4I7HA

Structural basis for peroxide sensing and gene regulation by perr from streptococcus pyogenes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
DIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVCEICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peroxide stress sensing regulator
publication title Crystal Structure of Peroxide Stress Regulator from Streptococcus pyogenes Provides Functional Insights into the Mechanism of Oxidative Stress Sensing.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transcription
total genus 38
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i7hA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4i7hA02
2HR3A 2IW5A 2EFWA 4IPAA 5HS9A 3ZN0A 2HEOA 3IL2A 1OR7A 1XDSA 4A12A 2FE3A 2R7FA 1G3TA 2MD5A 1CGPA 2ZBKA 2ZKZA 1GXPA 3PQKA 5E1WA 1QNTA 4WK8F 1QQIA 2F5EA 3KP7A 1J0RA 1FSEA 1LEBA 1TW2A 5L3BA 4MEYF 3ZMVA 3RI4A 1W7PA 4IXAA 2PFBA 2Y48A 3Q5FA 4YFNF 1BIBA 1ON1A 4P9FA 3O6BB 2OZUA 3TDZC 1K7AA 4WF2A 3J81Z 2ESNA 3I59B 3SHFA 1Y0UA 5JVTA 3FXQA 2W25A 2R3SA 2EFNA 1XCBA 3GWZA 1Z05A 3SFZA 4IF4A 3KP5A 4I0AA 2K4BA 1O7LA 2BGCA 2XAQA 2EK5A 2M45A 1KU7A 1JHHA 5L3GA 2OQGA 1D5VA 3SZPA 4HX8A 1YYVA 1O3SA 4OMZA 1R5GA 3GFJA 3WGIA 2PG4A 2G7UA 2QQ9A 2P7VB 5BMZA 3JSOA 3FMQA 3T1BA 4HX7A 1P4XA 1PP8F 3TKYA 2D2WA 2DT5A 4OIQF 4PGGA 5KVRA 4H0EA 4P9UA 1IW7F 4MQVA 3GO5A 3GFMA 2AS5F 2PEXA 3HSRA 5L3CA 2VT3A 1QPMA 3F22A 4KN7X 2D45A 3I54A 1KA8A 1STZA 2ZNZA 1FP2A 1WI9A 3DQVC 1KYWA 3TO9A 3WG9A 3ECHA 2XKPA 3FWEA 3V7SA 4L18B 2QWWA 1LJ9A 5CVUA 5J8FA 4LB6B 3VOEA 3COAC 2ISYA 1HW1A 3OV8A 2ISZA 2O61A 2FQ3A 2KKOA 5F1RA 1KYZA 3I53A 2HKXA 4HDVA 2HQNA 3IWZA 1WWXA 2EJRA 4OIOF 3DPTA 2W84A 4L9JA 5DUKA 3GYHX 4RS8A 4HQEA 1FT9A 5E20A 2OQRA 2H09A 3ABTA 3WU0A 4HLXA 2GZWA 2KIUA 2MH9A 4O5VA 3GXOA 4ZYHA 3HOTA 2GIVA 2YU3A 3RKWA 1BN5A 1SD7A 4S05A 2XAJA 1F4KA 1W7PD 3MQ0A 4YFKF 1ZYRF 3KP2A 3ELKA 4A5MA 1F1ZA 2H6BA 2L4MA 4FX4A 4EJTA 1TQMA 2BBYA 3VODA 1FYKA 1IN7A 5HS8A 2CSOA 4XSZF 2ZNYA 5K5QA 1ZHFA 5DDGA 3SZTA 2Z9OA 2L4AA 3HUGA 4NB5A 4OIRF 2M5WA 2YX4A 3NQOA 2FEZA 2HQRA 4YFXF 4LD5A 3E97A 4M9XA 1U78A 3LA7A 3KLOA 2IVMA 2RGVA 4LK1F 2L54A 3LAPA 2P4WA 1LDDA 3BROA 4HYEA 4G7ZF 1G3SA 2WV0A 4BXUA 3GW2A 1TW3A 1JGSA 1YO5C 3DV8A 2QQBA 2OD5A 1I1GA 2RDPA 1BI2A 4HX4A 2H27A 2XAFA 4A0YA 1MGTA 4Z2YA 3M1EA 3KP4A 3RYPA 4N9IA 3H92A 2E7WA 1SMTA 3H3ZA 3E5UA 3HOSA 2QZ8A 4U7BA 1EV7A 2KJCA 5LHGA 2XUBA 3DXJF 1T0FA 4QLCU 2WTEA 4HF1A 5L3DA 2STTA 4EGYA 1E2XA 4OU0A 4AIJA 5FLXK 2A68F 3CLOA 1U5TA 2O0YA 5LLQA 1BM9A 4M9SA 1RNLA 1TLHB 2Y0MA 3REOA 4AIHA 1XCVA 4GYIA 4KIGA 1U3EM 2G9WA 1Q1HA 4ZH4F 3ZMZA 3WTTC 2O8XA 1BJAA 4EM0B 3QAHA 1VTNC 4ESFA 2NNYA 2QBYA 1TNSA 1ZG1A 4BAYA 4NQWA 1OYWA 3U2RA 1MKMA 3V8JA 1LB2A 3ZMSA 5H6QA 3LQQA 1DP7P 3DF8A 4G7OF 4S04A 4I0BA 1U2WA 3IC7A 1LEAA 5D8KB 1LDKB 3RKYA 4N9HA 1T38A 3P9KA 2CW0F 2XHKA 4N0BA 3LAJA 2F5FA 4JQFA 1J7KA 3WE2A 4WWCA 4R1HA 2K86A 1O3TA 2COMA 1R1UA 1R1TA 1QBJA 3CUOA 3P9CA 1R7JA 4G9YA 3CO6C 1H0MA 4EM2A 1UB9A 1YLFA 2YX7A 4KYWA 2A6EF 4M73A 4L9NA 2XIGA 4PCQA 4BH9A 2CFXA 1TBXA 1HKTA 1IUYA 1OYYA 3MAJA 4XLPF 5FLXZ 5BPIA 3TO6A 2QM3A 5EEHA 3ZN1A 1XGMA 2RKHA 2LF8A 5FFZA 3I59A 2PI0A 3BWGA 2FBKA 1OPCA 3DP7A 2A6HF 2L3DA 3CDHA 4LLNA 1C0WA 2ZJ2A 3FM3A 2EFPA 2VT2A 2OBPA 3HHGA 3D0SA 3QPHA 3T8RA 3I71A 1BIAA 1FC3A 5IT9Z 2JZYA 2NAZA 1KQ9A 1O3RA 4ASNA 2DI3A 5EEGA 2IP2A 3V8KA 3RPQA 1FWZA 2FMYA 2VBZA 5D4SA 5CYVA 4R79A 2WWYA 2IJLA 2E7XA 1B9MA 4ENKA 1R5HA 3KCCA 2DQRA 4KIBA 2TDXA 1IN5A 3MZYA 4U88A 1V3FA 5BPDA 3QRFF 4LLGF 4L9VA 1LQ1A 3ML6A 3U1DA 1YG2A 3R4KA 3V7RA 3BZ6A 4KIFA 2M1BA 1FY7A 2HS5A 2HTJA 5JHUA 3FHZA 3F72A 2J5OA 3ABUA 2LDUA 1AWCA 4WCGA 2KIFA 4AVPA 4I98B 2OU2A 1MDMA 1YFHA 5JFRA 2Z99A 4K2EA 2IA1A 1G3WA 2R7DA 1W5TA 1XMKA 4UHTA 2RNJA 5D4RA 3LWFA 2J5PA 3RKXA 3EYIA 3F6OA 4OINF 2HGCA 4CICA 3FM5A 2EV0A 1J9IA 5CLSA 3JTHA 2E1CA 1ZRFA 2ESHA 4KA4A 1XSVA 4Q47A 4U0WA 5CJ9A 2VE8A 1RZ4A 1A04A 1OKRA 1ZH5A 3SXYA 2Z5UA 4A6EA 3QOPA 3Q9VA 1HSJA 3HRMA 3V7CA 3I0TA 2P5VA 3GFLA 2NYXA 4BYYA 5LEKA 5HDNA 3L9FA 3BDDA 4L0ZB 2A5YB 1P4AA 1J75A 4YG2F 5D5UB 2G7HA 3R60A 5K1YA 3JAMK 3BPVA 2K02A 4D0PA 2VC1A 2H6CA 5LGTA 3C3WA 4LFUA 2HDCA 1SFUA 3ZMUA 5FD6A 1HKSA 1FX7A 4I01A 5F64A 4LG0B 3HYIA 2HZTA 1J59A 2M87A 1PP7U 1EH6A 5ICFA 1O57A 3RTRA 3N4MA 5DEQA 1LVAA 1YTYA 2LKPA 4XSXF 4EM1A 4HQMA 3N97A 1ZARA 4KT5C 2QLZA 3F3XA 1HXDA 1IRFA 4HOBA 5E17F 3MCZA 3BPXA 1Z9CA 2C6YA 1IRGA 5D5WB 2JPBA 2ZCWA 3WU1B 2ZMEA 3FF5A 1S7AA 5K5RA 1I5ZA 3ZMDA 3E3VA 5E1ZB 3R6SA 2DO7A 1R36A 2V79A 4CO8A 1XSXA 1K6OA 2NRAC 5ED4A 1MJBA 2F5DA 4XLNF 1Z7UA 2RV8A 2GA2A 2VODA 2HYFA 4BHPA 2HOEA 3VB2A 1TTYA 5TRDA 3RJPA 1ZRDA 2GXGA 5D8LB 1ZG5A 4MHGA 2NS0A 4LJZF 4E70A 4F7ZA 4UNOA 1WRJA 1SAXA 1MJAA 2VXZA 2O03A 2B0LA 4HV5A 2GAUA 4YIFA 5L3EA 3FMRA 1P4WA 2YSRA 2EA2A 1YW7A 3KP6A 4I7HA 1B6AA 2DU9A 2FMLA 1IXSB 1TQIA 2QUFA 4UVAA 1XMAA 1W4MA 5E8IA 2W24A 5TJJA 2HKOA 2DPUA 2EFQA 1S6LA 5AONA 1S3JA 2UXNA 1T98A 2K27A 3K1MA 4M72A 3MZHA 1QGPA 2W85A 1WSUA 4EJWA 1T39A 1MZBA 5D5XB 4IRIA 1UFMA 4GXOA 3E6BA 2HFHA 3TO7A 2Z3YA 2Q2EA 2AXLA 4G8XA 4HAMA 4I09A 1LDJA 2YR2A 5ICCA 2GQQA 5HLHA 