3HOWG

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 31
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3howG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3howG01
1CKNA 1EWIA 5C3EG 4GLXA 1E22A 1HR0Q 3L0OA 4A3IG 3M9BA 1L0WA 1SE8A 1VQHA 3U58A 1HNXL 2I0QA 1L2FA 1WCMG 4A3JG 2ZJRA 3A74A 1IBML 2ATWA 5GADC 1XMQL 2D0OA 3M4OH 4R4TA 2RF4A 2B29A 2IHEA 1SFOH 4X62L 3HOXG 4LWCA 3Q8DA 2VQEQ 2Y0SE 4DV4Q 2NZHA 3RLFA 1LUZA 5HY6A 4X64L 3S15H 4NB3A 1K0RA 3D31A 4PZ8A 5LMUL 1VQ5A 1K8AC 1YJWA 5M3FH 1VQFA 2DGYA 1EUJA 4DV2L 2YV5A 3HOWG 4H02A 3I55A 3H0GG 4JI8L 4NXNQ 3J7A5 1NTGA 4YCUA 3KJPA 2ZM6Q 2OQ0A 2ALYB 2D62A 1YBYA 2IT1A 4DK3C 3HOZH 4DR6Q 1BBUA 4WJ3M 2NN6I 2JA5G 5LMNQ 2L15A 2KHJA 1S72A 2JJQA 4IPCA 4YCWA 4DV5L 1HNWQ 1E7ZA 4DR6L 4DR3L 3W1BA 1QZHA 3I4MH 3NELA 2BA1A 3I7FA 2Q2HA 1VQEA 4LW1A 4DV2Q 5IWAL 4JI2Q 1VQ8A 5BR8Q 4BA2I 1MKHA 4QJFA 4LF5L 4A93H 4OWTB 3H0GH 2CCZA 5K36G 1VCIA 1OXSC 2D0PA 1VQBA 5IWAQ 1VQOA 4APVA 4POFA 1KD1C 4AH6A 3CC4A 3RZDH 1Q8KA 5FLXc 5JEAJ 1U5KA 5IYDG 3CCEA 5FLMG 1SMXA 3HOVG 1K73C 1XNRQ 3S1MH 3E9IA 4DR3Q 4JC0A 4QL5A 4AQYQ 1FGUA 1TWHH 1XNQL 3E0EA 2Q2TA 4QQBX 4L5TA 2UUAL 3OYYA 1J5EL 1UE5A 1I5FA 1X3GA 2R7ZG 3CPWA 2Q2UA 1EIFA 1PYBA 3ER0A 4P73A 3RR5A 5C0XG 4DR7Q 2HT1A 2NVQH 2EIFA 2GVBA 2BH8A 1WCMH 2JK8A 4KLKA 3H15A 2A1AA 2VQEL 2AWOA 4DV4L 4A3JH 2B63G 3M85A 1GM5A 1LM0A 2OQKA 2YTYA 3GD7A 4X66Q 4BY7H 1VQGA 4ALPA 2N78A 1K8GA 4NXMQ 3PUVA 1K9MC 3FHWA 5C44G 5C0XJ 3S1RH 4DR1L 1IBMQ 2BH2A 3ZJYC 4OXPA 1VQ6A 1IBLQ 4DNIA 1SLJA 3TRZA 2PNHA 2YTVA 3F2BA 1Q86C 4BXXH 5IYDH 1L1OB 2R7FA 1HNXQ 2E2HH 4GKKQ 5IP7H 3GTPH 3IRBA 4DUYL 4R4QA 2UUBQ 1Z47A 3RLOA 1G6PA 2AKWB 3J81i 1YJNA 5C0XI 1Q46A 4JI6Q 2UXDQ 1RL2A 3J7ZC 4DV0Q 3I4NG 3AYHB 1N8RC 4NXML 3K80C 5JJLA 5FJ8H 4JI1Q 5GROA 1N36L 3PF4A 2I5LX 5IYCH 1KRTA 1N34Q 4IFDI 3UE1A 5BR8L 1M1KC 4JOIC 1G51A 2ID0A 2R92G 1UE7A 4A3EG 5M5YH 1EQQA 4RMFA 2UUAQ 1R9TH 1Q81C 4DR4Q 2MO1A 1CKMA 1WFQA 4K0KL 2UXCQ 4OONA 1XMOL 1XNQQ 2GVAA 1WOCA 4Y7NH 2ZTCA 1OTCA 1JJGA 3ERSX 3KJOA 4GOPB 3RZOH 3EIVA 4LFCQ 3GTMH 4A3DG 3PGZA 2PI2A 3CF5A 4XTCS 4HJ8A 3G4SA 3BJUA 3UDIA 4B3ML 3HOUH 2VUMG 5GQOA 3TEHB 1T9HA 1OXUA 4JYAQ 2IY5B 2CWAA 5AJ3Q 1AE2A 4YCVA 4GNXA 3PUZA 2R7ZH 1SR3A 4PZ7A 2XGTA 1VS0A 1A62A 2JA7G 3FKIG 3PCOB 3HFZB 3SGIA 4A4IA 4LF6Q 4OWXB 4X64Q 5FJ8G 1ASYA 1VQNA 3CCSA 4B3MQ 3KF6A 3HOXH 4HIOA 1QVFA 3I2ZA 4X65Q 4DV5Q 2B63H 1Q12A 4DV0L 1HNWL 4A3DH 2Z6KC 1GVPA 5IP7G 5LMNL 1OXVA 1X3EA 2Z0SA 2H5XA 3CC2A 1HZCA 1L1OC 3CCJA 1Q82C 3F2DA 1OXTA 4GN5A 1JJCB 5C3EH 1VQPA 3NEMA 4GLAC 5M3FG 3CP0A 2AMCB 1X55A 1N33L 3TS2A 2OTJA 3CC7A 4JI6L 1KQSA 4A3LG 2K5HA 3CCVA 4BBRH 4LF4Q 4A3BH 4B3SL 4PG3A 2JA5H 1CKOA 2VQFQ 4JI7Q 4IPHA 2E8GA 3CPFA 1PH6A 4PMWA 2N8NA 2V1CC 3A0JA 5M3MH 4C3JH 1E1TA 2WB1E 1B70B 4DV6L 2JA8G 4TVAB 1EOVA 5IP9G 4P72A 4DUYQ 2UUBL 1IL2A 4A3CH 4C3HH 3CCRA 2JA9A 4MTNA 3M3YH 1XMQQ 2R92H 1PH4A 1N32Q 1J6QA 2VY3A 4GLVB 2NZOA 3TREA 5JJKA 4DV3Q 4GOPC 3I4MG 2K52A 4GKKL 2CKZB 3OTOL 2R6GA 4TQUS 4HIMA 4L5QA 3T1YL 1HR0W 1I94L 4DUZL 4JI5Q 3TS0A 1FJGL 1S3OA 1QUQA 2VL6A 4LUZA 4LF7Q 2UXBQ 1O7IA 1VQAA 2N49A 2Y0SG 4DV1Q 4DAMA 2R93G 1VQKA 1UWVA 1B7YB 2WAQG 4PZ6A 4JOIA 4UP8A 4JI0Q 4DUZQ 1X9NA 1PH2A 3PO3H 1YHBA 4AIMA 4DV7L 1SROA 4X6AH 3KF6B 3CD6A 4A3GG 4OO1I 2ZTDA 3A5ZB 2HHHQ 3BZKA 1W3SA 3G6EA 5FLMH 2KBNA 3G48A 4DV6Q 3KLWA 2MO0A 2F4VQ 3CMAA 2E5LL 4AYBE 1TWCH 5M3MG 1SRUA 2BA0A 2N3SA 4UY8C 2JA6G 4A3CG 1W2BA 2Z6KA 2KHIA 3HKZE 4BBSH 2YTXA 3UDXA 1UE1A 3JC66 3K8AA 1TWGH 4IJLA 4A3MH 4R4CA 3F1ZA 3PUXA 1CSPA 4A3LH 4DR2L 4R1JA 3T1HL 1JMCA 1I6HH 1HZAA 5JEAG 2OTLA 3H3VH 5AJ3L 4GNXC 1D8LA 4X62Q 1SN8A 1E3PA 2K75A 1U0LA 4OO1G 3ICEA 4IFDJ 2CWPA 1B8AA 4YWKA 4R4IA 4YY3Q 1AE3A 1PFSA 2JA6H 3ULLA 1JE5A 1VQDA 1JB7A 4IFDG 1VQLA 3CCLA 3AFQA 4LFBL 4KHPL 1VQIA 1IZ6A 4LUVA 2DUDA 4UP7A 4NXNL 1LTLA 5IY0A 4HJ9A 4LFAL 4YHHQ 4DR2Q 2JA7H 3GTLH 2WP8J 4A3EH 4BXXG 4XIGS 4JI3L 4JI0L 5J3BA 1UEBA 3CCMA 1A8VA 3OW2A 3PO2G 4IJHA 4EQ5A 1PA6A 2UXBL 4OX9L 3PO3G 4A3FH 4Y52H 4JI1L 1LYLA 3HOUG 1HZBA 4JBMA 4A76A 2F3IA 2E5LQ 1PH9A 1YZ6A 2XTIA 5C4XG 4WJ4A 5M5WH 2VUMH 3A5UA 3E9HA 3ULJA 3MEFA 1E24A 3D0FA 1NBWA 4IOCA 3PUYA 4A3KH 4B3RL 1IYJB 1X6OA 1D7QA 5IYBG 5H1SE 3F8TA 1XMOQ 1E1OA 3UE0A 3S2HH 3RNUA 1Q1BA 1XPUA 3J80i 3TQYA 1PVOA 4BBRG 1I3QH 1X3FA 2I5HA 4HIKA 1EYGA 1HNZQ 2YYZA 4B3TQ 1CKNB 2OCEA 1Q1EA 4MNOA 3H3VI 4KHZA 2K50A 3NBHB 4J15A 1WI5A 1NE3A 3PV0A 3B6YA 3HOZG 4GN3B 4LF4L 3HOYG 1C9OA 2C35B 4DR7L 2Q2IA 1Q7YC 1AH9A 4O0AA 4GS3A 4KHPQ 4LF9Q 4DKAC 3CMEA 4HJAA 5IE8A 4QIWE 3T1YQ 4A93G 4LFAQ 3NENA 2MNAA 4A3BG 1X56A 1PH3A 5DLQE 4P71A 3BZCA 5IT9c 5C4XH 4IO9A 4LFBQ 2JEAI 1HH2P 2RCNA 3PO2H 3KYHC 3M4QA 1TWAH 1BVSA 4YY3L 4AQYL 4JBWA 2IHFA 1GD7A 4LF8L 2WAQE 4BY7G 3HOVH 1V9PA 1EFWA 3FP9A 4IPDA 3KDFA 1EQRA 3CQZH 1YIJA 4O2DA 2JA8H 3KOJA 2I5MX 1Y1WG 4DAYB 2VQFL 4JI7L 1A0IA 1OXXK 1Y14B 4NPSA 4LF5Q 4A3IH 3F2CA 4EX5A 1N33Q 4JYAL 3DM3A 3S1NH 1NMGA 3GTJH 3CXCA 1NJIC 1JJ2A 3HKSA 2JE6I 4A75A 3UDGA 1XPOA 4JCVE 3I56A 2ES2A 5LMNW 1C7YA 1VQJA 1NY4A 3MXNB 1XTDA 4BY1H 1BKBA 2NVXH 1YVCA 3U50C 5GAHC 4JBJA 2ZM6L 3GTQH 3I4NH 2UUCQ 4HIDA 3K7UC 4JG2A 1PHJA 4OWWB 1IBKQ 3BU2A 3S16H 3LGJA 1N34L 5ELNA 1UE6A 3ULPA 4QGUA 3J80c 2JQOA 1MJEA 2K5VA 3T1HQ 2EXDA 2UU9L 4A3GH 2NVYH 3CW2C 2IX0A 4DV1L 1YI2A 2RHQB 4DK6C 4GKJQ 4LF7L 2UXDL 3S14H 2B3GA 1M90C 2EQSA 5HGQA 5IYCG 4IPGA 5JJIA 3GDEA 3OTOQ 4LFCL 1KAWA 1HNZL 2WFWA 4C2MH 4GN4B 3PIOA 3W1GA 1QZGA 1Y1WH 4DR5Q 4P75A 1KHIA 4DR4L 4K0KQ 3K7AH 3VDYA 4DV3L 2HQLA 2HHHL 2UXCL 1HR0L 1VQMA 1G291 1KL9A 4L5SA 1KIXA 4LF9L 4GNXB 4GKJL 2ZJQA 4P74A 3AQQA 4X66L 5C4JH 3FKIH 4YWLA 3U4ZA 1K83H 3M7NA 4HJ7A 3I4OA 2NN6G 3J81c 1A63A 3W5OA 4JV5L 2AWNA 1HZ9A 3GTGH 5ELOA 1PH5A 1YHQA 4GOPA 3K0XA 4B3TL 4B3SQ 5GAGC 4JI5L 1FJGQ 4MZ9A 1Z9FA 1YJ9A 2K4KA 2ZTEA 2FXQA 1VQ4A 1J5EQ 2E2JH 3JAMi 2PQAB 3AFPA 1FVIA 3DLLA 2ZJPA 3RN2A 3KFUA 4ME3A 4FDBA 2QGQA 4RG1A 4LNQA 1N32L 1H95A 3K81C 4B3RQ 1IBLL 3S2DH 1DGSA 2MFIA 1C0AA 1YITA 2OWOA 4YWMA 2VNUD 3AEVA 1X65A 1KC8C 4AYBG 1N9WA 1KXLA 2HIVA 2KENA 2VZAA 1P8LA 2QEXA 3EN2A 1BBWA 2LXJA 3EBEA 2CQOA 3KF8B 2F52A 4JI3Q 1PYSB 4OX9Q 3GTOH 1V1QA 5IP9H 5IYBH 1MJCA 3RN5A 1CUKA 2UU9Q 4JI2L 1XPRA 3KDFB 1ASZA 1L1OA 4JI4Q 3GTKH 3G71A 2UUCL 4UPAA 1Y1VG 1GKHA 3M4PA 3S24A 1IBKL 1QVCA 4LF8Q 4JBKA 2LXKA 4A3FG 4POGA 2YU9H 2K5NA 1XNRL 1QUQB 3CCUA 1KRSA 2RHSB 2VS1A 4LUOA 4X65L 2K14A 2A8VA 3U4VA 3L7ZC 1MIUA 4A3KG 4LF6L 2VW9A 2PI2E 2R93H 3GO5A 3HOYH 2AHOB 1N36Q 3STBD 1YHAA 4UP9A 3UDFA 3CAMA 5LMUQ 1PH1A 4KI0A 1V43A 1WJJA 1K3RA 2KCTA 4BY1G 1X54A 2NVTH 3PSIA 2E2IH 3S17H 1QVGA 4DPGA 1WYDA 1S40A 1PH7A 3L2PA 2MQHA 1TXYA 2GN5A 1I94Q 2A19A 4C3IH 1FL0A 5C44H 1XJVA 2HIXA 2PQAA 1RIPA 4QY7A 3STBC 4DV7Q 4L5RC 4JI8Q 2LSSA 4BA1I 1PV4A 3PUWA 3RLNA 5GAEC 1VQCA 4DR1Q 1VQ9A 3PF5A 3PIPA 4BBSG 4JI4L 1CSQA 1Y1VH 1YEZA 2R7DA 5E7NA 5M5XH 1GO3E 1P16A 4JV5Q 4HJ5A 3S1QH 3J81j 1NMFA 3HOWH 3HKZG 2KCMA 2PMZE 3WWVA 2F4VL 2QA4A 4R4OA 1IXRA 2JEBI 2ASBA 1VQ7A 3JAMc 2WB1G 1EIYB 1TWFH 4A3MG 2IX1A 2CFMA 1PH8A 4YHHL 1JT8A 3CCQA 5EAYA 1YNXA 1I50H 1HJPA 4DR5L 4IOAA
chains in the Genus database with same CATH superfamily
5C3EG 4J9LA 2ZXOA 1EZ1A 1O75A 2I0QA 1N56A 2DIKA 5GADC 1XMQL 2R7ZB 1TWCA 3BVGA 4QIWA 3T5LA 1N36H 2B29A 5KFJA 1RTNA 4DGZA 4LWCA 5J1ZA 5KFAA 5J2UF 1LUZA 5KT7A 3S15H 1SEIA 1K8AC 3MTSA 1YJWA 1VQFA 1QB5D 4MTDA 4MV9A 2YV5A 2RDGA 3H4BA 2E2HA 3KAJA 1X32A 3BS1A 1FGBD 3I55A 2B2YA 3H0GG 4JI8L 3J7A5 1NTGA 4YCUA 4KTAA 4A93B 2FB9A 2ALYB 1YBYA 2IT1A 4DR6Q 4EQPA 1W6JA 1CFMA 2FMAA 1S72A 2EYFA 2EYLA 2LY7A 4DV5L 4BBRB 3W1BA 2IP4A 5J2TF 3I4MH 4F4WA 2DNEA 2BA1A 2DZDA 2F0JA 2PN1A 2Q2HA 3GV3A 5C5LA 5BN4A 1VQ8A 4C2MB 4BA2I 1MKHA 4L6TB 3NE5B 2WKCA 1VQBA 3OOCA 4BS9A 4APVA 2DJFC 3Q8RB 1TWHA 1KDCA 3HOVG 5F9LA 1JB3A 2PYKA 1XNRQ 1GUOA 1KJ8A 2W6NA 4RHSA 3T16A 1XNQL 2Q2TA 4O1NA 5DM63 1D2BA 3R93A 1EIFA 2FMMA 1LABA 2EXZA 4LSXA 4RFBA 1AN8A 4IWYA 4DV7H 3EQLC 2O4XA 1B44D 3BZDB 2JK8A 4KLKA 3LMLA 2VQEL 3HZXA 4DV4L 2F4VQ 4ZQIA 1LM0A 4BY7H 1STEA 2N78A 5LHY1 3PUVA 1K8GA 1K9MC 3GTLB 3A7LA 4RZRA 5C0XJ 3S1RH 1N32H 4OXPA 1VQ6A 1HTPA 1DOKA 4QUCA 3OHAA 1F2YA 1E4GT 5KFDA 3TRZA 3NK9A 2PNHA 4BXXH 1Q86C 2W6MA 1BGWA 1L1OB 1HNXQ 1TKWB 4ID6A 3RLOA 2AKWB 3KLRA 3DUZA 3J81i 4BBSB 4GKKH 2F0IA 2ICIA 4LH6A 4DV0Q 4ECSA 3I4NG 1U4MA 1BO0A 4JV0A 3I12A 4RNMA 4S3SA 4J9PA 4IAJA 2P5ZX 3PF4A 4ME6A 4U7CA 4IFDI 5BR8L 4DR7H 1A3VA 2UXCH 2QW7A 3LX0A 1G8ZD 2R92G 3N8DA 2AU0A 4A3EG 5M5YH 1EQQA 1B04A 2IJ0A 4DR4Q 4K0KL 4DR5H 3EYYA 2GVAA 4Y7NH 5KG3A 1OTCA 3ERSX 5J39A 5KEEA 3H40A 3H6MA 3TP8A 4XTCS 2BE5D 4A2AA 3BAAA 5GQOA 1T9HA 3WDNA 5AJ3Q 2CH4A 4YCVA 4ECVA 2FHTA 4YB8B 1ZXTA 3SGIA 4A4IA 1CQIB 2N55A 4DAPA 3R5HA 2TSSA 3CCSA 4ZOLF 3HOXH 5H80A 1QVFA 2QCPX 1HNWL 2VUMA 3RZDB 5IP7G 3HRZC 3E5SA 1L1OC 2EY6A 2FP4B 4RB2C 2WTFA 3F2DA 4GN5A 4IUUA 1U4RA 1LTTD 2W57A 2EOTA 2A6HC 3GTJB 3HGBA 5KKNB 3FPPA 3TS2A 2OTJA 4JI6L 4A3LG 2X0SA 4LF4Q 4A3BH 4K0KH 4EVOA 1CKOA 4IPHA 1KABA 4MV4A 1PH6A 4MTEA 4I7HA 5KFMA 5F2DA 5KT4A 4QWCA 4AQYH 2V1CC 3A0JA 3RB4A 2JN4A 2NVYA 2IW3A 2EY1A 2RQXA 5IT9L 4K2LA 1TS4A 1CHPD 1XMQQ 1N32Q 1PH4A 2UUCH 5JJKA 4GOPC 4GKKL 3OHXC 1KTKA 3OTOL 2EVBA 1BUVT 4TQUS 2JP1A 2M05A 1PYWD 2VPQA 3E6ZX 4DL6A 4JI5Q 3TS0A 4O2AF 3GILA 4RGNA 1ET9A 2QDLA 3H3VC 4HR7B 4Q43A 5LL6b 2BQ3A 2NTSA 1Y1WB 1O7IA 4DAMA 3LWBA 2R61A 2RKSA 1VQKA 4UP8A 1PH2A 1ICWA 1YHBA 5E3FA 1RYSA 1LT6D 3BYYB 1ET6A 4DV7L 4X6AH 3KF6B 3RGZA 2K7VA 5KNBA 4ULLA 4ZRZA 3I90A 1HFGA 3BZKA 1LT4D 1W3SA 4C3IB 2HHHQ 1RK6A 1S0OA 2KBNA 3V6JA 3KLWA 4QCLA 2W8LA 1A6XA 2JA6G 3S1NH 1SRUA 2N3SA 1XNQH 4RH6A 3M9NB 4FXGC 3HKZE 4NW2A 3JC66 2HVQA 3K8AA 4XT3B 4ECRA 1SYBA 4U68A 4A3MH 3MWEA 3PUXA 4A3LH 5KYLA 2XCAA 2NU8B 1PTOF 5LA6F 4R1JA 3T1HL 4OEMB 5LYJF 4J8QA 5AJ3L 4X62Q 1PXUA 3HEJA 2B63B 1ENAA 4OO1G 2FK2A 2YCHA 5EOYA 2M00A 1SJED 3DWQA 4FVMA 4RWSC 2J9GA 4ZCKA 5FD5A 4B9WA 2JA6H 3R3OA 1D1KA 4QB4A 2Z9HA 3D8GA 2EY5A 2F0SA 3OIQA 5C4JB 4FXKC 5BR8H 2XWJB 3AFQA 4UP7A 1IZ6A 4MV6A 2DUDA 4NXNL 2VPSA 1DIKA 3PR5B 4A3EH 4BWSC 2W6QA 2UVWA 4IALA 2RGVA 1UEBA 4JI8H 4G3IA 4N9TA 4EQ5A 1HRJA 3PO3G 4A3BB 3DM1A 3WO0A 4Y52H 4ECYA 3KHGA 3J7YW 3VA5A 4A76A 4JBMA 5FOBB 2F03A 1YZ6A 4OX9H 1I6VC 4HTHA 1JDEA 4FO2A 3D0FA 3MEFA 4IOCA 4B3RL 2PMZA 1EY6A 1LT5D 2W6OA 4QIWB 4Y8VB 4KY7A 3S2HH 1XMQH 1XPUA 3J80i 4HR7A 3P1HA 1EYGA 4JYAH 1X3FA 4ED8A 5COYA 5J22A 1HNZQ 2V58A 2OCEA 3A8JE 4WFN3 4MNOA 3H3VI 4J15A 3CQZA 1AN7A 1EZ6A 3PV0A 3HOZG 2VUGA 4GN3B 3PW5A 1K8MA 4CJ2C 3ITPA 2C35B 3HOYG 4LMQD 2YYAA 4DUZH 2HQEA 2JA5B 2Q2IA 4MV7A 1B9NA 3GTKA 2PW5A 2WV6D 4GS3A 1KJJA 3CMEA 2R7NA 4KN4C 2KECA 4QIWE 3I73A 1R9TA 1RD9D 3NENA 4IUNA 4CJ1B 4A3BG 3PO3B 1NR4A 3N41B 3BZCA 5CA0F 5C4XH 1PTOH 5JEAH 3HOWB 2CW0C 2JEAI 1E2WA 5KT5A 2RCNA 4C3HB 2KJXA 3PO2H 3KYHC 4DUYH 1BVSA 4UCUA 4JBWA 3RBDA 2IHFA 4Q0YA 4BY7G 3SI8A 3HOVH 4J9RA 4LAAA 5IGCA 1EFWA 2HVSA 3D4WA 2NWGA 3S1NB 2FK3A 1ICFB 4OGQC 4CKEA 5C3XA 2EYPA 4TV9F 3QZ7A 4QMGA 1GYFA 1TS5A 3GTJH 4I55F 3OSNA 2W70A 1UNSA 1SFOB 1GUGA 5CV4A 1DCZA 5LMNW 3GV8B 1VQJA 1K1QA 1EQTA 3NP8A 2W9BB 1SMYC 4XT1B 4B08A 2ZM6L 2VOBA 2LFNA 2JA8B 3I4NH 1J9OA 3HP3A 4OWWB 1IBKQ 3BU2A 3DWPA 3LGJA 4HNUA 5BMVF 1K8OA 