4I7HA

Structural basis for peroxide sensing and gene regulation by perr from streptococcus pyogenes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
DIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVCEICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Peroxide Stress Regulator from Streptococcus pyogenes Provides Functional Insights into the Mechanism of Oxidative Stress Sensing.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transcription
molecule keywords peroxide stress sensing regulator
total genus 38
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i7hA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4i7hA02
4S05A 5LHIA 3JSPA 4LB5A 1TTYA 5J6XA 4EGZA 2Y75A 1LEBA 1EH8A 3KZYA 3ELKA 1MJBA 3VOEA 4L5JA 5D8LB 2K27A 3R6SA 5ILVA 3IHUA 4GO1A 3WE2A 1SAXA 2FBIA 3RYPA 3EYIA 2PMHA 2PI0A 1MJAA 2Z33A 1LEAA 2HFHA 2DI3A 3TGNA 4CO8A 2PQ8A 5KVRA 3RIRA 1OYWA 1DP7P 2DAOA 2C6YA 3FM5A 5TRDA 3C3WA 1FNNA 3ECHA 1SD6A 1YYVA 1IN5A 3R0AA 1R00A 3BJ6A 2B0LA 1XMKA 5FD6A 1SFEA 5CVRA 3EUHA 1KYWA 2UXNA 2XHKA 4HDVA 4PGGA 2YR2A 4OOIA 4AD9A 4NQWA 3WGIA 4G6DA 2RKHA 5D6FA 2L3DA 3MZYA 1I1SA 3B73A 1S29A 1HW2A 1T39A 4M6XA 4U0WA 1LDDA 5JR3A 2HR3A 4NHJA 4OIRF 2BGCA 5K5QA 2HEOA 4KMUX 3F3XA 3P9KA 5ILUA 2EV5A 3N4MA 3R60A 2PJPA 1ON2A 3TDUC 2A6EF 5LEJA 2DPDA 4HX7A 5E17F 2E7WA 3HTSB 1QGPA 4GCVA 2M45A 1YLFA 3V7RA 3E6BA 2QUFA 4KT5C 5JVTA 2HWVA 4LK0F 3I59A 5FD5A 3F6OA 2E7XA 2W57A 3SQNA 4G6QA 4BNCA 2Q0OA 3KCCA 1XD7A 1ZG1A 3K9TA 5E8IA 1QNTA 3DKWA 2V1XA 3GYHX 2JTVA 4XBFA 5HLIA 3HUGA 3TO7A 2IP2A 5LEKA 3OV8A 4ENMA 5HS7A 4EM1A 1B9MA 1KQ0A 2OQGA 5F6FA 1U5TC 3M8EA 2R7FA 3G73A 3MQ0A 3QPTA 3LA2A 1F9NA 1CF7A 2F5DA 2QWWA 3T1BA 5L3EA 4I2OA 4U7DA 2Y48A 4BAYA 1H0MA 2HZTA 4RGXA 2OQRA 2O0YA 1J59A 3ZQ7A 3MEXA 3T5XA 3DEUA 2FMLA 3ECOA 1TW2A 2R7DA 3FHZA 1I6XA 4A6DA 2OU2A 4A0YA 1B9NA 3KZZA 1FY7A 1YW9A 4GGGA 1QQIA 1Z6TA 3KEOA 2QQAA 2FNPA 4HAMA 1QO0D 4YIIA 2ZKZA 4Q5SF 1T38A 3Q9SA 2UXXA 4BHBA 3DF8A 2XIGA 4L0YB 5DUKA 2PFBA 4HF2A 2IJLA 4KIGA 1FZPB 5E1WA 4I0AA 1CGPA 4L18B 2YX7A 5DV5A 4NB5A 2IPQX 1FBSA 4M73A 3H92A 4Y13A 1YFHA 2VOOA 3TDZC 2R3SA 3R0JA 3GFMA 4CZZA 2ZMEB 4XSXF 1X3UA 4ENJA 4A0ZA 4RAYA 3O3KA 1RUNA 1DPRA 5HS9A 4RB3C 3RDIA 5ICFA 2IA0A 3KEQA 1W7PB 2XRNA 3IRQA 5IT9Z 1O3TA 4I02A 1F4KA 4KUMA 5E18F 4PZJA 3R4KA 3R61A 1S8NA 4WCGA 2RN7A 1J2XA 5BMZA 1O3QA 2GXBA 1TQIA 4UVAA 2EFOA 2O8XA 1EH7A 5AONA 3F23A 5J8CA 3CUQC 1XDSA 2A61A 2ZXJA 5A2QZ 3GZ6A 4XRFA 4HF1A 3L9FA 1FYMA 4O6JA 3J81Z 3TOBA 1O3SA 3I4PA 3J80K 2W84A 2Z5UA 1FOKA 4LLLA 5LGNA 4YFNF 1K78A 3LQRA 1IW7F 1R58A 3HSFA 4IXAA 1YS7A 2YU3A 1DUXC 1DDNA 1G6NA 1FPQA 3F8CA 5D4SA 2VODA 2HYGD 3DP7A 3BP8A 1IAWA 5BPDA 5BOXA 1IN4A 3K0LA 4CICA 1BI0A 2OAZA 2ZO4A 3NRVA 3WU0A 4OIQF 3MFKA 1XSVA 1SMTA 3FX3A 2XKOA 4HQEA 2EV0A 2ISYA 2EFNA 2DW4A 4LJZF 4EGYA 3J81K 4I98B 4MTDA 3E6DA 4UXNA 1O7FA 2OD5A 3LAJA 1KU9A 2VBZA 1TQMA 2Z3YA 4KA4A 4A12A 1G3WA 3MAJA 4FX0A 4BHPA 4G94A 2D45A 3L00A 4Q47A 1F5TA 3U2RA 1B1BA 2HTJA 3ISPA 3VB2A 2EJRA 1FYKA 2G9WA 4R8HA 3LAPA 4AIHA 2COMA 2RVCA 5L3GA 3ABTA 4GYGA 3GEZA 2PBIA 2DTRA 2HGCA 2FSWA 4IF4A 1D8JA 5LRSA 2QBYA 1G3SA 4PCQA 3KETA 4EM2A 3WODF 4HYEA 2CW0F 2XASA 5HLHA 1TQPA 1FSHA 4B09A 3ML6A 5CJ9A 3ZMVA 5HDGA 4F7ZA 1OYIA 4WK8F 3M9AA 3E5XA 2D1VA 4RB1A 1MDMB 1S3JA 4RGRA 1OKRA 4UHTA 4UVBA 2G7UA 2ZFWA 4WX9A 1IRFA 3U1DA 4AWXB 5H20A 3L2CA 1HKTA 1P4AA 3FXUA 1QPMA 1P2FA 3W6JB 2STWA 3EQLF 3ZPLA 3JAMZ 3F8NA 5LHHA 4FT8A 2M5WA 1WRJA 1E17A 4M6YA 4HX4A 3ZMZA 2E1CA 1H9TA 5D5WB 5DCMB 1JXSA 2GIVA 1XCBA 2H09A 3SZTA 2MH9A 3J7AO 2QYOA 3WE3A 2WV0A 4UNOA 5D8KB 3IL2A 2X4HA 2FOKA 4A6EA 3IRRA 2QLZA 5IT3A 4B8XA 2DK8A 3E6MA 3KLOA 1ZG3A 4CYDA 4WF2A 1BN5A 2ELHA 3ROUA 4A5NA 2Z9OA 4RB0A 4LFUA 4IPAA 1U2WA 2PEXA 4EQQA 2XAQA 4MTEA 4AVPA 1UFMA 3JAMK 4U88A 3WG9A 2MA3A 3IC7A 3BJAA 3LFKA 3T8TA 3FZVA 2PLYA 3HRMA 3RKYA 2FU4A 1FSEA 3I64A 1V4RA 2LDUA 3COAC 5BS6A 1ULYA 3ZN1A 4EMSA 3HRUA 4ESFA 2OBPA 2HOEA 1BC8C 1A04A 1WWXA 3IKVA 2UZKA 1HSTA 1RUOA 2VT2A 3ABUA 1R5GA 1V3FA 4MNUA 5ICCA 2TDXA 3W6KB 1QBJA 3QP6A 1WQ2A 3WGGA 2DLLA 2HQRA 2QQ9A 4IHTA 3D0SA 2ZCWA 4L0ZB 1JHHA 5DYMA 2EK5A 5EEHA 1Z7UA 5E8GA 5ED4A 4LB6B 3ZN0A 1LDKB 3GVAA 2YX4A 4BH9A 1R5HA 1ZG5A 1EH6A 3BOQA 4KICA 5EEGA 3JTHA 3B02A 5L3CA 2STTA 1W5SA 1JGSA 3IKTA 4KN7X 1KYZA 3BPXA 1ZHFA 2KKOA 4QLCU 2RGVA 2K4BA 1IF1A 4Q48A 2M87A 2ADUA 3F22A 4R1HA 1ZN2A 1FX7A 1T6SA 3D5LA 4DQ2A 1F1ZA 1B4AA 5LHGA 2IT0A 2P7VB 2P4WA 2DFIA 2JRTA 1ONVA 4M9SA 2GWRA 1P92A 2KIUA 3F8MA 2M30A 4KNYA 3PFIA 4IRGA 1SD5A 3DPTA 2NRAC 2BE5F 3CJNA 4A0XA 5FO5A 2JPBA 1XGSA 1ZREA 5DD4A 4ESJA 4L9JA 2D1HA 3HYIA 4A5MA 2LF7A 3LWFA 2ZBKA 4HF0A 4ZYGA 2EFQA 4L9VA 4AIJA 4I7HA 3GLXA 2H94A 2V1DA 4I01A 1ZRFA 1FBUA 3DXJF 2NAZA 2XKPA 4RGSA 3H3UA 4UV8A 3REOA 3VFZA 1I5ZA 2KRFA 4EJTA 1KU3A 3I71A 4P55A 1QZYA 3KFWX 4L5IA 3I53A 1MDMA 1D5VA 3BJOA 2OA4A 3WTTC 4N0BA 3GFIA 2DT5A 3TO6A 3AAFA 2NNYA 4EJOA 1YW7A 2GAUA 1FYLA 1U3EM 1LQ1A 1YO5C 1BM9A 4OMYA 2JSCA 1PP8F 1SFXA 4UV9A 1E2XA 4I0BA 3K69A 3QOPA 2F5CA 4A2UA 4KFCA 2WTEA 5HLGA 1TW3A 1L0OC 4IVNA 1U5TA 2GA1A 2A5YB 4K2EA 5H6RA 4HBLA 4CGZA 3MZHA 3SFZA 