4I7HA

Structural basis for peroxide sensing and gene regulation by perr from streptococcus pyogenes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
147
structure length
147
Chain Sequence
DIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVCEICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords peroxide stress sensing regulator
publication title Crystal Structure of Peroxide Stress Regulator from Streptococcus pyogenes Provides Functional Insights into the Mechanism of Oxidative Stress Sensing.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transcription
total genus 38
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4i7hA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4i7hA02
4A6EA 2PMHA 3WE3A 3HRSA 1R36A 3GX4X 2EA2A 3R4KA 1YS7A 5LBQA 3WG9A 2G7HA 5EEHA 4MQVA 3JSOA 2EA4A 2XASA 1QQIA 2NAZA 3ML6A 3WTUC 2P5LC 2R7FA 3CJNA 4M9ZA 5ED4A 5EEGA 2FU4A 2RGVA 3RYPA 1G3YA 2QQBA 3E5XA 4YFXF 1AOYA 4KMUX 1FT9A 1O3SA 3TOAA 3BROA 1RNLA 2OZ6A 4IVNA 4AWXB 3O6BB 4GXOA 3WGIA 5LLQA 2RN7A 3IC7A 1R1VA 4BH9A 5L3EA 3V8LA 5IT3A 1Z91A 5AIPA 3BJOA 1D5VA 3EYIA 2FF4A 5ERIA 5D6EA 1T38A 3ECOA 5CVJA 1X3UA 2CO5A 2NNNA 2YSRA 3F3XA 2DLLA 4OIQF 3QP5A 3CDHA 3WTVC 4RAYA 3NRVA 5JR3A 4KT5C 5LEJA 4PCQA 4NQWA 2DTRA 4G94A 5LGNA 2VOOA 6PAXA 1T98A 3J81K 4GO1A 3HOTA 3T8TA 1TTYA 5BMZA 2PMUA 1Q1HA 3FXRA 4P96A 4RGXA 2DFIA 1SD6A 5FFZA 1HSTA 1HW5A 4PGHA 3LQQA 3KP2A 1LDKB 2ISZA 3ZMUA 2WV0A 4IHTA 2FNPA 1FSHA 3DXJF 2HYFA 2QYOA 3E5QA 3E6DA 2HTSA 1PUEE 2LF7A 1SFEA 2EFPA 1YIOA 1W7PB 1UHMA 5K1YA 2STTA 3FXUA 1J59A 1H9TA 3OOPA 1WRJA 4LLGF 3M1EA 2JTVA 4E70A 2ZMEB 5TJJA 3I5UA 2VONA 2VE8A 4WCGA 4CHUA 1ZH5A 1XCBA 2L4AA 1Z05A 1UHWA 3E6BA 3TDZC 3GVAA 2MH9A 2XKOA 5JVTA 3GZ6A 3QOPA 2K7LA 2E7XA 3M9AA 1ZRFA 3OV8A 3Q5FA 3CUQB 2Z99A 2K86A 2VBZA 4M71A 5D5UB 2W85A 5CVUA 2QBYB 3G3ZA 2COMA 1ZGAA 1YG2A 1RUOA 4UVAA 4L9NA 5L3FA 2GAUA 1E2XA 1D8KA 2VXZA 3MZYA 5ICCA 4ENNA 3QPHA 1KU7A 3TKYA 2PLYA 4EQQA 1TQPA 4JBAA 5E1ZB 1U78A 1I1GA 3ZMZA 2UXXA 5LHIA 4L9JA 2MLGA 4HDUA 3H3ZA 2QENA 5BPDA 1LEAA 2M5WA 3FMSA 5DCMB 1FBSA 2DU9A 3LQRA 5KK1A 1SAXA 1ONVA 2QUFA 1BC7C 4Q5SF 3EYYA 3HTUA 4O5VA 1MDMB 1IF1A 3I58A 1TBXA 4AVPA 3I0TA 4BHPA 2IA2A 5D8KB 4G9YA 1MD0A 3BWGA 5D8LB 4KIFA 5CJ9A 2ZJ2A 3CO7C 5F64A 4IJAA 2V1DA 1XSVA 2IT0A 4U7BA 4OIRF 3HHHA 5FLXK 4OIOF 2X4HA 2XV4S 5CVVA 5K5RA 4ZYGA 2O8XA 3TO6A 5BQTA 4EM2A 5HDGA 4MTEA 4BQAA 4RB2C 1OYYA 2L01A 2DQRA 5E20A 2LF8A 2M87A 3KEOA 3GW2A 2C6YA 4P55A 4MNUA 5E8GA 3O3KA 1OMIA 4ZYDA 1R5GA 5JHUA 1S29A 1G3TA 1TW2A 5HOOA 4GYIA 1XMAA 4N0BA 1KQ0A 5JI6A 2ZO4A 2HEOA 5BPIA 4L5IA 3R6SA 2HS5A 2VBYA 1DPUA 3CUQA 4I01A 2J5PA 5DYMA 4BNCA 1FP2A 3M8FA 5AONA 2STWA 3BDDA 5BS6A 4WXDA 3V8JA 1TNTA 4LD5A 3ZMDA 2QBYA 2P7CB 2V79A 2P7VB 3E97A 3GFLA 2MD5A 3CLOA 2QM3A 4KDPA 3IWFA 5AIQA 1R23A 3GFJA 2RNJA 1I27A 3B73A 4HF0A 3T8RA 1ODDA 2IA1A 3L09A 5E1WA 1OKRA 5J8FA 4CDGA 2JT1A 1V3FA 2QQ9A 2Z5UA 5DCMA 3HSRA 1DUXC 3LA7A 3F23A 1ZLJA 3C7JA 2FMLA 3GFMA 5LRSA 4EGYA 4G7OF 5E17F 3KP3A 3BOQA 4UV9A 2GWRA 3RYRA 1LB2A 1MDMA 3SXYA 5ICGA 1J0RA 5A2QZ 4WK8F 5ILUA 2VODA 3K0LA 4RS8A 2OU2A 2DQLA 1EH8A 3KP6A 1B9MA 3F8CA 4EJVA 2GQQA 2A6EF 1QGPA 3LAPA 3KP4A 2V1XA 3W6JB 1ZREA 3E6CC 3EDPA 5L3GA 1GXPA 3F6OA 1BOAA 2Q2EA 3FXQA 2OBPA 5D6FA 4I98B 4GGGA 5HVQC 2HZTA 1KYZA 1FSEA 2OQRA 2VBXA 4ASNA 3WTYC 2CGPA 2XRNA 1TW3A 4NB5A 4LLNA 4L5JA 1MJAA 3JTGA 1J7KA 1LJ9A 1FC3A 2PG4A 1BI2A 2FNAA 2HYGD 4LMYA 4A0ZA 3IWZA 2VC0A 4LB6B 2XAFA 4L9VA 5L3CA 2JPBA 3K1PA 1SFUA 3MQ0A 2O03A 2DBBA 2P8TA 1XD7A 3P7NA 3F72A 2W84A 1UB9A 1P6RA 2CW0F 2EJRA 2Q8KA 3TOBA 4A6DA 3HHGA 4CYDA 3K1MA 3QU6A 2P6TA 2F5CA 1EV7A 4HF2A 1DPRA 3EQLF 3HTSB 5A2QK 4D0PA 5DD8A 2HQRA 3C1DA 4BAYA 1G3SA 1V4RA 3ABUA 2ETHA 2V1UA 4H0EA 4OU0A 4WXHA 1FYMA 3MWMA 4WWCA 2NS0A 4ENJA 4Q4ZF 2D45A 1U5TB 1ON2A 1GVJA 2H6BA 2LKPA 4MQ9F 2RDPA 1B4AA 3WTSC 2HWVA 5LGUA 1K78B 4ZZLA 2DW4A 1D3YA 3W6KB 3GLXA 4KUMA 4A0YA 3BJ6A 1WWXA 2D1HA 4LG0B 1ZRCA 4OMZA 4KMFA 4YFKF 2HKOA 3I59A 1FNNA 4LFUA 4ZZDA 4FX4A 1BC8C 3ZN1A 2D1VA 4UXNA 1S7OA 5FO5A 1BI0A 1KQ8A 4OMYA 2MH2A 5J8CA 4CXFA 4HX8A 2G7UA 2MC3A 2YPRA 4LGWA 3DF8A 2NYXA 3RIRA 4S05A 3TQNA 3IL2A 1PP7U 2DAOA 4CICA 3BZ6A 4RGRA 4I7HA 5J6XA 1J2XA 1R00A 4ESBA 1SD4A 3GF2A 3VODA 1H0MA 4R79A 3RDIA 2DPDA 2TDXA 4U88A 1BIBA 2F5DA 4UV8A 4ZH4F 1YS6A 1B6AA 1E17A 3IKVA 1KGSA 2UXNA 1KYWA 2P4WA 2VT2A 2UZKA 3ZMVA 3L7WA 4ON0A 2ELHA 2EV0A 1W5TA 3T5XA 1IN4A 3E3VA 1SD5A 4UNOA 4P9FA 4ESJA 5DV5A 3DFGA 1R1UA 2HR3A 3F8NA 2DPUA 3GWZA 5CLSA 1BI1A 1FX7A 4RGSA 5H6QA 3H3UA 3Q9SA 2BGCA 4U0WA 2ZXJA 3JSPA 4F7ZA 4AIHA 3LSTA 1R5HA 3DV8A 1HXDA 2EWNA 4LJZF 5CVIA 1HKQA 5F1RA 4AIJA 1U5TA 5CVRA 5E8IA 1QO0D 2M45A 4HBLA 4G7ZF 3ROUA 2EB7A 3DP7A 4A2UA 3WGHA 1K78A 1O57A 3H92A 4BHCA 2QZ8A 1TQMA 3FF5A 5LHGA 4EGZA 2Z9OA 2XVCA 3LWFA 3P9KA 2V9VA 4HZFA 2DT5A 1IZ1A 4LG0A 2FEZA 4G6QA 5HS9A 5FD5A 3D5LA 2L3DA 4M9XA 3N4MA 3J80Z 4FX0A 3O2PE 4XLNF 5HDKA 1ZHFA 1NHAA 4B09A 1XGSA 4XLPF 3BPVA 3ZQ7A 1IXRC 1ULYA 5DD4A 3HRUA 1IN6A 1IXCA 4LK0F 5D4SA 1T6SA 2OAZA 3KZYA 1FWZA 1ZAOA 2PBIA 3FM5A 5DDGA 2E1NA 2Y48A 1BN5A 4I0AA 2ZFWA 1F4KA 2NNYA 4KICA 4R1HA 