2WE6A 5ELNA 1PDQA 1Z7TA 2WINB 2K5VA 2JA7A 3MWYW 3F8NA 3CW2C 4JV2A 1S5DD 4BY1B 4DA2A 3KF8A 3HXLA 4DK6C 3T4AC 1CTMA 4FU0A 3S14H 5IYZF 1G2SA 2EQSA 5HGQA 2JA6A 3GDEA 2J6TA 3W1GA 2GPSA 1I4PA 3GTMB 1SE2A 3K7AH 1HR0L 1VQMA 1LTRD 1KL9A 5E1FA 1KIXA 1C30A 3G6XA 1GSOA 1HXYD 5KFQA 4NXMH 4HCEA 4G57A 5I6YA 3U4ZA 1K83H 1WTXA 4XXEA 1KAAA 2NN6G 3J81c 2WB1B 4JV5L 4JI5H 1HZ9A 1STHA 2Z1CA 5DQGA 4CDEC 1PH5A 2YS6A 3H4DA 4V0BA 3N43B 2PCFB 2YZMA 3RAXA 1Z9FA 4HNVA 1TWCB 2PQAB 3KFUA 5FPRA 2R7ZA 1EY4A 3FDSA 4FDBA 2YRXA 2QGQA 1ENFA 4CKBA 4IZOA 2ASLA 3RGXA 1S10A 4C5AA 2F0EA 1CM9A 1CQFA 4HEDA 5IGBA 1A9XA 4AYBG 2HIVA 1HQMC 3QG1A 1XMOH 1P8LA 3QWNA 1S03G 4FF3A 4HQ6A 5CV7A 1BNCA 3RB0A 3EBEA 3KF8B 2F52A 1IKLA 3BQ0A 5IP9H 1G91A 2PQEA 4EBDA 1E4EA 1GHJA 4K2KA 2UUAH 1JR0D 1NR2A 2NZ1D 1ASZA 4JI4Q 3RV3A 3RUZA 4UPAA 4UCSA 2ASJA 1BBXC 1EUDB 1EWCA 2UUBH 5E4WC 1PZKD 2YU9H 4POGA 4I7AA 1KRSA 2VS1A 4LUOA 4X65L 3GIMA 2W71A 4JUZA 3U4VA 4R7RA 1MIUA 3BDOA 2R93H 3GO5A 1N36Q 1YHAA 4UP9A 2B2WA 3D4RA 3KALA 3MWDA 3RZOB 2NVYB 4EGVA 1K3RA 3K5OA 3MC0B 3EROA 1QVGA 1S40A 1PH7A 3L2PA 3R23A 2GN5A 3OPOA 3G6VA 1ML0D 2A19A 1FL0A 5DEHA 5C44H 3OMGA 3SDZA 1XJVA 3STBC 5JQWA 5KFZA 1PV4A 4IN3A 4DR1Q 4BBSG 2CHBD 3PIPA 3OTOH 1CSQA 1Y1VH 2WB1A 5E7NA 1GO3E 4JV5Q 2Z4HA 5KFCA 3HOWH 4NXNH 1D5XC 4DL3A 2A73B 2F4VL 1IXRA 4DXGA 4JI2H 2PO4A 2KHSA 2WB1G 1EIYB 1TWFH 5JVH3 1HNXH 2BOSA 1EY9A 1HQRD 4L8JA 3CCQA 3A56A 1I50H 4KK7A 2E2HB 2FLPA 4TKOB 1E22A 1HR0Q 3OW7A 4UCTA 3M9BA 4I7ZC 4R8UA 1SE8A 1VQHA 3WOFA 3U58A 4A3JG 3MHBA 2F0LA 2KSWA 1RJTA 4LJZC 4R4TA 2RF4A 2ALZA 1KJQA 1T94A 1SFOH 3GP7A 2L1BA 4X62L 3HOXG 2PZTA 5KNCA 3J81W 2RSOA 1SNOA 1RCVD 4NMZA 4FYDA 4J6HA 2DPJA 1XDNA 2FJZA 1M6VA 1EUJA 4F88A 3PMFA 4R8UB 1PLFA 2E74C 5LL6S 2EDGA 5M5WB 1KLGD 2BCOA 3QFFA 3KJPA 1L0XB 4KN7C 4DK3C 2WKDA 3A55A 4X66H 1EEFD 3GTGA 2L15A 1CHQD 4BWGB 1HTLD 3EA6A 1IBMH 1GUWA 4DR6L 4DV3H 4DR3L 2XRSD 2MHVA 3URYA 1QZHA 3I7FA 1CZGA 2F3VA 3BVZA 3L4KA 5DGAA 1VQEA 4MTKA 5IWAL 1SYDA 4JI2Q 4ED0A 2XNAC 5JPNC 2FPIB 2PBZA 3H0GH 5K36G 3PN1A 4YY3H 1VQOA 5KG7A 4DR2H 5ISRA 4ED3A 4POFA 3JAMW 3RZDH 2G9DA 5FLXc 1IHZA 3S1MH 3IG0A 4O3PA 4BY7B 4C56C 3E0EA 2M9VA 3U9OA 1NUCA 4C3HG 3ORQA 4F4ZA 2C2EA 2A68C 2R7ZG 3H0GA 3FMCA 3CPWA 3LWEA 4HYKA 5C0XG 2EE1A 1T3NA 5T1IA 2HT1A 1M0TA 1TT2A 2F0UA 5KG4A 1WCMH 1GXDC 2A1AA 2AWOA 3HOYB 5DGBA 4C1NI 3GD7A 4DR6H 3HOZB 3FHWA 5C44G 4LMYA 1S5BD 4DR1L 5JVLA 3P20A 3T5JA 3KTMA 1STYA 3KLSA 3F2BA 2E2HH 2NUAB 1QG7A 2J4XA 1DOMA 3IRBA 3LP8A 5EBCA 3Q8SB 1XNRH 5K36H 3M4OB 5FO7B 1VKZA 4HAEA 2FPPB 1PTOC 5EDWA 1DJRD 5EKKA 3PW4A 2E2DC 1N34Q 1Y8OB 3UE1A 4JOIC 5EKIA 4V190 2V4QA 1H9SB 1DM0B 3OHBA 4N8FA 1SE4A 1XNQQ 1M7JA 1JJGA 3H91A 4ZAIA 2DY8A 3RZOH 4A3DG 3PGZA 1TWFA 4X3SA 5KG0A 2G9HD 4B3ML 3UDIA 2PW7A 3K5HA 2YRWA 4J9QA 5JOBA 2VUMG 3BA9A 4DLKA 2I46A 2N88A 1IOWA 2NBFA 4GNXA 3K3PA 4PZ7A 3TBIB 1S5FD 4A3MB 4EQOA 2VB3X 3VR5A 3EJIA 1G2TA 3MXNA 5KFFA 3PCOB 3M9MB 3KHRA 4B3TH 1YNNC 4X64Q 2QK4A 1ASYA 4ZUIA 1VQNA 3HG9A 3FEWX 3KF6A 3TINA 3JAME 5D3DA 2B63H 1JWMD 2W9AA 1GVPA 2NU6B 1OXVA 4IQZA 2JA6B 4LFAH 1VBHA 1EY8A 2ZDQA 3CCJA 1NCVA 3NUCA 4KKUA 5C3EH 5KIXA 1BJTA 3C0FB 4DL2A 2B2TC 1VMPA 1X55A 2AMCB 2Q8TA 1HCZA 3CC7A 3GTLA 1EY7A 3CCVA 3M9OB 4YQWA 1UUPA 4PG3A 2JA5H 2VQFQ 2HVRA 1KNAA 2E8GA 2B39A 5KFWA 4KHVA 1I4QA 1LTGD 5M3MH 4C3JH 4WORA 5E4XA 5KRUA 2L5TA 3K58A 4TVAB 2VB2X 4DUYQ 4DV6L 2UUBL 3C2PA 2JA8G 4A3CH 4MV8A 1JX4A 4C3HH 3CCRA 2JA9A 4MTNA 1I6HB 4TUYF 3TREA 1HFNA 1O7ZA 2NZOA 5T1GA 3S2HB 4QW8A 5CBEE 4L5QA 2AQ3B 4RGTA 1I94L 2AGQA 5L37A 1FJGL 2QKIC 1QUQA 2UXBQ 3VPBA 5DG7A 1JLLB 2Y0SG 4U6PA 2R93G 4A3DB 4ZI7F 4DV5H 4IR1A 4RCOA 3Q22A 4M9UA 4JOIA 4JI0Q 3L9AX 1X9NA 3PO3H 1E4EB 1IOVA 1KBLA 1RJPA 3MAQA 1SROA 4K5VA 2GLTA 4YP3A 4KJOA 4MHEA 2ZTDA 4XQNA 2V4RA 1EU3A 5FLMH 3G48A 3BDLA 3N44B 3GLKA 1B6SA 2FKLA 3K3VA 3SHLA 1KC7A 4UY8C 4A3CG 3Q8PB 1W2BA 2K01A 4I4TF 2RGRA 3C1EA 2YTXA 3GIKA 4K5XA 1UE1A 2SNMA 3UDXA 3VR6A 3FKIA 4XYOA 4IJLA 4R4CA 5KG5A 2PVPA 2B2VC 1LTID 5JEAG 2WYOA 3SR1A 3TP7A 5I2XA 1MD2D 2AQ4A 3TZDA 5C6AA 3K7AB 4C2MA 3TMEA 3BA8A 1B8AA 3L4JA 1XTCD 4YWKA 1AE3A 1BOSA 1VQDA 1H9JA 2LKVA 3A8IE 2GPWA 1VQLA 3CCLA 1Y1VA 4LFBL 3NQIA 4KHPL 1VQIA 4CDDC 3S9WA 3GTLH 1FR3A 2O5IC 3QJYA 3RFCA 4TQRA 1O7YA 4BXXG 3KBGA 4XIGS 4JI0L 3KBXA 1SXTA 3CCMA 3NHHA 4EYHB 1M8AA 3BYTB 4EEQA 4A3FH 4C5BA 1TR5A 5EWEA 1LYLA 3ERQA 5FLXE 3KK7A 3HOUG 2F3IA 2E5LQ 2ZM6H 4WJ4A 2VUMH 4A3IB 3IFDA 3E9HA 3I8ZA 4XDXA 1NBWA 3PUYA 2FE3A 1ONLA 4YBZB 2FLNA 3NQTA 1CI3M 2DY7A 1D7QA 2I8CA 1XMOQ 3C3LA 3RNUA 3GTJA 1CQJB 4WBNF 5AFWA 3TQYA 1PVOA 1CKNB 4QUFA 3S17B 1N48A 2EYMA 4KHZA 2QILA 1MBYA 3NBHB 3J80L 1WI5A 1NE3A 4ED6A 1F9QA 3B6YA 3TP5A 1EZ8A 3X3MA 4LF7H 3ND8A 2G5DA 2FPGB 1ZEQX 4F8MA 5L1IA 1AH9A 3QO2A 4KHPQ 1MI2A 4HJAA 4KD4A 4DAVA 1X56A 1H9MA 5ELBA 1PH3A 5DLQE 4P71A 4O42A 1N34H 4IO9A 4QW9A 1WTQA 3S2DB 1JOQA 2F0DA 4HCSA 5KG1A 1TWAH 2FLLA 1GD7A 3NSWA 1V9PA 4RA8A 3FP9A 4IPDA 4CC6A 3HOXB 4O2DA 2JA8H 2I5MX 1Y1WG 4DAYB 1PFMA 3SE7A 5KFGA 1N33H 3TP6A 4TQSA 1Y14B 2HD3A 5K5PA 4A3JB 2MJ8A 4JYAL 3KAKA 4EX5A 4RB0A 3CXCA 1JJ2A 1D1IA 3HKSA 4A75A 1K3BC 2ES2A 2A74C 2XRQD 1WTPA 2JEJA 3MWMA 4BY1H 2WDTA 1BKBA 1B6RA 3T53B 3U50C 3WNZA 3QB3A 4DAYA 2UUCQ 2BE5C 3P7JA 2A68D 1MGSA 3MXPA 1JOKA 1PK8A 1BCPC 5LMUH 4TRDA 4LSAA 2R92A 3NGDA 5KX5F 1HA5A 4FF1A 3DF7A 3ULPA 5FD6A 1B33N 1HUNA 4DV6H 4A3GH 2NVYH 1RKNA 2A5HA 2VA2A 2RHQB 4J9KA 3T51B 4ILWA 4DNRB 4EBCA 2UXDL 4LF4H 2A69C 1M90C 4Z9CB 1DD2A 1EIHA 4LFCL 1KAWA 4CKCA 4DF7A 1QZGA 1Y1WH 4P75A 1KLUD 4DR4L 4K0KQ 4RKBA 2PZUA 3CQZB 3MZ5A 2HHHL 1IBLH 3VMMA 4LF9L 2WACA 4GNXB 2XN9C 4GKJL 3JSLA 2ZJQA 4X3KA 4P74A 3GTQA 4OIJA 1J8IA 4HSPA 1SE3A 3I4OA 5EJWA 5CA1F 2AWNA 3GTGH 3K5IA 3VA7A 3DWAA 4M1UB 3K0XA 3SK4A 4GOPA 4B3TL 1W6KA 1T5XD 2YL2A 5C1OA 1UNNC 3KXYT 1L0YB 1YJ9A 4JI6Q 2FXQA 2CW8A 1PRTB 3AFPA 2ZXRA 4O2BF 2K04A 3J80W 1DZ1A 2O5JC 1JICA 1WD0A 4ZHQF 4B3RQ 3TIIA 2B2TA 2J6SA 3S2DH 1NAPA 1YITA 2OWOA 2VNUD 2DLNA 1S9FA 3AEVA 4PDBA 5HURA 2VQFH 1N9WA 4H44C 2KENA 2IA6A 3TSSA 5M3FB 2CZGA 1PZID 2XIWA 2KCCA 1V1QA 5IYBH 3JSNA 1CUKA 2R93B 3LNNA 3GTKH 1I50A 1TU2B 2UU9H 2UUCL 2F0WA 1Y1VG 4DU9A 5FLXW 3M4PA 3S24A 5C0XH 4LF8Q 3IKJA 2R7MA 2AGOA 1U4PA 4LH7A 2W6PA 1XNRL 4O3QA 4FNFA 4APMA 4FF4A 3FKIB 1QUQB 5IODA 2RHSB 1KJIA 2K14A 4LF5H 1DXMA 3RF2A 1B4OA 3BG5A 1I3QA 2VW9A 2PI2E 3W3AA 4Q5VA 1MHWC 3HOYH 2AHOB 4O4IF 5KFPA 2TMPA 4KD3A 3UDFA 3RIZA 3MFIA 2K32A 1JXLA 1IW7C 2F0QA 1H9RA 4PNYA 1WJJA 3SE0A 5CV8A 4BY1G 1R4PB 3SVMA 2NVTH 3VYTA 5KFUA 2A69D 3S17H 1WYDA 4MIUA 5HV6A 1TXYA 1C4QA 1WVLA 2H1EA 5IOCA 1I94Q 4C3IH 5CBAE 3I4LA 5KFBA 1ZQ7A 1RIPA 3BG3A 4DV7Q 2DN8A 2M2LA 2LSSA 4JI8Q 3RB6A 3RLNA 4JI1H 4KKSA 1RTOA 2F0HA 2X6LA 1Y8PB 1M0WA 2KCMA 2PMZE 3R8BA 1TA8A 2Y0SA 2WIIB 4R4OA 2I07B 2ASBA 3JAMc 4A3MG 3FDTA 2IX1A 1PH8A 1JT8A 5IWAH 5EAYA 5BN3A 4N8X1 1HJPA 1FD7D 1LV9A 4DR5L 2JEIA 1CKNA 3L0OA 1I7NA 4A3IG 1L0WA 5D1OA 4XQQA 5EGTA 2ATWA 1L2FA 2ZJRA 1IBML 5JVDF 2D0OA 3M4OH 1LTAD 4RU9A 2IHEA 3AU7A 3MA2B 2J6UA 2F0TA 2L0CA 1E4FT 3Q8DA 2VR1A 2NZHA 3RLFA 1H9SA 4X64L 1VQ5A 4PZ8A 3D31A 3CHBD 5M3FH 1ILPA 2DGYA 3HOWG 2K1BA 5D1OB 4ECZA 2ZM6Q 2OQ0A 2D62A 1U9RA 3RUPA 5C3EB 1BBUA 2IL8A 5D3IB 2JA5G 1LACA 1RDPD 2KHJA 5KFXA 3Q23A 3NTHA 3H09A 4IPCA 4YCWA 4R8IA 1HNWQ 1E7ZA 3M4IA 3S1MB 5JAVA 1QE6A 2NU7B 3TIGA 3NELA 4M7EA 1HPCA 3S14B 2RCFA 4HMJA 4YAJB 4DV2Q 2KA7A 2K5DA 4ECUA 2UXDH 1XYIA 4LF5L 5C5JA 4OWTB 1EFID 2EJMA 2CCZA 1Y1WA 1VCIA 3AB9A 2D0PA 5IWAQ 1KD1C 4AH6A 3CC4A 2YS7A 1Q8KA 1WTHA 1HA6A 4RNNA 2XSCA 5JEAJ 1WSCA 1SMXA 1K73C 2V59A 5IGEA 4DR3Q 4JC0A 3RD4A 4AQYQ 1FGUA 5L1LA 5KFVA 2YW2A 4XX0B 4HNTA 2UVUA 3OYYA 1J5EL 1UE5A 1HHVA 2Q2UA 2MGSA 3NBHA 1UC9A 3BQ2A 1H9KA 1PYBA 3ER0A 4P73A 3RR5A 4DR7Q 3V4ZA 2Y0SB 2NVQH 1A2UA 2EIFA 3HS0C 3OUZA 1TIID 1FYCA 2GVBA 2VXWA 4R9WA 2B63G 1GM5A 2OQKA 2YTYA 4X66Q 1VQGA 1A2TA 4NXMQ 2PMZB 5KFSA 1S68A 1IBMQ 2O03A 3ZJYC 3MJFA 2YZGA 4NLGA 2HCCA 4FP5D 5LMNH 2F0FA 3QOJA 4RUAA 1EEID 2YTVA 3TQTA 1Q3LA 2R7FA 5KFTA 5IP7H 4R4QA 5C0XI 4YAKB 3A8KE 2UXBH 3J7ZC 1UC8A 5CB4F 3BVMA 3AYHB 3NWTA 4ZKBB 4GZYC 3K80C 3KHLA 5FJ8H 4G7OC 4JI1Q 3NPPA 5GROA 1N36L 5DG9A 2I5LX 3VR4A 4RZQA 1LLRD 2B2UA 1DONA 5DM73 3S1QB 4UCVA 1G51A 2ID0A 4DR4H 1UE7A 3JAML 2W6ZA 2RDJA 3Q1KA 2L9HA 1R9TH 1Q8IA 3DXJC 2UXCQ 1CKMA 4RGOS 1XMOL 4EGQA 4Q8FA 1WOCA 4MV1A 2ZTCA 5EWGA 3KJOA 2K5QA 2R3ZA 3NTIA 5C1PA 4J9MA 3CF5A 2PI2A 5KFHA 2R87A 4HJ8A 1JOOA 3LWUA 2Z8LA 2R8GA 3TEHB 3H20A 4JYAQ 2IY5B 3GTPA 2CWAA 4A3FB 4O3RA 3PUZA 1SR3A 4IR9A 5DLGA 2XGTA 2DWCA 1VS0A 1WTVA 3GV6A 5EPKA 5KT3A 1RF2D 5C3WA 2JA7G 3FKIG 4DV2H 1TS3A 2XWBB 4ZLTF 1Y69U 2VUMB 4CDCC 5FJ8G 4HIOA 4DV5Q 1Q12A 4DV0L 1SSOA 2R7KA 1Y1VB 4CGYB 2B8FA 1SEBD 3V96A 1FNUA 1X3EA 2H5XA 2Z0SA 1QJOA 3H94A 5M3MB 1O7LA 1HZCA 3CC2A 1DV2A 4UFZA 2C00A 4KHPH 3KLSX 4Q8EA 1JJCB 1HR0H 4IHJF 1SNMA 1NSNS 5M3FG 5BN5A 1A15A 2VQDA 5FO8B 1N33L 4K8JA 2K5HA 4UDUC 4B3SL 1S97A 4JI7Q 2R93A 3U9SA 3CPFA 5A35A 5TSSA 1XXGA 4PMWA 3E5NA 1MSGA 4RGMA 1E1TA 1B70B 1BCPB 5IP9G 1SNCA 4P72A 1ZHQA 4MA0A 5KFNA 5M9OA 1JORA 4GC7A 3M3YH 2VY3A 4GLVB 1QNUA 5I9PA 1KDBA 3ETHA 3W2DA 2R6GA 3IFTA 3T1YL 3Q6SA 5I6WA 2HCIA 3VYRA 1EYDA 3Q8QB 1B9MA 1S3OA 4LUZA 2RVLA 3GQBA 1WH2A 4LF7Q 4FF2A 2R8JA 1GOZA 2N49A 3D3RA 2R82A 4RKLA 2ENBA 4A3EB 1B7YB 4E4TA 5C4HA 2WAQG 2R92B 4PZ6A 3J80E 3SK6A 1LTBD 3PQIA 5K2MA 3I72A 3RJ0A 4AIMA 3D6CA 3PR4A 4XQJA 4JK1C 3G6EA 1I94H 3QIAA 4DXFA 1SFOA 1DYQA 4DV6Q 2MO0A 3CMAA 2I87A 4AYBE 1LT3D 3OMCA 2BA0A 1T36A 2Z6KA 1JQYD 4FS1A 3R2IA 2C28A 2HUGA 4DL5A 1GUTA 4QWEA 3F1ZA 2R6FA 3RBEA 5FKAC 1JMCA 1YNND 3GIJA 1HZAA 2K05A 1A3UA 3I70A 2OTLA 1VMCA 1D8LA 1SN8A 1E3PA 2EYJA 1AFPA 3EVQA 4IFDJ 4G7HC 3UI2A 2CWPA 3GTQB 4YY3Q 1PFSA 4ECQA 2XVSA 1JKJB 3DEOA 1JE5A 4DK0A 4J9OA 1JCKB 1V4YA 4IFDG 1B1ZA 5G3LF 2PPBC 5C4XB 5ELEA 4LUVA 2BQRA 5IY0A 4LFAL 3OUUA 5I4DA 4DR2Q 2JA7H 3PO2B 4O4HF 3GTGB 5KG2A 3RV4A 1STNA 2K5WA 2EZVA 1A8VA 1PA6A 2UXBL 1CT1D 4OX9L 4JI4H 1FNVA 4XYQA 4UHVA 2V5AA 1EYCA 1OWTA 1ILQA 4AYBA 1Z2PX 4ETSA 5M5WH 1DOLA 3A5UA 1JWUD 1E24A 4A3KH 4UAIA 3GV7B 1Z6HA 5IYBG 5H1SE 3F8TA 3UE0A 4EFEA 4IRKA 1Q1BA 4EEYA 1BCPF 4BBRG 2I5HA 4HIKA 4F4YA 1ZETA 2XC9A 5JH7F 4M8AA 4C1NK 4U673 2KCNA 2RDIA 1C48A 1TWAB 3HKZA 4LF8H 2MP1A 2F3WA 3E0JA 1FJGH 1K0SA 3G8CA 5IIFA 2QF7A 2BDNA 3T1HH 2AUKA 4ED2A 4DKAC 3T1YQ 4A93G 4LFAQ 2MNAA 2R85A 1IBKH 5F9NA 1Y8NB 3DHQA 2JYOA 4L1KA 1HH2P 4ABNA 1B2TA 2Z6BA 1PRTC 2FMCA 3OWFA 4PWQA 1SNPA 3KUPA 1EQRA 3KOJA 1YNJD 4F50A 2H4OA 4JI7L 2VA3A 4DR1H 1A0IA 1OXXK 4LF5Q 2V9WA 3RMHA 2SNSA 3F2CA 2R8HA 3DM3A 1I7LA 4K6DA 1FNWA 1CQVA 4EFBA 1NJIC 3N6XA 2NYZD 2JE6I 3S1RB 1XPOA 2R86A 1C7YA 1NY4A 3MXNB 1XTDA 5EWFA 3CVZA 1F2ZA 1K83A 3TDQA 2IX3A 1II3A 2XCLA 3GTQH 5BPFA 5DAUA 4JG2A 3K7UC 1SYCA 1B3QA 2DJGC 3S16H 3R5FA 1EOTA 2MCTA 4X64H 3PW0A 4LK1C 5L9XA 4DL4A 2ZT9C 5D1PA 1F9SA 2SEBD 1SNQA 4QGUA 2ZXPA 3J80c 3T1HQ 1MJEA 2UU9L 1AP0A 2SOBA 5FPOA 4JV1A 4HN7A 5DNFA 5KFRA 1V1OA 4I65A 4AYBB 1BXRA 4G4KA 4DV1L 1YI2A 3HB9A 3VPCA 4C5CA 3T5HA 2B3GA 5IYCG 2R8IA 2KEDA 4IPGA 4K8IA 4WRDA 5C5MA 5JJIA 3OTOQ 2B2WC 1HNZL 3VR3A 2WFWA 4C2MH 3J81L 4IUVA 3MXUA 1SBBB 1T5EA 4A3KB 3WO1A 2DNCA 4DV3L 1I4RA 