3LA7A 1BOAA 1UHMA 1MKMA 1HSJA 2GQQA 4G7ZF 4FHTA 4G8XA 2J5PA 2A68F 5K1YA 3HOSA 4M9ZA 5HS8A 4P9UA 1SMYF 3I54A 1W4MA 4HLXA 5HDKA 1K7AA 4HDUA 3K1PA 4TV7A 3V7SA 4PDKA 1TNTA 4HQMA 2IRFG 2L02A 4YG2F 3BZ6A 3P9CA 2Z99A 3V8KA 2W85A 5F1RA 2M1BA 4MGRA 5D4RA 4BQAA 4LG0A 5LRRA 3RI4A 5FLXZ 2D2WA 1ZARA 2DQLA 3S2WA 1S7OA 5CVVA 1Z6RA 5BPIA 3QU3A 2OZ6A 2V9VA 2K86A 1U8RA 2ISZA 1BI3A 1LJ9A 3FM3A 1O57A 2KIMA 1YW8A 3LQQA 1U5TB 2EWNA 4ENNA 4HW0A 1EV7A 2P5VA 1MD0A 2H6CA 3M1EA 1OR7A 1W7PA 2MBFA 3I5UA 3DPLC 2IW5A 3WTYC 2O3FA 3JW4A 3BY6A 1S7AA 2VBXA 5F64A 4Y15A 4U7BA 5KK1A 2JT1A 3QPHA 5FLXK 2XAHA 3V7CA 1STZA 1T98A 1J0RA 2HKOA 3FXQA 2VC1A 2FE3A 2LNBA 2L4MA 3OOPA 5ILSA 3RPQA 1REPC 1ON1A 2VN2A 3ZP5A 5LLQA 4KN4X 1USTA 2FA5A 1ZYRF 1XGNA 3BDDA 3O2PE 5E1XA 3BWGA 5BQTA 4IRIA 1MJ9A 3K1NA 3KP7A 5E20A 4HA8A 3NEUA 1BI2A 1BJAA 3VODA 4M74A 2HTSA 3WTUC 3F72A 2EA2A 1XSDA 1W5TA 2W25A 4ZZDA 2QVOA 5LGTA 2FXAA 1GXQA 3FXRA 2Q8KA 1H9GA 2IA1A 2ZMEA 1HKSA 4ETSA 3NQOA 2DBBA 5DD8A 2BV6A 2CG4A 5FB2A 3E5UA 4MHGA 1R1TA 4XLPF 5K5OA 1LDJA 4LMYA 1FP2A 2F5EA 1RIOH 1TLHB 1ZH5A 2L54A 4EJVA 3P7NA 1Q1HA 2DK5A 2K7LA 2HS5A 2XAGA 1XN7A 4CXFA 2F5FA 1D3YA 5JI6A 1B6AA 3C18A 2LF8A 2NNNA 4KMFA 1HW1A 1FT9A 3WTZA 4LD5A 1YS6A 3ULQB 1BIBA 2FRHA 2HDCA 1Z1DA 1AOYA 2VT3A 1ZRDA 4OINF 5IT9K 2VONA 1I27A 2O03A 4GXOA 2F2EA 4Q4ZF 2WWYA 2KJCA 4MQ9F 2A6HF 5LGUA 3FF5A 2QQBA 3GFJA 1SFUA 5DDGA 2QBYB 4HZFA 1XB4A 3C7JA 3H3ZA 5DUIA 1KQ8A 4ESBA 1HQCA 1IXRC 4WXHA 1NHAA 1J5YA 4G7OF 3K2ZA 3L7WA 1KU7A 5CVJA 3J80Z 1G3TA 3Q9VA 4ZYEA 3C1DA 1BI1A 3QRFF 3TOAA 5D6EA 1PUEE 4XSZF 1HW5A 2E1NA 2VE9A 4O5VA 2ZNYA 1HKQA 1WSUA 1YIOA 5ICGA 1USSA 1R7JA 3I58A 3KP5A 2ESNA 2BEOA 3ZMSA 4LLGF 2G7HA 3WTVC 1FP1D 2EB7A 1YG2A 4WXDA 2DO7A 4LGWA 2FNAA 1XDUA 6PAXA 1R22A 3ERED 3HTUA 2XAFA 2Y0MA 3WGHA 2XGXA 3CUQB 3CUOA 2CO5A 3GZ5A 1RI7A 4RGUA 2DU9A 2A07F 3IWZA 1R23A 2FQ3A 4UVCA 2YPRA 4HV5A 3HHHA 4ZZLA 1PDNC 1UB9A 5FFXA 1P4XA 1K79A 1SD4A 3QP5A 3QU6A 4IJAA 4EJUA 4Z2YA 3LA3A 1XGOA 4WWCA 2FF4A 1MGTA 4EVIA 3Q5FA 1XSXA 5HVQC 3KLNA 4RAZA 4CDGA 1J75A 1I1GA 2FBHA 5ICEA 3DV8A 1RNLA 2CFXA 1W7PD 3E5QA 3CO7C 5DCFA 5A2QK 1OYYA 3TKYA 1K6OA 2EFWA 1XCVA 4HX8A 2P5KA 3GUDA 1YTYA 1WKMA 2FBKA 3L09A 3WTSC 3GF2A 4JBAA 2KIFA 2ZNZA 3P9IA 1IZ1A 1SD7A 5DEQA 2CQKA 1ZAOA 1JHFA 3KE2A 5CLSA 1IRGA 3TO9A 2GZWA 2O6GE 1AWCA 2RC4A 4E70A 5FGMA 3F6VA 3RTRA 4UUVA 3PQKA 2ESHA 5FFZA 5ERIA 2DQRA 2OZUA 3N97A 3E97A 5E1ZB 2V1UA 3LSTA 4FX4A 4LK1F 4O3MA 2NYXA 4N9HA 2H6BA 1LNWA 3MCZA 2MD5A 1LVAA 2PMUA 1QZZA 1ZLKA 1J9IA 3GWZA 4ON0A 2RDPA 1OPCA 2M8EA 1IN7A 4KIBA 1KU2A 1HBXG 1DPUA 1TBXA 4OIOF 1G4DA 2JZYA 5CVUA 2EFPA 1C0WA 1UCRA 2VXZA 2W24A 2LKPA 5L3DA 1IN8A 3M7GA 2CSOA 3GXOA 3F8BA 5H6QA 3RPUA 4YFXF 2RV8A 4GYIA 3V8JA 1P4WA 1J7KA 3CUQA 3HHGA 4LLNA 2X0LA 2GXGA 4ZH4F 3EYYA 2CYYA 4ZYDA 1OMIA 4S04A 3KP3A 4M71A 3I0TA 4EM0B 5D5XB 5AIPA 1S6LA 4Y17A 3DQVC 3K1MA 3ZMDA 2WC2A 5DCMA 1XGMA 2IA2A 4ZYHA 3CLOA 4U0VA 2CGPA 2XVCA 3GW2A 4G9YA 1RZ4A 2V6CA 1ZGAA 4M72A 4H0EA 2J5OA 5K5RA 5HOOA 5CYVA 2MLGA 2EA4A 2PG4A 4HV6A 3CO6C 3HRSA 2HQNA 2P6TA 2P7CB 1FBQA 1O7LA 3I59B 3DFGA 4JQFA 3E3VA 1L3LA 2VBYA 2EV6A 1VTNC 1JE8A 2GA2A 4CHUA 2P8TA 3KP2A 1PP7U 3VEPA 1R1UA 4HLYA 4L9TA 4P5OA 3F21A 4OIPF 3RKWA 2NS0A 3WTXC 2VE8A 1BC7C 2MLKA 2XUBA 2ZJ2A 1LB2A 5AIQA 4G7HF 3JSOA 2PN6A 3CDHA 4KYWA 3RYRA 2BBYA 2QZ8A 5JHUA 1U78A 2FEZA 2BYVE 5L3BA 4U0YA 5LBQA 3BPVA 4OMZA 2VC0A 2HYFA 1KGSA 2V79A 1ZGJA 4KDPA 4XLNF 4LG0B 1CF7B 3GX4X 4MEXF 3T0YA 2ACJA 2QM3A 1R36A 3RJPA 5D5UB 4ENKA 1ODDA 1TNSA 3M8FA 2UWMA 2RNJA 3PQJA 2P5LC 4EJWA 3FMQA 2FMYA 2MC3A 3WTWC 1P6RA 4EV0A 1BIAA 1O3RA 1WI9A 5CVIA 1YQAA 3HIFA 1GVJA 2IVMA 3EDPA 1KQ9A 3FMRA 4PGHA 4IHSA 3KP4A 3O6BB 3HOTA 1GXPA 4RB2C 4D0PA 1UHWA 3EETA 1HXDA 1R1VA 3HRTA 1FC3A 2KJBA 3HSEA 3BROA 2VBWA 1Z9CA 3V4GA 5JFRA 4P96A 4M9XA 3SZPA 2K02A 1IXSB 1MZBA 1ZLJA 3FMSA 3KP6A 4YFKF 4DNCA 2XAJA 4IRHA 1GHCA 5HDNA 3FWEA 2H27A 3SHFA 1IN6A 2MH2A 2L01A 2P6SA 1BBYA 2AS5F 2YSRA 1Y0UA 3GO5A 2QENA 4MEYF 4BHCA 1K78B 4L9NA 4MQVA 3WU1B 3GFLA 5D5VB 2VOPA 4HOBA 3CTAA 1XMAA 1ZRCA 4I09A 2XROA 2AXLA 3TQNA 4YIFA 4JK1X 2A69F 5J8FA 5TJJA 1D8KA 2K4JA 2L4AA 2Q2EA 4WXCA 1FWZA 1FLIA 1B59A 3F8FA 1T2KA 3ZMUA 2DPUA 3U9GA 1Z05A 3V8LA 2RQPA 1T0FA 4QWQA 4RS8A 3QAHA 3T8RA 1IXCA 1IUYA 1G3YA 3SXYA 4P9FA 3ZMTA 2O61A 2ETHA 2JPCA 1U6GA 4BYYA 4N9IA 5L3FA 3RKXA 2CWEA 2LSOA 3JTGA 2HKXA 4AIKA 2XV4S 3HSRA 4BXUA 4KIFA 4OU0A 4ASNA 3MWMA 3E6CC 4R79A 2A3SA 1KA8A 1Z91A 3IWFA 3G3ZA
chains in the Genus database with same CATH superfamily
