1SYXB

The crystal structure of a binary u5 snrnp complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/immune system
molecule keywords Spliceosomal U5 snRNP-specific 15 kDa protein
publication title Structural basis for the bifunctionality of the U5 snRNP 52K protein (CD2BP2).
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 62
sequence length 62
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2004-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1syxB00
3FMAA 1GYFA 4BWSC 1WH2A 1L2ZA 1SYXB 3K3VA
chains in the Genus database with same CATH superfamily
4Q43A 3H20A 1TWFA 3PW5A 2ZJTA 1ZQ7A 5KFOA 1FKAH 2OH2A 4O3QA 3MR3A 2R93A 1JIHA 3GV5B 2W9CA 4A3DG 2PBZA 2VUMA 2JA6G 1T94A 3V4SA 5CA0F 4A3LG 1HNZH 4EFBA 1RYRA 4ECTA 1FVIA 5KG1A 2I80A 5FPRA 1UC9A 4EG0A 4QW8A 5I47A 5KFPA 4J9NA 2FK1A 4DV3H 4ECZA 5K2MA 1S68A 2W7OA 5BPHA 1KJ8A 2C2RA 2UVVA 2RDIA 4RZQA 1N32H 3R5HA 5FD5A 2YZGA 3RBEA 4LFCH 5EOYA 1W96A 1WR2A 4A2AA 4UCRA 4YAKB 4ED8A 2FLLA 5KG2A 3WO0A 5KFWA 5DLGA 3M9NB 3PO2G 1M6VA 2XGQA 3G6VA 4YR0A 5L1JA 1RYSA 2IMWP 4EGJA 4DL2A 4DV1H 1E4GT 1Z2NX 4ECVA 4AQYH 3TINA 1WCMA 5EWEA 4C2MA 1S97A 2DPJA 2DZDA 4LF6H 2ALZA 2FLPA 4MTDA 4EBDA 4O4LF 5C4XG 4DV6H 5KFRA 4DL3A 3RV3A 4B3SH 3I4NG 1DIKA 2FPGB 1RJPA 4HNUA 3BQ2A 4RB3C 4DLKA 4ED2A 2WYOA 1DV2A 1HNWH 2YRWA 4JV0A 4HR7A 3IN5A 4YB8B 5CB4F 3RFCA 3SI8A 4A3CG 2Y0SA 4GLXA 1M7JA 3BA8A 1Y1VA 5JVLA 1B33N 2XCPA 4MV4A 3OHAA 2C2DA 2WE6A 4ED7A 2B63G 4A3JG 2JEFA 4LF4H 3GTMA 2NVXA 2JEIA 1N36H 3RV4A 4U6PA 3KHHA 1EUCB 1O75A 1UC8A 2R85A 5D8DA 4TQRA 4XYLB 3KXYT 3R23A 3GIPA 4ED3A 4K0KH 4TV9F 4RUAA 3FKIG 1IBKH 4ECUA 3Q8SB 3T5JA 2FB9A 5EZYF 2W6PA 2FK3A 2UXCH 1GSAA 4MV6A 3Q2OA 4GC6A 2FK2A 4AYBA 4ED6A 1SYXB 1B6SA 5EWGA 3AYHB 5IP7G 1S0NA 1RJQA 4RB0A 4M9UA 4DR5H 1HR0H 5KFAA 1GYFA 1EUDB 1M0TA 2WAQA 2YZMA 3HOUG 5LMNH 1IBLH 2BQRA 2KSWA 5JUMA 2C22A 2WDTA 2W6NA 4YQWA 3MR6A 5KT4A 4O3NA 3G6YA 1RJRA 3RBDA 4JI6H 5BR8H 4J9SA 4JUZA 3JRWA 4DL5A 4QW9A 3V4ZA 4QIWA 5KFQA 4TQSA 3PR4A 3GLKA 1S10A 2W9CB 2NVYA 1GO3E 2WB1E 1IOWA 3GIDA 3Q1KA 1J5EH 4B3MH 4FS1A 4QWCA 2C00A 3EPGA 3GTQA 3RF2A 3PN1A 5DQHA 5DQGA 4R8UB 3KAJA 3MJFA 4XZ3B 4DV0H 4EEYA 2YCHA 3V6JA 2B63A 4BY1G 4J9MA 5F9LA 2Y0SE 4F4WA 3V6HA 3PR5B 1OWTA 5FD6A 2JEJA 5KT7A 4J9PA 4LFAH 1GGOA 1V51A 4QWAA 4LFBH 3GTOA 1B6RA 4DR3H 5C1PA 2UVWA 3N6XA 3UQ8A 2ZDHA 3BA9A 5DGBA 4LF9H 4MV7A 4C5BA 4IRKA 2R92G 3WNZA 4J9QA 5EWFA 1ZHSA 2QK4A 1SFOA 2FPPB 4QWDA 4F4YA 5EDWA 2FPIB 2FKLA 3TIGA 4I7HA 3U9TA 4UCVA 4KHPH 4MV3A 3HOVG 2ZDGA 4M7EA 1KJIA 5KFIA 