2GXBA 1G3YA 3ZQ7A 4I2OA 1IF1A 3F21A 2DBBA 3ZPLA 4G6QA 5FFXA 3ZP5A 1P2FA 4FX0A 3DPLC 5H6RA 1S7OA 4L0YB 1XSDA 1T2KA 2VE9A 2VOOA 2PMUA 2F2EA 2W57A 3ROUA 4BHBA 3HRTA 4CXFA 4L5JA 1DDNA 5L3FA 4BNCA 4ESJA 4Y17A 2L01A 4IJAA 3ECOA 4A2UA 2D1HA 1ZGAA 3T5XA 2ZO4A 5LHIA 3TQNA 4CHUA 3GZ6A 1H9TA 1FBQA 3K0LA 1Z91A 1CF7A 1R58A 3ZMTA 1U6GA 1I27A 4R8HA 4UVBA 4RGSA 4RGUA 3O2PE 3W6KB 3I64A 3K2ZA 1ZREA 2FNAA 3C18A 4M6YA 2GA1A 1K78A 1I6XA 2PBIA 3E6CC 1V4RA 1OYIA 2A61A 3WE3A 3J80K 2MLGA 2UWMA 3M9AA 3GEZA 2IPQX 5DCFA 2CYYA 2VBXA 1KU9A 1SFEA 1YQAA 5AIQA 3T8TA 2FRHA 1F9NA 1GVJA 3CUQC 4A5NA 3HHHA 2IRFG 2FOKA 2CQKA 2FSWA 3DFGA 3PFIA 1RI7A 2O6GE 1K79A 1EH8A 2P5KA 3M8EA 5FD5A 1PDNC 2H94A 2JSCA 4KMFA 3FXRA 1HBXG 1BC7C 1GXQA 3F8BA 2VC0A 3WTZA 1O3QA 1HQCA 1ZLKA 2FBHA 1QZZA 1FLIA 2CGPA 1R1VA 1RUNA 3KP3A 3KETA 5IT3A 5HS7A 3ISPA 4M71A 3S2WA 2FU4A 3K9TA 4AWXB 2A07F 4MNUA 4CYDA 5ILSA 3QP6A 1XD7A 3TOBA 1SD5A 1KGSA 3IKVA 1AOYA 5K5OA 3B73A 3KEQA 4WXDA 3ERED 1SD6A 5LRRA 3I5UA 4A0XA 4Q5SF 2IA0A 4GGGA 2ADUA 4TV7A 3LFKA 2QYOA 2Q0OA 5BOXA 5H20A 1YIOA 2CG4A 1FBSA 5AIPA 4MTDA 5LHHA 1B4AA 4KFCA 3BJAA 3GX4X 1YW8A 3KZYA 4DQ2A 3J80Z 4DNCA 4LK0F 2LSOA 1J2XA 2YPRA 5LBQA 1F5TA 1D8KA 3L09A 2VN2A 5FO5A 1USSA 3WTYC 2HWVA 3VEPA 5J6XA 4GCVA 2V6CA 3K69A 5D6FA 3J7AO 1FBUA 4IVNA 3W6JB 3RIRA 4WXHA 3KEOA 2MLKA 1SFXA 3QU3A 4AD9A 3GF2A 2P7CB 3BY6A 1IAWA 1RUOA 1H9GA 2VOPA 5DYMA 4OOIA 3IKTA 4UV9A 1FZPB 2V1DA 1R00A 2ETHA 1IXRC 1FNNA 3LA2A 1FPQA 3M7GA 4LGWA 2ZFWA 3HTUA 2V1XA 3QPTA 3DKWA 3L7WA 3GLXA 2FF4A 2DK8A 3EETA 3CTAA 2QVOA 3IRRA 1UHWA 2QBYB 4L5IA 1IN6A 2RVCA 4LG0A 2EV6A 2WC2A 2X4HA 5DCMB 5HLIA 3K1NA 2MBFA 1GHCA 3F6VA 5HVQC 4A6DA 1B9NA 1HSTA 2KJBA 2XVCA 3VFZA 1HW2A 1S8NA 3CUQB 2EWNA 4HDUA 2HTSA 3D5LA 3G73A 2VBYA 1P6RA 5F6FA 1L0OC 2KIMA 4QWQA 3WTXC 1XGOA 4OMYA 3KZZA 4EV0A 3MFKA 4HZFA 4HBLA 4MQ9F 3O3KA 2XKOA 3WTUC 5LRSA 4RGXA 5J8CA 4ZYDA 4Q4ZF 2XROA 4LB5A 1XGSA 2HYGD 2LF7A 1ZAOA 2Q8KA 1IZ1A 4IHSA 4B8XA 1FP1D 1IN4A 2CWEA 2M8EA 4JBAA 4GYGA 3U9GA 3CO7C 5LGNA 3PQJA 2K7LA 1FYMA 3F8CA 1S29A 3F8FA 3EYYA 1OMIA 4RB3C 4G6DA 4RAYA 4EJUA 3E6MA 3JSPA 2CO5A 4G7HF 1D8JA 4JK1X 5JR3A 1T6SA 5HLGA 1IN8A 2P6TA 3RPUA 2DK5A 1G6NA 4IRGA 2A3SA 1BI3A 1LNWA 2DAOA 3M8FA 5DD8A 3P9IA 2EV5A 4CDGA 3F23A 3BOQA 4U0YA 4YIIA 2EA4A 3I4PA 4XBFA 1USTA 2STWA 6PAXA 1E17A 3I58A 2PLYA 3DEUA 2OZ6A 3Q9SA 1L3LA 4Y15A 2P6SA 2BV6A 2Y75A 2LNBA 2FNPA 2QQAA 1O7FA 5LGUA 4HV6A 1XN7A 3F8MA 5ILUA 2PN6A 1KQ0A 4ON0A 2P5LC 1BI0A 4ESBA 4HLYA 2NNNA 1ULYA 1W5SA 3KFWX 3E6DA 2DFIA 1BC8C 1MDMB 5DV5A 5HOOA 1Z6RA 4EQQA 1X3UA 4ZZLA 5DD4A 1W7PB 3IHUA 3HIFA 2RQPA 2DW4A 3FX3A 1QO0D 2PMHA 3NEUA 1UCRA 4Y13A 4EGZA 4ZZDA 4EVIA 4KN4X 4HF0A 3JAMZ 4P55A 1YW9A 4RB1A 1XB4A 5BS6A 3KLNA 3HRSA 4BQAA 4KNYA 2M30A 3QU6A 5ICGA 4KUMA 2JRTA 2K4JA 3IWFA 1J5YA 3WTVC 1ZN2A 4OIPF 2VBWA 1UHMA 4UV8A 4FT8A 3H3UA 1FYLA 3V8LA 2A69F 2D1VA 1KU3A 4RB0A 2RC4A 3LSTA 2RN7A 3KE2A 4A0ZA 3OOPA 3NRVA 5CVIA 1R23A 5DUIA 5A2QK 2ACJA 3AAFA 3SQNA 1SMYF 2QENA 1SD4A 2V9VA 5D5VB 1U8RA 3JW4A 4GO1A 5FB2A 4WX9A 1BI1A 1WKMA 3LQRA 3G3ZA 1U5TC 4BHCA 2JTVA 1HKQA 4O6JA 4UVCA 4ZYGA 3HTSB 2XAGA 1ON2A 1YS6A 1R22A 2ZMEB 4HW0A 5JI6A 3R61A 4KDPA 3MEXA 4KMUX 2EB7A 3HRUA 4L9TA 2BE5F 1I1SA 3L2CA 2JPCA 2DPDA 3WGHA 1YS7A 4RGRA 2BYVE 3P7NA 2ELHA 3TDUC 3TOAA 1QZYA 1B1BA 1NHAA 2GWRA 2P8TA 2XASA 3WTSC 4NHJA 2OAZA 5CVVA 3GUDA 4U7DA 1RIOH 1DPUA 1XDUA 3LA3A 5CVJA 2Z33A 3T0YA 3FXUA 3EDPA 4PZJA 4B09A 4RB2C 1ONVA 1PUEE 3FMSA 4HA8A 5E18F 1XGNA 5BQTA 4XRFA 4EJVA 3MWMA 1ODDA 1BOAA 1DPRA 4WXCA 3HSEA 2UZKA 5ERIA 4IHTA 4CZZA 4G94A 2PJPA 5E1XA 5A2QZ 2IT0A 1B59A 4RAZA 3BJ6A 1BBYA 4LLLA 3V4GA 2JT1A 2MC3A 4ZYEA 4EJOA 1FOKA 2VONA 5E8GA 4ENJA 1ZG3A 4HF2A 2XRNA 2BEOA 1HW5A 5HDKA 1REPC 2FXAA 2E1NA 3C7JA 3E5QA 5DCMA 2PQ8A 2ZXJA 3EQLF 5IT9K 1MD0A 3R0AA 2UXXA 4ETSA 4PGHA 1ZRCA 3E5XA 3GZ5A 4ENNA 4UUVA 3ULQB 1KU2A 3CUQA 1FSHA 3RDIA 1ZLJA 4MEXF 4KICA 2XAHA 2L02A 3R0JA 1Z6TA 3HSFA 2IA2A 2O3FA 4O3MA 2XV4S 2OA4A 3FZVA 4FHTA 4ENMA 3BJOA 5KK1A 4M6XA 2MA3A 1CF7B 4IRHA 3WGGA 2DLLA 3C1DA 4P96A 4I02A 4M9ZA 4U0VA 3CJNA 5D6EA 1JE8A 3GFIA 1MJ9A 1JXSA 1WQ2A 4LMYA 1IXCA 1K78B 1KQ8A 3F8NA 3GVAA 1D3YA 4CGZA 4P5OA 2F5CA 1EH7A 4PDKA 2FA5A 5LEJA 1U5TB 5FGMA 3EUHA 4MTEA 3RYRA 1P92A 1TNTA 4MGRA 3JTGA 3B02A 3J81K 3WTWC 4AIKA 5CVRA 3K1PA 4UXNA 3TGNA 1TQPA 1DUXC 3BP8A 5ILVA 2FBIA 2DTRA 2MH2A 3L00A 2X0LA 4Q48A 4EMSA 1JHFA 2EFOA 3WODF 2XGXA 1ZGJA 2V1UA 5HDGA 2KRFA 3IRQA 1Z1DA 3QP5A 2DQLA 4M74A 5ICEA 1G4DA
chains in the Genus database with same CATH superfamily
