1SYXB

The crystal structure of a binary u5 snrnp complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the bifunctionality of the U5 snRNP 52K protein (CD2BP2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/immune system
molecule keywords Spliceosomal U5 snRNP-specific 15 kDa protein
total genus 11
structure length 62
sequence length 62
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1syxB00
1L2ZA 1SYXB 3K3VA 1GYFA 1WH2A 3FMAA 4BWSC
chains in the Genus database with same CATH superfamily
2X0SA 2XD4A 5KFJA 1MZBA 5KFZA 3KHRA 2GPWA 2R6FA 3ETJA 3AYHB 4IRKA 4Q43A 4GKKH 1KJQA 4DV3H 3M4IA 5KG4A 1HR0H 2V5AA 5KT3A 4FBUA 5KX5F 2W6OA 1TWCA 5EOYA 5GONF 4X64H 3H0GA 4QWDA 4ECZA 4M7EA 3MFIA 3M9NB 3RB3A 5KFAA 3EYYA 2W8LA 2IP4A 3MFHA 5KFWA 1GSOA 4A3KG 1CS0A 1TAEA 5DG9A 4YR0A 3RB4A 2DIKA 2R85A 3HB9A 3R5HA 2PBZA 3GV5B 4JV2A 2FMAA 2YCHA 5JQWA 4AYBA 3L2PA 2R93G 4B3RH 3WNZA 3T5HA 2W6ZA 1B04A 1M6VA 3H3VH 4ZOLF 1HNWH 4HR7A 4DLKA 5BMVF 4J9MA 5DGAA 2UVRA 4BXXG 5IP9G 1BNCA 5KFSA 5KFVA 1EZ1A 2DWCA 2M05A 4YP3A 1X9NA 1V4YA 1XNQH 1Z2OX 2JEIA 2BQUA 5F9LA 3EPIA 4O2AF 1WH2A 4DV1H 2YRWA 2CQYA 2YYAA 3L4JA 4O3NA 1JXLA 4GKJH 3RBDA 4ECTA 4DL7A 3RBEA 1SFOA 3GTGA 2CKZB 3MR3A 3GILA 5KG0A 1FJGH 4DR1H 3GTPA 2W6MA 2CZGA 4MAMA 5KFKA 1Z2NX 4DR5H 4A3IG 1I6UA 4GLXA 3QZ7A 1K1QA 1TA8A 5J2TF 3K5IA 5C1PA 1VBGA 2R86A 5KG7A 2XCPA 4A3DG 4PDBA 3Q8RB 1C30A 2R8JA 1UC9A 3JZIA 4L1KA 5FD6A 2GPSA 4EBCA 4ECVA 2VPQA 1P8LA 2PMZA 3PW4A 3BQ1A 2V59A 2W9CB 4YR3A 4YJ2F 4FS1A 2JA7A 2UUBH 3GLKA 4A2BA 4YY3H 4I7HA 4J9NA 5HBRB 2PMZE 4DUYH 1IBMH 4ED8A 5EZYF 4ECQA 3TIGA 2I8CA 4F4YA 2I80A 3FKIA 1W96A 3BQ2A 1K83A 1PX2A 3N6XA 4M9UA 4JI0H 2ASJA 5LMNH 3JSNA 3PN1A 2RGRA 1RJPA 4CC6A 2FP4B 4RAYA 4LFBH 4YHHH 1A0IA 1EUDB 2Q2TA 1S68A 5IYDG 1RK6A 1CE8A 5KFTA 4DV6H 5D1PA 3JSLA 2HVRA 4LFCH 2Q2UA 4RU9A 2XGQA 4ED6A 1RYRA 2OWOA 1WCMA 4NXMH 3RGZA 2UUAH 1SEIA 2ASDA 2VA3A 2O03A 3U9SA 1IBLH 2C2DA 2W57A 5KFUA 3V6KA 1JDBB 3RF2A 3HOUG 1BJTA 5KKNB 4QWAA 3BQ0A 4ED1A 1Z2PX 2NUAB 1N32H 2R84A 4A3LG 4R8UA 4ECYA 5LYJF 4DL2A 3FKIG 1N36H 3HOYG 2ZJTA 4LH7A 4QJFA 4X66H 5L1JA 3G6VA 1EHIA 2XC9A 2WB1E 4YJ3F 2W70A 2CW8A 1J5EH 3KHLA 4JV5H 3Q8SB 2E5LH 2J9GA 4IRCA 3JRXA 4C2MA 4HQ6A 4BWSC 4LF4H 3HOWG 1VS0A 4ETSA 1JX4A 2J6TA 2R7ZA 3GV8B 4JYAH 2NU9B 3T1HH 4B3SH 4TV8F 3U9TA 5LL6b 1XNRH 4DL3A 4J9RA 3KXYT 4O3PA 4K0KH 4DV4H 4YR2A 4O3SA 1TWHA 4A3CG 3HBLA 3PO3G 2NU8B 5KG6A 1AUVA 4ECWA 5KFDA 2E2IA 4UCRA 3OHAA 2MCTA 5L1LA 4LFAH 3GIKA 4IRDA 1WSCA 2DPJA 2YS6A 5FD5A 1TWGA 4EEQA 1I7NA 