2JA6G

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja6G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja6G01
1N8RC 2F52A 4DR2L 4Y52H 2OQKA 3PIPA 2Q2TA 1H95A 4DV5Q 1J5EQ 2HHHQ 4QQBX 3EBEA 1HNZL 3K8AA 4HIKA 1Q7YC 4JI0Q 3GTGH 4BXXG 1JJ2A 3G71A 1Q46A 2KENA 1R9TH 5E7NA 1X55A 2D0OA 2VL6A 2ZTEA 1L2FA 3T1YL 1UE1A 1VS0A 1QVGA 2K5VA 4POFA 4PG3A 1TWFH 4JBJA 4LFBQ 1VQ4A 1KC8C 1X56A 2A1AA 4AQYQ 2VZAA 4QJFA 1VQJA 4DR6Q 2CQOA 4LFCQ 1AE2A 1KHIA 1HZBA 2VW9A 1M90C 4DR7L 4A3DH 1E1TA 5GROA 1BBUA 4LWCA 2MFIA 2B3GA 3M9BA 3EN2A 4P71A 2R93H 1E1OA 4GOPA 4IPCA 1Q82C 2NN6I 3BZKA 1YBYA 1YHBA 1KD1C 1FL0A 1UWVA 3L7ZC 3ULJA 5IP9H 5M5YH 3HOYH 4P75A 4DR3L 5FLXc 3I4MH 3PUZA 2R7ZH 2ZJPA 2R93G 3FKIH 4EX5A 1IBKQ 2ASBA 3BJUA 3KDFA 4X65Q 2OTJA 4JBWA 1E7ZA 3PUYA 1YJNA 2JA5H 4OX9Q 4JI2L 3PUWA 3T1HL 5IP9G 4JOIC 3STBC 3ER0A 5IYBH 2R7ZG 4LNQA 1XNQL 3RLOA 2K14A 1EWIA 3CPWA 1MKHA 2F4VQ 4LF5L 5K36G 3I7FA 1XMQL 2JA5G 2UUAQ 1PA6A 5M3MH 4DV4L 4DV3L 1TXYA 2PMZE 4RG1A 5M5WH 3JAMi 5IYBG 1U0LA 4DR4L 1AH9A 1SN8A 3K0XA 2GVBA 4JI8L 4ALPA 1CKMA 3FHWA 1EQQA 4AYBG 4LF4Q 1WFQA 3HOUH 4DKAC 1C0AA 5M3MG 5GAEC 4XIGS 1HZCA 1K73C 3DLLA 4LF6L 1YZ6A 3UDXA 4K0KL 1OXXK 2NN6G 3KYHC 4X66Q 4X62Q 3HOUG 3TS2A 3I4NH 3J81j 1Q1BA 1HR0L 3D31A 4R4CA 2Y0SE 2DGYA 2E5LQ 2GN5A 3CCSA 4A3LH 1NJIC 2BH2A 1UEBA 3UDIA 5IWAQ 2V1CC 3ULLA 1X3EA 1I94Q 3TREA 2UXDQ 3J7ZC 2R7FA 1VQBA 2UXCQ 1VQ8A 4BA2I 1Q86C 3I2ZA 1PV4A 1TWAH 3CCRA 3GTKH 1VQNA 1YHQA 2CFMA 5J3BA 4A3LG 2VNUD 3PIOA 3S17H 1X6OA 3CC4A 1D7QA 4B3TQ 1B7YB 3IRBA 4YY3Q 4DV7L 4QGUA 4RMFA 4DV6L 4QY7A 1OXTA 4DV2L 3PF5A 5C44H 2IHEA 4LF8Q 2YU9H 2I5HA 3E0EA 1CSQA 5LMUL 5HGQA 1E22A 4HJ5A 4AIMA 1CKNB 5C44G 2ZM6Q 1PH2A 3PSIA 1Z9FA 1YEZA 4A3IH 1IBLL 5BR8L 3E9HA 3CCVA 2UU9L 2ES2A 2UUBL 4O0AA 3PUVA 3RN5A 4LUVA 5FJ8H 4DV5L 1J5EL 2HHHL 2BH8A 2VS1A 4IPHA 1OXVA 4DV6Q 4JI0L 4A3IG 4L5TA 1O7IA 3TS0A 4JBKA 2UUCL 5JJLA 3CF5A 4FDBA 2VUMH 3U4VA 3KJOA 1K3RA 1X65A 4JI3L 1DGSA 2JA8G 3CD6A 1PVOA 4OONA 3MEFA 2IHFA 4LFBL 2K52A 4TVAB 1C7YA 1EYGA 1TWGH 4GS3A 4JI1Q 2VUMG 4AQYL 4DR6L 2NVXH 2D0PA 5GQOA 4UY8C 4LFCL 1VQFA 1UE5A 1PH1A 3CCQA 1S72A 1K9MC 2UUBQ 4GN5A 1N9WA 3GTOH 3EIVA 2C35B 2MQHA 4EQ5A 3F2CA 1VQGA 4A3JH 2CCZA 2QA4A 4DUYL 2R7DA 1YJ9A 3HOVH 2ALYB 3L0OA 2UUCQ 4P74A 1YNXA 2N3SA 3RR5A 4IOAA 2PQAB 2KCTA 1KXLA 4H02A 4A3BH 1ASYA 1OXSC 3S1MH 1EOVA 1XJVA 1PH3A 1HNXQ 1IBKL 4A3JG 3U58A 4JI3Q 4X65L 1JJGA 2EQSA 2KBNA 3AFQA 4R4TA 3UDGA 1VQEA 3PF4A 4OX9L 5C4XH 3CQZH 3HOVG 4IJLA 3CW2C 3MXNB 3M85A 3RLNA 4A3BG 4KLKA 1WYDA 2NVTH 1CKOA 2Z6KC 3KF8B 4L5QA 2MNAA 4X64Q 4GLXA 4B3TL 3S16H 4IFDG 4PZ8A 1Y14B 5EAYA 5M5XH 1N34Q 1HR0W 2F4VL 2E2HH 3H3VH 5C4XG 2UUAL 3HOZH 1XNRQ 4DUYQ 3S1RH 2I0QA 2L15A 2MO1A 1LUZA 3KLWA 2JEAI 3VDYA 4A3DG 1SMXA 4JOIA 5ELOA 4NXML 1AE3A 1EIFA 1L1OA 4YWMA 1Y1WH 2E2JH 4LF4L 3HOZG 3KJPA 2F3IA 1CKNA 1BBWA 5DLQE 3RNUA 4JI6Q 3KF6B 3L2PA 3G6EA 4UP9A 3JAMc 1LTLA 1HNWQ 5IP7H 3HOYG 4QL5A 1N33Q 1A62A 3AYHB 4X66L 4A4IA 3I4MG 2D62A 4X62L 2HT1A 1Y1WG 3A74A 2JA9A 3FKIG 5AJ3Q 1TWHH 4O2DA 1VQOA 2E5LL 5GADC 1FJGL 1X3FA 4J15A 1KRTA 5C3EH 1T9HA 4DV1Q 3S1QH 5IP7G 1OTCA 1N32Q 3GO5A 5IWAL 4DV0Q 3E9IA 1I94L 1PH4A 1VQCA 3S15H 2UXDL 1YHAA 1GO3E 4GNXC 2UXCL 4NXMQ 2K75A 2DUDA 4LUZA 1JT8A 2WAQE 3G4SA 5IT9c 5C3EG 4POGA 2JQOA 3CC7A 3M3YH 2VQEQ 1SR3A 1IBMQ 4YY3L 2OWOA 5ELNA 4JCVE 1ASZA 1I5FA 1B70B 2LXJA 3HKZE 4OXPA 4PZ6A 4DK6C 2E2IH 4LF8L 4P73A 2JEBI 1NBWA 3HOXH 4R4OA 5LMNW 4LF9Q 1W2BA 4HJAA 1KIXA 4KHPQ 3W1GA 4WJ4A 2Z0SA 1IXRA 3J80i 1FJGQ 2IY5B 3H0GH 1PYSB 1HZAA 3PO2H 3AFPA 2ZM6L 1YVCA 3HOXG 2A8VA 2CWPA 2PQAA 1M1KC 1I50H 1LM0A 2K4KA 3I4NG 1JB7A 4A93H 1E24A 3H0GG 1XMOL 4DAYB 1EQRA 4BBSH 3PO2G 4HJ8A 3NBHB 1D8LA 3K7AH 2HIVA 3CCEA 4MNOA 4A3GH 3OW2A 2Q2HA 4LW1A 1I3QH 4C3IH 3BU2A 3HFZB 3RN2A 4A3KH 4L5RC 2NZHA 2WAQG 2K50A 4MZ9A 3WWVA 5IYCH 2JA7H 1IYJB 3B6YA 1OXUA 1BVSA 2LXKA 1PH8A 4B3SQ 2B29A 4DR4Q 3J81c 4AH6A 1A0IA 1JJCB 1NTGA 4JI1L 2IX0A 4A3KG 3CXCA 2K5NA 4HIDA 4OO1I 3KFUA 4JYAQ 1E3PA 5IYCG 3RZDH 5IE8A 4JI4Q 4GNXB 1XMOQ 1GKHA 2N49A 2Y0SG 3K7UC 3KF6A 2RCNA 2JK8A 4YCVA 2RHSB 1GM5A 4C2MH 4JC0A 1YJWA 3CCUA 4GKJQ 4YWLA 5M3FH 2E8GA 3OTOL 4LF7Q 1VQPA 3G48A 4DUZQ 1WI5A 3I55A 1IL2A 4DNIA 1PH7A 1RIPA 5FJ8G 1Z47A 2KHIA 1HNXL 3A5ZB 1MJCA 4A3EH 2UXBL 2IT1A 3AQQA 4MTNA 4XTCS 3H15A 4GN4B 5M3FG 4OWTB 4IOCA 4NXNQ 4WJ3M 1N36Q 1QZGA 3CCJA 3I4OA 4BA1I 3PO3H 1Q12A 3H3VI 3K81C 2XTIA 4X64L 2Q2IA 2OQ0A 4KHZA 4HJ9A 1EIYB 5JJIA 2NZOA 4A3EG 1X54A 2I5MX 3U50C 1PHJA 1N34L 5FLMH 4A3MH 1FVIA 4GKKQ 4YWKA 1SROA 4OWXB 4JI5Q 1XNRL 3F2DA 3HKSA 4DAMA 1QVFA 1YIJA 3TRZA 3OTOQ 3HOWH 1VQ7A 3M7NA 2HIXA 1G6PA 1PFSA 2KCMA 2PI2A 3NEMA 4KI0A 2H5XA 4OO1G 5FLMG 5H1SE 2JJQA 3S1NH 2UXBQ 2YTVA 1P8LA 4JI6L 4B3RQ 1HZ9A 2YTXA 3SGIA 1HNWL 3HOWG 2AKWB 4BY1H 1N33L 3ICEA 1XPUA 2N78A 3OYYA 4DR1Q 4JV5L 1SLJA 1VQAA 2RF4A 5AJ3L 3S14H 1JMCA 1KRSA 2I5LX 1XTDA 4UP7A 1HH2P 4L5SA 3FP9A 2KHJA 1QUQB 3LGJA 3UE1A 4DV1L 1N32L 4BY1G 5LMNQ 4DV0L 4JI7Q 3M4PA 2YTYA 4DPGA 1GVPA 2VY3A 4GLAC 2BA0A 2ZJRA 1Q1EA 2YYZA 3TEHB 4DR5Q 1VQKA 2WB1E 1UE7A 4HJ7A 4ME3A 2VQEL 2VQFQ 2ZTDA 1A8VA 1IBML 3S2DH 1YI2A 4A3CH 3F2BA 4X6AH 3M4QA 4OWWB 4LF9L 1K83H 2YV5A 4AYBE 4DR2Q 1XPRA 4LUOA 4JBMA 4JV5Q 4KHPL 3CMAA 4GNXA 1B8AA 4TQUS 1VQ9A 3GTPH 4B3ML 1HNZQ 5HY6A 1K0RA 1EFWA 1VQ5A 2OTLA 3STBD 3A5UA 2XGTA 3UE0A 3W1BA 3CCLA 2OCEA 1KAWA 4A3CG 1V43A 4YCUA 2IX1A 1SE8A 2A19A 3T1YQ 2WP8J 1P16A 2WFWA 1NMFA 1PH5A 2N8NA 3J80c 4GOPC 4QIWE 4R4IA 4A75A 2AWOA 4R1JA 2EIFA 4C3JH 4IO9A 4GLVB 5JJKA 2BA1A 3UDFA 4Y7NH 5IY0A 3W5OA 1L1OC 1Y1VH 2NVYH 3GTMH 4DR7Q 1J6QA 1S40A 1VQ6A 1KQSA 1YITA 2Q2UA 4A3FH 1Q8KA 2JA6H 2HQLA 4B3MQ 1VQMA 2WB1G 1L0WA 1UE6A 4HIMA 1Y1VG 4B3SL 4R4QA 1IZ6A 5JEAJ 4YHHL 4DK3C 5C0XJ 1NE3A 4P72A 1XPOA 2GVAA 4DR3Q 1KL9A 2ZJQA 2R6GA 3Q8DA 1K8AC 3TQYA 3AEVA 4HIOA 4A3FG 3PGZA 3CMEA 2JA6G 3CAMA 4JYAL 5GAHC 5C0XI 3ZJYC 1VCIA 2B63H 2FXQA 4LFAL 4JI4L 3CPFA 1X9NA 2ZTCA 4JI2Q 3J7A5 3T1HQ 4IPDA 4GKJL 2R92H 2JE6I 3CP0A 4C3HH 2CWAA 1TWCH 1G51A 1XNQQ 3A0JA 1V1QA 4LF7L 4A93G 3NELA 1VQDA 4DUZL 3GTJH 1WOCA 2B63G 4LF5Q 1V9PA 3PV0A 1XMQQ 4BBSG 2K5HA 1SRUA 1EUJA 3CCMA 1QUQA 4DV4Q 2R92G 1VQIA 4DV3Q 3RLFA 4YHHQ 2LSSA 4NXNL 3I56A 1LYLA 4GN3B 4UPAA 1WCMH 3F8TA 3HKZG 3PUXA 1PH6A 1N36L 4IJHA 4A3GG 1A63A 4JI8Q 2EXDA 3D0FA 1W3SA 4NPSA 3ULPA 4NB3A 3GTQH 4LFAQ 2JA7G 4PMWA 4BBRH 4GOPB 1WCMG 3GD7A 4LF6Q 4GKKL 4K0KQ 1K8GA 4JI5L 3F1ZA 3M4OH 3DM3A 3NENA 4YCWA 1L1OB 1HR0Q 3K80C 2MO0A 3GTLH 2CKZB 3U4ZA 1PH9A 1FGUA 4BBRG 3KDFB 1HJPA 5JEAG 5C0XG 2ATWA 5GAGC 4IPGA 2ID0A 4B3RL 5IYDH 1QZHA 3BZCA 1S3OA 1MJEA 1VQLA 1BKBA 4A76A 3ERSX 3S2HH 2AMCB 3CC2A 4DR1L 2RHQB 1CSPA 1JE5A 4IFDJ 2QGQA 1VQHA 1U5KA 4DV7Q 2JA8H 4APVA 4DV2Q 4BY7H 1RL2A 5IYDG 1Q81C 4JG2A 2NVQH 3J81i 3RZOH 5LMNL 4IFDI 4PZ7A 3PO3G 1I6HH 4JI7L 1SFOH 4UP8A 1C9OA 3S24A 3PCOB 5LMUQ 2PNHA 2Z6KA 1NMGA 2AWNA 3GDEA 2QEXA 4DR5L 4A3MG 1NY4A 4BY7G 1GD7A 5C4JH 3KOJA 1WJJA 2AHOB 4BXXH 2VQFL 1QVCA 2PI2E 1IBLQ 5BR8Q 1G291 3JC66 1CUKA 1PYBA 1MIUA 1X3GA 2UU9Q
chains in the Genus database with same CATH superfamily
2J4XA 2F0FA 4DR2L 1HCZA 2FK1A 2HHHQ 2YS6A 4HIKA 2KVMA 1KLUD 4IZ8A 1JJ2A 4J9KA 3SK4A 4F88A 3OMCA 4C2MB 5J1ZA 2XIWA 3P75A 3NQTA 2C28A 2VL6A 2ZTEA 4FXDA 1UE1A 4PG3A 1TWFH 1CI3M 4LFBQ 3OHBA 4LAAA 1KC8C 4CC5A 1JWMD 3C3LA 3PIP3 2A1AA 5IOCA 2K05A 2VZAA 4QJFA 4C1NI 4DR6Q 2CQOA 1EYZA 2VW9A 4A3DH 2KJXA 3PO3B 5GROA 5BMVF 5J2TF 3M9BA 4GOPA 4IPCA 2NU9B 1KD1C 2BQUA 1PTOF 4A2AA 3R93A 5KFBA 4O4IF 2EY5A 2XNAC 4EGQA 4EBDA 3DMUA 2ASBA 2V5AA 3BJUA 4JBWA 1E7ZA 4O3SA 4IQZA 2UU9H 1Q90A 4JI2L 3PUWA 4JV1A 3T1HL 5IP9G 5LOVF 1JORA 5KFAA 3STBC 2F0HA 1J5EH 5EWFA 1I4XA 3ER0A 4K5WA 5IYBH 4FXGC 4HYKA 2K14A 1EEID 2QDBA 4K8IA 2PZUA 5K36G 5LMNH 2MGSA 2I07B 3I7FA 2K7VA 2JA5G 1E4EA 2KHSA 2X0SA 4IUNA 2OF1A 4KTAA 1FGBD 1ZYRD 3G6YA 1MBYA 2AUKA 2EOTA 3K0XA 2GVBA 2L12A 4ALPA 2YU9A 3MFHA 4OL7A 1XDNA 3QIAA 4U673 2Y0SA 4RCNA 4LF6L 3VR6A 4X66Q 1KAAA 3CRKC 4X62Q 5ELFA 1Q1BA 1HR0L 1EY6A 1JDBB 4EG0A 1K1QA 4J9OA 1NJIC 1RJQA 1K8OA 5IWAQ 3ULLA 3TREA 1HFNA 2Z1CA 3J7ZC 3R3OA 1PXUA 2H1EA 2NTTA 4HCSA 2FHTA 1TWAH 3GTKH 1VQNA 3QB3A 1HUMA 2VNUD 3PIOA 4LH7A 1SDFA 3CC4A 4WJWA 3IRBA 4YY3Q 4DV7L 4B3TQ 3PF5A 4IUPA 4C3JB 2IHEA 3MAQA 4LF8Q 3PN1A 5CV7A 1DZ1A 3GV7B 2I5HA 2YZMA 2NVXA 1PZJD 2F0PA 1WTVA 5HGQA 4HNUA 3Q1KA 3GTOA 5C44G 1AP0A 4J6HA 1PH2A 1YEZA 2FFKB 5I6YA 1EYAA 3T5HA 3G6VA 5KFTA 2UUBL 1AW7A 3PUVA 4F4ZA 2M2LA 2HHHL 1B9NA 5KG2A 4IPHA 3MXPA 4DV6Q 3KHGA 4L5TA 1O7IA 4KJNA 4TSSA 4ECWA 1PFNA 1JB3A 2XWBB 4DR4H 2RGRA 2VPSA 3GTJB 3CD6A 1DGSA 2JA8G 1NCVA 1XX8A 5FO8B 4OONA 4ZCKA 5DAUA 4LFBL 3H91A 1T3NA 4FP5D 2HDMA 4V0BA 2JA7B 3J80L 4DR6L 2F0GA 1JCKB 1F9SA 1PMRA 5KG1A 1PH1A 2FMMA 4KD4A 3SEBA 4FU0A 5A35A 2RKSA 3RUZA 3GIQA 2MQHA 1AFPA 4IURA 4EQ5A 3F2CA 2CCZA 1EY9A 2R7DA 5CBEE 1YJ9A 4BBRB 3HOVH 4O3OA 4P74A 5JVDF 2VB2X 2F0QA 3RR5A 2IX3A 2PQAB 2KCTA 2HJWA 4FS1A 4A3BH 5IYZF 3Q0AA 1CM9A 3M4OB 1XJVA 1HNXQ 4JI3Q 1BJTA 1HTLD 3FMCA 2ZDHA 5JH7F 1PK8A 3Q8SB 3MXNB 3ETHA 1EWCA 2NTSA 3TP5A 2W9CB 3T5LA 4DV2H 4EGJA 5E3FA 4C1NK 2MJ8A 4LK1C 4PZ8A 1BDOA 1SMYC 1Y14B 5EAYA 1N34Q 4B08A 1HR0W 2E2HH 3S2HB 5F9NA 5EDWA 3HOZH 2CH4W 3BS1A 2BR0A 1A3UA 4BY7B 1S5BD 1I6HB 1EIFA 4N9TA 1SFOB 1YNND 1WD1A 1E2WA 2XRQD 2ZXPA 1HUNA 3G6EA 5ELBA 4O3NA 3AYHB 2BE5D 4X66L 3I4MG 2R8IA 3KLRA 4X62L 5C5JA 4FBUA 3HRZC 3A74A 2V9WA 3FKIG 5AJ3Q 4I50F 1VQOA 1N32Q 5C3EH 4DFAA 2M00A 4DV1Q 2G5DA 5IP7G 3GO5A 4CDEC 5IWAL 1ICWA 4O42A 5KFSA 1YHAA 2HQEA 1K28A 2O4XA 4WD3A 5IT9c 5H80A 2FINB 3PW5A 4POGA 1FNWA 3TSSA 2SNSA 2IP4A 4B3TL 4YY3L 2E2IH 4OXPA 1BGWA 1T5EA 4DK6C 3WO0A 4LF8L 4P73A 1UNNC 2F1MA 2JEBI 1KBLA 4R4OA 1W2BA 1B4OA 4PMCA 5JVG3 4HJAA 4WJ4A 2VA2A 4DUYH 1XNRH 1IXRA 3F8NA 3J80i 3GTQA 3EPGA 3H0GH 2W6ZA 2R93B 3BVMA 3PW0A 1WTQA 4CKBA 1CZWA 4DL5A 1RK5A 4HTHA 1PTOH 3BDCA 1E24A 5KNCA 2W7PA 2R7ZB 1EQRA 4BBSH 3PO2G 4HJ8A 1R4QB 1EY0A 4NLGA 1A3VA 1D8LA 3QOLA 3Q22A 1LV9A 3OSPA 1NAPA 3A56A 3J7YW 2FLLA 4L5RC 3BU2A 2I46A 3HFZB 3K6OA 4A3KH 2NZHA 2WAQG 1D5XC 2K04A 5IYCH 5KFGA 1BVSA 4NXMH 4J9LA 4XYMB 5IGFA 1A0IA 4XYLB 3PIO3 3EPIA 4TUYF 5M5WB 2L1BA 1GSOA 4JYAQ 4I7AA 5EGTA 5EPKA 5IE8A 3HOUB 4DK1A 4GNXB 1GKHA 3K7UC 2JXMB 2RCNA 2JK8A 1XWEA 4GKJQ 4JC0A 1YJWA 3I72A 3VR5A 4EQOA 2V59A 1LTGD 2HVRA 3ORQA 4KKUA 2E5LH 3R2TA 4LF7Q 5DQHA 2RSOA 3I55A 1IL2A 3R23A 1QE6A 5DQIA 1HNXL 2ZXRA 2UXCH 4DNTB 1BQQT 4EBCA 2IT1A 4MTNA 1CQFA 2K5WA 3MWEA 4WBNF 1S9FA 1ZQ7A 1N36Q 1QZGA 4CJ1B 1BXTA 3I4OA 2EVBA 1CZGA 2ZDQA 2GA4B 4HJ9A 2Q2IA 3D6WA 4FS2A 2I5MX 1UNSA 1N34L 1BCPC 1TWFA 1FVIA 3F2DA 1IKMA 3BJYA 1ILQA 1VQ7A 1CS0A 2RBMA 2KCMA 2ZM6H 4E6IA 4KKTA 2JP1A 2HVSA 4QF4A 2WKDA 2V4RA 5H1SE 2K01A 3S1NH 2UXBQ 1B9MA 3G8CA 4ZUJA 2WINB 2HUGA 3OSOA 4J9PA 5C4ZA 4EEYA 5CV6A 4A3IB 3QZ8A 3H4DA 4KY5A 3OYYA 3MXGA 4UCTA 3F2UA 2F0JA 4Z9CB 5AJ3L 4O2BF 4IUQA 3NTIA 3N43B 4L5SA 1N32L 4EYHB 5CORA 1QUQB 4DV1L 3SI8A 2TSSA 3EROA 4JI7Q 3TP6A 4PMBA 1NR4A 2VY3A 3I70A 1STAA 1TU2B 2BA0A 4ZUIA 2R6FA 2OH2A 4JI1H 4DR5Q 4AYBA 4TKOB 1D5MC 1STYA 2VQFQ 3S2DH 1GJXA 4I65A 3SE0A 4LUOA 1XXGA 1B8AA 1VQ9A 4BWGB 3GTPH 5HBRB 1HNZQ 5L9XA 1K0RA 4CHTB 3VR3A 2OTLA 3STBD 2XGTA 1SBBB 