4HQMA 4WF2A 3WU0A 3IRQA 2DO7A 3LA2A 2KJBA 4RGUA 4ENMA 3C3WA 3T1BA 3I64A 3M7GA 3S2WA 3F21A 1KQ9A 4LK1F 2VE9A 4LLLA 1U6GA 1QBJA 3QU3A 1MGTA 3FMRA 1XB4A 3KLNA 2W25A 4A5MA 4YIFA 4Y15A 3K9TA 3BY6A 4KYWA 3HRTA 1W7PA 3LFKA 3FMQA 2LSOA 2BE5F 3WODF 1EH6A 4M74A 1B1BA 2ZMEA 1HKTA 3ECHA 3PFIA 3DPTA 3MAJA 1XN7A 4AD9A 3MEXA 1ZYRF 1YW9A 2KIUA 1ZG1A 1ZG5A 3I4PA 2M8EA 1PP8F 2BV6A 4QWQA 1JHFA 3RI4A 1JXSA 1OYWA 3B02A 2H6CA 5H6RA 1BJAA 3RKXA 1QZYA 3LA3A 4IXAA 3SHFA 2FBKA 2F5FA 4PZJA 3NEUA 4OIPF 1BI3A 2A6HF 4YG2F 1LVAA 2PEXA 1FY7A 2GXGA 1ZGJA 2OD5A 2FA5A 1K7AA 3SZPA 1IN8A 1USSA 2KJCA 1O7LA 4HQEA 3SQNA 4YFNF 4M9SA 1FYLA 3R60A 4IHSA 4FT8A 5HLIA 3JW4A 4HLYA 3ZPLA 1REPC 4O3MA 2H94A 5LRRA 1ZRDA 4U0VA 1XCVA 4HV5A 1FOKA 2E1CA 4KN4X 4B8XA 3V7RA 4IRIA 1Z7UA 1W7PD 3WU1B 2OZUA 2CFXA 1W4MA 2JPCA 2L4MA 4HW0A 4L0ZB 3BP8A 4BXUA 5ICFA 1DP7P 2L54A 3MFKA 2VN2A 1WI9A 3IKTA 2BBYA 1YO5C 2O0YA 5K5QA 2XKPA 3E6MA 1YYVA 1YTYA 4MEYF 2HFHA 3M8EA 2YR2A 3KLOA 3KETA 2ADUA 4KFCA 2NRAC 2EFNA 1FLIA 4PGGA 3E5UA 3EETA 3BPXA 4M72A 2DK5A 4WXCA 4HOBA 4EVIA 4L0YB 4OINF 2IVMA 4EM1A 1RUNA 4G7HF 3RPUA 3RTRA 3JAMZ 2XHKA 4XSZF 3F8FA 1J75A 1LEBA 3NQOA 1T0FA 2O6GE 4CGZA 4EJTA 1JHHA 2KRFA 4I0BA 4U0YA 2HQNA 3WE2A 4O6JA 4ETSA 3MCZA 4UVBA 4CO8A 1AWCA 2XGXA 2A61A 1P4XA 1MKMA 1K6OA 1KU3A 2EK5A 3V7CA 2O3FA 5JFRA 2JRTA 2DI3A 3RKYA 1OPCA 1P4AA 1XSXA 1PDNC 2ISYA 2B0LA 4BYYA 1RZ4A 4RB3C 3DEUA 3PQJA 3F8MA 2W57A 4Q47A 4EJOA 2FOKA 1FYKA 3TDUC 2X0LA 2KIFA 2HOEA 1DDNA 4A12A 1QZZA 4N9HA 5L3DA 2LNBA 2YX7A 4A0XA 2IJLA 1I5ZA 4RAZA 4AIKA 2H09A 1IXSB 1LDJA 4HLXA 5F6FA 2ZCWA 4UHTA 4Y17A 4CZZA 3U9GA 1FBUA 2IPQX 3U2RA 4L9TA 2QQAA 3I71A 2ZNZA 3FM3A 4R8HA 1SMYF 2XAQA 3WTZA 2A3SA 3V4GA 1XSDA 3K1NA 3KEQA 3AAFA 2MBFA 2OQGA 3ZMSA 1BM9A 3ZN0A 3JAMK 1WQ2A 2FQ3A 2R3SA 1LQ1A 1MZBA 1R7JA 2CG4A 3LAJA 1SFXA 4WX9A 1YQAA 4GYGA 4KIGA 3Q9VA 1HQCA 1XGMA 1J9IA 2G9WA 2W24A 1ON1A 3P9IA 2VC1A 3REOA 1YFHA 2D2WA 2HKXA 2WC2A 1IN5A 1D8JA 4HA8A 2EFWA 4XSXF 1O3QA 1O3TA 4MGRA 2CYYA 1MJBA 3COAC 3R61A 2H27A 1TLHB 1HW1A 2LDUA 2JZYA 2BYVE 1Z6TA 4KA4A 3N97A 3RKWA 2ESNA 4EJWA 4KIBA 2BEOA 3IRRA 3PQKA 1Z1DA 4LB5A 3DPLC 4UUVA 4K2EA 3VEPA 4HAMA 3F22A 4OOIA 3ULQB 1ZG3A 1S6LA 1Y0UA 3I54A 4YIIA 1O3RA 1P4WA 4G6DA 4XBFA 4I02A 4EJUA 4U7DA 5ICEA 5D5XB 5K5OA 3KCCA 2CSOA 1W5SA 2RV8A 2ZKZA 1P92A 2RQPA 1IN7A 3L2CA 2GZWA 5FFXA 1OYIA 1P2FA 4M6YA 1IRFA 1OR7A 2EFOA 2YU3A 4RB0A 4EM0B 5FLXZ 2HTJA 4MEXF 3WGGA 3F6VA 5ILVA 2PN6A 3R0AA 1HKSA 3ABTA 1FBQA 5TRDA 2Z33A 3GUDA 4L18B 1R58A 5IT9Z 1IRGA 2FSWA 1KU9A 4Q48A 4KN7X 2O61A 2GIVA 1USTA 2F5EA 1FP1D 1CF7B 2FMYA 3QAHA 2PI0A 4MTDA 5HLGA 3RJPA 3V7SA 5HS8A 1XDSA 2Q0OA 1CGPA 3J7AO 5L3BA 3JTHA 2CQKA 1G6NA 4HDVA 5DCFA 2HDCA 2FBIA 4TV7A 4I2OA 4KNYA 2A07F 1U5TC 3FHZA 3V8KA 1F9NA 5DEQA 5ILSA 1G4DA 1R1TA 4N9IA 1HBXG 1WKMA 4EV0A 1A04A 2XUBA 1O7FA 3KZZA 3TO9A 1L0OC 1U2WA 3GZ5A 3CTAA 3DQVC 1XMKA 1U3EM 1HSJA 1YLFA 1C0WA 4ENKA 2WTEA 1B59A 2VBWA 2VOPA 1QPMA 1QNTA 3C18A 2XIGA 1GXQA 5FB2A 2Y0MA 3GEZA 1UFMA 4M6XA 4MHGA 4Y13A 3KP7A 1TNSA 2YX4A 2MA3A 5BOXA 3IHUA 4ZYHA 4UVCA 1RI7A 2PFBA 3DKWA 4HYEA 3KP5A 2AS5F 3P9CA 5IT9K 2P5VA 3GXOA 1IAWA 3HIFA 2GA1A 1J5YA 1IUYA 3I53A 1XDUA 2FBHA 1YW8A 2Y75A 1I6XA 1KA8A 1ZN2A 3HSFA 1R22A 1H9GA 3ELKA 3EUHA 3J80K 3K69A 3KE2A 2EV5A 4HX7A 2DK8A 2M1BA 1S7AA 3VOEA 1CF7A 1SD7A 2E7WA 3F8BA 3VFZA 1JE8A 4DNCA 1I1SA 1BBYA 4IRHA 2P5KA 2KKOA 4PDKA 4M73A 2ACJA 2FE3A 2K4BA 1F1ZA 2FRHA 3RPQA 2F2EA 3U1DA 1G3WA 3T0YA 5DUKA 3QP6A 3TO7A 2MLKA 4Z2YA 3HSEA 2JSCA 2XROA 3WTWC 5FD6A 3ISPA 4JQFA 3WTTC 2IRFG 3R0JA 3L9FA 5LGTA 5D5WB 2R7DA 4S04A 3CUQC 5DUIA 4HV6A 2PQ8A 3HOSA 2XAHA 2KIMA 3HUGA 3FWEA 3HRMA 4FHTA 2GXBA 5CYVA 4DQ2A 4BHBA 3HYIA 4HF1A 3QPTA 1EH7A 1XGOA 4ZYEA 3D0SA 2IA0A 1FZPB 4I09A 1F5TA 4IF4A 3KFWX 3MZHA 1L3LA 1GHCA 5HDNA 3CO6C 3SFZA 1WSUA 5FGMA 1XGNA 1HW2A 2GA2A 3VB2A 4P5OA 2L02A 1ZARA 2UWMA 1B9NA 4G8XA 2P6SA 2RVCA 1VTNC 2RC4A 1T39A 3ERED 3WTXC 4IPAA 1S8NA 5HLHA 1U8RA 4NHJA 3I59B 4IRGA 2QVOA 3QRFF 3TGNA 2A5YB 2J5OA 2A68F 5E1XA 2AXLA 2RKHA 1T2KA 4RB1A 4XRFA 1LDDA 1UCRA 2ESHA 1JGSA 3CUOA 3FX3A 5HS7A 4HX4A 4A5NA 5LHHA 5D4RA 2VT3A 5H20A 1SMTA 1BIAA 3G73A 3FZVA 2M30A 3ZP5A 2K27A 4QLCU 5LEKA 3K2ZA 1STZA 2Z3YA 2A69F 5E18F 1Z6RA 2FXAA 3GFIA 3SZTA 2QLZA 1Z9CA 1LNWA 4GCVA 2EV6A 3GYHX 1S3JA 1K79A 2CWEA 2OA4A 1IW7F 3L00A 5D5VB 2PJPA 3BJAA 2HGCA 1YW7A 2WWYA 2XAGA 2IP2A 2ZNYA 2IW5A 1ZLKA 2K4JA 5KVRA 1TQIA 3GO5A 2K02A 3J81Z 2XAJA 2V6CA 2EFQA 1FPQA 2QWWA 2ZBKA 4P9UA 1RIOH 1MJ9A 4EMSA 3ZMTA 4ESFA 4JK1X 1KU2A
chains in the Genus database with same CATH superfamily
