2JA6G

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja6G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja6G01
3NEMA 1J6QA 1D7QA 4A3BH 3NBHB 4JI7L 3H3VI 2Y0SG 1A63A 2I5MX 3OYYA 4DR4L 2BH2A 5M3MG 4DUYL 4L5SA 4JI5Q 2LXKA 3PUXA 4WJ4A 2WB1E 2IHFA 3K7UC 4DR7Q 1Q12A 3J81i 2Y0SE 1XNRL 1YHBA 2NVYH 4PZ8A 2F52A 2HHHQ 4HJAA 2UXBL 4C3IH 3RLNA 3J80i 4LUOA 3J81c 3NELA 2KBNA 1MJCA 1Z47A 3F2BA 4HJ8A 3G4SA 4JI6Q 3J7A5 4NPSA 5IP7G 1K9MC 1WI5A 4JI7Q 1E3PA 1Q86C 4K0KQ 3VDYA 2VZAA 1EQQA 3M4PA 1PV4A 1I94L 4BY1G 4DUZL 2K5NA 2NN6G 2UXBQ 4WJ3M 3KF6B 2PNHA 1EYGA 1VQLA 3KF6A 3HKSA 3UDFA 5LMNW 1X54A 2F4VQ 4DR7L 1B70B 2VY3A 4BXXH 3BJUA 2XTIA 4IJLA 1QZGA 1TWGH 4YWLA 2JK8A 1MJEA 4BBSG 1A0IA 4BY1H 1PH7A 1EOVA 3M4QA 1PH6A 1JT8A 2N3SA 1HNXL 5EAYA 2JJQA 1PH1A 4B3RL 1VQKA 2VUMG 1X9NA 2IHEA 2VQEL 2PI2E 2N78A 3HOXH 1CKOA 1B8AA 5C0XI 3G71A 4LNQA 5FLXc 4LFCL 2RHQB 3CAMA 4JI3L 4NXML 4YWMA 1XNQL 3H15A 3CC7A 2E2JH 2OCEA 1XNQQ 4DV3L 1V9PA 1HH2P 2AKWB 4R4IA 4L5TA 4QIWE 3OW2A 4OX9Q 4XTCS 4JOIC 3CPFA 4QY7A 4UP8A 1Q81C 2UUAL 4IOCA 4A3MG 5FJ8H 5IYDG 4LFBQ 3TREA 1OTCA 3KFUA 2L15A 1XJVA 4NB3A 4JI8Q 3PUWA 3CCMA 1AE2A 1VCIA 2HT1A 3PO2H 3CD6A 2UUBQ 4JBMA 4IFDG 4A93G 1K83H 1G6PA 2RHSB 1K73C 4IFDJ 1IBKL 4DK6C 1KRTA 4DV3Q 1XNRQ 1TWAH 2KHIA 1K0RA 1KAWA 2Z6KA 1Q7YC 1PHJA 4JV5Q 4DV1Q 1E22A 3BZKA 3T1YQ 4A3FG 1JE5A 2JA7G 2YTYA 1N32L 1Y1VG 1Y1WG 2JQOA 4A93H 3CMEA 1N33Q 3I4OA 2NVTH 1EIFA 3PIOA 2ZTDA 3CPWA 4B3MQ 5JJKA 2B29A 5M3FG 4IPCA 4AIMA 1WYDA 2PQAA 2CWPA 2E2IH 4LF6Q 3GTLH 3BU2A 4DNIA 4YWKA 4X6AH 4A3KH 2NVXH 4DR4Q 2Q2UA 4JI6L 1PH3A 2QEXA 3CC4A 3L0OA 1N9WA 1TXYA 1J5EL 3RR5A 4QJFA 4A3FH 1TWCH 2LSSA 4UP7A 1WOCA 1S3OA 4NXNL 1VQ5A 2KENA 3T1HQ 2VL6A 3CXCA 2YTVA 4BA2I 1PVOA 2ZM6Q 4DR3Q 4JI2L 1IL2A 1L1OB 3CMAA 4DR1L 1XPUA 4X62L 3CW2C 4POFA 2GVAA 3KDFB 2UUCQ 3CP0A 3EBEA 3B6YA 5BR8Q 3J80c 2FXQA 1CKMA 4OWTB 4LF8L 3I56A 2E5LQ 1PFSA 1Q46A 2JEBI 2Q2HA 4X66Q 1K8GA 1EIYB 3AEVA 4JC0A 5M5YH 4HJ5A 3FP9A 2XGTA 3CCEA 1CSQA 1IBLL 5IP9H 3AYHB 3HOWH 3RN2A 2WFWA 5GADC 2D0OA 2AWOA 4A3IG 2QA4A 4OO1G 3E0EA 4R4QA 3U58A 5HY6A 4TVAB 3PIPA 4B3TL 4R4OA 3GTKH 4BY7G 4OONA 2UXCQ 3PCOB 4LUVA 3S1MH 4PZ6A 3PF5A 1TWHH 3ULJA 4HJ7A 3S24A 3ULLA 4PMWA 4DAMA 2R92H 4P75A 3ICEA 2UU9L 1HR0W 4HIKA 1KHIA 3GTQH 4DAYB 2CFMA 5IY0A 2JA9A 2VUMH 1A8VA 1BBUA 1E7ZA 1X3FA 1H95A 3ZJYC 5C3EH 2OQKA 1A62A 4YCUA 1YHQA 3CCLA 4IPDA 5K36G 1S40A 3CCRA 4B3ML 1JJCB 2ALYB 4GKKL 4A3KG 4MTNA 3L7ZC 3OTOQ 1OXVA 3JC66 4ME3A 3CF5A 3S16H 2D62A 3A5UA 2DGYA 2VQEQ 3H3VH 4A3JH 3HOYG 1FJGQ 4KHPQ 3HOZG 4BBRG 1Q1BA 1V1QA 1VS0A 2K5VA 4X66L 4DV5L 4Y52H 4DV4L 4A3GH 1B7YB 1U0LA 4GKJL 1IBKQ 2KHJA 1IYJB 1OXXK 4A4IA 1LYLA 2HIVA 3KOJA 5GAGC 2JA6H 4GKJQ 4C2MH 3K81C 4MNOA 3PSIA 1HZCA 4X62Q 4A75A 1CKNB 3H0GG 4JI8L 3W1BA 3HOUG 4OWXB 2IY5B 4YY3L 2NN6I 3TEHB 4EQ5A 3GTPH 2R7ZG 3U4VA 1IBML 2EXDA 2ATWA 3MXNB 1X56A 4BY7H 3LGJA 3HOVG 4A3JG 1N36L 2K5HA 2I5LX 3A0JA 4A3IH 3PF4A 1HR0Q 4PZ7A 5GROA 2MNAA 2OTLA 3G48A 1GO3E 1PYSB 3JAMi 1Q8KA 3GD7A 4DR2L 1VQPA 2R7ZH 4DV5Q 1E1OA 5GAEC 1R9TH 5LMNL 2YV5A 4R4TA 5ELNA 2VW9A 3CCSA 2C35B 4GNXA 1JJ2A 1AE3A 5C0XG 4HIOA 4A3DH 1E1TA 1IXRA 2RCNA 1GVPA 2HIXA 3UDGA 1BBWA 1EFWA 3E9IA 4APVA 2UXCL 1CUKA 4YHHQ 1D8LA 4LF5L 1C0AA 3A5ZB 1P16A 1E24A 4GS3A 4LF6L 3D0FA 3CCVA 4DUZQ 3M9BA 2HQLA 1I3QH 4QQBX 3Q8DA 4GLXA 3J81j 4BA1I 4A3CH 5M3MH 4YCWA 4GN3B 4X65Q 5LMUQ 3S1NH 1SROA 1L1OA 4AQYQ 3S2HH 5ELOA 1N32Q 1UE7A 4YCVA 2UXDQ 4JBWA 4DR6L 5JJLA 3PUYA 3HKZG 3AFPA 5C44G 5IYBH 1VQDA 2ID0A 5H1SE 2JA8H 1UWVA 4GOPA 3I4NG 2ZM6L 3A74A 5DLQE 4DR3L 3M3YH 1G51A 5M5XH 4DR1Q 4L5RC 1T9HA 4JG2A 5FLMH 2ASBA 2KCMA 1NJIC 2WAQG 1HNZQ 2B63G 4GOPC 4X65L 3T1YL 4GNXB 4P73A 4LF8Q 2JEAI 3S17H 3GTGH 1KQSA 4GN4B 1L1OC 4UPAA 1YJNA 4LFAQ 1GKHA 1VQIA 1LM0A 2F4VL 4XIGS 4JI2Q 1N36Q 1XTDA 2YYZA 1NY4A 4B3TQ 3S14H 1WJJA 1GD7A 1HNZL 5M3FH 1M90C 4YY3Q 3S15H 5AJ3Q 2AMCB 1OXUA 2ZJQA 4A3LH 2JA6G 1WFQA 1I94Q 1NMFA 2E5LL 2BH8A 2JE6I 2K4KA 1XMQQ 1MIUA 1WCMG 3H0GH 4A3GG 4A3EG 2H5XA 2OQ0A 3PGZA 4AQYL 3M4OH 2UXDL 5C0XJ 2Z0SA 2MO0A 2ES2A 1VQ4A 3M85A 2N8NA 4DR5Q 4LF7Q 5AJ3L 1NMGA 3RZDH 1QZHA 2ZJPA 2UUAQ 1W3SA 2A1AA 2BA0A 1KD1C 4KHZA 5JEAJ 1EQRA 3OTOL 4JI1L 1NBWA 3KJOA 2YTXA 1L0WA 2NVQH 1KC8C 1VQ6A 1SE8A 1VQCA 1NE3A 3AQQA 4JI5L 4LUZA 1Z9FA 1GM5A 1KL9A 1VQJA 4C3JH 3EN2A 4KI0A 1PH5A 3M7NA 2V1CC 3PUVA 3KF8B 4DR6Q 4GLAC 3TS0A 3CC2A 3U4ZA 1C9OA 1UE1A 3FKIH 3U50C 3UE1A 3CCQA 4DV6L 1XMQL 1VQ8A 1LUZA 2AHOB 3I55A 2VNUD 1KRSA 1X6OA 4A3DG 1FL0A 4KLKA 3F2CA 3I2ZA 4LFBL 1SR3A 4DV2Q 3ERSX 1OXTA 2K52A 1SLJA 3KDFA 4DV0L 1SFOH 1YITA 2Q2TA 1QUQA 4YHHL 5J3BA 1U5KA 5IWAL 4A3CG 3K7AH 1EWIA 2WB1G 4IO9A 4JI4Q 1HZAA 4A3MH 4L5QA 4A76A 1RIPA 1PYBA 4ALPA 4AYBE 1YIJA 1PH2A 2CCZA 4DR2Q 5C4JH 2R93H 1DGSA 1IZ6A 3CCJA 2NZOA 2MQHA 3TS2A 3GTJH 5FLMG 4IJHA 1I6HH 3L2PA 1SMXA 4DV4Q 2WP8J 2ZTCA 4A3EH 4JI1Q 2B63H 3KJPA 2K14A 3S2DH 2R93G 1KIXA 4GLVB 4LF7L 1PH4A 3PO3H 1KXLA 1FVIA 3UE0A 3D31A 1QVCA 4LFAL 4UY8C 4JI0Q 2K50A 3GTMH 2VQFQ 1QUQB 1YNXA 1YBYA 3F2DA 3CCUA 1C7YA 3ER0A 1EUJA 1MKHA 1NTGA 2PMZE 1X3EA 3SGIA 2R7DA 3PO3G 3DM3A 3S1RH 1CSPA 1G291 2A19A 4LW1A 5IP7H 3DLLA 3RNUA 2I0QA 2OWOA 4A3BG 5LMNQ 5IWAQ 1UE6A 1OXSC 4O2DA 4DV1L 4R1JA 2NZHA 5IE8A 2ZJRA 3KLWA 3GTOH 3F8TA 4JCVE 1JB7A 1VQ9A 4B3SL 2JA8G 3HOYH 4BBSH 5C44H 2B3GA 2EIFA 4P74A 2R7FA 4TQUS 3W5OA 1QVGA 3STBC 4POGA 1IBMQ 1HNXQ 3I4MH 3ULPA 1YI2A 4R4CA 3HOWG 1HZ9A 2MO1A 4HJ9A 2AWNA 2MFIA 1VQOA 1SN8A 3J7ZC 5IT9c 1JJGA 1HR0L 1X3GA 3HOUH 2LXJA 2GVBA 4DV0Q 2A8VA 5JJIA 1UEBA 2WAQE 4LFCQ 3FHWA 3EIVA 2GN5A 1M1KC 4DPGA 1LTLA 2R6GA 1XMOL 2EQSA 4LF9Q 4NXNQ 3UDXA 4PG3A 4IPGA 1YJWA 2DUDA 2KCTA 4GN5A 3HOVH 5C4XG 2Z6KC 1BVSA 3K80C 4DK3C 1Q82C 5IYBG 1VQHA 2VQFL 3JAMc 2IX0A 3E9HA 1SRUA 3I7FA 4BXXG 3CQZH 2I5HA 4IPHA 4LF5Q 5JEAG 5M5WH 2CWAA 1PH9A 1S72A 5IP9G 1RL2A 4DKAC 5HGQA 2BA1A 1VQMA 3S1QH 3G6EA 4JOIA 4LF4L 5GQOA 1FGUA 4X64Q 5LMUL 3PUZA 4O0AA 4K0KL 4RMFA 1ASZA 1PH8A 1VQGA 3PV0A 3RN5A 4DR5L 4IFDI 1JMCA 3GO5A 1Y1WH 1BKBA 3MEFA 4JI0L 4UP9A 1N34L 3TRZA 1N34Q 4GOPB 1HNWL 3NENA 2UUCL 2YU9H 1FJGL 4KHPL 4JBKA 1N33L 2R92G 3FKIG 4J15A 4X64L 1YHAA 1P8LA 3WWVA 3RZOH 4DV7Q 2HHHL 1VQNA 1HZBA 1VQBA 4DV7L 3PO2G 3AFQA 1PA6A 3GDEA 5E7NA 4OX9L 1QVFA 4DUYQ 4GKKQ 1O7IA 1HNWQ 4B3SQ 3K8AA 1HJPA 4QGUA 1VQAA 4LWCA 1Y1VH 1VQEA 3HFZB 4EX5A 1W2BA 2JA7H 1L2FA 4JBJA 2UUBL 4RG1A 4P72A 5C3EG 1TWFH 1N8RC 2ZTEA 2CQOA 1I5FA 4DV6Q 4JYAL 1YEZA 3HOXG 2RF4A 1XMOQ 2UU9Q 4LF9L 3I4NH 4LF4Q 1K8AC 4GNXC 1XPOA 4JV5L 1X55A 1Y14B 2QGQA 1I50H 4HIMA 1J5EQ 2CKZB 5IYCG 4HIDA 2JA5G 4JI3Q 1VQ7A 4DV2L 2VS1A 4FDBA 4AYBG 4BBRH 3K0XA 4QL5A 2K75A 4A3LG 2IX1A 5FJ8G 4IOAA 5IYDH 5GAHC 1K3RA 3HKZE 2Q2IA 1IBLQ 2F3IA 1CKNA 3BZCA 4Y7NH 4H02A 1YJ9A 3W1GA 2N49A 4B3RQ 4JI4L 4JYAQ 3RLFA 3TQYA 2D0PA 1XPRA 3I4MG 1Q1EA 4MZ9A 3STBD 5BR8L 1ASYA 2OTJA 4OO1I 4P71A 1AH9A 1X65A 2PQAB 3UDIA 4C3HH 4AH6A 4OWWB 2E8GA 3KYHC 4NXMQ 2PI2A 3F1ZA 1VQFA 2IT1A 3IRBA 5C4XH 3T1HL 1UE5A 5IYCH 2JA5H 3RLOA 2E2HH 1WCMH 4OXPA 1V43A 1YVCA 1YZ6A 3HOZH
chains in the Genus database with same CATH superfamily
3OMGA 1UEAB 3BABA 3OWEB 4A3BH 1XXGA 4JI7L 1X3QA 1A63A 1SFOA 3OYYA 4DR4L 2BH2A 3M4OB 2AUKA 5JEAH 3MA2B 3PIO3 2WB1E 3VPCA 2IHFA 4EEYA 3D4WA 5KG6A 3GTGA 3V6KA 2HHHQ 4HJAA 3DEOA 1PFBA 3PZPA 3RLNA 2EVBA 4CJ1B 3J81c 3GIQA 2J6TA 1EOTA 5KFGA 2L12A 3F2BA 3UFXB 2PO4A 2B2VC 1D5MC 5IP7G 1B50A 4F50A 1Q86C 1EQTA 2GLTA 2YS7A 2K5NA 4KV6A 2UXBQ 1B33N 2PNHA 1VQLA 2F0VA 1CHQD 3KF6A 3R2IA 1Z2OX 2NU7B 2W9CB 3Q6SA 2MGSA 5KFMA 1X54A 2F4VQ 5EZYF 4S3SA 1ET9A 3G7LA 2V4QA 1S4ZA 2V59A 4QIWA 2DY7A 3S17B 1TWGH 1KABA 4BY7B 4BY1H 3QG1A 1CQIB 1ESFA 3MFYA 1HNXL 1I4RA 4WD3A 2XGQA 2B39A 5IGBA 3CHBD 1Y8OB 1RODA 2ZT9C 3FEWX 3KHLA 2ASJA 2UXDH 4LNQA 1CKOA 4UHVA 4JI3L 2J7ZA 3NUCA 1NNXA 3CQZB 4YWMA 2A69D 1NCVA 2OCEA 2E2JH 4R4IA 4L5TA 4C1NK 4JOIC 4UP8A 4RU9A 2NVQB 4A3MG 3K59A 3TREA 3LMLA 5KFVA 5G3LF 4XQJA 2RDHA 3FPPA 1ICFB 2UUBQ 3E6ZX 4JBMA 1ULZA 1K83H 3K0YA 4IFDJ 1K73C 4C5CA 3RD4A 1EWHA 2WB1A 1A3UA 3MC0B 4MV7A 5FO7B 5BN4A 1EY9A 4JYAH 2F0MA 3I8ZA 3T1YQ 3HOXB 3QZ8A 1N32L 2F0NA 2F4VH 1Y1WG 5CR3A 3BA8A 3GTPB 3PIOA 4RZRA 2R8GA 5ELBA 5C4XB 3RZDB 4LF6Q 5ELEA 4DR4Q 4JI6L 3VR5A 3FRPB 2UXBH 3PVXA 3IG0A 5CMDA 1N9WA 2OH2A 2HQEA 1N48A 2G5DA 3E5NA 4HMJA 4A3FH 3GQBA 4UP7A 4QCLA 2L5TA 4ZI7F 4BA2I 2F0OA 2A6ED 2VL6A 2DZDA 1IL2A 4XDXA 3S14B 1S5ED 1EYDA 1TA8A 4X62L 3CW2C 1LTSD 3ETJA 3J7AK 4POFA 4ECYA 5DM63 4I50F 3BVZA 4O1NA 3J80c 4FU0A 1CKMA 3ETHA 4OWTB 4LF8L 2DPJA 4MTEA 2NTSA 1N36H 3OHAA 1U9RA 2P0AA 2VQDA 1CSQA 3GTOA 1IBLL 3A7AB 3AYHB 2B2TA 5AFWA 5IP9H 2WFWA 3RN2A 2QDLA 4I7ZC 4A3IG 4PWQA 3M4YA 1F9PA 5KFQA 2JA5A 4ZYSA 3E0EA 3DXJC 4XYOA 3GTMA 1SE2A 5C3EB 5LMUH 4IR1A 4OONA 4QIWB 1UUPA 4ECVA 3ULJA 1X32A 5HV6A 2NWGA 2B2VA 2V5AA 3ULLA 1DM0B 1WTWA 2R92H 4P75A 4QB4A 4HIKA 4NW2A 1RYRA 3BQ0A 3GTQH 4DAYB 3J7AF 2RGVA 4A2BA 2W9AA 2AUJD 3DHQA 2WYOA 5KYIA 1V8QA 1YHQA 1H95A 1V51A 4YCUA 5C8YF 5EWGA 5KNCA 4IPDA 2R85A 1QCBD 1S40A 4LMYA 4YY3H 4ECSA 4B3ML 4ME5A 5KFBA 2SCUB 1VBHA 1Y1WA 4ME3A 1I3QB 1EY4A 3OW7A 1O75A 3RZOB 1PRTD 2D62A 3N52A 3QFFA 4A3JH 1XDNA 3VYUA 2K5DA 4KHPQ 3HOZG 1ICWA 4BBRG 4DR3H 1Q1BA 2K5VA 1WD1A 2XCLA 2MP1A 4A3GH 3L4KA 1Z6HA 1U0LA 1IBKQ 1GHJA 2KHJA 4XYLB 1OXXK 1KC7A 5BN5A 3J81L 4JV5H 4A75A 2PVPA 4UCSA 2E76C 1F9SA 3GTPH 3U4VA 2K5WA 2NZ1D 4LSAA 1FNWA 1QB5D 3WNZA 1TWGA 4BY7H 1ZXTA 3MXNA 1N36L 2M00A 1EY0A 1M4VA 1VBGA 2MNAA 2OTLA 2P5ZX 1PYSB 4G4KA 4I4TF 3L3OC 2BDOA 3Q2OA 2WACA 4X62H 5GAEC 5LMNL 1B2TA 2YV5A 4CGYB 1AZQA 1TVXA 2QDBA 4K8IA 2VW9A 2C35B 3CCSA 1JJ2A 5IOCA 5FLXW 1JWSD 4X3KA 3OSPA 2CW8A 2JA7A 2UUBH 3RIZA 1BBWA 2NVXA 1IOWA 3HG9A 4YHHQ 2V4DA 2R93B 4DR7H 4GS3A 4DUZQ 4J6HA 3K5HA 2OF1A 3J81j 1RDPD 1KBLA 4ETSA 3M9OB 2NU8B 5M3MH 4PMBA 3V6HA 3IKJA 1WTVA 1SROA 3H40A 1UE7A 4JBWA 1WCMA 3HKZG 1ZHQA 5DGAA 2Z1CA 1LTTD 1DJRD 1GUGA 1FNVA 1VQDA 2ID0A 5IYBH 1G6PA 4DR3L 4FF1A 2VR1A 1G51A 2HD3A 2A69C 4N8FA 5M5XH 3EFXD 4A3GB 1AUVA 2YW2A 4Q45A 4JG2A 3SK4A 2K04A 1HNZQ 3S15B 5KFLA 1U4RA 2JEAI 4EFEA 3H91A 4GN4B 4N9PA 4UPAA 1S5BD 1GOZA 4LFAQ 1S5DD 1VQIA 3NP8A 4MV1A 3U9OA 3I70A 4XIGS 2QEJC 4B9XA 1LTID 1XTDA 2YYZA 3S14H 5JVG3 2G9HD 5KG0A 1M90C 1SYEA 1WH2A 1OXUA 3HP3A 1I94Q 1NMFA 3QO2A 2E5LL 2BH8A 4EYHB 1XMQQ 1FGBD 1ZEQX 3H0GH 3SK8A 1ENAA 2UXDL 3VR3A 2N8NA 3WO0A 1TWFB 3VPBA 2JSOA 4ED8A 1WTRA 4DV0H 2YL2A 2K6AA 1R4QB 3MTSA 2C2EA 1NBWA 3EJIA 3KJOA 2JA5B 1HA6A 1NR4A 2LFNA 2TSSA 3MFGA 2F0LA 1KJIA 1QJOA 4JK1C 1KC8C 3AQQA 2IL8A 1NE3A 4RCNA 2BE5C 4JI5L 3FDTA 4LUZA 5A2QL 1GM5A 3MFHA 4HYKA 1EZ6A 1HRJA 2L11A 3F8NA 1CQFA 2V1CC 3PUVA 4DR6Q 3FVQA 5C5JA 1C9OA 1UE1A 4DV6L 4RB0A 1IBLH 3HS0C 2EDGA 2AHOB 3I55A 1O7LA 3RV4A 1TWCA 1X6OA 5E4XA 3S9WA 4DV3H 1XNRH 3P7JA 3K5MA 1SR3A 1MZBA 4KJOA 5L37A 2R86A 3ERSX 1OXTA 1I4QA 1CA5A 4DV0L 1SFOH 5ELDA 2CH4A 2F0PA 5FK9C 3GV5B 5IWAL 1PYWD 4RKBA 3K7AH 4ED7A 1EWIA 5G3LD 1GUOA 1KJQA 4N9TA 5JH7F 2C00A 3I4MB 1AN8A 1RIPA 2VOBA 1PYBA 4ALPA 1YIJA 1PH2A 3SK6A 4DR2Q 1GUNA 4MHEA 3CCJA 4P2CB 1XMOH 4TQRA 3GTJH 3H94A 4LF4H 1QOHA 3GV7B 4JPBW 5D3DA 1EEID 1SMXA 1FKAH 2NU6B 4QWDA 1KNAA 1PTOH 2UVUA 4DR5H 5F9LA 2K14A 1LTRD 2R93G 2AGQA 3MHBA 4LF7L 