1SYXB

The crystal structure of a binary u5 snrnp complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spliceosomal U5 snRNP-specific 15 kDa protein
publication title Structural basis for the bifunctionality of the U5 snRNP 52K protein (CD2BP2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation/immune system
total genus 11
structure length 62
sequence length 62
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1syxB00
3FMAA 4BWSC 1GYFA 1L2ZA 1SYXB 3K3VA 1WH2A
chains in the Genus database with same CATH superfamily
5L1IA 2YS6A 2CZGA 3HB9A 4EEYA 2OH2A 4MV4A 5EWGA 3BA8A 3L4KA 4U6PA 1TWCA 2W9CB 4J9SA 1IBMH 5LOVF 3BG5A 4I7HA 4A3IG 4EYIB 4PDBA 1RK6A 4RB2C 2XC9A 2IA6A 5JQWA 3ORQA 2PMZA 5LA6F 5KFWA 2W6NA 4YJ3F 4GC7A 4F50A 2W6ZA 4A3KG 3V6JA 1TWHA 4AQYH 1FVIA 3KALA 2R8IA 2CKZB 4IHJF 3RIZA 5L9XA 3FKIA 2P0AA 4A2BA 5HBRB 4ED6A 2R7ZA 4ED8A 5DQIA 1KJIA 1S9FA 2UVRA 4J9KA 4J9LA 3Q8QB 3RB4A 2ASJA 5JUMA 3U9TA 5KT2A 2ASLA 3H4DA 5DQHA 3HOUG 4JI5H 5JH7F 3M4IA 4HQ6A 4F4YA 2FKLA 2W6PA 1IBLH 5C8YF 2YW2A 2IP4A 3N8DA 1JDEA 5EZYF 2J6SA 1E4FT 5FLMG 2XCAA 4DV7H 2AGQA 1M6VA 3DF7A 2CW7A 1ZHSA 4M9UA 5KFRA 1MZBA 4YJ2F 5BMVF 4HNTA 4BY1G 2VQEH 1M0WA 3N6XA 4TV9F 2W70A 4MAMA 5C1OA 3N42B 4LH6A 4EFBA 2WE6A 1BGWA 1HNXH 3FMAA 3V4ZA 3HOVG 4DR2H 4PWQA 1O75A 2YZNA 5KFZA 3T1YH 3M9OB 3GIMA 4YR0A 4LSAA 2KSWA 2YRWA 4GKJH 4XYLB 1UNNC 1B6SA 1KBLA 4RB1A 2R82A 1RK5A 3M9MB 2C2EA 4ECQA 4I50F 1UC8A 5C3EG 4DV0H 2AGOA 1Y14B 5BPHA 3Q2OA 3GV5B 1HNZH 4EGQA 4RUCA 2VR1A 1T94A 1CQJB 5L1JA 5KFYA 4IWXA 3N41B 1HNWH 2R7ZG 3HKZE 4DR1H 4QW8A 4HYKA 1IBKH 3GV7B 3HBLA 2R92A 3R5FA 4A3BG 5KFIA 5DLGA 5KFPA 2MCTA 3PZPA 5FLXW 4DL7A 1AUXA 2WAQA 3H3VH 3GTGA 5KT6A 5L1KA 5KG6A 4IRCA 2W9CA 3EPGA 4EBCA 1A9XA 4DL4A 5EOYA 5DGBA 4DV3H 2YU9A 2FMAA 2R85A 4B3TH 3J80W 2J9GA 3IN5A 1GO3E 4ECWA 2FP4B 1RJQA 1M0TA 4Q43A 4QWEA 4ME6A 1B04A 2FJZA 5IYZF 1KJJA 4I55F 3JSNA 4ED2A 4DR4H 2XCPA 3K3PA 1B6RA 2JA7G 4BBSG 4MV8A 5IYBG 3LMLA 3RV4A 3M9NB 5DGAA 2C2RA 2FLPA 4DL3A 1Y1VA 2V4QA 5C1PA 4IRKA 3GTQA 1X9NA 2W9BA 4L1KA 1ULZA 1EYZA 1UC9A 3K5HA 4F4WA 4APMA 2W8KA 1TWAA 3BA9A 3KHHA 5D1PA 3ORRA 2VUGA 4Q45A 2NVXA 5JVLA 3H0GA 4LH7A 4A3FG 4YR3A 2Y0SE 4JI4H 5IWAH 1CE8A 4O3PA 4LF5H 1C3OA 4O2AF 1VS0A 4J0MA 4M7EA 4ETSA 4ED3A 2I80A 1J5EH 1OWTA 2BR0A 3GTJA 4KHPH 3V4SA 4JYAH 1K83A 1PK8A 3H20A 1GYFA 3GIKA 4IWYA 5T14A 4MTEA 4IRDA 3MJFA 4ED1A 2F4VH 1WCMA 2R84A 2XIGA 2GPWA 2Q2UA 3MFIA 1I50A 2C35B 4MV7A 4J9PA 3QZ7A 4Q8EA 1S10A 3GTMA 3OHBA 1Y1WA 3F8NA 3H4BA 2W9AA 1RYSA 2R7MA 5FJ8G 