3HOWG

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription,transferase/dna/rna hybrid
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 31
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3howG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3howG01
4EQ5A 4UP9A 4DR5Q 4DV6L 4IFDG 4A3GG 1JJCB 1AE3A 1OTCA 2VQFQ 4JI7Q 2E5LL 4DR4L 4NB3A 3K81C 3KYHC 4X65Q 4YCWA 4YHHQ 1JB7A 4DV0L 1HNXQ 1Q7YC 2I5MX 2YV5A 1X3EA 1WYDA 2OQKA 4GN3B 2R7FA 4KHZA 1TWGH 1Q1BA 5AJ3Q 2UUAQ 4LFBL 2BA1A 1Z47A 2UU9L 4JYAL 4LF4Q 2IT1A 3CC7A 1PH7A 1K0RA 1E22A 1B70B 1EUJA 1V1QA 1VQBA 3WWVA 2UU9Q 4LF8Q 1QVFA 2CFMA 3PO3G 2PMZE 2ID0A 2R7DA 2WAQG 4GS3A 4A3EG 1YVCA 2RHSB 1LYLA 2GVBA 4JBKA 3CCLA 4LF6L 4KLKA 4WJ4A 3JC66 1V9PA 3AYHB 4WJ3M 5C4XG 4C3IH 1VQPA 4IJLA 2UXCL 4DV7Q 5LMNQ 2JA7H 5IP9G 1KXLA 4Y7NH 1KL9A 3J80c 3HOXH 3CCVA 2HIXA 1YITA 1N33L 1J5EQ 1G51A 1GKHA 2KBNA 4UP8A 3S24A 1YJ9A 4GLVB 1XPRA 1PH9A 1XNRL 3DLLA 3HOYH 4IPGA 3UDFA 4A3KG 4X66L 4BY1H 2NN6I 1S40A 1YJNA 4HJ5A 1SROA 4JV5L 2WAQE 4P72A 3M4QA 1KIXA 4JCVE 1T9HA 3H0GG 1QUQA 1GM5A 1VQ8A 4JI5L 2H5XA 1MJEA 1PVOA 5IYDH 5M3FH 4YWLA 5C4XH 3S15H 4IPHA 1Q82C 1U0LA 5C0XJ 2MO0A 4P73A 3AFPA 3UDGA 3S2DH 1Q46A 2AHOB 1E24A 2K50A 2KHJA 1U5KA 1XPUA 3FKIH 2VQFL 2N3SA 3VDYA 3OYYA 3I55A 2VW9A 4DV3Q 3KDFA 3W5OA 3J81c 1PFSA 3KJOA 4DV6Q 4YY3L 3HOXG 2B3GA 3RLNA 1L1OC 2JQOA 3HFZB 2A1AA 3M9BA 2UXDQ 4DR6Q 5AJ3L 2VNUD 4YWMA 2UUCQ 1XNQL 3U58A 4XTCS 1YIJA 1UE7A 5C4JH 4A75A 4A76A 3PUWA 3AFQA 3GTMH 1RIPA 4LUVA 2HHHL 4YHHL 1DGSA 3J81i 4A3GH 1IBLQ 2ZTEA 1SE8A 4JI1L 5JEAJ 5M3FG 3BU2A 1N9WA 1PH2A 3PGZA 4JI6Q 1VQCA 2YYZA 4A3MG 3S1MH 3H0GH 1XMQQ 5JJKA 1A62A 3KJPA 4DR1Q 1Y1WH 4A3DG 2ZJPA 2F52A 2RHQB 1KD1C 2HHHQ 4NXNL 4JI1Q 4JI6L 3SGIA 1VQOA 5IE8A 2K4KA 2CWPA 3J7ZC 1X3GA 5IYCG 1L1OB 1IXRA 1PHJA 2FXQA 3T1YL 4UY8C 2Z6KC 2Q2IA 3DM3A 4LF9L 3I4NH 4YCUA 1YNXA 2MNAA 4JI0L 1CKOA 3KFUA 3PCOB 1X3FA 4P75A 4AYBG 1XMOL 3CCRA 1CSQA 4DV1Q 1NJIC 2N8NA 2N49A 1CKMA 2WFWA 1XPOA 4DAMA 1QZHA 4B3ML 3GTPH 4QQBX 3RN2A 1J5EL 2F3IA 5GAGC 3GTJH 4GLAC 3PF5A 1VQAA 1SMXA 1VQMA 5IYBG 2ZTCA 4JI8L 4BBRH 2R7ZH 3HKSA 1KC8C 4ALPA 3T1HQ 1VQHA 2VQEQ 4B3MQ 5LMUL 2VZAA 1O7IA 1OXTA 5M5WH 4DR7L 4KHPL 2D0OA 5IP7H 5FJ8G 3M4OH 2PNHA 3ERSX 4AYBE 5IYCH 2VQEL 1B8AA 2E2IH 5GADC 1Q8KA 1JJGA 4R4OA 1YZ6A 5GQOA 2D0PA 4DV4Q 4JOIC 1B7YB 2JA6H 2JK8A 5M5YH 4A3BH 1EFWA 1WCMH 1JMCA 3EIVA 4LWCA 4DV5L 3I4OA 3LGJA 4JYAQ 3S1QH 2XGTA 1IBLL 4IPCA 1I5FA 2NN6G 4OX9Q 1BBWA 1JJ2A 5JEAG 4BY7H 1YJWA 3I4MG 1L2FA 5C3EH 3AQQA 1KHIA 1TXYA 1UE5A 1YHAA 4LW1A 4NXNQ 1VQGA 4JI2Q 2ASBA 5IYDG 2B63H 3OTOL 2YTYA 1SLJA 4LFCL 3U4VA 2JA6G 1VQEA 3HOUH 1VQLA 4LFCQ 2OTLA 1VQ7A 3S17H 2UXCQ 5H1SE 4QL5A 4C3JH 2BH2A 5J3BA 4KI0A 3RLOA 1HNWQ 1N36Q 3ULJA 4BBSH 2V1CC 4IPDA 1G291 2Y0SG 4IJHA 1D8LA 4BY1G 2VS1A 1IZ6A 4GNXB 4K0KL 2JA8G 4HIDA 1M1KC 4LF5Q 4DKAC 3CCEA 1UE6A 4GLXA 1KRSA 3L7ZC 2A19A 4ME3A 3CPWA 1Q86C 3I4MH 4KHPQ 3OW2A 5M3MG 5M3MH 3F2BA 1E7ZA 3T1HL 3CQZH 1N34L 3D0FA 3NENA 1PYSB 5C3EG 4A3FH 1NMGA 1CSPA 4A3JH 1CKNA 3KF8B 4DV3L 2OTJA 1WOCA 1K8AC 4IFDJ 3A0JA 1L1OA 4PZ6A 5ELNA 4HJ7A 5ELOA 3I4NG 2PQAA 1GD7A 2CWAA 4DAYB 3E9IA 4DPGA 1VQ6A 1HZBA 4RG1A 2LXKA 1I3QH 1AE2A 4JG2A 3RZOH 3PUYA 3JAMc 1LTLA 1JE5A 2AWNA 3A5ZB 1VQFA 3HKZG 3J80i 2NVTH 3E0EA 1WFQA 2N78A 4X64Q 4DV2L 4DR2L 4BBRG 4QY7A 1FGUA 3H3VH 2I5LX 1YBYA 1HJPA 4A3JG 3PUZA 3M85A 3UE1A 3KOJA 5IWAQ 3CW2C 3BJUA 4DR1L 3HOUG 3CXCA 4OXPA 3FHWA 1XMQL 3PF4A 2VL6A 3FP9A 1FL0A 1IBML 4HIMA 3CP0A 3K7UC 2JJQA 5LMNL 4HJ8A 4YWKA 3STBC 2A8VA 4JI3Q 3CMAA 4L5SA 4R4QA 2JA9A 1FJGQ 1TWAH 3UDIA 4PG3A 3PIPA 1A0IA 1XJVA 3ICEA 2CQOA 3GTLH 5IT9c 1JT8A 1X55A 1VQ4A 2R92G 2AWOA 2HIVA 3PUXA 4UP7A 1EWIA 4NXMQ 1R9TH 3PIOA 2WB1G 4DV1L 5C0XG 2NVYH 4LFAQ 1IBKQ 1PH4A 3HOVH 5IY0A 1VS0A 2E2HH 4H02A 5IP7G 5FJ8H 2B63G 1OXVA 3U50C 1EIFA 1RL2A 1KAWA 1YHQA 2JEBI 3RR5A 2JA7G 4JOIA 1L0WA 1IL2A 3S1NH 3CAMA 3ZJYC 3W1BA 4A3IG 2E2JH 5JJIA 3JAMi 1GO3E 3J81j 3GTGH 1BKBA 2WB1E 1IYJB 4QIWE 4A3LG 5C44G 4L5QA 1MJCA 5C0XI 1HNZL 1QVGA 4GKJL 1WCMG 3H3VI 4GNXA 2K14A 3G4SA 2ZM6Q 4DR3Q 2UUBL 3HOVG 4GKKL 1NBWA 2EIFA 2R6GA 1LUZA 2IX0A 4OX9L 4A3LH 2Q2HA 3TS0A 5E7NA 4LF8L 1N32L 1VQNA 1MIUA 1SFOH 4GN4B 4JI2L 1CKNB 3CC2A 4POFA 4HIOA 4J15A 5IP9H 2PQAB 4UPAA 2WP8J 5GAHC 1XMOQ 2R93G 4O0AA 2NZOA 4TQUS 2ZJRA 4A3KH 4BA2I 3CPFA 3CCQA 3K8AA 3CF5A 1EYGA 1UEBA 4JI5Q 4LF9Q 4JI0Q 3CC4A 4A3BG 1SN8A 3PO2H 2PI2A 5DLQE 3S2HH 1PH5A 4DR7Q 2IHFA 1VQ9A 1WI5A 2K5NA 1IBKL 2OWOA 4LF7Q 4LFAL 4OO1I 3ER0A 4L5RC 4QJFA 1C0AA 1Q81C 4NXML 4HJAA 3A5UA 3I56A 3UE0A 3CCSA 3S14H 1QZGA 4A3DH 3E9HA 3CD6A 2HT1A 2UXBQ 4BBSG 1N34Q 1HZAA 2MFIA 2K52A 2AMCB 1HR0L 2LXJA 2QEXA 2IX1A 2HQLA 3D31A 2Q2UA 1VQKA 4A4IA 2Z0SA 3M4PA 5GAEC 2F4VQ 1ASYA 4X62L 4YY3Q 1G6PA 2JA5H 1HNZQ 2UUAL 3KF6A 4DV0Q 1HNXL 4JBMA 1NTGA 4A3CG 4DR4Q 2UUBQ 3I2ZA 4YCVA 1QVCA 4NPSA 4X65L 1Y14B 2MO1A 3K7AH 3KLWA 1I50H 4L5TA 4DUZQ 3MEFA 3HKZE 1YHBA 1NE3A 4IO9A 1C7YA 3HOZG 3TQYA 3HOZH 1K3RA 2NZHA 2YTVA 4DK3C 3OTOQ 4DUYL 2KHIA 3MXNB 2BA0A 1J6QA 5EAYA 5HGQA 4LF6Q 2JEAI 3PO3H 4JI4L 1HZ9A 4JI4Q 1C9OA 2CKZB 1SRUA 4B3SL 3J7A5 4B3RQ 1HNWL 1PH8A 1BBUA 1IBMQ 2JA5G 3S16H 4BXXH 4OWTB 1Q12A 4AQYL 4P74A 3STBD 1VCIA 1OXSC 1TWFH 2K5VA 1YEZA 4GOPC 3NELA 4LUZA 2NVQH 1Y1WG 2ES2A 4PZ7A 1P8LA 1N36L 5LMNW 1P16A 2VY3A 4A3MH 1SR3A 3NEMA 3PSIA 4XIGS 3S1RH 4A3EH 2F4VL 3RNUA 1K8GA 2B29A 1M90C 1I94Q 2KCMA 2EXDA 1MKHA 4R4IA 1NY4A 4X6AH 2UUCL 1XNQQ 1D7QA 3K80C 2AKWB 4GN5A 4JI7L 4IFDI 4DV5Q 4JBWA 5M5XH 3FKIG 2E5LQ 1UE1A 4AH6A 1WJJA 4DR5L 3TS2A 4FDBA 2PI2E 1TWCH 4OO1G 3CCMA 4R4CA 2CCZA 5FLXc 1YI2A 4C3HH 4GOPB 2UXDL 2I5HA 4QGUA 4HJ9A 1W2BA 1PH6A 4C2MH 3A74A 1V43A 4LUOA 3HOWH 4IOAA 3IRBA 2BH8A 4DR2Q 1K9MC 4GKKQ 3M7NA 4X62Q 4P71A 4A93H 2ZJQA 4LF4L 2EQSA 1LM0A 2E8GA 2OQ0A 1VQIA 4PMWA 1ASZA 2VUMG 3F2CA 4A3FG 3T1YQ 1PV4A 4B3SQ 3W1GA 3GD7A 1VQDA 5IWAL 4GNXC 3BZKA 3Q8DA 3K0XA 3GDEA 2I0QA 1S72A 1X65A 4Y52H 2IY5B 1E1TA 2GN5A 5FLMH 2YU9H 4A3IH 2Z6KA 3GO5A 2R93H 4AQYQ 1PYBA 1XTDA 3CCJA 2JA8H 5C44H 3PO2G 4IOCA 3AEVA 4B3RL 1FJGL 4K0KQ 1VQ5A 4A93G 1X6OA 3F1ZA 4HIKA 3KF6B 1W3SA 1I94L 3NBHB 1K73C 4LF5L 3ULPA 4MNOA 3F2DA 4PZ8A 2QA4A 4BA1I 1S3OA 1KRTA 1HZCA 2XTIA 2C35B 3EN2A 1HR0Q 2GVAA 1H95A 5BR8Q 1KQSA 2MQHA 1EOVA 1EIYB 1EQQA 3GTKH 2NVXH 2IHEA 2Y0SE 3UDXA 3G71A 2OCEA 4LNQA 2ATWA 1AH9A 4DV4L 4POGA 4RMFA 3TREA 5FLMG 1X54A 1TWHH 4LFBQ 2DGYA 3TRZA 1OXUA 4R4TA 1I6HH 3F8TA 5GROA 2D62A 4APVA 2KENA 2L15A 2RCNA 1Q1EA 1X56A 4BY7G 4OWXB 1QUQB 2K75A 1N8RC 4DR6L 4A3CH 2ZTDA 2ZM6L 4DR3L 3ULLA 4DUYQ 4X64L 2KCTA 4DV2Q 4GKJQ 1Y1VH 1HR0W 3GTOH 2QGQA 1N32Q 2DUDA 3HOWG 1FVIA 4DUZL 2JE6I 1OXXK 4OONA 4B3TQ 3TEHB 1E3PA 2RF4A 3B6YA 3KDFB 4B3TL 4JI3L 2VUMH 3HOYG 1PH1A 4X66Q 2LSSA 3RZDH 3RN5A 3G6EA 1E1OA 3I7FA 3H15A 1A8VA 2K5HA 1XNRQ 2ALYB 1EQRA 4OWWB 3GTQH 4JV5Q 1N33Q 3RLFA 3CCUA 3M3YH 1VQJA 4BXXG 4DV7L 1A63A 1Z9FA 4O2DA 3CMEA 2R92H 1HH2P 1PH3A 4AIMA 3BZCA 1Y1VG 4JI8Q 1GVPA 4GOPA 3L0OA 4DNIA 3L2PA 3U4ZA 2R7ZG 1K83H 2YTXA 4JC0A 5IYBH 1PA6A 1UWVA 5K36G 1NMFA 4EX5A 1CUKA 4MZ9A 4JBJA 3EBEA 5HY6A 4R1JA 3G48A 4TVAB 4LF7L 3PV0A 1X9NA 5BR8L 5LMUQ 4DK6C 5JJLA 1BVSA 4MTNA 2UXBL 3PUVA 2Q2TA
chains in the Genus database with same CATH superfamily
4YHHH 4EQ5A 4KTAA 1JJCB 1AE3A 1OTCA 1KABA 2E5LL 2UVWA 3KYHC 1KJIA 2FPPB 4DV0L 1JKJB 4FM9A 1HNZH 4LF4H 2YV5A 3KUPA 2BE5C 1X3EA 4G4KA 1IKMA 3RB6A 1WYDA 3ONAB 2R7FA 1TWGH 4LFBL 2BA1A 1JC7A 1PH7A 1K0RA 1V1QA 1VQBA 5C5MA 1DCZA 2W9CA 1QVFA 1KDAA 3T5HA 4A3EG 1YVCA 1VDZA 4LF6L 1AH9A 3AYHB 5LL6S 4C3IH 3C1EA 4IJLA 5C5JA 1V8QA 4Z9CB 4DR3H 3EQLC 3I70A 2JA7H 3N6RA 4Y7NH 3J80c 3CCVA 2W6NA 2HIXA 1YITA 3KAKA 4H0LC 4JV2A 5IOCA 1G51A 1SJHD 1ONLA 1PH9A 4A3KG 2EZVA 1S40A 2DLNA 5M9OA 3D4DA 4RUCA 1WTXA 2KQ3A 4JCVE 2O5JC 1C4QA 4ZUIA 3H4BA 1KJ9A 2JA8B 1GM5A 2E2HA 4JI5L 2H5XA 1MSGA 3BAAA 1U0LA 2LMCB 2MO0A 3DEOA 4MTDA 3D3RA 2AHOB 1E24A 3OHXC 5K36H 4TKOB 2VW9A 2F4VL 3KJOA 1NNXA 3P20A 2JQOA 1TWAB 2FE3A 1CK1A 2IWHA 3T16A 1G2TA 4YWMA 4DV3H 2UUCQ 1QOHA 1B2TA 3SE0A 5KG3A 2F0JA 2VQEH 4LUVA 2R7NA 2KEEA 2C28A 2AGOA 3K3VA 1IBLQ 2ZTEA 4JI1L 1JIHA 3NUCA 5KFKA 5LHY1 5M5WB 1XMQQ 3JAML 3TQTA 1A2UA 2WKDA 3KJPA 2PZWA 5ELBA 4KHVA 4JI6L 5CV6A 1UC8A 4DNTB 2K7VA 4L1KA 3KF8A 2K4KA 1X3GA 1SXTA 1L1OB 5IYCG 2HJWA 5J2TF 1G8ZD 4A3JB 4DL5A 2RGRA 4HNVA 3DM3A 4LF9L 1A2TA 1U4LA 3KFUA 3WO0A 4I7AA 3TIIA 1X3FA 4KY5A 1EHIA 1I6UA 2N8NA 2R7ZB 3EPIA 3I3CA 1QZHA 5NUCA 4K0KH 5GAGC 2K1BA 5DQIA 4DL2A 3V6KA 4IRCA 4NXNH 2UUCH 2XCLA 4JI8L 4BBRH 1AN7A 3HKSA 1ULZA 1VQHA 4KY6A 4R8NA 2VQEQ 4M9UA 3SXHA 2VZAA 2K01A 1WSCA 4JK1C 2PVPA 1OXTA 1B1ZA 4FS2A 4KKSA 2NU7B 3ERSX 1SYBA 1B8AA 3EPGA 1KC7A 1U4PA 5GADC 2QF7A 4Y8VB 1SYFA 4HSPA 3IG0A 4DV4Q 2D0PA 2E2IA 1MGSA 1JR0D 1EL0A 2VR1A 2AQ3B 4MA0A 4DXGA 2CHBD 4Q0FA 4ECVA 1JMCA 5LP6F 3EIVA 4DV5L 3FDSA 4ME6A 1YNNC 3LGJA 4J1MA 3UFXB 2W9BB 1IBLL 5KFAA 2NN6G 2Y0SA 2NWGA 4BY7H 3I4MG 1L2FA 2A73B 3HOVB 2VA2A 2B2UC 4NXNQ 2I07B 5M3MB 4LMYA 1D6EC 4I7HA 1ICWA 4U68A 4LFCQ 3S2DB 2UXCQ 4OGQC 5J3BA 1N33H 3RLOA 1EY0A 3DXJC 3ULJA 2V1CC 3KXYT 2K28A 5C1PA 