4I7HA

Structural basis for peroxide sensing and gene regulation by perr from streptococcus pyogenes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
DIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVCEICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Peroxide Stress Regulator from Streptococcus pyogenes Provides Functional Insights into the Mechanism of Oxidative Stress Sensing.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transcription
molecule keywords peroxide stress sensing regulator
total genus 38
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i7hA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4i7hA02
1G6NA 4N9IA 4ESFA 5ICCA 2EFWA 2XRNA 3LAJA 4EJUA 1R36A 5HDKA 3QU6A 3QAHA 1DPUA 2VBXA 3CJNA 3FHZA 3J7AO 3EDPA 1P4XA 5LHIA 3WTUC 3GWZA 2M45A 4EJOA 2V1DA 1O3TA 3Q5FA 1LVAA 1IRFA 2MLKA 1D8KA 3TO9A 4G8XA 2QZ8A 3CUQB 2L4AA 4M72A 3BY6A 3EETA 1LB2A 4EGYA 2OZUA 1KYWA 1RZ4A 1J7KA 4RGXA 4EJTA 2IA2A 3QP5A 3TOAA 3GFIA 5ICGA 2ZO4A 3KLOA 2JPBA 4EMSA 1YTYA 3DXJF 1HSJA 3ZMTA 1EV7A 3JAMK 1ZG5A 2K4BA 2H6BA 1ZRDA 1FYMA 3LA7A 2XAJA 4HLXA 2RDPA 3HUGA 5D5UB 1NHAA 2ZFWA 2ISYA 4L5JA 4HOBA 1B4AA 1CGPA 3NRVA 3VFZA 2J5OA 3SFZA 3ECHA 2M87A 3D0SA 2HQRA 2M8EA 1EH8A 2QM3A 1FZPB 2FE3A 2ZNYA 2IVMA 1IXCA 3JW4A 2XAGA 2XAFA 1KQ9A 3EQLF 5HS8A 2ZMEB 5CVJA 2VOPA 4WCGA 1I6XA 2DQLA 3RKXA 2CYYA 2P4WA 1WWXA 2PLYA 4HX4A 4RAZA 4B8XA 3WTTC 1USSA 3VODA 3ZMZA 1HKQA 3G73A 2H6CA 5L3FA 2MH9A 4Y15A 1TLHB 1YW7A 2MH2A 1FWZA 1ZG3A 4RB1A 4UV9A 1IAWA 3CO7C 4U0VA 4I01A 1F5TA 4A0XA 3FX3A 3E3VA 2PI0A 3C1DA 1TNSA 3HTSB 2X0LA 4S05A 2FBIA 3E6MA 3RYPA 2XV4S 1VTNC 4JBAA 2BV6A 4CGZA 3JSOA 1FLIA 3HIFA 2HYFA 4YFKF 1O3RA 1RIOH 2CW0F 2G7HA 2L3DA 2W85A 4L0YB 5CLSA 2EWNA 5D8KB 1TTYA 5E8GA 4PDKA 5FD5A 1I1GA 1HSTA 3KFWX 4O5VA 4R1HA 3MZYA 3MFKA 1H9GA 3KETA 3ZQ7A 2CFXA 4ENMA 4LB5A 4ESJA 1O3QA 4BYYA 3FXUA 3V8KA 2WTEA 4G6QA 1MDMB 2ACJA 1WKMA 5DCMA 1U78A 1J5YA 2Y0MA 4HQEA 4A0YA 4M9SA 3QPHA 3I5UA 3DFGA 2Z3YA 3HSFA 5CVRA 3QRFF 1CF7A 3C3WA 3KCCA 3DPLC 2IA0A 1IZ1A 2CWEA 4RGRA 3WE2A 2HZTA 1K7AA 2O0YA 2NNNA 3KLNA 5TJJA 6PAXA 3LA2A 5A2QZ 1SFUA 5DCFA 1U5TA 1IRGA 5FLXK 3T1BA 3T8TA 3KP5A 2Q8KA 4MQ9F 1Z9CA 3TQNA 2NRAC 3ZMVA 2VODA 1HKTA 1R22A 2MD5A 4LK1F 5LRRA 5AIPA 3F6OA 1J2XA 2D1HA 2EFQA 4L0ZB 2RQPA 2VC1A 5K5OA 1KU9A 3ULQB 4ZZDA 3F8FA 2MA3A 1V4RA 1LQ1A 3FXQA 2ZJ2A 3RKYA 4HF2A 2HKOA 4KIGA 4PCQA 1B9MA 4ZYGA 1V3FA 4IRHA 1XMAA 1KGSA 3N4MA 2H27A 1U5TC 2Z33A 3KE2A 4KUMA 2ZNZA 1TBXA 5E1WA 5DYMA 4L9TA 3KP7A 1P4WA 1DPRA 4AIKA 3BOQA 1BI0A 4YFNF 2UXXA 4M9XA 1F4KA 1Z7UA 4R79A 4YFXF 2DO7A 2FA5A 5BQTA 1FY7A 2F5FA 1JHFA 3E6CC 2BYVE 2OA4A 1FBQA 5CVIA 1J9IA 1ZARA 2PN6A 2QVOA 1WI9A 3QPTA 1RUNA 4FX4A 4O6JA 1PP7U 3HTUA 2P5VA 4PGGA 4LLLA 3T0YA 4KFCA 5HS9A 2HFHA 1T0FA 2JT1A 2PBIA 5FGMA 4CZZA 2DLLA 2ZKZA 3WU1B 2EFPA 3P9IA 5KK1A 4G9YA 3H3UA 4FT8A 2RKHA 2H94A 2WC2A 3U2RA 2QQAA 5TRDA 1FPQA 1QBJA 5AIQA 5DV5A 2EA4A 3T5XA 1XCBA 4PZJA 1FNNA 2XVCA 4UV8A 1S29A 1LNWA 5DD8A 2XASA 5L3EA 2X4HA 5ERIA 1KU2A 1P6RA 3BJOA 3T8RA 4BHBA 3F21A 3TDUC 3RTRA 2Z99A 3MZHA 1R5GA 2NAZA 2O61A 3R0AA 4P9UA 3HOSA 5DCMB 1YS6A 4UVBA 1K78B 3GZ5A 4IVNA 2DW4A 1G3SA 3KEOA 3RDIA 4EV0A 4P5OA 3MCZA 3FZVA 5K5QA 3ZMDA 2OD5A 4RS8A 4ZYHA 3O2PE 3K1MA 2KRFA 4P55A 1ZGJA 3I54A 1O3SA 1Z6TA 3Q9VA 4AD9A 3K1PA 3NQOA 2F2EA 2LF8A 3DEUA 3HRTA 1KQ0A 5LGTA 1ZG1A 1PDNC 1HXDA 4MHGA 3VB2A 5D6EA 2YX4A 1R7JA 1WSUA 4BXUA 1XDUA 1IN5A 3WTSC 5HLGA 4I7HA 1TNTA 4GCVA 1TQIA 2EJRA 4XLNF 1TQPA 3AAFA 1T98A 2IJLA 5H6RA 4CICA 1SD7A 3QP6A 5E18F 3J80K 2A5YB 1FBUA 2VBWA 3PQKA 1IF1A 2MBFA 1R23A 4BNCA 3O6BB 3BPVA 3PFIA 3CDHA 4A12A 2F5DA 1U6GA 1S6LA 5IT9K 5D5VB 1YW9A 4K2EA 4NHJA 2FNAA 3COAC 1STZA 1U2WA 3I59B 3J80Z 4A6DA 2HGCA 1ZYRF 1BM9A 1JXSA 1QQIA 3QOPA 4FX0A 2E7WA 5A2QK 1HW5A 1MKMA 2K27A 1HBXG 1IN7A 1IN8A 3ELKA 1K78A 4RAYA 3DP7A 4A0ZA 2GZWA 2QUFA 5FB2A 3RJPA 2DPDA 5ED4A 1BC8C 2VC0A 3ISPA 3TO7A 2RNJA 3BPXA 2L01A 2UWMA 4IJAA 2UZKA 2DTRA 3TGNA 3WGHA 5F1RA 4YIIA 3KZYA 1IN4A 1FYLA 3MEXA 3M9AA 4S04A 3L2CA 1QO0D 3I64A 3TO6A 1X3UA 2V1UA 2DAOA 2VBZA 3CUQA 3ZP5A 5IT3A 1YW8A 4G7ZF 3TKYA 4XRFA 4BQAA 3L09A 3NEUA 3WTZA 2STTA 3LSTA 4Z2YA 5HS7A 4UXNA 5AONA 2O6GE 4GGGA 5ILVA 3M8EA 2A07F 1AWCA 2PMHA 4WF2A 2FBKA 5D4RA 4OIOF 3D5LA 4HDVA 2XROA 1Z05A 2DK8A 1QPMA 5BMZA 1XGSA 4LD5A 2V9VA 3GFJA 1ZHFA 4MTEA 4EM2A 4RGSA 3IL2A 1U8RA 4WXHA 1G3TA 3JTHA 4QLCU 2CGPA 4Q48A 5CJ9A 3ROUA 1BI2A 3FWEA 5FLXZ 2KIUA 2YR2A 2HS5A 2P6TA 1BC7C 4ASNA 4U7DA 1IN6A 2ZMEA 2HYGD 2ISZA 1L3LA 5LHGA 4JK1X 3ECOA 4KIFA 4OIPF 4B09A 3KEQA 2MLGA 1MGTA 3HRMA 3GFMA 1ZH5A 2M30A 1B59A 1BI1A 3F8MA 3V4GA 2EB7A 5K5RA 5CVUA 1B9NA 2FSWA 4GXOA 3MWMA 5FFZA 2DT5A 4ESBA 4IHSA 2Q0OA 1YFHA 3WODF 4NQWA 4QWQA 2GWRA 3SHFA 4LFUA 3GXOA 2A6EF 1U5TB 3SZPA 3VOEA 1UHMA 1PP8F 2DPUA 4OMYA 3E6BA 4UVCA 4DQ2A 1HKSA 4HX7A 5EEHA 3HSRA 2M1BA 2IRFG 5DUKA 3K9TA 3WTVC 4M74A 1QZZA 1SMYF 4KMUX 4AWXB 4XBFA 2GAUA 3EUHA 1DDNA 3W6JB 2XKPA 2ESHA 2P5LC 2HTSA 2L02A 2Y48A 2LSOA 2DK5A 1UB9A 5L3CA 4M9ZA 3W6KB 4BH9A 2J5PA 2XIGA 4M6XA 1JGSA 5HDGA 1AOYA 4HLYA 3S2WA 1W4MA 2E1NA 2QWWA 1BJAA 3RPQA 3B73A 