1ZQ7A

X-ray crystal structure of protein q8pzk8 from methanosarcina mazei. northeast structural genomics consortium target mar9.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
204
structure length
201
Chain Sequence
MLTETEGRAAVKLARKTIEIFLSKGKSPRSGVELSPVFEEYRGVFVTLTEGGLLRGCIGHPYPDSTLKEAILDSAISAATRDPRFPTVEQDEMKNILVEVTILTQPEKINASPKELPDKVEIGKHGLIVKQGYCQGLLLPQVAPENDMDSIDFLSHTCMKAGLSPDAWVKGAEVYCFEGQIFKEKEPDGEVIEEKFLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the hypothetical protein Q8PZK8 from Methanosarcina mazei at the resolution 2.1A. Northeast Structural Genomics Consortium target MaR9.
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein MM0484
total genus 52
structure length 201
sequence length 204
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01871 AMMECR1 AMMECR1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.700.20 Alpha Beta 2-Layer Sandwich Glycoprotein, Type 4 Pilin Hypothetical protein ph0010; domain 1 1zq7A01
3.30.1490.150 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Hypothetical protein ph0010; domain 2 1zq7A02
1ZQ7A 1WSCA 1VAJA
chains in the Genus database with same CATH superfamily
3MWEA 3MR3A 2R8HA 1XDNA 3EPGA 4LF9H 4YBZB 1I50A 4C2MA 2JEIA 1Y14B 4RZRA 2YRXA 4J0MA 3LWBA 5KFJA 5KFKA 4DUZH 3GTQA 1HR0H 2CW7A 3TIGA 2W9CA 1Y1VG 3N8DA 5FJ8G 2AGOA 2FK3A 1S0OA 1N36H 4QWDA 3GIKA 5T14A 1KEEA 2W9BA 4E4TA 1B6SA 4F4WA 1JDBB 1I7LA 2DIKA 4M7EA 4A3KG 4DV5H 1KJIA 3ETHA 3F8NA 3JRWA 1L2ZA 4ECUA 3I4MG 2FK1A 4DR6H 2CKZB 3J80W 1OQWA 4F4XA 3GTMA 5KFBA 5JVDF 4QWCA 3HB9A 2JEFA 3GTKA 5IWAH 2C28A 5KG1A 2HJWA 1GSAA 4QW8A 2XIGA 4A3MG 5HBRB 3KALA 4IWYA 4FS1A 1RK6A 1ZHQA 3N41B 4MV8A 3RV4A 1N32H 4R8UA 4LFCH 3T5KA 4YJ3F 1GSOA 2W8KA 4IRKA 1K83A 2FLPA 2FK2A 5D1OA 2HVQA 5KX5F 1HNWH 1B6RA 2PVPA 4MTEA 3BQ1A 5KFMA 4DV6H 4ED7A 2AGPA 4I50F 3GN9A 4Q43A 3PW2A 2FMAA 2VOBA 3RGZA 4B3MH 4J9QA 4APMA 5JW8A 4ECVA 4DL5A 1X6RA 4IRDA 2DLNA 4RAZA 2FP4B 2ZM6H 2R86A 2KEPA 1EYZA 2YS6A 3K5HA 5IYBG 4A3FG 4LW9A 1AUXA 2BQRA 1TWGA 4LF7H 5FD6A 5D8DA 4TQRA 5JQWA 4B3RH 4HR7A 1KJQA 5FLXW 1X6ZA 1Y1VA 3Q8PB 1S97A 5DLFA 3PO2G 1V4YA 1IBKH 4DL2A 4EFEA 2ZJTA 