2VS1A 4G57A 3M4IA 4F50A 4OO1H 1KRSA 3BDOA 4ME3A 3TMEA 1Q86C 4MV1A 3P7JA 2HCIA 4ZQ3A 2A74C 2FMAA 5M3MG 5M3MH 1PTOC 4ZKCB 1E7ZA 3CQZH 4ECXA 5C3EG 2EDGA 2W57A 5KFGA 4N8X1 2OTJA 1WOCA 1K8AC 4HJ7A 1L1OA 1DV1A 1EWHA 2PO4A 3I4NG 3OUZA 3E9IA 4HMJA 2XIGA 2VUGA 2W6MA 2R87A 1BBXC 5D1OA 1QG7A 2RDGA 2XNAC 1I3QH 1PXUA 5E4XA 1E4EB 5KG5A 2VOBA 5CMDA 1RODA 3J80i 2WYOA 2I8CA 4IUQA 2D5DA 2N78A 3GV6A 3R2TA 2NU6B 3GTKA 4BBRG 1HJPA 2BDOA 3M85A 4DR1L 4ZRZA 3FDTA 1E4FT 1O7ZA 2O4XA 4OXPA 3HEJA 2PN1A 1FL0A 1SDFA 3CP0A 5LMNL 3R23A 4YWKA 4X3SA 2FKLA 1TWAH 4PG3A 1AP0A 1GUNA 1TA8A 1G6ZA 4AQYH 3FPUB 2CQOA 1LTID 4BY1B 2WB1G 4YJ2F 5C0XG 3A54A 3VPBA 4JI7H 5A35A 3HOVH 3Q0AA 3MWYW 4JUZA 3D8GA 5JEAH 4K2LA 1KAWA 1CQFA 1YHQA 3RR5A 4EYIB 4EEQA 4YR0A 2XN9C 3CAMA 3ZJYC 5CBEE 5I9OA 5KFLA 3J7AV 1A3TA 1TWCA 4HAEA 3JAMi 4IRKA 1BKBA 5C44G 1EWCA 1F2YA 1QVGA 4ECUA 2K14A 3G4SA 3LP8A 1BJTA 1NBWA 2J6UA 3N42B 2IX0A 3OW7A 3KALA 1QE6A 5IGDA 5A2QE 2A68C 1JWMD 4M8AA 1N32L 5ELEA 1VQNA 3I90A 1ZQ7A 1M8AA 4FNFA 1SFOH 4GN4B 4JI2L 2NVXB 3CC2A 5I9PA 1G91A 4J15A 1KDCA 2EOTA 3FPPA 2J6SA 4Q5VA 4OELB 2R86A 1EY7A 3NQTA 3SHLA 3ZYYX 4DV1H 4DU9A 1UEBA 4JI5Q 4JI0Q 3CC4A 2B2TC 4RB2C 2VB2X 2FINB 3J80E 3BVMA 3QOLA 3HZXA 2PZTA 4DR7Q 3BQ2A 1DOKA 2K5NA 1ENCA 2OWOA 2PNRC 3GTKB 2FB9A 4L5RC 1PZID 5JVG3 1SCUB 2AGQA 4B9XA 2EYJA 3PW7A 1Q81C 1HFGA 1D2BA 3CCSA 3UE0A 5KX5F 5FK9C 4PMCA 1BOSA 5DNFA 1NCVA 4EYHB 3I4MB 2UXBQ 4NW2A 4R8IA 2K5QA 1EQTA 4J6HA 1HZAA 4PV1C 2AMCB 2IX1A 3TBIB 3D31A 2Q2UA 5BMVF 1WH2A 3BYTB 2JA7B 1EY4A 4IUTA 1IYUA 1VF5C 5JJZA 5GAEC 5JH7F 4DR4H 3CQZA 4A3IB 2FLNA 1G6PA 1CZGA 5KFEA 4CC6A 3KF6A 1HNXL 2EJMA 3NBIA 3MJFA 2EJFC 4YCVA 4NPSA 3OTOH 1R4PB 1EOTA 3VYRA 4RNNA 3K7AH 5KFNA 1I50H 4DUZQ 4J9LA 1HTLD 3A7AB 3M3YB 2M05A 1NE3A 2UUBH 3TQYA 5IYZF 1F9SA 2W7PA 4DN4M 1IBLH 1S5BD 1HZ9A 1SE4A 2F0NA 2EYPA 4DK1A 5KRUA 4JI4Q 1HNWL 4B3RQ 1K0SA 1GSAA 1L0YB 2F0QA 1S0OA 1IBMQ 3GIMA 2WIIB 3S16H 1TWCB 4OWTB 2QCPX 5D65A 2X6LA 2L4NA 2K5VA 4GOPC 1QB5D 3NELA 1I4QA 3RBDA 4TQRA 2RDJA 1N36L 5LMNW 3VYUA 2WAQB 1VKZA 1P16A 4LAAA 3C1FA 4C5AA 1CTMA 2DIKA 4XIGS 3RNUA 1K8GA 1I94Q 1UC9A 4EBCA 4IUPA 2KCMA 1LTRD 2X6GA 2XGPA 2KECA 2R7MA 4FO2A 4KK7A 3TS2A 4JBWA 1M7JA 3FKIG 2E5LQ 3MXPA 4DR5L 1K83A 3K58A 5CC4A 4ZAIA 4J9OA 2CCZA 3NE5B 4C2MH 1V43A 4IOAA 2KUMA 2F0FA 4GKKQ 1JX4A 4X62Q 4A93H 2ASLA 3DUZA 4LF4L 1N36H 4RCOA 3F2CA 2RCFA 2YZNA 4A3FG 1A9XA 3G6XA 1SFOA 3QG1A 4B3SQ 3W1GA 4DK0A 5C8YF 1LT6D 4QF4A 5IWAL 3BZKA 3Q8DA 3K0XA 5CV4A 2WKCA 2AQ2B 4RHRA 2RQXA 2IY5B 2GN5A 5FLMH 3JRXA 5M3FB 1PYBA 1S68A 4ZQIA 1NSNS 3K5OA 4DUYH 3PZPA 1A6XA 4XQJA 1UNSA 1EQVA 4IHJF 5K2MA 5KFBA 1X6OA 4HIKA 1I94L 2W9CB 2VQDA 5BR8H 4MNOA 1STGA 2N88A 1PTOD 4BA1I 1S3OA 4QWCA 1HZCA 5E3FA 2XWJB 5JVDF 2MQHA 1EIYB 1EQQA 3K5LA 4BWSC 2IHEA 2Y0SE 3UDXA 1TAEA 4DAVA 2ATWA 2OCEA 4LNQA 2W71A 3M9NB 4HSVA 2CQYA 3TP5A 4A2AA 3WOFA 3N40P 3MFHA 2F3VA 4RGMA 3TREA 4IAJA 5IWAH 3VMMA 4NMZA 1ZXTA 3S1RB 4LFBQ 2HQEA 1H9RA 3F8TA 2L15A 1CT1D 3VYSA 4BY7G 1QUQB 2K75A 2EYFA 2ZTDA 5ELDA 3HOZB 4I4TF 1PRTB 5CR3A 2B2YA 1XDNA 4B3TH 1Y1VH 3GTOH 2L9HA 5JQWA 2BQRA 1N32Q 1YNJD 5KFVA 2ATLA 1JXLA 2ZDQA 4ED8A 2RF4A 3B6YA 3KDFB 3HOYG 3GTMA 1PH1A 4X66Q 3JRWA 5KNBA 3RZDH 1ENFA 3G6EA 1Z7TA 1XNRQ 4OIJA 3K5HA 1EYCA 5KFJA 4OWWB 1V4YA 1HUMA 3RLFA 2WB1A 3CCUA 4BXXG 4C2MB 1SYDA 4MV9A 3SK4A 2TSSA 2WACA 3CMEA 2R92H 5KFOA 3BZCA 1Y1VG 4AYBB 2OEOA 4JI8Q 5KT3A 2OF1A 4KJNA 2FLPA 3K5IA 2F0EA 2FJZA 3NTIA 3Q8QB 1JORA 3HBLA 4QIWA 4EX5A 1CUKA 4JBJA 5EDWA 1K8OA 2EY1A 4TVAB 3CRKC 3ND9A 4O3PA 5L1KA 1PRTF 4DK6C 5LMUQ 1BVSA 2BCOA 4JPBW 2UXDL 1NR2A 3NTHA 4DV6L 4IFDG 1RTOA 1Z2NX 1Y1VB 2VPQA 2R7ZA 2QDLA 2VQFQ 1EIGA 2ALZA 4NB3A 3K81C 1RCVD 1JB7A 4YCWA 2AUJD 5EKKA 1Q7YC 3TP6A 5HGTA 4FU0A 2BQUA 2OQKA 3I4LA 2VUMB 4KHZA 4X65H 2UU9L 4V190 4JYAL 4LF4Q 1E22A 3L3OC 2UU9Q 3OIPA 3PO3G 2PMZE 2ID0A 1E0BA 2R7DA 4GS3A 1LYLA 3R93A 4KLKA 3JC66 4WJ3M 3N52A 4CKEA 1Y8NB 5E1FA 3KHHA 1RF2D 4DV7Q 1SYXB 4EGQA 3T5JA 2ASJA 2XGQA 3PO2B 1J5EQ 4HEDA 1J9OA 1STYA 1IHZA 2KBNA 1YJ9A 3HOYH 1RYRA 3TRZA 3J7AF 2UVVA 3DLLA 3UDFA 4ZK9B 1DOLA 1VAJA 5LMUH 1YJNA 4UCOA 5FO9B 2Q8IB 1T9HA 3H0GG 1GSOA 1PK8A 1VQ8A 1M0TA 1PVOA 5M3FH 1SJED 4YWLA 5C4XH 3G8CA 1T5EA 1Q82C 1LV9A 4R8UB 1BDOA 2RDHA 3UDGA 3S17B 1B50A 3T5KA 3QR8A 2K50A 2KHJA 1U5KA 1XPUA 3VDYA 4O4HF 3OYYA 5KKNB 2FPIB 3RB3A 2XWBB 3GTLB 4YY3L 2B3GA 3PIO3 4ECSA 4DR6Q 5AJ3L 4XTCS 1WTRA 4LF6H 4YHHL 1DGSA 5M3FG 4JI6Q 2F0VA 5JEAJ 1N9WA 1WTVA 3EROA 2YYZA 3S1MH 1SEIA 5JJKA 4C3HG 3NK9A 4DR1Q 2WE6A 2XRQD 1MBYA 2RHQB 2ZJPA 5T1IA 1KD1C 1XXGA 4JI1Q 4TUYF 3OWFA 4HCEA 1PDQA 5IE8A 3PW0A 3PR4A 1IXRA 2FK2A 1PHJA 2FXQA 4TV9F 2Q8TA 5KIXA 3C2PA 2Z6KC 1WCMA 1YNXA 2OXPA 1B9MA 3PCOB 4FF4A 1BGWA 1C30A 3DEPA 1XMOL 3CCRA 4DUZH 4HTHA 1Y1VA 1CKMA 2FHTA 2WFWA 5KG2A 3V6JA 4GZYC 3RN2A 1BQQT 1TS4A 3PF5A 1VQMA 1Z2OX 5C1OA 5IYBG 2ZTCA 1KC8C 4O4IF 5FPRA 3OSNA 2MP1A 4FF2A 1IBMH 1O7IA 4DR7L 5IP7H 3M4OH 3QZ7A 4BS9A 2PNHA 3K0YA 2A6HD 4AYBE 4LSXA 4DR1H 2VQEL 4EBDA 5IGGA 2E2IH 1Q8KA 4E6IA 5FPOA 4R4OA 2DPJA 1YZ6A 4RAUC 3GIKA 4JOIC 2SEBD 1I50B 4RU9A 4JV0A 5BPFA 3OHAA 1S5CD 3KK7A 2GPSA 3K5NA 5FD5A 4OX9H 1WCMH 5CV5A 3C3LA 1GOZA 3I4OA 3GP7A 5IT9L 2C22A 3S1QH 2XGTA 3F2UA 1BBWA 1JJ2A 2ZXOA 4MV6A 5JEAG 2E2HB 4KN4C 5KFXA 5EQ0A 5C3EH 1DZ1A 3J80L 1KBLA 1KHIA 1TXYA 1UE5A 5IIFA 3V05A 4JI2Q 2ASBA 3MFGA 4R8UA 3HOUH 2FFKB 2HVQA 4X66H 4MN3A 1VQLA 5KG6A 1VQ7A 5H1SE 1ZYRC 2B2VA 4X62H 4KI0A 1WD0A 1TKWB 4ZI7F 1I4GA 4BBSH 5GONF 2Y0SG 4RCNA 2UXCH 1IZ6A 3A8KE 4HIDA 1B33N 4LF5Q 4DKAC 1ESRA 3CKIB 4DNRB 4CDDC 1RJPA 4X3UA 2F0WA 1R4QB 2DJFC 3BA9A 4RGTA 3T1HL 1N34L 3D0FA 5L1IA 3RJ0A 2V4QA 3A8IE 3HOXB 1C48A 1FJGH 2SDFA 1CSPA 3DHQA 5I6YA 1F2LA 2UXDQ 2H4OA 5HBRB 2JEJA 4DAYB 4IZ8A 3NPPA 1Y1WB 1S0NA 2W70A 3SR1A 5H80A 1AE2A 3RZOH 4CJ2C 3JAMc 3A5ZB 2R7LA 1VQFA 2WINB 5FOBB 4DR2L 1WFQA 1IW7D 2CW8A 5C0XH 3BG5A 3E0JA 1PX2A 1YBYA 3UQ8A 5DEHA 1ET6A 4A3JG 3PUZA 5KGUA 3UE1A 5IWAQ 2X69A 2YS7A 4DL6A 1I3QA 1NAPA 4DXFA 1R9TA 3WO1A 5CGKA 4DV7H 1FNUA 5M5YB 2DNCA 4L5SA 2DWCA 5F9NA 4R4QA 3G6YA 2JA9A 1FJGQ 4O4LF 3UDIA 5KG7A 3PIPA 3CQZB 4B08A 3ICEA 1KEEA 1GLVA 2CW7A 5EZYF 4JI3H 5D8DA 5KFRA 2R92G 2HIVA 4UP7A 4FXKC 2HDLA 1EWIA 2B8FA 3PIOA 2HUGA 1CA6A 3JZIA 4RUAA 2NVYH 3KBGA 3MTSA 3C46A 5EWEA 4G7OC 4EQNA 1CZWA 3T13A 2IJ0A 3NXWA 1RL2A 2A6EC 2JA7G 3RZOB 2K5WA 1GGOA 3S1NH 4UAIA 1KJ8A 1HCZA 4A3IG 3HP3A 2R92B 1GO3E 5C4HA 1ZHSA 1BCPD 4QIWE 1IYJB 2JXMB 3PR5B 5CYUA 5KFPA 1AFPA 1MJCA 5C0XI 4GNXA 4F7XA 4JI6H 4C5BA 4DR3Q 1F9PA 2MJ8A 3GIPA 4HNUA 3FMCA 2FK3A 1B6SA 2F0MA 2KHSA 1STBA 3MXUA 3NTKA 5E7NA 1HPCA 3SVMA 4IR9A 5DG9A 2L12A 5C4ZA 3L4KA 1CKNB 2K33A 4IQZA 4HIOA 2MHVA 5IP9H 3BABA 1TR5A 2D2CC 1XMOQ 5GAHC 1PTOB 4TQUS 2ZJRA 4A3KH 5D1OB 3CPFA 4RGNA 5LL6X 5DLGA 3D4WA 3K8AA 5DLFA 4A3BG 1V51A 5DLQE 4F4ZA 3S2HH 2KA7A 1PH5A 1S5DD 2IHFA 5C3EB 1VQ9A 2IW3A 1GUTA 4OO1I 3SEBA 4CGYB 1WTPA 4QJFA 4A93B 3H20A 1CS0A 2K03A 3FKIA 2VB3X 1QZGA 4A3DH 3CD6A 2HT1A 4OIKA 2HVRA 1EY6A 1N34Q 1TY2A 1UNNC 1I4PA 5KFCA 5KT7A 2LXJA 1UAPA 5JPNC 2QEXA 5IGCA 1VQKA 4QWEA 2HDMA 4O2AF 4QUCA 3M4PA 1B3AA 1XMOH 5JAVA 1HNZQ 1H9SB 4I65A 4ED3A 4X3TA 3HOUB 2Z6BA 1X32A 3VA5A 5KT4A 3H4DA 4DR4Q 2UUBQ 3I2ZA 4YB8B 4EGVA 1II3A 1BNCA 1Y14B 3H3VC 4MA5A 4Q45A 4LF9H 5J22A 3LX0A 5I2YA 4IO9A 1C7YA 2F03A 1EZ1A 3MWDA 1K3RA 2NZHA 2YTVA 4DK3C 3L9AX 1RDPD 2R84A 1J6QA 3W3AA 5FO7B 5HGQA 4LF6Q 3OHBA 5IGBA 1D5MC 4MTEA 1C9OA 2CKZB 3N41B 3A55A 2EY2A 5T14A 1CQIB 1TWHB 5K5PA 4APMA 2HHHH 4CJ1B 1Q12A 1TWGB 1LLRD 4AQYL 4JI4H 3STBD 1YEZA 5JVLA 1Y1WG 2NVTB 1JOQA 4PZ7A 1P8LA 3GV7B 3I8ZA 3T4AC 1BXTA 4XT1B 1C8CA 2VXWA 3A56A 1SR3A 3BG3A 5CV9A 3HGBA 4XX0B 3NEMA 2WTFA 2JEFA 3K7AB 4QWDA 4A3EH 4F4YA 4TRDA 2X0SA 2G5DA 1VMPA 1M90C 2R8HA 2GPWA 1MKHA 1ET9A 1NY4A 3LNNA 3K80C 3P1HA 4GN5A 3WDNA 2EJGC 3KTMA 4PDBA 2Z4IA 5M5XH 1UE1A 1Q8IA 1WJJA 4AH6A 2QYZA 2NUAB 2PI2E 1TWCH 4OO1G 1BF4A 2L5TA 1IOWA 1YI2A 4C3HH 2W6OA 4TQSA 2B8GA 2I5HA 1PH6A 3PF4A 2MPMA 3U9SA 1ENAA 2BH8A 1D5ZC 3TP8A 5CV8A 3M7NA 5M5XB 2R8JA 4QIWB 2EQSA 5LL6b 1I4XA 2E8GA 4PMWA 3L4JA 4IUUA 4DR2H 1ICFB 2FMMA 3J81L 2YU9B 1MHWC 2F1MA 2F0SA 3HS0C 4GNXC 4JYAH 5DG8A 4B3SH 3RMHA 4R7RA 1SNMA 1W6KA 4K5XA 3HG9A 5CV7A 2YU9H 4A3IH 2ZXRA 2GLTA 2SCUB 2R93H 5I4DA 2JA8H 3DF7A 4DV2H 2DPIA 4K0KQ 3V2TA 1B04A 5KG0A 2RGVA 3QIAA 4WRDA 2W6PA 2C00A 2EYHA 4CDFC 5HV6A 2C35B 3EN2A 1TS5A 1EUCB 4MAMA 1EOVA 3D6CA 3GTKH 5KG4A 2P5ZX 4ZCKA 3G71A 1PTOF 3GV3A 3VYTA 1AW7A 3N43B 4WFN3 4RMFA 1X54A 3HOYB 1OXUA 1I4RA 1XTCD 4APVA 2RCNA 3X3MA 3VR3A 1HTPA 1Q1EA 1N8RC 4L63B 1C3OA 2ZM6L 1Q90A 3ULLA 4X64L 4DV2Q 1QNUA 3SE7A 4RA8A 2R8GA 4GKJQ 4IR1A 1GHKA 4DL7A 2SNSA 3A8JE 4FF3A 3W2DA 1FVIA 4DUZL 4KN7C 4OONA 2F0GA 4B3TQ 1XNRH 3TEHB 1WTHA 4A3DB 4RAYA 2VUMH 4NXMH 1YNND 3ORQA 4HQ6A 4X64H 2K5HA 2NVQB 1F2MA 3GTQH 2J7ZA 4IWYA 3PW5A 4FBTA 1A63A 2SOBA 1A15A 4O2DA 1SNCA 1GXDC 1HH2P 2RA4A 4KJOA 4ED2A 2XD4A 4A3GB 4GOPA 1STHA 3L0OA 3TSSA 2R7ZG 3U4ZA 1AZPA 4JC0A 2XCAA 2ZJTA 3K6OA 2K5DA 1WTQA 3H6MA 2JA6B 5K36G 1BR9A 4C1NI 1ZHQA 1NMFA 3IFTA 2NVYA 1QNKA 2MUYA 4MV4A 2IP4A 5TSSA 