1SYXB

The crystal structure of a binary u5 snrnp complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
b'DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spliceosomal U5 snRNP-specific 15 kDa protein
publication title Structural basis for the bifunctionality of the U5 snRNP 52K protein (CD2BP2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/immune system
total genus 11
structure length 62
sequence length 62
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1syxB00
4BWSC 1WH2A 1GYFA 3FMAA 3K3VA 1L2ZA 1SYXB
chains in the Genus database with same CATH superfamily
5C1OA 3LP8A 3QZ8A 2DLNA 5CA1F 4JI3H 3RB3A 4A93G 4O3NA 1ZHSA 4MV8A 3HOUG 4PDBA 5KX5F 2E5LH 2YS7A 2YYAA 3CVZA 4LSXA 3QZ7A 4RZRA 4QJFA 2VQEH 3NGDA 3C0FB 2C28A 2YU9A 4XX0B 5KFKA 4RNMA 4IRCA 1XNQH 1WH2A 4XZ3B 2V59A 2R7LA 1J5EH 1M6VA 4EBCA 1I3QA 3MFIA 2WB1E 4RNOA 4MAMA 4EGQA 2YW2A 3KTMA 1P8LA 4FU0A 4CC5A 5BPFA 3M9OB 4MV9A 2R8IA 1XMQH 3L2PA 3KHLA 4NXMH 2UVWA 1UC9A 4YAJB 4I7HA 4UCOA 5C5JA 4EEYA 2JA7G 3GLKA 1Y1WA 2ZJTA 5H80A 4I4TF 4DV6H 1TWCA 1WSCA 2AU0A 1FVIA 4EYHB 1K83A 3BQ2A 2J6SA 4O3PA 4ED7A 3GIIA 5KT5A 1GO3E 4IR1A 3GTPA 2W7PA 3GIDA 3T5JA 4YJ3F 1JDEA 4A3GG 3J81W 1N34H 3I4NG 3U9TA 5LMUH 2AGPA 5JH7F 1UNNC 2FPGB 4DR6H 5DG9A 4IRKA 4EFBA 3SI8A 1TAEA 4B3SH 4DL5A 4A3JG 2JEGA 2ZDHA 1JDBB 2YS6A 3HXLA 3JAMW 4IWYA 4MV3A 2FB9A 4YBZB 5LP6F 4JI2H 5DG7A 5K2MA 4ED1A 1SFOA 2VR1A 4YR3A 3MFHA 4ECYA 4RUAA 4XYLB 3ORQA 3MR2A 1ZETA 3Q1KA 4TQRA 5D1OA 5EZYF 5KT3A 1VBHA 5IYDG 2DPIA 2ATLA 3MWDA 2HVRA 4A3BG 1N32H 1OWTA 4QWBA 3SE7A 4F4YA 1BGWA 3GTMA 1DV2A 2FLLA 4HNTA 2VA2A 4DR4H 4QIWA 5C3EG 3J7AK 4DL2A 4ME6A 5EWFA 1S10A 5IYZF 4EEQA 5KFJA 1EYZA 4UCVA 3UQ8A 3PW5A 3F8NA 2R8HA 4LFCH 2R8JA 2CW8A 1B6RA 4EBEA 3T5HA 5KFIA 5D1PA 4FBUA 1ULZA 1RJQA 4Q45A 2Y0SE 3FDSA 3T5KA 1FJGH 2R7KA 2VQDA 4YHHH 4MV1A 3FKIG 3OTOH 4ED2A 3T5LA 5JVLA 3RF2A 4F4WA 5DLGA 3GIMA 3RFCA 5DGAA 4WBNF 3BA8A 5LXTF 4MV4A 5L1LA 4F50A 4Y8VB 2WYOA 1JIHA 4UCSA 3N43B 4GKJH 4J9SA 5KT6A 2FK1A 2R84A 4DR1H 2VUMG 2I87A 2W9BA 1KJIA 3V6JA 2FPPB 1N33H 3OSNA 4ECXA 2P0AA 2HGSA 3L4JA 2C2DA 1E4FT 4O2AF 2WAQE 4HYKA 2FLPA 3GV8B 2BR0A 3J80W 1HNZH 1I6UA 5KG7A 4C5AA 1N48A 1RYRA 1EUCB 3N40P 2R93G 3HB9A 2KSWA 4BBSG 2W6OA 5KFCA 4O4LF 4RNNA 5KFHA 5L1KA 5I47A 3HOXG 1RJPA 1KJ9A 1ZHQA 4DV5H 3R5XA 4AQYH 3OUZA 3RJ0A 2JA5G 3PW4A 5KFEA 3PO3G 1GGOA 1KJ8A 3E5NA 3HKZE 2UUBH 5DG8A 3M4IA 4HR7A 5KG4A 4JV5H 3I12A 3HOYG 1SEIA 1CS0A 1JLLB 5JVDF 5IP7G 1WCMG 3G6XA 2CKZB 4IHJF 3GTOA 3PVXA 4DV3H 4JI5H 4O3SA 3U9SA 4LH6A 