 2CZGA 1NAPA 1SMYC 4F88A 2FMAA 2I5HA 1QNKA 5IGEA 2NN6G 4K8JA 3PUYA 5IGFA 3RBEA 1JKJB 3SK4A 3MTSA 3RB0A 2KCMA 5C4JB 1HH2P 1I6HB 3HB9A 3I90A 2W9BA 4LW1A 4B3RH 3T1YL 3ULPA 1AUVA 4KJNA 5LXTF 2F0KA 1S3OA 5KT3A 1KAAA 2CFMA 5KFAA 1JMCA 5LMNH 3DF7A 3K5IA 5JH7F 1EWHA 1JJGA 2E2HB 3K0YA 2BOSA 4Y8VB 4HCSA 3HOZH 4I7ZC 4KY7A 2VB3X 4JI5L 2RQXA 2F0IA 2ASDA 3Q2OA 3MR5A 2K33A 3V2TA 5KYLA 1Y8PB 1JB7A 2OWOA 4O3OA 3GTOA 2F0OA 2Z6KC 4HNVA 2YU9H 1V1OA 1ICWA 2VUGA 5EPJA 1VF5C 3CQZA 4X64H 4QJFA 1HNXH 4Q8FA 2W6MA 3H6MA 1K8GA 1H9KA 4LF6L 1RCVD 3MEHA 4LFAQ 1R9TH 5KFLA 1JX4A 4OONA 4WRDA 2ALYB 4NXNL 1C7YA 2UUCL 5CV6A 3KAJA 4HR7A 3HP3A 4OX9H 1Y1VG 4LFCL 4XXEA 5FD6A 5JEAH 2Y0SA 1EYAA 2SCUB 3STBD 2W9BB 1GKHA 2EY2A 1WCMA 2JA6B 1TWFH 3CCEA 2KQ3A 3RUZA 3U50C 5FD5A 4YJ2F 3U58A 1UUPA 2FFKB 2N78A 2ATWA 1ICFB 1MBYA 1TWAH 1LTRD 3T1YQ 1EU4A 3EQLC 5EKKA 1GM5A 1WD1A 5BR8L 4WJ3M 4DR6H 3E9IA 4K0KQ 1DIKA 1BOSA 3HKZG 3IFDA 4EQ5A 4A3BH 5M5XB 5C0XG 2CW8A 2NU6B 1M0WA 2AQ1B 2AUJD 5IYCG 3PV0A 1SYCA 3GTOB 2AWNA 3IFTA 4JI5Q 1G2TA 3MXUA 3VYSA 4ED7A 1K8MA 4O0AA 1DV1A 4JV5Q 3JZIA 1EY9A 3CPFA 5L1IA 2MNAA 2F3VA 2I5MX 1F9QA 4IFDH 5DEHA 3D31A 1PXUA 1YHAA 3K6OA 1QB5D 3FP9A 4A3EG 1PZKD 1OXTA 2F4VL 1SEIA 3Q23A 1JC7A 3A8IE 2EVBA 1IW7C 1OXXK 4A3CG 2NVXH 2PCFB 4JC0A 5DG7A 4R8IA 2B2WC 3K5NA 1SYDA 1GSAA 4LF6Q 1BVSA 3R5XA 2Y0SB 3MR2A 3VPBA 1UEBA 5KKNB 2ASLA 4NXNQ 1JE5A 2V4QA 1WCMB 3MVVA 1HCZA 2UUCQ 1WYDA 4A93B 1STHA 3C0FB 1ONLA 4LFCQ 5KT6A 1FR3A 4BBRB 2VUMH 1VQOA 2YYAA 1I4XA 4CC5A 2R7MA 3H4BA 2F0GA 4LF8L 2L0CA 2PMZE 1KTKA 3SEBA 4BA1I 4ABNA 1FGUA 1VBGA 5E7NA 1WTRA 2A74C 1NJIC 3E9HA 4A3IB 2A6EC 5IP9G 4OEMB 2L12A 4TV9F 4GC7A 1CTMA 4YP3A 3G4SA 2JEGA 4X62Q 4DR2L 2K6AA 3J81c 1VQPA 2Q8IB 1OWTA 1SYGA 4XX0B 1PRTD 4RUCA 2LXJA 1SFOA 1V1QA 1HUMA 3TBIB 1I50A 1O7YA 4DUYL 3MFYA 1PVOA 3F2CA 5E4XA 2PW5A 2UXDL 1KABA 1TS5A 3KF6A 3H0GA 4ODGA 4M7EA 3OOCA 3PCOB 5DG8A 1EY0A 1Y1WA 4DV5Q 2F4VQ 4RB0A 1EEID 4GKJL 1E4EA 2TSSA 5BR8H 4EX5A 4A3DH 2EXDA 2NWGA 3AB9A 2RDGA 3EPGA 4OO1I 2JA6G 3S2DH 2Q2IA 4OHJA 3V6KA 2KHSA 1B6RA 4FS2A 2XSCA 2JN4A 5JVDF 1ENCA 1L2FA 3SVMA 3FDTA 1KEEA 1LT6D 3EFXD 4K5XA 4DF7A 4A76A 2UUBQ 1VQ4A 2AGOA 2RF4A 4HSPA 3BG5A 3D6WA 4JOIA 1EFID 5C5LA 3MFHA 3UDFA 1CQJB 2F0VA 1ZYRD 2K01A 3RD4A 3VR6A 3GTLH 4X3TA 2MFIA 4LF8Q 4GZYC 2PBZA 2IJ0A 4ZQIA 2K5DA 5JJZA 4B3SL 4FBUA 4F7XA 3Q1KA 3R5HA 4EVOA 2FXQA 4DL7A 4IUNA 4ILWA 1CA5A 1HUNA 2WAQG 1KD1C 1QJOA 3PUVA 4DR2Q 1PH1A 4JBMA 3QZ7A 4DR4L 2O03A 5DGAA 3H0GB 1XPRA 3KF6B 1PH3A 1KAWA 2ZJPA 3KLWA 1EQVA 3GTPB 3L4JA 1BBUA 4DNTB 5KG5A 2RCNA 2NN6I 4C2MH 1Y1WB 4ZAIA 4DUYQ 4LF8H 1CQFA 1E4EB 2V58A 1PH6A 3OHXC 1K3BC 4JI7L 2BH2A 1RJPA 1T3NA 2Q8TA 2FK3A 4UAIA 4OXPA 2QKIC 2WE6A 5KG0A 1DOMA 5C3WA 4O2AF 4O2BF 3PN1A 1F2LA 5C5JA 1MD2D 4A93G 2E2DC 3ERSX 5ELBA 4ED1A 4A3LH 4BBRG 4EQOA 5EWFA 4ED2A 3P7JA 2AWOA 2JA5G 4YAJB 2B39A 3QOJA 3A5UA 1CHPD 5KFPA 2JEJA 3M3YH 1HNZL 3H09A 1STNA 1CM9A 3KHRA 2KEEA 3MWDA 2C2DA 2B2UC 4NKLA 1BCPC 2E2JB 3ERQA 4Q45A 3GTGA 2V9WA 3NTIA 1EIYB 2EY5A 1BCPF 1S68A 4FXGC 4APVA 2W6NA 2WACA 4UP7A 3SGIA 4DL3A 2UXDH 3CF5A 3R8BA 1N48A 2O5IC 1F2YA 1V43A 2L55A 4IPCA 3UDXA 5KNBA 1HR0L 2ZTCA 5D3IB 3HOUB 4YWLA 3HGBA 4GLVB 4GKJH 5M3MB 1J5EL 1U0LA 1RK5A 1EY8A 1E2VA 4UP9A 4B3SQ 4O3NA 1TAEA 4A3JB 5DQGA 3NPPA 3DUZA 1ASZA 1G2SA 4XTCS 2F0WA 3TS2A 4ECQA 4IPGA 2JA7B 2PMZA 1VQFA 4DV2H 4JI6L 2HQLA 1Z47A 1EIGA 1WOCA 1A63A 2IWHA 5D8DA 5CV5A 1I5FA 2W9CA 4JYAL 3GLKA 1HZAA 3FKIG 4BXXH 3OSNA 4LF5L 1EYCA 1LO5D 4JI7Q 1GHJA 3NSWA 3FPUB 4JI3L 1J8IA 3OSOA 5FOBB 3BU2A 1O80A 5I6YA 3GTGB 4K2LA 4XDXA 2AQ3B 1OXSC 1WTOA 5EDWA 5EBCA 4O4LF 1XTDA 5KX5F 4A4IA 5IWAL 1R4QB 4F50A 4DR4H 4LNQA 5EGTA 5C0XI 5KG7A 1S5FD 5FLXL 1HNZQ 3BZKA 1KLUD 2ZT9C 3STBC 2RHQB 1N56A 4IALA 4KKTA 3QFFA 2XCPA 2RGRA 2HCIA 4R8NA 2GPWA 3S2HB 2PVPA 2JA8B 1DGSA 4P75A 2OTLA 1Y14B 4FNFA 1QVCA 4UP8A 1HR0Q 4APMA 2PNHA 1DV2A 4CJ0B 4C3HB 2CHBD 3U4ZA 1J5EQ 1BQQT 4S3SA 4G57A 1TWHB 3QR8A 1XDNA 5BPFA 3N6XA 1IYJB 2PMZB 1CZWA 4GOPC 3I7FA 3I4OA 1UEAB 3WOFA 1HNZH 4K14A 3BDLA 1YITA 4A3FH 2EY1A 2RVLA 1WVLA 2AU0A 2W9CB 2K75A 2W6ZA 3DHQA 1ET6A 2FKLA 3K7AH 3LP8A 2FLLA 4AH6A 1I50H 1YJNA 1EIHA 3LWUA 2DWCA 3BZDB 4ZRZA 3BS1A 1HR0H 1K83H 2OTJA 1KRSA 4PZ6A 5EWEA 3NXWA 3BZCA 4LF5Q 2OQKA 4BY7G 1HTPA 2RSOA 1DYQA 4J0MA 1S0MA 4JI3Q 5DLFA 1V9PA 4IQZA 3S1RH 5KFRA 3KJPA 2NUCA 2VQDA 4N8X1 1BO0A 1S10A 2FP4B 5LMUQ 1H9SB 1YNXA 3OTOH 2HDLA 3T13A 4JI6H 4F87A 3GD7A 1YHQA 2A68D 5KYIA 1PFBA 3H20A 3T5JA 2R92A 1WJJA 3PO3H 3S15B 4JI2L 1IL8A 5EKLA 3PSIA 3N52A 4JYAH 3S16B 5AJ3L 3CCSA 2BR0A 4LF5H 4FXDA 1NUCA 3MWEA 3QWNA 3OWEB 4KKUA 3W1GA 1N33L 2W8KA 4ECTA 5L1LA 3HKZE 1KJQA 3KHHA 4J9NA 2LXKA 2K05A 1EY5A 2UXCL 5ELCA 2JA7G 3L7ZC 4YHHL 5DLQE 3S1QH 1WTPA 3DWPA 5IWAH 4L8JA 1IZ6A 4DL5A 2PO4A 1X55A 5JUMA 5HURA 1Y8NB 3QOLA 3R93A 5KFEA 5J2TF 3GILA 1SNDA 3BYYB 4ALPA 1D7QA 4FXKC 1PRTC 2KENA 4R4QA 3T5HA 2R7DA 4CHTB 1HHVA 1O75A 1DXMA 1SNOA 4NW2A 5CBEE 2R8KA 4E4TA 5LMNW 4JVZA 2QA4A 1M6VA 2B63H 2F1MA 2KBNA 5IYBH 1ZKOA 3H94A 1T5EA 1KXLA 4HIKA 3WO0A 3GV8B 2AQ2B 1U5KA 4A3MG 3HBLA 2G9HD 1IKLA 3KBXA 4ED0A 3W5OA 5L9XA 3BJYA 2F0LA 1JQYD 2K7VA 2ZDQA 1PFSA 2JA8G 1BR9A 2ES2A 5JAVA 4X3UA 1Z2PX 4A3KB 4XYMB 2F0MA 3S17B 1H9JA 3Q8DA 3PO2H 5HV6A 4JI2Q 2BQUA 1OXUA 4B9WA 1KJ8A 4GN4B 4IUVA 3KUPA 5AJ3Q 1ZYRC 3A55A 4NB3A 5CB4F 5KFNA 1PA6A 1A3TA 1N33Q 1PTOB 4KY5A 4A2AA 3CKIB 1PMRA 2MQHA 1M0TA 2DIKA 1EWIA 1NNXA 3BJUA 4IUPA 4C3JH 3KHLA 1PH2A 2R93H 3RLNA 1I6VC 2J0TD 3NP8A 4DAVA 4ZCKA 1VQAA 2QDBA 1T94A 3RGZA 1IBML 2VL6A 1HNWL 2J7ZA 5CV9A 4MTNA 1AE3A 1X6OA 3LWBA 2R3ZA 4JI2H 4UCTA 1SDFA 2M00A 2K5VA 3N41B 5F9NA 2EPBA 3X3NA 5CAEB 2IY5B 2AUKA 3HFZB 4DNRB 2IL8A 5C3EG 4JI8L 2ZM6L 2NBFA 2CQOA 2R7LA 1HXYD 2UXCH 1FNVA 4YHHH 4FVMA 3S1MB 4ED8A 4B9XA 3C2PA 1G51A 2OCEA 4NMZA 2JYOA 4TRDA 2ATLA 2AHOB 4R4TA 3RN2A 4QL5A 1SRUA 4DR5Q 3V6JA 1M7JA 3BVZA 5C44B 4B3TL 4JK1C 2UUAQ 4DV1Q 5GAGC 1GO3E 1KLGD 2GN5A 5A2QW 2A8VA 2R7ZG 3I4NB 1YHBA 1AN8A 5KFOA 2QYZA 3NEMA 2C5CA 1XNRH 3GIPA 4DR7H 2NVTB 5CV7A 4RHSA 4XIGS 3OW7A 3LWEA 4EQPA 3H3VC 2EYHA 1LT5D 2WAQE 2LS01 3JAME 3M85A 1CKOA 4I65A 5D14A 3G6VA 2MO0A 3RZDB 1S9FA 2P5ZX 4Y7NB 1Q1BA 2RCFA 5AFWA 3C1EA 5I9OA 4X66Q 1PDQA 2TMPA 2FMCA 5CV4A 3NBHA 3N43B 1WH2A 1RL2A 1SJED 3TZDA 1HNWQ 2ICIA 2H5XA 1JJ2A 3HKZA 4N9PA 4UPAA 5JPNC 5JEAJ 4DR3L 3RNUA 1I7NA 3TP8A 4JBKA 2KCNA 2RHSB 5L37A 1JICA 1UAPA 1VQGA 5KRUA 3HOVH 2ASBA 1L2ZA 4JI8Q 3K80C 1LM0A 1H9RA 2YU9B 1XWEA 1TWCA 1SYEA 4RA8A 1CKNB 3E6ZX 4DUZQ 1GUWA 2KOLA 3G48A 4MA0A 4O3RA 3QG1A 5IOCA 1L1OA 4ZLTF 4IHJF 4OWWB 2MCTA 4FF3A 3I3CA 4DAYA 1W96A 1SYFA 5GROA 3IKJA 2E2IA 5C6AA 1IBMH 5G3LD 1HNWH 3RAXA 4I7HA 1NSNS 1HZCA 5C1OA 3WOEA 4B3TQ 1Y1VB 4EEQA 1Y69U 5BN5A 2R92H 4MV7A 4ECSA 4ECVA 5GQOA 4DL2A 5C4XH 1WTXA 4O3PA 4YJ3F 1QZGA 4IPDA 2ZM6H 4XQJA 3PIO3 4TV8F 3AYHB 1XMQL 4YCVA 4IFDJ 2YZNA 4C5CA 4K2KA 5IT9E 4ZQ3A 4ECXA 4J8QA 4QMGA 1H95A 1Q8IA 3PVXA 3VYRA 4LUVA 5FLMG 1F9PA 1I4RA 3L2PA 3HKZB 4QGUA 2RDHA 2CVRA 4JW0A 3KXYT 2K5WA 1JWSD 3VR4A 1KNAA 5CC4A 2QK4A 1RF2D 3UE0A 4QIWB 3HZXA 4J9QA 1S0OA 4UDUC 4A3GH 1A3UA 4LFAL 4P73A 2J6TA 4YQWA 4DR3Q 1EYGA 5FJ8G 2IHFA 3EYYA 1L1OB 2MGSA 2Z9HA 2O5JC 2RDIA 4DAYB 4A3EB 3Q8RB 4H0LC 2E2IB 5CR3A 3KAKA 1RODA 1SBBB 5M5YH 5CORA 2JK8A 5IIFA 4FF2A 3I4MG 3I4NG 2D0PA 1I94L 2YS7A 1I4QA 3FEWX 3C3LA 4RH6A 1IYVA 2AQ4A 4NXMH 4DLKA 2L4NA 1LYLA 1QE6A 3K81C 2CQYA 1Z9FA 2A68C 3FDSA 2JA6A 4IWXA 1EUJA 5A2QL 1RJRA 4EGVA 1KDBA 4PMCA 4DV0L 2FK1A 2ASJA 4K0KL 4ZKBB 3HS0C 1A62A 2OF1A 3Q8PB 2PZUA 3PMFA 1XMQQ 2NN6H 1JB3A 3OUZA 2C22A 2HQEA 3CMAA 5JPMC 1AP0A 4JV5L 4XYQA 4J15A 4OWTB 4CJ1B 4HMIA 2IP4A 1G291 1Q46A 5IP7H 3EN2A 1ZHSA 5E3FA 4QUFA 3S24A 1HZBA 2Z6BA 2GVBA 5D65A 3DWAA 3CCRA 1K0RA 2F0PA 1K1QA 3FRPB 2GVAA 1II3A 5I2YA 1HA5A 1D6EC 4KV6A 5CYUA 3ND9A 1XMQH 3I91A 4RGNA 2DJFC 2R7NA 1PTOD 4IUTA 4I55F 4CDEC 2EY6A 4AIMA 3CRKC 3GP7A 4QWBA 5FKAC 5KG1A 1I4HA 1MZBA 1PH7A 5JEAG 1TY2A 1RJQA 4IOCA 1QILA 1I94Q 1SJHD 2RA4A 3CCJA 1VKZA 3F2BA 4MN3A 4YB8B 1E4FT 3JAMi 4BBSH 1EUCB 3OW2A 1U9RA 4LFAH 2KSWA 2JA5A 1W3SA 3MFGA 1YBYA 1B2TA 2F0NA 3HOXH 4DV0Q 1GHKA 3K3VA 4X62L 1B53A 3J7A5 5I6WA 4A3BG 3RV3A 4L5TA 1KIXA 5BMVF 2UVRA 3GTKH 2QEJC 2R7KA 1AEXA 4UCSA 5JJIA 3KLSX 2J4XA 2CQAA 4P2CB 2WDTA 4HNUA 1W93A 4RGTA 2ZDHA 1YJ9A 3I73A 1OO9B 4AYBG 3RIZA 4NDXA 2WAQB 3J81i 4IFDG 3J7AK 4JOIC 3T1YH 4IR1A 5J39A 4DV5L 5KFTA 4KI0A 3RBDA 3CCQA 1P8LA 5KGUA 3M9BA 2F03A 4K0KH 2HVRA 2NU8B 4KKSA 2XVSA 3BVMA 3SK6A 5C0XH 1X54A 2UU9L 4ZHQF 2W9AA 5KFUA 3TN2A 3S14H 1ZHQA 4M8AA 1JOQA 4JI5H 5M9OA 2VPQA 1HQRD 1EZ6A 4NP5A 4J9MA 1ML0D 2UUBL 4JV5H 4OGQC 3JAMc 3FKIA 5DQHA 2LFNA 1TR5A 5ELFA 4L5SA 2VUMG 3RB4A 4X65Q 1GUNA 2JA5B 1WTWA 2AGPA 3WWVA 4A3CH 1HR0W 4TUYF 2XWJB 4CGYB 5KFHA 4IJHA 5KG3A 4C5BA 3KALA 4HJ7A 4DA2A 3BVGA 4LF6H 2A19A 5C4JH 4HJ5A 1RDPD 3A54A 1KQSA 2N8NA 2C2EA 4DK1A 1I6HH 2UVWA 4NXNH 1EY6A 2K52A 1KNEA 3JAML 2E5LL 2UUCH 3J81j 2IA6A 3J7YW 1S5BD 4P71A 1LTAD 4QWAA 1AZQA 3VPDA 4OIKA 4DV3Q 2V4RA 3CU7A 4EYIB 1TS3A 4LFCH 2R8HA 3GTKA 1FGBD 1O78A 3M7NA 4XZ3B 2WINB 4JV1A 5ELDA 2E2HH 3BA8A 1PK8A 2DGYA 1TKWB 3P1HA 4KN4C 5JJLA 4KHPQ 1IBLQ 1D5XC 4TKOB 2OH2A 4XT1B 5J22A 3GTPA 4ME6A 1CZGA 2A6HD 1LT4D 1TVXA 1TWGA 5F9LA 1WI5A 3SE7A 1XMOQ 2PZTA 2N88A 3LGJA 3J81L 1VQIA 2KUMA 4A3DG 4X62H 2JP1A 2UU9Q 5DGBA 3CCLA 1O7LA 3H3VH 1MSHA 3FKIB 5K36H 3OUUA 4KK7A 5FPRA 2HD3A 1CS0A 2E76C 1HA6A 2FJZA 5FLXW 4MTKA 2OLSA 4YWMA 4LJZC 3TMEA 5IT9c 3D0FA 4DFAA 4DU9A 2IMWP 3N40P 5T1IA 1IXRA 1FJGQ 3CC7A 3G6JB 2KHJA 4DV5H 2F4VH 1K3RA 4B3ML 3GO5A 2EZVA 1E3PA 3BA9A 3GV5B 4G3IA 1ESFA 3NENA 1K9MC 2FK2A 4PWQA 1W6KA 1C3OA 3R23A 5DQIA 4H13C 3TQ1A 3HG9A 3AFPA 5LL6X 2K5NA 3J80E 3UE1A 2CW0D 2E5LQ 3PW4A 5HBRB 2BCOA 2BE5D 1CFMA 2UUBH 2K4KA 4HIMA 5L1KA 3JC66 5M5XH 4FM9A 3CP0A 2NVYA 2VR1A 4U7CA 1TWGB 2F0TA 1A0IA 4HSVA 2OQ0A 5BPHA 2JA7A 4QF4A 4PMBA 3GTOH 5KFSA 4F4WA 2W6QA 3K7AB 4UHVA 1VQEA 3CQZH 4X3KA 4MV9A 4DGZA 3I55A 4A3LG 1UWVA 2WB1G 4M1UB 2VNUD 2YS6A 2Z0SA 4DR2H 4ID6A 1GUGA 2XIWA 3H15A 4J9RA 2FE3A 3GIQA 1D5ZC 1SE8A 5KNDA 4BY7B 1V51A 1SEBD 2M9VA 1CHQD 4J6HA 4OWXB 4C3IH 3RB3A 4DUYH 