2JA6G

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja6G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja6G01
3GTPH 5GROA 3CW2C 1CSPA 4O2DA 2UUAL 1IXRA 5GAHC 4LUOA 2N3SA 1PVOA 4A3IG 4A3LH 1B70B 1V43A 3RLOA 3GTJH 1HZCA 4YHHQ 1WI5A 2RHSB 4PZ8A 1PH3A 1YHQA 4BXXG 4JI4Q 2B3GA 2R92G 3K7UC 4OX9L 4DK6C 2C35B 1PH4A 3F8TA 1M1KC 1IBKQ 1VQLA 4OXPA 2UUCQ 3M4OH 5C4JH 1XNRL 1TWAH 3M4PA 1J5EL 1P16A 2K52A 4DR7Q 3HKZE 3EIVA 1EIYB 4A3CH 2WAQG 4HIDA 4LF7L 2A8VA 3K81C 3G71A 4IOCA 2E5LL 1W3SA 2Q2HA 1X3GA 1E24A 2F3IA 4IPDA 4DV0Q 2LXJA 3AYHB 1HJPA 2K50A 1XPUA 1HNWQ 4B3SL 3PSIA 3Q8DA 5C44H 1GM5A 2UXDQ 3H0GG 3ICEA 3D0FA 3W1GA 3I4MG 4NXNQ 3U58A 4GN5A 3K0XA 4HJ8A 4P72A 1I3QH 4OX9Q 4A3BH 2B29A 4C3JH 5M5YH 1EQRA 2Z0SA 4BA2I 4YWMA 1C9OA 1KRTA 1XNRQ 4C3IH 3S2HH 2ATWA 3RZOH 4BBSH 4OO1G 4A4IA 3NEMA 1PYBA 1PV4A 4BBRH 4LF7Q 3HOUG 2E5LQ 1LUZA 2OQ0A 5FLMH 2F4VQ 1SMXA 1Q8KA 4R4TA 2NN6I 4GOPB 1QUQA 5LMNW 1Q81C 1XNQL 2ID0A 1I50H 3UDIA 1HZAA 4ME3A 4QL5A 4LF8L 5IP9G 2ES2A 3T1YQ 4B3SQ 1PH2A 2ASBA 4A3MH 3CCRA 1KQSA 4JI6Q 2XTIA 1TWFH 1CUKA 1HR0Q 4HIKA 1Q12A 3E9IA 3JAMi 2JA8H 2UUBL 2YYZA 4RMFA 1BBUA 1GVPA 3CP0A 3F2CA 1N34L 3GDEA 1Y1WG 2NVXH 2UXCL 4NXML 1Y14B 3SGIA 1NY4A 1QVCA 1TWCH 1BKBA 2YTYA 1UE1A 1Q1BA 4R4QA 4A3GH 3S1QH 4YY3Q 4QQBX 3HKSA 1MJCA 1EFWA 1N36Q 2AKWB 1NMFA 2YV5A 1HZ9A 2HQLA 1WJJA 2MO0A 1YBYA 1UE6A 2A1AA 2JK8A 3RLNA 5IYBG 4XIGS 4JBWA 1XNQQ 5FJ8G 2VUMG 1KHIA 4O0AA 5C0XG 1AH9A 1X3FA 2R7ZH 1A63A 3FP9A 4IJLA 4LF8Q 3U50C 1MKHA 1K3RA 1X56A 1YJ9A 3CPFA 4NB3A 3GTLH 4DUZQ 4B3RQ 3M3YH 1XPRA 1VQMA 3W5OA 1JT8A 1VS0A 4J15A 2IX1A 3J7A5 1Q1EA 2UUBQ 1N34Q 2KHIA 1XMQL 4OWWB 4DUYL 4NXMQ 1HNXL 3PF4A 4KHZA 2L15A 4OWTB 1K8AC 2HIVA 1UE7A 1PH6A 2UXBL 1OXSC 4X64L 4A93G 1NMGA 3PO3H 2CFMA 4IFDI 4BY1G 4JI2Q 2I5HA 2OCEA 4DV3Q 4HJ5A 3K8AA 2NZOA 3CAMA 4YWLA 1LYLA 5HGQA 4DAYB 4YHHL 3HOVH 4PZ7A 1YJWA 5GQOA 4DK3C 1S3OA 1R9TH 2UUCL 1KC8C 4BY7H 2E8GA 5IYDG 1UEBA 2CCZA 1I5FA 1N33L 2AMCB 1TWGH 1X55A 1NBWA 2NVYH 1S40A 4JI3Q 4JI8L 4DR7L 2CWAA 1IBLQ 1BBWA 4UP8A 4APVA 1V9PA 5ELNA 5EAYA 4LNQA 1A62A 1EOVA 3H3VI 1L1OC 1VQDA 2AWNA 3PCOB 3TQYA 1EYGA 1OXTA 1VCIA 3M4QA 1WYDA 4PZ6A 5JEAJ 4P73A 1VQKA 4GKKL 1KIXA 1YITA 1YJNA 1XMQQ 5C0XI 4A3KH 1HNXQ 4R1JA 2EQSA 3I4NG 3GO5A 1HNWL 2HT1A 3PUXA 5IYCH 3KYHC 4X64Q 1KD1C 1VQ4A 2UXDL 1SN8A 1GO3E 3KF6A 1C7YA 2DUDA 2ZJQA 2K5NA 1UE5A 4JI5Q 3HFZB 4NXNL 5M3FG 2JA6H 3DLLA 1L2FA 3UE1A 2NVQH 1Q82C 4LF9Q 1G51A 2QA4A 4AYBE 5IWAQ 2K75A 4QIWE 1E3PA 4DV2Q 2NN6G 3FKIG 3PIOA 4GNXC 2LXKA 1VQ5A 2RHQB 3HOWH 2IY5B 1N33Q 5IT9c 4JI8Q 5IP7H 3T1HQ 1QUQB 4TVAB 3PO2H 2D0PA 4L5SA 5DLQE 1KL9A 5J3BA 3TEHB 2F4VL 1I6HH 2IHFA 4GKKQ 4MNOA 4A3IH 4X65L 4A76A 4GLXA 2UU9L 1QZGA 1WCMG 4C3HH 3GTOH 3D31A 4DR3Q 3S16H 2R93G 2KCTA 3T1YL 1VQ7A 4DV7L 4JI0Q 4BXXH 3BZKA 2R92H 4JI6L 1VQHA 4RG1A 1K8GA 1S72A 1HR0L 2IHEA 1D8LA 5M3MG 3CCSA 3ERSX 3CCEA 1N9WA 4IJHA 1G6PA 2FXQA 3HKZG 1C0AA 3M7NA 3ULLA 4A3EG 3NBHB 3HOZH 2GVBA 3TS2A 3RLFA 4JYAL 4YY3L 3S24A 3GTMH 2VW9A 1N36L 1N32Q 2OQKA 4LFAL 1JB7A 3TRZA 3AFQA 2WB1E 1KRSA 4TQUS 1NJIC 4HIOA 2MQHA 1VQJA 1L1OA 3CC4A 2VQEQ 1IZ6A 3I7FA 2N49A 3H0GH 1D7QA 3RZDH 4X65Q 2UU9Q 4Y52H 1EUJA 2E2JH 3I4MH 3L0OA 4YCVA 4A75A 2CKZB 2GN5A 4DV7Q 1Q7YC 3ER0A 3E9HA 5GADC 3GTKH 3HOYG 4IFDG 2OWOA 4JI1Q 4DUZL 4B3RL 3GTQH 4LF4L 4LFCL 1H95A 1Q86C 4EX5A 3EN2A 5JJKA 1QVFA 4HJAA 4WJ3M 1YZ6A 5C3EG 1MJEA 4DAMA 2CQOA 3OW2A 3HOXG 1IYJB 4HIMA 1JJ2A 2JJQA 1E22A 4QGUA 3BJUA 3CD6A 1JMCA 3HOUH 3CCVA 2KBNA 2VS1A 2KCMA 4GNXA 2DGYA 1XPOA 4DV3L 4JI2L 4JYAQ 3PUVA 1SROA 2VQFQ 1QZHA 3S15H 1XMOQ 1K0RA 1FVIA 5ELOA 4LFAQ 4JOIC 3UDGA 5IP9H 3OTOQ 4DR2Q 1XJVA 1GD7A 1Y1VG 1OXUA 2MO1A 2Y0SE 2OTLA 1IL2A 1VQGA 3AQQA 1A0IA 4JI3L 2ZM6L 4DR1L 1GKHA 1XTDA 2HIXA 2YTVA 3A5ZB 1IBLL 4DR4L 1YIJA 4EQ5A 2VY3A 3RR5A 3JAMc 3RN2A 2IT1A 1VQCA 3LGJA 4JI7Q 2CWPA 2WFWA 4LF4Q 3J7ZC 4LFCQ 1HNZL 3KF6B 4LF6Q 3S2DH 1SLJA 4C2MH 1HZBA 3H15A 4KI0A 5JJIA 2JA9A 3NENA 5AJ3Q 4NPSA 1U0LA 4LWCA 3CCUA 1CKMA 3G6EA 3RNUA 2JEBI 5IYBH 1PA6A 2PNHA 5FLXc 1PH7A 1K9MC 2Q2IA 4QY7A 1O7IA 4JI5L 3CQZH 5M5WH 3KOJA 5FJ8H 4ALPA 4A3JG 2VUMH 4KLKA 3I55A 2YU9H 4QJFA 1Z47A 5JEAG 3UDFA 4KHPQ 4LF9L 1HR0W 3MXNB 2B63G 5IWAL 4UPAA 2ZTDA 4DV2L 3CC7A 2K4KA 4AIMA 4PMWA 4X62L 1PH1A 1PH9A 2JA5H 4L5RC 4DR1Q 1SR3A 2ZM6Q 1RIPA 3PUWA 4GLVB 1SRUA 2PQAA 3T1HL 2JA7H 4DR4Q 1E7ZA 2EXDA 4P71A 1UWVA 1U5KA 3F2BA 1W2BA 1E1TA 3PUZA 4BA1I 3M85A 3K7AH 4LF5Q 1HNZQ 2K14A 2NZHA 4A93H 3K80C 4A3DG 1PYSB 2RCNA 4DV1L 4BY1H 3UE0A 2R7FA 4A3FG 1ASZA 4GLAC 1Z9FA 1X3EA 4DR3L 2PMZE 3L7ZC 5LMNL 4YWKA 4YCWA 4JI0L 1JE5A 4LUZA 5H1SE 4Y7NH 4A3LG 2BA0A 5GAGC 1CKOA 5IYDH 2GVAA 1QVGA 5K36G 2UXBQ 3BU2A 4POGA 4L5TA 2AHOB 2IX0A 4P74A 4B3MQ 3F2DA 3I4OA 4GN4B 4DR5L 4JOIA 5C4XH 2HHHQ 4X62Q 5BR8Q 1V1QA 4LFBL 1L1OB 1PFSA 4A3CG 1RL2A 2D62A 4JCVE 2WAQE 3I56A 4DV4L 3PF5A 3UDXA 4AQYL 3PO2G 4K0KL 1N32L 1YHBA 1ASYA 1KAWA 3I4NH 1VQ8A 1PH8A 5IY0A 2MNAA 1CSQA 2VQEL 2N78A 3F1ZA 4DV1Q 3S1NH 4DKAC 3G48A 1SFOH 3BZCA 4GN3B 4IOAA 2VZAA 5LMNQ 5M3FH 4B3TL 2K5VA 5C44G 4AH6A 3CCJA 4IPCA 2MFIA 4AYBG 3CMEA 2E2HH 4H02A 4JI1L 4DR6Q 3FKIH 4GKJQ 2LSSA 2JQOA 1I94Q 5JJLA 3PGZA 1OXXK 4LUVA 4GNXB 4A3BG 1X9NA 4FDBA 5M5XH 4DNIA 4DR5Q 3A0JA 1WOCA 2BH8A 1JJCB 3GD7A 3CF5A 3KDFA 3CMAA 4DV6L 3TS0A 3HOZG 2BH2A 1JJGA 1YEZA 4BBSG 4LFBQ 2KENA 4HJ7A 4IO9A 1M90C 1L0WA 4IPHA 4BBRG 2F52A 2QEXA 2VQFL 4DV4Q 4AQYQ 1CKNA 1XMOL 1IBML 1VQ9A 1LTLA 1WCMH 4POFA 5FLMG 4GOPC 2YTXA 3KF8B 2R93H 1E1OA 3OTOL 1AE2A 4DR2L 1K83H 2UUAQ 4P75A 3EBEA 2R7DA 3CXCA 1HH2P 3OYYA 1G291 4GS3A 3DM3A 4B3TQ 1EWIA 1TXYA 1X65A 4A3MG 5M3MH 4JBMA 3PUYA 3MEFA 4UP7A 2E2IH 3B6YA 1X54A 1VQOA 2I0QA 1BVSA 4A3EH 4JI7L 4JC0A 3G4SA 2JA8G 1J5EQ 4LF6L 3CCLA 1FJGL 3U4VA 3S1MH 2WP8J 4JBJA 2BA1A 3J81i 3A5UA 2EIFA 5AJ3L 4XTCS 2RF4A 3J81j 3CCQA 4DV6Q 2WB1G 3TREA 1SE8A 1VQAA 1T9HA 4X66L 3VDYA 4A3GG 3KJOA 3KLWA 3WWVA 1TWHH 2ALYB 1VQPA 1IBMQ 1N8RC 2JEAI 4KHPL 2PQAB 3S1RH 2Z6KC 4K0KQ 3AEVA 3W1BA 1X6OA 3CC2A 2ZTEA 3E0EA 3J80i 3CCMA 3HOYH 4HJ9A 2R7ZG 3A74A 2QGQA 1VQBA 3ZJYC 1B7YB 4DUYQ 5C3EH 1Y1WH 1PH5A 3HOXH 2Q2TA 3ULJA 3PV0A 4LF5L 4X6AH 1AE3A 3U4ZA 2PI2A 1VQEA 2A19A 3J81c 5LMUL 2Q2UA 2V1CC 1FJGQ 1FGUA 3NELA 1OTCA 4IFDJ 1YNXA 2K5HA 2PI2E 5IE8A 3KFUA 3H3VH 1NTGA 3PO3G 3CPWA 3M9BA 1B8AA 3AFPA 4X66Q 3L2PA 1Y1VH 4UP9A 3JC66 3HOVG 2Y0SG 4OO1I 4IPGA 4OONA 1VQFA 3STBD 3J80c 4B3ML 4BY7G 4JV5L 2KHJA 4GOPA 2NVTH 4MZ9A 2HHHL 2I5LX 2JA5G 1Q46A 5BR8L 4DV5L 3IRBA 4JBKA 1P8LA 1VQIA 2JA7G 2XGTA 3S14H 5GAEC 2UXCQ 4UY8C 1KXLA 1DGSA 1NE3A 4OWXB 1J6QA 1FL0A 1EQQA 5C0XJ 3S17H 2ZJRA 3GTGH 2R6GA 2H5XA 5LMUQ 2N8NA 3FHWA 4A3KG 2I5MX 1A8VA 3STBC 1YHAA 4L5QA 4A3JH 2VNUD 4R4IA 1LM0A 3RN5A 5IYCG 3PIPA 4JI4L 1WFQA 5E7NA 3KJPA 1IBKL 2D0OA 2B63H 1YVCA 4LW1A 2AWOA 1YI2A 4R4OA 3KDFB 1PHJA 1VQNA 4DR6L 2JA6G 4GKJL 1I94L 3I2ZA 1MIUA 2OTJA 4MTNA 2JE6I 5HY6A 4DPGA 1CKNB 4PG3A 1VQ6A 4JV5Q 5C4XG 2ZTCA 1K73C 2Z6KA 1EIFA 3HOWG 3ULPA 1OXVA 5IP7G 4DV5Q 4YCUA 2VL6A 4DV0L 4WJ4A 4R4CA 2ZJPA 4A3DH 4JG2A 4A3FH
chains in the Genus database with same CATH superfamily
2UXCH 5KG6A 1EY6A 3GTPH 1GHJA 4IURA 5GROA 4NXMH 4O2DA 3MA2B 5EPLA 1IXRA 5GAHC 2UUAL 2EY5A 1SNDA 1WCMA 3OSPA 3G6YA 3JAMW 2G9HD 3LWUA 5KFVA 3GTJH 2R85A 1AUXA 2IX3A 3AU7A 2R92G 3K7UC 4OX9L 3QR8A 3VYTA 3F8TA 1VQLA 3S2DB 2UUCQ 3OMGA 4DGZA 1XNRL 1NUCA 3HKZA 2EXZA 4C2MB 2J9GA 4DAYA 2E2IA 4WBNF 5ISRA 2V5AA 4IWYA 4DL5A 2A8VA 3VPDA 2F4IA 3G71A 5D65A 2RVLA 4EYIB 3A8JE 4LK1C 4MA0A 5DLFA 1BNZA 1X3GA 1SNPA 4B9WA 3GP7A 2WDTA 3Q2OA 4ETSA 2WKCA 1CQJB 1HNWQ 4UCSA 1HNXH 5C44H 1E2VA 3F8NA 5CAEB 3D0FA 4X64H 2X6GA 3U58A 1S0MA 4J9NA 2FINB 1I3QH 4YHHH 3I4LA 2A69D 5D1OB 5M5YH 1ESRA 4JI4H 4BA2I 1KRTA 1S4ZA 1PYBA 1PV4A 5KFXA 2J0TD 3MC0B 4JI8H 1M7JA 2IL8A 2V58A 1SMXA 2WV6D 1Q8KA 4TV8F 4R4TA 4HTHA 1SMYC 2W9CB 1U4MA 3K58A 2R86A 2YS6A 2A69C 4QL5A 4A2BA 5C4XB 5IP9G 3ETHA 3KBXA 1FNVA 1CUKA 1L2ZA 3N40P 2UXDH 1STHA 4HIKA 4RMFA 1N34L 3CP0A 1FD7D 1RCVD 4PNYA 1Y1WG 2NVXH 2CW8A 1TR5A 4CKCA 1Y14B 4K8IA 3HGBA 1EL0A 3V4SA 1M4VA 2YTYA 5M3FB 1Q1BA 2I80A 1RF2D 3C46A 5CGKA 3S1QH 4YY3Q 4QQBX 4HNVA 3L9AX 1CI3M 1CFMA 2A6HD 5DQHA 1N36Q 2YV5A 5D8DA 2AGPA 1WJJA 4ED6A 3NBHA 1JR0D 1YBYA 2JK8A 3RLNA 2XGPA 3G6JB 2K5DA 1K1SA 1XNQQ 1LACA 2VUMG 4GC7A 5M5XB 2B63A 2R7ZH 3FP9A 1BCPB 1K3RA 1MKHA 2LY7A 1YJ9A 5KT2A 4NB3A 4DUZQ 4ED2A 4QCLA 3W5OA 1VS0A 2ZDQA 1Q1EA 3V4ZA 4HSPA 3ORQA 1RHPA 4DK0A 3BVMA 4DUYL 3PF4A 4ED1A 4PWQA 3J81E 5DGAA 1OXSC 4A93G 4I55F 1NMGA 1PZKD 3PO3H 5CA1F 2I5HA 4DV3Q 5M3MB 4R8UA 3E5NA 2RGVA 2E74C 4ULLA 3TP8A 1O7YA 3T4AC 3WO1A 2FK2A 1SYDA 2BQRA 2EJMA 4A3EB 3TMEA 4YAJB 1S3OA 2Q8TA 2UUCL 5IYDG 4RAUC 5IYZF 1UEBA 3S1MB 5C6AA 1I5FA 2AGQA 1N33L 2DPJA 1IBLQ 1R4PB 4UP8A 5ELCA 4APVA 2M2LA 1DCZA 2QK4A 4LNQA 1O80A 1L1OC 1VQDA 3N52A 3TQYA 3H3VC 2IW3A 1VCIA 2R7NA 2FLLA 1WYDA 3OIQA 4Y8VB 4B3RH 1VQKA 3VR2A 1S97A 3KALA 2OH2A 4MN3A 5C0XI 3SK8A 1Y69U 4ID6A 3J7AV 1HNWL 3JRXA 4NKLA 1S9FA 2EYLA 3KYHC 1BUVT 1KD1C 3KF6A 1C7YA 2JXMB 2DY7A 2YS7A 4FP5D 4CBVA 3P7JA 2DUDA 4JPBW 2K5NA 5FK9C 2ZJQA 1Y1WB 4JI2H 2EDGA 2JA6H 4AYBA 3DLLA 3HOXB 5J2TF 2XC9A 3W3AA 3KHGA 4UAIA 1O75A 3GV5B 5I4DA 3PIOA 2LXKA 2WINB 4RGOS 2M05A 1EHIA 5D1PA 5CBAE 4K6LA 1QUQB 1TS2A 2ZDHA 5FLXW 5DGBA 1NSNS 2ZM6H 3PO2H 1UNNC 1L0XB 5DLQE 5A2QL 2W6QA 2K1BA 3TEHB 4GKKQ 1LTTD 1EFID 4A76A 2GA4B 4XX0B 1QZGA 1WCMG 2J7ZA 3GTOH 3OHBA 4BXXH 2F0NA 1I50A 3HB9A 1VQHA 3EJIA 2J6SA 1HPCA 2IHEA 4C5CA 1SJED 1STGA 1G6PA 1PRTD 3HKZG 1I4RA 5F2DA 1A6XA 3M7NA 4LF9H 1PTOB 4O3QA 3RIZA 2K28A 4YY3L 3TP5A 1N36L 3OPOA 5KFYA 5JQWA 5EWFA 1SEIA 4TQUS 2SNMA 1L1OA 2VQEQ 4X65Q 1Z7TA 1PRTC 2UU9Q 4CDFC 2NU7B 4FF1A 3L0OA 4O3OA 4A75A 4IR1A 2GN5A 1HRJA 4ILWA 3E9HA 1PFNA 4JI0H 4JI1Q 4DUZL 3G8CA 3PZPA 2RKSA 1UC9A 4LF4L 3GTPB 4WJ3M 3MWYW 1GSAA 3NTHA 2CQOA 3VR3A 4DAMA 1WTQA 1JJ2A 2JJQA 4QGUA 3HOUH 3GTJB 1UC8A 1CHPD 1WH2A 4DV3L 4NDXA 4JYAQ 2W6OA 4LFBH 1D5ZC 1XMOQ 1FVIA 2DIKA 4LFAQ 2DPIA 1PTOF 3IFDA 3ITPA 5JVH3 2J6TA 1GD7A 4DL3A 4DFAA 2Y0SE 3D3RA 3KK7A 1R9TA 2RGRA 4DR1L 1A0IA 3KF8A 1IBLL 2YTVA 3PVXA 3KXYT 2ATLA 3SEBA 1JLLB 2NVYA 1VAJA 5KX5F 4EQ5A 5KKNB 3L3OC 1VQCA 1Q90A 3RGXA 5KEEA 1BDOA 4LFCQ 1HNZL 3OSOA 1GLVA 3RB4A 5M9OA 5C44B 1ICWA 1TS4A 5BPHA 5AJ3Q 2EY2A 4NPSA 2YL2A 3UQ8A 1WTXA 1KJ8A 4TKOB 3RNUA 5IYBH 3I12A 4DV6H 5FLXc 1I3QB 1O7IA 2J4XA 3CQZH 5M5WH 3KOJA 4ALPA 4A3JG 5M5YB 4RB1A 1Y8OB 4KLKA 4PQXA 5CV8A 1Z47A 3PW5A 2VQFH 1SE4A 1HR0W 2XD4A 1IBMH 2B63G 1LTGD 3BG5A 1XDNA 2P5ZX 4X62L 5HGTA 1SR3A 1RIPA 4GLVB 2PQAA 3MWEA 4DR4Q 4P71A 4K8JA 3MAQA 3BZDB 2SCUB 1LTSD 1EEFD 3G7LA 3I8ZA 1GUSA 4LF4H 4A3FG 1ASZA 4LF6H 4GLAC 1GOZA 1X3EA 5ELBA 5LMNL 3L7ZC 4YCWA 1IKMA 1V4YA 2FPIB 4LUZA 5IT9L 5GAGC 1CKOA 2NVXB 2UXBQ 3BU2A 2NTTA 4O3SA 3EFXD 1CT1D 3KTMA 4X3KA 4MA5A 2A68C 2WB1B 5EQ0A 3I4OA 4GN4B 3S1QB 1HTLD 2QW7A 1DYQA 1V1QA 3NQTA 1CQIB 2WAQA 4C1NI 4TV9F 4DV4L 3I56A 3PO2G 3DWAA 4LH6A 1KAWA 2RCFA 4QWCA 2V4QA 2DLNA 2K6AA 5IY0A 2R7ZB 3BDCA 1CSQA 2VQEL 1S0NA 3EROA 3F1ZA 1Y8PB 3M7GA 3TDQA 4DV1Q 4IOAA 1DOLA 2NYZD 3EQLC 4HMIA 2SOBA 4K14A 4QUCA 4B3TL 4ZUJA 2K5VA 4PMBA 4AH6A 2MFIA 4AYBG 5IOCA 4Z9CB 4JI1L 4J9KA 1TY2A 4O4IF 1JWMD 4GKJQ 2QDLA 