1ZQ7A

X-ray crystal structure of protein q8pzk8 from methanosarcina mazei. northeast structural genomics consortium target mar9.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
204
structure length
201
Chain Sequence
b'MLTETEGRAAVKLARKTIEIFLSKGKSPRSGVELSPVFEEYRGVFVTLTEGGLLRGCIGHPYPDSTLKEAILDSAISAATRDPRFPTVEQDEMKNILVEVTILTQPEKINASPKELPDKVEIGKHGLIVKQGYCQGLLLPQVAPENDMDSIDFLSHTCMKAGLSPDAWVKGAEVYCFEGQIFKEKEPDGEVIEEKFLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MM0484
molecule tags Structural genomics, unknown function
source organism Methanosarcina mazei
publication title X-Ray structure of the hypothetical protein Q8PZK8 from Methanosarcina mazei at the resolution 2.1A. Northeast Structural Genomics Consortium target MaR9.
rcsb
total genus 52
structure length 201
sequence length 204
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01871 AMMECR1 AMMECR1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.700.20 Alpha Beta 2-Layer Sandwich Glycoprotein, Type 4 Pilin Hypothetical protein ph0010; domain 1 1zq7A01
3.30.1490.150 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Hypothetical protein ph0010; domain 2 1zq7A02
1VAJA 1WSCA 1ZQ7A
chains in the Genus database with same CATH superfamily
4ECVA 1N48A 2YZGA 5F9NA 2W7PA 1TWHA 4QWBA 4ETSA 1IOVA 4QW8A 1DV1A 4DV3H 1I6UA 4A3IG 2YCHA 4A3MG 1RK6A 3OHAA 1ZQ7A 3PW2A 1AUVA 3M9OB 2FE3A 4JV1A 3OSPA 2ALZA 5EWFA 3FKIA 5KG5A 2W7OA 1TA8A 3JRXA 5HBRB 5FLXW 5KFEA 4OX9H 2W8LA 5C3EG 2FPIB 3PR5B 5IT9W 5J2TF 3M9MB 2DIKA 2W6OA 4B3RH 3HOYG 3MFIA 2J6UA 4DV0H 4LH7A 1JXLA 5KT4A 1UC8A 4J9PA 4C5AA 1EUCB 2W6NA 2NUAB 5HV6A 5L1IA 5KFMA 3PW7A 3MWEA 1DIKA 4FS1A 4A2BA 4ECZA 3PVXA 2KEPA 2YRWA 1BGWA 3GV8B 4DLKA 3I4MG 4EGQA 2R7ZA 4X64H 3FU1A 2ASJA 2OLSA 5FD6A 4HNTA 1BXRA 2C2EA 4UCVA 4YAKB 4RU9A 4QWAA 3GLKA 4YR2A 4A3JG 4O3PA 4IHJF 1SFOA 3EYYA 4RNOA 1I7NA 4HNVA 3MWDA 2NU7B 4MV8A 3KHHA 3RAQA 1XNQH 5KKNB 4B3MH 3RB4A 4X65H 4M7EA 4AQYH 5H80A 4U6PA 1S0MA 5FLMG 2QYZA 2CZGA 4IZOA 3T1YH 3MR3A 3N44B 4K0KH 2NVXA 2R6FA 4I7HA 2FPPB 3TIGA 4GKJH 5C44G 4QIWA 2DZDA 4AYBE 3FDSA 3GTJA 4CC5A 1S0OA 4DL2A 1X6PA 1JDEA 1W96A 1I50A 2J6TA 3GIIA 