2JA6G

Cpd lesion containing rna polymerase ii elongation complex b
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CPD damage recognition by transcribing RNA polymerase II.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja6G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2ja6G01
2AWOA 3HKZE 3M3YH 5IY0A 1WCMH 4JCVE 4A3KG 1PH6A 1KL9A 1PFSA 1Y14B 3U58A 5FLMG 4L5TA 2OTLA 5J3BA 3LGJA 1IL2A 1CKMA 2K52A 1XPRA 4L5SA 1VQLA 1NMFA 4DUZL 1MJCA 4BBRG 4K0KQ 1VQBA 1CUKA 4A3DH 3S2DH 2BA0A 4YWLA 4RG1A 2RF4A 4C3JH 3PO3G 4R4QA 3UE1A 4HJ9A 4A3JH 5C0XI 2PQAA 3CQZH 4JYAL 1E7ZA 3KDFB 2JK8A 4JI0Q 3J7A5 1U0LA 4NPSA 1PHJA 2JEAI 1I6HH 2JA6H 4PMWA 2WB1G 3I7FA 2YTYA 1XMQQ 4YY3Q 1Y1WG 1JB7A 3I4OA 2Z6KC 1Q81C 1E22A 4LF6L 4WJ3M 4GOPC 5IP7G 1HZBA 4YY3L 5ELNA 2JQOA 1AH9A 1H95A 3JAMc 4UP8A 2K4KA 4A3MH 3M9BA 4B3RQ 2A8VA 1SR3A 3U4VA 1FL0A 3KF6A 4QIWE 4IOCA 1B8AA 1VQAA 5HY6A 4DV5L 1MJEA 3PF4A 4IFDJ 3HFZB 3G4SA 2K75A 3I56A 2CCZA 4JV5Q 4H02A 2WB1E 1I50H 5K36G 3G71A 2Z0SA 3KJOA 2KCTA 4TVAB 5AJ3Q 5LMUQ 2UU9Q 2K5VA 4POGA 4IOAA 5IYDH 3H0GG 2AWNA 1HJPA 5AJ3L 5LMUL 1QUQA 2UUAQ 2IX0A 1K3RA 4DV7Q 2AKWB 4B3TQ 2LXJA 2ZJPA 1VQ5A 4APVA 1Y1VH 2UUAL 1A62A 2CQOA 4X66Q 3KYHC 4X62L 2K50A 1V43A 3RZDH 2BH8A 4A3GH 4GKJL 1SE8A 1IBKL 3VDYA 3OW2A 4JI2Q 1IBKQ 1PH1A 4JI1L 3CCRA 2VZAA 2YU9H 3CPWA 1PYBA 3BJUA 3F2CA 1LUZA 1PH3A 4DV3Q 4WJ4A 4YCUA 1WCMG 2JA9A 2N8NA 4DV6Q 1P16A 4FDBA 3I4NH 2D0PA 3NENA 1VQIA 5M5XH 4DK6C 1UE7A 2OCEA 3U4ZA 4DUYQ 1A8VA 3UDGA 4JI7L 4QL5A 2R7ZG 2KENA 1YIJA 2ZM6Q 4JBWA 2PI2E 4YCWA 1VS0A 4QY7A 3J80c 3KFUA 4A4IA 4R4CA 4DR5L 4OO1I 2VQFL 3IRBA 1LYLA 1KRTA 1OXXK 4DV1L 4DV2Q 1EYGA 1EIYB 5HGQA 2UU9L 2XGTA 3GTMH 4DR5Q 1L0WA 2R7DA 1PVOA 4PZ6A 4BY1G 1ASZA 5IT9c 1A63A 4YWMA 1CKNA 2I5HA 1IBLQ 4J15A 1HNZQ 4X64L 1K83H 1QZHA 4P75A 3GTOH 3KF8B 5GQOA 4IFDG 1HNWL 1JJGA 4Y7NH 2EQSA 4IPHA 4JC0A 5IE8A 1PH7A 2R6GA 4JI6Q 1I94L 3TREA 1KD1C 5JJIA 1SROA 2CKZB 1W3SA 3AYHB 4JI2L 5C44G 1VQKA 2UXBL 2ZJRA 4BBRH 4DR2Q 2I5LX 5IP7H 1SMXA 3F2DA 4GKKQ 2E2JH 2JA7G 4BY7H 1OXSC 2OQ0A 3E9HA 4GLXA 1Q12A 3HOVH 3WWVA 1T9HA 2NVYH 2K14A 4LFAQ 4DR7L 1OXUA 5FJ8H 4BY7G 4JBMA 1VQNA 1JT8A 1OXTA 1W2BA 2NVQH 3UE0A 5M3MG 1EFWA 2JA7H 3HOWG 2JE6I 4JI5L 1IBML 4L5RC 4YCVA 4BBSH 1HZCA 4BA1I 1PH8A 1WJJA 3J7ZC 4LFCQ 1TWFH 1YHAA 3KF6B 1Q86C 2R92H 2IY5B 1UE1A 1YEZA 2NVXH 4A76A 1TWGH 2CWAA 1KAWA 2PQAB 2VQEQ 3T1HQ 4A3MG 1K8GA 3S14H 1ASYA 2JA5H 5C0XG 1L1OB 4DAMA 5FLXc 5C4XH 1XPOA 1HR0Q 1GVPA 4GNXC 3HOUG 1YHQA 2I0QA 2LSSA 1YITA 1I94Q 1BKBA 4GS3A 4PZ7A 1Q7YC 1HR0L 5GAHC 1NTGA 3PCOB 4OXPA 4A3BG 3K8AA 2HQLA 3G6EA 1A0IA 1TWHH 4B3ML 2JA8G 1HH2P 4BXXG 2CFMA 3HOYG 4X65Q 4AQYL 1HNXL 2ASBA 2L15A 1X65A 1EWIA 3EBEA 3I4MG 1PV4A 4JI4Q 3RZOH 5JJKA 4IPDA 2R92G 4IFDI 3KOJA 4KHZA 2JEBI 1X54A 3H3VH 4A3EH 4JI4L 1G291 3CP0A 2HIVA 4DR4Q 1I5FA 1VQPA 4A3IG 3S1MH 3S1NH 4A3CH 3CC2A 5M5WH 4P73A 3L2PA 5GAGC 2HT1A 5C4XG 1K0RA 5IP9H 4DV6L 1P8LA 2GN5A 3GTPH 4KLKA 2IT1A 1K73C 4IJHA 4YWKA 1GD7A 2UXDL 5GADC 3OYYA 1OXVA 1JE5A 4A3LH 1HZAA 3HOZH 3GD7A 4P72A 4R4TA 2F3IA 3PUXA 2Q2TA 1V9PA 2E8GA 3PO2H 4P71A 4KHPQ 3UDIA 4DPGA 5IYBH 1BBWA 1CKNB 4LFBQ 4A93H 3W1BA 3A5ZB 1S3OA 4AYBE 3FKIH 1FGUA 1QVCA 3GDEA 3K0XA 1EUJA 4LUZA 1RIPA 1X3GA 4DAYB 4A3KH 1X56A 1N8RC 3GTJH 5LMNL 3GTKH 3NELA 2ZTDA 1VQOA 1UE6A 5LMNQ 2VNUD 2Q2UA 2QEXA 5C4JH 1UWVA 2NN6G 3NBHB 1YJWA 2R7ZH 4AQYQ 1HNXQ 3PO3H 2K5NA 4GN3B 3AFPA 4LF7Q 4JYAQ 2VS1A 3H3VI 3CCLA 3M4OH 3A0JA 4LF4L 4Y52H 2H5XA 4O0AA 4QGUA 4LFAL 1PH9A 4DR7Q 5EAYA 4X6AH 4KI0A 3J81j 4B3SL 4JOIA 4A93G 1JJCB 1EQQA 2JA5G 3F8TA 1QVFA 4DV3L 3PIPA 2OQKA 1C0AA 4KHPL 1IYJB 4YHHL 1JJ2A 4DNIA 5C3EG 1AE2A 1MIUA 1XNRL 3CXCA 4LF6Q 3A5UA 3GO5A 3CCVA 3T1HL 4BBSG 2A1AA 3E9IA 1GKHA 1PH2A 4MZ9A 4A3BH 2R7FA 1NY4A 4DV2L 4JBJA 4ALPA 2F4VL 4OX9L 3AEVA 4IO9A 1O7IA 3H15A 2VUMG 1BBUA 3BU2A 3PUZA 1NBWA 2NN6I 3A74A 2F4VQ 3SGIA 3S15H 3U50C 4JV5L 1WFQA 1N32L 4LF8L 3G48A 3L0OA 1TWAH 2WP8J 2R93H 4MTNA 1VQCA 4O2DA 1Q1BA 4A75A 2N3SA 1L1OA 2B29A 4UPAA 3RN5A 1N33L 1Z47A 1YHBA 1FVIA 4K0KL 1Y1VG 4UP9A 2JA8H 2MQHA 3HKZG 4DR2L 4BA2I 3CF5A 3CMAA 4UY8C 1KXLA 4B3SQ 3BZKA 4NXML 1E1OA 1L1OC 5IYDG 4GNXA 1OTCA 4GNXB 4JI3Q 4LF4Q 1D7QA 3W5OA 5IYBG 2N49A 4GLAC 2QGQA 4R1JA 2N78A 3RN2A 1K9MC 5IWAQ 4DR1Q 1B7YB 2AMCB 4IJLA 2YTXA 1XJVA 1E3PA 3PV0A 3CCQA 3F1ZA 1Q8KA 2NZOA 4OWXB 3PIOA 2ZJQA 3CAMA 3CPFA 3J81c 3PF5A 1VQGA 4UP7A 2E5LQ 5IP9G 2Q2IA 4A3DG 2ES2A 4PZ8A 2UUCQ 2ZM6L 2IHEA 2ZTCA 3EIVA 5DLQE 4HJ5A 3TEHB 1TXYA 4JG2A 4HJ8A 4GOPA 2UUBL 1S72A 1VQ6A 4LF9L 2VY3A 3GTQH 2VL6A 4DR3L 1J5EQ 1N33Q 1SFOH 1GO3E 2BA1A 2B63G 2BH2A 1KIXA 4DR3Q 1J5EL 4HIKA 4X66L 3PUVA 4HIOA 4GKJQ 2MO1A 3JC66 3FHWA 2UXBQ 1VQFA 3DLLA 4DV7L 5C44H 1G51A 5C0XJ 1EQRA 4AIMA 1SRUA 1CSPA 1WOCA 3PUYA 4X62Q 1XMQL 5JEAG 3PGZA 5ELOA 4DR4L 4XIGS 1J6QA 3DM3A 1LM0A 1LTLA 3CC7A 4LW1A 3KLWA 3TQYA 1XMOL 4QJFA 3HOVG 1X3EA 2MNAA 2UXCQ 2RHSB 5IYCH 1IBMQ 1SLJA 4R4IA 2E5LL 4LUVA 3S17H 2DUDA 3K81C 3K80C 3CMEA 4LNQA 1XNRQ 4OWWB 3I2ZA 2K5HA 4DV4Q 2KCMA 4LUOA 3S1RH 2WFWA 3NEMA 3KJPA 4JOIC 1R9TH 3CCSA 1D8LA 4AYBG 1KHIA 2Z6KA 2Y0SG 4TQUS 3RR5A 1IZ6A 1XPUA 2ZTEA 4X64Q 1N34Q 2UUBQ 2YV5A 3D0FA 4C3HH 4DV0L 4LF9Q 3ULLA 1XNQQ 4POFA 1YI2A 3HKSA 2WAQG 3PSIA 4LF8Q 4JI6L 2NVTH 3PUWA 4GN5A 4HIDA 3RLFA 1CKOA 1HZ9A 1FJGQ 1YJ9A 1Q1EA 1Q46A 2HIXA 1KRSA 5M3FG 1KC8C 4GOPB 2GVBA 1N36Q 4B3TL 3S24A 2MFIA 3ER0A 3RLNA 1QZGA 1FJGL 2I5MX 2QA4A 4HJ7A 3HOYH 1GM5A 3EN2A 3H0GH 2PNHA 4GLVB 3AQQA 2NZHA 1XMOQ 1EIFA 1C7YA 1WI5A 1VQ4A 4DKAC 1U5KA 2WAQE 5FLMH 1VQ9A 2GVAA 2JJQA 3HOUH 2DGYA 1VQMA 4JI8Q 1YBYA 3OTOL 3E0EA 3T1YL 2OWOA 3JAMi 2YYZA 4PG3A 4QQBX 4JI8L 2Y0SE 1B70B 1VQHA 2D62A 3K7AH 1PH4A 4YHHQ 1K8AC 4B3RL 1N9WA 3CD6A 3I4MH 1HR0W 1VQ7A 3RLOA 3CC4A 1IBLL 1Q82C 1UEBA 4DR6Q 4A3CG 2C35B 1VQ8A 1VQEA 2HHHL 4RMFA 1NJIC 2JA6G 2IHFA 1G6PA 1X6OA 1Z9FA 3FKIG 1N36L 5LMNW 2HHHQ 5JEAJ 3M4PA 1DGSA 2KBNA 5E7NA 1HNZL 1TWCH 2B3GA 2KHJA 3ERSX 3Q8DA 3GTGH 3HOZG 1N32Q 2OTJA 3STBC 4DR6L 3RNUA 3L7ZC 4IPGA 1YJNA 4A3LG 4XTCS 2ID0A 3S1QH 1CSQA 2B63H 4HJAA 4X65L 1C9OA 2FXQA 4LWCA 5BR8Q 1IXRA 5IYCG 1PA6A 4GKKL 1YVCA 4EX5A 1X9NA 1AE3A 4P74A 5FJ8G 3OTOQ 1Y1WH 4JI1Q 4LF5Q 3GTLH 1KQSA 1VCIA 4JI3L 3TS0A 3MXNB 1PH5A 2UXDQ 3CW2C 1NMGA 1X55A 3T1YQ 4A3JG 1QUQB 4JI5Q 5M5YH 2VQEL 2PI2A 4IPCA 1VQJA 3K7UC 4NXNL 3UDFA 4DV4L 4HIMA 2AHOB 4LFCL 4OWTB 3BZCA 3W1GA 3M85A 3CCMA 5GROA 4BXXH 1SN8A 3AFQA 5C3EH 5M3MH 2VQFQ 3STBD 5M3FH 4DV1Q 3HOWH 3M4QA 1XTDA 1M90C 3HOXH 2ATWA 2UUCL 4AH6A 4R4OA 4EQ5A 2R93G 2LXKA 5JJLA 1N34L 4DV0Q 2CWPA 3F2BA 1XNQL 4B3MQ 4NB3A 1UE5A 2EIFA 3FP9A 4A3EG 2XTIA 4GN4B 1E1TA 3ZJYC 2RCNA 3CCUA 2VUMH 3TRZA 4DUZQ 3HOXG 4A3FG 3MEFA 1PYSB 2D0OA 3ICEA 3S2HH 2Q2HA 1YZ6A 1WYDA 5H1SE 4LF5L 4OONA 5GAEC 1EOVA 4A3FH 3UDXA 4NXMQ 5BR8L 3CCEA 2E2IH 1JMCA 4LF7L 2V1CC 2A19A 3KDFA 3S16H 3J81i 3I4NG 1M1KC 4BY1H 4OO1G 2MO0A 2ALYB 2YTVA 1YNXA 4A3IH 1L2FA 1V1QA 1MKHA 1NE3A 4DK3C 3B6YA 2IX1A 4JI0L 3TS2A 3J80i 4NXNQ 4A3GG 1X3FA 3ULJA 3ULPA 2UXCL 2EXDA 2E2HH 3D31A 1E24A 1S40A 1QVGA 2F52A 2KHIA 4DUYL 4JBKA 4MNOA 3M7NA 4JI7Q 4LFBL 1HNWQ 3I55A 1I3QH 3PO2G 2PMZE 4C2MH 5IWAL 1RL2A 4DR1L 4OX9Q 4DV5Q 1BVSA 1VQDA 2VW9A 4L5QA 3CCJA 4ME3A 4C3IH 2RHQB
chains in the Genus database with same CATH superfamily
3M3YH 3FVQA 1V4YA 1WCMH 5LL6S 2OTLA 1KL9A 1Y14B 5C3WA 1STHA 5FLMG 5KEEA 3BABA 2F0EA 3Q8RB 3PW4A 2DPJA 1LTID 1NMFA 2PMZA 1Y69U 5I2XA 1HA6A 2X0SA 3TINA 3C3LA 3EA6A 1VQBA 2M9VA 1CUKA 4JI1H 2J6UA 1YNNC 2K04A 4J6HA 4KKSA 1SYCA 1TY2A 4KTAA 4CDCC 1ZKOA 2Q8TA 2JEAI 2FE3A 1PDQA 4DV6H 3QG1A 1RJQA 2JA6H 1QG7A 2EVBA 2YTYA 4DV2H 5JVDF 4IWYA 1EYAA 1KDCA 1E22A 4RAYA 4H13C 1GLVA 2DJGC 2PZWA 4YY3L 3N40P 5C5LA 5LP6F 3JAMc 1E4FT 2C28A 3Q6SA 4IUTA 3M9BA 4JV5H 4K14A 2A8VA 1SR3A 4C56C 3NGDA 1FL0A 3HEJA 4DV3H 4O4LF 1B8AA 4CHTB 1MZBA 5HY6A 2MPMA 4XQJA 2V5AA 2LMCB 2YW2A 3PF4A 2CHBD 3G7LA 2CCZA 2V4RA 3OHAA 3QO2A 2Z0SA 4C1NI 4HNVA 2KCTA 1PK8A 4YJ3F 5AJ3Q 1IKLA 5EPJA 4POGA 5IYDH 3L3OC 5EPKA 3RD4A 2F0FA 2AWNA 4LMQD 1QUQA 1UUPA 5CGKA 4ECSA 3R93A 5M9OA 1PTOB 4APVA 2UUAL 3DUZA 5L37A 4C2MA 4X62L 4GKJL 3RZDH 3FDSA 3QZ7A 3J7YW 3MR6A 1GUWA 4P2CB 1IBKL 5LYJF 5FLXW 1DCZA 1TU2B 5EDWA 4JI1L 3V4ZA 4K0KH 5JVLA 1QILA 3CCRA 4C5AA 5C8YF 4U68A 2EYFA 1D5XC 3PW5A 3WNZA 3BA8A 4DV3Q 1KJ8A 4YCUA 5E3FA 2V4QA 4FDBA 3NENA 1VQIA 3T1HH 4QIWB 4WJWA 4DK6C 3U4ZA 4HEDA 5M5XH 4O3PA 3GV6A 5A2QW 3UDGA 2NN6H 1YIJA 3ITPA 1VS0A 4XQNA 3D3RA 1UAPA 1N36H 4ZCKA 2MCTA 4AQYH 1HNXH 1DM0B 2SOBA 5FD6A 2VA2A 5IT9L 3LP8A 1SFOA 4B3RH 4P75A 4IFDG 1SNCA 3KLRA 3LNNA 4TRDA 2EQSA 2FP4B 4GKKH 1TY0A 4EQNA 4JI6Q 1DD2A 1I94L 1KD1C 3EROA 1CE8A 4ZI7F 3PR5B 2ZJRA 1FD7D 4HSVA 1SMXA 2E74C 1WTRA 1B3AA 2OLSA 4ME6A 4BY7H 1OXSC 2OQ0A 4GLXA 1O7LA 3ND9A 1I50A 3RIZA 3WWVA 4LFAQ 2K14A 1B33N 3VYTA 1OXUA 3UFXB 1VQNA 4J9OA 2NVQH 4JI5L 2EJFC 2HJWA 5C3XA 4L5RC 4BBSH 3N43B 1HZCA 3I3CA 1PH8A 3J7ZC 2NTTA 1TWFH 3GV3A 4LFCQ 1SE2A 2NVXH 5L1IA 1XNQH 2YS6A 1TWGH 2F1MA 1LTGD 1F2ZA 3QWNA 4DR3H 2XVSA 1FJGH 4KN7C 4TV9F 2NU6B 3QB3A 1YHQA 2WDTA 1XPUA 1ZHSA 1I94Q 4PZ7A 4I7HA 5GAHC 1NTGA 2F03A 3K8AA 4JVZA 3G6EA 1A0IA 2Y0SA 2WTFA 4LF4H 2JA8G 2VUMB 3M7GA 3HOYG 1E2ZA 4AQYL 1HNXL 2ASBA 3BVGA 3QR8A 1HQMC 3RV3A 4N9TA 3I4MG 1SYGA 2XGQA 1PV4A 4JI4Q 5DG9A 3NQTA 1K8OA 2JEBI 3T16A 3J80L 3H3VH 4QW8A 4XQQA 3GTMA 1G291 2HIVA 1VQPA 5EKIA 2F0LA 3S1MH 1I3QB 4FXGC 5M5WH 4P73A 2HT1A 5GAGC 4ED0A 4IJHA 1GD7A 4IWXA 2XCPA 3OYYA 1XWEA 2I87A 5BR8H 1SBBB 5LA6F 4DL2A 4R4TA 3PUXA 2N88A 1C8CA 3KF8A 4LF8H 1ESRA 1SNQA 5IYBH 5LHY1 1F9SA 4LFBQ 3W1BA 1PTOD 3A5ZB 2PZTA 5L1KA 4FM9A 3GLKA 4UCVA 1EUJA 4IUNA 5KYIA 5EZYF 1X3QA 1LTRD 4IRCA 1E4EB 3GTGA 2ZTDA 1VQOA 2VNUD 4EFEA 4JV1A 2C00A 4QMGA 1UWVA 2R7ZH 1S97A 1YNJC 1F2YA 4ECRA 4APMA 2K5NA 3AFPA 1PXUA 2JA8B 5CV7A 1EQTA 2EYMA 3M4OH 3A0JA 4LF4L 1D1KA 2H5XA 2R3ZA 2H4OA 4X6AH 1ENCA 4KI0A 4HMIA 2QYZA 2PO4A 4DAYA 3F8TA 3VPBA 1HTLD 1EIGA 4XYLB 2OQKA 5ELFA 4R8IA 5M5YB 4KHPL 3C0FB 2UUBH 1AN8A 1E0BA 4YIJA 4DNIA 3DEPA 1AE2A 4ZQ3A 1KTKA 2ZT9C 1XNRL 4L1KA 5L1LA 2HHHH 2OEOA 3L4JA 1J5EH 5LL6X 3NQIA 3BG3A 4ALPA 4NP5A 2X6LA 2F4VL 4NKLA 4IO9A 1HFGA 4QWAA 2NN6I 4DV7H 3SGIA 3SXHA 2VUMA 2LFNA 3N52A 1S10A 1DJRD 3MFGA 4FXKC 4LF8L 3L0OA 2R93H 4C3JB 3R23A 4A75A 2B29A 1N33L 4UPAA 3X3NA 1PX2A 3D6WA 1FVIA 3C2PA 3JAML 5FLXL 3CMAA 1R9TA 1PLFA 4NXML 2EYLA 2NUAB 4RNOA 1JLLB 2KCCA 2F0NA 1STAA 4GNXA 4LF4Q 2XWJB 3E0JA 3GTJA 3CRKC 2YU9B 4GLAC 1F9RA 2F0WA 2NZ1D 3BDCA 1K9MC 3NUCA 5CC4A 4DR1Q 1XJVA 2AMCB 3QFFA 4DR7H 3PV0A 3F1ZA 4O3RA 4DV0H 2RCFA 1BXRA 2EYOA 2Z4HA 3MXGA 2JA7B 1JDBB 1A3UA 2Q2IA 5E4XA 1JORA 4HJ8A 3M3YB 2ZTCA 3UI2A 2HUGA 4HJ5A 3TEHB 1VKZA 1JXLA 2UUBL 1VQ6A 4KHPH 1S72A 3WOEA 3PMFA 2VY3A 1FNWA 4DGZA 3GTQH 2VL6A 2VQDA 4DR1H 1N33Q 1GO3E 4FO2A 1EEID 3RZOB 4C3IB 1KIXA 1J5EL 2BH2A 4F88A 3OIQA 2RQXA 3HOVB 3GV5B 4J9KA 4A3EB 3FHWA 2W6PA 1VQFA 3DLLA 3VR3A 4IUPA 4DV7L 4EQPA 1KJ9A 4QF4A 3CQZA 4I50F 3TDQA 1JC7A 5BN3A 4X62Q 4JV2A 5ELOA 1VAJA 3DM3A 4A3FB 3KLWA 1EHIA 1Z2PX 3DWPA 3S14B 1IBMQ 4XT1B 3S17H 3V6KA 5KFIA 4NXMH 3RJ0A 3DXJC 4IN3A 1TWGB 2B63A 3NEMA 4MIUA 2W70A 1SYDA 3RV4A 1SEBD 3CCSA 1Z7TA 1N48A 1JKJB 1LLRD 2RDFA 1PTOC 5FO8B 4IUUA 2Y0SG 4KY6A 4U673 2RDJA 