3CCLA 2G9HD 2PCFB 1CHPD 3LWUA 2IJ0A 3RMHA 3T1YQ 5IT9E 3N8DA 4YB8B 1P16A 2SDFA 4DXGA 2J9GA 1PH5A 1EU4A 4U68A 3TMEA 4QIWE 2IMWP 2PNRC 2E2DC 4G7OC 4GLVB 2HCIA 4IRCA 4DR1H 1IL8A 5CV4A 3W5OA 5C4XB 3GTMH 3ORRA 4UFZA 3KHLA 2R7LA 4A3FH 5C1PA 5FO9B 1TAEA 1UE6A 5M5XB 1TS4A 1Y69U 4R4QA 1IZ6A 4YHHL 3HB9A 2RQXA 5IGBA 1G91A 4IHJF 4DR3Q 1KL9A 1PTOC 2Q8IB 1JDEA 1EY5A 1IYUA 4JYAL 3CAMA 5GAHC 1DJRD 2ATLA 2B63H 3CPFA 1X9NA 2E2JB 1I6VC 3MR3A 2F0IA 4JV5H 4GKJL 1G2SA 3OIQA 2JE6I 2NU7B 5KFRA 1TWCH 4KK7A 4LF7L 1EYDA 3NELA 4RNNA 5K5PA 4KMUC 4JV0A 4LF5Q 2WIIB 2W8KA 2QK4A 3PV0A 1XMQQ 2RDFA 3R5XA 3CCMA 1LT5D 5I9OA 3BDOA 1VQIA 2V4QA 1PH6A 4GN3B 3PUXA 3F8TA 1E2VA 2EZVA 1XYIA 1N36L 4IJHA 1A63A 3T51B 4L8JA 1L0XB 2EXDA 2LKVA 3S15B 1Z2OX 4NPSA 1W3SA 2W71A 5CBAE 1JX4A 4NB3A 4LFAQ 2JA7G 1Y8NB 2QYZA 1UEAB 4GOPB 5C0XH 4K0KQ 1RJPA 3F1ZA 3QOJA 5FOBB 1ET9A 4B3MH 4YCWA 4MTEA 1L1OB 1NR2A 3HOXB 3K80C 3GTLH 3GV8B 1GSHA 2CKZB 5F2DA 3U4ZA 1PH9A 4QWAA 4BBRG 3Q8RB 4ECTA 3I4NB 3GIMA 5JEAG 4ZRZA 2ATWA 2FMAA 2OLSA 2F0SA 3BZCA 1S3OA 1MJEA 2YYAA 2PW7A 4Q44A 1ULZA 4EVOA 4QW9A 5KFUA 1O80A 2R8GA 2D9UA 2XSCA 5EKLA 5BN5A 2JA8H 1RL2A 5IYDG 2NVQH 2L4NA 3RZOH 5CGKA 4JI7L 3EVQA 3PCOB 4R8NA 1GUOA 2EPBA 5A2QW 1I3QB 3HS0C 4C3IB 2AWNA 4BY7G 3GDEA 4DR5L 5KG7A 2E2HA 3KOJA 2BDNA 1WJJA 2AHOB 2VQFL 1JOOA 2CQAA 1IBLQ 4JI4H 1G291 4YCUA 1CKMA 1MIUA 1H9JA 5KKNB 5KFDA 4LF6H 3PIPA 1DONA 4DV5Q 2XD4A 1EZ8A 1E4GT 4ZYSA 1RTOA 1HNZL 3K8AA 1Q7YC 3E5NA 4DUZH 2C22A 1HR0H 3G71A 1R9TH 4F4WA 3T1YL 1VS0A 1HRJA 4NXNH 1SMYD 3MZ5A 4LSXA 1DM0B 4APMA 4J9RA 4ECSA 2H4OA 4JBJA 1VQ4A 3I4LA 3VYUA 3UFXB 4AQYQ 1VQJA 4LFCQ 4ZQIA 1TS5A 3SK5A 4HEDA 5KFIA 3G7LA 1JICA 5FPOA 4KN7C 1LTRD 1RD9D 1EIHA 3TINA 3ULJA 3BVGA 5M5YH 4H13C 4DR3L 1HFGA 2NB0A 5FLXc 3I4MH 4QWCA 3JZIA 2QCPX 2R93G 2LS01 3FKIH 4EX5A 3J81L 4X65Q 3W2DA 3TQTA 1TS3A 4OX9Q 3RD4A 4F7XA 3H0GA 5D1OA 5KNBA 4GC7A 4X3UA 4FXKC 4IZOA 4EYIB 5BN4A 4DNRB 2R7ZG 4BY1B 3RLOA 2F0OA 2B2VC 4R8UA 2F4VQ 1MKHA 4LF5L 1XMQL 4NDXA 2UUAQ 1VBHA 5M3MH 3K57A 5FLXW 3J7AK 1TXYA 2XCAA 5E4WC 1U0LA 4YP3A 3PR5B 2NN6H 1AH9A 4LFBH 1RYSA 3FHWA 4YIJA 4H7BA 4LF4Q 4C5CA 4X3TA 5I2XA 1STEA 5GAEC 2W8LA 1BOSA 2MCTA 4K0KL 5EKIA 4QUFA 3KYHC 4ULLA 3HOUG 2AUJD 1OO9B 2F0DA 3TS2A 1V4YA 3JRWA 3M9OB 1LT4D 3D31A 1GUGA 3RFCA 1HQMC 1TIID 2BH2A 4LMQD 3UDIA 2V1CC 1I94Q 1X3EA 2UXDQ 4U6PA 4ZHQF 3E5SA 3JSLA 5DG8A 2R7FA 2BDOA 3A8JE 4BA2I 3WNZA 1WTWA 2EY6A 4S3SA 2CFMA 3DWAA 5J3BA 1LTAD 5LL6S 4A3LG 4C5BA 3S17H 2R8JA 1X6OA 2IPKD 1ZKOA 1B7YB 4DR7H 4QGUA 1GHJA 4QY7A 3TBIB 5JQWA 3PW7A 1BF4A 2JEJA 2W6MA 2NVYB 2XCLA 2G9DA 2XN9C 2W9BA 2UVWA 5KX5F 4FF4A 1VBGA 1V1PA 4AIMA 2F0TA 4DL3A 5HV6A 3IFTA 3PSIA 4HR7A 4MV4A 2LMCB 1IBLL 2JSOA 3E9HA 3CCVA 1FR3A 3N6XA 2DIKA 2ES2A 3RN5A 3RUPA 4DV5L 4A93B 4X62H 2K28A 5EPJA 3TS0A 4A3IG 3HBLA 3RV4A 4JBKA 2UUCL 2WV6D 3CF5A 4FDBA 5G3LD 2VUMH 2NU6B 4C3HB 3X3NA 2FPIB 3LWBA 3J81W 1BCPD 1II3A 2HDLA 4HSVA 4X3SA 3MEFA 1E0BA 2B39A 3CRLC 1TWGH 5IGCA 2W70A 1SAPA 2K5QA 4AQYL 4G7ZC 3V05A 2B8FA 4LFCL 5KG4A 2ASLA 1S72A 1I7LA 4ILWA 4QMGA 2UUBQ 4XQJA 1N9WA 4RB0A 1F9PA 2C35B 3GTQB 1NNXA 4A3JH 2A6HC 3BABA 4K2KA 1YNXA 3I12A 3Q6SA 2N3SA 2BOSA 4IOAA 4IAJA 1KXLA 1SYBA 5D65A 1LTBD 1QCBD 5LL6X 4K5VA 3BYYB 3U58A 4F8MA 4X65L 3GTPA 3AFQA 3PF4A 1IKLA 4OX9L 2X6GA 3CW2C 2R85A 2DY7A 2ZDGA 5AFWA 3KHRA 1MGSA 2HCCA 4M1UB 4IFDG 3S16H 4DV6H 4X64Q 3KBGA 5KYLA 1QILA 2F4VL 3H3VH 4ZOLF 5C4XG 2UUAL 1ENCA 4K5XA 2EYPA 2MHVA 3OWFA 5LMUH 2W7OA 2WB1A 5FLXE 3VR4A 3KLWA 2VXWA 5JVH3 5CA1F 5ELOA 3GTMA 1L1OA 1X3QA 1LLRD 3D3RA 1Y1WH 4LF4L 3PVXA 1S97A 5EOYA 3MEHA 4C5AA 2F3IA 4NMZA 1CKNA 1BBWA 2B2VA 4JI6Q 5BR8H 4LJZC 2ZJTA 4UP9A 5C4JB 1S0NA 3GV5B 2D62A 1T94A 2KQ3A 4JI0H 5KT7A 3FPPA 1TWHH 1WTRA 1FJGL 5J22A 2B63A 2RCFA 1D1KA 1V8QA 3S1QH 5BPHA 5I47A 2PPBC 2FPGB 2KOLA 1U9RA 4DV0Q 2UXDL 1I94L 4JI3H 1GO3E 2M05A 2K75A 2EY1A 1TWCA 2A68C 1PFBA 1SYFA 3G4SA 1C30A 1B2TA 4PWQA 1B1ZA 5CMDA 1I3QA 2C2RA 4ED6A 5JPNC 1TWFB 3KHHA 4HNTA 3HKZE 3ITPA 1N34H 1PTOD 4ME5A 1EEFD 1M8AA 2B2YC 3ONAB 1KIXA 3W1GA 5KT5A 2Z0SA 4A3DB 1HXYD 4JW0A 3BA8A 4TQRA 1G8ZD 3CHBD 1YVCA 3HOXG 3QFFA 5EWEA 1IBKH 2CWPA 1I50H 1LM0A 3I4NG 2O2LD 2JN4A 4CJ2C 2Z8LA 1SSOA 3V6KA 1XMOL 3K5MA 3K7AH 2HIVA 4QCLA 1VMPA 4MNOA 1CA6A 1STHA 2Z9HA 2FJZA 1E2ZA 4LW1A 2EYHA 3BYTB 3U9TA 1KABA 4MZ9A 4I7HA 5DG7A 2SNMA 5TSSA 5IIFA 1IYJB 1ZXTA 4XQQA 1H9MA 2LXKA 4AYBB 4B3SQ 2B29A 2JA7H 3OUUA 4KV6A 3FDSA 3H94A 5K2MA 4HSPA 1NTGA 3NUCA 4C3IG 1Y8OB 1S0MA 2NYZD 3PQIA 2B2UC 1D6EC 2A74C 3RZDH 1PRTC 4RGTA 4PDBA 2WKCA 2N49A 2Y0SG 4YCVA 3HGBA 3KF6A 5KFNA 4MN3A 2BCOA 4YWLA 1JWSD 3T56B 5M3FH 3OTOL 1VQPA 4CJ0B 1WI5A 1QNKA 4DNIA 1RIPA 3E3XA 1Z47A 2KHIA 2RDGA 3HEJA 4A3EH 4DAPA 1MSGA 4XTCS 3HP3A 3CCJA 5FPRA 1KTKA 4LMYA 2P0AA 4Q8EA 2CH4A 1SYGA 3NWSA 1KDBA 3A55A 4X64L 4KHZA 3KLSX 3Q23A 1TWAB 1BO0A 4OO1H 4B9XA 5KGUA 4DAMA 3EJIA 1RK6A 5FK9C 4RNOA 3QJYA 3D4RA 2MPMA 2K32A 3HOWH 1GXDC 3TDQA 3RAQA 2PI2A 4KI0A 3NEMA 2EYJA 2H5XA 4XX0B 3V4ZA 5FLMG 2W6NA 2JJQA 5KG5A 4JI6L 2EJGC 4JYAH 3VMMA 5IT9L 4IUUA 2N55A 2AKWB 1B6RA 3X3MA 3DWQA 2EXZA 4J9NA 2XGQA 4GKJH 2N78A 4KKSA 3LMLA 1SLJA 1VQAA 4DAYA 4ECQA 5M9OA 1CT1D 3S14H 2ICIA 1KRSA 4FVMA 4EGVA 4EQPA 4LF7H 1HH2P 3LGJA 3AB9A 5JVLA 4BY1G 4K6DA 5LMNQ 4DV0L 2DLNA 4DPGA 2F0KA 1CE8A 2NVYA 3SXHA 1RTNA 5LL6b 2D5DA 4YJ3F 1N36H 2YYZA 1O78A 3TEHB 2WB1E 2GLTA 2ZTDA 3AU7A 4FF1A 1KDAA 3F2BA 3M4IA 3M4QA 4OWWB 4HQ6A 1K83H 2NUCA 2YV5A 1E4FT 4PQXA 2PVPA 2B2TC 4M7EA 2RDHA 3K59A 5HY6A 4OGQC 3WO1A 4DL6A 1JOQA 3A5UA 4QIWA 3W1BA 4A3CG 1S0OA 2OCEA 1KAWA 1AN8A 1V43A 1BCPB 5HGTA 2XWJB 3NP8A 5C6AA 4WFN3 3NQIA 1I4RA 1SE8A 3HOVB 2WP8J 3GILA 2UXBH 1HA6A 3P20A 3A7LA 2B2YA 3ND9A 3J80c 2W9AA 4R4IA 4A75A 4A3BB 2AWOA 4TV9F 2EIFA 1O75A 4IO9A 4DXFA 3UDFA 4Y7NH 5IY0A 1Y1VH 1TKWB 3TP7A 2AGPA 5DEHA 4MAMA 2DY8A 4FNFA 1S40A 5CV5A 2PMZA 2DWCA 3OHAA 2JEFA 2R7KA 4CDCC 2JA6H 3N6RA 1VQMA 1ZHQA 2DNEA 4ED2A 1B6SA 2YZNA 3VYRA 1MHWC 2KCNA 4HIMA 3M4YA 1DV2A 1KEEA 2E2HB 4B3SL 2ENBA 5C0XJ 2I0QA 1WSCA 3HOZB 2ZJQA 4QW8A 2R8HA 3J80W 2R6GA 3Q8DA 3MWYW 1K8AC 1DIKA 4HIOA 3OOCA 3HOYB 4YAJB 3CMEA 1PLFA 1HQRD 5C0XI 3ZJYC 1VCIA 2JEIA 3MC0B 1JWUD 2F3VA 4IPDA 2R92H 2F0LA 3K5HA 2CWAA 2PO4A 3K0YA 1K3BC 1VF5C 1XNQQ 1V51A 2A6EC 4A93G 2NZ1D 1V9PA 4RB3C 2VR1A 4G3IA 2B2UA 1EOTA 4DV4Q 3T1YH 4DV3Q 4ECUA 3ERQA 4YHHQ 4DR4Q 5CR3A 4C3HG 1DYQA 1LYLA 5C3EB 1WCMH 5KFWA 1TVXA 4A3GG 3U9SA 1STNA 3D0FA 2VQEH 5C1OA 2NUAB 1IBMH 3ULPA 2VUMA 1SJED 2SOBA 3V4SA 4KY7A 1EWHA 3QR8A 3H4BA 4KHPH 3FMAA 2ALZA 1BNZA 1K8GA 2CZGA 1U4PA 2KEEA 3SVMA 1TWGA 1UUPA 3N41B 3NENA 1S5ED 3NE5B 2R84A 5FD6A 2VUGA 4XT1B 1M0WA 4IPGA 2ID0A 3H0GB 4CKCA 5D1OB 1GOZA 3VYSA 1BKBA 3ERSX 1JQYD 3NTHA 3CC2A 4O4HF 3JAML 2WTFA 4R8UB 1PTOB 4DV2Q 4BBSB 4JG2A 5LMNL 2GPWA 3PO3G 4UP8A 2NBFA 4RB1A 3S24A 4WORA 3H20A 3GIDA 3HZXA 3SDZA 4MV8A 4A3KB 1NMGA 2A6HD 2QEXA 3N52A 1GD7A 3NWTA 1GLVA 4R7RA 2C2EA 4L6TB 1QVCA 4LFAH 2PI2E 1R4PB 3JC66 1DCZA 1PYBA 2J6UA 5KG0A 4TV8F 4GC6A 2F52A 4UCOA 1JLLB 1AZPA 4KN4C 5L1KA 1Y1WA 4HCEA 3T4AC 3GTGH 4BXXG 5E7NA 1X55A 2D0OA 1N48A 2OXPA 4DL2A 2F0WA 4RAZA 1QVGA 4IFDH 2K5VA 2KUMA 4DL4A 5KFEA 1TWHA 1LABA 2B2TA 3KALA 1X56A 5EBCA 5ELEA 3RB6A 3V6JA 1HHVA 3MR2A 5EBDA 2OEOA 1E1TA 4GKKH 3GV6A 4JI5H 5T14A 2B3GA 2W9BB 4ECZA 1DOMA 1V1PB 1E1OA 2NN6I 3BDLA 1YBYA 5D8DA 1FL0A 3L7ZC 5IP9H 1WTOA 4HR7B 2C2DA 5JJZA 4IN3A 1FKAH 2ZJPA 2OTJA 4K2LA 1PYWD 5K36H 3PUYA 2QW7A 1YJNA 3CVZA 4MV6A 2JA5H 4ETSA 5DLFA 1LTID 2EYOA 1PZKD 3L4KA 4M9UA 4ZAIA 2A68D 2V58A 1XNQL 1I50A 2NWGA 3CPWA 5L37A 4C3JG 3PMFA 3J7AF 1TWAA 3GTKA 1PA6A 3TIIA 2F03A 1KNEA 4ECXA 4ZLTF 4DV4L 3K5OA 3E0JA 4DV3L 2PMZE 4DR4L 1A6XA 1F2LA 5IYBG 3JAMi 2GPSA 5LP6F 2KCCA 1SN8A 5I4DA 3NBIA 2AQ3B 4AYBG 1WFQA 4DKAC 3JAMW 2QKIC 1S68A 2M9VA 2JEGA 2ZT9C 1JXLA 1M0TA 4DR2H 2P5ZX 1K73C 1GUSA 1YZ6A 1OXXK 4DGZA 2J6SA 3MA2B 3W3AA 4ABNA 4IUVA 3I4NH 4R4CA 2DGYA 2E5LQ 1SNMA 3CCSA 1GGOA 2YRWA 5L1LA 3A54A 3GTPB 1UEBA 3T53B 4X65H 2UXCQ 4YJ2F 1VQ8A 3VA5A 1ZHSA 1QNUA 2DNCA 4TRDA 2A69C 1RJTA 3CCRA 3C2PA 4Y8VB 4CDFC 1D7QA 3QG1A 3M9MB 1TS2A 4DV2L 5KEEA 5C44H 2WB1B 2YU9H 5KG3A 1S5DD 3A7AB 3E0EA 3GTMB 1SNCA 1CSQA 1PRTD 3KLSA 1E22A 4HJ5A 4A3FB 1S03G 1CKNB 2ZM6Q 4G57A 2E74C 1Z9FA 2PZTA 3KK7A 3SHLA 3UQ8A 4JI2H 3T1HH 3A8IE 4OHJA 1WR2A 1BNCA 4YR2A 4O0AA 1F9RA 1GUWA 2BH8A 2VS1A 2B63B 5I2YA 3NHHA 2PZWA 3U4VA 3KJOA 2IL8A 1KJJA 1TWCB 1I94H 5KG6A 3E6ZX 1X65A 1PVOA 2QF7A 2IHFA 3EYYA 1GUTA 4TVAB 4JI1Q 2UVUA 1BUVT 2NVXH 3I73A 2D0PA 5GQOA 3IN5A 4FM9A 5F9LA 1UE5A 3TZUA 5FKAC 1K9MC 4ECYA 1SEBD 4RA8A 3HG9A 3GTOH 3EIVA 4GZYC 1VQGA 4BWSC 3G6XA 2QA4A 4DUYL 2ALYB 1WTHA 4KHVA 2UUCQ 1C4QA 2RA4A 1LT6D 4UHVA 1RJRA 3JRXA 1ASYA 1RDPD 3S1MH 1IW7C 5C3WA 2HD3A 3H40A 3GTLB 2DPIA 4R4TA 3BA9A 2NU8B 4RHRA 3HOVG 3CQZH 5EZYF 4IJLA 2N88A 2DJFC 3M85A 3RLNA 4A3BG 4KLKA 1IHZA 1WYDA 2NVTH 4DV7H 2Z6KC 1B04A 2MNAA 4GLXA 2L5TA 3K5LA 3G6JB 1KJ8A 3OSNA 5JAVA 3S1RH 5DG9A 4A3MB 2L15A 2E2IA 2JEAI 3MXUA 1Y1VA 1JR0D 3VDYA 2NVQB 3RIZA 1SMXA 5KFCA 4NXML 1AE3A 3PW2A 1MD2D 2AQ1B 3HOZG 2JA6A 3KF6B 1HNWQ 4IALA 5IP7H 3HOYG 4DL7A 4QL5A 1N33Q 2UUBH 2L55A 4A4IA 3RBDA 2HHHH 4Q5VA 2HT1A 1LTSD 3ND8A 2JA9A 1ICFB 1YNNC 2UVVA 4K14A 5KFQA 2E5LL 2VB3X 1X3FA 1KRTA 1B3AA 5CAEB 1OTCA 1PH4A 1VQCA 3DWPA 2R92A 2KECA 2UXCL 3M9NB 1YNJC 4LUZA 3HKZA 3GIIA 1SXTA 2R82A 4IR1A 3J7AV 5C3EG 4DR6H 2JQOA 3M3YH 2PYKA 1EHIA 4EBEA 2OWOA 5ELNA 1ASZA 2TMPA 2BQ3A 4LF9Q 1WCMA 3U9OA 5FO7B 4RAUC 3MFGA 4H44C 3WOEA 3ZYYX 1FJGQ 2IY5B 4FBTA 1BXRA 1PYSB 3PO2H 2ZM6L 1PZID 1MSHA 2A8VA 3RV3A 3MR5A 2A6ED 4J9MA 4RUCA 4JI6H 2K4KA 5M5YB 4A93H 4MIUA 2EJFC 3EFXD 3GLKA 3JSNA 3I4MB 1SE3A 2IW3A 3H0GG 4DAYB 3NBHB 2E75C 5IODA 5C3XA 1TT2A 2X69A 2PBZA 3CCEA 2L9HA 1JOKA 1AUVA 4RU9A 3KF8A 2AGQA 4A3GH 2Q2HA 3T13A 4UCUA 2I80A 1SNOA 4XDXA 4J9SA 3WWVA 5C4HA 5A2QE 5EJWA 2A73B 1DOLA 5GONF 1OXUA 4XT3B 1PH8A 3C46A 2R3ZA 4OIJA 3J81c 1OWTA 1W96A 2R61A 4AH6A 5M3MB 5G3LF 1JJCB 4JI1L 4TQSA 1K0SA 2EE1A 4A3KG 1ENFA 3R2IA 4OO1I 3KFUA 3BG3A 4PV1C 1I4QA 5IYCG 1BCPF 4U7CA 1UAPA 3WOFA 4JI4Q 1VDZA 1XMOQ 4X66H 3BZDB 3V2TA 1H9RA 2RHSB 4C2MH 1X3PA 3FRPB 4RGNA 1KDCA 4QIWB 3Q2OA 4O3QA 3RB3A 1QG7A 3D6CA 3VPDA 3G48A 4DUZQ 1GYFA 5IWAH 1PH7A 3EA6A 1BR9A 4O1NA 5FJ8G 3A5ZB 4HAEA 5DNFA 2W6OA 3H15A 4NXNQ 3GTGA 4GN4B 3L9AX 4OWTB 3MWDA 4P2CB 1F2YA 3GIPA 4BA1I 3PO3H 1Q12A 4B3TH 3K81C 4YY3H 2PMZB 2RGVA 2XTIA 5T1IA 1D1IA 2OQ0A 4DLKA 3I91A 4LF8H 3GIJA 2NZOA 4ZI7F 3U50C 1GUNA 4K6LA 3S17B 5CV9A 5DLGA 4O3PA 1F2MA 4RNMA 4ME6A 1YIJA 3OTOQ 4IWXA 3RBEA 3BAAA 3M7NA 2HIXA 5KYIA 2EDGA 5KT6A 5I9PA 2KA7A 1I4GA 1RKNA 1Q8IA 4B3RQ 1HPCA 3SGIA 1HNWL 1FD7D 4ED1A 1T36A 1N33L 4ZK9B 2EY2A 2FMCA 1XPUA 4JV5L 1WH2A 2RF4A 3C1FA 2I5LX 1LTTD 1S4ZA 2F4IA 2JA5A 1U4LA 3UE1A 1PRTB 2PQEA 4L63B 5C8YF 3M4PA 2V4DA 1PX2A 3QZ7A 2Z4IA 1GVPA 4GLAC 2RVLA 5LYJF 4FO2A 4RWSC 2VUMB 1Q1EA 1GSAA 1C8CA 1UE7A 4HJ7A 4ME3A 3R5FA 1KLGD 2F0EA 2W57A 2CW7A 1EQTA 1B33N 1F2ZA 4LF9L 3HXLA 1TWGB 1I4HA 1XPRA 4JBMA 4DN4M 4MA5A 4RHSA 1AN7A 4ID6A 5CYUA 3K3PA 4IUTA 4B3ML 2R7MA 5FD5A 1EFWA 3UE0A 4MV7A 4RZRA 4A3JB 2IWHA 5LXTF 1HNXH 3FVQA 4Q0FA 5EWGA 4ZKBB 4YBZB 1NMFA 5ELDA 4CKEA 4O4LF 4R1JA 