4U68A 4GNXB 1BXRA 4A3BG 4C3JG 1KJQA 5DAUA 2CH4W 3PO3B 2FMCA 4R8NA 4ECVA 4DR5Q 4HR7A 2BH8A 2V59A 3Q8PB 4C3IG 2G9DA 1JJGA 4BBSG 2R7KA 2ZXRA 2QF7A 3R93A 3GIDA 4IPHA 4BBRG 4I7AA 4BWSC 1XMOL 1VQ9A 3K5NA 1LTLA 4RH6A 1E1OA 1K83H 2ZXOA 4RB3C 1HH2P 3OYYA 5DG9A 1I4HA 1K3BC 3TN2A 1I7LA 1H9SB 4A3MG 3X3MA 5EPJA 1DOMA 1ENAA 2PCFB 4JC0A 2I8CA 5DQIA 3CCLA 1LTRD 2WP8J 3NK9A 1ZKOA 5DG7A 5AJ3L 3CCQA 4C2MA 2JA6B 2N88A 1KBLA 4K2KA 1RODA 1N48A 2BR0A 4CDEC 2VOBA 2ALYB 5IGDA 5J1ZA 3W1BA 1X6OA 2F0KA 1QE6A 1WD0A 1U9RA 1BCPC 1EEID 3NHHA 4HJ9A 3PO2B 1JX4A 2QGQA 4KD4A 5COYA 1Z2OX 4FBTA 2PMZB 1LT4D 5C3EH 3GV6A 3P1HA 1PH5A 2VQDA 5KT6A 3PV0A 2RA4A 3X3NA 3GTOB 1AE3A 5LMUL 3J81c 1FJGQ 3CRLC 1SE2A 4IFDJ 1IOWA 5D1OA 4MV1A 4EGVA 4ECSA 2K5HA 2PI2E 3IN5A 4O3RA 4U673 4RAZA 2Z9HA 1B8AA 4IUNA 1KABA 1Y1VH 3JC66 2EYJA 4OO1I 5C0XH 4OONA 2EVBA 4RHRA 4RUAA 1GUTA 3BABA 4OHJA 4J1MA 3GIQA 4F87A 3GIKA 1NCVA 4MZ9A 2W9CA 2I5LX 1NNXA 4Q8EA 2F0IA 3D4WA 4DV5L 2FB9A 1VQIA 2XWBB 4PMCA 2XGTA 2KJXA 3CRKC 3S14H 3BAAA 3SE0A 3JAME 1A3VA 2UXCQ 3RUPA 5KFKA 3BJYA 2R7LA 3TIIA 3Q8QB 1FL0A 3S17H 2H5XA 2IP4A 5KFBA 5D3IB 4A3KG 2FJ2A 2I5MX 5JEAH 1IBKL 3SVMA 2I07B 3Q22A 3GQCA 4CDCC 1HFGA 2CQAA 4R4OA 4GKJL 4QWEA 4IRCA 5KFMA 1EY8A 3HOUB 3FVQA 2JE6I 2RQXA 3OHXC 1CKNB 5HY6A 1VQ6A 3VR5A 3SI8A 1JE4A 3HOWG 1K73C 5KG7A 4CHTB 1OXVA 1EOTA 1CTMA 4EFBA 4WJ4A 2VL6A 4E6IA 4DV0L 2ZJPA 4A3DH 4O2BF 4XXEA 3K5IA 1JICA 1PTOD 1B2TA 2SDFA 1F9QA 2X69A 4A3IG 4A3LH 3H40A 3OW7A 4EFEA 5LP6F 1HZCA 5LMUH 3DWPA 4YHHQ 4MV6A 4PZ8A 5E4XA 4JI4Q 3BA8A 5KFOA 3QFFA 4DK6C 2C35B 5HV6A 2MPMA 4N8FA 2MUYA 3M4OH 1TWAH 1LABA 2F0DA 3HG9A 2K52A 1UNSA 1Z2NX 4ZUIA 4MTEA 1E2WA 1X32A 3EIVA 4A3CH 4LMYA 1PTOC 2WAQG 1VF5C 3HRZC 2O4XA 1HHVA 2E5LL 2K7VA 5M5WB 3CQZB 1W3SA 1A9XA 5CORA 2XRQD 1E24A 2F3IA 4IPDA 2LXJA 1R4QB 3AYHB 1HJPA 1CZWA 2K50A 2PW5A 4DV5H 4KY7A 3SK4A 2JEJA 1XMQH 1EQVA 3IFTA 2K05A 2UXDQ 1LT3D 1GM5A 2R82A 2AQ4A 2R8GA 4FVMA 4KMUC 2D2CC 4QB4A 1KAAA 3I4MG 2KEDA 1A2TA 3TZUA 1HUNA 5KG5A 1H9JA 2F0JA 4OX9Q 3L4JA 4Q45A 1EQRA 1PDQA 1SYFA 1Y8NB 4G3IA 1EYAA 1XNRQ 3RB3A 1Y1WA 2ATWA 3RZOH 1XYIA 4EYHB 4RZQA 2NUAB 1LTAD 5KG2A 1CE8A 4DR7H 2Z1CA 3ONAB 5EDWA 4CGYB 2MHVA 1SCUB 1QUQA 1Q81C 2YZGA 4L8JA 2H1EA 4LF8L 1T94A 1EYZA 5L1IA 3CCRA 5CYUA 5F9LA 4RB2C 1TWFH 1TS3A 3DHQA 4DXFA 1W96A 1Q12A 4J9QA 3FPUB 1ZXTA 2UXCL 4NXNH 1PZJD 4NXML 3SGIA 1S5DD 1ILPA 1TWCH 3GIPA 3TIGA 4A3GH 1EZ6A 1MJCA 3J80L 2OF1A 5E4WC 4MV4A 3A55A 4X3TA 3DM1A 3J7AF 1NMFA 4K6DA 4ZCKA 1HZ9A 3QB3A 3C0FB 2MO0A 1SYCA 1STBA 1UE6A 2PBZA 4XIGS 1D1IA 2F4VH 2F0TA 1AH9A 5C0XG 2V4RA 1X3FA 1A63A 4IJLA 5IGGA 3F2UA 4RA8A 4RWSC 3CPFA 3T1YH 4DV7H 4B3RQ 2J6UA 1JT8A 1KC7A 2IX1A 4GC6A 5C3WA 1N34Q 2ASJA 4OWWB 1WTOA 1K83B 1HNXL 4KHZA 4S3SA 4OWTB 4G7HC 4JV1A 1VBHA 4X64L 3J7YW 5I9PA 2XGQA 4IFDI 4RHSA 4JI2Q 3GTPA 3RB0A 4HJ5A 3K8AA 2NZOA 4IRKA 4YWLA 2A74C 4YHHL 5JUMA 5E1FA 3WNZA 2KOLA 4P2CB 5L1LA 1JKJB 5FLXE 3BQ1A 3GTJA 4DK3C 2PVPA 4BY7H 1KC8C 2FFKB 3MZ5A 4XYMB 3ERQA 3ND9A 1TWGH 1NBWA 4JI8L 4IN3A 4KN7C 1V9PA 5EAYA 2L55A 2B2VC 2EJFC 2A5HA 4KHVA 3H3VI 3PCOB 4FNFA 1F2ZA 2D9UA 2SEBD 5JEAJ 4FF4A 3I72A 2F03A 4EBDA 3GO5A 3C3LA 2HT1A 4OEMB 5IYCH 2UXDL 2F0UA 1L0YB 2VB2X 3GLKA 2K03A 3A54A 1UE5A 5C3EB 3HFZB 4GZYC 5M3FG 5IGBA 4YJ2F 5C5JA 3UE1A 2NVQH 3PIO3 4LF9Q 3U9TA 1B1ZA 3FDTA 4QIWE 4RCNA 1OWTA 4GNXC 2NN6G 1VQ5A 1I3QA 2OT2A 2R6FA 1H9KA 1JQYD 2IY5B 1N33Q 2AQ3B 2AU0A 5IP7H 4UCUA 2GPSA 3URYA 2D0PA 4RNOA 1J9OA 1Y1VB 1GSOA 5KNCA 1KL9A 4DF7A 1B53A 3TSSA 2YW2A 4YIJA 2YYAA 1AUVA 4DNTB 2TSSA 1LV9A 3ETJA 2R93G 3MHBA 1ET9A 4ZHQF 4KKTA 4JI0Q 2VPSA 1UAPA 3T51B 2XNAC 3BZKA 5FKAC 1AN7A 2ZJTA 5BPFA 4F50A 3S14B 3RMHA 3GV8B 4UCOA 4IRDA 1DOKA 1VF7A 1SMYD 3S17B 5M3MG 1HFNA 4JI5H 2CW7A 4H13C 4F88A 3MR2A 4A3EG 2NVXA 5IWAH 4B08A 4DV2H 2K32A 5EKKA 3S24A 2WB1A 3NQIA 3U9OA 4ME6A 1NAPA 5CV4A 2B2VA 3R2IA 4EQNA 3MEHA 3H0GH 3CU7A 3RZDH 2EOTA 1NR4A 1EUJA 3QO2A 4QW8A 4J9OA 1Q7YC 4L1KA 1M8AA 3ER0A 1RK6A 2R7ZA 3GTKH 1I6UA 3M4YA 4B3RL 2KA7A 4A3DB 3K5OA 5BMVF 1IHZA 4KV6A 4OIJA 3TQTA 2AUJD 5JJKA 5T1IA 1GUNA 4OO1H 4XYLB 3SDZA 4F4ZA 3HOXG 3CD6A 3BJUA 1JMCA 3IL8A 3M4IA 3MXGA 1SEBD 4RKLA 3ZYYX 4GNXA 1XPOA 4JI2L 5L1KA 1SROA 4HSVA 2VQFQ 1QZHA 1S68A 3M4OB 3H20A 1SYEA 1TWAB 1PXUA 3UDGA 4U7CA 4DXGA 4AQYH 4DL4A 1N32H 2X0SA 3T5KA 2PN1A 2MO1A 2YZMA 4ED0A 2A6ED 1SNQA 3NBIA 2ZM6L 1K1QA 4JVZA 1WTHA 1XTDA 3A5ZB 1STAA 2EYPA 1YIJA 4HQ6A 3VPCA 3JAMc 4NLGA 1WTPA 1FYCA 1JIHA 4LF4Q 4LF6Q 2R93B 1H9SA 1F2YA 5LYJF 3MVVA 2MJ8A 4YR0A 1IOVA 2CVRA 4V190 1W93A 5JJIA 2JA9A 2W9AA 4J9RA 1GUWA 1U0LA 2A6EC 4LWCA 2C2RA 1B3AA 1CKMA 1PA6A 2JEBI 2JEGA 1PH7A 1QCBD 4QY7A 2R8JA 5FJ8H 2C5CA 5IGEA 2Z6BA 2YU9H 5AFWA 1WTWA 4LF9L 3MXNB 2EY6A 2JA6A 3RZOB 4UCVA 2ZTDA 3VR4A 4DR2H 3G6XA 4L5RC 3C1EA 5A35A 4DR1Q 3PUWA 2JA7H 1SRUA 2QYZA 3JSNA 1E7ZA 1U5KA 3D4RA 3PUZA 4BA1I 3M85A 3K7AH 3RGZA 1HNZQ 1EY4A 2NZHA 4QWDA 3K80C 3QZ7A 2R8KA 1BCPF 2RCNA 4X3UA 1FGBD 2DJFC 2F0SA 4BY1H 2PMZA 4FO2A 3G6VA 1TWFB 4JI0L 1JE5A 1STEA 3BVZA 2KHSA 4L63B 3GTOA 4JV0A 1QVGA 1RJTA 5KFAA 1SXTA 5I6WA 2I46A 2IX0A 2EJGC 2F0PA 2F0FA 4R7RA 3KLRA 4LMQD 5BN3A 1SJHD 4DK1A 5JVDF 3I90A 1TT2A 4A3GB 1B9NA 1A3TA 4K5WA 4X62Q 1BXTA 4ZI7F 4LFBL 1PFSA 5CV5A 2AGOA 4K0KL 2Z4HA 4Q44A 1YHBA 1ASYA 2HDMA 3H4BA 3I4NH 5JAVA 1XXGA 3RBEA 1VBGA 2MNAA 4LF5H 3BZCA 4GN3B 2PW7A 4H44C 4M8AA 2VZAA 3H91A 4KY6A 5LMNQ 5C44G 1TY0A 4IPCA 3OIPA 2F0EA 2E2HH 4LAAA 2F3WA 3FKIH 3WO0A 2KUMA 3LNNA 3NUCA 4LUVA 4DA2A 1G2TA 3PR5B 4JV2A 1E0BA 4K2LA 4DNIA 3D8GA 3GD7A 3M3YH 3TS0A 4DV6L 1TKWB 4JV5H 2BH2A 5CV6A 4O3NA 2Y0SB 5KFUA 2HHHH 2KECA 2QEXA 4O42A 2F52A 2VQFL 4DV4Q 1KXLA 5BR8H 1CKNA 1IBML 1TA8A 4BY7B 3OMCA 4POFA 2B2YC 1Z2PX 2YTXA 3VYRA 1TWGB 2BOSA 2QCPX 2RDHA 3AB9A 4IZ8A 3EBEA 4BWGB 3CVZA 5HBRB 5EWEA 4GS3A 1JCKB 2K5QA 3DM3A 4B3TQ 1EWIA 1TXYA 1X65A 3DF7A 1X3QA 2BDNA 4HEDA 2V9WA 3MEFA 2K04A 1SAPA 1VQOA 3T13A 3G4SA 4O3PA 4LF6L 2L11A 3U4VA 1I94H 4JBJA 2BA1A 3A5UA 2EIFA 1I4PA 4G57A 3J81j 2WB1G 1SE8A 4EQOA 4X66L 2NVQB 3EPIA 2B2WC 1TWHH 2F0GA 1B6SA 2VPQA 5J2UF 4K5XA 4I50F 5IT9W 4K0KH 2JEAI 2Z6KC 4CKBA 3CQZA 4ECXA 2ZTEA 3J80i 4O1NA 3HOYH 4IFDH 1JOOA 3K59A 2R7ZG 2PO4A 1VQBA 3ZJYC 1B7YB 5I2XA 4DUYQ 1M0TA 5FLXL 3IAYA 3ULJA 4YR2A 3K3PA 2YCHA 1STYA 2Q2UA 3R23A 2A19A 2L4NA 3NELA 1OTCA 4RGTA 1J5EH 4IALA 4MHEA 2PQEA 4HN7A 4NW2A 3H3VH 1CK1A 1CM9A 3PO3G 3M9BA 1C3OA 3FDSA 5FOBB 4XQQA 2VA2A 3CHBD 3K5HA 2NU6B 3STBD 1BBXC 1BNCA 2E2DC 3BDOA 2B2YA 2KHJA 4KKUA 3WOFA 1KJJA 1WTVA 1KDCA 1P8LA 2JA7G 5GAEC 3SK5A 3D6CA 4UY8C 4OWXB 5K5PA 3DEOA 1BQQT 3H0GB 3RZDB 5FO9B 1GHKA 2C2EA 2A68D 4LSXA 3GTGH 5LL6b 5KT3A 4DAPA 5LMUQ 1CQVA 1QNUA 4HYKA 3FHWA 1S0OA 3RUZA 3STBC 1YHAA 3GTKB 2VNUD 1S5FD 3JZIA 1LM0A 2ICEC 3RN5A 5CMDA 1WFQA 3HS0C 1FKAH 1F2LA 4I65A 2AWOA 3KDFB 5CR3A 2JA6G 4X66H 5KT7A 2HDLA 4HNUA 3I2ZA 3RD4A 2B2WA 2L12A 4WFN3 2OTJA 1KJ9A 1XNQH 3I73A 4EGQA 4PG3A 2Z6KA 1EIFA 3ORRA 3RAQA 1VMPA 4DV5Q 1JDEA 3OSNA 3NPPA 2OEOA 4CJ1B 5C5LA 2PNRC 4DL6A 3CW2C 1CSPA 1DM0B 2D5DA 4LUOA 2N3SA 4QMGA 4YAKB 1V43A 1MD2D 3RLOA 5BN5A 5K36H 4EBEA 1B33N 1K83A 1CHQD 1PH3A 4BXXG 1ZYRD 3HEJA 1PH4A 1IBKQ 1M1KC 4OXPA 4ODGA 1EY9A 5LL6S 2XCPA 1P16A 5KYLA 1SE3A 3HKZE 4DR7Q 4EEYA 2ZT9C 1EIYB 3SHLA 4HIDA 4LF7L 2B2TC 3K81C 4IOCA 3Q1KA 2Q2HA 2YU9B 4DV0Q 5LHY1 1CS0A 5CA0F 1ZYRC 1C30A 2XCAA 3TBIB 5EKIA 5D3DA 4FF3A 2HJWA 1C8CA 4B3SL 3Q8DA 2V4DA 3W2DA 2JA7B 1GUGA 4NXNQ 4HJ8A 4P72A 5DQGA 3K7AB 2B29A 3I70A 1IYVA 3BDLA 4BY1B 5I6YA 3N8DA 1C9OA 1G91A 3E3XA 1AFPA 2WIIB 1FR3A 3NEMA 1BCPD 2XVSA 3I91A 2O2LD 3HOUG 2E5LQ 1LUZA 3QG1A 2OQ0A 5FLMH 2F4VQ 3RBDA 4GOPB 4GKKH 4WRDA 3UDIA 3HBLA 1Y1VA 2ES2A 3A56A 3T1YQ 2X6LA 1KQSA 4IUPA 2XTIA 5BN4A 3J81L 3H09A 3JAMi 2JA8H 2GPWA 4EGJA 2UUBL 1GVPA 3E6ZX 1SNOA 3I4NB 3GDEA 1BF4A 3T5JA 1F9RA 1NY4A 1BKBA 1UE1A 1B9MA 3HKSA 1EFWA 2E2HB 4O4HF 4H0LC 1M0WA 3V6HA 2HQLA 3FKIB 2KSWA 4LF7H 3BYTB 2B2TA 1PZID 5G3LF 5IYBG 2HCIA 3JSLA 1TVXA 1KHIA 4O0AA 4KJOA 3M3YB 4LF8Q 4X65H 3U50C 1X56A 3RFCA 3PR4A 4G7ZC 4B3SH 3GTLH 1EUCB 5H80A 1XPRA 1VQMA 2F1MA 1RYSA 4JI6H 4XQNA 5CBEE 2DNCA 2NB0A 1HR0H 1O7LA 5L1JA 1EIHA 1XMQL 4NXMQ 3RF2A 2B8GA 2L15A 5KIXA 3SXHA 4ECYA 1WTRA 2CFMA 4XT3B 2ALZA 5DM73 2YRWA 4DLKA 3CAMA 5GONF 3HOVH 5IGCA 1B6RA 4JYAH 2QDBA 5GQOA 1U4LA 2TMPA 3NTKA 4LFAH 1HUMA 5IIFA 2CCZA 2AMCB 4EEQA 1S40A 1D6EC 2EYMA 4DR7L 1TWAA 2CWAA 4ECZA 1BBWA 5ELNA 1EOVA 2FLNA 2IPKD 1TWHB 3LMLA 4PZ6A 3DXJC 4P73A 1IKLA 2HQEA 5CC4A 3K5LA 1YITA 1YJNA 4LFCH 2R3ZA 1HNXQ 2UUBH 2CH4A 3HOYB 1ZEQX 2R87A 3TQ1A 4X64Q 1VQ4A 1AZPA 3M9MB 1GO3E 2R93A 4I7HA 1EY0A 2RSOA 2W9BB 4EVOA 4JI5Q 4NXNL 3EYYA 4RUCA 1B3QA 1L2FA 2ENBA 1Q82C 2NU8B 1HXYD 2EY1A 2QA4A 4AYBE 5IWAQ 1SYBA 4DV2Q 4RCOA 2HCCA 2LS01 2CQYA 1X3PA 1PK8A 4JI8Q 2KEEA 4ED8A 4TVAB 3MXNA 5C3XA 4C5AA 4JI3H 1WD1A 4L5SA 4UCRA 2E75C 4DR4H 5KG1A 2F4VL 3J80W 1RD9D 2FHTA 4MNOA 3MFGA 3SR1A 1LTBD 2DY8A 3A7LA 5J22A 1E4FT 3MTSA 2K33A 3D31A 3S16H 2KCTA 3T1YL 2JP1A 4DV7L 1VQ7A 4IWXA 2R92H 2FK1A 2BE5D 3RB6A 1TWFA 1D8LA 2SNSA 3CCSA 3ERSX 1N9WA 4IJHA 4MV9A 2FXQA 3GTGB 5KFNA 2UXBH 2R8IA 4RKBA 3ULLA 3CKIB 3HOZH 1EZ1A 2GVBA 4ECRA 4QWAA 3UFXB 5ELEA 1IYUA 1TAEA 3RLFA 1JOKA 5CV9A 3VPBA 3GTMH 1N32Q 3T1HH 3AFQA 3N6RA 4ZQ3A 1ZHSA 2BE5C 1KRSA 4U6PA 2MQHA 1VQJA 3CC4A 3I7FA 4WJWA 2N49A 4G7OC 5KT4A 2WACA 3MXUA 2PZUA 5E3FA 5KFJA 1SBBB 4PV1C 3D4DA 2CKZB 3HP3A 4DV1H 5DNFA 5A2QE 4DR3H 1F77A 2EE1A 4NP5A 3GTQH 3FRPB 1H95A 2MP1A 3VA5A 1Q86C 4EX5A 5J39A 1EU3A 5C3EG 2MCTA 1IYJB 3BS1A 2LKVA 3T56B 2KBNA 3CCVA 4DR5H 2R84A 4M1UB 4J9SA 2YZNA 1K0RA 5ELOA 1ESFA 4RGMA 4DNRB 5IP9H 2Y0SA 4DR2Q 1XJVA 1Y1VG 4N8X1 4M9UA 4ED7A 2OTLA 1IL2A 4IQZA 1VQGA 1JWSD 2HIXA 1TWGA 2W6ZA 5KFSA 5T14A 3DWQA 3VR6A 2IT1A 2NTSA 1UEAB 3LGJA 2CWPA 2WFWA 3MXPA 1HZBA 4KI0A 4LSAA 4QIWB 2UVRA 2XRSD 4DU9A 1C4QA 1EWCA 3I3CA 3G6EA 3CCUA 2MGSA 2XN9C 4JI5L 2C28A 1B04A 2VUMH 3I55A 4QJFA 5JEAG 5IWAL 4UPAA 4DV2L 2UVWA 5CV7A 2FPPB 3OTOH 1O78A 2ZXPA 4AIMA 1PH1A 1TU2B 2JA5H 1D2BA 3PN1A 4PDBA 1KDBA 2ZM6Q 3M9OB 1B44D 1F9PA 1G6ZA 1W2BA 3F2BA 3A8IE 1N56A 1E1TA 4LF5Q 1A2UA 3AMUA 4A93H 4A3DG 1QB5D 1PYSB 4JI7H 3UE0A 3DEPA 1QOHA 2JA8B 5H1SE 4Y7NH 4A3LG 3PQIA 4ECUA 4F4WA 1E4GT 1MGSA 5IYDH 2GVAA 3N42B 2PZTA 2OXPA 4IUVA 3IG0A 4L5TA 4P74A 4KHPH 2HHHQ 5BR8Q 4A3CG 4JCVE 2WAQE 3SK6A 3UDXA 4AQYL 1MHWC 1N32L 2JSOA 1I4GA 1SNMA 3R8BA 3K0YA 5G3LD 2N78A 3S1NH 1SFOH 1EU4A 5JPNC 3GTLB 3BA9A 2KCNA 3NWSA 3H0GA 2L1BA 1ZHQA 4H7BA 3GV7B 2DNEA 3T5LA 1EIGA 3QJYA 3CMEA 1VDZA 5LOVF 4UFZA 3GQBA 3E0JA 2LSSA 2JQOA 2FLPA 3GTKA 1I94Q 5JJLA 3PGZA 1OXXK 3N41B 4J9MA 1F2MA 3LWEA 4KD3A 3EPGA 4DN4M 5FO8B 1V1PB 5IT9E 1WOCA 3S9WA 1JJCB 1CQFA 2LFNA 2R61A 3KDFA 3CMAA 3CF5A 3HOZG 1RTOA 3HOVB 1YEZA 4B3MH 5C8YF 4LFBQ 2RDFA 2W57A 2KENA 3NXWA 4HJ7A 1L0WA 4K0KQ 1WCMH 3NSWA 4F8MA 5LL6X 4GOPC 2VA3A 3RAXA 4ZLTF 1K0SA 1K8OA 4DR2L 1FNUA 2R7DA 3ND8A 3QOLA 2VR1A 4RU9A 1HTPA 5F9NA 2BCOA 3T5HA 1PLFA 2JEFA 2N55A 1I4QA 4FS2A 4V0BA 3PUYA 1RK5A 1KEEA 2E2IH 4C1NK 3B6YA 1X54A 1BVSA 4N9TA 1J5EQ 1VMCA 4DR6H 4NMZA 2Z4IA 3QIAA 3J81i 2DWCA 5KFTA 3Q8SB 4XTCS 2RF4A 4DV6Q 3TREA 1JB3A 1VQAA 5ELFA 3VDYA 4A3GG 3KJOA 3V2TA 3WWVA 1IBMQ 3JAML 2CZGA 