3MWEA 5KG7A 1JLLB 2C00A 2JA5A 1KJ8A 1GSOA 4ED7A 3PW7A 2XCLA 3T5JA 1ZHQA 2DWCA 2C22A 1I94H 2FPGB 1CQIB 4EBEA 1V4YA 3I4MG 4XZ3B 3PW5A 1FKAH 3MR5A 2UUCH 3MR6A 3GIDA 4ECZA 4X66H 4JI2H 2W7PA 4O3SA 4GKKH 1V9PA 2BQRA 5C4XG 5KFHA 4RAYA 2RDIA 1GLVA 3PW2A 4Q44A 1TA8A 3KXYT 2JA6A 2ZJTA 3V6KA 3GIJA 5F9LA 2VUMA 3HOXG 2B63A 2R8HA 2V5AA 3HKZA 4J9QA 2PN1A 2UU9H 3RTXA 1S03G 5C5JA 5KT5A 4DR5H 4MV3A 3PR4A 1W96A 4YAKB 4LF4H 2IMWP 1RJRA 5KG2A 3KHGA 5FD6A 2R8KA 4LF6H 4BY7G 5EWEA 3N40P 4AYBA 3RBEA 3VPBA 3JAMW 4EBDA 2J6UA 3UQ8A 2V9WA 3GTPA 1WH2A 4BXXG 1SEIA 4NXMH 1I3QA 5KG0A 5A2QW 2JA8G 3FKIG 3RFCA 1SYXB 5FPOA 1WSCA 2QK4A 4YHHH 2R93A 5KX5F 1P8LA 5KFLA 5KG4A 3RGXA 1N36H 2JEGA 3PN1A 4ED0A 4EYHB 1XNQH 3JSLA 3Q8SB 2JEIA 3L4JA 2HGSA 4EFEA 4WBNF 2UUAH 2JEFA 2V58A 4ECXA 4A3GG 5FD5A 3RF2A 5KG1A 3RB6A 2J6TA 5D8DA 2UUBH 3SI8A 2UXDH 3I12A 1ZQ7A 2O03A 4A3JG 3GIIA 3GTOA 4J9RA 2R7LA 3H40A 1AN7A 4FU0A 4QW9A 3HOYG 4J9OA 1Z2PX 4MV1A 2X0SA 2FPPB 2V4RA 2W71A 3JZIA 1B33N 4MTDA 4JV1A 1V51A 1E4EB 2FLNA 1WR2A 2ZDQA 3V6HA 4BWSC 5LXTF 4DLKA 5KFBA 4RNOA 2HVRA 5C44G 1JIHA 1HR0H 5D1OB 2R7KA 1TAEA 4EGJA 2FLLA 3I4NG 2Y0SA 4R8UB 4E4TA 3FDSA 2UVUA 2R6FA 5KG5A 2FE3A 5CA1F 3C0FB 4C5CA 2I8CA 5KFDA 4A3MG 4JV5H 2E2HA 4RU9A 2VPSA 5LL6b 4RUAA 3GV8B 3GTKA 2E5LH 1T36A 4Y8VB 3VMMA 5K2MA 1JXLA 1PX2A 5EWFA 1M7JA 1S68A 4A3DG 4JI3H 5I47A 4DR7H 3HOZG 1KJ9A 4WD3A 5H80A 4LFCH 2R92G 5IP9G 3N44B 2VOBA 5KG3A 4YAJB 2NU7B 1TWFA 5LMNH 4DUYH 2DIKA 2R86A 3QFFA 4TUYF 5CAEB 1KEEA 3Q8PB 5KFEA 4JV0A 3R5XA 4XX0B 3OUUA 4YP3A 4LMYA 4O4LF 2W6OA 4TV8F 5DG7A 5KFTA 3OUZA 2NUAB 2RDJA 2WB1E 4HR7A 3KAKA 3ETJA 4DR6H 4G3IA 1JDBB 3E5NA 5KFKA 2NU8B 2HVSA 3RUPA 4U7CA 3G6VA 4DV4H 1I6UA 2W7OA 4QWDA 4XYMB 2R87A 2IBKA 4DL6A 2Q2TA 2WAQE 1VBHA 1I7NA 1Y1VG 3BAAA 4IZOA 4DV6H 4ECSA 3TQ1A 1JX4A 1R9TA 3GIPA 2UXCH 5IYCG 1DV1A 2SCUB 3T1HH 5BPFA 3RJ0A 2UVWA 4RNNA 2VPQA 2W57A 4LFBH 2FB9A 1SCUB 4EEQA 1N33H 1N56A 1E4EA 3H0GG 2DLNA 1T3NA 2ZDHA 3RBDA 1SFOA 4FBTA 4ZOLF 4YQWA 2C2DA 4X64H 5D1OA 3G6XA 5KKNB 5LYJF 1EHIA 1JKJB 1Z2NX 2RGVA 3GIQA 3WO1A 3BQ1A 5KFSA 3VPDA 2R8GA 2GLTA 1EUCB 4DV5H 4FBUA 5KFMA 4MA5A 4A3EG 2C28A 2NU6B 4QIWE 2DPJA 1WCMG 5LP6F 1DIKA 4GLXA 4A93G 2VA2A 4QJFA 4J9MA 2HHHH 2CW8A 3CQZA 4YR2A 3BQ0A 1Y1WG 3AYHB 3GQCA 4CC5A 1A0IA 3PR5B 3PO2G 4DR3H 2DPIA 4JI8H 3G8CA 2JA5G 4YBZB 1VKZA 3IG0A 3JRWA 3OSPA 3PO3G 2RF4A 5KFAA 2FK2A 4Q0YA 3TINA 5KFXA 3RAXA 4B3RH 4B3MH 1GGOA 3RB3A 4IR1A 3BABA 4O2BF 5KFFA 1KJQA 2ZM6H 4CC6A 4OX9H 3VPCA 3KTMA 1E4GT 4ECTA 4UCOA 2VA3A 4RZQA 3K5IA 4O3RA 3RGZA 