1ZQ7A

X-ray crystal structure of protein q8pzk8 from methanosarcina mazei. northeast structural genomics consortium target mar9.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
204
structure length
201
Chain Sequence
MLTETEGRAAVKLARKTIEIFLSKGKSPRSGVELSPVFEEYRGVFVTLTEGGLLRGCIGHPYPDSTLKEAILDSAISAATRDPRFPTVEQDEMKNILVEVTILTQPEKINASPKELPDKVEIGKHGLIVKQGYCQGLLLPQVAPENDMDSIDFLSHTCMKAGLSPDAWVKGAEVYCFEGQIFKEKEPDGEVIEEKFLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein MM0484
publication title X-Ray structure of the hypothetical protein Q8PZK8 from Methanosarcina mazei at the resolution 2.1A. Northeast Structural Genomics Consortium target MaR9.
rcsb
source organism Methanosarcina mazei
total genus 52
structure length 201
sequence length 204
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01871 AMMECR1 AMMECR1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.700.20 Alpha Beta 2-Layer Sandwich Glycoprotein, Type 4 Pilin Hypothetical protein ph0010; domain 1 1zq7A01
3.30.1490.150 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Hypothetical protein ph0010; domain 2 1zq7A02
1VAJA 1ZQ7A 1WSCA
chains in the Genus database with same CATH superfamily
3M9NB 1VBGA 1WSCA 5KFCA 4EBEA 2QK4A 5F9NA 1X6YA 4MV9A 3RTXA 5BPHA 5BR8H 5EWGA 4ECVA 1OWTA 4TQSA 4QWAA 2CQYA 4JV1A 4L1KA 3MR3A 4JV5H 3BQ2A 5KFDA 2FKLA 4EEYA 2DLNA 3R5XA 2ATLA 4LFCH 2JA5A 1SCUB 4IHJF 5KFYA 2BR0A 1JX4A 1X6QA 2IMWP 3K5IA 4JI4H 5IT9W 2FPIB 4PDBA 2W9CB 4ZQIA 2SCUB 2YCHA 2RDIA 4ED7A 5KG4A 4GKKH 4A2AA 2YS6A 2BQRA 5KFIA 5J2UF 2DWCA 2UXCH 4ZOLF 2JA5G 3T5LA 2UXBH 2P0AA 4F4YA 4ETSA 2R7LA 1X9NA 1A0IA 1QVEA 2R82A 4UCTA 2NUAB 2AGPA 4RAZA 3SOJA 4R7RA 1RYRA 4RUAA 2V58A 5D1PA 1TWGA 1E4EA 3HKZE 5BMVF 2C22A 5D1OB 2PBZA 4JI8H 2R84A 2R7ZG 2VA2A 4ME6A 3C0FB 1AUXA 4HR7A 2JA6G 5KFXA 1BGWA 3OHBA 2C35B 3RJ0A 1CS0A 1BNCA 5EWFA 4EFEA 2VQEH 3PW0A 3PW2A 1GYFA 4RB3C 5DG7A 1GGOA 4R8UB 4EEQA 4Y8VB 2R8IA 3N40P 2WB1E 4LF5H 2OLSA 2UUCH 2YZMA 3MR6A 2JEIA 1JKJB 2YYAA 1T92A 3N6XA 1VKZA 3KALA 5C8YF 5L1IA 1S97A 2W71A 1IBLH 4NXNH 2VPQA 5DLFA 1Y14B 2V4RA 4C5CA 3HBLA 4LF9H 2FE3A 3Q2OA 1DV1A 4O4IF 2FLNA 2FB9A 1X6RA 