4C3JH 4FF2A 5EQ0A 5JJKA 1CQVA 4R9WA 4OEMB 3BQ0A 4H0LC 1WTPA 4DR7Q 1VQ6A 2X6LA 2AQ4A 1YITA 1C3OA 2XC9A 1Q8KA 3S16B 1QJOA 3UI2A 2WB1G 5KIXA 1XPOA 4DK3C 5JOBA 2GVAA 4EEQA 3TQYA 4M8AA 4A3FG 2W6QA 3NXWA 1S10A 3TQ1A 2FXQA 4RCOA 1Y1WB 4JI4L 4QWBA 3GTLA 3J7A5 1EY7A 3K5IA 4UDUC 3OW7A 1M6VA 3A0JA 1V1QA 2A69D 1N32H 4DV1H 4DUZL 3GTJH 1WOCA 4PNYA 2B63G 1DOKA 4JUZA 3RF2A 1SRUA 3J81E 1EUJA 1TWHB 1CQJB 5CV8A 3RLFA 2LSSA 4NXNL 3I56A 3S1QB 3C1EA 4JK1C 4UPAA 4JI8Q 4MV9A 2XIGA 3FEWX 1M7JA 1QOHA 2EYLA 4JV2A 1ZETA 3LX0A 4X3KA 4BBRH 3KAKA 5JEAH 1SE2A 3GD7A 4RKLA 1CQIB 3C0FB 3SE7A 3P1HA 2KEDA 3M4OH 3DM3A 3ETJA 1SEIA 2FK2A 2O5IC 2CW0C 1FGUA 1W6KA 1HJPA 4DU9A 5C0XG 2D2CC 2QEJC 1O7ZA 5D3DA 4B3RL 5IYDH 1QZHA 1VQLA 4Q45A 1R9TA 1CA5A 2F0VA 3S2HH 2AMCB 1VAJA 3CU7A 2Q8RE 2RHQB 1JE5A 1I50B 4IFDJ 5DQGA 1N56A 2FE3A 3PZPA 3GTKB 1XNQH 4APVA 1FNVA 4BY7H 5KFKA 1CTMA 3IAYA 3MHBA 3CQZA 4IFDI 1I6HH 3K7AB 1SFOH 4DV4H 4IRDA 3TN2A 2Z6BA 1C9OA 4DV3H 5LMUQ 4YHHH 1U4MA 1CHQD 5KFXA 5BN3A 4A3MG 1TY2A 1NY4A 1W93A 2B8GA 4YAKB 2C9OA 2CW8A 5BR8Q 1Q86C 1D2BA 2J0TD 1EQVA 2W6PA 2K5DA 4KY6A 2DJGC 4OIKA 3WDNA 1N8RC 2UU9Q 4JPBW 3RGZA 4Y52H 2OQKA 3H3VC 1IW7D 2Q2TA 1H95A 1J5EQ 4QQBX 3EBEA 3FKIA 4J9QA 3NBHA 3RZDB 3RB4A 2ICEC 4JI0Q 2YW2A 4RZQA 5IGGA 3IKJA 5C5LA 1Q46A 2KENA 1I7NA 2LFNA 3VPCA 1ONLA 2O5JC 5M3FB 1VKZA 5KFYA 1L2FA 1D5ZC 4CBVA 4EFBA 4Q43A 4POFA 5IGDA 2VQDA 4A3EB 1SCUB 3MFYA 1AE2A 1KHIA 1HZBA 1EYCA 1M90C 4DR7L 3DUZA 3TZDA 5CC4A 1BBUA 1KJ9A 4LWCA 2MFIA 1Z2PX 2R93H 3EN2A 4P71A 4E4TA 1Q82C 3BZKA 1YHBA 4RGMA 1UWVA 2YS7A 5D14A 2XGPA 2UVRA 3HOYH 4P75A 3MJFA 1EIGA 1AEXA 1TR5A 2QDLA 4QB4A 3PUZA 2DZDA 3KAJA 3L3OC 2R7ZH 3HOWB 1JIHA 5L1JA 1IBKQ 3KDFA 3QO2A 2RSNA 3IL8A 5D1PA 4JOIC 4I4TF 2XRSD 3OMGA 1YNJD 1WVLA 2FLPA 4LNQA 1EWIA 1EU3A 4ED3A 5KFPA 4IRKA 4JI7H 3MR6A 2WAQA 3S14B 1A3TA 2K03A 5M5WH 4RG1A 4YR0A 4DR5H 4JI8L 3HOUH 1C0AA 3GP7A 1EQQA 2VQFH 1EY4A 4DA2A 4F50A 5M3MG 2F0NA 4RFBA 4XIGS 3TIGA 4HNVA 1HZCA 5LHY1 3DLLA 3UDXA 3MFIA 2NN6G 4DF7A 2B2WC 1HNZH 2VA3A 3FDTA 3LNNA 1W6JA 3MWMA 3J81j 3NGDA 1K83B 2CVRA 2Y0SE 2CHBD 4NW2A 2GN5A 1LACA 4LSAA 4A3LH 5C5MA 2YZGA 1X32A 4C2MA 4N9PA 4EFEA 1IOWA 3GQBA 1VQBA 5IT9W 5KFLA 3I2ZA 1ZEQX 1PV4A 2EYMA 1YHQA 4N8FA 5KRUA 4RGOS 4HMIA 3Q8QB 4DV6L 4RMFA 1OXTA 1EZ1A 1KNAA 1B44D 2K1BA 3OWEB 4Y7NB 2E2IB 1IYVA 1SNQA 1Y1VB 2SEBD 3DF7A 4RKBA 5LMUL 2C00A 1Q3LA 1RCVD 2R87A 3OIPA 4G4KA 4DR3H 3DXJC 5EKKA 2JA6B 1A2TA 4I55F 4ODGA 4A3IH 4MTKA 5I6WA 5BR8L 1H9SB 3T16A 2UU9L 4IR9A 4LUVA 1IOVA 5FJ8H 1J5EL 5J2UF 1OXVA 3DEPA 4JI0L 4LF5H 5JJLA 1TA8A 1G2TA 1XMQH 2R86A 2R92B 3VA7A 1A15A 4UCVA 4DAVA 4XYQA 3HKZB 4N8X1 1RYRA 2FP4B 1F9QA 1K3RA 4JI3L 4NP5A 5IGEA 2K52A 1UC8A 3S9WA 2ASJA 1C7YA 1EYGA 4GS3A 2VUMG 4UY8C 1WCMB 1VQFA 3BVZA 3SR1A 4G7HC 3CCQA 2F0MA 3DM1A 3PR4A 4K0KH 4GN5A 1KJIA 4QWDA 1EL0A 5L1IA 1B50A 3L0OA 5KT2A 2R8KA 2YCHA 4ED0A 3KUPA 1EUDB 1KJQA 4H02A 2R7NA 1OXSC 1EOVA 1PH3A 3RJ0A 1DXMA 2MUYA 1IBKL 1SE4A 1XTCD 1JE4A 4A3JG 1JJGA 2EQSA 2KBNA 4Q8FA 3QWNA 3UDGA 1VQEA 5C4XH 4O2AF 2OT2A 4ECRA 5LA6F 1CKOA 1TQOA 3KF8B 4L5QA 1JKJB 5ISRA 5M5XH 2ZXOA 1XNRQ 4DUYQ 2MO1A 4QUCA 1LUZA 1LO5D 5E1FA 3DHQA 3K5NA 1WTXA 2I87A 4A3DG 4JOIA 3FPUB 3J80E 1Z7TA 5EPLA 4YWMA 2E2JH 4HMJA 3KJPA 1IBLH 5DLQE 3RNUA 1GHKA 3RGXA 3L2PA 4YR3A 1G6ZA 3KXYT 3JAMc 1LTLA 3S1NB 1AZQA 1A2UA 1A62A 4DV5H 3M7GA 1Y1WG 4MV1A 4UCSA 4B9WA 3BQ1A 2K33A 2UUCH 4O2DA 2Q8TA 2IBKA 1J8IA 5GADC 4J15A 1T9HA 3GTGB 3E9IA 3D8GA 3S15H 4GNXC 4NXMQ 1FYCA 1QB5D 2DUDA 5A2QL 1JT8A 2B2WA 2WAQE 3D4DA 1O7YA 1BBXC 2CQYA 3GTJA 4AQYH 1EUCB 3NPPA 3CC7A 4LFCH 3T5KA 2VQEQ 1SR3A 1IBMQ 2JA7A 1EFID 4JCVE 1I5FA 1B70B 2LXJA 4I7ZC 4PZ6A 1S5CD 1J9OA 5KFJA 1NBWA 3HOXH 5LMNW 3S2DB 1ZYRC 2RDIA 4KHPQ 4MHEA 1I4PA 1ESFA 2E76C 4FF3A 5NUCA 1HZAA 3AFPA 3KBXA 4FYDA 2PQAA 1UC9A 1AUXA 2HGSA 4XXEA 1M1KC 4OX9H 1PRTF 1JB7A 4EQNA 1RF2D 1HNWH 1K8MA 1N33H 1M4VA 2AGOA 1HA5A 5BPFA 3H6MA 3URYA 3MXNA 2JA5B 2PN1A 1QWYA 2F4VH 4C56C 3V6HA 3Q24A 3T5JA 1STGA 2MP1A 4ZQ3A 2UUAH 3OW2A 2W9CA 1I3QH 4C3IH 3K3VA 3RN2A 5COYA 2YL2A 2K50A 3TP8A 2FKLA 1SYDA 3B6YA 2VOBA 5DGAA 2WE6A 4LF4H 5D3IB 1ILPA 4RB2C 5DGBA 1SJHD 1RODA 2IX0A 4KJOA 3CXCA 2K5NA 4HIDA 4RAYA 4YQWA 1SFOA 3I8ZA 1E3PA 4IWYA 2EJMA 2CW0D 4LF9H 4ED7A 3NSWA 2F0UA 1GM5A 4HN7A 3CCUA 2E8GA 1FJGH 1CK1A 1ENAA 2HVQA 1S5FD 3D4WA 2UXDH 2FB9A 1MJCA 1TY0A 4L1KA 2UXBL 5FLXL 3AQQA 1SNDA 5M3FG 4IOCA 4WJ3M 4DK0A 2DPJA 1F77A 1EZ6A 2WACA 5KFMA 3H3VI 3VYTA 1EIYB 1K1SA 5JJIA 4A3EG 1X54A 1E4EB 1PHJA 2ASDA 1EY8A 5FLMH 4A3MH 3L4JA 4GKKQ 4YWKA 1SROA 4OWXB 1LT3D 4JI5Q 1XNRL 3HKSA 1QVFA 3VPBA 1A9XA 2DN8A 3TRZA 5CB4F 1U4RA 5C44B 3GV3A 2Z4HA 4UCRA 1G6PA 2YU9B 1PFSA 1K83A 4LH6A 1FNUA 4OO1G 5KT3A 2FK3A 5KFVA 2R93A 2PW5A 1P8LA 1T5XD 2YTVA 2J6TA 4XQNA 1HZ9A 2Y0SB 2C5CA 2YTXA 3HOWG 4BY1H 4NKLA 1XMOH 3N40P 3ICEA 4DR1Q 3I3CA 2IA6A 5JPMC 2R7ZA 1JMCA 1XTDA 4UP7A 3FP9A 2KHJA 4WRDA 4F4YA 2O03A 4CGYB 2JA8B 2J7ZA 5ELCA 2YTYA 5DM73 3EQLC 3MTSA 2YRXA 3RZOB 4RUAA 4J8QA 2ZJRA 4O3RA 3N42B 1Y8PB 2JYOA 2FLNA 1VQKA 1C48A 1I6UA 3JAME 2VQEL 1IBML 1L0YB 1A8VA 5KFHA 2BQRA 4ZKCB 1YI2A 4A3CH 4X6AH 1NUCA 1H9SA 1HTPA 4AYBE 4DR2Q 4JV5Q 4KHPL 2NVXB 1VF7A 3CMAA 4XYOA 4TQUS 4GNXA 2RDJA 1SYXB 3GQCA 1B53A 3OTOH 4MTDA 1RHPA 1VQ5A 4J1MA 3GTOB 2FPPB 5E4XA 3IG0A 2LY7A 2I8CA 4XZ3B 4A2BA 2IX1A 3RAXA 3BG5A 3A8KE 2A19A 2BE5C 1R9TB 2WFWA 4B3RH 2WDTA 2N8NA 1NSNS 4GOPC 1JC7A 3V96A 3OHXC 3S1MB 4MV3A 2L11A 2BA1A 3LWEA 4X64H 4QWEA 1DV1A 1L1OC 5KFOA 2NVYH 3CQZB 1MZBA 4MA0A 1J6QA 2K6AA 5T1GA 1KQSA 3IFDA 2Q2UA 2NVTB 2HQLA 2QILA 4B3MQ 4CC6A 3I90A 1L0WA 2EYFA 3RTXA 2FJ2A 1Y1VG 3NK9A 5JEAJ 3NTKA 4J0MA 1NE3A 4P72A 3S1RB 3AEVA 4R8IA 3PGZA 2JA6G 4CDDC 4F87A 4LFAL 1PDQA 4OELB 2ZTCA 3N44B 4JI2Q 3FKIB 3T1HQ 1L2ZA 1ESRA 1H9KA 1VMCA 3CP0A 4C3HH 1G51A 1VQDA 3OPOA 3MVVA 1ML0D 3H09A 5KFZA 4DV0H 4BBSG 1MI2A 3OUZA 2K5HA 3SK8A 3GIKA 1QUQA 1KC7A 2R92G 4JVZA 3HKZG 2KSWA 2VPQA 3AMUA 3GTQH 3BQ2A 3CKIB 4PMWA 2A5HA 2AQ2B 1CFMA 1WCMG 2L0CA 4LF6Q 4V190 4GKKL 3M3YB 1Z6HA 4JI5L 5HURA 4K8JA 2AU0A 4ED8A 1HR0Q 2MO0A 5DM63 5KT4A 2WYOA 4BS9A 3KDFB 5KNDA 1B3QA 1ET6A 1O7LA 1SYCA 3O13A 5GAGC 5KFFA 1WD0A 3PW4A 2F3WA 3PO2B 3P7JA 1SYEA 4RH6A 2SCUB 1STBA 4A76A 4KD3A 4DR1L 1CSPA 3RB0A 2QGQA 3VR2A 1PFMA 1VQHA 3KTMA 1U5KA 4DV7Q 5JUMA 1SNPA 2WAQB 3LP8A 3K58A 4UAIA 1Q81C 3J81i 4F4XA 5CA0F 5J39A 4PZ7A 4ECVA 4Q0YA 3DEOA 3R5HA 4B3SH 4A3GB 2XCPA 2PNHA 3R8BA 2Z6KA 1DD2A 4JI8H 3SK6A 1V1OA 5C4JH 4BXXH 3Q8PB 1CUKA 1Z2NX 2XVSA 1X3GA
chains in the Genus database with same CATH topology
1N8RC 2F52A 4DR2L 4Y52H 2OQKA 3PIPA 2Q2TA 1H95A 4DV5Q 1J5EQ 2HHHQ 4QQBX 3EBEA 1HNZL 3K8AA 4HIKA 1Q7YC 4JI0Q 3GTGH 4BXXG 1JJ2A 3G71A 1Q46A 2KENA 1R9TH 5E7NA 1X55A 2D0OA 2VL6A 2ZTEA 1L2FA 3T1YL 1UE1A 1VS0A 1QVGA 2K5VA 4POFA 4PG3A 1TWFH 4JBJA 4LFBQ 1VQ4A 1KC8C 1X56A 2A1AA 4AQYQ 2VZAA 4QJFA 1VQJA 4DR6Q 2CQOA 4LFCQ 1AE2A 1KHIA 1HZBA 2VW9A 1M90C 4DR7L 4A3DH 1E1TA 5GROA 1BBUA 4LWCA 2MFIA 2B3GA 3M9BA 3EN2A 4P71A 2R93H 1E1OA 4GOPA 4IPCA 1Q82C 2NN6I 3BZKA 1YBYA 1YHBA 1KD1C 1FL0A 1UWVA 3L7ZC 3ULJA 5IP9H 5M5YH 3HOYH 4P75A 4DR3L 5FLXc 3I4MH 3PUZA 2R7ZH 2ZJPA 2R93G 3FKIH 4EX5A 1IBKQ 2ASBA 3BJUA 3KDFA 4X65Q 2OTJA 4JBWA 1E7ZA 3PUYA 1YJNA 2JA5H 4OX9Q 4JI2L 3PUWA 3T1HL 5IP9G 4JOIC 3STBC 3ER0A 5IYBH 2R7ZG 4LNQA 1XNQL 3RLOA 2K14A 1EWIA 3CPWA 1MKHA 2F4VQ 4LF5L 5K36G 3I7FA 1XMQL 2JA5G 2UUAQ 1PA6A 5M3MH 4DV4L 4DV3L 1TXYA 2PMZE 4RG1A 5M5WH 3JAMi 5IYBG 1U0LA 4DR4L 1AH9A 1SN8A 3K0XA 2GVBA 4JI8L 4ALPA 1CKMA 3FHWA 1EQQA 4AYBG 4LF4Q 1WFQA 3HOUH 4DKAC 1C0AA 5M3MG 5GAEC 4XIGS 1HZCA 1K73C 3DLLA 4LF6L 1YZ6A 3UDXA 4K0KL 1OXXK 2NN6G 3KYHC 4X66Q 4X62Q 3HOUG 3TS2A 3I4NH 3J81j 1Q1BA 1HR0L 3D31A 4R4CA 2Y0SE 2DGYA 2E5LQ 2GN5A 3CCSA 4A3LH 1NJIC 2BH2A 1UEBA 3UDIA 5IWAQ 2V1CC 3ULLA 1X3EA 1I94Q 3TREA 2UXDQ 3J7ZC 2R7FA 1VQBA 2UXCQ 1VQ8A 4BA2I 1Q86C 3I2ZA 1PV4A 1TWAH 3CCRA 3GTKH 1VQNA 1YHQA 2CFMA 5J3BA 4A3LG 2VNUD 3PIOA 3S17H 1X6OA 3CC4A 1D7QA 4B3TQ 1B7YB 3IRBA 4YY3Q 4DV7L 4QGUA 4RMFA 4DV6L 4QY7A 1OXTA 4DV2L 3PF5A 5C44H 2IHEA 4LF8Q 2YU9H 2I5HA 3E0EA 1CSQA 5LMUL 5HGQA 1E22A 4HJ5A 4AIMA 1CKNB 5C44G 2ZM6Q 1PH2A 3PSIA 1Z9FA 1YEZA 4A3IH 1IBLL 5BR8L 3E9HA 3CCVA 2UU9L 2ES2A 2UUBL 4O0AA 3PUVA 3RN5A 4LUVA 5FJ8H 4DV5L 1J5EL 2HHHL 2BH8A 2VS1A 4IPHA 1OXVA 4DV6Q 4JI0L 4A3IG 4L5TA 1O7IA 3TS0A 4JBKA 2UUCL 5JJLA 3CF5A 4FDBA 2VUMH 3U4VA 3KJOA 1K3RA 1X65A 4JI3L 1DGSA 2JA8G 3CD6A 1PVOA 4OONA 3MEFA 2IHFA 4LFBL 2K52A 4TVAB 1C7YA 1EYGA 1TWGH 4GS3A 4JI1Q 2VUMG 4AQYL 4DR6L 2NVXH 2D0PA 5GQOA 4UY8C 4LFCL 1VQFA 1UE5A 1PH1A 3CCQA 1S72A 1K9MC 2UUBQ 4GN5A 1N9WA 3GTOH 3EIVA 2C35B 2MQHA 4EQ5A 3F2CA 1VQGA 4A3JH 2CCZA 2QA4A 4DUYL 2R7DA 1YJ9A 3HOVH 2ALYB 3L0OA 2UUCQ 4P74A 1YNXA 2N3SA 3RR5A 4IOAA 2PQAB 2KCTA 1KXLA 4H02A 4A3BH 1ASYA 1OXSC 3S1MH 1EOVA 1XJVA 1PH3A 1HNXQ 1IBKL 4A3JG 3U58A 4JI3Q 4X65L 1JJGA 2EQSA 2KBNA 3AFQA 4R4TA 3UDGA 1VQEA 3PF4A 4OX9L 5C4XH 3CQZH 3HOVG 4IJLA 3CW2C 3MXNB 3M85A 3RLNA 4A3BG 4KLKA 1WYDA 2NVTH 1CKOA 2Z6KC 3KF8B 4L5QA 2MNAA 4X64Q 4GLXA 4B3TL 3S16H 4IFDG 4PZ8A 1Y14B 5EAYA 5M5XH 1N34Q 1HR0W 2F4VL 2E2HH 3H3VH 5C4XG 2UUAL 3HOZH 1XNRQ 4DUYQ 3S1RH 2I0QA 2L15A 2MO1A 1LUZA 3KLWA 2JEAI 3VDYA 4A3DG 1SMXA 4JOIA 5ELOA 4NXML 1AE3A 1EIFA 1L1OA 4YWMA 1Y1WH 2E2JH 4LF4L 3HOZG 3KJPA 2F3IA 1CKNA 1BBWA 5DLQE 3RNUA 4JI6Q 3KF6B 3L2PA 3G6EA 4UP9A 3JAMc 1LTLA 1HNWQ 5IP7H 3HOYG 4QL5A 1N33Q 1A62A 3AYHB 4X66L 4A4IA 3I4MG 2D62A 4X62L 2HT1A 1Y1WG 3A74A 2JA9A 3FKIG 5AJ3Q 1TWHH 4O2DA 1VQOA 2E5LL 5GADC 1FJGL 1X3FA 4J15A 1KRTA 5C3EH 1T9HA 4DV1Q 3S1QH 5IP7G 1OTCA 1N32Q 3GO5A 5IWAL 4DV0Q 3E9IA 1I94L 1PH4A 1VQCA 3S15H 2UXDL 1YHAA 1GO3E 4GNXC 2UXCL 4NXMQ 2K75A 2DUDA 4LUZA 1JT8A 2WAQE 3G4SA 5IT9c 5C3EG 4POGA 2JQOA 3CC7A 3M3YH 2VQEQ 1SR3A 1IBMQ 4YY3L 2OWOA 5ELNA 4JCVE 1ASZA 1I5FA 1B70B 2LXJA 3HKZE 4OXPA 4PZ6A 4DK6C 2E2IH 4LF8L 4P73A 2JEBI 1NBWA 3HOXH 4R4OA 5LMNW 4LF9Q 1W2BA 4HJAA 1KIXA 4KHPQ 3W1GA 4WJ4A 2Z0SA 1IXRA 3J80i 1FJGQ 2IY5B 3H0GH 1PYSB 1HZAA 3PO2H 3AFPA 2ZM6L 1YVCA 3HOXG 2A8VA 2CWPA 2PQAA 1M1KC 1I50H 1LM0A 2K4KA 3I4NG 1JB7A 4A93H 1E24A 3H0GG 1XMOL 4DAYB 1EQRA 4BBSH 3PO2G 4HJ8A 3NBHB 1D8LA 3K7AH 2HIVA 3CCEA 4MNOA 4A3GH 3OW2A 2Q2HA 4LW1A 1I3QH 4C3IH 3BU2A 3HFZB 3RN2A 4A3KH 4L5RC 2NZHA 2WAQG 2K50A 4MZ9A 3WWVA 5IYCH 2JA7H 1IYJB 3B6YA 1OXUA 1BVSA 2LXKA 1PH8A 4B3SQ 2B29A 4DR4Q 3J81c 4AH6A 1A0IA 1JJCB 1NTGA 4JI1L 2IX0A 4A3KG 3CXCA 2K5NA 4HIDA 4OO1I 3KFUA 4JYAQ 1E3PA 5IYCG 3RZDH 5IE8A 4JI4Q 4GNXB 1XMOQ 1GKHA 2N49A 2Y0SG 3K7UC 3KF6A 2RCNA 2JK8A 4YCVA 2RHSB 1GM5A 4C2MH 4JC0A 1YJWA 3CCUA 4GKJQ 4YWLA 5M3FH 2E8GA 3OTOL 4LF7Q 1VQPA 3G48A 4DUZQ 1WI5A 3I55A 1IL2A 4DNIA 1PH7A 1RIPA 5FJ8G 1Z47A 2KHIA 1HNXL 3A5ZB 1MJCA 4A3EH 2UXBL 2IT1A 3AQQA 4MTNA 4XTCS 3H15A 4GN4B 5M3FG 4OWTB 4IOCA 4NXNQ 4WJ3M 1N36Q 1QZGA 3CCJA 3I4OA 4BA1I 3PO3H 1Q12A 3H3VI 3K81C 2XTIA 4X64L 2Q2IA 2OQ0A 4KHZA 4HJ9A 1EIYB 5JJIA 2NZOA 4A3EG 1X54A 2I5MX 3U50C 1PHJA 1N34L 5FLMH 4A3MH 1FVIA 4GKKQ 4YWKA 1SROA 4OWXB 4JI5Q 1XNRL 3F2DA 3HKSA 4DAMA 1QVFA 1YIJA 3TRZA 3OTOQ 3HOWH 1VQ7A 3M7NA 2HIXA 1G6PA 1PFSA 2KCMA 2PI2A 3NEMA 4KI0A 2H5XA 4OO1G 5FLMG 5H1SE 2JJQA 3S1NH 2UXBQ 2YTVA 