2JA6G

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
molecule tags Transferase
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja6G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja6G01
2E2HH 3CPFA 2PI2A 3RLNA 1NTGA 2MFIA 2OQ0A 3CMEA 3CCSA 1BKBA 5FLMH 1PH3A 2R92H 2R7ZG 4JI8L 4L5TA 2MQHA 3D31A 4HIMA 3E0EA 4GNXA 3ULJA 3PO2G 4KI0A 4DUZQ 1NJIC 4JBJA 3TS0A 1PH4A 1KHIA 4DV3L 4YCVA 1Y1WG 4JI6Q 3CCJA 4A3BG 4DR6Q 1B7YB 4JI5L 4IJHA 1GD7A 1VQGA 2A19A 4OO1I 4JOIA 2AWOA 4IO9A 5JEAJ 3GTJH 4JI0L 3KF6B 2E8GA 3HOVH 5M3MH 1CKNA 2B63H 4A3FG 1IBKL 3E9HA 1FL0A 1CSPA 5DLQE 3S2HH 1QVFA 4DV5Q 5C44H 2B63G 1HH2P 4QIWE 3K7AH 4NPSA 3I4OA 4BBRH 3L2PA 3E9IA 4P73A 2ZJRA 4TQUS 4A3MH 4GKKQ 1WYDA 1J6QA 2JEBI 2KCMA 2PMZE 3AQQA 4KHPL 3I2ZA 1BBWA 4K0KQ 3CD6A 3BU2A 1OXXK 4X65Q 1N8RC 3S15H 3EN2A 4YWLA 1V1QA 4R4QA 3AFQA 5C3EH 3PSIA 4OX9L 2NVTH 1NE3A 2EIFA 4JYAQ 5FLMG 1VQ6A 2R92G 2PQAB 2ZTCA 5IYBH 4X64Q 4HJ9A 1VQPA 3ER0A 4NXNL 3HOZG 4DAYB 3F2DA 1EIFA 4RG1A 3UE1A 4YHHL 5LMUQ 1XPRA 4IOAA 3K7UC 3CF5A 4DUZL 4A3DH 2VS1A 1VQCA 4DV6Q 1N34Q 4P74A 4AQYQ 4BY1G 2JA6G 3H0GH 1G291 4DV3Q 4A76A 3TEHB 4J15A 4LW1A 3U50C 1J5EL 3S1QH 3NEMA 2PI2E 4R4TA 1I5FA 2I5HA 1PA6A 3S17H 1A62A 2AWNA 1HNZL 5FLXc 1YNXA 3JAMc 4DV5L 4IOCA 3HKZE 3M4QA 3GTQH 3HOYH 4GLXA 4IJLA 4LWCA 4P75A 5AJ3L 2R93G 4OWXB 1QUQA 3K8AA 4A3EG 3S24A 4C3HH 1KQSA 5M3FH 1YJWA 3I4MG 4A3GH 3CPWA 4UPAA 2C35B 2HHHL 1EQQA 4X65L 2GN5A 2KCTA 2YTXA 1I3QH 2BA1A 2OCEA 1N32L 1TWCH 1HZCA 4LF6L 1HNWQ 1Q7YC 3HKSA 1EUJA 5LMNW 2MNAA 4NXNQ 1JT8A 4JCVE 1VQHA 4DV4Q 2L15A 2UU9L 2ASBA 5C0XG 1KD1C 2MO1A 2CWAA 2ZM6L 2E5LQ 4BY1H 4A3CH 1TXYA 2WAQE 3D0FA 3KFUA 3L7ZC 1N33Q 1X3FA 4A3CG 2UUCQ 4LF4Q 4YCWA 1E1TA 1AE3A 3GO5A 4HIOA 2I5LX 2B3GA 4JI2Q 1EWIA 3U4VA 1VQMA 1XMOL 4A93H 1VQ5A 3STBD 4YCUA 1C7YA 1WJJA 1SROA 2PNHA 4PMWA 2IY5B 2I0QA 2IT1A 4OXPA 1QVCA 2BA0A 4ME3A 3BZKA 3CW2C 4DKAC 1PH5A 3G48A 3CCLA 1ASZA 1UE5A 1VQ7A 2QGQA 1KL9A 1X9NA 4GN4B 3WWVA 4DR6L 1IYJB 2K5NA 1YZ6A 2YTVA 1PV4A 4X66Q 4K0KL 3A0JA 2HHHQ 4C3JH 1X6OA 1O7IA 2ALYB 2ZTDA 4LF5L 4QQBX 1R9TH 5GADC 1E24A 3PCOB 4DV2L 3GTOH 4X62Q 3ULLA 4A3DG 2R6GA 3KF6A 3KOJA 1I6HH 3KJOA 3L0OA 3PUYA 2N3SA 3W1GA 5H1SE 1XMQL 3CC7A 1TWHH 5IP9H 1XNQL 1JE5A 4GLAC 4JI8Q 5IYDG 2VQEL 5C0XJ 4DR1L 1HR0W 3RNUA 4IFDG 2RCNA 3ICEA 4Y7NH 5C44G 3MXNB 4LFAL 5C0XI 1XPOA 3PUXA 1Y1VG 1OXUA 1K8AC 2EQSA 4JI6L 3HOZH 1D7QA 3OTOL 4OX9Q 3CCUA 1LUZA 1P16A 2K4KA 1HZBA 1Z47A 4DV7L 3KDFB 4XIGS 3RLOA 1GO3E 3PIOA 1PVOA 3JC66 1X3EA 5IYBG 3HOXG 3F2BA 1K73C 3SGIA 2OTLA 4A4IA 1PH9A 3S2DH 2K5HA 3ERSX 3J7ZC 2K52A 1PYSB 2IHFA 3H3VH 2DGYA 4A3KG 1IBKQ 1FVIA 1WCMG 3CP0A 5IYCG 4P71A 2K14A 3Q8DA 1U5KA 1N36L 5IT9c 4DV0L 3NBHB 1GM5A 3J81c 1N32Q 4JI3Q 1IBML 3VDYA 3B6YA 3T1HQ 1YEZA 1C9OA 2Q2HA 4MTNA 3G6EA 2B29A 2JA7H 4H02A 4UP8A 3STBC 4JOIC 4DR2Q 1JJCB 3FHWA 4KHPQ 1AE2A 1VQIA 2EXDA 4EQ5A 3ZJYC 4GS3A 3A74A 4HIKA 1VQLA 4JI7L 2JA5G 3PO2H 5IE8A 1XNRL 3CC4A 4PG3A 1Y1VH 4X66L 3HOYG 3TRZA 1Y1WH 4LF8L 1I94Q 2F3IA 2QEXA 4QJFA 3AYHB 3GTMH 4BY7G 2VUMG 3M9BA 1DGSA 3S14H 1EOVA 4OONA 4OO1G 3S1NH 5IWAQ 2FXQA 2VUMH 4DR3L 4LF9L 5E7NA 2AKWB 3GTLH 3HOUH 4IPDA 4DV6L 4HJAA 3J81j 3RN5A 1NBWA 2LSSA 1G6PA 1YITA 1WI5A 1X56A 1A63A 2Y0SE 3M7NA 2UXCL 1B8AA 4YY3L 1OXTA 3I55A 1V9PA 3MEFA 5BR8L 5M5XH 1JMCA 1WCMH 5EAYA 2WAQG 2I5MX 5JJKA 3HOWG 5IP9G 3S1RH 1Q1BA 5M5YH 1G51A 1GVPA 4QY7A 1X3GA 4JI0Q 3HOWH 2JA8G 4DUYL 2N8NA 4A3JG 4L5RC 3J80i 2KHJA 1LM0A 5ELNA 1YIJA 3UDFA 4GNXB 4JBMA 4A3JH 4DR4L 1A0IA 2VL6A 1C0AA 4O2DA 4GKKL 2Y0SG 2JEAI 1X55A 2YV5A 4LUVA 3PO3H 2UU9Q 4POFA 1YBYA 4GN3B 3T1YQ 1VS0A 1I94L 4BY7H 4LF8Q 2KHIA 4HJ7A 1Q46A 1TWGH 3OW2A 1JB7A 1HNWL 1N9WA 4GOPB 2ZTEA 3EIVA 3CAMA 1KRTA 1J5EQ 2DUDA 4BA1I 1M1KC 2CKZB 2HQLA 1HR0Q 4AH6A 2N78A 3PUWA 2NVXH 2XGTA 3KYHC 2AMCB 4DPGA 3K81C 1B70B 1Z9FA 4JI4L 2VW9A 4B3SQ 3F8TA 1EYGA 4A3IH 3NENA 3TREA 2UUAL 3GTPH 1ASYA 3TQYA 2D0OA 1UEBA 2VQFL 1L1OA 2JE6I 1YVCA 4LUZA 3PF4A 1CSQA 4GLVB 3H3VI 2D0PA 2Z6KC 2GVBA 1HNZQ 4YWKA 1JJ2A 1VQ9A 4L5SA 4IFDI 2R93H 4Y52H 2JA8H 1VCIA 4A3EH 3DLLA 1K9MC 5M3FG 3AFPA 1VQOA 2CQOA 2ID0A 4DV7Q 4X62L 4R1JA 2WP8J 4WJ3M 2K5VA 1E1OA 5IY0A 2VY3A 5LMNL 1Q82C 1VQKA 1SMXA 2JK8A 5FJ8H 4YY3Q 2ZJPA 1OXVA 2WB1E 4DK3C 4BXXG 4B3RQ 1IZ6A 4B3RL 2F52A 1L0WA 4OWTB 4YHHQ 3HOXH 5LMUL 1Q81C 4B3ML 4B3MQ 3M3YH 1D8LA 4RMFA 3CCEA 1IBLQ 4LFCQ 2HT1A 1KIXA 3A5ZB 3GTKH 3HOUG 1N36Q 1YHBA 1MJCA 4DR5Q 4A3KH 2HIXA 1VQDA 4QL5A 3FKIH 4A93G 4DR1Q 1SRUA 2UXBL 1LTLA 3W5OA 1KC8C 2NVYH 3RZDH 4A3LH 1UE7A 3H15A 1XMQQ 1I50H 2OTJA 1U0LA 1QUQB 2QA4A 3I7FA 4JI4Q 1HZAA 3OTOQ 2WFWA 4JI5Q 2R7ZH 3G71A 2UXDQ 1Y14B 1A8VA 3K0XA 4AQYL 3I4MH 3F1ZA 4R4OA 1QZGA 2RHQB 4IPCA 1PFSA 4LF7Q 2VZAA 4DNIA 1W3SA 3EBEA 5JEAG 1SLJA 3A5UA 3PO3G 2JQOA 5ELOA 1KXLA 1CKMA 1MIUA 4TVAB 2E2IH 2RHSB 2NZHA 5IYDH 4R4IA 2Z6KA 4P72A 4B3SL 2LXKA 3DM3A 3I56A 4JI7Q 4A3FH 4B3TQ 3CCRA 3UDXA 1Q86C 3OYYA 3PV0A 1E22A 2K75A 4BBRG 1YJ9A 3M4OH 1N34L 4DV1Q 4LF5Q 1VQJA 4DR4Q 2JA9A 1MKHA 3PUVA 4POGA 2NN6G 1TWFH 4A3LG 1E7ZA 2AHOB 3W1BA 4PZ7A 1RIPA 5M5WH 2KBNA 4KLKA 1OTCA 5JJIA 1KRSA 4L5QA 1K83H 3PF5A 1EIYB 2UUBQ 4APVA 3FP9A 4JI1L 5C3EG 4NXML 1VQNA 1IBLL 3T1YL 1AH9A 4HJ8A 1HZ9A 1IL2A 2R7FA 1PH2A 3I4NH 1UWVA 4JI2L 1WFQA 2H5XA 1L1OC 1UE1A 4JV5Q 5FJ8G 4BXXH 4LFBL 1VQEA 1OXSC 1QZHA 4JBKA 4O0AA 1VQBA 4DV4L 3U58A 3UDGA 3PUZA 4LF9Q 3CCVA 5HGQA 1HJPA 1HR0L 1KAWA 4LFAQ 4DR7Q 4MNOA 2E5LL 3AEVA 3M4PA 5BR8Q 4EX5A 2YTYA 1UE6A 2YU9H 2UXCQ 4UP9A 5IP7H 3RLFA 1SN8A 2VQEQ 3RN2A 1PH8A 4A75A 3KDFA 3RZOH 3KLWA 1SR3A 1XNRQ 2IX0A 5IP7G 4R4CA 1S40A 5C4XG 4QGUA 4LF7L 2Z0SA 4JBWA 4JG2A 1K8GA 1P8LA 1L1OB 1YHAA 4DV2Q 4LUOA 1IBMQ 1VQ8A 4DK6C 3CC2A 5LMNQ 4PZ6A 5C4JH 1YI2A 3BJUA 3UDIA 4IFDJ 1N33L 4C2MH 3J80c 2D62A 1IXRA 3JAMi 1BVSA 4A3BH 5GQOA 4IPHA 4X64L 5GAEC 3PIPA 2WB1G 2F4VQ 2F4VL 4YWMA 4GOPC 1PH7A 4JI1Q 3UE0A 1EFWA 2UUBL 2BH8A 5GAHC 5JJLA 1XPUA 3GDEA 4FDBA 5M3MG 4LFCL 1SFOH 3I4NG 4AYBE 2UXBQ 2CWPA 4ALPA 1CKNB 2XTIA 1LYLA 3S1MH 4BBSH 5GROA 2NN6I 5GAGC 3M85A 1H95A 2K50A 4JC0A 2ZJQA 4GNXC 1Q8KA 3HKZG 2N49A 1NMGA 2Q2UA 1Q12A 3GTGH 4GKJL 2PQAA 3FKIG 2A8VA 4NXMQ 5AJ3Q 1TWAH 2CFMA 2JA7G 2JJQA 3J7A5 3K80C 1T9HA 1XNQQ 2MO0A 1V43A 1X54A 5C4XH 3G4SA 2VQFQ 1K3RA 1VQ4A 5J3BA 1YJNA 2BH2A 3TS2A 3CQZH 2Q2TA 4UY8C 4LFBQ 2CCZA 4X6AH 3IRBA 3CXCA 2E2JH 2HIVA 4PZ8A 3CCQA 1E3PA 3KF8B 1GKHA 1HNXQ 2OQKA 4B3TL 1PHJA 3T1HL 5IWAL 3HFZB 3H0GG 4DAMA 4DR3Q 1NY4A 2LXJA 2NZOA 2R7DA 4C3IH 3F2CA 1W2BA 1CKOA 1FJGQ 3PGZA 2GVAA 2Q2IA 4BBSG 2V1CC 1EQRA 2UUAQ 4DV1L 1PH1A 4DR5L 1FGUA 1M90C 4DR2L 4UP7A 4JV5L 1PYBA 3J81i 2UUCL 4LF4L 1MJEA 4LNQA 2RF4A 4XTCS 1JJGA 4GKJQ 1XMOQ 2JA5H 4DV0Q 2UXDL 4DUYQ 4AYBG 4MZ9A 1VQAA 1VQFA 2A1AA 3U4ZA 4HIDA 2IX1A 1CUKA 2NVQH 5HY6A 3LGJA 2VNUD 4GN5A 2IHEA 4HJ5A 1YHQA 4WJ4A 4A3GG 3BZCA 1S3OA 3NELA 4OWWB 4BA2I 3KJPA 3S16H 2ATWA 1S72A 2ES2A 1RL2A 4NB3A 1QVGA 4DR7L 1XJVA 1HNXL 2KENA 1Q1EA 4JI3L 2OWOA 3HOVG 1WOCA 1PH6A 1BBUA 2YYZA 4A3MG 3RR5A 1L2FA 3GD7A 1XTDA 1SE8A 4GOPA 5K36G 4AIMA 3CCMA 3ULPA 4IPGA 3CMAA 1FJGL 4A3IG 1X65A 1NMFA 1K0RA 5IYCH 2ZM6Q 4KHZA 2JA6H 4JYAL 4LF6Q
chains in the Genus database with same CATH superfamily
3CPFA 3CCSA 2OQ0A 2M00A 3K0YA 1KJJA 1I4HA 2R7ZA 3TP5A 5JQWA 2L11A 1J5EH 2A6HD 3NHHA 5IODA 3TS0A 1PH4A 4JI6Q 1C3OA 4O3OA 4DR6Q 4S3SA 1B7YB 1VQGA 2QYZA 1GUOA 2JEJA 2UXDH 4NW2A 2EE1A 5C4HA 3KF6B 2E8GA 4XYMB 1CKNA 3MR6A 3E9HA 3QFFA 2PBZA 4A3DB 2L55A 3VR4A 3L2PA 4BBRH 1M8AA 3E9IA 4P73A 3RD4A 3AQQA 2PN1A 2DY7A 1BBWA 5KFFA 3ND8A 3EA6A 2PO4A 4ZKCB 4R4QA 3BA9A 4DLKA 4YHHH 1S97A 1PTOF 1K83A 5FLMG 1EY7A 5E1FA 2ZTCA 2B2TA 1H9KA 1TT2A 4ILWA 3ER0A 4DL2A 2R8GA 4DAYB 3HEJA 2VUMB 1PYWD 1KLUD 3HZXA 2EYFA 4APMA 4YR0A 5AFWA 2E5LH 4FNFA 1S03G 4JVZA 2HQEA 4B9XA 3CF5A 2VS1A 1VQCA 4DV6Q 2JA6G 5TSSA 4DV3Q 1I94H 4A76A 2K5WA 4ZCKA 4LW1A 1GUNA 2PI2E 3EPIA 4R4TA 1QNUA 1I5FA 2XVSA 5KT6A 3KTMA 4HMJA 3G6JB 3T51B 3SK6A 1SYXB 5FLXc 1ET9A 4EEQA 2RA4A 5C5LA 2YS7A 3N52A 5AJ3L 3KAJA 4WD3A 1KQSA 4A3EB 5KYIA 5M3FH 3I4MG 1TA8A 4EQPA 1EQQA 2HHHL 3JSNA 2J6UA 4FBTA 2GN5A 2KCTA 2YTXA 1CI3M 4NKLA 1UC8A 5BPHA 4O4LF 4HNUA 4MA5A 2M05A 1C48A 1Q7YC 2VPQA 4R8UB 4NXNQ 1R4QB 3V96A 2XWJB 4DV4Q 5M3MB 2DN8A 3AMUA 1KD1C 1IW7D 1EY6A 1GUGA 2ZM6L 3KK7A 2W8KA 4BY1H 1HHVA 4HNTA 1SJED 3CRKC 4LH6A 4A2BA 1BF4A 3L7ZC 3KFUA 4LF8H 1X3QA 4LF4Q 4IZ8A 3EPGA 2B3GA 3HRZC 1EWIA 4A93H 1VQ5A 3STBD 2JA8B 3KHHA 1SROA 1EYZA 2K03A 4ECWA 4OXPA 1QVCA 4Z9CB 4ME3A 3CW2C 4DKAC 2R82A 1ASZA 1VQ7A 4KK7A 1TS3A 2VB2X 2QGQA 4RHRA 5LL6b 4JI0H 3ITPA 1IYJB 1PV4A 3F8NA 2VQFH 1QJOA 1EU4A 1O7IA 3TBIB 3Q8RB 2V58A 4X62Q 3A8JE 3KF6A 2E2DC 1I6HH 4ED1A 3KJOA 3RUPA 1XMQL 3W1GA 1S5CD 1TWHH 3NGDA 1TS2A 1JE5A 1EWHA 3BDLA 4GLAC 2VQEL 5C0XJ 4DR1L 3M3YB 2RCNA 3VR5A 5DAUA 3ICEA 2ZJTA 2SNSA 4EBDA 1LTAD 3MXNB 2IBKA 2H4OA 3RUZA 5CBEE 1UNNC 3GTLA 5KFMA 1CK1A 3OTOL 5M5WB 4OX9Q 2HVRA 1LUZA 4DK0A 5EWGA 5EPJA 3NWTA 5KFQA 2AGPA 5BR8H 2GLTA 3GTPA 4QIWA 2V59A 1RCVD 2OT2A 3JC66 3FDTA 3I4NB 3SGIA 3A7LA 2K5HA 2F4IA 1Y8PB 3J7ZC 2B63A 4KD3A 1IW7C 2IHFA 4X65H 1JX4A 3QWNA 3H3VH 4A3KG 5DQHA 1IBKQ 1FVIA 1H9RA 5C3WA 4RNOA 1Z2PX 4Q44A 5IYCG 5BN5A 4OX9H 1U5KA 1N36L 3BVGA 3Q6SA 3J81c 1IBML 3CVZA 3T1HQ 3KUPA 4KD4A 4GC7A 4KHPQ 1DOMA 4DR2Q 2F0FA 2SDFA 1R9TA 2Z4IA 1VQIA 4NDXA 4JI7L 3ZJYC 4GS3A 4FYDA 3NE5B 1K1SA 5IE8A 1GUWA 5CV4A 5EGTA 3CC4A 2RCFA 4ODGA 4PG3A 5C4JB 1Y1WH 2NYZD 4G57A 3PIO3 1H9SB 5JEAH 4DR4H 4QJFA 2RDIA 1I50A 3VPBA 1B53A 5CC4A 4QWEA 4EGQA 1B4OA 1ZHSA 4OONA 1E4EA 2UXCH 5IWAQ 5KFOA 3NBHA 4DR3L 4IPDA 1KJIA 3J81j 2YS6A 5J39A 1OWTA 4YY3L 2L12A 1I7NA 3DUZA 3MEFA 5KGUA 3D6CA 1E0BA 2JEGA 1EWCA 1WCMH 1A3VA 2WAQG 1K1QA 3KBGA 1DOLA 3S1RH 1G51A 1V8QA 4UCSA 1X3GA 5M3FB 1GUSA 5JOBA 4KTAA 1LM0A 5ELNA 5CA1F 2IMWP 3C2PA 1XWEA 2K5QA 4JBMA 2W9BB 3G6XA 4Q8FA 2VL6A 2FMCA 2W71A 3GV8B 1PRTF 4R8IA 4CBVA 1S0NA 2K5DA 4POFA 4DAPA 2B2VA 4BY7H 4HJ7A 4L6TB 3HKZA 1HNWL 4TV9F 4KN4C 4F4XA 4LJZC 2OEOA 2X0SA 2PZTA 3CAMA 1KRTA 1M0WA 5KG0A 3TQ1A 2NVXH 2MUYA 1SE3A 5A2QW 3KYHC 3D4RA 3K81C 4RHSA 5DG8A 4HEDA 1LO5D 1L2ZA 2AQ2B 3F8TA 2UUAL 1ASYA 4XYQA 4H13C 4LUZA 3S1QB 4UHVA 3BG5A 3H3VI 3GTGB 2D0PA 2Z6KC 2GVBA 2ZXOA 4Y52H 1JJ2A 2W9BA 2R93H 4B3RH 1VCIA 2R8KA 3DLLA 4ED8A 1A3UA 2KEDA 2CQOA 4DV7Q 1EQTA 3MR5A 4X62L 4R1JA 2WP8J 2K5VA 1E1OA 4C5CA 2BCOA 2JK8A 5FJ8H 2ZJPA 4ZUIA 4JV0A 4ECYA 2UVUA 3GLKA 1ONLA 1AP0A 3N40P 3FEWX 4RKLA 2FINB 3M3YH 3IFTA 1JWUD 5D1PA 3GTKH 3IG0A 2B63B 3NTHA 1G6ZA 5KFKA 1YHBA 4CKCA 4A3KH 3VYRA 1UNSA 2ATLA 4MV3A 2UXBL 2FHTA 1YNND 4K2KA 4DN4M 4RAZA 3I8ZA 2R85A 3MZ5A 3T5JA 1I50H 3K57A 4XDXA 1N48A 4RA8A 5DLGA 2XCPA 1ILQA 3K5HA 1ZXTA 1HZAA 5CMDA 1VDZA 4JI5Q 2FK3A 2IWHA 3AU7A 5J2UF 3K0XA 5C3EB 2VA3A 3P1HA 4R8NA 4FXGC 2MPMA 5KFZA 1HXYD 5FO8B 3I73A 4DK1A 1SLJA 3A5UA 2JQOA 3FMCA 1KXLA 2XRQD 4OL7A 1CKMA 1MIUA 2DJGC 2E2IH 2RHSB 4FO2A 3TZDA 2JYOA 3IFDA 5KT4A 4K8JA 3SI8A 5FLXW 4C3JB 4QUCA 4DAVA 1KDCA 2K75A 1N34L 4LF5Q 1VQJA 4DR4Q 2CZGA 2PNRC 4YAJB 3M7GA 3Q8PB 2NN6G 2B39A 2HCCA 3QB3A 2VQDA 3RB4A 4RNMA 4PZ7A 3TDQA 1K8MA 4KLKA 2B2UA 1Y69U 3MVVA 2R7KA 4AYBA 4O3PA 5JUMA 4APVA 5HBRB 1IBLL 1SDFA 4HCEA 2SOBA 5CV8A 3T1YL 2NVXA 1HZ9A 1PH2A 1WFQA 2H5XA 5FJ8G 