2VQGA 3OS2A 2DPIA 1T36A 4A6EA 2PMHA 1LUJB 1RK6A 2W6MA 2HQAA 3WE3A 3MFIA 4CC6A 3HRSA 4PFPA 1R36A 4C2MA 1PUFB 3GX4X 2EA2A 3R4KA 5E3MA 1YS7A 3G1OA 5LBQA 3OOUA 3WG9A 4YP3A 2G7HA 1VQKI 2DFHA 3QYBA 5EEHA 2L0KA 4MQVA 3JSOA 2CUEA 2EA4A 2XASA 4FTHA 2HOSA 4BKXA 2KDZA 2Z2SB 1QQIA 1TWHJ 1IOWA 3TL4X 1B33N 4IRKA 2NAZA 1P8LA 4X64H 2MYSA 3ML6A 4ANJA 5DS9A 3WTUC 2AGPA 2LTPA 1MMGA 4EEQA 2CKZB 2P5LC 2W6PA 3LSMA 3DKXA 2VB6A 2R7FA 3B6CA 3CJNA 4M9ZA 4XKBA 4DR6H 5ED4A 5EEGA 2FU4A 2RGVA 2DOAA 3RYPA 3D1NI 3DTKA 1G3YA 3VPRA 3CCQI 2QQBA 3E5XA 1GO3E 4TUYF 1K83A 2ELKA 1B6SA 2W9AA 2C35B 3QZ8A 4YFXF 1MBKA 1AOYA 4KMUX 3DWLE 3CCMI 1DU6A 2BR0A 2DMUA 2QSGX 1FT9A 1O3SA 3TOAA 2VKDA 2OV7A 3KIOA 2E71A 1D0ZA 5EEAA 4J9SA 3BROA 1MMDA 2R5ZA 1IDYA 1RNLA 1X58A 2OZ6A 4IVNA 2EZLA 5K2MA 1RYRA 4AWXB 3CESA 3PJRA 3O6BB 2E2IA 4GXOA 2DMQA 5LLQA 2RN7A 3WGIA 3JRWA 3PIOF 3P5JA 4XLCA 3MFHA 4CCOA 4G6TB 2V4QA 3GTKA 3RB4A 1LFBA 3GTGJ 3IC7A 3PM1A 1R1VA 4BH9A 5L3EA 4A3BJ 3V8LA 4E7HA 3G2BA 2ICWG 5IT3A 1Z91A 5AIPA 3BJOA 1VQ9I 4J00A 3I12A 2GXAA 2ZXHA 1D5VA 3EYIA 1S5LC 2BOLA 3Q0WA 5KFZA 2O8KA 2FF4A 5ERIA 5D6EA 1B72B 1T38A 2GBYA 2DMTA 3ECOA 4C30A 5CVJA 5F0FA 4B1RA 1X3UA 5GAEJ 2VJ4A 2CO5A 4FQGA 4N4OB 2AO9A 4EFEA 2DA2A 2FOWA 1VQ7I 4MFDA 2NNNA 2YSRA 3F3XA 2DXIA 3CDLA 5LMNH 2DLLA 4LSAA 4OIQF 3QP5A 1I7NA 3CDHA 3WTVC 4RAYA 3NRVA 3S8PA 4OAZA 5JR3A 3KTMA 4KT5C 4QJFA 1FOWA 2VQEH 3JRAA 2W6QA 5LEJA 4PCQA 3TW6A 2R92J 4NQWA 5FRMA 5EDWA 5A2QW 2ZJPF 5GTIC 2DTRA 4G94A 1FKAH 4CCNA 5LGNA 2VOOA 6PAXA 4F52A 1T98A 2WAQN 4XLFA 1SAUA 4IZOA 3RTXA 3EPGA 1K83J 5F0HA 2VL8A 2JA8G 4J9QA 3J81K 3PIPF 3DF7A 1X3WB 2R7WA 3MD2A 1WJEA 1D0XA 4GO1A 2ALZA 3HOTA 3T8TA 1TTYA 2K5CA 5BMZA 2R85A 2PMUA 3DCFA 1JX4A 1Q1HA 4A3EJ 4IHXA 3FXRA 2VQCA 4P96A 4RGXA 4AVZA 3CCSI 4A3FJ 4BY1G 1BXRA 2DFIA 2E2IJ 4BGDA 1VBHA 1SD6A 5FFZA 1HSTA 1KONA 4M3FA 3KYDB 5TGTA 1HW5A 3GTKJ 2VKVA 4PGHA 2Q2TA 2YW2A 4ZDOA 3LQQA 2MGQA 1LDKB 3KP2A 3AG2H 5B3SH 1JXLA 4YIRX 2ISZA 1JUSA 3ZMUA 2WV0A 4IHTA 2FNPA 1GSAA 1JJ6C 1FSHA 4KJZA 3DXJF 2HYFA 2QYOA 3E5QA 3E6DA 4ECXA 2HTSA 1S03G 5DM6F 5FROA 1PUEE 2LF7A 3C0FB 4C5AA 1SFEA 4DOZA 4E7JA 2EFPA 4Q0YA 2B9SA 2IGNA 2FLNA 1SCUB 1VS0A 3G8CA 1YIOA 1W7PB 1UHMA 3K7AJ 5K1YA 1VQMI 3UNGC 2STTA 4LFAH 1IO2A 3FXUA 1MSFC 3RAXA 1J59A 1H9TA 3OOPA 1VQ4I 5BPFA 3BQ1A 1WRJA 1VZ0A 4LLGF 3M1EA 2JTVA 4E70A 1Y1VG 4A3DG 1J5EH 3CC2I 2ZMEB 4LF6H 1NG7A 2Y2ZA 1EZ1A 1FJGH 5TJJA 3I5UA 2VONA 2VE8A 4WCGA 2R8KA 4CHUA 1ZH5A 1XCBA 4XLAA 3SEQA 1FMVA 2L4AA 3QZ7A 2UVRA 1Z05A 1UHWA 3E6BA 3TDZC 3GVAA 2MH9A 2XKOA 5JVTA 3VYUB 2JSPA 1W0TA 3GZ6A 1ZR2A 4XKVA 3VDXA 3QOPA 1WZ2A 4LFBH 2I10A 2K7LA 2TRTA 2E7XA 2UU9H 3M9AA 5B5EC 1ZRFA 2GOXB 4HQ6A 1O75A 3OV8A 3Q5FA 1ULZA 1TAEA 1X1CA 3CUQB 4J9LA 3H3VH 2BHYA 3OYAA 1S10A 2Z99A 2K86A 2VBZA 3GTPA 2WY7Q 4M71A 5D5UB 4PUSA 4BWSC 4EBEA 2QK4A 4PSXA 5D1PA 3BAAA 3ZQLA 3R5FA 2LR8A 2W85A 5CVUA 3N05A 1TWCA 4M6VA 3OMYA 2QBYB 3G3ZA 3IAM2 3BCAA 2ME6A 3QPSA 2COMA 1ZGAA 3WO1A 4O4IF 1R6RA 4X0GA 1YG2A 2W9CA 2G0EA 1RUOA 5FLVA 4UVAA 4UFZA 4G12A 4XM3A 4L9NA 1UJ8A 5JH7F 5L3FA 2GAUA 1E2XA 1D8KA 2VXZA 3MZYA 5ICCA 1XMQH 5J47A 2ELJA 2LY2A 4ENNA 2K9LA 4BQOA 2FD5A 3QPHA 1KU7A 2DA4A 1Y1VA 3TKYA 4DR3H 2OC6A 4BDYA 4QIWE 4DL6A 5HNHA 3RGZA 2PLYA 4EQQA 1NG6A 1B72A 1TQPA 4ECZA 1X1PA 1OR7C 3MR2A 2C2RA 2R8JA 4JBAA 5E1ZB 1U78A 4Q8FA 1I1GA 3C2BA 3ZMZA 1OQYA 2UXXA 3K5IA 3A03A 2F4OB 3JRGA 5LHIA 4RUCA 2NVQJ 1KC7A 4L9JA 4B4CA 4YR0A 4DV7H 5DTDA 4J9PA 1FTZA 1JKJB 2MLGA 4HDUA 3TINA 3H3ZA 5E79C 2QENA 5BPDA 1LEAA 1ZETA 1Z0XA 2E60A 2M5WA 3LSPA 3MR6A 3A4CA 3FMSA 5DCMB 4JUZA 3H35A 4BY1J 1ZELA 3PUFA 3GTJA 4B3SH 4F55A 1VAJA 5DLGA 2HPIA 4DIQA 1FBSA 2DU9A 3LQRA 5KK1A 2R93G 1SAXA 1K6YA 1TT5B 2YZMA 5GPAA 1KBLA 4JV5H 1ONVA 2QUFA 4DBQA 4Y4RA 1BC7C 3GTPJ 2W7NA 4Q5SF 2Y31A 5HLTA 3EYYA 3HTUA 1DIKA 4O5VA 4AYBA 2R8HA 1MDMB 1IF1A 2XPUA 3I58A 1QVTA 1TBXA 3I0TA 4AVPA 4BHPA 3OYEA 1T08B 2IA2A 1MD0A 3BWGA 1TWCJ 4G9YA 1UHSA 5D8KB 4Y7NJ 4JI5H 1GYFA 5D8LB 4F92B 4KIFA 5CJ9A 2ZJ2A 2FQ4A 3CO7C 1VNDA 5F64A 3S32A 1MH3A 4A2BA 4IJAA 2V1DA 1XSVA 4IRCA 2IT0A 5EWGA 4ZDLA 1W36D 4U7BA 4OIRF 3ZRGA 4LIUA 4ED3A 1WJFA 4E7KA 3HHHA 5GADJ 2ZDGA 5FLXK 2X6OA 4OIOF 2X4HA 4PJLA 2F4MB 2LKSA 2VA2A 2XV4S 2E2JJ 5CVVA 1FVIA 1Y56A 5K5RA 1Y1VJ 4A3DJ 4RZQA 3BTJA 3JRDA 3H0DA 3DBHB 4GLXA 4CSWA 4ZYGA 2O8XA 3TO6A 5BQTA 5LOVF 4EM2A 5T14A 4J9KA 5M3MJ 2VOBA 1PJRA 1EKEA 2DIKA 5EWFA 2OF7A 5HDGA 4MTEA 3SDGA 4JP0A 3OHBA 1U9NA 4BQAA 4RB2C 2W71A 2OWOA 1OYYA 1UG0A 2L01A 2CJJA 2DQRA 2L9SA 4EEFG 5E20A 2V58A 3ZQIA 3K4KA 2LF8A 1T3NA 2DA1A 2M87A 4RMNA 3KEOA 4IHWA 3GW2A 2C6YA 4Y3OA 4P55A 2R93A 4MNUA 5E8GA 3O3KA 1OMIA 3JRHA 3G1MA 4FETA 2IS2A 4ZYDA 2DA6A 2M9HA 1R5GA 5JHUA 1S68A 3H5NA 2P0WA 1M7JA 4MA5A 2NS8A 3A0BC 1S29A 4IHJF 3HKZA 1G3TA 3DKYA 1SFOJ 1TW2A 5HOOA 4GYIA 1KJQA 1Q1VA 1XMAA 4N0BA 4V2GA 1KQ0A 5JI6A 4UCVA 3PNYA 2IEKA 2ZO4A 3AL0C 2ZJQF 2HEOA 1VI0A 1I50J 4L5IA 2L9NA 3R6SA 4DZJA 5BPIA 2HS5A 2VBYA 2JJ7A 3CUQA 4I01A 2JMWA 4OAYA 1DPUA 2J5PA 2X85A 3BR5A 4QPQA 4XQFA 4YR2A 1JKOC 2COBA 4LF7H 5DYMA 4BNCA 4EYIB 1FP2A 1OJLA 2Y9YA 3M8FA 5AONA 2STWA 3BDDA 5BS6A 2E36A 1JUPA 2MFZA 4WXDA 3BC8A 4O4LF 3ZOBA 2UVVA 3GMEA 3V8JA 4X62H 2IGMA 3MKZA 5FPOA 3GIPA 1TNTA 4LD5A 3ZMDA 3CCRI 2QBYA 4MV1A 5K7HA 3UKGA 1VQ8I 5KFDA 1WFXA 2HOTA 2X6WA 3Q2OA 3OYGA 3HM5A 2P7CB 2V79A 2P7VB 3E97A 3I4MG 3SEZA 5FPRA 2WAFA 1X1DA 3GFLA 5KFPA 1MMAA 1MW7A 3OR1C 1LPQA 3F0CA 2MD5A 3CLOA 2QM3A 5E3NA 2Y0SN 4KDPA 2K85A 3IWFA 5AIQA 1R23A 2X51A 3W2VA 3PN1A 4O2BF 3T5JA 1HR0H 5DQGA 3M4IA 5C4JJ 3GFJA 2R7NA 2X1DA 2FX0A 2RNJA 2W6NA 4IEJA 3SDBA 1I27A 2R93J 3B73A 4UCRA 3U1KA 2V9KA 4HF0A 3T8RA 1ODDA 4FBUA 2IA1A 1DP3A 3L09A 4XNFA 1YRNB 2BW3B 3ZQCA 