1D1IA 2ZTEA 3MJFA 2UUBQ 2R93B 1S5DD 3D0FA 4DV0L 3ULLA 3NTIA 4POFA 1YI2A 3HKSA 2WAQG 1BNZA 2NVTH 3RLFA 1CKOA 1HUNA 2IJ0A 1Q1EA 1Q46A 2HIXA 1KC8C 2MGSA 4GOPB 4B3TL 1SCUB 4K2LA 2I5MX 4HJ7A 1CHPD 3HOYH 1GM5A 3EN2A 2PNHA 3H0GH 4GLVB 1S0OA 4O4HF 3R3OA 2FLPA 1EIFA 2AQ3B 4MAMA 1I4XA 2F0VA 3PO3B 1OO9B 1U5KA 4K8JA 5IOCA 2PPBC 2UUAH 1VQ9A 2B2TA 3HOUH 2GVAA 2FMCA 2JJQA 3FPPA 2WE6A 2MJ8A 4DAVA 3OUZA 4Y8VB 5KFQA 1VQMA 4JI8Q 4DV1H 3OTOL 3OWFA 2F0JA 3T1YL 4BY1B 1LT5D 2YYZA 3MFYA 3ZYYX 4QQBX 1TVXA 4ZOLF 3PR4A 1PH4A 4YHHQ 4C3JG 1B50A 1G91A 5KNDA 1NCVA 4J8QA 1VF7A 3GP7A 4PQXA 5KT6A 4EBCA 1VDZA 1C48A 1Q82C 1UEBA 3NTHA 2YZNA 1S5FD 2C35B 4KJNA 3FKIA 1S5ED 3N41B 1N36L 4KHVA 2G9DA 2RDGA 5JEAJ 2HCIA 3M4PA 1HNZL 2FHTA 2W6QA 4LF7H 2FK3A 2R85A 5C44B 4GZYC 4ILWA 3I8ZA 3W2DA 3HZXA 4HR7A 1CI3M 4F4XA 4JI0H 1CSQA 2B63H 5KG6A 4LWCA 5KKNB 4FBTA 4GKKL 2XRSD 1HFNA 5KG7A 3RB0A 4EX5A 1AE3A 5FJ8G 4DUYH 4JI1Q 3GTLH 4RNNA 1KQSA 3TIGA 4JI3L 2A68C 2NVYB 5IGDA 1Q8IA 5KG0A 2NU9B 2UXDQ 3CW2C 4JI7H 5IT9W 1BNCA 3TZUA 1NMGA 2JA7A 3T1YQ 1QOHA 5M5YH 4M9UA 2PI2A 4IPCA 1DONA 1HRJA 1HPCA 2YRXA 5KFKA 5T14A 4DL4A 1CK1A 3UDFA 3Q0AA 2A69C 1MI2A 4QB4A 3BZCA 1Z2NX 2K5DA 2B2UA 1KDAA 2VQFQ 3STBD 3M4QA 1M90C 2UUCL 4XXEA 3VYSA 2BQRA 1XNQL 3VYUA 1UE5A 2EIFA 3FP9A 4YB8B 1E1TA 1B6SA 4JI4H 3CCUA 4ZK9B 4DUZQ 3HOXG 2L1BA 1B44D 3L9AX 3TP8A 1CA5A 1PYSB 1EY7A 3RB6A 2FPPB 4OONA 5GAEC 4RB2C 1EOVA 2WIIB 4FXDA 4A3FH 4NXMQ 1JMCA 5DGAA 1WTOA 4LF7L 2V1CC 2A19A 3KDFA 3GTPB 4BY1H 2MO0A 2BDOA 1YNXA 1L2FA 1V1QA 2CH4W 4LK1C 3B6YA 4DK3C 4JI0L 2IX1A 2DIKA 1FGBD 2EY5A 4A3GG 3ULPA 1SE4A 2KJXA 4JPBW 4MTEA 2C2RA 4DA2A 3K5NA 1S9FA 2KHIA 4DUYL 4JBKA 3VPCA 3T5KA 3A8IE 1EEFD 1BGWA 4LFBL 1EIHA 1I3QH 2PMZE 3PIO3 2PVPA 3A8JE 4OGQC 4OX9Q 4DV5Q 2R8IA 4L5QA 4H7BA 4ME3A 2M2LA 5COYA 4DFAA 1PH6A 1SMYC 4JCVE 1PFSA 1O75A 2YL2A 4L5TA 3S15B 5J3BA 2C5CA 1IL2A 1CKMA 1TA8A 2E75C 4RCNA 3S9WA 2DY7A 5KIXA 3HP3A 1TQOA 2DNCA 3BDLA 4XX0B 1CT1D 4ZQIA 1GHKA 3MHBA 3S1QB 4WFN3 4DUZL 4K0KQ 1LT4D 2IW3A 4A3DH 3S2DH 2BA0A 5C4JB 4YWLA 4CJ1B 2RF4A 4C3JH 1IW7C 3PO3G 2FMAA 4UCTA 5BN5A 3UE1A 4HJ9A 2V9WA 5C0XI 1B4OA 1Y8NB 2PQAA 5KFDA 4QIWA 4V190 3KDFB 4DK1A 3J7A5 1H9MA 4XYMB 3E5SA 3H20A 4O2BF 1DOKA 2WB1G 2W9BB 3I7FA 3SK6A 1JICA 4YY3Q 1K83A 1JB7A 3S17B 3O13A 4LF6L 4PMCA 2K28A 4WJ3M 2O5JC 1EWHA 4UP8A 5M3FB 4A3MH 4C2MB 3KLSA 4B3RQ 1NAPA 2LKVA 2L11A 4B9WA 5JPNC 1MSGA 2AGPA 2ZXPA 3KF6A 1VQAA 4DV5L 3PIP3 4JV5Q 2K75A 1IOVA 3GTMB 1F9QA 2WINB 3R2IA 3R8BA 1KLGD 2K5VA 1RD9D 1R4PB 4EEYA 4A93B 1EZ1A 4KD3A 5AJ3L 1RKNA 2R93A 4IZ8A 4B3TQ 1SJHD 2LXJA 5CV9A 2E76C 2GLTA 2Y0SB 1ONLA 3KYHC 3OW7A 3LWBA 4RB0A 1SE8A 1T5XD 1G6ZA 1IKMA 3Q8QB 4M8AA 4DUZH 3HS0C 2YU9H 1PYBA 1I6VC 3DWAA 5JPMC 3LWUA 4HR7B 1WCMG 3M4YA 4LF9H 1FNVA 2EJGC 3A54A 4CJ2C 2XN9C 1CM9A 4O4IF 5D1PA 5FOBB 3J80c 2PI2E 1PFBA 4YCWA 2EE1A 4QY7A 4A4IA 5EWFA 4OO1I 3PW2A 3IRBA 1KRTA 4YAJB 4B3MH 3FDTA 1ASZA 3S2HB 2B2TC 3P7JA 4C3IG 1U4MA 2I5HA 1IBLQ 3LMLA 5CV4A 5KT7A 1HNZQ 1ESFA 1T3NA 1K83H 1RK5A 4CKCA 1ZYRD 3NWSA 2AQ4A 3PW0A 2DPIA 4Y7NH 1PH7A 3KUPA 3P1HA 1VBGA 3JSNA 2R6GA 2OH2A 1XXGA 1SROA 2CKZB 1W3SA 4OL7A 4Q5VA 4JI2L 3Q2OA 3GQBA 3RAXA 1M4VA 2C2EA 4BBRH 4DR2Q 2I5LX 1SFOB 3J7AV 3TQTA 3F2DA 4GKKQ 3MA2B 2YCHA 3D4RA 2JA7G 3GIIA 3RMHA 3NE5B 3CVZA 1CHQD 1PRTB 5A2QE 4FF4A 3HOVH 2NVYH 2AQ2B 5FJ8H 2F0KA 1ULZA 4JBMA 2RSOA 5IGCA 1Y1WB 4IURA 5M3MG 4NW2A 2CW0D 3HKZB 2JE6I 3CHBD 4WD3A 3E3XA 4YCVA 2EOTA 5I9PA 1C4QA 3KF6B 2R92H 1UE1A 2CWAA 1KAWA 2MP1A 2VQEQ 4EEQA 3T1HQ 1K8GA 3S14H 3QZ8A 1ASYA 3OMCA 1S5CD 4DAMA 2GA4B 5C4XH 3X3MA 4O42A 2UVWA 1DV1A 3K3VA 3HOUG 3GIJA 2W9BA 2I0QA 1HR0L 1BKBA 4G7HC 1Q7YC 1NNXA 2V58A 3PCOB 1GJXA 3E5NA 2HQLA 1SMYD 4B3ML 4BXXG 1MBYA 4XYOA 4K6DA 1QB5D 2B2WA 4UAIA 4RB3C 1SEIA 1EWIA 1WTQA 4QWDA 1A6XA 3T5LA 4QW9A 3RZOH 2R92G 5CBEE 4A3EH 2YZGA 3CP0A 1I5FA 3BQ0A 2W7PA 4DAPA 1EQVA 4A3IG 3S1NH 1OWTA 3TP6A 1WD0A 5C4XG 5IP9H 3EPIA 4O3NA 1AFPA 2IT1A 4QWCA 4HYKA 1OXVA 4ED3A 3M4IA 5KFRA 4PDBA 4F7XA 4A3LH 3PO2H 5DM63 3G6YA 2Q2TA 3T1YH 1JR0D 1TS2A 3MXUA 3GILA 4A93H 3OHBA 1S3OA 1FGUA 3GDEA 4A3KH 4LUZA 1X56A 5LMNL 3TZDA 5CB4F 3NELA 1EWCA 2Q8RE 1H9SB 1UE6A 2A5HA 2Q2UA 2QEXA 5C4JH 1YJWA 1GUGA 1WSCA 3HOUB 2VPQA 4QUCA 4JYAQ 3NXWA 3D6CA 2FKLA 4NXNH 5KT2A 3CCLA 2QW7A 5LXTF 1Y1WA 4EYIB 3MWYW 4LFAL 5M5WB 1PH9A 2NTSA 3HOYB 2K6AA 4DR7Q 4RNMA 3GTLA 1RHPA 5DLFA 4A93G 4JOIA 4FP5D 1M0TA 1QVFA 4EYHB 4CKBA 2ZM6H 5JEAH 1C0AA 3RBDA 1F9PA 1IYJB 3HGBA 1K1QA 4JYAH 4JI3H 1IBLH 5KFZA 1MIUA 3H09A 3EVQA 1V8QA 5CMDA 3A5UA 3CCVA 4BBSG 3E9IA 5DAUA 4KKUA 1GKHA 2F0IA 1PH2A 3HRZC 4F50A 2R7FA 3EQLC 4ZHQF 3J7AK 4JBJA 3AEVA 3JRWA 4OX9L 3KHGA 3BZDB 4KD4A 2VUMG 3BU2A 3A74A 5K36H 2KUMA 1HTPA 2B2YC 3S15H 3U50C 1N32L 4IQZA 4BBRB 4EBEA 2ASDA 3L4KA 2RDIA 4O2DA 5DLGA 4DR4H 5G3LF 5KG4A 2L12A 5I6WA 4UP9A 2JA8H 2MQHA 4KY5A 2Z8LA 1KDBA 3I4NB 4BA2I 5KFGA 2Q8IB 4UY8C 4N8X1 4B3SQ 3BZKA 1KJJA 3AB9A 1IOWA 4RB1A 5DG7A 5IGEA 2F0UA 1D7QA 1B04A 2RA4A 4E6IA 3FPUB 5IYBG 1KABA 2ZDQA 3N42B 1BCPC 1SAPA 5IWAQ 4IJLA 1Q8KA 5FO7B 4OWXB 1ILPA 3G6XA 3MR3A 4LFAH 3CU7A 2F0TA 4UP7A 1N34H 4YAKB 4ZAIA 3Q1KA 2ES2A 1WTXA 2UUCQ 1EL0A 4EGQA 4XT3B 2ZM6L 2IHEA 4OIJA 1EY5A 3GV7B 1LTSD 1EFID 1J5EQ 2Z6BA 2G5DA 5KFYA 2B63G 3EPGA 2JP1A 4X66L 4GKJQ 2MO1A 2K01A 4N8FA 4FF2A 1G51A 5C0XJ 4AIMA 4YY3H 1SRUA 4JI8H 1N32H 1XMQL 4UDUC 3VR5A 4DK0A 3PGZA 3BVMA 3I72A 1S4ZA 3NK9A 2YZMA 4DR4L 4XIGS 5CR3A 1C3OA 1JOOA 4K5XA 3TMEA 1XMOL 5C0XH 5IYCH 4RAUC 4R4IA 5J1ZA 3I4LA 4LNQA 5DG8A 2NVXA 4LUOA 3Q24A 2WFWA 1TWGA 3URYA 1QNUA 4F87A 4ED6A 2EYPA 4I55F 1D2BA 1N56A 4O3SA 1KHIA 2L9HA 3NTKA 1IZ6A 1RTNA 2XC9A 3N8DA 4UCOA 2J6SA 4GKJH 2F0DA 4C3HH 1XNQQ 5EQ0A 4L8JA 4RZRA 4LF8Q 4O1NA 1DOMA 2SDFA 1MD2D 2D5DA 1YJ9A 2GVBA 4RZQA 4Q43A 2B2YA 2E2JB 4HMJA 2F0MA 3K5OA 2O03A 3J81L 3AQQA 2WB1A 5D65A 2VXWA 4ECXA 3V6HA 1WI5A 1U4LA 3EJIA 5FPOA 5FLMH 4BY7B 1NUCA 4J0MA 3GTPA 3JAMW 4TQSA 5KFPA 3JAMi 4RH6A 2ZJTA 4JI8L 4ED7A 1HUMA 1VQHA 1XMQH 1TS4A 4LH7A 1LABA 4A3GB 4K6LA 4MA0A 4MTDA 1K8AC 4B3RL 4H0LC 1N9WA 2PQEA 3GTJB 2R7NA 4DLKA 4MA5A 5KT4A 4ED8A 1V1OA 1VQ7A 1IL8A 4TUYF 4A2BA 4IRKA 3RLOA 3ORRA 3CC4A 1EU3A 1I94H 1ZEQX 1HA5A 1RJPA 1D5ZC 4B08A 3FRPB 1VQ8A 4RMFA 4A3KB 2JA6G 4CDFC 1X6OA 1Z9FA 2HHHQ 2XIGA 3M9OB 1Q3LA 1TWCH 3ERSX 4TSSA 3STBC 1RYSA 4E4TA 1YJNA 2R7MA 4XTCS 2W6MA 4JI5H 3MC0B 2FXQA 5J2UF 1VMCA 5IYCG 4Q8EA 1IHZA 1PA6A 2GPSA 4LH6A 4Y7NB 1GHJA 3BG5A 3NP8A 4LF5Q 4G7OC 4F4YA 3BYTB 1WCMA 4L6TB 1KAAA 2EY2A 2QCPX 2KVMA 2NVYA 2R8JA 5KNBA 4A3IB 1KNEA 5CA0F 2C2DA 5IYZF 4A3JG 1QUQB 2EZVA 4JI5Q 2VQEL 3QIAA 4J9SA 3K7UC 2NU8B 1HNWL 4HIMA 2AHOB 4LFCL 1TIID 3J80W 1RODA 2CVRA 3AFQA 4G3IA 4DV1Q 1JQYD 1XTDA 2XNAC 4C3HB 3HOXH 4AH6A 2IWHA 4DXGA 5JJLA 2TSSA 3H4BA 3PW7A 1PRTF 1B3QA 2CWPA 2JA6A 2DN8A 2FPGB 4YHHH 1WTWA 4JK1C 2VUMH 2RCNA 2R82A 4FU0A 4A3FG 1W93A 4JV0A 2D0OA 3S2HH 2OT2A 1YZ6A 5BPHA 3K3PA 2B2VA 2W6OA 3OHXC 3UDXA 3TIIA 5BR8L 2RSNA 2E2IH 3T53B 5C4ZA 2SNSA 3I4NG 2FK1A 1M1KC 3JZIA 2VB2X 4IAJA 2YTVA 1T36A 4F8MA 1WH2A 1XYIA 3J80i 1EY0A 2NB0A 3U9SA 2BE5C 2UXCL 1DIKA 1Q90A 3UQ8A 3JSLA 2E2HH 4BWSC 3VPDA 1E24A 1PFNA 2PMZB 1SYBA 4JI7Q 1U9RA 1HNWQ 2FFKB 3PO2G 1UC9A 4RHRA 1BVSA 2FLNA 3MEHA 5LMUH 4HTHA 3RGXA 2RHQB 1E2VA 3HKZE 2AUJD 1JWMD 4A3KG 2VQEH 3U58A 2I07B 3V6JA 2KHSA 2K52A 4LJZC 3SK8A 4MHEA 3RFCA 3A8KE 4Q0FA 2BQ3A 3A55A 4BBRG 1KEEA 5BPFA 1AUVA 4RG1A 3K5IA 3VR4A 4RGMA 3SDZA 3GTLB 1BCPB 3CQZH 1UNSA 2A73B 4DU9A 1PRTD 3GIMA 1E7ZA 5TSSA 1U0LA 4NPSA 1PHJA 4R7RA 5KG5A 2ENBA 1QWYA 3VYRA 4MV7A 5E4WC 3T13A 4HCEA 2NBFA 3TQ1A 4X3SA 1Y1WG 2R8HA 3T5JA 3I4OA 2WYOA 3F8NA 2X6GA 4GOPC 5IP7G 1CQJB 2PW7A 1AH9A 4ECZA 2K4KA 5NUCA 5KFVA 5C1OA 4Q0YA 1F2MA 5M5XB 3MFHA 4O3OA 4DL7A 4KY7A 5KFOA 3U4VA 2N55A 1BBXC 4IZOA 2B8FA 5DGBA 1N33H 1MJEA 3AU7A 2FK2A 1PZID 4C5CA 2H1EA 4H02A 4WBNF 2WB1E 1I50H 3W3AA 1U4RA 3KJOA 5K36G 3V4SA 4GC7A 2E5LH 3RB3A 1CTMA 2SNMA 2UU9Q 3H0GG 4XDXA 4JUZA 3GIDA 2E2HA 2EYJA 1HJPA 4EGVA 5LMUL 3NWTA 4DV7Q 2AKWB 1VQ5A 5CV8A 3ETJA 1J8IA 1GXDC 4X3KA 2CQOA 4X66Q 2K50A 3N44B 2BH8A 1XTCD 1LV9A 1JWSD 5K2MA 1K28A 3RGZA 5CV5A 4DNRB 3N6XA 1ZYRC 3KAJA 4KV6A 4X65H 3KHHA 4ABNA 5KFWA 4J9RA 2IBKA 2VZAA 5FLXE 4WJ4A 3F2CA 1LUZA 1PH3A 4NDXA 1ZHQA 4OO1H 5F9LA 2HCCA 2JA9A 4ZLTF 1P16A 2W8KA 4Z9CB 2W71A 2NWGA 4DUYQ 1A8VA 2FMMA 1VF5C 4QL5A 2R7ZG 2KENA 2ZM6Q 2F4VH 1ENFA 2EYHA 3KFUA 4HNUA 1XDNA 2ICEC 5F2DA 3GTGB 2NVXB 1E4EA 1C30A 2VQFL 1LYLA 2Z9HA 5LOVF 2UU9L 1EYGA 5HGQA 1ENAA 2W6ZA 3GTMH 2YS7A 4DR5Q 2R7DA 5A2QL 5IT9c 4YP3A 1A63A 1AN7A 1Z6HA 2AQ1B 2QKIC 5C5MA 4J15A 4X64L 1QZHA 3KF8B 5IE8A 2XCLA 2HGSA 5KT3A 5FKAC 3FMCA 4ZUIA 1B2TA 3VR2A 5C44G 4EG0A 4PNYA 1I4GA 5KYLA 2E2JH 5KFBA 4RKLA 3M9MB 1T9HA 3RF2A 4DR7L 4BY7G 2BE5D 4ECYA 1JT8A 2KEDA 1OXTA 2B2UC 4CC6A 5JJZA 4A3MB 2JA7H 3HOWG 1B6RA 4N9PA 5EKLA 5KG1A 2CQAA 2R8KA 1IBML 5JQWA 2PCFB 1WJJA 4MV6A 1Q86C 2IY5B 1YEZA 3K0YA 3K57A 4QUFA 1XMOH 1G2TA 5JAVA 1EOTA 2PQAB 4A3MG 3HOWB 1A15A 2XCAA 4J9MA 1GSAA 2QILA 1XPOA 5C3EB 1HR0Q 1GVPA 3KBXA 1LTAD 4GNXC 2CW7A 4EVOA 4R8NA 2LSSA 3BQ1A 5KFXA 3LX0A 4J9PA 4ZUJA 1B53A 2MUYA 1TWHH 2ZDHA 1TWCB 2CFMA 3SE7A 4C1NK 5F9NA 1YNND 5D14A 1I6UA 3OTOH 1TWAB 1GOZA 1X65A 3EBEA 5JJKA 4IPDA 2R7LA 4RA8A 3TP5A 4KHZA 5D3IB 4FS1A 1X54A 4G4KA 4DL3A 1AEXA 3JRXA 1QCBD 3VA5A 4DR4Q 3MTSA 4A3CH 3I91A 1AP0A 3E6ZX 3L2PA 1G2SA 1K0RA 4DXFA 4DV6L 1P8LA 2GN5A 3GTPH 4LF5H 4YWKA 4ED2A 1L2ZA 2W9CB 1M7JA 5FD5A 1HZAA 3HOZH 3GD7A 4P72A 3R5FA 1V9PA 5IODA 1II3A 2XGPA 4KHPQ 5EWEA 1TS5A 4DPGA 1VMPA 3MVVA 5DEHA 2GPWA 3P20A 1BBWA 1IBMH 4AYBE 1SNOA 2A6EC 1QVCA 2RKSA 1RF2D 1RIPA 1T5EA 1X3GA 2KCNA 4RCOA 3GTJH 4ECQA 1R9TB 3EYYA 4DR2H 1PYWD 3GTKH 2L55A 5LMNQ 1GSHA 5IGGA 3C1FA 1S5BD 2NN6G 3PO3H 1NR2A 4AQYQ 1HNXQ 3V96A 4LF7Q 2V4DA 3SEBA 4IFDH 4RHSA 2VS1A 1QNKA 1K0SA 1K3BC 1SNMA 5EAYA 3RZDB 1W6JA 3IFDA 3J81j 1TS3A 1JJCB 2JA5G 5KX5F 2K05A 3G8CA 3FEWX 1X3PA 4CBVA 4XZ3B 3CXCA 4LF6Q 4OHJA 3GO5A 4TKOB 3T1HL 2A1AA 4EGJA 1DYQA 3K5HA 4MZ9A 3IN5A 1NY4A 1PRTC 4DV2L 2ATLA 1HNWH 1O7IA 3H15A 5L9XA 4CGYB 3PUZA 1CZWA 3J81E 1STNA 4YR3A 4F4ZA 4RGOS 1W96A 4JV5L 1WFQA 1TWAH 5GONF 3OSNA 1KNAA 1VQCA 3KK7A 3DF7A 1L1OA 3RN5A 1T94A 3ETHA 1JX4A 1Z47A 1YHBA 5CYUA 1Y1VG 3D8GA 1B9NA 3KBGA 4DN4M 5CV6A 3HKZG 3LWEA 4DR2L 4U6PA 3U9OA 2E2IB 2K1BA 2F0OA 2PNRC 1L0YB 5IYDG 3MAQA 1A2TA 1OTCA 5KFMA 3W5OA 1RDPD 2VB3X 4Q45A 1WVLA 2QDBA 2QGQA 1JCKB 3IKJA 4LAAA 3RN2A 1JIHA 4X62H 5E1FA 1B7YB 3N6RA 1E3PA 1EY4A 3HOXB 4UCSA 4UCRA 2NZOA 2HDLA 2ZJQA 3CPFA 5I4DA 2K32A 3J81c 3V05A 3PF5A 2JEGA 4PMBA 2HVRA 1DOLA 2UXCH 1D5MC 1J9OA 4A3DG 4BBSB 2AGQA 4PZ8A 3H0GA 2VPSA 4GOPA 5DLQE 4JG2A 3BJYA 1STBA 3M9NB 4V0BA 4MV9A 4DR3L 2HVQA 1CS0A 4H44C 4Q8FA 5EJWA 2Z1CA 3Q23A 4HIKA 1PTOH 4HIOA 5EBCA 5J39A 5EKKA 2Z4IA 2B2WC 2YYAA 1CQFA 2L5TA 1BDOA 1EQRA 2RDHA 1CSPA 4G7ZC 1WOCA 2J7ZA 2WV6D 3MR5A 3EFXD 2SCUB 4BWGB 1J6QA 1LTLA 4K8IA 5T1IA 3TQYA 3CC7A 2UXCQ 1X3EA 4RAZA 4RUCA 3BQ2A 4ECUA 4LFBH 1SLJA 5KFCA 2DNEA 3CMEA 2O5IC 2R92A 2NVQB 2C9OA 2X69A 1WD1A 2K5HA 2KCMA 3S1RH 5D8DA 1H9SA 5KG3A 3KJPA 1LT3D 1R9TH 1TWFB 4AYBG 3DHQA 1EY6A 2EDGA 4TQUS 4I4TF 3GTQB 2G9HD 4OEMB 3RR5A 3KALA 5JH7F 1N34Q 5FPRA 1O80A 3U9TA 1ZETA 3PSIA 