3HOWG

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 31
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3howG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3howG01
4DK6C 3K7UC 1N36L 3PSIA 2Z6KC 3GTLH 2I5LX 1PH2A 1V9PA 2LXJA 3AFPA 1JJCB 3FHWA 3SGIA 1M90C 2YTVA 2GVAA 2VS1A 3CMEA 4LF5Q 1A63A 1L0WA 1PH8A 1KL9A 3G4SA 3GTOH 1NY4A 1XPOA 4POGA 2WAQE 2IY5B 4DAYB 2BA1A 2JA5H 3HOWG 3GTQH 2UUAL 2HQLA 1VQOA 1PH7A 2WFWA 1H95A 3A5UA 4X64Q 3S17H 3MEFA 2YV5A 1K73C 1A62A 4B3TQ 2HHHQ 4K0KL 1CSPA 2ALYB 2UXCQ 3KOJA 1I3QH 3K7AH 3PUZA 3H3VI 3W1BA 1OXSC 3U58A 1NE3A 1Q1EA 3W1GA 4UP9A 4BA1I 3J81c 1SLJA 4HIDA 3CW2C 4DR5Q 2Q2HA 2K75A 4DV6L 2BA0A 3RN5A 1VQBA 4DV3Q 2ZJRA 1Y1WG 4UY8C 1X9NA 1KRTA 1L1OB 3PCOB 2BH8A 1HJPA 4R4OA 2RF4A 2PMZE 1J5EL 4P72A 2NVXH 1CKOA 1YZ6A 3T1HQ 5IYBG 1N8RC 3I4OA 3CD6A 5C0XI 4A3DH 4L5TA 2E5LL 4B3RL 2AHOB 2F3IA 1EQRA 4KLKA 3GTJH 2V1CC 5C44G 3K80C 1K3RA 4TQUS 1Z9FA 2KBNA 3HFZB 4DV7L 4LUVA 1I94L 4MTNA 3ULJA 4DAMA 3LGJA 4MZ9A 1M1KC 2R92H 2IX0A 4Y7NH 1B7YB 4A3LH 4L5SA 1K8GA 3BZKA 4AYBE 3HOYG 1VQGA 3F8TA 1NTGA 2B29A 4A93H 4BY7G 1NMGA 1P8LA 2JE6I 1Q81C 2N8NA 1LTLA 1YEZA 1EWIA 3MXNB 2D62A 3RLNA 3S24A 4IFDI 2UXDQ 1Q7YC 3OTOL 3S1RH 3FP9A 1Q86C 1PHJA 5IY0A 1LM0A 2RCNA 2I5HA 1YBYA 3PO2H 2XTIA 2OWOA 2JA7H 1ASYA 4Y52H 1X3FA 4GOPC 4DV1L 1X65A 3RZDH 1Q46A 3STBD 4DK3C 4QJFA 1K0RA 1IBMQ 3UE0A 5GADC 4YY3Q 4PG3A 3GTMH 1JB7A 4LF5L 3RLOA 4L5QA 4DR2Q 4NXNL 2CFMA 1QZGA 2OQ0A 2UUCL 4HIMA 1TWCH 4DR1L 3I4MH 4POFA 4A3BG 4JI8L 3M85A 3S2DH 3I55A 2LXKA 5M3MH 4DV4Q 4P71A 3F2BA 3TEHB 3U4VA 2WB1G 4LFAL 1PH5A 1UE6A 4JCVE 2PQAB 4HJAA 1GO3E 2NZHA 4IOAA 5IE8A 2Z0SA 3F1ZA 4JI1Q 4B3TL 1Y14B 2CWAA 5FLMG 1VQAA 2HHHL 4XIGS 3M4OH 1HR0L 4A3CG 4A3EG 4GLXA 3KDFA 4A3KH 2EXDA 3DLLA 3HOVG 2ZTCA 1JJ2A 1A0IA 5C4XH 3HOXG 2Z6KA 2JA9A 3CPWA 5JEAJ 4DPGA 4DR5L 3S1QH 3AYHB 2DGYA 1HNZL 3PUXA 1A8VA 2KCMA 4P74A 3VDYA 2L15A 4LF7L 2K50A 4PZ7A 3GTKH 4GLAC 2KHIA 4R4IA 4XTCS 4JYAQ 2UXBQ 4JC0A 3RZOH 2KHJA 4PZ6A 4X6AH 1JJGA 3T1HL 1VQHA 4IPCA 2UXDL 4BY1G 2ZM6Q 4DUZL 2HIXA 5IYCH 1I5FA 5LMNQ 2RHSB 4JI4L 1EFWA 5LMUQ 1MJEA 1TWAH 4DV0Q 2PI2A 1YHAA 4OXPA 3W5OA 1GD7A 1WCMG 4X62Q 2PQAA 3ER0A 2IT1A 2QEXA 1WJJA 1YIJA 2MNAA 1OTCA 3S16H 5JJLA 1FJGQ 1BBUA 1YI2A 1BVSA 2F4VL 2ZJPA 2NVQH 3HOWH 1AH9A 1B70B 2Y0SE 1SFOH 1SE8A 4UPAA 1G291 4LUOA 1TWHH 2ZTDA 5IYDG 5GAEC 5IYCG 4KHZA 1N34Q 2VW9A 4HIKA 1X6OA 4EX5A 4YHHQ 3S2HH 3M4QA 3GTGH 4DUYL 1GKHA 3F2CA 2Q2TA 1P16A 3CCRA 3H3VH 4NXML 5JJKA 4JBKA 3KFUA 2EIFA 2VZAA 1NJIC 1E1TA 3CXCA 1XNRQ 2E2IH 4DR3Q 1TXYA 3OYYA 3GO5A 1XMQQ 4OO1I 3RR5A 1Y1WH 1U5KA 4DV2Q 3M7NA 4WJ3M 2QA4A 4GNXC 2OTLA 3I4NH 4JV5Q 2K5HA 4YY3L 4KHPQ 2UUBL 4R1JA 1GM5A 3TQYA 1AE3A 1BKBA 1QVCA 2VL6A 3A74A 1DGSA 4NB3A 5IYBH 1RL2A 1V43A 2Q2IA 1VQNA 2JA6H 1C0AA 4WJ4A 4GKJQ 3TRZA 4DR6L 4LF8L 3ERSX 2AWOA 4B3MQ 1VQCA 5C44H 1VCIA 2AMCB 3GDEA 3HKZE 5ELOA 5FJ8H 4X65Q 3H15A 1KIXA 3I4NG 3PGZA 3ULLA 1YJ9A 1HR0W 2CWPA 1HNXL 1C9OA 2PNHA 5GAGC 2IHFA 2JK8A 4X66Q 3TS2A 4HIOA 5AJ3Q 4JI2Q 4GOPA 4JI7Q 2JA8G 2JA6G 1E7ZA 1XNQQ 3HOYH 4BY7H 5C0XG 4H02A 4IPGA 4AIMA 4A75A 3HKSA 3K8AA 5IWAQ 1IBKQ 1XMOL 1Y1VG 3F2DA 4JI6Q 2ID0A 5E7NA 2VUMH 1SRUA 5FJ8G 1PYBA 2D0PA 2K14A 4JYAL 4JOIC 2ZJQA 1HNWQ 4FDBA 5GQOA 4RG1A 3CC4A 2K5NA 4R4CA 1X3EA 1KD1C 4QIWE 3T1YQ 4OONA 4DR4L 2ZM6L 3ICEA 2HIVA 2D0OA 4GN4B 4C3HH 1W2BA 1EUJA 4O2DA 1V1QA 3BZCA 4LF4Q 2C35B 5LMUL 4JI0Q 2WP8J 3KDFB 5IT9c 1PVOA 1Q1BA 1UE7A 1AE2A 4DR7Q 4APVA 4IFDG 3E0EA 4X62L 1PH6A 1X55A 4PMWA 2MO1A 4LF6Q 3TREA 4DV5Q 3A5ZB 1PH1A 2VUMG 4A3BH 1EOVA 1TWGH 3KF8B 1OXTA 1OXVA 2K52A 3IRBA 1YHBA 1O7IA 1W3SA 2VY3A 4OWTB 3UDIA 3G6EA 1MJCA 1YJWA 4B3SQ 2WAQG 5JJIA 5IP9G 4IOCA 1QVGA 2VNUD 1VQ4A 1U0LA 2R7ZG 1N34L 5FLMH 3EIVA 5HGQA 4YHHL 4A3CH 1CKMA 4R4TA 4A3EH 1KAWA 2RHQB 3H0GG 4TVAB 4DKAC 4A3IG 2N3SA 2NVYH 3HOVH 3K0XA 1WYDA 3HOXH 3CMAA 4RMFA 4DR3L 1XMQL 4A3FH 2IX1A 4A3MG 1S40A 1IXRA 2K4KA 3KYHC 3TS0A 2EQSA 3KLWA 5IP7G 1JMCA 2R6GA 1YJNA 3OW2A 4X64L 4C3IH 4YWKA 4NPSA 4A3JG 1VQ5A 4KHPL 1XPUA 1PA6A 4LNQA 2IHEA 2UUAQ 4BBRH 1X56A 4HJ7A 1X54A 1PV4A 4BY1H 4GKJL 4LFBQ 3CCJA 4B3ML 3E9IA 4A3FG 1PH4A 1KXLA 1B8AA 3PUVA 4DV3L 4X65L 1NMFA 1EQQA 1XJVA 1FJGL 1EYGA 1WCMH 1PFSA 2A19A 3HOZG 4AH6A 4JI5Q 1JT8A 4DV6Q 4X66L 1XTDA 3STBC 3UDXA 4BBRG 5AJ3L 1HH2P 4R4QA 4P75A 4BXXG 4AYBG 5IYDH 1HZ9A 2YYZA 5M5WH 5FLXc 4GNXA 1HZCA 1J5EQ 2A8VA 4UP7A 4YWLA 3BU2A 1PYSB 3CCSA 3JC66 2AKWB 1IYJB 1L1OC 4AQYQ 3PF5A 1KC8C 1WFQA 3NEMA 3PO3H 2DUDA 1TWFH 3PF4A 1E1OA 5M5XH 1Q8KA 2VQFQ 1UEBA 3CCMA 5GROA 3CCLA 4JG2A 1Z47A 2OQKA 2UU9Q 1ASZA 2OCEA 2R7FA 2OTJA 2ASBA 3M4PA 4HJ5A 1N32Q 2XGTA 4LF4L 5K36G 2ZTEA 2YTYA 2QGQA 3KF6A 4DR7L 1CSQA 1FGUA 3AQQA 3FKIG 3I2ZA 3U4ZA 3KJOA 4GOPB 3AFQA 1QVFA 4YWMA 4LF6L 2UXCL 4DV5L 4IJLA 2I5MX 3PO3G 1G51A 1VQIA 3M3YH 3CAMA 2E8GA 4HJ8A 4B3SL 4IPDA 4YCWA 1IL2A 4OO1G 3OTOQ 4GN5A 4LF9Q 3J7A5 3PV0A 3CF5A 1C7YA 1IBML 2R93H 1QUQA 1GVPA 2JEBI 3ZJYC 1VQ8A 1J6QA 4DR2L 1X3GA 4JOIA 3I56A 1SROA 3S1MH 1S72A 4DV1Q 3UE1A 4QGUA 1Q12A 3M9BA 1RIPA 1YITA 1Q82C 2JA8H 1VQMA 1CKNB 1VQ9A 4DV4L 1K9MC 3NELA 4QL5A 4NXNQ 2UUCQ 2GVBA 3L7ZC 4DR1Q 1Y1VH 1KHIA 4JI8Q 2K5VA 4DNIA 4KI0A 3J80i 2R93G 4JI1L 1IBLQ 4LFAQ 2E2HH 4LFCQ 3U50C 1VQ7A 4ME3A 1K83H 1VQJA 3DM3A 3PUWA 2B63H 5BR8Q 3CPFA 3S1NH 4LFBL 3GD7A 3G48A 2NN6I 2NN6G 4OWWB 1HR0Q 4LW1A 3NENA 3JAMi 4JBWA 4IJHA 4YCVA 1E24A 3CCEA 3ULPA 4BA2I 1VQFA 2WB1E 2PI2E 1L2FA 4JI5L 2JA5G 2UXBL 3PIOA 1HNZQ 4GN3B 1HZAA 1LUZA 1LYLA 2AWNA 4MNOA 5ELNA 1OXXK 4LF7Q 5IP9H 5J3BA 3E9HA 2B63G 2Y0SG 5C4JH 1YNXA 4J15A 5LMNL 1CKNA 5M5YH 2F52A 3B6YA 2R7ZH 1UE1A 1XPRA 2CKZB 1I50H 5HY6A 4A3GH 4DV0L 3H0GH 4AQYL 4A3IH 1N33Q 4GKKQ 3Q8DA 4BBSH 1YHQA 4DUZQ 1UWVA 2KENA 3J80c 4HJ9A 1EIFA 1D8LA 5C0XJ 4IO9A 4JI4Q 2VQFL 1MKHA 2LSSA 1KRSA 3NBHB 2VQEQ 4A3MH 2UU9L 3CC2A 5IP7H 4A76A 4JI3Q 1N32L 1VQPA 1VQKA 4OX9Q 4A3JH 4A4IA 2F4VQ 1T9HA 1YVCA 2B3GA 4A3GG 2N78A 2A1AA 1PH9A 1N36Q 3JAMc 5EAYA 2YU9H 4A3DG 1SMXA 3CP0A 4QY7A 1R9TH 4BBSG 4GNXB 1XNRL 1MIUA 3PIPA 1KQSA 4LWCA 3UDFA 2H5XA 4DUYQ 1K8AC 3AEVA 4LF9L 2MO0A 4DV2L 4IFDJ 4NXMQ 3J81j 2MQHA 1L1OA 3HOZH 1G6PA 2R92G 3HKZG 4JV5L 4IPHA 3RNUA 2JJQA 4A3LG 4QQBX 5C3EH 3CCVA 1JE5A 4A93G 5JEAG 5H1SE 2ES2A 3K81C 3L2PA 2MFIA 4BXXH 2UUBQ 1N9WA 1FVIA 3BJUA 1OXUA 2YTXA 2GN5A 3KF6B 1WOCA 4ALPA 1IZ6A 3G71A 3S15H 4K0KQ 3RN2A 4JBMA 3L0OA 4YCUA 3RLFA 3WWVA 3GTPH 3UDGA 2R7DA 2BH2A 4LF8Q 3PO2G 4LUZA 1IBLL 2NZOA 4LFCL 5C3EG 2JA7G 4DR6Q 2JQOA 3I7FA 4OWXB 4L5RC 4GS3A 1D7QA 4P73A 4JI2L 1HZBA 5BR8L 4JI7L 1CUKA 1XNQL 1QUQB 1EIYB 3HOUH 1HNXQ 3CCQA 4EQ5A 1SR3A 2KCTA 4UP8A 5GAHC 3CQZH 4PZ8A 1BBWA 4O0AA 4C3JH 3FKIH 5IWAL 1IBKL 4JI6L 3I4MG 5M3FH 1FL0A 5M3MG 2FXQA 1E3PA 2E5LQ 2NVTH 4B3RQ 1HNWL 1XMOQ 2CCZA 4DV7Q 3S14H 3A0JA 3T1YL 1QZHA 1I94Q 5LMNW 3J7ZC 1VQ6A 1PH3A 3KJPA 3HOUG 1E22A 1SN8A 3PUYA 4JI0L 1NBWA 4DR4Q 4A3KG 2HT1A 1N33L 4GKKL 2JEAI 5M3FG 5C4XG 2Q2UA 3D0FA 3EN2A 1I6HH 2CQOA 4GLVB 5DLQE 3D31A 2VQEL 1VQLA 3CC7A 1VQEA 3J81i 3CCUA 1WI5A 1UE5A 4JI3L 4JBJA 2I0QA 2N49A 2E2JH 1VQDA 2ATWA 4OX9L 1S3OA 4C2MH 1VS0A 3EBEA
chains in the Genus database with same CATH superfamily
4Y8VB 3K7UC 3PZPA 4KJOA 3PSIA 2F4VH 3DEPA 2VS1A 3CMEA 3A55A 4FXKC 1PH8A 2Z9HA 1QOHA 1NY4A 1I4GA 2CW0D 1JOQA 3J7AF 3HOWG 1L2ZA 5A35A 3R8BA 2B39A 2HQLA 1PH7A 4IZOA 4X64Q 3MR5A 1TWHB 3MEFA 2HHHQ 4TKOB 2ALYB 4NKLA 2VA3A 4RNNA 4K8IA 3H3VI 1OXSC 2R7NA 1QILA 4LSAA 2KHSA 1X32A 3W1GA 4DA2A 4HIDA 1BF4A 1TA8A 4DR5Q 3GIQA 1BDOA 2K75A 5FO9B 2R86A 1I6VC 4DL6A 4UY8C 2ZJRA 1NNXA 1X9NA 1AN7A 3T53B 4DR6H 4LF8H 3OPOA 2WACA 2BH8A 3PCOB 4IWXA 1RJRA 3T16A 1J5EL 3H20A 2NVXH 5KFYA 3T5LA 1YZ6A 2W9BB 3L9AX 2B2UA 1N8RC 5IIFA 2E5LL 2F3IA 3GTJH 1F2LA 5C44G 3K80C 2AUJD 5C44B 4MTNA 5KFKA 3ULJA 2EJFC 1V51A 2VB2X 1XMOH 1PZKD 3KAJA 1EFID 4Y7NH 1TWHA 1B7YB 4A3LH 3P7JA 1K8GA 3T13A 2NVXB 1VQGA 3M9OB 4BY7G 1NMGA 4O42A 4BY7B 3SEBA 1S97A 4DR4H 1LTLA 1YEZA 1EWIA 4XYMB 2W9CB 4EG0A 1ESFA 3GTJB 2BQRA 2OLSA 4HMJA 2FK2A 1JWMD 3OTOL 3QIAA 3FP9A 4OELB 3V2TA 1PHJA 3N44B 2EYPA 2K28A 5D3DA 2OWOA 3PO2H 1IOWA 4Y7NB 4GOPC 4DV1L 4K2LA 4QWDA 1K0RA 3Q0AA 3DEOA 1IBMQ 5GADC 3U9SA 1JB7A 4LF5L 1A15A 3GIDA 4ECXA 4NXNL 2CFMA 5CV5A 2UUCL 2R7LA 4DR1L 1N34H 1T5EA 1BCPC 4P2CB 3S2DH 1GJXA 3JZIA 1HQMC 4LFAL 3V05A 4O3SA 5EBDA 2A68D 2NB0A 3K6OA 2UVWA 1QNUA 4CDCC 4A2AA 2SNMA 4B3TL 2UXCL 4XIGS 1G2TA 5KG7A 3KDFA 4A3KH 3RJ0A 3DLLA 2KEEA 4LJZC 1A0IA 5C4XH 1AFPA 2Z6KA 4XXEA 3S9WA 3S2DB 5KFQA 4IUPA 5CBAE 1HNZL 1A8VA 2ZXOA 2L15A 4XT1B 1EYZA 4B3MH 5COYA 3GTKH 3BDCA 4DV3H 4R4IA 5DG7A 2UXBQ 3SXHA 2CVRA 5CA0F 3LNNA 5DG9A 2IJ0A 4X6AH 4PZ6A 2ATLA 4C1NI 4A3KB 2ZDGA 1HHVA 4DUZL 1ZHQA 5IYCH 1I5FA 4ECRA 5C4XB 3NQIA 3T1HH 4FM9A 1TWAH 4OHJA 2PI2A 3W5OA 1GD7A 1RJTA 4MA5A 2QEXA 4Q5VA 2QKIC 3GTKB 3EJIA 4MV8A 1IW7C 1YNJD 1BVSA 2NVQH 1A9XA 3VR4A 1LTBD 3X3MA 4HSPA 1U4RA 2F0TA 2F0UA 1JCKB 4RB0A 4UFZA 5GAEC 1II3A 5IYCG 4KHZA 1N34Q 4R8UB 2VW9A 5C5MA 4HIKA 4I7HA 5F9LA 3JRXA 3OHBA 2XIGA 3GTGH 4DUYL 2A69D 4WRDA 1TWAB 2R6FA 4NXML 3KFUA 1C30A 2VZAA 3R23A 4DR7H 3CXCA 1XNRQ 2PZUA 1RJPA 2BQUA 1JB3A 4E4TA 4LF6H 5FO8B 5J22A 3BZDB 4DV5H 3RR5A 2NVQB 1JLLB 1U5KA 5KNDA 4DV2Q 4R8NA 2NYZD 4CHTB 4GNXC 3I4NH 4KHPQ 4YY3L 1I6UA 2UUBL 2W7PA 2K04A 1HPCA 4ZKBB 4ZCKA 4G3IA 1BKBA 2VL6A 3A74A 3GTGB 2Z6BA 1ILPA 1V43A 2Q2IA 2IBKA 2V4RA 1FKAH 5DQHA 2R8IA 2ICIA 2L5TA 2AWOA 4B3MQ 3RBEA 1VQCA 1VCIA 1PDQA 3A8IE 3H15A 3I4NG 5E4WC 1KAAA 3ULLA 2AGPA 1O7LA 3I4NB 2C2RA 3NK9A 2WE6A 1K3BC 4J9RA 4WORA 3H91A 1PTOF 4HR7B 4JI2Q 3HOYH 2QYZA 4IHJF 1Q8IA 2FPIB 4IPGA 4F8MA 1E4EA 1WTQA 1Y1VG 1SRUA 2L1BA 2KQ3A 4QCLA 5KG3A 4BWSC 4IRCA 1SYFA 4ECQA 4JYAL 5E3FA 2ZJQA 1HNWQ 1W6KA 4R4CA 4QIWE 1OWTA 4ECYA 1F2YA 3BVZA 3FVQA 3HOYB 4NP5A 2XIWA 1RK5A 1PX2A 1V1QA 1JXLA 4ZQ3A 3WOFA 1PVOA 4HQ6A 4O3QA 1Q1BA 2F0KA 3PQIA 4DR7Q 4X62L 1PH6A 3KALA 4PV1C 3TREA 4DV5Q 4LF6Q 5BN5A 4WD3A 2FLPA 3KF8B 1OXTA 4DV0H 3G6EA 4WBNF 2QW7A 2WAQG 2PPBC 5IP9G 2F0EA 4IOCA 1TU2B 3TIIA 4FF4A 1VQ4A 4YB8B 3DWPA 4A3CH 1D1KA 2P0AA 4DKAC 2XGQA 4RZRA 2NVYH 5FLXL 3HOVH 1ENFA 4MV9A 1Y1VA 4JV2A 5DG8A 3CMAA 1XMQL 2R8KA 3KYHC 3OSOA 4Q0FA 4X64L 5BMVF 4XYLB 4HNTA 1XPUA 4LSXA 4PDBA 3HGBA 1EY9A 4LNQA 2IHEA 2TMPA 1ICFB 4HJ7A 1BGWA 3VPCA 1X54A 5J2UF 2NU6B 2FPGB 4YR0A 4RNOA 2NVYB 5CV9A 3HOVB 4GKJL 2A6EC 2RA4A 2J6TA 2FMCA 1ZEQX 2M00A 2J9GA 3I8ZA 3NBHA 4X65L 2VOBA 2WAQA 3RGXA 5DGAA 4DV6Q 2J4XA 4R9WA 1I50A 1IBLH 4R4QA 4UCTA 2JYOA 5ELDA 4IURA 4BXXG 4AYBG 1GUSA 5M5WH 5A2QL 5IYDH 2F3WA 4X66H 3IKJA 3RB6A 4E6IA 4ZKCB 2A8VA 3RAXA 3BU2A 3JC66 1JQYD 1IYJB 1TY0A 2R7KA 5JJZA 2WINB 1KC8C 3NEMA 5FPOA 3VYSA 4JI6H 1B53A 5CA1F 3E6ZX 3G7LA 4JG2A 2OQKA 1IKLA 1ASZA 2UU9Q 5DLGA 1LTTD 3M4PA 2YU9A 3MA2B 5K36G 2ZTEA 2Z4HA 1V8QA 5M5WB 3OIPA 1DD2A 1TS2A 1CSQA 4DL4A 3AQQA 1LTRD 3FKIG 3KJOA 2QF7A 3FKIB 2K03A 4YWMA 2PO4A 1KNEA 4JI0H 1PRTC 1VQIA 3M3YH 4LH6A 1VMPA 4B3SL 4FS1A 4YCWA 2F0VA 2W57A 5D1OA 3UFXB 1TQOA 1IBML 2VQEH 2MGSA 1R4PB 2JEBI 1CFMA 4JI3H 2YRXA 1J6QA 4JOIA 4AYBA 2DPIA 4OX9H 4HYKA 4YIJA 1Q82C 1CKNB 2F0FA 5D14A 1JWUD 1KBLA 4QL5A 1HCZA 4XDXA 2V4DA 3K3PA 3GTPA 1M4VA 2F1MA 3Q2OA 1RJQA 2V9WA 2F0NA 4JI8Q 3T56B 4B9XA 4DNIA 3I12A 5EPJA 