1KJ9A 1W93A 4HNVA 4GLXA 1JDBB 1CQIB 1N33H 4QWCA 1FVIA 4DR1H 4A3LG 2DIKA 5KG5A 4EBCA 2XIGA 4MV4A 5KFMA 3I4MG 3T1HH 3FKIG 5C1OA 2UU9H 4JI7H 3RAQA 3V6HA 4YP3A 2PY0A 5C4XG 1PK8A 3KAJA 4IRDA 4TV9F 3QZ8A 2ASJA 4ECQA 2C2RA 1RK6A 2O03A 3TIGA 1RJRA 4C2MA 4GKJH 5KFTA 5KT4A 4A3DG 2NU8B 4JI6H 1UC8A 5L1JA 4A3GG 2CKZB 2V59A 3GIDA 5KFFA 1WCMG 2JA7G 4YR3A 4DV3H 3GTMA 3Q8SB 3HB9A 2PMZA 5LXTF 1Z2PX 5KFHA 5KT5A 4F4WA 3GLKA 2X0SA 4QJFA 3EPIA 3PN1A 2ZDHA 3IG0A 3RV4A 3HOXG 1K83A 5KFUA 2XCPA 4V1JA 1SEIA 1E4FT 5KX5F 1ULZA 5KFPA 1DGSA 3HKZA 4K0KH 2NU7B 2R6FA 1M0TA 2W6QA 4BY1G 4JI2H 5EWEA 2R8HA 3HOWG 4ED1A 4FU0A 1OQWA 4YBZB 3M4IA 4DV2H 5C3EG 3BQ1A 4FS1A 5FPOA 4MV6A 4UFZA 1UC9A 2FJZA 3RB3A 2FLPA 2JEJA 2XC9A 3JYZA 1T3NA 3RGXA 2WB1A 2NU9B 3N43B 4A2BA 5LOVF 5KFEA 4QWBA 4LF7H 3Q1KA 1GO3E 1I7NA 2AQ4A 2ASLA 1M7JA 5KFQA 3M9MB 4NLGA 3T5JA 2ZJTA 4QW8A 3KTMA 1VS0A 4DR6H 1ZHSA 4LMYA 4DL4A 1JIHA 1KC7A 3PW5A 3OSPA 3VPDA 4I4TF 5K2MA 4ECWA 1M0WA 4O3QA 2I87A 5KG0A 2JEGA 3HOVG 3Q8RB 5EOYA 1EHIA 3MR5A 4J9KA 1N56A 1JDEA 2B63G 4DR7H 3RIZA 2W6ZA 1K1QA 4DR2H 5FD5A 2J6SA 1KJQA 4MAMA 1JLLB 2NVXA 4X66H 4DL7A 4HNTA 4JI5H 1RYSA 1VBHA 4ED2A 2YL2A 1S9FA 1N34H 2RF4A 5CAEB 3QZ7A 2I8CA 2PMZE 4YQWA 4I50F 2VR1A 5KKNB 1GSOA 3LMLA 3G6YA 4Q0YA 2E2IA 5KFJA 2HVSA 4GC7A 4PWQA 3FU1A 2VQFH 5J2TF 3GIQA 4IR9A 3J81W 1B33N 4LSAA 3ETHA 3G8CA 5CA0F 3N44B 3RB4A 3KHRA 5JW8A 2WE6A 5LMUH 4DV4H 4UCRA 4DV0H 2VPSA 3EYYA 3MWMA 5FD6A 3T5HA 5L1LA 3UQ8A 1IBMH 1FKAH 2J6TA 2FLLA 4A3BG 1S0OA 2FPGB 4MTEA 4XYLB 3H20A 2XCLA 5KFNA 4YR0A 5HBRB 4LF8H 1ZETA 4YJ3F 1IOVA 2R86A 4DV1H 4LFAH 1M6VA 4X64H 3NGDA 1AN7A 4X62H 4HYKA 2R8KA 2F4VH 3MWEA 4RAYA 4YY3H 3J80W 3GIIA 3H0GA 3T5KA 2FK2A 5KFOA 1JXLA 5KFGA 2V5AA 2YZGA 2W9CA 4OX9H 1VAJA 4AYBE 3GIMA 3RFCA 5EZYF 4ECXA 3HOUG 2ZDGA 4QWDA 1HNXH 2RGRA 4QIWE 3TQ1A 5BPFA 2GPWA 3PO2G 1N32H 3H0GG 5FLMG 2M7GA 1CQJB 4HNUA 2XD4A 4J9QA 2W70A 2WYOA 2WDTA 5KFKA 2W9BA 2W6NA 5D1OA 2W7PA 2W9AA 4RNOA 1I94H 1RK5A 2DZDA 3JRWA 3MWDA 2ZM6H 4B3RH 4BWSC 5FLXW 3RV3A 4MTDA 4ECUA 1J5EH 3R5HA 5KT7A 4LFBH 4MA5A 3KXYT 5KG2A 3GN9A 1ZHQA 5LL6b 3MFIA 1KBLA 1XMQH 4IAJA 4R8UA 1TWHA 2PILA 4DLKA 4UCSA 4ED8A 1B6RA 4DV7H 3GTLA 1C30A 1EZ1A 