4S05A 2R7ZJ 3HEFA 3L4JA 4IRKA 2JN6A 5LHIA 3JSPA 4ZJZA 4LB5A 1W5CC 1TWAJ 3GIMA 5LD2C 4B3TH 1SC7A 1TTYA 2FMAA 4J9PA 2DA5A 1WPKA 5J6XA 4EGZA 2E34A 2Y75A 2BR0A 1C30A 2R4GA 2M0CA 1LEBA 3K2AA 1E4GT 4LSXA 1IDYA 4F92B 1QA6A 1UNNC 2IXSA 3MVPA 5BPFA 1EH8A 3QYBA 3KZYA 3ELKA 5GTIC 3I4NG 4O3RA 3TQ1A 1WCMJ 1MJBA 2R5YA 1K1QA 3VOEA 4DV7H 1RR8C 4FS1A 2ZXHA 1MBKA 2DYSH 3OIQA 2KT0A 2IS2A 1A6IA 2FPPB 3J80W 2HOTA 4L5JA 1ZTRA 1XMOH 1B72B 3V6HA 4DL4A 2X0SA 2FD5A 5D8LB 2KHMA 2DA2A 5FRMA 2K27A 4A3KG 3PM1A 3R6SA 4DL7A 2CQ7A 2BY1A 5ILVA 3IHUA 5JVGF 4GO1A 3OYBA 1VQNI 2R7NA 3WE2A 2DOEA 1SAXA 2FBIA 1X9NA 3DWLE 3RYPA 1YX5A 4IWXA 3EYIA 2PMHA 1H88C 2PI0A 1MJAA 4JOMA 5KCMA 3MR5A 3IWFA 2K3PA 4J9MA 3OYAA 2YS9A 2Z33A 1APLC 2XCPA 2KQRA 1LEAA 3PO2J 4JP0A 1P9QC 2HFHA 2DI3A 3TGNA 4CO8A 2PQ8A 5J1RA 5KVRA 1GSAA 3RIRA 1RETA 2VKEA 2XF7A 1A6QA 1OYWA 4UB8C 1DP7P 2HQAA 1ZHSA 2DAOA 1D5YA 4LG3A 4FU0A 2C6YA 1B04A 1MNDA 4RAGA 3FM5A 4A2AA 4G3IA 2E2HA 5EG0A 5TRDA 3C3WA 3OIPA 1FNNA 4XORA 3VPRA 1ZQ3P 4EG0A 3ECHA 2V9WA 1SD6A 1YYVA 1IN5A 3R0AA 1R00A 3BJ6A 2B0LA 1XMKA 2DCEA 5FD6A 2W1OA 5LOVF 2QK4A 3E1SA 1SFEA 5CVRA 2COBA 4ECSA 3RF2A 2MD0A 3EUHA 2BW3B 2F6CA 5KG0A 1KYWA 2UXNA 2XHKA 4HDVA 3PNTA 4PGGA 2YR2A 4OOIA 2O8KA 4AD9A 2XF5A 1JDBB 4NQWA 1ZR2A 1LFBA 3WGIA 4G6DA 4A3GJ 1MMDA 5IT9W 3BQYA 2DMPA 2RKHA 5D6FA 2WB1E 2JA6J 1XX5A 1OISA 2L3DA 3GV7B 3MZYA 1I1SA 4C2MJ 2OWOA 3B73A 4A3BJ 2ECBA 2LG4A 2AU0A 2ZJPF 3O8HA 4QW8A 4C5CA 2Z16A 1W93A 2NVXJ 1S29A 2A6TA 3DU6A 2V7FA 2E1MB 1RPWA 2PMZA 4IQ4A 1HW2A 3LSHA 1KJQA 1V54H 1T39A 3QYEA 4PSWA 4Y8VB 4M6XA 4U0WA 2TCTA 1LDDA 3AG3H 4J0MA 3RB4A 2HXIA 3CCEI 4BJTA 2HU9A 3OYFA 5FLVA 5JR3A 4G6TB 2HR3A 3GTOA 4F93B 2HPMA 3HOUJ 3MKLA 4ZOLF 1SVMA 4NHJA 4OIRF 2BGCA 2ELJA 4FM9A 4LF7H 5K5QA 5EZGA 2HEOA 5KFEA 4KMUX 3UNGC 2KZVA 1N25A 3F3XA 3VSLA 1SEUA 4MIMA 3AKZA 5KFGA 2YS7A 2JA8G 3P9KA 4WD3A 3RIZA 2BHYA 5ILUA 1XDNA 1SEIA 2BHZA 1EA3A 2WA0A 1IGNA 1IG7A 5M3MJ 2EV5A 3OYJA 1XPXA 2BQUA 2Y69H 4JYAH 5JHFA 3N4MA 1XC5A 4YR2A 2YZGA 3R60A 2VUMG 3QQAA 2R7SA 2ASDA 2PJPA 2NU6B 3MKYB 1ON2A 3TDUC 2A6EF 5LEJA 3CZ6A 3AG1H 3SFIA 1XMQH 4XQFA 2XSDC 1JKJB 4V19K 1AKHB 1S0OA 3CESA 5LMUH 1RR7A 2FLLA 2DPDA 2VQHA 4HX7A 1HNZH 5E17F 2E7WA 4FBUA 3HTSB 4MV7A 5GADJ 2XF6A 1QGPA 4GCVA 2M45A 2W6QA 3S8PA 3PR4A 1YLFA 3V7RA 3E6BA 2QUFA 2VI6A 3KTMA 5DQHA 1V4YA 1X1BA 4KT5C 5JVTA 1BL0A 5K2MA 2HWVA 3BQZA 3LOCA 4LK0F 1RJRA 3I59A 3V4ZA 4A3CG 3C2HA 1X2NA 2EIMH 3VYSB 5C3EJ 5FD5A 1YJNI 4A3CJ 3BTJA 3F6OA 4A3LG 2GOXB 2E7XA 2V9PA 4DR1H 2X6YA 2W57A 3SQNA 2WDTA 4B3MH 4G6QA 4BNCA 2Q0OA 3KCCA 2R8GA 1XD7A 4DR2H 5J3LA 4YHHH 2JA7J 1Y1WA 1ZG1A 4A3IG 2V6EA 3K9TA 4GKJH 1Z3XA 5E8IA 1SANA 2EILH 5JVDF 5FKOA 1QNTA 2CQNA 1IOWA 3DKWA 2UVVA 4LF5H 2WTFA 2V1XA 2E2HJ 3KX2A 4A93J 4ED7A 2YL2A 4DR5H 3DCFA 3GYHX 2IGKA 2JTVA 3EPIA 2IBDA 4XBFA 3QODA 5HLIA 2BY0A 3HUGA 4RM2A 3TO7A 2IP2A 2MW8A 5LEKA 3OV8A 1OQYA 3RV4A 2CUJA 2JA5G 2UXCH 2R7VA 4ENMA 2E36A 4MFEA 3CJQB 1BJZA 3TMOA 4A3JJ 1BA5A 1E4EA 1A9XA 1SAUA 3CDLA 5HS7A 1EYZA 4EM1A 1B9MA 3ZQLA 1KQ0A 4MV1A 3DLLF 2QSFX 2OQGA 3OR1C 4DL2A 5F6FA 2JEGA 1U5TC 1MH3A 1Y56A 2HQ5A 5IYBJ 4DIQA 3M8EA 2R7FA 3LP8A 3G73A 3MQ0A 4B1RA 3QPTA 2IS4A 2XGQA 3LA2A 1F9NA 1CF7A 3KAKA 2F5DA 4J01A 2HDDA 2KFDA 5CKTA 3G1LA 5TGTA 2QWWA 2ZB9A 3T1BA 3JRXA 2HPIA 5L3EA 1Z2OX 3ETHA 4UFZA 4I2OA 2BVLA 1VQ6I 4F4YA 4U7DA 2Y48A 4BAYA 3EUKL 1MIJA 1H0MA 3QWLA 2HZTA 3I4MG 3LSGA 2R7XA 4RGXA 2OQRA 1ZELA 2VJ5A 2R6FA 2O0YA 4IX7A 4UCOA 1J59A 2M3AA 3ZQ7A 2VQEH 4FS2A 2Q2TA 4RNOA 3OUZA 1MBJA 5EWGA 3MEXA 3T5XA 2KPMA 3DEUA 2FMLA 1WSCA 2DFFA 2VJIA 2XCAA 3ECOA 4RNMA 2V4RA 1DGWY 1JXLA 3A0HC 3MWDA 2P81A 4BQQA 1T08B 1TW2A 2OUMA 3W2WA 2X6WA 3HGGA 1PJRA 2LH9A 4LF9H 2R7OA 4B3XA 2R7DA 3FHZA 5KFKA 4YJ3F 1I6XA 5DM6F 5IYDJ 4XYMB 3I12A 4A6DA 2OU2A 2OV7A 2JA5J 2WAEA 4A0YA 4PJNA 1B9NA 2YZNA 1EKEA 3KZZA 4F91B 1FY7A 3MJFA 1YW9A 4GGGA 5EZHA 4JI3H 1QQIA 1Z6TA 3KEOA 1X3WB 2QQAA 4ED1A 2FNPA 4U87A 4RZQA 4HAMA 2C2RA 3I55I 5EWEA 3V6KA 1QO0D 4YIIA 2GM4A 2ZKZA 3PO3G 4NBQA 4Q5SF 3OYDA 5KFRA 3BG9A 2LYCA 4LITA 2F48A 1T38A 3Q9SA 2UXXA 4BHBA 3N41B 3DF8A 2DN0A 2XIGA 4L0YB 5L9XA 5DUKA 2PFBA 1JUPA 1I94H 2KZGA 4HF2A 2IJLA 3ZXSA 3S1MJ 4KIGA 1TWGA 4AUXA 3M4OJ 3MFIA 2C28A 4QTRA 4M3GA 2Y9ZA 2WBMA 4C2MA 2A05A 5EEAA 1FZPB 3PZPA 5E1WA 3Q8QB 3CCYA 1AKHA 2W6PA 3D5SC 4I0AA 3GIJA 1CGPA 4L18B 3BAAA 1A5JA 4JUZA 1I6UA 1VAJA 2YX7A 1MBFA 1YJWI 5DV5A 3GCMA 2UV1A 4NB5A 2IPQX 2CV1A 3IN5A 3ZQHA 1FBSA 2NVYJ 3M4IA 2VA2A 1QZEA 4M73A 5EZYF 3TBIA 3H92A 4Y13A 1YFHA 2VOOA 3BG5A 1JT6A 4HQ6A 4YAJB 5IYZF 2ASLA 2M7AA 3TDZC 2R3SA 3FBIB 3K6GA 3HPGA 5EYRA 4XKBA 3R0JA 5CB4F 1T95A 1FOYA 3MKZA 3GFMA 5EGOB 4CZZA 5KX5F 5M3FJ 4BU2A 2R82A 2ZMEB 4XSXF 3H5AA 1AUXA 2WY7Q 5F9LA 2JA5A 1TWHJ 1X3UA 5B1AH 2R7ZA 4BY7G 4ENJA 4A0ZA 4BE2A 4RAYA 1JJ6C 3ETJA 4TQSA 4F4WA 4IRCA 3BG7A 3O3KA 1RUNA 3GIQA 1DPRA 5HS9A 1HF0A 4RB3C 2DA6A 3RDIA 5ICFA 3C0FB 2IA0A 2KRCA 5F9NA 3OSPA 3KEQA 1W7PB 2XRNA 3IRQA 3S3NA 1O3TA 5GPAA 5IT9Z 4YEJA 4I02A 2CH0A 1ZGWA 1WFXA 2QSHX 1S10A 5B5EC 4ECQA 2K85A 2CFOA 5IYCG 1F4KA 4KUMA 2EPFA 5E18F 1YITI 3LSPA 3LSIA 4PZJA 4KJZA 4XL9A 3BA8A 1BW5A 3R4KA 3R61A 1S8NA 2DDAA 2M2EA 2Y2ZA 1WCMA 5E3LA 4WCGA 2ASJA 2RN7A 1I6HJ 1WCMG 4KHPH 3HKZA 1J2XA 2WB1N 5BMZA 1O3QA 3K3VA 2GXBA 4NC7A 2ZJQF 1TQIA 4UVAA 2EFOA 2O8XA 2X48A 5J47A 1EH7A 2K5CA 2GXAA 5AONA 1KJ8A 5KG6A 2D5VA 3F23A 4B3RH 3I3LA 5J8CA 1PK8A 3CUQC 3AL0C 1TZLA 1XDSA 2JA6A 5IWAH 2A61A 2ZXJA 5A2QZ 3GZ6A 4ECWA 4XRFA 4HF1A 3GLLA 4CCKA 3L9FA 1FYMA 4O6JA 2M4GA 3KHHA 4LF4H 2UUBH 3MD2A 3TOBA 3J81Z 1O3SA 4CC5A 3I4PA 3J80K 1VQPI 2W84A 3OSFA 4BXXG 2Z5UA 1FOKA 2ZC2A 2NVTJ 4LLLA 2Q1ZB 1X2MA 5LGNA 4AC0A 4QIWN 4F4ZA 2E1MC 1Y8RB 3JCUC 4YFNF 2LREA 5F0FA 3JRFA 1K78A 3LQRA 1IW7F 