4LF5H 3VYTA 1QZHA 4TRDA 4FU0A 3OSOA 3U58A 3RB3A 2EJFC 4LF9Q 3MFGA 1STNA 1HJPA 5IOCA 4R8UA 4MNOA 2E5LL 3D6WA 4KV6A 3Q8SB 5BR8Q 3OMGA 2JN4A 3I3CA 2YTYA 2YU9H 1QB5D 2EYHA 1SN8A 1PH8A 1RF2D 5T14A 2ZDHA 3RZOH 2DNEA 3OHAA 3KLRA 2Y0SA 5C4XG 2Z0SA 4JBWA 3K5MA 1VMCA 4LUOA 2UXBH 3OIPA 1Y1VB 3TQTA 1IYUA 4ZRZA 5LXTF 5DG7A 4J9SA 4DR3H 1O7YA 4C2MH 5D1OA 2F0MA 1BVSA 2NTTA 5GQOA 4IPHA 3U9TA 5GAEC 2R8HA 4GOPC 4FXDA 1EFWA 2UUBL 2BH8A 1TWFA 1XPUA 3QOLA 1SFOH 5EPKA 4ALPA 2VPSA 3H0GB 2XTIA 1LYLA 4RFBA 5IGDA 2NN6I 4JI1H 5DM63 3M85A 2F0LA 1E2ZA 3OUZA 1Q8KA 3GTGH 4GKJL 1NMGA 3OW7A 4RB3C 2R8JA 2PQAA 3FKIG 5FK9C 2F1MA 5KFRA 1TWAH 4LFAH 2JJQA 4LK1C 4B9WA 3J7A5 2IPKD 3K80C 2L5TA 4JPBW 5CV9A 1XNQQ 3MC0B 2MO0A 1X54A 1VQ4A 1K3RA 5J3BA 3OOCA 5LOVF 3CQZH 1TWGB 1STHA 3BYTB 2E2JH 2HIVA 1BOSA 4PZ8A 2OH2A 4CGYB 3IAYA 1HNXQ 1X32A 1HQRD 4MIUA 1PHJA 4B3TL 1PZID 3T1HL 1H9MA 4DAMA 4PDBA 1A3TA 2ICEC 3Q1KA 2A68C 3W2DA 1EY4A 1FJGQ 2J0TD 3PGZA 3ORQA 2V1CC 2UUAQ 4RCOA 3R23A 4CJ1B 4DV1L 2DPIA 1PH1A 3VR6A 4UP7A 2IX3A 1PYBA 3J81i 3RZDB 4JV5L 1ML0D 2JA7B 2IA6A 2RF4A 4XTCS 1JJGA 1BJTA 1XMOQ 1HTPA 4ZI7F 2KCNA 4AYBG 1STYA 4ZYSA 1VQAA 1KABA 2KOLA 3U4ZA 5KFIA 3BAAA 2FPGB 3T5HA 2NVQH 3L4JA 4GN5A 4C3HG 4OHJA 4A3GG 1VMPA 1PK8A 3KJPA 1RL2A 2WB1B 4DR7L 1JKJB 1BO0A 2I07B 1UUPA 3EVQA 1PH6A 3EJIA 3GP7A 4J9PA 3GTOA 1ZEQX 4GOPA 1SE8A 1WR2A 1JXLA 3J7AV 5DG9A 4IPGA 3M4OB 4A3IG 3KBXA 1NMFA 4EFEA 1QILA 4RAYA 3MEHA 4LF6Q 4DUZH 1CM9A 2R7ZB 2PI2A 1NTGA 2MFIA 1RTNA 2H1EA 5J1ZA 3VA5A 5FLMH 4IUVA 3VMMA 3RBEA 1XMQH 2JEFA 2MQHA 4XZ3B 4GKKH 3H91A 3PR5B 1RD9D 3PO2G 4KI0A 1I4GA 3VYSA 1NJIC 4KKUA 3GTGA 4A3FB 4JI5L 3GTMB 1PRTC 5KFGA 3QZ8A 2F0PA 2C22A 2AWOA 4JI0L 5KG7A 1EOTA 3SEBA 4HSPA 4A3FG 2B63H 3RZOB 1FL0A 4ECUA 3U9OA 2VB3X 5JVH3 4DV5Q 2SEBD 5C44H 4O1NA 3H09A 4QIWE 4GKKQ 4LH7A 1J6QA 1J9OA 1VF7A 2PMZE 2NUAB 2EY6A 4KHPL 4K0KQ 3CD6A 3S15H 5JAVA 4IN3A 2EJMA 1N8RC 5I47A 4YWLA 1BQQT 2HDMA 5C5MA 3VPDA 2B2WA 1SEIA 4KJNA 4RNNA 2UVRA 5C3EH 3PSIA 5LL6S 4JYAQ 5EWEA 1VQ6A 4HJ9A 5IYBH 1VQPA 4YR3A 1SXTA 5FKAC 3UE1A 3TINA 4YHHL 5LMUQ 1XPRA 5CYUA 4P74A 4HMIA 1HNZH 2D2CC 1I6UA 4HAEA 2I5HA 1A62A 1N56A 5CORA 3K3VA 3FPUB 3M4QA 4QIWB 5GONF 4DV6H 2E2JB 1EEID 3PW7A 4IJLA 2E2HB 5ELEA 2R93G 4OWXB 4FP5D 3S24A 4L1KA 1YJWA 1KNEA 4A3GH 4IRDA 2C35B 2JA7A 2C2RA 2XCLA 2OCEA 1NR4A 1U9RA 1SYEA 3NPPA 3M9NB 4LF6L 1I4PA 4RGMA 3C46A 2PZUA 4DUYH 3PO3B 3T56B 5LMNW 1JLLB 3R3OA 3V2TA 2UU9L 2ASBA 5LL6X 2CWAA 2DIKA 2TSSA 1QE6A 1O80A 3V05A 1WTPA 4A3MB 3RMHA 3W3AA 4A3CG 1GJXA 2MCTA 2WB1A 5KRUA 1E1TA 5K36H 4Y8VB 4LF7H 1RK5A 4H44C 4BS9A 1XDNA 4YCUA 1C7YA 2PNHA 4PMWA 3H40A 2BA0A 5KG4A 1STAA 4L63B 5KX5F 1KL9A 3MFHA 1B9MA 1G2SA 2K04A 4GN4B 3WWVA 2XWBB 4KHVA 3A8KE 4NP5A 3J7AF 2LFNA 5KFJA 1DOKA 2HHHQ 1BCPB 2ZTDA 5FO9B 2C00A 4LFBH 1HUMA 1R9TH 2XSCA 4A3DG 3TN2A 4QWAA 1STEA 1FNUA 2W9CB 3L0OA 3HOVG 3IL8A 3T53B 1XNQL 1AUVA 1HR0W 4IFDG 5IYDG 1SNCA 4CDFC 5HURA 5C44G 3RAQA 3GQBA 3OUUA 3PUXA 2VUMA 1FNWA 2CH4A 3T5LA 3TP7A 1CA6A 5KFXA 1BCPC 2RVLA 4ABNA 1CQFA 1WD0A 4L8JA 4J6HA 1DM0B 2K4KA 4U7CA 2FLLA 1HZBA 1Z47A 1EQVA 3KDFB 3DHQA 3PIOA 1X3EA 2OTLA 1K73C 4A4IA 2MGSA 4HCSA 3ERSX 1XMOH 3GIPA 1IBMH 2K52A 1PYSB 4YB8B 3BABA 1B50A 4PQXA 2W9AA 3HOVB 2V9WA 2LS01 3Q8DA 2W57A 2WYOA 1GM5A 1N32Q 1CQJB 1A9XA 1YEZA 2DLNA 4MTNA 2WACA 2JA7H 4A2AA 4UP8A 1JJCB 4EQ5A 3TIIA 1I4RA 1FKAH 1VQLA 4M7EA 1XNRL 1GSOA 3PVXA 1Y1VH 2AGOA 4N9TA 1I94Q 2F0QA 2QEXA 3MXPA 4ECXA 1AW7A 2VUMG 3M9BA 4RGNA 1LABA 3S14H 1EIGA 1EOVA 2F0JA 2RGVA 2ZDQA 1F2ZA 5C8YF 2FXQA 5D14A 4X3UA 2R7NA 5E7NA 3GTLH 3HOUH 3E5NA 1NBWA 2LSSA 1F2YA 1FYCA 1WI5A 5BN3A 1YITA 2X6GA 1A63A 5J2TF 3M7NA 2F4VH 1B8AA 4MTEA 3GIIA 1OXTA 4DV0H 3C1EA 3I55A 5BR8L 1PFBA 1DV2A 4MHEA 5IGBA 2KJXA 1BXTA 1S10A 4TUYF 1Q1BA 5M5YH 4Y7NB 2YRXA 3RV4A 4J0MA 2I80A 1NR2A 2N8NA 4L5RC 1YNJD 1V1PB 4O42A 4BBRB 2AU0A 3UDFA 4GNXB 1SNQA 4O2DA 2BE5C 4GKKL 4YR2A 3PO3H 1X55A 1E4GT 4EBEA 3GIMA 2R93B 4N9PA 3FKIA 4ZOLF 2M9VA 4GN3B 1VS0A 5FLXL 4LF8Q 3S2DB 1XYIA 4CJ2C 4I55F 1YNNC 3HG9A 1LTTD 3OW2A 4WBNF 4GOPB 2ZTEA 4BWGB 2ALZA 4EGJA 2CKZB 5KG2A 2HQLA 2N78A 1UAPA 2AQ3B 2XGTA 4MV4A 2AMCB 3GIDA 1CHPD 1JR0D 1RODA 1DXMA 1S5ED 3C1FA 4CC6A 3LWEA 4A3IH 4LF9H 2B2YC 4PMCA 1L1OA 3PF4A 1YVCA 1CSQA 2RQXA 3R2TA 5IT9W 3RBDA 1GHJA 1SYBA 1HNZQ 2KCCA 4L5SA 2WKDA 3KLSX 3M9OB 1DONA 1QOHA 4FF1A 3AFPA 2R84A 4P2CB 1R9TB 4E6IA 5CV6A 3BDOA 5IY0A 5A2QE 1Q82C 1EUCB 4YY3Q 1JDEA 4DK3C 1IZ6A 3OWEB 2F0HA 2XIGA 4CDDC 3J7AK 2Q8IB 4OWTB 4B3ML 1Q81C 4B3MQ 5H80A 4RMFA 3CCEA 2NU8B 2DY8A 4ECSA 3WO0A 3J81L 1SE2A 4RUAA 2E2IB 3GTPB 2HIXA 4QL5A 3T13A 3GV5B 4JI4H 4JUZA 1SRUA 4A93B 2JSOA 1UE7A 1Y8OB 4RUCA 4ED6A 5E4WC 1QUQB 2QA4A 3I7FA 2HD3A 2WINB 2R7ZH 2EZVA 1Y14B 4O3RA 2CQAA 4EGVA 2CH4W 3F1ZA 3EFXD 4DV1H 1RYRA 1B3QA 3EBEA 2A5HA 5KT3A 4XQNA 4TVAB 2CQYA 2W70A 5ELDA 5IGEA 2HCIA 2NZHA 4F50A 3G6YA 1SJHD 2B2UC 3RB6A 1SMYD 2F0OA 3I56A 4B3TQ 4JI7Q 5C5JA 2C5CA 3SXHA 3SR1A 1O7LA 1AFPA 4C2MA 2AQ4A 1E22A 2B8FA 1YJ9A 4IZOA 3P7JA 1Q90A 4DV1Q 1C30A 4RGTA 1MKHA 1WTHA 2EYMA 3MXGA 2F0IA 4POGA 5LP6F 4U68A 3Q24A 1TWFH 4A3LG 3RFCA 4XT1B 1RIPA 5T1IA 1PTOD 4L5QA 2FJZA 4JV5H 4JI1L 5C3EG 1TIID 2BR0A 4QWBA 2E2HA 3SK4A 4NXML 1N33H 4YIJA 1VQNA 3SVMA 5EPLA 4HJ8A 3N41B 2R7FA 3LNNA 2V4RA 1UWVA 3RIZA 4JI2L 1HUNA 1LTSD 1UE1A 2UUBH 5BMVF 1AN7A 2AQ1B 4B3SH 4O0AA 3PUZA 3CCVA 1SYDA 1HR0L 1W6KA 1DZ1A 4LFAQ 4IWXA 5C0XH 5JH7F 4RGOS 1I6VC 4Q5VA 4XXEA 1RHPA 2WAQB 4EX5A 1G2TA 3CQZA 3RV3A 2J6SA 3PR4A 2NVYB 2VQEQ 2BQ3A 4A75A 3KDFA 4ECZA 1ESFA 1SR3A 4WJWA 1XNRQ 5C1PA 4M1UB 2PCFB 4JG2A 1K8GA 1IBMQ 3ETJA 1EY0A 4IAJA 2XGPA 1VQ8A 4IWYA 4NLGA 5CA0F 1ZQ7A 1WTRA 4DA2A 1IBLH 1XX8A 3JAMi 4DL6A 3V6HA 4A3BH 4RB0A 1JC7A 4X64L 1BNCA 4MV6A 3PIPA 4Q45A 1PH7A 1MZBA 3N43B 1B44D 3UE0A 4IURA 1Y1WB 5K5PA 1L0YB 3NWSA 1KNAA 4LFCL 4G3IA 4AYBE 2UXBQ 3WOFA 1M6VA 4ECQA 1BR9A 3S1MH 4BBSH 3BQ1A 1IKLA 1F9SA 2FB9A 1ENCA 5KIXA 5CV7A 2PVPA 4GNXC 1JWSD 4G4KA 3T1YH 2Q2UA 1Q12A 5L9XA 1G91A 2B2VC 2YW2A 2HVQA 4NXMQ 2LKVA 5AJ3Q 3KALA 4EYHB 5I4DA 5L1LA 1IL8A 1MD2D 3PW0A 2RDJA 1S9FA 1T3NA 1YJNA 5C4XH 5KNBA 5ELCA 1K83B 1CFMA 3G6VA 1WSCA 2Q2TA 4UY8C 2CCZA 3IRBA 4EBCA 4MAMA 2J9GA 1O7ZA 3DWQA 3KF8B 3PN1A 4DXGA 2X6LA 1TS5A 4RZQA 3VPCA 1NY4A 4IQZA 5KG5A 2LXJA 2NZOA 4C3IH 4DR2H 2EPBA 3F2CA 4JV1A 2LY7A 2PW5A 2O5JC 2W6NA 2GVAA 4JI2H 1T5XD 2O03A 2QDLA 4HR7B 1RJRA 1AZPA 4DR5L 2AUJD 5KFYA 1SNOA 4LF4L 1MJEA 4MTDA 3A56A 4GKJQ 4IFDH 3PO2B 3F2UA 4ZUJA 3GIKA 1EYAA 3OIQA 2MHVA 4DFAA 4DR5H 1VQFA 1SYGA 2A1AA 2PMZA 4M9UA 2C28A 1ULZA 4KKSA 1WD1A 2EVBA 5L1KA 2RGRA 2IX1A 5DEHA 3GTQA 2CW8A 2K33A 1TWAA 4CDCC 1ZYRC 2IHEA 4WJ4A 3NELA 4F4ZA 1Q8IA 2G5DA 4HSVA 1S72A 2ATWA 4C5AA 1UEAB 4DV7H 2OWOA 3MFIA 3MFYA 1L2FA 1TWFB 2WTFA 2RDGA 3QZ7A 3TZUA 3LWUA 1C4QA 1XTDA 1WTVA 1RK6A 3ULPA 2EXZA 3R5HA 1FGBD 1KTKA 4KHZA 1MGSA 5KYLA 3DWPA 2K6AA 1FNVA 4FF4A 1JOOA 3MJFA 1MHWC 3CMEA 3J7YW 2R92H 2DPJA 4JI8L 4L5TA 5KT7A 3IKJA 1TAEA 3E0EA 4GNXA 3ULJA 3S16B 5EOYA 1KHIA 1D5MC 4YCVA 4A3BG 3M4IA 4IJHA 4OO1I 2A19A 3K5IA 2YZNA 2CW0C 4RAUC 1GHKA 5IT9L 4RU9A 1PTOH 5M3MH 1IBKL 2B2WC 4LSXA 5JVDF 4IRKA 4RZRA 3S2HH 2R6FA 1QVFA 2B63G 3HS0C 1HH2P 5I2XA 2R7LA 3K7AH 5BN4A 5BPFA 2YZMA 5KNCA 5IGCA 1WYDA 4ME6A 1KDBA 3WO1A 1EY8A 2N55A 3I2ZA 3BU2A 1OXXK 5EZYF 3QOJA 3EN2A 2X69A 4RB2C 2Z9HA 1S4ZA 5D1OB 3H3VC 4YQWA 4AQYH 1ICFB 4OX9L 1NE3A 2EIFA 4XQJA 3BA8A 3E0JA 4X64Q 1Y1VA 1JIHA 1EFID 1KLGD 4GZYC 1RDPD 2CHBD 5KFNA 1HR0H 4OIKA 4CC5A 1KJ9A 4IOAA 1STGA 1AZQA 1B2TA 1HFNA 1N34Q 4PV1C 3DEPA 2XD4A 3PMFA 5KFTA 3TEHB 2XGQA 3BS1A 4CJ0B 1J5EL 3NEMA 1R4PB 3S1RB 4FXKC 2XRSD 1HNZL 1YNXA 1DIKA 1CQVA 4DV5L 4DAYA 4IOCA 3GTQH 5FPOA 1EU3A 4JW0A 2E74C 4AYBB 2NVTB 1KEEA 2NUCA 3MA2B 1SAPA 3BG3A 2J6TA 1QUQA 3K8AA 4A3EG 3N42B 5F2DA 1J8IA 3HOXB 4NXNH 3K6OA 4X65L 1ET6A 1I3QH 1EZ1A 3HBLA 4BY7B 1N32L 2VOBA 1ESRA 2YZGA 4C2MB 5CGKA 1EUJA 2F0EA 1JT8A 1KJQA 3NK9A 4JCVE 3SK8A 1KJ8A 2L15A 4UAIA 1WVLA 1VKZA 2MO1A 1KDAA 4QUFA 2P5ZX 1I7LA 2VR1A 2Q8TA 1SFOB 4A3CH 1TXYA 2WAQE 2L1BA 5HGTA 4QW8A 1GSAA 2JXMB 2QCPX 3WNZA 1GSHA 4I50F 3JSLA 4DU9A 4J9NA 1PMRA 1AE3A 3I4MB 1B6RA 2EYJA 4LAAA 4JI2Q 1DD2A 5I2YA 1XMOL 1IHZA 3SK5A 3KAKA 2WE6A 3RB0A 1D2BA 4E4TA 1KBLA 1VBHA 4DV3H 2I0QA 1PH5A 3CCLA 3BZKA 1V4YA 4EFBA 3GV6A 3R5FA 3MAQA 3T5KA 3I90A 2W6PA 1PLFA 1DV1A 4ZAIA 1D5ZC 3JAML 4K0KL 2A73B 3CQZB 3CHBD 2ALYB 3EROA 5KFCA 4QQBX 5E3FA 3R93A 3GTKB 4C3JG 5CB4F 3DMUA 3GTOH 3ULLA 1W93A 3KOJA 2JA6H 2N3SA 4JI8Q 4PWQA 5LA6F 1TWCA 3M9MB 4I7ZC 1GXDC 4OEMB 1SNPA 4IALA 2MP1A 4QB4A 3RNUA 1CZWA 4EQNA 2ZXPA 1U4RA 5C0XI 1XPOA 3LWBA 1ZKOA 3EQLC 1Y1VG 1OXUA 3FKIB 1K8AC 1A6XA 2RDFA 4FM9A 5C4XB 4ZLTF 1CA5A 3FPPA 1QG7A 4XIGS 1GO3E 2OXPA 5KG3A 3VR2A 1ILPA 4J9KA 1PZKD 4KMUC 4EVOA 4ID6A 2DGYA 1LACA 1EY9A 4X3SA 3CP0A 1TY2A 2QK4A 3HOUB 1XNQH 4YY3H 1EZ6A 3NBHB 5F9NA 4DL7A 3TIGA 2PMZB 4KJOA 4ZK9B 3VDYA 1Z7TA 4U6PA 2HVSA 2B29A 3STBC 4JOIC 1C0AA 4JI6H 4R9WA 4HIKA 2IY5B 4KN7C 1Z2NX 3A74A 3QG1A 3PO2H 3SE7A 2FMMA 1PXUA 4QCLA 1PDQA 2N88A 4X66L 3TRZA 2R86A 5F9LA 5KNDA 4LF8L 2VUGA 2EYPA 1LTGD 5G3LD 1LT4D 3AYHB 3GTMH 1DCZA 1RYSA 5NUCA 4OO1G 4TQSA 3URYA 2VUMH 4LF9L 5KFPA 3K5OA 4Q43A 4DV6L 4X64H 1G6PA 1X56A 2Y0SE 3S1MB 4BBSB 2UXCL 1I6HB 2AGQA 2A6HC 1V9PA 4J9MA 5M5XH 5I6YA 2I8CA 1F9QA 5EAYA 5JJKA 3HOWG 2NN6H 4Q8EA 1I50B 2NZ1D 4X3TA 2IP4A 4QY7A 3PIP3 2NU9B 2W6MA 4DUYL 5C44B 4A3JG 1IKMA 5DQIA 4DV4H 1I3QB 2K01A 1ENAA 4XYOA 4DR4L 1A0IA 2K7VA 2Y0SG 3NSWA 5ELFA 2YV5A 4LUVA 2JEAI 2UU9Q 3BJYA 1YBYA 4ME5A 1HPCA 4DV2H 4MTKA 3T1YQ 2ASJA 1PRTB 3J81E 1I94L 1NCVA 2FP4B 1WH2A 1Q46A 1N9WA 2Q8RE 3EIVA 4YJ2F 4K6DA 2XN9C 1J5EQ 4HNVA 2DUDA 4MV7A 4EEYA 5KFLA 4F4WA 4AH6A 3PUWA 5I9OA 3MR3A 3BZDB 3S17B 1Z9FA 4JI4L 4OIJA 5EWFA 1T5EA 4B3SQ 1V51A 3NENA 3TREA 5KFDA 2K1BA 3GTPH 1PFNA 3TQYA 2D0OA 1UEBA 2VQFL 2JE6I 4CDEC 4GLVB 5DQGA 4IFDI 1SYCA 2A69C 4IUNA 2QILA 2XNAC 4YWKA 1VQ9A 4ZQ3A 2V5AA 2JA8H 5JPMC 1K9MC 2ID0A 2JA5B 2EY2A 4K5VA 2QDBA 4O3NA 2VY3A 3NQTA 1SMXA 4BXXG 2EY1A 2F03A 1OXVA 2WB1E 3QR8A 4B3RQ 2FLPA 2B2YA 2AUKA 2JA6B 1L0WA 4O4IF 4Q0YA 4YHHQ 5LMUL 1HQMC 2PZWA 1D8LA 1E2VA 1IBLQ 3X3MA 3JZIA 1KIXA 3A5ZB 3K5NA 3H4BA 1JICA 1MJCA 4DR5Q 1VQDA 3FKIH 3W5OA 2HJWA 4IR9A 1Y1WA 2F0SA 3RZDH 4A3LH 3H20A 4X66H 3GTMA 1BCPF 1U0LA 2B8GA 1Y8NB 5EKIA 3OTOQ 1A8VA 1HTLD 2O4XA 1WTWA 3KHRA 2ZT9C 3ETHA 2JA5A 1GUTA 4X62H 4R4OA 2MJ8A 3K58A 2RHQB 2KHSA 5JPNC 4NXMH 4LF7Q 2VZAA 3M4YA 5JEAG 1NAPA 2UVWA 3MHBA 1GOZA 1S0OA 4X3KA 4NMZA 5HV6A 3J80W 3GTJA 5IYDH 4R4IA 2Z6KA 3PW4A 3U9SA 3DM3A 3GILA 5I9PA 1GGOA 3JAMW 1TU2B 3CCRA 1B04A 5EJWA 3UDXA 1Q86C 3OYYA 4M8AA 4BBRG 1PRTD 3M4OH 2FKLA 2JA9A 1RTOA 1S5DD 3MWYW 1JCKB 1E7ZA 2AHOB 3W1BA 2W6QA 5A35A 2KBNA 2O5IC 5JJIA 1M7JA 1KRSA 2Z6BA 4B3TH 1EIYB 2NU6B 3FP9A 3LX0A 3RTXA 2F0DA 5FLXE 1AH9A 2I87A 1IL2A 4ETSA 3NQIA 3LMLA 2XC9A 3N44B 3MWDA 3MXNA 4A3BB 4BXXH 4LFBL 1VQEA 1OXSC 1WTQA 5T1GA 4DV4L 1TS4A 3UDGA 4YP3A 3V6JA 3AEVA 1HA6A 1NSNS 1UE6A 3BDCA 1S0MA 3HKZB 4UP9A 2PW7A 5IP7H 3RLFA 3ZYYX 3HP3A 3RN2A 3KLWA 2NWGA 1I4QA 5IWAH 1LT3D 4R4CA 1L0XB 3G7LA 1YHAA 4DV2Q 2RBMA 4IUPA 3S14B 4V190 4FS1A 3BJUA 5DNFA 1NUCA 3UDIA 1N33L 3UQ8A 3J80c 3O13A 3G8CA 1IXRA 1SEBD 