1P8LA 4JI6L 4B3RQ 1HZ9A 2YTXA 3SGIA 1HNWL 3HOWG 2AKWB 4BY1H 1N33L 3ICEA 1XPUA 2N78A 3OYYA 4DR1Q 4JV5L 1SLJA 1VQAA 2RF4A 5AJ3L 3S14H 1JMCA 1KRSA 2I5LX 1XTDA 4UP7A 1HH2P 4L5SA 3FP9A 2KHJA 1QUQB 3LGJA 3UE1A 4DV1L 1N32L 4BY1G 5LMNQ 4DV0L 4JI7Q 3M4PA 2YTYA 4DPGA 1GVPA 2VY3A 4GLAC 2BA0A 2ZJRA 1Q1EA 2YYZA 3TEHB 4DR5Q 1VQKA 2WB1E 1UE7A 4HJ7A 4ME3A 2VQEL 2VQFQ 2ZTDA 1A8VA 1IBML 3S2DH 1YI2A 4A3CH 3F2BA 4X6AH 3M4QA 4OWWB 4LF9L 1K83H 2YV5A 4AYBE 4DR2Q 1XPRA 4LUOA 4JBMA 4JV5Q 4KHPL 3CMAA 4GNXA 1B8AA 4TQUS 1VQ9A 3GTPH 4B3ML 1HNZQ 5HY6A 1K0RA 1EFWA 1VQ5A 2OTLA 3STBD 3A5UA 2XGTA 3UE0A 3W1BA 3CCLA 2OCEA 1KAWA 4A3CG 1V43A 4YCUA 2IX1A 1SE8A 2A19A 3T1YQ 2WP8J 1P16A 2WFWA 1NMFA 1PH5A 2N8NA 3J80c 4GOPC 4QIWE 4R4IA 4A75A 2AWOA 4R1JA 2EIFA 4C3JH 4IO9A 4GLVB 5JJKA 2BA1A 3UDFA 4Y7NH 5IY0A 3W5OA 1L1OC 1Y1VH 2NVYH 3GTMH 4DR7Q 1J6QA 1S40A 1VQ6A 1KQSA 1YITA 2Q2UA 4A3FH 1Q8KA 2JA6H 2HQLA 4B3MQ 1VQMA 2WB1G 1L0WA 1UE6A 4HIMA 1Y1VG 4B3SL 4R4QA 1IZ6A 5JEAJ 4YHHL 4DK3C 5C0XJ 1NE3A 4P72A 1XPOA 2GVAA 4DR3Q 1KL9A 2ZJQA 2R6GA 3Q8DA 1K8AC 3TQYA 3AEVA 4HIOA 4A3FG 3PGZA 3CMEA 2JA6G 3CAMA 4JYAL 5GAHC 5C0XI 3ZJYC 1VCIA 2B63H 2FXQA 4LFAL 4JI4L 3CPFA 1X9NA 2ZTCA 4JI2Q 3J7A5 3T1HQ 4IPDA 4GKJL 2R92H 2JE6I 3CP0A 4C3HH 2CWAA 1TWCH 1G51A 1XNQQ 3A0JA 1V1QA 4LF7L 4A93G 3NELA 1VQDA 4DUZL 3GTJH 1WOCA 2B63G 4LF5Q 1V9PA 3PV0A 1XMQQ 4BBSG 2K5HA 1SRUA 1EUJA 3CCMA 1QUQA 4DV4Q 2R92G 1VQIA 4DV3Q 3RLFA 4YHHQ 2LSSA 4NXNL 3I56A 1LYLA 4GN3B 4UPAA 1WCMH 3F8TA 3HKZG 3PUXA 1PH6A 1N36L 4IJHA 4A3GG 1A63A 4JI8Q 2EXDA 3D0FA 1W3SA 4NPSA 3ULPA 4NB3A 3GTQH 4LFAQ 2JA7G 4PMWA 4BBRH 4GOPB 1WCMG 3GD7A 4LF6Q 4GKKL 4K0KQ 1K8GA 4JI5L 3F1ZA 3M4OH 3DM3A 3NENA 4YCWA 1L1OB 1HR0Q 3K80C 2MO0A 3GTLH 2CKZB 3U4ZA 1PH9A 1FGUA 4BBRG 3KDFB 1HJPA 5JEAG 5C0XG 2ATWA 5GAGC 4IPGA 2ID0A 4B3RL 5IYDH 1QZHA 3BZCA 1S3OA 1MJEA 1VQLA 1BKBA 4A76A 3ERSX 3S2HH 2AMCB 3CC2A 4DR1L 2RHQB 1CSPA 1JE5A 4IFDJ 2QGQA 1VQHA 1U5KA 4DV7Q 2JA8H 4APVA 4DV2Q 4BY7H 1RL2A 5IYDG 1Q81C 4JG2A 2NVQH 3J81i 3RZOH 5LMNL 4IFDI 4PZ7A 3PO3G 1I6HH 4JI7L 1SFOH 4UP8A 1C9OA 3S24A 3PCOB 5LMUQ 2PNHA 2Z6KA 1NMGA 2AWNA 3GDEA 2QEXA 4DR5L 4A3MG 1NY4A 4BY7G 1GD7A 5C4JH 3KOJA 1WJJA 2AHOB 4BXXH 2VQFL 1QVCA 2PI2E 1IBLQ 5BR8Q 1G291 3JC66 1CUKA 1PYBA 1MIUA 1X3GA 2UU9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R C;  2F52 A;  4DR2 L;  4Y52 H;  2OQK A;  3PIP A;  2Q2T A;  1H95 A;  4DV5 Q;  1J5E Q;  2HHH Q;  4QQB X;  3EBE A;  1HNZ L;  3K8A A;  4HIK A;  1Q7Y C;  4JI0 Q;  3GTG H;  4BXX G;  1JJ2 A;  3G71 A;  1Q46 A;  2KEN A;  1R9T H;  5E7N A;  1X55 A;  2D0O A;  2VL6 A;  2ZTE A;  1L2F A;  3T1Y L;  1UE1 A;  1VS0 A;  1QVG A;  2K5V A;  4POF A;  4PG3 A;  1TWF H;  4JBJ A;  4LFB Q;  1VQ4 A;  1KC8 C;  1X56 A;  2A1A A;  4AQY Q;  2VZA A;  4QJF A;  1VQJ A;  4DR6 Q;  2CQO A;  4LFC Q;  1AE2 A;  1KHI A;  1HZB A;  2VW9 A;  1M90 C;  4DR7 L;  4A3D H;  1E1T A;  5GRO A;  1BBU A;  4LWC A;  2MFI A;  2B3G A;  3M9B A;  3EN2 A;  4P71 A;  2R93 H;  1E1O A;  4GOP A;  4IPC A;  1Q82 C;  2NN6 I;  3BZK A;  1YBY A;  1YHB A;  1KD1 C;  1FL0 A;  1UWV A;  3L7Z C;  3ULJ A;  5IP9 H;  5M5Y H;  3HOY H;  4P75 A;  4DR3 L;  5FLX c;  3I4M H;  3PUZ A;  2R7Z H;  2ZJP A;  2R93 G;  3FKI H;  4EX5 A;  1IBK Q;  2ASB A;  3BJU A;  3KDF A;  4X65 Q;  2OTJ A;  4JBW A;  1E7Z A;  3PUY A;  1YJN A;  2JA5 H;  4OX9 Q;  4JI2 L;  3PUW A;  3T1H L;  5IP9 G;  4JOI C;  3STB C;  3ER0 A;  5IYB H;  2R7Z G;  4LNQ A;  1XNQ L;  3RLO A;  2K14 A;  1EWI A;  3CPW A;  1MKH A;  2F4V Q;  4LF5 L;  5K36 G;  3I7F A;  1XMQ L;  2JA5 G;  2UUA Q;  1PA6 A;  5M3M H;  4DV4 L;  4DV3 L;  1TXY A;  2PMZ E;  4RG1 A;  5M5W H;  3JAM i;  5IYB G;  1U0L A;  4DR4 L;  1AH9 A;  1SN8 A;  3K0X A;  2GVB A;  4JI8 L;  4ALP A;  1CKM A;  3FHW A;  1EQQ A;  4AYB G;  4LF4 Q;  1WFQ A;  3HOU H;  4DKA C;  1C0A A;  5M3M G;  5GAE C;  4XIG S;  1HZC A;  1K73 C;  3DLL A;  4LF6 L;  1YZ6 A;  3UDX A;  4K0K L;  1OXX K;  2NN6 G;  3KYH C;  4X66 Q;  4X62 Q;  3HOU G;  3TS2 A;  3I4N H;  3J81 j;  1Q1B A;  1HR0 L;  3D31 A;  4R4C A;  2Y0S E;  2DGY A;  2E5L Q;  2GN5 A;  3CCS A;  4A3L H;  1NJI C;  2BH2 A;  1UEB A;  3UDI A;  5IWA Q;  2V1C C;  3ULL A;  1X3E A;  1I94 Q;  3TRE A;  2UXD Q;  3J7Z C;  2R7F A;  1VQB A;  2UXC Q;  1VQ8 A;  4BA2 I;  1Q86 C;  3I2Z A;  1PV4 A;  1TWA H;  3CCR A;  3GTK H;  1VQN A;  1YHQ A;  2CFM A;  5J3B A;  4A3L G;  2VNU D;  3PIO A;  3S17 H;  1X6O A;  3CC4 A;  1D7Q A;  4B3T Q;  1B7Y B;  3IRB A;  4YY3 Q;  4DV7 L;  4QGU A;  4RMF A;  4DV6 L;  4QY7 A;  1OXT A;  4DV2 L;  3PF5 A;  5C44 H;  2IHE A;  4LF8 Q;  2YU9 H;  2I5H A;  3E0E A;  1CSQ A;  5LMU L;  5HGQ A;  1E22 A;  4HJ5 A;  4AIM A;  1CKN B;  5C44 G;  2ZM6 Q;  1PH2 A;  3PSI A;  1Z9F A;  1YEZ A;  4A3I H;  1IBL L;  5BR8 L;  3E9H A;  3CCV A;  2UU9 L;  2ES2 A;  2UUB L;  4O0A A;  3PUV A;  3RN5 A;  4LUV A;  5FJ8 H;  4DV5 L;  1J5E L;  2HHH L;  2BH8 A;  2VS1 A;  4IPH A;  1OXV A;  4DV6 Q;  4JI0 L;  4A3I G;  4L5T A;  1O7I A;  3TS0 A;  4JBK A;  2UUC L;  5JJL A;  3CF5 A;  4FDB A;  2VUM H;  3U4V A;  3KJO A;  1K3R A;  1X65 A;  4JI3 L;  1DGS A;  2JA8 G;  3CD6 A;  1PVO A;  4OON A;  3MEF A;  2IHF A;  4LFB L;  2K52 A;  4TVA B;  1C7Y A;  1EYG A;  1TWG H;  4GS3 A;  4JI1 Q;  2VUM G;  4AQY L;  4DR6 L;  2NVX H;  2D0P A;  5GQO A;  4UY8 C;  4LFC L;  1VQF A;  1UE5 A;  1PH1 A;  3CCQ A;  1S72 A;  1K9M C;  2UUB Q;  4GN5 A;  1N9W A;  3GTO H;  3EIV A;  2C35 B;  2MQH A;  4EQ5 A;  3F2C A;  1VQG A;  4A3J H;  2CCZ A;  2QA4 A;  4DUY L;  2R7D A;  1YJ9 A;  3HOV H;  2ALY B;  3L0O A;  2UUC Q;  4P74 A;  1YNX A;  2N3S A;  3RR5 A;  4IOA A;  2PQA B;  2KCT A;  1KXL A;  4H02 A;  4A3B H;  1ASY A;  1OXS C;  3S1M H;  1EOV A;  1XJV A;  1PH3 A;  1HNX Q;  1IBK L;  4A3J G;  3U58 A;  4JI3 Q;  4X65 L;  1JJG A;  2EQS A;  2KBN A;  3AFQ A;  4R4T A;  3UDG A;  1VQE A;  3PF4 A;  4OX9 L;  5C4X H;  3CQZ H;  3HOV G;  4IJL A;  3CW2 C;  3MXN B;  3M85 A;  3RLN A;  4A3B G;  4KLK A;  1WYD A;  2NVT H;  1CKO A;  2Z6K C;  3KF8 B;  4L5Q A;  2MNA A;  4X64 Q;  4GLX A;  4B3T L;  3S16 H;  4IFD G;  4PZ8 A;  1Y14 B;  5EAY A;  5M5X H;  1N34 Q;  1HR0 W;  2F4V L;  2E2H H;  3H3V H;  5C4X G;  2UUA L;  3HOZ H;  1XNR Q;  4DUY Q;  3S1R H;  2I0Q A;  2L15 A;  2MO1 A;  1LUZ A;  3KLW A;  2JEA I;  3VDY A;  4A3D G;  1SMX A;  4JOI A;  5ELO A;  4NXM L;  1AE3 A;  1EIF A;  1L1O A;  4YWM A;  1Y1W H;  2E2J H;  4LF4 L;  3HOZ G;  3KJP A;  2F3I A;  1CKN A;  1BBW A;  5DLQ E;  3RNU A;  4JI6 Q;  3KF6 B;  3L2P A;  3G6E A;  4UP9 A;  3JAM c;  1LTL A;  1HNW Q;  5IP7 H;  3HOY G;  4QL5 A;  1N33 Q;  1A62 A;  3AYH B;  4X66 L;  4A4I A;  3I4M G;  2D62 A;  4X62 L;  2HT1 A;  1Y1W G;  3A74 A;  2JA9 A;  3FKI G;  5AJ3 Q;  1TWH H;  4O2D A;  1VQO A;  2E5L L;  5GAD C;  1FJG L;  1X3F A;  4J15 A;  1KRT A;  5C3E H;  1T9H A;  4DV1 Q;  3S1Q H;  5IP7 G;  1OTC A;  1N32 Q;  3GO5 A;  5IWA L;  4DV0 Q;  3E9I A;  1I94 L;  1PH4 A;  1VQC A;  3S15 H;  2UXD L;  1YHA A;  1GO3 E;  4GNX C;  2UXC L;  4NXM Q;  2K75 A;  2DUD A;  4LUZ A;  1JT8 A;  2WAQ E;  3G4S A;  5IT9 c;  5C3E G;  4POG A;  2JQO A;  3CC7 A;  3M3Y H;  2VQE Q;  1SR3 A;  1IBM Q;  4YY3 L;  2OWO A;  5ELN A;  4JCV E;  1ASZ A;  1I5F A;  1B70 B;  2LXJ A;  3HKZ E;  4OXP A;  4PZ6 A;  4DK6 C;  2E2I H;  4LF8 L;  4P73 A;  2JEB I;  1NBW A;  3HOX H;  4R4O A;  5LMN W;  4LF9 Q;  1W2B A;  4HJA A;  1KIX A;  4KHP Q;  3W1G A;  4WJ4 A;  2Z0S A;  1IXR A;  3J80 i;  1FJG Q;  2IY5 B;  3H0G H;  1PYS B;  1HZA A;  3PO2 H;  3AFP A;  2ZM6 L;  1YVC A;  3HOX G;  2A8V A;  2CWP A;  2PQA A;  1M1K C;  1I50 H;  1LM0 A;  2K4K A;  3I4N G;  1JB7 A;  4A93 H;  1E24 A;  3H0G G;  1XMO L;  4DAY B;  1EQR A;  4BBS H;  3PO2 G;  4HJ8 A;  3NBH B;  1D8L A;  3K7A H;  2HIV A;  3CCE A;  4MNO A;  4A3G H;  3OW2 A;  2Q2H A;  4LW1 A;  1I3Q H;  4C3I H;  3BU2 A;  3HFZ B;  3RN2 A;  4A3K H;  4L5R C;  2NZH A;  2WAQ G;  2K50 A;  4MZ9 A;  3WWV A;  5IYC H;  2JA7 H;  1IYJ B;  3B6Y A;  1OXU A;  1BVS A;  2LXK A;  1PH8 A;  4B3S Q;  2B29 A;  4DR4 Q;  3J81 c;  4AH6 A;  1A0I A;  1JJC B;  1NTG A;  4JI1 L;  2IX0 A;  4A3K G;  3CXC A;  2K5N A;  4HID A;  4OO1 I;  3KFU A;  4JYA Q;  1E3P A;  5IYC G;  3RZD H;  5IE8 A;  4JI4 Q;  4GNX B;  1XMO Q;  1GKH A;  2N49 A;  2Y0S G;  3K7U C;  3KF6 A;  2RCN A;  2JK8 A;  4YCV A;  2RHS B;  1GM5 A;  4C2M H;  4JC0 A;  1YJW A;  3CCU A;  4GKJ Q;  4YWL A;  5M3F H;  2E8G A;  3OTO L;  4LF7 Q;  1VQP A;  3G48 A;  4DUZ Q;  1WI5 A;  3I55 A;  1IL2 A;  4DNI A;  1PH7 A;  1RIP A;  5FJ8 G;  1Z47 A;  2KHI A;  1HNX L;  3A5Z B;  1MJC A;  4A3E H;  2UXB L;  2IT1 A;  3AQQ A;  4MTN A;  4XTC S;  3H15 A;  4GN4 B;  5M3F G;  4OWT B;  4IOC A;  4NXN Q;  4WJ3 M;  1N36 Q;  1QZG A;  3CCJ A;  3I4O A;  4BA1 I;  3PO3 H;  1Q12 A;  3H3V I;  3K81 C;  2XTI A;  4X64 L;  2Q2I A;  2OQ0 A;  4KHZ A;  4HJ9 A;  1EIY B;  5JJI A;  2NZO A;  4A3E G;  1X54 A;  2I5M X;  3U50 C;  1PHJ A;  1N34 L;  5FLM H;  4A3M H;  1FVI A;  4GKK Q;  4YWK A;  1SRO A;  4OWX B;  4JI5 Q;  1XNR L;  3F2D A;  3HKS A;  4DAM A;  1QVF A;  1YIJ A;  3TRZ A;  3OTO Q;  3HOW H;  1VQ7 A;  3M7N A;  2HIX A;  1G6P A;  1PFS A;  2KCM A;  2PI2 A;  3NEM A;  4KI0 A;  2H5X A;  4OO1 G;  5FLM G;  5H1S E;  2JJQ A;  3S1N H;  2UXB Q;  2YTV A;  1P8L A;  4JI6 L;  4B3R Q;  1HZ9 A;  2YTX A;  3SGI A;  1HNW L;  3HOW G;  2AKW B;  4BY1 H;  1N33 L;  3ICE A;  1XPU A;  2N78 A;  3OYY A;  4DR1 Q;  4JV5 L;  1SLJ A;  1VQA A;  2RF4 A;  5AJ3 L;  3S14 H;  1JMC A;  1KRS A;  2I5L X;  1XTD A;  4UP7 A;  1HH2 P;  4L5S A;  3FP9 A;  2KHJ A;  1QUQ B;  3LGJ A;  3UE1 A;  4DV1 L;  1N32 L;  4BY1 G;  5LMN Q;  4DV0 L;  4JI7 Q;  3M4P A;  2YTY A;  4DPG A;  1GVP A;  2VY3 A;  4GLA C;  2BA0 A;  2ZJR A;  1Q1E A;  2YYZ A;  3TEH B;  4DR5 Q;  1VQK A;  2WB1 E;  1UE7 A;  4HJ7 A;  4ME3 A;  2VQE L;  2VQF Q;  2ZTD A;  1A8V A;  1IBM L;  3S2D H;  1YI2 A;  4A3C H;  3F2B A;  4X6A H;  3M4Q A;  4OWW B;  4LF9 L;  1K83 H;  2YV5 A;  4AYB E;  4DR2 Q;  1XPR A;  4LUO A;  4JBM A;  4JV5 Q;  4KHP L;  3CMA A;  4GNX A;  1B8A A;  4TQU S;  1VQ9 A;  3GTP H;  4B3M L;  1HNZ Q;  5HY6 A;  1K0R A;  1EFW A;  1VQ5 A;  2OTL A;  3STB D;  3A5U A;  2XGT A;  3UE0 A;  3W1B A;  3CCL A;  2OCE A;  1KAW A;  4A3C G;  1V43 A;  4YCU A;  2IX1 A;  1SE8 A;  2A19 A;  3T1Y Q;  2WP8 J;  1P16 A;  2WFW A;  1NMF A;  1PH5 A;  2N8N A;  3J80 c;  4GOP C;  4QIW E;  4R4I A;  4A75 A;  2AWO A;  4R1J A;  2EIF A;  4C3J H;  4IO9 A;  4GLV B;  5JJK A;  2BA1 A;  3UDF A;  4Y7N H;  5IY0 A;  3W5O A;  1L1O C;  1Y1V H;  2NVY H;  3GTM H;  4DR7 Q;  1J6Q A;  1S40 A;  1VQ6 A;  1KQS A;  1YIT A;  2Q2U A;  4A3F H;  1Q8K A;  2JA6 H;  2HQL A;  4B3M Q;  1VQM A;  2WB1 G;  1L0W A;  1UE6 A;  4HIM A;  1Y1V G;  4B3S L;  4R4Q A;  1IZ6 A;  5JEA J;  4YHH L;  4DK3 C;  5C0X J;  1NE3 A;  4P72 A;  1XPO A;  2GVA A;  4DR3 Q;  1KL9 A;  2ZJQ A;  2R6G A;  3Q8D A;  1K8A C;  3TQY A;  3AEV A;  4HIO A;  4A3F G;  3PGZ A;  3CME A;  2JA6 G;  3CAM A;  4JYA L;  5GAH C;  5C0X I;  3ZJY C;  1VCI A;  2B63 H;  2FXQ A;  4LFA L;  4JI4 L;  3CPF A;  1X9N A;  2ZTC A;  4JI2 Q;  3J7A 5;  3T1H Q;  4IPD A;  4GKJ L;  2R92 H;  2JE6 I;  3CP0 A;  4C3H H;  2CWA A;  1TWC H;  1G51 A;  1XNQ Q;  3A0J A;  1V1Q A;  4LF7 L;  4A93 G;  3NEL A;  1VQD A;  4DUZ L;  3GTJ H;  1WOC A;  2B63 G;  4LF5 Q;  1V9P A;  3PV0 A;  1XMQ Q;  4BBS G;  2K5H A;  1SRU A;  1EUJ A;  3CCM A;  1QUQ A;  4DV4 Q;  2R92 G;  1VQI A;  4DV3 Q;  3RLF A;  4YHH Q;  2LSS A;  4NXN L;  3I56 A;  1LYL A;  4GN3 B;  4UPA A;  1WCM H;  3F8T A;  3HKZ G;  3PUX A;  1PH6 A;  1N36 L;  4IJH A;  4A3G G;  1A63 A;  4JI8 Q;  2EXD A;  3D0F A;  1W3S A;  4NPS A;  3ULP A;  4NB3 A;  3GTQ H;  4LFA Q;  2JA7 G;  4PMW A;  4BBR H;  4GOP B;  1WCM G;  3GD7 A;  4LF6 Q;  4GKK L;  4K0K Q;  1K8G A;  4JI5 L;  3F1Z A;  3M4O H;  3DM3 A;  3NEN A;  4YCW A;  1L1O B;  1HR0 Q;  3K80 C;  2MO0 A;  3GTL H;  2CKZ B;  3U4Z A;  1PH9 A;  1FGU A;  4BBR G;  3KDF B;  1HJP A;  5JEA G;  5C0X G;  2ATW A;  5GAG C;  4IPG A;  2ID0 A;  4B3R L;  5IYD H;  1QZH A;  3BZC A;  1S3O A;  1MJE A;  1VQL A;  1BKB A;  4A76 A;  3ERS X;  3S2H H;  2AMC B;  3CC2 A;  4DR1 L;  2RHQ B;  1CSP A;  1JE5 A;  4IFD J;  2QGQ A;  1VQH A;  1U5K A;  4DV7 Q;  2JA8 H;  4APV A;  4DV2 Q;  4BY7 H;  1RL2 A;  5IYD G;  1Q81 C;  4JG2 A;  2NVQ H;  3J81 i;  3RZO H;  5LMN L;  4IFD I;  4PZ7 A;  3PO3 G;  1I6H H;  4JI7 L;  1SFO H;  4UP8 A;  1C9O A;  3S24 A;  3PCO B;  5LMU Q;  2PNH A;  2Z6K A;  1NMG A;  2AWN A;  3GDE A;  2QEX A;  4DR5 L;  4A3M G;  1NY4 A;  4BY7 G;  1GD7 A;  5C4J H;  3KOJ A;  1WJJ A;  2AHO B;  4BXX H;  2VQF L;  1QVC A;  2PI2 E;  1IBL Q;  5BR8 Q;  1G29 1;  3JC6 6;  1CUK A;  1PYB A;  1MIU A;  1X3G A;  2UU9 Q; 