4ECTA 5LYJF 4LF4H 3N8DA 1XDNA 5KFAA 5CA1F 4XYMB 1DZOA 4QWEA 2UVRA 1MZBA 3G6XA 3GIKA 4ECZA 3PO3G 4DL5A 2R92A 4A3IG 2OWOA 4EBDA 1W96A 1Y1WA 5L1KA 4BY7G 2W8KA 3RBDA 4A3JG 2VA3A 5KFZA 2V9WA 2YW2A 2XGPA 4U7CA 5GONF 1V9PA 5C1PA 5KFSA 3BG5A 1GSAA 3PZPA 2YZNA 2UVUA 4JI3H 4J0MA 3K5HA 2IBKA 1EUCB 4O2AF 4LW9A 5KFWA 4QW9A 2YRXA 2CW7A 3OUZA 1EYZA 1SYXB 2NVYA 4HQ6A 3L4JA 5DG9A 1S0MA 4ED3A 1GSHA 4FBTA 4DL2A 5D8DA 3BAAA 1K1SA 4DR5H 3WO1A 4GC6A 2W6PA 3G20A 4AYBA 5IWAH 1CE8A 5H80A 1WR2A 2R93A 3GTKA 4CC6A 3JAMW 5DG8A 1DIKA 3GV5B 4EYIB 3RF2A 4QIWA 3EPGA 4UCVA 3RB0A 2C2DA 4Q43A 4TV8F 2W8LA 3IN5A 4Q8FA 3HOYG 2WAQE 2XCAA 4J9RA 1TWFA 3RAXA 4XZ3B 3PR5B 4F4ZA 1B04A 4J9LA 1I6UA 4DUZH 4X65H 2R93G 3TQTA 4MV7A 5T14A 2UVWA 2WTFA 2AU0A 2R87A 4UCUA 2HJWA 2W6MA 4YHHH 1XNRH 4UCOA 4Q8EA 3UFXB 2HVRA 1Z2OX 1IOWA 5DQHA 3AYHB 1EUDB 4ZHQF 2YRWA 2VUMA 3BJYA 3GTOA 3MFHA 4RB0A 5JUMA 2R85A 2MCTA 4A93G 1TWAA 5C44G 1HNWH 4AQYH 3PW4A 2C28A 1ZQ7A 2BQ3A 3HOZG 1X6ZA 5IYBG 5LMNH 1XMOH 4ED6A 2FK3A 4C5BA 2DPJA 1E4EB 5FJ8G 3PW7A 1AY2A 4I7HA 2R7MA 4IWXA 5DGAA 3GTJA 2CZGA 4IRKA 1PX2A 5A2QW 2HGSA 5L9XA 1RJQA 4RB2C 2RDJA 2XGQA 4NXMH 3RUPA 2CW8A 2VOBA 3GV7B 4J9SA 2W7OA 1S10A 2J6UA 3RB6A 3RGZA 4F4XA 4ED0A 3Q8PB 4M9UA 5JH7F 5KT2A 4A3EG 3GIPA 4LSXA 3VPBA 5IYDG 3V4ZA 4RNMA 4JV0A 2JEFA 5KFBA 1X6PA 4BXXG 5F9LA 3J7AK 5DQGA 3VMMA 5KT3A 3LWBA 1P8LA 3R5FA 1T36A 1SFOA 2JA8G 3GQCA 3V6KA 4O3RA 3H3VH 2FMAA 3I4NG 4DR3H 2R7ZA 3JRXA 3Q8QB 5DGBA 3U9TA 1Y1VA 3JSNA 2KEPA 1T94A 4RU9A 2JA6A 4U6PA 5IP7G 2KSWA 2Q2TA 4O4LF 2AGOA 3V4SA 3BQ0A 5DQIA 4DUYH 4A3MG 5KT6A 3K3PA 2W9BB 3HXLA 4IZOA 5KG1A 5FPRA 1BXRA 2IP4A 4G3IA 4ZI7F 4ECSA 1X6XX 4JI0H 4BBSG 3CQZA 4DL3A 1V4YA 4LH6A 3N42B 1Y1VG 4FM9A 4CC5A 2WAQA 1KJJA 3TIIA 3KHLA 3F8NA 3ORQA 2R8JA 1KJIA 4DV5H 3MJFA 3TINA 4O3OA 4ECYA 2IA6A 2R8GA 4M7EA 2GPSA 3SOKA 4J9PA 3OHAA 4EFBA 3PVXA 2VQDA 4JI1H 4O3SA 3ETJA 2UVVA 1TWCA 3OSNA 4YAJB 4FBUA 4A3CG 3LP8A 2PVPA 2PN1A 3KAKA 3GV8B 2Q2UA 1B6SA 3FKIA 4ECRA 3BABA 2ALZA 1R9TA 4B3SH 1FJGH 2Y0SA 2HI2A 3WNZA 2FPPB 3PR4A 3BA9A 5HV6A 3BA8A 4O4HF 2ASDA 3QFFA 4RZRA 4TUYF 1I50A 4YR2A 2C00A 3H4DA 4JV2A 2FK1A 3G6VA 5C5JA 4DR4H 2HHHH 2J9GA 3FMAA 2YU9A 4MV1A 2I80A 