1SYXB

The crystal structure of a binary u5 snrnp complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the bifunctionality of the U5 snRNP 52K protein (CD2BP2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/immune system
molecule keywords Spliceosomal U5 snRNP-specific 15 kDa protein
total genus 11
structure length 62
sequence length 62
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1syxB00
4BWSC 1GYFA 1WH2A 1L2ZA 1SYXB 3K3VA 3FMAA
chains in the Genus database with same CATH superfamily
3V4SA 4EYIB 2VPQA 3BG5A 3M4IA 3H40A 2FPPB 2CKZB 2W6OA 1JLLB 3PO2G 1OWTA 5KFLA 4LSXA 3GIIA 3KAKA 2R7NA 4Q8EA 1PK8A 1TA8A 4YR3A 2YYAA 2J6UA 3MWEA 3N40P 5FD6A 4BY7G 5A2QW 3RTXA 2NU9B 1GYFA 4GKKH 4IHJF 3MR5A 2HJWA 1X9NA 4UFZA 3RGXA 1E4EA 5LP6F 3FMAA 5DQHA 1S0MA 4JI3H 3U9TA 3RAQA 1EUDB 3HOWG 1CQIB 3H4BA 2WAQA 5KFXA 2ATLA 4ED6A 1TAEA 3VPCA 4RAZA 3M9OB 1JXLA 1VBGA 3IG0A 2WAQE 3PW2A 3OTOH 5GONF 1MZBA 2HVRA 2W8LA 2Q2TA 5IYBG 1W93A 5FPOA 4X66H 1KJIA 5L9XA 2V4QA 2ALZA 5EWEA 5LL6b 3HOVG 1UNNC 4FU0A 2JA8G 3G8CA 3G6VA 2R86A 1ZHQA 2IBKA 2UXBH 5IWAH 3PW5A 1TWCA 3GLKA 4MV7A 4MV6A 4DV7H 4ECZA 2WE6A 5DLGA 1JKJB 2R8JA 3K5HA 1KBLA 2YZGA 5KFTA 3OSPA 4YY3H 4ECWA 4G3IA 4NXNH 1SEIA 2NU8B 4J9OA 5KT6A 2HHHH 5IYCG 2ASLA 1C30A 2V4RA 3TIGA 5KFWA 3QZ8A 3TQ1A 2R6FA 2UUBH 1KJ9A 3CVZA 5KFMA 2GPWA 4A3BG 4QWDA 4QIWA 5DGAA 3GTPA 5C4XG 2R8IA 2JA6G 2VA2A 1BJTA 3R5HA 4DV4H 2W6PA 3L4KA 2UUAH 5EZYF 2XCAA 3G6YA 2NUAB 4JV1A 3SI8A 1M6VA 4DR7H 3HOYG 2W71A 2YW2A 3WO1A 3OHBA 1I7NA 1I6UA 1M0WA 4Q45A 2JA7A 4ZOLF 1V9PA 4ZI7F 5I47A 5KFEA 3ETHA 2YU9A 4A3DG 1FVIA 3RB4A 4JI5H 4J9KA 5BPHA 4ECUA 4O4IF 5KG7A 5CAEB 4BBRG 1I3QA 3H20A 1DV2A 2AGOA 3FKIA 4YAJB 4CC5A 4A3JG 1KJJA 5KFNA 1Y1WG 5KG1A 4DR4H 2VUGA 3M9MB 4JYAH 2X0SA 4F4YA 5KFUA 2RGRA 4YR0A 5FPRA 4YAKB 5IP9G 2W9CB 2VA3A 4Q8FA 4FS2A 2BR0A 5KFKA 2UU9H 1R9TA 3GTJA 2WB1E 4ECQA 1BNCA 5EWFA 2V59A 2FK2A 3RUPA 5DG7A 4DR5H 4EEYA 4JI4H 2R84A 4X62H 4TQRA 1RJPA 1TWFA 2W9BA 3PN1A 2PVPA 3GIMA 4O3RA 4A3CG 4RNMA 4ED1A 3MFIA 4DR3H 1S03G 2UVUA 3QFFA 4YB8B 4IAJA 3CQZA 2YCHA 1V51A 4AYBE 4DL3A 3RBDA 4YP3A 4EBDA 3JRWA 5JVDF 4X64H 4LF6H 3BJYA 4DL5A 5DLFA 4L1KA 2W70A 4A3IG 3RV3A 4ECYA 1N33H 4TV9F 3JSLA 5D8DA 4A2AA 5FLXW 4QWAA 4ECSA 5DGBA 4MV8A 2J6TA 3GIQA 4RNNA 1B6SA 5EDWA 4J9RA 3GTKA 2XGQA 4O2BF 1C3OA 1M0TA 1UC9A 5KFYA 2E5LH 1E4EB 5C5JA 3JAMW 2OLSA 4LF5H 2WTFA 3HKZA 4B3RH 5JUMA 2W6ZA 2R7ZG 2R7KA 4YBZB 3PZPA 3TINA 1A0IA 5KFVA 5KT2A 3N41B 1AUXA 1A9XA 3KHLA 3BQ1A 3RAXA 1DGSA 5KFQA 3RV4A 2NVYA 4I55F 