4KMFA 3MAJA 4R8HA 2O8XA 2XAHA 1YG2A 4WWCA 4HAMA 2IW5A 5IT9Z 3WE3A 4KT5C 1KU7A 3HRSA 3IRRA 3L9FA 4I09A 1S3JA 1YIOA 2VE9A 1DP7P 4ZYEA 4I2OA 4UUVA 3GUDA 5FO5A 2DFIA 5D5XB 1FT9A 2ESNA 2GQQA 4EVIA 5KVRA 1MZBA 4H0EA 3L7WA 2QBYA 1BOAA 2WV0A 4MNUA 5D4SA 3RI4A 1R1TA 3U9GA 3FF5A 3E6DA 4MEXF 1QNTA 4EJVA 2QYOA 4ZYDA 3K69A 5HVQC 3IC7A 4ETSA 5E17F 3ZPLA 1KA8A 2K86A 3DV8A 3ERED 3V8JA 1YQAA 4D0PA 4GYIA 3GX4X 4HW0A 4RGUA 5HOOA 5JR3A 5ILSA 4ON0A 4L18B 4I0BA 2NYXA 2CSOA 1BI3A 4KDPA 2A61A 3GFLA 4IRGA 4G7HF 1H0MA 1IW7F 4FHTA 1R1UA 2PJPA 1OPCA 1S7OA 1OMIA 3VEPA 3WTYC 1XGMA 1FBSA 2B0LA 2RGVA 4L9JA 4IRIA 4LB6B 4I0AA 4MGRA 5L3BA 2FQ3A 2K4JA 2M5WA 1Z1DA 1UFMA 1FYKA 2BE5F 2GA2A 2XAQA 1U3EM 4OINF 2A69F 2XKOA 5DEQA 3V7SA 4A2UA 3GLXA 5LLQA 1MDMA 3CUOA 1QZYA 2COMA 1R00A 4OIQF 4LMYA 3FMQA 2GXGA 1W7PD 2BGCA 1XGNA 3DQVC 3FM5A 5ICFA 1YYVA 2ELHA 2VN2A 4RB0A 4CXFA 2NNYA 1RUOA 2YSRA 5JVTA 2W25A 3F23A 4E70A 2ADUA 1SD6A 2RN7A 3V8LA 2UXNA 2A3SA 3IWZA 2F5EA 3CO6C 1XD7A 2L4MA 3SXYA 1BIAA 4HQMA 2CG4A 2LDUA 5LEJA 5L3DA 2AS5F 1T6SA 1USTA 5ICEA 4KA4A 1T38A 1D3YA 3RIRA 1H9TA 1C0WA 1R58A 2H09A 2FF4A 2HQNA 2IP2A 3O3KA 2ZCWA 4I02A 2IPQX 1FSEA 2PG4A 2CO5A 3RPUA 5DUIA 4Q4ZF 3KP4A 3BP8A 1CF7B 3H3ZA 3IKTA 3LWFA 1XCVA 3JAMZ 4A5NA 3FM3A 3ZMSA 2NS0A 1LDJA 2HDCA 1BN5A 4HV5A 5H20A 3R6SA 2FOKA 3KP3A 1F9NA 2F5CA 4CYDA 3RYRA 1I5ZA 4TV7A 4LG0A 1L0OC 3G3ZA 2MC3A 4G6DA 2YX7A 4OIRF 2V79A 4CDGA 4U0YA 1S8NA 4Q5SF 3WTXC 1FSHA 2K02A 1YO5C 2E1CA 4GYGA 4WXDA 2EA2A 1W7PA 1GVJA 1G3YA 3IKVA 2EK5A 1I27A 3HHGA 3F22A 1Y0UA 3E5XA 1FX7A 3ABTA 2FU4A 3ABUA 4G7OF 3ZMUA 2OZ6A 2DU9A 4KN4X 1IXRC 3IHUA 5K1YA 2OQRA 2P7VB 4UVAA 2LKPA 1QGPA 3KP2A 2P7CB 3V7RA 2HEOA 4RB2C 3IRQA 1O57A 3I58A 1ZRCA 4I98B 1XB4A 2QQBA 3I71A 5HDNA 2W57A 4Y17A 2XUBA 3OV8A 1J0RA 1W7PB 3DF8A 2YU3A 2JSCA 1JHHA 4U88A 2BEOA 1ZN2A 3CUQC 4G94A 3WGIA 5HLIA 4EQQA 1FP1D 1R5HA 2FRHA 4LLGF 2QLZA 5LGNA 4HX8A 1ZGAA 4ENJA 3EYYA 3BDDA 3H92A 1Z6RA 4LLNA 3IWFA 2DI3A 5LHHA 2G7UA 4EJWA 2EV6A 3BROA 3HHHA 2LNBA 5JFRA 4A6EA 3DKWA 3EYIA 1LEBA 2R7FA 1MJBA 5LGUA 1FP2A 2QENA 3I0TA 2RC4A 3MQ0A 3JSPA 4HDUA 5CYVA 1TW3A 2GA1A 2KIFA 2GXBA 2FMLA 2VBYA 2HR3A 1TQMA 2FNPA 2VT3A 2EFNA 4LG0B 3GYHX 4NB5A 5E1XA 4IF4A 1IUYA 4YIFA 2RV8A 1SFEA 2FEZA 1GXQA 1W5TA 2ETHA 1OYIA 3E5UA 5D5WB 4DNCA 4HYEA 2VONA 3KP6A 1MJAA 3E5QA 2OU2A 2RVCA 2YPRA 2Z9OA 2PEXA 4XLPF 3C7JA 2IT0A 3LFKA 3BJAA 1B1BA 5LRSA 1EH6A 1DUXC 1HQCA 4YG2F 3JTGA 1REPC 1YS7A 3HYIA 1KYZA 1R1VA 2KJBA 1LEAA 3CTAA 1YLFA 1S7AA 1T2KA 4AIJA 5J8CA 5E8IA 4P9FA 2OBPA 5JI6A 2PQ8A 2HTJA 4JQFA 1F1ZA 4EM0B 4WK8F 5F6FA 3TDZC 4A5MA 2DQRA 4IPAA 4L9NA 3LQRA 3GO5A 4EM1A 2KKOA 4XSZF 2VOOA 1E17A 3I59A 5CVVA 2PFBA 4HF1A 1SFXA 1LJ9A 1ZREA 3R4KA 3LA3A 4XSXF 2AXLA 5J6XA 3SQNA 3BZ6A 5BS6A 4M71A 2ZBKA 4M73A 1T39A 1Q1HA 2JRTA 3R60A 1ZAOA 4EGZA 2K7LA 2A6HF 1FC3A 1XMKA 4WX9A 1HW2A 3HSEA 4PGHA 3WU0A 3Q9SA 3WTWC 1ODDA 5LEKA 1D5VA 3OOPA 1TW2A 3I4PA 5BPIA 1XSDA 2JTVA 1G4DA 4AIHA 3SZTA 4U7BA 5JHUA 1A04A 4OMZA 3FXRA 3M7GA 1Z91A 4WXCA 2VXZA 1J75A 3F3XA 4LK0F 2E7XA 2EV0A 4BHPA 4KN7X 2WWYA 5BPDA 3N97A 3WGGA 3J81Z 2L54A 4OU0A 1XGOA 2Q2EA 5F64A 1IXSB 1OR7A 2Y75A 2D2WA 2FMYA 4Y13A 4HA8A 5LBQA 2STWA 4UHTA 3K0LA 2DBBA 3R61A 3ZN0A 2W24A 3REOA 3PQJA 5DDGA 3HRUA 3QU3A 4KYWA 1XN7A 5BOXA 5J8FA 2V1XA 4ZZLA 1P2FA 2R7DA 3ZN1A 2FXAA 1B6AA 2QBYB 5D6FA 3BJ6A 1E2XA 4BAYA 5H6QA 2BBYA 2G9WA 2PMUA 4ENKA 5ILUA 2D1VA 3K2ZA 3F8NA 3B02A 3GF2A 4IHTA 3GW2A 3C18A 1J59A 3E97A 4UNOA 1GXPA 1ON1A 3FMSA 4BHCA 1KQ8A 1K6OA 5DD4A 2OQGA 3F8BA 3RKWA 2P5KA 2HOEA 3K1NA 3I53A 3P7NA 5E1ZB 3FMRA 3U1DA 2OAZA 1W5SA 1D8JA 5E20A 1OYYA 5FD6A 3KZZA 4U0WA 1SMTA 2KIMA 1P92A 3DPTA 1SD4A 1XSVA 1OKRA 1SD5A 3F6VA 4AVPA 1P4AA 2JZYA 2O3FA 3CLOA 2TDXA 2C6YA 3LQQA 4GO1A 1O7FA 1WQ2A 4L5IA 1MD0A 4HBLA 3GEZA 2VT2A 1OYWA 4M6YA 4Q47A 1BIBA 3L00A 4KICA 4ZH4F 1EH7A 3WG9A 3BWGA 2CQKA 3F8CA 4F7ZA 1RNLA 4OOIA 1FOKA 1XDSA 1K79A 2HWVA 2R3SA 1LDKB 3F72A 3M8FA 1ULYA 3HOTA 3GZ6A 4RB3C 2GIVA 4KNYA 4HZFA 1ZLJA 2KJCA 3P9CA 1HW1A 5D8LB 4N9HA 2XHKA 2P8TA 5HLHA 2P6SA 5FFXA 1XSXA 2EV5A 1G3WA 4HV6A 1UHWA 3ML6A 1UCRA 1PUEE 2Z5UA 4HF0A 1GHCA 4P96A 2V6CA 1ONVA 2O03A 1JE8A 2A68F 3J81K 2W84A 4O3MA 4L9VA 1ON2A 4N0BA 2VE8A 5EEGA 1WRJA 2IA1A 4MEYF 1BBYA 4KIBA 1ZRFA 3P9KA 4CO8A 4MTDA 3LAPA 1ZLKA 4LJZF 3R0JA 3TOBA 4IXAA 3GVAA 4ENNA 4MQVA 2FBHA 1MJ9A 2XGXA 2QQ9A 5L3GA 1KU3A 1SAXA 2HKXA 1O7LA 2EFOA 2LF7A 2D45A 2JPCA 1LDDA 3V7CA 4LGWA 3M1EA 2ZXJA 1I1SA 1RI7A 4CHUA
chains in the Genus database with same CATH superfamily