4C1NK 1KNAA 5I2XA 1EFID 2PQEA 1BXRA 2FK1A 1X9NA 5BR8L 1A3UA 4OHJA 3D6WA 5JJLA 2UXBL 3PUVA 2F0IA 4U6PA 2YZMA 4UP9A 1HNXH 4A3GG 2R8KA 5DGBA 3F8NA 4X65Q 1QCBD 1ZEQX 2I5MX 2EE1A 1IKLA 4DV0H 1SBBB 5KFZA 2UUAQ 4RB0A 4HNTA 4UHVA 3CC7A 3G6VA 1H9KA 1EUJA 2PMZB 1PMRA 3M7GA 3NBHA 2WAQG 1RK6A 2RHSB 4ED1A 4Q8EA 1MZBA 1B9NA 4JBKA 3CCLA 3KAJA 1VQPA 1GYFA 3N6XA 5LMNQ 1DIKA 3RGXA 1KXLA 3HOXH 1KL9A 4RB3C 1GKHA 1XPRA 4K2KA 2IA6A 2CW0D 4IPGA 2BR0A 4X66L 1XMQH 5KFTA 3I91A 2W9BA 2JSOA 4K5VA 2WAQE 4HCSA 1N48A 3RV3A 4WJWA 1TWFB 4XYLB 2I80A 5IYDH 1X3QA 4IPHA 4J9QA 4DF7A 5C0XJ 1WTOA 3AFPA 2Q8RE 1Q46A 1XX8A 4ZOLF 1SMYD 4TV8F 4LH7A 3FKIH 1BO0A 2UVRA 3I55A 3KDFA 3W5OA 3J81c 1PFSA 4DV6Q 1JLLB 1Y69U 2YL2A 3M9BA 3HFZB 1TVXA 1F77A 3RUZA 3I12A 1UE7A 4A75A 3PUWA 3AFQA 1RIPA 3WNZA 2JEGA 2HHHL 3J81i 1RD9D 4A3GH 1SE8A 2B2YC 1PH2A 4JI1H 1VQCA 3G7LA 3H0GH 1Y1WH 1FR3A 5CB4F 4NXNL 4O1NA 5C3WA 4BBRB 1VQOA 1EU3A 3KLRA 5C6AA 2I87A 2XIWA 1VBGA 1JQYD 3K59A 5DGAA 1IOVA 3I4NH 2Q2IA 1D1KA 3KBXA 2F0LA 2MNAA 4G3IA 4B9WA 4IWXA 4P75A 5J39A 4ECZA 2HVSA 2FMCA 4DV1Q 1NJIC 4A3MB 2N49A 4FVMA 1XPOA 4DAMA 5T1GA 3GTPH 1J5EL 3V6HA 2R82A 2F3IA 3I73A 4ID6A 3GTJH 4WBNF 1VQAA 1SMXA 5KFIA 2VUMA 3GTGA 4YR3A 1B53A 4XQQA 4B3MQ 4ZUJA 4A2BA 5LMUL 1LACA 1FYCA 2EY6A 1R9TB 5M5WH 5JUMA 4LFCH 4KHPL 2D0OA 5FJ8G 4HR7A 5DQGA 3KHGA 2HD3A 2ENBA 1J8IA 1JJGA 2VPSA 3PW4A 4QWAA 5KNCA 2W9AA 2ZT9C 1B7YB 4JVZA 2JK8A 3S16B 5F2DA 3X3NA 1K3BC 4LK1C 2KCCA 1EFWA 4KY7A 1DV2A 3SDZA 1SYGA 3MEHA 5F9LA 4ECQA 4OX9Q 5CBAE 4JI2H 1YJWA 3I72A 2E2DC 1TWFA 1GSHA 4IN3A 4BBSB 3GTPA 1V1PA 4LW1A 1YHAA 3RAXA 3M9OB 1VQGA 2L55A 1SNQA 4LFCL 4EG0A 2F0UA 3K3PA 2RVLA 3S17H 4C3JH 2BH2A 1FKAH 3O13A 4XT3B 1V1OA 1HNWQ 4IPDA 1G291 1D8LA 4F4WA 4BY1G 2JA8G 2K6AA 1M1KC 3CCEA 4KV6A 1BCPF 4GLXA 3L7ZC 5FKAC 3CPWA 2XVSA 3I4MH 5EPJA 4KHPQ 4QW8A 1B3QA 1AN8A 1EY8A 4N9PA 4LF5H 5KFYA 4LFBH 3NENA 4QWBA 3TDQA 5EPKA 1NMGA 4G7HC 1LT4D 2KCNA 1CKNA 1DD2A 3LWBA 3R5FA 4IFDJ 3A0JA 1A3VA 4PZ6A 1GUOA 4YQWA 2PQAA 1S10A 3KHLA 1HZBA 4RG1A 5AFWA 4K8JA 1O7LA 2PW7A 2YW2A 4JG2A 1GUSA 2V59A 3PUYA 4CKBA 2G9DA 3J81W 3VR2A 4ZKBB 1JE5A 3T51B 2AWNA 3PW2A 2NVTH 5I47A 1T36A 5BPHA 1U9RA 3BJUA 4XXEA 3RUPA 2I46A 1CFMA 4M1UB 4MIUA 3N8DA 3RB4A 1XMQL 5I6WA 2VL6A 3VR6A 1IBML 4C5CA 3K7UC 2JJQA 1HA6A 4HJ8A 1ZKOA 3PQIA 2A8VA 3IAYA 4JI3Q 3CMAA 2NU9B 3HKZB 4LMQD 2C5CA 3RD4A 4GKJH 1O78A 1A0IA 1ESFA 4HYKA 1I50A 2CH4W 1JT8A 4DL3A 1VQ4A 2AWOA 2LS01 3HRZC 4NXMQ 1R9TH 4UCVA 1E2WA 4DV1L 4WD3A 1I6VC 5EPLA 3NSWA 4LFAQ 4IURA 4KD3A 1PH4A 5IY0A 1IYVA 1VS0A 4H02A 3MZ5A 5IP7G 1AEXA 5KFDA 3EJIA 2AQ1B 1V1PB 3GTPB 3U50C 1EIFA 3RBEA 1EZ6A 4JOIA 1L0WA 1I6HB 1CI3M 2ASDA 3W1BA 2E2JH 5JJIA 2UU9H 3GTGH 3GTOB 2WB1E 3I4NB 2A5HA 1QWYA 1PRTC 1ZYRD 5BN4A 4LF7H 2W7OA 5KNDA 4GKJL 1WCMG 1O75A 2R6FA 2ZM6Q 1N56A 4LJZC 3HOVG 1K1QA 2R6GA 1LUZA 4A3BB 4YAJB 3N44B 2F3WA 3MR6A 4A3LH 3BVGA 4Q44A 4ED0A 4MV3A 1CQJB 3QOJA 4ODGA 1MIUA 5KT5A 1VF7A 2XC9A 2DY7A 2QEJC 3RF2A 4POFA 3Q1KA 4A3FB 4QB4A 3RAQA 4UCTA 1RHPA 2PQAB 5E4WC 2WP8J 1STEA 2YRWA 2NZOA 3TQ1A 3CCQA 5EWGA 2RSNA 4H7BA 4R9WA 1EYGA 3CF5A 2H1EA 1SN8A 1ILQA 2EVBA 3MVVA 4O3NA 3BQ0A 4JI8H 2IMWP 1JICA 2A6HC 2F0HA 1IBKL 4LF7Q 4IZOA 4J0MA 5IT9E 4DR6H 3Q22A 3MR2A 2LY7A 4V0BA 1N34H 2F4IA 3I56A 3PIP3 3VR4A 4A3EB 3CU7A 2QDBA 3GIQA 1SYEA 1SSOA 4CKCA 1PRTD 2CH4A 2Z9HA 4EFEA 2FLLA 2K52A 1BCPC 4DV4H 4C3JG 2W6ZA 1JOKA 3OPOA 4A4IA 4G7ZC 2Z0SA 1AUVA 2A69D 3VA7A 4YY3Q 1HRJA 4NLGA 2UUAL 4HN7A 2PPBC 1NTGA 4A3CG 3R5XA 2L1BA 2HGSA 2ZDGA 5EBDA 4X65L 4CC5A 3KLWA 4J9KA 4YR2A 1SAPA 3MEFA 4RNMA 3HKZE 1YHBA 4K14A 3NGDA 1KAAA 2XSCA 2KHIA 5EAYA 5COYA 1O7YA 2JEAI 4JI4L 1RYSA 3HOWB 5IT9W 1XWEA 3Q6SA 3J7A5 5EKLA 1SRUA 4B3SL 5FLXW 1PH8A 1HUNA 1HNWH 1HQRD 4HMIA 5CORA 4XYOA 3AU7A 1B44D 2V5AA 4ILWA 2O03A 1OXSC 4XYMB 3TIGA 2FPGB 3GTOA 4GKKH 4LUZA 2NVQH 3R5HA 4X3KA 2A6ED 1EYDA 5KFMA 2XRSD 5D3IB 4F8MA 1KTKA 2NYZD 3GIIA 2YZGA 1DYQA 3PSIA 1EU4A 3S1RH 1Z6HA 1S97A 2E74C 5JVH3 2EXDA 2JA5B 2UUCL 1SE2A 1CM9A 2MCTA 1UEAB 2N55A 1JOOA 4DV5Q 3NQIA 2FJ2A 4B3MH 4K6LA 5L37A 4FDBA 3IN5A 1LTAD 4IALA 1XYIA 4AYBA 5FLXc 1EY9A 2PYKA 4YAKB 4GOPB 4KKUA 4QGUA 4QQBX 1S5FD 4XZ3B 3IRBA 4DR2Q 3MWEA 5C4JB 1K9MC 5DM63 3T1YH 3BJYA 4P71A 2ZJQA 5DG7A 2DY8A 2OQ0A 2JA5A 3FEWX 2IX3A 1OWTA 1PV4A 1S4ZA 2V58A 2DJGC 3CVZA 1VQDA 4O3RA 4UFZA 1JB3A 5EGTA 1HA5A 3CRLC 2I0QA 4QCLA 3PN1A 4P2CB 1KLUD 4EQPA 4Y52H 2Z6KA 5KG1A 4AQYQ 4RHSA 1EUDB 5C44H 3GTJA 1F9RA 3PO2G 5J1ZA 4IOCA 3AEVA 1FJGL 1WTWA 4A93G 2E76C 1CHPD 2K32A 2KSWA 3Q24A 3KF6B 2YYAA 2PMZA 3D4RA 4CHTB 4LF5L 4F88A 3ULPA 4PZ8A 3JAME 1KRTA 1GJXA 4EFBA 1HR0Q 2R8IA 2GVAA 1H95A 3R2IA 2RDIA 3MFYA 2NVXH 2RSOA 3BA8A 3MXNA 1Y8PB 3LWEA 3HB9A 4DV4L 2R7KA 1TWHH 1EYZA 3GQBA 4J9PA 4RGOS 2V9WA 2DGYA 1T94A 4R4TA 2B2WC 5GROA 1L2ZA 2M2LA 2KENA 4OWXB 2DZDA 4DR3L 2NZ1D 4DUYQ 3OMGA 1YNJC 2AGPA 3TINA 5FLXE 2NBFA 3HXLA 4ME5A 2JE6I 1OXXK 3MA2B 4C3HB 2NU8B 1S0MA 1STNA 1TU2B 1QILA 1D1IA 4PNYA 4DAPA 3H15A 3GV8B 1JDBB 3CHBD 2AU0A 4NP5A 3V96A 1IBKH 3QO2A 3M3YH 2NUCA 4DV7L 1K83B 2B2VC 3S1MB 1DOMA 2R3ZA 4JV5H 1PH3A 2L0CA 4AIMA 4F4XA 4DR7H 1GVPA 2YRXA 1K83H 1PA6A 1JE4A 3IFDA 1UWVA 4NKLA 3GTQA 4CDEC 3VPDA 1J5EH 4R1JA 3G48A 1SFOB 4MTKA 3BZDB 2FP4B 5EOYA 3ND8A 1FNVA 5KFSA 3H09A 2UXDH 4MTNA 2QW7A 2EYOA 1K1SA 3GQCA 2Q2TA 1LO5D 4DR5Q 4F87A 1PTOH 5C4XB 1RKNA 4JI7Q 1B4OA 1DM0B 5LYJF 4C56C 4DR4L 3Q8PB 4YHHQ 3V4ZA 1HNXQ 1OO9B 4IUVA 1JWUD 3GTJB 5KYIA 4GN3B 4FF1A 1PFNA 5AJ3Q 1Q1BA 1DONA 3NWSA 1Z47A 2NTTA 5KFUA 2IT1A 2JN4A 1TQOA 3KLSA 1GHJA 1B70B 2V4DA 4LF8Q 3C0FB 3WWVA 2C2DA 2CFMA 4HR7B 2UUAH 2CQAA 4I55F 2KVMA 2GVBA 2EY5A 4WJ4A 1V9PA 1DXMA 5C4XG 2UXCL 2ZM6H 4J9NA 1AUXA 5IP9G 4J9SA 2CW0C 1N33L 4UP8A 1XNRL 3S24A 4GLVB 5LMNH 4BY1H 4LFAH 2NN6I 4DR5H 4HJ5A 1SROA 4JV5L 5KT2A 4P72A 3M4QA 5C5LA 1KIXA 2Y0SB 4LH6A 4RB1A 3RB0A 1F2ZA 1QUQA 4XQNA 2PCFB 1MJEA 5CA1F 3DMUA 3GV5B 3S15H 1FNWA 4P73A 4DV6H 3S2DH 1B6RA 2ICEC 4JI0H 1FD7D 2VQFL 4QW9A 2N3SA 2EPBA 1D5XC 4DFAA 2PBZA 4DV3Q 4A3KB 3Q8SB 2J6TA 4EGJA 2JYOA 3RLNA 3HOXG 3QWNA 1L1OC 1M0WA 2UVUA 2A1AA 3ITPA 4BY7B 1RJQA 2VNUD 1NUCA 1XNQL 3U58A 1YIJA 2WB1B 5C4JH 4A76A 3IL8A 2MGSA 3GTMH 4C2MA 2BOSA 2UXBH 2M9VA 3BU2A 4S3SA 3S1NB 1GUGA 3PGZA 2YS6A 4A3MG 4TSSA 1A62A 2Z8LA 2B63B 3U9TA 1K28A 3QB3A 4A3DG 2F52A 2HHHQ 4ED7A 3E6ZX 4RAZA 1K8MA 3H91A 3SGIA 3MXGA 2JA6A 3MHBA 2IL8A 2CWPA 3J7ZC 2NVYB 1F9QA 1EZ8A 5ELFA 3T1YL 1JDEA 4YY3H 4ZYSA 4UY8C 1RJTA 5DAUA 3QZ8A 4YCUA 2EXZA 4DA2A 4JI0L 1CKOA 4AYBG 5G3LF 2QILA 1CSQA 4FP5D 1E4EA 1O80A 1KJQA 1HHVA 1W93A 4PMBA 3E5NA 2QK4A 1I7NA 4B3ML 4WORA 4FS1A 1LTBD 1XNQH 4M7EA 4GLAC 3VPCA 3J81E 1BNZA 5IGFA 2R7ZH 2HCCA 4ALPA 3T1HQ 2O5IC 2E2JB 3NHHA 3PVXA 4FYDA 4RWSC 1I3QB 2EYMA 1U4RA 4EEYA 1LTGD 3OOCA 1UUPA 5KFHA 5IYCH 4O3SA 3GILA 4IRDA 1I7LA 4O3OA 4N8FA 3FMAA 5GQOA 3LMLA 4J8QA 2JA6H 4ULLA 2KJXA 5M5YH 4PQXA 4ABNA 5EJWA 4PWQA 4KKTA 4A3BH 1I94H 3U9OA 4LWCA 3PO3B 4JYAQ 1LT3D 2F0KA 4RKBA 4IPCA 1I5FA 5JOBA 2A68D 2E5LH 2K05A 3KLSX 1KLGD 3AQQA 3S1QB 2BQ3A 1SEBD 3RV4A 5IYDG 2B63H 3ORRA 3OTOL 2YTYA 5ISRA 3T1HH 1CHQD 1SLJA 3U4VA 2JA6G 1VQEA 3EFXD 3GLKA 4ECWA 1KNEA 2OTLA 1CQVA 1GUWA 3DWPA 4QL5A 3GTLA 1N36Q 1SE3A 4IJHA 1HXYD 4GNXB 4K0KL 3UI2A 1UE6A 5EKIA 1L0XB 2LKVA 2A19A 3NWTA 2B2TA 3M4OB 3OW2A 1PFBA 3S14B 3KHRA 4RZRA 4FXDA 4Q0YA 3F2BA 2CVRA 3E5SA 2ZDHA 2R85A 1PYSB 4A3FH 4Y7NB 3TZDA 4A3JH 4ECYA 3KF8B 5LA6F 2BDNA 4H44C 2M00A 4DV3L 2OLSA 5ELNA 4C3IB 2R93G 4BA2I 5ELOA 4DPGA 1GD7A 2CWAA 1BUVT 3K57A 1VQ6A 2OH2A 4RZQA 1WCMB 2LXKA 1X3PA 5EBCA 1WR2A 5KT6A 3J7YW 1LTLA 4RNOA 2KOLA 3DM1A 3FVQA 3HKZG 5D1PA 3A7LA 1TS2A 3E0EA 3H40A 4J9MA 4X64Q 4DV2L 2C2RA 3BYYB 4QY7A 3V4SA 1FGUA 4DGZA 3H3VH 2I5LX 2JP1A 3GTGB 3KOJA 4C3IG 3CW2C 3HOUG 2R93B 4MV8A 4U7CA 3J7AK 1LTSD 3CXCA 1PYWD 4E4TA 3Q2OA 3FHWA 1M6VA 1ZETA 2F0TA 3FP9A 3AMUA 5D3DA 4HIMA 2B2UA 4FBUA 5KFFA 3STBC 2G9HD 2VA3A 4Q8FA 3SK5A 2JA7A 5FO8B 1KJJA 2E2IB 3TN2A 1XJVA 1N32H 3GTLH 3OSPA 2QKIC 5IT9c 1H9SA 1X55A 2W8LA 1WVLA 3PUXA 5G3LD 2D9UA 2EYLA 2O2LD 4L8JA 4LSAA 1Q3LA 4RKLA 5LXTF 3GIJA 1IBKQ 3URYA 4OEMB 2E2HH 5L1JA 2NTSA 5CAEB 4ECTA 5FJ8H 3R3OA 1OXVA 4C3JB 2B63G 2BE5D 1PZJD 1HQMC 3Q8RB 2V4RA 2JEBI 2A69C 2Z4HA 1IL2A 1TT2A 1TWHA 3QJYA 2ICIA 3J81j 1WD1A 4L5QA 4RH6A 3P75A 1HNZL 3H3VI 3BS1A 1T3NA 3MC0B 2UUBL 4GKKL 2EIFA 2RKSA 1CA5A 4JV1A 4OX9L 1HFNA 2ZXPA 4YIJA 2Q2HA 3TS0A 1SNDA 4LF8L 2P0AA 1RTNA 4ETSA 2C2EA 5C44B 3ERQA 3R8BA 4UPAA 4DAYA 1FGBD 5C3XA 1BCPB 5DM73 4O0AA 3H0GA 4LF8H 5KFWA 1Y1WA 1W6JA 4K8IA 4LF9Q 3EYYA 4YP3A 2DN8A 3PO2H 2PI2A 1PFMA 2WDTA 4JI5H 1WI5A 4LFAL 3ER0A 3Q23A 1LABA 3RTXA 4XYQA 1KDBA 4GC6A 4MV7A 4UDUC 4DLKA 1C0AA 2YU9A 4NXML 1NR4A 4HJAA 3A5UA 2R93A 5D14A 1U4MA 4EBEA 3S14H 4YJ3F 4O42A 3E9HA 1ILPA 5KEEA 5ELCA 1S9FA 3IKJA 4BBSG 2F0PA 2IBKA 2TMPA 2MFIA 1HR0L 2Z1CA 4CDCC 2HQLA 3HKZA 3RIZA 2F4VQ 1ASYA 4X62L 4IFDH 4UCUA 4IUNA 5KFQA 2JA5H 3S2HB 4JBMA 4DV0Q 1T5XD 4UCSA 4ED6A 3EA6A 3TZUA 3JAMW 1QVCA 3MR5A 3WOEA 2MO1A 4L5TA 3HOZG 5CA0F 3HOZH 3OTOQ 4DUYL 2PW5A 5BN3A 3MXNB 2BA0A 3PO3H 3OUUA 1H9JA 3T53B 2KEDA 5JPMC 2R61A 