2JA6G

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja6G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja6G01
2OQ0A 3J7A5 4UY8C 4HJ7A 1Q46A 1QUQA 1RIPA 2VUMH 4Y52H 2R7ZH 1ASZA 1E22A 1X54A 3CMEA 5ELOA 1VQMA 1Q7YC 4LW1A 1PH6A 3CD6A 1A8VA 4YWKA 1OXUA 2I5HA 2F4VQ 4ALPA 4NB3A 1IBMQ 4LF7Q 3RN2A 1VQCA 4DR2Q 2VZAA 4DV6L 4LWCA 3S1NH 2UXDL 2NZOA 3I4NG 2V1CC 4R4CA 1X9NA 4JI6L 3W1GA 3ULJA 4A4IA 1PH9A 4A3LG 2JA9A 5IWAQ 4LF9L 1X3EA 3PUZA 3CXCA 4UP7A 5LMNQ 3UDIA 1OXVA 2ALYB 1NY4A 2F3IA 3OW2A 4MZ9A 2RHSB 2Z0SA 2PQAB 4GNXA 3JAMc 3G48A 1KRTA 5GAGC 5H1SE 4KHPL 3T1YQ 1UEBA 1X6OA 4LFBQ 3TS2A 4B3TQ 5FLXc 2D0OA 3PF5A 3GTQH 1HNXQ 1VQJA 4JI5L 2JA7G 4LF4L 3FKIH 2BA0A 5GAEC 2VS1A 1N9WA 1YBYA 3Q8DA 4GLXA 2UU9Q 1VQOA 2R92H 4B3RL 1W3SA 1VQKA 1MKHA 2GVAA 3OTOL 3S16H 1K8AC 4GKKL 2AHOB 3ERSX 3F2DA 2MFIA 4JI8L 2NVTH 1X56A 4YCVA 4A3MG 4BA2I 3KF8B 4A93H 3HOYH 2IT1A 4DAMA 1EUJA 2AKWB 5M5YH 4A3EH 1E1OA 4QY7A 2CKZB 2RCNA 2UXDQ 3PUXA 4DV1L 1PH7A 3TQYA 1I94Q 1SR3A 4JOIA 3TS0A 1CSQA 4LF6Q 4LUVA 2CCZA 4DV3L 1XMQQ 4BA1I 3S1QH 4BY7G 3GTGH 3HKSA 2VQFQ 2HIVA 4AIMA 1YIJA 3E9HA 4DV4L 1X55A 1L0WA 4LUZA 1KD1C 3CCLA 4O2DA 4P73A 1VQBA 1UE7A 5C0XJ 4IPHA 1PH2A 2K5VA 3CPWA 1VQAA 1JMCA 4KHPQ 3CQZH 4OO1G 2VUMG 1WFQA 2R7ZG 3ICEA 2I5LX 1TWCH 3CCJA 2I5MX 4YHHQ 4IO9A 1UE5A 4JI5Q 3S1MH 2IY5B 1G6PA 4DV7Q 2NVQH 1O7IA 3GTKH 1WJJA 2K75A 4DR6L 3PCOB 2IHFA 5EAYA 4AYBE 4QQBX 3DLLA 1BBUA 3F1ZA 4DKAC 5IY0A 2KHIA 4DR1L 1GD7A 4YY3L 4X65Q 3GTMH 1B7YB 2EXDA 4GKKQ 2PI2E 1OXSC 3PSIA 5DLQE 4XTCS 4QJFA 2VW9A 3CAMA 2PQAA 3RZDH 4BY1H 1YVCA 2JEBI 2ZM6Q 1D8LA 2OTJA 1KC8C 4X6AH 4R4QA 1Q82C 1VQ8A 2OQKA 2ZTEA 1UE1A 3AFQA 4NXNL 2F4VL 4C3JH 5JJKA 4MTNA 1IL2A 4X62Q 1IBML 1E7ZA 4DV1Q 1L2FA 4TQUS 2ZJRA 3HOVH 3JC66 4RMFA 1Q86C 2L15A 5C44H 3I56A 4L5RC 3S1RH 2N8NA 3H15A 3CCSA 1PA6A 1JT8A 3PIPA 3HOUH 2HT1A 2ASBA 1GM5A 3J81c 3G4SA 4DV4Q 4IFDI 2FXQA 1CKNB 4LUOA 1VQHA 3FKIG 5LMNL 4A3KH 1XNQL 1RL2A 1JE5A 2UUAL 1HZCA 4PMWA 1QVFA 4R1JA 3TEHB 1NBWA 2R92G 4BY7H 2XTIA 2JA5H 3PIOA 3S24A 1AH9A 3T1YL 4YCWA 1IXRA 2PI2A 4B3TL 1C9OA 4DR6Q 2GN5A 4A93G 1NTGA 3HOYG 3A5ZB 2Q2TA 1KAWA 2D0PA 1E1TA 4DR1Q 2CWAA 4DV0Q 1K9MC 4YY3Q 2UU9L 4A3EG 3GTJH 4PZ6A 1H95A 3E9IA 2BA1A 1TWAH 4HJ8A 3I2ZA 1VQLA 4JI2L 1VQNA 4DK3C 1XNRQ 3CMAA 4OX9Q 4X64Q 1XTDA 1SLJA 4NXNQ 1N34Q 1LTLA 2K5NA 3LGJA 1R9TH 3L0OA 1N36Q 3G6EA 2ZJPA 4IJHA 3KYHC 1PH1A 3J81j 1T9HA 1YITA 3GD7A 1SFOH 2E2IH 4GN3B 5ELNA 1I94L 4BBSH 3CP0A 3M85A 4LF6L 3OYYA 1XMQL 3RN5A 1CSPA 4A3JH 4WJ4A 3FHWA 3A5UA 1YI2A 2VQFL 1E24A 3GO5A 1XNQQ 4HJAA 2UUAQ 2QGQA 4DV5Q 3RNUA 3AQQA 3PF4A 3K7UC 1VQ4A 1LM0A 5M5XH 2H5XA 3GTOH 2Z6KC 3PUWA 2JA5G 4A75A 4BY1G 5HGQA 4X66Q 3CCQA 4C2MH 5JEAJ 4YHHL 2Q2IA 4IPDA 5BR8Q 1GVPA 4DV7L 1D7QA 4K0KQ 2JA6H 2QA4A 4IPGA 1VQFA 2AWNA 3I55A 1TWGH 4C3IH 1LUZA 1CKNA 3M4PA 4B3MQ 5IYCH 4X65L 2E2HH 3HOVG 2OWOA 3DM3A 3D31A 2F52A 2OTLA 4JBKA 4JI2Q 5FJ8H 5IP7H 5C44G 2ZM6L 3K0XA 1JJCB 4DUZL 3HOUG 4R4IA 4OWTB 2NN6I 2ZTDA 3L7ZC 3F2CA 4DAYB 1AE2A 1BKBA 3VDYA 2E5LQ 1XMOL 4DR4Q 4GN4B 2UXBL 2A19A 2YTXA 2JQOA 3UDFA 4X62L 1KRSA 1S3OA 2MQHA 3K7AH 4A3KG 1Y1WH 1X3GA 4QIWE 1VQ5A 4R4TA 4R4OA 3CC7A 3A0JA 1K73C 4LF8Q 1GKHA 4A3FH 1DGSA 1SROA 1YHAA 1YZ6A 3KLWA 4YWLA 3CF5A 2PMZE 4LFCQ 3ZJYC 3TRZA 3M4OH 1P16A 2WP8J 5C0XI 1K83H 2AWOA 1Z47A 1NJIC 3HKZE 2UUBQ 2MO1A 3AFPA 3PGZA 3W1BA 5IYBH 4JI3Q 4LF5Q 4JBJA 4RG1A 5FLMH 1XPOA 4C3HH 4HJ9A 3H0GH 1UE6A 3K81C 2RHQB 1EIFA 2LXJA 1M1KC 3GDEA 4DR7L 5C4JH 2HHHQ 1SE8A 3S14H 2K52A 4HIOA 1JJ2A 1I6HH 4QL5A 5AJ3L 4BBRH 3IRBA 2CWPA 1PH4A 1VQ6A 3M7NA 3S2DH 1ASYA 1HNWQ 5C3EH 4A3DH 5C4XH 4JI7Q 2YYZA 1N32Q 4JC0A 5IYDH 3M9BA 4P72A 4JI1Q 3W5OA 1C7YA 3PUYA 1EIYB 5M5WH 4KLKA 3BJUA 5GADC 2CQOA 4DV0L 3RLOA 3M3YH 1PH5A 2KBNA 5M3MH 4GKJQ 2UXCQ 5GROA 1IBLQ 1EFWA 3CW2C 4MNOA 2UUCQ 1PFSA 4OWWB 4FDBA 4P71A 4DUZQ 4BBSG 1N33L 4DUYQ 1XNRL 4OX9L 4X64L 4UP9A 4A3JG 1XMOQ 3RZOH 4OONA 2UXBQ 2WAQE 1QZHA 1N34L 2R93G 2VQEL 3FP9A 3F2BA 3BU2A 1W2BA 1PHJA 1UWVA 3NEMA 1N36L 4GOPC 1U0LA 1YJ9A 4A3IH 4POGA 1V1QA 2WB1E 3S2HH 3KOJA 2N78A 2B63H 4LFAL 4NPSA 2K50A 3MXNB 1Q12A 2GVBA 4H02A 1A63A 1NE3A 4A3GH 4UPAA 4DR7Q 1A62A 2JA6G 1Q1BA 1FVIA 3RLNA 5J3BA 1M90C 4DV5L 3PO2H 1KL9A 3CCVA 5AJ3Q 2WFWA 1XPUA 4BXXH 4L5QA 4P74A 5IYCG 3STBD 4JBWA 3CPFA 3PO3H 3KF6B 4X66L 4GN5A 3AYHB 3J80i 1VQGA 3BZKA 5IP7G 5FJ8G 4APVA 2E8GA 3EBEA 3HFZB 5BR8L 4PZ8A 2KCTA 3UDXA 4DR5Q 1XJVA 1KQSA 1AE3A 4K0KL 5JJLA 2NZHA 1HZ9A 4PG3A 3EN2A 3CCMA 3HOXH 4IOCA 1EYGA 2JA8H 2ZTCA 1J5EQ 4KHZA 1Y1WG 4B3ML 2Z6KA 3I4OA 5IT9c 3S15H 3I7FA 1CKMA 4EQ5A 1I5FA 2DUDA 2R7DA 1L1OC 2KENA 1N33Q 1KHIA 3TREA 1CKOA 3K80C 5LMUQ 4A3FG 3HOZH 4GOPB 4JG2A 4IPCA 1NMGA 2VQEQ 1QZGA 2E5LL 1HH2P 5IP9H 2IX1A 2RF4A 3UE0A 5IYBG 4DR4L 1WYDA 1SN8A 5FLMG 3J7ZC 1HNZL 3H0GG 1VQ7A 1MIUA 3I4MH 2PNHA 4NXML 1K8GA 4IOAA 3KJOA 1EWIA 1B70B 4BBRG 1JB7A 4GS3A 4LFAQ 2HIXA 2QEXA 1YHQA 4LFCL 4LF8L 2NN6G 1G291 1A0IA 1GO3E 5C3EG 4A3DG 3A74A 3UE1A 5IYDG 3S17H 3UDGA 3ULPA 2Y0SG 2UUBL 1C0AA 4LF5L 5GAHC 4JI3L 4GLAC 2OCEA 1FJGQ 3EIVA 2JE6I 3SGIA 2HHHL 2JJQA 4L5SA 3HOWH 5M3MG 1MJEA 2VY3A 1WOCA 5M3FH 5C0XG 1EQQA 1Q81C 3CC4A 4UP8A 4JI0Q 4A3BH 4JI7L 4TVAB 4DR3L 1HNWL 1N32L 2YV5A 1Y14B 4EX5A 4A76A 1HJPA 4JI1L 4IJLA 2ES2A 1P8LA 1L1OB 2VL6A 2XGTA 3CCUA 2VNUD 1HR0W 4GKJL 1OXXK 3JAMi 4A3IG 2UXCL 3T1HQ 2B29A 2N49A 4DNIA 4QGUA 1IBLL 2AMCB 2Q2UA 2UUCL 4B3SL 4JYAQ 3G71A 2R6GA 1TXYA 2B63G 4DUYL 1FGUA 3KF6A 4AQYQ 4DK6C 5E7NA 4JV5Q 1VQEA 3CC2A 1X65A 1HNZQ 4YWMA 1G51A 1S40A 4A3GG 1K3RA 4PZ7A 4NXMQ 1EOVA 1K0RA 4JI4L 5C4XG 1QVCA 3PO2G 2C35B 1BBWA 2R93H 4AH6A 1WCMH 3CCRA 4BXXG 3D0FA 2JK8A 1VQPA 1Y1VH 1S72A 2B3GA 2E2JH 1Q8KA 1IZ6A 1IBKL 2ATWA 3PO3G 4A3CH 1V43A 1VS0A 1I3QH 1CUKA 1HR0L 1N8RC 4GOPA 5K36G 4DV2L 2LXKA 3E0EA 4LNQA 3KFUA 2D62A 4OWXB 3HOXG 1YJWA 2JA8G 1JJGA 3NENA 3KDFB 1X3FA 3U4ZA 4DV6Q 1FL0A 1WI5A 4DR3Q 4IFDG 3B6YA 4JI6Q 4P75A 3U4VA 1PH8A 2EQSA 4GNXC 4LF9Q 3HOZG 1MJCA 4DR5L 2BH8A 1HZBA 5IP9G 2YTVA 2DGYA 3H3VI 1VQIA 1OTCA 1SRUA 1J5EL 4ME3A 1PV4A 4HIDA 5GQOA 4B3SQ 1QUQB 3I4MG 5IE8A 1TWHH 1E3PA 3I4NH 1PYBA 2YTYA 2MO0A 4A3LH 1QVGA 3U50C 1I50H 5LMUL 1OXTA 1SMXA 1Q1EA 2K4KA 3U58A 3CCEA 2K14A 1PH3A 4LF4Q 3PV0A 4JI4Q 2HQLA 1VQ9A 3K8AA 4POFA 1L1OA 5JJIA 4B3RQ 1KIXA 2JEAI 3MEFA 1HZAA 1LYLA 2CFMA 3HOWG 3F8TA 3OTOQ 3HKZG 5M3FG 1IBKQ 2ZJQA 3BZCA 4GLVB 1VQDA 3KJPA 5LMNW 4A3BG 2IX0A 2N3SA 1HR0Q 4JOIC 4DV2Q 3H3VH 4JI8Q 2EIFA 2JA7H 4L5TA 1KXLA 3NBHB 4HJ5A 4JBMA 3WWVA 4OXPA 3AEVA 1FJGL 2I0QA 1VCIA 4Y7NH 3RLFA 4LF7L 5HY6A 1TWFH 4GNXB 4J15A 4DR2L 1BVSA 3NELA 1Z9FA 3ER0A 3ULLA 4YCUA 4JI0L 4HIKA 2YU9H 2Q2HA 4AYBG 1V9PA 2A1AA 4KI0A 2MNAA 3J81i 4DV3Q 1J6QA 4JCVE 4A3MH 4OO1I 3J80c 2NVYH 5IWAL 2A8VA 1B8AA 2KCMA 5JEAG 2NVXH 1YEZA 1YNXA 4XIGS 2Y0SE 1IYJB 4O0AA 1YJNA 1U5KA 3T1HL 3GTLH 2IHEA 3KDFA 2ID0A 1NMFA 1WCMG 2R7FA 4JYAL 4IFDJ 2WAQG 2KHJA 2BH2A 1Y1VG 1XPRA 3M4QA 4AQYL 3GTPH 4A3CG 4DPGA 4JV5L 1EQRA 4HIMA 4LFBL 3RR5A 1PYSB 3PUVA 3STBC 2WB1G 1HNXL 1PVOA 3L2PA 2K5HA 4WJ3M 2LSSA 1YHBA
chains in the Genus database with same CATH superfamily
4HJ7A 1QUQA 1RIPA 4AQYH 4ZUIA 1QJOA 3GTGA 1E22A 1X54A 5D1OA 1S5DD 1W93A 4NXMH 3BABA 2MJ8A 3CD6A 1OXUA 2WV6D 1E4EB 3DHQA 3EYYA 2IMWP 3RN2A 4DR2Q 4PQXA 4DV6L 3V6JA 1STNA 1KTKA 3OWFA 2HCIA 4LWCA 2UXDL 1B4OA 4YJ2F 5JVLA 3QB3A 2R84A 1X9NA 2YCHA 2J6UA 4A4IA 5KFTA 3L4JA 3GTKA 4A3LG 3SVMA 5A2QL 1CI3M 4UP7A 2NTSA 5LMNQ 4ZQIA 2V4DA 4DV6H 2FLNA 4KN4C 2JA5A 2F3IA 1A3UA 2QKIC 2W70A 4DR3H 3DWQA 2Z0SA 1S68A 4YR2A 1QG7A 1RCVD 3T16A 3LWUA 1UEBA 1X6OA 3GTQH 2NU7B 3KBGA 3M4IA 2JA7G 1RK6A 2XC9A 4XDXA 2V58A 1PFMA 2BA0A 5KFRA 5KT2A 4J9NA 2J6SA 5KFVA 1N9WA 1YBYA 3Q8DA 4GLXA 2UU9Q 2EXZA 4C2MB 4DUYH 4B3RL 5IT9W 1MKHA 3T5LA 3MR6A 2GVAA 4BWSC 3OTOL 3S16H 1G2SA 4N8X1 4FF3A 5JVDF 4MV1A 3ERSX 3F2DA 4UDUC 5FD6A 4KKTA 1TWGB 3R5XA 2MFIA 2NVTH 5J22A 2C28A 5KKNB 3HOYH 4L63B 1DD2A 1WH2A 2R86A 2VB3X 4B3RH 3OTOH 1IBKH 3I90A 3TQYA 1I94Q 1HR0H 5M5YB 5E1FA 4LUVA 2CCZA 5E3FA 2F03A 1F2ZA 3IG0A 1B1ZA 3HKSA 2HIVA 4AIMA 2MGSA 1L0WA 1KD1C 4P73A 2NWGA 2L11A 4A3FB 1B9MA 1E4EA 4QUCA 3SI8A 2AQ1B 5C0XJ 2AQ4A 4IPHA 2EYPA 2W8KA 2K5VA 1K83B 3CPWA 1JMCA 2RCFA 1DV1A 2BE5D 2VUMG 2V9WA 2K05A 2IY5B 3S1MH 5C4JB 1BNCA 1STHA 3SHLA 1BQQT 1I4XA 3PCOB 3OIQA 4QQBX 4ED2A 4IRCA 3K0YA 2Y0SB 4GKKQ 4LMQD 5DLQE 3RZDH 2VW9A 4G7ZC 3CAMA 1AZPA 4J9MA 1YVCA 2F0GA 4RKLA 1D8LA 2ZM6Q 3EJIA 3I70A 2W8LA 3FPUB 3SDZA 1KC8C 5FD5A 4RB3C 1A15A 2OQKA 1I4RA 4Q5VA 5CV5A 1TY0A 3NSWA 3P1HA 4DK1A 4FF1A 1IL2A 4RNMA 4F4WA 4DV1Q 2ZJRA 3HOVH 4ETSA 3CHBD 4RMFA 1CHPD 2WTFA 1SDFA 4QWAA 2JA6A 1Y8NB 1PFBA 3EA6A 4IUNA 2ASBA 5KFIA 4J9PA 1TWGA 3S2HB 1B53A 1CKNB 3D6CA 4LUOA 3FKIG 1XNQL 3HOUB 1DXMA 5C8YF 4JV2A 1SYFA 1NBWA 1AH9A 1K1QA 4TV8F 2XD4A 5KFBA 2ALZA 3A5ZB 1KAWA 1SYDA 4DR1Q 2CWAA 3K3PA 4A3EG 3T51B 4RNNA 1EOTA 2OEOA 2OH2A 2R8KA 1H9MA 1HXYD 2BA1A 5CC4A 2K1BA 1BO0A 3QO2A 1TWAH 2BDOA 5EBDA 1VQLA 1VQNA 3CMAA 1BNZA 1LABA 1BGWA 2GPSA 4J9OA 4NXNQ 1CZGA 2K03A 5CORA 1RODA 3T4AC 1N34Q 3L0OA 3Q8PB 3BG3A 1NUCA 2XWBB 4MA0A 2X0SA 1YITA 2E2IH 3NTIA 3BDLA 4BBSH 2Y0SA 2PW5A 2TSSA 3H09A 1HQRD 5KG4A 1ZKOA 1EZ8A 2F0NA 4WJ4A 2UVVA 2KCNA 2RDIA 2VQFL 2ASJA 3VR6A 1IYVA 3CRLC 3RD4A 2QGQA 4YB8B 5JH7F 4DV5Q 4J9SA 4LF9H 1EYAA 1B3QA 1DOKA 1JCKB 3DUZA 2JA5G 5HGQA 2VQFH 1SYXB 5DG8A 2Q2IA 2FFKB 4J8QA 1GVPA 2WINB 2CH4A 3PR5B 3T53B 3HOWB 4DNRB 1OO9B 5M3FB 4C3JG 3MVVA 1CKNA 3M4PA 3I12A 4KHPH 1BCPD 4X65L 2WACA 3DM3A 3R5FA 4JBKA 4JI2Q 4JI5H 5IP7H 5BMVF 3K0XA 5FO9B 4DUZL 1FGBD 4OWTB 1HUMA 3BDOA 1AE2A 1BKBA 4LK1C 4ME6A 2YTXA 1F9QA 4X62L 1C8CA 2MQHA 3VR4A 3VPDA 2HCCA 1VQ5A 1JWSD 4R4TA 4R4OA 1K73C 2ZXPA 1ASYA 1SROA 1YZ6A 4LFCQ 1IW7C 3OHBA 2KA7A 4OIKA 1BOSA 1P16A 3NPPA 2WP8J 5IT9L 5C0XI 1NJIC 3M4OH 3HKZE 4XT1B 3W1BA 4X62H 4JBJA 3TZDA 1XPOA 4HJ9A 3Q22A 2WAQB 2YS6A 1EIFA 4DR7L 3GV6A 1SBBB 1SE8A 3S14H 2E2JB 3VPBA 3VR2A 2BQ3A 1XYIA 1XDNA 2J0TD 3S2DH 2WB1B 2WDTA 3K5MA 2F0SA 1K28A 2H4OA 1N32Q 4DV4H 1SAPA 2IWHA 1J9OA 4RFBA 3OUUA 1C7YA 1VBGA 5M5WH 1W96A 3W2DA 1BDOA 2KECA 1TS4A 1WR2A 3RLOA 5KG0A 1ZXTA 3TIIA 1EFWA 3G8CA 5C0XH 1GSOA 4HNVA 4DR6H 1N33L 4DUYQ 2C5CA 1RYRA 1SNQA 4OX9L 3RZOH 1XMOQ 4OONA 5BPFA 2WAQE 2IBKA 1TWHB 2VQEL 5KNDA 2OF1A 4YY3H 1W2BA 1N36L 1UWVA 3NEMA 3V4ZA 4NW2A 3HKZA 2LMCB 4A3IH 4R8UB 2W7PA 4HMJA 2QYZA 2WB1E 2IPKD 1KABA 1X32A 3K5IA 3T5HA 3J80E 2N78A 3X3NA 4OX9H 2B63H 5LL6S 5BN3A 2F4VH 1EYDA 3J7AF 5FO8B 1JIHA 1N36H 3UFXB 1AP0A 1QE6A 1BCPF 2F3VA 4A3GH 1A62A 2JA6G 1H9KA 1Z2OX 1FVIA 4YJ3F 5AJ3Q 2O4XA 1EWHA 2XIWA 4XQJA 4YR3A 3U9OA 4JBWA 2OT2A 2B8GA 3PO3H 3KF6B 3RB3A 3J80i 1VQGA 3BZKA 3MR5A 2E8GA 5BR8L 2KCTA 3TIGA 1AE3A 1TWFB 2L12A 3KLRA 4DL7A 3EROA 1X3QA 1J5EQ 2YU9B 2AU0A 2WAQA 3S15H 3MWEA 3I7FA 1MGSA 1I5FA 1RF2D 1QNKA 2O03A 4A3FG 3K80C 5LMUQ 2XNAC 2WB1A 3OWEB 2E2DC 1NMGA 1QZGA 5DLGA 2V4QA 1JX4A 2E5LL 5IP9H 3UE0A 1STEA 5IYBG 2EJMA 1BF4A 4DR4L 2FPPB 1HNZL 2DJGC 3I4MH 1ML0D 3GTPB 3KJOA 2XWJB 1L2ZA 1MBYA 2R8GA 1PRTB 4B9XA 2HIXA 2NN6G 2E5LH 2IA6A 4N8FA 2QCPX 5BN5A 5J2TF 3UDGA 4O4LF 2Y0SG 4LF5L 1JWMD 4GLAC 1TWHA 3JAME 4ZKCB 2R7ZB 3EIVA 2HHHL 4QIWB 3RF2A 3WOFA 4R8UA 5FLXE 1MJEA 2VY3A 1EU3A 1M6VA 1X3PA 