5LP6F 4L5SA 5M5XB 4OO1H 1V51A 1SJHD 4X66L 1TWGA 2OH2A 4YWLA 2B8GA 2WAQA 3M7NA 4HJ7A 1HNWH 5KNDA 4QF4A 1GHKA 3G6YA 3J81E 4O3NA 5GAGC 4DNTB 1FJGQ 2JSOA 4PMCA 5IT9E 2K4KA 2NTTA 1J5EQ 2E2JH 2SCUB 4PMBA 4A2BA 2ZJPA 3RN2A 4TSSA 4X62H 4RG1A 4LNQA 4K5WA 1IL8A 4QWAA 3K81C 5T14A 4O4LF 1IBLL 1UAPA 1C0AA 2F0OA 4C3IG 5FO9B 3VYUA 1F9PA 4YWMA 1ZHSA 4IWXA 4IRDA 5LOVF 3GTMA 5I2YA 2HJWA 2A6HD 1KC8C 2IPKD 4JI7H 1KXLA 2VZAA 1I3QB 2QEXA 3DEPA 4MV3A 2O2LD 3EN2A 4LFCH 5FK9C 1QCBD 3ONAB 3Q2OA 4JI3Q 4OX9Q 3GTOH 3RN5A 2CVRA 4RAYA 2W7OA 4JI2L 1XPRA 3KDFB 2ICEC 5L1KA 1E2VA 3IAYA 3EFXD 4B9XA 5KFOA 3N52A 1IBKL 1QVCA 3N42B 3R5XA 4JBKA 4I50F 1S0NA 1L2ZA 2Z4IA 4A3FG 1Q90A 3QOLA 1ESFA 3ORRA 2K5NA 4DFAA 3JRXA 1TY2A 3K57A 1I50B 3CCUA 4J9SA 1K83B 2NVQB 3JRWA 5KT2A 1BCPD 3L7ZC 4KY5A 2KQ3A 2PZWA 3WOEA 3K5LA 3STBD 5EBDA 3X3NA 1HUMA 2QDBA 1SNDA 2IWHA 4KI0A 2R84A 3PSIA 4Q44A 3N6RA 4DPGA 2F4IA 2D2CC 5A2QE 2OEOA 4NKLA 2KUMA 4PQXA 2HIXA 1LO5D 3K0YA 4NP5A 1IKMA 3OIPA 2ZDGA 4L5RC 1C3OA 1VQ9A 4BA1I 3VYSA 1VQCA 1W93A 3PF5A 4JI4L 4EQNA 4KV6A 2D9UA 1YEZA 2A6ED 5M5XH 3FMAA 4H0LC 3S1QH 1V1PB 3HKZG 1SMYD 3WWVA 2QA4A 2YU9A 2JEBI 1R9TB 1VQ7A 3IL8A 2CQYA 1JIHA 2GA4B 5IT9W 2CFMA 4QWBA 4YHHL 1GUNA 3PUWA 3GIPA 2HDLA 1EWIA 2A6EC 4GLXA 3TN2A 3ETJA 3GTPB 5L1JA 1HNXL 1E2ZA 1WCMG 3A74A 1C8CA 1I4XA 2AUJD 4ZK9B 2VQEQ 2Y0SE 4DV4Q 1TQOA 1BF4A 1AEXA 5HY6A 1KEEA 4NB3A 1K0RA 5LMUL 3PW2A 2EYHA 4DV2L 1D5ZC 2RSNA 1PRTD 4H02A 1BNZA 2W7PA 5D14A 4NXNQ 5DQHA 2W9BA 1CS0A 4E6IA 3HOZH 2AGPA 3F2UA 1SYGA 4ODGA 4WJ3M 2NN6I 5CR3A 5LMNQ 2HDMA 5HGTA 2JJQA 1GGOA 1NNXA 2W8KA 1S0MA 2JXMB 2B2VA 3FRPB 4YR3A 1EYAA 4LW1A 5BR8Q 3M4YA 1QILA 4ZYSA 4QJFA 3UQ8A 4A93H 4X65H 3T1YH 2K33A 3CU7A 1OXSC 3GIIA 3BQ1A 3M7GA 1ZKOA 2E2IB 1U5KA 4L63B 5IYDG 2EPBA 5FLMG 3CCEA 5KFIA 2JEGA 4EBEA 3E9IA 4FS2A 4QL5A 1TWGB 2JA5A 1TWHH 2CH4W 4QQBX 4L5TA 2UUAL 1X3GA 1I5FA 4IZ8A 1OO9B 1EYZA 2E2JB 3TQ1A 3HOVB 4EYIB 5KG6A 2E2IA 4RAZA 2BH8A 4A3JH 3H15A 3D6WA 5C4ZA 1R4QB 2HGSA 3M85A 1BDOA 2K6AA 4ALPA 1A3TA 1EHIA 3GV5B 3MFGA 4KY6A 2BH2A 1IBLQ 4DNIA 4FM9A 1SLJA 4LF6H 4DL7A 1PZJD 2F0KA 5IYDH 4GKKQ 5ELFA 3U9TA 3L3OC 3GTPH 4DUYL 3SK5A 2UUBQ 1Z47A 1G6PA 1AUXA 1J5EH 1YJNA 2UXDQ 1F2LA 1Q46A 3PIP3 4C3JG 1RL2A 1TVXA 1SAPA 4ZKCB 3G6JB 4X3UA 2MPMA 3NWSA 3H0GB 5CORA 3GTKB 1N8RC 4UCOA 4NXML 4A3GB 5JJLA 4WD3A 4DN4M 1F77A 5IYCH 1KRTA 1WD1A 1EL0A 4LFBH 2F0MA 1XX8A 4YIJA 1M1KC 2F0VA 1ZYRD 2W9CB 1ESRA 4RMFA 1PFNA 2NUCA 5FLXL 4F87A 1Q81C 2UUAQ 4YJ2F 2MO1A 4IRCA 1WFQA 2L55A 4OONA 3Q24A 4K6LA 4YHHH 4GOPB 5EZYF 2L4NA 2UVRA 5NUCA 3EIVA 4LFCQ 3GTMH 3G4SA 3BJUA 3T13A 5GONF 3HOUH 3IN5A 3I4MB 1OXUA 5C8YF 1Z2NX 4J9NA 1AE2A 2NU9B 2R7ZH 4RNOA 4CC5A 1A62A 1VF5C 2PNRC 3HFZB 4LF6Q 4OWXB 1EQVA 2QEJC 1JDBB 3P75A 4F4XA 2LMCB 4B3MQ 2FK1A 4PV1C 3I2ZA 4X65Q 1RK5A 4A3DH 2Z6KC 1V8QA 5LMNL 4N9PA 1WCMA 1SCUB 3E3XA 1LTSD 5JJZA 2KVMA 1WTRA 1Q82C 1OXTA 1VQPA 2XIGA 2LS01 3MVVA 3NEMA 4GLAC 4J0MA 3CP0A 4YJ3F 1KQSA 1RODA 5HBRB 4BBRH 3MR2A 3FVQA 5KT6A 4KKTA 4MA5A 2WAQB 2XGPA 5DG8A 5EKLA 4CJ0B 2N8NA 5A2QW 2OT2A 2WB1E 4ECTA 3J7AV 3GIDA 1EOVA 1STBA 4IUTA 1CA6A 4K14A 1IL2A 5CAEB 2R92H 1J6QA 4MN3A 4DV3Q 3I4MG 2K52A 2CKZB 4JW0A 5A2QL 5D65A 3BABA 2X69A 4HIMA 4CBVA 2CQAA 5IGFA 1HR0W 1JWSD 1PMRA 4DUZL 1GLVA 1KJ9A 3RAQA 3ZYYX 1B3AA 2VL6A 2NVXA 1K1SA 5CV6A 1RHPA 5CYUA 2IMWP 2ZDHA 1VQAA 2SDFA 1WTOA 2IBKA 4HMIA 1F9RA 4DV1Q 2C2DA 1EY0A 1UWVA 2XCPA 4ED1A 5D8DA 3UFXB 2NVTB 4DUZQ 3VPDA 5M5YB 1IYVA 4B3RH 3CD6A 1VDZA 4A3GG 4OO1I 3CRKC 3A5ZB 1PX2A 1BR9A 2E76C 3RB3A 2FINB 3OWEB 2E5LL 3O13A 2F0GA 1TWCH 5M3MG 3SEBA 2KHIA 4BBSH 4C3JB 4ECWA 1TWGH 2RA4A 5CV5A 1CZWA 1RJRA 1MSHA 3EPIA 4ED7A 1CSPA 3CRLC 2OLSA 5KYIA 4B3MH 4DR2L 2JA7B 5LL6X 3OSPA 1I6HH 3K6OA 1SYXB 5DQIA 1W96A 3H3VH 1TWFB 2EY2A 4GNXC 1O80A 1AZQA 2AQ1B 2K75A 1U0LA 3BJYA 1STAA 3ICEA 1HNZH 1EUCB 4JI6H 4R8NA 1U4LA 4R4IA 4RCNA 2ASDA 3ULLA 5JPMC 4DR3H 1SYEA 1JB7A 3N40P 4JPBW 4Y7NB 4DV1H 2F0PA 3QR8A 3S16B 5I47A 3NBIA 4HJ9A 3BDCA 1LTLA 4YHHQ 3A7AB 2WP8J 3I3CA 3AMUA 2C22A 4JI3L 3HBLA 1EIGA 2YU9B 5J3BA 1I4GA 4MAMA 1SDFA 3OW2A 3PO2G 4IJHA 3PVXA 4JI1L 4KJNA 4CHTB 4H13C 1HZBA 2FFKB 5C4XG 1PH9A 2XTIA 3MFYA 1AUVA 3ULJA 2E75C 2K28A 4JI3H 1KNEA 1IYJB 1TY0A 1X6OA 3MXGA 4EG0A 4QWDA 2C9OA 1E1OA 1SYFA 1QNKA 5EPJA 2BDOA 1EWHA 1GSHA 1RYRA 1JE4A 1I3QH 4ZUJA 3K59A 2YYZA 2MUYA 4B3TQ 1IYUA 2V4DA 3J7AK 1Q1EA 2K50A 1D6EC 1WR2A 4Q0FA 4LF4L 2B2YC 4DR7L 1C9OA 2NB0A 4XYLB 4GC6A 1Q7YC 4O0AA 1RJQA 4XZ3B 3OSOA 3HOUB 5IE8A 5G3LD 4Q45A 1YNJC 3GTOA 5IT9c 4LFBQ 1G6ZA 1STGA 1BXTA 1QOHA 3V6HA 2E5LH 1M4VA 5CV9A 1QWYA 3M4QA 4YY3L 3K5MA 1I6UA 4AQYL 2K03A 3T5KA 4LF8L 2WAQE 2KOLA 3V6KA 1CE8A 3KDFA 3Q0AA 3CQZH 1PTOD 1YIJA 4RB1A 3G7LA 4JVZA 2R8KA 2F1MA 2VQFL 5CC4A 3KHHA 3GTOB 4NPSA 4OELB 1WCMB 4A3IH 2RDHA 1PTOB 1N33Q 1VBGA 1NMGA 2RDFA 2ZJTA 3UDGA 4O3SA 4JCVE 3I56A 3C46A 3HKZB 4YR2A 1XWEA 3V2TA 2NVXH 3RTXA 3S15B 2EJGC 4RB3C 1YVCA 5GAHC 4JBJA 5KFEA 3V05A 4EGJA 4HIDA 3D4DA 3JZIA 4KMUC 1PHJA 1S5CD 5ELDA 1Z2OX 5BPHA 2J7ZA 2KEEA 1N34L 1UE6A 1JC7A 1TAEA 2JQOA 2EXDA 3M3YB 4LF9H 1PFBA 4GKJH 2L12A 2IX0A 3K5NA 2HHHH 4IUPA 2NN6H 5CGKA 4LF7L 4GKJQ 3MEHA 2UVVA 2J0TD 2XD4A 4GN4B 3PIOA 1AZPA 3TZUA 1GSAA 4DR5Q 1KHIA 2UXCL 1CA5A 5EPLA 2CW0D 3VDYA 2HQLA 1AW7A 1V1PA 1DV1A 4NDXA 4RUCA 1G291 4WJWA 3NXWA 2F4VH 2C2RA 2Q8IB 1PRTF 4YR0A 5IGDA 2OXPA 5KFLA 3A54A 3MR5A 2QYZA 3FPUB 3AQQA 5C4JH 1VF7A 3FKIH 4DK1A 2B63A 1A63A 3W5OA 5JVG3 5ELOA 1X3PA 1YHQA 4F7XA 4B3SQ 4JI5L 4J1MA 4IFDH 4MZ9A 2ZTEA 1VQ4A 3GIQA 4ME5A 3VR2A 3JAMi 1FVIA 3R2TA 3DLLA 4JI0H 4ZQ3A 4ME3A 4RHRA 5CMDA 3GQCA 1CK1A 1H95A 1N32L 1O78A 2AQ2B 5JUMA 2CW7A 2YZNA 4TV8F 3V4SA 3PZPA 1DGSA 2MFIA 3NTKA 1ENCA 2DPIA 2RBMA 2VQEH 4DV4H 5KFKA 1X65A 1GUSA 1TWAA 4IURA 2EYOA 1UEAB 1X3QA 3CKIB 4FXDA 1BBWA 3MR6A 1TS2A 2LXJA 5EQ0A 2CQOA 5LXTF 1PYSB 1VAJA 1MJCA 2UU9Q 1EY5A 5KGUA 1L1OA 2X6GA 1I4HA 1B53A 1WTWA 4ECXA 3G71A 1MZBA 2XGQA 1FKAH 1GKHA 2P0AA 2ATLA 2LXKA 1B50A 1IW7D 4OHJA 2NVXB 3PW7A 3QZ8A 2A8VA 2OF1A 2I80A 3MFHA 3MR3A 4A3KG 4LF6L 4FBUA 4B3SH 4G7ZC 2D5DA 2C5CA 5I9OA 5KFYA 3DMUA 5DLFA 3SK8A 2F0NA 1K28A 3CAMA 2FJ2A 2BR0A 5LMUQ 1PH1A 4RAUC 3I91A 1V43A 3PIO3 3C1FA 2KCTA 3J7AF 1X54A 2B2UC 2E2IH 3T56B 4FBTA 2MQHA 2EJFC 1TWHB 2R7LA 4DV0H 2PQAA 4QY7A 4XYMB 4HSVA 2Q8RE 5GAEC 1F2MA 1ZYRC 5IGGA 4JV5H 4O3OA 3ND9A 4OL7A 4CDFC 1S4ZA 3I4NB 3EPGA 2R7DA 4P2CB 1P16A 4X3TA 2W9CA 2JEFA 1KDAA 1S5ED 4IUQA 3J81j 4HJ5A 1NMFA 1ULZA 2L11A 4UCRA 1D5MC 5ELCA 4H7BA 2BQUA 5C44B 3SXHA 1GJXA 1E0BA 4OIKA 1EU4A 1BQQT 1YNXA 4LF9Q 4IOAA
chains in the Genus database with same CATH topology
1CKNA 1EWIA 5C3EG 4GLXA 1E22A 1HR0Q 3L0OA 4A3IG 3M9BA 1L0WA 1SE8A 1VQHA 3U58A 1HNXL 2I0QA 1L2FA 1WCMG 4A3JG 2ZJRA 3A74A 1IBML 2ATWA 5GADC 1XMQL 2D0OA 3M4OH 4R4TA 2RF4A 2B29A 2IHEA 1SFOH 4X62L 3HOXG 4LWCA 3Q8DA 2VQEQ 2Y0SE 4DV4Q 2NZHA 3RLFA 1LUZA 5HY6A 4X64L 3S15H 4NB3A 1K0RA 3D31A 4PZ8A 5LMUL 1VQ5A 1K8AC 1YJWA 5M3FH 1VQFA 2DGYA 1EUJA 4DV2L 2YV5A 3HOWG 4H02A 3I55A 3H0GG 4JI8L 4NXNQ 3J7A5 1NTGA 4YCUA 3KJPA 2ZM6Q 2OQ0A 2ALYB 2D62A 1YBYA 2IT1A 4DK3C 3HOZH 4DR6Q 1BBUA 4WJ3M 2NN6I 2JA5G 5LMNQ 2L15A 2KHJA 1S72A 2JJQA 4IPCA 4YCWA 4DV5L 1HNWQ 1E7ZA 4DR6L 4DR3L 3W1BA 1QZHA 3I4MH 3NELA 2BA1A 3I7FA 2Q2HA 1VQEA 4LW1A 4DV2Q 5IWAL 4JI2Q 1VQ8A 5BR8Q 4BA2I 1MKHA 4QJFA 4LF5L 4A93H 4OWTB 3H0GH 2CCZA 5K36G 1VCIA 1OXSC 2D0PA 1VQBA 5IWAQ 1VQOA 4APVA 4POFA 1KD1C 4AH6A 3CC4A 3RZDH 1Q8KA 5FLXc 5JEAJ 1U5KA 5IYDG 3CCEA 5FLMG 1SMXA 3HOVG 1K73C 1XNRQ 3S1MH 3E9IA 4DR3Q 4JC0A 4QL5A 4AQYQ 1FGUA 1TWHH 1XNQL 3E0EA 2Q2TA 4QQBX 4L5TA 2UUAL 3OYYA 1J5EL 1UE5A 1I5FA 1X3GA 2R7ZG 3CPWA 2Q2UA 1EIFA 1PYBA 3ER0A 4P73A 3RR5A 5C0XG 4DR7Q 2HT1A 2NVQH 2EIFA 2GVBA 2BH8A 1WCMH 2JK8A 4KLKA 3H15A 2A1AA 2VQEL 2AWOA 4DV4L 4A3JH 2B63G 3M85A 1GM5A 1LM0A 2OQKA 2YTYA 3GD7A 4X66Q 4BY7H 1VQGA 4ALPA 2N78A 1K8GA 4NXMQ 3PUVA 1K9MC 3FHWA 5C44G 5C0XJ 3S1RH 4DR1L 1IBMQ 2BH2A 3ZJYC 4OXPA 1VQ6A 1IBLQ 4DNIA 1SLJA 3TRZA 2PNHA 2YTVA 3F2BA 1Q86C 4BXXH 5IYDH 1L1OB 2R7FA 1HNXQ 2E2HH 4GKKQ 5IP7H 3GTPH 3IRBA 4DUYL 4R4QA 2UUBQ 1Z47A 3RLOA 1G6PA 2AKWB 3J81i 1YJNA 5C0XI 1Q46A 4JI6Q 2UXDQ 1RL2A 3J7ZC 4DV0Q 3I4NG 3AYHB 1N8RC 4NXML 3K80C 5JJLA 5FJ8H 4JI1Q 5GROA 1N36L 3PF4A 2I5LX 5IYCH 1KRTA 1N34Q 4IFDI 3UE1A 5BR8L 1M1KC 4JOIC 1G51A 2ID0A 2R92G 1UE7A 4A3EG 5M5YH 1EQQA 4RMFA 2UUAQ 1R9TH 1Q81C 4DR4Q 2MO1A 1CKMA 1WFQA 4K0KL 2UXCQ 4OONA 1XMOL 1XNQQ 2GVAA 1WOCA 4Y7NH 2ZTCA 1OTCA 1JJGA 3ERSX 3KJOA 4GOPB 3RZOH 3EIVA 4LFCQ 3GTMH 4A3DG 3PGZA 2PI2A 3CF5A 4XTCS 4HJ8A 3G4SA 3BJUA 3UDIA 4B3ML 3HOUH 2VUMG 5GQOA 3TEHB 1T9HA 1OXUA 4JYAQ 2IY5B 2CWAA 5AJ3Q 1AE2A 4YCVA 4GNXA 3PUZA 2R7ZH 1SR3A 4PZ7A 2XGTA 1VS0A 1A62A 2JA7G 3FKIG 3PCOB 3HFZB 3SGIA 4A4IA 4LF6Q 4OWXB 4X64Q 5FJ8G 1ASYA 1VQNA 3CCSA 4B3MQ 3KF6A 3HOXH 4HIOA 1QVFA 3I2ZA 4X65Q 4DV5Q 2B63H 1Q12A 4DV0L 1HNWL 4A3DH 2Z6KC 1GVPA 5IP7G 5LMNL 1OXVA 1X3EA 2Z0SA 2H5XA 3CC2A 1HZCA 1L1OC 3CCJA 1Q82C 3F2DA 1OXTA 4GN5A 1JJCB 5C3EH 1VQPA 3NEMA 4GLAC 5M3FG 3CP0A 2AMCB 1X55A 1N33L 3TS2A 2OTJA 3CC7A 4JI6L 1KQSA 4A3LG 2K5HA 3CCVA 4BBRH 4LF4Q 4A3BH 4B3SL 4PG3A 2JA5H 1CKOA 2VQFQ 4JI7Q 4IPHA 2E8GA 3CPFA 1PH6A 4PMWA 2N8NA 2V1CC 3A0JA 5M3MH 4C3JH 1E1TA 2WB1E 1B70B 4DV6L 2JA8G 4TVAB 1EOVA 5IP9G 4P72A 4DUYQ 2UUBL 1IL2A 4A3CH 4C3HH 3CCRA 2JA9A 4MTNA 3M3YH 1XMQQ 2R92H 1PH4A 1N32Q 1J6QA 2VY3A 4GLVB 2NZOA 3TREA 5JJKA 4DV3Q 4GOPC 3I4MG 2K52A 4GKKL 2CKZB 3OTOL 2R6GA 4TQUS 4HIMA 4L5QA 3T1YL 1HR0W 1I94L 4DUZL 4JI5Q 3TS0A 1FJGL 1S3OA 1QUQA 2VL6A 4LUZA 4LF7Q 2UXBQ 1O7IA 1VQAA 2N49A 2Y0SG 4DV1Q 4DAMA 2R93G 1VQKA 1UWVA 1B7YB 2WAQG 4PZ6A 4JOIA 4UP8A 4JI0Q 4DUZQ 1X9NA 1PH2A 3PO3H 1YHBA 4AIMA 4DV7L 1SROA 4X6AH 3KF6B 3CD6A 4A3GG 4OO1I 2ZTDA 3A5ZB 2HHHQ 3BZKA 1W3SA 3G6EA 5FLMH 2KBNA 3G48A 4DV6Q 3KLWA 2MO0A 2F4VQ 3CMAA 2E5LL 4AYBE 1TWCH 5M3MG 1SRUA 2BA0A 2N3SA 4UY8C 2JA6G 4A3CG 1W2BA 2Z6KA 2KHIA 3HKZE 4BBSH 2YTXA 3UDXA 1UE1A 3JC66 3K8AA 1TWGH 4IJLA 4A3MH 4R4CA 3F1ZA 3PUXA 1CSPA 4A3LH 4DR2L 4R1JA 3T1HL 1JMCA 1I6HH 1HZAA 5JEAG 2OTLA 3H3VH 5AJ3L 4GNXC 1D8LA 4X62Q 1SN8A 1E3PA 2K75A 1U0LA 4OO1G 3ICEA 4IFDJ 2CWPA 1B8AA 4YWKA 4R4IA 4YY3Q 1AE3A 1PFSA 2JA6H 3ULLA 1JE5A 1VQDA 1JB7A 4IFDG 1VQLA 3CCLA 3AFQA 4LFBL 4KHPL 1VQIA 1IZ6A 4LUVA 2DUDA 4UP7A 4NXNL 1LTLA 5IY0A 4HJ9A 4LFAL 4YHHQ 4DR2Q 2JA7H 3GTLH 2WP8J 4A3EH 4BXXG 4XIGS 4JI3L 4JI0L 5J3BA 1UEBA 3CCMA 1A8VA 3OW2A 3PO2G 4IJHA 4EQ5A 1PA6A 2UXBL 4OX9L 3PO3G 4A3FH 4Y52H 4JI1L 1LYLA 3HOUG 1HZBA 4JBMA 4A76A 2F3IA 2E5LQ 1PH9A 1YZ6A 2XTIA 5C4XG 4WJ4A 5M5WH 2VUMH 3A5UA 3E9HA 3ULJA 3MEFA 1E24A 3D0FA 1NBWA 4IOCA 3PUYA 4A3KH 4B3RL 1IYJB 1X6OA 1D7QA 5IYBG 5H1SE 3F8TA 1XMOQ 1E1OA 3UE0A 3S2HH 3RNUA 1Q1BA 1XPUA 3J80i 3TQYA 1PVOA 4BBRG 1I3QH 1X3FA 2I5HA 4HIKA 1EYGA 1HNZQ 2YYZA 4B3TQ 1CKNB 2OCEA 1Q1EA 4MNOA 3H3VI 4KHZA 2K50A 3NBHB 4J15A 1WI5A 1NE3A 3PV0A 3B6YA 3HOZG 4GN3B 4LF4L 3HOYG 1C9OA 2C35B 4DR7L 2Q2IA 1Q7YC 1AH9A 4O0AA 4GS3A 4KHPQ 4LF9Q 4DKAC 3CMEA 4HJAA 5IE8A 4QIWE 3T1YQ 4A93G 4LFAQ 3NENA 2MNAA 4A3BG 1X56A 1PH3A 5DLQE 4P71A 3BZCA 5IT9c 5C4XH 4IO9A 4LFBQ 2JEAI 1HH2P 2RCNA 3PO2H 3KYHC 3M4QA 1TWAH 1BVSA 4YY3L 4AQYL 4JBWA 2IHFA 1GD7A 4LF8L 2WAQE 4BY7G 3HOVH 