1ZQ7A

X-ray crystal structure of protein q8pzk8 from methanosarcina mazei. northeast structural genomics consortium target mar9.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
204
structure length
201
Chain Sequence
MLTETEGRAAVKLARKTIEIFLSKGKSPRSGVELSPVFEEYRGVFVTLTEGGLLRGCIGHPYPDSTLKEAILDSAISAATRDPRFPTVEQDEMKNILVEVTILTQPEKINASPKELPDKVEIGKHGLIVKQGYCQGLLLPQVAPENDMDSIDFLSHTCMKAGLSPDAWVKGAEVYCFEGQIFKEKEPDGEVIEEKFLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the hypothetical protein Q8PZK8 from Methanosarcina mazei at the resolution 2.1A. Northeast Structural Genomics Consortium target MaR9.
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein MM0484
total genus 52
structure length 201
sequence length 204
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01871 AMMECR1 AMMECR1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.700.20 Alpha Beta 2-Layer Sandwich Glycoprotein, Type 4 Pilin Hypothetical protein ph0010; domain 1 1zq7A01
3.30.1490.150 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Hypothetical protein ph0010; domain 2 1zq7A02
1VAJA 1WSCA 1ZQ7A
chains in the Genus database with same CATH superfamily
4MTEA 5KFKA 1Y1VA 2ZDHA 3VMMA 4XX0B 5C4XG 2VUGA 4QWBA 4ECRA 1X6ZA 3PR4A 2UVRA 5KFZA 1JKJB 4ETSA 4YHHH 4DV5H 4ED8A 3LP8A 2R7LA 4UCSA 5A2QW 3N41B 2XGQA 5BPFA 1T3NA 5KFUA 3HKZE 3H4DA 1GSAA 4LF6H 3TQTA 1SCUB 1RJPA 4EBDA 4EGQA 5EDWA 3K3PA 4O3QA 1N48A 5L1LA 5KG0A 1ULZA 2NU7B 1KJIA 3MR3A 4JI1H 3L4JA 2VQFH 3H3VH 1RYRA 4A93G 4X62H 4BWSC 1E4GT 5LMUH 3RJ0A 3JYZA 3M9MB 4A3MG 5IWAH 1FVIA 4DL3A 4M7EA 1N32H 1A0IA 2ZM6H 2W7OA 1K83A 3PW2A 1XNQH 3J7AK 1KJQA 4MV6A 3RAQA 4A2AA 2YRXA 1I94H 4EFBA 1HNXH 2YZGA 4RB0A 5C44G 3JZZA 3BQ2A 2PN1A 5EWFA 5LL6b 4WBNF 2FB9A 2R8JA 2VA2A 2WB1E 4O3SA 1Y1WA 4PWQA 5C1OA 2JEFA 4Q8EA 3H0GA 4LMYA 1CQJB 4I4TF 1T94A 3HOWG 1AY2A 2DPIA 2CKZB 5KFYA 5JUMA 2JEGA 4RB1A 2R6FA 1TAEA 4C2MA 5KFCA 5KFFA 4Q43A 1S10A 2Q2UA 2UVUA 2AGQA 2UUAH 4ECXA 3T5LA 4RB3C 4JI3H 4U6PA 4I7HA 2R7ZA 4ED7A 5DG9A 3UFXB 4J9QA 4HYKA 4QIWE 1JXLA 5KFEA 3RFCA 4ECZA 1XNRH 1Z2PX 1RG0A 2YYAA 2VA3A 3ETHA 4IAJA 4YAKB 1E4EB 5EWEA 3T5JA 4HNTA 4YAJB 