4IUQA 1HA5A 2DWCA 3S1NB 2F4VQ 4JI1Q 1DYQA 3I4LA 2J7ZA 5JJLA 4WRDA 2UUCH 4QWCA 3I4NG 2KECA 5C6AA 4IR1A 5I6WA 5GROA 4RKBA 5GAGC 3GIQA 2A6ED 2K50A 1A2UA 3OWFA 3WDNA 3HKZG 3FMAA 1JOQA 2O2LD 3FVQA 1E4EB 1ENFA 2F0GA 2K05A 2A8VA 2JA7G 3HB9A 3PW2A 1WTOA 1A2TA 3HOZB 1HNXH 2DNCA 2SCUB 1EY5A 2BH2A 2VQFQ 5KFEA 2W7OA 1LTBD 3TS2A 2F0UA 5KFHA 4G7OC 1YNJC 5C3XA 1TY0A 1HFGA 2I46A 3HOYB 2C2EA 3CCQA 2WKCA 1E3PA 1JWMD 3CU7A 1GYFA 4C3HB 3H6MA 4RH6A 5IWAL 1TWHB 3H0GG 1EZ8A 2FPPB 2R7DA 4J9RA 1W2BA 2F0NA 1ZHQA 4BBSG 1CS0A 1EQRA 5E4XA 1M90C 3NTKA 4DR2L 3GV7B 4K5XA 3ND9A 2UUCL 4DUYQ 4DL4A 4MZ9A 5G3LF 2HUGA 4IUTA 4MV8A 2R93A 3C3LA 4ECVA 4HIDA 3RJ0A 3D4WA 4JI3H 3OTOH 2XIWA 2PQEA 1V1PA 3VA7A 4HJ5A 1YHQA 4K2LA 3H4DA 2KUMA 1WTXA 3OHXC 2K32A 3S16H 4ECTA 3ORRA 4NB3A 3MXUA 4XX0B 5EDWA 2KENA 1CT1D 1BBUA 4LF6H 1SBBB 2KA7A 5LHY1 3GD7A 4I65A 5C1OA 3BYYB 5K36G 1E4FT 2VA2A 1FJGL 3S2HB 1EYCA 1X65A 5IYCH 1K0RA 2ZM6Q 4ED3A 4IUUA 2EOTA 4JYAL 4XYLB 5KFBA 2E2HH 3QO2A 2RDHA 3RLNA 2F3VA 1PH3A 2R7ZG 1BKBA 1SSOA 3UFXB 4U673 3CRLC 3P20A 4CKEA 1O75A 3D31A 1S5BD 4HIMA 2RKSA 4DUZQ 1QWYA 4K5WA 3K3PA 4JBJA 2D5DA 1LT6D 4F7XA 4DV3L 1Y1WG 2YCHA 3CCJA 1JQYD 1GD7A 2G9DA 4JOIA 1WCMB 1H9JA 1PZJD 5COYA 2W9CA 4IO9A 5JEAJ 3GTJH 3HOVH 5IGFA 2F0KA 3KF8A 1CSPA 5DLQE 4EG0A 4DL5A 4K0KH 1U4PA 4C1NK 1SMYC 2B2TC 1ZYRD 4NPSA 3I4OA 2E75C 2ZJRA 4A3MH 3E6ZX 4TQUS 4J8QA 1C8CA 4I7HA 2JEBI 2KCMA 5JJZA 1RJPA 4X65Q 5KFSA 4DR7H 1T36A 1V1QA 2V4DA 3AFQA 1EHIA 4ED0A 2OF1A 4KY5A 1TQOA 2NVTH 2R92G 2PQAB 3A55A 3HOZG 4NXNL 3F2DA 4O2AF 4R7RA 1EIFA 5EKKA 3R8BA 2EYLA 4RG1A 2HDLA 2F0TA 3GTLB 3K7UC 4DUZL 4A3DH 3RAXA 1BDOA 1JOKA 4ED2A 4AQYQ 4BY1G 4YAKB 3H0GH 3H94A 1G291 1AEXA 2QKIC 3PQIA 3SDZA 4YBZB 4J15A 5CR3A 5L37A 3AB9A 3U50C 3S1QH 4UCTA 3KHGA 3S17H 1PA6A 2ZXRA 2AWNA 3K5LA 2NVXB 1VBGA 3JRWA 3JAMc 2R7MA 3HKZE 1MSGA 5L1IA 3VR3A 3HOYH 4RB1A 4GLXA 2W8LA 5JVG3 4DF7A 4LWCA 3E3XA 4P75A 5A2QL 1BNZA 4ZQIA 1F9RA 2R8IA 2BQRA 2UUAH 4C3HH 4CHTB 4JV2A 4DV5H 1W96A 3CPWA 4UPAA 1UC9A 1PFMA 1STBA 2A6EC 2YRWA 1F77A 2BA1A 3BQ0A 3CKIB 1TWCH 5EKLA 5JVLA 1HZCA 4JI8H 3ONAB 1HNWQ 3HKSA 2MNAA 4GKJH 1SFOA 4OELB 1VQHA 3MWEA 2Z1CA 5C0XG 5D8DA 2E5LQ 1RJQA 2CW7A 2FPIB 1VAJA 3D0FA 2NB0A 1N33Q 1X3FA 1EEFD 2UUCQ 4YCWA 3OSPA 2HGSA 2K28A 5FD6A 4F87A 3GO5A 4HIOA 2I5LX 3U4VA 1VQMA 4YJ3F 4DR6H 1WJJA 2DZDA 1LV9A 2IT1A 5DM73 1CTMA 2E76C 3G48A 1UE5A 2F0VA 2NBFA 3GQCA 1X9NA 3RGXA 4N8X1 5ELBA 2K5NA 1YZ6A 2YTVA 4DR6L 4X66Q 2KSWA 5M9OA 3A0JA 1B3AA 1A15A 4C3JH 2Z4HA 1X6OA 4N8FA 3P75A 4WFN3 2R87A 4LMYA 4LF5L 4H7BA 4LMQD 1E24A 5GADC 4BY1B 4XT3B 5D3IB 4UFZA 1DJRD 3PCOB 4DV2L 2R6GA 4KY6A 4JK1C 3PUYA 1K3BC 1JB3A 3I72A 5H1SE 3CC7A 3GTKA 5IP9H 1TWGA 5EBCA 4C3IB 2NTSA 4Y7NH 1OO9B 4LFAL 1ZETA 3EYYA 2JP1A 3MTSA 2EQSA 2RSNA 1Q3LA 4JI6L 3HOZH 4JI7H 3JRXA 1D7QA 5FPRA 5FD5A 3CCUA 3QJYA 1P16A 3GV3A 2ENBA 4F8MA 5DGAA 5DGBA 1IBKH 2ICIA 1SYFA 2FK1A 4DV7L 3RLOA 1PVOA 3HOXG 5IYBG 3F2BA 3S2DH 5KG1A 3T1HH 1PH9A 4KHPH 4QMGA 4C3IG 2J4XA 5LMNH 1WCMG 2E2IA 4P71A 2K14A 1TR5A 1IOWA 5KFUA 5IT9c 4DV0L 1M0TA 4DL3A 5KFVA 4JI3Q 3B6YA 1BBXC 3Q23A 1IOVA 1C9OA 3J80L 2Q2HA 3G6EA 1II3A 5IYZF 4H02A 5M5XB 2YYAA 1QCBD 2R61A 1AE2A 1RJTA 2EXDA 3FHWA 2YU9B 3LP8A 1KAAA 2XCAA 2JA5G 2RSOA 3RF2A 1N32H 4C56C 3HOYG 4UCVA 3K59A 2C2DA 2F3IA 1XXGA 4BY7G 2VQEH 1DGSA 2YL2A 1AN8A 3S1NH 1XNRH 5J22A 2ZM6H 2PPBC 3IN5A 3ERQA 2AKWB 3NTIA 4HJAA 3RN5A 3L3OC 4I7AA 2LMCB 5ISRA 4GC6A 5LYJF 3OHBA 3HGBA 4C1NI 4FBUA 4J1MA 4RWSC 1F9PA 1JMCA 1IYVA 4O4HF 4BWSC 2I5MX 2IL8A 3FRPB 1ICWA 5IP9G 2V4QA 4IRCA 1GVPA 2QEJC 1BCPD 4F4YA 4JI0Q 3RGZA 3HOWH 5CAEB 2SNMA 2JA8G 2ASLA 2UVVA 4I4TF 5LMUH 3J80i 2KHJA 4KKTA 3TSSA 3K7AB 1YIJA 1XTCD 3Q2OA 4A3JH 4EYIB 1I3QA 3I91A 3D8GA 5FOBB 1JORA 1HNWH 1TKWB 3UI2A 3HXLA 3I12A 2KHIA 1JE4A 5IT9E 1TWGH 3Q22A 4O3SA 1JB7A 2FE3A 2CVRA 4FF2A 4OO1H 4TKOB 2D9UA 5K2MA 5KFAA 1BXRA 4BA1I 3KHLA 1B6SA 1M1KC 1HR0Q 1EL0A 3N6XA 4DPGA 2JEIA 4EQOA 1B70B 3OSNA 2VW9A 4LSAA 5KG6A 3E5SA 1EYGA 2M2LA 2W7PA 1I4XA 4OGQC 4LFCH 1D6EC 5KT2A 3J81W 3A54A 5IIFA 4Q0FA 4A3EH 2BQUA 1MSHA 3DWAA 4QF4A 5M3FG 1VQOA 1TVXA 1BUVT 3DM1A 4J9OA 3SE0A 4WJ3M 3NP8A 5D65A 1E2WA 5LMNL 1VQKA 1RKNA 4DXFA 5C4ZA 4B3RL 3KLSA 2F52A 3V4SA 4QWDA 2GA4B 1SNMA 4MV1A 3HOXH 4PNYA 2NVQB 2EDGA 4LFCQ 2HT1A 3R5XA 3HOUG 1TWHA 1N36Q 3PW5A 3GIJA 1CHQD 2EYOA 4A93G 4DR1Q 1LTLA 1KC8C 3OPOA 2NVYH 3WOEA 1K28A 3H15A 1XMQQ 5KT5A 1V1OA 4TQRA 4MV9A 2OTJA 4QW9A 2R92A 4JI4Q 1SE4A 2WFWA 2UXDQ 1M4VA 3G71A 1K0SA 4J9LA 2A69D 1FJGH 4AQYL 3I4MH 1Z2OX 1QZGA 1O78A 2BDNA 4IPCA 1N36H 1PFSA 1B33N 4DNIA 1W3SA 3TMEA 3PO3G 3N8DA 2YU9A 1F2LA 5ELOA 1G8ZD 4ECRA 3MWMA 4A3KB 2OLSA 1S5FD 3A7AB 4P72A 4B3SL 2LXKA 2A74C 5CBAE 3GTJB 1CE8A 4UCUA 4A3FH 4HR7A 1U4MA 4G7HC 3S15B 3NBIA 3PV0A 3KXYT 5L1JA 2WIIB 3C0FB 4V0BA 2KVMA 1NNXA 2QW7A 2IW3A 1W6JA 2CW0D 3PUVA 2GPSA 5KFWA 2KQ3A 4B3MH 1OTCA 5M5WH 2BOSA 3V4ZA 3J80E 3VYUA 1K83H 2WV6D 3PF5A 2UUBQ 1D1IA 3X3NA 1CZGA 3I70A 3T16A 3JAME 2KEEA 2F0WA 2L4NA 4IHJF 3I4NH 4UCOA 4K6LA 1T94A 1L1OC 1LLRD 5FO7B 4JV5Q 4DGZA 4HQ6A 4JBKA 1VQBA 1MBYA 3Q0AA 1D1KA 5HGQA 4DR7Q 4MA0A 1KAWA 1WCMA 1LT5D 3M4PA 4HTHA 2QF7A 3HOWB 1F2MA 5EQ0A 3T4AC 2UXCQ 4J9QA 3L9AX 2G9HD 4B08A 3L4KA 4TV8F 5M5YB 3MR2A 2IX0A 5IP7G 1S40A 1HCZA 4QGUA 4LF7L 3TP6A 1P8LA 1L1OB 4O3QA 2ASDA 2IJ0A 3BVMA 4DK6C 3DEOA 4PZ6A 5C4JH 5LMNQ 1YI2A 3CC2A 2Y0SB 4IFDJ 2TMPA 2D62A 1FR3A 1SCUB 2FMAA 4WORA 2WB1G 2F4VL 4YWMA 2WAQA 5GAHC 1TWCB 4A3GB 1PX2A 4LF4H 3GDEA 4PMBA 2NVYA 4FDBA 5M3MG 3PZPA 2A68D 2CWPA 1CKNB 2FLNA 2W6OA 4JYAH 4CKBA 2Z8LA 4C5BA 1H95A 2F3WA 4JC0A 1Z6HA 4KY7A 4F88A 4UDUC 2ZJQA 3H0GA 3Q8QB 2N49A 1SNDA 3A8IE 2BE5D 4HYKA 5KKNB 1JDBB 4K8IA 4A3IB 3NUCA 2CFMA 2DJFC 3OMCA 1PTOC 1T9HA 4ZHQF 1KC7A 4UCRA 4G7ZC 2R92B 1V43A 4H0LC 3G4SA 1N34H 1MI2A 5EBDA 4RCNA 4LFBQ 4X6AH 3CXCA 3NXWA 2L0CA 4FS2A 4K14A 1GKHA 4ZKBB 2OQKA 1B9NA 4MN3A 2VXWA 3BVZA 1EIHA 1HRJA 5DLFA 1S68A 3HFZB 4DR3Q 1EYDA 1AUXA 1PTOB 1GLVA 3BQ2A 2JA6A 1VF5C 1CKOA 2HHHH 2Q2IA 5CV5A 4HN7A 1TWAB 4FVMA 4O2BF 1H9SA 1FGUA 3R2IA 2FFKB 3QIAA 4LNQA 2L9HA 4XQQA 2P0AA 3V6KA 3FDSA 2JA5H 4DR1H 4DV0Q 1QNKA 1LTRD 2UXDL 1U4LA 3D4DA 4FF3A 2FK2A 2R3ZA 1X3PA 3DF7A 4A3JB 2WDTA 4DNTB 1K8OA 2GPWA 4DNRB 2PYKA 4ED7A 1CUKA 1FD7D 4ULLA 5HY6A 3S9WA 3LGJA 2VNUD 2ZDGA 2EJGC 2EY5A 1CQIB 2W6ZA 2C9OA 3BZCA 1S3OA 4OWWB 4BA2I 4JI5H 3D3RA 2BDOA 1QVGA 2ES2A 3TP8A 3DXJC 3N6RA 5IGGA 1XJVA 1HNXL 3GTOB 1Q1EA 1D5XC 4JI3L 1EUDB 1WOCA 2NU7B 1LTID 2FJ2A 2YYZA 4A3MG 3RR5A 5KEEA 4TSSA 5D3DA 4AIMA 3CCMA 1B1ZA 3SHLA 3CMAA 1BGWA 3GTQB 2UU9H
chains in the Genus database with same CATH topology
2E2HH 3CPFA 2PI2A 3RLNA 1NTGA 2MFIA 2OQ0A 3CMEA 3CCSA 1BKBA 5FLMH 1PH3A 2R92H 2R7ZG 4JI8L 4L5TA 2MQHA 3D31A 4HIMA 3E0EA 4GNXA 3ULJA 3PO2G 4KI0A 4DUZQ 1NJIC 4JBJA 3TS0A 1PH4A 1KHIA 4DV3L 4YCVA 1Y1WG 4JI6Q 3CCJA 4A3BG 4DR6Q 1B7YB 4JI5L 4IJHA 1GD7A 1VQGA 2A19A 4OO1I 4JOIA 2AWOA 4IO9A 5JEAJ 3GTJH 4JI0L 3KF6B 2E8GA 3HOVH 5M3MH 1CKNA 2B63H 4A3FG 1IBKL 3E9HA 1FL0A 1CSPA 5DLQE 3S2HH 1QVFA 4DV5Q 5C44H 2B63G 1HH2P 4QIWE 3K7AH 4NPSA 3I4OA 4BBRH 3L2PA 3E9IA 4P73A 2ZJRA 4TQUS 4A3MH 4GKKQ 1WYDA 1J6QA 2JEBI 2KCMA 2PMZE 3AQQA 4KHPL 3I2ZA 1BBWA 4K0KQ 3CD6A 3BU2A 1OXXK 4X65Q 1N8RC 3S15H 3EN2A 4YWLA 1V1QA 4R4QA 3AFQA 5C3EH 3PSIA 4OX9L 2NVTH 1NE3A 2EIFA 4JYAQ 5FLMG 1VQ6A 2R92G 2PQAB 2ZTCA 5IYBH 4X64Q 4HJ9A 1VQPA 3ER0A 4NXNL 3HOZG 4DAYB 3F2DA 1EIFA 4RG1A 3UE1A 4YHHL 5LMUQ 1XPRA 4IOAA 3K7UC 3CF5A 4DUZL 4A3DH 2VS1A 1VQCA 4DV6Q 1N34Q 4P74A 4AQYQ 4BY1G 2JA6G 3H0GH 1G291 4DV3Q 4A76A 3TEHB 4J15A 4LW1A 3U50C 1J5EL 3S1QH 3NEMA 2PI2E 4R4TA 1I5FA 2I5HA 1PA6A 3S17H 1A62A 2AWNA 1HNZL 5FLXc 1YNXA 3JAMc 4DV5L 4IOCA 3HKZE 3M4QA 3GTQH 3HOYH 4GLXA 4IJLA 4LWCA 4P75A 5AJ3L 2R93G 4OWXB 1QUQA 3K8AA 4A3EG 3S24A 4C3HH 1KQSA 5M3FH 1YJWA 3I4MG 4A3GH 3CPWA 4UPAA 2C35B 2HHHL 1EQQA 4X65L 2GN5A 2KCTA 2YTXA 1I3QH 2BA1A 2OCEA 1N32L 1TWCH 1HZCA 4LF6L 1HNWQ 1Q7YC 3HKSA 1EUJA 5LMNW 2MNAA 4NXNQ 1JT8A 4JCVE 1VQHA 4DV4Q 2L15A 2UU9L 2ASBA 5C0XG 1KD1C 2MO1A 2CWAA 2ZM6L 2E5LQ 4BY1H 4A3CH 1TXYA 2WAQE 3D0FA 3KFUA 3L7ZC 1N33Q 1X3FA 4A3CG 2UUCQ 4LF4Q 4YCWA 1E1TA 1AE3A 3GO5A 4HIOA 2I5LX 2B3GA 4JI2Q 1EWIA 3U4VA 1VQMA 1XMOL 4A93H 1VQ5A 3STBD 4YCUA 1C7YA 1WJJA 1SROA 2PNHA 4PMWA 2IY5B 2I0QA 2IT1A 4OXPA 1QVCA 2BA0A 4ME3A 3BZKA 3CW2C 4DKAC 1PH5A 3G48A 3CCLA 1ASZA 1UE5A 1VQ7A 2QGQA 1KL9A 1X9NA 4GN4B 3WWVA 4DR6L 1IYJB 2K5NA 1YZ6A 2YTVA 1PV4A 4X66Q 4K0KL 3A0JA 2HHHQ 4C3JH 1X6OA 1O7IA 2ALYB 2ZTDA 4LF5L 4QQBX 1R9TH 5GADC 1E24A 3PCOB 4DV2L 3GTOH 4X62Q 3ULLA 4A3DG 2R6GA 3KF6A 3KOJA 1I6HH 3KJOA 3L0OA 3PUYA 2N3SA 3W1GA 5H1SE 1XMQL 3CC7A 1TWHH 5IP9H 1XNQL 1JE5A 4GLAC 4JI8Q 5IYDG 2VQEL 5C0XJ 4DR1L 1HR0W 3RNUA 4IFDG 2RCNA 3ICEA 4Y7NH 5C44G 3MXNB 4LFAL 5C0XI 1XPOA 3PUXA 1Y1VG 1OXUA 1K8AC 2EQSA 4JI6L 3HOZH 1D7QA 3OTOL 4OX9Q 3CCUA 1LUZA 1P16A 2K4KA 1HZBA 1Z47A 4DV7L 3KDFB 4XIGS 3RLOA 1GO3E 3PIOA 1PVOA 3JC66 1X3EA 5IYBG 3HOXG 3F2BA 1K73C 3SGIA 2OTLA 4A4IA 1PH9A 3S2DH 2K5HA 3ERSX 3J7ZC 2K52A 1PYSB 2IHFA 3H3VH 2DGYA 4A3KG 1IBKQ 1FVIA 1WCMG 3CP0A 5IYCG 4P71A 2K14A 3Q8DA 1U5KA 1N36L 5IT9c 4DV0L 3NBHB 1GM5A 3J81c 1N32Q 4JI3Q 1IBML 3VDYA 3B6YA 3T1HQ 1YEZA 1C9OA 2Q2HA 4MTNA 3G6EA 2B29A 2JA7H 4H02A 4UP8A 3STBC 4JOIC 4DR2Q 1JJCB 3FHWA 4KHPQ 1AE2A 1VQIA 2EXDA 4EQ5A 3ZJYC 4GS3A 3A74A 4HIKA 1VQLA 4JI7L 2JA5G 3PO2H 5IE8A 1XNRL 3CC4A 4PG3A 1Y1VH 4X66L 3HOYG 3TRZA 1Y1WH 4LF8L 1I94Q 2F3IA 2QEXA 4QJFA 3AYHB 3GTMH 4BY7G 2VUMG 3M9BA 1DGSA 3S14H 1EOVA 4OONA 4OO1G 3S1NH 5IWAQ 2FXQA 2VUMH 4DR3L 4LF9L 5E7NA 2AKWB 3GTLH 3HOUH 4IPDA 4DV6L 4HJAA 3J81j 3RN5A 1NBWA 2LSSA 1G6PA 1YITA 1WI5A 1X56A 1A63A 2Y0SE 3M7NA 2UXCL 1B8AA 4YY3L 1OXTA 3I55A 1V9PA 3MEFA 5BR8L 5M5XH 1JMCA 1WCMH 5EAYA 2WAQG 2I5MX 5JJKA 3HOWG 5IP9G 3S1RH 1Q1BA 5M5YH 1G51A 1GVPA 4QY7A 1X3GA 4JI0Q 3HOWH 2JA8G 4DUYL 2N8NA 4A3JG 4L5RC 3J80i 2KHJA 1LM0A 5ELNA 1YIJA 3UDFA 4GNXB 4JBMA 4A3JH 4DR4L 1A0IA 2VL6A 1C0AA 4O2DA 4GKKL 2Y0SG 2JEAI 1X55A 2YV5A 4LUVA 3PO3H 2UU9Q 4POFA 1YBYA 4GN3B 3T1YQ 1VS0A 1I94L 4BY7H 4LF8Q 2KHIA 4HJ7A 1Q46A 1TWGH 3OW2A 1JB7A 1HNWL 1N9WA 4GOPB 2ZTEA 3EIVA 3CAMA 1KRTA 1J5EQ 2DUDA 4BA1I 1M1KC 2CKZB 2HQLA 1HR0Q 4AH6A 2N78A 3PUWA 2NVXH 2XGTA 3KYHC 2AMCB 4DPGA 3K81C 1B70B 1Z9FA 4JI4L 2VW9A 4B3SQ 3F8TA 1EYGA 4A3IH 3NENA 3TREA 2UUAL 3GTPH 1ASYA 3TQYA 2D0OA 1UEBA 2VQFL 1L1OA 2JE6I 1YVCA 4LUZA 3PF4A 1CSQA 4GLVB 3H3VI 2D0PA 2Z6KC 2GVBA 1HNZQ 4YWKA 1JJ2A 1VQ9A 4L5SA 4IFDI 2R93H 4Y52H 2JA8H 1VCIA 4A3EH 3DLLA 1K9MC 5M3FG 3AFPA 1VQOA 2CQOA 2ID0A 4DV7Q 4X62L 4R1JA 2WP8J 4WJ3M 2K5VA 1E1OA 5IY0A 2VY3A 5LMNL 1Q82C 1VQKA 1SMXA 2JK8A 5FJ8H 4YY3Q 2ZJPA 1OXVA 2WB1E 4DK3C 4BXXG 4B3RQ 1IZ6A 4B3RL 2F52A 1L0WA 4OWTB 4YHHQ 3HOXH 5LMUL 1Q81C 4B3ML 4B3MQ 3M3YH 1D8LA 4RMFA 3CCEA 1IBLQ 4LFCQ 2HT1A 1KIXA 3A5ZB 3GTKH 3HOUG 1N36Q 1YHBA 1MJCA 4DR5Q 4A3KH 2HIXA 1VQDA 4QL5A 3FKIH 4A93G 4DR1Q 1SRUA 2UXBL 1LTLA 3W5OA 1KC8C 2NVYH 3RZDH 4A3LH 1UE7A 3H15A 1XMQQ 1I50H 2OTJA 1U0LA 1QUQB 2QA4A 3I7FA 4JI4Q 1HZAA 3OTOQ 2WFWA 4JI5Q 2R7ZH 3G71A 2UXDQ 1Y14B 1A8VA 3K0XA 4AQYL 3I4MH 3F1ZA 4R4OA 1QZGA 2RHQB 4IPCA 1PFSA 4LF7Q 2VZAA 4DNIA 1W3SA 3EBEA 5JEAG 1SLJA 3A5UA 3PO3G 