4RNNA 3GIIA 2HVSA 2FLNA 1I3QA 5BMVF 2YZNA 2R7KA 3TQTA 3HBLA 1FJGH 2W8LA 2W71A 5L9XA 2W7PA 1N56A 4AYBE 4U7CA 4G3IA 4UCTA 3BQ1A 3T1YH 2VQDA 2XC9A 4BXXG 4EBCA 2BR0A 2WAQE 5GONF 4RB2C 1P8LA 2X0SA 3LP8A 4GKKH 3RTXA 4DL6A 5J2UF 3OTOH 3M9MB 4A3MG 4FS2A 3GTPA 3HB9A 4O3OA 4APMA 2V9WA 1C30A 1ZHQA 3M9OB 3GV8B 2J6TA 3VPCA 3HOWG 4QIWE 4J0MA 4JV2A 3PZPA 5DGAA 2W70A 5IT9W 2XD4A 4MV8A 4F50A 4E4TA 5KG0A 2W57A 5DG9A 4ED1A 2I87A 3T5LA 4GKJH 2YS6A 2HHHH 5FLXW 2VA2A 4BY7G 3R5FA 4ECXA 1K1QA 3JAMW 2NUAB 2VUGA 4IWYA 1JX4A 1N33H 1KJJA 1E4EA 3EYYA 4A2BA 3T5KA 4Q45A 2BQ3A 5CA1F 2HVQA 4JI5H 3GILA 2J6SA 2R92A 5JH7F 5FJ8G 2BQUA 4UCUA 3LMLA 4ZOLF 2QYZA 4O3PA 4J9RA 1X9NA 4FU0A 3TQ1A 4RAYA 2DPIA 2WB1A 2V58A 3ORQA 2NU8B 4BWSC 4MTEA 3GIMA 4RB1A 1DGSA 1VKZA 5IWAH 2V4QA 1S0OA 1A0IA 5KFMA 5C5JA 1MZBA 3ORRA 5D1OB 2W8KA 3RB3A 5C1OA 2RGRA 4MA0A 4CC6A 2W6MA 3KHLA 4UFZA 2IP4A 3N40P 2R7ZG 2GPWA 5KFFA 1BXRA 3I4MG 1SEIA 1AUXA 2ZM6H 4DR2H 3RAQA 5KT6A 3VMMA 3J81W 4IWXA 2E5LH 5KFJA 2R82A 2YS7A 2DWCA 2XGPA 4QWEA 3BG5A 4DL4A 1WH2A 2M05A 3OSNA 4ECSA 3GTKA 1VAJA 2R7MA 3MR2A 4EBEA 1KEEA 3VPDA 5KFCA 1XMOH 2R8GA 1Z2PX 2PN1A 2AGQA 2E2IA 1WSCA 3TIIA 3JRXA 2VQEH 3T1HH 5KKNB 2NU6B 5LP6F 4MA5A 5KFGA 4IR9A 4ME6A 4RZRA 4RUCA 3KHGA 5KFVA 1T3NA 3CQZA 3T5HA 4TV8F 3K3PA 1GSOA 1KBLA 3MFIA 3J7AK 3G6XA 2YYAA 1EYZA 4FBTA 4A3IG 4O3SA 4ZQIA 1DV1A 4TUYF 4HNTA 5KFBA 3OHBA 4ECWA 4I50F 4JI3H 4DR6H 3GTJA 1CQIB 4MAMA 2JA8G 2DIKA 2FP4B 2V5AA 2DLNA 4EEQA 4F4XA 1V4YA 5HV6A 4DV5H 2C28A 3H3VH 2R8JA 1RK5A 4JV5H 4J9LA 5DG7A 2JA5A 1GSHA 3HKZE 2XIGA 3L4KA 1W93A 2PVPA 3JZIA 5A2QW 5FLMG 2O03A 4LF5H 3GTGA 3PW2A 3RB0A 4MV9A 1S0MA 4IZOA 3BABA 2R7ZA 4LH7A 1PX2A 5JVDF 4PWQA 4ZI7F 3HOZG 4FBUA 4RU9A 4JV1A 2R8IA 4NLGA 2W6ZA 4F4ZA 3KTMA 1EHIA 4WBNF 1PK8A 3FMAA 3PVXA 4WD3A 2UVUA 5IYCG 4JYAH 1BNCA 1IBMH 2R8KA 1TAEA 5KFDA 1N34H 1S9FA 5KFZA 2ASDA 1XMQH 4LMYA 3QFFA 4EYHB 2UUCH 2WTFA 1K1SA 5KFHA 1I50A 4YHHH 5D1PA 5T14A 1JKJB 1JDEA 3QZ7A 4B3TH 1ULZA 2R7LA 2XCAA 3EPIA 2FJZA 2RF4A 3KAKA 1TWGA 3GIJA 2Q2TA 5IYDG 2R84A 3Q8RB 4O2AF 5KFKA 4DUYH 2R86A 4DUZH 4DR1H 2F4VH 5DG8A 3E5NA 2VQFH 4J9OA 1EZ1A 4A3KG 1AN7A 2W9AA 1K83A 4DV4H 3GIQA 1KC7A 3GQCA 2I8CA 5HBRB 2JEGA 4IR1A 5LA6F 5KFLA 1RK6A 1I7NA 4A3FG 4ECYA 1ZETA 5FPOA 5CAEB 5KX5F 4IRDA 3C0FB 4YAJB 5F9NA 2OWOA 2SCUB 4HQ6A 5KT5A 3LWBA 3U9SA 5LL6b 2NU7B 5IYBG 2Q2UA 4BBSG 3N42B 3H4DA 2YL2A 4XYMB 4JI1H 1T36A 2W6OA 4X65H 4JI4H 1Y14B 4OX9H 3N43B 3M4IA 1TA8A 2IA6A 3L2PA 3KALA 4Q8EA 1VS0A 5BPFA 3MWEA 1L2ZA 2NU9B 5C8YF 3QZ8A 2YU9A 4A3GG 3PW7A 2CW8A 