1PH4A 3PO3H 3D31A 1QVCA 5CV5A 2CW7A 4X64H 1JR0D 2XC9A 4EYIB 4JI8H 2CQYA 2K50A 3GTMH 1A3TA 4ECWA 4DGZA 1EYZA 4RB1A 3MZ5A 4LW1A 1K28A 3QB3A 4LH7A 3S1QB 4MTKA 4DV1L 2SNMA 5KFZA 2ZJRA 3GTOH 3F8TA 4J8QA 3HOYH 2JA8G 3BDOA 4LF9H 2PMZA 2SOBA 1AZPA 1K3BC 4F4ZA 3MR3A 3ERQA 3HGBA 5FPRA 1QVGA 3STBC 4JUZA 4POGA 2N88A 1RTNA 3ORRA 1SEBD 1EFID 1HZ9A 1VQOA 3TBIB 2O03A 2MFIA 5IT9c 3TN2A 4F4YA 1WCMB 2LXJA 2GVBA 2TMPA 2A8VA 5JJIA 3R23A 4IWXA 2UUAH 2WAQE 1L2ZA 3FHWA 3LWUA 2GN5A 3MEHA 2IWHA 4DPGA 3N44B 4F4WA 3TP8A 1ZYRD 1CI3M 4NXNQ 4NXMH 1K8MA 1YJWA 2F4IA 2JEIA 2C9OA 2Z6KC 4A3JB 1Q82C 3GTPA 3T1HH 3TQTA 2NTTA 1W6KA 4O3PA 2R7ZB 1SRUA 3I7FA 3GTKB 1BCPF 5JEAG 2I07B 1PH9A 2VXWA 1RF2D 5IP9G 1RL2A 2ENBA 4DKAC 3K5LA 3T1YH 5BR8H 5I6YA 1VQMA 3G6EA 4L1KA 3GQCA 2W71A 3N41B 5GQOA 1FD7D 4X64Q 5L1KA 1E2VA 2YCHA 2D2CC 1ASZA 4ODGA 4FXKC 4KY7A 4UP9A 3RUPA 4B3RH 3OSOA 3KUPA 1HNWL 1DOLA 1RYSA 4MAMA 3T5JA 2YU9H 1FJGL 3IN5A 2R92G 4X64L 3WWVA 2YRXA 2RVLA 4DV7Q 2E75C 2HCCA 1HZBA 4MV9A 2ASLA 1PA6A 3TQ1A 5E7NA 2IA6A 2B63B 4A3KB 4GKKQ 3GP7A 3Q8SB 3NSWA 5D8DA 3K8AA 4OHJA 5C5MA 4PDBA 4O4LF 1VQEA 3J80W 2GPWA 3GTLB 3X3NA 1CK1A 1ZKOA 1Y1WB 2EXZA 2FMCA 4DV6Q 3SE7A 4C3IB 4JYAL 3HOXG 4BWSC 1FJGH 1X55A 1Y14B 2XD4A 3A8IE 1EL0A 3FMCA 1BF4A 2FLPA 4FDBA 4BBRH 4KK7A 2B8GA 4YAKB 4CDFC 1QG7A 1CKNA 1EIHA 3EPIA 4Y7NH 2N49A 4B3RQ 4JI4L 3VMMA 3RLFA 2W6ZA 2D0PA 3HB9A 5I6WA 5BR8L 4OO1I 1X65A 1HNXH 4C3HH 4OWWB 2Z8LA 4XXEA 1GLVA 1T5EA 2KA7A 2JA6A 2L4NA 2IT1A 2KHSA 3IRBA 5IGFA 4FF4A 1RK5A 4RZQA 3T1HL 2Y0SB 2KEEA 2B2UA 3IL8A 4MIUA 3U9SA 1XNQH 1SCUB 1STEA 4ABNA 3NBHB 3A55A 2I5MX 4QMGA 3DF7A 2RDFA 5J2UF 4KJNA 2R61A 4IZ8A 1UNNC 4K5WA 5EPJA 1EYCA 4HNTA 1IKMA 1WR2A 1EZ8A 4CDCC 5J39A 2ALZA 4DR6H 2NVYH 2X6GA 2NVTB 2UUCH 4NMZA 1B3AA 3PW7A 4LUOA 4C5BA 3S16B 4H7BA 4R8IA 3G4SA 3K3PA 1PTOD 4NPSA 4NP5A 1WI5A 4C1NI 1E3PA 2RQXA 1EQQA 2VB2X 1PV4A 1IYUA 4BY1G 4DUZL 2NN6G 1EYGA 3SXHA 2B2TC 3UDFA 5LMNW 4J9PA 4FVMA 4TUYF 4G3IA 1E2ZA 2XTIA 4IJLA 1F9RA 4XT3B 1QZGA 1HCZA 3OUUA 5DLGA 4K2LA 3S1MB 3S2HB 2W6NA 3KF8A 3Q8PB 2JJQA 1PH1A 3HBLA 1FNUA 2EY2A 3PW2A 3OIPA 1EY5A 2UVWA 1X9NA 2IHEA 3HOXH 1B8AA 3V96A 4XYMB 4QWEA 1XWEA 5KIXA 3GTJB 4IFDH 1C4QA 5EPLA 2DNCA 3H15A 3CC7A 1XNQQ 4CJ0B 2AKWB 5EKKA 5EOYA 3MR5A 5M5YB 3ZYYX 5IYZF 2L15A 2RDIA 2ZDGA 2IX3A 3MWEA 2LY7A 1NSNS 3D4DA 2W9BB 5CA1F 1LT3D 1PMRA 3BVMA 1IBKL 2KOLA 5EDWA 1CFMA 1K0RA 4JV5Q 4DV1Q 4B9WA 5KFDA 3LNNA 2VUMB 3BZKA 1JXLA 2JA7G 1VDZA 2YTYA 1Y1VG 2UXCH 3I72A 5FLXE 2JQOA 4KD4A 4A93H 1VMPA 1S97A 1AN7A 4RB2C 3CPWA 4B3MQ 3Q23A 2B29A 4PNYA 4HNUA 1WYDA 2PQAA 3GTLH 2E2IH 4HAEA 3TP5A 1K0SA 4FBUA 3JAME 4DNIA 2A6HD 2QEXA 3CC4A 2PCFB 1CE8A 3RFCA 1S9FA 4JI4H 3RR5A 5ELFA 2WAQA 4LSXA 3RBEA 3C46A 1I4HA 1PFNA 2V58A 2YTVA 4DR3Q 4JI2L 3CMAA 3JRWA 2KEDA 1XPUA 2CW0C 2VA3A 2ASDA 2RDGA 2EYOA 1GSOA 2NU9B 3GV6A 3I56A 4LFBH 1QWYA 5KFXA 5E3FA 1BXTA 4JI6H 1K8GA 1BCPB 3AEVA 5F9NA 2F3WA 2XGTA 2L9HA 2D0OA 2AWOA 4OO1G 4A3MB 4B3TL 3U58A 4TVAB 3GTKH 4DXGA 2UXCQ 3S1MH 4Q5VA 5KT4A 2B2WC 1SYDA 4QF4A 4ED6A 2C5CA 4PMWA 4APMA 1TWFA 1SYBA 1SNOA 3NWTA 2HCIA 2YZGA 5IY0A 3RBDA 4LF5H 2FK2A 2JA9A 2VUMH 3VYSA 4BY1B 3U9TA 5CA0F 2CHBD 1BBUA 1E7ZA 5KEEA 5C3EH 2DWCA 1I4PA 4DK0A 1JJCB 1E4EA 4MTNA 1O80A 1OXVA 4OGQC 2R93A 3GTLA 3CF5A 1ILPA 3S16H 1U4LA 1YNND 3A5UA 2DGYA 2R92A 4K8JA 2R3ZA 4K14A 4HSPA 4X66L 4DV6H 3WO1A 3KLSA 4YAJB 5FKAC 4Y52H 4DV4L 5EWFA 1B7YB 4QUCA 3RB6A 1CQVA 5CV6A 4A4IA 1E4FT 4EQNA 4C2MH 1EY7A 4MNOA 2HDLA 2QKIC 5LOVF 3PR5B 3H0GG 3W1BA 1XTCD 3T53B 2AU0A 4OO1H 2NN6I 3TEHB 2YRWA 2C2RA 2EXDA 5C4ZA 2ATWA 1X56A 5IT9W 4H44C 1JORA 2IPKD 3MWMA 4PZ7A 5GROA 3G48A 1GO3E 5KFTA 4HN7A 4ZK9B 4DR2L 2ZXOA 1U4MA 4DV5Q 5M3FB 5D1PA 2J6SA 5EKLA 2BQ3A 3Q1KA 1N34H 1TIID 3TP7A 4R4TA 3SK5A 4GNXA 1SDFA 3NWSA 4RWSC 5EGTA 5IIFA 1I94H 1E1TA 2RCNA 4HEDA 1HTLD 3E9IA 4APVA 2UXCL 1CUKA 5FD5A 4LF5L 4DNRB 1MD2D 3BJYA 4JW0A 3V05A 3A54A 4GLXA 1EYAA 3TZUA 4YCWA 3VR2A 5LMUQ 3I4NB 5KFHA 4EFBA 1IKLA 3BDCA 1L1OA 5HGTA 5ELOA 5JJLA 2A68D 4L8JA 1CA6A 3VYTA 5C44G 1F2YA 1I6HB 5H1SE 3I4NG 5DLQE 1J8IA 1B04A 5I2YA 4L5RC 4EEQA 5DQIA 4ECUA 1PRTB 1BCPD 2GPSA 2I87A 5EWEA 1NJIC 5J2TF 2CVRA 2B63G 4X65L 1VAJA 2EYPA 5M3MB 4C2MA 4TV8F 4IRKA 5JOBA 3SHLA 3PN1A 1KQSA 1JDBB 5M5WB 5DG8A 1LM0A 4K6DA 2EYFA 1N36Q 1W96A 4LF7H 1NY4A 1W6JA 4TRDA 3S15H 2HVQA 5AJ3Q 3BYYB 2PZTA 4A3LH 4DR2H 2R7KA 1WCMG 1PZID 2LS01 4A3GG 4J9QA 4A3EG 2FB9A 2OQ0A 3PGZA 4AQYL 3VYRA 1O7ZA 5C0XJ 2Z0SA 2MO0A 2ES2A 3HZXA 1VQ4A 1K83B 4DR5Q 4DFAA 3RZDH 3DM1A 2ZJPA 3A8JE 5KYLA 1W3SA 4H0LC 1EQRA 2FKLA 1PX2A 3E0JA 1L0WA 2V9WA 4CHTB 1V4YA 1VQ6A 5C4HA 1V1PB 1VQJA 1PH5A 3EN2A 2EE1A 4ZOLF 4F4XA 3KF8B 2VUMA 4GLAC 3TS0A 5A2QE 1Z2PX 3MR6A 2VNUD 1KRSA 1FL0A 4CKEA 3K5NA 3T13A 5DGBA 3F2CA 3NBHA 4PV1C 1DOMA 1UNSA 2K52A 1SLJA 5KNBA 2Q2TA 3OMCA 4X65H 1QUQA 4DUZH 2QILA 5J3BA 4IHJF 2JA8B 2FJ2A 2RBMA 2K05A 4JI4Q 1HZAA 4CBVA 1HFGA 2E2DC 4A93B 3KAJA 4AYBE 3RGZA 2CCZA 3DEPA 2R93H 1JLLB 1J5EH 4FS2A 2L0CA 2W6MA 1N32H 3TS2A 5FLMG 5BMVF 5KFFA 4RKLA 4AYBA 1SYXB 4RAZA 2WP8J 4PQXA 2ZTCA 3DUZA 1WVLA 2FPIB 1S0NA 1CS0A 2E2IA 4CC6A 1SYGA 1TS2A 1TS4A 3S2DH 4IUNA 5KFYA 3PW5A 1KIXA 2W70A 2QW7A 3LWEA 1CZWA 4ILWA 4DAYA 3MAQA 2E2HA 3W2DA 4WJWA 3HXLA 3OOCA 1Y8PB 3GTKA 1ML0D 1I7NA 5KT2A 4JI2H 3G6VA 3F2DA 4B3TH 3A7LA 1F2LA 1IL8A 3IAYA 1X3EA 3DM3A 3S1RH 2F03A 4JYAQ 2J0TD 1LTAD 4UAIA 1HNWH 2R7ZA 3GLKA 4A3EB 5EBDA 2NZHA 4O2BF 1H9SB 3KLWA 4JCVE 3ONAB 4KTAA 1QNUA 4DAPA 2EIFA 2WDTA 1AP0A 1UC9A 1SNDA 1S0OA 5JVDF 4EGQA 4NLGA 4DR4H 2R7NA 1IBMQ 2R7MA 5IGCA 1YI2A 4RUAA 2MO1A 4HJ9A 2ICIA 3BDLA 1EUDB 5FD6A 1HR0L 3GV8B 3HOUH 3QJYA 2YZMA 3EIVA 3OHBA 2HVRA 5LA6F 5H80A 3PO3B 3RTXA 4LF9Q 4PG3A 4IPGA 2NBFA 5LL6X 4RGTA 1R9TA 5TSSA 2NVYA 1BVSA 4DK3C 1KJJA 1B53A 5JPMC 2F0SA 1VQHA 1SBBB 3SDZA 5C44B 3URYA 2IX0A 2JA7B 3CQZH 4IPHA 5KFKA 4LF5Q 4I7HA 2UU9H 4RGNA 3GILA 4DL4A 2BOSA 2WTFA 3D6WA 4JV1A 2BA1A 3S1QH 2IMWP 4XQNA 5KFIA 1I3QA 1D5ZC 4O0AA 1HQRD 2F0DA 4FNFA 1C8CA 2F0GA 4O3RA 4B3MH 1VQGA 3K7AB 4IFDI 1MSHA 2EY1A 1Y1WH 3HKZB 3MEFA 5KRUA 4JI0L 3TRZA 5D14A 2Q8RE 4GOPB 4J9MA 1IBMH 4KKSA 3SR1A 2K01A 1DIKA 1OWTA 5L9XA 5C6AA 4FXDA 4JBKA 2VPQA 2PW5A 2HHHL 1MHWC 3AFQA 1PDQA 4OX9L 4DUYQ 1IW7C 4ZLTF 2R7LA 2EJMA 5KG4A 1B9NA 1HJPA 4EX5A 2B2YC 4JBJA 4ME6A 1IBKH 5JQWA 5L1IA 1II3A 2RF4A 1XMOQ 2UU9Q 3I4NH 1JB3A 1IHZA 1GSAA 1MI2A 4LF4Q 1K8AC 1XPOA 1RJTA 5A35A 4OL7A 1I50H 1J5EQ 4JI3Q 5IYCG 4G57A 4DV2L 1S5FD 4AYBG 4IOAA 4QL5A 5FJ8G 5IYDH 5FLXL 1Z2NX 5GAHC 3BA9A 5IT9L 3NHHA 1YJ9A 3G6YA 2O5IC 3K6OA 1JICA 1EQVA 1Q1EA 1SNPA 3STBD 2D9UA 2OTJA 2CW0D 1AH9A 2PQAB 3R2TA 5KX5F 4ZHQF 2K1BA 3KYHC 4NXMQ 3F1ZA 3TDQA 4NXNH 4YQWA 3EPGA 1EY8A 4BBRB 5LL6S 1UE5A 2JA5H 2FMMA 2E2HH 1EEFD 2A74C 1WCMH 4OXPA 4R8UA 4RHRA 3MXGA 1YVCA 5LP6F 3HOZH 1J6QA 4J0MA 1D7QA 2PPBC 4U7CA 3AMUA 3T4AC 2Y0SG 3KTMA 5DM73 1V1OA 3RMHA 2NYZD 5CC4A 2E2JB 1D1KA 2MHVA 3OPOA 4CDEC 4WJ4A 3N6XA 3R5HA 2XGPA 1M0WA 3K7UC 3Q24A 2XVSA 2Y0SE 1YHBA 5FO8B 1I4XA 4PZ8A 4GZYC 2HVSA 2ICEC 4YB8B 4RAUC 3R8BA 2UXBL 3J80i 5EJWA 3GTJA 1TR5A 5FO9B 1HNZH 1TY2A 3TP6A 3V4ZA 1SYFA 3HRZC 4K0KQ 2VZAA 1RJPA 5BN3A 4KY6A 2K5QA 1JX4A 4JI3H 3KF6B 2W9CA 1ESRA 2R6FA 1TWHB 4GKKH 3HKSA 4J9SA 3EQLC 2VY3A 5IT9E 4BXXH 1LV9A 4OEMB 1CQJB 3C0FB 5DG7A 3RB0A 1Z7TA 4RCOA 1A0IA 4BBSG 2N55A 1JT8A 1PH6A 2Z9HA 5EAYA 4FXGC 2QYZA 1L0XB 1RD9D 4B3RL 1VQKA 2VUMG 3HOVB 5A2QW 2JEGA 1B9MA 4TSSA 2PI2E 2N78A 3G71A 5C0XI 4LFCL 2RHQB 3KHGA 3BZDB 1JOOA 1WTXA 1XNQL 4O3QA 5C3WA 3N40P 3OW2A 4OX9Q 4WRDA 2IW3A 3CPFA 4K6LA 2O5JC 5FJ8H 5IYDG 4LFBQ 2I80A 5T14A 4NB3A 2FMAA 4IUVA 2QCPX 3PUWA 1VCIA 4IFDG 3CD6A 4C5AA 1ZQ7A 4DK6C 1KRTA 2NUCA 3L9AX 4DV3Q 1XNRQ 3DWAA 1TWAH 3EA6A 2KHIA 4XQQA 1PHJA 2JA6B 2EJFC 1E22A 4F87A 1JE5A 2PZWA 2F0WA 1TWCB 3CU7A 1N33Q 3I4OA 4C3JB 3ITPA 1SEIA 1Q8IA 2X69A 5M3FG 2CWPA 1KJ8A 2Q8IB 3H20A 4HCEA 4K0KH 3J7YW 1JC7A 2MPMA 3KXYT 1PFMA 2Q2UA 2ATLA 1DV2A 5ISRA 2FP4B 3X3MA 1J5EL 5KT6A 3GTGB 4QJFA 1I50A 1HFNA 4ZKCB 1WOCA 3H09A 1R4PB 1BDOA 4O3SA 1Q90A 1PVOA 3T1HQ 2AQ1B 5CGKA 2PN1A 4MTDA 3RAQA 1L1OB 3PMFA 3H0GB 4ZCKA 3C2PA 4MA0A 1B44D 2GVAA 3NQIA 1K8OA 3CQZA 4JI1H 3CP0A 3B6YA 5BR8Q 1XMQH 4IN3A 4AYBB 2RGRA 3C3LA 1EU3A 3T51B 1Q46A 4X66Q 1HUMA 5BPFA 4DL6A 1EIYB 1I7LA 4JC0A 4HJ5A 1EY6A 5GADC 5HBRB 2A6EC 4R4QA 2KCNA 4JV0A 5HY6A 2KJXA 4U673 4BY7G 3UI2A 2R82A 4PZ6A 3OWFA 4HJ7A 3S24A 1SMYC 4DAMA 2W8KA 2UU9L 5JAVA 1KHIA 3KHHA 1KDBA 5DQGA 1Y69U 1FYCA 2CFMA 4RGMA 2FLNA 3QWNA 2V4RA 2XIGA 1SMYD 3JZIA 2WKDA 1D6EC 1PZJD 2OXPA 4RH6A 2EJGC 4WORA 1JKJB 4C3JG 3CCRA 5KG2A 2JN4A 2LMCB 3OTOQ 3JC66 2L55A 4RAYA 4WFN3 4RNMA 5CV7A 3D8GA 3G8CA 2UUAQ 3N43B 3LX0A 1FJGQ 4LFAH 1G2SA 1F2MA 2ZM6H 4KKTA 2NN6H 4YIJA 1VS0A 3JRXA 1T36A 4Q43A 1WTHA 2A5HA 4GKJL 4EBEA 1B1ZA 1IYJB 3VA7A 1DONA 1LYLA 3BAAA 5GAGC 4M9UA 2JA6H 1HZCA 3JSLA 1CKNB 2M2LA 1QE6A 4JI8L 2LKVA 1H9KA 1ENFA 3HOUG 4Q8FA 4OWXB 2C22A 3O13A 1D1IA 3QIAA 4YY3L 2RSNA 2IY5B 3PW4A 2R8KA 2O2LD 1IBML 1ZHSA 2HJWA 2AQ2B 3MXNB 3LGJA 4UCUA 4YP3A 2BQRA 3I12A 2K5HA 2I5LX 4TKOB 3A0JA 3V2TA 4A3IH 4I65A 1C3OA 4DA2A 5C1PA 4UCOA 4DNTB 1ONLA 1X3PA 3JAMi 3GD7A 4OX9H 3I90A 1E1OA 3D3RA 1R9TH 1E4GT 3NPPA 5ELNA 1IYVA 1B4OA 5C0XG 1Y1VA 1A2UA 2K03A 2MUYA 2YU9B 1GVPA 1BR9A 2HIXA 3HOUB 3I91A 1O78A 3LWBA 4QWCA 3UQ8A 4ECTA 5CB4F 1BJTA 2XWBB 1E24A 4LF6L 1RHPA 1D2BA 4I7AA 3CCVA 2HQLA 1I3QH 3Q8DA 4BA1I 5KT5A 4A3CH 3S1NH 1ZYRC 1LTBD 4AQYQ 3S2HH 1N32Q 2RSOA 4IURA 1GUSA 4RGOS 5T1IA 3PUYA 4DR6L 3N8DA 4JVZA 3PQIA 1UWVA 4GOPA 3M3YH 2ZM6L 3A74A 1V1PA 4KHVA 4G7ZC 1AUXA 5FLMH 2ASBA 1S03G 1VF5C 1AFPA 1B3QA 2WAQG 4GOPC 3NK9A 3T1YL 3DWPA 5D65A 2FPGB 4GNXB 3K5OA 2X6LA 2W6OA 3KAKA 5KFCA 2XIWA 5KG5A 3GTGH 4QWAA 2KECA 3FKIB 4B08A 1GKHA 2F4VL 4XX0B 5JPNC 3KBXA 4JI2Q 3SE0A 3WDNA 4RB3C 4B3TQ 1WJJA 2F0UA 2F0FA 1GD7A 3GV3A 4G7OC 1BNZA 3K3VA 4HNVA 4YY3Q 1PTOF 4KY5A 5EBCA 4A3FB 2ZJQA 4Q0YA 4ECQA 4PMCA 1WFQA 4ZKBB 2JE6I 1F77A 1MIUA 2EYMA 1G91A 5CV4A 5KFOA 2W9BA 1HTPA 2H5XA 2K7VA 2FE3A 5FPOA 4RNOA 1RCVD 2MJ8A 2IBKA 4LF7Q 1NMGA 2E2IB 4ZAIA 3FPUB 2J6UA 1LO5D 1JCKB 2A1AA 2BA0A 1SXTA 4KHZA 5CYUA 5JEAJ 4C2MB 3OTOL 1WTQA 2NVQH 3MXUA 1SE8A 3M9MB 3RB4A 4EBDA 5C5LA 3M7NA 4A3BB 5K36H 2JP1A 3G6JB 3ORQA 3Q8RB 2OWOA 3U4ZA 3U50C 1VQ8A 1CHPD 4A3DG 4KLKA 2F3VA 3I2ZA 4LFBL 4M8AA 3NTHA 4DV2Q 4ECRA 2FK3A 1HHVA 3KDFA 1RTOA 5EKIA 2K28A 4YHHL 3QOJA 1JOQA 1U5KA 2JYOA 2BCOA 2WAQB 4A3CG 4IO9A 1EWCA 2WB1G 4ZQIA 4Y7NB 1TT2A 4MA5A 4A3MH 3S1NB 4FP5D 3QZ7A 3HOWB 5C4JH 1VKZA 3D4RA 1DGSA 1IZ6A 2NZOA 2MQHA 2Z6BA 4DL5A 1JQYD 4IJHA 4M1UB 3Q8QB 3L2PA 4ECXA 1FR3A 4DV4Q 2EY6A 3C1EA 4A3EH 4JI1Q 4OIJA 2B2WA 4GLVB 2W8LA 3H6MA 4C3IG 5IWAH 1TWGB 2DLNA 3KALA 4LF8H 1H9JA 1KXLA 2DIKA 3J80L 2L1BA 1HUNA 2W57A 2OEOA 4LFAL 1SAPA 4JI0Q 4KN7C 4DV7H 4CC5A 2WE6A 2VQFQ 2VPSA 1QUQB 1C7YA 3ER0A 1CZGA 1EUJA 3CKIB 1I6UA 3PO3G 1CSPA 1G291 3NTIA 1RJQA 5IP7H 1W93A 2W6QA 3J81E 1UE6A 1OXSC 2YYAA 1E2WA 1M6VA 3CRKC 2WKCA 3OHXC 3RV3A 1BQQT 1VQ9A 3KLSX 5C44H 4OIKA 2VUGA 2B3GA 4Q0FA 1RK6A 2F0HA 2R7FA 3R3OA 1PRTC 2FINB 1F2ZA 1HNXQ 3I4MH 3ULPA 1KEEA 2XRSD 4R4CA 3HOWG 3K58A 4O4HF 2AWNA 4N8X1 3J7ZC 2C28A 2K33A 4DV0Q 4XYQA 5JVLA 2DPIA 5KG1A 2WB1B 1SFOB 