4MV7A 4A2AA 3Q8SB 5KFUA 4J9MA 3V6HA 3ETHA 3RBEA 4JYAH 4RB1A 3BQ0A 4FS1A 1M7JA 3V4SA 1EUDB 3M9MB 2FLNA 2VOBA 1Z2OX 4Q0YA 5GONF 5KT2A 2YZMA 3VMMA 2CW7A 2SCUB 2FK3A 2JEIA 3K5HA 1KC7A 1R9TA 1EZ1A 2BQRA 1Y1VG 3WO0A 2UUCH 5KFDA 3PR5B 4JI0H 4RAZA 3KHGA 3V4ZA 2JEFA 4J9RA 4O3OA 4C5BA 5D8DA 1I94H 3RGXA 5C4XG 2C2EA 2PN1A 2DWCA 4RB0A 5LL6b 3MJFA 1XNRH 1RYSA 4EG0A 2ZDQA 5A2QW 1JX4A 5CA0F 2QYZA 4LF4H 1C30A 1UC8A 5KG2A 4QW9A 4J9PA 3GTKA 4BY7G 3BG5A 4A3IG 4A3MG 1E4EB 5L9XA 4XYMB 2XCAA 2XIGA 3PW7A 2R8KA 4E4TA 4A2BA 4YY3H 4ECQA 3RB0A 3ORRA 3R23A 4ZOLF 5KG5A 2R85A 2NU7B 2AGOA 1C3OA 1M0TA 3DF7A 3EPIA 4DV2H 4C2MA 1BJTA 1IBMH 2BQUA 3G6YA 3HOWG 5KFTA 4DR3H 4LF7H 4NXNH 5BPHA 4CC6A 2VQFH 1JKJB 1Y1WG 3R5HA 5C44G 1V9PA 4U6PA 2XGQA 2ZDGA 1K1SA 1RJRA 1VAJA 4MTDA 2ASDA 2UUAH 2DZDA 2RF4A 1RK6A 5L1JA 2ASLA 3N8DA 4L1KA 1DV1A 5T14A 3RUPA 1AN7A 4LSAA 4GC7A 3KXYT 2RGRA 3HOVG 2UXCH 3H40A 2F4VH 3JSNA 1O75A 5FJ8G 2I8CA 5LYJF 1I7NA 5L1IA 2W6ZA 2OWOA 2E2HA 2R92A 2J6UA 5EDWA 4J0MA 5KFLA 4PWQA 5FLMG 5BR8H 3H4BA 4EGJA 1W93A 2PMZA 4FBTA 2IP4A 2AGQA 3VPDA 5DQHA 2XCLA 2C22A 3GTQA 2I80A 4QWEA 1DIKA 5JUMA 1A9XA 3GIJA 2V9WA 5KKNB 4A3FG 1S97A 4JI4H 3PN1A 2JA8G 4J9OA 5KFBA 4EBDA 4YJ2F 3TQ1A 2WAQA 5KFYA 2X0SA 3H20A 2GLTA 3KALA 4MTEA 5FLXW 5BMVF 4QWCA 2RDJA 5LMNH 2W71A 2XGPA 4FM9A 1HR0H 4JV0A 3G6VA 2OH2A 2DPJA 5HBRB 1AUXA 2R8GA 4ZHQF 4IAJA 4J9NA 1M0WA 2R7ZA 4DLKA 4BWSC 3RBDA 2FJZA 2UXBH 2B63A 4B3RH 4X64H 3QFFA 4F4ZA 5DGBA 1X9NA 2V58A 4F4XA 1CQIB 3GTGA 4IWXA 2YZGA 5JQWA 1T36A 3HKZA 4HNVA 2XD4A 4YQWA 4DR2H 4LF5H 4O2BF 3KAJA 3JRXA 5KFVA 4J9KA 3N42B 3WO1A 4TV9F 3I4MG 2VA3A 3Q8PB 5KFZA 4ED6A 1CQJB 2VPSA 3GILA 1TA8A 4AYBE 3WNZA 4A3KG 3OSPA 4DL4A 4DV7H 5KFSA 4DV1H 1EHIA 5F9NA 5EWGA 4A3EG 2R7ZG 1VKZA 4GLXA 3PO2G 3RGZA 3PZPA 1Z2PX 5IP9G 3RAQA 4RUCA 2Q2UA 4BXXG 3GTLA 2NU9B 5DQGA 2JA6A 4A3CG 4ECUA 3L4KA 1B04A 2HVSA 2R7NA 1IBLH 2W70A 4Q8FA 4LFAH 3OHAA 1JXLA 1WR2A 2W9CB 5KFMA 2FE3A 3MR3A 2XCPA 5DQIA 5EWEA 2UVRA 2WB1A 4I55F 1PK8A 3H3VH 3MWMA 1I50A 4MV6A 1S0NA 3PR4A 1E4EA 3VPCA 1CE8A 2RGVA 2JEJA 3T1HH 3IN5A 5IYCG 2FP4B 4ECSA 1MZBA 2R7MA 5DLFA 1GSHA 4UCRA 1B33N 3GTJA 3GIKA 2W6MA 3G8CA 4O4IF 4RZQA 2FPIB 2C2RA 4HQ6A 4JUZA 4LMYA 4LH7A 4QW8A 4R8UB 1N56A 2WDTA 4LFBH 3T1YH 2UVUA 3M9NB 4G3IA 3K3PA 4A3LG 4ZI7F 3GIPA 2PVPA 1AUVA 2R82A 3GIQA 4DV0H 1V51A 4YB8B 4ECVA 5C1PA 2HJWA 5KFXA 1L2ZA 4BY1G 3MR5A 4QWAA 3BA9A 4JI7H 3V6KA 3RV3A 3EPGA 2ALZA 2JA7A 4TQSA 2J9GA 4EYIB 1ZQ7A 5CAEB 4EFEA 5J2UF 4ED0A 5KFNA 3OUUA 3HBLA 4DL7A 5FD5A 2R87A 4MA5A 4DUZH 4ECZA 4X62H 2C35B 