3HOWG

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 31
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3howG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3howG01
2PI2A 1LUZA 2BH8A 2JA5H 1BBUA 4JI6L 1UE6A 4NPSA 4R4IA 4A3KG 3S15H 1K3RA 2VS1A 5FJ8G 4JI2L 2RCNA 2D0PA 3EBEA 1PFSA 1YEZA 2I5LX 4K0KQ 4GOPC 4GLXA 4LWCA 2OQKA 1TXYA 4RG1A 3J81c 4K0KL 1N32Q 5EAYA 4P74A 1IBKL 3BU2A 4NXML 3GTLH 3UE0A 2VNUD 3D0FA 4DUZL 2IX1A 3CCLA 1EIYB 3CPWA 3CF5A 5M5WH 3TS2A 4IOAA 2GVAA 3FKIH 1IL2A 4AH6A 5DLQE 4GLVB 3GTQH 2IY5B 5C44G 4QY7A 4DR1L 1BVSA 1E3PA 2KENA 4JYAL 2WB1E 2HT1A 2ZM6L 1Q8KA 2YV5A 4IPCA 1GD7A 3MEFA 4IJHA 1AE3A 1G291 3I7FA 3ER0A 4JV5Q 3D31A 4UY8C 1K0RA 1CKOA 2UUCL 3CQZH 4P71A 4TVAB 5GADC 1KRTA 5J3BA 5IT9c 1X55A 1CKMA 1A62A 4PZ7A 2B29A 3L7ZC 4ALPA 1GVPA 1N34L 3I55A 1X9NA 2FXQA 3I4OA 1KAWA 2AWNA 1VQLA 3OW2A 2Q2UA 3HOZG 1Y1VH 4P75A 3S1MH 3RLOA 5LMUQ 3STBC 3H3VI 4KLKA 3UE1A 5M3FG 4LF5L 1HNWQ 3L0OA 1YIJA 1L1OA 2NN6I 4LUOA 4AIMA 3JAMc 1N36L 3PO2G 4IO9A 3M7NA 1HNZQ 1T9HA 3KF8B 4B3SL 1DGSA 3CCJA 1Y1WG 3CCVA 1M90C 3CCEA 4YY3L 3WWVA 4IJLA 2ID0A 3T1HQ 2E2IH 4B3TL 4GOPA 3HOZH 3S2HH 2AMCB 4A3MG 1IYJB 4LF9L 4DV1L 3PUVA 2MNAA 3UDFA 2Z6KA 3HKZE 2N78A 3UDXA 3G6EA 2JQOA 1N33L 2E5LL 1LTLA 3A5UA 4GNXC 4NXNQ 3KDFB 1PH3A 1GM5A 4APVA 1AE2A 3HOXG 1YJ9A 4NXMQ 4X65L 2Z6KC 4A3BG 4POGA 2RF4A 2UXCL 2F4VL 4HIDA 3K7AH 3PGZA 4NB3A 3U4ZA 1PH8A 3HOWG 3FP9A 2C35B 3G71A 1XNQL 1JMCA 2B63H 3I56A 3EIVA 1Q7YC 4ME3A 5ELOA 2VQFQ 3FKIG 2Y0SG 3EN2A 3KOJA 2CWPA 5BR8L 4JBKA 4LFCQ 3HKSA 5C3EH 4DR6Q 3PO3H 2QEXA 1XMOQ 4XIGS 4X6AH 4EX5A 5FJ8H 4A4IA 3TS0A 3W1GA 2YTYA 5BR8Q 1ASZA 4GKJQ 1B8AA 4BA1I 5M3MG 1VQPA 4BXXG 1L0WA 3F1ZA 2MQHA 4JC0A 4DV4L 3CC2A 4H02A 2ATWA 2R7ZG 2R7FA 2JA8H 1WCMH 3JC66 4BY1G 5LMNQ 1JJ2A 3S1NH 4LF8L 1QUQA 1EIFA 4YY3Q 3T1HL 4DR7L 1X65A 4JI2Q 1NY4A 2B63G 2V1CC 4LF9Q 2NZHA 3J80c 4PZ6A 2JA6H 4GLAC 1S40A 5M3MH 4LNQA 1SFOH 4AYBE 5HY6A 1GO3E 4QIWE 2B3GA 4HIKA 4A76A 4DR3Q 2ES2A 4JI0L 4POFA 1Q1EA 5IP7G 3S1QH 1NBWA 3CCSA 1D8LA 4A3JH 1IBML 1EFWA 4PZ8A 4DR3L 4JI0Q 1YITA 4A3EG 4JBWA 3GTOH 5C4XG 4OXPA 2YU9H 3GTJH 2F4VQ 1VQGA 3A74A 4YCUA 2I0QA 1V9PA 4JI1Q 3NBHB 1HZBA 2WAQG 3KYHC 1XNQQ 1LM0A 2HHHQ 4C2MH 1PV4A 1VQEA 1VQDA 4JI5L 1HR0Q 3KF6B 2HHHL 4A75A 1WI5A 4HIOA 1W3SA 3M85A 3CP0A 1OXSC 3RZDH 2WAQE 1WJJA 2PNHA 3GD7A 1TWFH 1Y14B 3RN2A 4BBRG 4GNXA 1PHJA 3U58A 4DR5Q 1P8LA 1UE1A 5LMNL 1Q12A 4GN3B 1VQIA 2PQAB 2YTVA 4DV7L 1PH7A 4O0AA 1FJGL 1Y1WH 1Q81C 3FHWA 3CCRA 2BH2A 4DR7Q 3RLNA 2UUAL 1KHIA 2JE6I 1C9OA 1EWIA 2OQ0A 3KF6A 3MXNB 4JBJA 5C0XJ 3H0GH 4OONA 1NMGA 3HOVG 1SN8A 3DLLA 3K80C 1K8AC 1N36Q 5IYDG 1Q82C 3RNUA 1M1KC 3W5OA 1K9MC 2GVBA 3J7ZC 1CKNA 2NVYH 5LMUL 4DV2L 4A3FG 2VL6A 2DUDA 1TWAH 2NZOA 2PMZE 1HZCA 3BZKA 3A0JA 1N9WA 1VQ7A 4A93H 2EQSA 4FDBA 1HJPA 4C3IH 1Z9FA 1R9TH 4DV0Q 2JJQA 1SRUA 2A19A 2BA1A 2NN6G 5GAHC 3U50C 2QA4A 1HNZL 3CCUA 3I2ZA 1B7YB 5GAGC 1C0AA 2K14A 3I4NG 3B6YA 4X66Q 4HJ9A 4X62Q 1SE8A 4QL5A 3KJPA 4L5SA 4A3KH 3H3VH 2E5LQ 2K5NA 1YZ6A 4YWMA 4HIMA 2MO1A 3Q8DA 1GKHA 4DR1Q 3AQQA 3OTOQ 4OX9L 1Q86C 4C3JH 3TREA 5IYBG 1IBMQ 2UXCQ 2EIFA 3PCOB 4NXNL 2F52A 2OCEA 1MIUA 2K52A 1P16A 4UP7A 2K5VA 1VQFA 1ASYA 4J15A 2JA8G 4R4TA 3H15A 4LF4L 3DM3A 1PYSB 1PH4A 1D7QA 4Y7NH 2JA5G 3J81i 1I94Q 5JJLA 3M9BA 1Q1BA 2JA7H 4IFDI 1E1OA 3HOUG 3KFUA 5LMNW 3I4MH 4LFAQ 3PUXA 2R93G 2NVQH 4XTCS 5AJ3Q 4DR2L 3ZJYC 4A3GG 4DV4Q 4A3FH 4OWWB 3T1YQ 4MTNA 3M4QA 4KHPQ 3HOXH 1G6PA 4DV2Q 1PH5A 5C0XI 4YWLA 1XJVA 3AYHB 3KDFA 4DV7Q 4GNXB 1UEBA 1WCMG 1PH1A 4BY1H 4JI4L 2R92G 3GDEA 5IP9H 4HJ5A 2Y0SE 3G4SA 1QZHA 1TWGH 4A3CH 1CSQA 1RIPA 5IWAQ 4JI8Q 4HJ8A 4DV1Q 4BBSG 2UUBQ 2UXDL 1VQJA 3U4VA 4L5TA 1SROA 4IOCA 1A63A 1YBYA 1HH2P 1VQOA 1I6HH 1CKNB 4X64L 1QVFA 5JEAG 1K83H 1FGUA 1MJEA 2K4KA 4JI3Q 4B3RL 1MJCA 3PUZA 4P73A 1X3EA 5E7NA 4LW1A 4DKAC 2R7DA 4HJAA 1E7ZA 2PI2E 2VQEQ 3UDGA 3JAMi 1XMQL 1L1OB 1EUJA 1NJIC 1C7YA 1BBWA 3OYYA 4YCVA 1XTDA 4A3IH 4A3CG 5JJKA 2N49A 5FLXc 5FLMG 3RLFA 2AWOA 2CCZA 3CC4A 4KI0A 5IYCG 2Q2HA 2VQFL 4MNOA 4DAMA 3S16H 1TWCH 4O2DA 3AFPA 1IXRA 5M3FH 1OXXK 2ALYB 2UUCQ 3ICEA 4KHZA 3ULJA 3GTGH 4WJ4A 1I5FA 4DAYB 1K73C 4LF4Q 2K50A 4HJ7A 2JK8A 4GN5A 4A3EH 2VZAA 3ULPA 4BA2I 1X3FA 4AYBG 4JG2A 2K5HA 2R6GA 3L2PA 3S1RH 1XPRA 1PH6A 1EQQA 4BBSH 1HR0W 3RN5A 4QGUA 1JE5A 5C44H 1VQ4A 5C3EG 3PV0A 1JJCB 2YTXA 3UDIA 1V43A 4DUYQ 4YHHL 4LF6Q 1SMXA 1IBLQ 1OTCA 1JB7A 2VUMH 1E22A 3KJOA 4LFBQ 4Y52H 4EQ5A 1IBLL 4LUVA 3PIPA 1N32L 4LF8Q 2GN5A 2Q2IA 2OTLA 1YVCA 4L5RC 2L15A 1VCIA 3SGIA 1HNXQ 2AHOB 3BJUA 4JI7L 3HOWH 1I3QH 2EXDA 4GOPB 4A3BH 1RL2A 2LSSA 5M5XH 3F2DA 2JA7G 4DV3Q 5C4JH 1HNXL 3KLWA 2UXDQ 5IYCH 3S14H 3M4OH 4DPGA 4JOIC 4OO1I 4DV3L 4R1JA 4R4OA 3HOUH 2KCTA 1PVOA 1CSPA 4YCWA 4X62L 1S72A 3AEVA 1JJGA 3VDYA 1KIXA 4OWTB 2VUMG 2UU9Q 4X65Q 3HOYG 2CQOA 1Q46A 5M5YH 2HQLA 4BY7G 4WJ3M 4JV5L 1VQ9A 1NTGA 3RZOH 1E24A 3CW2C 4A3MH 4B3MQ 4DR4Q 4JI1L 4YWKA 3K7UC 2IHEA 4A3DG 1UE7A 3I4NH 5AJ3L 4DR2Q 3J7A5 2BA0A 3HOVH 3CMAA 2JEAI 4AQYL 4DK3C 1HZ9A 5IY0A 3PF5A 4UPAA 3GTPH 2KCMA 2HIVA 1QVCA 1I50H 2ZM6Q 1KC8C 1MKHA 4DNIA 3ERSX 3S17H 1XMOL 3W1BA 4DUYL 4LF6L 4R4QA 2I5HA 1NE3A 2WB1G 3IRBA 4BY7H 3BZCA 2I5MX 1V1QA 2VW9A 2ZJPA 1U5KA 1J5EL 1CUKA 1SR3A 4QJFA 4LF5Q 3TEHB 2R92H 3K0XA 2CFMA 4JI8L 1PA6A 2AKWB 1N34Q 1VQ5A 2IT1A 5C4XH 2UUBL 4JI7Q 2MO0A 2WFWA 2D62A 2E2JH 3PF4A 1VQAA 3HFZB 2A8VA 5IWAL 4MZ9A 4IFDJ 2ZJRA 4LF7L 1YNXA 2JA6G 2F3IA 4YHHQ 1KQSA 2N3SA 3J80i 4GN4B 1N33Q 1KXLA 1J6QA 3GTMH 3HOYH 3GO5A 1PH2A 4DV6Q 4LFBL 2WP8J 1S3OA 1K8GA 1PYBA 4GKKL 4B3RQ 4P72A 5ELNA 4B3TQ 1Z47A 3G48A 1YHQA 4UP8A 2DGYA 2RHSB 1QZGA 1IBKQ 5IP9G 4B3ML 4DR4L 4GKKQ 1EYGA 4A3LH 4DUZQ 1HR0L 4JI5Q 2A1AA 2ZTDA 2NVXH 3I4MG 2R93H 3CAMA 4JCVE 2QGQA 3PUYA 4GS3A 3PO3G 3TQYA 4JOIA 4LUZA 4TQUS 2XGTA 3CD6A 1LYLA 1OXTA 3LGJA 2ASBA 2KHJA 2MFIA 1EQRA 3T1YL 4OWXB 1YHBA 1YJNA 2Q2TA 3CPFA 3CMEA 1U0LA 2N8NA 1VQ8A 3PSIA 1VQNA 1J5EQ 1WOCA 5C0XG 4DR5L 3TRZA 1FL0A 4A3LG 1XPOA 4AQYQ 4OO1G 2PQAA 3CXCA 4DV5Q 4QQBX 1SLJA 4C3HH 5JJIA 1TWHH 1WYDA 3E9HA 4DR6L 4R4CA 1NMFA 2Z0SA 5HGQA 1XNRL 5IYDH 2UUAQ 1O7IA 1OXVA 2E8GA 2IX0A 2KBNA 1L1OC 4IFDG 3HKZG 4IPHA 4X64Q 1E1TA 5IYBH 2CKZB 3F2BA 4A93G 4BXXH 4PMWA 4JI3L 1WFQA 4DV6L 3M3YH 1A8VA 3PUWA 5K36G 3GTKH 1UE5A 3E0EA 5GROA 1L2FA 4JI4Q 2K75A 2OWOA 1KRSA 1X56A 2YYZA 2D0OA 2VQEL 5GQOA 1VQMA 1XMQQ 2VY3A 1VQBA 3NELA 4B3SQ 3CCQA 2UXBL 1G51A 5FLMH 1X3GA 1JT8A 3H0GG 2KHIA 1EOVA 1B70B 3S2DH 1YHAA 2UXBQ 3E9IA 3PIOA 4LF7Q 3NENA 1IZ6A 4X66L 2ZJQA 3CCMA 1BKBA 3PO2H 1FVIA 1VS0A 1KD1C 4DK6C 1A0IA 2JA9A 1PH9A 4IPGA 3J81j 1XPUA 2CWAA 1VQHA 2IHFA 1OXUA 4BBRH 5IE8A 3F2CA 3OTOL 4OX9Q 2UU9L 4RMFA 3CC7A 4A3JG 2LXJA 1VQKA 4IPDA 3STBD 3AFQA 3ULLA 5H1SE 1YJWA 1N8RC 1I94L 4L5QA 1X54A 2ZTEA 2RHQB 1UWVA 4A3IG 3RR5A 1QUQB 1YI2A 4A3DH 4LFAL 1FJGQ 5JEAJ 4LFCL 3S24A 1KL9A 5GAEC 2E2HH 1H95A 3M4PA 1HZAA 1Y1VG 2OTJA 4GKJL 4KHPL 2XTIA 3A5ZB 4JYAQ 3NEMA 2H5XA 3F8TA 3K81C 1XNRQ 2ZTCA 1HNWL 1W2BA 1QVGA 4A3GH 1AH9A 2JEBI 4UP9A 3K8AA 1X6OA 2R7ZH 5IP7H 4JBMA 2NVTH 1VQ6A 2HIXA 4DV0L 4PG3A 4JI6Q 4DV5L 1VQCA 2LXKA
chains in the Genus database with same CATH superfamily
1WD0A 1LUZA 1WTHA 1SE2A 2BH8A 1BBUA 2JA5H 2O5IC 5KT2A 3MR2A 1FD7D 4A3KG 3VMMA 2VS1A 1XMQH 2VB3X 1LT6D 1PZJD 3T51B 1GOZA 1PZID 1PFSA 4XQQA 3LX0A 3TP5A 3HOWB 2XIGA 4MHEA 5K5PA 2VQEH 3OMGA 3VYSA 4GLXA 3PR4A 2OQKA 2J6UA 4R8UB 4Q5VA 2KEEA 4I7HA 5FLXW 1LABA 3J81c 1N32Q 1ZETA 1B9MA 4RB0A 3UE0A 1BXRA 2D2CC 4A3GB 3D0FA 3FRPB 4JUZA 2ZXPA 1D1IA 3CPWA 4RZRA 3GTMB 4QW8A 1ENAA 1JQYD 1Y8NB 2GVAA 1M4VA 2YZNA 2R8IA 4NXMH 3BVZA 3OHBA 3GQCA 2WB1E 4RKLA 1A15A 3TMEA 2JA7B 1AE3A 1G291 3ER0A 2E2HB 2UUCL 2NVXB 4LF5H 3PO3B 4TVAB 3WO0A 1MBYA 4DXGA 3QFFA 1A62A 1N34L 5NUCA 4FXKC 4B08A 1KAWA 1GHKA 5I6YA 1IBLH 4F4YA 1MD2D 4P75A 3RLOA 5CMDA 3H3VI 4KLKA 3UE1A 3OWEB 3L0OA 4LUOA 1UNSA 4IO9A 3BQ2A 4DAVA 2KVMA 2QKIC 4X3TA 3M7NA 3HGBA 5KX5F 3GTPA 1HNZQ 1EEFD 3MFGA 1TWCB 4B3SL 3G6JB 2DLNA 2NU7B 2H4OA 3CCVA 3CCEA 4YY3L 3T1HQ 2E2IH 3BDCA 3NSWA 4B3TL 4OELB 5DGAA 1NCVA 2RSNA 2MNAA 2Z6KA 1S97A 2N78A 1JDEA 1FNVA 1NR2A 2JQOA 2PBZA 1N33L 1W93A 4GNXC 4IFDH 5KFWA 4NXNQ 3KDFB 1STEA 2VPSA 5IYZF 4C3JG 3N44B 2XCLA 2EY5A 3HOXG 3FKIB 4NXMQ 4R8NA 1JICA 1F9RA 4RWSC 5CA1F 3K5NA 2UXCL 2K32A 3FPPA 2NU9B 4BWSC 4NB3A 3U4ZA 1PH8A 3K5HA 1O7LA 2CHBD 1WTQA 5J39A 1SYXB 3H3VC 3N40P 4OHJA 1B2TA 2MHVA 3OTOH 3EN2A 3KOJA 3RUPA 2CWPA 4DV0H 1RJRA 4GKKH 5BR8Q 1Y8PB 5FD5A 1JKJB 2ZT9C 3CC2A 1TKWB 4JC0A 2DNCA 1SMYD 5C5MA 4ZLTF 4DV4L 2ATWA 2P0AA 4JV2A 4J6HA 4BBSB 3SE0A 3PN1A 3JC66 2CZGA 1SFOA 3SI8A 3A55A 2N55A 3S1NH 4MIUA 3J7AF 4LF8L 5LMUH 1QUQA 5M5YB 3T1HL 4DR7L 4Q44A 1NY4A 1JDBB 5EOYA 1RK5A 2F0QA 1Z2OX 4GLAC 2R7KA 3OHAA 2WV6D 1S40A 5KYIA 5HY6A 1UC8A 4K0KL 3R8BA 4O42A 2RDHA 3CCSA 4A3JH 4A3KB 1TS5A 4K5WA 4DF7A 1G2TA 1EFWA 1S9FA 1IW7D 1MSHA 1STNA 5FLXE 5C4XG 5M3FB 2YU9H 2EXZA 3D4DA 1V9PA 2R6FA 3H6MA 3I12A 3GLKA 4ECRA 1VQEA 2WACA 4JI5L 1IOWA 2HHHL 1VAJA 1WI5A 3V2TA 3K5IA 5D65A 1D5ZC 1Y14B 1CHPD 5I9PA 2IA6A 1R4PB 5BR8H 4QUFA 2XIWA 4GN3B 3S16B 2YTVA 4YHHH 3I72A 4XDXA 3FHWA 2BH2A 3T1YH 4DR7Q 3RLNA 4OX9H 5FKAC 1EWIA 4IOAA 1EU4A 2JP1A 1ZQ7A 2DZDA 1TY2A 3K80C 3C0FB 1M1KC 1B04A 2GVBA 2VR1A 1VQ5A 2VL6A 2NZOA 3OIQA 1VQ7A 4ZK9B 1HA5A 4I4TF 4J9KA 2UUAH 2RVLA 4EGJA 1SRUA 1LTAD 2BA1A 5GAHC 3EFXD 2XGQA 3ZYYX 5CV8A 1A2UA 2NUAB 3HOYB 2IJ0A 4X66Q 3GP7A 4HJ9A 4JI3H 3Q24A 2K5NA 4HIMA 3EJIA 2I46A 4MA5A 2LFNA 1GKHA 3C1EA 3AQQA 3OTOQ 4YY3H 1HR0H 1IBMQ 2UXCQ 4TQRA 3PCOB 3GIPA 2F52A 3NTHA 1GUGA 1BCPC 4U673 1B1ZA 2B2VC 4J1MA 3H4BA 2K5VA 2X0SA 3SHLA 4DV3H 1SSOA 2UXDH 4R4TA 3I73A 3H15A 3NTIA 4LF4L 1KBLA 3AB9A 5EBCA 4Y7NH 2PZWA 4NMZA 5BMVF 3RTXA 2WTFA 3KFUA 1GUTA 2R93G 3RGZA 1OO9B 1KTKA 5FO8B 4XTCS 4DR2L 2EYFA 2UXCH 1WVLA 4KHPQ 3T1YQ 4MTNA 4F4ZA 1G6PA 1RKNA 5EQ0A 3QZ8A 1PH5A 1NR4A 1SJHD 3CQZA 1I4PA 1XJVA 5I9OA 1UEBA 1WCMG 4BY1H 2R92G 2F3WA 3GDEA 5IP9H 5JPNC 5T14A 4RFBA 4HJ5A 5KFTA 3RAXA 2UU9H 3Q23A 4HJ8A 3G6YA 2Z8LA 3NGDA 4BBSG 4KJNA 3RIZA 4RCOA 1YBYA 3G6VA 1HH2P 4X64L 2EDGA 1K83H 1YNJD 5JEAG 1M6VA 1MJEA 2K4KA 3J81E 3R3OA 4JI3Q 4LF9H 1RDPD 5E7NA 3FPUB 1ILQA 4J9LA 2R7DA 4HJAA 2PI2E 1XMQL 1C7YA 4MV3A 5KT4A 4YCVA 5JJKA 4H0LC 1C48A 5I6WA 1EYZA 3FDTA 1LTBD 2AWOA 4J8QA 3RLFA 4J0MA 4J9NA 3CC4A 4KI0A 3SK4A 4X65H 5IYCG 2Q2HA 2J6TA 2B2VA 5LL6X 5FPRA 5CAEB 2ASJA 3JAME 1Y1WB 1Y1WA 1PRTC 1B3AA 2NYZD 3I4LA 2VA2A 2UUCQ 3ICEA 4CC6A 4DL4A 1G8ZD 4KHZA 3GILA 4C2MB 5E3FA 5ELEA 2VZAA 4M1UB 3WDNA 5EPKA 1AFPA 4AYBG 5ELCA 4KY6A 4IWYA 4FXDA 1GSAA 1JJCB 2QF7A 2FB9A 2L9HA 1N56A 4LF6Q 4YHHL 3JRXA 1ENFA 1SMXA 4DV1H 1TWCA 4LFBQ 4ED8A 1IBLL 3SEBA 4LUVA 4L5RC 1YVCA 5KFYA 3QZ7A 1VCIA 3KHGA 3MFYA 3HOWH 1M0WA 2EXDA 3O13A 4R7RA 3F2DA 4DV3Q 5C4JH 3WO1A 3KLWA 4U68A 1TR5A 2UXDQ 3BA8A 2MUYA 4XYOA 4DPGA 4OO1I 3RBEA 1Z7TA 4R4OA 2KCTA 1T5EA 4LF6H 4X62L 1GJXA 3GIDA 3VDYA 1KIXA 2UU9Q 1LT3D 1ET6A 3HOYG 1QILA 5M5YH 2HQLA 1MHWC 5BN5A 4JV5L 2B63A 3K5OA 1E24A 1TY0A 2SNMA 4FF1A 4DR4Q 5ELBA 3GV8B 3Q8PB 1D5XC 1NSNS 1V1OA 4V0BA 3I4NH 5AJ3L 4JW0A 4CJ0B 3J7A5 3HOVH 1WTWA 3VYRA 4DK3C 4E6IA 4JI4H 2KCMA 2CH4W 1QVCA 5CC4A 5KG4A 1XMOL 4LAAA 4HNVA 4O3SA 4DU9A 4C56C 4BY7H 