3UFXB 2UUAH 4HYKA 4DR4H 3MFHA 1N48A 2UXDH 2VA3A 3HKZA 2VOBA 1TWCA 4R8UA 2UUBH 4YJ3F 5KFEA 2FMAA 4XX0B 3RGXA 2ATLA 2FE3A 1BJTA 2CQYA 1B04A 2V59A 4O4IF 3RIZA 3J80W 2JA5G 5KFTA 2OLSA 5KFSA 2J9GA 2XCLA 4YBZB 3RUPA 1I94H 2PMZA 4I55F 2UU9H 4RNMA 2R7NA 2J6UA 2ASLA 4LSAA 2CW7A 1JLLB 3N8DA 3PO3G 1SCUB 2AQ4A 2RDJA 4CC5A 1TWHA 4JI0H 5KFXA 5LMUH 4YP3A 5JQWA 1I7LA 2W6QA 3PW4A 1TWAA 3MR5A 4JI7H 4PDBA 4NXNH 3VPBA 4MV1A 3H40A 3WO1A 2ASJA 1CE8A 3BJYA 2AGOA 3GIKA 2R6FA 3PW0A 4DV7H 4ECQA 2E2HA 3BAAA 4EGQA 2HGSA 4RAZA 5C3EG 3G8CA 4C5AA 2W9BA 4O2BF 3H0GA 1C3OA 5IP9G 4O4HF 4YY3H 4X66H 4IRCA 1UNNC 3N44B 4JI2H 4A3BG 1R9TA 4LH6A 4I4TF 4ZHQF 3RAXA 5KG5A 4FM9A 4NXMH 1KJ9A 2MCTA 3Q8PB 2UXBH 2VR1A 2JA7G 2V4RA 1XNQH 2VPQA 3JSNA 5L1KA 5DQIA 2JA6A 3NGDA 4C5CA 4BBRG 4YR2A 4DL7A 2HVRA 4IHJF 4R7RA 4ED0A 3IG0A 3N41B 3ETHA 3RGZA 2UVRA 3OSPA 4Q8FA 4X64H 5LYJF 5L1LA 1XDNA 3GV7B 1KJQA 1AUVA 4Y8VB 1S03G 5KG7A 2P0AA 5LOVF 2VPSA 3K5HA 1Y1WG 3I12A 5KG6A 2ZDQA 2GPSA 1BGWA 4EFEA 5L1IA 2RGVA 3KHRA 3HXLA 4UCOA 2PMZE 1E4FT 1IOVA 3CVZA 4O3RA 5KT2A 4EYIB 2CKZB 4YJ2F 3HOXG 1V9PA 1VBHA 5IYZF 1E4EB 3RJ0A 5KFNA 2IBKA 1A9XA 4Q0YA 5KG4A 2C2EA 1XNRH 3JSLA 3L4JA 2R93G 4GC7A 3H4BA 2GLTA 5D1OA 2VUMG 4ETSA 3DF7A 3R5XA 4HNVA 5KG3A 4RNOA 2AU0A 1VBGA 5KFYA 3V6KA 3OUZA 5C44G 4LF7H 2JA7A 5KT3A 2YW2A 3HOYG 3RB6A 4L1KA 2AGPA 2HJWA 4A93G 1JDBB 4JI8H 1GLVA 3ETJA 4UCSA 2R8HA 4A3EG 4B3RH 2YRXA 4LF8H 4QJFA 3FKIA 5KFUA 4YR3A 1M0WA 5DLFA 5LXTF 4QWBA 1WCMG 3K5IA 5H80A 3RB4A 3GTLA 2C35B 4Q44A 1Y1WA 5J2TF 3F8NA 3OUUA 2CZGA 4DV2H 4DR7H 3MWDA 1I6UA 1Z2OX 4J9KA 4LSXA 3K3VA 3MWMA 3BQ0A 4X62H 3FDSA 1JXLA 1CQJB 1CS0A 3H0GG 2W9BB 1HNXH 1Y1VG 4IAJA 3SE7A 3Q8QB 4ECRA 2R87A
chains in the Genus database with same CATH topology
5LMUH 3H20A 4DR6H 2ZJTA 4JI3H 4DR3H 1FKAH 4JI7H 3N6XA 3UQ8A 3BA9A 4LF9H 4NXNH 4PDBA 4MV7A 4EEQA 4DV5H 1ZHSA 4JV5H 1HNZH 4EFBA 4I7HA 4KHPH 1FVIA 4UCVA 5FPRA 4DV7H 2XIGA 4DV3H 3L4KA 4M7EA 5A2QW 2O03A 3BAAA 2HVSA 4LF5H 1S68A 2HGSA 4RAZA 4MV9A 1N32H 4RZQA 5FD5A 4YY3H 4LFCH 4X66H 3BABA 1FJGH 5EOYA 4JI2H 3N44B 4LH7A 4LH6A 4A2AA 4UCRA 4UCTA 3T1YH 4FM9A 4NXMH 2MCTA 2UXBH 1XNQH 4RB2C 1P8LA 3JSNA 3FMAA 4GKKH 3RTXA 2HVRA 4DV1H 1E4GT 1Z2NX 3OTOH 4R7RA 4JYAH 4AQYH 3IG0A 3N41B 1TAEA 4APMA 3RGZA 1IBMH 4LF6H 1N34H 1ZHQA 4MTDA 4X64H 1XMQH 1XDNA 4LMYA 4DV6H 2UUCH 4B3SH 4YHHH 5D1PA 4J0MA 4RB3C 1S03G 2WYOA 1HNWH 4B3TH 2VPSA 5IT9W 2W57A 4GKJH 3KAKA 2Q2TA 2HHHH 5FLXW 1BGWA 4GLXA 3BA8A 4EFEA 4DUYH 2RGVA 3JAMW 4DUZH 3HXLA 2VUGA 4UCOA 1N33H 1E4FT 2WE6A 4DR1H 2F4VH 