2HR3A 2ASDA 3GTJA 2R7ZA 1QHGA 2MC4A 4MV3A 4M6VA 2IW5A 2EIJH 1ERDA 1UJ8A 2XPWA 1V4YA 4O3PA 2EFWA 2X9DA 2DMTA 4IPAA 5HS9A 2LP0A 1S0MA 3ZN0A 2HEOA 5BMVF 3IL2A 3PVXA 4M9UA 5KFYA 2UV1A 1OR7A 1XDSA 3CLQA 4A12A 2E2IJ 1D1CA 3OUUA 1FVIA 4GC7A 5L1LA 4DR1H 2FE3A 3HOYG 4XLFA 2EILH 3EPZA 2R7FA 1KJ9A 3JRHA 2RREA 1G3TA 2JMWA 2OV7A 1W36D 3HOWG 2DA6A 2LBFB 4A69C 1KJJA 1GV5A 5K7FA 1TAEA 2DWCA 1B8IA 2MD5A 1CGPA 2DFEA 2ZBKA 2ZKZA 1X3WB 1JX4A 1GXPA 3ZOBA 2F4MB 3PQKA 5E1WA 4I4TF 3M9MB 1N34H 1L2ZA 5DQHA 4U87A 1QNTA 4WK8F 2HPMA 1QQIA 4XKCA 4L1KA 4LFCH 2DJNA 1OCPA 2F5EA 3KP7A 1B6SA 1J0RA 1FSEA 2QEXI 1LEBA 2XCLA 1QHHD 2R92J 1TW2A 2IMWP 5L3BA 4LH7A 4ME6A 4MEYF 3Q2OA 2Z2SB 3NWTA 1VQ6I 1PVEA 3ZMVA 2X1DA 3RI4A 1W7PA 4IXAA 2PFBA 2Y48A 3Q5FA 5C4XJ 2VL8A 5FLVA 5FPOA 4XYMB 3MFHA 3QYFA 4DYRA 2H8RA 4IEJA 1BJTA 4YFNF 2M8GX 3N44B 3FBIB 3MN2A 1BIBA 3MKLA 1ON1A 3KZIC 4P9FA 5CAEB 3V6HA 3EUKL 3O6BB 2OZUA 1ETWA 1S5LC 3KHHA 2GM4A 1OQYA 4YQWA 3UR3C 4Q43A 3TDZC 2EZIA 5DM6F 3JSLA 1K7AA 4WF2A 3G6YA 1T3NA 4W1UA 4P1WA 1X1AA 4I6ZA 3B6AA 3J81Z 3V6JA 1N48A 1ZELA 2ESNA 3MWEA 4ECTA 4ED8A 3I59B 3SHFA 4D9JA 1Y0UA 2R7WA 1D0ZA 2VQHA 5FLXW 4PJJA 1V5EA 5JVTA 2NOGA 3FXQA 3LP8A 5IOYA 2CW7A 2W25A 5KT7A 3OYBA 2R3SA 2EFNA 2E60A 5GADJ 4CC5A 1XCBA 4MO7A 3RJ0A 1SCUB 2V7FA 1Y1WG 3GWZA 1Z05A 4Y3OA 3SFZA 4IF4A 4TV8F 3KP5A 4M7EA 4Y33A 3BQZA 4B3XA 4IHJF 4I0AA 3BG6A 2K4BA 3HL2A 1O7LA 2BGCA 1Z3XA 2XAQA 2EK5A 2DMQA 2M45A 1KU7A 1JHHA 5L3GA 2OQGA 1D5VA 3TINA 1DP3A 3SZPA 2V4RA 4F4YA 4IO9F 5F27A 3OYCA 4ZOLF 4HX8A 1YYVA 4A3MG 2KZVA 1O3SA 4LF6H 4OMZA 1R5GA 5HLTA 3GFJA 3WGIA 2L5QA 2PG4A 3HZJA 3HGGA 1WCMG 2VB6A 2G7UA 2QQ9A 2P7VB 2KT0A 3GBGA 4QWEA 5BMZA 4IRDA 3JSOA 3FMQA 5J4YA 1KJIA 3T1BA 2DT6A 4HX7A 2IA6A 3OIQA 4AYBN 1P4XA 1PP8F 1Z3YA 4J9RA 2PN1A 3WO1A 4BY1G 3JSNA 2DA2A 2K85A 4Y7NJ 5GTIC 3TKYA 2M7BA 1Q1VA 2D2WA 2NVYA 4LF5H 3HOZG 2FX0A 2DT5A 1AUXA 3QYEA 2KDZA 2CQNA 4OIQF 3OIOA 4PGGA 5KVRA 3TP3A 2NU7B 4NXNH 3GTKA 4P9UA 4M3DA 4H0EA 2O8KA 1IW7F 1I6HJ 1BGWA 2I80A 5JUMA 4J19A 4F50A 4MQVA 3GO5A 1M0WA 2CV1A 4BXXG 2UXBH 4J00A 2F48A 3GFMA 2AS5F 2PEXA 3HSRA 1TWFA 3CF2A 4BE0A 2JA6J 3GTQA 4PK4A 5L3CA 2AXTC 3ONQA 3MJFA 3HKZE 4UB6C 3H5RA 2VT3A 4C30A 1QPMA 4C2UA 3VYUB 1Y1VG 2ME0A 3F22A 3S15J 4J9MA 3PNTA 1JUMA 4KN7X 2D45A 1MMNA 3V4ZA 3CC4I 1M6VA 3K10A 1PJRA 3PW7A 3I54A 3GTJJ 1KA8A 2R7ZJ 4J9KA 4A93G 1S7EA 1STZA 1U0JA 2ZNZA 1FP2A 3AL0C 4D7MA 1WI9A 1V5FA 3DQVC 1KYWA 3TO9A 3GTGA 3WG9A 4IHXA 3ECHA 4BKXA 1B33N 2XKPA 3FWEA 3V7SA 3PIOF 5KFRA 3NAUA 2Y0SE 1FTTA 4L18B 1HNZH 5KFEA 3F0CA 3TL4X 1MSFC 5C8YF 2QWWA 3MR5A 1LJ9A 4N4NB 5CVUA 4LB6B 3VOEA 5J8FA 3COAC 2ISYA 1HW1A 3OV8A 2ISZA 3M9NB 2O61A 1JLLB 1X9NA 3KHLA 2FQ3A 2KKOA 5F1RA 4YBZB 1VQKI 3OTOH 5L1IA 3JRBA 4YAJB 1KYZA 4RUCA 2R4GA 3OIPA 3I53A 2HKXA 4A3JJ 4HDVA 1LFBA 2HQNA 3IWZA 4Z6YA 4APMA 1IBLH 1WWXA 2EJRA 4V2FA 1JT0A 5KFFA 4DV6H 3H9JA 1CQTA 1CS0A 4CA0A 4OIOF 4BQNA 1KJ8A 3DPTA 3LSMA 3GCMA 1W5CC 1X3ZB 2W84A 4L9JA 3RGXA 4GKKH 5L1JA 4LIUA 1E4FT 5DUKA 3GYHX 4RS8A 4BBRJ 4HQEA 1IOWA 5KFMA 4DL2A 1FT9A 5E20A 2OQRA 1I3QA 2OPTA 2EBIA 3HXLA 2H09A 1GLVA 3ABTA 3WU0A 3J7ZI 1D0XA 1D1AA 2K9NA 4HLXA 5K7HA 1LFUP 2R0QC 2GZWA 2KIUA 3ZR8X 2MH9A 4ZDPA 3EPIA 4O5VA 3OHAA 3GXOA 4IHYA 4A3CJ 1PK8A 4ZYHA 3HOTA 3DEWA 2GIVA 2YU3A 3RKWA 2BY0A 2JA5G 3BR1A 3ESWB 1BN5A 1SD7A 3G8CA 2W9BB 2B63A 1GUUA 5F0FA 4S05A 1RJRA 2XAJA 1FMWA 1W7PD 2VKVA 5CQGA 1F4KA 3PR5B 4DUYH 3MQ0A 3PW2A 5F0CA 4YFKF 5KFIA 5KT6A 4HSRA 4KITB 5IYDJ 2ID6A 4BE2A 1ZYRF 3KP2A 3PNYA 3RB4A 2LK2A 5F08A 4ECVA 3M4IA 3ELKA 3U1KA 3H0GG 4DV3H 2HJWA 4A5MA 1F1ZA 5EG0A 4CUGA 1HNXH 2H6BA 3OYHA 3CC7I 3WNZA 2DFFA 2L4MA 4QWDA 4FX4A 4EJTA 1AN7A 2VIXA 1TQMA 2BBYA 2CUEA 3VODA 4JI4H 2HGSA 3PM1A 1FYKA 3ABMH 1A36A 1IN7A 5HS8A 1S68A 4IAJA 2CSOA 4XSZF 4QTRA 3K70D 2R5ZB 4JV0A 4AUXA 1APLC 2Y30A 3GIIA 4RU9A 1RR7A 4FASD 5JVDF 2ZNYA 1BOBA 1Y14B 4EFBA 2W6QA 2M05A 1IBKH 1X1CA 5K5QA 4NC8A 4IQJA 5F1JA 3ORRA 4EBEA 1ZHFA 4EFEA 5DDGA 4ED1A 2MCTA 3LSJA 2ICWG 3MR3A 1ITYA 3SZTA 2Z9OA 5J2UF 3HJEA 4ZTJA 2IGKA 2DCEA 2L4AA 3HUGA 3H3VH 3LMMA 3PNVA 3CMMA 1X2NA 3PW0A 2XGEA 4NB5A 4OIRF 2R86A 2E5NA 2M5WA 4MV6A 3RCOA 2YX4A 1N75A 2FEZA 2HQRA 3NQOA 4YFXF 4LD5A 3E97A 3Q8RB 4KISA 3IH3A 4J9LA 3R5HA 3LOCA 4M9XA 1U78A 2C35B 3OS2A 3LA7A 3GTKJ 3KLOA 2IVMA 4I99C 2RGVA 4LK1F 2L54A 1AKHA 2KISA 3LAPA 2P4WA 3CCVI 4QJFA 1LDDA 3BROA 4UY8I 3C2GA 1TWFJ 4HYEA 4G7ZF 1G3SA 1FEXA 4XN0A 5FJ8J 3GTQJ 2LMDA 1HA8A 1TWHA 3AG2H 1T95A 2WV0A 2K9MA 4BXUA 3GW2A 2E2JJ 1TW3A 1JGSA 3CMYA 4DV0H 4DBQA 2IP4A 1YO5C 3DV8A 2QQBA 2OD5A 5J47A 1RPWA 4IRCA 2YUSA 2VQCA 2PMZN 1I1GA 3KALA 2W70A 4CYCB 3T1YH 1UMQA 4A3LG 2RDPA 1BI2A 4HX4A 2CQXA 2FPPB 1JDBB 3I9V2 2H27A 3RB3A 2XAFA 4ZQIA 4AM3A 4O2BF 4A0YA 3L1PA 1MGTA 3GTGJ 3K5HA 3VPCA 2VQFH 1SFOA 2CH0A 4Z2YA 1I94H 3M1EA 2WE6A 3LL7A 2IS1A 1Y1WA 3KP4A 3RYPA 4N9IA 3H92A 3R23A 4LIVA 4DL3A 4CC6A 2E7WA 1SMTA 2B9SA 4EYIB 4F93B 4JV2A 1Z2NX 3H3ZA 1R49A 2H1KA 3E5UA 4IZOA 2V9KA 4PJ0C 3HOXG 2CZGA 3HOSA 2QZ8A 3LSGA 4JX6A 1RYRA 2KMUA 4U7BA 1EV7A 2KJCA 2XGQA 5LHGA 2XUBA 3DXJF 5GAHJ 2MG4A 5CKTA 2LG4A 1ZR2A 2QGUA 2E71A 1T0FA 3OR2C 4QLCU 2WTEA 2ZXWH 4HF1A 5L3DA 4ZJZA 4LF4H 2STTA 4EGYA 4QW9A 3GIKA 4BGDA 1E2XA 3QPSA 4OU0A 3OYNA 1H89C 4DV4H 2VJJA 3SZGA 5EZHA 4AIJA 5FLXK 3B6CA 2LC2A 2VQLA 4DW6A 4HYKA 3BG7A 1S72I 2A68F 3CLOA 2VR1A 2FK2A 1U5TA 2O0YA 2XPUA 3OYJA 5LLQA 1BM9A 5C3EJ 4M9SA 1OLTA 2CW8A 3A03A 1RNLA 5HODA 3K4BA 1TLHB 2Y0MA 2DA7A 3REOA 1TA8A 2ZSHB 4AIHA 1I3QJ 1VQOI 1RR8C 1XCVA 2Y2ZA 3CJTB 4GYIA 4KIGA 1U3EM 2G9WA 1Q1HA 3V4SA 2VKEA 5CB4F 4ZH4F 3ZMZA 5C44J 3WTTC 5B1BH 4J9SA 3AL0B 3CQZA 2O8XA 1BJAA 3JAMW 4EM0B 4XX0B 3QAHA 5IWAH 3ZRGA 2IS6A 2IS2A 1X1PA 1K6YA 1VTNC 2M0CA 1JGGA 2VUGA 4CSWA 