1RC9A 2MG4A 1R58A 4DL5A 3D1NI 1ZQ7A 3HSFA 4IXAA 3RCOA 2VJJA 2YU3A 1YS7A 4JX4A 3HDDA 1DUXC 1MMAA 2JUGA 4RA2A 4XLHA 1DDNA 1G6NA 5J40A 1FPQA 1M7JA 1KEEA 3RSNA 3F8CA 1BR2A 4JI2H 5D4SA 3A4CA 1YHQI 2E5ZA 2VODA 4DL6A 4CUGA 2HYGD 1WH2A 2ZJTA 3DP7A 3VPCA 3GTKA 2LRDA 3ABKH 4LSAA 5F27A 3I9V2 3BP8A 4LH6A 1K6YA 2QCOA 1TAEA 4CCLA 3T1HH 1MNMC 5BPDA 1IAWA 5BOXA 1IN4A 3K0LA 2GLOA 4CICA 1BI0A 2OAZA 3FDYA 1A0IA 2ZO4A 3NRVA 3WU0A 5FJ8G 4D9JA 3SDBA 4OIQF 3J7AY 4IEJA 1GV5A 3QYFA 3MFKA 2W9CA 3Q1KA 1GV2A 2FJZA 3PSFA 3KZIC 1XSVA 1SMTA 3CQZJ 3FX3A 4DR7H 4FBTA 2LTPA 2XKOA 4HQEA 2EV0A 2ISYA 5L1JA 3NWSA 2JQ7A 2DOFA 1XG1A 3CJTB 3H3VK 3IP4B 4GKKH 1WI3A 2EFNA 3DLAA 3BA9A 4JV0A 4FE4A 1UMQA 2DW4A 2VL8A 4LJZF 2ZFUA 1Y6IA 4EGYA 3OSGA 5KKNB 3J81K 3MR6A 5DS9A 4I98B 3K70C 4MTDA 3E6DA 4UXNA 3S2DJ 1O7FA 2OD5A 3LAJA 1KU9A 2VBZA 3M3YJ 1TQMA 2Z3YA 3PL8A 1F36A 4KA4A 4A12A 3OIOA 2IS6A 1G3WA 3J81W 1D0ZA 4FETA 3MAJA 3GIKA 3VYUB 4FX0A 1NK3P 4BHPA 4E7ZA 4G94A 2D45A 2W00A 3L00A 4ED0A 5KFSA 5LP6F 2VPQA 2EINH 4IQJA 2QYZA 4Q47A 4PSXA 4XLCA 3FK7A 1EJ9A 4GLXA 3CCRI 4BL0B 3PIOF 1VBGA 2J6UA 1F5TA 3EPZA 3WNZA 3U2RA 1B1BA 2HTJA 3ISPA 5EG0B 5DGBA 2YRWA 2DTZA 1VQ4I 1TP4A 3VB2A 4DV1H 2EJRA 3EPGA 4XLEA 1FYKA 2G9WA 4R8HA 3DEWA 2X51A 3LAPA 4M7EA 4P1WA 1N36H 3H9QA 2OC6A 5KAFC 1JTXA 2J9GA 4AIHA 5IYBG 3HXLA 2CZGA 2COMA 2RVCA 3CCVI 3SZGA 4D5CA 2HYJA 5L3GA 3CMYA 3ABTA 4GYGA 3GEZA 2PBIA 2DTRA 4BUPA 3HOYG 3RAQA 2FSWA 2HGCA 1I3AA 4IF4A 1ERDA 1D1CA 1D8JA 5IP9G 1ETYA 5LRSA 1Q1VA 2QBYA 1K83A 4B44A 3GV8B 1G3SA 1Y8QB 4PCQA 3WODF 4EM2A 3KETA 5D1OA 2CQXA 3L2QA 2VASA 4MV9A 4HYEA 2IAIA 4ED6A 5C1PA 2BZTA 2W7OA 2CW0F 2XASA 1T8IA 2KDOA 1TQPA 5HLHA 2ECCA 3KPHA 5K7ZA 3OYKA 2R92J 2Y0SE 2YZMA 1FSHA 2XSJC 4IHXA 4B09A 1B72A 1Y1WG 3ML6A 3G6EI 5CJ9A 3ZGKA 3ZMVA 2RGRA 5HDGA 2NXNB 4F7ZA 4KITB 1OYIA 2W6OA 4XYLB 1OCTC 4RUCA 4WK8F 3M9AA 3E5XA 1TC3C 2BY3A 2D1VA 1WJCA 4RB1A 1Y1VG 1MDMB 1S3JA 5E3NA 4RGRA 4XN3A 3N6XA 4BBSG 3TW6A 1TWFA 4AYBN 1OKRA 4UHTA 4DV4H 4F55A 1W96A 4UVBA 2G7UA 2ZFWA 4RUAA 4WX9A 4XKVA 3UFXB 1IRFA 2R7ZG 3U1DA 1R6RA 3RB3A 4AWXB 2DFHA 5H20A 2K9LA 3L2CA 1HKTA 1P4AA 3S14J 3FXUA 5C4JJ 1JJ8C 4DGWB 1I7LA 3DBLB 4O2AF 2I5UA 2AQEA 5IP7G 1X1DA 1QPMA 1TL8A 1P2FA 3G1OA 3W6JB 1N56A 2STWA 1BOBA 3EQLF 3NARA 4DBQA 3ZPLA 2W82A 3GTKJ 2V5AA 5DQIA 3JAMZ 4AQYH 3K70D 2YS6A 3HM5A 2M05A 2EZHA 3F8NA 4QIWE 2LKXA 3H0GJ 4DLKA 2VUMA 4DJAA 2IMWP 1VQKI 5LHHA 4JI4H 3BT9A 3ZQIA 4FT8A 4LIVA 1AHDP 2F5VA 2M5WA 1WRJA 1E17A 2DJIA 3RBDA 4M6YA 3IAS2 3QFFA 4HX4A 1K4TA 2WV1A 4J19A 3ZMZA 4JX6A 2E1CA 1H9TA 5D5WB 2Y0SN 5DCMB 1JLLB 3NWTA 1JXSA 1N77A 4X64H 2GIVA 1XCBA 2H09A 3SZTA 2MH9A 1GDTA 1BGWA 3J7AO 2QYOA 4NNJA 4B48A 4UUSB 4R8UA 4M3EA 5L1IA 5EJCA 3WE3A 2WV0A 3U9TA 2E5NA 2W48A 5D8KB 4UNOA 3IL2A 2X4HA 2FOKA 4A6EA 3IRRA 4Q43A 2QLZA 1NG6A 1HOMA 1MSFC 5IT3A 4B8XA 3G71I 3S2HJ 5KAIC 3PN1A 3J7AK 3RZOJ 2DK8A 4HSTA 2EZIA 3E6MA 3KLOA 1ZG3A 5KG7A 4CCJA 3DBRB 4CYDA 4WF2A 3FXJA 4YB8B 1X1PA 1V5FA 1BN5A 2HDWA 4IL6C 4UUSA 1UG2A 4R8UB 2ELHA 3ROUA 4A5NA 1S72I 2Z9OA 4RB0A 5KT2A 4LFUA 1IV6A 4JI5H 3IAM2 2DMUA 3BR0A 2L0KA 4OAZA 4IPAA 1MBHA 2CV2A 4YR3A 1ZR4A 2QSGX 2YCHA 1U2WA 3KYDB 4IWYA 2PEXA 4EQQA 2H1KA 2XAQA 4LFAH 2W70A 1T3NA 3H40A 1WJDA 4MV8A 5KT4A 4MTEA 2W8KA 5F0CA 2IGNA 4AVPA 1UFMA 3JAMK 1WJBA 1T0FC 2DA3A 5LMNH 5JVLA 2K9MA 4U88A 3GIPA 3R5HA 4C3JJ 1Z77A 3HPHA 1LE8B 3WG9A 1UJ8A 3V42A 2MA3A 3GBGA 2LBFB 2KDZA 1WJEA 2IGMA 3IC7A 3BJAA 1FTZA 1JT0A 3ABMH 3LFKA 3T8TA 2W9BB 3FZVA 1DGRM 5JQWA 4JYKA 5J4YA 2C2DA 2ZDHA 4Y52J 2E2IJ 2PLYA 1ULZA 1R5ID 3HRMA 1E4EB 3RKYA 3M1CA 3BC8A 2FU4A 1FSEA 1Y1WJ 3I64A 1V4RA 4MV3A 2JA7A 2LDUA 1VQLI 3COAC 1D0YA 3PO2G 5F0HA 4ZHQF 2EZLA 1ULYA 3ZN1A 5BS6A 4EMSA 3HRUA 1MMSA 4ESFA 2OBPA 5M5YJ 2HOEA 2HGSA 4JI0H 1WGXA 1CQTA 2L9VA 1BC8C 1A04A 4CYCA 2XB5A 1WWXA 2QF7A 3IKVA 2UZKA 2WADA 1HSTA 1Y0NA 5IOZA 1RUOA 1BNCA 2VT2A 3ABUA 1TWAA 2UU9H 3BZKA 5CQGA 1R5GA 4DR6H 3GTPJ 1KJJA 1V3FA 4MNUA 5ICCA 3RPUD 1EF4A 2TDXA 4ECYA 3W6KB 2RDIA 2DDBA 2ICWG 1QBJA 3QP6A 1WQ2A 3OL3A 2DLLA 3WGGA 2E1OA 2HQRA 2QQ9A 2K9SA 4IHTA 3SYTA 3D0SA 4GDFA 4II2A 2ZCWA 4L0ZB 1JHHA 1VQ8I 2JVGA 2M0MA 3FKJA 2YRXA 1U0JA 4C30A 4C9YA 3TQTA 5DYMA 5IP6A 4EYIB 2EK5A 1T36A 5EEHA 3CCLI 1JI8A 1Z7UA 2R87A 5E8GA 2ZMEC 5ED4A 4LB6B 5GAHJ 3ZN0A 1LDKB 1N75A 4FISA 4YP3A 4PWQA 5DM7F 3PNVA 1V9PA 3H5RA 1E0EA 4C3HJ 3ZQFA 3PW2A 2VKVA 3MWEA 1QVUA 1YOVB 1K83J 3CLQA 3H0GA 2JEJA 1ZKGA 4CCNA 3GVAA 1IO2A 2F4IA 2YX4A 4BH9A 4J9KA 2XD4A 1R5HA 3RUPA 3SJMA 4DV2H 1EH6A 3BOQA 4KICA 1ZG5A 1Z7LA 1PX2A 1HCRA 5EEGA 1S7EA 3JTHA 2V1NA 1IOVA 3B02A 4DV0H 3V6JA 5L3CA 1PUFA 4ECZA 3U9SA 2AHQA 2VQGA 2STTA 3OS0A 3TINA 4AIDA 1W5SA 4PFPA 1JGSA 2QKMB 3IKTA 4KN7X 2R5ZA 1KYZA 3BPXA 4AU7A 4ANJA 4MAMA 1ZHFA 1GLNA 4HSRA 5C5JA 3LSMA 2KKOA 3OL4A 5L1LA 3QPSA 4QLCU 2RGVA 5KFUA 2K4BA 2JA8J 4NDLA 1WH5A 2M9HA 2DT6A 2BW3A 3H9GA 4S0HB 1IF1A 1M0TA 1TWHA 2QEXI 4Q48A 2IEKA 1R49A 2M87A 1X4OA 2ADUA 3IUOA 3F22A 3SE7A 4R1HA 1ZN2A 4BJ6C 3L2WA 5KFXA 5IYDG 3OYLA 2LKSA 3K10A 4N4OB 4AM3A 1OR7C 4BBRG 3HJEA 1FX7A 3JSNA 1BXRA 1A31A 1T6SA 1W0TA 4X62H 3D5LA 4DQ2A 1F1ZA 5KG4A 3PO3J 3M8JA 1B4AA 5LHGA 