3JZIA 4I55F 4Q45A 1S03G 4EYHB 2V4QA 2ZDQA 4J9NA 3VPCA 4RZQA 3N41B 1KEEA 3H4BA 2E5LH 2QYZA 2UUBH 1L2ZA 5KFLA 1AUVA 5LA6F 4C5AA 5EDWA 4B3TH 1WCMA 4E4TA 4RUCA 2AGQA 2JA7A 3I12A 4WBNF 4YAKB 3GTQA 1E4GT 3OTOH 4IRCA 2W6OA 2DPIA 2HVQA 1HR0H 2R92G 1C3OA 4TQRA 3MR2A 2FP4B 1Y1WG 2BQUA 2C2EA 4Q44A 3OUUA 3V6JA 4A3FG 1Z2NX 3GIJA 2UXDH 3H40A 3JSLA 4XX0B 4YJ2F 3ORRA 5IYZF 2YS7A 3T1YH 4KHPH 3SE7A 1TAEA 5IYCG 1V51A 4WD3A 1DV2A 3SI8A 3M9OB 3WO0A 3E5NA 5DLGA 5LP6F 3JZZA 1N36H 3GTPA 3N6RA 3L4KA 4EGQA 3CVZA 4F50A 4J9MA 2VUGA 4MV3A 2GLTA 4O3NA 4LH7A 4MV8A 4DL6A 4BBRG 3R23A 5KG6A 4RB1A 1UNNC 1RJPA 5CB4F 5KG7A 3RBEA 1IBKH 3L2PA 3DF7A 3U9SA 5KG3A 4IR1A 4MA0A 1O75A 3KHGA 1N48A 1HNZH 5KFVA 3KHHA 3GTGA 1GLVA 4A3KG 2R7NA 1TA8A 5I47A 1XNQH 4B3MH 2UUAH 2M05A 5JVDF 5JVLA 2OH2A 1RG0A 5IP9G 2R7KA 2Y0SE 3FDSA 2W57A 3K3VA 2NU6B 4O3PA 4JUZA 1S68A 4O2BF 4DV6H 4APMA 1WH2A 5JQWA 1I3QA 2M3KA 1I7LA 1S0NA 2E2HA 4RNNA 4FS2A 4JYAH 4IWYA 1KJ8A 1BJTA 2B63A 4YB8B 3GILA 5KFRA 4LF6H 4J9OA 4EG0A 1A9XA 1HPWA 4EGJA 2RGVA 2VUMG
chains in the Genus database with same CATH topology
1VAJA 1ZQ7A 1WSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAJ A;  1ZQ7 A;  1WSC A; 
#chains in the Genus database with same CATH topology
 3M9N B;  1VBG A;  1WSC A;  5KFC A;  4EBE A;  2QK4 A;  5F9N A;  1X6Y A;  4MV9 A;  3RTX A;  5BPH A;  5BR8 H;  5EWG A;  4ECV A;  1OWT A;  4TQS A;  4QWA A;  2CQY A;  4JV1 A;  4L1K A;  3MR3 A;  4JV5 H;  3BQ2 A;  5KFD A;  2FKL A;  4EEY A;  2DLN A;  3R5X A;  2ATL A;  4LFC H;  2JA5 A;  1SCU B;  4IHJ F;  5KFY A;  2BR0 A;  1JX4 A;  1X6Q A;  2IMW P;  3K5I A;  4JI4 H;  5IT9 W;  2FPI B;  4PDB A;  2W9C B;  4ZQI A;  2SCU B;  2YCH A;  2RDI A;  4ED7 A;  5KG4 A;  4GKK H;  4A2A A;  2YS6 A;  2BQR A;  5KFI A;  5J2U F;  2DWC A;  2UXC H;  4ZOL F;  2JA5 G;  3T5L A;  2UXB H;  2P0A A;  4F4Y A;  4ETS A;  2R7L A;  1X9N A;  1A0I A;  1QVE A;  2R82 A;  4UCT A;  2NUA B;  2AGP A;  4RAZ A;  3SOJ A;  4R7R A;  1RYR A;  4RUA A;  2V58 A;  5D1P A;  1TWG A;  1E4E A;  3HKZ E;  5BMV F;  2C22 A;  5D1O B;  2PBZ A;  4JI8 H;  2R84 A;  2R7Z G;  2VA2 A;  4ME6 A;  3C0F B;  1AUX A;  4HR7 A;  2JA6 G;  5KFX A;  1BGW A;  3OHB A;  