#chains in the Genus database with same CATH topology
 2J4X A;  2F0F A;  4DR2 L;  1HCZ A;  2FK1 A;  2HHH Q;  2YS6 A;  4HIK A;  2KVM A;  1KLU D;  4IZ8 A;  1JJ2 A;  4J9K A;  3SK4 A;  4F88 A;  3OMC A;  4C2M B;  5J1Z A;  2XIW A;  3P75 A;  3NQT A;  2C28 A;  2VL6 A;  2ZTE A;  4FXD A;  1UE1 A;  4PG3 A;  1TWF H;  1CI3 M;  4LFB Q;  3OHB A;  4LAA A;  1KC8 C;  4CC5 A;  1JWM D;  3C3L A;  3PIP 3;  2A1A A;  5IOC A;  2K05 A;  2VZA A;  4QJF A;  4C1N I;  4DR6 Q;  2CQO A;  1EYZ A;  2VW9 A;  4A3D H;  2KJX A;  3PO3 B;  5GRO A;  5BMV F;  5J2T F;  3M9B A;  4GOP A;  4IPC A;  2NU9 B;  1KD1 C;  2BQU A;  1PTO F;  4A2A A;  3R93 A;  5KFB A;  4O4I F;  2EY5 A;  2XNA C;  4EGQ A;  4EBD A;  3DMU A;  2ASB A;  2V5A A;  3BJU A;  4JBW A;  1E7Z A;  4O3S A;  4IQZ A;  2UU9 H;  1Q90 A;  4JI2 L;  3PUW A;  4JV1 A;  3T1H L;  5IP9 G;  5LOV F;  1JOR A;  5KFA A;  3STB C;  2F0H A;  1J5E H;  5EWF A;  1I4X A;  3ER0 A;  4K5W A;  5IYB H;  4FXG C;  4HYK A;  2K14 A;  1EEI D;  2QDB A;  4K8I A;  2PZU A;  5K36 G;  5LMN H;  2MGS A;  2I07 B;  3I7F A;  2K7V A;  2JA5 G;  1E4E A;  2KHS A;  2X0S A;  4IUN A;  2OF1 A;  4KTA A;  1FGB D;  1ZYR D;  3G6Y A;  1MBY A;  2AUK A;  2EOT A;  3K0X A;  2GVB A;  2L12 A;  4ALP A;  2YU9 A;  3MFH A;  4OL7 A;  1XDN A;  3QIA A;  4U67 3;  2Y0S A;  4RCN A;  4LF6 L;  3VR6 A;  4X66 Q;  1KAA A;  3CRK C;  4X62 Q;  5ELF A;  1Q1B A;  1HR0 L;  1EY6 A;  1JDB B;  4EG0 A;  1K1Q A;  4J9O A;  1NJI C;  1RJQ A;  1K8O A;  5IWA Q;  3ULL A;  3TRE A;  1HFN A;  2Z1C A;  3J7Z C;  3R3O A;  1PXU A;  2H1E A;  2NTT A;  4HCS A;  2FHT A;  1TWA H;  3GTK H;  1VQN A;  3QB3 A;  1HUM A;  2VNU D;  3PIO A;  4LH7 A;  1SDF A;  3CC4 A;  4WJW A;  3IRB A;  4YY3 Q;  4DV7 L;  4B3T Q;  3PF5 A;  4IUP A;  4C3J B;  2IHE A;  3MAQ A;  4LF8 Q;  3PN1 A;  5CV7 A;  1DZ1 A;  3GV7 B;  2I5H A;  2YZM A;  2NVX A;  1PZJ D;  2F0P A;  1WTV A;  5HGQ A;  4HNU A;  3Q1K A;  3GTO A;  5C44 G;  1AP0 A;  4J6H A;  1PH2 A;  1YEZ A;  2FFK B;  5I6Y A;  1EYA A;  3T5H A;  3G6V A;  5KFT A;  2UUB L;  1AW7 A;  3PUV A;  4F4Z A;  2M2L A;  2HHH L;  1B9N A;  5KG2 A;  4IPH A;  3MXP A;  4DV6 Q;  3KHG A;  4L5T A;  1O7I A;  4KJN A;  4TSS A;  4ECW A;  1PFN A;  1JB3 A;  2XWB B;  4DR4 H;  2RGR A;  2VPS A;  3GTJ B;  3CD6 A;  1DGS A;  2JA8 G;  1NCV A;  1XX8 A;  5FO8 B;  4OON A;  4ZCK A;  5DAU A;  4LFB L;  3H91 A;  1T3N A;  4FP5 D;  2HDM A;  4V0B A;  2JA7 B;  3J80 L;  4DR6 L;  2F0G A;  1JCK B;  1F9S A;  1PMR A;  5KG1 A;  1PH1 A;  2FMM A;  4KD4 A;  3SEB A;  4FU0 A;  5A35 A;  2RKS A;  3RUZ A;  3GIQ A;  2MQH A;  1AFP A;  4IUR A;  4EQ5 A;  3F2C A;  2CCZ A;  1EY9 A;  2R7D A;  5CBE E;  1YJ9 A;  4BBR B;  3HOV H;  4O3O A;  4P74 A;  5JVD F;  2VB2 X;  2F0Q A;  3RR5 A;  2IX3 A;  2PQA B;  2KCT A;  2HJW A;  4FS1 A;  4A3B H;  5IYZ F;  3Q0A A;  1CM9 A;  3M4O B;  1XJV A;  1HNX Q;  4JI3 Q;  1BJT A;  1HTL D;  3FMC A;  2ZDH A;  5JH7 F;  1PK8 A;  3Q8S B;  3MXN B;  3ETH A;  1EWC A;  2NTS A;  3TP5 A;  2W9C B;  3T5L A;  4DV2 H;  4EGJ A;  5E3F A;  4C1N K;  2MJ8 A;  4LK1 C;  4PZ8 A;  1BDO A;  1SMY C;  1Y14 B;  5EAY A;  1N34 Q;  4B08 A;  1HR0 W;  2E2H H;  3S2H B;  5F9N A;  5EDW A;  3HOZ H;  2CH4 W;  3BS1 A;  2BR0 A;  1A3U A;  4BY7 B;  1S5B D;  1I6H B;  1EIF A;  4N9T A;  1SFO B;  1YNN D;  1WD1 A;  1E2W A;  2XRQ D;  2ZXP A;  1HUN A;  3G6E A;  5ELB A;  4O3N A;  3AYH B;  2BE5 D;  4X66 L;  3I4M G;  2R8I A;  3KLR A;  4X62 L;  5C5J A;  4FBU A;  3HRZ C;  3A74 A;  2V9W A;  3FKI G;  5AJ3 Q;  4I50 F;  1VQO A;  1N32 Q;  5C3E H;  4DFA A;  2M00 A;  4DV1 Q;  2G5D A;  5IP7 G;  3GO5 A;  4CDE C;  5IWA L;  1ICW A;  4O42 A;  5KFS A;  1YHA A;  2HQE A;  1K28 A;  2O4X A;  4WD3 A;  5IT9 c;  5H80 A;  2FIN B;  3PW5 A;  4POG A;  1FNW A;  3TSS A;  2SNS A;  2IP4 A;  4B3T L;  4YY3 L;  2E2I H;  4OXP A;  1BGW A;  1T5E A;  4DK6 C;  3WO0 A;  4LF8 L;  4P73 A;  1UNN C;  2F1M A;  2JEB I;  1KBL A;  4R4O A;  1W2B A;  1B4O A;  4PMC A;  5JVG 3;  4HJA A;  4WJ4 A;  2VA2 A;  4DUY H;  1XNR H;  1IXR A;  3F8N A;  3J80 i;  3GTQ A;  3EPG A;  3H0G H;  2W6Z A;  2R93 B;  3BVM A;  3PW0 A;  1WTQ A;  4CKB A;  1CZW A;  4DL5 A;  1RK5 A;  4HTH A;  1PTO H;  3BDC A;  1E24 A;  5KNC A;  2W7P A;  2R7Z B;  1EQR A;  4BBS H;  3PO2 G;  4HJ8 A;  1R4Q B;  1EY0 A;  4NLG A;  1A3V A;  1D8L A;  3QOL A;  3Q22 A;  1LV9 A;  3OSP A;  1NAP A;  3A56 A;  3J7Y W;  2FLL A;  4L5R C;  3BU2 A;  2I46 A;  3HFZ B;  3K6O A;  4A3K H;  2NZH A;  2WAQ G;  1D5X C;  2K04 A;  5IYC H;  5KFG A;  1BVS A;  4NXM H;  4J9L A;  4XYM B;  5IGF A;  1A0I A;  4XYL B;  3PIO 3;  3EPI A;  4TUY F;  5M5W B;  2L1B A;  1GSO A;  4JYA Q;  4I7A A;  5EGT A;  5EPK A;  5IE8 A;  3HOU B;  4DK1 A;  4GNX B;  1GKH A;  3K7U C;  2JXM B;  2RCN A;  2JK8 A;  1XWE A;  4GKJ Q;  4JC0 A;  1YJW A;  3I72 A;  3VR5 A;  4EQO A;  2V59 A;  1LTG D;  2HVR A;  3ORQ A;  4KKU A;  2E5L H;  3R2T A;  4LF7 Q;  5DQH A;  2RSO A;  3I55 A;  1IL2 A;  3R23 A;  1QE6 A;  5DQI A;  1HNX L;  2ZXR A;  2UXC H;  4DNT B;  1BQQ T;  4EBC A;  2IT1 A;  4MTN A;  1CQF A;  2K5W A;  3MWE A;  4WBN F;  1S9F A;  1ZQ7 A;  1N36 Q;  1QZG A;  4CJ1 B;  1BXT A;  3I4O A;  2EVB A;  1CZG A;  2ZDQ A;  2GA4 B;  4HJ9 A;  2Q2I A;  3D6W A;  4FS2 A;  2I5M X;  1UNS A;  1N34 L;  1BCP C;  1TWF A;  1FVI A;  3F2D A;  1IKM A;  3BJY A;  1ILQ A;  1VQ7 A;  1CS0 A;  2RBM A;  2KCM A;  2ZM6 H;  4E6I A;  4KKT A;  2JP1 A;  2HVS A;  4QF4 A;  2WKD A;  2V4R A;  5H1S E;  2K01 A;  3S1N H;  2UXB Q;  1B9M A;  3G8C A;  4ZUJ A;  2WIN B;  2HUG A;  3OSO A;  4J9P A;  5C4Z A;  4EEY A;  5CV6 A;  4A3I B;  3QZ8 A;  3H4D A;  4KY5 A;  3OYY A;  3MXG A;  4UCT A;  3F2U A;  2F0J A;  4Z9C B;  5AJ3 L;  4O2B F;  4IUQ A;  3NTI A;  3N43 B;  4L5S A;  1N32 L;  4EYH B;  5COR A;  1QUQ B;  4DV1 L;  3SI8 A;  2TSS A;  3ERO A;  4JI7 Q;  3TP6 A;  4PMB A;  1NR4 A;  2VY3 A;  3I70 A;  1STA A;  1TU2 B;  2BA0 A;  4ZUI A;  2R6F A;  2OH2 A;  4JI1 H;  4DR5 Q;  4AYB A;  4TKO B;  1D5M C;  1STY A;  2VQF Q;  3S2D H;  1GJX A;  4I65 A;  3SE0 A;  4LUO A;  1XXG A;  1B8A A;  1VQ9 A;  4BWG B;  3GTP H;  5HBR B;  1HNZ Q;  5L9X A;  1K0R A;  4CHT B;  3VR3 A;  2OTL A;  3STB D;  2XGT A;  1SBB B;  3CCL A;  2G9H D;  2PCF B;  1CHP D;  3LWU A;  2IJ0 A;  3RMH A;  3T1Y Q;  5IT9 E;  3N8D A;  4YB8 B;  1P16 A;  2SDF A;  4DXG A;  2J9G A;  1PH5 A;  1EU4 A;  4U68 A;  3TME A;  4QIW E;  2IMW P;  2PNR C;  2E2D C;  4G7O C;  4GLV B;  2HCI A;  4IRC A;  4DR1 H;  1IL8 A;  5CV4 A;  3W5O A;  5C4X B;  3GTM H;  3ORR A;  4UFZ A;  3KHL A;  2R7L A;  4A3F H;  5C1P A;  5FO9 B;  1TAE A;  1UE6 A;  5M5X B;  1TS4 A;  1Y69 U;  4R4Q A;  1IZ6 A;  4YHH L;  3HB9 A;  2RQX A;  5IGB A;  1G91 A;  4IHJ F;  4DR3 Q;  1KL9 A;  1PTO C;  2Q8I B;  1JDE A;  1EY5 A;  1IYU A;  4JYA L;  3CAM A;  5GAH C;  1DJR D;  2ATL A;  2B63 H;  3CPF A;  1X9N A;  2E2J B;  1I6V C;  3MR3 A;  2F0I A;  4JV5 H;  4GKJ L;  1G2S A;  3OIQ A;  2JE6 I;  2NU7 B;  5KFR A;  1TWC H;  4KK7 A;  4LF7 L;  1EYD A;  3NEL A;  4RNN A;  5K5P A;  4KMU C;  4JV0 A;  4LF5 Q;  2WII B;  2W8K A;  2QK4 A;  3PV0 A;  1XMQ Q;  2RDF A;  3R5X A;  3CCM A;  1LT5 D;  5I9O A;  3BDO A;  1VQI A;  2V4Q A;  1PH6 A;  4GN3 B;  3PUX A;  3F8T A;  1E2V A;  2EZV A;  1XYI A;  1N36 L;  4IJH A;  1A63 A;  3T51 B;  4L8J A;  1L0X B;  2EXD A;  2LKV A;  3S15 B;  1Z2O X;  4NPS A;  1W3S A;  2W71 A;  5CBA E;  1JX4 A;  4NB3 A;  4LFA Q;  2JA7 G;  1Y8N B;  2QYZ A;  1UEA B;  4GOP B;  5C0X H;  4K0K Q;  1RJP A;  3F1Z A;  3QOJ A;  5FOB B;  1ET9 A;  4B3M H;  4YCW A;  4MTE A;  1L1O B;  1NR2 A;  3HOX B;  3K80 C;  3GTL H;  3GV8 B;  1GSH A;  2CKZ B;  5F2D A;  3U4Z A;  1PH9 A;  4QWA A;  4BBR G;  3Q8R B;  4ECT A;  3I4N B;  3GIM A;  5JEA G;  4ZRZ A;  2ATW A;  2FMA A;  2OLS A;  2F0S A;  3BZC A;  1S3O A;  1MJE A;  2YYA A;  2PW7 A;  4Q44 A;  1ULZ A;  4EVO A;  4QW9 A;  5KFU A;  1O80 A;  2R8G A;  2D9U A;  2XSC A;  5EKL A;  5BN5 A;  2JA8 H;  1RL2 A;  5IYD G;  2NVQ H;  2L4N A;  3RZO H;  5CGK A;  4JI7 L;  3EVQ A;  3PCO B;  4R8N A;  1GUO A;  2EPB A;  5A2Q W;  1I3Q B;  3HS0 C;  4C3I B;  2AWN A;  4BY7 G;  3GDE A;  4DR5 L;  5KG7 A;  2E2H A;  3KOJ A;  2BDN A;  1WJJ A;  2AHO B;  2VQF L;  1JOO A;  2CQA A;  1IBL Q;  4JI4 H;  1G29 1;  4YCU A;  1CKM A;  1MIU A;  1H9J A;  5KKN B;  5KFD A;  4LF6 H;  3PIP A;  1DON A;  4DV5 Q;  2XD4 A;  1EZ8 A;  1E4G T;  4ZYS A;  1RTO A;  1HNZ L;  3K8A A;  1Q7Y C;  3E5N A;  4DUZ H;  2C22 A;  1HR0 H;  3G71 A;  1R9T H;  4F4W A;  3T1Y L;  1VS0 A;  1HRJ A;  4NXN H;  1SMY D;  3MZ5 A;  4LSX A;  1DM0 B;  4APM A;  4J9R A;  4ECS A;  2H4O A;  4JBJ A;  1VQ4 A;  3I4L A;  3VYU A;  3UFX B;  4AQY Q;  1VQJ A;  4LFC Q;  4ZQI A;  1TS5 A;  3SK5 A;  4HED A;  5KFI A;  3G7L A;  1JIC A;  5FPO A;  4KN7 C;  1LTR D;  1RD9 D;  1EIH A;  3TIN A;  3ULJ A;  3BVG A;  5M5Y H;  4H13 C;  4DR3 L;  1HFG A;  2NB0 A;  5FLX c;  3I4M H;  4QWC A;  3JZI A;  2QCP X;  2R93 G;  2LS0 1;  3FKI H;  4EX5 A;  3J81 L;  4X65 Q;  3W2D A;  3TQT A;  1TS3 A;  4OX9 Q;  3RD4 A;  4F7X A;  3H0G A;  5D1O A;  5KNB A;  4GC7 A;  4X3U A;  4FXK C;  4IZO A;  4EYI B;  5BN4 A;  4DNR B;  2R7Z G;  4BY1 B;  3RLO A;  2F0O A;  2B2V C;  4R8U A;  2F4V Q;  1MKH A;  4LF5 L;  1XMQ L;  4NDX A;  2UUA Q;  1VBH A;  5M3M H;  3K57 A;  5FLX W;  3J7A K;  1TXY A;  2XCA A;  5E4W C;  1U0L A;  4YP3 A;  3PR5 B;  2NN6 H;  1AH9 A;  4LFB H;  1RYS A;  3FHW A;  4YIJ A;  4H7B A;  4LF4 Q;  4C5C A;  4X3T A;  5I2X A;  1STE A;  5GAE C;  2W8L A;  1BOS A;  2MCT A;  4K0K L;  5EKI A;  4QUF A;  3KYH C;  4ULL A;  3HOU G;  2AUJ D;  1OO9 B;  2F0D A;  3TS2 A;  1V4Y A;  3JRW A;  3M9O B;  1LT4 D;  3D31 A;  1GUG A;  3RFC A;  