3BQ1A 4JI8H 5KFAA 3R5FA 1K1QA 2FKLA 4TV8F 5CB4F 3Q8QB 2UVVA 1B6SA 3H0GA 2NU6B 5KFWA 3RAXA 1E4GT 3N44B 2YZNA 5LOVF 5KT4A 3Q8RB 5KFOA 4B3TH 1S9FA 3JRWA 5KG6A 2W9AA 1V4YA 4APMA 2ZM6H 1KJQA 2YCHA 2V5AA 4HNUA 2WE6A 2Y0SA 2YL2A 3IG0A 3LMLA 4BBRG 1PX2A 4A3DG 1VBGA 2BQ3A 2NU8B 1TWHA 4X66H 4J9QA 3HOZG 4LF8H 1Z2NX 4IRDA 4YAKB 2W8LA 2R6FA 3TINA 3H0GG 4DL3A 5KG3A 4YR0A 2W8KA 2UXDH 3TQTA 2E2IA 2YRWA 5FPOA 3LWBA 4ECWA 3Q2OA 4YR2A 2V4QA 3RB4A 4J9LA 1HNXH 1KBLA 3GV7B 1GSAA 3JZIA 3EYYA 4UFZA 5F9LA 2WTFA 1KJJA 3KHRA 2VUGA 4ZQIA 4AYBA 4ETSA 1IBKH 2R92G 1S0OA 5HV6A 1XDNA 3K3VA 4ECTA 5KG0A 2VPQA 5IYBG 4JV1A 1TWGA 3FKIA 4QWDA 1BNCA 4O4HF 1W96A 4GKKH 5KFGA 3OHBA 2DIKA 2FK2A 4M9UA 3H4DA 3GQCA 2W9CA 3BJYA 2IMWP 3RB6A 3RIZA 1T94A 1T3NA 4Q43A 2IBKA 5LA6F 3MWEA 3TIIA 4O3QA 2V4RA 2C00A 4Q44A 2MCTA 5KG1A 1I7LA 2VUMA 3BAAA 5KFQA 1Y14B 2NVYA 4M7EA 1GSOA 5KT7A 2ASJA 1XMOH 5J2TF 1KEEA 5IWAH 2B63G 2HVQA 3PW2A 2R93A 4QIWE 2R86A 1SCUB 4NLGA 4RU9A 3AYHB 2W6PA 3ETJA 3BABA 2W6QA 4MA0A 4FS2A 2PMZE 5D1OB 1S0MA 4LF9H 4K0KH 3N6XA 4DV4H 5FD6A 2FMAA 4Q8EA 1TWFA 2GPWA 4R8UA 2O03A 3RV4A 5KFFA 4ED8A 4C5CA 4O3RA 2J6TA 2W6NA 2M05A 5C8YF 4UCTA 4GC6A 4JV2A 3GV5B 2CQYA 4DR5H 2JA5A 4JI6H 1BXRA 1A0IA 3PW0A 1HNWH 2OLSA 4JI1H 4RB3C 3VPBA 1VS0A 2RDIA 4RB2C 3KAKA 3KHHA 4I50F 1RK5A 1TWAA 2HHHH 4LF6H 2YRXA 2AQ4A 1WCMA 2IA6A 4WD3A 4KHPH 3JSLA 2W57A 1S68A 2Q2TA 5IT9W 4ECRA 4ED3A 3K5IA 5KFPA 4TUYF 4DUYH 3RTXA 1S03G 2JA6G 2NUAB 2UU9H 1GYFA 1IOWA 4U7CA 2CZGA 5KFRA 1IOVA 3UFXB 1N36H 4OX9H 2NVXA 4X65H 2XC9A 2GPSA 3CQZA 1GLVA 2PBZA 4DL6A 4R7RA 4YP3A 2QK4A 4B3MH 4IR9A 1SYXB 1Y1VA 4UCUA 3TIGA 2W7OA 4IZOA 4DR7H 5EOYA 3N41B 3FMAA 3MR6A 2W9BB 1FKAH 1DGSA 4RAYA 5FPRA
chains in the Genus database with same CATH topology
3J80W 1HNZH 1I6UA 4JI4H 3PN1A 4JI3H 4B3TH 3N40P 1ZHSA 2KSWA 4PDBA 3H20A 4MTEA 3KALA 4APMA 5FLXW 2ZM6H 5LMNH 4FM9A 3CVZA 4LSXA 2YCHA 1HR0H 2E5LH 2WE6A 3IG0A 3LMLA 2VQEH 1ZHQA 3C0FB 4DV5H 4IAJA 4AQYH 3RJ0A 1M0WA 4X66H 4BWSC 2UXBH 4LF8H 1XNQH 1WH2A 1Z2NX 4B3RH 4X64H 2UUBH 1X9NA 1J5EH 3M4IA 4JV5H 1SEIA 2UXDH 4DR2H 4LF5H 3KAJA 5FPOA 1P8LA 4CC5A 4DV3H 3N42B 4JI5H 4MV9A 1XMQH 4NXMH 3L2PA 4LH6A 4MV7A 4A2AA 4JYAH 1HNXH 2VPSA 4I7HA 4UCOA 4RB1A 1TA8A 3EYYA 4UFZA 4DV7H 2ZJTA 4DV1H 4DV6H 2VUGA 2VOBA 1Z2OX 4Q0YA 4GLXA 3RGZA 1FVIA 4ETSA 1IBKH 1Z2PX 2CW7A 2Q2UA 1XDNA 3K3VA 2UUCH 3L4KA 4JI0H 1B04A 4RAZA 2HVSA 4GKKH 3J81W 1N34H 1IBLH 3RIZA 5LMUH 4LFAH 4DR6H 1I94H 4EFBA 3RGXA 2FE3A 1TAEA 4B3SH 2MCTA 4RB0A 5LL6b 3BAAA 3HXLA 3JAMW 1XNRH 4M7EA 1XMOH 4JI2H 