1STNA 2Q8RE 3S1RH 4MV3A 3DMUA 2YU9A 3E0EA 4RGNA 3KLSX 3R5XA 1EQTA 2XWJB 5KG0A 2UUAH 3EA6A 2F0HA 2DZDA 3QWNA 4FXKC 5KRUA 2O5IC 4TUYF 2G5DA 1RDPD 3IKJA 1BGWA 1DJRD 2EYOA 1JXLA 3QZ8A 2I87A 1XWEA 1PMRA 2H4OA 4K5VA 2JA7A 4OX9H 5KFIA 4LF5L 4X6AH 5LXTF 5EGTA 4IUUA 2HD3A 2PI2A 3S16B 4YB8B 2IA6A 1XNRH 1SYGA 2V1CC 1FGUA 5A2QW 2R92B 2BQUA 5IE8A 5FPRA 4IUTA 4C56C 1NTGA 5KFQA 3CPWA 1LT6D 4X66Q 5KFCA 5DEHA 4UP9A 2Y0SG 2L5TA 4ME5A 4IPGA 2ICIA 4DL7A 1VQFA 3HOZB 4JV5L 4BY7G 4GOPA 2NVTH 3KHHA 1I6VC 2HHHL 2JA5G 3GTMB 1Q46A 2FE3A 3BQ0A 5BR8L 2A6HC 3IRBA 4JBKA 2FPGB 5EOYA 1DXMA 5KYIA 1CA5A 1EQQA 4JUZA 2ZJRA 4ECTA 2C22A 1OO9B 1ULZA 1EWHA 4RZRA 1T5XD 2N8NA 1S5ED 4N9PA 4XT1B 4L5QA 4A3JH 4G4KA 3GTQB 5IYCG 2QKIC 3PIPA 1AP0A 2B63H 4MTDA 1YI2A 4O2AF 1PHJA 1VQNA 2E2HA 1I94L 4I7ZC 3V6KA 1MIUA 3NTIA 3FKIA 4MTNA 4MTKA 1TWCB 4J8QA 2B39A 1DONA 4FM9A 2EZVA 5IP7G 4ZYSA 1KLUD 5EWGA 1QNKA 4A3FH 1N34H 2C2DA 2L9HA 3OWEB 4J6HA 4MV7A 4MV8A 4RNNA 1PVOA 1QILA 2B8FA 1B70B 1MBYA 2YRXA 1RJPA 2F0WA 3GIIA 2R8HA 1E2ZA 1WI5A 2RHSB 3LWBA 1YHQA 2B3GA 4XZ3B 4ECQA 1S03G 5JPMC 4ABNA 5C4JH 3FMAA 1T3NA 3M4PA 1J5EL 5KGUA 1V1OA 1JC7A 4TRDA 2XCLA 4ZKCB 2M9VA 4UHVA 2CW0D 3Q24A 1RTNA 2B2UC 5KFPA 2VUMB 4OIKA 5C4HA 1XPUA 5FPOA 4HAEA 4FS1A 5IODA 1TWHA 4DUYH 3NP8A 3PSIA 1ILQA 2JA5B 2O03A 4JK1C 3H0GG 3ICEA 3OHAA 3W1GA 2FKLA 4GN5A 3Q8RB 3K0XA 2WE6A 3PW2A 2CW0C 4A3BH 1V51A 3L4KA 4C3JH 4JW0A 1AEXA 4A93B 4IZOA 2Z0SA 4QF4A 4YWMA 2W9BA 4C3IH 2UUCH 3S2HH 4OO1G 3HZXA 4BBSH 3K57A 2C9OA 4A4IA 1B50A 1SYXB 4R8IA 3NGDA 4ECWA 1N33H 3V96A 4BBRH 4Y7NB 4LF7Q 2CHBD 4HNTA 1G8ZD 4EBCA 4FXDA 3WOEA 1KLGD 1I6HB 2NN6I 5LMNW 3V6JA 1XNQL 2ID0A 1I50H 1JWUD 1E4EB 2BDOA 1HZAA 4ME3A 1CA6A 1HCZA 2VUGA 4B3SQ 1PH2A 2ASBA 4A3MH 4JI6Q 5KFGA 1W6KA 2EYFA 5CB4F 1HNWH 1HR0Q 4CC6A 3E9IA 2FJZA 2OLSA 4QWBA 4QUFA 2YYZA 1BBUA 2K5WA 3F2CA 1ZQ7A 5C4ZA 1KTKA 4FYDA 3S1NB 1SFOB 1QVCA 4EQPA 2PYKA 1PX2A 4R4QA 1DV2A 4HCSA 5KFHA 3GTGA 2AKWB 1M6VA 3MR5A 4YQWA 1AN8A 2A1AA 4JBWA 4TSSA 3PW0A 5EKLA 2B2UA 5IGFA 5FJ8G 3OOCA 1V8QA 4CDDC 2EPBA 4ZQIA 2W70A 5DG8A 2HGSA 3R5FA 3Q23A 4J15A 3J7A5 1WCMB 2HVRA 2UUBQ 2ZDGA 3MR3A 1UUPA 2KHIA 1WVLA 1S10A 2QEJC 2HUGA 3DUZA 2W8KA 2F0MA 3RV3A 1K8AC 1UE7A 2HIVA 1KJIA 1PH6A 3N44B 1KNEA 4BY1G 2OCEA 4J9PA 4APMA 4KK7A 3HKZB 4J9LA 1LYLA 5HGQA 4DAYB 3KAKA 2E2IB 4PZ7A 1YJWA 4YY3H 1N36H 3P20A 1R9TH 1T36A 2E8GA 1AZQA 1EY7A 1X55A 1G2SA 3J80E 2NVYH 4JI3Q 1CZGA 3GIJA 3OUZA 1BO0A 1F9SA 1A62A 3KBGA 2AWNA 1EYGA 1OXTA 3M4QA 5KFLA 3FEWX 1HA6A 1RYRA 5EZYF 5KFZA 4GKKL 4DUZH 1KIXA 1PYWD 2P0AA 4I4TF 5L37A 3S1RB 4CC5A 5FD6A 1XMQQ 3MR6A 4A3KH 4R1JA 2EQSA 4ZK9B 2RDJA 3R2TA 4FF2A 3I4NG 3N43B 1SDFA 2Z8LA 3PUXA 2W6NA 1SN8A 4YR3A 3WDNA 1J8IA 1ONLA 1ET6A 3FMCA 3H4DA 1SNCA 1GGOA 3LP8A 2W6MA 3TINA 4DV3H 4QIWA 5KNBA 2IBKA 3J81W 1G51A 2AUKA 2K75A 1E3PA 2C00A 3MFIA 3FKIG 3VYSA 4UDUC 2RHQB 4LJZC 3HOWH 2LMCB 1D1KA 2F3VA 5IT9c 2KQ3A 3T1HQ 1XTCD 4DR1H 4XYOA 3MWMA 2RDIA 1IBLH 4CJ0B 5J3BA 1I6HH 2RSNA 2IHFA 4A3IH 4X65L 4GLXA 2W7OA 1C48A 5DM63 2UU9L 4C3HH 4IHJF 4RFBA 1HNZH 2NVTB 4DR3Q 4C5BA 2FMMA 2A73B 4XQJA 4IR9A 1NR2A 4JI6L 4F4XA 4HCEA 3A7AB 4RG1A 1K8GA 1S72A 1HR0L 2W7PA 2WTFA 1GXDC 3CCEA 1S5CD 1BR9A 1DD2A 1C0AA 4KTAA 3NBHB 4ED3A 4A3JB 3KHLA 3TP6A 3TS2A 4JYAL 3BVGA 4X62H 5D14A 2VW9A 2F0LA 2B63B 5FO7B 2OQKA 1GSHA 4LFAL 1JB7A 3TRZA 2WB1E 4CKEA 1NJIC 4HIOA 1Q3LA 1BOSA 3FPPA 1IZ6A 2F0OA 1D7QA 1HQRD 4L6TB 1PFBA 4Y52H 2E2JH 3I4MH 4YCVA 1BJTA 4DV7Q 1T5EA 2RBMA 5LMNH 5GADC 3J7AK 3HOYG 4IFDG 2OWOA 1TS5A 5I47A 3OWFA 4HMJA 4A3FB 4LFCL 1FNWA 3GTLA 3EN2A 3BG3A 1QVFA 4HJAA 1YZ6A 3Q6SA 1MJEA 4YBZB 4R8UB 5EBCA 3V05A 1WSCA 3OW2A 4HIMA 1E22A 5C1OA 2VS1A 2FP4B 2KCMA 2DGYA 3OUUA 1TQOA 2NBFA 1DIKA 3PUVA 1A15A 2NU9B 3D6WA 3S15H 1V1PA 2R7MA 5C4JB 4DV4H 4JOIC 1HA5A 4M7EA 3OTOQ 1OXUA 3BQ2A 3PW7A 3NE5B 2VQEH 3AQQA 4JI3L 4FBUA 3KLSA 2UU9H 1GKHA 4DR4L 5DLGA 4B3TH 2VY3A 3BYYB 3RR5A 1ZETA 3RN2A 4B9XA 4JI7Q 3J7ZC 4JI1H 3S2DH 3KF6B 5LA6F 4WD3A 1SLJA 4X3SA 3TZDA 2W6PA 4C2MH 3H15A 1II3A 4AYBB 3A8KE 3NENA 5C1PA 4DAVA 2AQ1B 3SE7A 2NZ1D 1K9MC 4RNMA 2PNHA 2PZWA 4QW9A 2ASLA 4A3BB 2Q2IA 4OELB 4C3JB 1GJXA 2UXBL 2HVSA 3QOJA 1ICFB 3U9SA 3UDFA 4KHPQ 4XDXA 1XMOH 4C3IB 2GLTA 3S2HB 2NWGA 1MSGA 4BBSB 3CC7A 1K28A 2K4KA 1PH9A 4PMWA 2W71A 4BBRB 4FU0A 5NUCA 2EYHA 5KFFA 3T1HL 2ASDA 2XSCA 2EXDA 1UWVA 4OGQC 2VB3X 4FXGC 1IL8A 1I50B 3NWTA 2K14A 2M00A 4RB0A 2XIWA 4J0MA 2UVUA 4DV1L 2R7FA 4A3MB 1Z9FA 2E76C 2PMZE 4DR3L 4KN4C 3E5SA 4YWKA 3MFYA 4IAJA 2BA0A 3H94A 1MI2A 5K36G 1SSOA 2R92A 4POGA 3R5HA 3VYUA 2AHOB 4KKSA 3KAJA 4Q43A 5L9XA 1RKNA 4B3MQ 3F2DA 4DR5L 4JOIA 2BQ3A 5C4XH 3GV3A 2WKDA 2L0CA 3K6OA 1L1OB 4E4TA 4O4LF 1YNND 1RL2A 3PMFA 2D62A 2Q8IB 3PF5A 4F7XA 1WR2A 4DL2A 1U4PA 2FK3A 2W8LA 1EYDA 2KVMA 3GTMA 1VQ8A 1PH8A 1D5XC 2AQ2B 4C3HG 3G48A 4DKAC 2IMWP 5M3FH 4MAMA 4Q0YA 1ENCA 2DN8A 1RJQA 3CCJA 3RV4A 4BS9A 4H02A 4ZAIA 3K5MA 1H9RA 1YNNC 2NN6H 5KNDA 4DR6Q 3GILA 1JOQA 3GTQA 5JOBA 4FDBA 1X9NA 1O7ZA 2F0VA 1U4RA 5M5XH 1VKZA 3A0JA 1QJOA 2HVQA 5KFDA 1KDAA 3GIMA 1XX8A 1LT5D 4IO9A 1M90C 1QWYA 1EZ8A 1TWCA 4RAYA 2K01A 1HQMC 4AQYQ 4KY5A 1R9TB 2JEIA 3MFHA 5FLMG 4MIUA 1QG7A 3KF8B 2O5JC 2R93H 3OTOL 1AE2A 2UUAQ 3MJFA 1EUDB 2NVYB 4P75A 4LH7A 4YJ3F 1KNAA 2PPBC 2IJ0A 5EBDA 3CXCA 1G291 1LTID 2XIGA 4R9WA 2UVVA 1S5BD 4TQRA 4F4YA 5M3MH 4JBMA 4UP7A 4XYQA 1Q8IA 5JVG3 1IBKH 5HURA 4A3KB 4A3EH 2I0QA 4JI7L 2JA8G 1GYFA 1AW7A 4ZKBB 4GKJH 1FJGL 3S1MH 1MSHA 1ML0D 2F0QA 4EG0A 1I4XA 1T9HA 4Q8FA 5JJZA 5KFRA 3KLWA 2WYOA 4TQSA 5I9OA 4Q5VA 1VQPA 4DV0H 1N8RC 4KHPL 2PQAB 1PRTB 2NUCA 3HOWB 5KG4A 3AEVA 2VUMA 5KFEA 3CC2A 3CCMA 3A74A 1ENFA 2QILA 5T1GA 3UI2A 3Q0AA 2JA5A 2RDGA 1K8MA 3H6MA 3LX0A 4KJNA 5EPKA 3TP7A 5C5MA 5ELDA 5I2YA 1LLRD 1Y1WH 3HOXH 2Q2TA 1DZ1A 4A3IB 4C3HB 4WORA 3U4ZA 1VQEA 1D5MC 3KHRA 1YNXA 3HXLA 3KFUA 3RTXA 5K2MA 3VA7A 3AFPA 3C2PA 3EVQA 2E5LH 3K3VA 1JORA 3L2PA 3HOVG 2FMAA 4IUQA 1H9MA 2WAQB 2IWHA 5KFWA 3JRWA 1I7NA 5JH7F 3MWDA 4UCTA 3J80c 2VXWA 4B3ML 3C1FA 1B4OA 1W6JA 4ZOLF 3PW4A 3T16A 1E4EA 1PRTF 5KG3A 1DGSA 1NE3A 3VMMA 1GUOA 1TIID 1RJRA 4Q0FA 1J6QA 5C0XJ 3N6XA 2E2JB 2R6GA 3I4MB 3P75A 1YNJD 5TSSA 1IW7D 4YP3A 1EY5A 1PFMA 3PIP3 1A8VA 1PTOH 4A2AA 1A3UA 1FJGH 3O13A 2DJGC 4R4IA 4JI4L 1SFOA 5E7NA 3KJPA 1JDBB 1DV1A 2D0OA 4OL7A 4ZRZA 5JVLA 3R3OA 1YVCA 4HR7B 4LW1A 3RJ0A 4DR6L 3T53B 2JN4A 5EJWA 2KCCA 4CJ2C 4JV5Q 1MZBA 4DPGA 4LF8H 1Z6HA 1YNJC 3KUPA 1IW7C 1LO5D 2ZTCA 5C4XG 5KT5A 3ULPA 3S15B 5FD5A 4YCUA 2JYOA 4R4CA 3M9NB 4JG2A 1EYCA
chains in the Genus database with same CATH topology
3GTPH 5GROA 3CW2C 1CSPA 4O2DA 2UUAL 1IXRA 5GAHC 4LUOA 2N3SA 1PVOA 4A3IG 4A3LH 1B70B 1V43A 3RLOA 3GTJH 1HZCA 4YHHQ 1WI5A 2RHSB 4PZ8A 1PH3A 1YHQA 4BXXG 4JI4Q 2B3GA 2R92G 3K7UC 4OX9L 4DK6C 2C35B 1PH4A 3F8TA 1M1KC 1IBKQ 1VQLA 4OXPA 2UUCQ 3M4OH 5C4JH 1XNRL 1TWAH 3M4PA 1J5EL 1P16A 2K52A 4DR7Q 3HKZE 3EIVA 1EIYB 4A3CH 2WAQG 4HIDA 4LF7L 2A8VA 3K81C 3G71A 4IOCA 2E5LL 1W3SA 2Q2HA 1X3GA 1E24A 2F3IA 4IPDA 4DV0Q 2LXJA 3AYHB 1HJPA 2K50A 1XPUA 1HNWQ 4B3SL 3PSIA 3Q8DA 5C44H 1GM5A 2UXDQ 3H0GG 3ICEA 3D0FA 3W1GA 3I4MG 4NXNQ 3U58A 4GN5A 3K0XA 4HJ8A 4P72A 1I3QH 4OX9Q 4A3BH 2B29A 4C3JH 5M5YH 1EQRA 2Z0SA 4BA2I 4YWMA 1C9OA 1KRTA 1XNRQ 4C3IH 3S2HH 2ATWA 3RZOH 4BBSH 4OO1G 4A4IA 3NEMA 1PYBA 1PV4A 4BBRH 4LF7Q 3HOUG 2E5LQ 1LUZA 2OQ0A 5FLMH 2F4VQ 1SMXA 1Q8KA 4R4TA 2NN6I 4GOPB 1QUQA 5LMNW 1Q81C 1XNQL 2ID0A 1I50H 3UDIA 1HZAA 4ME3A 4QL5A 4LF8L 5IP9G 2ES2A 3T1YQ 4B3SQ 1PH2A 2ASBA 4A3MH 3CCRA 1KQSA 4JI6Q 2XTIA 1TWFH 1CUKA 1HR0Q 4HIKA 1Q12A 3E9IA 3JAMi 2JA8H 2UUBL 2YYZA 4RMFA 1BBUA 1GVPA 3CP0A 3F2CA 1N34L 3GDEA 1Y1WG 2NVXH 2UXCL 4NXML 1Y14B 3SGIA 1NY4A 1QVCA 1TWCH 1BKBA 2YTYA 1UE1A 1Q1BA 4R4QA 4A3GH 3S1QH 4YY3Q 4QQBX 3HKSA 1MJCA 1EFWA 1N36Q 2AKWB 1NMFA 2YV5A 1HZ9A 2HQLA 1WJJA 2MO0A 1YBYA 1UE6A 2A1AA 2JK8A 3RLNA 5IYBG 4XIGS 4JBWA 1XNQQ 5FJ8G 2VUMG 1KHIA 4O0AA 5C0XG 1AH9A 1X3FA 2R7ZH 1A63A 3FP9A 4IJLA 4LF8Q 3U50C 1MKHA 1K3RA 1X56A 1YJ9A 3CPFA 4NB3A 3GTLH 4DUZQ 4B3RQ 3M3YH 1XPRA 1VQMA 3W5OA 1JT8A 1VS0A 4J15A 2IX1A 3J7A5 1Q1EA 2UUBQ 1N34Q 2KHIA 1XMQL 4OWWB 4DUYL 4NXMQ 1HNXL 3PF4A 4KHZA 2L15A 4OWTB 1K8AC 2HIVA 1UE7A 1PH6A 2UXBL 1OXSC 4X64L 4A93G 1NMGA 3PO3H 2CFMA 4IFDI 4BY1G 4JI2Q 2I5HA 2OCEA 4DV3Q 4HJ5A 3K8AA 2NZOA 3CAMA 4YWLA 1LYLA 5HGQA 4DAYB 4YHHL 3HOVH 4PZ7A 1YJWA 5GQOA 4DK3C 1S3OA 1R9TH 2UUCL 1KC8C 4BY7H 2E8GA 5IYDG 1UEBA 2CCZA 1I5FA 1N33L 2AMCB 1TWGH 1X55A 1NBWA 2NVYH 1S40A 4JI3Q 4JI8L 4DR7L 2CWAA 1IBLQ 1BBWA 4UP8A 4APVA 1V9PA 5ELNA 5EAYA 4LNQA 1A62A 1EOVA 3H3VI 1L1OC 1VQDA 2AWNA 3PCOB 3TQYA 1EYGA 1OXTA 1VCIA 3M4QA 1WYDA 4PZ6A 5JEAJ 4P73A 1VQKA 4GKKL 1KIXA 1YITA 1YJNA 1XMQQ 5C0XI 4A3KH 1HNXQ 4R1JA 2EQSA 3I4NG 3GO5A 1HNWL 2HT1A 3PUXA 5IYCH 3KYHC 4X64Q 1KD1C 1VQ4A 2UXDL 1SN8A 1GO3E 3KF6A 1C7YA 2DUDA 2ZJQA 2K5NA 1UE5A 4JI5Q 3HFZB 4NXNL 5M3FG 2JA6H 3DLLA 1L2FA 3UE1A 2NVQH 1Q82C 4LF9Q 1G51A 2QA4A 4AYBE 5IWAQ 2K75A 4QIWE 1E3PA 4DV2Q 2NN6G 3FKIG 3PIOA 4GNXC 2LXKA 1VQ5A 2RHQB 3HOWH 2IY5B 1N33Q 5IT9c 4JI8Q 5IP7H 3T1HQ 1QUQB 4TVAB 3PO2H 2D0PA 4L5SA 5DLQE 1KL9A 5J3BA 3TEHB 2F4VL 1I6HH 2IHFA 4GKKQ 4MNOA 4A3IH 4X65L 4A76A 4GLXA 2UU9L 1QZGA 1WCMG 4C3HH 3GTOH 3D31A 4DR3Q 3S16H 2R93G 2KCTA 3T1YL 1VQ7A 4DV7L 4JI0Q 4BXXH 3BZKA 2R92H 4JI6L 1VQHA 4RG1A 1K8GA 1S72A 1HR0L 2IHEA 1D8LA 5M3MG 3CCSA 3ERSX 3CCEA 1N9WA 4IJHA 1G6PA 2FXQA 3HKZG 1C0AA 3M7NA 3ULLA 4A3EG 3NBHB 3HOZH 2GVBA 3TS2A 3RLFA 4JYAL 4YY3L 3S24A 3GTMH 2VW9A 1N36L 1N32Q 2OQKA 4LFAL 1JB7A 3TRZA 3AFQA 2WB1E 1KRSA 4TQUS 1NJIC 4HIOA 2MQHA 1VQJA 1L1OA 3CC4A 2VQEQ 1IZ6A 3I7FA 2N49A 3H0GH 1D7QA 3RZDH 4X65Q 2UU9Q 4Y52H 1EUJA 2E2JH 3I4MH 3L0OA 4YCVA 4A75A 2CKZB 2GN5A 4DV7Q 1Q7YC 3ER0A 3E9HA 5GADC 3GTKH 3HOYG 4IFDG 2OWOA 4JI1Q 4DUZL 4B3RL 3GTQH 4LF4L 4LFCL 1H95A 1Q86C 4EX5A 3EN2A 5JJKA 1QVFA 4HJAA 4WJ3M 1YZ6A 5C3EG 1MJEA 4DAMA 2CQOA 3OW2A 3HOXG 1IYJB 4HIMA 1JJ2A 2JJQA 1E22A 4QGUA 3BJUA 3CD6A 1JMCA 3HOUH 3CCVA 2KBNA 2VS1A 2KCMA 4GNXA 2DGYA 1XPOA 4DV3L 4JI2L 4JYAQ 3PUVA 1SROA 2VQFQ 1QZHA 3S15H 1XMOQ 1K0RA 1FVIA 5ELOA 4LFAQ 4JOIC 3UDGA 5IP9H 3OTOQ 4DR2Q 1XJVA 1GD7A 1Y1VG 1OXUA 2MO1A 2Y0SE 2OTLA 1IL2A 1VQGA 3AQQA 1A0IA 4JI3L 2ZM6L 4DR1L 1GKHA 1XTDA 2HIXA 2YTVA 3A5ZB 1IBLL 4DR4L 1YIJA 4EQ5A 2VY3A 3RR5A 3JAMc 3RN2A 2IT1A 1VQCA 3LGJA 4JI7Q 2CWPA 2WFWA 4LF4Q 3J7ZC 4LFCQ 1HNZL 3KF6B 4LF6Q 3S2DH 1SLJA 4C2MH 1HZBA 3H15A 4KI0A 5JJIA 2JA9A 3NENA 5AJ3Q 4NPSA 1U0LA 4LWCA 3CCUA 1CKMA 3G6EA 3RNUA 2JEBI 5IYBH 1PA6A 2PNHA 5FLXc 1PH7A 1K9MC 2Q2IA 4QY7A 1O7IA 4JI5L 3CQZH 5M5WH 3KOJA 5FJ8H 4ALPA 4A3JG 2VUMH 4KLKA 3I55A 2YU9H 4QJFA 1Z47A 5JEAG 3UDFA 4KHPQ 4LF9L 1HR0W 3MXNB 2B63G 5IWAL 4UPAA 2ZTDA 4DV2L 3CC7A 2K4KA 4AIMA 4PMWA 4X62L 1PH1A 1PH9A 2JA5H 4L5RC 4DR1Q 1SR3A 2ZM6Q 1RIPA 3PUWA 4GLVB 1SRUA 2PQAA 3T1HL 2JA7H 4DR4Q 1E7ZA 2EXDA 4P71A 1UWVA 1U5KA 3F2BA 1W2BA 1E1TA 3PUZA 4BA1I 3M85A 3K7AH 4LF5Q 1HNZQ 2K14A 2NZHA 4A93H 3K80C 4A3DG 1PYSB 2RCNA 4DV1L 4BY1H 3UE0A 2R7FA 4A3FG 1ASZA 4GLAC 1Z9FA 1X3EA 4DR3L 2PMZE 3L7ZC 5LMNL 4YWKA 4YCWA 4JI0L 1JE5A 4LUZA 5H1SE 4Y7NH 4A3LG 2BA0A 5GAGC 1CKOA 5IYDH 2GVAA 1QVGA 5K36G 2UXBQ 3BU2A 4POGA 4L5TA 2AHOB 2IX0A 4P74A 4B3MQ 3F2DA 