4LFCQ 1TWAB 5I2XA 1LTLA 2R6GA 2EQSA 2K32A 2WINB 3DWQA 1A15A 2KCTA 2ZDQA 1GYFA 4GN5A 5C4XG 3K80C 1SNQA 2I8CA 5KFUA 5C1OA 1Q3LA 1S5CD 3AB9A 5IYBG 2VQFL 4FO2A 4GC7A 3JAMc 1T5XD 3E9HA 3GIMA 3NGDA 4CKCA 2EYJA 1KAAA 2W7OA 4O2AF 2PQEA 1Y8NB 4LF4L 1FGUA 1B6SA 4K0KL 5K5PA 1STAA 1WTOA 3RN5A 4DR5L 3TIIA 2EZVA 1BKBA 4F7XA 3MXPA 1N34L 4J9OA 3QOLA 4U6PA 5KG3A 3NENA 2UUCL 4QW9A 3NTKA 5T1GA 4KHPL 4J15A 1P8LA 1VQNA 4ZUJA 1LLRD 1STGA 2F0QA 3PO2G 5CV9A 1PXUA 3I3CA 4B3SQ 4EQPA 1SE3A 4K2KA 4QGUA 4IQZA 2W6PA 1Y1VH 3RJ0A 4ZRZA 1L2FA 2JA7H 2UUBL 2NB0A 5FOBB 4RG1A 1EU4A 1YNNC 2ZTEA 1F9QA 2M05A 4I55F 4KHPH 1DXMA 5IGDA 1LT4D 4HIMA 1CTMA 4HIDA 1H9RA 3T16A 1XYIA 1E0BA 1VQ7A 3V4SA 2FJZA 2FFKB 3NQTA 4A3LG 3K0XA 4FF2A 4F8MA 2IX1A 5NUCA 3HKZE 2Q2IA 2AQ4A 1EIGA 2DY8A 1ILQA 3I4MG 4MZ9A 1ASYA 1U4PA 2KCCA 3GIDA 3GIJA 4DL3A 4P71A 1KDAA 4MN3A 4AH6A 2E8GA 5CV8A 4YBZB 2R8HA 3EROA 5C4XH 2E5LH 4RA8A 2F0TA 4UCVA 4HQ6A 1YZ6A 1WSCA 3NEMA 1TQOA 3MR2A 4B3SH 3JSNA 4JV2A 1NR2A 3TINA 3H3VI 4LH6A 4GC6A 3TZDA 1I6VC 4A3IB 3KK7A 5M3MG 2NVXB 1E4EB 4DUYL 4L5SA 4JI5Q 2LXKA 3PUXA 1JDEA 4FS1A 2R8JA 4DR7Q 3I73A 1I50B 1Q12A 2KVMA 3J81i 3VPDA 5JJZA 2VB3X 2F52A 2PNRC 2W7PA 1RKNA 4H13C 1DOKA 1PK8A 4C3IH 3L4JA 1Y1VB 2OT2A 1TAEA 3NELA 2KBNA 1KLGD 1MJCA 1Z47A 2DJFC 4RNNA 4HJ8A 4JI6Q 3J7A5 1TU2B 5KFJA 1K9MC 1C30A 4UFZA 4YR3A 4JI7Q 1I4GA 2B2YA 5M9OA 3VDYA 2FPPB 4MV8A 3M9NB 3M4PA 1I94L 5JUMA 1R9TB 4WJ3M 5KFAA 2AGPA 1O7YA 5LHY1 1PLFA 1KLUD 1SSOA 5BPHA 4YJ3F 5LMNH 4DR7L 3OIQA 1B70B 1BXRA 1STHA 4O4IF 4ED1A 3BJUA 3J7AV 2X0SA 4EQOA 5CBEE 4YWLA 1MJEA 2JK8A 1AW7A 4EGVA 1PH7A 4LK1C 4DV4H 1EOVA 3BYTB 3M4QA 1A3VA 2N3SA 4E6IA 2Y0SA 2PYKA 5KFRA 4J9RA 5KKNB 4J9NA 5M5XB 4AQYH 5C4JB 2VQEL 5KT3A 3J81W 1JE4A 1BNCA 4DL2A 3N6RA 2FHTA 3A56A 5FLXc 3PW0A 3T5HA 3CAMA 4NXML 4C3HB 4DV3L 1V9PA 1HH2P 4BS9A 1XNRL 1EUCB 4QIWE 3Q0AA 4XTCS 4QY7A 1Q81C 2UUAL 4IOCA 2VQFH 5LL6b 1OTCA 4FYDA 3KFUA 1XJVA 3K5IA 4JI8Q 1M0TA 1S10A 3I4LA 4DUYH 3CCMA 4X3TA 1AE2A 3D6CA 2HT1A 3PO2H 1TWHA 3RAXA 5DQHA 4A93G 3MJFA 4LJZC 2RHSB 1GUWA 2G9DA 1JWMD 3ND8A 2Z6KA 1KAWA 4XT1B 1Q7YC 3SI8A 4OELB 1DV1A 4A3FG 4M7EA 3P20A 5IGEA 2QK4A 3CMEA 5J1ZA 4IUTA 1WD0A 2NVTH 2M9VA 4IZOA 1EIFA 5K2MA 4IRDA 4BWGB 2ZTDA 4QUFA 5KGUA 5JJKA 1GGOA 4IPCA 4AIMA 3MWDA 4DN4M 2DNEA 1LT6D 3BU2A 4X6AH 4YWKA 4A3KH 2NVXH 1PH3A 1TWAA 3L0OA 1TXYA 2Z4HA 4JI0H 2HGSA 4GKJH 5KNDA 2BQUA 2IP4A 1TWCH 2LSSA 1S3OA 1A2TA 3KBGA 4NXNL 1JOKA 1VQ5A 2KENA 3CXCA 1N33H 2ZM6Q 3Q22A 4DR1L 3MVVA 1MSGA 2KSWA 1A9XA 1CT1D 3KDFB 2UUCQ 3J80E 4UDUC 3EBEA 3OSNA 2F1MA 2FXQA 1EZ1A 2A6HC 3RB3A 2E5LQ 1PFSA 2JEBI 2Q2HA 2FK1A 1KNEA 3H4BA 2AGOA 3GTQA 3SVMA 1ENCA 5M5YH 3GIIA 3FP9A 1PTOB 2H1EA 5IGGA 3CCEA 5L1JA 4EVOA 3HOWH 2XWJB 1K1QA 2QA4A 4LAAA 3PIPA 1G6ZA 4R4OA 1MGSA 3PCOB 4LUVA 4C56C 5DG9A 3PF5A 1TWHH 1DCZA 5KFWA 1GXDC 4CJ2C 4LFCH 1HR0H 4J9KA 2D5DA 3ICEA 1HR0W 3NXWA 3RUZA 4TQSA 2B8FA 1A8VA 3GIKA 2H4OA 3HEJA 1X3FA 3BS1A 3ZJYC 4O3NA 2OQKA 1A62A 3CCLA 4NKLA 5K36G 3BVGA 1IOVA 2ALYB 2E74C 4A3KG 4GKKL 3L7ZC 1G2TA 3KHRA 1AEXA 4JI7H 2VQEQ 1VMCA 3H3VH 1TS3A 3HOYG 4IRCA 1TKWB 2YU9A 1V1QA 3F2UA 4DV5L 1YNJD 2EPBA 1NAPA 2B2UC 4GKJQ 1I6HH 1A6XA 2HIVA 3KOJA 1SNCA 4V190 5L1LA 3K81C 3PSIA 4KMUC 4IUQA 4X62Q 1B6RA 4X3UA 1DYQA 2J4XA 1YNJC 1JIHA 2XCAA 4ECZA 4EQ5A 2R7ZG 4DV1H 2BE5D 1PTOC 1DD2A 1VF7A 3P1HA 1GJXA 3T56B 4A3JG 4FF3A 4HCSA 1M8AA 2E2HB 3PF4A 1HR0Q 2WV6D 4IUUA 2Q8TA 4Q44A 1Q8KA 3NBIA 5EQ0A 1VQPA 2R7ZH 2SEBD 2NUAB 5J22A 5E4WC 5I47A 4RHSA 3G6XA 1AE3A 4HIOA 1OO9B 4A3DH 1IXRA 3UDGA 2XNAC 1EFWA 2KQ3A 2EY5A 1D8LA 4KD3A 1BCPC 3BQ1A 1C0AA 3A5ZB 3PO2B 3VR6A 1P16A 4O3OA 3K57A 3D0FA 2ZDHA 3M9BA 3PIP3 4QQBX 2AQ3B 1HA5A 4HSVA 1STYA 3NE5B 4X65Q 4GN3B 4YR2A 4DAVA 3TMEA 2UXDQ 1GUTA 4YCVA 3VR4A 2XSCA 1IW7D 3AFPA 3TSSA 5C0XH 1PRTF 1V43A 3S17H 2JA8H 2VQEH 2XN9C 4J9LA 4YJ2F 4DR1Q 4R7RA 1T9HA 2KCMA 4Y8VB 4X3SA 4IAJA 5DEHA 4P73A 4LF8Q 2UVVA 1L0YB 1S68A 1L1OC 1JWUD 4HR7B 4K5VA 1YJNA 3R5XA 4MV4A 4HTHA 3WOFA 2Z4IA 2HHHH 4X66H 2ZJTA 2JEJA 4DF7A 1HNZL 1SE4A 5M3FH 4G7HC 3S2DB 5DLFA 2AMCB 4JI5H 4DK1A 1NUCA 2JA6G 4MV6A 1BBXC 4EG0A 4IR9A 2K4KA 3HKZA 5ELCA 4E4TA 1MBYA 1G8ZD 2XRQD 3M4OH 2XCPA 3HOZB 3C1FA 4QW8A 2R8IA 5KFPA 4L6TB 4YR0A 3M85A 4IALA 5AJ3L 1QZHA 1SYCA 3E5SA 1K1SA 5CBAE 1KD1C 3FMAA 4UCTA 1TS5A 3TIGA 4JI1L 4IWYA 3T5LA 1KJ9A 2YTXA 4IUPA 4FBTA 3E3XA 1VQCA 4DL7A 1SJHD 1Z9FA 3M4IA 4LMQD 1KL9A 1S0MA 4C3JH 5HURA 4KI0A 1STBA 2QF7A 3CC2A 3UE1A 3HOVG 1SNMA 3FKIH 4DXFA 3CCQA 1XMQL 4WBNF 3MWYW 1LUZA 3A8KE 4Q8EA 5D1OB 2JXMB 4BBSB 2HDMA 5IODA 3EVQA 1WTPA 1BO0A 4ZQ3A 3R5FA 1H9SA 2SNSA 1YITA 4XZ3B 3H4DA 3M7GA 2ZXRA 2PBZA 1HPCA 2CQAA 5CORA 2R92B 1LACA 1KDCA 4L5QA 4A76A 5KG7A 4UCRA 3CRLC 3GTOB 3HOYB 3BQ2A 2CH4W 3OUZA 3GTMB 3KLRA 3H3VC 2B63H 2RA4A 5F2DA 1QNKA 3R93A 3KJPA 4A2AA 3PR4A 1K83A 2RCFA 1LT5D 3GTQB 1T3NA 1EHIA 1C48A 3WOEA 2J9GA 4RUCA 4ED0A 3IFDA 1FVIA 3UE0A 2F0IA 4Z9CB 4ZUIA 4EBCA 1BGWA 4DU9A 5C3XA 4UY8C 2EOTA 4R8NA 4R9WA 4F88A 3GIPA 2R87A 1YNXA 1YBYA 4O42A 3CCUA 4A3DB 2F0KA 3RGXA 1MKHA 2DJGC 1NTGA 2PMZE 3SGIA 4ED2A 2R7DA 4V0BA 2A19A 2CZGA 3DLLA 3RNUA 2I0QA 4A3BG 5D1OA 5LMNQ 5IWAQ 1D5XC 3FKIA 4O2DA 4R1JA 4U68A 5IE8A 3EYYA 1JB7A 4B3SL 4BBSH 5CAEB 3OTOH 3QR8A 4P74A 3V6JA 4DR1H 2EYHA 4NDXA 4TQUS 3W5OA 2KUMA 5E1FA 5KT7A 2F0EA 1SN8A 1JJGA 3LP8A 1X3GA 3W3AA 5I9OA 1PZKD 1UEBA 1M7JA 1M1KC 1N56A 1XMOL 1GSHA 5DAUA 3UDXA 2DUDA 1LABA 2DN8A 4K5XA 3HOVH 3N42B 1XX8A 2F0JA 2BR0A 4QWBA 2A73B 3BG5A 2B63A 4HR7A 4BXXG 5KFSA 1ZETA 2I5HA 4EGJA 5M5WH 1KTKA 2CWAA 4ED3A 2UVRA 4ID6A 1S72A 2VA2A 1SJED 1HXYD 5HGQA 3DMUA 4JOIA 1UAPA 5LMUL 3PUZA 1QILA 4KKUA 4HMIA 4RFBA 1GHKA 3S1RB 4RMFA 1PH8A 3PV0A 1STNA 1JMCA 1CM9A 3GO5A 3RF2A 5LYJF 5KFNA 2C2DA 3FDSA 5D3IB 1LTGD 1N34Q 2PZUA 3SEBA 4CDDC 5GONF 4C3HG 1N33L 3FKIG 3RZOH 1YHAA 2GA4B 2OLSA 2WIIB 1TY0A 1VQBA 4DV7L 1T94A 2YZNA 3M3YB 4DV2H 3GDEA 5EPKA 4CKBA 1QVFA 2FLLA 2A68C 4ULLA 2HUGA 5I9PA 4J1MA 4KN4C 4FM9A 1O7IA 2SDFA 1HNWQ 3T5KA 1VQAA 4LWCA 3HFZB 1W2BA 2RDJA 4L63B 5JVH3 4P72A 2BDNA 1TWFH 5C3EG 1N8RC 2CQOA 1I5FA 1HQMC 2MCTA 2YS6A 1YEZA 2ZXPA 4LF9L 1RJRA 5LXTF 4LF6H 2O4XA 4GNXC 4JV5L 2QGQA 5DNFA 2PW7A 3H0GA 3VA5A 2CKZB 2I46A 2IJ0A 2JA5G 3MFIA 3IFTA 2VS1A 3ND9A 3P75A 1BOSA 2K75A 2JEFA 3AU7A 2PMZB 1K3RA 1DZ1A 1J9OA 1IBLQ 2F3IA 3BZCA 4H02A 3W1GA 4MV3A 3CVZA 5COYA 2EYLA 3TQYA 4DLKA 1XPRA 4YHHH 1H9MA 3JAMW 2R84A 5I4DA 3BG3A 1BUVT 3UDIA 1VQFA 2PI2A 4TV9F 1ET6A 5IYCH 1UC8A 3RLOA 3JAML 4R8UB 4DV5H 2RKSA 2NVYB 5KFEA
chains in the Genus database with same CATH topology
3NEMA 1J6QA 1D7QA 4A3BH 3NBHB 4JI7L 3H3VI 2Y0SG 1A63A 2I5MX 3OYYA 4DR4L 2BH2A 5M3MG 4DUYL 4L5SA 4JI5Q 2LXKA 3PUXA 4WJ4A 2WB1E 2IHFA 3K7UC 4DR7Q 1Q12A 3J81i 2Y0SE 1XNRL 1YHBA 2NVYH 4PZ8A 2F52A 2HHHQ 4HJAA 2UXBL 4C3IH 3RLNA 3J80i 4LUOA 3J81c 3NELA 2KBNA 1MJCA 1Z47A 3F2BA 4HJ8A 3G4SA 4JI6Q 3J7A5 4NPSA 5IP7G 1K9MC 1WI5A 4JI7Q 1E3PA 1Q86C 4K0KQ 3VDYA 2VZAA 1EQQA 3M4PA 1PV4A 1I94L 4BY1G 4DUZL 2K5NA 2NN6G 2UXBQ 4WJ3M 3KF6B 2PNHA 1EYGA 1VQLA 3KF6A 3HKSA 3UDFA 5LMNW 1X54A 2F4VQ 4DR7L 1B70B 2VY3A 4BXXH 3BJUA 2XTIA 4IJLA 1QZGA 1TWGH 4YWLA 2JK8A 1MJEA 4BBSG 1A0IA 4BY1H 1PH7A 1EOVA 3M4QA 1PH6A 1JT8A 2N3SA 1HNXL 5EAYA 2JJQA 1PH1A 4B3RL 1VQKA 2VUMG 1X9NA 2IHEA 2VQEL 2PI2E 2N78A 3HOXH 1CKOA 1B8AA 5C0XI 3G71A 4LNQA 5FLXc 4LFCL 2RHQB 3CAMA 4JI3L 4NXML 4YWMA 1XNQL 3H15A 3CC7A 2E2JH 2OCEA 1XNQQ 4DV3L 1V9PA 1HH2P 2AKWB 4R4IA 4L5TA 4QIWE 3OW2A 4OX9Q 4XTCS 4JOIC 3CPFA 4QY7A 4UP8A 1Q81C 2UUAL 4IOCA 4A3MG 5FJ8H 5IYDG 4LFBQ 3TREA 1OTCA 3KFUA 2L15A 1XJVA 4NB3A 4JI8Q 3PUWA 3CCMA 1AE2A 1VCIA 2HT1A 3PO2H 3CD6A 2UUBQ 4JBMA 4IFDG 4A93G 1K83H 1G6PA 2RHSB 1K73C 4IFDJ 1IBKL 4DK6C 1KRTA 4DV3Q 1XNRQ 1TWAH 2KHIA 1K0RA 1KAWA 2Z6KA 1Q7YC 1PHJA 4JV5Q 4DV1Q 1E22A 3BZKA 3T1YQ 4A3FG 1JE5A 2JA7G 2YTYA 1N32L 1Y1VG 1Y1WG 2JQOA 4A93H 3CMEA 1N33Q 3I4OA 2NVTH 1EIFA 3PIOA 2ZTDA 3CPWA 4B3MQ 5JJKA 2B29A 5M3FG 4IPCA 4AIMA 1WYDA 2PQAA 2CWPA 2E2IH 4LF6Q 3GTLH 3BU2A 4DNIA 4YWKA 4X6AH 4A3KH 2NVXH 4DR4Q 2Q2UA 4JI6L 1PH3A 2QEXA 3CC4A 3L0OA 1N9WA 1TXYA 1J5EL 3RR5A 4QJFA 4A3FH 1TWCH 2LSSA 4UP7A 1WOCA 1S3OA 4NXNL 1VQ5A 2KENA 3T1HQ 2VL6A 3CXCA 2YTVA 4BA2I 1PVOA 2ZM6Q 4DR3Q 4JI2L 1IL2A 1L1OB 3CMAA 4DR1L 1XPUA 4X62L 3CW2C 4POFA 2GVAA 3KDFB 2UUCQ 3CP0A 3EBEA 3B6YA 5BR8Q 3J80c 2FXQA 1CKMA 4OWTB 4LF8L 3I56A 2E5LQ 1PFSA 1Q46A 2JEBI 2Q2HA 4X66Q 1K8GA 1EIYB 3AEVA 4JC0A 5M5YH 4HJ5A 3FP9A 2XGTA 3CCEA 1CSQA 1IBLL 5IP9H 3AYHB 3HOWH 3RN2A 2WFWA 5GADC 2D0OA 2AWOA 4A3IG 2QA4A 4OO1G 3E0EA 4R4QA 3U58A 5HY6A 4TVAB 3PIPA 4B3TL 4R4OA 3GTKH 4BY7G 4OONA 2UXCQ 3PCOB 4LUVA 3S1MH 4PZ6A 3PF5A 1TWHH 3ULJA 4HJ7A 3S24A 3ULLA 4PMWA 4DAMA 2R92H 4P75A 3ICEA 2UU9L 1HR0W 4HIKA 1KHIA 3GTQH 4DAYB 2CFMA 5IY0A 2JA9A 2VUMH 1A8VA 1BBUA 1E7ZA 1X3FA 1H95A 3ZJYC 5C3EH 2OQKA 1A62A 4YCUA 1YHQA 3CCLA 4IPDA 5K36G 1S40A 3CCRA 4B3ML 1JJCB 2ALYB 4GKKL 4A3KG 4MTNA 3L7ZC 3OTOQ 1OXVA 3JC66 4ME3A 3CF5A 3S16H 2D62A 3A5UA 2DGYA 2VQEQ 3H3VH 4A3JH 3HOYG 1FJGQ 4KHPQ 3HOZG 4BBRG 1Q1BA 1V1QA 1VS0A 2K5VA 4X66L 4DV5L 4Y52H 4DV4L 4A3GH 1B7YB 1U0LA 4GKJL 1IBKQ 2KHJA 1IYJB 1OXXK 4A4IA 1LYLA 2HIVA 3KOJA 5GAGC 2JA6H 4GKJQ 4C2MH 3K81C 4MNOA 3PSIA 1HZCA 4X62Q 4A75A 1CKNB 3H0GG 4JI8L 3W1BA 3HOUG 4OWXB 2IY5B 4YY3L 2NN6I 3TEHB 4EQ5A 3GTPH 2R7ZG 3U4VA 1IBML 2EXDA 2ATWA 3MXNB 1X56A 4BY7H 3LGJA 3HOVG 4A3JG 1N36L 2K5HA 2I5LX 3A0JA 4A3IH 3PF4A 1HR0Q 4PZ7A 5GROA 2MNAA 2OTLA 3G48A 1GO3E 1PYSB 3JAMi 1Q8KA 3GD7A 4DR2L 1VQPA 2R7ZH 4DV5Q 1E1OA 5GAEC 1R9TH 5LMNL 2YV5A 4R4TA 5ELNA 2VW9A 3CCSA 2C35B 4GNXA 1JJ2A 1AE3A 5C0XG 4HIOA 4A3DH 1E1TA 1IXRA 2RCNA 1GVPA 2HIXA 3UDGA 1BBWA 1EFWA 3E9IA 4APVA 2UXCL 1CUKA 4YHHQ 1D8LA 4LF5L 1C0AA 3A5ZB 1P16A 1E24A 4GS3A 4LF6L 3D0FA 3CCVA 4DUZQ 3M9BA 2HQLA 1I3QH 4QQBX 3Q8DA 4GLXA 3J81j 4BA1I 4A3CH 5M3MH 4YCWA 4GN3B 4X65Q 5LMUQ 3S1NH 1SROA 1L1OA 4AQYQ 3S2HH 5ELOA 1N32Q 1UE7A 4YCVA 2UXDQ 4JBWA 4DR6L 5JJLA 3PUYA 3HKZG 3AFPA 5C44G 5IYBH 1VQDA 2ID0A 5H1SE 2JA8H 1UWVA 4GOPA 3I4NG 2ZM6L 3A74A 5DLQE 4DR3L 3M3YH 1G51A 5M5XH 4DR1Q 4L5RC 1T9HA 4JG2A 5FLMH 2ASBA 2KCMA 1NJIC 2WAQG 1HNZQ 2B63G 4GOPC 4X65L 3T1YL 4GNXB 4P73A 4LF8Q 2JEAI 3S17H 3GTGH 1KQSA 4GN4B 1L1OC 4UPAA 1YJNA 4LFAQ 1GKHA 1VQIA 1LM0A 2F4VL 4XIGS 4JI2Q 1N36Q 1XTDA 2YYZA 1NY4A 4B3TQ 3S14H 1WJJA 1GD7A 1HNZL 5M3FH 1M90C 4YY3Q 3S15H 5AJ3Q 2AMCB 1OXUA 2ZJQA 4A3LH 2JA6G 1WFQA 1I94Q 1NMFA 2E5LL 2BH8A 2JE6I 2K4KA 1XMQQ 1MIUA 1WCMG 3H0GH 4A3GG 4A3EG 2H5XA 2OQ0A 3PGZA 4AQYL 3M4OH 2UXDL 5C0XJ 2Z0SA 2MO0A 2ES2A 1VQ4A 3M85A 2N8NA 4DR5Q 4LF7Q 5AJ3L 1NMGA 3RZDH 1QZHA 2ZJPA 2UUAQ 1W3SA 2A1AA 2BA0A 1KD1C 4KHZA 5JEAJ 1EQRA 3OTOL 4JI1L 1NBWA 3KJOA 2YTXA 1L0WA 2NVQH 1KC8C 1VQ6A 1SE8A 1VQCA 1NE3A 3AQQA 4JI5L 4LUZA 1Z9FA 1GM5A 1KL9A 1VQJA 4C3JH 3EN2A 4KI0A 1PH5A 3M7NA 2V1CC 3PUVA 3KF8B 4DR6Q 4GLAC 3TS0A 3CC2A 3U4ZA 1C9OA 1UE1A 3FKIH 3U50C 3UE1A 3CCQA 4DV6L 1XMQL 1VQ8A 1LUZA 2AHOB 3I55A 2VNUD 1KRSA 1X6OA 4A3DG 1FL0A 4KLKA 3F2CA 3I2ZA 4LFBL 1SR3A 4DV2Q 3ERSX 1OXTA 2K52A 1SLJA 3KDFA 4DV0L 1SFOH 1YITA 2Q2TA 1QUQA 4YHHL 5J3BA 1U5KA 5IWAL 4A3CG 3K7AH 1EWIA 2WB1G 4IO9A 4JI4Q 1HZAA 4A3MH 4L5QA 4A76A 1RIPA 1PYBA 4ALPA 4AYBE 1YIJA 1PH2A 