3CVZA 3EYYA 2VQFH 1AN7A 4A2BA 4LFAH 4LF4H 2HVQA 4DV4H 4JI5H 1V9PA 1N36H 3RJ0A 1O75A 4UCUA 3LMLA 4Q0YA 1XNRH 3JSLA 3KXYT 3L4JA 1X9NA 4K0KH 4RAYA 5D1OA 5FPOA 4BWSC 4ETSA 3DF7A 3C0FB 4MTEA 2OWOA 4RB1A 1DGSA 1IBKH 5IWAH 2UXCH 1A0IA 5LL6b 1MZBA 5D1OB 2RGRA 4CC6A 1SYXB 2Q2UA 3N42B 4UFZA 4JI1H 4RB0A 3N40P 4DR5H 1HR0H 4JI4H 4X65H 4LF7H 1M0TA 1GYFA 1SEIA 4DR2H 2ZM6H 3N43B 4OX9H 3M4IA 5LMNH 1TA8A 2KSWA 3J81W 1IBLH 2E5LH 2WDTA 3L2PA 3KALA 4JI8H 1VS0A 4UCSA 5BR8H 1WH2A 4JI6H 1L2ZA 4B3RH 4LF8H 1M0WA 2CW8A 1XMOH 2UUAH 4DR4H 2UXDH 1Z2PX 2VOBA 2UUBH 3J7AK 3RGXA 1J5EH 3F8NA 2VQEH 4DV2H 2FE3A 3T1HH 1BJTA 3RIZA 1B04A 3J80W 4B3MH 4DR7H 1I6UA 3RF2A 3PN1A 1Z2OX 4LSXA 3K3VA 3KAJA 3MWMA 4DV0H 1I94H 2YCHA 4X62H 2UU9H 4LSAA 1HNXH 2CW7A 4IAJA 5FD6A 4CC5A 4JI0H 4LFBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMA A;  1GYF A;  4BWS C;  1WH2 A;  1L2Z A;  1SYX B;  3K3V A; 
#chains in the Genus database with same CATH topology
 4Q43 A;  3H20 A;  1TWF A;  3PW5 A;  2ZJT A;  1ZQ7 A;  5KFO A;  1FKA H;  2OH2 A;  4O3Q A;  3MR3 A;  2R93 A;  1JIH A;  3GV5 B;  2W9C A;  4A3D G;  2PBZ A;  2VUM A;  2JA6 G;  1T94 A;  3V4S A;  5CA0 F;  4A3L G;  1HNZ H;  4EFB A;  1RYR A;  4ECT A;  1FVI A;  5KG1 A;  2I80 A;  5FPR A;  1UC9 A;  4EG0 A;  4QW8 A;  5I47 A;  5KFP A;  4J9N A;  2FK1 A;  4DV3 H;  4ECZ A;  5K2M A;  1S68 A;  2W7O A;  5BPH A;  1KJ8 A;  2C2R A;  2UVV A;  2RDI A;  4RZQ A;  1N32 H;  3R5H A;  5FD5 A;  2YZG A;  3RBE A;  4LFC H;  5EOY A;  1W96 A;  1WR2 A;  4A2A A;  4UCR A;  4YAK B;  4ED8 A;  2FLL A;  5KG2 A;  3WO0 A;  5KFW A;  5DLG A;  3M9N B;  3PO2 G;  1M6V A;  2XGQ A;  3G6V A;  4YR0 A;  5L1J A;  1RYS A;  2IMW P;  4EGJ A;  4DL2 A;  4DV1 H;  1E4G T;  1Z2N X;  4ECV A;  4AQY H;  3TIN A;  1WCM A;  5EWE A;  4C2M A;  1S97 A;  2DPJ A;  2DZD A;  4LF6 H;  2ALZ A;  2FLP A;  4MTD A;  4EBD A;  4O4L F;  5C4X G;  4DV6 H;  5KFR A;  4DL3 A;  3RV3 A;  4B3S H;  3I4N G;  1DIK A;  2FPG B;  1RJP A;  4HNU A;  3BQ2 A;  4RB3 C;  4DLK A;  4ED2 A;  2WYO A;  1DV2 A;  1HNW H;  2YRW A;  4JV0 A;  4HR7 A;  3IN5 A;  4YB8 B;  5CB4 F;  3RFC A;  3SI8 A;  4A3C G;  2Y0S A;  4GLX A;  1M7J A;  3BA8 A;  1Y1V A;  5JVL A;  1B33 N;  2XCP A;  4MV4 A;  3OHA A;  2C2D A;  2WE6 A;  4ED7 A;  2B63 G;  4A3J G;  2JEF A;  4LF4 H;  3GTM A;  2NVX A;  2JEI A;  1N36 H;  3RV4 A;  4U6P A;  3KHH A;  1EUC B;  1O75 A;  1UC8 A;  2R85 A;  5D8D A;  4TQR A;  4XYL B;  3KXY T;  3R23 A;  3GIP A;  4ED3 A;  4K0K H;  4TV9 F;  4RUA A;  3FKI G;  1IBK H;  4ECU A;  3Q8S B;  3T5J A;  2FB9 