1V1OA 3PR4A 1EIHA 1HNWL 4EEYA 1ILPA 2PMZB 4C5BA 5JVG3 1F9SA 1HJPA 1L0YB 2ENBA 2K5DA 3MAQA 1EL0A 1MD2D 4A3BB 1L1OB 2CVRA 3L3OC 1AN7A 2VL6A 3C0FB 4PDBA 3A7LA 4F88A 3JAMi 1HNWH 2B29A 4QGUA 4H7BA 2AMCB 4TRDA 5KYLA 1DOLA 5EOYA 3G71A 2R6GA 5KG6A 3KF6A 4DK6C 1MZBA 2AGQA 3FDSA 2KJXA 3TDQA 1DM0B 1MHWC 1K3RA 1TWFA 1KJJA 2QK4A 2C35B 5IGGA 2R93H 4M1UB 2YU9A 1WCMH 2RVLA 3I73A 3CCRA 1SYBA 3Q23A 2JK8A 3JSNA 1Y1VH 2ATWA 1Q8KA 2UXBH 5EKIA 4A3CH 1HTLD 1SMYC 1I3QH 4DV2L 2B2VA 2ICIA 1IOVA 4LNQA 1JJGA 4U6PA 3NENA 1PDQA 1N48A 3DEOA 3F8NA 3GTPA 4XYMB 3DWAA 4IFDG 5KFPA 4QW9A 1EYCA 4LF9Q 2QILA 1NNXA 2I8CA 2DGYA 2CH4W 5IGCA 1OTCA 2YL2A 5JQWA 2R7ZA 1SXTA 3W3AA 2DNEA 1HA6A 1PYBA 5DGAA 2MO0A 1JORA 3U50C 1F9RA 1JC7A 1Q1EA 2K4KA 5ISRA 5HBRB 4RGOS 4JI4Q 1JOQA 4MV9A 3CQZB 3K8AA 4QWCA 1IHZA 1ICWA 1L1OA 4KD3A 2A74C 2VR1A 3SXHA 1SSOA 4KY7A 1HZAA 3HOWG 2CFMA 3J81E 3HKZG 5M3FG 1NSNS 3D6WA 4GLVB 4KJOA 4QWEA 3SK8A 2I46A 5CR3A 2FE3A 5EDWA 3GTMB 2B2TA 3JSLA 1FJGL 2I0QA 3SE0A 4LFAH 4GNXB 4J15A 4DR2L 3RJ0A 3P20A 1Z9FA 4YCUA 2ICEC 1A3TA 2Q2HA 2JP1A 4KI0A 4DV3Q 5KFFA 3J81i 4I65A 4OO1I 3N41B 4U673 2K5QA 5L1IA 2NVYH 4MV6A 2KCMA 5JEAG 2NVXH 2R92A 1FNUA 4EFBA 3Q2OA 4X66H 1IYJB 2VA3A 1GUSA 3CVZA 2ID0A 1NMFA 2R7FA 4IFDJ 4K0KH 2WAQG 3BVGA 1T3NA 2B2UA 3NK9A 4JV5L 4HIMA 3O13A 1PYSB 4IUQA 3STBC 2WB1G 4CGYB 4BY7B 3VPCA 1U4PA 3OPOA 4UCSA 1TAEA 2C9OA 3LWEA 1DONA 5A2QW 2OQ0A 3L4KA 1Q46A 4OO1H 5KX5F 1ASZA 4JV5H 1B6RA 3RV3A 1Q7YC 4LW1A 3BS1A 1PH6A 3UQ8A 2XSCA 4FF2A 5C3WA 1Z7TA 2I5HA 1QWYA 3NHHA 2F4VQ 2I80A 2VPQA 5L9XA 4LF7Q 3ORRA 3CQZA 5KFLA 1RD9D 2E74C 2NU6B 1TWCA 4ILWA 2NZOA 3TZUA 4R4CA 1R9TB 2W7OA 2G9HD 2JA9A 3HGBA 2D2CC 4H13C 3PUZA 2NU9B 1D5XC 5LP6F 2ASDA 3IFTA 1SFOB 4NLGA 1RKNA 1S97A 2EYLA 2ALYB 2MPMA 3GTMA 3A56A 2XN9C 3PW0A 1TKWB 1RTNA 4MZ9A 4JI7H 2PQAB 3KUPA 4JI1H 4GNXA 1KRTA 5GAGC 4RZRA 1XX8A 2UVWA 1CQVA 4CJ2C 3TS2A 2SOBA 2D0OA 1ESFA 3BJYA 1A2TA 4GKJH 4B3SH 5GAEC 1IW7D 4JW0A 2VS1A 1PTOC 1WTPA 1VQOA 4I4TF 4I7AA 2AGPA 4RUCA 1VQKA 3G6VA 2W6PA 4X3KA 4CJ1B 5CA1F 4IR1A 1E4GT 4GKKL 4ZK9B 1EEID 2AHOB 4EG0A 2RQXA 5KT7A 5LHY1 1HA5A 1S9FA 1X56A 3KF8B 4A93H 1E2ZA 2RBMA 2E2HB 3RB4A 1EUJA 3OMCA 5M5YH 2FKLA 1W6KA 4QY7A 2RCNA 2W9BA 4DV1L 1PH7A 4ECUA 1NR2A 3NWTA 1CSQA 1G6ZA 5HURA 2B2YA 1KEEA 5FPOA 2E76C 1S0MA 1AUXA 2IJ0A 1QCBD 4J1MA 4DAVA 5EPJA 1YIJA 1PFNA 1ZETA 3N44B 4KN7C 5KFMA 3S1QB 1UE7A 3NTKA 2YZNA 3J7YW 1PH2A 1VQAA 4DL4A 2FMAA 3C3LA 5K2MA 2W6MA 2R7ZG 4RCOA 4C3HB 4J9LA 3H0GB 3CCJA 4IO9A 2I5MX 4YHHQ 1R9TA 1UE5A 1G6PA 4Q43A 1O7IA 1I6HB 4BBRB 5KT4A 5DG9A 2IHFA 1SFOA 3F1ZA 1LACA 3RV4A 4A3DB 4DR1L 5IY0A 2KHIA 2KQ3A 1B7YB 2EXDA 2PI2E 4BY1H 2PQAA 5D3IB 1CE8A 3M3YB 2CQYA 2FMMA 4O2AF 4R4QA 3TP5A 5KG7A 2ZTEA 1TS3A 2R82A 1UE1A 4NXNL 5IOCA 5JJKA 1IBML 1GUGA 5DNFA 1ONLA 4TQUS 1F77A 2W6OA 2PVPA 3JC66 3MFIA 4ZAIA 5IGFA 1AFPA 5C44H 3I56A 4J9KA 1K8OA 3H15A 3CCSA 2H1EA 5E4XA 3PIPA 3HOUH 4JPBW 4ID6A 3G4SA 4IFDI 1IBMH 4ECZA 5KFCA 2FXQA 4A3KH 3S1RB 1LV9A 1GGOA 1PRTC 3GV3A 2E2HA 3ND8A 4N9TA 4JK1C 2A68C 1HZCA 1T94A 3WOEA 5C3XA 5EPKA 3TEHB 2R92G 1YNNC 3KXYT 5IWAH 4LAAA 3LNNA 3S24A 5BPHA 3T1YL 1IOWA 4ZCKA 1F9PA 2PI2A 4B3TL 3Q0AA 4ED8A 1JQYD 1GHJA 1PZID 4X3TA 4DV0Q 1O75A 3GTJH 3E9IA 2JEGA 1A6XA 1Y1VA 1Q3LA 1HRJA 4LFBH 1EY8A 3BYYB 4B3TH 1HNXH 2HQEA 4JI2L 2JA8B 3GV7B 2JEIA 2WYOA 1C48A 1LLRD 1SLJA 1XTDA 4CDDC 5NUCA 3H0GA 4LH7A 1LTLA 2ASLA 2F0UA 4V0BA 3PMFA 5A35A 1BBXC 5CMDA 3DWPA 3KYHC 3N40P 5DG7A 1PH1A 4ZOLF 1VMCA 1T9HA 3GD7A 3N52A 2VPSA 4GN3B 5ELNA 3CP0A 2IX3A 4LF6L 3TP8A 1XMQL 4ED7A 1CSPA 3HP3A 4A3JH 3FHWA 1F2MA 3CRKC 5I6YA 3MWYW 5I9OA 3QR8A 2UUAQ 2UXDH 2Q8IB 5D14A 1BR9A 3RNUA 4EYIB 1CZWA 2KHSA 3TP7A 3PF4A 1VQ4A 4RB2C 1LM0A 4QCLA 5M5XH 3KAKA 2EY6A 2V59A 4LF6H 3T56B 3GTOH 1XMQH 1D5MC 2Z6KC 3IL8A 3PUWA 4MV7A 4X66Q 1U4RA 4IPDA 4K8IA 3RGZA 4DV7L 1I7NA 4K0KQ 1ENFA 1VQFA 3QJYA 4IPGA 3ZYYX 1I4HA 4C3IH 1LUZA 1SMYD 4B3MQ 4C5AA 3PW4A 2XGPA 2J6TA 2JA6B 4O3PA 1JWUD 1KNEA 2QDBA 3D31A 3MFGA 2VOBA 5FJ8H 3K6OA 4DV7H 2FLPA 2KUMA 1WVLA 3D4RA 3S1NH 2ZTDA 3F2CA 1ZEQX 2W71A 4DAYB 4ECVA 1XMOL 1EY9A 3QG1A 2FINB 5T1IA 3MFHA 4K6LA 3UDFA 1KRSA 3K7AH 1Y1WH 1UC8A 1HHVA 2J4XA 1K8MA 3ERQA 4I7HA 3OHAA 3DM1A 3CC7A 3A0JA 4BY7G 4LF8Q 1GKHA 1I7LA 1YHAA 3ETHA 3CF5A 2HDMA 1T5XD 2AWOA 2PW7A 2RSOA 2UUBQ 2MO1A 2YRWA 5LXTF 4RGNA 1S0OA 1CHQD 3JZIA 4RG1A 2RHQB 5IODA 1M1KC 3GDEA 1PTOH 4ED0A 4RKBA 1Q90A 4HIOA 3FPPA 2R6FA 5AJ3L 2M2LA 1A3VA 3IRBA 2RDGA 1CT1D 5T1GA 4JI7Q 5IYDH 4RGMA 4P72A 2N55A 4JI1Q 1EIYB 3PUYA 2Z6BA 4CJ0B 3BQ1A 3RAXA 3BJUA 5GADC 5KFOA 3G7LA 2KBNA 5KYIA 4GKJQ 3SR1A 5GROA 2UUCQ 1SE4A 4OWWB 4P71A 4F4ZA 1XNRL 5KFJA 4X64L 2NUCA 1WD0A 4IURA 3FP9A 3I4NB 2AQ3B 2XCPA 1U0LA 2PYKA 2ZDGA 4POGA 5KFZA 1A9XA 3KOJA 3K59A 5JVH3 2I87A 2W6QA 4KK7A 4IAJA 3GV5B 1I4PA 5KFUA 3H91A 5G3LF 2K50A 3I8ZA 1Q12A 2YRXA 4DAYA 1M90C 5J3BA 3NQIA 2WKCA 3CCVA 4L5QA 2FK3A 2PN1A 4IQZA 5IYCG 3STBD 3TINA 4KY6A 5DGBA 3AYHB 5D8DA 1XNQH 4G57A 3EBEA 4PZ8A 4DR5Q 1EYZA 4PG3A 3CCMA 2VB2X 3HOXH 4IOCA 1EYGA 2DLNA 5L37A 2ZTCA 2GLTA 1RDPD 4KHZA 4UCRA 3I4OA 3OSPA 4KTAA 4A3MB 1CKMA 4XYOA 2DUDA 3V6KA 3RGXA 1KHIA 4TSSA 2SCUB 3KK7A 3HOZH 2EVBA 4GOPB 2XVSA 1JR0D 2IX1A 4MTEA 3MJFA 2RF4A 3TP6A 2PPBC 4P2CB 5FLMG 4C3HG 2Z8LA 3H0GG 1VQ7A 2GA4B 3E0JA 1WTHA 1AZQA 1EWIA 1GUTA 4BBRG 1JB7A 1YHQA 4EGQA 3ORQA 1A0IA 5C3EG 4A3DG 3A74A 5C4XG 2CW7A 3S17H 1PX2A 4JI3L 1GUWA 4M9UA 3I3CA 2EYOA 4I50F 3HRZC 2L9HA 2OCEA 3NTHA 2F4IA 4JUZA 5KG5A 4YR0A 3SGIA 2O5JC 4HSPA 2IP4A 4L5SA 5M3MG 1C3OA 2B2WA 3RFCA 1UNSA 5EGTA 2A6EC 4HCSA 1HPCA 4U7CA 2K01A 1Q81C 4UP8A 4A3BH 4ZRZA 1PTOD 2F0PA 2YV5A 4A76A 4JI3H 1S10A 2JEFA 3HKZB 2JEJA 1P8LA 1TIID 3N42B 4NKLA 3NBHA 2X6LA 2UXCL 1VDZA 2F0KA 2N49A 1IBLL 2L4NA 4JYAQ 4CBVA 1J8IA 1TXYA 4DGZA 2J7ZA 4LMYA 1NCVA 1FGUA 1ZYRC 4PNYA 4AQYQ 2HGSA 5E7NA 4YAJB 1VQEA 3CC2A 4XYQA 4X65H 4YWMA 4IUTA 2L55A 4NXMQ 1EOVA 4JI4L 1IBLH 2DNCA 3PO2G 4ZI7F 5GONF 4AH6A 4BXXG 4DUZH 3GTQB 3D0FA 5EWEA 1S72A 5IGEA 4LH6A 1IZ6A 2KEEA 1V43A 4GOPA 1TVXA 3CKIB 5K36G 5KFHA 1E4FT 2RDFA 3E0EA 3KFUA 1OWTA 2D62A 2FJZA 3S16B 1JOKA 1YJWA 2JA8G 1B04A 3KDFB 1X3FA 4DV6Q 4V190 3GIMA 2YZMA 1WI5A 2NVTB 3R23A 2ATLA 4DR3Q 3I91A 3HOYB 1TS2A 4K5WA 3U4VA 2HD3A 3DXJC 4DR7H 2BH8A 4O2BF 1HZBA 2BQUA 4WORA 1BJTA 4IR9A 1O78A 2TMPA 4ME3A 5GQOA 1U9RA 2R8JA 2F0HA 2PNRC 2YTYA 3AB9A 4CDCC 4A3LH 1I50H 5D3DA 2K32A 2CW8A 3CCEA 1GSHA 3SE7A 4HR7B 2FLLA 4K2LA 2FK2A 2RSNA 2NZ1D 3MR3A 5DM63 1N33H 1PTOF 4B3RQ 3S1MB 1KIXA 2JEAI 1BCPB 3MEFA 1LYLA 3VYTA 3F8TA 1PRTD 4QMGA 3OTOQ 1IBKQ 1KDCA 1D1KA 4F87A 5LMNW 4JV0A 2VQEH 2ZDHA 2A68D 2IX0A 1HR0Q 2EIFA 4I55F 2JA7H 4L5TA 1YNND 1O80A 1KLUD 4EEQA 3RZDB 5M9OA 3WWVA 5LL6X 3LMLA 3VMMA 3RAQA 4IALA 1HFGA 4Y7NH 4LF7L 1ET6A 3GTOA 3NELA 4RAUC 4JI0L 2PO4A 3GTQA 1V9PA 2A1AA 5FK9C 2MNAA 2EY5A 4JCVE 1VMPA 2MHVA 3J80c 4IZOA 3IKJA 3PW7A 2A8VA 1YNXA 3MWDA 4O0AA 4HAEA 3GTLH 1U5KA 3T1HL 1UNNC 3GIDA 3KDFA 1LTID 4ZHQF 4JI0H 5BR8H 4DNTB 2KHJA 2NBFA 2VA2A 1XPRA 3PN1A 1PXUA 3MHBA 4DU9A 3C1FA 4F8MA 5KG2A 5F9NA 2F0VA 3GIJA 2LSSA 1YHBA 4ED6A 2BCOA 2PZWA 2VUMH 4Y52H 5KFXA 4DR4H 3HB9A 3CMEA 1C4QA 1PK8A 1HNZH 3G6XA 2E75C 1JDBB 4XXEA 1A8VA 2R61A 3OMGA 3EQLC 4YWKA 3OUZA 2KVMA 4ALPA 4J6HA 4NB3A 1TWAB 4IWYA 4HR7A 3FMAA 2R85A 4LF5H 2JSOA 3I4NG 4JI6L 3W1GA 1PH9A 2R7KA 4FXGC 4ECQA 2HHHH 1LTAD 2C2DA 3Q6SA 3GIIA 2R7NA 1V51A 4Q8EA 4BBSB 3UDIA 1FR3A 4DK0A 2W57A 1PRTF 3QIAA 3OW2A 2RA4A 5EWFA 2RDJA 3HZXA 3K5NA 4K6DA 2FB9A 4C1NK 4JI6H 2R87A 1V4YA 4WBNF 3KAJA 1KJQA 3JAMc 4ME5A 5H1SE 1LT3D 3MTSA 1M0WA 3C2PA 5FLXc 3PF5A 2DY7A 4LF4L 3FKIH 2ZXOA 1XXGA 4NDXA 3DF7A 5KIXA 3JRXA 3GP7A 5LA6F 2R92B 4JI8L 4A3MG 4BA2I 1RJTA 2XGQA 4DAMA 2DPJA 2F0QA 4A3EH 1RJPA 3PUXA 4MTDA 2XCLA 3HEJA 5EJWA 1SR3A 4JOIA 3TS0A 1EHIA 4DV2H 4YBZB 4JI8H 3KLSA 5F2DA 3GTGH 3S1QH 2VQFQ 4DLKA 3E9HA 3GQCA 3V6HA 1X55A 3CCLA 1EQTA 4XT3B 5KFQA 3BVMA 1TWAA 3M4OB 2W6NA 2F0JA 5ELDA 4KHPQ 1M0TA 2EOTA 1WFQA 4IRDA 4O1NA 5J39A 3ICEA 3R2TA 4JI5Q 1SNOA 2G9DA 3S14B 1R4QB 2NVQH 3GTKH 2K75A 4QB4A 5EAYA 4AYBE 2E2IA 4UCUA 3DLLA 1BBUA 1TWCB 4J9RA 2EJGC 4DKAC 4FO2A 4X65Q 4LJZC 4IWXA 2JA5H 3PSIA 4XTCS 4QJFA 1IKMA 5M5WB 4FNFA 2JEBI 2O2LD 4JVZA 4YP3A 3D3RA 2CZGA 4KJNA 3A54A 5ELEA 1VQ8A 3AFQA 1WSCA 4C3JH 1B50A 4X62Q 1E7ZA 3Q8RB 2KCCA 1LT5D 3R8BA 1EIGA 4ZQ3A 2L0CA 3KHRA 1Q86C 2L15A 4L5RC 3A7AB 4HN7A 5FOBB 2N8NA 3S1RH 1PA6A 2AUKA 1JT8A 1UC9A 5CGKA 2HT1A 4F4YA 1FJGH 4RH6A 4A3IB 3J81c 4DV4Q 5HV6A 5IT9E 3PQIA 4DR2H 5LMNL 5DEHA 1SJED 2QW7A 1RL2A 3BVZA 2B63B 2UUAL 4RB1A 4I7ZC 5C6AA 4O3SA 4GC6A 1QVFA 4R1JA 4Z9CB 4YQWA 4EBDA 1NR4A 5EBCA 4H0LC 1G2TA 3AMUA 4A3GB 1LTSD 5I9PA 4YCWA 2M9VA 1IXRA 3NQTA 1C9OA 1B2TA 2M00A 4DR6Q 1TY2A 4F7XA 2W9BB 1NTGA 4CKBA 3HOYG 2Q2TA 2D0PA 3PO3B 1SEBD 2UU9L 4YY3Q 4KKSA 4PZ6A 1EZ1A 3M9OB 4HJ8A 3I2ZA 4OX9Q 5I6WA 3S15B 2A6ED 1N36Q 3G6EA 2ZJPA 3J81j 3MXGA 4DAPA 1I94L 3BQ0A 4RB0A 3A8IE 1E0BA 4UHVA 3NUCA 2J9GA 4YAKB 5C1PA 3OYYA 4FBUA 3I4MB 3A5UA 1E24A 3GO5A 2YW2A 3QZ8A 1ZYRD 3PZPA 4ZUJA 5I2XA 3K7UC 3BAAA 2F0TA 5I47A 2K33A 4R9WA 2H5XA 2HJWA 4A75A 1VAJA 3CCQA 2WIIB 4C2MH 2AQ2B 4FXKC 5JEAJ 1KDAA 5BR8Q 3J80W 3MXPA 1KJ8A 4WRDA 2JA6H 2AWNA 3I55A 1TWGH 3PIP3 1JKJB 4R7RA 2B63A 3U9SA 1EY6A 3HOVG 4S3SA 5L1JA 4TQRA 2A6HC 2F52A 5ELBA 5J1ZA 2UVRA 2ZM6L 4IN3A 3RB6A 1WTOA 5JJZA 5CBAE 3VDYA 2NN6I 1EUDB 2E5LQ 4MHEA 4DR4Q 1UUPA 4GN4B 2JQOA 3RMHA 4GKKH 2C22A 1QOHA 2IL8A 2FMCA 3SK6A 3R93A 4C5CA 4ECWA 4A3FH 1DGSA 1U4MA 2F0LA 1K83H 1Z47A 3FVQA 5H80A 1DIKA 5IYBH 3AFPA 4LF5Q 1WCMB 4DV1H 1N56A 3OIPA 4E6IA 3TQTA 1UE6A 3K81C 4EQNA 1Y1VB 2LXJA 1LTBD 5C4JH 2HHHQ 1JJ2A 1I3QB 3MR2A 2CWPA 1PH4A 3M7NA 2K28A 2NN6H 1HNWQ 4Q45A 4O4IF 4K5VA 3M9BA 4WJWA 1JDEA 2ZDQA 2MP1A 2SNSA 1JE4A 1AN8A 5C3EB 5C4XB 4O3QA 5KFDA 2K7VA 1PH5A 4Q44A 3M7GA 1WD1A 4FM9A 3CW2C 1EEFD 4EQPA 3DMUA 3HBLA 3JAMW 4BBSG 2R8HA 1S5BD 1CA6A 4DF7A 5M3MB 3KLSX 5FLXW 2UXBQ 4DR1H 1N34L 1JXLA 3MFYA 3F2BA 1DOMA 3BU2A 1PZKD 1SYGA 2B2VC 2NUAB 1EUCB 2I07B 3S2HH 1VKZA 4MIUA 5DLFA 3R2IA 5IYZF 4NXNH 3MXNB 3BQ2A 4RGTA 2GVBA 2EY2A 4Y8VB 2RGRA 5EZYF 1NE3A 2V5AA 4DV5L 2Z9HA 2WFWA 1CFMA 1CQIB 5LL6b 1AEXA 1GXDC 2M05A 4PV1C 2Q8RE 1O7LA 3PO2B 4IUPA 1S5FD 5IP7G 4APVA 4DL5A 3HFZB 1LTTD 3NBIA 1HUNA 4DV5H 1HZ9A 2FK1A 2R93A 3EN2A 4GZYC 1E2VA 1WCMA 3S9WA 3BA9A 4MV3A 1STBA 2EYFA 3T1YH 4EQ5A 1CQJB 3MWMA 2R7DA 1L1OC 2NVYB 4IFDH 2KENA 1I3QA 3TREA 2B8FA 2NVXB 1CKOA 2KSWA 3N43B 4JG2A 4RU9A 2BQRA 1HH2P 1M4VA 2EYMA 4NMZA 1KBLA 4RAZA 1GSAA 1KAAA 5KG1A 1SN8A 4UAIA 2QEJC 2W6ZA 2Z1CA 5DQIA 1RYSA 4KV6A 4NXML 1D1IA 2B2TC 3KHHA 4IOAA 5IIFA 4JI2H 5COYA 1B70B 2DN8A 4GS3A 4YIJA 1XWEA 4LFAQ 4LFCL 2QEXA 1XTCD 2K5WA 5CB4F 1GO3E 2G5DA 3UE1A 1SE2A 1C0AA 5IGDA 3M9MB 1CQFA 1PLFA 1FJGQ 5KFEA 2BR0A 1I6UA 3HOWH 4LFCH 1B3AA 5M3FH 5C0XG 1EQQA 3J7AV 1DCZA 4DR3L 1N32L 1TA8A 1G8ZD 3WNZA 5HGTA 3MA2B 1KJ9A 1BXRA 3MXNA 3K3VA 2B2UC 5G3LD 1T36A 2DJFC 3J81W 2ES2A 3V4SA 4RZQA 2WKDA 2XGTA 2VNUD 1MSHA 3SEBA 3F2UA 1VF7A 5E4WC 4A3IG 2F3WA 1FYCA 4RNOA 2Q2UA 2EJFC 4GC7A 1N32H 4L8JA 4ABNA 2EDGA 3OW7A 2B63G 4DUYL 5C4ZA 5FKAC 2SDFA 4R8NA 4JV5Q 1S4ZA 5JEAH 1SCUB 1S40A 1L0XB 4A3GG 2RDHA 1B9NA 4FBTA 3BA8A 5JUMA 