3G6VA 5K2MA 2F4VH 4DL5A 2BQUA 5DQGA 1BGWA 2HHHH 3JSLA 2JA7A 3GV5B 4EBEA 2W6MA 1S97A 4RNMA 5H80A 3G8CA 4I50F 5KT4A 3SI8A 3EYYA 4YJ3F 4F4ZA 3LWBA 1S0MA 3GLKA 3MJFA 3BA8A 5KG1A 3OTOH 5KFLA 5LP6F 3GTQA 4J9SA 2CQYA 2YRWA 2W71A 3V6HA 2IMWP 2IBKA 2W7PA 3GQCA 2VUMG 4XYLB 5KFQA 2FLNA 3GTLA 4MA5A 4QJFA 1EUDB 4O2BF 4JI6H 5L1IA 5FD6A 3JZIA 4R7RA 3JAMW 3G6YA 1TWHA 2JA5G 4FBTA 2DIKA 4LSAA 4J9KA 3RBDA 2C22A 3QZ7A 3OSNA 2FLLA 1SEIA 4UCTA 2C28A 5J2TF 5KKNB 1XMQH 4BY7G 3IN5A 2IP4A 2W9CB 3V4ZA 1HPWA 4TQRA 2C2RA 4RZQA 1K1SA 2XD4A 4UCOA 2W9AA 5FPOA 2W9CA 3U9TA 3JRWA 5KFGA 4TV8F 5JVDF 4UCRA 3WNZA 1Z2OX 1VKZA 2R82A 5LA6F 4YQWA 3KHGA 2J6UA 4B3TH 2UXBH 3V4SA 1KC7A 4A3DG 1XDNA 1I7NA 4APMA 1GLVA 2HI2A 3GIQA 5LXTF 2W9BA 2C00A 1BNCA 4LH6A 5CAEB 2XCLA 2V59A 3BAAA 5FLXW 3RV3A 5KFBA 3RIZA 4IHJF 2NVXA 3ORRA 5D1OA 3CVZA 4EEQA 4MTDA 2C35B 1EHIA 1CQIB 2ZDQA 3M9OB 4EYHB 1S0NA 2J6SA 4ED1A 2RGRA 4QIWA 3ORQA 2JA7G 2YW2A 3N6RA 4LSXA 3GIIA 5KFXA 2M7GA 5L1KA 4DL2A 2ZJTA 3OSPA 2Y0SE 4AYBA 5I47A 3RF2A 4ECSA 4ECTA 4ED0A 3SOKA 3GIMA 3RGXA 1KBLA 2FMAA 2R87A 3TINA 2NU6B 1I50A 2R85A 4IWXA 4O3PA 4YB8B 4RZRA 2IA6A 3V6JA 3Q8PB 4O4LF 2VR1A 4DL6A 5C8YF 4TV9F 5BR8H 5DQIA 3TQ1A 4TQSA 2GLTA 1DV2A 1A9XA 2OLSA 3GN9A 2HJWA 5IT9W 3PN1A 4C5CA 1K1QA 2M3KA 4MAMA 1UC9A 1DV1A 1X6QA 4LW9A 4BY1G 5HBRB 1X6PA 3N8DA 2AQ4A 3OUUA 3OUZA 2HGSA 4LF7H 4DR7H 4V1JA 3RAXA 2R92A 5DG7A 3GIDA 1B04A 3E5NA 4XYMB 5KG7A 4YP3A 2CW8A 2JEJA 4J9NA 4EEYA 3PO3G 1EUCB 4DLKA 2W6PA 1IBLH 5KT7A 2WYOA 4O4IF 2VOBA 1SYXB 4X66H 2XIGA 3Q2OA 2JA6A 1X6RA 2GPSA 4IZOA 2MCTA 3DF7A 1X6XX 4BXXG 2RDIA 4DL4A 3MWMA 2JA6G 2DLNA 4R8UB 4OX9H 5KFIA 4EBCA 5CA1F 4IRKA 1WR2A 4XZ3B 2UVVA 3Q8QB 3VPBA 3ETJA 3PW0A 1TWCA 4JI2H 4CC6A 5KG5A 2DWCA 1IBMH 5KFAA 1WCMA 4GC7A 4MA0A 2W8KA 1ZHSA 4FM9A 4FU0A 3MWEA 3R5FA 1I3QA 4MV4A 5FJ8G 4QWAA 2JEIA 3EPIA 2ASJA 1C30A 4ED2A 5KFOA 3HOYG 2M05A 4JV0A 2FK2A 4A3FG 2AGOA 2NU8B 5KG6A 4JI4H 5LYJF 4FBUA 3N43B 1AUVA 5KG4A 3Q8RB 5FPRA 3KTMA 4B3SH 2E5LH 2UXDH 3M4IA 3BG5A 3J81W 3RB4A 3KHHA 5JQWA 2C2EA 1P8LA 4E4TA 1DIKA 1EZ1A 2FKLA 2RF4A 4DV0H 5HV6A 3RB3A 5KFVA 1M0TA 2BR0A 1JX4A 4O3RA 2R92G 3MR6A 4MV1A 1ZETA 2AGPA 2FPPB 3C0FB 3AYHB 4GKJH 