2VW9A 2ZJPA 1T36A 1I6HB 3J80W 2XCPA 1WD1A 2WINB 3GTMA 4DR2H 3VYUA 4DV2H 2V9WA 1N34Q 3SVMA 4ETSA 3PF4A 4EEYA 2C2DA 4A3JB 1VQAA 1IBKH 2K01A 3M4YA 1F9PA 2NVYA 2C2RA 1YNXA 2F3IA 2XNAC 2N3SA 2IW3A 2C22A 3OOCA 3GTMH 4H44C 3MAQA 3GO5A 4DV6Q 1R9TA 1VF7A 1S3OA 4JI6H 5F2DA 1F9SA 2SEBD 4YR3A 3PW0A 2NB0A 2O03A 2A68C 4B3RQ 2FK2A 2V59A 4EBEA 2XN9C 2Z1CA 1B3QA 1CK1A 4LF7H 4B3TQ 1Z47A 2CH4A 1I6UA 4UP8A 4GKKQ 2RHSB 3MXGA 1IBKQ 4DR4L 3EVQA 4ED7A 4DUZQ 4JI5Q 2A6HC 2F0VA 4H13C 4MAMA 1HA6A 1KDCA 1XYIA 3I4MG 1JLLB 1IW7C 1D1KA 1ET9A 1YNND 3PUYA 4GS3A 4I7AA 5C3XA 4TQUS 3KXYT 2XGTA 3ERQA 1OXTA 2MGSA 1YHBA 2K5DA 5CYUA 1ONLA 2NVQB 3CMEA 1VQ8A 3HBLA 2Z6BA 3PSIA 4EFEA 1U9RA 1FL0A 5BN3A 5CGKA 4AQYQ 5JJIA 1SLJA 5KFCA 3Q8QB 2FINB 1TWHH 1WYDA 1PK8A 2RGVA 4EQOA 3BYYB 1NMFA 4QIWA 1BF4A 5TSSA 3PIP3 2XCAA 1L1OC 1K0SA 3R5FA 2CKZB 4A93G 3QR8A 4BXXH 4IR9A 1WFQA 1A8VA 4EFBA 4JI4Q 2XRQD 4NDXA 2VQEL 5G3LF 1WTOA 2VY3A 3VA5A 1LT4D 3NELA 3CCQA 2UXBL 1SNMA 4KY7A 3NENA 4X66L 1PRTB 1W96A 1RYRA 1CQVA 3KUPA 1K3BC 5EBDA 4BBRH 1OXUA 4OX9Q 3I8ZA 4RMFA 4UCRA 4FS2A 5T1IA 1S4ZA 1RJPA 2JA5A 1N8RC 4L5QA 4A3DH 3RR5A 1E2ZA 1F77A 2P5ZX 2EYJA 4G4KA 3S24A 2E2HH 3M4PA 2OTJA 5D8DA 4GKJL 4KHPL 5BPFA 4JYAQ 3RJ0A 4CDCC 2JA7A 2M2LA 1JWMD 3C2PA 1HNWL 3S2DB 1AH9A 4ECTA 4LFAH 1W6KA 4N8X1 3MHBA 1Z2NX 4JI2H 2JEBI 2CW7A 4S3SA 2HIXA 3HKZA 1PX2A 2X6GA 4NXNH 1I50B 4XQNA 2EYPA 1PDQA 2DJGC 4R4IA 4KJOA 3S15H 5FJ8G 2RDIA 1WTPA 2RCNA 4I65A 3EBEA 2F3VA 1YEZA 3QIAA 3NTKA 3IG0A 1VMPA 1PTOB 4ECUA 1G2SA 2R7LA 1TXYA 2AGPA 1ZYRC 1IBKL 1Q8IA 4DUZL 2IX1A 4LMQD 1I50A 3AMUA 1CS0A 2R7ZB 4IN3A 3TS2A 1TQOA 1V4YA 1L0XB 4ZRZA 5KFMA 5EPJA 2B8GA 1EOTA 1LLRD 1F2LA 5C8YF 4LF4H 2HT1A 4J9QA 1RTNA 1N48A 3RUZA 4IPCA 3DEOA 1S5BD 4IJHA 3I7FA 2ENBA 5J2TF 3D31A 1CKOA 3HB9A 5KFFA 2BE5D 3IL8A 4WORA 3OW7A 1KRTA 5J3BA 5CBEE 3J81L 1BCPF 1GVPA 1PMRA 4ALPA 1CE8A 3KLRA 3KLSX 2FXQA 3I4OA 3C46A 5JQWA 4RGNA 4R8UA 4NKLA 1JCKB 1PRTF 3S1MH 1G6ZA 5LMUQ 3PW7A 5IGFA 4RHRA 5A2QW 1L1OA 1N36L 5KNDA 1H9JA 4K8JA 2ATLA 3MC0B 3DM1A 4A3MG 1IYJB 4LF9L 4DV1L 3PUVA 1JORA 3PQIA 3UDXA 3RZOB 5EKLA 3G6EA 4XYLB 2E5LL 4J9MA 3T5LA 3BJYA 1GUNA 1SYCA 5DG7A 2EY2A 1YJ9A 2EJGC 2ZDHA 4X65L 2Z6KC 4A3BG 5C3EB 4POGA 3WNZA 4HIDA 4X66H 3ETHA 3A54A 3G71A 2G9DA 1XNQL 3E3XA 2KCNA 3PVXA 4C3JB 4K5VA 2V4RA 1KDAA 3FKIG 1RYSA 1SJED 3K5MA 4BY1B 5BR8L 1ZHQA 3JRWA 1EIGA 1ZEQX 3HKSA 1XMOQ 5EDWA 4HEDA 5FJ8H 2F0LA 4KTAA 5EKKA 2M00A 2B63B 2MQHA 4H02A 2R7FA 1RJTA 4K8IA 2D9UA 2W9CA 4IAJA 5C44B 1KABA 1FGBD 2HDLA 4L63B 4XZ3B 4YY3Q 2WIIB 1DIKA 2RGRA 3ETJA 1WR2A 3JAMW 4LF9Q 2J7ZA 2B2WC 5KFIA 4LNQA 5D14A 4DN4M 2F0SA 5LOVF 3D8GA 1GO3E 4QIWE 3S2HB 3MWEA 4A76A 2ES2A 4J9SA 5IP7G 1Q1EA 3SR1A 1D8LA 4ED1A 4M8AA 4DR3L 1YITA 4IRDA 3GTOH 4OXPA 3RV4A 2ZM6H 4O2AF 2CW0C 2L55A 3A74A 3H09A 3CRLC 2I0QA 1BCPB 4JI1Q 4C5CA 1HZBA 5JAVA 4C2MH 1LTTD 4C1NI 3KF6B 2FMCA 5C4XB 4HIOA 1VF5C 1W3SA 4C3IB 3M85A 2VOBA 2YYAA 3H20A 1H9SA 3RZDH 2R8HA 2WAQE 1WJJA 3N6RA 3ND9A 1HFNA 3GD7A 1NAPA 1TWFH 1O78A 4GNXA 4ZYSA 3U58A 4JPBW 2RA4A 3NK9A 3D3RA 4G57A 3WOFA 4DR5Q 2GLTA 4JVZA 5FOBB 4ZHQF 2DY7A 1VQIA 2EYLA 2ZJTA 1JWSD 4HSPA 4CKEA 5LHY1 4RNNA 2B8FA 2JE6I 4AQYL 2OQ0A 3KF6A 3H0GH 4ZUJA 3DLLA 1K8AC 2E2IA 5IYDG 4BWGB 1H9RA 2B2UC 1K9MC 4DV2L 1CKNA 2NU8B 2DUDA 3TP7A 4Q0YA 2RQXA 3BZKA 1N9WA 4L8JA 4FDBA 4OIKA 1BNCA 4LFCH 2A19A 3U50C 1HNZL 3S1MB 3FMCA 1SEBD 3PW4A 1K83B 1JXLA 1FNUA 1PYWD 4L5SA 1AUXA 3KJPA 3V6KA 1YZ6A 4YB8B 2MO1A 2XGPA 2PN1A 2YRXA 4OX9L 4DR4H 1Q86C 1ESFA 3TREA 2PYKA 2BQRA 2PVPA 2YW2A 4QWBA 4O3RA 2K52A 1AW7A 2WE6A 2EY1A 5KEEA 4ZAIA 1KJ8A 4J15A 1E4FT 1XWEA 1PYSB 2E5LH 4KN7C 3M9BA 3NHHA 3J80E 1DOMA 5JVH3 5LMNW 1EY5A 1XTCD 2NVQH 3S1NB 1TWHA 4BS9A 4X3UA 5HURA 4A3GG 4DV4Q 4A3FH 4OWWB 1Y69U 3M4QA 4JI1H 1XNQH 4IUQA 5C0XI 4YWLA 2CVRA 4LH7A 4FS1A 1I4XA 2SOBA 4RAZA 4IUNA 3L9AX 2RKSA 2Y0SE 3N41B 4JI0H 1CI3M 3BQ0A 1ESRA 1GUSA 3EROA 3LWEA 3X3NA 5C6AA 2UXDL 2B2WA 2FPIB 2KEDA 2R92B 1CKNB 3K3PA 4WBNF 3RD4A 3QG1A 1LT5D 2FJZA 1KJQA 3V05A 4P73A 1Y1VA 4XT3B 4LW1A 3T5KA 2OLSA 4X62H 3JAMi 2DJFC 1EUJA 4A3CG 1BBWA 1U4PA 4UFZA 3R5HA 1F9QA 5C5JA 1DV2A 4TQSA 2N49A 5FLMG 4O3OA 2CCZA 2E2DC 4EEQA 1WSCA 5LP6F 1JX4A 5EZYF 3S1QB 2VPQA 2JEJA 3D4WA 5EPLA 2F4VH 3OUZA 1TWCH 2C00A 2H1EA 3AFPA 1IXRA 5JUMA 2ALYB 1STBA 4B3TH 1HTLD 3X3MA 1ZXTA 2AUJD 3W2DA 1DOKA 4KHPH 5I4DA 2K50A 4A3EH 1M0TA 5KFJA 3EPIA 5CB4F 3ULPA 4ED3A 4BA2I 2K5HA 5AFWA 3GTLB 1EQQA 4U6PA 1JE5A 1VQ4A 2NTSA 1B50A 4K2LA 2B2YC 2YTXA 3UDIA 3R5XA 1IBLQ 3JSLA 1JB7A 2JA5B 4HR7A 2KUMA 1STGA 3LMLA 3PIPA 4IWXA 3BS1A 2Q2IA 1RHPA 3VR5A 4LF8Q 5KT7A 4JI7L 3TQ1A 3MA2B 1RL2A 2LSSA 1V1PA 3HEJA 3EYYA 3M4OH 2NUCA 4JOIC 4R1JA 3HOUH 2VUMA 1S72A 4YCWA 4M9UA 1R9TB 4WD3A 3J81W 4K6DA 3RB3A 4KK7A 3MR6A 4A3IB 2VUMG 5LL6S 1X3QA 3DXJC 4X65Q 4IUVA 4BY7G 2R3ZA 2A6EC 1VQ9A 3RZOH 1RCVD 3CW2C 3D6WA 1FNWA 3U9OA 2V5AA 1TS4A 3K7UC 3PO2B 3DUZA 1BCPD 2Q8RE 4DR2Q 4FF3A 1M7JA 4MV1A 3MXPA 5IODA 1TVXA 4PV1C 1K1QA 1IL8A 3GTPH 5D1OB 2EZVA 2HIVA 1RF2D 1I50H 1KC8C 2F0DA 4DNIA 3A56A 3S17H 1KJIA 4R9WA 1KLGD 3GTOB 5IGBA 2W9AA 4LF6L 4R4QA 4DFAA 1NE3A 1V1QA 1J5EL 1RD9D 3GV3A 3LWBA 2CFMA 1PA6A 1K83A 1B9NA 3TBIB 1KNEA 5C4XH 3E6ZX 5IIFA 2WFWA 4DL5A 4DR7H 5CV7A 2A8VA 2MP1A 1GSOA 3TINA 1CHQD 3KHLA 5KFHA 3UFXB 4KKTA 2JA6G 1KQSA 3L4KA 5C5LA 1NNXA 3J80i 4GN4B 1N33Q 1KXLA 4ECZA 2JA6A 1PH2A 2UUBH 2HCIA 3GTPB 1CA5A 1K8GA 2JXMB 2K6AA 2FMAA 1PYBA 3GV6A 1S0OA 5KFDA 5ELNA 2J4XA 5DLGA 1XMOH 4MTDA 1TWAA 1UNNC 1BR9A 1IHZA 4CJ2C 4CGYB 2ZTDA 4ECWA 1SYEA 3N52A 5KFKA 4MV9A 2QGQA 5KFZA 4JV0A 2IX3A 5CORA 4O2BF 2MFIA 1EQRA 1UEAB 2NTTA 5DM63 2W71A 2N8NA 1VQNA 2WDTA 3K58A 1WOCA 1J5EQ 4DR5L 4QWCA 1S0MA 1XPOA 4ECSA 4OO1G 2PQAA 4QQBX 4C3HH 4QWEA 5IT9E 2F0TA 5KFGA 2EPBA 4O4HF 3E9HA 3M9NB 2R7ZA 2BDOA 1I4HA 2Z0SA 1TAEA 2UUAQ 1OXVA 2E8GA 1I3QA 4IFDG 1EYAA 3HKZG 4N9TA 3M4IA 1E1TA 5IYBH 2M05A 4Q0FA 3S1RB 4DV6L 1SE4A 1O80A 3E0EA 1GUWA 2HVQA 1Z2PX 5T1GA 2W6ZA 1X56A 2YYZA 1BOSA 2D0OA 1E4GT 1VQMA 2Z4HA 1VQBA 2HVRA 1VKZA 4UHVA 3QOJA 4BBRB 2YU9A 3E9IA 4HN7A 4LF7Q 2RBMA 3WOEA 3CCMA 1V1PB 1FVIA 1VS0A 1KD1C 5KFUA 1KJJA 1A9XA 1T3NA 4C5BA 2KCCA 4NW2A 2IHFA 2UU9L 3GIKA 3CC7A 3D4RA 1H9MA 3STBD 3AFQA 4A3FB 2ZTEA 1UWVA 4A3IG 1HRJA 4LH6A 2BQUA 1FJGQ 2L5TA 5JEAJ 1TWFB 2Z9HA 1K1SA 1KL9A 1H95A 5L1JA 1JOKA 1HZAA 2EJMA 2R87A 2JEFA 3NEMA 3F8TA 4RH6A 2ZTCA 1C4QA 1S68A 3URYA 4IRKA 4ZUIA 2AGOA 2PNRC 2WKCA 4UP9A 1X6OA 2LKVA 5M5WB 1WH2A 2EVBA 5IP7H 5BPHA 2NVTH 4DV0L 1B6RA 4KHVA 4PG3A 2VQDA 5JH7F 4DV5L 1VQCA 5DLFA 4FP5D 2J6SA 1UAPA 2NBFA 1IBMH 3HRZC 1UE6A 4KN4C 3M3YB 1K3RA 3AU7A 5DQIA 1EY0A 3KTMA 2OH2A 2FK1A 2D0PA 1J5EH 5KNBA 1CFMA 3HP3A 4GOPC 3BZDB 2W57A 3C3LA 4AYBB 5L1LA 1X32A 4IRCA 2SCUB 3BU2A 4NXML 4EBDA 2JA6B 1S0NA 2F0JA 4MTKA 2RDFA 5KFSA 1QJOA 3H4DA 1EY4A 3FKIH 3TQTA 4HMJA 2QCPX 4AH6A 2F0GA 3BAAA 4YP3A 2UUCH 1BVSA 1E3PA 4JYAL 3PMFA 1WTVA 1Q8KA 1TWHB 2YV5A 2FE3A 1GD7A 5CBAE 3MEFA 4IQZA 2DN8A 3GQBA 4CC5A 1YNNC 3H0GB 5KRUA 1B33N 3HZXA 3DWAA 3BYTB 3CQZH 2W7PA 1PTOH 3OMCA 2HHHH 1A3UA 2BDNA 1CKMA 4RU9A 2B29A 3L7ZC 1VBHA 3I55A 1X9NA 1AZQA 2F0MA 3U9SA 1VQLA 3OW2A 3HOZG 1JR0D 4HCEA 2WB1A 3Q22A 3UI2A 4LF5L 5M3FG 2QK4A 2PQEA 4JV5H 1YIJA 3KBXA 3JAMc 1GHJA 2DY8A 4DR5H 2E2JB 4LK1C 2W6QA 3M4OB 2XWBB 2F0EA 1RTOA 3KF8B 1OWTA 1PXUA 1U4LA 3CCJA 4UCSA 4DL2A 1M90C 1PFMA 3T4AC 4IJLA 3HKZB 5I47A 2FLPA 4GOPA 4RCNA 3HOZH 5KG1A 3UDFA 1SYFA 3HKZE 3MXNA 3EA6A 1GYFA 4Y8VB 2DWCA 4B3SH 3HS0C 5DG8A 2A6ED 5F9LA 3A5UA 2E2IB 5JVLA 5L37A 3U9TA 1PH3A 5M5XB 1GM5A 4O4IF 4APVA 4KD4A 2KJXA 5K36H 4F8MA 3RAQA 1M8AA 1A2TA 1AP0A 4K14A 2F4VL 3K7AH 3HOWG 3FP9A 5M3MB 2W6NA 4DV4H 2AQ1B 3BG3A 4J9OA 1S5DD 4ME3A 1CQIB 2I80A 4A3BB 4LFCQ 4QF4A 4JBKA 3V6JA 4DR6Q 4Q43A 4X6AH 2HVSA 4A4IA 4GKJQ 3BDOA 3ITPA 3S9WA 5IT9L 2F0OA 4BXXG 2ZDQA 4N9PA 1DZ1A 1EQTA 1WCMH 4BY1G 5LMNQ 1JJ2A 2Z4IA 5EWFA 4L1KA 3D6CA 4DLKA 2RDJA 1Y8OB 1X65A 2B63G 3KK7A 1CZWA 3R2TA 4Q45A 3OSOA 4PZ6A 4F4WA 2EE1A 1HNZH 2E76C 4ID6A 5BN4A 3VR3A 3Q6SA 4TKOB 4AYBE 5IGEA 4HIKA 2B3GA 5LMNH 1UUPA 4DR3Q 4POFA 3S1QH 1NBWA 1B4OA 4JI5H 1S03G 1IBML 4JI0Q 4TV8F 1TA8A 4A3EG 1AN8A 2K7VA 2XWJB 5ELDA 2WYOA 1CTMA 2L0CA 2F4VQ 1VQGA 2O5JC 1IOVA 1SXTA 3KALA 4X64H 1MZBA 4PWQA 1MI2A 5KG6A 3KYHC 1XNQQ 2HHHQ 4HYKA 4QUCA 1PV4A 5KT3A 1VQDA 1V51A 2AQ4A 4A75A 3DEPA 2B2TC 4HQ6A 5IOCA 4O4LF 3MFHA 2UXBH 3ONAB 3HOVB 2FPPB 2Y0SA 2IPKD 2PQAB 4C3IG 2AGQA 5FO9B 3G8CA 4Q8FA 4O0AA 5M9OA 3V6HA 3CCRA 1GXDC 2UUAL 1KHIA 4LF5Q 1C9OA 3Q1KA 2W8LA 5C0XJ 3RB6A 2LS01 4OONA 1NMGA 4PQXA 1N36Q 2C2EA 4FF2A 1KLUD 4RAUC 3RNUA 3W5OA 3J7ZC 2NVYH 1TWAH 2PMZE 2G5DA 2QEJC 3A0JA 2OF1A 1I4RA 4C3IH 1Z9FA 2K1BA 1R9TH 4KKUA 5CR3A 1AUVA 4ULLA 4O3QA 1LACA 2VB2X 5ISRA 3CCUA 4GKJH 1PRTD 4A2AA 4UCTA 1C0AA 3L4JA 2FJ2A 3G7LA 3B6YA 3KF8A 3I4NG 3T16A 1Z6HA 2QDBA 4X62Q 1SE8A 1G91A 1S5ED 4A3KH 2E5LQ 4F50A 4QW9A 2LY7A 3GV5B 4MV4A 3Q8DA 4DK0A 4DR1Q 3J7AK 2EYHA 2DPIA 4AQYH 1HFGA 4C3JH 2K33A 2GA4B 5IYBG 4NXNL 1HUNA 2CQYA 3PW2A 1RK6A 1B44D 1P16A 2OT2A 4C5AA 1ASYA 3SK5A 5KG7A 2KSWA 4C3HG 5JJLA 3GTQA 2JA7H 4IFDI 3HOUG 2XD4A 3I4MH 2WB1B 2EY6A 3PUXA 2K5WA 1C8CA 1LTSD 3VPDA 5FD6A 5JVDF 2X69A 1QNUA 2AQ3B 2CW0D 3HOXH 1H9SB 3T13A 4DV2Q 1C30A 1TS3A 2W9BA 1O7ZA 4KKSA 1GGOA 5KFRA 5C1PA 2WAQA 1DXMA 4DV7Q 3T5JA 4F7XA 2HD3A 1STAA 4JI4L 1PH1A 3GIIA 3NBHA 3G4SA 1QZHA 3SDZA 1RIPA 4A3CH 5IWAQ 4JI8Q 4G7OC 5CA0F 1EZ8A 4RGMA 4DV6H 4UAIA 4OGQC 3U4VA 4L5TA 1A63A 4EQNA 1VQOA 1I6HH 4CKBA 1QVFA 1PTOF 2AU0A 1FGUA 3OHXC 1HXYD 1HQMC 4FF4A 3MWMA 4B3RL 3ORRA 5F9NA 1MJCA 3PUZA 3FVQA 1CQJB 4DKAC 5KG2A 1LV9A 4FYDA 2VQEQ 3UDGA 1BGWA 4I50F 1L1OB 4DR1H 3RZDB 3JSNA 3PW5A 1QB5D 4A3IH 4WRDA 5E1FA 4DL6A 2J9GA 2YZMA 5FLXc 2ASDA 1CT1D 1DV1A 1LTID 2VQFL 4MNOA 4YIJA 3S16H 4YAKB 2E75C 4A3EB 1EYCA 2B2TA 2BOSA 4KMUC 1C3OA 4PMBA 5DAUA 4FBUA 5JOBA 4XQJA 4TSSA 3KBGA 2EJFC 2NVXA 1LO5D 2I8CA 4ECQA 1I5FA 4DAYB 1K73C 4LF4Q 4HJ7A 4N8FA 4OO1H 3IFTA 3NE5B 4DGZA 1X3FA 3S1RH 1KC7A 2IL8A 2R6GA 1XPRA 1SNDA 1PH6A 5FPOA 5KIXA 3RN5A 2O4XA 4QGUA 4O3PA 1B6SA 5C3EG 3PV0A 3K0YA 4EYIB 4QCLA 3J80L 4DUYQ 1K8MA 1OTCA 2VUMH 1DCZA 1E22A 4FVMA 3KJOA 4EQ5A 3FKIA 1MSGA 3E5SA 1N32L 3RF2A 2XSCA 4X3KA 2GN5A 5JVG3 4XYMB 2A73B 2L15A 3SGIA 4A3BH 1I7LA 2AHOB 2CQAA 5M5XH 4G7HC 2JA7G 5K2MA 1HNXL 3W3AA 2W8KA 5IYCH 1BQQT 4F87A 4WFN3 4DV3L 1PVOA 4DUYH 1WTXA 1CSPA 3K7AB 1FR3A 4Y7NB 1JJGA 1WCMB 1ZHSA 3N43B 2FLNA 4ECVA 2W70A 2CQOA 2F4IA 2YCHA 4ZCKA 2NN6H 1Q46A 4YR2A 4UCVA 3P20A 3S14B 1K8OA 3K59A 4MN3A 1NTGA 3TDQA 5C4HA 4B3MQ 3E5NA 1PFBA 2R61A 4YJ3F 4YWKA 4JYAH 3RMHA 2K28A 4A3DG 1I4QA 1BBXC 3V4ZA 1UE7A 5L1KA 4CKCA 2BA0A 3TSSA 3CMAA 2JEAI 4BY7B 3ORQA 3GTGB 3GTGA 3DHQA 2MCTA 4JI7H 1HZ9A 5IY0A 3CQZB 3PF5A 3N8DA 3GTJA 2QW7A 1JIHA 1KAAA 2GPSA 5L1IA 4EG0A 3ERSX 3CRKC 2I07B 5DM73 2I5HA 2WB1G 3IRBA 1N33H 2FP4B 3SK8A 3K0XA 4YAJB 1EWHA 3NPPA 4JI8L 1HUMA 2AKWB 3GV7B 4HAEA 4JI7Q 2D62A 2E2JH 3HOXB 2R7NA 3HFZB 1E4EA 4LF7L 2MPMA 1JB3A 1BUVT 1EFID 3RFCA 1R4QB 1SNQA 1E2VA 4DXFA 3HOYH 2UVWA 2WP8J 3BG5A 4GKKL 1W6JA 5KFLA 2ICIA 2L4NA 4P72A 4QB4A 3RGXA 1YHQA 1QZGA 5EKIA 2Q8IB 5IP9G 4B3ML 1EYGA 1T5XD 2QYZA 5KFVA 5C0XH 2NVYB 2C5CA 2R93H 1E4EB 4JCVE 4ECXA 3TQYA 