1B1ZA 3TP5A 1DOKA 1IBLQ 5KYIA 5KYLA 1K83H 1VQJA 3PUWA 3FKIA 4LK1C 4LFBL 3BA9A 3G48A 2NN6I 2NN6G 4FBUA 4LW1A 3QO2A 1XTCD 4IJHA 4YCVA 5ISRA 1E24A 3PW5A 1SYEA 1L2FA 1ILQA 1RTOA 2UXBL 2XD4A 3PW7A 2AWNA 1FYCA 1RKNA 1WR2A 2SNSA 1OXXK 1BJTA 2B2WC 4MV1A 4JI5H 4N8FA 1K83B 2Y0SG 2I80A 2Y0SB 1CKNA 5M5YH 3B6YA 2R7ZH 1UE1A 1KLUD 1JR0D 4UDUC 5J1ZA 1N33Q 4A3IH 1IOVA 3VR3A 5KFVA 1ESRA 1J5EH 3KLSX 2KENA 3J80c 4HJ9A 1EIFA 1SCUB 2V59A 4DAYA 1KRSA 1WD1A 2VQEQ 4C2MA 2K01A 3NHHA 1SMYD 4A76A 4JI3Q 4I55F 1YNNC 1G2SA 5CAEB 4OX9Q 4A3JH 1A2TA 5M5YB 1CTMA 2R7ZB 2B3GA 2D9UA 1O80A 1ZYRD 2NTSA 1N32H 3PIO3 1R9TH 4A3IB 3T5HA 3GTOA 1XNRL 1J8IA 1EY6A 1KQSA 5CORA 2H5XA 2XNAC 4OIJA 4DV2L 1V4YA 2JP1A 3MJFA 1L1OA 5KGUA 3MAQA 4EQPA 2R92G 1NAPA 3HKZG 3OTOH 2JEJA 4RUCA 5EDWA 4ZAIA 3I90A 5CV4A 4IQZA 4LAAA 1I3QA 2DPJA 5JEAG 2ES2A 3K81C 1R9TB 4TV8F 2MFIA 1IHZA 4DV1H 2YTXA 3KF6B 4J9MA 2FE3A 2C2DA 3HXLA 3RN2A 1GSAA 1KC7A 3UDGA 1UUPA 4NXNH 2UUCH 4DR1H 2JA7G 5KG5A 2JQOA 3I7FA 1UC8A 4J9LA 2XWBB 3KBGA 4JI2L 1HZBA 1CUKA 4LFAH 1STGA 3VMMA 3QWNA 4UP8A 4NW2A 2H4OA 4TSSA 3M9NB 1QB5D 2KEDA 3CQZH 4PZ8A 1BBWA 5BR8H 4XZ3B 4DU9A 1WTVA 4EEYA 2F0MA 1UEAB 2E5LQ 4O2BF 1HNWL 2R92A 3HKZA 4ZRZA 1EU3A 1QZHA 1QG7A 5LMNW 3J7ZC 1HNZH 2JEIA 1A6XA 1SN8A 1R9TA 2JN4A 5J2TF 2GPWA 2C5CA 2EYLA 3NTKA 2NWGA 4ZYSA 5IGDA 3D0FA 3K3VA 1I4RA 1I6HH 3EVQA 3ONAB 2VUGA 4DN4M 4DUZH 1VQEA 4CDDC 4K2KA 3JSNA 3K5OA 2JA7A 2HDMA 3C1EA 1VQDA 3J80E 3Q24A 1E4FT 1VS0A 2EE1A 2EJGC 2QEJC 1ZKOA 1SAPA 3VPBA 4KD4A 3U9OA 5FLXW 3UQ8A 2F0DA 3GTLH 4H44C 2I5LX 2WTFA 3AFPA 3RBDA 1M90C 2DLNA 5L37A 4LF5Q 2GVAA 1I6HB 5D8DA 2Q8IB 1KL9A 1G91A 4DL7A 1EQTA 1C8CA 2A6HC 3X3NA 1AUVA 2XVSA 4DUYH 2BA1A 2FJZA 3NUCA 4NXMH 4MTEA 2HD3A 5EQ0A 4KY7A 3GILA 2WFWA 1H95A 2DWCA 1B9NA 3BVGA 3GTLB 1K73C 1A62A 4B3TQ 1KTKA 2UXCQ 2I87A 2G5DA 3ITPA 3KOJA 2BDNA 3K7AH 3EYYA 3W1BA 2XN9C 2UUBH 3J81c 3G6VA 4RAUC 4UP9A 3V96A 1ENAA 4BA1I 1KJJA 4K0KH 3D4WA 4DV6L 1O7YA 2BDOA 4JUZA 4MAMA 1S4ZA 1KRTA 4FU0A 2BQ3A 5I2YA 1W93A 4OGQC 1HJPA 5A2QW 4GZYC 2RF4A 2PMZE 2QDLA 4P72A 1EY4A 3OUZA 1CKOA 4TV9F 4DNRB 3K7AB 2NZ1D 3I4OA 5IYBG 5C0XI 2AHOB 5C5LA 2YZGA 2LS01 1BBXC 2FB9A 1K3RA 2KBNA 4FBTA 1I94L 2PVPA 3M9MB 4DAMA 4MZ9A 5LOVF 3PVXA 3DUZA 3NSWA 4JYAH 1NTGA 2XCLA 1LT4D 1I4PA 1Q81C 2N8NA 4IZ8A 3MXNB 2D62A 3RLNA 3S24A 2PN1A 4K8JA 4IFDI 1A3VA 2UXDQ 3F8NA 2E2IA 5LYJF 3ETHA 4Q45A 4S3SA 1PK8A 1LM0A 2KCCA 4IALA 4X62H 1YBYA 1VKZA 2EOTA 4M7EA 4J9PA 4Y52H 3BABA 3RZDH 1Q46A 4C3HG 2GLTA 4YY3Q 4PG3A 3L3OC 3R93A 2AQ3B 3A56A 3I4MH 3SK8A 2OT2A 2RDFA 2KCNA 4JI8L 4A3BG 1WTWA 3I55A 5M3MH 4DV4Q 3V6JA 2WB1G 1XX8A 4LH7A 4ECSA 2KVMA 2EVBA 1PRTF 1XMQH 3GLKA 5I9OA 3RZDB 3I72A 1STHA 3V6HA 2CWAA 5F2DA 3V6KA 4A3EG 4DAPA 1CS0A 4X64H 2IX3A 3C1FA 3H6MA 4UCRA 1GYFA 3I4MB 3MXGA 3R2IA 5JEAJ 5M3MB 3S1QH 4YAJB 2DGYA 3T51B 4EVOA 1BQQT 4NMZA 3J81E 2E74C 2K50A 3MFHA 4DR5H 4X65H 4JYAQ 1TT2A 4MTKA 5JPMC 1JJGA 1Z2NX 4IPCA 4BY1G 4EGVA 3CKIB 2HDLA 2HIXA 2IW3A 5LMNQ 2O5IC 1CZWA 1SNPA 1EFWA 3S1QB 1MJEA 1WVLA 4PMCA 1TKWB 3MC0B 3L4JA 1EIGA 2WB1A 4OXPA 1F9PA 4X62Q 3KAKA 4EFEA 2PNRC 3ER0A 2IT1A 2MNAA 1G8ZD 3MVVA 2CH4A 1AH9A 2ZJPA 3HOWH 1B70B 1ET9A 1FD7D 4UPAA 5I4DA 1HA6A 4X3KA 3BG3A 4LUOA 1TWHH 2PMZA 1K0SA 1MGSA 1LT3D 4EX5A 1I4QA 1TIID 5KFAA 4QWEA 4J9NA 4OIKA 2IWHA 2M2LA 3H3VH 4JPBW 4L63B 5KKNB 2EIFA 1WTXA 2DNCA 1E1TA 5IT9E 1NJIC 5EOYA 5CMDA 1XMQQ 3GO5A 4OO1I 4CKCA 3HOWB 1EYCA 2L4NA 1CA5A 4ECZA 4XYQA 3M7NA 1S0MA 4WJ3M 4QWAA 4B3SH 4JV5Q 1LTSD 2K5HA 3HS0C 2W6ZA 5TSSA 1B4OA 2Z1CA 1IBMH 2QDBA 3GP7A 4NB3A 1VQNA 3RD4A 2B2YA 2X6GA 4GKJQ 3ERSX 3N6RA 4ETSA 5C44H 3GDEA 4N8X1 4X65Q 5KFIA 3PGZA 1DOMA 1KDAA 3K0YA 1X3QA 3GQBA 1C9OA 5GAGC 2JK8A 3K5IA 2OF1A 3BYTB 5IGEA 1KDBA 5DQGA 1XNQQ 4BY7H 1FR3A 2XCAA 5C4ZA 1TWFA 2XRQD 1IBKQ 4LFBH 2R85A 2UVVA 4RCOA 2B2VA 2CW0C 1FGBD 1PYBA 2D0PA 1CQJB 1PFMA 3KHLA 4FS2A 4FDBA 1HXYD 2O5JC 3LWUA 1KD1C 4ECTA 3T1YQ 4O3OA 3P20A 2ZM6L 1TY2A 2UXBH 2HIVA 1W2BA 1EUJA 1EY7A 4O2DA 2C35B 4RKLA 1S5DD 3KDFB 4HCEA 3TP6A 5LMUL 4R7RA 4KY6A 5KFDA 5CYUA 1X55A 3BYYB 2LY7A 2O2LD 1STYA 1PH1A 1TWGH 4IUNA 2NU9B 4B08A 2R93A 1YHBA 1O7IA 2A5HA 2VY3A 3FEWX 4OWTB 1YJWA 1MJCA 4B3SQ 3T5JA 5KT6A 1B3QA 3EIVA 4IUTA 1QE6A 1MHWC 4YHHL 4R4TA 3N42B 5L1JA 3K0XA 5KFXA 1RODA 4DR3L 1B04A 1KJ8A 1TWGB 4KHVA 2IX1A 4RHSA 4A3MG 1AN8A 1S40A 2K4KA 5EKLA 5IP7G 2E76C 1XNRH 5KNBA 4YWKA 1VQ5A 3R5FA 2ASJA 5I6YA 4JV0A 4DV2H 2F0PA 4Q8FA 2VQDA 2UUAQ 5KG6A 4QMGA 4BBRH 1X56A 4KHPH 5IYZF 4UAIA 4LFBQ 4M1UB 3VR5A 3H40A 1B8AA 5JUMA 1SYDA 1EQQA 3N40P 1PFSA 1EWCA 1IW7D 5ELBA 4KJNA 3H4BA 5BPFA 3MEHA 4BBRG 4BBRB 1XXGA 4ID6A 5KFWA 1HZCA 3BQ0A 4JI2H 1GGOA 1TWGA 2XRSD 2AKWB 1STEA 2DUDA 4Q44A 1DONA 3G8CA 1E1OA 2HQEA 2A68C 5GROA 3P75A 2F0LA 2OCEA 4HJ5A 1HNWH 3RUPA 3RMHA 4LF4L 4DLKA 2YTYA 2UXDL 3U4ZA 3I2ZA 1S0OA 3AFQA 2EDGA 4J0MA 2I5MX 1GUGA 4XQJA 4M8AA 3C46A 1E4EB 4RGMA 2B2TC 4G7OC 1IL2A 4IUQA 1SJHD 3J7A5 3PV0A 5JVDF 1B9MA 1GVPA 4FP5D 2FMMA 2HGSA 1STAA 1V1PA 3ZJYC 2L55A 3DWQA 3WDNA 3UE1A 4QGUA 3M9BA 1IYVA 3MR6A 1YITA 3RIZA 4DV4L 4DAVA 3V4ZA 5CR3A 2JSOA 2D5DA 4R8IA 3W3AA 1Y1VH 4EYIB 1F77A 3J80L 4ZQIA 4F50A 1YNJC 2PZWA 4X3UA 5NUCA 2EZVA 1VQ7A 2LKVA 4FVMA 4ME3A 1HA5A 1VDZA 4HTHA 4FYDA 3S1NH 1K8MA 3GD7A 5KT3A 3Q8PB 3ETJA 4OWWB 4IR9A 2A69C 2YZNA 1U4MA 1TAEA 1E2VA 4H13C 3SR1A 5JOBA 3CCEA 1Y1VB 3ULPA 4YQWA 4O3RA 3QJYA 1PZID 3QOJA 2JA5G 2DY8A 3PIOA 3FRPB 4GN3B 1LUZA 1ICWA 1LYLA 3GTQB 3M4IA 2UVRA 1WTRA 5IP9H 4DV6H 5J3BA 3E9HA 4HAEA 2J6SA 4N9PA 5LMNL 4DL2A 3S1NB 3VYTA 2CKZB 1I50H 3BDLA 1MI2A 3Q8DA 4BBSH 1DOLA 1UWVA 5IGFA 4IO9A 4JI4Q 5C1PA 1CI3M 2VQFL 3NBHB 1MBYA 2WAQB 3D4DA 5J39A 2A73B 1I4XA 1VQPA 1VQKA 4K6DA 1S10A 2UU9H 1T9HA 1SNMA 5C4HA 1I50B 2A1AA 3MR2A 3JAMc 2YU9H 1TS4A 1EL0A 4A3DG 1SMXA 4MIUA 4QY7A 4ULLA 3K5MA 3Q22A 3H09A 4BBSG 4BBSB 4RB1A 1WTPA 2OEOA 5KT7A 1MIUA 3RV3A 4QUFA 3PIPA 1RD9D 1EY8A 4LWCA 4YAKB 1EOTA 2JA5A 4TRDA 2FLNA 1KABA 2RGRA 1H9JA 3GTQA 2MQHA 3LMLA 5FOBB 4JV5L 4IPHA 3Q8QB 1EZ6A 3E0JA 4RKBA 5C3EH 1MZBA 2V4QA 2B2UC 3CCVA 5EZYF 4C1NK 4A93G 4IRKA 2YU9B 2BE5D 3L2PA 4BXXH 4LMQD 1FVIA 1M0TA 1SNDA 1WOCA 4QB4A 2O03A 5EPKA 4JBMA 3N43B 3QG1A 4CBVA 3RLFA 3GTPH 4LUZA 1ENCA 2NZOA 4LFCL 5C3EG 4JI8H 3J7AV 4ECUA 3J7AK 5C3EB 5D1OB 5HURA 1D7QA 2V5AA 3H3VC 1XNQL 4RB2C 1EIYB 3Q8SB 4DL3A 3OSPA 1HNXQ 3CCQA 4EQ5A 2NBFA 4AYBB 5K36H 4J6HA 1IBKL 3FKIH 2EYJA 2YZMA 1LABA 1M8AA 5M3FH 3OSNA 1F9SA 1WTHA 2CW7A 3SE0A 3GTPB 4YBZB 3QR8A 1AP0A 1U9RA 2CCZA 3S14H 3SE7A 5JVG3 3VA5A 3T1YL 2MJ8A 1ZQ7A 3O13A 1I94Q 4J1MA 4ABNA 1VQ6A 4Q0YA 1H9KA 5EKIA 1E22A 2FJ2A 4CKBA 2RDHA 3V4SA 1KLGD 1PTOH 5M3FG 5M3FB 2ENBA 1N33H 4J8QA 3D31A 3J81L 1PXUA 3CC7A 1WI5A 2CQAA 2I0QA 3S14B 2X6LA 2W6MA 2E2JH 1D2BA 1SE3A 3MR3A 4C2MH 4QIWA 3FMCA 4DK6C 3GTMA 2ASLA 5KRUA 3PR5B 3JRWA 5JAVA 2Z6KC 1TWCA 5DQIA 1PTOB 5CGKA 3RTXA 3FHWA 3SGIA 2F0HA 2NN6H 4CJ0B 3JAME 1L0WA 1A63A 3G4SA 3GTOH 3GIIA 4POGA 2E2JB 1VAJA 4DAYB 4C2MB 3RB4A 2UUAL 2HVQA 3URYA 5H80A 4FF3A 3BVMA 4F4YA 3S17H 1T94A 4G57A 3G6JB 2CHBD 1KEEA 1I3QH 4CJ2C 1XWEA 2C22A 1NE3A 1Q1EA 2PW7A 3GTOB 2G9HD 3DMUA 1SLJA 1K28A 3HEJA 4KD3A 3RAQA 2K5WA 2YL2A 2BA0A 4ED6A 1Y1WG 1W6JA 1STNA 1BCPF 1L1OB 4H0LC 4CDFC 3M4YA 2E75C 3S17B 3TP7A 1DXMA 4RZQA 1I3QB 1I7NA 2XGPA 4B3RL 1EQRA 4KLKA 2ZDQA 5KFGA 1Z9FA 5KT5A 2AQ2B 2E5LH 1FNVA 3EROA 5T14A 5LP6F 2XSCA 1SFOA 1LT6D 2R92H 1GSOA 5JPNC 4L5SA 4EGQA 2YYAA 4O3PA 3TN2A 4J9QA 1P8LA 5JEAH 3KBXA 2LMCB 5LL6X 4B9WA 4L1KA 2ZM6H 4PWQA 1Q7YC 4RWSC 3S1RH 5LMUH 1Y1WA 5DEHA 5IY0A 1EHIA 3E5NA 2CQYA 2RCNA 2I5HA 2R92B 3HKZB 2JA7H 1ASYA 1X3FA 4DL5A 2OXPA 4K14A 3STBD 4DK3C 4QJFA 2BR0A 1GXDC 1EUDB 4V0BA 3K5HA 4DR2Q 4OEMB 2EYOA 2RDIA 3RFCA 4MHEA 1HTPA 4HIMA 1CT1D 4K5VA 2WDTA 3J80W 3TP8A 3S1RB 1SEIA 4YHHH 1T3NA 1ML0D 4LF5H 3F2BA 1GUNA 1JE4A 3M7GA 2JA7B 1PH5A 1SMYC 1UE6A 2PQAB 4HNVA 3ERQA 2MP1A 4DR3H 2NZHA 5M9OA 1OO9B 2P5ZX 4JI1Q 3M4OH 1Y14B 5FLMG 3DM1A 1VQAA 1KJQA 1ZYRC 4EBCA 1T5XD 3MFGA 4QW9A 5KFFA 4B3TH 2UXCH 3HOXG 3CPWA 2J7ZA 4DPGA 1VF5C 2DZDA 3PUXA 2KCMA 3VDYA 1CQIB 5KFPA 1G6ZA 4PZ7A 4GLAC 4FF1A 3RF2A 4ODGA 3M4OB 1S68A 2KHJA 3HZXA 3T1HL 1VQHA 1X3PA 3G6XA 2ZM6Q 2K05A 3P1HA 1GOZA 3KHRA 2ICEC 4JI4L 3MWMA 5LMUQ 2CH4W 3K5LA 2EYHA 3K59A 2GPSA 1WCMG 1YIJA 2PQAA 3S16H 1FJGQ 1AEXA 5FK9C 3BA8A 3L4KA 1YI2A 2MCTA 2HCIA 1SE8A 5HGTA 3MZ5A 1NUCA 4CJ1B 4FO2A 4RAYA 3S2HH 4YHHQ 1M7JA 2NU7B 5ELCA 3F2CA 2Q2TA 3NPPA 1P16A 4LF4H 1VBGA 2UXDH 2E2IH 4DR3Q 3I73A 1TXYA 4K6LA 3S16B 3SDZA 2EY5A 1H9MA 4XYOA 2H1EA 5HBRB 3BG5A 2W6NA 1BXRA 4Q43A 2QA4A 2A74C 4K5WA 2OTLA 4R1JA 5I2XA 3Q1KA 2IL8A 5KEEA 3LWBA 1PYWD 1K1QA 1QVCA 3S2HB 1CQFA 5IODA 1DGSA 4YY3H 5IYBH 3NXWA 1QJOA 2R61A 2CZGA 2RGVA 5EWEA 3TRZA 1WCMA 2KSWA 2E2IB 4DV4H 2F4IA 2AMCB 5KFTA 1SE2A 1K8OA 4RGOS 3TIGA 3Q6SA 2L0CA 1YJ9A 1HR0W 1HNXL 2PNHA 2IHFA 3TS2A 2VA2A 5LXTF 1XYIA 2I07B 2QILA 4GOPA 4JI7Q 2JA8G 1E7ZA 4MV7A 5C0XG 5DM63 4AIMA 4A75A 3HKSA 4IFDH 5IWAQ 3F2DA 2W8KA 2ID0A 3IG0A 4CGYB 2K14A 1PTOD 4JOIC 2K5NA 1X3EA 4OONA 1DCZA 3NGDA 3LWEA 1Q90A 3ICEA 2D0OA 4C3HH 1M6VA 3BZCA 2DN8A 4LF4Q 3DHQA 5EBCA 5IT9c 5KFRA 3J81W 1ZHSA 4IFDG 3E0EA 5LMNH 1KJ9A 1UC9A 4A3BH 3A5ZB 4O4LF 1CK1A 1OXVA 2K52A 1EYDA 3UDIA 2FFKB 2Z4IA 2ZT9C 4LMYA 4ME5A 3PN1A 4CKEA 4U68A 4DGZA 1U0LA 4C3HB 2M9VA 5HGQA 2ZXPA 1CKMA 1DZ1A 4A3EH 3H0GG 3I91A 4TVAB 1RDPD 4F87A 2N3SA 1JKJB 2WKCA 4A3BB 1WYDA 4KN7C 1B50A 4RMFA 1PFBA 4A3FH 1IXRA 2WB1B 3TMEA 2EQSA 1JMCA 1DIKA 2M05A 4RAZA 4IR1A 1YJNA 3OW2A 1MSGA 4DF7A 1EIHA 4ED7A 1GLVA 4EQOA 4ZLTF 2ALZA 1DV2A 4A3EB 4JV5H 5C5JA 2F3VA 5C3WA 2PMZB 1PV4A 4BY1H 1C4QA 1VMCA 3AB9A 3OWEB 5ELEA 3E9IA 5T1GA 4A3FG 4A3FB 4TQSA 2PYKA 4GKJH 1NMFA 1XJVA 2IP4A 3HOZG 2A19A 4EFBA 4AH6A 2KUMA 3A7AB 4RGNA 4X66L 5AJ3L 2EJMA 4LFCH 1ULZA 3H0GA 5KFEA 4BY1B 2YYZA 1L0XB 2K33A 4GNXA 2HJWA 1UNNC 1SNOA 1Y8NB 5KFJA 4UP7A 1XNQH 1PYSB 1E2WA 1L1OC 2GA4B 3VYRA 3PF5A 1WFQA 3PO3H 3WO1A 2R8GA 1TWFH 2K7VA 5DLFA 1IBKH 1Q8KA 1S9FA 2VQFQ 1UEBA 3CCMA 2MUYA 3EPIA 4OO1H 1D1IA 2R7FA 3FMAA 2ASBA 4K5XA 2XGTA 3T1YH 2Z8LA 2SCUB 4ZI7F 3CRLC 1KDCA 3LX0A 4C3JG 3R5XA 3BQ2A 4EBEA 1H9SA 5KT2A 4X3SA 1G51A 3HP3A 5ELFA 3PO3G 3PO3B 5KX5F 1TWFB 2I46A 2EYFA 2WIIB 4IPDA 4MV6A 3UI2A 4OO1G 1HUMA 1RF2D 2CW8A 4ZUIA 3BAAA 3MWEA 5KG0A 2R93H 4UHVA 3WOEA 1A2UA 1R4QB 3KTMA 1QUQA 3TZDA 1QCBD 3AU7A 4DR2L 2VXWA 3I56A 1VQ8A 3RUZA 3S1MH 1HTLD 2RQXA 1RIPA 1AZPA 3WNZA 4FNFA 1SYXB 2O4XA 1KHIA 2K5VA 4KI0A 3J80i 2R93G 1GUWA 2R93B 4JI1L 3OWFA 4LFCQ 3U50C 3S1MB 2IA6A 1Z6HA 2KECA 3DM3A 3PMFA 3CPFA 2FLLA 2UUAH 2L12A 3JAML 1HR0Q 1LTAD 2R8JA 4BA2I 1RHPA 3ND9A 2PI2E 5EPLA 5G3LF 2ZXRA 1HUNA 1JIHA 4JI5L 2FP4B 4YR3A 3GIJA 4ILWA 3GV3A 5CBEE 1Y69U 4QW8A 4LF7Q 3FDTA 3PR4A 1UAPA 2F52A 4I7AA 1QNKA 5HY6A 3I3CA 4IN3A 1GSHA 4AQYL 3R5HA 1D6EC 1BCPD 2RVLA 4ZK9B 4QWBA 5BPHA 1FJGL 5C0XJ 1D8LA 3SK4A 2PZTA 4A3MH 3MWYW 3CC2A 5LL6b 4B3RH 5IP7H 2Q8TA 1PRTB 1N32L 3NWSA 2XWJB 4A4IA 2F4VQ 2RBMA 3K58A 2W6PA 5L1IA 1L0YB 1Y8OB 5EAYA 3CP0A 5C8YF 3GV8B 1RCVD 2HCCA 4HEDA 4CC6A 2OH2A 4A3MB 1K8AC 4LF9L 3VYUA 1QWYA 4IFDJ 3J81j 4O2AF 4V190 3RNUA 1TR5A 2F03A 4A3LG 4QQBX 1GHJA 2F0WA 3IFTA 3Q8RB 2W9BA 2NUAB 2ASDA 3H94A 2K5QA 2L9HA 5I9PA 5IOCA 