1ZQ7A

X-ray crystal structure of protein q8pzk8 from methanosarcina mazei. northeast structural genomics consortium target mar9.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
204
structure length
201
Chain Sequence
MLTETEGRAAVKLARKTIEIFLSKGKSPRSGVELSPVFEEYRGVFVTLTEGGLLRGCIGHPYPDSTLKEAILDSAISAATRDPRFPTVEQDEMKNILVEVTILTQPEKINASPKELPDKVEIGKHGLIVKQGYCQGLLLPQVAPENDMDSIDFLSHTCMKAGLSPDAWVKGAEVYCFEGQIFKEKEPDGEVIEEKFLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MM0484
publication title X-Ray structure of the hypothetical protein Q8PZK8 from Methanosarcina mazei at the resolution 2.1A. Northeast Structural Genomics Consortium target MaR9.
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
total genus 52
structure length 201
sequence length 204
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01871 AMMECR1 AMMECR1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.700.20 Alpha Beta 2-Layer Sandwich Glycoprotein, Type 4 Pilin Hypothetical protein ph0010; domain 1 1zq7A01
3.30.1490.150 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Hypothetical protein ph0010; domain 2 1zq7A02
1VAJA 1WSCA 1ZQ7A
chains in the Genus database with same CATH superfamily
4QJFA 4GLXA 2J6SA 5KKNB 2V4RA 3M9MB 4J9MA 4ECRA 1V51A 4O3RA 2JA6A 4IR1A 4DV0H 1JLLB 2YYAA 2W7OA 4LF9H 4DL2A 5KG3A 2MCTA 1XDNA 5D1OB 2R93G 2UUAH 5KFSA 1ZETA 4DUYH 4M9UA 4JI0H 3BQ1A 3JRWA 4ECUA 5EDWA 1EHIA 4EGQA 1I6UA 2W7PA 2FP4B 4UCVA 2YU9A 1KJJA 1Y1VA 5FLXW 4AYBE 4J9QA 4GKJH 4EG0A 3Q8SB 1C3OA 3KAKA 3U9TA 3U9SA 1FJGH 4EFBA 4DR6H 3G20A 1RYSA 5LA6F 2VA3A 2YZNA 4TV9F 3MFHA 1CQJB 5LXTF 2AU0A 2BQ3A 2NU9B 4MTEA 1RK5A 1KJ9A 3TQ1A 4LF7H 5KX5F 4HNTA 4Q43A 3OSPA 1T92A 1OQWA 5BR8H 2R8IA 5KG5A 4JUZA 3K3PA 2FLNA 2RGRA 2W6OA 3HOUG 3GTMA 3GQCA 4BWSC 3IG0A 3FKIA 5KFUA 5KT2A 2C2EA 4B3TH 4YP3A 3JAMW 4ETSA 2ZDGA 2BR0A 3L4JA 3FMAA 3Q2OA 3HOVG 2RF4A 4DV2H 2J9GA 4LMYA 3V4SA 4ECZA 5C4XG 2NU6B 4A3IG 3RB0A 2UU9H 3LWBA 1E4GT 1CQIB 4UCRA 3TINA 1I50A 1WCMA 3L4KA 4IRCA 2W6MA 3E5NA 5L1JA 5JH7F 3PR5B 3H4BA 4YR3A 2YL2A 5L1KA 2OH2A 4FBTA 4DL4A 1BXRA 3KHHA 4J9RA 2NVXA 3MWDA 3KHRA 2FB9A 4BXXG 3GTQA 3Q8RB 4XYMB 1PX2A 