5C4XB 1KJQA 3PUWA 4GN5A 1KJIA 5C6AA 3WOFA 4R8UB 5M3FG 1N36Q 1UC8A 2FJZA 4R8UA 1I50B 2AGOA 2K33A 3D4WA 3RUZA 2MFIA 3ER0A 2K5QA 4ODGA 3RLNA 2QA4A 1FJGL 4I7AA 1EYCA 3MWDA 2TMPA 2LS01 3IL8A 1S03G 1VQ4A 1L0XB 1VBHA 4RGNA 3GTQA 2WAQE 5D3DA 1YBYA 2OWOA 4PG3A 3BYYB 2Y0SE 3S1MB 1B70B 2D62A 2HVSA 2F0SA 4OELB 1KBLA 2J6TA 2D2CC 1BJTA 1HR0W 3VMMA 4ME5A 3KLSX 3ONAB 1A9XA 4A3CG 4FS2A 4ZRZA 1XNRH 1VQEA 2ICIA 3SHLA 2HHHL 1K83B 2PZUA 2IA6A 1FNUA 2I8CA 3I90A 1G6PA 2CW0C 2DJFC 3GTKB 5DQGA 2VQFH 1RYRA 2HDMA 2KBNA 3H3VC 2KHJA 4LSAA 1N32Q 3HOZG 1IYVA 4MV1A 3L7ZC 1QJOA 1I7NA 4IPGA 4TV8F 2ALZA 4A3LG 4QCLA 3Q22A 4RU9A 3K59A 4HJAA 4FBUA 2P5ZX 3SK5A 2ASJA 1IXRA 3T5HA 2B8GA 2B39A 4P74A 3OTOQ 1Y1WH 4TQRA 1ML0D 1B9MA 3R2TA 4RKBA 5DM73 1EY8A 1F2LA 1VCIA 3TS0A 2R87A 3MXNA 5ELBA 4U7CA 1PH5A 2NUCA 4J1MA 1SYFA 5A35A 1WTPA 5KFFA 4EBDA 1X55A 2JXMB 5CBAE 3NPPA 1HR0H 2QDLA 4DV4L 4EFBA 4OWTB 5IT9E 3CCMA 4WRDA 5GROA 4HNTA 4BXXH 3HOWH 1WTVA 2ATWA 1I4PA 1STYA 4EQ5A 3I12A 4Q44A 4IR9A 3ORQA 5FO9B 3F2BA 1PZKD 4A2AA 3MWMA 5KFAA 4A3EG 1SNDA 3ZJYC 5BMVF 2XIWA 5KNCA 4JI2H 3D4DA 3BAAA 3T56B 2O2LD 1TWHA 1DZ1A 3PQIA 4MN3A 2UVRA 2FINB 4KK7A 3M4OB 1BF4A 2W57A 3HG9A 1BOSA 4R9WA 2A6HD 4OO1G 2ALYB 3A7LA 1ICFB 3TS2A 3TSSA 1X3FA 2W7OA 2CQYA 1H9RA 2KOLA 5C4HA 1QVGA 4RUAA 4QWBA 3T51B 1Y1VA 3I55A 3H6MA 5IWAL 1RL2A 2VW9A 1VQDA 4DR6L 1HHVA 2DZDA 2AWOA 2EPBA 1BQQT 3OWEB 5IY0A 1LTTD 3LGJA 2QF7A 3WO1A 4DV4H 3HOZB 3SE0A 1XPRA 3ERQA 2IP4A 4BS9A 1VQLA 2RGVA 3GTKA 4LSXA 1MJCA 4GC6A 1ET9A 2FB9A 3K5LA 1RK6A 2B2VC 2R7ZA 3DMUA 3QJYA 4R4QA 5KGUA 1V1PB 4A3JH 2PBZA 3KHRA 2F4IA 2VOBA 1S0NA 4JYAL 2JK8A 4JI0Q 1KC7A 1SYXB 1GUOA 3C46A 3K6OA 1PMRA 1K8MA 5ISRA 3K7AB 4PMWA 2ZDGA 1A3VA 1XMQQ 1M8AA 4ECTA 2Z6KC 1Q81C 3CKIB 2YRWA 5FK9C 4DNTB 3NHHA 1HZBA 5IIFA 5ELNA 2JQOA 5JVH3 1H95A 1AUXA 4LMYA 2VA3A 1KLUD 3GIPA 1BCPF 1GSOA 3S1RB 3IAYA 3BDOA 2A74C 4UHVA 4QIWE 4IOCA 4IFDJ 5LMNH 3HFZB 2L4NA 3QOLA 2BDNA 4CKEA 3I56A 3G4SA 1E4GT 3G71A 4TVAB 5LMUQ 2XSCA 4IOAA 2XD4A 3H40A 1TWAA 4DR6H 5KFNA 2UUAQ 2IX0A 1K3RA 2ZJPA 3TN2A 2NVTB 3G6VA 1CQVA 1Y1VH 2FLLA 1A62A 2PYKA 1I3QA 4X3UA 1V43A 2CZGA 4J9QA 2UVUA 2J9GA 4WORA 3VDYA 3OW2A 4XYQA 4CC5A 4JI2Q 1FR3A 2JA5A 3J7AF 1IBKQ 1AW7A 2VUGA 1SE3A 2XWBB 1PH1A 3V2TA 1SJED 3I4MB 1GUTA 5K5PA 3CPWA 1BR9A 3BJUA 5HGTA 2R86A 1D6EC 4B3TH 2R61A 2N8NA 2RBMA 4DV6Q 3I4NH 4IR1A 2D0PA 2PW5A 1UE7A 2OCEA 4JI7L 4O3QA 4YR2A 3G6JB 4JBWA 4UCUA 2W6NA 2M00A 4R4CA 4DR5L 5I9OA 1EIYB 4DV1L 4DV2Q 1OXXK 4IHJF 1CQIB 2A69D 2XGTA 1JDEA 3NSWA 1L0WA 1PVOA 4PZ6A 4BY1G 3R5HA 5KG2A 3DWQA 4YWMA 3AMUA 1CKNA 4I7ZC 2UUCH 4A3BB 2R84A 1BXTA 1GUNA 3GTOH 5GQOA 2KQ3A 4IPHA 4JC0A 2NU7B 3CQZB 3TREA 5JJIA 4KJOA 3S16B 1V51A 3AYHB 3OSOA 5ELCA 1VQKA 1E2WA 2UXBL 4DL5A 3H0GB 3PVXA 5IP7H 3C1EA 4YBZB 5CORA 5KFHA 4S3SA 3DM1A 4NMZA 4ETSA 4ED1A 3E9HA 1BCPD 1HNZH 3KAKA 1Q12A 3GIQA 5J2TF 5C5JA 3WO0A 3BS1A 1W2BA 2O4XA 1CA6A 3UE0A 1EFWA 2ZXRA 2JEFA 4BA1I 3OMGA 4J9LA 1YHAA 3RAQA 4HAEA 3TP7A 4A76A 1MSHA 3OUUA 3TBIB 1TR5A 5KFEA 5M3MB 3IG0A 4EQOA 4IALA 2JA5H 5KFTA 5C0XG 1L1OB 5FLXc 1WTHA 2BOSA 2WAQB 1HQRD 2WAQA 2HD3A 2YU9A 1H9JA 4X66H 1YITA 2EY1A 3RTXA 4GS3A 4OXPA 4A3BG 4DR5H 3VR6A 1Y8OB 1DXMA 1HH2P 4OIKA 3K58A 5HBRB 4X65Q 2I46A 2JN4A 2L15A 2WKDA 2R7KA 4ECWA 4B3SH 1I6HB 2OXPA 4IFDI 4J9NA 3KOJA 3MZ5A 5EPLA 1IYUA 4JI4L 3BA9A 4QWEA 2W9AA 3CC2A 2UXBH 3DEOA 1YNJD 1AZPA 3GTOA 3I70A 4KLKA 1K73C 2KECA 2UXDL 5GADC 1HXYD 4K2KA 1JE5A 1HCZA 2CH4A 1TT2A 3SI8A 1EYZA 2F3IA 4YJ2F 3H4DA 5L1JA 2E8GA 4P71A 2M05A 1AZQA 1MGSA 3UDIA 1CKNB 1G8ZD 1EUCB 5HURA 3FKIH 4A3DB 1X32A 3K0XA 4L5SA 4A3GH 5D1OB 4DAYB 1N8RC 2A6HC 4AYBB 5CAEB 2K03A 3MWEA 4FF1A 1EYDA 1TWHB 2D9UA 2B63B 3GIKA 3NBHB 1TKWB 1NSNS 4A3JB 4GN3B 5ELEA 2K5WA 5EGTA 2IL8A 3S2DB 2WACA 3RBEA 1NR4A 5JUMA 3QOJA 3H3VI 1I4QA 4Y52H 1RJRA 4O0AA 4QGUA 3HB9A 5BN4A 1M0WA 4C3HG 4PWQA 3PZPA 4B3SL 1EQQA 1JE4A 3Q8PB 1U4PA 1O78A 4DV3L 3PIPA 2JEJA 2A6ED 2NYZD 1JWUD 4YHHL 1SXTA 1PTOF 1LTBD 5ELDA 1JJ2A 5C3EG 1FKAH 1I7LA 2F3VA 3GV8B 4M7EA 4MV3A 3CRLC 4A3BH 4RFBA 1BBUA 1STEA 1NBWA 4ULLA 1TAEA 4LF6H 2F4VQ 4YQWA 1PFMA 2V59A 3G48A 3A56A 2WP8J 1IBKH 4MTNA 5J22A 1Q1BA 2N3SA 2CW8A 2EJMA 3KTMA 4DV5H 1PZJD 1RCVD 4K0KL 1FYCA 4HSPA 3CF5A 2IX3A 2K7VA 2MHVA 1KXLA 1A2UA 4CJ0B 1E1OA 2JA6B 1L1OC 5I47A 2OF1A 4JI3Q 4GNXB 4ECVA 3H91A 4IUQA 5AFWA 3OOCA 2N49A 2AU0A 4ZKCB 1QE6A 4R1JA 4LFCH 3SVMA 2N78A 1H9KA 1MHWC 5JVG3 1EZ6A 5EBDA 4FYDA 1K1SA 3HKZA 2YTXA 3SK4A 3CCQA 3PIOA 3CAMA 3KHLA 3J81W 3IFTA 1VQGA 4O2AF 2E5LQ 5IP9G 2FPIB 2DY8A 2R6FA 2FJ2A 1BO0A 3EIVA 1TXYA 1WCMB 3HBLA 2DWCA 4LF9L 2J4XA 5IWAH 4FF3A 1SFOH 2BA1A 3GTOB 5JOBA 3GQCA 4DR3Q 3PUVA 3JC66 2UXBQ 2KA7A 1ET6A 5C44H 3T4AC 4RWSC 3MXPA 2BQUA 3PUYA 5JEAG 5KRUA 3RB4A 1A3TA 1LM0A 4KMUC 1LO5D 1ZXTA 4LW1A 3VA7A 4M1UB 3HOVG 4QJFA 2MNAA 4C5BA 2RHSB 1JOKA 1TWCA 4HCSA 4LUVA 2E5LL 2C22A 2DUDA 3K81C 3K80C 5KFSA 3SR1A 1S68A 1TWFA 2SEBD 1JB3A 1XNRQ 4OWWB 2JYOA 3FKIB 3I2ZA 4DV4Q 4FVMA 4DL6A 3MFIA 4JOIC 4JW0A 4RGTA 2R92B 1D8LA 2PN1A 2Z6KA 2IMWP 2EXZA 4DF7A 4X64Q 2YV5A 2WB1B 4LF9Q 1DV2A 2ASLA 4JI6L 4HQ6A 4HIDA 4MV4A 1WR2A 2L0CA 4UFZA 1HZ9A 4MTKA 1FJGQ 1B1ZA 3ND8A 1KRSA 1EY9A 4IUVA 1Y1VB 3S24A 4KKTA 1QZGA 1I6HH 5DQHA 5KT5A 5T1GA 2NZHA 1ZQ7A 2WKCA 1XMOQ 3F2UA 1LACA 4CDDC 1C7YA 3I73A 4DKAC 2I80A 1EZ8A 2F0HA 5KFUA 2DGYA 2R8GA 3E0EA 3Q8SB 1UNNC 3S1NB 3RUPA 1BUVT 2F3WA 3K7AH 5DQIA 1XX8A 4X64H 1O7YA 3CD6A 2QEJC 3JAME 3I4MH 1SYEA 5IGFA 4IRDA 3HXLA 1JOQA 5I2YA 1SNPA 1IBLL 4DR6Q 2E2IA 3PO2B 1R4QB 5CA1F 1SDFA 2JSOA 2JA5B 1NJIC 1EU4A 2IHFA 4I65A 2KEEA 3FKIG 5LMNW 3WDNA 4OX9H 1W6KA 1DGSA 4G57A 5E7NA 3GTGH 2B3GA 3Q8DA 2IPKD 4ZYSA 2OTJA 1GUSA 2UVVA 5IGBA 3K5MA 3RNUA 2ID0A 3S1QH 4X65L 1C9OA 5BR8Q 2F0QA 4B9XA 4KN4C 2ZXOA 4JI6H 1YVCA 4MV8A 3FMAA 3R5XA 1X9NA 1SSOA 5G3LD 1ICWA 4HN7A 3MXNB 3NBIA 2RGRA 1LT6D 1UEAB 1I4RA 5KFLA 1S0MA 4NLGA 5C1PA 2BR0A 2E2HB 1VQJA 4NXNL 1EUDB 4K5WA 4CDEC 5H80A 3M85A 2UU9H 4PV1C 3W1GA 3BVZA 2KSWA 1SN8A 5C3EH 4K5VA 5M3MH 1JJGA 2JEIA 5M3FH 2DLNA 1Y8PB 2R93G 4R4OA 2LXKA 3NBHA 2J0TD 1N34L 3J80E 2P0AA 4F4WA 4DV0Q 1RTOA 4B3MQ 4NB3A 1ILQA 5EOYA 2XTIA 4GN4B 5LL6b 5EWGA 3TRZA 1F77A 1V1PA 5KFJA 4AYBA 3MEFA 2HQEA 2R7ZB 3ICEA 1GGOA 2A68D 5D1OA 2Q2HA 1M6VA 3A7AB 1WYDA 2EY6A 3H94A 3OSPA 5H1SE 4LF5L 2VR1A 2F0GA 1GYFA 2AUKA 2LY7A 1CFMA 1I4HA 3CCEA 2XRQD 2F0PA 4ID6A 4ZKBB 3S16H 3KXYT 3J81i 5DNFA 4FNFA 4X3TA 3P75A 4A3IH 2BCOA 1CZGA 1MKHA 1NE3A 4NXNQ 2W9CA 1IW7D 4L63B 1STGA 3ULJA 2QK4A 4YR0A 2EXDA 2W8LA 2RVLA 3D31A 1S40A 2F52A 2E2DC 4MNOA 3M7NA 3PN1A 1O7ZA 3OPOA 5I6YA 4DR1L 3OIPA 4C2MH 1RJTA 5HV6A 3MR2A 3CCJA 4C3IH 2UXDH 1Z2OX
chains in the Genus database with same CATH topology
2AWOA 3HKZE 3M3YH 5IY0A 1WCMH 4JCVE 4A3KG 1PH6A 1KL9A 1PFSA 1Y14B 3U58A 5FLMG 4L5TA 2OTLA 5J3BA 3LGJA 1IL2A 1CKMA 2K52A 1XPRA 4L5SA 1VQLA 1NMFA 4DUZL 1MJCA 4BBRG 4K0KQ 1VQBA 1CUKA 4A3DH 3S2DH 2BA0A 4YWLA 4RG1A 2RF4A 4C3JH 3PO3G 4R4QA 3UE1A 4HJ9A 4A3JH 5C0XI 2PQAA 3CQZH 4JYAL 1E7ZA 3KDFB 2JK8A 4JI0Q 3J7A5 1U0LA 4NPSA 1PHJA 2JEAI 1I6HH 2JA6H 4PMWA 2WB1G 3I7FA 2YTYA 1XMQQ 4YY3Q 1Y1WG 1JB7A 3I4OA 2Z6KC 1Q81C 1E22A 4LF6L 4WJ3M 4GOPC 5IP7G 1HZBA 4YY3L 5ELNA 2JQOA 1AH9A 1H95A 3JAMc 4UP8A 2K4KA 4A3MH 3M9BA 4B3RQ 2A8VA 1SR3A 3U4VA 1FL0A 3KF6A 4QIWE 4IOCA 1B8AA 1VQAA 5HY6A 4DV5L 1MJEA 3PF4A 4IFDJ 3HFZB 3G4SA 2K75A 3I56A 2CCZA 4JV5Q 4H02A 2WB1E 1I50H 5K36G 3G71A 2Z0SA 3KJOA 2KCTA 4TVAB 5AJ3Q 5LMUQ 2UU9Q 2K5VA 4POGA 4IOAA 5IYDH 3H0GG 2AWNA 1HJPA 5AJ3L 5LMUL 1QUQA 2UUAQ 2IX0A 1K3RA 4DV7Q 2AKWB 4B3TQ 2LXJA 2ZJPA 1VQ5A 4APVA 1Y1VH 2UUAL 1A62A 2CQOA 4X66Q 3KYHC 4X62L 2K50A 1V43A 3RZDH 2BH8A 4A3GH 4GKJL 1SE8A 1IBKL 3VDYA 3OW2A 4JI2Q 1IBKQ 1PH1A 4JI1L 3CCRA 2VZAA 2YU9H 3CPWA 1PYBA 3BJUA 3F2CA 1LUZA 1PH3A 4DV3Q 4WJ4A 4YCUA 1WCMG 2JA9A 2N8NA 4DV6Q 1P16A 4FDBA 3I4NH 2D0PA 3NENA 1VQIA 5M5XH 4DK6C 1UE7A 2OCEA 3U4ZA 4DUYQ 1A8VA 3UDGA 4JI7L 4QL5A 2R7ZG 2KENA 1YIJA 2ZM6Q 4JBWA 2PI2E 4YCWA 1VS0A 4QY7A 3J80c 3KFUA 4A4IA 4R4CA 4DR5L 4OO1I 2VQFL 3IRBA 1LYLA 1KRTA 1OXXK 4DV1L 4DV2Q 1EYGA 1EIYB 5HGQA 2UU9L 2XGTA 3GTMH 4DR5Q 1L0WA 2R7DA 1PVOA 4PZ6A 4BY1G 1ASZA 5IT9c 1A63A 4YWMA 1CKNA 2I5HA 1IBLQ 4J15A 1HNZQ 4X64L 1K83H 1QZHA 4P75A 3GTOH 3KF8B 5GQOA 4IFDG 1HNWL 1JJGA 4Y7NH 2EQSA 4IPHA 4JC0A 5IE8A 1PH7A 2R6GA 4JI6Q 1I94L 3TREA 1KD1C 5JJIA 1SROA 2CKZB 1W3SA 3AYHB 4JI2L 5C44G 1VQKA 2UXBL 2ZJRA 4BBRH 4DR2Q 2I5LX 5IP7H 1SMXA 3F2DA 4GKKQ 2E2JH 2JA7G 4BY7H 1OXSC 2OQ0A 3E9HA 4GLXA 1Q12A 3HOVH 3WWVA 1T9HA 2NVYH 2K14A 4LFAQ 4DR7L 1OXUA 5FJ8H 4BY7G 4JBMA 1VQNA 1JT8A 1OXTA 1W2BA 2NVQH 3UE0A 5M3MG 1EFWA 2JA7H 3HOWG 2JE6I 4JI5L 1IBML 4L5RC 4YCVA 4BBSH 1HZCA 4BA1I 1PH8A 1WJJA 3J7ZC 4LFCQ 1TWFH 1YHAA 3KF6B 1Q86C 2R92H 2IY5B 1UE1A 1YEZA 2NVXH 4A76A 1TWGH 2CWAA 1KAWA 2PQAB 2VQEQ 3T1HQ 4A3MG 1K8GA 3S14H 1ASYA 2JA5H 5C0XG 1L1OB 4DAMA 5FLXc 5C4XH 1XPOA 1HR0Q 1GVPA 4GNXC 3HOUG 1YHQA 2I0QA 2LSSA 1YITA 1I94Q 1BKBA 4GS3A 4PZ7A 1Q7YC 1HR0L 5GAHC 1NTGA 3PCOB 4OXPA 4A3BG 3K8AA 2HQLA 3G6EA 1A0IA 1TWHH 4B3ML 2JA8G 1HH2P 4BXXG 2CFMA 3HOYG 4X65Q 4AQYL 1HNXL 2ASBA 2L15A 1X65A 1EWIA 3EBEA 3I4MG 1PV4A 4JI4Q 3RZOH 5JJKA 4IPDA 2R92G 4IFDI 3KOJA 4KHZA 2JEBI 1X54A 3H3VH 4A3EH 4JI4L 1G291 3CP0A 2HIVA 4DR4Q 1I5FA 1VQPA 4A3IG 3S1MH 3S1NH 4A3CH 3CC2A 5M5WH 4P73A 3L2PA 5GAGC 2HT1A 5C4XG 1K0RA 5IP9H 4DV6L 1P8LA 2GN5A 3GTPH 4KLKA 2IT1A 1K73C 4IJHA 4YWKA 1GD7A 2UXDL 5GADC 3OYYA 1OXVA 1JE5A 4A3LH 1HZAA 3HOZH 3GD7A 4P72A 4R4TA 2F3IA 3PUXA 2Q2TA 1V9PA 2E8GA 3PO2H 4P71A 4KHPQ 3UDIA 4DPGA 5IYBH 1BBWA 1CKNB 4LFBQ 4A93H 3W1BA 3A5ZB 1S3OA 4AYBE 3FKIH 1FGUA 1QVCA 3GDEA 3K0XA 1EUJA 4LUZA 1RIPA 1X3GA 4DAYB 4A3KH 1X56A 1N8RC 3GTJH 5LMNL 3GTKH 3NELA 2ZTDA 1VQOA 1UE6A 5LMNQ 2VNUD 2Q2UA 2QEXA 5C4JH 1UWVA 2NN6G 3NBHB 1YJWA 2R7ZH 4AQYQ 1HNXQ 3PO3H 2K5NA 4GN3B 3AFPA 4LF7Q 4JYAQ 2VS1A 3H3VI 3CCLA 3M4OH 3A0JA 4LF4L 4Y52H 2H5XA 4O0AA 4QGUA 4LFAL 1PH9A 4DR7Q 5EAYA 4X6AH 4KI0A 3J81j 4B3SL 4JOIA 4A93G 1JJCB 1EQQA 2JA5G 3F8TA 1QVFA 4DV3L 3PIPA 2OQKA 1C0AA 4KHPL 1IYJB 4YHHL 1JJ2A 4DNIA 5C3EG 1AE2A 1MIUA 1XNRL 3CXCA 4LF6Q 3A5UA 3GO5A 3CCVA 3T1HL 4BBSG 2A1AA 3E9IA 1GKHA 1PH2A 4MZ9A 4A3BH 2R7FA 1NY4A 4DV2L 4JBJA 4ALPA 2F4VL 4OX9L 3AEVA 4IO9A 1O7IA 3H15A 2VUMG 1BBUA 3BU2A 3PUZA 1NBWA 2NN6I 3A74A 2F4VQ 3SGIA 3S15H 3U50C 4JV5L 1WFQA 1N32L 4LF8L 3G48A 3L0OA 1TWAH 2WP8J 2R93H 4MTNA 1VQCA 4O2DA 1Q1BA 4A75A 2N3SA 1L1OA 2B29A 4UPAA 3RN5A 1N33L 1Z47A 1YHBA 1FVIA 4K0KL 1Y1VG 4UP9A 2JA8H 2MQHA 3HKZG 4DR2L 4BA2I 3CF5A 3CMAA 4UY8C 1KXLA 4B3SQ 3BZKA 4NXML 1E1OA 1L1OC 5IYDG 4GNXA 1OTCA 4GNXB 4JI3Q 4LF4Q 1D7QA 3W5OA 5IYBG 2N49A 4GLAC 2QGQA 4R1JA 2N78A 3RN2A 1K9MC 5IWAQ 4DR1Q 1B7YB 2AMCB 4IJLA 2YTXA 1XJVA 1E3PA 3PV0A 3CCQA 3F1ZA 1Q8KA 2NZOA 4OWXB 3PIOA 2ZJQA 3CAMA 3CPFA 3J81c 3PF5A 1VQGA 4UP7A 2E5LQ 5IP9G 2Q2IA 4A3DG 2ES2A 4PZ8A 2UUCQ 2ZM6L 2IHEA 2ZTCA 3EIVA 5DLQE 4HJ5A 3TEHB 1TXYA 4JG2A 4HJ8A 4GOPA 2UUBL 1S72A 1VQ6A 4LF9L 2VY3A 3GTQH 2VL6A 4DR3L 1J5EQ 1N33Q 1SFOH 1GO3E 2BA1A 2B63G 2BH2A 1KIXA 4DR3Q 1J5EL 4HIKA 4X66L 3PUVA 4HIOA 4GKJQ 2MO1A 3JC66 3FHWA 2UXBQ 1VQFA 3DLLA 4DV7L 5C44H 1G51A 5C0XJ 1EQRA 4AIMA 1SRUA 1CSPA 1WOCA 3PUYA 4X62Q 1XMQL 5JEAG 3PGZA 5ELOA 