5H1SE 1N9WA 1CA6A 2GN5A 1J9OA 3VA7A 4ALPA 3G71A 5KG2A 1K1SA 3OW7A 4YCUA 1KNAA 2BH2A 4DR6Q 1TS3A 4LF8Q 3PO2G 5KFSA 2C9OA 3PO2B 3F2UA 5I6WA 1D5ZC 4L5RC 2NVXA 5BR8L 4JI7L 2F0IA 4MV3A 5I47A 1V1PB 4RHRA 1SR3A 2R87A 5GAHC 5EWFA 2PQEA 2VPSA 2W9CA 2B8FA 3TQTA 4BWGB 2TSSA 4O0AA 5IWAL 3GTJA 4EGJA 1FL0A 2C00A 2FXQA 1E3PA 4B3RQ 2YS7A 1BR9A 2K6AA 5FD5A 1XMOQ 3TSSA 3C3LA 3ORRA 4RUAA 4RB3C 2AGOA 1Y8PB 4JW0A 5EWGA 1F2MA 1PH3A 3KJPA 2SDFA 3GV5B 1SNQA 4DR4Q 4A3KG 4ECVA 4GKKL 2JEAI 5C4XG 2Q2UA 3GQCA 3PW0A 4KKTA 1JC7A 1PMRA 2CQOA 4GLVB 4DK0A 3J81i 3CCUA 1HRJA 4JI4H 3VPDA 1JX4A 2ATWA 1S3OA 3BDOA 4U7CA 3EBEA 5KNCA 1N36L 4NDXA 2R82A 1N56A 2B2WA 3RV4A 5JVLA 1T36A 5K2MA 1PH2A 1V9PA 2LXJA 3QB3A 1JJCB 5KFCA 2UVUA 2YTVA 1O78A 5IGBA 3KK7A 4YJ2F 3A8KE 1XPOA 2WAQE 1DYQA 2IY5B 2JA5H 1EEID 4RU9A 3GTQH 3FPUB 1V1OA 1VQOA 3A5UA 2R7MA 4JV1A 2YV5A 1JDEA 4K0KL 5DGBA 1CSPA 2KA7A 2VR1A 3PUZA 1LLRD 3U58A 5K5PA 4O4HF 4WFN3 3KHGA 4J9SA 3CW2C 3D3RA 2YCHA 2Q2HA 3GTKA 1MSHA 3I70A 3RN5A 1F2ZA 1VQBA 4DV3Q 2JA5B 4UCUA 2E2DC 5KFZA 1GUOA 2AUKA 3CHBD 1DJRD 4R4OA 1SYCA 4R8UA 3T1HQ 4C5BA 1HNXH 5D65A 1BXTA 3CD6A 4A3DH 1TWAA 4MTDA 3MXUA 1EQVA 4L5TA 4KKSA 4J9KA 1SSOA 1HFGA 2V58A 3QZ8A 1IYUA 2V1CC 4TQUS 4DV7L 3HFZB 4LUVA 5L1LA 4EBDA 4YJ3F 1ZETA 3N6XA 3LGJA 4BS9A 1M1KC 1SYGA 4Q8EA 1KJIA 1E0BA 2IX0A 3IAYA 2JEFA 1I94H 3BZKA 5IGCA 4AYBE 1SBBB 3HOYG 1LTGD 3F8TA 4A93H 2B29A 2B2YC 2K1BA 3GTGA 2JE6I 4A3DB 4C5AA 2A6ED 5C6AA 4CC5A 1CHPD 4XQNA 1IKMA 3WO0A 3QOLA 1Q86C 3MFIA 3RGZA 5EKKA 1B6SA 2XTIA 3GIPA 3IFDA 1XDNA 4DFAA 1X65A 3J7YW 4JK1C 3SI8A 1N48A 4HR7A 4A93B 2KJXA 3UE0A 5KIXA 2DIKA 3D6WA 3GTMH 3RLOA 4L5QA 2FK1A 1QZGA 2WV6D 1JOOA 2MPMA 1C48A 2B2VC 1TWCH 2OQ0A 1IL8A 2J6UA 4PNYA 4POFA 4RA8A 2B8GA 4RGTA 3M85A 5FD6A 2W8LA 2LXKA 4P71A 4MA0A 3TEHB 2EPBA 3U4VA 1JORA 4ZOLF 3KLRA 4JCVE 4HJAA 2AQ4A 1GO3E 1TVXA 5C3XA 4O3NA 3EA6A 2NTTA 4KY5A 4IOAA 5IE8A 2Z0SA 3F1ZA 3NWTA 1LO5D 4QIWB 5CV6A 2HHHL 4A3CG 5CC4A 1EZ1A 3JAMW 1HR0L 3GTMB 3OHXC 4GLXA 2EXDA 4MV4A 3HOVG 1TWCB 2ZTCA 2EXZA 1JJ2A 1ONLA 2JA9A 4DR5L 1EYAA 1PRTD 3C0FB 3AYHB 3OUUA 3KF8A 4YR2A 1BNCA 5CV8A 5EJWA 4P74A 1AZQA 5KT4A 4LF7L 2EY2A 1BOSA 3D6CA 2KHIA 4XTCS 2JEGA 1NSNS 4JC0A 3RZOH 4KTAA 2RSOA 2SOBA 1JOKA 4I7ZC 1VBHA 2BE5C 3ZYYX 1CHQD 2RHSB 2VPQA 4DV0Q 1VF7A 4JVZA 4RCNA 1YHAA 3FPPA 2I8CA 1WTOA 2BCOA 3EPGA 2F0GA 5JJLA 1WJJA 1OTCA 2QK4A 3ND8A 5LHY1 1BBUA 2F4VL 2G9DA 3MXPA 2Y0SE 4YP3A 1WH2A 1SFOH 3RZOB 1FNUA 4I65A 1G291 2HUGA 2ZTDA 3VR2A 5IYDG 2NVYA 2X69A 1X6OA 2DJGC 3M4QA 2NU8B 2MHVA 3T4AC 1GKHA 3OMCA 4XT3B 3CCRA 5JJKA 4JBKA 2NUCA 5FPRA 1F9QA 2PBZA 4PMBA 1RK6A 3OYYA 1SE4A 1E2ZA 1Y1WH 1SFOB 4F88A 4F4ZA 5DNFA 3K57A 3FDSA 1GM5A 4DXFA 1LTID 3TQYA 1AE3A 4X3TA 4DK1A 1LV9A 1RL2A 5LL6S 2JA6H 4HSVA 1C0AA 3OHAA 5IT9L 3DF7A 4WJ4A 2XC9A 4DR2H 3M3YB 1WSCA 4DR6L 4LF8L 5L1KA 1UNSA 3HKZE 5ELOA 5FJ8H 1Y1WB 3NTHA 4FF2A 2FPPB 1KIXA 4L8JA 1YNND 3DWAA 2CWPA 5DAUA 4APMA 5IGGA 1BNZA 4X66Q 2EY6A 2W6OA 4HIOA 5AJ3Q 4JI1H 2JA6G 1DV1A 2JA6B 1Q3LA 1HQRD 4H02A 2DY7A 4RH6A 4Z9CB 3DXJC 3K8AA 4C56C 1GHKA 3VR6A 1XMOL 5KFBA 4JI6Q 5E7NA 2VUMH 5FJ8G 5L9XA 5JQWA 5JVH3 3EQLC 5GQOA 4RG1A 3CC4A 4DR4L 3SHLA 3D4RA 2FINB 4IRDA 4GN4B 3NP8A 2ZJTA 4FXGC 5G3LD 4JI0Q 3TQ1A 2WP8J 5CV7A 1UE7A 1AE2A 2DNEA 4APVA 3JSLA 1U4PA 2VUMG 4PMWA 1SNCA 2MO1A 5D3IB 2VUMB 1EUCB 2W71A 2N55A 3GV7B 1EOVA 3IRBA 2ZDHA 4AQYH 1A3UA 3OIQA 1W3SA 5JJIA 2QCPX 1B3AA 1FJGH 2R3ZA 1QVGA 2VNUD 5KFNA 2PW5A 2L11A 1N34L 2R7ZG 2JA6A 5FLMH 3C2PA 1O7ZA 5LA6F 1KAWA 2RCFA 1EU4A 2RHQB 3I4LA 4PQXA 4A3IG 3MWDA 5KFUA 2BOSA 4MN3A 5JH7F 3HOXH 1EWHA 2X0SA 1EY5A 3MHBA 3SVMA 4ED0A 1S5ED 5C1OA 3TS0A 3A8JE 4NLGA 3KLWA 3K5NA 1CE8A 2R6GA 4C3IH 4KHPL 4NPSA 4A3JG 1K83A 4A3JB 1C3OA 2Y0SA 4LF9H 1NCVA 4HNUA 1PA6A 4ED2A 1JWSD 2RKSA 4XQQA 1S5BD 5KFOA 2VUMA 2C2EA 3HOXB 4KMUC 3CCJA 1PH4A 4B3ML 1KXLA 3PUVA 4DV3L 1M0WA 3GV6A 3PW2A 5AFWA 1EYGA 1WCMH 5EGTA 4C3IG 2VB3X 2PCFB 4JI5Q 4C3IB 1JT8A 1H9RA 3SK6A 1XTDA 2R7ZA 3STBC 3HRZC 3UDXA 3PIP3 1HH2P 2AQ1B 3R2TA 3N52A 4P75A 1FNWA 3BS1A 1HZ9A 4KV6A 5FLXc 3T5KA 3HBLA 4UCOA 1J5EQ 4JI7H 2R8HA 4YWLA 1Z2OX 3CCSA 4AQYQ 3HG9A 3IL8A 3BQ1A 3PF4A 1WCMB 5IWAH 1S03G 2A6HD 2SEBD 3E5SA 5M5XH 1B33N 4KKUA 2FKLA 3CCLA 1Z47A 4HN7A 4WJWA 2OTJA 1N32Q 1E4GT 3IN5A 1CQVA 3OOCA 2QGQA 3KF6A 4DR7L 3CQZB 1A3TA 1FGUA 4GOPB 1QVFA 4LF6L 4DV5L 4IJLA 4FXDA 3TZUA 2RSNA 4GKKH 1SXTA 2E8GA 3CAMA 4HJ8A 5M5XB 1SJED 2LFNA 4O4IF 5KFHA 2XCPA 3D8GA 3OTOQ 4GN5A 4LF9Q 3QFFA 4KN4C 1BCPB 1PZJD 3CF5A 1C7YA 5KFLA 4N9TA 1X3GA 4H7BA 3KHHA 1SROA 4EEQA 5E4XA 2K32A 4DV1Q 2DJFC 3NTIA 1S72A 1Q12A 1B2TA 4ECWA 2JA8H 1PLFA 1VQMA 3QZ7A 1VQ9A 5KG4A 1S5FD 2C28A 5C0XH 1K9MC 3NELA 3SK5A 3PW4A 1N36H 1SEBD 4NXNQ 3U9TA 2UUCQ 2GVBA 3L7ZC 4DR1Q 3W2DA 4IAJA 4M9UA 1SDFA 1D5XC 1HFNA 3CVZA 2YS6A 2EYMA 3A7LA 2E2HH 4LFAQ 4G7ZC 5KG1A 3R3OA 5BN4A 3CQZA 5CB4F 1ET6A 2FK3A 2B63H 5BR8Q 2JA8B 4U6PA 2JXMB 4TUYF 4IUUA 4OL7A 1CM9A 3NENA 3JAMi 4JBWA 4A2BA 4F4XA 1NR2A 1I4HA 4RNMA 1VQFA 1CZGA 2WB1E 3TINA 1HNZQ 1HZAA 4MNOA 4GC6A 2E2HB 4ZUJA 5ELNA 3CU7A 3TDQA 2WYOA 5GONF 3NE5B 1WD0A 2IMWP 2B63G 5C4JH 1YNXA 4J15A 4G7HC 4G4KA 2B63B 1AUXA 4O1NA 1XPRA 4U673 1NR4A 2D2CC 4A3GH 2W7OA 2KOLA 4DV0L 3H0GH 4GKKQ 2Q8RE 1PFNA 3N8DA 1YHQA 1U4LA 5FLXE 4DUZQ 2J0TD 4GC7A 1W96A 1EZ8A 4ZHQF 1EY0A 1MKHA 1Z7TA 2LSSA 3KXYT 4ED3A 3RB0A 2UU9L 2F0SA 3NQTA 5E1FA 4CDEC 2W9AA 2W6QA 2VQFH 4DV7H 3GIKA 4HCSA 4QUCA 5C4JB 1S0NA 3GTLA 1RYRA 1D5MC 1YVCA 5HV6A 4A3GG 1JICA 2FHTA 2N78A 5T1IA 4A3GB 1PH9A 1N36Q 1LT5D 1B44D 3ORQA 1EEFD 4QWCA 3H0GB 4ED1A 3BJYA 4DXGA 4GNXB 4IWYA 3HB9A 2F0OA 2IPKD 4XX0B 3N41B 3UDFA 4DUYQ 2WKDA 3AEVA 4TQRA 2MO0A 5D1PA 2E2HA 4KK7A 4NXMQ 2RDJA 3MFYA 2F0JA 5BN3A 3HOZH 1G6PA 1PTOC 4QF4A 4IUVA 1O75A 2JJQA 5FKAC 2YW2A 2B63A 4EQNA 1S5CD 1GUTA 1SYBA 1JE5A 2RDGA 5IT9W 2N88A 4C5CA 2UUBQ 3GIMA 3LP8A 3BJUA 1OXUA 5A2QE 3S15H 4K0KQ 2HVSA 2AU0A 1IZ6A 1H9SB 1AW7A 1DM0B 3L0OA 3WWVA 3OMGA 1Z2PX 2W70A 3HOZB 2R7DA 1IBLL 5DM73 4ME6A 3EFXD 4OWXB 2B2TA 4GS3A 1LACA 4P73A 4I4TF 3G6YA 1QUQB 3HOUH 2KCTA 4HMIA 4UCVA 3MXNA 4UCSA 3S15B 5F9NA 1F9RA 1RTNA 4C3JH 3I4MG 4JI6L 1STBA 4EYHB 3RB3A 2HHHH 5M3MG 1B6RA 1HR0H 2NVTH 3AMUA 1RYSA 4DV7Q 3A0JA 1TS5A 4ED8A 4RFBA 4J9OA 1JDBB 1MD2D 3HOUG 2AGQA 3PUYA 4LF7H 4JI0L 3HOUB 1NBWA 1BUVT 2HT1A 1N33L 2HVRA 3H4DA 4C3JB 3Q23A 4F7XA 1I7LA 2F0QA 3KLSA 3E3XA 2FMAA 3EN2A 4L6TB 5KFMA 2NVTB 5DLQE 2VQEL 1VQLA 2EY1A 3CRKC 4DNTB 3KUPA 4JI3L 1UE5A 3A54A 2K5DA 4JBJA 2N49A 4OX9L 4I50F 1BO0A 1ZXTA 2R84A 2YRWA 3NBIA 4F4WA 3TBIB 5FO7B 3MTSA
chains in the Genus database with same CATH topology
4DK6C 3K7UC 1N36L 3PSIA 2Z6KC 3GTLH 2I5LX 1PH2A 1V9PA 2LXJA 3AFPA 1JJCB 3FHWA 3SGIA 1M90C 2YTVA 2GVAA 2VS1A 3CMEA 4LF5Q 1A63A 1L0WA 1PH8A 1KL9A 3G4SA 3GTOH 1NY4A 1XPOA 4POGA 2WAQE 2IY5B 4DAYB 2BA1A 2JA5H 3HOWG 3GTQH 2UUAL 2HQLA 1VQOA 1PH7A 2WFWA 1H95A 3A5UA 4X64Q 3S17H 3MEFA 2YV5A 1K73C 1A62A 4B3TQ 2HHHQ 4K0KL 1CSPA 2ALYB 2UXCQ 3KOJA 1I3QH 3K7AH 3PUZA 3H3VI 3W1BA 1OXSC 3U58A 1NE3A 1Q1EA 3W1GA 4UP9A 4BA1I 3J81c 1SLJA 4HIDA 3CW2C 4DR5Q 2Q2HA 2K75A 4DV6L 2BA0A 3RN5A 1VQBA 4DV3Q 2ZJRA 1Y1WG 4UY8C 1X9NA 1KRTA 1L1OB 3PCOB 2BH8A 1HJPA 4R4OA 2RF4A 2PMZE 1J5EL 4P72A 2NVXH 1CKOA 1YZ6A 3T1HQ 5IYBG 1N8RC 3I4OA 3CD6A 5C0XI 4A3DH 4L5TA 2E5LL 4B3RL 2AHOB 2F3IA 1EQRA 4KLKA 3GTJH 2V1CC 5C44G 3K80C 1K3RA 4TQUS 1Z9FA 2KBNA 3HFZB 4DV7L 4LUVA 1I94L 4MTNA 3ULJA 4DAMA 3LGJA 4MZ9A 1M1KC 2R92H 2IX0A 4Y7NH 1B7YB 4A3LH 4L5SA 1K8GA 3BZKA 4AYBE 3HOYG 1VQGA 3F8TA 1NTGA 2B29A 4A93H 4BY7G 1NMGA 1P8LA 2JE6I 1Q81C 2N8NA 1LTLA 1YEZA 1EWIA 3MXNB 2D62A 3RLNA 3S24A 4IFDI 2UXDQ 1Q7YC 3OTOL 3S1RH 3FP9A 1Q86C 1PHJA 5IY0A 1LM0A 2RCNA 2I5HA 1YBYA 3PO2H 2XTIA 2OWOA 2JA7H 1ASYA 4Y52H 1X3FA 4GOPC 4DV1L 1X65A 3RZDH 1Q46A 3STBD 4DK3C 4QJFA 1K0RA 1IBMQ 3UE0A 5GADC 4YY3Q 4PG3A 3GTMH 1JB7A 4LF5L 3RLOA 4L5QA 4DR2Q 4NXNL 2CFMA 1QZGA 2OQ0A 2UUCL 4HIMA 1TWCH 4DR1L 3I4MH 4POFA 4A3BG 4JI8L 3M85A 3S2DH 3I55A 2LXKA 5M3MH 4DV4Q 4P71A 3F2BA 3TEHB 3U4VA 2WB1G 4LFAL 1PH5A 1UE6A 4JCVE 2PQAB 4HJAA 1GO3E 2NZHA 4IOAA 5IE8A 2Z0SA 3F1ZA 4JI1Q 4B3TL 1Y14B 2CWAA 5FLMG 1VQAA 2HHHL 4XIGS 3M4OH 1HR0L 4A3CG 4A3EG 4GLXA 3KDFA 4A3KH 2EXDA 3DLLA 3HOVG 2ZTCA 1JJ2A 1A0IA 5C4XH 3HOXG 2Z6KA 2JA9A 3CPWA 5JEAJ 4DPGA 4DR5L 3S1QH 3AYHB 2DGYA 1HNZL 3PUXA 1A8VA 2KCMA 4P74A 3VDYA 2L15A 4LF7L 2K50A 4PZ7A 3GTKH 4GLAC 2KHIA 4R4IA 4XTCS 4JYAQ 2UXBQ 4JC0A 3RZOH 2KHJA 4PZ6A 4X6AH 1JJGA 3T1HL 1VQHA 4IPCA 2UXDL 4BY1G 2ZM6Q 4DUZL 2HIXA 5IYCH 1I5FA 5LMNQ 2RHSB 4JI4L 1EFWA 5LMUQ 1MJEA 1TWAH 4DV0Q 2PI2A 1YHAA 4OXPA 3W5OA 1GD7A 1WCMG 4X62Q 2PQAA 3ER0A 2IT1A 2QEXA 1WJJA 1YIJA 2MNAA 1OTCA 3S16H 5JJLA 1FJGQ 1BBUA 1YI2A 1BVSA 2F4VL 2ZJPA 2NVQH 3HOWH 1AH9A 1B70B 2Y0SE 1SFOH 1SE8A 4UPAA 1G291 4LUOA 1TWHH 2ZTDA 5IYDG 5GAEC 5IYCG 4KHZA 1N34Q 2VW9A 4HIKA 1X6OA 4EX5A 4YHHQ 3S2HH 3M4QA 3GTGH 4DUYL 1GKHA 3F2CA 2Q2TA 1P16A 3CCRA 3H3VH 4NXML 5JJKA 4JBKA 3KFUA 2EIFA 2VZAA 1NJIC 1E1TA 3CXCA 1XNRQ 2E2IH 4DR3Q 1TXYA 3OYYA 3GO5A 1XMQQ 4OO1I 3RR5A 1Y1WH 1U5KA 4DV2Q 3M7NA 4WJ3M 2QA4A 4GNXC 2OTLA 3I4NH 4JV5Q 2K5HA 4YY3L 4KHPQ 2UUBL 4R1JA 1GM5A 3TQYA 1AE3A 1BKBA 1QVCA 2VL6A 3A74A 1DGSA 4NB3A 5IYBH 1RL2A 1V43A 2Q2IA 1VQNA 2JA6H 1C0AA 4WJ4A 4GKJQ 3TRZA 4DR6L 4LF8L 3ERSX 2AWOA 4B3MQ 1VQCA 5C44H 1VCIA 2AMCB 3GDEA 3HKZE 5ELOA 5FJ8H 4X65Q 3H15A 1KIXA 3I4NG 3PGZA 3ULLA 1YJ9A 1HR0W 2CWPA 1HNXL 1C9OA 2PNHA 5GAGC 2IHFA 2JK8A 4X66Q 3TS2A 4HIOA 5AJ3Q 4JI2Q 4GOPA 4JI7Q 2JA8G 2JA6G 1E7ZA 1XNQQ 3HOYH 4BY7H 5C0XG 4H02A 4IPGA 4AIMA 4A75A 3HKSA 3K8AA 5IWAQ 1IBKQ 1XMOL 1Y1VG 3F2DA 4JI6Q 2ID0A 5E7NA 2VUMH 1SRUA 5FJ8G 1PYBA 2D0PA 2K14A 4JYAL 4JOIC 2ZJQA 1HNWQ 4FDBA 5GQOA 4RG1A 3CC4A 2K5NA 4R4CA 1X3EA 1KD1C 4QIWE 3T1YQ 4OONA 4DR4L 2ZM6L 3ICEA 2HIVA 2D0OA 4GN4B 4C3HH 1W2BA 1EUJA 4O2DA 1V1QA 3BZCA 4LF4Q 2C35B 5LMUL 4JI0Q 2WP8J 3KDFB 5IT9c 1PVOA 1Q1BA 1UE7A 1AE2A 4DR7Q 4APVA 4IFDG 3E0EA 4X62L 1PH6A 1X55A 4PMWA 2MO1A 4LF6Q 3TREA 4DV5Q 3A5ZB 1PH1A 2VUMG 4A3BH 1EOVA 1TWGH 3KF8B 1OXTA 1OXVA 2K52A 3IRBA 1YHBA 1O7IA 1W3SA 2VY3A 4OWTB 3UDIA 3G6EA 1MJCA 1YJWA 4B3SQ 2WAQG 5JJIA 5IP9G 4IOCA 1QVGA 2VNUD 1VQ4A 1U0LA 2R7ZG 1N34L 5FLMH 3EIVA 5HGQA 4YHHL 4A3CH 1CKMA 4R4TA 4A3EH 1KAWA 2RHQB 3H0GG 4TVAB 4DKAC 4A3IG 2N3SA 2NVYH 3HOVH 3K0XA 1WYDA 3HOXH 3CMAA 4RMFA 4DR3L 1XMQL 4A3FH 2IX1A 4A3MG 1S40A 1IXRA 2K4KA 3KYHC 3TS0A 2EQSA 3KLWA 5IP7G 1JMCA 2R6GA 1YJNA 3OW2A 4X64L 4C3IH 4YWKA 4NPSA 4A3JG 1VQ5A 4KHPL 1XPUA 1PA6A 4LNQA 2IHEA 2UUAQ 4BBRH 1X56A 4HJ7A 1X54A 1PV4A 4BY1H 4GKJL 4LFBQ 3CCJA 4B3ML 3E9IA 4A3FG 1PH4A 1KXLA 1B8AA 3PUVA 4DV3L 4X65L 1NMFA 1EQQA 1XJVA 1FJGL 1EYGA 1WCMH 1PFSA 2A19A 3HOZG 4AH6A 4JI5Q 1JT8A 4DV6Q 4X66L 1XTDA 3STBC 3UDXA 4BBRG 5AJ3L 1HH2P 4R4QA 4P75A 4BXXG 4AYBG 5IYDH 1HZ9A 2YYZA 5M5WH 5FLXc 4GNXA 1HZCA 1J5EQ 2A8VA 4UP7A 4YWLA 3BU2A 1PYSB 3CCSA 3JC66 2AKWB 1IYJB 1L1OC 4AQYQ 3PF5A 1KC8C 1WFQA 3NEMA 3PO3H 2DUDA 1TWFH 3PF4A 1E1OA 5M5XH 1Q8KA 2VQFQ 1UEBA 3CCMA 5GROA 3CCLA 4JG2A 1Z47A 2OQKA 2UU9Q 1ASZA 2OCEA 2R7FA 2OTJA 2ASBA 3M4PA 4HJ5A 1N32Q 2XGTA 4LF4L 5K36G 2ZTEA 2YTYA 2QGQA 3KF6A 4DR7L 1CSQA 1FGUA 3AQQA 3FKIG 3I2ZA 3U4ZA 3KJOA 4GOPB 3AFQA 1QVFA 