2JQOA 5ELOA 1KXLA 1CKMA 1MIUA 4TVAB 2E2IH 2RHSB 2NZHA 5IYDH 4R4IA 2Z6KA 4P72A 4B3SL 2LXKA 3DM3A 3I56A 4JI7Q 4A3FH 4B3TQ 3CCRA 3UDXA 1Q86C 3OYYA 3PV0A 1E22A 2K75A 4BBRG 1YJ9A 3M4OH 1N34L 4DV1Q 4LF5Q 1VQJA 4DR4Q 2JA9A 1MKHA 3PUVA 4POGA 2NN6G 1TWFH 4A3LG 1E7ZA 2AHOB 3W1BA 4PZ7A 1RIPA 5M5WH 2KBNA 4KLKA 1OTCA 5JJIA 1KRSA 4L5QA 1K83H 3PF5A 1EIYB 2UUBQ 4APVA 3FP9A 4JI1L 5C3EG 4NXML 1VQNA 1IBLL 3T1YL 1AH9A 4HJ8A 1HZ9A 1IL2A 2R7FA 1PH2A 3I4NH 1UWVA 4JI2L 1WFQA 2H5XA 1L1OC 1UE1A 4JV5Q 5FJ8G 4BXXH 4LFBL 1VQEA 1OXSC 1QZHA 4JBKA 4O0AA 1VQBA 4DV4L 3U58A 3UDGA 3PUZA 4LF9Q 3CCVA 5HGQA 1HJPA 1HR0L 1KAWA 4LFAQ 4DR7Q 4MNOA 2E5LL 3AEVA 3M4PA 5BR8Q 4EX5A 2YTYA 1UE6A 2YU9H 2UXCQ 4UP9A 5IP7H 3RLFA 1SN8A 2VQEQ 3RN2A 1PH8A 4A75A 3KDFA 3RZOH 3KLWA 1SR3A 1XNRQ 2IX0A 5IP7G 4R4CA 1S40A 5C4XG 4QGUA 4LF7L 2Z0SA 4JBWA 4JG2A 1K8GA 1P8LA 1L1OB 1YHAA 4DV2Q 4LUOA 1IBMQ 1VQ8A 4DK6C 3CC2A 5LMNQ 4PZ6A 5C4JH 1YI2A 3BJUA 3UDIA 4IFDJ 1N33L 4C2MH 3J80c 2D62A 1IXRA 3JAMi 1BVSA 4A3BH 5GQOA 4IPHA 4X64L 5GAEC 3PIPA 2WB1G 2F4VQ 2F4VL 4YWMA 4GOPC 1PH7A 4JI1Q 3UE0A 1EFWA 2UUBL 2BH8A 5GAHC 5JJLA 1XPUA 3GDEA 4FDBA 5M3MG 4LFCL 1SFOH 3I4NG 4AYBE 2UXBQ 2CWPA 4ALPA 1CKNB 2XTIA 1LYLA 3S1MH 4BBSH 5GROA 2NN6I 5GAGC 3M85A 1H95A 2K50A 4JC0A 2ZJQA 4GNXC 1Q8KA 3HKZG 2N49A 1NMGA 2Q2UA 1Q12A 3GTGH 4GKJL 2PQAA 3FKIG 2A8VA 4NXMQ 5AJ3Q 1TWAH 2CFMA 2JA7G 2JJQA 3J7A5 3K80C 1T9HA 1XNQQ 2MO0A 1V43A 1X54A 5C4XH 3G4SA 2VQFQ 1K3RA 1VQ4A 5J3BA 1YJNA 2BH2A 3TS2A 3CQZH 2Q2TA 4UY8C 4LFBQ 2CCZA 4X6AH 3IRBA 3CXCA 2E2JH 2HIVA 4PZ8A 3CCQA 1E3PA 3KF8B 1GKHA 1HNXQ 2OQKA 4B3TL 1PHJA 3T1HL 5IWAL 3HFZB 3H0GG 4DAMA 4DR3Q 1NY4A 2LXJA 2NZOA 2R7DA 4C3IH 3F2CA 1W2BA 1CKOA 1FJGQ 3PGZA 2GVAA 2Q2IA 4BBSG 2V1CC 1EQRA 2UUAQ 4DV1L 1PH1A 4DR5L 1FGUA 1M90C 4DR2L 4UP7A 4JV5L 1PYBA 3J81i 2UUCL 4LF4L 1MJEA 4LNQA 2RF4A 4XTCS 1JJGA 4GKJQ 1XMOQ 2JA5H 4DV0Q 2UXDL 4DUYQ 4AYBG 4MZ9A 1VQAA 1VQFA 2A1AA 3U4ZA 4HIDA 2IX1A 1CUKA 2NVQH 5HY6A 3LGJA 2VNUD 4GN5A 2IHEA 4HJ5A 1YHQA 4WJ4A 4A3GG 3BZCA 1S3OA 3NELA 4OWWB 4BA2I 3KJPA 3S16H 2ATWA 1S72A 2ES2A 1RL2A 4NB3A 1QVGA 4DR7L 1XJVA 1HNXL 2KENA 1Q1EA 4JI3L 2OWOA 3HOVG 1WOCA 1PH6A 1BBUA 2YYZA 4A3MG 3RR5A 1L2FA 3GD7A 1XTDA 1SE8A 4GOPA 5K36G 4AIMA 3CCMA 3ULPA 4IPGA 3CMAA 1FJGL 4A3IG 1X65A 1NMFA 1K0RA 5IYCH 2ZM6Q 4KHZA 2JA6H 4JYAL 4LF6Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H H;  3CPF A;  2PI2 A;  3RLN A;  1NTG A;  2MFI A;  2OQ0 A;  3CME A;  3CCS A;  1BKB A;  5FLM H;  1PH3 A;  2R92 H;  2R7Z G;  4JI8 L;  4L5T A;  2MQH A;  3D31 A;  4HIM A;  3E0E A;  4GNX A;  3ULJ A;  3PO2 G;  4KI0 A;  4DUZ Q;  1NJI C;  4JBJ A;  3TS0 A;  1PH4 A;  1KHI A;  4DV3 L;  4YCV A;  1Y1W G;  4JI6 Q;  3CCJ A;  4A3B G;  4DR6 Q;  1B7Y B;  4JI5 L;  4IJH A;  1GD7 A;  1VQG A;  2A19 A;  4OO1 I;  4JOI A;  2AWO A;  4IO9 A;  5JEA J;  3GTJ H;  4JI0 L;  3KF6 B;  2E8G A;  3HOV H;  5M3M H;  1CKN A;  2B63 H;  4A3F G;  1IBK L;  3E9H A;  1FL0 A;  1CSP A;  5DLQ E;  3S2H H;  1QVF A;  4DV5 Q;  5C44 H;  2B63 G;  1HH2 P;  4QIW E;  3K7A H;  4NPS A;  3I4O A;  4BBR H;  3L2P A;  3E9I A;  4P73 A;  2ZJR A;  4TQU S;  4A3M H;  4GKK Q;  1WYD A;  1J6Q A;  2JEB I;  2KCM A;  2PMZ E;  3AQQ A;  4KHP L;  3I2Z A;  1BBW A;  4K0K Q;  3CD6 A;  3BU2 A;  1OXX K;  4X65 Q;  1N8R C;  3S15 H;  3EN2 A;  4YWL A;  1V1Q A;  4R4Q A;  3AFQ A;  5C3E H;  3PSI A;  4OX9 L;  2NVT H;  1NE3 A;  2EIF A;  4JYA Q;  5FLM G;  1VQ6 A;  2R92 G;  2PQA B;  2ZTC A;  5IYB H;  4X64 Q;  4HJ9 A;  1VQP A;  3ER0 A;  4NXN L;  3HOZ G;  4DAY B;  3F2D A;  1EIF A;  4RG1 A;  3UE1 A;  4YHH L;  5LMU Q;  1XPR A;  4IOA A;  3K7U C;  3CF5 A;  4DUZ L;  4A3D H;  2VS1 A;  1VQC A;  4DV6 Q;  1N34 Q;  4P74 A;  4AQY Q;  4BY1 G;  2JA6 G;  3H0G H;  1G29 1;  4DV3 Q;  4A76 A;  3TEH B;  4J15 A;  4LW1 A;  3U50 C;  1J5E L;  3S1Q H;  3NEM A;  2PI2 E;  4R4T A;  1I5F A;  2I5H A;  1PA6 A;  3S17 H;  1A62 A;  2AWN A;  1HNZ L;  5FLX c;  1YNX A;  3JAM c;  4DV5 L;  4IOC A;  3HKZ E;  3M4Q A;  3GTQ H;  3HOY H;  4GLX A;  4IJL A;  4LWC A;  4P75 A;  5AJ3 L;  2R93 G;  4OWX B;  1QUQ A;  3K8A A;  4A3E G;  3S24 A;  4C3H H;  1KQS A;  5M3F H;  1YJW A;  3I4M G;  4A3G H;  3CPW A;  4UPA A;  2C35 B;  2HHH L;  1EQQ A;  4X65 L;  2GN5 A;  2KCT A;  2YTX A;  1I3Q H;  2BA1 A;  2OCE A;  1N32 L;  1TWC H;  1HZC A;  4LF6 L;  1HNW Q;  1Q7Y C;  3HKS A;  1EUJ A;  5LMN W;  2MNA A;  4NXN Q;  1JT8 A;  4JCV E;  1VQH A;  4DV4 Q;  2L15 A;  2UU9 L;  2ASB A;  5C0X G;  1KD1 C;  2MO1 A;  2CWA A;  2ZM6 L;  2E5L Q;  4BY1 H;  4A3C H;  1TXY A;  2WAQ E;  3D0F A;  3KFU A;  3L7Z C;  1N33 Q;  1X3F A;  4A3C G;  2UUC Q;  4LF4 Q;  4YCW A;  1E1T A;  1AE3 A;  3GO5 A;  4HIO A;  2I5L X;  2B3G A;  4JI2 Q;  1EWI A;  3U4V A;  1VQM A;  1XMO L;  4A93 H;  1VQ5 A;  3STB D;  4YCU A;  1C7Y A;  1WJJ A;  1SRO A;  2PNH A;  4PMW A;  2IY5 B;  2I0Q A;  2IT1 A;  4OXP A;  1QVC A;  2BA0 A;  4ME3 A;  3BZK A;  3CW2 C;  4DKA C;  1PH5 A;  3G48 A;  3CCL A;  1ASZ A;  1UE5 A;  1VQ7 A;  2QGQ A;  1KL9 A;  1X9N A;  4GN4 B;  3WWV A;  4DR6 L;  1IYJ B;  2K5N A;  1YZ6 A;  2YTV A;  1PV4 A;  4X66 Q;  4K0K L;  3A0J A;  2HHH Q;  4C3J H;  1X6O A;  1O7I A;  2ALY B;  2ZTD A;  4LF5 L;  4QQB X;  1R9T H;  5GAD C;  1E24 A;  3PCO B;  4DV2 L;  3GTO H;  4X62 Q;  3ULL A;  4A3D G;  2R6G A;  3KF6 A;  3KOJ A;  1I6H H;  3KJO A;  3L0O A;  3PUY A;  2N3S A;  3W1G A;  5H1S E;  1XMQ L;  3CC7 A;  1TWH H;  5IP9 H;  1XNQ L;  1JE5 A;  4GLA C;  4JI8 Q;  5IYD G;  2VQE L;  5C0X J;  4DR1 L;  1HR0 W;  3RNU A;  4IFD G;  2RCN A;  3ICE A;  4Y7N H;  5C44 G;  3MXN B;  4LFA L;  5C0X I;  1XPO A;  3PUX A;  1Y1V G;  1OXU A;  1K8A C;  2EQS A;  4JI6 L;  3HOZ H;  1D7Q A;  3OTO L;  4OX9 Q;  3CCU A;  1LUZ A;  1P16 A;  2K4K A;  1HZB A;  1Z47 A;  4DV7 L;  3KDF B;  4XIG S;  3RLO A;  1GO3 E;  3PIO A;  1PVO A;  3JC6 6;  1X3E A;  5IYB G;  3HOX G;  3F2B A;  1K73 C;  3SGI A;  2OTL A;  4A4I A;  1PH9 A;  3S2D H;  2K5H A;  3ERS X;  3J7Z C;  2K52 A;  1PYS B;  2IHF A;  3H3V H;  2DGY A;  4A3K G;  1IBK Q;  1FVI A;  1WCM G;  3CP0 A;  5IYC G;  4P71 A;  2K14 A;  3Q8D A;  1U5K A;  1N36 L;  5IT9 c;  4DV0 L;  3NBH B;  1GM5 A;  3J81 c;  1N32 Q;  4JI3 Q;  1IBM L;  3VDY A;  3B6Y A;  3T1H Q;  1YEZ A;  1C9O A;  2Q2H A;  4MTN A;  3G6E A;  2B29 A;  2JA7 H;  4H02 A;  4UP8 A;  3STB C;  4JOI C;  4DR2 Q;  1JJC B;  3FHW A;  4KHP Q;  1AE2 A;  1VQI A;  2EXD A;  4EQ5 A;  3ZJY C;  4GS3 A;  3A74 A;  4HIK A;  1VQL A;  4JI7 L;  2JA5 G;  3PO2 H;  5IE8 A;  1XNR L;  3CC4 A;  4PG3 A;  1Y1V H;  4X66 L;  3HOY G;  3TRZ A;  1Y1W H;  4LF8 L;  1I94 Q;  2F3I A;  2QEX A;  4QJF A;  3AYH B;  3GTM H;  4BY7 G;  2VUM G;  3M9B A;  1DGS A;  3S14 H;  1EOV A;  4OON A;  4OO1 G;  3S1N H;  5IWA Q;  2FXQ A;  2VUM H;  4DR3 L;  4LF9 L;  5E7N A;  2AKW B;  3GTL H;  3HOU H;  4IPD A;  4DV6 L;  4HJA A;  3J81 j;  3RN5 A;  1NBW A;  2LSS A;  1G6P A;  1YIT A;  1WI5 A;  1X56 A;  1A63 A;  2Y0S E;  3M7N A;  2UXC L;  1B8A A;  4YY3 L;  1OXT A;  3I55 A;  1V9P A;  3MEF A;  5BR8 L;  5M5X H;  1JMC A;  1WCM H;  5EAY A;  2WAQ G;  2I5M X;  5JJK A;  3HOW G;  5IP9 G;  3S1R H;  1Q1B A;  5M5Y H;  1G51 A;  1GVP A;  4QY7 A;  1X3G A;  4JI0 Q;  3HOW H;  2JA8 G;  4DUY L;  2N8N A;  4A3J G;  4L5R C;  3J80 i;  2KHJ A;  1LM0 A;  5ELN A;  1YIJ A;  3UDF A;  4GNX B;  4JBM A;  4A3J H;  4DR4 L;  1A0I A;  2VL6 A;  1C0A A;  4O2D A;  4GKK L;  2Y0S G;  2JEA I;  1X55 A;  2YV5 A;  4LUV A;  3PO3 H;  2UU9 Q;  4POF A;  1YBY A;  4GN3 B;  3T1Y Q;  1VS0 A;  1I94 L;  4BY7 H;  4LF8 Q;  2KHI A;  4HJ7 A;  1Q46 A;  1TWG H;  3OW2 A;  1JB7 A;  1HNW L;  1N9W A;  4GOP B;  2ZTE A;  3EIV A;  3CAM A;  1KRT A;  1J5E Q;  2DUD A;  4BA1 I;  1M1K C;  2CKZ B;  2HQL A;  1HR0 Q;  4AH6 A;  2N78 A;  3PUW A;  2NVX H;  2XGT A;  3KYH C;  2AMC B;  4DPG A;  3K81 C;  1B70 B;  1Z9F A;  4JI4 L;  2VW9 A;  4B3S Q;  3F8T A;  1EYG A;  4A3I H;  3NEN A;  3TRE A;  2UUA L;  3GTP H;  1ASY A;  3TQY A;  2D0O A;  1UEB A;  2VQF L;  1L1O A;  2JE6 I;  1YVC A;  4LUZ A;  3PF4 A;  1CSQ A;  4GLV B;  3H3V I;  2D0P A;  2Z6K C;  2GVB A;  1HNZ Q;  4YWK A;  1JJ2 A;  1VQ9 A;  4L5S A;  4IFD I;  2R93 H;  4Y52 H;  2JA8 H;  1VCI A;  4A3E H;  3DLL A;  1K9M C;  5M3F G;  3AFP A;  1VQO A;  2CQO A;  2ID0 A;  4DV7 Q;  4X62 L;  4R1J A;  2WP8 J;  4WJ3 M;  2K5V A;  1E1O A;  5IY0 A;  2VY3 A;  5LMN L;  1Q82 C;  1VQK A;  1SMX A;  2JK8 A;  5FJ8 H;  4YY3 Q;  2ZJP A;  1OXV A;  2WB1 E;  4DK3 C;  4BXX G;  4B3R Q;  1IZ6 A;  4B3R L;  2F52 A;  1L0W A;  4OWT B;  4YHH Q;  3HOX H;  5LMU L;  1Q81 C;  4B3M L;  4B3M Q;  3M3Y H;  1D8L A;  4RMF A;  3CCE A;  1IBL Q;  4LFC Q;  2HT1 A;  1KIX A;  3A5Z B;  3GTK H;  3HOU G;  1N36 Q;  1YHB A;  1MJC A;  4DR5 Q;  4A3K H;  2HIX A;  1VQD A;  4QL5 A;  3FKI H;  4A93 G;  4DR1 Q;  1SRU A;  2UXB L;  1LTL A;  3W5O A;  1KC8 C;  2NVY H;  3RZD H;  4A3L H;  1UE7 A;  3H15 A;  1XMQ Q;  1I50 H;  2OTJ A;  1U0L A;  1QUQ B;  2QA4 A;  3I7F A;  4JI4 Q;  1HZA A;  3OTO Q;  2WFW A;  4JI5 Q;  2R7Z H;  3G71 A;  2UXD Q;  1Y14 B;  1A8V A;  3K0X A;  4AQY L;  3I4M H;  3F1Z A;  4R4O A;  1QZG A;  2RHQ B;  4IPC A;  1PFS A;  4LF7 Q;  2VZA A;  4DNI A;  1W3S A;  3EBE A;  5JEA G;  1SLJ A;  3A5U A;  3PO3 G;  2JQO A;  5ELO A;  1KXL A;  1CKM A;  1MIU A;  4TVA B;  2E2I H;  2RHS B;  2NZH A;  5IYD H;  4R4I A;  2Z6K A;  4P72 A;  4B3S L;  2LXK A;  3DM3 A;  3I56 A;  4JI7 Q;  4A3F H;  4B3T Q;  3CCR A;  3UDX A;  1Q86 C;  3OYY A;  3PV0 A;  1E22 A;  2K75 A;  4BBR G;  1YJ9 A;  3M4O H;  1N34 L;  4DV1 Q;  4LF5 Q;  1VQJ A;  4DR4 Q;  2JA9 A;  1MKH A;  3PUV A;  4POG A;  2NN6 G;  1TWF H;  4A3L G;  1E7Z A;  2AHO B;  3W1B A;  4PZ7 A;  1RIP A;  5M5W H;  2KBN A;  4KLK A;  1OTC A;  5JJI A;  1KRS A;  4L5Q A;  1K83 H;  3PF5 A;  1EIY B;  2UUB Q;  4APV A;  3FP9 A;  4JI1 L;  5C3E G;  4NXM L;  1VQN A;  1IBL L;  3T1Y L;  1AH9 A;  4HJ8 A;  1HZ9 A;  1IL2 A;  2R7F A;  1PH2 A;  3I4N H;  1UWV A;  4JI2 L;  1WFQ A;  2H5X A;  1L1O C;  1UE1 A;  4JV5 Q;  5FJ8 G;  4BXX H;  4LFB L;  1VQE A;  1OXS C;  1QZH A;  4JBK A;  4O0A A;  1VQB A;  4DV4 L;  3U58 A;  3UDG A;  3PUZ A;  4LF9 Q;  3CCV A;  5HGQ A;  1HJP A;  1HR0 L;  1KAW A;  4LFA Q;  4DR7 Q;  4MNO A;  2E5L L;  3AEV A;  3M4P A;  5BR8 Q;  4EX5 A;  2YTY A;  1UE6 A;  2YU9 H;  2UXC Q;  4UP9 A;  5IP7 H;  3RLF A;  1SN8 A;  2VQE Q;  3RN2 A;  1PH8 A;  4A75 A;  3KDF A;  3RZO H;  3KLW A;  1SR3 A;  1XNR Q;  2IX0 A;  5IP7 G;  4R4C A;  1S40 A;  5C4X G;  4QGU A;  4LF7 L;  2Z0S A;  4JBW A;  4JG2 A;  1K8G A;  1P8L A;  1L1O B;  1YHA A;  4DV2 Q;  4LUO A;  1IBM Q;  1VQ8 A;  4DK6 C;  3CC2 A;  5LMN Q;  4PZ6 A;  5C4J H;  1YI2 A;  3BJU A;  3UDI A;  4IFD J;  1N33 L;  4C2M H;  3J80 c;  2D62 A;  1IXR A;  3JAM i;  1BVS A;  4A3B H;  5GQO A;  4IPH A;  4X64 L;  5GAE C;  3PIP A;  2WB1 G;  2F4V Q;  2F4V L;  4YWM A;  4GOP C;  1PH7 A;  4JI1 Q;  3UE0 A;  1EFW A;  2UUB L;  2BH8 A;  5GAH C;  5JJL A;  1XPU A;  3GDE A;  4FDB A;  5M3M G;  4LFC L;  1SFO H;  3I4N G;  4AYB E;  2UXB Q;  2CWP A;  4ALP A;  1CKN B;  2XTI A;  1LYL A;  3S1M H;  4BBS H;  5GRO A;  2NN6 I;  5GAG C;  3M85 A;  1H95 A;  2K50 A;  4JC0 A;  2ZJQ A;  4GNX C;  1Q8K A;  3HKZ G;  2N49 A;  1NMG A;  2Q2U A;  1Q12 A;  3GTG H;  4GKJ L;  2PQA A;  3FKI G;  2A8V A;  4NXM Q;  5AJ3 Q;  1TWA H;  2CFM A;  2JA7 G;  2JJQ A;  3J7A 5;  3K80 C;  1T9H A;  1XNQ Q;  2MO0 A;  1V43 A;  1X54 A;  5C4X H;  3G4S A;  2VQF Q;  1K3R A;  1VQ4 A;  5J3B A;  1YJN A;  2BH2 A;  3TS2 A;  3CQZ H;  2Q2T A;  4UY8 C;  4LFB Q;  2CCZ A;  4X6A H;  3IRB A;  3CXC A;  2E2J H;  2HIV A;  4PZ8 A;  3CCQ A;  1E3P A;  3KF8 B;  1GKH A;  1HNX Q;  2OQK A;  4B3T L;  1PHJ A;  3T1H L;  5IWA L;  3HFZ B;  3H0G G;  4DAM A;  4DR3 Q;  1NY4 A;  2LXJ A;  2NZO A;  2R7D A;  4C3I H;  3F2C A;  1W2B A;  1CKO A;  1FJG Q;  3PGZ A;  2GVA A;  2Q2I A;  4BBS G;  2V1C C;  1EQR A;  2UUA Q;  4DV1 L;  1PH1 A;  4DR5 L;  1FGU A;  1M90 C;  4DR2 L;  4UP7 A;  4JV5 L;  1PYB A;  3J81 i;  2UUC L;  4LF4 L;  1MJE A;  4LNQ A;  2RF4 A;  4XTC S;  1JJG A;  4GKJ Q;  1XMO Q;  2JA5 H;  4DV0 Q;  2UXD L;  4DUY Q;  4AYB G;  4MZ9 A;  1VQA A;  1VQF A;  2A1A A;  3U4Z A;  4HID A;  2IX1 A;  1CUK A;  2NVQ H;  5HY6 A;  3LGJ A;  2VNU D;  4GN5 A;  2IHE A;  4HJ5 A;  1YHQ A;  4WJ4 A;  4A3G G;  3BZC A;  1S3O A;  3NEL A;  4OWW B;  4BA2 I;  3KJP A;  3S16 H;  2ATW A;  1S72 A;  2ES2 A;  1RL2 A;  4NB3 A;  1QVG A;  4DR7 L;  1XJV A;  1HNX L;  2KEN A;  1Q1E A;  4JI3 L;  2OWO A;  3HOV G;  1WOC A;  1PH6 A;  1BBU A;  2YYZ A;  4A3M G;  3RR5 A;  1L2F A;  3GD7 A;  1XTD A;  1SE8 A;  4GOP A;  5K36 G;  4AIM A;  3CCM A;  3ULP A;  4IPG A;  3CMA A;  1FJG L;  4A3I G;  1X65 A;  1NMF A;  1K0R A;  5IYC H;  2ZM6 Q;  4KHZ A;  2JA6 H;  4JYA L;  4LF6 Q; 