2QEXA 2HVSA 5ELEA 1YNND 1WCMH 2W7OA 1LV9A 2D0OA 5KFCA 2FPGB 2HUGA 3ONAB 4BBRH 2FB9A 4RCOA 2PNRC 5FO8B 4B3MQ 2Q2UA 1JDBB 5KEEA 4YY3L 1B3AA 3EROA 1ILPA 4IJLA 1EU3A 4PV1C 1OXVA 2WYOA 2NVYB 3D4WA 4YR2A 4A3IH 3HKSA 2VQFL 1X9NA 2R84A 3M9OB 4LMQD 5FK9C 1SE3A 1TWHA 2I07B 1SNQA 1AH9A 1F2MA 1A9XA 1DJRD 2PW7A 4JI1Q 4FYDA 4B3MH 4PZ8A 4BXXG 1B33N 5GAEC 4HJ8A 5KFZA 4IRCA 4B3SH 1IYUA 1TY0A 5M5WB 3S1NB 3DEOA 1A3VA 2EYPA 1PHJA 3G6XA 5KFFA 2KEDA 1N32Q 2EIFA 4MTDA 5LMUL 4PZ7A 1CK1A 1RHPA 4CKEA 4JI4L 1PTOC 4J9KA 1Q8KA 2B63B 1Z6HA 3PIOA 4EEYA 1LACA 3RB6A 2X6GA 3T53B 1Q81C 3T1HQ 1BUVT 3V05A 1DONA 4K5VA 3M9NB 4A3MB 3AU7A 1H9SA 3CAMA 1Z2OX 4JI7H 3U9TA 5KFWA 2DZDA 3VA7A 3UDGA 2WP8J 2C28A 1X3PA 1ET9A 3GTMB 3MR3A 2MPMA 1C48A 2F0QA 2DN8A 4UCOA 1N34Q 1JORA 4HTHA 4IFDI 4DV7L 1V8QA 4DV6Q 2HHHQ 5H1SE 2HIVA 2Q2TA 4H44C 3RUPA 4BS9A 3M4PA 5JVG3 1I6UA 4YY3Q 2VA2A 4R8UA 1D5MC 5I9PA 2Q2HA 4Y52H 1SYXB 2A69D 3HOYH 2R7ZA 1XYIA 2CW7A 2FJ2A 2VQFQ 4A3FG 1QZHA 4NPSA 2IPKD 1SFOH 1EYDA 1EQTA 1FD7D 2NVQH 4DL4A 2XTIA 4K6LA 5JVH3 5EZYF 3URYA 5EBDA 4LF9Q 4TVAB 3H0GH 3IAYA 4C5AA 1CQVA 3LNNA 2H4OA 4FF4A 2YZGA 1KHIA 5C4ZA 4PDBA 1BXTA 1J5EH 5KNCA 1Y1WH 3UQ8A 1RIPA 1KDAA 2HJWA 3A5ZB 2HVQA 2IW3A 3GIDA 5KFXA 5EPLA 3SE0A 1B8AA 2DY8A 5C3EB 1U4PA 1HFGA 3J7ZC 1ZQ7A 2R82A 1X32A 1K73C 4JI4Q 1QUQB 1T9HA 4LF7L 2V5AA 2B2YA 2DY7A 2LSSA 4ME3A 3I12A 2IX0A 5JJKA 1QVGA 3M4QA 4IWYA 2CCZA 4MIUA 3RFCA 2FINB 3NBIA 1VCIA 3ULJA 5T1GA 2F0JA 2VQEL 4O4HF 2E2JH 3J80i 5KFYA 2DJGC 4N9TA 2I46A 3FPPA 3I72A 3W3AA 2NU7B 4R8UB 1TQOA 4JI3H 4O42A 4DV7Q 4MTEA 2DPIA 2R7ZB 5IGDA 3M4OB 4IO9A 5KFIA 2PI2E 3ZYYX 1M1KC 1NMFA 5LMUH 3ND8A 4HNTA 4QIWE 4RKLA 3G6YA 3HOUH 2B2TA 1UE1A 3CVZA 5I4DA 5M3MH 1D8LA 1Q90A 4AYBE 2RDFA 1GUSA 1RTNA 1QCBD 2KCTA 1QNUA 4MZ9A 1WR2A 5E4WC 4A3JH 3NTHA 1JLLB 3D3RA 5CBAE 5KFQA 1PRTF 3K59A 1U4RA 2WIIB 3TDQA 3OHBA 3GTJA 1SR3A 1S5DD 1BCPB 2SDFA 4DV7H 5LP6F 1C4QA 5TSSA 4DXFA 2B63G 2A6HC 2BA0A 2XRSD 1TS4A 5IYBG 1I3QA 2G9DA 4UCVA 5EOYA 2FMMA 1TIID 3OMCA 2HGSA 1JIHA 1EOVA 5IYZF 1TU2B 4DR5L 1C8CA 2JEBI 4LK1C 2Z4IA 2FPPB 3A7LA 3GDEA 3HOVB 2UUAL 4CDFC 1R4PB 2ID0A 3J80c 4DV1L 3T56B 3GTGH 5EPKA 3U4VA 4MV6A 4LF7Q 3OPOA 1ESRA 1KJ9A 3SR1A 4U68A 4RAUC 4H02A 4IRKA 2M2LA 2DNCA 3AEVA 4M9UA 4Z9CB 3TRZA 1T36A 3F8TA 3ER0A 2VQEQ 1F9RA 3RZOB 3GIJA 1CSQA 3JRXA 3TINA 2N55A 1YNJD 3B6YA 5ELNA 3CCUA 3NQIA 3K0XA 2EJGC 2G5DA 2QDLA 4MV4A 4EGQA 3J80L 3HOWH 2XC9A 5J2UF 2CKZB 3K5LA 2JA8H 4ECWA 4C3JG 2B8FA 4CKCA 4X66L 3QZ8A 3GTQB 2R93G 1L1OC 4JV0A 4IN3A 1DM0B 2CW0C 3PGZA 4C3HH 1XPUA 2RDJA 4LF7H 3KBGA 2BE5C 3GTJB 1IKMA 3A8JE 1VQJA 3NGDA 4KD3A 4O1NA 1FNWA 5GONF 4TQRA 3W2DA 4KJOA 1KC7A 1SLJA 1CUKA 1AFPA 4RAZA 4J9LA 2BQ3A 1N33H 1I3QB 2VPSA 1CE8A 1J6QA 2WKCA 1XJVA 2EJMA 3A74A 4DUZL 3NE5B 2XIGA 1C0AA 3RV4A 1EQQA 1V1PA 2C2RA 3VMMA 2YU9A 1VDZA 1CKNA 4LSXA 2JSOA 1B3QA 2HCCA 3GV6A 3PW0A 2K5HA 1CI3M 4YBZB 2JJQA 4LF4L 3EBEA 1XNQL 3I4MB 2XRQD 1HFNA 1YNNC 4GOPB 2EJFC 1BBWA 4F4ZA 3JSLA 2EOTA 2JEIA 1Y1VA 4KHZA 5M3FH 4WFN3 4BY1H 3O13A 2IBKA 3UI2A 2V4DA 3S16H 3LX0A 4XT3B 1TWFA 3Q8SB 1KRTA 1EZ1A 2JQOA 4DR5H 2N49A 4IUUA 1PYBA 4L5QA 2R8IA 3DWQA 3PIP3 4JBJA 4PQXA 5FPOA 5KFKA 4DV1H 2UUAH 3DEPA 4Q0FA 4ZKCB 3HOZB 4F4XA 3PW7A 1NR2A 4WJWA 1T5XD 1A6XA 1BKBA 1GJXA 4AQYL 2ENBA 2NUAB 3JRWA 2PI2A 5HY6A 3RN5A 4EFBA 1G8ZD 2CH4W 3TP5A 4QIWA 2WB1E 1V1PB 1SAPA 4KY6A 5DM73 3HOVG 3I4LA 1D2BA 3KDFA 3G71A 3TZUA 4ZUIA 4RG1A 4BA2I 2XD4A 4HQ6A 3PUXA 5JQWA 4AYBA 1HJPA 4BWSC 4G4KA 4X66H 4ECZA 4J9PA 2YZMA 5IGCA 1Q86C 1OTCA 1R9TB 4IZOA 4RUAA 1AW7A 2IT1A 2KECA 1VQ7A 1PX2A 3VA5A 5KG2A 1F9SA 3BDOA 1UC9A 1DZ1A 2NTTA 4QB4A 1PH5A 4LF4Q 1RKNA 1B6SA 1GSHA 1XNQQ 2MJ8A 4KHVA 1X3EA 1S4ZA 4TSSA 5C4XG 4FBTA 4RCNA 4JI8H 1BDOA 1TWFB 3A7AB 4I4TF 4A3KH 1RD9D 4V190 3S17H 4DUZH 4BWGB 3WO1A 1TWAB 2VUMA 1EWCA 1JXLA 4BBSB 2ICEC 3FHWA 3Q6SA 2YYZA 1IL2A 1AN7A 2W71A 1PLFA 1X56A 2K32A 1PTOH 4Q44A 1STEA 4KLKA 2A69C 1E1TA 4A3BB 4B3TH 3OWFA 1K8OA 4DR1Q 1JDEA 5BN4A 1VQ5A 1YI2A 5KFMA 4OO1H 3G7LA 4X64L 3HXLA 1NY4A 4QCLA 2NTSA 3KDFB 3RMHA 3MHBA 4AQYQ 4ME5A 4AYBB 2F3WA 2WTFA 3GV7B 4RNOA 3U9OA 4X6AH 3OHAA 5CA0F 4OX9L 3WDNA 2GPSA 1TA8A 2K50A 1CQIB 3HRZC 1IOWA 5IYDH 2Z1CA 2NVXB 3RTXA 5D1OA 3WNZA 3K5OA 2QF7A 3TREA 3S1MH 1XX8A 3S14B 1GSOA 4CBVA 1VQKA 4GS3A 3ETJA 4B3RQ 1S5CD 3G8CA 4DK6C 4CDCC 2UXBL 1RK6A 2W70A 5CMDA 4DR3H 2VW9A 4CKBA 5HGTA 3AMUA 5LMNQ 2VUMB 3N6RA 5C44H 2BDNA 1WTVA 4LMYA 3JAMW 2IHEA 1EOTA 1SNPA 2FHTA 3I4NH 2GLTA 3HOZG 4U6PA 2A1AA 1GLVA 2PPBC 2QCPX 2BA1A 3CCVA 3D4DA 2QW7A 5DNFA 4DK3C 1EFWA 5JVLA 1O7IA 2NVTH 2AKWB 4OIJA 4A2BA 4IAJA 4FS1A 3GTLA 3CC4A 1S97A 4IURA 3NK9A 4HCEA 3SHLA 4A75A 3T5LA 5DAUA 5IP7G 1GXDC 1YZ6A 2AMCB 4Y7NH 3RZDH 3TQTA 4TQSA 2D5DA 3GQCA 4DPGA 1EHIA 2F4IA 3MWYW 3SK8A 3VR5A 1B9MA 4X64Q 3FMAA 1HNXQ 3N44B 3J81W 1TT2A 3M4IA 2WAQA 1BNCA 4QWDA 1KJIA 4XQQA 3VR2A 3PR4A 2OEOA 1MSGA 2SNMA 1K8AC 4LH7A 5E1FA 1SNCA 5D1OB 4L5RC 1G91A 4CJ2C 1U4LA 3TIGA 4OX9Q 2ZXPA 1LTID 4C2MA 1KJJA 3E3XA 2I5LX 1UE7A 4A3DB 4Q8EA 4FF1A 4X65L 4ECUA 1SNMA 2KA7A 2XGTA 1A8VA 3S2DB 1DCZA 3R2IA 4I50F 3FMCA 1LABA 4JG2A 1QVFA 1ENAA 4QUCA 3K8AA 5KIXA 5KG4A 2WB1A 4ECYA 4BBSG 3RF2A 4RFBA 4EG0A 2B8GA 2UXBQ 1B70B 2B29A 4RNMA 2EQSA 4JI0L 4DR6Q 3E0EA 1E2ZA 3HOXG 4GNXA 2NU9B 5IT9W 1Y1VH 1YNJC 4DV3L 3GTLB 3SXHA 2KJXA 1NR4A 1Z2NX 4HYKA 4QQBX 1Q1EA 4ZI7F 5GADC 5FLXE 3VYUA 3DXJC 4DN4M 1I94H 1STGA 2A73B 4KHPL 5BN3A 4IOAA 1IBLL 1O7ZA 1VQ6A 4HMJA 2I8CA 1Z7TA 1GOZA 2WKDA 1E24A 2UXBH 2NZHA 1BJTA 4RU9A 4ED3A 3KHGA 2PQEA 3BAAA 1WFQA 5JOBA 1XMOL 4DV0H 2PN1A 1MIUA 3W1BA 4FU0A 2ZTEA 3CPWA 2B2VA 4YCWA 2IX3A 2AGQA 4C2MB 4C1NI 1K1SA 1S03G 4G7HC 1STYA 2YTYA 5IYCH 4X3SA 1TWCH 4DAMA 5EWGA 3CQZB 1WD0A 2CWAA 1PH4A 1W2BA 5L1JA 4YR0A 3V96A 3T4AC 3PW2A 2WB1B 3P75A 4A3EH 3J7AF 2XNAC 2E2IH 4R4IA 3H40A 1FJGL 3TSSA 2NYZD 3M3YB 2Q8RE 2F0HA 4HR7B 4GNXB 1BF4A 4LSAA 3E5NA 2E74C 3IL8A 5KFGA 4C3IB 2LKVA 1HZ9A 1NE3A 5K2MA 5D3DA 2DPJA 4JI0Q 2W57A 1MI2A 4LFBL 4N8FA 1ENFA 2GA4B 4ED6A 1GD7A 4RZQA 1JE4A 1MKHA 1YVCA 3S9WA 3F8NA 5KG6A 1B44D 2V59A 5KT4A 2XWBB 3DM1A 1JJCB 2VB2X 1EQRA 3V4ZA 4X65H 2Z6KA 3R2TA 3GIMA 1VQ8A 3NWSA 2I0QA 1PYSB 3MEFA 4FDBA 2EYMA 3RLFA 5ISRA 4GN3B 5IP9H 4OL7A 3K5HA 4YR3A 4JI0H 4XYLB 5BR8Q 4RNNA 2XGPA 2XCAA 2L1BA 1RYRA 3NTKA 1HRJA 4DL6A 2BDOA 2C35B 4V0BA 4DV3H 4ULLA 5K36G 4JV2A 3E0JA 1LLRD 4GLAC 3TIIA 5DG9A 4IPHA 1LTLA 2F0FA 2HDMA 4IUQA 1ULZA 3MC0B 4MV3A 4DAPA 4KHPH 2F52A 2L9HA 5C3XA 1IBLH 1J9OA 1K83A 2LMCB 3GIKA 1GYFA 5C8YF 3A0JA 5NUCA 3ULLA 4ZUJA 1XTCD 5K5PA 1ASYA 2J6UA 5G3LF 2PQAA 1TXYA 1XMOH 3RGXA 1B1ZA 2ZTDA 4DNIA 2MO1A 4KTAA 4LUOA 5IGBA 2JA6H 3PF4A 2M05A 5DLGA 2EXZA 2UU9H 4ZOLF 1BXRA 3DMUA 2K1BA 2K04A 5EAYA 4JUZA 4TQUS 3SI8A 2BH8A 2FPIB 1PH8A 5IT9L 4LFBQ 2N3SA 3NQTA 4O3QA 4HIDA 4DV2L 2RGVA 2FLPA 1AUXA 1VQDA 2SEBD 1GGOA 4ECRA 3K58A 2J9GA 4RKBA 1K28A 3TP7A 2IX1A 1VQNA 1LTBD 3T16A 1ZEQX 4JI1L 1FJGH 1VQLA 2UVUA 3BABA 2O4XA 4R4OA 2VOBA 3N8DA 1EY7A 4RMFA 1B4OA 2B2WA 3HOYB 4EBEA 4C1NK 4A3FB 1X65A 3VYTA 1SFOB 2R61A 2NVQB 4LFBH 1N32L 1I50B 1DOKA 5T14A 2E5LH 5IE8A 4EBDA 1GVPA 1WTQA 3T5KA 1QG7A 1K83B 3MFIA 1SCUB 2R7FA 2R86A 2WFWA 3T1HL 1NBWA 3TS0A 1B7YB 3M7GA 3BDCA 4C3IG 2Y0SG 2PQAB 1L0YB 2UXDQ 5C1PA 2B63A 3S1RB 1WCMG 1X3FA 3TP6A 1N34L 3PIPA 4A93H 1KL9A 5IODA 2NB0A 4DV6L 4QY7A 2HHHL 4GKJQ 3L0OA 3Q0AA 4L1KA 5D1PA 1D1KA 4ETSA 4RGMA 2OXPA 4YAKB 1FL0A 3H4DA 2JA5H 1X3QA 3QJYA 4YIJA 4ZYSA 4DKAC 4JCVE 1VQ9A 3PUZA 2PZWA 3CMEA 3ICEA 4GN5A 3PO3B 2K5QA 3GTMA 3AFQA 3L4KA 3OSPA 4J1MA 1EZ8A 4KMUC 1SE4A 4RAYA 4GLXA 2K28A 4CDDC 1XPOA 4UY8C 1NCVA 4A3IG 2XCLA 1PFNA 3EVQA 1E0BA 4DV2Q 3NHHA 3P20A 2VZAA 1IOVA 3S1QB 2B2YC 2R6FA 1EEFD 4EFEA 4QWEA 4MHEA 2MHVA 4LF9L 4YCUA 1JT8A 3MWMA 4LAAA 1HTLD 5CGKA 1NMGA 3MZ5A 1SYBA 5GAHC 2D9UA 2R93A 5KFDA 1FKAH 2XGQA 3BQ1A 2R87A 1MHWC 2C9OA 5KFVA 1JOKA 3OTOL 4G7OC 1B9NA 4DR4Q 3BQ0A 1F2ZA 4JBWA 4F8MA 4LH6A 2B2TC 1SN8A 1GUOA 1PTOF 2MP1A 3CW2C 1P16A 3OMGA 3QB3A 5C5MA 1Q82C 1BBXC 4JI1H 2HIXA 3FKIH 5FLXc 1UE5A 4WJ4A 1I4PA 4MAMA 1QUQA 1JWUD 4HIOA 1UNNC 4I7AA 2HT1A 1I7LA 5KT2A 5LA6F 3AQQA 4PMWA 2D2CC 3J80W 1N32H 1H9MA 4LWCA 1SROA 3RLOA 3PO2B 2BQRA 1DD2A 1S0NA 2DLNA 3VDYA 4O3SA 3KF8A 3R3OA 3T1HH 2JXMB 3HOYG 2VS1A 1FYCA 4KN7C 1LTTD 4HEDA 4MV1A 2SNSA 1X3GA 3HOWB 3CD6A 4C3JB 4RB2C 3BQ2A 1KC8C 1N34H 2R93B 3I2ZA 4O4IF 4HJAA 4MNOA 4DV6H 4HN7A 2W8LA 2HHHH 3H0GG 2QGQA 3GV3A 3JSNA 2Z8LA 3GTPH 3CCMA 4YY3H 2EYLA 2O2LD 1EUDB 1TWGH 1Y1WG 3KLSA 3V4SA 3PR5B 3FVQA 2B2UA 2X0SA 1W6JA 3F1ZA 3Q24A 1VF7A 1VS0A 1A15A 2VQFH 2YRWA 3OTOQ 1CA6A 5IY0A 4JI6Q 3PUWA 2K03A 4PNYA 1IBKL 4JYAQ 4Q43A 2KHIA 4YWKA 3PO3G 4LF9H 1Q3LA 4BY7H 4LUZA 3Q8QB 4DV4L 3L3OC 1N8RC 1A2TA 2L5TA 1CSPA 4RB1A 1UC8A 1SMYD 4XYOA 3KF8B 1G6ZA 1WSCA 3NELA 3IN5A 1A2UA 3DM3A 1S5ED 1F77A 3PQIA 5LYJF 4WD3A 2SOBA 5IWAQ 1PFMA 2F0DA 3KK7A 3U9SA 1D1IA 4JI4H 4G7ZC 1PV4A 2I87A 3HOUG 4B08A 5M3FB 5M3MG 4BY1B 3H3VI 1VAJA 1HPCA 1G6PA 5EKIA 4MV8A 4RZRA 1B04A 2A5HA 2FLNA 3GTQA 4DK0A 4A3JG 5LL6S 3X3MA 2NVYH 3SK5A 5A2QE 3A56A 3EA6A 4GKKL 3PW5A 2ZJRA 3L9AX 2JA7H 3K5MA 2YV5A 4R9WA 2YTXA 3KOJA 1PZJD 1E2WA 4HAEA 1CT1D 1K0SA 2X69A 2RBMA 1ZETA 4QWCA 1U4MA 3MXPA 2W7PA 1E7ZA 3GQBA 4H7BA 5M5WH 2ZDGA 3S1NH 1DOLA 4EGJA 2XN9C 3KFUA 5J1ZA 5A35A 1AZPA 3RJ0A 4DR7L 3TEHB 1XNRL 1JWMD 1IBKQ 3PO2G 3ORRA 4J9SA 2P0AA 2DNEA 2JE6I 4DV4Q 3BG3A 3TQYA 4A3MH 2CWPA 1S40A 4EYHB 4GOPA 2R8GA 2F0UA 2DUDA 2R92B 4RB3C 2YRXA 1VBHA 3GTMH 2OT2A 3QO2A 5FO7B 3S2HH 3HOWG 5C4XB 3VR3A 1WTHA 3BYTB 1N36L 3CC2A 2VY3A 4L6TB 4XQNA 4C3HG 4P74A 3KLRA 1IHZA 1LTSD 4UFZA 4QW9A 4EQNA 1TWHH 1IBKH 4F4YA 1VMCA 4DXGA 2W6PA 4Q0YA 3D6CA 2VQEH 2YW2A 5CV8A 1VQHA 1UE6A 4DV4H 4FP5D 1STBA 3H91A 3F2DA 4GKKQ 4MA5A 2UXCQ 3I70A 1VMPA 5DM63 4YHHQ 1BGWA 5KFBA 4POFA 3VPCA 2F0EA 1RTOA 3MAQA 4A3GB 2KCCA 1AE2A 3K57A 3PF5A 4PG3A 1VQCA 1M90C 1B50A 1TS2A 1RJTA 4KD4A 4R1JA 1E1OA 3ORQA 3MR6A 1E4GT 1IW7D 3V6HA 2EYOA 1PH9A 1XXGA 1BNZA 4IRDA 1KDCA 3K7UC 1NTGA 2E75C 3OIPA 5C3EH 5M5YB 2ZXOA 2K14A 1R9TA 4GKKH 4DR7Q 1EY4A 1XNRQ 2YL2A 4R7RA 3D4RA 1LUZA 5I2XA 2L15A 5M3FG 4BY1G 3S15H 2F3IA 2W6OA 2C00A 4O2DA 3SDZA 5EQ0A 4C56C 5KT7A 1I4GA 4R4CA 1MJCA 2X6LA 5IGGA 2PYKA 1TWAA 4RHRA 1CKMA 2V1CC 1Q7YC 4DR1L 1S72A 1N36Q 2R7ZH 3OYYA 3KJOA 2RKSA 3M4OH 2A6ED 1SMXA 2JA9A 2EE1A 2MUYA 5ELOA 4Q5VA 2E8GA 3K3PA 1HQMC 3F2UA 1QOHA 4IZ8A 3DLLA 4POGA 2F0SA 3N42B 1YJWA