4YWMA 4LF6L 2UXCL 4DV5L 4IJLA 2I5MX 3PO3G 1G51A 1VQIA 3M3YH 3CAMA 2E8GA 4HJ8A 4B3SL 4IPDA 4YCWA 1IL2A 4OO1G 3OTOQ 4GN5A 4LF9Q 3J7A5 3PV0A 3CF5A 1C7YA 1IBML 2R93H 1QUQA 1GVPA 2JEBI 3ZJYC 1VQ8A 1J6QA 4DR2L 1X3GA 4JOIA 3I56A 1SROA 3S1MH 1S72A 4DV1Q 3UE1A 4QGUA 1Q12A 3M9BA 1RIPA 1YITA 1Q82C 2JA8H 1VQMA 1CKNB 1VQ9A 4DV4L 1K9MC 3NELA 4QL5A 4NXNQ 2UUCQ 2GVBA 3L7ZC 4DR1Q 1Y1VH 1KHIA 4JI8Q 2K5VA 4DNIA 4KI0A 3J80i 2R93G 4JI1L 1IBLQ 4LFAQ 2E2HH 4LFCQ 3U50C 1VQ7A 4ME3A 1K83H 1VQJA 3DM3A 3PUWA 2B63H 5BR8Q 3CPFA 3S1NH 4LFBL 3GD7A 3G48A 2NN6I 2NN6G 4OWWB 1HR0Q 4LW1A 3NENA 3JAMi 4JBWA 4IJHA 4YCVA 1E24A 3CCEA 3ULPA 4BA2I 1VQFA 2WB1E 2PI2E 1L2FA 4JI5L 2JA5G 2UXBL 3PIOA 1HNZQ 4GN3B 1HZAA 1LUZA 1LYLA 2AWNA 4MNOA 5ELNA 1OXXK 4LF7Q 5IP9H 5J3BA 3E9HA 2B63G 2Y0SG 5C4JH 1YNXA 4J15A 5LMNL 1CKNA 5M5YH 2F52A 3B6YA 2R7ZH 1UE1A 1XPRA 2CKZB 1I50H 5HY6A 4A3GH 4DV0L 3H0GH 4AQYL 4A3IH 1N33Q 4GKKQ 3Q8DA 4BBSH 1YHQA 4DUZQ 1UWVA 2KENA 3J80c 4HJ9A 1EIFA 1D8LA 5C0XJ 4IO9A 4JI4Q 2VQFL 1MKHA 2LSSA 1KRSA 3NBHB 2VQEQ 4A3MH 2UU9L 3CC2A 5IP7H 4A76A 4JI3Q 1N32L 1VQPA 1VQKA 4OX9Q 4A3JH 4A4IA 2F4VQ 1T9HA 1YVCA 2B3GA 4A3GG 2N78A 2A1AA 1PH9A 1N36Q 3JAMc 5EAYA 2YU9H 4A3DG 1SMXA 3CP0A 4QY7A 1R9TH 4BBSG 4GNXB 1XNRL 1MIUA 3PIPA 1KQSA 4LWCA 3UDFA 2H5XA 4DUYQ 1K8AC 3AEVA 4LF9L 2MO0A 4DV2L 4IFDJ 4NXMQ 3J81j 2MQHA 1L1OA 3HOZH 1G6PA 2R92G 3HKZG 4JV5L 4IPHA 3RNUA 2JJQA 4A3LG 4QQBX 5C3EH 3CCVA 1JE5A 4A93G 5JEAG 5H1SE 2ES2A 3K81C 3L2PA 2MFIA 4BXXH 2UUBQ 1N9WA 1FVIA 3BJUA 1OXUA 2YTXA 2GN5A 3KF6B 1WOCA 4ALPA 1IZ6A 3G71A 3S15H 4K0KQ 3RN2A 4JBMA 3L0OA 4YCUA 3RLFA 3WWVA 3GTPH 3UDGA 2R7DA 2BH2A 4LF8Q 3PO2G 4LUZA 1IBLL 2NZOA 4LFCL 5C3EG 2JA7G 4DR6Q 2JQOA 3I7FA 4OWXB 4L5RC 4GS3A 1D7QA 4P73A 4JI2L 1HZBA 5BR8L 4JI7L 1CUKA 1XNQL 1QUQB 1EIYB 3HOUH 1HNXQ 3CCQA 4EQ5A 1SR3A 2KCTA 4UP8A 5GAHC 3CQZH 4PZ8A 1BBWA 4O0AA 4C3JH 3FKIH 5IWAL 1IBKL 4JI6L 3I4MG 5M3FH 1FL0A 5M3MG 2FXQA 1E3PA 2E5LQ 2NVTH 4B3RQ 1HNWL 1XMOQ 2CCZA 4DV7Q 3S14H 3A0JA 3T1YL 1QZHA 1I94Q 5LMNW 3J7ZC 1VQ6A 1PH3A 3KJPA 3HOUG 1E22A 1SN8A 3PUYA 4JI0L 1NBWA 4DR4Q 4A3KG 2HT1A 1N33L 4GKKL 2JEAI 5M3FG 5C4XG 2Q2UA 3D0FA 3EN2A 1I6HH 2CQOA 4GLVB 5DLQE 3D31A 2VQEL 1VQLA 3CC7A 1VQEA 3J81i 3CCUA 1WI5A 1UE5A 4JI3L 4JBJA 2I0QA 2N49A 2E2JH 1VQDA 2ATWA 4OX9L 1S3OA 4C2MH 1VS0A 3EBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DK6 C;  3K7U C;  1N36 L;  3PSI A;  2Z6K C;  3GTL H;  2I5L X;  1PH2 A;  1V9P A;  2LXJ A;  3AFP A;  1JJC B;  3FHW A;  3SGI A;  1M90 C;  2YTV A;  2GVA A;  2VS1 A;  3CME A;  4LF5 Q;  1A63 A;  1L0W A;  1PH8 A;  1KL9 A;  3G4S A;  3GTO H;  1NY4 A;  1XPO A;  4POG A;  2WAQ E;  2IY5 B;  4DAY B;  2BA1 A;  2JA5 H;  3HOW G;  3GTQ H;  2UUA L;  2HQL A;  1VQO A;  1PH7 A;  2WFW A;  1H95 A;  3A5U A;  4X64 Q;  3S17 H;  3MEF A;  2YV5 A;  1K73 C;  1A62 A;  4B3T Q;  2HHH Q;  4K0K L;  1CSP A;  2ALY B;  2UXC Q;  3KOJ A;  1I3Q H;  3K7A H;  3PUZ A;  3H3V I;  3W1B A;  1OXS C;  3U58 A;  1NE3 A;  1Q1E A;  3W1G A;  4UP9 A;  4BA1 I;  3J81 c;  1SLJ A;  4HID A;  3CW2 C;  4DR5 Q;  2Q2H A;  2K75 A;  4DV6 L;  2BA0 A;  3RN5 A;  1VQB A;  4DV3 Q;  2ZJR A;  1Y1W G;  4UY8 C;  1X9N A;  1KRT A;  1L1O B;  3PCO B;  2BH8 A;  1HJP A;  4R4O A;  2RF4 A;  2PMZ E;  1J5E L;  4P72 A;  2NVX H;  1CKO A;  1YZ6 A;  3T1H Q;  5IYB G;  1N8R C;  3I4O A;  3CD6 A;  5C0X I;  4A3D H;  4L5T A;  2E5L L;  4B3R L;  2AHO B;  2F3I A;  1EQR A;  4KLK A;  3GTJ H;  2V1C C;  5C44 G;  3K80 C;  1K3R A;  4TQU S;  1Z9F A;  2KBN A;  3HFZ B;  4DV7 L;  4LUV A;  1I94 L;  4MTN A;  3ULJ A;  4DAM A;  3LGJ A;  4MZ9 A;  1M1K C;  2R92 H;  2IX0 A;  4Y7N H;  1B7Y B;  4A3L H;  4L5S A;  1K8G A;  3BZK A;  4AYB E;  3HOY G;  1VQG A;  3F8T A;  1NTG A;  2B29 A;  4A93 H;  4BY7 G;  1NMG A;  1P8L A;  2JE6 I;  1Q81 C;  2N8N A;  1LTL A;  1YEZ A;  1EWI A;  3MXN B;  2D62 A;  3RLN A;  3S24 A;  4IFD I;  2UXD Q;  1Q7Y C;  3OTO L;  3S1R H;  3FP9 A;  1Q86 C;  1PHJ A;  5IY0 A;  1LM0 A;  2RCN A;  2I5H A;  1YBY A;  3PO2 H;  2XTI A;  2OWO A;  2JA7 H;  1ASY A;  4Y52 H;  1X3F A;  4GOP C;  4DV1 L;  1X65 A;  3RZD H;  1Q46 A;  3STB D;  4DK3 C;  4QJF A;  1K0R A;  1IBM Q;  3UE0 A;  5GAD C;  4YY3 Q;  4PG3 A;  3GTM H;  1JB7 A;  4LF5 L;  3RLO A;  4L5Q A;  4DR2 Q;  4NXN L;  2CFM A;  1QZG A;  2OQ0 A;  2UUC L;  4HIM A;  1TWC H;  4DR1 L;  3I4M H;  4POF A;  4A3B G;  4JI8 L;  3M85 A;  3S2D H;  3I55 A;  2LXK A;  5M3M H;  4DV4 Q;  4P71 A;  3F2B A;  3TEH B;  3U4V A;  2WB1 G;  4LFA L;  1PH5 A;  1UE6 A;  4JCV E;  2PQA B;  4HJA A;  1GO3 E;  2NZH A;  4IOA A;  5IE8 A;  2Z0S A;  3F1Z A;  4JI1 Q;  4B3T L;  1Y14 B;  2CWA A;  5FLM G;  1VQA A;  2HHH L;  4XIG S;  3M4O H;  1HR0 L;  4A3C G;  4A3E G;  4GLX A;  3KDF A;  4A3K H;  2EXD A;  3DLL A;  3HOV G;  2ZTC A;  1JJ2 A;  1A0I A;  5C4X H;  3HOX G;  2Z6K A;  2JA9 A;  3CPW A;  5JEA J;  4DPG A;  4DR5 L;  3S1Q H;  3AYH B;  2DGY A;  1HNZ L;  3PUX A;  1A8V A;  2KCM A;  4P74 A;  3VDY A;  2L15 A;  4LF7 L;  2K50 A;  4PZ7 A;  3GTK H;  4GLA C;  2KHI A;  4R4I A;  4XTC S;  4JYA Q;  2UXB Q;  4JC0 A;  3RZO H;  2KHJ A;  4PZ6 A;  4X6A H;  1JJG A;  3T1H L;  1VQH A;  4IPC A;  2UXD L;  4BY1 G;  2ZM6 Q;  4DUZ L;  2HIX A;  5IYC H;  1I5F A;  5LMN Q;  2RHS B;  4JI4 L;  1EFW A;  5LMU Q;  1MJE A;  1TWA H;  4DV0 Q;  2PI2 A;  1YHA A;  4OXP A;  3W5O A;  1GD7 A;  1WCM G;  4X62 Q;  2PQA A;  3ER0 A;  2IT1 A;  2QEX A;  1WJJ A;  1YIJ A;  2MNA A;  1OTC A;  3S16 H;  5JJL A;  1FJG Q;  1BBU A;  1YI2 A;  1BVS A;  2F4V L;  2ZJP A;  2NVQ H;  3HOW H;  1AH9 A;  1B70 B;  2Y0S E;  1SFO H;  1SE8 A;  4UPA A;  1G29 1;  4LUO A;  1TWH H;  2ZTD A;  5IYD G;  5GAE C;  5IYC G;  4KHZ A;  1N34 Q;  2VW9 A;  4HIK A;  1X6O A;  4EX5 A;  4YHH Q;  3S2H H;  3M4Q A;  3GTG H;  4DUY L;  1GKH A;  3F2C A;  2Q2T A;  1P16 A;  3CCR A;  3H3V H;  4NXM L;  5JJK A;  4JBK A;  3KFU A;  2EIF A;  2VZA A;  1NJI C;  1E1T A;  3CXC A;  1XNR Q;  2E2I H;  4DR3 Q;  1TXY A;  3OYY A;  3GO5 A;  1XMQ Q;  4OO1 I;  3RR5 A;  1Y1W H;  1U5K A;  4DV2 Q;  3M7N A;  4WJ3 M;  2QA4 A;  4GNX C;  2OTL A;  3I4N H;  4JV5 Q;  2K5H A;  4YY3 L;  4KHP Q;  2UUB L;  4R1J A;  1GM5 A;  3TQY A;  1AE3 A;  1BKB A;  1QVC A;  2VL6 A;  3A74 A;  1DGS A;  4NB3 A;  5IYB H;  1RL2 A;  1V43 A;  2Q2I A;  1VQN A;  2JA6 H;  1C0A A;  4WJ4 A;  4GKJ Q;  3TRZ A;  4DR6 L;  4LF8 L;  3ERS X;  2AWO A;  4B3M Q;  1VQC A;  5C44 H;  1VCI A;  2AMC B;  3GDE A;  3HKZ E;  5ELO A;  5FJ8 H;  4X65 Q;  3H15 A;  1KIX A;  3I4N G;  3PGZ A;  3ULL A;  1YJ9 A;  1HR0 W;  2CWP A;  1HNX L;  1C9O A;  2PNH A;  5GAG C;  2IHF A;  2JK8 A;  4X66 Q;  3TS2 A;  4HIO A;  5AJ3 Q;  4JI2 Q;  4GOP A;  4JI7 Q;  2JA8 G;  2JA6 G;  1E7Z A;  1XNQ Q;  3HOY H;  4BY7 H;  5C0X G;  4H02 A;  4IPG A;  4AIM A;  4A75 A;  3HKS A;  3K8A A;  5IWA Q;  1IBK Q;  1XMO L;  1Y1V G;  3F2D A;  4JI6 Q;  2ID0 A;  5E7N A;  2VUM H;  1SRU A;  5FJ8 G;  1PYB A;  2D0P A;  2K14 A;  4JYA L;  4JOI C;  2ZJQ A;  1HNW Q;  4FDB A;  5GQO A;  4RG1 A;  3CC4 A;  2K5N A;  4R4C A;  1X3E A;  1KD1 C;  4QIW E;  3T1Y Q;  4OON A;  4DR4 L;  2ZM6 L;  3ICE A;  2HIV A;  2D0O A;  4GN4 B;  4C3H H;  1W2B A;  1EUJ A;  4O2D A;  1V1Q A;  3BZC A;  4LF4 Q;  2C35 B;  5LMU L;  4JI0 Q;  2WP8 J;  3KDF B;  5IT9 c;  1PVO A;  1Q1B A;  1UE7 A;  1AE2 A;  4DR7 Q;  4APV A;  4IFD G;  3E0E A;  4X62 L;  1PH6 A;  1X55 A;  4PMW A;  2MO1 A;  4LF6 Q;  3TRE A;  4DV5 Q;  3A5Z B;  1PH1 A;  2VUM G;  4A3B H;  1EOV A;  1TWG H;  3KF8 B;  1OXT A;  1OXV A;  2K52 A;  3IRB A;  1YHB A;  1O7I A;  1W3S A;  2VY3 A;  4OWT B;  3UDI A;  3G6E A;  1MJC A;  1YJW A;  4B3S Q;  2WAQ G;  5JJI A;  5IP9 G;  4IOC A;  1QVG A;  2VNU D;  1VQ4 A;  1U0L A;  2R7Z G;  1N34 L;  5FLM H;  3EIV A;  5HGQ A;  4YHH L;  4A3C H;  1CKM A;  4R4T A;  4A3E H;  1KAW A;  2RHQ B;  3H0G G;  4TVA B;  4DKA C;  4A3I G;  2N3S A;  2NVY H;  3HOV H;  3K0X A;  1WYD A;  3HOX H;  3CMA A;  4RMF A;  4DR3 L;  1XMQ L;  4A3F H;  2IX1 A;  4A3M G;  1S40 A;  1IXR A;  2K4K A;  3KYH C;  3TS0 A;  2EQS A;  3KLW A;  5IP7 G;  1JMC A;  2R6G A;  1YJN A;  3OW2 A;  4X64 L;  4C3I H;  4YWK A;  4NPS A;  4A3J G;  1VQ5 A;  4KHP L;  1XPU A;  1PA6 A;  4LNQ A;  2IHE A;  2UUA Q;  4BBR H;  1X56 A;  4HJ7 A;  1X54 A;  1PV4 A;  4BY1 H;  4GKJ L;  4LFB Q;  3CCJ A;  4B3M L;  3E9I A;  4A3F G;  1PH4 A;  1KXL A;  1B8A A;  3PUV A;  4DV3 L;  4X65 L;  1NMF A;  1EQQ A;  1XJV A;  1FJG L;  1EYG A;  1WCM H;  1PFS A;  2A19 A;  3HOZ G;  4AH6 A;  4JI5 Q;  1JT8 A;  4DV6 Q;  4X66 L;  1XTD A;  3STB C;  3UDX A;  4BBR G;  5AJ3 L;  1HH2 P;  4R4Q A;  4P75 A;  4BXX G;  4AYB G;  5IYD H;  1HZ9 A;  2YYZ A;  5M5W H;  5FLX c;  4GNX A;  1HZC A;  1J5E Q;  2A8V A;  4UP7 A;  4YWL A;  3BU2 A;  1PYS B;  3CCS A;  3JC6 6;  2AKW B;  1IYJ B;  1L1O C;  4AQY Q;  3PF5 A;  1KC8 C;  1WFQ A;  3NEM A;  3PO3 H;  2DUD A;  1TWF H;  3PF4 A;  1E1O A;  5M5X H;  1Q8K A;  2VQF Q;  1UEB A;  3CCM A;  5GRO A;  3CCL A;  4JG2 A;  1Z47 A;  2OQK A;  2UU9 Q;  1ASZ A;  2OCE A;  2R7F A;  2OTJ A;  2ASB A;  3M4P A;  4HJ5 A;  1N32 Q;  2XGT A;  4LF4 L;  5K36 G;  2ZTE A;  2YTY A;  2QGQ A;  3KF6 A;  4DR7 L;  1CSQ A;  1FGU A;  3AQQ A;  3FKI G;  3I2Z A;  3U4Z A;  3KJO A;  4GOP B;  3AFQ A;  1QVF A;  4YWM A;  4LF6 L;  2UXC L;  4DV5 L;  4IJL A;  2I5M X;  3PO3 G;  1G51 A;  1VQI A;  3M3Y H;  3CAM A;  2E8G A;  4HJ8 A;  4B3S L;  4IPD A;  4YCW A;  1IL2 A;  4OO1 G;  3OTO Q;  4GN5 A;  4LF9 Q;  3J7A 5;  3PV0 A;  3CF5 A;  1C7Y A;  1IBM L;  2R93 H;  1QUQ A;  1GVP A;  2JEB I;  3ZJY C;  1VQ8 A;  1J6Q A;  4DR2 L;  1X3G A;  4JOI A;  3I56 A;  1SRO A;  3S1M H;  1S72 A;  4DV1 Q;  3UE1 A;  4QGU A;  1Q12 A;  3M9B A;  1RIP A;  1YIT A;  1Q82 C;  2JA8 H;  1VQM A;  1CKN B;  1VQ9 A;  4DV4 L;  1K9M C;  3NEL A;  4QL5 A;  4NXN Q;  2UUC Q;  2GVB A;  3L7Z C;  4DR1 Q;  1Y1V H;  1KHI A;  4JI8 Q;  2K5V A;  4DNI A;  4KI0 A;  3J80 i;  2R93 G;  4JI1 L;  1IBL Q;  4LFA Q;  2E2H H;  4LFC Q;  3U50 C;  1VQ7 A;  4ME3 A;  1K83 H;  1VQJ A;  3DM3 A;  3PUW A;  2B63 H;  5BR8 Q;  3CPF A;  3S1N H;  4LFB L;  3GD7 A;  3G48 A;  2NN6 I;  2NN6 G;  4OWW B;  1HR0 Q;  4LW1 A;  3NEN A;  3JAM i;  4JBW A;  4IJH A;  4YCV A;  1E24 A;  3CCE A;  3ULP A;  4BA2 I;  1VQF A;  2WB1 E;  2PI2 E;  1L2F A;  4JI5 L;  2JA5 G;  2UXB L;  3PIO A;  1HNZ Q;  4GN3 B;  1HZA A;  1LUZ A;  1LYL A;  2AWN A;  4MNO A;  5ELN A;  1OXX K;  4LF7 Q;  5IP9 H;  5J3B A;  3E9H A;  2B63 G;  2Y0S G;  5C4J H;  1YNX A;  4J15 A;  5LMN L;  1CKN A;  5M5Y H;  2F52 A;  3B6Y A;  2R7Z H;  1UE1 A;  1XPR A;  2CKZ B;  1I50 H;  5HY6 A;  4A3G H;  4DV0 L;  3H0G H;  4AQY L;  4A3I H;  1N33 Q;  4GKK Q;  3Q8D A;  4BBS H;  1YHQ A;  4DUZ Q;  1UWV A;  2KEN A;  3J80 c;  4HJ9 A;  1EIF A;  1D8L A;  5C0X J;  4IO9 A;  4JI4 Q;  2VQF L;  1MKH A;  2LSS A;  1KRS A;  3NBH B;  2VQE Q;  4A3M H;  2UU9 L;  3CC2 A;  5IP7 H;  4A76 A;  4JI3 Q;  1N32 L;  1VQP A;  1VQK A;  4OX9 Q;  4A3J H;  4A4I A;  2F4V Q;  1T9H A;  1YVC A;  2B3G A;  4A3G G;  2N78 A;  2A1A A;  1PH9 A;  1N36 Q;  3JAM c;  5EAY A;  2YU9 H;  4A3D G;  1SMX A;  3CP0 A;  4QY7 A;  1R9T H;  4BBS G;  4GNX B;  1XNR L;  1MIU A;  3PIP A;  1KQS A;  4LWC A;  3UDF A;  2H5X A;  4DUY Q;  1K8A C;  3AEV A;  4LF9 L;  2MO0 A;  4DV2 L;  4IFD J;  4NXM Q;  3J81 j;  2MQH A;  1L1O A;  3HOZ H;  1G6P A;  2R92 G;  3HKZ G;  4JV5 L;  4IPH A;  3RNU A;  2JJQ A;  4A3L G;  4QQB X;  5C3E H;  3CCV A;  1JE5 A;  4A93 G;  5JEA G;  5H1S E;  2ES2 A;  3K81 C;  3L2P A;  2MFI A;  4BXX H;  2UUB Q;  1N9W A;  1FVI A;  3BJU A;  1OXU A;  2YTX A;  2GN5 A;  3KF6 B;  1WOC A;  4ALP A;  1IZ6 A;  3G71 A;  3S15 H;  4K0K Q;  3RN2 A;  4JBM A;  3L0O A;  4YCU A;  3RLF A;  3WWV A;  3GTP H;  3UDG A;  2R7D A;  2BH2 A;  4LF8 Q;  3PO2 G;  4LUZ A;  1IBL L;  2NZO A;  4LFC L;  5C3E G;  2JA7 G;  4DR6 Q;  2JQO A;  3I7F A;  4OWX B;  4L5R C;  4GS3 A;  1D7Q A;  4P73 A;  4JI2 L;  1HZB A;  5BR8 L;  4JI7 L;  1CUK A;  1XNQ L;  1QUQ B;  1EIY B;  3HOU H;  1HNX Q;  3CCQ A;  4EQ5 A;  1SR3 A;  2KCT A;  4UP8 A;  5GAH C;  3CQZ H;  4PZ8 A;  1BBW A;  4O0A A;  4C3J H;  3FKI H;  5IWA L;  1IBK L;  4JI6 L;  3I4M G;  5M3F H;  1FL0 A;  5M3M G;  2FXQ A;  1E3P A;  2E5L Q;  2NVT H;  4B3R Q;  1HNW L;  1XMO Q;  2CCZ A;  4DV7 Q;  3S14 H;  3A0J A;  3T1Y L;  1QZH A;  1I94 Q;  5LMN W;  3J7Z C;  1VQ6 A;  1PH3 A;  3KJP A;  3HOU G;  1E22 A;  1SN8 A;  3PUY A;  4JI0 L;  1NBW A;  4DR4 Q;  4A3K G;  2HT1 A;  1N33 L;  4GKK L;  2JEA I;  5M3F G;  5C4X G;  2Q2U A;  3D0F A;  3EN2 A;  1I6H H;  2CQO A;  4GLV B;  5DLQ E;  3D31 A;  2VQE L;  1VQL A;  3CC7 A;  1VQE A;  3J81 i;  3CCU A;  1WI5 A;  1UE5 A;  4JI3 L;  4JBJ A;  2I0Q A;  2N49 A;  2E2J H;  1VQD A;  2ATW A;  4OX9 L;  1S3O A;  4C2M H;  1VS0 A;  3EBE A; 