4ESFA 2LKXA 2NNYA 1POGA 1Y1VA 2Z16A 2QBYA 2DA5A 4MA0A 5KFZA 5KFBA 1TNSA 1ZG1A 2Q2EB 4IR1A 4QIWN 2L2OA 4BAYA 2DXIA 3D5RC 2FJZA 3Q8QB 2JWTA 4DBRA 2HXOA 4NQWA 2R8GA 1P9QC 4MIMA 3I55I 3M3YJ 1OYWA 4S0HB 3U2RA 3F9KA 3BTLA 3PO3J 2F4OB 1MKMA 5JH7F 4IWXA 4ECZA 3CJRB 3V8JA 1LB2A 5EZYF 2VI6A 2O7OA 3CZ6A 5KFJA 3ZMSA 5H6QA 2K9QA 1EJ9A 3LQQA 3KYCB 3MD2A 1XX5A 4CCOA 1DP7P 1J5EH 1CQJB 3I4MG 3DF8A 4G7OF 4S04A 4I0BA 2EZKA 1U2WA 3HOYJ 2C00A 5IP9G 1MBHA 2YL2A 4YHHH 3DWLE 4HNUA 1PUFA 3IC7A 1EA3A 2I10A 2KL4A 1Z2OX 1LEAA 5D8KB 4BL0B 3HOWJ 1LDKB 1GSOA 4XLAA 3G1LA 4X6AJ 3RKYA 4N9HA 3ZQCA 1DGRM 1T38A 1H88C 3P9KA 4AC0A 4ECWA 2CW0F 2XHKA 4N0BA 3LAJA 2BVLA 2F5FA 4ED2A 2WB1N 2CUJA 4HR7A 4JQFA 1J7KA 3WE2A 3TQ1A 4B48A 4R1HA 4WWCA 2K86A 1O3TA 2AGOA 2COMA 4DJAA 4DL7A 1ENHA 2GXAA 3MR2A 1ZK8A 1R1UA 1R1TA 3BJYA 4DUZH 1QBJA 2LBFA 1UG2A 4YELA 1KEEA 3DPUA 3CUOA 3P9CA 1R7JA 3L2RA 4G9YA 2YCHA 4YB8B 3U9SA 2NU6B 3TQTA 3CO6C 2M4GA 1H0MA 4IHVA 2OWOA 4EM2A 1UB9A 1YLFA 4AU7A 2YX7A 4KYWA 2A6EF 4BE1A 2RDIA 3VMMA 2BHZA 1AA7A 4M73A 4PSXA 2DDBA 1TWHJ 1KC7A 2V4JC 3CDLA 4L9NA 1EHIA 4RBOA 2V59A 1G59A 2XIGA 2R93G 4PCQA 3NARA 3G71I 1E4EA 3EPGA 2NVQJ 1IJWC 4BH9A 2CFXA 1TBXA 3ABKH 4FETA 1HKTA 3VPDA 1N32H 1IUYA 2R7SA 1OYYA 2X6WA 3MAJA 1E3HA 2DOEA 2YS9A 4XLPF 2DMUA 4XRSA 3G6EI 4IL6C 2L7MP 5FLXZ 1UAAA 3A2KA 3S17J 3PW4A 2GPWA 3RV3A 2LD5A 1YITI 5BPIA 4NC6A 2WTFA 4D7NA 2X0SA 3MVPA 2K3FA 4GRIA 3CESA 3TO6A 2QM3A 4XLHA 4DLKA 5EJCA 2JA7G 1Z77A 5EEHA 3L2PA 2ECBA 2V6EA 4ECRA 1IDYA 3ZN1A 1SFOJ 4U6PA 1XGMA 1S10A 2RKHA 2K40A 5EF6A 1A0IA 1Y1WJ 2ASJA 2LF8A 1LE8B 2W8LA 3PUFA 3OSGA 2MABA 5FFZA 5KFPA 3I59A 2HXIA 5KAFC 2PI0A 3BWGA 1JTYA 1TZLA 2FBKA 4F52A 4B3AA 3AG1H 2IXSA 1OPCA 2XPVA 3S3NA 3KIOA 3EUAA 3KAKA 3SYTA 4XOPA 3BR0A 3DP7A 2A6HF 2JUGA 2L3DA 3CDHA 1MMAA 3FISA 4A3MJ 1P7IA 4LLNA 5HBRB 1WJBA 1C0WA 2PVPA 5FROA 4EGJA 4BJ6C 1ZETA 1NG7A 4K0KH 5F9NA 4F91B 2YRXA 1WCMJ 3R5FA 3CDIA 3IUOA 4NXMH 2ZJ2A 3PN1A 3FDSA 1Z7LA 1YHQI 1SVOA 1FOXA 3FM3A 4C3HJ 2EFPA 5M5YJ 2VT2A 1CQIB 2ZM6H 2OBPA 3HHGA 3D0SA 3GIMA 1WFXA 2HOAA 3RGZA 5DG8A 4HEA2 4BY1J 3QPHA 3O8HA 2R6FA 3T8RA 3I71A 2LR8A 2PX9A 1BIAA 1FC3A 5IT9Z 3D5SC 2JZYA 4TUYF 3HOZJ 2XB0X 2FOWA 1KQ9A 2NAZA 2EQRA 1O3RA 3H20A 3JZIA 4ASNA 5KNLA 1RK6A 5LMNH 3DU6A 5EYRA 1X1BA 2HOTA 3ORQA 1Y56A 2DI3A 2KIQA 3OYAA 2IGNA 4UCTA 4BXXJ 2WYOA 5EEGA 2R7OA 2Y9ZA 2FKLA 2IP2A 3V8KA 2V26A 1IUFA 3CQZJ 3RPQA 3QFFA 4UCUA 3RQ4A 1FWZA 4D5CA 4FTHA 3MR6A 3RV4A 2FMYA 2VBZA 1OCTC 1MMGA 5D4SA 2F4VH 5CYVA 2X85A 3W2VA 4R79A 2KHMA 3OYEA 2WWYA 2IJLA 2W6NA 3H1CA 2ZXHA 1SVLA 1TWCA 2E7XA 1B9MA 1R5HA 3CJQB 3KCCA 2DQRA 4ABZA 4KIBA 4ENKA 4Y8VB 3RAXA 2VA3A 1Y1VJ 2TDXA 5F04A 4BJ5C 4KHPH 1IN5A 1NTCA 2XF5A 1WJDA 5B5EC 4FCYA 3BR2A 3MZYA 5KFOA 4B44A 4U88A 3H3VK 5IP7G 4O3RA 1AHDP 1V3FA 2MGQA 5BPDA 1T36A 2W9AA 1YOVB 2IS4A 3QRFF 4A93J 2VUMG 4LLGF 4L9VA 4X64H 2DT7B 1LQ1A 2YW2A 3ML6A 1EZ1A 2BXYA 1M7JA 3GIDA 1U9NA 4HG2A 2QSHX 1N78A 3ETJA 1WJEA 3U1DA 1YG2A 2ASLA 3R4KA 3V7RA 3BZ6A 2NVTJ 4KIFA 2M1BA 2R7XA 1ZKGA 1FY7A 2HS5A 2HTJA 2D5VA 3Q8PB 1TT5B 5JHUA 3FHZA 3F72A 2J5OA 3A1YA 3BABA 3ABUA 2LDUA 1GV2A 1AWCA 3R5XA 2X48A 5DGBA 3ZQFA 4WCGA 2KIFA 4AVPA 4RDUA 5GPAA 4I98B 3OYGA 2OU2A 3DF7A 2R5YB 1WH2A 4ZDOA 2Q1ZB 4A3BG 4D1QA 1MDMA 1YFHA 3GIQA 4Q0YA 4B3MH 1ETVA 4A3GG 2R8HA 2HQ5A 5JFRA 2Z99A 2FB9A 4K2EA 2IA1A 2E36A 3DTIA 3S8PA 1EKEA 3CCYA 1G3WA 1JKJB 4EBCA 1GSAA 2R7DA 1GT0C 3G6XA 1W5TA 1XMKA 4UHTA 1KONA 2RNJA 5D4RA 4B43A 1BNCA 3LWFA 2QCOA 3K4LA 2J5PA 4BY7G 3RZOJ 3RKXA 1QA6A 5LFAA 3F6OA 4OINF 4XLEA 3D1NI 4E7LA 3EYIA 2YS7A 2HGCA 4DR3H 4JI1H 4CICA 3FM5A 3CP8A 1X58A 2HYJA 2EV0A 3KYDB 1J9IA 5CLSA 1ETQA 4BEHB 3JTHA 2E1CA 3ZQLA 1ZRFA 2ESHA 4C3IJ 3AKZA 4KA4A 1XSVA 1K4TA 4Q47A 5KG0A 4F92B 4U0WA 2OUMA 3I4NG 5CJ9A 3J80W 3L4KA 2VE8A 4YAKB 2JA5J 1RZ4A 2XB5A 4UCSA 1Z2PX 4IRKA 1A04A 4AYBA 1OKRA 3BAAA 4JUZA 1ZH5A 3SXYA 2Z5UA 1IRZA 4A6EA 4XKBA 4E7SA 4I76A 3QOPA 4A3IG 2BQRA 3Q9VA 3N05A 4HPQA 5CQEA 1HSJA 4J9OA 3HRMA 1ETKA 4IQ4A 3V7CA 4EATA 3JRCA 3CCQI 2PJRB 1PX2A 1ETYA 3I0TA 1SVMA 2P5VA 3GFLA 2NYXA 4BYYA 5LEKA 4DZJA 3L9FA 5HDNA 3TIIA 5FLMG 3BDDA 3H0GJ 4L0ZB 2A5YB 2W9BA 4MAMA 3PR4A 1P4AA 2ZFUA 3DTEA 2XCAA 4J9PA 1J75A 2E35A 4ZDLA 4YG2F 5D5UB 2VA2A 1VQMI 2G7HA 2HI3A 3R60A 4H4KC 1Y8QB 5K1YA 5KG5A 3C2BA 1Z67A 4AIDA 3JAMK 3QYBA 1WVRA 1DU0A 3BPVA 2GLOA 4B3RH 2EIMH 2K02A 4NLGA 4D0PA 2VC1A 2LRDA 2H6CA 2LTPA 2YZMA 5LGTA 3C3WA 1IBMH 3MKZA 2MFZA 2BXZA 4LFUA 2XSDC 2HDCA 1E3OC 1JUPA 1SFUA 3L2VA 2R7TA 3ZMUA 4BQQA 2FK3A 1OCOH 2AQEA 3RBDA 4J01A 5FD6A 3HC7A 2R85A 1HKSA 1FX7A 4I01A 4DR4H 5F64A 4LG0B 2DTZA 2QYZA 3HYIA 2UUZA 2HZTA 1J59A 2M87A 1PP7U 3WO0A 1MBEA 2BY2A 1EH6A 2W1OA 5ICFA 2WAEA 1B72A 1O57A 2NVXJ 3RTRA 1LUJB 3N4MA 5DEQA 3MKYB 1JJ6C 4A3KG 5IT9W 1LVAA 3PO2G 1YTYA 5K7ZA 2LKPA 5CA0F 4XSXF 1F36A 2KQRA 1WHUA 4EM1A 4HQMA 3S93A 4FE7A 2HU9A 3PSFA 5FKNA 3N97A 1ZARA 4KT5C 2QLZA 3F3XA 1HXDA 1IRFA 3VPRA 4HOBA 1ULZA 1Y6IA 2XGDA 3JRFA 3MCZA 5E17F 4B3SH 5KFVA 3BPXA 4BUPA 2C2RA 2MW8A 4GDFA 2R93A 5HNFA 5E3OA 1Z9CA 1TWCJ 2C6YA 4NUBA 1XS9A 5D5WB 2LY2A 2JPBA 3BQYA 1IRGA 1V5GA 2ZCWA 3WU1B 2ZMEA 4Q8FA 3FF5A 