3OMCA 1VBHA 3LWUA 1E2VA 5L1LA 1BBUA 2JA5G 4BXXH 2R92A 3OSOA 2WV6D 1EY5A 2C9OA 4P74A 1PZKD 2GA4B 1VCIA 4B3RH 1TWFH 2NB0A 2RDFA 2W6QA 1RK5A 2ES2A 3RZDB 1SMYC 2SNMA 5HURA 2VY3A 3OIQA 4A3MH 1I4HA 2F4VH 4GC7A 2J4XA 2AUKA 4FXGC 1S5ED 2J9GA 2B29A 5A2QL 3GTMB 1EYAA 4R4IA 4BWGB 1XNQQ 4X6AH 1D7QA 2AKWB 2NVXA 3MWMA 3NP8A 4JI7L 4IFDI 3M4YA 2B2WA 3JSLA 3H0GB 3CCMA 4R4CA 2IPKD 4ZHQF 4DV5H 2CZGA 3QFFA 3E3XA 4HJ9A 1W2BA 4I7ZC 3A74A 3HOWH 1IL8A 4LUOA 3S15B 3RGZA 4ZLTF 4ECRA 2OT2A 3GTQB 5DQHA 4DL4A 1LM0A 1LTTD 2F0DA 2F0OA 1VQIA 4QMGA 1ASZA 5IODA 2VUMG 5FD6A 3J80W 4KD4A 3T1YQ 5BN5A 3GD7A 3GIDA 1IW7C 3FKIB 3AB9A 1W96A 1PLFA 3SK8A 4KHPH 3GDEA 1S72A 4Q43A 1H9MA 1E2ZA 1X65A 1E1TA 3RFCA 1TS3A 1Y8OB 3GO5A 1M4VA 1XTDA 3MAQA 3CCJA 3BDCA 4B3RL 1VQ5A 1RJRA 5A2QW 3F1ZA 4O2BF 3MR3A 3M9MB 1W3SA 3K5MA 3EVQA 3NBHB 1K73C 3F2DA 2QA4A 1MI2A 1MSHA 1Z2PX 2XTIA 3G6JB 5BR8Q 5KYLA 1KQSA 1EIHA 3T5LA 4N9TA 3ETHA 3SI8A 5L9XA 5IGEA 1HR0H 2K04A 1MD2D 4POGA 5FLMG 3MFIA 2YCHA 2B39A 2E75C 2L11A 1I6HH 1G2SA 2D62A 1TWGA 3BVZA 4UCRA 3H94A 4CJ0B 1X56A 3FRPB 3BQ1A 4DR6L 4A3CH 4H13C 4XDXA 1LT5D 2KCTA 4U673 2J0TD 2WAQA 5J2UF 1JCKB 4L6TB 4RFBA 3JSNA 1HR0W 3S9WA 2QGQA 4CBVA 4J9RA 2JEIA 2DUDA 3HOWG 3TP7A 1QJOA 1VMCA 1E3PA 4A3LG 4OL7A 4EVOA 4JI3L 4B3TL 4NDXA 2LFNA 1TY0A 2DNEA 2LSSA 4JW0A 3RN5A 4I50F 4YBZB 1SNOA 2PZUA 1TWAA 1E1OA 3I7FA 1AZQA 4MHEA 1A8VA 1EEFD 2ALYB 1EQRA 1DJRD 1SNPA 2RBMA 4KMUC 4QUFA 1N33Q 4JV5Q 1CE8A 5EWFA 2W8KA 1S03G 2XCPA 3T56B 1VQJA 1Z9FA 3BDLA 4K6DA 1E4GT 5LOVF 1ML0D 3SK6A 2B63A 2NN6H 1JWSD 4DNIA 3L2PA 4EQOA 2YTXA 5IYBH 4K5WA 3OWEB 3PMFA 3DWAA 3DWQA 4MZ9A 4O3QA 2AQ4A 1TIID 3EBEA 5HY6A 4LF7L 1SYCA 3PV0A 1EEID 3VR5A 2VQFH 1STAA 3ETJA 5FLXL
chains in the Genus database with same CATH topology
4EQ5A 4UP9A 4DR5Q 4DV6L 4IFDG 4A3GG 1JJCB 1AE3A 1OTCA 2VQFQ 4JI7Q 2E5LL 4DR4L 4NB3A 3K81C 3KYHC 4X65Q 4YCWA 4YHHQ 1JB7A 4DV0L 1HNXQ 1Q7YC 2I5MX 2YV5A 1X3EA 1WYDA 2OQKA 4GN3B 2R7FA 4KHZA 1TWGH 1Q1BA 5AJ3Q 2UUAQ 4LFBL 2BA1A 1Z47A 2UU9L 4JYAL 4LF4Q 2IT1A 3CC7A 1PH7A 1K0RA 1E22A 1B70B 1EUJA 1V1QA 1VQBA 3WWVA 2UU9Q 4LF8Q 1QVFA 2CFMA 3PO3G 2PMZE 2ID0A 2R7DA 2WAQG 4GS3A 4A3EG 1YVCA 2RHSB 1LYLA 2GVBA 4JBKA 3CCLA 4LF6L 4KLKA 4WJ4A 3JC66 1V9PA 3AYHB 4WJ3M 5C4XG 4C3IH 1VQPA 4IJLA 2UXCL 4DV7Q 5LMNQ 2JA7H 5IP9G 1KXLA 4Y7NH 1KL9A 3J80c 3HOXH 3CCVA 2HIXA 1YITA 1N33L 1J5EQ 1G51A 1GKHA 2KBNA 4UP8A 3S24A 1YJ9A 4GLVB 1XPRA 1PH9A 1XNRL 3DLLA 3HOYH 4IPGA 3UDFA 4A3KG 4X66L 4BY1H 2NN6I 1S40A 1YJNA 4HJ5A 1SROA 4JV5L 2WAQE 4P72A 3M4QA 1KIXA 4JCVE 1T9HA 3H0GG 1QUQA 1GM5A 1VQ8A 4JI5L 2H5XA 1MJEA 1PVOA 5IYDH 5M3FH 4YWLA 5C4XH 3S15H 4IPHA 1Q82C 1U0LA 5C0XJ 2MO0A 4P73A 3AFPA 3UDGA 3S2DH 1Q46A 2AHOB 1E24A 2K50A 2KHJA 1U5KA 1XPUA 3FKIH 2VQFL 2N3SA 3VDYA 3OYYA 3I55A 2VW9A 4DV3Q 3KDFA 3W5OA 3J81c 1PFSA 3KJOA 4DV6Q 4YY3L 3HOXG 2B3GA 3RLNA 1L1OC 2JQOA 3HFZB 2A1AA 3M9BA 2UXDQ 4DR6Q 5AJ3L 2VNUD 4YWMA 2UUCQ 1XNQL 3U58A 4XTCS 1YIJA 1UE7A 5C4JH 4A75A 4A76A 3PUWA 3AFQA 3GTMH 1RIPA 4LUVA 2HHHL 4YHHL 1DGSA 3J81i 4A3GH 1IBLQ 2ZTEA 1SE8A 4JI1L 5JEAJ 5M3FG 3BU2A 1N9WA 1PH2A 3PGZA 4JI6Q 1VQCA 2YYZA 4A3MG 3S1MH 3H0GH 1XMQQ 5JJKA 1A62A 3KJPA 4DR1Q 1Y1WH 4A3DG 2ZJPA 2F52A 2RHQB 1KD1C 2HHHQ 4NXNL 4JI1Q 4JI6L 3SGIA 1VQOA 5IE8A 2K4KA 2CWPA 3J7ZC 1X3GA 5IYCG 1L1OB 1IXRA 1PHJA 2FXQA 3T1YL 4UY8C 2Z6KC 2Q2IA 3DM3A 4LF9L 3I4NH 4YCUA 1YNXA 2MNAA 4JI0L 1CKOA 3KFUA 3PCOB 1X3FA 4P75A 4AYBG 1XMOL 3CCRA 1CSQA 4DV1Q 1NJIC 2N8NA 2N49A 1CKMA 2WFWA 1XPOA 4DAMA 1QZHA 4B3ML 3GTPH 4QQBX 3RN2A 1J5EL 2F3IA 5GAGC 3GTJH 4GLAC 3PF5A 1VQAA 1SMXA 1VQMA 5IYBG 2ZTCA 4JI8L 4BBRH 2R7ZH 3HKSA 1KC8C 4ALPA 3T1HQ 1VQHA 2VQEQ 4B3MQ 5LMUL 2VZAA 1O7IA 1OXTA 5M5WH 4DR7L 4KHPL 2D0OA 5IP7H 5FJ8G 3M4OH 2PNHA 3ERSX 4AYBE 5IYCH 2VQEL 1B8AA 2E2IH 5GADC 1Q8KA 1JJGA 4R4OA 1YZ6A 5GQOA 2D0PA 4DV4Q 4JOIC 1B7YB 2JA6H 2JK8A 5M5YH 4A3BH 1EFWA 1WCMH 1JMCA 3EIVA 4LWCA 4DV5L 3I4OA 3LGJA 4JYAQ 3S1QH 2XGTA 1IBLL 4IPCA 1I5FA 2NN6G 4OX9Q 1BBWA 1JJ2A 5JEAG 4BY7H 1YJWA 3I4MG 1L2FA 5C3EH 3AQQA 1KHIA 1TXYA 1UE5A 1YHAA 4LW1A 4NXNQ 1VQGA 4JI2Q 2ASBA 5IYDG 2B63H 3OTOL 2YTYA 1SLJA 4LFCL 3U4VA 2JA6G 1VQEA 3HOUH 1VQLA 4LFCQ 2OTLA 1VQ7A 3S17H 2UXCQ 5H1SE 4QL5A 4C3JH 2BH2A 5J3BA 4KI0A 3RLOA 1HNWQ 1N36Q 3ULJA 4BBSH 2V1CC 4IPDA 1G291 2Y0SG 4IJHA 1D8LA 4BY1G 2VS1A 1IZ6A 4GNXB 4K0KL 2JA8G 4HIDA 1M1KC 4LF5Q 4DKAC 3CCEA 1UE6A 4GLXA 1KRSA 3L7ZC 2A19A 4ME3A 3CPWA 1Q86C 3I4MH 4KHPQ 3OW2A 5M3MG 5M3MH 3F2BA 1E7ZA 3T1HL 3CQZH 1N34L 3D0FA 3NENA 1PYSB 5C3EG 4A3FH 1NMGA 1CSPA 4A3JH 1CKNA 3KF8B 4DV3L 2OTJA 1WOCA 1K8AC 4IFDJ 3A0JA 1L1OA 4PZ6A 5ELNA 4HJ7A 5ELOA 3I4NG 2PQAA 1GD7A 2CWAA 4DAYB 3E9IA 4DPGA 1VQ6A 1HZBA 4RG1A 2LXKA 1I3QH 1AE2A 4JG2A 3RZOH 3PUYA 3JAMc 1LTLA 1JE5A 2AWNA 3A5ZB 1VQFA 3HKZG 3J80i 2NVTH 3E0EA 1WFQA 2N78A 4X64Q 4DV2L 4DR2L 4BBRG 4QY7A 1FGUA 3H3VH 2I5LX 1YBYA 1HJPA 4A3JG 3PUZA 3M85A 3UE1A 3KOJA 5IWAQ 3CW2C 3BJUA 4DR1L 3HOUG 3CXCA 4OXPA 3FHWA 1XMQL 3PF4A 2VL6A 3FP9A 1FL0A 1IBML 4HIMA 3CP0A 3K7UC 2JJQA 5LMNL 4HJ8A 4YWKA 3STBC 2A8VA 4JI3Q 3CMAA 4L5SA 4R4QA 2JA9A 1FJGQ 1TWAH 3UDIA 4PG3A 3PIPA 1A0IA 1XJVA 3ICEA 2CQOA 3GTLH 5IT9c 1JT8A 1X55A 1VQ4A 2R92G 2AWOA 2HIVA 3PUXA 4UP7A 1EWIA 4NXMQ 1R9TH 3PIOA 2WB1G 4DV1L 5C0XG 2NVYH 4LFAQ 1IBKQ 1PH4A 3HOVH 5IY0A 1VS0A 2E2HH 4H02A 5IP7G 5FJ8H 2B63G 1OXVA 3U50C 1EIFA 1RL2A 1KAWA 1YHQA 2JEBI 3RR5A 2JA7G 4JOIA 1L0WA 1IL2A 3S1NH 3CAMA 3ZJYC 3W1BA 4A3IG 2E2JH 5JJIA 3JAMi 1GO3E 3J81j 3GTGH 1BKBA 2WB1E 1IYJB 4QIWE 4A3LG 5C44G 4L5QA 1MJCA 5C0XI 1HNZL 1QVGA 4GKJL 1WCMG 3H3VI 4GNXA 2K14A 3G4SA 2ZM6Q 4DR3Q 2UUBL 3HOVG 4GKKL 1NBWA 2EIFA 2R6GA 1LUZA 2IX0A 4OX9L 4A3LH 2Q2HA 3TS0A 5E7NA 4LF8L 1N32L 1VQNA 1MIUA 1SFOH 4GN4B 4JI2L 1CKNB 3CC2A 4POFA 4HIOA 4J15A 5IP9H 2PQAB 4UPAA 2WP8J 5GAHC 1XMOQ 2R93G 4O0AA 2NZOA 4TQUS 2ZJRA 4A3KH 4BA2I 3CPFA 3CCQA 3K8AA 3CF5A 1EYGA 1UEBA 4JI5Q 4LF9Q 4JI0Q 3CC4A 4A3BG 1SN8A 3PO2H 2PI2A 5DLQE 3S2HH 1PH5A 4DR7Q 2IHFA 1VQ9A 1WI5A 2K5NA 1IBKL 2OWOA 4LF7Q 4LFAL 4OO1I 3ER0A 4L5RC 4QJFA 1C0AA 1Q81C 4NXML 4HJAA 3A5UA 3I56A 3UE0A 3CCSA 3S14H 1QZGA 4A3DH 3E9HA 3CD6A 2HT1A 2UXBQ 4BBSG 1N34Q 1HZAA 2MFIA 2K52A 2AMCB 1HR0L 2LXJA 2QEXA 2IX1A 2HQLA 3D31A 2Q2UA 1VQKA 4A4IA 2Z0SA 3M4PA 5GAEC 2F4VQ 1ASYA 4X62L 4YY3Q 1G6PA 2JA5H 1HNZQ 2UUAL 3KF6A 4DV0Q 1HNXL 4JBMA 1NTGA 4A3CG 4DR4Q 2UUBQ 3I2ZA 4YCVA 1QVCA 4NPSA 4X65L 1Y14B 2MO1A 3K7AH 3KLWA 1I50H 4L5TA 4DUZQ 3MEFA 3HKZE 1YHBA 1NE3A 4IO9A 1C7YA 3HOZG 3TQYA 3HOZH 1K3RA 2NZHA 2YTVA 4DK3C 3OTOQ 4DUYL 2KHIA 3MXNB 2BA0A 1J6QA 5EAYA 5HGQA 4LF6Q 2JEAI 3PO3H 4JI4L 1HZ9A 4JI4Q 1C9OA 2CKZB 1SRUA 4B3SL 3J7A5 4B3RQ 1HNWL 1PH8A 1BBUA 1IBMQ 2JA5G 3S16H 4BXXH 4OWTB 1Q12A 4AQYL 4P74A 3STBD 1VCIA 1OXSC 1TWFH 2K5VA 1YEZA 4GOPC 3NELA 4LUZA 2NVQH 1Y1WG 2ES2A 4PZ7A 1P8LA 1N36L 5LMNW 1P16A 2VY3A 4A3MH 1SR3A 3NEMA 3PSIA 4XIGS 3S1RH 4A3EH 2F4VL 3RNUA 1K8GA 2B29A 1M90C 1I94Q 2KCMA 2EXDA 1MKHA 4R4IA 1NY4A 4X6AH 2UUCL 1XNQQ 1D7QA 3K80C 2AKWB 4GN5A 4JI7L 4IFDI 4DV5Q 4JBWA 5M5XH 3FKIG 2E5LQ 1UE1A 4AH6A 1WJJA 4DR5L 3TS2A 4FDBA 2PI2E 1TWCH 4OO1G 3CCMA 4R4CA 2CCZA 5FLXc 1YI2A 4C3HH 4GOPB 2UXDL 2I5HA 4QGUA 4HJ9A 1W2BA 1PH6A 4C2MH 3A74A 1V43A 4LUOA 3HOWH 4IOAA 3IRBA 2BH8A 4DR2Q 1K9MC 4GKKQ 3M7NA 4X62Q 4P71A 4A93H 2ZJQA 4LF4L 2EQSA 1LM0A 2E8GA 2OQ0A 1VQIA 4PMWA 1ASZA 2VUMG 3F2CA 4A3FG 3T1YQ 1PV4A 4B3SQ 3W1GA 3GD7A 1VQDA 5IWAL 4GNXC 3BZKA 3Q8DA 3K0XA 3GDEA 2I0QA 1S72A 1X65A 4Y52H 2IY5B 1E1TA 2GN5A 5FLMH 2YU9H 4A3IH 2Z6KA 3GO5A 2R93H 4AQYQ 1PYBA 1XTDA 3CCJA 2JA8H 5C44H 3PO2G 4IOCA 3AEVA 4B3RL 1FJGL 4K0KQ 1VQ5A 4A93G 1X6OA 3F1ZA 4HIKA 3KF6B 1W3SA 1I94L 3NBHB 1K73C 4LF5L 3ULPA 4MNOA 3F2DA 4PZ8A 2QA4A 4BA1I 1S3OA 1KRTA 1HZCA 2XTIA 2C35B 3EN2A 1HR0Q 2GVAA 1H95A 5BR8Q 1KQSA 2MQHA 1EOVA 1EIYB 1EQQA 3GTKH 2NVXH 2IHEA 2Y0SE 3UDXA 3G71A 2OCEA 4LNQA 2ATWA 1AH9A 4DV4L 4POGA 4RMFA 3TREA 5FLMG 1X54A 1TWHH 4LFBQ 2DGYA 3TRZA 1OXUA 4R4TA 1I6HH 3F8TA 5GROA 2D62A 4APVA 2KENA 2L15A 2RCNA 1Q1EA 1X56A 4BY7G 4OWXB 1QUQB 2K75A 1N8RC 4DR6L 4A3CH 2ZTDA 2ZM6L 4DR3L 3ULLA 4DUYQ 4X64L 2KCTA 4DV2Q 4GKJQ 1Y1VH 1HR0W 3GTOH 2QGQA 1N32Q 2DUDA 3HOWG 1FVIA 4DUZL 2JE6I 1OXXK 4OONA 4B3TQ 3TEHB 1E3PA 2RF4A 3B6YA 3KDFB 4B3TL 4JI3L 2VUMH 3HOYG 1PH1A 4X66Q 2LSSA 3RZDH 3RN5A 3G6EA 1E1OA 3I7FA 3H15A 1A8VA 2K5HA 1XNRQ 2ALYB 1EQRA 4OWWB 3GTQH 4JV5Q 1N33Q 3RLFA 3CCUA 3M3YH 1VQJA 4BXXG 4DV7L 1A63A 1Z9FA 4O2DA 3CMEA 2R92H 1HH2P 1PH3A 4AIMA 3BZCA 1Y1VG 4JI8Q 1GVPA 4GOPA 3L0OA 4DNIA 3L2PA 3U4ZA 2R7ZG 1K83H 2YTXA 4JC0A 5IYBH 1PA6A 1UWVA 5K36G 1NMFA 4EX5A 1CUKA 4MZ9A 4JBJA 3EBEA 5HY6A 4R1JA 3G48A 4TVAB 4LF7L 3PV0A 1X9NA 5BR8L 5LMUQ 4DK6C 5JJLA 1BVSA 4MTNA 2UXBL 3PUVA 2Q2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQ5 A;  4UP9 A;  4DR5 Q;  4DV6 L;  4IFD G;  4A3G G;  1JJC B;  1AE3 A;  1OTC A;  2VQF Q;  4JI7 Q;  2E5L L;  4DR4 L;  4NB3 A;  3K81 C;  3KYH C;  4X65 Q;  4YCW A;  4YHH Q;  1JB7 A;  4DV0 L;  1HNX Q;  1Q7Y C;  2I5M X;  2YV5 A;  1X3E A;  1WYD A;  2OQK A;  4GN3 B;  2R7F A;  4KHZ A;  1TWG H;  1Q1B A;  5AJ3 Q;  2UUA Q;  4LFB L;  2BA1 