3MWMA 5A2QW 4LF4H 5IWAH 2RGVA 2HVQA 3T1HH 5D1OA 2HVRA 1N32H 2XIGA 1MZBA 1BGWA 3BABA 4K0KH 5D1OB 4UCRA 4LF9H 4A2BA 3N6XA 4YY3H 5FD6A 4DV4H 4DR4H 4RZQA 3J7AK 2O03A 1M0TA 3DF7A 4LMYA 4LH7A 4UCTA 4DV2H 1BJTA 4DR5H 1IBMH 4JI6H 4EEQA 1A0IA 2WDTA 4LFBH 3T1YH 1HNWH 4UCVA 3UQ8A 4RB3C 4JI1H 3F8NA 4DR3H 4LF7H 4LFCH 4NXNH 1VS0A 4CC6A 4RB2C 3KAKA 2CW8A 2VQFH 2HHHH 4LF6H 1V9PA 4DV0H 5D1PA 4MTDA 4KHPH 3JSLA 2W57A 2UUAH 1S68A 1FJGH 2Q2TA 5IT9W 1L2ZA 2RGRA 1AN7A 3BA9A 4LSAA 3KXYT 3RTXA 4YHHH 4DUYH 3OTOH 4JI7H 1S03G 2UU9H 3JSNA 2F4VH 1GYFA 3RF2A 1O75A 3BA8A 1N36H 4OX9H 2OWOA 4EFEA 4X65H 2WYOA 4J0MA 4UCSA 3N43B 5FD5A 5BR8H 4GKJH 4R7RA 4B3MH 4RAYA 4DUZH 1SYXB 4DR1H 4UCUA 4X62H 4JI8H 4DR7H 5EOYA 3N41B 1N33H 2UXCH 3FMAA 2HGSA 3L4JA 1FKAH 1DGSA 1E4FT 5FPRA 1E4GT 3N44B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWS C;  1WH2 A;  1GYF A;  3FMA A;  3K3V A;  1L2Z A;  1SYX B; 
#chains in the Genus database with same CATH topology
 5C1O A;  3LP8 A;  3QZ8 A;  2DLN A;  5CA1 F;  4JI3 H;  3RB3 A;  4A93 G;  4O3N A;  1ZHS A;  4MV8 A;  3HOU G;  4PDB A;  5KX5 F;  2E5L H;  2YS7 A;  2YYA A;  3CVZ A;  4LSX A;  3QZ7 A;  4RZR A;  4QJF A;  2VQE H;  3NGD A;  3C0F B;  2C28 A;  2YU9 A;  4XX0 B;  5KFK A;  4RNM A;  4IRC A;  1XNQ H;  1WH2 A;  4XZ3 B;  2V59 A;  2R7L A;  1J5E H;  1M6V A;  4EBC A;  1I3Q A;  3MFI A;  2WB1 E;  4RNO A;  4MAM A;  4EGQ A;  2YW2 A;  3KTM A;  1P8L A;  4FU0 A;  4CC5 A;  5BPF A;  3M9O B;  4MV9 A;  2R8I A;  1XMQ H;  3L2P A;  3KHL A;  4NXM H;  2UVW A;  1UC9 A;  4YAJ B;  4I7H A;  4UCO A;  5C5J A;  4EEY A;  2JA7 G;  3GLK A;  1Y1W A;  2ZJT A;  5H80 A;  4I4T F;  4DV6 H;  1TWC A;  1WSC A;  2AU0 A;  1FVI A;  4EYH B;  1K83 A;  3BQ2 A;  2J6S A;  4O3P A;  4ED7 A;  3GII A;  5KT5 A;  1GO3 E;  4IR1 A;  3GTP A;  2W7P A;  3GID A;  3T5J A;  4YJ3 F;  1JDE A;  4A3G G;  3J81 W;  1N34 H;  3I4N G;  3U9T A;  5LMU H;  2AGP A;  5JH7 F;  1UNN C;  2FPG B;  4DR6 H;  5DG9 A;  4IRK A;  4EFB A;  3SI8 A;  1TAE A;  4B3S H;  4DL5 A;  4A3J G;  2JEG A;  2ZDH A;  1JDB B;  2YS6 A;  3HXL A;  3JAM W;  4IWY A;  4MV3 A;  2FB9 A;  4YBZ B;  5LP6 F;  4JI2 H;  5DG7 A;  5K2M A;  4ED1 A;  1SFO A;  2VR1 A;  4YR3 A;  3MFH A;  4ECY A;  4RUA A;  4XYL B;  3ORQ A;  3MR2 A;  1ZET A;  3Q1K A;  4TQR A;  5D1O A;  5EZY F;  5KT3 A;  1VBH A;  5IYD G;  2DPI A;  2ATL A;  3MWD A;  2HVR A;  4A3B G;  1N32 H;  1OWT A;  4QWB A;  3SE7 A;  4F4Y A;  1BGW A;  3GTM A;  1DV2 A;  2FLL A;  4HNT A;  2VA2 A;  4DR4 H;  4QIW A;  5C3E G;  3J7A K;  4DL2 A;  4ME6 A;  5EWF A;  