3EPIA 1IL8A 3J80L 2XCAA 4M8AA 5C5MA 2JN4A 2B3GA 2E2JH 3PO3G 2NVYA 1IBKL 4FS1A 1XMOH 2NVXA 1HR0L 5IGBA 1N8RC 2SEBD 2LXKA 1IKLA 3UI2A 1QILA 3U4ZA 1EY0A 5CV4A 3H40A 4A93B 1W6JA 1ET9A 3MC0B 2CW0C 2EPBA 4L1KA 2Z4IA 3MZ5A 4GNXC 1MJCA 1FD7D 3R5HA 4QW8A 5IP9G 2YTVA 5CV6A 1Z2NX 4F50A 4MN3A 1VQIA 1SRUA 1J5EL 1GUNA 1PV4A 4HIDA 4B3SQ 1S03G 3I4MG 5IE8A 1TWHH 4TUYF 5KFNA 1R4PB 1EFID 5CV9A 1ESRA 5LMUL 1DV2A 5C5JA 1OXTA 1SMXA 4ODGA 4CKCA 5CA0F 2FHTA 1PH3A 1J5EH 2FPGB 5DAUA 4BWGB 1WTRA 1VQ9A 4OELB 3BG5A 5JJIA 1CK1A 1XNRH 4X64H 5LMUH 2CQAA 2B39A 2K04A 5D1PA 2ZJQA 4EBEA 4M7EA 4G4KA 1VQDA 4RHRA 2N3SA 5CYUA 2B2YC 4R8IA 1TS5A 1CA5A 1KXLA 1K0SA 3NBHB 3JAML 3K5LA 4MV8A 4HJ5A 2XIGA 1AW7A 4BY1B 4OXPA 1EZ6A 4RHSA 3AEVA 1VCIA 5FLXL 2A5HA 3Q8QB 5HY6A 1TWFH 1BVSA 2C2EA 2EZVA 4C2MA 2YU9H 1WTQA 4J0MA 1J6QA 1KLGD 1WTXA 3M4YA 2JXMB 1YEZA 4F4XA 5C44B 3KHLA 4XIGS 1Y69U 1D2BA 1ZHSA 1JLLB 2Y0SE 4HEDA 1ZQ7A 1YJNA 2R93G 1WCMG 4U68A 4G3IA 3RTXA 1PYWD 4A3KB 2BH2A 3T13A 1Y1VG 2YZGA 4MA5A 3GTPH 4A3CG 4DPGA 2N88A 1GJXA 1FNWA 1EQRA 3CU7A 3RR5A 3PUVA 1O7ZA 3ONAB 5KFKA 1PVOA 1PZJD 3L2PA 2K5HA 3GIKA 3WO1A 2ZJTA 2F0WA 3J7A5 4UY8C 4X3UA 5CV7A 2R7ZH 1A2UA 1HTPA 4OEMB 1TT2A 2Q8TA 1VQMA 5ELOA 4TKOB 1K83A 3R3OA 5TSSA 4EGVA 4FYDA 2VQDA 3GTJB 1NAPA 3TMEA 3N6RA 4MTKA 1H9RA 1EY4A 2F0FA 1IBMQ 4PMCA 1AUVA 3EVQA 1VQCA 4WD3A 3T5JA 3TQ1A 2VZAA 3A55A 3V05A 2V1CC 5EPLA 3H4BA 4XYLB 3ULJA 4ED1A 3E5NA 5IWAQ 4LF9L 2V4RA 1X3EA 3BYTB 4K14A 1M7JA 4QUFA 2P5ZX 3CXCA 2A6HD 3GIQA 1ULZA 2A69C 4G7HC 3FMCA 1OXVA 1NY4A 3GIPA 2RHSB 4A3JB 1SNDA 1VF5C 2CHBD 3G48A 5LYJF 4OL7A 4KHPL 1V1PB 5C4HA 2R8IA 3T1YQ 5KFWA 4LFBQ 4B3TQ 3GLKA 1HNXQ 1VQJA 4N9PA 1STAA 4JI5L 5M5XB 3LX0A 4HYKA 2UXCH 3GTOB 4K2KA 3K58A 3N6XA 2W9AA 3VR5A 4IUVA 2R92H 3J81L 1W3SA 1V8QA 5KNCA 4RWSC 3TBIB 3RIZA 4FS2A 4MAMA 2NYZD 1K8AC 3OHXC 1CS0A 4CHTB 4C3IB 5I2YA 4JI4H 2F0OA 4YCVA 3QWNA 2WE6A 2IT1A 2AKWB 1SYCA 5KFSA 1E1OA 2VXWA 3PIO3 2CKZB 2UXDQ 3WDNA 4Q0YA 1STGA 4EQOA 4O3RA 3S1NB 2PZTA 4LF6Q 4DV3L 1XMQQ 1Y1WB 3K7AB 4OIJA 3VR3A 4BA1I 5A2QE 3FEWX 4Q8FA 5JOBA 4DV4L 2MCTA 3D4WA 4LUZA 3GTJA 4O2DA 2X69A 1LT6D 5KRUA 2QDLA 1VQBA 1LTGD 3TN2A 1EQVA 1FKAH 4DV3H 3CQZH 4OO1G 5C1OA 5T14A 1G91A 3H20A 1SNCA 2I5LX 1TWCH 1C30A 1PTOB 4B9WA 2C00A 1CTMA 3I4LA 1Z6HA 5K5PA 4DV7Q 1H9SB 4MV4A 4H44C 3RUPA 1WJJA 4DR6L 2PZUA 3K5OA 4X3SA 3NP8A 5FO7B 4FU0A 1GD7A 4YY3L 3GTMH 1CM9A 1OXSC 1QB5D 3RBDA 2OTJA 1GLVA 1V1PA 4X6AH 1Q82C 4IZ8A 3HS0C 2F4VL 4PWQA 1SJHD 4MTNA 1II3A 3OOCA 1LTRD 2K6AA 1MI2A 1L2FA 1T5EA 2HVQA 2RKSA 2EYHA 5CBEE 1H9JA 1EU4A 4L6TB 1YNJC 1RJRA 1PMRA 1E2WA 3HOVB 1ZHQA 1GM5A 1BXTA 3HXLA 4LF7H 5KFYA 1VQHA 5KG3A 1JE5A 1ENCA 4FXDA 4PMWA 4BY7H 2XTIA 3PIOA 2IW3A 1EY7A 3E3XA 3H94A 1GOZA 4RCNA 2DIKA 1Y1WA 2HDLA 3U9TA 3EFXD 2GN5A 4A93G 3T1HH 1LT4D 1E1TA 1K9MC 4HCEA 2SNMA 1H95A 3Q8SB 5EKKA 2GPWA 4DL3A 4J9QA 3HOXB 4DK3C 1XNRQ 4X64Q 2F0IA 2LKVA 2K5NA 3LGJA 1R9TH 4RAYA 3PW2A 1H9SA 3KHGA 2AGOA 4IJHA 2L1BA 2F0DA 3HOZB 1SFOH 3EPGA 3M85A 5EKLA 4CKEA 3ETJA 3RN5A 1K3BC 4EFEA 5KT3A 1YI2A 2E2IB 3M9NB 5FPRA 3LP8A 2MUYA 1B33N 1Z2PX 1XNQQ 4ECRA 3SK5A 4HJAA 3GILA 2R3ZA 1WTWA 3C1EA 4CC5A 5C5LA 3G6YA 1EY5A 3AQQA 3S17B 1KDBA 3PVXA 5L1KA 1MSGA 4BY1G 3KTMA 4LSAA 2ZT9C 5JAVA 1B44D 4BS9A 4IHJF 4YHHL 3RUZA 3PW5A 2HVSA 1D7QA 2FPIB 2QA4A 2XRQD 1ENAA 5IYCH 2E2HH 1I4GA 3NWSA 2OWOA 3KALA 2OTLA 3TSSA 4DFAA 4YHHH 2F0MA 3QOJA 5C44G 4XZ3B 4LF4H 1JJCB 3V96A 3HOUG 1JB3A 4R4IA 4TV9F 3L7ZC 1VBHA 2RGVA 3NE5B 4RA8A 2UXBL 2A19A 4A3KG 4AYBB 2CW0D 1S3OA 2R7MA 4ED3A 3IN5A 1X3GA 3GV8B 3VA5A 4HNUA 4QIWE 3K5HA 3JRWA 5KNBA 3KLWA 4YWLA 2B2WC 2PMZE 5ELCA 3ZJYC 4NP5A 3TRZA 3LWBA 4HQ6A 1GYFA 3PGZA 4JI3Q 5FLMH 3H6MA 4C3HH 3H0GH 4Q0FA 1HCZA 1U4LA 5JPNC 2K52A 1I6HH 4QL5A 3VYUA 4PMBA 4BBRH 1VQ6A 1DYQA 3N8DA 1SE3A 2PQEA 4O3NA 5C3EH 4A3DH 1F2YA 5C4XH 2YYZA 3DEPA 4JC0A 2HUGA 4APMA 1RHPA 3H3VC 3S2DB 3W5OA 4O3OA 4FF4A 4KLKA 4HNTA 1EWCA 1WTVA 3I72A 2CQOA 4DV0L 3M3YH 2LS01 5M3MH 1HQMC 2UXCQ 1IBLQ 4UCTA 2ZXRA 4MNOA 1PFSA 4FDBA 1ICFB 4DUZQ 4EVOA 4QIWA 3OSOA 4ECXA 1BUVT 4HSVA 1KJIA 4UP9A 4A3JG 1QZHA 1S0NA 4DV0H 2PMZA 1PHJA 2BE5C 4ZKBB 3ND9A 4GOPC 4ECTA 1YJ9A 1I50B 3RZOB 1V1QA 3KBXA 1KNAA 3IAYA 2DY8A 3E5SA 2FP4B 4LFAL 4NPSA 1RJQA 2KOLA 4H02A 3URYA 4G7OC 3A8KE 4DXGA 3Q1KA 1A63A 4ULLA 3WO0A 4UPAA 2EYJA 4DR7Q 3P7JA 1Q1BA 3RLNA 3PO2H 1KL9A 4C3IG 1XPUA 4BXXH 4AYBA 2C2RA 4P74A 4DA2A 2JA7B 3D8GA 1B6SA 3CPFA 2BOSA 1SNMA 2LY7A 4GN5A 4X66L 5FJ8G 5LMNH 1TU2B 3IFDA 2FJ2A 4EGJA 5K36H 4Y7NB 2UUAH 1DJRD 5JJLA 3UDXA 1KQSA 1XJVA 4K0KL 2NZHA 4IUUA 1KC7A 4TQSA 2JA8H 4CC6A 3RBEA 1Y1WG 4B3ML 2VUGA 2Z6KA 5IT9c 5DQHA 4A2AA 4ECSA 1N33Q 3SK4A 3BZDB 4UFZA 5L1LA 2A73B 4IPCA 2VQEQ 4EYHB 2UU9H 1TR5A 4UCOA 3D4DA 3GTLB 2F0EA 4KMUC 1FNVA 2W9CB 4B3MH 3Q24A 1WYDA 3J7ZC 3T5KA 1TQOA 1MIUA 2PNHA 5ELFA 1K8GA 4KD4A 4ECYA 1D6EC 3VYSA 5LOVF 2A69D 4LF8L 5CV8A 4RUAA 4KY5A 5I4DA 1G291 5IYDG 2LFNA 3ULPA 2UUBL 2DPIA 2HVRA 5GAHC 4EBCA 3RB0A 3QZ7A 1I94H 2VUMB 2JE6I 4O42A 2JJQA 4LF8H 1IYUA 3J7AK 1I50A 1WOCA 4HMIA 3V2TA 2L5TA 4JI0Q 5D65A 3CC4A 2UUBH 4JI7L 4TVAB 4FVMA 1Y14B 4EX5A 3QFFA 4JI1L 4IJLA 4HTHA 1M8AA 1Y8OB 1HFNA 3K57A 2UVUA 2EE1A 4WJ3M 4A2BA 4UCVA 3CCUA 2XRSD 1SYEA 1HR0W 4GKJL 1OXXK 3MXUA 3T1HQ 5KEEA 4DNIA 1JOOA 2UUCL 4B3SL 1GUOA 3FDTA 1RK5A 2JA7A 3GQBA 1O7YA 4QWBA 3X3MA 1UEAB 1X65A 4XX0B 4QF4A 1HNZQ 4DL6A 5KFGA 1G51A 2DZDA 4PZ7A 1K0RA 1QVCA 4K5XA 2UUCH 1BBWA 2ZM6H 3E6ZX 4CDEC 4WFN3 3C46A 5F9LA 1F2LA 1LO5D 3FKIB 3FRPB 1VQPA 2OLSA 1Y8PB 5BN4A 2R93B 5EWGA 1VS0A 4C1NI 1BCPC 1CUKA 2D5DA 3NGDA 3G6JB 3BDCA 2OXPA 4B08A 3GTLA 4OWXB 3VYRA 3HOXG 2W9CA 1D5ZC 3HG9A 5KGUA 1FL0A 2BDNA 3P75A 4DXFA 3L9AX 1JICA 1Q8IA 2Z4HA 4C56C 3B6YA 4JI6Q 4P75A 1ILQA 1PH8A 2EQSA 4A3EB 4OGQC 2DWCA 3HOZG 4JV1A 4DR5L 3AU7A 4KHVA 3VA7A 3H3VI 3ITPA 4O4HF 2VUMA 1QUQB 2PBZA 1E3PA 3GTGB 3I4NH 5D1OB 5JPMC 1QVGA 4DR5H 4CDFC 2YYAA 1DZ1A 4DN4M 3QOLA 5EQ0A 4XQNA 2K14A 2D9UA 3U58A 4LF4Q 3PV0A 4DL2A 2HQLA 1YNJD 3A8JE 4POFA 5KT6A 2QF7A 1RTOA 2YS7A 3GTKB 2NVQB 4QWDA 4XQQA 2EY1A 5KFAA 5AFWA 3BZCA 1N34H 3KJPA 4A3BG 1QNUA 4JOIC 4DV2Q 4JI8Q 3H3VH 2NB0A 4FP5D 4JBMA 2JA5B 1SEIA 3OSNA 1STYA 3RLFA 4K8JA 1SNPA 3MEHA 1UAPA 4ZLTF 3ER0A 3ULLA 2O5IC 4HIKA 4KKUA 4AYBG 4C3JB 3FKIA 4A3MH 4ZYSA 5J2UF 2AUJD 5IWAL 2NTTA 1B8AA 4E4TA 2JYOA 1S5ED 3KF8A 2P0AA 1I6VC 1GHKA 1I4QA 5DQGA 5KT5A 2X6GA 2IHEA 2PCFB 4OHJA 5CAEB 4JYAL 2F1MA 1K1SA 2NU8B 3H4DA 1S5CD 3M4QA 4AQYL 4LFBL 4LSXA 2R7LA 1HNXL 4IRKA 3NXWA 2KEDA 5DM73 4JYAH
chains in the Genus database with same CATH topology
2OQ0A 3J7A5 4UY8C 4HJ7A 1Q46A 1QUQA 1RIPA 2VUMH 4Y52H 2R7ZH 1ASZA 1E22A 1X54A 3CMEA 5ELOA 1VQMA 1Q7YC 4LW1A 1PH6A 3CD6A 1A8VA 4YWKA 1OXUA 2I5HA 2F4VQ 4ALPA 4NB3A 1IBMQ 4LF7Q 3RN2A 1VQCA 4DR2Q 2VZAA 4DV6L 4LWCA 3S1NH 2UXDL 2NZOA 3I4NG 2V1CC 4R4CA 1X9NA 4JI6L 3W1GA 3ULJA 4A4IA 1PH9A 4A3LG 2JA9A 5IWAQ 4LF9L 1X3EA 3PUZA 3CXCA 4UP7A 5LMNQ 3UDIA 1OXVA 2ALYB 1NY4A 2F3IA 3OW2A 4MZ9A 2RHSB 2Z0SA 2PQAB 4GNXA 3JAMc 3G48A 1KRTA 5GAGC 5H1SE 4KHPL 3T1YQ 1UEBA 1X6OA 4LFBQ 3TS2A 4B3TQ 5FLXc 2D0OA 3PF5A 3GTQH 1HNXQ 1VQJA 4JI5L 2JA7G 4LF4L 3FKIH 2BA0A 5GAEC 2VS1A 1N9WA 1YBYA 3Q8DA 4GLXA 2UU9Q 1VQOA 2R92H 4B3RL 1W3SA 1VQKA 1MKHA 2GVAA 3OTOL 3S16H 1K8AC 4GKKL 2AHOB 3ERSX 3F2DA 2MFIA 4JI8L 2NVTH 1X56A 4YCVA 4A3MG 4BA2I 3KF8B 4A93H 3HOYH 2IT1A 4DAMA 1EUJA 2AKWB 5M5YH 4A3EH 1E1OA 4QY7A 2CKZB 2RCNA 2UXDQ 3PUXA 4DV1L 1PH7A 3TQYA 1I94Q 1SR3A 4JOIA 3TS0A 1CSQA 4LF6Q 4LUVA 2CCZA 4DV3L 1XMQQ 4BA1I 3S1QH 4BY7G 3GTGH 3HKSA 2VQFQ 2HIVA 4AIMA 1YIJA 3E9HA 4DV4L 1X55A 1L0WA 4LUZA 1KD1C 3CCLA 4O2DA 4P73A 1VQBA 1UE7A 5C0XJ 4IPHA 1PH2A 2K5VA 3CPWA 1VQAA 1JMCA 4KHPQ 3CQZH 4OO1G 2VUMG 1WFQA 2R7ZG 3ICEA 2I5LX 1TWCH 3CCJA 2I5MX 4YHHQ 4IO9A 1UE5A 4JI5Q 3S1MH 2IY5B 1G6PA 4DV7Q 2NVQH 1O7IA 3GTKH 1WJJA 2K75A 4DR6L 3PCOB 2IHFA 5EAYA 4AYBE 4QQBX 3DLLA 1BBUA 3F1ZA 4DKAC 5IY0A 2KHIA 4DR1L 1GD7A 4YY3L 4X65Q 3GTMH 1B7YB 2EXDA 4GKKQ 2PI2E 1OXSC 3PSIA 5DLQE 4XTCS 4QJFA 2VW9A 3CAMA 2PQAA 3RZDH 4BY1H 1YVCA 2JEBI 2ZM6Q 1D8LA 2OTJA 1KC8C 4X6AH 4R4QA 1Q82C 1VQ8A 2OQKA 2ZTEA 1UE1A 3AFQA 4NXNL 2F4VL 4C3JH 5JJKA 4MTNA 1IL2A 4X62Q 1IBML 1E7ZA 4DV1Q 1L2FA 4TQUS 2ZJRA 3HOVH 3JC66 4RMFA 1Q86C 2L15A 5C44H 3I56A 4L5RC 3S1RH 2N8NA 3H15A 3CCSA 1PA6A 1JT8A 3PIPA 3HOUH 2HT1A 2ASBA 1GM5A 3J81c 3G4SA 4DV4Q 4IFDI 2FXQA 1CKNB 4LUOA 1VQHA 3FKIG 5LMNL 4A3KH 1XNQL 1RL2A 1JE5A 2UUAL 1HZCA 4PMWA 1QVFA 4R1JA 3TEHB 1NBWA 2R92G 4BY7H 2XTIA 2JA5H 3PIOA 3S24A 1AH9A 3T1YL 4YCWA 1IXRA 2PI2A 4B3TL 1C9OA 4DR6Q 2GN5A 4A93G 1NTGA 3HOYG 3A5ZB 2Q2TA 1KAWA 2D0PA 1E1TA 4DR1Q 2CWAA 4DV0Q 1K9MC 4YY3Q 2UU9L 4A3EG 3GTJH 4PZ6A 1H95A 3E9IA 2BA1A 1TWAH 4HJ8A 3I2ZA 1VQLA 4JI2L 1VQNA 4DK3C 1XNRQ 3CMAA 4OX9Q 4X64Q 1XTDA 1SLJA 4NXNQ 1N34Q 1LTLA 2K5NA 3LGJA 1R9TH 3L0OA 1N36Q 3G6EA 2ZJPA 4IJHA 3KYHC 1PH1A 3J81j 1T9HA 1YITA 3GD7A 1SFOH 2E2IH 4GN3B 5ELNA 1I94L 4BBSH 3CP0A 3M85A 4LF6L 3OYYA 1XMQL 3RN5A 1CSPA 4A3JH 4WJ4A 3FHWA 3A5UA 1YI2A 2VQFL 1E24A 3GO5A 1XNQQ 4HJAA 2UUAQ 2QGQA 4DV5Q 3RNUA 3AQQA 3PF4A 3K7UC 1VQ4A 1LM0A 5M5XH 2H5XA 3GTOH 2Z6KC 3PUWA 2JA5G 4A75A 4BY1G 5HGQA 4X66Q 3CCQA 4C2MH 5JEAJ 4YHHL 2Q2IA 4IPDA 5BR8Q 1GVPA 4DV7L 1D7QA 4K0KQ 2JA6H 2QA4A 4IPGA 1VQFA 2AWNA 3I55A 1TWGH 4C3IH 1LUZA 1CKNA 3M4PA 4B3MQ 5IYCH 4X65L 2E2HH 3HOVG 2OWOA 3DM3A 3D31A 2F52A 2OTLA 4JBKA 4JI2Q 5FJ8H 5IP7H 5C44G 2ZM6L 3K0XA 1JJCB 4DUZL 3HOUG 4R4IA 4OWTB 2NN6I 2ZTDA 3L7ZC 3F2CA 4DAYB 1AE2A 1BKBA 3VDYA 2E5LQ 1XMOL 4DR4Q 4GN4B 2UXBL 2A19A 2YTXA 2JQOA 3UDFA 4X62L 1KRSA 1S3OA 2MQHA 3K7AH 4A3KG 1Y1WH 1X3GA 4QIWE 1VQ5A 4R4TA 4R4OA 3CC7A 3A0JA 1K73C 4LF8Q 1GKHA 4A3FH 1DGSA 1SROA 1YHAA 1YZ6A 3KLWA 4YWLA 3CF5A 2PMZE 4LFCQ 3ZJYC 3TRZA 3M4OH 1P16A 2WP8J 5C0XI 1K83H 2AWOA 1Z47A 1NJIC 3HKZE 2UUBQ 2MO1A 3AFPA 3PGZA 3W1BA 5IYBH 4JI3Q 4LF5Q 4JBJA 4RG1A 5FLMH 1XPOA 4C3HH 4HJ9A 3H0GH 1UE6A 3K81C 2RHQB 1EIFA 2LXJA 1M1KC 3GDEA 4DR7L 5C4JH 2HHHQ 1SE8A 3S14H 2K52A 4HIOA 1JJ2A 1I6HH 4QL5A 5AJ3L 4BBRH 3IRBA 2CWPA 1PH4A 1VQ6A 3M7NA 3S2DH 1ASYA 1HNWQ 5C3EH 4A3DH 5C4XH 4JI7Q 2YYZA 1N32Q 4JC0A 5IYDH 3M9BA 4P72A 4JI1Q 3W5OA 1C7YA 3PUYA 1EIYB 5M5WH 4KLKA 3BJUA 5GADC 2CQOA 4DV0L 3RLOA 3M3YH 1PH5A 2KBNA 5M3MH 4GKJQ 2UXCQ 5GROA 1IBLQ 1EFWA 3CW2C 4MNOA 2UUCQ 1PFSA 4OWWB 4FDBA 4P71A 4DUZQ 4BBSG 1N33L 4DUYQ 1XNRL 4OX9L 4X64L 4UP9A 4A3JG 1XMOQ 3RZOH 4OONA 2UXBQ 2WAQE 1QZHA 1N34L 2R93G 2VQEL 3FP9A 3F2BA 3BU2A 1W2BA 1PHJA 1UWVA 3NEMA 1N36L 4GOPC 1U0LA 1YJ9A 4A3IH 4POGA 1V1QA 2WB1E 3S2HH 3KOJA 2N78A 2B63H 4LFAL 4NPSA 2K50A 3MXNB 1Q12A 2GVBA 4H02A 1A63A 1NE3A 4A3GH 4UPAA 4DR7Q 1A62A 2JA6G 1Q1BA 1FVIA 3RLNA 5J3BA 1M90C 4DV5L 3PO2H 1KL9A 3CCVA 5AJ3Q 2WFWA 1XPUA 4BXXH 4L5QA 4P74A 5IYCG 3STBD 4JBWA 3CPFA 3PO3H 3KF6B 4X66L 4GN5A 3AYHB 3J80i 1VQGA 3BZKA 5IP7G 5FJ8G 4APVA 2E8GA 3EBEA 3HFZB 5BR8L 4PZ8A 2KCTA 3UDXA 4DR5Q 1XJVA 1KQSA 1AE3A 4K0KL 5JJLA 2NZHA 1HZ9A 4PG3A 3EN2A 3CCMA 3HOXH 4IOCA 1EYGA 2JA8H 2ZTCA 1J5EQ 4KHZA 1Y1WG 4B3ML 2Z6KA 3I4OA 5IT9c 3S15H 3I7FA 1CKMA 4EQ5A 1I5FA 2DUDA 2R7DA 1L1OC 2KENA 1N33Q 1KHIA 3TREA 1CKOA 3K80C 5LMUQ 4A3FG 3HOZH 4GOPB 4JG2A 4IPCA 1NMGA 2VQEQ 1QZGA 2E5LL 1HH2P 5IP9H 2IX1A 