1QVEA 5KG1A 4Q44A 2R8HA 4DUYH 2ASLA 4YQWA 2FJZA 2YZNA 5KFDA 4PWQA 2R87A 1RJRA 4MV3A 3Q8SB 3Q8QB 1S10A 4Q0YA 1GSAA 4DL3A 2R7NA 5KG6A 4LFAH 4O3SA 2J9GA 5KFGA 3OHBA 2FMAA 2R84A 2PMZA 4V1JA 3HXLA 4BXXG 2V5AA 3R5XA 3L2PA 2PBZA 1T94A 2UXCH 2YL2A 1EYZA 1HNZH 4A93G 2ZDHA 5KFJA 2XCPA 4DV1H 3U9SA 1K1SA 4JUZA 1RG0A 2JEFA 4IAJA 1RYRA 3BQ0A 5EDWA 1DZOA 5KFAA 1OWTA 5DQHA 1AUXA 4DV4H 2Q2TA 1KJ9A 1KEEA 5DQGA 2IMWP 2R8KA 2ASDA 1GO3E 4A3KG 2SCUB 2HHHH 2DWCA 4JI8H 1T36A 1A9XA 2VUMA 1X6YA 5KFHA 3N8DA 4QW9A 2VQDA 4APMA 2W6PA 4QJFA 4O4HF 5EWEA 3K3VA 5KFTA 3GTKA 4I4TF 3BQ1A 3G20A 4ME6A 4J9LA 4JI7H 3GIDA 5JW8A 4UCSA 5KFBA 5DG7A 3V6KA 2GPWA 4FS2A 1C30A 1KC7A 2DLNA 4DL7A 2FK3A 4TUYF 1ZHSA 1I7LA 5KFIA 4A3GG 2IP4A 4XX0B 5JUMA 3KAJA 3HOWG 5EOYA 3TINA 2WB1A 4JI0H 3SOJA 1FVIA 3N6XA 3DF7A 4R7RA 5CB4F 4IWYA 3RIZA 5IP7G 4ECRA 4DR6H 5D1PA 3HOXG 3V6JA 5FD5A 3N6RA 3N41B 4A3CG 1E4EA 3JZIA 4ED2A 2VA3A 1N32H 1FKAH 4ZQIA 3WNZA 4TV9F 1RJPA 4BWSC 4RAYA 3J81W 2XC9A 3QFFA 1UNNC 2W57A 1M0TA 2CW8A 5IYBG 1R9TA 2PN1A 4LF4H 3RFCA 3KALA 4F4XA 2RGRA 4JI2H 4TV8F 4LSAA 5EZYF 1I3QA 2UU9H 4ECYA 1JKJB 1E4EB 3LP8A 2C2RA 1XNRH 3ORQA 3RBDA 2HGSA 2VOBA 4FU0A 3RGZA 1IBKH 3Q2OA 5GONF 3MR6A 2R8GA 4ED3A 4JV2A 1GYFA 4JI3H 5KFNA 4J9MA 4NLGA 1L2ZA 2KSWA 4I50F 2JA7A 5D1OA 1S03G 4MV7A 4ZI7F 5LXTF 2DPIA 5JH7F 1TWCA 2XGPA 4YJ2F 4IRKA 3OSNA 4CC6A 4ECQA 3M9NB 2RF4A 5L1JA 2AQ4A 3IN5A 2BQ3A 4YR0A 2V9WA 3RV3A 4IR9A 1DGSA 1PX2A 2AGQA 4DR7H 2R86A 4B3TH 2Y0SA 3BA8A 5KFPA 5DGAA 2GPSA 4EBCA 4J9QA 1HR0H 4DR3H 3H4BA 3MR5A 4E4TA 2I8CA 3JSLA 4RAZA 1RJQA 1B04A 5KFLA 2VPSA 5LL6b 3GIMA 5KT2A 1Z2OX 4EFBA 2M05A 3RUPA 2E5LH 2UUCH 4GC7A 4KHPH 1N56A 2JA7G 3RB3A 2ZM6H 4F4WA 4RNMA 4TQSA 2RGVA 4EYHB 3N40P 5KFYA 3UQ8A 4Q43A 3GIPA 4XYMB 2ZDGA 4ED0A 4A3DG 4QIWE 4AYBA 3GIQA 5L1LA 1V4YA 4FBTA 1ZHQA 5KG0A 4X66H 1IBMH 3H4DA 4YP3A 4EYIB 3PO3G 5IYCG 2J6SA 2B63A 5JVLA 2R92G 4UCRA 3E5NA 2RDJA 2WYOA 3GTMA 2W71A 2R85A 3MFHA 2PVPA 4J9OA 3BABA 4DV6H 1JX4A 2UXDH 3HOZG 5T14A 1AN7A 1VBGA 1Z2NX 5FPRA 4BY1G 5KFRA 4YY3H 5KFKA 3PW0A 1T3NA 2VQFH 3RF2A 3GILA 4MAMA 2WE6A 3HB9A 2R7KA 4L1KA 2P0AA 3R5FA 1X9NA 2JEGA 4MTEA 3KHGA 4IRDA 2XIGA 3GTQA 4DR4H 3OUZA 2HVQA 2OWOA 5KG7A 