1S10 A;  5IYZ F;  4EEQ A;  5KFJ A;  1EYZ A;  4UCV A;  3UQ8 A;  3PW5 A;  3F8N A;  2R8H A;  4LFC H;  2R8J A;  2CW8 A;  1B6R A;  4EBE A;  3T5H A;  5KFI A;  5D1P A;  4FBU A;  1ULZ A;  1RJQ A;  4Q45 A;  2Y0S E;  3FDS A;  3T5K A;  1FJG H;  2R7K A;  2VQD A;  4YHH H;  4MV1 A;  3FKI G;  3OTO H;  4ED2 A;  3T5L A;  5JVL A;  3RF2 A;  4F4W A;  5DLG A;  3GIM A;  3RFC A;  5DGA A;  4WBN F;  3BA8 A;  5LXT F;  4MV4 A;  5L1L A;  4F50 A;  4Y8V B;  2WYO A;  1JIH A;  4UCS A;  3N43 B;  4GKJ H;  4J9S A;  5KT6 A;  2FK1 A;  2R84 A;  4DR1 H;  2VUM G;  2I87 A;  2W9B A;  1KJI A;  3V6J A;  2FPP B;  1N33 H;  3OSN A;  4ECX A;  2P0A A;  2HGS A;  3L4J A;  2C2D A;  1E4F T;  4O2A F;  2WAQ E;  4HYK A;  2FLP A;  3GV8 B;  2BR0 A;  3J80 W;  1HNZ H;  1I6U A;  5KG7 A;  4C5A A;  1N48 A;  1RYR A;  1EUC B;  3N40 P;  2R93 G;  3HB9 A;  2KSW A;  4BBS G;  2W6O A;  5KFC A;  4O4L F;  4RNN A;  5KFH A;  5L1K A;  5I47 A;  3HOX G;  1RJP A;  1KJ9 A;  1ZHQ A;  4DV5 H;  3R5X A;  4AQY H;  3OUZ A;  3RJ0 A;  2JA5 G;  3PW4 A;  5KFE A;  3PO3 G;  1GGO A;  1KJ8 A;  3E5N A;  3HKZ E;  2UUB H;  5DG8 A;  3M4I A;  4HR7 A;  5KG4 A;  4JV5 H;  3I12 A;  3HOY G;  1SEI A;  1CS0 A;  1JLL B;  5JVD F;  5IP7 G;  1WCM G;  3G6X A;  2CKZ B;  4IHJ F;  3GTO A;  3PVX A;  4DV3 H;  4JI5 H;  4O3S A;  3U9S A;  4LH6 A;  4MV7 A;  4A2A A;  3Q8S B;  5KFU A;  4J9M A;  3V6H A;  3ETH A;  3RBE A;  4JYA H;  4RB1 A;  3BQ0 A;  4FS1 A;  1M7J A;  3V4S A;  1EUD B;  3M9M B;  2FLN A;  2VOB A;  1Z2O X;  4Q0Y A;  5GON F;  5KT2 A;  2YZM A;  3VMM A;  2CW7 A;  2SCU B;  2FK3 A;  2JEI A;  3K5H A;  1KC7 A;  1R9T A;  1EZ1 A;  2BQR A;  1Y1V G;  3WO0 A;  2UUC H;  5KFD A;  3PR5 B;  4JI0 H;  4RAZ A;  3KHG A;  3V4Z A;  2JEF A;  4J9R A;  4O3O A;  4C5B A;  5D8D A;  1I94 H;  3RGX A;  5C4X G;  2C2E A;  2PN1 A;  2DWC A;  4RB0 A;  5LL6 b;  3MJF A;  1XNR H;  1RYS A;  4EG0 A;  2ZDQ A;  5A2Q W;  1JX4 A;  5CA0 F;  2QYZ A;  4LF4 H;  1C30 A;  1UC8 A;  5KG2 A;  4QW9 A;  4J9P A;  3GTK A;  4BY7 G;  3BG5 A;  4A3I G;  4A3M G;  1E4E B;  5L9X A;  4XYM B;  2XCA A;  2XIG A;  3PW7 A;  2R8K A;  4E4T A;  4A2B A;  4YY3 H;  4ECQ A;  3RB0 A;  3ORR A;  3R23 A;  4ZOL F;  5KG5 A;  2R85 A;  2NU7 B;  2AGO A;  1C3O A;  1M0T A;  3DF7 A;  3EPI A;  4DV2 H;  4C2M A;  1BJT A;  1IBM H;  2BQU A;  3G6Y A;  3HOW G;  5KFT A;  4DR3 H;  4LF7 H;  4NXN H;  5BPH A;  4CC6 A;  2VQF H;  1JKJ B;  1Y1W G;  3R5H A;  5C44 G;  1V9P A;  4U6P A;  2XGQ A;  2ZDG A;  1K1S A;  1RJR A;  1VAJ A;  4MTD A;  2ASD A;  2UUA H;  2DZD A;  2RF4 A;  1RK6 A;  5L1J