3I4OA 4GN4B 4DR5L 4JOIA 5C4XH 2HHHQ 4X62Q 5BR8Q 1V1QA 4LFBL 1L1OB 1PFSA 4A3CG 1RL2A 2D62A 4JCVE 2WAQE 3I56A 4DV4L 3PF5A 3UDXA 4AQYL 3PO2G 4K0KL 1N32L 1YHBA 1ASYA 1KAWA 3I4NH 1VQ8A 1PH8A 5IY0A 2MNAA 1CSQA 2VQEL 2N78A 3F1ZA 4DV1Q 3S1NH 4DKAC 3G48A 1SFOH 3BZCA 4GN3B 4IOAA 2VZAA 5LMNQ 5M3FH 4B3TL 2K5VA 5C44G 4AH6A 3CCJA 4IPCA 2MFIA 4AYBG 3CMEA 2E2HH 4H02A 4JI1L 4DR6Q 3FKIH 4GKJQ 2LSSA 2JQOA 1I94Q 5JJLA 3PGZA 1OXXK 4LUVA 4GNXB 4A3BG 1X9NA 4FDBA 5M5XH 4DNIA 4DR5Q 3A0JA 1WOCA 2BH8A 1JJCB 3GD7A 3CF5A 3KDFA 3CMAA 4DV6L 3TS0A 3HOZG 2BH2A 1JJGA 1YEZA 4BBSG 4LFBQ 2KENA 4HJ7A 4IO9A 1M90C 1L0WA 4IPHA 4BBRG 2F52A 2QEXA 2VQFL 4DV4Q 4AQYQ 1CKNA 1XMOL 1IBML 1VQ9A 1LTLA 1WCMH 4POFA 5FLMG 4GOPC 2YTXA 3KF8B 2R93H 1E1OA 3OTOL 1AE2A 4DR2L 1K83H 2UUAQ 4P75A 3EBEA 2R7DA 3CXCA 1HH2P 3OYYA 1G291 4GS3A 3DM3A 4B3TQ 1EWIA 1TXYA 1X65A 4A3MG 5M3MH 4JBMA 3PUYA 3MEFA 4UP7A 2E2IH 3B6YA 1X54A 1VQOA 2I0QA 1BVSA 4A3EH 4JI7L 4JC0A 3G4SA 2JA8G 1J5EQ 4LF6L 3CCLA 1FJGL 3U4VA 3S1MH 2WP8J 4JBJA 2BA1A 3J81i 3A5UA 2EIFA 5AJ3L 4XTCS 2RF4A 3J81j 3CCQA 4DV6Q 2WB1G 3TREA 1SE8A 1VQAA 1T9HA 4X66L 3VDYA 4A3GG 3KJOA 3KLWA 3WWVA 1TWHH 2ALYB 1VQPA 1IBMQ 1N8RC 2JEAI 4KHPL 2PQAB 3S1RH 2Z6KC 4K0KQ 3AEVA 3W1BA 1X6OA 3CC2A 2ZTEA 3E0EA 3J80i 3CCMA 3HOYH 4HJ9A 2R7ZG 3A74A 2QGQA 1VQBA 3ZJYC 1B7YB 4DUYQ 5C3EH 1Y1WH 1PH5A 3HOXH 2Q2TA 3ULJA 3PV0A 4LF5L 4X6AH 1AE3A 3U4ZA 2PI2A 1VQEA 2A19A 3J81c 5LMUL 2Q2UA 2V1CC 1FJGQ 1FGUA 3NELA 1OTCA 4IFDJ 1YNXA 2K5HA 2PI2E 5IE8A 3KFUA 3H3VH 1NTGA 3PO3G 3CPWA 3M9BA 1B8AA 3AFPA 4X66Q 3L2PA 1Y1VH 4UP9A 3JC66 3HOVG 2Y0SG 4OO1I 4IPGA 4OONA 1VQFA 3STBD 3J80c 4B3ML 4BY7G 4JV5L 2KHJA 4GOPA 2NVTH 4MZ9A 2HHHL 2I5LX 2JA5G 1Q46A 5BR8L 4DV5L 3IRBA 4JBKA 1P8LA 1VQIA 2JA7G 2XGTA 3S14H 5GAEC 2UXCQ 4UY8C 1KXLA 1DGSA 1NE3A 4OWXB 1J6QA 1FL0A 1EQQA 5C0XJ 3S17H 2ZJRA 3GTGH 2R6GA 2H5XA 5LMUQ 2N8NA 3FHWA 4A3KG 2I5MX 1A8VA 3STBC 1YHAA 4L5QA 4A3JH 2VNUD 4R4IA 1LM0A 3RN5A 5IYCG 3PIPA 4JI4L 1WFQA 5E7NA 3KJPA 1IBKL 2D0OA 2B63H 1YVCA 4LW1A 2AWOA 1YI2A 4R4OA 3KDFB 1PHJA 1VQNA 4DR6L 2JA6G 4GKJL 1I94L 3I2ZA 1MIUA 2OTJA 4MTNA 2JE6I 5HY6A 4DPGA 1CKNB 4PG3A 1VQ6A 4JV5Q 5C4XG 2ZTCA 1K73C 2Z6KA 1EIFA 3HOWG 3ULPA 1OXVA 5IP7G 4DV5Q 4YCUA 2VL6A 4DV0L 4WJ4A 4R4CA 2ZJPA 4A3DH 4JG2A 4A3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTP H;  5GRO A;  3CW2 C;  1CSP A;  4O2D A;  2UUA L;  1IXR A;  5GAH C;  4LUO A;  2N3S A;  1PVO A;  4A3I G;  4A3L H;  1B70 B;  1V43 A;  3RLO A;  3GTJ H;  1HZC A;  4YHH Q;  1WI5 A;  2RHS B;  4PZ8 A;  1PH3 A;  1YHQ A;  4BXX G;  4JI4 Q;  2B3G A;  2R92 G;  3K7U C;  4OX9 L;  4DK6 C;  2C35 B;  1PH4 A;  3F8T A;  1M1K C;  1IBK Q;  1VQL A;  4OXP A;  2UUC Q;  3M4O H;  5C4J H;  1XNR L;  1TWA H;  3M4P A;  1J5E L;  1P16 A;  2K52 A;  4DR7 Q;  3HKZ E;  3EIV A;  1EIY B;  4A3C H;  2WAQ G;  4HID A;  4LF7 L;  2A8V A;  3K81 C;  3G71 A;  4IOC A;  2E5L L;  1W3S A;  2Q2H A;  1X3G A;  1E24 A;  2F3I A;  4IPD A;  4DV0 Q;  2LXJ A;  3AYH B;  1HJP A;  2K50 A;  1XPU A;  1HNW Q;  4B3S L;  3PSI A;  3Q8D A;  5C44 H;  1GM5 A;  2UXD Q;  3H0G G;  3ICE A;  3D0F A;  3W1G A;  3I4M G;  4NXN Q;  3U58 A;  4GN5 A;  3K0X A;  4HJ8 A;  4P72 A;  1I3Q H;  4OX9 Q;  4A3B H;  2B29 A;  4C3J H;  5M5Y H;  1EQR A;  2Z0S A;  4BA2 I;  4YWM A;  1C9O A;  1KRT A;  1XNR Q;  4C3I H;  3S2H H;  2ATW A;  3RZO H;  4BBS H;  4OO1 G;  4A4I A;  3NEM A;  1PYB A;  1PV4 A;  4BBR H;  4LF7 Q;  3HOU G;  2E5L Q;  1LUZ A;  2OQ0 A;  5FLM H;  2F4V Q;  1SMX A;  1Q8K A;  4R4T A;  2NN6 I;  4GOP B;  1QUQ A;  5LMN W;  1Q81 C;  1XNQ L;  2ID0 A;  1I50 H;  3UDI A;  1HZA A;  4ME3 A;  4QL5 A;  4LF8 L;  5IP9 G;  2ES2 A;  3T1Y Q;  4B3S Q;  1PH2 A;  2ASB A;  4A3M H;  3CCR A;  1KQS A;  4JI6 Q;  2XTI A;  1TWF H;  1CUK A;  1HR0 Q;  4HIK A;  1Q12 A;  3E9I A;  3JAM i;  2JA8 H;  2UUB L;  2YYZ A;  4RMF A;  1BBU A;  1GVP A;  3CP0 A;  3F2C A;  1N34 L;  3GDE A;  1Y1W G;  2NVX H;  2UXC L;  4NXM L;  1Y14 B;  3SGI A;  1NY4 A;  1QVC A;  1TWC H;  1BKB A;  2YTY A;  1UE1 A;  1Q1B A;  4R4Q A;  4A3G H;  3S1Q H;  4YY3 Q;  4QQB X;  3HKS A;  1MJC A;  1EFW A;  1N36 Q;  2AKW B;  1NMF A;  2YV5 A;  1HZ9 A;  2HQL A;  1WJJ A;  2MO0 A;  1YBY A;  1UE6 A;  2A1A A;  2JK8 A;  3RLN A;  5IYB G;  4XIG S;  4JBW A;  1XNQ Q;  5FJ8 G;  2VUM G;  1KHI A;  4O0A A;  5C0X G;  1AH9 A;  1X3F A;  2R7Z H;  1A63 A;  3FP9 A;  4IJL A;  4LF8 Q;  3U50 C;  1MKH A;  1K3R A;  1X56 A;  1YJ9 A;  3CPF A;  4NB3 A;  3GTL H;  4DUZ Q;  4B3R Q;  3M3Y H;  1XPR A;  1VQM A;  3W5O A;  1JT8 A;  1VS0 A;  4J15 A;  2IX1 A;  3J7A 5;  1Q1E A;  2UUB Q;  1N34 Q;  2KHI A;  1XMQ L;  4OWW B;  4DUY L;  4NXM Q;  1HNX L;  3PF4 A;  4KHZ A;  2L15 A;  4OWT B;  1K8A C;  2HIV A;  1UE7 A;  1PH6 A;  2UXB L;  1OXS C;  4X64 L;  4A93 G;  1NMG A;  3PO3 H;  2CFM A;  4IFD I;  4BY1 G;  4JI2 Q;  2I5H A;  2OCE A;  4DV3 Q;  4HJ5 A;  3K8A A;  2NZO A;  3CAM A;  4YWL A;  1LYL A;  5HGQ A;  4DAY B;  4YHH L;  3HOV H;  4PZ7 A;  1YJW A;  5GQO A;  4DK3 C;  1S3O A;  1R9T H;  2UUC L;  1KC8 C;  4BY7 H;  2E8G A;  5IYD G;  1UEB A;  2CCZ A;  1I5F A;  1N33 L;  2AMC B;  1TWG H;  1X55 A;  1NBW A;  2NVY H;  1S40 A;  4JI3 Q;  4JI8 L;  4DR7 L;  2CWA A;  1IBL Q;  1BBW A;  4UP8 A;  4APV A;  1V9P A;  5ELN A;  5EAY A;  4LNQ A;  1A62 A;  1EOV A;  3H3V I;  1L1O C;  1VQD A;  2AWN A;  3PCO B;  3TQY A;  1EYG A;  1OXT A;  1VCI A;  3M4Q A;  1WYD A;  4PZ6 A;  5JEA J;  4P73 A;  1VQK A;  4GKK L;  1KIX A;  1YIT A;  1YJN A;  1XMQ Q;  5C0X I;  4A3K H;  1HNX Q;  4R1J A;  2EQS A;  3I4N G;  3GO5 A;  1HNW L;  2HT1 A;  3PUX A;  5IYC H;  3KYH C;  4X64 Q;  1KD1 C;  1VQ4 A;  2UXD L;  1SN8 A;  1GO3 E;  3KF6 A;  1C7Y A;  2DUD A;  2ZJQ A;  2K5N A;  1UE5 A;  4JI5 Q;  3HFZ B;  4NXN L;  5M3F G;  2JA6 H;  3DLL A;  1L2F A;  3UE1 A;  2NVQ H;  1Q82 C;  4LF9 Q;  1G51 A;  2QA4 A;  4AYB E;  5IWA Q;  2K75 A;  4QIW E;  1E3P A;  4DV2 Q;  2NN6 G;  3FKI G;  3PIO A;  4GNX C;  2LXK A;  1VQ5 A;  2RHQ B;  3HOW H;  2IY5 B;  1N33 Q;  5IT9 c;  4JI8 Q;  5IP7 H;  3T1H Q;  1QUQ B;  4TVA B;  3PO2 H;  2D0P A;  4L5S A;  5DLQ E;  1KL9 A;  5J3B A;  3TEH B;  2F4V L;  1I6H H;  2IHF A;  4GKK Q;  4MNO A;  4A3I H;  4X65 L;  4A76 A;  4GLX A;  2UU9 L;  1QZG A;  1WCM G;  4C3H H;  3GTO H;  3D31 A;  4DR3 Q;  3S16 H;  2R93 G;  2KCT A;  3T1Y L;  1VQ7 A;  4DV7 L;  4JI0 Q;  4BXX H;  3BZK A;  2R92 H;  4JI6 L;  1VQH A;  4RG1 A;  1K8G A;  1S72 A;  1HR0 L;  2IHE A;  1D8L A;  5M3M G;  3CCS A;  3ERS X;  3CCE A;  1N9W A;  4IJH A;  1G6P A;  2FXQ A;  3HKZ G;  1C0A A;  3M7N A;  3ULL A;  4A3E G;  3NBH B;  3HOZ H;  2GVB A;  3TS2 A;  3RLF A;  4JYA L;  4YY3 L;  3S24 A;  3GTM H;  2VW9 A;  1N36 L;  1N32 Q;  2OQK A;  4LFA L;  1JB7 A;  3TRZ A;  3AFQ A;  2WB1 E;  1KRS A;  4TQU S;  1NJI C;  4HIO A;  2MQH A;  1VQJ A;  1L1O A;  3CC4 A;  2VQE Q;  1IZ6 A;  3I7F A;  2N49 A;  3H0G H;  1D7Q A;  3RZD H;  4X65 Q;  2UU9 Q;  4Y52 H;  1EUJ A;  2E2J H;  3I4M H;  3L0O A;  4YCV A;  4A75 A;  2CKZ B;  2GN5 A;  4DV7 Q;  1Q7Y C;  3ER0 A;  3E9H A;  5GAD C;  3GTK H;  3HOY G;  4IFD G;  2OWO A;  4JI1 Q;  4DUZ L;  4B3R L;  3GTQ H;  4LF4 L;  4LFC L;  1H95 A;  1Q86 C;  4EX5 A;  3EN2 A;  5JJK A;  1QVF A;  4HJA A;  4WJ3 M;  1YZ6 A;  5C3E G;  1MJE A;  4DAM A;  2CQO A;  3OW2 A;  3HOX G;  1IYJ B;  4HIM A;  1JJ2 A;  2JJQ A;  1E22 A;  4QGU A;  3BJU A;  3CD6 A;  1JMC A;  3HOU H;  3CCV A;  2KBN A;  2VS1 A;  2KCM A;  4GNX A;  2DGY A;  1XPO A;  4DV3 L;  4JI2 L;  4JYA Q;  3PUV A;  1SRO A;  2VQF Q;  1QZH A;  3S15 H;  1XMO Q;  1K0R A;  1FVI A;  5ELO A;  4LFA Q;  4JOI C;  3UDG A;  5IP9 H;  3OTO Q;  4DR2 Q;  1XJV A;  1GD7 A;  1Y1V G;  1OXU A;  2MO1 A;  2Y0S E;  2OTL A;  1IL2 A;  1VQG A;  3AQQ A;  1A0I A;  4JI3 L;  2ZM6 L;  4DR1 L;  1GKH A;  1XTD A;  2HIX A;  2YTV A;  3A5Z B;  1IBL L;  4DR4 L;  1YIJ A;  4EQ5 A;  2VY3 A;  3RR5 A;  3JAM c;  3RN2 A;  2IT1 A;  1VQC A;  3LGJ A;  4JI7 Q;  2CWP A;  2WFW A;  4LF4 Q;  3J7Z C;  4LFC Q;  1HNZ L;  3KF6 B;  4LF6 Q;  3S2D H;  1SLJ A;  4C2M H;  1HZB A;  3H15 A;  4KI0 A;  5JJI A;  2JA9 A;  3NEN A;  5AJ3 Q;  4NPS A;  1U0L A;  4LWC A;  3CCU A;  1CKM A;  3G6E A;  3RNU A;  2JEB I;  5IYB H;  1PA6 A;  2PNH A;  5FLX c;  1PH7 A;  1K9M C;  2Q2I A;  4QY7 A;  1O7I A;  4JI5 L;  3CQZ H;  5M5W H;  3KOJ A;  5FJ8 H;  4ALP A;  4A3J G;  2VUM H;  4KLK A;  3I55 A;  2YU9 H;  4QJF A;  1Z47 A;  5JEA G;  3UDF A;  4KHP Q;  4LF9 L;  1HR0 W;  3MXN B;  2B63 G;  5IWA L;  4UPA A;  2ZTD A;  4DV2 L;  3CC7 A;  2K4K A;  4AIM A;  4PMW A;  4X62 L;  1PH1 A;  1PH9 A;  2JA5 H;  4L5R C;  4DR1 Q;  1SR3 A;  2ZM6 Q;  1RIP A;  3PUW A;  4GLV B;  1SRU A;  2PQA A;  3T1H L;  2JA7 H;  4DR4 Q;  1E7Z A;  2EXD A;  4P71 A;  1UWV A;  1U5K A;  3F2B A;  1W2B A;  1E1T A;  3PUZ A;  4BA1 I;  3M85 A;  3K7A H;  4LF5 Q;  1HNZ Q;  2K14 A;  2NZH A;  4A93 H;  3K80 C;  4A3D G;  1PYS B;  2RCN A;  4DV1 L;  4BY1 H;  3UE0 A;  2R7F A;  4A3F G;  1ASZ A;  4GLA C;  1Z9F A;  1X3E A;  4DR3 L;  2PMZ E;  3L7Z C;  5LMN L;  4YWK A;  4YCW A;  4JI0 L;  1JE5 A;  4LUZ A;  5H1S E;  4Y7N H;  4A3L G;  2BA0 A;  5GAG C;  1CKO A;  5IYD H;  2GVA A;  1QVG A;  5K36 G;  2UXB Q;  3BU2 A;  4POG A;  4L5T A;  2AHO B;  2IX0 A;  4P74 A;  4B3M Q;  3F2D A;  3I4O A;  4GN4 B;  4DR5 L;  4JOI A;  5C4X H;  2HHH Q;  4X62 Q;  5BR8 Q;  1V1Q A;  4LFB L;  1L1O B;  1PFS A;  4A3C G;  1RL2 A;  2D62 A;  4JCV E;  2WAQ E;  3I56 A;  4DV4 L;  3PF5 A;  3UDX A;  4AQY L;  3PO2 G;  4K0K L;  1N32 L;  1YHB A;  1ASY A;  1KAW A;  3I4N H;  1VQ8 A;  1PH8 A;  5IY0 A;  2MNA A;  1CSQ A;  2VQE L;  2N78 A;  3F1Z A;  4DV1 Q;  3S1N H;  4DKA C;  3G48 A;  1SFO H;  3BZC A;  4GN3 B;  4IOA A;  2VZA A;  5LMN Q;  5M3F H;  4B3T L;  2K5V A;  5C44 G;  4AH6 A;  3CCJ A;  4IPC A;  2MFI A;  4AYB G;  3CME A;  2E2H H;  4H02 A;  4JI1 L;  4DR6 Q;  3FKI H;  4GKJ Q;  2LSS A;  2JQO A;  1I94 Q;  5JJL A;  3PGZ A;  1OXX K;  4LUV A;  4GNX B;  4A3B G;  1X9N A;  4FDB A;  5M5X H;  4DNI A;  4DR5 Q;  3A0J A;  1WOC A;  2BH8 A;  1JJC B;  3GD7 A;  3CF5 A;  3KDF A;  3CMA A;  4DV6 L;  3TS0 A;  3HOZ G;  2BH2 A;  1JJG A;  1YEZ A;  4BBS G;  4LFB Q;  2KEN A;  4HJ7 A;  4IO9 A;  1M90 C;  1L0W A;  4IPH A;  4BBR G;  2F52 A;  2QEX A;  2VQF L;  4DV4 Q;  4AQY Q;  1CKN A;  1XMO L;  1IBM L;  1VQ9 A;  1LTL A;  1WCM H;  4POF A;  5FLM G;  4GOP C;  2YTX A;  3KF8 B;  2R93 H;  1E1O A;  3OTO L;  1AE2 A;  4DR2 L;  1K83 H;  2UUA Q;  4P75 A;  3EBE A;  2R7D A;  3CXC A;  1HH2 P;  3OYY A;  1G29 1;  4GS3 A;  3DM3 A;  4B3T Q;  1EWI A;  1TXY A;  1X65 A;  4A3M G;  5M3M H;  4JBM A;  3PUY A;  3MEF A;  4UP7 A;  2E2I H;  3B6Y A;  1X54 A;  1VQO A;  2I0Q A;  1BVS A;  4A3E H;  4JI7 L;  4JC0 A;  3G4S A;  2JA8 G;  1J5E Q;  4LF6 L;  3CCL A;  1FJG L;  3U4V A;  3S1M H;  2WP8 J;  4JBJ A;  2BA1 A;  3J81 i;  3A5U A;  2EIF A;  5AJ3 L;  4XTC S;  2RF4 A;  3J81 j;  3CCQ A;  4DV6 Q;  2WB1 G;  3TRE A;  1SE8 A;  1VQA A;  1T9H A;  4X66 L;  3VDY A;  4A3G G;  3KJO A;  3KLW A;  3WWV A;  1TWH H;  2ALY B;  1VQP A;  1IBM Q;  1N8R C;  2JEA I;  4KHP L;  2PQA B;  3S1R H;  2Z6K C;  4K0K Q;  3AEV A;  3W1B A;  1X6O A;  3CC2 A;  2ZTE A;  3E0E A;  3J80 i;  3CCM A;  3HOY H;  4HJ9 A;  2R7Z G;  3A74 A;  2QGQ A;  1VQB A;  3ZJY C;  1B7Y B;  4DUY Q;  5C3E H;  1Y1W H;  1PH5 A;  3HOX H;  2Q2T A;  3ULJ A;  3PV0 A;  4LF5 L;  4X6A H;  1AE3 A;  3U4Z A;  2PI2 A;  1VQE A;  2A19 A;  3J81 c;  5LMU L;  2Q2U A;  2V1C C;  1FJG Q;  1FGU A;  3NEL A;  1OTC A;  4IFD J;  1YNX A;  2K5H A;  2PI2 E;  5IE8 A;  3KFU A;  3H3V H;  1NTG A;  3PO3 G;  3CPW A;  3M9B A;  1B8A A;  3AFP A;  4X66 Q;  3L2P A;  1Y1V H;  4UP9 A;  3JC6 6;  3HOV G;  2Y0S G;  4OO1 I;  4IPG A;  4OON A;  1VQF A;  3STB D;  3J80 c;  4B3M L;  4BY7 G;  4JV5 L;  2KHJ A;  4GOP A;  2NVT H;  4MZ9 A;  2HHH L;  2I5L X;  2JA5 G;  1Q46 A;  5BR8 L;  4DV5 L;  3IRB A;  4JBK A;  1P8L A;  1VQI A;  2JA7 G;  2XGT A;  3S14 H;  5GAE C;  2UXC Q;  4UY8 C;  1KXL A;  1DGS A;  1NE3 A;  4OWX B;  1J6Q A;  1FL0 A;  1EQQ A;  5C0X J;  3S17 H;  2ZJR A;  3GTG H;  2R6G A;  2H5X A;  5LMU Q;  2N8N A;  3FHW A;  4A3K G;  2I5M X;  1A8V A;  3STB C;  1YHA A;  4L5Q A;  4A3J H;  2VNU D;  4R4I A;  1LM0 A;  3RN5 A;  5IYC G;  3PIP A;  4JI4 L;  1WFQ A;  5E7N A;  3KJP A;  1IBK L;  2D0O A;  2B63 H;  1YVC A;  4LW1 A;  2AWO A;  1YI2 A;  4R4O A;  3KDF B;  1PHJ A;  1VQN A;  4DR6 L;  2JA6 G;  4GKJ L;  1I94 L;  3I2Z A;  1MIU A;  2OTJ A;  4MTN A;  2JE6 I;  5HY6 A;  4DPG A;  1CKN B;  4PG3 A;  1VQ6 A;  4JV5 Q;  5C4X G;  2ZTC A;  1K73 C;  2Z6K A;  1EIF A;  3HOW G;  3ULP A;  1OXV A;  5IP7 G;  4DV5 Q;  4YCU A;  2VL6 A;  4DV0 L;  4WJ4 A;  4R4C A;  2ZJP A;  4A3D H;  4JG2 A;  4A3F H; 