4DR4L 4XIGS 1J6QA 3DM3A 1LM0A 1LTLA 3CC7A 4LW1A 3KLWA 3TQYA 1XMOL 4QJFA 3HOVG 1X3EA 2MNAA 2UXCQ 2RHSB 5IYCH 1IBMQ 1SLJA 4R4IA 2E5LL 4LUVA 3S17H 2DUDA 3K81C 3K80C 3CMEA 4LNQA 1XNRQ 4OWWB 3I2ZA 2K5HA 4DV4Q 2KCMA 4LUOA 3S1RH 2WFWA 3NEMA 3KJPA 4JOIC 1R9TH 3CCSA 1D8LA 4AYBG 1KHIA 2Z6KA 2Y0SG 4TQUS 3RR5A 1IZ6A 1XPUA 2ZTEA 4X64Q 1N34Q 2UUBQ 2YV5A 3D0FA 4C3HH 4DV0L 4LF9Q 3ULLA 1XNQQ 4POFA 1YI2A 3HKSA 2WAQG 3PSIA 4LF8Q 4JI6L 2NVTH 3PUWA 4GN5A 4HIDA 3RLFA 1CKOA 1HZ9A 1FJGQ 1YJ9A 1Q1EA 1Q46A 2HIXA 1KRSA 5M3FG 1KC8C 4GOPB 2GVBA 1N36Q 4B3TL 3S24A 2MFIA 3ER0A 3RLNA 1QZGA 1FJGL 2I5MX 2QA4A 4HJ7A 3HOYH 1GM5A 3EN2A 3H0GH 2PNHA 4GLVB 3AQQA 2NZHA 1XMOQ 1EIFA 1C7YA 1WI5A 1VQ4A 4DKAC 1U5KA 2WAQE 5FLMH 1VQ9A 2GVAA 2JJQA 3HOUH 2DGYA 1VQMA 4JI8Q 1YBYA 3OTOL 3E0EA 3T1YL 2OWOA 3JAMi 2YYZA 4PG3A 4QQBX 4JI8L 2Y0SE 1B70B 1VQHA 2D62A 3K7AH 1PH4A 4YHHQ 1K8AC 4B3RL 1N9WA 3CD6A 3I4MH 1HR0W 1VQ7A 3RLOA 3CC4A 1IBLL 1Q82C 1UEBA 4DR6Q 4A3CG 2C35B 1VQ8A 1VQEA 2HHHL 4RMFA 1NJIC 2JA6G 2IHFA 1G6PA 1X6OA 1Z9FA 3FKIG 1N36L 5LMNW 2HHHQ 5JEAJ 3M4PA 1DGSA 2KBNA 5E7NA 1HNZL 1TWCH 2B3GA 2KHJA 3ERSX 3Q8DA 3GTGH 3HOZG 1N32Q 2OTJA 3STBC 4DR6L 3RNUA 3L7ZC 4IPGA 1YJNA 4A3LG 4XTCS 2ID0A 3S1QH 1CSQA 2B63H 4HJAA 4X65L 1C9OA 2FXQA 4LWCA 5BR8Q 1IXRA 5IYCG 1PA6A 4GKKL 1YVCA 4EX5A 1X9NA 1AE3A 4P74A 5FJ8G 3OTOQ 1Y1WH 4JI1Q 4LF5Q 3GTLH 1KQSA 1VCIA 4JI3L 3TS0A 3MXNB 1PH5A 2UXDQ 3CW2C 1NMGA 1X55A 3T1YQ 4A3JG 1QUQB 4JI5Q 5M5YH 2VQEL 2PI2A 4IPCA 1VQJA 3K7UC 4NXNL 3UDFA 4DV4L 4HIMA 2AHOB 4LFCL 4OWTB 3BZCA 3W1GA 3M85A 3CCMA 5GROA 4BXXH 1SN8A 3AFQA 5C3EH 5M3MH 2VQFQ 3STBD 5M3FH 4DV1Q 3HOWH 3M4QA 1XTDA 1M90C 3HOXH 2ATWA 2UUCL 4AH6A 4R4OA 4EQ5A 2R93G 2LXKA 5JJLA 1N34L 4DV0Q 2CWPA 3F2BA 1XNQL 4B3MQ 4NB3A 1UE5A 2EIFA 3FP9A 4A3EG 2XTIA 4GN4B 1E1TA 3ZJYC 2RCNA 3CCUA 2VUMH 3TRZA 4DUZQ 3HOXG 4A3FG 3MEFA 1PYSB 2D0OA 3ICEA 3S2HH 2Q2HA 1YZ6A 1WYDA 5H1SE 4LF5L 4OONA 5GAEC 1EOVA 4A3FH 3UDXA 4NXMQ 5BR8L 3CCEA 2E2IH 1JMCA 4LF7L 2V1CC 2A19A 3KDFA 3S16H 3J81i 3I4NG 1M1KC 4BY1H 4OO1G 2MO0A 2ALYB 2YTVA 1YNXA 4A3IH 1L2FA 1V1QA 1MKHA 1NE3A 4DK3C 3B6YA 2IX1A 4JI0L 3TS2A 3J80i 4NXNQ 4A3GG 1X3FA 3ULJA 3ULPA 2UXCL 2EXDA 2E2HH 3D31A 1E24A 1S40A 1QVGA 2F52A 2KHIA 4DUYL 4JBKA 4MNOA 3M7NA 4JI7Q 4LFBL 1HNWQ 3I55A 1I3QH 3PO2G 2PMZE 4C2MH 5IWAL 1RL2A 4DR1L 4OX9Q 4DV5Q 1BVSA 1VQDA 2VW9A 4L5QA 3CCJA 4ME3A 4C3IH 2RHQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWO A;  3HKZ E;  3M3Y H;  5IY0 A;  1WCM H;  4JCV E;  4A3K G;  1PH6 A;  1KL9 A;  1PFS A;  1Y14 B;  3U58 A;  5FLM G;  4L5T A;  2OTL A;  5J3B A;  3LGJ A;  1IL2 A;  1CKM A;  2K52 A;  1XPR A;  4L5S A;  1VQL A;  1NMF A;  4DUZ L;  1MJC A;  4BBR G;  4K0K Q;  1VQB A;  1CUK A;  4A3D H;  3S2D H;  2BA0 A;  4YWL A;  4RG1 A;  2RF4 A;  4C3J H;  3PO3 G;  4R4Q A;  3UE1 A;  4HJ9 A;  4A3J H;  5C0X I;  2PQA A;  3CQZ H;  4JYA L;  1E7Z A;  3KDF B;  2JK8 A;  4JI0 Q;  3J7A 5;  1U0L A;  4NPS A;  1PHJ A;  2JEA I;  1I6H H;  2JA6 H;  4PMW A;  2WB1 G;  3I7F A;  2YTY A;  1XMQ Q;  4YY3 Q;  1Y1W G;  1JB7 A;  3I4O A;  2Z6K C;  1Q81 C;  1E22 A;  4LF6 L;  4WJ3 M;  4GOP C;  5IP7 G;  1HZB A;  4YY3 L;  5ELN A;  2JQO A;  1AH9 A;  1H95 A;  3JAM c;  4UP8 A;  2K4K A;  4A3M H;  3M9B A;  4B3R Q;  2A8V A;  1SR3 A;  3U4V A;  1FL0 A;  3KF6 A;  4QIW E;  4IOC A;  1B8A A;  1VQA A;  5HY6 A;  4DV5 L;  1MJE A;  3PF4 A;  4IFD J;  3HFZ B;  3G4S A;  2K75 A;  3I56 A;  2CCZ A;  4JV5 Q;  4H02 A;  2WB1 E;  1I50 H;  5K36 G;  3G71 A;  2Z0S A;  3KJO A;  2KCT A;  4TVA B;  5AJ3 Q;  5LMU Q;  2UU9 Q;  2K5V A;  4POG A;  4IOA A;  5IYD H;  3H0G G;  2AWN A;  1HJP A;  5AJ3 L;  5LMU L;  1QUQ A;  2UUA Q;  2IX0 A;  1K3R A;  4DV7 Q;  2AKW B;  4B3T Q;  2LXJ A;  2ZJP A;  1VQ5 A;  4APV A;  1Y1V H;  2UUA L;  1A62 A;  2CQO A;  4X66 Q;  3KYH C;  4X62 L;  2K50 A;  1V43 A;  3RZD H;  2BH8 A;  4A3G H;  4GKJ L;  1SE8 A;  1IBK L;  3VDY A;  3OW2 A;  4JI2 Q;  1IBK Q;  1PH1 A;  4JI1 L;  3CCR A;  2VZA A;  2YU9 H;  3CPW A;  1PYB A;  3BJU A;  3F2C A;  1LUZ A;  1PH3 A;  4DV3 Q;  4WJ4 A;  4YCU A;  1WCM G;  2JA9 A;  2N8N A;  4DV6 Q;  1P16 A;  4FDB A;  3I4N H;  2D0P A;  3NEN A;  1VQI A;  5M5X H;  4DK6 C;  1UE7 A;  2OCE A;  3U4Z A;  4DUY Q;  1A8V A;  3UDG A;  4JI7 L;  4QL5 A;  2R7Z G;  2KEN A;  1YIJ A;  2ZM6 Q;  4JBW A;  2PI2 E;  4YCW A;  1VS0 A;  4QY7 A;  3J80 c;  3KFU A;  4A4I A;  4R4C A;  4DR5 L;  4OO1 I;  2VQF L;  3IRB A;  1LYL A;  1KRT A;  1OXX K;  4DV1 L;  4DV2 Q;  1EYG A;  1EIY B;  5HGQ A;  2UU9 L;  2XGT A;  3GTM H;  4DR5 Q;  1L0W A;  2R7D A;  1PVO A;  4PZ6 A;  4BY1 G;  1ASZ A;  5IT9 c;  1A63 A;  4YWM A;  1CKN A;  2I5H A;  1IBL Q;  4J15 A;  1HNZ Q;  4X64 L;  1K83 H;  1QZH A;  4P75 A;  3GTO H;  3KF8 B;  5GQO A;  4IFD G;  1HNW L;  1JJG A;  4Y7N H;  2EQS A;  4IPH A;  4JC0 A;  5IE8 A;  1PH7 A;  2R6G A;  4JI6 Q;  1I94 L;  3TRE A;  1KD1 C;  5JJI A;  1SRO A;  2CKZ B;  1W3S A;  3AYH B;  4JI2 L;  5C44 G;  1VQK A;  2UXB L;  2ZJR A;  4BBR H;  4DR2 Q;  2I5L X;  5IP7 H;  1SMX A;  3F2D A;  4GKK Q;  2E2J H;  2JA7 G;  4BY7 H;  1OXS C;  2OQ0 A;  3E9H A;  4GLX A;  1Q12 A;  3HOV H;  3WWV A;  1T9H A;  2NVY H;  2K14 A;  4LFA Q;  4DR7 L;  1OXU A;  5FJ8 H;  4BY7 G;  4JBM A;  1VQN A;  1JT8 A;  1OXT A;  1W2B A;  2NVQ H;  3UE0 A;  5M3M G;  1EFW A;  2JA7 H;  3HOW G;  2JE6 I;  4JI5 L;  1IBM L;  4L5R C;  4YCV A;  4BBS H;  1HZC A;  4BA1 I;  1PH8 A;  1WJJ A;  3J7Z C;  4LFC Q;  1TWF H;  1YHA A;  3KF6 B;  1Q86 C;  2R92 H;  2IY5 B;  1UE1 A;  1YEZ A;  2NVX H;  4A76 A;  1TWG H;  2CWA A;  1KAW A;  2PQA B;  2VQE Q;  3T1H Q;  4A3M G;  1K8G A;  3S14 H;  1ASY A;  2JA5 H;  5C0X G;  1L1O B;  4DAM A;  5FLX c;  5C4X H;  1XPO A;  1HR0 Q;  1GVP A;  4GNX C;  3HOU G;  1YHQ A;  2I0Q A;  2LSS A;  1YIT A;  1I94 Q;  1BKB A;  4GS3 A;  4PZ7 A;  1Q7Y C;  1HR0 L;  5GAH C;  1NTG A;  3PCO B;  4OXP A;  4A3B G;  3K8A A;  2HQL A;  3G6E A;  1A0I A;  1TWH H;  4B3M L;  2JA8 G;  1HH2 P;  4BXX G;  2CFM A;  3HOY G;  4X65 Q;  4AQY L;  1HNX L;  2ASB A;  2L15 A;  1X65 A;  1EWI A;  3EBE A;  3I4M G;  1PV4 A;  4JI4 Q;  3RZO H;  5JJK A;  4IPD A;  2R92 G;  4IFD I;  3KOJ A;  4KHZ A;  2JEB I;  1X54 A;  3H3V H;  4A3E H;  4JI4 L;  1G29 1;  3CP0 A;  2HIV A;  4DR4 Q;  1I5F A;  1VQP A;  4A3I G;  3S1M H;  3S1N H;  4A3C H;  3CC2 A;  5M5W H;  4P73 A;  3L2P A;  5GAG C;  2HT1 A;  5C4X G;  1K0R A;  5IP9 H;  4DV6 L;  1P8L A;  2GN5 A;  3GTP H;  4KLK A;  2IT1 A;  1K73 C;  4IJH A;  4YWK A;  1GD7 A;  2UXD L;  5GAD C;  3OYY A;  1OXV A;  1JE5 A;  4A3L H;  1HZA A;  3HOZ H;  3GD7 A;  4P72 A;  4R4T A;  2F3I A;  3PUX A;  2Q2T A;  1V9P A;  2E8G A;  3PO2 H;  4P71 A;  4KHP Q;  3UDI A;  4DPG A;  5IYB H;  1BBW A;  1CKN B;  4LFB Q;  4A93 H;  3W1B A;  3A5Z B;  1S3O A;  4AYB E;  3FKI H;  1FGU A;  1QVC A;  3GDE A;  3K0X A;  1EUJ A;  4LUZ A;  1RIP A;  1X3G A;  4DAY B;  4A3K H;  1X56 A;  1N8R C;  3GTJ H;  5LMN L;  3GTK H;  3NEL A;  2ZTD A;  1VQO A;  1UE6 A;  5LMN Q;  2VNU D;  2Q2U A;  2QEX A;  5C4J H;  1UWV A;  2NN6 G;  3NBH B;  1YJW A;  2R7Z H;  4AQY Q;  1HNX Q;  3PO3 H;  2K5N A;  4GN3 B;  3AFP A;  4LF7 Q;  4JYA Q;  2VS1 A;  3H3V I;  3CCL A;  3M4O H;  3A0J A;  4LF4 L;  4Y52 H;  2H5X A;  4O0A A;  4QGU A;  4LFA L;  1PH9 A;  4DR7 Q;  5EAY A;  4X6A H;  4KI0 A;  3J81 j;  4B3S L;  4JOI A;  4A93 G;  1JJC B;  1EQQ A;  2JA5 G;  3F8T A;  1QVF A;  4DV3 L;  3PIP A;  2OQK A;  1C0A A;  4KHP L;  1IYJ B;  4YHH L;  1JJ2 A;  4DNI A;  5C3E G;  1AE2 A;  1MIU A;  1XNR L;  3CXC A;  4LF6 Q;  3A5U A;  3GO5 A;  3CCV A;  3T1H L;  4BBS G;  2A1A A;  3E9I A;  1GKH A;  1PH2 A;  4MZ9 A;  4A3B H;  2R7F A;  1NY4 A;  4DV2 L;  4JBJ A;  4ALP A;  2F4V L;  4OX9 L;  3AEV A;  4IO9 A;  1O7I A;  3H15 A;  2VUM G;  1BBU A;  3BU2 A;  3PUZ A;  1NBW A;  2NN6 I;  3A74 A;  2F4V Q;  3SGI A;  3S15 H;  3U50 C;  4JV5 L;  1WFQ A;  1N32 L;  4LF8 L;  3G48 A;  3L0O A;  1TWA H;  2WP8 J;  2R93 H;  4MTN A;  1VQC A;  4O2D A;  1Q1B A;  4A75 A;  2N3S A;  1L1O A;  2B29 A;  4UPA A;  3RN5 A;  1N33 L;  1Z47 A;  1YHB A;  1FVI A;  4K0K L;  1Y1V G;  4UP9 A;  2JA8 H;  2MQH A;  3HKZ G;  4DR2 L;  4BA2 I;  3CF5 A;  3CMA A;  4UY8 C;  1KXL A;  4B3S Q;  3BZK A;  4NXM L;  1E1O A;  1L1O C;  5IYD G;  4GNX A;  1OTC A;  4GNX B;  4JI3 Q;  4LF4 Q;  1D7Q A;  3W5O A;  5IYB G;  2N49 A;  4GLA C;  2QGQ A;  4R1J A;  2N78 A;  3RN2 A;  1K9M C;  5IWA Q;  4DR1 Q;  1B7Y B;  2AMC B;  4IJL A;  2YTX A;  1XJV A;  1E3P A;  3PV0 A;  3CCQ A;  3F1Z A;  1Q8K A;  2NZO A;  4OWX B;  3PIO A;  2ZJQ A;  3CAM A;  3CPF A;  3J81 c;  3PF5 A;  1VQG A;  4UP7 A;  2E5L Q;  5IP9 G;  2Q2I A;  4A3D G;  2ES2 A;  4PZ8 A;  2UUC Q;  2ZM6 L;  2IHE A;  2ZTC A;  3EIV A;  5DLQ E;  4HJ5 A;  3TEH B;  1TXY A;  4JG2 A;  4HJ8 A;  4GOP A;  2UUB L;  1S72 A;  1VQ6 A;  4LF9 L;  2VY3 A;  3GTQ H;  2VL6 A;  4DR3 L;  1J5E Q;  1N33 Q;  1SFO H;  1GO3 E;  2BA1 A;  2B63 G;  2BH2 A;  1KIX A;  4DR3 Q;  1J5E L;  4HIK A;  4X66 L;  3PUV A;  4HIO A;  4GKJ Q;  2MO1 A;  3JC6 6;  3FHW A;  2UXB Q;  1VQF A;  3DLL A;  4DV7 L;  5C44 H;  1G51 A;  5C0X J;  1EQR A;  4AIM A;  1SRU A;  1CSP A;  1WOC A;  3PUY A;  4X62 Q;  1XMQ L;  5JEA G;  3PGZ A;  5ELO A;  4DR4 L;  4XIG S;  1J6Q A;  3DM3 A;  1LM0 A;  1LTL A;  3CC7 A;  4LW1 A;  3KLW A;  3TQY A;  1XMO L;  4QJF A;  3HOV G;  1X3E A;  2MNA A;  2UXC Q;  2RHS B;  5IYC H;  1IBM Q;  1SLJ A;  4R4I A;  2E5L L;  4LUV A;  3S17 H;  2DUD A;  3K81 C;  3K80 C;  3CME A;  4LNQ A;  1XNR Q;  4OWW B;  3I2Z A;  2K5H A;  4DV4 Q;  2KCM A;  4LUO A;  3S1R H;  2WFW A;  3NEM A;  3KJP A;  4JOI C;  1R9T H;  3CCS A;  1D8L A;  4AYB G;  1KHI A;  2Z6K A;  2Y0S G;  4TQU S;  3RR5 A;  1IZ6 A;  1XPU A;  2ZTE A;  4X64 Q;  1N34 Q;  2UUB Q;  2YV5 A;  3D0F A;  4C3H H;  4DV0 L;  4LF9 Q;  3ULL A;  1XNQ Q;  4POF A;  1YI2 A;  3HKS A;  2WAQ G;  3PSI A;  4LF8 Q;  4JI6 L;  2NVT H;  3PUW A;  4GN5 A;  4HID A;  3RLF A;  1CKO A;  1HZ9 A;  1FJG Q;  1YJ9 A;  1Q1E A;  1Q46 A;  2HIX A;  1KRS A;  5M3F G;  1KC8 C;  4GOP B;  2GVB A;  1N36 Q;  4B3T L;  3S24 A;  2MFI A;  3ER0 A;  3RLN A;  1QZG A;  1FJG L;  2I5M X;  2QA4 A;  4HJ7 A;  3HOY H;  1GM5 A;  3EN2 A;  3H0G H;  2PNH A;  4GLV B;  3AQQ A;  2NZH A;  1XMO Q;  1EIF A;  1C7Y A;  1WI5 A;  1VQ4 A;  4DKA C;  1U5K A;  2WAQ E;  5FLM H;  1VQ9 A;  2GVA A;  2JJQ A;  3HOU H;  2DGY A;  1VQM A;  4JI8 Q;  1YBY A;  3OTO L;  3E0E A;  3T1Y L;  2OWO A;  3JAM i;  2YYZ A;  4PG3 A;  4QQB X;  4JI8 L;  2Y0S E;  1B70 B;  1VQH A;  2D62 A;  3K7A H;  1PH4 A;  4YHH Q;  1K8A C;  4B3R L;  1N9W A;  3CD6 A;  3I4M H;  1HR0 W;  1VQ7 A;  3RLO A;  3CC4 A;  1IBL L;  1Q82 C;  1UEB A;  4DR6 Q;  4A3C G;  2C35 B;  1VQ8 A;  1VQE A;  2HHH L;  4RMF A;  1NJI C;  2JA6 G;  2IHF A;  1G6P A;  1X6O A;  1Z9F A;  3FKI G;  1N36 L;  5LMN W;  2HHH Q;  5JEA J;  3M4P A;  1DGS A;  2KBN A;  5E7N A;  1HNZ L;  1TWC H;  2B3G A;  2KHJ A;  3ERS X;  3Q8D A;  3GTG H;  3HOZ G;  1N32 Q;  2OTJ A;  3STB C;  4DR6 L;  3RNU A;  3L7Z C;  4IPG A;  1YJN A;  4A3L G;  4XTC S;  2ID0 A;  3S1Q H;  1CSQ A;  2B63 H;  4HJA A;  4X65 L;  1C9O A;  2FXQ A;  4LWC A;  5BR8 Q;  1IXR A;  5IYC G;  1PA6 A;  4GKK L;  1YVC A;  4EX5 A;  1X9N A;  1AE3 A;  4P74 A;  5FJ8 G;  3OTO Q;  1Y1W H;  4JI1 Q;  4LF5 Q;  3GTL H;  1KQS A;  1VCI A;  4JI3 L;  3TS0 A;  3MXN B;  1PH5 A;  2UXD Q;  3CW2 C;  1NMG A;  1X55 A;  3T1Y Q;  4A3J G;  1QUQ B;  4JI5 Q;  5M5Y H;  2VQE L;  2PI2 A;  4IPC A;  1VQJ A;  3K7U C;  4NXN L;  3UDF A;  4DV4 L;  4HIM A;  2AHO B;  4LFC L;  4OWT B;  3BZC A;  3W1G A;  3M85 A;  3CCM A;  5GRO A;  4BXX H;  1SN8 A;  3AFQ A;  5C3E H;  5M3M H;  2VQF Q;  3STB D;  5M3F H;  4DV1 Q;  3HOW H;  3M4Q A;  1XTD A;  1M90 C;  3HOX H;  2ATW A;  2UUC L;  4AH6 A;  4R4O A;  4EQ5 A;  2R93 G;  2LXK A;  5JJL A;  1N34 L;  4DV0 Q;  2CWP A;  3F2B A;  1XNQ L;  4B3M Q;  4NB3 A;  1UE5 A;  2EIF A;  3FP9 A;  4A3E G;  2XTI A;  4GN4 B;  1E1T A;  3ZJY C;  2RCN A;  3CCU A;  2VUM H;  3TRZ A;  4DUZ Q;  3HOX G;  4A3F G;  3MEF A;  1PYS B;  2D0O A;  3ICE A;  3S2H H;  2Q2H A;  1YZ6 A;  1WYD A;  5H1S E;  4LF5 L;  4OON A;  5GAE C;  1EOV A;  4A3F H;  3UDX A;  4NXM Q;  5BR8 L;  3CCE A;  2E2I H;  1JMC A;  4LF7 L;  2V1C C;  2A19 A;  3KDF A;  3S16 H;  3J81 i;  3I4N G;  1M1K C;  4BY1 H;  4OO1 G;  2MO0 A;  2ALY B;  2YTV A;  1YNX A;  4A3I H;  1L2F A;  1V1Q A;  1MKH A;  1NE3 A;  4DK3 C;  3B6Y A;  2IX1 A;  4JI0 L;  3TS2 A;  3J80 i;  4NXN Q;  4A3G G;  1X3F A;  3ULJ A;  3ULP A;  2UXC L;  2EXD A;  2E2H H;  3D31 A;  1E24 A;  1S40 A;  1QVG A;  2F52 A;  2KHI A;  4DUY L;  4JBK A;  4MNO A;  3M7N A;  4JI7 Q;  4LFB L;  1HNW Q;  3I55 A;  1I3Q H;  3PO2 G;  2PMZ E;  4C2M H;  5IWA L;  1RL2 A;  4DR1 L;  4OX9 Q;  4DV5 Q;  1BVS A;  1VQD A;  2VW9 A;  4L5Q A;  3CCJ A;  4ME3 A;  4C3I H;  2RHQ B; 