5EWGA 1QVEA 5KFTA 4LH6A 3M4IA 3JSNA 1X9NA 5LOVF 3H40A 1M7JA 4BBSG 4TV8F 5GONF 1VBHA 3RF2A 1N34H 1VBGA 4HNVA 3GTGA 1DZOA 3PW4A 5KG7A 4K0KH 2C22A 2HHHH 4PDBA 2GPWA 3JZIA 3N40P 4J9OA 3PW7A 4A3GG 3EPIA 2R84A 2WDTA 3GIKA 1RK6A 5IYCG 2R92A 2R8JA 1BGWA 1VS0A 2IMWP 1JDEA 4XZ3B 4A3JG 1JKJB 2VUGA 5K2MA 4DL3A 4ECVA 5JQWA 3KALA 2W9CB 3VMMA 2PMZE 5FD6A 4YJ2F 1X6PA 3R5HA 1HPWA 4IRDA 4LF6H 1TAEA 3N41B 2C35B 5KT5A 5HV6A 2Q2UA 2B63G 3T5LA 2Y0SA 5C3EG 2XCPA 2CKZB 5IT9W 4A3LG 5KFYA 2R6FA 1DIKA 3R23A 3GIJA 5C5JA 5KFHA 4F4WA 3PVXA 2X0SA 3TQTA 1VKZA 4JI8H 2FK1A 2FPGB 4ME6A 2JA5G 4IWXA 1E4EA 2O03A 1I7LA 3RV4A 1RJRA 2FPIB 4JV5H 4DLKA 5LMNH 2VQDA 1B33N 4EBEA 4XYLB 4F4XA 1WH2A 3RV3A 3VPDA 1N36H 4YB8B 4DR7H 2HVSA 3BABA 5HBRB 2WTFA 3FU1A 2JA6G 1S0OA 1CE8A 3K5HA 2YZGA 4O4IF 4MAMA 4RNNA 3ETJA 4M7EA 4QIWA 4F50A 2RDIA 2M7GA 5CAEB 5DQGA 2WAQA 4TQRA 1IBMH 1Y1VG 1AY2A 2WB1A 4CC5A 4ED6A 3PW5A 2CQYA 5DG9A 3ORRA 3GV5B 4R7RA 4A3EG 4JI4H 4CC6A 2BQRA 4KHPH 2YS7A 2QYZA 1HNXH 5KFPA 3BA9A 2R8HA 2UVWA 3N44B 2XD4A 3GTPA 2FLLA 1X6XX 4TUYF 3PN1A 4YAJB 4ZHQF 3GIPA 2UUCH 4X66H 1JIHA 2SCUB 1RG0A 4DUZH 2WE6A 1Y1WG 1N48A 4MV8A 4BY7G 4LW9A 4X65H 2DWCA 4ED0A 2NU7B 3MWMA 4C2MA 3GILA 4I4TF 2DLNA 2FJZA 3MR2A 3VPCA 4J9LA 3HOWG 1MZBA 4UCOA 2NUAB 3PO3G 3RBEA 4QW8A 3GN9A 1I7NA 4UCTA 1E4FT 4YHHH 4FS2A 4RNOA 2VUMA 2UXBH 5BMVF 5T14A 3AYHB 5KFWA 3GIMA 3KHLA 3J7AK 2W71A 5BPHA 2W9BA 2V59A 4LSAA 2V4QA 4RB2C 1FKAH 4NLGA 2AGPA 4A3KG 2YW2A 1GO3E 1IBLH 2YRWA 4MV6A 1TWGA 4A93G 3UQ8A 5L9XA 2R7KA 3M9NB 1W96A 4LSXA 2AGOA 3K5IA 1XMOH 4AQYH 3T5HA 5D8DA 3HOZG 4EEYA 1OWTA 4DL6A 5IP9G 2HGSA 5F9LA 4ECSA 2R7MA 2I80A 2C2DA 1W93A 2PILA 1Y14B 1IOWA 3K3VA 5KFJA 3MR6A 4FBUA 4UCUA 1KBLA 4YR2A 3KTMA 1GSHA 4A2BA 2W57A 2JA7A 3L2PA 4C5AA 2OLSA 4OX9H 4AYBA 4LFBH 3I4MG 4QWAA 3CQZA 1V4YA 3KHGA 2V9WA 2R82A 2C28A 2V5AA 4RB1A 3RIZA 5DG7A 1ZQ7A 3GTLA 2R93A 4RUAA 5L1IA 2PVPA 5DQIA 1K83A 1TWFA 4O2BF 4YY3H 1TWAA 5EWEA 4ZOLF 3RUPA 4DR5H 2XGPA 3EPGA 5EOYA 4LFAH 2VPSA 2ZJTA 2ASJA 5DGAA 1M6VA 2JA8G 4J9PA 1L2ZA 5KFKA 2M3KA 4HYKA 5KG1A 3MJFA 4O3OA 1V9PA 4X62H 1JX4A 1IOVA 3KXYT 3V6HA 2OWOA 3RGZA 4RAYA 4EGJA 5JVLA 3RAXA 3OTOH 3H0GA 2E2HA 2R8GA 2GLTA 4MV3A 