chains in the Genus database with same CATH topology
4JG2A 5M5XH 3UDIA 3K8AA 3CP0A 5LMUQ 4BBSG 1YNXA 2UXBQ 1B70B 2B29A 1A0IA 2EQSA 4JI0L 2OQ0A 3GD7A 1YHQA 3GTOH 4DR6Q 3E0EA 3HOXG 1WJJA 4GNXA 3PO3H 1Y1VH 4JI2L 3PSIA 4DV3L 5AJ3L 3CCSA 1VQEA 3CQZH 4NXML 2JEAI 2Y0SE 1FVIA 1IBMQ 4QQBX 1Q1EA 3I55A 1N33L 3W1GA 5GADC 4A3LG 1UWVA 2WB1G 3CXCA 1K9MC 2VNUD 2Z0SA 3HKZE 4B3RL 2LXKA 3I56A 1YIJA 3H15A 4KHPL 2UXCL 2JA7G 3L7ZC 5HGQA 4YHHL 1SE8A 1IBLL 5DLQE 1VQ6A 2R92G 5LMNL 3S1QH 1E24A 1IZ6A 4OWXB 4C3IH 2ZM6Q 1X55A 2NZHA 2QEXA 2YTVA 1WCMH 1WFQA 4A3KG 1N9WA 1XMOL 1MIUA 3W1BA 4ALPA 1D7QA 2D0OA 3IRBA 2KENA 2ZTEA 4R4QA 3CPWA 2R7DA 4YCWA 3G6EA 4BBRH 1Q12A 3RZOH 2YTYA 5IYCH 1E22A 4B3MQ 1C9OA 1MJEA 5C0XJ 2Q2UA 5LMNW 4YY3L 2QA4A 1TWCH 4DAMA 2B63H 2B3GA 4IJLA 2CWAA 1PH4A 1W2BA 1OXVA 3RR5A 2KBNA 5IYBH 3ZJYC 4OO1G 3GTQH 4A3IH 3HKSA 2VQFL 4HIKA 4A3EH 1X9NA 4R4IA 1U5KA 4A3MG 1HNXL 2E2IH 1FJGL 3GTJH 4A3GG 3W5OA 4GNXB 1AH9A 4JI1Q 3NBHB 1PFSA 2R6GA 4P72A 4GNXC 2JA8G 5FLMH 2ES2A 1HZ9A 1NE3A 4PZ8A 4JI0Q 1I3QH 2ZJQA 4BXXG 5GAEC 4LFBL 3Q8DA 4HJ8A 3PO2H 2NZOA 1EIFA 5IYDG 3MXNB 4JI2Q 1GD7A 1OXUA 1VQBA 3EIVA 4GN4B 1L0WA 1MKHA 1YVCA 5AJ3Q 1YEZA 4NB3A 1PHJA 4NXMQ 1JJCB 1PA6A 1N32Q 2EIFA 1N33Q 1EQRA 4HJ9A 5LMUL 4PZ7A 2Z6KA 1VQMA 2MQHA 5J3BA 1VQ8A 1EWIA 4JI4L 2I0QA 1Q8KA 1PYSB 3BJUA 5FJ8H 3PIOA 3MEFA 4FDBA 4C3JH 3KYHC 1Q81C 4DR6L 3T1HQ 3RLFA 1PH2A 2R93H 4GN3B 3RLNA 5IP9H 5C44G 2D62A 1VQAA 3CAMA 3I4MH 5BR8Q 1IBML 3UDGA 2VL6A 1HNWL 2WP8J 4MTNA 1AE3A 1X6OA 2I5HA 2NN6G 1N34Q 3PUYA 2C35B 4IFDI 2K5VA 4DV7L 4DV6Q 2KCMA 2HHHQ 1HH2P 5H1SE 5K36G 2HIVA 2Q2TA 2IY5B 4GLAC 3HFZB 3M4PA 4IPHA 4LW1A 5C3EG 4JI8L 4YY3Q 1LTLA 2ZM6L 3ULPA 3T1YL 4IOAA 2CQOA 1S3OA 2F52A 2Q2HA 4Y52H 2CFMA 1JMCA 3HOYH 1G51A 3A0JA 2OCEA 2VQFQ 3ULLA 4A3FG 1JJGA 1QZHA 2AHOB 4NPSA 4R4TA 3RN2A 4QL5A 1SFOH 1ASYA 3HOZH 2PQAA 1TXYA 2NVQH 1SRUA 2XTIA 4DR5Q 2ZTDA 4DNIA 4JI5L 2MO1A 4LUOA 2JA6H 3PF4A 4B3TL 2UUAQ 4LF9Q 4DV1Q 4TVAB 3H0GH 5EAYA 5GAGC 1GO3E 4TQUS 1KHIA 2GN5A 2BH8A 2A8VA 2R7ZG 1YHBA 2OWOA 1PH8A 1JB7A 4LFBQ 2N3SA 1Y1WH 3NEMA 1RIPA 2Z6KC 2YU9H 4HIDA 4DV2L 3A5ZB 1VQDA 4XIGS 1B8AA 2IX1A 4QJFA 1VQNA 3J7ZC 2WAQE 4JI1L 1K8GA 1VQLA 3M85A 4LFAQ 1CKOA 4LF6L 4R4OA 1R9TH 2MO0A 1K73C 4OONA 1QUQB 4JI4Q 4RMFA 1T9HA 2ALYB 1Q1BA 4NXNL 1C7YA 4LF7L 2LSSA 4ME3A 2UUCL 2IX0A 5JJKA 1QVGA 3M4QA 2CCZA 4X66Q 1Y1VG 1VCIA 1X65A 4LFCL 3ULJA 2VQEL 2E2JH 3STBD 1GKHA 1RL2A 3J80i 1HNWQ 1N32L 2H5XA 1JJ2A 5IE8A 1GVPA 1TWFH 4UPAA 3CCEA 3U50C 5JEAJ 4DV7Q 3U58A 4DR3L 3RNUA 2N78A 2ATWA 2R7FA 4IO9A 1TWAH 2PI2E 2RHSB 4JBKA 1M1KC 1NMFA 2WFWA 3T1HL 1NBWA 1VQGA 3HOVH 4QIWE 1B7YB 4JI8Q 3T1YQ 3K80C 3TS0A 2ASBA 1LM0A 1UE1A 3HOUH 2Y0SG 2PQAB 5M3MH 3S1RH 1D8LA 4DUZQ 1CKNB 1GM5A 2UXDQ 5BR8L 4WJ3M 3G48A 1WCMG 3E9IA 4AYBE 3HKZG 4EQ5A 4A3BH 1L1OA 1X3FA 4K0KQ 2KCTA 4OWWB 4MZ9A 3PIPA 1N34L 4DR7Q 5C0XG 4A3JH 4A93H 1KL9A 5GROA 4DV6L 4QY7A 2HHHL 4GKJQ 3L0OA 1FL0A 5IYCG 3PV0A 2AWNA 2JA5H 1HZCA 4JI5Q 1VQ9A 3ICEA 4DKAC 4JCVE 3PUZA 3CMEA 1SR3A 4O0AA 4GN5A 4B3TQ 2R92H 3AFQA 4JV5Q 3CPFA 2B63G 5GQOA 5C4XH 2MNAA 2I5MX 2BA0A 4GLXA 1XPOA 1QZGA 3D31A 4IPDA 1YHAA 5IYBG 4UY8C 4A3EG 3FP9A 4A3IG 1OXTA 2F4VL 3AYHB 4DV2Q 1XMQL 1EOVA 4YCVA 4A3CG 1OXXK 2VZAA 4DR5L 2JEBI 4JC0A 2NVXH 4IFDJ 3GDEA 2UUAL 4LF6Q 2ID0A 1BVSA 4YCUA 3J80c 4DV1L 4LF9L 3GTGH 1H95A 1JT8A 1UEBA 3U4VA 5FLMG 4LUVA 4LF7Q 1JE5A 1NMGA 4NXNQ 3L2PA 2UUCQ 4QGUA 4H02A 5GAHC 3AEVA 1WYDA 3TRZA 4LFCQ 3F8TA 3UE0A 3ER0A 2VQEQ 2VUMH 1VQOA 1CSQA 3B6YA 5ELNA 3CCUA 4A3GH 3OTOL 3K0XA 4LFAL 4DR4Q 4P73A 4LF8L 4JBWA 2PMZE 4DR3Q 1SN8A 1EYGA 3HOWH 5FJ8G 2IHFA 2CKZB 1P16A 3CW2C 1L1OB 4BA1I 1FGUA 1Q82C 5E7NA 2JA8H 1NJIC 3E9HA 4X66L 4DAYB 2R93G 2HIXA 1L1OC 3FKIH 5IP9G 5FLXc 3PGZA 4C3HH 1XPUA 1UE5A 4WJ4A 5M5YH 1VQJA 1QUQA 2JK8A 3I4MG 3G4SA 3I4NG 4HIOA 4X62Q 2HT1A 4DR2L 2D0PA 1I94L 3J81c 1SLJA 1VQPA 1CUKA 3AQQA 4PMWA 2LXJA 4LWCA 1SROA 1V1QA 1LYLA 3K81C 3RLOA 1Z9FA 1J6QA 4DUYL 1XJVA 1PVOA 3F2CA 3VDYA 1EUJA 3A74A 4DUZL 2UXDL 3KF6A 4DV0L 1C0AA 4K0KL 3HOYG 1EQQA 4OX9Q 3PCOB 1A62A 2VS1A 4DV5Q 2F4VQ 4GKJL 1X3GA 4EX5A 1XMQQ 4A3DH 2EXDA 3CD6A 1CKNA 4OO1I 1KC8C 2K5HA 3I2ZA 2JA6G 4HJAA 3CMAA 3S2DH 2Q2IA 2JJQA 4MNOA 4LF4L 3EBEA 3H0GG 4JV5L 2QGQA 4J15A 1XNQL 4OWTB 3GTPH 4GOPB 1G291 1Q46A 1BBWA 1L2FA 3EN2A 5IP7H 3CCMA 1TWGH 1Y1WG 4A76A 3S24A 2UUBQ 1VQ4A 1HZBA 2RF4A 4KHZA 5M3FH 4BY1H 3F1ZA 2GVBA 4JOIA 3CCRA 1K0RA 1VS0A 3UDFA 3S16H 2GVAA 3GTLH 3OTOQ 2MFIA 5IY0A 4LF8Q 1KRTA 3PUWA 4JI6Q 2JQOA 2N49A 1PYBA 4L5QA 4B3SL 4JBJA 1IBKL 4JYAQ 2KHIA 4YWKA 4AIMA 3PO3G 2FXQA 4BY7H 1PH7A 4LUZA 5JEAG 4DV4L 1N8RC 2WAQG 1KD1C 3PUVA 4DR2Q 4IOCA 1PH1A 1I94Q 1BKBA 1CSPA 4JBMA 4DR4L 4AQYL 3KF8B 3CCJA 3NELA 1XPRA 3KF6B 1PH3A 1KAWA 3DM3A 2PI2A 5HY6A 3F2BA 2ZJPA 3KLWA 3RN5A 1BBUA 5IWAQ 2RCNA 3JAMi 4BBSH 3OW2A 2WB1E 2NN6I 4C2MH 4DUYQ 3HOVG 1W3SA 1PV4A 3KDFA 3G71A 1PH6A 3HOUG 1YBYA 4JI7L 4RG1A 2BH2A 4BA2I 5M3MG 3HOXH 3PUXA 3H3VI 1HJPA 4DV0Q 1G6PA 4X62L 4OXPA 3J7A5 4A3BG 4L5TA 1KIXA 1Q86C 3GTKH 1OTCA 4A3JG 4A93G 3ERSX 5JJIA 2IT1A 2NVYH 4BBRG 4A3LH 1VQ7A 4GKKL 2AWOA 2ZJRA 2JA5G 2JA7H 3A5UA 3M3YH 1PH5A 4LF4Q 2YV5A 1HNZL 1YJ9A 2YTXA 4AYBG 3KOJA 1XNQQ 1X3EA 5C4XG 3J81i 1EIYB 4IFDG 4JOIC 4DV5L 4A3KH 4APVA 4KI0A 4UP7A 3SGIA 3CCQA 3S17H 1P8LA 3CF5A 2OTJA 3M9BA 1E7ZA 1V43A 4IPCA 3UDXA 3KJPA 2UU9L 1X54A 5M5WH 1KXLA 3S1NH 3FHWA 1HR0L 2ZTCA 2YYZA 1IL2A 4YWLA 4GLVB 1XNRQ 3KFUA 3S14H 1X56A 1J5EL 1U0LA 4UP9A 4KLKA 1E1TA 4B3SQ 3TEHB 1XNRL 4DR7L 1IBKQ 4DR1Q 3PO2G 2UUBL 1VQ5A 1YI2A 3JAMc 1ASZA 4XTCS 2JE6I 4X64L 4L5SA 2VUMG 3TS2A 4DV4Q 4A3MH 3TQYA 4X65Q 2CWPA 1S40A 1NY4A 4IPGA 4GOPA 3KDFB 2DUDA 3WWVA 4A3CH 4AQYQ 1VQFA 1HR0W 4JI6L 4JYAL 2HQLA 1Z47A 3GTMH 1WOCA 4IJHA 3HOWG 3S2HH 1A63A 4X6AH 4HJ7A 4OX9L 1I5FA 2A19A 5C4JH 4HJ5A 1N36L 1HZAA 3FKIG 2N8NA 2VY3A 1KQSA 3CC2A 4LF5L 4BXXH 1I6HH 4JI7Q 2K52A 2K50A 4P74A 1QVFA 2E5LL 3J81j 5IYDH 1TWHH 4P71A 4JI3L 3TREA 4DV3Q 3BU2A 3S1MH 1OXSC 1VQKA 1VQHA 1UE6A 3M7NA 4GS3A 1XTDA 2E2HH 4A4IA 5IWAL 3F2DA 4GKKQ 4B3RQ 2DGYA 4DK6C 2UXBL 4LNQA 5JJLA 5C0XI 4KHPQ 2UXCQ 1IBLQ 4YHHQ 2VW9A 1HNZQ 4POFA 5LMNQ 3BZKA 5C44H 3STBC 2RHQB 2IHEA 1AE2A 3I4NH 3PF5A 1WI5A 1XMOQ 4PG3A 1VQCA 2A1AA 3LGJA 1M90C 3HOZG 1VQIA 2BA1A 3CCVA 4A3DG 1EFWA 4DK3C 2UU9Q 1DGSA 4P75A 4R1JA 1O7IA 1E1OA 2AKWB 2OTLA 1Y14B 3CCLA 2NVTH 1QVCA 4UP8A 1HR0Q 3H3VH 2PNHA 1PH9A 3CC4A 3K7UC 1NTGA 3U4ZA 5C3EH 1J5EQ 4A75A 2K14A 5IP7G 1IYJB 1YZ6A 2AMCB 4YWMA 4Y7NH 3RZDH 4GOPC 3I7FA 3I4OA 1LUZA 5IT9c 3D0FA 2L15A 5M3FG 4DPGA 1YITA 4BY1G 4X64Q 4A3FH 1HNXQ 3S15H 2F3IA 1IXRA 1FJGQ 2K75A 3CC7A 2KHJA 4O2DA 3K7AH 1K3RA 4AH6A 4B3ML 1K8AC 3GO5A 1I50H 1YJNA 4R4CA 1MJCA 4L5RC 1E3PA 3NENA 1CKMA 1K83H 2V1CC 1KRSA 4PZ6A 4DR1L 1S72A 1Q7YC 1N36Q 3OYYA 3KJOA 2R7ZH 3M4OH 3BZCA 4LF5Q 2OQKA 4BY7G 2I5LX 1UE7A 3AFPA 1SMXA 2JA9A 2K5NA 2E5LQ 3UE1A 5ELOA 4X65L 2XGTA 2E8GA 4JI3Q 1A8VA 1V9PA 2K4KA 3DLLA 4HIMA 4POGA 3JC66 1YJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JG2 A;  5M5X H;  3UDI A;  3K8A A;  3CP0 A;  5LMU Q;  4BBS G;  1YNX A;  2UXB Q;  1B70 B;  2B29 A;  1A0I A;  2EQS A;  4JI0 L;  2OQ0 A;  3GD7 A;  1YHQ A;  3GTO H;  4DR6 Q;  3E0E A;  3HOX G;  1WJJ A;  4GNX A;  3PO3 H;  1Y1V H;  4JI2 L;  3PSI A;  4DV3 L;  5AJ3 L;  3CCS A;  1VQE A;  3CQZ H;  4NXM L;  2JEA I;  2Y0S E;  1FVI A;  1IBM Q;  4QQB X;  1Q1E A;  3I55 A;  1N33 L;  3W1G A;  5GAD C;  4A3L G;  1UWV A;  2WB1 G;  3CXC A;  1K9M C;  2VNU D;  2Z0S A;  3HKZ E;  4B3R L;  2LXK A;  3I56 A;  1YIJ A;  3H15 A;  4KHP L;  2UXC L;  2JA7 G;  3L7Z C;  5HGQ A;  4YHH L;  1SE8 A;  1IBL L;  5DLQ E;  1VQ6 A;  2R92 G;  5LMN L;  3S1Q H;  1E24 A;  1IZ6 A;  4OWX B;  4C3I H;  2ZM6 Q;  1X55 A;  2NZH A;  2QEX A;  2YTV A;  1WCM H;  1WFQ A;  4A3K G;  1N9W A;  1XMO L;  1MIU A;  3W1B A;  4ALP A;  1D7Q A;  2D0O A;  3IRB A;  2KEN A;  2ZTE A;  4R4Q A;  3CPW A;  2R7D A;  4YCW A;  3G6E A;  4BBR H;  1Q12 A;  3RZO H;  2YTY A;  5IYC H;  1E22 A;  4B3M Q;  1C9O A;  1MJE A;  5C0X J;  2Q2U A;  5LMN W;  4YY3 L;  2QA4 A;  1TWC H;  4DAM A;  2B63 H;  2B3G A;  4IJL A;  2CWA A;  1PH4 A;  1W2B A;  1OXV A;  3RR5 A;  2KBN A;  5IYB H;  3ZJY C;  4OO1 G;  3GTQ H;  4A3I H;  3HKS A;  2VQF L;  4HIK A;  4A3E H;  1X9N A;  4R4I A;  1U5K A;  4A3M G;  1HNX L;  2E2I H;  1FJG L;  3GTJ H;  4A3G G;  3W5O A;  4GNX B;  1AH9 A;  4JI1 Q;  3NBH B;  1PFS A;  2R6G A;  4P72 A;  4GNX C;  2JA8 G;  5FLM H;  2ES2 A;  1HZ9 A;  1NE3 A;  4PZ8 A;  4JI0 Q;  1I3Q H;  2ZJQ A;  4BXX G;  5GAE C;  4LFB L;  3Q8D A;  4HJ8 A;  3PO2 H;  2NZO A;  1EIF A;  5IYD G;  3MXN B;  4JI2 Q;  1GD7 A;  1OXU A;  1VQB A;  3EIV A;  4GN4 B;  1L0W A;  1MKH A;  1YVC A;  5AJ3 Q;  1YEZ A;  4NB3 A;  1PHJ A;  4NXM Q;  1JJC B;  1PA6 A;  1N32 Q;  2EIF A;  1N33 Q;  1EQR A;  4HJ9 A;  5LMU L;  4PZ7 A;  2Z6K A;  1VQM A;  2MQH A;  5J3B A;  1VQ8 A;  1EWI A;  4JI4 L;  2I0Q A;  1Q8K A;  1PYS B;  3BJU A;  5FJ8 H;  3PIO A;  3MEF A;  4FDB A;  4C3J H;  3KYH C;  1Q81 C;  4DR6 L;  3T1H Q;  3RLF A;  1PH2 A;  2R93 H;  4GN3 B;  3RLN A;  5IP9 H;  5C44 G;  2D62 A;  1VQA A;  3CAM A;  3I4M H;  5BR8 Q;  1IBM L;  3UDG A;  2VL6 A;  1HNW L;  2WP8 J;  4MTN A;  1AE3 A;  1X6O A;  2I5H A;  2NN6 G;  1N34 Q;  3PUY A;  2C35 B;  4IFD I;  2K5V A;  4DV7 L;  4DV6 Q;  2KCM A;  2HHH Q;  1HH2 P;  5H1S E;  5K36 G;  2HIV A;  2Q2T A;  2IY5 B;  4GLA C;  3HFZ B;  3M4P A;  4IPH A;  4LW1 A;  5C3E G;  4JI8 L;  4YY3 Q;  1LTL A;  2ZM6 L;  3ULP A;  3T1Y L;  4IOA A;  2CQO A;  1S3O A;  2F52 A;  2Q2H A;  4Y52 H;  2CFM A;  1JMC A;  3HOY H;  1G51 A;  3A0J A;  2OCE A;  2VQF Q;  3ULL A;  4A3F G;  1JJG A;  1QZH A;  2AHO B;  4NPS A;  4R4T A;  3RN2 A;  4QL5 A;  1SFO H;  1ASY A;  3HOZ H;  2PQA A;  1TXY A;  2NVQ H;  1SRU A;  2XTI A;  4DR5 Q;  2ZTD A;  4DNI A;  4JI5 L;  2MO1 A;  4LUO A;  2JA6 H;  3PF4 A;  4B3T L;  2UUA