3T1HH 4RU9A 3UQ8A 3RJ0A 3N6XA 4YHHH 4MA5A 3T5KA 5EOYA 3UFXB 1Z2OX 5KT3A 3M9NB 5KFGA 4FM9A 4R8UB 2M05A 1Y1VA 4ED7A 5C1OA 4NXMH 4MAMA 4ZHQF 5KFDA 4Q43A 4J9NA 3RB0A 1EZ1A 4KHPH 2VUMA 1RJQA 4WD3A 4AYBA 4GC7A 4DL4A 1I94H 2XIGA 2UXCH 4LFBH 2W7PA 4DLKA 4QWBA 2JA5A 1TWAA 1S97A 4FS1A 5KG5A 1WH2A 4UCRA 5FLMG 1P8LA 3TQTA 1N48A 3Q1KA 2JEGA 5D1OB 2AU0A 1B6RA 3LP8A 4EEQA 2DPJA 4JI0H 2PBZA 2AGQA 3EPIA 5KFFA 4R8UA 2RF4A 3MFHA 4F4XA 2SCUB 4HNVA 4CC6A 2CZGA 1T3NA 3K3PA 2I8CA 1B33N 1I7LA 4O3PA 3RIZA 2O03A 1BXRA 4ED3A 4FBTA 2C35B 1VAJA 3HXLA 4TQSA 5KFZA 4JI1H 3GTLA 2R7ZA 5C8YF 1L2ZA 5LMUH 1FJGH 4BWSC 2C28A 4LFCH 5KT5A 4F50A 4ECXA 4DL7A 2BQRA 1RYRA 2RGVA 2R7LA 4M7EA 3T5LA 1JDEA 4C5CA 4J9SA 4RB0A 4QWCA 1WSCA 3KHGA 4ED2A 5JVLA 3FDSA 4MTDA 2BQUA 4IWYA 5K2MA 3L4JA 2FB9A 2UVVA 4YJ2F 4ECTA 5F9NA 4EFEA 2FLNA 5KFSA 2WB1A 4MTEA 4C5AA 5L1JA 1XNQH 2YL2A 4E4TA 4EFBA 4TV8F 4YJ3F 4U6PA 3GIJA 4A3GG 5KX5F 4B3SH 3WO0A 4A2BA 2HGSA 3OHAA 4RUAA 3RBEA 1BGWA 3OSNA 2W8KA 2IP4A 4ECVA 3N42B 3N43B 3J81W 2F4VH 3GIKA 2XCLA 3RF2A 2J9GA 4YQWA 3MR2A 4EGQA 3EYYA 3RB6A 1K83A 2E2IA 3L2PA 1RYSA 3QZ7A 3I4MG 3GTMA 2W6MA 5KFIA 5IYZF 1Z2NX 3V6JA 4PDBA 3V4ZA 3I4NG 1K1QA 3C0FB 5HV6A 2NU7B 2PMZE 4B3TH 4RZRA 2CQYA 1S68A 4LF7H 2YRWA 1M7JA 4U7CA 4A3LG 3GTGA 3GTOA 4JUZA 3PO3G 3SE7A 2PMZA 2BQ3A 2PN1A 4XZ3B 4HYKA 4DV6H 2XD4A 2CW8A 1Y14B 5JH7F 4FBUA 2DZDA 2ASJA 2R87A 2WDTA 1TWGA 4IZOA 4RB1A 1S0NA 4A3MG 5KG6A 4F4WA 4JV2A 3R5FA 2R8HA 1IBLH 4MA0A 1HR0H 3GV7B 4EBEA 4DL6A 3PW7A 2QK4A 1WCMG 2FK3A 4Q0YA 1CS0A 3IN5A 1S9FA 2JEFA 4LFAH 3ORQA 2FE3A 1AN7A 2W57A 5DG9A 4QJFA 5LOVF 4XX0B 1KC7A 5BMVF 3MR3A 3R5XA 4BY1G 4HNTA 5H80A 2ZDHA 4RUCA 2FKLA 2UVWA 3HB9A 1WR2A 1DIKA 1I50A 1CE8A 4TUYF 4J9LA 2CW7A 5KG4A 3K5IA 3OUUA 1EUCB 4PWQA 4DL2A 2R85A 5DQGA 3KAJA 2R92A 5T14A 3LMLA 1GLVA 4JI7H 1KJ8A 5BPFA 2VQDA 5KFBA 2W9BB 4R7RA 2YS7A 4BXXG 4GLXA 3BAAA 4I7HA 4UCUA 4WBNF 2E2HA 4M9UA 3EPGA 5KFHA 4A3KG 1N34H 1XDNA 5LXTF 4I50F 2MCTA 3H4DA 5KT7A 3T5JA 4RZQA 2VPSA 4IRKA 4RNOA 2AGPA 4IRDA 5KFOA 2OWOA 2FP4B 1TWHA 4HNUA 4LF9H 4QW8A 1GSOA 4I4TF 2ASDA 1K1SA 1WCMA 5L1LA 2R82A 3E5NA 4XYMB 4DV1H 3OUZA 4APMA 2I87A 2Q2UA 4DR1H 3N8DA 5KFCA 2W9CA 4QW9A 1IBKH 2JA7G 2WYOA 4IWXA 4RAYA 2FLLA 5LYJF 3Q8PB 3H0GA 2NU6B 1ZQ7A 3BA8A 4B3MH 1RK6A 1GSAA 1B04A 1Y1VG 3KTMA 5KG2A 2R8GA 2HVQA 5JQWA 2AQ4A 1GO3E 1VKZA 2B63G 2FLPA 3RFCA 3KALA 1HNXH 3RB3A 5KKNB 2YRXA 4EGJA 1O75A 4HQ6A 4GC6A 3GIPA 2DWCA 1T94A 3J80W 4O4LF 1KJQA 2XGPA 2XCPA 3HOXG 4A3EG 1JIHA 3HOZG 1IOVA 3F8NA 2NVXA 1PX2A 5CB4F 2FPGB 