1JT0A 4DUZH 5E1WA 1T33A 1OKRA 5J8FA 5KG3A 2JVGA 1YX3A 4CDGA 2JT1A 1V3FA 3H9QA 2QQ9A 4D5FA 3H4BA 2Z5UA 5DCMA 2H8WA 3CMMA 1M1EB 4I50F 1BJZA 1JKRC 4JI6H 3HSRA 2CQQA 1DUXC 3S17J 3LA7A 4XN0A 3DTIA 4M3EA 1BJTA 3F23A 1ZLJA 5KG2A 2IBKA 2ZSHB 3M1CA 3DU6A 3C7JA 3M3YJ 3EUHC 2FMLA 3GFMA 5LRSA 2QEXI 4EGYA 4G7OF 4CCJA 5E17F 3KP3A 3RV3A 3BOQA 2CQNA 1A36A 4UV9A 5KFEA 1F36A 2GWRA 3LSKA 3RYRA 1HCRA 5HNFA 1WJ5A 1LB2A 2GLOA 4RLQA 3OYMA 2M3AA 1MDMA 2NUAB 2JEGA 4LFCH 1X2NA 2BY2A 3SXYA 2XGPA 2W48A 5ICGA 4EBDA 1X3ZB 2RDIA 1J0RA 1T56A 5A2QZ 4WK8F 3UQ8A 3AG4H 2FPGB 1NK3P 5ILUA 2HDDA 5KG1A 3KX2A 2VODA 3K0LA 4RS8A 3E5NA 4QWBA 1JGGA 2OU2A 2FMAA 1E3PA 2DQLA 3A01B 1EH8A 3HL2A 3KP6A 4MIMA 1B9MA 1XS9A 5DG7A 3CF2A 2LK2A 1X1AA 3F8CA 4QWDA 4QWAA 3SYTA 4LF5H 3S3OA 3GBGA 2VIXA 4RDUA 1K1SA 4EJVA 2HHHH 2GQQA 3MN2A 2ZB9A 3ZQGA 2A6EF 1QGPA 3LAPA 1ACIA 2MABA 1WI3A 4W97A 3HOYG 2BY3A 3KP4A 2V1XA 3W6JB 4XOTA 5LP6F 3JSNA 2CQ7A 1ZREA 4LF8H 3RZDJ 3BR2A 3MVPA 3OIOA 1WH2A 5KFXA 3E6CC 1P7JA 1RC9A 3EDPA 5L3GA 3L4JA 3HOVG 4JI8H 1XTAA 3F6OA 2DYRH 1BOAA 2E19A 2Q2EA 1GXPA 3FDSA 2QSHX 4AYBE 3FXQA 2VJ5A 5KT4A 3HOZG 4NXMH 2JEFA 1CQTA 3Q3SA 2OBPA 2R5YA 5D6FA 1BNCA 4I98B 5DG9A 4GGGA 4PFOA 5HVQC 3QQAA 1P9QC 2QKMB 1JKQC 3K4CA 2HZTA 3R5HA 5LL6b 4HNUA 1LFPA 1FMWA 3BTCA 1FEXA 1KYZA 1FSEA 2OQRA 2VBXA 1X1BA 3GZNB 2W82A 4ASNA 3WTYC 2CGPA 3PW4A 1VBGA 3ABKH 2NU6B 1OCPA 3GQCA 2XRNA 1TW3A 4ZTFA 4YJ3F 3RB6A 1GSHA 3CP2A 4NB5A 2J6UA 4M3GA 4LLNA 2OCCH 3H4DA 3I4MJ 4U7CA 4L5JA 1MJAA 3JTGA 1J7KA 4X66H 1LJ9A 1FC3A 2R86A 3PSFA 4X1EA 2YU9J 2PG4A 1BI2A 2FUG2 2FNAA 5IP7G 5KFBA 3PR5B 3KHRA 2ID3A 3VSLA 2R7XA 4C3HJ 4E7IA 1HNZH 2OUMA 5JHFA 2HYGD 4LMYA 3L2PA 5KFHA 1V5FA 4A0ZA 5IY5H 2RF4A 3IWZA 1DGWY 2VC0A 3H0GJ 2M2EA 4CCMA 3M9MB 2E1MB 4NNJA 4U6PA 4KITB 4LB6B 4UCOA 3M07A 2XAFA 4GC6A 4L9VA 2VPLA 2EQRA 2NVXA 2HGSA 4C2TA 1I3AA 5L3CA 3RKQA 3VMMA 2XSJC 4FBTA 2JPBA 2GM4A 2OH2A 3K1PA 1SFUA 2KPMA 3MQ0A 3KYLA 2KSWA 5KG0A 3LSGA 2IP4A 2NVTJ 2O03A 2DBBA 3HKZE 2P8TA 5EJCA 2XGCA 1HLVA 1Y6IA 1XD7A 4ECRA 5D1OA 2ECBA 1LVKA 2X1EA 3P7NA 4XR6A 2HXOA 1S0OA 2KDOA 3K6GA 1YRNA 2BW3A 3F72A 3FISA 2W84A 1UB9A 3CCEI 3CC7I 1P6RA 2CW0F 2EJRA 2L7KA 2Q8KA 1PX2A 1N34H 3H9GA 3TOBA 4IOAF 2B7EA 2EH3A 4A6DA 2LY1A 2EIMH 3HHGA 3TMOA 4E7LA 4CYDA 4B3RH 3K1MA 3PVXA 2LH9A 4NLGA 2ASDA 1V5GA 5EOYA 3QU6A 2R84A 2P6TA 4IAJA 2R7RA 1BOBA 2F5CA 1VQNI 1F43A 1EV7A 1ZQ3P 2PBZA 4EG0A 4HF2A 3QODA 1VQLI 3L2VA 1DPRA 4QW8A 4B3TH 2JUGA 3J7YJ 3EQLF 3ZQQA 3HTSB 2C2DA 5A2QK 3RF2A 3OL3A 4D0PA 2A05A 1T0FC 2X9DA 2L5QA 5DD8A 2HQRA 3C1DA 3IUOA 2V5AA 4BAYA 4AC0A 2I8CA 1G3SA 1V4RA 3MKLA 3ABUA 1MIJA 2ETHA 3GCMA 3CMEI 2V1UA 3N44B 4PWQA 2IMWP 2NOJB 2DT6A 4H0EA 1R4MB 4OU0A 4WXHA 1FYMA 4APMA 3MWMA 4MV6A 2M4GA 5DQHA 3HOYJ 2VUGA 4LITA 4WWCA 2NS0A 4LG3A 4AU7A 1V5EA 4Q4ZF 4ENJA 1EUCB 3JRFA 2D45A 1AHDP 3A01A 1BR1A 2NVXJ 3Q8RB 1U5TB 2AGOA 4MV8A 3VYSB 4ZI7F 1ON2A 4H4KC 3HOVJ 1GVJA 5F04A 4NBQA 1IV8A 2DYSH 2VJIA 3RUPA 2H6BA 3HOZJ 2LKPA 4MQ9F 2W6OA 4XMYA 2RDPA 1B4AA 3FXKA 3WTSC 4HEA2 3JRIA 2HWVA 5LGUA 2UUZA 1K78B 1A5JA 4ZDPA 4GC7A 2XCLA 5IWAH 4ZZLA 2DW4A 2QA4I 1G59A 1D3YA 3PL8A 3W6KB 3RQIA 5LXTF 5L1KA 1W5CC 3GLXA 5F9LA 4LH7A 4KUMA 4A3LG 3ZR8X 1NH3A 4A0YA 2OCEA 4JV2A 3BJ6A 3CD6I 1TWGA 2CV0A 2MSYA 1WWXA 2D1HA 2WAQA 2XB5A 2XF5A 1ZRCA 4LG0B 3OSNA 4OMZA 1APLC 1CS0A 2R8GA 4KMFA 4YFKF 3W2AA 3PW5A 1WJAA 3S3NA 1W93A 2HKOA 3I59A 2PX9A 1JLLB 1AU7A 1FNNA 4CYCB 4O3SA 2L2OA 4LFUA 4ZZDA 4FX4A 1BC8C 3ZN1A 2D1VA 3UFXB 5IP7J 3HOUG 2QGUA 4BL0B 4UXNA 1S7OA 5FO5A 1BI0A 2CQYA 1KQ8A 3ZXSA 4OMYA 2MH2A 1YX5A 5J8CA 1GVDA 4CXFA 1U0JA 4HX8A 1YJWI 2UXBH 1YHQI 1EA3A 2DFFA 2G7UA 2MC3A 3TQTA 2YPRA 5L1LA 4LGWA 2K9MA 3NARA 4ECSA 2QSFX 4HG2A 3DF8A 5BPHA 2NYXA 4C2MJ 3T1HH 2IBDA 3BQ2A 3RIRA 1WH5A 2HNHA 4S05A 3TQNA 3IL2A 2F6CA 2WY8Q 1PP7U 2QCOA 2DAOA 4B47A 3S1MJ 4V19K 3OY9A 5KFUA 5L1JA 4YHHH 1I3QA 4CICA 3BZ6A 4RGRA 3A0HC 4I7HA 4NDLA 5J6XA 2NOGA 1QU3A 2R7TA 1J2XA 3WHCA 1R00A 1MMNA 4DYRA 4MV7A 5KT2A 4ESBA 1SD4A 4CH7A 4ED8A 1V51A 3GF2A 3VODA 1QHHD 1S9HA 3JSLA 5DG8A 1ETXA 1H0MA 1SYXB 2XC9A 4R79A 2FK2A 4QWCA 4A3IG 3GTOA 3RDIA 5F27A 5B1BH 2DPDA 2TDXA 4U88A 2XDVA 1BIBA 4DR5H 2F5DA 2KT0A 1LE8B 4UV8A 4ZH4F 4RNMA 2DWCA 4NXNH 4ED2A 1YS6A 2NS7A 2JEIA 4RU9A 4QIWN 1Z3YA 1B6AA 5IP6A 1E17A 3FXJA 5HBRB 1AA7A 1J09A 3IKVA 1KGSA 3CMAI 4MV9A 3GV8B 2UXNA 1MNMC 1KYWA 2P4WA 4R7RA 1HOMA 4GKKH 3WU2C 2VT2A 3C2GA 2IGOA 1JT6A 3KHLA 2PMZN 4IWYA 4XLEA 1Z2OX 2UZKA 5FKLA 1UG2A 4ZQIA 5DLFA 3ZMVA 3AG1H 2LBFB 3L7WA 4ON0A 1ETWA 2ELHA 1E4EA 2EV0A 1W5TA 2MD0A 5BNGA 3T5XA 4DV2H 1IN4A 3E3VA 1SD5A 1DQUA 4UNOA 5DGBA 3IG0A 4P9FA 4ESJA 3BZKA 4YEJA 5M3FJ 5DV5A 2CW8A 2LG4A 3DFGA 2H1LA 1R1UA 2HR3A 5IYCG 2BQRA 3F8NA 5FLMG 4C9YA 5KKNB 4O3OA 1Z7LA 2DPUA 5H80A 2WTFA 2Q1ZB 3GWZA 1X4PA 2F5VA 5CLSA 3K4NA 4I6ZA 1ETQA 3GIQA 5KFYA 1FOYA 4PK4A 3IP4B 1BI1A 4J9NA 3S16J 4BJ5C 1FX7A 3HOWG 4PJ0C 2BY0A 4RGSA 5H6QA 3H3UA 3Q9SA 4DV4H 1XNQH 1I3QJ 3OYKA 2BGCA 4U0WA 2ZXJA 3JSPA 2VUMA 3JREA 4F7ZA 3BG6A 4AIHA 3TIGA 1PUFA 3LSTA 1R5HA 3DV8A 4EGJA 1HXDA 2FLPA 2EWNA 2KQRA 4LJZF 4IR9A 5CVIA 2VR1A 2KLOA 4A3LJ 3J7AK 1HKQA 5F1RA 4AIJA 2DMNA 