4YP3A 4X66H 3G6XA 4QWEA 1VAJA 2XD4A 2R93G 2MCTA 2V5AA 1JIHA 1TAEA 3V4SA 4CC6A 3OSPA 3K5IA 1C3OA 5KG6A 1VS0A 1GLVA 2ALZA 1FJGH 3HOWG 1XNRH 4ME6A 4JI0H 2I8CA 2CZGA 2Q2UA 4HNUA 2X0SA 1DIKA 1S0NA 1S10A 1N33H 4JYAH 4J9OA 1I94H 3BA9A 3EPIA 3PW5A 4JI4H 5FPRA 1Y1WA 4B3SH 2KSWA 4ETSA 3T5LA 1IBLH 2W9AA 3RF2A 2E2HA 4Q8EA 1Z2OX 1CS0A 2CQYA 2HGSA 4IR9A 3HOUG 3PO3G 2R92A 3V6HA 2UVUA 1WCMG 4CC5A 3N6RA 2JA8G 4RU9A 3KHHA 3RB3A 5KFOA 1E4EA 4UCRA 3T1YH 2J6SA 2W9CB 1M0TA 2OWOA 2W70A 4M9UA 2R6FA 3HOYG 1VKZA 4ECQA 4JI8H 2YS7A 4LMYA 3N43B 5LXTF 4YR3A 2V4QA 1EUCB 3RFCA 4A3EG 5L9XA 2E2IA 5C4XG 5EWGA 3MR6A 3V6KA 3GIQA 4NXNH 1RJPA 3PVXA 1EUDB 3HXLA 4YJ2F 2PMZA 1KJJA 4BWSC 4QWBA 4DR2H 4GC7A 5DG7A 3ETJA 2ASJA 1DV1A 4J9PA 1M7JA 3G8CA 4YB8B 1A9XA 2IP4A 5KFRA 4HYKA 3T5HA 4F4ZA 4LFBH 4C5AA 4Q44A 2UXCH 4RB3C 3RB6A 2NVXA 4MV3A 5I47A 1S0MA 4RB0A 3GILA 2DPIA 3G20A 1UC9A 5KFTA 1RYSA 1Z2NX 3KAJA 2R8GA 2E5LH 1VBHA 3L4JA 3GTPA 5CA0F 4QW9A 2QYZA 3IG0A 4IWXA 3QZ8A 1SEIA 4J9SA 4BXXG 2WDTA 2JA7A 4DV0H 2NU7B 2Y0SE 5IP7G 2YW2A 3JZIA 4XYMB 4LH7A 2W7OA 3MFHA 2JEJA 2YZMA 1KC7A 1S9FA 2WAQA 5BR8H 3I12A 4DV7H 3R5XA 1ZETA 4RAYA 5BMVF 2UXDH 2VUGA 4LH6A 4LSAA 3GTOA 4O2AF 4EBCA 2O03A 1KJ8A 2W6QA 3SE7A 4O2BF 5KFWA 4FBUA 1P8LA 1WR2A 2FPGB 2NU8B 4I4TF 5FD5A 4JI2H 1J5EH 4A2AA 4F50A 2W6ZA 2V4RA 3BAAA 5L1KA 2FJZA 4EEQA 3BQ2A 2JA5G 1JLLB 5KG5A 4DV3H 5IYZF 2GPWA 1IOVA 2AGQA 1FKAH 5KFNA 1CQIB 4A93G 5KFQA 4JV0A 3J81W 5BPFA 2W8LA 2IMWP 3BABA 5DQGA 5D1OB 1SFOA 3OUUA 1M6VA 4A2BA 3U9TA 4EEYA 4ECYA 3H40A 3T5JA 3VPCA 1TWHA 4NXMH 2R82A 2R7ZA 2R7LA 2Y0SA 2NU9B 4QIWE 2J6UA 2UUAH 5EOYA 1HNZH 2GLTA 3R5HA 2WYOA 4A3CG 4RZQA 3H4DA 1XNQH 5DG9A 1GYFA 1S03G 5IT9W 3MR5A 1DGSA 3M9NB 2HHHH 3GIPA 3GV8B 4F4YA 4BBRG 1W93A 3FDSA 3OHAA 4Q8FA 5KT7A 1VBGA 2QK4A 4DR3H 3M9OB 2R84A 2AQ4A 2W6NA 4XZ3B 3BA8A 4DL6A 2RGRA 3MWDA 2XGPA 5L1LA 3R23A 3FKIA 3GIJA 4LFAH 3FU1A 4DV2H 1Z2PX 1B33N 4X65H 4JI7H 3HOVG 4ECZA 1N34H 2GPSA 4XX0B 1T92A 5KFGA 4J9NA 4ED3A 4ECRA 1V51A 5KT5A 5IP9G 4RUCA 2ASLA 5JH7F 4RB1A 4YHHH 5KFVA 5KFDA 4EGQA 4K0KH 4FU0A 3KXYT 3RAQA 2BQ3A 4O3QA 1V9PA 3JZZA 4FM9A 2R7MA 1I7NA 4IZOA 3H0GA 4KHPH 2FLNA 5L1IA 5KT2A 3PW4A 2R92G 2C22A 