#chains in the Genus database with same CATH topology
 4Y8V B;  3K7U C;  3PZP A;  4KJO A;  3PSI A;  2F4V H;  3DEP A;  2VS1 A;  3CME A;  3A55 A;  4FXK C;  1PH8 A;  2Z9H A;  1QOH A;  1NY4 A;  1I4G A;  2CW0 D;  1JOQ A;  3J7A F;  3HOW G;  1L2Z A;  5A35 A;  3R8B A;  2B39 A;  2HQL A;  1PH7 A;  4IZO A;  4X64 Q;  3MR5 A;  1TWH B;  3MEF A;  2HHH Q;  4TKO B;  2ALY B;  4NKL A;  2VA3 A;  4RNN A;  4K8I A;  3H3V I;  1OXS C;  2R7N A;  1QIL A;  4LSA A;  2KHS A;  1X32 A;  3W1G A;  4DA2 A;  4HID A;  1BF4 A;  1TA8 A;  4DR5 Q;  3GIQ A;  1BDO A;  2K75 A;  5FO9 B;  2R86 A;  1I6V C;  4DL6 A;  4UY8 C;  2ZJR A;  1NNX A;  1X9N A;  1AN7 A;  3T53 B;  4DR6 H;  4LF8 H;  3OPO A;  2WAC A;  2BH8 A;  3PCO B;  4IWX A;  1RJR A;  3T16 A;  1J5E L;  3H20 A;  2NVX H;  5KFY A;  3T5L A;  1YZ6 A;  2W9B B;  3L9A X;  2B2U A;  1N8R C;  5IIF A;  2E5L L;  2F3I A;  3GTJ H;  1F2L A;  5C44 G;  3K80 C;  2AUJ D;  5C44 B;  4MTN A;  5KFK A;  3ULJ A;  2EJF C;  1V51 A;  2VB2 X;  1XMO H;  1PZK D;  3KAJ A;  1EFI D;  4Y7N H;  1TWH A;  1B7Y B;  4A3L H;  3P7J A;  1K8G A;  3T13 A;  2NVX B;  1VQG A;  3M9O B;  4BY7 G;  1NMG A;  4O42 A;  4BY7 B;  3SEB A;  1S97 A;  4DR4 H;  1LTL A;  1YEZ A;  1EWI A;  4XYM B;  2W9C B;  4EG0 A;  1ESF A;  3GTJ B;  2BQR A;  2OLS A;  4HMJ A;  2FK2 A;  1JWM D;  3OTO L;  3QIA A;  3FP9 A;  4OEL B;  3V2T A;  1PHJ A;  3N44 B;  2EYP A;  2K28 A;  5D3D A;  2OWO A;  3PO2 H;  1IOW A;  4Y7N B;  4GOP C;  4DV1 L;  4K2L A;  4QWD A;  1K0R A;  3Q0A A;  3DEO A;  1IBM Q;  5GAD C;  3U9S A;  1JB7 A;  4LF5 L;  1A15 A;  3GID A;  4ECX A;  4NXN L;  2CFM A;  5CV5 A;  2UUC L;  2R7L A;  4DR1 L;  1N34 H;  1T5E A;  1BCP C;  4P2C B;  3S2D H;  1GJX A;  3JZI A;  1HQM C;  4LFA L;  3V05 A;  4O3S A;  5EBD A;  2A68 D;  2NB0 A;  3K6O A;  2UVW A;  1QNU A;  4CDC C;  4A2A A;  2SNM A;  4B3T L;  2UXC L;  4XIG S;  1G2T A;  5KG7 A;  3KDF A;  4A3K H;  3RJ0 A;  3DLL A;  2KEE A;  4LJZ C;  1A0I A;  5C4X H;  1AFP A;  2Z6K A;  4XXE A;  3S9W A;  3S2D B;  5KFQ A;  4IUP A;  5CBA E;  1HNZ L;  1A8V A;  2ZXO A;  2L15 A;  4XT1 B;  1EYZ A;  4B3M H;  5COY A;  3GTK H;  3BDC A;  4DV3 H;  4R4I A;  5DG7 A;  2UXB Q;  3SXH A;  2CVR A;  5CA0 F;  3LNN A;  5DG9 A;  2IJ0 A;  4X6A H;  4PZ6 A;  2ATL A;  4C1N I;  4A3K B;  2ZDG A;  1HHV A;  4DUZ L;  1ZHQ A;  5IYC H;  1I5F A;  4ECR A;  5C4X B;  3NQI A;  3T1H H;  4FM9 A;  1TWA H;  4OHJ A;  2PI2 A;  3W5O A;  1GD7 A;  1RJT A;  4MA5 A;  2QEX A;  4Q5V A;  2QKI C;  3GTK B;  3EJI A;  4MV8 A;  1IW7 C;  1YNJ D;  1BVS A;  2NVQ H;  1A9X A;  3VR4 A;  1LTB D;  3X3M A;  4HSP A;  1U4R A;  2F0T A;  2F0U A;  1JCK B;  4RB0 A;  4UFZ A;  5GAE C;  1II3 A;  5IYC G;  4KHZ A;  1N34 Q;  4R8U B;  2VW9 A;  5C5M A;  4HIK A;  4I7H A;  5F9L A;  3JRX A;  3OHB A;  2XIG A;  3GTG H;  4DUY L;  2A69 D;  4WRD A;  1TWA B;  2R6F A;  4NXM L;  3KFU A;  1C30 A;  2VZA A;  3R23 A;  4DR7 H;  3CXC A;  1XNR Q;  2PZU A;  1RJP A;  2BQU A;  1JB3 A;  4E4T A;  4LF6 H;  5FO8 B;  5J22 A;  3BZD B;  4DV5 H;  3RR5 A;  2NVQ B;  1JLL B;  1U5K A;  5KND A;  4DV2 Q;  4R8N A;  2NYZ D;  4CHT B;  4GNX C;  3I4N H;  4KHP Q;  4YY3 L;  1I6U A;  2UUB L;  2W7P A;  2K04 A;  1HPC A;  4ZKB B;  4ZCK A;  4G3I A;  1BKB A;  2VL6 A;  3A74 A;  3GTG B;  2Z6B A;  1ILP A;  1V43 A;  2Q2I A;  2IBK A;  2V4R A;  1FKA H;  5DQH A;  2R8I A;  2ICI A;  2L5T A;  2AWO A;  4B3M Q;  3RBE A;  1VQC A;  1VCI A;  1PDQ A;  3A8I E;  3H15 A;  3I4N G;  5E4W C;  1KAA A;  3ULL A;  2AGP A;  1O7L A;  3I4N B;  2C2R A;  3NK9 A;  2WE6 A;  1K3B C;  4J9R A;  4WOR A;  3H91 A;  1PTO F;  4HR7 B;  4JI2 Q;  3HOY H;  2QYZ A;  4IHJ F;  1Q8I A;  2FPI B;  4IPG A;  4F8M A;  1E4E A;  1WTQ A;  1Y1V G;  1SRU A;  2L1B A;  2KQ3 A;  4QCL A;  5KG3 A;  4BWS C;  4IRC A;  1SYF A;  4ECQ A;  4JYA L;  5E3F A;  2ZJQ A;  1HNW Q;  1W6K A;  4R4C A;  4QIW E;  1OWT A;  4ECY A;  1F2Y A;  3BVZ A;  3FVQ A;  3HOY B;  4NP5 A;  2XIW A;  1RK5 A;  1PX2 A;  1V1Q A;  1JXL A;  4ZQ3 A;  3WOF A;  1PVO A;  4HQ6 A;  4O3Q A;  1Q1B A;  2F0K A;  3PQI A;  4DR7 Q;  4X62 L;  1PH6 A;  3KAL A;  4PV1 C;  3TRE A;  4DV5 Q;  4LF6 Q;  5BN5 A;  4WD3 A;  2FLP A;  3KF8 B;  1OXT A;  4DV0 H;  3G6E A;  4WBN F;  2QW7 A;  2WAQ G;  2PPB C;  5IP9 G;  2F0E A;  4IOC A;  1TU2 B;  3TII A;  4FF4 A;  1VQ4 A;  4YB8 B;  3DWP A;  4A3C H;  1D1K A;  2P0A A;  4DKA C;  2XGQ A;  4RZR A;  2NVY H;  5FLX L;  3HOV H;  1ENF A;  4MV9 A;  1Y1V A;  4JV2 A;  5DG8 A;  3CMA A;  1XMQ L;  2R8K A;  3KYH C;  3OSO A;  4Q0F A;  4X64 L;  5BMV F;  4XYL B;  4HNT A;  1XPU A;  4LSX A;  4PDB A;  3HGB A;  1EY9 A;  4LNQ A;  2IHE A;  2TMP A;  1ICF B;  4HJ7 A;  1BGW A;  3VPC A;  1X54 A;  5J2U F;  2NU6 B;  2FPG B;  4YR0 A;  4RNO A;  2NVY B;  5CV9 A;  3HOV B;  4GKJ L;  2A6E C;  2RA4 A;  2J6T A;  2FMC A;  1ZEQ X;  2M00 A;  2J9G A;  3I8Z A;  3NBH A;  4X65 L;  2VOB A;  2WAQ A;  3RGX A;  5DGA A;  4DV6 Q;  2J4X A;  4R9W A;  1I50 A;  1IBL H;  4R4Q A;  4UCT A;  2JYO A;  5ELD A;  4IUR A;  4BXX G;  4AYB G;  1GUS A;  5M5W H;  5A2Q L;  5IYD H;  2F3W A;  4X66 H;  3IKJ A;  3RB6 A;  4E6I A;  4ZKC B;  2A8V A;  3RAX A;  3BU2 A;  3JC6 6;  1JQY D;  1IYJ B;  1TY0 A;  2R7K A;  5JJZ A;  2WIN B;  1KC8 C;  3NEM A;  5FPO A;  3VYS A;  4JI6 H;  1B53 A;  5CA1 F;  3E6Z X;  3G7L A;  4JG2 A;  2OQK A;  1IKL A;  1ASZ A;  2UU9 Q;  5DLG A;  1LTT D;  3M4P A;  2YU9 A;  3MA2 B;  5K36 G;  2ZTE A;  2Z4H A;  1V8Q A;  5M5W B;  3OIP A;  1DD2 A;  1TS2 A;  1CSQ A;  4DL4 A;  3AQQ A;  1LTR D;  3FKI G;  3KJO A;  2QF7 A;  3FKI B;  2K03 A;  4YWM A;  2PO4 A;  1KNE A;  4JI0 H;  1PRT C;  1VQI A;  3M3Y H;  4LH6 A;  1VMP A;  4B3S L;  4FS1 A;  4YCW A;  2F0V A;  2W57 A;  5D1O A;  3UFX B;  1TQO A;  1IBM L;  2VQE H;  2MGS A;  1R4P B;  2JEB I;  1CFM A;  4JI3 H;  2YRX A;  1J6Q A;  4JOI A;  4AYB A;  2DPI A;  4OX9 H;  4HYK A;  4YIJ A;  1Q82 C;  1CKN B;  2F0F A;  5D14 A;  1JWU D;  1KBL A;  4QL5 A;  1HCZ A;  4XDX A;  2V4D A;  3K3P A;  3GTP A;  1M4V A;  2F1M A;  3Q2O A;  1RJQ A;  2V9W A;  2F0N A;  4JI8 Q;  3T56 B;  4B9X A;  4DNI A;  3I12 A;  5EPJ A;  1B1Z A;  3TP5 A;  1DOK A;  1IBL Q;  5KYI A;  5KYL A;  1K83 H;  1VQJ A;  3PUW A;  3FKI A;  4LK1 C;  4LFB L;  3BA9 A;  3G48 A;  2NN6 I;  2NN6 G;  4FBU A;  4LW1 A;  3QO2 A;  1XTC D;  4IJH A;  4YCV A;  5ISR A;  1E24 A;  3PW5 A;  1SYE A;  1L2F A;  1ILQ A;  1RTO A;  2UXB L;  2XD4 A;  3PW7 A;  2AWN A;  1FYC A;  1RKN A;  1WR2 A;  2SNS A;  1OXX K;  1BJT A;  2B2W C;  4MV1 A;  4JI5 H;  4N8F A;  1K83 B;  2Y0S G;  2I80 A;  2Y0S B;  1CKN A;  5M5Y H;  3B6Y A;  2R7Z H;  1UE1 A;  1KLU D;  1JR0 D;  4UDU C;  5J1Z A;  1N33 Q;  4A3I H;  1IOV A;  3VR3 A;  5KFV A;  1ESR A;  1J5E H;  3KLS X;  2KEN A;  3J80 c;  4HJ9 A;  1EIF A;  1SCU B;  2V59 A;  4DAY A;  1KRS A;  1WD1 A;  2VQE Q;  4C2M A;  2K01 A;  3NHH A;  1SMY D;  4A76 A;  4JI3 Q;  4I55 F;  1YNN C;  1G2S A;  5CAE B;  4OX9 Q;  4A3J H;  1A2T A;  5M5Y B;  1CTM A;  2R7Z B;  2B3G A;  2D9U A;  1O80 A;  1ZYR D;  2NTS A;  1N32 H;  3PIO 3;  1R9T H;  4A3I B;  3T5H A;  3GTO A;  1XNR L;  1J8I A;  1EY6 A;  1KQS A;  5COR A;  2H5X A;  2XNA C;  4OIJ A;  4DV2 L;  1V4Y A;  2JP1 A;  3MJF A;  1L1O A;  5KGU A;  3MAQ A;  4EQP A;  2R92 G;  1NAP A;  3HKZ G;  3OTO H;  2JEJ A;  4RUC A;  5EDW A;  4ZAI A;  3I90 A;  5CV4 A;  4IQZ A;  4LAA A;  1I3Q A;  2DPJ A;  5JEA G;  2ES2 A;  3K81 C;  1R9T B;  4TV8 F;  2MFI A;  1IHZ A;  4DV1 H;  2YTX A;  3KF6 B;  4J9M A;  2FE3 A;  2C2D A;  3HXL A;  3RN2 A;  1GSA A;  1KC7 A;  3UDG A;  1UUP A;  4NXN H;  2UUC H;  4DR1 H;  2JA7 G;  5KG5 A;  2JQO A;  3I7F A;  1UC8 A;  4J9L A;  2XWB B;  3KBG A;  4JI2 L;  1HZB A;  1CUK A;  4LFA H;  1STG A;  3VMM A;  3QWN A;  4UP8 A;  4NW2 A;  2H4O A;  4TSS A;  3M9N B;  1QB5 D;  2KED A;  3CQZ H;  4PZ8 A;  1BBW A;  5BR8 H;  4XZ3 B;  4DU9 A;  1WTV A;  4EEY A;  2F0M A;  1UEA B;  2E5L Q;  4O2B F;  1HNW L;  2R92 A;  3HKZ A;  4ZRZ A;  1EU3 A;  1QZH A;  1QG7 A;  5LMN W;  3J7Z C;  1HNZ H;  2JEI A;  1A6X A;  1SN8 A;  1R9T A;  2JN4 A;  5J2T F;  2GPW A;  2C5C A;  2EYL A;  3NTK A;  2NWG A;  4ZYS A;  5IGD A;  3D0F A;  3K3V A;  1I4R A;  1I6H H;  3EVQ A;  3ONA B;  2VUG A;  4DN4 M;  4DUZ H;  1VQE A;  4CDD C;  4K2K A;  3JSN A;  3K5O A;  2JA7 A;  2HDM A;  3C1E A;  1VQD A;  3J80 E;  3Q24 A;  1E4F T;  1VS0 A;  2EE1 A;  2EJG C;  2QEJ C;  1ZKO A;  1SAP A;  3VPB A;  4KD4 A;  3U9O A;  5FLX W;  3UQ8 A;  2F0D A;  3GTL H;  4H44 C;  2I5L X;  2WTF A;  3AFP A;  3RBD A;  1M90 C;  2DLN A;  5L37 A;  4LF5 Q;  2GVA A;  1I6H B;  5D8D A;  2Q8I B;  1KL9 A;  1G91 A;  4DL7 A;  1EQT A;  1C8C A;  2A6H C;  3X3N A;  1AUV A;  2XVS A;  4DUY H;  2BA1 A;  2FJZ A;  3NUC A;  4NXM H;  4MTE A;  2HD3 A;  5EQ0 A;  4KY7 A;  3GIL A;  2WFW A;  1H95 A;  2DWC A;  1B9N A;  3BVG A;  3GTL B;  1K73 C;  1A62 A;  4B3T Q;  1KTK A;  2UXC Q;  2I87 A;  2G5D A;  3ITP A;  3KOJ A;  2BDN A;  3K7A H;  3EYY A;  3W1B A;  2XN9 C;  2UUB H;  3J81 c;  3G6V A;  4RAU C;  4UP9 A;  3V96 A;  1ENA A;  4BA1 I;  1KJJ A;  4K0K H;  3D4W A;  4DV6 L;  1O7Y A;  2BDO A;  4JUZ A;  4MAM A;  1S4Z A;  1KRT A;  4FU0 A;  2BQ3 A;  5I2Y A;  1W93 A;  4OGQ C;  1HJP A;  5A2Q W;  4GZY C;  2RF4 A;  2PMZ E;  2QDL A;  4P72 A;  1EY4 A;  3OUZ A;  1CKO A;  4TV9 F;  4DNR B;  3K7A B;  2NZ1 D;  3I4O A;  5IYB G;  5C0X I;  2AHO B;  5C5L A;  2YZG A;  2LS0 1;  1BBX C;  2FB9 A;  1K3R A;  2KBN A;  4FBT A;  1I94 L;  2PVP A;  3M9M B;  4DAM A;  4MZ9 A;  5LOV F;  3PVX A;  3DUZ A;  3NSW A;  4JYA H;  1NTG A;  2XCL A;  1LT4 D;  1I4P A;  1Q81 C;  2N8N A;  4IZ8 A;  3MXN B;  2D62 A;  3RLN A;  3S24 A;  2PN1 A;  4K8J