4YAKB 3CCUI 2IT0A 4NXMH 2P7VB 4A3JG 2HNHA 3OWTA 1S5LC 2P4WA 3B6AA 2DFIA 2JRTA 5BPHA 1ONVA 4M9SA 3BG6A 1POGA 2GWRA 1P92A 5KFZA 2JA6G 3GTLJ 2KIUA 3F8MA 3ERMA 5KFHA 2R93A 2M30A 1W1WE 4G12A 4KNYA 3PFIA 4HNUA 4IRGA 1SD5A 3DPTA 2NRAC 3GTLA 4I50F 2BE5F 4UCSA 2XGCA 3CJNA 4A0XA 3OYCA 1W0UA 5FO5A 1KC7A 5C44G 2CRGA 3L4KA 1UAAA 2JPBA 1G8XA 3ZQQA 2X1EA 4ZYAA 2FPIB 1LFPA 1XGSA 1DQUA 1ZREA 2GLTA 3OMYA 4I99C 5DD4A 4ESJA 1VI0A 4L9JA 4DOZA 2D1HA 4A3DJ 3HYIA 4A5MA 3OR2C 2LF7A 1DP3A 1M0WA 3K7AJ 3RZDJ 1YRNB 3AG2H 2B63G 1ZHQA 3LWFA 5KFIA 4C3IJ 3L2UA 2ZBKA 2W7NA 4IR9A 4HF0A 4ZYGA 2EFQA 4L9VA 3CF2A 3GTGA 2VPRA 4AIJA 4I7HA 3ZOBA 1MSEC 3KALA 2CQQA 2M7BA 3GLXA 2H94A 2V1DA 1E3OC 3WHBA 2IGOA 1PYVA 4X65H 4I01A 3HOXJ 1ZRFA 2I8CA 1FBUA 3DXJF 3CCQI 2UVRA 2HOAA 2NAZA 2FKLA 2XKPA 4J9LA 2N8GA 2KISA 1N33H 4RGSA 4JV5H 3H3UA 2L7ZA 4UV8A 4EATA 4GRIA 2R8JA 2FJ1A 2W4SA 3VYRB 3REOA 2R7KA 3WO1A 2DPIA 3VFZA 1I5ZA 2KRFA 4EJTA 2F4VH 4A3KJ 5IP9J 3O8GA 3PUFA 1KU3A 3I71A 4P55A 1QZYA 2ZXIA 3KFWX 4L5IA 1X3ZB 3HOYJ 3S1QJ 4MV6A 3I53A 1MDMA 3TIGA 1D5VA 3BJOA 2FK3A 2OA4A 4UCVA 3WTTC 4QWDA 4N0BA 2I10A 1I3QJ 3GFIA 1EUCB 4NQWB 4LH7A 1S9FA 2DT5A 3TO6A 4IO9F 1RKWA 3HOZJ 3AAFA 2AQFA 2NNYA 1UC8A 4EJOA 3F9KA 1YW7A 3N44B 2Q2EB 2GAUA 4U7CA 2B63J 1FYLA 1NK2P 1X4PA 4MFDA 2SCUB 1U3EM 3Q8PB 2HJWA 4F50A 5HBRB 4Y3OA 1LQ1A 3KHGA 4GC7A 1OLTA 3I56I 4A3EJ 1PUFB 1YO5C 4XOPA 1BM9A 4OMYA 1K61A 2JSCA 4HEA2 5FKMA 1PP8F 3CF5F 3N40P 2FX0A 4XOTA 2MABA 3OHAA 4E7JA 1SFXA 3P5JA 3H20A 1OWTA 4MLOA 4UV9A 3RFCA 1KBLA 1UHSA 2ZDGA 1E2XA 4I0BA 3K69A 1S0MA 4DYQA 2W9AA 4U6PA 2ID3A 1SCUB 2LC2A 3PW4A 3AG4H 3QOPA 2P0AA 1DV1A 2F5CA 5FLXW 4TUYF 4DR4H 1RKTA 4A2UA 2VQCA 3BCAA 4KFCA 2WTEA 3KYLA 5KFWA 5IP7J 4YJ2F 3HGYA 5HLGA 3CCSI 5HNFA 1YI2I 1TW3A 1L0OC 4C2TA 4IVNA 4IHYA 4A3GG 2DT7B 2HHHH 2E35A 1BJTA 1VF9A 5KFNA 1FOWA 1H89C 2EH3A 1U5TA 2GA1A 2L9NA 2A5YB 1UC9A 4K2EA 5H6RA 1QVTA 4HBLA 5CQEA 5KG1A 1ETKA 4CGZA 3RAXA 3MZHA 1WHUA 3SFZA 3LA7A 1GT0C 1VQ7I 2E2IA 1BOAA 1ETQA 4L1KA 4RM3A 1RJQA 1UHMA 1MKMA 1L2ZA 5KFMA 1HSJA 2GQQA 4G7ZF 3X2QH 3JRWA 1QHHD 4BE1A 4FHTA 5KNLA 4G8XA 2JK3A 2J5PA 2A68F 5K1YA 3HOSA 5KFLA 2AGQA 4LF8H 4M9ZA 3JRGA 5HS8A 1DU0A 4P9UA 1SMYF 2OF7A 3S32A 3RTXA 5I47A 1VNDA 2JA2A 3I54A 1W4MA 4HLXA 5HDKA 4CCOA 1K7AA 1R71A 2Y9YA 3RJ0A 4PJMA 4HDUA 3K1PA 2DXIA 5B3SH 4ED3A 5FPRA 4PJLA 5B66C 4QWCA 3DEEA 2FUG2 4TV7A 3V7SA 4XMYA 1E3HA 4EBDA 1GUUA 3FXKA 4PDKA 2TRTA 1TNTA 4Z6YA 4HQMA 1TT5B 4ZC3A 3A2KA 2IRFG 4BDYA 3NAUA 1CE8A 1ETVA 2L02A 4YG2F 3BZ6A 1U8BA 4IHVA 3P9CA 2ME6A 1BR1A 2LY1A 3U21A 2Z99A 3V8KA 2W85A 3JREA 1FJLA 2R7UA 2O5RA 4KT6A 5F1RA 2M1BA 3BLYA 1B6SA 1XS9A 2BXZA 4MGRA 5HV6A 5A2QW 3M9MB 4EEYA 5D4RA 4O3SA 2DYRH 3HG9A 5IYCJ 1RYRA 1FKAH 3BJYA 4BQAA 3FISA 4LG0A 3HL2A 5LRRA 3RI4A 5DLGA 5FLXZ 2D2WA 1ZARA 5FPOA 2LOOA 2DQLA 4IAJA 1B6RA 3S2WA 3ZQCA 2NU9B 4M3FA 1S7OA 4QPOA 5CVVA 1I3QA 3FBNB 1Z6RA 2VKDA 5BPIA 3A1YA 3QU3A 2OZ6A 4RBOA 4HR7A 2V9VA 2K86A 1U8RA 2ISZA 2R93J 1BI3A 3OS2A 3Q8RB 3IG0A 4MO7A 1BR4A 3LFUA 1LJ9A 2VB6A 3JRBA 3FM3A 4ME6A 2YW2A 1O57A 2KIMA 4QJFA 1YW8A 4J9NA 3LQQA 4L5EA 1U5TB 2RAEA 3CCJI 2EWNA 4E7KA 4ENNA 2W6ZA 1XTAA 4HW0A 4Q44A 1EV7A 2H1LA 3LL7A 1LPQA 4FQGA 2P5VA 1MD0A 2H6CA 3M1EA 1OR7A 1FVIA 1VQ5I 4GFBA 4J9SA 1W7PA 2MBFA 3I5UA 5EOYA 3DPLC 4BKXA 3CD6I 2IW5A 3EUHC 3WTYC 1U9OA 3FXLA 2O3FA 1GSOA 1RK6A 5DQGA 1LKXA 3JW4A 4IHWA 1NH3A 1AN7A 3BY6A 4BEHB 1S7AA 2FP4B 3PIPF 3G6XA 3LSKA 2VBXA 1JKPC 3GTQA 4D1QA 5F64A 4DL3A 3FK6A 4Y15A 3HKZN 2QA4I 3C2BA 4BBRJ 1IDZA 3GTJA 4U7BA 5KT5A 5KK1A 2JT1A 5KFOA 4C5AA 2R0QC 3I4NJ 3QPHA 5FLXK 2C2EA 3M9NB 2XAHA 5LYJF 3H35A 1Y14B 5EF6A 1O75A 3V7CA 4D7NA 1STZA 2YU9A 1V5EA 3RGXA 1T98A 1J0RA 2HKOA 3FXQA 3BZCA 3WU2C 1VQMI 4A3BG 1O4XA 2CV0A 2VC1A 2FE3A 1FOXA 1LVKA 2LNBA 3H1CA 2L4MA 3OOPA 5ILSA 3RPQA 1REPC 1ON1A 2VN2A 3ZP5A 2I8DA 5LLQA 4RLQA 1V55H 4KN4X 1QHGA 1MW7A 1USTA 2FA5A 1ZYRF 1XGNA 3BDDA 3O2PE 5E1XA 5D8DA 2DMTA 3BWGA 5BQTA 3RQ4A 1XMXA 4UCUA 2JSPA 3PNYA 1ITYA 2HVQA 4IRIA 1MJ9A 3BQ0A 3M9OB 3K4LA 3K1NA 3KP7A 3N42B 3QZ8A 2UVUA 1UZCA 3LSJA 3SEQA 4XRSA 2E2JJ 3NGDA 4RU9A 3CP8A 5E20A 4HA8A 2R86A 4DR3H 3NEUA 2KRHA 4PJJA 4A3MG 4AVZA 1BI2A 1ZK8A 1BJAA 4XLAA 4UCRA 4A3MJ 4RLFA 2CQYA 1XNRH 3VODA 1I39A 3E5NA 2LLKA 2HTSA 4M74A 3BR2A 2WAQA 5J1UA 3GTQJ 5IOYA 4A93G 4E4HA 4ZDOA 4YIRX 1X1CA 3F72A 3WTUC 4YR0A 2EA2A 4ED2A 1XSDA 3K4CA 4O2BF 1W5TA 2W25A 1KZHA 3HKZE 4ZZDA 3T5KA 2QVOA 2X6OA 4W97A 5LGTA 4E7IA 4O3PA 3HOXG 1HR0H 3TP0A 2FXAA 4HNVA 1GXQA 3FXRA 2Q8KA 3MKWB 1H9GA 2IA1A 2ZMEA 2MFZA 4BY1J 2KIQA 1IC8A 4RAFA 1C3OA 2Z2SB 2GBYA 1HKSA 4ETSA 3BR5A 4GC6A 3NQOA 2DBBA 3G2BA 5DD8A 2BV6A 2CG4A 1OFCX 5FB2A 3HOVJ 1SFOA 4NXNH 3J7YJ 3E5UA 1UG0A 4NC8A 1N78A 2OTJI 4MHGA 1R1TA 4XLPF 2UVWA 3CQZA 5K5OA 1LDJA 2LR8A 3FKIA 4LMYA 4DV3H 1FP2A 2F5EA 1RIOH 1TLHB 4XM3A 4LOCA 1ZH5A 2L54A 4EJVA 2R7RA 2CUFA 3OY9A 2PJRA 1TWGJ 1GLVA 3P7NA 4ECUA 1Q1HA 1R4MB 2DK5A 2K7LA 2HS5A 3VDXA 1QU3A 4DV6H 4K0KH 2XAGA 3N43B 1XN7A 4CC6A 2VPSA 2Y30A 4CXFA 3HB9A 2F5FA 1D3YA 4A3LJ 1R4NB 5JI6A 1B6AA 3C18A 2LF8A 2NNNA 4ABZA 1VQOI 2X1DA 1S68A 1VKZA 4KMFA 4IOCF 4HNTA 1ACIA 2PVPA 3JR9A 2R8KA 