3GTQA 1SYXB 2Y0SE 2C22A 1KEEA 3GIDA 3ETJA 4OX9H 4UCSA 4LH6A 4ME6A 2YS6A 5KG3A 2ZJTA 1EHIA 4O3NA 1ZETA 2C2EA 3MWMA 3JZIA 1RK5A 2V5AA 3V6HA 1VBHA 2YZNA 3R23A 4EBCA 4MV9A 3Q8SB 3T1YH 1S10A 1EYZA 4ED0A 4J9MA 3ORRA 3MJFA 4MV3A 2C2RA 3HKZE 2C00A 3LWBA 3BQ0A 2HVSA 3K3VA 2C2DA 5C3EG 3KXYT 2JA6A 4UCVA 5CA0F 4JV5H 1VS0A 2R7MA 4A3FG 4ED8A 4YR2A 4O2AF 2DIKA 1GGOA 2DLNA 4LMYA 4QIWE 5CA1F 5C44G 3Q8RB 5IP7G 3MR6A 2ZM6H 3TIIA 1N36H 2VQEH 4IRCA 3VPDA 4JI6H 4J0MA 1N32H 3T5HA 1T36A 4F4ZA 3GQCA 4A93G 5L1IA 5FJ8G 1Z2PX 5DG8A 1DV1A 5LA6F 3BABA 2UXDH 1ZHSA 5J2UF 4O3QA 3JRXA 3J7AK 4ZQIA 5IYDG 2RDIA 5L1KA 5D1OA 2R93A 4C2MA 2P0AA 2Y0SA 4DR6H 3HOUG 4J9PA 2VR1A 3Q2OA 3G6XA 4DV2H 2FK1A 4O3OA 4EYHB 2JA5G 1FKAH 2FPIB 2R8KA 5IT9W 4DR2H 1JDBB 5KFRA 1N56A 2R92G 4K0KH 5BR8H 2JEIA 2YZMA 3KHHA 4JV0A 1SFOA 4LH7A 2KSWA 3V6KA 3HBLA 1AUVA 1UC8A 3RGZA 1RJRA 4LF8H 2XC9A 2IMWP 3H3VH 1ULZA 2FJZA 1GSHA 5KFAA 2ZDQA 4LF4H 4MV4A 1HNWH 4EG0A 3PW4A 3PVXA 1JX4A 3DF7A 2W9AA 3JSNA 4BBSG 3GV8B 2W6NA 4JI8H 4UCTA 4DUZH 1IOWA 4UCOA 3VMMA 4ETSA 4X65H 5KFPA 5DQIA 2QYZA 4DUYH 3BQ2A 1IBMH 4RB3C 2JEJA 4ECRA 2ZDGA 2FMAA 3FKIG 4MV1A 4O4HF 4DV5H 4HR7A 3VPBA 3GILA 2GLTA 5F9LA 3KHRA 2W6QA 4IR9A 4J9QA 3PW0A 4QWEA 1Y1WA 1CQJB 2W7OA 5LMNH 3H0GG 5KG0A 4DV3H 3MWDA 4RB2C 3N44B 1SCUB 3WNZA 2R93G 4Q44A 5D1PA 2V9WA 4IR1A 1W96A 3I12A 1XMQH 5J2TF 3PR4A 4O3SA 4AQYH 2B63A 5C1PA 2OH2A 4GKJH 4Y8VB 2V58A 1V4YA 2RDJA 3NGDA 1XMOH 2DPIA 1S0OA 3U9SA 5KT4A 5HBRB 3Q8QB 2IA6A 2UUCH 3GV5B 4JI2H 2I80A 1E4GT 2J6SA 4LSAA 2UVRA 2VQFH 4NLGA 1J5EH 2VUMG 1HNZH 1XNRH 3PR5B 2VOBA 3BA9A 4XYLB 5EWGA 4DV0H 4C5BA 3AYHB 5FD5A 5KFJA 2GPSA 1E4FT
chains in the Genus database with same CATH topology
3MWMA 3JSLA 3M4IA 4A2AA 4MV9A 5FLXW 3T1YH 4DV6H 4LSXA 3KAKA 1TA8A 2CW8A 1M0TA 2E5LH 3N40P 2HVSA 5FD6A 3K3VA 2WDTA 4RB1A 3JAMW 3KXYT 5A2QW 3RTXA 4UCVA 4LF5H 4B3RH 1GYFA 1IBLH 4GKKH 4JV5H 1VS0A 1HR0H 1X9NA 4UFZA 3RGXA 4JI3H 3FMAA 1A0IA 4LMYA 4Q0YA 3N41B 2ZM6H 1N36H 4LFAH 2VQEH 1DGSA 1AN7A 1TAEA 2FE3A 2W57A 4RAZA 4J0MA 4JI6H 1N32H 3IG0A 3T1HH 3UQ8A 3RJ0A 3N6XA 4YHHH 1Z2PX 5EOYA 3OTOH 1MZBA 1Z2OX 3BABA 1ZHSA 2HVRA 2Q2TA 2UXDH 3J7AK 5FPOA 4FM9A 4X66H 4NXMH 2CW7A 5D1OA 5LL6b 4KHPH 4DR6H 4DV2H 1ZHQA 1I94H 2XIGA 3KAJA 2UXBH 5IWAH 3LMLA 1FKAH 4LFBH 2UXCH 5IT9W 4DR2H 4MV7A 4JI7H 4DV7H 4K0KH 2WE6A 5BR8H 1WH2A 4R7RA 4UCRA 1P8LA 4LH7A 4GLXA 2KSWA 3BAAA 4I7HA 4UCUA 4YY3H 5D1OB 3RGZA 4NXNH 1SEIA 2HHHH 4EEQA 4JI0H 4LF8H 1N34H 1XDNA 2UUBH 2MCTA 3CVZA 4CC6A 4RZQA 2VPSA 4LF4H 1HNWH 3RIZA 1BJTA 2O03A 