4O3RA 1G6NA 3G1MA 1GVDA 4HSRA 3LSPA 4N9IA 4ESFA 3OSGA 4RDUA 5ICCA 2EFWA 1RYSA 2EQRA 2XRNA 1Y0NA 3GZNB 3VYTB 3LAJA 4EJUA 3ONQA 4U7CA 3EPZA 4B1RA 1R36A 2DTZA 5F9NA 2CV1A 5HDKA 3QU6A 3ASNH 3QYFA 3GCMA 2FB9A 3QAHA 1DPUA 2VBXA 1BOBA 1GGOA 2QGUA 2VB6A 3J7AK 3CJNA 1JTYA 2M4KA 3FHZA 3J7AO 3EDPA 1P4XA 5LHIA 3WTUC 1VQ7I 5IP7G 2BY3A 3MJFA 5GTIC 4LOCA 1Z67A 3GWZA 5DQHA 2M45A 4EJOA 2FK2A 1GV2A 2V1DA 1O3TA 4G12A 3Q5FA 3ZXSA 3MKYB 1LVAA 3G6VA 1IRFA 2MLKA 2PMZA 1T0FC 5KFPA 1D8KA 3TO9A 2HI3A 4G8XA 1U9NA 1GUUA 4GKKH 2QZ8A 3KTMA 2TCTA 2BHYA 3CUQB 2L4AA 2XC9A 4EFBA 1JKOC 4M72A 1XC5A 3BY6A 3RQ4A 2E1OA 3EETA 1LB2A 4EGYA 1KZHA 2OZUA 3LOCA 1KYWA 4DYCA 2YU9J 2R8GA 1RZ4A 2I5UA 3ZQCA 1J7KA 4RGXA 3EUHC 3HB9A 2CJJA 4EJTA 1FVIA 2YRXA 4LFBH 2IA2A 3QP5A 3RV4A 3TOAA 1S0MA 3GFIA 5ICGA 2ZO4A 2CQ7A 3KLOA 2JPBA 4EMSA 3FK6A 4ZOLF 1YTYA 3DXJF 1ZGWA 2DZDA 4J0MA 2R7LA 4EBDA 1HSJA 3ZMTA 1EV7A 4FISA 2CUJA 3RUPA 3JAMK 2AXTC 1ZG5A 5KFQA 2K4BA 3UQ8A 2H6BA 4MAMA 1IUFA 1N25A 2W8KA 1ZRDA 1FYMA 3LA7A 1JUPA 2XAJA 4HLXA 4RZRA 2RDPA 4BU2A 1WPKA 3HUGA 3HOXG 5C4JJ 5D5UB 1WJDA 3KYCB 2FX0A 1MMNA 1NHAA 5KFFA 2YZNA 1K61A 2ZFWA 2ISYA 3CCMI 1I7LA 1LFPA 3OYAA 4XLCA 3BAAA 4ED8A 3RAXA 2VKEA 4QWCA 3V6KA 3HPGA 4L5JA 4O2AF 5FPOA 4ECZA 4BXXG 4HOBA 2YCHA 3TQ1A 1B4AA 1CGPA 4BJ6C 2LMDA 3NRVA 2FK3A 1ITYA 3VFZA 3ZQFA 2VLAA 2E5NA 3MZ8A 4II3A 2IS1A 5KCMA 4DBQA 3OYCA 2L2OA 3HXLA 2J5OA 3SFZA 4BQOA 3ECHA 4CYCB 1AHDP 1UHSA 2JVGA 2M87A 2JVHA 4ECYA 3D0SA 3VPBA 2HQRA 2HPMA 2ASLA 2M8EA 2NXNB 4DR4H 1EH8A 5BPFA 4BEHA 2QM3A 4BBSG 5M3MJ 3BZKA 1FZPB 2FE3A 2M4GA 2ZNYA 3DPUA 4BWSC 5KFMA 4ECTA 5EEAA 2C22A 2RF4A 2IVMA 1IXCA 1Y8QB 3SFIA 2BQRA 3JW4A 4DJAA 1WH2A 5JQWA 5KG7A 2XAGA 3L4JA 3AFHA 3H0GG 2XAFA 4NQWB 3S3NA 2OLSA 1TWCA 1SVMA 1G8XA 1FTZA 1KQ9A 3EQLF 4RLQA 4IAJA 5HS8A 3K70C 3VMMA 2BY2A 2ZMEB 5CVJA 2VOPA 1T56A 2CMPA 4WCGA 1MNMC 2AGQA 1I6XA 1N48A 1JDEA 2DQLA 3RKXA 2CYYA 4QTRA 5KT3A 2NU9B 3T5HA 4EGQA 3KPHA 5KFVA 3CD6I 2P4WA 1WWXA 3OYBA 4XKBA 3H9JA 2PLYA 4HX4A 4RAZA 4B8XA 4YJ2F 1LVKA 5KFIA 2Z2SB 3HOVJ 3BTIA 3WTTC 5K7HA 2OTLI 1USSA 3VODA 3ZMZA 1HKQA 4HNVA 3G73A 4DL6A 2H6CA 5L3FA 2MH9A 4Y15A 4X65H 4QIWA 1TLHB 1W96A 1YW7A 4PSWA 1TWAA 2EINH 3JRBA 2MH2A 2JRMA 2R7MA 3DWLE 1A9XA 4DL3A 4ECSA 2GLTA 1HNXH 3RB3A 1FWZA 4OX9H 5IT9W 1D1AA 3AYHB 1ZG3A 4RB1A 1KJQA 1I39A 4MV9A 4UV9A 1IAWA 1UELB 4U0VA 3CO7C 4I01A 4QWBA 1F5TA 4A0XA 2HHHH 3FX3A 4LF5H 2VXDA 3E3VA 2PI0A 4DV0H 3C1DA 3CDIA 1TNSA 3M9NB 3HTSB 2X0LA 4S05A 2FBIA 3AL0B 3E6MA 5M3FJ 2ZJTA 3N05A 3HOWG 2LBFA 5EGOA 5LL6b 3RYPA 4ZDLA 2JA5J 2XV4S 1VTNC 2Q2TA 2W7NA 4JBAA 2BV6A 3GTPJ 1XNRH 4CGZA 3DU5A 1EUCB 2WY8Q 3EUKL 3JSOA 4XMYA 1FLIA 3HIFA 2HYFA 4YFKF 1WJBA 1O3RA 1RIOH 1A31A 4ZI7F 4EBCA 4DUZH 2CW0F 2PMZN 2ZDHA 2G7HA 3SDGA 5EF6A 1MSEC 1U9OA 2L3DA 3HDDA 2W85A 4L0YB 3C2BA 2IGMA 2FJZA 5CLSA 2EWNA 5D8KB 2R92G 2Y69H 1E3PA 2MC4A 1TTYA 5F04A 4XRMA 4ECVA 5E8GA 1SAUA 3CMEI 3H36A 4PDKA 1FIAA 5FD5A 1I1GA 3HBLA 1DU0A 1UAAA 4DL4A 3GTJA 4JX4A 1HSTA 3KFWX 4O5VA 4R1HA 4XYLB 2VQCA 4L5EA 3MZYA 3MFKA 2L0KA 2WTFA 5K7ZA 2V5AA 2QSHX 4O3OA 1ETKA 1H9GA 2Y30A 3GMEA 4PSXA 5KT6A 1POGA 1UG0A 3ZQ7A 3KETA 1S72I 4IEJA 2CFXA 3H0GA 4ECUA 2DXIA 3I4MG 1QRYA 4ENMA 5KFTA 1X9NA 3H9QA 4ESJA 4LB5A 1O3QA 1B33N 4BYYA 4BE0A 3FXUA 2DCEA 1V5GA 2WTEA 3V8KA 2R5YB 3HKZA 3DKXA 4XQFA 2DLNA 1AA7A 2P0AA 4E7KA 4G6QA 1MDMB 3ZGKA 3MR6A 1YJNI 2XPUA 1E4GT 3OYFA 2ACJA 1KBLA 5DLFA 2VOBA 2AU0A 3JRAA 1IOVA 4ZTFA 1WKMA 1VQLI 4M3DA 5DCMA 3SDBA 1A6QA 1U78A 2J6SA 2K9MA 5IPAA 1J5YA 1HOMA 2Y0MA 4HQEA 5M5WJ 5EZYF 4A0YA 5IYDG 4M9SA 3QPHA 3I5UA 3IAM2 3KYDB 3DFGA 2Z3YA 2IA6A 2W7PA 3J7AY 3HSFA 5CVRA 3QRFF 4B48A 1CF7A 5F0FA 3FMAA 4EFEA 3C3WA 1Z3YA 2E2JJ 1S9HA 1JKJB 3KCCA 4YR2A 1E4FT 3DPLC 4J9NA 2IA0A 1IZ1A 2CWEA 4RGRA 1GLVA 3WE2A 2HZTA 4FASD 1K7AA 4UCTA 1VKZA 2HVRA 2O0YA 1X1CA 2NNNA 4B43A 3KLNA 2K40A 4BQQA 3PN1A 3G6YA 2VJ5A 5TJJA 2FUG2 4BGDA 6PAXA 1R5ID 3LA2A 3QYEA 5A2QZ 1X3WB 3ABKH 4BBSJ 1SFUA 3FBNB 1DP3A 5DCFA 3I4MJ 1U5TA 1RPWA 3GIPA 1IRGA 5FLXK 3T1BA 3T8TA 3KP5A 2Q8KA 4MQ9F 5B3SH 3TQNA 3PIPF 1Z9CA 3ZMVA 3PNYA 1ZR4A 2LTPA 2NRAC 2VODA 1HKTA 1AUVA 2WV1A 3PUBA 3W2VA 1R22A 2B63A 2MD5A 4LK1F 1IDZA 1EZ1A 1LFBA 5LRRA 5AIPA 4GC6A 2JA7A 3MVPA 4CC6A 1K1SA 4YAJB 4KHPH 5D8DA 4IHJF 3F6OA 3T1YH 3QPSA 1C30A 1J2XA 2D1HA 2XF7A 4UCOA 2EFQA 4L0ZB 5T14A 3AG4H 3PR5B 2RQPA 2VC1A 4CCJA 2E1MB 5K5OA 3S17J 1KU9A 2NS8A 3ULQB 2ZMEC 4ED6A 4ZZDA 3F8FA 2MA3A 1SANA 1TAEA 1V4RA 1LQ1A 3DEEA 3FXQA 1GSHA 4I76A 1B8IA 5JLWA 2ZJ2A 3RKYA 1DU6A 3W3CA 4HF2A 4O3QA 5KG5A 4GLXA 2VI6A 2HKOA 4KIGA 1XX5A 4AU7A 4PCQA 5LP6F 1NG6A 3RZOJ 3GV7B 3KZIC 4F4XA 1B9MA 4A3BJ 4ZYGA 1V3FA 2XGPA 4IRHA 4FCYA 3OSNA 1XMAA 2DMUA 1KGSA 3N4MA 2H27A 1U5TC 4RNNA 2ALZA 4DOZA 2Z33A 3KE2A 4KUMA 5C4XJ 2Y0SE 5F08A 5KFUA 3IAS2 2ZNZA 2E19A 4XM3A 1FEXA 1TBXA 5KFRA 5E1WA 5DYMA 1JT0A 4L9TA 3I3LA 3KP7A 1P4WA 2XF6A 3CP2A 3DF7A 4BY7J 1DPRA 4AIKA 3TMOA 2VJJA 1BI0A 3BOQA 4YFNF 2UXXA 3ZQGA 3H40A 4M9XA 4F93B 1IBLH 1F4KA 4IQ4A 1Z7UA 2LK2A 4R79A 4YFXF 3L2QA 2DO7A 1S0OA 2FA5A 2V4JC 5BQTA 1GDTA 1FY7A 2F5FA 1JHFA 3E6CC 1H88C 3GTKJ 4LITA 3TW6A 3BQ1A 3UFXB 2BYVE 3OTOH 2OA4A 1FBQA 5CVIA 4XZ3B 1TZLA 3S32A 1J9IA 4AUXA 1ZARA 2PN6A 3K4KA 3G4SI 2CRGA 4B44A 4B3TH 3L2VA 1IOWA 2C28A 2VQFH 2QVOA 1WI9A 2HYJA 3QPTA 5C5JA 2HU9A 1RUNA 4FX4A 4O6JA 1PP7U 1ZKGA 3HTUA 3K4BA 5IY5H 2KMUA 1VQNI 3K3PA 4FS2A 4XOPA 1B72A 2DFEA 4A3GJ 2P5VA 2JA5A 4PGGA 4LLLA 1WSCA 3T0YA 4LIVA 4KFCA 4XKCA 1IRXA 5HS9A 4YEJA 1X19A 2HFHA 1ETVA 1T0FA 2Z1DA 2JT1A 2R87A 2PBIA 1W5CC 2ZFUA 3H5RA 5FGMA 2DLLA 2ZKZA 4CZZA 1N77A 2R0QC 3BQ0A 3AG1H 3JREA 1W1WE 3WU1B 2KDOA 2RDIA 3CCLI 1X1AA 1YE9A 2O9LA 2FLLA 2EFPA 4JI8H 2N8GA 5HBRB 3P9IA 5KK1A 2P0WA 4G9YA 1SFOJ 1N34H 3H3UA 4FT8A 