2JA6G 4O3NA 1BJTA 2FK1A 1N48A 2QYZA 3MWDA 1XDNA 3HXLA 2W9BB 2B63G 2VUMG 2FK3A 5IP7G 1RYRA 5KFNA 4ZI7F 4LFAH 4IAJA 2AGPA 4F4XA 4FS2A 5DG9A 4QWBA 4K0KH 4A3LG 1CS0A 1W93A 3SE7A 1S97A 4NXNH 4JUZA 3RB0A 4HNUA 2ATLA 1I7LA 3MR3A 1N32H 5KT3A 4O3QA 4LF9H 4X65H 5HV6A 2ZDGA 2PMZE 1XNRH 1RJPA 1KC7A 3KHRA 4BBRG 5J2UF 3R23A 5J2TF 5L1LA 3Q1KA 2ASDA 3LWBA 1N34H 4ECYA 2CQYA 1VBGA 2VQFH 1GSAA 4RB3C 3R5HA 2DZDA 2AQ4A 3TIIA 4MV6A 2R93G 4JI1H 3UFXB 2WB1A 3L2PA 1TWGA 2W8LA 5DQGA 3LP8A 4UCRA 5KFCA 2FPIB 4UCUA 4JI6H 4ZQIA 5KFQA 4A3CG 3GILA 2ALZA 4EG0A 4GC6A 2JEJA 3ETHA 3OSNA 3CVZA 2JA7A 2RGRA 5FPRA 2BQ3A 4I4TF 3J81W 5F9NA 4UCVA 3NGDA 3T5HA 3U9SA 3OHAA 4AYBE 2UVVA 1BXRA 4Q8FA 2YYAA 3TQTA 2XGQA 3MFHA 1IOWA 1DGSA 5GONF 1K1SA 4DV2H 2YCHA 1XMQH 3N43B 4ECUA 4DL2A 1ZETA 1S0NA 5KT7A 3J7AK 3OTOH 3RV3A 1BNCA 2XGPA 3EPIA 4QWAA 4DUZH 3T5LA 2BQUA 4LF7H 2WTFA 2W6QA 1L2ZA 3MWMA 2YZGA 2PBZA 3PW0A 2YZMA 3TIGA 5CA0F 3RAQA 1EZ1A 2VQDA 3MR2A 3PVXA 3KHLA 4O4IF 3GTLA 1EUDB 1DV2A 4O4HF 4O3OA 1GSHA 2E2IA 1VAJA 2XD4A 2M05A 1K1QA 3QZ8A 4DV1H 4QIWA 5KFUA 4C5BA 4ECVA 5DLFA 4JV2A 4F4ZA 3HOWG 1C30A 4R7RA 4RB0A 4UFZA 4RZRA 4TQSA 4B3SH 2I87A 2WYOA 2R8JA 5BR8H 2YRXA 5EDWA 4RAZA 4RNMA 3EYYA 4QWCA 3Q8RB 5JVDF 3WNZA 4IR9A 2W6MA 4A2AA 4LF8H 5KFGA 4ECRA 3T5KA 3JRXA 1AUVA 3WO0A 4ZHQF 2OLSA 1FJGH 3K3VA 4HNVA 1Z2OX 2HVQA 2R7NA 2YS7A 3KAJA 5KT4A 4TQRA 5LMUH 4X62H 1XMOH 2UXBH 2HJWA 4FS1A 4C5AA 4J9NA 2V59A 4MA0A 2YL2A 1S0MA 4JI7H 2WDTA 4UCSA 5KFVA 5CB4F 5KFOA 1S0OA 5DG8A 5IYDG 2GPSA 4C2MA 5KFJA 2NVYA 4FM9A 4R8UA 1IOVA 3GLKA 4NLGA 4MV9A 2AU0A 5IT9W 3BJYA 2NU9B 3BQ2A 4JI0H 3G6YA 4YB8B 4DL5A 2PVPA 3PW4A 2OWOA 4LSXA 4YY3H 4UCTA
chains in the Genus database with same CATH topology
1BJTA 3BA9A 5D1PA 3BA8A 3L4KA 2VUGA 1IBMH 1XDNA 2FE3A 3HXLA 3C0FB 4I7HA 4LFAH 4JV5H 4JI4H 4LH7A 4IAJA 4PDBA 5IWAH 2VPSA 5LL6b 4RB2C 4LF5H 2E5LH 4KHPH 4K0KH 4NXNH 1VS0A 4J0MA 4M7EA 4ETSA 4AQYH 1FVIA 3KALA 1J5EH 1S68A 4JI3H 4DR7H 3RIZA 1N32H 4LF9H 4LFCH 4X65H 4JYAH 3H20A 3N44B 2VOBA 4A2BA 1XNRH 1GYFA 4MTEA 2F4VH 2XIGA 1N34H 2Q2UA 5LMNH 4DUYH 4MV7A 2VQFH 4JI5H 4RB3C 3M4IA 3F8NA 4APMA 4JI1H 1IBLH 3L2PA 4LMYA 4JI6H 1E4FT 4UCRA 4UCUA 4DV7H 3DF7A 2CW7A 1ZHSA 1ZHQA 4YY3H 1MZBA 1I94H 2VQEH 1M0WA 3N6XA 3CVZA 3KAKA 2RGRA 3N42B 1FKAH 4DR6H 4LH6A 5FPRA 2UUCH 3J81W 4EFBA 2WE6A 1BGWA 4UCVA 3FMAA 4X66H 1HNXH 4JI2H 2HVSA 4GKKH 4DR2H 4DV4H 1O75A 1V9PA 3T1YH 4LSAA 2KSWA 4GKJH 1I6UA 4RAYA 1DGSA 4RB1A 2Q2TA 1TA8A 3KXYT 3BAAA 4DV6H 4DV2H 2YCHA 1XMQH 3N43B 2ZJTA 4DV0H 3J7AK 2UXCH 3OTOH 