4IHWA 1MNEA 1S7AA 2XF6A 5K5RA 3G6VA 1I5ZA 3ZMDA 5DS9A 1WZ2A 3E3VA 5E1ZB 4RM3A 3R6SA 2DO7A 1JDEA 1R36A 4A3LJ 3RQIA 1MH3A 2WADA 2V79A 4RAFA 4CO8A 1SYXB 1XSXA 2KLOA 1K6OA 2HOSA 2NRAC 2JA7A 5ED4A 1MJBA 1S9FA 4JYKA 3U9TA 2DPIA 3CCRI 4UCOA 3S16J 2F5DA 1MMDA 1VQ4I 4XLNF 1Z7UA 2RV8A 5JQWA 2GA2A 2VODA 3T5LA 2HYFA 4BHPA 5FKKA 2HOEA 3VB2A 4A3FG 1TTYA 5TRDA 3RJPA 3TW6A 1ZRDA 1RETA 2GXGA 2M34A 4CYCA 4X1EA 3HOXJ 5D8LB 1ZG5A 4MHGA 5BR8H 4BDZA 2EZLA 2NS0A 2Y9YA 4LJZF 4E70A 1U9OA 3UQ8A 3V6KA 2FK1A 2E5LH 2ZDGA 4F7ZA 4UNOA 2XSJC 4LF7H 2CJJA 1TWAA 2UVVA 4W97A 5D1OA 2NUAB 3CCMI 3PJRA 1WRJA 4GC6A 1SAXA 2IBKA 1UHSA 1YIJI 1ORKA 3I3LA 5KFUA 3RSNA 1N25A 3GTPJ 2FLLA 1MJAA 2VXZA 2XGCA 2O03A 4FQGA 2UU9H 2W4SA 2V9PA 2B0LA 2DODA 2X51A 1WR2A 1VQLI 3HG9A 4RZRA 1EUDB 2AGPA 2EZHA 1GO3E 4HV5A 4G6TB 2R7KA 5J1UA 2LKSA 4QPQA 2A5WA 4MLOA 2GAUA 3RB6A 1EUCB 4YIFA 5L3EA 3FMRA 1P4WA 3U21A 4HNTA 2CRGA 2YSRA 5GPCA 1DGSA 2EA2A 5GTHC 3FKIA 1YW7A 2CQQA 2WV1A 1WJCA 3P5JA 1N77A 1YX3A 3BZKA 2E5ZA 3KP6A 2BY3A 2I5UA 4I7HA 1B6AA 4KT6A 5B3SH 2DU9A 2FMLA 3ASNH 3H9QA 1IXSB 1TQIA 2QUFA 4UUTA 4UFZA 5LP6F 4LF8H 4UVAA 1E0EA 1I6UA 1XMAA 4RA2A 1S9HA 1W4MA 1VQ8I 4C2TA 2M3AA 2AQFA 5E8IA 5J1YA 2W24A 5TJJA 2VPLA 5KG1A 1HCRA 2HKOA 2DPUA 3HDDA 1A31A 2DJIA 5DLGA 2EFQA 5JVGF 1S6LA 2LFBA 1JKRC 2ZDHA 4UUSB 2K9SA 3BZCA 5AONA 1BXRA 4IWYA 5IPAA 1S3JA 2W00A 5KFTA 1OISA 2UXNA 1T98A 3KAJA 3J81W 2CV0A 2R7LA 2K27A 3K1MA 4M72A 3MZHA 1QGPA 3T1HH 2JEGA 2RGRA 4E7IA 2W85A 1WSUA 4EJWA 1T39A 4MA5A 3L2QA 4C2MJ 3M4OJ 1MZBA 2VUMA 4UB8C 5D5XB 4IRIA 1UFMA 3LSHA 1JUSA 4GXOA 3E6BA 2VQGA 2KRHA 1Y8RB 2HFHA 4BWSC 4ED7A 1A6IA 5M5XJ 1FIAA 3TO7A 1XMOH 4JI5H 2Z3YA 4QPOA 4LITA 1YJWI 2Q2EA 4MV4A 1MSEC 2DA1A 1N56A 2AXLA 5I47A 2E34A 1BR2A 3I4MJ 4G8XA 4HAMA 2KDOA 4I09A 1VF9A 4RNOA 5J40A 5IP9J 1LDJA 2YR2A 4XIDA 1DQUA 1BA5A 3H5AA 1RK5A 3Q0VA 5ICCA 2GQQA 3QPLA 2OJED 5HLHA 1VZ0A 2GXBA 1G3YA 3CP2A 1RJPA 3ZQ7A 2XDVA 4YIRX 4I2OA 1IO2A 2F6CA 3G2BA 4NC7A 1IF1A 3JREA 2H8WA 3F21A 2DBBA 2C28A 2PMZA 3ZPLA 5DGAA 2FD5A 4G6QA 5FFXA 3ZP5A 4DZPA 3RKQA 1P2FA 3A0BC 3GTLA 1N36H 4CCJA 3H36A 4FX0A 4EBDA 2RQQA 3DPLC 5H6RA 1S7OA 4L0YB 1XSDA 4AYBE 1RKTA 5KFWA 1T2KA 2VE9A 1VKZA 3NWSA 3OMYA 2VOOA 2R7VA 5KFCA 1WH7A 3FXLA 2PMUA 1ZR4A 2F2EA 1RJQA 2M9HA 4HQ6A 2NU9B 2JA6G 2EH3A 3PSIA 2W57A 3ROUA 5T14A 4BHBA 2HVSA 4FBTA 5DG7A 3HRTA 2DIKA 1YE9A 4CXFA 2J6SA 2ZJRF 4L5JA 3OWTA 2R93J 3HM5A 1DDNA 5L3FA 4BNCA 3KPHA 4Y17A 4ESJA 2L01A 4IJAA 1QPIA 3ECOA 4A2UA 1IDZA 2BOLA 2D1HA 1ZGAA 2BVMA 4PJMA 2ZO4A 1LFPA 3A4CA 3T5XA 5LHIA 2SCUB 4LSXA 1IC8A 3TQNA 2L7ZA 4CHUA 3GZ6A 1W36C 1H9TA 2RDJA 1FBQA 3AG4H 3K0LA 3W2WA 3CMAI 1IOVA 1Z91A 4C3JJ 1R58A 1CF7A 4X65H 4BBSG 3ZMTA 1C30A 1QVTA 2X1EA 3A02A 2W48A 1W0UA 1U6GA 1I27A 4R8HA 4UVBA 1AU7A 5C4JJ 2JA7J 2B7EA 4RGSA 5IYCJ 2UVWA 3ZCOA 4RGUA 3J7YJ 3O2PE 3W6KB 3KHGA 3I64A 1EYZA 5IYZF 1S03G 3K2ZA 1ZREA 2DOFA 2FNAA 4MV7A 2LY9A 5J3LA 3C18A 4M6YA 2GA1A 1LPQA 1WCMA 1K78A 1I6XA 1P7JA 2PBIA 5EWFA 5FKLA 3W6VA 4DR7H 3E6CC 1V4RA 1OYIA 3O8GA 2BW3A 5JHFA 3H4DA 2A61A 3WE3A 3J80K 2MLGA 4PFPA 2UWMA 1HOMA 1TWAJ 3M9AA 2Z1DA 3GEZA 5LOVF 2I87A 4A3JG 2IPQX 5DCFA 1XPXA 2CYYA 1LE8A 2VBXA 3ABLH 1KU9A 1SFEA 1YQAA 5AIQA 3CD6I 5D1PA 1WJFA 3T8TA 2FRHA 3X2QH 1F9NA 1TL8A 1GVJA 2DA4A 1ZHSA 3CUQC 2L9RA 3HHHA 3ZQQA 4A5NA 2IRFG 1G8XA 1T08B 2FOKA 3J7AY 2W6PA 4QIWA 2CQKA 2FSWA 3DFGA 3PFIA 5EDNA 2QA4I 3DKXA 3IH2A 1RI7A 3M9OB 3PIPF 2V58A 4DV5H 3RB0A 2NXNB 4IOCF 1K79A 2O6GE 2IGOA 4XQFA 2EINH 1RRJA 1EH8A 1AUVA 2P5KA 2RF4A 4X66H 5GP9A 3M8EA 1X4OA 5FD5A 5H80A 3FKIJ 4C5AA 1BJZA 1PDNC 5KX5F 1YRNB 4ED6A 2ZJPF 2H94A 2JSCA 4KMFA 3FXRA 4ANJA 2JN6A 2R8IA 3TEDA 1HBXG 1BC7C 1FMVA 2BZTA 1GXQA 3F8BA 2G0EA 2R7UA 4RUAA 2VC0A 3WTZA 1NG6A 1O3QA 3E5NA 1HQCA 1ZLKA 1K1SA 2FBHA 2ZXIA 1QZZA 3PFYA 2ZJTA 5DG9A 3VSLA 5EG0B 2DPJA 3N41B 1FLIA 3IAM2 3FXJA 2K3PA 2CGPA 4A3DG 1R1VA 3ETHA 2FPIB 2AU0A 2WB1A 3BR3A 3LSRA 4B47A 3CCUI 5KG2A 3E7LA 1R71A 2FQ4A 1LKXA 1RUNA 3KP3A 5IP7J 2WBMA 3KETA 4J9NA 5IT3A 4TQRA 5HS7A 3FMAA 4BQOA 4RAGA 1FOYA 3ISPA 4M71A 2VUMJ 2QK4A 3HOVG 2AO9A 2FU4A 3K9TA 3S2WA 2KP6A 4AWXB 2L7KA 5GAEJ 1R6RA 2A07F 1S0OA 2FJ1A 4MNUA 2CUFA 4CYDA 1MBJA 5ILSA 2V9WA 3QP6A 3WHCA 1VQNI 1R9TA 1RYSA 3M07A 4V19K 4RLFA 2YU9A 2V4QA 3HUGB 1VQPI 3Q1KA 3RUPA 3H35A 3EUHC 2HVRA 1XD7A 2I8DA 1M1EB 3QODA 1SD5A 3TOBA 1KGSA 5DTDA 3IKVA 1AOYA 3S1NJ 2VPQA 5K5OA 2YZGA 5M5WJ 4V2GA 3B73A 2BQUA 1TP4A 3KEQA 4OAZA 4WXDA 4ED0A 5EGOB 3ERED 4EYHB 1VQ7I 2AQ4A 1DIKA 5KHDA 4BACA 3FBNB 4FM9A 2N8GA 1SD6A 5LRRA 1ZGWA 1VBGA 2MSYA 3LSKA 4A3BJ 1ACIA 2KRCA 1WH5A 3I5UA 4A0XA 1HLVA 2IA0A 4NBQA 4Q5SF 4GGGA 2ADUA 3GTLJ 4A3GJ 4TV7A 2OCCH 4MFDA 4O3SA 3W2AA 3LFKA 5LL6b 3BA8A 2QYOA 2Q0OA 5BOXA 5H20A 3ZQHA 3BT9A 2XGPA 3Q3SA 5KG4A 1HF0A 1YIOA 3MWDA 3L2WA 1XDNA 4QW8A 2CG4A 5C1PA 1MNMC 3H4BA 1FBSA 2R5YA 4BY7J 2YRWA 5AIPA 4MTDA 5DQGA 5LHHA 1B4AA 4KFCA 3BJAA 5M3FJ 4DIQA 3GV7B 3GX4X 4L5EA 3CVZA 1YW8A 2AGQA 2JA5A 1NK2P 3KZYA 2O5RA 3C2HA 4DQ2A 3J80Z 1UNNC 5FPRA 2P0AA 2C2DA 4JI3H 2Y31A 4DNCA 4LK0F 2LSOA 1J2XA 1WGXA 2YPRA 5LBQA 2CQYA 3TP0A 1F5TA 3I4NJ 4AVZA 5KFLA 4EGQA 4Q44A 1D8KA 4X0GA 