#chains in the Genus database with same CATH topology
 3M3Y H;  3FVQ A;  1V4Y A;  1WCM H;  5LL6 S;  2OTL A;  1KL9 A;  1Y14 B;  5C3W A;  1STH A;  5FLM G;  5KEE A;  3BAB A;  2F0E A;  3Q8R B;  3PW4 A;  2DPJ A;  1LTI D;  1NMF A;  2PMZ A;  1Y69 U;  5I2X A;  1HA6 A;  2X0S A;  3TIN A;  3C3L A;  3EA6 A;  1VQB A;  2M9V A;  1CUK A;  4JI1 H;  2J6U A;  1YNN C;  2K04 A;  4J6H A;  4KKS A;  1SYC A;  1TY2 A;  4KTA A;  4CDC C;  1ZKO A;  2Q8T A;  2JEA I;  2FE3 A;  1PDQ A;  4DV6 H;  3QG1 A;  1RJQ A;  2JA6 H;  1QG7 A;  2EVB A;  2YTY A;  4DV2 H;  5JVD F;  4IWY A;  1EYA A;  1KDC A;  1E22 A;  4RAY A;  4H13 C;  1GLV A;  2DJG C;  2PZW A;  4YY3 L;  3N40 P;  5C5L A;  5LP6 F;  3JAM c;  1E4F T;  2C28 A;  3Q6S A;  4IUT A;  3M9B A;  4JV5 H;  4K14 A;  2A8V A;  1SR3 A;  4C56 C;  3NGD A;  1FL0 A;  3HEJ A;  4DV3 H;  4O4L F;  1B8A A;  4CHT B;  1MZB A;  5HY6 A;  2MPM A;  4XQJ A;  2V5A A;  2LMC B;  2YW2 A;  3PF4 A;  2CHB D;  3G7L A;  2CCZ A;  2V4R A;  3OHA A;  3QO2 A;  2Z0S A;  4C1N I;  4HNV A;  2KCT A;  1PK8 A;  4YJ3 F;  5AJ3 Q;  1IKL A;  5EPJ A;  4POG A;  5IYD H;  3L3O C;  5EPK A;  3RD4 A;  2F0F A;  2AWN A;  4LMQ D;  1QUQ A;  1UUP A;  5CGK A;  4ECS A;  3R93 A;  5M9O A;  1PTO B;  4APV A;  2UUA L;  3DUZ A;  5L37 A;  4C2M A;  4X62 L;  4GKJ L;  3RZD H;  3FDS A;  3QZ7 A;  3J7Y W;  3MR6 A;  1GUW A;  4P2C B;  1IBK L;  5LYJ F;  5FLX W;  1DCZ A;  1TU2 B;  5EDW A;  4JI1 L;  3V4Z A;  4K0K H;  5JVL A;  1QIL A;  3CCR A;  4C5A A;  5C8Y F;  4U68 A;  2EYF A;  1D5X C;  3PW5 A;  3WNZ A;  3BA8 A;  4DV3 Q;  1KJ8 A;  4YCU A;  5E3F A;  2V4Q A;  4FDB A;  3NEN A;  1VQI A;  3T1H H;  4QIW B;  4WJW A;  4DK6 C;  3U4Z A;  4HED A;  5M5X H;  4O3P A;  3GV6 A;  5A2Q W;  3UDG A;  2NN6 H;  1YIJ A;  3ITP A;  1VS0 A;  4XQN A;  3D3R A;  1UAP A;  1N36 H;  4ZCK A;  2MCT A;  4AQY H;  1HNX H;  1DM0 B;  2SOB A;  5FD6 A;  2VA2 A;  5IT9 L;  3LP8 A;  1SFO A;  4B3R H;  4P75 A;  4IFD G;  1SNC A;  3KLR A;  3LNN A;  4TRD A;  2EQS A;  2FP4 B;  4GKK H;  1TY0 A;  4EQN A;  4JI6 Q;  1DD2 A;  1I94 L;  1KD1 C;  3ERO A;  1CE8 A;  4ZI7 F;  3PR5 B;  2ZJR A;  1FD7 D;  4HSV A;  1SMX A;  2E74 C;  1WTR A;  1B3A A;  2OLS A;  4ME6 A;  4BY7 H;  1OXS C;  2OQ0 A;  4GLX A;  1O7L A;  3ND9 A;  1I50 A;  3RIZ A;  3WWV A;  4LFA Q;  2K14 A;  1B33 N;  3VYT A;  1OXU A;  3UFX B;  1VQN A;  4J9O A;  2NVQ H;  4JI5 L;  2EJF C;  2HJW A;  5C3X A;  4L5R C;  4BBS H;  3N43 B;  1HZC A;  3I3C A;  1PH8 A;  3J7Z C;  2NTT A;  1TWF H;  3GV3 A;  4LFC Q;  1SE2 A;  2NVX H;  5L1I A;  1XNQ H;  2YS6 A;  1TWG H;  2F1M A;  1LTG D;  1F2Z A;  3QWN A;  4DR3 H;  2XVS A;  1FJG H;  4KN7 C;  4TV9 F;  2NU6 B;  3QB3 A;  1YHQ A;  2WDT A;  1XPU A;  1ZHS A;  1I94 Q;  4PZ7 A;  4I7H A;  5GAH C;  1NTG A;  2F03 A;  3K8A A;  4JVZ A;  3G6E A;  1A0I A;  2Y0S A;  2WTF A;  4LF4 H;  2JA8 G;  2VUM B;  3M7G A;  3HOY G;  1E2Z A;  4AQY L;  1HNX L;  2ASB A;  3BVG A;  3QR8 A;  1HQM C;  3RV3 A;  4N9T A;  3I4M G;  1SYG A;  2XGQ A;  1PV4 A;  4JI4 Q;  5DG9 A;  3NQT A;  1K8O A;  2JEB I;  3T16 A;  3J80 L;  3H3V H;  4QW8 A;  4XQQ A;  3GTM A;  1G29 1;  2HIV A;  1VQP A;  5EKI A;  2F0L A;  3S1M H;  1I3Q B;  4FXG C;  5M5W H;  4P73 A;  2HT1 A;  5GAG C;  4ED0 A;  4IJH A;  1GD7 A;  4IWX A;  2XCP A;  3OYY A;  1XWE A;  2I87 A;  5BR8 H;  1SBB B;  5LA6 F;  4DL2 A;  4R4T A;  3PUX A;  2N88 A;  1C8C A;  3KF8 A;  4LF8 H;  1ESR A;  1SNQ A;  5IYB H;  5LHY 1;  1F9S A;  4LFB Q;  3W1B A;  1PTO D;  3A5Z B;  2PZT A;  5L1K A;  4FM9 A;  3GLK A;  4UCV A;  1EUJ A;  4IUN A;  5KYI A;  5EZY F;  1X3Q A;  1LTR D;  4IRC A;  1E4E B;  3GTG A;  2ZTD A;  1VQO A;  2VNU D;  4EFE A;  4JV1 A;  2C00 A;  4QMG A;  1UWV A;  2R7Z H;  1S97 A;  1YNJ C;  1F2Y A;  4ECR A;  4APM A;  2K5N A;  3AFP A;  1PXU A;  2JA8 B;  5CV7 A;  1EQT A;  2EYM A;  3M4O H;  3A0J A;  4LF4 L;  1D1K A;  2H5X A;  2R3Z A;  2H4O A;  4X6A H;  1ENC A;  4KI0 A;  4HMI A;  2QYZ A;  2PO4 A;  4DAY A;  3F8T A;  3VPB A;  1HTL D;  1EIG A;  4XYL B;  2OQK A;  5ELF A;  4R8I A;  5M5Y B;  4KHP L;  3C0F B;  2UUB H;  1AN8 A;  1E0B A;  4YIJ A;  4DNI A;  3DEP A;  1AE2 A;  4ZQ3 A;  1KTK A;  2ZT9 C;  1XNR L;  4L1K A;  5L1L A;  2HHH H;  2OEO A;  3L4J A;  1J5E H;  5LL6 X;  3NQI A;  3BG3 A;  4ALP A;  4NP5 A;  2X6L A;  2F4V L;  4NKL A;  4IO9 A;  1HFG A;  4QWA A;  2NN6 I;  4DV7 H;  3SGI A;  3SXH A;  2VUM A;  2LFN A;  3N52 A;  1S10 A;  1DJR D;  3MFG A;  4FXK C;  4LF8 L;  3L0O A;  2R93 H;  4C3J B;  3R23 A;  4A75 A;  2B29 A;  1N33 L;  4UPA A;  3X3N A;  1PX2 A;  3D6W A;  1FVI A;  3C2P A;  3JAM L;  5FLX L;  3CMA A;  1R9T A;  1PLF A;  4NXM L;  2EYL A;  2NUA B;  4RNO A;  1JLL B;  2KCC A;  2F0N A;  1STA A;  4GNX A;  4LF4 Q;  2XWJ B;  3E0J A;  3GTJ A;  3CRK C;  2YU9 B;  4GLA C;  1F9R A;  2F0W A;  2NZ1 D;  3BDC A;  1K9M C;  3NUC A;  5CC4 A;  4DR1 Q;  1XJV A;  2AMC B;  3QFF A;  4DR7 H;  3PV0 A;  3F1Z A;  4O3R A;  4DV0 H;  2RCF A;  1BXR A;  2EYO A;  2Z4H A;  3MXG A;  2JA7 B;  1JDB B;  1A3U A;  2Q2I A;  5E4X A;  1JOR A;  4HJ8 A;  3M3Y B;  2ZTC A;  3UI2 A;  2HUG A;  4HJ5 A;  3TEH B;  1VKZ A;  1JXL A;  2UUB L;  1VQ6 A;  4KHP H;  1S72 A;  3WOE A;  3PMF A;  2VY3 A;  1FNW A;  4DGZ A;  3GTQ H;  2VL6 A;  2VQD A;  4DR1 H;  1N33 Q;  1GO3 E;  4FO2 A;  1EEI D;  3RZO B;  4C3I B;  1KIX A;  1J5E L;  2BH2 A;  4F88 A;  3OIQ A;  2RQX A;  3HOV B;  3GV5 B;  4J9K A;  4A3E B;  3FHW A;  2W6P A;  1VQF A;  3DLL A;  3VR3 A;  4IUP A;  4DV7 L;  4EQP A;  1KJ9 A;  4QF4 A;  3CQZ A;  4I50 F;  3TDQ A;  1JC7 A;  5BN3 A;  4X62 Q;  4JV2 A;  5ELO A;  1VAJ A;  3DM3 A;  4A3F B;  3KLW A;  1EHI A;  1Z2P X;  3DWP A;  3S14 B;  1IBM Q;  4XT1 B;  3S17 H;  3V6K A;  5KFI A;  4NXM H;  3RJ0 A;  3DXJ C;  4IN3 A;  1TWG B;  2B63 A;  3NEM A;  4MIU A;  2W70 A;  1SYD A;  3RV4 A;  1SEB D;  3CCS A;  1Z7T A;  1N48 A;  1JKJ B;  1LLR D;  2RDF A;  1PTO C;  5FO8 B;  4IUU A;  2Y0S G;  4KY6 A;  4U67 3;  2RDJ A;  1D1I A;  2ZTE A;  3MJF A;  2UUB Q;  2R93 B;  1S5D D;  3D0F A;  4DV0 L;  3ULL A;  3NTI A;  4POF A;  1YI2 A;  3HKS A;  2WAQ G;  1BNZ A;  2NVT H;  3RLF A;  1CKO A;  1HUN A;  2IJ0 A;  1Q1E A;  1Q46 A;  2HIX A;  1KC8 C;  2MGS A;  4GOP B;  4B3T L;  1SCU B;  4K2L A;  2I5M X;  4HJ7 A;  1CHP D;  3HOY H;  1GM5 A;  3EN2 A;  2PNH A;  3H0G H;  4GLV B;  1S0O A;  4O4H F;  3R3O A;  2FLP A;  1EIF A;  2AQ3 B;  4MAM A;  1I4X A;  2F0V A;  3PO3 B;  1OO9 B;  1U5K A;  4K8J A;  5IOC A;  2PPB C;  2UUA H;  1VQ9 A;  2B2T A;  3HOU H;  2GVA A;  2FMC A;  2JJQ A;  3FPP A;  2WE6 A;  2MJ8 A;  4DAV A;  3OUZ A;  4Y8V B;  5KFQ A;  1VQM A;  4JI8 Q;  4DV1 H;  3OTO L;  3OWF A;  2F0J A;  3T1Y L;  4BY1 B;  1LT5 D;  2YYZ A;  3MFY A;  3ZYY X;  4QQB X;  1TVX A;  4ZOL F;  3PR4 A;  1PH4 A;  4YHH Q;  4C3J G;  1B50 A;  1G91 A;  5KND A;  1NCV A;  4J8Q A;  1VF7 A;  3GP7 A;  4PQX A;  5KT6 A;  4EBC A;  1VDZ A;  1C48 A;  1Q82 C;  1UEB A;  3NTH A;  2YZN A;  1S5F D;  2C35 B;  4KJN A;  3FKI A;  1S5E D;  3N41 B;  1N36 L;  4KHV A;  2G9D A;  2RDG A;  5JEA J;  2HCI A;  3M4P A;  1HNZ L;  2FHT A;  2W6Q A;  4LF7 H;  2FK3 A;  2R85 A;  5C44 B;  4GZY C;  4ILW A;  3I8Z A;  3W2D A;  3HZX A;  4HR7 A;  1CI3 M;  4F4X A;  4JI0 H;  1CSQ A;  2B63 H;  5KG6 A;  4LWC A;  5KKN B;  4FBT A;  4GKK L;  2XRS D;  1HFN A;  5KG7 A;  3RB0 A;  4EX5 A;  1AE3 A;  5FJ8 G;  4DUY H;  4JI1 Q;  3GTL H;  4RNN A;  1KQS A;  3TIG A;  4JI3 L;  2A68 C;  2NVY B;  5IGD A;  1Q8I A;  5KG0 A;  2NU9 B;  2UXD Q;  3CW2 C;  4JI7 H;  5IT9 W;  1BNC A;  3TZU A;  1NMG A;  2JA7 A;  3T1Y Q;  1QOH A;  5M5Y H;  4M9U A;  2PI2 A;  4IPC A;  1DON A;  1HRJ A;  1HPC A;  2YRX A;  5KFK A;  5T14 A;  4DL4 A;  1CK1 A;  3UDF A;  3Q0A A;  2A69 C;  1MI2 A;  4QB4 A;  3BZC A;  1Z2N X;  2K5D A;  2B2U A;  1KDA A;  2VQF Q;  3STB D;  3M4Q A;  1M90 C;  2UUC L;  4XXE A;  3VYS A;  2BQR A;  1XNQ L;  3VYU A;  1UE5 A;  2EIF A;  3FP9 A;  4YB8 B;  1E1T A;  1B6S A;  4JI4 H;  3CCU A;  4ZK9 B;  4DUZ Q;  3HOX G;  2L1B A;  1B44 D;  3L9A X;  3TP8 A;  1CA5 A;  1PYS B;  1EY7 A;  3RB6 A;  2FPP B;  4OON A;  5GAE C;  4RB2 C;  1EOV A;  2WII B;  4FXD A;  4A3F H;  4NXM Q;  1JMC A;  5DGA A;  1WTO A;  4LF7 L;  2V1C C;  2A19 A;  3KDF A;  3GTP B;  4BY1 H;  2MO0 A;  2BDO A;  1YNX A;  1L2F A;  1V1Q A;  2CH4 W;  4LK1 C;  3B6Y A;  4DK3 C;  4JI0 L;  2IX1 A;  2DIK A;  1FGB D;  2EY5 A;  4A3G G;  3ULP A;  1SE4 A;  2KJX A;  4JPB W;  4MTE A;  2C2R A;  4DA2 A;  3K5N A;  1S9F A;  2KHI A;  4DUY L;  4JBK A;  3VPC A;  3T5K A;  3A8I E;  1EEF D;  1BGW A;  4LFB L;  1EIH A;  1I3Q H;  2PMZ E;  3PIO 3;  2PVP A;  3A8J E;  4OGQ C;  4OX9 Q;  4DV5 Q;  2R8I A;  4L5Q A;  4H7B A;  4ME3 A;  2M2L A;  5COY A;  4DFA A;  1PH6 A;  1SMY C;  4JCV E;  1PFS A;  1O75 A;  2YL2 A;  4L5T A;  3S15 B;  5J3B A;  2C5C A;  1IL2 A;  1CKM A;  1TA8 A;  2E75 C;  4RCN A;  3S9W A;  2DY7 A;  5KIX A;  3HP3 A;  1TQO A;  2DNC A;  3BDL A;  4XX0 B;  1CT1 D;  4ZQI A;  1GHK A;  3MHB A;  3S1Q B;  4WFN 3;  4DUZ L;  4K0K Q;  1LT4 D;  2IW3 A;  4A3D H;  3S2D H;  2BA0 A;  5C4J B;  4YWL A;  4CJ1 B;  2RF4 A;  4C3J H;  1IW7 C;  3PO3 G;  2FMA A;  4UCT A;  5BN5 A;  3UE1 A;  4HJ9 A;  2V9W A;  5C0X I;  1B4O A;  1Y8N B;  2PQA A;  5KFD A;  4QIW A;  4V19 0;  3KDF B;  4DK1 A;  3J7A 5;  1H9M A;  4XYM B;  3E5S A;  3H20 A;  4O2B F;  1DOK A;  2WB1 G;  2W9B B;  3I7F A;  3SK6 A;  1JIC A;  4YY3 Q;  1K83 A;  1JB7 A;  3S17 B;  3O13 A;  4LF6 L;  4PMC A;  2K28 A;  4WJ3 M;  2O5J C;  1EWH A;  4UP8 A;  5M3F B;  4A3M H;  4C2M B;  3KLS A;  4B3R Q;  1NAP A;  2LKV A;  2L11 A;  4B9W A;  5JPN C;  1MSG A;  