2RF4A 3UE0A 5IYBG 4DR4L 1WYDA 1SN8A 5FLMG 3J7ZC 1HNZL 3H0GG 1VQ7A 1MIUA 3I4MH 2PNHA 4NXML 1K8GA 4IOAA 3KJOA 1EWIA 1B70B 4BBRG 1JB7A 4GS3A 4LFAQ 2HIXA 2QEXA 1YHQA 4LFCL 4LF8L 2NN6G 1G291 1A0IA 1GO3E 5C3EG 4A3DG 3A74A 3UE1A 5IYDG 3S17H 3UDGA 3ULPA 2Y0SG 2UUBL 1C0AA 4LF5L 5GAHC 4JI3L 4GLAC 2OCEA 1FJGQ 3EIVA 2JE6I 3SGIA 2HHHL 2JJQA 4L5SA 3HOWH 5M3MG 1MJEA 2VY3A 1WOCA 5M3FH 5C0XG 1EQQA 1Q81C 3CC4A 4UP8A 4JI0Q 4A3BH 4JI7L 4TVAB 4DR3L 1HNWL 1N32L 2YV5A 1Y14B 4EX5A 4A76A 1HJPA 4JI1L 4IJLA 2ES2A 1P8LA 1L1OB 2VL6A 2XGTA 3CCUA 2VNUD 1HR0W 4GKJL 1OXXK 3JAMi 4A3IG 2UXCL 3T1HQ 2B29A 2N49A 4DNIA 4QGUA 1IBLL 2AMCB 2Q2UA 2UUCL 4B3SL 4JYAQ 3G71A 2R6GA 1TXYA 2B63G 4DUYL 1FGUA 3KF6A 4AQYQ 4DK6C 5E7NA 4JV5Q 1VQEA 3CC2A 1X65A 1HNZQ 4YWMA 1G51A 1S40A 4A3GG 1K3RA 4PZ7A 4NXMQ 1EOVA 1K0RA 4JI4L 5C4XG 1QVCA 3PO2G 2C35B 1BBWA 2R93H 4AH6A 1WCMH 3CCRA 4BXXG 3D0FA 2JK8A 1VQPA 1Y1VH 1S72A 2B3GA 2E2JH 1Q8KA 1IZ6A 1IBKL 2ATWA 3PO3G 4A3CH 1V43A 1VS0A 1I3QH 1CUKA 1HR0L 1N8RC 4GOPA 5K36G 4DV2L 2LXKA 3E0EA 4LNQA 3KFUA 2D62A 4OWXB 3HOXG 1YJWA 2JA8G 1JJGA 3NENA 3KDFB 1X3FA 3U4ZA 4DV6Q 1FL0A 1WI5A 4DR3Q 4IFDG 3B6YA 4JI6Q 4P75A 3U4VA 1PH8A 2EQSA 4GNXC 4LF9Q 3HOZG 1MJCA 4DR5L 2BH8A 1HZBA 5IP9G 2YTVA 2DGYA 3H3VI 1VQIA 1OTCA 1SRUA 1J5EL 4ME3A 1PV4A 4HIDA 5GQOA 4B3SQ 1QUQB 3I4MG 5IE8A 1TWHH 1E3PA 3I4NH 1PYBA 2YTYA 2MO0A 4A3LH 1QVGA 3U50C 1I50H 5LMUL 1OXTA 1SMXA 1Q1EA 2K4KA 3U58A 3CCEA 2K14A 1PH3A 4LF4Q 3PV0A 4JI4Q 2HQLA 1VQ9A 3K8AA 4POFA 1L1OA 5JJIA 4B3RQ 1KIXA 2JEAI 3MEFA 1HZAA 1LYLA 2CFMA 3HOWG 3F8TA 3OTOQ 3HKZG 5M3FG 1IBKQ 2ZJQA 3BZCA 4GLVB 1VQDA 3KJPA 5LMNW 4A3BG 2IX0A 2N3SA 1HR0Q 4JOIC 4DV2Q 3H3VH 4JI8Q 2EIFA 2JA7H 4L5TA 1KXLA 3NBHB 4HJ5A 4JBMA 3WWVA 4OXPA 3AEVA 1FJGL 2I0QA 1VCIA 4Y7NH 3RLFA 4LF7L 5HY6A 1TWFH 4GNXB 4J15A 4DR2L 1BVSA 3NELA 1Z9FA 3ER0A 3ULLA 4YCUA 4JI0L 4HIKA 2YU9H 2Q2HA 4AYBG 1V9PA 2A1AA 4KI0A 2MNAA 3J81i 4DV3Q 1J6QA 4JCVE 4A3MH 4OO1I 3J80c 2NVYH 5IWAL 2A8VA 1B8AA 2KCMA 5JEAG 2NVXH 1YEZA 1YNXA 4XIGS 2Y0SE 1IYJB 4O0AA 1YJNA 1U5KA 3T1HL 3GTLH 2IHEA 3KDFA 2ID0A 1NMFA 1WCMG 2R7FA 4JYAL 4IFDJ 2WAQG 2KHJA 2BH2A 1Y1VG 1XPRA 3M4QA 4AQYL 3GTPH 4A3CG 4DPGA 4JV5L 1EQRA 4HIMA 4LFBL 3RR5A 1PYSB 3PUVA 3STBC 2WB1G 1HNXL 1PVOA 3L2PA 2K5HA 4WJ3M 2LSSA 1YHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQ0 A;  3J7A 5;  4UY8 C;  4HJ7 A;  1Q46 A;  1QUQ A;  1RIP A;  2VUM H;  4Y52 H;  2R7Z H;  1ASZ A;  1E22 A;  1X54 A;  3CME A;  5ELO A;  1VQM A;  1Q7Y C;  4LW1 A;  1PH6 A;  3CD6 A;  1A8V A;  4YWK A;  1OXU A;  2I5H A;  2F4V Q;  4ALP A;  4NB3 A;  1IBM Q;  4LF7 Q;  3RN2 A;  1VQC A;  4DR2 Q;  2VZA A;  4DV6 L;  4LWC A;  3S1N H;  2UXD L;  2NZO A;  3I4N G;  2V1C C;  4R4C A;  1X9N A;  4JI6 L;  3W1G A;  3ULJ A;  4A4I A;  1PH9 A;  4A3L G;  2JA9 A;  5IWA Q;  4LF9 L;  1X3E A;  3PUZ A;  3CXC A;  4UP7 A;  5LMN Q;  3UDI A;  1OXV A;  2ALY B;  1NY4 A;  2F3I A;  3OW2 A;  4MZ9 A;  2RHS B;  2Z0S A;  2PQA B;  4GNX A;  3JAM c;  3G48 A;  1KRT A;  5GAG C;  5H1S E;  4KHP L;  3T1Y Q;  1UEB A;  1X6O A;  4LFB Q;  3TS2 A;  4B3T Q;  5FLX c;  2D0O A;  3PF5 A;  3GTQ H;  1HNX Q;  1VQJ A;  4JI5 L;  2JA7 G;  4LF4 L;  3FKI H;  2BA0 A;  5GAE C;  2VS1 A;  1N9W A;  1YBY A;  3Q8D A;  4GLX A;  2UU9 Q;  1VQO A;  2R92 H;  4B3R L;  1W3S A;  1VQK A;  1MKH A;  2GVA A;  3OTO L;  3S16 H;  1K8A C;  4GKK L;  2AHO B;  3ERS X;  3F2D A;  2MFI A;  4JI8 L;  2NVT H;  1X56 A;  4YCV A;  4A3M G;  4BA2 I;  3KF8 B;  4A93 H;  3HOY H;  2IT1 A;  4DAM A;  1EUJ A;  2AKW B;  5M5Y H;  4A3E H;  1E1O A;  4QY7 A;  2CKZ B;  2RCN A;  2UXD Q;  3PUX A;  4DV1 L;  1PH7 A;  3TQY A;  1I94 Q;  1SR3 A;  4JOI A;  3TS0 A;  1CSQ A;  4LF6 Q;  4LUV A;  2CCZ A;  4DV3 L;  1XMQ Q;  4BA1 I;  3S1Q H;  4BY7 G;  3GTG H;  3HKS A;  2VQF Q;  2HIV A;  4AIM A;  1YIJ A;  3E9H A;  4DV4 L;  1X55 A;  1L0W A;  4LUZ A;  1KD1 C;  3CCL A;  4O2D A;  4P73 A;  1VQB A;  1UE7 A;  5C0X J;  4IPH A;  1PH2 A;  2K5V A;  3CPW A;  1VQA A;  1JMC A;  4KHP Q;  3CQZ H;  4OO1 G;  2VUM G;  1WFQ A;  2R7Z G;  3ICE A;  2I5L X;  1TWC H;  3CCJ A;  2I5M X;  4YHH Q;  4IO9 A;  1UE5 A;  4JI5 Q;  3S1M H;  2IY5 B;  1G6P A;  4DV7 Q;  2NVQ H;  1O7I A;  3GTK H;  1WJJ A;  2K75 A;  4DR6 L;  3PCO B;  2IHF A;  5EAY A;  4AYB E;  4QQB X;  3DLL A;  1BBU A;  3F1Z A;  4DKA C;  5IY0 A;  2KHI A;  4DR1 L;  1GD7 A;  4YY3 L;  4X65 Q;  3GTM H;  1B7Y B;  2EXD A;  4GKK Q;  2PI2 E;  1OXS C;  3PSI A;  5DLQ E;  4XTC S;  4QJF A;  2VW9 A;  3CAM A;  2PQA A;  3RZD H;  4BY1 H;  1YVC A;  2JEB I;  2ZM6 Q;  1D8L A;  2OTJ A;  1KC8 C;  4X6A H;  4R4Q A;  1Q82 C;  1VQ8 A;  2OQK A;  2ZTE A;  1UE1 A;  3AFQ A;  4NXN L;  2F4V L;  4C3J H;  5JJK A;  4MTN A;  1IL2 A;  4X62 Q;  1IBM L;  1E7Z A;  4DV1 Q;  1L2F A;  4TQU S;  2ZJR A;  3HOV H;  3JC6 6;  4RMF A;  1Q86 C;  2L15 A;  5C44 H;  3I56 A;  4L5R C;  3S1R H;  2N8N A;  3H15 A;  3CCS A;  1PA6 A;  1JT8 A;  3PIP A;  3HOU H;  2HT1 A;  2ASB A;  1GM5 A;  3J81 c;  3G4S A;  4DV4 Q;  4IFD I;  2FXQ A;  1CKN B;  4LUO A;  1VQH A;  3FKI G;  5LMN L;  4A3K H;  1XNQ L;  1RL2 A;  1JE5 A;  2UUA L;  1HZC A;  4PMW A;  1QVF A;  4R1J A;  3TEH B;  1NBW A;  2R92 G;  4BY7 H;  2XTI A;  2JA5 H;  3PIO A;  3S24 A;  1AH9 A;  3T1Y L;  4YCW A;  1IXR A;  2PI2 A;  4B3T L;  1C9O A;  4DR6 Q;  2GN5 A;  4A93 G;  1NTG A;  3HOY G;  3A5Z B;  2Q2T A;  1KAW A;  2D0P A;  1E1T A;  4DR1 Q;  2CWA A;  4DV0 Q;  1K9M C;  4YY3 Q;  2UU9 L;  4A3E G;  3GTJ H;  4PZ6 A;  1H95 A;  3E9I A;  2BA1 A;  1TWA H;  4HJ8 A;  3I2Z A;  1VQL A;  4JI2 L;  1VQN A;  4DK3 C;  1XNR Q;  3CMA A;  4OX9 Q;  4X64 Q;  1XTD A;  1SLJ A;  4NXN Q;  1N34 Q;  1LTL A;  2K5N A;  3LGJ A;  1R9T H;  3L0O A;  1N36 Q;  3G6E A;  2ZJP A;  4IJH A;  3KYH C;  1PH1 A;  3J81 j;  1T9H A;  1YIT A;  3GD7 A;  1SFO H;  2E2I H;  4GN3 B;  5ELN A;  1I94 L;  4BBS H;  3CP0 A;  3M85 A;  4LF6 L;  3OYY A;  1XMQ L;  3RN5 A;  1CSP A;  4A3J H;  4WJ4 A;  3FHW A;  3A5U A;  1YI2 A;  2VQF L;  1E24 A;  3GO5 A;  1XNQ Q;  4HJA A;  2UUA Q;  2QGQ A;  4DV5 Q;  3RNU A;  3AQQ A;  3PF4 A;  3K7U C;  1VQ4 A;  1LM0 A;  5M5X H;  2H5X A;  3GTO H;  2Z6K C;  3PUW A;  2JA5 G;  4A75 A;  4BY1 G;  5HGQ A;  4X66 Q;  3CCQ A;  4C2M H;  5JEA J;  4YHH L;  2Q2I A;  4IPD A;  5BR8 Q;  1GVP A;  4DV7 L;  1D7Q A;  4K0K Q;  2JA6 H;  2QA4 A;  4IPG A;  1VQF A;  2AWN A;  3I55 A;  1TWG H;  4C3I H;  1LUZ A;  1CKN A;  3M4P A;  4B3M Q;  5IYC H;  4X65 L;  2E2H H;  3HOV G;  2OWO A;  3DM3 A;  3D31 A;  2F52 A;  2OTL A;  4JBK A;  4JI2 Q;  5FJ8 H;  5IP7 H;  5C44 G;  2ZM6 L;  3K0X A;  1JJC B;  4DUZ L;  3HOU G;  4R4I A;  4OWT B;  2NN6 I;  2ZTD A;  3L7Z C;  3F2C A;  4DAY B;  1AE2 A;  1BKB A;  3VDY A;  2E5L Q;  1XMO L;  4DR4 Q;  4GN4 B;  2UXB L;  2A19 A;  2YTX A;  2JQO A;  3UDF A;  4X62 L;  1KRS A;  1S3O A;  2MQH A;  3K7A H;  4A3K G;  1Y1W H;  1X3G A;  4QIW E;  1VQ5 A;  4R4T A;  4R4O A;  3CC7 A;  3A0J A;  1K73 C;  4LF8 Q;  1GKH A;  4A3F H;  1DGS A;  1SRO A;  1YHA A;  1YZ6 A;  3KLW A;  4YWL A;  3CF5 A;  2PMZ E;  4LFC Q;  3ZJY C;  3TRZ A;  3M4O H;  1P16 A;  2WP8 J;  5C0X I;  1K83 H;  2AWO A;  1Z47 A;  1NJI C;  3HKZ E;  2UUB Q;  2MO1 A;  3AFP A;  3PGZ A;  3W1B A;  5IYB H;  4JI3 Q;  4LF5 Q;  4JBJ A;  4RG1 A;  5FLM H;  1XPO A;  4C3H H;  4HJ9 A;  3H0G H;  1UE6 A;  3K81 C;  2RHQ B;  1EIF A;  2LXJ A;  1M1K C;  3GDE A;  4DR7 L;  5C4J H;  2HHH Q;  1SE8 A;  3S14 H;  2K52 A;  4HIO A;  1JJ2 A;  1I6H H;  4QL5 A;  5AJ3 L;  4BBR H;  3IRB A;  2CWP A;  1PH4 A;  1VQ6 A;  3M7N A;  3S2D H;  1ASY A;  1HNW Q;  5C3E H;  4A3D H;  5C4X H;  4JI7 Q;  2YYZ A;  1N32 Q;  4JC0 A;  5IYD H;  3M9B A;  4P72 A;  4JI1 Q;  3W5O A;  1C7Y A;  3PUY A;  1EIY B;  5M5W H;  4KLK A;  3BJU A;  5GAD C;  2CQO A;  4DV0 L;  3RLO A;  3M3Y H;  1PH5 A;  2KBN A;  5M3M H;  4GKJ Q;  2UXC Q;  5GRO A;  1IBL Q;  1EFW A;  3CW2 C;  4MNO A;  2UUC Q;  1PFS A;  4OWW B;  4FDB A;  4P71 A;  4DUZ Q;  4BBS G;  1N33 L;  4DUY Q;  1XNR L;  4OX9 L;  4X64 L;  4UP9 A;  4A3J G;  1XMO Q;  3RZO H;  4OON A;  2UXB Q;  2WAQ E;  1QZH A;  1N34 L;  2R93 G;  2VQE L;  3FP9 A;  3F2B A;  3BU2 A;  1W2B A;  1PHJ A;  1UWV A;  3NEM A;  1N36 L;  4GOP C;  1U0L A;  1YJ9 A;  4A3I H;  4POG A;  1V1Q A;  2WB1 E;  3S2H H;  3KOJ A;  2N78 A;  2B63 H;  4LFA L;  4NPS A;  2K50 A;  3MXN B;  1Q12 A;  2GVB A;  4H02 A;  1A63 A;  1NE3 A;  4A3G H;  4UPA A;  4DR7 Q;  1A62 A;  2JA6 G;  1Q1B A;  1FVI A;  3RLN A;  5J3B A;  1M90 C;  4DV5 L;  3PO2 H;  1KL9 A;  3CCV A;  5AJ3 Q;  2WFW A;  1XPU A;  4BXX H;  4L5Q A;  4P74 A;  5IYC G;  3STB D;  4JBW A;  3CPF A;  3PO3 H;  3KF6 B;  4X66 L;  4GN5 A;  3AYH B;  3J80 i;  1VQG A;  3BZK A;  5IP7 G;  5FJ8 G;  4APV A;  2E8G A;  3EBE A;  3HFZ B;  5BR8 L;  4PZ8 A;  2KCT A;  3UDX A;  4DR5 Q;  1XJV A;  1KQS A;  1AE3 A;  4K0K L;  5JJL A;  2NZH A;  1HZ9 A;  4PG3 A;  3EN2 A;  3CCM A;  3HOX H;  4IOC A;  1EYG A;  2JA8 H;  2ZTC A;  1J5E Q;  4KHZ A;  1Y1W G;  4B3M L;  2Z6K A;  3I4O A;  5IT9 c;  3S15 H;  3I7F A;  1CKM A;  4EQ5 A;  1I5F A;  2DUD A;  2R7D A;  1L1O C;  2KEN A;  1N33 Q;  1KHI A;  3TRE A;  1CKO A;  3K80 C;  5LMU Q;  4A3F G;  3HOZ H;  4GOP B;  4JG2 A;  4IPC A;  1NMG A;  2VQE Q;  1QZG A;  2E5L L;  1HH2 P;  5IP9 H;  2IX1 A;  2RF4 A;  3UE0 A;  5IYB G;  4DR4 L;  1WYD A;  1SN8 A;  5FLM G;  3J7Z C;  1HNZ L;  3H0G G;  1VQ7 A;  1MIU A;  3I4M H;  2PNH A;  4NXM L;  1K8G A;  4IOA A;  3KJO A;  1EWI A;  1B70 B;  4BBR G;  1JB7 A;  4GS3 A;  4LFA Q;  2HIX A;  2QEX A;  1YHQ A;  4LFC L;  4LF8 L;  2NN6 G;  1G29 1;  1A0I A;  1GO3 E;  5C3E G;  4A3D G;  3A74 A;  3UE1 A;  5IYD G;  3S17 H;  3UDG A;  3ULP A;  2Y0S G;  2UUB L;  1C0A A;  4LF5 L;  5GAH C;  4JI3 L;  4GLA C;  2OCE A;  1FJG Q;  3EIV A;  2JE6 I;  3SGI A;  2HHH L;  2JJQ A;  4L5S A;  3HOW H;  5M3M G;  1MJE A;  2VY3 A;  1WOC A;  5M3F H;  5C0X G;  1EQQ A;  1Q81 C;  3CC4 A;  4UP8 A;  4JI0 Q;  4A3B H;  4JI7 L;  4TVA B;  4DR3 L;  1HNW L;  1N32 L;  2YV5 A;  1Y14 B;  4EX5 A;  4A76 A;  1HJP A;  4JI1 L;  4IJL A;  2ES2 A;  1P8L A;  1L1O B;  2VL6 A;  2XGT A;  3CCU A;  2VNU D;  1HR0 W;  4GKJ L;  1OXX K;  3JAM i;  4A3I G;  2UXC L;  3T1H Q;  2B29 A;  2N49 A;  4DNI A;  4QGU A;  1IBL L;  2AMC B;  2Q2U A;  2UUC L;  4B3S L;  4JYA Q;  3G71 A;  2R6G A;  1TXY A;  2B63 G;  4DUY L;  1FGU A;  3KF6 A;  4AQY Q;  4DK6 C;  5E7N A;  4JV5 Q;  1VQE A;  3CC2 A;  1X65 A;  1HNZ Q;  4YWM A;  1G51 A;  1S40 A;  4A3G G;  1K3R A;  4PZ7 A;  4NXM Q;  1EOV A;  1K0R A;  4JI4 L;  5C4X G;  1QVC A;  3PO2 G;  2C35 B;  1BBW A;  2R93 H;  4AH6 A;  1WCM H;  3CCR A;  4BXX G;  3D0F A;  2JK8 A;  1VQP A;  1Y1V H;  1S72 A;  2B3G A;  2E2J H;  1Q8K A;  1IZ6 A;  1IBK L;  2ATW A;  3PO3 G;  4A3C H;  1V43 A;  1VS0 A;  1I3Q H;  1CUK A;  1HR0 L;  1N8R C;  4GOP A;  5K36 G;  4DV2 L;  2LXK A;  3E0E A;  4LNQ A;  3KFU A;  2D62 A;  4OWX B;  3HOX G;  1YJW A;  2JA8 G;  1JJG A;  3NEN A;  3KDF B;  1X3F A;  3U4Z A;  4DV6 Q;  1FL0 A;  1WI5 A;  4DR3 Q;  4IFD G;  3B6Y A;  4JI6 Q;  4P75 A;  3U4V A;  1PH8 A;  2EQS A;  4GNX C;  4LF9 Q;  3HOZ G;  1MJC A;  4DR5 L;  2BH8 A;  1HZB A;  5IP9 G;  2YTV A;  2DGY A;  3H3V I;  1VQI A;  1OTC A;  1SRU A;  1J5E L;  4ME3 A;  1PV4 A;  4HID A;  5GQO A;  4B3S Q;  1QUQ B;  3I4M G;  5IE8 A;  1TWH H;  1E3P A;  3I4N H;  1PYB A;  2YTY A;  2MO0 A;  4A3L H;  1QVG A;  3U50 C;  1I50 H;  5LMU L;  1OXT A;  1SMX A;  1Q1E A;  2K4K A;  3U58 A;  3CCE A;  2K14 A;  1PH3 A;  4LF4 Q;  3PV0 A;  4JI4 Q;  2HQL A;  1VQ9 A;  3K8A A;  4POF A;  1L1O A;  5JJI A;  4B3R Q;  1KIX A;  2JEA I;  3MEF A;  1HZA A;  1LYL A;  2CFM A;  3HOW G;  3F8T A;  3OTO Q;  3HKZ G;  5M3F G;  1IBK Q;  2ZJQ A;  3BZC A;  4GLV B;  1VQD A;  3KJP A;  5LMN W;  4A3B G;  2IX0 A;  2N3S A;  1HR0 Q;  4JOI C;  4DV2 Q;  3H3V H;  4JI8 Q;  2EIF A;  2JA7 H;  4L5T A;  1KXL A;  3NBH B;  4HJ5 A;  4JBM A;  3WWV A;  4OXP A;  3AEV A;  1FJG L;  2I0Q A;  1VCI A;  4Y7N H;  3RLF A;  4LF7 L;  5HY6 A;  1TWF H;  4GNX B;  4J15 A;  4DR2 L;  1BVS A;  3NEL A;  1Z9F A;  3ER0 A;  3ULL A;  4YCU A;  4JI0 L;  4HIK A;  2YU9 H;  2Q2H A;  4AYB G;  1V9P A;  2A1A A;  4KI0 A;  2MNA A;  3J81 i;  4DV3 Q;  1J6Q A;  4JCV E;  4A3M H;  4OO1 I;  3J80 c;  2NVY H;  5IWA L;  2A8V A;  1B8A A;  2KCM A;  5JEA G;  2NVX H;  1YEZ A;  1YNX A;  4XIG S;  2Y0S E;  1IYJ B;  4O0A A;  1YJN A;  1U5K A;  3T1H L;  3GTL H;  2IHE A;  3KDF A;  2ID0 A;  1NMF A;  1WCM G;  2R7F A;  4JYA L;  4IFD J;  2WAQ G;  2KHJ A;  2BH2 A;  1Y1V G;  1XPR A;  3M4Q A;  4AQY L;  3GTP H;  4A3C G;  4DPG A;  4JV5 L;  1EQR A;  4HIM A;  4LFB L;  3RR5 A;  1PYS B;  3PUV A;  3STB C;  2WB1 G;  1HNX L;  1PVO A;  3L2P A;  2K5H A;  4WJ3 M;  2LSS A;  1YHB A; 