2W9CA 2VQFH 1KBLA 4YAJB 3K5HA 3RV4A 1AUXA 4I4TF 3RB6A 2AGOA 4O3QA 1IOVA 5KFYA 3CQZA 5KT4A 1N33H 4A3GG 1JIHA 4IZOA 1VKZA 4ECXA 5KFIA 4U6PA 3L4KA 2RDJA 3BG5A 4LF6H 2W6NA 4A3EG 5C44G 3MR5A 1I7LA 4FU0A 5IYCG 3VPDA 4APMA 1N34H 2DZDA 4F4WA 5KFRA 4EGQA 2V9WA 1SCUB 4BY1G 5CA0F 5D1OB 3OSPA 2WAQA 3R23A 4BBSG 4DV7H 4J9SA 1VAJA 4IWXA 2W9BA 2HHHH 4IR1A 5J2UF 4Q8EA 2UVVA 4UCOA 3QFFA 1I94H 4DR7H 1SYXB 3N40P 1AN7A 5FJ8G 2V4RA 2FKLA 4RUCA 3HXLA 3HOVG 5L9XA 3MJFA 2C22A 3TINA 2VOBA 2GLTA 2UUCH 4XYLB 2B63G 2JEGA 1Y1VG 4NXNH 2NVXA 2NU7B 4ED2A 4JI1H 3BA9A 3H4DA 5KFBA 5KFCA 2HJWA 1RJRA 3RFCA 2DLNA 4UFZA 4GC6A 4DL6A 2W7PA 2FB9A 2XGPA 1IBKH 2W6QA 3G8CA 3OSNA 2I87A 3J80W 4BY7G 1Y14B 3VMMA 2R7MA 5KFXA 4NLGA 2WAQE 1V51A 4O3OA 1GO3E 4A3JG 5DQGA 5KT5A 1T3NA 4DR2H 1B6SA 1EYZA 3E5NA 4YB8B 2BR0A 4XZ3B 3PW5A 4ED7A 1WR2A 2UXCH 1GYFA 2QYZA 3TQTA 4O2BF 2XIGA 2YRXA 3LP8A 3N42B 5LA6F 2XCLA 4YAKB 2ZDGA 3OTOH 4MA0A 2R8HA 1XMOH 4RNOA 4FS2A 5EWEA 2JA6A 2KSWA 1PK8A 2BQ3A 1M0TA 2W7OA 4FM9A 5F9NA 4AYBE 4O4HF 3T5JA 1T36A 2R93A 3BAAA 2RGVA 2HVSA 4QIWA 1S0NA 3I4NG 5KFOA 3KAJA 2WDTA 2WYOA 1N48A 3H0GG 4IHJF 3T1YH 3UQ8A 5IYZF 5CB4F 3HOZG 1JKJB 2BQRA 1KJ9A 1S0MA 1UNNC 1C3OA 2R82A 2VPSA 4GC7A 5C5JA 2F4VH 3KHGA 1Y1WA 1JLLB 4HYKA 4EFEA 4PWQA 5FPRA 4A3FG 1KJIA 2FLLA 5FPOA 4DR3H 2W9BB 2W9AA 3MR6A 3NGDA 3BABA 1JDEA 3RAXA 4R7RA 2FPPB 1M0WA 4LSXA 2J6SA 3PR5B 3VPCA 1HNZH 3PW2A 5KT7A 2XCAA 4JUZA 3VPBA 3V4SA 3SE7A 5C1OA 2V4QA 1VBHA 3GIDA 3IG0A 4QIWE 5JH7F 5KG3A 1KJJA 4R8UB 1GSAA 4JI5H 1T94A 5BPHA 2V58A 3BA8A 2UVWA 3GTOA 2YL2A 2JEJA 5KT2A 3RJ0A 3H20A 4DV0H 3K3PA 5KFPA 2UU9H 3H4BA 2UXBH 3GTKA 1B6RA 4EG0A 4Y8VB 1BXRA 5FLMG 4J9LA 2UXDH 2ZDHA 3PR4A 4UCTA 2HGSA 3R5XA 3UFXB 2J6UA 2IBKA 3Q8QB 5KFQA 5KT6A 1S0OA 4TQRA 2WE6A 5LXTF 5HV6A 3RUPA 2VUMA 4X65H 4G3IA 4EGJA 5KFEA 5KFFA 3ETHA 2ZDQA 1ZQ7A 4JI6H 4MV6A 4B3MH 5JVDF 3PO2G 4MV3A 2OH2A 1RK5A 5EWFA 3T5KA 4O3RA 4F50A 4EBDA 2Y0SE 1S10A 5EDWA 2C2EA 3PW0A 5KFLA 2YW2A 4HNTA 3RIZA 5KG2A 5CAEB 3GQCA 4Q8FA 1KC7A 3I4MG 2R7ZG 4A3MG 2Y0SA 1CQJB 2WTFA 4I50F 1A9XA 5KG5A 4ECRA 3TQ1A 2C2RA 4DL5A 4DL4A 2NU6B 1CQIB 5I47A 4AQYH 4MV4A 3OUUA 2JA5A 3RAQA 4ECSA 4HNUA 2FK1A 2JA6G 3GIPA 5D1OA 4MTEA 3TIIA 3RGXA 4LSAA 2JA8G 3T5LA 4QW8A 2SCUB 4EYHB 4E4TA 1DGSA 3GV7B 2ASLA 2W71A 3JRWA 2AU0A 3LWBA 5A2QW 5EWGA 5DG8A 4J9PA 3M9MB 1BGWA 1OWTA 2QK4A 2CW7A 3Q2OA 4EYIB 3V6HA 5L1IA 4JI2H 5L1KA 3N41B 4J9OA 1E4EA 3WO1A 4C5CA 2FK2A 1GSHA 4RUAA 2C28A 4MTDA 3C0FB 3HKZA 4XYMB 2FPIB 4FBTA 1M7JA 4JI8H 4MV1A 5KFGA 5LP6F 3ORQA 1EUCB 