1U5TA 5CVRA 3JAMW 1X4OA 1ORKA 5E8IA 2W70A 1QO0D 2M45A 4EEYA 4X6AJ 4HBLA 3FKIA 4XYMB 2HI3A 4G7ZF 1VQOI 3ROUA 5KT3A 2EB7A 2JEJA 2UUAH 3DP7A 4A2UA 2W6ZA 3WGHA 1K78A 5H2FC 1O57A 3H92A 4BHCA 2QZ8A 3FIWA 1TQMA 3HOUJ 3IN5A 5JUMA 3FF5A 5CQEA 5LHGA 4EGZA 3H3VK 2Z9OA 4II3A 2V59A 3H20A 3OYHA 2LKXA 2XVCA 3LWFA 4HNVA 2VPQA 3AG3H 3P9KA 1JUMA 1N32H 2JUCA 2V9VA 3CJTB 4J9OA 4B44A 3QYFA 4B3MH 2R7ZG 4HZFA 4IKFA 4XLHA 3KEYA 2DT5A 3V6HA 1IZ1A 4LG0A 2FEZA 4G6QA 5HS9A 2XF6A 2RREA 3L4KA 2WB1N 5KFFA 1G8XA 2WAEA 5FD5A 2CRGA 3KYCB 1FOXA 1MBHA 1JTYA 3D5LA 4CYCA 2L3DA 4M9XA 5GTHC 2Q2UA 3N4MA 2WADA 5J40A 3J80Z 4A3KG 4FX0A 3O2PE 4XLNF 2M0CA 3VSKA 2NVYA 4R8UB 3HZJA 3LL7A 1RYSA 1T95A 5HDKA 1ZHFA 2R7OA 1NHAA 1JDEA 2ME0A 4B09A 4DZPA 4A3IJ 1SC7A 3N8DA 1WCMG 4U87A 1XGSA 3H5AA 1IDZA 4ECVA 4XLPF 3BPVA 2HU9A 3ZQ7A 4TV8F 1IXRC 5KT7A 1ULYA 5DD4A 2R7QA 2KP6A 3HRUA 1IN6A 2UVUA 3OTOH 2KFDA 1IXCA 2ZJTA 4HYKA 4LK0F 5D4SA 1MBJA 2JA8J 1T6SA 2KISA 2OAZA 2HVQA 1FWZA 3KZYA 1ZAOA 2LYCA 3CP8A 2PBIA 2EILH 2IS6A 5C1PA 4XRSG 4JV1A 4J01A 3FM5A 4LF9H 5DDGA 1LFUP 2WAQE 2UXDH 2E1NA 1LE8A 2Y48A 1BN5A 4DL5A 3OYFA 2A5WA 2HVRA 1RJRA 1FIAA 4IL6C 2R7ZA 3RGXA 1W36C 3EPZA 4DR1H 4I0AA 4NC6A 2ZFWA 1RR8C 1F4KA 2NNYA 4KICA 5C1OA 5KG7A 3EUKL 1KJJA 5B1AH 2HYJA 4RAGA 5IYCJ 2DMPA 5FLMJ 4R1HA 4D5CA 4HQMA 4WF2A 2UVWA 3WU0A 1TL8A 1YE9A 2H1KA 2R7UA 3D5SC 1XC5A 4YELA 3IRQA 1AN7A 2DO7A 3LA2A 2ZSIB 2YZGA 2PVPA 2KJBA 2AGQA 1IV6A 4RGUA 3R23A 2RQQA 4ENMA 2LBFA 3C3WA 3T1BA 3I64A 3HOWJ 3M7GA 2X6XA 3ERMA 1E4GT 3S2WA 3F21A 2KHMA 1KQ9A 4LK1F 5KCMA 1U9OA 5FKKA 1WCMA 2DZDA 5IYZF 4RNOA 2NVYJ 3NGDA 1B6RA 2VE9A 4LLLA 1PVEA 3KXYT 3RAQA 3JRCA 2H8RA 1U6GA 1QBJA 3QU3A 1MGTA 1K61A 2XCAA 2FKLA 1AUVA 3ZCOA 3GLLA 3FMRA 4DV3H 3OSFA 2X6YA 1HF0A 1Y1WA 3O8HA 4D1QA 1XB4A 3I3LA 3HC7A 4XX0B 1KEEA 3KLNA 2W25A 4A5MA 3D5RC 4YIFA 1BW6A 1ETYA 3DEEA 4Y15A 2FB9A 3K9TA 2R7LA 3BY6A 4XRSA 4DBRA 4KYWA 4CA0A 2DTZA 4YAKB 3HRTA 1W7PA 2EIKH 5FJ8G 2RDJA 3LFKA 2W7OA 3FMQA 2E1OA 4MO7A 2LSOA 4V2FA 4GFBA 1E3OC 2Y0SA 2BE5F 5DM7F 3WODF 3ZGKA 2F48A 1EH6A 4M74A 3QWLA 1B1BA 2ZMEA 2XD4A 1HKTA 4HRIA 4Q43A 2ASLA 3ECHA 3FK7A 2D5VA 1WJCA 3GTJJ 4O3RA 1D1AA 3U9TA 2R7MA 3PFIA 3DPTA 3MAJA 1XN7A 4DL4A 3DBRB 4AD9A 3MEXA 1ZYRF 1YW9A 2M05A 2KIUA 4ZJZA 1ZG1A 4MA0A 1GLNA 1ZG5A 1H89C 1RPWA 3H36A 3HXLA 5KHDA 3I4PA 4I4TF 2M8EA 1PP8F 4BJ6C 4YJ2F 1N48A 3BR6A 1UNNC 4C5BA 2BV6A 4QWQA 1JHFA 3RI4A 1JXSA 3O8GA 1OYWA 2YS7A 2XGDA 2GOMA 4A3KJ 2DA5A 4BE2A 3B02A 4UY8I 1JI8A 4N4NB 3FDYA 1GLVA 2H6CA 5H6RA 1BJAA 3RKXA 3C2HA 4RBOA 2CV2A 4EGQA 1QZYA 3LA3A 4JV0A 2ASJA 4IXAA 3GIMA 4AYBN 1WCMJ 3SHFA 2FBKA 2Y9ZA 2F5FA 4PZJA 1SEUA 3NEUA 4OIPF 1BI3A 3G6EI 5BR8H 2A6HF 4DYCA 4YG2F 3G71I 1GGOA 3N6XA 1X2MA 2LFBA 4IHVA 1LVAA 2PEXA 1FY7A 1YJNI 4IX7A 5KFLA 5KFRA 3OYLA 5FRNA 4LOCA 5GAGJ 2GXGA 1ZGJA 4FM9A 2OD5A 4R8UA 2FA5A 3BG7A 2VI6A 3SZPA 1K7AA 3NWTA 3VPBA 4IZZA 2E35A 2CUFA 1IN8A 1USSA 1NTCA 2K9SA 4Y8VB 3CCJI 5KAFC 4KHPH 3RFCA 2ZC2A 3ETHA 5C44G 2KJCA 2WV1A 1O7LA 4FISA 4JYKA 4HQEA 4A3MG 3SQNA 4YFNF 4M9SA 1FYLA 3R60A 4C5CA 2BVLA 4FT8A 4IHSA 3KHHA 2M34A 1UZCA 4XICA 4UUSB 5HLIA 1OCZH 3JW4A 1T94A 3QOEA 3Q1KA 2YL2A 4HLYA 3ZPLA 1Y14B 1REPC 1Y8QB 2CUZA 4O3MA 2H94A 2JRMA 5LRRA 3MKYB 2EBIA 4F4YA 3LNQA 1ZRDA 5EZYF 4A3JG 4U0VA 3UR3C 4FE4A 1XCVA 4HSTA 1WSCA 3HG9A 4HV5A 1FOKA 1VQPI 5J2UF 2E1CA 4BEHB 1A0IA 4QPOA 3LMMA 2CFOA 4TQRA 4KN4X 3S2DJ 1RJQA 5CQGA 4B8XA 2N8GA 3HKZN 3V7RA 4IRIA 1Z7UA 2RGRA 4DR2H 4BBRG 2HDWA 1W7PD 3WU1B 5FLXW 2OZUA 2CFXA 1W4MA 5GP9A 2KIQA 2R7KA 5GAHJ 4RM3A 2JPCA 3CLQA 2L4MA 4HW0A 3OWTA 2JA6G 4L0ZB 3BP8A 4B48A 2WBMA 2OJED 4GKJH 2DODA 4BXUA 3G1LA 5ICFA 4F3QA 1DP7P 3OYJA 4Q8EA 2ATLA 3ZQHA 2L54A 4E7ZA 1UC8A 1N25A 3MFKA 2UV1A 5LD2C 5FJ8J 2VN2A 2JK3A 3DBLB 4II2A 5IT9W 4PDBA 3ORRA 2E34A 1QPIA 3PO3G 1WI9A 3IKTA 4OWRB 4WBNF 2BBYA 1DV1A 1YO5C 4MAMA 1N33H 1BR2A 2A6TA 5EGOB 1TA8A 2O0YA 3PW7A 1Z77A 4J9RA 1Z3XA 3GTQA 3VYTB 5C8YF 2YS9A 5K5QA 2XKPA 2LC2A 2SCUB 3E6MA 3X2QH 2C28A 4BU2A 1IC8A 1GUUA 4MFEA 2YUSA 3BT9A 1YYVA 5FKNA 1JKPC 3T5HA 1YTYA 2HVSA 3J80W 4MEYF 2DJIA 1P7IA 4E4TA 5F9NA 3ESWB 3LOCA 2HFHA 3PR4A 4LH6A 1UC9A 3M8EA 2YR2A 3GTMA 3KLOA 4YBZB 3KETA 4EFBA 2ADUA 3E0JB 3DLAA 2B63G 4KFCA 4ECYA 2NRAC 2EFNA 2O5RA 1FLIA 4PGGA 3LFUA 1OFCX 2ZM6H 1RJPA 3LSIA 3E5UA 3EETA 3K3PA 2CH0A 3BPXA 4M72A 2HQ5A 4BS9A 2DK5A 3E7LA 4DV1H 2JA6A 4WXCA 4OX9H 3Q0VA 1PYVA 4HOBA 1TT0A 2JWTA 4EVIA 2V1NA 4L0YB 1R71A 2W7PA 4OINF 2IVMA 4ED1A 4EM1A 1RUNA 3AFHA 5LA6F 4G7HF 2DCEA 3RPUA 1HNWH 2LOOA 3JRXA 3GTLA 2K9NA 1IUFA 2YRXA 2CS3A 3RTRA 4UUTA 4CCKA 3JAMZ 2M0MA 2XHKA 3CJRB 4D7MA 1ZGWA 1ITYA 4HR7A 4XSZF 2JA2A 3KHGA 3F8FA 1J75A 1ZQ7A 2W8LA 1LEBA 3NQOA 1T0FA 1ETVA 1MSEC 2VPRA 2O6GE 5C44J 5JVDF 4CGZA 1Z2PX 2ZXIA 2CQXA 3AKZA 2F4VH 2GPSA 4A3MJ 2VQFH 4EJTA 3W2WA 1JHHA 2KRFA 4I0BA 1VQ5I 1B04A 4U0YA 1MMSA 1ZHQA 2HQNA 2QQ8A 1KZHA 4O3PA 3WE2A 1ETOA 2BHZA 4O6JA 3GTQJ 1CQIB 3GLKA 2VKEA 2HPMA 4ETSA 3MCZA 4UVBA 3OS1A 4CO8A 1AWCA 2XGXA 2IGKA 1ZTRA 2A61A 1P4XA 4A3JJ 3K4BA 5KT6A 2K3PA 2BXYA 4F93B 2B63A 1MKMA 4YY3H 1K6OA 4I76A 1KU3A 2EK5A 3V7CA 3FBNB 3HGYA 2V4RA 2O3FA 5JFRA 4UUSA 3GTMJ 2JRTA 3KAKA 