2C35 B;  3RJ0 A;  1CS0 A;  1BNC A;  5EWF A;  4EFE A;  2VQE H;  3PW0 A;  3PW2 A;  1GYF A;  4RB3 C;  5DG7 A;  1GGO A;  4R8U B;  4EEQ A;  4Y8V B;  2R8I A;  3N40 P;  2WB1 E;  4LF5 H;  2OLS A;  2UUC H;  2YZM A;  3MR6 A;  2JEI A;  1JKJ B;  2YYA A;  1T92 A;  3N6X A;  1VKZ A;  3KAL A;  5C8Y F;  5L1I A;  1S97 A;  2W71 A;  1IBL H;  4NXN H;  2VPQ A;  5DLF A;  1Y14 B;  2V4R A;  4C5C A;  3HBL A;  4LF9 H;  2FE3 A;  3Q2O A;  1DV1 A;  4O4I F;  2FLN A;  2FB9 A;  1X6R A;  1KJ9 A;  1W93 A;  4HNV A;  4GLX A;  1JDB B;  1CQI B;  1N33 H;  4QWC A;  1FVI A;  4DR1 H;  4A3L G;  2DIK A;  5KG5 A;  4EBC A;  2XIG A;  4MV4 A;  5KFM A;  3I4M G;  3T1H H;  3FKI G;  5C1O A;  2UU9 H;  4JI7 H;  3RAQ A;  3V6H A;  4YP3 A;  2PY0 A;  5C4X G;  1PK8 A;  3KAJ A;  4IRD A;  4TV9 F;  3QZ8 A;  2ASJ A;  4ECQ A;  2C2R A;  1RK6 A;  2O03 A;  3TIG A;  1RJR A;  4C2M A;  4GKJ H;  5KFT A;  5KT4 A;  4A3D G;  2NU8 B;  4JI6 H;  1UC8 A;  5L1J A;  4A3G G;  2CKZ B;  2V59 A;  3GID A;  5KFF A;  1WCM G;  2JA7 G;  4YR3 A;  4DV3 H;  3GTM A;  3Q8S B;  3HB9 A;  2PMZ A;  5LXT F;  1Z2P X;  5KFH A;  5KT5 A;  4F4W A;  3GLK A;  2X0S A;  4QJF A;  3EPI A;  3PN1 A;  2ZDH A;  3IG0 A;  3RV4 A;  3HOX G;  1K83 A;  5KFU A;  2XCP A;  4V1J A;  1SEI A;  1E4F T;  5KX5 F;  1ULZ A;  5KFP A;  1DGS A;  3HKZ A;  4K0K H;  2NU7 B;  2R6F A;  1M0T A;  2W6Q A;  4BY1 G;  4JI2 H;  5EWE A;  2R8H A;  3HOW G;  4ED1 A;  4FU0 A;  1OQW A;  4YBZ B;  3M4I A;  4DV2 H;  5C3E G;  3BQ1 A;  4FS1 A;  5FPO A;  4MV6 A;  4UFZ A;  1UC9 A;  2FJZ A;  3RB3 A;  2FLP A;  2JEJ A;  2XC9 A;  3JYZ A;  1T3N A;  3RGX A;  2WB1 A;  2NU9 B;  3N43 B;  4A2B A;  5LOV F;  5KFE A;  4QWB A;  4LF7 H;  3Q1K A;  1GO3 E;  1I7N A;  2AQ4 A;  2ASL A;  1M7J A;  5KFQ A;  3M9M B;  4NLG A;  3T5J A;  2ZJT A;  4QW8 A;  3KTM A;  1VS0 A;  4DR6 H;  1ZHS A;  4LMY A;  4DL4 A;  1JIH A;  1KC7 A;  3PW5 A;  3OSP A;  3VPD A;  4I4T F;  5K2M A;  4ECW A;  1M0W A;  4O3Q A;  2I87 A;  5KG0 A;  2JEG A;  3HOV G;  3Q8R B;  5EOY A;  1EHI A;  3MR5 A;  4J9K A;  1N56 A;  1JDE A;  2B63 G;  4DR7 H;  3RIZ A;  2W6Z A;  1K1Q A;  4DR2 H;  5FD5 A;  2J6S A;  1KJQ A;  4MAM A;  1JLL B;  2NVX A;  4X66 H;  4DL7 A;  4HNT A;  