4I7HA

Structural basis for peroxide sensing and gene regulation by perr from streptococcus pyogenes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
DIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVCEICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords peroxide stress sensing regulator
publication title Crystal Structure of Peroxide Stress Regulator from Streptococcus pyogenes Provides Functional Insights into the Mechanism of Oxidative Stress Sensing.
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 38
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i7hA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4i7hA02
3HSRA 3QPTA 3HHHA 3T8RA 3M8EA 4ZZLA 2STWA 3R60A 4GO1A 3L9FA 3HSFA 1RUOA 1FY7A 4G7OF 4HF2A 3SQNA 4P9UA 2OZ6A 1LDDA 3S2WA 2IT0A 2A69F 3JAMK 3ULQB 3I64A 3RKYA 2ZKZA 4L9NA 2PFBA 5E8IA 1G3YA 4EJOA 1OYIA 3F8MA 2GXGA 5E1XA 3VODA 3JAMZ 4R79A 1OMIA 1IN7A 3D0SA 5JVTA 3KZZA 3I4PA 4Z2YA 4RB1A 2HGCA 2CGPA 1YW7A 4NHJA 1R58A 3K9TA 2OU2A 1MJ9A 1YLFA 1IW7F 4PGGA 2FMYA 3TOAA 1ZRCA 1FSEA 2ISYA 4ZYHA 4WK8F 4ENNA 3GEZA 1WI9A 3K0LA 3BZ6A 4FX0A 1BI2A 4ENKA 1MZBA 2Q0OA 1H9GA 4G6DA 5D4RA 3D5LA 3F3XA 2KIMA 5L3CA 1LVAA 2HOEA 2F5DA 2GXBA 5FD5A 5CVVA 5BPDA 1S7AA 1LQ1A 2XAHA 1ON1A 3ELKA 2Q8KA 4HLYA 5FFZA 2DBBA 1KGSA 1XCBA 2J5PA 2D45A 4L0ZB 3KLOA 5DD8A 5FLXZ 1R1TA 3F72A 5HS8A 4EJVA 1G3WA 4KT5C 2MH2A 2GAUA 3LWFA 1SFUA 4RGSA 2H09A 1ZGAA 4CDGA 4BQAA 1ZREA 1JHFA 5ILUA 3ZMUA 4ZH4F 3U9GA 2DQRA 4HZFA 2ZMEA 2EV5A 1J9IA 3TQNA 1BN5A 1USTA 5K5OA 3F22A 2LF8A 5LBQA 4ESFA 4MTDA 3FM3A 2JZYA 1ZRFA 4B8XA 2E1CA 2R7FA 3GF2A 3TDUC 2WTEA 1KYWA 3ERED 2Z3YA 4U0WA 4Q4ZF 1AWCA 2WV0A 1LDKB 2PQ8A 1U5TB 3TO9A 2IA2A 2OQGA 3HUGA 2NRAC 4EQQA 3V4GA 1YYVA 1YIOA 4MQ9F 3LSTA 5HVQC 4R8HA 4JBAA 1NHAA 2GWRA 3DPLC 2V1DA 2O0YA 4UHTA 1SMYF 3PFIA 2VC0A 1IN5A 5LGUA 2STTA 3ZMDA 3TO6A 3HSEA 4I7HA 1DP7P 2PBIA 3F6OA 5K5RA 3E3VA 2CSOA 1FX7A 1YW9A 1TNSA 4L9VA 1XSVA 1RZ4A 3FF5A 5DV5A 4AWXB 1C0WA 2KJCA 2A6EF 1CGPA 1P2FA 4KICA 3ABTA 4LD5A 4GYGA 3DV8A 1SD4A 4HYEA 5LEKA 2EJRA 4I0AA 2K4JA 2M45A 4UNOA 3BP8A 3RKXA 3CUQB 4KN4X 5HLGA 1UB9A 1OPCA 2HYGD 5D6EA 4YFNF 2MLGA 4XLNF 2V79A 4I98B 4MTEA 4WXCA 3FMRA 4ZYGA 4HDUA 4O3MA 4RB3C 5LGNA 4BNCA 5HDGA 5HS7A 5D4SA 2ADUA 2W57A 1T6SA 4ESBA 3CO7C 1TTYA 3E6BA 4DNCA 5LEJA 2HS5A 2V6CA 2W25A 4ESJA 2P8TA 3MQ0A 1FPQA 2F5EA 3TOBA 2QBYB 5JI6A 3O2PE 2EA4A 4MEYF 2XAFA 4KIFA 4I0BA 4BHBA 1P92A 2YPRA 2O61A 5LHGA 4HOBA 1B4AA 2RDPA 5DCMA 1KA8A 3MZHA 2A61A 3L00A 3GFLA 2JPBA 1ZLJA 3E6DA 1MJAA 1HW1A 2M5WA 1ZHFA 5D5UB 2XIGA 3ZMVA 1MGTA 2K7LA 4AIHA 4A2UA 4M9ZA 5BOXA 3BY6A 5JR3A 2HR3A 3KFWX 2WWYA 1EH7A 5DEQA 3HYIA 2BBYA 1G3SA 1T39A 4IF4A 3WTSC 2P7VB 5KVRA 1XGNA 2A6HF 2NS0A 4XBFA 1IXRC 2ISZA 3VB2A 3NQOA 3RPUA 2RVCA 4HAMA 2EA2A 1SD6A 3J80Z 5TRDA 1G3TA 2HQRA 4BHPA 2HDCA 5J8CA 2O8XA 2Q2EA 2FXAA 1K78A 5D8KB 2EFOA 3NRVA 1R1VA 3GFIA 4KNYA 5JHUA 4JQFA 2XAJA 3BJ6A 4MEXF 2L4MA 1XMKA 1Z9CA 4EVIA 1AOYA 5L3FA 1I1GA 3BROA 1QBJA 5E17F 5HDNA 3AAFA 4HQMA 4YIIA 1W5TA 3E5QA 3KP7A 3ZN1A 1T98A 1SMTA 2GIVA 1HW5A 2BE5F 1XSDA 3ZMTA 4IHTA 1ZN2A 1GXQA 1YO5C 2Z99A 2XV4S 1FYLA 1FSHA 2PEXA 3DKWA 4PDKA 3EYIA 1FBSA 2F5FA 1U3EM 1XDSA 3KP2A 3EETA 4RAZA 3WTTC 2L3DA 1ZLKA 3RJPA 1FC3A 3HOSA 3B73A 5DD4A 2LF7A 4AD9A 5IT9K 1BI1A 3PQJA 2VOOA 2BYVE 4KIBA 4G6QA 2ZCWA 1R00A 1QQIA 3L2CA 1XDUA 2P5KA 4UVBA 3M7GA 1U2WA 2OD5A 5BMZA 4BYYA 4HF1A 4LK0F 2PI0A 3I0TA 4ZYDA 4YFKF 4AVPA 5LRSA 3LQRA 3G73A 3ECOA 1ON2A 1R7JA 4UUVA 3P9IA 1R22A 3PQKA 2L01A 3SZTA 2IVMA 2CO5A 4L5JA 1FZPB 1IXCA 1ZRDA 2CW0F 4WF2A 1V4RA 4ZZDA 4IJAA 1B6AA 4BH9A 4QWQA 3RIRA 3I71A 2VBXA 5LHIA 3KP4A 3ZN0A 2R7DA 1W7PB 3IWFA 3HIFA 1BBYA 1Z7UA 3W6JB 4JK1X 4M72A 1HBXG 3V7RA 3IHUA 3LQQA 2E7XA 1ZYRF 2PJPA 3WTZA 2QQAA 4P9FA 4LLGF 1W7PD 4CZZA 5L3GA 2YU3A 3WTXC 3I58A 4H0EA 3MEXA 3J7AO 1FYMA 2DO7A 1P6RA 3Q9SA 1YQAA 4UV8A 4AIKA 1ZG1A 1F5TA 3T5XA 3FMSA 1MJBA 5CJ9A 1O3RA 5K1YA 2Y0MA 4EMSA 2PLYA 4HLXA 1K79A 3ZPLA 3JSPA 3U1DA 4LFUA 1J2XA 3QU3A 2UXNA 2ETHA 3FZVA 3SZPA 3F23A 2K4BA 3F8CA 2RC4A 3I53A 5FFXA 1BOAA 5A2QK 2RN7A 3M1EA 4OINF 3F21A 2EFNA 2UXXA 2L02A 1UCRA 4XSXF 1PDNC 3TKYA 3E5UA 2ESNA 3KCCA 1LDJA 3WODF 1PP8F 5DUKA 2HKXA 1IRGA 4EJUA 4UVCA 5TJJA 4EGYA 1J75A 2P6TA 3CTAA 1F9NA 2GZWA 4A0YA 3GFJA 3CDHA 1TBXA 2FA5A 1HQCA 1XCVA 1DPUA 3SXYA 2DU9A 1R36A 4M71A 4UVAA 2IW5A 2YX4A 1R5HA 5H6RA 5D5VB 2RNJA 4CHUA 4OIQF 4L18B 2FEZA 3MAJA 2XRNA 2X4HA 2NAZA 2YSRA 3J81K 2LDUA 3JW4A 2FE3A 1VTNC 4DQ2A 1XGSA 1U8RA 2VBWA 4U7DA 4A0ZA 4KMFA 4E70A 2HTJA 1R5GA 2O3FA 3GWZA 4LLLA 2H27A 5HLIA 5J8FA 4KUMA 3KLNA 3FM5A 1MD0A 2HTSA 1OKRA 2EFPA 2ZXJA 2P5LC 1LB2A 2XVCA 4A5NA 4G7HF 1YG2A 4FHTA 4S04A 4BAYA 1IUYA 4XSZF 1T38A 5J6XA 2HQNA 1HXDA 3H3UA 2ZMEB 5ILSA 3RI4A 2EV6A 1WKMA 4YG2F 1IN4A 2A5YB 5F64A 2FNAA 3LAJA 5E1ZB 3V7CA 1EH8A 2XHKA 1P4AA 2Y48A 5LHHA 4M6XA 1ONVA 2VODA 1IF1A 1J7KA 2X0LA 1S7OA 3IWZA 3EQLF 3QP6A 1B1BA 1BC7C 4HQEA 3HHGA 5EEHA 1SD5A 3IRQA 5D5WB 4I01A 5KK1A 3R0AA 1T2KA 1TW2A 4G94A 1XMAA 3FXUA 3Q5FA 5F6FA 5D8LB 3H92A 3REOA 2RKHA 3M9AA 4OIOF 3QPHA 2OA4A 3MFKA 1S6LA 3QU6A 1KQ9A 1TQIA 2VT3A 4NQWA 