1EUCB 4JOIA 4LUZA 2YRWA 1FJGH 1LYLA 3LGJA 1PTOC 4JK1C 2KHJA 1CZGA 4OWXB 2F03A 2VUGA 1KJ9A 3CPFA 1I4GA 3TZUA 3VYTA 1TWFA 1A6XA 5C0XG 2FKLA 3F2UA 3TRZA 3EPGA 4FM9A 4QMGA 3CXCA 4DV5Q 4DAYA 2PZTA 5A2QL 1ULZA 2F0NA 5EWGA 5HGQA 5IYDH 1XNRL 2NVTB 1KDBA 2KECA 2IX0A 2KBNA 4X64Q 2K03A 1I94H 4IZOA 4FXGC 2IWHA 1CQFA 2PMZB 3GTKH 1UE5A 1L2FA 4ZQIA 1EY9A 2K75A 2OWOA 3A8KE 1TWGA 1XMQQ 5GQOA 2HDMA 3KAKA 3MVVA 1JT8A 3G6XA 2M9VA 2KHIA 4MA0A 1JOQA 1EOVA 1B70B 3PIO3 1YHAA 2G9HD 3PIOA 3OIPA 3VA7A 2ZJQA 1BKBA 1BO0A 1IYVA 3PO2H 4G3IA 4FNFA 2PW7A 2KQ3A 1A0IA 2JA9A 1PH9A 4IPGA 1XPUA 2OXPA 2CWAA 1VQHA 2RSOA 3RBDA 4CDDC 3F2CA 4O3NA 3T5HA 4A3JG 1VQKA 2F0PA 3A7LA 2SNSA 5FK9C 3Q8SB 2K5QA 5H1SE 3DMUA 1X54A 2F0WA 2MJ8A 1QUQB 5KFEA 4LFAL 3KHHA 3SE7A 1Y1VG 5D3DA 2A68D 4MTEA 1DOLA 4ZKBB 2AQ2B 3A5ZB 5E4XA 2H5XA 3K81C 1XNRQ 1QE6A 3DF7A 1HHVA 4A3MB 3LP8A 3VPCA 1W2BA 4WJWA 1QVGA 1DJRD 4A3GH 1EU3A 5KNCA 2A6HD 4B9XA 1SEIA 5JEAH 1EHIA 1SNPA 5I2XA 3I4MB 3K8AA 3MEHA 1VQ6A 3GTQB 5D3IB 3K57A 3PR5B 1HNWH 2PI2A 4EGQA 4JI6L 3VR4A 5KG0A 4I7ZC 3QO2A 4NPSA 4X3SA 3TP8A 2CW8A 2BQ3A 2A74C 4JI2L 2V4QA 4RAYA 2I5LX 1I3QB 4K0KQ 2YS7A 1PFNA 5C4JB 2WAQB 4LWCA 1LTGD 3EQLC 4LJZC 4RG1A 4LMYA 2BR0A 3GIJA 5EAYA 4P74A 2A69C 4B9WA 3GTLH 4EQPA 2IP4A 3A8JE 2VNUD 3Q8RB 5ELFA 4NLGA 3CCLA 1EIYB 1JOOA 1MGSA 1DD2A 3CF5A 5M5WH 5KFXA 2R8JA 3GIMA 1IL2A 1ZKOA 5DLQE 4GLVB 3GTQH 5EJWA 1L0YB 2IY5B 5C44G 4DV7H 2R84A 4QY7A 4DR1L 1TIID 4HMIA 4HCSA 4DUZH 2KENA 3J7YW 3GTOA 3NWSA 2ZM6L 3GIQA 4JV5Q 4HSVA 4UY8C 1K0RA 4DL3A 4C2MA 4P71A 3OSNA 1STHA 1V8QA 1SDFA 5GADC 1TWAB 1IYUA 5IT9c 1X55A 1EY7A 1YNJC 1N36H 1I6VC 4PZ7A 3T53B 5C1OA 2Q2UA 2AWNA 4XYQA 1NUCA 4AYBA 1Y1VH 4I55F 3STBC 1HNWQ 3HG9A 4LSXA 4RKBA 2NN6I 1PZKD 4AIMA 1U4RA 3PO2G 4ZI7F 5DGBA 3Q2OA 3M9MB 4MV7A 1T9HA 2IMWP 1DGSA 1Y1WG 4L6TB 3JAML 2FK3A 4RB3C 3WWVA 2ID0A 3SXHA 1KEEA 3S2HH 2AMCB 4JV1A 4LFBH 4F88A 1EYDA 1X3PA 1VMCA 3HXLA 1QOHA 1N32H 4FBTA 4OIJA 2JA8B 4YQWA 1LTLA 1CM9A 2ASLA 3MWDA 3A8IE 3P75A 4NP5A 4J9PA 2FFKB 1O75A 1AE2A 1E0BA 4CDFC 3H91A 4HTHA 4IHJF 4E4TA 2F0IA 2RF4A 1IKMA 3OSPA 3PGZA 5KT6A 1T94A 4XXEA 2C35B 4PNYA 1JMCA 2B63H 3I56A 5KFQA 3EIVA 1Q7YC 5KFAA 2JEIA 1SFOB 5ELOA 2ZXOA 2VQFQ 1I7NA 4UDUC 3RV3A 2Y0SG 3GTKA 5KFPA 5C3EH 3PO3H 2QEXA 4ZKCB 4XIGS 3VR2A 4EX5A 3TS0A 4ED2A 1ASZA 3W1GA 2YTYA 1B8AA 2W6OA 4BA1I 5M3MG 1VQPA 1L0WA 3F1ZA 3FEWX 4IALA 1N34H 3S15B 2R7ZG 4TV9F 5IWAH 2JA8H 5LL6b 1QG7A 2I87A 1BJTA 3P7JA 5DEHA 3E0JA 3TIGA 1EIFA 2VXWA 2K04A 3P1HA 5IGGA 4JI2Q 1QCBD 2V4DA 3NBIA 4DL7A 2V1CC 2NZHA 3J80c 2JA6H 5M3MH 1D5MC 1SFOH 2L11A 5KG3A 2R8KA 4QWAA 4JI0L 3NQTA 2W9BB 5HV6A 4PZ8A 2GPWA 4JBWA 2W6PA 3GTJH 3MZ5A 1SNOA 4YCUA 4FU0A 5KT5A 2C28A 2VA3A 3NBHB 2PZUA 2WAQG 3M7GA 5KFBA 1LM0A 1PTOD 3NP8A 3MXUA 2HGSA 4RB1A 1HR0Q 3L3OC 1D2BA 3I70A 5CV6A 3CP0A 1OXSC 2LMCB 2PNHA 4IUTA 3RN2A 3SK6A 2F0UA 5J1ZA 4BBRG 1PHJA 3F8NA 4DR6H 1P8LA 1UE1A 5LMNL 1Q12A 2N88A 1S5CD 2RDGA 4DV7L 3MJFA 5KFOA 1PH7A 3TIIA 4RUAA 1FJGL 1Y1WH 4M7EA 5KKNB 1Q81C 3MXNB 3HOVG 1BXTA 4JBJA 4RGOS 3GTKB 3DWQA 1SN8A 5D1PA 3NXWA 3DWPA 4K2KA 1Q82C 4JI8H 5LMUL 4A3FG 4LF8H 1HZCA 3MWYW 4A93H 2EQSA 1HJPA 1SE3A 1BNZA 1RJQA 2R93A 4DV0Q 2JJQA 4ME5A 1ML0D 2NN6G 4DNTB 4CJ1B 2QA4A 2ZXRA 5HBRB 3I2ZA 1B7YB 5GAGC 2K14A 5C4ZA 1EIHA 3V96A 1WTRA 3H3VH 2F1MA 2K05A 4QL5A 4ZOLF 4YWMA 3NQIA 4YR0A 4PDBA 5HGTA 4UCUA 1IKLA 1EZ1A 4K6LA 1BDOA 4B3MH 2W9CB 2JSOA 2F0KA 2EIFA 4ODGA 2R93B 4K5XA 2KOLA 1MIUA 2OCEA 2PW5A 3K6OA 4UP7A 4HNUA 1VQFA 2ICEC 2JA8G 2L1BA 3DM3A 1ICWA 1PH4A 4A93B 1D7QA 3R93A 3K3VA 2JA5G 3J81i 1I94Q 4EGVA 3H40A 1Q1BA 1E1OA 5L9XA 4LFAQ 4IUUA 2RCFA 1XX8A 5AJ3Q 3ZJYC 5FLXL 2JEGA 4QWDA 5COYA 3IKJA 3LNNA 4RHSA 3IFDA 2Q8TA 1QWYA 2E74C 4GC7A 2OEOA 5CV9A 4RA8A 3QWNA 2Y0SB 3AYHB 3KDFA 4GNXB 4KY5A 5DNFA 5KGUA 4DA2A 2DPJA 1TWGH 1CSQA 3NWTA 3S17B 5KYLA 4ED0A 5I2YA 5JJZA 4DV1Q 1STYA 3NUCA 2UUBQ 2PO4A 1VQJA 3MTSA 4IOCA 1SROA 2W6MA 4GC6A 1HCZA 3BA9A 2A69D 1SNCA 1ILPA 4HNTA 3FDSA 3BABA 1HNXH 2R85A 2R8GA 1II3A 1X3EA 2HCCA 1GLVA 3R23A 5FO7B 1E7ZA 1ENCA 1U4MA 3QOLA 1NJIC 5LYJF 2AUKA 3OYYA 1EY8A 1XTDA 3MR5A 2XC9A 1HQRD 2HUGA 3ND8A 2W7OA 4DK1A 5DQHA 1O7YA 1GUOA 4DAMA 4KV6A 3N6XA 4H7BA 5IGDA 5IGCA 4O2DA 4G7ZC 4APMA 4A2BA 1J9OA 4RNOA 5M3FH 1OXXK 4CHTB 1AEXA 3KAJA 2HQEA 3ULJA 4DNRB 1EUDB 3H0GA 3GTGH 1RODA 2R86A 4WJ4A 2A5HA 2J0TD 1FKAH 2JK8A 4GN5A 5CV5A 2JN4A 1TS2A 1JC7A 3TN2A 4JG2A 3L2PA 5J22A 3N42B 4BBSH 4MV8A 1HR0W 5G3LD 5C44H 2TMPA 2SDFA 2F0HA 4CDEC 4LSAA 4IR1A 1SAPA 1XDNA 3C1FA 1V43A 1A3VA 5H80A 3BVGA 4Y52H 2QDLA 1ICFB 3QJYA 1SBBB 2F0FA 3Q0AA 2OTLA 1HNXQ 3BJUA 5LXTF 1I3QH 4GOPB 3IN5A 3V4SA 2YL2A 2PCFB 5J2UF 3KHRA 1F2ZA 3IAYA 1SCUB 1UC9A 2XRSD 3S14H 1EQVA 2WKDA 3AEVA 3CU7A 3QB3A 4OWTB 2FHTA 2JYOA 1JWUD 2FMMA 2R92A 5EGTA 2B2UA 1AZPA 5CV4A 4WJ3M 4YBZB 4J9RA 4A3MH 4RNMA 2UVVA 1Q90A 4JI1L 4CBVA 2EYMA 4ILWA 3R2IA 2IHEA 4UCOA 1FYCA 3I90A 2KHSA 4C1NK 4QIWB 4ED6A 1EL0A 3I91A 1SMYC 4UPAA 2X6LA 5JPMC 4F4XA 2KA7A 2ZM6Q 1J8IA 1MKHA 4P2CB 4A3DB 3W1BA 4DUYL 3J7AV 4DAPA 3BZCA 2I5MX 2E2HA 2R92H 1TT2A 1U5KA 1CUKA 1SR3A 2L12A 1DM0B 4QJFA 3TEHB 2FLLA 3MR3A 4EYHB 3BDLA 2IT1A 1XXGA 2UUBL 1WCMA 2MO0A 4K0KH 3T56B 3M9OB 1EWCA 2D5DA 5IWAL 4MZ9A 4IFDJ 2ZJRA 2DNEA 2XVSA 2PPBC 4MV6A 4YHHQ 3CVZA 3VPBA 1J6QA 5E4WC 4LFBL 1LTRD 1TWGB 2UVRA 3K5LA 1SYBA 2IBKA 3TZDA 1VDZA 1D6EC 3A7AB 4RUCA 2NZ1D 5KFNA 3RB0A 3G48A 1TU2B 2DGYA 1PLFA 4OEMB 4A3LH 3RB4A 1AN7A 1HR0L 2A1AA 5EWEA 2NVXH 3CAMA 4TRDA 2TSSA 3PO3G 4HR7B 4IUPA 4KD3A 3CD6A 4RGTA 4IURA 2BE5C 2O2LD 3GTJB 2ASBA 3FMAA 3T1YL 3BVMA 3I4NB 4RZQA 1YJNA 4Q8EA 3KLSA 3BQ1A 2Q2TA 1KNAA 1U0LA 1H9KA 4O1NA 3I3CA 2YS6A 4ECYA 2UVUA 2NU6B 5A35A 1VBGA 4TUYF 3OWFA 4A3LG 5DQGA 2VUMB 4DR3H 1ZYRD 4DR6L 2HJWA 4PMCA 4R4CA 2YU9B 5DG9A 1O7IA 4RB2C 4FO2A 4EBCA 4IPHA 2QILA 1Q3LA 4ZQ3A 3F2BA 2ALZA 2YZGA 4C3HB 3OPOA 4PMWA 4JI3L 3HOUB 3M3YH 5K36G 1B53A 3PUWA 1K28A 5GROA 1HPCA 1KRSA 2V58A 2R7MA 1EEID 4B3SQ 5C3WA 4XX0B 1G51A 5FLMH 1X3GA 4Z9CB 3H0GG 3S2DH 2UXBQ 3GTLA 1IZ6A 1SYDA 3JZIA 2PMZA 2R82A 2B39A 4DK6C 3MFIA 4ABNA 3J81j 1JE4A 5IE8A 3CKIB 3HOZB 2B2YA 1XNRH 1HTPA 3OTOL 4ME6A 2C9OA 3TP6A 2LXJA 4OL7A 4V190 3OUUA 4IPDA 1YJWA 3CHBD 3ULLA 3VR6A 3LWUA 1I94L 2FPGB 2DIKA 2RHQB 1YI2A 5D1OA 1GSHA 4U7CA 5KG5A 1DYQA 4LFCL 2NWGA 3PZPA 4IZ8A 5GAEC 1E2WA 4EVOA 4YJ2F 4B3RH 1S10A 2XTIA 3UQ8A 5IT9W 1S5FD 1SYGA 1CA6A 2BCOA 2ZDGA 4DV5H 1F2MA 3T1HH 4XT1B 1F2YA 1EY6A 5LA6F 1EZ6A 1Y1VB 2EOTA 4GZYC 2R7ZH 4JBMA 1QNKA 3H94A 4R8IA 4JI6Q 5A2QE 2VQFH 1L2ZA 2EYOA 1A3TA 5GONF 2LXKA 1DONA
chains in the Genus database with same CATH topology
2PI2A 1LUZA 2BH8A 2JA5H 1BBUA 4JI6L 1UE6A 4NPSA 4R4IA 4A3KG 3S15H 1K3RA 2VS1A 5FJ8G 4JI2L 2RCNA 2D0PA 3EBEA 1PFSA 1YEZA 2I5LX 4K0KQ 4GOPC 4GLXA 4LWCA 2OQKA 1TXYA 4RG1A 3J81c 4K0KL 1N32Q 5EAYA 4P74A 1IBKL 3BU2A 4NXML 3GTLH 3UE0A 2VNUD 3D0FA 4DUZL 2IX1A 3CCLA 1EIYB 3CPWA 3CF5A 5M5WH 3TS2A 4IOAA 2GVAA 3FKIH 1IL2A 4AH6A 5DLQE 4GLVB 3GTQH 2IY5B 5C44G 4QY7A 4DR1L 1BVSA 1E3PA 2KENA 4JYAL 2WB1E 2HT1A 2ZM6L 1Q8KA 2YV5A 4IPCA 1GD7A 3MEFA 4IJHA 1AE3A 1G291 3I7FA 3ER0A 4JV5Q 3D31A 4UY8C 1K0RA 1CKOA 2UUCL 3CQZH 4P71A 4TVAB 5GADC 1KRTA 5J3BA 5IT9c 1X55A 1CKMA 1A62A 4PZ7A 2B29A 3L7ZC 4ALPA 1GVPA 1N34L 3I55A 1X9NA 2FXQA 3I4OA 1KAWA 2AWNA 1VQLA 3OW2A 2Q2UA 3HOZG 1Y1VH 4P75A 3S1MH 3RLOA 5LMUQ 3STBC 3H3VI 4KLKA 3UE1A 5M3FG 4LF5L 1HNWQ 3L0OA 1YIJA 1L1OA 2NN6I 4LUOA 4AIMA 3JAMc 1N36L 3PO2G 4IO9A 3M7NA 1HNZQ 1T9HA 3KF8B 4B3SL 1DGSA 3CCJA 1Y1WG 3CCVA 1M90C 3CCEA 4YY3L 3WWVA 4IJLA 2ID0A 3T1HQ 2E2IH 4B3TL 4GOPA 3HOZH 3S2HH 2AMCB 4A3MG 1IYJB 4LF9L 4DV1L 3PUVA 2MNAA 3UDFA 2Z6KA 3HKZE 2N78A 3UDXA 3G6EA 2JQOA 1N33L 2E5LL 1LTLA 3A5UA 4GNXC 4NXNQ 3KDFB 1PH3A 1GM5A 4APVA 1AE2A 3HOXG 1YJ9A 4NXMQ 4X65L 2Z6KC 4A3BG 4POGA 2RF4A 2UXCL 2F4VL 4HIDA 3K7AH 3PGZA 4NB3A 3U4ZA 1PH8A 3HOWG 3FP9A 2C35B 3G71A 1XNQL 1JMCA 2B63H 3I56A 3EIVA 1Q7YC 4ME3A 5ELOA 2VQFQ 3FKIG 2Y0SG 3EN2A 3KOJA 2CWPA 5BR8L 4JBKA 4LFCQ 3HKSA 5C3EH 4DR6Q 3PO3H 2QEXA 1XMOQ 4XIGS 4X6AH 4EX5A 5FJ8H 4A4IA 3TS0A 3W1GA 2YTYA 5BR8Q 1ASZA 4GKJQ 1B8AA 4BA1I 5M3MG 1VQPA 4BXXG 1L0WA 3F1ZA 2MQHA 4JC0A 4DV4L 3CC2A 4H02A 2ATWA 2R7ZG 2R7FA 2JA8H 1WCMH 3JC66 4BY1G 5LMNQ 1JJ2A 3S1NH 4LF8L 1QUQA 1EIFA 4YY3Q 3T1HL 4DR7L 1X65A 4JI2Q 1NY4A 2B63G 2V1CC 4LF9Q 2NZHA 3J80c 4PZ6A 2JA6H 4GLAC 1S40A 5M3MH 4LNQA 1SFOH 4AYBE 5HY6A 1GO3E 4QIWE 2B3GA 4HIKA 4A76A 4DR3Q 2ES2A 4JI0L 4POFA 1Q1EA 5IP7G 3S1QH 1NBWA 3CCSA 1D8LA 4A3JH 1IBML 1EFWA 4PZ8A 4DR3L 4JI0Q 1YITA 4A3EG 4JBWA 3GTOH 5C4XG 4OXPA 2YU9H 3GTJH 2F4VQ 1VQGA 3A74A 4YCUA 2I0QA 1V9PA 4JI1Q 3NBHB 1HZBA 2WAQG 3KYHC 1XNQQ 1LM0A 2HHHQ 4C2MH 1PV4A 1VQEA 1VQDA 4JI5L 1HR0Q 3KF6B 2HHHL 4A75A 1WI5A 4HIOA 1W3SA 3M85A 3CP0A 1OXSC 3RZDH 2WAQE 1WJJA 2PNHA 3GD7A 1TWFH 1Y14B 3RN2A 4BBRG 4GNXA 1PHJA 3U58A 4DR5Q 1P8LA 1UE1A 5LMNL 1Q12A 4GN3B 1VQIA 2PQAB 2YTVA 4DV7L 1PH7A 4O0AA 1FJGL 1Y1WH 1Q81C 3FHWA 3CCRA 2BH2A 4DR7Q 3RLNA 2UUAL 1KHIA 2JE6I 1C9OA 1EWIA 2OQ0A 3KF6A 3MXNB 4JBJA 5C0XJ 3H0GH 4OONA 1NMGA 3HOVG 1SN8A 3DLLA 3K80C 1K8AC 1N36Q 5IYDG 1Q82C 3RNUA 1M1KC 3W5OA 1K9MC 2GVBA 3J7ZC 1CKNA 2NVYH 5LMUL 4DV2L 4A3FG 2VL6A 2DUDA 1TWAH 2NZOA 2PMZE 1HZCA 3BZKA 3A0JA 1N9WA 1VQ7A 4A93H 2EQSA 4FDBA 1HJPA 4C3IH 1Z9FA 1R9TH 4DV0Q 2JJQA 1SRUA 2A19A 2BA1A 2NN6G 5GAHC 3U50C 2QA4A 1HNZL 3CCUA 3I2ZA 1B7YB 5GAGC 1C0AA 2K14A 3I4NG 3B6YA 4X66Q 4HJ9A 4X62Q 1SE8A 4QL5A 3KJPA 4L5SA 4A3KH 3H3VH 2E5LQ 2K5NA 1YZ6A 4YWMA 4HIMA 2MO1A 3Q8DA 1GKHA 4DR1Q 3AQQA 3OTOQ 4OX9L 1Q86C 4C3JH 3TREA 5IYBG 1IBMQ 2UXCQ 2EIFA 3PCOB 4NXNL 2F52A 2OCEA 1MIUA 2K52A 1P16A 4UP7A 2K5VA 1VQFA 1ASYA 4J15A 2JA8G 4R4TA 3H15A 4LF4L 3DM3A 1PYSB 1PH4A 1D7QA 4Y7NH 2JA5G 3J81i 1I94Q 5JJLA 3M9BA 1Q1BA 2JA7H 4IFDI 1E1OA 3HOUG 3KFUA 5LMNW 3I4MH 4LFAQ 3PUXA 2R93G 2NVQH 4XTCS 5AJ3Q 4DR2L 3ZJYC 4A3GG 4DV4Q 4A3FH 4OWWB 3T1YQ 4MTNA 3M4QA 4KHPQ 3HOXH 1G6PA 4DV2Q 1PH5A 5C0XI 4YWLA 1XJVA 3AYHB 3KDFA 4DV7Q 4GNXB 1UEBA 1WCMG 1PH1A 4BY1H 4JI4L 2R92G 3GDEA 5IP9H 4HJ5A 2Y0SE 3G4SA 1QZHA 1TWGH 4A3CH 1CSQA 1RIPA 5IWAQ 4JI8Q 4HJ8A 4DV1Q 4BBSG 2UUBQ 2UXDL 1VQJA 3U4VA 4L5TA 1SROA 4IOCA 1A63A 1YBYA 1HH2P 1VQOA 1I6HH 1CKNB 4X64L 1QVFA 5JEAG 1K83H 1FGUA 1MJEA 2K4KA 4JI3Q 4B3RL 1MJCA 3PUZA 4P73A 1X3EA 5E7NA 4LW1A 4DKAC 2R7DA 4HJAA 1E7ZA 2PI2E 2VQEQ 3UDGA 3JAMi 1XMQL 1L1OB 1EUJA 1NJIC 1C7YA 1BBWA 3OYYA 4YCVA 1XTDA 4A3IH 4A3CG 5JJKA 2N49A 5FLXc 5FLMG 3RLFA 2AWOA 2CCZA 3CC4A 4KI0A 5IYCG 2Q2HA 2VQFL 4MNOA 4DAMA 3S16H 1TWCH 4O2DA 3AFPA 1IXRA 5M3FH 1OXXK 2ALYB 2UUCQ 3ICEA 4KHZA 3ULJA 3GTGH 4WJ4A 1I5FA 4DAYB 1K73C 4LF4Q 2K50A 4HJ7A 2JK8A 4GN5A 4A3EH 2VZAA 3ULPA 4BA2I 1X3FA 4AYBG 4JG2A 2K5HA 2R6GA 3L2PA 3S1RH 1XPRA 1PH6A 1EQQA 4BBSH 1HR0W 3RN5A 4QGUA 1JE5A 5C44H 1VQ4A 5C3EG 3PV0A 1JJCB 2YTXA 3UDIA 1V43A 4DUYQ 4YHHL 4LF6Q 1SMXA 1IBLQ 1OTCA 1JB7A 2VUMH 1E22A 3KJOA 4LFBQ 4Y52H 4EQ5A 1IBLL 4LUVA 3PIPA 1N32L 4LF8Q 2GN5A 2Q2IA 2OTLA 1YVCA 4L5RC 2L15A 1VCIA 3SGIA 1HNXQ 2AHOB 3BJUA 4JI7L 3HOWH 1I3QH 2EXDA 4GOPB 4A3BH 1RL2A 2LSSA 5M5XH 3F2DA 2JA7G 4DV3Q 5C4JH 1HNXL 3KLWA 2UXDQ 5IYCH 3S14H 3M4OH 4DPGA 4JOIC 4OO1I 4DV3L 4R1JA 4R4OA 3HOUH 2KCTA 1PVOA 1CSPA 4YCWA 4X62L 