A;  2ASL A;  3N8D A;  4L1K A;  1DV1 A;  5T14 A;  3RUP A;  1AN7 A;  4LSA A;  4GC7 A;  3KXY T;  2RGR A;  3HOV G;  2UXC H;  3H40 A;  2F4V H;  3JSN A;  1O75 A;  5FJ8 G;  2I8C A;  5LYJ F;  1I7N A;  5L1I A;  2W6Z A;  2OWO A;  2E2H A;  2R92 A;  2J6U A;  5EDW A;  4J0M A;  5KFL A;  4PWQ A;  5FLM G;  5BR8 H;  3H4B A;  4EGJ A;  1W93 A;  2PMZ A;  4FBT A;  2IP4 A;  2AGQ A;  3VPD A;  5DQH A;  2XCL A;  2C22 A;  3GTQ A;  2I80 A;  4QWE A;  1DIK A;  5JUM A;  1A9X A;  3GIJ A;  2V9W A;  5KKN B;  4A3F G;  1S97 A;  4JI4 H;  3PN1 A;  2JA8 G;  4J9O A;  5KFB A;  4EBD A;  4YJ2 F;  3TQ1 A;  2WAQ A;  5KFY A;  2X0S A;  3H20 A;  2GLT A;  3KAL A;  4MTE A;  5FLX W;  5BMV F;  4QWC A;  2RDJ A;  5LMN H;  2W71 A;  2XGP A;  4FM9 A;  1HR0 H;  4JV0 A;  3G6V A;  2OH2 A;  2DPJ A;  5HBR B;  1AUX A;  2R8G A;  4ZHQ F;  4IAJ A;  4J9N A;  1M0W A;  2R7Z A;  4DLK A;  4BWS C;  3RBD A;  2FJZ A;  2UXB H;  2B63 A;  4B3R H;  4X64 H;  3QFF A;  4F4Z A;  5DGB A;  1X9N A;  2V58 A;  4F4X A;  1CQI B;  3GTG A;  4IWX A;  2YZG A;  5JQW A;  1T36 A;  3HKZ A;  4HNV A;  2XD4 A;  4YQW A;  4DR2 H;  4LF5 H;  4O2B F;  3KAJ A;  3JRX A;  5KFV A;  4J9K A;  3N42 B;  3WO1 A;  4TV9 F;  3I4M G;  2VA3 A;  3Q8P B;  5KFZ A;  4ED6 A;  1CQJ B;  2VPS A;  3GIL A;  1TA8 A;  4AYB E;  3WNZ A;  4A3K G;  3OSP A;  4DL4 A;  4DV7 H;  5KFS A;  4DV1 H;  1EHI A;  5F9N A;  5EWG A;  4A3E G;  2R7Z G;  1VKZ A;  4GLX A;  3PO2 G;  3RGZ A;  3PZP A;  1Z2P X;  5IP9 G;  3RAQ A;  4RUC A;  2Q2U A;  4BXX G;  3GTL A;  2NU9 B;  5DQG A;  2JA6 A;  4A3C G;  4ECU A;  3L4K A;  1B04 A;  2HVS A;  2R7N A;  1IBL H;  2W70 A;  4Q8F A;  4LFA H;  3OHA A;  1JXL A;  1WR2 A;  2W9C B;  5KFM A;  2FE3 A;  3MR3 A;  2XCP A;  5DQI A;  5EWE A;  2UVR A;  2WB1 A;  4I55 F;  1PK8 A;  3H3V H;  3MWM A;  1I50 A;  4MV6 A;  1S0N A;  3PR4 A;  1E4E A;  3VPC A;  1CE8 A;  2RGV A;  2JEJ A;  3T1H H;  3IN5 A;  5IYC G;  2FP4 B;  4ECS A;  1MZB A;  2R7M A;  5DLF A;  1GSH A;  4UCR A;  1B33 N;  3GTJ A;  3GIK A;  2W6M A;  3G8C A;  4O4I F;  4RZQ A;  2FPI B;  2C2R A;  4HQ6 A;  4JUZ A;  4LMY A;  4LH7 A;  4QW8 A;  4R8U B;  1N56 A;  2WDT A;  4LFB H;  3T1Y H;  2UVU A;  3M9N B;  4G3I A;  3K3P A;  4A3L G;  4ZI7 F;  3GIP A;  2PVP A;  1AUV A;  2R82 A;  3GIQ A;  4DV0 H;  1V51 A;  4YB8 B;  4ECV A;  5C1P A;  2HJW A;  5KFX A;  1L2Z A;  4BY1 G;  3MR5 A;  4QWA A;  3BA9 A;  4JI7 H;  3V6K A;  3RV3 A;  3EPG A;  2ALZ A;  2JA7 A;  4TQS A;  2J9G A;  4EYI B;  1ZQ7 A;  5CAE B;  4EFE A;  5J2U F;  4ED0 A;  5KFN A;  3OUU A;  3HBL A;  4DL7 A;  5FD5 A;  2R87 