4JI5 H;  1RYS A;  1VBH A;  4ED2 A;  2YL2 A;  1S9F A;  1N34 H;  2RF4 A;  5CAE B;  3QZ7 A;  2I8C A;  2PMZ E;  4YQW A;  4I50 F;  2VR1 A;  5KKN B;  1GSO A;  3LML A;  3G6Y A;  4Q0Y A;  2E2I A;  5KFJ A;  2HVS A;  4GC7 A;  4PWQ A;  3FU1 A;  2VQF H;  5J2T F;  3GIQ A;  4IR9 A;  3J81 W;  1B33 N;  4LSA A;  3ETH A;  3G8C A;  5CA0 F;  3N44 B;  3RB4 A;  3KHR A;  5JW8 A;  2WE6 A;  5LMU H;  4DV4 H;  4UCR A;  4DV0 H;  2VPS A;  3EYY A;  3MWM A;  5FD6 A;  3T5H A;  5L1L A;  3UQ8 A;  1IBM H;  1FKA H;  2J6T A;  2FLL A;  4A3B G;  1S0O A;  2FPG B;  4MTE A;  4XYL B;  3H20 A;  2XCL A;  5KFN A;  4YR0 A;  5HBR B;  4LF8 H;  1ZET A;  4YJ3 F;  1IOV A;  2R86 A;  4DV1 H;  4LFA H;  1M6V A;  4X64 H;  3NGD A;  1AN7 A;  4X62 H;  4HYK A;  2R8K A;  2F4V H;  3MWE A;  4RAY A;  4YY3 H;  3J80 W;  3GII A;  3H0G A;  3T5K A;  2FK2 A;  5KFO A;  1JXL A;  5KFG A;  2V5A A;  2YZG A;  2W9C A;  4OX9 H;  1VAJ A;  4AYB E;  3GIM A;  3RFC A;  5EZY F;  4ECX A;  3HOU G;  2ZDG A;  4QWD A;  1HNX H;  2RGR A;  4QIW E;  3TQ1 A;  5BPF A;  2GPW A;  3PO2 G;  1N32 H;  3H0G G;  5FLM G;  2M7G A;  1CQJ B;  4HNU A;  2XD4 A;  4J9Q A;  2W70 A;  2WYO A;  2WDT A;  5KFK A;  2W9B A;  2W6N A;  5D1O A;  2W7P A;  2W9A A;  4RNO A;  1I94 H;  1RK5 A;  2DZD A;  3JRW A;  3MWD A;  2ZM6 H;  4B3R H;  4BWS C;  5FLX W;  3RV3 A;  4MTD A;  4ECU A;  1J5E H;  3R5H A;  5KT7 A;  4LFB H;  4MA5 A;  3KXY T;  5KG2 A;  3GN9 A;  1ZHQ A;  5LL6 b;  3MFI A;  1KBL A;  1XMQ H;  4IAJ A;  4R8U A;  1TWH A;  2PIL A;  4DLK A;  4UCS A;  4ED8 A;  1B6R A;  4DV7 H;  3GTL A;  1C30 A;  1EZ1 A;  4ECT A;  5LYJ F;  4LF4 H;  3N8D A;  1XDN A;  5KFA A;  5CA1 F;  4XYM B;  1DZO A;  4QWE A;  2UVR A;  1MZB A;  3G6X A;  3GIK A;  4ECZ A;  3PO3 G;  4DL5 A;  2R92 A;  4A3I G;  2OWO A;  4EBD A;  1W96 A;  1Y1W A;  5L1K A;  4BY7 G;  2W8K A;  3RBD A;  4A3J G;  2VA3 A;  5KFZ A;  2V9W A;  2YW2 A;  2XGP A;  4U7C A;  5GON F;  1V9P A;  5C1P A;  5KFS A;  3BG5 A;  1GSA A;  3PZP A;  2YZN A;  2UVU A;  4JI3 H;  4J0M A;  3K5H A;  2IBK A;  1EUC B;  4O2A F;  4LW9 A;  5KFW A;  4QW9 A;  2YRX A;  2CW7 A;  3OUZ A;  1EYZ A;  1SYX B;  2NVY A;  4HQ6 A;  3L4J A;  5DG9 A;  1S0M A;  4ED3 A;  1GSH A;  