1S72A 3AEVA 1JJGA 3VDYA 1KIXA 4OWTB 2VUMG 2UU9Q 4X65Q 3HOYG 2CQOA 1Q46A 5M5YH 2HQLA 4BY7G 4WJ3M 4JV5L 1VQ9A 1NTGA 3RZOH 1E24A 3CW2C 4A3MH 4B3MQ 4DR4Q 4JI1L 4YWKA 3K7UC 2IHEA 4A3DG 1UE7A 3I4NH 5AJ3L 4DR2Q 3J7A5 2BA0A 3HOVH 3CMAA 2JEAI 4AQYL 4DK3C 1HZ9A 5IY0A 3PF5A 4UPAA 3GTPH 2KCMA 2HIVA 1QVCA 1I50H 2ZM6Q 1KC8C 1MKHA 4DNIA 3ERSX 3S17H 1XMOL 3W1BA 4DUYL 4LF6L 4R4QA 2I5HA 1NE3A 2WB1G 3IRBA 4BY7H 3BZCA 2I5MX 1V1QA 2VW9A 2ZJPA 1U5KA 1J5EL 1CUKA 1SR3A 4QJFA 4LF5Q 3TEHB 2R92H 3K0XA 2CFMA 4JI8L 1PA6A 2AKWB 1N34Q 1VQ5A 2IT1A 5C4XH 2UUBL 4JI7Q 2MO0A 2WFWA 2D62A 2E2JH 3PF4A 1VQAA 3HFZB 2A8VA 5IWAL 4MZ9A 4IFDJ 2ZJRA 4LF7L 1YNXA 2JA6G 2F3IA 4YHHQ 1KQSA 2N3SA 3J80i 4GN4B 1N33Q 1KXLA 1J6QA 3GTMH 3HOYH 3GO5A 1PH2A 4DV6Q 4LFBL 2WP8J 1S3OA 1K8GA 1PYBA 4GKKL 4B3RQ 4P72A 5ELNA 4B3TQ 1Z47A 3G48A 1YHQA 4UP8A 2DGYA 2RHSB 1QZGA 1IBKQ 5IP9G 4B3ML 4DR4L 4GKKQ 1EYGA 4A3LH 4DUZQ 1HR0L 4JI5Q 2A1AA 2ZTDA 2NVXH 3I4MG 2R93H 3CAMA 4JCVE 2QGQA 3PUYA 4GS3A 3PO3G 3TQYA 4JOIA 4LUZA 4TQUS 2XGTA 3CD6A 1LYLA 1OXTA 3LGJA 2ASBA 2KHJA 2MFIA 1EQRA 3T1YL 4OWXB 1YHBA 1YJNA 2Q2TA 3CPFA 3CMEA 1U0LA 2N8NA 1VQ8A 3PSIA 1VQNA 1J5EQ 1WOCA 5C0XG 4DR5L 3TRZA 1FL0A 4A3LG 1XPOA 4AQYQ 4OO1G 2PQAA 3CXCA 4DV5Q 4QQBX 1SLJA 4C3HH 5JJIA 1TWHH 1WYDA 3E9HA 4DR6L 4R4CA 1NMFA 2Z0SA 5HGQA 1XNRL 5IYDH 2UUAQ 1O7IA 1OXVA 2E8GA 2IX0A 2KBNA 1L1OC 4IFDG 3HKZG 4IPHA 4X64Q 1E1TA 5IYBH 2CKZB 3F2BA 4A93G 4BXXH 4PMWA 4JI3L 1WFQA 4DV6L 3M3YH 1A8VA 3PUWA 5K36G 3GTKH 1UE5A 3E0EA 5GROA 1L2FA 4JI4Q 2K75A 2OWOA 1KRSA 1X56A 2YYZA 2D0OA 2VQEL 5GQOA 1VQMA 1XMQQ 2VY3A 1VQBA 3NELA 4B3SQ 3CCQA 2UXBL 1G51A 5FLMH 1X3GA 1JT8A 3H0GG 2KHIA 1EOVA 1B70B 3S2DH 1YHAA 2UXBQ 3E9IA 3PIOA 4LF7Q 3NENA 1IZ6A 4X66L 2ZJQA 3CCMA 1BKBA 3PO2H 1FVIA 1VS0A 1KD1C 4DK6C 1A0IA 2JA9A 1PH9A 4IPGA 3J81j 1XPUA 2CWAA 1VQHA 2IHFA 1OXUA 4BBRH 5IE8A 3F2CA 3OTOL 4OX9Q 2UU9L 4RMFA 3CC7A 4A3JG 2LXJA 1VQKA 4IPDA 3STBD 3AFQA 3ULLA 5H1SE 1YJWA 1N8RC 1I94L 4L5QA 1X54A 2ZTEA 2RHQB 1UWVA 4A3IG 3RR5A 1QUQB 1YI2A 4A3DH 4LFAL 1FJGQ 5JEAJ 4LFCL 3S24A 1KL9A 5GAEC 2E2HH 1H95A 3M4PA 1HZAA 1Y1VG 2OTJA 4GKJL 4KHPL 2XTIA 3A5ZB 4JYAQ 3NEMA 2H5XA 3F8TA 3K81C 1XNRQ 2ZTCA 1HNWL 1W2BA 1QVGA 4A3GH 1AH9A 2JEBI 4UP9A 3K8AA 1X6OA 2R7ZH 5IP7H 4JBMA 2NVTH 1VQ6A 2HIXA 4DV0L 4PG3A 4JI6Q 4DV5L 1VQCA 2LXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI2 A;  1LUZ A;  2BH8 A;  2JA5 H;  1BBU A;  4JI6 L;  1UE6 A;  4NPS A;  4R4I A;  4A3K G;  3S15 H;  1K3R A;  2VS1 A;  5FJ8 G;  4JI2 L;  2RCN A;  2D0P A;  3EBE A;  1PFS A;  1YEZ A;  2I5L X;  4K0K Q;  4GOP C;  4GLX A;  4LWC A;  2OQK A;  1TXY A;  4RG1 A;  3J81 c;  4K0K L;  1N32 Q;  5EAY A;  4P74 A;  1IBK L;  3BU2 A;  4NXM L;  3GTL H;  3UE0 A;  2VNU D;  3D0F A;  4DUZ L;  2IX1 A;  3CCL A;  1EIY B;  3CPW A;  3CF5 A;  5M5W H;  3TS2 A;  4IOA A;  2GVA A;  3FKI H;  1IL2 A;  4AH6 A;  5DLQ E;  4GLV B;  3GTQ H;  2IY5 B;  5C44 G;  4QY7 A;  4DR1 L;  1BVS A;  1E3P A;  2KEN A;  4JYA L;  2WB1 E;  2HT1 A;  2ZM6 L;  1Q8K A;  2YV5 A;  4IPC A;  1GD7 A;  3MEF A;  4IJH A;  1AE3 A;  1G29 1;  3I7F A;  3ER0 A;  4JV5 Q;  3D31 A;  4UY8 C;  1K0R A;  1CKO A;  2UUC L;  3CQZ H;  4P71 A;  4TVA B;  5GAD C;  1KRT A;  5J3B A;  5IT9 c;  1X55 A;  1CKM A;  1A62 A;  4PZ7 A;  2B29 A;  3L7Z C;  4ALP A;  1GVP A;  1N34 L;  3I55 A;  1X9N A;  2FXQ A;  3I4O A;  1KAW A;  2AWN A;  1VQL A;  3OW2 A;  2Q2U A;  3HOZ G;  1Y1V H;  4P75 A;  3S1M H;  3RLO A;  5LMU Q;  3STB C;  3H3V I;  4KLK A;  3UE1 A;  5M3F G;  4LF5 L;  1HNW Q;  3L0O A;  1YIJ A;  1L1O A;  2NN6 I;  4LUO A;  4AIM A;  3JAM c;  1N36 L;  3PO2 G;  4IO9 A;  3M7N A;  1HNZ Q;  1T9H A;  3KF8 B;  4B3S L;  1DGS A;  3CCJ A;  1Y1W G;  3CCV A;  1M90 C;  3CCE A;  4YY3 L;  3WWV A;  4IJL A;  2ID0 A;  3T1H Q;  2E2I H;  4B3T L;  4GOP A;  3HOZ H;  3S2H H;  2AMC B;  4A3M G;  1IYJ B;  4LF9 L;  4DV1 L;  3PUV A;  2MNA A;  3UDF A;  2Z6K A;  3HKZ E;  2N78 A;  3UDX A;  3G6E A;  2JQO A;  1N33 L;  2E5L L;  1LTL A;  3A5U A;  4GNX C;  4NXN Q;  3KDF B;  1PH3 A;  1GM5 A;  4APV A;  1AE2 A;  3HOX G;  1YJ9 A;  4NXM Q;  4X65 L;  2Z6K C;  4A3B G;  4POG A;  2RF4 A;  2UXC L;  2F4V L;  4HID A;  3K7A H;  3PGZ A;  4NB3 A;  3U4Z A;  1PH8 A;  3HOW G;  3FP9 A;  2C35 B;  3G71 A;  1XNQ L;  1JMC A;  2B63 H;  3I56 A;  3EIV A;  1Q7Y C;  4ME3 A;  5ELO A;  2VQF Q;  3FKI G;  2Y0S G;  3EN2 A;  3KOJ A;  2CWP A;  5BR8 L;  4JBK A;  4LFC Q;  3HKS A;  5C3E H;  4DR6 Q;  3PO3 H;  2QEX A;  1XMO Q;  4XIG S;  4X6A H;  4EX5 A;  5FJ8 H;  4A4I A;  3TS0 A;  3W1G A;  2YTY A;  5BR8 Q;  1ASZ A;  4GKJ Q;  1B8A A;  4BA1 I;  5M3M G;  1VQP A;  4BXX G;  1L0W A;  3F1Z A;  2MQH A;  4JC0 A;  4DV4 L;  3CC2 A;  4H02 A;  2ATW A;  2R7Z G;  2R7F A;  2JA8 H;  1WCM H;  3JC6 6;  4BY1 G;  5LMN Q;  1JJ2 A;  3S1N H;  4LF8 L;  1QUQ A;  1EIF A;  4YY3 Q;  3T1H L;  4DR7 L;  1X65 A;  4JI2 Q;  1NY4 A;  2B63 G;  2V1C C;  4LF9 Q;  2NZH A;  3J80 c;  4PZ6 A;  2JA6 H;  4GLA C;  1S40 A;  5M3M H;  4LNQ A;  1SFO H;  4AYB E;  5HY6 A;  1GO3 E;  4QIW E;  2B3G A;  4HIK A;  4A76 A;  4DR3 Q;  2ES2 A;  4JI0 L;  4POF A;  1Q1E A;  5IP7 G;  3S1Q H;  1NBW A;  3CCS A;  1D8L A;  4A3J H;  1IBM L;  1EFW A;  4PZ8 A;  4DR3 L;  4JI0 Q;  1YIT A;  4A3E G;  4JBW A;  3GTO H;  5C4X G;  4OXP A;  2YU9 H;  3GTJ H;  2F4V Q;  1VQG A;  3A74 A;  4YCU A;  2I0Q A;  1V9P A;  4JI1 Q;  3NBH B;  1HZB A;  2WAQ G;  3KYH C;  1XNQ Q;  1LM0 A;  2HHH Q;  4C2M H;  1PV4 A;  1VQE A;  1VQD A;  4JI5 L;  1HR0 Q;  3KF6 B;  2HHH L;  4A75 A;  1WI5 A;  4HIO A;  1W3S A;  3M85 A;  3CP0 A;  1OXS C;  3RZD H;  2WAQ E;  1WJJ A;  2PNH A;  3GD7 A;  1TWF H;  1Y14 B;  3RN2 A;  4BBR G;  4GNX A;  1PHJ A;  3U58 A;  4DR5 Q;  1P8L A;  1UE1 A;  5LMN L;  1Q12 A;  4GN3 B;  1VQI A;  2PQA B;  2YTV A;  4DV7 L;  1PH7 A;  4O0A A;  1FJG L;  1Y1W H;  1Q81 C;  3FHW A;  3CCR A;  2BH2 A;  4DR7 Q;  3RLN A;  2UUA L;  1KHI A;  2JE6 I;  1C9O A;  1EWI A;  2OQ0 A;  3KF6 A;  3MXN B;  4JBJ A;  5C0X J;  3H0G H;  4OON A;  1NMG A;  3HOV G;  1SN8 A;  3DLL A;  3K80 C;  1K8A C;  1N36 Q;  5IYD G;  1Q82 C;  3RNU A;  1M1K C;  3W5O A;  1K9M C;  2GVB A;  3J7Z C;  1CKN A;  2NVY H;  5LMU L;  4DV2 L;  4A3F G;  2VL6 A;  2DUD A;  1TWA H;  2NZO A;  2PMZ E;  1HZC A;  3BZK A;  3A0J A;  1N9W A;  1VQ7 A;  4A93 H;  2EQS A;  4FDB A;  1HJP A;  4C3I H;  1Z9F A;  1R9T H;  4DV0 Q;  2JJQ A;  1SRU A;  2A19 A;  2BA1 A;  2NN6 G;  5GAH C;  3U50 C;  2QA4 A;  1HNZ L;  3CCU A;  3I2Z A;  1B7Y B;  5GAG C;  1C0A A;  2K14 A;  3I4N G;  3B6Y A;  4X66 Q;  4HJ9 A;  4X62 Q;  1SE8 A;  4QL5 A;  3KJP A;  4L5S A;  4A3K H;  3H3V H;  2E5L Q;  2K5N A;  1YZ6 A;  4YWM A;  4HIM A;  2MO1 A;  3Q8D A;  1GKH A;  4DR1 Q;  3AQQ A;  3OTO Q;  4OX9 L;  1Q86 C;  4C3J H;  3TRE A;  5IYB G;  1IBM Q;  2UXC Q;  2EIF A;  3PCO B;  4NXN L;  2F52 A;  2OCE A;  1MIU A;  2K52 A;  1P16 A;  4UP7 A;  2K5V A;  1VQF A;  1ASY A;  4J15 A;  2JA8 G;  4R4T A;  3H15 A;  4LF4 L;  3DM3 A;  1PYS B;  1PH4 A;  1D7Q A;  4Y7N H;  2JA5 G;  3J81 i;  1I94 Q;  5JJL A;  3M9B A;  1Q1B A;  2JA7 H;  4IFD I;  1E1O A;  3HOU G;  3KFU A;  5LMN W;  3I4M H;  4LFA Q;  3PUX A;  2R93 G;  2NVQ H;  4XTC S;  5AJ3 Q;  4DR2 L;  3ZJY C;  4A3G G;  4DV4 Q;  4A3F H;  4OWW B;  3T1Y Q;  4MTN A;  3M4Q A;  4KHP Q;  3HOX H;  1G6P A;  4DV2 Q;  1PH5 A;  5C0X I;  4YWL A;  1XJV A;  3AYH B;  3KDF A;  4DV7 Q;  4GNX B;  1UEB A;  1WCM G;  1PH1 A;  4BY1 H;  4JI4 L;  2R92 G;  3GDE A;  5IP9 H;  4HJ5 A;  2Y0S E;  3G4S A;  1QZH A;  1TWG H;  4A3C H;  1CSQ A;  1RIP A;  5IWA Q;  4JI8 Q;  4HJ8 A;  4DV1 Q;  4BBS G;  2UUB Q;  2UXD L;  1VQJ A;  3U4V A;  4L5T A;  1SRO A;  4IOC A;  1A63 A;  1YBY A;  1HH2 P;  1VQO A;  1I6H H;  1CKN B;  4X64 L;  1QVF A;  5JEA G;  1K83 H;  1FGU A;  1MJE A;  2K4K A;  4JI3 Q;  4B3R L;  1MJC A;  3PUZ A;  4P73 A;  1X3E A;  5E7N A;  4LW1 A;  4DKA C;  2R7D A;  4HJA A;  1E7Z A;  2PI2 E;  2VQE Q;  3UDG A;  3JAM i;  1XMQ L;  1L1O B;  1EUJ A;  1NJI C;  1C7Y A;  1BBW A;  3OYY A;  4YCV A;  1XTD A;  4A3I H;  4A3C G;  5JJK A;  2N49 A;  5FLX c;  5FLM G;  3RLF A;  2AWO A;  2CCZ A;  3CC4 A;  4KI0 A;  5IYC G;  2Q2H A;  2VQF L;  4MNO A;  4DAM A;  3S16 H;  1TWC H;  4O2D A;  3AFP A;  1IXR A;  5M3F H;  1OXX K;  2ALY B;  2UUC Q;  3ICE A;  4KHZ A;  3ULJ A;  3GTG H;  4WJ4 A;  1I5F A;  4DAY B;  1K73 C;  4LF4 Q;  2K50 A;  4HJ7 A;  2JK8 A;  4GN5 A;  4A3E H;  2VZA A;  3ULP A;  4BA2 I;  1X3F A;  4AYB G;  4JG2 A;  2K5H A;  2R6G A;  3L2P A;  3S1R H;  1XPR A;  1PH6 A;  1EQQ A;  4BBS H;  1HR0 W;  3RN5 A;  4QGU A;  1JE5 A;  5C44 H;  1VQ4 A;  5C3E G;  3PV0 A;  1JJC B;  2YTX A;  3UDI A;  1V43 A;  4DUY Q;  4YHH L;  4LF6 Q;  1SMX A;  1IBL Q;  1OTC A;  1JB7 A;  2VUM H;  1E22 A;  3KJO A;  4LFB Q;  4Y52 H;  4EQ5 A;  1IBL L;  4LUV A;  3PIP A;  1N32 L;  4LF8 Q;  2GN5 A;  2Q2I A;  2OTL A;  1YVC A;  4L5R C;  2L15 A;  1VCI A;  3SGI A;  1HNX Q;  2AHO B;  3BJU A;  4JI7 L;  3HOW H;  1I3Q H;  2EXD A;  4GOP B;  4A3B H;  1RL2 A;  2LSS A;  5M5X H;  3F2D A;  2JA7 G;  4DV3 Q;  5C4J H;  1HNX L;  3KLW A;  2UXD Q;  5IYC H;  3S14 H;  3M4O H;  4DPG A;  4JOI C;  4OO1 I;  4DV3 L;  4R1J A;  4R4O A;  3HOU H;  2KCT A;  1PVO A;  1CSP A;  4YCW A;  4X62 L;  1S72 A;  3AEV A;  1JJG A;  3VDY A;  1KIX A;  4OWT B;  2VUM G;  2UU9 Q;  4X65 Q;  3HOY G;  2CQO A;  1Q46 A;  5M5Y H;  2HQL A;  4BY7 G;  4WJ3 M;  4JV5 L;  1VQ9 A;  1NTG A;  3RZO H;  1E24 A;  3CW2 C;  4A3M H;  4B3M Q;  4DR4 Q;  4JI1 L;  4YWK A;  3K7U C;  2IHE A;  4A3D G;  1UE7 A;  3I4N H;  5AJ3 L;  4DR2 Q;  3J7A 5;  2BA0 A;  3HOV H;  3CMA A;  2JEA I;  4AQY L;  4DK3 C;  1HZ9 A;  5IY0 A;  3PF5 A;  4UPA A;  3GTP H;  2KCM A;  2HIV A;  1QVC A;  1I50 H;  2ZM6 Q;  1KC8 C;  1MKH A;  4DNI A;  3ERS X;  3S17 H;  1XMO L;  3W1B A;  4DUY L;  4LF6 L;  4R4Q A;  2I5H A;  1NE3 A;  2WB1 G;  3IRB A;  4BY7 H;  3BZC A;  2I5M X;  1V1Q A;  2VW9 A;  2ZJP A;  1U5K A;  1J5E L;  1CUK A;  1SR3 A;  4QJF A;  4LF5 Q;  3TEH B;  2R92 H;  3K0X A;  2CFM A;  4JI8 L;  1PA6 A;  2AKW B;  1N34 Q;  1VQ5 A;  2IT1 A;  5C4X H;  2UUB L;  4JI7 Q;  2MO0 A;  2WFW A;  2D62 A;  2E2J H;  3PF4 A;  1VQA A;  3HFZ B;  2A8V A;  5IWA L;  4MZ9 A;  4IFD J;  2ZJR A;  4LF7 L;  1YNX A;  2JA6 G;  2F3I A;  4YHH Q;  1KQS A;  2N3S A;  3J80 i;  4GN4 B;  1N33 Q;  1KXL A;  1J6Q A;  3GTM H;  3HOY H;  3GO5 A;  1PH2 A;  4DV6 Q;  4LFB L;  2WP8 J;  1S3O A;  1K8G A;  1PYB A;  4GKK L;  4B3R Q;  4P72 A;  5ELN A;  4B3T Q;  1Z47 A;  3G48 A;  1YHQ A;  4UP8 A;  2DGY A;  2RHS B;  1QZG A;  1IBK Q;  5IP9 G;  4B3M L;  4DR4 L;  4GKK Q;  1EYG A;  4A3L H;  4DUZ Q;  1HR0 L;  4JI5 Q;  2A1A A;  2ZTD A;  2NVX H;  3I4M G;  2R93 H;  3CAM A;  4JCV E;  2QGQ A;  3PUY A;  4GS3 A;  3PO3 G;  3TQY A;  4JOI A;  4LUZ A;  4TQU S;  2XGT A;  3CD6 A;  1LYL A;  1OXT A;  3LGJ A;  2ASB A;  2KHJ A;  2MFI A;  1EQR A;  3T1Y L;  4OWX B;  1YHB A;  1YJN A;  2Q2T A;  3CPF A;  3CME A;  1U0L A;  2N8N A;  1VQ8 A;  3PSI A;  1VQN A;  1J5E Q;  1WOC A;  5C0X G;  4DR5 L;  3TRZ A;  1FL0 A;  4A3L G;  1XPO A;  4AQY Q;  4OO1 G;  2PQA A;  3CXC A;  4DV5 Q;  4QQB X;  1SLJ A;  4C3H H;  5JJI A;  1TWH H;  1WYD A;  3E9H A;  4DR6 L;  4R4C A;  1NMF A;  2Z0S A;  5HGQ A;  1XNR L;  5IYD H;  2UUA Q;  1O7I A;  1OXV A;  2E8G A;  2IX0 A;  2KBN A;  1L1O C;  4IFD G;  3HKZ G;  4IPH A;  4X64 Q;  1E1T A;  5IYB H;  2CKZ B;  3F2B A;  4A93 G;  4BXX H;  4PMW A;  4JI3 L;  1WFQ A;  4DV6 L;  3M3Y H;  1A8V A;  3PUW A;  5K36 G;  3GTK H;  1UE5 A;  3E0E A;  5GRO A;  1L2F A;  4JI4 Q;  2K75 A;  2OWO A;  1KRS A;  1X56 A;  2YYZ A;  2D0O A;  2VQE L;  5GQO A;  1VQM A;  1XMQ Q;  2VY3 A;  1VQB A;  3NEL A;  4B3S Q;  3CCQ A;  2UXB L;  1G51 A;  5FLM H;  1X3G A;  1JT8 A;  3H0G G;  2KHI A;  1EOV A;  1B70 B;  3S2D H;  1YHA A;  2UXB Q;  3E9I A;  3PIO A;  4LF7 Q;  3NEN A;  1IZ6 A;  4X66 L;  2ZJQ A;  3CCM A;  1BKB A;  3PO2 H;  1FVI A;  1VS0 A;  1KD1 C;  4DK6 C;  1A0I A;  2JA9 A;  1PH9 A;  4IPG A;  3J81 j;  1XPU A;  2CWA A;  1VQH A;  2IHF A;  1OXU A;  4BBR H;  5IE8 A;  3F2C A;  3OTO L;  4OX9 Q;  2UU9 L;  4RMF A;  3CC7 A;  4A3J G;  2LXJ A;  1VQK A;  4IPD A;  3STB D;  3AFQ A;  3ULL A;  5H1S E;  1YJW A;  1N8R C;  1I94 L;  4L5Q A;  1X54 A;  2ZTE A;  2RHQ B;  1UWV A;  4A3I G;  3RR5 A;  1QUQ B;  1YI2 A;  4A3D H;  4LFA L;  1FJG Q;  5JEA J;  4LFC L;  3S24 A;  1KL9 A;  5GAE C;  2E2H H;  1H95 A;  3M4P A;  1HZA A;  1Y1V G;  2OTJ A;  4GKJ L;  4KHP L;  2XTI A;  3A5Z B;  4JYA Q;  3NEM A;  2H5X A;  3F8T A;  3K81 C;  1XNR Q;  2ZTC A;  1HNW L;  1W2B A;  1QVG A;  4A3G H;  1AH9 A;  2JEB I;  4UP9 A;  3K8A A;  1X6O A;  2R7Z H;  5IP7 H;  4JBM A;  2NVT H;  1VQ6 A;  2HIX A;  4DV0 L;  4PG3 A;  4JI6 Q;  4DV5 L;  1VQC A;  2LXK A; 