3KEQA 3R61A 3DXJF 2PMHA 2DTRA 3FXQA 3WTYC 2FSWA 1ZARA 1BI3A 4M9XA 3RDIA 4EV0A 1S3JA 2BEOA 4ETSA 5D5XB 2Z5UA 1Z6TA 2QBYA 5IT3A 3B02A 2UWMA 4HV6A 1S8NA 2E1NA 2XAQA 4WCGA 1PP7U 3BJOA 1TNTA 3T8TA 1BIAA 4HX8A 3FWEA 2AXLA 3RPQA 3U2RA 2JSCA 3BOQA 3WGHA 1BM9A 1G6NA 1Z1DA 5HS9A 4MNUA 2XUBA 3GW2A 2ZNZA 5E18F 2IRFG 1U6GA 2VXZA 2KRFA 4HX7A 2YX7A 2J5OA 1W4MA 3O6BB 4LG0B 3WE3A 5DYMA 2DFIA 1SFXA 1BJAA 3BWGA 4N0BA 4XRFA 4FT8A 3LA2A 4HW0A 1A04A 1IN6A 4GGGA 1KU2A 4KYWA 2E7WA 5ILVA 5L3DA 2XGXA 4OIRF 3GO5A 5CVUA 1FOKA 4EM0B 4RGUA 3WG9A 1RNLA 2VBYA 1WRJA 3EDPA 2CFXA 1L0OC 2QYOA 4EM1A 1LEAA 3C3WA 4WXHA 1FNNA 4EJTA 3RKWA 4AIJA 1FBUA 1GHCA 1RUNA 2L54A 3LFKA 1HSJA 1I27A 3IRRA 3GX4X 4YIFA 2ZFWA 1P4WA 4Q48A 2CG4A 2IJLA 2H94A 3P9KA 3E97A 3ML6A 1REPC 1ULYA 3SFZA 1YFHA 1FLIA 4EM2A 1K78B 3ZMSA 2FU4A 4CXFA 1OR7A 3RYPA 1MDMB 3ROUA 4LMYA 2XROA 5CLSA 2XKPA 4A6EA 3OV8A 2NNYA 4L9TA 3IKTA 1TQMA 1O3SA 1I6XA 2O03A 1XGMA 4A0XA 3BJAA 5E8GA 4YFXF 2KIUA 2ACJA 4HF0A 3DEUA 2FBIA 2DT5A 3V8LA 5IT9Z 1YS6A 2EV0A 3K1MA 1FP2A 2OZUA 4R1HA 3BDDA 1DDNA 1W5SA 2QM3A 1CF7B 2VONA 3HTSB 1SFEA 1QPMA 3DPTA 3E5XA 1HKQA 3HOTA 2HYFA 2FMLA 3CJNA 1T0FA 3H3ZA 3I59B 1B9MA 4K2EA 1S29A 4GXOA 1UFMA 2MBFA 3HTUA 2KIFA 4FX4A 1UHWA 1IAWA 5HDKA 1IZ1A 3JTGA 3DFGA 2XAGA 1I5ZA 4ENMA 3IKVA 5AIPA 1LNWA 1D3YA 1FWZA 1W7PA 2D1HA 3C1DA 3CLOA 2PN6A 2VOPA 2W24A 2FF4A 4U7BA 4CGZA 1YW8A 3T0YA 1FP1D 4D0PA 5FGMA 3BPXA 3P9CA 1XGOA 1HSTA 1ZH5A 3JSOA 4L0YB 2ZNYA 3W6KB 3V7SA 4HV5A 1WSUA 4OIPF 3Q9VA 1Z91A 3TO7A 2VT2A 1WWXA 4HX4A 4S05A 2PG4A 4M6YA 3DQVC 2ZO4A 4KA4A 3HRSA 4KN7X 5E20A 3KZYA 3ZMZA 1SD7A 4UXNA 4WXDA 2P6SA 1F4KA 4PCQA 4Q47A 2QZ8A 1STZA 1D8KA 2VC1A 2DPUA 2B0LA 2DW4A 3F8BA 1O3QA 3DP7A 1O3TA 1J5YA 3F6VA 3WTVC 2F5CA 2NNNA 3E6CC 3LAPA 1TQPA 3WTWC 2G7UA 3HRTA 2IA0A 3FXRA 3R0JA 3VOEA 4IPAA 3GUDA 4ENJA 4KFCA 1ZG5A 2FNPA 4Y15A 4A12A 5H20A 1USSA 2W84A 2A68F 5A2QZ 2JT1A 5FD6A 2HWVA 4IRGA 4OMZA 2DPDA 4U0VA 2JTVA 3GZ5A 3K1NA 4TV7A 1LJ9A 4MQVA 1WQ2A 5FB2A 1IN8A 4LJZF 2V1XA 2DK5A 3MZYA 5LLQA 5CVIA 2EFQA 1MKMA 3COAC 4I02A 4L5IA 5L3EA 1FYKA 3KEOA 4IXAA 2QVOA 4RGRA 2VE9A 1K6OA 2NYXA 2AS5F 4RB2C 4LLNA 4BXUA 3GXOA 1DPRA 4KDPA 2CQKA 3FMQA 2LKPA 2DK8A 4NB5A 2D2WA 2LSOA 3NEUA 4IRIA 2RV8A 4O6JA 1KQ8A 1Q1HA 3J81Z 2YR2A 3WTUC 5FLXK 3F8NA 2QQBA 2C6YA 3ZP5A 5DCFA 4A5MA 4HA8A 2COMA 3K2ZA 2A07F 3I5UA 3VEPA 1BC8C 2MLKA 1QGPA 3WE2A 1O57A 1EV7A 2QWWA 2H6BA 2RGVA 2K86A 3N97A 4PGHA 3F8FA 4UV9A 4CYDA 5DUIA 2RQPA 2DLLA 3O3KA 4G9YA 3DF8A 1OYWA 5ICFA 5AIQA 3GZ6A 3RTRA 1U5TA 2FOKA 3GYHX 4Y13A 4P5OA 1JXSA 2MC3A 2JRTA 5CVJA 2FRHA 4RAYA 3HRUA 1Z05A 1XB4A 2FBHA 4RGXA 1U78A 4OOIA 2ELHA 3WU0A 1LEBA 2EFWA 5ED4A 1DUXC 4O5VA 5D6FA 1ZAOA 2M87A 1O7FA 2VBZA 1L3LA 4LB5A 1B59A 4P55A 2BV6A 2F2EA 4XLPF 2V1UA 5HOOA 1KYZA 3KP5A 1IRFA 1B9NA 4RB0A 2UZKA 2WC2A 2IA1A 2IPQX 5AONA 2CWEA 2EK5A 3HRMA 1O7LA 1FBQA 2JPCA 3KP3A 3CUQA 2HKOA 4G8XA 1G4DA 3SHFA 3CUOA 1E17A 1I1SA 4ZYEA 3E6MA 3R6SA 2M8EA 3KP6A 1PUEE 2LNBA 1KU7A 4IRHA 3GFMA 3LA3A 2K27A 3QOPA 3MCZA 3WGGA 5E1WA 1KQ0A 2OAZA 1UHMA 4IVNA 4M74A 2R3SA 1QZZA 4CO8A 1IXSB 2Z9OA 1XN7A 4EJWA 4KMUX 1XSXA 2G9WA 5CYVA 2L4AA 1D5VA 3ABUA 2TDXA 4LGWA 1J59A 1YS7A 3T1BA 3KE2A 2P5VA 2FQ3A 4BHCA 5LGTA 3C7JA 3IC7A 4N9IA 3QAHA 5ERIA 1QZYA 4ASNA 2IP2A 4L9JA 4GYIA 4LG0A 3K1PA 3P7NA 1P4XA 3WGIA 2K02A 1Z6RA 1OYYA 3CO6C 6PAXA 3LA7A 1TW3A 2D1VA 3M8FA 5ICEA 1R1UA 1H9TA 5BPIA 5H6QA 5DCMB 3V8KA 3GLXA 2VN2A 5CVRA 5L3BA 1GVJA 1JGSA 1KU3A 1X3UA 1H0MA 5DDGA 3EUHA 4QLCU 1EH6A 2ESHA 3V8JA 2OQRA 2EWNA 1XD7A 4Y17A 4F7ZA 3ZQ7A 3G3ZA 3J80K 1HKTA 5JFRA 3IL2A 2KJBA 1QO0D 4M73A 5BQTA 2XASA 3OOPA 2M1BA 1JE8A 2H6CA 3EYYA 2HEOA 4P96A 2W85A 5ICCA 1SAXA 3GVAA 1MDMA 4A6DA 1ZG3A 2FBKA 2P4WA 5ICGA 4GCVA 2EB7A 4OU0A 5LRRA 4PZJA 1ODDA 5EEGA 4I09A 1RI7A 2HFHA 4WWCA 5F1RA 2KKOA 3C18A 3ECHA 3QP5A 3TDZC 1BI0A 2QQ9A 4U0YA 1R23A 3VFZA 4LK1F 4EGZA 4OMYA 3RYRA 3K69A 3WU1B 1RIOH 1CF7A 2DQLA 2MH9A 1HKSA 4Q5SF 3FX3A 2OBPA 2QLZA 5FO5A 1V3FA 1FT9A 3FHZA 3I54A 4G7ZF 2XKOA 3I59A 3BPVA 2GA2A 2Z33A 2M30A 4RS8A 3QRFF 1E2XA 1Y0UA 1KU9A 4U88A 4WX9A 5K5QA 1D8JA 2DI3A 1J0RA 1U5TC 2O6GE 1HW2A 2V9VA 2Y75A 4IHSA 4KIGA 3L7WA 5BS6A 2G7HA 2QENA 2HZTA 3MWMA 1F1ZA 3TGNA 4HBLA 2BGCA 3R4KA 1BIBA 4M9SA 4I2OA 1ZGJA 2ZBKA 2DAOA 1K7AA 2P7CB 2ZJ2A 2PMUA 1JHHA 4B09A 3L09A 2VE8A 4HDVA 5HLHA 1YTYA 2A3SA 3JTHA 3N4MA 1GXPA 1QNTA 4MHGA 2MA3A 2CYYA 4LB6B 2MD5A 1TLHB 4MGRA 4N9HA 4CICA 2QUFA 4ON0A 3CUQC 3ISPA 3KETA 2GQQA 2GA1A
chains in the Genus database with same CATH superfamily