1HNZH 4DUZH 3T1HH 3RJ0A 4LF7H 2W57A 1L2ZA 2UU9H 3MWMA 3RTXA 1S03G 4LFBH 4DR5H 4EEQA 3N41B 1HNWH 1N33H 4LF4H 4LF6H 4DR1H 5FD6A 1IBKH 3N40P 3JAMW 3UQ8A 1WH2A 1SEIA 3RGZA 2MCTA 5D1OA 4X64H 4NXMH 1Z2NX 2RGVA 5FLXW 4DV1H 5A2QW 4B3SH 4R7RA 4RB0A 4UFZA 1SYXB 4DV5H 5FPOA 2WYOA 5BR8H 4YHHH 4RAZA 1P8LA 5EOYA 4GLXA 1N36H 3EYYA 3RGXA 4DV3H 3PN1A 2HHHH 1XNQH 4B3TH 3JSLA 3J80W 2CW8A 3L4JA 2HGSA 4A2AA 4EFEA 2UUAH 4LF8H 5FD5A 1A0IA 4CC5A 3RF2A 4DR3H 4JI8H 1FJGH 2UUBH 3K3VA 1M0TA 1Z2OX 2HVQA 3KAJA 5LMUH 1XMOH 2UXBH 4X62H 3IG0A 2UXDH 1B04A 2O03A 3JSNA 4DR4H 4Q0YA 4JI7H 2WDTA 4UCSA 4B3MH 4B3RH 1AN7A 1Z2PX 3BABA 3LMLA 4OX9H 2ZM6H 4CC6A 4MTDA 4FM9A 4MV9A 1E4GT 5IT9W 4JI0H 4UCOA 4BWSC 1X9NA 2OWOA 4RZQA 2HVRA 1HR0H 5D1OB 4LSXA 1TAEA 4UCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMA A;  4BWS C;  1GYF A;  1L2Z A;  1SYX B;  3K3V A;  1WH2 A; 
#chains in the Genus database with same CATH topology
 5L1I A;  2YS6 A;  2CZG A;  3HB9 A;  4EEY A;  2OH2 A;  4MV4 A;  5EWG A;  3BA8 A;  3L4K A;  4U6P A;  1TWC A;  2W9C B;  4J9S A;  1IBM H;  5LOV F;  3BG5 A;  4I7H A;  4A3I G;  4EYI B;  4PDB A;  1RK6 A;  4RB2 C;  2XC9 A;  2IA6 A;  5JQW A;  3ORQ A;  2PMZ A;  5LA6 F;  5KFW A;  2W6N A;  4YJ3 F;  4GC7 A;  4F50 A;  2W6Z A;  4A3K G;  3V6J A;  1TWH A;  4AQY H;  1FVI A;  3KAL A;  2R8I A;  2CKZ B;  4IHJ F;  3RIZ A;  5L9X A;  3FKI A;  2P0A A;  4A2B A;  5HBR B;  4ED6 A;  2R7Z A;  4ED8 A;  5DQI A;  1KJI A;  1S9F A;  2UVR A;  4J9K A;  4J9L A;  3Q8Q B;  3RB4 A;  2ASJ A;  5JUM A;  3U9T A;  5KT2 A;  2ASL A;  3H4D A;  5DQH A;  3HOU G;  4JI5 H;  5JH7 F;  3M4I A;  4HQ6 A;  4F4Y A;  2FKL A;  2W6P A;  1IBL H;  5C8Y F;  2YW2 A;  2IP4 A;  3N8D A;  1JDE A;  5EZY F;  2J6S A;  1E4F T;  5FLM G;  2XCA A;  4DV7 H;  2AGQ A;  1M6V A;  3DF7 A;  2CW7 A;  1ZHS A;  4M9U A;  5KFR A;  1MZB A;  4YJ2 F;  5BMV F;  4HNT A;  4BY1 G;  2VQE H;  1M0W A;  3N6X A;  4TV9 F;  2W70 A;  4MAM A;  5C1O A;  3N42 B;  4LH6 A;  4EFB A;  2WE6 A;  1BGW A;  1HNX H;  3FMA A;  3V4Z A;  3HOV G;  4DR2 H;  4PWQ A;  1O75 A;  2YZN A;  5KFZ A;  3T1Y H;  3M9O B;  3GIM A;  4YR0 A;  4LSA A;  2KSW A;  2YRW A;  4GKJ H;  4XYL B;  1UNN C;  1B6S A;  1KBL A;  4RB1 A;  2R82 A;  1RK5 A;  3M9M B;  2C2E A;  4ECQ A;  4I50 F;  1UC8 A;  5C3E G;  4DV0 H;  2AGO A;  1Y14 B;  5BPH A;  3Q2O A;  3GV5 B;  1HNZ H;  4EGQ A;  4RUC A;  2VR1 A;  1T94 A;  1CQJ B;  5L1J A;  5KFY A;  4IWX A;  3N41 B;  1HNW H;  2R7Z G;  3HKZ E;  4DR1 H;  4QW8 A;  4HYK A;  1IBK H;  3GV7 B;  3HBL A;  2R92 A;  3R5F A;  