#chains in the Genus database with same CATH topology
 2UXC H;  5KG6 A;  1EY6 A;  3GTP H;  1GHJ A;  4IUR A;  5GRO A;  4NXM H;  4O2D A;  3MA2 B;  5EPL A;  1IXR A;  5GAH C;  2UUA L;  2EY5 A;  1SND A;  1WCM A;  3OSP A;  3G6Y A;  3JAM W;  2G9H D;  3LWU A;  5KFV A;  3GTJ H;  2R85 A;  1AUX A;  2IX3 A;  3AU7 A;  2R92 G;  3K7U C;  4OX9 L;  3QR8 A;  3VYT A;  3F8T A;  1VQL A;  3S2D B;  2UUC Q;  3OMG A;  4DGZ A;  1XNR L;  1NUC A;  3HKZ A;  2EXZ A;  4C2M B;  2J9G A;  4DAY A;  2E2I A;  4WBN F;  5ISR A;  2V5A A;  4IWY A;  4DL5 A;  2A8V A;  3VPD A;  2F4I A;  3G71 A;  5D65 A;  2RVL A;  4EYI B;  3A8J E;  4LK1 C;  4MA0 A;  5DLF A;  1BNZ A;  1X3G A;  1SNP A;  4B9W A;  3GP7 A;  2WDT A;  3Q2O A;  4ETS A;  2WKC A;  1CQJ B;  1HNW Q;  4UCS A;  1HNX H;  5C44 H;  1E2V A;  3F8N A;  5CAE B;  3D0F A;  4X64 H;  2X6G A;  3U58 A;  1S0M A;  4J9N A;  2FIN B;  1I3Q H;  4YHH H;  3I4L A;  2A69 D;  5D1O B;  5M5Y H;  1ESR A;  4JI4 H;  4BA2 I;  1KRT A;  1S4Z A;  1PYB A;  1PV4 A;  5KFX A;  2J0T D;  3MC0 B;  4JI8 H;  1M7J A;  2IL8 A;  2V58 A;  1SMX A;  2WV6 D;  1Q8K A;  4TV8 F;  4R4T A;  4HTH A;  1SMY C;  2W9C B;  1U4M A;  3K58 A;  2R86 A;  2YS6 A;  2A69 C;  4QL5 A;  4A2B A;  5C4X B;  5IP9 G;  3ETH A;  3KBX A;  1FNV A;  1CUK A;  1L2Z A;  3N40 P;  2UXD H;  1STH A;  4HIK A;  4RMF A;  1N34 L;  3CP0 A;  1FD7 D;  1RCV D;  4PNY A;  1Y1W G;  2NVX H;  2CW8 A;  1TR5 A;  4CKC A;  1Y14 B;  4K8I A;  3HGB A;  1EL0 A;  3V4S A;  1M4V A;  2YTY A;  5M3F B;  1Q1B A;  2I80 A;  1RF2 D;  3C46 A;  5CGK A;  3S1Q H;  4YY3 Q;  4QQB X;  4HNV A;  3L9A X;  1CI3 M;  1CFM A;  2A6H D;  5DQH A;  1N36 Q;  2YV5 A;  5D8D A;  2AGP A;  1WJJ A;  4ED6 A;  3NBH A;  1JR0 D;  1YBY A;  2JK8 A;  3RLN A;  2XGP A;  3G6J B;  2K5D A;  1K1S A;  1XNQ Q;  1LAC A;  2VUM G;  4GC7 A;  5M5X B;  2B63 A;  2R7Z H;  3FP9 A;  1BCP B;  1K3R A;  1MKH A;  2LY7 A;  1YJ9 A;  5KT2 A;  4NB3 A;  4DUZ Q;  4ED2 A;  4QCL A;  3W5O A;  1VS0 A;  2ZDQ A;  1Q1E A;  3V4Z A;  4HSP A;  3ORQ A;  1RHP A;  4DK0 A;  3BVM A;  4DUY L;  3PF4 A;  4ED1 A;  4PWQ A;  3J81 E;  5DGA A;  1OXS C;  4A93 G;  4I55 F;  1NMG A;  1PZK D;  3PO3 H;  5CA1 F;  2I5H A;  4DV3 Q;  5M3M B;  4R8U A;  3E5N A;  2RGV A;  2E74 C;  4ULL A;  3TP8 A;  1O7Y A;  3T4A C;  3WO1 A;  2FK2 A;  1SYD A;  2BQR A;  2EJM A;  4A3E B;  3TME A;  4YAJ B;  1S3O A;  2Q8T A;  2UUC L;  5IYD G;  4RAU C;  5IYZ F;  1UEB A;  3S1M B;  5C6A A;  1I5F A;  2AGQ A;  1N33 L;  2DPJ A;  1IBL Q;  1R4P B;  4UP8 A;  5ELC A;  4APV A;  2M2L A;  1DCZ A;  2QK4 A;  4LNQ A;  1O80 A;  1L1O C;  1VQD A;  3N52 A;  3TQY A;  3H3V C;  2IW3 A;  1VCI A;  2R7N A;  2FLL A;  1WYD A;  3OIQ A;  4Y8V B;  4B3R H;  1VQK A;  3VR2 A;  1S97 A;  3KAL A;  2OH2 A;  4MN3 A;  5C0X I;  3SK8 A;  1Y69 U;  4ID6 A;  3J7A V;  1HNW L;  3JRX A;  4NKL A;  1S9F A;  2EYL A;  3KYH C;  1BUV T;  1KD1 C;  3KF6 A;  1C7Y A;  2JXM B;  2DY7 A;  2YS7 A;  4FP5 D;  4CBV A;  3P7J A;  2DUD A;  4JPB W;  2K5N A;  5FK9 C;  2ZJQ A;  1Y1W B;  4JI2 H;  2EDG A;  2JA6 H;  4AYB A;  3DLL A;  3HOX B;  5J2T F;  2XC9 A;  3W3A A;  3KHG A;  4UAI A;  1O75 A;  3GV5 B;  5I4D A;  3PIO A;  2LXK A;  2WIN B;  4RGO S;  2M05 A;  1EHI A;  5D1P A;  5CBA E;  4K6L A;  1QUQ B;  1TS2 A;  2ZDH A;  5FLX W;  5DGB A;  1NSN S;  2ZM6 H;  3PO2 H;  1UNN C;  1L0X B;  5DLQ E;  5A2Q L;  2W6Q A;  2K1B A;  3TEH B;  4GKK Q;  1LTT D;  1EFI D;  4A76 A;  2GA4 B;  4XX0 B;  1QZG A;  1WCM G;  2J7Z A;  3GTO H;  3OHB A;  4BXX H;  2F0N A;  1I50 A;  3HB9 A;  1VQH A;  3EJI A;  2J6S A;  1HPC A;  2IHE A;  4C5C A;  1SJE D;  1STG A;  1G6P A;  1PRT D;  3HKZ G;  1I4R A;  5F2D A;  1A6X A;  3M7N A;  4LF9 H;  1PTO B;  4O3Q A;  3RIZ A;  2K28 A;  4YY3 L;  3TP5 A;  1N36 L;  3OPO A;  5KFY A;  5JQW A;  5EWF A;  1SEI A;  4TQU S;  2SNM A;  1L1O A;  2VQE Q;  4X65 Q;  1Z7T A;  1PRT C;  2UU9 Q;  4CDF C;  2NU7 B;  4FF1 A;  3L0O A;  4O3O A;  4A75 A;  4IR1 A;  2GN5 A;  1HRJ A;  4ILW A;  3E9H A;  1PFN A;  4JI0 H;  4JI1 Q;  4DUZ L;  3G8C A;  3PZP A;  2RKS A;  1UC9 A;  4LF4 L;  3GTP B;  4WJ3 M;  3MWY W;  1GSA A;  3NTH A;  2CQO A;  3VR3 A;  4DAM A;  1WTQ A;  1JJ2 A;  2JJQ A;  4QGU A;  3HOU H;  3GTJ B;  1UC8 A;  1CHP D;  1WH2 A;  4DV3 L;  4NDX A;  4JYA Q;  2W6O A;  4LFB H;  1D5Z C;  1XMO Q;  1FVI A;  2DIK A;  4LFA Q;  2DPI A;  1PTO F;  3IFD A;  3ITP A;  5JVH 3;  2J6T A;  1GD7 A;  4DL3 A;  4DFA A;  2Y0S E;  3D3R A;  3KK7 A;  1R9T A;  2RGR A;  4DR1 L;  1A0I A;  3KF8 A;  1IBL L;  2YTV A;  3PVX A;  3KXY T;  2ATL A;  3SEB A;  1JLL B;  2NVY A;  1VAJ A;  5KX5 F;  4EQ5 A;  5KKN B;  3L3O C;  1VQC A;  1Q90 A;  3RGX A;  5KEE A;  1BDO A;  4LFC Q;  1HNZ L;  3OSO A;  1GLV A;  3RB4 A;  5M9O A;  5C44 B;  1ICW A;  1TS4 A;  5BPH A;  5AJ3 Q;  2EY2 A;  4NPS A;  2YL2 A;  3UQ8 A;  1WTX A;  1KJ8 A;  4TKO B;  3RNU A;  5IYB H;  3I12 A;  4DV6 H;  5FLX c;  1I3Q B;  1O7I A;  2J4X A;  3CQZ H;  5M5W H;  3KOJ A;  4ALP A;  4A3J G;  5M5Y B;  4RB1 A;  1Y8O B;  4KLK A;  4PQX A;  5CV8 A;  1Z47 A;  3PW5 A;  2VQF H;  1SE4 A;  1HR0 W;  2XD4 A;  1IBM H;  2B63 G;  1LTG D;  3BG5 A;  1XDN A;  2P5Z X;  4X62 L;  5HGT A;  1SR3 A;  1RIP A;  4GLV B;  2PQA A;  3MWE A;  4DR4 Q;  4P71 A;  4K8J A;  3MAQ A;  3BZD B;  2SCU B;  1LTS D;  1EEF D;  3G7L A;  3I8Z A;  1GUS A;  4LF4 H;  4A3F G;  1ASZ A;  4LF6 H;  4GLA C;  1GOZ A;  1X3E A;  5ELB A;  5LMN L;  3L7Z C;  4YCW A;  1IKM A;  1V4Y A;  2FPI B;  4LUZ A;  5IT9 L;  5GAG C;  1CKO A;  2NVX B;  2UXB Q;  3BU2 A;  2NTT A;  4O3S A;  3EFX D;  1CT1 D;  3KTM A;  4X3K A;  4MA5 A;  2A68 C;  2WB1 B;  5EQ0 A;  3I4O A;  4GN4 B;  3S1Q B;  1HTL D;  2QW7 A;  1DYQ A;  1V1Q A;  3NQT A;  1CQI B;  2WAQ A;  4C1N I;  4TV9 F;  4DV4 L;  3I56 A;  3PO2 G;  3DWA A;  4LH6 A;  1KAW A;  2RCF A;  4QWC A;  2V4Q A;  2DLN A;  2K6A A;  5IY0 A;  2R7Z B;  3BDC A;  1CSQ A;  2VQE L;  1S0N A;  3ERO A;  3F1Z A;  1Y8P B;  3M7G A;  3TDQ A;  4DV1 Q;  4IOA A;  1DOL A;  2NYZ D;  3EQL C;  4HMI A;  2SOB A;  4K14 A;  4QUC A;  4B3T L;  4ZUJ A;  2K5V A;  4PMB A;  4AH6 A;  2MFI A;  4AYB G;  5IOC A;  4Z9C B;  4JI1 L;  4J9K A;  1TY2 A;  4O4I F;  1JWM D;  4GKJ Q;  2QDL A;  4U68 A;  4GNX B;  1BXR A;  4A3B G;  4C3J G;  1KJQ A;  5DAU A;  2CH4 W;  3PO3 B;  2FMC A;  4R8N A;  4ECV A;  4DR5 Q;  4HR7 A;  2BH8 A;  2V59 A;  3Q8P B;  4C3I G;  2G9D A;  1JJG A;  4BBS G;  2R7K A;  2ZXR A;  2QF7 A;  3R93 A;  3GID A;  4IPH A;  4BBR G;  4I7A A;  4BWS C;  1XMO L;  1VQ9 A;  3K5N A;  1LTL A;  4RH6 A;  1E1O A;  1K83 H;  2ZXO A;  4RB3 C;  1HH2 P;  3OYY A;  5DG9 A;  1I4H A;  1K3B C;  3TN2 A;  1I7L A;  1H9S B;  4A3M G;  3X3M A;  5EPJ A;  1DOM A;  1ENA A;  2PCF B;  4JC0 A;  2I8C A;  5DQI A;  3CCL A;  1LTR D;  2WP8 J;  3NK9 A;  1ZKO A;  5DG7 A;  5AJ3 L;  3CCQ A;  4C2M A;  2JA6 B;  2N88 A;  1KBL A;  4K2K A;  1ROD A;  1N48 A;  2BR0 A;  4CDE C;  2VOB A;  2ALY B;  5IGD A;  5J1Z A;  3W1B A;  1X6O A;  2F0K A;  1QE6 A;  1WD0 A;  1U9R A;  1BCP C;  1EEI D;  3NHH A;  4HJ9 A;  3PO2 B;  1JX4 A;  2QGQ A;  4KD4 A;  5COY A;  1Z2O X;  4FBT A;  2PMZ B;  1LT4 D;  5C3E H;  3GV6 A;  3P1H A;  1PH5 A;  2VQD A;  5KT6 A;  3PV0 A;  2RA4 A;  3X3N A;  3GTO B;  1AE3 A;  5LMU L;  3J81 c;  1FJG Q;  3CRL C;  1SE2 A;  4IFD J;  1IOW A;  5D1O A;  4MV1 A;  4EGV A;  4ECS A;  2K5H A;  2PI2 E;  3IN5 A;  4O3R A;  4U67 3;  4RAZ A;  2Z9H A;  1B8A A;  4IUN A;  1KAB A;  1Y1V H;  3JC6 6;  2EYJ A;  4OO1 I;  5C0X H;  4OON A;  2EVB A;  4RHR A;  4RUA A;  1GUT A;  3BAB A;  4OHJ A;  4J1M A;  3GIQ A;  4F87 A;  3GIK A;  1NCV A;  4MZ9 A;  2W9C A;  2I5L X;  1NNX A;  4Q8E A;  2F0I A;  3D4W A;  4DV5 L;  2FB9 A;  1VQI A;  2XWB B;  4PMC A;  2XGT A;  2KJX A;  3CRK C;  3S14 H;  3BAA A;  3SE0 A;  3JAM E;  1A3V A;  2UXC Q;  3RUP A;  5KFK A;  3BJY A;  2R7L A;  3TII A;  3Q8Q B;  1FL0 A;  3S17 H;  2H5X A;  2IP4 A;  5KFB A;  5D3I B;  4A3K G;  2FJ2 A;  2I5M X;  5JEA H;  1IBK L;  3SVM A;  2I07 B;  3Q22 A;  3GQC A;  4CDC C;  1HFG A;  2CQA A;  4R4O A;  4GKJ L;  4QWE A;  4IRC A;  5KFM A;  1EY8 A;  3HOU B;  3FVQ A;  2JE6 I;  2RQX A;  3OHX C;  1CKN B;  5HY6 A;  1VQ6 A;  3VR5 A;  3SI8 A;  1JE4 A;  3HOW G;  1K73 C;  5KG7 A;  4CHT B;  1OXV A;  1EOT A;  1CTM A;  4EFB A;  4WJ4 A;  2VL6 A;  4E6I A;  4DV0 L;  2ZJP A;  4A3D H;  4O2B F;  4XXE A;  3K5I A;  1JIC A;  1PTO D;  1B2T A;  2SDF A;  1F9Q A;  2X69 A;  4A3I G;  4A3L H;  3H40 A;  3OW7 A;  4EFE A;  5LP6 F;  1HZC A;  5LMU H;  3DWP A;  4YHH Q;  4MV6 A;  4PZ8 A;  5E4X A;  4JI4 Q;  3BA8 A;  5KFO A;  3QFF A;  4DK6 C;  2C35 B;  5HV6 A;  2MPM A;  4N8F A;  2MUY A;  3M4O H;  1TWA H;  1LAB A;  2F0D A;  3HG9 A;  2K52 A;  1UNS A;  1Z2N X;  4ZUI A;  4MTE A;  1E2W A;  1X32 A;  3EIV A;  4A3C H;  4LMY A;  1PTO C;  2WAQ G;  1VF5 C;  3HRZ C;  2O4X A;  1HHV A;  2E5L L;  2K7V A;  5M5W B;  3CQZ B;  1W3S A;  1A9X A;  5COR A;  2XRQ D;  1E24 A;  2F3I A;  4IPD A;  2LXJ A;  1R4Q B;  3AYH B;  1HJP A;  1CZW A;  2K50 A;  2PW5 A;  4DV5 H;  4KY7 A;  3SK4 A;  2JEJ A;  1XMQ H;  1EQV A;  3IFT A;  2K05 A;  2UXD Q;  1LT3 D;  1GM5 A;  2R82 A;  2AQ4 A;  2R8G A;  4FVM A;  4KMU C;  2D2C C;  4QB4 A;  1KAA A;  3I4M G;  2KED A;  1A2T A;  3TZU A;  1HUN A;  5KG5 A;  1H9J A;  2F0J A;  4OX9 Q;  3L4J A;  4Q45 A;  1EQR A;  1PDQ A;  1SYF A;  1Y8N B;  4G3I A;  1EYA A;  1XNR Q;  3RB3 A;  1Y1W A;  2ATW A;  3RZO H;  1XYI A;  4EYH B;  4RZQ A;  2NUA B;  1LTA D;  5KG2 A;  1CE8 A;  4DR7 H;  2Z1C A;  3ONA B;  5EDW A;  4CGY B;  2MHV A;  1SCU B;  1QUQ A;  1Q81 C;  2YZG A;  4L8J A;  2H1E A;  4LF8 L;  1T94 A;  1EYZ A;  5L1I A;  3CCR A;  5CYU A;  5F9L A;  4RB2 C;  1TWF H;  