4DV4H 3DF7A 3L4KA 3HXLA 3JSNA 2UUAH 2OWOA 4LF9H 4JI1H 4JI8H 4UCTA 1L2ZA 4DR7H 5LMUH 4DUZH 4UCOA 4ETSA 1FJGH 4X65H 4DV1H 1I6UA 4BWSC 1M0WA 4LF7H 4APMA 4LFCH 4DUYH 2Q2UA 4DR1H 1V9PA 1IBMH 4RB3C 1IBKH 1FVIA 4JI5H 2WYOA 2RGVA 4RAYA 4M7EA 4DV5H 3BA8A 3H20A 4RB0A 5LMNH 4B3MH 4CC5A 4MTDA 1B04A 3L4JA 4DV3H 4RB2C 4DR4H 3N44B 2VUGA 4JYAH 4EFEA 2HVQA 2RGRA 5FPRA 4MTEA 1XNQH 5D1PA 4EFBA 1XMQH 2UU9H 3KALA 1HNXH 4B3SH 4A2BA 4AQYH 2HGSA 1O75A 4GKJH 1BGWA 4DR5H 3N42B 3N43B 4X62H 3J81W 1XMOH 4JI4H 2F4VH 3PN1A 3RF2A 3J80W 3EYYA 2UUCH 4JI2H 3F8NA 4DR3H 1S03G 1E4GT 3L2PA 4IAJA 4LSAA 1SYXB 2YCHA 2VQFH 1J5EH 4PDBA 1Z2NX 1HNZH 4DV0H 2VOBA 3BA9A 1XNRH 4OX9H 4UCSA 4X64H 4LF6H 4LH6A 3C0FB 5FD5A 4B3TH 2ZJTA 1S68A 1E4FT 1N33H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWS C;  1GYF A;  1WH2 A;  1L2Z A;  1SYX B;  3K3V A;  3FMA A; 
#chains in the Genus database with same CATH topology
 3V4S A;  4EYI B;  2VPQ A;  3BG5 A;  3M4I A;  3H40 A;  2FPP B;  2CKZ B;  2W6O A;  1JLL B;  3PO2 G;  1OWT A;  5KFL A;  4LSX A;  3GII A;  3KAK A;  2R7N A;  4Q8E A;  1PK8 A;  1TA8 A;  4YR3 A;  2YYA A;  2J6U A;  3MWE A;  3N40 P;  5FD6 A;  4BY7 G;  5A2Q W;  3RTX A;  2NU9 B;  1GYF A;  4GKK H;  4IHJ F;  3MR5 A;  2HJW A;  1X9N A;  4UFZ A;  3RGX A;  1E4E A;  5LP6 F;  3FMA A;  5DQH A;  1S0M A;  4JI3 H;  3U9T A;  3RAQ A;  1EUD B;  3HOW G;  1CQI B;  3H4B A;  2WAQ A;  5KFX A;  2ATL A;  4ED6 A;  1TAE A;  3VPC A;  4RAZ A;  3M9O B;  1JXL A;  1VBG A;  3IG0 A;  2WAQ E;  3PW2 A;  3OTO H;  5GON F;  1MZB A;  2HVR A;  2W8L A;  2Q2T A;  5IYB G;  1W93 A;  5FPO A;  4X66 H;  1KJI A;  5L9X A;  2V4Q A;  2ALZ A;  5EWE A;  5LL6 b;  3HOV G;  1UNN C;  4FU0 A;  2JA8 G;  3G8C A;  3G6V A;  2R86 A;  1ZHQ A;  2IBK A;  2UXB H;  5IWA H;  3PW5 A;  1TWC A;  3GLK A;  4MV7 A;  4MV6 A;  4DV7 H;  4ECZ A;  2WE6 A;  5DLG A;  1JKJ B;  2R8J A;  3K5H A;  1KBL A;  2YZG A;  5KFT A;  3OSP A;  4YY3 H;  4ECW A;  4G3I A;  4NXN H;  1SEI A;  2NU8 B;  4J9O A;  5KT6 A;  2HHH H;  5IYC G;  2ASL A;  1C30 A;  2V4R A;  3TIG A;  5KFW A;  3QZ8 A;  3TQ1 A;  2R6F A;  2UUB H;  1KJ9 A;  3CVZ A;  5KFM A;  2GPW A;  4A3B G;  4QWD A;  4QIW A;  5DGA A;  3GTP A;  5C4X G;  2R8I A;  2JA6 G;  2VA2 A;  1BJT A;  3R5H A;  4DV4 H;  2W6P A;  3L4K A;  2UUA H;  5EZY F;  2XCA A;  3G6Y A;  2NUA B;  4JV1 A;  3SI8 A;  1M6V A;  4DR7 H;  3HOY G;  2W71 A;  2YW2 A;  3WO1 A;  3OHB A;  1I7N A;  1I6U A;  1M0W A;  4Q45 A;  2JA7 A;  4ZOL F;  1V9P A;  4ZI7 F;  5I47 A;  5KFE A;  3ETH A;  2YU9 A;  4A3D G;  