2JA5A 3GIKA 5D8DA 3MR2A 5K2MA 4HNUA 2YZMA 1WCMA 1SCUB 5D1OB 3TQTA 1TWFA 4UCUA 2XCAA 3G6YA 2UVRA 2V58A 4DV5H 2YYAA 5C8YF 1WSCA 4LFBH 2M3KA 5C1PA 5A2QW 3G8CA 4JI1H 2VA2A 4RNNA 4JI5H 3KXYT 5FJ8G 4F4YA 4Y8VB 3N43B 5DGBA 2C35B 1Z2PX 4GLXA 4B3SH 4MV6A 3GV5B 4MV9A 3G6XA 1C3OA 3F8NA 5BR8H 1EHIA 2X0SA 1ZETA 5KFWA 2FLLA 3R5HA 3T5LA 2VUMG 1N33H 4O3OA 3L4JA 4DL4A 4C5CA 3U9TA 1SEIA 2JA6A 4PDBA 4EBEA 2YW2A 4O2BF 1UC9A 3G6VA 3RJ0A 2Y0SE 2R7MA 4M9UA 3RTXA 3RB6A 1S97A 1JLLB 4ED6A 2FK2A 4RB3C 3WO0A 1M0WA 2CW7A 3SOKA 4LF8H 2FP4B 2JA8G 5BPFA 4A3BG 3HKZE 4MA5A 4C2MA 3TIIA 2E2HA 5IYDG 2M7GA 1MZBA 1VAJA 5DLGA 4YB8B 2PY0A 2W6ZA 3RBEA 3AYHB 3K3PA 3V6HA 1ULZA 1Y1VG 5KFSA 3QZ8A 5F9LA 5LMUH 5KT7A 4ED8A 4LF9H 3CVZA 3NGDA 5KT6A 1CS0A 3SE7A 3Q8RB 4RZRA 1KJJA 1XMOH 3MWMA 1E4GT 4F50A 1X6XX 1KJ8A 3ORRA 5KFUA 3VPCA 4O3NA 1PK8A 5LP6F 5KFQA 2V4RA 4EG0A 4EEQA 4BY7G 3H3VH 1SYXB 3K5HA 5KFXA 5KG3A 4DL5A 3T1HH 2FK1A 2C2DA 4Q8FA 2WAQA 4MV1A 4LH6A 4J9SA 5FPOA 4O3QA 4HYKA 2WDTA 3H0GA 4RUCA 4O3RA 2OH2A 5DG9A 4O2AF 1CQIB 1IOWA 4EEYA 3MJFA 2NU9B 5EWGA 2RDIA 2C00A 4G3IA 5CA1F 4Q45A 1KJIA 2VQEH 4JV0A 4U7CA 1S9FA 2AGPA 2NU6B 4LF5H 5LA6F 4ED7A 1GSHA 2CQYA 3GTLA 3R23A 1E4FT 2XGQA 4LF7H 1WR2A 2B63G 1V9PA 1X6ZA 1Y1VA 3RGXA 4DR2H 4J9KA 1RYSA 3BJYA 1K83A 3UFXB 1HPWA 3LMLA 1T92A 1WCMG 4FBUA 1FJGH 3VPDA 1X6RA 4RUAA 1EZ1A 4JYAH 3VMMA 5C4XG 3BA9A 4NXMH 1RK5A 4LFCH 1JDBB 3HOUG 4A3EG 3ETHA 5DQIA 3VPBA 3PR4A 2NVYA 4X62H 5CAEB 5LMNH 3J7AK 4Q8EA 4ECUA 4GKKH 3I4NG 4YHHH 5KFOA 4HR7A 2YU9A 3HBLA 2O03A 2YS6A 1VBHA 1S0NA 2FLNA 4I55F 3Q1KA 3JRWA 3JZZA 1GGOA 1AY2A 2HI2A 3RV4A 4IR1A 3PO2G 2R93A 3WO1A 3M4IA 4O4LF 4ECXA 5KFVA 4A3LG 1BJTA 3RAXA 4ED1A 4A3FG 3EPGA 1OQWA 3GN9A 2MCTA 3IG0A 5KG2A 2V59A 1XDNA 5J2UF 5KG4A 5C5JA 4UCOA 3V4SA 2W70A 1CE8A 3T5KA 4YJ3F 1I94H 4JI4H 3V4ZA 2HVSA 2R92A 3GIJA 4C5BA 1IBLH 3C0FB 3ETJA 3FKIG 4J9NA 4EGJA 2GLTA 1HNWH 5IYZF 4O4IF 2W9BB 4GC6A 5KFCA 4LW9A 1N36H 2JEIA 2R8JA 3OTOH 2VPQA 2IBKA 4UFZA 4F4ZA 2PILA 4EBDA 1BNCA 1TWGA 1A0IA 2WTFA 4JI6H 4R8UA 4LSXA 1DV2A 5LYJF 4TQRA 4QWDA 1JIHA 4MTDA 3GQCA 4DV7H 1HNXH 4ZHQF 4RZQA 2Q2UA 3LWBA 1B6RA 2PMZE 1V51A 3L4KA 5KFFA 4ECTA 2HVRA 4LF6H 4J0MA 3Q8PB 1GSOA 1P8LA 