Q;  4LF9 Q;  4DV1 Q;  4TVA B;  3H0G H;  5EAY A;  5GAG C;  1GO3 E;  4TQU S;  1KHI A;  2GN5 A;  2BH8 A;  2A8V A;  2R7Z G;  1YHB A;  2OWO A;  1PH8 A;  1JB7 A;  4LFB Q;  2N3S A;  1Y1W H;  3NEM A;  1RIP A;  2Z6K C;  2YU9 H;  4HID A;  4DV2 L;  3A5Z B;  1VQD A;  4XIG S;  1B8A A;  2IX1 A;  4QJF A;  1VQN A;  3J7Z C;  2WAQ E;  4JI1 L;  1K8G A;  1VQL A;  3M85 A;  4LFA Q;  1CKO A;  4LF6 L;  4R4O A;  1R9T H;  2MO0 A;  1K73 C;  4OON A;  1QUQ B;  4JI4 Q;  4RMF A;  1T9H A;  2ALY B;  1Q1B A;  4NXN L;  1C7Y A;  4LF7 L;  2LSS A;  4ME3 A;  2UUC L;  2IX0 A;  5JJK A;  1QVG A;  3M4Q A;  2CCZ A;  4X66 Q;  1Y1V G;  1VCI A;  1X65 A;  4LFC L;  3ULJ A;  2VQE L;  2E2J H;  3STB D;  1GKH A;  1RL2 A;  3J80 i;  1HNW Q;  1N32 L;  2H5X A;  1JJ2 A;  5IE8 A;  1GVP A;  1TWF H;  4UPA A;  3CCE A;  3U50 C;  5JEA J;  4DV7 Q;  3U58 A;  4DR3 L;  3RNU A;  2N78 A;  2ATW A;  2R7F A;  4IO9 A;  1TWA H;  2PI2 E;  2RHS B;  4JBK A;  1M1K C;  1NMF A;  2WFW A;  3T1H L;  1NBW A;  1VQG A;  3HOV H;  4QIW E;  1B7Y B;  4JI8 Q;  3T1Y Q;  3K80 C;  3TS0 A;  2ASB A;  1LM0 A;  1UE1 A;  3HOU H;  2Y0S G;  2PQA B;  5M3M H;  3S1R H;  1D8L A;  4DUZ Q;  1CKN B;  1GM5 A;  2UXD Q;  5BR8 L;  4WJ3 M;  3G48 A;  1WCM G;  3E9I A;  4AYB E;  3HKZ G;  4EQ5 A;  4A3B H;  1L1O A;  1X3F A;  4K0K Q;  2KCT A;  4OWW B;  4MZ9 A;  3PIP A;  1N34 L;  4DR7 Q;  5C0X G;  4A3J H;  4A93 H;  1KL9 A;  5GRO A;  4DV6 L;  4QY7 A;  2HHH L;  4GKJ Q;  3L0O A;  1FL0 A;  5IYC G;  3PV0 A;  2AWN A;  2JA5 H;  1HZC A;  4JI5 Q;  1VQ9 A;  3ICE A;  4DKA C;  4JCV E;  3PUZ A;  3CME A;  1SR3 A;  4O0A A;  4GN5 A;  4B3T Q;  2R92 H;  3AFQ A;  4JV5 Q;  3CPF A;  2B63 G;  5GQO A;  5C4X H;  2MNA A;  2I5M X;  2BA0 A;  4GLX A;  1XPO A;  1QZG A;  3D31 A;  4IPD A;  1YHA A;  5IYB G;  4UY8 C;  4A3E G;  3FP9 A;  4A3I G;  1OXT A;  2F4V L;  3AYH B;  4DV2 Q;  1XMQ L;  1EOV A;  4YCV A;  4A3C G;  1OXX K;  2VZA A;  4DR5 L;  2JEB I;  4JC0 A;  2NVX H;  4IFD J;  3GDE A;  2UUA L;  4LF6 Q;  2ID0 A;  1BVS A;  4YCU A;  3J80 c;  4DV1 L;  4LF9 L;  3GTG H;  1H95 A;  1JT8 A;  1UEB A;  3U4V A;  5FLM G;  4LUV A;  4LF7 Q;  1JE5 A;  1NMG A;  4NXN Q;  3L2P A;  2UUC Q;  4QGU A;  4H02 A;  5GAH C;  3AEV A;  1WYD A;  3TRZ A;  4LFC Q;  3F8T A;  3UE0 A;  3ER0 A;  2VQE Q;  2VUM H;  1VQO A;  1CSQ A;  3B6Y A;  5ELN A;  3CCU A;  4A3G H;  3OTO L;  3K0X A;  4LFA L;  4DR4 Q;  4P73 A;  4LF8 L;  4JBW A;  2PMZ E;  4DR3 Q;  1SN8 A;  1EYG A;  3HOW H;  5FJ8 G;  2IHF A;  2CKZ B;  1P16 A;  3CW2 C;  1L1O B;  4BA1 I;  1FGU A;  1Q82 C;  5E7N A;  2JA8 H;  1NJI C;  3E9H A;  4X66 L;  4DAY B;  2R93 G;  2HIX A;  1L1O C;  3FKI H;  5IP9 G;  5FLX c;  3PGZ A;  4C3H H;  1XPU A;  1UE5 A;  4WJ4 A;  5M5Y H;  1VQJ A;  1QUQ A;  2JK8 A;  3I4M G;  3G4S A;  3I4N G;  4HIO A;  4X62 Q;  2HT1 A;  4DR2 L;  2D0P A;  1I94 L;  3J81 c;  1SLJ A;  1VQP A;  1CUK A;  3AQQ A;  4PMW A;  2LXJ A;  4LWC A;  1SRO A;  1V1Q A;  1LYL A;  3K81 C;  3RLO A;  1Z9F A;  1J6Q A;  4DUY L;  1XJV A;  1PVO A;  3F2C A;  3VDY A;  1EUJ A;  3A74 A;  4DUZ L;  2UXD L;  3KF6 A;  4DV0 L;  1C0A A;  4K0K L;  3HOY G;  1EQQ A;  4OX9 Q;  3PCO B;  1A62 A;  2VS1 A;  4DV5 Q;  2F4V Q;  4GKJ L;  1X3G A;  4EX5 A;  1XMQ Q;  4A3D H;  2EXD A;  3CD6 A;  1CKN A;  4OO1 I;  1KC8 C;  2K5H A;  3I2Z A;  2JA6 G;  4HJA A;  3CMA A;  3S2D H;  2Q2I A;  2JJQ A;  4MNO A;  4LF4 L;  3EBE A;  3H0G G;  4JV5 L;  2QGQ A;  4J15 A;  1XNQ L;  4OWT B;  3GTP H;  4GOP B;  1G29 1;  1Q46 A;  1BBW A;  1L2F A;  3EN2 A;  5IP7 H;  3CCM A;  1TWG H;  1Y1W G;  4A76 A;  3S24 A;  2UUB Q;  1VQ4 A;  1HZB A;  2RF4 A;  4KHZ A;  5M3F H;  4BY1 H;  3F1Z A;  2GVB A;  4JOI A;  3CCR A;  1K0R A;  1VS0 A;  3UDF A;  3S16 H;  2GVA A;  3GTL H;  3OTO Q;  2MFI A;  5IY0 A;  4LF8 Q;  1KRT A;  3PUW A;  4JI6 Q;  2JQO A;  2N49 A;  1PYB A;  4L5Q A;  4B3S L;  4JBJ A;  1IBK L;  4JYA Q;  2KHI A;  4YWK A;  4AIM A;  3PO3 G;  2FXQ A;  4BY7 H;  1PH7 A;  4LUZ A;  5JEA G;  4DV4 L;  1N8R C;  2WAQ G;  1KD1 C;  3PUV A;  4DR2 Q;  4IOC A;  1PH1 A;  1I94 Q;  1BKB A;  1CSP A;  4JBM A;  4DR4 L;  4AQY L;  3KF8 B;  3CCJ A;  3NEL A;  1XPR A;  3KF6 B;  1PH3 A;  1KAW A;  3DM3 A;  2PI2 A;  5HY6 A;  3F2B A;  2ZJP A;  3KLW A;  3RN5 A;  1BBU A;  5IWA Q;  2RCN A;  3JAM i;  4BBS H;  3OW2 A;  2WB1 E;  2NN6 I;  4C2M H;  4DUY Q;  3HOV G;  1W3S A;  1PV4 A;  3KDF A;  3G71 A;  1PH6 A;  3HOU G;  1YBY A;  4JI7 L;  4RG1 A;  2BH2 A;  4BA2 I;  5M3M G;  3HOX H;  3PUX A;  3H3V I;  1HJP A;  4DV0 Q;  1G6P A;  4X62 L;  4OXP A;  3J7A 5;  4A3B G;  4L5T A;  1KIX A;  1Q86 C;  3GTK H;  1OTC A;  4A3J G;  4A93 G;  3ERS X;  5JJI A;  2IT1 A;  2NVY H;  4BBR G;  4A3L H;  1VQ7 A;  4GKK L;  2AWO A;  2ZJR A;  2JA5 G;  2JA7 H;  3A5U A;  3M3Y H;  1PH5 A;  4LF4 Q;  2YV5 A;  1HNZ L;  1YJ9 A;  2YTX A;  4AYB G;  3KOJ A;  1XNQ Q;  1X3E A;  5C4X G;  3J81 i;  1EIY B;  4IFD G;  4JOI C;  4DV5 L;  4A3K H;  4APV A;  4KI0 A;  4UP7 A;  3SGI A;  3CCQ A;  3S17 H;  1P8L A;  3CF5 A;  2OTJ A;  3M9B A;  1E7Z A;  1V43 A;  4IPC A;  3UDX A;  3KJP A;  2UU9 L;  1X54 A;  5M5W H;  1KXL A;  3S1N H;  3FHW A;  1HR0 L;  2ZTC A;  2YYZ A;  1IL2 A;  4YWL A;  4GLV B;  1XNR Q;  3KFU A;  3S14 H;  1X56 A;  1J5E L;  1U0L A;  4UP9 A;  4KLK A;  1E1T A;  4B3S Q;  3TEH B;  1XNR L;  4DR7 L;  1IBK Q;  4DR1 Q;  3PO2 G;  2UUB L;  1VQ5 A;  1YI2 A;  3JAM c;  1ASZ A;  4XTC S;  2JE6 I;  4X64 L;  4L5S A;  2VUM G;  3TS2 A;  4DV4 Q;  4A3M H;  3TQY A;  4X65 Q;  2CWP A;  1S40 A;  1NY4 A;  4IPG A;  4GOP A;  3KDF B;  2DUD A;  3WWV A;  4A3C H;  4AQY Q;  1VQF A;  1HR0 W;  4JI6 L;  4JYA L;  2HQL A;  1Z47 A;  3GTM H;  1WOC A;  4IJH A;  3HOW G;  3S2H H;  1A63 A;  4X6A H;  4HJ7 A;  4OX9 L;  1I5F A;  2A19 A;  5C4J H;  4HJ5 A;  1N36 L;  1HZA A;  3FKI G;  2N8N A;  2VY3 A;  1KQS A;  3CC2 A;  4LF5 L;  4BXX H;  1I6H H;  4JI7 Q;  2K52 A;  2K50 A;  4P74 A;  1QVF A;  2E5L L;  3J81 j;  5IYD H;  1TWH H;  4P71 A;  4JI3 L;  3TRE A;  4DV3 Q;  3BU2 A;  3S1M H;  1OXS C;  1VQK A;  1VQH A;  1UE6 A;  3M7N A;  4GS3 A;  1XTD A;  2E2H H;  4A4I A;  5IWA L;  3F2D A;  4GKK Q;  4B3R Q;  2DGY A;  4DK6 C;  2UXB L;  4LNQ A;  5JJL A;  5C0X I;  4KHP Q;  2UXC Q;  1IBL Q;  4YHH Q;  2VW9 A;  1HNZ Q;  4POF A;  5LMN Q;  3BZK A;  5C44 H;  3STB C;  2RHQ B;  2IHE A;  1AE2 A;  3I4N H;  3PF5 A;  1WI5 A;  1XMO Q;  4PG3 A;  1VQC A;  2A1A A;  3LGJ A;  1M90 C;  3HOZ G;  1VQI A;  2BA1 A;  3CCV A;  4A3D G;  1EFW A;  4DK3 C;  2UU9 Q;  1DGS A;  4P75 A;  4R1J A;  1O7I A;  1E1O A;  2AKW B;  2OTL A;  1Y14 B;  3CCL A;  2NVT H;  1QVC A;  4UP8 A;  1HR0 Q;  3H3V H;  2PNH A;  1PH9 A;  3CC4 A;  3K7U C;  1NTG A;  3U4Z A;  5C3E H;  1J5E Q;  4A75 A;  2K14 A;  5IP7 G;  1IYJ B;  1YZ6 A;  2AMC B;  4YWM A;  4Y7N H;  3RZD H;  4GOP C;  3I7F A;  3I4O A;  1LUZ A;  5IT9 c;  3D0F A;  2L15 A;  5M3F G;  4DPG A;  1YIT A;  4BY1 G;  4X64 Q;  4A3F H;  1HNX Q;  3S15 H;  2F3I A;  1IXR A;  1FJG Q;  2K75 A;  3CC7 A;  2KHJ A;  4O2D A;  3K7A H;  1K3R A;  4AH6 A;  4B3M L;  1K8A C;  3GO5 A;  1I50 H;  1YJN A;  4R4C A;  1MJC A;  4L5R C;  1E3P A;  3NEN A;  1CKM A;  1K83 H;  2V1C C;  1KRS A;  4PZ6 A;  4DR1 L;  1S72 A;  1Q7Y C;  1N36 Q;  3OYY A;  3KJO A;  2R7Z H;  3M4O H;  3BZC A;  4LF5 Q;  2OQK A;  4BY7 G;  2I5L X;  1UE7 A;  3AFP A;  1SMX A;  2JA9 A;  2K5N A;  2E5L Q;  3UE1 A;  5ELO A;  4X65 L;  2XGT A;  2E8G A;  4JI3 Q;  1A8V A;  1V9P A;  2K4K A;  3DLL A;  4HIM A;  4POG A;  3JC6 6;  1YJW A; 
#chains in the Genus database with same CATH topology
 1C30 A;  3UDI A;  3UFX B;  3EJI A;  1JCK B;  5CA1 F;  3E5S A;  5I47 A;  5LHY 1;  2QIL A;  3Q22 A;  4J9O A;  5KT5 A;  3C1F A;  2EYF A;  4GC6 A;  1N36 H;  2LY7 A;  2R8J A;  4NXM L;  2JEA I;  1PZI D;  2Y0S E;  1FVI A;  1IBM Q;  3KTM A;  5F2D A;  5COY A;  3MA2 B;  5LL6 b;  3CXC A;  4B3R L;  3I56 A;  2YCH A;  2NVX A;  2L11 A;  3MXN A;  1YIJ A;  3M9M B;  2I80 A;  1ZXT A;  5HGQ A;  4OEL B;  2ALZ A;  2R92 G;  3NWT A;  5LMN L;  1SE2 A;  2WV6 D;  3OIQ A;  3J7A V;  5C4H A;  3J81 E;  2ZM6 Q;  1RYS A;  1JOO A;  4JPB W;  4NLG A;  4WBN F;  4IR9 A;  2YTV A;  4A3K G;  1N9W A;  1PRT B;  2JEF A;  1EL0 A;  3IG0 A;  3IRB A;  1L0X B;  1V4Y A;  1KBL A;  1LT3 D;  4RGO S;  3G6E A;  2UVV A;  4U67 3;  3MXG A;  1SSO A;  4K6D A;  1Q12 A;  3D8G A;  5EJW A;  3RZO H;  1E22 A;  4L63 B;  5KFJ A;  1C9O A;  1MJE A;  3HOX B;  3EPI A;  5C0X J;  3HEJ A;  2H1E A;  4UCU A;  2ZJT A;  2VA3 A;  3I8Z A;  2VXW A;  3QIA A;  4LF4 H;  1FNU A;  2RSN A;  2B3G A;  1JR0 D;  3GTK B;  1XNQ H;  3RR5 A;  1PYW D;  3MJF A;  3ZJY C;  4OO1 G;  3GTQ H;  2CH4 A;  1HNX L;  4K5W A;  4UCR A;  3GII A;  3GTJ H;  4A3G G;  5FO9 B;  3ETH A;  2Z4H A;  1ILQ A;  3CHB D;  3CRL C;  2EDG A;  1M4V A;  3LML A;  3NBH B;  2R6G A;  4P72 A;  4GNX C;  4QW8 A;  5LOV F;  2E2H A;  5FLM H;  4WOR A;  4RWS C;  1I3Q H;  2ZJQ A;  4K8I A;  2EYJ A;  4E6I A;  2NZO A;  2NZ1 D;  1EIF A;  3R5F A;  5IYD G;  3MXN B;  1LTG D;  3ITP A;  4CC6 A;  1VQB A;  4DR1 H;  3EIV A;  1L0W A;  1YEZ A;  4NXM Q;  3RAQ A;  1SXT A;  2J6S A;  4HJ9 A;  1VQM A;  1GUT A;  5H80 A;  1Y8O B;  1TWC B;  5J3B A;  1STA A;  1QWY A;  5FJ8 H;  4ZK9 B;  4AQY H;  3M4Y A;  4FO2 A;  3KYH C;  1EYZ A;  3T51 B;  4DR6 L;  2R85 A;  3PZP A;  3C46 A;  3NUC A;  4EBC A;  3A8K E;  2KVM A;  5C44 G;  2D62 A;  1BCP D;  1UNS A;  1M8A A;  1MGS A;  2B2V C;  3I4M H;  2ZXR A;  2CZG A;  1NAP A;  1SMY C;  4F88 A;  2FMA A;  2I5H A;  1QNK A;  5IGE A;  2NN6 G;  4K8J A;  3PUY A;  5IGF A;  3RBE A;  1JKJ B;  3SK4 A;  3MTS A;  3RB0 A;  2KCM A;  5C4J B;  1HH2 P;  1I6H B;  3HB9 A;  3I90 A;  2W9B A;  4LW1 A;  4B3R H;  3T1Y L;  3ULP A;  1AUV A;  4KJN A;  5LXT F;  2F0K A;  1S3O A;  5KT3 A;  1KAA A;  2CFM A;  5KFA A;  1JMC A;  5LMN H;  3DF7 A;  3K5I A;  5JH7 F;  1EWH A;  1JJG A;  2E2H B;  3K0Y A;  2BOS A;  4Y8V B;  4HCS A;  3HOZ H;  4I7Z C;  4KY7 A;  2VB3 X;  4JI5 L;  2RQX A;  2F0I A;  2ASD A;  3Q2O A;  3MR5 A;  2K33 A;  3V2T A;  5KYL A;  1Y8P B;  1JB7 A;  2OWO A;  4O3O A;  3GTO A;  2F0O A;  2Z6K C;  4HNV A;  2YU9 H;  1V1O A;  1ICW A;  2VUG A;  5EPJ A;  1VF5 C;  3CQZ A;  4X64 H;  4QJF A;  1HNX H;  4Q8F A;  2W6M A;  3H6M A;  1K8G A;  1H9K A;  4LF6 L;  1RCV D;  3MEH A;  4LFA Q;  1R9T H;  5KFL A;  1JX4 A;  4OON A;  4WRD A;  2ALY B;  4NXN L;  1C7Y A;  2UUC L;  5CV6 A;  3KAJ A;  4HR7 A;  3HP3 A;  4OX9 H;  1Y1V G;  4LFC L;  4XXE A;  5FD6 A;  5JEA H;  2Y0S A;  1EYA A;  2SCU B;  3STB D;  2W9B B;  1GKH A;  2EY2 A;  1WCM A;  2JA6 B;  1TWF H;  3CCE A;  2KQ3 A;  3RUZ A;  3U50 C;  5FD5 A;  4YJ2 F;  3U58 A;  1UUP A;  2FFK B;  2N78 A;  2ATW A;  1ICF B;  1MBY A;  1TWA H;  1LTR D;  3T1Y Q;  1EU4 A;  3EQL C;  5EKK A;  1GM5 A;  1WD1 A;  5BR8 L;  4WJ3 M;  4DR6 H;  3E9I A;  4K0K Q;  1DIK A;  1BOS A;  3HKZ G;  3IFD A;  4EQ5 A;  4A3B H;  5M5X B;  5C0X G;  2CW8 A;  2NU6 B;  1M0W A;  2AQ1 B;  2AUJ D;  5IYC G;  3PV0 A;  1SYC A;  3GTO B;  2AWN A;  3IFT A;  4JI5 Q;  1G2T A;  3MXU A;  3VYS A;  4ED7 A;  1K8M A;  4O0A A;  1DV1 A;  4JV5 Q;  3JZI A;  1EY9 A;  3CPF A;  5L1I A;  2MNA A;  2F3V A;  2I5M X;  1F9Q A;  4IFD H;  5DEH A;  3D31 A;  1PXU A;  1YHA A;  3K6O A;  1QB5 D;  3FP9 A;  4A3E G;  1PZK D;  1OXT A;  2F4V L;  1SEI A;  3Q23 A;  1JC7 A;  3A8I E;  2EVB A;  1IW7 C;  1OXX K;  4A3C G;  2NVX H;  2PCF B;  4JC0 A;  5DG7 A;  4R8I A;  2B2W C;  3K5N A;  1SYD A;  1GSA A;  4LF6 Q;  1BVS A;  3R5X A;  2Y0S B;  3MR2 A;  3VPB A;  1UEB A;  5KKN B;  2ASL A;  4NXN Q;  1JE5 A;  2V4Q A;  1WCM B;  3MVV A;  1HCZ A;  2UUC Q;  1WYD A;  4A93 B;  1STH A;  3C0F B;  1ONL A;  4LFC Q;  5KT6 A;  1FR3 A;  4BBR B;  2VUM H;  1VQO A;  2YYA A;  1I4X A;  4CC5 A;  2R7M A;  3H4B A;  2F0G A;  4LF8 L;  2L0C A;  2PMZ E;  1KTK A;  3SEB A;  4BA1 I;  4ABN A;  1FGU A;  1VBG A;  5E7N A;  1WTR A;  2A74 C;  1NJI C;  3E9H A;  4A3I B;  2A6E C;  5IP9 G;  4OEM B;  2L12 A;  4TV9 F;  4GC7 A;  1CTM A;  4YP3 A;  3G4S A;  2JEG A;  4X62 Q;  4DR2 L;  2K6A A;  3J81 c;  1VQP A;  2Q8I B;  1OWT A;  1SYG A;  4XX0 B;  1PRT D;  4RUC A;  2LXJ A;  1SFO A;  1V1Q A;  1HUM A;  3TBI B;  1I50 A;  1O7Y A;  4DUY L;  3MFY A;  1PVO A;  3F2C A;  5E4X A;  2PW5 A;  2UXD L;  1KAB A;  1TS5 A;  3KF6 A;  3H0G A;  4ODG A;  4M7E A;  3OOC A;  3PCO B;  5DG8 A;  1EY0 A;  1Y1W A;  4DV5 Q;  2F4V Q;  4RB0 A;  1EEI D;  4GKJ L;  1E4E A;  2TSS A;  5BR8 H;  4EX5 A;  4A3D H;  2EXD A;  2NWG A;  3AB9 A;  2RDG A;  3EPG A;  4OO1 I;  2JA6 G;  3S2D H;  2Q2I A;  4OHJ A;  3V6K A;  2KHS A;  1B6R A;  4FS2 A;  2XSC A;  2JN4 A;  5JVD F;  1ENC A;  1L2F A;  3SVM A;  3FDT A;  1KEE A;  1LT6 D;  3EFX D;  4K5X A;  4DF7 A;  4A76 A;  2UUB Q;  1VQ4 A;  2AGO A;  2RF4 A;  4HSP A;  3BG5 A;  3D6W A;  4JOI A;  1EFI D;  5C5L A;  3MFH A;  3UDF A;  1CQJ B;  2F0V A;  1ZYR D;  2K01 A;  3RD4 A;  3VR6 A;  3GTL H;  4X3T A;  2MFI A;  4LF8 Q;  4GZY C;  2PBZ A;  2IJ0 A;  4ZQI A;  2K5D A;  5JJZ A;  4B3S L;  4FBU A;  4F7X A;  3Q1K A;  3R5H A;  4EVO A;  2FXQ A;  4DL7 A;  4IUN A;  4ILW A;  1CA5 A;  1HUN A;  2WAQ G;  1KD1 C;  1QJO A;  3PUV A;  4DR2 Q;  1PH1 A;  4JBM A;  3QZ7 A;  4DR4 L;  2O03 A;  5DGA A;  3H0G B;  1XPR A;  3KF6 B;  1PH3 A;  1KAW A;  2ZJP A;  3KLW A;  1EQV A;  3GTP B;  3L4J A;  1BBU A;  4DNT B;  5KG5 A;  2RCN A;  2NN6 I;  4C2M H;  1Y1W B;  4ZAI A;  4DUY Q;  4LF8 H;  1CQF A;  1E4E B;  2V58 A;  1PH6 A;  3OHX C;  1K3B C;  4JI7 L;  2BH2 A;  1RJP A;  1T3N A;  2Q8T A;  2FK3 A;  4UAI A;  4OXP A;  2QKI C;  2WE6 A;  5KG0 A;  1DOM A;  5C3W A;  4O2A F;  4O2B F;  3PN1 A;  1F2L A;  5C5J A;  1MD2 D;  4A93 G;  2E2D C;  3ERS X;  5ELB A;  4ED1 A;  4A3L H;  4BBR G;  4EQO A;  5EWF A;  4ED2 A;  3P7J A;  2AWO A;  2JA5 G;  4YAJ B;  2B39 A;  3QOJ A;  3A5U A;  1CHP D;  5KFP A;  2JEJ A;  3M3Y H;  1HNZ L;  3H09 A;  1STN A;  1CM9 A;  3KHR A;  2KEE A;  3MWD A;  2C2D A;  2B2U C;  4NKL A;  1BCP C;  2E2J B;  3ERQ A;  4Q45 A;  3GTG A;  2V9W A;  3NTI A;  1EIY B;  2EY5 A;  1BCP F;  1S68 A;  4FXG C;  4APV A;  2W6N A;  2WAC A;  4UP7 A;  3SGI A;  4DL3 A;  2UXD H;  3CF5 A;  3R8B A;  1N48 A;  2O5I C;  1F2Y A;  1V43 A;  2L55 A;  4IPC A;  3UDX A;  5KNB A;  1HR0 L;  2ZTC A;  5D3I B;  3HOU B;  4YWL A;  3HGB A;  4GLV B;  4GKJ H;  5M3M B;  1J5E L;  1U0L A;  1RK5 A;  1EY8 A;  1E2V A;  4UP9 A;  4B3S Q;  4O3N A;  1TAE A;  4A3J B;  5DQG A;  3NPP A;  3DUZ A;  1ASZ A;  1G2S A;  4XTC S;  2F0W A;  3TS2 A;  4ECQ A;  4IPG A;  2JA7 B;  2PMZ A;  1VQF A;  4DV2 H;  4JI6 L;  2HQL A;  1Z47 A;  1EIG A;  1WOC A;  1A63 A;  2IWH A;  5D8D A;  5CV5 A;  1I5F A;  2W9C A;  4JYA L;  3GLK A;  1HZA A;  3FKI G;  4BXX H;  3OSN A;  4LF5 L;  1EYC A;  1LO5 D;  4JI7 Q;  1GHJ A;  3NSW A;  3FPU B;  4JI3 L;  1J8I A;  3OSO A;  5FOB B;  3BU2 A;  1O80 A;  5I6Y A;  3GTG B;  4K2L A;  4XDX A;  2AQ3 B;  1OXS C;  1WTO A;  5EDW A;  5EBC A;  4O4L F;  1XTD A;  5KX5 F;  4A4I A;  5IWA L;  1R4Q B;  4F50 A;  4DR4 H;  4LNQ A;  5EGT A;  5C0X I;  5KG7 A;  1S5F D;  5FLX L;  1HNZ Q;  3BZK A;  1KLU D;  2ZT9 C;  3STB C;  2RHQ B;  1N56 A;  4IAL A;  4KKT A;  3QFF A;  2XCP A;  2RGR A;  2HCI A;  4R8N A;  2GPW A;  3S2H B;  2PVP A;  2JA8 B;  1DGS A;  4P75 A;  2OTL A;  1Y14 B;  4FNF A;  1QVC A;  4UP8 A;  1HR0 Q;  4APM A;  2PNH A;  1DV2 A;  4CJ0 B;  4C3H B;  2CHB D;  3U4Z A;  1J5E Q;  1BQQ T;  4S3S A;  4G57 A;  1TWH B;  3QR8 A;  1XDN A;  5BPF A;  3N6X A;  1IYJ B;  2PMZ B;  1CZW A;  4GOP C;  3I7F A;  3I4O A;  1UEA B;  3WOF A;  1HNZ H;  4K14 A;  3BDL A;  1YIT A;  4A3F H;  2EY1 A;  2RVL A;  1WVL A;  2AU0 A;  2W9C B;  2K75 A;  2W6Z A;  3DHQ A;  1ET6 A;  2FKL A;  3K7A H;  3LP8 A;  2FLL A;  4AH6 A;  1I50 H;  1YJN A;  1EIH A;  3LWU A;  2DWC A;  3BZD B;  4ZRZ A;  3BS1 A;  1HR0 H;  1K83 H;  2OTJ A;  1KRS A;  4PZ6 A;  5EWE A;  3NXW A;  3BZC A;  4LF5 Q;  2OQK A;  4BY7 G;  1HTP A;  2RSO A;  1DYQ A;  4J0M A;  1S0M A;  4JI3 Q;  5DLF A;  1V9P A;  4IQZ A;  3S1R H;  5KFR A;  3KJP A;  2NUC A;  2VQD A;  4N8X 1;  1BO0 A;  1S10 A;  2FP4 B;  5LMU Q;  1H9S B;  1YNX A;  3OTO H;  2HDL A;  3T13 A;  4JI6 H;  4F87 A;  3GD7 A;  1YHQ A;  2A68 D;  5KYI A;  1PFB A;  3H20 A;  3T5J A;  2R92 A;  1WJJ A;  3PO3 H;  3S15 B;  4JI2 L;  1IL8 A;  5EKL A;  3PSI A;  3N52 A;  4JYA H;  3S16 B;  5AJ3 L;  3CCS A;  2BR0 A;  4LF5 H;  4FXD A;  1NUC A;  3MWE A;  3QWN A;  3OWE B;  4KKU A;  3W1G A;  1N33 L;  2W8K A;  4ECT A;  5L1L A;  3HKZ E;  1KJQ A;  3KHH A;  4J9N A;  2LXK A;  2K05 A;  1EY5 A;  2UXC L;  5ELC A;  2JA7 G;  3L7Z C;  4YHH L;  5DLQ E;  3S1Q H;  1WTP A;  3DWP A;  5IWA H;  4L8J A;  1IZ6 A;  4DL5 A;  2PO4 A;  1X55 A;  5JUM A;  5HUR A;  1Y8N B;  3QOL A;  3R93 A;  5KFE A;  5J2T F;  3GIL A;  1SND A;  3BYY B;  4ALP A;  1D7Q A;  4FXK C;  1PRT C;  2KEN A;  4R4Q A;  3T5H A;  2R7D A;  4CHT B;  1HHV A;  1O75 A;  1DXM A;  1SNO A;  4NW2 A;  5CBE E;  2R8K A;  4E4T A;  5LMN W;  4JVZ A;  2QA4 A;  1M6V A;  2B63 H;  2F1M A;  2KBN A;  5IYB H;  1ZKO A;  3H94 A;  1T5E A;  1KXL A;  4HIK A;  3WO0 A;  3GV8 B;  2AQ2 B;  1U5K A;  4A3M G;  3HBL A;  2G9H D;  1IKL A;  3KBX A;  4ED0 A;  3W5O A;  5L9X A;  3BJY A;  2F0L A;  1JQY D;  2K7V A;  2ZDQ A;  1PFS A;  2JA8 G;  1BR9 A;  2ES2 A;  5JAV A;  4X3U A;  1Z2P X;  4A3K B;  4XYM B;  2F0M A;  3S17 B;  1H9J A;  3Q8D A;  3PO2 H;  5HV6 A;  4JI2 Q;  2BQU A;  1OXU A;  4B9W A;  1KJ8 A;  4GN4 B;  4IUV A;  3KUP A;  5AJ3 Q;  1ZYR C;  3A55 A;  4NB3 A;  5CB4 F;  5KFN A;  1PA6 A;  1A3T A;  1N33 Q;  1PTO B;  4KY5 A;  4A2A A;  3CKI B;  1PMR A;  2MQH A;  1M0T A;  2DIK A;  1EWI A;  1NNX A;  3BJU A;  4IUP A;  4C3J H;  3KHL A;  1PH2 A;  2R93 H;  3RLN A;  1I6V C;  2J0T D;  3NP8 A;  4DAV A;  4ZCK A;  1VQA A;  2QDB A;  1T94 A;  3RGZ A;  1IBM L;  2VL6 A;  1HNW L;  2J7Z A;  5CV9 A;  4MTN A;  1AE3 A;  1X6O A;  3LWB A;  2R3Z A;  4JI2 H;  4UCT A;  1SDF A;  2M00 A;  2K5V A;  3N41 B;  5F9N A;  2EPB A;  3X3N A;  5CAE B;  2IY5 B;  2AUK A;  3HFZ B;  4DNR B;  2IL8 A;  5C3E G;  4JI8 L;  2ZM6 L;  2NBF A;  2CQO A;  2R7L A;  1HXY D;  2UXC H;  1FNV A;  4YHH H;  4FVM A;  3S1M B;  4ED8 A;  4B9X A;  3C2P A;  1G51 A;  2OCE A;  4NMZ A;  2JYO A;  4TRD A;  2ATL A;  2AHO B;  4R4T A;  3RN2 A;  4QL5 A;  1SRU A;  4DR5 Q;  3V6J A;  1M7J A;  3BVZ A;  5C44 B;  4B3T L;  4JK1 C;  2UUA Q;  4DV1 Q;  5GAG C;  1GO3 E;  1KLG D;  2GN5 A;  5A2Q W;  2A8V A;  2R7Z G;  3I4N B;  1YHB A;  1AN8 A;  5KFO A;  2QYZ A;  3NEM A;  2C5C A;  1XNR H;  3GIP A;  4DR7 H;  2NVT B;  5CV7 A;  4RHS A;  4XIG S;  3OW7 A;  3LWE A;  4EQP A;  3H3V C;  2EYH A;  1LT5 D;  2WAQ E;  2LS0 1;  3JAM E;  3M85 A;  1CKO A;  4I65 A;  5D14 A;  3G6V A;  2MO0 A;  3RZD B;  1S9F A;  2P5Z X;  4Y7N B;  1Q1B A;  2RCF A;  5AFW A;  3C1E A;  5I9O A;  4X66 Q;  1PDQ A;  2TMP A;  2FMC A;  5CV4 A;  3NBH A;  3N43 B;  1WH2 A;  1RL2 A;  1SJE D;  3TZD A;  1HNW Q;  2ICI A;  2H5X A;  1JJ2 A;  3HKZ A;  4N9P A;  4UPA A;  5JPN C;  5JEA J;  4DR3 L;  3RNU A;  1I7N A;  3TP8 A;  4JBK A;  2KCN A;  2RHS B;  5L37 A;  1JIC A;  1UAP A;  1VQG A;  5KRU A;  3HOV H;  2ASB A;  1L2Z A;  4JI8 Q;  3K80 C;  1LM0 A;  1H9R A;  2YU9 B;  1XWE A;  1TWC A;  1SYE A;  4RA8 A;  1CKN B;  3E6Z X;  4DUZ Q;  1GUW A;  2KOL A;  3G48 A;  4MA0 A;  4O3R A;  3QG1 A;  5IOC A;  1L1O A;  4ZLT F;  4IHJ F;  4OWW B;  2MCT A;  4FF3 A;  3I3C A;  4DAY A;  1W96 A;  1SYF A;  5GRO A;  3IKJ A;  2E2I A;  5C6A A;  1IBM H;  5G3L D;  1HNW H;  3RAX A;  4I7H A;  1NSN S;  1HZC A;  5C1O A;  3WOE A;  4B3T Q;  1Y1V B;  4EEQ A;  1Y69 U;  5BN5 A;  2R92 H;  4MV7 A;  4ECS A;  4ECV A;  5GQO A;  4DL2 A;  5C4X H;  1WTX A;  4O3P A;  4YJ3 F;  1QZG A;  4IPD A;  2ZM6 H;  4XQJ A;  3PIO 3;  4TV8 F;  3AYH B;  1XMQ L;  4YCV A;  4IFD J;  2YZN A;  4C5C A;  4K2K A;  5IT9 E;  4ZQ3 A;  4ECX A;  4J8Q A;  4QMG A;  1H95 A;  1Q8I A;  3PVX A;  3VYR A;  4LUV A;  5FLM G;  1F9P A;  1I4R A;  3L2P A;  3HKZ B;  4QGU A;  2RDH A;  2CVR A;  4JW0 A;  3KXY T;  2K5W A;  1JWS D;  3VR4 A;  1KNA A;  5CC4 A;  2QK4 A;  1RF2 D;  3UE0 A;  4QIW B;  3HZX A;  4J9Q A;  1S0O A;  4UDU C;  4A3G H;  1A3U A;  4LFA L;  4P73 A;  2J6T A;  4YQW A;  4DR3 Q;  1EYG A;  5FJ8 G;  2IHF A;  3EYY A;  1L1O B;  2MGS A;  2Z9H A;  2O5J C;  2RDI A;  4DAY B;  4A3E B;  3Q8R B;  4H0L C;  2E2I B;  5CR3 A;  3KAK A;  1ROD A;  1SBB B;  5M5Y H;  5COR A;  2JK8 A;  5IIF A;  4FF2 A;  3I4M G;  3I4N G;  2D0P A;  1I94 L;  2YS7 A;  1I4Q A;  3FEW X;  3C3L A;  4RH6 A;  1IYV A;  2AQ4 A;  4NXM H;  4DLK A;  2L4N A;  1LYL A;  1QE6 A;  3K81 C;  2CQY A;  1Z9F A;  2A68 C;  3FDS A;  2JA6 A;  4IWX A;  1EUJ A;  5A2Q L;  1RJR A;  4EGV A;  1KDB A;  4PMC A;  4DV0 L;  2FK1 A;  2ASJ A;  4K0K L;  4ZKB B;  3HS0 C;  1A62 A;  2OF1 A;  3Q8P B;  2PZU A;  3PMF A;  1XMQ Q;  2NN6 H;  1JB3 A;  3OUZ A;  2C22 A;  2HQE A;  3CMA A;  5JPM C;  1AP0 A;  4JV5 L;  4XYQ A;  4J15 A;  4OWT B;  4CJ1 B;  4HMI A;  2IP4 A;  1G29 1;  1Q46 A;  5IP7 H;  3EN2 A;  1ZHS A;  5E3F A;  4QUF A;  3S24 A;  1HZB A;  2Z6B A;  2GVB A;  5D65 A;  3DWA A;  3CCR A;  1K0R A;  2F0P A;  1K1Q A;  3FRP B;  2GVA A;  1II3 A;  5I2Y A;  1HA5 A;  1D6E C;  4KV6 A;  5CYU A;  3ND9 A;  1XMQ H;  3I91 A;  4RGN A;  2DJF C;  2R7N A;  1PTO D;  4IUT A;  4I55 F;  4CDE C;  2EY6 A;  4AIM A;  3CRK C;  3GP7 A;  4QWB A;  5FKA C;  5KG1 A;  1I4H A;  1MZB A;  1PH7 A;  5JEA G;  1TY2 A;  1RJQ A;  4IOC A;  1QIL A;  1I94 Q;  1SJH D;  2RA4 A;  3CCJ A;  1VKZ A;  3F2B A;  4MN3 A;  4YB8 B;  1E4F T;  3JAM i;  4BBS H;  1EUC B;  3OW2 A;  1U9R A;  4LFA H;  2KSW A;  2JA5 A;  1W3S A;  3MFG A;  1YBY A;  1B2T A;  2F0N A;  3HOX H;  4DV0 Q;  1GHK A;  3K3V A;  4X62 L;  1B53 A;  3J7A 5;  5I6W A;  4A3B G;  3RV3 A;  4L5T A;  1KIX A;  5BMV F;  2UVR A;  3GTK H;  2QEJ C;  2R7K A;  1AEX A;  4UCS A;  5JJI A;  3KLS X;  2J4X A;  2CQA A;  4P2C B;  2WDT A;  4HNU A;  1W93 A;  4RGT A;  2ZDH A;  1YJ9 A;  3I73 A;  1OO9 B;  4AYB G;  3RIZ A;  4NDX A;  2WAQ B;  3J81 i;  4IFD G;  3J7A K;  4JOI C;  3T1Y H;  4IR1 A;  5J39 A;  4DV5 L;  5KFT A;  4KI0 A;  3RBD A;  3CCQ A;  1P8L A;  5KGU A;  3M9B A;  2F03 A;  4K0K H;  2HVR A;  2NU8 B;  4KKS A;  2XVS A;  3BVM A;  3SK6 A;  5C0X H;  1X54 A;  2UU9 L;  4ZHQ F;  2W9A A;  5KFU A;  3TN2 A;  3S14 H;  1ZHQ A;  4M8A A;  1JOQ A;  4JI5 H;  5M9O A;  2VPQ A;  1HQR D;  1EZ6 A;  4NP5 A;  4J9M A;  1ML0 D;  2UUB L;  4JV5 H;  4OGQ C;  3JAM c;  3FKI A;  5DQH A;  2LFN A;  1TR5 A;  5ELF A;  4L5S A;  2VUM G;  3RB4 A;  4X65 Q;  1GUN A;  2JA5 B;  1WTW A;  2AGP A;  3WWV A;  4A3C H;  1HR0 W;  4TUY F;  2XWJ B;  4CGY B;  5KFH A;  4IJH A;  5KG3 A;  4C5B A;  3KAL A;  4HJ7 A;  4DA2 A;  3BVG A;  4LF6 H;  2A19 A;  5C4J H;  4HJ5 A;  1RDP D;  3A54 A;  1KQS A;  2N8N A;  2C2E A;  4DK1 A;  1I6H H;  2UVW A;  4NXN H;  1EY6 A;  2K52 A;  1KNE A;  3JAM L;  2E5L L;  2UUC H;  3J81 j;  2IA6 A;  3J7Y W;  1S5B D;  4P71 A;  1LTA D;  4QWA A;  1AZQ A;  3VPD A;  4OIK A;  4DV3 Q;  2V4R A;  3CU7 A;  4EYI B;  1TS3 A;  4LFC H;  2R8H A;  3GTK A;  1FGB D;  1O78 A;  3M7N A;  4XZ3 B;  2WIN B;  4JV1 A;  5ELD A;  2E2H H;  3BA8 A;  1PK8 A;  2DGY A;  1TKW B;  3P1H A;  4KN4 C;  5JJL A;  4KHP Q;  1IBL Q;  1D5X C;  4TKO B;  2OH2 A;  4XT1 B;  5J22 A;  3GTP A;  4ME6 A;  1CZG A;  2A6H D;  1LT4 D;  1TVX A;  1TWG A;  5F9L A;  1WI5 A;  3SE7 A;  1XMO Q;  2PZT A;  2N88 A;  3LGJ A;  3J81 L;  1VQI A;  2KUM A;  4A3D G;  4X62 H;  2JP1 A;  2UU9 Q;  5DGB A;  3CCL A;  1O7L A;  3H3V H;  1MSH A;  3FKI B;  5K36 H;  3OUU A;  4KK7 A;  5FPR A;  2HD3 A;  1CS0 A;  2E76 C;  1HA6 A;  2FJZ A;  5FLX W;  4MTK A;  2OLS A;  4YWM A;  4LJZ C;  3TME A;  5IT9 c;  3D0F A;  4DFA A;  4DU9 A;  2IMW P;  3N40 P;  5T1I A;  1IXR A;  1FJG Q;  3CC7 A;  3G6J B;  2KHJ A;  4DV5 H;  2F4V H;  1K3R A;  4B3M L;  3GO5 A;  2EZV A;  1E3P A;  3BA9 A;  3GV5 B;  4G3I A;  1ESF A;  3NEN A;  1K9M C;  2FK2 A;  4PWQ A;  1W6K A;  1C3O A;  3R23 A;  5DQI A;  4H13 C;  3TQ1 A;  3HG9 A;  3AFP A;  5LL6 X;  2K5N A;  3J80 E;  3UE1 A;  2CW0 D;  2E5L Q;  3PW4 A;  5HBR B;  2BCO A;  2BE5 D;  1CFM A;  2UUB H;  2K4K A;  4HIM A;  5L1K A;  3JC6 6;  5M5X H;  4FM9 A;  3CP0 A;  2NVY A;  2VR1 A;  4U7C A;  1TWG B;  2F0T A;  1A0I A;  4HSV A;  2OQ0 A;  5BPH A;  2JA7 A;  4QF4 A;  4PMB A;  3GTO H;  5KFS A;  4F4W A;  2W6Q A;  3K7A B;  4UHV A;  1VQE A;  3CQZ H;  4X3K A;  4MV9 A;  4DGZ A;  3I55 A;  4A3L G;  1UWV A;  2WB1 G;  4M1U B;  2VNU D;  2YS6 A;  2Z0S A;  4DR2 H;  4ID6 A;  1GUG A;  2XIW A;  3H15 A;  4J9R A;  2FE3 A;  3GIQ A;  1D5Z C;  1SE8 A;  5KND A;  4BY7 B;  1V51 A;  1SEB D;  2M9V A;  1CHQ D;  4J6H A;  4OWX B;  4C3I H;  3RB3 A;  4DUY H;  2QEX A;  2HVS A;  5ELE A;  1YNN D;  1WCM H;  2W7O A;  1LV9 A;  2D0O A;  5KFC A;  2FPG B;  2HUG A;  3ONA B;  4BBR H;  2FB9 A;  4RCO A;  2PNR C;  5FO8 B;  4B3M Q;  2Q2U A;  1JDB B;  5KEE A;  4YY3 L;  1B3A A;  3ERO A;  1ILP A;  4IJL A;  1EU3 A;  4PV1 C;  1OXV A;  2WYO A;  2NVY B;  3D4W A;  4YR2 A;  4A3I H;  3HKS A;  2VQF L;  1X9N A;  2R84 A;  3M9O B;  4LMQ D;  5FK9 C;  1SE3 A;  1TWH A;  2I07 B;  1SNQ A;  1AH9 A;  1F2M A;  1A9X A;  1DJR D;  2PW7 A;  4JI1 Q;  4FYD A;  4B3M H;  4PZ8 A;  4BXX G;  1B33 N;  5GAE C;  4HJ8 A;  5KFZ A;  4IRC A;  4B3S H;  1IYU A;  1TY0 A;  5M5W B;  3S1N B;  3DEO A;  1A3V A;  2EYP A;  1PHJ A;  3G6X A;  5KFF A;  2KED A;  1N32 Q;  2EIF A;  4MTD A;  5LMU L;  4PZ7 A;  1CK1 A;  1RHP A;  4CKE A;  4JI4 L;  1PTO C;  4J9K A;  1Q8K A;  2B63 B;  1Z6H A;  3PIO A;  4EEY A;  1LAC A;  3RB6 A;  2X6G A;  3T53 B;  1Q81 C;  3T1H Q;  1BUV T;  3V05 A;  1DON A;  4K5V A;  3M9N B;  4A3M B;  3AU7 A;  1H9S A;  3CAM A;  1Z2O X;  4JI7 H;  3U9T A;  5KFW A;  2DZD A;  3VA7 A;  3UDG A;  2WP8 J;  2C28 A;  1X3P A;  1ET9 A;  3GTM B;  3MR3 A;  2MPM A;  1C48 A;  2F0Q A;  2DN8 A;  4UCO A;  1N34 Q;  1JOR A;  4HTH A;  4IFD I;  4DV7 L;  1V8Q A;  4DV6 Q;  2HHH Q;  5H1S E;  2HIV A;  2Q2T A;  4H44 C;  3RUP A;  4BS9 A;  3M4P A;  5JVG 3;  1I6U A;  4YY3 Q;  2VA2 A;  4R8U A;  1D5M C;  5I9P A;  2Q2H A;  4Y52 H;  1SYX B;  2A69 D;  3HOY H;  2R7Z A;  1XYI A;  2CW7 A;  2FJ2 A;  2VQF Q;  4A3F G;  1QZH A;  4NPS A;  2IPK D;  1SFO H;  1EYD A;  1EQT A;  1FD7 D;  2NVQ H;  4DL4 A;  2XTI A;  4K6L A;  5JVH 3;  5EZY F;  3URY A;  5EBD A;  4LF9 Q;  4TVA B;  3H0G H;  3IAY A;  4C5A A;  1CQV A;  3LNN A;  2H4O A;  4FF4 A;  2YZG A;  1KHI A;  5C4Z A;  4PDB A;  1BXT A;  1J5E H;  5KNC A;  1Y1W H;  3UQ8 A;  1RIP A;  1KDA A;  2HJW A;  3A5Z B;  2HVQ A;  2IW3 A;  3GID A;  5KFX A;  5EPL A;  3SE0 A;  1B8A A;  2DY8 A;  5C3E B;  1U4P A;  1HFG A;  3J7Z C;  1ZQ7 A;  2R82 A;  1X32 A;  1K73 C;  4JI4 Q;  1QUQ B;  1T9H A;  4LF7 L;  2V5A A;  2B2Y A;  2DY7 A;  2LSS A;  4ME3 A;  3I12 A;  2IX0 A;  5JJK A;  1QVG A;  3M4Q A;  4IWY A;  2CCZ A;  4MIU A;  3RFC A;  2FIN B;  3NBI A;  1VCI A;  3ULJ A;  5T1G A;  2F0J A;  2VQE L;  4O4H F;  2E2J H;  3J80 i;  5KFY A;  2DJG C;  4N9T A;  2I46 A;  3FPP A;  3I72 A;  3W3A A;  2NU7 B;  4R8U B;  1TQO A;  4JI3 H;  4O42 A;  4DV7 Q;  4MTE A;  2DPI A;  2R7Z B;  5IGD A;  3M4O B;  4IO9 A;  5KFI A;  2PI2 E;  3ZYY X;  1M1K C;  1NMF A;  5LMU H;  3ND8 A;  4HNT A;  4QIW E;  4RKL A;  3G6Y A;  3HOU H;  2B2T A;  1UE1 A;  3CVZ A;  5I4D A;  5M3M H;  1D8L A;  1Q90 A;  4AYB E;  2RDF A;  1GUS A;  1RTN A;  1QCB D;  2KCT A;  1QNU A;  4MZ9 A;  1WR2 A;  5E4W C;  4A3J H;  3NTH A;  1JLL B;  3D3R A;  5CBA E;  5KFQ A;  1PRT F;  3K59 A;  1U4R A;  2WII B;  3TDQ A;  3OHB A;  3GTJ A;  1SR3 A;  1S5D D;  1BCP B;  2SDF A;  4DV7 H;  5LP6 F;  1C4Q A;  5TSS A;  4DXF A;  2B63 G;  2A6H C;  2BA0 A;  2XRS D;  1TS4 A;  5IYB G;  1I3Q A;  2G9D A;  4UCV A;  5EOY A;  2FMM A;  1TII D;  3OMC A;  2HGS A;  1JIH A;  1EOV A;  5IYZ F;  1TU2 B;  4DR5 L;  1C8C A;  2JEB I;  4LK1 C;  2Z4I A;  2FPP B;  3A7L A;  3GDE A;  3HOV B;  2UUA L;  4CDF C;  1R4P B;  2ID0 A;  3J80 c;  4DV1 L;  3T56 B;  3GTG H;  5EPK A;  3U4V A;  4MV6 A;  4LF7 Q;  3OPO A;  1ESR A;  1KJ9 A;  3SR1 A;  4U68 A;  4RAU C;  4H02 A;  4IRK A;  2M2L A;  2DNC A;  3AEV A;  4M9U A;  4Z9C B;  3TRZ A;  1T36 A;  3F8T A;  3ER0 A;  2VQE Q;  1F9R A;  3RZO B;  3GIJ A;  1CSQ A;  3JRX A;  3TIN A;  2N55 A;  1YNJ D;  3B6Y A;  5ELN A;  3CCU A;  3NQI A;  3K0X A;  2EJG C;  2G5D A;  2QDL A;  4MV4 A;  4EGQ A;  3J80 L;  3HOW H;  2XC9 A;  5J2U F;  2CKZ B;  3K5L A;  2JA8 H;  4ECW A;  4C3J G;  2B8F A;  4CKC A;  4X66 L;  3QZ8 A;  3GTQ B;  2R93 G;  1L1O C;  4JV0 A;  4IN3 A;  1DM0 B;  2CW0 C;  3PGZ A;  4C3H H;  1XPU A;  2RDJ A;  4LF7 H;  3KBG A;  2BE5 C;  3GTJ B;  1IKM A;  3A8J E;  1VQJ A;  3NGD A;  4KD3 A;  4O1N A;  1FNW A;  5GON F;  4TQR A;  3W2D A;  4KJO A;  1KC7 A;  1SLJ A;  1CUK A;  1AFP A;  4RAZ A;  4J9L A;  2BQ3 A;  1N33 H;  1I3Q B;  2VPS A;  1CE8 A;  1J6Q A;  2WKC A;  1XJV A;  2EJM A;  3A74 A;  4DUZ L;  3NE5 B;  2XIG A;  1C0A A;  3RV4 A;  1EQQ A;  1V1P A;  2C2R A;  3VMM A;  2YU9 A;  1VDZ A;  1CKN A;  4LSX A;  2JSO A;  1B3Q A;  2HCC A;  3GV6 A;  3PW0 A;  2K5H A;  1CI3 M;  4YBZ B;  2JJQ A;  4LF4 L;  3EBE A;  1XNQ L;  3I4M B;  2XRQ D;  1HFN A;  1YNN C;  4GOP B;  2EJF C;  1BBW A;  4F4Z A;  3JSL A;  2EOT A;  2JEI A;  1Y1V A;  4KHZ A;  5M3F H;  4WFN 3;  4BY1 H;  3O13 A;  2IBK A;  3UI2 A;  2V4D A;  3S16 H;  3LX0 A;  4XT3 B;  1TWF A;  3Q8S B;  1KRT A;  1EZ1 A;  2JQO A;  4DR5 H;  2N49 A;  4IUU A;  1PYB A;  4L5Q A;  2R8I A;  3DWQ A;  3PIP 3;  4JBJ A;  4PQX A;  5FPO A;  5KFK A;  4DV1 H;  2UUA H;  3DEP A;  4Q0F A;  4ZKC B;  3HOZ B;  4F4X A;  3PW7 A;  1NR2 A;  4WJW A;  1T5X D;  1A6X A;  1BKB A;  1GJX A;  4AQY L;  2ENB A;  2NUA B;  3JRW A;  2PI2 A;  5HY6 A;  3RN5 A;  4EFB A;  1G8Z D;  2CH4 W;  3TP5 A;  4QIW A;  2WB1 E;  1V1P B;  1SAP A;  4KY6 A;  5DM7 3;  3HOV G;  3I4L A;  1D2B A;  3KDF A;  3G71 A;  3TZU A;  4ZUI A;  4RG1 A;  4BA2 I;  2XD4 A;  4HQ6 A;  3PUX A;  5JQW A;  4AYB A;  1HJP A;  4BWS C;  4G4K A;  4X66 H;  4ECZ A;  4J9P A;  2YZM A;  5IGC A;  1Q86 C;  1OTC A;  1R9T B;  4IZO A;  4RUA A;  1AW7 A;  2IT1 A;  2KEC A;  1VQ7 A;  1PX2 A;  3VA5 A;  5KG2 A;  1F9S A;  3BDO A;  1UC9 A;  1DZ1 A;  2NTT A;  4QB4 A;  1PH5 A;  4LF4 Q;  1RKN A;  1B6S A;  1GSH A;  1XNQ Q;  2MJ8 A;  4KHV A;  1X3E A;  1S4Z A;  4TSS A;  5C4X G;  4FBT A;  4RCN A;  4JI8 H;  1BDO A;  1TWF B;  3A7A B;  4I4T F;  4A3K H;  1RD9 D;  4V19 0;  3S17 H;  4DUZ H;  4BWG B;  3WO1 A;  1TWA B;  2VUM A;  1EWC A;  1JXL A;  4BBS B;  