1V9PA 1EFWA 3FP9A 4IPDA 3KDFA 1EQRA 3CQZH 1YIJA 4O2DA 2JA8H 3KOJA 2I5MX 1Y1WG 4DAYB 2VQFL 4JI7L 1A0IA 1OXXK 1Y14B 4NPSA 4LF5Q 4A3IH 3F2CA 4EX5A 1N33Q 4JYAL 3DM3A 3S1NH 1NMGA 3GTJH 3CXCA 1NJIC 1JJ2A 3HKSA 2JE6I 4A75A 3UDGA 1XPOA 4JCVE 3I56A 2ES2A 5LMNW 1C7YA 1VQJA 1NY4A 3MXNB 1XTDA 4BY1H 1BKBA 2NVXH 1YVCA 3U50C 5GAHC 4JBJA 2ZM6L 3GTQH 3I4NH 2UUCQ 4HIDA 3K7UC 4JG2A 1PHJA 4OWWB 1IBKQ 3BU2A 3S16H 3LGJA 1N34L 5ELNA 1UE6A 3ULPA 4QGUA 3J80c 2JQOA 1MJEA 2K5VA 3T1HQ 2EXDA 2UU9L 4A3GH 2NVYH 3CW2C 2IX0A 4DV1L 1YI2A 2RHQB 4DK6C 4GKJQ 4LF7L 2UXDL 3S14H 2B3GA 1M90C 2EQSA 5HGQA 5IYCG 4IPGA 5JJIA 3GDEA 3OTOQ 4LFCL 1KAWA 1HNZL 2WFWA 4C2MH 4GN4B 3PIOA 3W1GA 1QZGA 1Y1WH 4DR5Q 4P75A 1KHIA 4DR4L 4K0KQ 3K7AH 3VDYA 4DV3L 2HQLA 2HHHL 2UXCL 1HR0L 1VQMA 1G291 1KL9A 4L5SA 1KIXA 4LF9L 4GNXB 4GKJL 2ZJQA 4P74A 3AQQA 4X66L 5C4JH 3FKIH 4YWLA 3U4ZA 1K83H 3M7NA 4HJ7A 3I4OA 2NN6G 3J81c 1A63A 3W5OA 4JV5L 2AWNA 1HZ9A 3GTGH 5ELOA 1PH5A 1YHQA 4GOPA 3K0XA 4B3TL 4B3SQ 5GAGC 4JI5L 1FJGQ 4MZ9A 1Z9FA 1YJ9A 2K4KA 2ZTEA 2FXQA 1VQ4A 1J5EQ 2E2JH 3JAMi 2PQAB 3AFPA 1FVIA 3DLLA 2ZJPA 3RN2A 3KFUA 4ME3A 4FDBA 2QGQA 4RG1A 4LNQA 1N32L 1H95A 3K81C 4B3RQ 1IBLL 3S2DH 1DGSA 2MFIA 1C0AA 1YITA 2OWOA 4YWMA 2VNUD 3AEVA 1X65A 1KC8C 4AYBG 1N9WA 1KXLA 2HIVA 2KENA 2VZAA 1P8LA 2QEXA 3EN2A 1BBWA 2LXJA 3EBEA 2CQOA 3KF8B 2F52A 4JI3Q 1PYSB 4OX9Q 3GTOH 1V1QA 5IP9H 5IYBH 1MJCA 3RN5A 1CUKA 2UU9Q 4JI2L 1XPRA 3KDFB 1ASZA 1L1OA 4JI4Q 3GTKH 3G71A 2UUCL 4UPAA 1Y1VG 1GKHA 3M4PA 3S24A 1IBKL 1QVCA 4LF8Q 4JBKA 2LXKA 4A3FG 4POGA 2YU9H 2K5NA 1XNRL 1QUQB 3CCUA 1KRSA 2RHSB 2VS1A 4LUOA 4X65L 2K14A 2A8VA 3U4VA 3L7ZC 1MIUA 4A3KG 4LF6L 2VW9A 2PI2E 2R93H 3GO5A 3HOYH 2AHOB 1N36Q 3STBD 1YHAA 4UP9A 3UDFA 3CAMA 5LMUQ 1PH1A 4KI0A 1V43A 1WJJA 1K3RA 2KCTA 4BY1G 1X54A 2NVTH 3PSIA 2E2IH 3S17H 1QVGA 4DPGA 1WYDA 1S40A 1PH7A 3L2PA 2MQHA 1TXYA 2GN5A 1I94Q 2A19A 4C3IH 1FL0A 5C44H 1XJVA 2HIXA 2PQAA 1RIPA 4QY7A 3STBC 4DV7Q 4L5RC 4JI8Q 2LSSA 4BA1I 1PV4A 3PUWA 3RLNA 5GAEC 1VQCA 4DR1Q 1VQ9A 3PF5A 3PIPA 4BBSG 4JI4L 1CSQA 1Y1VH 1YEZA 2R7DA 5E7NA 5M5XH 1GO3E 1P16A 4JV5Q 4HJ5A 3S1QH 3J81j 1NMFA 3HOWH 3HKZG 2KCMA 2PMZE 3WWVA 2F4VL 2QA4A 4R4OA 1IXRA 2JEBI 2ASBA 1VQ7A 3JAMc 2WB1G 1EIYB 1TWFH 4A3MG 2IX1A 2CFMA 1PH8A 4YHHL 1JT8A 3CCQA 5EAYA 1YNXA 1I50H 1HJPA 4DR5L 4IOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKN A;  1EWI A;  5C3E G;  4GLX A;  1E22 A;  1HR0 Q;  3L0O A;  4A3I G;  3M9B A;  1L0W A;  1SE8 A;  1VQH A;  3U58 A;  1HNX L;  2I0Q A;  1L2F A;  1WCM G;  4A3J G;  2ZJR A;  3A74 A;  1IBM L;  2ATW A;  5GAD C;  1XMQ L;  2D0O A;  3M4O H;  4R4T A;  2RF4 A;  2B29 A;  2IHE A;  1SFO H;  4X62 L;  3HOX G;  4LWC A;  3Q8D A;  2VQE Q;  2Y0S E;  4DV4 Q;  2NZH A;  3RLF A;  1LUZ A;  5HY6 A;  4X64 L;  3S15 H;  4NB3 A;  1K0R A;  3D31 A;  4PZ8 A;  5LMU L;  1VQ5 A;  1K8A C;  1YJW A;  5M3F H;  1VQF A;  2DGY A;  1EUJ A;  4DV2 L;  2YV5 A;  3HOW G;  4H02 A;  3I55 A;  3H0G G;  4JI8 L;  4NXN Q;  3J7A 5;  1NTG A;  4YCU A;  3KJP A;  2ZM6 Q;  2OQ0 A;  2ALY B;  2D62 A;  1YBY A;  2IT1 A;  4DK3 C;  3HOZ H;  4DR6 Q;  1BBU A;  4WJ3 M;  2NN6 I;  2JA5 G;  5LMN Q;  2L15 A;  2KHJ A;  1S72 A;  2JJQ A;  4IPC A;  4YCW A;  4DV5 L;  1HNW Q;  1E7Z A;  4DR6 L;  4DR3 L;  3W1B A;  1QZH A;  3I4M H;  3NEL A;  2BA1 A;  3I7F A;  2Q2H A;  1VQE A;  4LW1 A;  4DV2 Q;  5IWA L;  4JI2 Q;  1VQ8 A;  5BR8 Q;  4BA2 I;  1MKH A;  4QJF A;  4LF5 L;  4A93 H;  4OWT B;  3H0G H;  2CCZ A;  5K36 G;  1VCI A;  1OXS C;  2D0P A;  1VQB A;  5IWA Q;  1VQO A;  4APV A;  4POF A;  1KD1 C;  4AH6 A;  3CC4 A;  3RZD H;  1Q8K A;  5FLX c;  5JEA J;  1U5K A;  5IYD G;  3CCE A;  5FLM G;  1SMX A;  3HOV G;  1K73 C;  1XNR Q;  3S1M H;  3E9I A;  4DR3 Q;  4JC0 A;  4QL5 A;  4AQY Q;  1FGU A;  1TWH H;  1XNQ L;  3E0E A;  2Q2T A;  4QQB X;  4L5T A;  2UUA L;  3OYY A;  1J5E L;  1UE5 A;  1I5F A;  1X3G A;  2R7Z G;  3CPW A;  2Q2U A;  1EIF A;  1PYB A;  3ER0 A;  4P73 A;  3RR5 A;  5C0X G;  4DR7 Q;  2HT1 A;  2NVQ H;  2EIF A;  2GVB A;  2BH8 A;  1WCM H;  2JK8 A;  4KLK A;  3H15 A;  2A1A A;  2VQE L;  2AWO A;  4DV4 L;  4A3J H;  2B63 G;  3M85 A;  1GM5 A;  1LM0 A;  2OQK A;  2YTY A;  3GD7 A;  4X66 Q;  4BY7 H;  1VQG A;  4ALP A;  2N78 A;  1K8G A;  4NXM Q;  3PUV A;  1K9M C;  3FHW A;  5C44 G;  5C0X J;  3S1R H;  4DR1 L;  1IBM Q;  2BH2 A;  3ZJY C;  4OXP A;  1VQ6 A;  1IBL Q;  4DNI A;  1SLJ A;  3TRZ A;  2PNH A;  2YTV A;  3F2B A;  1Q86 C;  4BXX H;  5IYD H;  1L1O B;  2R7F A;  1HNX Q;  2E2H H;  4GKK Q;  5IP7 H;  3GTP H;  3IRB A;  4DUY L;  4R4Q A;  2UUB Q;  1Z47 A;  3RLO A;  1G6P A;  2AKW B;  3J81 i;  1YJN A;  5C0X I;  1Q46 A;  4JI6 Q;  2UXD Q;  1RL2 A;  3J7Z C;  4DV0 Q;  3I4N G;  3AYH B;  1N8R C;  4NXM L;  3K80 C;  5JJL A;  5FJ8 H;  4JI1 Q;  5GRO A;  1N36 L;  3PF4 A;  2I5L X;  5IYC H;  1KRT A;  1N34 Q;  4IFD I;  3UE1 A;  5BR8 L;  1M1K C;  4JOI C;  1G51 A;  2ID0 A;  2R92 G;  1UE7 A;  4A3E G;  5M5Y H;  1EQQ A;  4RMF A;  2UUA Q;  1R9T H;  1Q81 C;  4DR4 Q;  2MO1 A;  1CKM A;  1WFQ A;  4K0K L;  2UXC Q;  4OON A;  1XMO L;  1XNQ Q;  2GVA A;  1WOC A;  4Y7N H;  2ZTC A;  1OTC A;  1JJG A;  3ERS X;  3KJO A;  4GOP B;  3RZO H;  3EIV A;  4LFC Q;  3GTM H;  4A3D G;  3PGZ A;  2PI2 A;  3CF5 A;  4XTC S;  4HJ8 A;  3G4S A;  3BJU A;  3UDI A;  4B3M L;  3HOU H;  2VUM G;  5GQO A;  3TEH B;  1T9H A;  1OXU A;  4JYA Q;  2IY5 B;  2CWA A;  5AJ3 Q;  1AE2 A;  4YCV A;  4GNX A;  3PUZ A;  2R7Z H;  1SR3 A;  4PZ7 A;  2XGT A;  1VS0 A;  1A62 A;  2JA7 G;  3FKI G;  3PCO B;  3HFZ B;  3SGI A;  4A4I A;  4LF6 Q;  4OWX B;  4X64 Q;  5FJ8 G;  1ASY A;  1VQN A;  3CCS A;  4B3M Q;  3KF6 A;  3HOX H;  4HIO A;  1QVF A;  3I2Z A;  4X65 Q;  4DV5 Q;  2B63 H;  1Q12 A;  4DV0 L;  1HNW L;  4A3D H;  2Z6K C;  1GVP A;  5IP7 G;  5LMN L;  1OXV A;  1X3E A;  2Z0S A;  2H5X A;  3CC2 A;  1HZC A;  1L1O C;  3CCJ A;  1Q82 C;  3F2D A;  1OXT A;  4GN5 A;  1JJC B;  5C3E H;  1VQP A;  3NEM A;  4GLA C;  5M3F G;  3CP0 A;  2AMC B;  1X55 A;  1N33 L;  3TS2 A;  2OTJ A;  3CC7 A;  4JI6 L;  1KQS A;  4A3L G;  2K5H A;  3CCV A;  4BBR H;  4LF4 Q;  4A3B H;  4B3S L;  4PG3 A;  2JA5 H;  1CKO A;  2VQF Q;  4JI7 Q;  4IPH A;  2E8G A;  3CPF A;  1PH6 A;  4PMW A;  2N8N A;  2V1C C;  3A0J A;  5M3M H;  4C3J H;  1E1T A;  2WB1 E;  1B70 B;  4DV6 L;  2JA8 G;  4TVA B;  1EOV A;  5IP9 G;  4P72 A;  4DUY Q;  2UUB L;  1IL2 A;  4A3C H;  4C3H H;  3CCR A;  2JA9 A;  4MTN A;  3M3Y H;  1XMQ Q;  2R92 H;  1PH4 A;  1N32 Q;  1J6Q A;  2VY3 A;  4GLV B;  2NZO A;  3TRE A;  5JJK A;  4DV3 Q;  4GOP C;  3I4M G;  2K52 A;  4GKK L;  2CKZ B;  3OTO L;  2R6G A;  4TQU S;  4HIM A;  4L5Q A;  3T1Y L;  1HR0 W;  1I94 L;  4DUZ L;  4JI5 Q;  3TS0 A;  1FJG L;  1S3O A;  1QUQ A;  2VL6 A;  4LUZ A;  4LF7 Q;  2UXB Q;  1O7I A;  1VQA A;  2N49 A;  2Y0S G;  4DV1 Q;  4DAM A;  2R93 G;  1VQK A;  1UWV A;  1B7Y B;  2WAQ G;  4PZ6 A;  4JOI A;  4UP8 A;  4JI0 Q;  4DUZ Q;  1X9N A;  1PH2 A;  3PO3 H;  1YHB A;  4AIM A;  4DV7 L;  1SRO A;  4X6A H;  3KF6 B;  3CD6 A;  4A3G G;  4OO1 I;  2ZTD A;  3A5Z B;  2HHH Q;  3BZK A;  1W3S A;  3G6E A;  5FLM H;  2KBN A;  3G48 A;  4DV6 Q;  3KLW A;  2MO0 A;  2F4V Q;  3CMA A;  2E5L L;  4AYB E;  1TWC H;  5M3M G;  1SRU A;  2BA0 A;  2N3S A;  4UY8 C;  2JA6 G;  4A3C G;  1W2B A;  2Z6K A;  2KHI A;  3HKZ E;  4BBS H;  2YTX A;  3UDX A;  1UE1 A;  3JC6 6;  3K8A A;  1TWG H;  4IJL A;  4A3M H;  4R4C A;  3F1Z A;  3PUX A;  1CSP A;  4A3L H;  4DR2 L;  4R1J A;  3T1H L;  1JMC A;  1I6H H;  1HZA A;  5JEA G;  2OTL A;  3H3V H;  5AJ3 L;  4GNX C;  1D8L A;  4X62 Q;  1SN8 A;  1E3P A;  2K75 A;  1U0L A;  4OO1 G;  3ICE A;  4IFD J;  2CWP A;  1B8A A;  4YWK A;  4R4I A;  4YY3 Q;  1AE3 A;  1PFS A;  2JA6 H;  3ULL A;  1JE5 A;  1VQD A;  1JB7 A;  4IFD G;  1VQL A;  3CCL A;  3AFQ A;  4LFB L;  4KHP L;  1VQI A;  1IZ6 A;  4LUV A;  2DUD A;  4UP7 A;  4NXN L;  1LTL A;  5IY0 A;  4HJ9 A;  4LFA L;  4YHH Q;  4DR2 Q;  2JA7 H;  3GTL H;  2WP8 J;  4A3E H;  4BXX G;  4XIG S;  4JI3 L;  4JI0 L;  5J3B A;  1UEB A;  3CCM A;  1A8V A;  3OW2 A;  3PO2 G;  4IJH A;  4EQ5 A;  1PA6 A;  2UXB L;  4OX9 L;  3PO3 G;  4A3F H;  4Y52 H;  4JI1 L;  1LYL A;  3HOU G;  1HZB A;  4JBM A;  4A76 A;  2F3I A;  2E5L Q;  1PH9 A;  1YZ6 A;  2XTI A;  5C4X G;  4WJ4 A;  5M5W H;  2VUM H;  3A5U A;  3E9H A;  3ULJ A;  3MEF A;  1E24 A;  3D0F A;  1NBW A;  4IOC A;  3PUY A;  4A3K H;  4B3R L;  1IYJ B;  1X6O A;  1D7Q A;  5IYB G;  5H1S E;  3F8T A;  1XMO Q;  1E1O A;  3UE0 A;  3S2H H;  3RNU A;  1Q1B A;  1XPU A;  3J80 i;  3TQY A;  1PVO A;  4BBR G;  1I3Q H;  1X3F A;  2I5H A;  4HIK A;  1EYG A;  1HNZ Q;  2YYZ A;  4B3T Q;  1CKN B;  2OCE A;  1Q1E A;  4MNO A;  3H3V I;  4KHZ A;  2K50 A;  3NBH B;  4J15 A;  1WI5 A;  1NE3 A;  3PV0 A;  3B6Y A;  3HOZ G;  4GN3 B;  4LF4 L;  3HOY G;  1C9O A;  2C35 B;  4DR7 L;  2Q2I A;  1Q7Y C;  1AH9 A;  4O0A A;  4GS3 A;  4KHP Q;  4LF9 Q;  4DKA C;  3CME A;  4HJA A;  5IE8 A;  4QIW E;  3T1Y Q;  4A93 G;  4LFA Q;  3NEN A;  2MNA A;  4A3B G;  1X56 A;  1PH3 A;  5DLQ E;  4P71 A;  3BZC A;  5IT9 c;  5C4X H;  4IO9 A;  4LFB Q;  2JEA I;  1HH2 P;  2RCN A;  3PO2 H;  3KYH C;  3M4Q A;  1TWA H;  1BVS A;  4YY3 L;  4AQY L;  4JBW A;  2IHF A;  1GD7 A;  4LF8 L;  2WAQ E;  4BY7 G;  3HOV H;  1V9P A;  1EFW A;  3FP9 A;  4IPD A;  3KDF A;  1EQR A;  3CQZ H;  1YIJ A;  4O2D A;  2JA8 H;  3KOJ A;  2I5M X;  1Y1W G;  4DAY B;  2VQF L;  4JI7 L;  1A0I A;  1OXX K;  1Y14 B;  4NPS A;  4LF5 Q;  4A3I H;  3F2C A;  4EX5 A;  1N33 Q;  4JYA L;  3DM3 A;  3S1N H;  1NMG A;  3GTJ H;  3CXC A;  1NJI C;  1JJ2 A;  3HKS A;  2JE6 I;  4A75 A;  3UDG A;  1XPO A;  4JCV E;  3I56 A;  2ES2 A;  5LMN W;  1C7Y A;  1VQJ A;  1NY4 A;  3MXN B;  1XTD A;  4BY1 H;  1BKB A;  2NVX H;  1YVC A;  3U50 C;  5GAH C;  4JBJ A;  2ZM6 L;  3GTQ H;  3I4N H;  2UUC Q;  4HID A;  3K7U C;  4JG2 A;  1PHJ A;  4OWW B;  1IBK Q;  3BU2 A;  3S16 H;  3LGJ A;  1N34 L;  5ELN A;  1UE6 A;  3ULP A;  4QGU A;  3J80 c;  2JQO A;  1MJE A;  2K5V A;  3T1H Q;  2EXD A;  2UU9 L;  4A3G H;  2NVY H;  3CW2 C;  2IX0 A;  4DV1 L;  1YI2 A;  2RHQ B;  4DK6 C;  4GKJ Q;  4LF7 L;  2UXD L;  3S14 H;  2B3G A;  1M90 C;  2EQS A;  5HGQ A;  5IYC G;  4IPG A;  5JJI A;  3GDE A;  3OTO Q;  4LFC L;  1KAW A;  1HNZ L;  2WFW A;  4C2M H;  4GN4 B;  3PIO A;  3W1G A;  1QZG A;  1Y1W H;  4DR5 Q;  4P75 A;  1KHI A;  4DR4 L;  4K0K Q;  3K7A H;  3VDY A;  4DV3 L;  2HQL A;  2HHH L;  2UXC L;  1HR0 L;  1VQM A;  1G29 1;  1KL9 A;  4L5S A;  1KIX A;  4LF9 L;  4GNX B;  4GKJ L;  2ZJQ A;  4P74 A;  3AQQ A;  4X66 L;  5C4J H;  3FKI H;  4YWL A;  3U4Z A;  1K83 H;  3M7N A;  4HJ7 A;  3I4O A;  2NN6 G;  3J81 c;  1A63 A;  3W5O A;  4JV5 L;  2AWN A;  1HZ9 A;  3GTG H;  5ELO A;  1PH5 A;  1YHQ A;  4GOP A;  3K0X A;  4B3T L;  4B3S Q;  5GAG C;  4JI5 L;  1FJG Q;  4MZ9 A;  1Z9F A;  1YJ9 A;  2K4K A;  2ZTE A;  2FXQ A;  1VQ4 A;  1J5E Q;  2E2J H;  3JAM i;  2PQA B;  3AFP A;  1FVI A;  3DLL A;  2ZJP A;  3RN2 A;  3KFU A;  4ME3 A;  4FDB A;  2QGQ A;  4RG1 A;  4LNQ A;  1N32 L;  1H95 A;  3K81 C;  4B3R Q;  1IBL L;  3S2D H;  1DGS A;  2MFI A;  1C0A A;  1YIT A;  2OWO A;  4YWM A;  2VNU D;  3AEV A;  1X65 A;  1KC8 C;  4AYB G;  1N9W A;  1KXL A;  2HIV A;  2KEN A;  2VZA A;  1P8L A;  2QEX A;  3EN2 A;  1BBW A;  2LXJ A;  3EBE A;  2CQO A;  3KF8 B;  2F52 A;  4JI3 Q;  1PYS B;  4OX9 Q;  3GTO H;  1V1Q A;  5IP9 H;  5IYB H;  1MJC A;  3RN5 A;  1CUK A;  2UU9 Q;  4JI2 L;  1XPR A;  3KDF B;  1ASZ A;  1L1O A;  4JI4 Q;  3GTK H;  3G71 A;  2UUC L;  4UPA A;  1Y1V G;  1GKH A;  3M4P A;  3S24 A;  1IBK L;  1QVC A;  4LF8 Q;  4JBK A;  2LXK A;  4A3F G;  4POG A;  2YU9 H;  2K5N A;  1XNR L;  1QUQ B;  3CCU A;  1KRS A;  2RHS B;  2VS1 A;  4LUO A;  4X65 L;  2K14 A;  2A8V A;  3U4V A;  3L7Z C;  1MIU A;  4A3K G;  4LF6 L;  2VW9 A;  2PI2 E;  2R93 H;  3GO5 A;  3HOY H;  2AHO B;  1N36 Q;  3STB D;  1YHA A;  4UP9 A;  3UDF A;  3CAM A;  5LMU Q;  1PH1 A;  4KI0 A;  1V43 A;  1WJJ A;  1K3R A;  2KCT A;  4BY1 G;  1X54 A;  2NVT H;  3PSI A;  2E2I H;  3S17 H;  1QVG A;  4DPG A;  1WYD A;  1S40 A;  1PH7 A;  3L2P A;  2MQH A;  1TXY A;  2GN5 A;  1I94 Q;  2A19 A;  4C3I H;  1FL0 A;  5C44 H;  1XJV A;  2HIX A;  2PQA A;  1RIP A;  4QY7 A;  3STB C;  4DV7 Q;  4L5R C;  4JI8 Q;  2LSS A;  4BA1 I;  1PV4 A;  3PUW A;  3RLN A;  5GAE C;  1VQC A;  4DR1 Q;  1VQ9 A;  3PF5 A;  3PIP A;  4BBS G;  4JI4 L;  1CSQ A;  1Y1V H;  1YEZ A;  2R7D A;  5E7N A;  5M5X H;  1GO3 E;  1P16 A;  4JV5 Q;  4HJ5 A;  3S1Q H;  3J81 j;  1NMF A;  3HOW H;  3HKZ G;  2KCM A;  2PMZ E;  3WWV A;  2F4V L;  2QA4 A;  4R4O A;  1IXR A;  2JEB I;  2ASB A;  1VQ7 A;  3JAM c;  2WB1 G;  1EIY B;  1TWF H;  4A3M G;  2IX1 A;  2CFM A;  1PH8 A;  4YHH L;  1JT8 A;  3CCQ A;  5EAY A;  1YNX A;  1I50 H;  1HJP A;  4DR5 L;  4IOA A; 