#chains in the Genus database with same CATH topology
 1WD0 A;  1LUZ A;  1WTH A;  1SE2 A;  2BH8 A;  1BBU A;  2JA5 H;  2O5I C;  5KT2 A;  3MR2 A;  1FD7 D;  4A3K G;  3VMM A;  2VS1 A;  1XMQ H;  2VB3 X;  1LT6 D;  1PZJ D;  3T51 B;  1GOZ A;  1PZI D;  1PFS A;  4XQQ A;  3LX0 A;  3TP5 A;  3HOW B;  2XIG A;  4MHE A;  5K5P A;  2VQE H;  3OMG A;  3VYS A;  4GLX A;  3PR4 A;  2OQK A;  2J6U A;  4R8U B;  4Q5V A;  2KEE A;  4I7H A;  5FLX W;  1LAB A;  3J81 c;  1N32 Q;  1ZET A;  1B9M A;  4RB0 A;  3UE0 A;  1BXR A;  2D2C C;  4A3G B;  3D0F A;  3FRP B;  4JUZ A;  2ZXP A;  1D1I A;  3CPW A;  4RZR A;  3GTM B;  4QW8 A;  1ENA A;  1JQY D;  1Y8N B;  2GVA A;  1M4V A;  2YZN A;  2R8I A;  4NXM H;  3BVZ A;  3OHB A;  3GQC A;  2WB1 E;  4RKL A;  1A15 A;  3TME A;  2JA7 B;  1AE3 A;  1G29 1;  3ER0 A;  2E2H B;  2UUC L;  2NVX B;  4LF5 H;  3PO3 B;  4TVA B;  3WO0 A;  1MBY A;  4DXG A;  3QFF A;  1A62 A;  1N34 L;  5NUC A;  4FXK C;  4B08 A;  1KAW A;  1GHK A;  5I6Y A;  1IBL H;  4F4Y A;  1MD2 D;  4P75 A;  3RLO A;  5CMD A;  3H3V I;  4KLK A;  3UE1 A;  3OWE B;  3L0O A;  4LUO A;  1UNS A;  4IO9 A;  3BQ2 A;  4DAV A;  2KVM A;  2QKI C;  4X3T A;  3M7N A;  3HGB A;  5KX5 F;  3GTP A;  1HNZ Q;  1EEF D;  3MFG A;  1TWC B;  4B3S L;  3G6J B;  2DLN A;  2NU7 B;  2H4O A;  3CCV A;  3CCE A;  4YY3 L;  3T1H Q;  2E2I H;  3BDC A;  3NSW A;  4B3T L;  4OEL B;  5DGA A;  1NCV A;  2RSN A;  2MNA A;  2Z6K A;  1S97 A;  2N78 A;  1JDE A;  1FNV A;  1NR2 A;  2JQO A;  2PBZ A;  1N33 L;  1W93 A;  4GNX C;  4IFD H;  5KFW A;  4NXN Q;  3KDF B;  1STE A;  2VPS A;  5IYZ F;  4C3J G;  3N44 B;  2XCL A;  2EY5 A;  3HOX G;  3FKI B;  4NXM Q;  4R8N A;  1JIC A;  1F9R A;  4RWS C;  5CA1 F;  3K5N A;  2UXC L;  2K32 A;  3FPP A;  2NU9 B;  4BWS C;  4NB3 A;  3U4Z A;  1PH8 A;  3K5H A;  1O7L A;  2CHB D;  1WTQ A;  5J39 A;  1SYX B;  3H3V C;  3N40 P;  4OHJ A;  1B2T A;  2MHV A;  3OTO H;  3EN2 A;  3KOJ A;  3RUP A;  2CWP A;  4DV0 H;  1RJR A;  4GKK H;  5BR8 Q;  1Y8P B;  5FD5 A;  1JKJ B;  2ZT9 C;  3CC2 A;  1TKW B;  4JC0 A;  2DNC A;  1SMY D;  5C5M A;  4ZLT F;  4DV4 L;  2ATW A;  2P0A A;  4JV2 A;  4J6H A;  4BBS B;  3SE0 A;  3PN1 A;  3JC6 6;  2CZG A;  1SFO A;  3SI8 A;  3A55 A;  2N55 A;  3S1N H;  4MIU A;  3J7A F;  4LF8 L;  5LMU H;  1QUQ A;  5M5Y B;  3T1H L;  4DR7 L;  4Q44 A;  1NY4 A;  1JDB B;  5EOY A;  1RK5 A;  2F0Q A;  1Z2O X;  4GLA C;  2R7K A;  3OHA A;  2WV6 D;  1S40 A;  5KYI A;  5HY6 A;  1UC8 A;  4K0K L;  3R8B A;  4O42 A;  2RDH A;  3CCS A;  4A3J H;  4A3K B;  1TS5 A;  4K5W A;  4DF7 A;  1G2T A;  1EFW A;  1S9F A;  1IW7 D;  1MSH A;  1STN A;  5FLX E;  5C4X G;  5M3F B;  2YU9 H;  2EXZ A;  3D4D A;  1V9P A;  2R6F A;  3H6M A;  3I12 A;  3GLK A;  4ECR A;  1VQE A;  2WAC A;  4JI5 L;  1IOW A;  2HHH L;  1VAJ A;  1WI5 A;  3V2T A;  3K5I A;  5D65 A;  1D5Z C;  1Y14 B;  1CHP D;  5I9P A;  2IA6 A;  1R4P B;  5BR8 H;  4QUF A;  2XIW A;  4GN3 B;  3S16 B;  2YTV A;  4YHH H;  3I72 A;  4XDX A;  3FHW A;  2BH2 A;  3T1Y H;  4DR7 Q;  3RLN A;  4OX9 H;  5FKA C;  1EWI A;  4IOA A;  1EU4 A;  2JP1 A;  1ZQ7 A;  2DZD A;  1TY2 A;  3K80 C;  3C0F B;  1M1K C;  1B04 A;  2GVB A;  2VR1 A;  1VQ5 A;  2VL6 A;  2NZO A;  3OIQ A;  1VQ7 A;  4ZK9 B;  1HA5 A;  4I4T F;  4J9K A;  2UUA H;  2RVL A;  4EGJ A;  1SRU A;  1LTA D;  2BA1 A;  5GAH C;  3EFX D;  2XGQ A;  3ZYY X;  5CV8 A;  1A2U A;  2NUA B;  3HOY B;  2IJ0 A;  4X66 Q;  3GP7 A;  4HJ9 A;  4JI3 H;  3Q24 A;  2K5N A;  4HIM A;  3EJI A;  2I46 A;  4MA5 A;  2LFN A;  1GKH A;  3C1E A;  3AQQ A;  3OTO Q;  4YY3 H;  1HR0 H;  1IBM Q;  2UXC Q;  4TQR A;  3PCO B;  3GIP A;  2F52 A;  3NTH A;  1GUG A;  1BCP C;  4U67 3;  1B1Z A;  2B2V C;  4J1M A;  3H4B A;  2K5V A;  2X0S A;  3SHL A;  4DV3 H;  1SSO A;  2UXD H;  4R4T A;  3I73 A;  3H15 A;  3NTI A;  4LF4 L;  1KBL A;  3AB9 A;  5EBC A;  4Y7N H;  2PZW A;  4NMZ A;  5BMV F;  3RTX A;  2WTF A;  3KFU A;  1GUT A;  2R93 G;  3RGZ A;  1OO9 B;  1KTK A;  5FO8 B;  4XTC S;  4DR2 L;  2EYF A;  2UXC H;  1WVL A;  4KHP Q;  3T1Y Q;  4MTN A;  4F4Z A;  1G6P A;  1RKN A;  5EQ0 A;  3QZ8 A;  1PH5 A;  1NR4 A;  1SJH D;  3CQZ A;  1I4P A;  1XJV A;  5I9O A;  1UEB A;  1WCM G;  4BY1 H;  2R92 G;  2F3W A;  3GDE A;  5IP9 H;  5JPN C;  5T14 A;  4RFB A;  4HJ5 A;  5KFT A;  3RAX A;  2UU9 H;  3Q23 A;  4HJ8 A;  3G6Y A;  2Z8L A;  3NGD A;  4BBS G;  4KJN A;  3RIZ A;  4RCO A;  1YBY A;  3G6V A;  1HH2 P;  4X64 L;  2EDG A;  1K83 H;  1YNJ D;  5JEA G;  1M6V A;  1MJE A;  2K4K A;  3J81 E;  3R3O A;  4JI3 Q;  4LF9 H;  1RDP D;  5E7N A;  3FPU B;  1ILQ A;  4J9L A;  2R7D A;  4HJA A;  2PI2 E;  1XMQ L;  1C7Y A;  4MV3 A;  5KT4 A;  4YCV A;  5JJK A;  4H0L C;  1C48 A;  5I6W A;  1EYZ A;  3FDT A;  1LTB D;  2AWO A;  4J8Q A;  3RLF A;  4J0M A;  4J9N A;  3CC4 A;  4KI0 A;  3SK4 A;  4X65 H;  5IYC G;  2Q2H A;  2J6T A;  2B2V A;  5LL6 X;  5FPR A;  5CAE B;  2ASJ A;  3JAM E;  1Y1W B;  1Y1W A;  1PRT C;  1B3A A;  2NYZ D;  3I4L A;  2VA2 A;  2UUC Q;  3ICE A;  4CC6 A;  4DL4 A;  1G8Z D;  4KHZ A;  3GIL A;  4C2M B;  5E3F A;  5ELE A;  2VZA A;  4M1U B;  3WDN A;  5EPK A;  1AFP A;  4AYB G;  5ELC A;  4KY6 A;  4IWY A;  4FXD A;  1GSA A;  1JJC B;  2QF7 A;  2FB9 A;  2L9H A;  1N56 A;  4LF6 Q;  4YHH L;  3JRX A;  1ENF A;  1SMX A;  4DV1 H;  1TWC A;  4LFB Q;  4ED8 A;  1IBL L;  3SEB A;  4LUV A;  4L5R C;  1YVC A;  5KFY A;  3QZ7 A;  1VCI A;  3KHG A;  3MFY A;  3HOW H;  1M0W A;  2EXD A;  3O13 A;  4R7R A;  3F2D A;  4DV3 Q;  5C4J H;  3WO1 A;  3KLW A;  4U68 A;  1TR5 A;  2UXD Q;  3BA8 A;  2MUY A;  4XYO A;  4DPG A;  4OO1 I;  3RBE A;  1Z7T A;  4R4O A;  2KCT A;  1T5E A;  4LF6 H;  4X62 L;  1GJX A;  3GID A;  3VDY A;  1KIX A;  2UU9 Q;  1LT3 D;  1ET6 A;  3HOY G;  1QIL A;  5M5Y H;  2HQL A;  1MHW C;  5BN5 A;  4JV5 L;  2B63 A;  3K5O A;  1E24 A;  1TY0 A;  2SNM A;  4FF1 A;  4DR4 Q;  5ELB A;  3GV8 B;  3Q8P B;  1D5X C;  1NSN S;  1V1O A;  4V0B A;  3I4N H;  5AJ3 L;  4JW0 A;  4CJ0 B;  3J7A 5;  3HOV H;  1WTW A;  3VYR A;  4DK3 C;  4E6I A;  4JI4 H;  2KCM A;  2CH4 W;  1QVC A;  5CC4 A;  5KG4 A;  1XMO L;  4LAA A;  4HNV A;  4O3S A;  4DU9 A;  4C56 C;  4BY7 H;  2VW9 A;  2ZJP A;  1T36 A;  1I6H B;  3J80 W;  2XCP A;  1WD1 A;  2WIN B;  3GTM A;  4DR2 H;  3VYU A;  4DV2 H;  2V9W A;  1N34 Q;  3SVM A;  4ETS A;  3PF4 A;  4EEY A;  2C2D A;  4A3J B;  1VQA A;  1IBK H;  2K01 A;  3M4Y A;  1F9P A;  2NVY A;  2C2R A;  1YNX A;  2F3I A;  2XNA C;  2N3S A;  2IW3 A;  2C22 A;  3OOC A;  3GTM H;  4H44 C;  3MAQ A;  3GO5 A;  4DV6 Q;  1R9T A;  1VF7 A;  1S3O A;  4JI6 H;  5F2D A;  1F9S A;  2SEB D;  4YR3 A;  3PW0 A;  2NB0 A;  2O03 A;  2A68 C;  4B3R Q;  2FK2 A;  2V59 A;  4EBE A;  2XN9 C;  2Z1C A;  1B3Q A;  1CK1 A;  4LF7 H;  4B3T Q;  1Z47 A;  2CH4 A;  1I6U A;  4UP8 A;  4GKK Q;  2RHS B;  3MXG A;  1IBK Q;  4DR4 L;  3EVQ A;  4ED7 A;  4DUZ Q;  4JI5 Q;  2A6H C;  2F0V A;  4H13 C;  4MAM A;  1HA6 A;  1KDC A;  1XYI A;  3I4M G;  1JLL B;  1IW7 C;  1D1K A;  1ET9 A;  1YNN D;  3PUY A;  4GS3 A;  4I7A A;  5C3X A;  4TQU S;  3KXY T;  2XGT A;  3ERQ A;  1OXT A;  2MGS A;  1YHB A;  2K5D A;  5CYU A;  1ONL A;  2NVQ B;  3CME A;  1VQ8 A;  3HBL A;  2Z6B A;  3PSI A;  4EFE A;  1U9R A;  1FL0 A;  5BN3 A;  5CGK A;  4AQY Q;  5JJI A;  1SLJ A;  5KFC A;  3Q8Q B;  2FIN B;  1TWH H;  1WYD A;  1PK8 A;  2RGV A;  4EQO A;  3BYY B;  1NMF A;  4QIW A;  1BF4 A;  5TSS A;  3PIP 3;  2XCA A;  1L1O C;  1K0S A;  3R5F A;  2CKZ B;  4A93 G;  3QR8 A;  4BXX H;  4IR9 A;  1WFQ A;  1A8V A;  4EFB A;  4JI4 Q;  2XRQ D;  4NDX A;  2VQE L;  5G3L F;  1WTO A;  2VY3 A;  3VA5 A;  1LT4 D;  3NEL A;  3CCQ A;  2UXB L;  1SNM A;  4KY7 A;  3NEN A;  4X66 L;  1PRT B;  1W96 A;  1RYR A;  1CQV A;  3KUP A;  1K3B C;  5EBD A;  4BBR H;  1OXU A;  4OX9 Q;  3I8Z A;  4RMF A;  4UCR A;  4FS2 A;  5T1I A;  1S4Z A;  1RJP A;  2JA5 A;  1N8R C;  4L5Q A;  4A3D H;  3RR5 A;  1E2Z A;  1F77 A;  2P5Z X;  2EYJ A;  4G4K A;  3S24 A;  2E2H H;  3M4P A;  2OTJ A;  5D8D A;  4GKJ L;  4KHP L;  5BPF A;  4JYA Q;  3RJ0 A;  4CDC C;  2JA7 A;  2M2L A;  1JWM D;  3C2P A;  1HNW L;  3S2D B;  1AH9 A;  4ECT A;  4LFA H;  1W6K A;  4N8X 1;  3MHB A;  1Z2N X;  4JI2 H;  2JEB I;  2CW7 A;  4S3S A;  2HIX A;  3HKZ A;  1PX2 A;  2X6G A;  4NXN H;  1I50 B;  4XQN A;  2EYP A;  1PDQ A;  2DJG C;  4R4I A;  4KJO A;  3S15 H;  5FJ8 G;  2RDI A;  1WTP A;  2RCN A;  4I65 A;  3EBE A;  2F3V A;  1YEZ A;  3QIA A;  3NTK A;  3IG0 A;  1VMP A;  1PTO B;  4ECU A;  1G2S A;  2R7L A;  1TXY A;  2AGP A;  1ZYR C;  1IBK L;  1Q8I A;  4DUZ L;  2IX1 A;  4LMQ D;  1I50 A;  3AMU A;  1CS0 A;  2R7Z B;  4IN3 A;  3TS2 A;  1TQO A;  1V4Y A;  1L0X B;  4ZRZ A;  5KFM A;  5EPJ A;  2B8G A;  1EOT A;  1LLR D;  1F2L A;  5C8Y F;  4LF4 H;  2HT1 A;  4J9Q A;  1RTN A;  1N48 A;  3RUZ A;  4IPC A;  3DEO A;  1S5B D;  4IJH A;  3I7F A;  2ENB A;  5J2T F;  3D31 A;  1CKO A;  3HB9 A;  5KFF A;  2BE5 D;  3IL8 A;  4WOR A;  3OW7 A;  1KRT A;  5J3B A;  5CBE E;  3J81 L;  1BCP F;  1GVP A;  1PMR A;  4ALP A;  1CE8 A;  3KLR A;  3KLS X;  2FXQ A;  3I4O A;  3C46 A;  5JQW A;  4RGN A;  4R8U A;  4NKL A;  1JCK B;  1PRT F;  3S1M H;  1G6Z A;  5LMU Q;  3PW7 A;  5IGF A;  4RHR A;  5A2Q W;  1L1O A;  1N36 L;  5KND A;  1H9J A;  4K8J A;  2ATL A;  3MC0 B;  3DM1 A;  4A3M G;  1IYJ B;  4LF9 L;  4DV1 L;  3PUV A;  1JOR A;  3PQI A;  3UDX A;  3RZO B;  5EKL A;  3G6E A;  4XYL B;  2E5L L;  4J9M A;  3T5L A;  3BJY A;  1GUN A;  1SYC A;  5DG7 A;  2EY2 A;  1YJ9 A;  2EJG C;  2ZDH A;  4X65 L;  2Z6K C;  4A3B G;  5C3E B;  4POG A;  3WNZ A;  4HID A;  4X66 H;  3ETH A;  3A54 A;  3G71 A;  2G9D A;  1XNQ L;  3E3X A;  2KCN A;  3PVX A;  4C3J B;  4K5V A;  2V4R A;  1KDA A;  3FKI G;  1RYS A;  1SJE