4A3B G;  5KFI A;  5DLG A;  5KFP A;  2MCT A;  3PZP A;  5FLX W;  4DL7 A;  1AUX A;  2WAQ A;  3H3V H;  3GTG A;  5KT6 A;  5L1K A;  5KG6 A;  4IRC A;  2W9C A;  3EPG A;  4EBC A;  1A9X A;  4DL4 A;  5EOY A;  5DGB A;  4DV3 H;  2YU9 A;  2FMA A;  2R85 A;  4B3T H;  3J80 W;  2J9G A;  3IN5 A;  1GO3 E;  4ECW A;  2FP4 B;  1RJQ A;  1M0T A;  4Q43 A;  4QWE A;  4ME6 A;  1B04 A;  2FJZ A;  5IYZ F;  1KJJ A;  4I55 F;  3JSN A;  4ED2 A;  4DR4 H;  2XCP A;  3K3P A;  1B6R A;  2JA7 G;  4BBS G;  4MV8 A;  5IYB G;  3LML A;  3RV4 A;  3M9N B;  5DGA A;  2C2R A;  2FLP A;  4DL3 A;  1Y1V A;  2V4Q A;  5C1P A;  4IRK A;  3GTQ A;  1X9N A;  2W9B A;  4L1K A;  1ULZ A;  1EYZ A;  1UC9 A;  3K5H A;  4F4W A;  4APM A;  2W8K A;  1TWA A;  3BA9 A;  3KHH A;  5D1P A;  3ORR A;  2VUG A;  4Q45 A;  2NVX A;  5JVL A;  3H0G A;  4LH7 A;  4A3F G;  4YR3 A;  2Y0S E;  4JI4 H;  5IWA H;  1CE8 A;  4O3P A;  4LF5 H;  1C3O A;  4O2A F;  1VS0 A;  4J0M A;  4M7E A;  4ETS A;  4ED3 A;  2I80 A;  1J5E H;  1OWT A;  2BR0 A;  3GTJ A;  4KHP H;  3V4S A;  4JYA H;  1K83 A;  1PK8 A;  3H20 A;  1GYF A;  3GIK A;  4IWY A;  5T14 A;  4MTE A;  4IRD A;  3MJF A;  4ED1 A;  2F4V H;  1WCM A;  2R84 A;  2XIG A;  2GPW A;  2Q2U A;  3MFI A;  1I50 A;  2C35 B;  4MV7 A;  4J9P A;  3QZ7 A;  4Q8E A;  1S10 A;  3GTM A;  3OHB A;  1Y1W A;  3F8N A;  3H4B A;  2W9A A;  1RYS A;  2R7M A;  5FJ8 G;  3MWE A;  5KG7 A;  1JLL B;  2C00 A;  2JA5 A;  1KJ8 A;  1GSO A;  4ED7 A;  3PW7 A;  2XCL A;  3T5J A;  1ZHQ A;  2DWC A;  2C22 A;  1I94 H;  2FPG B;  1CQI B;  4EBE A;  1V4Y A;  3I4M G;  4XZ3 B;  3PW5 A;  1FKA H;  3MR5 A;  2UUC H;  3MR6 A;  3GID A;  4ECZ A;  4X66 H;  4JI2 H;  2W7P A;  4O3S A;  4GKK H;  1V9P A;  2BQR A;  5C4X G;  5KFH A;  4RAY A;  2RDI A;  1GLV A;  3PW2 A;  4Q44 A;  1TA8 A;  3KXY T;  2JA6 A;  2ZJT A;  3V6K A;  3GIJ A;  5F9L A;  2VUM A;  3HOX G;  2B63 A;  2R8H A;  2V5A A;  3HKZ A;  4J9Q A;  2PN1 A;  2UU9 H;  3RTX A;  1S03 G;  5C5J A;  5KT5 A;  4DR5 H;  4MV3 A;  3PR4 A;  1W96 A;  4YAK B;  4LF4 H;  2IMW P;  1RJR A;  5KG2 A;  3KHG A;  5FD6 A;  2R8K A;  4LF6 H;  4BY7 G;  5EWE A;  3N40 P;  4AYB A;  3RBE A;  3VPB A;  3JAM W;  4EBD A;  2J6U A;  3UQ8 A;  2V9W A;  3GTP A;  1WH2 A;  4BXX G;  1SEI A;  4NXM H;  1I3Q A;  5KG0 A;  5A2Q W;  2JA8 G;  3FKI G;  3RFC A;  1SYX B;  5FPO A;  1WSC A;  2QK4 A;  4YHH H;  2R93 A;  5KX5 F;  1P8L A;  5KFL A;  5KG4 A;  3RGX A;  1N36 H;  2JEG A;  3PN1 A;  4ED0 A;  4EYH B;  1XNQ H;  3JSL A;  3Q8S B;  2JEI A;  3L4J A;  2HGS A;  4EFE A;  4WBN F;  2UUA H;  2JEF A;  2V58 A;  