2NU6B 4O3PA 3FMAA 5C8YF 2W7PA 1AN7A 4QJFA 3JYZA 4I55F 4A3JG 4O3NA 4ECXA 2W6OA 3HKZE 4RUAA 4O4LF 3N44B 4WBNF 4GLXA 2R7KA 5J2TF 3Q2OA 3PZPA 3HOZG 4J9RA 2UUCH 2IBKA 2B63A 5KFZA 3T1HH 3TQ1A 4LF8H 4RB2C 1I6UA 3JSLA 1K1QA 2HI2A 2C2EA 5FPOA 2DPJA 2XCAA 4DR4H 3RBDA 3GQCA 4DUYH 2W6MA 1EZ1A 3LMLA 5KFLA 2V9WA 1R9TA 4C5BA 5KT3A 2VR1A 2W6PA 5KFAA 3K3VA 3GLKA 1K1SA 4IHJF 4PDBA 2R8KA 4X62H 4IAJA 2WE6A 2JA6G 5FLMG 4O3RA 4EGJA 1AY2A 1HPWA 5LA6F 4HNTA 4JV1A 5F9NA 5KG3A 2R85A 4JV2A 3H0GG 3C0FB 3PN1A 3KAKA 2YRWA 1AUVA 3JRXA 4L1KA 3HOXG 4R7RA 5LMNH 4J9MA 3SOJA 5KFIA 1T94A 3I4NG 2RDIA 4ECTA 3GTLA 1OWTA 1W96A 2M05A 5EZYF 4YAKB 1EHIA 5LYJF 5KG2A 2VA3A 3RBEA 2ZDGA 5C1PA 2WB1E 5EWFA 2DWCA 3BG5A 4JV5H 2XCLA 3CVZA 1TA8A 2FB9A 3TINA 4WD3A 5KFPA 4DR5H 5IYDG 5HV6A 4FS2A 2W57A 3CQZA 1M0WA 1E4EB 1WCMA 4U7CA 2YU9A 2YZNA 2DZDA 1TWFA 1JX4A 3N42B 3RUPA 2HVRA 3OUZA 4R8UB 4DV1H 5K2MA 1X9NA 5EWEA 3L4KA 3QFFA 4QWAA 3ORQA 2M7GA 3TIIA 4GKKH 4UCOA 4BY7G 1E4GT 4Q45A 4O4IF 4LF4H 4DR1H 3N40P 2CW8A 1PK8A 4UCTA 5KT4A 2HVSA 3UFXB 2VQEH 5C44G 4HNVA 5DQIA 3AYHB 4O3OA 3PW0A 3QZ7A 4LSXA 1RJRA 4MA5A 3Q8QB 1X6PA 3V6JA 5JUMA 3MWMA 5F9LA 2JA6A 2WAQE 4EYIB 2NUAB 4TQSA 1IOWA 1JKJB 5CA1F 1X6YA 4U6PA 1BGWA 5KFUA 2WB1A 1ULZA 4O4HF 5KFYA 4MTDA 3TQTA 4C5CA 3MR2A 4QIWA 4EYHB 2I80A 2PN1A 2UVVA 2C2DA 4J9KA 3WO1A 1UC8A 4A3GG 4AQYH 1FVIA 1TWCA 2VQDA 2YYAA 4MV9A 2UVRA 2R87A 2VPQA 3PR5B 2V59A 2W71A 4ECSA 2NVYA 5LL6b 3UQ8A 2J9GA 3BJYA 5D1PA 2B63G 4A3BG 2PMZE 2YL2A 1UNNC 4ZOLF 3JAMW 2R93A 5DQHA 4BBSG 4UCVA 4ED2A 2BQUA 4DL3A 2PY0A 1S68A 2PILA 5KG7A 4DV4H 1DV2A 1DZOA 4TV8F 5DG8A 1BJTA 1XMQH 2OH2A 3KHLA 2VA2A 2UU9H 4Q0YA 1N48A 1RJQA 3K3PA 5KFCA 2YCHA 5JVLA 1ZQ7A 2ASDA 4ZI7F 3VPBA 4ECWA 2XCPA 2VUMA 4LF6H 3Q8SB 5LMUH 3WO0A 4EG0A 1SCUB 3PR4A 2FKLA 4UCSA 1KJ9A 3MJFA 3RTXA 4V1JA 3M9MB 2ZDQA 2XGQA 4DL7A 3HBLA 4MA0A 3RGXA 5DGBA 3GV5B 1GGOA 1CQJB 1RK5A 4ZHQF 4RNOA 3GTGA 5CAEB 4G3IA 2C00A 3RIZA 4MV1A 3WNZA 5LP6F 5IYCG 2M3KA 4A3LG 4I7HA 4TV9F 4X64H 3VPDA 2XC9A 4JI6H 3MFIA 2UXBH 5C5JA 5DLGA 4YAJB 3NGDA 2W9BB 2P0AA 4AYBE 4DL4A 2IA6A 3Q1KA 3U9SA 4HQ6A 4YQWA 4MV4A 2FPIB 3SI8A 1N56A 1QVEA 1X6XX 4ED8A 3EYYA 4MV6A 1XMOH 3IN5A 1TWAA 5H80A 