#chains in the Genus database with same CATH topology
 3CPF A;  3CCS A;  2OQ0 A;  2M00 A;  3K0Y A;  1KJJ A;  1I4H A;  2R7Z A;  3TP5 A;  5JQW A;  2L11 A;  1J5E H;  2A6H D;  3NHH A;  5IOD A;  3TS0 A;  1PH4 A;  4JI6 Q;  1C3O A;  4O3O A;  4DR6 Q;  4S3S A;  1B7Y B;  1VQG A;  2QYZ A;  1GUO A;  2JEJ A;  2UXD H;  4NW2 A;  2EE1 A;  5C4H A;  3KF6 B;  2E8G A;  4XYM B;  1CKN A;  3MR6 A;  3E9H A;  3QFF A;  2PBZ A;  4A3D B;  2L55 A;  3VR4 A;  3L2P A;  4BBR H;  1M8A A;  3E9I A;  4P73 A;  3RD4 A;  3AQQ A;  2PN1 A;  2DY7 A;  1BBW A;  5KFF A;  3ND8 A;  3EA6 A;  2PO4 A;  4ZKC B;  4R4Q A;  3BA9 A;  4DLK A;  4YHH H;  1S97 A;  1PTO F;  1K83 A;  5FLM G;  1EY7 A;  5E1F A;  2ZTC A;  2B2T A;  1H9K A;  1TT2 A;  4ILW A;  3ER0 A;  4DL2 A;  2R8G A;  4DAY B;  3HEJ A;  2VUM B;  1PYW D;  1KLU D;  3HZX A;  2EYF A;  4APM A;  4YR0 A;  5AFW A;  2E5L H;  4FNF A;  1S03 G;  4JVZ A;  2HQE A;  4B9X A;  3CF5 A;  2VS1 A;  1VQC A;  4DV6 Q;  2JA6 G;  5TSS A;  4DV3 Q;  1I94 H;  4A76 A;  2K5W A;  4ZCK A;  4LW1 A;  1GUN A;  2PI2 E;  3EPI A;  4R4T A;  1QNU A;  1I5F A;  2XVS A;  5KT6 A;  3KTM A;  4HMJ A;  3G6J B;  3T51 B;  3SK6 A;  1SYX B;  5FLX c;  1ET9 A;  4EEQ A;  2RA4 A;  5C5L A;  2YS7 A;  3N52 A;  5AJ3 L;  3KAJ A;  4WD3 A;  1KQS A;  4A3E B;  5KYI A;  5M3F H;  3I4M G;  1TA8 A;  4EQP A;  1EQQ A;  2HHH L;  3JSN A;  2J6U A;  4FBT A;  2GN5 A;  2KCT A;  2YTX A;  1CI3 M;  4NKL A;  1UC8 A;  5BPH A;  4O4L F;  4HNU A;  4MA5 A;  2M05 A;  1C48 A;  1Q7Y C;  2VPQ A;  4R8U B;  4NXN Q;  1R4Q B;  3V96 A;  2XWJ B;  4DV4 Q;  5M3M B;  2DN8 A;  3AMU A;  1KD1 C;  1IW7 D;  1EY6 A;  1GUG A;  2ZM6 L;  3KK7 A;  2W8K A;  4BY1 H;  1HHV A;  4HNT A;  1SJE D;  3CRK C;  4LH6 A;  4A2B A;  1BF4 A;  3L7Z C;  3KFU A;  4LF8 H;  1X3Q A;  4LF4 Q;  4IZ8 A;  3EPG A;  2B3G A;  3HRZ C;  1EWI A;  4A93 H;  1VQ5 A;  3STB D;  2JA8 B;  3KHH A;  1SRO A;  1EYZ A;  2K03 A;  4ECW A;  4OXP A;  1QVC A;  4Z9C B;  4ME3 A;  3CW2 C;  4DKA C;  2R82 A;  1ASZ A;  1VQ7 A;  4KK7 A;  1TS3 A;  2VB2 X;  2QGQ A;  4RHR A;  5LL6 b;  4JI0 H;  3ITP A;  1IYJ B;  1PV4 A;  3F8N A;  2VQF H;  1QJO A;  1EU4 A;  1O7I A;  3TBI B;  3Q8R B;  2V58 A;  4X62 Q;  3A8J E;  3KF6 A;  2E2D C;  1I6H H;  4ED1 A;  3KJO A;  3RUP A;  1XMQ L;  3W1G A;  1S5C D;  1TWH H;  3NGD A;  1TS2 A;  1JE5 A;  1EWH A;  3BDL A;  4GLA C;  2VQE L;  5C0X J;  4DR1 L;  3M3Y B;  2RCN A;  3VR5 A;  5DAU A;  3ICE A;  2ZJT A;  2SNS A;  4EBD A;  1LTA D;  3MXN B;  2IBK A;  2H4O A;  3RUZ A;  5CBE E;  1UNN C;  3GTL A;  5KFM A;  1CK1 A;  3OTO L;  5M5W B;  4OX9 Q;  2HVR A;  1LUZ A;  4DK0 A;  5EWG A;  5EPJ A;  3NWT A;  5KFQ A;  2AGP A;  5BR8 H;  2GLT A;  3GTP A;  4QIW A;  2V59 A;  1RCV D;  2OT2 A;  3JC6 6;  3FDT A;  3I4N B;  3SGI A;  3A7L A;  2K5H A;  2F4I A;  1Y8P B;  3J7Z C;  2B63 A;  4KD3 A;  1IW7 C;  2IHF A;  4X65 H;  1JX4 A;  3QWN A;  3H3V H;  4A3K G;  5DQH A;  1IBK Q;  1FVI A;  1H9R A;  5C3W A;  4RNO A;  1Z2P X;  4Q44 A;  5IYC G;  5BN5 A;  4OX9 H;  1U5K A;  1N36 L;  3BVG A;  3Q6S A;  3J81 c;  1IBM L;  3CVZ A;  3T1H Q;  3KUP A;  4KD4 A;  4GC7 A;  4KHP Q;  1DOM A;  4DR2 Q;  2F0F A;  2SDF A;  1R9T A;  2Z4I A;  1VQI A;  4NDX A;  4JI7 L;  3ZJY C;  4GS3 A;  4FYD A;  3NE5 B;  1K1S A;  5IE8 A;  1GUW A;  5CV4 A;  5EGT A;  3CC4 A;  2RCF A;  4ODG A;  4PG3 A;  5C4J B;  1Y1W H;  2NYZ D;  4G57 A;  3PIO 3;  1H9S B;  5JEA H;  4DR4 H;  4QJF A;  2RDI A;  1I50 A;  3VPB A;  1B53 A;  5CC4 A;  4QWE A;  4EGQ A;  1B4O A;  1ZHS A;  4OON A;  1E4E A;  2UXC H;  5IWA Q;  5KFO A;  3NBH A;  4DR3 L;  4IPD A;  1KJI A;  3J81 j;  2YS6 A;  5J39 A;  1OWT A;  4YY3 L;  2L12 A;  1I7N A;  3DUZ A;  3MEF A;  5KGU A;  3D6C A;  1E0B A;  2JEG A;  1EWC A;  1WCM H;  1A3V A;  2WAQ G;  1K1Q A;  3KBG A;  1DOL A;  3S1R H;  1G51 A;  1V8Q A;  4UCS A;  1X3G A;  5M3F B;  1GUS A;  5JOB A;  4KTA A;  1LM0 A;  5ELN A;  5CA1 F;  2IMW P;  3C2P A;  1XWE A;  2K5Q A;  4JBM A;  2W9B B;  3G6X A;  4Q8F A;  2VL6 A;  2FMC A;  2W71 A;  3GV8 B;  1PRT F;  4R8I A;  4CBV A;  1S0N A;  2K5D A;  4POF A;  4DAP A;  2B2V A;  4BY7 H;  4HJ7 A;  4L6T B;  3HKZ A;  1HNW L;  4TV9 F;  4KN4 C;  4F4X A;  4LJZ C;  2OEO A;  2X0S A;  2PZT A;  3CAM A;  1KRT A;  1M0W A;  5KG0 A;  3TQ1 A;  2NVX H;  2MUY A;  1SE3 A;  5A2Q W;  3KYH C;  3D4R A;  3K81 C;  4RHS A;  5DG8 A;  4HED A;  1LO5 D;  1L2Z A;  2AQ2 B;  3F8T A;  2UUA L;  1ASY A;  4XYQ A;  4H13 C;  4LUZ A;  3S1Q B;  4UHV A;  3BG5 A;  3H3V I;  3GTG B;  2D0P A;  2Z6K C;  2GVB A;  2ZXO A;  4Y52 H;  1JJ2 A;  2W9B A;  2R93 H;  4B3R H;  1VCI A;  2R8K A;  3DLL A;  4ED8 A;  1A3U A;  2KED A;  2CQO A;  4DV7 Q;  1EQT A;  3MR5 A;  4X62 L;  4R1J A;  2WP8 J;  2K5V A;  1E1O A;  4C5C A;  2BCO A;  2JK8 A;  5FJ8 H;  2ZJP A;  4ZUI A;  4JV0 A;  4ECY A;  2UVU A;  3GLK A;  1ONL A;  1AP0 A;  3N40 P;  3FEW X;  4RKL A;  2FIN B;  3M3Y H;  3IFT A;  1JWU D;  5D1P A;  3GTK H;  3IG0 A;  2B63 B;  3NTH A;  1G6Z A;  5KFK A;  1YHB A;  4CKC A;  4A3K H;  3VYR A;  1UNS A;  2ATL A;  4MV3 A;  2UXB L;  2FHT A;  1YNN D;  4K2K A;  4DN4 M;  4RAZ A;  3I8Z A;  2R85 A;  3MZ5 A;  3T5J A;  1I50 H;  3K57 A;  4XDX A;  1N48 A;  4RA8 A;  5DLG A;  2XCP A;  1ILQ A;  3K5H A;  1ZXT A;  1HZA A;  5CMD A;  1VDZ A;  4JI5 Q;  2FK3 A;  2IWH A;  3AU7 A;  5J2U F;  3K0X A;  5C3E B;  2VA3 A;  3P1H A;  4R8N A;  4FXG C;  2MPM A;  5KFZ A;  1HXY D;  5FO8 B;  3I73 A;  4DK1 A;  1SLJ A;  3A5U A;  2JQO A;  3FMC A;  1KXL A;  2XRQ D;  4OL7 A;  1CKM A;  1MIU A;  2DJG C;  2E2I H;  2RHS B;  4FO2 A;  3TZD A;  2JYO A;  3IFD A;  5KT4 A;  4K8J A;  3SI8 A;  5FLX W;  4C3J B;  4QUC A;  4DAV A;  1KDC A;  2K75 A;  1N34 L;  4LF5 Q;  1VQJ A;  4DR4 Q;  2CZG A;  2PNR C;  4YAJ B;  3M7G A;  3Q8P B;  2NN6 G;  2B39 A;  2HCC A;  3QB3 A;  2VQD A;  3RB4 A;  4RNM A;  4PZ7 A;  3TDQ A;  1K8M A;  4KLK A;  2B2U A;  1Y69 U;  3MVV A;  2R7K A;  4AYB A;  4O3P A;  5JUM A;  4APV A;  5HBR B;  1IBL L;  1SDF A;  4HCE A;  2SOB A;  5CV8 A;  3T1Y L;  2NVX A;  1HZ9 A;  1PH2 A;  1WFQ A;  2H5X A;  5FJ8 G;  4LF5 H;  3VYT A;  1QZH A;  4TRD A;  4FU0 A;  3OSO A;  3U58 A;  3RB3 A;  2EJF C;  4LF9 Q;  3MFG A;  1STN A;  1HJP A;  5IOC A;  4R8U A;  4MNO A;  2E5L L;  3D6W A;  4KV6 A;  3Q8S B;  5BR8 Q;  3OMG A;  2JN4 A;  3I3C A;  2YTY A;  2YU9 H;  1QB5 D;  2EYH A;  1SN8 A;  1PH8 A;  1RF2 D;  5T14 A;  2ZDH A;  3RZO H;  2DNE A;  3OHA A;  3KLR A;  2Y0S A;  5C4X G;  2Z0S A;  4JBW A;  3K5M A;  1VMC A;  4LUO A;  2UXB H;  3OIP A;  1Y1V B;  3TQT A;  1IYU A;  4ZRZ A;  5LXT F;  5DG7 A;  4J9S A;  4DR3 H;  1O7Y A;  4C2M H;  5D1O A;  2F0M A;  1BVS A;  2NTT A;  5GQO A;  4IPH A;  3U9T A;  5GAE C;  2R8H A;  4GOP C;  4FXD A;  1EFW A;  2UUB L;  2BH8 A;  1TWF A;  1XPU A;  3QOL A;  1SFO H;  5EPK A;  4ALP A;  2VPS A;  3H0G B;  2XTI A;  1LYL A;  4RFB A;  5IGD A;  2NN6 I;  4JI1 H;  5DM6 3;  3M85 A;  2F0L A;  1E2Z A;  3OUZ A;  1Q8K A;  3GTG H;  4GKJ L;  1NMG A;  3OW7 A;  4RB3 C;  2R8J A;  2PQA A;  3FKI G;  5FK9 C;  2F1M A;  5KFR A;  1TWA H;  4LFA H;  2JJQ A;  4LK1 C;  4B9W A;  3J7A 5;  2IPK D;  3K80 C;  2L5T A;  4JPB W;  5CV9 A;  1XNQ Q;  3MC0 B;  2MO0 A;  1X54 A;  1VQ4 A;  1K3R A;  5J3B A;  3OOC A;  5LOV F;  3CQZ H;  1TWG B;  1STH A;  3BYT B;  2E2J H;  2HIV A;  1BOS A;  4PZ8 A;  2OH2 A;  4CGY B;  3IAY A;  1HNX Q;  1X32 A;  1HQR D;  4MIU A;  1PHJ A;  4B3T L;  1PZI D;  3T1H L;  1H9M A;  4DAM A;  4PDB A;  1A3T A;  2ICE C;  3Q1K A;  2A68 C;  3W2D A;  1EY4 A;  1FJG Q;  2J0T D;  3PGZ A;  3ORQ A;  2V1C C;  2UUA Q;  4RCO A;  3R23 A;  4CJ1 B;  4DV1 L;  2DPI A;  1PH1 A;  3VR6 A;  4UP7 A;  2IX3 A;  1PYB A;  3J81 i;  3RZD B;  4JV5 L;  1ML0 D;  2JA7 B;  2IA6 A;  2RF4 A;  4XTC S;  1JJG A;  1BJT A;  1XMO Q;  1HTP A;  4ZI7 F;  2KCN A;  4AYB G;  1STY A;  4ZYS A;  1VQA A;  1KAB A;  2KOL A;  3U4Z A;  5KFI A;  3BAA A;  2FPG B;  3T5H A;  2NVQ H;  3L4J A;  4GN5 A;  4C3H G;  4OHJ A;  4A3G G;  1VMP A;  1PK8 A;  3KJP A;  1RL2 A;  2WB1 B;  4DR7 L;  1JKJ B;  1BO0 A;  2I07 B;  1UUP A;  3EVQ A;  1PH6 A;  3EJI A;  3GP7 A;  4J9P A;  3GTO A;  1ZEQ X;  4GOP A;  1SE8 A;  1WR2 A;  1JXL A;  3J7A V;  5DG9 A;  4IPG A;  3M4O B;  4A3I G;  3KBX A;  1NMF A;  4EFE A;  1QIL A;  4RAY A;  3MEH A;  4LF6 Q;  4DUZ H;  1CM9 A;  2R7Z B;  2PI2 A;  1NTG A;  2MFI A;  1RTN A;  2H1E A;  5J1Z A;  3VA5 A;  5FLM H;  4IUV A;  3VMM A;  3RBE A;  1XMQ H;  2JEF A;  2MQH A;  4XZ3 B;  4GKK H;  3H91 A;  3PR5 B;  1RD9 D;  3PO2 G;  4KI0 A;  1I4G A;  3VYS A;  1NJI C;  4KKU A;  3GTG A;  4A3F B;  4JI5 L;  3GTM B;  1PRT C;  5KFG A;  3QZ8 A;  2F0P A;  2C22 A;  2AWO A;  4JI0 L;  5KG7 A;  1EOT A;  3SEB A;  4HSP A;  4A3F G;  2B63 H;  3RZO B;  1FL0 A;  4ECU A;  3U9O A;  2VB3 X;  5JVH 3;  4DV5 Q;  2SEB D;  5C44 H;  4O1N A;  3H09 A;  4QIW E;  4GKK Q;  4LH7 A;  1J6Q A;  1J9O A;  1VF7 A;  2PMZ E;  2NUA B;  2EY6 A;  4KHP L;  4K0K Q;  3CD6 A;  3S15 H;  5JAV A;  4IN3 A;  2EJM A;  1N8R C;  5I47 A;  4YWL A;  1BQQ T;  2HDM A;  5C5M A;  3VPD A;  2B2W A;  1SEI A;  4KJN A;  4RNN A;  2UVR A;  5C3E H;  3PSI A;  5LL6 S;  4JYA Q;  5EWE A;  1VQ6 A;  4HJ9 A;  5IYB H;  1VQP A;  4YR3 A;  1SXT A;  5FKA C;  3UE1 A;  3TIN A;  4YHH L;  5LMU Q;  1XPR A;  5CYU A;  4P74 A;  4HMI A;  1HNZ H;  2D2C C;  1I6U A;  4HAE A;  2I5H A;  1A62 A;  1N56 A;  5COR A;  3K3V A;  3FPU B;  3M4Q A;  4QIW B;  5GON F;  4DV6 H;  2E2J B;  1EEI D;  3PW7 A;  4IJL A;  2E2H B;  5ELE A;  2R93 G;  4OWX B;  4FP5 D;  3S24 A;  4L1K A;  1YJW A;  1KNE A;  4A3G H;  4IRD A;  2C35 B;  2JA7 A;  2C2R A;  2XCL A;  2OCE A;  1NR4 A;  1U9R A;  1SYE A;  