2CCZA 4DR2Q 5C4JH 2R93H 1DGSA 1IZ6A 3CCJA 2NZOA 2MQHA 3TS2A 3GTJH 5FLMG 4IJHA 1I6HH 3L2PA 1SMXA 4DV4Q 2WP8J 2ZTCA 4A3EH 4JI1Q 2B63H 3KJPA 2K14A 3S2DH 2R93G 1KIXA 4GLVB 4LF7L 1PH4A 3PO3H 1KXLA 1FVIA 3UE0A 3D31A 1QVCA 4LFAL 4UY8C 4JI0Q 2K50A 3GTMH 2VQFQ 1QUQB 1YNXA 1YBYA 3F2DA 3CCUA 1C7YA 3ER0A 1EUJA 1MKHA 1NTGA 2PMZE 1X3EA 3SGIA 2R7DA 3PO3G 3DM3A 3S1RH 1CSPA 1G291 2A19A 4LW1A 5IP7H 3DLLA 3RNUA 2I0QA 2OWOA 4A3BG 5LMNQ 5IWAQ 1UE6A 1OXSC 4O2DA 4DV1L 4R1JA 2NZHA 5IE8A 2ZJRA 3KLWA 3GTOH 3F8TA 4JCVE 1JB7A 1VQ9A 4B3SL 2JA8G 3HOYH 4BBSH 5C44H 2B3GA 2EIFA 4P74A 2R7FA 4TQUS 3W5OA 1QVGA 3STBC 4POGA 1IBMQ 1HNXQ 3I4MH 3ULPA 1YI2A 4R4CA 3HOWG 1HZ9A 2MO1A 4HJ9A 2AWNA 2MFIA 1VQOA 1SN8A 3J7ZC 5IT9c 1JJGA 1HR0L 1X3GA 3HOUH 2LXJA 2GVBA 4DV0Q 2A8VA 5JJIA 1UEBA 2WAQE 4LFCQ 3FHWA 3EIVA 2GN5A 1M1KC 4DPGA 1LTLA 2R6GA 1XMOL 2EQSA 4LF9Q 4NXNQ 3UDXA 4PG3A 4IPGA 1YJWA 2DUDA 2KCTA 4GN5A 3HOVH 5C4XG 2Z6KC 1BVSA 3K80C 4DK3C 1Q82C 5IYBG 1VQHA 2VQFL 3JAMc 2IX0A 3E9HA 1SRUA 3I7FA 4BXXG 3CQZH 2I5HA 4IPHA 4LF5Q 5JEAG 5M5WH 2CWAA 1PH9A 1S72A 5IP9G 1RL2A 4DKAC 5HGQA 2BA1A 1VQMA 3S1QH 3G6EA 4JOIA 4LF4L 5GQOA 1FGUA 4X64Q 5LMUL 3PUZA 4O0AA 4K0KL 4RMFA 1ASZA 1PH8A 1VQGA 3PV0A 3RN5A 4DR5L 4IFDI 1JMCA 3GO5A 1Y1WH 1BKBA 3MEFA 4JI0L 4UP9A 1N34L 3TRZA 1N34Q 4GOPB 1HNWL 3NENA 2UUCL 2YU9H 1FJGL 4KHPL 4JBKA 1N33L 2R92G 3FKIG 4J15A 4X64L 1YHAA 1P8LA 3WWVA 3RZOH 4DV7Q 2HHHL 1VQNA 1HZBA 1VQBA 4DV7L 3PO2G 3AFQA 1PA6A 3GDEA 5E7NA 4OX9L 1QVFA 4DUYQ 4GKKQ 1O7IA 1HNWQ 4B3SQ 3K8AA 1HJPA 4QGUA 1VQAA 4LWCA 1Y1VH 1VQEA 3HFZB 4EX5A 1W2BA 2JA7H 1L2FA 4JBJA 2UUBL 4RG1A 4P72A 5C3EG 1TWFH 1N8RC 2ZTEA 2CQOA 1I5FA 4DV6Q 4JYAL 1YEZA 3HOXG 2RF4A 1XMOQ 2UU9Q 4LF9L 3I4NH 4LF4Q 1K8AC 4GNXC 1XPOA 4JV5L 1X55A 1Y14B 2QGQA 1I50H 4HIMA 1J5EQ 2CKZB 5IYCG 4HIDA 2JA5G 4JI3Q 1VQ7A 4DV2L 2VS1A 4FDBA 4AYBG 4BBRH 3K0XA 4QL5A 2K75A 4A3LG 2IX1A 5FJ8G 4IOAA 5IYDH 5GAHC 1K3RA 3HKZE 2Q2IA 1IBLQ 2F3IA 1CKNA 3BZCA 4Y7NH 4H02A 1YJ9A 3W1GA 2N49A 4B3RQ 4JI4L 4JYAQ 3RLFA 3TQYA 2D0PA 1XPRA 3I4MG 1Q1EA 4MZ9A 3STBD 5BR8L 1ASYA 2OTJA 4OO1I 4P71A 1AH9A 1X65A 2PQAB 3UDIA 4C3HH 4AH6A 4OWWB 2E8GA 3KYHC 4NXMQ 2PI2A 3F1ZA 1VQFA 2IT1A 3IRBA 5C4XH 3T1HL 1UE5A 5IYCH 2JA5H 3RLOA 2E2HH 1WCMH 4OXPA 1V43A 1YVCA 1YZ6A 3HOZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEM A;  1J6Q A;  1D7Q A;  4A3B H;  3NBH B;  4JI7 L;  3H3V I;  2Y0S G;  1A63 A;  2I5M X;  3OYY A;  4DR4 L;  2BH2 A;  5M3M G;  4DUY L;  4L5S A;  4JI5 Q;  2LXK A;  3PUX A;  4WJ4 A;  2WB1 E;  2IHF A;  3K7U C;  4DR7 Q;  1Q12 A;  3J81 i;  2Y0S E;  1XNR L;  1YHB A;  2NVY H;  4PZ8 A;  2F52 A;  2HHH Q;  4HJA A;  2UXB L;  4C3I H;  3RLN A;  3J80 i;  4LUO A;  3J81 c;  3NEL A;  2KBN A;  1MJC A;  1Z47 A;  3F2B A;  4HJ8 A;  3G4S A;  4JI6 Q;  3J7A 5;  4NPS A;  5IP7 G;  1K9M C;  1WI5 A;  4JI7 Q;  1E3P A;  1Q86 C;  4K0K Q;  3VDY A;  2VZA A;  1EQQ A;  3M4P A;  1PV4 A;  1I94 L;  4BY1 G;  4DUZ L;  2K5N A;  2NN6 G;  2UXB Q;  4WJ3 M;  3KF6 B;  2PNH A;  1EYG A;  1VQL A;  3KF6 A;  3HKS A;  3UDF A;  5LMN W;  1X54 A;  2F4V Q;  4DR7 L;  1B70 B;  2VY3 A;  4BXX H;  3BJU A;  2XTI A;  4IJL A;  1QZG A;  1TWG H;  4YWL A;  2JK8 A;  1MJE A;  4BBS G;  1A0I A;  4BY1 H;  1PH7 A;  1EOV A;  3M4Q A;  1PH6 A;  1JT8 A;  2N3S A;  1HNX L;  5EAY A;  2JJQ A;  1PH1 A;  4B3R L;  1VQK A;  2VUM G;  1X9N A;  2IHE A;  2VQE L;  2PI2 E;  2N78 A;  3HOX H;  1CKO A;  1B8A A;  5C0X I;  3G71 A;  4LNQ A;  5FLX c;  4LFC L;  2RHQ B;  3CAM A;  4JI3 L;  4NXM L;  4YWM A;  1XNQ L;  3H15 A;  3CC7 A;  2E2J H;  2OCE A;  1XNQ Q;  4DV3 L;  1V9P A;  1HH2 P;  2AKW B;  4R4I A;  4L5T A;  4QIW E;  3OW2 A;  4OX9 Q;  4XTC S;  4JOI C;  3CPF A;  4QY7 A;  4UP8 A;  1Q81 C;  2UUA L;  4IOC A;  4A3M G;  5FJ8 H;  5IYD G;  4LFB Q;  3TRE A;  1OTC A;  3KFU A;  2L15 A;  1XJV A;  4NB3 A;  4JI8 Q;  3PUW A;  3CCM A;  1AE2 A;  1VCI A;  2HT1 A;  3PO2 H;  3CD6 A;  2UUB Q;  4JBM A;  4IFD G;  4A93 G;  1K83 H;  1G6P A;  2RHS B;  1K73 C;  4IFD J;  1IBK L;  4DK6 C;  1KRT A;  4DV3 Q;  1XNR Q;  1TWA H;  2KHI A;  1K0R A;  1KAW A;  2Z6K A;  1Q7Y C;  1PHJ A;  4JV5 Q;  4DV1 Q;  1E22 A;  3BZK A;  3T1Y Q;  4A3F G;  1JE5 A;  2JA7 G;  2YTY A;  1N32 L;  1Y1V G;  1Y1W G;  2JQO A;  4A93 H;  3CME A;  1N33 Q;  3I4O A;  2NVT H;  1EIF A;  3PIO A;  2ZTD A;  3CPW A;  4B3M Q;  5JJK A;  2B29 A;  5M3F G;  4IPC A;  4AIM A;  1WYD A;  2PQA A;  2CWP A;  2E2I H;  4LF6 Q;  3GTL H;  3BU2 A;  4DNI A;  4YWK A;  4X6A H;  4A3K H;  2NVX H;  4DR4 Q;  2Q2U A;  4JI6 L;  1PH3 A;  2QEX A;  3CC4 A;  3L0O A;  1N9W A;  1TXY A;  1J5E L;  3RR5 A;  4QJF A;  4A3F H;  1TWC H;  2LSS A;  4UP7 A;  1WOC A;  1S3O A;  4NXN L;  1VQ5 A;  2KEN A;  3T1H Q;  2VL6 A;  3CXC A;  2YTV A;  4BA2 I;  1PVO A;  2ZM6 Q;  4DR3 Q;  4JI2 L;  1IL2 A;  1L1O B;  3CMA A;  4DR1 L;  1XPU A;  4X62 L;  3CW2 C;  4POF A;  2GVA A;  3KDF B;  2UUC Q;  3CP0 A;  3EBE A;  3B6Y A;  5BR8 Q;  3J80 c;  2FXQ A;  1CKM A;  4OWT B;  4LF8 L;  3I56 A;  2E5L Q;  1PFS A;  1Q46 A;  2JEB I;  2Q2H A;  4X66 Q;  1K8G A;  1EIY B;  3AEV A;  4JC0 A;  5M5Y H;  4HJ5 A;  3FP9 A;  2XGT A;  3CCE A;  1CSQ A;  1IBL L;  5IP9 H;  3AYH B;  3HOW H;  3RN2 A;  2WFW A;  5GAD C;  2D0O A;  2AWO A;  4A3I G;  2QA4 A;  4OO1 G;  3E0E A;  4R4Q A;  3U58 A;  5HY6 A;  4TVA B;  3PIP A;  4B3T L;  4R4O A;  3GTK H;  4BY7 G;  4OON A;  2UXC Q;  3PCO B;  4LUV A;  3S1M H;  4PZ6 A;  3PF5 A;  1TWH H;  3ULJ A;  4HJ7 A;  3S24 A;  3ULL A;  4PMW A;  4DAM A;  2R92 H;  4P75 A;  3ICE A;  2UU9 L;  1HR0 W;  4HIK A;  1KHI A;  3GTQ H;  4DAY B;  2CFM A;  5IY0 A;  2JA9 A;  2VUM H;  1A8V A;  1BBU A;  1E7Z A;  1X3F A;  1H95 A;  3ZJY C;  5C3E H;  2OQK A;  1A62 A;  4YCU A;  1YHQ A;  3CCL A;  4IPD A;  5K36 G;  1S40 A;  3CCR A;  4B3M L;  1JJC B;  2ALY B;  4GKK L;  4A3K G;  4MTN A;  3L7Z C;  3OTO Q;  1OXV A;  3JC6 6;  4ME3 A;  3CF5 A;  3S16 H;  2D62 A;  3A5U A;  2DGY A;  2VQE Q;  3H3V H;  4A3J H;  3HOY G;  1FJG Q;  4KHP Q;  3HOZ G;  4BBR G;  1Q1B A;  1V1Q A;  1VS0 A;  2K5V A;  4X66 L;  4DV5 L;  4Y52 H;  4DV4 L;  4A3G H;  1B7Y B;  1U0L A;  4GKJ L;  1IBK Q;  2KHJ A;  1IYJ B;  1OXX K;  4A4I A;  1LYL A;  2HIV A;  3KOJ A;  5GAG C;  2JA6 H;  4GKJ Q;  4C2M H;  3K81 C;  4MNO A;  3PSI A;  1HZC A;  4X62 Q;  4A75 A;  1CKN B;  3H0G G;  4JI8 L;  3W1B A;  3HOU G;  4OWX B;  2IY5 B;  4YY3 L;  2NN6 I;  3TEH B;  4EQ5 A;  3GTP H;  2R7Z G;  3U4V A;  1IBM L;  2EXD A;  2ATW A;  3MXN B;  1X56 A;  4BY7 H;  3LGJ A;  3HOV G;  4A3J G;  1N36 L;  2K5H A;  2I5L X;  3A0J A;  4A3I H;  3PF4 A;  1HR0 Q;  4PZ7 A;  5GRO A;  2MNA A;  2OTL A;  3G48 A;  1GO3 E;  1PYS B;  3JAM i;  1Q8K A;  3GD7 A;  4DR2 L;  1VQP A;  2R7Z H;  4DV5 Q;  1E1O A;  5GAE C;  1R9T H;  5LMN L;  2YV5 A;  4R4T A;  5ELN A;  2VW9 A;  3CCS A;  2C35 B;  4GNX A;  1JJ2 A;  1AE3 A;  5C0X G;  4HIO A;  4A3D H;  1E1T A;  1IXR A;  2RCN A;  1GVP A;  2HIX A;  3UDG A;  1BBW A;  1EFW A;  3E9I A;  4APV A;  2UXC L;  1CUK A;  4YHH Q;  1D8L A;  4LF5 L;  1C0A A;  3A5Z B;  1P16 A;  1E24 A;  4GS3 A;  4LF6 L;  3D0F A;  3CCV A;  4DUZ Q;  3M9B A;  2HQL A;  1I3Q H;  4QQB X;  3Q8D A;  4GLX A;  3J81 j;  4BA1 I;  4A3C H;  5M3M H;  4YCW A;  4GN3 B;  4X65 Q;  5LMU Q;  3S1N H;  1SRO A;  1L1O A;  4AQY Q;  3S2H H;  5ELO A;  1N32 Q;  1UE7 A;  4YCV A;  2UXD Q;  4JBW A;  4DR6 L;  5JJL A;  3PUY A;  3HKZ G;  3AFP A;  5C44 G;  5IYB H;  1VQD A;  2ID0 A;  5H1S E;  2JA8 H;  1UWV A;  4GOP A;  3I4N G;  2ZM6 L;  3A74 A;  5DLQ E;  4DR3 L;  3M3Y H;  1G51 A;  5M5X H;  4DR1 Q;  4L5R C;  1T9H A;  4JG2 A;  5FLM H;  2ASB A;  2KCM A;  1NJI C;  2WAQ G;  1HNZ Q;  2B63 G;  4GOP C;  4X65 L;  3T1Y L;  4GNX B;  4P73 A;  4LF8 Q;  2JEA I;  3S17 H;  3GTG H;  1KQS A;  4GN4 B;  1L1O C;  4UPA A;  1YJN A;  4LFA Q;  1GKH A;  1VQI A;  1LM0 A;  2F4V L;  4XIG S;  4JI2 Q;  1N36 Q;  1XTD A;  2YYZ A;  1NY4 A;  4B3T Q;  3S14 H;  1WJJ A;  1GD7 A;  1HNZ L;  5M3F H;  1M90 C;  4YY3 Q;  3S15 H;  5AJ3 Q;  2AMC B;  1OXU A;  2ZJQ A;  4A3L H;  2JA6 G;  1WFQ A;  1I94 Q;  1NMF A;  2E5L L;  2BH8 A;  2JE6 I;  2K4K A;  1XMQ Q;  1MIU A;  1WCM G;  3H0G H;  4A3G G;  4A3E G;  2H5X A;  2OQ0 A;  3PGZ A;  4AQY L;  3M4O H;  2UXD L;  5C0X J;  2Z0S A;  2MO0 A;  2ES2 A;  1VQ4 A;  3M85 A;  2N8N A;  4DR5 Q;  4LF7 Q;  5AJ3 L;  1NMG A;  3RZD H;  1QZH A;  2ZJP A;  2UUA Q;  1W3S A;  2A1A A;  2BA0 A;  1KD1 C;  4KHZ A;  5JEA J;  1EQR A;  3OTO L;  4JI1 L;  1NBW A;  3KJO A;  2YTX A;  1L0W A;  2NVQ H;  1KC8 C;  1VQ6 A;  1SE8 A;  1VQC A;  1NE3 A;  3AQQ A;  4JI5 L;  4LUZ A;  1Z9F A;  1GM5 A;  1KL9 A;  1VQJ A;  4C3J H;  3EN2 A;  4KI0 A;  1PH5 A;  3M7N A;  2V1C C;  3PUV A;  3KF8 B;  4DR6 Q;  4GLA C;  3TS0 A;  3CC2 A;  3U4Z A;  1C9O A;  1UE1 A;  3FKI H;  3U50 C;  3UE1 A;  3CCQ A;  4DV6 L;  1XMQ L;  1VQ8 A;  1LUZ A;  2AHO B;  3I55 A;  2VNU D;  1KRS A;  1X6O A;  4A3D G;  1FL0 A;  4KLK A;  3F2C A;  3I2Z A;  4LFB L;  1SR3 A;  4DV2 Q;  3ERS X;  1OXT A;  2K52 A;  1SLJ A;  3KDF A;  4DV0 L;  1SFO H;  1YIT A;  2Q2T A;  1QUQ A;  4YHH L;  5J3B A;  1U5K A;  5IWA L;  4A3C G;  3K7A H;  1EWI A;  2WB1 G;  4IO9 A;  4JI4 Q;  1HZA A;  4A3M H;  4L5Q A;  4A76 A;  1RIP A;  1PYB A;  4ALP A;  4AYB E;  1YIJ A;  1PH2 A;  2CCZ A;  4DR2 Q;  5C4J H;  2R93 H;  1DGS A;  1IZ6 A;  3CCJ A;  2NZO A;  2MQH A;  3TS2 A;  3GTJ H;  5FLM G;  4IJH A;  1I6H H;  3L2P A;  1SMX A;  4DV4 Q;  2WP8 J;  2ZTC A;  4A3E H;  4JI1 Q;  2B63 H;  3KJP A;  2K14 A;  3S2D H;  2R93 G;  1KIX A;  4GLV B;  4LF7 L;  1PH4 A;  3PO3 H;  1KXL A;  1FVI A;  3UE0 A;  3D31 A;  1QVC A;  4LFA L;  4UY8 C;  4JI0 Q;  2K50 A;  3GTM H;  2VQF Q;  1QUQ B;  1YNX A;  1YBY A;  3F2D A;  3CCU A;  1C7Y A;  3ER0 A;  1EUJ A;  1MKH A;  1NTG A;  2PMZ E;  1X3E A;  3SGI A;  2R7D A;  3PO3 G;  3DM3 A;  3S1R H;  1CSP A;  1G29 1;  2A19 A;  4LW1 A;  5IP7 H;  3DLL A;  3RNU A;  2I0Q A;  2OWO A;  4A3B G;  5LMN Q;  5IWA Q;  1UE6 A;  1OXS C;  4O2D A;  4DV1 L;  4R1J A;  2NZH A;  5IE8 A;  2ZJR A;  3KLW A;  3GTO H;  3F8T A;  4JCV E;  1JB7 A;  1VQ9 A;  4B3S L;  2JA8 G;  3HOY H;  4BBS H;  5C44 H;  2B3G A;  2EIF A;  4P74 A;  2R7F A;  4TQU S;  3W5O A;  1QVG A;  3STB C;  4POG A;  1IBM Q;  1HNX Q;  3I4M H;  3ULP A;  1YI2 A;  4R4C A;  3HOW G;  1HZ9 A;  2MO1 A;  4HJ9 A;  2AWN A;  2MFI A;  1VQO A;  1SN8 A;  3J7Z C;  5IT9 c;  1JJG A;  1HR0 L;  1X3G A;  3HOU H;  2LXJ A;  2GVB A;  4DV0 Q;  2A8V A;  5JJI A;  1UEB A;  2WAQ E;  4LFC Q;  3FHW A;  3EIV A;  2GN5 A;  1M1K C;  4DPG A;  1LTL A;  2R6G A;  1XMO L;  2EQS A;  4LF9 Q;  4NXN Q;  3UDX A;  4PG3 A;  4IPG A;  1YJW A;  2DUD A;  2KCT A;  4GN5 A;  3HOV H;  5C4X G;  2Z6K C;  1BVS A;  3K80 C;  4DK3 C;  1Q82 C;  5IYB G;  1VQH A;  2VQF L;  3JAM c;  2IX0 A;  3E9H A;  1SRU A;  3I7F A;  4BXX G;  3CQZ H;  2I5H A;  4IPH A;  4LF5 Q;  5JEA G;  5M5W H;  2CWA A;  1PH9 A;  1S72 A;  5IP9 G;  1RL2 A;  4DKA C;  5HGQ A;  2BA1 A;  1VQM A;  3S1Q H;  3G6E A;  4JOI A;  4LF4 L;  5GQO A;  1FGU A;  4X64 Q;  5LMU L;  3PUZ A;  4O0A A;  4K0K L;  4RMF A;  1ASZ A;  1PH8 A;  1VQG A;  3PV0 A;  3RN5 A;  4DR5 L;  4IFD I;  1JMC A;  3GO5 A;  1Y1W H;  1BKB A;  3MEF A;  4JI0 L;  4UP9 A;  1N34 L;  3TRZ A;  1N34 Q;  4GOP B;  1HNW L;  3NEN A;  2UUC L;  2YU9 H;  1FJG L;  4KHP L;  4JBK A;  1N33 L;  2R92 G;  3FKI G;  4J15 A;  4X64 L;  1YHA A;  1P8L A;  3WWV A;  3RZO H;  4DV7 Q;  2HHH L;  1VQN A;  1HZB A;  1VQB A;  4DV7 L;  3PO2 G;  3AFQ A;  1PA6 A;  3GDE A;  5E7N A;  4OX9 L;  1QVF A;  4DUY Q;  4GKK Q;  1O7I A;  1HNW Q;  4B3S Q;  3K8A A;  1HJP A;  4QGU A;  1VQA A;  4LWC A;  1Y1V H;  1VQE A;  3HFZ B;  4EX5 A;  1W2B A;  2JA7 H;  1L2F A;  4JBJ A;  2UUB L;  4RG1 A;  4P72 A;  5C3E G;  1TWF H;  1N8R C;  2ZTE A;  2CQO A;  1I5F A;  4DV6 Q;  4JYA L;  1YEZ A;  3HOX G;  2RF4 A;  1XMO Q;  2UU9 Q;  4LF9 L;  3I4N H;  4LF4 Q;  1K8A C;  4GNX C;  1XPO A;  4JV5 L;  1X55 A;  1Y14 B;  2QGQ A;  1I50 H;  4HIM A;  1J5E Q;  2CKZ B;  5IYC G;  4HID A;  2JA5 G;  4JI3 Q;  1VQ7 A;  4DV2 L;  2VS1 A;  4FDB A;  4AYB G;  4BBR H;  3K0X A;  4QL5 A;  2K75 A;  4A3L G;  2IX1 A;  5FJ8 G;  4IOA A;  5IYD H;  5GAH C;  1K3R A;  3HKZ E;  2Q2I A;  1IBL Q;  2F3I A;  1CKN A;  3BZC A;  4Y7N H;  4H02 A;  1YJ9 A;  3W1G A;  2N49 A;  4B3R Q;  4JI4 L;  4JYA Q;  3RLF A;  3TQY A;  2D0P A;  1XPR A;  3I4M G;  1Q1E A;  4MZ9 A;  3STB D;  5BR8 L;  1ASY A;  2OTJ A;  4OO1 I;  4P71 A;  1AH9 A;  1X65 A;  2PQA B;  3UDI A;  4C3H H;  4AH6 A;  4OWW B;  2E8G A;  3KYH C;  4NXM Q;  2PI2 A;  3F1Z A;  1VQF A;  2IT1 A;  3IRB A;  5C4X H;  3T1H L;  1UE5 A;  5IYC H;  2JA5 H;  3RLO A;  2E2H H;  1WCM H;  4OXP A;  1V43 A;  1YVC A;  1YZ6 A;  3HOZ H; 