1FVI A;  3RB4 A;  4JI5 H;  4J9K A;  5BPH A;  4ECU A;  4O4I F;  5KG7 A;  5CAE B;  4BBR G;  1I3Q A;  3H20 A;  1DV2 A;  2AGO A;  3FKI A;  4YAJ B;  4CC5 A;  4A3J G;  1KJJ A;  5KFN A;  1Y1W G;  5KG1 A;  4DR4 H;  2VUG A;  3M9M B;  4JYA H;  2X0S A;  4F4Y A;  5KFU A;  2RGR A;  4YR0 A;  5FPR A;  4YAK B;  5IP9 G;  2W9C B;  2VA3 A;  4Q8F A;  4FS2 A;  2BR0 A;  5KFK A;  2UU9 H;  1R9T A;  3GTJ A;  2WB1 E;  4ECQ A;  1BNC A;  5EWF A;  2V59 A;  2FK2 A;  3RUP A;  5DG7 A;  4DR5 H;  4EEY A;  4JI4 H;  2R84 A;  4X62 H;  4TQR A;  1RJP A;  1TWF A;  2W9B A;  3PN1 A;  2PVP A;  3GIM A;  4O3R A;  4A3C G;  4RNM A;  4ED1 A;  3MFI A;  4DR3 H;  1S03 G;  2UVU A;  3QFF A;  4YB8 B;  4IAJ A;  3CQZ A;  2YCH A;  1V51 A;  4AYB E;  4DL3 A;  3RBD A;  4YP3 A;  4EBD A;  3JRW A;  5JVD F;  4X64 H;  4LF6 H;  3BJY A;  4DL5 A;  5DLF A;  4L1K A;  2W70 A;  4A3I G;  3RV3 A;  4ECY A;  1N33 H;  4TV9 F;  3JSL A;  5D8D A;  4A2A A;  5FLX W;  4QWA A;  4ECS A;  5DGB A;  4MV8 A;  2J6T A;  3GIQ A;  4RNN A;  1B6S A;  5EDW A;  4J9R A;  3GTK A;  2XGQ A;  4O2B F;  1C3O A;  1M0T A;  1UC9 A;  5KFY A;  2E5L H;  1E4E B;  5C5J A;  3JAM W;  2OLS A;  4LF5 H;  2WTF A;  3HKZ A;  4B3R H;  5JUM A;  2W6Z A;  2R7Z G;  2R7K A;  4YBZ B;  3PZP A;  3TIN A;  1A0I A;  5KFV A;  5KT2 A;  3N41 B;  1AUX A;  1A9X A;  3KHL A;  3BQ1 A;  3RAX A;  1DGS A;  5KFQ A;  3RV4 A;  2NVY A;  4I55 F;  3T1H H;  4RU9 A;  3UQ8 A;  3RJ0 A;  3N6X A;  4YHH H;  4MA5 A;  3T5K A;  5EOY A;  3UFX B;  1Z2O X;  5KT3 A;  3M9N B;  5KFG A;  4FM9 A;  4R8U B;  2M05 A;  1Y1V A;  4ED7 A;  5C1O A;  4NXM H;  4MAM A;  4ZHQ F;  5KFD A;  4Q43 A;  4J9N A;  3RB0 A;  1EZ1 A;  4KHP H;  2VUM A;  1RJQ A;  4WD3 A;  4AYB A;  4GC7 A;  4DL4 A;  1I94 H;  2XIG A;  2UXC H;  4LFB H;  2W7P A;  4DLK A;  4QWB A;  2JA5 A;  1TWA A;  1S97 A;  4FS1 A;  5KG5 A;  1WH2 A;  4UCR A;  5FLM G;  1P8L A;  3TQT A;  1N48 A;  3Q1K A;  2JEG A;  5D1O B;  2AU0 A;  1B6R A;  3LP8 A;  4EEQ A;  2DPJ A;  4JI0 H;  2PBZ A;  2AGQ A;  3EPI A;  5KFF A;  4R8U A;  2RF4 A;  3MFH A;  4F4X A;  2SCU B;  4HNV A;  4CC6 A;  2CZG A;  1T3N A;  3K3P A;  2I8C A;  1B33 N;  1I7L A;  4O3P A;  3RIZ A;  2O03 A;  1BXR A;  4ED3 A;  4FBT A;  2C35 B;  1VAJ A;  3HXL A;  4TQS A;  5KFZ A;  4JI1 H;  3GTL A;  2R7Z A;  5C8Y F;  1L2Z A;  5LMU H;  1FJG H;  4BWS C;  2C28 A;  4LFC H;  5KT5 A;  4F50 A;  4ECX A;  4DL7 A;  2BQR A;  1RYR A;  2RGV A;  2R7L A;  4M7E A;  3T5L A;  1JDE A;  4C5C A;  4J9S A;  4RB0 A;  4QWC A;  1WSC A;  3KHG A;  4ED2 A;  5JVL A;  3FDS A;  4MTD A;  