#chains in the Genus database with same CATH topology
 4HJ7 A;  1QUQ A;  1RIP A;  4AQY H;  4ZUI A;  1QJO A;  3GTG A;  1E22 A;  1X54 A;  5D1O A;  1S5D D;  1W93 A;  4NXM H;  3BAB A;  2MJ8 A;  3CD6 A;  1OXU A;  2WV6 D;  1E4E B;  3DHQ A;  3EYY A;  2IMW P;  3RN2 A;  4DR2 Q;  4PQX A;  4DV6 L;  3V6J A;  1STN A;  1KTK A;  3OWF A;  2HCI A;  4LWC A;  2UXD L;  1B4O A;  4YJ2 F;  5JVL A;  3QB3 A;  2R84 A;  1X9N A;  2YCH A;  2J6U A;  4A4I A;  5KFT A;  3L4J A;  3GTK A;  4A3L G;  3SVM A;  5A2Q L;  1CI3 M;  4UP7 A;  2NTS A;  5LMN Q;  4ZQI A;  2V4D A;  4DV6 H;  2FLN A;  4KN4 C;  2JA5 A;  2F3I A;  1A3U A;  2QKI C;  2W70 A;  4DR3 H;  3DWQ A;  2Z0S A;  1S68 A;  4YR2 A;  1QG7 A;  1RCV D;  3T16 A;  3LWU A;  1UEB A;  1X6O A;  3GTQ H;  2NU7 B;  3KBG A;  3M4I A;  2JA7 G;  1RK6 A;  2XC9 A;  4XDX A;  2V58 A;  1PFM A;  2BA0 A;  5KFR A;  5KT2 A;  4J9N A;  2J6S A;  5KFV A;  1N9W A;  1YBY A;  3Q8D A;  4GLX A;  2UU9 Q;  2EXZ A;  4C2M B;  4DUY H;  4B3R L;  5IT9 W;  1MKH A;  3T5L A;  3MR6 A;  2GVA A;  4BWS C;  3OTO L;  3S16 H;  1G2S A;  4N8X 1;  4FF3 A;  5JVD F;  4MV1 A;  3ERS X;  3F2D A;  4UDU C;  5FD6 A;  4KKT A;  1TWG B;  3R5X A;  2MFI A;  2NVT H;  5J22 A;  2C28 A;  5KKN B;  3HOY H;  4L63 B;  1DD2 A;  1WH2 A;  2R86 A;  2VB3 X;  4B3R H;  3OTO H;  1IBK H;  3I90 A;  3TQY A;  1I94 Q;  1HR0 H;  5M5Y B;  5E1F A;  4LUV A;  2CCZ A;  5E3F A;  2F03 A;  1F2Z A;  3IG0 A;  1B1Z A;  3HKS A;  2HIV A;  4AIM A;  2MGS A;  1L0W A;  1KD1 C;  4P73 A;  2NWG A;  2L11 A;  4A3F B;  1B9M A;  1E4E A;  4QUC A;  3SI8 A;  2AQ1 B;  5C0X J;  2AQ4 A;  4IPH A;  2EYP A;  2W8K A;  2K5V A;  1K83 B;  3CPW A;  1JMC A;  2RCF A;  1DV1 A;  2BE5 D;  2VUM G;  2V9W A;  2K05 A;  2IY5 B;  3S1M H;  5C4J B;  1BNC A;  1STH A;  3SHL A;  1BQQ T;  1I4X A;  3PCO B;  3OIQ A;  4QQB X;  4ED2 A;  4IRC A;  3K0Y A;  2Y0S B;  4GKK Q;  4LMQ D;  5DLQ E;  3RZD H;  2VW9 A;  4G7Z C;  3CAM A;  1AZP A;  4J9M A;  1YVC A;  2F0G A;  4RKL A;  1D8L A;  2ZM6 Q;  3EJI A;  3I70 A;  2W8L A;  3FPU B;  3SDZ A;  1KC8 C;  5FD5 A;  4RB3 C;  1A15 A;  2OQK A;  1I4R A;  4Q5V A;  5CV5 A;  1TY0 A;  3NSW A;  3P1H A;  4DK1 A;  4FF1 A;  1IL2 A;  4RNM A;  4F4W A;  4DV1 Q;  2ZJR A;  3HOV H;  4ETS A;  3CHB D;  4RMF A;  1CHP D;  2WTF A;  1SDF A;  4QWA A;  2JA6 A;  1Y8N B;  1PFB A;  3EA6 A;  4IUN A;  2ASB A;  5KFI A;  4J9P A;  1TWG A;  3S2H B;  1B53 A;  1CKN B;  3D6C A;  4LUO A;  3FKI G;  1XNQ L;  3HOU B;  1DXM A;  5C8Y F;  4JV2 A;  1SYF A;  1NBW A;  1AH9 A;  1K1Q A;  4TV8 F;  2XD4 A;  5KFB A;  2ALZ A;  3A5Z B;  1KAW A;  1SYD A;  4DR1 Q;  2CWA A;  3K3P A;  4A3E G;  3T51 B;  4RNN A;  1EOT A;  2OEO A;  2OH2 A;  2R8K A;  1H9M A;  1HXY D;  2BA1 A;  5CC4 A;  2K1B A;  1BO0 A;  3QO2 A;  1TWA H;  2BDO A;  5EBD A;  1VQL A;  1VQN A;  3CMA A;  1BNZ A;  1LAB A;  1BGW A;  2GPS A;  4J9O A;  4NXN Q;  1CZG A;  2K03 A;  5COR A;  1ROD A;  3T4A C;  1N34 Q;  3L0O A;  3Q8P B;  3BG3 A;  1NUC A;  2XWB B;  4MA0 A;  2X0S A;  1YIT A;  2E2I H;  3NTI A;  3BDL A;  4BBS H;  2Y0S A;  2PW5 A;  2TSS A;  3H09 A;  1HQR D;  5KG4 A;  1ZKO A;  1EZ8 A;  2F0N A;  4WJ4 A;  2UVV A;  2KCN A;  2RDI A;  2VQF L;  2ASJ A;  3VR6 A;  1IYV A;  3CRL C;  3RD4 A;  2QGQ A;  4YB8 B;  5JH7 F;  4DV5 Q;  4J9S A;  4LF9 H;  1EYA A;  1B3Q A;  1DOK A;  1JCK B;  3DUZ A;  2JA5 G;  5HGQ A;  2VQF H;  1SYX B;  5DG8 A;  2Q2I A;  2FFK B;  4J8Q A;  1GVP A;  2WIN B;  2CH4 A;  3PR5 B;  3T53 B;  3HOW B;  4DNR B;  1OO9 B;  5M3F B;  4C3J G;  3MVV A;  1CKN A;  3M4P A;  3I12 A;  4KHP H;  1BCP D;  4X65 L;  2WAC A;  3DM3 A;  3R5F A;  4JBK A;  4JI2 Q;  4JI5 H;  5IP7 H;  5BMV F;  3K0X A;  5FO9 B;  4DUZ L;  1FGB D;  4OWT B;  1HUM A;  3BDO A;  1AE2 A;  1BKB A;  4LK1 C;  4ME6 A;  2YTX A;  1F9Q A;  4X62 L;  1C8C A;  2MQH A;  3VR4 A;  3VPD A;  2HCC A;  1VQ5 A;  1JWS D;  4R4T A;  4R4O A;  1K73 C;  2ZXP A;  1ASY A;  1SRO A;  1YZ6 A;  4LFC Q;  1IW7 C;  3OHB A;  2KA7 A;  4OIK A;  1BOS A;  1P16 A;  3NPP A;  2WP8 J;  5IT9 L;  5C0X I;  1NJI C;  3M4O H;  3HKZ E;  4XT1 B;  3W1B A;  4X62 H;  4JBJ A;  3TZD A;  1XPO A;  4HJ9 A;  3Q22 A;  2WAQ B;  2YS6 A;  1EIF A;  4DR7 L;  3GV6 A;  1SBB B;  1SE8 A;  3S14 H;  2E2J B;  3VPB A;  3VR2 A;  2BQ3 A;  1XYI A;  1XDN A;  2J0T D;  3S2D H;  2WB1 B;  2WDT A;  3K5M A;  2F0S A;  1K28 A;  2H4O A;  1N32 Q;  4DV4 H;  1SAP A;  2IWH A;  1J9O A;  4RFB A;  3OUU A;  1C7Y A;  1VBG A;  5M5W H;  1W96 A;  3W2D A;  1BDO A;  2KEC A;  1TS4 A;  1WR2 A;  3RLO A;  5KG0 A;  1ZXT A;  3TII A;  1EFW A;  3G8C A;  5C0X H;  1GSO A;  4HNV A;  4DR6 H;  1N33 L;  4DUY Q;  2C5C A;  1RYR A;  1SNQ A;  4OX9 L;  3RZO H;  1XMO Q;  4OON A;  5BPF A;  2WAQ E;  2IBK A;  1TWH B;  2VQE L;  5KND A;  2OF1 A;  4YY3 H;  1W2B A;  1N36 L;  1UWV A;  3NEM A;  3V4Z A;  4NW2 A;  3HKZ A;  2LMC B;  4A3I H;  4R8U B;  2W7P A;  4HMJ A;  2QYZ A;  2WB1 E;  2IPK D;  1KAB A;  1X32 A;  3K5I A;  3T5H A;  3J80 E;  2N78 A;  3X3N A;  4OX9 H;  2B63 H;  5LL6 S;  5BN3 A;  2F4V H;  1EYD A;  3J7A F;  5FO8 B;  1JIH A;  1N36 H;  3UFX B;  1AP0 A;  1QE6 A;  1BCP F;  2F3V A;  4A3G H;  1A62 A;  2JA6 G;  1H9K A;  1Z2O X;  1FVI A;  4YJ3 F;  5AJ3 Q;  2O4X A;  1EWH A;  2XIW A;  4XQJ A;  4YR3 A;  3U9O A;  4JBW A;  2OT2 A;  2B8G A;  3PO3 H;  3KF6 B;  3RB3 A;  3J80 i;  1VQG A;  3BZK A;  3MR5 A;  2E8G A;  5BR8 L;  2KCT A;  3TIG A;  1AE3 A;  1TWF B;  2L12 A;  3KLR A;  4DL7 A;  3ERO A;  1X3Q A;  1J5E Q;  2YU9 B;  2AU0 A;  2WAQ A;  3S15 H;  3MWE A;  3I7F A;  1MGS A;  1I5F A;  1RF2 D;  1QNK A;  2O03 A;  4A3F G;  3K80 C;  5LMU Q;  2XNA C;  2WB1 A;  3OWE B;  2E2D C;  1NMG A;  1QZG A;  5DLG A;  2V4Q A;  1JX4 A;  2E5L L;  5IP9 H;  3UE0 A;  1STE A;  5IYB G;  2EJM A;  1BF4 A;  4DR4 L;  2FPP B;  1HNZ L;  2DJG C;  3I4M H;  1ML0 D;  3GTP B;  3KJO A;  2XWJ B;  1L2Z A;  1MBY A;  2R8G A;  1PRT B;  4B9X A;  2HIX A;  2NN6 G;  2E5L H;  2IA6 A;  4N8F A;  2QCP X;  5BN5 A;  5J2T F;  3UDG A;  4O4L F;  2Y0S G;  4LF5 L;  1JWM D;  4GLA C;  1TWH A;  3JAM E;  4ZKC B;  2R7Z B;  3EIV A;  2HHH L;  4QIW B;  3RF2 A;  3WOF A;  4R8U A;  5FLX E;  1MJE A;  2VY3 A;  1EU3 A;  1M6V A;  1X3P A;  1V1O A;  3PR4 A;  1EIH A;  1HNW L;  4EEY A;  1ILP A;  2PMZ B;  4C5B A;  5JVG 3;  1F9S A;  1HJP A;  1L0Y B;  2ENB A;  2K5D A;  3MAQ A;  1EL0 A;  1MD2 D;  4A3B B;  1L1O B;  2CVR A;  3L3O C;  1AN7 A;  2VL6 A;  3C0F B;  4PDB A;  3A7L A;  4F88 A;  3JAM i;  1HNW H;  2B29 A;  4QGU A;  4H7B A;  2AMC B;  4TRD A;  5KYL A;  1DOL A;  5EOY A;  3G71 A;  2R6G A;  5KG6 A;  3KF6 A;  4DK6 C;  1MZB A;  2AGQ A;  3FDS A;  2KJX A;  3TDQ A;  1DM0 B;  1MHW C;  1K3R A;  1TWF A;  1KJJ A;  2QK4 A;  2C35 B;  5IGG A;  2R93 H;  4M1U B;  2YU9 A;  1WCM H;  2RVL A;  3I73 A;  3CCR A;  1SYB A;  3Q23 A;  2JK8 A;  3JSN A;  1Y1V H;  2ATW A;  1Q8K A;  2UXB H;  5EKI A;  4A3C H;  1HTL D;  1SMY C;  1I3Q H;  4DV2 L;  2B2V A;  2ICI A;  1IOV A;  4LNQ A;  1JJG A;  4U6P A;  3NEN A;  1PDQ A;  1N48 A;  3DEO A;  3F8N A;  3GTP A;  4XYM B;  3DWA A;  4IFD G;  5KFP A;  4QW9 A;  1EYC A;  4LF9 Q;  2QIL A;  1NNX A;  2I8C A;  2DGY A;  2CH4 W;  5IGC A;  1OTC A;  2YL2 A;  5JQW A;  2R7Z A;  1SXT A;  3W3A A;  2DNE A;  1HA6 A;  1PYB A;  5DGA A;  2MO0 A;  1JOR A;  3U50 C;  1F9R A;  1JC7 A;  1Q1E A;  2K4K A;  5ISR A;  5HBR B;  4RGO S;  4JI4 Q;  1JOQ A;  4MV9 A;  3CQZ B;  3K8A A;  4QWC A;  1IHZ A;  1ICW A;  1L1O A;  4KD3 A;  2A74 C;  2VR1 A;  3SXH A;  1SSO A;  4KY7 A;  1HZA A;  3HOW G;  2CFM A;  3J81 E;  3HKZ G;  5M3F G;  1NSN S;  3D6W A;  4GLV B;  4KJO A;  4QWE A;  3SK8 A;  2I46 A;  5CR3 A;  2FE3 A;  5EDW A;  3GTM B;  2B2T A;  3JSL A;  1FJG L;  2I0Q A;  3SE0 A;  4LFA H;  4GNX B;  4J15 A;  4DR2 L;  3RJ0 A;  3P20 A;  1Z9F A;  4YCU A;  2ICE C;  1A3T A;  2Q2H A;  2JP1 A;  4KI0 A;  4DV3 Q;  5KFF A;  3J81 i;  4I65 A;  4OO1 I;  3N41 B;  4U67 3;  2K5Q A;  5L1I A;  2NVY H;  4MV6 A;  2KCM A;  5JEA G;  2NVX H;  2R92 A;  1FNU A;  4EFB A;  3Q2O A;  4X66 H;  1IYJ B;  2VA3 A;  1GUS A;  3CVZ A;  2ID0 A;  1NMF A;  2R7F A;  4IFD J;  4K0K H;  2WAQ G;  3BVG A;  1T3N A;  2B2U A;  3NK9 A;  4JV5 L;  4HIM A;  3O13 A;  1PYS B;  4IUQ A;  3STB C;  2WB1 G;  4CGY B;  4BY7 B;  3VPC A;  1U4P A;  3OPO A;  4UCS A;  1TAE A;  2C9O A;  3LWE A;  1DON A;  5A2Q W;  2OQ0 A;  3L4K A;  1Q46 A;  4OO1 H;  5KX5 F;  1ASZ A;  4JV5 H;  1B6R A;  3RV3 A;  1Q7Y C;  4LW1 A;  3BS1 A;  1PH6 A;  3UQ8 A;  2XSC A;  4FF2 A;  5C3W A;  1Z7T A;  2I5H A;  1QWY A;  3NHH A;  2F4V Q;  2I80 A;  2VPQ A;  5L9X A;  4LF7 Q;  3ORR A;  3CQZ A;  5KFL A;  1RD9 D;  2E74 C;  2NU6 B;  1TWC A;  4ILW A;  2NZO A;  3TZU A;  4R4C A;  1R9T B;  2W7O A;  2G9H D;  2JA9 A;  3HGB A;  2D2C C;  4H13 C;  3PUZ A;  2NU9 B;  1D5X C;  5LP6 F;  2ASD A;  3IFT A;  1SFO B;  4NLG A;  1RKN A;  1S97 A;  2EYL A;  2ALY B;  2MPM A;  3GTM A;  3A56 A;  2XN9 C;  3PW0 A;  1TKW B;  1RTN A;  4MZ9 A;  4JI7 H;  2PQA B;  3KUP A;  4JI1 H;  4GNX A;  1KRT A;  5GAG C;  4RZR A;  1XX8 A;  2UVW A;  1CQV A;  4CJ2 C;  3TS2 A;  2SOB A;  2D0O A;  1ESF A;  3BJY A;  1A2T A;  4GKJ H;  4B3S H;  5GAE C;  1IW7 D;  4JW0 A;  2VS1 A;  1PTO C;  1WTP A;  1VQO A;  4I4T F;  4I7A A;  2AGP A;  4RUC A;  1VQK A;  3G6V A;  2W6P A;  4X3K A;  4CJ1 B;  5CA1 F;  4IR1 A;  1E4G T;  4GKK L;  4ZK9 B;  1EEI D;  2AHO B;  4EG0 A;  2RQX A;  5KT7 A;  5LHY 1;  1HA5 A;  1S9F A;  1X56 A;  3KF8 B;  4A93 H;  1E2Z A;  2RBM A;  2E2H B;  3RB4 A;  1EUJ A;  3OMC A;  5M5Y H;  2FKL A;  1W6K A;  4QY7 A;  2RCN A;  2W9B A;  4DV1 L;  1PH7 A;  4ECU A;  1NR2 A;  3NWT A;  1CSQ A;  1G6Z A;  5HUR A;  2B2Y A;  1KEE A;  5FPO A;  