1HQM C;  1TII D;  2BH2 A;  4LMQ D;  3UDI A;  2V1C C;  1I94 Q;  1X3E A;  2UXD Q;  4U6P A;  4ZHQ F;  3E5S A;  3JSL A;  5DG8 A;  2R7F A;  2BDO A;  3A8J E;  4BA2 I;  3WNZ A;  1WTW A;  2EY6 A;  4S3S A;  2CFM A;  3DWA A;  5J3B A;  1LTA D;  5LL6 S;  4A3L G;  4C5B A;  3S17 H;  2R8J A;  1X6O A;  2IPK D;  1ZKO A;  1B7Y B;  4DR7 H;  4QGU A;  1GHJ A;  4QY7 A;  3TBI B;  5JQW A;  3PW7 A;  1BF4 A;  2JEJ A;  2W6M A;  2NVY B;  2XCL A;  2G9D A;  2XN9 C;  2W9B A;  2UVW A;  5KX5 F;  4FF4 A;  1VBG A;  1V1P A;  4AIM A;  2F0T A;  4DL3 A;  5HV6 A;  3IFT A;  3PSI A;  4HR7 A;  4MV4 A;  2LMC B;  1IBL L;  2JSO A;  3E9H A;  3CCV A;  1FR3 A;  3N6X A;  2DIK A;  2ES2 A;  3RN5 A;  3RUP A;  4DV5 L;  4A93 B;  4X62 H;  2K28 A;  5EPJ A;  3TS0 A;  4A3I G;  3HBL A;  3RV4 A;  4JBK A;  2UUC L;  2WV6 D;  3CF5 A;  4FDB A;  5G3L D;  2VUM H;  2NU6 B;  4C3H B;  3X3N A;  2FPI B;  3LWB A;  3J81 W;  1BCP D;  1II3 A;  2HDL A;  4HSV A;  4X3S A;  3MEF A;  1E0B A;  2B39 A;  3CRL C;  1TWG H;  5IGC A;  2W70 A;  1SAP A;  2K5Q A;  4AQY L;  4G7Z C;  3V05 A;  2B8F A;  4LFC L;  5KG4 A;  2ASL A;  1S72 A;  1I7L A;  4ILW A;  4QMG A;  2UUB Q;  4XQJ A;  1N9W A;  4RB0 A;  1F9P A;  2C35 B;  3GTQ B;  1NNX A;  4A3J H;  2A6H C;  3BAB A;  4K2K A;  1YNX A;  3I12 A;  3Q6S A;  2N3S A;  2BOS A;  4IOA A;  4IAJ A;  1KXL A;  1SYB A;  5D65 A;  1LTB D;  1QCB D;  5LL6 X;  4K5V A;  3BYY B;  3U58 A;  4F8M A;  4X65 L;  3GTP A;  3AFQ A;  3PF4 A;  1IKL A;  4OX9 L;  2X6G A;  3CW2 C;  2R85 A;  2DY7 A;  2ZDG A;  5AFW A;  3KHR A;  1MGS A;  2HCC A;  4M1U B;  4IFD G;  3S16 H;  4DV6 H;  4X64 Q;  3KBG A;  5KYL A;  1QIL A;  2F4V L;  3H3V H;  4ZOL F;  5C4X G;  2UUA L;  1ENC A;  4K5X A;  2EYP A;  2MHV A;  3OWF A;  5LMU H;  2W7O A;  2WB1 A;  5FLX E;  3VR4 A;  3KLW A;  2VXW A;  5JVH 3;  5CA1 F;  5ELO A;  3GTM A;  1L1O A;  1X3Q A;  1LLR D;  3D3R A;  1Y1W H;  4LF4 L;  3PVX A;  1S97 A;  5EOY A;  3MEH A;  4C5A A;  2F3I A;  4NMZ A;  1CKN A;  1BBW A;  2B2V A;  4JI6 Q;  5BR8 H;  4LJZ C;  2ZJT A;  4UP9 A;  5C4J B;  1S0N A;  3GV5 B;  2D62 A;  1T94 A;  2KQ3 A;  4JI0 H;  5KT7 A;  3FPP A;  1TWH H;  1WTR A;  1FJG L;  5J22 A;  2B63 A;  2RCF A;  1D1K A;  1V8Q A;  3S1Q H;  5BPH A;  5I47 A;  2PPB C;  2FPG B;  2KOL A;  1U9R A;  4DV0 Q;  2UXD L;  1I94 L;  4JI3 H;  1GO3 E;  2M05 A;  2K75 A;  2EY1 A;  1TWC A;  2A68 C;  1PFB A;  1SYF A;  3G4S A;  1C30 A;  1B2T A;  4PWQ A;  1B1Z A;  5CMD A;  1I3Q A;  2C2R A;  4ED6 A;  5JPN C;  1TWF B;  3KHH A;  4HNT A;  3HKZ E;  3ITP A;  1N34 H;  1PTO D;  4ME5 A;  1EEF D;  1M8A A;  2B2Y C;  3ONA B;  1KIX A;  3W1G A;  5KT5 A;  2Z0S A;  4A3D B;  1HXY D;  4JW0 A;  3BA8 A;  4TQR A;  1G8Z D;  3CHB D;  1YVC A;  3HOX G;  3QFF A;  5EWE A;  1IBK H;  2CWP A;  1I50 H;  1LM0 A;  3I4N G;  2O2L D;  2JN4 A;  4CJ2 C;  2Z8L A;  1SSO A;  3V6K A;  1XMO L;  3K5M A;  3K7A H;  2HIV A;  4QCL A;  1VMP A;  4MNO A;  1CA6 A;  1STH A;  2Z9H A;  2FJZ A;  1E2Z A;  4LW1 A;  2EYH A;  3BYT B;  3U9T A;  1KAB A;  4MZ9 A;  4I7H A;  5DG7 A;  2SNM A;  5TSS A;  5IIF A;  1IYJ B;  1ZXT A;  4XQQ A;  1H9M A;  2LXK A;  4AYB B;  4B3S Q;  2B29 A;  2JA7 H;  3OUU A;  4KV6 A;  3FDS A;  3H94 A;  5K2M A;  4HSP A;  1NTG A;  3NUC A;  4C3I G;  1Y8O B;  1S0M A;  2NYZ D;  3PQI A;  2B2U C;  1D6E C;  2A74 C;  3RZD H;  1PRT C;  4RGT A;  4PDB A;  2WKC A;  2N49 A;  2Y0S G;  4YCV A;  3HGB A;  3KF6 A;  5KFN A;  4MN3 A;  2BCO A;  4YWL A;  1JWS D;  3T56 B;  5M3F H;  3OTO L;  1VQP A;  4CJ0 B;  1WI5 A;  1QNK A;  4DNI A;  1RIP A;  3E3X A;  1Z47 A;  2KHI A;  2RDG A;  3HEJ A;  4A3E H;  4DAP A;  1MSG A;  4XTC S;  3HP3 A;  3CCJ A;  5FPR A;  1KTK A;  4LMY A;  2P0A A;  4Q8E A;  2CH4 A;  1SYG A;  3NWS A;  1KDB A;  3A55 A;  4X64 L;  4KHZ A;  3KLS X;  3Q23 A;  1TWA B;  1BO0 A;  4OO1 H;  4B9X A;  5KGU A;  4DAM A;  3EJI A;  1RK6 A;  5FK9 C;  4RNO A;  3QJY A;  3D4R A;  2MPM A;  2K32 A;  3HOW H;  1GXD C;  3TDQ A;  3RAQ A;  2PI2 A;  4KI0 A;  3NEM A;  2EYJ A;  2H5X A;  4XX0 B;  3V4Z A;  5FLM G;  2W6N A;  2JJQ A;  5KG5 A;  4JI6 L;  2EJG C;  4JYA H;  3VMM A;  5IT9 L;  4IUU A;  2N55 A;  2AKW B;  1B6R A;  3X3M A;  3DWQ A;  2EXZ A;  4J9N A;  2XGQ A;  4GKJ H;  2N78 A;  4KKS A;  3LML A;  1SLJ A;  1VQA A;  4DAY A;  4ECQ A;  5M9O A;  1CT1 D;  3S14 H;  2ICI A;  1KRS A;  4FVM A;  4EGV A;  4EQP A;  4LF7 H;  1HH2 P;  3LGJ A;  3AB9 A;  5JVL A;  4BY1 G;  4K6D A;  5LMN Q;  4DV0 L;  2DLN A;  4DPG A;  2F0K A;  1CE8 A;  2NVY A;  3SXH A;  1RTN A;  5LL6 b;  2D5D A;  4YJ3 F;  1N36 H;  2YYZ A;  1O78 A;  3TEH B;  2WB1 E;  2GLT A;  2ZTD A;  3AU7 A;  4FF1 A;  1KDA A;  3F2B A;  3M4I A;  3M4Q A;  4OWW B;  4HQ6 A;  1K83 H;  2NUC A;  2YV5 A;  1E4F T;  4PQX A;  2PVP A;  2B2T C;  4M7E A;  2RDH A;  3K59 A;  5HY6 A;  4OGQ C;  3WO1 A;  4DL6 A;  1JOQ A;  3A5U A;  4QIW A;  3W1B A;  4A3C G;  1S0O A;  2OCE A;  1KAW A;  1AN8 A;  1V43 A;  1BCP B;  5HGT A;  2XWJ B;  3NP8 A;  5C6A A;  4WFN 3;  3NQI A;  1I4R A;  1SE8 A;  3HOV B;  2WP8 J;  3GIL A;  2UXB H;  1HA6 A;  3P20 A;  3A7L A;  2B2Y A;  3ND9 A;  3J80 c;  2W9A A;  4R4I A;  4A75 A;  4A3B B;  2AWO A;  4TV9 F;  2EIF A;  1O75 A;  4IO9 A;  4DXF A;  3UDF A;  4Y7N H;  5IY0 A;  1Y1V H;  1TKW B;  3TP7 A;  2AGP A;  5DEH A;  4MAM A;  2DY8 A;  4FNF A;  1S40 A;  5CV5 A;  2PMZ A;  2DWC A;  3OHA A;  2JEF A;  2R7K A;  4CDC C;  2JA6 H;  3N6R A;  1VQM A;  1ZHQ A;  2DNE A;  4ED2 A;  1B6S A;  2YZN A;  3VYR A;  1MHW C;  2KCN A;  4HIM A;  3M4Y A;  1DV2 A;  1KEE A;  2E2H B;  4B3S L;  2ENB A;  5C0X J;  2I0Q A;  1WSC A;  3HOZ B;  2ZJQ A;  4QW8 A;  2R8H A;  3J80 W;  2R6G A;  3Q8D A;  3MWY W;  1K8A C;  1DIK A;  4HIO A;  3OOC A;  3HOY B;  4YAJ B;  3CME A;  1PLF A;  1HQR D;  5C0X I;  3ZJY C;  1VCI A;  2JEI A;  3MC0 B;  1JWU D;  2F3V A;  4IPD A;  2R92 H;  2F0L A;  3K5H A;  2CWA A;  2PO4 A;  3K0Y A;  1K3B C;  1VF5 C;  1XNQ Q;  1V51 A;  2A6E C;  4A93 G;  2NZ1 D;  1V9P A;  4RB3 C;  2VR1 A;  4G3I A;  2B2U A;  1EOT A;  4DV4 Q;  3T1Y H;  4DV3 Q;  4ECU A;  3ERQ A;  4YHH Q;  4DR4 Q;  5CR3 A;  4C3H G;  1DYQ A;  1LYL A;  5C3E B;  1WCM H;  5KFW A;  1TVX A;  4A3G G;  3U9S A;  1STN A;  3D0F A;  2VQE H;  5C1O A;  2NUA B;  1IBM H;  3ULP A;  2VUM A;  1SJE D;  2SOB A;  3V4S A;  4KY7 A;  1EWH A;  3QR8 A;  3H4B A;  4KHP H;  3FMA A;  2ALZ A;  1BNZ A;  1K8G A;  2CZG A;  1U4P A;  2KEE A;  3SVM A;  1TWG A;  1UUP A;  3N41 B;  3NEN A;  1S5E D;  3NE5 B;  2R84 A;  5FD6 A;  2VUG A;  4XT1 B;  1M0W A;  4IPG A;  2ID0 A;  3H0G B;  4CKC A;  5D1O B;  1GOZ A;  3VYS A;  1BKB A;  3ERS X;  1JQY D;  3NTH A;  3CC2 A;  4O4H F;  3JAM L;  2WTF A;  4R8U B;  1PTO B;  4DV2 Q;  4BBS B;  4JG2 A;  5LMN L;  2GPW A;  3PO3 G;  4UP8 A;  2NBF A;  4RB1 A;  3S24 A;  4WOR A;  3H20 A;  3GID A;  3HZX A;  3SDZ A;  4MV8 A;  4A3K B;  1NMG A;  2A6H D;  2QEX A;  3N52 A;  1GD7 A;  3NWT A;  1GLV A;  4R7R A;  2C2E A;  4L6T B;  1QVC A;  4LFA H;  2PI2 E;  1R4P B;  3JC6 6;  1DCZ A;  1PYB A;  2J6U A;  5KG0 A;  4TV8 F;  4GC6 A;  2F52 A;  4UCO A;  1JLL B;  1AZP A;  4KN4 C;  5L1K A;  1Y1W A;  4HCE A;  3T4A C;  3GTG H;  4BXX G;  5E7N A;  1X55 A;  2D0O A;  1N48 A;  2OXP A;  4DL2 A;  2F0W A;  4RAZ A;  1QVG A;  4IFD H;  2K5V A;  2KUM A;  4DL4 A;  5KFE A;  1TWH A;  1LAB A;  2B2T A;  3KAL A;  1X56 A;  5EBC A;  5ELE A;  3RB6 A;  3V6J A;  1HHV A;  3MR2 A;  5EBD A;  2OEO A;  1E1T A;  4GKK H;  3GV6 A;  4JI5 H;  5T14 A;  2B3G A;  2W9B B;  4ECZ A;  1DOM A;  1V1P B;  1E1O A;  2NN6 I;  3BDL A;  1YBY A;  5D8D A;  1FL0 A;  3L7Z C;  5IP9 H;  1WTO A;  4HR7 B;  2C2D A;  5JJZ A;  4IN3 A;  1FKA H;  2ZJP A;  2OTJ A;  4K2L A;  1PYW D;  5K36 H;  3PUY A;  2QW7 A;  1YJN A;  3CVZ A;  4MV6 A;  2JA5 H;  4ETS A;  5DLF A;  1LTI D;  2EYO A;  1PZK D;  3L4K A;  4M9U A;  4ZAI A;  2A68 D;  2V58 A;  1XNQ L;  1I50 A;  2NWG A;  3CPW A;  5L37 A;  4C3J G;  3PMF A;  3J7A F;  1TWA A;  3GTK A;  1PA6 A;  3TII A;  2F03 A;  1KNE A;  4ECX A;  4ZLT F;  4DV4 L;  3K5O A;  3E0J A;  4DV3 L;  2PMZ E;  4DR4 L;  1A6X A;  1F2L A;  5IYB G;  3JAM i;  2GPS A;  5LP6 F;  2KCC A;  1SN8 A;  5I4D A;  3NBI A;  2AQ3 B;  4AYB G;  1WFQ A;  4DKA C;  3JAM W;  2QKI C;  1S68 A;  2M9V A;  2JEG A;  2ZT9 C;  1JXL A;  1M0T A;  4DR2 H;  2P5Z X;  1K73 C;  1GUS A;  1YZ6 A;  1OXX K;  4DGZ A;  2J6S A;  3MA2 B;  3W3A A;  4ABN A;  4IUV A;  3I4N H;  4R4C A;  2DGY A;  2E5L Q;  1SNM A;  3CCS A;  1GGO A;  2YRW A;  5L1L A;  3A54 A;  3GTP B;  1UEB A;  3T53 B;  4X65 H;  2UXC Q;  4YJ2 F;  1VQ8 A;  3VA5 A;  1ZHS A;  1QNU A;  2DNC A;  4TRD A;  2A69 C;  1RJT A;  3CCR A;  3C2P A;  4Y8V B;  4CDF C;  1D7Q A;  3QG1 A;  3M9M B;  1TS2 A;  4DV2 L;  5KEE A;  5C44 H;  2WB1 B;  2YU9 H;  5KG3 A;  1S5D D;  3A7A B;  3E0E A;  3GTM B;  1SNC A;  1CSQ A;  1PRT D;  3KLS A;  1E22 A;  4HJ5 A;  4A3F B;  1S03 G;  1CKN B;  2ZM6 Q;  4G57 A;  2E74 C;  1Z9F A;  2PZT A;  3KK7 A;  3SHL A;  3UQ8 A;  4JI2 H;  3T1H H;  3A8I E;  4OHJ A;  1WR2 A;  1BNC A;  4YR2 A;  4O0A A;  1F9R A;  1GUW A;  2BH8 A;  2VS1 A;  2B63 B;  5I2Y A;  3NHH A;  2PZW A;  3U4V A;  3KJO A;  2IL8 A;  1KJJ A;  1TWC B;  1I94 H;  5KG6 A;  3E6Z X;  1X65 A;  1PVO A;  2QF7 A;  2IHF A;  3EYY A;  1GUT A;  4TVA B;  4JI1 Q;  2UVU A;  1BUV T;  2NVX H;  3I73 A;  2D0P A;  5GQO A;  3IN5 A;  4FM9 A;  5F9L A;  1UE5 A;  3TZU A;  5FKA C;  1K9M C;  4ECY A;  1SEB D;  4RA8 A;  3HG9 A;  3GTO H;  3EIV A;  4GZY C;  1VQG A;  4BWS C;  3G6X A;  2QA4 A;  4DUY L;  2ALY B;  1WTH A;  4KHV A;  2UUC Q;  1C4Q A;  2RA4 A;  1LT6 D;  4UHV A;  1RJR A;  3JRX A;  1ASY A;  1RDP D;  3S1M H;  1IW7 C;  5C3W A;  2HD3 A;  3H40 A;  3GTL B;  2DPI A;  4R4T A;  3BA9 A;  2NU8 B;  4RHR A;  3HOV G;  3CQZ H;  5EZY F;  4IJL A;  2N88 A;  2DJF C;  3M85 A;  3RLN A;  4A3B G;  4KLK A;  1IHZ A;  1WYD A;  2NVT H;  4DV7 H;  2Z6K C;  1B04 A;  2MNA A;  4GLX A;  2L5T A;  3K5L A;  3G6J B;  1KJ8 A;  3OSN A;  5JAV A;  3S1R H;  5DG9 A;  4A3M B;  2L15 A;  2E2I A;  2JEA I;  3MXU A;  1Y1V A;  1JR0 D;  3VDY A;  2NVQ B;  3RIZ A;  1SMX A;  5KFC A;  4NXM L;  1AE3 A;  3PW2 A;  1MD2 D;  2AQ1 B;  3HOZ G;  2JA6 A;  3KF6 B;  1HNW Q;  4IAL A;  5IP7 H;  3HOY G;  4DL7 A;  4QL5 A;  1N33 Q;  2UUB H;  2L55 A;  4A4I A;  3RBD A;  2HHH H;  4Q5V A;  2HT1 A;  1LTS D;  3ND8 A;  2JA9 A;  1ICF B;  1YNN C;  2UVV A;  4K14 A;  5KFQ A;  2E5L L;  2VB3 X;  1X3F A;  1KRT A;  1B3A A;  5CAE B;  1OTC A;  1PH4 A;  1VQC A;  3DWP A;  2R92 A;  2KEC A;  2UXC L;  3M9N B;  1YNJ C;  4LUZ A;  3HKZ A;  3GII A;  1SXT A;  2R82 A;  4IR1 A;  3J7A V;  5C3E G;  4DR6 H;  2JQO A;  3M3Y H;  2PYK A;  1EHI A;  4EBE A;  2OWO A;  5ELN A;  1ASZ A;  2TMP A;  2BQ3 A;  4LF9 Q;  1WCM A;  3U9O A;  5FO7 B;  4RAU C;  3MFG A;  4H44 C;  3WOE A;  3ZYY X;  1FJG Q;  2IY5 B;  4FBT A;  1BXR A;  1PYS B;  3PO2 H;  2ZM6 L;  1PZI D;  1MSH A;  2A8V A;  3RV3 A;  3MR5 A;  2A6E D;  4J9M A;  4RUC A;  4JI6 H;  2K4K A;  5M5Y B;  4A93 H;  4MIU A;  2EJF C;  3EFX D;  3GLK A;  3JSN A;  3I4M B;  1SE3 A;  2IW3 A;  3H0G G;  4DAY B;  3NBH B;  2E75 C;  5IOD A;  5C3X A;  1TT2 A;  2X69 A;  2PBZ A;  3CCE A;  2L9H A;  1JOK A;  1AUV A;  4RU9 A;  3KF8 A;  