2AGP A;  2ZXP A;  3KF6 A;  1VQA A;  4DV5 L;  3PIP 3;  4JV5 Q;  2K75 A;  1IOV A;  3GTM B;  1F9Q A;  2WIN B;  3R2I A;  3R8B A;  1KLG D;  2K5V A;  1RD9 D;  1R4P B;  4EEY A;  4A93 B;  1EZ1 A;  4KD3 A;  5AJ3 L;  1RKN A;  2R93 A;  4IZ8 A;  4B3T Q;  1SJH D;  2LXJ A;  5CV9 A;  2E76 C;  2GLT A;  2Y0S B;  1ONL A;  3KYH C;  3OW7 A;  3LWB A;  4RB0 A;  1SE8 A;  1T5X D;  1G6Z A;  1IKM A;  3Q8Q B;  4M8A A;  4DUZ H;  3HS0 C;  2YU9 H;  1PYB A;  1I6V C;  3DWA A;  5JPM C;  3LWU A;  4HR7 B;  1WCM G;  3M4Y A;  4LF9 H;  1FNV A;  2EJG C;  3A54 A;  4CJ2 C;  2XN9 C;  1CM9 A;  4O4I F;  5D1P A;  5FOB B;  3J80 c;  2PI2 E;  1PFB A;  4YCW A;  2EE1 A;  4QY7 A;  4A4I A;  5EWF A;  4OO1 I;  3PW2 A;  3IRB A;  1KRT A;  4YAJ B;  4B3M H;  3FDT A;  1ASZ A;  3S2H B;  2B2T C;  3P7J A;  4C3I G;  1U4M A;  2I5H A;  1IBL Q;  3LML A;  5CV4 A;  5KT7 A;  1HNZ Q;  1ESF A;  1T3N A;  1K83 H;  1RK5 A;  4CKC A;  1ZYR D;  3NWS A;  2AQ4 A;  3PW0 A;  2DPI A;  4Y7N H;  1PH7 A;  3KUP A;  3P1H A;  1VBG A;  3JSN A;  2R6G A;  2OH2 A;  1XXG A;  1SRO A;  2CKZ B;  1W3S A;  4OL7 A;  4Q5V A;  4JI2 L;  3Q2O A;  3GQB A;  3RAX A;  1M4V A;  2C2E A;  4BBR H;  4DR2 Q;  2I5L X;  1SFO B;  3J7A V;  3TQT A;  3F2D A;  4GKK Q;  3MA2 B;  2YCH A;  3D4R A;  2JA7 G;  3GII A;  3RMH A;  3NE5 B;  3CVZ A;  1CHQ D;  1PRT B;  5A2Q E;  4FF4 A;  3HOV H;  2NVY H;  2AQ2 B;  5FJ8 H;  2F0K A;  1ULZ A;  4JBM A;  2RSO A;  5IGC A;  1Y1W B;  4IUR A;  5M3M G;  4NW2 A;  2CW0 D;  3HKZ B;  2JE6 I;  3CHB D;  4WD3 A;  3E3X A;  4YCV A;  2EOT A;  5I9P A;  1C4Q A;  3KF6 B;  2R92 H;  1UE1 A;  2CWA A;  1KAW A;  2MP1 A;  2VQE Q;  4EEQ A;  3T1H Q;  1K8G A;  3S14 H;  3QZ8 A;  1ASY A;  3OMC A;  1S5C D;  4DAM A;  2GA4 B;  5C4X H;  3X3M A;  4O42 A;  2UVW A;  1DV1 A;  3K3V A;  3HOU G;  3GIJ A;  2W9B A;  2I0Q A;  1HR0 L;  1BKB A;  4G7H C;  1Q7Y C;  1NNX A;  2V58 A;  3PCO B;  1GJX A;  3E5N A;  2HQL A;  1SMY D;  4B3M L;  4BXX G;  1MBY A;  4XYO A;  4K6D A;  1QB5 D;  2B2W A;  4UAI A;  4RB3 C;  1SEI A;  1EWI A;  1WTQ A;  4QWD A;  1A6X A;  3T5L A;  4QW9 A;  3RZO H;  2R92 G;  5CBE E;  4A3E H;  2YZG A;  3CP0 A;  1I5F A;  3BQ0 A;  2W7P A;  4DAP A;  1EQV A;  4A3I G;  3S1N H;  1OWT A;  3TP6 A;  1WD0 A;  5C4X G;  5IP9 H;  3EPI A;  4O3N A;  1AFP A;  2IT1 A;  4QWC A;  4HYK A;  1OXV A;  4ED3 A;  3M4I A;  5KFR A;  4PDB A;  4F7X A;  4A3L H;  3PO2 H;  5DM6 3;  3G6Y A;  2Q2T A;  3T1Y H;  1JR0 D;  1TS2 A;  3MXU A;  3GIL A;  4A93 H;  3OHB A;  1S3O A;  1FGU A;  3GDE A;  4A3K H;  4LUZ A;  1X56 A;  5LMN L;  3TZD A;  5CB4 F;  3NEL A;  1EWC A;  2Q8R E;  1H9S B;  1UE6 A;  2A5H A;  2Q2U A;  2QEX A;  5C4J H;  1YJW A;  1GUG A;  1WSC A;  3HOU B;  2VPQ A;  4QUC A;  4JYA Q;  3NXW A;  3D6C A;  2FKL A;  4NXN H;  5KT2 A;  3CCL A;  2QW7 A;  5LXT F;  1Y1W A;  4EYI B;  3MWY W;  4LFA L;  5M5W B;  1PH9 A;  2NTS A;  3HOY B;  2K6A A;  4DR7 Q;  4RNM A;  3GTL A;  1RHP A;  5DLF A;  4A93 G;  4JOI A;  4FP5 D;  1M0T A;  1QVF A;  4EYH B;  4CKB A;  2ZM6 H;  5JEA H;  1C0A A;  3RBD A;  1F9P A;  1IYJ B;  3HGB A;  1K1Q A;  4JYA H;  4JI3 H;  1IBL H;  5KFZ A;  1MIU A;  3H09 A;  3EVQ A;  1V8Q A;  5CMD A;  3A5U A;  3CCV A;  4BBS G;  3E9I A;  5DAU A;  4KKU A;  1GKH A;  2F0I A;  1PH2 A;  3HRZ C;  4F50 A;  2R7F A;  3EQL C;  4ZHQ F;  3J7A K;  4JBJ A;  3AEV A;  3JRW A;  4OX9 L;  3KHG A;  3BZD B;  4KD4 A;  2VUM G;  3BU2 A;  3A74 A;  5K36 H;  2KUM A;  1HTP A;  2B2Y C;  3S15 H;  3U50 C;  1N32 L;  4IQZ A;  4BBR B;  4EBE A;  2ASD A;  3L4K A;  2RDI A;  4O2D A;  5DLG A;  4DR4 H;  5G3L F;  5KG4 A;  2L12 A;  5I6W A;  4UP9 A;  2JA8 H;  2MQH A;  4KY5 A;  2Z8L A;  1KDB A;  3I4N B;  4BA2 I;  5KFG A;  2Q8I B;  4UY8 C;  4N8X 1;  4B3S Q;  3BZK A;  1KJJ A;  3AB9 A;  1IOW A;  4RB1 A;  5DG7 A;  5IGE A;  2F0U A;  1D7Q A;  1B04 A;  2RA4 A;  4E6I A;  3FPU B;  5IYB G;  1KAB A;  2ZDQ A;  3N42 B;  1BCP C;  1SAP A;  5IWA Q;  4IJL A;  1Q8K A;  5FO7 B;  4OWX B;  1ILP A;  3G6X A;  3MR3 A;  4LFA H;  3CU7 A;  2F0T A;  4UP7 A;  1N34 H;  4YAK B;  4ZAI A;  3Q1K A;  2ES2 A;  1WTX A;  2UUC Q;  1EL0 A;  4EGQ A;  4XT3 B;  2ZM6 L;  2IHE A;  4OIJ A;  1EY5 A;  3GV7 B;  1LTS D;  1EFI D;  1J5E Q;  2Z6B A;  2G5D A;  5KFY A;  2B63 G;  3EPG A;  2JP1 A;  4X66 L;  4GKJ Q;  2MO1 A;  2K01 A;  4N8F A;  4FF2 A;  1G51 A;  5C0X J;  4AIM A;  4YY3 H;  1SRU A;  4JI8 H;  1N32 H;  1XMQ L;  4UDU C;  3VR5 A;  4DK0 A;  3PGZ A;  3BVM A;  3I72 A;  1S4Z A;  3NK9 A;  2YZM A;  4DR4 L;  4XIG S;  5CR3 A;  1C3O A;  1JOO A;  4K5X A;  3TME A;  1XMO L;  5C0X H;  5IYC H;  4RAU C;  4R4I A;  5J1Z A;  3I4L A;  4LNQ A;  5DG8 A;  2NVX A;  4LUO A;  3Q24 A;  2WFW A;  1TWG A;  3URY A;  1QNU A;  4F87 A;  4ED6 A;  2EYP A;  4I55 F;  1D2B A;  1N56 A;  4O3S A;  1KHI A;  2L9H A;  3NTK A;  1IZ6 A;  1RTN A;  2XC9 A;  3N8D A;  4UCO A;  2J6S A;  4GKJ H;  2F0D A;  4C3H H;  1XNQ Q;  5EQ0 A;  4L8J A;  4RZR A;  4LF8 Q;  4O1N A;  1DOM A;  2SDF A;  1MD2 D;  2D5D A;  1YJ9 A;  2GVB A;  4RZQ A;  4Q43 A;  2B2Y A;  2E2J B;  4HMJ A;  2F0M A;  3K5O A;  2O03 A;  3J81 L;  3AQQ A;  2WB1 A;  5D65 A;  2VXW A;  4ECX A;  3V6H A;  1WI5 A;  1U4L A;  3EJI A;  5FPO A;  5FLM H;  4BY7 B;  1NUC A;  4J0M A;  3GTP A;  3JAM W;  4TQS A;  5KFP A;  3JAM i;  4RH6 A;  2ZJT A;  4JI8 L;  4ED7 A;  1HUM A;  1VQH A;  1XMQ H;  1TS4 A;  4LH7 A;  1LAB A;  4A3G B;  4K6L A;  4MA0 A;  4MTD A;  1K8A C;  4B3R L;  4H0L C;  1N9W A;  2PQE A;  3GTJ B;  2R7N A;  4DLK A;  4MA5 A;  5KT4 A;  4ED8 A;  1V1O A;  1VQ7 A;  1IL8 A;  4TUY F;  4A2B A;  4IRK A;  3RLO A;  3ORR A;  3CC4 A;  1EU3 A;  1I94 H;  1ZEQ X;  1HA5 A;  1RJP A;  1D5Z C;  4B08 A;  3FRP B;  1VQ8 A;  4RMF A;  4A3K B;  2JA6 G;  4CDF C;  1X6O A;  1Z9F A;  2HHH Q;  2XIG A;  3M9O B;  1Q3L A;  1TWC H;  3ERS X;  4TSS A;  3STB C;  1RYS A;  4E4T A;  1YJN A;  2R7M A;  4XTC S;  2W6M A;  4JI5 H;  3MC0 B;  2FXQ A;  5J2U F;  1VMC A;  5IYC G;  4Q8E A;  1IHZ A;  1PA6 A;  2GPS A;  4LH6 A;  4Y7N B;  1GHJ A;  3BG5 A;  3NP8 A;  4LF5 Q;  4G7O C;  4F4Y A;  3BYT B;  1WCM A;  4L6T B;  1KAA A;  2EY2 A;  2QCP X;  2KVM A;  2NVY A;  2R8J A;  5KNB A;  4A3I B;  1KNE A;  5CA0 F;  2C2D A;  5IYZ F;  4A3J G;  1QUQ B;  2EZV A;  4JI5 Q;  2VQE L;  3QIA A;  4J9S A;  3K7U C;  2NU8 B;  1HNW L;  4HIM A;  2AHO B;  4LFC L;  1TII D;  3J80 W;  1ROD A;  2CVR A;  3AFQ A;  4G3I A;  4DV1 Q;  1JQY D;  1XTD A;  2XNA C;  4C3H B;  3HOX H;  4AH6 A;  2IWH A;  4DXG A;  5JJL A;  2TSS A;  3H4B A;  3PW7 A;  1PRT F;  1B3Q A;  2CWP A;  2JA6 A;  2DN8 A;  2FPG B;  4YHH H;  1WTW A;  4JK1 C;  2VUM H;  2RCN A;  2R82 A;  4FU0 A;  4A3F G;  1W93 A;  4JV0 A;  2D0O A;  3S2H H;  2OT2 A;  1YZ6 A;  5BPH A;  3K3P A;  2B2V A;  2W6O A;  3OHX C;  3UDX A;  3TII A;  5BR8 L;  2RSN A;  2E2I H;  3T53 B;  5C4Z A;  2SNS A;  3I4N G;  2FK1 A;  1M1K C;  3JZI A;  2VB2 X;  4IAJ A;  2YTV A;  1T36 A;  4F8M A;  1WH2 A;  1XYI A;  3J80 i;  1EY0 A;  2NB0 A;  3U9S A;  2BE5 C;  2UXC L;  1DIK A;  1Q90 A;  3UQ8 A;  3JSL A;  2E2H H;  4BWS C;  3VPD A;  1E24 A;  1PFN A;  2PMZ B;  1SYB A;  4JI7 Q;  1U9R A;  1HNW Q;  2FFK B;  3PO2 G;  1UC9 A;  4RHR A;  1BVS A;  2FLN A;  3MEH A;  5LMU H;  4HTH A;  3RGX A;  2RHQ B;  1E2V A;  3HKZ E;  2AUJ D;  1JWM D;  4A3K G;  2VQE H;  3U58 A;  2I07 B;  3V6J A;  2KHS A;  2K52 A;  4LJZ C;  3SK8 A;  4MHE A;  3RFC A;  3A8K E;  4Q0F A;  2BQ3 A;  3A55 A;  4BBR G;  1KEE A;  5BPF A;  1AUV A;  4RG1 A;  3K5I A;  3VR4 A;  4RGM A;  3SDZ A;  3GTL B;  1BCP B;  3CQZ H;  1UNS A;  2A73 B;  4DU9 A;  1PRT D;  3GIM A;  1E7Z A;  5TSS A;  1U0L A;  4NPS A;  1PHJ A;  4R7R A;  5KG5 A;  2ENB A;  1QWY A;  3VYR A;  4MV7 A;  5E4W C;  3T13 A;  4HCE A;  2NBF A;  3TQ1 A;  4X3S A;  1Y1W G;  2R8H A;  3T5J A;  3I4O A;  2WYO A;  3F8N A;  2X6G A;  4GOP C;  5IP7 G;  1CQJ B;  2PW7 A;  1AH9 A;  4ECZ A;  2K4K A;  5NUC A;  5KFV A;  5C1O A;  4Q0Y A;  1F2M A;  5M5X B;  3MFH A;  4O3O A;  4DL7 A;  4KY7 A;  5KFO A;  3U4V A;  2N55 A;  1BBX C;  4IZO A;  2B8F A;  5DGB A;  1N33 H;  1MJE A;  3AU7 A;  2FK2 A;  1PZI D;  4C5C A;  2H1E A;  4H02 A;  4WBN F;  2WB1 E;  1I50 H;  3W3A A;  1U4R A;  3KJO A;  5K36 G;  3V4S A;  4GC7 A;  2E5L H;  3RB3 A;  1CTM A;  2SNM A;  2UU9 Q;  3H0G G;  4XDX A;  4JUZ A;  3GID A;  2E2H A;  2EYJ A;  1HJP A;  4EGV A;  5LMU L;  3NWT A;  4DV7 Q;  2AKW B;  1VQ5 A;  5CV8 A;  3ETJ A;  1J8I A;  1GXD C;  4X3K A;  2CQO A;  4X66 Q;  2K50 A;  3N44 B;  2BH8 A;  1XTC D;  1LV9 A;  1JWS D;  5K2M A;  1K28 A;  3RGZ A;  5CV5 A;  4DNR B;  3N6X A;  1ZYR C;  3KAJ A;  4KV6 A;  4X65 H;  3KHH A;  4ABN A;  5KFW A;  4J9R A;  2IBK A;  2VZA A;  5FLX E;  4WJ4 A;  3F2C A;  1LUZ A;  1PH3 A;  4NDX A;  1ZHQ A;  4OO1 H;  5F9L A;  2HCC A;  2JA9 A;  4ZLT F;  1P16 A;  2W8K A;  4Z9C B;  2W71 A;  2NWG A;  4DUY Q;  1A8V A;  2FMM A;  1VF5 C;  4QL5 A;  2R7Z G;  2KEN A;  2ZM6 Q;  2F4V H;  1ENF A;  2EYH A;  3KFU A;  4HNU A;  1XDN A;  2ICE C;  5F2D A;  3GTG B;  2NVX B;  1E4E A;  1C30 A;  2VQF L;  1LYL A;  2Z9H A;  5LOV F;  2UU9 L;  1EYG A;  5HGQ A;  1ENA A;  2W6Z A;  3GTM H;  2YS7 A;  4DR5 Q;  2R7D A;  5A2Q L;  5IT9 c;  4YP3 A;  1A63 A;  1AN7 A;  1Z6H A;  2AQ1 B;  2QKI C;  5C5M A;  4J15 A;  4X64 L;  1QZH A;  3KF8 B;  5IE8 A;  2XCL A;  2HGS A;  5KT3 A;  5FKA C;  3FMC A;  4ZUI A;  1B2T A;  3VR2 A;  5C44 G;  4EG0 A;  4PNY A;  1I4G A;  5KYL A;  2E2J H;  5KFB A;  4RKL A;  3M9M B;  1T9H A;  3RF2 A;  4DR7 L;  4BY7 G;  2BE5 D;  4ECY A;  1JT8 A;  2KED A;  1OXT A;  2B2U C;  4CC6 A;  5JJZ A;  4A3M B;  2JA7 H;  3HOW G;  1B6R A;  4N9P A;  5EKL A;  5KG1 A;  2CQA A;  2R8K A;  1IBM L;  5JQW A;  2PCF B;  1WJJ A;  4MV6 A;  1Q86 C;  2IY5 B;  1YEZ A;  3K0Y A;  3K57 A;  4QUF A;  1XMO H;  1G2T A;  5JAV A;  1EOT A;  2PQA B;  4A3M G;  3HOW B;  1A15 A;  2XCA A;  4J9M A;  1GSA A;  2QIL A;  1XPO A;  5C3E B;  1HR0 Q;  1GVP A;  3KBX A;  1LTA D;  4GNX C;  2CW7 A;  4EVO A;  4R8N A;  2LSS A;  3BQ1 A;  5KFX A;  3LX0 A;  4J9P A;  4ZUJ A;  1B53 A;  2MUY A;  1TWH H;  2ZDH A;  1TWC B;  2CFM A;  3SE7 A;  4C1N K;  5F9N A;  1YNN D;  5D14 A;  1I6U A;  3OTO H;  1TWA B;  1GOZ A;  1X65 A;  3EBE A;  5JJK A;  4IPD A;  2R7L A;  4RA8 A;  3TP5 A;  4KHZ A;  5D3I B;  4FS1 A;  1X54 A;  4G4K A;  4DL3 A;  1AEX A;  3JRX A;  1QCB D;  3VA5 A;  4DR4 Q;  3MTS A;  4A3C H;  3I91 A;  1AP0 A;  3E6Z X;  3L2P A;  1G2S A;  1K0R A;  4DXF A;  4DV6 L;  1P8L A;  2GN5 A;  3GTP H;  4LF5 H;  4YWK A;  4ED2 A;  1L2Z A;  2W9C B;  1M7J A;  5FD5 A;  1HZA A;  3HOZ H;  3GD7 A;  4P72 A;  3R5F A;  1V9P A;  5IOD A;  1II3 A;  2XGP A;  4KHP Q;  5EWE A;  1TS5 A;  4DPG A;  1VMP A;  3MVV A;  5DEH A;  2GPW A;  3P20 A;  1BBW A;  1IBM H;  4AYB E;  1SNO A;  2A6E C;  1QVC A;  2RKS A;  1RF2 D;  1RIP A;  1T5E A;  1X3G A;  2KCN A;  4RCO A;  3GTJ H;  4ECQ A;  1R9T B;  3EYY A;  4DR2 H;  1PYW D;  3GTK H;  2L55 A;  5LMN Q;  1GSH A;  5IGG A;  3C1F A;  1S5B D;  2NN6 G;  3PO3 H;  1NR2 A;  4AQY Q;  1HNX Q;  3V96 A;  4LF7 Q;  2V4D A;  3SEB A;  4IFD H;  4RHS A;  2VS1 A;  1QNK A;  1K0S A;  1K3B C;  1SNM A;  5EAY A;  3RZD B;  1W6J A;  3IFD A;  3J81 j;  1TS3 A;  1JJC B;  2JA5 G;  5KX5 F;  2K05 A;  3G8C A;  3FEW X;  1X3P A;  4CBV A;  4XZ3 B;  3CXC A;  4LF6 Q;  4OHJ A;  3GO5 A;  4TKO B;  3T1H L;  2A1A A;  4EGJ A;  1DYQ A;  3K5H A;  4MZ9 A;  3IN5 A;  1NY4 A;  1PRT C;  4DV2 L;  2ATL A;  1HNW H;  1O7I A;  3H15 A;  5L9X A;  4CGY B;  3PUZ A;  1CZW A;  3J81 E;  1STN A;  4YR3 A;  4F4Z A;  4RGO S;  1W96 A;  4JV5 L;  1WFQ A;  1TWA H;  5GON F;  3OSN A;  1KNA A;  1VQC A;  3KK7 A;  3DF7 A;  1L1O A;  3RN5 A;  1T94 A;  3ETH A;  1JX4 A;  1Z47 A;  1YHB A;  5CYU A;  1Y1V G;  3D8G A;  1B9N A;  3KBG A;  4DN4 M;  5CV6 A;  3HKZ G;  3LWE A;  4DR2 L;  4U6P A;  3U9O A;  2E2I B;  2K1B A;  2F0O A;  2PNR C;  1L0Y B;  5IYD G;  3MAQ A;  1A2T A;  1OTC A;  5KFM A;  3W5O A;  1RDP D;  2VB3 X;  4Q45 A;  1WVL A;  2QDB A;  2QGQ A;  1JCK B;  3IKJ A;  4LAA A;  3RN2 A;  1JIH A;  4X62 H;  5E1F A;  1B7Y B;  3N6R A;  1E3P A;  1EY4 A;  3HOX B;  4UCS A;  4UCR A;  2NZO A;  2HDL A;  2ZJQ A;  3CPF A;  5I4D A;  2K32 A;  3J81 c;  3V05 A;  3PF5 A;  2JEG A;  4PMB A;  2HVR A;  1DOL A;  2UXC H;  1D5M C;  1J9O A;  4A3D G;  4BBS B;  2AGQ A;  4PZ8 A;  3H0G A;  2VPS A;  4GOP A;  5DLQ E;  4JG2 A;  3BJY A;  1STB A;  3M9N B;  4V0B A;  4MV9 A;  4DR3 L;  2HVQ A;  1CS0 A;  4H44 C;  4Q8F A;  5EJW A;  2Z1C A;  3Q23 A;  4HIK A;  1PTO H;  4HIO A;  5EBC A;  5J39 A;  5EKK A;  2Z4I A;  2B2W C;  2YYA A;  1CQF A;  2L5T A;  1BDO A;  1EQR A;  2RDH A;  1CSP A;  4G7Z C;  1WOC A;  2J7Z A;  2WV6 D;  3MR5 A;  3EFX D;  2SCU B;  4BWG B;  1J6Q A;  1LTL A;  4K8I A;  5T1I A;  3TQY A;  3CC7 A;  2UXC Q;  1X3E A;  4RAZ A;  4RUC A;  3BQ2 A;  4ECU A;  4LFB H;  1SLJ A;  5KFC A;  2DNE A;  3CME A;  2O5I C;  2R92 A;  2NVQ B;  2C9O A;  2X69 A;  1WD1 A;  2K5H A;  2KCM A;  3S1R H;  5D8D A;  1H9S A;  5KG3 A;  3KJP A;  1LT3 D;  1R9T H;  1TWF B;  4AYB G;  3DHQ A;  1EY6 A;  2EDG A;  4TQU S;  4I4T F;  3GTQ B;  2G9H D;  4OEM B;  3RR5 A;  3KAL A;  5JH7 F;  1N34 Q;  5FPR A;  1O80 A;  3U9T A;  1ZET A;  3PSI A;  5C4X B;  1KJQ A;  3PUW A;  4GN5 A;  1KJI A;  5C6A A;  3WOF A;  4R8U B;  5M3F G;  1N36 Q;  1UC8 A;  2FJZ A;  4R8U A;  1I50 B;  2AGO A;  2K33 A;  3D4W A;  3RUZ A;  2MFI A;  3ER0 A;  2K5Q A;  4ODG A;  3RLN A;  2QA4 A;  1FJG L;  4I7A A;  1EYC A;  3MWD A;  2TMP A;  2LS0 1;  3IL8 A;  1S03 G;  1VQ4 A;  1L0X B;  1VBH A;  4RGN A;  3GTQ A;  2WAQ E;  5D3D A;  1YBY A;  2OWO A;  4PG3 A;  3BYY B;  2Y0S E;  3S1M B;  1B70 B;  2D62 A;  2HVS A;  2F0S A;  4OEL B;  1KBL A;  2J6T A;  2D2C C;  1BJT A;  1HR0 W;  3VMM A;  4ME5 A;  3KLS X;  3ONA B;  1A9X A;  4A3C G;  4FS2 A;  4ZRZ A;  1XNR H;  1VQE A;  2ICI A;  3SHL A;  2HHH L;  1K83 B;  2PZU A;  2IA6 A;  1FNU A;  2I8C A;  3I90 A;  1G6P A;  2CW0 C;  2DJF C;  3GTK B;  5DQG A;  2VQF H;  1RYR A;  2HDM A;  2KBN A;  3H3V C;  2KHJ A;  4LSA A;  1N32 Q;  3HOZ G;  1IYV A;  4MV1 A;  3L7Z C;  1QJO A;  1I7N A;  4IPG A;  4TV8 F;  2ALZ A;  4A3L G;  4QCL A;  3Q22 A;  4RU9 A;  3K59 A;  4HJA A;  4FBU A;  2P5Z X;  3SK5 A;  2ASJ A;  1IXR A;  3T5H A;  2B8G A;  2B39 A;  4P74 A;  3OTO Q;  1Y1W H;  4TQR A;  1ML0 D;  1B9M A;  3R2T A;  4RKB A;  5DM7 3;  1EY8 A;  1F2L A;  1VCI A;  3TS0 A;  2R87 A;  3MXN A;  5ELB A;  4U7C A;  1PH5 A;  2NUC A;  4J1M A;  1SYF A;  5A35 A;  1WTP A;  5KFF A;  4EBD A;  1X55 A;  2JXM B;  5CBA E;  3NPP A;  1HR0 H;  2QDL A;  4DV4 L;  4EFB A;  4OWT B;  5IT9 E;  3CCM A;  4WRD A;  5GRO A;  4HNT A;  4BXX H;  3HOW H;  1WTV A;  2ATW A;  1I4P A;  1STY A;  4EQ5 A;  3I12 A;  4Q44 A;  4IR9 A;  3ORQ A;  5FO9 B;  3F2B A;  1PZK D;  4A2A A;  3MWM A;  5KFA A;  4A3E G;  1SND A;  3ZJY C;  5BMV F;  2XIW A;  5KNC A;  4JI2 H;  3D4D A;  3BAA A;  3T56 B;  2O2L D;  1TWH A;  1DZ1 A;  3PQI A;  4MN3 A;  2UVR A;  2FIN B;  4KK7 A;  3M4O B;  1BF4 A;  2W57 A;  3HG9 A;  1BOS A;  4R9W A;  2A6H D;  4OO1 G;  2ALY B;  3A7L A;  1ICF B;  3TS2 A;  3TSS A;  1X3F A;  2W7O A;  2CQY A;  1H9R A;  2KOL A;  5C4H A;  1QVG A;  4RUA A;  4QWB A;  3T51 B;  1Y1V A;  3I55 A;  3H6M A;  5IWA L;  1RL2 A;  2VW9 A;  1VQD A;  4DR6 L;  1HHV A;  2DZD A;  2AWO A;  2EPB A;  1BQQ T;  3OWE B;  5IY0 A;  1LTT D;  3LGJ A;  2QF7 A;  3WO1 A;  4DV4 H;  3HOZ B;  3SE0 A;  1XPR A;  3ERQ A;  2IP4 A;  4BS9 A;  1VQL A;  2RGV A;  3GTK A;  4LSX A;  1MJC A;  4GC6 A;  1ET9 A;  2FB9 A;  3K5L A;  1RK6 A;  2B2V C;  2R7Z A;  3DMU A;  3QJY A;  4R4Q A;  5KGU A;  1V1P B;  4A3J H;  2PBZ A;  3KHR A;  2F4I A;  2VOB A;  1S0N A;  4JYA L;  2JK8 A;  4JI0 Q;  1KC7 A;  1SYX B;  1GUO A;  3C46 A;  3K6O A;  1PMR A;  1K8M A;  5ISR A;  3K7A B;  4PMW A;  2ZDG A;  1A3V A;  1XMQ Q;  1M8A A;  4ECT A;  2Z6K C;  1Q81 C;  3CKI B;  2YRW A;  5FK9 C;  4DNT B;  3NHH A;  1HZB A;  5IIF A;  5ELN A;  2JQO A;  5JVH 3;  1H95 A;  1AUX A;  4LMY A;  2VA3 A;  1KLU D;  3GIP A;  1BCP F;  1GSO A;  3S1R B;  3IAY A;  3BDO A;  2A74 C;  4UHV A;  4QIW E;  4IOC A;  4IFD J;  5LMN H;  3HFZ B;  2L4N A;  3QOL A;  2BDN A;  4CKE A;  3I56 A;  3G4S A;  1E4G T;  3G71 A;  4TVA B;  5LMU Q;  2XSC A;  4IOA A;  2XD4 A;  3H40 A;  1TWA A;  4DR6 H;  5KFN A;  2UUA Q;  2IX0 A;  1K3R A;  2ZJP A;  3TN2 A;  2NVT B;  3G6V A;  1CQV A;  1Y1V H;  2FLL A;  1A62 A;  2PYK A;  1I3Q A;  4X3U A;  1V43 A;  2CZG A;  4J9Q A;  2UVU A;  2J9G A;  4WOR A;  3VDY A;  3OW2 A;  4XYQ A;  4CC5 A;  4JI2 Q;  1FR3 A;  2JA5 A;  3J7A F;  1IBK Q;  1AW7 A;  2VUG A;  1SE3 A;  2XWB B;  1PH1 A;  3V2T A;  1SJE D;  3I4M B;  1GUT A;  5K5P A;  3CPW A;  1BR9 A;  3BJU A;  5HGT A;  2R86 A;  1D6E C;  4B3T H;  2R61 A;  2N8N A;  2RBM A;  4DV6 Q;  3I4N H;  4IR1 A;  2D0P A;  2PW5 A;  1UE7 A;  2OCE A;  4JI7 L;  4O3Q A;  4YR2 A;  3G6J B;  4JBW A;  4UCU A;  2W6N A;  2M00 A;  4R4C A;  4DR5 L;  5I9O A;  1EIY B;  4DV1 L;  4DV2 Q;  1OXX K;  4IHJ F;  1CQI B;  2A69 D;  2XGT A;  1JDE A;  3NSW A;  1L0W A;  1PVO A;  4PZ6 A;  4BY1 G;  3R5H A;  5KG2 A;  3DWQ A;  4YWM A;  3AMU A;  1CKN A;  4I7Z C;  2UUC H;  4A3B B;  2R84 A;  1BXT A;  1GUN A;  3GTO H;  5GQO A;  2KQ3 A;  4IPH A;  4JC0 A;  2NU7 B;  3CQZ B;  3TRE A;  5JJI A;  4KJO A;  3S16 B;  1V51 A;  3AYH B;  3OSO A;  5ELC A;  1VQK A;  1E2W A;  2UXB L;  4DL5 A;  3H0G B;  3PVX A;  5IP7 H;  3C1E A;  4YBZ B;  5COR A;  5KFH A;  4S3S A;  3DM1 A;  4NMZ A;  4ETS A;  4ED1 A;  3E9H A;  1BCP D;  1HNZ H;  3KAK A;  1Q12 A;  3GIQ A;  5J2T F;  5C5J A;  3WO0 A;  3BS1 A;  1W2B A;  2O4X A;  1CA6 A;  3UE0 A;  1EFW A;  2ZXR A;  2JEF A;  4BA1 I;  3OMG A;  4J9L A;  1YHA A;  3RAQ A;  4HAE A;  3TP7 A;  4A76 A;  1MSH A;  3OUU A;  3TBI B;  1TR5 A;  5KFE A;  5M3M B;  3IG0 A;  4EQO A;  4IAL A;  2JA5 H;  5KFT A;  5C0X G;  1L1O B;  5FLX c;  1WTH A;  2BOS A;  2WAQ B;  1HQR D;  2WAQ A;  2HD3 A;  2YU9 A;  1H9J A;  4X66 H;  1YIT A;  2EY1 A;  3RTX A;  4GS3 A;  4OXP A;  4A3B G;  4DR5 H;  3VR6 A;  1Y8O B;  1DXM A;  1HH2 P;  4OIK A;  3K58 A;  5HBR B;  4X65 Q;  2I46 A;  2JN4 A;  2L15 A;  2WKD A;  2R7K A;  4ECW A;  4B3S H;  1I6H B;  2OXP A;  4IFD I;  4J9N A;  3KOJ A;  3MZ5 A;  5EPL A;  1IYU A;  4JI4 L;  3BA9 A;  4QWE A;  2W9A A;  3CC2 A;  2UXB H;  3DEO A;  1YNJ D;  1AZP A;  3GTO A;  3I70 A;  4KLK A;  1K73 C;  2KEC A;  2UXD L;  5GAD C;  1HXY D;  4K2K A;  1JE5 A;  1HCZ A;  2CH4 A;  1TT2 A;  3SI8 A;  1EYZ A;  2F3I A;  4YJ2 F;  3H4D A;  5L1J A;  2E8G A;  4P71 A;  2M05 A;  1AZQ A;  1MGS A;  3UDI A;  1CKN B;  1G8Z D;  1EUC B;  5HUR A;  3FKI H;  4A3D B;  1X32 A;  3K0X A;  4L5S A;  4A3G H;  5D1O B;  4DAY B;  1N8R C;  2A6H C;  4AYB B;  5CAE B;  2K03 A;  3MWE A;  4FF1 A;  1EYD A;  1TWH B;  2D9U A;  2B63 B;  3GIK A;  3NBH B;  1TKW B;  1NSN S;  4A3J B;  4GN3 B;  5ELE A;  2K5W A;  5EGT A;  2IL8 A;  3S2D B;  2WAC A;  3RBE A;  1NR4 A;  5JUM A;  3QOJ A;  3H3V I;  1I4Q A;  4Y52 H;  1RJR A;  4O0A A;  4QGU A;  3HB9 A;  5BN4 A;  1M0W A;  4C3H G;  4PWQ A;  3PZP A;  4B3S L;  1EQQ A;  1JE4 A;  3Q8P B;  1U4P A;  1O78 A;  4DV3 L;  3PIP A;  2JEJ A;  2A6E D;  2NYZ D;  1JWU D;  4YHH L;  1SXT A;  1PTO F;  1LTB D;  5ELD A;  1JJ2 A;  5C3E G;  1FKA H;  1I7L A;  2F3V A;  3GV8 B;  4M7E A;  4MV3 A;  3CRL C;  4A3B H;  4RFB A;  1BBU A;  1STE A;  1NBW A;  4ULL A;  1TAE A;  4LF6 H;  2F4V Q;  4YQW A;  1PFM A;  2V59 A;  3G48 A;  3A56 A;  2WP8 J;  1IBK H;  4MTN A;  5J22 A;  1Q1B A;  2N3S A;  2CW8 A;  2EJM A;  3KTM A;  4DV5 H;  1PZJ D;  1RCV D;  4K0K L;  1FYC A;  4HSP A;  3CF5 A;  2IX3 A;  2K7V A;  2MHV A;  1KXL A;  1A2U A;  4CJ0 B;  1E1O A;  2JA6 B;  1L1O C;  5I47 A;  2OF1 A;  4JI3 Q;  4GNX B;  4ECV A;  3H91 A;  4IUQ A;  5AFW A;  3OOC A;  2N49 A;  2AU0 A;  4ZKC B;  1QE6 A;  4R1J A;  4LFC H;  3SVM A;  2N78 A;  1H9K A;  1MHW C;  5JVG 3;  1EZ6 A;  5EBD A;  4FYD A;  1K1S A;  3HKZ A;  2YTX A;  3SK4 A;  3CCQ A;  3PIO A;  3CAM A;  3KHL A;  3J81 W;  3IFT A;  1VQG A;  4O2A F;  2E5L Q;  5IP9 G;  2FPI B;  2DY8 A;  2R6F A;  2FJ2 A;  1BO0 A;  3EIV A;  1TXY A;  1WCM B;  3HBL A;  2DWC A;  4LF9 L;  2J4X A;  5IWA H;  4FF3 A;  1SFO H;  2BA1 A;  3GTO B;  5JOB A;  3GQC A;  4DR3 Q;  3PUV A;  3JC6 6;  2UXB Q;  2KA7 A;  1ET6 A;  5C44 H;  3T4A C;  4RWS C;  3MXP A;  2BQU A;  3PUY A;  5JEA G;  5KRU A;  3RB4 A;  1A3T A;  1LM0 A;  4KMU C;  1LO5 D;  1ZXT A;  4LW1 A;  3VA7 A;  4M1U B;  3HOV G;  4QJF A;  2MNA A;  4C5B A;  2RHS B;  1JOK A;  1TWC A;  4HCS A;  4LUV A;  2E5L L;  2C22 A;  2DUD A;  3K81 C;  3K80 C;  5KFS A;  3SR1 A;  1S68 A;  1TWF A;  2SEB D;  1JB3 A;  1XNR Q;  4OWW B;  2JYO A;  3FKI B;  3I2Z A;  4DV4 Q;  4FVM A;  4DL6 A;  3MFI A;  4JOI C;  4JW0 A;  4RGT A;  2R92 B;  1D8L A;  2PN1 A;  2Z6K A;  2IMW P;  2EXZ A;  4DF7 A;  4X64 Q;  2YV5 A;  2WB1 B;  4LF9 Q;  1DV2 A;  2ASL A;  4JI6 L;  4HQ6 A;  4HID A;  4MV4 A;  1WR2 A;  2L0C A;  4UFZ A;  1HZ9 A;  4MTK A;  1FJG Q;  1B1Z A;  3ND8 A;  1KRS A;  1EY9 A;  4IUV A;  1Y1V B;  3S24 A;  4KKT A;  1QZG A;  1I6H H;  5DQH A;  5KT5 A;  5T1G A;  2NZH A;  1ZQ7 A;  2WKC A;  1XMO Q;  3F2U A;  1LAC A;  4CDD C;  1C7Y A;  3I73 A;  4DKA C;  2I80 A;  1EZ8 A;  2F0H A;  5KFU A;  2DGY A;  2R8G A;  3E0E A;  3Q8S B;  1UNN C;  3S1N B;  3RUP A;  1BUV T;  2F3W A;  3K7A H;  5DQI A;  1XX8 A;  4X64 H;  1O7Y A;  3CD6 A;  2QEJ C;  3JAM E;  3I4M H;  1SYE A;  5IGF A;  4IRD A;  3HXL A;  1JOQ A;  5I2Y A;  1SNP A;  1IBL L;  4DR6 Q;  2E2I A;  3PO2 B;  1R4Q B;  5CA1 F;  1SDF A;  2JSO A;  2JA5 B;  1NJI C;  1EU4 A;  2IHF A;  4I65 A;  2KEE A;  3FKI G;  5LMN W;  3WDN A;  4OX9 H;  1W6K A;  1DGS A;  4G57 A;  5E7N A;  3GTG H;  2B3G A;  3Q8D A;  2IPK D;  4ZYS A;  2OTJ A;  1GUS A;  2UVV A;  5IGB A;  3K5M A;  3RNU A;  2ID0 A;  3S1Q H;  4X65 L;  1C9O A;  5BR8 Q;  2F0Q A;  4B9X A;  4KN4 C;  2ZXO A;  4JI6 H;  1YVC A;  4MV8 A;  3FMA A;  3R5X A;  1X9N A;  1SSO A;  5G3L D;  1ICW A;  4HN7 A;  3MXN B;  3NBI A;  2RGR A;  1LT6 D;  1UEA B;  1I4R A;  5KFL A;  1S0M A;  4NLG A;  5C1P A;  2BR0 A;  2E2H B;  1VQJ A;  4NXN L;  1EUD B;  4K5W A;  4CDE C;  5H80 A;  3M85 A;  2UU9 H;  4PV1 C;  3W1G A;  3BVZ A;  2KSW A;  1SN8 A;  5C3E H;  4K5V A;  5M3M H;  1JJG A;  2JEI A;  5M3F H;  2DLN A;  1Y8P B;  2R93 G;  4R4O A;  2LXK A;  3NBH A;  2J0T D;  1N34 L;  3J80 E;  2P0A A;  4F4W A;  4DV0 Q;  1RTO A;  4B3M Q;  4NB3 A;  1ILQ A;  5EOY A;  2XTI A;  4GN4 B;  5LL6 b;  5EWG A;  3TRZ A;  1F77 A;  1V1P A;  5KFJ A;  4AYB A;  3MEF A;  2HQE A;  2R7Z B;  3ICE A;  1GGO A;  2A68 D;  5D1O A;  2Q2H A;  1M6V A;  3A7A B;  1WYD A;  2EY6 A;  3H94 A;  3OSP A;  5H1S E;  4LF5 L;  2VR1 A;  2F0G A;  1GYF A;  2AUK A;  2LY7 A;  1CFM A;  1I4H A;  3CCE A;  2XRQ D;  2F0P A;  4ID6 A;  4ZKB B;  3S16 H;  3KXY T;  3J81 i;  5DNF A;  4FNF A;  4X3T A;  3P75 A;  4A3I H;  2BCO A;  1CZG A;  1MKH A;  1NE3 A;  4NXN Q;  2W9C A;  1IW7 D;  4L63 B;  1STG A;  3ULJ A;  2QK4 A;  4YR0 A;  2EXD A;  2W8L A;  2RVL A;  3D31 A;  1S40 A;  2F52 A;  2E2D C;  4MNO A;  3M7N A;  3PN1 A;  1O7Z A;  3OPO A;  5I6Y A;  4DR1 L;  3OIP A;  4C2M H;  1RJT A;  5HV6 A;  3MR2 A;  3CCJ A;  4C3I H;  2UXD H;  1Z2O X; 