1BNCA 4A3JJ 3KALA 1JT6A 5L9XA 3W2WA 2RKHA 5KT4A 5IWAH 2KSWA 2XF5A 3T1HH 2JUCA 2H94A 3VSLA 2WC2A 3CDLA 3U2RA 2QQAA 3QQAA 2XCAA 4UUSB 5TRDA 1QU3A 1D0ZA 3HKZE 1FPQA 1QBJA 3OR2C 5AIQA 5DV5A 2EA4A 3CMMA 4IL6C 5B5EC 3T5XA 1XCBA 4PZJA 1FNNA 3O8GA 2EILH 3GTGJ 1QVTA 3FXOA 1KJJA 2XVCA 4LF4H 4IQJA 2QKMB 2BXZA 4Q45A 3UNGC 1DGSA 2YYAA 4UV8A 3GIQA 3JRWA 1XTAA 2DT7B 4RA2A 1S29A 3CF5F 2Y9ZA 4RLFA 3E1SA 1LNWA 3LSKA 2R7VA 4TV8F 1Y6IA 2XASA 5DD8A 2KHMA 2W48A 4E7SA 5L3EA 1RKTA 4XK4A 1SC7A 2DA3A 4BY1J 1VFCA 4ECWA 3LSRA 4BKXA 3H5AA 3PZPA 4LF8H 2X4HA 5ERIA 4AVZA 2WB1A 4UCVA 3RF2A 1KJ8A 1I50J 1KU2A 1V4YA 3WO0A 4A3FG 2W9CB 1P6RA 2R7ZA 3BJOA 1P7IA 3GTLJ 1X3ZB 3T8RA 4BHBA 3F21A 4V2GA 3TDUC 1ZELA 3RTRA 2C00A 2JN6A 2YS9A 1XNQH 4BJTA 2Z99A 1E4EB 1FIPA 3MZHA 3OL3A 5IOYA 4CC5A 1R5GA 2NAZA 3GILA 4IRDA 4X66H 2O61A 3L2PA 3R0AA 3DBHB 4UB8C 4P9UA 3HOSA 5DCMB 1YS6A 4UVBA 1K78B 3GZ5A 3R5FA 4IVNA 2DW4A 1G3SA 3KEOA 3RDIA 4EV0A 5FLMJ 2VUMA 1A5JA 3A02A 1N75A 1WI3A 5GPCA 2UXCH 2WA0A 2CUZA 1JKRC 2FPGB 3A1YA 5FKMA 3ZOBA 3HOWJ 2W6NA 1T94A 4LH7A 5DGAA 4JI7H 2PMZE 2E2IA 3T5KA 2FD5A 2R4GA 3G8CA 1P7JA 1B6RA 2R93J 4W1UA 5KFLA 5E3OA 2CS3A 4P5OA 1MNDA 2YRWA 3MCZA 2V4QA 4NUBA 1GLNA 2RDJA 4FETA 3FZVA 4ECRA 5K5QA 3GV8B 3ZMDA 2OD5A 2JWTA 2YS6A 3ZQQA 4RS8A 4ZYHA 3O2PE 1B04A 3Q8PB 3K1MA 4IRCA 1FMVA 2HQ5A 2KIQA 2KRFA 4CH7A 4P55A 1ZGJA 3N43B 2EIMH 3I54A 1V51A 1O3SA 1L2ZA 4XYMB 1LPQA 1Z6TA 3Q9VA 2W00A 4BACA 2R93A 2MYSA 2OC6A 4FE4A 3PW5A 4AD9A 4JP0A 3K1PA 3NQOA 2F2EA 2LF8A 4QW8A 4HRIA 2R85A 3DEUA 1GSAA 3HRTA 1KQ0A 3VDXA 5LGTA 2R92J 3N44B 1ZG1A 1PDNC 1HXDA 3LNQA 3QZ8A 4D5CA 3VYRB 4A3LG 4A3DJ 1WH5A 4MHGA 4XONA 3VB2A 5D6EA 3ETJA 1IGNA 1K83J 2YX4A 1R7JA 4UCSA 3OIQA 2VA2A 1YRNA 2R7TA 3OIPA 5FKKA 1WSUA 4BXUA 3LMMA 2KQRA 1XDUA 1IN5A 3WTSC 5HLGA 3CCJI 4I7HA 4XLEA 4MV7A 1TNTA 2V1NA 4GCVA 1TQIA 2EJRA 2NVYJ 2VQEH 4DR6H 5B1AH 1X4OA 4QPOA 4XLNF 3MR5A 2OUMA 2QQ8A 1M7JA 5KFEA 4RBOA 1TQPA 4BL0B 4CCNA 3AAFA 1W36D 1WJEA 2XCPA 2VUMG 4J9PA 4G3IA 2UUAH 3RKQA 4IHWA 1T98A 4NC6A 1S10A 2IJLA 2WAQA 2XB5A 5H6RA 1SD7A 3QP6A 2DMTA 4CICA 5E18F 1A35A 1A36A 5BNGA 2PJRA 3N8DA 2RGRA 3J80K 4V2FA 5KAFC 2A5YB 2BOLA 4DV6H 1FBUA 1K1QA 2VBWA 3FHNA 3PQKA 1I7NA 3PUFA 4JI1H 1E3OC 2E2HJ 1IF1A 2MBFA 4ME6A 3BQ2A 2R7ZG 3H35A 1R23A 3G71I 2R86A 3FKJA 1PX2A 4JI6H 4BDZA 2UVVA 4N4NB 4BNCA 3O6BB 4E7JA 2X9DA 3BPVA 3TINA 5LD2C 4DLKA 4J01A 2CV2A 3AL0C 4CSWA 3OUZA 1T33A 4NXMH 3PFIA 2V9PA 3RJ0A 1ZR2A 3CDHA 4A12A 3BTLA 2F5DA 1U6GA 2R7QA 3DBRB 4XNFA 1S6LA 1RK5A 1V5FA 5IT9K 2ID3A 2WB1E 5D5VB 1YW9A 4K2EA 4NHJA 2FNAA 2D5VA 3S2DJ 1BW5A 3COAC 2MGQA 2I8DA 3CJTB 1KC7A 1STZA 1U2WA 2UV1A 4RUCA 3I59B 4S0HB 2PBZA 3J80Z 4A6DA 2DPIA 2HGCA 2YL2A 2W82A 5KG6A 4FQGA 3R23A 2W6OA 1ZYRF 2CV0A 3E5NA 3GTMA 4JV2A 1MH3A 1Z2NX 1NG7A 1BM9A 3MKLA 1VI0A 4OWRB 3S14J 1QQIA 1JXSA 3QOPA 4FX0A 4C2UA 2E7WA 1TT5B 3ORQA 2ZDGA 5A2QK 3NWSA 4C5BA 1HW5A 4JV5H 1MKMA 1Y8RB 3H4DA 4DV5H 2E60A 5K2MA 4TUYF 2DA1A 4BBRJ 4O4HF 2K27A 4PFOA 1HBXG 3ERMA 1ENHA 3H20A 1Z0XA 1OCOH 4CCOA 1IN7A 3ZR8X 2IS6A 4XRSA 4I55F 3VPCA 1WJCA 5IYBG 1IN8A 3ELKA 2XC7A 1K78A 5E3LA 2WY7Q 2FOWA 4RAYA 2M0MA 1V54H 3DP7A 4A0ZA 3OYMA 2KT0A 1ZHSA 2GZWA 2QUFA 2LD5A 5FB2A 3RJPA 4ANJA 2DPDA 4AQYH 4J00A 5E3NA 4A3MJ 4RU9A 5FJ8G 3K10A 1MBGA 3OS0A 5JVGF 4Y33A 5KFKA 4A2BA 5ED4A 1BC8C 5KFGA 2A05A 2I8CA 2VC0A 1VZ0A 3ISPA 3KHHA 2VQDA 2EZHA 3RSNA 3TO7A 5DS9A 2EIKH 4DV3H 2RNJA 2R7RA 3L4KA 3BPXA 2L01A 4ED3A 2UWMA 5JH7F 4IJAA 2UZKA 2NVUB 4O4IF 2DTRA 3BR6A 1TWHJ 3HUGB 3TGNA 3WGHA 5F1RA 3CQZA 2K9QA 3M9OB 2B7EA 4ZJZA 5EDWA 4YQWA 3SYTA 4YIIA 5KG0A 2JSPA 3KZYA 3OYLA 1IN4A 4M6VA 3TIGA 1FYLA 3CCEI 3OIOA 2OV7A 3MEXA 5EDNA 3M9AA 4PJ0C 5EZGA 4S04A 1UNNC 2DMNA 3L2CA 1UJ8A 4XKVA 3K2AA 3OS1A 2DYRH 5LMNH 1QO0D 1Y56A 3V4ZA 3I64A 3TO6A 1X3UA 4O2BF 2E71A 5DG7A 2AHQA 1F36A 1WFXA 3H0GJ 2V1UA 3H4BA 1VNDA 2DAOA 2C2EA 2VBZA 5J4VA 3CUQA 2CUFA 3ZP5A 4JYKA 3DCFA 5IT3A 4HG2A 1YOVB 2HOSA 1WGXA 1YW8A 2K9NA 4G7ZF 5D1OB 4ITVA 3TKYA 2Y0SA 4XRFA 2OWOA 4BQAA 4LF9H 4FM9A 2DJNA 2LKSA 4CUGA 2JA8J 2HJWA 3ORRA 1R4MB 3Q8SB 3L09A 3NEUA 2ZB9A 2F4MB 3WTZA 2QSFX 4EEQA 3GTOA 3LSMA 2STTA 3LSTA 3QWLA 4BBRG 4Z2YA 5HS7A 4UXNA 3OY9A 4MV6A 2I87A 1T95A 4A3DG 2IAIA 4ZTJA 2XAUA 4DR7H 5AONA 1P9QC 2O6GE 1HR0H 2DPJA 1Y1WA 1JIHA 4GGGA 2WYOA 2DJIA 5ILVA 4LFCH 2KZGA 2GIZA 3M8EA 3I12A 3GTGA 5CQEA 2A07F 1AWCA 4UUTA 3SEZA 5LA6F 1S68A 2PMHA 1IDYA 2VPRA 2E36A 4B3XA 3LWBA 3MWEA 1VBHA 2VQGA 4WF2A 2FBKA 4NC8A 5D4RA 4F55A 4OIOF 3D5LA 4MFEA 2XROA 4HDVA 3BA9A 3G1OA 3JRHA 1PVEA 1Z05A 3Q0WA 2DK8A 1QPMA 5BMZA 1XGSA 3CLQA 4J9SA 1CS0A 3PSIA 1I6HJ 2ME6A 2R7XA 4LD5A 2V9VA 5F27A 2B9SA 5LXTF 4QIWN 3GFJA 3FDYA 2GLOA 1ZHFA 4MTEA 3KHLA 4EM2A 3PW7A 4RGSA 1QA6A 3QOEA 4RM2A 2M05A 1RJQA 1D0YA 3RCOA 3KXYT 4RNOA 1N56A 1YJWI 3IL2A 2EBIA 1U8RA 1H8AC 2M0CA 3RB6A 2DA2A 2KISA 4J9RA 4WXHA 1G3TA 3JTHA 4QLCU 2UXDH 2CGPA 4J9QA 1Z7LA 4Q48A 4DV1H 5CJ9A 1WVRA 3OR1C 1BI2A 3ROUA 3VWBA 3FWEA 5FLXZ 2BQUA 2XSJC 1VQ4I 4E4TA 4M3GA 2KIUA 3RB0A 1AKHB 2YR2A 1XDNA 2R5ZA 2KZVA 2HS5A 2KP6A 2P6TA 1JGGA 2JK3A 3HOZG 1W93A 2NOJB 1BC7C 4ASNA 4HYKA 2XB0X 3DEWA 4U7DA 4MA0A 1IN6A 