D;  3K5M A;  4BY1 B;  5BR8 L;  1ZHQ A;  3JRW A;  1EIG A;  1ZEQ X;  3HKS A;  1XMO Q;  5EDW A;  4HED A;  5FJ8 H;  2F0L A;  4KTA A;  5EKK A;  2M00 A;  2B63 B;  2MQH A;  4H02 A;  2R7F A;  1RJT A;  4K8I A;  2D9U A;  2W9C A;  4IAJ A;  5C44 B;  1KAB A;  1FGB D;  2HDL A;  4L63 B;  4XZ3 B;  4YY3 Q;  2WII B;  1DIK A;  2RGR A;  3ETJ A;  1WR2 A;  3JAM W;  4LF9 Q;  2J7Z A;  2B2W C;  5KFI A;  4LNQ A;  5D14 A;  4DN4 M;  2F0S A;  5LOV F;  3D8G A;  1GO3 E;  4QIW E;  3S2H B;  3MWE A;  4A76 A;  2ES2 A;  4J9S A;  5IP7 G;  1Q1E A;  3SR1 A;  1D8L A;  4ED1 A;  4M8A A;  4DR3 L;  1YIT A;  4IRD A;  3GTO H;  4OXP A;  3RV4 A;  2ZM6 H;  4O2A F;  2CW0 C;  2L55 A;  3A74 A;  3H09 A;  3CRL C;  2I0Q A;  1BCP B;  4JI1 Q;  4C5C A;  1HZB A;  5JAV A;  4C2M H;  1LTT D;  4C1N I;  3KF6 B;  2FMC A;  5C4X B;  4HIO A;  1VF5 C;  1W3S A;  4C3I B;  3M85 A;  2VOB A;  2YYA A;  3H20 A;  1H9S A;  3RZD H;  2R8H A;  2WAQ E;  1WJJ A;  3N6R A;  3ND9 A;  1HFN A;  3GD7 A;  1NAP A;  1TWF H;  1O78 A;  4GNX A;  4ZYS A;  3U58 A;  4JPB W;  2RA4 A;  3NK9 A;  3D3R A;  4G57 A;  3WOF A;  4DR5 Q;  2GLT A;  4JVZ A;  5FOB B;  4ZHQ F;  2DY7 A;  1VQI A;  2EYL A;  2ZJT A;  1JWS D;  4HSP A;  4CKE A;  5LHY 1;  4RNN A;  2B8F A;  2JE6 I;  4AQY L;  2OQ0 A;  3KF6 A;  3H0G H;  4ZUJ A;  3DLL A;  1K8A C;  2E2I A;  5IYD G;  4BWG B;  1H9R A;  2B2U C;  1K9M C;  4DV2 L;  1CKN A;  2NU8 B;  2DUD A;  3TP7 A;  4Q0Y A;  2RQX A;  3BZK A;  1N9W A;  4L8J A;  4FDB A;  4OIK A;  1BNC A;  4LFC H;  2A19 A;  3U50 C;  1HNZ L;  3S1M B;  3FMC A;  1SEB D;  3PW4 A;  1K83 B;  1JXL A;  1FNU A;  1PYW D;  4L5S A;  1AUX A;  3KJP A;  3V6K A;  1YZ6 A;  4YB8 B;  2MO1 A;  2XGP A;  2PN1 A;  2YRX A;  4OX9 L;  4DR4 H;  1Q86 C;  1ESF A;  3TRE A;  2PYK A;  2BQR A;  2PVP A;  2YW2 A;  4QWB A;  4O3R A;  2K52 A;  1AW7 A;  2WE6 A;  2EY1 A;  5KEE A;  4ZAI A;  1KJ8 A;  4J15 A;  1E4F T;  1XWE A;  1PYS B;  2E5L H;  4KN7 C;  3M9B A;  3NHH A;  3J80 E;  1DOM A;  5JVH 3;  5LMN W;  1EY5 A;  1XTC D;  2NVQ H;  3S1N B;  1TWH A;  4BS9 A;  4X3U A;  5HUR A;  4A3G G;  4DV4 Q;  4A3F H;  4OWW B;  1Y69 U;  3M4Q A;  4JI1 H;  1XNQ H;  4IUQ A;  5C0X I;  4YWL A;  2CVR A;  4LH7 A;  4FS1 A;  1I4X A;  2SOB A;  4RAZ A;  4IUN A;  3L9A X;  2RKS A;  2Y0S E;  3N41 B;  4JI0 H;  1CI3 M;  3BQ0 A;  1ESR A;  1GUS A;  3ERO A;  3LWE A;  3X3N A;  5C6A A;  2UXD L;  2B2W A;  2FPI B;  2KED A;  2R92 B;  1CKN B;  3K3P A;  4WBN F;  3RD4 A;  3QG1 A;  1LT5 D;  2FJZ A;  1KJQ A;  3V05 A;  4P73 A;  1Y1V A;  4XT3 B;  4LW1 A;  3T5K A;  2OLS A;  4X62 H;  3JAM i;  2DJF C;  1EUJ A;  4A3C G;  1BBW A;  1U4P A;  4UFZ A;  3R5H A;  1F9Q A;  5C5J A;  1DV2 A;  4TQS A;  2N49 A;  5FLM G;  4O3O A;  2CCZ A;  2E2D C;  4EEQ A;  1WSC A;  5LP6 F;  1JX4 A;  5EZY F;  3S1Q B;  2VPQ A;  2JEJ A;  3D4W A;  5EPL A;  2F4V H;  3OUZ A;  1TWC H;  2C00 A;  2H1E A;  3AFP A;  1IXR A;  5JUM A;  2ALY B;  1STB A;  4B3T H;  1HTL D;  3X3M A;  1ZXT A;  2AUJ D;  3W2D A;  1DOK A;  4KHP H;  5I4D A;  2K50 A;  4A3E H;  1M0T A;  5KFJ A;  3EPI A;  5CB4 F;  3ULP A;  4ED3 A;  4BA2 I;  2K5H A;  5AFW A;  3GTL B;  1EQQ A;  4U6P A;  1JE5 A;  1VQ4 A;  2NTS A;  1B50 A;  4K2L A;  2B2Y C;  2YTX A;  3UDI A;  3R5X A;  1IBL Q;  3JSL A;  1JB7 A;  2JA5 B;  4HR7 A;  2KUM A;  1STG A;  3LML A;  3PIP A;  4IWX A;  3BS1 A;  2Q2I A;  1RHP A;  3VR5 A;  4LF8 Q;  5KT7 A;  4JI7 L;  3TQ1 A;  3MA2 B;  1RL2 A;  2LSS A;  1V1P A;  3HEJ A;  3EYY A;  3M4O H;  2NUC A;  4JOI C;  4R1J A;  3HOU H;  2VUM A;  1S72 A;  4YCW A;  4M9U A;  1R9T B;  4WD3 A;  3J81 W;  4K6D A;  3RB3 A;  4KK7 A;  3MR6 A;  4A3I B;  2VUM G;  5LL6 S;  1X3Q A;  3DXJ C;  4X65 Q;  4IUV A;  4BY7 G;  2R3Z A;  2A6E C;  1VQ9 A;  3RZO H;  1RCV D;  3CW2 C;  3D6W A;  1FNW A;  3U9O A;  2V5A A;  1TS4 A;  3K7U C;  3PO2 B;  3DUZ A;  1BCP D;  2Q8R E;  4DR2 Q;  4FF3 A;  1M7J A;  4MV1 A;  3MXP A;  5IOD A;  1TVX A;  4PV1 C;  1K1Q A;  1IL8 A;  3GTP H;  5D1O B;  2EZV A;  2HIV A;  1RF2 D;  1I50 H;  1KC8 C;  2F0D A;  4DNI A;  3A56 A;  3S17 H;  1KJI A;  4R9W A;  1KLG D;  3GTO B;  5IGB A;  2W9A A;  4LF6 L;  4R4Q A;  4DFA A;  1NE3 A;  1V1Q A;  1J5E L;  1RD9 D;  3GV3 A;  3LWB A;  2CFM A;  1PA6 A;  1K83 A;  1B9N A;  3TBI B;  1KNE A;  5C4X H;  3E6Z X;  5IIF A;  2WFW A;  4DL5 A;  4DR7 H;  5CV7 A;  2A8V A;  2MP1 A;  1GSO A;  3TIN A;  1CHQ D;  3KHL A;  5KFH A;  3UFX B;  4KKT A;  2JA6 G;  1KQS A;  3L4K A;  5C5L A;  1NNX A;  3J80 i;  4GN4 B;  1N33 Q;  1KXL A;  4ECZ A;  2JA6 A;  1PH2 A;  2UUB H;  2HCI A;  3GTP B;  1CA5 A;  1K8G A;  2JXM B;  2K6A A;  2FMA A;  1PYB A;  3GV6 A;  1S0O A;  5KFD A;  5ELN A;  2J4X A;  5DLG A;  1XMO H;  4MTD A;  1TWA A;  1UNN C;  1BR9 A;  1IHZ A;  4CJ2 C;  4CGY B;  2ZTD A;  4ECW A;  1SYE A;  3N52 A;  5KFK A;  4MV9 A;  2QGQ A;  5KFZ A;  4JV0 A;  2IX3 A;  5COR A;  4O2B F;  2MFI A;  1EQR A;  1UEA B;  2NTT A;  5DM6 3;  2W71 A;  2N8N A;  1VQN A;  2WDT A;  3K58 A;  1WOC A;  1J5E Q;  4DR5 L;  4QWC A;  1S0M A;  1XPO A;  4ECS A;  4OO1 G;  2PQA A;  4QQB X;  4C3H H;  4QWE A;  5IT9 E;  2F0T A;  5KFG A;  2EPB A;  4O4H F;  3E9H A;  3M9N B;  2R7Z A;  2BDO A;  1I4H A;  2Z0S A;  1TAE A;  2UUA Q;  1OXV A;  2E8G A;  1I3Q A;  4IFD G;  1EYA A;  3HKZ G;  4N9T A;  3M4I A;  1E1T A;  5IYB H;  2M05 A;  4Q0F A;  3S1R B;  4DV6 L;  1SE4 A;  1O80 A;  3E0E A;  1GUW A;  2HVQ A;  1Z2P X;  5T1G A;  2W6Z A;  1X56 A;  2YYZ A;  1BOS A;  2D0O A;  1E4G T;  1VQM A;  2Z4H A;  1VQB A;  2HVR A;  1VKZ A;  4UHV A;  3QOJ A;  4BBR B;  2YU9 A;  3E9I A;  4HN7 A;  4LF7 Q;  2RBM A;  3WOE A;  3CCM A;  1V1P B;  1FVI A;  1VS0 A;  1KD1 C;  5KFU A;  1KJJ A;  1A9X A;  1T3N A;  4C5B A;  2KCC A;  4NW2 A;  2IHF A;  2UU9 L;  3GIK A;  3CC7 A;  3D4R A;  1H9M A;  3STB D;  3AFQ A;  4A3F B;  2ZTE A;  1UWV A;  4A3I G;  1HRJ A;  4LH6 A;  2BQU A;  1FJG Q;  2L5T A;  5JEA J;  1TWF B;  2Z9H A;  1K1S A;  1KL9 A;  1H95 A;  5L1J A;  1JOK A;  1HZA A;  2EJM A;  2R87 A;  2JEF A;  3NEM A;  3F8T A;  4RH6 A;  2ZTC A;  1C4Q A;  1S68 A;  3URY A;  4IRK A;  4ZUI A;  2AGO A;  2PNR C;  2WKC A;  4UP9 A;  1X6O A;  2LKV A;  5M5W B;  1WH2 A;  2EVB A;  5IP7 H;  5BPH A;  2NVT H;  4DV0 L;  1B6R A;  4KHV A;  4PG3 A;  2VQD A;  5JH7 F;  4DV5 L;  1VQC A;  5DLF A;  4FP5 D;  2J6S A;  1UAP A;  2NBF A;  1IBM H;  3HRZ C;  1UE6 A;  4KN4 C;  3M3Y B;  1K3R A;  3AU7 A;  5DQI A;  1EY0 A;  3KTM A;  2OH2 A;  2FK1 A;  2D0P A;  1J5E H;  5KNB A;  1CFM A;  3HP3 A;  4GOP C;  3BZD B;  2W57 A;  3C3L A;  4AYB B;  5L1L A;  1X32 A;  4IRC A;  2SCU B;  3BU2 A;  4NXM L;  4EBD A;  2JA6 B;  1S0N A;  2F0J A;  4MTK A;  2RDF A;  5KFS A;  1QJO A;  3H4D A;  1EY4 A;  3FKI H;  3TQT A;  4HMJ A;  2QCP X;  4AH6 A;  2F0G A;  3BAA A;  4YP3 A;  2UUC H;  1BVS A;  1E3P A;  4JYA L;  3PMF A;  1WTV A;  1Q8K A;  1TWH B;  2YV5 A;  2FE3 A;  1GD7 A;  5CBA E;  3MEF A;  4IQZ A;  2DN8 A;  3GQB A;  4CC5 A;  1YNN C;  3H0G B;  5KRU A;  1B33 N;  3HZX A;  3DWA A;  3BYT B;  3CQZ H;  2W7P A;  1PTO H;  3OMC A;  2HHH H;  1A3U A;  2BDN A;  1CKM A;  4RU9 A;  2B29 A;  3L7Z C;  1VBH A;  3I55 A;  1X9N A;  1AZQ A;  2F0M A;  3U9S A;  1VQL A;  3OW2 A;  3HOZ G;  1JR0 D;  4HCE A;  2WB1 A;  3Q22 A;  3UI2 A;  4LF5 L;  5M3F G;  2QK4 A;  2PQE A;  4JV5 H;  1YIJ A;  3KBX A;  3JAM c;  1GHJ A;  2DY8 A;  4DR5 H;  2E2J B;  4LK1 C;  2W6Q A;  3M4O B;  2XWB B;  2F0E A;  1RTO A;  3KF8 B;  1OWT A;  1PXU A;  1U4L A;  3CCJ A;  4UCS A;  4DL2 A;  1M90 C;  1PFM A;  3T4A C;  4IJL A;  3HKZ B;  5I47 A;  2FLP A;  4GOP A;  4RCN A;  3HOZ H;  5KG1 A;  3UDF A;  1SYF A;  3HKZ E;  3MXN A;  3EA6 A;  1GYF A;  4Y8V B;  2DWC A;  4B3S H;  3HS0 C;  5DG8 A;  2A6E D;  5F9L A;  3A5U A;  2E2I B;  5JVL A;  5L37 A;  3U9T A;  1PH3 A;  5M5X B;  1GM5 A;  4O4I F;  4APV A;  4KD4 A;  2KJX A;  5K36 H;  4F8M A;  3RAQ A;  1M8A A;  1A2T A;  1AP0 A;  4K14 A;  2F4V L;  3K7A H;  3HOW G;  3FP9 A;  5M3M B;  2W6N A;  4DV4 H;  2AQ1 B;  3BG3 A;  4J9O A;  1S5D D;  4ME3 A;  1CQI B;  2I80 A;  4A3B B;  4LFC Q;  4QF4 A;  4JBK A;  3V6J A;  4DR6 Q;  4Q43 A;  4X6A H;  2HVS A;  4A4I A;  4GKJ Q;  3BDO A;  3ITP A;  3S9W A;  5IT9 L;  2F0O A;  4BXX G;  2ZDQ A;  4N9P A;  1DZ1 A;  1EQT A;  1WCM H;  4BY1 G;  5LMN Q;  1JJ2 A;  2Z4I A;  5EWF A;  4L1K A;  3D6C A;  4DLK A;  2RDJ A;  1Y8O B;  1X65 A;  2B63 G;  3KK7 A;  1CZW A;  3R2T A;  4Q45 A;  3OSO A;  4PZ6 A;  4F4W A;  2EE1 A;  1HNZ H;  2E76 C;  4ID6 A;  5BN4 A;  3VR3 A;  3Q6S A;  4TKO B;  4AYB E;  5IGE A;  4HIK A;  2B3G A;  5LMN H;  1UUP A;  4DR3 Q;  4POF A;  3S1Q H;  1NBW A;  1B4O A;  4JI5 H;  1S03 G;  1IBM L;  4JI0 Q;  4TV8 F;  1TA8 A;  4A3E G;  1AN8 A;  2K7V A;  2XWJ B;  5ELD A;  2WYO A;  1CTM A;  2L0C A;  2F4V Q;  1VQG A;  2O5J C;  1IOV A;  1SXT A;  3KAL A;  4X64 H;  1MZB A;  4PWQ A;  1MI2 A;  5KG6 A;  3KYH C;  1XNQ Q;  2HHH Q;  4HYK A;  4QUC A;  1PV4 A;  5KT3 A;  1VQD A;  1V51 A;  2AQ4 A;  4A75 A;  3DEP A;  2B2T C;  4HQ6 A;  5IOC A;  4O4L F;  3MFH A;  2UXB H;  3ONA B;  3HOV B;  2FPP B;  2Y0S A;  2IPK D;  2PQA B;  4C3I G;  2AGQ A;  5FO9 B;  3G8C A;  4Q8F A;  4O0A A;  5M9O A;  3V6H A;  3CCR A;  1GXD C;  2UUA L;  1KHI A;  4LF5 Q;  1C9O A;  3Q1K A;  2W8L A;  5C0X J;  3RB6 A;  2LS0 1;  4OON A;  1NMG A;  4PQX A;  1N36 Q;  2C2E A;  4FF2 A;  1KLU D;  4RAU C;  3RNU A;  3W5O A;  3J7Z C;  2NVY H;  1TWA H;  2PMZ E;  2G5D A;  2QEJ C;  3A0J A;  2OF1 A;  1I4R A;  4C3I H;  1Z9F A;  2K1B A;  1R9T H;  4KKU A;  5CR3 A;  1AUV A;  4ULL A;  4O3Q A;  1LAC A;  2VB2 X;  5ISR A;  3CCU A;  4GKJ H;  1PRT D;  4A2A A;  4UCT A;  1C0A A;  3L4J A;  2FJ2 A;  3G7L A;  3B6Y A;  3KF8 A;  3I4N G;  3T16 A;  1Z6H A;  2QDB A;  4X62 Q;  1SE8 A;  1G91 A;  1S5E D;  4A3K H;  2E5L Q;  4F50 A;  4QW9 A;  2LY7 A;  3GV5 B;  4MV4 A;  3Q8D A;  4DK0 A;  4DR1 Q;  3J7A K;  2EYH A;  2DPI A;  4AQY H;  1HFG A;  4C3J H;  2K33 A;  2GA4 B;  5IYB G;  4NXN L;  1HUN A;  2CQY A;  3PW2 A;  1RK6 A;  1B44 D;  1P16 A;  2OT2 A;  4C5A A;  1ASY A;  3SK5 A;  5KG7 A;  2KSW A;  4C3H G;  5JJL A;  3GTQ A;  2JA7 H;  4IFD I;  3HOU G;  2XD4 A;  3I4M H;  2WB1 B;  2EY6 A;  3PUX A;  2K5W A;  1C8C A;  1LTS D;  3VPD A;  5FD6 A;  5JVD F;  2X69 A;  1QNU A;  2AQ3 B;  2CW0 D;  3HOX H;  1H9S B;  3T13 A;  4DV2 Q;  1C30 A;  1TS3 A;  2W9B A;  1O7Z A;  4KKS A;  1GGO A;  5KFR A;  5C1P A;  2WAQ A;  1DXM A;  4DV7 Q;  3T5J A;  4F7X A;  2HD3 A;  1STA A;  4JI4 L;  1PH1 A;  3GII A;  3NBH A;  3G4S A;  1QZH A;  3SDZ A;  1RIP A;  4A3C H;  5IWA Q;  4JI8 Q;  4G7O C;  5CA0 F;  1EZ8 A;  4RGM A;  4DV6 H;  4UAI A;  4OGQ C;  3U4V A;  4L5T A;  1A63 A;  4EQN A;  1VQO A;  1I6H H;  4CKB A;  1QVF A;  1PTO F;  2AU0 A;  1FGU A;  3OHX C;  1HXY D;  1HQM C;  4FF4 A;  3MWM A;  4B3R L;  3ORR A;  5F9N A;  1MJC A;  3PUZ A;  3FVQ A;  1CQJ B;  4DKA C;  5KG2 A;  1LV9 A;  4FYD A;  2VQE Q;  3UDG A;  1BGW A;  4I50 F;  1L1O B;  4DR1 H;  3RZD B;  3JSN A;  3PW5 A;  1QB5 D;  4A3I H;  4WRD A;  5E1F A;  4DL6 A;  2J9G A;  2YZM A;  5FLX c;  2ASD A;  1CT1 D;  1DV1 A;  1LTI D;  2VQF L;  4MNO A;  4YIJ A;  3S16 H;  4YAK B;  2E75 C;  4A3E B;  1EYC A;  2B2T A;  2BOS A;  4KMU C;  1C3O A;  4PMB A;  5DAU