A;  4IFD I;  1A3V A;  2UXD Q;  3F8N A;  2E2I A;  5LYJ F;  3ETH A;  4Q45 A;  4S3S A;  1PK8 A;  1LM0 A;  2KCC A;  4IAL A;  4X62 H;  1YBY A;  1VKZ A;  2EOT A;  4M7E A;  4J9P A;  4Y52 H;  3BAB A;  3RZD H;  1Q46 A;  4C3H G;  2GLT A;  4YY3 Q;  4PG3 A;  3L3O C;  3R93 A;  2AQ3 B;  3A56 A;  3I4M H;  3SK8 A;  2OT2 A;  2RDF A;  2KCN A;  4JI8 L;  4A3B G;  1WTW A;  3I55 A;  5M3M H;  4DV4 Q;  3V6J A;  2WB1 G;  1XX8 A;  4LH7 A;  4ECS A;  2KVM A;  2EVB A;  1PRT F;  1XMQ H;  3GLK A;  5I9O A;  3RZD B;  3I72 A;  1STH A;  3V6H A;  2CWA A;  5F2D A;  3V6K A;  4A3E G;  4DAP A;  1CS0 A;  4X64 H;  2IX3 A;  3C1F A;  3H6M A;  4UCR A;  1GYF A;  3I4M B;  3MXG A;  3R2I A;  5JEA J;  5M3M B;  3S1Q H;  4YAJ B;  2DGY A;  3T51 B;  4EVO A;  1BQQ T;  4NMZ A;  3J81 E;  2E74 C;  2K50 A;  3MFH A;  4DR5 H;  4X65 H;  4JYA Q;  1TT2 A;  4MTK A;  5JPM C;  1JJG A;  1Z2N X;  4IPC A;  4BY1 G;  4EGV A;  3CKI B;  2HDL A;  2HIX A;  2IW3 A;  5LMN Q;  2O5I C;  1CZW A;  1SNP A;  1EFW A;  3S1Q B;  1MJE A;  1WVL A;  4PMC A;  1TKW B;  3MC0 B;  3L4J A;  1EIG A;  2WB1 A;  4OXP A;  1F9P A;  4X62 Q;  3KAK A;  4EFE A;  2PNR C;  3ER0 A;  2IT1 A;  2MNA A;  1G8Z D;  3MVV A;  2CH4 A;  1AH9 A;  2ZJP A;  3HOW H;  1B70 B;  1ET9 A;  1FD7 D;  4UPA A;  5I4D A;  1HA6 A;  4X3K A;  3BG3 A;  4LUO A;  1TWH H;  2PMZ A;  1K0S A;  1MGS A;  1LT3 D;  4EX5 A;  1I4Q A;  1TII D;  5KFA A;  4QWE A;  4J9N A;  4OIK A;  2IWH A;  2M2L A;  3H3V H;  4JPB W;  4L63 B;  5KKN B;  2EIF A;  1WTX A;  2DNC A;  1E1T A;  5IT9 E;  1NJI C;  5EOY A;  5CMD A;  1XMQ Q;  3GO5 A;  4OO1 I;  4CKC A;  3HOW B;  1EYC A;  2L4N A;  1CA5 A;  4ECZ A;  4XYQ A;  3M7N A;  1S0M A;  4WJ3 M;  4QWA A;  4B3S H;  4JV5 Q;  1LTS D;  2K5H A;  3HS0 C;  2W6Z A;  5TSS A;  1B4O A;  2Z1C A;  1IBM H;  2QDB A;  3GP7 A;  4NB3 A;  1VQN A;  3RD4 A;  2B2Y A;  2X6G A;  4GKJ Q;  3ERS X;  3N6R A;  4ETS A;  5C44 H;  3GDE A;  4N8X 1;  4X65 Q;  5KFI A;  3PGZ A;  1DOM A;  1KDA A;  3K0Y A;  1X3Q A;  3GQB A;  1C9O A;  5GAG C;  2JK8 A;  3K5I A;  2OF1 A;  3BYT B;  5IGE A;  1KDB A;  5DQG A;  1XNQ Q;  4BY7 H;  1FR3 A;  2XCA A;  5C4Z A;  1TWF A;  2XRQ D;  1IBK Q;  4LFB H;  2R85 A;  2UVV A;  4RCO A;  2B2V A;  2CW0 C;  1FGB D;  1PYB A;  2D0P A;  1CQJ B;  1PFM A;  3KHL A;  4FS2 A;  4FDB A;  1HXY D;  2O5J C;  3LWU A;  1KD1 C;  4ECT A;  3T1Y Q;  4O3O A;  3P20 A;  2ZM6 L;  1TY2 A;  2UXB H;  2HIV A;  1W2B A;  1EUJ A;  1EY7 A;  4O2D A;  2C35 B;  4RKL A;  1S5D D;  3KDF B;  4HCE A;  3TP6 A;  5LMU L;  4R7R A;  4KY6 A;  5KFD A;  5CYU A;  1X55 A;  3BYY B;  2LY7 A;  2O2L D;  1STY A;  1PH1 A;  1TWG H;  4IUN A;  2NU9 B;  4B08 A;  2R93 A;  1YHB A;  1O7I A;  2A5H A;  2VY3 A;  3FEW X;  4OWT B;  1YJW A;  1MJC A;  4B3S Q;  3T5J A;  5KT6 A;  1B3Q A;  3EIV A;  4IUT A;  1QE6 A;  1MHW C;  4YHH L;  4R4T A;  3N42 B;  5L1J A;  3K0X A;  5KFX A;  1ROD A;  4DR3 L;  1B04 A;  1KJ8 A;  1TWG B;  4KHV A;  2IX1 A;  4RHS A;  4A3M G;  1AN8 A;  1S40 A;  2K4K A;  5EKL A;  5IP7 G;  2E76 C;  1XNR H;  5KNB A;  4YWK A;  1VQ5 A;  3R5F A;  2ASJ A;  5I6Y A;  4JV0 A;  4DV2 H;  2F0P A;  4Q8F A;  2VQD A;  2UUA Q;  5KG6 A;  4QMG A;  4BBR H;  1X56 A;  4KHP H;  5IYZ F;  4UAI A;  4LFB Q;  4M1U B;  3VR5 A;  3H40 A;  1B8A A;  5JUM A;  1SYD A;  1EQQ A;  3N40 P;  1PFS A;  1EWC A;  1IW7 D;  5ELB A;  4KJN A;  3H4B A;  5BPF A;  3MEH A;  4BBR G;  4BBR B;  1XXG A;  4ID6 A;  5KFW A;  1HZC A;  3BQ0 A;  4JI2 H;  1GGO A;  1TWG A;  2XRS D;  2AKW B;  1STE A;  2DUD A;  4Q44 A;  1DON A;  3G8C A;  1E1O A;  2HQE A;  2A68 C;  5GRO A;  3P75 A;  2F0L A;  2OCE A;  4HJ5 A;  1HNW H;  3RUP A;  3RMH A;  4LF4 L;  4DLK A;  2YTY A;  2UXD L;  3U4Z A;  3I2Z A;  1S0O A;  3AFQ A;  2EDG A;  4J0M A;  2I5M X;  1GUG A;  4XQJ A;  4M8A A;  3C46 A;  1E4E B;  4RGM A;  2B2T C;  4G7O C;  1IL2 A;  4IUQ A;  1SJH D;  3J7A 5;  3PV0 A;  5JVD F;  1B9M A;  1GVP A;  4FP5 D;  2FMM A;  2HGS A;  1STA A;  1V1P A;  3ZJY C;  2L55 A;  3DWQ A;  3WDN A;  3UE1 A;  4QGU A;  3M9B A;  1IYV A;  3MR6 A;  1YIT A;  3RIZ A;  4DV4 L;  4DAV A;  3V4Z A;  5CR3 A;  2JSO A;  2D5D A;  4R8I A;  3W3A A;  1Y1V H;  4EYI B;  1F77 A;  3J80 L;  4ZQI A;  4F50 A;  1YNJ C;  2PZW A;  4X3U A;  5NUC A;  2EZV A;  1VQ7 A;  2LKV A;  4FVM A;  4ME3 A;  1HA5 A;  1VDZ A;  4HTH A;  4FYD A;  3S1N H;  1K8M A;  3GD7 A;  5KT3 A;  3Q8P B;  3ETJ A;  4OWW B;  4IR9 A;  2A69 C;  2YZN A;  1U4M A;  1TAE A;  1E2V A;  4H13 C;  3SR1 A;  5JOB A;  3CCE A;  1Y1V B;  3ULP A;  4YQW A;  4O3R A;  3QJY A;  1PZI D;  3QOJ A;  2JA5 G;  2DY8 A;  3PIO A;  3FRP B;  4GN3 B;  1LUZ A;  1ICW A;  1LYL A;  3GTQ B;  3M4I A;  2UVR A;  1WTR A;  5IP9 H;  4DV6 H;  5J3B A;  3E9H A;  4HAE A;  2J6S A;  4N9P A;  5LMN L;  4DL2 A;  3S1N B;  3VYT A;  2CKZ B;  1I50 H;  3BDL A;  1MI2 A;  3Q8D A;  4BBS H;  1DOL A;  1UWV A;  5IGF A;  4IO9 A;  4JI4 Q;  5C1P A;  1CI3 M;  2VQF L;  3NBH B;  1MBY A;  2WAQ B;  3D4D A;  5J39 A;  2A73 B;  1I4X A;  1VQP A;  1VQK A;  4K6D A;  1S10 A;  2UU9 H;  1T9H A;  1SNM A;  5C4H A;  1I50 B;  2A1A A;  3MR2 A;  3JAM c;  2YU9 H;  1TS4 A;  1EL0 A;  4A3D G;  1SMX A;  4MIU A;  4QY7 A;  4ULL A;  3K5M A;  3Q22 A;  3H09 A;  4BBS G;  4BBS B;  4RB1 A;  1WTP A;  2OEO A;  5KT7 A;  1MIU A;  3RV3 A;  4QUF A;  3PIP A;  1RD9 D;  1EY8 A;  4LWC A;  4YAK B;  1EOT A;  2JA5 A;  4TRD A;  2FLN A;  1KAB A;  2RGR A;  1H9J A;  3GTQ A;  2MQH A;  3LML A;  5FOB B;  4JV5 L;  4IPH A;  3Q8Q B;  1EZ6 A;  3E0J A;  4RKB A;  5C3E H;  1MZB A;  2V4Q A;  2B2U C;  3CCV A;  5EZY F;  4C1N K;  4A93 G;  4IRK A;  2YU9 B;  2BE5 D;  3L2P A;  4BXX H;  4LMQ D;  1FVI A;  1M0T A;  1SND A;  1WOC A;  4QB4 A;  2O03 A;  5EPK A;  4JBM A;  3N43 B;  3QG1 A;  4CBV A;  3RLF A;  3GTP H;  4LUZ A;  1ENC A;  2NZO A;  4LFC L;  5C3E G;  4JI8 H;  3J7A V;  4ECU A;  3J7A K;  5C3E B;  5D1O B;  5HUR A;  1D7Q A;  2V5A A;  3H3V C;  1XNQ L;  4RB2 C;  1EIY B;  3Q8S B;  4DL3 A;  3OSP A;  1HNX Q;  3CCQ A;  4EQ5 A;  2NBF A;  4AYB B;  5K36 H;  4J6H A;  1IBK L;  3FKI H;  2EYJ A;  2YZM A;  1LAB A;  1M8A A;  5M3F H;  3OSN A;  1F9S A;  1WTH A;  2CW7 A;  3SE0 A;  3GTP B;  4YBZ B;  3QR8 A;  1AP0 A;  1U9R A;  2CCZ A;  3S14 H;  3SE7 A;  5JVG 3;  3VA5 A;  3T1Y L;  2MJ8 A;  1ZQ7 A;  3O13 A;  1I94 Q;  4J1M A;  4ABN A;  1VQ6 A;  4Q0Y A;  1H9K A;  5EKI A;  1E22 A;  2FJ2 A;  4CKB A;  2RDH A;  3V4S A;  1KLG D;  1PTO H;  5M3F G;  5M3F B;  2ENB A;  1N33 H;  4J8Q A;  3D31 A;  3J81 L;  1PXU A;  3CC7 A;  1WI5 A;  2CQA A;  2I0Q A;  3S14 B;  2X6L A;  2W6M A;  2E2J H;  1D2B A;  1SE3 A;  3MR3 A;  4C2M H;  4QIW A;  3FMC A;  4DK6 C;  3GTM A;  2ASL A;  5KRU A;  3PR5 B;  3JRW A;  5JAV A;  2Z6K C;  1TWC A;  5DQI A;  1PTO B;  5CGK A;  3RTX A;  3FHW A;  3SGI A;  2F0H A;  2NN6 H;  4CJ0 B;  3JAM E;  1L0W A;  1A63 A;  3G4S A;  3GTO H;  3GII A;  4POG A;  2E2J B;  1VAJ A;  4DAY B;  4C2M B;  3RB4 A;  2UUA L;  2HVQ A;  3URY A;  5H80 A;  4FF3 A;  3BVM A;  4F4Y A;  3S17 H;  1T94 A;  4G57 A;  3G6J B;  2CHB D;  1KEE A;  1I3Q H;  4CJ2 C;  1XWE A;  2C22 A;  1NE3 A;  1Q1E A;  2PW7 A;  3GTO B;  2G9H D;  3DMU A;  1SLJ A;  1K28 A;  3HEJ A;  4KD3 A;  3RAQ A;  2K5W A;  2YL2 A;  2BA0 A;  4ED6 A;  1Y1W G;  1W6J A;  1STN A;  1BCP F;  1L1O B;  4H0L C;  4CDF C;  3M4Y A;  2E75 C;  3S17 B;  3TP7 A;  1DXM A;  4RZQ A;  1I3Q B;  1I7N A;  2XGP A;  4B3R L;  1EQR A;  4KLK A;  2ZDQ A;  5KFG A;  1Z9F A;  5KT5 A;  2AQ2 B;  2E5L H;  1FNV A;  3ERO A;  5T14 A;  5LP6 F;  2XSC A;  1SFO A;  1LT6 D;  2R92 H;  1GSO A;  5JPN C;  4L5S A;  4EGQ A;  2YYA A;  4O3P A;  3TN2 A;  4J9Q A;  1P8L A;  5JEA H;  3KBX A;  2LMC B;  5LL6 X;  4B9W A;  4L1K A;  2ZM6 H;  4PWQ A;  1Q7Y C;  4RWS C;  3S1R H;  5LMU H;  1Y1W A;  5DEH A;  5IY0 A;  1EHI A;  3E5N A;  2CQY A;  2RCN A;  2I5H A;  2R92 B;  3HKZ B;  2JA7 H;  1ASY A;  1X3F A;  4DL5 A;  2OXP A;  4K14 A;  3STB D;  4DK3 C;  4QJF A;  2BR0 A;  1GXD C;  1EUD B;  4V0B A;  3K5H A;  4DR2 Q;  4OEM B;  2EYO A;  2RDI A;  3RFC A;  4MHE A;  1HTP A;  4HIM A;  1CT1 D;  4K5V A;  2WDT A;  3J80 W;  3TP8 A;  3S1R B;  1SEI A;  4YHH H;  1T3N A;  1ML0 D;  4LF5 H;  3F2B A;  1GUN A;  1JE4 A;  3M7G A;  2JA7 B;  1PH5 A;  1SMY C;  1UE6 A;  2PQA B;  4HNV A;  3ERQ A;  2MP1 A;  4DR3 H;  2NZH A;  5M9O A;  1OO9 B;  2P5Z X;  4JI1 Q;  3M4O H;  1Y14 B;  5FLM G;  3DM1 A;  1VQA A;  1KJQ A;  1ZYR C;  4EBC A;  1T5X D;  3MFG A;  4QW9 A;  5KFF A;  4B3T H;  2UXC H;  3HOX G;  3CPW A;  2J7Z A;  4DPG A;  1VF5 C;  2DZD A;  3PUX A;  2KCM A;  3VDY A;  1CQI B;  5KFP A;  1G6Z A;  4PZ7 A;  4GLA C;  4FF1 A;  3RF2 A;  4ODG A;  3M4O B;  1S68 A;  2KHJ A;  3HZX A;  3T1H L;  1VQH A;  1X3P A;  3G6X A;  2ZM6 Q;  2K05 A;  3P1H A;  1GOZ A;  3KHR A;  2ICE C;  4JI4 L;  3MWM A;  5LMU Q;  2CH4 W;  3K5L A;  2EYH A;  3K59 A;  2GPS A;  1WCM G;  1YIJ A;  2PQA A;  3S16 H;  1FJG Q;  1AEX A;  5FK9 C;  3BA8 A;  3L4K A;  1YI2 A;  2MCT A;  2HCI A;  1SE8 A;  5HGT A;  3MZ5 A;  1NUC A;  4CJ1 B;  4FO2 A;  4RAY A;  3S2H H;  4YHH Q;  1M7J A;  2NU7 B;  5ELC A;  3F2C A;  2Q2T A;  3NPP A;  1P16 A;  4LF4 H;  1VBG A;  2UXD H;  2E2I H;  4DR3 Q;  3I73 A;  1TXY A;  4K6L A;  3S16 B;  3SDZ A;  2EY5 A;  1H9M A;  4XYO A;  2H1E A;  5HBR B;  3BG5 A;  2W6N A;  1BXR A;  4Q43 A;  2QA4 A;  2A74 C;  4K5W A;  2OTL A;  4R1J A;  5I2X A;  3Q1K A;  2IL8 A;  5KEE A;  3LWB A;  1PYW D;  1K1Q A;  1QVC A;  3S2H B;  1CQF A;  5IOD A;  1DGS A;  4YY3 H;  5IYB H;  3NXW A;  1QJO A;  2R61 A;  2CZG A;  2RGV A;  5EWE A;  3TRZ A;  1WCM A;  2KSW A;  2E2I B;  4DV4 H;  2F4I A;  2AMC B;  5KFT A;  1SE2 A;  1K8O A;  4RGO S;  3TIG A;  3Q6S A;  2L0C A;  1YJ9 A;  1HR0 W;  1HNX L;  2PNH A;  2IHF A;  3TS2 A;  2VA2 A;  5LXT F;  1XYI A;  2I07 B;  2QIL A;  4GOP A;  4JI7 Q;  2JA8 G;  1E7Z A;  4MV7 A;  5C0X G;  5DM6 3;  4AIM A;  4A75 A;  3HKS A;  4IFD H;  5IWA Q;  3F2D A;  2W8K A;  2ID0 A;  3IG0 A;  4CGY B;  2K14 A;  1PTO D;  4JOI C;  2K5N A;  1X3E A;  4OON A;  1DCZ A;  3NGD A;  3LWE A;  1Q90 A;  3ICE A;  2D0O A;  4C3H H;  1M6V A;  3BZC A;  2DN8 A;  4LF4 Q;  3DHQ A;  5EBC A;  5IT9 c;  5KFR A;  3J81 W;  1ZHS A;  4IFD G;  3E0E A;  5LMN H;  1KJ9 A;  1UC9 A;  4A3B H;  3A5Z B;  4O4L F;  1CK1 A;  1OXV A;  2K52 A;  1EYD A;  3UDI A;  2FFK B;  2Z4I A;  2ZT9 C;  4LMY A;  4ME5 A;  3PN1 A;  4CKE A;  4U68 A;  4DGZ A;  1U0L A;  4C3H B;  2M9V A;  5HGQ A;  2ZXP A;  1CKM A;  1DZ1 A;  4A3E H;  3H0G G;  3I91 A;  4TVA B;  1RDP D;  4F87 A;  2N3S A;  1JKJ B;  2WKC A;  4A3B B;  1WYD A;  4KN7 C;  1B50 A;  4RMF A;  1PFB A;  4A3F H;  1IXR A;  2WB1 B;  3TME A;  2EQS A;  1JMC A;  1DIK A;  2M05 A;  4RAZ A;  4IR1 A;  1YJN A;  3OW2 A;  1MSG A;  4DF7 A;  1EIH A;  4ED7 A;  1GLV A;  4EQO A;  4ZLT F;  2ALZ A;  1DV2 A;  4A3E B;  4JV5 H;  5C5J A;  2F3V A;  5C3W A;  2PMZ B;  1PV4 A;  4BY1 H;  1C4Q A;  1VMC A;  3AB9 A;  3OWE B;  5ELE A;  3E9I A;  5T1G A;  4A3F G;  4A3F B;  4TQS A;  2PYK A;  4GKJ H;  1NMF A;  1XJV A;  2IP4 A;  3HOZ G;  2A19 A;  4EFB A;  4AH6 A;  2KUM A;  3A7A B;  4RGN A;  4X66 L;  5AJ3 L;  2EJM A;  4LFC H;  1ULZ A;  3H0G A;  5KFE A;  4BY1 B;  2YYZ A;  1L0X B;  2K33 A;  4GNX A;  2HJW