2AGQ A;  4A3G H;  2Q2H A;  3T13 A;  4UCU A;  2I80 A;  1SNO A;  4XDX A;  4J9S A;  3WWV A;  5C4H A;  5A2Q E;  5EJW A;  2A73 B;  1DOL A;  5GON F;  1OXU A;  4XT3 B;  1PH8 A;  3C46 A;  2R3Z A;  4OIJ A;  3J81 c;  1OWT A;  1W96 A;  2R61 A;  4AH6 A;  5M3M B;  5G3L F;  1JJC B;  4JI1 L;  4TQS A;  1K0S A;  2EE1 A;  4A3K G;  1ENF A;  3R2I A;  4OO1 I;  3KFU A;  3BG3 A;  4PV1 C;  1I4Q A;  5IYC G;  1BCP F;  4U7C A;  1UAP A;  3WOF A;  4JI4 Q;  1VDZ A;  1XMO Q;  4X66 H;  3BZD B;  3V2T A;  1H9R A;  2RHS B;  4C2M H;  1X3P A;  3FRP B;  4RGN A;  1KDC A;  4QIW B;  3Q2O A;  4O3Q A;  3RB3 A;  1QG7 A;  3D6C A;  3VPD A;  3G48 A;  4DUZ Q;  1GYF A;  5IWA H;  1PH7 A;  3EA6 A;  1BR9 A;  4O1N A;  5FJ8 G;  3A5Z B;  4HAE A;  5DNF A;  2W6O A;  3H15 A;  4NXN Q;  3GTG A;  4GN4 B;  3L9A X;  4OWT B;  3MWD A;  4P2C B;  1F2Y A;  3GIP A;  4BA1 I;  3PO3 H;  1Q12 A;  4B3T H;  3K81 C;  4YY3 H;  2PMZ B;  2RGV A;  2XTI A;  5T1I A;  1D1I A;  2OQ0 A;  4DLK A;  3I91 A;  4LF8 H;  3GIJ A;  2NZO A;  4ZI7 F;  3U50 C;  1GUN A;  4K6L A;  3S17 B;  5CV9 A;  5DLG A;  4O3P A;  1F2M A;  4RNM A;  4ME6 A;  1YIJ A;  3OTO Q;  4IWX A;  3RBE A;  3BAA A;  3M7N A;  2HIX A;  5KYI A;  2EDG A;  5KT6 A;  5I9P A;  2KA7 A;  1I4G A;  1RKN A;  1Q8I A;  4B3R Q;  1HPC A;  3SGI A;  1HNW L;  1FD7 D;  4ED1 A;  1T36 A;  1N33 L;  4ZK9 B;  2EY2 A;  2FMC A;  1XPU A;  4JV5 L;  1WH2 A;  2RF4 A;  3C1F A;  2I5L X;  1LTT D;  1S4Z A;  2F4I A;  2JA5 A;  1U4L A;  3UE1 A;  1PRT B;  2PQE A;  4L63 B;  5C8Y F;  3M4P A;  2V4D A;  1PX2 A;  3QZ7 A;  2Z4I A;  1GVP A;  4GLA C;  2RVL A;  5LYJ F;  4FO2 A;  4RWS C;  2VUM B;  1Q1E A;  1GSA A;  1C8C A;  1UE7 A;  4HJ7 A;  4ME3 A;  3R5F A;  1KLG D;  2F0E A;  2W57 A;  2CW7 A;  1EQT A;  1B33 N;  1F2Z A;  4LF9 L;  3HXL A;  1TWG B;  1I4H A;  1XPR A;  4JBM A;  4DN4 M;  4MA5 A;  4RHS A;  1AN7 A;  4ID6 A;  5CYU A;  3K3P A;  4IUT A;  4B3M L;  2R7M A;  5FD5 A;  1EFW A;  3UE0 A;  4MV7 A;  4RZR A;  4A3J B;  2IWH A;  5LXT F;  1HNX H;  3FVQ A;  4Q0F A;  5EWG A;  4ZKB B;  4YBZ B;  1NMF A;  5ELD A;  4CKE A;  4O4L F;  4R1J A;  4C3J H;  4FF2 A;  5EQ0 A;  5JJK A;  1CQV A;  4R9W A;  4OEM B;  3BQ0 A;  4H0L C;  1WTP A;  4DR7 Q;  1VQ6 A;  2X6L A;  2AQ4 A;  1YIT A;  1C3O A;  2XC9 A;  1Q8K A;  3S16 B;  1QJO A;  3UI2 A;  2WB1 G;  5KIX A;  1XPO A;  4DK3 C;  5JOB A;  2GVA A;  4EEQ A;  3TQY A;  4M8A A;  4A3F G;  2W6Q A;  3NXW A;  1S10 A;  3TQ1 A;  2FXQ A;  4RCO A;  1Y1W B;  4JI4 L;  4QWB A;  3GTL A;  3J7A 5;  1EY7 A;  3K5I A;  4UDU C;  3OW7 A;  1M6V A;  3A0J A;  1V1Q A;  2A69 D;  1N32 H;  4DV1 H;  4DUZ L;  3GTJ H;  1WOC A;  4PNY A;  2B63 G;  1DOK A;  4JUZ A;  3RF2 A;  1SRU A;  3J81 E;  1EUJ A;  1TWH B;  1CQJ B;  5CV8 A;  3RLF A;  2LSS A;  4NXN L;  3I56 A;  3S1Q B;  3C1E A;  4JK1 C;  4UPA A;  4JI8 Q;  4MV9 A;  2XIG A;  3FEW X;  1M7J A;  1QOH A;  2EYL A;  4JV2 A;  1ZET A;  3LX0 A;  4X3K A;  4BBR H;  3KAK A;  5JEA H;  1SE2 A;  3GD7 A;  4RKL A;  1CQI B;  3C0F B;  3SE7 A;  3P1H A;  2KED A;  3M4O H;  3DM3 A;  3ETJ A;  1SEI A;  2FK2 A;  2O5I C;  2CW0 C;  1FGU A;  1W6K A;  1HJP A;  4DU9 A;  5C0X G;  2D2C C;  2QEJ C;  1O7Z A;  5D3D A;  4B3R L;  5IYD H;  1QZH A;  1VQL A;  4Q45 A;  1R9T A;  1CA5 A;  2F0V A;  3S2H H;  2AMC B;  1VAJ A;  3CU7 A;  2Q8R E;  2RHQ B;  1JE5 A;  1I50 B;  4IFD J;  5DQG A;  1N56 A;  2FE3 A;  3PZP A;  3GTK B;  1XNQ H;  4APV A;  1FNV A;  4BY7 H;  5KFK A;  1CTM A;  3IAY A;  3MHB A;  3CQZ A;  4IFD I;  1I6H H;  3K7A B;  1SFO H;  4DV4 H;  4IRD A;  3TN2 A;  2Z6B A;  1C9O A;  4DV3 H;  5LMU Q;  4YHH H;  1U4M A;  1CHQ D;  5KFX A;  5BN3 A;  4A3M G;  1TY2 A;  1NY4 A;  1W93 A;  2B8G A;  4YAK B;  2C9O A;  2CW8 A;  5BR8 Q;  1Q86 C;  1D2B A;  2J0T D;  1EQV A;  2W6P A;  2K5D A;  4KY6 A;  2DJG C;  4OIK A;  3WDN A;  1N8R C;  2UU9 Q;  4JPB W;  3RGZ A;  4Y52 H;  2OQK A;  3H3V C;  1IW7 D;  2Q2T A;  1H95 A;  1J5E Q;  4QQB X;  3EBE A;  3FKI A;  4J9Q A;  3NBH A;  3RZD B;  3RB4 A;  2ICE C;  4JI0 Q;  2YW2 A;  4RZQ A;  5IGG A;  3IKJ A;  5C5L A;  1Q46 A;  2KEN A;  1I7N A;  2LFN A;  3VPC A;  1ONL A;  2O5J C;  5M3F B;  1VKZ A;  5KFY A;  1L2F A;  1D5Z C;  4CBV A;  4EFB A;  4Q43 A;  4POF A;  5IGD A;  2VQD A;  4A3E B;  1SCU B;  3MFY A;  1AE2 A;  1KHI A;  1HZB A;  1EYC A;  1M90 C;  4DR7 L;  3DUZ A;  3TZD A;  5CC4 A;  1BBU A;  1KJ9 A;  4LWC A;  2MFI A;  1Z2P X;  2R93 H;  3EN2 A;  4P71 A;  4E4T A;  1Q82 C;  3BZK A;  1YHB A;  4RGM A;  1UWV A;  2YS7 A;  5D14 A;  2XGP A;  2UVR A;  3HOY H;  4P75 A;  3MJF A;  1EIG A;  1AEX A;  1TR5 A;  2QDL A;  4QB4 A;  3PUZ A;  2DZD A;  3KAJ A;  3L3O C;  2R7Z H;  3HOW B;  1JIH A;  5L1J A;  1IBK Q;  3KDF A;  3QO2 A;  2RSN A;  3IL8 A;  5D1P A;  4JOI C;  4I4T F;  2XRS D;  3OMG A;  1YNJ D;  1WVL A;  2FLP A;  4LNQ A;  1EWI A;  1EU3 A;  4ED3 A;  5KFP A;  4IRK A;  4JI7 H;  3MR6 A;  2WAQ A;  3S14 B;  1A3T A;  2K03 A;  5M5W H;  4RG1 A;  4YR0 A;  4DR5 H;  4JI8 L;  3HOU H;  1C0A A;  3GP7 A;  1EQQ A;  2VQF H;  1EY4 A;  4DA2 A;  4F50 A;  5M3M G;  2F0N A;  4RFB A;  4XIG S;  3TIG A;  4HNV A;  1HZC A;  5LHY 1;  3DLL A;  3UDX A;  3MFI A;  2NN6 G;  4DF7 A;  2B2W C;  1HNZ H;  2VA3 A;  3FDT A;  3LNN A;  1W6J A;  3MWM A;  3J81 j;  3NGD A;  1K83 B;  2CVR A;  2Y0S E;  2CHB D;  4NW2 A;  2GN5 A;  1LAC A;  4LSA A;  4A3L H;  5C5M A;  2YZG A;  1X32 A;  4C2M A;  4N9P A;  4EFE A;  1IOW A;  3GQB A;  1VQB A;  5IT9 W;  5KFL A;  3I2Z A;  1ZEQ X;  1PV4 A;  2EYM A;  1YHQ A;  4N8F A;  5KRU A;  4RGO S;  4HMI A;  3Q8Q B;  4DV6 L;  4RMF A;  1OXT A;  1EZ1 A;  1KNA A;  1B44 D;  2K1B A;  3OWE B;  4Y7N B;  2E2I B;  1IYV A;  1SNQ A;  1Y1V B;  2SEB D;  3DF7 A;  4RKB A;  5LMU L;  2C00 A;  1Q3L A;  1RCV D;  2R87 A;  3OIP A;  4G4K A;  4DR3 H;  3DXJ C;  5EKK A;  2JA6 B;  1A2T A;  4I55 F;  4ODG A;  4A3I H;  4MTK A;  5I6W A;  5BR8 L;  1H9S B;  3T16 A;  2UU9 L;  4IR9 A;  4LUV A;  1IOV A;  5FJ8 H;  1J5E L;  5J2U F;  1OXV A;  3DEP A;  4JI0 L;  4LF5 H;  5JJL A;  1TA8 A;  1G2T A;  1XMQ H;  2R86 A;  2R92 B;  3VA7 A;  1A15 A;  4UCV A;  4DAV A;  4XYQ A;  3HKZ B;  4N8X 1;  1RYR A;  2FP4 B;  1F9Q A;  1K3R A;  4JI3 L;  4NP5 A;  5IGE A;  2K52 A;  1UC8 A;  3S9W A;  2ASJ A;  1C7Y A;  1EYG A;  4GS3 A;  2VUM G;  4UY8 C;  1WCM B;  1VQF A;  3BVZ A;  3SR1 A;  4G7H C;  3CCQ A;  2F0M A;  3DM1 A;  3PR4 A;  4K0K H;  4GN5 A;  1KJI A;  4QWD A;  1EL0 A;  5L1I A;  1B50 A;  3L0O A;  5KT2 A;  2R8K A;  2YCH A;  4ED0 A;  3KUP A;  1EUD B;  1KJQ A;  4H02 A;  2R7N A;  1OXS C;  1EOV A;  1PH3 A;  3RJ0 A;  1DXM A;  2MUY A;  1IBK L;  1SE4 A;  1XTC D;  1JE4 A;  4A3J G;  1JJG A;  2EQS A;  2KBN A;  4Q8F A;  3QWN A;  3UDG A;  1VQE A;  5C4X H;  4O2A F;  2OT2 A;  4ECR A;  5LA6 F;  1CKO A;  1TQO A;  3KF8 B;  4L5Q A;  1JKJ B;  5ISR A;  5M5X H;  2ZXO A;  1XNR Q;  4DUY Q;  2MO1 A;  4QUC A;  1LUZ A;  1LO5 D;  5E1F A;  3DHQ A;  3K5N A;  1WTX A;  2I87 A;  4A3D G;  4JOI A;  3FPU B;  3J80 E;  1Z7T A;  5EPL A;  4YWM A;  2E2J H;  4HMJ A;  3KJP A;  1IBL H;  5DLQ E;  3RNU A;  1GHK A;  3RGX A;  3L2P A;  4YR3 A;  1G6Z A;  3KXY T;  3JAM c;  1LTL A;  3S1N B;  1AZQ A;  1A2U A;  1A62 A;  4DV5 H;  3M7G A;  1Y1W G;  4MV1 A;  4UCS A;  4B9W A;  3BQ1 A;  2K33 A;  2UUC H;  4O2D A;  2Q8T A;  2IBK A;  1J8I A;  5GAD C;  4J15 A;  1T9H A;  3GTG B;  3E9I A;  3D8G A;  3S15 H;  4GNX C;  4NXM Q;  1FYC A;  1QB5 D;  2DUD A;  5A2Q L;  1JT8 A;  2B2W A;  2WAQ E;  3D4D A;  1O7Y A;  1BBX C;  2CQY A;  3GTJ A;  4AQY H;  1EUC B;  3NPP A;  3CC7 A;  4LFC H;  3T5K A;  2VQE Q;  1SR3 A;  1IBM Q;  2JA7 A;  1EFI D;  4JCV E;  1I5F A;  1B70 B;  2LXJ A;  4I7Z C;  4PZ6 A;  1S5C D;  1J9O A;  5KFJ A;  1NBW A;  3HOX H;  5LMN W;  3S2D B;  1ZYR C;  2RDI A;  4KHP Q;  4MHE A;  1I4P A;  1ESF A;  2E76 C;  4FF3 A;  5NUC A;  1HZA A;  3AFP A;  3KBX A;  4FYD A;  2PQA A;  1UC9 A;  1AUX A;  2HGS A;  4XXE A;  1M1K C;  4OX9 H;  1PRT F;  1JB7 A;  4EQN A;  1RF2 D;  1HNW H;  1K8M A;  1N33 H;  1M4V A;  2AGO A;  1HA5 A;  5BPF A;  3H6M A;  3URY A;  3MXN A;  2JA5 B;  2PN1 A;  1QWY A;  2F4V H;  4C56 C;  3V6H A;  3Q24 A;  3T5J A;  1STG A;  2MP1 A;  4ZQ3 A;  2UUA H;  3OW2 A;  2W9C A;  1I3Q H;  4C3I H;  3K3V A;  3RN2 A;  5COY A;  2YL2 A;  2K50 A;  3TP8 A;  2FKL A;  1SYD A;  3B6Y A;  2VOB A;  5DGA A;  2WE6 A;  4LF4 H;  5D3I B;  1ILP A;  4RB2 C;  5DGB A;  1SJH D;  1ROD A;  2IX0 A;  4KJO A;  3CXC A;  2K5N A;  4HID A;  4RAY A;  4YQW A;  1SFO A;  3I8Z A;  1E3P A;  4IWY A;  2EJM A;  2CW0 D;  4LF9 H;  4ED7 A;  3NSW A;  2F0U A;  1GM5 A;  4HN7 A;  3CCU A;  2E8G A;  1FJG H;  1CK1 A;  1ENA A;  2HVQ A;  1S5F D;  3D4W A;  2UXD H;  2FB9 A;  1MJC A;  1TY0 A;  4L1K A;  2UXB L;  5FLX L;  3AQQ A;  1SND A;  5M3F G;  4IOC A;  4WJ3 M;  4DK0 A;  2DPJ A;  1F77 A;  1EZ6 A;  2WAC A;  5KFM A;  3H3V I;  3VYT A;  1EIY B;  1K1S A;  5JJI A;  4A3E G;  1X54 A;  1E4E B;  1PHJ A;  2ASD A;  1EY8 A;  5FLM H;  4A3M H;  3L4J A;  4GKK Q;  4YWK A;  1SRO A;  4OWX B;  1LT3 D;  4JI5 Q;  1XNR L;  3HKS A;  1QVF A;  3VPB A;  1A9X A;  2DN8 A;  3TRZ A;  5CB4 F;  1U4R A;  5C44 B;  3GV3 A;  2Z4H A;  4UCR A;  1G6P A;  2YU9 B;  1PFS A;  1K83 A;  4LH6 A;  1FNU A;  4OO1 G;  5KT3 A;  2FK3 A;  5KFV A;  2R93 A;  2PW5 A;  1P8L A;  1T5X D;  2YTV A;  2J6T A;  4XQN A;  1HZ9 A;  2Y0S B;  2C5C A;  2YTX A;  3HOW G;  4BY1 H;  4NKL A;  1XMO H;  3N40 P;  3ICE A;  4DR1 Q;  3I3C A;  2IA6 A;  5JPM C;  2R7Z A;  1JMC A;  1XTD A;  4UP7 A;  3FP9 A;  2KHJ A;  4WRD A;  4F4Y A;  2O03 A;  4CGY B;  2JA8 B;  2J7Z A;  5ELC A;  2YTY A;  5DM7 3;  3EQL C;  3MTS A;  2YRX A;  3RZO B;  4RUA A;  4J8Q A;  2ZJR A;  4O3R A;  3N42 B;  1Y8P B;  2JYO A;  2FLN A;  1VQK A;  1C48 A;  1I6U A;  3JAM E;  2VQE L;  1IBM L;  1L0Y B;  1A8V A;  5KFH A;  2BQR A;  4ZKC B;  1YI2 A;  4A3C H;  4X6A H;  1NUC A;  1H9S A;  1HTP A;  4AYB E;  4DR2 Q;  4JV5 Q;  4KHP L;  2NVX B;  1VF7 A;  3CMA A;  4XYO A;  4TQU S;  4GNX A;  2RDJ A;  1SYX B;  3GQC A;  1B53 A;  3OTO H;  4MTD A;  1RHP A;  1VQ5 A;  4J1M A;  3GTO B;  2FPP B;  5E4X A;  3IG0 A;  2LY7 A;  2I8C A;  4XZ3 B;  4A2B A;  2IX1 A;  3RAX A;  3BG5 A;  3A8K E;  2A19 A;  2BE5 C;  1R9T B;  2WFW A;  4B3R H;  2WDT A;  2N8N A;  1NSN S;  4GOP C;  1JC7 A;  3V96 A;  3OHX C;  3S1M B;  4MV3 A;  2L11 A;  2BA1 A;  3LWE A;  4X64 H;  4QWE A;  1DV1 A;  1L1O C;  5KFO A;  2NVY H;  3CQZ B;  1MZB A;  4MA0 A;  1J6Q A;  2K6A A;  5T1G A;  1KQS A;  3IFD A;  2Q2U A;  2NVT B;  2HQL A;  2QIL A;  4B3M Q;  4CC6 A;  3I90 A;  1L0W A;  2EYF A;  3RTX A;  2FJ2 A;  1Y1V G;  3NK9 A;  5JEA J;  3NTK A;  4J0M A;  1NE3 A;  4P72 A;  3S1R B;  3AEV A;  4R8I A;  3PGZ A;  2JA6 G;  4CDD C;  4F87 A;  4LFA L;  1PDQ A;  4OEL B;  2ZTC A;  3N44 B;  4JI2 Q;  3FKI B;  3T1H Q;  1L2Z A;  1ESR A;  1H9K A;  1VMC A;  3CP0 A;  4C3H H;  1G51 A;  1VQD A;  3OPO A;  3MVV A;  1ML0 D;  3H09 A;  5KFZ A;  4DV0 H;  4BBS G;  1MI2 A;  3OUZ A;  2K5H A;  3SK8 A;  3GIK A;  1QUQ A;  1KC7 A;  2R92 G;  4JVZ A;  3HKZ G;  2KSW A;  2VPQ A;  3AMU A;  3GTQ H;  3BQ2 A;  3CKI B;  4PMW A;  2A5H A;  2AQ2 B;  1CFM A;  1WCM G;  2L0C A;  4LF6 Q;  4V19 0;  4GKK L;  3M3Y B;  1Z6H A;  4JI5 L;  5HUR A;  4K8J A;  2AU0 A;  4ED8 A;  1HR0 Q;  2MO0 A;  5DM6 3;  5KT4 A;  2WYO A;  4BS9 A;  3KDF B;  5KND A;  1B3Q A;  1ET6 A;  1O7L A;  1SYC A;  3O13 A;  5GAG C;  5KFF A;  1WD0 A;  3PW4 A;  2F3W A;  3PO2 B;  3P7J A;  1SYE A;  4RH6 A;  2SCU B;  1STB A;  4A76 A;  4KD3 A;  4DR1 L;  1CSP A;  3RB0 A;  2QGQ A;  3VR2 A;  1PFM A;  1VQH A;  3KTM A;  1U5K A;  4DV7 Q;  5JUM A;  1SNP A;  2WAQ B;  3LP8 A;  3K58 A;  4UAI A;  1Q81 C;  3J81 i;  4F4X A;  5CA0 F;  5J39 A;  4PZ7 A;  4ECV A;  4Q0Y A;  3DEO A;  3R5H A;  4B3S H;  4A3G B;  2XCP A;  2PNH A;  3R8B A;  2Z6K A;  1DD2 A;  4JI8 H;  3SK6 A;  1V1O A;  5C4J H;  4BXX H;  3Q8P B;  1CUK A;  1Z2N X;  2XVS A;  1X3G A; 