3HSRA 3QPTA 1KJIA 1AU7A 3HHHA 1E4GT 3ZQQA 4NLGA 1VQ4I 5IYDJ 3S14J 4JOMA 3T8RA 2CUEA 2EQRA 2HDWA 2I5UA 1OFCX 3M8EA 3R60A 3L9FA 3HSFA 4GO1A 1FY7A 3OS1A 2ZXIA 1RUOA 3GTKJ 4G7OF 3OSPA 3BAAA 4HF2A 5M5XJ 3SQNA 4P9UA 1SFOA 2OZ6A 3KALA 4DLKA 4QIWN 1LDDA 3S2WA 2IT0A 4LH6A 4ECYA 1VQ6I 3ZQFA 2A69F 1IRXA 3HEFA 4Q45A 3JAMK 1RYSA 3ULQB 4BQNA 2F4MB 3I64A 3RKYA 2ZKZA 4L9NA 2PFBA 5E8IA 2TRTA 1Z3XA 1G3YA 2Y2ZA 4EJOA 4CYCB 1ZR2A 4GFBA 2R8HA 1OYIA 2JJ7A 3ZQGA 3F8MA 5KT2A 4F4XA 4BEHA 4GKKH 2GXGA 1LVKA 5E1XA 1MSEC 3V4SA 4JX6A 3VODA 4A3EJ 3JAMZ 4R79A 4AM3A 1OMIA 1IN7A 3KPHA 4J01A 3D0SA 5JVTA 2QEXI 2ZXHA 2VQCA 2TCTA 3KZZA 2WB1N 2LKSA 3HOYG 3I4PA 4Z2YA 1RJRA 2QF7A 4RB1A 1FIPA 2HGCA 2CGPA 1IBKH 3BR6A 3J7YJ 1RYRA 4B3TH 1YW7A 5C44J 4NHJA 4FTHA 1R58A 5EG0A 1X3WB 3K9TA 5KFEA 2OU2A 2DOAA 2ICWG 1A36A 1MJ9A 1YLFA 1IW7F 5FKKA 1DV2A 2UUCH 1UELB 3FKIJ 4PGGA 3OWTA 3L2QA 3RQIA 1V51A 2RNGA 2K9MA 3L4KA 3PZPA 3OYIA 2QSFX 5LD2C 1WH5A 2YU9A 1P7JA 2FMYA 3TOAA 1I39A 1ZRCA 2EBIA 4XQFA 5F9NA 4Q44A 2LOOA 5FPOA 1FSEA 4IAJA 3RBEA 3EUAA 4YR3A 4I55F 2WA0A 2ISYA 2HVRA 4ZYHA 2BZTA 2DN0A 3M9OB 2L5QA 3DBLB 4WK8F 4ENNA 4XORA 2JA7A 2C35B 1Y6IA 3GEZA 1GSOA 1K83J 1WI9A 1DU6A 3K0LA 4YHHH 3BZ6A 4FX0A 1BI2A 4E7SA 1X1BA 4ENKA 1MZBA 2R93G 2Q0OA 3CP8A 1VZ0A 1H9GA 2DFFA 3H35A 3NWSA 1Q1VA 4BY1J 2R7SA 4G6DA 4A93G 1R9TA 1WJEA 2A05A 3HM5A 1XX5A 5D4RA 3S17J 2CFOA 4NC6A 3ERMA 4PFOA 2IS1A 1O75A 4A2AA 3L2PA 5HLTA 3K4BA 4QTRA 1VS0A 3D5LA 3F3XA 2KIMA 5L3CA 1LVAA 2HOEA 1OQYA 2F5DA 2GXBA 2HZDA 4G6TB 1ETKA 4XKWA 3PNVA 1QU3A 5FD5A 1SYXB 3CCUI 4BBSJ 1XNRH 3ABMH 5CVVA 2XF7A 5BPDA 1S7AA 1LQ1A 4G12A 2FK1A 2XAHA 3H0GJ 2YW2A 1ON1A 2DA4A 3RTXA 5FLMG 2ZDQA 2WADA 5J40A 4DL2A 4QJFA 3BLYA 3ELKA 2Q8KA 4BL0B 4HLYA 5KFTA 3GCMA 2DBBA 5FFZA 1KGSA 2M34A 2XGQA 4M3BA 2X6OA 4PJJA 2OV7A 3S3OA 3SEQA 1XCBA 2VPQA 4IEJA 2J5PA 2D45A 2DPJA 2KISA 4L0ZB 2AU0A 3KLOA 5DD8A 1KJ8A 2JA5G 4A3MG 5FLXZ 3ABKH 1R1TA 3G6EI 3F72A 5HS8A 2DTZA 5E3NA 4EJVA 3JRGA 4ZTFA 1G3WA 1YX5A 4RDUA 4KT5C 1FJGH 2MH2A 4MV4A 2ID3A 4Q43A 1K61A 2MG4A 2GAUA 4DV0H 3GTJA 2DMTA 5HNFA 3LWFA 2XRLA 1SFUA 4RGSA 2XGDA 2K9QA 2H09A 1ZGAA 4CDGA 3OSNA 1EZ1A 4BQAA 2VQLA 1ZREA 1JHFA 4LOCA 5EZYF 1R4MB 1WZ2A 3RF2A 2LBFA 5ILUA 3S32A 3ZMUA 2E19A 5F08A 4ZH4F 3U9GA 2DQRA 4C2MA 2M3AA 4HZFA 2ZMEA 2EV5A 1J9IA 2LRDA 2QSGX 4DV6H 3TQNA 2LY9A 1BN5A 4M7EA 1USTA 1Z21A 5KFUA 2COBA 3G2BA 4U7CA 3PO3J 1Y39A 4R8UB 5K5OA 1W36D 4FM9A 3F22A 3G6VA 2BHYA 1DV1A 1OR7C 2FB9A 2LF8A 5LBQA 4ESFA 4MTDA 4O3RA 2NU6B 2RQQA 3FM3A 5FJ8J 2JZYA 1ZRFA 1D1AA 4B8XA 3N42B 2E1CA 4DV7H 2LMDA 4DBRA 2AGOA 4W97A 2R5ZA 2R7FA 3GF2A 4HG2A 1WH7A 2B7EA 3TDUC 2ZSIB 2WTEA 3RFCA 5F9LA 1KYWA 3ERED 2Z3YA 4U0WA 4Q4ZF 3A01A 1V54H 1AWCA 1GLVA 2GIZA 4X66H 1Y8QB 2WV0A 1LDKB 3C2GA 2R7ZJ 2PQ8A 4RMNA 4CCOA 4UUTA 3MKYB 1K4TA 3ORRA 4FU0A 5KG4A 4ED6A 1U5TB 3TO9A 2IA2A 2OQGA 3TQTA 3HUGA 1A31A 2NRAC 3IH3A 4Q0YA 1QZEA 4YAJB 2UUBH 4EQQA 4JV2A 3V4GA 1YYVA 1YIOA 4MQ9F 3LSTA 5HVQC 2AQEA 4R8HA 3GQCA 2J6TA 4C3HJ 4JBAA 2VXDA 2JEFA 4ZJZA 3CMYA 1QHHD 1NHAA 2GWRA 3DPLC 4A3IJ 4JI5H 1A6QA 2V1DA 2C2EA 1V5FA 4ECRA 3I3LA 3OYFA 2O0YA 4DBQA 3ONQA 4UHTA 1SMYF 3PFIA 1SFKA 2VC0A 1IN5A 3G1OA 4E7IA 5LGUA 2STTA 3H9QA 4NC8A 3TO6A 3ZMDA 2O8KA 3FBIB 3HSEA 1M1EB 2IGKA 4I7HA 1DP7P 4TQRA 5J1UA 4BWSC 1SFOJ 4XK4A 1IV8A 2PBIA 3CCJI 3N6XA 3F6OA 5K5RA 3E3VA 3RB3A 2CSOA 3FK7A 1FX7A 2BVLA 1YW9A 1DP3A 1TNSA 1ZHSA 1JXLA 2BW3A 4L9VA 1M7JA 1XSVA 3H40A 1RZ4A 3OR1C 2M2EA 3FF5A 5DV5A 2JN6A 4AWXB 1XMOH 2CQ7A 4KJZA 4X1EA 3CQZA 1I3QA 5KFXA 2IEKA 1C0WA 3LSGA 4DUZH 3CESA 5FKLA 3T5JA 1Z77A 2KJCA 2A6EF 5KFPA 5J1RA 1CGPA 3ZCOA 1P2FA 4KICA 5DM7F 2CV2A 1Z2OX 3ABTA 2C28A 2CQXA 3RGZA 5FKNA 2KSWA 1X1AA 2O5RA 3FDSA 4LD5A 4GYGA 3LSRA 3DV8A 1SC7A 2O7OA 3N43B 4R7RA 3BJYA 2EIJH 4UCSA 3M4OJ 2X1DA 1MMAA 3DKXA 1SD4A 4HPQA 4HYEA 5LEKA 4TQSA 2EJRA 4I0AA 4ZDLA 2K4JA 2E36A 1GLNA 4XN3A 3OOUA 5GTIC 3S8PA 5D1OB 5DLGA 2M45A 4UNOA 3BP8A 3RZDJ 2VKHA 4DZJA 3RKXA 4BJTA 3CUQB 1A35A 2HOTA 2OPTA 4KN4X 4EGJA 4JV1A 2E5ZA 5HLGA 1YI2I 2YU9J 1UB9A 5DLFA 1OPCA 3BQYA 5KT3A 3GV5B 2HYGD 1MBFA 2R93J 2M9HA 2V58A 5D6EA 4YFNF 4Q8FA 2W6NA 5KT7A 1I50A 2MLGA 4XLNF 2XPWA 4HNVA 5KNLA 2V79A 4I98B 4A93J 4MTEA 4WXCA 3FMRA 4ZYGA 2LP0A 4HDUA 2XPUA 4O3MA 4HR7A 2JA7J 2O9LA 1GV5A 4RB3C 3BQZA 2WDTA 2R8KA 2XSDC 1ORKA 5LGNA 4BNCA 5L9XA 2EIKH 5HDGA 5HS7A 5D4SA 2OJED 2Z1DA 2QCOA 1LFUP 1RK6A 5FKMA 3RV3A 4ECWA 2ADUA 4A3LJ 1R5ID 2LY2A 2W57A 3F0CA 4M3DA 2R7ZG 1T6SA 4ESBA 5E3LA 3CO7C 1TTYA 3E6BA 4XLAA 3K5HA 3JAMW 4DNCA 3D1NI 3JSNA 5FLMJ 5LEJA 1R9TJ 2HS5A 2V6CA 1T94A 3H20A 2W25A 4O4LF 4ESJA 3OYGA 2P8TA 4KISA 1M0WA 1KJ9A 3BR3A 2AXTC 1FPQA 2F5EA 3MQ0A 3TOBA 3NAUA 4A3KG 2QBYB 4CZCA 3O2PE 2EA4A 4MEYF 4KITB 5JI6A 4YR0A 1X2MA 2XAFA 2R7OA 2BHZA 4KIFA 4I0BA 4BHBA 2JA5J 4D1QA 4A3MJ 2Y0SE 1P92A 5JLWA 2EPFA 4HEA2 4YB8B 2YPRA 2O61A 5LHGA 3W6VA 5KFYA 4U6PA 4HOBA 4RLFA 1LE8A 4X6AJ 1B4AA 1AHDP 4M9UA 4RNMA 1GGOA 3JRDA 2RDPA 5DCMA 1KA8A 3MZHA 3GILA 2Y69H 4IHYA 2A61A 5J47A 1WJAA 1RR7A 3L00A 2EZLA 4IX7A 3VYTB 3GFLA 3PUBA 2JPBA 1ZLJA 3E6DA 1MJAA 1HW1A 4P1WA 2M5WA 3CF5F 1ZHFA 5D5UB 4DGWB 2WAEA 2IBDA 2XIGA 1VQNI 2K9NA 3RV4A 4II2A 4Y7NJ 3ZMVA 1IJWC 1I7NA 3K6GA 4HRIA 3DTKA 3T1YH 1MGTA 1VQOI 2K7LA 5FRMA 3BQ1A 2CUFA 2GPSA 2FD5A 4XLCA 1MH4A 5J4YA 5E3OA 3CC7I 4AIHA 3BA9A 4LSAA 4A2UA 4M9ZA 1WJCA 1X4PA 5BOXA 2CZGA 4LIVA 1YIJI 4O3SA 3BY6A 5JR3A 2HR3A 1ETYA 3KFWX 2WWYA 1ENHA 1X58A 3PSFA 5KCMA 2W6QA 4JV5H 1EH7A 2DCEA 5DEQA 3HYIA 2VL8A 2BBYA 4DV1H 1G3SA 1UZCA 3A03A 5B1BH 3JRAA 5CA1F 1UHSA 4XKCA 2FOWA 4MAMA 1T39A 4IF4A 3WTSC 1JDEA 1I7LA 1YITI 2P7VB 5KVRA 1XGNA 2N8GA 1SANA 2A6HF 3OS0A 2NS0A 4H4KC 2W6MA 2R8GA 4XBFA 2R5YB 4QW8A 1IXRC 2Y0SN 2ISZA 1SAUA 2FX0A 2GBYA 3RIZA 3VB2A 