4MA0A 1Y14B 2XCLA 5BMVF 4J9RA 2R8IA 4IRCA 2VR1A 3HOVG 3JYZA 2NU8B 3H40A 2W8KA 1Y1WG 4YR3A 5L9XA 1B33N 4QWEA 2VUGA 4R8UB 4WBNF 3JAMW 1VS0A 4WD3A 3BAAA 4MV4A 5L1KA 3RB0A 4RB0A 2FB9A 3KHRA 3OUUA 1EUDB 2W6QA 4YAJB 5KX5F 2V4QA 2R7ZG 3T5HA 1Y1WA 1K1QA 5DG8A 4DR1H 2XD4A 3KHLA 3GTGA 3PW5A 4DV2H 5JQWA 2BQUA 2UUAH 1KBLA 3SI8A 2DPJA 5CA0F 3TQ1A 4BBSG 4A2AA 3PW4A 3GTPA 2FPGB 4IWXA 1KJQA 2ZDQA 4RB2C 2QK4A 3I12A 2WAQE 5C1OA 2ZJTA 1M7JA 1XMQH 2BR0A 1X6QA 4ECSA 2JA6G 1TAEA 4LMYA 3N42B 2C22A 2BQRA 5LOVF 4NXNH 1O75A 5KFZA 3T5JA 2E2IA 4JV5H 3K5IA 4XZ3B 4XYLB 1M6VA 5IP9G 1TWAA 5BPHA 2WB1E 4YBZB 2UXBH 4HQ6A 3CQZA 4ZOLF 1N34H 2R82A 2JA5G 3J80W 4DL6A 2W6MA 2HJWA 1WH2A 2CKZB 4UCTA 5I47A 2AU0A 3GTOA 1W93A 2FLPA 2UVUA 3PN1A 2FKLA 2UUBH 2W9BA 2F4VH 4BBRG 1VKZA 3BG5A 4ECWA 3JSNA 4QWCA 2C28A 2YS7A 3QZ7A 3H20A 2I80A 3H0GG 3BQ2A 1S68A 2JEJA 3KAKA 5JVDF 4DUZH 2W9CA 3KTMA 3PZPA 2UVVA 2UVWA 2I87A 3EPIA 4DR5H 3GV7B 4FM9A 2IA6A 2AGOA 1CQJB 2R7LA 5KT3A 5DLFA 5KT5A 2W9AA 1B6SA 3HKZA 4EFEA 2R93G 1GLVA 4RB1A 2ATLA 5IWAH 2YRXA 1J5EH 3FMAA 2W9CB
chains in the Genus database with same CATH topology
1VAJA 1WSCA 1ZQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAJ A;  1WSC A;  1ZQ7 A; 
#chains in the Genus database with same CATH topology
 4ECV A;  1N48 A;  2YZG A;  5F9N A;  2W7P A;  1TWH A;  4QWB A;  4ETS A;  1IOV A;  4QW8 A;  1DV1 A;  4DV3 H;  1I6U A;  4A3I G;  2YCH A;  4A3M G;  1RK6 A;  3OHA A;  1ZQ7 A;  3PW2 A;  1AUV A;  3M9O B;  2FE3 A;  4JV1 A;  3OSP A;  2ALZ A;  5EWF A;  3FKI A;  5KG5 A;  2W7O A;  1TA8 A;  3JRX A;  5HBR B;  5FLX W;  5KFE A;  4OX9 H;  2W8L A;  5C3E G;  2FPI B;  3PR5 B;  5IT9 W;  5J2T F;  3M9M B;  2DIK A;  2W6O A;  4B3R H;  3HOY G;  3MFI A;  2J6U A;  4DV0 H;  4LH7 A;  1JXL A;  5KT4 A;  1UC8 A;  4J9P A;  4C5A A;  1EUC B;  2W6N A;  2NUA B;  5HV6 A;  5L1I A;  5KFM A;  3PW7 A;  3MWE A;  1DIK A;  4FS1 A;  4A2B A;  4ECZ A;  3PVX A;  2KEP A;  2YRW A;  1BGW A;  3GV8 B;  4DLK A;  3I4M G;  4EGQ A;  2R7Z A;  4X64 H;  3FU1 A;  2ASJ A;  2OLS A;  5FD6 A;  4HNT A;  1BXR A;  2C2E A;  4UCV A;  4YAK B;  4RU9 A;  4QWA A;  3GLK A;  4YR2 A;  4A3J G;  4O3P A;  4IHJ F;  1SFO A;  3EYY A;  