2BQU A;  4IWY A;  5K2M A;  3L4J A;  2FB9 A;  2UVV A;  4YJ2 F;  4ECT A;  5F9N A;  4EFE A;  2FLN A;  5KFS A;  2WB1 A;  4MTE A;  4C5A A;  5L1J A;  1XNQ H;  2YL2 A;  4E4T A;  4EFB A;  4TV8 F;  4YJ3 F;  4U6P A;  3GIJ A;  4A3G G;  5KX5 F;  4B3S H;  3WO0 A;  4A2B A;  2HGS A;  3OHA A;  4RUA A;  3RBE A;  1BGW A;  3OSN A;  2W8K A;  2IP4 A;  4ECV A;  3N42 B;  3N43 B;  3J81 W;  2F4V H;  3GIK A;  2XCL A;  3RF2 A;  2J9G A;  4YQW A;  3MR2 A;  4EGQ A;  3EYY A;  3RB6 A;  1K83 A;  2E2I A;  3L2P A;  1RYS A;  3QZ7 A;  3I4M G;  3GTM A;  2W6M A;  5KFI A;  5IYZ F;  1Z2N X;  3V6J A;  4PDB A;  3V4Z A;  3I4N G;  1K1Q A;  3C0F B;  5HV6 A;  2NU7 B;  2PMZ E;  4B3T H;  4RZR A;  2CQY A;  1S68 A;  4LF7 H;  2YRW A;  1M7J A;  4U7C A;  4A3L G;  3GTG A;  3GTO A;  4JUZ A;  3PO3 G;  3SE7 A;  2PMZ A;  2BQ3 A;  2PN1 A;  4XZ3 B;  4HYK A;  4DV6 H;  2XD4 A;  2CW8 A;  1Y14 B;  5JH7 F;  4FBU A;  2DZD A;  2ASJ A;  2R87 A;  2WDT A;  1TWG A;  4IZO A;  4RB1 A;  1S0N A;  4A3M G;  5KG6 A;  4F4W A;  4JV2 A;  3R5F A;  2R8H A;  1IBL H;  4MA0 A;  1HR0 H;  3GV7 B;  4EBE A;  4DL6 A;  3PW7 A;  2QK4 A;  1WCM G;  2FK3 A;  4Q0Y A;  1CS0 A;  3IN5 A;  1S9F A;  2JEF A;  4LFA H;  3ORQ A;  2FE3 A;  1AN7 A;  2W57 A;  5DG9 A;  4QJF A;  5LOV F;  4XX0 B;  1KC7 A;  5BMV F;  3MR3 A;  3R5X A;  4BY1 G;  4HNT A;  5H80 A;  2ZDH A;  4RUC A;  2FKL A;  2UVW A;  3HB9 A;  1WR2 A;  1DIK A;  1I50 A;  1CE8 A;  4TUY F;  4J9L A;  2CW7 A;  5KG4 A;  3K5I A;  3OUU A;  1EUC B;  4PWQ A;  4DL2 A;  2R85 A;  5DQG A;  3KAJ A;  2R92 A;  5T14 A;  3LML A;  1GLV A;  4JI7 H;  1KJ8 A;  5BPF A;  2VQD A;  5KFB A;  2W9B B;  4R7R A;  2YS7 A;  4BXX G;  4GLX A;  3BAA A;  4I7H A;  4UCU A;  4WBN F;  2E2H A;  4M9U A;  3EPG A;  5KFH A;  4A3K G;  1N34 H;  1XDN A;  5LXT F;  4I50 F;  2MCT A;  3H4D A;  5KT7 A;  3T5J A;  4RZQ A;  2VPS A;  4IRK A;  4RNO A;  2AGP A;  4IRD A;  5KFO A;  2OWO A;  2FP4 B;  1TWH A;  4HNU A;  4LF9 H;  4QW8 A;  1GSO A;  4I4T F;  2ASD A;  1K1S A;  1WCM A;  5L1L A;  2R82 A;  3E5N A;  4XYM B;  4DV1 H;  3OUZ A;  4APM A;  2I87 A;  2Q2U A;  4DR1 H;  3N8D A;  5KFC A;  2W9C A;  4QW9 A;  1IBK H;  2JA7 G;  2WYO A;  4IWX A;  4RAY A;  2FLL A;  5LYJ F;  3Q8P B;  3H0G A;  2NU6 B;  1ZQ7 A;  3BA8 A;  4B3M H;  1RK6 A;  1GSA A;  1B04 A;  1Y1V G;  3KTM A;  5KG2 A;  2R8G A;  2HVQ A;  5JQW A;  2AQ4 A;  1GO3 E;  1VKZ A;  2B63 G;  2FLP A;  3RFC A;  3KAL A;  1HNX H;  3RB3 A;  5KKN B;  2YRX A;  4EGJ A;  1O75 A;  4HQ6 A;  4GC6 A;  3GIP A;  2DWC A;  1T94 A;  3J80 W;  4O4L F;  1KJQ A;  2XGP A;  2XCP A;  3HOX G;  4A3E G;  1JIH A;  3HOZ G;  1IOV A;  3F8N A;  2NVX A;  1PX2 A;  5CB4 F;  2FPG B;  3GTQ A;  1SYX B;  2Y0S E;  2C22 A;  1KEE A;  3GID A;  3ETJ A;  4OX9 H;  4UCS A;  4LH6 A;  4ME6 A;  2YS6 A;  5KG3 A;  2ZJT A;  1EHI A;  4O3N A;  1ZET A;  2C2E A;  3MWM A;  3JZI A;  1RK5 A;  2V5A A;  3V6H A;  1VBH A;  2YZN A;  3R23 A;  4EBC A;  4MV9 A;  3Q8S B;  3T1Y H;  1S10 A;  1EYZ A;  4ED0 A;  4J9M A;  3ORR A;  3MJF A;  4MV3 A;  2C2R A;  3HKZ E;  2C00 A;  3LWB A;  3BQ0 A;  2HVS A;  3K3V A;  2C2D A;  5C3E G;  3KXY T;  2JA6 A;  4UCV A;  5CA0 F;  4JV5 H;  1VS0 A;  2R7M A;  4A3F G;  4ED8 A;  4YR2 A;  4O2A F;  2DIK A;  1GGO A;  2DLN A;  4LMY A;  4QIW E;  5CA1 F;  5C44 G;  3Q8R B;  5IP7 G;  3MR6 A;  2ZM6 H;  3TII A;  1N36 H;  2VQE H;  4IRC A;  3VPD A;  4JI6 H;  4J0M A;  1N32 H;  3T5H A;  1T36 A;  4F4Z A;  3GQC A;  4A93 G;  5L1I A;  5FJ8 G;  1Z2P X;  5DG8 A;  1DV1 A;  5LA6 F;  3BAB A;  2UXD H;  1ZHS A;  5J2U F;  4O3Q A;  3JRX A;  3J7A K;  4ZQI A;  5IYD G;  2RDI A;  5L1K A;  5D1O A;  2R93 A;  4C2M A;  2P0A A;  2Y0S A;  4DR6 H;  3HOU G;  4J9P A;  2VR1 A;  3Q2O A;  3G6X A;  4DV2 H;  2FK1 A;  4O3O A;  4EYH B;  2JA5 G;  1FKA H;  2FPI B;  2R8K A;  5IT9 W;  4DR2 H;  1JDB B;  5KFR A;  1N56 A;  2R92 G;  4K0K H;  5BR8 H;  2JEI A;  2YZM A;  3KHH A;  4JV0 A;  1SFO A;  4LH7 A;  2KSW A;  3V6K A;  3HBL A;  1AUV A;  1UC8 A;  3RGZ A;  1RJR A;  4LF8 H;  2XC9 A;  2IMW P;  3H3V H;  1ULZ A;  2FJZ A;  1GSH A;  5KFA A;  2ZDQ A;  4LF4 H;  4MV4 A;  1HNW H;  4EG0 A;  3PW4 A;  3PVX A;  1JX4 A;  3DF7 A;  2W9A A;  3JSN A;  4BBS G;  3GV8 B;  2W6N A;  4JI8 H;  4UCT A;  4DUZ H;  1IOW A;  4UCO A;  3VMM A;  4ETS A;  4X65 H;  5KFP A;  5DQI A;  2QYZ A;  4DUY H;  3BQ2 A;  1IBM H;  4RB3 C;  2JEJ A;  4ECR A;  2ZDG A;  2FMA A;  3FKI G;  4MV1 A;  4O4H F;  4DV5 H;  4HR7 A;  3VPB A;  3GIL A;  2GLT A;  5F9L A;  3KHR A;  2W6Q A;  4IR9 A;  4J9Q A;  3PW0 A;  4QWE A;  1Y1W A;  1CQJ B;  2W7O A;  5LMN H;  3H0G G;  5KG0 A;  4DV3 H;  3MWD A;  4RB2 C;  3N44 B;  1SCU B;  3WNZ A;  2R93 G;  4Q44 A;  5D1P A;  2V9W A;  4IR1 A;  1W96 A;  3I12 A;  1XMQ H;  5J2T F;  3PR4 A;  4O3S A;  4AQY H;  2B63 A;  5C1P A;  2OH2 A;  4GKJ H;  4Y8V B;  2V58 A;  1V4Y A;  2RDJ A;  3NGD A;  1XMO H;  2DPI A;  1S0O A;  3U9S A;  5KT4 A;  5HBR B;  3Q8Q B;  2IA6 A;  2UUC H;  3GV5 B;  4JI2 H;  2I80 A;  1E4G T;  2J6S A;  4LSA A;  2UVR A;  2VQF H;  4NLG A;  1J5E H;  2VUM G;  1HNZ H;  1XNR H;  3PR5 B;  2VOB A;  3BA9 A;  4XYL B;  5EWG A;  4DV0 H;  4C5B A;  3AYH B;  5FD5 A;  5KFJ A;  2GPS A;  1E4F T; 