1B72A 3NQOA 3RPUA 2RVCA 3S15J 4HAMA 1JJ6C 2EA2A 1SD6A 2EZHA 2Y31A 1G3TA 2HQRA 2CUJA 4BHPA 2DOEA 3J80Z 5J8CA 1B8IB 2HDCA 3HOUJ 2R7NA 2O8XA 4TUYF 2Q2EA 2UUAH 3SYTA 3H9JA 2FXAA 2DA1A 1K78A 5D8KB 3CCLI 2EFOA 2VQFH 2W48A 3MWEA 3IH4A 2DDBA 3NRVA 2FK2A 2V9PA 4A3FG 1R1VA 3GFIA 1YHQI 4KNYA 5CB4F 1FIAA 2KFDA 5JHUA 5FLXW 4JQFA 2XAJA 3BJ6A 1FMWA 3U1KA 2GOXB 4MEXF 1CQIB 3OL3A 3M9MB 1VQ8I 2MABA 2WE6A 4A3BG 1LPQA 2L4MA 3ZQLA 4FBUA 1XMKA 3OYKA 2FPIB 1Z9CA 4EVIA 1AOYA 3OS2A 5L3FA 3MFHA 1NK2P 2BY0A 3CDIA 1D0ZA 1PYVA 1X19A 1I1GA 3TW7A 4ECQA 1GV2A 3BROA 1QBJA 5E17F 1Z7LA 1X1PA 5M3MJ 3WHBA 5HDNA 3AAFA 4HQMA 4YIIA 1W5TA 3E5QA 3KP7A 1Y14B 3ZN1A 1T98A 5F0HA 1XPXA 9ANTA 1GSAA 1SMTA 1VQ5I 1GO3E 3KHRA 4NXMH 4A3JJ 4AYBA 3Q0WA 2GIVA 1HW5A 3W3CA 5J1YA 3S1MJ 2BE5F 1XSDA 3ZMTA 4IHTA 1ZN2A 1BGWA 1W93A 1GXQA 5EWFA 5HODA 5C4XG 4JI8H 1YO5C 2Z99A 2L7FP 2ZDHA 3OYCA 3CCSI 1TL8A 2LY1A 1I3QJ 4OWRB 1JJ8C 4E7ZA 2XV4S 3GV8B 1FYLA 3EPIA 4AUXA 1FSHA 2PEXA 3DKWA 4PDKA 3EYIA 1S0MA 2LFBA 1J5EH 1FBSA 1VQ7I 2F5FA 1U3EM 1T3NA 2JWTA 1XDSA 1D5YA 3KP2A 1PUFB 4IR9A 3EETA 3HPHA 4RAZA 2L3DA 3WTTC 1ZLKA 2LLKA 3RJPA 1FC3A 3HOSA 3B73A 3Q8QB 4DV2H 2JA8J 1BR1A 2LF7A 4ITVA 5DD4A 4AD9A 5IT9K 1BI1A 3S3NA 1CS0A 1Z0XA 3PQJA 2VOOA 2VUGA 2BYVE 1WI3A 4KIBA 4G6QA 3OYHA 2ZCWA 1R00A 1QQIA 3AG2H 3L2CA 3KHLA 1RESA 3QYFA 1XDUA 2EINH 3L2RA 1FTZA 2J9GA 4ZQIA 2P5KA 2F48A 3KX2A 4UVBA 3M7GA 4XRMA 1U2WA 2W8LA 1NG6A 5EJCA 2OD5A 4E7LA 3LWBA 4C5CA 2JA6A 5BMZA 4BYYA 4O2AF 5K2MA 3U9SA 2DYSH 4C3JJ 4HF1A 3OMYA 4LK0F 1I50J 4F4WA 4EYIB 5B3SH 1ETQA 1VQMI 2LR8A 2ZMEC 2ZJQF 2PI0A 2XB5A 5L1JA 1E3OC 4XL9A 3I0TA 4IWXA 4ZYDA 1V4YA 4YFKF 1BW5A 4AVPA 5KAIC 5LRSA 3LQRA 3G73A 2JA6G 4A3KJ 4X62H 3ECOA 2J6UA 2JMWA 3FXLA 1ON2A 3K10A 4NUBA 5EZHA 1R7JA 4UUVA 4AVZA 3P9IA 1X9NA 1VQLI 1R22A 4JYKA 1K1SA 5DG8A 1TA8A 1SVMA 2K85A 3LSHA 3HB9A 3PQKA 5DQIA 3H4BA 2L01A 3SZTA 5CQGA 3I4NG 2DA3A 2IVMA 4BQQA 2CO5A 4L5JA 2EZKA 3BA8A 1FZPB 1IXCA 5IPAA 1ZRDA 2VJ5A 2CW0F 1HOMA 4WF2A 2F4IA 1V4RA 3S93A 4ZZDA 4IJAA 1IO2A 1B6AA 4DYCA 2VLAA 4BH9A 5JVDF 4QWQA 3RIRA 4RU9A 1XTAA 4D7MA 3I71A 2DODA 3LNQA 3BG9A 3L2WA 4E7KA 5BPFA 3TBIA 2VBXA 5LHIA 3KP4A 3ZN0A 2AO9A 5BNGA 2R7DA 1W7PB 3PVXA 2IS6A 4Z6YA 3IWFA 4ECVA 5DS9A 3HIFA 3BG5A 1BBYA 1GSHA 1Z7UA 1WJBA 3W6JB 4C9YA 4JK1X 3TP3A 3GBGA 3A2KA 4M72A 1HBXG 3V7RA 3GLKA 3IHUA 2CW7A 3UNGC 3LQQA 2WY8Q 4XLFA 1K1QA 2E7XA 1RR8C 2R7UA 1ZYRF 2QKMB 1EHIA 3ZQCA 2PJPA 2FLNA 4DR4H 2XGEA 3AL0C 4I4TF 3WTZA 4BACA 2QQAA 4CUGA 4M3EA 4E4HA 1WJ5A 2H1LA 5KFQA 4P9FA 1S0NA 3RB6A 4LLGF 1W7PD 4CZZA 5L3GA 5KT6A 2YU3A 2MCTA 3A0BC 1VBGA 3VPCA 4HSTA 3WTXC 3RZOJ 2YYAA 1BR4A 3I58A 3K4KA 5GTHC 3KYDB 5GPCA 4QWBA 4H0EA 3UR3C 3MEXA 4ECXA 2HPIA 3PSIA 1VI0A 4CCLA 3SDBA 3J7AO 3TEDA 1R6RA 2B9SA 1FYMA 2DO7A 2AHQA 1P6RA 3Q9SA 1YQAA 4UV8A 4AIKA 1ZG1A 1KJQA 5DQHA 4F4YA 1F5TA 1ACIA 2NVUB 3T5XA 3FMSA 1MJBA 2OTLI 5CJ9A 1O3RA 3PO2G 5K1YA 2Y0MA 4EMSA 2PLYA 5IP6A 5LMUH 3JZIA 4HLXA 2R7KA 2R6FA 3RBDA 4IRDA 2LREA 1K79A 2R92A 5TGTA 4PJ0C 4RA2A 4F55A 3ZPLA 2PJRA 1PVEA 3JSPA 1AUXA 3U1DA 3OYAA 2W1OA 1PK8A 3Q1KA 4LFUA 4A3BJ 1J2XA 1ZHQA 2VPSA 1MMSA 1TWCA 3WNZA 2XCPA 3EPGA 1TT5B 4J9RA 2FLPA 1RKTA 4BU2A 1BA5A 2VR1A 2ZJTA 2ZXWH 3QU3A 4CCNA 4C5BA 5KFZA 2UXNA 1E4EA 1OCPA 5BR8H 3GTLA 3CMEI 3HOZG 3RAXA 2XB0X 3BQ2A 2ETHA 3FZVA 1CQTA 2H1KA 2NVYA 3SZPA 1S68A 5DG7A 1VQ9I 3F23A 2UVWA 4I50F 2R92G 1F36A 2M0MA 3A4CA 3SJMA 2K4BA 1IGNA 2X0SA 3L4JA 3F8CA 3I56I 1X2NA 2RC4A 3I53A 1BOAA 5FFXA 2RN7A 5A2QK 3MD2A 4ABZA 3M1EA 1T33A 3UKGA 4XKVA 5C4XJ 4OINF 5GAGJ 4TV9F 3H1CA 2BY3A 1QRYA 4RNOA 3F21A 4BEHB 2EFNA 3PIPF 3HOXJ 2UXXA 1ZELA 2YS9A 2L02A 1UCRA 4UB6C 4XSXF 2CW8A 2R93A 2K3FA 1NK3P 2BVMA 1YRNB 3KEYA 5IY5H 5C3EG 1PDNC 4UCOA 4IOAF 2VQHA 3TKYA 3E5UA 1GDTA 4YAKB 1I3AA 4A3CG 1Y56A 3DLLF 2ESNA 1KJJA 3KCCA 4L5EA 1APLC 5EDWA 1N48A 1LDJA 3WODF 3ORQA 3QZ7A 1PP8F 1U9OA 4JP0A 3GIQA 2VQDA 3BTIA 4CA0A 5DUKA 2I10A 5M3FJ 2HKXA 2AQFA 2KHMA 1IRGA 4DUYH 4EJUA 4MV8A 3JRXA 2WAQA 4UVCA 4JI2H 1UMQA 2KDOA 3MKWB 5TJJA 4F3QA 3BZKA 4EGYA 1J75A 3DU6A 3J80W 2P6TA 4NXNH 4J9OA 3CTAA 2XGPA 5T14A 4LFCH 2NOJB 1NG7A 3T5LA 1F9NA 2GZWA 3IAS2 1UAAA 5KFCA 4A0YA 3GFJA 3CDHA 3GIKA 2W9BB 1TBXA 2JVHA 3BQ0A 1D0YA 2FA5A 1ETVA 2NU9B 3RB0A 4M6VA 5K7HA 4IHXA 2E1OA 3TW6A 1B04A 1S03G 3RB4A 2UXDH 1HQCA 4DJAA 1XCVA 2M4KA 1DPUA 3K70D 2W7PA 2LK2A 2NS8A 3SXYA 1BJZA 2DU9A 1WFXA 2X1EA 1R36A 4M71A 3PW7A 1T36A 5DQGA 4UVAA 2JA5A 2IW5A 5KFLA 4FS1A 2NUAB 3N8DA 3Q0VA 2IAIA 4DW6A 2ZFUA 3EUHC 2YX4A 1R5HA 3J7ZI 5KKNB 3Q8PB 5H6RA 5D5VB 1JDBB 2RNJA 1S5LC 2JA6J 4CHUA 4OIQF 1ZQ3P 3WO1A 1JT6A 2QQ8A 4L18B 4MFDA 3K3VA 2FEZA 3MAJA 5KFFA 2RF4A 2XRNA 2NVXA 4MFEA 2X4HA 3GTQA 3ETHA 2NAZA 4UFZA 2YSRA 2BY2A 3J81K 2LDUA 2Y30A 4YELA 3I4NJ 5EYRA 3S1RJ 5CAEB 1HLVA 3JW4A 2FK3A 3S1NJ 1TT0A 2FE3A 1VTNC 4YEJA 4DQ2A 3Q8RB 1XGSA 1U8RA 2DMQA 1ZETA 5KHDA 2VBWA 4U7DA 2VA2A 4FQGA 4TV8F 2CQQA 2YZGA 4A0ZA 4KMFA 3WO0A 3PR4A 2M8GX 3MFIA 4E70A 5B5EC 3H4DA 1AUVA 2HTJA 3GIJA 2UXCH 1R5GA 5KG3A 2O3FA 2Q1ZB 3C2HA 3GWZA 1R49A 2IS4A 4LLLA 5KFJA 2H27A 3AG3H 4ECTA 2CJJA 1C3OA 3OHBA 1IRZA 2DA2A 1E4FT 4ZDPA 5HLIA 5J8FA 4BDYA 