4OX9H 2JEIA 1HW1A 1FT9A 3WTZA 3OS1A 4LD5A 2J6TA 1I50J 1YS6A 3ULQB 4A3IJ 1Z67A 3OOUA 1OCPA 3K3PA 2V4QA 4IKFA 5E79C 1BIBA 2FRHA 2HDCA 1Z1DA 5F08A 3R5XA 1AOYA 2JMWA 2VT3A 1ZRDA 2DMQA 1S0NA 3H0DA 2XGPA 2HXOA 4OINF 3MMYB 2VONA 5IT9K 2M8GX 1I27A 5EGOA 2FB9A 2WAFA 2AGOA 2O03A 2CJJA 1H8AC 4GXOA 4OWRB 2F2EA 5CA1F 3ABLH 4Q4ZF 4CYCB 2WWYA 2KJCA 2Y31A 4MQ9F 2A6HF 5LGUA 3K4BA 3QOEA 1BW6A 3FF5A 4OAYA 2QQBA 3GFJA 1SFUA 4XKWA 5DDGA 2K9NA 1XB4A 4HZFA 2QBYB 4X66H 5KFJA 3C7JA 3H3ZA 4E6KG 1WZ2A 5DUIA 1KQ8A 1JUSA 1EHIA 4ESBA 3W6VA 1EZ1A 3TP3A 4PJ0C 1HQCA 1IXRC 5HODA 5FJ8J 2W7PA 1AU7A 3ORQA 3Q3SA 4WXHA 2NVQJ 4D7MA 2ZDQA 3LMLA 2IS1A 4BDZA 1NHAA 5K7FA 3CJRB 5F1JA 1J5YA 4G7OF 5GAGJ 4V2FA 1OCOH 3G4SI 4I76A 4EEQA 5C44J 3L2RA 4MA0A 1W36C 5M5WJ 2YUSA 3K2ZA 4IR1A 3L7WA 2V9KA 4DV5H 1KU7A 5CVJA 1G3TA 3Q9VA 3J80Z 2HVRA 4ZYEA 3C1DA 3HBLA 3H4BA 1ORKA 3GZNB 1BI1A 3QRFF 1RYSA 5GAEJ 2LMDA 3UR3C 3TOAA 2PMZN 2R92A 5D6EA 2E5LH 1GYFA 4PUSA 3HOWG 1HA8A 4B47A 3DF7A 1PUEE 4XSZF 1HW5A 2E1NA 2VE9A 4O5VA 2ZNYA 3WG7H 1HKQA 1WSUA 2DPJA 5F04A 1S9HA 1YIOA 5FLMJ 5ICGA 4FASD 4ECXA 1USSA 1R7JA 3I58A 1KONA 3KYCB 4BJ5C 1J5EH 4PFOA 3S15J 1F43A 2KSWA 2B63A 3KP5A 3DTIA 3RQIA 2ESNA 2W6MA 2BEOA 3ZMSA 2FK2A 3K4MA 3L2VA 4LLGF 2G7HA 3WTVC 3PR5B 3PW0A 2DMNA 3QPLA 5KHDA 3TL4X 1J09A 3PSIA 1FP1D 4ZDLA 3A0BC 1TWCA 2EB7A 1ZETA 2AGPA 4CSWA 2JJ7A 1YG2A 2BY2A 4WXDA 1AUVA 4O4IF 3K4JA 3OTOH 4PDBA 3JRDA 2CU7A 2Y0SA 2I87A 2DO7A 1W36D 1KJIA 4ZI7F 4E4TA 5TISC 2C22A 4LGWA 3KIOA 3G8CA 3KXYT 2CS3A 2CMPA 1XDUA 2FNAA 4BXFA 3JRAA 6PAXA 4H4KC 1R22A 2ZXWH 4F3QA 3ERED 5BMVF 3HTUA 4A3FG 2XAFA 2Y0MA 1MMGA 3FKIJ 3MFHA 5CA0F 2WAQN 3N05A 2XRLA 2XGXA 3WGHA 3JZIA 2WE6A 4E7SA 2X1CA 2WAQE 3CUQB 5L1KA 3CUOA 2CO5A 2H8WA 2R7LA 1M1EB 1RI7A 3GZ5A 2B7EA 3RV3A 5GTHC 1FJGH 2MC4A 4RGUA 3PW7A 2V59A 1B8IB 4XK4A 4RZRA 2W9CB 3CMEI 2DU9A 3VPDA 2PJRB 2A07F 4YRVA 3IWZA 3QZ7A 2R84A 2XC9A 1R23A 4FE7A 4NLGA 2FQ3A 4LFCH 4D5FA 4UVCA 2YPRA 4HV5A 3HHHA 2C35B 3BR1A 4BY7J 3K4KA 1TT0A 4A3EG 4ZZLA 1PDNC 1A35A 5LL6b 2OH2A 3DPUA 1DV2A 1GSHA 3BQ1A 2KLOA 1SFKA 1UB9A 5T14A 5FFXA 2X9DA 2P0WA 1P4XA 1K79A 5E3MA 3E7LA 1TWFJ 1SD4A 4R7RA 4JI6H 3T5LA 2VQLA 3QP5A 1D1BA 3CCMI 3QU6A 1RRJA 3ESWB 4IJAA 4X6AJ 4EJUA 4Z2YA 4DYRA 1YE9A 3LA3A 3R5FA 1UELB 4ECTA 3DBHB 2VLAA 1XGOA 4WWCA 2FF4A 1MGTA 4EVIA 1Y39A 4LIUA 2HOSA 5J2TF 5JUMA 2VKHA 3JSLA 3T5HA 4M3DA 2ZSIB 2UXDH 3Q5FA 1XSXA 5HVQC 4O3NA 2OJED 3E0JB 1G2HA 2GOMA 3KLNA 4LF6H 1LFUP 4RAZA 2OCEA 2XPUA 2R5ZB 1SVLA 4CDGA 4MV4A 2L2OA 1J75A 2JWTA 1I1GA 5IY5H 2FBHA 2XGEA 4RMNA 5ICEA 3DV8A 1RNLA 3BTLA 4O4LF 4ED8A 3FKIG 2FLPA 3OYEA 2CFXA 1W7PD 5C4XJ 3E5QA 3CO7C 5DCFA 5FKKA 5A2QK 2K3FA 5GPCA 3RKQA 1OYYA 3TKYA 4Q45A 1MNEA 2EFWA 1XCVA 1K6OA 4HX8A 1RESA 1QPIA 2R92G 4BQOA 2P5KA 2IBKA 3UQ8A 3GUDA 5KT7A 1E4FT 4BQNA 4N4NB 4E7HA 3HOUG 1YTYA 1WKMA 2DA7A 2NVYA 1T33A 2FBKA 3L09A 4BWSC 5DG7A 3GLKA 1S03G 1P8LA 2DA1A 5KG2A 2MSYA 3WTSC 2DA4A 1JX4A 2WY8Q 3GF2A 1V51A 4JBAA 1A36A 3W2AA 2KIFA 4RDUA 5BNGA 5CAEB 3PFYA 2EIKH 1EUDB 2W6NA 2ZNZA 3P9IA 1IZ1A 3OUUA 1SD7A 5DEQA 3Q0UA 2CQKA 1ZAOA 2H8RA 4ECRA 3K4NA 5FLMG 2VUMJ 1MH4A 1JHFA 3KE2A 5CLSA 4F52A 3TO9A 2GZWA 1IRGA 4XNFA 1N34H 2O6GE 1AWCA 2RC4A 4E70A 2WB1A 5FGMA 5LFAA 3JRHA 3RB6A 3CMMA 5JLXA 2R7TA 3F6VA 4JX5A 1YIJI 5FKNA 3RTRA 4UUVA 1HDDC 4BY1G 3GIDA 2XAUA 5BR8H 2BVMA 1D1AA 4O3QA 3HOVG 3S17J 5KG3A 3PQKA 1X58A 3IH2A 2NVXA 4Y33A 1RJPA 1Z21A 2RNGA 3WO0A 2JVHA 2ESHA 5FFZA 3G6VA 1IRXA 5ERIA 2DQRA 2OZUA 3N97A 3E97A 1IBMH 5M5XJ 2GPSA 3H0GG 2R7QA 5E1ZB 1R9TA 1GVDA 1MMNA 1P7JA 1WJFA 3OYHA 2ALZA 3SDGA 4A3FJ 4M9UA 4DZPA 3H36A 3A01A 2V1UA 4JI7H 3LSTA 3GIIA 1LE8A 4FX4A 1QRYA 4LK1F 4O3MA 2NYXA 4N9HA 4IZOA 3FXMA 2H6BA 4XRSG 1LNWA 3Q0VA 2KP6A 5DG8A 3N8DA 3MCZA 3BCBA 3KAJA 1HNWH 1CS0A 2MD5A 3OSNA 3VSKA 2DFEA 1LVAA 3GILA 2DLNA 2PMUA 3CMAI 2ATLA 2E60A 3Q2OA 4DUZH 1QZZA 4XLFA 1ZLKA 1J9IA 2NUAB 3GTPA 3GWZA 4ON0A 3FMAA 2RDPA 4JV1A 1OPCA 2M8EA 1HNXH 1IN7A 4KIBA 1KU2A 1HBXG 1DPUA 4BGDA 3HOWJ 1TBXA 2UUAH 4OIOF 1G4DA 5EDWA 2JZYA 5KFTA 3H4DA 2LK2A 1NG7A 5CVUA 2EFPA 5JLWA 1C0WA 3C2GA 2R8IA 2R7MA 1UCRA 4XRMA 1GGOA 4YY3H 5DG9A 2VXZA 4O4HF 1JIHA 5C1OA 4BS9A 2R8HA 2W24A 2LKPA 3F0CA 5L3DA 3CC2I 1IN8A 1FIPA 3M7GA 4QWAA 2CSOA 3MR2A 2WYOA 1WR2A 3GXOA 3F8BA 3H9JA 5H6QA 3RPUA 4YFXF 2RV8A 4GYIA 5J1YA 2JEFA 2HI3A 2VIXA 2L5QA 3V8JA 1Z2PX 2GIZA 1P4WA 1J7KA 4M3BA 3CUQA 3HHGA 4LLNA 2X0LA 2GXGA 2L7MP 2W8LA 4ZH4F 1B33N 4ZTJA 2RDJA 3EYYA 2CYYA 2YYAA 2NOGA 3AL0B 4ZYDA 5KFVA 1OMIA 1RK5A 4S04A 1VBHA 3KP3A 3G1MA 4M71A 2PN1A 5KFPA 3GV5B 4EBEA 2L7FP 3BABA 4TQRA 1WJAA 3GTOJ 3I0TA 1IBLH 2AQ4A 4HYKA 3T5JA 2NOJB 3ASNH 4EM0B 2DJNA 5D5XB 3K5IA 5AIPA 3GMEA 1JKQC 3S1NJ 1S6LA 4Y17A 5KFAA 3IH4A 3DQVC 4Q8FA 1WVRA 2X85A 3K1MA 3ZMDA 4BBSJ 2WC2A 5DCMA 1FTTA 1XGMA 2M34A 2IA2A 5IPAA 4A2BA 2LY2A 1FMWA 3CLOA 4U0VA 4QPQA 4ZYHA 3S1RJ 2CGPA 1VZ0A 2VQDA 4DUYH 1X19A 2DWCA 2XVCA 3GW2A 3GTGJ 3ORRA 4TV9F 4G9YA 5KT6A 1RZ4A 3BQ2A 2V6CA 3BR6A 1ZGAA 4M72A 4H0EA 5JH7F 5J2UF 2J5OA 4QWBA 1IV8A 5K5RA 5HOOA 3ZRGA 5CYVA 2GPWA 2MLGA 2UUZA 2EA4A 2PG4A 1DGSA 2JRMA 4HV6A 4JI8H 3CO6C 1T56A 1WJ5A 4RNNA 3KHRA 