#chains in the Genus database with same CATH topology
 3OMG A;  1UEA B;  3BAB A;  3OWE B;  4A3B H;  1XXG A;  4JI7 L;  1X3Q A;  1A63 A;  1SFO A;  3OYY A;  4DR4 L;  2BH2 A;  3M4O B;  2AUK A;  5JEA H;  3MA2 B;  3PIO 3;  2WB1 E;  3VPC A;  2IHF A;  4EEY A;  3D4W A;  5KG6 A;  3GTG A;  3V6K A;  2HHH Q;  4HJA A;  3DEO A;  1PFB A;  3PZP A;  3RLN A;  2EVB A;  4CJ1 B;  3J81 c;  3GIQ A;  2J6T A;  1EOT A;  5KFG A;  2L12 A;  3F2B A;  3UFX B;  2PO4 A;  2B2V C;  1D5M C;  5IP7 G;  1B50 A;  4F50 A;  1Q86 C;  1EQT A;  2GLT A;  2YS7 A;  2K5N A;  4KV6 A;  2UXB Q;  1B33 N;  2PNH A;  1VQL A;  2F0V A;  1CHQ D;  3KF6 A;  3R2I A;  1Z2O X;  2NU7 B;  2W9C B;  3Q6S A;  2MGS A;  5KFM A;  1X54 A;  2F4V Q;  5EZY F;  4S3S A;  1ET9 A;  3G7L A;  2V4Q A;  1S4Z A;  2V59 A;  4QIW A;  2DY7 A;  3S17 B;  1TWG H;  1KAB A;  4BY7 B;  4BY1 H;  3QG1 A;  1CQI B;  1ESF A;  3MFY A;  1HNX L;  1I4R A;  4WD3 A;  2XGQ A;  2B39 A;  5IGB A;  3CHB D;  1Y8O B;  1ROD A;  2ZT9 C;  3FEW X;  3KHL A;  2ASJ A;  2UXD H;  4LNQ A;  1CKO A;  4UHV A;  4JI3 L;  2J7Z A;  3NUC A;  1NNX A;  3CQZ B;  4YWM A;  2A69 D;  1NCV A;  2OCE A;  2E2J H;  4R4I A;  4L5T A;  4C1N K;  4JOI C;  4UP8 A;  4RU9 A;  2NVQ B;  4A3M G;  3K59 A;  3TRE A;  3LML A;  5KFV A;  5G3L F;  4XQJ A;  2RDH A;  3FPP A;  1ICF B;  2UUB Q;  3E6Z X;  4JBM A;  1ULZ A;  1K83 H;  3K0Y A;  4IFD J;  1K73 C;  4C5C A;  3RD4 A;  1EWH A;  2WB1 A;  1A3U A;  3MC0 B;  4MV7 A;  5FO7 B;  5BN4 A;  1EY9 A;  4JYA H;  2F0M A;  3I8Z A;  3T1Y Q;  3HOX B;  3QZ8 A;  1N32 L;  2F0N A;  2F4V H;  1Y1W G;  5CR3 A;  3BA8 A;  3GTP B;  3PIO A;  4RZR A;  2R8G A;  5ELB A;  5C4X B;  3RZD B;  4LF6 Q;  5ELE A;  4DR4 Q;  4JI6 L;  3VR5 A;  3FRP B;  2UXB H;  3PVX A;  3IG0 A;  5CMD A;  1N9W A;  2OH2 A;  2HQE A;  1N48 A;  2G5D A;  3E5N A;  4HMJ A;  4A3F H;  3GQB A;  4UP7 A;  4QCL A;  2L5T A;  4ZI7 F;  4BA2 I;  2F0O A;  2A6E D;  2VL6 A;  2DZD A;  1IL2 A;  4XDX A;  3S14 B;  1S5E D;  1EYD A;  1TA8 A;  4X62 L;  3CW2 C;  1LTS D;  3ETJ A;  3J7A K;  4POF A;  4ECY A;  5DM6 3;  4I50 F;  3BVZ A;  4O1N A;  3J80 c;  4FU0 A;  1CKM A;  3ETH A;  4OWT B;  4LF8 L;  2DPJ A;  4MTE A;  2NTS A;  1N36 H;  3OHA A;  1U9R A;  2P0A A;  2VQD A;  1CSQ A;  3GTO A;  1IBL L;  3A7A B;  3AYH B;  2B2T A;  5AFW A;  5IP9 H;  2WFW A;  3RN2 A;  2QDL A;  4I7Z C;  4A3I G;  4PWQ A;  3M4Y A;  1F9P A;  5KFQ A;  2JA5 A;  4ZYS A;  3E0E A;  3DXJ C;  4XYO A;  3GTM A;  1SE2 A;  5C3E B;  5LMU H;  4IR1 A;  4OON A;  4QIW B;  1UUP A;  4ECV A;  3ULJ A;  1X32 A;  5HV6 A;  2NWG A;  2B2V A;  2V5A A;  3ULL A;  1DM0 B;  1WTW A;  2R92 H;  4P75 A;  4QB4 A;  4HIK A;  4NW2 A;  1RYR A;  3BQ0 A;  3GTQ H;  4DAY B;  3J7A F;  2RGV A;  4A2B A;  2W9A A;  2AUJ D;  3DHQ A;  2WYO A;  5KYI A;  1V8Q A;  1YHQ A;  1H95 A;  1V51 A;  4YCU A;  5C8Y F;  5EWG A;  5KNC A;  4IPD A;  2R85 A;  1QCB D;  1S40 A;  4LMY A;  4YY3 H;  4ECS A;  4B3M L;  4ME5 A;  5KFB A;  2SCU B;  1VBH A;  1Y1W A;  4ME3 A;  1I3Q B;  1EY4 A;  3OW7 A;  1O75 A;  3RZO B;  1PRT D;  2D62 A;  3N52 A;  3QFF A;  4A3J H;  1XDN A;  3VYU A;  2K5D A;  4KHP Q;  3HOZ G;  1ICW A;  4BBR G;  4DR3 H;  1Q1B A;  2K5V A;  1WD1 A;  2XCL A;  2MP1 A;  4A3G H;  3L4K A;  1Z6H A;  1U0L A;  1IBK Q;  1GHJ A;  2KHJ A;  4XYL B;  1OXX K;  1KC7 A;  5BN5 A;  3J81 L;  4JV5 H;  4A75 A;  2PVP A;  4UCS A;  2E76 C;  1F9S A;  3GTP H;  3U4V A;  2K5W A;  2NZ1 D;  4LSA A;  1FNW A;  1QB5 D;  3WNZ A;  1TWG A;  4BY7 H;  1ZXT A;  3MXN A;  1N36 L;  2M00 A;  1EY0 A;  1M4V A;  1VBG A;  2MNA A;  2OTL A;  2P5Z X;  1PYS B;  4G4K A;  4I4T F;  3L3O C;  2BDO A;  3Q2O A;  2WAC A;  4X62 H;  5GAE C;  5LMN L;  1B2T A;  2YV5 A;  4CGY B;  1AZQ A;  1TVX A;  2QDB A;  4K8I A;  2VW9 A;  2C35 B;  3CCS A;  1JJ2 A;  5IOC A;  5FLX W;  1JWS D;  4X3K A;  3OSP A;  2CW8 A;  2JA7 A;  2UUB H;  3RIZ A;  1BBW A;  2NVX A;  1IOW A;  3HG9 A;  4YHH Q;  2V4D A;  2R93 B;  4DR7 H;  4GS3 A;  4DUZ Q;  4J6H A;  3K5H A;  2OF1 A;  3J81 j;  1RDP D;  1KBL A;  4ETS A;  3M9O B;  2NU8 B;  5M3M H;  4PMB A;  3V6H A;  3IKJ A;  1WTV A;  1SRO A;  3H40 A;  1UE7 A;  4JBW A;  1WCM A;  3HKZ G;  1ZHQ A;  5DGA A;  2Z1C A;  1LTT D;  1DJR D;  1GUG A;  1FNV A;  1VQD A;  2ID0 A;  5IYB H;  1G6P A;  4DR3 L;  4FF1 A;  2VR1 A;  1G51 A;  2HD3 A;  2A69 C;  4N8F A;  5M5X H;  3EFX D;  4A3G B;  1AUV A;  2YW2 A;  4Q45 A;  4JG2 A;  3SK4 A;  2K04 A;  1HNZ Q;  3S15 B;  5KFL A;  1U4R A;  2JEA I;  4EFE A;  3H91 A;  4GN4 B;  4N9P A;  4UPA A;  1S5B D;  1GOZ A;  4LFA Q;  1S5D D;  1VQI A;  3NP8 A;  4MV1 A;  3U9O A;  3I70 A;  4XIG S;  2QEJ C;  4B9X A;  1LTI D;  1XTD A;  2YYZ A;  3S14 H;  5JVG 3;  2G9H D;  5KG0 A;  1M90 C;  1SYE A;  1WH2 A;  1OXU A;  3HP3 A;  1I94 Q;  1NMF A;  3QO2 A;  2E5L L;  2BH8 A;  4EYH B;  1XMQ Q;  1FGB D;  1ZEQ X;  3H0G H;  3SK8 A;  1ENA A;  2UXD L;  3VR3 A;  2N8N A;  3WO0 A;  1TWF B;  3VPB A;  2JSO A;  4ED8 A;  1WTR A;  4DV0 H;  2YL2 A;  2K6A A;  1R4Q B;  3MTS A;  2C2E A;  1NBW A;  3EJI A;  3KJO A;  2JA5 B;  1HA6 A;  1NR4 A;  2LFN A;  2TSS A;  3MFG A;  2F0L A;  1KJI A;  1QJO A;  4JK1 C;  1KC8 C;  3AQQ A;  2IL8 A;  1NE3 A;  4RCN A;  2BE5 C;  4JI5 L;  3FDT A;  4LUZ A;  5A2Q L;  1GM5 A;  3MFH A;  4HYK A;  1EZ6 A;  1HRJ A;  2L11 A;  3F8N A;  1CQF A;  2V1C C;  3PUV A;  4DR6 Q;  3FVQ A;  5C5J A;  1C9O A;  1UE1 A;  4DV6 L;  4RB0 A;  1IBL H;  3HS0 C;  2EDG A;  2AHO B;  3I55 A;  1O7L A;  3RV4 A;  1TWC A;  1X6O A;  5E4X A;  3S9W A;  4DV3 H;  1XNR H;  3P7J A;  3K5M A;  1SR3 A;  1MZB A;  4KJO A;  5L37 A;  2R86 A;  3ERS X;  1OXT A;  1I4Q A;  1CA5 A;  4DV0 L;  1SFO H;  5ELD A;  2CH4 A;  2F0P A;  5FK9 C;  3GV5 B;  5IWA L;  1PYW D;  4RKB A;  3K7A H;  4ED7 A;  1EWI A;  5G3L D;  1GUO A;  1KJQ A;  4N9T A;  5JH7 F;  2C00 A;  3I4M B;  1AN8 A;  1RIP A;  2VOB A;  1PYB A;  4ALP A;  1YIJ A;  1PH2 A;  3SK6 A;  4DR2 Q;  1GUN A;  4MHE A;  3CCJ A;  4P2C B;  1XMO H;  4TQR A;  3GTJ H;  3H94 A;  4LF4 H;  1QOH A;  3GV7 B;  4JPB W;  5D3D A;  1EEI D;  1SMX A;  1FKA H;  2NU6 B;  4QWD A;  1KNA A;  1PTO H;  2UVU A;  4DR5 H;  5F9L A;  2K14 A;  1LTR D;  2R93 G;  2AGQ A;  3MHB A;  4LF7 L;  1PH4 A;  3PO3 H;  3D31 A;  1QVC A;  5CV5 A;  2CW7 A;  4X64 H;  1JR0 D;  2XC9 A;  4EYI B;  4JI8 H;  2CQY A;  2K50 A;  3GTM H;  1A3T A;  4ECW A;  4DGZ A;  1EYZ A;  4RB1 A;  3MZ5 A;  4LW1 A;  1K28 A;  3QB3 A;  4LH7 A;  3S1Q B;  4MTK A;  4DV1 L;  2SNM A;  5KFZ A;  2ZJR A;  3GTO H;  3F8T A;  4J8Q A;  3HOY H;  2JA8 G;  3BDO A;  4LF9 H;  2PMZ A;  2SOB A;  1AZP A;  1K3B C;  4F4Z A;  3MR3 A;  3ERQ A;  3HGB A;  5FPR A;  1QVG A;  3STB C;  4JUZ A;  4POG A;  2N88 A;  1RTN A;  3ORR A;  1SEB D;  1EFI D;  1HZ9 A;  1VQO A;  3TBI B;  2O03 A;  2MFI A;  5IT9 c;  3TN2 A;  4F4Y A;  1WCM B;  2LXJ A;  2GVB A;  2TMP A;  2A8V A;  5JJI A;  3R23 A;  4IWX A;  2UUA H;  2WAQ E;  1L2Z A;  3FHW A;  3LWU A;  2GN5 A;  3MEH A;  2IWH A;  4DPG A;  3N44 B;  4F4W A;  3TP8 A;  1ZYR D;  1CI3 M;  4NXN Q;  4NXM H;  1K8M A;  1YJW A;  2F4I A;  2JEI A;  2C9O A;  2Z6K C;  4A3J B;  1Q82 C;  3GTP A;  3T1H H;  3TQT A;  2NTT A;  1W6K A;  4O3P A;  2R7Z B;  1SRU A;  3I7F A;  3GTK B;  1BCP F;  5JEA G;  2I07 B;  1PH9 A;  2VXW A;  1RF2 D;  5IP9 G;  1RL2 A;  2ENB A;  4DKA C;  3K5L A;  3T1Y H;  5BR8 H;  5I6Y A;  1VQM A;  3G6E A;  4L1K A;  3GQC A;  2W71 A;  3N41 B;  5GQO A;  1FD7 D;  4X64 Q;  5L1K A;  1E2V A;  2YCH A;  2D2C C;  1ASZ A;  4ODG A;  4FXK C;  4KY7 A;  4UP9 A;  3RUP A;  4B3R H;  3OSO A;  3KUP A;  1HNW L;  1DOL A;  1RYS A;  4MAM A;  3T5J A;  2YU9 H;  1FJG L;  3IN5 A;  2R92 G;  4X64 L;  3WWV A;  2YRX A;  2RVL A;  4DV7 Q;  2E75 C;  2HCC A;  1HZB A;  4MV9 A;  2ASL A;  1PA6 A;  3TQ1 A;  5E7N A;  2IA6 A;  2B63 B;  4A3K B;  4GKK Q;  3GP7 A;  3Q8S B;  3NSW A;  5D8D A;  3K8A A;  4OHJ A;  5C5M A;  4PDB A;  4O4L F;  1VQE A;  3J80 W;  2GPW A;  3GTL B;  3X3N A;  1CK1 A;  1ZKO A;  1Y1W B;  2EXZ A;  2FMC A;  4DV6 Q;  3SE7 A;  4C3I B;  4JYA L;  3HOX G;  4BWS C;  1FJG H;  1X55 A;  1Y14 B;  2XD4 A;  3A8I E;  1EL0 A;  3FMC A;  1BF4 A;  2FLP A;  4FDB A;  4BBR H;  4KK7 A;  2B8G A;  4YAK B;  4CDF C;  1QG7 A;  1CKN A;  1EIH A;  3EPI A;  4Y7N H;  2N49 A;  4B3R Q;  4JI4 L;  3VMM A;  3RLF A;  2W6Z A;  2D0P A;  3HB9 A;  5I6W A;  5BR8 L;  4OO1 I;  1X65 A;  1HNX H;  4C3H H;  4OWW B;  2Z8L A;  4XXE A;  1GLV A;  1T5E A;  2KA7 A;  2JA6 A;  2L4N A;  2IT1 A;  2KHS A;  3IRB A;  5IGF A;  4FF4 A;  1RK5 A;  4RZQ A;  3T1H L;  2Y0S B;  2KEE A;  2B2U A;  3IL8 A;  4MIU A;  3U9S A;  1XNQ H;  1SCU B;  1STE A;  4ABN A;  3NBH B;  3A55 A;  2I5M X;  4QMG A;  3DF7 A;  2RDF A;  5J2U F;  4KJN A;  2R61 A;  4IZ8 A;  1UNN C;  4K5W A;  5EPJ A;  1EYC A;  4HNT A;  1IKM A;  1WR2 A;  1EZ8 A;  4CDC C;  5J39 A;  2ALZ A;  4DR6 H;  2NVY H;  2X6G A;  2NVT B;  2UUC H;  4NMZ A;  1B3A A;  3PW7 A;  4LUO A;  4C5B A;  3S16 B;  4H7B A;  4R8I A;  3G4S A;  3K3P A;  1PTO D;  4NPS A;  4NP5 A;  1WI5 A;  4C1N I;  1E3P A;  2RQX A;  1EQQ A;  2VB2 X;  1PV4 A;  1IYU A;  4BY1 G;  4DUZ L;  2NN6 G;  1EYG A;  3SXH A;  2B2T C;  3UDF A;  5LMN W;  4J9P A;  4FVM A;  4TUY F;  4G3I A;  1E2Z A;  2XTI A;  4IJL A;  1F9R A;  4XT3 B;  1QZG A;  1HCZ A;  3OUU A;  5DLG A;  4K2L A;  3S1M B;  3S2H B;  2W6N A;  3KF8 A;  3Q8P B;  2JJQ A;  1PH1 A;  3HBL A;  1FNU A;  2EY2 A;  3PW2 A;  3OIP A;  1EY5 A;  2UVW A;  1X9N A;  2IHE A;  3HOX H;  1B8A A;  3V96 A;  4XYM B;  4QWE A;  1XWE A;  5KIX A;  3GTJ B;  4IFD H;  1C4Q A;  5EPL A;  2DNC A;  3H15 A;  3CC7 A;  1XNQ Q;  4CJ0 B;  2AKW B;  5EKK A;  5EOY A;  3MR5 A;  5M5Y B;  3ZYY X;  5IYZ F;  2L15 A;  