1FOWA 2M4KA 5CPRB 3L09A 1HR0H 1V51A 3VDXA 2VN2A 5FO5A 2VLAA 1A9XA 1I39A 2DYRH 3H9GA 1USSA 3WTYC 1OCZH 2HWVA 4EEFG 3VEPA 4XLCA 5J6XA 3H0GA 1XNRH 3DKYA 4GCVA 3K4MA 2V6CA 4E7KA 1V54H 1GSHA 3K69A 4XN3A 3C0FB 2W8KA 2BR0A 5D6FA 2R8JA 3M8JA 3J7AO 3QZ8A 3BC8A 1FBUA 3K7AJ 4IVNA 3W6JB 3RIRA 2GLTA 3NGDA 4ECSA 5FLMJ 4WXHA 5EOYA 5CA1F 3SFIA 3KEOA 3IG0A 3QOEA 2PMZE 2MLKA 3SJMA 1SFXA 1OR7C 2JRMA 3UKGA 3QU3A 2GBYA 4AD9A 2DMPA 2F5VA 2AHQA 3GF2A 3ERMA 4XICA 5KG7A 4F4ZA 4YRVA 1Z21A 2P7CB 1WJAA 3BY6A 2PJRA 3W3CA 3T5KA 1IAWA 3JRXA 4R7RA 2BQ3A 1H8AC 1H9GA 1RUOA 1IG7A 2VOPA 2CKZB 4ECYA 5DYMA 3L2UA 1XNQH 4OOIA 3IKTA 5H2FC 2QSGX 2HPIA 4G3IA 1FJLA 4XM3A 2C2EA 3K4KA 3AYHB 4UV9A 3S3MA 1FZPB 2V1DA 1R00A 2EPFA 2JVGA 4A2AA 4UCRA 3RBEA 4LF9H 2ETHA 3BR6A 1IXRC 1FNNA 1QVUA 2QQ8A 2PBZA 3LA2A 1FPQA 2LYCA 3M7GA 4LGWA 4YY3H 2NVXA 2NS7A 2ZFWA 2H1LA 2V1XA 3HTUA 4PJNA 5E3MA 4CCNA 4R8UB 3QPTA 3DTKA 3DKWA 3DLAA 4JV5H 3IV5A 1VI0A 3L7WA 3GTOJ 3GLXA 2FF4A 5DM7F 3HKZN 2DK8A 3EETA 2LOOA 4C5BA 1JXLA 3CTAA 2VQEH 4N4OB 1YX5A 2X1CA 3LWBA 3IAS2 2QVOA 4A3KJ 3IRRA 1UHWA 1WI3A 2R7MA 3PO2J 2QBYB 4L5IA 5IY5H 1IN6A 5E79C 5A2QW 3T5HA 3OS0A 2RVCA 4LG0A 2EV6A 3DBHB 1UC9A 3BCBA 4NQWB 3KTMA 2WC2A 5HNHA 3RFCA 2UUCH 3N40P 2X4HA 4KJZA 5BNGA 3DEEA 5DCMB 4II3A 1K61A 2ZSIB 1X1DA 5M3MJ 3HOUG 4XKWA 2MYSA 2DYSH 3K1NA 5HLIA 2B63G 2DMNA 2Y0SN 3WHBA 3K70C 2MBFA 1GHCA 3S1QJ 1K4SA 1DV2A 3F6VA 2YYAA 5HVQC 4EG0A 3CC2I 2VOBA 2LLKA 2M2EA 1B9NA 4A6DA 1HSTA 4BXFA 2KJBA 1I7LA 3CCEI 4IKFA 2XVCA 1PUFB 3PO3G 3WU2C 3VFZA 1HW2A 1S8NA 2YZNA 3JRGA 2W7PA 3IP4B 3CUQB 3UFXB 3VYTB 2E1MC 2EWNA 4QIWE 3OYMA 3SDGA 4E7ZA 4HDUA 2HTSA 3D5LA 1R9TJ 2JA2A 4ZI7F 4DR5H 1J09A 3G73A 2VBYA 3KEYA 2YU9J 1P6RA 1CE8A 5K2MA 4A3FJ 3FK7A 5F6FA 1L0OC 3OL3A 1OCRH 2KFDA 2KIMA 4RNMA 4QWQA 3WTXC 1XGOA 4DV7H 4JX4A 4D5FA 4OMYA 1HC8A 5KFSA 3ZGKA 4A3EG 2Y69H 3KZZA 3GTPA 4J9QA 4EV0A 5LMUH 3K2AA 3MFKA 3FXOA 4HZFA 3K6GA 2JUCA 4HBLA 2EIKH 2WA0A 1YJ9I 4MQ9F 3TIGA 3O3KA 2XKOA 4QSHA 4QWCA 3K5IA 2CU7A 4ZHQF 3WTUC 5LRSA 2QKMB 4RGXA 3KYLA 5J8CA 3MFIA 3VWBA 3RTXA 4ZYDA 3G1OA 3K4NA 4M3GA 2IGMA 4DYQA 1VQ5I 1IGNA 4Q4ZF 3A01B 2XROA 4LB5A 1E4EB 5DQIA 1XGSA 3E0JB 5KFXA 4E7JA 2WB1E 2HYGD 2LF7A 2OH2A 2NU8B 1ZAOA 4XONA 2Q8KA 4C9YA 3ASOH 5FRMA 3HEFA 4I55F 1IZ1A 5LD2C 4IHSA 3GQCA 4B8XA 3OYKA 3CF5F 1FP1D 4MFEA 1IN4A 2CWEA 2KPMA 2M8EA 4JBAA 3V42A 1NH3A 1FTZA 1JIHA 2BHYA 4GYGA 3U9GA 4PFOA 3CO7C 5LGNA 4Q8EA 3PQJA 2K7LA 1W96A 1FYMA 2LH9A 3JRDA 3DLLF 5F9LA 1T8IA 5L1KA 3GTMA 3PUBA 5BPHA 1D5YA 3F8CA 1TWGA 4C2MA 4YR3A 1S29A 2CS3A 1DGWY 1S97A 3F8FA 3EYYA 1OMIA 2ZMEC 5IP6A 1W93A 1P8LA 2X6XA 4RB3C 4YEJA 4G6DA 3Q8SB 4RAYA 4EJUA 3E6MA 3HB9A 3JSPA 2FUG2 1V9PA 2CO5A 2J6TA 4TQSA 4G7HF 2DLNA 3BQ0A 4UUSA 1D8JA 2ZDQA 2VJIA 2VJ4A 5KT4A 2FLNA 1OJLA 1JKQC 4JI7H 4JK1X 4M3EA 5JR3A 1T6SA 5IYBG 2E19A 3FKJA 2JA8G 3S32A 5C5JA 2E2HA 5HLGA 4FE4A 1O4XA 4XORA 3G4SI 5KFAA 1HDDC 2R5ZA 1IN8A 2FMAA 3S14J 4FU0A 2W6MA 2P6TA 3RPUA 3QQAA 5KKNB 2DK5A 1TT0A 3DCFA 1G6NA 4IRGA 2XC9A 1QU3A 2HHHH 2A3SA 1BR1A 1BI3A 4NDLA 1LNWA 2DAOA 3M8FA 4HRIA 2L9VA 5DD8A 2QKLB 2UXCH 3P9IA 2EV5A 4CDGA 3K4CA 3F23A 3BOQA 5F0HA 3HGYA 3BG3A 2CQ7A 2GIZA 4XR6A 2EA4A 3I4PA 4YIIA 4XBFA 4U0YA 1JKPC 1E4GT 1USTA 5J1RA 4YR2A 2W9CB 3OSPA 2STWA 2HVQA 4PUSA 2VKDA 6PAXA 1E17A 4ECUA 3I58A 1X2MA 2PLYA 5KG6A 3DEUA 2OZ6A 3DU5A 3Q9SA 3OUZA 4DV1H 1L3LA 4Y15A 1MMSA 5EEAA 1JI8A 2XD4A 3KHRA 2UVRA 2P6SA 2BV6A 2DDAA 3GV8B 2BY1A 5TISC 1MW7A 3IN5A 3VYSB 2ZC2A 2Y75A 1KZHA 5EWEA 2LNBA 2FNPA 3KX2A 1QZEA 2QQAA 1O7FA 1XC5A 2WAFA 2W7NA 4IOAF 2R87A 4RM2A 5LYJF 5LGUA 3LSIA 4HV6A 2CMPA 2QSFX 2DFHA 1XN7A 3F8MA 5ILUA 2O9LA 2OTLI 1GYFA 4QWAA 1W1WE 1B8IB 2PN6A 4BBSJ 3VPBA 3BQ2A 4JI0H 1KQ0A 1ZHQA 4ON0A 4O4HF 2P5LC 4O3NA 3UNGC 1BI0A 4ESBA 3LNQA 4HLYA 2A05A 1ULYA 1W5SA 2NNNA 4AQYH 2NVUB 2GOMA 2P81A 3SI8A 3KFWX 3E6DA 2DFIA 1BC8C 5KFQA 1MDMB 5DV5A 5HOOA 2HDDA 4OX9H 1Z6RA 3VSKA 2ECCA 1PYVA 2ME6A 4EQQA 3BA9A 4YP3A 1FKAH 4M3FA 1X3UA 4ZZLA 4JV1A 5DD4A 1I50A 1W7PB 2UUBH 1GDTA 3IHUA 5D8DA 1OWTA 3HIFA 3Q0UA 4QWBA 4DL6A 2OCEA 2RQPA 9ANTA 1JTXA 1R5ID 1K1QA 3HPGA 2R92G 2JEJA 1UZCA 2DW4A 4WD3A 2L0KA 5C4XG 3FX3A 2ZJQF 4Y4RA 1QO0D 2DN0A 2PMHA 1A6QA 3NEUA 4XKVA 3OSNA 1UCRA 4Y13A 3GILA 2X6OA 4ZZDA 4EGZA 4EVIA 1Z0XA 4KN4X 4HF0A 5KFGA 4DYCA 2VJ5A 3JAMZ 4P55A 1UG0A 5DLFA 1FIPA 5FKMA 1M0TA 1YW9A 2WY8Q 4RB1A 1X19A 1XB4A 4ZYAA 4E7HA 3OS1A 3J7AK 5BS6A 3KLNA 4JI8H 4BU2A 3HRSA 4IZZA 4GLXA 4BQAA 2XF7A 5B1AH 4KNYA 4E4TA 3VYRB 1S0NA 1VBHA 2E1MB 2M30A 4EEQA 2KZGA 2X6YA 3QU6A 3BG9A 3QWLA 5ICGA 4KUMA 2JRTA 2VPRA 1YJNI 2VKHA 1IV6A 2K4JA 2CUZA 3IWFA 1J5YA 3WTVC 1ZN2A 4XRSG 4B4CA 3GTMJ 4OIPF 2OC6A 2YS6A 2VBWA 4CCLA 1YRNA 2LY1A 1TWGJ 4A3DJ 1UHMA 4UV8A 4FT8A 1V55H 2ZB9A 3H3UA 3SEZA 1FYLA 2JSPA 2A69F 4XL9A 3V8LA 1ZQ7A 2WAQA 2D1VA 4XYLB 1KU3A 1E3PA 1A35A 5FKOA 5GONF 4RB0A 1I7NA 3DBRB 3HOVJ 2RC4A 3LSTA 1YI2I 2RN7A 2P0WA 3CCJI 1BW6A 3KE2A 2XCPA 4A0ZA 1GVDA 2CV2A 4LFBH 5KCMA 3OOPA 3NRVA 1MBFA 5CVIA 1R23A 5DUIA 4ECQA 1SAUA 1SANA 5A2QK 2ACJA 4IR9A 1GGOA 3QZ7A 2M7AA 4RMNA 3AAFA 3SQNA 1G2HA 4M3BA 1SMYF 2GOXB 1T0FC 4YJ3F 2QENA 1JJ8C 5BPFA 2E2HJ 