2NVYA 2HVQA 1BJTA 3GTGA 1QVEA 3HOXG 5EZYF 5KFJA 2HVRA 1VBGA 3G20A 3OHBA 1JLLB 3NGDA 3RB6A 4LF5H 4LFAH 1WCMG 1TA8A 5IP9G 4DR6H 2BQ3A 1B33N 4DUZH 4X64H 5KT6A 1S0OA 1I6UA 3L4KA 2PY0A 4J9RA 2XCPA 2YZMA 3HKZA 4DV1H 4Q0YA 2DPJA 1C3OA 3FDSA 3PW7A 4NXNH 1BXRA 1S68A 5F9LA 1OQWA 3H20A 2VQEH 1RJRA 3GTPA 4RU9A 4DR4H 2W6ZA 1OWTA 2YL2A 2R8HA 3U9SA 3GILA 3RBEA 4JYAH 2FP4B 2WAQA 1Y14B 4BBSG 3N40P 2FK3A 1RK6A 2V4QA 3N44B 4A3GG 1L2ZA 4O3NA 2P0AA 3SE7A 4DV6H 1N34H 3K5HA 1T92A 3M9NB 4B3RH 1GYFA 1W96A 1FKAH 3I4MG 5KFNA 3PW4A 3GTMA 4O4HF 2CW7A 2WB1A 4HR7A 3RB0A 2FE3A 2W57A 2W6NA 4UFZA 1IOWA 5KFHA 4RUAA 4QWEA 5DLFA 1N36H 5F9NA 5DG8A 5BMVF 4JV1A 3BQ1A 2XGPA 4ECWA 2J9GA 4FS1A 3TIGA 4UCVA 4RNOA 3GTKA 2R8KA 4C5BA 4F4YA 4ECUA 4F50A 2UVWA 2R8GA 2VPSA 5CA0F 1R9TA 5IYBG 4G3IA 4MV7A 3Q1KA 2VUMA 2W6OA 3CQZA 1FJGH 1O75A 5EWGA 4ZHQF 2RGVA 1ZQ7A 5KX5F 3J80W 4A3EG 2HVSA 1JIHA 4QWCA 3VPDA 4RAYA 3EPGA 5BPHA 3K3VA 4YBZB 4DR2H 3T1HH 2W9BB 3FKIG 1KJJA 2R7NA 4A3CG 4DV2H 2WAQE 4DL7A 4LFBH 5IP7G 2FJZA 3WO0A 1KJ9A 3RUPA 4ZOLF 2SCUB 1GSOA 3G6XA 4NLGA 2NUAB 4O2AF 3RGZA 3BABA 1UNNC 4NXMH 2PMZA 1M0WA 4J9MA 1Y1VG 3T5KA 4QW9A 2OH2A 4PDBA 5C5JA 3GTOA 4F4XA 1TWFA 2FLPA 2J6TA 2E2IA 1N33H 1PX2A 1DZOA 4QW8A 2V9WA 4RAZA 3R5XA 2E2HA 4ECVA 4RB2C 5GONF 4EYIB 3GV8B 5KFMA 4IR9A 1V9PA 3HXLA 5KG3A 4IRCA 1CE8A 3HB9A 1J5EH 5JW8A 4EGJA 2JA5A 5DGBA 4HNUA 1UC8A 3Q8SB 2YS7A 1RYSA 5EOYA 4J9LA 5KFDA 2X0SA 3H0GG 4A3IG 3L2PA 2WTFA 1GGOA 2YCHA 5IYZF 1B6RA 2B63G 3KHLA 3PO2G 5D1PA 2YS6A 3QZ8A 3KAJA 4ME6A 3SOJA 1JDBB 4YR2A 4IWYA 2B63A 2WDTA 4EG0A 1MZBA 2VPQA 4C5AA 2RDJA 2ALZA 3TIIA 5KFTA 1EYZA 4MV9A 4FS2A 4LF9H 2Y0SA 4AYBE 2CZGA 5C3EG 3FU1A 4DV4H 2JA8G 5J2UF 2R7MA 4IRDA 5KFPA 5LOVF 2BQRA 2UUCH 2UUBH 1HNWH 2ASDA 2VQDA 4LFCH 2KEPA 3FMAA 5C1PA 1E4EA 1AUXA 4U7CA 5KG2A 3R23A 4CC5A 4GC6A 4MV8A 1PK8A 5CB4F 3GIKA 1V4YA 1WH2A 3KHRA 1TWAA 2R7ZG 5JH7F 4ED3A 5L1JA 2PVPA 4J9OA 3PR5B 5D1OB 4QWDA 4ZI7F 4LF8H 2R93G 3PZPA 2W6QA 4A2BA 4B3MH 1ZHQA 5KT3A 3LMLA 4GLXA 2V58A 3F8NA 4BBRG 2UXCH 3GIPA 5KT2A 3PW5A 1JDEA 4KHPH 1N56A 5D8DA 1HR0H 3KAKA 4ZQIA 4JI8H 4L1KA 4F4WA 2FK1A 1Y1WG 2NU9B 3HOVG 3HOZG 1CS0A 2YZNA 3RTXA 2UU9H 1W93A 2R86A 2C2DA 4IR1A 