3NPP A;  3M9N B;  4LF6 L;  1I4P A;  4RGM A;  3C46 A;  2PZU A;  4DUY H;  3PO3 B;  3T56 B;  5LMN W;  1JLL B;  3R3O A;  3V2T A;  2UU9 L;  2ASB A;  5LL6 X;  2CWA A;  2DIK A;  2TSS A;  1QE6 A;  1O80 A;  3V05 A;  1WTP A;  4A3M B;  3RMH A;  3W3A A;  4A3C G;  1GJX A;  2MCT A;  2WB1 A;  5KRU A;  1E1T A;  5K36 H;  4Y8V B;  4LF7 H;  1RK5 A;  4H44 C;  4BS9 A;  1XDN A;  4YCU A;  1C7Y A;  2PNH A;  4PMW A;  3H40 A;  2BA0 A;  5KG4 A;  1STA A;  4L63 B;  5KX5 F;  1KL9 A;  3MFH A;  1B9M A;  1G2S A;  2K04 A;  4GN4 B;  3WWV A;  2XWB B;  4KHV A;  3A8K E;  4NP5 A;  3J7A F;  2LFN A;  5KFJ A;  1DOK A;  2HHH Q;  1BCP B;  2ZTD A;  5FO9 B;  2C00 A;  4LFB H;  1HUM A;  1R9T H;  2XSC A;  4A3D G;  3TN2 A;  4QWA A;  1STE A;  1FNU A;  2W9C B;  3L0O A;  3HOV G;  3IL8 A;  3T53 B;  1XNQ L;  1AUV A;  1HR0 W;  4IFD G;  5IYD G;  1SNC A;  4CDF C;  5HUR A;  5C44 G;  3RAQ A;  3GQB A;  3OUU A;  3PUX A;  2VUM A;  1FNW A;  2CH4 A;  3T5L A;  3TP7 A;  1CA6 A;  5KFX A;  1BCP C;  2RVL A;  4ABN A;  1CQF A;  1WD0 A;  4L8J A;  4J6H A;  1DM0 B;  2K4K A;  4U7C A;  2FLL A;  1HZB A;  1Z47 A;  1EQV A;  3KDF B;  3DHQ A;  3PIO A;  1X3E A;  2OTL A;  1K73 C;  4A4I A;  2MGS A;  4HCS A;  3ERS X;  1XMO H;  3GIP A;  1IBM H;  2K52 A;  1PYS B;  4YB8 B;  3BAB A;  1B50 A;  4PQX A;  2W9A A;  3HOV B;  2V9W A;  2LS0 1;  3Q8D A;  2W57 A;  2WYO A;  1GM5 A;  1N32 Q;  1CQJ B;  1A9X A;  1YEZ A;  2DLN A;  4MTN A;  2WAC A;  2JA7 H;  4A2A A;  4UP8 A;  1JJC B;  4EQ5 A;  3TII A;  1I4R A;  1FKA H;  1VQL A;  4M7E A;  1XNR L;  1GSO A;  3PVX A;  1Y1V H;  2AGO A;  4N9T A;  1I94 Q;  2F0Q A;  2QEX A;  3MXP A;  4ECX A;  1AW7 A;  2VUM G;  3M9B A;  4RGN A;  1LAB A;  3S14 H;  1EIG A;  1EOV A;  2F0J A;  2RGV A;  2ZDQ A;  1F2Z A;  5C8Y F;  2FXQ A;  5D14 A;  4X3U A;  2R7N A;  5E7N A;  3GTL H;  3HOU H;  3E5N A;  1NBW A;  2LSS A;  1F2Y A;  1FYC A;  1WI5 A;  5BN3 A;  1YIT A;  2X6G A;  1A63 A;  5J2T F;  3M7N A;  2F4V H;  1B8A A;  4MTE A;  3GII A;  1OXT A;  4DV0 H;  3C1E A;  3I55 A;  5BR8 L;  1PFB A;  1DV2 A;  4MHE A;  5IGB A;  2KJX A;  1BXT A;  1S10 A;  4TUY F;  1Q1B A;  5M5Y H;  4Y7N B;  2YRX A;  3RV4 A;  4J0M A;  2I80 A;  1NR2 A;  2N8N A;  4L5R C;  1YNJ D;  1V1P B;  4O42 A;  4BBR B;  2AU0 A;  3UDF A;  4GNX B;  1SNQ A;  4O2D A;  2BE5 C;  4GKK L;  4YR2 A;  3PO3 H;  1X55 A;  1E4G T;  4EBE A;  3GIM A;  2R93 B;  4N9P A;  3FKI A;  4ZOL F;  2M9V A;  4GN3 B;  1VS0 A;  5FLX L;  4LF8 Q;  3S2D B;  1XYI A;  4CJ2 C;  4I55 F;  1YNN C;  3HG9 A;  1LTT D;  3OW2 A;  4WBN F;  4GOP B;  2ZTE A;  4BWG B;  2ALZ A;  4EGJ A;  2CKZ B;  5KG2 A;  2HQL A;  2N78 A;  1UAP A;  2AQ3 B;  2XGT A;  4MV4 A;  2AMC B;  3GID A;  1CHP D;  1JR0 D;  1ROD A;  1DXM A;  1S5E D;  3C1F A;  4CC6 A;  3LWE A;  4A3I H;  4LF9 H;  2B2Y C;  4PMC A;  1L1O A;  3PF4 A;  1YVC A;  1CSQ A;  2RQX A;  3R2T A;  5IT9 W;  3RBD A;  1GHJ A;  1SYB A;  1HNZ Q;  2KCC A;  4L5S A;  2WKD A;  3KLS X;  3M9O B;  1DON A;  1QOH A;  4FF1 A;  3AFP A;  2R84 A;  4P2C B;  1R9T B;  4E6I A;  5CV6 A;  3BDO A;  5IY0 A;  5A2Q E;  1Q82 C;  1EUC B;  4YY3 Q;  1JDE A;  4DK3 C;  1IZ6 A;  3OWE B;  2F0H A;  2XIG A;  4CDD C;  3J7A K;  2Q8I B;  4OWT B;  4B3M L;  1Q81 C;  4B3M Q;  5H80 A;  4RMF A;  3CCE A;  2NU8 B;  2DY8 A;  4ECS A;  3WO0 A;  3J81 L;  1SE2 A;  4RUA A;  2E2I B;  3GTP B;  2HIX A;  4QL5 A;  3T13 A;  3GV5 B;  4JI4 H;  4JUZ A;  1SRU A;  4A93 B;  2JSO A;  1UE7 A;  1Y8O B;  4RUC A;  4ED6 A;  5E4W C;  1QUQ B;  2QA4 A;  3I7F A;  2HD3 A;  2WIN B;  2R7Z H;  2EZV A;  1Y14 B;  4O3R A;  2CQA A;  4EGV A;  2CH4 W;  3F1Z A;  3EFX D;  4DV1 H;  1RYR A;  1B3Q A;  3EBE A;  2A5H A;  5KT3 A;  4XQN A;  4TVA B;  2CQY A;  2W70 A;  5ELD A;  5IGE A;  2HCI A;  2NZH A;  4F50 A;  3G6Y A;  1SJH D;  2B2U C;  3RB6 A;  1SMY D;  2F0O A;  3I56 A;  4B3T Q;  4JI7 Q;  5C5J A;  2C5C A;  3SXH A;  3SR1 A;  1O7L A;  1AFP A;  4C2M A;  2AQ4 A;  1E22 A;  2B8F A;  1YJ9 A;  4IZO A;  3P7J A;  1Q90 A;  4DV1 Q;  1C30 A;  4RGT A;  1MKH A;  1WTH A;  2EYM A;  3MXG A;  2F0I A;  4POG A;  5LP6 F;  4U68 A;  3Q24 A;  1TWF H;  4A3L G;  3RFC A;  4XT1 B;  1RIP A;  5T1I A;  1PTO D;  4L5Q A;  2FJZ A;  4JV5 H;  4JI1 L;  5C3E G;  1TII D;  2BR0 A;  4QWB A;  2E2H A;  3SK4 A;  4NXM L;  1N33 H;  4YIJ A;  1VQN A;  3SVM A;  5EPL A;  4HJ8 A;  3N41 B;  2R7F A;  3LNN A;  2V4R A;  1UWV A;  3RIZ A;  4JI2 L;  1HUN A;  1LTS D;  1UE1 A;  2UUB H;  5BMV F;  1AN7 A;  2AQ1 B;  4B3S H;  4O0A A;  3PUZ A;  3CCV A;  1SYD A;  1HR0 L;  1W6K A;  1DZ1 A;  4LFA Q;  4IWX A;  5C0X H;  5JH7 F;  4RGO S;  1I6V C;  4Q5V A;  4XXE A;  1RHP A;  2WAQ B;  4EX5 A;  1G2T A;  3CQZ A;  3RV3 A;  2J6S A;  3PR4 A;  2NVY B;  2VQE Q;  2BQ3 A;  4A75 A;  3KDF A;  4ECZ A;  1ESF A;  1SR3 A;  4WJW A;  1XNR Q;  5C1P A;  4M1U B;  2PCF B;  4JG2 A;  1K8G A;  1IBM Q;  3ETJ A;  1EY0 A;  4IAJ A;  2XGP A;  1VQ8 A;  4IWY A;  4NLG A;  5CA0 F;  1ZQ7 A;  1WTR A;  4DA2 A;  1IBL H;  1XX8 A;  3JAM i;  4DL6 A;  3V6H A;  4A3B H;  4RB0 A;  1JC7 A;  4X64 L;  1BNC A;  4MV6 A;  3PIP A;  4Q45 A;  1PH7 A;  1MZB A;  3N43 B;  1B44 D;  3UE0 A;  4IUR A;  1Y1W B;  5K5P A;  1L0Y B;  3NWS A;  1KNA A;  4LFC L;  4G3I A;  4AYB E;  2UXB Q;  3WOF A;  1M6V A;  4ECQ A;  1BR9 A;  3S1M H;  4BBS H;  3BQ1 A;  1IKL A;  1F9S A;  2FB9 A;  1ENC A;  5KIX A;  5CV7 A;  2PVP A;  4GNX C;  1JWS D;  4G4K A;  3T1Y H;  2Q2U A;  1Q12 A;  5L9X A;  1G91 A;  2B2V C;  2YW2 A;  2HVQ A;  4NXM Q;  2LKV A;  5AJ3 Q;  3KAL A;  4EYH B;  5I4D A;  5L1L A;  1IL8 A;  1MD2 D;  3PW0 A;  2RDJ A;  1S9F A;  1T3N A;  1YJN A;  5C4X H;  5KNB A;  5ELC A;  1K83 B;  1CFM A;  3G6V A;  1WSC A;  2Q2T A;  4UY8 C;  2CCZ A;  3IRB A;  4EBC A;  4MAM A;  2J9G A;  1O7Z A;  3DWQ A;  3KF8 B;  3PN1 A;  4DXG A;  2X6L A;  1TS5 A;  4RZQ A;  3VPC A;  1NY4 A;  4IQZ A;  5KG5 A;  2LXJ A;  2NZO A;  4C3I H;  4DR2 H;  2EPB A;  3F2C A;  4JV1 A;  2LY7 A;  2PW5 A;  2O5J C;  2W6N A;  2GVA A;  4JI2 H;  1T5X D;  2O03 A;  2QDL A;  4HR7 B;  1RJR A;  1AZP A;  4DR5 L;  2AUJ D;  5KFY A;  1SNO A;  4LF4 L;  1MJE A;  4MTD A;  3A56 A;  4GKJ Q;  4IFD H;  3PO2 B;  3F2U A;  4ZUJ A;  3GIK A;  1EYA A;  3OIQ A;  2MHV A;  4DFA A;  4DR5 H;  1VQF A;  1SYG A;  2A1A A;  2PMZ A;  4M9U A;  2C28 A;  1ULZ A;  4KKS A;  1WD1 A;  2EVB A;  5L1K A;  2RGR A;  2IX1 A;  5DEH A;  3GTQ A;  2CW8 A;  2K33 A;  1TWA A;  4CDC C;  1ZYR C;  2IHE A;  4WJ4 A;  3NEL A;  4F4Z A;  1Q8I A;  2G5D A;  4HSV A;  1S72 A;  2ATW A;  4C5A A;  1UEA B;  4DV7 H;  2OWO A;  3MFI A;  3MFY A;  1L2F A;  1TWF B;  2WTF A;  2RDG A;  3QZ7 A;  3TZU A;  3LWU A;  1C4Q A;  1XTD A;  1WTV A;  1RK6 A;  3ULP A;  2EXZ A;  3R5H A;  1FGB D;  1KTK A;  4KHZ A;  1MGS A;  5KYL A;  3DWP A;  2K6A A;  1FNV A;  4FF4 A;  1JOO A;  3MJF A;  1MHW C;  3CME A;  3J7Y W;  2R92 H;  2DPJ A;  4JI8 L;  4L5T A;  5KT7 A;  3IKJ A;  1TAE A;  3E0E A;  4GNX A;  3ULJ A;  3S16 B;  5EOY A;  1KHI A;  1D5M C;  4YCV A;  4A3B G;  3M4I A;  4IJH A;  4OO1 I;  2A19 A;  3K5I A;  2YZN A;  2CW0 C;  4RAU C;  1GHK A;  5IT9 L;  4RU9 A;  1PTO H;  5M3M H;  1IBK L;  2B2W C;  4LSX A;  5JVD F;  4IRK A;  4RZR A;  3S2H H;  2R6F A;  1QVF A;  2B63 G;  3HS0 C;  1HH2 P;  5I2X A;  2R7L A;  3K7A H;  5BN4 A;  5BPF A;  2YZM A;  5KNC A;  5IGC A;  1WYD A;  4ME6 A;  1KDB A;  3WO1 A;  1EY8 A;  2N55 A;  3I2Z A;  3BU2 A;  1OXX K;  5EZY F;  3QOJ A;  3EN2 A;  2X69 A;  4RB2 C;  2Z9H A;  1S4Z A;  5D1O B;  3H3V C;  4YQW A;  4AQY H;  1ICF B;  4OX9 L;  1NE3 A;  2EIF A;  4XQJ A;  3BA8 A;  3E0J A;  4X64 Q;  1Y1V A;  1JIH A;  1EFI D;  1KLG D;  4GZY C;  1RDP D;  2CHB D;  5KFN A;  1HR0 H;  4OIK A;  4CC5 A;  1KJ9 A;  4IOA A;  1STG A;  1AZQ A;  1B2T A;  1HFN A;  1N34 Q;  4PV1 C;  3DEP A;  2XD4 A;  3PMF A;  5KFT A;  3TEH B;  2XGQ A;  3BS1 A;  4CJ0 B;  1J5E L;  3NEM A;  1R4P B;  3S1R B;  4FXK C;  2XRS D;  1HNZ L;  1YNX A;  1DIK A;  1CQV A;  4DV5 L;  4DAY A;  4IOC A;  3GTQ H;  5FPO A;  1EU3 A;  4JW0 A;  2E74 C;  4AYB B;  2NVT B;  1KEE A;  2NUC A;  3MA2 B;  1SAP A;  3BG3 A;  2J6T A;  1QUQ A;  3K8A A;  4A3E G;  3N42 B;  5F2D A;  1J8I A;  3HOX B;  4NXN H;  3K6O A;  4X65 L;  1ET6 A;  1I3Q H;  1EZ1 A;  3HBL A;  4BY7 B;  1N32 L;  2VOB A;  1ESR A;  2YZG A;  4C2M B;  5CGK A;  1EUJ A;  2F0E A;  1JT8 A;  1KJQ A;  3NK9 A;  4JCV E;  3SK8 A;  1KJ8 A;  2L15 A;  4UAI A;  1WVL A;  1VKZ A;  2MO1 A;  1KDA A;  4QUF A;  2P5Z X;  1I7L A;  2VR1 A;  2Q8T A;  1SFO B;  4A3C H;  1TXY A;  2WAQ E;  2L1B A;  5HGT A;  4QW8 A;  1GSA A;  2JXM B;  2QCP X;  3WNZ A;  1GSH A;  4I50 F;  3JSL A;  4DU9 A;  4J9N A;  1PMR A;  1AE3 A;  3I4M B;  1B6R A;  2EYJ A;  4LAA A;  4JI2 Q;  1DD2 A;  5I2Y A;  1XMO L;  1IHZ A;  3SK5 A;  3KAK A;  2WE6 A;  3RB0 A;  1D2B A;  4E4T A;  1KBL A;  1VBH A;  4DV3 H;  2I0Q A;  1PH5 A;  3CCL A;  3BZK A;  1V4Y A;  4EFB A;  3GV6 A;  3R5F A;  3MAQ A;  3T5K A;  3I90 A;  2W6P A;  1PLF A;  1DV1 A;  4ZAI A;  1D5Z C;  3JAM L;  4K0K L;  2A73 B;  3CQZ B;  3CHB D;  2ALY B;  3ERO A;  5KFC A;  4QQB X;  5E3F A;  3R93 A;  3GTK B;  4C3J G;  5CB4 F;  3DMU A;  3GTO H;  3ULL A;  1W93 A;  3KOJ A;  2JA6 H;  2N3S A;  4JI8 Q;  4PWQ A;  5LA6 F;  1TWC A;  3M9M B;  4I7Z C;  1GXD C;  4OEM B;  1SNP A;  4IAL A;  2MP1 A;  4QB4 A;  3RNU A;  1CZW A;  4EQN A;  2ZXP A;  1U4R A;  5C0X I;  1XPO A;  3LWB A;  1ZKO A;  3EQL C;  1Y1V G;  1OXU A;  3FKI B;  1K8A C;  1A6X A;  2RDF A;  4FM9 A;  5C4X B;  4ZLT F;  1CA5 A;  3FPP A;  1QG7 A;  4XIG S;  1GO3 E;  2OXP A;  5KG3 A;  3VR2 A;  1ILP A;  4J9K A;  1PZK D;  4KMU C;  4EVO A;  4ID6 A;  2DGY A;  1LAC A;  1EY9 A;  4X3S A;  3CP0 A;  1TY2 A;  2QK4 A;  3HOU B;  1XNQ H;  4YY3 H;  1EZ6 A;  3NBH B;  5F9N A;  4DL7 A;  3TIG A;  2PMZ B;  4KJO A;  4ZK9 B;  3VDY A;  1Z7T A;  4U6P A;  2HVS A;  2B29 A;  3STB C;  4JOI C;  1C0A A;  4JI6 H;  4R9W A;  4HIK A;  2IY5 B;  4KN7 C;  1Z2N X;  3A74 A;  3QG1 A;  3PO2 H;  3SE7 A;  2FMM A;  1PXU A;  4QCL A;  1PDQ A;  2N88 A;  4X66 L;  3TRZ A;  2R86 A;  5F9L A;  5KND A;  4LF8 L;  2VUG A;  2EYP A;  1LTG D;  5G3L D;  1LT4 D;  3AYH B;  3GTM H;  1DCZ A;  1RYS A;  5NUC A;  4OO1 G;  4TQS A;  3URY A;  2VUM H;  4LF9 L;  5KFP A;  3K5O A;  4Q43 A;  4DV6 L;  4X64 H;  1G6P A;  1X56 A;  2Y0S E;  3S1M B;  4BBS B;  2UXC L;  1I6H B;  2AGQ A;  2A6H C;  1V9P A;  4J9M A;  5M5X H;  5I6Y A;  2I8C A;  1F9Q A;  5EAY A;  5JJK A;  3HOW G;  2NN6 H;  4Q8E A;  1I50 B;  2NZ1 D;  4X3T A;  2IP4 A;  4QY7 A;  3PIP 3;  2NU9 B;  2W6M A;  4DUY L;  5C44 B;  4A3J G;  1IKM A;  5DQI A;  4DV4 H;  1I3Q B;  2K01 A;  1ENA A;  4XYO A;  4DR4 L;  1A0I A;  2K7V A;  2Y0S G;  3NSW A;  5ELF A;  2YV5 A;  4LUV A;  2JEA I;  2UU9 Q;  3BJY A;  1YBY A;  4ME5 A;  1HPC A;  4DV2 H;  4MTK A;  3T1Y Q;  2ASJ A;  1PRT B;  3J81 E;  1I94 L;  1NCV A;  2FP4 B;  1WH2 A;  1Q46 A;  1N9W A;  2Q8R E;  3EIV A;  4YJ2 F;  4K6D A;  2XN9 C;  1J5E Q;  4HNV A;  2DUD A;  4MV7 A;  4EEY A;  5KFL A;  4F4W A;  4AH6 A;  3PUW A;  5I9O A;  3MR3 A;  3BZD B;  3S17 B;  1Z9F A;  4JI4 L;  4OIJ A;  5EWF A;  1T5E A;  4B3S Q;  1V51 A;  3NEN A;  3TRE A;  5KFD A;  2K1B A;  3GTP H;  1PFN A;  3TQY A;  2D0O A;  1UEB A;  2VQF L;  