#chains in the Genus database with same CATH homology
 1N8R C;  2F52 A;  4DR2 L;  4Y52 H;  2OQK A;  3PIP A;  2Q2T A;  1H95 A;  4DV5 Q;  1J5E Q;  2HHH Q;  4QQB X;  3EBE A;  1HNZ L;  3K8A A;  4HIK A;  1Q7Y C;  4JI0 Q;  3GTG H;  4BXX G;  1JJ2 A;  3G71 A;  1Q46 A;  2KEN A;  1R9T H;  5E7N A;  1X55 A;  2D0O A;  2VL6 A;  2ZTE A;  1L2F A;  3T1Y L;  1UE1 A;  1VS0 A;  1QVG A;  2K5V A;  4POF A;  4PG3 A;  1TWF H;  4JBJ A;  4LFB Q;  1VQ4 A;  1KC8 C;  1X56 A;  2A1A A;  4AQY Q;  2VZA A;  4QJF A;  1VQJ A;  4DR6 Q;  2CQO A;  4LFC Q;  1AE2 A;  1KHI A;  1HZB A;  2VW9 A;  1M90 C;  4DR7 L;  4A3D H;  1E1T A;  5GRO A;  1BBU A;  4LWC A;  2MFI A;  2B3G A;  3M9B A;  3EN2 A;  4P71 A;  2R93 H;  1E1O A;  4GOP A;  4IPC A;  1Q82 C;  2NN6 I;  3BZK A;  1YBY A;  1YHB A;  1KD1 C;  1FL0 A;  1UWV A;  3L7Z C;  3ULJ A;  5IP9 H;  5M5Y H;  3HOY H;  4P75 A;  4DR3 L;  5FLX c;  3I4M H;  3PUZ A;  2R7Z H;  2ZJP A;  2R93 G;  3FKI H;  4EX5 A;  1IBK Q;  2ASB A;  3BJU A;  3KDF A;  4X65 Q;  2OTJ A;  4JBW A;  1E7Z A;  3PUY A;  1YJN A;  2JA5 H;  4OX9 Q;  4JI2 L;  3PUW A;  3T1H L;  5IP9 G;  4JOI C;  3STB C;  3ER0 A;  5IYB H;  2R7Z G;  4LNQ A;  1XNQ L;  3RLO A;  2K14 A;  1EWI A;  3CPW A;  1MKH A;  2F4V Q;  4LF5 L;  5K36 G;  3I7F A;  1XMQ L;  2JA5 G;  2UUA Q;  1PA6 A;  5M3M H;  4DV4 L;  4DV3 L;  1TXY A;  2PMZ E;  4RG1 A;  5M5W H;  3JAM i;  5IYB G;  1U0L A;  4DR4 L;  1AH9 A;  1SN8 A;  3K0X A;  2GVB A;  4JI8 L;  4ALP A;  1CKM A;  3FHW A;  1EQQ A;  4AYB G;  4LF4 Q;  1WFQ A;  3HOU H;  4DKA C;  1C0A A;  5M3M G;  5GAE C;  4XIG S;  1HZC A;  1K73 C;  3DLL A;  4LF6 L;  1YZ6 A;  3UDX A;  4K0K L;  1OXX K;  2NN6 G;  3KYH C;  4X66 Q;  4X62 Q;  3HOU G;  3TS2 A;  3I4N H;  3J81 j;  1Q1B A;  1HR0 L;  3D31 A;  4R4C A;  2Y0S E;  2DGY A;  2E5L Q;  2GN5 A;  3CCS A;  4A3L H;  1NJI C;  2BH2 A;  1UEB A;  3UDI A;  5IWA Q;  2V1C C;  3ULL A;  1X3E A;  1I94 Q;  3TRE A;  2UXD Q;  3J7Z C;  2R7F A;  1VQB A;  2UXC Q;  1VQ8 A;  4BA2 I;  1Q86 C;  3I2Z A;  1PV4 A;  1TWA H;  3CCR A;  3GTK H;  1VQN A;  1YHQ A;  2CFM A;  5J3B A;  4A3L G;  2VNU D;  3PIO A;  3S17 H;  1X6O A;  3CC4 A;  1D7Q A;  4B3T Q;  1B7Y B;  3IRB A;  4YY3 Q;  4DV7 L;  4QGU A;  4RMF A;  4DV6 L;  4QY7 A;  1OXT A;  4DV2 L;  3PF5 A;  5C44 H;  2IHE A;  4LF8 Q;  2YU9 H;  2I5H A;  3E0E A;  1CSQ A;  5LMU L;  5HGQ A;  1E22 A;  4HJ5 A;  4AIM A;  1CKN B;  5C44 G;  2ZM6 Q;  1PH2 A;  3PSI A;  1Z9F A;  1YEZ A;  4A3I H;  1IBL L;  5BR8 L;  3E9H A;  3CCV A;  2UU9 L;  2ES2 A;  2UUB L;  4O0A A;  3PUV A;  3RN5 A;  4LUV A;  5FJ8 H;  4DV5 L;  1J5E L;  2HHH L;  2BH8 A;  2VS1 A;  4IPH A;  1OXV A;  4DV6 Q;  4JI0 L;  4A3I G;  4L5T A;  1O7I A;  3TS0 A;  4JBK A;  2UUC L;  5JJL A;  3CF5 A;  4FDB A;  2VUM H;  3U4V A;  3KJO A;  1K3R A;  1X65 A;  4JI3 L;  1DGS A;  2JA8 G;  3CD6 A;  1PVO A;  4OON A;  3MEF A;  2IHF A;  4LFB L;  2K52 A;  4TVA B;  1C7Y A;  1EYG A;  1TWG H;  4GS3 A;  4JI1 Q;  2VUM G;  4AQY L;  4DR6 L;  2NVX H;  2D0P A;  5GQO A;  4UY8 C;  4LFC L;  1VQF A;  1UE5 A;  1PH1 A;  3CCQ A;  1S72 A;  1K9M C;  2UUB Q;  4GN5 A;  1N9W A;  3GTO H;  3EIV A;  2C35 B;  2MQH A;  4EQ5 A;  3F2C A;  1VQG A;  4A3J H;  2CCZ A;  2QA4 A;  4DUY L;  2R7D A;  1YJ9 A;  3HOV H;  2ALY B;  3L0O A;  2UUC Q;  4P74 A;  1YNX A;  2N3S A;  3RR5 A;  4IOA A;  2PQA B;  2KCT A;  1KXL A;  4H02 A;  4A3B H;  1ASY A;  1OXS C;  3S1M H;  1EOV A;  1XJV A;  1PH3 A;  1HNX Q;  1IBK L;  4A3J G;  3U58 A;  4JI3 Q;  4X65 L;  1JJG A;  2EQS A;  2KBN A;  3AFQ A;  4R4T A;  3UDG A;  1VQE A;  3PF4 A;  4OX9 L;  5C4X H;  3CQZ H;  3HOV G;  4IJL A;  3CW2 C;  3MXN B;  3M85 A;  3RLN A;  4A3B G;  4KLK A;  1WYD A;  2NVT H;  1CKO A;  2Z6K C;  3KF8 B;  4L5Q A;  2MNA A;  4X64 Q;  4GLX A;  4B3T L;  3S16 H;  4IFD G;  4PZ8 A;  1Y14 B;  5EAY A;  5M5X H;  1N34 Q;  1HR0 W;  2F4V L;  2E2H H;  3H3V H;  5C4X G;  2UUA L;  3HOZ H;  1XNR Q;  4DUY Q;  3S1R H;  2I0Q A;  2L15 A;  2MO1 A;  1LUZ A;  3KLW A;  2JEA I;  3VDY A;  4A3D G;  1SMX A;  4JOI A;  5ELO A;  4NXM L;  1AE3 A;  1EIF A;  1L1O A;  4YWM A;  1Y1W H;  2E2J H;  4LF4 L;  3HOZ G;  3KJP A;  2F3I A;  1CKN A;  1BBW A;  5DLQ E;  3RNU A;  4JI6 Q;  3KF6 B;  3L2P A;  3G6E A;  4UP9 A;  3JAM c;  1LTL A;  1HNW Q;  5IP7 H;  3HOY G;  4QL5 A;  1N33 Q;  1A62 A;  3AYH B;  4X66 L;  4A4I A;  3I4M G;  2D62 A;  4X62 L;  2HT1 A;  1Y1W G;  3A74 A;  2JA9 A;  3FKI G;  5AJ3 Q;  1TWH H;  4O2D A;  1VQO A;  2E5L L;  5GAD C;  1FJG L;  1X3F A;  4J15 A;  1KRT A;  5C3E H;  1T9H A;  4DV1 Q;  3S1Q H;  5IP7 G;  1OTC A;  1N32 Q;  3GO5 A;  5IWA L;  4DV0 Q;  3E9I A;  1I94 L;  1PH4 A;  1VQC A;  3S15 H;  2UXD L;  1YHA A;  1GO3 E;  4GNX C;  2UXC L;  4NXM Q;  2K75 A;  2DUD A;  4LUZ A;  1JT8 A;  2WAQ E;  3G4S A;  5IT9 c;  5C3E G;  4POG A;  2JQO A;  3CC7 A;  3M3Y H;  2VQE Q;  1SR3 A;  1IBM Q;  4YY3 L;  2OWO A;  5ELN A;  4JCV E;  1ASZ A;  1I5F A;  1B70 B;  2LXJ A;  3HKZ E;  4OXP A;  4PZ6 A;  4DK6 C;  2E2I H;  4LF8 L;  4P73 A;  2JEB I;  1NBW A;  3HOX H;  4R4O A;  5LMN W;  4LF9 Q;  1W2B A;  4HJA A;  1KIX A;  4KHP Q;  3W1G A;  4WJ4 A;  2Z0S A;  1IXR A;  3J80 i;  1FJG Q;  2IY5 B;  3H0G H;  1PYS B;  1HZA A;  3PO2 H;  3AFP A;  2ZM6 L;  1YVC A;  3HOX G;  2A8V A;  2CWP A;  2PQA A;  1M1K C;  1I50 H;  1LM0 A;  2K4K A;  3I4N G;  1JB7 A;  4A93 H;  1E24 A;  3H0G G;  1XMO L;  4DAY B;  1EQR A;  4BBS H;  3PO2 G;  4HJ8 A;  3NBH B;  1D8L A;  3K7A H;  2HIV A;  3CCE A;  4MNO A;  4A3G H;  3OW2 A;  2Q2H A;  4LW1 A;  1I3Q H;  4C3I H;  3BU2 A;  3HFZ B;  3RN2 A;  4A3K H;  4L5R C;  2NZH A;  2WAQ G;  2K50 A;  4MZ9 A;  3WWV A;  5IYC H;  2JA7 H;  1IYJ B;  3B6Y A;  1OXU A;  1BVS A;  2LXK A;  1PH8 A;  4B3S Q;  2B29 A;  4DR4 Q;  3J81 c;  4AH6 A;  1A0I A;  1JJC B;  1NTG A;  4JI1 L;  2IX0 A;  4A3K G;  3CXC A;  2K5N A;  4HID A;  4OO1 I;  3KFU A;  4JYA Q;  1E3P A;  5IYC G;  3RZD H;  5IE8 A;  4JI4 Q;  4GNX B;  1XMO Q;  1GKH A;  2N49 A;  2Y0S G;  3K7U C;  3KF6 A;  2RCN A;  2JK8 A;  4YCV A;  2RHS B;  1GM5 A;  4C2M H;  4JC0 A;  1YJW A;  3CCU A;  4GKJ Q;  4YWL A;  5M3F H;  2E8G A;  3OTO L;  4LF7 Q;  1VQP A;  3G48 A;  4DUZ Q;  1WI5 A;  3I55 A;  1IL2 A;  4DNI A;  1PH7 A;  1RIP A;  5FJ8 G;  1Z47 A;  2KHI A;  1HNX L;  3A5Z B;  1MJC A;  4A3E H;  2UXB L;  2IT1 A;  3AQQ A;  4MTN A;  4XTC S;  3H15 A;  4GN4 B;  5M3F G;  4OWT B;  4IOC A;  4NXN Q;  4WJ3 M;  1N36 Q;  1QZG A;  3CCJ A;  3I4O A;  4BA1 I;  3PO3 H;  1Q12 A;  3H3V I;  3K81 C;  2XTI A;  4X64 L;  2Q2I A;  2OQ0 A;  4KHZ A;  4HJ9 A;  1EIY B;  5JJI A;  2NZO A;  4A3E G;  1X54 A;  2I5M X;  3U50 C;  1PHJ A;  1N34 L;  5FLM H;  4A3M H;  1FVI A;  4GKK Q;  4YWK A;  1SRO A;  4OWX B;  4JI5 Q;  1XNR L;  3F2D A;  3HKS A;  4DAM A;  1QVF A;  1YIJ A;  3TRZ A;  3OTO Q;  3HOW H;  1VQ7 A;  3M7N A;  2HIX A;  1G6P A;  1PFS A;  2KCM A;  2PI2 A;  3NEM A;  4KI0 A;  2H5X A;  4OO1 G;  5FLM G;  5H1S E;  2JJQ A;  3S1N H;  2UXB Q;  2YTV A;  1P8L A;  4JI6 L;  4B3R Q;  1HZ9 A;  2YTX A;  3SGI A;  1HNW L;  3HOW G;  2AKW B;  4BY1 H;  1N33 L;  3ICE A;  1XPU A;  2N78 A;  3OYY A;  4DR1 Q;  4JV5 L;  1SLJ A;  1VQA A;  2RF4 A;  5AJ3 L;  3S14 H;  1JMC A;  1KRS A;  2I5L X;  1XTD A;  4UP7 A;  1HH2 P;  4L5S A;  3FP9 A;  2KHJ A;  1QUQ B;  3LGJ A;  3UE1 A;  4DV1 L;  1N32 L;  4BY1 G;  5LMN Q;  4DV0 L;  4JI7 Q;  3M4P A;  2YTY A;  4DPG A;  1GVP A;  2VY3 A;  4GLA C;  2BA0 A;  2ZJR A;  1Q1E A;  2YYZ A;  3TEH B;  4DR5 Q;  1VQK A;  2WB1 E;  1UE7 A;  4HJ7 A;  4ME3 A;  2VQE L;  2VQF Q;  2ZTD A;  1A8V A;  1IBM L;  3S2D H;  1YI2 A;  4A3C H;  3F2B A;  4X6A H;  3M4Q A;  4OWW B;  4LF9 L;  1K83 H;  2YV5 A;  4AYB E;  4DR2 Q;  1XPR A;  4LUO A;  4JBM A;  4JV5 Q;  4KHP L;  3CMA A;  4GNX A;  1B8A A;  4TQU S;  1VQ9 A;  3GTP H;  4B3M L;  1HNZ Q;  5HY6 A;  1K0R A;  1EFW A;  1VQ5 A;  2OTL A;  3STB D;  3A5U A;  2XGT A;  3UE0 A;  3W1B A;  3CCL A;  2OCE A;  1KAW A;  4A3C G;  1V43 A;  4YCU A;  2IX1 A;  1SE8 A;  2A19 A;  3T1Y Q;  2WP8 J;  1P16 A;  2WFW A;  1NMF A;  1PH5 A;  2N8N A;  3J80 c;  4GOP C;  4QIW E;  4R4I A;  4A75 A;  2AWO A;  4R1J A;  2EIF A;  4C3J H;  4IO9 A;  4GLV B;  5JJK A;  2BA1 A;  3UDF A;  4Y7N H;  5IY0 A;  3W5O A;  1L1O C;  1Y1V H;  2NVY H;  3GTM H;  4DR7 Q;  1J6Q A;  1S40 A;  1VQ6 A;  1KQS A;  1YIT A;  2Q2U A;  4A3F H;  1Q8K A;  2JA6 H;  2HQL A;  4B3M Q;  1VQM A;  2WB1 G;  1L0W A;  1UE6 A;  4HIM A;  1Y1V G;  4B3S L;  4R4Q A;  1IZ6 A;  5JEA J;  4YHH L;  4DK3 C;  5C0X J;  1NE3 A;  4P72 A;  1XPO A;  2GVA A;  4DR3 Q;  1KL9 A;  2ZJQ A;  2R6G A;  3Q8D A;  1K8A C;  3TQY A;  3AEV A;  4HIO A;  4A3F G;  3PGZ A;  3CME A;  2JA6 G;  3CAM A;  4JYA L;  5GAH C;  5C0X I;  3ZJY C;  1VCI A;  2B63 H;  2FXQ A;  4LFA L;  4JI4 L;  3CPF A;  1X9N A;  2ZTC A;  4JI2 Q;  3J7A 5;  3T1H Q;  4IPD A;  4GKJ L;  2R92 H;  2JE6 I;  3CP0 A;  4C3H H;  2CWA A;  1TWC H;  1G51 A;  1XNQ Q;  3A0J A;  1V1Q A;  4LF7 L;  4A93 G;  3NEL A;  1VQD A;  4DUZ L;  3GTJ H;  1WOC A;  2B63 G;  4LF5 Q;  1V9P A;  3PV0 A;  1XMQ Q;  4BBS G;  2K5H A;  1SRU A;  1EUJ A;  3CCM A;  1QUQ A;  4DV4 Q;  2R92 G;  1VQI A;  4DV3 Q;  3RLF A;  4YHH Q;  2LSS A;  4NXN L;  3I56 A;  1LYL A;  4GN3 B;  4UPA A;  1WCM H;  3F8T A;  3HKZ G;  3PUX A;  1PH6 A;  1N36 L;  4IJH A;  4A3G G;  1A63 A;  4JI8 Q;  2EXD A;  3D0F A;  1W3S A;  4NPS A;  3ULP A;  4NB3 A;  3GTQ H;  4LFA Q;  2JA7 G;  4PMW A;  4BBR H;  4GOP B;  1WCM G;  3GD7 A;  4LF6 Q;  4GKK L;  4K0K Q;  1K8G A;  4JI5 L;  3F1Z A;  3M4O H;  3DM3 A;  3NEN A;  4YCW A;  1L1O B;  1HR0 Q;  3K80 C;  2MO0 A;  3GTL H;  2CKZ B;  3U4Z A;  1PH9 A;  1FGU A;  4BBR G;  3KDF B;  1HJP A;  5JEA G;  5C0X G;  2ATW A;  5GAG C;  4IPG A;  2ID0 A;  4B3R L;  5IYD H;  1QZH A;  3BZC A;  1S3O A;  1MJE A;  1VQL A;  1BKB A;  4A76 A;  3ERS X;  3S2H H;  2AMC B;  3CC2 A;  4DR1 L;  2RHQ B;  1CSP A;  1JE5 A;  4IFD J;  2QGQ A;  1VQH A;  1U5K A;  4DV7 Q;  2JA8 H;  4APV A;  4DV2 Q;  4BY7 H;  1RL2 A;  5IYD G;  1Q81 C;  4JG2 A;  2NVQ H;  3J81 i;  3RZO H;  5LMN L;  4IFD I;  4PZ7 A;  3PO3 G;  1I6H H;  4JI7 L;  1SFO H;  4UP8 A;  1C9O A;  3S24 A;  3PCO B;  5LMU Q;  2PNH A;  2Z6K A;  1NMG A;  2AWN A;  3GDE A;  2QEX A;  4DR5 L;  4A3M G;  1NY4 A;  4BY7 G;  1GD7 A;  5C4J H;  3KOJ A;  1WJJ A;  2AHO B;  4BXX H;  2VQF L;  1QVC A;  2PI2 E;  1IBL Q;  5BR8 Q;  1G29 1;  3JC6 6;  1CUK A;  1PYB A;  1MIU A;  1X3G A;  2UU9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...