1I7LA 4YR3A 3MWDA 4HQ6A 4LH7A 4O3OA 4JV2A 1T36A 3UQ8A 2AU0A 3MR5A 4TUYF 2XC9A 4A3JG 5IYDG 3GIJA 1S9FA 1Z2NX 3QFFA 4Q44A 3T1YH 4JI7H 1DGSA 3I4NG 1AN7A 1M6VA 1V51A 3BQ0A 4EFEA 2R84A 3KALA 1RJQA 1VBHA 1HNZH 3OHAA 4M9UA 4JI5H 2ATLA 2V5AA 3IG0A 3RV4A 2I8CA 4A3BG 1VAJA 4R8UA 1M7JA 3HOUG 3K5IA 4DR5H 3GTJA 2W8LA 4RUCA 4J9PA 5KFRA 1TWGA 2W70A 1IOVA 2OWOA 4JV5H 2R7KA 4J0MA 4DV7H 4A3KG 4UCUA 4YR0A 2PBZA 2I80A 3BA9A 4MV3A 4YJ2F 5JVLA 4LF4H 2Q2TA 4GKKH 5KFSA 3MFIA 1KEEA 4RNNA 3GV7B 2ZDGA 4WD3A 3H4BA 3R5HA 1RK5A 1E4FT 2O03A 5DQHA 4DUYH 3H40A 3WO1A 4YY3H 5FLMG 2PMZE 1IBKH 1GO3E 4ED6A 3JSNA 3BJYA 4K0KH 1SFOA 4ECYA 1S03G 1KJ8A 5FD5A 4JI0H 4DR3H 3JRXA 2YU9A 4Q8FA 4Q45A 2GPWA 2ASLA 1GSHA 5KT5A 1XMOH 1X9NA 4HNVA 5LMNH 1VS0A 5DGAA 4DV3H 4JUZA 1WSCA 2DZDA 5DLGA 3KXYT 2I87A 2KSWA 2QK4A 3VPCA 1X6YA 3I12A 3FKIA 4X65H 4AQYH 4ECQA 5IYCG 4DR1H 2R8IA 3V6KA 2R93A 2WE6A 1B6SA 5L9XA 3MR2A 3T5HA 5T14A 2QYZA 2FPGB 3MFHA 4Y8VB 3N42B 3HBLA 5KFWA 2XCAA 2V4RA 2FPIB 3PVXA 4A3LG 4I55F 2PILA 3N6XA
chains in the Genus database with same CATH topology
1VAJA 1WSCA 1ZQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAJ A;  1WSC A;  1ZQ7 A; 
#chains in the Genus database with same CATH topology
 4MTE A;  5KFK A;  1Y1V A;  2ZDH A;  3VMM A;  4XX0 B;  5C4X G;  2VUG A;  4QWB A;  4ECR A;  1X6Z A;  3PR4 A;  2UVR A;  5KFZ A;  1JKJ B;  4ETS A;  4YHH H;  4DV5 H;  4ED8 A;  3LP8 A;  2R7L A;  4UCS A;  5A2Q W;  3N41 B;  2XGQ A;  5BPF A;  1T3N A;  5KFU A;  3HKZ E;  3H4D A;  1GSA A;  4LF6 H;  3TQT A;  1SCU B;  1RJP A;  4EBD A;  4EGQ A;  5EDW A;  3K3P A;  4O3Q A;  1N48 A;  5L1L A;  5KG0 A;  1ULZ A;  2NU7 B;  1KJI A;  3MR3 A;  4JI1 H;  3L4J A;  2VQF H;  3H3V H;  1RYR A;  4A93 G;  4X62 H;  4BWS C;  1E4G T;  5LMU H;  3RJ0 A;  3JYZ A;  3M9M B;  4A3M G;  5IWA H;  1FVI A;  4DL3 A;  4M7E A;  1N32 H;  1A0I A;  2ZM6 H;  2W7O A;  1K83 A;  3PW2 A;  1XNQ H;  3J7A K;  1KJQ A;  4MV6 A;  3RAQ A;  4A2A A;  2YRX A;  1I94 H;  4EFB A;  1HNX H;  2YZG A;  4RB0 A;  5C44 G;  3JZZ A;  3BQ2 A;  2PN1 A;  5EWF A;  5LL6 b;  4WBN F;  2FB9 A;  2R8J A;  2VA2 A;  2WB1 E;  4O3S A;  1Y1W A;  4PWQ A;  5C1O A;  2JEF A;  4Q8E A;  3H0G A;  4LMY A;  1CQJ B;  4I4T F;  1T94 A;  3HOW G;  1AY2 A;  2DPI A;  2CKZ B;  5KFY A;  5JUM A;  2JEG A;  4RB1 A;  2R6F A;  1TAE A;  4C2M A;  5KFC A;  5KFF A;  4Q43 A;  1S10 A;  2Q2U A;  2UVU A;  2AGQ A;  2UUA H;  4ECX A;  3T5L A;  4RB3 C;  4JI3 H;  4U6P A;  4I7H A;  2R7Z A;  4ED7 A;  5DG9 A;  3UFX B;  4J9Q A;  4HYK A;  4QIW E;  1JXL A;  5KFE A;  3RFC A;  4ECZ A;  1XNR H;  1Z2P X;  1RG0 A;  2YYA A;  2VA3 A;  3ETH A;  4IAJ A;  4YAK B;  1E4E B;  5EWE A;  3T5J A;  4HNT A;  4YAJ B;  3G6V A;  5K2M A;  2F4V H;  4DL5 A;  2BQU A;  5DQG A;  1BGW A;  2HHH H;  3JSL A;  2JA7 A;  3GV5 B;  4EBE A;  2W6M A;  1S97 A;  4RNM A;  5H80 A;  3G8C A;  4I50 F;  5KT4 A;  3SI8 A;  3EYY A;  4YJ3 F;  4F4Z A;  3LWB A;  1S0M A;  3GLK A;  3MJF A;  3BA8 A;  5KG1 A;  3OTO H;  5KFL A;  5LP6 F;  3GTQ A;  4J9S A;  2CQY A;  2YRW A;  2W71 A;  3V6H A;  2IMW P;  2IBK A;  2W7P A;  3GQC A;  2VUM G;  4XYL B;  5KFQ A;  2FLN A;  3GTL A;  4MA5 A;  4QJF A;  1EUD B;  4O2B F;  4JI6 H;  5L1I A;  5FD6 A;  3JZI A;  4R7R A;  3JAM W;  3G6Y A;  1TWH A;  2JA5 G;  4FBT A;  2DIK A;  4LSA A;  4J9K A;  3RBD A;  2C22 A;  3QZ7 A;  3OSN A;  2FLL A;  1SEI A;  4UCT A;  2C28 A;  5J2T F;  5KKN B;  1XMQ H;  4BY7 G;  3IN5 A;  2IP4 A;  2W9C B;  3V4Z A;  1HPW A;  4TQR A;  2C2R A;  4RZQ A;  1K1S A;  2XD4 A;  4UCO A;  2W9A A;  5FPO A;  2W9C A;  3U9T A;  3JRW A;  5KFG A;  4TV8 F;  5JVD F;  4UCR A;  3WNZ A;  1Z2O X;  1VKZ A;  2R82 A;  5LA6 F;  4YQW A;  3KHG A;  2J6U A;  4B3T H;  2UXB H;  3V4S A;  1KC7 A;  4A3D G;  1XDN A;  1I7N A;  4APM A;  1GLV A;  2HI2 A;  3GIQ A;  5LXT F;  2W9B A;  2C00 A;  1BNC A;  4LH6 A;  5CAE B;  2XCL A;  2V59 A;  3BAA A;  5FLX W;  3RV3 A;  5KFB A;  3RIZ A;  4IHJ F;  2NVX A;  3ORR A;  5D1O A;  3CVZ A;  4EEQ A;  4MTD A;  2C35 B;  1EHI A;  1CQI B;  2ZDQ A;  3M9O B;  4EYH B;  1S0N A;  2J6S A;  4ED1 A;  2RGR A;  4QIW A;  3ORQ A;  2JA7 G;  2YW2 A;  3N6R A;  4LSX A;  3GII A;  5KFX A;  2M7G A;  5L1K A;  4DL2 A;  2ZJT A;  3OSP A;  2Y0S E;  4AYB A;  5I47 A;  3RF2 A;  4ECS A;  4ECT A;  4ED0 A;  3SOK A;  3GIM A;  3RGX A;  1KBL A;  2FMA A;  2R87 A;  3TIN A;  2NU6 B;  1I50 A;  2R85 A;  4IWX A;  4O3P A;  