A;  4FBU A;  5JOB A;  4XQJ A;  4TSS A;  3KBG A;  2EJF C;  2NVX A;  1LO5 D;  2I8C A;  4ECQ A;  1I5F A;  4DAY B;  1K73 C;  4LF4 Q;  4HJ7 A;  4N8F A;  4OO1 H;  3IFT A;  3NE5 B;  4DGZ A;  1X3F A;  3S1R H;  1KC7 A;  2IL8 A;  2R6G A;  1XPR A;  1SND A;  1PH6 A;  5FPO A;  5KIX A;  3RN5 A;  2O4X A;  4QGU A;  4O3P A;  1B6S A;  5C3E G;  3PV0 A;  3K0Y A;  4EYI B;  4QCL A;  3J80 L;  4DUY Q;  1K8M A;  1OTC A;  2VUM H;  1DCZ A;  1E22 A;  4FVM A;  3KJO A;  4EQ5 A;  3FKI A;  1MSG A;  3E5S A;  1N32 L;  3RF2 A;  2XSC A;  4X3K A;  2GN5 A;  5JVG 3;  4XYM B;  2A73 B;  2L15 A;  3SGI A;  4A3B H;  1I7L A;  2AHO B;  2CQA A;  5M5X H;  4G7H C;  2JA7 G;  5K2M A;  1HNX L;  3W3A A;  2W8K A;  5IYC H;  1BQQ T;  4F87 A;  4WFN 3;  4DV3 L;  1PVO A;  4DUY H;  1WTX A;  1CSP A;  3K7A B;  1FR3 A;  4Y7N B;  1JJG A;  1WCM B;  1ZHS A;  3N43 B;  2FLN A;  4ECV A;  2W70 A;  2CQO A;  2F4I A;  2YCH A;  4ZCK A;  2NN6 H;  1Q46 A;  4YR2 A;  4UCV A;  3P20 A;  3S14 B;  1K8O A;  3K59 A;  4MN3 A;  1NTG A;  3TDQ A;  5C4H A;  4B3M Q;  3E5N A;  1PFB A;  2R61 A;  4YJ3 F;  4YWK A;  4JYA H;  3RMH A;  2K28 A;  4A3D G;  1I4Q A;  1BBX C;  3V4Z A;  1UE7 A;  5L1K A;  4CKC A;  2BA0 A;  3TSS A;  3CMA A;  2JEA I;  4BY7 B;  3ORQ A;  3GTG B;  3GTG A;  3DHQ A;  2MCT A;  4JI7 H;  1HZ9 A;  5IY0 A;  3CQZ B;  3PF5 A;  3N8D A;  3GTJ A;  2QW7 A;  1JIH A;  1KAA A;  2GPS A;  5L1I A;  4EG0 A;  3ERS X;  3CRK C;  2I07 B;  5DM7 3;  2I5H A;  2WB1 G;  3IRB A;  1N33 H;  2FP4 B;  3SK8 A;  3K0X A;  4YAJ B;  1EWH A;  3NPP A;  4JI8 L;  1HUM A;  2AKW B;  3GV7 B;  4HAE A;  4JI7 Q;  2D62 A;  2E2J H;  3HOX B;  2R7N A;  3HFZ B;  1E4E A;  4LF7 L;  2MPM A;  1JB3 A;  1BUV T;  1EFI D;  3RFC A;  1R4Q B;  1SNQ A;  1E2V A;  4DXF A;  3HOY H;  2UVW A;  2WP8 J;  3BG5 A;  4GKK L;  1W6J A;  5KFL A;  2ICI A;  2L4N A;  4P72 A;  4QB4 A;  3RGX A;  1YHQ A;  1QZG A;  5EKI A;  2Q8I B;  5IP9 G;  4B3M L;  1EYG A;  1T5X D;  2QYZ A;  5KFV A;  5C0X H;  2NVY B;  2C5C A;  2R93 H;  1E4E B;  4JCV E;  4ECX A;  3TQY A;  1EUC B;  4JOI A;  4LUZ A;  2YRW A;  1FJG H;  1LYL A;  3LGJ A;  1PTO C;  4JK1 C;  2KHJ A;  1CZG A;  4OWX B;  2F03 A;  2VUG A;  1KJ9 A;  3CPF A;  1I4G A;  3TZU A;  3VYT A;  1TWF A;  1A6X A;  5C0X G;  2FKL A;  3F2U A;  3TRZ A;  3EPG A;  4FM9 A;  4QMG A;  3CXC A;  4DV5 Q;  4DAY A;  2PZT A;  5A2Q L;  1ULZ A;  2F0N A;  5EWG A;  5HGQ A;  5IYD H;  1XNR L;  2NVT B;  1KDB A;  2KEC A;  2IX0 A;  2KBN A;  4X64 Q;  2K03 A;  1I94 H;  4IZO A;  4FXG C;  2IWH A;  1CQF A;  2PMZ B;  3GTK H;  1UE5 A;  1L2F A;  4ZQI A;  1EY9 A;  2K75 A;  2OWO A;  3A8K E;  1TWG A;  1XMQ Q;  5GQO A;  2HDM A;  3KAK A;  3MVV A;  1JT8 A;  3G6X A;  2M9V A;  2KHI A;  4MA0 A;  1JOQ A;  1EOV A;  1B70 B;  3PIO 3;  1YHA A;  2G9H D;  3PIO A;  3OIP A;  3VA7 A;  2ZJQ A;  1BKB A;  1BO0 A;  1IYV A;  3PO2 H;  4G3I A;  4FNF A;  2PW7 A;  2KQ3 A;  1A0I A;  2JA9 A;  1PH9 A;  4IPG A;  1XPU A;  2OXP A;  2CWA A;  1VQH A;  2RSO A;  3RBD A;  4CDD C;  3F2C A;  4O3N A;  3T5H A;  4A3J G;  1VQK A;  2F0P A;  3A7L A;  2SNS A;  5FK9 C;  3Q8S B;  2K5Q A;  5H1S E;  3DMU A;  1X54 A;  2F0W A;  2MJ8 A;  1QUQ B;  5KFE A;  4LFA L;  3KHH A;  3SE7 A;  1Y1V G;  5D3D A;  2A68 D;  4MTE A;  1DOL A;  4ZKB B;  2AQ2 B;  3A5Z B;  5E4X A;  2H5X A;  3K81 C;  1XNR Q;  1QE6 A;  3DF7 A;  1HHV A;  4A3M B;  3LP8 A;  3VPC A;  1W2B A;  4WJW A;  1QVG A;  1DJR D;  4A3G H;  1EU3 A;  5KNC A;  2A6H D;  4B9X A;  1SEI A;  5JEA H;  1EHI A;  1SNP A;  5I2X A;  3I4M B;  3K8A A;  3MEH A;  1VQ6 A;  3GTQ B;  5D3I B;  3K57 A;  3PR5 B;  1HNW H;  2PI2 A;  4EGQ A;  4JI6 L;  3VR4 A;  5KG0 A;  4I7Z C;  3QO2 A;  4NPS A;  4X3S A;  3TP8 A;  2CW8 A;  2BQ3 A;  2A74 C;  4JI2 L;  2V4Q A;  4RAY A;  2I5L X;  1I3Q B;  4K0K Q;  2YS7 A;  1PFN A;  5C4J B;  2WAQ B;  4LWC A;  1LTG D;  3EQL C;  4LJZ C;  4RG1 A;  4LMY A;  2BR0 A;  3GIJ A;  5EAY A;  4P74 A;  2A69 C;  4B9W A;  3GTL H;  4EQP A;  2IP4 A;  3A8J E;  2VNU D;  3Q8R B;  5ELF A;  4NLG A;  3CCL A;  1EIY B;  1JOO A;  1MGS A;  1DD2 A;  3CF5 A;  5M5W H;  5KFX A;  2R8J A;  3GIM A;  1IL2 A;  1ZKO A;  5DLQ E;  4GLV B;  3GTQ H;  5EJW A;  1L0Y B;  2IY5 B;  5C44 G;  4DV7 H;  2R84 A;  4QY7 A;  4DR1 L;  1TII D;  4HMI A;  4HCS A;  4DUZ H;  2KEN A;  3J7Y W;  3GTO A;  3NWS A;  2ZM6 L;  3GIQ A;  4JV5 Q;  4HSV A;  4UY8 C;  1K0R A;  4DL3 A;  4C2M A;  4P71 A;  3OSN A;  1STH A;  1V8Q A;  1SDF A;  5GAD C;  1TWA B;  1IYU A;  5IT9 c;  1X55 A;  1EY7 A;  1YNJ C;  1N36 H;  1I6V C;  4PZ7 A;  3T53 B;  5C1O A;  2Q2U A;  2AWN A;  4XYQ A;  1NUC A;  4AYB A;  1Y1V H;  4I55 F;  3STB C;  1HNW Q;  3HG9 A;  4LSX A;  4RKB A;  2NN6 I;  1PZK D;  4AIM A;  1U4R A;  3PO2 G;  4ZI7 F;  5DGB A;  3Q2O A;  3M9M B;  4MV7 A;  1T9H A;  2IMW P;  1DGS A;  1Y1W G;  4L6T B;  3JAM L;  2FK3 A;  4RB3 C;  3WWV A;  2ID0 A;  3SXH A;  1KEE A;  3S2H H;  2AMC B;  4JV1 A;  4LFB H;  4F88 A;  1EYD A;  1X3P A;  1VMC A;  3HXL A;  1QOH A;  1N32 H;  4FBT A;  4OIJ A;  2JA8 B;  4YQW A;  1LTL A;  1CM9 A;  2ASL A;  3MWD A;  3A8I E;  3P75 A;  4NP5 A;  4J9P A;  2FFK B;  1O75 A;  1AE2 A;  1E0B A;  4CDF C;  3H91 A;  4HTH A;  4IHJ F;  4E4T A;  2F0I A;  2RF4 A;  1IKM A;  3OSP A;  3PGZ A;  5KT6 A;  1T94 A;  4XXE A;  2C35 B;  4PNY A;  1JMC A;  2B63 H;  3I56 A;  5KFQ A;  3EIV A;  1Q7Y C;  5KFA A;  2JEI A;  1SFO B;  5ELO A;  2ZXO A;  2VQF Q;  1I7N A;  4UDU C;  3RV3 A;  2Y0S G;  3GTK A;  5KFP A;  5C3E H;  3PO3 H;  2QEX A;  4ZKC B;  4XIG S;  3VR2 A;  4EX5 A;  3TS0 A;  4ED2 A;  1ASZ A;  3W1G A;  2YTY A;  1B8A A;  2W6O A;  4BA1 I;  5M3M G;  1VQP A;  1L0W A;  3F1Z A;  3FEW X;  4IAL A;  1N34 H;  3S15 B;  2R7Z G;  4TV9 F;  5IWA H;  2JA8 H;  5LL6 b;  1QG7 A;  2I87 A;  1BJT A;  3P7J A;  5DEH A;  3E0J A;  3TIG A;  1EIF A;  2VXW A;  2K04 A;  3P1H A;  5IGG A;  4JI2 Q;  1QCB D;  2V4D A;  3NBI A;  4DL7 A;  2V1C C;  2NZH A;  3J80 c;  2JA6 H;  5M3M H;  1D5M C;  1SFO H;  2L11 A;  5KG3 A;  2R8K A;  4QWA A;  4JI0 L;  3NQT A;  2W9B B;  5HV6 A;  4PZ8 A;  2GPW A;  4JBW A;  2W6P A;  3GTJ H;  3MZ5 A;  1SNO A;  4YCU A;  4FU0 A;  5KT5 A;  2C28 A;  2VA3 A;  3NBH B;  2PZU A;  2WAQ G;  3M7G A;  5KFB A;  1LM0 A;  1PTO D;  3NP8 A;  3MXU A;  2HGS A;  4RB1 A;  1HR0 Q;  3L3O C;  1D2B A;  3I70 A;  5CV6 A;  3CP0 A;  1OXS C;  2LMC B;  2PNH A;  4IUT A;  3RN2 A;  3SK6 A;  2F0U A;  5J1Z A;  4BBR G;  1PHJ A;  3F8N A;  4DR6 H;  1P8L A;  1UE1 A;  5LMN L;  1Q12 A;  2N88 A;  1S5C D;  2RDG A;  4DV7 L;  3MJF A;  5KFO A;  1PH7 A;  3TII A;  4RUA A;  1FJG L;  1Y1W H;  4M7E A;  5KKN B;  1Q81 C;  3MXN B;  3HOV G;  1BXT A;  4JBJ A;  4RGO S;  3GTK B;  3DWQ A;  1SN8 A;  5D1P A;  3NXW A;  3DWP A;  4K2K A;  1Q82 C;  4JI8 H;  5LMU L;  4A3F G;  4LF8 H;  1HZC A;  3MWY W;  4A93 H;  2EQS A;  1HJP A;  1SE3 A;  1BNZ A;  1RJQ A;  2R93 A;  4DV0 Q;  2JJQ A;  4ME5 A;  1ML0 D;  2NN6 G;  4DNT B;  4CJ1 B;  2QA4 A;  2ZXR A;  5HBR B;  3I2Z A;  1B7Y B;  5GAG C;  2K14 A;  5C4Z A;  1EIH A;  3V96 A;  1WTR A;  3H3V H;  2F1M A;  2K05 A;  4QL5 A;  4ZOL F;  4YWM A;  3NQI A;  4YR0 A;  4PDB A;  5HGT A;  4UCU A;  1IKL A;  1EZ1 A;  4K6L A;  1BDO A;  4B3M H;  2W9C B;  2JSO A;  2F0K A;  2EIF A;  4ODG A;  2R93 B;  4K5X A;  2KOL A;  1MIU A;  2OCE A;  2PW5 A;  3K6O A;  4UP7 A;  4HNU A;  1VQF A;  2ICE C;  2JA8 G;  2L1B A;  3DM3 A;  1ICW A;  1PH4 A;  4A93 B;  1D7Q A;  3R93 A;  3K3V A;  2JA5 G;  3J81 i;  1I94 Q;  4EGV A;  3H40 A;  1Q1B A;  1E1O A;  5L9X A;  4LFA Q;  4IUU A;  2RCF A;  1XX8 A;  5AJ3 Q;  3ZJY C;  5FLX L;  2JEG A;  4QWD A;  5COY A;  3IKJ A;  3LNN A;  4RHS A;  3IFD A;  2Q8T A;  1QWY A;  2E74 C;  4GC7 A;  2OEO A;  5CV9 A;  4RA8 A;  3QWN A;  2Y0S B;  3AYH B;  3KDF A;  4GNX B;  4KY5 A;  5DNF A;  5KGU A;  4DA2 A;  2DPJ A;  1TWG H;  1CSQ A;  3NWT A;  3S17 B;  5KYL A;  4ED0 A;  5I2Y A;  5JJZ A;  4DV1 Q;  1STY A;  3NUC A;  2UUB Q;  2PO4 A;  1VQJ A;  3MTS A;  4IOC A;  1SRO A;  2W6M A;  4GC6 A;  1HCZ A;  3BA9 A;  2A69 D;  1SNC A;  1ILP A;  4HNT A;  3FDS A;  3BAB A;  1HNX H;  2R85 A;  2R8G A;  1II3 A;  1X3E A;  2HCC A;  1GLV A;  3R23 A;  5FO7 B;  1E7Z A;  1ENC A;  1U4M A;  3QOL A;  1NJI C;  5LYJ F;  2AUK A;  3OYY A;  1EY8 A;  1XTD A;  3MR5 A;  2XC9 A;  1HQR D;  2HUG A;  3ND8 A;  2W7O A;  4DK1 A;  5DQH A;  1O7Y A;  1GUO A;  4DAM A;  4KV6 A;  3N6X A;  4H7B A;  5IGD A;  5IGC A;  4O2D A;  4G7Z C;  4APM A;  4A2B A;  1J9O A;  4RNO A;  5M3F H;  1OXX K;  4CHT B;  1AEX A;  3KAJ A;  2HQE A;  3ULJ A;  4DNR B;  1EUD B;  3H0G A;  3GTG H;  1ROD A;  2R86 A;  4WJ4 A;  2A5H A;  2J0T D;  1FKA H;  2JK8 A;  4GN5 A;  5CV5 A;  2JN4 A;  1TS2 A;  1JC7 A;  3TN2 A;  4JG2 A;  3L2P A;  5J22 A;  3N42 B;  4BBS H;  4MV8 A;  1HR0 W;  5G3L D;  5C44 H;  2TMP A;  2SDF A;  2F0H A;  4CDE C;  4LSA A;  4IR1 A;  1SAP A;  1XDN A;  3C1F A;  1V43 A;  1A3V A;  5H80 A;  3BVG A;  4Y52 H;  2QDL A;  1ICF B;  3QJY A;  1SBB B;  2F0F A;  3Q0A A;  2OTL A;  1HNX Q;  3BJU A;  5LXT F;  1I3Q H;  4GOP B;  3IN5 A;  3V4S A;  2YL2 A;  2PCF B;  5J2U F;  3KHR A;  1F2Z A;  3IAY A;  1SCU B;  1UC9 A;  2XRS D;  3S14 H;  1EQV A;  2WKD A;  3AEV A;  3CU7 A;  3QB3 A;  4OWT B;  2FHT A;  2JYO A;  1JWU D;  2FMM A;  2R92 A;  5EGT A;  2B2U A;  1AZP A;  5CV4 A;  4WJ3 M;  4YBZ B;  4J9R A;  4A3M H;  4RNM A;  2UVV A;  1Q90 A;  4JI1 L;  4CBV A;  2EYM A;  4ILW A;  3R2I A;  2IHE A;  4UCO A;  1FYC A;  3I90 A;  2KHS A;  4C1N K;  4QIW B;  4ED6 A;  1EL0 A;  3I91 A;  1SMY C;  4UPA A;  2X6L A;  5JPM C;  4F4X A;  2KA7 A;  2ZM6 Q;  1J8I A;  1MKH A;  4P2C B;  4A3D B;  3W1B A;  4DUY L;  3J7A V;  4DAP A;  3BZC A;  2I5M X;  2E2H A;  2R92 H;  1TT2 A;  1U5K A;  1CUK A;  1SR3 A;  2L12 A;  1DM0 B;  4QJF A;  3TEH B;  2FLL A;  3MR3 A;  4EYH B;  3BDL A;  2IT1 A;  1XXG A;  2UUB L;  1WCM A;  2MO0 A;  4K0K H;  3T56 B;  3M9O B;  1EWC A;  2D5D A;  5IWA L;  4MZ9 A;  4IFD J;  2ZJR A;  2DNE A;  2XVS A;  2PPB C;  4MV6 A;  4YHH Q;  3CVZ A;  3VPB A;  1J6Q A;  5E4W C;  4LFB L;  1LTR D;  1TWG B;  2UVR A;  3K5L A;  1SYB A;  2IBK A;  3TZD A;  1VDZ A;  1D6E C;  3A7A B;  4RUC A;  2NZ1 D;  5KFN A;  3RB0 A;  3G48 A;  1TU2 B;  2DGY A;  1PLF A;  4OEM B;  4A3L H;  3RB4 A;  1AN7 A;  1HR0 L;  2A1A A;  5EWE A;  2NVX H;  3CAM A;  4TRD A;  2TSS A;  3PO3 G;  4HR7 B;  4IUP A;  4KD3 A;  3CD6 A;  4RGT A;  4IUR A;  2BE5 C;  2O2L D;  3GTJ B;  2ASB A;  3FMA A;  3T1Y L;  3BVM A;  3I4N B;  4RZQ A;  1YJN A;  4Q8E A;  3KLS A;  3BQ1 A;  2Q2T A;  1KNA A;  1U0L A;  1H9K A;  4O1N A;  3I3C A;  2YS6 A;  4ECY A;  2UVU A;  2NU6 B;  5A35 A;  1VBG A;  4TUY F;  3OWF A;  4A3L G;  5DQG A;  2VUM B;  4DR3 H;  1ZYR D;  4DR6 L;  2HJW A;  4PMC A;  4R4C A;  2YU9 B;  5DG9 A;  1O7I A;  4RB2 C;  4FO2 A;  4EBC A;  4IPH A;  2QIL A;  1Q3L A;  4ZQ3 A;  3F2B A;  2ALZ A;  2YZG A;  4C3H B;  3OPO A;  4PMW A;  4JI3 L;  3HOU B;  3M3Y H;  5K36 G;  1B53 A;  3PUW A;  1K28 A;  5GRO A;  1HPC A;  1KRS A;  2V58 A;  2R7M A;  1EEI D;  4B3S Q;  5C3W A;  4XX0 B;  1G51 A;  5FLM H;  1X3G A;  4Z9C B;  3H0G G;  3S2D H;  2UXB Q;  3GTL A;  1IZ6 A;  1SYD A;  3JZI A;  2PMZ A;  2R82 A;  2B39 A;  4DK6 C;  3MFI A;  4ABN A;  3J81 j;  1JE4 A;  5IE8 A;  3CKI B;  3HOZ B;  2B2Y A;  1XNR H;  1HTP A;  3OTO L;  4ME6 A;  2C9O A;  3TP6 A;  2LXJ A;  4OL7 A;  4V19 0;  3OUU A;  4IPD A;  1YJW A;  3CHB D;  3ULL A;  3VR6 A;  3LWU A;  1I94 L;  2FPG B;  2DIK A;  2RHQ B;  1YI2 A;  5D1O A;  1GSH A;  4U7C A;  5KG5 A;  1DYQ A;  4LFC L;  2NWG A;  3PZP A;  4IZ8 A;  5GAE C;  1E2W A;  4EVO A;  4YJ2 F;  4B3R H;  1S10 A;  2XTI A;  3UQ8 A;  5IT9 W;  1S5F D;  1SYG A;  1CA6 A;  2BCO A;  2ZDG A;  4DV5 H;  1F2M A;  3T1H H;  4XT1 B;  1F2Y A;  1EY6 A;  5LA6 F;  1EZ6 A;  1Y1V B;  2EOT A;  4GZY C;  2R7Z H;  4JBM A;  1QNK A;  3H94 A;  4R8I A;  4JI6 Q;  5A2Q E;  2VQF H;  1L2Z A;  2EYO A;  1A3T A;  5GON F;  2LXK A;  1DON A; 