A;  1UNN C;  1SNO A;  1Y8N B;  5KFJ A;  4UP7 A;  1XNQ H;  1PYS B;  1E2W A;  1L1O C;  2GA4 B;  3VYR A;  3PF5 A;  1WFQ A;  3PO3 H;  3WO1 A;  2R8G A;  1TWF H;  2K7V A;  5DLF A;  1IBK H;  1Q8K A;  1S9F A;  2VQF Q;  1UEB A;  3CCM A;  2MUY A;  3EPI A;  4OO1 H;  1D1I A;  2R7F A;  3FMA A;  2ASB A;  4K5X A;  2XGT A;  3T1Y H;  2Z8L A;  2SCU B;  4ZI7 F;  3CRL C;  1KDC A;  3LX0 A;  4C3J G;  3R5X A;  3BQ2 A;  4EBE A;  1H9S A;  5KT2 A;  4X3S A;  1G51 A;  3HP3 A;  5ELF A;  3PO3 G;  3PO3 B;  5KX5 F;  1TWF B;  2I46 A;  2EYF A;  2WII B;  4IPD A;  4MV6 A;  3UI2 A;  4OO1 G;  1HUM A;  1RF2 D;  2CW8 A;  4ZUI A;  3BAA A;  3MWE A;  5KG0 A;  2R93 H;  4UHV A;  3WOE A;  1A2U A;  1R4Q B;  3KTM A;  1QUQ A;  3TZD A;  1QCB D;  3AU7 A;  4DR2 L;  2VXW A;  3I56 A;  1VQ8 A;  3RUZ A;  3S1M H;  1HTL D;  2RQX A;  1RIP A;  1AZP A;  3WNZ A;  4FNF A;  1SYX B;  2O4X A;  1KHI A;  2K5V A;  4KI0 A;  3J80 i;  2R93 G;  1GUW A;  2R93 B;  4JI1 L;  3OWF A;  4LFC Q;  3U50 C;  3S1M B;  2IA6 A;  1Z6H A;  2KEC A;  3DM3 A;  3PMF A;  3CPF A;  2FLL A;  2UUA H;  2L12 A;  3JAM L;  1HR0 Q;  1LTA D;  2R8J A;  4BA2 I;  1RHP A;  3ND9 A;  2PI2 E;  5EPL A;  5G3L F;  2ZXR A;  1HUN A;  1JIH A;  4JI5 L;  2FP4 B;  4YR3 A;  3GIJ A;  4ILW A;  3GV3 A;  5CBE E;  1Y69 U;  4QW8 A;  4LF7 Q;  3FDT A;  3PR4 A;  1UAP A;  2F52 A;  4I7A A;  1QNK A;  5HY6 A;  3I3C A;  4IN3 A;  1GSH A;  4AQY L;  3R5H A;  1D6E C;  1BCP D;  2RVL A;  4ZK9 B;  4QWB A;  5BPH A;  1FJG L;  5C0X J;  1D8L A;  3SK4 A;  2PZT A;  4A3M H;  3MWY W;  3CC2 A;  5LL6 b;  4B3R H;  5IP7 H;  2Q8T A;  1PRT B;  1N32 L;  3NWS A;  2XWJ B;  4A4I A;  2F4V Q;  2RBM A;  3K58 A;  2W6P A;  5L1I A;  1L0Y B;  1Y8O B;  5EAY A;  3CP0 A;  5C8Y F;  3GV8 B;  1RCV D;  2HCC A;  4HED A;  4CC6 A;  2OH2 A;  4A3M B;  1K8A C;  4LF9 L;  3VYU A;  1QWY A;  4IFD J;  3J81 j;  4O2A F;  4V19 0;  3RNU A;  1TR5 A;  2F03 A;  4A3L G;  4QQB X;  1GHJ A;  2F0W A;  3IFT A;  3Q8R B;  2W9B A;  2NUA B;  2ASD A;  3H94 A;  2K5Q A;  2L9H A;  5I9P A;  5IOC A;  5H1S E;  1N9W A;  1CA6 A;  2GN5 A;  1J9O A;  3VA7 A;  4ALP A;  3G71 A;  5KG2 A;  1K1S A;  3OW7 A;  4YCU A;  1KNA A;  2BH2 A;  4DR6 Q;  1TS3 A;  4LF8 Q;  3PO2 G;  5KFS A;  2C9O A;  3PO2 B;  3F2U A;  5I6W A;  1D5Z C;  4L5R C;  2NVX A;  5BR8 L;  4JI7 L;  2F0I A;  4MV3 A;  5I47 A;  1V1P B;  4RHR A;  1SR3 A;  2R87 A;  5GAH C;  5EWF A;  2PQE A;  2VPS A;  2W9C A;  2B8F A;  3TQT A;  4BWG B;  2TSS A;  4O0A A;  5IWA L;  3GTJ A;  4EGJ A;  1FL0 A;  2C00 A;  2FXQ A;  1E3P A;  4B3R Q;  2YS7 A;  1BR9 A;  2K6A A;  5FD5 A;  1XMO Q;  3TSS A;  3C3L A;  3ORR A;  4RUA A;  4RB3 C;  2AGO A;  1Y8P B;  4JW0 A;  5EWG A;  1F2M A;  1PH3 A;  3KJP A;  2SDF A;  3GV5 B;  1SNQ A;  4DR4 Q;  4A3K G;  4ECV A;  4GKK L;  2JEA I;  5C4X G;  2Q2U A;  3GQC A;  3PW0 A;  4KKT A;  1JC7 A;  1PMR A;  2CQO A;  4GLV B;  4DK0 A;  3J81 i;  3CCU A;  1HRJ A;  4JI4 H;  3VPD A;  1JX4 A;  2ATW A;  1S3O A;  3BDO A;  4U7C A;  3EBE A;  5KNC A;  1N36 L;  4NDX A;  2R82 A;  1N56 A;  2B2W A;  3RV4 A;  5JVL A;  1T36 A;  5K2M A;  1PH2 A;  1V9P A;  2LXJ A;  3QB3 A;  1JJC B;  5KFC A;  2UVU A;  2YTV A;  1O78 A;  5IGB A;  3KK7 A;  4YJ2 F;  3A8K E;  1XPO A;  2WAQ E;  1DYQ A;  2IY5 B;  2JA5 H;  1EEI D;  4RU9 A;  3GTQ H;  3FPU B;  1V1O A;  1VQO A;  3A5U A;  2R7M A;  4JV1 A;  2YV5 A;  1JDE A;  4K0K L;  5DGB A;  1CSP A;  2KA7 A;  2VR1 A;  3PUZ A;  1LLR D;  3U58 A;  5K5P A;  4O4H F;  4WFN 3;  3KHG A;  4J9S A;  3CW2 C;  3D3R A;  2YCH A;  2Q2H A;  3GTK A;  1MSH A;  3I70 A;  3RN5 A;  1F2Z A;  1VQB A;  4DV3 Q;  2JA5 B;  4UCU A;  2E2D C;  5KFZ A;  1GUO A;  2AUK A;  3CHB D;  1DJR D;  4R4O A;  1SYC A;  4R8U A;  3T1H Q;  4C5B A;  1HNX H;  5D65 A;  1BXT A;  3CD6 A;  4A3D H;  1TWA A;  4MTD A;  3MXU A;  1EQV A;  4L5T A;  4KKS A;  4J9K A;  1SSO A;  1HFG A;  2V58 A;  3QZ8 A;  1IYU A;  2V1C C;  4TQU S;  4DV7 L;  3HFZ B;  4LUV A;  5L1L A;  4EBD A;  4YJ3 F;  1ZET A;  3N6X A;  3LGJ A;  4BS9 A;  1M1K C;  1SYG A;  4Q8E A;  1KJI A;  1E0B A;  2IX0 A;  3IAY A;  2JEF A;  1I94 H;  3BZK A;  5IGC A;  4AYB E;  1SBB B;  3HOY G;  1LTG D;  3F8T A;  4A93 H;  2B29 A;  2B2Y C;  2K1B A;  3GTG A;  2JE6 I;  4A3D B;  4C5A A;  2A6E D;  5C6A A;  4CC5 A;  1CHP D;  4XQN A;  1IKM A;  3WO0 A;  3QOL A;  1Q86 C;  3MFI A;  3RGZ A;  5EKK A;  1B6S A;  2XTI A;  3GIP A;  3IFD A;  1XDN A;  4DFA A;  1X65 A;  3J7Y W;  4JK1 C;  3SI8 A;  1N48 A;  4HR7 A;  4A93 B;  2KJX A;  3UE0 A;  5KIX A;  2DIK A;  3D6W A;  3GTM H;  3RLO A;  4L5Q A;  2FK1 A;  1QZG A;  2WV6 D;  1JOO A;  2MPM A;  1C48 A;  2B2V C;  1TWC H;  2OQ0 A;  1IL8 A;  2J6U A;  4PNY A;  4POF A;  4RA8 A;  2B8G A;  4RGT A;  3M85 A;  5FD6 A;  2W8L A;  2LXK A;  4P71 A;  4MA0 A;  3TEH B;  2EPB A;  3U4V A;  1JOR A;  4ZOL F;  3KLR A;  4JCV E;  4HJA A;  2AQ4 A;  1GO3 E;  1TVX A;  5C3X A;  4O3N A;  3EA6 A;  2NTT A;  4KY5 A;  4IOA A;  5IE8 A;  2Z0S A;  3F1Z A;  3NWT A;  1LO5 D;  4QIW B;  5CV6 A;  2HHH L;  4A3C G;  5CC4 A;  1EZ1 A;  3JAM W;  1HR0 L;  3GTM B;  3OHX C;  4GLX A;  2EXD A;  4MV4 A;  3HOV G;  1TWC B;  2ZTC A;  2EXZ A;  1JJ2 A;  1ONL A;  2JA9 A;  4DR5 L;  1EYA A;  1PRT D;  3C0F B;  3AYH B;  3OUU A;  3KF8 A;  4YR2 A;  1BNC A;  5CV8 A;  5EJW A;  4P74 A;  1AZQ A;  5KT4 A;  4LF7 L;  2EY2 A;  1BOS A;  3D6C A;  2KHI A;  4XTC S;  2JEG A;  1NSN S;  4JC0 A;  3RZO H;  4KTA A;  2RSO A;  2SOB A;  1JOK A;  4I7Z C;  1VBH A;  2BE5 C;  3ZYY X;  1CHQ D;  2RHS B;  2VPQ A;  4DV0 Q;  1VF7 A;  4JVZ A;  4RCN A;  1YHA A;  3FPP A;  2I8C A;  1WTO A;  2BCO A;  3EPG A;  2F0G A;  5JJL A;  1WJJ A;  1OTC A;  2QK4 A;  3ND8 A;  5LHY 1;  1BBU A;  2F4V L;  2G9D A;  3MXP A;  2Y0S E;  4YP3 A;  1WH2 A;  1SFO H;  3RZO B;  1FNU A;  4I65 A;  1G29 1;  2HUG A;  2ZTD A;  3VR2 A;  5IYD G;  2NVY A;  2X69 A;  1X6O A;  2DJG C;  3M4Q A;  2NU8 B;  2MHV A;  3T4A C;  1GKH A;  3OMC A;  4XT3 B;  3CCR A;  5JJK A;  4JBK A;  2NUC A;  5FPR A;  1F9Q A;  2PBZ A;  4PMB A;  1RK6 A;  3OYY A;  1SE4 A;  1E2Z A;  1Y1W H;  1SFO B;  4F88 A;  4F4Z A;  5DNF A;  3K57 A;  3FDS A;  1GM5 A;  4DXF A;  1LTI D;  3TQY A;  1AE3 A;  4X3T A;  4DK1 A;  1LV9 A;  1RL2 A;  5LL6 S;  2JA6 H;  4HSV A;  1C0A A;  3OHA A;  5IT9 L;  3DF7 A;  4WJ4 A;  2XC9 A;  4DR2 H;  3M3Y B;  1WSC A;  4DR6 L;  4LF8 L;  5L1K A;  1UNS A;  3HKZ E;  5ELO A;  5FJ8 H;  1Y1W B;  3NTH A;  4FF2 A;  2FPP B;  1KIX A;  4L8J A;  1YNN D;  3DWA A;  2CWP A;  5DAU A;  4APM A;  5IGG A;  1BNZ A;  4X66 Q;  2EY6 A;  2W6O A;  4HIO A;  5AJ3 Q;  4JI1 H;  2JA6 G;  1DV1 A;  2JA6 B;  1Q3L A;  1HQR D;  4H02 A;  2DY7 A;  4RH6 A;  4Z9C B;  3DXJ C;  3K8A A;  4C56 C;  1GHK A;  3VR6 A;  1XMO L;  5KFB A;  4JI6 Q;  5E7N A;  2VUM H;  5FJ8 G;  5L9X A;  5JQW A;  5JVH 3;  3EQL C;  5GQO A;  4RG1 A;  3CC4 A;  4DR4 L;  3SHL A;  3D4R A;  2FIN B;  4IRD A;  4GN4 B;  3NP8 A;  2ZJT A;  4FXG C;  5G3L D;  4JI0 Q;  3TQ1 A;  2WP8 J;  5CV7 A;  1UE7 A;  1AE2 A;  2DNE A;  4APV A;  3JSL A;  1U4P A;  2VUM G;  4PMW A;  1SNC A;  2MO1 A;  5D3I B;  2VUM B;  1EUC B;  2W71 A;  2N55 A;  3GV7 B;  1EOV A;  3IRB A;  2ZDH A;  4AQY H;  1A3U A;  3OIQ A;  1W3S A;  5JJI A;  2QCP X;  1B3A A;  1FJG H;  2R3Z A;  1QVG A;  2VNU D;  5KFN A;  2PW5 A;  2L11 A;  1N34 L;  2R7Z G;  2JA6 A;  5FLM H;  3C2P A;  1O7Z A;  5LA6 F;  1KAW A;  2RCF A;  1EU4 A;  2RHQ B;  3I4L A;  4PQX A;  4A3I G;  3MWD A;  5KFU A;  2BOS A;  4MN3 A;  5JH7 F;  3HOX H;  1EWH A;  2X0S A;  1EY5 A;  3MHB A;  3SVM A;  4ED0 A;  1S5E D;  5C1O A;  3TS0 A;  3A8J E;  4NLG A;  3KLW A;  3K5N A;  1CE8 A;  2R6G A;  4C3I H;  4KHP L;  4NPS A;  4A3J G;  1K83 A;  4A3J B;  1C3O A;  2Y0S A;  4LF9 H;  1NCV A;  4HNU A;  1PA6 A;  4ED2 A;  1JWS D;  2RKS A;  4XQQ A;  1S5B D;  5KFO A;  2VUM A;  2C2E A;  3HOX B;  4KMU C;  3CCJ A;  1PH4 A;  4B3M L;  1KXL A;  3PUV A;  4DV3 L;  1M0W A;  3GV6 A;  3PW2 A;  5AFW A;  1EYG A;  1WCM H;  5EGT A;  4C3I G;  2VB3 X;  2PCF B;  4JI5 Q;  4C3I B;  1JT8 A;  1H9R A;  3SK6 A;  1XTD A;  2R7Z A;  3STB C;  3HRZ C;  3UDX A;  3PIP 3;  1HH2 P;  2AQ1 B;  3R2T A;  3N52 A;  4P75 A;  1FNW A;  3BS1 A;  1HZ9 A;  4KV6 A;  5FLX c;  3T5K A;  3HBL A;  4UCO A;  1J5E Q;  4JI7 H;  2R8H A;  4YWL A;  1Z2O X;  3CCS A;  4AQY Q;  3HG9 A;  3IL8 A;  3BQ1 A;  3PF4 A;  1WCM B;  5IWA H;  1S03 G;  2A6H D;  2SEB D;  3E5S A;  5M5X H;  1B33 N;  4KKU A;  2FKL A;  3CCL A;  1Z47 A;  4HN7 A;  4WJW A;  2OTJ A;  1N32 Q;  1E4G T;  3IN5 A;  1CQV A;  3OOC A;  2QGQ A;  3KF6 A;  4DR7 L;  3CQZ B;  1A3T A;  1FGU A;  4GOP B;  1QVF A;  4LF6 L;  4DV5 L;  4IJL A;  4FXD A;  3TZU A;  2RSN A;  4GKK H;  1SXT A;  2E8G A;  3CAM A;  4HJ8 A;  5M5X B;  1SJE D;  2LFN A;  4O4I F;  5KFH A;  2XCP A;  3D8G A;  3OTO Q;  4GN5 A;  4LF9 Q;  3QFF A;  4KN4 C;  1BCP B;  1PZJ D;  3CF5 A;  1C7Y A;  5KFL A;  4N9T A;  1X3G A;  4H7B A;  3KHH A;  1SRO A;  4EEQ A;  5E4X A;  2K32 A;  4DV1 Q;  2DJF C;  3NTI A;  1S72 A;  1Q12 A;  1B2T A;  4ECW A;  2JA8 H;  1PLF A;  1VQM A;  3QZ7 A;  1VQ9 A;  5KG4 A;  1S5F D;  2C28 A;  5C0X H;  1K9M C;  3NEL A;  3SK5 A;  3PW4 A;  1N36 H;  1SEB D;  4NXN Q;  3U9T A;  2UUC Q;  2GVB A;  3L7Z C;  4DR1 Q;  3W2D A;  4IAJ A;  4M9U A;  1SDF A;  1D5X C;  1HFN A;  3CVZ A;  2YS6 A;  2EYM A;  3A7L A;  2E2H H;  4LFA Q;  4G7Z C;  5KG1 A;  3R3O A;  5BN4 A;  3CQZ A;  5CB4 F;  1ET6 A;  2FK3 A;  2B63 H;  5BR8 Q;  2JA8 B;  4U6P A;  2JXM B;  4TUY F;  4IUU A;  4OL7 A;  1CM9 A;  3NEN A;  3JAM i;  4JBW A;  4A2B A;  4F4X A;  1NR2 A;  1I4H A;  4RNM A;  1VQF A;  1CZG A;  2WB1 E;  3TIN A;  1HNZ Q;  1HZA A;  4MNO A;  4GC6 A;  2E2H B;  4ZUJ A;  5ELN A;  3CU7 A;  3TDQ A;  2WYO A;  5GON F;  3NE5 B;  1WD0 A;  2IMW P;  2B63 G;  5C4J H;  1YNX A;  4J15 A;  4G7H C;  4G4K A;  2B63 B;  1AUX A;  4O1N A;  1XPR A;  4U67 3;  1NR4 A;  2D2C C;  4A3G H;  2W7O A;  2KOL A;  4DV0 L;  3H0G H;  4GKK Q;  2Q8R E;  1PFN A;  3N8D A;  1YHQ A;  1U4L A;  5FLX E;  4DUZ Q;  2J0T D;  4GC7 A;  1W96 A;  1EZ8 A;  4ZHQ F;  1EY0 A;  1MKH A;  1Z7T A;  2LSS A;  3KXY T;  4ED3 A;  3RB0 A;  2UU9 L;  2F0S A;  3NQT A;  5E1F A;  4CDE C;  2W9A A;  2W6Q A;  2VQF H;  4DV7 H;  3GIK A;  4HCS A;  4QUC A;  5C4J B;  1S0N A;  3GTL A;  1RYR A;  1D5M C;  1YVC A;  5HV6 A;  4A3G G;  1JIC A;  2FHT A;  2N78 A;  5T1I A;  4A3G B;  1PH9 A;  1N36 Q;  1LT5 D;  1B44 D;  3ORQ A;  1EEF D;  4QWC A;  3H0G B;  4ED1 A;  3BJY A;  4DXG A;  4GNX B;  4IWY A;  3HB9 A;  2F0O A;  2IPK D;  4XX0 B;  3N41 B;  3UDF A;  4DUY Q;  2WKD A;  3AEV A;  4TQR A;  2MO0 A;  5D1P A;  2E2H A;  4KK7 A;  4NXM Q;  2RDJ A;  3MFY A;  2F0J A;  5BN3 A;  3HOZ H;  1G6P A;  1PTO C;  4QF4 A;  4IUV A;  1O75 A;  2JJQ A;  5FKA C;  2YW2 A;  2B63 A;  4EQN A;  1S5C D;  1GUT A;  1SYB A;  1JE5 A;  2RDG A;  5IT9 W;  2N88 A;  4C5C A;  2UUB Q;  3GIM A;  3LP8 A;  3BJU A;  1OXU A;  5A2Q E;  3S15 H;  4K0K Q;  2HVS A;  2AU0 A;  1IZ6 A;  1H9S B;  1AW7 A;  1DM0 B;  3L0O A;  3WWV A;  3OMG A;  1Z2P X;  2W70 A;  3HOZ B;  2R7D A;  1IBL L;  5DM7 3;  4ME6 A;  3EFX D;  4OWX B;  2B2T A;  4GS3 A;  1LAC A;  4P73 A;  4I4T F;  3G6Y A;  1QUQ B;  3HOU H;  2KCT A;  4HMI A;  4UCV A;  3MXN A;  4UCS A;  3S15 B;  5F9N A;  1F9R A;  1RTN A;  4C3J H;  3I4M G;  4JI6 L;  1STB A;  4EYH B;  3RB3 A;  2HHH H;  5M3M G;  1B6R A;  1HR0 H;  2NVT H;  3AMU A;  1RYS A;  4DV7 Q;  3A0J A;  1TS5 A;  4ED8 A;  4RFB A;  4J9O A;  1JDB B;  1MD2 D;  3HOU G;  2AGQ A;  3PUY A;  4LF7 H;  4JI0 L;  3HOU B;  1NBW A;  1BUV T;  2HT1 A;  1N33 L;  2HVR A;  3H4D A;  4C3J B;  3Q23 A;  4F7X A;  1I7L A;  2F0Q A;  3KLS A;  3E3X A;  2FMA A;  3EN2 A;  4L6T B;  5KFM A;  2NVT B;  5DLQ E;  2VQE L;  1VQL A;  2EY1 A;  3CRK C;  4DNT B;  3KUP A;  4JI3 L;  1UE5 A;  3A54 A;  2K5D A;  4JBJ A;  2N49 A;  4OX9 L;  4I50 F;  1BO0 A;  1ZXT A;  2R84 A;  2YRW A;  3NBI A;  4F4W A;  3TBI B;  5FO7 B;  3MTS A; 