A;  1Z47 A;  2UU9 L;  4JYA L;  4LF4 Q;  2IT1 A;  3CC7 A;  1PH7 A;  1K0R A;  1E22 A;  1B70 B;  1EUJ A;  1V1Q A;  1VQB A;  3WWV A;  2UU9 Q;  4LF8 Q;  1QVF A;  2CFM A;  3PO3 G;  2PMZ E;  2ID0 A;  2R7D A;  2WAQ G;  4GS3 A;  4A3E G;  1YVC A;  2RHS B;  1LYL A;  2GVB A;  4JBK A;  3CCL A;  4LF6 L;  4KLK A;  4WJ4 A;  3JC6 6;  1V9P A;  3AYH B;  4WJ3 M;  5C4X G;  4C3I H;  1VQP A;  4IJL A;  2UXC L;  4DV7 Q;  5LMN Q;  2JA7 H;  5IP9 G;  1KXL A;  4Y7N H;  1KL9 A;  3J80 c;  3HOX H;  3CCV A;  2HIX A;  1YIT A;  1N33 L;  1J5E Q;  1G51 A;  1GKH A;  2KBN A;  4UP8 A;  3S24 A;  1YJ9 A;  4GLV B;  1XPR A;  1PH9 A;  1XNR L;  3DLL A;  3HOY H;  4IPG A;  3UDF A;  4A3K G;  4X66 L;  4BY1 H;  2NN6 I;  1S40 A;  1YJN A;  4HJ5 A;  1SRO A;  4JV5 L;  2WAQ E;  4P72 A;  3M4Q A;  1KIX A;  4JCV E;  1T9H A;  3H0G G;  1QUQ A;  1GM5 A;  1VQ8 A;  4JI5 L;  2H5X A;  1MJE A;  1PVO A;  5IYD H;  5M3F H;  4YWL A;  5C4X H;  3S15 H;  4IPH A;  1Q82 C;  1U0L A;  5C0X J;  2MO0 A;  4P73 A;  3AFP A;  3UDG A;  3S2D H;  1Q46 A;  2AHO B;  1E24 A;  2K50 A;  2KHJ A;  1U5K A;  1XPU A;  3FKI H;  2VQF L;  2N3S A;  3VDY A;  3OYY A;  3I55 A;  2VW9 A;  4DV3 Q;  3KDF A;  3W5O A;  3J81 c;  1PFS A;  3KJO A;  4DV6 Q;  4YY3 L;  3HOX G;  2B3G A;  3RLN A;  1L1O C;  2JQO A;  3HFZ B;  2A1A A;  3M9B A;  2UXD Q;  4DR6 Q;  5AJ3 L;  2VNU D;  4YWM A;  2UUC Q;  1XNQ L;  3U58 A;  4XTC S;  1YIJ A;  1UE7 A;  5C4J H;  4A75 A;  4A76 A;  3PUW A;  3AFQ A;  3GTM H;  1RIP A;  4LUV A;  2HHH L;  4YHH L;  1DGS A;  3J81 i;  4A3G H;  1IBL Q;  2ZTE A;  1SE8 A;  4JI1 L;  5JEA J;  5M3F G;  3BU2 A;  1N9W A;  1PH2 A;  3PGZ A;  4JI6 Q;  1VQC A;  2YYZ A;  4A3M G;  3S1M H;  3H0G H;  1XMQ Q;  5JJK A;  1A62 A;  3KJP A;  4DR1 Q;  1Y1W H;  4A3D G;  2ZJP A;  2F52 A;  2RHQ B;  1KD1 C;  2HHH Q;  4NXN L;  4JI1 Q;  4JI6 L;  3SGI A;  1VQO A;  5IE8 A;  2K4K A;  2CWP A;  3J7Z C;  1X3G A;  5IYC G;  1L1O B;  1IXR A;  1PHJ A;  2FXQ A;  3T1Y L;  4UY8 C;  2Z6K C;  2Q2I A;  3DM3 A;  4LF9 L;  3I4N H;  4YCU A;  1YNX A;  2MNA A;  4JI0 L;  1CKO A;  3KFU A;  3PCO B;  1X3F A;  4P75 A;  4AYB G;  1XMO L;  3CCR A;  1CSQ A;  4DV1 Q;  1NJI C;  2N8N A;  2N49 A;  1CKM A;  2WFW A;  1XPO A;  4DAM A;  1QZH A;  4B3M L;  3GTP H;  4QQB X;  3RN2 A;  1J5E L;  2F3I A;  5GAG C;  3GTJ H;  4GLA C;  3PF5 A;  1VQA A;  1SMX A;  1VQM A;  5IYB G;  2ZTC A;  4JI8 L;  4BBR H;  2R7Z H;  3HKS A;  1KC8 C;  4ALP A;  3T1H Q;  1VQH A;  2VQE Q;  4B3M Q;  5LMU L;  2VZA A;  1O7I A;  1OXT A;  5M5W H;  4DR7 L;  4KHP L;  2D0O A;  5IP7 H;  5FJ8 G;  3M4O H;  2PNH A;  3ERS X;  4AYB E;  5IYC H;  2VQE L;  1B8A A;  2E2I H;  5GAD C;  1Q8K A;  1JJG A;  4R4O A;  1YZ6 A;  5GQO A;  2D0P A;  4DV4 Q;  4JOI C;  1B7Y B;  2JA6 H;  2JK8 A;  5M5Y H;  4A3B H;  1EFW A;  1WCM H;  1JMC A;  3EIV A;  4LWC A;  4DV5 L;  3I4O A;  3LGJ A;  4JYA Q;  3S1Q H;  2XGT A;  1IBL L;  4IPC A;  1I5F A;  2NN6 G;  4OX9 Q;  1BBW A;  1JJ2 A;  5JEA G;  4BY7 H;  1YJW A;  3I4M G;  1L2F A;  5C3E H;  3AQQ A;  1KHI A;  1TXY A;  1UE5 A;  1YHA A;  4LW1 A;  4NXN Q;  1VQG A;  4JI2 Q;  2ASB A;  5IYD G;  2B63 H;  3OTO L;  2YTY A;  1SLJ A;  4LFC L;  3U4V A;  2JA6 G;  1VQE A;  3HOU H;  1VQL A;  4LFC Q;  2OTL A;  1VQ7 A;  3S17 H;  2UXC Q;  5H1S E;  4QL5 A;  4C3J H;  2BH2 A;  5J3B A;  4KI0 A;  3RLO A;  1HNW Q;  1N36 Q;  3ULJ A;  4BBS H;  2V1C C;  4IPD A;  1G29 1;  2Y0S G;  4IJH A;  1D8L A;  4BY1 G;  2VS1 A;  1IZ6 A;  4GNX B;  4K0K L;  2JA8 G;  4HID A;  1M1K C;  4LF5 Q;  4DKA C;  3CCE A;  1UE6 A;  4GLX A;  1KRS A;  3L7Z C;  2A19 A;  4ME3 A;  3CPW A;  1Q86 C;  3I4M H;  4KHP Q;  3OW2 A;  5M3M G;  5M3M H;  3F2B A;  1E7Z A;  3T1H L;  3CQZ H;  1N34 L;  3D0F A;  3NEN A;  1PYS B;  5C3E G;  4A3F H;  1NMG A;  1CSP A;  4A3J H;  1CKN A;  3KF8 B;  4DV3 L;  2OTJ A;  1WOC A;  1K8A C;  4IFD J;  3A0J A;  1L1O A;  4PZ6 A;  5ELN A;  4HJ7 A;  5ELO A;  3I4N G;  2PQA A;  1GD7 A;  2CWA A;  4DAY B;  3E9I A;  4DPG A;  1VQ6 A;  1HZB A;  4RG1 A;  2LXK A;  1I3Q H;  1AE2 A;  4JG2 A;  3RZO H;  3PUY A;  3JAM c;  1LTL A;  1JE5 A;  2AWN A;  3A5Z B;  1VQF A;  3HKZ G;  3J80 i;  2NVT H;  3E0E A;  1WFQ A;  2N78 A;  4X64 Q;  4DV2 L;  4DR2 L;  4BBR G;  4QY7 A;  1FGU A;  3H3V H;  2I5L X;  1YBY A;  1HJP A;  4A3J G;  3PUZ A;  3M85 A;  3UE1 A;  3KOJ A;  5IWA Q;  3CW2 C;  3BJU A;  4DR1 L;  3HOU G;  3CXC A;  4OXP A;  3FHW A;  1XMQ L;  3PF4 A;  2VL6 A;  3FP9 A;  1FL0 A;  1IBM L;  4HIM A;  3CP0 A;  3K7U C;  2JJQ A;  5LMN L;  4HJ8 A;  4YWK A;  3STB C;  2A8V A;  4JI3 Q;  3CMA A;  4L5S A;  4R4Q A;  2JA9 A;  1FJG Q;  1TWA H;  3UDI A;  4PG3 A;  3PIP A;  1A0I A;  1XJV A;  3ICE A;  2CQO A;  3GTL H;  5IT9 c;  1JT8 A;  1X55 A;  1VQ4 A;  2R92 G;  2AWO A;  2HIV A;  3PUX A;  4UP7 A;  1EWI A;  4NXM Q;  1R9T H;  3PIO A;  2WB1 G;  4DV1 L;  5C0X G;  2NVY H;  4LFA Q;  1IBK Q;  1PH4 A;  3HOV H;  5IY0 A;  1VS0 A;  2E2H H;  4H02 A;  5IP7 G;  5FJ8 H;  2B63 G;  1OXV A;  3U50 C;  1EIF A;  1RL2 A;  1KAW A;  1YHQ A;  2JEB I;  3RR5 A;  2JA7 G;  4JOI A;  1L0W A;  1IL2 A;  3S1N H;  3CAM A;  3ZJY C;  3W1B A;  4A3I G;  2E2J H;  5JJI A;  3JAM i;  1GO3 E;  3J81 j;  3GTG H;  1BKB A;  2WB1 E;  1IYJ B;  4QIW E;  4A3L G;  5C44 G;  4L5Q A;  1MJC A;  5C0X I;  1HNZ L;  1QVG A;  4GKJ L;  1WCM G;  3H3V I;  4GNX A;  2K14 A;  3G4S A;  2ZM6 Q;  4DR3 Q;  2UUB L;  3HOV G;  4GKK L;  1NBW A;  2EIF A;  2R6G A;  1LUZ A;  2IX0 A;  4OX9 L;  4A3L H;  2Q2H A;  3TS0 A;  5E7N A;  4LF8 L;  1N32 L;  1VQN A;  1MIU A;  1SFO H;  4GN4 B;  4JI2 L;  1CKN B;  3CC2 A;  4POF A;  4HIO A;  4J15 A;  5IP9 H;  2PQA B;  4UPA A;  2WP8 J;  5GAH C;  1XMO Q;  2R93 G;  4O0A A;  2NZO A;  4TQU S;  2ZJR A;  4A3K H;  4BA2 I;  3CPF A;  3CCQ A;  3K8A A;  3CF5 A;  1EYG A;  1UEB A;  4JI5 Q;  4LF9 Q;  4JI0 Q;  3CC4 A;  4A3B G;  1SN8 A;  3PO2 H;  2PI2 A;  5DLQ E;  3S2H H;  1PH5 A;  4DR7 Q;  2IHF A;  1VQ9 A;  1WI5 A;  2K5N A;  1IBK L;  2OWO A;  4LF7 Q;  4LFA L;  4OO1 I;  3ER0 A;  4L5R C;  4QJF A;  1C0A A;  1Q81 C;  4NXM L;  4HJA A;  3A5U A;  3I56 A;  3UE0 A;  3CCS A;  3S14 H;  1QZG A;  4A3D H;  3E9H A;  3CD6 A;  2HT1 A;  2UXB Q;  4BBS G;  1N34 Q;  1HZA A;  2MFI A;  2K52 A;  2AMC B;  1HR0 L;  2LXJ A;  2QEX A;  2IX1 A;  2HQL A;  3D31 A;  2Q2U A;  1VQK A;  4A4I A;  2Z0S A;  3M4P A;  5GAE C;  2F4V Q;  1ASY A;  4X62 L;  4YY3 Q;  1G6P A;  2JA5 H;  1HNZ Q;  2UUA L;  3KF6 A;  4DV0 Q;  1HNX L;  4JBM A;  1NTG A;  4A3C G;  4DR4 Q;  2UUB Q;  3I2Z A;  4YCV A;  1QVC A;  4NPS A;  4X65 L;  1Y14 B;  2MO1 A;  3K7A H;  3KLW A;  1I50 H;  4L5T A;  4DUZ Q;  3MEF A;  3HKZ E;  1YHB A;  1NE3 A;  4IO9 A;  1C7Y A;  3HOZ G;  3TQY A;  3HOZ H;  1K3R A;  2NZH A;  2YTV A;  4DK3 C;  3OTO Q;  4DUY L;  2KHI A;  3MXN B;  2BA0 A;  1J6Q A;  5EAY A;  5HGQ A;  4LF6 Q;  2JEA I;  3PO3 H;  4JI4 L;  1HZ9 A;  4JI4 Q;  1C9O A;  2CKZ B;  1SRU A;  4B3S L;  3J7A 5;  4B3R Q;  1HNW L;  1PH8 A;  1BBU A;  1IBM Q;  2JA5 G;  3S16 H;  4BXX H;  4OWT B;  1Q12 A;  4AQY L;  4P74 A;  3STB D;  1VCI A;  1OXS C;  1TWF H;  2K5V A;  1YEZ A;  4GOP C;  3NEL A;  4LUZ A;  2NVQ H;  1Y1W G;  2ES2 A;  4PZ7 A;  1P8L A;  1N36 L;  5LMN W;  1P16 A;  2VY3 A;  4A3M H;  1SR3 A;  3NEM A;  3PSI A;  4XIG S;  3S1R H;  4A3E H;  2F4V L;  3RNU A;  1K8G A;  2B29 A;  1M90 C;  1I94 Q;  2KCM A;  2EXD A;  1MKH A;  4R4I A;  1NY4 A;  4X6A H;  2UUC L;  1XNQ Q;  1D7Q A;  3K80 C;  2AKW B;  4GN5 A;  4JI7 L;  4IFD I;  4DV5 Q;  4JBW A;  5M5X H;  3FKI G;  2E5L Q;  1UE1 A;  4AH6 A;  1WJJ A;  4DR5 L;  3TS2 A;  4FDB A;  2PI2 E;  1TWC H;  4OO1 G;  3CCM A;  4R4C A;  2CCZ A;  5FLX c;  1YI2 A;  4C3H H;  4GOP B;  2UXD L;  2I5H A;  4QGU A;  4HJ9 A;  1W2B A;  1PH6 A;  4C2M H;  3A74 A;  1V43 A;  4LUO A;  3HOW H;  4IOA A;  3IRB A;  2BH8 A;  4DR2 Q;  1K9M C;  4GKK Q;  3M7N A;  4X62 Q;  4P71 A;  4A93 H;  2ZJQ A;  4LF4 L;  2EQS A;  1LM0 A;  2E8G A;  2OQ0 A;  1VQI A;  4PMW A;  1ASZ A;  2VUM G;  3F2C A;  4A3F G;  3T1Y Q;  1PV4 A;  4B3S Q;  3W1G A;  3GD7 A;  1VQD A;  5IWA L;  4GNX C;  3BZK A;  3Q8D A;  3K0X A;  3GDE A;  2I0Q A;  1S72 A;  1X65 A;  4Y52 H;  2IY5 B;  1E1T A;  2GN5 A;  5FLM H;  2YU9 H;  4A3I H;  2Z6K A;  3GO5 A;  2R93 H;  4AQY Q;  1PYB A;  1XTD A;  3CCJ A;  2JA8 H;  5C44 H;  3PO2 G;  4IOC A;  3AEV A;  4B3R L;  1FJG L;  4K0K Q;  1VQ5 A;  4A93 G;  1X6O A;  3F1Z A;  4HIK A;  3KF6 B;  1W3S A;  1I94 L;  3NBH B;  1K73 C;  4LF5 L;  3ULP A;  4MNO A;  3F2D A;  4PZ8 A;  2QA4 A;  4BA1 I;  1S3O A;  1KRT A;  1HZC A;  2XTI A;  2C35 B;  3EN2 A;  1HR0 Q;  2GVA A;  1H95 A;  5BR8 Q;  1KQS A;  2MQH A;  1EOV A;  1EIY B;  1EQQ A;  3GTK H;  2NVX H;  2IHE A;  2Y0S E;  3UDX A;  3G71 A;  2OCE A;  4LNQ A;  2ATW A;  1AH9 A;  4DV4 L;  4POG A;  4RMF A;  3TRE A;  5FLM G;  1X54 A;  1TWH H;  4LFB Q;  2DGY A;  3TRZ A;  1OXU A;  4R4T A;  1I6H H;  3F8T A;  5GRO A;  2D62 A;  4APV A;  2KEN A;  2L15 A;  2RCN A;  1Q1E A;  1X56 A;  4BY7 G;  4OWX B;  1QUQ B;  2K75 A;  1N8R C;  4DR6 L;  4A3C H;  2ZTD A;  2ZM6 L;  4DR3 L;  3ULL A;  4DUY Q;  4X64 L;  2KCT A;  4DV2 Q;  4GKJ Q;  1Y1V H;  1HR0 W;  3GTO H;  2QGQ A;  1N32 Q;  2DUD A;  3HOW G;  1FVI A;  4DUZ L;  2JE6 I;  1OXX K;  4OON A;  4B3T Q;  3TEH B;  1E3P A;  2RF4 A;  3B6Y A;  3KDF B;  4B3T L;  4JI3 L;  2VUM H;  3HOY G;  1PH1 A;  4X66 Q;  2LSS A;  3RZD H;  3RN5 A;  3G6E A;  1E1O A;  3I7F A;  3H15 A;  1A8V A;  2K5H A;  1XNR Q;  2ALY B;  1EQR A;  4OWW B;  3GTQ H;  4JV5 Q;  1N33 Q;  3RLF A;  3CCU A;  3M3Y H;  1VQJ A;  4BXX G;  4DV7 L;  1A63 A;  1Z9F A;  4O2D A;  3CME A;  2R92 H;  1HH2 P;  1PH3 A;  4AIM A;  3BZC A;  1Y1V G;  4JI8 Q;  1GVP A;  4GOP A;  3L0O A;  4DNI A;  3L2P A;  3U4Z A;  2R7Z G;  1K83 H;  2YTX A;  4JC0 A;  5IYB H;  1PA6 A;  1UWV A;  5K36 G;  1NMF A;  4EX5 A;  1CUK A;  4MZ9 A;  4JBJ A;  3EBE A;  5HY6 A;  4R1J A;  3G48 A;  4TVA B;  4LF7 L;  3PV0 A;  1X9N A;  5BR8 L;  5LMU Q;  4DK6 C;  5JJL A;  1BVS A;  4MTN A;  2UXB L;  3PUV A;  2Q2T A; 