2JE6 I;  4CDE C;  4GLV B;  5DQG A;  4IFD I;  1SYC A;  2A69 C;  4IUN A;  2QIL A;  2XNA C;  4YWK A;  1VQ9 A;  4ZQ3 A;  2V5A A;  2JA8 H;  5JPM C;  1K9M C;  2ID0 A;  2JA5 B;  2EY2 A;  4K5V A;  2QDB A;  4O3N A;  2VY3 A;  3NQT A;  1SMX A;  4BXX G;  2EY1 A;  2F03 A;  1OXV A;  2WB1 E;  3QR8 A;  4B3R Q;  2FLP A;  2B2Y A;  2AUK A;  2JA6 B;  1L0W A;  4O4I F;  4Q0Y A;  4YHH Q;  5LMU L;  1HQM C;  2PZW A;  1D8L A;  1E2V A;  1IBL Q;  3X3M A;  3JZI A;  1KIX A;  3A5Z B;  3K5N A;  3H4B A;  1JIC A;  1MJC A;  4DR5 Q;  1VQD A;  3FKI H;  3W5O A;  2HJW A;  4IR9 A;  1Y1W A;  2F0S A;  3RZD H;  4A3L H;  3H20 A;  4X66 H;  3GTM A;  1BCP F;  1U0L A;  2B8G A;  1Y8N B;  5EKI A;  3OTO Q;  1A8V A;  1HTL D;  2O4X A;  1WTW A;  3KHR A;  2ZT9 C;  3ETH A;  2JA5 A;  1GUT A;  4X62 H;  4R4O A;  2MJ8 A;  3K58 A;  2RHQ B;  2KHS A;  5JPN C;  4NXM H;  4LF7 Q;  2VZA A;  3M4Y A;  5JEA G;  1NAP A;  2UVW A;  3MHB A;  1GOZ A;  1S0O A;  4X3K A;  4NMZ A;  5HV6 A;  3J80 W;  3GTJ A;  5IYD H;  4R4I A;  2Z6K A;  3PW4 A;  3U9S A;  3DM3 A;  3GIL A;  5I9P A;  1GGO A;  3JAM W;  1TU2 B;  3CCR A;  1B04 A;  5EJW A;  3UDX A;  1Q86 C;  3OYY A;  4M8A A;  4BBR G;  1PRT D;  3M4O H;  2FKL A;  2JA9 A;  1RTO A;  1S5D D;  3MWY W;  1JCK B;  1E7Z A;  2AHO B;  3W1B A;  2W6Q A;  5A35 A;  2KBN A;  2O5I C;  5JJI A;  1M7J A;  1KRS A;  2Z6B A;  4B3T H;  1EIY B;  2NU6 B;  3FP9 A;  3LX0 A;  3RTX A;  2F0D A;  5FLX E;  1AH9 A;  2I87 A;  1IL2 A;  4ETS A;  3NQI A;  3LML A;  2XC9 A;  3N44 B;  3MWD A;  3MXN A;  4A3B B;  4BXX H;  4LFB L;  1VQE A;  1OXS C;  1WTQ A;  5T1G A;  4DV4 L;  1TS4 A;  3UDG A;  4YP3 A;  3V6J A;  3AEV A;  1HA6 A;  1NSN S;  1UE6 A;  3BDC A;  1S0M A;  3HKZ B;  4UP9 A;  2PW7 A;  5IP7 H;  3RLF A;  3ZYY X;  3HP3 A;  3RN2 A;  3KLW A;  2NWG A;  1I4Q A;  5IWA H;  1LT3 D;  4R4C A;  1L0X B;  3G7L A;  1YHA A;  4DV2 Q;  2RBM A;  4IUP A;  3S14 B;  4V19 0;  4FS1 A;  3BJU A;  5DNF A;  1NUC A;  3UDI A;  1N33 L;  3UQ8 A;  3J80 c;  3O13 A;  3G8C A;  1IXR A;  1SEB D;  4IUQ A;  1HA5 A;  2DWC A;  3S1N B;  2F4V Q;  4JI1 Q;  1DYQ A;  3I4L A;  2J7Z A;  5JJL A;  4WRD A;  2UUC H;  4QWC A;  3I4N G;  2KEC A;  5C6A A;  4IR1 A;  5I6W A;  5GRO A;  4RKB A;  5GAG C;  3GIQ A;  2A6E D;  2K50 A;  1A2U A;  3OWF A;  3WDN A;  3HKZ G;  3FMA A;  1JOQ A;  2O2L D;  3FVQ A;  1E4E B;  1ENF A;  2F0G A;  2K05 A;  2A8V A;  2JA7 G;  3HB9 A;  3PW2 A;  1WTO A;  1A2T A;  3HOZ B;  1HNX H;  2DNC A;  2SCU B;  1EY5 A;  2BH2 A;  2VQF Q;  5KFE A;  2W7O A;  1LTB D;  3TS2 A;  2F0U A;  5KFH A;  4G7O C;  1YNJ C;  5C3X A;  1TY0 A;  1HFG A;  2I46 A;  3HOY B;  2C2E A;  3CCQ A;  2WKC A;  1E3P A;  1JWM D;  3CU7 A;  1GYF A;  4C3H B;  3H6M A;  4RH6 A;  5IWA L;  1TWH B;  3H0G G;  1EZ8 A;  2FPP B;  2R7D A;  4J9R A;  1W2B A;  2F0N A;  1ZHQ A;  4BBS G;  1CS0 A;  1EQR A;  5E4X A;  1M90 C;  3NTK A;  4DR2 L;  3GV7 B;  4K5X A;  3ND9 A;  2UUC L;  4DUY Q;  4DL4 A;  4MZ9 A;  5G3L F;  2HUG A;  4IUT A;  4MV8 A;  2R93 A;  3C3L A;  4ECV A;  4HID A;  3RJ0 A;  3D4W A;  4JI3 H;  3OTO H;  2XIW A;  2PQE A;  1V1P A;  3VA7 A;  4HJ5 A;  1YHQ A;  4K2L A;  3H4D A;  2KUM A;  1WTX A;  3OHX C;  2K32 A;  3S16 H;  4ECT A;  3ORR A;  4NB3 A;  3MXU A;  4XX0 B;  5EDW A;  2KEN A;  1CT1 D;  1BBU A;  4LF6 H;  1SBB B;  2KA7 A;  5LHY 1;  3GD7 A;  4I65 A;  5C1O A;  3BYY B;  5K36 G;  1E4F T;  2VA2 A;  1FJG L;  3S2H B;  1EYC A;  1X65 A;  5IYC H;  1K0R A;  2ZM6 Q;  4ED3 A;  4IUU A;  2EOT A;  4JYA L;  4XYL B;  5KFB A;  2E2H H;  3QO2 A;  2RDH A;  3RLN A;  2F3V A;  1PH3 A;  2R7Z G;  1BKB A;  1SSO A;  3UFX B;  4U67 3;  3CRL C;  3P20 A;  4CKE A;  1O75 A;  3D31 A;  1S5B D;  4HIM A;  2RKS A;  4DUZ Q;  1QWY A;  4K5W A;  3K3P A;  4JBJ A;  2D5D A;  1LT6 D;  4F7X A;  4DV3 L;  1Y1W G;  2YCH A;  3CCJ A;  1JQY D;  1GD7 A;  2G9D A;  4JOI A;  1WCM B;  1H9J A;  1PZJ D;  5COY A;  2W9C A;  4IO9 A;  5JEA J;  3GTJ H;  3HOV H;  5IGF A;  2F0K A;  3KF8 A;  1CSP A;  5DLQ E;  4EG0 A;  4DL5 A;  4K0K H;  1U4P A;  4C1N K;  1SMY C;  2B2T C;  1ZYR D;  4NPS A;  3I4O A;  2E75 C;  2ZJR A;  4A3M H;  3E6Z X;  4TQU S;  4J8Q A;  1C8C A;  4I7H A;  2JEB I;  2KCM A;  5JJZ A;  1RJP A;  4X65 Q;  5KFS A;  4DR7 H;  1T36 A;  1V1Q A;  2V4D A;  3AFQ A;  1EHI A;  4ED0 A;  2OF1 A;  4KY5 A;  1TQO A;  2NVT H;  2R92 G;  2PQA B;  3A55 A;  3HOZ G;  4NXN L;  3F2D A;  4O2A F;  4R7R A;  1EIF A;  5EKK A;  3R8B A;  2EYL A;  4RG1 A;  2HDL A;  2F0T A;  3GTL B;  3K7U C;  4DUZ L;  4A3D H;  3RAX A;  1BDO A;  1JOK A;  4ED2 A;  4AQY Q;  4BY1 G;  4YAK B;  3H0G H;  3H94 A;  1G29 1;  1AEX A;  2QKI C;  3PQI A;  3SDZ A;  4YBZ B;  4J15 A;  5CR3 A;  5L37 A;  3AB9 A;  3U50 C;  3S1Q H;  4UCT A;  3KHG A;  3S17 H;  1PA6 A;  2ZXR A;  2AWN A;  3K5L A;  2NVX B;  1VBG A;  3JRW A;  3JAM c;  2R7M A;  3HKZ E;  1MSG A;  5L1I A;  3VR3 A;  3HOY H;  4RB1 A;  4GLX A;  2W8L A;  5JVG 3;  4DF7 A;  4LWC A;  3E3X A;  4P75 A;  5A2Q L;  1BNZ A;  4ZQI A;  1F9R A;  2R8I A;  2BQR A;  2UUA H;  4C3H H;  4CHT B;  4JV2 A;  4DV5 H;  1W96 A;  3CPW A;  4UPA A;  1UC9 A;  1PFM A;  1STB A;  2A6E C;  2YRW A;  1F77 A;  2BA1 A;  3BQ0 A;  3CKI B;  1TWC H;  5EKL A;  5JVL A;  1HZC A;  4JI8 H;  3ONA B;  1HNW Q;  3HKS A;  2MNA A;  4GKJ H;  1SFO A;  4OEL B;  1VQH A;  3MWE A;  2Z1C A;  5C0X G;  5D8D A;  2E5L Q;  1RJQ A;  2CW7 A;  2FPI B;  1VAJ A;  3D0F A;  2NB0 A;  1N33 Q;  1X3F A;  1EEF D;  2UUC Q;  4YCW A;  3OSP A;  2HGS A;  2K28 A;  5FD6 A;  4F87 A;  3GO5 A;  4HIO A;  2I5L X;  3U4V A;  1VQM A;  4YJ3 F;  4DR6 H;  1WJJ A;  2DZD A;  1LV9 A;  2IT1 A;  5DM7 3;  1CTM A;  2E76 C;  3G48 A;  1UE5 A;  2F0V A;  2NBF A;  3GQC A;  1X9N A;  3RGX A;  4N8X 1;  5ELB A;  2K5N A;  1YZ6 A;  2YTV A;  4DR6 L;  4X66 Q;  2KSW A;  5M9O A;  3A0J A;  1B3A A;  1A15 A;  4C3J H;  2Z4H A;  1X6O A;  4N8F A;  3P75 A;  4WFN 3;  2R87 A;  4LMY A;  4LF5 L;  4H7B A;  4LMQ D;  1E24 A;  5GAD C;  4BY1 B;  4XT3 B;  5D3I B;  4UFZ A;  1DJR D;  3PCO B;  4DV2 L;  2R6G A;  4KY6 A;  4JK1 C;  3PUY A;  1K3B C;  1JB3 A;  3I72 A;  5H1S E;  3CC7 A;  3GTK A;  5IP9 H;  1TWG A;  5EBC A;  4C3I B;  2NTS A;  4Y7N H;  1OO9 B;  4LFA L;  1ZET A;  3EYY A;  2JP1 A;  3MTS A;  2EQS A;  2RSN A;  1Q3L A;  4JI6 L;  3HOZ H;  4JI7 H;  3JRX A;  1D7Q A;  5FPR A;  5FD5 A;  3CCU A;  3QJY A;  1P16 A;  3GV3 A;  2ENB A;  4F8M A;  5DGA A;  5DGB A;  1IBK H;  2ICI A;  1SYF A;  2FK1 A;  4DV7 L;  3RLO A;  1PVO A;  3HOX G;  5IYB G;  3F2B A;  3S2D H;  5KG1 A;  3T1H H;  1PH9 A;  4KHP H;  4QMG A;  4C3I G;  2J4X A;  5LMN H;  1WCM G;  2E2I A;  4P71 A;  2K14 A;  1TR5 A;  1IOW A;  5KFU A;  5IT9 c;  4DV0 L;  1M0T A;  4DL3 A;  5KFV A;  4JI3 Q;  3B6Y A;  1BBX C;  3Q23 A;  1IOV A;  1C9O A;  3J80 L;  2Q2H A;  3G6E A;  1II3 A;  5IYZ F;  4H02 A;  5M5X B;  2YYA A;  1QCB D;  2R61 A;  1AE2 A;  1RJT A;  2EXD A;  3FHW A;  2YU9 B;  3LP8 A;  1KAA A;  2XCA A;  2JA5 G;  2RSO A;  3RF2 A;  1N32 H;  4C56 C;  3HOY G;  4UCV A;  3K59 A;  2C2D A;  2F3I A;  1XXG A;  4BY7 G;  2VQE H;  1DGS A;  2YL2 A;  1AN8 A;  3S1N H;  1XNR H;  5J22 A;  2ZM6 H;  2PPB C;  3IN5 A;  3ERQ A;  2AKW B;  3NTI A;  4HJA A;  3RN5 A;  3L3O C;  4I7A A;  2LMC B;  5ISR A;  4GC6 A;  5LYJ F;  3OHB A;  3HGB A;  4C1N I;  4FBU A;  4J1M A;  4RWS C;  1F9P A;  1JMC A;  1IYV A;  4O4H F;  4BWS C;  2I5M X;  2IL8 A;  3FRP B;  1ICW A;  5IP9 G;  2V4Q A;  4IRC A;  1GVP A;  2QEJ C;  1BCP D;  4F4Y A;  4JI0 Q;  3RGZ A;  3HOW H;  5CAE B;  2SNM A;  2JA8 G;  2ASL A;  2UVV A;  4I4T F;  5LMU H;  3J80 i;  2KHJ A;  4KKT A;  3TSS A;  3K7A B;  1YIJ A;  1XTC D;  3Q2O A;  4A3J H;  4EYI B;  1I3Q A;  3I91 A;  3D8G A;  5FOB B;  1JOR A;  1HNW H;  1TKW B;  3UI2 A;  3HXL A;  3I12 A;  2KHI A;  1JE4 A;  5IT9 E;  1TWG H;  3Q22 A;  4O3S A;  1JB7 A;  2FE3 A;  2CVR A;  4FF2 A;  4OO1 H;  4TKO B;  2D9U A;  5K2M A;  5KFA A;  1BXR A;  4BA1 I;  3KHL A;  1B6S A;  1M1K C;  1HR0 Q;  1EL0 A;  3N6X A;  4DPG A;  2JEI A;  4EQO A;  1B70 B;  3OSN A;  2VW9 A;  4LSA A;  5KG6 A;  3E5S A;  1EYG A;  2M2L A;  2W7P A;  1I4X A;  4OGQ C;  4LFC H;  1D6E C;  5KT2 A;  3J81 W;  3A54 A;  5IIF A;  4Q0F A;  4A3E H;  2BQU A;  1MSH A;  3DWA A;  4QF4 A;  5M3F G;  1VQO A;  1TVX A;  1BUV T;  3DM1 A;  4J9O A;  3SE0 A;  4WJ3 M;  3NP8 A;  5D65 A;  1E2W A;  5LMN L;  1VQK A;  1RKN A;  4DXF A;  5C4Z A;  4B3R L;  3KLS A;  2F52 A;  3V4S A;  4QWD A;  2GA4 B;  1SNM A;  4MV1 A;  3HOX H;  4PNY A;  2NVQ B;  2EDG A;  4LFC Q;  2HT1 A;  3R5X A;  3HOU G;  1TWH A;  1N36 Q;  3PW5 A;  3GIJ A;  1CHQ D;  2EYO A;  4A93 G;  4DR1 Q;  1LTL A;  1KC8 C;  3OPO A;  2NVY H;  3WOE A;  1K28 A;  3H15 A;  1XMQ Q;  5KT5 A;  1V1O A;  4TQR A;  4MV9 A;  2OTJ A;  4QW9 A;  2R92 A;  4JI4 Q;  1SE4 A;  2WFW A;  2UXD Q;  1M4V A;  3G71 A;  1K0S A;  4J9L A;  2A69 D;  1FJG H;  4AQY L;  3I4M H;  1Z2O X;  1QZG A;  1O78 A;  2BDN A;  4IPC A;  1N36 H;  1PFS A;  1B33 N;  4DNI A;  1W3S A;  3TME A;  3PO3 G;  3N8D A;  2YU9 A;  1F2L A;  5ELO A;  1G8Z D;  4ECR A;  3MWM A;  4A3K B;  2OLS A;  1S5F D;  3A7A B;  4P72 A;  4B3S L;  2LXK A;  2A74 C;  5CBA E;  3GTJ B;  1CE8 A;  4UCU A;  4A3F H;  4HR7 A;  1U4M A;  4G7H C;  3S15 B;  3NBI A;  3PV0 A;  3KXY T;  5L1J A;  2WII B;  3C0F B;  4V0B A;  2KVM A;  1NNX A;  2QW7 A;  2IW3 A;  1W6J A;  2CW0 D;  3PUV A;  2GPS A;  5KFW A;  2KQ3 A;  4B3M H;  1OTC A;  5M5W H;  2BOS A;  3V4Z A;  3J80 E;  3VYU A;  1K83 H;  2WV6 D;  3PF5 A;  2UUB Q;  1D1I A;  3X3N A;  1CZG A;  3I70 A;  3T16 A;  3JAM E;  2KEE A;  2F0W A;  2L4N A;  4IHJ F;  3I4N H;  4UCO A;  4K6L A;  1T94 A;  1L1O C;  1LLR D;  5FO7 B;  4JV5 Q;  4DGZ A;  4HQ6 A;  4JBK A;  1VQB A;  1MBY A;  3Q0A A;  1D1K A;  5HGQ A;  4DR7 Q;  4MA0 A;  1KAW A;  1WCM A;  1LT5 D;  3M4P A;  4HTH A;  2QF7 A;  3HOW B;  1F2M A;  5EQ0 A;  3T4A C;  2UXC Q;  4J9Q A;  3L9A X;  2G9H D;  4B08 A;  3L4K A;  4TV8 F;  5M5Y B;  3MR2 A;  2IX0 A;  5IP7 G;  1S40 A;  1HCZ A;  4QGU A;  4LF7 L;  3TP6 A;  1P8L A;  1L1O B;  4O3Q A;  2ASD A;  2IJ0 A;  3BVM A;  4DK6 C;  3DEO A;  4PZ6 A;  5C4J H;  5LMN Q;  1YI2 A;  3CC2 A;  2Y0S B;  4IFD J;  2TMP A;  2D62 A;  1FR3 A;  1SCU B;  2FMA A;  4WOR A;  2WB1 G;  2F4V L;  4YWM A;  2WAQ A;  5GAH C;  1TWC B;  4A3G B;  1PX2 A;  4LF4 H;  3GDE A;  4PMB A;  2NVY A;  4FDB A;  5M3M G;  3PZP A;  2A68 D;  2CWP A;  1CKN B;  2FLN A;  2W6O A;  4JYA H;  4CKB A;  2Z8L A;  4C5B A;  1H95 A;  2F3W A;  4JC0 A;  1Z6H A;  4KY7 A;  4F88 A;  4UDU C;  2ZJQ A;  3H0G A;  3Q8Q B;  2N49 A;  1SND A;  3A8I E;  2BE5 D;  4HYK A;  5KKN B;  1JDB B;  4K8I A;  4A3I B;  3NUC A;  2CFM A;  2DJF C;  3OMC A;  1PTO C;  1T9H A;  4ZHQ F;  1KC7 A;  4UCR A;  4G7Z C;  2R92 B;  1V43 A;  4H0L C;  3G4S A;  1N34 H;  1MI2 A;  5EBD A;  4RCN A;  4LFB Q;  4X6A H;  3CXC A;  3NXW A;  2L0C A;  4FS2 A;  4K14 A;  1GKH A;  4ZKB B;  2OQK A;  1B9N A;  4MN3 A;  2VXW A;  3BVZ A;  1EIH A;  1HRJ A;  5DLF A;  1S68 A;  3HFZ B;  4DR3 Q;  1EYD A;  1AUX A;  1PTO B;  1GLV A;  3BQ2 A;  2JA6 A;  1VF5 C;  1CKO A;  2HHH H;  2Q2I A;  5CV5 A;  4HN7 A;  1TWA B;  4FVM A;  4O2B F;  1H9S A;  1FGU A;  3R2I A;  2FFK B;  3QIA A;  4LNQ A;  2L9H A;  4XQQ A;  2P0A A;  3V6K A;  3FDS A;  2JA5 H;  4DR1 H;  4DV0 Q;  1QNK A;  1LTR D;  2UXD L;  1U4L A;  3D4D A;  4FF3 A;  2FK2 A;  2R3Z A;  1X3P A;  3DF7 A;  4A3J B;  2WDT A;  4DNT B;  1K8O A;  2GPW A;  4DNR B;  2PYK A;  4ED7 A;  1CUK A;  1FD7 D;  4ULL A;  5HY6 A;  3S9W A;  3LGJ A;  2VNU D;  2ZDG A;  2EJG C;  2EY5 A;  1CQI B;  2W6Z A;  2C9O A;  3BZC A;  1S3O A;  4OWW B;  4BA2 I;  4JI5 H;  3D3R A;  2BDO A;  1QVG A;  2ES2 A;  3TP8 A;  3DXJ C;  3N6R A;  5IGG A;  1XJV A;  1HNX L;  3GTO B;  1Q1E A;  1D5X C;  4JI3 L;  1EUD B;  1WOC A;  2NU7 B;  1LTI D;  2FJ2 A;  2YYZ A;  4A3M G;  3RR5 A;  5KEE A;  4TSS A;  5D3D A;  4AIM A;  3CCM A;  1B1Z A;  3SHL A;  3CMA A;  1BGW A;  3GTQ B;  2UU9 H; 