A;  5EZY F;  2W6P A;  2FK3 A;  2UXC H;  1GSA A;  4MV6 A;  3Q2O A;  4GC6 A;  2FK2 A;  4AYB A;  4ED6 A;  1SYX B;  1B6S A;  5EWG A;  3AYH B;  5IP7 G;  1S0N A;  1RJQ A;  4RB0 A;  4M9U A;  4DR5 H;  1HR0 H;  5KFA A;  1GYF A;  1EUD B;  1M0T A;  2WAQ A;  2YZM A;  3HOU G;  5LMN H;  1IBL H;  2BQR A;  2KSW A;  5JUM A;  2C22 A;  2WDT A;  2W6N A;  4YQW A;  3MR6 A;  5KT4 A;  4O3N A;  3G6Y A;  1RJR A;  3RBD A;  4JI6 H;  5BR8 H;  4J9S A;  4JUZ A;  3JRW A;  4DL5 A;  4QW9 A;  3V4Z A;  4QIW A;  5KFQ A;  4TQS A;  3PR4 A;  3GLK A;  1S10 A;  2W9C B;  2NVY A;  1GO3 E;  2WB1 E;  1IOW A;  3GID A;  3Q1K A;  1J5E H;  4B3M H;  4FS1 A;  4QWC A;  2C00 A;  3EPG A;  3GTQ A;  3RF2 A;  3PN1 A;  5DQH A;  5DQG A;  4R8U B;  3KAJ A;  3MJF A;  4XZ3 B;  4DV0 H;  4EEY A;  2YCH A;  3V6J A;  2B63 A;  4BY1 G;  4J9M A;  5F9L A;  2Y0S E;  4F4W A;  3V6H A;  3PR5 B;  1OWT A;  5FD6 A;  2JEJ A;  5KT7 A;  4J9P A;  4LFA H;  1GGO A;  1V51 A;  4QWA A;  4LFB H;  3GTO A;  1B6R A;  4DR3 H;  5C1P A;  2UVW A;  3N6X A;  3UQ8 A;  2ZDH A;  3BA9 A;  5DGB A;  4LF9 H;  4MV7 A;  4C5B A;  4IRK A;  2R92 G;  3WNZ A;  4J9Q A;  5EWF A;  1ZHS A;  2QK4 A;  1SFO A;  2FPP B;  4QWD A;  4F4Y A;  5EDW A;  2FPI B;  2FKL A;  3TIG A;  4I7H A;  3U9T A;  4UCV A;  4KHP H;  4MV3 A;  3HOV G;  2ZDG A;  4M7E A;  1KJI A;  5KFI A;  4RNN A;  3GII A;  2HVS A;  2FLN A;  1I3Q A;  5BMV F;  2YZN A;  2R7K A;  3TQT A;  3HBL A;  1FJG H;  2W8L A;  2W71 A;  5L9X A;  2W7P A;  1N56 A;  4AYB E;  4U7C A;  4G3I A;  4UCT A;  3BQ1 A;  3T1Y H;  2VQD A;  2XC9 A;  4BXX G;  4EBC A;  2BR0 A;  2WAQ E;  5GON F;  4RB2 C;  1P8L A;  2X0S A;  3LP8 A;  4GKK H;  3RTX A;  4DL6 A;  5J2U F;  3OTO H;  3M9M B;  4A3M G;  4FS2 A;  3GTP A;  3HB9 A;  4O3O A;  4APM A;  2V9W A;  1C30 A;  1ZHQ A;  3M9O B;  3GV8 B;  2J6T A;  3VPC A;  3HOW G;  4QIW E;  4J0M A;  4JV2 A;  3PZP A;  5DGA A;  2W70 A;  5IT9 W;  2XD4 A;  4MV8 A;  4F50 A;  4E4T A;  5KG0 A;  2W57 A;  5DG9 A;  4ED1 A;  2I87 A;  3T5L A;  4GKJ H;  2YS6 A;  2HHH H;  5FLX W;  2VA2 A;  4BY7 G;  3R5F A;  4ECX A;  1K1Q A;  3JAM W;  2NUA B;  2VUG A;  4IWY A;  1JX4 A;  1N33 H;  1KJJ A;  1E4E A;  3EYY A;  4A2B A;  3T5K A;  4Q45 A;  2BQ3 A;  5CA1 F;  2HVQ A;  4JI5 H;  3GIL A;  2J6S A;  2R92 A;  5JH7 F;  5FJ8 G;  2BQU A;  4UCU A;  3LML A;  4ZOL F;  2QYZ A;  4O3P A;  4J9R A;  1X9N A;  4FU0 A;  3TQ1 A;  4RAY A;  2DPI A;  2WB1 A;  2V58 A;  3ORQ A;  2NU8 B;  4BWS C;  4MTE A;  3GIM A;  4RB1 A;  1DGS A;  1VKZ A;  5IWA H;  2V4Q A;  1S0O A;  1A0I A;  5KFM A;  5C5J A;  