2PVPA 4KUMA 4R8UA 3KLNA 3FM5A 3KAKA 2MD0A 2FQ4A 4LSXA 3RGXA 1MD0A 2HTSA 3FXMA 2VPLA 4DL6A 1XNQH 1OKRA 2XAUA 2EFPA 2ZXJA 3M3YJ 2KL4A 1BR2A 2QK4A 2P5LC 3CLQA 4XOPA 4CC6A 1MIJA 1UC8A 4A69C 1FOYA 4OAYA 1TAEA 3VYUB 1LB2A 2FPGB 4EFEA 1WSCA 2XVCA 4A5NA 4G7HF 1ITYA 4XYLB 4MV9A 2DJNA 3PIOF 2DT6A 2YZNA 1YG2A 3DU5A 4X65H 2NU8B 4FHTA 3CC4I 4S04A 4BAYA 3Q8SB 2BR0A 5IYBG 1W0TA 1IUYA 4XSZF 1T38A 2W9CB 2Y9YA 3MVPA 5J6XA 2HQNA 1HXDA 4BY7G 3H3UA 3G6YA 2ZMEB 5ILSA 1XMQH 3RI4A 1IC8A 4CCKA 2EV6A 2W82A 1WKMA 3K4CA 4YG2F 3RQ4A 2LTPA 4PSXA 1IN4A 2EH3A 2A5YB 2R7VA 5F64A 4ED0A 5C1OA 2FNAA 2LG4A 3CF2A 3LAJA 1HCRA 4U87A 2OUMA 5E1ZB 3V7CA 1N32H 3PO2J 1EH8A 4A2BA 2XHKA 1P4AA 4IKFA 5IWAH 2DMUA 2Y48A 2R5ZB 3BG6A 5LHHA 5JHFA 3TIGA 1DGRM 4M6XA 2YUSA 4J9PA 3OSGA 3R5XA 1O4XA 1ONVA 2E60A 2VODA 4M3FA 1IF1A 1J7KA 2CRGA 2X0LA 1V9PA 3ZXSA 3JRIA 2V4RA 5EGOB 3HOYJ 1S7OA 1RRJA 4O3NA 3L2VA 3HOZJ 4AQYH 3IWZA 5LL6b 1SEIA 2CQYA 3KAJA 3EQLF 3QP6A 1B1BA 2VI6A 1BC7C 2R92J 4HQEA 3PUFA 4CCMA 4HQ6A 3HHGA 4XX0B 1DGSA 2R0QC 2OF7A 1DQUA 3E1SA 5EEHA 3S16J 1SD5A 5KFRA 1TWCJ 3A0HC 3IRQA 5D5WB 4I01A 5KK1A 2GXAA 5KG7A 2BY1A 3MMYB 3R0AA 1T2KA 4DV4H 4HSRA 1TW2A 4J9QA 3GTLJ 4KT6A 4MA5A 4G94A 1FKAH 1XMAA 4ED8A 4LF7H 3FXUA 2NVYJ 4BBRG 5D1OA 3Q5FA 5F6FA 1YJ9I 2PMZE 4RAFA 4BE1A 2FJ1A 5D8LB 3H92A 1N36H 3REOA 2RKHA 3M9AA 5C3EJ 4OIOF 1VBHA 1XS9A 4W1UA 2E1MB 3HG9A 3QPHA 2OA4A 3MFKA 3OIOA 1S6LA 3SE7A 3E7LA 4J19A 3VMMA 1IOWA 4XYMB 2PX9A 3QU6A 4RUAA 5J2UF 1T56A 2STWA 5IYCG 1KQ9A 3HOVG 3BR5A 1TQIA 2VT3A 3FKJA 3K4MA 4NQWA 4MV7A 3KEQA 3R61A 3DXJF 3ETJA 2E2HA 4B3RH 1BNCA 1S97A 2PMHA 4AYBE 2KPMA 1POGA 2DTRA 2R4GA 3FXQA 4AC0A 4N4NB 4BUPA 3WTYC 2FSWA 3KHHA 3E5NA 1ZARA 1BI3A 2CMPA 4M9XA 3RDIA 5M5WJ 1ULZA 4EV0A 1S3JA 2BEOA 5IP9G 4B44A 4PDBA 4ETSA 3KZIC 4EEQA 4JI0H 5D5XB 1S10A 3S2DJ 2HVSA 2Z5UA 3AKZA 1Z6TA 3A02A 1RK5A 5L1KA 2QBYA 2X6YA 2NVTJ 5LMNH 2HQ5A 5IT3A 3B02A 5GAEJ 2UWMA 3K4NA 3UQ8A 3FK6A 4HV6A 1S8NA 2E1NA 1RC9A 3KYCB 3HOWG 5C1PA 2XAQA 3LSPA 3JRBA 4WCGA 1ZR4A 1PP7U 3BJOA 4LF8H 1TNTA 3QYEA 3T8TA 2OCCH 1BIAA 1UJ8A 1AA7A 3OIQA 4HX8A 1WCMG 1RJQA 1ZKGA 4BE2A 4JI3H 3FWEA 2AXLA 3I4MG 4V2GA 4QSHA 3RPQA 2JSCA 3U2RA 1FJLA 2L7ZA 1EJ9A 4ECUA 3BOQA 2L9RA 2VKDA 3WGHA 1BM9A 1G6NA 3DPUA 4EATA 1UC9A 2V9KA 1Z1DA 5A2QW 3FHNA 5HS9A 2NVXJ 4MNUA 1BW6A 2XUBA 3GTQJ 4UUSA 3GW2A 3EUKL 3SZGA 2I87A 1W0UA 2ZNZA 5KFAA 5E18F 1OCOH 4F50A 4AYBN 2IRFG 2E35A 1U6GA 3AG1H 1SCUB 5L1IA 2VXZA 2KRFA 4HX7A 2XCLA 1VQPI 3VPBA 2YX7A 4NDLA 2SCUB 2J5OA 5IP7G 1W4MA 3O6BB 3GTGA 4LG0B 1OCTC 3WE3A 2OC6A 5DYMA 2DFIA 1SFXA 1BJAA 2ZSHB 3BWGA 1DU0A 2HHHH 4N0BA 4XRFA 4EYHB 5KX5F 1WJDA 1XMXA 5DG9A 1T8IA 4FT8A 3LA2A 1HNZH 4A3GG 1P9QC 2GOMA 3G8CA 1MNMC 2W9AA 5EEAA 3H9GA 4EFBA 4HW0A 2AQ4A 1LFPA 1A04A 3HKZA 3OYBA 1IN6A 2R7XA 2JUGA 4GGGA 1KU2A 4KYWA 2E7WA 1VF9A 4DV5H 4RNNA 4LF5H 5ILVA 3K4JA 4EG0A 5IYBJ 5L3DA 5KAFC 4QW9A 1B8IA 2XGXA 2YS6A 2GLOA 4OIRF 2DZDA 2YRWA 4BY7J 3GO5A 5CVUA 2GLTA 1FOKA 4EM0B 4RGUA 3WG9A 1RNLA 2NOGA 3OYMA 2MYSA 2VBYA 1WRJA 2JSPA 4BJ6C 3V6KA 4G3IA 4IHJF 4Y4RA 3EDPA 4YIRX 2UV1A 2CFXA 1EUDB 3MR5A 1L0OC 5GADJ 4Y8VB 1TZLA 1N56A 5KFWA 2QYOA 3GMEA 4EM1A 1LEAA 4BXXG 3C3WA 5LA6F 2MSYA 2PMZA 2V59A 4WXHA 1FNNA 4EJTA 5I47A 3VPDA 4ZHQF 3J81W 5IYDG 3RKWA 4AIJA 1FBUA 2VKEA 1WJFA 1GHCA 1RUNA 2L54A 2MFZA 3LFKA 5H2FC 5J2TF 2RAEA 3GLLA 2E2IJ 1HSJA 1DIKA 2L0KA 3QFFA 1I27A 3PM1A 4UCRA 3IRRA 3GX4X 4YIFA 2NS7A 2X6WA 2ZFWA 1RETA 4XR6A 1P4WA 4Q48A 5HNHA 1JKJB 2CG4A 1JI8A 3OHAA 2IJLA 2X48A 2W8KA 3QYBA 3PL8A 3CC2I 2H94A 1Y0NA 3P9KA 1H8AC 3E97A 3ML6A 3SEZA 3SDGA 3OYDA 1ULYA 3SFZA 1ZGWA 1YFHA 1REPC 1FLIA 2YCHA 2NXNB 3JRWA 4EM2A 1K78B 3MWDA 3MKZA 2KZVA 5KFNA 1MMDA 3ZMSA 2FU4A 4XN0A 4CXFA 4O3OA 1OR7A 3RYPA 2DA6A 1AKHB 1MDMB 4JX5A 4A3EG 1SVOA 4F52A 3ROUA 5CKTA 1BXRA 4LMYA 2JA2A 2XROA 2BOLA 5CLSA 1IDYA 2XKPA 2QSHX 4V19K 4NBQA 4A6EA 2R8JA 4QPOA 2R85A 3OV8A 1G8XA 1PUFA 5LFAA 5KFMA 4DZPA 2NNYA 4L9TA 5KG5A 1S9FA 3X2QH 1T95A 3IKTA 5JLXA 5C44G 1TQMA 1Z2PX 1JT0A 1PX2A 1O3SA 5KFOA 2ALZA 1QVUA 1I6XA 3K3PA 2O03A 1XGMA 4A0XA 2ASJA 3BJAA 5IYCJ 5E8GA 2A6TA 3HOVJ 4FBTA 4YFXF 2KIUA 2ACJA 5C4JJ 4HF0A 4CC5A 3DEUA 4RZRA 4JI4H 2L2OA 5FLVA 3BT9A 3QWLA 4J00A 2FBIA 2HXIA 2V9WA 4HNUA 4D9JA 1JTYA 4YR2A 1XG1A 2OCEA 2DT5A 4ED2A 1V5EA 2B63G 2R86A 3V8LA 4PFPA 2X51A 1YS6A 3H36A 2EV0A 5IT9Z 4DR3H 4YQWA 3K1MA 3B6CA 1FP2A 2OZUA 4R1HA 3BDDA 1JLLB 1FMVA 1DDNA 1W5SA 4J0MA 2QM3A 1CF7B 3DKYA 3DTIA 3OR2C 2VONA 3I9V2 2ZB9A 4XKBA 4ZZLA 1SFEA 3HTSB 1WH2A 1FVIA 1PJRA 2QYZA 2XD4A 2E2HJ 2VUMA 1VAJA 4LITA 5E79C 1QPMA 4GRIA 2W6ZA 4J9MA 3DPTA 4ED7A 1Z2NX 2WYOA 3E5XA 1HKQA 3VWBA 1LFBA 3HOTA 2HYFA 2FKLA 2FMLA 3CJNA 3PFYA 3OUUA 5EWGA 1JKOC 3L1PA 1T0FA 4KHPH 3H3ZA 3HOWJ 5D1PA 3I59B 3ZRGA 5GAHJ 1B9MA 2WAQE 3KXYT 5F0CA 1TP4A 4K2EA 1S29A 1YOVB 2VUMG 2UVUA 1MBKA 4B3XA 3BTLA 2BQRA 4MLOA 4GXOA 1NTCA 1UFMA 1W1WE 2ELJA 2MBFA 3HTUA 4NNJA 3W2AA 3I4MJ 2KIFA 4FX4A 2D5VA 4UCUA 4DR7H 1UHWA 2W6PA 1IAWA 5HDKA 2UVRA 1IZ1A 4NC7A 3JTGA 3DFGA 3NARA 3IH2A 2PN1A 3BG7A 2XAGA 2YZMA 1I5ZA 4ENMA 3TMOA 3IKVA 5AIPA 1LNWA 1D3YA 1FWZA 3TL4X 2QA4I 2A5WA 2W4SA 1W7PA 2DA7A 4JI7H 