#chains in the Genus database with same CATH topology
 4YHH H;  4EQ5 A;  4KTA A;  1JJC B;  1AE3 A;  1OTC A;  1KAB A;  2E5L L;  2UVW A;  3KYH C;  1KJI A;  2FPP B;  4DV0 L;  1JKJ B;  4FM9 A;  1HNZ H;  4LF4 H;  2YV5 A;  3KUP A;  2BE5 C;  1X3E A;  4G4K A;  1IKM A;  3RB6 A;  1WYD A;  3ONA B;  2R7F A;  1TWG H;  4LFB L;  2BA1 A;  1JC7 A;  1PH7 A;  1K0R A;  1V1Q A;  1VQB A;  5C5M A;  1DCZ A;  2W9C A;  1QVF A;  1KDA A;  3T5H A;  4A3E G;  1YVC A;  1VDZ A;  4LF6 L;  1AH9 A;  3AYH B;  5LL6 S;  4C3I H;  3C1E A;  4IJL A;  5C5J A;  1V8Q A;  4Z9C B;  4DR3 H;  3EQL C;  3I70 A;  2JA7 H;  3N6R A;  4Y7N H;  3J80 c;  3CCV A;  2W6N A;  2HIX A;  1YIT A;  3KAK A;  4H0L C;  4JV2 A;  5IOC A;  1G51 A;  1SJH D;  1ONL A;  1PH9 A;  4A3K G;  2EZV A;  1S40 A;  2DLN A;  5M9O A;  3D4D A;  4RUC A;  1WTX A;  2KQ3 A;  4JCV E;  2O5J C;  1C4Q A;  4ZUI A;  3H4B A;  1KJ9 A;  2JA8 B;  1GM5 A;  2E2H A;  4JI5 L;  2H5X A;  1MSG A;  3BAA A;  1U0L A;  2LMC B;  2MO0 A;  3DEO A;  4MTD A;  3D3R A;  2AHO B;  1E24 A;  3OHX C;  5K36 H;  4TKO B;  2VW9 A;  2F4V L;  3KJO A;  1NNX A;  3P20 A;  2JQO A;  1TWA B;  2FE3 A;  1CK1 A;  2IWH A;  3T16 A;  1G2T A;  4YWM A;  4DV3 H;  2UUC Q;  1QOH A;  1B2T A;  3SE0 A;  5KG3 A;  2F0J A;  2VQE H;  4LUV A;  2R7N A;  2KEE A;  2C28 A;  2AGO A;  3K3V A;  1IBL Q;  2ZTE A;  4JI1 L;  1JIH A;  3NUC A;  5KFK A;  5LHY 1;  5M5W B;  1XMQ Q;  3JAM L;  3TQT A;  1A2U A;  2WKD A;  3KJP A;  2PZW A;  5ELB A;  4KHV A;  4JI6 L;  5CV6 A;  1UC8 A;  4DNT B;  2K7V A;  4L1K A;  3KF8 A;  2K4K A;  1X3G A;  1SXT A;  1L1O B;  5IYC G;  2HJW A;  5J2T F;  1G8Z D;  4A3J B;  4DL5 A;  2RGR A;  4HNV A;  3DM3 A;  4LF9 L;  1A2T A;  1U4L A;  3KFU A;  3WO0 A;  4I7A A;  3TII A;  1X3F A;  4KY5 A;  1EHI A;  1I6U A;  2N8N A;  2R7Z B;  3EPI A;  3I3C A;  1QZH A;  5NUC A;  4K0K H;  5GAG C;  2K1B A;  5DQI A;  4DL2 A;  3V6K A;  4IRC A;  4NXN H;  2UUC H;  2XCL A;  4JI8 L;  4BBR H;  1AN7 A;  3HKS A;  1ULZ A;  1VQH A;  4KY6 A;  4R8N A;  2VQE Q;  4M9U A;  3SXH A;  2VZA A;  2K01 A;  1WSC A;  4JK1 C;  2PVP A;  1OXT A;  1B1Z A;  4FS2 A;  4KKS A;  2NU7 B;  3ERS X;  1SYB A;  1B8A A;  3EPG A;  1KC7 A;  1U4P A;  5GAD C;  2QF7 A;  4Y8V B;  1SYF A;  4HSP A;  3IG0 A;  4DV4 Q;  2D0P A;  2E2I A;  1MGS A;  1JR0 D;  1EL0 A;  2VR1 A;  2AQ3 B;  4MA0 A;  4DXG A;  2CHB D;  4Q0F A;  4ECV A;  1JMC A;  5LP6 F;  3EIV A;  4DV5 L;  3FDS A;  4ME6 A;  1YNN C;  3LGJ A;  4J1M A;  3UFX B;  2W9B B;  1IBL L;  5KFA A;  2NN6 G;  2Y0S A;  2NWG A;  4BY7 H;  3I4M G;  1L2F A;  2A73 B;  3HOV B;  2VA2 A;  2B2U C;  4NXN Q;  2I07 B;  5M3M B;  4LMY A;  1D6E C;  4I7H A;  1ICW A;  4U68 A;  4LFC Q;  3S2D B;  2UXC Q;  4OGQ C;  5J3B A;  1N33 H;  3RLO A;  1EY0 A;  3DXJ C;  3ULJ A;  2V1C C;  3KXY T;  2K28 A;  5C1P A;  2VS1 A;  4G57 A;  3M4I A;  4F50 A;  4OO1 H;  1KRS A;  3BDO A;  4ME3 A;  3TME A;  1Q86 C;  4MV1 A;  3P7J A;  2HCI A;  4ZQ3 A;  2A74 C;  2FMA A;  5M3M G;  5M3M H;  1PTO C;  4ZKC B;  1E7Z A;  3CQZ H;  4ECX A;  5C3E G;  2EDG A;  2W57 A;  5KFG A;  4N8X 1;  2OTJ A;  1WOC A;  1K8A C;  4HJ7 A;  1L1O A;  1DV1 A;  1EWH A;  2PO4 A;  3I4N G;  3OUZ A;  3E9I A;  4HMJ A;  2XIG A;  2VUG A;  2W6M A;  2R87 A;  1BBX C;  5D1O A;  1QG7 A;  2RDG A;  2XNA C;  1I3Q H;  1PXU A;  5E4X A;  1E4E B;  5KG5 A;  2VOB A;  5CMD A;  1ROD A;  3J80 i;  2WYO A;  2I8C A;  4IUQ A;  2D5D A;  2N78 A;  3GV6 A;  3R2T A;  2NU6 B;  3GTK A;  4BBR G;  1HJP A;  2BDO A;  3M85 A;  4DR1 L;  4ZRZ A;  3FDT A;  1E4F T;  1O7Z A;  2O4X A;  4OXP A;  3HEJ A;  2PN1 A;  1FL0 A;  1SDF A;  3CP0 A;  5LMN L;  3R23 A;  4YWK A;  4X3S A;  2FKL A;  1TWA H;  4PG3 A;  1AP0 A;  1GUN A;  1TA8 A;  1G6Z A;  4AQY H;  3FPU B;  2CQO A;  1LTI D;  4BY1 B;  2WB1 G;  4YJ2 F;  5C0X G;  3A54 A;  3VPB A;  4JI7 H;  5A35 A;  3HOV H;  3Q0A A;  3MWY W;  4JUZ A;  3D8G A;  5JEA H;  4K2L A;  1KAW A;  1CQF A;  1YHQ A;  3RR5 A;  4EYI B;  4EEQ A;  4YR0 A;  2XN9 C;  3CAM A;  3ZJY C;  5CBE E;  5I9O A;  5KFL A;  3J7A V;  1A3T A;  1TWC A;  4HAE A;  3JAM i;  4IRK A;  1BKB A;  5C44 G;  1EWC A;  1F2Y A;  1QVG A;  4ECU A;  2K14 A;  3G4S A;  3LP8 A;  1BJT A;  1NBW A;  2J6U A;  3N42 B;  2IX0 A;  3OW7 A;  3KAL A;  1QE6 A;  5IGD A;  5A2Q E;  2A68 C;  1JWM D;  4M8A A;  1N32 L;  5ELE A;  1VQN A;  3I90 A;  1ZQ7 A;  1M8A A;  4FNF A;  1SFO H;  4GN4 B;  4JI2 L;  2NVX B;  3CC2 A;  5I9P A;  1G91 A;  4J15 A;  1KDC A;  2EOT A;  3FPP A;  2J6S A;  4Q5V A;  4OEL B;  2R86 A;  1EY7 A;  3NQT A;  3SHL A;  3ZYY X;  4DV1 H;  4DU9 A;  1UEB A;  4JI5 Q;  4JI0 Q;  3CC4 A;  2B2T C;  4RB2 C;  2VB2 X;  2FIN B;  3J80 E;  3BVM A;  3QOL A;  3HZX A;  2PZT A;  4DR7 Q;  3BQ2 A;  1DOK A;  2K5N A;  1ENC A;  2OWO A;  2PNR C;  3GTK B;  2FB9 A;  4L5R C;  1PZI D;  5JVG 3;  1SCU B;  2AGQ A;  4B9X A;  2EYJ A;  3PW7 A;  1Q81 C;  1HFG A;  1D2B A;  3CCS A;  3UE0 A;  5KX5 F;  5FK9 C;  4PMC A;  1BOS A;  5DNF A;  1NCV A;  4EYH B;  3I4M B;  2UXB Q;  4NW2 A;  4R8I A;  2K5Q A;  1EQT A;  4J6H A;  1HZA A;  4PV1 C;  2AMC B;  2IX1 A;  3TBI B;  3D31 A;  2Q2U A;  5BMV F;  1WH2 A;  3BYT B;  2JA7 B;  1EY4 A;  4IUT A;  1IYU A;  1VF5 C;  5JJZ A;  5GAE C;  5JH7 F;  4DR4 H;  3CQZ A;  4A3I B;  2FLN A;  1G6P A;  1CZG A;  5KFE A;  4CC6 A;  3KF6 A;  1HNX L;  2EJM A;  3NBI A;  3MJF A;  2EJF C;  4YCV A;  4NPS A;  3OTO H;  1R4P B;  1EOT A;  3VYR A;  4RNN A;  3K7A H;  5KFN A;  1I50 H;  4DUZ Q;  4J9L A;  1HTL D;  3A7A B;  3M3Y B;  2M05 A;  1NE3 A;  2UUB H;  3TQY A;  5IYZ F;  1F9S A;  2W7P A;  4DN4 M;  1IBL H;  1S5B D;  1HZ9 A;  1SE4 A;  2F0N A;  2EYP A;  4DK1 A;  5KRU A;  4JI4 Q;  1HNW L;  4B3R Q;  1K0S A;  1GSA A;  1L0Y B;  2F0Q A;  1S0O A;  1IBM Q;  3GIM A;  2WII B;  3S16 H;  1TWC B;  4OWT B;  2QCP X;  5D65 A;  2X6L A;  2L4N A;  2K5V A;  4GOP C;  1QB5 D;  3NEL A;  1I4Q A;  3RBD A;  4TQR A;  2RDJ A;  1N36 L;  5LMN W;  3VYU A;  2WAQ B;  1VKZ A;  1P16 A;  4LAA A;  3C1F A;  4C5A A;  1CTM A;  2DIK A;  4XIG S;  3RNU A;  1K8G A;  1I94 Q;  1UC9 A;  4EBC A;  4IUP A;  2KCM A;  1LTR D;  2X6G A;  2XGP A;  2KEC A;  2R7M A;  4FO2 A;  4KK7 A;  3TS2 A;  4JBW A;  1M7J A;  3FKI G;  2E5L Q;  3MXP A;  4DR5 L;  1K83 A;  3K58 A;  5CC4 A;  4ZAI A;  4J9O A;  2CCZ A;  3NE5 B;  4C2M H;  1V43 A;  4IOA A;  2KUM A;  2F0F A;  4GKK Q;  1JX4 A;  4X62 Q;  4A93 H;  2ASL A;  3DUZ A;  4LF4 L;  1N36 H;  4RCO A;  3F2C A;  2RCF A;  2YZN A;  4A3F G;  1A9X A;  3G6X A;  1SFO A;  3QG1 A;  4B3S Q;  3W1G A;  4DK0 A;  5C8Y F;  1LT6 D;  4QF4 A;  5IWA L;  3BZK A;  3Q8D A;  3K0X A;  5CV4 A;  2WKC A;  2AQ2 B;  4RHR A;  2RQX A;  2IY5 B;  2GN5 A;  5FLM H;  3JRX A;  5M3F B;  1PYB A;  1S68 A;  4ZQI A;  1NSN S;  3K5O A;  4DUY H;  3PZP A;  1A6X A;  4XQJ A;  1UNS A;  1EQV A;  4IHJ F;  5K2M A;  5KFB A;  1X6O A;  4HIK A;  1I94 L;  2W9C B;  2VQD A;  5BR8 H;  4MNO A;  1STG A;  2N88 A;  1PTO D;  4BA1 I;  1S3O A;  4QWC A;  1HZC A;  5E3F A;  2XWJ B;  5JVD F;  2MQH A;  1EIY B;  1EQQ A;  3K5L A;  4BWS C;  2IHE A;  2Y0S E;  3UDX A;  1TAE A;  4DAV A;  2ATW A;  2OCE A;  4LNQ A;  2W71 A;  3M9N B;  4HSV A;  2CQY A;  3TP5 A;  4A2A A;  3WOF A;  3N40 P;  3MFH A;  2F3V A;  4RGM A;  3TRE A;  4IAJ A;  5IWA H;  3VMM A;  4NMZ A;  1ZXT A;  3S1R B;  4LFB Q;  2HQE A;  1H9R A;  3F8T A;  2L15 A;  1CT1 D;  3VYS A;  4BY7 G;  1QUQ B;  2K75 A;  2EYF A;  2ZTD A;  5ELD A;  3HOZ B;  4I4T F;  1PRT B;  5CR3 A;  2B2Y A;  1XDN A;  4B3T H;  1Y1V H;  3GTO H;  2L9H A;  5JQW A;  2BQR A;  1N32 Q;  1YNJ D;  5KFV A;  2ATL A;  1JXL A;  2ZDQ A;  4ED8 A;  2RF4 A;  3B6Y A;  3KDF B;  3HOY G;  3GTM A;  1PH1 A;  4X66 Q;  3JRW A;  5KNB A;  3RZD H;  1ENF A;  3G6E A;  1Z7T A;  1XNR Q;  4OIJ A;  3K5H A;  1EYC A;  5KFJ A;  4OWW B;  1V4Y A;  1HUM A;  3RLF A;  2WB1 A;  3CCU A;  4BXX G;  4C2M B;  1SYD A;  4MV9 A;  3SK4 A;  2TSS A;  2WAC A;  3CME A;  2R92 H;  5KFO A;  3BZC A;  1Y1V G;  4AYB B;  2OEO A;  4JI8 Q;  5KT3 A;  2OF1 A;  4KJN A;  2FLP A;  3K5I A;  2F0E A;  2FJZ A;  3NTI A;  3Q8Q B;  1JOR A;  3HBL A;  4QIW A;  4EX5 A;  1CUK A;  4JBJ A;  5EDW A;  1K8O A;  2EY1 A;  4TVA B;  3CRK C;  3ND9 A;  4O3P A;  5L1K A;  1PRT