2IGKA 2ZMEA 2HYGD 3FXKA 4E7ZA 2ISZA 1L3LA 1VBGA 5LHGA 4JK1X 3NAUA 3HGYA 2JEIA 3A03A 3ECOA 3OYHA 4YHHH 5IP9J 4XKWA 2QSGX 2VJIA 2FPIB 5KG3A 4KIFA 4OIPF 3JAMW 3CF2A 4IO9F 3WNZA 4B09A 2K85A 4C5CA 1T3NA 3KEQA 4UFZA 1IBKH 2MLGA 1MGTA 2WAQN 2YZMA 3HRMA 3GFMA 2K9SA 3MKZA 1ZH5A 2CQNA 2M30A 5F1JA 1B59A 1BI1A 3F8MA 2AQFA 3V4GA 2EB7A 5K5RA 5CVUA 5BMVF 3TIIA 4U6PA 1B9NA 1JKPC 5KT2A 1X4PA 2FSWA 4GXOA 3KIOA 3MWMA 2BVMA 4DGWB 3GBGA 5FFZA 2R92A 3FKIA 4R7RA 2DT5A 4ESBA 1U8BA 4IHSA 2Q0OA 1YFHA 4Y8VB 3WODF 2H1LA 2E34A 3HOXJ 2KL4A 4NQWA 3BG6A 1DQUA 4E7HA 4QWQA 3SE7A 2GWRA 3SHFA 1WCMG 4LFUA 1K83A 3GXOA 2A6EF 2ZDQA 3QODA 4A3KG 1U5TB 3SZPA 1UHMA 3KX2A 3VOEA 4MO7A 1PP8F 2DPUA 1NH3A 5D1OA 2K5CA 2CW8A 3E6BA 4UVCA 4OMYA 4DQ2A 1HKSA 3JCUC 4HX7A 5EEHA 3OYNA 4ED1A 3HSRA 2M1BA 1MSFC 1I6UA 2IRFG 5DUKA 2E35A 1MH4A 1NTCA 3S3OA 1KONA 2R8IA 3K9TA 3WTVC 1R71A 1HA8A 1BJTA 1JLLB 4X64H 2XGDA 3D5RC 4M74A 1QZZA 3MFIA 2Z16A 2HGSA 4C3IJ 1WR2A 1SMYF 3H9GA 4KMUX 1YIJI 5CKTA 4AWXB 1W0TA 2M9HA 3TP3A 2GAUA 4XBFA 5KFDA 2M7BA 4A3MG 3EUHA 5C3EJ 1DDNA 4UY8I 3MWDA 2OCEA 3W6JB 3KHRA 1UMQA 2XKPA 2DOAA 2HOAA 2ESHA 2LBFB 2P5LC 2HTSA 2FK1A 4L1KA 2W4SA 1VS0A 5DM6F 2L02A 5FKLA 5JLXA 2Y48A 2CQQA 2LSOA 1D5YA 1SFOA 2GOMA 2YU9A 2DK5A 3Q8QB 1UB9A 5L3CA 4M9ZA 3W6KB 4BH9A 2NVXA 1PUFB 5DQGA 1OFCX 2DOEA 5IP7J 2BR0A 4UCRA 2J5PA 2X6OA 2XIGA 4M6XA 2GOXB 1JGSA 1WJFA 3LFUA 5HDGA 1AOYA 3F0CA 5K7FA 4HLYA 2X6WA 5EWFA 2UUZA 3LSHA 4B47A 1LE8B 1AKHA 4YR0A 1UC8A 3S2WA 4G6TB 3JRGA 1W4MA 3CCUI 4CCMA 1XG1A 2CQYA 1LKXA 2E1NA 2BHZA 4B3SH 1JXLA 2QWWA 1BJAA 3RPQA 1T8IA 2AGOA 1N32H 1JKQC 2NVQJ 4M3EA 3B73A 2M34A 2O7OA 5IYCG 4KMFA 3MAJA 5IP9G 4R8HA 2ZJPF 2O8XA 2XAHA 2V7FA 5JVLA 3LSGA 1TWAJ 3CC4I 1YG2A 3DBLB 3HGGA 4WWCA 4HAMA 1VQ5I 3GLKA 2IW5A 2IGNA 5IT9Z 3WE3A 4BXFA 4LG3A 2QCOA 2SCUB 3HM5A 1DGRM 4KT5C 1KJ9A 1KU7A 4IOAF 3R5HA 3HRSA 2KLOA 3IRRA 3L9FA 1TWFA 5C1OA 2X1EA 1ZTRA 2ELKA 2MW8A 4I09A 2OPTA 4A3KJ 1S3JA 1YIOA 2WAQE 5BR8H 3NWTA 2VE9A 1XPXA 4DL7A 2F6CA 5FKNA 4K0KH 1DP7P 4ZYEA 3BLYA 4I2OA 2LRDA 4ZC3A 5GAGJ 4UUVA 2IGOA 2R7NA 4QIWE 3GUDA 5FO5A 2DFIA 5D5XB 1FT9A 1MNEA 2ESNA 3D5SC 2GQQA 5BPHA 3Q2OA 2G0EA 4EVIA 2ZJQF 2WDTA 1VQPI 1RJRA 4D1QA 5KVRA 3Q1KA 1SEUA 1MZBA 3CMYA 4PUSA 4H0EA 3L7WA 4CCKA 2XCLA 3CP8A 3O8HA 4AIDA 2EZIA 2QBYA 2W9BB 1BOAA 4N4OB 2CFOA 2WV0A 4JX5A 4MNUA 2LP0A 4QSHA 1BW6A 3S1RJ 2RREA 2GPWA 3MD2A 1Y1VA 2BXYA 1RKWA 3JSLA 2QF7A 5D4SA 3RI4A 1TWHA 3L1PA 1R1TA 4PWQA 3K4CA 4EYIB 3U9GA 3JRXA 3FF5A 3G1LA 3E6DA 3CCYA 4ABZA 4MEXF 2J6UA 2EH3A 1QNTA 3FXJA 4EJVA 4BE1A 2QYOA 2VUGA 2UU9H 1IG7A 4ZYDA 3K69A 1X1BA 1RETA 5HVQC 3B6AA 3IC7A 2R8JA 2DA7A 4HPQA 1CE8A 1JDBB 4LSXA 4ETSA 1X2MA 4A3LJ 5E17F 3ZPLA 1JJ8C 2GXAA 1KA8A 1IJWC 2JA6J 4C2MJ 4CZCA 4MFDA 2K86A 3R5XA 5E3MA 3DV8A 3ERED 1PUFA 2DDAA 4C5AA 5DM7F 3V8JA 4PJLA 1YQAA 3FK7A 3U21A 5C3EG 3IN5A 2W9BA 4D0PA 4GYIA 3HPHA 4C2TA 1RJPA 2WADA 3GX4X 1TL8A 2R7SA 3TBIA 4HW0A 3TW7A 1W0UA 4RGUA 3V6JA 5HOOA 2LLKA 5FLXW 4ED0A 5JR3A 2E5LH 2VIXA 3OS2A 5ILSA 5E79C 1WH7A 3HG9A 3S1MJ 5GONF 4ON0A 3KEYA 4L18B 2W8LA 4IWYA 1ETYA 2Y0SN 4I0BA 2NYXA 1SCUB 3QFFA 4NNJA 2CSOA 4H4KC 3PIOF 2VQHA 3BCBA 1BI3A 3H1CA 3GIDA 3GV5B 4A93G 4KDPA 2A61A 3GFLA 4IRGA 2RQQA 2XGEA 3WHCA 1MMGA 4G7HF 3GQCA 4ED2A 4HNUA 1U0JA 1H0MA 1YI2I 2PX9A 5KFJA 1IW7F 2KFDA 2ASDA 3U1KA 4FHTA 1R1UA 1EA3A 2PJPA 4ZDOA 1OPCA 1S7OA 1OMIA 4DR3H 3VEPA 3WTYC 2BQ3A 1K6YA 2Y31A 1BA5A 4B3MH 4E7LA 3RGZA 5DG8A 1Q1VA 1FTTA 2HNHA 4YRVA 3DKYA 1XGMA 1FBSA 2B0LA 2RGVA 4F52A 4L9JA 4IRIA 4LB6B 3HC7A 2VJ4A 3BQYA 2M7AA 4I0AA 3CC2I 1EYZA 5LOVF 1ORKA 2HDDA 1FJLA 4Y7NJ 3DLAA 4NC7A 2BW3A 4MGRA 5L3BA 2HOTA 2FQ3A 2ZXWH 2K4JA 4DIQA 1FJGH 2M5WA 1VQ8I 5GTHC 2VQLA 3CCQI 2ZXHA 1DV2A 1VQKI 1Z1DA 1UFMA 3H3VH 3DU6A 1FYKA 4A3CJ 2BE5F 3BJYA 4BUPA 2GA2A 2XAQA 4AM3A 3AG3H 1U3EM 5LYJF 4OINF 2A69F 4ZHQF 1RRJA 4ED7A 1SVOA 2XKOA 5DEQA 1C3OA 1JX4A 5EJCA 2Q2UA 2WE6A 4BDYA 3V7SA 2Y9YA 5LFAA 4A2UA 2WAFA 4WBNF 1HDPA 2LYCA 4XLAA 1S9FA 3GLXA 5LLQA 1MDMA 2JEJA 3CUOA 1BR4A 2R84A 1DGWY 1QZYA 4D7MA 1Z2PX 3Q0VA 2COMA 3PW2A 1CQJB 3G6XA 4JX6A 4EGJA 5HNFA 2KRHA 2OF7A 1R00A 4OIQF 4IRKA 4LMYA 3HJEA 3FMQA 3VSKA 3U9TA 4TQSA 2GXGA 5EG0B 2JA7G 1W7PD 2BGCA 3AG2H 1QHGA 4M3BA 1XGNA 2V59A 5EOYA 3DQVC 5J2TF 3FM5A 5ICFA 1YYVA 1ULZA 2L9NA 1VAJA 2ELHA 3CESA 4HSTA 3L2WA 3RTXA 1GO3E 2ELJA 2VN2A 4IHXA 4RB0A 4CXFA 2NNYA 1GV5A 1RUOA 2YSRA 3HZJA 5JVTA 2W25A 3BR1A 2TRTA 3F23A 1NK3P 4A3CG 4E70A 3A4CA 2ADUA 1WJ5A 2L9SA 1TC3C 1SD6A 2RN7A 3V8LA 2UXNA 2A3SA 1D0XA 5EGOB 3IP4B 4F92B 3IWZA 3M9MB 5KKNB 3M1CA 2HXIA 2F5EA 3HKZN 3CO6C 1XD7A 2L4MA 3SXYA 1BIAA 4HQMA 5I47A 2CG4A 1WHUA 2DA6A 2LDUA 1HF0A 5LEJA 3U9SA 5HODA 3H3VK 3BR3A 2XRLA 4A3GG 5C1PA 4R8UB 1RR8C 2AQ4A 4P1WA 4XOTA 1OJLA 1CQTA 3GIMA 4DR5H 4NDLA 2YW2A 1BR1A 3IV5A 3PW4A 5L3DA 2AS5F 1T6SA 2PN1A 1USTA 5ICEA 2V9WA 4KA4A 3GTQA 3SEQA 1T38A 1D3YA 3RIRA 2EPFA 3JRCA 5IYDJ 3CJRB 1W36C 3K7AJ 1H9TA 2BZTA 5EWEA 1OR7C 3I4NG 1C0WA 1R58A 3Q0UA 3SZGA 2H09A 2FF4A 2HQNA 2X1CA 1RK6A 1RESA 2DDBA 1E4EA 4WD3A 2IP2A 3O3KA 2IEKA 2ZCWA 5DQIA 4I02A 4YAKB 4EYHB 3RV3A 2IPQX 1FSEA 1OCRH 3ABLH 2PG4A 4BJ5C 3NARA 1X1DA 