2R7ZG 3J7AK 4FBTA 2J6TA 3PW7A 4EBDA 4OX9H 4UCUA 3GV7B 4A3DG 2VPSA 4YR0A 3KTMA 4JI5H 2R7NA 4J9LA 1WSCA 4GC6A 4XYLB 3RB4A 1MZBA 3H20A 5KFXA 5LOVF 4RNMA 4RNNA 2ATLA 2SCUB 5BPHA 3RV3A 5A2QW 1I3QA 3GIMA 5KG4A 4A3IG 1PX2A 1C30A 3FKIG 4PWQA 4ZQIA 4EBEA 3OHBA 2RF4A 3N6XA 4MV7A 1A0IA 1T36A 1WH2A 2UUBH 1RG0A 5L1JA 2BR0A 2Q2TA 5KFEA 4B3TH 3GIIA 2R8JA 3RB0A 1SYXB 4IRCA 5GONF 2FPPB 2YZGA 3OTOH 1JXLA 4AYBA 3BQ0A 1HNXH 1BNCA 3SOKA 4ED1A 1Y1WG 1CE8A 1X6QA 4ED6A 3GTJA 2F4VH 2ZDHA 3RJ0A 4ED0A 4BY1G 1RYRA 3M4IA 3H4BA 2VQFH 1KBLA 3DF7A 3V4ZA 2R8IA 2AU0A 3LP8A 5KG0A 2FLLA 1JDEA 2WTFA 3KHGA 2V58A 2JA7G 2I87A 4LF5H 5KFSA 2UVWA 4JI1H 1BXRA 5KFFA 1O75A 3L2PA 4NLGA 4IR1A 3E5NA 1E4FT 4DR7H 4YR2A 1ZHSA 3R5FA 4JI3H 4GKJH 3JSNA 4TUYF 5EDWA 5DGAA 5CB4F 4Y8VB 2RDJA 5C3EG 2OLSA 2VUMG 2JA5A 5KKNB 5J2UF 3KHRA 5KFHA 1IBMH 1GO3E 5C1OA 3OSNA 2RGVA 4MAMA 3VMMA 3GIDA 2PBZA 4UFZA 3G6VA 4O3SA 3H3VH 1T3NA 1B04A 1GSHA 3ORRA 3G6YA 2C35B 3Q8RB 3HKZA 2FE3A 5KT6A 3RAXA 4JUZA 4EFBA 2C2RA 4YY3H 4DLKA 2JEGA
chains in the Genus database with same CATH topology
1ZQ7A 1WSCA 1VAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQ7 A;  1WSC A;  1VAJ A; 
#chains in the Genus database with same CATH topology
 3MWE A;  3MR3 A;  2R8H A;  1XDN A;  3EPG A;  4LF9 H;  4YBZ B;  1I50 A;  4C2M A;  2JEI A;  1Y14 B;  4RZR A;  2YRX A;  4J0M A;  3LWB A;  5KFJ A;  5KFK A;  4DUZ H;  3GTQ A;  1HR0 H;  2CW7 A;  3TIG A;  2W9C A;  1Y1V G;  3N8D A;  5FJ8 G;  2AGO A;  2FK3 A;  1S0O A;  1N36 H;  4QWD A;  3GIK A;  5T14 A;  1KEE A;  2W9B A;  4E4T A;  1B6S A;  4F4W A;  1JDB B;  1I7L A;  2DIK A;  4M7E A;  4A3K G;  4DV5 H;  1KJI A;  3ETH A;  3F8N A;  3JRW A;  1L2Z A;  4ECU A;  3I4M G;  2FK1 A;  4DR6 H;  2CKZ B;  3J80 W;  1OQW A;  4F4X A;  3GTM A;  5KFB A;  5JVD F;  4QWC A;  3HB9 A;  2JEF A;  3GTK A;  5IWA H;  2C28 A;  5KG1 A;  2HJW A;  1GSA A;  4QW8 A;  2XIG A;  4A3M G;  5HBR B;  3KAL A;  4IWY A;  4FS1 A;  1RK6 A;  1ZHQ A;  3N41 B;  4MV8 A;  3RV4 A;  1N32 H;  4R8U A;  4LFC H;  3T5K A;  4YJ3 F;  1GSO A;  2W8K A;  4IRK A;  1K83 A;  2FLP A;  2FK2 A;  5D1O A;  2HVQ A;  5KX5 F;  1HNW H;  1B6R A;  2PVP A;  4MTE A;  3BQ1 A;  5KFM