4ECX A;  4A3G G;  5FD5 A;  3RF2 A;  5KG1 A;  3RB6 A;  2J6T A;  5D8D A;  2UUB H;  3SI8 A;  2UXD H;  3I12 A;  1ZQ7 A;  2O03 A;  4A3J G;  3GII A;  3GTO A;  4J9R A;  2R7L A;  3H40 A;  1AN7 A;  4FU0 A;  4QW9 A;  3HOY G;  4J9O A;  1Z2P X;  4MV1 A;  2X0S A;  2FPP B;  2V4R A;  2W71 A;  3JZI A;  1B33 N;  4MTD A;  4JV1 A;  1V51 A;  1E4E B;  2FLN A;  1WR2 A;  2ZDQ A;  3V6H A;  4BWS C;  5LXT F;  4DLK A;  5KFB A;  4RNO A;  2HVR A;  5C44 G;  1JIH A;  1HR0 H;  5D1O B;  2R7K A;  1TAE A;  4EGJ A;  2FLL A;  3I4N G;  2Y0S A;  4R8U B;  4E4T A;  3FDS A;  2UVU A;  2R6F A;  5KG5 A;  2FE3 A;  5CA1 F;  3C0F B;  4C5C A;  2I8C A;  5KFD A;  4A3M G;  4JV5 H;  2E2H A;  4RU9 A;  2VPS A;  5LL6 b;  4RUA A;  3GV8 B;  3GTK A;  2E5L H;  1T36 A;  4Y8V B;  3VMM A;  5K2M A;  1JXL A;  1PX2 A;  5EWF A;  1M7J A;  1S68 A;  4A3D G;  4JI3 H;  5I47 A;  4DR7 H;  3HOZ G;  1KJ9 A;  4WD3 A;  5H80 A;  4LFC H;  2R92 G;  5IP9 G;  3N44 B;  2VOB A;  5KG3 A;  4YAJ B;  2NU7 B;  1TWF A;  5LMN H;  4DUY H;  2DIK A;  2R86 A;  3QFF A;  4TUY F;  5CAE B;  1KEE A;  3Q8P B;  5KFE A;  4JV0 A;  3R5X A;  4XX0 B;  3OUU A;  4YP3 A;  4LMY A;  4O4L F;  2W6O A;  4TV8 F;  5DG7 A;  5KFT A;  3OUZ A;  2NUA B;  2RDJ A;  2WB1 E;  4HR7 A;  3KAK A;  3ETJ A;  4DR6 H;  4G3I A;  1JDB B;  3E5N A;  5KFK A;  2NU8 B;  2HVS A;  3RUP A;  4U7C A;  3G6V A;  4DV4 H;  1I6U A;  2W7O A;  4QWD A;  4XYM B;  2R87 A;  2IBK A;  4DL6 A;  2Q2T A;  2WAQ E;  1VBH A;  1I7N A;  1Y1V G;  3BAA A;  4IZO A;  4DV6 H;  4ECS A;  3TQ1 A;  1JX4 A;  1R9T A;  3GIP A;  2UXC H;  5IYC G;  1DV1 A;  2SCU B;  3T1H H;  5BPF A;  3RJ0 A;  2UVW A;  4RNN A;  2VPQ A;  2W57 A;  4LFB H;  2FB9 A;  1SCU B;  4EEQ A;  1N33 H;  1N56 A;  1E4E A;  3H0G G;  2DLN A;  1T3N A;  2ZDH A;  3RBD A;  1SFO A;  4FBT A;  4ZOL F;  4YQW A;  2C2D A;  4X64 H;  5D1O A;  3G6X A;  5KKN B;  5LYJ F;  1EHI A;  1JKJ B;  1Z2N X;  2RGV A;  3GIQ A;  3WO1 A;  3BQ1 A;  5KFS A;  3VPD A;  2R8G A;  2GLT A;  1EUC B;  4DV5 H;  4FBU A;  5KFM A;  4MA5 A;  4A3E G;  2C28 A;  2NU6 B;  4QIW E;  2DPJ A;  1WCM G;  5LP6 F;  1DIK A;  4GLX A;  4A93 G;  2VA2 A;  4QJF A;  4J9M A;  2HHH H;  2CW8 A;  3CQZ A;  4YR2 A;  3BQ0 A;  1Y1W G;  3AYH B;  3GQC A;  4CC5 A;  1A0I A;  3PR5 B;  3PO2 G;  4DR3 H;  2DPI A;  4JI8 H;  3G8C A;  2JA5 G;  4YBZ B;  1VKZ A;  3IG0 A;  3JRW A;  3OSP A;  3PO3 G;  2RF4 A;  5KFA A;  2FK2 A;  4Q0Y A;  3TIN A;  5KFX A;  3RAX A;  4B3R H;  4B3M H;  1GGO A;  3RB3 A;  4IR1 A;  3BAB A;  4O2B F;  5KFF A;  1KJQ A;  2ZM6 H;  4CC6 A;  4OX9 