#chains in the Genus database with same CATH topology
 5C3E G;  4J9L A;  2ZXO A;  1EZ1 A;  1O75 A;  2I0Q A;  1N56 A;  2DIK A;  5GAD C;  1XMQ L;  2R7Z B;  1TWC A;  3BVG A;  4QIW A;  3T5L A;  1N36 H;  2B29 A;  5KFJ A;  1RTN A;  4DGZ A;  4LWC A;  5J1Z A;  5KFA A;  5J2U F;  1LUZ A;  5KT7 A;  3S15 H;  1SEI A;  1K8A C;  3MTS A;  1YJW A;  1VQF A;  1QB5 D;  4MTD A;  4MV9 A;  2YV5 A;  2RDG A;  3H4B A;  2E2H A;  3KAJ A;  1X32 A;  3BS1 A;  1FGB D;  3I55 A;  2B2Y A;  3H0G G;  4JI8 L;  3J7A 5;  1NTG A;  4YCU A;  4KTA A;  4A93 B;  2FB9 A;  2ALY B;  1YBY A;  2IT1 A;  4DR6 Q;  4EQP A;  1W6J A;  1CFM A;  2FMA A;  1S72 A;  2EYF A;  2EYL A;  2LY7 A;  4DV5 L;  4BBR B;  3W1B A;  2IP4 A;  5J2T F;  3I4M H;  4F4W A;  2DNE A;  2BA1 A;  2DZD A;  2F0J A;  2PN1 A;  2Q2H A;  3GV3 A;  5C5L A;  5BN4 A;  1VQ8 A;  4C2M B;  4BA2 I;  1MKH A;  4L6T B;  3NE5 B;  2WKC A;  1VQB A;  3OOC A;  4BS9 A;  4APV A;  2DJF C;  3Q8R B;  1TWH A;  1KDC A;  3HOV G;  5F9L A;  1JB3 A;  2PYK A;  1XNR Q;  1GUO A;  1KJ8 A;  2W6N A;  4RHS A;  3T16 A;  1XNQ L;  2Q2T A;  4O1N A;  5DM6 3;  1D2B A;  3R93 A;  1EIF A;  2FMM A;  1LAB A;  2EXZ A;  4LSX A;  4RFB A;  1AN8 A;  4IWY A;  4DV7 H;  3EQL C;  2O4X A;  1B44 D;  3BZD B;  2JK8 A;  4KLK A;  3LML A;  2VQE L;  3HZX A;  4DV4 L;  2F4V Q;  4ZQI A;  1LM0 A;  4BY7 H;  1STE A;  2N78 A;  5LHY 1;  3PUV A;  1K8G A;  1K9M C;  3GTL B;  3A7L A;  4RZR A;  5C0X J;  3S1R H;  1N32 H;  4OXP A;  1VQ6 A;  1HTP A;  1DOK A;  4QUC A;  3OHA A;  1F2Y A;  1E4G T;  5KFD A;  3TRZ A;  3NK9 A;  2PNH A;  4BXX H;  1Q86 C;  2W6M A;  1BGW A;  1L1O B;  1HNX Q;  1TKW B;  4ID6 A;  3RLO A;  2AKW B;  3KLR A;  3DUZ A;  3J81 i;  4BBS B;  4GKK H;  2F0I A;  2ICI A;  4LH6 A;  4DV0 Q;  4ECS A;  3I4N G;  1U4M A;  1BO0 A;  4JV0 A;  3I12 A;  4RNM A;  4S3S A;  4J9P A;  4IAJ A;  2P5Z X;  3PF4 A;  4ME6 A;  4U7C A;  4IFD I;  5BR8 L;  4DR7 H;  1A3V A;  2UXC H;  2QW7 A;  3LX0 A;  1G8Z D;  2R92 G;  3N8D A;  2AU0 A;  4A3E G;  5M5Y H;  1EQQ A;  1B04 A;  2IJ0 A;  4DR4 Q;  4K0K L;  4DR5 H;  3EYY A;  2GVA A;  4Y7N H;  5KG3 A;  1OTC A;  3ERS X;  5J39 A;  5KEE A;  3H40 A;  3H6M A;  3TP8 A;  4XTC S;  2BE5 D;  4A2A A;  3BAA A;  5GQO A;  1T9H A;  3WDN A;  5AJ3 Q;  2CH4 A;  4YCV A;  4ECV A;  2FHT A;  4YB8 B;  1ZXT A;  3SGI A;  4A4I A;  1CQI B;  2N55 A;  4DAP A;  3R5H A;  2TSS A;  3CCS A;  4ZOL F;  3HOX H;  5H80 A;  1QVF A;  2QCP X;  1HNW L;  2VUM A;  3RZD B;  5IP7 G;  3HRZ C;  3E5S A;  1L1O C;  2EY6 A;  2FP4 B;  4RB2 C;  2WTF A;  3F2D A;  4GN5 A;  4IUU A;  1U4R A;  1LTT D;  2W57 A;  2EOT A;  2A6H C;  3GTJ B;  3HGB A;  5KKN B;  3FPP A;  3TS2 A;  2OTJ A;  4JI6 L;  4A3L G;  2X0S A;  4LF4 Q;  4A3B H;  4K0K H;  4EVO A;  1CKO A;  4IPH A;  1KAB A;  4MV4 A;  1PH6 A;  4MTE A;  4I7H A;  5KFM A;  5F2D A;  5KT4 A;  4QWC A;  4AQY H;  2V1C C;  3A0J A;  3RB4 A;  2JN4 A;  2NVY A;  2IW3 A;  2EY1 A;  2RQX A;  5IT9 L;  4K2L A;  1TS4 A;  1CHP D;  1XMQ Q;  1N32 Q;  1PH4 A;  2UUC H;  5JJK A;  4GOP C;  4GKK L;  3OHX C;  1KTK A;  3OTO L;  2EVB A;  1BUV T;  4TQU S;  2JP1 A;  2M05 A;  1PYW D;  2VPQ A;  3E6Z X;  4DL6 A;  4JI5 Q;  3TS0 A;  4O2A F;  3GIL A;  4RGN A;  1ET9 A;  2QDL A;  3H3V C;  4HR7 B;  4Q43 A;  5LL6 b;  2BQ3 A;  2NTS A;  1Y1W B;  1O7I A;  4DAM A;  3LWB A;  2R61 A;  2RKS A;  1VQK A;  4UP8 A;  1PH2 A;  1ICW A;  1YHB A;  5E3F A;  1RYS A;  1LT6 D;  3BYY B;  1ET6 A;  4DV7 L;  4X6A H;  3KF6 B;  3RGZ A;  2K7V A;  5KNB A;  4ULL A;  4ZRZ A;  3I90 A;  1HFG A;  3BZK A;  1LT4 D;  1W3S A;  4C3I B;  2HHH Q;  1RK6 A;  1S0O A;  2KBN A;  3V6J A;  3KLW A;  4QCL A;  2W8L A;  1A6X A;  2JA6 G;  3S1N H;  1SRU A;  2N3S A;  1XNQ H;  4RH6 A;  3M9N B;  4FXG C;  3HKZ E;  4NW2 A;  3JC6 6;  2HVQ A;  3K8A A;  4XT3 B;  4ECR A;  1SYB A;  4U68 A;  4A3M H;  3MWE A;  3PUX A;  4A3L H;  5KYL A;  2XCA A;  2NU8 B;  1PTO F;  5LA6 F;  4R1J A;  3T1H L;  4OEM B;  5LYJ F;  4J8Q A;  5AJ3 L;  4X62 Q;  1PXU A;  3HEJ A;  2B63 B;  1ENA A;  4OO1 G;  2FK2 A;  2YCH A;  5EOY A;  2M00 A;  1SJE D;  3DWQ A;  4FVM A;  4RWS C;  2J9G A;  4ZCK A;  5FD5 A;  4B9W A;  2JA6 H;  3R3O A;  1D1K A;  4QB4 A;  2Z9H A;  3D8G A;  2EY5 A;  2F0S A;  3OIQ A;  5C4J B;  4FXK C;  5BR8 H;  2XWJ B;  3AFQ A;  4UP7 A;  1IZ6 A;  4MV6 A;  2DUD A;  4NXN L;  2VPS A;  1DIK A;  3PR5 B;  4A3E H;  4BWS C;  2W6Q A;  2UVW A;  4IAL A;  2RGV A;  1UEB A;  4JI8 H;  4G3I A;  4N9T A;  4EQ5 A;  1HRJ A;  3PO3 G;  4A3B B;  3DM1 A;  3WO0 A;  4Y52 H;  4ECY A;  3KHG A;  3J7Y W;  3VA5 A;  4A76 A;  4JBM A;  5FOB B;  2F03 A;  1YZ6 A;  4OX9 H;  1I6V C;  4HTH A;  1JDE A;  4FO2 A;  3D0F A;  3MEF A;  4IOC A;  4B3R L;  2PMZ A;  1EY6 A;  1LT5 D;  2W6O A;  4QIW B;  4Y8V B;  4KY7 A;  3S2H H;  1XMQ H;  1XPU A;  3J80 i;  4HR7 A;  3P1H A;  1EYG A;  4JYA H;  1X3F A;  4ED8 A;  5COY A;  5J22 A;  1HNZ Q;  2V58 A;  2OCE A;  3A8J E;  4WFN 3;  4MNO A;  3H3V I;  4J15 A;  3CQZ A;  1AN7 A;  1EZ6 A;  3PV0 A;  3HOZ G;  2VUG A;  4GN3 B;  3PW5 A;  1K8M A;  4CJ2 C;  3ITP A;  2C35 B;  3HOY G;  4LMQ D;  2YYA A;  4DUZ H;  2HQE A;  2JA5 B;  2Q2I A;  4MV7 A;  1B9N A;  3GTK A;  2PW5 A;  2WV6 D;  4GS3 A;  1KJJ A;  3CME A;  2R7N A;  4KN4 C;  2KEC A;  4QIW E;  3I73 A;  1R9T A;  1RD9 D;  3NEN A;  4IUN A;  4CJ1 B;  4A3B G;  3PO3 B;  1NR4 A;  3N41 B;  3BZC A;  5CA0 F;  5C4X H;  1PTO H;  5JEA H;  3HOW B;  2CW0 C;  2JEA I;  1E2W A;  5KT5 A;  2RCN A;  4C3H B;  2KJX A;  3PO2 H;  3KYH C;  4DUY H;  1BVS A;  4UCU A;  4JBW A;  3RBD A;  2IHF A;  4Q0Y A;  4BY7 G;  3SI8 A;  3HOV H;  4J9R A;  4LAA A;  5IGC A;  1EFW A;  2HVS A;  3D4W A;  2NWG A;  3S1N B;  2FK3 A;  1ICF B;  4OGQ C;  4CKE A;  5C3X A;  2EYP A;  4TV9 F;  3QZ7 A;  4QMG A;  1GYF A;  1TS5 A;  3GTJ H;  4I55 F;  3OSN A;  2W70 A;  1UNS A;  1SFO B;  1GUG A;  5CV4 A;  1DCZ A;  5LMN W;  3GV8 B;  1VQJ A;  1K1Q A;  1EQT A;  3NP8 A;  2W9B B;  1SMY C;  4XT1 B;  4B08 A;  2ZM6 L;  2VOB A;  2LFN A;  2JA8 B;  3I4N H;  1J9O A;  3HP3 A;  4OWW B;  1IBK Q;  3BU2 A;  3DWP A;  3LGJ A;  4HNU A;  5BMV F;  1K8O A;  2WE6 A;  5ELN A;  1PDQ A;  1Z7T A;  2WIN B;  2K5V A;  2JA7 A;  3MWY W;  3F8N A;  3CW2 C;  4JV2 A;  1S5D D;  4BY1 B;  4DA2 A;  3KF8 A;  3HXL A;  4DK6 C;  3T4A C;  1CTM A;  4FU0 A;  3S14 H;  5IYZ F;  1G2S A;  2EQS A;  5HGQ A;  2JA6 A;  3GDE A;  2J6T A;  3W1G A;  2GPS A;  1I4P A;  3GTM B;  1SE2 A;  3K7A H;  1HR0 L;  1VQM A;  1LTR D;  1KL9 A;  5E1F A;  1KIX A;  1C30 A;  3G6X A;  1GSO A;  1HXY D;  5KFQ A;  4NXM H;  4HCE A;  4G57 A;  5I6Y A;  3U4Z A;  1K83 H;  1WTX A;  4XXE A;  1KAA A;  2NN6 G;  3J81 c;  2WB1 B;  4JV5 L;  4JI5 H;  1HZ9 A;  1STH A;  2Z1C A;  5DQG A;  4CDE C;  1PH5 A;  2YS6 A;  3H4D A;  4V0B A;  3N43 B;  2PCF B;  2YZM A;  3RAX A;  1Z9F A;  4HNV A;  1TWC B;  2PQA B;  3KFU A;  5FPR A;  2R7Z A;  1EY4 A;  3FDS A;  4FDB A;  2YRX A;  2QGQ A;  1ENF A;  4CKB A;  4IZO A;  2ASL A;  3RGX A;  1S10 A;  4C5A A;  2F0E A;  1CM9 A;  1CQF A;  4HED A;  5IGB A;  1A9X A;  4AYB G;  2HIV A;  1HQM C;  3QG1 A;  1XMO H;  1P8L A;  3QWN A;  1S03 G;  4FF3 A;  4HQ6 A;  5CV7 A;  1BNC A;  3RB0 A;  3EBE A;  3KF8 B;  2F52 A;  1IKL A;  3BQ0 A;  5IP9 H;  1G91 A;  2PQE A;  4EBD A;  1E4E A;  1GHJ A;  4K2K A;  2UUA H;  1JR0 D;  1NR2 A;  2NZ1 D;  1ASZ A;  4JI4 Q;  3RV3 A;  3RUZ A;  4UPA A;  4UCS A;  2ASJ A;  1BBX C;  1EUD B;  1EWC A;  2UUB H;  5E4W C;  1PZK D;  2YU9 H;  4POG A;  4I7A A;  1KRS A;  2VS1 A;  4LUO A;  4X65 L;  3GIM A;  2W71 A;  4JUZ A;  3U4V A;  4R7R A;  1MIU A;  3BDO A;  2R93 H;  3GO5 A;  1N36 Q;  1YHA A;  4UP9 A;  2B2W A;  3D4R A;  3KAL A;  3MWD A;  3RZO B;  2NVY B;  4EGV A;  1K3R A;  3K5O A;  3MC0 B;  3ERO A;  1QVG A;  1S40 A;  1PH7 A;  3L2P A;  3R23 A;  2GN5 A;  3OPO A;  3G6V A;  1ML0 D;  2A19 A;  1FL0 A;  5DEH A;  5C44 H;  3OMG A;  3SDZ A;  1XJV A;  3STB C;  5JQW A;  5KFZ A;  1PV4 A;  4IN3 A;  4DR1 Q;  4BBS G;  2CHB D;  3PIP A;  3OTO H;  1CSQ A;  1Y1V H;  2WB1 A;  5E7N A;  1GO3 E;  4JV5 Q;  2Z4H A;  5KFC A;  3HOW H;  4NXN H;  1D5X C;  4DL3 A;  2A73 B;  2F4V L;  1IXR A;  4DXG A;  4JI2 H;  2PO4 A;  2KHS A;  2WB1 G;  1EIY B;  1TWF H;  5JVH 3;  1HNX H;  2BOS A;  1EY9 A;  1HQR D;  4L8J A;  3CCQ A;  3A56 A;  1I50 H;  4KK7 A;  2E2H B;  2FLP A;  4TKO B;  1E22 A;  1HR0 Q;  3OW7 A;  4UCT A;  3M9B A;  4I7Z C;  4R8U A;  1SE8 A;  1VQH A;  3WOF A;  3U58 A;  4A3J G;  3MHB A;  2F0L A;  2KSW A;  1RJT A;  4LJZ C;  4R4T A;  2RF4 A;  2ALZ A;  1KJQ A;  1T94 A;  1SFO H;  3GP7 A;  2L1B A;  4X62 L;  3HOX G;  2PZT A;  5KNC A;  3J81 W;  2RSO A;  1SNO A;  1RCV D;  4NMZ A;  4FYD A;  4J6H A;  2DPJ A;  1XDN A;  2FJZ A;  1M6V A;  1EUJ A;  4F88 A;  3PMF A;  4R8U B;  1PLF A;  2E74 C;  5LL6 S;  2EDG A;  5M5W B;  1KLG D;  2BCO A;  3QFF A;  3KJP A;  1L0X B;  4KN7 C;  4DK3 C;  2WKD A;  3A55 A;  4X66 H;  1EEF D;  3GTG A;  2L15 A;  1CHQ D;  4BWG B;  1HTL D;  3EA6 A;  1IBM H;  1GUW A;  4DR6 L;  4DV3 H;  4DR3 L;  2XRS D;  2MHV A;  3URY A;  1QZH A;  3I7F A;  1CZG A;  2F3V A;  3BVZ A;  3L4K A;  5DGA A;  1VQE A;  4MTK A;  5IWA L;  1SYD A;  4JI2 Q;  4ED0 A;  2XNA C;  5JPN C;  2FPI B;  2PBZ A;  3H0G H;  5K36 G;  3PN1 A;  4YY3 H;  1VQO A;  5KG7 A;  4DR2 H;  5ISR A;  4ED3 A;  4POF A;  3JAM W;  3RZD H;  2G9D A;  5FLX c;  1IHZ A;  3S1M H;  3IG0 A;  4O3P A;  4BY7 B;  4C56 C;  3E0E A;  2M9V A;  3U9O A;  1NUC A;  4C3H G;  3ORQ A;  4F4Z A;  2C2E A;  2A68 C;  2R7Z G;  3H0G A;  3FMC A;  3CPW A;  3LWE A;  4HYK A;  5C0X G;  2EE1 A;  1T3N A;  5T1I A;  2HT1 A;  1M0T A;  1TT2 A;  2F0U A;  5KG4 A;  1WCM H;  1GXD C;  2A1A