A;  4MA5 A;  4DUZ H;  4ECZ A;  4X62 H;  2C35 B;  3BQ1 A;  4JI8 H;  5KFA A;  3R5F A;  1K1Q A;  2FKL A;  4TV8 F;  5CB4 F;  3Q8Q B;  2UVV A;  1B6S A;  3H0G A;  2NU6 B;  5KFW A;  3RAX A;  1E4G T;  3N44 B;  2YZN A;  5LOV F;  5KT4 A;  3Q8R B;  5KFO A;  4B3T H;  1S9F A;  3JRW A;  5KG6 A;  2W9A A;  1V4Y A;  4APM A;  2ZM6 H;  1KJQ A;  2YCH A;  2V5A A;  4HNU A;  2WE6 A;  2Y0S A;  2YL2 A;  3IG0 A;  3LML A;  4BBR G;  1PX2 A;  4A3D G;  1VBG A;  2BQ3 A;  2NU8 B;  1TWH A;  4X66 H;  4J9Q A;  3HOZ G;  4LF8 H;  1Z2N X;  4IRD A;  4YAK B;  2W8L A;  2R6F A;  3TIN A;  3H0G G;  4DL3 A;  5KG3 A;  4YR0 A;  2W8K A;  2UXD H;  3TQT A;  2E2I A;  2YRW A;  5FPO A;  3LWB A;  4ECW A;  3Q2O A;  4YR2 A;  2V4Q A;  3RB4 A;  4J9L A;  1HNX H;  1KBL A;  3GV7 B;  1GSA A;  3JZI A;  3EYY A;  4UFZ A;  5F9L A;  2WTF A;  1KJJ A;  3KHR A;  2VUG A;  4ZQI A;  4AYB A;  4ETS A;  1IBK H;  2R92 G;  1S0O A;  5HV6 A;  1XDN A;  3K3V A;  4ECT A;  5KG0 A;  2VPQ A;  5IYB G;  4JV1 A;  1TWG A;  3FKI A;  4QWD A;  1BNC A;  4O4H F;  1W96 A;  4GKK H;  5KFG A;  3OHB A;  2DIK A;  2FK2 A;  4M9U A;  3H4D A;  3GQC A;  2W9C A;  3BJY A;  2IMW P;  3RB6 A;  3RIZ A;  1T94 A;  1T3N A;  4Q43 A;  2IBK A;  5LA6 F;  3MWE A;  3TII A;  4O3Q A;  2V4R A;  2C00 A;  4Q44 A;  2MCT A;  5KG1 A;  1I7L A;  2VUM A;  3BAA A;  5KFQ A;  1Y14 B;  2NVY A;  4M7E A;  1GSO A;  5KT7 A;  2ASJ A;  1XMO H;  5J2T F;  1KEE A;  5IWA H;  2B63 G;  2HVQ A;  3PW2 A;  2R93 A;  4QIW E;  2R86 A;  1SCU B;  4NLG A;  4RU9 A;  3AYH B;  2W6P A;  3ETJ A;  3BAB A;  2W6Q A;  4MA0 A;  4FS2 A;  2PMZ E;  5D1O B;  1S0M A;  4LF9 H;  4K0K H;  3N6X A;  4DV4 H;  5FD6 A;  2FMA A;  4Q8E A;  1TWF A;  2GPW A;  4R8U A;  2O03 A;  3RV4 A;  5KFF A;  4ED8 A;  4C5C A;  4O3R A;  2J6T A;  2W6N A;  2M05 A;  5C8Y F;  4UCT A;  4GC6 A;  4JV2 A;  3GV5 B;  2CQY A;  4DR5 H;  2JA5 A;  4JI6 H;  1BXR A;  1A0I A;  3PW0 A;  1HNW H;  2OLS A;  4JI1 H;  4RB3 C;  3VPB A;  1VS0 A;  2RDI A;  4RB2 C;  3KAK A;  3KHH A;  4I50 F;  1RK5 A;  1TWA A;  2HHH H;  4LF6 H;  2YRX A;  2AQ4 A;  1WCM A;  2IA6 A;  4WD3 A;  4KHP H;  3JSL A;  2W57 A;  1S68 A;  2Q2T A;  5IT9 W;  4ECR A;  4ED3 A;  3K5I A;  5KFP A;  4TUY F;  4DUY H;  3RTX A;  1S03 G;  2JA6 G;  2NUA B;  2UU9 H;  1GYF A;  1IOW A;  4U7C A;  2CZG A;  5KFR A;  1IOV A;  3UFX B;  1N36 H;  4OX9 H;  2NVX A;  4X65 H;  2XC9 A;  2GPS A;  3CQZ A;  1GLV A;  2PBZ A;  4DL6 A;  4R7R A;  4YP3 A;  2QK4 A;  4B3M H;  4IR9 A;  1SYX B;  1Y1V A;  4UCU A;  3TIG A;  2W7O A;  4IZO A;  4DR7 H;  5EOY A;  3N41 B;  3FMA A;  3MR6 A;  2W9B B;  1FKA H;  1DGS A;  4RAY A;  5FPR A; 