4RNO A;  1I7N A;  4HNV A;  3MWD A;  2NU7 B;  4MV8 A;  3KHH A;  3RAQ A;  1XNQ H;  5KKN B;  4B3M H;  3RB4 A;  4X65 H;  4M7E A;  4AQY H;  5H80 A;  4U6P A;  1S0M A;  5FLM G;  2QYZ A;  2CZG A;  4IZO A;  3T1Y H;  3MR3 A;  3N44 B;  4K0K H;  2NVX A;  2R6F A;  4I7H A;  2FPP B;  3TIG A;  4GKJ H;  5C44 G;  4QIW A;  2DZD A;  4AYB E;  3FDS A;  3GTJ A;  4CC5 A;  1S0O A;  4DL2 A;  1X6P A;  1JDE A;  1W96 A;  1I50 A;  2J6T A;  3GII A;  1QVE A;  5KG1 A;  4Q44 A;  2R8H A;  4DUY H;  2ASL A;  4YQW A;  2FJZ A;  2YZN A;  5KFD A;  4PWQ A;  2R87 A;  1RJR A;  4MV3 A;  3Q8S B;  3Q8Q B;  1S10 A;  4Q0Y A;  1GSA A;  4DL3 A;  2R7N A;  5KG6 A;  4LFA H;  4O3S A;  2J9G A;  5KFG A;  3OHB A;  2FMA A;  2R84 A;  2PMZ A;  4V1J A;  3HXL A;  4BXX G;  2V5A A;  3R5X A;  3L2P A;  2PBZ A;  1T94 A;  2UXC H;  2YL2 A;  1EYZ A;  1HNZ H;  4A93 G;  2ZDH A;  5KFJ A;  2XCP A;  4DV1 H;  3U9S A;  1K1S A;  4JUZ A;  1RG0 A;  2JEF A;  4IAJ A;  1RYR A;  3BQ0 A;  5EDW A;  1DZO A;  5KFA A;  1OWT A;  5DQH A;  1AUX A;  4DV4 H;  2Q2T A;  1KJ9 A;  1KEE A;  5DQG A;  2IMW P;  2R8K A;  2ASD A;  1GO3 E;  4A3K G;  2SCU B;  2HHH H;  2DWC A;  4JI8 H;  1T36 A;  1A9X A;  2VUM A;  1X6Y A;  5KFH A;  3N8D A;  4QW9 A;  2VQD A;  4APM A;  2W6P A;  4QJF A;  4O4H F;  5EWE A;  3K3V A;  5KFT A;  3GTK A;  4I4T F;  3BQ1 A;  3G20 A;  4ME6 A;  4J9L A;  4JI7 H;  3GID A;  5JW8 A;  4UCS A;  5KFB A;  5DG7 A;  3V6K A;  2GPW A;  4FS2 A;  1C30 A;  1KC7 A;  2DLN A;  4DL7 A;  2FK3 A;  4TUY F;  1ZHS A;  1I7L A;  5KFI A;  4A3G G;  2IP4 A;  4XX0 B;  5JUM A;  3KAJ A;  3HOW G;  5EOY A;  3TIN A;  2WB1 A;  4JI0 H;  3SOJ A;  1FVI A;  3N6X A;  3DF7 A;  4R7R A;  5CB4 F;  4IWY A;  3RIZ A;  5IP7 G;  4ECR A;  4DR6 H;  5D1P A;  3HOX G;  3V6J A;  5FD5 A;  3N6R A;  3N41 B;  4A3C G;  1E4E A;  3JZI A;  4ED2 A;  2VA3 A;  1N32 H;  1FKA H;  4ZQI A;  3WNZ A;  4TV9 F;  1RJP A;  4BWS C;  4RAY A;  3J81 W;  2XC9 A;  3QFF A;  1UNN C;  2W57 A;  1M0T A;  2CW8 A;  5IYB G;  1R9T A;  2PN1 A;  4LF4 H;  3RFC A;  3KAL A;  4F4X A;  2RGR A;  4JI2 H;  4TV8 F;  4LSA A;  5EZY F;  1I3Q A;  2UU9 H;  4ECY A;  1JKJ B;  1E4E B;  3LP8 A;  2C2R A;  1XNR H;  3ORQ A;  3RBD A;  2HGS A;  2VOB A;  