#chains in the Genus database with same CATH homology
 3MWM A;  3JSL A;  3M4I A;  4A2A A;  4MV9 A;  5FLX W;  3T1Y H;  4DV6 H;  4LSX A;  3KAK A;  1TA8 A;  2CW8 A;  1M0T A;  2E5L H;  3N40 P;  2HVS A;  5FD6 A;  3K3V A;  2WDT A;  4RB1 A;  3JAM W;  3KXY T;  5A2Q W;  3RTX A;  4UCV A;  4LF5 H;  4B3R H;  1GYF A;  1IBL H;  4GKK H;  4JV5 H;  1VS0 A;  1HR0 H;  1X9N A;  4UFZ A;  3RGX A;  4JI3 H;  3FMA A;  1A0I A;  4LMY A;  4Q0Y A;  3N41 B;  2ZM6 H;  1N36 H;  4LFA H;  2VQE H;  1DGS A;  1AN7 A;  1TAE A;  2FE3 A;  2W57 A;  4RAZ A;  4J0M A;  4JI6 H;  1N32 H;  3IG0 A;  3T1H H;  3UQ8 A;  3RJ0 A;  3N6X A;  4YHH H;  1Z2P X;  5EOY A;  3OTO H;  1MZB A;  1Z2O X;  3BAB A;  1ZHS A;  2HVR A;  2Q2T A;  2UXD H;  3J7A K;  5FPO A;  4FM9 A;  4X66 H;  4NXM H;  2CW7 A;  5D1O A;  5LL6 b;  4KHP H;  4DR6 H;  4DV2 H;  1ZHQ A;  1I94 H;  2XIG A;  3KAJ A;  2UXB H;  5IWA H;  3LML A;  1FKA H;  4LFB H;  2UXC H;  5IT9 W;  4DR2 H;  4MV7 A;  4JI7 H;  4DV7 H;  4K0K H;  2WE6 A;  5BR8 H;  1WH2 A;  4R7R A;  4UCR A;  1P8L A;  4LH7 A;  4GLX A;  2KSW A;  3BAA A;  4I7H A;  4UCU A;  4YY3 H;  5D1O B;  3RGZ A;  4NXN H;  1SEI A;  2HHH H;  4EEQ A;  4JI0 H;  4LF8 H;  1N34 H;  1XDN A;  2UUB H;  2MCT A;  3CVZ A;  4CC6 A;  4RZQ A;  2VPS A;  4LF4 H;  1HNW H;  3RIZ A;  1BJT A;  2O03 A;  4DV4 H;  3DF7 A;  3L4K A;  3HXL A;  3JSN A;  2UUA H;  2OWO A;  4LF9 H;  4JI1 H;  4JI8 H;  4UCT A;  1L2Z A;  4DR7 H;  5LMU H;  4DUZ H;  4UCO A;  4ETS A;  1FJG H;  4X65 H;  4DV1 H;  1I6U A;  4BWS C;  1M0W A;  4LF7 H;  4APM A;  4LFC H;  4DUY H;  2Q2U A;  4DR1 H;  1V9P A;  1IBM H;  4RB3 C;  1IBK H;  1FVI A;  4JI5 H;  2WYO A;  2RGV A;  4RAY A;  4M7E A;  4DV5 H;  3BA8 A;  3H20 A;  4RB0 A;  5LMN H;  4B3M H;  4CC5 A;  4MTD A;  1B04 A;  3L4J A;  4DV3 H;  4RB2 C;  4DR4 H;  3N44 B;  2VUG A;  4JYA H;  4EFE A;  2HVQ A;  2RGR A;  5FPR A;  4MTE A;  1XNQ H;  5D1P A;  4EFB A;  1XMQ H;  2UU9 H;  3KAL A;  1HNX H;  4B3S H;  4A2B A;  4AQY H;  2HGS A;  1O75 A;  4GKJ H;  1BGW A;  4DR5 H;  3N42 B;  3N43 B;  4X62 H;  3J81 W;  1XMO H;  4JI4 H;  2F4V H;  3PN1 A;  3RF2 A;  3J80 W;  3EYY A;  2UUC H;  4JI2 H;  3F8N A;  4DR3 H;  1S03 G;  1E4G T;  3L2P A;  4IAJ A;  4LSA A;  1SYX B;  2YCH A;  2VQF H;  1J5E H;  4PDB A;  1Z2N X;  1HNZ H;  4DV0 H;  2VOB A;  3BA9 A;  1XNR H;  4OX9 H;  4UCS A;  4X64 H;  4LF6 H;  4LH6 A;  3C0F B;  5FD5 A;  4B3T H;  2ZJT A;  1S68 A;  1E4F T;  1N33 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...