#chains in the Genus database with same CATH homology
 2PI2 A;  1LUZ A;  2BH8 A;  2JA5 H;  1BBU A;  4JI6 L;  1UE6 A;  4NPS A;  4R4I A;  4A3K G;  3S15 H;  1K3R A;  2VS1 A;  5FJ8 G;  4JI2 L;  2RCN A;  2D0P A;  3EBE A;  1PFS A;  1YEZ A;  2I5L X;  4K0K Q;  4GOP C;  4GLX A;  4LWC A;  2OQK A;  1TXY A;  4RG1 A;  3J81 c;  4K0K L;  1N32 Q;  5EAY A;  4P74 A;  1IBK L;  3BU2 A;  4NXM L;  3GTL H;  3UE0 A;  2VNU D;  3D0F A;  4DUZ L;  2IX1 A;  3CCL A;  1EIY B;  3CPW A;  3CF5 A;  5M5W H;  3TS2 A;  4IOA A;  2GVA A;  3FKI H;  1IL2 A;  4AH6 A;  5DLQ E;  4GLV B;  3GTQ H;  2IY5 B;  5C44 G;  4QY7 A;  4DR1 L;  1BVS A;  1E3P A;  2KEN A;  4JYA L;  2WB1 E;  2HT1 A;  2ZM6 L;  1Q8K A;  2YV5 A;  4IPC A;  1GD7 A;  3MEF A;  4IJH A;  1AE3 A;  1G29 1;  3I7F A;  3ER0 A;  4JV5 Q;  3D31 A;  4UY8 C;  1K0R A;  1CKO A;  2UUC L;  3CQZ H;  4P71 A;  4TVA B;  5GAD C;  1KRT A;  5J3B A;  5IT9 c;  1X55 A;  1CKM A;  1A62 A;  4PZ7 A;  2B29 A;  3L7Z C;  4ALP A;  1GVP A;  1N34 L;  3I55 A;  1X9N A;  2FXQ A;  3I4O A;  1KAW A;  2AWN A;  1VQL A;  3OW2 A;  2Q2U A;  3HOZ G;  1Y1V H;  4P75 A;  3S1M H;  3RLO A;  5LMU Q;  3STB C;  3H3V I;  4KLK A;  3UE1 A;  5M3F G;  4LF5 L;  1HNW Q;  3L0O A;  1YIJ A;  1L1O A;  2NN6 I;  4LUO A;  4AIM A;  3JAM c;  1N36 L;  3PO2 G;  4IO9 A;  3M7N A;  1HNZ Q;  1T9H A;  3KF8 B;  4B3S L;  1DGS A;  3CCJ A;  1Y1W G;  3CCV A;  1M90 C;  3CCE A;  4YY3 L;  3WWV A;  4IJL A;  2ID0 A;  3T1H Q;  2E2I H;  4B3T L;  4GOP A;  3HOZ H;  3S2H H;  2AMC B;  4A3M G;  1IYJ B;  4LF9 L;  4DV1 L;  3PUV A;  2MNA A;  3UDF A;  2Z6K A;  3HKZ E;  2N78 A;  3UDX A;  3G6E A;  2JQO A;  1N33 L;  2E5L L;  1LTL A;  3A5U A;  4GNX C;  4NXN Q;  3KDF B;  1PH3 A;  1GM5 A;  4APV A;  1AE2 A;  3HOX G;  1YJ9 A;  4NXM Q;  4X65 L;  2Z6K C;  4A3B G;  4POG A;  2RF4 A;  2UXC L;  2F4V L;  4HID A;  3K7A H;  3PGZ A;  4NB3 A;  3U4Z A;  1PH8 A;  3HOW G;  3FP9 A;  2C35 B;  3G71 A;  1XNQ L;  1JMC A;  2B63 H;  3I56 A;  3EIV A;  1Q7Y C;  4ME3 A;  5ELO A;  2VQF Q;  3FKI G;  2Y0S G;  3EN2 A;  3KOJ A;  2CWP A;  5BR8 L;  4JBK A;  4LFC Q;  3HKS A;  5C3E H;  4DR6 Q;  3PO3 H;  2QEX A;  1XMO Q;  4XIG S;  4X6A H;  4EX5 A;  5FJ8 H;  4A4I A;  3TS0 A;  3W1G A;  2YTY A;  5BR8 Q;  1ASZ A;  4GKJ Q;  1B8A A;  4BA1 I;  5M3M G;  1VQP A;  4BXX G;  1L0W A;  3F1Z A;  2MQH A;  4JC0 A;  4DV4 L;  3CC2 A;  4H02 A;  2ATW A;  2R7Z G;  2R7F A;  2JA8 H;  1WCM H;  3JC6 6;  4BY1 G;  5LMN Q;  1JJ2 A;  3S1N H;  4LF8 L;  1QUQ A;  1EIF A;  4YY3 Q;  3T1H L;  4DR7 L;  1X65 A;  4JI2 Q;  1NY4 A;  2B63 G;  2V1C C;  4LF9 Q;  2NZH A;  3J80 c;  4PZ6 A;  2JA6 H;  4GLA C;  1S40 A;  5M3M H;  4LNQ A;  1SFO H;  4AYB E;  5HY6 A;  1GO3 E;  4QIW E;  2B3G A;  4HIK A;  4A76 A;  4DR3 Q;  2ES2 A;  4JI0 L;  4POF A;  1Q1E A;  5IP7 G;  3S1Q H;  1NBW A;  3CCS A;  1D8L A;  4A3J H;  1IBM L;  1EFW A;  4PZ8 A;  4DR3 L;  4JI0 Q;  1YIT A;  4A3E G;  4JBW A;  3GTO H;  5C4X G;  4OXP A;  2YU9 H;  3GTJ H;  2F4V Q;  1VQG A;  3A74 A;  4YCU A;  2I0Q A;  1V9P A;  4JI1 Q;  3NBH B;  1HZB A;  2WAQ G;  3KYH C;  1XNQ Q;  1LM0 A;  2HHH Q;  4C2M H;  1PV4 A;  1VQE A;  1VQD A;  4JI5 L;  1HR0 Q;  3KF6 B;  2HHH L;  4A75 A;  1WI5 A;  4HIO A;  1W3S A;  3M85 A;  3CP0 A;  1OXS C;  3RZD H;  2WAQ E;  1WJJ A;  2PNH A;  3GD7 A;  1TWF H;  1Y14 B;  3RN2 A;  4BBR G;  4GNX A;  1PHJ A;  3U58 A;  4DR5 Q;  1P8L A;  1UE1 A;  5LMN L;  1Q12 A;  4GN3 B;  1VQI A;  2PQA B;  2YTV A;  4DV7 L;  1PH7 A;  4O0A A;  1FJG L;  1Y1W H;  1Q81 C;  3FHW A;  3CCR A;  2BH2 A;  4DR7 Q;  3RLN A;  2UUA L;  1KHI A;  2JE6 I;  1C9O A;  1EWI A;  2OQ0 A;  3KF6 A;  3MXN B;  4JBJ A;  5C0X J;  3H0G H;  4OON A;  1NMG A;  3HOV G;  1SN8 A;  3DLL A;  3K80 C;  1K8A C;  1N36 Q;  5IYD G;  1Q82 C;  3RNU A;  1M1K C;  3W5O A;  1K9M C;  2GVB A;  3J7Z C;  1CKN A;  2NVY H;  5LMU L;  4DV2 L;  4A3F G;  2VL6 A;  2DUD A;  1TWA H;  2NZO A;  2PMZ E;  1HZC A;  3BZK A;  3A0J A;  1N9W A;  1VQ7 A;  4A93 H;  2EQS A;  4FDB A;  1HJP A;  4C3I H;  1Z9F A;  1R9T H;  4DV0 Q;  2JJQ A;  1SRU A;  2A19 A;  2BA1 A;  2NN6 G;  5GAH C;  3U50 C;  2QA4 A;  1HNZ L;  3CCU A;  3I2Z A;  1B7Y B;  5GAG C;  1C0A A;  2K14 A;  3I4N G;  3B6Y A;  4X66 Q;  4HJ9 A;  4X62 Q;  1SE8 A;  4QL5 A;  3KJP A;  4L5S A;  4A3K H;  3H3V H;  2E5L Q;  2K5N A;  1YZ6 A;  4YWM A;  4HIM A;  2MO1 A;  3Q8D A;  1GKH A;  4DR1 Q;  3AQQ A;  3OTO Q;  4OX9 L;  1Q86 C;  4C3J H;  3TRE A;  5IYB G;  1IBM Q;  2UXC Q;  2EIF A;  3PCO B;  4NXN L;  2F52 A;  2OCE A;  1MIU A;  2K52 A;  1P16 A;  4UP7 A;  2K5V A;  1VQF A;  1ASY A;  4J15 A;  2JA8 G;  4R4T A;  3H15 A;  4LF4 L;  3DM3 A;  1PYS B;  1PH4 A;  1D7Q A;  4Y7N H;  2JA5 G;  3J81 i;  1I94 Q;  5JJL A;  3M9B A;  1Q1B A;  2JA7 H;  4IFD I;  1E1O A;  3HOU G;  3KFU A;  5LMN W;  3I4M H;  4LFA Q;  3PUX A;  2R93 G;  2NVQ H;  4XTC S;  5AJ3 Q;  4DR2 L;  3ZJY C;  4A3G G;  4DV4 Q;  4A3F H;  4OWW B;  3T1Y Q;  4MTN A;  3M4Q A;  4KHP Q;  3HOX H;  1G6P A;  4DV2 Q;  1PH5 A;  5C0X I;  4YWL A;  1XJV A;  3AYH B;  3KDF A;  4DV7 Q;  4GNX B;  1UEB A;  1WCM G;  1PH1 A;  4BY1 H;  4JI4 L;  2R92 G;  3GDE A;  5IP9 H;  4HJ5 A;  2Y0S E;  3G4S A;  1QZH A;  1TWG H;  4A3C H;  1CSQ A;  1RIP A;  5IWA Q;  4JI8 Q;  4HJ8 A;  4DV1 Q;  4BBS G;  2UUB Q;  2UXD L;  1VQJ A;  3U4V A;  4L5T A;  1SRO A;  4IOC A;  1A63 A;  1YBY A;  1HH2 P;  1VQO A;  1I6H H;  1CKN B;  4X64 L;  1QVF A;  5JEA G;  1K83 H;  1FGU A;  1MJE A;  2K4K A;  4JI3 Q;  4B3R L;  1MJC A;  3PUZ A;  4P73 A;  1X3E A;  5E7N A;  4LW1 A;  4DKA C;  2R7D A;  4HJA A;  1E7Z A;  2PI2 E;  2VQE Q;  3UDG A;  3JAM i;  1XMQ L;  1L1O B;  1EUJ A;  1NJI C;  1C7Y A;  1BBW A;  3OYY A;  4YCV A;  1XTD A;  4A3I H;  4A3C G;  5JJK A;  2N49 A;  5FLX c;  5FLM G;  3RLF A;  2AWO A;  2CCZ A;  3CC4 A;  4KI0 A;  5IYC G;  2Q2H A;  2VQF L;  4MNO A;  4DAM A;  3S16 H;  1TWC H;  4O2D A;  3AFP A;  1IXR A;  5M3F H;  1OXX K;  2ALY B;  2UUC Q;  3ICE A;  4KHZ A;  3ULJ A;  3GTG H;  4WJ4 A;  1I5F A;  4DAY B;  1K73 C;  4LF4 Q;  2K50 A;  4HJ7 A;  2JK8 A;  4GN5 A;  4A3E H;  2VZA A;  3ULP A;  4BA2 I;  1X3F A;  4AYB G;  4JG2 A;  2K5H A;  2R6G A;  3L2P A;  3S1R H;  1XPR A;  1PH6 A;  1EQQ A;  4BBS H;  1HR0 W;  3RN5 A;  4QGU A;  1JE5 A;  5C44 H;  1VQ4 A;  5C3E G;  3PV0 A;  1JJC B;  2YTX A;  3UDI A;  1V43 A;  4DUY Q;  4YHH L;  4LF6 Q;  1SMX A;  1IBL Q;  1OTC A;  1JB7 A;  2VUM H;  1E22 A;  3KJO A;  4LFB Q;  4Y52 H;  4EQ5 A;  1IBL L;  4LUV A;  3PIP A;  1N32 L;  4LF8 Q;  2GN5 A;  2Q2I A;  2OTL A;  1YVC A;  4L5R C;  2L15 A;  1VCI A;  3SGI A;  1HNX Q;  2AHO B;  3BJU A;  4JI7 L;  3HOW H;  1I3Q H;  2EXD A;  4GOP B;  4A3B H;  1RL2 A;  2LSS A;  5M5X H;  3F2D A;  2JA7 G;  4DV3 Q;  5C4J H;  1HNX L;  3KLW A;  2UXD Q;  5IYC H;  3S14 H;  3M4O H;  4DPG A;  4JOI C;  4OO1 I;  4DV3 L;  4R1J A;  4R4O A;  3HOU H;  2KCT A;  1PVO A;  1CSP A;  4YCW A;  4X62 L;  1S72 A;  3AEV A;  1JJG A;  3VDY A;  1KIX A;  4OWT B;  2VUM G;  2UU9 Q;  4X65 Q;  3HOY G;  2CQO A;  1Q46 A;  5M5Y H;  2HQL A;  4BY7 G;  4WJ3 M;  4JV5 L;  1VQ9 A;  1NTG A;  3RZO H;  1E24 A;  3CW2 C;  4A3M H;  4B3M Q;  4DR4 Q;  4JI1 L;  4YWK A;  3K7U C;  2IHE A;  4A3D G;  1UE7 A;  3I4N H;  5AJ3 L;  4DR2 Q;  3J7A 5;  2BA0 A;  3HOV H;  3CMA A;  2JEA I;  4AQY L;  4DK3 C;  1HZ9 A;  5IY0 A;  3PF5 A;  4UPA A;  3GTP H;  2KCM A;  2HIV A;  1QVC A;  1I50 H;  2ZM6 Q;  1KC8 C;  1MKH A;  4DNI A;  3ERS X;  3S17 H;  1XMO L;  3W1B A;  4DUY L;  4LF6 L;  4R4Q A;  2I5H A;  1NE3 A;  2WB1 G;  3IRB A;  4BY7 H;  3BZC A;  2I5M X;  1V1Q A;  2VW9 A;  2ZJP A;  1U5K A;  1J5E L;  1CUK A;  1SR3 A;  4QJF A;  4LF5 Q;  3TEH B;  2R92 H;  3K0X A;  2CFM A;  4JI8 L;  1PA6 A;  2AKW B;  1N34 Q;  1VQ5 A;  2IT1 A;  5C4X H;  2UUB L;  4JI7 Q;  2MO0 A;  2WFW A;  2D62 A;  2E2J H;  3PF4 A;  1VQA A;  3HFZ B;  2A8V A;  5IWA L;  4MZ9 A;  4IFD J;  2ZJR A;  4LF7 L;  1YNX A;  2JA6 G;  2F3I A;  4YHH Q;  1KQS A;  2N3S A;  3J80 i;  4GN4 B;  1N33 Q;  1KXL A;  1J6Q A;  3GTM H;  3HOY H;  3GO5 A;  1PH2 A;  4DV6 Q;  4LFB L;  2WP8 J;  1S3O A;  1K8G A;  1PYB A;  4GKK L;  4B3R Q;  4P72 A;  5ELN A;  4B3T Q;  1Z47 A;  3G48 A;  1YHQ A;  4UP8 A;  2DGY A;  2RHS B;  1QZG A;  1IBK Q;  5IP9 G;  4B3M L;  4DR4 L;  4GKK Q;  1EYG A;  4A3L H;  4DUZ Q;  1HR0 L;  4JI5 Q;  2A1A A;  2ZTD A;  2NVX H;  3I4M G;  2R93 H;  3CAM A;  4JCV E;  2QGQ A;  3PUY A;  4GS3 A;  3PO3 G;  3TQY A;  4JOI A;  4LUZ A;  4TQU S;  2XGT A;  3CD6 A;  1LYL A;  1OXT A;  3LGJ A;  2ASB A;  2KHJ A;  2MFI A;  1EQR A;  3T1Y L;  4OWX B;  1YHB A;  1YJN A;  2Q2T A;  3CPF A;  3CME A;  1U0L A;  2N8N A;  1VQ8 A;  3PSI A;  1VQN A;  1J5E Q;  1WOC A;  5C0X G;  4DR5 L;  3TRZ A;  1FL0 A;  4A3L G;  1XPO A;  4AQY Q;  4OO1 G;  2PQA A;  3CXC A;  4DV5 Q;  4QQB X;  1SLJ A;  4C3H H;  5JJI A;  1TWH H;  1WYD A;  3E9H A;  4DR6 L;  4R4C A;  1NMF A;  2Z0S A;  5HGQ A;  1XNR L;  5IYD H;  2UUA Q;  1O7I A;  1OXV A;  2E8G A;  2IX0 A;  2KBN A;  1L1O C;  4IFD G;  3HKZ G;  4IPH A;  4X64 Q;  1E1T A;  5IYB H;  2CKZ B;  3F2B A;  4A93 G;  4BXX H;  4PMW A;  4JI3 L;  1WFQ A;  4DV6 L;  3M3Y H;  1A8V A;  3PUW A;  5K36 G;  3GTK H;  1UE5 A;  3E0E A;  5GRO A;  1L2F A;  4JI4 Q;  2K75 A;  2OWO A;  1KRS A;  1X56 A;  2YYZ A;  2D0O A;  2VQE L;  5GQO A;  1VQM A;  1XMQ Q;  2VY3 A;  1VQB A;  3NEL A;  4B3S Q;  3CCQ A;  2UXB L;  1G51 A;  5FLM H;  1X3G A;  1JT8 A;  3H0G G;  2KHI A;  1EOV A;  1B70 B;  3S2D H;  1YHA A;  2UXB Q;  3E9I A;  3PIO A;  4LF7 Q;  3NEN A;  1IZ6 A;  4X66 L;  2ZJQ A;  3CCM A;  1BKB A;  3PO2 H;  1FVI A;  1VS0 A;  1KD1 C;  4DK6 C;  1A0I A;  2JA9 A;  1PH9 A;  4IPG A;  3J81 j;  1XPU A;  2CWA A;  1VQH A;  2IHF A;  1OXU A;  4BBR H;  5IE8 A;  3F2C A;  3OTO L;  4OX9 Q;  2UU9 L;  4RMF A;  3CC7 A;  4A3J G;  2LXJ A;  1VQK A;  4IPD A;  3STB D;  3AFQ A;  3ULL A;  5H1S E;  1YJW A;  1N8R C;  1I94 L;  4L5Q A;  1X54 A;  2ZTE A;  2RHQ B;  1UWV A;  4A3I G;  3RR5 A;  1QUQ B;  1YI2 A;  4A3D H;  4LFA L;  1FJG Q;  5JEA J;  4LFC L;  3S24 A;  1KL9 A;  5GAE C;  2E2H H;  1H95 A;  3M4P A;  1HZA A;  1Y1V G;  2OTJ A;  4GKJ L;  4KHP L;  2XTI A;  3A5Z B;  4JYA Q;  3NEM A;  2H5X A;  3F8T A;  3K81 C;  1XNR Q;  2ZTC A;  1HNW L;  1W2B A;  1QVG A;  4A3G H;  1AH9 A;  2JEB I;  4UP9 A;  3K8A A;  1X6O A;  2R7Z H;  5IP7 H;  4JBM A;  2NVT H;  1VQ6 A;  2HIX A;  4DV0 L;  4PG3 A;  4JI6 Q;  4DV5 L;  1VQC A;  2LXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...