F;  4DK6 C;  5LMU Q;  1BVS A;  2BCO A;  4JPB W;  2UXD L;  1NR2 A;  3NTH A;  4DV6 L;  4IFD G;  1RTO A;  1Z2N X;  1Y1V B;  2VPQ A;  2R7Z A;  2QDL A;  2VQF Q;  1EIG A;  2ALZ A;  4NB3 A;  3K81 C;  1RCV D;  1JB7 A;  4YCW A;  2AUJ D;  5EKK A;  1Q7Y C;  3TP6 A;  5HGT A;  4FU0 A;  2BQU A;  2OQK A;  3I4L A;  2VUM B;  4KHZ A;  4X65 H;  2UU9 L;  4V19 0;  4JYA L;  4LF4 Q;  1E22 A;  3L3O C;  2UU9 Q;  3OIP A;  3PO3 G;  2PMZ E;  2ID0 A;  1E0B A;  2R7D A;  4GS3 A;  1LYL A;  3R93 A;  4KLK A;  3JC6 6;  4WJ3 M;  3N52 A;  4CKE A;  1Y8N B;  5E1F A;  3KHH A;  1RF2 D;  4DV7 Q;  1SYX B;  4EGQ A;  3T5J A;  2ASJ A;  2XGQ A;  3PO2 B;  1J5E Q;  4HED A;  1J9O A;  1STY A;  1IHZ A;  2KBN A;  1YJ9 A;  3HOY H;  1RYR A;  3TRZ A;  3J7A F;  2UVV A;  3DLL A;  3UDF A;  4ZK9 B;  1DOL A;  1VAJ A;  5LMU H;  1YJN A;  4UCO A;  5FO9 B;  2Q8I B;  1T9H A;  3H0G G;  1GSO A;  1PK8 A;  1VQ8 A;  1M0T A;  1PVO A;  5M3F H;  1SJE D;  4YWL A;  5C4X H;  3G8C A;  1T5E A;  1Q82 C;  1LV9 A;  4R8U B;  1BDO A;  2RDH A;  3UDG A;  3S17 B;  1B50 A;  3T5K A;  3QR8 A;  2K50 A;  2KHJ A;  1U5K A;  1XPU A;  3VDY A;  4O4H F;  3OYY A;  5KKN B;  2FPI B;  3RB3 A;  2XWB B;  3GTL B;  4YY3 L;  2B3G A;  3PIO 3;  4ECS A;  4DR6 Q;  5AJ3 L;  4XTC S;  1WTR A;  4LF6 H;  4YHH L;  1DGS A;  5M3F G;  4JI6 Q;  2F0V A;  5JEA J;  1N9W A;  1WTV A;  3ERO A;  2YYZ A;  3S1M H;  1SEI A;  5JJK A;  4C3H G;  3NK9 A;  4DR1 Q;  2WE6 A;  2XRQ D;  1MBY A;  2RHQ B;  2ZJP A;  5T1I A;  1KD1 C;  1XXG A;  4JI1 Q;  4TUY F;  3OWF A;  4HCE A;  1PDQ A;  5IE8 A;  3PW0 A;  3PR4 A;  1IXR A;  2FK2 A;  1PHJ A;  2FXQ A;  4TV9 F;  2Q8T A;  5KIX A;  3C2P A;  2Z6K C;  1WCM A;  1YNX A;  2OXP A;  1B9M A;  3PCO B;  4FF4 A;  1BGW A;  1C30 A;  3DEP A;  1XMO L;  3CCR A;  4DUZ H;  4HTH A;  1Y1V A;  1CKM A;  2FHT A;  2WFW A;  5KG2 A;  3V6J A;  4GZY C;  3RN2 A;  1BQQ T;  1TS4 A;  3PF5 A;  1VQM A;  1Z2O X;  5C1O A;  5IYB G;  2ZTC A;  1KC8 C;  4O4I F;  5FPR A;  3OSN A;  2MP1 A;  4FF2 A;  1IBM H;  1O7I A;  4DR7 L;  5IP7 H;  3M4O H;  3QZ7 A;  4BS9 A;  2PNH A;  3K0Y A;  2A6H D;  4AYB E;  4LSX A;  4DR1 H;  2VQE L;  4EBD A;  5IGG A;  2E2I H;  1Q8K A;  4E6I A;  5FPO A;  4R4O A;  2DPJ A;  1YZ6 A;  4RAU C;  3GIK A;  4JOI C;  2SEB D;  1I50 B;  4RU9 A;  4JV0 A;  5BPF A;  3OHA A;  1S5C D;  3KK7 A;  2GPS A;  3K5N A;  5FD5 A;  4OX9 H;  1WCM H;  5CV5 A;  3C3L A;  1GOZ A;  3I4O A;  3GP7 A;  5IT9 L;  2C22 A;  3S1Q H;  2XGT A;  3F2U A;  1BBW A;  1JJ2 A;  2ZXO A;  4MV6 A;  5JEA G;  2E2H B;  4KN4 C;  5KFX A;  5EQ0 A;  5C3E H;  1DZ1 A;  3J80 L;  1KBL A;  1KHI A;  1TXY A;  1UE5 A;  5IIF A;  3V05 A;  4JI2 Q;  2ASB A;  3MFG A;  4R8U A;  3HOU H;  2FFK B;  2HVQ A;  4X66 H;  4MN3 A;  1VQL A;  5KG6 A;  1VQ7 A;  5H1S E;  1ZYR C;  2B2V A;  4X62 H;  4KI0 A;  1WD0 A;  1TKW B;  4ZI7 F;  1I4G A;  4BBS H;  5GON F;  2Y0S G;  4RCN A;  2UXC H;  1IZ6 A;  3A8K E;  4HID A;  1B33 N;  4LF5 Q;  4DKA C;  1ESR A;  3CKI B;  4DNR B;  4CDD C;  1RJP A;  4X3U A;  2F0W A;  1R4Q B;  2DJF C;  3BA9 A;  4RGT A;  3T1H L;  1N34 L;  3D0F A;  5L1I A;  3RJ0 A;  2V4Q A;  3A8I E;  3HOX B;  1C48 A;  1FJG H;  2SDF A;  1CSP A;  3DHQ A;  5I6Y A;  1F2L A;  2UXD Q;  2H4O A;  5HBR B;  2JEJ A;  4DAY B;  4IZ8 A;  3NPP A;  1Y1W B;  1S0N A;  2W70 A;  3SR1 A;  5H80 A;  1AE2 A;  3RZO H;  4CJ2 C;  3JAM c;  3A5Z B;  2R7L A;  1VQF A;  2WIN B;  5FOB B;  4DR2 L;  1WFQ A;  1IW7 D;  2CW8 A;  5C0X H;  3BG5 A;  3E0J A;  1PX2 A;  1YBY A;  3UQ8 A;  5DEH A;  1ET6 A;  4A3J G;  3PUZ A;  5KGU A;  3UE1 A;  5IWA Q;  2X69 A;  2YS7 A;  4DL6 A;  1I3Q A;  1NAP A;  4DXF A;  1R9T A;  3WO1 A;  5CGK A;  4DV7 H;  1FNU A;  5M5Y B;  2DNC A;  4L5S A;  2DWC A;  5F9N A;  4R4Q A;  3G6Y A;  2JA9 A;  1FJG Q;  4O4L F;  3UDI A;  5KG7 A;  3PIP A;  3CQZ B;  4B08 A;  3ICE A;  1KEE A;  1GLV A;  2CW7 A;  5EZY F;  4JI3 H;  5D8D A;  5KFR A;  2R92 G;  2HIV A;  4UP7 A;  4FXK C;  2HDL A;  1EWI A;  2B8F A;  3PIO A;  2HUG A;  1CA6 A;  3JZI A;  4RUA A;  2NVY H;  3KBG A;  3MTS A;  3C46 A;  5EWE A;  4G7O C;  4EQN A;  1CZW A;  3T13 A;  2IJ0 A;  3NXW A;  1RL2 A;  2A6E C;  2JA7 G;  3RZO B;  2K5W A;  1GGO A;  3S1N H;  4UAI A;  1KJ8 A;  1HCZ A;  4A3I G;  3HP3 A;  2R92 B;  1GO3 E;  5C4H A;  1ZHS A;  1BCP D;  4QIW E;  1IYJ B;  2JXM B;  3PR5 B;  5CYU A;  5KFP A;  1AFP A;  1MJC A;  5C0X I;  4GNX A;  4F7X A;  4JI6 H;  4C5B A;  4DR3 Q;  1F9P A;  2MJ8 A;  3GIP A;  4HNU A;  3FMC A;  2FK3 A;  1B6S A;  2F0M A;  2KHS A;  1STB A;  3MXU A;  3NTK A;  5E7N A;  1HPC A;  3SVM A;  4IR9 A;  5DG9 A;  2L12 A;  5C4Z A;  3L4K A;  1CKN B;  2K33 A;  4IQZ A;  4HIO A;  2MHV A;  5IP9 H;  3BAB A;  1TR5 A;  2D2C C;  1XMO Q;  5GAH C;  1PTO B;  4TQU S;  2ZJR A;  4A3K H;  5D1O B;  3CPF A;  4RGN A;  5LL6 X;  5DLG A;  3D4W A;  3K8A A;  5DLF A;  4A3B G;  1V51 A;  5DLQ E;  4F4Z A;  3S2H H;  2KA7 A;  1PH5 A;  1S5D D;  2IHF A;  5C3E B;  1VQ9 A;  2IW3 A;  1GUT A;  4OO1 I;  3SEB A;  4CGY B;  1WTP A;  4QJF A;  4A93 B;  3H20 A;  1CS0 A;  2K03 A;  3FKI A;  2VB3 X;  1QZG A;  4A3D H;  3CD6 A;  2HT1 A;  4OIK A;  2HVR A;  1EY6 A;  1N34 Q;  1TY2 A;  1UNN C;  1I4P A;  5KFC A;  5KT7 A;  2LXJ A;  1UAP A;  5JPN C;  2QEX A;  5IGC A;  1VQK A;  4QWE A;  2HDM A;  4O2A F;  4QUC A;  3M4P A;  1B3A A;  1XMO H;  5JAV A;  1HNZ Q;  1H9S B;  4I65 A;  4ED3 A;  4X3T A;  3HOU B;  2Z6B A;  1X32 A;  3VA5 A;  5KT4 A;  3H4D A;  4DR4 Q;  2UUB Q;  3I2Z A;  4YB8 B;  4EGV A;  1II3 A;  1BNC A;  1Y14 B;  3H3V C;  4MA5 A;  4Q45 A;  4LF9 H;  5J22 A;  3LX0 A;  5I2Y A;  4IO9 A;  1C7Y A;  2F03 A;  1EZ1 A;  3MWD A;  1K3R A;  2NZH A;  2YTV A;  4DK3 C;  3L9A X;  1RDP D;  2R84 A;  1J6Q A;  3W3A A;  5FO7 B;  5HGQ A;  4LF6 Q;  3OHB A;  5IGB A;  1D5M C;  4MTE A;  1C9O A;  2CKZ B;  3N41 B;  3A55 A;  2EY2 A;  5T14 A;  1CQI B;  1TWH B;  5K5P A;  4APM A;  2HHH H;  4CJ1 B;  1Q12 A;  1TWG B;  1LLR D;  4AQY L;  4JI4 H;  3STB D;  1YEZ A;  5JVL A;  1Y1W G;  2NVT B;  1JOQ A;  4PZ7 A;  1P8L A;  3GV7 B;  3I8Z A;  3T4A C;  1BXT A;  4XT1 B;  1C8C A;  2VXW A;  3A56 A;  1SR3 A;  3BG3 A;  5CV9 A;  3HGB A;  4XX0 B;  3NEM A;  2WTF A;  2JEF A;  3K7A B;  4QWD A;  4A3E H;  4F4Y A;  4TRD A;  2X0S A;  2G5D A;  1VMP A;  1M90 C;  2R8H A;  2GPW A;  1MKH A;  1ET9 A;  1NY4 A;  3LNN A;  3K80 C;  3P1H A;  4GN5 A;  3WDN A;  2EJG C;  3KTM A;  4PDB A;  2Z4I A;  5M5X H;  1UE1 A;  1Q8I A;  1WJJ A;  4AH6 A;  2QYZ A;  2NUA B;  2PI2 E;  1TWC H;  4OO1 G;  1BF4 A;  2L5T A;  1IOW A;  1YI2 A;  4C3H H;  2W6O A;  4TQS A;  2B8G A;  2I5H A;  1PH6 A;  3PF4 A;  2MPM A;  3U9S A;  1ENA A;  2BH8 A;  1D5Z C;  3TP8 A;  5CV8 A;  3M7N A;  5M5X B;  2R8J A;  4QIW B;  2EQS A;  5LL6 b;  1I4X A;  2E8G A;  4PMW A;  3L4J A;  4IUU A;  4DR2 H;  1ICF B;  2FMM A;  3J81 L;  2YU9 B;  1MHW C;  2F1M A;  2F0S A;  3HS0 C;  4GNX C;  4JYA H;  5DG8 A;  4B3S H;  3RMH A;  4R7R A;  1SNM A;  1W6K A;  4K5X A;  3HG9 A;  5CV7 A;  2YU9 H;  4A3I H;  2ZXR A;  2GLT A;  2SCU B;  2R93 H;  5I4D A;  2JA8 H;  3DF7 A;  4DV2 H;  2DPI A;  4K0K Q;  3V2T A;  1B04 A;  5KG0 A;  2RGV A;  3QIA A;  4WRD A;  2W6P A;  2C00 A;  2EYH A;  4CDF C;  5HV6 A;  2C35 B;  3EN2 A;  1TS5 A;  1EUC B;  4MAM A;  1EOV A;  3D6C A;  3GTK H;  5KG4 A;  2P5Z X;  4ZCK A;  3G71 A;  1PTO F;  3GV3 A;  3VYT A;  1AW7 A;  3N43 B;  4WFN 3;  4RMF A;  1X54 A;  3HOY B;  1OXU A;  1I4R A;  1XTC D;  4APV A;  2RCN A;  3X3M A;  3VR3 A;  1HTP A;  1Q1E A;  1N8R C;  4L63 B;  1C3O A;  2ZM6 L;  1Q90 A;  3ULL A;  4X64 L;  4DV2 Q;  1QNU A;  3SE7 A;  4RA8 A;  2R8G A;  4GKJ Q;  4IR1 A;  1GHK A;  4DL7 A;  2SNS A;  3A8J E;  4FF3 A;  3W2D A;  1FVI A;  4DUZ L;  4KN7 C;  4OON A;  2F0G A;  4B3T Q;  1XNR H;  3TEH B;  1WTH A;  4A3D B;  4RAY A;  2VUM H;  4NXM H;  1YNN D;  3ORQ A;  4HQ6 A;  4X64 H;  2K5H A;  2NVQ B;  1F2M A;  3GTQ H;  2J7Z A;  4IWY A;  3PW5 A;  4FBT A;  1A63 A;  2SOB A;  1A15 A;  4O2D A;  1SNC A;  1GXD C;  1HH2 P;  2RA4 A;  4KJO A;  4ED2 A;  2XD4 A;  4A3G B;  4GOP A;  1STH A;  3L0O A;  3TSS A;  2R7Z G;  3U4Z A;  1AZP A;  4JC0 A;  2XCA A;  2ZJT A;  3K6O A;  2K5D A;  1WTQ A;  3H6M A;  2JA6 B;  5K36 G;  1BR9 A;  4C1N I;  1ZHQ A;  1NMF A;  3IFT A;  2NVY A;  1QNK A;  2MUY A;  4MV4 A;  2IP4 A;  5TSS A;  4C1N K;  1KNA A;  5I2X A;  1EFI D;  2PQE A;  1BXR A;  2FK1 A;  1X9N A;  5BR8 L;  1A3U A;  4OHJ A;  3D6W A;  5JJL A;  2UXB L;  3PUV A;  2F0I A;  4U6P A;  2YZM A;  4UP9 A;  1HNX H;  4A3G G;  2R8K A;  5DGB A;  3F8N A;  4X65 Q;  1QCB D;  1ZEQ X;  2I5M X;  2EE1 A;  1IKL A;  4DV0 H;  1SBB B;  5KFZ A;  2UUA Q;  4RB0 A;  4HNT A;  4UHV A;  3CC7 A;  3G6V A;  1H9K A;  1EUJ A;  2PMZ B;  1PMR A;  3M7G A;  3NBH A;  2WAQ G;  1RK6 A;  2RHS B;  4ED1 A;  4Q8E A;  1MZB A;  1B9N A;  4JBK A;  3CCL A;  3KAJ A;  1VQP A;  1GYF A;  3N6X A;  5LMN Q;  1DIK A;  3RGX A;  1KXL A;  3HOX H;  1KL9 A;  4RB3 C;  1GKH A;  1XPR A;  4K2K A;  2IA6 A;  2CW0 D;  4IPG A;  2BR0 A;  4X66 L;  1XMQ H;  5KFT A;  3I91 A;  2W9B A;  2JSO A;  4K5V A;  2WAQ E;  4HCS A;  1N48 A;  3RV3 A;  4WJW A;  1TWF B;  