A;  2AWO A;  3HOY B;  5DGB A;  4C1N I;  3GD7 A;  4DR6 H;  3HOZ B;  3FHW A;  5C44 G;  4LMY A;  1S5B D;  4DR1 L;  5JVL A;  3P20 A;  3T5J A;  3KTM A;  1STY A;  3KLS A;  3F2B A;  2E2H H;  2NUA B;  1QG7 A;  2J4X A;  1DOM A;  3IRB A;  3LP8 A;  5EBC A;  3Q8S B;  1XNR H;  5K36 H;  3M4O B;  5FO7 B;  1VKZ A;  4HAE A;  2FPP B;  1PTO C;  5EDW A;  1DJR D;  5EKK A;  3PW4 A;  2E2D C;  1N34 Q;  1Y8O B;  3UE1 A;  4JOI C;  5EKI A;  4V19 0;  2V4Q A;  1H9S B;  1DM0 B;  3OHB A;  4N8F A;  1SE4 A;  1XNQ Q;  1M7J A;  1JJG A;  3H91 A;  4ZAI A;  2DY8 A;  3RZO H;  4A3D G;  3PGZ A;  1TWF A;  4X3S A;  5KG0 A;  2G9H D;  4B3M L;  3UDI A;  2PW7 A;  3K5H A;  2YRW A;  4J9Q A;  5JOB A;  2VUM G;  3BA9 A;  4DLK A;  2I46 A;  2N88 A;  1IOW A;  2NBF A;  4GNX A;  3K3P A;  4PZ7 A;  3TBI B;  1S5F D;  4A3M B;  4EQO A;  2VB3 X;  3VR5 A;  3EJI A;  1G2T A;  3MXN A;  5KFF A;  3PCO B;  3M9M B;  3KHR A;  4B3T H;  1YNN C;  4X64 Q;  2QK4 A;  1ASY A;  4ZUI A;  1VQN A;  3HG9 A;  3FEW X;  3KF6 A;  3TIN A;  3JAM E;  5D3D A;  2B63 H;  1JWM D;  2W9A A;  1GVP A;  2NU6 B;  1OXV A;  4IQZ A;  2JA6 B;  4LFA H;  1VBH A;  1EY8 A;  2ZDQ A;  3CCJ A;  1NCV A;  3NUC A;  4KKU A;  5C3E H;  5KIX A;  1BJT A;  3C0F B;  4DL2 A;  2B2T C;  1VMP A;  1X55 A;  2AMC B;  2Q8T A;  1HCZ A;  3CC7 A;  3GTL A;  1EY7 A;  3CCV A;  3M9O B;  4YQW A;  1UUP A;  4PG3 A;  2JA5 H;  2VQF Q;  2HVR A;  1KNA A;  2E8G A;  2B39 A;  5KFW A;  4KHV A;  1I4Q A;  1LTG D;  5M3M H;  4C3J H;  4WOR A;  5E4X A;  5KRU A;  2L5T A;  3K58 A;  4TVA B;  2VB2 X;  4DUY Q;  4DV6 L;  2UUB L;  3C2P A;  2JA8 G;  4A3C H;  4MV8 A;  1JX4 A;  4C3H H;  3CCR A;  2JA9 A;  4MTN A;  1I6H B;  4TUY F;  3TRE A;  1HFN A;  1O7Z A;  2NZO A;  5T1G A;  3S2H B;  4QW8 A;  5CBE E;  4L5Q A;  2AQ3 B;  4RGT A;  1I94 L;  2AGQ A;  5L37 A;  1FJG L;  2QKI C;  1QUQ A;  2UXB Q;  3VPB A;  5DG7 A;  1JLL B;  2Y0S G;  4U6P A;  2R93 G;  4A3D B;  4ZI7 F;  4DV5 H;  4IR1 A;  4RCO A;  3Q22 A;  4M9U A;  4JOI A;  4JI0 Q;  3L9A X;  1X9N A;  3PO3 H;  1E4E B;  1IOV A;  1KBL A;  1RJP A;  3MAQ A;  1SRO A;  4K5V A;  2GLT A;  4YP3 A;  4KJO A;  4MHE A;  2ZTD A;  4XQN A;  2V4R A;  1EU3 A;  5FLM H;  3G48 A;  3BDL A;  3N44 B;  3GLK A;  1B6S A;  2FKL A;  3K3V A;  3SHL A;  1KC7 A;  4UY8 C;  4A3C G;  3Q8P B;  1W2B A;  2K01 A;  4I4T F;  2RGR A;  3C1E A;  2YTX A;  3GIK A;  4K5X A;  1UE1 A;  2SNM A;  3UDX A;  3VR6 A;  3FKI A;  4XYO A;  4IJL A;  4R4C A;  5KG5 A;  2PVP A;  2B2V C;  1LTI D;  5JEA G;  2WYO A;  3SR1 A;  3TP7 A;  5I2X A;  1MD2 D;  2AQ4 A;  3TZD A;  5C6A A;  3K7A B;  4C2M A;  3TME A;  3BA8 A;  1B8A A;  3L4J A;  1XTC D;  4YWK A;  1AE3 A;  1BOS A;  1VQD A;  1H9J A;  2LKV A;  3A8I E;  2GPW A;  1VQL A;  3CCL A;  1Y1V A;  4LFB L;  3NQI A;  4KHP L;  1VQI A;  4CDD C;  3S9W A;  3GTL H;  1FR3 A;  2O5I C;  3QJY A;  3RFC A;  4TQR A;  1O7Y A;  4BXX G;  3KBG A;  4XIG S;  4JI0 L;  3KBX A;  1SXT A;  3CCM A;  3NHH A;  4EYH B;  1M8A A;  3BYT B;  4EEQ A;  4A3F H;  4C5B A;  1TR5 A;  5EWE A;  1LYL A;  3ERQ A;  5FLX E;  3KK7 A;  3HOU G;  2F3I A;  2E5L Q;  2ZM6 H;  4WJ4 A;  2VUM H;  4A3I B;  3IFD A;  3E9H A;  3I8Z A;  4XDX A;  1NBW A;  3PUY A;  2FE3 A;  1ONL A;  4YBZ B;  2FLN A;  3NQT A;  1CI3 M;  2DY7 A;  1D7Q A;  2I8C A;  1XMO Q;  3C3L A;  3RNU A;  3GTJ A;  1CQJ B;  4WBN F;  5AFW A;  3TQY A;  1PVO A;  1CKN B;  4QUF A;  3S17 B;  1N48 A;  2EYM A;  4KHZ A;  2QIL A;  1MBY A;  3NBH B;  3J80 L;  1WI5 A;  1NE3 A;  4ED6 A;  1F9Q A;  3B6Y A;  3TP5 A;  1EZ8 A;  3X3M A;  4LF7 H;  3ND8 A;  2G5D A;  2FPG B;  1ZEQ X;  4F8M A;  5L1I A;  1AH9 A;  3QO2 A;  4KHP Q;  1MI2 A;  4HJA A;  4KD4 A;  4DAV A;  1X56 A;  1H9M A;  5ELB A;  1PH3 A;  5DLQ E;  4P71 A;  4O42 A;  1N34 H;  4IO9 A;  4QW9 A;  1WTQ A;  3S2D B;  1JOQ A;  2F0D A;  4HCS A;  5KG1 A;  1TWA H;  2FLL A;  1GD7 A;  3NSW A;  1V9P A;  4RA8 A;  3FP9 A;  4IPD A;  4CC6 A;  3HOX B;  4O2D A;  2JA8 H;  2I5M X;  1Y1W G;  4DAY B;  1PFM A;  3SE7 A;  5KFG A;  1N33 H;  3TP6 A;  4TQS A;  1Y14 B;  2HD3 A;  5K5P A;  4A3J B;  2MJ8 A;  4JYA L;  3KAK A;  4EX5 A;  4RB0 A;  3CXC A;  1JJ2 A;  1D1I A;  3HKS A;  4A75 A;  1K3B C;  2ES2 A;  2A74 C;  2XRQ D;  1WTP A;  2JEJ A;  3MWM A;  4BY1 H;  2WDT A;  1BKB A;  1B6R A;  3T53 B;  3U50 C;  3WNZ A;  3QB3 A;  4DAY A;  2UUC Q;  2BE5 C;  3P7J A;  2A68 D;  1MGS A;  3MXP A;  1JOK A;  1PK8 A;  1BCP C;  5LMU H;  4TRD A;  4LSA A;  2R92 A;  3NGD A;  5KX5 F;  1HA5 A;  4FF1 A;  3DF7 A;  3ULP A;  5FD6 A;  1B33 N;  1HUN A;  4DV6 H;  4A3G H;  2NVY H;  1RKN A;  2A5H A;  2VA2 A;  2RHQ B;  4J9K A;  3T51 B;  4ILW A;  4DNR B;  4EBC A;  2UXD L;  4LF4 H;  2A69 C;  1M90 C;  4Z9C B;  1DD2 A;  1EIH A;  4LFC L;  1KAW A;  4CKC A;  4DF7 A;  1QZG A;  1Y1W H;  4P75 A;  1KLU D;  4DR4 L;  4K0K Q;  4RKB A;  2PZU A;  3CQZ B;  3MZ5 A;  2HHH L;  1IBL H;  3VMM A;  4LF9 L;  2WAC A;  4GNX B;  2XN9 C;  4GKJ L;  3JSL A;  2ZJQ A;  4X3K A;  4P74 A;  3GTQ A;  4OIJ A;  1J8I A;  4HSP A;  1SE3 A;  3I4O A;  5EJW A;  5CA1 F;  2AWN A;  3GTG H;  3K5I A;  3VA7 A;  3DWA A;  4M1U B;  3K0X A;  3SK4 A;  4GOP A;  4B3T L;  1W6K A;  1T5X D;  2YL2 A;  5C1O A;  1UNN C;  3KXY T;  1L0Y B;  1YJ9 A;  4JI6 Q;  2FXQ A;  2CW8 A;  1PRT B;  3AFP A;  2ZXR A;  4O2B F;  2K04 A;  3J80 W;  1DZ1 A;  2O5J C;  1JIC A;  1WD0 A;  4ZHQ F;  4B3R Q;  3TII A;  2B2T A;  2J6S A;  3S2D H;  1NAP A;  1YIT A;  2OWO A;  2VNU D;  2DLN A;  1S9F A;  3AEV A;  4PDB A;  5HUR A;  2VQF H;  1N9W A;  4H44 C;  2KEN A;  2IA6 A;  3TSS A;  5M3F B;  2CZG A;  1PZI D;  2XIW A;  2KCC A;  1V1Q A;  5IYB H;  3JSN A;  1CUK A;  2R93 B;  3LNN A;  3GTK H;  1I50 A;  1TU2 B;  2UU9 H;  2UUC L;  2F0W A;  1Y1V G;  4DU9 A;  5FLX W;  3M4P A;  3S24 A;  5C0X H;  4LF8 Q;  3IKJ A;  2R7M A;  2AGO A;  1U4P A;  4LH7 A;  2W6P A;  1XNR L;  4O3Q A;  4FNF A;  4APM A;  4FF4 A;  3FKI B;  1QUQ B;  5IOD A;  2RHS B;  1KJI A;  2K14 A;  4LF5 H;  1DXM A;  3RF2 A;  1B4O A;  3BG5 A;  1I3Q A;  2VW9 A;  2PI2 E;  3W3A A;  4Q5V A;  1MHW C;  3HOY H;  2AHO B;  4O4I F;  5KFP A;  2TMP A;  4KD3 A;  3UDF A;  3RIZ A;  3MFI A;  2K32 A;  1JXL A;  1IW7 C;  2F0Q A;  1H9R A;  4PNY A;  1WJJ A;  3SE0 A;  5CV8 A;  4BY1 G;  1R4P B;  3SVM A;  2NVT H;  3VYT A;  5KFU A;  2A69 D;  3S17 H;  1WYD A;  4MIU A;  5HV6 A;  1TXY A;  1C4Q A;  1WVL A;  2H1E A;  5IOC A;  1I94 Q;  4C3I H;  5CBA E;  3I4L A;  5KFB A;  1ZQ7 A;  1RIP A;  3BG3 A;  4DV7 Q;  2DN8 A;  2M2L A;  2LSS A;  4JI8 Q;  3RB6 A;  3RLN A;  4JI1 H;  4KKS A;  1RTO A;  2F0H A;  2X6L A;  1Y8P B;  1M0W A;  2KCM A;  2PMZ E;  3R8B A;  1TA8 A;  2Y0S A;  2WII B;  4R4O A;  2I07 B;  2ASB A;  3JAM c;  4A3M G;  3FDT A;  2IX1 A;  1PH8 A;  1JT8 A;  5IWA H;  5EAY A;  5BN3 A;  4N8X 1;  1HJP A;  1FD7 D;  1LV9 A;  4DR5 L;  2JEI A;  1CKN A;  3L0O A;  1I7N A;  4A3I G;  1L0W A;  5D1O A;  4XQQ A;  5EGT A;  2ATW A;  1L2F A;  2ZJR A;  1IBM L;  5JVD F;  2D0O A;  3M4O H;  1LTA D;  4RU9 A;  2IHE A;  3AU7 A;  3MA2 B;  2J6U A;  2F0T A;  2L0C A;  1E4F T;  3Q8D A;  2VR1 A;  2NZH A;  3RLF A;  1H9S A;  4X64 L;  1VQ5 A;  4PZ8 A;  3D31 A;  3CHB D;  5M3F H;  1ILP A;  2DGY A;  3HOW G;  2K1B A;  5D1O B;  4ECZ A;  2ZM6 Q;  2OQ0 A;  2D62 A;  1U9R A;  3RUP A;  5C3E B;  1BBU A;  2IL8 A;  5D3I B;  2JA5 G;  1LAC A;  1RDP D;  2KHJ A;  5KFX A;  3Q23 A;  3NTH A;  3H09 A;  4IPC A;  4YCW A;  4R8I A;  1HNW Q;  1E7Z A;  3M4I A;  3S1M B;  5JAV A;  1QE6 A;  2NU7 B;  3TIG A;  3NEL A;  4M7E A;  1HPC A;  3S14 B;  2RCF A;  4HMJ A;  4YAJ B;  4DV2 Q;  2KA7 A;  2K5D A;  4ECU A;  2UXD H;  1XYI A;  4LF5 L;  5C5J A;  4OWT B;  1EFI D;  2EJM A;  2CCZ A;  1Y1W A;  1VCI A;  3AB9 A;  2D0P A;  5IWA Q;  1KD1 C;  4AH6 A;  3CC4 A;  2YS7 A;  1Q8K A;  1WTH A;  1HA6 A;  4RNN A;  2XSC A;  5JEA J;  1WSC A;  1SMX A;  1K73 C;  2V59 A;  5IGE A;  4DR3 Q;  4JC0 A;  3RD4 A;  4AQY Q;  1FGU A;  5L1L A;  5KFV A;  2YW2 A;  4XX0 B;  4HNT A;  2UVU A;  3OYY A;  1J5E L;  1UE5 A;  1HHV A;  2Q2U A;  2MGS A;  3NBH A;  1UC9 A;  3BQ2 A;  1H9K A;  1PYB A;  3ER0 A;  4P73 A;  3RR5 A;  4DR7 Q;  3V4Z A;  2Y0S B;  2NVQ H;  1A2U A;  2EIF A;  3HS0 C;  3OUZ A;  1TII D;  1FYC A;  2GVB A;  2VXW A;  4R9W A;  2B63 G;  1GM5 A;  2OQK A;  2YTY A;  4X66 Q;  1VQG A;  1A2T A;  4NXM Q;  2PMZ B;  5KFS A;  1S68 A;  1IBM Q;  2O03 A;  3ZJY C;  3MJF A;  2YZG A;  4NLG A;  2HCC A;  4FP5 D;  5LMN H;  2F0F A;  3QOJ A;  4RUA A;  1EEI D;  2YTV A;  3TQT A;  1Q3L A;  2R7F A;  5KFT A;  5IP7 H;  4R4Q A;  5C0X I;  4YAK B;  3A8K E;  2UXB H;  3J7Z C;  1UC8 A;  5CB4 F;  3BVM A;  3AYH B;  3NWT A;  4ZKB B;  4GZY C;  3K80 C;  3KHL A;  5FJ8 H;  4G7O C;  4JI1 Q;  3NPP A;  5GRO A;  1N36 L;  5DG9 A;  2I5L X;  3VR4 A;  4RZQ A;  1LLR D;  2B2U A;  1DON A;  5DM7 3;  3S1Q B;  4UCV A;  1G51 A;  2ID0 A;  4DR4 H;  1UE7 A;  3JAM L;  2W6Z A;  2RDJ A;  3Q1K A;  2L9H A;  1R9T H;  1Q8I A;  3DXJ C;  2UXC Q;  1CKM A;  4RGO S;  1XMO L;  4EGQ A;  4Q8F A;  1WOC A;  4MV1 A;  2ZTC A;  5EWG A;  3KJO A;  2K5Q A;  2R3Z A;  3NTI A;  5C1P A;  4J9M A;  3CF5 A;  2PI2 A;  5KFH A;  2R87 A;  4HJ8 A;  1JOO A;  3LWU A;  2Z8L A;  2R8G A;  3TEH B;  3H20 A;  4JYA Q;  2IY5 B;  3GTP A;  2CWA A;  4A3F B;  4O3R A;  3PUZ A;  1SR3 A;  4IR9 A;  5DLG A;  2XGT A;  2DWC A;  1VS0 A;  1WTV A;  3GV6 A;  5EPK A;  5KT3 A;  1RF2 D;  5C3W A;  2JA7 G;  3FKI G;  4DV2 H;  1TS3 A;  2XWB B;  4ZLT F;  1Y69 U;  2VUM B;  4CDC C;  5FJ8 G;  4HIO A;  4DV5 Q;  1Q12 A;  4DV0 L;  1SSO A;  2R7K A;  1Y1V B;  4CGY B;  2B8F A;  1SEB D;  3V96 A;  1FNU A;  1X3E A;  2H5X A;  2Z0S A;  1QJO A;  3H94 A;  5M3M B;  1O7L A;  1HZC A;  3CC2 A;  1DV2 A;  4UFZ A;  2C00 A;  4KHP H;  3KLS X;  4Q8E A;  1JJC B;  1HR0 H;  4IHJ F;  1SNM A;  1NSN S;  5M3F G;  5BN5 A;  1A15 A;  2VQD A;  5FO8 B;  1N33 L;  4K8J A;  2K5H A;  4UDU C;  4B3S L;  1S97 A;  4JI7 Q;  2R93 A;  3U9S A;  3CPF A;  5A35 A;  5TSS A;  1XXG A;  4PMW A;  3E5N A;  1MSG A;  4RGM A;  1E1T A;  1B70 B;  1BCP B;  5IP9 G;  1SNC A;  4P72 A;  1ZHQ A;  4MA0 A;  5KFN A;  5M9O A;  1JOR A;  4GC7 A;  3M3Y H;  2VY3 A;  4GLV B;  1QNU A;  5I9P A;  1KDB A;  3ETH A;  3W2D A;  2R6G A;  3IFT A;  3T1Y L;  3Q6S A;  5I6W A;  2HCI A;  3VYR A;  1EYD A;  3Q8Q B;  1B9M A;  1S3O A;  4LUZ A;  2RVL A;  3GQB A;  1WH2 A;  4LF7 Q;  4FF2 A;  2R8J A;  1GOZ A;  2N49 A;  3D3R A;  2R82 A;  4RKL A;  2ENB A;  4A3E B;  1B7Y B;  4E4T A;  5C4H A;  2WAQ G;  2R92 B;  4PZ6 A;  3J80 E;  3SK6 A;  1LTB D;  3PQI A;  5K2M A;  3I72 A;  3RJ0 A;  4AIM A;  3D6C A;  3PR4 A;  4XQJ A;  4JK1 C;  3G6E A;  1I94 H;  3QIA A;  4DXF A;  1SFO A;  1DYQ A;  4DV6 Q;  2MO0 A;  3CMA A;  2I87 A;  4AYB E;  1LT3 D;  3OMC A;  2BA0 A;  1T36 A;  2Z6K A;  1JQY D;  4FS1 A;  3R2I A;  2C28 A;  2HUG A;  4DL5 A;  1GUT A;  4QWE A;  3F1Z A;  2R6F A;  3RBE A;  5FKA C;  1JMC A;  1YNN D;  3GIJ A;  1HZA A;  2K05 A;  1A3U A;  3I70 A;  2OTL A;  1VMC A;  1D8L A;  1SN8 A;  1E3P A;  2EYJ A;  1AFP A;  3EVQ A;  4IFD J;  4G7H C;  3UI2 A;  2CWP A;  3GTQ B;  4YY3 Q;  1PFS A;  4ECQ A;  2XVS A;  1JKJ B;  3DEO A;  1JE5 A;  4DK0 A;  4J9O A;  1JCK B;  1V4Y A;  4IFD G;  1B1Z A;  5G3L F;  2PPB