1MZB A;  3ORR A;  5D1O B;  2W8K A;  3RB3 A;  5C1O A;  2RGR A;  4MA0 A;  4CC6 A;  2W6M A;  3KHL A;  4UFZ A;  2IP4 A;  3N40 P;  2R7Z G;  2GPW A;  5KFF A;  1BXR A;  3I4M G;  1SEI A;  1AUX A;  2ZM6 H;  4DR2 H;  3RAQ A;  5KT6 A;  3VMM A;  3J81 W;  4IWX A;  2E5L H;  5KFJ A;  2R82 A;  2YS7 A;  2DWC A;  2XGP A;  4QWE A;  3BG5 A;  4DL4 A;  1WH2 A;  2M05 A;  3OSN A;  4ECS A;  3GTK A;  1VAJ A;  2R7M A;  3MR2 A;  4EBE A;  1KEE A;  3VPD A;  5KFC A;  1XMO H;  2R8G A;  1Z2P X;  2PN1 A;  2AGQ A;  2E2I A;  1WSC A;  3TII A;  3JRX A;  2VQE H;  3T1H H;  5KKN B;  2NU6 B;  5LP6 F;  4MA5 A;  5KFG A;  4IR9 A;  4ME6 A;  4RZR A;  4RUC A;  3KHG A;  5KFV A;  1T3N A;  3CQZ A;  3T5H A;  4TV8 F;  3K3P A;  1GSO A;  1KBL A;  3MFI A;  3J7A K;  3G6X A;  2YYA A;  1EYZ A;  4FBT A;  4A3I G;  4O3S A;  4ZQI A;  1DV1 A;  4TUY F;  4HNT A;  5KFB A;  3OHB A;  4ECW A;  4I50 F;  4JI3 H;  4DR6 H;  3GTJ A;  1CQI B;  4MAM A;  2JA8 G;  2DIK A;  2FP4 B;  2V5A A;  2DLN A;  4EEQ A;  4F4X A;  1V4Y A;  5HV6 A;  4DV5 H;  2C28 A;  3H3V H;  2R8J A;  1RK5 A;  4JV5 H;  4J9L A;  5DG7 A;  2JA5 A;  1GSH A;  3HKZ E;  2XIG A;  3L4K A;  1W93 A;  2PVP A;  3JZI A;  5A2Q W;  5FLM G;  2O03 A;  4LF5 H;  3GTG A;  3PW2 A;  3RB0 A;  4MV9 A;  1S0M A;  4IZO A;  3BAB A;  2R7Z A;  4LH7 A;  1PX2 A;  5JVD F;  4PWQ A;  4ZI7 F;  3HOZ G;  4FBU A;  4RU9 A;  4JV1 A;  2R8I A;  4NLG A;  2W6Z A;  4F4Z A;  3KTM A;  1EHI A;  4WBN F;  1PK8 A;  3FMA A;  3PVX A;  4WD3 A;  2UVU A;  5IYC G;  4JYA H;  1BNC A;  1IBM H;  2R8K A;  1TAE A;  5KFD A;  1N34 H;  1S9F A;  5KFZ A;  2ASD A;  1XMQ H;  4LMY A;  3QFF A;  4EYH B;  2UUC H;  2WTF A;  1K1S A;  5KFH A;  1I50 A;  4YHH H;  5D1P A;  5T14 A;  1JKJ B;  1JDE A;  3QZ7 A;  4B3T H;  1ULZ A;  2R7L A;  2XCA A;  3EPI A;  2FJZ A;  2RF4 A;  3KAK A;  1TWG A;  3GIJ A;  2Q2T A;  5IYD G;  2R84 A;  3Q8R B;  4O2A F;  5KFK A;  4DUY H;  2R86 A;  4DUZ H;  4DR1 H;  2F4V H;  5DG8 A;  3E5N A;  2VQF H;  4J9O A;  1EZ1 A;  4A3K G;  1AN7 A;  2W9A A;  1K83 A;  4DV4 H;  3GIQ A;  1KC7 A;  3GQC A;  2I8C A;  5HBR B;  2JEG A;  4IR1 A;  5LA6 F;  5KFL A;  1RK6 A;  1I7N A;  4A3F G;  4ECY A;  1ZET A;  5FPO A;  5CAE B;  5KX5 F;  4IRD A;  3C0F B;  4YAJ B;  5F9N A;  2OWO A;  2SCU B;  4HQ6 A;  5KT5 A;  3LWB A;  3U9S A;  5LL6 b;  2NU7 B;  5IYB G;  2Q2U A;  4BBS G;  3N42 B;  3H4D A;  2YL2 A;  4XYM B;  4JI1 H;  1T36 A;  2W6O A;  4X65 H;  4JI4 H;  1Y14 B;  4OX9 H;  3N43 B;  3M4I A;  1TA8 A;  2IA6 A;  3L2P A;  3KAL A;  4Q8E A;  1VS0 A;  5BPF A;  3MWE A;  1L2Z A;  2NU9 