4FBT A;  4DL2 A;  5D8D A;  3BAA A;  1K1S A;  4DR5 H;  3WO1 A;  4GC6 A;  2W6P A;  3G20 A;  4AYB A;  5IWA H;  1CE8 A;  5H80 A;  1WR2 A;  2R93 A;  3GTK A;  4CC6 A;  3JAM W;  5DG8 A;  1DIK A;  3GV5 B;  4EYI B;  3RF2 A;  4QIW A;  3EPG A;  4UCV A;  3RB0 A;  2C2D A;  4Q43 A;  4TV8 F;  2W8L A;  3IN5 A;  4Q8F A;  3HOY G;  2WAQ E;  2XCA A;  4J9R A;  1TWF A;  3RAX A;  4XZ3 B;  3PR5 B;  4F4Z A;  1B04 A;  4J9L A;  1I6U A;  4DUZ H;  4X65 H;  2R93 G;  3TQT A;  4MV7 A;  5T14 A;  2UVW A;  2WTF A;  2AU0 A;  2R87 A;  4UCU A;  2HJW A;  2W6M A;  4YHH H;  1XNR H;  4UCO A;  4Q8E A;  3UFX B;  2HVR A;  1Z2O X;  1IOW A;  5DQH A;  3AYH B;  1EUD B;  4ZHQ F;  2YRW A;  2VUM A;  3BJY A;  3GTO A;  3MFH A;  4RB0 A;  5JUM A;  2R85 A;  2MCT A;  4A93 G;  1TWA A;  5C44 G;  1HNW H;  4AQY H;  3PW4 A;  2C28 A;  1ZQ7 A;  2BQ3 A;  3HOZ G;  1X6Z A;  5IYB G;  5LMN H;  1XMO H;  4ED6 A;  2FK3 A;  4C5B A;  2DPJ A;  1E4E B;  5FJ8 G;  3PW7 A;  1AY2 A;  4I7H A;  2R7M A;  4IWX A;  5DGA A;  3GTJ A;  2CZG A;  4IRK A;  1PX2 A;  5A2Q W;  2HGS A;  5L9X A;  1RJQ A;  4RB2 C;  2RDJ A;  2XGQ A;  4NXM H;  3RUP A;  2CW8 A;  2VOB A;  3GV7 B;  4J9S A;  2W7O A;  1S10 A;  2J6U A;  3RB6 A;  3RGZ A;  4F4X A;  4ED0 A;  3Q8P B;  4M9U A;  5JH7 F;  5KT2 A;  4A3E G;  3GIP A;  4LSX A;  3VPB A;  5IYD G;  3V4Z A;  4RNM A;  4JV0 A;  2JEF A;  5KFB A;  1X6P A;  4BXX G;  5F9L A;  3J7A K;  5DQG A;  3VMM A;  5KT3 A;  3LWB A;  1P8L A;  3R5F A;  1T36 A;  1SFO A;  2JA8 G;  3GQC A;  3V6K A;  4O3R A;  3H3V H;  2FMA A;  3I4N G;  4DR3 H;  2R7Z A;  3JRX A;  3Q8Q B;  5DGB A;  3U9T A;  1Y1V A;  3JSN A;  2KEP A;  1T94 A;  4RU9 A;  2JA6 A;  4U6P A;  5IP7 G;  2KSW A;  2Q2T A;  4O4L F;  2AGO A;  3V4S A;  3BQ0 A;  5DQI A;  4DUY H;  4A3M G;  5KT6 A;  3K3P A;  2W9B B;  3HXL A;  4IZO A;  5KG1 A;  5FPR A;  1BXR A;  2IP4 A;  4G3I A;  4ZI7 F;  4ECS A;  1X6X X;  4JI0 H;  4BBS G;  3CQZ A;  4DL3 A;  1V4Y A;  4LH6 A;  3N42 B;  1Y1V G;  4FM9 A;  4CC5 A;  2WAQ A;  1KJJ A;  3TII A;  3KHL A;  3F8N A;  3ORQ A;  2R8J A;  1KJI A;  4DV5 H;  3MJF A;  3TIN A;  4O3O A;  4ECY A;  2IA6 A;  2R8G A;  4M7E A;  2GPS A;  3SOK A;  4J9P A;  3OHA A;  4EFB A;  3PVX A;  2VQD