#chains in the Genus database with same CATH homology
 3J80 W;  1HNZ H;  1I6U A;  4JI4 H;  3PN1 A;  4JI3 H;  4B3T H;  3N40 P;  1ZHS A;  2KSW A;  4PDB A;  3H20 A;  4MTE A;  3KAL A;  4APM A;  5FLX W;  2ZM6 H;  5LMN H;  4FM9 A;  3CVZ A;  4LSX A;  2YCH A;  1HR0 H;  2E5L H;  2WE6 A;  3IG0 A;  3LML A;  2VQE H;  1ZHQ A;  3C0F B;  4DV5 H;  4IAJ A;  4AQY H;  3RJ0 A;  1M0W A;  4X66 H;  4BWS C;  2UXB H;  4LF8 H;  1XNQ H;  1WH2 A;  1Z2N X;  4B3R H;  4X64 H;  2UUB H;  1X9N A;  1J5E H;  3M4I A;  4JV5 H;  1SEI A;  2UXD H;  4DR2 H;  4LF5 H;  3KAJ A;  5FPO A;  1P8L A;  4CC5 A;  4DV3 H;  3N42 B;  4JI5 H;  4MV9 A;  1XMQ H;  4NXM H;  3L2P A;  4LH6 A;  4MV7 A;  4A2A A;  4JYA H;  1HNX H;  2VPS A;  4I7H A;  4UCO A;  4RB1 A;  1TA8 A;  3EYY A;  4UFZ A;  4DV7 H;  2ZJT A;  4DV1 H;  4DV6 H;  2VUG A;  2VOB A;  1Z2O X;  4Q0Y A;  4GLX A;  3RGZ A;  1FVI A;  4ETS A;  1IBK H;  1Z2P X;  2CW7 A;  2Q2U A;  1XDN A;  3K3V A;  2UUC H;  3L4K A;  4JI0 H;  1B04 A;  4RAZ A;  2HVS A;  4GKK H;  3J81 W;  1N34 H;  1IBL H;  3RIZ A;  5LMU H;  4LFA H;  4DR6 H;  1I94 H;  4EFB A;  3RGX A;  2FE3 A;  1TAE A;  4B3S H;  2MCT A;  4RB0 A;  5LL6 b;  3BAA A;  3HXL A;  3JAM W;  1XNR H;  4M7E A;  1XMO H;  4JI2 H;  3MWM A;  5A2Q W;  4LF4 H;  5IWA H;  2RGV A;  2HVQ A;  3T1H H;  5D1O A;  2HVR A;  1N32 H;  2XIG A;  1MZB A;  1BGW A;  3BAB A;  4K0K H;  5D1O B;  4UCR A;  4LF9 H;  4A2B A;  3N6X A;  4YY3 H;  5FD6 A;  4DV4 H;  4DR4 H;  4RZQ A;  3J7A K;  2O03 A;  1M0T A;  3DF7 A;  4LMY A;  4LH7 A;  4UCT A;  4DV2 H;  1BJT A;  4DR5 H;  1IBM H;  4JI6 H;  4EEQ A;  1A0I A;  2WDT A;  4LFB H;  3T1Y H;  1HNW H;  4UCV A;  3UQ8 A;  4RB3 C;  4JI1 H;  3F8N A;  4DR3 H;  4LF7 H;  4LFC H;  4NXN H;  1VS0 A;  4CC6 A;  4RB2 C;  3KAK A;  2CW8 A;  2VQF H;  2HHH H;  4LF6 H;  1V9P A;  4DV0 H;  5D1P A;  4MTD A;  4KHP H;  3JSL A;  2W57 A;  2UUA H;  1S68 A;  1FJG H;  2Q2T A;  5IT9 W;  1L2Z A;  2RGR A;  1AN7 A;  3BA9 A;  4LSA A;  3KXY T;  3RTX A;  4YHH H;  4DUY H;  3OTO H;  4JI7 H;  1S03 G;  2UU9 H;  3JSN A;  2F4V H;  1GYF A;  3RF2 A;  1O75 A;  3BA8 A;  1N36 H;  4OX9 H;  2OWO A;  4EFE A;  4X65 H;  2WYO A;  4J0M A;  4UCS A;  3N43 B;  5FD5 A;  5BR8 H;  4GKJ H;  4R7R A;  4B3M H;  4RAY A;  4DUZ H;  1SYX B;  4DR1 H;  4UCU A;  4X62 H;  4JI8 H;  4DR7 H;  5EOY A;  3N41 B;  1N33 H;  2UXC H;  3FMA A;  2HGS A;  3L4J A;  1FKA H;  1DGS A;  1E4F T;  5FPR A;  1E4G T;  3N44 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...