A;  4DV6 H;  4ED7 A;  2AGP A;  4I50 F;  3GN9 A;  4Q43 A;  3PW2 A;  2FMA A;  2VOB A;  3RGZ A;  4B3M H;  4J9Q A;  4APM A;  5JW8 A;  4ECV A;  4DL5 A;  1X6R A;  4IRD A;  2DLN A;  4RAZ A;  2FP4 B;  2ZM6 H;  2R86 A;  2KEP A;  1EYZ A;  2YS6 A;  3K5H A;  5IYB G;  4A3F G;  4LW9 A;  1AUX A;  2BQR A;  1TWG A;  4LF7 H;  5FD6 A;  5D8D A;  4TQR A;  5JQW A;  4B3R H;  4HR7 A;  1KJQ A;  5FLX W;  1X6Z A;  1Y1V A;  3Q8P B;  1S97 A;  5DLF A;  3PO2 G;  1V4Y A;  1IBK H;  4DL2 A;  4EFE A;  2ZJT A;  4YP3 A;  4X66 H;  3G6X A;  4QWE A;  1VAJ A;  2XD4 A;  2R93 G;  2MCT A;  2V5A A;  1JIH A;  1TAE A;  3V4S A;  4CC6 A;  3OSP A;  3K5I A;  1C3O A;  5KG6 A;  1VS0 A;  1GLV A;  2ALZ A;  1FJG H;  3HOW G;  1XNR H;  4ME6 A;  4JI0 H;  2I8C A;  2CZG A;  2Q2U A;  4HNU A;  2X0S A;  1DIK A;  1S0N A;  1S10 A;  1N33 H;  4JYA H;  4J9O A;  1I94 H;  3BA9 A;  3EPI A;  3PW5 A;  4JI4 H;  5FPR A;  1Y1W A;  4B3S H;  2KSW A;  4ETS A;  3T5L A;  1IBL H;  2W9A A;  3RF2 A;  2E2H A;  4Q8E A;  1Z2O X;  1CS0 A;  2CQY A;  2HGS A;  4IR9 A;  3HOU G;  3PO3 G;  2R92 A;  3V6H A;  2UVU A;  1WCM G;  4CC5 A;  3N6R A;  2JA8 G;  4RU9 A;  3KHH A;  3RB3 A;  5KFO A;  1E4E A;  4UCR A;  3T1Y H;  2J6S A;  2W9C B;  1M0T A;  2OWO A;  2W70 A;  4M9U A;  2R6F A;  3HOY G;  1VKZ A;  4ECQ A;  4JI8 H;  2YS7 A;  4LMY A;  3N43 B;  5LXT F;  4YR3 A;  2V4Q A;  1EUC B;  3RFC A;  4A3E G;  5L9X A;  2E2I A;  5C4X G;  5EWG A;  3MR6 A;  3V6K A;  3GIQ A;  4NXN H;  1RJP A;  3PVX A;  1EUD B;  3HXL A;  4YJ2 F;  2PMZ A;  1KJJ A;  4BWS C;  4QWB A;  4DR2 H;  4GC7 A;  5DG7 A;  3ETJ A;  2ASJ A;  1DV1 A;  4J9P A;  1M7J A;  3G8C A;  4YB8 B;  1A9X A;  2IP4 A;  5KFR A;  4HYK A;  3T5H A;  4F4Z A;  4LFB H;  4C5A A;  4Q44 A;  2UXC H;  4RB3 C;  3RB6 A;  2NVX A;  4MV3 A;  5I47 A;  1S0M A;  4RB0 A;  3GIL A;  2DPI A;  3G20 A;  1UC9 A;  5KFT A;  1RYS A;  1Z2N X;  3KAJ A;  2R8G A;  2E5L H;  1VBH A;  3L4J A;  3GTP A;  5CA0 F;  4QW9 A;  2QYZ A;  3IG0 A;  4IWX A;  3QZ8 A;  1SEI A;  4J9S A;  4BXX G;  2WDT A;  2JA7 A;  4DV0 H;  2NU7 B;  2Y0S E;  5IP7 G;  2YW2 A;  3JZI A;  4XYM B;  4LH7 A;  2W7O A;  3MFH A;  2JEJ A;  2YZM A;  1KC7 A;  1S9F A;  2WAQ A;  5BR8 H;  