2CO5A 5J1RA 4APMA 1DV1A 3GTQJ 3EPGA 1R6RA 3RPUA 5DUIA 2DOFA 3RZDJ 4Q4ZF 3BZCA 3KP4A 3BP8A 3J7YJ 1CF7B 3J80W 3H3ZA 3ZQLA 3IKTA 3LWFA 3CCSI 1PK8A 1XCVA 3JAMZ 1ZQ7A 4FU0A 2NU8B 4A5NA 3FM3A 1BGWA 4E4HA 3ZMSA 2NS0A 1LDJA 3KHGA 2HDCA 2L7KA 2R93G 1Y1VG 5H80A 1BN5A 2W71A 2X0SA 5KFCA 1T36A 4HV5A 4X1EA 5H20A 1YJ9I 5KFYA 3R6SA 2R8KA 3WG7H 2FP4B 4X0GA 5B1BH 5KG2A 2FOKA 2FPPB 5TGTA 2JEFA 1IO2A 5HLTA 1HC8A 3HOVG 4LF6H 2VKVA 4FBUA 4XLHA 3KP3A 4MV1A 1F9NA 2F5CA 2IXSA 2HVSA 4CYDA 3RYRA 5C44J 1I5ZA 4TV7A 4LG0A 9ANTA 2LKXA 1GT0C 1L0OC 3G3ZA 2HDWA 1I3QJ 2UXBH 2FLPA 2MC3A 3OHAA 4DR1H 3CZ6A 5J1YA 2JQ7A 5KFBA 4G6DA 2YX7A 4OIRF 5FKOA 2V79A 4CDGA 4U0YA 1S8NA 4IKFA 4J9MA 4Q5SF 3WTXC 3N42B 2NS7A 2XPVA 2X85A 2K02A 1FSHA 4IHVA 3RQIA 3PM1A 1YO5C 2E1CA 3BABA 3B6CA 4B3RH 3I55I 5EG0A 4GYGA 2M8GX 2QA4I 1B8IB 3I56I 3MN2A 2OJED 1I94H 4WXDA 2EA2A 4B3AA 1W7PA 2IS4A 1GYFA 1GVJA 2FLNA 1G3YA 4DBRA 4A2AA 1XMQH 3IKVA 2XSDC 2EK5A 1I27A 3HHGA 4BXXJ 3F22A 3RB4A 4FBTA 5KFXA 3H0DA 1Y0UA 3E5XA 3ZQHA 1FX7A 3MR3A 3ABTA 3TL4X 2FKLA 4XR6A 3ABMH 4A69C 2EZLA 4EEFG 1JI8A 1EJ9A 3IH4A 5HNHA 1M0TA 2FU4A 3C0FB 3ABUA 2Y2ZA 2COBA 1Z21A 2M3AA 3ZMUA 4G7OF 4A3IJ 2OZ6A 3GTOJ 4KJZA 1M0WA 1MBJA 2RAEA 3MR2A 2HPIA 4A3EJ 2DU9A 4KN4X 1IXRC 2L7ZA 3IHUA 2IP4A 2OQRA 5K1YA 4UCUA 2P7VB 1FOXA 1TWGA 4UVAA 4QJFA 2CKZB 2E1MC 2LKPA 5M5YJ 1QGPA 3KP2A 3V7RA 2P7CB 2MFZA 2HEOA 1HNZH 4RB2C 2UVWA 1T08B 3HOUG 4UUSA 3IRQA 4YR3A 1O57A 3I58A 1ZRCA 3WHBA 1PYVA 4R8UA 4I98B 3S2HJ 1XB4A 2QQBA 3I71A 5HDNA 3BR2A 2W57A 2WB1N 3JRIA 4Y17A 4PJJA 3PFYA 5L1IA 2JMWA 3GIIA 2XUBA 3OV8A 4JV0A 2JA6G 1J0RA 1W7PB 5H2FC 3W2AA 3DF8A 5L1JA 2YU3A 2JSCA 3OYKA 3LSJA 4IZOA 1ACIA 3OUUA 1JHHA 4U88A 1M6VA 3QPLA 4D7NA 4IOCF 2BEOA 4JI2H 1ZN2A 1HCRA 4Q8EA 3CUQC 1J09A 2LR8A 1TWCJ 2BY1A 3OYGA 4G94A 1JTXA 1YX5A 3WGIA 5IYBJ 5HLIA 4EQQA 4EATA 3N40P 5B66C 3E7LA 1FP1D 1R5HA 3FXLA 1HNWH 2LY2A 2YZGA 1UC9A 5GAHJ 2DWCA 4TQRA 2FRHA 1EKEA 2DYSH 2VKDA 2QLZA 4LLGF 2LFBA 4E6KG 5LGNA 3OYJA 1S97A 3PNVA 4HX8A 1KJIA 3CJQB 3VPDA 2CQXA 1JUMA 5CPRB 1ZGAA 2MCTA 4ENJA 3GIJA 4E7IA 2MABA 1E3HA 5J4YA 3EYYA 3BDDA 3H92A 2JA8G 4JYAH 1Z6RA 4LLNA 1NK2P 2VKHA 4IX7A 1Y39A 1WCMA 3VYUB 2X1DA 3IWFA 4FE7A 3BQZA 4W97A 3JRFA 3N6XA 2DI3A 2JA5G 1TA8A 5LHHA 2CUEA 2VA3A 2W7OA 2G7UA 3RBEA 2W9CA 4BE2A 4O4LF 2XGQA 1S0NA 3OYIA 4EJWA 1APLC 2EV6A 3BROA 3HHHA 2LNBA 2LY9A 5JFRA 4IHYA 1B6SA 4RMNA 4BEHB 3FKIG 3GTKA 4JI3H 3Q8RB 4A6EA 3DKWA 3DLLF 2ZJRF 3EYIA 2ECBA 2JA7J 1LEBA 2UVUA 2VL8A 2R7FA 5C4XG 1MJBA 2R7WA 5F0CA 3K3VA 3RPUD 3TP0A 2XGCA 1FP2A 2LOOA 2QENA 1K4SA 2KRCA 1MBHA 2F4OB 2J6TA 3I0TA 1O4XA 4AYBA 4C9YA 5KNLA 5GADJ 3A01B 1TP4A 3OWTA 5J2UF 4MLOA 5DLGA 2RC4A 2FQ4A 3MQ0A 2F5VA 3JSPA 3RGXA 4NXNH 5F0HA 4HDUA 2UVRA 5CYVA 1TW3A 4AYBN 1Z3XA 2GA1A 2KIFA 3FIWA 5DTDA 3K70D 2FMLA 4FTHA 2GXBA 4ZYAA 1IV6A 3IH2A 2VBYA 3EUAA 2HR3A 1V9PA 5TISC 1TQMA 2FNPA 2VT3A 1I3AA 1TT0A 2EFNA 4XORA 1IC8A 2W6QA 5L1LA 4EBEA 3PL8A 4LG0B 3GYHX 1ETQA 2NUAB 4NB5A 3K4MA 4IF4A 5E1XA 1IUYA 4YIFA 3CQZJ 5D1PA 5C8YF 2DA5A 5KX5F 4GFBA 1S03G 2WBMA 2RV8A 4HEA2 4I50F 1SFEA 5FLMG 2FEZA 5J40A 3JR9A 4LIUA 1GXQA 2E2HA 1W5TA 2ETHA 1OYIA 3E5UA 5D5WB 2EIJH 4DNCA 3CCRI 4HYEA 3RIZA 1OISA 5KFOA 2VONA 2DN0A 3KP6A 4FS1A 3SI8A 1MJAA 3E5QA 2OU2A 2RVCA 3E0JB 3K4LA 1ERDA 1OWTA 2YPRA 5KFNA 3L2RA 2Z9OA 4Q8FA 1FOYA 1PJRA 3VYSB 5GP9A 2L9RA 2PEXA 5FLVA 2XD4A 4XLPF 2V4RA 3C7JA 4MV8A 4GDFA 5EZHA 3LFKA 2IT0A 4M3FA 5KAIC 3BJAA 2A5WA 1B1BA 1OLTA 2DA4A 5LRSA 1VQ9I 1EH6A 2DMQA 1DUXC 1HQCA 3PO3G 2DMPA 5GPAA 1SYXB 4YG2F 2MG4A 3JTGA 1R49A 1REPC 2B63G 4XICA 2YUSA 2NVXJ 2O8KA 1YS7A 1A0IA 3HYIA 1KYZA 3AKZA 2CH0A 1OQYA 1Y1WG 5LMUH 1Y1VJ 5IP6A 5GAEJ 1R1VA 4XRSG 1MBKA 2KJBA 5KFSA 2C35B 1LEAA 3CTAA 1FKAH 1YLFA 1P8LA 3LL7A 1S7AA 3A0HC 1T2KA 4BY7G 4AIJA 1Y1WJ 5J8CA 1OCPA 1S5LC 5E8IA 4DR2H 4P9FA 2DIKA 1I50A 4YIRX 2OBPA 2ICWG 5JI6A 5KHDA 1ZHQA 4F91B 2PQ8A 2HTJA 2HZDA 4JQFA 2R5YA 1HDDC 2QYZA 3OSPA 1F1ZA 3BR5A 4EM0B 4WK8F 5L1KA 1JUSA 4YY3H 1V5EA 2AO9A 4LF7H 2JJ7A 3BC8A 5F6FA 4JV1A 3TDZC 4I6ZA 4RNMA 2DFHA 2JA6A 1TWFJ 4MIMA 5M5XJ 4D5FA 4A3BG 4A5MA 3D1NI 1MBFA 2DQRA 4BQNA 1G59A 2V58A 4X62H 1YX3A 4IPAA 1TWGJ 4C2MA 3NGDA 2H8WA 5EYRA 4L9NA 3PO3J 3LQRA 3GO5A 4EM1A 2R7UA 4A3FJ 3JZIA 2KKOA 4XSZF 2VOOA 2W9AA 1E17A 2JUGA 2VASA 2F48A 3ZCOA 3I59A 5CVVA 3M07A 1QPIA 2PFBA 3HOYJ 2VPLA 2R7KA 4F4WA 4HF1A 2ECCA 1WZ2A 1SFXA 4YBZB 1LJ9A 1ZREA 4U87A 2E2IJ 1YRNB 4Y3OA 3R4KA 3LA3A 2X6YA 4XSXF 2L5QA 3CVZA 2NOGA 2AXLA 5J6XA 1B72B 3SQNA 3BZ6A 1F43A 2HVQA 2LG4A 4DL5A 1X1PA 5BS6A 4M71A 3PW0A 3EPIA 3LMLA 2ZBKA 4M73A 3OL4A 1N36H 1Z77A 2M2EA 4J19A 2QKLB 3GTMJ 2F4VH 3S1NJ 1T39A 1KEEA 1Q1HA 2PJRB 4PJMA 2IBDA 3BG5A 5KFHA 3FBIB 2JRTA 4MA5A 2YS7A 2VR1A 3R60A 4CA0A 4Y52J 1ZAOA 4EGZA 2K7LA 2A6HF 3V6HA 2V9KA 5J47A 4EEYA 3BR0A 2J9GA 1FC3A 1WJAA 2XPWA 2X51A 3ZQIA 1XMKA 5CA0F 1LFUP 1IBMH 1MBEA 4WX9A 4DZPA 4JI5H 1MW7A 1HW2A 1JJ6C 3HSEA 2K3PA 4PGHA 3WU0A 4XN3A 3M3YJ 2Q2EB 3V42A 1AU7A 5A2QW 2MD0A 2Q1ZB 2ZSIB 1S7EA 3Q9SA 3WTWC 3BG3A 4MV4A 3X2QH 4LH6A 1I3QA 1ODDA 4C3HJ 3ASOH 5LEKA 1D5VA 3ZRGA 4I99C 3GTPA 3OOPA 1TW2A 3I4PA 3BT9A 5BPIA 1XSDA 5KFZA 