#chains in the Genus database with same CATH homology
 4DK6 C;  3K7U C;  1N36 L;  3PSI A;  2Z6K C;  3GTL H;  2I5L X;  1PH2 A;  1V9P A;  2LXJ A;  3AFP A;  1JJC B;  3FHW A;  3SGI A;  1M90 C;  2YTV A;  2GVA A;  2VS1 A;  3CME A;  4LF5 Q;  1A63 A;  1L0W A;  1PH8 A;  1KL9 A;  3G4S A;  3GTO H;  1NY4 A;  1XPO A;  4POG A;  2WAQ E;  2IY5 B;  4DAY B;  2BA1 A;  2JA5 H;  3HOW G;  3GTQ H;  2UUA L;  2HQL A;  1VQO A;  1PH7 A;  2WFW A;  1H95 A;  3A5U A;  4X64 Q;  3S17 H;  3MEF A;  2YV5 A;  1K73 C;  1A62 A;  4B3T Q;  2HHH Q;  4K0K L;  1CSP A;  2ALY B;  2UXC Q;  3KOJ A;  1I3Q H;  3K7A H;  3PUZ A;  3H3V I;  3W1B A;  1OXS C;  3U58 A;  1NE3 A;  1Q1E A;  3W1G A;  4UP9 A;  4BA1 I;  3J81 c;  1SLJ A;  4HID A;  3CW2 C;  4DR5 Q;  2Q2H A;  2K75 A;  4DV6 L;  2BA0 A;  3RN5 A;  1VQB A;  4DV3 Q;  2ZJR A;  1Y1W G;  4UY8 C;  1X9N A;  1KRT A;  1L1O B;  3PCO B;  2BH8 A;  1HJP A;  4R4O A;  2RF4 A;  2PMZ E;  1J5E L;  4P72 A;  2NVX H;  1CKO A;  1YZ6 A;  3T1H Q;  5IYB G;  1N8R C;  3I4O A;  3CD6 A;  5C0X I;  4A3D H;  4L5T A;  2E5L L;  4B3R L;  2AHO B;  2F3I A;  1EQR A;  4KLK A;  3GTJ H;  2V1C C;  5C44 G;  3K80 C;  1K3R A;  4TQU S;  1Z9F A;  2KBN A;  3HFZ B;  4DV7 L;  4LUV A;  1I94 L;  4MTN A;  3ULJ A;  4DAM A;  3LGJ A;  4MZ9 A;  1M1K C;  2R92 H;  2IX0 A;  4Y7N H;  1B7Y B;  4A3L H;  4L5S A;  1K8G A;  3BZK A;  4AYB E;  3HOY G;  1VQG A;  3F8T A;  1NTG A;  2B29 A;  4A93 H;  4BY7 G;  1NMG A;  1P8L A;  2JE6 I;  1Q81 C;  2N8N A;  1LTL A;  1YEZ A;  1EWI A;  3MXN B;  2D62 A;  3RLN A;  3S24 A;  4IFD I;  2UXD Q;  1Q7Y C;  3OTO L;  3S1R H;  3FP9 A;  1Q86 C;  1PHJ A;  5IY0 A;  1LM0 A;  2RCN A;  2I5H A;  1YBY A;  3PO2 H;  2XTI A;  2OWO A;  2JA7 H;  1ASY A;  4Y52 H;  1X3F A;  4GOP C;  4DV1 L;  1X65 A;  3RZD H;  1Q46 A;  3STB D;  4DK3 C;  4QJF A;  1K0R A;  1IBM Q;  3UE0 A;  5GAD C;  4YY3 Q;  4PG3 A;  3GTM H;  1JB7 A;  4LF5 L;  3RLO A;  4L5Q A;  4DR2 Q;  4NXN L;  2CFM A;  1QZG A;  2OQ0 A;  2UUC L;  4HIM A;  1TWC H;  4DR1 L;  3I4M H;  4POF A;  4A3B G;  4JI8 L;  3M85 A;  3S2D H;  3I55 A;  2LXK A;  5M3M H;  4DV4 Q;  4P71 A;  3F2B A;  3TEH B;  3U4V A;  2WB1 G;  4LFA L;  1PH5 A;  1UE6 A;  4JCV E;  2PQA B;  4HJA A;  1GO3 E;  2NZH A;  4IOA A;  5IE8 A;  2Z0S A;  3F1Z A;  4JI1 Q;  4B3T L;  1Y14 B;  2CWA A;  5FLM G;  1VQA A;  2HHH L;  4XIG S;  3M4O H;  1HR0 L;  4A3C G;  4A3E G;  4GLX A;  3KDF A;  4A3K H;  2EXD A;  3DLL A;  3HOV G;  2ZTC A;  1JJ2 A;  1A0I A;  5C4X H;  3HOX G;  2Z6K A;  2JA9 A;  3CPW A;  5JEA J;  4DPG A;  4DR5 L;  3S1Q H;  3AYH B;  2DGY A;  1HNZ L;  3PUX A;  1A8V A;  2KCM A;  4P74 A;  3VDY A;  2L15 A;  4LF7 L;  2K50 A;  4PZ7 A;  3GTK H;  4GLA C;  2KHI A;  4R4I A;  4XTC S;  4JYA Q;  2UXB Q;  4JC0 A;  3RZO H;  2KHJ A;  4PZ6 A;  4X6A H;  1JJG A;  3T1H L;  1VQH A;  4IPC A;  2UXD L;  4BY1 G;  2ZM6 Q;  4DUZ L;  2HIX A;  5IYC H;  1I5F A;  5LMN Q;  2RHS B;  4JI4 L;  1EFW A;  5LMU Q;  1MJE A;  1TWA H;  4DV0 Q;  2PI2 A;  1YHA A;  4OXP A;  3W5O A;  1GD7 A;  1WCM G;  4X62 Q;  2PQA A;  3ER0 A;  2IT1 A;  2QEX A;  1WJJ A;  1YIJ A;  2MNA A;  1OTC A;  3S16 H;  5JJL A;  1FJG Q;  1BBU A;  1YI2 A;  1BVS A;  2F4V L;  2ZJP A;  2NVQ H;  3HOW H;  1AH9 A;  1B70 B;  2Y0S E;  1SFO H;  1SE8 A;  4UPA A;  1G29 1;  4LUO A;  1TWH H;  2ZTD A;  5IYD G;  5GAE C;  5IYC G;  4KHZ A;  1N34 Q;  2VW9 A;  4HIK A;  1X6O A;  4EX5 A;  4YHH Q;  3S2H H;  3M4Q A;  3GTG H;  4DUY L;  1GKH A;  3F2C A;  2Q2T A;  1P16 A;  3CCR A;  3H3V H;  4NXM L;  5JJK A;  4JBK A;  3KFU A;  2EIF A;  2VZA A;  1NJI C;  1E1T A;  3CXC A;  1XNR Q;  2E2I H;  4DR3 Q;  1TXY A;  3OYY A;  3GO5 A;  1XMQ Q;  4OO1 I;  3RR5 A;  1Y1W H;  1U5K A;  4DV2 Q;  3M7N A;  4WJ3 M;  2QA4 A;  4GNX C;  2OTL A;  3I4N H;  4JV5 Q;  2K5H A;  4YY3 L;  4KHP Q;  2UUB L;  4R1J A;  1GM5 A;  3TQY A;  1AE3 A;  1BKB A;  1QVC A;  2VL6 A;  3A74 A;  1DGS A;  4NB3 A;  5IYB H;  1RL2 A;  1V43 A;  2Q2I A;  1VQN A;  2JA6 H;  1C0A A;  4WJ4 A;  4GKJ Q;  3TRZ A;  4DR6 L;  4LF8 L;  3ERS X;  2AWO A;  4B3M Q;  1VQC A;  5C44 H;  1VCI A;  2AMC B;  3GDE A;  3HKZ E;  5ELO A;  5FJ8 H;  4X65 Q;  3H15 A;  1KIX A;  3I4N G;  3PGZ A;  3ULL A;  1YJ9 A;  1HR0 W;  2CWP A;  1HNX L;  1C9O A;  2PNH A;  5GAG C;  2IHF A;  2JK8 A;  4X66 Q;  3TS2 A;  4HIO A;  5AJ3 Q;  4JI2 Q;  4GOP A;  4JI7 Q;  2JA8 G;  2JA6 G;  1E7Z A;  1XNQ Q;  3HOY H;  4BY7 H;  5C0X G;  4H02 A;  4IPG A;  4AIM A;  4A75 A;  3HKS A;  3K8A A;  5IWA Q;  1IBK Q;  1XMO L;  1Y1V G;  3F2D A;  4JI6 Q;  2ID0 A;  5E7N A;  2VUM H;  1SRU A;  5FJ8 G;  1PYB A;  2D0P A;  2K14 A;  4JYA L;  4JOI C;  2ZJQ A;  1HNW Q;  4FDB A;  5GQO A;  4RG1 A;  3CC4 A;  2K5N A;  4R4C A;  1X3E A;  1KD1 C;  4QIW E;  3T1Y Q;  4OON A;  4DR4 L;  2ZM6 L;  3ICE A;  2HIV A;  2D0O A;  4GN4 B;  4C3H H;  1W2B A;  1EUJ A;  4O2D A;  1V1Q A;  3BZC A;  4LF4 Q;  2C35 B;  5LMU L;  4JI0 Q;  2WP8 J;  3KDF B;  5IT9 c;  1PVO A;  1Q1B A;  1UE7 A;  1AE2 A;  4DR7 Q;  4APV A;  4IFD G;  3E0E A;  4X62 L;  1PH6 A;  1X55 A;  4PMW A;  2MO1 A;  4LF6 Q;  3TRE A;  4DV5 Q;  3A5Z B;  1PH1 A;  2VUM G;  4A3B H;  1EOV A;  1TWG H;  3KF8 B;  1OXT A;  1OXV A;  2K52 A;  3IRB A;  1YHB A;  1O7I A;  1W3S A;  2VY3 A;  4OWT B;  3UDI A;  3G6E A;  1MJC A;  1YJW A;  4B3S Q;  2WAQ G;  5JJI A;  5IP9 G;  4IOC A;  1QVG A;  2VNU D;  1VQ4 A;  1U0L A;  2R7Z G;  1N34 L;  5FLM H;  3EIV A;  5HGQ A;  4YHH L;  4A3C H;  1CKM A;  4R4T A;  4A3E H;  1KAW A;  2RHQ B;  3H0G G;  4TVA B;  4DKA C;  4A3I G;  2N3S A;  2NVY H;  3HOV H;  3K0X A;  1WYD A;  3HOX H;  3CMA A;  4RMF A;  4DR3 L;  1XMQ L;  4A3F H;  2IX1 A;  4A3M G;  1S40 A;  1IXR A;  2K4K A;  3KYH C;  3TS0 A;  2EQS A;  3KLW A;  5IP7 G;  1JMC A;  2R6G A;  1YJN A;  3OW2 A;  4X64 L;  4C3I H;  4YWK A;  4NPS A;  4A3J G;  1VQ5 A;  4KHP L;  1XPU A;  1PA6 A;  4LNQ A;  2IHE A;  2UUA Q;  4BBR H;  1X56 A;  4HJ7 A;  1X54 A;  1PV4 A;  4BY1 H;  4GKJ L;  4LFB Q;  3CCJ A;  4B3M L;  3E9I A;  4A3F G;  1PH4 A;  1KXL A;  1B8A A;  3PUV A;  4DV3 L;  4X65 L;  1NMF A;  1EQQ A;  1XJV A;  1FJG L;  1EYG A;  1WCM H;  1PFS A;  2A19 A;  3HOZ G;  4AH6 A;  4JI5 Q;  1JT8 A;  4DV6 Q;  4X66 L;  1XTD A;  3STB C;  3UDX A;  4BBR G;  5AJ3 L;  1HH2 P;  4R4Q A;  4P75 A;  4BXX G;  4AYB G;  5IYD H;  1HZ9 A;  2YYZ A;  5M5W H;  5FLX c;  4GNX A;  1HZC A;  1J5E Q;  2A8V A;  4UP7 A;  4YWL A;  3BU2 A;  1PYS B;  3CCS A;  3JC6 6;  2AKW B;  1IYJ B;  1L1O C;  4AQY Q;  3PF5 A;  1KC8 C;  1WFQ A;  3NEM A;  3PO3 H;  2DUD A;  1TWF H;  3PF4 A;  1E1O A;  5M5X H;  1Q8K A;  2VQF Q;  1UEB A;  3CCM A;  5GRO A;  3CCL A;  4JG2 A;  1Z47 A;  2OQK A;  2UU9 Q;  1ASZ A;  2OCE A;  2R7F A;  2OTJ A;  2ASB A;  3M4P A;  4HJ5 A;  1N32 Q;  2XGT A;  4LF4 L;  5K36 G;  2ZTE A;  2YTY A;  2QGQ A;  3KF6 A;  4DR7 L;  1CSQ A;  1FGU A;  3AQQ A;  3FKI G;  3I2Z A;  3U4Z A;  3KJO A;  4GOP B;  3AFQ A;  1QVF A;  4YWM A;  4LF6 L;  2UXC L;  4DV5 L;  4IJL A;  2I5M X;  3PO3 G;  1G51 A;  1VQI A;  3M3Y H;  3CAM A;  2E8G A;  4HJ8 A;  4B3S L;  4IPD A;  4YCW A;  1IL2 A;  4OO1 G;  3OTO Q;  4GN5 A;  4LF9 Q;  3J7A 5;  3PV0 A;  3CF5 A;  1C7Y A;  1IBM L;  2R93 H;  1QUQ A;  1GVP A;  2JEB I;  3ZJY C;  1VQ8 A;  1J6Q A;  4DR2 L;  1X3G A;  4JOI A;  3I56 A;  1SRO A;  3S1M H;  1S72 A;  4DV1 Q;  3UE1 A;  4QGU A;  1Q12 A;  3M9B A;  1RIP A;  1YIT A;  1Q82 C;  2JA8 H;  1VQM A;  1CKN B;  1VQ9 A;  4DV4 L;  1K9M C;  3NEL A;  4QL5 A;  4NXN Q;  2UUC Q;  2GVB A;  3L7Z C;  4DR1 Q;  1Y1V H;  1KHI A;  4JI8 Q;  2K5V A;  4DNI A;  4KI0 A;  3J80 i;  2R93 G;  4JI1 L;  1IBL Q;  4LFA Q;  2E2H H;  4LFC Q;  3U50 C;  1VQ7 A;  4ME3 A;  1K83 H;  1VQJ A;  3DM3 A;  3PUW A;  2B63 H;  5BR8 Q;  3CPF A;  3S1N H;  4LFB L;  3GD7 A;  3G48 A;  2NN6 I;  2NN6 G;  4OWW B;  1HR0 Q;  4LW1 A;  3NEN A;  3JAM i;  4JBW A;  4IJH A;  4YCV A;  1E24 A;  3CCE A;  3ULP A;  4BA2 I;  1VQF A;  2WB1 E;  2PI2 E;  1L2F A;  4JI5 L;  2JA5 G;  2UXB L;  3PIO A;  1HNZ Q;  4GN3 B;  1HZA A;  1LUZ A;  1LYL A;  2AWN A;  4MNO A;  5ELN A;  1OXX K;  4LF7 Q;  5IP9 H;  5J3B A;  3E9H A;  2B63 G;  2Y0S G;  5C4J H;  1YNX A;  4J15 A;  5LMN L;  1CKN A;  5M5Y H;  2F52 A;  3B6Y A;  2R7Z H;  1UE1 A;  1XPR A;  2CKZ B;  1I50 H;  5HY6 A;  4A3G H;  4DV0 L;  3H0G H;  4AQY L;  4A3I H;  1N33 Q;  4GKK Q;  3Q8D A;  4BBS H;  1YHQ A;  4DUZ Q;  1UWV A;  2KEN A;  3J80 c;  4HJ9 A;  1EIF A;  1D8L A;  5C0X J;  4IO9 A;  4JI4 Q;  2VQF L;  1MKH A;  2LSS A;  1KRS A;  3NBH B;  2VQE Q;  4A3M H;  2UU9 L;  3CC2 A;  5IP7 H;  4A76 A;  4JI3 Q;  1N32 L;  1VQP A;  1VQK A;  4OX9 Q;  4A3J H;  4A4I A;  2F4V Q;  1T9H A;  1YVC A;  2B3G A;  4A3G G;  2N78 A;  2A1A A;  1PH9 A;  1N36 Q;  3JAM c;  5EAY A;  2YU9 H;  4A3D G;  1SMX A;  3CP0 A;  4QY7 A;  1R9T H;  4BBS G;  4GNX B;  1XNR L;  1MIU A;  3PIP A;  1KQS A;  4LWC A;  3UDF A;  2H5X A;  4DUY Q;  1K8A C;  3AEV A;  4LF9 L;  2MO0 A;  4DV2 L;  4IFD J;  4NXM Q;  3J81 j;  2MQH A;  1L1O A;  3HOZ H;  1G6P A;  2R92 G;  3HKZ G;  4JV5 L;  4IPH A;  3RNU A;  2JJQ A;  4A3L G;  4QQB X;  5C3E H;  3CCV A;  1JE5 A;  4A93 G;  5JEA G;  5H1S E;  2ES2 A;  3K81 C;  3L2P A;  2MFI A;  4BXX H;  2UUB Q;  1N9W A;  1FVI A;  3BJU A;  1OXU A;  2YTX A;  2GN5 A;  3KF6 B;  1WOC A;  4ALP A;  1IZ6 A;  3G71 A;  3S15 H;  4K0K Q;  3RN2 A;  4JBM A;  3L0O A;  4YCU A;  3RLF A;  3WWV A;  3GTP H;  3UDG A;  2R7D A;  2BH2 A;  4LF8 Q;  3PO2 G;  4LUZ A;  1IBL L;  2NZO A;  4LFC L;  5C3E G;  2JA7 G;  4DR6 Q;  2JQO A;  3I7F A;  4OWX B;  4L5R C;  4GS3 A;  1D7Q A;  4P73 A;  4JI2 L;  1HZB A;  5BR8 L;  4JI7 L;  1CUK A;  1XNQ L;  1QUQ B;  1EIY B;  3HOU H;  1HNX Q;  3CCQ A;  4EQ5 A;  1SR3 A;  2KCT A;  4UP8 A;  5GAH C;  3CQZ H;  4PZ8 A;  1BBW A;  4O0A A;  4C3J H;  3FKI H;  5IWA L;  1IBK L;  4JI6 L;  3I4M G;  5M3F H;  1FL0 A;  5M3M G;  2FXQ A;  1E3P A;  2E5L Q;  2NVT H;  4B3R Q;  1HNW L;  1XMO Q;  2CCZ A;  4DV7 Q;  3S14 H;  3A0J A;  3T1Y L;  1QZH A;  1I94 Q;  5LMN W;  3J7Z C;  1VQ6 A;  1PH3 A;  3KJP A;  3HOU G;  1E22 A;  1SN8 A;  3PUY A;  4JI0 L;  1NBW A;  4DR4 Q;  4A3K G;  2HT1 A;  1N33 L;  4GKK L;  2JEA I;  5M3F G;  5C4X G;  2Q2U A;  3D0F A;  3EN2 A;  1I6H H;  2CQO A;  4GLV B;  5DLQ E;  3D31 A;  2VQE L;  1VQL A;  3CC7 A;  1VQE A;  3J81 i;  3CCU A;  1WI5 A;  1UE5 A;  4JI3 L;  4JBJ A;  2I0Q A;  2N49 A;  2E2J H;  1VQD A;  2ATW A;  4OX9 L;  1S3O A;  4C2M H;  1VS0 A;  3EBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...