3GIDA 4Q44A 4HR7A 3HOXG 4WD3A 2Y0SE 5KFBA 1N56A 1M0TA 3OSNA 3IN5A 2JEIA 3JSLA 2R7NA 4JI6H 4DV5H 5LYJF 4Q45A 5F9NA 1N33H 1K1SA 2UVVA 3OUZA 3N8DA 4O3QA 1DV2A 1Z2OX 1EZ1A 3I12A 4ZI7F 5JW8A 4IZOA 4ECYA 2R86A 2FPPB 3R5XA 4J9SA 4YAKB 5A2QW 1K1QA 4EFEA 5DLFA 2WYOA 4O3SA 2DPIA 2UXCH 4DV1H 1TA8A 4V1JA 2R87A 2XC9A 4ECWA 1S97A 1S68A 3RJ0A 2PBZA 5FPOA 1S0MA 1EUDB 2CW8A 2E2IA 2VA2A 4A3MG 2DIKA 5KFXA 4A2AA 3SI8A 2NVYA 3RBDA 3GTOA 4QIWE 4IHJF 4UFZA 4FS1A 2FK2A 4YR0A 4IR9A 3HKZE 1XNRH 4GC7A 4I7HA 3V6KA 4A3FG 4U7CA 2UUBH 4IAJA 4YQWA 1XNQH 1BJTA 1KC7A 3BAAA 4LH7A 3MWEA 2HJWA 2PY0A 1B04A 1T94A 2W70A 4QW9A 5D1OA 2KSWA 4ED7A 2R8KA 2DZDA 4PWQA 2VR1A 5LP6F 2PN1A 3T5KA 2ASLA 2AQ4A 4JV0A 2JEFA 1X6YA 4JYAH 3RGXA 1AN7A 4YJ3F 3H3VH 4ECXA 4EEQA 4JV2A 2BQUA 5KT6A 5KFFA 3QZ8A 2ZDQA 2R7ZA 5KFIA 5LMUH 3LP8A 3GIIA 4DR2H 1SFOA 3R5FA 5KFLA 2FMAA 4QWEA 1AUXA 1S9FA 3N6XA 1IBKH 3MFIA 5JVDF 4ED3A 5KFVA 4I55F 2VOBA 4WBNF 4QWDA 4MA0A 1AUVA 4U6PA 3PW2A 4LF5H 4LFCH 2B63A 5BPFA 1J5EH 2FLPA 3BJYA 2FE3A 4RZQA 3T1HH 3H4DA 5C44G 1A9XA 1RJPA 3BQ2A 4ED2A 2VPQA 5CA0F 4ED8A 3FKIG 4IRKA 3HOYG 2W6NA 5KFCA 1WR2A 1X6ZA 2FKLA 3WO1A 3OHBA 3F8NA 4RB0A 3PZPA 1O75A 1GSOA 3DF7A 1EYZA 1E4EB 2Q2TA 3Q8PB 2IP4A 3RFCA 1B6SA 1T36A 1SEIA 2RGVA 2W6ZA 1WCMG 2V58A 3JRXA 5FD5A 4JI2H 4RNMA 4IWYA 3HXLA 2NU8B 5KT4A 2ATLA 1ZHQA 5KG6A 4B3SH 4FM9A 3BQ0A 2CZGA 1CS0A 1SYXB 1SCUB 3N43B 2YS6A 4F4YA 1GSAA 5J2UF 2J6TA 4MV1A 1S0NA 4RZRA 4DR4H 2YCHA 4RAZA 5C8YF 1TWCA 3VPBA 4J9KA 4DL7A 1KJQA 3G8CA 2DPJA 2XIGA 1FVIA 2JEJA 3PO2G 2W8KA 3SOKA 4HQ6A 3T1YH 4Q0YA 1ULZA 5KG4A 1VAJA 2ALZA 2W8LA 1JXLA 3SOJA 5KFEA 2ZM6H 2XCLA 4BY1G 5KFRA 3OHAA 3RB4A 4LF4H 4A3CG 2UXDH 4C5BA 4LF8H 4Q8EA 2E5LH 2F4VH 3QFFA 3H0GG 4MA5A 1Y1WA 2R92G 2W6PA 5L1LA 3OUUA 2HI2A 1JDBB 4DV3H 3T5JA 4GKKH 2FK3A 5KFNA 3RTXA 1X6RA 5KFAA 2XGQA 3FDSA 3PR4A 5KG0A 4DL5A 2IA6A 1HNWH 2W9CA 4EBDA 4JI7H 4FU0A 2HVRA 1A0IA 4DR1H 4YBZB 4APMA 1X6QA 5J2TF 1T3NA 1S10A 4J0MA 2W9BB 2C00A 4DV6H 4EYHB 2UVUA 1UC9A 5DG8A 4RUCA 2R85A 3TIGA 3GV7B 4ECQA 4O4HF 4UCSA 4JV1A 5H80A 3UFXB 1PK8A 1HNZH 4JI5H 2YZMA 5C1PA 5KFDA 3HB9A 3G6VA 2RDJA 1M0WA 1HR0H 2JEGA 4EBCA 1DGSA 3PW0A 5EWFA 1I3QA 4DV7H 3N6RA 4Y8VB 