2JTVA 4QWDA 1G4DA 1ZETA 2GM4A 1A6IA 4AIHA 1RR7A 3SZTA 5FROA 2VPSA 3Q3SA 4U7BA 3HOUJ 3I9V2 3QZ7A 2KPMA 5JHUA 1A04A 3RBDA 4OMZA 3FXRA 3K4JA 4F4ZA 4Q44A 3GTJJ 1OCCH 3M7GA 2W1OA 1R9TJ 1Z91A 3RFCA 4WXCA 2VXZA 1J75A 4PJNA 3JRDA 2UUCH 5FJ8J 3F3XA 4LK0F 2ZC2A 2E7XA 2EV0A 4BHPA 1XS9A 1LE8A 2V6EA 3C2GA 3GIKA 4KN7X 3RAQA 2WWYA 5BPDA 2C2RA 3CCVI 2FJ1A 2W70A 4IWXA 3N97A 3WGGA 3J81Z 1MMSA 2L54A 4OU0A 1XGOA 2B63J 1OCTC 4M9UA 1UZCA 2Q2EA 3L2UA 1BJZA 2C2DA 5F64A 1N33H 3T5JA 1FMWA 1IV8A 4DUYH 5IOZA 1CQIB 1QVUA 2V26A 2DODA 1IXSB 1OR7A 2Y75A 4NBQA 4B4CA 3G2BA 4DV4H 1YHQI 3OYDA 1R9TA 1QZEA 2VUMJ 4DV2H 2OH2A 3HOYG 1V55H 3T5LA 4YB8B 2ID6A 3K6GA 4EG0A 4Y4RA 2D2WA 4DZJA 2FMYA 4Y13A 4HA8A 1AUXA 5LBQA 2STWA 1MMAA 4UHTA 4GC7A 4PFPA 4ECXA 3K0LA 3HOZJ 2DBBA 3R61A 2RNGA 2PVPA 3ZN0A 4HR7A 2W24A 3REOA 4ECQA 3PQJA 4CCLA 5KT7A 1DIKA 4OAYA 2W6PA 5DDGA 3TEDA 3HRUA 3QU3A 4KYWA 3WO1A 2NU7B 2AQEA 1D1CA 3A01A 1XN7A 5KT5A 4KITB 5BOXA 2W6MA 4PDBA 1VQOI 1VF9A 4XL9A 1HLVA 2ME0A 5J8FA 2AGPA 2ASJA 1SFKA 3S93A 2V1XA 2LY1A 4ZZLA 1P2FA 2K3FA 4J9KA 3OOUA 3MMYB 4IR1A 2R7DA 3ZN1A 2FXAA 1H89C 2IBKA 1BXRA 2GPSA 3MKWB 4A3JG 1B6AA 1YITI 1UG2A 3HEFA 2QBYB 3PVXA 1RC9A 3P5JA 5D6FA 3KAJA 5FRNA 5C44G 4Q0YA 4JI0H 1EHIA 5IYCJ 3BJ6A 4DYQA 1E2XA 3J7ZI 2LC2A 4BAYA 1OCZH 3CC7I 1ETXA 2BBYA 2G9WA 2PMUA 5H6QA 3S8PA 5ILUA 4ENKA 2DT6A 1AN7A 5KFWA 3GTLA 1Z2OX 2DFFA 3PSFA 3IUOA 2D1VA 4RM3A 3K2ZA 3F8NA 3OMYA 4IR9A 5KG1A 3S15J 2ZSHB 3B02A 5JVDF 4QPQA 5J1UA 2K9LA 3FKIJ 3GF2A 4BS9A 4IHTA 2VPQA 4J9OA 1SVLA 4HQ6A 1RYRA 5CAEB 2LREA 4C3JJ 4NLGA 3S16J 3GW2A 4XN0A 4YP3A 2QK4A 3C18A 3HL2A 3SJMA 2E5ZA 3E97A 1J59A 4HNTA 4UNOA 1GXPA 4I4TF 1ON1A 3FMSA 4BHCA 4D9JA 4KT6A 2BW3B 1K6OA 5DD4A 1VQMI 2OQGA 1KQ8A 3F8BA 3OHBA 3FXMA 2EZKA 3LSIA 3JSNA 4F50A 2ZM6H 3DTKA 5CQGA 4F3QA 3OYEA 3RKWA 2P5KA 3W6VA 2HQAA 2HOEA 3K1NA 3KYLA 3I53A 3QYBA 4BY1G 1MMDA 2BY0A 3P7NA 5E1ZB 1QHHD 3FMRA 3IG0A 3U1DA 1G2HA 4GKJH 2OAZA 1W5SA 1D8JA 1IRZA 3BA8A 4A93J 2UUBH 3F9KA 5E20A 4C30A 2ZXIA 2JA2A 1ZK8A 4CYCA 1OYYA 2H1KA 5FD6A 3KZZA 4U0WA 3WU2C 1SMTA 1WCMJ 4UB6C 2KIMA 3DPTA 1P92A 1XMXA 1SD4A 2MSYA 4GRIA 4CHUA 1XSVA 4O3PA 5HV6A 1OKRA 5DG9A 1J5EH 1SD5A 3F6VA 5JUMA 5KFAA 2R7OA 1EUDB 4AVPA 4ZQIA 4DW6A 1P4AA 2JZYA 4IZZA 3BCAA 2O3FA 3MFHA 2L7FP 3CLOA 3VPRA 5JHFA 4PK4A 2TDXA 1X2NA 2X6XA 3BG9A 2C6YA 4II2A 3LQQA 4GO1A 4RZQA 1O7FA 3FDSA 1WQ2A 4QW9A 4A3IG 4Z6YA 2CU7A 4L5IA 2NVYA 1MD0A 4HBLA 5CA1F 3GEZA 2NVTJ 4M7EA 3UKGA 1D1BA 2VT2A 1MIJA 1XMOH 1OYWA 4LFAH 4M6YA 2R82A 4Q47A 4RUAA 4XIDA 3ESWB 2ATLA 1BIBA 2CZGA 3BTCA 3L00A 4KICA 4DV7H 1BL0A 4ZH4F 1E0EA 3PO2G 1EH7A 3WG9A 3BWGA 2CQKA 2LVSA 3F8CA 1FOWA 3A0BC 4RAFA 1RNLA 2A6TA 3BG7A 2GBYA 4OOIA 4F7ZA 3I4NJ 4Q43A 4J9LA 1FOKA 4O3SA 1XDSA 4TV9F 5EWGA 2R5ZB 4A3EG 3UR3C 1K79A 4YJ3F 2HWVA 1GSOA 2R3SA 4AYBE 4RAGA 2IS2A 1LDKB 5CB4F 3F72A 3M8FA 3M4OJ 1LUJB 1ULYA 1ETOA 5DGBA 3HOTA 4QWAA 4XX0B 3GZ6A 2OCCH 2LH9A 1K4TA 4RB3C 2GIVA 3M8JA 3S1QJ 4KNYA 4HZFA 4F4YA 3K4NA 1ZLJA 2KJCA 3P9CA 3OSFA 1BR2A 1N78A 1HW1A 3PNTA 5D8LB 4N9HA 2XHKA 2JEGA 2P8TA 5HLHA 2O5RA 2F4IA 2P6SA 5FFXA 2OTJI 2R6FA 1XSXA 2EV5A 2KDZA 3K5HA 1G3WA 2NU6B 4HV6A 1UHWA 4MV3A 3ML6A 1UCRA 1PUEE 4YELA 1ZQ3P 2Z5UA 2WAEA 4HF0A 2L7MP 4JUZA 5J3LA 1GHCA 3S3MA 4P96A 2V6CA 3C2HA 1ONVA 5FPRA 2O03A 1JE8A 2A68F 3J81K 2H8RA 1VQ6I 4KISA 3ETHA 2W84A 3G6EI 4O3MA 3IH3A 3M4IA 4L9VA 1ON2A 4N0BA 3N41B 2VE8A 2XDVA 5EEGA 4V19K 1Y14B 4QWEA 1WRJA 2IA1A 4MEYF 5FRMA 3A2KA 3PO2J 2W6ZA 1BBYA 4AC0A 2X48A 2QEXI 4KIBA 2L9VA 1EF4A 2IMWP 1ZRFA 3PR4A 3P9KA 5F9LA 4CO8A 4MTDA 3H5NA 4DYRA 3LAPA 3CMAI 3V4SA 5KG4A 1ZLKA 3K5IA 3TQTA 3DTEA 1R4NB 3GLLA 1O75A 2BVLA 2R8HA 4JI4H 4LJZF 3R0JA 4XLFA 3KAKA 1ETWA 1M1EB 4JOMA 3TOBA 4IXAA 1SEIA 1X58A 2I10A 2CW7A 4OAZA 2P81A 3GVAA 4ENNA 4MQVA 2R7ZJ 2FBHA 3LP8A 3J81W 4LSAA 1MJ9A 2XGXA 4DL2A 3FISA 2QQ9A 5L3GA 3PJRA 1KU3A 4X6AJ 1SAXA 4O3NA 2HKXA 1O7LA 2EFOA 2LF7A 2D45A 2JPCA 3BTJA 1LDDA 2HXOA 3V7CA 3DTIA 2FMAA 4LGWA 3M1EA 5IYZF 2ZXJA 1I1SA 1RI7A 5LGUA 2I80A 4ZDPA
chains in the Genus database with same CATH topology
1G6NA 4N9IA 4ESFA 5ICCA 2EFWA 2XRNA 3LAJA 4EJUA 1R36A 5HDKA 3QU6A 3QAHA 1DPUA 2VBXA 3J7AK 3CJNA 3FHZA 3J7AO 3EDPA 1P4XA 5LHIA 3WTUC 3GWZA 2M45A 4EJOA 2V1DA 1O3TA 3Q5FA 1LVAA 1IRFA 2MLKA 1D8KA 3TO9A 4G8XA 4GKKH 2QZ8A 3CUQB 2L4AA 4EFBA 4M72A 3BY6A 3EETA 1LB2A 4EGYA 2OZUA 1KYWA 1RZ4A 1J7KA 4RGXA 4EJTA 1FVIA 4LFBH 2IA2A 3QP5A 3TOAA 3GFIA 5ICGA 2ZO4A 3KLOA 2JPBA 4EMSA 1YTYA 3DXJF 4J0MA 1HSJA 3ZMTA 1EV7A 3JAMK 1ZG5A 2K4BA 3UQ8A 2H6BA 1ZRDA 1FYMA 3LA7A 2XAJA 4HLXA 2RDPA 3HUGA 5D5UB 1NHAA 2ZFWA 2ISYA 3BAAA 4L5JA 5FPOA 4HOBA 2YCHA 1B4AA 1CGPA 3NRVA 3VFZA 3HXLA 2J5OA 3SFZA 3ECHA 2M87A 3D0SA 2HQRA 2M8EA 4DR4H 1EH8A 2QM3A 1FZPB 2FE3A 2ZNYA 4BWSC 2IVMA 1IXCA 3JW4A 1WH2A 3L4JA 2XAGA 2XAFA 1KQ9A 3EQLF 4IAJA 5HS8A 2ZMEB 5CVJA 2VOPA 4WCGA 1I6XA 2DQLA 3RKXA 2CYYA 2P4WA 1WWXA 2PLYA 4HX4A 4RAZA 4B8XA 3WTTC 1USSA 3VODA 3ZMZA 1HKQA 3G73A 2H6CA 5L3FA 2MH9A 4Y15A 4X65H 1TLHB 1YW7A 2MH2A 1HNXH 1FWZA 4OX9H 5IT9W 1ZG3A 4RB1A 4MV9A 4UV9A 1IAWA 3CO7C 4U0VA 2HHHH 4I01A 1F5TA 4A0XA 4LF5H 3FX3A 3E3VA 2PI0A 4DV0H 