2E76 C;  1S0M A;  1AUX A;  2IJ0 A;  1QCB D;  4J1M A;  4DAV A;  5EPJ A;  1YIJ A;  1PFN A;  1ZET A;  3N44 B;  4KN7 C;  5KFM A;  3S1Q B;  1UE7 A;  3NTK A;  2YZN A;  3J7Y W;  1PH2 A;  1VQA A;  4DL4 A;  2FMA A;  3C3L A;  5K2M A;  2W6M A;  2R7Z G;  4RCO A;  4C3H B;  4J9L A;  3H0G B;  3CCJ A;  4IO9 A;  2I5M X;  4YHH Q;  1R9T A;  1UE5 A;  1G6P A;  4Q43 A;  1O7I A;  1I6H B;  4BBR B;  5KT4 A;  5DG9 A;  2IHF A;  1SFO A;  3F1Z A;  1LAC A;  3RV4 A;  4A3D B;  4DR1 L;  5IY0 A;  2KHI A;  2KQ3 A;  1B7Y B;  2EXD A;  2PI2 E;  4BY1 H;  2PQA A;  5D3I B;  1CE8 A;  3M3Y B;  2CQY A;  2FMM A;  4O2A F;  4R4Q A;  3TP5 A;  5KG7 A;  2ZTE A;  1TS3 A;  2R82 A;  1UE1 A;  4NXN L;  5IOC A;  5JJK A;  1IBM L;  1GUG A;  5DNF A;  1ONL A;  4TQU S;  1F77 A;  2W6O A;  2PVP A;  3JC6 6;  3MFI A;  4ZAI A;  5IGF A;  1AFP A;  5C44 H;  3I56 A;  4J9K A;  1K8O A;  3H15 A;  3CCS A;  2H1E A;  5E4X A;  3PIP A;  3HOU H;  4JPB W;  4ID6 A;  3G4S A;  4IFD I;  1IBM H;  4ECZ A;  5KFC A;  2FXQ A;  4A3K H;  3S1R B;  1LV9 A;  1GGO A;  1PRT C;  3GV3 A;  2E2H A;  3ND8 A;  4N9T A;  4JK1 C;  2A68 C;  1HZC A;  1T94 A;  3WOE A;  5C3X A;  5EPK A;  3TEH B;  2R92 G;  1YNN C;  3KXY T;  5IWA H;  4LAA A;  3LNN A;  3S24 A;  5BPH A;  3T1Y L;  1IOW A;  4ZCK A;  1F9P A;  2PI2 A;  4B3T L;  3Q0A A;  4ED8 A;  1JQY D;  1GHJ A;  1PZI D;  4X3T A;  4DV0 Q;  1O75 A;  3GTJ H;  3E9I A;  2JEG A;  1A6X A;  1Y1V A;  1Q3L A;  1HRJ A;  4LFB H;  1EY8 A;  3BYY B;  4B3T H;  1HNX H;  2HQE A;  4JI2 L;  2JA8 B;  3GV7 B;  2JEI A;  2WYO A;  1C48 A;  1LLR D;  1SLJ A;  1XTD A;  4CDD C;  5NUC A;  3H0G A;  4LH7 A;  1LTL A;  2ASL A;  2F0U A;  4V0B A;  3PMF A;  5A35 A;  1BBX C;  5CMD A;  3DWP A;  3KYH C;  3N40 P;  5DG7 A;  1PH1 A;  4ZOL F;  1VMC A;  1T9H A;  3GD7 A;  3N52 A;  2VPS A;  4GN3 B;  5ELN A;  3CP0 A;  2IX3 A;  4LF6 L;  3TP8 A;  1XMQ L;  4ED7 A;  1CSP A;  3HP3 A;  4A3J H;  3FHW A;  1F2M A;  3CRK C;  5I6Y A;  3MWY W;  5I9O A;  3QR8 A;  2UUA Q;  2UXD H;  2Q8I B;  5D14 A;  1BR9 A;  3RNU A;  4EYI B;  1CZW A;  2KHS A;  3TP7 A;  3PF4 A;  1VQ4 A;  4RB2 C;  1LM0 A;  4QCL A;  5M5X H;  3KAK A;  2EY6 A;  2V59 A;  4LF6 H;  3T56 B;  3GTO H;  1XMQ H;  1D5M C;  2Z6K C;  3IL8 A;  3PUW A;  4MV7 A;  4X66 Q;  1U4R A;  4IPD A;  4K8I A;  3RGZ A;  4DV7 L;  1I7N A;  4K0K Q;  1ENF A;  1VQF A;  3QJY A;  4IPG A;  3ZYY X;  1I4H A;  4C3I H;  1LUZ A;  1SMY D;  4B3M Q;  4C5A A;  3PW4 A;  2XGP A;  2J6T A;  2JA6 B;  4O3P A;  1JWU D;  1KNE A;  2QDB A;  3D31 A;  3MFG A;  2VOB A;  5FJ8 H;  3K6O A;  4DV7 H;  2FLP A;  2KUM A;  1WVL A;  3D4R A;  3S1N H;  2ZTD A;  3F2C A;  1ZEQ X;  2W71 A;  4DAY B;  4ECV A;  1XMO L;  1EY9 A;  3QG1 A;  2FIN B;  5T1I A;  3MFH A;  4K6L A;  3UDF A;  1KRS A;  3K7A H;  1Y1W H;  1UC8 A;  1HHV A;  2J4X A;  1K8M A;  3ERQ A;  4I7H A;  3OHA A;  3DM1 A;  3CC7 A;  3A0J A;  4BY7 G;  4LF8 Q;  1GKH A;  1I7L A;  1YHA A;  3ETH A;  3CF5 A;  2HDM A;  1T5X D;  2AWO A;  2PW7 A;  2RSO A;  2UUB Q;  2MO1 A;  2YRW A;  5LXT F;  4RGN A;  1S0O A;  1CHQ D;  3JZI A;  4RG1 A;  2RHQ B;  5IOD A;  1M1K C;  3GDE A;  1PTO H;  4ED0 A;  4RKB A;  1Q90 A;  4HIO A;  3FPP A;  2R6F A;  5AJ3 L;  2M2L A;  1A3V A;  3IRB A;  2RDG A;  1CT1 D;  5T1G A;  4JI7 Q;  5IYD H;  4RGM A;  4P72 A;  2N55 A;  4JI1 Q;  1EIY B;  3PUY A;  2Z6B A;  4CJ0 B;  3BQ1 A;  3RAX A;  3BJU A;  5GAD C;  5KFO A;  3G7L A;  2KBN A;  5KYI A;  4GKJ Q;  3SR1 A;  5GRO A;  2UUC Q;  1SE4 A;  4OWW B;  4P71 A;  4F4Z A;  1XNR L;  5KFJ A;  4X64 L;  2NUC A;  1WD0 A;  4IUR A;  3FP9 A;  3I4N B;  2AQ3 B;  2XCP A;  1U0L A;  2PYK A;  2ZDG A;  4POG A;  5KFZ A;  1A9X A;  3KOJ A;  3K59 A;  5JVH 3;  2I87 A;  2W6Q A;  4KK7 A;  4IAJ A;  3GV5 B;  1I4P A;  5KFU A;  3H91 A;  5G3L F;  2K50 A;  3I8Z A;  1Q12 A;  2YRX A;  4DAY A;  1M90 C;  5J3B A;  3NQI A;  2WKC A;  3CCV A;  4L5Q A;  2FK3 A;  2PN1 A;  4IQZ A;  5IYC G;  3STB D;  3TIN A;  4KY6 A;  5DGB A;  3AYH B;  5D8D A;  1XNQ H;  4G57 A;  3EBE A;  4PZ8 A;  4DR5 Q;  1EYZ A;  4PG3 A;  3CCM A;  2VB2 X;  3HOX H;  4IOC A;  1EYG A;  2DLN A;  5L37 A;  2ZTC A;  2GLT A;  1RDP D;  4KHZ A;  4UCR A;  3I4O A;  3OSP A;  4KTA A;  4A3M B;  1CKM A;  4XYO A;  2DUD A;  3V6K A;  3RGX A;  1KHI A;  4TSS A;  2SCU B;  3KK7 A;  3HOZ H;  2EVB A;  4GOP B;  2XVS A;  1JR0 D;  2IX1 A;  4MTE A;  3MJF A;  2RF4 A;  3TP6 A;  2PPB C;  4P2C B;  5FLM G;  4C3H G;  2Z8L A;  3H0G G;  1VQ7 A;  2GA4 B;  3E0J A;  1WTH A;  1AZQ A;  1EWI A;  1GUT A;  4BBR G;  1JB7 A;  1YHQ A;  4EGQ A;  3ORQ A;  1A0I A;  5C3E G;  4A3D G;  3A74 A;  5C4X G;  2CW7 A;  3S17 H;  1PX2 A;  4JI3 L;  1GUW A;  4M9U A;  3I3C A;  2EYO A;  4I50 F;  3HRZ C;  2L9H A;  2OCE A;  3NTH A;  2F4I A;  4JUZ A;  5KG5 A;  4YR0 A;  3SGI A;  2O5J C;  4HSP A;  2IP4 A;  4L5S A;  5M3M G;  1C3O A;  2B2W A;  3RFC A;  1UNS A;  5EGT A;  2A6E C;  4HCS A;  1HPC A;  4U7C A;  2K01 A;  1Q81 C;  4UP8 A;  4A3B H;  4ZRZ A;  1PTO D;  2F0P A;  2YV5 A;  4A76 A;  4JI3 H;  1S10 A;  2JEF A;  3HKZ B;  2JEJ A;  1P8L A;  1TII D;  3N42 B;  4NKL A;  3NBH A;  2X6L A;  2UXC L;  1VDZ A;  2F0K A;  2N49 A;  1IBL L;  2L4N A;  4JYA Q;  4CBV A;  1J8I A;  1TXY A;  4DGZ A;  2J7Z A;  4LMY A;  1NCV A;  1FGU A;  1ZYR C;  4PNY A;  4AQY Q;  2HGS A;  5E7N A;  4YAJ B;  1VQE A;  3CC2 A;  4XYQ A;  4X65 H;  4YWM A;  4IUT A;  2L55 A;  4NXM Q;  1EOV A;  4JI4 L;  1IBL H;  2DNC A;  3PO2 G;  4ZI7 F;  5GON F;  4AH6 A;  4BXX G;  4DUZ H;  3GTQ B;  3D0F A;  5EWE A;  1S72 A;  5IGE A;  4LH6 A;  1IZ6 A;  2KEE A;  1V43 A;  4GOP A;  1TVX A;  3CKI B;  5K36 G;  5KFH A;  1E4F T;  2RDF A;  3E0E A;  3KFU A;  1OWT A;  2D62 A;  2FJZ A;  3S16 B;  1JOK A;  1YJW A;  2JA8 G;  1B04 A;  3KDF B;  1X3F A;  4DV6 Q;  4V19 0;  3GIM A;  2YZM A;  1WI5 A;  2NVT B;  3R23 A;  2ATL A;  4DR3 Q;  3I91 A;  3HOY B;  1TS2 A;  4K5W A;  3U4V A;  2HD3 A;  3DXJ C;  4DR7 H;  2BH8 A;  4O2B F;  1HZB A;  2BQU A;  4WOR A;  1BJT A;  4IR9 A;  1O78 A;  2TMP A;  4ME3 A;  5GQO A;  1U9R A;  2R8J A;  2F0H A;  2PNR C;  2YTY A;  3AB9 A;  4CDC C;  4A3L H;  1I50 H;  5D3D A;  2K32 A;  2CW8 A;  3CCE A;  1GSH A;  3SE7 A;  4HR7 B;  2FLL A;  4K2L A;  2FK2 A;  2RSN A;  2NZ1 D;  3MR3 A;  5DM6 3;  1N33 H;  1PTO F;  4B3R Q;  3S1M B;  1KIX A;  2JEA I;  1BCP B;  3MEF A;  1LYL A;  3VYT A;  3F8T A;  1PRT D;  4QMG A;  3OTO Q;  1IBK Q;  1KDC A;  1D1K A;  4F87 A;  5LMN W;  4JV0 A;  2VQE H;  2ZDH A;  2A68 D;  2IX0 A;  1HR0 Q;  2EIF A;  4I55 F;  2JA7 H;  4L5T A;  1YNN D;  1O80 A;  1KLU D;  4EEQ A;  3RZD B;  5M9O A;  3WWV A;  5LL6 X;  3LML A;  3VMM A;  3RAQ A;  4IAL A;  1HFG A;  4Y7N H;  4LF7 L;  1ET6 A;  3GTO A;  3NEL A;  4RAU C;  4JI0 L;  2PO4 A;  3GTQ A;  1V9P A;  2A1A A;  5FK9 C;  2MNA A;  2EY5 A;  4JCV E;  1VMP A;  2MHV A;  3J80 c;  4IZO A;  3IKJ A;  3PW7 A;  2A8V A;  1YNX A;  3MWD A;  4O0A A;  4HAE A;  3GTL H;  1U5K A;  3T1H L;  1UNN C;  3GID A;  3KDF A;  1LTI D;  4ZHQ F;  4JI0 H;  5BR8 H;  4DNT B;  2KHJ A;  2NBF A;  2VA2 A;  1XPR A;  3PN1 A;  1PXU A;  3MHB A;  4DU9 A;  3C1F A;  4F8M A;  5KG2 A;  5F9N A;  2F0V A;  3GIJ A;  2LSS A;  1YHB A;  4ED6 A;  2BCO A;  2PZW A;  2VUM H;  4Y52 H;  5KFX A;  4DR4 H;  3HB9 A;  3CME A;  1C4Q A;  1PK8 A;  1HNZ H;  3G6X A;  2E75 C;  1JDB B;  4XXE A;  1A8V A;  2R61 A;  3OMG A;  3EQL C;  4YWK A;  3OUZ A;  2KVM A;  4ALP A;  4J6H A;  4NB3 A;  1TWA B;  4IWY A;  4HR7 A;  3FMA A;  2R85 A;  4LF5 H;  2JSO A;  3I4N G;  4JI6 L;  3W1G A;  1PH9 A;  2R7K A;  4FXG C;  4ECQ A;  2HHH H;  1LTA D;  2C2D A;  3Q6S A;  3GII A;  2R7N A;  1V51 A;  4Q8E A;  4BBS B;  3UDI A;  1FR3 A;  4DK0 A;  2W57 A;  1PRT F;  3QIA A;  3OW2 A;  2RA4 A;  5EWF A;  2RDJ A;  3HZX A;  3K5N A;  4K6D A;  2FB9 A;  4C1N K;  4JI6 H;  2R87 A;  1V4Y A;  4WBN F;  3KAJ A;  1KJQ A;  3JAM c;  4ME5 A;  5H1S E;  1LT3 D;  3MTS A;  1M0W A;  3C2P A;  5FLX c;  3PF5 A;  2DY7 A;  4LF4 L;  3FKI H;  2ZXO A;  1XXG A;  4NDX A;  3DF7 A;  5KIX A;  3JRX A;  3GP7 A;  5LA6 F;  2R92 B;  4JI8 L;  4A3M G;  4BA2 I;  1RJT A;  2XGQ A;  4DAM A;  2DPJ A;  2F0Q A;  4A3E H;  1RJP A;  3PUX A;  4MTD A;  2XCL A;  3HEJ A;  5EJW A;  1SR3 A;  4JOI A;  3TS0 A;  1EHI A;  4DV2 H;  4YBZ B;  4JI8 H;  3KLS A;  5F2D A;  3GTG H;  3S1Q H;  2VQF Q;  4DLK A;  3E9H A;  3GQC A;  3V6H A;  1X55 A;  3CCL A;  1EQT A;  4XT3 B;  5KFQ A;  3BVM A;  1TWA A;  3M4O B;  2W6N A;  2F0J A;  5ELD A;  4KHP Q;  1M0T A;  2EOT A;  1WFQ A;  4IRD A;  4O1N A;  5J39 A;  3ICE A;  3R2T A;  4JI5 Q;  1SNO A;  2G9D A;  3S14 B;  1R4Q B;  2NVQ H;  3GTK H;  2K75 A;  4QB4 A;  5EAY A;  4AYB E;  2E2I A;  4UCU A;  3DLL A;  1BBU A;  1TWC B;  4J9R A;  2EJG C;  4DKA C;  4FO2 A;  4X65 Q;  4LJZ C;  4IWX A;  2JA5 H;  3PSI A;  4XTC S;  4QJF A;  1IKM A;  5M5W B;  4FNF A;  2JEB I;  2O2L D;  4JVZ A;  4YP3 A;  3D3R A;  2CZG A;  4KJN A;  3A54 A;  5ELE A;  1VQ8 A;  3AFQ A;  1WSC A;  4C3J H;  1B50 A;  4X62 Q;  1E7Z A;  3Q8R B;  2KCC A;  1LT5 D;  3R8B A;  1EIG A;  4ZQ3 A;  2L0C A;  3KHR A;  1Q86 C;  2L15 A;  4L5R C;  3A7A B;  4HN7 A;  5FOB B;  2N8N A;  3S1R H;  1PA6 A;  2AUK A;  1JT8 A;  1UC9 A;  5CGK A;  2HT1 A;  4F4Y A;  1FJG H;  4RH6 A;  4A3I B;  3J81 c;  4DV4 Q;  5HV6 A;  5IT9 E;  3PQI A;  4DR2 H;  5LMN L;  5DEH A;  1SJE D;  2QW7 A;  1RL2 A;  3BVZ A;  2B63 B;  2UUA L;  4RB1 A;  4I7Z C;  5C6A A;  4O3S A;  4GC6 A;  1QVF A;  4R1J A;  4Z9C B;  4YQW A;  4EBD A;  1NR4 A;  5EBC A;  4H0L C;  1G2T A;  3AMU A;  4A3G B;  1LTS D;  5I9P A;  4YCW A;  2M9V A;  1IXR A;  3NQT A;  1C9O A;  1B2T A;  2M00 A;  4DR6 Q;  1TY2 A;  4F7X A;  2W9B B;  1NTG A;  4CKB A;  3HOY G;  2Q2T A;  2D0P A;  3PO3 B;  1SEB D;  2UU9 L;  4YY3 Q;  4KKS A;  4PZ6 A;  1EZ1 A;  3M9O B;  4HJ8 A;  3I2Z A;  4OX9 Q;  5I6W A;  3S15 B;  2A6E D;  1N36 Q;  3G6E A;  2ZJP A;  3J81 j;  3MXG A;  4DAP A;  1I94 L;  3BQ0 A;  4RB0 A;  3A8I E;  1E0B A;  4UHV A;  3NUC A;  2J9G A;  4YAK B;  5C1P A;  3OYY A;  4FBU A;  3I4M B;  3A5U A;  1E24 A;  3GO5 A;  2YW2 A;  3QZ8 A;  1ZYR D;  3PZP A;  4ZUJ A;  5I2X A;  3K7U C;  3BAA A;  2F0T A;  5I47 A;  2K33 A;  4R9W A;  2H5X A;  2HJW A;  4A75 A;  1VAJ A;  3CCQ A;  2WII B;  4C2M H;  2AQ2 B;  4FXK C;  5JEA J;  1KDA A;  5BR8 Q;  3J80 W;  3MXP A;  1KJ8 A;  4WRD A;  2JA6 H;  2AWN A;  3I55 A;  1TWG H;  3PIP 3;  1JKJ B;  4R7R A;  2B63 A;  3U9S A;  1EY6 A;  3HOV G;  4S3S A;  5L1J A;  4TQR A;  2A6H C;  2F52 A;  5ELB A;  5J1Z A;  2UVR A;  2ZM6 L;  4IN3 A;  3RB6 A;  1WTO A;  5JJZ A;  5CBA E;  3VDY A;  2NN6 I;  1EUD B;  2E5L Q;  4MHE A;  4DR4 Q;  1UUP A;  4GN4 B;  2JQO A;  3RMH A;  4GKK H;  2C22 A;  1QOH A;  2IL8 A;  2FMC A;  3SK6 A;  3R93 A;  4C5C A;  4ECW A;  4A3F H;  1DGS A;  1U4M A;  2F0L A;  1K83 H;  1Z47 A;  3FVQ A;  5H80 A;  1DIK A;  5IYB H;  3AFP A;  4LF5 Q;  1WCM B;  4DV1 H;  1N56 A;  3OIP A;  4E6I A;  3TQT A;  1UE6 A;  3K81 C;  4EQN A;  1Y1V B;  2LXJ A;  1LTB D;  5C4J H;  2HHH Q;  1JJ2 A;  1I3Q B;  3MR2 A;  2CWP A;  1PH4 A;  3M7N A;  2K28 A;  2NN6 H;  1HNW Q;  4Q45 A;  4O4I F;  4K5V A;  3M9B A;  4WJW A;  1JDE A;  2ZDQ A;  2MP1 A;  2SNS A;  1JE4 A;  1AN8 A;  5C3E B;  5C4X B;  4O3Q A;  