3JZZA 4O3PA 2HVQA 4G3IA 3J80W 1S03G 2UVRA 3MR3A 3Q1KA 4RU9A 1BNCA 1KEEA 4Q8FA 5CB4F 1TWHA 5CA1F 3GV8B 3N42B 1ZHSA 3WNZA 4JI3H 5D1PA 2AGQA 2J6UA 5KFGA 2C2RA 2CW7A 4O3NA 4MTDA 3GTJA 1GLVA 5DLGA 4RB3C 3QZ7A 3ETHA 3RB3A 1I94H 5KFOA 5IWAH 2IBKA 1EUCB 2R7ZG 1N32H 1UNNC 2YRXA 1P8LA 5DGBA 1WSCA 4R8UA 1KJIA 3M9OB 3V4ZA 5KFQA 3BG5A 4TQSA 3GLKA 2R7LA 3KAJA 5KT3A 4X64H 3HBLA 3V6JA 1R9TA 2WAQE 4B3MH 4O2AF 4ED1A 5KFZA 4O4LF 4HNUA 5C1OA 1RYRA 4XX0B 2WB1E 5IYDG 2W9AA 4A3BG 4MV9A 2P0AA 2PMZA 1XMQH 3I4NG 1B6RA 3ORQA 4DR3H 3CVZA 5IP7G 3MR5A 4E4TA 2GPSA 2VUMG 1RJQA 2VQEH 4GC6A 2XCAA 4NXNH 2VQFH 3TIIA 5KT7A 4A3DG 1C30A 2QK4A 4B3RH 2I87A 3GTKA 3GIQA 5FPRA 3C0FB 5IYZF 4F4ZA 2I8CA 4C5CA 4J9NA 1Z2NX 4EYIB 3RB6A 3H20A 2KEPA 3EYYA 4QWBA 5FLMG 4NXMH 5EZYF 3J81W 2M05A 3HKZA 3G6YA 1GGOA 5I47A 4BBRG 4L1KA 3BA8A 5KG2A 5DQHA 5KFMA 4DV4H 4ECTA 1Z2PX 4JI1H 4QWCA 4ZQIA 4I50F 4R8UB 3JYZA 5IYBG 3Q8QB 2JA5A 1KJ8A 3LMLA 5LL6b 5FJ8G 3RAQA 1DV1A 4MV4A 1UC8A 4MV7A 2W6QA 3SE7A 5JUMA 2ASDA 2JA7G 1GYFA 3WO0A 3NGDA 3G6XA 2ZDHA
chains in the Genus database with same CATH topology
1VAJA 1WSCA 1ZQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAJ A;  1WSC A;  1ZQ7 A; 
#chains in the Genus database with same CATH topology
 4QJF A;  4GLX A;  2J6S A;  5KKN B;  2V4R A;  3M9M B;  4J9M A;  4ECR A;  1V51 A;  4O3R A;  2JA6 A;  4IR1 A;  4DV0 H;  1JLL B;  2YYA A;  2W7O A;  4LF9 H;  4DL2 A;  5KG3 A;  2MCT A;  1XDN A;  5D1O B;  2R93 G;  2UUA H;  5KFS A;  1ZET A;  4DUY H;  4M9U A;  4JI0 H;  3BQ1 A;  3JRW A;  4ECU A;  5EDW A;  1EHI A;  4EGQ A;  1I6U A;  2W7P A;  2FP4 B;  4UCV A;  2YU9 A;  1KJJ A;  1Y1V A;  5FLX W;  4AYB E;  4J9Q A;  4GKJ H;  4EG0 A;  3Q8S B;  1C3O A;  3KAK A;  3U9T A;  3U9S A;  1FJG H;  4EFB A;  4DR6 H;  3G20 A;  1RYS A;  5LA6 F;  2VA3 A;  2YZN A;  4TV9 F;  3MFH A;  1CQJ B;  5LXT F;  2AU0 A;  2BQ3 A;  2NU9 B;  4MTE A;  1RK5 A;  1KJ9 A;  3TQ1 A;  4LF7 H;  5KX5 F;  4HNT A;  4Q43 A;  3OSP A;  1T92 A;  1OQW A;  5BR8 H;  2R8I A;  5KG5 A;  4JUZ A;  3K3P A;  2FLN A;  2RGR A;  2W6O A;  3HOU G;  3GTM A;  3GQC A;  4BWS C;  3IG0 A;  3FKI A;  5KFU A;  5KT2 A;  2C2E A;  4B3T H;  4YP3 A;  3JAM W;  4ETS