2RDI A;  2ZDG A;  2IX3 A;  3MWE A;  2LY7 A;  1NSN S;  3D4D A;  2W9B B;  5CA1 F;  1LT3 D;  1PMR A;  3BVM A;  1IBK L;  2KOL A;  5EDW A;  1CFM A;  1K0R A;  4JV5 Q;  4DV1 Q;  4B9W A;  5KFD A;  3LNN A;  2VUM B;  3BZK A;  1JXL A;  2JA7 G;  1VDZ A;  2YTY A;  1Y1V G;  2UXC H;  3I72 A;  5FLX E;  2JQO A;  4KD4 A;  4A93 H;  1VMP A;  1S97 A;  1AN7 A;  4RB2 C;  3CPW A;  4B3M Q;  3Q23 A;  2B29 A;  4PNY A;  4HNU A;  1WYD A;  2PQA A;  3GTL H;  2E2I H;  4HAE A;  3TP5 A;  1K0S A;  4FBU A;  3JAM E;  4DNI A;  2A6H D;  2QEX A;  3CC4 A;  2PCF B;  1CE8 A;  3RFC A;  1S9F A;  4JI4 H;  3RR5 A;  5ELF A;  2WAQ A;  4LSX A;  3RBE A;  3C46 A;  1I4H A;  1PFN A;  2V58 A;  2YTV A;  4DR3 Q;  4JI2 L;  3CMA A;  3JRW A;  2KED A;  1XPU A;  2CW0 C;  2VA3 A;  2ASD A;  2RDG A;  2EYO A;  1GSO A;  2NU9 B;  3GV6 A;  3I56 A;  4LFB H;  1QWY A;  5KFX A;  5E3F A;  1BXT A;  4JI6 H;  1K8G A;  1BCP B;  3AEV A;  5F9N A;  2F3W A;  2XGT A;  2L9H A;  2D0O A;  2AWO A;  4OO1 G;  4A3M B;  4B3T L;  3U58 A;  4TVA B;  3GTK H;  4DXG A;  2UXC Q;  3S1M H;  4Q5V A;  5KT4 A;  2B2W C;  1SYD A;  4QF4 A;  4ED6 A;  2C5C A;  4PMW A;  4APM A;  1TWF A;  1SYB A;  1SNO A;  3NWT A;  2HCI A;  2YZG A;  5IY0 A;  3RBD A;  4LF5 H;  2FK2 A;  2JA9 A;  2VUM H;  3VYS A;  4BY1 B;  3U9T A;  5CA0 F;  2CHB D;  1BBU A;  1E7Z A;  5KEE A;  5C3E H;  2DWC A;  1I4P A;  4DK0 A;  1JJC B;  1E4E A;  4MTN A;  1O80 A;  1OXV A;  4OGQ C;  2R93 A;  3GTL A;  3CF5 A;  1ILP A;  3S16 H;  1U4L A;  1YNN D;  3A5U A;  2DGY A;  2R92 A;  4K8J A;  2R3Z A;  4K14 A;  4HSP A;  4X66 L;  4DV6 H;  3WO1 A;  3KLS A;  4YAJ B;  5FKA C;  4Y52 H;  4DV4 L;  5EWF A;  1B7Y B;  4QUC A;  3RB6 A;  1CQV A;  5CV6 A;  4A4I A;  1E4F T;  4EQN A;  4C2M H;  1EY7 A;  4MNO A;  2HDL A;  2QKI C;  5LOV F;  3PR5 B;  3H0G G;  3W1B A;  1XTC D;  3T53 B;  2AU0 A;  4OO1 H;  2NN6 I;  3TEH B;  2YRW A;  2C2R A;  2EXD A;  5C4Z A;  2ATW A;  1X56 A;  5IT9 W;  4H44 C;  1JOR A;  2IPK D;  3MWM A;  4PZ7 A;  5GRO A;  3G48 A;  1GO3 E;  5KFT A;  4HN7 A;  4ZK9 B;  4DR2 L;  2ZXO A;  1U4M A;  4DV5 Q;  5M3F B;  5D1P A;  2J6S A;  5EKL A;  2BQ3 A;  3Q1K A;  1N34 H;  1TII D;  3TP7 A;  4R4T A;  3SK5 A;  4GNX A;  1SDF A;  3NWS A;  4RWS C;  5EGT A;  5IIF A;  1I94 H;  1E1T A;  2RCN A;  4HED A;  1HTL D;  3E9I A;  4APV A;  2UXC L;  1CUK A;  5FD5 A;  4LF5 L;  4DNR B;  1MD2 D;  3BJY A;  4JW0 A;  3V05 A;  3A54 A;  4GLX A;  1EYA A;  3TZU A;  4YCW A;  3VR2 A;  5LMU Q;  3I4N B;  5KFH A;  4EFB A;  1IKL A;  3BDC A;  1L1O A;  5HGT A;  5ELO A;  5JJL A;  2A68 D;  4L8J A;  1CA6 A;  3VYT A;  5C44 G;  1F2Y A;  1I6H B;  5H1S E;  3I4N G;  5DLQ E;  1J8I A;  1B04 A;  5I2Y A;  4L5R C;  4EEQ A;  5DQI A;  4ECU A;  1PRT B;  1BCP D;  2GPS A;  2I87 A;  5EWE A;  1NJI C;  5J2T F;  2CVR A;  2B63 G;  4X65 L;  1VAJ A;  2EYP A;  5M3M B;  4C2M A;  4TV8 F;  4IRK A;  5JOB A;  3SHL A;  3PN1 A;  1KQS A;  1JDB B;  5M5W B;  5DG8 A;  1LM0 A;  4K6D A;  2EYF A;  1N36 Q;  1W96 A;  4LF7 H;  1NY4 A;  1W6J A;  4TRD A;  3S15 H;  2HVQ A;  5AJ3 Q;  3BYY B;  2PZT A;  4A3L H;  4DR2 H;  2R7K A;  1WCM G;  1PZI D;  2LS0 1;  4A3G G;  4J9Q A;  4A3E G;  2FB9 A;  2OQ0 A;  3PGZ A;  4AQY L;  3VYR A;  1O7Z A;  5C0X J;  2Z0S A;  2MO0 A;  2ES2 A;  3HZX A;  1VQ4 A;  1K83 B;  4DR5 Q;  4DFA A;  3RZD H;  3DM1 A;  2ZJP A;  3A8J E;  5KYL A;  1W3S A;  4H0L C;  1EQR A;  2FKL A;  1PX2 A;  3E0J A;  1L0W A;  2V9W A;  4CHT B;  1V4Y A;  1VQ6 A;  5C4H A;  1V1P B;  1VQJ A;  1PH5 A;  3EN2 A;  2EE1 A;  4ZOL F;  4F4X A;  3KF8 B;  2VUM A;  4GLA C;  3TS0 A;  5A2Q E;  1Z2P X;  3MR6 A;  2VNU D;  1KRS A;  1FL0 A;  4CKE A;  3K5N A;  3T13 A;  5DGB A;  3F2C A;  3NBH A;  4PV1 C;  1DOM A;  1UNS A;  2K52 A;  1SLJ A;  5KNB A;  2Q2T A;  3OMC A;  4X65 H;  1QUQ A;  4DUZ H;  2QIL A;  5J3B A;  4IHJ F;  2JA8 B;  2FJ2 A;  2RBM A;  2K05 A;  4JI4 Q;  1HZA A;  4CBV A;  1HFG A;  2E2D C;  4A93 B;  3KAJ A;  4AYB E;  3RGZ A;  2CCZ A;  3DEP A;  2R93 H;  1JLL B;  1J5E H;  4FS2 A;  2L0C A;  2W6M A;  1N32 H;  3TS2 A;  5FLM G;  5BMV F;  5KFF A;  4RKL A;  4AYB A;  1SYX B;  4RAZ A;  2WP8 J;  4PQX A;  2ZTC A;  3DUZ A;  1WVL A;  2FPI B;  1S0N A;  1CS0 A;  2E2I A;  4CC6 A;  1SYG A;  1TS2 A;  1TS4 A;  3S2D H;  4IUN A;  5KFY A;  3PW5 A;  1KIX A;  2W70 A;  2QW7 A;  3LWE A;  1CZW A;  4ILW A;  4DAY A;  3MAQ A;  2E2H A;  3W2D A;  4WJW A;  3HXL A;  3OOC A;  1Y8P B;  3GTK A;  1ML0 D;  1I7N A;  5KT2 A;  4JI2 H;  3G6V A;  3F2D A;  4B3T H;  3A7L A;  1F2L A;  1IL8 A;  3IAY A;  1X3E A;  3DM3 A;  3S1R H;  2F03 A;  4JYA Q;  2J0T D;  1LTA D;  4UAI A;  1HNW H;  2R7Z A;  3GLK A;  4A3E B;  5EBD A;  2NZH A;  4O2B F;  1H9S B;  3KLW A;  4JCV E;  3ONA B;  4KTA A;  1QNU A;  4DAP A;  2EIF A;  2WDT A;  1AP0 A;  1UC9 A;  1SND A;  1S0O A;  5JVD F;  4EGQ A;  4NLG A;  4DR4 H;  2R7N A;  1IBM Q;  2R7M A;  5IGC A;  1YI2 A;  4RUA A;  2MO1 A;  4HJ9 A;  2ICI A;  3BDL A;  1EUD B;  5FD6 A;  1HR0 L;  3GV8 B;  3HOU H;  3QJY A;  2YZM A;  3EIV A;  3OHB A;  2HVR A;  5LA6 F;  5H80 A;  3PO3 B;  3RTX A;  4LF9 Q;  4PG3 A;  4IPG A;  2NBF A;  5LL6 X;  4RGT A;  1R9T A;  5TSS A;  2NVY A;  1BVS A;  4DK3 C;  1KJJ A;  1B53 A;  5JPM C;  2F0S A;  1VQH A;  1SBB B;  3SDZ A;  5C44 B;  3URY A;  2IX0 A;  2JA7 B;  3CQZ H;  4IPH A;  5KFK A;  4LF5 Q;  4I7H A;  2UU9 H;  4RGN A;  3GIL A;  4DL4 A;  2BOS A;  2WTF A;  3D6W A;  4JV1 A;  2BA1 A;  3S1Q H;  2IMW P;  4XQN A;  5KFI A;  1I3Q A;  1D5Z C;  4O0A A;  1HQR D;  2F0D A;  4FNF A;  1C8C A;  2F0G A;  4O3R A;  4B3M H;  1VQG A;  3K7A B;  4IFD I;  1MSH A;  2EY1 A;  1Y1W H;  3HKZ B;  3MEF A;  5KRU A;  4JI0 L;  3TRZ A;  5D14 A;  2Q8R E;  4GOP B;  4J9M A;  1IBM H;  4KKS A;  3SR1 A;  2K01 A;  1DIK A;  1OWT A;  5L9X A;  5C6A A;  4FXD A;  4JBK A;  2VPQ A;  2PW5 A;  2HHH L;  1MHW C;  3AFQ A;  1PDQ A;  4OX9 L;  4DUY Q;  1IW7 C;  4ZLT F;  2R7L A;  2EJM A;  5KG4 A;  1B9N A;  1HJP A;  4EX5 A;  2B2Y C;  4JBJ A;  4ME6 A;  1IBK H;  5JQW A;  5L1I A;  1II3 A;  2RF4 A;  1XMO Q;  2UU9 Q;  3I4N H;  1JB3 A;  1IHZ A;  1GSA A;  1MI2 A;  4LF4 Q;  1K8A C;  1XPO A;  1RJT A;  5A35 A;  4OL7 A;  1I50 H;  1J5E Q;  4JI3 Q;  5IYC G;  4G57 A;  4DV2 L;  1S5F D;  4AYB G;  4IOA A;  4QL5 A;  5FJ8 G;  5IYD H;  5FLX L;  1Z2N X;  5GAH C;  3BA9 A;  5IT9 L;  3NHH A;  1YJ9 A;  3G6Y A;  2O5I C;  3K6O A;  1JIC A;  1EQV A;  1Q1E A;  1SNP A;  3STB D;  2D9U A;  2OTJ A;  2CW0 D;  1AH9 A;  2PQA B;  3R2T A;  5KX5 F;  4ZHQ F;  2K1B A;  3KYH C;  4NXM Q;  3F1Z A;  3TDQ A;  4NXN H;  4YQW A;  3EPG A;  1EY8 A;  4BBR B;  5LL6 S;  1UE5 A;  2JA5 H;  2FMM A;  2E2H H;  1EEF D;  2A74 C;  1WCM H;  4OXP A;  4R8U A;  4RHR A;  3MXG A;  1YVC A;  5LP6 F;  3HOZ H;  1J6Q A;  4J0M A;  1D7Q A;  2PPB C;  4U7C A;  3AMU A;  3T4A C;  2Y0S G;  3KTM A;  5DM7 3;  1V1O A;  3RMH A;  2NYZ D;  5CC4 A;  2E2J B;  1D1K A;  2MHV A;  3OPO A;  4CDE C;  4WJ4 A;  3N6X A;  3R5H A;  2XGP A;  1M0W A;  3K7U C;  3Q24 A;  2XVS A;  2Y0S E;  1YHB A;  5FO8 B;  1I4X A;  4PZ8 A;  4GZY C;  2HVS A;  2ICE C;  4YB8 B;  4RAU C;  3R8B A;  2UXB L;  3J80 i;  5EJW A;  3GTJ A;  1TR5 A;  5FO9 B;  1HNZ H;  1TY2 A;  3TP6 A;  3V4Z A;  1SYF A;  3HRZ C;  4K0K Q;  2VZA A;  1RJP A;  5BN3 A;  4KY6 A;  2K5Q A;  1JX4 A;  4JI3 H;  3KF6 B;  2W9C A;  1ESR A;  2R6F A;  1TWH B;  4GKK H;  3HKS A;  4J9S A;  3EQL C;  2VY3 A;  5IT9 E;  4BXX H;  1LV9 A;  4OEM B;  1CQJ B;  3C0F B;  5DG7 A;  3RB0 A;  1Z7T A;  4RCO A;  1A0I A;  4BBS G;  2N55 A;  1JT8 A;  1PH6 A;  2Z9H A;  5EAY A;  4FXG C;  2QYZ A;  1L0X B;  1RD9 D;  4B3R L;  1VQK A;  2VUM G;  3HOV B;  5A2Q W;  2JEG A;  1B9M A;  4TSS A;  2PI2 E;  2N78 A;  3G71 A;  5C0X I;  4LFC L;  2RHQ B;  3KHG A;  3BZD B;  1JOO A;  1WTX A;  1XNQ L;  4O3Q A;  5C3W A;  3N40 P;  3OW2 A;  4OX9 Q;  4WRD A;  2IW3 A;  3CPF A;  4K6L A;  2O5J C;  5FJ8 H;  5IYD G;  4LFB Q;  2I80 A;  5T14 A;  4NB3 A;  2FMA A;  4IUV A;  2QCP X;  3PUW A;  1VCI A;  4IFD G;  3CD6 A;  4C5A A;  1ZQ7 A;  4DK6 C;  1KRT A;  2NUC A;  3L9A X;  4DV3 Q;  1XNR Q;  3DWA A;  1TWA H;  3EA6 A;  2KHI A;  4XQQ A;  1PHJ A;  2JA6 B;  2EJF C;  1E22 A;  4F87 A;  1JE5 A;  2PZW A;  2F0W A;  1TWC B;  3CU7 A;  1N33 Q;  3I4O A;  4C3J B;  3ITP A;  1SEI A;  1Q8I A;  2X69 A;  5M3F G;  2CWP A;  1KJ8 A;  2Q8I B;  3H20 A;  4HCE A;  4K0K H;  3J7Y W;  1JC7 A;  2MPM A;  3KXY T;  1PFM A;  2Q2U A;  2ATL A;  1DV2 A;  5ISR A;  2FP4 B;  3X3M A;  1J5E L;  5KT6 A;  3GTG B;  4QJF A;  1I50 A;  1HFN A;  4ZKC B;  1WOC A;  3H09 A;  1R4P B;  1BDO A;  4O3S A;  1Q90 A;  1PVO A;  3T1H Q;  2AQ1 B;  5CGK A;  2PN1 A;  4MTD A;  3RAQ A;  1L1O B;  3PMF A;  3H0G B;  4ZCK A;  3C2P A;  4MA0 A;  1B44 D;  2GVA A;  3NQI A;  1K8O A;  3CQZ A;  4JI1 H;  3CP0 A;  3B6Y A;  5BR8 Q;  1XMQ H;  4IN3 A;  4AYB B;  2RGR A;  3C3L A;  1EU3 A;  3T51 B;  1Q46 A;  4X66 Q;  1HUM A;  5BPF A;  4DL6 A;  1EIY B;  1I7L A;  4JC0 A;  4HJ5 A;  1EY6 A;  5GAD C;  5HBR B;  2A6E C;  4R4Q A;  2KCN A;  4JV0 A;  5HY6 A;  2KJX A;  4U67 3;  4BY7 G;  3UI2 A;  2R82 A;  4PZ6 A;  3OWF A;  4HJ7 A;  3S24 A;  1SMY C;  4DAM A;  2W8K A;  2UU9 L;  5JAV A;  1KHI A;  3KHH A;  1KDB A;  5DQG A;  1Y69 U;  1FYC A;  2CFM A;  4RGM A;  2FLN A;  3QWN A;  2V4R A;  2XIG A;  1SMY D;  3JZI A;  2WKD A;  1D6E C;  1PZJ D;  2OXP A;  4RH6 A;  2EJG C;  4WOR A;  1JKJ B;  4C3J G;  3CCR A;  5KG2 A;  2JN4 A;  2LMC B;  3OTO Q;  3JC6 6;  2L55 A;  4RAY A;  4WFN 3;  4RNM A;  5CV7 A;  3D8G A;  3G8C A;  2UUA Q;  3N43 B;  3LX0 A;  1FJG Q;  4LFA H;  1G2S A;  1F2M A;  2ZM6 H;  4KKT A;  2NN6 H;  4YIJ A;  1VS0 A;  3JRX A;  1T36 A;  4Q43 A;  1WTH A;  2A5H A;  4GKJ L;  4EBE A;  1B1Z A;  1IYJ B;  3VA7 A;  1DON A;  1LYL A;  3BAA A;  5GAG C;  4M9U A;  2JA6 H;  1HZC A;  3JSL A;  1CKN B;  2M2L A;  1QE6 A;  4JI8 L;  2LKV A;  1H9K A;  1ENF A;  3HOU G;  4Q8F A;  4OWX B;  2C22 A;  3O13 A;  1D1I A;  3QIA A;  4YY3 L;  2RSN A;  2IY5 B;  3PW4 A;  2R8K A;  2O2L D;  1IBM L;  1ZHS A;  2HJW A;  2AQ2 B;  3MXN B;  3LGJ A;  4UCU A;  4YP3 A;  2BQR A;  3I12 A;  2K5H A;  2I5L X;  4TKO B;  3A0J A;  3V2T A;  4A3I H;  4I65 A;  1C3O A;  4DA2 A;  5C1P A;  4UCO A;  4DNT B;  1ONL A;  1X3P A;  3JAM i;  3GD7 A;  4OX9 H;  3I90 A;  1E1O A;  3D3R A;  1R9T H;  1E4G T;  3NPP A;  5ELN A;  1IYV A;  1B4O A;  5C0X G;  1Y1V A;  1A2U A;  2K03 A;  2MUY A;  2YU9 B;  1GVP A;  1BR9 A;  2HIX A;  3HOU B;  3I91 A;  1O78 A;  3LWB A;  4QWC A;  3UQ8 A;  4ECT A;  5CB4 F;  1BJT A;  2XWB B;  1E24 A;  4LF6 L;  1RHP A;  1D2B A;  4I7A A;  3CCV A;  2HQL A;  1I3Q H;  3Q8D A;  4BA1 I;  5KT5 A;  4A3C H;  3S1N H;  1ZYR C;  1LTB D;  4AQY Q;  3S2H H;  1N32 Q;  2RSO A;  4IUR A;  1GUS A;  4RGO S;  5T1I A;  3PUY A;  4DR6 L;  3N8D A;  4JVZ A;  3PQI A;  1UWV A;  4GOP A;  3M3Y H;  2ZM6 L;  3A74 A;  1V1P A;  4KHV A;  4G7Z C;  1AUX A;  5FLM H;  2ASB A;  1S03 G;  1VF5 C;  1AFP A;  1B3Q A;  2WAQ G;  4GOP C;  3NK9 A;  3T1Y L;  3DWP A;  5D65 A;  2FPG B;  4GNX B;  3K5O A;  2X6L A;  2W6O A;  3KAK A;  5KFC A;  2XIW A;  5KG5 A;  3GTG H;  4QWA A;  2KEC A;  3FKI B;  4B08 A;  1GKH A;  2F4V L;  4XX0 B;  5JPN C;  3KBX A;  4JI2 Q;  3SE0 A;  