4YB8 B;  4RZR A;  2IA6 A;  3V6J A;  3Q8P B;  4O4L F;  2VR1 A;  4DL6 A;  5C8Y F;  4TV9 F;  5BR8 H;  5DQI A;  3TQ1 A;  4TQS A;  2GLT A;  1DV2 A;  1A9X A;  2OLS A;  3GN9 A;  2HJW A;  5IT9 W;  3PN1 A;  4C5C A;  1K1Q A;  2M3K A;  4MAM A;  1UC9 A;  1DV1 A;  1X6Q A;  4LW9 A;  4BY1 G;  5HBR B;  1X6P A;  3N8D A;  2AQ4 A;  3OUU A;  3OUZ A;  2HGS A;  4LF7 H;  4DR7 H;  4V1J A;  3RAX A;  2R92 A;  5DG7 A;  3GID A;  1B04 A;  3E5N A;  4XYM B;  5KG7 A;  4YP3 A;  2CW8 A;  2JEJ A;  4J9N A;  4EEY A;  3PO3 G;  1EUC B;  4DLK A;  2W6P A;  1IBL H;  5KT7 A;  2WYO A;  4O4I F;  2VOB A;  1SYX B;  4X66 H;  2XIG A;  3Q2O A;  2JA6 A;  1X6R A;  2GPS A;  4IZO A;  2MCT A;  3DF7 A;  1X6X X;  4BXX G;  2RDI A;  4DL4 A;  3MWM A;  2JA6 G;  2DLN A;  4R8U B;  4OX9 H;  5KFI A;  4EBC A;  5CA1 F;  4IRK A;  1WR2 A;  4XZ3 B;  2UVV A;  3Q8Q B;  3VPB A;  3ETJ A;  3PW0 A;  1TWC A;  4JI2 H;  4CC6 A;  5KG5 A;  2DWC A;  1IBM H;  5KFA A;  1WCM A;  4GC7 A;  4MA0 A;  2W8K A;  1ZHS A;  4FM9 A;  4FU0 A;  3MWE A;  3R5F A;  1I3Q A;  4MV4 A;  5FJ8 G;  4QWA A;  2JEI A;  3EPI A;  2ASJ A;  1C30 A;  4ED2 A;  5KFO A;  3HOY G;  2M05 A;  4JV0 A;  2FK2 A;  4A3F G;  2AGO A;  2NU8 B;  5KG6 A;  4JI4 H;  5LYJ F;  4FBU A;  3N43 B;  1AUV A;  5KG4 A;  3Q8R B;  5FPR A;  3KTM A;  4B3S H;  2E5L H;  2UXD H;  3M4I A;  3BG5 A;  3J81 W;  3RB4 A;  3KHH A;  5JQW A;  2C2E A;  1P8L A;  4E4T A;  1DIK A;  1EZ1 A;  2FKL A;  2RF4 A;  4DV0 H;  5HV6 A;  3RB3 A;  5KFV A;  1M0T A;  2BR0 A;  1JX4 A;  4O3R A;  2R92 G;  3MR6 A;  4MV1 A;  1ZET A;  2AGP A;  2FPP B;  3C0F B;  3AYH B;  4GKJ H;  2NVY A;  2HVQ A;  1BJT A;  3GTG A;  1QVE A;  3HOX G;  5EZY F;  5KFJ A;  2HVR A;  1VBG A;  3G20 A;  3OHB A;  1JLL B;  3NGD A;  3RB6 A;  4LF5 H;  4LFA H;  1WCM G;  1TA8 A;  5IP9 G;  4DR6 H;  2BQ3 A;  1B33 N;  4DUZ H;  4X64 H;  5KT6 A;  1S0O A;  1I6U A;  3L4K A;  2PY0 A;  4J9R A;  2XCP A;  2YZM A;  3HKZ A;  4DV1 H;  4Q0Y A;  2DPJ A;  1C3O A;  3FDS A;  3PW7 A;  4NXN H;  1BXR A;  1S68 A;  5F9L A;  1OQW A;  3H20 A;  2VQE H;  1RJR A;  3GTP A;  4RU9 A;  4DR4 H;  2W6Z A;  1OWT A;  2YL2 A;  2R8H A;  3U9S A;  3GIL A;  3RBE A;  4JYA H;  2FP4 B;  2WAQ A;  1Y14 B;  