3C1DA 1TNSA 3HTSB 2X0LA 4S05A 2FBIA 3E6MA 2ZJTA 5LL6b 3RYPA 2XV4S 1VTNC 2Q2TA 4JBAA 2BV6A 1XNRH 4CGZA 3JSOA 1FLIA 3HIFA 2HYFA 4YFKF 1O3RA 1RIOH 4DUZH 2CW0F 2G7HA 2L3DA 2W85A 4L0YB 5CLSA 2EWNA 5D8KB 1TTYA 5E8GA 4PDKA 5FD5A 1I1GA 1HSTA 3KFWX 4O5VA 4R1HA 3MZYA 3MFKA 1H9GA 1N36H 3KETA 3ZQ7A 2CFXA 4ENMA 1X9NA 4LB5A 4ESJA 1O3QA 4BYYA 3FXUA 3V8KA 2WTEA 4G6QA 1MDMB 1E4GT 2ACJA 2VOBA 1WKMA 5DCMA 1U78A 1J5YA 2Y0MA 4HQEA 4A0YA 4M9SA 3QPHA 3I5UA 3DFGA 2Z3YA 3HSFA 5CVRA 3QRFF 4EFEA 1CF7A 3FMAA 3C3WA 3KCCA 1E4FT 3DPLC 2IA0A 1IZ1A 2CWEA 4RGRA 3WE2A 2HZTA 1K7AA 4UCTA 2HVRA 2O0YA 2NNNA 3KLNA 3PN1A 5TJJA 6PAXA 3LA2A 5A2QZ 1SFUA 5DCFA 1U5TA 1IRGA 5FLXK 3T1BA 3T8TA 3KP5A 2Q8KA 4MQ9F 1Z9CA 3TQNA 2NRAC 3ZMVA 2VODA 1HKTA 1R22A 2MD5A 4LK1F 5LRRA 5AIPA 4CC6A 4KHPH 3F6OA 3T1YH 1J2XA 2D1HA 4UCOA 2EFQA 4L0ZB 2RQPA 2VC1A 5K5OA 1KU9A 3ULQB 4ZZDA 3F8FA 2MA3A 1TAEA 1V4RA 1LQ1A 3FXQA 2ZJ2A 3RKYA 4HF2A 4GLXA 2HKOA 4KIGA 4PCQA 1B9MA 4ZYGA 1V3FA 4IRHA 1XMAA 1KGSA 3N4MA 2H27A 1U5TC 2Z33A 3KE2A 4KUMA 2ZNZA 1TBXA 5E1WA 5DYMA 4L9TA 3KP7A 1P4WA 3DF7A 1DPRA 4AIKA 3BOQA 1BI0A 4YFNF 1IBLH 2UXXA 4M9XA 1F4KA 1Z7UA 4R79A 4YFXF 2DO7A 2FA5A 5BQTA 1FY7A 2F5FA 1JHFA 3E6CC 2BYVE 3OTOH 2OA4A 1FBQA 5CVIA 1J9IA 1ZARA 2PN6A 4B3TH 2VQFH 2QVOA 1WI9A 3QPTA 1RUNA 4FX4A 4O6JA 1PP7U 3HTUA 2P5VA 4PGGA 4LLLA 3T0YA 4KFCA 5HS9A 2HFHA 1T0FA 2JT1A 2PBIA 5FGMA 4CZZA 2DLLA 2ZKZA 3WU1B 2EFPA 4JI8H 3P9IA 5KK1A 4G9YA 1N34H 3H3UA 4FT8A 3KALA 2RKHA 5IWAH 2KSWA 3T1HH 2H94A 2WC2A 3U2RA 2QQAA 5TRDA 1FPQA 1QBJA 5AIQA 5DV5A 2EA4A 3T5XA 1XCBA 4PZJA 1FNNA 2XVCA 4LF4H 1DGSA 4UV8A 1S29A 1LNWA 5DD8A 2XASA 3CVZA 5L3EA 4LF8H 2X4HA 5ERIA 4UCVA 1KU2A 1P6RA 3BJOA 3T8RA 4BHBA 3F21A 3TDUC 3RTRA 1XNQH 2Z99A 3MZHA 4CC5A 1R5GA 2NAZA 4X66H 2O61A 3L2PA 3R0AA 4P9UA 3HOSA 5DCMB 1YS6A 4UVBA 1K78B 3GZ5A 4IVNA 2DW4A 1G3SA 3KEOA 3RDIA 4EV0A 2UXCH 4LH7A 4JI7H 4P5OA 3MCZA 3FZVA 5K5QA 3ZMDA 2OD5A 4RS8A 4ZYHA 3O2PE 1B04A 3K1MA 2KRFA 4P55A 1ZGJA 3N43B 3I54A 1O3SA 1L2ZA 1Z6TA 3Q9VA 4AD9A 3K1PA 3NQOA 2F2EA 2LF8A 3DEUA 3HRTA 1KQ0A 3N44B 5LGTA 1ZG1A 1PDNC 1HXDA 4MHGA 3VB2A 5D6EA 2YX4A 1R7JA 4UCSA 1WSUA 4BXUA 1XDUA 1IN5A 3WTSC 5HLGA 4I7HA 4MV7A 1TNTA 4GCVA 1TQIA 2EJRA 2VQEH 4DR6H 4XLNF 1TQPA 3AAFA 2UUAH 1T98A 2IJLA 5H6RA 4CICA 1SD7A 3QP6A 5E18F 2RGRA 3J80K 2A5YB 4DV6H 1FBUA 2VBWA 3PQKA 4JI1H 1IF1A 2MBFA 1R23A 4JI6H 4BNCA 3O6BB 3BPVA 4NXMH 3PFIA 3RJ0A 3CDHA 4A12A 2F5DA 1U6GA 1S6LA 5IT9K 5D5VB 1YW9A 4K2EA 4NHJA 2FNAA 3COAC 1STZA 1U2WA 3I59B 3J80Z 4A6DA 2HGCA 1ZYRF 1Z2NX 1BM9A 1JXSA 1QQIA 3QOPA 4FX0A 2E7WA 5A2QK 1HW5A 4JV5H 1MKMA 4DV5H 2K27A 1HBXG 3H20A 1IN7A 1IN8A 3ELKA 1K78A 4RAYA 3DP7A 4A0ZA 1ZHSA 2GZWA 2QUFA 5FB2A 3RJPA 2DPDA 4AQYH 4A2BA 5ED4A 1BC8C 2VC0A 3ISPA 3TO7A 4DV3H 2RNJA 3L4KA 3BPXA 2L01A 2UWMA 4IJAA 2UZKA 2DTRA 3TGNA 3WGHA 5F1RA 4YIIA 3KZYA 1IN4A 1FYLA 3MEXA 3M9AA 4S04A 3L2CA 5LMNH 1QO0D 3I64A 3TO6A 1X3UA 2V1UA 2DAOA 2VBZA 3CUQA 3ZP5A 5IT3A 1YW8A 4G7ZF 5D1OB 3TKYA 4XRFA 2OWOA 4BQAA 4LF9H 4FM9A 3L09A 3NEUA 3WTZA 4EEQA 2STTA 3LSTA 4Z2YA 5HS7A 4UXNA 4DR7H 5AONA 2O6GE 1HR0H 4GGGA 2WYOA 5ILVA 4LFCH 3M8EA 2A07F 1AWCA 1S68A 2PMHA 4WF2A 2FBKA 5D4RA 4OIOF 3D5LA 4HDVA 2XROA 3BA9A 1Z05A 2DK8A 1QPMA 5BMZA 1XGSA 4LD5A 2V9VA 3GFJA 1ZHFA 4MTEA 4EM2A 4RGSA 3KXYT 3IL2A 1U8RA 4WXHA 1G3TA 3JTHA 4QLCU 2UXDH 2CGPA 4DV1H 4Q48A 5CJ9A 3ROUA 1BI2A 3FWEA 5FLXZ 2KIUA 2YR2A 1XDNA 2HS5A 2P6TA 1BC7C 4ASNA 4U7DA 1IN6A 2ZMEA 2HYGD 2ISZA 1L3LA 5LHGA 4JK1X 3ECOA 4YHHH 4KIFA 4OIPF 3JAMW 1IBKH 4B09A 3KEQA 4UFZA 2MLGA 1MGTA 3HRMA 3GFMA 1ZH5A 2M30A 1B59A 1BI1A 3F8MA 3V4GA 2EB7A 5K5RA 5CVUA 1B9NA 2FSWA 4GXOA 3MWMA 5FFZA 4R7RA 2DT5A 4ESBA 4IHSA 2Q0OA 1YFHA 3WODF 4NQWA 4QWQA 2GWRA 3SHFA 4LFUA 3GXOA 2A6EF 1U5TB 3SZPA 3VOEA 1UHMA 1PP8F 2DPUA 5D1OA 4OMYA 2CW8A 3E6BA 4UVCA 4DQ2A 1HKSA 4HX7A 5EEHA 3HSRA 2M1BA 1I6UA 2IRFG 5DUKA 3K9TA 3WTVC 4X64H 1BJTA 4M74A 1QZZA 2HGSA 1SMYF 4KMUX 4AWXB 4XBFA 2GAUA 3EUHA 1DDNA 3W6JB 2XKPA 2ESHA 2P5LC 2HTSA 1VS0A 2L02A 2Y48A 2LSOA 2DK5A 1UB9A 5L3CA 4M9ZA 3W6KB 4BH9A 4UCRA 2J5PA 2XIGA 4M6XA 1JGSA 5HDGA 1AOYA 4HLYA 3S2WA 1W4MA 2E1NA 4B3SH 2QWWA 1BJAA 3RPQA 1N32H 3B73A 4KMFA 3MAJA 4R8HA 2O8XA 2XAHA 1YG2A 4WWCA 4HAMA 2IW5A 5IT9Z 3WE3A 4KT5C 1KU7A 3HRSA 3IRRA 3L9FA 4I09A 1S3JA 1YIOA 5BR8H 2VE9A 4K0KH 1DP7P 4ZYEA 4I2OA 4UUVA 3GUDA 5FO5A 2DFIA 5D5XB 1FT9A 2ESNA 2GQQA 4EVIA 2WDTA 5KVRA 1MZBA 4H0EA 3L7WA 2QBYA 1BOAA 2WV0A 4MNUA 3JSLA 5D4SA 3RI4A 1R1TA 3U9GA 3FF5A 3E6DA 4MEXF 2UU9H 1QNTA 4EJVA 2VUGA 2QYOA 4ZYDA 3K69A 5HVQC 3IC7A 4LSXA 4ETSA 5E17F 3ZPLA 1KA8A 2K86A 3DV8A 3ERED 3V8JA 1YQAA 4D0PA 4GYIA 3GX4X 4HW0A 4RGUA 5HOOA 5FLXW 5JR3A 2E5LH 5ILSA 4ON0A 4L18B 4I0BA 2NYXA 2CSOA 1BI3A 4KDPA 2A61A 3GFLA 4IRGA 4G7HF 1H0MA 1IW7F 4FHTA 1R1UA 2PJPA 1OPCA 1S7OA 1OMIA 4DR3H 3VEPA 3WTYC 4B3MH 3RGZA 1XGMA 1FBSA 2B0LA 2RGVA 4L9JA 4IRIA 4LB6B 4I0AA 4MGRA 5L3BA 2FQ3A 2K4JA 1FJGH 2M5WA 1Z1DA 1UFMA 1FYKA 2BE5F 2GA2A 2XAQA 1U3EM 4OINF 2A69F 2XKOA 5DEQA 2Q2UA 2WE6A 3V7SA 4A2UA 3GLXA 5LLQA 1MDMA 3CUOA 1Z2PX 1QZYA 2COMA 1R00A 4OIQF 4LMYA 3FMQA 2GXGA 1W7PD 2BGCA 1XGNA 5EOYA 3DQVC 3FM5A 5ICFA