2DZDA 2PX9A 3HRSA 3DKYA 1YJ9I 2V58A 2HQNA 2VQFH 5EDNA 2ME0A 2P6TA 2P7CB 2VA3A 2MGQA 4PK4A 1E3PA 1FBQA 3ZQGA 5D1OB 3DTKA 3GQCA 5CPRB 1O7LA 3I59B 3DFGA 4JQFA 3E3VA 1HLVA 4MA5A 1L3LA 4DZJA 4EFBA 2VBYA 2EV6A 4XKCA 3OYGA 1K1SA 1I7NA 1VTNC 2FOWA 1JE8A 3FHNA 2GA2A 3T1YH 1JTYA 2DODA 3KEYA 4CHUA 3SI8A 4XR6A 1ETOA 2P8TA 3KP2A 1PP7U 3AYHB 3VEPA 3OYMA 2FQ4A 3CC7I 1R1UA 4HLYA 4L9TA 4X0GA 2FK1A 4AYBE 4P5OA 3F21A 4OIPF 3RBEA 1N48A 3RKWA 2LBFA 2NS0A 3OHBA 3CDIA 1D0XA 2XCLA 4FTHA 1OJLA 3WTXC 2VE8A 2FLNA 3CC4I 1BC7C 1U9NA 2MLKA 2XUBA 3HUGB 2Z1DA 2LY9A 2ZJ2A 1MBGA 1Z0XA 1LB2A 5AIQA 4UUTA 3DKXA 2ID6A 3ZCOA 4G7HF 3W2VA 3JSOA 3PUBA 2PN6A 2XGDA 2NVUB 4XN0A 2LP0A 3CDHA 3MN2A 4KYWA 3RYRA 2BBYA 2QZ8A 4DYCA 3D5RC 5JHUA 3GTJJ 1U78A 1Y1VJ 3A03A 1JGGA 2AXTC 5LXTF 4EBCA 3JRCA 2FEZA 2BYVE 4EEFG 5L3BA 4U0YA 2DOAA 2E71A 3DU5A 3BPVA 5LBQA 4OMZA 1JDEA 2BQ3A 2VC0A 3KHLA 2XDVA 5DGAA 2HYFA 1KGSA 2V79A 2UXBH 1ETXA 1Z3YA 1MBEA 1ZGJA 1G59A 2YU9J 4KDPA 4AYBA 1IBKH 4XLNF 2W71A 4BE0A 4I4TF 4LG0B 3W3CA 2BQRA 5LA6F 4KISA 1CF7B 3GX4X 4MEXF 3JRIA 1I50A 2O7OA 3T0YA 2XC7A 4EFEA 1N32H 2ACJA 3V4SA 4UCTA 4BACA 1YRNA 4X1EA 4EYHB 5C8YF 3L2PA 2QM3A 3OYNA 1R36A 1CQJB 3RJPA 1XNQH 2F4OB 3MZ8A 3S16J 1JUMA 5D5UB 4ENKA 2NU7B 5FRNA 1ODDA 1B8IA 3EUAA 4HG2A 3PVXA 1TNSA 2CW7A 3M8FA 2RQQA 4CZCA 4NUBA 2K40A 4IZZA 2UWMA 2RNJA 2A5WA 2J6SA 3ONQA 3PQJA 1IJWC 2P5LC 3VMMA 1VFCA 2CUEA 3FMQA 4EJWA 2RREA 4Q8EA 2FMYA 5C4XG 2OPTA 2MC3A 4B3AA 2AO9A 3WTWC 1P6RA 4EV0A 4QWEA 1BIAA 3U1KA 1TWCJ 1O3RA 2K9QA 1S97A 4J9OA 1WI9A 5KFFA 5CVIA 1YQAA 4E7LA 3HIFA 2VUGA 1GVJA 2IVMA 3EDPA 1KQ9A 3FMRA 2X6XA 2O9LA 1ETWA 1NTCA 4PGHA 4EGQA 1SYXB 2M4KA 4J00A 2L9SA 4IHSA 3KP4A 3S3MA 3BTCA 2Q2UA 3O6BB 5C3EG 3HOTA 2QKLB 3RGZA 2F4MB 3HZJA 2JA7G 4A3DG 1GXPA 4RB2C 3CP2A 4B3SH 4D0PA 2HVSA 1UHWA 3EETA 1HXDA 2EQRA 1X1AA 4XX0B 1HDPA 3WHCA 2VXDA 4JI1H 3FXOA 1R1VA 3VPBA 2CKZB 4EGJA 3HRTA 2NU8B 3CVZA 4UY8I 1FC3A 2KMUA 3K5HA 4FCYA 5DLFA 5HNHA 2KJBA 1KJ9A 2VOBA 3HSEA 1TA8A 1WH7A 3BROA 3J7ZI 2R5YB 4LFBH 2L9RA 2QQ8A 4ITVA 1OCCH 2VBWA 2BOLA 1HC8A 5H80A 4QW9A 4M6VA 2ZJRF 1Z9CA 3V4GA 1AA7A 4B4CA 5JFRA 3IH3A 2W9BA 4P96A 1FIAA 4M9XA 4CA0A 3SZPA 4YELA 2K02A 2DIKA 4XONA 2LVSA 1IXSB 3BG3A 1MZBA 1ZLJA 3FMSA 3A01B 5D1PA 1Z2NX 3DTEA 4CH7A 3KP6A 3S93A 4YFKF 2XPVA 4XICA 2LFBA 3TEDA 4DNCA 4J9QA 2XAJA 2XPWA 4IRHA 1T94A 1GHCA 3ASOH 3FWEA 2MYSA 5HDNA 2H27A 4CCMA 2PMZE 5KG5A 3SHFA 2R93G 4ZDPA 5J4VA 1IN6A 2MH2A 2L7KA 3LWBA 2L01A 2QGUA 2P6SA 3ZR8X 1BBYA 3BTIA 3M07A 2YSRA 3S3OA 2AS5F 3HC7A 3R23A 5GONF 5FKLA 1DU6A 4YQWA 2UUCH 4V2GA 1Y0UA 3GO5A 2CW8A 2QENA 4MEYF 3IV5A 4A69C 4BHCA 1R9TJ 3FDSA 3PW5A 1K78B 4L9NA 4HPQA 1YX3A 2E19A 4MQVA 3WU1B 3GFLA 5D5VB 2VOPA 2MCTA 4B43A 1Y1VA 2R85A 2IA6A 1CQIB 3LSRA 5EWFA 2C00A 2I80A 2ELKA 4HOBA 3GTMJ 3CTAA 3MR3A 4F4XA 1V5GA 3RB0A 3H3VH 1XMAA 1VQ9I 5KT3A 2CUZA 1ZRCA 4BEHA 4I09A 2KL4A 5E3OA 2XROA 4I6ZA 2OLSA 4QSHA 1DIKA 4C5BA 2AXLA 2VR1A 2EIJH 4JV2A 3GTMA 2EBIA 5H2FC 3TQNA 2VPLA 4YIFA 4JK1X 1LUJB 2VJ4A 2A69F 5DTDA 2OTLI 5J8FA 4WBNF 5TJJA 1D8KA 2R7WA 1K4SA 4J9RA 2K4JA 2L4AA 2Q2EA 2BXYA 4WXCA 2FPGB 2G0EA 4TV8F 1FWZA 9ANTA 3G6YA 3TIIA 4YBZB 1FLIA 2ZM6H 1B59A 4II3A 4IRDA 2NS8A 3F8FA 3B6CA 4UB6C 1T2KA 3ZMUA 2IP4A 4W1UA 2XB0X 4ZTFA 3U9GA 2DPUA 1Z05A 5FROA 2V26A 3V8LA 1SFOJ 2RQPA 1OCRH 3LNQA 1T0FA 1JKRC 4QWQA 4I55F 4RS8A 3QAHA 3T8RA 1IXCA 1IUYA 1G3YA 4DW6A 3Q8SB 3TW7A 5KFYA 1PVEA 4Q0YA 1FEXA 4Y4RA 3SXYA 4P9FA 4XIDA 3VWBA 3ZMTA 2RF4A 4ECVA 2O61A 5KFCA 1P7IA 2ETHA 3OYIA 3A02A 5KFBA 1SVOA 1M6VA 5KFQA 1VS0A 1FMVA 4HRIA 2JPCA 1U6GA 4BYYA 4IOAF 1GO3E 2HZDA 2ZSHB 1IRZA 1JKOC 3PJRA 4DBRA 4N9IA 3Q0WA 3HOZG 5K7HA 5L3FA 4ZQIA 3UKGA 2OCCH 2CWEA 3RKXA 1OCZH 3LMMA 4IHJF 4QIWA 4NC6A 2NS7A 3H5NA 3I4MJ 2LSOA 3JTGA 3VYTB 2HKXA 4XZ3B 5HLTA 4AIKA 5B1BH 4C2UA 3L1PA 5GP9A 2XV4S 1ENHA 2PBZA 3AFHA 3HSRA 2V4JC 4BXUA 4KIFA 4OU0A 4ASNA 3MWMA 3E6CC 4BXXJ 4APMA 5KFDA 2JUCA 3SEZA 2A3SA 1KA8A 4R79A 2B9SA 3JAMW 4O3OA 2LD5A 2EZKA 1Z91A 4Y7NJ 1IUFA 3FIWA 3G3ZA 3BR3A
chains in the Genus database with same CATH topology
4S05A 3L4JA 5LHIA 3JSPA 4LB5A 4B3TH 1TTYA 5J6XA 4EGZA 2Y75A 1LEBA 1E4GT 4LSXA 1EH8A 3KZYA 3ELKA 1MJBA 4DV7H 3VOEA 3J80W 4L5JA 1XMOH 5D8LB 2K27A 3R6SA 5ILVA 3IHUA 4GO1A 3WE2A 1SAXA 2FBIA 1X9NA 3RYPA 3EYIA 2PMHA 2PI0A 1MJAA 2Z33A 1LEAA 2HFHA 2DI3A 3TGNA 4CO8A 2PQ8A 5KVRA 3RIRA 1OYWA 1DP7P 1ZHSA 2DAOA 2C6YA 1B04A 4A2AA 3FM5A 5TRDA 3C3WA 1FNNA 3ECHA 1SD6A 1YYVA 1IN5A 3R0AA 1R00A 3BJ6A 2B0LA 1XMKA 5FD6A 1SFEA 5CVRA 3RF2A 3EUHA 1KYWA 2UXNA 2XHKA 4HDVA 4PGGA 2YR2A 4OOIA 4AD9A 4NQWA 3WGIA 4G6DA 2RKHA 5D6FA 2L3DA 3MZYA 1I1SA 2OWOA 3B73A 1S29A 1HW2A 1T39A 4M6XA 4U0WA 4J0MA 1LDDA 5JR3A 2HR3A 4NHJA 4OIRF 2BGCA 4FM9A 4LF7H 5K5QA 2HEOA 4KMUX 3F3XA 3P9KA 3RIZA 5ILUA 1XDNA 1SEIA 2EV5A 4JYAH 3N4MA 3R60A 2PJPA 1ON2A 3TDUC 2A6EF 5LEJA 1XMQH 5LMUH 2DPDA 4HX7A 1HNZH 5E17F 2E7WA 3HTSB 4MV7A 1QGPA 4GCVA 2M45A 1YLFA 3V7RA 3E6BA 2QUFA 4KT5C 5JVTA 2HWVA 4LK0F 3I59A 5FD5A 3F6OA 2E7XA 4DR1H 2W57A 3SQNA 2WDTA 4B3MH 4G6QA 4BNCA 2Q0OA 3KCCA 1XD7A 4DR2H 4YHHH 1ZG1A 3K9TA 4GKJH 5E8IA 1QNTA 3DKWA 4LF5H 2V1XA 4DR5H 