3WDN A;  4RB3 C;  4B3T Q;  1WJJ A;  2F0U A;  2F0F A;  1GD7 A;  3GV3 A;  4G7O C;  1BNZ A;  3K3V A;  4HNV A;  4YY3 Q;  1PTO F;  4KY5 A;  5EBC A;  4A3F B;  2ZJQ A;  4Q0Y A;  4ECQ A;  4PMC A;  1WFQ A;  4ZKB B;  2JE6 I;  1F77 A;  1MIU A;  2EYM A;  1G91 A;  5CV4 A;  5KFO A;  2W9B A;  1HTP A;  2H5X A;  2K7V A;  2FE3 A;  5FPO A;  4RNO A;  1RCV D;  2MJ8 A;  2IBK A;  4LF7 Q;  1NMG A;  2E2I B;  4ZAI A;  3FPU B;  2J6U A;  1LO5 D;  1JCK B;  2A1A A;  2BA0 A;  1SXT A;  4KHZ A;  5CYU A;  5JEA J;  4C2M B;  3OTO L;  1WTQ A;  2NVQ H;  3MXU A;  1SE8 A;  3M9M B;  3RB4 A;  4EBD A;  5C5L A;  3M7N A;  4A3B B;  5K36 H;  2JP1 A;  3G6J B;  3ORQ A;  3Q8R B;  2OWO A;  3U4Z A;  3U50 C;  1VQ8 A;  1CHP D;  4A3D G;  4KLK A;  2F3V A;  3I2Z A;  4LFB L;  4M8A A;  3NTH A;  4DV2 Q;  4ECR A;  2FK3 A;  1HHV A;  3KDF A;  1RTO A;  5EKI A;  2K28 A;  4YHH L;  3QOJ A;  1JOQ A;  1U5K A;  2JYO A;  2BCO A;  2WAQ B;  4A3C G;  4IO9 A;  1EWC A;  2WB1 G;  4ZQI A;  4Y7N B;  1TT2 A;  4MA5 A;  4A3M H;  3S1N B;  4FP5 D;  3QZ7 A;  3HOW B;  5C4J H;  1VKZ A;  3D4R A;  1DGS A;  1IZ6 A;  2NZO A;  2MQH A;  2Z6B A;  4DL5 A;  1JQY D;  4IJH A;  4M1U B;  3Q8Q B;  3L2P A;  4ECX A;  1FR3 A;  4DV4 Q;  2EY6 A;  3C1E A;  4A3E H;  4JI1 Q;  4OIJ A;  2B2W A;  4GLV B;  2W8L A;  3H6M A;  4C3I G;  5IWA H;  1TWG B;  2DLN A;  3KAL A;  4LF8 H;  1H9J A;  1KXL A;  2DIK A;  3J80 L;  2L1B A;  1HUN A;  2W57 A;  2OEO A;  4LFA L;  1SAP A;  4JI0 Q;  4KN7 C;  4DV7 H;  4CC5 A;  2WE6 A;  2VQF Q;  2VPS A;  1QUQ B;  1C7Y A;  3ER0 A;  1CZG A;  1EUJ A;  3CKI B;  1I6U A;  3PO3 G;  1CSP A;  1G29 1;  3NTI A;  1RJQ A;  5IP7 H;  1W93 A;  2W6Q A;  3J81 E;  1UE6 A;  1OXS C;  2YYA A;  1E2W A;  1M6V A;  3CRK C;  2WKC A;  3OHX C;  3RV3 A;  1BQQ T;  1VQ9 A;  3KLS X;  5C44 H;  4OIK A;  2VUG A;  2B3G A;  4Q0F A;  1RK6 A;  2F0H A;  2R7F A;  3R3O A;  1PRT C;  2FIN B;  1F2Z A;  1HNX Q;  3I4M H;  3ULP A;  1KEE A;  2XRS D;  4R4C A;  3HOW G;  3K58 A;  4O4H F;  2AWN A;  4N8X 1;  3J7Z C;  2C28 A;  2K33 A;  4DV0 Q;  4XYQ A;  5JVL A;  2DPI A;  5KG1 A;  2WB1 B;  1SFO B;  4LFC Q;  1TWA B;  5I2X A;  1LTL A;  2R6G A;  2EQS A;  2K32 A;  2WIN B;  3DWQ A;  1A15 A;  2KCT A;  2ZDQ A;  1GYF A;  4GN5 A;  5C4X G;  3K80 C;  1SNQ A;  2I8C A;  5KFU A;  5C1O A;  1Q3L A;  1S5C D;  3AB9 A;  5IYB G;  2VQF L;  4FO2 A;  4GC7 A;  3JAM c;  1T5X D;  3E9H A;  3GIM A;  3NGD A;  4CKC A;  2EYJ A;  1KAA A;  2W7O A;  4O2A F;  2PQE A;  1Y8N B;  4LF4 L;  1FGU A;  1B6S A;  4K0K L;  5K5P A;  1STA A;  1WTO A;  3RN5 A;  4DR5 L;  3TII A;  2EZV A;  1BKB A;  4F7X A;  3MXP A;  1N34 L;  4J9O A;  3QOL A;  4U6P A;  5KG3 A;  3NEN A;  2UUC L;  4QW9 A;  3NTK A;  5T1G A;  4KHP L;  4J15 A;  1P8L A;  1VQN A;  4ZUJ A;  1LLR D;  1STG A;  2F0Q A;  3PO2 G;  5CV9 A;  1PXU A;  3I3C A;  4B3S Q;  4EQP A;  1SE3 A;  4K2K A;  4QGU A;  4IQZ A;  2W6P A;  1Y1V H;  3RJ0 A;  4ZRZ A;  1L2F A;  2JA7 H;  2UUB L;  2NB0 A;  5FOB B;  4RG1 A;  1EU4 A;  1YNN C;  2ZTE A;  1F9Q A;  2M05 A;  4I55 F;  4KHP H;  1DXM A;  5IGD A;  1LT4 D;  4HIM A;  1CTM A;  4HID A;  1H9R A;  3T16 A;  1XYI A;  1E0B A;  1VQ7 A;  3V4S A;  2FJZ A;  2FFK B;  3NQT A;  4A3L G;  3K0X A;  4FF2 A;  4F8M A;  2IX1 A;  5NUC A;  3HKZ E;  2Q2I A;  2AQ4 A;  1EIG A;  2DY8 A;  1ILQ A;  3I4M G;  4MZ9 A;  1ASY A;  1U4P A;  2KCC A;  3GID A;  3GIJ A;  4DL3 A;  4P71 A;  1KDA A;  4MN3 A;  4AH6 A;  2E8G A;  5CV8 A;  4YBZ B;  2R8H A;  3ERO A;  5C4X H;  2E5L H;  4RA8 A;  2F0T A;  4UCV A;  4HQ6 A;  1YZ6 A;  1WSC A;  3NEM A;  1TQO A;  3MR2 A;  4B3S H;  3JSN A;  4JV2 A;  1NR2 A;  3TIN A;  3H3V I;  4LH6 A;  4GC6 A;  3TZD A;  1I6V C;  4A3I B;  3KK7 A;  5M3M G;  2NVX B;  1E4E B;  4DUY L;  4L5S A;  4JI5 Q;  2LXK A;  3PUX A;  1JDE A;  4FS1 A;  2R8J A;  4DR7 Q;  3I73 A;  1I50 B;  1Q12 A;  2KVM A;  3J81 i;  3VPD A;  5JJZ A;  2VB3 X;  2F52 A;  2PNR C;  2W7P A;  1RKN A;  4H13 C;  1DOK A;  1PK8 A;  4C3I H;  3L4J A;  1Y1V B;  2OT2 A;  1TAE A;  3NEL A;  2KBN A;  1KLG D;  1MJC A;  1Z47 A;  2DJF C;  4RNN A;  4HJ8 A;  4JI6 Q;  3J7A 5;  1TU2 B;  5KFJ A;  1K9M C;  1C30 A;  4UFZ A;  4YR3 A;  4JI7 Q;  1I4G A;  2B2Y A;  5M9O A;  3VDY A;  2FPP B;  4MV8 A;  3M9N B;  3M4P A;  1I94 L;  5JUM A;  1R9T B;  4WJ3 M;  5KFA A;  2AGP A;  1O7Y A;  5LHY 1;  1PLF A;  1KLU D;  1SSO A;  5BPH A;  4YJ3 F;  5LMN H;  4DR7 L;  3OIQ A;  1B70 B;  1BXR A;  1STH A;  4O4I F;  4ED1 A;  3BJU A;  3J7A V;  2X0S A;  4EQO A;  5CBE E;  4YWL A;  1MJE A;  2JK8 A;  1AW7 A;  4EGV A;  1PH7 A;  4LK1 C;  4DV4 H;  1EOV A;  3BYT B;  3M4Q A;  1A3V A;  2N3S A;  4E6I A;  2Y0S A;  2PYK A;  5KFR A;  4J9R A;  5KKN B;  4J9N A;  5M5X B;  4AQY H;  5C4J B;  2VQE L;  5KT3 A;  3J81 W;  1JE4 A;  1BNC A;  4DL2 A;  3N6R A;  2FHT A;  3A56 A;  5FLX c;  3PW0 A;  3T5H A;  3CAM A;  4NXM L;  4C3H B;  4DV3 L;  1V9P A;  1HH2 P;  4BS9 A;  1XNR L;  1EUC B;  4QIW E;  3Q0A A;  4XTC S;  4QY7 A;  1Q81 C;  2UUA L;  4IOC A;  2VQF H;  5LL6 b;  1OTC A;  4FYD A;  3KFU A;  1XJV A;  3K5I A;  4JI8 Q;  1M0T A;  1S10 A;  3I4L A;  4DUY H;  3CCM A;  4X3T A;  1AE2 A;  3D6C A;  2HT1 A;  3PO2 H;  1TWH A;  3RAX A;  5DQH A;  4A93 G;  3MJF A;  4LJZ C;  2RHS B;  1GUW A;  2G9D A;  1JWM D;  3ND8 A;  2Z6K A;  1KAW A;  4XT1 B;  1Q7Y C;  3SI8 A;  4OEL B;  1DV1 A;  4A3F G;  4M7E A;  3P20 A;  5IGE A;  2QK4 A;  3CME A;  5J1Z A;  4IUT A;  1WD0 A;  2NVT H;  2M9V A;  4IZO A;  1EIF A;  5K2M A;  4IRD A;  4BWG B;  2ZTD A;  4QUF A;  5KGU A;  5JJK A;  1GGO A;  4IPC A;  4AIM A;  3MWD A;  4DN4 M;  2DNE A;  1LT6 D;  3BU2 A;  4X6A H;  4YWK A;  4A3K H;  2NVX H;  1PH3 A;  1TWA A;  3L0O A;  1TXY A;  2Z4H A;  4JI0 H;  2HGS A;  4GKJ H;  5KND A;  2BQU A;  2IP4 A;  1TWC H;  2LSS A;  1S3O A;  1A2T A;  3KBG A;  4NXN L;  1JOK A;  1VQ5 A;  2KEN A;  3CXC A;  1N33 H;  2ZM6 Q;  3Q22 A;  4DR1 L;  3MVV A;  1MSG A;  2KSW A;  1A9X A;  1CT1 D;  3KDF B;  2UUC Q;  3J80 E;  4UDU C;  3EBE A;  3OSN A;  2F1M A;  2FXQ A;  1EZ1 A;  2A6H C;  3RB3 A;  2E5L Q;  1PFS A;  2JEB I;  2Q2H A;  2FK1 A;  1KNE A;  3H4B A;  2AGO A;  3GTQ A;  3SVM A;  1ENC A;  5M5Y H;  3GII A;  3FP9 A;  1PTO B;  2H1E A;  5IGG A;  3CCE A;  5L1J A;  4EVO A;  3HOW H;  2XWJ B;  1K1Q A;  2QA4 A;  4LAA A;  3PIP A;  1G6Z A;  4R4O A;  1MGS A;  3PCO B;  4LUV A;  4C56 C;  5DG9 A;  3PF5 A;  1TWH H;  1DCZ A;  5KFW A;  1GXD C;  4CJ2 C;  4LFC H;  1HR0 H;  4J9K A;  2D5D A;  3ICE A;  1HR0 W;  3NXW A;  3RUZ A;  4TQS A;  2B8F A;  1A8V A;  3GIK A;  2H4O A;  3HEJ A;  1X3F A;  3BS1 A;  3ZJY C;  4O3N A;  2OQK A;  1A62 A;  3CCL A;  4NKL A;  5K36 G;  3BVG A;  1IOV A;  2ALY B;  2E74 C;  4A3K G;  4GKK L;  3L7Z C;  1G2T A;  3KHR A;  1AEX A;  4JI7 H;  2VQE Q;  1VMC A;  3H3V H;  1TS3 A;  3HOY G;  4IRC A;  1TKW B;  2YU9 A;  1V1Q A;  3F2U A;  4DV5 L;  1YNJ D;  2EPB A;  1NAP A;  2B2U C;  4GKJ Q;  1I6H H;  1A6X A;  2HIV A;  3KOJ A;  1SNC A;  4V19 0;  5L1L A;  3K81 C;  3PSI A;  4KMU C;  4IUQ A;  4X62 Q;  1B6R A;  4X3U A;  1DYQ A;  2J4X A;  1YNJ C;  1JIH A;  2XCA A;  4ECZ A;  4EQ5 A;  2R7Z G;  4DV1 H;  2BE5 D;  1PTO C;  1DD2 A;  1VF7 A;  3P1H A;  1GJX A;  3T56 B;  4A3J G;  4FF3 A;  4HCS A;  1M8A A;  2E2H B;  3PF4 A;  1HR0 Q;  2WV6 D;  4IUU A;  2Q8T A;  4Q44 A;  1Q8K A;  3NBI A;  5EQ0 A;  1VQP A;  2R7Z H;  2SEB D;  2NUA B;  5J22 A;  5E4W C;  5I47 A;  4RHS A;  3G6X A;  1AE3 A;  4HIO A;  1OO9 B;  4A3D H;  1IXR A;  3UDG A;  2XNA C;  1EFW A;  2KQ3 A;  2EY5 A;  1D8L A;  4KD3 A;  1BCP C;  3BQ1 A;  1C0A A;  3A5Z B;  3PO2 B;  3VR6 A;  1P16 A;  4O3O A;  3K57 A;  3D0F A;  2ZDH A;  3M9B A;  3PIP 3;  4QQB X;  2AQ3 B;  1HA5 A;  4HSV A;  1STY A;  3NE5 B;  4X65 Q;  4GN3 B;  4YR2 A;  4DAV A;  3TME A;  2UXD Q;  1GUT A;  4YCV A;  3VR4 A;  2XSC A;  1IW7 D;  3AFP A;  3TSS A;  5C0X H;  1PRT F;  1V43 A;  3S17 H;  2JA8 H;  2VQE H;  2XN9 C;  4J9L A;  4YJ2 F;  4DR1 Q;  4R7R A;  1T9H A;  2KCM A;  4Y8V B;  4X3S A;  4IAJ A;  5DEH A;  4P73 A;  4LF8 Q;  2UVV A;  1L0Y B;  1S68 A;  1L1O C;  1JWU D;  4HR7 B;  4K5V A;  1YJN A;  3R5X A;  4MV4 A;  4HTH A;  3WOF A;  2Z4I A;  2HHH H;  4X66 H;  2ZJT A;  2JEJ A;  4DF7 A;  1HNZ L;  1SE4 A;  5M3F H;  4G7H C;  3S2D B;  5DLF A;  2AMC B;  4JI5 H;  4DK1 A;  1NUC A;  2JA6 G;  4MV6 A;  1BBX C;  4EG0 A;  4IR9 A;  2K4K A;  3HKZ A;  5ELC A;  4E4T A;  1MBY A;  1G8Z D;  2XRQ D;  3M4O H;  2XCP A;  3HOZ B;  3C1F A;  4QW8 A;  2R8I A;  5KFP A;  4L6T B;  4YR0 A;  3M85 A;  4IAL A;  5AJ3 L;  1QZH A;  1SYC A;  3E5S A;  1K1S A;  5CBA E;  1KD1 C;  3FMA A;  4UCT A;  1TS5 A;  3TIG A;  4JI1 L;  4IWY A;  3T5L A;  1KJ9 A;  2YTX A;  4IUP A;  4FBT A;  3E3X A;  1VQC A;  4DL7 A;  1SJH D;  1Z9F A;  3M4I A;  4LMQ D;  1KL9 A;  1S0M A;  4C3J H;  5HUR A;  4KI0 A;  1STB A;  2QF7 A;  3CC2 A;  3UE1 A;  3HOV G;  1SNM A;  3FKI H;  4DXF A;  3CCQ A;  1XMQ L;  4WBN F;  3MWY W;  1LUZ A;  3A8K E;  4Q8E A;  5D1O B;  2JXM B;  4BBS B;  2HDM A;  5IOD A;  3EVQ A;  1WTP A;  1BO0 A;  4ZQ3 A;  3R5F A;  1H9S A;  2SNS A;  1YIT A;  4XZ3 B;  3H4D A;  3M7G A;  2ZXR A;  2PBZ A;  1HPC A;  2CQA A;  5COR A;  2R92 B;  1LAC A;  1KDC A;  4L5Q A;  4A76 A;  5KG7 A;  4UCR A;  3CRL C;  3GTO B;  3HOY B;  3BQ2 A;  2CH4 W;  3OUZ A;  3GTM B;  3KLR A;  3H3V C;  2B63 H;  2RA4 A;  5F2D A;  1QNK A;  3R93 A;  3KJP A;  4A2A A;  3PR4 A;  1K83 A;  2RCF A;  1LT5 D;  3GTQ B;  1T3N A;  1EHI A;  1C48 A;  3WOE A;  2J9G A;  4RUC A;  4ED0 A;  3IFD A;  1FVI A;  3UE0 A;  2F0I A;  4Z9C B;  4ZUI A;  4EBC A;  1BGW A;  4DU9 A;  5C3X A;  4UY8 C;  2EOT A;  4R8N A;  4R9W A;  4F88 A;  3GIP A;  2R87 A;  1YNX A;  1YBY A;  4O42 A;  3CCU A;  4A3D B;  2F0K A;  3RGX A;  1MKH A;  2DJG C;  1NTG A;  2PMZ E;  3SGI A;  4ED2 A;  2R7D A;  4V0B A;  2A19 A;  2CZG A;  3DLL A;  3RNU A;  2I0Q A;  4A3B G;  5D1O A;  5LMN Q;  5IWA Q;  1D5X C;  3FKI A;  4O2D A;  4R1J A;  4U68 A;  5IE8 A;  3EYY A;  1JB7 A;  4B3S L;  4BBS H;  5CAE B;  3OTO H;  3QR8 A;  4P74 A;  3V6J A;  4DR1 H;  2EYH A;  4NDX A;  4TQU S;  3W5O A;  2KUM A;  5E1F A;  5KT7 A;  2F0E A;  1SN8 A;  1JJG A;  3LP8 A;  1X3G A;  3W3A A;  5I9O A;  1PZK D;  1UEB A;  1M7J A;  1M1K C;  1N56 A;  1XMO L;  1GSH A;  5DAU A;  3UDX A;  2DUD A;  1LAB A;  2DN8 A;  4K5X A;  3HOV H;  3N42 B;  1XX8 A;  2F0J A;  2BR0 A;  4QWB A;  2A73 B;  3BG5 A;  2B63 A;  4HR7 A;  4BXX G;  5KFS A;  1ZET A;  2I5H A;  4EGJ A;  5M5W H;  1KTK A;  2CWA A;  4ED3 A;  2UVR A;  4ID6 A;  1S72 A;  2VA2 A;  1SJE D;  1HXY D;  5HGQ A;  3DMU A;  4JOI A;  1UAP A;  5LMU L;  3PUZ A;  1QIL A;  4KKU A;  4HMI A;  4RFB A;  1GHK A;  3S1R B;  4RMF A;  1PH8 A;  3PV0 A;  1STN A;  1JMC A;  1CM9 A;  3GO5 A;  3RF2 A;  5LYJ F;  5KFN A;  2C2D A;  3FDS A;  5D3I B;  1LTG D;  1N34 Q;  2PZU A;  3SEB A;  4CDD C;  5GON F;  4C3H G;  1N33 L;  3FKI G;  3RZO H;  1YHA A;  2GA4 B;  2OLS A;  2WII B;  1TY0 A;  1VQB A;  4DV7 L;  1T94 A;  2YZN A;  3M3Y B;  4DV2 H;  3GDE A;  5EPK A;  4CKB A;  1QVF A;  2FLL A;  2A68 C;  4ULL A;  2HUG A;  5I9P A;  4J1M A;  4KN4 C;  4FM9 A;  1O7I A;  2SDF A;  1HNW Q;  3T5K A;  1VQA A;  4LWC A;  3HFZ B;  1W2B A;  2RDJ A;  4L63 B;  5JVH 3;  4P72 A;  2BDN A;  1TWF H;  5C3E G;  1N8R C;  2CQO A;  1I5F A;  1HQM C;  2MCT A;  2YS6 A;  1YEZ A;  2ZXP A;  4LF9 L;  1RJR A;  5LXT F;  4LF6 H;  2O4X A;  4GNX C;  4JV5 L;  2QGQ A;  5DNF A;  2PW7 A;  3H0G A;  3VA5 A;  2CKZ B;  2I46 A;  2IJ0 A;  2JA5 G;  3MFI A;  3IFT A;  2VS1 A;  3ND9 A;  3P75 A;  1BOS A;  2K75 A;  2JEF A;  3AU7 A;  2PMZ B;  1K3R A;  1DZ1 A;  1J9O A;  1IBL Q;  2F3I A;  3BZC A;  4H02 A;  3W1G A;  4MV3 A;  3CVZ A;  5COY A;  2EYL A;  3TQY A;  4DLK A;  1XPR A;  4YHH H;  1H9M A;  3JAM W;  2R84 A;  5I4D A;  3BG3 A;  1BUV T;  3UDI A;  1VQF A;  2PI2 A;  4TV9 F;  1ET6 A;  5IYC H;  1UC8 A;  3RLO A;  3JAM L;  4R8U B;  4DV5 H;  2RKS A;  2NVY B;  5KFE A; 