5KFD A;  2K7V A;  1PH5 A;  4Q44 A;  3M7G A;  1WD1 A;  4FM9 A;  3CW2 C;  1EEF D;  4EQP A;  3DMU A;  3HBL A;  3JAM W;  4BBS G;  2R8H A;  1S5B D;  1CA6 A;  4DF7 A;  5M3M B;  3KLS X;  5FLX W;  2UXB Q;  4DR1 H;  1N34 L;  1JXL A;  3MFY A;  3F2B A;  1DOM A;  3BU2 A;  1PZK D;  1SYG A;  2B2V C;  2NUA B;  1EUC B;  2I07 B;  3S2H H;  1VKZ A;  4MIU A;  5DLF A;  3R2I A;  5IYZ F;  4NXN H;  3MXN B;  3BQ2 A;  4RGT A;  2GVB A;  2EY2 A;  4Y8V B;  2RGR A;  5EZY F;  1NE3 A;  2V5A A;  4DV5 L;  2Z9H A;  2WFW A;  1CFM A;  1CQI B;  5LL6 b;  1AEX A;  1GXD C;  2M05 A;  4PV1 C;  2Q8R E;  1O7L A;  3PO2 B;  4IUP A;  1S5F D;  5IP7 G;  4APV A;  4DL5 A;  3HFZ B;  1LTT D;  3NBI A;  1HUN A;  4DV5 H;  1HZ9 A;  2FK1 A;  2R93 A;  3EN2 A;  4GZY C;  1E2V A;  1WCM A;  3S9W A;  3BA9 A;  4MV3 A;  1STB A;  2EYF A;  3T1Y H;  4EQ5 A;  1CQJ B;  3MWM A;  2R7D A;  1L1O C;  2NVY B;  4IFD H;  2KEN A;  1I3Q A;  3TRE A;  2B8F A;  2NVX B;  1CKO A;  2KSW A;  3N43 B;  4JG2 A;  4RU9 A;  2BQR A;  1HH2 P;  1M4V A;  2EYM A;  4NMZ A;  1KBL A;  4RAZ A;  1GSA A;  1KAA A;  5KG1 A;  1SN8 A;  4UAI A;  2QEJ C;  2W6Z A;  2Z1C A;  5DQI A;  1RYS A;  4KV6 A;  4NXM L;  1D1I A;  2B2T C;  3KHH A;  4IOA A;  5IIF A;  4JI2 H;  5COY A;  1B70 B;  2DN8 A;  4GS3 A;  4YIJ A;  1XWE A;  4LFA Q;  4LFC L;  2QEX A;  1XTC D;  2K5W A;  5CB4 F;  1GO3 E;  2G5D A;  3UE1 A;  1SE2 A;  1C0A A;  5IGD A;  3M9M B;  1CQF A;  1PLF A;  1FJG Q;  5KFE A;  2BR0 A;  1I6U A;  3HOW H;  4LFC H;  1B3A A;  5M3F H;  5C0X G;  1EQQ A;  3J7A V;  1DCZ A;  4DR3 L;  1N32 L;  1TA8 A;  1G8Z D;  3WNZ A;  5HGT A;  3MA2 B;  1KJ9 A;  1BXR A;  3MXN A;  3K3V A;  2B2U C;  5G3L D;  1T36 A;  2DJF C;  3J81 W;  2ES2 A;  3V4S A;  4RZQ A;  2WKD A;  2XGT A;  2VNU D;  1MSH A;  3SEB A;  3F2U A;  1VF7 A;  5E4W C;  4A3I G;  2F3W A;  1FYC A;  4RNO A;  2Q2U A;  2EJF C;  4GC7 A;  1N32 H;  4L8J A;  4ABN A;  2EDG A;  3OW7 A;  2B63 G;  4DUY L;  5C4Z A;  5FKA C;  2SDF A;  4R8N A;  4JV5 Q;  1S4Z A;  5JEA H;  1SCU B;  1S40 A;  1L0X B;  4A3G G;  2RDH A;  1B9N A;  4FBT A;  3BA8 A;  5JUM A;  3EPI A;  1IL8 A;  3J80 L;  2XCA A;  4M8A A;  5C5M A;  2JN4 A;  2B3G A;  2E2J H;  3PO3 G;  2NVY A;  1IBK L;  4FS1 A;  1XMO H;  2NVX A;  1HR0 L;  5IGB A;  1N8R C;  2SEB D;  2LXK A;  1IKL A;  3UI2 A;  1QIL A;  3U4Z A;  1EY0 A;  5CV4 A;  3H40 A;  4A93 B;  1W6J A;  1ET9 A;  3MC0 B;  2CW0 C;  2EPB A;  4L1K A;  2Z4I A;  3MZ5 A;  4GNX C;  1MJC A;  1FD7 D;  3R5H A;  4QW8 A;  5IP9 G;  2YTV A;  5CV6 A;  1Z2N X;  4F50 A;  4MN3 A;  1VQI A;  1SRU A;  1J5E L;  1GUN A;  1PV4 A;  4HID A;  4B3S Q;  1S03 G;  3I4M G;  5IE8 A;  1TWH H;  4TUY F;  5KFN A;  1R4P B;  1EFI D;  5CV9 A;  1ESR A;  5LMU L;  1DV2 A;  5C5J A;  1OXT A;  1SMX A;  4ODG A;  4CKC A;  5CA0 F;  2FHT A;  1PH3 A;  1J5E H;  2FPG B;  5DAU A;  4BWG B;  1WTR A;  1VQ9 A;  4OEL B;  3BG5 A;  5JJI A;  1CK1 A;  1XNR H;  4X64 H;  5LMU H;  2CQA A;  2B39 A;  2K04 A;  5D1P A;  2ZJQ A;  4EBE A;  4M7E A;  4G4K A;  1VQD A;  4RHR A;  2N3S A;  5CYU A;  2B2Y C;  4R8I A;  1TS5 A;  1CA5 A;  1KXL A;  1K0S A;  3NBH B;  3JAM L;  3K5L A;  4MV8 A;  4HJ5 A;  2XIG A;  1AW7 A;  4BY1 B;  4OXP A;  1EZ6 A;  4RHS A;  3AEV A;  1VCI A;  5FLX L;  2A5H A;  3Q8Q B;  5HY6 A;  1TWF H;  1BVS A;  2C2E A;  2EZV A;  4C2M A;  2YU9 H;  1WTQ A;  4J0M A;  1J6Q A;  1KLG D;  1WTX A;  3M4Y A;  2JXM B;  1YEZ A;  4F4X A;  5C44 B;  3KHL A;  4XIG S;  1Y69 U;  1D2B A;  1ZHS A;  1JLL B;  2Y0S E;  4HED A;  1ZQ7 A;  1YJN A;  2R93 G;  1WCM G;  4U68 A;  4G3I A;  3RTX A;  1PYW D;  4A3K B;  2BH2 A;  3T13 A;  1Y1V G;  2YZG A;  4MA5 A;  3GTP H;  4A3C G;  4DPG A;  2N88 A;  1GJX A;  1FNW A;  1EQR A;  3CU7 A;  3RR5 A;  3PUV A;  1O7Z A;  3ONA B;  5KFK A;  1PVO A;  1PZJ D;  3L2P A;  2K5H A;  3GIK A;  3WO1 A;  2ZJT A;  2F0W A;  3J7A 5;  4UY8 C;  4X3U A;  5CV7 A;  2R7Z H;  1A2U A;  1HTP A;  4OEM B;  1TT2 A;  2Q8T A;  1VQM A;  5ELO A;  4TKO B;  1K83 A;  3R3O A;  5TSS A;  4EGV A;  4FYD A;  2VQD A;  3GTJ B;  1NAP A;  3TME A;  3N6R A;  4MTK A;  1H9R A;  1EY4 A;  2F0F A;  1IBM Q;  4PMC A;  1AUV A;  3EVQ A;  1VQC A;  4WD3 A;  3T5J A;  3TQ1 A;  2VZA A;  3A55 A;  3V05 A;  2V1C C;  5EPL A;  3H4B A;  4XYL B;  3ULJ A;  4ED1 A;  3E5N A;  5IWA Q;  4LF9 L;  2V4R A;  1X3E A;  3BYT B;  4K14 A;  1M7J A;  4QUF A;  2P5Z X;  3CXC A;  2A6H D;  3GIQ A;  1ULZ A;  2A69 C;  4G7H C;  3FMC A;  1OXV A;  1NY4 A;  3GIP A;  2RHS B;  4A3J B;  1SND A;  1VF5 C;  2CHB D;  3G48 A;  5LYJ F;  4OL7 A;  4KHP L;  1V1P B;  5C4H A;  2R8I A;  3T1Y Q;  5KFW A;  4LFB Q;  4B3T Q;  3GLK A;  1HNX Q;  1VQJ A;  4N9P A;  1STA A;  4JI5 L;  5M5X B;  3LX0 A;  4HYK A;  2UXC H;  3GTO B;  4K2K A;  3K58 A;  3N6X A;  2W9A A;  3VR5 A;  4IUV A;  2R92 H;  3J81 L;  1W3S A;  1V8Q A;  5KNC A;  4RWS C;  3TBI B;  3RIZ A;  4FS2 A;  4MAM A;  2NYZ D;  1K8A C;  3OHX C;  1CS0 A;  4CHT B;  4C3I B;  5I2Y A;  4JI4 H;  2F0O A;  4YCV A;  3QWN A;  2WE6 A;  2IT1 A;  2AKW B;  1SYC A;  5KFS A;  1E1O A;  2VXW A;  3PIO 3;  2CKZ B;  2UXD Q;  3WDN A;  4Q0Y A;  1STG A;  4EQO A;  4O3R A;  3S1N B;  2PZT A;  4LF6 Q;  4DV3 L;  1XMQ Q;  1Y1W B;  3K7A B;  4OIJ A;  3VR3 A;  4BA1 I;  5A2Q E;  3FEW X;  4Q8F A;  5JOB A;  4DV4 L;  2MCT A;  3D4W A;  4LUZ A;  3GTJ A;  4O2D A;  2X69 A;  1LT6 D;  5KRU A;  2QDL A;  1VQB A;  1LTG D;  3TN2 A;  1EQV A;  1FKA H;  4DV3 H;  3CQZ H;  4OO1 G;  5C1O A;  5T14 A;  1G91 A;  3H20 A;  1SNC A;  2I5L X;  1TWC H;  1C30 A;  1PTO B;  4B9W A;  2C00 A;  1CTM A;  3I4L A;  1Z6H A;  5K5P A;  4DV7 Q;  1H9S B;  4MV4 A;  4H44 C;  3RUP A;  1WJJ A;  4DR6 L;  2PZU A;  3K5O A;  4X3S A;  3NP8 A;  5FO7 B;  4FU0 A;  1GD7 A;  4YY3 L;  3GTM H;  1CM9 A;  1OXS C;  1QB5 D;  3RBD A;  2OTJ A;  1GLV A;  1V1P A;  4X6A H;  1Q82 C;  4IZ8 A;  3HS0 C;  2F4V L;  4PWQ A;  1SJH D;  4MTN A;  1II3 A;  3OOC A;  1LTR D;  2K6A A;  1MI2 A;  1L2F A;  1T5E A;  2HVQ A;  2RKS A;  2EYH A;  5CBE E;  1H9J A;  1EU4 A;  4L6T B;  1YNJ C;  1RJR A;  1PMR A;  1E2W A;  3HOV B;  1ZHQ A;  1GM5 A;  1BXT A;  3HXL A;  4LF7 H;  5KFY A;  1VQH A;  5KG3 A;  1JE5 A;  1ENC A;  4FXD A;  4PMW A;  4BY7 H;  2XTI A;  3PIO A;  2IW3 A;  1EY7 A;  3E3X A;  3H94 A;  1GOZ A;  4RCN A;  2DIK A;  1Y1W A;  2HDL A;  3U9T A;  3EFX D;  2GN5 A;  4A93 G;  3T1H H;  1LT4 D;  1E1T A;  1K9M C;  4HCE A;  2SNM A;  1H95 A;  3Q8S B;  5EKK A;  2GPW A;  4DL3 A;  4J9Q A;  3HOX B;  4DK3 C;  1XNR Q;  4X64 Q;  2F0I A;  2LKV A;  2K5N A;  3LGJ A;  1R9T H;  4RAY A;  3PW2 A;  1H9S A;  3KHG A;  2AGO A;  4IJH A;  2L1B A;  2F0D A;  3HOZ B;  1SFO H;  3EPG A;  3M85 A;  5EKL A;  4CKE A;  3ETJ A;  3RN5 A;  1K3B C;  4EFE A;  5KT3 A;  1YI2 A;  2E2I B;  3M9N B;  5FPR A;  3LP8 A;  2MUY A;  1B33 N;  1Z2P X;  1XNQ Q;  4ECR A;  3SK5 A;  4HJA A;  3GIL A;  2R3Z A;  1WTW A;  3C1E A;  4CC5 A;  5C5L A;  3G6Y A;  1EY5 A;  3AQQ A;  3S17 B;  1KDB A;  3PVX A;  5L1K A;  1MSG A;  4BY1 G;  3KTM A;  4LSA A;  2ZT9 C;  5JAV A;  1B44 D;  4BS9 A;  4IHJ F;  4YHH L;  3RUZ A;  3PW5 A;  2HVS A;  1D7Q A;  2FPI B;  2QA4 A;  2XRQ D;  1ENA A;  5IYC H;  2E2H H;  1I4G A;  3NWS A;  2OWO A;  3KAL A;  2OTL A;  3TSS A;  4DFA A;  4YHH H;  2F0M A;  3QOJ A;  5C44 G;  4XZ3 B;  4LF4 H;  1JJC B;  3V96 A;  3HOU G;  1JB3 A;  4R4I A;  4TV9 F;  3L7Z C;  1VBH A;  2RGV A;  3NE5 B;  4RA8 A;  2UXB L;  2A19 A;  4A3K G;  4AYB B;  2CW0 D;  1S3O A;  2R7M A;  4ED3 A;  3IN5 A;  1X3G A;  3GV8 B;  3VA5 A;  4HNU A;  4QIW E;  3K5H A;  3JRW A;  5KNB A;  3KLW A;  4YWL A;  2B2W C;  2PMZ E;  5ELC A;  3ZJY C;  4NP5 A;  3TRZ A;  3LWB A;  4HQ6 A;  1GYF A;  3PGZ A;  4JI3 Q;  5FLM H;  3H6M A;  4C3H H;  3H0G H;  4Q0F A;  1HCZ A;  1U4L A;  5JPN C;  2K52 A;  1I6H H;  4QL5 A;  3VYU A;  4PMB A;  4BBR H;  1VQ6 A;  1DYQ A;  3N8D A;  1SE3 A;  2PQE A;  4O3N A;  5C3E H;  4A3D H;  1F2Y A;  5C4X H;  2YYZ A;  3DEP A;  4JC0 A;  2HUG A;  4APM A;  1RHP A;  3H3V C;  3S2D B;  3W5O A;  4O3O A;  4FF4 A;  4KLK A;  4HNT A;  1EWC A;  1WTV A;  3I72 A;  2CQO A;  4DV0 L;  3M3Y H;  2LS0 1;  5M3M H;  1HQM C;  2UXC Q;  1IBL Q;  4UCT A;  2ZXR A;  4MNO A;  1PFS A;  4FDB A;  1ICF B;  4DUZ Q;  4EVO A;  4QIW A;  3OSO A;  4ECX A;  1BUV T;  4HSV A;  1KJI A;  4UP9 A;  4A3J G;  1QZH A;  1S0N A;  4DV0 H;  2PMZ A;  1PHJ A;  2BE5 C;  4ZKB B;  3ND9 A;  4GOP C;  4ECT A;  1YJ9 A;  1I50 B;  3RZO B;  1V1Q A;  3KBX A;  1KNA A;  3IAY A;  2DY8 A;  3E5S A;  2FP4 B;  4LFA L;  4NPS A;  1RJQ A;  2KOL A;  4H02 A;  3URY A;  4G7O C;  3A8K E;  4DXG A;  3Q1K A;  1A63 A;  4ULL A;  3WO0 A;  4UPA A;  2EYJ A;  4DR7 Q;  3P7J A;  1Q1B A;  3RLN A;  3PO2 H;  1KL9 A;  4C3I G;  1XPU A;  4BXX H;  4AYB A;  2C2R A;  4P74 A;  4DA2 A;  2JA7 B;  3D8G A;  1B6S A;  3CPF A;  2BOS A;  1SNM A;  2LY7 A;  4GN5 A;  4X66 L;  5FJ8 G;  5LMN H;  1TU2 B;  3IFD A;  2FJ2 A;  4EGJ A;  5K36 H;  4Y7N B;  2UUA H;  1DJR D;  5JJL A;  3UDX A;  1KQS A;  1XJV A;  4K0K L;  2NZH A;  4IUU A;  1KC7 A;  4TQS A;  2JA8 H;  4CC6 A;  3RBE A;  1Y1W G;  4B3M L;  2VUG A;  2Z6K A;  5IT9 c;  5DQH A;  4A2A A;  4ECS A;  1N33 Q;  3SK4 A;  3BZD B;  4UFZ A;  5L1L A;  2A73 B;  4IPC A;  2VQE Q;  4EYH B;  2UU9 H;  1TR5 A;  4UCO A;  3D4D A;  3GTL B;  2F0E A;  4KMU C;  1FNV A;  2W9C B;  4B3M H;  3Q24 A;  1WYD A;  3J7Z C;  3T5K A;  1TQO A;  1MIU A;  2PNH A;  5ELF A;  1K8G A;  4KD4 A;  4ECY A;  1D6E C;  3VYS A;  5LOV F;  2A69 D;  4LF8 L;  5CV8 A;  4RUA A;  4KY5 A;  5I4D A;  1G29 1;  5IYD G;  2LFN A;  3ULP A;  2UUB L;  2DPI A;  2HVR A;  5GAH C;  4EBC A;  3RB0 A;  3QZ7 A;  1I94 H;  2VUM B;  2JE6 I;  4O42 A;  2JJQ A;  4LF8 H;  1IYU A;  3J7A K;  1I50 A;  1WOC A;  4HMI A;  3V2T A;  2L5T A;  4JI0 Q;  5D65 A;  3CC4 A;  2UUB H;  4JI7 L;  4TVA B;  4FVM A;  1Y14 B;  4EX5 A;  3QFF A;  4JI1 L;  4IJL A;  4HTH A;  1M8A A;  1Y8O B;  1HFN A;  3K57 A;  2UVU A;  2EE1 A;  4WJ3 M;  4A2B A;  4UCV A;  3CCU A;  2XRS D;  1SYE A;  1HR0 W;  4GKJ L;  1OXX K;  3MXU A;  3T1H Q;  5KEE A;  4DNI A;  1JOO A;  2UUC L;  4B3S L;  1GUO A;  3FDT A;  1RK5 A;  2JA7 A;  3GQB A;  1O7Y A;  4QWB A;  3X3M A;  1UEA B;  1X65 A;  4XX0 B;  4QF4 A;  1HNZ Q;  4DL6 A;  5KFG A;  1G51 A;  2DZD A;  4PZ7 A;  1K0R A;  1QVC A;  4K5X A;  2UUC H;  1BBW A;  2ZM6 H;  3E6Z X;  4CDE C;  4WFN 3;  3C46 A;  5F9L A;  1F2L A;  1LO5 D;  3FKI B;  3FRP B;  1VQP A;  2OLS A;  1Y8P B;  5BN4 A;  2R93 B;  5EWG A;  1VS0 A;  4C1N I;  1BCP C;  1CUK A;  2D5D A;  3NGD A;  3G6J B;  3BDC A;  2OXP A;  4B08 A;  3GTL A;  4OWX B;  3VYR A;  3HOX G;  2W9C A;  1D5Z C;  3HG9 A;  5KGU A;  1FL0 A;  2BDN A;  3P75 A;  4DXF A;  3L9A X;  1JIC A;  1Q8I A;  2Z4H A;  4C56 C;  3B6Y A;  4JI6 Q;  4P75 A;  1ILQ A;  1PH8 A;  2EQS A;  4A3E B;  4OGQ C;  2DWC A;  3HOZ G;  4JV1 A;  4DR5 L;  3AU7 A;  4KHV A;  3VA7 A;  3H3V I;  3ITP A;  4O4H F;  2VUM A;  1QUQ B;  2PBZ A;  1E3P A;  3GTG B;  3I4N H;  5D1O B;  5JPM C;  1QVG A;  4DR5 H;  4CDF C;  2YYA A;  1DZ1 A;  4DN4 M;  3QOL A;  5EQ0 A;  4XQN A;  2K14 A;  2D9U A;  3U58 A;  4LF4 Q;  3PV0 A;  4DL2 A;  2HQL A;  1YNJ D;  3A8J E;  4POF A;  5KT6 A;  2QF7 A;  1RTO A;  2YS7 A;  3GTK B;  2NVQ B;  4QWD A;  4XQQ A;  2EY1 A;  5KFA A;  5AFW A;  3BZC A;  1N34 H;  3KJP A;  4A3B G;  1QNU A;  4JOI C;  4DV2 Q;  4JI8 Q;  3H3V H;  2NB0 A;  4FP5 D;  4JBM A;  2JA5 B;  1SEI A;  3OSN A;  1STY A;  3RLF A;  4K8J A;  1SNP A;  3MEH A;  1UAP A;  4ZLT F;  3ER0 A;  3ULL A;  2O5I C;  4HIK A;  4KKU A;  4AYB G;  4C3J B;  3FKI A;  4A3M H;  4ZYS A;  5J2U F;  2AUJ D;  5IWA L;  2NTT A;  1B8A A;  4E4T A;  2JYO A;  1S5E D;  3KF8 A;  2P0A A;  1I6V C;  1GHK A;  1I4Q A;  5DQG A;  5KT5 A;  2X6G A;  2IHE A;  2PCF B;  4OHJ A;  5CAE B;  4JYA L;  2F1M A;  1K1S A;  2NU8 B;  3H4D A;  1S5C D;  3M4Q A;  4AQY L;  4LFB L;  4LSX A;  2R7L A;  1HNX L;  4IRK A;  3NXW A;  2KED A;  5DM7 3;  4JYA H; 