3I12 A;  4DV7 H;  3R5X A;  1ZET A;  4RAY A;  5BMV F;  2UXD H;  2VUG A;  4LH6 A;  4LSA A;  3GTO A;  4O2A F;  4EBC A;  2O03 A;  1KJ8 A;  2W6Q A;  3SE7 A;  4O2B F;  5KFW A;  4FBU A;  1P8L A;  1WR2 A;  2FPG B;  2NU8 B;  4I4T F;  5FD5 A;  4JI2 H;  1J5E H;  4A2A A;  4F50 A;  2W6Z A;  2V4R A;  3BAA A;  5L1K A;  2FJZ A;  4EEQ A;  3BQ2 A;  2JA5 G;  1JLL B;  5KG5 A;  4DV3 H;  5IYZ F;  2GPW A;  1IOV A;  2AGQ A;  1FKA H;  5KFN A;  1CQI B;  4A93 G;  5KFQ A;  4JV0 A;  3J81 W;  5BPF A;  2W8L A;  2IMW P;  3BAB A;  5DQG A;  5D1O B;  1SFO A;  3OUU A;  1M6V A;  4A2B A;  3U9T A;  4EEY A;  4ECY A;  3H40 A;  3T5J A;  3VPC A;  1TWH A;  4NXM H;  2R82 A;  2R7Z A;  2R7L A;  2Y0S A;  2NU9 B;  4QIW E;  2J6U A;  2UUA H;  5EOY A;  1HNZ H;  2GLT A;  3R5H A;  2WYO A;  4A3C G;  4RZQ A;  3H4D A;  1XNQ H;  5DG9 A;  1GYF A;  1S03 G;  5IT9 W;  3MR5 A;  1DGS A;  3M9N B;  2HHH H;  3GIP A;  3GV8 B;  4F4Y A;  4BBR G;  1W93 A;  3FDS A;  3OHA A;  4Q8F A;  5KT7 A;  1VBG A;  2QK4 A;  4DR3 H;  3M9O B;  2R84 A;  2AQ4 A;  2W6N A;  4XZ3 B;  3BA8 A;  4DL6 A;  2RGR A;  3MWD A;  2XGP A;  5L1L A;  3R23 A;  3FKI A;  3GIJ A;  4LFA H;  3FU1 A;  4DV2 H;  1Z2P X;  1B33 N;  4X65 H;  4JI7 H;  3HOV G;  4ECZ A;  1N34 H;  2GPS A;  4XX0 B;  1T92 A;  5KFG A;  4J9N A;  4ED3 A;  4ECR A;  1V51 A;  5KT5 A;  5IP9 G;  4RUC A;  2ASL A;  5JH7 F;  4RB1 A;  4YHH H;  5KFV A;  5KFD A;  4EGQ A;  4K0K H;  4FU0 A;  3KXY T;  3RAQ A;  2BQ3 A;  4O3Q A;  1V9P A;  3JZZ A;  4FM9 A;  2R7M A;  1I7N A;  4IZO A;  3H0G A;  4KHP H;  2FLN A;  5L1I A;  5KT2 A;  3PW4 A;  2R92 G;  2C22 A;  2NU6 B;  4O3P A;  3FMA A;  5C8Y F;  2W7P A;  1AN7 A;  4QJF A;  3JYZ A;  4I55 F;  4A3J G;  4O3N A;  4ECX A;  2W6O A;  3HKZ E;  4RUA A;  4O4L F;  3N44 B;  4WBN F;  4GLX A;  2R7K A;  5J2T F;  3Q2O A;  3PZP A;  3HOZ G;  4J9R A;  2UUC H;  2IBK A;  2B63 A;  5KFZ A;  3T1H H;  3TQ1 A;  4LF8 H;  4RB2 C;  1I6U A;  3JSL A;  1K1Q A;  2HI2 A;  2C2E A;  5FPO A;  2DPJ A;  2XCA A;  4DR4 H;  3RBD A;  3GQC A;  4DUY H;  2W6M A;  1EZ1 A;  3LML A;  5KFL A;  2V9W A;  1R9T A;  4C5B A;  5KT3 A;  2VR1 A;  2W6P A;  5KFA A;  3K3V A;  3GLK A;  1K1S A;  4IHJ F;  4PDB A;  2R8K A;  