1TS3 A;  3DHQ A;  4DXF A;  1W96 A;  1Q12 A;  4J9Q A;  3FPU B;  1ZXT A;  2UXC L;  4NXN H;  1PZJ D;  4NXM L;  3SGI A;  1S5D D;  1ILP A;  1TWC H;  3GIP A;  3TIG A;  4A3G H;  1EZ6 A;  1MJC A;  3J80 L;  2OF1 A;  5E4W C;  4MV4 A;  3A55 A;  4X3T A;  3DM1 A;  3J7A F;  1NMF A;  4K6D A;  4ZCK A;  1HZ9 A;  3QB3 A;  3C0F B;  2MO0 A;  1SYC A;  1STB A;  1UE6 A;  2PBZ A;  4XIG S;  1D1I A;  2F4V H;  2F0T A;  1AH9 A;  5C0X G;  2V4R A;  1X3F A;  1A63 A;  4IJL A;  5IGG A;  3F2U A;  4RA8 A;  4RWS C;  3CPF A;  3T1Y H;  4DV7 H;  4B3R Q;  2J6U A;  1JT8 A;  1KC7 A;  2IX1 A;  4GC6 A;  5C3W A;  1N34 Q;  2ASJ A;  4OWW B;  1WTO A;  1K83 B;  1HNX L;  4KHZ A;  4S3S A;  4OWT B;  4G7H C;  4JV1 A;  1VBH A;  4X64 L;  3J7Y W;  5I9P A;  2XGQ A;  4IFD I;  4RHS A;  4JI2 Q;  3GTP A;  3RB0 A;  4HJ5 A;  3K8A A;  2NZO A;  4IRK A;  4YWL A;  2A74 C;  4YHH L;  5JUM A;  5E1F A;  3WNZ A;  2KOL A;  4P2C B;  5L1L A;  1JKJ B;  5FLX E;  3BQ1 A;  3GTJ A;  4DK3 C;  2PVP A;  4BY7 H;  1KC8 C;  2FFK B;  3MZ5 A;  4XYM B;  3ERQ A;  3ND9 A;  1TWG H;  1NBW A;  4JI8 L;  4IN3 A;  4KN7 C;  1V9P A;  5EAY A;  2L55 A;  2B2V C;  2EJF C;  2A5H A;  4KHV A;  3H3V I;  3PCO B;  4FNF A;  1F2Z A;  2D9U A;  2SEB D;  5JEA J;  4FF4 A;  3I72 A;  2F03 A;  4EBD A;  3GO5 A;  3C3L A;  2HT1 A;  4OEM B;  5IYC H;  2UXD L;  2F0U A;  1L0Y B;  2VB2 X;  3GLK A;  2K03 A;  3A54 A;  1UE5 A;  5C3E B;  3HFZ B;  4GZY C;  5M3F G;  5IGB A;  4YJ2 F;  5C5J A;  3UE1 A;  2NVQ H;  3PIO 3;  4LF9 Q;  3U9T A;  1B1Z A;  3FDT A;  4QIW E;  4RCN A;  1OWT A;  4GNX C;  2NN6 G;  1VQ5 A;  1I3Q A;  2OT2 A;  2R6F A;  1H9K A;  1JQY D;  2IY5 B;  1N33 Q;  2AQ3 B;  2AU0 A;  5IP7 H;  4UCU A;  2GPS A;  3URY A;  2D0P A;  4RNO A;  1J9O A;  1Y1V B;  1GSO A;  5KNC A;  1KL9 A;  4DF7 A;  1B53 A;  3TSS A;  2YW2 A;  4YIJ A;  2YYA A;  1AUV A;  4DNT B;  2TSS A;  1LV9 A;  3ETJ A;  2R93 G;  3MHB A;  1ET9 A;  4ZHQ F;  4KKT A;  4JI0 Q;  2VPS A;  1UAP A;  3T51 B;  2XNA C;  3BZK A;  5FKA C;  1AN7 A;  2ZJT A;  5BPF A;  4F50 A;  3S14 B;  3RMH A;  3GV8 B;  4UCO A;  4IRD A;  1DOK A;  1VF7 A;  1SMY D;  3S17 B;  5M3M G;  1HFN A;  4JI5 H;  2CW7 A;  4H13 C;  4F88 A;  3MR2 A;  4A3E G;  2NVX A;  5IWA H;  4B08 A;  4DV2 H;  2K32 A;  5EKK A;  3S24 A;  2WB1 A;  3NQI A;  3U9O A;  4ME6 A;  1NAP A;  5CV4 A;  2B2V A;  3R2I A;  4EQN A;  3MEH A;  3H0G H;  3CU7 A;  3RZD H;  2EOT A;  1NR4 A;  1EUJ A;  3QO2 A;  4QW8 A;  4J9O A;  1Q7Y C;  4L1K A;  1M8A A;  3ER0 A;  1RK6 A;  2R7Z A;  3GTK H;  1I6U A;  3M4Y A;  4B3R L;  2KA7 A;  4A3D B;  3K5O A;  5BMV F;  1IHZ A;  4KV6 A;  4OIJ A;  3TQT A;  2AUJ D;  5JJK A;  5T1I A;  1GUN A;  4OO1 H;  4XYL B;  3SDZ A;  4F4Z A;  3HOX G;  3CD6 A;  3BJU A;  1JMC A;  3IL8 A;  3M4I A;  3MXG A;  1SEB D;  4RKL A;  3ZYY X;  4GNX A;  1XPO A;  4JI2 L;  5L1K A;  1SRO A;  4HSV A;  2VQF Q;  1QZH A;  1S68 A;  3M4O B;  3H20 A;  1SYE A;  1TWA B;  1PXU A;  3UDG A;  4U7C A;  4DXG A;  4AQY H;  4DL4 A;  1N32 H;  2X0S A;  3T5K A;  2PN1 A;  2MO1 A;  2YZM A;  4ED0 A;  2A6E D;  1SNQ A;  3NBI A;  2ZM6 L;  1K1Q A;  4JVZ A;  1WTH A;  1XTD A;  3A5Z B;  1STA A;  2EYP A;  1YIJ A;  4HQ6 A;  3VPC A;  3JAM c;  4NLG A;  1WTP A;  1FYC A;  1JIH A;  4LF4 Q;  4LF6 Q;  2R93 B;  1H9S A;  1F2Y A;  5LYJ F;  3MVV A;  2MJ8 A;  4YR0 A;  1IOV A;  2CVR A;  4V19 0;  1W93 A;  5JJI A;  2JA9 A;  2W9A A;  4J9R A;  1GUW A;  1U0L A;  2A6E C;  4LWC A;  2C2R A;  1B3A A;  1CKM A;  1PA6 A;  2JEB I;  2JEG A;  1PH7 A;  1QCB D;  4QY7 A;  2R8J A;  5FJ8 H;  2C5C A;  5IGE A;  2Z6B A;  2YU9 H;  5AFW A;  1WTW A;  4LF9 L;  3MXN B;  2EY6 A;  2JA6 A;  3RZO B;  4UCV A;  2ZTD A;  3VR4 A;  4DR2 H;  3G6X A;  4L5R C;  3C1E A;  5A35 A;  4DR1 Q;  3PUW A;  2JA7 H;  1SRU A;  2QYZ A;  3JSN A;  1E7Z A;  1U5K A;  3D4R A;  3PUZ A;  4BA1 I;  3M85 A;  3K7A H;  3RGZ A;  1HNZ Q;  1EY4 A;  2NZH A;  4QWD A;  3K80 C;  3QZ7 A;  2R8K A;  1BCP F;  2RCN A;  4X3U A;  1FGB D;  2DJF C;  2F0S A;  4BY1 H;  2PMZ A;  4FO2 A;  3G6V A;  1TWF B;  4JI0 L;  1JE5 A;  1STE A;  3BVZ A;  2KHS A;  4L63 B;  3GTO A;  4JV0 A;  1QVG A;  1RJT A;  5KFA A;  1SXT A;  5I6W A;  2I46 A;  2IX0 A;  2EJG C;  2F0P A;  2F0F A;  4R7R A;  3KLR A;  4LMQ D;  5BN3 A;  1SJH D;  4DK1 A;  5JVD F;  3I90 A;  1TT2 A;  4A3G B;  1B9N A;  1A3T A;  4K5W A;  4X62 Q;  1BXT A;  4ZI7 F;  4LFB L;  1PFS A;  5CV5 A;  2AGO A;  4K0K L;  2Z4H A;  4Q44 A;  1YHB A;  1ASY A;  2HDM A;  3H4B A;  3I4N H;  5JAV A;  1XXG A;  3RBE A;  1VBG A;  2MNA A;  4LF5 H;  3BZC A;  4GN3 B;  2PW7 A;  4H44 C;  4M8A A;  2VZA A;  3H91 A;  4KY6 A;  5LMN Q;  5C44 G;  1TY0 A;  4IPC A;  3OIP A;  2F0E A;  2E2H H;  4LAA A;  2F3W A;  3FKI H;  3WO0 A;  2KUM A;  3LNN A;  3NUC A;  4LUV A;  4DA2 A;  1G2T A;  3PR5 B;  4JV2 A;  1E0B A;  4K2L A;  4DNI A;  3D8G A;  3GD7 A;  3M3Y H;  3TS0 A;  4DV6 L;  1TKW B;  4JV5 H;  2BH2 A;  5CV6 A;  4O3N A;  2Y0S B;  5KFU A;  2HHH H;  2KEC A;  2QEX A;  4O42 A;  2F52 A;  2VQF L;  4DV4 Q;  1KXL A;  5BR8 H;  1CKN A;  1IBM L;  1TA8 A;  4BY7 B;  3OMC A;  4POF A;  2B2Y C;  1Z2P X;  2YTX A;  3VYR A;  1TWG B;  2BOS A;  2QCP X;  2RDH A;  3AB9 A;  4IZ8 A;  3EBE A;  4BWG B;  3CVZ A;  5HBR B;  5EWE A;  4GS3 A;  1JCK B;  2K5Q A;  3DM3 A;  4B3T Q;  1EWI A;  1TXY A;  1X65 A;  3DF7 A;  1X3Q A;  2BDN A;  4HED A;  2V9W A;  3MEF A;  2K04 A;  1SAP A;  1VQO A;  3T13 A;  3G4S A;  4O3P A;  4LF6 L;  2L11 A;  3U4V A;  1I94 H;  4JBJ A;  2BA1 A;  3A5U A;  2EIF A;  1I4P A;  4G57 A;  3J81 j;  2WB1 G;  1SE8 A;  4EQO A;  4X66 L;  2NVQ B;  3EPI A;  2B2W C;  1TWH H;  2F0G A;  1B6S A;  2VPQ A;  5J2U F;  4K5X A;  4I50 F;  5IT9 W;  4K0K H;  2JEA I;  2Z6K C;  4CKB A;  3CQZ A;  4ECX A;  2ZTE A;  3J80 i;  4O1N A;  3HOY H;  4IFD H;  1JOO A;  3K59 A;  2R7Z G;  2PO4 A;  1VQB A;  3ZJY C;  1B7Y B;  5I2X A;  4DUY Q;  1M0T A;  5FLX L;  3IAY A;  3ULJ A;  4YR2 A;  3K3P A;  2YCH A;  1STY A;  2Q2U A;  3R23 A;  2A19 A;  2L4N A;  3NEL A;  1OTC A;  4RGT A;  1J5E H;  4IAL A;  4MHE A;  2PQE A;  4HN7 A;  4NW2 A;  3H3V H;  1CK1 A;  1CM9 A;  3PO3 G;  3M9B A;  1C3O A;  3FDS A;  5FOB B;  4XQQ A;  2VA2 A;  3CHB D;  3K5H A;  2NU6 B;  3STB D;  1BBX C;  1BNC A;  2E2D C;  3BDO A;  2B2Y A;  2KHJ A;  4KKU A;  3WOF A;  1KJJ A;  1WTV A;  1KDC A;  1P8L A;  2JA7 G;  5GAE C;  3SK5 A;  3D6C A;  4UY8 C;  4OWX B;  5K5P A;  3DEO A;  1BQQ T;  3H0G B;  3RZD B;  5FO9 B;  1GHK A;  2C2E A;  2A68 D;  4LSX A;  3GTG H;  5LL6 b;  5KT3 A;  4DAP A;  5LMU Q;  1CQV A;  1QNU A;  4HYK A;  3FHW A;  1S0O A;  3RUZ A;  3STB C;  1YHA A;  3GTK B;  2VNU D;  1S5F D;  3JZI A;  1LM0 A;  2ICE C;  3RN5 A;  5CMD A;  1WFQ A;  3HS0 C;  1FKA H;  1F2L A;  4I65 A;  2AWO A;  3KDF B;  5CR3 A;  2JA6 G;  4X66 H;  5KT7 A;  2HDL A;  4HNU A;  3I2Z A;  3RD4 A;  2B2W A;  2L12 A;  4WFN 3;  2OTJ A;  1KJ9 A;  1XNQ H;  3I73 A;  4EGQ A;  4PG3 A;  2Z6K A;  1EIF A;  3ORR A;  3RAQ A;  1VMP A;  4DV5 Q;  1JDE A;  3OSN A;  3NPP A;  2OEO A;  4CJ1 B;  5C5L A;  2PNR C;  4DL6 A;  3CW2 C;  1CSP A;  1DM0 B;  2D5D A;  4LUO A;  2N3S A;  4QMG A;  4YAK B;  1V43 A;  1MD2 D;  3RLO A;  5BN5 A;  5K36 H;  4EBE A;  1B33 N;  1K83 A;  1CHQ D;  1PH3 A;  4BXX G;  1ZYR D;  3HEJ A;  1PH4 A;  1IBK Q;  1M1K C;  4OXP A;  4ODG A;  1EY9 A;  5LL6 S;  2XCP A;  1P16 A;  5KYL A;  1SE3 A;  3HKZ E;  4DR7 Q;  4EEY A;  2ZT9 C;  1EIY B;  3SHL A;  4HID A;  4LF7 L;  2B2T C;  3K81 C;  4IOC A;  3Q1K A;  2Q2H A;  2YU9 B;  4DV0 Q;  5LHY 1;  1CS0 A;  5CA0 F;  1ZYR C;  1C30 A;  2XCA A;  3TBI B;  5EKI A;  5D3D A;  4FF3 A;  2HJW A;  1C8C A;  4B3S L;  3Q8D A;  2V4D A;  3W2D A;  2JA7 B;  1GUG A;  4NXN Q;  4HJ8 A;  4P72 A;  5DQG A;  3K7A B;  2B29 A;  3I70 A;  1IYV A;  3BDL A;  4BY1 B;  5I6Y A;  3N8D A;  1C9O A;  1G91 A;  3E3X A;  1AFP A;  2WII B;  1FR3 A;  3NEM A;  1BCP D;  2XVS A;  3I91 A;  2O2L D;  3HOU G;  2E5L Q;  1LUZ A;  3QG1 A;  2OQ0 A;  5FLM H;  2F4V Q;  3RBD A;  4GOP B;  4GKK H;  4WRD A;  3UDI A;  3HBL A;  1Y1V A;  2ES2 A;  3A56 A;  3T1Y Q;  2X6L A;  1KQS A;  4IUP A;  2XTI A;  5BN4 A;  3J81 L;  3H09 A;  3JAM i;  2JA8 H;  2GPW A;  4EGJ A;  2UUB L;  1GVP A;  3E6Z X;  1SNO A;  3I4N B;  3GDE A;  1BF4 A;  3T5J A;  1F9R A;  1NY4 A;  1BKB A;  1UE1 A;  1B9M A;  3HKS A;  1EFW A;  2E2H B;  4O4H F;  4H0L C;  1M0W A;  3V6H A;  2HQL A;  3FKI B;  2KSW A;  4LF7 H;  3BYT B;  2B2T A;  1PZI D;  5G3L F;  5IYB G;  2HCI A;  3JSL A;  1TVX A;  1KHI A;  4O0A A;  4KJO A;  3M3Y B;  4LF8 Q;  4X65 H;  3U50 C;  1X56 A;  3RFC A;  3PR4 A;  4G7Z C;  4B3S H;  3GTL H;  1EUC B;  5H80 A;  1XPR A;  1VQM A;  2F1M A;  1RYS A;  4JI6 H;  4XQN A;  5CBE E;  2DNC A;  2NB0 A;  1HR0 H;  1O7L A;  5L1J A;  1EIH A;  1XMQ L;  4NXM Q;  3RF2 A;  2B8G A;  2L15 A;  5KIX A;  3SXH A;  4ECY A;  1WTR A;  2CFM A;  4XT3 B;  2ALZ A;  5DM7 3;  2YRW A;  4DLK A;  3CAM A;  5GON F;  3HOV H;  5IGC A;  1B6R A;  4JYA H;  2QDB A;  5GQO A;  1U4L A;  2TMP A;  3NTK A;  4LFA H;  1HUM A;  5IIF A;  2CCZ A;  2AMC B;  4EEQ A;  1S40 A;  1D6E C;  2EYM A;  4DR7 L;  1TWA A;  2CWA A;  4ECZ A;  1BBW A;  5ELN A;  1EOV A;  2FLN A;  2IPK D;  1TWH B;  3LML A;  4PZ6 A;  3DXJ C;  4P73 A;  1IKL A;  2HQE A;  5CC4 A;  3K5L A;  1YIT A;  1YJN A;  4LFC H;  2R3Z A;  1HNX Q;  2UUB H;  2CH4 A;  3HOY B;  1ZEQ X;  2R87 A;  3TQ1 A;  4X64 Q;  1VQ4 A;  1AZP A;  3M9M B;  1GO3 E;  2R93 A;  4I7H A;  1EY0 A;  2RSO A;  2W9B B;  4EVO A;  4JI5 Q;  4NXN L;  3EYY A;  4RUC A;  1B3Q A;  1L2F A;  2ENB A;  1Q82 C;  2NU8 B;  1HXY D;  2EY1 A;  2QA4 A;  4AYB E;  5IWA Q;  1SYB A;  4DV2 Q;  4RCO A;  2HCC A;  2LS0 1;  2CQY A;  1X3P A;  1PK8 A;  4JI8 Q;  2KEE A;  4ED8 A;  4TVA B;  3MXN A;  5C3X A;  4C5A A;  4JI3 H;  1WD1 A;  4L5S A;  4UCR A;  2E75 C;  4DR4 H;  5KG1 A;  2F4V L;  3J80 W;  1RD9 D;  2FHT A;  4MNO A;  3MFG A;  3SR1 A;  1LTB D;  2DY8 A;  3A7L A;  5J22 A;  1E4F T;  3MTS A;  2K33 A;  3D31 A;  3S16 H;  2KCT A;  3T1Y L;  2JP1 A;  4DV7 L;  1VQ7 A;  4IWX A;  2R92 H;  2FK1 A;  2BE5 D;  3RB6 A;  1TWF A;  1D8L A;  2SNS A;  3CCS A;  3ERS X;  1N9W A;  4IJH A;  4MV9 A;  2FXQ A;  3GTG B;  5KFN A;  2UXB H;  2R8I A;  4RKB A;  3ULL A;  3CKI B;  3HOZ H;  1EZ1 A;  2GVB A;  4ECR A;  4QWA A;  3UFX B;  5ELE A;  1IYU A;  1TAE A;  3RLF A;  1JOK A;  5CV9 A;  3VPB A;  3GTM H;  1N32 Q;  3T1H H;  3AFQ A;  3N6R A;  4ZQ3 A;  1ZHS A;  2BE5 C;  1KRS A;  4U6P A;  2MQH A;  1VQJ A;  3CC4 A;  3I7F A;  4WJW A;  2N49 A;  4G7O C;  5KT4 A;  2WAC A;  3MXU A;  2PZU A;  5E3F A;  5KFJ A;  1SBB B;  4PV1 C;  3D4D A;  2CKZ B;  3HP3 A;  4DV1 H;  5DNF A;  5A2Q E;  4DR3 H;  1F77 A;  2EE1 A;  4NP5 A;  3GTQ H;  3FRP B;  1H95 A;  2MP1 A;  3VA5 A;  1Q86 C;  4EX5 A;  5J39 A;  1EU3 A;  5C3E G;  2MCT A;  1IYJ B;  3BS1 A;  2LKV A;  3T56 B;  2KBN A;  3CCV A;  4DR5 H;  2R84 A;  4M1U B;  4J9S A;  2YZN A;  1K0R A;  5ELO A;  1ESF A;  4RGM A;  4DNR B;  5IP9 H;  2Y0S A;  4DR2 Q;  1XJV A;  1Y1V G;  4N8X 1;  4M9U A;  4ED7 A;  2OTL A;  1IL2 A;  4IQZ A;  1VQG A;  1JWS D;  2HIX A;  1TWG A;  2W6Z A;  5KFS A;  5T14 A;  3DWQ A;  3VR6 A;  2IT1 A;  2NTS A;  1UEA B;  3LGJ A;  2CWP A;  2WFW A;  3MXP A;  