4FU0 A;  3RGZ A;  1IBK H;  3Q2O A;  5GON F;  3MR6 A;  2R8G A;  4ED3 A;  4JV2 A;  1GYF A;  4JI3 H;  5KFN A;  4J9M A;  4NLG A;  1L2Z A;  2KSW A;  4I50 F;  2JA7 A;  5D1O A;  1S03 G;  4MV7 A;  4ZI7 F;  5LXT F;  2DPI A;  5JH7 F;  1TWC A;  2XGP A;  4YJ2 F;  4IRK A;  3OSN A;  4CC6 A;  4ECQ A;  3M9N B;  2RF4 A;  5L1J A;  2AQ4 A;  3IN5 A;  2BQ3 A;  4YR0 A;  2V9W A;  3RV3 A;  4IR9 A;  1DGS A;  1PX2 A;  2AGQ A;  4DR7 H;  2R86 A;  4B3T H;  2Y0S A;  3BA8 A;  5KFP A;  5DGA A;  2GPS A;  4EBC A;  4J9Q A;  1HR0 H;  4DR3 H;  3H4B A;  3MR5 A;  4E4T A;  2I8C A;  3JSL A;  4RAZ A;  1RJQ A;  1B04 A;  5KFL A;  2VPS A;  5LL6 b;  3GIM A;  5KT2 A;  1Z2O X;  4EFB A;  2M05 A;  3RUP A;  2E5L H;  2UUC H;  4GC7 A;  4KHP H;  1N56 A;  2JA7 G;  3RB3 A;  2ZM6 H;  4F4W A;  4RNM A;  4TQS A;  2RGV A;  4EYH B;  3N40 P;  5KFY A;  3UQ8 A;  4Q43 A;  3GIP A;  4XYM B;  2ZDG A;  4ED0 A;  4A3D G;  4QIW E;  4AYB A;  3GIQ A;  5L1L A;  1V4Y A;  4FBT A;  1ZHQ A;  5KG0 A;  4X66 H;  1IBM H;  3H4D A;  4YP3 A;  4EYI B;  3PO3 G;  5IYC G;  2J6S A;  2B63 A;  5JVL A;  2R92 G;  4UCR A;  3E5N A;  2RDJ A;  2WYO A;  3GTM A;  2W71 A;  2R85 A;  3MFH A;  2PVP A;  4J9O A;  3BAB A;  4DV6 H;  1JX4 A;  2UXD H;  3HOZ G;  5T14 A;  1AN7 A;  1VBG A;  1Z2N X;  5FPR A;  4BY1 G;  5KFR A;  4YY3 H;  5KFK A;  3PW0 A;  1T3N A;  2VQF H;  3RF2 A;  3GIL A;  4MAM A;  2WE6 A;  3HB9 A;  2R7K A;  4L1K A;  2P0A A;  3R5F A;  1X9N A;  2JEG A;  4MTE A;  3KHG A;  4IRD A;  2XIG A;  3GTQ A;  4DR4 H;  3OUZ A;  2HVQ A;  2OWO A;  5KG7 A;  2JA5 A;  3GIK A;  5D8D A;  3MR2 A;  5K2M A;  4HNU A;  2YZM A;  1WCM A;  1SCU B;  5D1O B;  3TQT A;  1TWF A;  4UCU A;  2XCA A;  3G6Y A;  2UVR A;  2V58 A;  4DV5 H;  2YYA A;  5C8Y F;  1WSC A;  4LFB H;  2M3K A;  5C1P A;  5A2Q W;  3G8C A;  4JI1 H;  2VA2 A;  4RNN A;  4JI5 H;  3KXY T;  5FJ8 G;  4F4Y A;  4Y8V B;  3N43 B;  5DGB A;  2C35 B;  1Z2P X;  4GLX A;  4B3S H;  4MV6 A;  3GV5 B;  4MV9 A;  3G6X A;  1C3O A;  3F8N A;  5BR8 H;  1EHI A;  2X0S A;  1ZET A;  5KFW A;  2FLL A;  3R5H A;  3T5L A;  2VUM G;  1N33 H;  4O3O A;  3L4J A;  4DL4 A;  4C5C A;  3U9T A;  1SEI A;  2JA6 A;  4PDB A;  4EBE A;  2YW2 A;  4O2B F;  1UC9 A;  3G6V A;  