2ICE C;  3FHW A;  3Q6S A;  2YYZ A;  1IL2 A;  1AN7 A;  2W71 A;  1PLF A;  1X56 A;  2K32 A;  1PTO H;  4Q44 A;  1STE A;  4KLK A;  2A69 C;  1E1T A;  4A3B B;  4B3T H;  3OWF A;  1K8O A;  4DR1 Q;  1JDE A;  5BN4 A;  1VQ5 A;  1YI2 A;  5KFM A;  4OO1 H;  3G7L A;  4X64 L;  3HXL A;  1NY4 A;  4QCL A;  2NTS A;  3KDF B;  3RMH A;  3MHB A;  4AQY Q;  4ME5 A;  4AYB B;  2F3W A;  2WTF A;  3GV7 B;  4RNO A;  3U9O A;  4X6A H;  3OHA A;  5CA0 F;  4OX9 L;  3WDN A;  2GPS A;  1TA8 A;  2K50 A;  1CQI B;  3HRZ C;  1IOW A;  5IYD H;  2Z1C A;  2NVX B;  3RTX A;  5D1O A;  3WNZ A;  3K5O A;  2QF7 A;  3TRE A;  3S1M H;  1XX8 A;  3S14 B;  1GSO A;  4CBV A;  1VQK A;  4GS3 A;  3ETJ A;  4B3R Q;  1S5C D;  3G8C A;  4DK6 C;  4CDC C;  2UXB L;  1RK6 A;  2W70 A;  5CMD A;  4DR3 H;  2VW9 A;  4CKB A;  5HGT A;  3AMU A;  5LMN Q;  2VUM B;  3N6R A;  5C44 H;  2BDN A;  1WTV A;  4LMY A;  3JAM W;  2IHE A;  1EOT A;  1SNP A;  2FHT A;  3I4N H;  2GLT A;  3HOZ G;  4U6P A;  2A1A A;  1GLV A;  2PPB C;  2QCP X;  2BA1 A;  3CCV A;  3D4D A;  2QW7 A;  5DNF A;  4DK3 C;  1EFW A;  5JVL A;  1O7I A;  2NVT H;  2AKW B;  4OIJ A;  4A2B A;  4IAJ A;  4FS1 A;  3GTL A;  3CC4 A;  1S97 A;  4IUR A;  3NK9 A;  4HCE A;  3SHL A;  4A75 A;  3T5L A;  5DAU A;  5IP7 G;  1GXD C;  1YZ6 A;  2AMC B;  4Y7N H;  3RZD H;  3TQT A;  4TQS A;  2D5D A;  3GQC A;  4DPG A;  1EHI A;  2F4I A;  3MWY W;  3SK8 A;  3VR5 A;  1B9M A;  4X64 Q;  3FMA A;  1HNX Q;  3N44 B;  3J81 W;  1TT2 A;  3M4I A;  2WAQ A;  1BNC A;  4QWD A;  1KJI A;  4XQQ A;  3VR2 A;  3PR4 A;  2OEO A;  1MSG A;  2SNM A;  1K8A C;  4LH7 A;  5E1F A;  1SNC A;  5D1O B;  4L5R C;  1G91 A;  4CJ2 C;  1U4L A;  3TIG A;  4OX9 Q;  2ZXP A;  1LTI D;  4C2M A;  1KJJ A;  3E3X A;  2I5L X;  1UE7 A;  4A3D B;  4Q8E A;  4FF1 A;  4X65 L;  4ECU A;  1SNM A;  2KA7 A;  2XGT A;  1A8V A;  3S2D B;  1DCZ A;  3R2I A;  4I50 F;  3FMC A;  1LAB A;  4JG2 A;  1QVF A;  1ENA A;  4QUC A;  3K8A A;  5KIX A;  5KG4 A;  2WB1 A;  4ECY A;  4BBS G;  3RF2 A;  4RFB A;  4EG0 A;  2B8G A;  2UXB Q;  1B70 B;  2B29 A;  4RNM A;  2EQS A;  4JI0 L;  4DR6 Q;  3E0E A;  1E2Z A;  3HOX G;  4GNX A;  2NU9 B;  5IT9 W;  1Y1V H;  1YNJ C;  4DV3 L;  3GTL B;  3SXH A;  2KJX A;  1NR4 A;  1Z2N X;  4HYK A;  4QQB X;  1Q1E A;  4ZI7 F;  5GAD C;  5FLX E;  3VYU A;  3DXJ C;  4DN4 M;  1I94 H;  1STG A;  2A73 B;  4KHP L;  5BN3 A;  4IOA A;  1IBL L;  1O7Z A;  1VQ6 A;  4HMJ A;  2I8C A;  1Z7T A;  1GOZ A;  2WKD A;  1E24 A;  2UXB H;  2NZH A;  1BJT A;  4RU9 A;  4ED3 A;  3KHG A;  2PQE A;  3BAA A;  1WFQ A;  5JOB A;  1XMO L;  4DV0 H;  2PN1 A;  1MIU A;  3W1B A;  4FU0 A;  2ZTE A;  3CPW A;  2B2V A;  4YCW A;  2IX3 A;  2AGQ A;  4C2M B;  4C1N I;  1K1S A;  1S03 G;  4G7H C;  1STY A;  2YTY A;  5IYC H;  4X3S A;  1TWC H;  4DAM A;  5EWG A;  3CQZ B;  1WD0 A;  2CWA A;  1PH4 A;  1W2B A;  5L1J A;  4YR0 A;  3V96 A;  3T4A C;  3PW2 A;  2WB1 B;  3P75 A;  4A3E H;  3J7A F;  2XNA C;  2E2I H;  4R4I A;  3H40 A;  1FJG L;  3TSS A;  2NYZ D;  3M3Y B;  2Q8R E;  2F0H A;  4HR7 B;  4GNX B;  1BF4 A;  4LSA A;  3E5N A;  2E74 C;  3IL8 A;  5KFG A;  4C3I B;  2LKV A;  1HZ9 A;  1NE3 A;  5K2M A;  5D3D A;  2DPJ A;  4JI0 Q;  2W57 A;  1MI2 A;  4LFB L;  4N8F A;  1ENF A;  2GA4 B;  4ED6 A;  1GD7 A;  4RZQ A;  1JE4 A;  1MKH A;  1YVC A;  3S9W A;  3F8N A;  5KG6 A;  1B44 D;  2V59 A;  5KT4 A;  2XWB B;  3DM1 A;  1JJC B;  2VB2 X;  1EQR A;  3V4Z A;  4X65 H;  2Z6K A;  3R2T A;  3GIM A;  1VQ8 A;  3NWS A;  2I0Q A;  1PYS B;  3MEF A;  4FDB A;  2EYM A;  3RLF A;  5ISR A;  4GN3 B;  5IP9 H;  4OL7 A;  3K5H A;  4YR3 A;  4JI0 H;  4XYL B;  5BR8 Q;  4RNN A;  2XGP A;  2XCA A;  2L1B A;  1RYR A;  3NTK A;  1HRJ A;  4DL6 A;  2BDO A;  2C35 B;  4V0B A;  4DV3 H;  4ULL A;  5K36 G;  4JV2 A;  3E0J A;  1LLR D;  4GLA C;  3TII A;  5DG9 A;  4IPH A;  1LTL A;  2F0F A;  2HDM A;  4IUQ A;  1ULZ A;  3MC0 B;  4MV3 A;  4DAP A;  4KHP H;  2F52 A;  2L9H A;  5C3X A;  1IBL H;  1J9O A;  1K83 A;  2LMC B;  3GIK A;  1GYF A;  5C8Y F;  3A0J A;  5NUC A;  3ULL A;  4ZUJ A;  1XTC D;  5K5P A;  1ASY A;  2J6U A;  5G3L F;  2PQA A;  1TXY A;  1XMO H;  3RGX A;  1B1Z A;  2ZTD A;  4DNI A;  2MO1 A;  4KTA A;  4LUO A;  5IGB A;  2JA6 H;  3PF4 A;  2M05 A;  5DLG A;  2EXZ A;  2UU9 H;  4ZOL F;  1BXR A;  3DMU A;  2K1B A;  2K04 A;  5EAY A;  4JUZ A;  4TQU S;  3SI8 A;  2BH8 A;  2FPI B;  1PH8 A;  5IT9 L;  4LFB Q;  2N3S A;  3NQT A;  4O3Q A;  4HID A;  4DV2 L;  2RGV A;  2FLP A;  1AUX A;  1VQD A;  2SEB D;  1GGO A;  4ECR A;  3K58 A;  2J9G A;  4RKB A;  1K28 A;  3TP7 A;  2IX1 A;  1VQN A;  1LTB D;  3T16 A;  1ZEQ X;  4JI1 L;  1FJG H;  1VQL A;  2UVU A;  3BAB A;  2O4X A;  4R4O A;  2VOB A;  3N8D A;  1EY7 A;  4RMF A;  1B4O A;  2B2W A;  3HOY B;  4EBE A;  4C1N K;  4A3F B;  1X65 A;  3VYT A;  1SFO B;  2R61 A;  2NVQ B;  4LFB H;  1N32 L;  1I50 B;  1DOK A;  5T14 A;  2E5L H;  5IE8 A;  4EBD A;  1GVP A;  1WTQ A;  3T5K A;  1QG7 A;  1K83 B;  3MFI A;  1SCU B;  2R7F A;  2R86 A;  2WFW A;  3T1H L;  1NBW A;  3TS0 A;  1B7Y B;  3M7G A;  3BDC A;  4C3I G;  2Y0S G;  2PQA B;  1L0Y B;  2UXD Q;  5C1P A;  2B63 A;  3S1R B;  1WCM G;  1X3F A;  3TP6 A;  1N34 L;  3PIP A;  4A93 H;  1KL9 A;  5IOD A;  2NB0 A;  4DV6 L;  4QY7 A;  2HHH L;  4GKJ Q;  3L0O A;  3Q0A A;  4L1K A;  5D1P A;  1D1K A;  4ETS A;  4RGM A;  2OXP A;  4YAK B;  1FL0 A;  3H4D A;  2JA5 H;  1X3Q A;  3QJY A;  4YIJ A;  4ZYS A;  4DKA C;  4JCV E;  1VQ9 A;  3PUZ A;  2PZW A;  3CME A;  3ICE A;  4GN5 A;  3PO3 B;  2K5Q A;  3GTM A;  3AFQ A;  3L4K A;  3OSP A;  4J1M A;  1EZ8 A;  4KMU C;  1SE4 A;  4RAY A;  4GLX A;  2K28 A;  4CDD C;  1XPO A;  4UY8 C;  1NCV A;  4A3I G;  2XCL A;  1PFN A;  3EVQ A;  1E0B A;  4DV2 Q;  3NHH A;  3P20 A;  2VZA A;  1IOV A;  3S1Q B;  2B2Y C;  2R6F A;  1EEF D;  4EFE A;  4QWE A;  4MHE A;  2MHV A;  4LF9 L;  4YCU A;  1JT8 A;  3MWM A;  4LAA A;  1HTL D;  5CGK A;  1NMG A;  3MZ5 A;  1SYB A;  5GAH C;  2D9U A;  2R93 A;  5KFD A;  1FKA H;  2XGQ A;  3BQ1 A;  2R87 A;  1MHW C;  2C9O A;  5KFV A;  1JOK A;  3OTO L;  4G7O C;  1B9N A;  4DR4 Q;  3BQ0 A;  1F2Z A;  4JBW A;  4F8M A;  4LH6 A;  2B2T C;  1SN8 A;  1GUO A;  1PTO F;  2MP1 A;  3CW2 C;  1P16 A;  3OMG A;  3QB3 A;  5C5M A;  1Q82 C;  1BBX C;  4JI1 H;  2HIX A;  3FKI H;  5FLX c;  1UE5 A;  4WJ4 A;  1I4P A;  4MAM A;  1QUQ A;  1JWU D;  4HIO A;  1UNN C;  4I7A A;  2HT1 A;  1I7L A;  5KT2 A;  5LA6 F;  3AQQ A;  4PMW A;  2D2C C;  3J80 W;  1N32 H;  1H9M A;  4LWC A;  1SRO A;  3RLO A;  3PO2 B;  2BQR A;  1DD2 A;  1S0N A;  2DLN A;  3VDY A;  4O3S A;  3KF8 A;  3R3O A;  3T1H H;  2JXM B;  3HOY G;  2VS1 A;  1FYC A;  4KN7 C;  1LTT D;  4HED A;  4MV1 A;  2SNS A;  1X3G A;  3HOW B;  3CD6 A;  4C3J B;  4RB2 C;  3BQ2 A;  1KC8 C;  1N34 H;  2R93 B;  3I2Z A;  4O4I F;  4HJA A;  4MNO A;  4DV6 H;  4HN7 A;  2W8L A;  2HHH H;  3H0G G;  2QGQ A;  3GV3 A;  3JSN A;  2Z8L A;  3GTP H;  3CCM A;  4YY3 H;  2EYL A;  2O2L D;  1EUD B;  1TWG H;  1Y1W G;  3KLS A;  3V4S A;  3PR5 B;  3FVQ A;  2B2U A;  2X0S A;  1W6J A;  3F1Z A;  3Q24 A;  1VF7 A;  1VS0 A;  1A15 A;  2VQF H;  2YRW A;  3OTO Q;  1CA6 A;  5IY0 A;  4JI6 Q;  3PUW A;  2K03 A;  4PNY A;  1IBK L;  4JYA Q;  4Q43 A;  2KHI A;  4YWK A;  3PO3 G;  4LF9 H;  1Q3L A;  4BY7 H;  4LUZ A;  3Q8Q B;  4DV4 L;  3L3O C;  1N8R C;  1A2T A;  2L5T A;  1CSP A;  4RB1 A;  1UC8 A;  1SMY D;  4XYO A;  3KF8 B;  1G6Z A;  1WSC A;  3NEL A;  3IN5 A;  1A2U A;  3DM3 A;  1S5E D;  1F77 A;  3PQI A;  5LYJ F;  4WD3 A;  2SOB A;  5IWA Q;  1PFM A;  2F0D A;  3KK7 A;  3U9S A;  1D1I A;  4JI4 H;  4G7Z C;  1PV4 A;  2I87 A;  3HOU G;  4B08 A;  5M3F B;  5M3M G;  4BY1 B;  3H3V I;  1VAJ A;  1HPC A;  1G6P A;  5EKI A;  4MV8 A;  4RZR A;  1B04 A;  2A5H A;  2FLN A;  3GTQ A;  4DK0 A;  4A3J G;  5LL6 S;  3X3M A;  2NVY H;  3SK5 A;  5A2Q E;  3A56 A;  3EA6 A;  4GKK L;  3PW5 A;  2ZJR A;  3L9A X;  2JA7 H;  3K5M A;  2YV5 A;  4R9W A;  2YTX A;  3KOJ A;  1PZJ D;  1E2W A;  4HAE A;  1CT1 D;  1K0S A;  2X69 A;  2RBM A;  1ZET A;  4QWC A;  1U4M A;  3MXP A;  2W7P A;  1E7Z A;  3GQB A;  4H7B A;  5M5W H;  2ZDG A;  3S1N H;  1DOL A;  4EGJ A;  2XN9 C;  3KFU A;  5J1Z A;  5A35 A;  1AZP A;  3RJ0 A;  4DR7 L;  3TEH B;  1XNR L;  1JWM D;  1IBK Q;  3PO2 G;  3ORR A;  4J9S A;  2P0A A;  2DNE A;  2JE6 I;  4DV4 Q;  3BG3 A;  3TQY A;  4A3M H;  2CWP A;  1S40 A;  4EYH B;  4GOP A;  2R8G A;  2F0U A;  2DUD A;  2R92 B;  4RB3 C;  2YRX A;  1VBH A;  3GTM H;  2OT2 A;  3QO2 A;  5FO7 B;  3S2H H;  3HOW G;  5C4X B;  3VR3 A;  1WTH A;  3BYT B;  1N36 L;  3CC2 A;  2VY3 A;  4L6T B;  4XQN A;  4C3H G;  4P74 A;  3KLR A;  1IHZ A;  1LTS D;  4UFZ A;  4QW9 A;  4EQN A;  1TWH H;  1IBK H;  4F4Y A;  1VMC A;  4DXG A;  2W6P A;  4Q0Y A;  3D6C A;  2VQE H;  2YW2 A;  5CV8 A;  1VQH A;  1UE6 A;  4DV4 H;  4FP5 D;  1STB A;  3H91 A;  3F2D A;  4GKK Q;  4MA5 A;  2UXC Q;  3I70 A;  1VMP A;  5DM6 3;  4YHH Q;  1BGW A;  5KFB A;  4POF A;  3VPC A;  2F0E A;  1RTO A;  3MAQ A;  4A3G B;  2KCC A;  1AE2 A;  3K57 A;  3PF5 A;  4PG3 A;  1VQC A;  1M90 C;  1B50 A;  1TS2 A;  1RJT A;  4KD4 A;  4R1J A;  1E1O A;  3ORQ A;  3MR6 A;  1E4G T;  1IW7 D;  3V6H A;  2EYO A;  1PH9 A;  1XXG A;  1BNZ A;  4IRD A;  1KDC A;  3K7U C;  1NTG A;  2E75 C;  3OIP A;  5C3E H;  5M5Y B;  2ZXO A;  2K14 A;  1R9T A;  4GKK H;  4DR7 Q;  1EY4 A;  1XNR Q;  2YL2 A;  4R7R A;  3D4R A;  1LUZ A;  5I2X A;  2L15 A;  5M3F G;  4BY1 G;  3S15 H;  2F3I A;  2W6O A;  2C00 A;  4O2D A;  3SDZ A;  5EQ0 A;  4C56 C;  5KT7 A;  1I4G A;  4R4C A;  1MJC A;  2X6L A;  5IGG A;  2PYK A;  1TWA A;  4RHR A;  1CKM A;  2V1C C;  1Q7Y C;  4DR1 L;  1S72 A;  1N36 Q;  2R7Z H;  3OYY A;  3KJO A;  2RKS A;  3M4O H;  2A6E D;  1SMX A;  2JA9 A;  2EE1 A;  2MUY A;  5ELO A;  4Q5V A;  2E8G A;  3K3P A;  1HQM C;  3F2U A;  1QOH A;  4IZ8 A;  3DLL A;  4POG A;  2F0S A;  3N42 B;  1YJW A; 
#chains in the Genus database with same CATH homology