A;  2ZDG A;  2BR0 A;  3L4J A;  3FMA A;  3Q2O A;  3HOV G;  2RF4 A;  4DV2 H;  2J9G A;  4LMY A;  3V4S A;  4ECZ A;  5C4X G;  2NU6 B;  4A3I G;  3RB0 A;  2UU9 H;  3LWB A;  1E4G T;  1CQI B;  4UCR A;  3TIN A;  1I50 A;  1WCM A;  3L4K A;  4IRC A;  2W6M A;  3E5N A;  5L1J A;  5JH7 F;  3PR5 B;  3H4B A;  4YR3 A;  2YL2 A;  5L1K A;  2OH2 A;  4FBT A;  4DL4 A;  1BXR A;  3KHH A;  4J9R A;  2NVX A;  3MWD A;  3KHR A;  2FB9 A;  4BXX G;  3GTQ A;  3Q8R B;  4XYM B;  1PX2 A;  5EWG A;  1QVE A;  5KFT A;  4LH6 A;  3M4I A;  3JSN A;  1X9N A;  5LOV F;  3H40 A;  1M7J A;  4BBS G;  4TV8 F;  5GON F;  1VBH A;  3RF2 A;  1N34 H;  1VBG A;  4HNV A;  3GTG A;  1DZO A;  3PW4 A;  5KG7 A;  4K0K H;  2C22 A;  2HHH H;  4PDB A;  2GPW A;  3JZI A;  3N40 P;  4J9O A;  3PW7 A;  4A3G G;  3EPI A;  2R84 A;  2WDT A;  3GIK A;  1RK6 A;  5IYC G;  2R92 A;  2R8J A;  1BGW A;  1VS0 A;  2IMW P;  1JDE A;  4XZ3 B;  4A3J G;  1JKJ B;  2VUG A;  5K2M A;  4DL3 A;  4ECV A;  5JQW A;  3KAL A;  2W9C B;  3VMM A;  2PMZ E;  5FD6 A;  4YJ2 F;  1X6P A;  3R5H A;  1HPW A;  4IRD A;  4LF6 H;  1TAE A;  3N41 B;  2C35 B;  5KT5 A;  5HV6 A;  2Q2U A;  2B63 G;  3T5L A;  2Y0S A;  5C3E G;  2XCP A;  2CKZ B;  5IT9 W;  4A3L G;  5KFY A;  2R6F A;  1DIK A;  3R23 A;  3GIJ A;  5C5J A;  5KFH A;  4F4W A;  3PVX A;  2X0S A;  3TQT A;  1VKZ A;  4JI8 H;  2FK1 A;  2FPG B;  4ME6 A;  2JA5 G;  4IWX A;  1E4E A;  2O03 A;  1I7L A;  3RV4 A;  1RJR A;  2FPI B;  4JV5 H;  4DLK A;  5LMN H;  2VQD A;  1B33 N;  4EBE A;  4XYL B;  4F4X A;  1WH2 A;  3RV3 A;  3VPD A;  1N36 H;  4YB8 B;  4DR7 H;  2HVS A;  3BAB A;  5HBR B;  2WTF A;  3FU1 A;  2JA6 G;  1S0O A;  1CE8 A;  3K5H A;  2YZG A;  4O4I F;  4MAM A;  4RNN A;  3ETJ A;  4M7E A;  4QIW A;  4F50 A;  2RDI A;  2M7G A;  5CAE B;  5DQG A;  2WAQ A;  4TQR A;  1IBM H;  1Y1V G;  1AY2 A;  2WB1 A;  4CC5 A;  4ED6 A;  3PW5 A;  2CQY A;  5DG9 A;  3ORR A;  3GV5 B;  4R7R A;  4A3E G;  4JI4 H;  4CC6 A;  2BQR A;  4KHP H;  2YS7 A;  2QYZ A;  1HNX H;  5KFP A;  3BA9 A;  2R8H A;  2UVW A;  3N44 B;  2XD4 A;  3GTP A;  2FLL A;  1X6X X;  4TUY F;  3PN1 A;  4YAJ B;  4ZHQ F;  3GIP A;  2UUC H;  4X66 H;  1JIH A;  2SCU B;  1RG0 A;  4DUZ H;  2WE6 A;  1Y1W G;  1N48 