B;  5C8Y F;  3QZ8 A;  2YU9 A;  4A3G G;  3PW7 A;  2CW8 A;  3UFX B;  2UUA H;  4HYK A;  4DR4 H;  3MFH A;  1N48 A;  2UXD H;  2VA3 A;  3HKZ A;  2VOB A;  1TWC A;  4R8U A;  2UUB H;  4YJ3 F;  5KFE A;  2FMA A;  4XX0 B;  3RGX A;  2ATL A;  2FE3 A;  1BJT A;  2CQY A;  1B04 A;  2V59 A;  4O4I F;  3RIZ A;  3J80 W;  2JA5 G;  5KFT A;  2OLS A;  5KFS A;  2J9G A;  2XCL A;  4YBZ B;  3RUP A;  1I94 H;  2PMZ A;  4I55 F;  2UU9 H;  4RNM A;  2R7N A;  2J6U A;  2ASL A;  4LSA A;  2CW7 A;  1JLL B;  3N8D A;  3PO3 G;  1SCU B;  2AQ4 A;  2RDJ A;  4CC5 A;  1TWH A;  4JI0 H;  5KFX A;  5LMU H;  4YP3 A;  5JQW A;  1I7L A;  2W6Q A;  3PW4 A;  1TWA A;  3MR5 A;  4JI7 H;  4PDB A;  4NXN H;  3VPB A;  4MV1 A;  3H40 A;  3WO1 A;  2ASJ A;  1CE8 A;  3BJY A;  2AGO A;  3GIK A;  2R6F A;  3PW0 A;  4DV7 H;  4ECQ A;  2E2H A;  3BAA A;  4EGQ A;  2HGS A;  4RAZ A;  5C3E G;  3G8C A;  4C5A A;  2W9B A;  4O2B F;  3H0G A;  1C3O A;  5IP9 G;  4O4H F;  4YY3 H;  4X66 H;  4IRC A;  1UNN C;  3N44 B;  4JI2 H;  4A3B G;  1R9T A;  4LH6 A;  4I4T F;  4ZHQ F;  3RAX A;  5KG5 A;  4FM9 A;  4NXM H;  1KJ9 A;  2MCT A;  3Q8P B;  2UXB H;  2VR1 A;  2JA7 G;  2V4R A;  1XNQ H;  2VPQ A;  3JSN A;  5L1K A;  5DQI A;  2JA6 A;  3NGD A;  4C5C A;  4BBR G;  4YR2 A;  4DL7 A;  2HVR A;  4IHJ F;  4R7R A;  4ED0 A;  3IG0 A;  3N41 B;  3ETH A;  3RGZ A;  2UVR A;  3OSP A;  4Q8F A;  4X64 H;  5LYJ F;  5L1L A;  1XDN A;  3GV7 B;  1KJQ A;  1AUV A;  4Y8V B;  1S03 G;  5KG7 A;  2P0A A;  5LOV F;  2VPS A;  3K5H A;  1Y1W G;  3I12 A;  5KG6 A;  2ZDQ A;  2GPS A;  1BGW A;  4EFE A;  5L1I A;  2RGV A;  3KHR A;  3HXL A;  4UCO A;  2PMZ E;  1E4F T;  1IOV A;  3CVZ A;  4O3R A;  5KT2 A;  4EYI B;  2CKZ B;  4YJ2 F;  3HOX G;  1V9P A;  1VBH A;  5IYZ F;  1E4E B;  3RJ0 A;  5KFN A;  2IBK A;  1A9X A;  4Q0Y A;  5KG4 A;  2C2E A;  1XNR H;  3JSL A;  3L4J A;  2R93 G;  4GC7 A;  3H4B A;  2GLT A;  5D1O A;  2VUM G;  4ETS A;  3DF7 A;  3R5X A;  4HNV A;  5KG3 A;  4RNO A;  2AU0 A;  1VBG A;  5KFY A;  3V6K A;  3OUZ A;  5C44 G;  4LF7 H;  2JA7 A;  5KT3 A;  2YW2 A;  3HOY G;  3RB6 A;  4L1K A;  2AGP A;  2HJW A;  4A93 G;  1JDB B;  4JI8 H;  1GLV A;  3ETJ A;  4UCS A;  2R8H A;  4A3E G;  4B3R H;  2YRX A;  4LF8 H;  4QJF A;  3FKI A;  5KFU A;  4YR3 A;  1M0W A;  5DLF A;  5LXT F;  4QWB A;  1WCM G;  3K5I A;  5H80 A;  3RB4 A;  3GTL A;  2C35 B;  4Q44 A;  1Y1W A;  5J2T F;  3F8N A;  3OUU A;  2CZG A;  4DV2 H;  4DR7 H;  3MWD A;  1I6U A;  1Z2O X;  4J9K A;  4LSX A;  3K3V A;  3MWM A;  3BQ0 A;  4X62 H;  3FDS A;  1JXL A;  1CQJ B;  1CS0 A;  3H0G G;  2W9B B;  1HNX H;  1Y1V G;  4IAJ A;  3SE7 A;  3Q8Q B;  4ECR A;  2R87 A; 