1HZB A;  4KI0 A;  4LSA A;  4QIW B;  2UVR A;  2XRS D;  4DU9 A;  1C4Q A;  1EWC A;  3I3C A;  3G6E A;  3CCU A;  2MGS A;  2XN9 C;  4JI5 L;  2C28 A;  1B04 A;  2VUM H;  3I55 A;  4QJF A;  5JEA G;  5IWA L;  4UPA A;  4DV2 L;  2UVW A;  5CV7 A;  2FPP B;  3OTO H;  1O78 A;  2ZXP A;  4AIM A;  1PH1 A;  1TU2 B;  2JA5 H;  1D2B A;  3PN1 A;  4PDB A;  1KDB A;  2ZM6 Q;  3M9O B;  1B44 D;  1F9P A;  1G6Z A;  1W2B A;  3F2B A;  3A8I E;  1N56 A;  1E1T A;  4LF5 Q;  1A2U A;  3AMU A;  4A93 H;  4A3D G;  1QB5 D;  1PYS B;  4JI7 H;  3UE0 A;  3DEP A;  1QOH A;  2JA8 B;  5H1S E;  4Y7N H;  4A3L G;  3PQI A;  4ECU A;  4F4W A;  1E4G T;  1MGS A;  5IYD H;  2GVA A;  3N42 B;  2PZT A;  2OXP A;  4IUV A;  3IG0 A;  4L5T A;  4P74 A;  4KHP H;  2HHH Q;  5BR8 Q;  4A3C G;  4JCV E;  2WAQ E;  3SK6 A;  3UDX A;  4AQY L;  1MHW C;  1N32 L;  2JSO A;  1I4G A;  1SNM A;  3R8B A;  3K0Y A;  5G3L D;  2N78 A;  3S1N H;  1SFO H;  1EU4 A;  5JPN C;  3GTL B;  3BA9 A;  2KCN A;  3NWS A;  3H0G A;  2L1B A;  1ZHQ A;  4H7B A;  3GV7 B;  2DNE A;  3T5L A;  1EIG A;  3QJY A;  3CME A;  1VDZ A;  5LOV F;  4UFZ A;  3GQB A;  3E0J A;  2LSS A;  2JQO A;  2FLP A;  3GTK A;  1I94 Q;  5JJL A;  3PGZ A;  1OXX K;  3N41 B;  4J9M A;  1F2M A;  3LWE A;  4KD3 A;  3EPG A;  4DN4 M;  5FO8 B;  1V1P B;  5IT9 E;  1WOC A;  3S9W A;  1JJC B;  1CQF A;  2LFN A;  2R61 A;  3KDF A;  3CMA A;  3CF5 A;  3HOZ G;  1RTO A;  3HOV B;  1YEZ A;  4B3M H;  5C8Y F;  4LFB Q;  2RDF A;  2W57 A;  2KEN A;  3NXW A;  4HJ7 A;  1L0W A;  4K0K Q;  1WCM H;  3NSW A;  4F8M A;  5LL6 X;  4GOP C;  2VA3 A;  3RAX A;  4ZLT F;  1K0S A;  1K8O A;  4DR2 L;  1FNU A;  2R7D A;  3ND8 A;  3QOL A;  2VR1 A;  4RU9 A;  1HTP A;  5F9N A;  2BCO A;  3T5H A;  1PLF A;  2JEF A;  2N55 A;  1I4Q A;  4FS2 A;  4V0B A;  3PUY A;  1RK5 A;  1KEE A;  2E2I H;  4C1N K;  3B6Y A;  1X54 A;  1BVS A;  4N9T A;  1J5E Q;  1VMC A;  4DR6 H;  4NMZ A;  2Z4I A;  3QIA A;  3J81 i;  2DWC A;  5KFT A;  3Q8S B;  4XTC S;  2RF4 A;  4DV6 Q;  3TRE A;  1JB3 A;  1VQA A;  5ELF A;  3VDY A;  4A3G G;  3KJO A;  3V2T A;  3WWV A;  1IBM Q;  3JAM L;  2CZG A;  1STN A;  2Q8R E;  3S1R H;  4MV3 A;  3DMU A;  2YU9 A;  3E0E A;  4RGN A;  3KLS X;  3R5X A;  1EQT A;  2XWJ B;  5KG0 A;  2UUA H;  3EA6 A;  2F0H A;  2DZD A;  3QWN A;  4FXK C;  5KRU A;  2O5I C;  4TUY F;  2G5D A;  1RDP D;  3IKJ A;  1BGW A;  1DJR D;  2EYO A;  1JXL A;  3QZ8 A;  2I87 A;  1XWE A;  1PMR A;  2H4O A;  4K5V A;  2JA7 A;  4OX9 H;  5KFI A;  4LF5 L;  4X6A H;  5LXT F;  5EGT A;  4IUU A;  2HD3 A;  2PI2 A;  3S16 B;  4YB8 B;  2IA6 A;  1XNR H;  1SYG A;  2V1C C;  1FGU A;  5A2Q W;  2R92 B;  2BQU A;  5IE8 A;  5FPR A;  4IUT A;  4C56 C;  1NTG A;  5KFQ A;  3CPW A;  1LT6 D;  4X66 Q;  5KFC A;  5DEH A;  4UP9 A;  2Y0S G;  2L5T A;  4ME5 A;  4IPG A;  2ICI A;  4DL7 A;  1VQF A;  3HOZ B;  4JV5 L;  4BY7 G;  4GOP A;  2NVT H;  3KHH A;  1I6V C;  2HHH L;  2JA5 G;  3GTM B;  1Q46 A;  2FE3 A;  3BQ0 A;  5BR8 L;  2A6H C;  3IRB A;  4JBK A;  2FPG B;  5EOY A;  1DXM A;  5KYI A;  1CA5 A;  1EQQ A;  4JUZ A;  2ZJR A;  4ECT A;  2C22 A;  1OO9 B;  1ULZ A;  1EWH A;  4RZR A;  1T5X D;  2N8N A;  1S5E D;  4N9P A;  4XT1 B;  4L5Q A;  4A3J H;  4G4K A;  3GTQ B;  5IYC G;  2QKI C;  3PIP A;  1AP0 A;  2B63 H;  4MTD A;  1YI2 A;  4O2A F;  1PHJ A;  1VQN A;  2E2H A;  1I94 L;  4I7Z C;  3V6K A;  1MIU A;  3NTI A;  3FKI A;  4MTN A;  4MTK A;  1TWC B;  4J8Q A;  2B39 A;  1DON A;  4FM9 A;  2EZV A;  5IP7 G;  4ZYS A;  1KLU D;  5EWG A;  1QNK A;  4A3F H;  1N34 H;  2C2D A;  2L9H A;  3OWE B;  4J6H A;  4MV7 A;  4MV8 A;  4RNN A;  1PVO A;  1QIL A;  2B8F A;  1B70 B;  1MBY A;  2YRX A;  1RJP A;  2F0W A;  3GII A;  2R8H A;  1E2Z A;  1WI5 A;  2RHS B;  3LWB A;  1YHQ A;  2B3G A;  4XZ3 B;  4ECQ A;  1S03 G;  5JPM C;  4ABN A;  5C4J H;  3FMA A;  1T3N A;  3M4P A;  1J5E L;  5KGU A;  1V1O A;  1JC7 A;  4TRD A;  2XCL A;  4ZKC B;  2M9V A;  4UHV A;  2CW0 D;  3Q24 A;  1RTN A;  2B2U C;  5KFP A;  2VUM B;  4OIK A;  5C4H A;  1XPU A;  5FPO A;  4HAE A;  4FS1 A;  5IOD A;  1TWH A;  4DUY H;  3NP8 A;  3PSI A;  1ILQ A;  2JA5 B;  2O03 A;  4JK1 C;  3H0G G;  3ICE A;  3OHA A;  3W1G A;  2FKL A;  4GN5 A;  3Q8R B;  3K0X A;  2WE6 A;  3PW2 A;  2CW0 C;  4A3B H;  1V51 A;  3L4K A;  4C3J H;  4JW0 A;  1AEX A;  4A93 B;  4IZO A;  2Z0S A;  4QF4 A;  4YWM A;  2W9B A;  4C3I H;  2UUC H;  3S2H H;  4OO1 G;  3HZX A;  4BBS H;  3K57 A;  2C9O A;  4A4I A;  1B50 A;  1SYX B;  4R8I A;  3NGD A;  4ECW A;  1N33 H;  3V96 A;  4BBR H;  4Y7N B;  4LF7 Q;  2CHB D;  4HNT A;  1G8Z D;  4EBC A;  4FXD A;  3WOE A;  1KLG D;  1I6H B;  2NN6 I;  5LMN W;  3V6J A;  1XNQ L;  2ID0 A;  1I50 H;  1JWU D;  1E4E B;  2BDO A;  1HZA A;  4ME3 A;  1CA6 A;  1HCZ A;  2VUG A;  4B3S Q;  1PH2 A;  2ASB A;  4A3M H;  4JI6 Q;  5KFG A;  1W6K A;  2EYF A;  5CB4 F;  1HNW H;  1HR0 Q;  4CC6 A;  3E9I A;  2FJZ A;  2OLS A;  4QWB A;  4QUF A;  2YYZ A;  1BBU A;  2K5W A;  3F2C A;  1ZQ7 A;  5C4Z A;  1KTK A;  4FYD A;  3S1N B;  1SFO B;  1QVC A;  4EQP A;  2PYK A;  1PX2 A;  4R4Q A;  1DV2 A;  4HCS A;  5KFH A;  3GTG A;  2AKW B;  1M6V A;  3MR5 A;  4YQW A;  1AN8 A;  2A1A A;  4JBW A;  4TSS A;  3PW0 A;  5EKL A;  2B2U A;  5IGF A;  5FJ8 G;  3OOC A;  1V8Q A;  4CDD C;  2EPB A;  4ZQI A;  2W70 A;  5DG8 A;  2HGS A;  3R5F A;  3Q23 A;  4J15 A;  3J7A 5;  1WCM B;  2HVR A;  2UUB Q;  2ZDG A;  3MR3 A;  1UUP A;  2KHI A;  1WVL A;  1S10 A;  2QEJ C;  2HUG A;  3DUZ A;  2W8K A;  2F0M A;  3RV3 A;  1K8A C;  1UE7 A;  2HIV A;  1KJI A;  1PH6 A;  3N44 B;  1KNE A;  4BY1 G;  2OCE A;  4J9P A;  4APM A;  4KK7 A;  3HKZ B;  4J9L A;  1LYL A;  5HGQ A;  4DAY B;  3KAK A;  2E2I B;  4PZ7 A;  1YJW A;  4YY3 H;  1N36 H;  3P20 A;  1R9T H;  1T36 A;  2E8G A;  1AZQ A;  1EY7 A;  1X55 A;  1G2S A;  3J80 E;  2NVY H;  4JI3 Q;  1CZG A;  3GIJ A;  3OUZ A;  1BO0 A;  1F9S A;  1A62 A;  3KBG A;  2AWN A;  1EYG A;  1OXT A;  3M4Q A;  5KFL A;  3FEW X;  1HA6 A;  1RYR A;  5EZY F;  5KFZ A;  4GKK L;  4DUZ H;  1KIX A;  1PYW D;  2P0A A;  4I4T F;  5L37 A;  3S1R B;  4CC5 A;  5FD6 A;  1XMQ Q;  3MR6 A;  4A3K H;  4R1J A;  2EQS A;  4ZK9 B;  2RDJ A;  3R2T A;  4FF2 A;  3I4N G;  3N43 B;  1SDF A;  2Z8L A;  3PUX A;  2W6N A;  1SN8 A;  4YR3 A;  3WDN A;  1J8I A;  1ONL A;  1ET6 A;  3FMC A;  3H4D A;  1SNC A;  1GGO A;  3LP8 A;  2W6M A;  3TIN A;  4DV3 H;  4QIW A;  5KNB A;  2IBK A;  3J81 W;  1G51 A;  2AUK A;  2K75 A;  1E3P A;  2C00 A;  3MFI A;  3FKI G;  3VYS A;  4UDU C;  2RHQ B;  4LJZ C;  3HOW H;  2LMC B;  1D1K A;  2F3V A;  5IT9 c;  2KQ3 A;  3T1H Q;  1XTC D;  4DR1 H;  4XYO A;  3MWM A;  2RDI A;  1IBL H;  4CJ0 B;  5J3B A;  1I6H H;  2RSN A;  2IHF A;  4A3I H;  4X65 L;  4GLX A;  2W7O A;  1C48 A;  5DM6 3;  2UU9 L;  4C3H H;  4IHJ F;  4RFB A;  1HNZ H;  2NVT B;  4DR3 Q;  4C5B A;  2FMM A;  2A73 B;  4XQJ A;  4IR9 A;  1NR2 A;  4JI6 L;  4F4X A;  4HCE A;  3A7A B;  4RG1 A;  1K8G A;  1S72 A;  1HR0 L;  2W7P A;  2WTF A;  1GXD C;  3CCE A;  1S5C D;  1BR9 A;  1DD2 A;  1C0A A;  4KTA A;  3NBH B;  4ED3 A;  4A3J B;  3KHL A;  3TP6 A;  3TS2 A;  4JYA L;  3BVG A;  4X62 H;  5D14 A;  2VW9 A;  2F0L A;  2B63 B;  5FO7 B;  2OQK A;  1GSH A;  4LFA L;  1JB7 A;  3TRZ A;  2WB1 E;  4CKE A;  1NJI C;  4HIO A;  1Q3L A;  1BOS A;  3FPP A;  1IZ6 A;  2F0O A;  1D7Q A;  1HQR D;  4L6T B;  1PFB A;  4Y52 H;  2E2J H;  3I4M H;  4YCV A;  1BJT A;  4DV7 Q;  1T5E A;  2RBM A;  5LMN H;  5GAD C;  3J7A K;  3HOY G;  4IFD G;  2OWO A;  1TS5 A;  5I47 A;  3OWF A;  4HMJ A;  4A3F B;  4LFC L;  1FNW A;  3GTL A;  3EN2 A;  3BG3 A;  1QVF A;  4HJA A;  1YZ6 A;  3Q6S A;  1MJE A;  4YBZ B;  4R8U B;  5EBC A;  3V05 A;  1WSC A;  3OW2 A;  4HIM A;  1E22 A;  5C1O A;  2VS1 A;  2FP4 B;  2KCM A;  2DGY A;  3OUU A;  1TQO A;  2NBF A;  1DIK A;  3PUV A;  1A15 A;  2NU9 B;  3D6W A;  3S15 H;  1V1P A;  2R7M A;  5C4J B;  4DV4 H;  4JOI C;  1HA5 A;  4M7E A;  3OTO Q;  1OXU A;  3BQ2 A;  3PW7 A;  3NE5 B;  2VQE H;  3AQQ A;  4JI3 L;  4FBU A;  3KLS A;  2UU9 H;  1GKH A;  4DR4 L;  5DLG A;  4B3T H;  2VY3 A;  3BYY B;  3RR5 A;  1ZET A;  3RN2 A;  4B9X A;  4JI7 Q;  3J7Z C;  4JI1 H;  3S2D H;  3KF6 B;  5LA6 F;  4WD3 A;  1SLJ A;  4X3S A;  3TZD A;  2W6P A;  4C2M H;  3H15 A;  1II3 A;  4AYB B;  3A8K E;  3NEN A;  5C1P A;  4DAV A;  2AQ1 B;  3SE7 A;  2NZ1 D;  1K9M C;  4RNM A;  2PNH A;  2PZW A;  4QW9 A;  2ASL A;  4A3B B;  2Q2I A;  4OEL B;  4C3J B;  1GJX A;  2UXB L;  2HVS A;  3QOJ A;  1ICF B;  3U9S A;  3UDF A;  4KHP Q;  4XDX A;  1XMO H;  4C3I B;  2GLT A;  3S2H B;  2NWG A;  1MSG A;  4BBS B;  3CC7 A;  1K28 A;  2K4K A;  1PH9 A;  4PMW A;  2W71 A;  4BBR B;  4FU0 A;  5NUC A;  2EYH A;  5KFF A;  3T1H L;  2ASD A;  2XSC A;  2EXD A;  1UWV A;  4OGQ C;  2VB3 X;  4FXG C;  1IL8 A;  1I50 B;  3NWT A;  2K14 A;  2M00 A;  4RB0 A;  2XIW A;  4J0M A;  2UVU A;  4DV1 L;  2R7F A;  4A3M B;  1Z9F A;  2E76 C;  2PMZ E;  4DR3 L;  4KN4 C;  3E5S A;  4YWK A;  3MFY A;  4IAJ A;  2BA0 A;  3H94 A;  1MI2 A;  5K36 G;  1SSO A;  2R92 A;  4POG A;  3R5H A;  3VYU A;  2AHO B;  4KKS A;  3KAJ A;  4Q43 A;  5L9X A;  1RKN A;  4B3M Q;  3F2D A;  4DR5 L;  4JOI A;  2BQ3 A;  5C4X H;  3GV3 A;  2WKD A;  2L0C A;  3K6O A;  1L1O B;  4E4T A;  4O4L F;  1YNN D;  1RL2 A;  3PMF A;  2D62 A;  2Q8I B;  3PF5 A;  4F7X A;  1WR2 A;  4DL2 A;  1U4P A;  2FK3 A;  2W8L A;  1EYD A;  2KVM A;  3GTM A;  1VQ8 A;  1PH8 A;  1D5X C;  2AQ2 B;  4C3H G;  3G48 A;  4DKA C;  2IMW P;  5M3F H;  4MAM A;  4Q0Y A;  1ENC A;  2DN8 A;  1RJQ A;  3CCJ A;  3RV4 A;  4BS9 A;  4H02 A;  4ZAI A;  3K5M A;  1H9R A;  1YNN C;  2NN6 H;  5KND A;  4DR6 Q;  3GIL A;  1JOQ A;  3GTQ A;  5JOB A;  4FDB A;  1X9N A;  1O7Z A;  2F0V A;  1U4R A;  5M5X H;  1VKZ A;  3A0J A;  1QJO A;  2HVQ A;  5KFD A;  1KDA A;  3GIM A;  1XX8 A;  1LT5 D;  4IO9 A;  1M90 C;  1QWY A;  1EZ8 A;  1TWC A;  4RAY A;  2K01 A;  1HQM C;  4AQY Q;  4KY5 A;  1R9T B;  2JEI A;  3MFH A;  5FLM G;  4MIU A;  1QG7 A;  3KF8 B;  2O5J C;  2R93 H;  3OTO L;  1AE2 A;  2UUA Q;  3MJF A;  1EUD B;  2NVY B;  4P75 A;  4LH7 A;  4YJ3 F;  1KNA A;  2PPB C;  2IJ0 A;  5EBD A;  3CXC A;  1G29 1;  1LTI D;  2XIG A;  4R9W A;  2UVV A;  1S5B D;  4TQR A;  4F4Y A;  5M3M H;  4JBM A;  4UP7 A;  4XYQ A;  1Q8I A;  5JVG 3;  1IBK H;  5HUR A;  4A3K B;  4A3E H;  2I0Q A;  4JI7 L;  2JA8 G;  1GYF A;  1AW7 A;  4ZKB B;  4GKJ H;  1FJG L;  3S1M H;  1MSH A;  1ML0 D;  2F0Q A;  4EG0 A;  1I4X A;  1T9H A;  4Q8F A;  5JJZ A;  5KFR A;  3KLW A;  2WYO A;  4TQS A;  5I9O A;  4Q5V A;  1VQP A;  4DV0 H;  1N8R C;  4KHP L;  2PQA B;  1PRT B;  2NUC A;  3HOW B;  5KG4 A;  3AEV A;  2VUM A;  5KFE A;  3CC2 A;  3CCM A;  3A74 A;  1ENF A;  2QIL A;  5T1G A;  3UI2 A;  3Q0A A;  2JA5 A;  2RDG A;  1K8M A;  3H6M A;  3LX0 A;  4KJN A;  5EPK A;  3TP7 A;  5C5M A;  5ELD A;  5I2Y A;  1LLR D;  1Y1W H;  3HOX H;  2Q2T A;  1DZ1 A;  4A3I B;  4C3H B;  4WOR A;  3U4Z A;  1VQE A;  1D5M C;  3KHR A;  1YNX A;  3HXL A;  3KFU A;  3RTX A;  5K2M A;  3VA7 A;  3AFP A;  3C2P A;  3EVQ A;  2E5L H;  3K3V A;  1JOR A;  3L2P A;  3HOV G;  2FMA A;  4IUQ A;  1H9M A;  2WAQ B;  2IWH A;  5KFW A;  3JRW A;  1I7N A;  5JH7 F;  3MWD A;  4UCT A;  3J80 c;  2VXW A;  4B3M L;  3C1F A;  1B4O A;  1W6J A;  4ZOL F;  3PW4 A;  3T16 A;  1E4E A;  1PRT F;  5KG3 A;  1DGS A;  1NE3 A;  3VMM A;  1GUO A;  1TII D;  1RJR A;  4Q0F A;  1J6Q A;  5C0X J;  3N6X A;  2E2J B;  2R6G A;  3I4M B;  3P75 A;  1YNJ D;  5TSS A;  1IW7 D;  4YP3 A;  1EY5 A;  1PFM A;  3PIP 3;  1A8V A;  1PTO H;  4A2A A;  1A3U A;  1FJG H;  3O13 A;  2DJG C;  4R4I A;  4JI4 L;  1SFO A;  5E7N A;  3KJP A;  1JDB B;  1DV1 A;  2D0O A;  4OL7 A;  4ZRZ A;  5JVL A;  3R3O A;  1YVC A;  4HR7 B;  4LW1 A;  3RJ0 A;  4DR6 L;  3T53 B;  2JN4 A;  5EJW A;  2KCC A;  4CJ2 C;  4JV5 Q;  1MZB A;  4DPG A;  4LF8 H;  1Z6H A;  1YNJ C;  3KUP A;  1IW7 C;  1LO5 D;  2ZTC A;  5C4X G;  5KT5 A;  3ULP A;  3S15 B;  5FD5 A;  4YCU A;  2JYO A;  4R4C A;  3M9N B;  4JG2 A;  1EYC A; 