A;  4MV8 A;  4BY7 G;  4LW9 A;  4X65 H;  2DWC A;  4ED0 A;  2NU7 B;  3MWM A;  4C2M A;  3GIL A;  4I4T F;  2DLN A;  2FJZ A;  3MR2 A;  3VPC A;  4J9L A;  3HOW G;  1MZB A;  4UCO A;  2NUA B;  3PO3 G;  3RBE A;  4QW8 A;  3GN9 A;  1I7N A;  4UCT A;  1E4F T;  4YHH H;  4FS2 A;  4RNO A;  2VUM A;  2UXB H;  5BMV F;  5T14 A;  3AYH B;  5KFW A;  3GIM A;  3KHL A;  3J7A K;  2W71 A;  5BPH A;  2W9B A;  2V59 A;  4LSA A;  2V4Q A;  4RB2 C;  1FKA H;  4NLG A;  2AGP A;  4A3K G;  2YW2 A;  1GO3 E;  1IBL H;  2YRW A;  4MV6 A;  1TWG A;  4A93 G;  3UQ8 A;  5L9X A;  2R7K A;  3M9N B;  1W96 A;  4LSX A;  2AGO A;  3K5I A;  1XMO H;  4AQY H;  3T5H A;  5D8D A;  3HOZ G;  4EEY A;  1OWT A;  4DL6 A;  5IP9 G;  2HGS A;  5F9L A;  4ECS A;  2R7M A;  2I80 A;  2C2D A;  1W93 A;  2PIL A;  1Y14 B;  1IOW A;  3K3V A;  5KFJ A;  3MR6 A;  4FBU A;  4UCU A;  1KBL A;  4YR2 A;  3KTM A;  1GSH A;  4A2B A;  2W57 A;  2JA7 A;  3L2P A;  4C5A A;  2OLS A;  4OX9 H;  4AYB A;  4LFB H;  3I4M G;  4QWA A;  3CQZ A;  1V4Y A;  3KHG A;  2V9W A;  2R82 A;  2C28 A;  2V5A A;  4RB1 A;  3RIZ A;  5DG7 A;  1ZQ7 A;  3GTL A;  2R93 A;  4RUA A;  5L1I A;  2PVP A;  5DQI A;  1K83 A;  1TWF A;  4O2B F;  4YY3 H;  1TWA A;  5EWE A;  4ZOL F;  3RUP A;  4DR5 H;  2XGP A;  3EPG A;  5EOY A;  4LFA H;  2VPS A;  2ZJT A;  2ASJ A;  5DGA A;  1M6V A;  2JA8 G;  4J9P A;  1L2Z A;  5KFK A;  2M3K A;  4HYK A;  5KG1 A;  3MJF A;  4O3O A;  1V9P A;  4X62 H;  1JX4 A;  1IOV A;  3KXY T;  3V6H A;  2OWO A;  3RGZ A;  4RAY A;  4EGJ A;  5JVL A;  3RAX A;  3OTO H;  3H0G A;  2E2H A;  2R8G A;  2GLT A;  4MV3 A;  3GID A;  4Q44 A;  4HR7 A;  3HOX G;  4WD3 A;  2Y0S E;  5KFB A;  1N56 A;  1M0T A;  3OSN A;  3IN5 A;  2JEI A;  3JSL A;  2R7N A;  4JI6 H;  4DV5 H;  5LYJ F;  4Q45 A;  5F9N A;  1N33 H;  1K1S A;  2UVV A;  3OUZ A;  3N8D A;  4O3Q A;  1DV2 A;  1Z2O X;  1EZ1 A;  3I12 A;  4ZI7 F;  5JW8 A;  4IZO A;  4ECY A;  2R86 A;  2FPP B;  3R5X A;  4J9S A;  4YAK B;  5A2Q W;  1K1Q A;  4EFE A;  5DLF A;  2WYO A;  4O3S A;  2DPI A;  2UXC H;  4DV1 H;  1TA8 A;  4V1J A;  2R87 A;  2XC9 A;  4ECW A;  1S97 A;  1S68 A;  3RJ0 A;  2PBZ A;  5FPO A;  1S0M A;  1EUD B;  2CW8 A;  2E2I A;  2VA2 A;  4A3M G;  2DIK A;  5KFX A;  