2DI3A 1IOVA 3RKYA 3JCUC 4ZHQF 1OPCA 4AIDA 1P4AA 2ECCA 3RZOJ 2ZDQA 4XL9A 1V4YA 1E0EA 2M7BA 3DEWA 4BBRJ 4NC7A 1XSXA 4BQQA 5IOYA 1PDNC 4NQWB 2IS4A 1WH7A 2ISYA 2Z16A 1YOVB 3FXOA 4EBCA 2B0LA 2JA6J 4IO9F 2C22A 4BYYA 5KG6A 4XIDA 3BA8A 2AHQA 1EJ9A 1RZ4A 4BEHA 5KFWA 3TP3A 3DEUA 4RB3C 3MWDA 3PQJA 4DV0H 3F8MA 2W57A 4QW9A 4FASD 3FBIB 3HBLA 2LMDA 1RESA 5J4YA 3GTLJ 4Q47A 4EJOA 3H40A 4RZRA 2FOKA 1FYKA 3PO3J 5D8DA 3TDUC 2X0LA 2KIFA 1POGA 2LD5A 3E1SA 2HOEA 1BR4A 1FJLA 1DDNA 4A12A 1K4TA 1QZZA 1R9TA 5DGAA 3I55I 4N9HA 5L3DA 2XRLA 1U8BA 3PUBA 4O3NA 3G4SI 4DL2A 2LNBA 2YX7A 1N56A 4A0XA 5F1JA 2C00A 4KT6A 3S15J 2IJLA 3JZIA 4ABZA 3RCOA 1A6IA 5K7ZA 3BTLA 1N78A 1I5ZA 4RAZA 2LRDA 4AIKA 2R7VA 5CB4F 2IAIA 3ASNH 4B3AA 3GTGA 2H09A 9ANTA 5I47A 1IXSB 2NXNB 3CCVI 4C2UA 1LDJA 5KFGA 2OPTA 1V55H 4RLFA 1PK8A 4HLXA 4ZTJA 5KX5F 4IHYA 4UB8C 5F6FA 1MBGA 1HC8A 1Z21A 2ZCWA 4UHTA 4Y17A 5EGOA 3K70D 4QSHA 4CZZA 3U9GA 1FBUA 3S1NJ 4MLOA 2B63J 2IPQX 4JX6A 5M5WJ 3RPUD 3RQ4A 3U2RA 1S72I 4L9TA 2QQAA 1UAAA 2WE6A 3R5XA 3I71A 2ZNZA 2QF7A 4FS2A 2OTLI 3FM3A 4R8HA 3GIJA 1SMYF 1A6QA 3BG3A 1I7LA 2VA3A 4F4XA 4BE1A 3BLYA 3W6VA 3CDIA 4NUBA 2XAQA 1HA8A 4JI4H 4QIWA 3WTZA 2A3SA 1OLTA 3V4GA 1XSDA 2K3FA 1IBMH 3LSRA 3K1NA 2VXDA 3KEQA 1CE8A 3AAFA 1M6VA 2MBFA 2OQGA 2UUBH 4ITVA 3ZMSA 3PFYA 2WDTA 2R92A 5KG4A 3VYRB 2M4KA 2PMZA 3GIDA 3TEDA 1YIJI 1TWFA 1BM9A 3BZCA 3OYCA 1YITI 4ZOLF 3ZN0A 1WQ2A 3JAMK 2FQ3A 4FS1A 2R3SA 1LQ1A 1MZBA 3MR3A 1R7JA 4L5EA 1WJBA 1E3HA 3CVZA 1JIHA 2CG4A 3LAJA 1GDTA 2XB0X 4RM2A 1SFXA 1C30A 4YB8B 4A3GG 4WX9A 2ZDHA 1R9TJ 4I55F 1YQAA 2KRCA 3OL4A 3Q9VA 4GYGA 4KIGA 1RKTA 1HQCA 5HV6A 4F4WA 2JA5G 1RRJA 1SVLA 1XGMA 1J9IA 4TQSA 4IQ4A 2G9WA 3RSNA 2W9CB 2W24A 5E3OA 4JI7H 2DT7B 1ON1A 4XRMA 4J9MA 3H1CA 3SZGA 1UELB 3P9IA 2VC1A 3REOA 2W9BB 1QA6A 4F91B 4J0MA 1YFHA 2D2WA 3IH2A 2LY9A 5KFJA 3OS0A 2HKXA 2WC2A 2C2EA 1IN5A 1D8JA 4HA8A 4XN3A 3A1YA 2EFWA 4XSXF 4M7EA 2VJJA 1QZEA 2VUMG 4LIVA 3DLLF 1LKXA 1IJWC 3QYEA 4HSRA 1O3QA 1O3TA 2CYYA 4MGRA 2EZKA 1W0UA 2FP4B 5KFIA 3V6JA 1MJBA 3COAC 3R61A 2MCTA 2YZNA 3BQ0A 2H27A 1TLHB 1HW1A 1Z2NX 2LDUA 3PNVA 2YS6A 1E4FT 5M5XJ 1D5YA 2JZYA 4CZCA 2CMPA 2BYVE 1TWGJ 2DOEA 4XONA 4M3DA 1Z6TA 2W8KA 1C3OA 4KA4A 3N97A 2P81A 3RKWA 2ESNA 3FKIG 1MNEA 4EJWA 5J4VA 2OLSA 4KIBA 1V9PA 2BEOA 3AL0B 1IRXA 2F4IA 3ETJA 4BJTA 3IRRA 2LREA 3PQKA 1Z1DA 4LB5A 3DPLC 5CPRB 2I8DA 5KFCA 4ED0A 2BZTA 1TWFJ 1IG7A 4S0HB 5GONF 3RV4A 4F4ZA 3OSPA 4A93G 3TBIA 2AQ4A 3GV7B 2XGEA 4C3JJ 4UUVA 2DA7A 4K2EA 3VEPA 3U9SA 2I87A 3HB9A 4HAMA 4AQYH 2JA5A 3F22A 4OOIA 5IYBG 3ULQB 1ZG3A 1S6LA 1XMXA 2WB1A 4O4HF 3RB0A 1Y0UA 2L7MP 3WG7H 3I54A 1S7EA 1SFKA 4UB6C 4Q45A 4DL7A 4YIIA 5TISC 1O3RA 2M7AA 1P4WA 2KZVA 4G6DA 4XBFA 4CC5A 4I02A 4B3XA 3ORQA 4EJUA 2RAEA 4U7DA 1X9NA 5ICEA 1TZLA 1B8IB 4L1KA 5D5XB 3PNTA 5K5OA 3KCCA 3SE7A 2CSOA 1W5SA 1W96A 2RV8A 3GTOJ 1AKHB 3T5KA 2ZKZA 2VPSA 1P92A 2RQPA 2W4SA 3LWBA 3CJQB 4YR3A 1IN7A 5CA0F 3L2CA 2GZWA 5FFXA 1OYIA 1P2FA 4M6YA 5KFKA 3V4ZA 4RNNA 1IRFA 1OR7A 2EFOA 2KRHA 2K9QA 2YU3A 4RB0A 4EM0B 5FLXZ 1ZHSA 5KFAA 2HTJA 4MEXF 4DJAA 3WGGA 1RK5A 2E5NA 3F6VA 3G6YA 1T8IA 3PW0A 3SI8A 2NVUB 5ILVA 2P0AA 2PN6A 2I5UA 3R0AA 5CKTA 2E1MC 1HKSA 3ABTA 1FBQA 2FJ1A 5FKOA 4DV5H 2MC4A 3IH4A 5TRDA 2TCTA 5KT5A 1D1CA 2Z33A 3GUDA 1WVRA 3BR0A 1JTXA 4L18B 1A35A 2CU7A 1R58A 5IT9Z 4M9UA 1IRGA 1WR2A 5IOZA 1XX5A 1ZKGA 3CCLI 3V4SA 2FSWA 4UCUA 1KU9A 4A3GJ 2BQUA 5EDNA 3MR5A 2W1OA 4Q48A 2XCPA 3L2UA 3VWBA 3BABA 4KN7X 1MH4A 2JA5J 5JLWA 2O61A 1Z67A 4M3BA 2JQ7A 1TP4A 2GIVA 1USTA 2F5EA 2L7FP 1TC3C 4E6KG 3OYDA 3BQZA 3Q8SB 1FP1D 1CF7B 2FMYA 2FLLA 3QAHA 1JJ8C 3U21A 5LYJF 4A3CG 2BY1A 1XDNA 2PI0A 4MTDA 5JVLA 3EPIA 2WA0A 3DU5A 2QYZA 4O2AF 5EWEA 3V6KA 3LSJA 5HLGA 4ECTA 2DDAA 2KZGA 2L7ZA 2VQHA 4DGWB 3HGGA 4IWXA 3RJPA 3V7SA 5HS8A 3J7AY 1QRYA 1KJ9A 3KALA 1N77A 5EZGA 1XDSA 4Y33A 2Q0OA 4ZC3A 2VKHA 2Y30A 3CF5F 1CGPA 2VUMJ 3S1QJ 5BMVF 3RIZA 3J7AO 3I4NG 5CA1F 5L3BA 3JTHA 2V4JC 4A2AA 4EATA 2MG4A 3OSGA 2CQKA 4BXFA 1G6NA 3OUZA 1Y1WG 3OIQA 2W9BA 4HDVA 5DCFA 2W00A 4FE7A 2IXSA 5J1YA 2HDCA 1V54H 2EPFA 4PSWA 2PJRB 3M9NB 2AQFA 3J81W 3RBDA 3FKIJ 5EYRA 5C3EG 1QHGA 1W1WE 3I56I 3ONQA 4J19A 1M0TA 1SVOA 1Y8RB 2FBIA 2X1CA 3K2AA 4PJMA 4TV7A 1H88C 2AQEA 3CQZA 2RNGA 4I2OA 3OUUA 2NU9B 3GIKA 2XPWA 4KNYA 3L1PA 2A07F 1U5TC 3L2QA 4JX5A 3FHZA 4A93J 1R5ID 3V8KA 1F9NA 5DEQA 5ILSA 2OTJI 1I6HJ 1G4DA 1R1TA 3FXMA 4N9IA 2ZFUA 2PMZE 5CAEB 5KFTA 2V9WA 1HBXG 3A02A 1WKMA 4EV0A 3IV5A 1VKZA 1A04A 5IYBJ 2CW7A 1D1BA 2K40A 2XUBA 3L2RA 3KPHA 1O7FA 2DDBA 3KZZA 3TO9A 4PJJA 4HPQA 1L0OC 4NC8A 3TP0A 1U2WA 3GZ5A 1MBEA 4AUXA 3NWSA 5EG0B 3V42A 3CTAA 5IYDG 3HUGB 3DQVC 1WJDA 3EUAA 3JRBA 2YYAA 1XMKA 1SFOA 2CZGA 5KFNA 1ETKA 3QPLA 1U3EM 1GV2A 1HSJA 1YLFA 4I99C 4JI1H 2EINH 1C0WA 4XZ3B 2XAUA 4ENKA 2V9PA 3QFFA 2WTEA 4DW6A 1I50A 1NK2P 1HDPA 3RJ0A 1B59A 2VBWA 4MV4A 2VOPA 1QPMA 1QNTA 4A69C 4ECUA 1KJ8A 1S0NA 1DGRM 3C18A 2XIGA 1GXQA 5FB2A 2Y0MA 2L9VA 3CZ6A 5C4XG 3VPDA 2E5ZA 3PO2J 3MWEA 3GEZA 3Q0UA 1UFMA 3WO0A 1WHUA 4IR1A 4M6XA 4MHGA 5J3LA 3FMAA 4YAJB 1B8IA 4JX4A 1WGXA 1VF9A 4Y13A 5FKMA 3KP7A 3BQYA 4UCTA 2EZIA 1TNSA 4UCSA 3Q8QB 3SFIA 1AKHA 2YX4A 