1ZTRA 2D1HA 4XRSA 3C1DA 3ABLH 3CLOA 2PN6A 2VOPA 4ECZA 3E0JB 2F4VH 2W24A 2R7TA 2EZIA 3JSLA 2FF4A 4CCJA 5IP7J 2LYCA 4U7BA 4DR2H 4CGZA 4RM2A 1YW8A 3T0YA 1JTXA 4B4CA 2BXYA 2V7FA 1FP1D 2OH2A 4MA0A 1QA6A 4C3IJ 4D0PA 3HL2A 5FGMA 3OYLA 2WV1A 3VSLA 4C5AA 4A3GJ 2L9SA 3BPXA 3DEWA 3P9CA 4XRSG 4PWQA 3TIIA 1XGOA 4CH7A 3PR5B 1HSTA 5BPHA 1ZH5A 3QOEA 1J09A 1VQKI 3JSOA 4LFBH 4L0YB 3H5RA 2MC4A 4I76A 1MMGA 2ZNYA 3M1CA 3GTGJ 2Q2UA 3M8JA 3W6KB 3V7SA 4HV5A 1KEEA 4BS9A 1WSUA 2WAQN 1Z91A 3Q9VA 3TO7A 3IP4B 1HDDC 4OIPF 2VT2A 2BQ3A 1WWXA 3G1LA 4HX4A 1MMNA 1CE8A 4S05A 4FS2A 3CCEI 2K3PA 1UG2A 3KTMA 2PG4A 4M6YA 3PO3G 3BTCA 2L9VA 2FP4B 3DQVC 2ZO4A 3BC8A 3MKLA 4XONA 4KA4A 3HRSA 2DYRH 2X6XA 4I6ZA 4KN7X 1V55H 5KFIA 3C0FB 2MW8A 5E20A 3PN1A 2C2DA 3KZYA 2W7NA 3ZMZA 4CYCA 1I6HJ 5CA0F 1SD7A 3DEEA 4UXNA 4WXDA 2LD5A 1QPIA 2IBKA 4II3A 3HC7A 2P6SA 4AU7A 4JYAH 3IG0A 2BQUA 1X3ZB 1F4KA 5GP9A 4A3FJ 2XF5A 4PCQA 4Q47A 2QZ8A 1STZA 1D8KA 5FROA 5IOYA 5HV6A 2VC1A 4LF9H 1IG7A 4ZYAA 1HA8A 4JX4A 1ZK8A 2DPUA 1FOWA 2B0LA 2ID6A 2BXZA 2DW4A 3F8BA 3LSKA 1O3QA 3DP7A 2VQGA 3DCFA 3UFXB 1O3TA 3MN2A 4IWYA 1J5YA 4JI6H 3F6VA 2DA5A 3G1MA 2F5CA 1BOBA 2NNNA 3WTVC 5EOYA 3E6CC 5KG2A 3LAPA 1TQPA 4PJNA 4B43A 3WTWC 2HQAA 4IOCF 1JKQC 2JQ7A 2WY7Q 2G7UA 3HRTA 4A3IG 2IA0A 3FXRA 1G2HA 3DBRB 3R0JA 1I94H 1MNDA 3VOEA 3FIWA 4IPAA 2E71A 2RDJA 4GC6A 5J4VA 1UNNC 2I8CA 3GUDA 3U9TA 1D1BA 4ANJA 4HNTA 2WTFA 2K9SA 3GTPA 4IHVA 4ENJA 4KFCA 1YRNA 1ZG5A 1P7IA 2FNPA 4RLQA 2I8DA 3LOCA 4Y15A 4A12A 1A6IA 2M7AA 5K7ZA 2HYJA 5H20A 1EKEA 1USSA 2PJRB 2W84A 4BGDA 2HI3A 3RSNA 2A68F 4XIDA 5A2QZ 2F5VA 2JT1A 3TQ1A 2DT7B 4B3SH 5FD6A 2DDAA 1TWFA 4IO9F 2HWVA 3BR1A 2LH9A 2LVSA 1E4EB 4IRGA 4OMZA 3QPLA 3V6HA 1JKRC 3KYLA 1LUJB 2DPDA 4D5CA 3S3MA 4U0VA 5BMVF 2IGMA 1R71A 1M0TA 5JQWA 4IRKA 1S0OA 4D5FA 5EG0B 1Y1WA 5EDNA 2JTVA 1GVDA 1JUSA 3IAM2 3DBHB 3GZ5A 4XMYA 2M05A 2W9BA 3K1NA 4EBCA 4TV7A 2KRCA 1LJ9A 4ZDOA 1EF4A 2B63J 4F91B 3NGDA 3Q3SA 3NWTA 2VPRA 2DFHA 4XM3A 4MQVA 1WQ2A 4YP3A 1F43A 5FB2A 4F93B 1IN8A 4LJZF 4ED3A 2V1XA 3J7AY 2DK5A 3MZYA 3FMAA 2KT0A 5CVIA 5LLQA 1HC8A 3RJ0A 1Y1WG 2EFQA 1MKMA 3COAC 1MBHA 2G0EA 4I02A 1GT0C 4XNFA 4L5IA 4MO7A 5L3EA 1FYKA 3KEOA 1RJPA 1VNDA 4IXAA 4LIUA 1HR0H 4N4OB 2QVOA 4V2FA 3CVZA 5LYJF 4RGRA 2VE9A 4EEFG 1K6OA 2V5AA 4O4HF 2JA7G 4WBNF 1MBEA 3T5KA 2NYXA 2AS5F 2IGNA 4RB2C 4LLNA 2ASLA 3CCVI 2VUMJ 4BXUA 3PNTA 3LSIA 3CJRB 4JUZA 4QIWA 4A3LG 3GXOA 1DPRA 1SEUA 3OYNA 4KDPA 2CQKA 3FMQA 4PJLA 2LKPA 2DK8A 4NB5A 4PJMA 1OISA 1XDNA 1Z67A 1CQJB 3N44B 2D2WA 2LSOA 3NEUA 4IRIA 2RV8A 2EILH 4O6JA 1T08B 3D5SC 1KQ8A 4IZZA 4YJ3F 1Q1HA 3IN5A 2MGQA 3V4ZA 1S9HA 3J81Z 4EBDA 3AG4H 4PUSA 5KG0A 2YR2A 3WTUC 5FLXK 1A0IA 1TWGJ 5KFVA 3WU2C 4B48A 2ECCA 2ME0A 3F8NA 3DTEA 2H8RA 2QQBA 2WB1A 2VOBA 5D8DA 2C6YA 1ETWA 3ZP5A 2R7QA 3FXJA 4J9SA 5DCFA 3AYHB 4A5MA 1MBGA 4HA8A 2COMA 3K2ZA 2A07F 2V4QA 3I5UA 4XZ3B 3VEPA 1BC8C 2MLKA 3A1YA 3DLAA 2QKLB 1QGPA 3WE2A 4LH7A 5KG6A 1DGWY 1O57A 3HJEA 4E4TA 3LMMA 1EV7A 1E3PA 1JUMA 2HPMA 3FXKA 4E7HA 1KONA 2QWWA 4Y3OA 2H6BA 2RGVA 2K86A 4BKXA 2J6SA 3N97A 4PGHA 2P0WA 3F8FA 4UV9A 5E3MA 3GV7B 5IT9W 4CYDA 2VA3A 1MBJA 2X85A 4F92B 1B6SA 3HZJA 3U21A 2W9CA 5DUIA 2RQPA 2UU9H 2DLLA 3O3KA 5DGAA 1MNEA 3V42A 3BTJA 1L2ZA 4G9YA 3DF8A 1G59A 1OYWA 3BG3A 3W2VA 3KHGA 2DFEA 4X64H 2XF6A 1MW7A 3CMMA 5AIQA 5ICFA 2LBFB 3RTRA 1U5TA 3GZ6A 1IDZA 3LP8A 3R23A 2FOKA 2Z2SB 2R7WA 2HNHA 4Y33A 3GYHX 4Y13A 1B6RA 4Y52J 4P5OA 4DR1H 1JUPA 1JXSA 5JH7F 4FASD 2MC3A 2JRTA 5KT5A 1ETXA 2FRHA 5CVJA 1X1CA 2JRMA 3QZ8A 1HNWH 3H3VH 2HU9A 4UCTA 4RAYA 3HRUA 1ZQ7A 2DIKA 1Z05A 1XB4A 5LP6F 2FBHA 4RGXA 2DWCA 4PSWA 2E2IA 1U9NA 4RAGA 4M3GA 1U78A 1JGGA 4ME6A 2JVGA 3LFUA 2L7MP 3JRCA 4OOIA 2ELHA 3WU0A 3S1QJ 1U0JA 1LEBA 2EFWA 3VSKA 5ED4A 3HKZE 3O8GA 2UVVA 1DUXC 4GC7A 5EGOA 5KFGA 5B1AH 4B3MH 3JR9A 1JIHA 3RUPA 4O5VA 5D6FA 1ZAOA 2W7OA 1OLTA 2M87A 1O7FA 2VBZA 3GIPA 3A01B 1L3LA 3GIMA 3GTMA 3CCRI 3HOUG 4LB5A 1B59A 4FETA 2P0AA 2KMUA 4P55A 4LF4H 2GM4A 3R5HA 2BV6A 2F2EA 3VYRB 3N41B 1YX3A 2V4JC 2F6CA 4F4ZA 4XLPF 2X9DA 3HUGB 3RKQA 4IRCA 2E34A 2V1UA 2VJIA 1VFCA 3LL7A 1W5CC 5HOOA 2VQEH 3JCUC 1KYZA 3KP5A 2ELKA 5CPRB 1U8BA 1IRFA 1B9NA 4RB0A 2UZKA 4RZQA 2VB6A 4O3PA 1TWHA 5GONF 2WC2A 5B66C 5JVGF 4QWEA 1W96A 4BXFA 4UY8I 4MV1A 2IA1A 2IPQX 4LF6H 5AONA 2CWEA 2EK5A 4DV3H 3HRMA 2K5CA 1O7LA 2C00A 1FBQA 2JPCA 3KP3A 3SI8A 2AGQA 3CUQA 1T0FC 1TWAA 4A3CJ 2HKOA 4G8XA 2VASA 5KT4A 2KQRA 4DR5H 1G4DA 4IQJA 3GTOA 3AL0B 3GTPJ 2BW3B 1X1DA 4A3JG 5F1JA 1S72I 2K9LA 3SHFA 3PJRA 3CD6I 3CUOA 4IQ4A 1GUUA 2KP6A 2VJJA 1E17A 3B6AA 1I1SA 5EF6A 4ZYEA 3OL4A 3E6MA 3CJTB 3ZQIA 3R6SA 2M8EA 3HDDA 4FE7A 1JX4A 3HKZN 3KP6A 3Q0UA 1PUEE 1TWFJ 1Y1VA 4CSWA 2OWOA 2LNBA 1KU7A 4IRHA 3M4IA 3W2WA 2E5NA 5F27A 3GFMA 3LA3A 5K7FA 3T1HH 4APMA 3LSJA 1A9XA 2OLSA 5KFKA 2K27A 4L1KA 3HGYA 4LFAH 3QOPA 2CKZB 1R4NB 3MCZA 3QODA 1WR2A 4IZOA 3WGGA 3G4SI 1Y1WJ 5E1WA 1KQ0A 2OAZA 3K2AA 3OIPA 5F0FA 5HBRB 1UHMA 2XGCA 4IVNA 4M74A 2DMNA 2R3SA 2JA8G 1QZZA 2Z16A 4CO8A 1Y1VG 5JUMA 1WCMA 1KZHA 4ZTJA 3S2HJ 3GZNB 1IXSB 2Z9OA 4O3QA 1XN7A 4NQWB 4EJWA 2R8IA 3RAQA 2NVQJ 4KMUX 5H80A 5TISC 1XSXA 2IMWP 2G9WA 