#chains in the Genus database with same CATH homology
 3NEM A;  1J6Q A;  1D7Q A;  4A3B H;  3NBH B;  4JI7 L;  3H3V I;  2Y0S G;  1A63 A;  2I5M X;  3OYY A;  4DR4 L;  2BH2 A;  5M3M G;  4DUY L;  4L5S A;  4JI5 Q;  2LXK A;  3PUX A;  4WJ4 A;  2WB1 E;  2IHF A;  3K7U C;  4DR7 Q;  1Q12 A;  3J81 i;  2Y0S E;  1XNR L;  1YHB A;  2NVY H;  4PZ8 A;  2F52 A;  2HHH Q;  4HJA A;  2UXB L;  4C3I H;  3RLN A;  3J80 i;  4LUO A;  3J81 c;  3NEL A;  2KBN A;  1MJC A;  1Z47 A;  3F2B A;  4HJ8 A;  3G4S A;  4JI6 Q;  3J7A 5;  4NPS A;  5IP7 G;  1K9M C;  1WI5 A;  4JI7 Q;  1E3P A;  1Q86 C;  4K0K Q;  3VDY A;  2VZA A;  1EQQ A;  3M4P A;  1PV4 A;  1I94 L;  4BY1 G;  4DUZ L;  2K5N A;  2NN6 G;  2UXB Q;  4WJ3 M;  3KF6 B;  2PNH A;  1EYG A;  1VQL A;  3KF6 A;  3HKS A;  3UDF A;  5LMN W;  1X54 A;  2F4V Q;  4DR7 L;  1B70 B;  2VY3 A;  4BXX H;  3BJU A;  2XTI A;  4IJL A;  1QZG A;  1TWG H;  4YWL A;  2JK8 A;  1MJE A;  4BBS G;  1A0I A;  4BY1 H;  1PH7 A;  1EOV A;  3M4Q A;  1PH6 A;  1JT8 A;  2N3S A;  1HNX L;  5EAY A;  2JJQ A;  1PH1 A;  4B3R L;  1VQK A;  2VUM G;  1X9N A;  2IHE A;  2VQE L;  2PI2 E;  2N78 A;  3HOX H;  1CKO A;  1B8A A;  5C0X I;  3G71 A;  4LNQ A;  5FLX c;  4LFC L;  2RHQ B;  3CAM A;  4JI3 L;  4NXM L;  4YWM A;  1XNQ L;  3H15 A;  3CC7 A;  2E2J H;  2OCE A;  1XNQ Q;  4DV3 L;  1V9P A;  1HH2 P;  2AKW B;  4R4I A;  4L5T A;  4QIW E;  3OW2 A;  4OX9 Q;  4XTC S;  4JOI C;  3CPF A;  4QY7 A;  4UP8 A;  1Q81 C;  2UUA L;  4IOC A;  4A3M G;  5FJ8 H;  5IYD G;  4LFB Q;  3TRE A;  1OTC A;  3KFU A;  2L15 A;  1XJV A;  4NB3 A;  4JI8 Q;  3PUW A;  3CCM A;  1AE2 A;  1VCI A;  2HT1 A;  3PO2 H;  3CD6 A;  2UUB Q;  4JBM A;  4IFD G;  4A93 G;  1K83 H;  1G6P A;  2RHS B;  1K73 C;  4IFD J;  1IBK L;  4DK6 C;  1KRT A;  4DV3 Q;  1XNR Q;  1TWA H;  2KHI A;  1K0R A;  1KAW A;  2Z6K A;  1Q7Y C;  1PHJ A;  4JV5 Q;  4DV1 Q;  1E22 A;  3BZK A;  3T1Y Q;  4A3F G;  1JE5 A;  2JA7 G;  2YTY A;  1N32 L;  1Y1V G;  1Y1W G;  2JQO A;  4A93 H;  3CME A;  1N33 Q;  3I4O A;  2NVT H;  1EIF A;  3PIO A;  2ZTD A;  3CPW A;  4B3M Q;  5JJK A;  2B29 A;  5M3F G;  4IPC A;  4AIM A;  1WYD A;  2PQA A;  2CWP A;  2E2I H;  4LF6 Q;  3GTL H;  3BU2 A;  4DNI A;  4YWK A;  4X6A H;  4A3K H;  2NVX H;  4DR4 Q;  2Q2U A;  4JI6 L;  1PH3 A;  2QEX A;  3CC4 A;  3L0O A;  1N9W A;  1TXY A;  1J5E L;  3RR5 A;  4QJF A;  4A3F H;  1TWC H;  2LSS A;  4UP7 A;  1WOC A;  1S3O A;  4NXN L;  1VQ5 A;  2KEN A;  3T1H Q;  2VL6 A;  3CXC A;  2YTV A;  4BA2 I;  1PVO A;  2ZM6 Q;  4DR3 Q;  4JI2 L;  1IL2 A;  1L1O B;  3CMA A;  4DR1 L;  1XPU A;  4X62 L;  3CW2 C;  4POF A;  2GVA A;  3KDF B;  2UUC Q;  3CP0 A;  3EBE A;  3B6Y A;  5BR8 Q;  3J80 c;  2FXQ A;  1CKM A;  4OWT B;  4LF8 L;  3I56 A;  2E5L Q;  1PFS A;  1Q46 A;  2JEB I;  2Q2H A;  4X66 Q;  1K8G A;  1EIY B;  3AEV A;  4JC0 A;  5M5Y H;  4HJ5 A;  3FP9 A;  2XGT A;  3CCE A;  1CSQ A;  1IBL L;  5IP9 H;  3AYH B;  3HOW H;  3RN2 A;  2WFW A;  5GAD C;  2D0O A;  2AWO A;  4A3I G;  2QA4 A;  4OO1 G;  3E0E A;  4R4Q A;  3U58 A;  5HY6 A;  4TVA B;  3PIP A;  4B3T L;  4R4O A;  3GTK H;  4BY7 G;  4OON A;  2UXC Q;  3PCO B;  4LUV A;  3S1M H;  4PZ6 A;  3PF5 A;  1TWH H;  3ULJ A;  4HJ7 A;  3S24 A;  3ULL A;  4PMW A;  4DAM A;  2R92 H;  4P75 A;  3ICE A;  2UU9 L;  1HR0 W;  4HIK A;  1KHI A;  3GTQ H;  4DAY B;  2CFM A;  5IY0 A;  2JA9 A;  2VUM H;  1A8V A;  1BBU A;  1E7Z A;  1X3F A;  1H95 A;  3ZJY C;  5C3E H;  2OQK A;  1A62 A;  4YCU A;  1YHQ A;  3CCL A;  4IPD A;  5K36 G;  1S40 A;  3CCR A;  4B3M L;  1JJC B;  2ALY B;  4GKK L;  4A3K G;  4MTN A;  3L7Z C;  3OTO Q;  1OXV A;  3JC6 6;  4ME3 A;  3CF5 A;  3S16 H;  2D62 A;  3A5U A;  2DGY A;  2VQE Q;  3H3V H;  4A3J H;  3HOY G;  1FJG Q;  4KHP Q;  3HOZ G;  4BBR G;  1Q1B A;  1V1Q A;  1VS0 A;  2K5V A;  4X66 L;  4DV5 L;  4Y52 H;  4DV4 L;  4A3G H;  1B7Y B;  1U0L A;  4GKJ L;  1IBK Q;  2KHJ A;  1IYJ B;  1OXX K;  4A4I A;  1LYL A;  2HIV A;  3KOJ A;  5GAG C;  2JA6 H;  4GKJ Q;  4C2M H;  3K81 C;  4MNO A;  3PSI A;  1HZC A;  4X62 Q;  4A75 A;  1CKN B;  3H0G G;  4JI8 L;  3W1B A;  3HOU G;  4OWX B;  2IY5 B;  4YY3 L;  2NN6 I;  3TEH B;  4EQ5 A;  3GTP H;  2R7Z G;  3U4V A;  1IBM L;  2EXD A;  2ATW A;  3MXN B;  1X56 A;  4BY7 H;  3LGJ A;  3HOV G;  4A3J G;  1N36 L;  2K5H A;  2I5L X;  3A0J A;  4A3I H;  3PF4 A;  1HR0 Q;  4PZ7 A;  5GRO A;  2MNA A;  2OTL A;  3G48 A;  1GO3 E;  1PYS B;  3JAM i;  1Q8K A;  3GD7 A;  4DR2 L;  1VQP A;  2R7Z H;  4DV5 Q;  1E1O A;  5GAE C;  1R9T H;  5LMN L;  2YV5 A;  4R4T A;  5ELN A;  2VW9 A;  3CCS A;  2C35 B;  4GNX A;  1JJ2 A;  1AE3 A;  5C0X G;  4HIO A;  4A3D H;  1E1T A;  1IXR A;  2RCN A;  1GVP A;  2HIX A;  3UDG A;  1BBW A;  1EFW A;  3E9I A;  4APV A;  2UXC L;  1CUK A;  4YHH Q;  1D8L A;  4LF5 L;  1C0A A;  3A5Z B;  1P16 A;  1E24 A;  4GS3 A;  4LF6 L;  3D0F A;  3CCV A;  4DUZ Q;  3M9B A;  2HQL A;  1I3Q H;  4QQB X;  3Q8D A;  4GLX A;  3J81 j;  4BA1 I;  4A3C H;  5M3M H;  4YCW A;  4GN3 B;  4X65 Q;  5LMU Q;  3S1N H;  1SRO A;  1L1O A;  4AQY Q;  3S2H H;  5ELO A;  1N32 Q;  1UE7 A;  4YCV A;  2UXD Q;  4JBW A;  4DR6 L;  5JJL A;  3PUY A;  3HKZ G;  3AFP A;  5C44 G;  5IYB H;  1VQD A;  2ID0 A;  5H1S E;  2JA8 H;  1UWV A;  4GOP A;  3I4N G;  2ZM6 L;  3A74 A;  5DLQ E;  4DR3 L;  3M3Y H;  1G51 A;  5M5X H;  4DR1 Q;  4L5R C;  1T9H A;  4JG2 A;  5FLM H;  2ASB A;  2KCM A;  1NJI C;  2WAQ G;  1HNZ Q;  2B63 G;  4GOP C;  4X65 L;  3T1Y L;  4GNX B;  4P73 A;  4LF8 Q;  2JEA I;  3S17 H;  3GTG H;  1KQS A;  4GN4 B;  1L1O C;  4UPA A;  1YJN A;  4LFA Q;  1GKH A;  1VQI A;  1LM0 A;  2F4V L;  4XIG S;  4JI2 Q;  1N36 Q;  1XTD A;  2YYZ A;  1NY4 A;  4B3T Q;  3S14 H;  1WJJ A;  1GD7 A;  1HNZ L;  5M3F H;  1M90 C;  4YY3 Q;  3S15 H;  5AJ3 Q;  2AMC B;  1OXU A;  2ZJQ A;  4A3L H;  2JA6 G;  1WFQ A;  1I94 Q;  1NMF A;  2E5L L;  2BH8 A;  2JE6 I;  2K4K A;  1XMQ Q;  1MIU A;  1WCM G;  3H0G H;  4A3G G;  4A3E G;  2H5X A;  2OQ0 A;  3PGZ A;  4AQY L;  3M4O H;  2UXD L;  5C0X J;  2Z0S A;  2MO0 A;  2ES2 A;  1VQ4 A;  3M85 A;  2N8N A;  4DR5 Q;  4LF7 Q;  5AJ3 L;  1NMG A;  3RZD H;  1QZH A;  2ZJP A;  2UUA Q;  1W3S A;  2A1A A;  2BA0 A;  1KD1 C;  4KHZ A;  5JEA J;  1EQR A;  3OTO L;  4JI1 L;  1NBW A;  3KJO A;  2YTX A;  1L0W A;  2NVQ H;  1KC8 C;  1VQ6 A;  1SE8 A;  1VQC A;  1NE3 A;  3AQQ A;  4JI5 L;  4LUZ A;  1Z9F A;  1GM5 A;  1KL9 A;  1VQJ A;  4C3J H;  3EN2 A;  4KI0 A;  1PH5 A;  3M7N A;  2V1C C;  3PUV A;  3KF8 B;  4DR6 Q;  4GLA C;  3TS0 A;  3CC2 A;  3U4Z A;  1C9O A;  1UE1 A;  3FKI H;  3U50 C;  3UE1 A;  3CCQ A;  4DV6 L;  1XMQ L;  1VQ8 A;  1LUZ A;  2AHO B;  3I55 A;  2VNU D;  1KRS A;  1X6O A;  4A3D G;  1FL0 A;  4KLK A;  3F2C A;  3I2Z A;  4LFB L;  1SR3 A;  4DV2 Q;  3ERS X;  1OXT A;  2K52 A;  1SLJ A;  3KDF A;  4DV0 L;  1SFO H;  1YIT A;  2Q2T A;  1QUQ A;  4YHH L;  5J3B A;  1U5K A;  5IWA L;  4A3C G;  3K7A H;  1EWI A;  2WB1 G;  4IO9 A;  4JI4 Q;  1HZA A;  4A3M H;  4L5Q A;  4A76 A;  1RIP A;  1PYB A;  4ALP A;  4AYB E;  1YIJ A;  1PH2 A;  2CCZ A;  4DR2 Q;  5C4J H;  2R93 H;  1DGS A;  1IZ6 A;  3CCJ A;  2NZO A;  2MQH A;  3TS2 A;  3GTJ H;  5FLM G;  4IJH A;  1I6H H;  3L2P A;  1SMX A;  4DV4 Q;  2WP8 J;  2ZTC A;  4A3E H;  4JI1 Q;  2B63 H;  3KJP A;  2K14 A;  3S2D H;  2R93 G;  1KIX A;  4GLV B;  4LF7 L;  1PH4 A;  3PO3 H;  1KXL A;  1FVI A;  3UE0 A;  3D31 A;  1QVC A;  4LFA L;  4UY8 C;  4JI0 Q;  2K50 A;  3GTM H;  2VQF Q;  1QUQ B;  1YNX A;  1YBY A;  3F2D A;  3CCU A;  1C7Y A;  3ER0 A;  1EUJ A;  1MKH A;  1NTG A;  2PMZ E;  1X3E A;  3SGI A;  2R7D A;  3PO3 G;  3DM3 A;  3S1R H;  1CSP A;  1G29 1;  2A19 A;  4LW1 A;  5IP7 H;  3DLL A;  3RNU A;  2I0Q A;  2OWO A;  4A3B G;  5LMN Q;  5IWA Q;  1UE6 A;  1OXS C;  4O2D A;  4DV1 L;  4R1J A;  2NZH A;  5IE8 A;  2ZJR A;  3KLW A;  3GTO H;  3F8T A;  4JCV E;  1JB7 A;  1VQ9 A;  4B3S L;  2JA8 G;  3HOY H;  4BBS H;  5C44 H;  2B3G A;  2EIF A;  4P74 A;  2R7F A;  4TQU S;  3W5O A;  1QVG A;  3STB C;  4POG A;  1IBM Q;  1HNX Q;  3I4M H;  3ULP A;  1YI2 A;  4R4C A;  3HOW G;  1HZ9 A;  2MO1 A;  4HJ9 A;  2AWN A;  2MFI A;  1VQO A;  1SN8 A;  3J7Z C;  5IT9 c;  1JJG A;  1HR0 L;  1X3G A;  3HOU H;  2LXJ A;  2GVB A;  4DV0 Q;  2A8V A;  5JJI A;  1UEB A;  2WAQ E;  4LFC Q;  3FHW A;  3EIV A;  2GN5 A;  1M1K C;  4DPG A;  1LTL A;  2R6G A;  1XMO L;  2EQS A;  4LF9 Q;  4NXN Q;  3UDX A;  4PG3 A;  4IPG A;  1YJW A;  2DUD A;  2KCT A;  4GN5 A;  3HOV H;  5C4X G;  2Z6K C;  1BVS A;  3K80 C;  4DK3 C;  1Q82 C;  5IYB G;  1VQH A;  2VQF L;  3JAM c;  2IX0 A;  3E9H A;  1SRU A;  3I7F A;  4BXX G;  3CQZ H;  2I5H A;  4IPH A;  4LF5 Q;  5JEA G;  5M5W H;  2CWA A;  1PH9 A;  1S72 A;  5IP9 G;  1RL2 A;  4DKA C;  5HGQ A;  2BA1 A;  1VQM A;  3S1Q H;  3G6E A;  4JOI A;  4LF4 L;  5GQO A;  1FGU A;  4X64 Q;  5LMU L;  3PUZ A;  4O0A A;  4K0K L;  4RMF A;  1ASZ A;  1PH8 A;  1VQG A;  3PV0 A;  3RN5 A;  4DR5 L;  4IFD I;  1JMC A;  3GO5 A;  1Y1W H;  1BKB A;  3MEF A;  4JI0 L;  4UP9 A;  1N34 L;  3TRZ A;  1N34 Q;  4GOP B;  1HNW L;  3NEN A;  2UUC L;  2YU9 H;  1FJG L;  4KHP L;  4JBK A;  1N33 L;  2R92 G;  3FKI G;  4J15 A;  4X64 L;  1YHA A;  1P8L A;  3WWV A;  3RZO H;  4DV7 Q;  2HHH L;  1VQN A;  1HZB A;  1VQB A;  4DV7 L;  3PO2 G;  3AFQ A;  1PA6 A;  3GDE A;  5E7N A;  4OX9 L;  1QVF A;  4DUY Q;  4GKK Q;  1O7I A;  1HNW Q;  4B3S Q;  3K8A A;  1HJP A;  4QGU A;  1VQA A;  4LWC A;  1Y1V H;  1VQE A;  3HFZ B;  4EX5 A;  1W2B A;  2JA7 H;  1L2F A;  4JBJ A;  2UUB L;  4RG1 A;  4P72 A;  5C3E G;  1TWF H;  1N8R C;  2ZTE A;  2CQO A;  1I5F A;  4DV6 Q;  4JYA L;  1YEZ A;  3HOX G;  2RF4 A;  1XMO Q;  2UU9 Q;  4LF9 L;  3I4N H;  4LF4 Q;  1K8A C;  4GNX C;  1XPO A;  4JV5 L;  1X55 A;  1Y14 B;  2QGQ A;  1I50 H;  4HIM A;  1J5E Q;  2CKZ B;  5IYC G;  4HID A;  2JA5 G;  4JI3 Q;  1VQ7 A;  4DV2 L;  2VS1 A;  4FDB A;  4AYB G;  4BBR H;  3K0X A;  4QL5 A;  2K75 A;  4A3L G;  2IX1 A;  5FJ8 G;  4IOA A;  5IYD H;  5GAH C;  1K3R A;  3HKZ E;  2Q2I A;  1IBL Q;  2F3I A;  1CKN A;  3BZC A;  4Y7N H;  4H02 A;  1YJ9 A;  3W1G A;  2N49 A;  4B3R Q;  4JI4 L;  4JYA Q;  3RLF A;  3TQY A;  2D0P A;  1XPR A;  3I4M G;  1Q1E A;  4MZ9 A;  3STB D;  5BR8 L;  1ASY A;  2OTJ A;  4OO1 I;  4P71 A;  1AH9 A;  1X65 A;  2PQA B;  3UDI A;  4C3H H;  4AH6 A;  4OWW B;  2E8G A;  3KYH C;  4NXM Q;  2PI2 A;  3F1Z A;  1VQF A;  2IT1 A;  3IRB A;  5C4X H;  3T1H L;  1UE5 A;  5IYC H;  2JA5 H;  3RLO A;  2E2H H;  1WCM H;  4OXP A;  1V43 A;  1YVC A;  1YZ6 A;  3HOZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...