4BBS G;  3N40 P;  2FK3 A;  1RK6 A;  2V4Q A;  3N44 B;  4A3G G;  1L2Z A;  4O3N A;  2P0A A;  3SE7 A;  4DV6 H;  1N34 H;  3K5H A;  1T92 A;  3M9N B;  4B3R H;  1GYF A;  1W96 A;  1FKA H;  3I4M G;  5KFN A;  3PW4 A;  3GTM A;  4O4H F;  2CW7 A;  2WB1 A;  4HR7 A;  3RB0 A;  2FE3 A;  2W57 A;  2W6N A;  4UFZ A;  1IOW A;  5KFH A;  4RUA A;  4QWE A;  5DLF A;  1N36 H;  5F9N A;  5DG8 A;  5BMV F;  4JV1 A;  3BQ1 A;  2XGP A;  4ECW A;  2J9G A;  4FS1 A;  3TIG A;  4UCV A;  4RNO A;  3GTK A;  2R8K A;  4C5B A;  4F4Y A;  4ECU A;  4F50 A;  2UVW A;  2R8G A;  2VPS A;  5CA0 F;  1R9T A;  5IYB G;  4G3I A;  4MV7 A;  3Q1K A;  2VUM A;  2W6O A;  3CQZ A;  1FJG H;  1O75 A;  5EWG A;  4ZHQ F;  2RGV A;  1ZQ7 A;  5KX5 F;  3J80 W;  4A3E G;  2HVS A;  1JIH A;  4QWC A;  3VPD A;  4RAY A;  3EPG A;  5BPH A;  3K3V A;  4YBZ B;  4DR2 H;  3T1H H;  2W9B B;  3FKI G;  1KJJ A;  2R7N A;  4A3C G;  4DV2 H;  2WAQ E;  4DL7 A;  4LFB H;  5IP7 G;  2FJZ A;  3WO0 A;  1KJ9 A;  3RUP A;  4ZOL F;  2SCU B;  1GSO A;  3G6X A;  4NLG A;  2NUA B;  4O2A F;  3RGZ A;  3BAB A;  1UNN C;  4NXM H;  2PMZ A;  1M0W A;  4J9M A;  1Y1V G;  3T5K A;  4QW9 A;  2OH2 A;  4PDB A;  5C5J A;  3GTO A;  4F4X A;  1TWF A;  2FLP A;  2J6T A;  2E2I A;  1N33 H;  1PX2 A;  1DZO A;  4QW8 A;  2V9W A;  4RAZ A;  3R5X A;  2E2H A;  4ECV A;  4RB2 C;  5GON F;  4EYI B;  3GV8 B;  5KFM A;  4IR9 A;  1V9P A;  3HXL A;  5KG3 A;  4IRC A;  1CE8 A;  3HB9 A;  1J5E H;  5JW8 A;  4EGJ A;  2JA5 A;  5DGB A;  4HNU A;  1UC8 A;  3Q8S B;  2YS7 A;  1RYS A;  5EOY A;  4J9L A;  5KFD A;  2X0S A;  3H0G G;  4A3I G;  3L2P A;  2WTF A;  1GGO A;  2YCH A;  5IYZ F;  1B6R A;  2B63 G;  3KHL A;  3PO2 G;  5D1P A;  2YS6 A;  3QZ8 A;  3KAJ A;  4ME6 A;  3SOJ A;  1JDB B;  4YR2 A;  4IWY A;  2B63 A;  2WDT A;  4EG0 A;  1MZB A;  2VPQ A;  4C5A A;  2RDJ A;  2ALZ A;  3TII A;  5KFT A;  1EYZ A;  4MV9 A;  4FS2 A;  4LF9 H;  2Y0S A;  4AYB E;  2CZG A;  5C3E G;  3FU1 A;  4DV4 H;  2JA8 G;  5J2U F;  2R7M A;  4IRD A;  5KFP A;  5LOV F;  2BQR A;  2UUC H;  2UUB H;  1HNW H;  2ASD A;  2VQD A;  4LFC H;  2KEP A;  3FMA A;  5C1P A;  1E4E A;  1AUX A;  4U7C A;  5KG2 A;  3R23 A;  4CC5 A;  4GC6 A;  4MV8 A;  1PK8 A;  5CB4 F;  3GIK A;  