2MA3A 5BOXA 3OYNA 5KG5A 3PO2G 2CUJA 1IGNA 2E2HA 1ZK8A 1O4XA 3IHUA 5IP9G 4ZYHA 3CQZJ 2EIJH 4UVCA 3FK6A 1RI7A 2PFBA 3KAJA 3DKWA 1EYZA 4HYEA 2R7ZJ 3RBEA 5E3LA 4TV9F 3G6XA 3KP5A 5GPCA 2AS5F 3P9CA 5IT9K 3HEFA 4Q44A 1DU0A 2P5VA 3GXOA 5K7FA 5LFAA 3HIFA 1IAWA 3CC4I 2GA1A 1HDDC 4Z6YA 1J5YA 1IUYA 1OISA 3I53A 3S1RJ 1K1QA 1XDUA 3N43B 2FBHA 1S0MA 2R8IA 4DUYH 1YW8A 2Q2EB 1RR7A 2Y75A 2ZJRF 4A3CJ 1M0WA 2WB1E 1I6XA 1KA8A 2UUCH 4JI0H 2R5YB 1ZN2A 4X65H 3HSFA 4K0KH 1R22A 3ZQFA 1H9GA 2V26A 3ELKA 3EUHA 1SEIA 3LSHA 4DR4H 3J80K 4JYAH 3MZ8A 3K69A 5L9XA 3KE2A 2EV5A 2E5LH 4HX7A 1A9XA 1EHIA 2DK8A 2M1BA 3GV5B 3I4NJ 1I94H 1S7AA 1SVMA 3HPHA 3HPGA 1OCTC 1OWTA 3VOEA 1CF7A 1SD7A 4BUPA 1Y0NA 3W3CA 1Y1WJ 3N40P 2E7WA 2HJWA 3J7ZI 3ABLH 4Y52J 3F8BA 3HOXG 1IBKH 3OR2C 4D9JA 5J2TF 3K4JA 3VFZA 1JE8A 4CUGA 5F0CA 4XYLB 4DNCA 2HZDA 5C3EJ 3WNZA 3TIIA 1I39A 1I1SA 3MKWB 3BCBA 1XNRH 1BBYA 3OYIA 4IRHA 4GDFA 2P5KA 3B6AA 5KFOA 3FHNA 2CV1A 4AM3A 1R49A 4IRDA 2KKOA 4PDKA 4M73A 3H5RA 2DJNA 2O7OA 1YI2I 4RA2A 2ACJA 2FE3A 3PSIA 2E2HJ 2K4BA 4ECWA 1MBFA 5C5JA 1F1ZA 2R0QC 5J1RA 2GPWA 2FRHA 4CCLA 4BY7G 3RPQA 2F2EA 2DPJA 2PJRA 3A2KA 3U1DA 2J6SA 1G3WA 3K5HA 5KFVA 2I80A 3T0YA 5DUKA 3S93A 3QP6A 3TO7A 2MLKA 3OIPA 2ZMEC 3HSEA 4Z2YA 3N41B 4ME6A 3PZPA 2GLTA 2JSCA 2XROA 2J6TA 3GILA 3H0GG 4BQNA 2L9RA 3WTWC 4BACA 5IYDJ 5D1OB 5FD6A 4JI3H 2V6EA 1EF4A 3ISPA 4JQFA 2ZXWH 3WTTC 2DN0A 4HNTA 3RB3A 2IRFG 3R0JA 1BA5A 3HDDA 3L9FA 4PJNA 4RAFA 5LGTA 1A31A 5D5WB 2R7DA 5KFQA 1I6UA 4F50A 2JA7G 4XOPA 3M9OB 4S04A 3CUQC 5DUIA 4HV6A 3CCUI 5C4XJ 3BR1A 3TW7A 2PQ8A 3HOSA 2UXCH 4BDZA 5EG0A 3S14J 2XAHA 1ZR4A 2KIMA 2VASA 3HUGA 3FWEA 5J1UA 5L1IA 3K4LA 3HRMA 2Z1DA 4P1WA 1BW5A 4FHTA 3T5LA 3HJEA 2X0SA 2GXBA 5CYVA 3JR9A 4DQ2A 4BHBA 2KL4A 5B66C 2PN1A 2XPVA 3HYIA 4ZYAA 4HF1A 3QPTA 4O3QA 4W1UA 3MMYB 1EH7A 1EUDB 4QWEA 4DV6H 4C3IJ 1VQ6I 4BBSG 1XGOA 2DOFA 2ID6A 5EZHA 4ZYEA 5M5YJ 3D0SA 3NAUA 5IP9J 4FCYA 3IH3A 2FPIB 1RKWA 2IA0A 3BTIA 4I09A 1FZPB 1F5TA 2FJZA 4BXXG 3BA9A 2JN6A 4B43A 5JQWA 1FIPA 4IF4A 3KFWX 4WD3A 4KISA 3S3MA 2YU9A 3MZHA 1UMQA 1L3LA 1GHCA 5HDNA 4XKWA 4QTRA 4LSXA 2NU7B 1ENHA 2R87A 3DTEA 3CO6C 4E4HA 3SFZA 2FPPB 1WSUA 2DA3A 3FXLA 5FGMA 1OCCH 1XPXA 3S2HJ 3H0GA 2LLKA 1XGNA 5DQIA 2IA6A 2LVSA 3CCYA 1HW2A 2GA2A 3VB2A 1AUXA 2YCHA 4P5OA 2L02A 1ZARA 2UWMA 1B9NA 3M4OJ 3CMYA 1YJ9I 1JDBB 3K4MA 4G8XA 3BG9A 4EYHB 2JA7A 2P6SA 2RVCA 2VLAA 3SJMA 1TWAA 1L2ZA 1VTNC 2RC4A 2V7FA 2VQLA 1T39A 5EF6A 3ERED 1X19A 3WTXC 3ASOH 4MV3A 1DV2A 4XK4A 1HNXH 4IPAA 5F08A 1S8NA 2HOAA 1D0YA 2R5ZB 2GIZA 5HLHA 3HOXJ 3K3VA 4LF4H 2HXIA 1U8RA 4NHJA 2DLNA 3I59B 4IRGA 1ERDA 2QVOA 1MNDA 3MJFA 3G6VA 2BQ3A 2M8GX 4XKCA 3OYBA 1IRZA 4XORA 2J9GA 5HODA 3QRFF 2AXTC 2JVHA 2XF7A 3TGNA 3Q8PB 1XMOH 2A5YB 2J5OA 2A68F 1IBLH 4YRVA 1XG1A 2O9LA 5E1XA 2AXLA 1R4NB 2RKHA 1T2KA 4RB1A 1OCOH 3BR3A 4XRFA 1GV5A 3OHAA 1LDDA 1UCRA 2ESHA 1JGSA 3IAS2 3CUOA 2MW8A 2IS1A 2Y0SE 3F9KA 1K4SA 5JLXA 3FX3A 1QVUA 4HX4A 5HS7A 4A5NA 5LHHA 5D4RA 4BY7J 2Y69H 2VT3A 2AU0A 5H20A 2XGQA 2X48A 3H9JA 5KNLA 1SMTA 1BIAA 4IOCF 4IQJA 2XSDC 3ABMH 3G73A 3FZVA 2QKLB 4BE0A 4A3BG 4JOMA 2M30A 3ZP5A 3L2WA 3DPUA 2K27A 4E7SA 2EZHA 4QLCU 5LEKA 1GSOA 4ECQA 3M8JA 1GT0C 3K2ZA 1STZA 2Z3YA 2A69F 4D7NA 5E18F 4DL3A 3GIIA 1CQJB 1RETA 2R4GA 4FU0A 1Z6RA 2FXAA 4JI2H 4RUAA 3GFIA 1SANA 3SZTA 2YRWA 2QLZA 1Z9CA 1LNWA 4GCVA 1S9FA 2EV6A 1S97A 3GYHX 1Y39A 1TWHA 1S3JA 1K79A 4DR7H 2CWEA 2OA4A 2R7SA 2JA7J 2FK3A 2VQDA 2NU8B 1IW7F 1TWAJ 2FK1A 3L00A 5D5VB 3KZIC 3LMLA 1KJIA 3BJYA 2PJPA 3PW2A 1N36H 3BJAA 2HGCA 3WHBA 1BL0A 2KMUA 1YW7A 3LP8A 2WWYA 2XAGA 3K10A 5KFMA 3FKJA 2IP2A 2R82A 5KFSA 2ZNYA 2IW5A 1ZLKA 4G3IA 4GRIA 2K4JA 3N42B 3TQ1A 1VFCA 5KVRA 5IPAA 3T1YH 1TQIA 3GO5A 2K02A 1E4EB 3J81Z 1DGSA 2R92G 3BG5A 2XAJA 2V6CA 4ED7A 4BBSJ 5KAIC 1BGWA 4DYQA 2EFQA 3K70C 1FPQA 2QWWA 5JVGF 4YQWA 2ZBKA 4P9UA 4DLKA 4BXXJ 2R6FA 1RIOH 2DFEA 2LP0A 1MJ9A 4EMSA 3I9V2 2XC7A 4ED6A 3AYHB 1G2HA 4A3EG 1FTTA 3ZMTA 4ESFA 1OCRH 2BVMA 4A3FG 4JK1X 1H8AC 2BXZA 2WYOA 1N75A 5LMUH 1WPKA 3VPCA 1KU2A
chains in the Genus database with same CATH topology
4A6EA 2PMHA 3WE3A 4CC6A 3HRSA 1R36A 3GX4X 2EA2A 3R4KA 1YS7A 5LBQA 3WG9A 2G7HA 5EEHA 4MQVA 3JSOA 2EA4A 2XASA 1QQIA 2NAZA 1P8LA 4X64H 3ML6A 3WTUC 4EEQA 2P5LC 2R7FA 3CJNA 4M9ZA 4DR6H 5ED4A 5EEGA 2FU4A 2RGVA 3RYPA 1G3YA 2QQBA 3E5XA 4YFXF 1AOYA 4KMUX 1FT9A 1O3SA 3TOAA 3BROA 1RNLA 2OZ6A 4IVNA 4AWXB 3O6BB 4GXOA 3WGIA 5LLQA 2RN7A 3IC7A 1R1VA 4BH9A 5L3EA 3V8LA 5IT3A 1Z91A 5AIPA 3BJOA 1D5VA 3EYIA 2FF4A 5ERIA 5D6EA 1T38A 3ECOA 5CVJA 1X3UA 2CO5A 4EFEA 2NNNA 2YSRA 3F3XA 5LMNH 2DLLA 4LSAA 4OIQF 3QP5A 3CDHA 3WTVC 4RAYA 3NRVA 5JR3A 4KT5C 2VQEH 5LEJA 4PCQA 4NQWA 5A2QW 2DTRA 4G94A 1FKAH 5LGNA 2VOOA 6PAXA 1T98A 3RTXA 3J81K 3DF7A 4GO1A 3HOTA 3T8TA 1TTYA 5BMZA 2PMUA 1Q1HA 3FXRA 4P96A 4RGXA 2DFIA 1SD6A 5FFZA 1HSTA 1HW5A 2Q2TA 4PGHA 3LQQA 3KP2A 1LDKB 2ISZA 3ZMUA 2WV0A 4IHTA 2FNPA 1FSHA 3DXJF 2HYFA 2QYOA 3E5QA 3E6DA 2HTSA 1S03G 1PUEE 2LF7A 3C0FB 1SFEA 2EFPA 4Q0YA 1VS0A 1YIOA 1W7PB 1UHMA 5K1YA 2STTA 4LFAH 3FXUA 1J59A 1H9TA 3OOPA 1WRJA 4LLGF 3M1EA 2JTVA 4E70A 1J5EH 2ZMEB 4LF6H 1FJGH 5TJJA 3I5UA 2VONA 