1SD4A 1GLNA 2V9VA 4WBNF 5D5VB 2L9SA 1B72B 1U8RA 1NK3P 4X62H 3JW4A 4GO1A 2R8KA 5FB2A 1B6RA 2WAQN 4WX9A 2IBDA 1BI1A 1WKMA 4MV1A 3LQRA 3G3ZA 1U5TC 3OYIA 1OFCX 4BHCA 2JTVA 3N6XA 2ALZA 1HKQA 2W6OA 1SEUA 4O6JA 4UVCA 2W82A 5KT3A 4E6KG 4ZYGA 4ECXA 3HTSB 2NVYJ 5EGOA 2XAGA 1EF4A 1ON2A 2W71A 1YS6A 2ATLA 2QF7A 1U8BA 5TGTA 1R4MB 1R22A 1K83A 3GV5B 2JEFA 4PDBA 2ZMEB 4HW0A 4NNJA 5JI6A 4RZQA 2VXDA 4F3QA 3R61A 2NS8A 5IOZA 4KDPA 3MEXA 4KMUX 3RPUD 3BR5A 2MD0A 4JX5A 2DZDA 2EB7A 3HRUA 4C5CA 2ID3A 4L9TA 2BE5F 1I1SA 3L2CA 4ED3A 1SEIA 2JPCA 4F4WA 5C1OA 2R82A 2UVUA 2DPDA 3G1MA 3WGHA 4XZ3B 4FISA 4CCKA 1RC9A 3OYLA 3T5JA 3MZ8A 4DV2H 1YS7A 3RF2A 4LOCA 2R7ZG 2DOAA 4RGRA 3FXKA 4F4XA 1D0YA 3N42B 3LFUA 2BYVE 2XRLA 3P7NA 3GMEA 4JYAH 4B3TH 1R4NB 4DL5A 2ELHA 3MKWB 3TDUC 3TOAA 3JRWA 4CCMA 3OY9A 2JK3A 5KFDA 1QZYA 3BTJA 4DR2H 3Q0WA 1B1BA 1QRYA 5L9XA 1NHAA 2GWRA 2P8TA 2XASA 3FXMA 3WTSC 4NHJA 2J9GA 4BS9A 2OAZA 2W7OA 3JCUC 5CVVA 3GUDA 4U7DA 2I8CA 1ETXA 1RKWA 5D1OB 4DL4A 4ITVA 3H5NA 1VQ9I 5J4VA 3AG3H 1RIOH 1DPUA 1XDUA 1SC7A 3FK6A 3LA3A 5CVJA 2Z33A 4O4LF 3S1MJ 3T0YA 3FXUA 2V5AA 1I50J 3EDPA 4PZJA 4JI6H 2K5CA 4B09A 2VASA 3GLLA 2R7QA 2R84A 4RB2C 1ONVA 1PUEE 3RAQA 3FMSA 3OOUA 4HA8A 4HSTA 5E18F 1WJ5A 3KXYT 3ZXSA 3CCLI 4FBUA 2COBA 3H40A 3GTOA 1XGNA 5BQTA 4XRFA 5EZGA 4MV9A 4EJVA 2ELKA 3MWMA 1VAJA 1MBGA 4BBRG 1HDPA 2M0MA 1ODDA 1BOAA 2HQAA 4A2BA 1DPRA 4WXCA 3HSEA 1WSCA 2Q2UA 2UZKA 1XTAA 5ERIA 4O3OA 1UC8A 2RNGA 4IHTA 4CZZA 4O4IF 3SE7A 4GKJH 1BR4A 4A3CG 2C22A 5KG3A 4G94A 4HNVA 2L9NA 2PJPA 3BQ1A 5E1XA 3HPHA 5A2QZ 2IT0A 4TV9F 1B59A 3TBIA 4RAZA 3SDBA 3OYDA 2TCTA 3BJ6A 1BBYA 4LLLA 3V4GA 1MIJA 2JT1A 2MC3A 4ZYEA 1XMXA 4PJLA 4EJOA 4R8UA 2FP4B 3BTCA 5KT5A 4JOMA 2R7RA 1FOKA 4XOTA 4PWQA 2VONA 5IYDG 5E8GA 1I3AA 3WG7H 4ENJA 3HOUJ 1ZG3A 3I56I 4HF2A 2B63J 1XG1A 2XRNA 1MH4A 2BEOA 1HW5A 3TMOA 5HDKA 4DOZA 1REPC 2CFOA 4EEYA 4Q45A 4BDYA 2FXAA 2E1NA 2WDTA 3RZDJ 5JVLA 3I12A 3C7JA 2V1NA 3E5QA 2E2IA 5DCMA 2PQ8A 2ZXJA 3EQLF 5IT9K 5JLXA 4I50F 1MD0A 4LSAA 2Q2TA 2UUAH 3R0AA 3OHBA 5KAIC 2UXXA 3TW7A 4ETSA 1RESA 2VQDA 4IX7A 1ETOA 1VS0A 3PW5A 3OSFA 5KT2A 3AFHA 1JKOC 4PGHA 4G12A 3H0DA 1ZRCA 1XMQH 3E5XA 3GZ5A 1T56A 4ENNA 2JJ7A 2J6UA 1T33A 4UUVA 2FPGB 3ZQIA 3ULQB 1WPKA 2E1OA 1O75A 1KU2A 1AKHB 3S3OA 4A3EJ 3N43B 2DA3A 3CUQA 1FSHA 1VFCA 3A0HC 4XK4A 4FS2A 2FLPA 5EDWA 4XRMA 3RDIA 1B04A 2R92A 1ZLJA 4O3QA 4MEXF 1MBKA 4KICA 2XAHA 2A6TA 3JRIA 2KSWA 5KFHA 3MMYB 3E1SA 4XMYA 3BCAA 1DU6A 2L02A 3FDYA 2OF7A 3R0JA 4F55A 1DV1A 1Z6TA 3HSFA 2JEIA 2IA2A 4JP0A 2O3FA 2XC7A 5FJ8G 4O3MA 2XV4S 2OA4A 1K83J 2IAIA 3FZVA 4FHTA 4ENMA 3GLKA 3BJOA 5KK1A 2JVHA 1OCCH 2WAQE 4M6XA 2VPSA 1ZTRA 5HV6A 1JT6A 2MA3A 2UXDH 1CF7B 1A5JA 1F43A 4LG3A 1W0TA 4U7CA 4II2A 4IRHA 3PL8A 3WGGA 2RAEA 4Y52J 2DLLA 3A01A 4RNNA 3C1DA 4P96A 4BEHA 4A3IJ 1TC3C 4I02A 5KFNA 4M9ZA 3FIWA 2LVSA 4U0VA 3CJNA 5D6EA 4E4HA 4O2AF 1JE8A 5JLWA 3GFIA 3S2DJ 2LREA 1MJ9A 2XAUA 3OYFA 1JXSA 1WQ2A 4LMYA 2HZDA 5FRNA 1IXCA 1X4PA 1K78B 1D1BA 5E3LA 4LH6A 4UCVA 3HKZA 2K9LA 3K4JA 3F8NA 2BW3B 3GVAA 1KQ8A 5EWGA 1Y0NA 1D3YA 4CGZA 5IYCG 4YR0A 4P5OA 3LSPA 4DGWB 4ZTFA 1ZQ3P 2F5CA 1EH7A 4PDKA 3BTIA 2FA5A 1MNDA 1U5TB 3M1CA 3OR1C 4OWRB 5LEJA 1C3OA 5FGMA 3EUHA 3PZPA 2HNHA 4J0MA 4MTEA 3RYRA 4GFBA 3K3VA 2JQ7A 1P92A 1TNTA 2GPSA 2L7FP 4MGRA 3N8DA 3JTGA 3K3PA 4DR6H 2WY7Q 2W6ZA 3B02A 5IYBJ 3CMEI 4CH7A 1T94A 2JA8J 3DBLB 3J81K 3GIJA 4YJ2F 3WTWC 1IV8A 4AIKA 2Y0SA 3IH4A 3JR9A 3S2HJ 3BG5A 5CVRA 4OAYA 5C3EG 3K1PA 1VNDA 2OLSA 3OL4A 4UXNA 4ZC3A 3TGNA 4LFAH 1HNWH 3L4JA 5GAGJ 1TQPA 5LA6F 4PSWA 5J2TF 5LXTF 1DUXC 5E3NA 2HDWA 3BP8A 2NOJB 3JRAA 5ILVA 1SFKA 2OTJI 3RIZA 5B66C 4B1RA 4FS1A 1IRXA 3ZQGA 1Y39A 5KFKA 2FBIA 3GIPA 3FHNA 2DTRA 1LVKA 2MH2A 4CZCA 4JI2H 5C44G 1UELB 3L00A 1KBLA 3GZNB 2X0LA 4Q48A 3FKIG 4EMSA 1JHFA 2R7NA 3CCSI 2JA6A 2EFOA 3WODF 1BW5A 2TRTA 2XGXA 3HBLA 1BL0A 1ZGJA 1KJQA 4RLQA 2V1UA 5HDGA 4XNFA 3S1RJ 2KRFA 3IRQA 1Z1DA 3QP5A 2DQLA 2ELJA 2F4IA 4M74A 3SEQA 5ICEA 4BJTA 1N33H 1FJGH 2W9CA 2IEKA 1G4DA 3BLYA 3LMLA 4MV8A
chains in the Genus database with same CATH topology
2HR3A 2IW5A 2EFWA 4IPAA 5HS9A 3ZN0A 2HEOA 3IL2A 1OR7A 1XDSA 4A12A 1FVIA 4DR1H 2FE3A 2R7FA 1G3TA 1TAEA 2MD5A 1CGPA 2ZBKA 2ZKZA 1GXPA 3PQKA 5E1WA 1L2ZA 1N34H 1QNTA 4WK8F 1QQIA 4LFCH 2F5EA 3KP7A 1J0RA 1FSEA 1LEBA 1TW2A 5L3BA 4LH7A 4MEYF 3ZMVA 3RI4A 1W7PA 4IXAA 2PFBA 2Y48A 3Q5FA 5FPOA 1BJTA 4YFNF 3N44B 1BIBA 1ON1A 4P9FA 3O6BB 2OZUA 3TDZC 3JSLA 1K7AA 4WF2A 3J81Z 2ESNA 3I59B 3SHFA 1Y0UA 5FLXW 5JVTA 3FXQA 2CW7A 2W25A 2R3SA 2EFNA 4CC5A 1XCBA 3RJ0A 3GWZA 1Z05A 3SFZA 4IF4A 4M7EA 3KP5A 4I0AA 2K4BA 1O7LA 2BGCA 2XAQA 2EK5A 2M45A 1KU7A 1JHHA 5L3GA 2OQGA 1D5VA 3SZPA 4HX8A 1YYVA 4LF6H 1O3SA 4OMZA 1R5GA 3GFJA 3WGIA 2PG4A 2G7UA 2QQ9A 2P7VB 5BMZA 3JSOA 3FMQA 3T1BA 4HX7A 1P4XA 1PP8F 3JSNA 3TKYA 2D2WA 4LF5H 2DT5A 4OIQF 4PGGA 5KVRA 4NXNH 4H0EA 4P9UA 1IW7F 1BGWA 4MQVA 3GO5A 1M0WA 2UXBH 3GFMA 2AS5F 2PEXA 3HSRA 5L3CA 2VT3A 1QPMA 3F22A 4KN7X 2D45A 3I54A 1KA8A 1STZA 2ZNZA 1FP2A 1WI9A 3DQVC 1KYWA 3TO9A 3WG9A 3ECHA 2XKPA 3FWEA 3V7SA 4L18B 1HNZH 2QWWA 1LJ9A 5CVUA 5J8FA 4LB6B 3VOEA 3COAC 2ISYA 1HW1A 3OV8A 2ISZA 