A;  4JI1 H;  4O3S A;  3ETJ A;  2UVV A;  1TWC A;  3OSN A;  4YAJ B;  4FBU A;  4A3C G;  3LP8 A;  2PVP A;  2PN1 A;  3KAK A;  3GV8 B;  2Q2U A;  1B6S A;  3FKI A;  4ECR A;  3BAB A;  2ALZ A;  1R9T A;  4B3S H;  1FJG H;  2Y0S A;  2HI2 A;  3WNZ A;  2FPP B;  3PR4 A;  3BA9 A;  5HV6 A;  3BA8 A;  4O4H F;  2ASD A;  3QFF A;  4RZR A;  4TUY F;  1I50 A;  4YR2 A;  2C00 A;  3H4D A;  4JV2 A;  2FK1 A;  3G6V A;  5C5J A;  4DR4 H;  2HHH H;  2J9G A;  3FMA A;  2YU9 A;  4MV1 A;  2I80 A;  3JZI A;  4I55 F;  4Q45 A;  1S03 G;  4EYH B;  2V4Q A;  2ZDQ A;  4J9N A;  3VPC A;  4RZQ A;  3N41 B;  1KEE A;  3H4B A;  2E5L H;  2QYZ A;  2UUB H;  1L2Z A;  5KFL A;  1AUV A;  5LA6 F;  4C5A A;  5EDW A;  4B3T H;  1WCM A;  4E4T A;  4RUC A;  2AGQ A;  2JA7 A;  3I12 A;  4WBN F;  4YAK B;  3GTQ A;  1E4G T;  3OTO H;  4IRC A;  2W6O A;  2DPI A;  2HVQ A;  1HR0 H;  2R92 G;  1C3O A;  4TQR A;  3MR2 A;  2FP4 B;  1Y1W G;  2BQU A;  2C2E A;  4Q44 A;  3OUU A;  3V6J A;  4A3F G;  1Z2N X;  3GIJ A;  2UXD H;  3H40 A;  3JSL A;  4XX0 B;  4YJ2 F;  3ORR A;  5IYZ F;  2YS7 A;  3T1Y H;  4KHP H;  3SE7 A;  1TAE A;  5IYC G;  1V51 A;  4WD3 A;  1DV2 A;  3SI8 A;  3M9O B;  3WO0 A;  3E5N A;  5DLG A;  5LP6 F;  3JZZ A;  1N36 H;  3GTP A;  3N6R A;  3L4K A;  4EGQ A;  3CVZ A;  4F50 A;  4J9M A;  2VUG A;  4MV3 A;  2GLT A;  4O3N A;  4LH7 A;  4MV8 A;  4DL6 A;  4BBR G;  3R23 A;  5KG6 A;  4RB1 A;  1UNN C;  1RJP A;  5CB4 F;  5KG7 A;  3RBE A;  1IBK H;  3L2P A;  3DF7 A;  3U9S A;  5KG3 A;  4IR1 A;  4MA0 A;  1O75 A;  3KHG A;  1N48 A;  1HNZ H;  5KFV A;  3KHH A;  3GTG A;  1GLV A;  4A3K G;  2R7N A;  1TA8 A;  5I47 A;  1XNQ H;  4B3M H;  2UUA H;  2M05 A;  5JVD F;  5JVL A;  2OH2 A;  1RG0 A;  5IP9 G;  2R7K A;  2Y0S E;  3FDS A;  2W57 A;  3K3V A;  2NU6 B;  4O3P A;  4JUZ A;  1S68 A;  4O2B F;  4DV6 H;  4APM A;  1WH2 A;  5JQW A;  1I3Q A;  2M3K A;  1I7L A;  1S0N A;  2E2H A;  4RNN A;  4FS2 A;  4JYA H;  4IWY A;  1KJ8 A;  1BJT A;  2B63 A;  4YB8 B;  3GIL A;  5KFR A;  4LF6 H;  4J9O A;  4EG0 A;  1A9X A;  1HPW A;  4EGJ A;  2RGV A;  2VUM G; 
#chains in the Genus database with same CATH homology
 1VAJ A;  1ZQ7 A;  1WSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...