H;  3VPC A;  3KTM A;  1E4G T;  4ECT A;  4UCO A;  2VA3 A;  4RZQ A;  3K5I A;  4O3R A;  3RGZ A;  2JA6 G;  4O3N A;  1BJT A;  2FK1 A;  1N48 A;  2QYZ A;  3MWD A;  1XDN A;  3HXL A;  2W9B B;  2B63 G;  2VUM G;  2FK3 A;  5IP7 G;  1RYR A;  5KFN A;  4ZI7 F;  4LFA H;  4IAJ A;  2AGP A;  4F4X A;  4FS2 A;  5DG9 A;  4QWB A;  4K0K H;  4A3L G;  1CS0 A;  1W93 A;  3SE7 A;  1S97 A;  4NXN H;  4JUZ A;  3RB0 A;  4HNU A;  2ATL A;  1I7L A;  3MR3 A;  1N32 H;  5KT3 A;  4O3Q A;  4LF9 H;  4X65 H;  5HV6 A;  2ZDG A;  2PMZ E;  1XNR H;  1RJP A;  1KC7 A;  3KHR A;  4BBR G;  5J2U F;  3R23 A;  5J2T F;  5L1L A;  3Q1K A;  2ASD A;  3LWB A;  1N34 H;  4ECY A;  2CQY A;  1VBG A;  2VQF H;  1GSA A;  4RB3 C;  3R5H A;  2DZD A;  2AQ4 A;  3TII A;  4MV6 A;  2R93 G;  4JI1 H;  3UFX B;  2WB1 A;  3L2P A;  1TWG A;  2W8L A;  5DQG A;  3LP8 A;  4UCR A;  5KFC A;  2FPI B;  4UCU A;  4JI6 H;  4ZQI A;  5KFQ A;  4A3C G;  3GIL A;  2ALZ A;  4EG0 A;  4GC6 A;  2JEJ A;  3ETH A;  3OSN A;  3CVZ A;  2JA7 A;  2RGR A;  5FPR A;  2BQ3 A;  4I4T F;  3J81 W;  5F9N A;  4UCV A;  3NGD A;  3T5H A;  3U9S A;  3OHA A;  4AYB E;  2UVV A;  1BXR A;  4Q8F A;  2YYA A;  3TQT A;  2XGQ A;  3MFH A;  1IOW A;  1DGS A;  5GON F;  1K1S A;  4DV2 H;  2YCH A;  1XMQ H;  3N43 B;  4ECU A;  4DL2 A;  1ZET A;  1S0N A;  5KT7 A;  3J7A K;  3OTO H;  3RV3 A;  1BNC A;  2XGP A;  3EPI A;  4QWA A;  4DUZ H;  3T5L A;  2BQU A;  4LF7 H;  2WTF A;  2W6Q A;  1L2Z A;  3MWM A;  2YZG A;  2PBZ A;  3PW0 A;  2YZM A;  3TIG A;  5CA0 F;  3RAQ A;  1EZ1 A;  2VQD A;  3MR2 A;  3PVX A;  3KHL A;  4O4I F;  3GTL A;  1EUD B;  1DV2 A;  4O4H F;  4O3O A;  1GSH A;  2E2I A;  1VAJ A;  2XD4 A;  2M05 A;  1K1Q A;  3QZ8 A;  4DV1 H;  4QIW A;  5KFU A;  4C5B A;  4ECV A;  5DLF A;  4JV2 A;  4F4Z A;  3HOW G;  1C30 A;  4R7R A;  4RB0 A;  4UFZ A;  4RZR A;  4TQS A;  4B3S H;  2I87 A;  2WYO A;  2R8J A;  5BR8 H;  2YRX A;  5EDW A;  4RAZ A;  4RNM A;  3EYY A;  4QWC A;  3Q8R B;  5JVD F;  3WNZ A;  4IR9 A;  2W6M A;  4A2A A;  4LF8 H;  5KFG A;  4ECR A;  3T5K A;  3JRX A;  1AUV A;  3WO0 A;  4ZHQ F;  2OLS A;  1FJG H;  3K3V A;  4HNV A;  1Z2O X;  2HVQ A;  2R7N A;  2YS7 A;  3KAJ A;  5KT4 A;  4TQR A;  5LMU H;  4X62 H;  1XMO H;  2UXB H;  2HJW A;  4FS1 A;  4C5A A;  4J9N A;  2V59 A;  4MA0 A;  2YL2 A;  1S0M A;  4JI7 H;  2WDT A;  4UCS A;  5KFV A;  5CB4 F;  5KFO A;  1S0O A;  5DG8 A;  5IYD G;  2GPS A;  4C2M A;  5KFJ A;  2NVY A;  4FM9 A;  4R8U A;  1IOV A;  3GLK A;  4NLG A;  4MV9 A;  2AU0 A;  5IT9 W;  3BJY A;  2NU9 B;  3BQ2 A;  4JI0 H;  3G6Y A;  4YB8 B;  4DL5 A;  2PVP A;  3PW4 A;  2OWO A;  4LSX A;  4YY3 H;  4UCT A; 