C;  5C4X B;  5ELE A;  4LUV A;  2BQR A;  5IY0 A;  4LFA L;  3OUU A;  5I4D A;  4DR2 Q;  2JA7 H;  3PO2 B;  4O4H F;  3GTG B;  5KG2 A;  3RV4 A;  1STN A;  2K5W A;  2EZV A;  1A8V A;  1PA6 A;  2UXB L;  1CT1 D;  4OX9 L;  4JI4 H;  1FNV A;  4XYQ A;  4UHV A;  2V5A A;  1EYC A;  1OWT A;  1ILQ A;  4AYB A;  1Z2P X;  4ETS A;  5M5W H;  1DOL A;  3A5U A;  1JWU D;  1E24 A;  4A3K H;  4UAI A;  3GV7 B;  1Z6H A;  5IYB G;  5H1S E;  3F8T A;  3UE0 A;  4EFE A;  4IRK A;  1Q1B A;  4EEY A;  1BCP F;  4BBR G;  2I5H A;  4HIK A;  4F4Y A;  1ZET A;  2XC9 A;  5JH7 F;  4M8A A;  4C1N K;  4U67 3;  2KCN A;  2RDI A;  1C48 A;  1TWA B;  3HKZ A;  4LF8 H;  2MP1 A;  2F3W A;  3E0J A;  1FJG H;  1K0S A;  3G8C A;  5IIF A;  2QF7 A;  2BDN A;  3T1H H;  2AUK A;  4ED2 A;  4DKA C;  3T1Y Q;  4A93 G;  4LFA Q;  2MNA A;  2R85 A;  1IBK H;  5F9N A;  1Y8N B;  3DHQ A;  2JYO A;  4L1K A;  1HH2 P;  4ABN A;  1B2T A;  2Z6B A;  1PRT C;  2FMC A;  3OWF A;  4PWQ A;  1SNP A;  3KUP A;  1EQR A;  3KOJ A;  1YNJ D;  4F50 A;  2H4O A;  4JI7 L;  2VA3 A;  4DR1 H;  1A0I A;  1OXX K;  4LF5 Q;  2V9W A;  3RMH A;  2SNS A;  3F2C A;  2R8H A;  3DM3 A;  1I7L A;  4K6D A;  1FNW A;  1CQV A;  4EFB A;  1NJI C;  3N6X A;  2NYZ D;  2JE6 I;  3S1R B;  1XPO A;  2R86 A;  1C7Y A;  1NY4 A;  3MXN B;  1XTD A;  5EWF A;  3CVZ A;  1F2Z A;  1K83 A;  3TDQ A;  2IX3 A;  1II3 A;  2XCL A;  3GTQ H;  5BPF A;  5DAU A;  4JG2 A;  3K7U C;  1SYC A;  1B3Q A;  2DJG C;  3S16 H;  3R5F A;  1EOT A;  2MCT A;  4X64 H;  3PW0 A;  4LK1 C;  5L9X A;  4DL4 A;  2ZT9 C;  5D1P A;  1F9S A;  2SEB D;  1SNQ A;  4QGU A;  2ZXP A;  3J80 c;  3T1H Q;  1MJE A;  2UU9 L;  1AP0 A;  2SOB A;  5FPO A;  4JV1 A;  4HN7 A;  5DNF A;  5KFR A;  1V1O A;  4I65 A;  4AYB B;  1BXR A;  4G4K A;  4DV1 L;  1YI2 A;  3HB9 A;  3VPC A;  4C5C A;  3T5H A;  2B3G A;  5IYC G;  2R8I A;  2KED A;  4IPG A;  4K8I A;  4WRD A;  5C5M A;  5JJI A;  3OTO Q;  2B2W C;  1HNZ L;  3VR3 A;  2WFW A;  4C2M H;  3J81 L;  4IUV A;  3MXU A;  1SBB B;  1T5E A;  4A3K B;  3WO1 A;  2DNC A;  4DV3 L;  1I4R A;  5LP6 F;  4L5S A;  5M5X B;  4OO1 H;  1V51 A;  1SJH D;  4X66 L;  1TWG A;  2OH2 A;  4YWL A;  2B8G A;  2WAQ A;  3M7N A;  4HJ7 A;  1HNW H;  5KND A;  4QF4 A;  1GHK A;  3G6Y A;  3J81 E;  4O3N A;  5GAG C;  4DNT B;  1FJG Q;  2JSO A;  4PMC A;  5IT9 E;  2K4K A;  2NTT A;  1J5E Q;  2E2J H;  2SCU B;  4PMB A;  4A2B A;  2ZJP A;  3RN2 A;  4TSS A;  4X62 H;  4RG1 A;  4LNQ A;  4K5W A;  1IL8 A;  4QWA A;  3K81 C;  5T14 A;  4O4L F;  1IBL L;  1UAP A;  1C0A A;  2F0O A;  4C3I G;  5FO9 B;  3VYU A;  1F9P A;  4YWM A;  1ZHS A;  4IWX A;  4IRD A;  5LOV F;  3GTM A;  5I2Y A;  2HJW A;  2A6H D;  1KC8 C;  2IPK D;  4JI7 H;  1KXL A;  2VZA A;  1I3Q B;  2QEX A;  3DEP A;  4MV3 A;  2O2L D;  3EN2 A;  4LFC H;  5FK9 C;  1QCB D;  3ONA B;  3Q2O A;  4JI3 Q;  4OX9 Q;  3GTO H;  3RN5 A;  2CVR A;  4RAY A;  2W7O A;  4JI2 L;  1XPR A;  3KDF B;  2ICE C;  5L1K A;  1E2V A;  3IAY A;  3EFX D;  4B9X A;  5KFO A;  3N52 A;  1IBK L;  1QVC A;  3N42 B;  3R5X A;  4JBK A;  4I50 F;  1S0N A;  1L2Z A;  2Z4I A;  4A3F G;  1Q90 A;  3QOL A;  1ESF A;  3ORR A;  2K5N A;  4DFA A;  3JRX A;  1TY2 A;  3K57 A;  1I50 B;  3CCU A;  4J9S A;  1K83 B;  2NVQ B;  3JRW A;  5KT2 A;  1BCP D;  3L7Z C;  4KY5 A;  2KQ3 A;  2PZW A;  3WOE A;  3K5L A;  3STB D;  5EBD A;  3X3N A;  1HUM A;  2QDB A;  1SND A;  2IWH A;  4KI0 A;  2R84 A;  3PSI A;  4Q44 A;  3N6R A;  4DPG A;  2F4I A;  2D2C C;  5A2Q E;  2OEO A;  4NKL A;  2KUM A;  4PQX A;  2HIX A;  1LO5 D;  3K0Y A;  4NP5 A;  1IKM A;  3OIP A;  2ZDG A;  4L5R C;  1C3O A;  1VQ9 A;  4BA1 I;  3VYS A;  1VQC A;  1W93 A;  3PF5 A;  4JI4 L;  4EQN A;  4KV6 A;  2D9U A;  1YEZ A;  2A6E D;  5M5X H;  3FMA A;  4H0L C;  3S1Q H;  1V1P B;  3HKZ G;  1SMY D;  3WWV A;  2QA4 A;  2YU9 A;  2JEB I;  1R9T B;  1VQ7 A;  3IL8 A;  2CQY A;  1JIH A;  2GA4 B;  5IT9 W;  2CFM A;  4QWB A;  4YHH L;  1GUN A;  3PUW A;  3GIP A;  2HDL A;  1EWI A;  2A6E C;  4GLX A;  3TN2 A;  3ETJ A;  3GTP B;  5L1J A;  1HNX L;  1E2Z A;  1WCM G;  3A74 A;  1C8C A;  1I4X A;  2AUJ D;  4ZK9 B;  2VQE Q;  2Y0S E;  4DV4 Q;  1TQO A;  1BF4 A;  1AEX A;  5HY6 A;  1KEE A;  4NB3 A;  1K0R A;  5LMU L;  3PW2 A;  2EYH A;  4DV2 L;  1D5Z C;  2RSN A;  1PRT D;  4H02 A;  1BNZ A;  2W7P A;  5D14 A;  4NXN Q;  5DQH A;  2W9B A;  1CS0 A;  4E6I A;  3HOZ H;  2AGP A;  3F2U A;  1SYG A;  4ODG A;  4WJ3 M;  2NN6 I;  5CR3 A;  5LMN Q;  2HDM A;  5HGT A;  2JJQ A;  1GGO A;  1NNX A;  2W8K A;  1S0M A;  2JXM B;  2B2V A;  3FRP B;  4YR3 A;  1EYA A;  4LW1 A;  5BR8 Q;  3M4Y A;  1QIL A;  4ZYS A;  4QJF A;  3UQ8 A;  4A93 H;  4X65 H;  3T1Y H;  2K33 A;  3CU7 A;  1OXS C;  3GII A;  3BQ1 A;  3M7G A;  1ZKO A;  2E2I B;  1U5K A;  4L63 B;  5IYD G;  2EPB A;  5FLM G;  3CCE A;  5KFI A;  2JEG A;  4EBE A;  3E9I A;  4FS2 A;  4QL5 A;  1TWG B;  2JA5 A;  1TWH H;  2CH4 W;  4QQB X;  4L5T A;  2UUA L;  1X3G A;  1I5F A;  4IZ8 A;  1OO9 B;  1EYZ A;  2E2J B;  3TQ1 A;  3HOV B;  4EYI B;  5KG6 A;  2E2I A;  4RAZ A;  2BH8 A;  4A3J H;  3H15 A;  3D6W A;  5C4Z A;  1R4Q B;  2HGS A;  3M85 A;  1BDO A;  2K6A A;  4ALP A;  1A3T A;  1EHI A;  3GV5 B;  3MFG A;  4KY6 A;  2BH2 A;  1IBL Q;  4DNI A;  4FM9 A;  1SLJ A;  4LF6 H;  4DL7 A;  1PZJ D;  2F0K A;  5IYD H;  4GKK Q;  5ELF A;  3U9T A;  3L3O C;  3GTP H;  4DUY L;  3SK5 A;  2UUB Q;  1Z47 A;  1G6P A;  1AUX A;  1J5E H;  1YJN A;  2UXD Q;  1F2L A;  1Q46 A;  3PIP 3;  4C3J G;  1RL2 A;  1TVX A;  1SAP A;  4ZKC B;  3G6J B;  4X3U A;  2MPM A;  3NWS A;  3H0G B;  5COR A;  3GTK B;  1N8R C;  4UCO A;  4NXM L;  4A3G B;  5JJL A;  4WD3 A;  4DN4 M;  1F77 A;  5IYC H;  1KRT A;  1WD1 A;  1EL0 A;  4LFB H;  2F0M A;  1XX8 A;  4YIJ A;  1M1K C;  2F0V A;  1ZYR D;  2W9C B;  1ESR A;  4RMF A;  1PFN A;  2NUC A;  5FLX L;  4F87 A;  1Q81 C;  2UUA Q;  4YJ2 F;  2MO1 A;  4IRC A;  1WFQ A;  2L55 A;  4OON A;  3Q24 A;  4K6L A;  4YHH H;  4GOP B;  5EZY F;  2L4N A;  2UVR A;  5NUC A;  3EIV A;  4LFC Q;  3GTM H;  3G4S A;  3BJU A;  3T13 A;  5GON F;  3HOU H;  3IN5 A;  3I4M B;  1OXU A;  5C8Y F;  1Z2N X;  4J9N A;  1AE2 A;  2NU9 B;  2R7Z H;  4RNO A;  4CC5 A;  1A62 A;  1VF5 C;  2PNR C;  3HFZ B;  4LF6 Q;  4OWX B;  1EQV A;  2QEJ C;  1JDB B;  3P75 A;  4F4X A;  2LMC B;  4B3M Q;  2FK1 A;  4PV1 C;  3I2Z A;  4X65 Q;  1RK5 A;  4A3D H;  2Z6K C;  1V8Q A;  5LMN L;  4N9P A;  1WCM A;  1SCU B;  3E3X A;  1LTS D;  5JJZ A;  2KVM A;  1WTR A;  1Q82 C;  1OXT A;  1VQP A;  2XIG A;  2LS0 1;  3MVV A;  3NEM A;  4GLA C;  4J0M A;  3CP0 A;  4YJ3 F;  1KQS A;  1ROD A;  5HBR B;  4BBR H;  3MR2 A;  3FVQ A;  5KT6 A;  4KKT A;  4MA5 A;  2WAQ B;  2XGP A;  5DG8 A;  5EKL A;  4CJ0 B;  2N8N A;  5A2Q W;  2OT2 A;  2WB1 E;  4ECT A;  3J7A V;  3GID A;  1EOV A;  1STB A;  4IUT A;  1CA6 A;  4K14 A;  1IL2 A;  5CAE B;  2R92 H;  1J6Q A;  4MN3 A;  4DV3 Q;  3I4M G;  2K52 A;  2CKZ B;  4JW0 A;  5A2Q L;  5D65 A;  3BAB A;  2X69 A;  4HIM A;  4CBV A;  2CQA A;  5IGF A;  1HR0 W;  1JWS D;  1PMR A;  4DUZ L;  1GLV A;  1KJ9 A;  3RAQ A;  3ZYY X;  1B3A A;  2VL6 A;  2NVX A;  1K1S A;  5CV6 A;  1RHP A;  5CYU A;  2IMW P;  2ZDH A;  1VQA A;  2SDF A;  1WTO A;  2IBK A;  4HMI A;  1F9R A;  4DV1 Q;  2C2D A;  1EY0 A;  1UWV A;  2XCP A;  4ED1 A;  5D8D A;  3UFX B;  2NVT B;  4DUZ Q;  3VPD A;  5M5Y B;  1IYV A;  4B3R H;  3CD6 A;  1VDZ A;  4A3G G;  4OO1 I;  3CRK C;  3A5Z B;  1PX2 A;  1BR9 A;  2E76 C;  3RB3 A;  2FIN B;  3OWE B;  2E5L L;  3O13 A;  2F0G A;  1TWC H;  5M3M G;  3SEB A;  2KHI A;  4BBS H;  4C3J B;  4ECW A;  1TWG H;  2RA4 A;  5CV5 A;  1CZW A;  1RJR A;  1MSH A;  3EPI A;  4ED7 A;  1CSP A;  3CRL C;  2OLS A;  5KYI A;  4B3M H;  4DR2 L;  2JA7 B;  5LL6 X;  3OSP A;  1I6H H;  3K6O A;  1SYX B;  5DQI A;  1W96 A;  3H3V H;  1TWF B;  2EY2 A;  4GNX C;  1O80 A;  1AZQ A;  2AQ1 B;  2K75 A;  1U0L A;  3BJY A;  1STA A;  3ICE A;  1HNZ H;  1EUC B;  4JI6 H;  4R8N A;  1U4L A;  4R4I A;  4RCN A;  2ASD A;  3ULL A;  5JPM C;  4DR3 H;  1SYE A;  1JB7 A;  3N40 P;  4JPB W;  4Y7N B;  4DV1 H;  2F0P A;  3QR8 A;  3S16 B;  5I47 A;  3NBI A;  4HJ9 A;  3BDC A;  1LTL A;  4YHH Q;  3A7A B;  2WP8 J;  3I3C A;  3AMU A;  2C22 A;  4JI3 L;  3HBL A;  1EIG A;  2YU9 B;  5J3B A;  1I4G A;  4MAM A;  1SDF A;  3OW2 A;  3PO2 G;  4IJH A;  3PVX A;  4JI1 L;  4KJN A;  4CHT B;  4H13 C;  1HZB A;  2FFK B;  5C4X G;  1PH9 A;  2XTI A;  3MFY A;  1AUV A;  3ULJ A;  2E75 C;  2K28 A;  4JI3 H;  1KNE A;  1IYJ B;  1TY0 A;  1X6O A;  3MXG A;  4EG0 A;  4QWD A;  2C9O A;  1E1O A;  1SYF A;  1QNK A;  5EPJ A;  2BDO A;  1EWH A;  1GSH A;  1RYR A;  1JE4 A;  1I3Q H;  4ZUJ A;  3K59 A;  2YYZ A;  2MUY A;  4B3T Q;  1IYU A;  2V4D A;  3J7A K;  1Q1E A;  2K50 A;  1D6E C;  1WR2 A;  4Q0F A;  4LF4 L;  2B2Y C;  4DR7 L;  1C9O A;  2NB0 A;  4XYL B;  4GC6 A;  1Q7Y C;  4O0A A;  1RJQ A;  4XZ3 B;  3OSO A;  3HOU B;  5IE8 A;  5G3L D;  4Q45 A;  1YNJ C;  3GTO A;  5IT9 c;  4LFB Q;  1G6Z A;  1STG A;  1BXT A;  1QOH A;  3V6H A;  2E5L H;  1M4V A;  5CV9 A;  1QWY A;  3M4Q A;  4YY3 L;  3K5M A;  1I6U A;  4AQY L;  2K03 A;  3T5K A;  4LF8 L;  2WAQ E;  2KOL A;  3V6K A;  1CE8 A;  3KDF A;  3Q0A A;  3CQZ H;  1PTO D;  1YIJ A;  4RB1 A;  3G7L A;  4JVZ A;  2R8K A;  2F1M A;  2VQF L;  5CC4 A;  3KHH A;  3GTO B;  4NPS A;  4OEL B;  1WCM B;  4A3I H;  2RDH A;  1PTO B;  1N33 Q;  1VBG A;  1NMG A;  2RDF A;  2ZJT A;  3UDG A;  4O3S A;  4JCV E;  3I56 A;  3C46 A;  3HKZ B;  4YR2 A;  1XWE A;  3V2T A;  2NVX H;  3RTX A;  3S15 B;  2EJG C;  4RB3 C;  1YVC A;  5GAH C;  4JBJ A;  5KFE A;  3V05 A;  4EGJ A;  4HID A;  3D4D A;  3JZI A;  4KMU C;  1PHJ A;  1S5C D;  5ELD A;  1Z2O X;  5BPH A;  2J7Z A;  2KEE A;  1N34 L;  1UE6 A;  1JC7 A;  1TAE A;  2JQO A;  2EXD A;  3M3Y B;  4LF9 H;  1PFB A;  4GKJ H;  2L12 A;  2IX0 A;  3K5N A;  2HHH H;  4IUP A;  2NN6 H;  5CGK A;  4LF7 L;  4GKJ Q;  3MEH A;  2UVV A;  2J0T D;  2XD4 A;  4GN4 B;  3PIO A;  1AZP A;  3TZU A;  1GSA A;  4DR5 Q;  1KHI A;  2UXC L;  1CA5 A;  5EPL A;  2CW0 D;  3VDY A;  2HQL A;  1AW7 A;  1V1P A;  1DV1 A;  4NDX A;  4RUC A;  1G29 1;  4WJW A;  3NXW A;  2F4V H;  2C2R A;  2Q8I B;  1PRT F;  4YR0 A;  5IGD A;  2OXP A;  5KFL A;  3A54 A;  3MR5 A;  2QYZ A;  3FPU B;  3AQQ A;  5C4J H;  1VF7 A;  3FKI H;  4DK1 A;  2B63 A;  1A63 A;  3W5O A;  5JVG 3;  5ELO A;  1X3P A;  1YHQ A;  4F7X A;  4B3S Q;  4JI5 L;  4J1M A;  4IFD H;  4MZ9 A;  2ZTE A;  1VQ4 A;  3GIQ A;  4ME5 A;  3VR2 A;  3JAM i;  1FVI A;  3R2T A;  3DLL A;  4JI0 H;  4ZQ3 A;  4ME3 A;  4RHR A;  5CMD A;  3GQC A;  1CK1 A;  1H95 A;  1N32 L;  1O78 A;  2AQ2 B;  5JUM A;  2CW7 A;  2YZN A;  4TV8 F;  3V4S A;  3PZP A;  1DGS A;  2MFI A;  3NTK A;  1ENC A;  2DPI A;  2RBM A;  2VQE H;  4DV4 H;  5KFK A;  1X65 A;  1GUS A;  1TWA A;  4IUR A;  2EYO A;  1UEA B;  1X3Q A;  3CKI B;  4FXD A;  1BBW A;  3MR6 A;  1TS2 A;  2LXJ A;  5EQ0 A;  2CQO A;  5LXT F;  1PYS B;  1VAJ A;  1MJC A;  2UU9 Q;  1EY5 A;  5KGU A;  1L1O A;  2X6G A;  1I4H A;  1B53 A;  1WTW A;  4ECX A;  3G71 A;  1MZB A;  2XGQ A;  1FKA H;  1GKH A;  2P0A A;  2ATL A;  2LXK A;  1B50 A;  1IW7 D;  4OHJ A;  2NVX B;  3PW7 A;  3QZ8 A;  2A8V A;  2OF1 A;  2I80 A;  3MFH A;  3MR3 A;  4A3K G;  4LF6 L;  4FBU A;  4B3S H;  4G7Z C;  2D5D A;  2C5C A;  5I9O A;  5KFY A;  3DMU A;  5DLF A;  3SK8 A;  2F0N A;  1K28 A;  3CAM A;  2FJ2 A;  2BR0 A;  5LMU Q;  1PH1 A;  4RAU C;  3I91 A;  1V43 A;  3PIO 3;  3C1F A;  2KCT A;  3J7A F;  1X54 A;  2B2U C;  2E2I H;  3T56 B;  4FBT A;  2MQH A;  2EJF C;  1TWH B;  2R7L A;  4DV0 H;  2PQA A;  4QY7 A;  4XYM B;  4HSV A;  2Q8R E;  5GAE C;  1F2M A;  1ZYR C;  5IGG A;  4JV5 H;  4O3O A;  3ND9 A;  4OL7 A;  4CDF C;  1S4Z A;  3I4N B;  3EPG A;  2R7D A;  4P2C B;  1P16 A;  4X3T A;  2W9C A;  2JEF A;  1KDA A;  1S5E D;  4IUQ A;  3J81 j;  4HJ5 A;  1NMF A;  1ULZ A;  2L11 A;  4UCR A;  1D5M C;  5ELC A;  4H7B A;  2BQU A;  5C44 B;  3SXH A;  1GJX A;  1E0B A;  4OIK A;  1EU4 A;  1BQQ T;  1YNX A;  4LF9 Q;  4IOA A; 