#chains in the Genus database with same CATH homology
 2OQ0 A;  3J7A 5;  4UY8 C;  4HJ7 A;  1Q46 A;  1QUQ A;  1RIP A;  2VUM H;  4Y52 H;  2R7Z H;  1ASZ A;  1E22 A;  1X54 A;  3CME A;  5ELO A;  1VQM A;  1Q7Y C;  4LW1 A;  1PH6 A;  3CD6 A;  1A8V A;  4YWK A;  1OXU A;  2I5H A;  2F4V Q;  4ALP A;  4NB3 A;  1IBM Q;  4LF7 Q;  3RN2 A;  1VQC A;  4DR2 Q;  2VZA A;  4DV6 L;  4LWC A;  3S1N H;  2UXD L;  2NZO A;  3I4N G;  2V1C C;  4R4C A;  1X9N A;  4JI6 L;  3W1G A;  3ULJ A;  4A4I A;  1PH9 A;  4A3L G;  2JA9 A;  5IWA Q;  4LF9 L;  1X3E A;  3PUZ A;  3CXC A;  4UP7 A;  5LMN Q;  3UDI A;  1OXV A;  2ALY B;  1NY4 A;  2F3I A;  3OW2 A;  4MZ9 A;  2RHS B;  2Z0S A;  2PQA B;  4GNX A;  3JAM c;  3G48 A;  1KRT A;  5GAG C;  5H1S E;  4KHP L;  3T1Y Q;  1UEB A;  1X6O A;  4LFB Q;  3TS2 A;  4B3T Q;  5FLX c;  2D0O A;  3PF5 A;  3GTQ H;  1HNX Q;  1VQJ A;  4JI5 L;  2JA7 G;  4LF4 L;  3FKI H;  2BA0 A;  5GAE C;  2VS1 A;  1N9W A;  1YBY A;  3Q8D A;  4GLX A;  2UU9 Q;  1VQO A;  2R92 H;  4B3R L;  1W3S A;  1VQK A;  1MKH A;  2GVA A;  3OTO L;  3S16 H;  1K8A C;  4GKK L;  2AHO B;  3ERS X;  3F2D A;  2MFI A;  4JI8 L;  2NVT H;  1X56 A;  4YCV A;  4A3M G;  4BA2 I;  3KF8 B;  4A93 H;  3HOY H;  2IT1 A;  4DAM A;  1EUJ A;  2AKW B;  5M5Y H;  4A3E H;  1E1O A;  4QY7 A;  2CKZ B;  2RCN A;  2UXD Q;  3PUX A;  4DV1 L;  1PH7 A;  3TQY A;  1I94 Q;  1SR3 A;  4JOI A;  3TS0 A;  1CSQ A;  4LF6 Q;  4LUV A;  2CCZ A;  4DV3 L;  1XMQ Q;  4BA1 I;  3S1Q H;  4BY7 G;  3GTG H;  3HKS A;  2VQF Q;  2HIV A;  4AIM A;  1YIJ A;  3E9H A;  4DV4 L;  1X55 A;  1L0W A;  4LUZ A;  1KD1 C;  3CCL A;  4O2D A;  4P73 A;  1VQB A;  1UE7 A;  5C0X J;  4IPH A;  1PH2 A;  2K5V A;  3CPW A;  1VQA A;  1JMC A;  4KHP Q;  3CQZ H;  4OO1 G;  2VUM G;  1WFQ A;  2R7Z G;  3ICE A;  2I5L X;  1TWC H;  3CCJ A;  2I5M X;  4YHH Q;  4IO9 A;  1UE5 A;  4JI5 Q;  3S1M H;  2IY5 B;  1G6P A;  4DV7 Q;  2NVQ H;  1O7I A;  3GTK H;  1WJJ A;  2K75 A;  4DR6 L;  3PCO B;  2IHF A;  5EAY A;  4AYB E;  4QQB X;  3DLL A;  1BBU A;  3F1Z A;  4DKA C;  5IY0 A;  2KHI A;  4DR1 L;  1GD7 A;  4YY3 L;  4X65 Q;  3GTM H;  1B7Y B;  2EXD A;  4GKK Q;  2PI2 E;  1OXS C;  3PSI A;  5DLQ E;  4XTC S;  4QJF A;  2VW9 A;  3CAM A;  2PQA A;  3RZD H;  4BY1 H;  1YVC A;  2JEB I;  2ZM6 Q;  1D8L A;  2OTJ A;  1KC8 C;  4X6A H;  4R4Q A;  1Q82 C;  1VQ8 A;  2OQK A;  2ZTE A;  1UE1 A;  3AFQ A;  4NXN L;  2F4V L;  4C3J H;  5JJK A;  4MTN A;  1IL2 A;  4X62 Q;  1IBM L;  1E7Z A;  4DV1 Q;  1L2F A;  4TQU S;  2ZJR A;  3HOV H;  3JC6 6;  4RMF A;  1Q86 C;  2L15 A;  5C44 H;  3I56 A;  4L5R C;  3S1R H;  2N8N A;  3H15 A;  3CCS A;  1PA6 A;  1JT8 A;  3PIP A;  3HOU H;  2HT1 A;  2ASB A;  1GM5 A;  3J81 c;  3G4S A;  4DV4 Q;  4IFD I;  2FXQ A;  1CKN B;  4LUO A;  1VQH A;  3FKI G;  5LMN L;  4A3K H;  1XNQ L;  1RL2 A;  1JE5 A;  2UUA L;  1HZC A;  4PMW A;  1QVF A;  4R1J A;  3TEH B;  1NBW A;  2R92 G;  4BY7 H;  2XTI A;  2JA5 H;  3PIO A;  3S24 A;  1AH9 A;  3T1Y L;  4YCW A;  1IXR A;  2PI2 A;  4B3T L;  1C9O A;  4DR6 Q;  2GN5 A;  4A93 G;  1NTG A;  3HOY G;  3A5Z B;  2Q2T A;  1KAW A;  2D0P A;  1E1T A;  4DR1 Q;  2CWA A;  4DV0 Q;  1K9M C;  4YY3 Q;  2UU9 L;  4A3E G;  3GTJ H;  4PZ6 A;  1H95 A;  3E9I A;  2BA1 A;  1TWA H;  4HJ8 A;  3I2Z A;  1VQL A;  4JI2 L;  1VQN A;  4DK3 C;  1XNR Q;  3CMA A;  4OX9 Q;  4X64 Q;  1XTD A;  1SLJ A;  4NXN Q;  1N34 Q;  1LTL A;  2K5N A;  3LGJ A;  1R9T H;  3L0O A;  1N36 Q;  3G6E A;  2ZJP A;  4IJH A;  3KYH C;  1PH1 A;  3J81 j;  1T9H A;  1YIT A;  3GD7 A;  1SFO H;  2E2I H;  4GN3 B;  5ELN A;  1I94 L;  4BBS H;  3CP0 A;  3M85 A;  4LF6 L;  3OYY A;  1XMQ L;  3RN5 A;  1CSP A;  4A3J H;  4WJ4 A;  3FHW A;  3A5U A;  1YI2 A;  2VQF L;  1E24 A;  3GO5 A;  1XNQ Q;  4HJA A;  2UUA Q;  2QGQ A;  4DV5 Q;  3RNU A;  3AQQ A;  3PF4 A;  3K7U C;  1VQ4 A;  1LM0 A;  5M5X H;  2H5X A;  3GTO H;  2Z6K C;  3PUW A;  2JA5 G;  4A75 A;  4BY1 G;  5HGQ A;  4X66 Q;  3CCQ A;  4C2M H;  5JEA J;  4YHH L;  2Q2I A;  4IPD A;  5BR8 Q;  1GVP A;  4DV7 L;  1D7Q A;  4K0K Q;  2JA6 H;  2QA4 A;  4IPG A;  1VQF A;  2AWN A;  3I55 A;  1TWG H;  4C3I H;  1LUZ A;  1CKN A;  3M4P A;  4B3M Q;  5IYC H;  4X65 L;  2E2H H;  3HOV G;  2OWO A;  3DM3 A;  3D31 A;  2F52 A;  2OTL A;  4JBK A;  4JI2 Q;  5FJ8 H;  5IP7 H;  5C44 G;  2ZM6 L;  3K0X A;  1JJC B;  4DUZ L;  3HOU G;  4R4I A;  4OWT B;  2NN6 I;  2ZTD A;  3L7Z C;  3F2C A;  4DAY B;  1AE2 A;  1BKB A;  3VDY A;  2E5L Q;  1XMO L;  4DR4 Q;  4GN4 B;  2UXB L;  2A19 A;  2YTX A;  2JQO A;  3UDF A;  4X62 L;  1KRS A;  1S3O A;  2MQH A;  3K7A H;  4A3K G;  1Y1W H;  1X3G A;  4QIW E;  1VQ5 A;  4R4T A;  4R4O A;  3CC7 A;  3A0J A;  1K73 C;  4LF8 Q;  1GKH A;  4A3F H;  1DGS A;  1SRO A;  1YHA A;  1YZ6 A;  3KLW A;  4YWL A;  3CF5 A;  2PMZ E;  4LFC Q;  3ZJY C;  3TRZ A;  3M4O H;  1P16 A;  2WP8 J;  5C0X I;  1K83 H;  2AWO A;  1Z47 A;  1NJI C;  3HKZ E;  2UUB Q;  2MO1 A;  3AFP A;  3PGZ A;  3W1B A;  5IYB H;  4JI3 Q;  4LF5 Q;  4JBJ A;  4RG1 A;  5FLM H;  1XPO A;  4C3H H;  4HJ9 A;  3H0G H;  1UE6 A;  3K81 C;  2RHQ B;  1EIF A;  2LXJ A;  1M1K C;  3GDE A;  4DR7 L;  5C4J H;  2HHH Q;  1SE8 A;  3S14 H;  2K52 A;  4HIO A;  1JJ2 A;  1I6H H;  4QL5 A;  5AJ3 L;  4BBR H;  3IRB A;  2CWP A;  1PH4 A;  1VQ6 A;  3M7N A;  3S2D H;  1ASY A;  1HNW Q;  5C3E H;  4A3D H;  5C4X H;  4JI7 Q;  2YYZ A;  1N32 Q;  4JC0 A;  5IYD H;  3M9B A;  4P72 A;  4JI1 Q;  3W5O A;  1C7Y A;  3PUY A;  1EIY B;  5M5W H;  4KLK A;  3BJU A;  5GAD C;  2CQO A;  4DV0 L;  3RLO A;  3M3Y H;  1PH5 A;  2KBN A;  5M3M H;  4GKJ Q;  2UXC Q;  5GRO A;  1IBL Q;  1EFW A;  3CW2 C;  4MNO A;  2UUC Q;  1PFS A;  4OWW B;  4FDB A;  4P71 A;  4DUZ Q;  4BBS G;  1N33 L;  4DUY Q;  1XNR L;  4OX9 L;  4X64 L;  4UP9 A;  4A3J G;  1XMO Q;  3RZO H;  4OON A;  2UXB Q;  2WAQ E;  1QZH A;  1N34 L;  2R93 G;  2VQE L;  3FP9 A;  3F2B A;  3BU2 A;  1W2B A;  1PHJ A;  1UWV A;  3NEM A;  1N36 L;  4GOP C;  1U0L A;  1YJ9 A;  4A3I H;  4POG A;  1V1Q A;  2WB1 E;  3S2H H;  3KOJ A;  2N78 A;  2B63 H;  4LFA L;  4NPS A;  2K50 A;  3MXN B;  1Q12 A;  2GVB A;  4H02 A;  1A63 A;  1NE3 A;  4A3G H;  4UPA A;  4DR7 Q;  1A62 A;  2JA6 G;  1Q1B A;  1FVI A;  3RLN A;  5J3B A;  1M90 C;  4DV5 L;  3PO2 H;  1KL9 A;  3CCV A;  5AJ3 Q;  2WFW A;  1XPU A;  4BXX H;  4L5Q A;  4P74 A;  5IYC G;  3STB D;  4JBW A;  3CPF A;  3PO3 H;  3KF6 B;  4X66 L;  4GN5 A;  3AYH B;  3J80 i;  1VQG A;  3BZK A;  5IP7 G;  5FJ8 G;  4APV A;  2E8G A;  3EBE A;  3HFZ B;  5BR8 L;  4PZ8 A;  2KCT A;  3UDX A;  4DR5 Q;  1XJV A;  1KQS A;  1AE3 A;  4K0K L;  5JJL A;  2NZH A;  1HZ9 A;  4PG3 A;  3EN2 A;  3CCM A;  3HOX H;  4IOC A;  1EYG A;  2JA8 H;  2ZTC A;  1J5E Q;  4KHZ A;  1Y1W G;  4B3M L;  2Z6K A;  3I4O A;  5IT9 c;  3S15 H;  3I7F A;  1CKM A;  4EQ5 A;  1I5F A;  2DUD A;  2R7D A;  1L1O C;  2KEN A;  1N33 Q;  1KHI A;  3TRE A;  1CKO A;  3K80 C;  5LMU Q;  4A3F G;  3HOZ H;  4GOP B;  4JG2 A;  4IPC A;  1NMG A;  2VQE Q;  1QZG A;  2E5L L;  1HH2 P;  5IP9 H;  2IX1 A;  2RF4 A;  3UE0 A;  5IYB G;  4DR4 L;  1WYD A;  1SN8 A;  5FLM G;  3J7Z C;  1HNZ L;  3H0G G;  1VQ7 A;  1MIU A;  3I4M H;  2PNH A;  4NXM L;  1K8G A;  4IOA A;  3KJO A;  1EWI A;  1B70 B;  4BBR G;  1JB7 A;  4GS3 A;  4LFA Q;  2HIX A;  2QEX A;  1YHQ A;  4LFC L;  4LF8 L;  2NN6 G;  1G29 1;  1A0I A;  1GO3 E;  5C3E G;  4A3D G;  3A74 A;  3UE1 A;  5IYD G;  3S17 H;  3UDG A;  3ULP A;  2Y0S G;  2UUB L;  1C0A A;  4LF5 L;  5GAH C;  4JI3 L;  4GLA C;  2OCE A;  1FJG Q;  3EIV A;  2JE6 I;  3SGI A;  2HHH L;  2JJQ A;  4L5S A;  3HOW H;  5M3M G;  1MJE A;  2VY3 A;  1WOC A;  5M3F H;  5C0X G;  1EQQ A;  1Q81 C;  3CC4 A;  4UP8 A;  4JI0 Q;  4A3B H;  4JI7 L;  4TVA B;  4DR3 L;  1HNW L;  1N32 L;  2YV5 A;  1Y14 B;  4EX5 A;  4A76 A;  1HJP A;  4JI1 L;  4IJL A;  2ES2 A;  1P8L A;  1L1O B;  2VL6 A;  2XGT A;  3CCU A;  2VNU D;  1HR0 W;  4GKJ L;  1OXX K;  3JAM i;  4A3I G;  2UXC L;  3T1H Q;  2B29 A;  2N49 A;  4DNI A;  4QGU A;  1IBL L;  2AMC B;  2Q2U A;  2UUC L;  4B3S L;  4JYA Q;  3G71 A;  2R6G A;  1TXY A;  2B63 G;  4DUY L;  1FGU A;  3KF6 A;  4AQY Q;  4DK6 C;  5E7N A;  4JV5 Q;  1VQE A;  3CC2 A;  1X65 A;  1HNZ Q;  4YWM A;  1G51 A;  1S40 A;  4A3G G;  1K3R A;  4PZ7 A;  4NXM Q;  1EOV A;  1K0R A;  4JI4 L;  5C4X G;  1QVC A;  3PO2 G;  2C35 B;  1BBW A;  2R93 H;  4AH6 A;  1WCM H;  3CCR A;  4BXX G;  3D0F A;  2JK8 A;  1VQP A;  1Y1V H;  1S72 A;  2B3G A;  2E2J H;  1Q8K A;  1IZ6 A;  1IBK L;  2ATW A;  3PO3 G;  4A3C H;  1V43 A;  1VS0 A;  1I3Q H;  1CUK A;  1HR0 L;  1N8R C;  4GOP A;  5K36 G;  4DV2 L;  2LXK A;  3E0E A;  4LNQ A;  3KFU A;  2D62 A;  4OWX B;  3HOX G;  1YJW A;  2JA8 G;  1JJG A;  3NEN A;  3KDF B;  1X3F A;  3U4Z A;  4DV6 Q;  1FL0 A;  1WI5 A;  4DR3 Q;  4IFD G;  3B6Y A;  4JI6 Q;  4P75 A;  3U4V A;  1PH8 A;  2EQS A;  4GNX C;  4LF9 Q;  3HOZ G;  1MJC A;  4DR5 L;  2BH8 A;  1HZB A;  5IP9 G;  2YTV A;  2DGY A;  3H3V I;  1VQI A;  1OTC A;  1SRU A;  1J5E L;  4ME3 A;  1PV4 A;  4HID A;  5GQO A;  4B3S Q;  1QUQ B;  3I4M G;  5IE8 A;  1TWH H;  1E3P A;  3I4N H;  1PYB A;  2YTY A;  2MO0 A;  4A3L H;  1QVG A;  3U50 C;  1I50 H;  5LMU L;  1OXT A;  1SMX A;  1Q1E A;  2K4K A;  3U58 A;  3CCE A;  2K14 A;  1PH3 A;  4LF4 Q;  3PV0 A;  4JI4 Q;  2HQL A;  1VQ9 A;  3K8A A;  4POF A;  1L1O A;  5JJI A;  4B3R Q;  1KIX A;  2JEA I;  3MEF A;  1HZA A;  1LYL A;  2CFM A;  3HOW G;  3F8T A;  3OTO Q;  3HKZ G;  5M3F G;  1IBK Q;  2ZJQ A;  3BZC A;  4GLV B;  1VQD A;  3KJP A;  5LMN W;  4A3B G;  2IX0 A;  2N3S A;  1HR0 Q;  4JOI C;  4DV2 Q;  3H3V H;  4JI8 Q;  2EIF A;  2JA7 H;  4L5T A;  1KXL A;  3NBH B;  4HJ5 A;  4JBM A;  3WWV A;  4OXP A;  3AEV A;  1FJG L;  2I0Q A;  1VCI A;  4Y7N H;  3RLF A;  4LF7 L;  5HY6 A;  1TWF H;  4GNX B;  4J15 A;  4DR2 L;  1BVS A;  3NEL A;  1Z9F A;  3ER0 A;  3ULL A;  4YCU A;  4JI0 L;  4HIK A;  2YU9 H;  2Q2H A;  4AYB G;  1V9P A;  2A1A A;  4KI0 A;  2MNA A;  3J81 i;  4DV3 Q;  1J6Q A;  4JCV E;  4A3M H;  4OO1 I;  3J80 c;  2NVY H;  5IWA L;  2A8V A;  1B8A A;  2KCM A;  5JEA G;  2NVX H;  1YEZ A;  1YNX A;  4XIG S;  2Y0S E;  1IYJ B;  4O0A A;  1YJN A;  1U5K A;  3T1H L;  3GTL H;  2IHE A;  3KDF A;  2ID0 A;  1NMF A;  1WCM G;  2R7F A;  4JYA L;  4IFD J;  2WAQ G;  2KHJ A;  2BH2 A;  1Y1V G;  1XPR A;  3M4Q A;  4AQY L;  3GTP H;  4A3C G;  4DPG A;  4JV5 L;  1EQR A;  4HIM A;  4LFB L;  3RR5 A;  1PYS B;  3PUV A;  3STB C;  2WB1 G;  1HNX L;  1PVO A;  3L2P A;  2K5H A;  4WJ3 M;  2LSS A;  1YHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...