5C4XG 3KTMA 4RB3C 5DG7A 2PN1A 3N43B 4KHPH 2FLNA 2ATLA 4C5AA 4TUYF 2YZNA 1Y1VA 2HVQA 5IP7G 3SI8A 4DR4H 4LH6A 5T14A 2YZGA 4LF5H 4RB0A 3V6JA 3MWMA 5KFNA 1Y1WG 4RB1A 2VUGA 4QWCA 3FDSA 5DQIA 4MV8A 2FE3A 1DV1A 4Q0YA 4QWBA 5BPFA 5LOVF 2VUMG 4WBNF 3F8NA 4UCUA 5C8YF 2DPIA 4ECUA 1TWAA 5KFMA 4RNNA 4A2AA 2R87A 4HNVA 5IYBG 4RNMA 4RZQA 3JAMW 4ED3A 1B33N 1FVIA 4EFBA 5KG1A 4QWEA 2VQEH 3KALA 4WD3A 3HKZE 4QW9A 4I55F 4ZQIA 2JA7G 3CVZA 4IAJA 4F4ZA 1KJ8A 4A93G 4YQWA 4DV5H 4EEYA 1XDNA 5KFHA 2P0AA 3V4ZA 2WB1A 4Q44A 3KAKA 4DUZH 4MV9A 3OHBA 4LF7H 4ME6A 1GGOA 2VQDA 3DF7A 2RDIA 2W8KA 4A3BG 4O4IF 2VA2A 2C00A 2RF4A 5CA1F 3G6XA 3J7AK 4RZRA 1ZHSA 1KEEA 4DV2H 3ORRA 4MA5A 3GIMA 2JA5G 2R7KA 3N8DA 1E4FT 2IMWP 4LF8H 4J9KA 3EPGA 1RYSA 2VR1A 3PVXA 4RB2C 2R7LA 3MWDA 1I3QA 5JVLA 2E2HA 4BBRG 4MV7A 2AGPA 1GLVA 2AGQA 5FLXW 5LMUH 5IWAH 3GTJA 4TV9F 1DV2A 2B63A 3PW7A 4LMYA 1S97A 4J0MA 2AQ4A 3R5FA 2PVPA 3OUZA 5K2MA 2ZM6H 4TQSA 4IWYA 2C35B 2ALZA 3QZ8A 1E4EB 1ZHQA 4J9QA 4F4XA 3PZPA 3GTQA 2R92A 4C5BA 3LMLA 4XX0B 4JI4H 2W6PA 5IT9W 3RV3A 5C3EG 3H40A 3KHHA 3BJYA 3RB0A 4JI7H 2JEFA 3RTXA 1N56A 5BR8H 2R92G 4X62H 3GTMA 1V9PA 2FPGB 4CC5A 5JUMA 4RAZA 2FK3A 1UC8A 1W93A 3MR2A 1ZETA 2UVUA 1L2ZA 2R8IA 4Q45A 1FKAH 2IA6A 3GTLA 1HNXH 2R8GA 1E4GT 1I50A 1XMQH 5DLFA 1O75A 4JV1A 2FLPA 4IR9A 4JV0A 1S03G 1IOWA 4UCVA 4DR6H 1WCMG 3FMAA 3J81W 3GIQA 3GIJA 2OLSA 2YU9A 2FJZA 1DIKA 3K3VA 3GIIA 3IN5A 1S9FA 1R9TA 2YZMA 1TWFA 4ZI7F 3I12A 2R8KA 4ZHQF 1RJQA 4ED0A 3G6YA 4YBZB 3Q8PB 3M9OB 4UCSA 4U7CA 4B3TH 3MWEA 4EBEA 1ULZA 3HOXG 3Q1KA 2R7NA 2YS7A 5DQHA 2NVYA 1K1SA 5H80A 5DLGA 5D8DA 3N44B 4OX9H 4O4LF 3WO0A 4LF9H 5DGBA 4JI3H
chains in the Genus database with same CATH topology
3UQ8A 2CW8A 1J5EH 2HVQA 1MZBA 4JV5H 2E5LH 4DR4H 2VPSA 4BWSC 4LH6A 4LF4H 4DV3H 3M4IA 4LF5H 1VS0A 4RB0A 3MWMA 1HR0H 4ETSA 2F4VH 4RB1A 2VUGA 5EOYA 4X64H 4JYAH 4Q0YA 2FE3A 4EFEA 4M7EA 3T1HH 3EYYA 4B3SH 3F8NA 5FPRA 4UCUA 5LL6b 4KHPH 1XNRH 3KXYT 5FPOA 1TAEA 4DV4H 4DR3H 4K0KH 4A2AA 3BABA 4R7RA 1M0WA 4RZQA 4LSXA 3JAMW 1FVIA 4EFBA 2VQEH 1HNZH 2YCHA 3KALA 3L2PA 4B3RH 4UCRA 3CVZA 4IAJA 2MCTA 1B04A 4LFAH 3IG0A 1HNWH 5FD5A 4EEQA 4DV5H 1XDNA 2VQFH 4JI5H 4GKKH 1X9NA 3BA8A 1XNQH 3KAKA 4DUZH 1Z2OX 4MV9A 4LF7H 1N33H 3DF7A 3RJ0A 3H20A 4DV0H 2UU9H 3J7AK 2UXBH 1WH2A 2UXDH 3L4KA 4DV1H 1ZHSA 4DV2H 4UCTA 2HGSA 4LF6H 3L4JA 4GKJH 1E4FT 4APMA 1N34H 4LF8H 2WE6A 1FJGH 4DR1H 4RB2C 4DR5H 1Z2NX 5D1OB 4X65H 4MV7A 4DV7H 1I6UA 4GLXA 5FLXW 4JI6H 2HHHH 4B3MH 5LMUH 1TA8A 5IWAH 4PDBA 4LMYA 4UCOA 1I94H 4DR7H 5FD6A 1SYXB 