2VE8A 4WCGA 4CHUA 1ZH5A 1XCBA 2L4AA 1Z05A 1UHWA 3E6BA 3TDZC 3GVAA 2MH9A 2XKOA 5JVTA 3GZ6A 3QOPA 4LFBH 2K7LA 2E7XA 2UU9H 3M9AA 1ZRFA 1O75A 3OV8A 3Q5FA 1TAEA 3CUQB 2Z99A 2K86A 2VBZA 4M71A 5D5UB 4BWSC 5D1PA 3BAAA 2W85A 5CVUA 2QBYB 3G3ZA 2COMA 1ZGAA 1YG2A 1RUOA 4UVAA 4UFZA 4L9NA 5L3FA 2GAUA 1E2XA 1D8KA 2VXZA 3MZYA 5ICCA 1XMQH 4ENNA 3QPHA 1KU7A 3TKYA 4DR3H 3RGZA 2PLYA 4EQQA 1TQPA 4JBAA 5E1ZB 1U78A 1I1GA 3ZMZA 2UXXA 5LHIA 4L9JA 4DV7H 2MLGA 4HDUA 3H3ZA 2QENA 5BPDA 1LEAA 2M5WA 3FMSA 5DCMB 4B3SH 1FBSA 2DU9A 3LQRA 5KK1A 1SAXA 1ONVA 2QUFA 1BC7C 4Q5SF 3EYYA 3HTUA 4O5VA 1MDMB 1IF1A 3I58A 1TBXA 4AVPA 3I0TA 4BHPA 2IA2A 5D8KB 4G9YA 1MD0A 3BWGA 4JI5H 1GYFA 5D8LB 4KIFA 5CJ9A 2ZJ2A 3CO7C 5F64A 4A2BA 4IJAA 2V1DA 1XSVA 2IT0A 4U7BA 4OIRF 3HHHA 5FLXK 4OIOF 2X4HA 2XV4S 5CVVA 1FVIA 5K5RA 4RZQA 4GLXA 4ZYGA 2O8XA 3TO6A 5BQTA 4EM2A 2VOBA 5HDGA 4MTEA 2OWOA 4BQAA 4RB2C 1OYYA 2L01A 2DQRA 5E20A 2LF8A 2M87A 3KEOA 3GW2A 2C6YA 4P55A 4MNUA 5E8GA 3O3KA 1OMIA 4ZYDA 1R5GA 5JHUA 1S68A 1S29A 1G3TA 1TW2A 5HOOA 4GYIA 1XMAA 4N0BA 1KQ0A 5JI6A 4UCVA 2ZO4A 2HEOA 5BPIA 4L5IA 3R6SA 2HS5A 2VBYA 1DPUA 3CUQA 4I01A 2J5PA 4LF7H 5DYMA 4BNCA 1FP2A 3M8FA 5AONA 2STWA 3BDDA 5BS6A 4WXDA 4X62H 3V8JA 5FPOA 1TNTA 4LD5A 3ZMDA 2QBYA 2P7CB 2V79A 2P7VB 3E97A 5FPRA 3GFLA 2MD5A 3CLOA 2QM3A 4KDPA 3IWFA 5AIQA 1R23A 3PN1A 1HR0H 3M4IA 3GFJA 2RNJA 4UCRA 1I27A 3B73A 4HF0A 3T8RA 1ODDA 2IA1A 3L09A 4DUZH 5E1WA 1OKRA 5J8FA 4CDGA 2JT1A 1V3FA 2QQ9A 2Z5UA 5DCMA 4JI6H 3HSRA 1DUXC 3LA7A 1BJTA 3F23A 1ZLJA 3C7JA 2FMLA 3GFMA 5LRSA 4EGYA 4G7OF 5E17F 3KP3A 3BOQA 4UV9A 2GWRA 3RYRA 1LB2A 4LFCH 1MDMA 3SXYA 5ICGA 1J0RA 5A2QZ 4WK8F 3UQ8A 5ILUA 2VODA 3K0LA 4RS8A 2OU2A 2DQLA 1EH8A 3KP6A 1B9MA 3F8CA 4LF5H 4EJVA 2HHHH 2GQQA 2A6EF 1QGPA 3LAPA 3KP4A 2V1XA 3W6JB 3JSNA 1ZREA 4LF8H 1WH2A 3E6CC 3EDPA 5L3GA 3L4JA 4JI8H 1GXPA 3F6OA 1BOAA 2Q2EA 3FXQA 4NXMH 2OBPA 5D6FA 4I98B 4GGGA 5HVQC 2HZTA 5LL6b 1KYZA 1FSEA 2OQRA 2VBXA 4ASNA 3WTYC 2CGPA 2XRNA 1TW3A 4NB5A 4LLNA 4L5JA 1MJAA 3JTGA 1J7KA 4X66H 1LJ9A 1FC3A 2PG4A 1BI2A 2FNAA 1HNZH 2HYGD 4LMYA 3L2PA 4A0ZA 3IWZA 2VC0A 4LB6B 4UCOA 2XAFA 4L9VA 2HGSA 5L3CA 2JPBA 3K1PA 1SFUA 3MQ0A 2KSWA 2O03A 2DBBA 2P8TA 1XD7A 5D1OA 3P7NA 3F72A 2W84A 1UB9A 1P6RA 2CW0F 2EJRA 2Q8KA 1N34H 3TOBA 4A6DA 3HHGA 4CYDA 4B3RH 3K1MA 5EOYA 3QU6A 4IAJA 2P6TA 2F5CA 1EV7A 4HF2A 1DPRA 4B3TH 3EQLF 3HTSB 5A2QK 3RF2A 4D0PA 5DD8A 2HQRA 3C1DA 4BAYA 1G3SA 1V4RA 3ABUA 2ETHA 2V1UA 3N44B 4H0EA 4OU0A 4WXHA 1FYMA 4APMA 3MWMA 2VUGA 4WWCA 2NS0A 4ENJA 4Q4ZF 2D45A 1U5TB 1ON2A 1GVJA 2H6BA 2LKPA 4MQ9F 2RDPA 1B4AA 3WTSC 2HWVA 5LGUA 1K78B 5IWAH 4ZZLA 2DW4A 1D3YA 3W6KB 3GLXA 4LH7A 4KUMA 4A0YA 3BJ6A 1WWXA 2D1HA 4LG0B 1ZRCA 4OMZA 4KMFA 4YFKF 2HKOA 3I59A 1FNNA 4LFUA 4ZZDA 4FX4A 1BC8C 3ZN1A 2D1VA 4UXNA 1S7OA 5FO5A 1BI0A 1KQ8A 4OMYA 2MH2A 5J8CA 4CXFA 4HX8A 2UXBH 2G7UA 2MC3A 2YPRA 4LGWA 3DF8A 2NYXA 3T1HH 3RIRA 4S05A 3TQNA 3IL2A 1PP7U 2DAOA 4YHHH 4CICA 3BZ6A 4RGRA 4I7HA 5J6XA 1J2XA 1R00A 4MV7A 4ESBA 1SD4A 3GF2A 3VODA 3JSLA 1H0MA 1SYXB 4R79A 3RDIA 2DPDA 2TDXA 4U88A 1BIBA 4DR5H 2F5DA 4UV8A 4ZH4F 4NXNH 1YS6A 1B6AA 1E17A 3IKVA 1KGSA 4MV9A 2UXNA 4R7RA 1KYWA 2P4WA 4GKKH 2VT2A 1Z2OX 2UZKA 3ZMVA 3L7WA 4ON0A 2ELHA 2EV0A 1W5TA 3T5XA 4DV2H 1IN4A 3E3VA 1SD5A 4UNOA 3IG0A 4P9FA 4ESJA 5DV5A 2CW8A 3DFGA 1R1UA 2HR3A 3F8NA 2DPUA 3GWZA 5CLSA 1BI1A 1FX7A 4RGSA 5H6QA 3H3UA 3Q9SA 4DV4H 1XNQH 2BGCA 4U0WA 2ZXJA 3JSPA 4F7ZA 4AIHA 3LSTA 1R5HA 3DV8A 1HXDA 2EWNA 4LJZF 5CVIA 3J7AK 1HKQA 5F1RA 4AIJA 1U5TA 5CVRA 3JAMW 5E8IA 1QO0D 2M45A 4HBLA 4G7ZF 3ROUA 2EB7A 2UUAH 3DP7A 4A2UA 3WGHA 1K78A 1O57A 3H92A 4BHCA 2QZ8A 1TQMA 3FF5A 5LHGA 4EGZA 2Z9OA 3H20A 2XVCA 3LWFA 3P9KA 1N32H 2V9VA 4B3MH 4HZFA 2DT5A 1IZ1A 4LG0A 2FEZA 4G6QA 5HS9A 3L4KA 5FD5A 3D5LA 2L3DA 4M9XA 2Q2UA 3N4MA 3J80Z 4FX0A 3O2PE 4XLNF 5HDKA 1ZHFA 1NHAA 4B09A 1XGSA 4XLPF 3BPVA 3ZQ7A 1IXRC 1ULYA 5DD4A 3HRUA 1IN6A 3OTOH 1IXCA 2ZJTA 4LK0F 5D4SA 1T6SA 2OAZA 3KZYA 1FWZA 2HVQA 1ZAOA 2PBIA 3FM5A 4LF9H 5DDGA 2UXDH 2E1NA 2Y48A 1BN5A 2HVRA 3RGXA 4DR1H 4I0AA 2ZFWA 1F4KA 2NNYA 4KICA 4R1HA 4HQMA 4WF2A 3WU0A 3IRQA 1AN7A 2DO7A 3LA2A 2KJBA 4RGUA 4ENMA 3C3WA 3T1BA 3I64A 3M7GA 1E4GT 3S2WA 3F21A 1KQ9A 4LK1F 2VE9A 4LLLA 3KXYT 1U6GA 1QBJA 3QU3A 1MGTA 3FMRA 4DV3H 1XB4A 3KLNA 2W25A 4A5MA 4YIFA 4Y15A 3K9TA 3BY6A 4KYWA 3HRTA 1W7PA 3LFKA 3FMQA 2LSOA 2BE5F 3WODF 1EH6A 4M74A 1B1BA 2ZMEA 1HKTA 3ECHA 3PFIA 3DPTA 3MAJA 1XN7A 4AD9A 3MEXA 1ZYRF 1YW9A 2KIUA 1ZG1A 1ZG5A 3HXLA 3I4PA 2M8EA 1PP8F 2BV6A 4QWQA 1JHFA 3RI4A 1JXSA 1OYWA 3B02A 2H6CA 5H6RA 1BJAA 3RKXA 1QZYA 3LA3A 4IXAA 3SHFA 2FBKA 2F5FA 4PZJA 3NEUA 4OIPF 1BI3A 5BR8H 2A6HF 4YG2F 3N6XA 1LVAA 2PEXA 1FY7A 2GXGA 1ZGJA 4FM9A 2OD5A 2FA5A 1K7AA 3SZPA 1IN8A 1USSA 4KHPH 2KJCA 1O7LA 4HQEA 3SQNA 4YFNF 4M9SA 1FYLA 3R60A 4JV5H 4IHSA 4FT8A 5HLIA 3JW4A 4HLYA 3ZPLA 1REPC 4O3MA 2H94A 5LRRA 1ZRDA 4U0VA 1XCVA 4HV5A 1FOKA 2E1CA 1A0IA 4KN4X 4B8XA 3V7RA 4IRIA 1Z7UA 2RGRA 4DR2H 1W7PD 3WU1B 5FLXW 2OZUA 2CFXA 1W4MA 2JPCA 2L4MA 4HW0A 4L0ZB 3BP8A 4GKJH 4BXUA 5ICFA 1DP7P 2L54A 3MFKA 2VN2A 5IT9W 4PDBA 1WI9A 3IKTA 2BBYA 1YO5C 1N33H 1TA8A 2O0YA 5K5QA 2XKPA 3E6MA