3GYHX 2JTVA 4XBFA 5HLIA 3HUGA 3TO7A 2IP2A 5LEKA 3OV8A 2UXCH 4ENMA 5HS7A 4EM1A 1B9MA 1KQ0A 2OQGA 5F6FA 1U5TC 3M8EA 2R7FA 3G73A 3MQ0A 3QPTA 3LA2A 1F9NA 1CF7A 3KAKA 2F5DA 2QWWA 3T1BA 5L3EA 1Z2OX 4UFZA 4I2OA 4U7DA 2Y48A 4BAYA 1H0MA 2HZTA 4RGXA 2OQRA 2O0YA 4UCOA 1J59A 3ZQ7A 2VQEH 2Q2TA 3MEXA 3T5XA 3DEUA 2FMLA 3ECOA 1TW2A 4LF9H 2R7DA 3FHZA 1I6XA 4A6DA 2OU2A 4A0YA 1B9NA 3KZZA 1FY7A 1YW9A 4GGGA 4JI3H 1QQIA 1Z6TA 3KEOA 2QQAA 2FNPA 4RZQA 4HAMA 1QO0D 4YIIA 2ZKZA 4Q5SF 1T38A 3Q9SA 2UXXA 4BHBA 3N41B 3DF8A 2XIGA 4L0YB 5DUKA 2PFBA 1I94H 4HF2A 2IJLA 4KIGA 1FZPB 5E1WA 4I0AA 1CGPA 4L18B 3BAAA 1I6UA 2YX7A 5DV5A 4NB5A 2IPQX 1FBSA 3M4IA 4M73A 3H92A 4Y13A 1YFHA 2VOOA 3TDZC 2R3SA 3R0JA 3GFMA 4CZZA 2ZMEB 4XSXF 1X3UA 4ENJA 4A0ZA 4RAYA 4NXNH 3O3KA 1RUNA 1DPRA 5HS9A 4RB3C 3RDIA 5ICFA 3C0FB 2IA0A 3KEQA 1W7PB 2XRNA 3IRQA 5IT9Z 1O3TA 4I02A 1F4KA 4KUMA 5E18F 4PZJA 3BA8A 3R4KA 3R61A 1S8NA 4WCGA 2RN7A 4KHPH 1J2XA 5BMZA 1O3QA 3K3VA 2GXBA 1TQIA 4UVAA 2EFOA 2O8XA 1EH7A 5AONA 3F23A 4B3RH 5J8CA 3CUQC 1XDSA 5IWAH 2A61A 2ZXJA 5A2QZ 3GZ6A 4XRFA 4HF1A 3L9FA 1FYMA 4O6JA 4LF4H 2UUBH 3J81Z 3TOBA 1O3SA 4CC5A 3I4PA 3J80K 2W84A 2Z5UA 1FOKA 4LLLA 5LGNA 4YFNF 1K78A 3LQRA 1IW7F 1R58A 3HSFA 4IXAA 1YS7A 2YU3A 1DUXC 1DDNA 1G6NA 1FPQA 3F8CA 4JI2H 5D4SA 2VODA 2HYGD 1WH2A 2ZJTA 3DP7A 4LSAA 3BP8A 4LH6A 1TAEA 3T1HH 1IAWA 5BPDA 5BOXA 1IN4A 3K0LA 4CICA 1BI0A 2OAZA 1A0IA 2ZO4A 3NRVA 3WU0A 4OIQF 3MFKA 1XSVA 1SMTA 3FX3A 4DR7H 2XKOA 4HQEA 2EV0A 2ISYA 4GKKH 2EFNA 3BA9A 2DW4A 4LJZF 4EGYA 3J81K 4I98B 4MTDA 3E6DA 4UXNA 1O7FA 2OD5A 3LAJA 1KU9A 2VBZA 1TQMA 2Z3YA 4KA4A 4A12A 3J81W 1G3WA 3MAJA 4FX0A 4BHPA 4G94A 2D45A 3L00A 4Q47A 4GLXA 1F5TA 3U2RA 1B1BA 2HTJA 3ISPA 3VB2A 4DV1H 2EJRA 1FYKA 2G9WA 4R8HA 3LAPA 4M7EA 1N36H 4AIHA 3HXLA 2COMA 2RVCA 5L3GA 3ABTA 4GYGA 3GEZA 2PBIA 2DTRA 2HGCA 2FSWA 4IF4A 1D8JA 5LRSA 2QBYA 1G3SA 4PCQA 3KETA 4EM2A 3WODF 5D1OA 4MV9A 4HYEA 2CW0F 2XASA 5HLHA 1TQPA 1FSHA 4B09A 3ML6A 5CJ9A 3ZMVA 2RGRA 5HDGA 4F7ZA 1OYIA 4WK8F 3M9AA 3E5XA 2D1VA 4RB1A 1MDMB 1S3JA 3N6XA 4RGRA 1OKRA 4UHTA 4DV4H 4UVBA 2G7UA 2ZFWA 4WX9A 1IRFA 3U1DA 4AWXB 5H20A 3L2CA 1HKTA 1P4AA 3FXUA 1QPMA 1P2FA 3W6JB 2STWA 3EQLF 3ZPLA 4AQYH 3JAMZ 3F8NA 5LHHA 4JI4H 4FT8A 2M5WA 1WRJA 1E17A 4M6YA 4HX4A 3ZMZA 2E1CA 1H9TA 5D5WB 5DCMB 1JXSA 4X64H 2GIVA 1XCBA 2H09A 3SZTA 2MH9A 1BGWA 3J7AO 2QYOA 3WE3A 2WV0A 4UNOA 5D8KB 3IL2A 2X4HA 2FOKA 4A6EA 3IRRA 2QLZA 5IT3A 4B8XA 3PN1A 3J7AK 2DK8A 3E6MA 3KLOA 1ZG3A 4CYDA 4WF2A 1BN5A 2ELHA 3ROUA 4A5NA 2Z9OA 4RB0A 4JI5H 4LFUA 4IPAA 2YCHA 1U2WA 2PEXA 4EQQA 2XAQA 4LFAH 4MTEA 4AVPA 1UFMA 3JAMK 5LMNH 4U88A 3WG9A 2MA3A 3IC7A 3BJAA 3LFKA 3T8TA 3FZVA 2PLYA 3HRMA 3RKYA 2FU4A 1FSEA 3I64A 1V4RA 2LDUA 3COAC 5BS6A 1ULYA 3ZN1A 4EMSA 3HRUA 4ESFA 2OBPA 2HOEA 2HGSA 4JI0H 1BC8C 1A04A 1WWXA 3IKVA 2UZKA 1HSTA 1RUOA 2VT2A 3ABUA 2UU9H 1R5GA 4DR6H 1V3FA 4MNUA 5ICCA 2TDXA 3W6KB 1QBJA 3QP6A 1WQ2A 3WGGA 2DLLA 2HQRA 2QQ9A 4IHTA 3D0SA 2ZCWA 4L0ZB 1JHHA 5DYMA 2EK5A 5EEHA 1Z7UA 5E8GA 5ED4A 4LB6B 3ZN0A 1LDKB 1V9PA 3GVAA 2YX4A 4BH9A 1R5HA 4DV2H 1ZG5A 1EH6A 3BOQA 4KICA 5EEGA 3JTHA 3B02A 4DV0H 5L3CA 2STTA 1W5SA 1JGSA 3IKTA 4KN7X 1KYZA 3BPXA 1ZHFA 2KKOA 4QLCU 2RGVA 2K4BA 1IF1A 1M0TA 4Q48A 2M87A 2ADUA 3F22A 4R1HA 1ZN2A 1FX7A 3JSNA 1T6SA 4X62H 3D5LA 4DQ2A 1F1ZA 1B4AA 5LHGA 2IT0A 4NXMH 2P7VB 2P4WA 2DFIA 2JRTA 1ONVA 4M9SA 2GWRA 1P92A 2KIUA 3F8MA 2M30A 4KNYA 3PFIA 4IRGA 1SD5A 3DPTA 2NRAC 2BE5F 4UCSA 3CJNA 4A0XA 5FO5A 3L4KA 2JPBA 1XGSA 1ZREA 5DD4A 4ESJA 4L9JA 2D1HA 3HYIA 4A5MA 2LF7A 1M0WA 1ZHQA 3LWFA 2ZBKA 4HF0A 4ZYGA 2EFQA 4L9VA 4AIJA 4I7HA 3KALA 3GLXA 2H94A 2V1DA 4X65H 4I01A 1ZRFA 1FBUA 3DXJF 2NAZA 2XKPA 1N33H 4RGSA 4JV5H 3H3UA 4UV8A 3REOA 2F4VH 3VFZA 1I5ZA 2KRFA 4EJTA 1KU3A 3I71A 4P55A 1QZYA 3KFWX 4L5IA 3I53A 1MDMA 1D5VA 3BJOA 4UCVA 2OA4A 3WTTC 4N0BA 3GFIA 4LH7A 2DT5A 3TO6A 3AAFA 2NNYA 4EJOA 1YW7A 3N44B 2GAUA 1FYLA 1U3EM 1LQ1A 1YO5C 1BM9A 4OMYA 2JSCA 1PP8F 3N40P 1SFXA 3H20A 4UV9A 1E2XA 4I0BA 3K69A 5FLXW 3QOPA 2F5CA 4DR4H 4A2UA 4KFCA 2WTEA 5HLGA 1TW3A 1L0OC 4IVNA 2HHHH 1BJTA 1U5TA 2GA1A 2A5YB 4K2EA 5H6RA 4HBLA 4CGZA 3MZHA 3SFZA 3LA7A 1BOAA 1UHMA 1MKMA 1L2ZA 1HSJA 2GQQA 4G7ZF 4FHTA 4G8XA 2J5PA 2A68F 5K1YA 3HOSA 4LF8H 4M9ZA 5HS8A 4P9UA 1SMYF 3RTXA 3I54A 1W4MA 4HLXA 5HDKA 1K7AA 3RJ0A 4HDUA 3K1PA 5FPRA 4TV7A 3V7SA 4PDKA 1TNTA 4HQMA 2IRFG 2L02A 4YG2F 3BZ6A 3P9CA 2Z99A 3V8KA 2W85A 5F1RA 2M1BA 4MGRA 5A2QW 5D4RA 1FKAH 4BQAA 4LG0A 5LRRA 3RI4A 5FLXZ 2D2WA 1ZARA 5FPOA 2DQLA 4IAJA 3S2WA 1S7OA 5CVVA 1Z6RA 5BPIA 3QU3A 2OZ6A 2V9VA 2K86A 1U8RA 2ISZA 1BI3A 3IG0A 1LJ9A 3FM3A 1O57A 2KIMA 1YW8A 3LQQA 1U5TB 2EWNA 4ENNA 4HW0A 1EV7A 2P5VA 1MD0A 2H6CA 3M1EA 1OR7A 1FVIA 1W7PA 2MBFA 3I5UA 5EOYA 3DPLC 2IW5A 3WTYC 2O3FA 3JW4A 1AN7A 3BY6A 1S7AA 2VBXA 5F64A 4Y15A 4U7BA 5KK1A 2JT1A 3QPHA 5FLXK 2XAHA 1O75A 3V7CA 1STZA 3RGXA 1T98A 1J0RA 2HKOA 3FXQA 2VC1A 2FE3A 2LNBA 2L4MA 3OOPA 5ILSA 3RPQA 1REPC 1ON1A 2VN2A 3ZP5A 5LLQA 4KN4X 1USTA 2FA5A 1ZYRF 1XGNA 3BDDA 3O2PE 5E1XA 3BWGA 5BQTA 4UCUA 2HVQA 4IRIA 1MJ9A 3K1NA 3KP7A 3N42B 5E20A 4HA8A 4DR3H 3NEUA 1BI2A 1BJAA 4UCRA 1XNRH 3VODA 4M74A 2HTSA