 4JG2 A;  5M5X H;  3UDI A;  3K8A A;  3CP0 A;  5LMU Q;  4BBS G;  1YNX A;  2UXB Q;  1B70 B;  2B29 A;  1A0I A;  2EQS A;  4JI0 L;  2OQ0 A;  3GD7 A;  1YHQ A;  3GTO H;  4DR6 Q;  3E0E A;  3HOX G;  1WJJ A;  4GNX A;  3PO3 H;  1Y1V H;  4JI2 L;  3PSI A;  4DV3 L;  5AJ3 L;  3CCS A;  1VQE A;  3CQZ H;  4NXM L;  2JEA I;  2Y0S E;  1FVI A;  1IBM Q;  4QQB X;  1Q1E A;  3I55 A;  1N33 L;  3W1G A;  5GAD C;  4A3L G;  1UWV A;  2WB1 G;  3CXC A;  1K9M C;  2VNU D;  2Z0S A;  3HKZ E;  4B3R L;  2LXK A;  3I56 A;  1YIJ A;  3H15 A;  4KHP L;  2UXC L;  2JA7 G;  3L7Z C;  5HGQ A;  4YHH L;  1SE8 A;  1IBL L;  5DLQ E;  1VQ6 A;  2R92 G;  5LMN L;  3S1Q H;  1E24 A;  1IZ6 A;  4OWX B;  4C3I H;  2ZM6 Q;  1X55 A;  2NZH A;  2QEX A;  2YTV A;  1WCM H;  1WFQ A;  4A3K G;  1N9W A;  1XMO L;  1MIU A;  3W1B A;  4ALP A;  1D7Q A;  2D0O A;  3IRB A;  2KEN A;  2ZTE A;  4R4Q A;  3CPW A;  2R7D A;  4YCW A;  3G6E A;  4BBR H;  1Q12 A;  3RZO H;  2YTY A;  5IYC H;  1E22 A;  4B3M Q;  1C9O A;  1MJE A;  5C0X J;  2Q2U A;  5LMN W;  4YY3 L;  2QA4 A;  1TWC H;  4DAM A;  2B63 H;  2B3G A;  4IJL A;  2CWA A;  1PH4 A;  1W2B A;  1OXV A;  3RR5 A;  2KBN A;  5IYB H;  3ZJY C;  4OO1 G;  3GTQ H;  4A3I H;  3HKS A;  2VQF L;  4HIK A;  4A3E H;  1X9N A;  4R4I A;  1U5K A;  4A3M G;  1HNX L;  2E2I H;  1FJG L;  3GTJ H;  4A3G G;  3W5O A;  4GNX B;  1AH9 A;  4JI1 Q;  3NBH B;  1PFS A;  2R6G A;  4P72 A;  4GNX C;  2JA8 G;  5FLM H;  2ES2 A;  1HZ9 A;  1NE3 A;  4PZ8 A;  4JI0 Q;  1I3Q H;  2ZJQ A;  4BXX G;  5GAE C;  4LFB L;  3Q8D A;  4HJ8 A;  3PO2 H;  2NZO A;  1EIF A;  5IYD G;  3MXN B;  4JI2 Q;  1GD7 A;  1OXU A;  1VQB A;  3EIV A;  4GN4 B;  1L0W A;  1MKH A;  1YVC A;  5AJ3 Q;  1YEZ A;  4NB3 A;  1PHJ A;  4NXM Q;  1JJC B;  1PA6 A;  1N32 Q;  2EIF A;  1N33 Q;  1EQR A;  4HJ9 A;  5LMU L;  4PZ7 A;  2Z6K A;  1VQM A;  2MQH A;  5J3B A;  1VQ8 A;  1EWI A;  4JI4 L;  2I0Q A;  1Q8K A;  1PYS B;  3BJU A;  5FJ8 H;  3PIO A;  3MEF A;  4FDB A;  4C3J H;  3KYH C;  1Q81 C;  4DR6 L;  3T1H Q;  3RLF A;  1PH2 A;  2R93 H;  4GN3 B;  3RLN A;  5IP9 H;  5C44 G;  2D62 A;  1VQA A;  3CAM A;  3I4M H;  5BR8 Q;  1IBM L;  3UDG A;  2VL6 A;  1HNW L;  2WP8 J;  4MTN A;  1AE3 A;  1X6O A;  2I5H A;  2NN6 G;  1N34 Q;  3PUY A;  2C35 B;  4IFD I;  2K5V A;  4DV7 L;  4DV6 Q;  2KCM A;  2HHH Q;  1HH2 P;  5H1S E;  5K36 G;  2HIV A;  2Q2T A;  2IY5 B;  4GLA C;  3HFZ B;  3M4P A;  4IPH A;  4LW1 A;  5C3E G;  4JI8 L;  4YY3 Q;  1LTL A;  2ZM6 L;  3ULP A;  3T1Y L;  4IOA A;  2CQO A;  1S3O A;  2F52 A;  2Q2H A;  4Y52 H;  2CFM A;  1JMC A;  3HOY H;  1G51 A;  3A0J A;  2OCE A;  2VQF Q;  3ULL A;  4A3F G;  1JJG A;  1QZH A;  2AHO B;  4NPS A;  4R4T A;  3RN2 A;  4QL5 A;  1SFO H;  1ASY A;  3HOZ H;  2PQA A;  1TXY A;  2NVQ H;  1SRU A;  2XTI A;  4DR5 Q;  2ZTD A;  4DNI A;  4JI5 L;  2MO1 A;  4LUO A;  2JA6 H;  3PF4 A;  4B3T L;  2UUA Q;  4LF9 Q;  4DV1 Q;  4TVA B;  3H0G H;  5EAY A;  5GAG C;  1GO3 E;  4TQU S;  1KHI A;  2GN5 A;  2BH8 A;  2A8V A;  2R7Z G;  1YHB A;  2OWO A;  1PH8 A;  1JB7 A;  4LFB Q;  2N3S A;  1Y1W H;  3NEM A;  1RIP A;  2Z6K C;  2YU9 H;  4HID A;  4DV2 L;  3A5Z B;  1VQD A;  4XIG S;  1B8A A;  2IX1 A;  4QJF A;  1VQN A;  3J7Z C;  2WAQ E;  4JI1 L;  1K8G A;  1VQL A;  3M85 A;  4LFA Q;  1CKO A;  4LF6 L;  4R4O A;  1R9T H;  2MO0 A;  1K73 C;  4OON A;  1QUQ B;  4JI4 Q;  4RMF A;  1T9H A;  2ALY B;  1Q1B A;  4NXN L;  1C7Y A;  4LF7 L;  2LSS A;  4ME3 A;  2UUC L;  2IX0 A;  5JJK A;  1QVG A;  3M4Q A;  2CCZ A;  4X66 Q;  1Y1V G;  1VCI A;  1X65 A;  4LFC L;  3ULJ A;  2VQE L;  2E2J H;  3STB D;  1GKH A;  1RL2 A;  3J80 i;  1HNW Q;  1N32 L;  2H5X A;  1JJ2 A;  5IE8 A;  1GVP A;  1TWF H;  4UPA A;  3CCE A;  3U50 C;  5JEA J;  4DV7 Q;  3U58 A;  4DR3 L;  3RNU A;  2N78 A;  2ATW A;  2R7F A;  4IO9 A;  1TWA H;  2PI2 E;  2RHS B;  4JBK A;  1M1K C;  1NMF A;  2WFW A;  3T1H L;  1NBW A;  1VQG A;  3HOV H;  4QIW E;  1B7Y B;  4JI8 Q;  3T1Y Q;  3K80 C;  3TS0 A;  2ASB A;  1LM0 A;  1UE1 A;  3HOU H;  2Y0S G;  2PQA B;  5M3M H;  3S1R H;  1D8L A;  4DUZ Q;  1CKN B;  1GM5 A;  2UXD Q;  5BR8 L;  4WJ3 M;  3G48 A;  1WCM G;  3E9I A;  4AYB E;  3HKZ G;  4EQ5 A;  4A3B H;  1L1O A;  1X3F A;  4K0K Q;  2KCT A;  4OWW B;  4MZ9 A;  3PIP A;  1N34 L;  4DR7 Q;  5C0X G;  4A3J H;  4A93 H;  1KL9 A;  5GRO A;  4DV6 L;  4QY7 A;  2HHH L;  4GKJ Q;  3L0O A;  1FL0 A;  5IYC G;  3PV0 A;  2AWN A;  2JA5 H;  1HZC A;  4JI5 Q;  1VQ9 A;  3ICE A;  4DKA C;  4JCV E;  3PUZ A;  3CME A;  1SR3 A;  4O0A A;  4GN5 A;  4B3T Q;  2R92 H;  3AFQ A;  4JV5 Q;  3CPF A;  2B63 G;  5GQO A;  5C4X H;  2MNA A;  2I5M X;  2BA0 A;  4GLX A;  1XPO A;  1QZG A;  3D31 A;  4IPD A;  1YHA A;  5IYB G;  4UY8 C;  4A3E G;  3FP9 A;  4A3I G;  1OXT A;  2F4V L;  3AYH B;  4DV2 Q;  1XMQ L;  1EOV A;  4YCV A;  4A3C G;  1OXX K;  2VZA A;  4DR5 L;  2JEB I;  4JC0 A;  2NVX H;  4IFD J;  3GDE A;  2UUA L;  4LF6 Q;  2ID0 A;  1BVS A;  4YCU A;  3J80 c;  4DV1 L;  4LF9 L;  3GTG H;  1H95 A;  1JT8 A;  1UEB A;  3U4V A;  5FLM G;  4LUV A;  4LF7 Q;  1JE5 A;  1NMG A;  4NXN Q;  3L2P A;  2UUC Q;  4QGU A;  4H02 A;  5GAH C;  3AEV A;  1WYD A;  3TRZ A;  4LFC Q;  3F8T A;  3UE0 A;  3ER0 A;  2VQE Q;  2VUM H;  1VQO A;  1CSQ A;  3B6Y A;  5ELN A;  3CCU A;  4A3G H;  3OTO L;  3K0X A;  4LFA L;  4DR4 Q;  4P73 A;  4LF8 L;  4JBW A;  2PMZ E;  4DR3 Q;  1SN8 A;  1EYG A;  3HOW H;  5FJ8 G;  2IHF A;  2CKZ B;  1P16 A;  3CW2 C;  1L1O B;  4BA1 I;  1FGU A;  1Q82 C;  5E7N A;  2JA8 H;  1NJI C;  3E9H A;  4X66 L;  4DAY B;  2R93 G;  2HIX A;  1L1O C;  3FKI H;  5IP9 G;  5FLX c;  3PGZ A;  4C3H H;  1XPU A;  1UE5 A;  4WJ4 A;  5M5Y H;  1VQJ A;  1QUQ A;  2JK8 A;  3I4M G;  3G4S A;  3I4N G;  4HIO A;  4X62 Q;  2HT1 A;  4DR2 L;  2D0P A;  1I94 L;  3J81 c;  1SLJ A;  1VQP A;  1CUK A;  3AQQ A;  4PMW A;  2LXJ A;  4LWC A;  1SRO A;  1V1Q A;  1LYL A;  3K81 C;  3RLO A;  1Z9F A;  1J6Q A;  4DUY L;  1XJV A;  1PVO A;  3F2C A;  3VDY A;  1EUJ A;  3A74 A;  4DUZ L;  2UXD L;  3KF6 A;  4DV0 L;  1C0A A;  4K0K L;  3HOY G;  1EQQ A;  4OX9 Q;  3PCO B;  1A62 A;  2VS1 A;  4DV5 Q;  2F4V Q;  4GKJ L;  1X3G A;  4EX5 A;  1XMQ Q;  4A3D H;  2EXD A;  3CD6 A;  1CKN A;  4OO1 I;  1KC8 C;  2K5H A;  3I2Z A;  2JA6 G;  4HJA A;  3CMA A;  3S2D H;  2Q2I A;  2JJQ A;  4MNO A;  4LF4 L;  3EBE A;  3H0G G;  4JV5 L;  2QGQ A;  4J15 A;  1XNQ L;  4OWT B;  3GTP H;  4GOP B;  1G29 1;  1Q46 A;  1BBW A;  1L2F A;  3EN2 A;  5IP7 H;  3CCM A;  1TWG H;  1Y1W G;  4A76 A;  3S24 A;  2UUB Q;  1VQ4 A;  1HZB A;  2RF4 A;  4KHZ A;  5M3F H;  4BY1 H;  3F1Z A;  2GVB A;  4JOI A;  3CCR A;  1K0R A;  1VS0 A;  3UDF A;  3S16 H;  2GVA A;  3GTL H;  3OTO Q;  2MFI A;  5IY0 A;  4LF8 Q;  1KRT A;  3PUW A;  4JI6 Q;  2JQO A;  2N49 A;  1PYB A;  4L5Q A;  4B3S L;  4JBJ A;  1IBK L;  4JYA Q;  2KHI A;  4YWK A;  4AIM A;  3PO3 G;  2FXQ A;  4BY7 H;  1PH7 A;  4LUZ A;  5JEA G;  4DV4 L;  1N8R C;  2WAQ G;  1KD1 C;  3PUV A;  4DR2 Q;  4IOC A;  1PH1 A;  1I94 Q;  1BKB A;  1CSP A;  4JBM A;  4DR4 L;  4AQY L;  3KF8 B;  3CCJ A;  3NEL A;  1XPR A;  3KF6 B;  1PH3 A;  1KAW A;  3DM3 A;  2PI2 A;  5HY6 A;  3F2B A;  2ZJP A;  3KLW A;  3RN5 A;  1BBU A;  5IWA Q;  2RCN A;  3JAM i;  4BBS H;  3OW2 A;  2WB1 E;  2NN6 I;  4C2M H;  4DUY Q;  3HOV G;  1W3S A;  1PV4 A;  3KDF A;  3G71 A;  1PH6 A;  3HOU G;  1YBY A;  4JI7 L;  4RG1 A;  2BH2 A;  4BA2 I;  5M3M G;  3HOX H;  3PUX A;  3H3V I;  1HJP A;  4DV0 Q;  1G6P A;  4X62 L;  4OXP A;  3J7A 5;  4A3B G;  4L5T A;  1KIX A;  1Q86 C;  3GTK H;  1OTC A;  4A3J G;  4A93 G;  3ERS X;  5JJI A;  2IT1 A;  2NVY H;  4BBR G;  4A3L H;  1VQ7 A;  4GKK L;  2AWO A;  2ZJR A;  2JA5 G;  2JA7 H;  3A5U A;  3M3Y H;  1PH5 A;  4LF4 Q;  2YV5 A;  1HNZ L;  1YJ9 A;  2YTX A;  4AYB G;  3KOJ A;  1XNQ Q;  1X3E A;  5C4X G;  3J81 i;  1EIY B;  4IFD G;  4JOI C;  4DV5 L;  4A3K H;  4APV A;  4KI0 A;  4UP7 A;  3SGI A;  3CCQ A;  3S17 H;  1P8L A;  3CF5 A;  2OTJ A;  3M9B A;  1E7Z A;  1V43 A;  4IPC A;  3UDX A;  3KJP A;  2UU9 L;  1X54 A;  5M5W H;  1KXL A;  3S1N H;  3FHW A;  1HR0 L;  2ZTC A;  2YYZ A;  1IL2 A;  4YWL A;  4GLV B;  1XNR Q;  3KFU A;  3S14 H;  1X56 A;  1J5E L;  1U0L A;  4UP9 A;  4KLK A;  1E1T A;  4B3S Q;  3TEH B;  1XNR L;  4DR7 L;  1IBK Q;  4DR1 Q;  3PO2 G;  2UUB L;  1VQ5 A;  1YI2 A;  3JAM c;  1ASZ A;  4XTC S;  2JE6 I;  4X64 L;  4L5S A;  2VUM G;  3TS2 A;  4DV4 Q;  4A3M H;  3TQY A;  4X65 Q;  2CWP A;  1S40 A;  1NY4 A;  4IPG A;  4GOP A;  3KDF B;  2DUD A;  3WWV A;  4A3C H;  4AQY Q;  1VQF A;  1HR0 W;  4JI6 L;  4JYA L;  2HQL A;  1Z47 A;  3GTM H;  1WOC A;  4IJH A;  3HOW G;  3S2H H;  1A63 A;  4X6A H;  4HJ7 A;  4OX9 L;  1I5F A;  2A19 A;  5C4J H;  4HJ5 A;  1N36 L;  1HZA A;  3FKI G;  2N8N A;  2VY3 A;  1KQS A;  3CC2 A;  4LF5 L;  4BXX H;  1I6H H;  4JI7 Q;  2K52 A;  2K50 A;  4P74 A;  1QVF A;  2E5L L;  3J81 j;  5IYD H;  1TWH H;  4P71 A;  4JI3 L;  3TRE A;  4DV3 Q;  3BU2 A;  3S1M H;  1OXS C;  1VQK A;  1VQH A;  1UE6 A;  3M7N A;  4GS3 A;  1XTD A;  2E2H H;  4A4I A;  5IWA L;  3F2D A;  4GKK Q;  4B3R Q;  2DGY A;  4DK6 C;  2UXB L;  4LNQ A;  5JJL A;  5C0X I;  4KHP Q;  2UXC Q;  1IBL Q;  4YHH Q;  2VW9 A;  1HNZ Q;  4POF A;  5LMN Q;  3BZK A;  5C44 H;  3STB C;  2RHQ B;  2IHE A;  1AE2 A;  3I4N H;  3PF5 A;  1WI5 A;  1XMO Q;  4PG3 A;  1VQC A;  2A1A A;  3LGJ A;  1M90 C;  3HOZ G;  1VQI A;  2BA1 A;  3CCV A;  4A3D G;  1EFW A;  4DK3 C;  2UU9 Q;  1DGS A;  4P75 A;  4R1J A;  1O7I A;  1E1O A;  2AKW B;  2OTL A;  1Y14 B;  3CCL A;  2NVT H;  1QVC A;  4UP8 A;  1HR0 Q;  3H3V H;  2PNH A;  1PH9 A;  3CC4 A;  3K7U C;  1NTG A;  3U4Z A;  5C3E H;  1J5E Q;  4A75 A;  2K14 A;  5IP7 G;  1IYJ B;  1YZ6 A;  2AMC B;  4YWM A;  4Y7N H;  3RZD H;  4GOP C;  3I7F A;  3I4O A;  1LUZ A;  5IT9 c;  3D0F A;  2L15 A;  5M3F G;  4DPG A;  1YIT A;  4BY1 G;  4X64 Q;  4A3F H;  1HNX Q;  3S15 H;  2F3I A;  1IXR A;  1FJG Q;  2K75 A;  3CC7 A;  2KHJ A;  4O2D A;  3K7A H;  1K3R A;  4AH6 A;  4B3M L;  1K8A C;  3GO5 A;  1I50 H;  1YJN A;  4R4C A;  1MJC A;  4L5R C;  1E3P A;  3NEN A;  1CKM A;  1K83 H;  2V1C C;  1KRS A;  4PZ6 A;  4DR1 L;  1S72 A;  1Q7Y C;  1N36 Q;  3OYY A;  3KJO A;  2R7Z H;  3M4O H;  3BZC A;  4LF5 Q;  2OQK A;  4BY7 G;  2I5L X;  1UE7 A;  3AFP A;  1SMX A;  2JA9 A;  2K5N A;  2E5L Q;  3UE1 A;  5ELO A;  4X65 L;  2XGT A;  2E8G A;  4JI3 Q;  1A8V A;  1V9P A;  2K4K A;  3DLL A;  4HIM A;  4POG A;  3JC6 6;  1YJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...