4A2A A;  3SI8 A;  2NVY A;  3RBD A;  3GTO A;  4QIW E;  4IHJ F;  4UFZ A;  4FS1 A;  2FK2 A;  4YR0 A;  4IR9 A;  3HKZ E;  1XNR H;  4GC7 A;  4I7H A;  3V6K A;  4A3F G;  4U7C A;  2UUB H;  4IAJ A;  4YQW A;  1XNQ H;  1BJT A;  1KC7 A;  3BAA A;  4LH7 A;  3MWE A;  2HJW A;  2PY0 A;  1B04 A;  1T94 A;  2W70 A;  4QW9 A;  5D1O A;  2KSW A;  4ED7 A;  2R8K A;  2DZD A;  4PWQ A;  2VR1 A;  5LP6 F;  2PN1 A;  3T5K A;  2ASL A;  2AQ4 A;  4JV0 A;  2JEF A;  1X6Y A;  4JYA H;  3RGX A;  1AN7 A;  4YJ3 F;  3H3V H;  4ECX A;  4EEQ A;  4JV2 A;  2BQU A;  5KT6 A;  5KFF A;  3QZ8 A;  2ZDQ A;  2R7Z A;  5KFI A;  5LMU H;  3LP8 A;  3GII A;  4DR2 H;  1SFO A;  3R5F A;  5KFL A;  2FMA A;  4QWE A;  1AUX A;  1S9F A;  3N6X A;  1IBK H;  3MFI A;  5JVD F;  4ED3 A;  5KFV A;  4I55 F;  2VOB A;  4WBN F;  4QWD A;  4MA0 A;  1AUV A;  4U6P A;  3PW2 A;  4LF5 H;  4LFC H;  2B63 A;  5BPF A;  1J5E H;  2FLP A;  3BJY A;  2FE3 A;  4RZQ A;  3T1H H;  3H4D A;  5C44 G;  1A9X A;  1RJP A;  3BQ2 A;  4ED2 A;  2VPQ A;  5CA0 F;  4ED8 A;  3FKI G;  4IRK A;  3HOY G;  2W6N A;  5KFC A;  1WR2 A;  1X6Z A;  2FKL A;  3WO1 A;  3OHB A;  3F8N A;  4RB0 A;  3PZP A;  1O75 A;  1GSO A;  3DF7 A;  1EYZ A;  1E4E B;  2Q2T A;  3Q8P B;  2IP4 A;  3RFC A;  1B6S A;  1T36 A;  1SEI A;  2RGV A;  2W6Z A;  1WCM G;  2V58 A;  3JRX A;  5FD5 A;  4JI2 H;  4RNM A;  4IWY A;  3HXL A;  2NU8 B;  5KT4 A;  2ATL A;  1ZHQ A;  5KG6 A;  4B3S H;  4FM9 A;  3BQ0 A;  2CZG A;  1CS0 A;  1SYX B;  1SCU B;  3N43 B;  2YS6 A;  4F4Y A;  1GSA A;  5J2U F;  2J6T A;  4MV1 A;  1S0N A;  4RZR A;  4DR4 H;  2YCH A;  4RAZ A;  5C8Y F;  1TWC A;  3VPB A;  4J9K A;  4DL7 A;  1KJQ A;  3G8C A;  2DPJ A;  2XIG A;  1FVI A;  2JEJ A;  3PO2 G;  2W8K A;  3SOK A;  4HQ6 A;  3T1Y H;  4Q0Y A;  1ULZ A;  5KG4 A;  1VAJ A;  2ALZ A;  2W8L A;  1JXL A;  3SOJ A;  5KFE A;  2ZM6 H;  2XCL A;  4BY1 G;  5KFR A;  3OHA A;  3RB4 A;  4LF4 H;  4A3C G;  2UXD H;  4C5B A;  4LF8 H;  4Q8E A;  2E5L H;  2F4V H;  3QFF A;  3H0G G;  4MA5 A;  1Y1W A;  2R92 G;  2W6P A;  5L1L A;  3OUU A;  2HI2 A;  1JDB B;  4DV3 H;  3T5J A;  4GKK H;  2FK3 A;  5KFN A;  3RTX A;  1X6R A;  5KFA A;  2XGQ A;  3FDS A;  3PR4 A;  5KG0 A;  4DL5 A;  2IA6 A;  1HNW H;  2W9C