#chains in the Genus database with same CATH homology
 1BJT A;  3BA9 A;  5D1P A;  3BA8 A;  3L4K A;  2VUG A;  1IBM H;  1XDN A;  2FE3 A;  3HXL A;  3C0F B;  4I7H A;  4LFA H;  4JV5 H;  4JI4 H;  4LH7 A;  4IAJ A;  4PDB A;  5IWA H;  2VPS A;  5LL6 b;  4RB2 C;  4LF5 H;  2E5L H;  4KHP H;  4K0K H;  4NXN H;  1VS0 A;  4J0M A;  4M7E A;  4ETS A;  4AQY H;  1FVI A;  3KAL A;  1J5E H;  1S68 A;  4JI3 H;  4DR7 H;  3RIZ A;  1N32 H;  4LF9 H;  4LFC H;  4X65 H;  4JYA H;  3H20 A;  3N44 B;  2VOB A;  4A2B A;  1XNR H;  1GYF A;  4MTE A;  2F4V H;  2XIG A;  1N34 H;  2Q2U A;  5LMN H;  4DUY H;  4MV7 A;  2VQF H;  4JI5 H;  4RB3 C;  3M4I A;  3F8N A;  4APM A;  4JI1 H;  1IBL H;  3L2P A;  4LMY A;  4JI6 H;  1E4F T;  4UCR A;  4UCU A;  4DV7 H;  3DF7 A;  2CW7 A;  1ZHS A;  1ZHQ A;  4YY3 H;  1MZB A;  1I94 H;  2VQE H;  1M0W A;  3N6X A;  3CVZ A;  3KAK A;  2RGR A;  3N42 B;  1FKA H;  4DR6 H;  4LH6 A;  5FPR A;  2UUC H;  3J81 W;  4EFB A;  2WE6 A;  1BGW A;  4UCV A;  3FMA A;  4X66 H;  1HNX H;  4JI2 H;  2HVS A;  4GKK H;  4DR2 H;  4DV4 H;  1O75 A;  1V9P A;  3T1Y H;  4LSA A;  2KSW A;  4GKJ H;  1I6U A;  4RAY A;  1DGS A;  4RB1 A;  2Q2T A;  1TA8 A;  3KXY T;  3BAA A;  4DV6 H;  4DV2 H;  2YCH A;  1XMQ H;  3N43 B;  2ZJT A;  4DV0 H;  3J7A K;  2UXC H;  3OTO H;  1HNZ H;  4DUZ H;  3T1H H;  3RJ0 A;  4LF7 H;  2W57 A;  1L2Z A;  2UU9 H;  3MWM A;  3RTX A;  1S03 G;  4LFB H;  4DR5 H;  4EEQ A;  3N41 B;  1HNW H;  1N33 H;  4LF4 H;  4LF6 H;  4DR1 H;  5FD6 A;  1IBK H;  3N40 P;  3JAM W;  3UQ8 A;  1WH2 A;  1SEI A;  3RGZ A;  2MCT A;  5D1O A;  4X64 H;  4NXM H;  1Z2N X;  2RGV A;  5FLX W;  4DV1 H;  5A2Q W;  4B3S H;  4R7R A;  4RB0 A;  4UFZ A;  1SYX B;  4DV5 H;  5FPO A;  2WYO A;  5BR8 H;  4YHH H;  4RAZ A;  1P8L A;  5EOY A;  4GLX A;  1N36 H;  3EYY A;  3RGX A;  4DV3 H;  3PN1 A;  2HHH H;  1XNQ H;  4B3T H;  3JSL A;  3J80 W;  2CW8 A;  3L4J A;  2HGS A;  4A2A A;  4EFE A;  2UUA H;  4LF8 H;  5FD5 A;  1A0I A;  4CC5 A;  3RF2 A;  4DR3 H;  4JI8 H;  1FJG H;  2UUB H;  3K3V A;  1M0T A;  1Z2O X;  2HVQ A;  3KAJ A;  5LMU H;  1XMO H;  2UXB H;  4X62 H;  3IG0 A;  2UXD H;  1B04 A;  2O03 A;  3JSN A;  4DR4 H;  4Q0Y A;  4JI7 H;  2WDT A;  4UCS A;  4B3M H;  4B3R H;  1AN7 A;  1Z2P X;  3BAB A;  3LML A;  4OX9 H;  2ZM6 H;  4CC6 A;  4MTD A;  4FM9 A;  4MV9 A;  1E4G T;  5IT9 W;  4JI0 H;  4UCO A;  4BWS C;  1X9N A;  2OWO A;  4RZQ A;  2HVR A;  1HR0 H;  5D1O B;  4LSX A;  1TAE A;  4UCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...