2PMZN 5CYVA 4GDFA 5EZGA 2L4AA 2Q2TA 2RREA 1FOXA 4MIMA 1D5VA 1I6UA 5KFHA 3ABUA 3ESWB 2XC7A 2TDXA 4LGWA 2XC9A 4B1RA 1J59A 5KFDA 3IUOA 2CS3A 1YS7A 3T1BA 3KE2A 2AGPA 4A3DG 2P5VA 2IA6A 3MZ8A 2FQ3A 2LC2A 3H5NA 1MH3A 4BHCA 5LGTA 4QWDA 3JRHA 2ZM6H 4EEYA 2JEIA 3C7JA 3IC7A 2IP4A 4N9IA 2W70A 3QAHA 5ERIA 2CV1A 1QZYA 5KFSA 4YJ2F 4ASNA 5KFBA 3ZOBA 2IS2A 2FUG2 2IP2A 4L9JA 4GYIA 3HBLA 4LG0A 3CMAI 3K1PA 2L7KA 3P7NA 2M7BA 3WG7H 3GIIA 2R7LA 2YS7A 3MR6A 3ZR8X 2HOAA 1P4XA 3WGIA 1ERDA 2HXOA 2K02A 3H5AA 2R84A 1Z6RA 1C30A 1OYYA 3CO6C 5IOZA 6PAXA 2FJZA 2ZC2A 3LA7A 3GIDA 3DWLE 4WD3A 1TW3A 2D1VA 4EBEA 4BDZA 3CCQI 3OY9A 4ZOLF 2PBZA 3O8HA 4Q8EA 3M8FA 4QWAA 1LKXA 1Y8RB 2VKVA 5ICEA 2ME6A 2WAFA 1R1UA 4YBZB 1LE8B 1H9TA 5BPIA 3P5JA 5H6QA 4MV3A 3QQAA 5DGBA 5DCMB 2K40A 2M0CA 3BR0A 1D0XA 3V8KA 3GLXA 2VN2A 5CVRA 5L3BA 3OUZA 1GVJA 3N05A 1JGSA 2R5YA 3TINA 3CZ6A 1KU3A 1WPKA 4UUSB 1X3UA 2QGUA 5TRDA 1H0MA 2DJIA 4IHWA 5DDGA 4ECSA 3GTJJ 4EGQA 3EUHA 3M07A 1ETOA 2JK3A 4XOTA 4QLCU 2ATLA 2W00A 1WVRA 4DR6H 1EH6A 3ASNH 3BZCA 2KIQA 3D5RC 2ESHA 3CJQB 4OAZA 3V8JA 2LKXA 1VKZA 2E2JJ 1XC5A 2OQRA 2EWNA 2HGSA 2CUZA 4PK4A 4C2MJ 2DPIA 1OCZH 3GTKA 1NH3A 2V26A 1XD7A 4Y17A 1QHGA 4C30A 2RGRA 4BJ5C 4F7ZA 2H8WA 3ZQ7A 1JKPC 3G3ZA 3K70C 2CV0A 2W71A 1EA3A 4RBOA 3J80K 3IV5A 3BR2A 2DLNA 2F4OB 1FEXA 3PW2A 1M6VA 4FISA 3HPGA 3QPSA 4BQOA 1HKTA 3OYJA 5JFRA 3IL2A 2KDZA 2UUZA 2KJBA 3PW0A 2UXBH 5F04A 1QO0D 3K7AJ 1YJWI 4M73A 5BQTA 2XASA 4O4IF 3OOPA 4FE4A 1N25A 2M1BA 2M4GA 1JE8A 2H6CA 2ZDGA 2YRXA 3BABA 3HGGA 1B72B 1QVTA 2XSJC 3EYYA 2HEOA 3I12A 4P96A 2W85A 5ICCA 1IUFA 1SAXA 1WGXA 3GVAA 1AKHA 1MDMA 4A6DA 2NU7B 2Q2EB 4XICA 1IV6A 1ZG3A 2FBKA 2KRHA 3BCAA 1K4SA 2FPPB 4YY3H 4QWCA 2P4WA 5ICGA 4GCVA 2EB7A 4OU0A 5LRRA 4PZJA 3ZGKA 3GTMJ 1A5JA 5KG1A 1ODDA 1BL0A 2HVQA 2R7RA 5EEGA 4J9NA 3MR3A 4J9LA 4RUCA 4I09A 3FKIA 4BBRJ 4XLEA 5GPAA 4OX9H 1GYFA 3OYEA 5DM6F 1RI7A 2HFHA 4WWCA 5F1RA 2FMAA 2KKOA 1TC3C 1E3HA 1HDPA 3RPUD 1EUCB 3C18A 3ECHA 2VJ4A 3LSMA 3QP5A 3G6XA 3TDZC 1BI0A 2B63A 2QQ9A 1R23A 4U0YA 1TWHJ 3VFZA 2ASDA 3MR2A 2EIMH 2KZGA 1FTTA 3R5FA 4LK1F 4EGZA 4OMYA 1UG0A 1YE9A 1W36C 3ZQHA 3K5IA 3FKIG 4B47A 1BJTA 4JI1H 2DOFA 4B3AA 3RYRA 3JREA 3K69A 1K83A 1D1CA 3CQZJ 1TWAJ 2ECBA 3HOXG 2X1CA 3WU1B 3Q2OA 3K4LA 1N77A 2C2RA 1RIOH 1CF7A 3EPZA 3GTOJ 1HF0A 3OTOH 1KBLA 3J7AK 2DQLA 2MH9A 1OWTA 5C8YF 2CQNA 2DMPA 2ZJPF 1HKSA 5IP9J 4Q5SF 2C22A 3FX3A 1P8LA 4D7NA 4HYKA 2OBPA 4S0HB 2P81A 2GPWA 2V6EA 2QLZA 2L9NA 4J9KA 3T5HA 1IBLH 5FO5A 1H88C 2YL2A 1V3FA 1FT9A 1Y1VJ 4QPQA 3FHZA 3V6JA 3I54A 4G7ZF 1Z3YA 2XKOA 1K6YA 3I59A 1RPWA 5M5YJ 4GLXA 4DL3A 3BPVA 4IR1A 2Y0SA 2CH0A 2R7MA 4BY1G 3H0GA 2GA2A 2Z33A 3CCMI 3M9NB 2CU7A 2RDIA 4DL5A 2XPVA 4YRVA 2M30A 3WHCA 4RS8A 2FLLA 3CDLA 2KLOA 3QRFF 4UCVA 4DL4A 2W6OA 4ZC3A 1E2XA 1KC7A 1OCCH 1V5GA 1Y0UA 4IL6C 1KU9A 4U88A 1TWGA 4MV6A 5CQEA 1WCMJ 3VDXA 4WX9A 4LG3A 4JV0A 4BBSG 5K5QA 1D8JA 1E0EA 3VPRA 1OCRH 4C2UA 3HXLA 3PNYA 2E5LH 4A3DJ 3H0GG 2DI3A 1J0RA 1U5TC 1MSFC 3F9KA 2O6GE 1HW2A 4ZI7F 4DYRA 2V9VA 2Y75A 3MJFA 4IHSA 4KIGA 3FBNB 3DF7A 3VYSB 3FDYA 5C5JA 4FCYA 3L7WA 5BS6A 1S7EA 5IYZF 1N34H 1OJLA 2V1NA 3L2UA 2G7HA 2HDDA 2QENA 2HZTA 4XLHA 3TP0A 2DXIA 3MWMA 1F1ZA 3TGNA 5L1LA 5LOVF 4HBLA 2BGCA 1N75A 2Y9ZA 1YJNI 4I99C 1N78A 3R4KA 3AFHA 1BIBA 3FXOA 4M9SA 3RCOA 4I2OA 1ZGJA 3N40P 3PW4A 2ZBKA 5J3LA 2DAOA 1K7AA 2P7CB 2I80A 3H3VK 4QIWE 2ZJ2A 4ED1A 2JEJA 2WBMA 2XDVA 4DOZA 1IOVA 1IBMH 4DIQA 1H89C 4AIDA 1X4OA 2PMUA 5FPRA 1JHHA 4B09A 3L09A 2XCAA 4DL7A 2JUCA 2VE8A 4HDVA 4E6KG 5HLHA 4C2TA 1YTYA 2A3SA 1N33H 1RKWA 3FISA 3JRFA 2ZJRF 4K0KH 3JTHA 3KIOA 3N4MA 1GXPA 1QNTA 4MHGA 1AN7A 2R82A 4UB8C 3BCBA 2HOSA 3SFIA 2WB1E 2IXSA 3CP2A 3G71I 5DTDA 2OTJI 2MA3A 2CYYA 1SVLA 5EWEA 3CCYA 1HNXH 3PW5A 4E7JA 3I55I 4LB6B 4RM3A 2HJWA 4DYQA 5FRNA 5FJ8G 3OSFA 2MD5A 2E1MC 2R7ZA 1EYZA 1B33N 4BE0A 1WHUA 3H0DA 1TLHB 5FKOA 5JVLA 4MGRA 4N9HA 2IGOA 4CICA 2QUFA 3C2BA 4ON0A 3LMLA 2JEGA 4X0GA 5LXTF 2R87A 4GKJH 3CUQC 2VIXA 3ISPA 3KETA 4BXXJ 2GQQA 4O2BF 2GA1A 3ASOH
chains in the Genus database with same CATH topology
3HSRA 3QPTA 1E4GT 3HHHA 3T8RA 3M8EA 4ZZLA 2STWA 3R60A 4GO1A 3L9FA 3HSFA 1RUOA 1FY7A 4G7OF 3BAAA 4HF2A 3SQNA 4P9UA 2OZ6A 3KALA 1LDDA 3S2WA 2IT0A 4LH6A 2A69F 3JAMK 3ULQB 3I64A 3RKYA 2ZKZA 4L9NA 2PFBA 5E8IA 1G3YA 4EJOA 1OYIA 3F8MA 4GKKH 2GXGA 5E1XA 3VODA 3JAMZ 4R79A 1OMIA 1IN7A 3D0SA 5JVTA 3KZZA 3I4PA 4Z2YA 4RB1A 2HGCA 2CGPA 1IBKH 4B3TH 1YW7A 4NHJA 1R58A 3K9TA 2OU2A 1MJ9A 1YLFA 1IW7F 2UUCH 4PGGA 3L4KA 2FMYA 3TOAA 1ZRCA 5FPOA 1FSEA 4IAJA 2ISYA 2HVRA 4ZYHA 4WK8F 4ENNA 3GEZA 1WI9A 3K0LA 4YHHH 3BZ6A 4FX0A 1BI2A 4ENKA 1MZBA 2Q0OA 1H9GA 4G6DA 5D4RA 1O75A 3L2PA 4A2AA 1VS0A 3D5LA 3F3XA 2KIMA 5L3CA 1LVAA 2HOEA 2F5DA 2GXBA 5FD5A 1SYXB 1XNRH 5CVVA 5BPDA 1S7AA 1LQ1A 2XAHA 1ON1A 3RTXA 3ELKA 2Q8KA 4HLYA 5FFZA 2DBBA 1KGSA 1XCBA 2J5PA 2D45A 4L0ZB 3KLOA 5DD8A 5FLXZ 1R1TA 3F72A 5HS8A 4EJVA 1G3WA 4KT5C 1FJGH 2MH2A 2GAUA 4DV0H 3LWFA 1SFUA 4RGSA 2H09A 1ZGAA 4CDGA 4BQAA 1ZREA 1JHFA 3RF2A 5ILUA 3ZMUA 4ZH4F 3U9GA 2DQRA 4HZFA 2ZMEA 2EV5A 1J9IA 4DV6H 3TQNA 1BN5A 4M7EA 1USTA 5K5OA 4FM9A 3F22A 2LF8A 5LBQA 4ESFA 