2O61A 1X9NA 2FQ3A 2KKOA 5F1RA 3OTOH 1KYZA 3I53A 2HKXA 4HDVA 2HQNA 3IWZA 4APMA 1IBLH 1WWXA 2EJRA 4DV6H 4OIOF 3DPTA 2W84A 4L9JA 3RGXA 4GKKH 1E4FT 5DUKA 3GYHX 4RS8A 4HQEA 1FT9A 5E20A 2OQRA 3HXLA 2H09A 3ABTA 3WU0A 4HLXA 2GZWA 2KIUA 2MH9A 4O5VA 3GXOA 4ZYHA 3HOTA 2GIVA 2YU3A 3RKWA 1BN5A 1SD7A 4S05A 2XAJA 1F4KA 1W7PD 4DUYH 3MQ0A 4YFKF 1ZYRF 3KP2A 3M4IA 3ELKA 4DV3H 4A5MA 1F1ZA 1HNXH 2H6BA 2L4MA 4FX4A 4EJTA 1AN7A 1TQMA 2BBYA 3VODA 4JI4H 2HGSA 1FYKA 1IN7A 5HS8A 1S68A 4IAJA 2CSOA 4XSZF 2ZNYA 4EFBA 1IBKH 5K5QA 1ZHFA 4EFEA 5DDGA 2MCTA 3SZTA 2Z9OA 2L4AA 3HUGA 4NB5A 4OIRF 2M5WA 2YX4A 3NQOA 2FEZA 2HQRA 4YFXF 4LD5A 3E97A 4M9XA 1U78A 3LA7A 3KLOA 2IVMA 2RGVA 4LK1F 2L54A 3LAPA 2P4WA 1LDDA 3BROA 4HYEA 4G7ZF 1G3SA 2WV0A 4BXUA 3GW2A 1TW3A 1JGSA 4DV0H 1YO5C 3DV8A 2QQBA 2OD5A 1I1GA 3KALA 3T1YH 2RDPA 1BI2A 4HX4A 2H27A 2XAFA 2UXDH 4A0YA 1MGTA 2VQFH 4Z2YA 1I94H 3M1EA 2WE6A 3KP4A 3RYPA 4N9IA 3H92A 4CC6A 2E7WA 1SMTA 1Z2NX 3H3ZA 3E5UA 3HOSA 2QZ8A 4U7BA 1EV7A 2KJCA 5LHGA 2XUBA 3DXJF 1T0FA 4QLCU 2WTEA 4HF1A 5L3DA 4LF4H 2STTA 4EGYA 1E2XA 4OU0A 4DV4H 4AIJA 5FLXK 2A68F 3CLOA 1U5TA 2O0YA 5LLQA 1BM9A 4M9SA 2CW8A 1RNLA 1TLHB 2Y0MA 3REOA 1TA8A 4AIHA 1XCVA 4GYIA 4KIGA 1U3EM 2G9WA 1Q1HA 4ZH4F 3ZMZA 3WTTC 3JAMW 2O8XA 1BJAA 4EM0B 3QAHA 5IWAH 1VTNC 2VUGA 4ESFA 2NNYA 2QBYA 1TNSA 1ZG1A 4BAYA 4NQWA 1OYWA 3U2RA 1MKMA 3V8JA 1LB2A 3ZMSA 5H6QA 3LQQA 1J5EH 1DP7P 3DF8A 4G7OF 4S04A 4I0BA 1U2WA 4YHHH 3IC7A 1Z2OX 1LEAA 5D8KB 1LDKB 3RKYA 4N9HA 1T38A 3P9KA 2CW0F 2XHKA 4N0BA 3LAJA 2F5FA 4JQFA 1J7KA 3WE2A 4WWCA 4R1HA 2K86A 1O3TA 2COMA 1R1UA 1R1TA 4DUZH 1QBJA 3CUOA 3P9CA 1R7JA 2YCHA 4G9YA 3CO6C 1H0MA 2OWOA 4EM2A 1UB9A 1YLFA 2YX7A 4KYWA 2A6EF 4M73A 4L9NA 2XIGA 4PCQA 4BH9A 2CFXA 1TBXA 1N32H 1HKTA 1IUYA 1OYYA 3MAJA 4XLPF 5FLXZ 5BPIA 3TO6A 2QM3A 5EEHA 3L2PA 3ZN1A 1XGMA 2RKHA 1A0IA 2LF8A 5FFZA 3I59A 2PI0A 3BWGA 2FBKA 1OPCA 3KAKA 3DP7A 2A6HF 2L3DA 3CDHA 4LLNA 1C0WA 4K0KH 4NXMH 2ZJ2A 3PN1A 3FM3A 2EFPA 2VT2A 2ZM6H 2OBPA 3HHGA 3D0SA 3RGZA 3QPHA 3T8RA 3I71A 1BIAA 1FC3A 5IT9Z 2JZYA 2NAZA 1KQ9A 3H20A 1O3RA 5LMNH 4ASNA 2DI3A 4UCTA 2WYOA 5EEGA 2IP2A 3V8KA 3RPQA 4UCUA 1FWZA 2FMYA 2VBZA 5D4SA 2F4VH 5CYVA 4R79A 2WWYA 2IJLA 2E7XA 1B9MA 4ENKA 1R5HA 3KCCA 2DQRA 4KIBA 2TDXA 4KHPH 1IN5A 3MZYA 4U88A 1V3FA 5BPDA 3QRFF 4LLGF 4L9VA 4X64H 1LQ1A 3ML6A 3U1DA 1YG2A 3R4KA 3V7RA 3BZ6A 4KIFA 2M1BA 1FY7A 2HS5A 2HTJA 5JHUA 3FHZA 3F72A 2J5OA 3BABA 3ABUA 2LDUA 1AWCA 4WCGA 2KIFA 4AVPA 4I98B 2OU2A 3DF7A 1WH2A 1MDMA 1YFHA 4Q0YA 4B3MH 5JFRA 2Z99A 4K2EA 2IA1A 1G3WA 2R7DA 1W5TA 1XMKA 4UHTA 2RNJA 5D4RA 3LWFA 2J5PA 3RKXA 3EYIA 3F6OA 4OINF 4DR3H 4JI1H 2HGCA 4CICA 3FM5A 2EV0A 1J9IA 5CLSA 3JTHA 2E1CA 1ZRFA 2ESHA 4KA4A 1XSVA 4Q47A 4U0WA 5CJ9A 3J80W 3L4KA 2VE8A 1RZ4A 4UCSA 1Z2PX 1A04A 1OKRA 3BAAA 1ZH5A 3SXYA 2Z5UA 4A6EA 3QOPA 3Q9VA 1HSJA 3HRMA 3V7CA 3I0TA 2P5VA 3GFLA 2NYXA 4BYYA 5LEKA 5HDNA 3L9FA 3BDDA 4L0ZB 2A5YB 1P4AA 1J75A 4YG2F 5D5UB 2G7HA 3R60A 5K1YA 3JAMK 3BPVA 4B3RH 2K02A 4D0PA 2VC1A 2H6CA 5LGTA 3C3WA 1IBMH 4LFUA 2HDCA 1SFUA 3ZMUA 5FD6A 1HKSA 1FX7A 4I01A 4DR4H 5F64A 4LG0B 3HYIA 2HZTA 1J59A 2M87A 1PP7U 1EH6A 5ICFA 1O57A 3RTRA 3N4MA 5DEQA 1LVAA 1YTYA 2LKPA 4XSXF 4EM1A 4HQMA 3N97A 1ZARA 4KT5C 2QLZA 3F3XA 1HXDA 1IRFA 4HOBA 4B3SH 5E17F 3MCZA 3BPXA 1Z9CA 2C6YA 1IRGA 5D5WB 2JPBA 2ZCWA 3WU1B 2ZMEA 3FF5A 1S7AA 5K5RA 1I5ZA 3ZMDA 3E3VA 5E1ZB 3R6SA 2DO7A 1R36A 2V79A 4CO8A 1SYXB 1XSXA 1K6OA 2NRAC 5ED4A 1MJBA 4UCOA 2F5DA 4XLNF 1Z7UA 2RV8A 2GA2A 2VODA 2HYFA 4BHPA 2HOEA 3VB2A 1TTYA 5TRDA 3RJPA 1ZRDA 2GXGA 5BR8H 5D8LB 1ZG5A 4MHGA 2NS0A 4LJZF 4E70A 3UQ8A 2E5LH 4F7ZA 4UNOA 4LF7H 5D1OA 1WRJA 1SAXA 1MJAA 2VXZA 2O03A 2UU9H 2B0LA 4HV5A 2GAUA 4YIFA 5L3EA 3FMRA 1P4WA 1DGSA 2YSRA 2EA2A 1YW7A 3KP6A 4I7HA 1B6AA 2DU9A 2FMLA 4UFZA 1IXSB 1TQIA 2QUFA 1I6UA 4LF8H 4UVAA 1XMAA 1W4MA 5E8IA 2W24A 5TJJA 2HKOA 2DPUA 2EFQA 1S6LA 5AONA 1S3JA 2UXNA 1T98A 3KAJA 3J81W 2K27A 3K1MA 4M72A 3MZHA 1QGPA 3T1HH 2RGRA 2W85A 1WSUA 4EJWA 1T39A 1MZBA 5D5XB 4IRIA 1UFMA 4GXOA 3E6BA 2HFHA 4BWSC 1XMOH 3TO7A 4JI5H 2Z3YA 2Q2EA 2AXLA 4G8XA 4HAMA 4I09A 1LDJA 2YR2A 5ICCA 2GQQA 5HLHA 2GXBA 1G3YA 3ZQ7A 4I2OA 1IF1A 3F21A 2DBBA 3ZPLA 4G6QA 5FFXA 3ZP5A 1P2FA 1N36H 4FX0A 3DPLC 5H6RA 1S7OA 4L0YB 1XSDA 1T2KA 2VE9A 2VOOA 2PMUA 2F2EA 2W57A 3ROUA 4BHBA 2HVSA 3HRTA 4CXFA 4L5JA 1DDNA 5L3FA 4BNCA 4ESJA 4Y17A 2L01A 4IJAA 3ECOA 4A2UA 2D1HA 1ZGAA 3T5XA 2ZO4A 5LHIA 4LSXA 3TQNA 4CHUA 3GZ6A 1H9TA 1FBQA 3K0LA 1Z91A 1CF7A 1R58A 4X65H 3ZMTA 1U6GA 1I27A 4R8HA 4UVBA 4RGSA 4RGUA 3O2PE 3W6KB 3I64A 1S03G 3K2ZA 1ZREA 2FNAA 4MV7A 3C18A 4M6YA 2GA1A 1K78A 1I6XA 2PBIA 4DR7H 3E6CC 1V4RA 1OYIA 2A61A 3WE3A 3J80K 2MLGA 2UWMA 3M9AA 3GEZA 2IPQX 5DCFA 2CYYA 5D1PA 2VBXA 1KU9A 1SFEA 1YQAA 5AIQA 3T8TA 2FRHA 1ZHSA 1F9NA 1GVJA 3CUQC 4A5NA 3HHHA 2IRFG 2FOKA 2CQKA 2FSWA 3DFGA 3PFIA 1RI7A 4DV5H 2O6GE 1K79A 1EH8A 2P5KA 4X66H 3M8EA 5FD5A 1PDNC 2H94A 2JSCA 4KMFA 3FXRA 1HBXG 1BC7C 1GXQA 3F8BA 2VC0A 3WTZA 1O3QA 1HQCA 1ZLKA 2FBHA 1QZZA 2ZJTA 3N41B 1FLIA 2CGPA 1R1VA 1RUNA 3KP3A 3KETA 5IT3A 5HS7A 3FMAA 3ISPA 4M71A 3S2WA 2FU4A 3K9TA 4AWXB 2A07F 4MNUA 4CYDA 5ILSA 3QP6A