4X62 H;  4IAJ A;  2WE6 A;  2JA6 G;  5FLM G;  4O3R A;  4EGJ A;  1AY2 A;  1HPW A;  5LA6 F;  4HNT A;  4JV1 A;  5F9N A;  5KG3 A;  2R85 A;  4JV2 A;  3H0G G;  3C0F B;  3PN1 A;  3KAK A;  2YRW A;  1AUV A;  3JRX A;  4L1K A;  3HOX G;  4R7R A;  5LMN H;  4J9M A;  3SOJ A;  5KFI A;  1T94 A;  3I4N G;  2RDI A;  4ECT A;  3GTL A;  1OWT A;  1W96 A;  2M05 A;  5EZY F;  4YAK B;  1EHI A;  5LYJ F;  5KG2 A;  2VA3 A;  3RBE A;  2ZDG A;  5C1P A;  2WB1 E;  5EWF A;  2DWC A;  3BG5 A;  4JV5 H;  2XCL A;  3CVZ A;  1TA8 A;  2FB9 A;  3TIN A;  4WD3 A;  5KFP A;  4DR5 H;  5IYD G;  5HV6 A;  4FS2 A;  2W57 A;  3CQZ A;  1M0W A;  1E4E B;  1WCM A;  4U7C A;  2YU9 A;  2YZN A;  2DZD A;  1TWF A;  1JX4 A;  3N42 B;  3RUP A;  2HVR A;  3OUZ A;  4R8U B;  4DV1 H;  5K2M A;  1X9N A;  5EWE A;  3L4K A;  3QFF A;  4QWA A;  3ORQ A;  2M7G A;  3TII A;  4GKK H;  4UCO A;  4BY7 G;  1E4G T;  4Q45 A;  4O4I F;  4LF4 H;  4DR1 H;  3N40 P;  2CW8 A;  1PK8 A;  4UCT A;  5KT4 A;  2HVS A;  3UFX B;  2VQE H;  5C44 G;  4HNV A;  5DQI A;  3AYH B;  4O3O A;  3PW0 A;  3QZ7 A;  4LSX A;  1RJR A;  4MA5 A;  3Q8Q B;  1X6P A;  3V6J A;  5JUM A;  3MWM A;  5F9L A;  2JA6 A;  2WAQ E;  4EYI B;  2NUA B;  4TQS A;  1IOW A;  1JKJ B;  5CA1 F;  1X6Y A;  4U6P A;  1BGW A;  5KFU A;  2WB1 A;  1ULZ A;  4O4H F;  5KFY A;  4MTD A;  3TQT A;  4C5C A;  3MR2 A;  4QIW A;  4EYH B;  2I80 A;  2PN1 A;  2UVV A;  2C2D A;  4J9K A;  3WO1 A;  1UC8 A;  4A3G G;  4AQY H;  1FVI A;  1TWC A;  2VQD A;  2YYA A;  4MV9 A;  2UVR A;  2R87 A;  2VPQ A;  3PR5 B;  2V59 A;  2W71 A;  4ECS A;  2NVY A;  5LL6 b;  3UQ8 A;  2J9G A;  3BJY A;  5D1P A;  2B63 G;  4A3B G;  2PMZ E;  2YL2 A;  1UNN C;  4ZOL F;  3JAM W;  2R93 A;  5DQH A;  4BBS G;  4UCV A;  4ED2 A;  2BQU A;  4DL3 A;  2PY0 A;  1S68 A;  2PIL A;  5KG7 A;  4DV4 H;  1DV2 A;  1DZO A;  4TV8 F;  5DG8 A;  1BJT A;  1XMQ H;  2OH2 A;  3KHL A;  2VA2 A;  2UU9 H;  4Q0Y A;  1N48 A;  1RJQ A;  3K3P A;  5KFC A;  2YCH A;  5JVL A;  1ZQ7 A;  2ASD A;  4ZI7 F;  3VPB A;  4ECW A;  2XCP A;  2VUM A;  4LF6 H;  3Q8S B;  5LMU H;  3WO0 A;  4EG0 A;  1SCU B;  3PR4 A;  2FKL A;  4UCS A;  1KJ9 A;  3MJF A;  3RTX A;  4V1J A;  3M9M B;  2ZDQ A;  2XGQ A;  4DL7 A;  3HBL A;  