3N40P 1AN7A 4J0MA 1P8LA 2ZM6H 3HXLA 3RIZA 1ZHQA 2VOBA 2UUBH 2UUCH 4A2BA 4YY3H 3LMLA 4NXNH 4I7HA 4JI4H 4JI1H 3BA9A 5IT9W 4DUYH 4JI7H 1IBMH 4UFZA 3RTXA 5BR8H 4X62H 1V9PA 4AQYH 1IBKH 4CC5A 4RAZA 3J80W 1L2ZA 3N6XA 4JI0H 1FKAH 5LMNH 3JSNA 1HNXH 4MTEA 3PN1A 5D1OA 3RGXA 2RGRA 4CC6A 1E4GT 4RAYA 4LSAA 1XMQH 4LFBH 1O75A 4YHHH 4DR2H 1A0IA 1DGSA 2Q2TA 1S03G 1S68A 4UCVA 4DR6H 3FMAA 5D1PA 3JSLA 3J81W 4DV6H 2HVRA 2Q2UA 4LFCH 2UXCH 1GYFA 5A2QW 4X66H 2XIGA 3K3VA 2OWOA 3N42B 4NXMH 1BGWA 3RGZA 2CW7A 2UUAH 1SEIA 2O03A 1IBLH 4JI2H 3OTOH 1XMOH 2W57A 3N41B 3RF2A 1BJTA 2KSWA 4MTDA 4UCSA 4B3TH 1M0TA 4FM9A 3C0FB 1Z2PX 1N32H 4JI8H 3BAAA 2RGVA 2HVSA 4OX9H 3N44B 1N36H 2ZJTA 4LH7A 4RB3C 3KAJA 2WDTA 2WYOA 3N43B 4LF9H 3T1YH 4JI3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2Z A;  1SYX B;  3K3V A;  1GYF A;  1WH2 A;  3FMA A;  4BWS C; 
#chains in the Genus database with same CATH topology
 2X0S A;  2XD4 A;  5KFJ A;  1MZB A;  5KFZ A;  3KHR A;  2GPW A;  2R6F A;  3ETJ A;  3AYH B;  4IRK A;  4Q43 A;  4GKK H;  1KJQ A;  4DV3 H;  3M4I A;  5KG4 A;  1HR0 H;  2V5A A;  5KT3 A;  4FBU A;  5KX5 F;  2W6O A;  1TWC A;  5EOY A;  5GON F;  4X64 H;  3H0G A;  4QWD A;  4ECZ A;  4M7E A;  3MFI A;  3M9N B;  3RB3 A;  5KFA A;  3EYY A;  2W8L A;  2IP4 A;  3MFH A;  5KFW A;  1GSO A;  4A3K G;  1CS0 A;  1TAE A;  5DG9 A;  4YR0 A;  3RB4 A;  2DIK A;  2R85 A;  3HB9 A;  3R5H A;  2PBZ A;  3GV5 B;  4JV2 A;  2FMA A;  2YCH A;  5JQW A;  4AYB A;  3L2P A;  2R93 G;  4B3R H;  3WNZ A;  3T5H A;  2W6Z A;  1B04 A;  1M6V A;  3H3V H;  4ZOL F;  1HNW H;  4HR7 A;  4DLK A;  5BMV F;  4J9M A;  5DGA A;  2UVR A;  4BXX G;  5IP9 G;  1BNC A;  5KFS A;  5KFV A;  1EZ1 A;  2DWC A;  2M05 A;  4YP3 A;  1X9N A;  1V4Y A;  1XNQ H;  1Z2O X;  2JEI A;  2BQU A;  5F9L A;  3EPI A;  4O2A F;  1WH2 A;  4DV1 H;  2YRW A;  2CQY A;  2YYA A;  3L4J A;  4O3N A;  1JXL A;  4GKJ H;  3RBD A;  4ECT A;  4DL7 A;  3RBE A;  1SFO A;  3GTG A;  2CKZ B;  3MR3 A;  3GIL A;  5KG0 A;  1FJG H;  4DR1 H;  3GTP A;  2W6M A;  2CZG A;  4MAM A;  5KFK A;  1Z2N X;  4DR5 H;  4A3I G;  1I6U A;  4GLX A;  3QZ7 A;  1K1Q A;  1TA8 A;  5J2T F;  3K5I A;  5C1P A;  1VBG A;  2R86 A;  5KG7 A;  2XCP A;  4A3D G;  4PDB A;  3Q8R B;  1C30 A;  2R8J A;  1UC9 A;  3JZI A;  4L1K A;  5FD6 A;  2GPS A;  4EBC A;  4ECV A;  2VPQ A;  1P8L A;  2PMZ A;  3PW4 A;  3BQ1 A;  2V59 A;  2W9C B;  4YR3 A;  4YJ2 F;  4FS1 A;  2JA7 A;  2UUB H;  3GLK A;  4A2B A;  4YY3 H;  4I7H A;  4J9N A;  5HBR B;  2PMZ E;  4DUY H;  1IBM H;  4ED8 A;  5EZY F;  4ECQ A;  