1V4Y A;  1WH2 A;  3KHR A;  1TWA A;  2R7Z G;  5JH7 F;  4ED3 A;  5L1J A;  2PVP A;  4J9O A;  3PR5 B;  5D1O B;  4QWD A;  4ZI7 F;  4LF8 H;  2R93 G;  3PZP A;  2W6Q A;  4A2B A;  4B3M H;  1ZHQ A;  5KT3 A;  3LML A;  4GLX A;  2V58 A;  3F8N A;  4BBR G;  2UXC H;  3GIP A;  5KT2 A;  3PW5 A;  1JDE A;  4KHP H;  1N56 A;  5D8D A;  1HR0 H;  3KAK A;  4ZQI A;  4JI8 H;  4L1K A;  4F4W A;  2FK1 A;  1Y1W G;  2NU9 B;  3HOV G;  3HOZ G;  1CS0 A;  2YZN A;  3RTX A;  2UU9 H;  1W93 A;  2R86 A;  2C2D A;  4IR1 A;  1I7L A;  4YR3 A;  3MWD A;  4HQ6 A;  4LH7 A;  4O3O A;  4JV2 A;  1T36 A;  3UQ8 A;  2AU0 A;  3MR5 A;  4TUY F;  2XC9 A;  4A3J G;  5IYD G;  3GIJ A;  1S9F A;  1Z2N X;  3QFF A;  4Q44 A;  3T1Y H;  4JI7 H;  1DGS A;  3I4N G;  1AN7 A;  1M6V A;  1V51 A;  3BQ0 A;  4EFE A;  2R84 A;  3KAL A;  1RJQ A;  1VBH A;  1HNZ H;  3OHA A;  4M9U A;  4JI5 H;  2ATL A;  2V5A A;  3IG0 A;  3RV4 A;  2I8C A;  4A3B G;  1VAJ A;  4R8U A;  1M7J A;  3HOU G;  3K5I A;  4DR5 H;  3GTJ A;  2W8L A;  4RUC A;  4J9P A;  5KFR A;  1TWG A;  2W70 A;  1IOV A;  2OWO A;  4JV5 H;  2R7K A;  4J0M A;  4DV7 H;  4A3K G;  4UCU A;  4YR0 A;  2PBZ A;  2I80 A;  3BA9 A;  4MV3 A;  4YJ2 F;  5JVL A;  4LF4 H;  2Q2T A;  4GKK H;  5KFS A;  3MFI A;  1KEE A;  4RNN A;  3GV7 B;  2ZDG A;  4WD3 A;  3H4B A;  3R5H A;  1RK5 A;  1E4F T;  2O03 A;  5DQH A;  4DUY H;  3H40 A;  3WO1 A;  4YY3 H;  5FLM G;  2PMZ E;  1IBK H;  1GO3 E;  4ED6 A;  3JSN A;  3BJY A;  4K0K H;  1SFO A;  4ECY A;  1S03 G;  1KJ8 A;  5FD5 A;  4JI0 H;  4DR3 H;  3JRX A;  2YU9 A;  4Q8F A;  4Q45 A;  2GPW A;  2ASL A;  1GSH A;  5KT5 A;  1XMO H;  1X9N A;  4HNV A;  5LMN H;  1VS0 A;  5DGA A;  4DV3 H;  4JUZ A;  1WSC A;  2DZD A;  5DLG A;  3KXY T;  2I87 A;  2KSW A;  2QK4 A;  3VPC A;  1X6Y A;  3I12 A;  3FKI A;  4X65 H;  4AQY H;  4ECQ A;  5IYC G;  4DR1 H;  2R8I A;  3V6K A;  2R93 A;  2WE6 A;  1B6S A;  5L9X A;  3MR2 A;  3T5H A;  5T14 A;  2QYZ A;  2FPG B;  3MFH A;  4Y8V B;  3N42 B;  3HBL A;  5KFW A;  2XCA A;  2V4R A;  2FPI B;  3PVX A;  4A3L G;  4I55 F;  2PIL A;  3N6X A; 
#chains in the Genus database with same CATH homology
 1VAJ A;  1WSC A;  1ZQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...