A;  4EBD A;  4JI7 H;  4FU0 A;  2HVR A;  1A0I A;  4DR1 H;  4YBZ B;  4APM A;  1X6Q A;  5J2T F;  1T3N A;  1S10 A;  4J0M A;  2W9B B;  2C00 A;  4DV6 H;  4EYH B;  2UVU A;  1UC9 A;  5DG8 A;  4RUC A;  2R85 A;  3TIG A;  3GV7 B;  4ECQ A;  4O4H F;  4UCS A;  4JV1 A;  5H80 A;  3UFX B;  1PK8 A;  1HNZ H;  4JI5 H;  2YZM A;  5C1P A;  5KFD A;  3HB9 A;  3G6V A;  2RDJ A;  1M0W A;  1HR0 H;  2JEG A;  4EBC A;  1DGS A;  3PW0 A;  5EWF A;  1I3Q A;  4DV7 H;  3N6R A;  4Y8V B;  3JZZ A;  4O3P A;  2HVQ A;  4G3I A;  3J80 W;  1S03 G;  2UVR A;  3MR3 A;  3Q1K A;  4RU9 A;  1BNC A;  1KEE A;  4Q8F A;  5CB4 F;  1TWH A;  5CA1 F;  3GV8 B;  3N42 B;  1ZHS A;  3WNZ A;  4JI3 H;  5D1P A;  2AGQ A;  2J6U A;  5KFG A;  2C2R A;  2CW7 A;  4O3N A;  4MTD A;  3GTJ A;  1GLV A;  5DLG A;  4RB3 C;  3QZ7 A;  3ETH A;  3RB3 A;  1I94 H;  5KFO A;  5IWA H;  2IBK A;  1EUC B;  2R7Z G;  1N32 H;  1UNN C;  2YRX A;  1P8L A;  5DGB A;  1WSC A;  4R8U A;  1KJI A;  3M9O B;  3V4Z A;  5KFQ A;  3BG5 A;  4TQS A;  3GLK A;  2R7L A;  3KAJ A;  5KT3 A;  4X64 H;  3HBL A;  3V6J A;  1R9T A;  2WAQ E;  4B3M H;  4O2A F;  4ED1 A;  5KFZ A;  4O4L F;  4HNU A;  5C1O A;  1RYR A;  4XX0 B;  2WB1 E;  5IYD G;  2W9A A;  4A3B G;  4MV9 A;  2P0A A;  2PMZ A;  1XMQ H;  3I4N G;  1B6R A;  3ORQ A;  4DR3 H;  3CVZ A;  5IP7 G;  3MR5 A;  4E4T A;  2GPS A;  2VUM G;  1RJQ A;  2VQE H;  4GC6 A;  2XCA A;  4NXN H;  2VQF H;  3TII A;  5KT7 A;  4A3D G;  1C30 A;  2QK4 A;  4B3R H;  2I87 A;  3GTK A;  3GIQ A;  5FPR A;  3C0F B;  5IYZ F;  4F4Z A;  2I8C A;  4C5C A;  4J9N A;  1Z2N X;  4EYI B;  3RB6 A;  3H20 A;  2KEP A;  3EYY A;  4QWB A;  5FLM G;  4NXM H;  5EZY F;  3J81 W;  2M05 A;  3HKZ A;  3G6Y A;  1GGO A;  5I47 A;  4BBR G;  4L1K A;  3BA8 A;  5KG2 A;  5DQH A;  5KFM A;  4DV4 H;  4ECT A;  1Z2P X;  4JI1 H;  4QWC A;  4ZQI A;  4I50 F;  4R8U B;  3JYZ A;  5IYB G;  3Q8Q B;  2JA5 A;  1KJ8 A;  3LML A;  5LL6 b;  5FJ8 G;  3RAQ A;  1DV1 A;  4MV4 A;  1UC8 A;  4MV7 A;  2W6Q A;  3SE7 A;  5JUM A;  2ASD A;  2JA7 G;  1GYF A;  3WO0 A;  3NGD A;  3G6X A;  2ZDH A; 
#chains in the Genus database with same CATH homology
 1VAJ A;  1WSC A;  1ZQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...