3TIG A;  2I8C A;  4F4Y A;  2I80 A;  3FKI A;  1W96 A;  3BQ2 A;  1K83 A;  1PX2 A;  3N6X A;  4M9U A;  4JI0 H;  2ASJ A;  5LMN H;  3JSN A;  3PN1 A;  2RGR A;  1RJP A;  4CC6 A;  2FP4 B;  4RAY A;  4LFB H;  4YHH H;  1A0I A;  1EUD B;  2Q2T A;  1S68 A;  5IYD G;  1RK6 A;  1CE8 A;  5KFT A;  4DV6 H;  5D1P A;  3JSL A;  2HVR A;  4LFC H;  2Q2U A;  4RU9 A;  2XGQ A;  4ED6 A;  1RYR A;  2OWO A;  1WCM A;  4NXM H;  3RGZ A;  2UUA H;  1SEI A;  2ASD A;  2VA3 A;  2O03 A;  3U9S A;  1IBL H;  2C2D A;  2W57 A;  5KFU A;  3V6K A;  1JDB B;  3RF2 A;  3HOU G;  1BJT A;  5KKN B;  4QWA A;  3BQ0 A;  4ED1 A;  1Z2P X;  2NUA B;  1N32 H;  2R84 A;  4A3L G;  4R8U A;  4ECY A;  5LYJ F;  4DL2 A;  3FKI G;  1N36 H;  3HOY G;  2ZJT A;  4LH7 A;  4QJF A;  4X66 H;  5L1J A;  3G6V A;  1EHI A;  2XC9 A;  2WB1 E;  4YJ3 F;  2W70 A;  2CW8 A;  1J5E H;  3KHL A;  4JV5 H;  3Q8S B;  2E5L H;  2J9G A;  4IRC A;  3JRX A;  4C2M A;  4HQ6 A;  4BWS C;  4LF4 H;  3HOW G;  1VS0 A;  4ETS A;  1JX4 A;  2J6T A;  2R7Z A;  3GV8 B;  4JYA H;  2NU9 B;  3T1H H;  4B3S H;  4TV8 F;  3U9T A;  5LL6 b;  1XNR H;  4DL3 A;  4J9R A;  3KXY T;  4O3P A;  4K0K H;  4DV4 H;  4YR2 A;  4O3S A;  1TWH A;  4A3C G;  3HBL A;  3PO3 G;  2NU8 B;  5KG6 A;  1AUV A;  4ECW A;  5KFD A;  2E2I A;  4UCR A;  3OHA A;  2MCT A;  5L1L A;  4LFA H;  3GIK A;  4IRD A;  1WSC A;  2DPJ A;  2YS6 A;  5FD5 A;  1TWG A;  4EEQ A;  1I7N A;  2W9C A;  2VQF H;  1KBL A;  4YAJ B;  3K5H A;  3RV4 A;  1AUX A;  4I4T F;  3RB6 A;  2AGO A;  4O3Q A;  1IOV A;  5KFY A;  3CQZ A;  5KT4 A;  1N33 H;  4A3G G;  1JIH A;  4IZO A;  1VKZ A;  4ECX A;  5KFI A;  4U6P A;  3L4K A;  2RDJ A;  3BG5 A;  4LF6 H;  2W6N A;  4A3E G;  5C44 G;  3MR5 A;  1I7L A;  4FU0 A;  5IYC G;  3VPD A;  4APM A;  1N34 H;  2DZD A;  4F4W A;  5KFR A;  4EGQ A;  2V9W A;  1SCU B;  4BY1 G;  5CA0 F;  5D1O B;  3OSP A;  2WAQ A;  3R23 A;  4BBS G;  4DV7 H;  4J9S A;  1VAJ A;  4IWX A;  2W9B A;  2HHH H;  4IR1 A;  5J2U F;  4Q8E A;  2UVV A;  4UCO A;  3QFF A;  1I94 H;  4DR7 H;  1SYX B;  3N40 P;  1AN7 A;  5FJ8 G;  2V4R A;  2FKL A;  4RUC A;  3HXL A;  3HOV G;  5L9X A;  3MJF A;  2C22 A;  3TIN A;  2VOB A;  2GLT A;  2UUC H;  4XYL B;  2B63 G;  2JEG A;  1Y1V G;  4NXN H;  2NVX A;  2NU7 B;  4ED2 A;  4JI1 H;  3BA9 A;  3H4D A;  5KFB A;  5KFC A;  2HJW A;  1RJR A;  3RFC A;  2DLN A;  4UFZ A;  4GC6 A;  4DL6 A;  2W7P A;  2FB9 A;  2XGP A;  1IBK H;  2W6Q A;  3G8C A;  3OSN A;  2I87 A;  3J80 W;  4BY7 G;  1Y14 B;  3VMM A;  2R7M A;  5KFX A;  4NLG A;  2WAQ E;  1V51 A;  4O3O A;  1GO3 E;  4A3J G;  5DQG A;  