#chains in the Genus database with same CATH homology
 1CKN A;  1EWI A;  5C3E G;  4GLX A;  1E22 A;  1HR0 Q;  3L0O A;  4A3I G;  3M9B A;  1L0W A;  1SE8 A;  1VQH A;  3U58 A;  1HNX L;  2I0Q A;  1L2F A;  1WCM G;  4A3J G;  2ZJR A;  3A74 A;  1IBM L;  2ATW A;  5GAD C;  1XMQ L;  2D0O A;  3M4O H;  4R4T A;  2RF4 A;  2B29 A;  2IHE A;  1SFO H;  4X62 L;  3HOX G;  4LWC A;  3Q8D A;  2VQE Q;  2Y0S E;  4DV4 Q;  2NZH A;  3RLF A;  1LUZ A;  5HY6 A;  4X64 L;  3S15 H;  4NB3 A;  1K0R A;  3D31 A;  4PZ8 A;  5LMU L;  1VQ5 A;  1K8A C;  1YJW A;  5M3F H;  1VQF A;  2DGY A;  1EUJ A;  4DV2 L;  2YV5 A;  3HOW G;  4H02 A;  3I55 A;  3H0G G;  4JI8 L;  4NXN Q;  3J7A 5;  1NTG A;  4YCU A;  3KJP A;  2ZM6 Q;  2OQ0 A;  2ALY B;  2D62 A;  1YBY A;  2IT1 A;  4DK3 C;  3HOZ H;  4DR6 Q;  1BBU A;  4WJ3 M;  2NN6 I;  2JA5 G;  5LMN Q;  2L15 A;  2KHJ A;  1S72 A;  2JJQ A;  4IPC A;  4YCW A;  4DV5 L;  1HNW Q;  1E7Z A;  4DR6 L;  4DR3 L;  3W1B A;  1QZH A;  3I4M H;  3NEL A;  2BA1 A;  3I7F A;  2Q2H A;  1VQE A;  4LW1 A;  4DV2 Q;  5IWA L;  4JI2 Q;  1VQ8 A;  5BR8 Q;  4BA2 I;  1MKH A;  4QJF A;  4LF5 L;  4A93 H;  4OWT B;  3H0G H;  2CCZ A;  5K36 G;  1VCI A;  1OXS C;  2D0P A;  1VQB A;  5IWA Q;  1VQO A;  4APV A;  4POF A;  1KD1 C;  4AH6 A;  3CC4 A;  3RZD H;  1Q8K A;  5FLX c;  5JEA J;  1U5K A;  5IYD G;  3CCE A;  5FLM G;  1SMX A;  3HOV G;  1K73 C;  1XNR Q;  3S1M H;  3E9I A;  4DR3 Q;  4JC0 A;  4QL5 A;  4AQY Q;  1FGU A;  1TWH H;  1XNQ L;  3E0E A;  2Q2T A;  4QQB X;  4L5T A;  2UUA L;  3OYY A;  1J5E L;  1UE5 A;  1I5F A;  1X3G A;  2R7Z G;  3CPW A;  2Q2U A;  1EIF A;  1PYB A;  3ER0 A;  4P73 A;  3RR5 A;  5C0X G;  4DR7 Q;  2HT1 A;  2NVQ H;  2EIF A;  2GVB A;  2BH8 A;  1WCM H;  2JK8 A;  4KLK A;  3H15 A;  2A1A A;  2VQE L;  2AWO A;  4DV4 L;  4A3J H;  2B63 G;  3M85 A;  1GM5 A;  1LM0 A;  2OQK A;  2YTY A;  3GD7 A;  4X66 Q;  4BY7 H;  1VQG A;  4ALP A;  2N78 A;  1K8G A;  4NXM Q;  3PUV A;  1K9M C;  3FHW A;  5C44 G;  5C0X J;  3S1R H;  4DR1 L;  1IBM Q;  2BH2 A;  3ZJY C;  4OXP A;  1VQ6 A;  1IBL Q;  4DNI A;  1SLJ A;  3TRZ A;  2PNH A;  2YTV A;  3F2B A;  1Q86 C;  4BXX H;  5IYD H;  1L1O B;  2R7F A;  1HNX Q;  2E2H H;  4GKK Q;  5IP7 H;  3GTP H;  3IRB A;  4DUY L;  4R4Q A;  2UUB Q;  1Z47 A;  3RLO A;  1G6P A;  2AKW B;  3J81 i;  1YJN A;  5C0X I;  1Q46 A;  4JI6 Q;  2UXD Q;  1RL2 A;  3J7Z C;  4DV0 Q;  3I4N G;  3AYH B;  1N8R C;  4NXM L;  3K80 C;  5JJL A;  5FJ8 H;  4JI1 Q;  5GRO A;  1N36 L;  3PF4 A;  2I5L X;  5IYC H;  1KRT A;  1N34 Q;  4IFD I;  3UE1 A;  5BR8 L;  1M1K C;  4JOI C;  1G51 A;  2ID0 A;  2R92 G;  1UE7 A;  4A3E G;  5M5Y H;  1EQQ A;  4RMF A;  2UUA Q;  1R9T H;  1Q81 C;  4DR4 Q;  2MO1 A;  1CKM A;  1WFQ A;  4K0K L;  2UXC Q;  4OON A;  1XMO L;  1XNQ Q;  2GVA A;  1WOC A;  4Y7N H;  2ZTC A;  1OTC A;  1JJG A;  3ERS X;  3KJO A;  4GOP B;  3RZO H;  3EIV A;  4LFC Q;  3GTM H;  4A3D G;  3PGZ A;  2PI2 A;  3CF5 A;  4XTC S;  4HJ8 A;  3G4S A;  3BJU A;  3UDI A;  4B3M L;  3HOU H;  2VUM G;  5GQO A;  3TEH B;  1T9H A;  1OXU A;  4JYA Q;  2IY5 B;  2CWA A;  5AJ3 Q;  1AE2 A;  4YCV A;  4GNX A;  3PUZ A;  2R7Z H;  1SR3 A;  4PZ7 A;  2XGT A;  1VS0 A;  1A62 A;  2JA7 G;  3FKI G;  3PCO B;  3HFZ B;  3SGI A;  4A4I A;  4LF6 Q;  4OWX B;  4X64 Q;  5FJ8 G;  1ASY A;  1VQN A;  3CCS A;  4B3M Q;  3KF6 A;  3HOX H;  4HIO A;  1QVF A;  3I2Z A;  4X65 Q;  4DV5 Q;  2B63 H;  1Q12 A;  4DV0 L;  1HNW L;  4A3D H;  2Z6K C;  1GVP A;  5IP7 G;  5LMN L;  1OXV A;  1X3E A;  2Z0S A;  2H5X A;  3CC2 A;  1HZC A;  1L1O C;  3CCJ A;  1Q82 C;  3F2D A;  1OXT A;  4GN5 A;  1JJC B;  5C3E H;  1VQP A;  3NEM A;  4GLA C;  5M3F G;  3CP0 A;  2AMC B;  1X55 A;  1N33 L;  3TS2 A;  2OTJ A;  3CC7 A;  4JI6 L;  1KQS A;  4A3L G;  2K5H A;  3CCV A;  4BBR H;  4LF4 Q;  4A3B H;  4B3S L;  4PG3 A;  2JA5 H;  1CKO A;  2VQF Q;  4JI7 Q;  4IPH A;  2E8G A;  3CPF A;  1PH6 A;  4PMW A;  2N8N A;  2V1C C;  3A0J A;  5M3M H;  4C3J H;  1E1T A;  2WB1 E;  1B70 B;  4DV6 L;  2JA8 G;  4TVA B;  1EOV A;  5IP9 G;  4P72 A;  4DUY Q;  2UUB L;  1IL2 A;  4A3C H;  4C3H H;  3CCR A;  2JA9 A;  4MTN A;  3M3Y H;  1XMQ Q;  2R92 H;  1PH4 A;  1N32 Q;  1J6Q A;  2VY3 A;  4GLV B;  2NZO A;  3TRE A;  5JJK A;  4DV3 Q;  4GOP C;  3I4M G;  2K52 A;  4GKK L;  2CKZ B;  3OTO L;  2R6G A;  4TQU S;  4HIM A;  4L5Q A;  3T1Y L;  1HR0 W;  1I94 L;  4DUZ L;  4JI5 Q;  3TS0 A;  1FJG L;  1S3O A;  1QUQ A;  2VL6 A;  4LUZ A;  4LF7 Q;  2UXB Q;  1O7I A;  1VQA A;  2N49 A;  2Y0S G;  4DV1 Q;  4DAM A;  2R93 G;  1VQK A;  1UWV A;  1B7Y B;  2WAQ G;  4PZ6 A;  4JOI A;  4UP8 A;  4JI0 Q;  4DUZ Q;  1X9N A;  1PH2 A;  3PO3 H;  1YHB A;  4AIM A;  4DV7 L;  1SRO A;  4X6A H;  3KF6 B;  3CD6 A;  4A3G G;  4OO1 I;  2ZTD A;  3A5Z B;  2HHH Q;  3BZK A;  1W3S A;  3G6E A;  5FLM H;  2KBN A;  3G48 A;  4DV6 Q;  3KLW A;  2MO0 A;  2F4V Q;  3CMA A;  2E5L L;  4AYB E;  1TWC H;  5M3M G;  1SRU A;  2BA0 A;  2N3S A;  4UY8 C;  2JA6 G;  4A3C G;  1W2B A;  2Z6K A;  2KHI A;  3HKZ E;  4BBS H;  2YTX A;  3UDX A;  1UE1 A;  3JC6 6;  3K8A A;  1TWG H;  4IJL A;  4A3M H;  4R4C A;  3F1Z A;  3PUX A;  1CSP A;  4A3L H;  4DR2 L;  4R1J A;  3T1H L;  1JMC A;  1I6H H;  1HZA A;  5JEA G;  2OTL A;  3H3V H;  5AJ3 L;  4GNX C;  1D8L A;  4X62 Q;  1SN8 A;  1E3P A;  2K75 A;  1U0L A;  4OO1 G;  3ICE A;  4IFD J;  2CWP A;  1B8A A;  4YWK A;  4R4I A;  4YY3 Q;  1AE3 A;  1PFS A;  2JA6 H;  3ULL A;  1JE5 A;  1VQD A;  1JB7 A;  4IFD G;  1VQL A;  3CCL A;  3AFQ A;  4LFB L;  4KHP L;  1VQI A;  1IZ6 A;  4LUV A;  2DUD A;  4UP7 A;  4NXN L;  1LTL A;  5IY0 A;  4HJ9 A;  4LFA L;  4YHH Q;  4DR2 Q;  2JA7 H;  3GTL H;  2WP8 J;  4A3E H;  4BXX G;  4XIG S;  4JI3 L;  4JI0 L;  5J3B A;  1UEB A;  3CCM A;  1A8V A;  3OW2 A;  3PO2 G;  4IJH A;  4EQ5 A;  1PA6 A;  2UXB L;  4OX9 L;  3PO3 G;  4A3F H;  4Y52 H;  4JI1 L;  1LYL A;  3HOU G;  1HZB A;  4JBM A;  4A76 A;  2F3I A;  2E5L Q;  1PH9 A;  1YZ6 A;  2XTI A;  5C4X G;  4WJ4 A;  5M5W H;  2VUM H;  3A5U A;  3E9H A;  3ULJ A;  3MEF A;  1E24 A;  3D0F A;  1NBW A;  4IOC A;  3PUY A;  4A3K H;  4B3R L;  1IYJ B;  1X6O A;  1D7Q A;  5IYB G;  5H1S E;  3F8T A;  1XMO Q;  1E1O A;  3UE0 A;  3S2H H;  3RNU A;  1Q1B A;  1XPU A;  3J80 i;  3TQY A;  1PVO A;  4BBR G;  1I3Q H;  1X3F A;  2I5H A;  4HIK A;  1EYG A;  1HNZ Q;  2YYZ A;  4B3T Q;  1CKN B;  2OCE A;  1Q1E A;  4MNO A;  3H3V I;  4KHZ A;  2K50 A;  3NBH B;  4J15 A;  1WI5 A;  1NE3 A;  3PV0 A;  3B6Y A;  3HOZ G;  4GN3 B;  4LF4 L;  3HOY G;  1C9O A;  2C35 B;  4DR7 L;  2Q2I A;  1Q7Y C;  1AH9 A;  4O0A A;  4GS3 A;  4KHP Q;  4LF9 Q;  4DKA C;  3CME A;  4HJA A;  5IE8 A;  4QIW E;  3T1Y Q;  4A93 G;  4LFA Q;  3NEN A;  2MNA A;  4A3B G;  1X56 A;  1PH3 A;  5DLQ E;  4P71 A;  3BZC A;  5IT9 c;  5C4X H;  4IO9 A;  4LFB Q;  2JEA I;  1HH2 P;  2RCN A;  3PO2 H;  3KYH C;  3M4Q A;  1TWA H;  1BVS A;  4YY3 L;  4AQY L;  4JBW A;  2IHF A;  1GD7 A;  4LF8 L;  2WAQ E;  4BY7 G;  3HOV H;  1V9P A;  1EFW A;  3FP9 A;  4IPD A;  3KDF A;  1EQR A;  3CQZ H;  1YIJ A;  4O2D A;  2JA8 H;  3KOJ A;  2I5M X;  1Y1W G;  4DAY B;  2VQF L;  4JI7 L;  1A0I A;  1OXX K;  1Y14 B;  4NPS A;  4LF5 Q;  4A3I H;  3F2C A;  4EX5 A;  1N33 Q;  4JYA L;  3DM3 A;  3S1N H;  1NMG A;  3GTJ H;  3CXC A;  1NJI C;  1JJ2 A;  3HKS A;  2JE6 I;  4A75 A;  3UDG A;  1XPO A;  4JCV E;  3I56 A;  2ES2 A;  5LMN W;  1C7Y A;  1VQJ A;  1NY4 A;  3MXN B;  1XTD A;  4BY1 H;  1BKB A;  2NVX H;  1YVC A;  3U50 C;  5GAH C;  4JBJ A;  2ZM6 L;  3GTQ H;  3I4N H;  2UUC Q;  4HID A;  3K7U C;  4JG2 A;  1PHJ A;  4OWW B;  1IBK Q;  3BU2 A;  3S16 H;  3LGJ A;  1N34 L;  5ELN A;  1UE6 A;  3ULP A;  4QGU A;  3J80 c;  2JQO A;  1MJE A;  2K5V A;  3T1H Q;  2EXD A;  2UU9 L;  4A3G H;  2NVY H;  3CW2 C;  2IX0 A;  4DV1 L;  1YI2 A;  2RHQ B;  4DK6 C;  4GKJ Q;  4LF7 L;  2UXD L;  3S14 H;  2B3G A;  1M90 C;  2EQS A;  5HGQ A;  5IYC G;  4IPG A;  5JJI A;  3GDE A;  3OTO Q;  4LFC L;  1KAW A;  1HNZ L;  2WFW A;  4C2M H;  4GN4 B;  3PIO A;  3W1G A;  1QZG A;  1Y1W H;  4DR5 Q;  4P75 A;  1KHI A;  4DR4 L;  4K0K Q;  3K7A H;  3VDY A;  4DV3 L;  2HQL A;  2HHH L;  2UXC L;  1HR0 L;  1VQM A;  1G29 1;  1KL9 A;  4L5S A;  1KIX A;  4LF9 L;  4GNX B;  4GKJ L;  2ZJQ A;  4P74 A;  3AQQ A;  4X66 L;  5C4J H;  3FKI H;  4YWL A;  3U4Z A;  1K83 H;  3M7N A;  4HJ7 A;  3I4O A;  2NN6 G;  3J81 c;  1A63 A;  3W5O A;  4JV5 L;  2AWN A;  1HZ9 A;  3GTG H;  5ELO A;  1PH5 A;  1YHQ A;  4GOP A;  3K0X A;  4B3T L;  4B3S Q;  5GAG C;  4JI5 L;  1FJG Q;  4MZ9 A;  1Z9F A;  1YJ9 A;  2K4K A;  2ZTE A;  2FXQ A;  1VQ4 A;  1J5E Q;  2E2J H;  3JAM i;  2PQA B;  3AFP A;  1FVI A;  3DLL A;  2ZJP A;  3RN2 A;  3KFU A;  4ME3 A;  4FDB A;  2QGQ A;  4RG1 A;  4LNQ A;  1N32 L;  1H95 A;  3K81 C;  4B3R Q;  1IBL L;  3S2D H;  1DGS A;  2MFI A;  1C0A A;  1YIT A;  2OWO A;  4YWM A;  2VNU D;  3AEV A;  1X65 A;  1KC8 C;  4AYB G;  1N9W A;  1KXL A;  2HIV A;  2KEN A;  2VZA A;  1P8L A;  2QEX A;  3EN2 A;  1BBW A;  2LXJ A;  3EBE A;  2CQO A;  3KF8 B;  2F52 A;  4JI3 Q;  1PYS B;  4OX9 Q;  3GTO H;  1V1Q A;  5IP9 H;  5IYB H;  1MJC A;  3RN5 A;  1CUK A;  2UU9 Q;  4JI2 L;  1XPR A;  3KDF B;  1ASZ A;  1L1O A;  4JI4 Q;  3GTK H;  3G71 A;  2UUC L;  4UPA A;  1Y1V G;  1GKH A;  3M4P A;  3S24 A;  1IBK L;  1QVC A;  4LF8 Q;  4JBK A;  2LXK A;  4A3F G;  4POG A;  2YU9 H;  2K5N A;  1XNR L;  1QUQ B;  3CCU A;  1KRS A;  2RHS B;  2VS1 A;  4LUO A;  4X65 L;  2K14 A;  2A8V A;  3U4V A;  3L7Z C;  1MIU A;  4A3K G;  4LF6 L;  2VW9 A;  2PI2 E;  2R93 H;  3GO5 A;  3HOY H;  2AHO B;  1N36 Q;  3STB D;  1YHA A;  4UP9 A;  3UDF A;  3CAM A;  5LMU Q;  1PH1 A;  4KI0 A;  1V43 A;  1WJJ A;  1K3R A;  2KCT A;  4BY1 G;  1X54 A;  2NVT H;  3PSI A;  2E2I H;  3S17 H;  1QVG A;  4DPG A;  1WYD A;  1S40 A;  1PH7 A;  3L2P A;  2MQH A;  1TXY A;  2GN5 A;  1I94 Q;  2A19 A;  4C3I H;  1FL0 A;  5C44 H;  1XJV A;  2HIX A;  2PQA A;  1RIP A;  4QY7 A;  3STB C;  4DV7 Q;  4L5R C;  4JI8 Q;  2LSS A;  4BA1 I;  1PV4 A;  3PUW A;  3RLN A;  5GAE C;  1VQC A;  4DR1 Q;  1VQ9 A;  3PF5 A;  3PIP A;  4BBS G;  4JI4 L;  1CSQ A;  1Y1V H;  1YEZ A;  2R7D A;  5E7N A;  5M5X H;  1GO3 E;  1P16 A;  4JV5 Q;  4HJ5 A;  3S1Q H;  3J81 j;  1NMF A;  3HOW H;  3HKZ G;  2KCM A;  2PMZ E;  3WWV A;  2F4V L;  2QA4 A;  4R4O A;  1IXR A;  2JEB I;  2ASB A;  1VQ7 A;  3JAM c;  2WB1 G;  1EIY B;  1TWF H;  4A3M G;  2IX1 A;  2CFM A;  1PH8 A;  4YHH L;  1JT8 A;  3CCQ A;  5EAY A;  1YNX A;  1I50 H;  1HJP A;  4DR5 L;  4IOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...