4MTDA 3FM3A 2JZYA 1ZRFA 4B8XA 3N42B 2E1CA 4DV7H 2R7FA 3GF2A 3TDUC 2WTEA 1KYWA 3ERED 2Z3YA 4U0WA 4Q4ZF 1AWCA 4X66H 2WV0A 1LDKB 2PQ8A 1U5TB 3TO9A 2IA2A 2OQGA 3HUGA 2NRAC 4Q0YA 2UUBH 4EQQA 3V4GA 1YYVA 1YIOA 4MQ9F 3LSTA 5HVQC 4R8HA 4JBAA 1NHAA 2GWRA 3DPLC 4JI5H 2V1DA 2O0YA 4UHTA 1SMYF 3PFIA 2VC0A 1IN5A 5LGUA 2STTA 3ZMDA 3TO6A 3HSEA 4I7HA 1DP7P 4BWSC 2PBIA 3N6XA 3F6OA 5K5RA 3E3VA 2CSOA 1FX7A 1YW9A 1TNSA 1ZHSA 4L9VA 1XSVA 1RZ4A 3FF5A 5DV5A 4AWXB 1XMOH 1C0WA 4DUZH 2KJCA 2A6EF 1CGPA 1P2FA 4KICA 1Z2OX 3ABTA 3RGZA 2KSWA 4LD5A 4GYGA 3DV8A 3N43B 4R7RA 4UCSA 1SD4A 4HYEA 5LEKA 2EJRA 4I0AA 2K4JA 5D1OB 2M45A 4UNOA 3BP8A 3RKXA 3CUQB 4KN4X 5HLGA 1UB9A 1OPCA 2HYGD 5D6EA 4YFNF 2MLGA 4XLNF 2V79A 4I98B 4MTEA 4WXCA 3FMRA 4ZYGA 4HDUA 4O3MA 4RB3C 2WDTA 5LGNA 4BNCA 5HDGA 5HS7A 5D4SA 2ADUA 2W57A 1T6SA 4ESBA 3CO7C 1TTYA 3E6BA 3JAMW 4DNCA 3JSNA 5LEJA 2HS5A 2V6CA 3H20A 2W25A 4ESJA 2P8TA 1M0WA 3MQ0A 1FPQA 2F5EA 3TOBA 2QBYB 5JI6A 3O2PE 2EA4A 4MEYF 2XAFA 4KIFA 4I0BA 4BHBA 1P92A 2YPRA 2O61A 5LHGA 4HOBA 1B4AA 2RDPA 5DCMA 1KA8A 3MZHA 2A61A 3L00A 3GFLA 2JPBA 1ZLJA 3E6DA 1MJAA 1HW1A 2M5WA 1ZHFA 5D5UB 2XIGA 3ZMVA 3T1YH 1MGTA 2K7LA 4AIHA 3BA9A 4LSAA 4A2UA 4M9ZA 5BOXA 3BY6A 5JR3A 2HR3A 3KFWX 2WWYA 4JV5H 1EH7A 5DEQA 3HYIA 2BBYA 4DV1H 1G3SA 1T39A 4IF4A 3WTSC 2P7VB 5KVRA 1XGNA 2A6HF 2NS0A 4XBFA 1IXRC 2ISZA 3RIZA 3VB2A 3NQOA 3RPUA 2RVCA 4HAMA 2EA2A 1SD6A 3J80Z 5TRDA 1G3TA 2HQRA 4BHPA 2HDCA 5J8CA 2O8XA 2Q2EA 2UUAH 2FXAA 1K78A 5D8KB 2EFOA 2VQFH 3NRVA 1R1VA 3GFIA 4KNYA 5FLXW 5JHUA 4JQFA 2XAJA 3BJ6A 4MEXF 2WE6A 2L4MA 1XMKA 1Z9CA 4EVIA 1AOYA 5L3FA 1I1GA 3BROA 1QBJA 5E17F 5HDNA 3AAFA 4HQMA 4YIIA 1W5TA 3E5QA 3KP7A 3ZN1A 1T98A 1SMTA 4NXMH 2GIVA 1HW5A 2BE5F 1XSDA 3ZMTA 4IHTA 1ZN2A 1BGWA 1GXQA 4JI8H 1YO5C 2Z99A 2XV4S 1FYLA 1FSHA 2PEXA 3DKWA 4PDKA 3EYIA 1J5EH 1FBSA 2F5FA 1U3EM 1XDSA 3KP2A 3EETA 4RAZA 3WTTC 2L3DA 1ZLKA 3RJPA 1FC3A 3HOSA 3B73A 4DV2H 5DD4A 2LF7A 4AD9A 5IT9K 1BI1A 3PQJA 2VOOA 2VUGA 2BYVE 4KIBA 4G6QA 2ZCWA 1R00A 1QQIA 3L2CA 1XDUA 2P5KA 4UVBA 3M7GA 1U2WA 2OD5A 5BMZA 4BYYA 4HF1A 4LK0F 2PI0A 3I0TA 4ZYDA 4YFKF 4AVPA 5LRSA 3LQRA 3G73A 4X62H 3ECOA 1ON2A 1R7JA 4UUVA 1X9NA 3P9IA 1R22A 1TA8A 3PQKA 2L01A 3SZTA 2IVMA 2CO5A 4L5JA 3BA8A 1FZPB 1IXCA 1ZRDA 2CW0F 4WF2A 1V4RA 4ZZDA 4IJAA 1B6AA 4BH9A 4QWQA 3RIRA 3I71A 2VBXA 5LHIA 3KP4A 3ZN0A 2R7DA 1W7PB 3IWFA 3HIFA 1BBYA 1Z7UA 3W6JB 4JK1X 4M72A 1HBXG 3V7RA 3IHUA 2CW7A 3LQQA 2E7XA 1ZYRF 2PJPA 4DR4H 3WTZA 2QQAA 4P9FA 4LLGF 1W7PD 4CZZA 5L3GA 2YU3A 2MCTA 3WTXC 3I58A 4H0EA 3MEXA 3J7AO 1FYMA 2DO7A 1P6RA 3Q9SA 1YQAA 4UV8A 4AIKA 1ZG1A 1F5TA 3T5XA 3FMSA 1MJBA 5CJ9A 1O3RA 5K1YA 2Y0MA 4EMSA 2PLYA 5LMUH 4HLXA 1K79A 3ZPLA 3JSPA 3U1DA 4LFUA 1ZHQA 1J2XA 2VPSA 2ZJTA 3QU3A 2UXNA 5BR8H 2ETHA 3FZVA 3SZPA 1S68A 3F23A 2K4BA 3L4JA 3F8CA 2RC4A 3I53A 5FFXA 1BOAA 5A2QK 2RN7A 3M1EA 4OINF 3F21A 2EFNA 2UXXA 2L02A 1UCRA 4XSXF 2CW8A 1PDNC 4UCOA 3TKYA 3E5UA 2ESNA 3KCCA 1LDJA 3WODF 1PP8F 5DUKA 4DUYH 2HKXA 1IRGA 4EJUA 4UVCA 4JI2H 5TJJA 4EGYA 1J75A 3J80W 2P6TA 4NXNH 3CTAA 4LFCH 1F9NA 2GZWA 4A0YA 3GFJA 3CDHA 1TBXA 2FA5A 1B04A 1S03G 2UXDH 1HQCA 1XCVA 1DPUA 3SXYA 2DU9A 1R36A 4M71A 4UVAA 2IW5A 2YX4A 1R5HA 5H6RA 5D5VB 2RNJA 4CHUA 4OIQF 4L18B 3K3VA 2FEZA 3MAJA 2XRNA 2X4HA 2NAZA 4UFZA 2YSRA 3J81K 2LDUA 3JW4A 2FE3A 1VTNC 4DQ2A 1XGSA 1U8RA 2VBWA 4U7DA 4A0ZA 4KMFA 4E70A 2HTJA 2UXCH 1R5GA 2O3FA 3GWZA 4LLLA 2H27A 1E4FT 5HLIA 5J8FA 4KUMA 3KLNA 3FM5A 3KAKA 4LSXA 3RGXA 1MD0A 2HTSA 1XNQH 1OKRA 2EFPA 2ZXJA 2P5LC 4CC6A 1TAEA 1LB2A 4EFEA 2XVCA 4A5NA 4G7HF 4MV9A 1YG2A 4X65H 4FHTA 4S04A 4BAYA 1IUYA 4XSZF 1T38A 5J6XA 2HQNA 1HXDA 3H3UA 1XMQH 2ZMEB 5ILSA 3RI4A 2EV6A 1WKMA 4YG2F 1IN4A 2A5YB 5F64A 2FNAA 3LAJA 5E1ZB 3V7CA 1N32H 1EH8A 4A2BA 2XHKA 1P4AA 5IWAH 2Y48A 5LHHA 4M6XA 1ONVA 2VODA 1IF1A 1J7KA 2X0LA 1V9PA 1S7OA 4AQYH 3IWZA 5LL6b 1SEIA 3KAJA 3EQLF 3QP6A 1B1BA 1BC7C 4HQEA 3HHGA 1DGSA 5EEHA 1SD5A 3IRQA 5D5WB 4I01A 5KK1A 3R0AA 1T2KA 4DV4H 1TW2A 1FKAH 4G94A 1XMAA 4LF7H 3FXUA 5D1OA 3Q5FA 5F6FA 5D8LB 3H92A 1N36H 3REOA 2RKHA 3M9AA 4OIOF 3QPHA 2OA4A 3MFKA 1S6LA 3QU6A 1KQ9A 1TQIA 2VT3A 4NQWA 4MV7A 3KEQA 3R61A 3DXJF 4B3RH 2PMHA 2DTRA 3FXQA 3WTYC 2FSWA 1ZARA 1BI3A 4M9XA 3RDIA 4EV0A 1S3JA 2BEOA 4PDBA 4ETSA 4EEQA 4JI0H 5D5XB 2HVSA 2Z5UA 1Z6TA 2QBYA 5LMNH 5IT3A 3B02A 2UWMA 3UQ8A 4HV6A 1S8NA 2E1NA 2XAQA 4WCGA 1PP7U 3BJOA 4LF8H 1TNTA 3T8TA 1BIAA 4HX8A 4JI3H 3FWEA 2AXLA 3RPQA 3U2RA 2JSCA 3BOQA 3WGHA 1BM9A 1G6NA 1Z1DA 5A2QW 5HS9A 4MNUA 2XUBA 3GW2A 2ZNZA 5E18F 2IRFG 1U6GA 2VXZA 2KRFA 4HX7A 2YX7A 2J5OA 1W4MA 3O6BB 4LG0B 3WE3A 5DYMA 2DFIA 1SFXA 1BJAA 3BWGA 2HHHH 4N0BA 4XRFA 4FT8A 3LA2A 1HNZH 4EFBA 4HW0A 1A04A 1IN6A 4GGGA 1KU2A 4KYWA 2E7WA 4DV5H 4LF5H 5ILVA 5L3DA 2XGXA 4OIRF 3GO5A 5CVUA 1FOKA 4EM0B 4RGUA 3WG9A 1RNLA 2VBYA 1WRJA 3EDPA 2CFXA 1L0OC 2QYOA 4EM1A 1LEAA 3C3WA 4WXHA 1FNNA 4EJTA 3J81W 3RKWA 4AIJA 1FBUA 1GHCA 1RUNA 2L54A 3LFKA 1HSJA 1I27A 4UCRA 3IRRA 3GX4X 4YIFA 2ZFWA 1P4WA 4Q48A 2CG4A 2IJLA 2H94A 3P9KA 3E97A 3ML6A 1REPC 1ULYA 3SFZA 2YCHA 1YFHA 1FLIA 4EM2A 1K78B 3ZMSA 2FU4A 4CXFA 1OR7A 3RYPA 1MDMB 3ROUA 4LMYA 2XROA 5CLSA 2XKPA