5KT5 A;  1T3N A;  4DR2 H;  1B6S A;  1EYZ A;  3E5N A;  4YB8 B;  2BR0 A;  4XZ3 B;  3PW5 A;  4ED7 A;  1WR2 A;  2UXC H;  1GYF A;  2QYZ A;  3TQT A;  4O2B F;  2XIG A;  2YRX A;  3LP8 A;  3N42 B;  5LA6 F;  2XCL A;  4YAK B;  2ZDG A;  3OTO H;  4MA0 A;  2R8H A;  1XMO H;  4RNO A;  4FS2 A;  5EWE A;  2JA6 A;  2KSW A;  1PK8 A;  2BQ3 A;  1M0T A;  2W7O A;  4FM9 A;  5F9N A;  4AYB E;  4O4H F;  3T5J A;  1T36 A;  2R93 A;  3BAA A;  2RGV A;  2HVS A;  4QIW A;  1S0N A;  3I4N G;  5KFO A;  3KAJ A;  2WDT A;  2WYO A;  1N48 A;  3H0G G;  4IHJ F;  3T1Y H;  3UQ8 A;  5IYZ F;  5CB4 F;  3HOZ G;  1JKJ B;  2BQR A;  1KJ9 A;  1S0M A;  1UNN C;  1C3O A;  2R82 A;  2VPS A;  4GC7 A;  5C5J A;  2F4V H;  3KHG A;  1Y1W A;  1JLL B;  4HYK A;  4EFE A;  4PWQ A;  5FPR A;  4A3F G;  1KJI A;  2FLL A;  5FPO A;  4DR3 H;  2W9B B;  2W9A A;  3MR6 A;  3NGD A;  3BAB A;  1JDE A;  3RAX A;  4R7R A;  2FPP B;  1M0W A;  4LSX A;  2J6S A;  3PR5 B;  3VPC A;  1HNZ H;  3PW2 A;  5KT7 A;  2XCA A;  4JUZ A;  3VPB A;  3V4S A;  3SE7 A;  5C1O A;  2V4Q A;  1VBH A;  3GID A;  3IG0 A;  4QIW E;  5JH7 F;  5KG3 A;  1KJJ A;  4R8U B;  1GSA A;  4JI5 H;  1T94 A;  5BPH A;  2V58 A;  3BA8 A;  2UVW A;  3GTO A;  2YL2 A;  2JEJ A;  5KT2 A;  3RJ0 A;  3H20 A;  4DV0 H;  3K3P A;  5KFP A;  2UU9 H;  3H4B A;  2UXB H;  3GTK A;  1B6R A;  4EG0 A;  4Y8V B;  1BXR A;  5FLM G;  4J9L A;  2UXD H;  2ZDH A;  3PR4 A;  4UCT A;  2HGS A;  3R5X A;  3UFX B;  2J6U A;  2IBK A;  3Q8Q B;  5KFQ A;  5KT6 A;  1S0O A;  4TQR A;  2WE6 A;  5LXT F;  5HV6 A;  3RUP A;  2VUM A;  4X65 H;  4G3I A;  4EGJ A;  5KFE A;  5KFF A;  3ETH A;  2ZDQ A;  1ZQ7 A;  4JI6 H;  4MV6 A;  4B3M H;  5JVD F;  3PO2 G;  4MV3 A;  2OH2 A;  1RK5 A;  5EWF A;  3T5K A;  4O3R A;  4F50 A;  4EBD A;  2Y0S E;  1S10 A;  5EDW A;  2C2E A;  3PW0 A;  5KFL A;  2YW2 A;  4HNT A;  3RIZ A;  5KG2 A;  5CAE B;  3GQC A;  4Q8F A;  1KC7 A;  3I4M G;  2R7Z G;  4A3M G;  2Y0S A;  1CQJ B;  2WTF A;  4I50 F;  1A9X A;  5KG5 A;  4ECR A;  3TQ1 A;  2C2R A;  4DL5 A;  4DL4 A;  2NU6 B;  1CQI B;  5I47 A;  4AQY H;  4MV4 A;  3OUU A;  2JA5 A;  3RAQ A;  4ECS A;  4HNU A;  2FK1 A;  2JA6 G;  3GIP A;  5D1O A;  4MTE A;  3TII A;  3RGX A;  4LSA A;  2JA8 G;  3T5L A;  4QW8 A;  2SCU B;  4EYH B;  4E4T A;  1DGS A;  3GV7 B;  2ASL A;  2W71 A;  3JRW A;  2AU0 A;  3LWB A;  5A2Q W;  5EWG A;  5DG8 A;  4J9P A;  3M9M B;  1BGW A;  1OWT A;  2QK4 A;  2CW7 A;  3Q2O A;  4EYI B;  3V6H A;  5L1I A;  4JI2 H;  5L1K A;  3N41 B;  4J9O A;  1E4E A;  3WO1 A;  4C5C A;  2FK2 A;  1GSH A;  4RUA A;  2C28 A;  4MTD