3RJ0 A;  2Y0S E;  2R7M A;  4M9U A;  3RTX A;  3RB6 A;  1S97 A;  1JLL B;  4ED6 A;  2FK2 A;  4RB3 C;  3WO0 A;  1M0W A;  2CW7 A;  3SOK A;  4LF8 H;  2FP4 B;  2JA8 G;  5BPF A;  4A3B G;  3HKZ E;  4MA5 A;  4C2M A;  3TII A;  2E2H A;  5IYD G;  2M7G A;  1MZB A;  1VAJ A;  5DLG A;  4YB8 B;  2PY0 A;  2W6Z A;  3RBE A;  3AYH B;  3K3P A;  3V6H A;  1ULZ A;  1Y1V G;  5KFS A;  3QZ8 A;  5F9L A;  5LMU H;  5KT7 A;  4ED8 A;  4LF9 H;  3CVZ A;  3NGD A;  5KT6 A;  1CS0 A;  3SE7 A;  3Q8R B;  4RZR A;  1KJJ A;  1XMO H;  3MWM A;  1E4G T;  4F50 A;  1X6X X;  1KJ8 A;  3ORR A;  5KFU A;  3VPC A;  4O3N A;  1PK8 A;  5LP6 F;  5KFQ A;  2V4R A;  4EG0 A;  4EEQ A;  4BY7 G;  3H3V H;  1SYX B;  3K5H A;  5KFX A;  5KG3 A;  4DL5 A;  3T1H H;  2FK1 A;  2C2D A;  4Q8F A;  2WAQ A;  4MV1 A;  4LH6 A;  4J9S A;  5FPO A;  4O3Q A;  4HYK A;  2WDT A;  3H0G A;  4RUC A;  4O3R A;  2OH2 A;  5DG9 A;  4O2A F;  1CQI B;  1IOW A;  4EEY A;  3MJF A;  2NU9 B;  5EWG A;  2RDI A;  2C00 A;  4G3I A;  5CA1 F;  4Q45 A;  1KJI A;  2VQE H;  4JV0 A;  4U7C A;  1S9F A;  2AGP A;  2NU6 B;  4LF5 H;  5LA6 F;  4ED7 A;  1GSH A;  2CQY A;  3GTL A;  3R23 A;  1E4F T;  2XGQ A;  4LF7 H;  1WR2 A;  2B63 G;  1V9P A;  1X6Z A;  1Y1V A;  3RGX A;  4DR2 H;  4J9K A;  1RYS A;  3BJY A;  1K83 A;  3UFX B;  1HPW A;  3LML A;  1T92 A;  1WCM G;  4FBU A;  1FJG H;  3VPD A;  1X6R A;  4RUA A;  1EZ1 A;  4JYA H;  3VMM A;  5C4X G;  3BA9 A;  4NXM H;  1RK5 A;  4LFC H;  1JDB B;  3HOU G;  4A3E G;  3ETH A;  5DQI A;  3VPB A;  3PR4 A;  2NVY A;  4X62 H;  5CAE B;  5LMN H;  3J7A K;  4Q8E A;  4ECU A;  4GKK H;  3I4N G;  4YHH H;  5KFO A;  4HR7 A;  2YU9 A;  3HBL A;  2O03 A;  2YS6 A;  1VBH A;  1S0N A;  2FLN A;  4I55 F;  3Q1K A;  3JRW A;  3JZZ A;  1GGO A;  1AY2 A;  2HI2 A;  3RV4 A;  4IR1 A;  3PO2 G;  2R93 A;  3WO1 A;  3M4I A;  4O4L F;  4ECX A;  5KFV A;  4A3L G;  1BJT A;  3RAX A;  4ED1 A;  4A3F G;  3EPG A;  1OQW A;  3GN9 A;  2MCT A;  3IG0 A;  5KG2 A;  2V59 A;  1XDN A;  5J2U F;  5KG4 A;  5C5J A;  4UCO A;  3V4S A;  2W70 A;  1CE8 A;  3T5K A;  4YJ3 F;  1I94 H;  4JI4 H;  3V4Z A;  2HVS A;  2R92 A;  3GIJ A;  4C5B A;  1IBL H;  3C0F B;  3ETJ A;  3FKI G;  4J9N A;  4EGJ A;  2GLT A;  1HNW H;  5IYZ F;  4O4I F;  2W9B B;  4GC6 A;  5KFC A;  4LW9 A;  1N36 H;  2JEI A;  2R8J A;  3OTO H;  2VPQ A;  2IBK A;  4UFZ A;  4F4Z A;  2PIL A;  4EBD A;  1BNC A;  1TWG A;  1A0I A;  2WTF A;  4JI6 H;  4R8U A;  4LSX A;  1DV2 A;  5LYJ F;  4TQR A;  4QWD A;  1JIH A;  4MTD A;  3GQC A;  4DV7 H;  1HNX H;  4ZHQ F;  4RZQ A;  2Q2U A;  3LWB A;  1B6R A;  2PMZ E;  1V51 A;  3L4K A;  5KFF A;  4ECT A;  2HVR A;  4LF6 H;  4J0M A;  3Q8P B;  1GSO A;  1P8L A;  4MA0 A;  1Y14 B;  2XCL A;  5BMV F;  4J9R A;  2R8I A;  4IRC A;  2VR1 A;  3HOV G;  3JYZ A;  2NU8 B;  3H40 A;  2W8K A;  1Y1W G;  4YR3 A;  5L9X A;  1B33 N;  4QWE A;  2VUG A;  4R8U B;  4WBN F;  3JAM W;  1VS0 A;  4WD3 A;  3BAA A;  4MV4 A;  5L1K A;  3RB0 A;  4RB0 A;  2FB9 A;  3KHR A;  3OUU A;  1EUD B;  2W6Q A;  4YAJ B;  5KX5 F;  2V4Q A;  2R7Z G;  3T5H A;  1Y1W A;  1K1Q A;  5DG8 A;  4DR1 H;  2XD4 A;  3KHL A;  3GTG A;  3PW5 A;  4DV2 H;  5JQW A;  2BQU A;  2UUA H;  1KBL A;  3SI8 A;  2DPJ A;  5CA0 F;  3TQ1 A;  4BBS G;  4A2A A;  3PW4 A;  3GTP A;  2FPG B;  4IWX A;  1KJQ A;  2ZDQ A;  4RB2 C;  2QK4 A;  3I12 A;  2WAQ E;  5C1O A;  2ZJT A;  1M7J A;  1XMQ H;  2BR0 A;  1X6Q A;  4ECS A;  2JA6 G;  1TAE A;  4LMY A;  3N42 B;  2C22 A;  2BQR A;  5LOV F;  4NXN H;  1O75 A;  5KFZ A;  3T5J A;  2E2I A;  4JV5 H;  3K5I A;  4XZ3 B;  4XYL B;  1M6V A;  5IP9 G;  1TWA A;  5BPH A;  2WB1 E;  4YBZ B;  2UXB H;  4HQ6 A;  3CQZ A;  4ZOL F;  1N34 H;  2R82 A;  2JA5 G;  3J80 W;  4DL6 A;  2W6M A;  2HJW A;  1WH2 A;  2CKZ B;  4UCT A;  5I47 A;  2AU0 A;  3GTO A;  1W93 A;  2FLP A;  2UVU A;  3PN1 A;  2FKL A;  2UUB H;  2W9B A;  2F4V H;  4BBR G;  1VKZ A;  3BG5 A;  4ECW A;  3JSN A;  4QWC A;  2C28 A;  2YS7 A;  3QZ7 A;  3H20 A;  2I80 A;  3H0G G;  3BQ2 A;  1S68 A;  2JEJ A;  3KAK A;  5JVD F;  4DUZ H;  2W9C A;  3KTM A;  3PZP A;  2UVV A;  2UVW A;  2I87 A;  3EPI A;  4DR5 H;  3GV7 B;  4FM9 A;  2IA6 A;  2AGO A;  1CQJ B;  2R7L A;  5KT3 A;  5DLF A;  5KT5 A;  2W9A A;  1B6S A;  3HKZ A;  4EFE A;  2R93 G;  1GLV A;  4RB1 A;  2ATL A;  5IWA H;  2YRX A;  1J5E H;  3FMA A;  2W9C B; 
#chains in the Genus database with same CATH homology
 1VAJ A;  1WSC A;  1ZQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...