#chains in the Genus database with same CATH homology
 2AWO A;  3HKZ E;  3M3Y H;  5IY0 A;  1WCM H;  4JCV E;  4A3K G;  1PH6 A;  1KL9 A;  1PFS A;  1Y14 B;  3U58 A;  5FLM G;  4L5T A;  2OTL A;  5J3B A;  3LGJ A;  1IL2 A;  1CKM A;  2K52 A;  1XPR A;  4L5S A;  1VQL A;  1NMF A;  4DUZ L;  1MJC A;  4BBR G;  4K0K Q;  1VQB A;  1CUK A;  4A3D H;  3S2D H;  2BA0 A;  4YWL A;  4RG1 A;  2RF4 A;  4C3J H;  3PO3 G;  4R4Q A;  3UE1 A;  4HJ9 A;  4A3J H;  5C0X I;  2PQA A;  3CQZ H;  4JYA L;  1E7Z A;  3KDF B;  2JK8 A;  4JI0 Q;  3J7A 5;  1U0L A;  4NPS A;  1PHJ A;  2JEA I;  1I6H H;  2JA6 H;  4PMW A;  2WB1 G;  3I7F A;  2YTY A;  1XMQ Q;  4YY3 Q;  1Y1W G;  1JB7 A;  3I4O A;  2Z6K C;  1Q81 C;  1E22 A;  4LF6 L;  4WJ3 M;  4GOP C;  5IP7 G;  1HZB A;  4YY3 L;  5ELN A;  2JQO A;  1AH9 A;  1H95 A;  3JAM c;  4UP8 A;  2K4K A;  4A3M H;  3M9B A;  4B3R Q;  2A8V A;  1SR3 A;  3U4V A;  1FL0 A;  3KF6 A;  4QIW E;  4IOC A;  1B8A A;  1VQA A;  5HY6 A;  4DV5 L;  1MJE A;  3PF4 A;  4IFD J;  3HFZ B;  3G4S A;  2K75 A;  3I56 A;  2CCZ A;  4JV5 Q;  4H02 A;  2WB1 E;  1I50 H;  5K36 G;  3G71 A;  2Z0S A;  3KJO A;  2KCT A;  4TVA B;  5AJ3 Q;  5LMU Q;  2UU9 Q;  2K5V A;  4POG A;  4IOA A;  5IYD H;  3H0G G;  2AWN A;  1HJP A;  5AJ3 L;  5LMU L;  1QUQ A;  2UUA Q;  2IX0 A;  1K3R A;  4DV7 Q;  2AKW B;  4B3T Q;  2LXJ A;  2ZJP A;  1VQ5 A;  4APV A;  1Y1V H;  2UUA L;  1A62 A;  2CQO A;  4X66 Q;  3KYH C;  4X62 L;  2K50 A;  1V43 A;  3RZD H;  2BH8 A;  4A3G H;  4GKJ L;  1SE8 A;  1IBK L;  3VDY A;  3OW2 A;  4JI2 Q;  1IBK Q;  1PH1 A;  4JI1 L;  3CCR A;  2VZA A;  2YU9 H;  3CPW A;  1PYB A;  3BJU A;  3F2C A;  1LUZ A;  1PH3 A;  4DV3 Q;  4WJ4 A;  4YCU A;  1WCM G;  2JA9 A;  2N8N A;  4DV6 Q;  1P16 A;  4FDB A;  3I4N H;  2D0P A;  3NEN A;  1VQI A;  5M5X H;  4DK6 C;  1UE7 A;  2OCE A;  3U4Z A;  4DUY Q;  1A8V A;  3UDG A;  4JI7 L;  4QL5 A;  2R7Z G;  2KEN A;  1YIJ A;  2ZM6 Q;  4JBW A;  2PI2 E;  4YCW A;  1VS0 A;  4QY7 A;  3J80 c;  3KFU A;  4A4I A;  4R4C A;  4DR5 L;  4OO1 I;  2VQF L;  3IRB A;  1LYL A;  1KRT A;  1OXX K;  4DV1 L;  4DV2 Q;  1EYG A;  1EIY B;  5HGQ A;  2UU9 L;  2XGT A;  3GTM H;  4DR5 Q;  1L0W A;  2R7D A;  1PVO A;  4PZ6 A;  4BY1 G;  1ASZ A;  5IT9 c;  1A63 A;  4YWM A;  1CKN A;  2I5H A;  1IBL Q;  4J15 A;  1HNZ Q;  4X64 L;  1K83 H;  1QZH A;  4P75 A;  3GTO H;  3KF8 B;  5GQO A;  4IFD G;  1HNW L;  1JJG A;  4Y7N H;  2EQS A;  4IPH A;  4JC0 A;  5IE8 A;  1PH7 A;  2R6G A;  4JI6 Q;  1I94 L;  3TRE A;  1KD1 C;  5JJI A;  1SRO A;  2CKZ B;  1W3S A;  3AYH B;  4JI2 L;  5C44 G;  1VQK A;  2UXB L;  2ZJR A;  4BBR H;  4DR2 Q;  2I5L X;  5IP7 H;  1SMX A;  3F2D A;  4GKK Q;  2E2J H;  2JA7 G;  4BY7 H;  1OXS C;  2OQ0 A;  3E9H A;  4GLX A;  1Q12 A;  3HOV H;  3WWV A;  1T9H A;  2NVY H;  2K14 A;  4LFA Q;  4DR7 L;  1OXU A;  5FJ8 H;  4BY7 G;  4JBM A;  1VQN A;  1JT8 A;  1OXT A;  1W2B A;  2NVQ H;  3UE0 A;  5M3M G;  1EFW A;  2JA7 H;  3HOW G;  2JE6 I;  4JI5 L;  1IBM L;  4L5R C;  4YCV A;  4BBS H;  1HZC A;  4BA1 I;  1PH8 A;  1WJJ A;  3J7Z C;  4LFC Q;  1TWF H;  1YHA A;  3KF6 B;  1Q86 C;  2R92 H;  2IY5 B;  1UE1 A;  1YEZ A;  2NVX H;  4A76 A;  1TWG H;  2CWA A;  1KAW A;  2PQA B;  2VQE Q;  3T1H Q;  4A3M G;  1K8G A;  3S14 H;  1ASY A;  2JA5 H;  5C0X G;  1L1O B;  4DAM A;  5FLX c;  5C4X H;  1XPO A;  1HR0 Q;  1GVP A;  4GNX C;  3HOU G;  1YHQ A;  2I0Q A;  2LSS A;  1YIT A;  1I94 Q;  1BKB A;  4GS3 A;  4PZ7 A;  1Q7Y C;  1HR0 L;  5GAH C;  1NTG A;  3PCO B;  4OXP A;  4A3B G;  3K8A A;  2HQL A;  3G6E A;  1A0I A;  1TWH H;  4B3M L;  2JA8 G;  1HH2 P;  4BXX G;  2CFM A;  3HOY G;  4X65 Q;  4AQY L;  1HNX L;  2ASB A;  2L15 A;  1X65 A;  1EWI A;  3EBE A;  3I4M G;  1PV4 A;  4JI4 Q;  3RZO H;  5JJK A;  4IPD A;  2R92 G;  4IFD I;  3KOJ A;  4KHZ A;  2JEB I;  1X54 A;  3H3V H;  4A3E H;  4JI4 L;  1G29 1;  3CP0 A;  2HIV A;  4DR4 Q;  1I5F A;  1VQP A;  4A3I G;  3S1M H;  3S1N H;  4A3C H;  3CC2 A;  5M5W H;  4P73 A;  3L2P A;  5GAG C;  2HT1 A;  5C4X G;  1K0R A;  5IP9 H;  4DV6 L;  1P8L A;  2GN5 A;  3GTP H;  4KLK A;  2IT1 A;  1K73 C;  4IJH A;  4YWK A;  1GD7 A;  2UXD L;  5GAD C;  3OYY A;  1OXV A;  1JE5 A;  4A3L H;  1HZA A;  3HOZ H;  3GD7 A;  4P72 A;  4R4T A;  2F3I A;  3PUX A;  2Q2T A;  1V9P A;  2E8G A;  3PO2 H;  4P71 A;  4KHP Q;  3UDI A;  4DPG A;  5IYB H;  1BBW A;  1CKN B;  4LFB Q;  4A93 H;  3W1B A;  3A5Z B;  1S3O A;  4AYB E;  3FKI H;  1FGU A;  1QVC A;  3GDE A;  3K0X A;  1EUJ A;  4LUZ A;  1RIP A;  1X3G A;  4DAY B;  4A3K H;  1X56 A;  1N8R C;  3GTJ H;  5LMN L;  3GTK H;  3NEL A;  2ZTD A;  1VQO A;  1UE6 A;  5LMN Q;  2VNU D;  2Q2U A;  2QEX A;  5C4J H;  1UWV A;  2NN6 G;  3NBH B;  1YJW A;  2R7Z H;  4AQY Q;  1HNX Q;  3PO3 H;  2K5N A;  4GN3 B;  3AFP A;  4LF7 Q;  4JYA Q;  2VS1 A;  3H3V I;  3CCL A;  3M4O H;  3A0J A;  4LF4 L;  4Y52 H;  2H5X A;  4O0A A;  4QGU A;  4LFA L;  1PH9 A;  4DR7 Q;  5EAY A;  4X6A H;  4KI0 A;  3J81 j;  4B3S L;  4JOI A;  4A93 G;  1JJC B;  1EQQ A;  2JA5 G;  3F8T A;  1QVF A;  4DV3 L;  3PIP A;  2OQK A;  1C0A A;  4KHP L;  1IYJ B;  4YHH L;  1JJ2 A;  4DNI A;  5C3E G;  1AE2 A;  1MIU A;  1XNR L;  3CXC A;  4LF6 Q;  3A5U A;  3GO5 A;  3CCV A;  3T1H L;  4BBS G;  2A1A A;  3E9I A;  1GKH A;  1PH2 A;  4MZ9 A;  4A3B H;  2R7F A;  1NY4 A;  4DV2 L;  4JBJ A;  4ALP A;  2F4V L;  4OX9 L;  3AEV A;  4IO9 A;  1O7I A;  3H15 A;  2VUM G;  1BBU A;  3BU2 A;  3PUZ A;  1NBW A;  2NN6 I;  3A74 A;  2F4V Q;  3SGI A;  3S15 H;  3U50 C;  4JV5 L;  1WFQ A;  1N32 L;  4LF8 L;  3G48 A;  3L0O A;  1TWA H;  2WP8 J;  2R93 H;  4MTN A;  1VQC A;  4O2D A;  1Q1B A;  4A75 A;  2N3S A;  1L1O A;  2B29 A;  4UPA A;  3RN5 A;  1N33 L;  1Z47 A;  1YHB A;  1FVI A;  4K0K L;  1Y1V G;  4UP9 A;  2JA8 H;  2MQH A;  3HKZ G;  4DR2 L;  4BA2 I;  3CF5 A;  3CMA A;  4UY8 C;  1KXL A;  4B3S Q;  3BZK A;  4NXM L;  1E1O A;  1L1O C;  5IYD G;  4GNX A;  1OTC A;  4GNX B;  4JI3 Q;  4LF4 Q;  1D7Q A;  3W5O A;  5IYB G;  2N49 A;  4GLA C;  2QGQ A;  4R1J A;  2N78 A;  3RN2 A;  1K9M C;  5IWA Q;  4DR1 Q;  1B7Y B;  2AMC B;  4IJL A;  2YTX A;  1XJV A;  1E3P A;  3PV0 A;  3CCQ A;  3F1Z A;  1Q8K A;  2NZO A;  4OWX B;  3PIO A;  2ZJQ A;  3CAM A;  3CPF A;  3J81 c;  3PF5 A;  1VQG A;  4UP7 A;  2E5L Q;  5IP9 G;  2Q2I A;  4A3D G;  2ES2 A;  4PZ8 A;  2UUC Q;  2ZM6 L;  2IHE A;  2ZTC A;  3EIV A;  5DLQ E;  4HJ5 A;  3TEH B;  1TXY A;  4JG2 A;  4HJ8 A;  4GOP A;  2UUB L;  1S72 A;  1VQ6 A;  4LF9 L;  2VY3 A;  3GTQ H;  2VL6 A;  4DR3 L;  1J5E Q;  1N33 Q;  1SFO H;  1GO3 E;  2BA1 A;  2B63 G;  2BH2 A;  1KIX A;  4DR3 Q;  1J5E L;  4HIK A;  4X66 L;  3PUV A;  4HIO A;  4GKJ Q;  2MO1 A;  3JC6 6;  3FHW A;  2UXB Q;  1VQF A;  3DLL A;  4DV7 L;  5C44 H;  1G51 A;  5C0X J;  1EQR A;  4AIM A;  1SRU A;  1CSP A;  1WOC A;  3PUY A;  4X62 Q;  1XMQ L;  5JEA G;  3PGZ A;  5ELO A;  4DR4 L;  4XIG S;  1J6Q A;  3DM3 A;  1LM0 A;  1LTL A;  3CC7 A;  4LW1 A;  3KLW A;  3TQY A;  1XMO L;  4QJF A;  3HOV G;  1X3E A;  2MNA A;  2UXC Q;  2RHS B;  5IYC H;  1IBM Q;  1SLJ A;  4R4I A;  2E5L L;  4LUV A;  3S17 H;  2DUD A;  3K81 C;  3K80 C;  3CME A;  4LNQ A;  1XNR Q;  4OWW B;  3I2Z A;  2K5H A;  4DV4 Q;  2KCM A;  4LUO A;  3S1R H;  2WFW A;  3NEM A;  3KJP A;  4JOI C;  1R9T H;  3CCS A;  1D8L A;  4AYB G;  1KHI A;  2Z6K A;  2Y0S G;  4TQU S;  3RR5 A;  1IZ6 A;  1XPU A;  2ZTE A;  4X64 Q;  1N34 Q;  2UUB Q;  2YV5 A;  3D0F A;  4C3H H;  4DV0 L;  4LF9 Q;  3ULL A;  1XNQ Q;  4POF A;  1YI2 A;  3HKS A;  2WAQ G;  3PSI A;  4LF8 Q;  4JI6 L;  2NVT H;  3PUW A;  4GN5 A;  4HID A;  3RLF A;  1CKO A;  1HZ9 A;  1FJG Q;  1YJ9 A;  1Q1E A;  1Q46 A;  2HIX A;  1KRS A;  5M3F G;  1KC8 C;  4GOP B;  2GVB A;  1N36 Q;  4B3T L;  3S24 A;  2MFI A;  3ER0 A;  3RLN A;  1QZG A;  1FJG L;  2I5M X;  2QA4 A;  4HJ7 A;  3HOY H;  1GM5 A;  3EN2 A;  3H0G H;  2PNH A;  4GLV B;  3AQQ A;  2NZH A;  1XMO Q;  1EIF A;  1C7Y A;  1WI5 A;  1VQ4 A;  4DKA C;  1U5K A;  2WAQ E;  5FLM H;  1VQ9 A;  2GVA A;  2JJQ A;  3HOU H;  2DGY A;  1VQM A;  4JI8 Q;  1YBY A;  3OTO L;  3E0E A;  3T1Y L;  2OWO A;  3JAM i;  2YYZ A;  4PG3 A;  4QQB X;  4JI8 L;  2Y0S E;  1B70 B;  1VQH A;  2D62 A;  3K7A H;  1PH4 A;  4YHH Q;  1K8A C;  4B3R L;  1N9W A;  3CD6 A;  3I4M H;  1HR0 W;  1VQ7 A;  3RLO A;  3CC4 A;  1IBL L;  1Q82 C;  1UEB A;  4DR6 Q;  4A3C G;  2C35 B;  1VQ8 A;  1VQE A;  2HHH L;  4RMF A;  1NJI C;  2JA6 G;  2IHF A;  1G6P A;  1X6O A;  1Z9F A;  3FKI G;  1N36 L;  5LMN W;  2HHH Q;  5JEA J;  3M4P A;  1DGS A;  2KBN A;  5E7N A;  1HNZ L;  1TWC H;  2B3G A;  2KHJ A;  3ERS X;  3Q8D A;  3GTG H;  3HOZ G;  1N32 Q;  2OTJ A;  3STB C;  4DR6 L;  3RNU A;  3L7Z C;  4IPG A;  1YJN A;  4A3L G;  4XTC S;  2ID0 A;  3S1Q H;  1CSQ A;  2B63 H;  4HJA A;  4X65 L;  1C9O A;  2FXQ A;  4LWC A;  5BR8 Q;  1IXR A;  5IYC G;  1PA6 A;  4GKK L;  1YVC A;  4EX5 A;  1X9N A;  1AE3 A;  4P74 A;  5FJ8 G;  3OTO Q;  1Y1W H;  4JI1 Q;  4LF5 Q;  3GTL H;  1KQS A;  1VCI A;  4JI3 L;  3TS0 A;  3MXN B;  1PH5 A;  2UXD Q;  3CW2 C;  1NMG A;  1X55 A;  3T1Y Q;  4A3J G;  1QUQ B;  4JI5 Q;  5M5Y H;  2VQE L;  2PI2 A;  4IPC A;  1VQJ A;  3K7U C;  4NXN L;  3UDF A;  4DV4 L;  4HIM A;  2AHO B;  4LFC L;  4OWT B;  3BZC A;  3W1G A;  3M85 A;  3CCM A;  5GRO A;  4BXX H;  1SN8 A;  3AFQ A;  5C3E H;  5M3M H;  2VQF Q;  3STB D;  5M3F H;  4DV1 Q;  3HOW H;  3M4Q A;  1XTD A;  1M90 C;  3HOX H;  2ATW A;  2UUC L;  4AH6 A;  4R4O A;  4EQ5 A;  2R93 G;  2LXK A;  5JJL A;  1N34 L;  4DV0 Q;  2CWP A;  3F2B A;  1XNQ L;  4B3M Q;  4NB3 A;  1UE5 A;  2EIF A;  3FP9 A;  4A3E G;  2XTI A;  4GN4 B;  1E1T A;  3ZJY C;  2RCN A;  3CCU A;  2VUM H;  3TRZ A;  4DUZ Q;  3HOX G;  4A3F G;  3MEF A;  1PYS B;  2D0O A;  3ICE A;  3S2H H;  2Q2H A;  1YZ6 A;  1WYD A;  5H1S E;  4LF5 L;  4OON A;  5GAE C;  1EOV A;  4A3F H;  3UDX A;  4NXM Q;  5BR8 L;  3CCE A;  2E2I H;  1JMC A;  4LF7 L;  2V1C C;  2A19 A;  3KDF A;  3S16 H;  3J81 i;  3I4N G;  1M1K C;  4BY1 H;  4OO1 G;  2MO0 A;  2ALY B;  2YTV A;  1YNX A;  4A3I H;  1L2F A;  1V1Q A;  1MKH A;  1NE3 A;  4DK3 C;  3B6Y A;  2IX1 A;  4JI0 L;  3TS2 A;  3J80 i;  4NXN Q;  4A3G G;  1X3F A;  3ULJ A;  3ULP A;  2UXC L;  2EXD A;  2E2H H;  3D31 A;  1E24 A;  1S40 A;  1QVG A;  2F52 A;  2KHI A;  4DUY L;  4JBK A;  4MNO A;  3M7N A;  4JI7 Q;  4LFB L;  1HNW Q;  3I55 A;  1I3Q H;  3PO2 G;  2PMZ E;  4C2M H;  5IWA L;  1RL2 A;  4DR1 L;  4OX9 Q;  4DV5 Q;  1BVS A;  1VQD A;  2VW9 A;  4L5Q A;  3CCJ A;  4ME3 A;  4C3I H;  2RHQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...