A;  3C0F B;  3HKZ A;  4XYM B;  2FPI B;  4FBT A;  1M7J A;  4JI8 H;  4MV1 A;  5KFG A;  5LP6 F;  3ORQ A;  1EUC B;  5C4X G;  3KTM A;  4RB3 C;  5DG7 A;  2PN1 A;  3N43 B;  4KHP H;  2FLN A;  2ATL A;  4C5A A;  4TUY F;  2YZN A;  1Y1V A;  2HVQ A;  5IP7 G;  3SI8 A;  4DR4 H;  4LH6 A;  5T14 A;  2YZG A;  4LF5 H;  4RB0 A;  3V6J A;  3MWM A;  5KFN A;  1Y1W G;  4RB1 A;  2VUG A;  4QWC A;  3FDS A;  5DQI A;  4MV8 A;  2FE3 A;  1DV1 A;  4Q0Y A;  4QWB A;  5BPF A;  5LOV F;  2VUM G;  4WBN F;  3F8N A;  4UCU A;  5C8Y F;  2DPI A;  4ECU A;  1TWA A;  5KFM A;  4RNN A;  4A2A A;  2R87 A;  4HNV A;  5IYB G;  4RNM A;  4RZQ A;  3JAM W;  4ED3 A;  1B33 N;  1FVI A;  4EFB A;  5KG1 A;  4QWE A;  2VQE H;  3KAL A;  4WD3 A;  3HKZ E;  4QW9 A;  4I55 F;  4ZQI A;  2JA7 G;  3CVZ A;  4IAJ A;  4F4Z A;  1KJ8 A;  4A93 G;  4YQW A;  4DV5 H;  4EEY A;  1XDN A;  5KFH A;  2P0A A;  3V4Z A;  2WB1 A;  4Q44 A;  3KAK A;  4DUZ H;  4MV9 A;  3OHB A;  4LF7 H;  4ME6 A;  1GGO A;  2VQD A;  3DF7 A;  2RDI A;  2W8K A;  4A3B G;  4O4I F;  2VA2 A;  2C00 A;  2RF4 A;  5CA1 F;  3G6X A;  3J7A K;  4RZR A;  1ZHS A;  1KEE A;  4DV2 H;  3ORR A;  4MA5 A;  3GIM A;  2JA5 G;  2R7K A;  3N8D A;  1E4F T;  2IMW P;  4LF8 H;  4J9K A;  3EPG A;  1RYS A;  2VR1 A;  3PVX A;  4RB2 C;  2R7L A;  3MWD A;  1I3Q A;  5JVL A;  2E2H A;  4BBR G;  4MV7 A;  2AGP A;  1GLV A;  2AGQ A;  5FLX W;  5LMU H;  5IWA H;  3GTJ A;  4TV9 F;  1DV2 A;  2B63 A;  3PW7 A;  4LMY A;  1S97 A;  4J0M A;  2AQ4 A;  3R5F A;  2PVP A;  3OUZ A;  5K2M A;  2ZM6 H;  4TQS A;  4IWY A;  2C35 B;  2ALZ A;  3QZ8 A;  1E4E B;  1ZHQ A;  4J9Q A;  4F4X A;  3PZP A;  3GTQ A;  2R92 A;  4C5B A;  3LML A;  4XX0 B;  4JI4 H;  2W6P A;  5IT9 W;  3RV3 A;  5C3E G;  3H40 A;  3KHH A;  3BJY A;  3RB0 A;  4JI7 H;  2JEF A;  3RTX A;  1N56 A;  5BR8 H;  2R92 G;  4X62 H;  3GTM A;  1V9P A;  2FPG B;  4CC5 A;  5JUM A;  4RAZ A;  2FK3 A;  1UC8 A;  1W93 A;  3MR2 A;  1ZET A;  2UVU A;  1L2Z A;  2R8I A;  4Q45 A;  1FKA H;  2IA6 A;  3GTL A;  1HNX H;  2R8G A;  1E4G T;  1I50 A;  1XMQ H;  5DLF A;  1O75 A;  4JV1 A;  2FLP A;  4IR9 A;  4JV0 A;  1S03 G;  1IOW A;  4UCV A;  4DR6 H;  1WCM G;  3FMA A;  3J81 W;  3GIQ A;  3GIJ A;  2OLS A;  2YU9 A;  2FJZ A;  1DIK A;  3K3V A;  3GII A;  3IN5 A;  1S9F A;  1R9T A;  2YZM A;  1TWF A;  4ZI7 F;  3I12 A;  2R8K A;  4ZHQ F;  1RJQ A;  4ED0 A;  3G6Y A;  4YBZ B;  3Q8P B;  3M9O B;  4UCS A;  4U7C A;  4B3T H;  3MWE A;  4EBE A;  1ULZ A;  3HOX G;  3Q1K A;  2R7N A;  2YS7 A;  5DQH A;  2NVY A;  1K1S A;  5H80 A;  5DLG A;  5D8D A;  3N44 B;  4OX9 H;  4O4L F;  3WO0 A;  4LF9 H;  5DGB A;  4JI3 H; 