#chains in the Genus database with same CATH homology
 5LMU H;  3H20 A;  4DR6 H;  2ZJT A;  4JI3 H;  4DR3 H;  1FKA H;  4JI7 H;  3N6X A;  3UQ8 A;  3BA9 A;  4LF9 H;  4NXN H;  4PDB A;  4MV7 A;  4EEQ A;  4DV5 H;  1ZHS A;  4JV5 H;  1HNZ H;  4EFB A;  4I7H A;  4KHP H;  1FVI A;  4UCV A;  5FPR A;  4DV7 H;  2XIG A;  4DV3 H;  3L4K A;  4M7E A;  5A2Q W;  2O03 A;  3BAA A;  2HVS A;  4LF5 H;  1S68 A;  2HGS A;  4RAZ A;  4MV9 A;  1N32 H;  4RZQ A;  5FD5 A;  4YY3 H;  4LFC H;  4X66 H;  3BAB A;  1FJG H;  5EOY A;  4JI2 H;  3N44 B;  4LH7 A;  4LH6 A;  4A2A A;  4UCR A;  4UCT A;  3T1Y H;  4FM9 A;  4NXM H;  2MCT A;  2UXB H;  1XNQ H;  4RB2 C;  1P8L A;  3JSN A;  3FMA A;  4GKK H;  3RTX A;  2HVR A;  4DV1 H;  1E4G T;  1Z2N X;  3OTO H;  4R7R A;  4JYA H;  4AQY H;  3IG0 A;  3N41 B;  1TAE A;  4APM A;  3RGZ A;  1IBM H;  4LF6 H;  1N34 H;  1ZHQ A;  4MTD A;  4X64 H;  1XMQ H;  1XDN A;  4LMY A;  4DV6 H;  2UUC H;  4B3S H;  4YHH H;  5D1P A;  4J0M A;  4RB3 C;  1S03 G;  2WYO A;  1HNW H;  4B3T H;  2VPS A;  5IT9 W;  2W57 A;  4GKJ H;  3KAK A;  2Q2T A;  2HHH H;  5FLX W;  1BGW A;  4GLX A;  3BA8 A;  4EFE A;  4DUY H;  2RGV A;  3JAM W;  4DUZ H;  3HXL A;  2VUG A;  4UCO A;  1N33 H;  1E4F T;  2WE6 A;  4DR1 H;  2F4V H;  3CVZ A;  3EYY A;  2VQF H;  1AN7 A;  4A2B A;  4LFA H;  4LF4 H;  2HVQ A;  4DV4 H;  4JI5 H;  1V9P A;  1N36 H;  3RJ0 A;  1O75 A;  4UCU A;  3LML A;  4Q0Y A;  1XNR H;  3JSL A;  3KXY T;  3L4J A;  1X9N A;  4K0K H;  4RAY A;  5D1O A;  5FPO A;  4BWS C;  4ETS A;  3DF7 A;  3C0F B;  4MTE A;  2OWO A;  4RB1 A;  1DGS A;  1IBK H;  5IWA H;  2UXC H;  1A0I A;  5LL6 b;  1MZB A;  5D1O B;  2RGR A;  4CC6 A;  1SYX B;  2Q2U A;  3N42 B;  4UFZ A;  4JI1 H;  4RB0 A;  3N40 P;  4DR5 H;  1HR0 H;  4JI4 H;  4X65 H;  4LF7 H;  1M0T A;  1GYF A;  1SEI A;  4DR2 H;  2ZM6 H;  3N43 B;  4OX9 H;  3M4I A;  5LMN H;  1TA8 A;  2KSW A;  3J81 W;  1IBL H;  2E5L H;  2WDT A;  3L2P A;  3KAL A;  4JI8 H;  1VS0 A;  4UCS A;  5BR8 H;  1WH2 A;  4JI6 H;  1L2Z A;  4B3R H;  4LF8 H;  1M0W A;  2CW8 A;  1XMO H;  2UUA H;  4DR4 H;  2UXD H;  1Z2P X;  2VOB A;  2UUB H;  3J7A K;  3RGX A;  1J5E H;  3F8N A;  2VQE H;  4DV2 H;  2FE3 A;  3T1H H;  1BJT A;  3RIZ A;  1B04 A;  3J80 W;  4B3M H;  4DR7 H;  1I6U A;  3RF2 A;  3PN1 A;  1Z2O X;  4LSX A;  3K3V A;  3KAJ A;  3MWM A;  4DV0 H;  1I94 H;  2YCH A;  4X62 H;  2UU9 H;  4LSA A;  1HNX H;  2CW7 A;  4IAJ A;  5FD6 A;  4CC5 A;  4JI0 H;  4LFB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...