#chains in the Genus database with same CATH homology
 3GTP H;  5GRO A;  3CW2 C;  1CSP A;  4O2D A;  2UUA L;  1IXR A;  5GAH C;  4LUO A;  2N3S A;  1PVO A;  4A3I G;  4A3L H;  1B70 B;  1V43 A;  3RLO A;  3GTJ H;  1HZC A;  4YHH Q;  1WI5 A;  2RHS B;  4PZ8 A;  1PH3 A;  1YHQ A;  4BXX G;  4JI4 Q;  2B3G A;  2R92 G;  3K7U C;  4OX9 L;  4DK6 C;  2C35 B;  1PH4 A;  3F8T A;  1M1K C;  1IBK Q;  1VQL A;  4OXP A;  2UUC Q;  3M4O H;  5C4J H;  1XNR L;  1TWA H;  3M4P A;  1J5E L;  1P16 A;  2K52 A;  4DR7 Q;  3HKZ E;  3EIV A;  1EIY B;  4A3C H;  2WAQ G;  4HID A;  4LF7 L;  2A8V A;  3K81 C;  3G71 A;  4IOC A;  2E5L L;  1W3S A;  2Q2H A;  1X3G A;  1E24 A;  2F3I A;  4IPD A;  4DV0 Q;  2LXJ A;  3AYH B;  1HJP A;  2K50 A;  1XPU A;  1HNW Q;  4B3S L;  3PSI A;  3Q8D A;  5C44 H;  1GM5 A;  2UXD Q;  3H0G G;  3ICE A;  3D0F A;  3W1G A;  3I4M G;  4NXN Q;  3U58 A;  4GN5 A;  3K0X A;  4HJ8 A;  4P72 A;  1I3Q H;  4OX9 Q;  4A3B H;  2B29 A;  4C3J H;  5M5Y H;  1EQR A;  2Z0S A;  4BA2 I;  4YWM A;  1C9O A;  1KRT A;  1XNR Q;  4C3I H;  3S2H H;  2ATW A;  3RZO H;  4BBS H;  4OO1 G;  4A4I A;  3NEM A;  1PYB A;  1PV4 A;  4BBR H;  4LF7 Q;  3HOU G;  2E5L Q;  1LUZ A;  2OQ0 A;  5FLM H;  2F4V Q;  1SMX A;  1Q8K A;  4R4T A;  2NN6 I;  4GOP B;  1QUQ A;  5LMN W;  1Q81 C;  1XNQ L;  2ID0 A;  1I50 H;  3UDI A;  1HZA A;  4ME3 A;  4QL5 A;  4LF8 L;  5IP9 G;  2ES2 A;  3T1Y Q;  4B3S Q;  1PH2 A;  2ASB A;  4A3M H;  3CCR A;  1KQS A;  4JI6 Q;  2XTI A;  1TWF H;  1CUK A;  1HR0 Q;  4HIK A;  1Q12 A;  3E9I A;  3JAM i;  2JA8 H;  2UUB L;  2YYZ A;  4RMF A;  1BBU A;  1GVP A;  3CP0 A;  3F2C A;  1N34 L;  3GDE A;  1Y1W G;  2NVX H;  2UXC L;  4NXM L;  1Y14 B;  3SGI A;  1NY4 A;  1QVC A;  1TWC H;  1BKB A;  2YTY A;  1UE1 A;  1Q1B A;  4R4Q A;  4A3G H;  3S1Q H;  4YY3 Q;  4QQB X;  3HKS A;  1MJC A;  1EFW A;  1N36 Q;  2AKW B;  1NMF A;  2YV5 A;  1HZ9 A;  2HQL A;  1WJJ A;  2MO0 A;  1YBY A;  1UE6 A;  2A1A A;  2JK8 A;  3RLN A;  5IYB G;  4XIG S;  4JBW A;  1XNQ Q;  5FJ8 G;  2VUM G;  1KHI A;  4O0A A;  5C0X G;  1AH9 A;  1X3F A;  2R7Z H;  1A63 A;  3FP9 A;  4IJL A;  4LF8 Q;  3U50 C;  1MKH A;  1K3R A;  1X56 A;  1YJ9 A;  3CPF A;  4NB3 A;  3GTL H;  4DUZ Q;  4B3R Q;  3M3Y H;  1XPR A;  1VQM A;  3W5O A;  1JT8 A;  1VS0 A;  4J15 A;  2IX1 A;  3J7A 5;  1Q1E A;  2UUB Q;  1N34 Q;  2KHI A;  1XMQ L;  4OWW B;  4DUY L;  4NXM Q;  1HNX L;  3PF4 A;  4KHZ A;  2L15 A;  4OWT B;  1K8A C;  2HIV A;  1UE7 A;  1PH6 A;  2UXB L;  1OXS C;  4X64 L;  4A93 G;  1NMG A;  3PO3 H;  2CFM A;  4IFD I;  4BY1 G;  4JI2 Q;  2I5H A;  2OCE A;  4DV3 Q;  4HJ5 A;  3K8A A;  2NZO A;  3CAM A;  4YWL A;  1LYL A;  5HGQ A;  4DAY B;  4YHH L;  3HOV H;  4PZ7 A;  1YJW A;  5GQO A;  4DK3 C;  1S3O A;  1R9T H;  2UUC L;  1KC8 C;  4BY7 H;  2E8G A;  5IYD G;  1UEB A;  2CCZ A;  1I5F A;  1N33 L;  2AMC B;  1TWG H;  1X55 A;  1NBW A;  2NVY H;  1S40 A;  4JI3 Q;  4JI8 L;  4DR7 L;  2CWA A;  1IBL Q;  1BBW A;  4UP8 A;  4APV A;  1V9P A;  5ELN A;  5EAY A;  4LNQ A;  1A62 A;  1EOV A;  3H3V I;  1L1O C;  1VQD A;  2AWN A;  3PCO B;  3TQY A;  1EYG A;  1OXT A;  1VCI A;  3M4Q A;  1WYD A;  4PZ6 A;  5JEA J;  4P73 A;  1VQK A;  4GKK L;  1KIX A;  1YIT A;  1YJN A;  1XMQ Q;  5C0X I;  4A3K H;  1HNX Q;  4R1J A;  2EQS A;  3I4N G;  3GO5 A;  1HNW L;  2HT1 A;  3PUX A;  5IYC H;  3KYH C;  4X64 Q;  1KD1 C;  1VQ4 A;  2UXD L;  1SN8 A;  1GO3 E;  3KF6 A;  1C7Y A;  2DUD A;  2ZJQ A;  2K5N A;  1UE5 A;  4JI5 Q;  3HFZ B;  4NXN L;  5M3F G;  2JA6 H;  3DLL A;  1L2F A;  3UE1 A;  2NVQ H;  1Q82 C;  4LF9 Q;  1G51 A;  2QA4 A;  4AYB E;  5IWA Q;  2K75 A;  4QIW E;  1E3P A;  4DV2 Q;  2NN6 G;  3FKI G;  3PIO A;  4GNX C;  2LXK A;  1VQ5 A;  2RHQ B;  3HOW H;  2IY5 B;  1N33 Q;  5IT9 c;  4JI8 Q;  5IP7 H;  3T1H Q;  1QUQ B;  4TVA B;  3PO2 H;  2D0P A;  4L5S A;  5DLQ E;  1KL9 A;  5J3B A;  3TEH B;  2F4V L;  1I6H H;  2IHF A;  4GKK Q;  4MNO A;  4A3I H;  4X65 L;  4A76 A;  4GLX A;  2UU9 L;  1QZG A;  1WCM G;  4C3H H;  3GTO H;  3D31 A;  4DR3 Q;  3S16 H;  2R93 G;  2KCT A;  3T1Y L;  1VQ7 A;  4DV7 L;  4JI0 Q;  4BXX H;  3BZK A;  2R92 H;  4JI6 L;  1VQH A;  4RG1 A;  1K8G A;  1S72 A;  1HR0 L;  2IHE A;  1D8L A;  5M3M G;  3CCS A;  3ERS X;  3CCE A;  1N9W A;  4IJH A;  1G6P A;  2FXQ A;  3HKZ G;  1C0A A;  3M7N A;  3ULL A;  4A3E G;  3NBH B;  3HOZ H;  2GVB A;  3TS2 A;  3RLF A;  4JYA L;  4YY3 L;  3S24 A;  3GTM H;  2VW9 A;  1N36 L;  1N32 Q;  2OQK A;  4LFA L;  1JB7 A;  3TRZ A;  3AFQ A;  2WB1 E;  1KRS A;  4TQU S;  1NJI C;  4HIO A;  2MQH A;  1VQJ A;  1L1O A;  3CC4 A;  2VQE Q;  1IZ6 A;  3I7F A;  2N49 A;  3H0G H;  1D7Q A;  3RZD H;  4X65 Q;  2UU9 Q;  4Y52 H;  1EUJ A;  2E2J H;  3I4M H;  3L0O A;  4YCV A;  4A75 A;  2CKZ B;  2GN5 A;  4DV7 Q;  1Q7Y C;  3ER0 A;  3E9H A;  5GAD C;  3GTK H;  3HOY G;  4IFD G;  2OWO A;  4JI1 Q;  4DUZ L;  4B3R L;  3GTQ H;  4LF4 L;  4LFC L;  1H95 A;  1Q86 C;  4EX5 A;  3EN2 A;  5JJK A;  1QVF A;  4HJA A;  4WJ3 M;  1YZ6 A;  5C3E G;  1MJE A;  4DAM A;  2CQO A;  3OW2 A;  3HOX G;  1IYJ B;  4HIM A;  1JJ2 A;  2JJQ A;  1E22 A;  4QGU A;  3BJU A;  3CD6 A;  1JMC A;  3HOU H;  3CCV A;  2KBN A;  2VS1 A;  2KCM A;  4GNX A;  2DGY A;  1XPO A;  4DV3 L;  4JI2 L;  4JYA Q;  3PUV A;  1SRO A;  2VQF Q;  1QZH A;  3S15 H;  1XMO Q;  1K0R A;  1FVI A;  5ELO A;  4LFA Q;  4JOI C;  3UDG A;  5IP9 H;  3OTO Q;  4DR2 Q;  1XJV A;  1GD7 A;  1Y1V G;  1OXU A;  2MO1 A;  2Y0S E;  2OTL A;  1IL2 A;  1VQG A;  3AQQ A;  1A0I A;  4JI3 L;  2ZM6 L;  4DR1 L;  1GKH A;  1XTD A;  2HIX A;  2YTV A;  3A5Z B;  1IBL L;  4DR4 L;  1YIJ A;  4EQ5 A;  2VY3 A;  3RR5 A;  3JAM c;  3RN2 A;  2IT1 A;  1VQC A;  3LGJ A;  4JI7 Q;  2CWP A;  2WFW A;  4LF4 Q;  3J7Z C;  4LFC Q;  1HNZ L;  3KF6 B;  4LF6 Q;  3S2D H;  1SLJ A;  4C2M H;  1HZB A;  3H15 A;  4KI0 A;  5JJI A;  2JA9 A;  3NEN A;  5AJ3 Q;  4NPS A;  1U0L A;  4LWC A;  3CCU A;  1CKM A;  3G6E A;  3RNU A;  2JEB I;  5IYB H;  1PA6 A;  2PNH A;  5FLX c;  1PH7 A;  1K9M C;  2Q2I A;  4QY7 A;  1O7I A;  4JI5 L;  3CQZ H;  5M5W H;  3KOJ A;  5FJ8 H;  4ALP A;  4A3J G;  2VUM H;  4KLK A;  3I55 A;  2YU9 H;  4QJF A;  1Z47 A;  5JEA G;  3UDF A;  4KHP Q;  4LF9 L;  1HR0 W;  3MXN B;  2B63 G;  5IWA L;  4UPA A;  2ZTD A;  4DV2 L;  3CC7 A;  2K4K A;  4AIM A;  4PMW A;  4X62 L;  1PH1 A;  1PH9 A;  2JA5 H;  4L5R C;  4DR1 Q;  1SR3 A;  2ZM6 Q;  1RIP A;  3PUW A;  4GLV B;  1SRU A;  2PQA A;  3T1H L;  2JA7 H;  4DR4 Q;  1E7Z A;  2EXD A;  4P71 A;  1UWV A;  1U5K A;  3F2B A;  1W2B A;  1E1T A;  3PUZ A;  4BA1 I;  3M85 A;  3K7A H;  4LF5 Q;  1HNZ Q;  2K14 A;  2NZH A;  4A93 H;  3K80 C;  4A3D G;  1PYS B;  2RCN A;  4DV1 L;  4BY1 H;  3UE0 A;  2R7F A;  4A3F G;  1ASZ A;  4GLA C;  1Z9F A;  1X3E A;  4DR3 L;  2PMZ E;  3L7Z C;  5LMN L;  4YWK A;  4YCW A;  4JI0 L;  1JE5 A;  4LUZ A;  5H1S E;  4Y7N H;  4A3L G;  2BA0 A;  5GAG C;  1CKO A;  5IYD H;  2GVA A;  1QVG A;  5K36 G;  2UXB Q;  3BU2 A;  4POG A;  4L5T A;  2AHO B;  2IX0 A;  4P74 A;  4B3M Q;  3F2D A;  3I4O A;  4GN4 B;  4DR5 L;  4JOI A;  5C4X H;  2HHH Q;  4X62 Q;  5BR8 Q;  1V1Q A;  4LFB L;  1L1O B;  1PFS A;  4A3C G;  1RL2 A;  2D62 A;  4JCV E;  2WAQ E;  3I56 A;  4DV4 L;  3PF5 A;  3UDX A;  4AQY L;  3PO2 G;  4K0K L;  1N32 L;  1YHB A;  1ASY A;  1KAW A;  3I4N H;  1VQ8 A;  1PH8 A;  5IY0 A;  2MNA A;  1CSQ A;  2VQE L;  2N78 A;  3F1Z A;  4DV1 Q;  3S1N H;  4DKA C;  3G48 A;  1SFO H;  3BZC A;  4GN3 B;  4IOA A;  2VZA A;  5LMN Q;  5M3F H;  4B3T L;  2K5V A;  5C44 G;  4AH6 A;  3CCJ A;  4IPC A;  2MFI A;  4AYB G;  3CME A;  2E2H H;  4H02 A;  4JI1 L;  4DR6 Q;  3FKI H;  4GKJ Q;  2LSS A;  2JQO A;  1I94 Q;  5JJL A;  3PGZ A;  1OXX K;  4LUV A;  4GNX B;  4A3B G;  1X9N A;  4FDB A;  5M5X H;  4DNI A;  4DR5 Q;  3A0J A;  1WOC A;  2BH8 A;  1JJC B;  3GD7 A;  3CF5 A;  3KDF A;  3CMA A;  4DV6 L;  3TS0 A;  3HOZ G;  2BH2 A;  1JJG A;  1YEZ A;  4BBS G;  4LFB Q;  2KEN A;  4HJ7 A;  4IO9 A;  1M90 C;  1L0W A;  4IPH A;  4BBR G;  2F52 A;  2QEX A;  2VQF L;  4DV4 Q;  4AQY Q;  1CKN A;  1XMO L;  1IBM L;  1VQ9 A;  1LTL A;  1WCM H;  4POF A;  5FLM G;  4GOP C;  2YTX A;  3KF8 B;  2R93 H;  1E1O A;  3OTO L;  1AE2 A;  4DR2 L;  1K83 H;  2UUA Q;  4P75 A;  3EBE A;  2R7D A;  3CXC A;  1HH2 P;  3OYY A;  1G29 1;  4GS3 A;  3DM3 A;  4B3T Q;  1EWI A;  1TXY A;  1X65 A;  4A3M G;  5M3M H;  4JBM A;  3PUY A;  3MEF A;  4UP7 A;  2E2I H;  3B6Y A;  1X54 A;  1VQO A;  2I0Q A;  1BVS A;  4A3E H;  4JI7 L;  4JC0 A;  3G4S A;  2JA8 G;  1J5E Q;  4LF6 L;  3CCL A;  1FJG L;  3U4V A;  3S1M H;  2WP8 J;  4JBJ A;  2BA1 A;  3J81 i;  3A5U A;  2EIF A;  5AJ3 L;  4XTC S;  2RF4 A;  3J81 j;  3CCQ A;  4DV6 Q;  2WB1 G;  3TRE A;  1SE8 A;  1VQA A;  1T9H A;  4X66 L;  3VDY A;  4A3G G;  3KJO A;  3KLW A;  3WWV A;  1TWH H;  2ALY B;  1VQP A;  1IBM Q;  1N8R C;  2JEA I;  4KHP L;  2PQA B;  3S1R H;  2Z6K C;  4K0K Q;  3AEV A;  3W1B A;  1X6O A;  3CC2 A;  2ZTE A;  3E0E A;  3J80 i;  3CCM A;  3HOY H;  4HJ9 A;  2R7Z G;  3A74 A;  2QGQ A;  1VQB A;  3ZJY C;  1B7Y B;  4DUY Q;  5C3E H;  1Y1W H;  1PH5 A;  3HOX H;  2Q2T A;  3ULJ A;  3PV0 A;  4LF5 L;  4X6A H;  1AE3 A;  3U4Z A;  2PI2 A;  1VQE A;  2A19 A;  3J81 c;  5LMU L;  2Q2U A;  2V1C C;  1FJG Q;  1FGU A;  3NEL A;  1OTC A;  4IFD J;  1YNX A;  2K5H A;  2PI2 E;  5IE8 A;  3KFU A;  3H3V H;  1NTG A;  3PO3 G;  3CPW A;  3M9B A;  1B8A A;  3AFP A;  4X66 Q;  3L2P A;  1Y1V H;  4UP9 A;  3JC6 6;  3HOV G;  2Y0S G;  4OO1 I;  4IPG A;  4OON A;  1VQF A;  3STB D;  3J80 c;  4B3M L;  4BY7 G;  4JV5 L;  2KHJ A;  4GOP A;  2NVT H;  4MZ9 A;  2HHH L;  2I5L X;  2JA5 G;  1Q46 A;  5BR8 L;  4DV5 L;  3IRB A;  4JBK A;  1P8L A;  1VQI A;  2JA7 G;  2XGT A;  3S14 H;  5GAE C;  2UXC Q;  4UY8 C;  1KXL A;  1DGS A;  1NE3 A;  4OWX B;  1J6Q A;  1FL0 A;  1EQQ A;  5C0X J;  3S17 H;  2ZJR A;  3GTG H;  2R6G A;  2H5X A;  5LMU Q;  2N8N A;  3FHW A;  4A3K G;  2I5M X;  1A8V A;  3STB C;  1YHA A;  4L5Q A;  4A3J H;  2VNU D;  4R4I A;  1LM0 A;  3RN5 A;  5IYC G;  3PIP A;  4JI4 L;  1WFQ A;  5E7N A;  3KJP A;  1IBK L;  2D0O A;  2B63 H;  1YVC A;  4LW1 A;  2AWO A;  1YI2 A;  4R4O A;  3KDF B;  1PHJ A;  1VQN A;  4DR6 L;  2JA6 G;  4GKJ L;  1I94 L;  3I2Z A;  1MIU A;  2OTJ A;  4MTN A;  2JE6 I;  5HY6 A;  4DPG A;  1CKN B;  4PG3 A;  1VQ6 A;  4JV5 Q;  5C4X G;  2ZTC A;  1K73 C;  2Z6K A;  1EIF A;  3HOW G;  3ULP A;  1OXV A;  5IP7 G;  4DV5 Q;  4YCU A;  2VL6 A;  4DV0 L;  4WJ4 A;  4R4C A;  2ZJP A;  4A3D H;  4JG2 A;  4A3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...