#chains in the Genus database with same CATH homology
 3UQ8 A;  2CW8 A;  1J5E H;  2HVQ A;  1MZB A;  4JV5 H;  2E5L H;  4DR4 H;  2VPS A;  4BWS C;  4LH6 A;  4LF4 H;  4DV3 H;  3M4I A;  4LF5 H;  1VS0 A;  4RB0 A;  3MWM A;  1HR0 H;  4ETS A;  2F4V H;  4RB1 A;  2VUG A;  5EOY A;  4X64 H;  4JYA H;  4Q0Y A;  2FE3 A;  4EFE A;  4M7E A;  3T1H H;  3EYY A;  4B3S H;  3F8N A;  5FPR A;  4UCU A;  5LL6 b;  4KHP H;  1XNR H;  3KXY T;  5FPO A;  1TAE A;  4DV4 H;  4DR3 H;  4K0K H;  4A2A A;  3BAB A;  4R7R A;  1M0W A;  4RZQ A;  4LSX A;  3JAM W;  1FVI A;  4EFB A;  2VQE H;  1HNZ H;  2YCH A;  3KAL A;  3L2P A;  4B3R H;  4UCR A;  3CVZ A;  4IAJ A;  2MCT A;  1B04 A;  4LFA H;  3IG0 A;  1HNW H;  5FD5 A;  4EEQ A;  4DV5 H;  1XDN A;  2VQF H;  4JI5 H;  4GKK H;  1X9N A;  3BA8 A;  1XNQ H;  3KAK A;  4DUZ H;  1Z2O X;  4MV9 A;  4LF7 H;  1N33 H;  3DF7 A;  3RJ0 A;  3H20 A;  4DV0 H;  2UU9 H;  3J7A K;  2UXB H;  1WH2 A;  2UXD H;  3L4K A;  4DV1 H;  1ZHS A;  4DV2 H;  4UCT A;  2HGS A;  4LF6 H;  3L4J A;  4GKJ H;  1E4F T;  4APM A;  1N34 H;  4LF8 H;  2WE6 A;  1FJG H;  4DR1 H;  4RB2 C;  4DR5 H;  1Z2N X;  5D1O B;  4X65 H;  4MV7 A;  4DV7 H;  1I6U A;  4GLX A;  5FLX W;  4JI6 H;  2HHH H;  4B3M H;  5LMU H;  1TA8 A;  5IWA H;  4PDB A;  4LMY A;  4UCO A;  1I94 H;  4DR7 H;  5FD6 A;  1SYX B;  3N40 P;  1AN7 A;  4J0M A;  1P8L A;  2ZM6 H;  3HXL A;  3RIZ A;  1ZHQ A;  2VOB A;  2UUB H;  2UUC H;  4A2B A;  4YY3 H;  3LML A;  4NXN H;  4I7H A;  4JI4 H;  4JI1 H;  3BA9 A;  5IT9 W;  4DUY H;  4JI7 H;  1IBM H;  4UFZ A;  3RTX A;  5BR8 H;  4X62 H;  1V9P A;  4AQY H;  1IBK H;  4CC5 A;  4RAZ A;  3J80 W;  1L2Z A;  3N6X A;  4JI0 H;  1FKA H;  5LMN H;  3JSN A;  1HNX H;  4MTE A;  3PN1 A;  5D1O A;  3RGX A;  2RGR A;  4CC6 A;  1E4G T;  4RAY A;  4LSA A;  1XMQ H;  4LFB H;  1O75 A;  4YHH H;  4DR2 H;  1A0I A;  1DGS A;  2Q2T A;  1S03 G;  1S68 A;  4UCV A;  4DR6 H;  3FMA A;  5D1P A;  3JSL A;  3J81 W;  4DV6 H;  2HVR A;  2Q2U A;  4LFC H;  2UXC H;  1GYF A;  5A2Q W;  4X66 H;  2XIG A;  3K3V A;  2OWO A;  3N42 B;  4NXM H;  1BGW A;  3RGZ A;  2CW7 A;  2UUA H;  1SEI A;  2O03 A;  1IBL H;  4JI2 H;  3OTO H;  1XMO H;  2W57 A;  3N41 B;  3RF2 A;  1BJT A;  2KSW A;  4MTD A;  4UCS A;  4B3T H;  1M0T A;  4FM9 A;  3C0F B;  1Z2P X;  1N32 H;  4JI8 H;  3BAA A;  2RGV A;  2HVS A;  4OX9 H;  3N44 B;  1N36 H;  2ZJT A;  4LH7 A;  4RB3 C;  3KAJ A;  2WDT A;  2WYO A;  3N43 B;  4LF9 H;  3T1Y H;  4JI3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...