4MA0 A;  3RGX A;  5DGB A;  3GV5 B;  1GGO A;  1CQJ B;  1RK5 A;  4ZHQ F;  4RNO A;  3GTG A;  5CAE B;  4G3I A;  2C00 A;  3RIZ A;  4MV1 A;  3WNZ A;  5LP6 F;  5IYC G;  2M3K A;  4A3L G;  4I7H A;  4TV9 F;  4X64 H;  3VPD A;  2XC9 A;  4JI6 H;  3MFI A;  2UXB H;  5C5J A;  5DLG A;  4YAJ B;  3NGD A;  2W9B B;  2P0A A;  4AYB E;  4DL4 A;  2IA6 A;  3Q1K A;  3U9S A;  4HQ6 A;  4YQW A;  4MV4 A;  2FPI B;  3SI8 A;  1N56 A;  1QVE A;  1X6X X;  4ED8 A;  3EYY A;  4MV6 A;  1XMO H;  3IN5 A;  1TWA A;  5H80 A;  2R7Z G;  3J7A K;  4FBT A;  2J6T A;  3PW7 A;  4EBD A;  4OX9 H;  4UCU A;  3GV7 B;  4A3D G;  2VPS A;  4YR0 A;  3KTM A;  4JI5 H;  2R7N A;  4J9L A;  1WSC A;  4GC6 A;  4XYL B;  3RB4 A;  1MZB A;  3H20 A;  5KFX A;  5LOV F;  4RNM A;  4RNN A;  2ATL A;  2SCU B;  5BPH A;  3RV3 A;  5A2Q W;  1I3Q A;  3GIM A;  5KG4 A;  4A3I G;  1PX2 A;  1C30 A;  3FKI G;  4PWQ A;  4ZQI A;  4EBE A;  3OHB A;  2RF4 A;  3N6X A;  4MV7 A;  1A0I A;  1T36 A;  1WH2 A;  2UUB H;  1RG0 A;  5L1J A;  2BR0 A;  2Q2T A;  5KFE A;  4B3T H;  3GII A;  2R8J A;  3RB0 A;  1SYX B;  4IRC A;  5GON F;  2FPP B;  2YZG A;  3OTO H;  1JXL A;  4AYB A;  3BQ0 A;  1HNX H;  1BNC A;  3SOK A;  4ED1 A;  1Y1W G;  1CE8 A;  1X6Q A;  4ED6 A;  3GTJ A;  2F4V H;  2ZDH A;  3RJ0 A;  4ED0 A;  4BY1 G;  1RYR A;  3M4I A;  3H4B A;  2VQF H;  1KBL A;  3DF7 A;  3V4Z A;  2R8I A;  2AU0 A;  3LP8 A;  5KG0 A;  2FLL A;  1JDE A;  2WTF A;  3KHG A;  2V58 A;  2JA7 G;  2I87 A;  4LF5 H;  5KFS A;  2UVW A;  4JI1 H;  1BXR A;  5KFF A;  1O75 A;  3L2P A;  4NLG A;  4IR1 A;  3E5N A;  1E4F T;  4DR7 H;  4YR2 A;  1ZHS A;  3R5F A;  4JI3 H;  4GKJ H;  3JSN A;  4TUY F;  5EDW A;  5DGA A;  5CB4 F;  4Y8V B;  2RDJ A;  5C3E G;  2OLS A;  2VUM G;  2JA5 A;  5KKN B;  5J2U F;  3KHR A;  5KFH A;  1IBM H;  1GO3 E;  5C1O A;  3OSN A;  2RGV A;  4MAM A;  3VMM A;  3GID A;  2PBZ A;  4UFZ A;  3G6V A;  4O3S A;  3H3V H;  1T3N A;  1B04 A;  1GSH A;  3ORR A;  3G6Y A;  2C35 B;  3Q8R B;  3HKZ A;  2FE3 A;  5KT6 A;  3RAX A;  4JUZ A;  4EFB A;  2C2R A;  4YY3 H;  4DLK A;  2JEG A; 
#chains in the Genus database with same CATH homology
 1ZQ7 A;  1WSC A;  1VAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...