#chains in the Genus database with same CATH homology
 2E2H H;  3CPF A;  2PI2 A;  3RLN A;  1NTG A;  2MFI A;  2OQ0 A;  3CME A;  3CCS A;  1BKB A;  5FLM H;  1PH3 A;  2R92 H;  2R7Z G;  4JI8 L;  4L5T A;  2MQH A;  3D31 A;  4HIM A;  3E0E A;  4GNX A;  3ULJ A;  3PO2 G;  4KI0 A;  4DUZ Q;  1NJI C;  4JBJ A;  3TS0 A;  1PH4 A;  1KHI A;  4DV3 L;  4YCV A;  1Y1W G;  4JI6 Q;  3CCJ A;  4A3B G;  4DR6 Q;  1B7Y B;  4JI5 L;  4IJH A;  1GD7 A;  1VQG A;  2A19 A;  4OO1 I;  4JOI A;  2AWO A;  4IO9 A;  5JEA J;  3GTJ H;  4JI0 L;  3KF6 B;  2E8G A;  3HOV H;  5M3M H;  1CKN A;  2B63 H;  4A3F G;  1IBK L;  3E9H A;  1FL0 A;  1CSP A;  5DLQ E;  3S2H H;  1QVF A;  4DV5 Q;  5C44 H;  2B63 G;  1HH2 P;  4QIW E;  3K7A H;  4NPS A;  3I4O A;  4BBR H;  3L2P A;  3E9I A;  4P73 A;  2ZJR A;  4TQU S;  4A3M H;  4GKK Q;  1WYD A;  1J6Q A;  2JEB I;  2KCM A;  2PMZ E;  3AQQ A;  4KHP L;  3I2Z A;  1BBW A;  4K0K Q;  3CD6 A;  3BU2 A;  1OXX K;  4X65 Q;  1N8R C;  3S15 H;  3EN2 A;  4YWL A;  1V1Q A;  4R4Q A;  3AFQ A;  5C3E H;  3PSI A;  4OX9 L;  2NVT H;  1NE3 A;  2EIF A;  4JYA Q;  5FLM G;  1VQ6 A;  2R92 G;  2PQA B;  2ZTC A;  5IYB H;  4X64 Q;  4HJ9 A;  1VQP A;  3ER0 A;  4NXN L;  3HOZ G;  4DAY B;  3F2D A;  1EIF A;  4RG1 A;  3UE1 A;  4YHH L;  5LMU Q;  1XPR A;  4IOA A;  3K7U C;  3CF5 A;  4DUZ L;  4A3D H;  2VS1 A;  1VQC A;  4DV6 Q;  1N34 Q;  4P74 A;  4AQY Q;  4BY1 G;  2JA6 G;  3H0G H;  1G29 1;  4DV3 Q;  4A76 A;  3TEH B;  4J15 A;  4LW1 A;  3U50 C;  1J5E L;  3S1Q H;  3NEM A;  2PI2 E;  4R4T A;  1I5F A;  2I5H A;  1PA6 A;  3S17 H;  1A62 A;  2AWN A;  1HNZ L;  5FLX c;  1YNX A;  3JAM c;  4DV5 L;  4IOC A;  3HKZ E;  3M4Q A;  3GTQ H;  3HOY H;  4GLX A;  4IJL A;  4LWC A;  4P75 A;  5AJ3 L;  2R93 G;  4OWX B;  1QUQ A;  3K8A A;  4A3E G;  3S24 A;  4C3H H;  1KQS A;  5M3F H;  1YJW A;  3I4M G;  4A3G H;  3CPW A;  4UPA A;  2C35 B;  2HHH L;  1EQQ A;  4X65 L;  2GN5 A;  2KCT A;  2YTX A;  1I3Q H;  2BA1 A;  2OCE A;  1N32 L;  1TWC H;  1HZC A;  4LF6 L;  1HNW Q;  1Q7Y C;  3HKS A;  1EUJ A;  5LMN W;  2MNA A;  4NXN Q;  1JT8 A;  4JCV E;  1VQH A;  4DV4 Q;  2L15 A;  2UU9 L;  2ASB A;  5C0X G;  1KD1 C;  2MO1 A;  2CWA A;  2ZM6 L;  2E5L Q;  4BY1 H;  4A3C H;  1TXY A;  2WAQ E;  3D0F A;  3KFU A;  3L7Z C;  1N33 Q;  1X3F A;  4A3C G;  2UUC Q;  4LF4 Q;  4YCW A;  1E1T A;  1AE3 A;  3GO5 A;  4HIO A;  2I5L X;  2B3G A;  4JI2 Q;  1EWI A;  3U4V A;  1VQM A;  1XMO L;  4A93 H;  1VQ5 A;  3STB D;  4YCU A;  1C7Y A;  1WJJ A;  1SRO A;  2PNH A;  4PMW A;  2IY5 B;  2I0Q A;  2IT1 A;  4OXP A;  1QVC A;  2BA0 A;  4ME3 A;  3BZK A;  3CW2 C;  4DKA C;  1PH5 A;  3G48 A;  3CCL A;  1ASZ A;  1UE5 A;  1VQ7 A;  2QGQ A;  1KL9 A;  1X9N A;  4GN4 B;  3WWV A;  4DR6 L;  1IYJ B;  2K5N A;  1YZ6 A;  2YTV A;  1PV4 A;  4X66 Q;  4K0K L;  3A0J A;  2HHH Q;  4C3J H;  1X6O A;  1O7I A;  2ALY B;  2ZTD A;  4LF5 L;  4QQB X;  1R9T H;  5GAD C;  1E24 A;  3PCO B;  4DV2 L;  3GTO H;  4X62 Q;  3ULL A;  4A3D G;  2R6G A;  3KF6 A;  3KOJ A;  1I6H H;  3KJO A;  3L0O A;  3PUY A;  2N3S A;  3W1G A;  5H1S E;  1XMQ L;  3CC7 A;  1TWH H;  5IP9 H;  1XNQ L;  1JE5 A;  4GLA C;  4JI8 Q;  5IYD G;  2VQE L;  5C0X J;  4DR1 L;  1HR0 W;  3RNU A;  4IFD G;  2RCN A;  3ICE A;  4Y7N H;  5C44 G;  3MXN B;  4LFA L;  5C0X I;  1XPO A;  3PUX A;  1Y1V G;  1OXU A;  1K8A C;  2EQS A;  4JI6 L;  3HOZ H;  1D7Q A;  3OTO L;  4OX9 Q;  3CCU A;  1LUZ A;  1P16 A;  2K4K A;  1HZB A;  1Z47 A;  4DV7 L;  3KDF B;  4XIG S;  3RLO A;  1GO3 E;  3PIO A;  1PVO A;  3JC6 6;  1X3E A;  5IYB G;  3HOX G;  3F2B A;  1K73 C;  3SGI A;  2OTL A;  4A4I A;  1PH9 A;  3S2D H;  2K5H A;  3ERS X;  3J7Z C;  2K52 A;  1PYS B;  2IHF A;  3H3V H;  2DGY A;  4A3K G;  1IBK Q;  1FVI A;  1WCM G;  3CP0 A;  5IYC G;  4P71 A;  2K14 A;  3Q8D A;  1U5K A;  1N36 L;  5IT9 c;  4DV0 L;  3NBH B;  1GM5 A;  3J81 c;  1N32 Q;  4JI3 Q;  1IBM L;  3VDY A;  3B6Y A;  3T1H Q;  1YEZ A;  1C9O A;  2Q2H A;  4MTN A;  3G6E A;  2B29 A;  2JA7 H;  4H02 A;  4UP8 A;  3STB C;  4JOI C;  4DR2 Q;  1JJC B;  3FHW A;  4KHP Q;  1AE2 A;  1VQI A;  2EXD A;  4EQ5 A;  3ZJY C;  4GS3 A;  3A74 A;  4HIK A;  1VQL A;  4JI7 L;  2JA5 G;  3PO2 H;  5IE8 A;  1XNR L;  3CC4 A;  4PG3 A;  1Y1V H;  4X66 L;  3HOY G;  3TRZ A;  1Y1W H;  4LF8 L;  1I94 Q;  2F3I A;  2QEX A;  4QJF A;  3AYH B;  3GTM H;  4BY7 G;  2VUM G;  3M9B A;  1DGS A;  3S14 H;  1EOV A;  4OON A;  4OO1 G;  3S1N H;  5IWA Q;  2FXQ A;  2VUM H;  4DR3 L;  4LF9 L;  5E7N A;  2AKW B;  3GTL H;  3HOU H;  4IPD A;  4DV6 L;  4HJA A;  3J81 j;  3RN5 A;  1NBW A;  2LSS A;  1G6P A;  1YIT A;  1WI5 A;  1X56 A;  1A63 A;  2Y0S E;  3M7N A;  2UXC L;  1B8A A;  4YY3 L;  1OXT A;  3I55 A;  1V9P A;  3MEF A;  5BR8 L;  5M5X H;  1JMC A;  1WCM H;  5EAY A;  2WAQ G;  2I5M X;  5JJK A;  3HOW G;  5IP9 G;  3S1R H;  1Q1B A;  5M5Y H;  1G51 A;  1GVP A;  4QY7 A;  1X3G A;  4JI0 Q;  3HOW H;  2JA8 G;  4DUY L;  2N8N A;  4A3J G;  4L5R C;  3J80 i;  2KHJ A;  1LM0 A;  5ELN A;  1YIJ A;  3UDF A;  4GNX B;  4JBM A;  4A3J H;  4DR4 L;  1A0I A;  2VL6 A;  1C0A A;  4O2D A;  4GKK L;  2Y0S G;  2JEA I;  1X55 A;  2YV5 A;  4LUV A;  3PO3 H;  2UU9 Q;  4POF A;  1YBY A;  4GN3 B;  3T1Y Q;  1VS0 A;  1I94 L;  4BY7 H;  4LF8 Q;  2KHI A;  4HJ7 A;  1Q46 A;  1TWG H;  3OW2 A;  1JB7 A;  1HNW L;  1N9W A;  4GOP B;  2ZTE A;  3EIV A;  3CAM A;  1KRT A;  1J5E Q;  2DUD A;  4BA1 I;  1M1K C;  2CKZ B;  2HQL A;  1HR0 Q;  4AH6 A;  2N78 A;  3PUW A;  2NVX H;  2XGT A;  3KYH C;  2AMC B;  4DPG A;  3K81 C;  1B70 B;  1Z9F A;  4JI4 L;  2VW9 A;  4B3S Q;  3F8T A;  1EYG A;  4A3I H;  3NEN A;  3TRE A;  2UUA L;  3GTP H;  1ASY A;  3TQY A;  2D0O A;  1UEB A;  2VQF L;  1L1O A;  2JE6 I;  1YVC A;  4LUZ A;  3PF4 A;  1CSQ A;  4GLV B;  3H3V I;  2D0P A;  2Z6K C;  2GVB A;  1HNZ Q;  4YWK A;  1JJ2 A;  1VQ9 A;  4L5S A;  4IFD I;  2R93 H;  4Y52 H;  2JA8 H;  1VCI A;  4A3E H;  3DLL A;  1K9M C;  5M3F G;  3AFP A;  1VQO A;  2CQO A;  2ID0 A;  4DV7 Q;  4X62 L;  4R1J A;  2WP8 J;  4WJ3 M;  2K5V A;  1E1O A;  5IY0 A;  2VY3 A;  5LMN L;  1Q82 C;  1VQK A;  1SMX A;  2JK8 A;  5FJ8 H;  4YY3 Q;  2ZJP A;  1OXV A;  2WB1 E;  4DK3 C;  4BXX G;  4B3R Q;  1IZ6 A;  4B3R L;  2F52 A;  1L0W A;  4OWT B;  4YHH Q;  3HOX H;  5LMU L;  1Q81 C;  4B3M L;  4B3M Q;  3M3Y H;  1D8L A;  4RMF A;  3CCE A;  1IBL Q;  4LFC Q;  2HT1 A;  1KIX A;  3A5Z B;  3GTK H;  3HOU G;  1N36 Q;  1YHB A;  1MJC A;  4DR5 Q;  4A3K H;  2HIX A;  1VQD A;  4QL5 A;  3FKI H;  4A93 G;  4DR1 Q;  1SRU A;  2UXB L;  1LTL A;  3W5O A;  1KC8 C;  2NVY H;  3RZD H;  4A3L H;  1UE7 A;  3H15 A;  1XMQ Q;  1I50 H;  2OTJ A;  1U0L A;  1QUQ B;  2QA4 A;  3I7F A;  4JI4 Q;  1HZA A;  3OTO Q;  2WFW A;  4JI5 Q;  2R7Z H;  3G71 A;  2UXD Q;  1Y14 B;  1A8V A;  3K0X A;  4AQY L;  3I4M H;  3F1Z A;  4R4O A;  1QZG A;  2RHQ B;  4IPC A;  1PFS A;  4LF7 Q;  2VZA A;  4DNI A;  1W3S A;  3EBE A;  5JEA G;  1SLJ A;  3A5U A;  3PO3 G;  2JQO A;  5ELO A;  1KXL A;  1CKM A;  1MIU A;  4TVA B;  2E2I H;  2RHS B;  2NZH A;  5IYD H;  4R4I A;  2Z6K A;  4P72 A;  4B3S L;  2LXK A;  3DM3 A;  3I56 A;  4JI7 Q;  4A3F H;  4B3T Q;  3CCR A;  3UDX A;  1Q86 C;  3OYY A;  3PV0 A;  1E22 A;  2K75 A;  4BBR G;  1YJ9 A;  3M4O H;  1N34 L;  4DV1 Q;  4LF5 Q;  1VQJ A;  4DR4 Q;  2JA9 A;  1MKH A;  3PUV A;  4POG A;  2NN6 G;  1TWF H;  4A3L G;  1E7Z A;  2AHO B;  3W1B A;  4PZ7 A;  1RIP A;  5M5W H;  2KBN A;  4KLK A;  1OTC A;  5JJI A;  1KRS A;  4L5Q A;  1K83 H;  3PF5 A;  1EIY B;  2UUB Q;  4APV A;  3FP9 A;  4JI1 L;  5C3E G;  4NXM L;  1VQN A;  1IBL L;  3T1Y L;  1AH9 A;  4HJ8 A;  1HZ9 A;  1IL2 A;  2R7F A;  1PH2 A;  3I4N H;  1UWV A;  4JI2 L;  1WFQ A;  2H5X A;  1L1O C;  1UE1 A;  4JV5 Q;  5FJ8 G;  4BXX H;  4LFB L;  1VQE A;  1OXS C;  1QZH A;  4JBK A;  4O0A A;  1VQB A;  4DV4 L;  3U58 A;  3UDG A;  3PUZ A;  4LF9 Q;  3CCV A;  5HGQ A;  1HJP A;  1HR0 L;  1KAW A;  4LFA Q;  4DR7 Q;  4MNO A;  2E5L L;  3AEV A;  3M4P A;  5BR8 Q;  4EX5 A;  2YTY A;  1UE6 A;  2YU9 H;  2UXC Q;  4UP9 A;  5IP7 H;  3RLF A;  1SN8 A;  2VQE Q;  3RN2 A;  1PH8 A;  4A75 A;  3KDF A;  3RZO H;  3KLW A;  1SR3 A;  1XNR Q;  2IX0 A;  5IP7 G;  4R4C A;  1S40 A;  5C4X G;  4QGU A;  4LF7 L;  2Z0S A;  4JBW A;  4JG2 A;  1K8G A;  1P8L A;  1L1O B;  1YHA A;  4DV2 Q;  4LUO A;  1IBM Q;  1VQ8 A;  4DK6 C;  3CC2 A;  5LMN Q;  4PZ6 A;  5C4J H;  1YI2 A;  3BJU A;  3UDI A;  4IFD J;  1N33 L;  4C2M H;  3J80 c;  2D62 A;  1IXR A;  3JAM i;  1BVS A;  4A3B H;  5GQO A;  4IPH A;  4X64 L;  5GAE C;  3PIP A;  2WB1 G;  2F4V Q;  2F4V L;  4YWM A;  4GOP C;  1PH7 A;  4JI1 Q;  3UE0 A;  1EFW A;  2UUB L;  2BH8 A;  5GAH C;  5JJL A;  1XPU A;  3GDE A;  4FDB A;  5M3M G;  4LFC L;  1SFO H;  3I4N G;  4AYB E;  2UXB Q;  2CWP A;  4ALP A;  1CKN B;  2XTI A;  1LYL A;  3S1M H;  4BBS H;  5GRO A;  2NN6 I;  5GAG C;  3M85 A;  1H95 A;  2K50 A;  4JC0 A;  2ZJQ A;  4GNX C;  1Q8K A;  3HKZ G;  2N49 A;  1NMG A;  2Q2U A;  1Q12 A;  3GTG H;  4GKJ L;  2PQA A;  3FKI G;  2A8V A;  4NXM Q;  5AJ3 Q;  1TWA H;  2CFM A;  2JA7 G;  2JJQ A;  3J7A 5;  3K80 C;  1T9H A;  1XNQ Q;  2MO0 A;  1V43 A;  1X54 A;  5C4X H;  3G4S A;  2VQF Q;  1K3R A;  1VQ4 A;  5J3B A;  1YJN A;  2BH2 A;  3TS2 A;  3CQZ H;  2Q2T A;  4UY8 C;  4LFB Q;  2CCZ A;  4X6A H;  3IRB A;  3CXC A;  2E2J H;  2HIV A;  4PZ8 A;  3CCQ A;  1E3P A;  3KF8 B;  1GKH A;  1HNX Q;  2OQK A;  4B3T L;  1PHJ A;  3T1H L;  5IWA L;  3HFZ B;  3H0G G;  4DAM A;  4DR3 Q;  1NY4 A;  2LXJ A;  2NZO A;  2R7D A;  4C3I H;  3F2C A;  1W2B A;  1CKO A;  1FJG Q;  3PGZ A;  2GVA A;  2Q2I A;  4BBS G;  2V1C C;  1EQR A;  2UUA Q;  4DV1 L;  1PH1 A;  4DR5 L;  1FGU A;  1M90 C;  4DR2 L;  4UP7 A;  4JV5 L;  1PYB A;  3J81 i;  2UUC L;  4LF4 L;  1MJE A;  4LNQ A;  2RF4 A;  4XTC S;  1JJG A;  4GKJ Q;  1XMO Q;  2JA5 H;  4DV0 Q;  2UXD L;  4DUY Q;  4AYB G;  4MZ9 A;  1VQA A;  1VQF A;  2A1A A;  3U4Z A;  4HID A;  2IX1 A;  1CUK A;  2NVQ H;  5HY6 A;  3LGJ A;  2VNU D;  4GN5 A;  2IHE A;  4HJ5 A;  1YHQ A;  4WJ4 A;  4A3G G;  3BZC A;  1S3O A;  3NEL A;  4OWW B;  4BA2 I;  3KJP A;  3S16 H;  2ATW A;  1S72 A;  2ES2 A;  1RL2 A;  4NB3 A;  1QVG A;  4DR7 L;  1XJV A;  1HNX L;  2KEN A;  1Q1E A;  4JI3 L;  2OWO A;  3HOV G;  1WOC A;  1PH6 A;  1BBU A;  2YYZ A;  4A3M G;  3RR5 A;  1L2F A;  3GD7 A;  1XTD A;  1SE8 A;  4GOP A;  5K36 G;  4AIM A;  3CCM A;  3ULP A;  4IPG A;  3CMA A;  1FJG L;  4A3I G;  1X65 A;  1NMF A;  1K0R A;  5IYC H;  2ZM6 Q;  4KHZ A;  2JA6 H;  4JYA L;  4LF6 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...