4XYL B;  2I80 A;  5IYD H;  1X3Q A;  4IPH A;  4J9Q A;  4DF7 A;  5C0X J;  1WTO A;  3AFP A;  2Q8R E;  1Q46 A;  1XX8 A;  4ZOL F;  1SMY D;  4TV8 F;  4LH7 A;  3FKI H;  1BO0 A;  2UVR A;  3I55 A;  3KDF A;  3W5O A;  3J81 c;  1PFS A;  4DV6 Q;  1JLL B;  1Y69 U;  2YL2 A;  3M9B A;  3HFZ B;  1TVX A;  1F77 A;  3RUZ A;  3I12 A;  1UE7 A;  4A75 A;  3PUW A;  3AFQ A;  1RIP A;  3WNZ A;  2JEG A;  2HHH L;  3J81 i;  1RD9 D;  4A3G H;  1SE8 A;  2B2Y C;  1PH2 A;  4JI1 H;  1VQC A;  3G7L A;  3H0G H;  1Y1W H;  1FR3 A;  5CB4 F;  4NXN L;  4O1N A;  5C3W A;  4BBR B;  1VQO A;  1EU3 A;  3KLR A;  5C6A A;  2I87 A;  2XIW A;  1VBG A;  1JQY D;  3K59 A;  5DGA A;  1IOV A;  3I4N H;  2Q2I A;  1D1K A;  3KBX A;  2F0L A;  2MNA A;  4G3I A;  4B9W A;  4IWX A;  4P75 A;  5J39 A;  4ECZ A;  2HVS A;  2FMC A;  4DV1 Q;  1NJI C;  4A3M B;  2N49 A;  4FVM A;  1XPO A;  4DAM A;  5T1G A;  3GTP H;  1J5E L;  3V6H A;  2R82 A;  2F3I A;  3I73 A;  4ID6 A;  3GTJ H;  4WBN F;  1VQA A;  1SMX A;  5KFI A;  2VUM A;  3GTG A;  4YR3 A;  1B53 A;  4XQQ A;  4B3M Q;  4ZUJ A;  4A2B A;  5LMU L;  1LAC A;  1FYC A;  2EY6 A;  1R9T B;  5M5W H;  5JUM A;  4LFC H;  4KHP L;  2D0O A;  5FJ8 G;  4HR7 A;  5DQG A;  3KHG A;  2HD3 A;  2ENB A;  1J8I A;  1JJG A;  2VPS A;  3PW4 A;  4QWA A;  5KNC A;  2W9A A;  2ZT9 C;  1B7Y B;  4JVZ A;  2JK8 A;  3S16 B;  5F2D A;  3X3N A;  1K3B C;  4LK1 C;  2KCC A;  1EFW A;  4KY7 A;  1DV2 A;  3SDZ A;  1SYG A;  3MEH A;  5F9L A;  4ECQ A;  4OX9 Q;  5CBA E;  4JI2 H;  1YJW A;  3I72 A;  2E2D C;  1TWF A;  1GSH A;  4IN3 A;  4BBS B;  3GTP A;  1V1P A;  4LW1 A;  1YHA A;  3RAX A;  3M9O B;  1VQG A;  2L55 A;  1SNQ A;  4LFC L;  4EG0 A;  2F0U A;  3K3P A;  2RVL A;  3S17 H;  4C3J H;  2BH2 A;  1FKA H;  3O13 A;  4XT3 B;  1V1O A;  1HNW Q;  4IPD A;  1G29 1;  1D8L A;  4F4W A;  4BY1 G;  2JA8 G;  2K6A A;  1M1K C;  3CCE A;  4KV6 A;  1BCP F;  4GLX A;  3L7Z C;  5FKA C;  3CPW A;  2XVS A;  3I4M H;  5EPJ A;  4KHP Q;  4QW8 A;  1B3Q A;  1AN8 A;  1EY8 A;  4N9P A;  4LF5 H;  5KFY A;  4LFB H;  3NEN A;  4QWB A;  3TDQ A;  5EPK A;  1NMG A;  4G7H C;  1LT4 D;  2KCN A;  1CKN A;  1DD2 A;  3LWB A;  3R5F A;  4IFD J;  3A0J A;  1A3V A;  4PZ6 A;  1GUO A;  4YQW A;  2PQA A;  1S10 A;  3KHL A;  1HZB A;  4RG1 A;  5AFW A;  4K8J A;  1O7L A;  2PW7 A;  2YW2 A;  4JG2 A;  1GUS A;  2V59 A;  3PUY A;  4CKB A;  2G9D A;  3J81 W;  3VR2 A;  4ZKB B;  1JE5 A;  3T51 B;  2AWN A;  3PW2 A;  2NVT H;  5I47 A;  1T36 A;  5BPH A;  1U9R A;  3BJU A;  4XXE A;  3RUP A;  2I46 A;  1CFM A;  4M1U B;  4MIU A;  3N8D A;  3RB4 A;  1XMQ L;  5I6W A;  2VL6 A;  3VR6 A;  1IBM L;  4C5C A;  3K7U C;  2JJQ A;  1HA6 A;  4HJ8 A;  1ZKO A;  3PQI A;  2A8V A;  3IAY A;  4JI3 Q;  3CMA A;  2NU9 B;  3HKZ B;  4LMQ D;  2C5C A;  3RD4 A;  4GKJ H;  1O78 A;  1A0I A;  1ESF A;  4HYK A;  1I50 A;  2CH4 W;  1JT8 A;  4DL3 A;  1VQ4 A;  2AWO A;  2LS0 1;  3HRZ C;  4NXM Q;  1R9T H;  4UCV A;  1E2W A;  4DV1 L;  4WD3 A;  1I6V C;  5EPL A;  3NSW A;  4LFA Q;  4IUR A;  4KD3 A;  1PH4 A;  5IY0 A;  1IYV A;  1VS0 A;  4H02 A;  3MZ5 A;  5IP7 G;  1AEX A;  5KFD A;  3EJI A;  2AQ1 B;  1V1P B;  3GTP B;  3U50 C;  1EIF A;  3RBE A;  1EZ6 A;  4JOI A;  1L0W A;  1I6H B;  1CI3 M;  2ASD A;  3W1B A;  2E2J H;  5JJI A;  2UU9 H;  3GTG H;  3GTO B;  2WB1 E;  3I4N B;  2A5H A;  1QWY A;  1PRT C;  1ZYR D;  5BN4 A;  4LF7 H;  2W7O A;  5KND A;  4GKJ L;  1WCM G;  1O75 A;  2R6F A;  2ZM6 Q;  1N56 A;  4LJZ C;  3HOV G;  1K1Q A;  2R6G A;  1LUZ A;  4A3B B;  4YAJ B;  3N44 B;  2F3W A;  3MR6 A;  4A3L H;  3BVG A;  4Q44 A;  4ED0 A;  4MV3 A;  1CQJ B;  3QOJ A;  4ODG A;  1MIU A;  5KT5 A;  1VF7 A;  2XC9 A;  2DY7 A;  2QEJ C;  3RF2 A;  4POF A;  3Q1K A;  4A3F B;  4QB4 A;  3RAQ A;  4UCT A;  1RHP A;  2PQA B;  5E4W C;  2WP8 J;  1STE A;  2YRW A;  2NZO A;  3TQ1 A;  3CCQ A;  5EWG A;  2RSN A;  4H7B A;  4R9W A;  1EYG A;  3CF5 A;  2H1E A;  1SN8 A;  1ILQ A;  2EVB A;  3MVV A;  4O3N A;  3BQ0 A;  4JI8 H;  2IMW P;  1JIC A;  2A6H C;  2F0H A;  1IBK L;  4LF7 Q;  4IZO A;  4J0M A;  5IT9 E;  4DR6 H;  3Q22 A;  3MR2 A;  2LY7 A;  4V0B A;  1N34 H;  2F4I A;  3I56 A;  3PIP 3;  3VR4 A;  4A3E B;  3CU7 A;  2QDB A;  3GIQ A;  1SYE A;  1SSO A;  4CKC A;  1PRT D;  2CH4 A;  2Z9H A;  4EFE A;  2FLL A;  2K52 A;  1BCP C;  4DV4 H;  4C3J G;  2W6Z A;  1JOK A;  3OPO A;  4A4I A;  4G7Z C;  2Z0S A;  1AUV A;  2A69 D;  3VA7 A;  4YY3 Q;  1HRJ A;  4NLG A;  2UUA L;  4HN7 A;  2PPB C;  1NTG A;  4A3C G;  3R5X A;  2L1B A;  2HGS A;  2ZDG A;  5EBD A;  4X65 L;  4CC5 A;  3KLW A;  4J9K A;  4YR2 A;  1SAP A;  3MEF A;  4RNM A;  3HKZ E;  1YHB A;  4K14 A;  3NGD A;  1KAA A;  2XSC A;  2KHI A;  5EAY A;  5COY A;  1O7Y A;  2JEA I;  4JI4 L;  1RYS A;  3HOW B;  5IT9 W;  1XWE A;  3Q6S A;  3J7A 5;  5EKL A;  1SRU A;  4B3S L;  5FLX W;  1PH8 A;  1HUN A;  1HNW H;  1HQR D;  4HMI A;  5COR A;  4XYO A;  3AU7 A;  1B44 D;  2V5A A;  4ILW A;  2O03 A;  1OXS C;  4XYM B;  3TIG A;  2FPG B;  3GTO A;  4GKK H;  4LUZ A;  2NVQ H;  3R5H A;  4X3K A;  2A6E D;  1EYD A;  5KFM A;  2XRS D;  5D3I B;  4F8M A;  1KTK A;  2NYZ D;  3GII A;  2YZG A;  1DYQ A;  3PSI A;  1EU4 A;  3S1R H;  1Z6H A;  1S97 A;  2E74 C;  5JVH 3;  2EXD A;  2JA5 B;  2UUC L;  1SE2 A;  1CM9 A;  2MCT A;  1UEA B;  2N55 A;  1JOO A;  4DV5 Q;  3NQI A;  2FJ2 A;  4B3M H;  4K6L A;  5L37 A;  4FDB A;  3IN5 A;  1LTA D;  4IAL A;  1XYI A;  4AYB A;  5FLX c;  1EY9 A;  2PYK A;  4YAK B;  4GOP B;  4KKU A;  4QGU A;  4QQB X;  1S5F D;  4XZ3 B;  3IRB A;  4DR2 Q;  3MWE A;  5C4J B;  1K9M C;  5DM6 3;  3T1Y H;  3BJY A;  4P71 A;  2ZJQ A;  5DG7 A;  2DY8 A;  2OQ0 A;  2JA5 A;  3FEW X;  2IX3 A;  1OWT A;  1PV4 A;  1S4Z A;  2V58 A;  2DJG C;  3CVZ A;  1VQD A;  4O3R A;  4UFZ A;  1JB3 A;  5EGT A;  1HA5 A;  3CRL C;  2I0Q A;  4QCL A;  3PN1 A;  4P2C B;  1KLU D;  4EQP A;  4Y52 H;  2Z6K A;  5KG1 A;  4AQY Q;  4RHS A;  1EUD B;  5C44 H;  3GTJ A;  1F9R A;  3PO2 G;  5J1Z A;  4IOC A;  3AEV A;  1FJG L;  1WTW A;  4A93 G;  2E76 C;  1CHP D;  2K32 A;  2KSW A;  3Q24 A;  3KF6 B;  2YYA A;  2PMZ A;  3D4R A;  4CHT B;  4LF5 L;  4F88 A;  3ULP A;  4PZ8 A;  3JAM E;  1KRT A;  1GJX A;  4EFB A;  1HR0 Q;  2R8I A;  2GVA A;  1H95 A;  3R2I A;  2RDI A;  3MFY A;  2NVX H;  2RSO A;  3BA8 A;  3MXN A;  1Y8P B;  3LWE A;  3HB9 A;  4DV4 L;  2R7K A;  1TWH H;  1EYZ A;  3GQB A;  4J9P A;  4RGO S;  2V9W A;  2DGY A;  1T94 A;  4R4T A;  2B2W C;  5GRO A;  1L2Z A;  2M2L A;  2KEN A;  4OWX B;  2DZD A;  4DR3 L;  2NZ1 D;  4DUY Q;  3OMG A;  1YNJ C;  2AGP A;  3TIN A;  5FLX E;  2NBF A;  3HXL A;  4ME5 A;  2JE6 I;  1OXX K;  3MA2 B;  4C3H B;  2NU8 B;  1S0M A;  1STN A;  1TU2 B;  1QIL A;  1D1I A;  4PNY A;  4DAP A;  3H15 A;  3GV8 B;  1JDB B;  3CHB D;  2AU0 A;  4NP5 A;  3V96 A;  1IBK H;  3QO2 A;  3M3Y H;  2NUC A;  4DV7 L;  1K83 B;  2B2V C;  3S1M B;  1DOM A;  2R3Z A;  4JV5 H;  1PH3 A;  2L0C A;  4AIM A;  4F4X A;  4DR7 H;  1GVP A;  2YRX A;  1K83 H;  1PA6 A;  1JE4 A;  3IFD A;  1UWV A;  4NKL A;  3GTQ A;  4CDE C;  3VPD A;  1J5E H;  4R1J A;  3G48 A;  1SFO B;  4MTK A;  3BZD B;  2FP4 B;  5EOY A;  3ND8 A;  1FNV A;  5KFS A;  3H09 A;  2UXD H;  4MTN A;  2QW7 A;  2EYO A;  1K1S A;  3GQC A;  2Q2T A;  1LO5 D;  4DR5 Q;  4F87 A;  1PTO H;  5C4X B;  1RKN A;  4JI7 Q;  1B4O A;  1DM0 B;  5LYJ F;  4C56 C;  4DR4 L;  3Q8P B;  4YHH Q;  3V4Z A;  1HNX Q;  1OO9 B;  4IUV A;  1JWU D;  3GTJ B;  5KYI A;  4GN3 B;  4FF1 A;  1PFN A;  5AJ3 Q;  1Q1B A;  1DON A;  3NWS A;  1Z47 A;  2NTT A;  5KFU A;  2IT1 A;  2JN4 A;  1TQO A;  3KLS A;  1GHJ A;  1B70 B;  2V4D A;  4LF8 Q;  3C0F B;  3WWV A;  2C2D A;  2CFM A;  4HR7 B;  2UUA H;  2CQA A;  4I55 F;  2KVM A;  2GVB A;  2EY5 A;  4WJ4 A;  1V9P A;  1DXM A;  5C4X G;  2UXC L;  2ZM6 H;  4J9N A;  1AUX A;  5IP9 G;  4J9S A;  2CW0 C;  1N33 L;  4UP8 A;  1XNR L;  3S24 A;  4GLV B;  5LMN H;  4BY1 H;  4LFA H;  2NN6 I;  4DR5 H;  4HJ5 A;  1SRO A;  4JV5 L;  5KT2 A;  4P72 A;  3M4Q A;  5C5L A;  1KIX A;  2Y0S B;  4LH6 A;  4RB1 A;  3RB0 A;  1F2Z A;  1QUQ A;  4XQN A;  2PCF B;  1MJE A;  5CA1 F;  3DMU A;  3GV5 B;  3S15 H;  1FNW A;  4P73 A;  4DV6 H;  3S2D H;  1B6R A;  2ICE C;  4JI0 H;  1FD7 D;  2VQF L;  4QW9 A;  2N3S A;  2EPB A;  1D5X C;  4DFA A;  2PBZ A;  4DV3 Q;  4A3K B;  3Q8S B;  2J6T A;  4EGJ A;  2JYO A;  3RLN A;  3HOX G;  3QWN A;  1L1O C;  1M0W A;  2UVU A;  2A1A A;  3ITP A;  4BY7 B;  1RJQ A;  2VNU D;  1NUC A;  1XNQ L;  3U58 A;  1YIJ A;  2WB1 B;  5C4J H;  4A76 A;  3IL8 A;  2MGS A;  3GTM H;  4C2M A;  2BOS A;  2UXB H;  2M9V A;  3BU2 A;  4S3S A;  3S1N B;  1GUG A;  3PGZ A;  2YS6 A;  4A3M G;  4TSS A;  1A62 A;  2Z8L A;  2B63 B;  3U9T A;  1K28 A;  3QB3 A;  4A3D G;  2F52 A;  2HHH Q;  4ED7 A;  3E6Z X;  4RAZ A;  1K8M A;  3H91 A;  3SGI A;  3MXG A;  2JA6 A;  3MHB A;  2IL8 A;  2CWP A;  3J7Z C;  2NVY B;  1F9Q A;  1EZ8 A;  5ELF A;  3T1Y L;  1JDE A;  4YY3 H;  4ZYS A;  4UY8 C;  1RJT A;  5DAU A;  3QZ8 A;  4YCU A;  2EXZ A;  4DA2 A;  4JI0 L;  1CKO A;  4AYB G;  5G3L F;  2QIL A;  1CSQ A;  4FP5 D;  1E4E A;  1O80 A;  1KJQ A;  1HHV A;  1W93 A;  4PMB A;  3E5N A;  2QK4 A;  1I7N A;  4B3M L;  4WOR A;  4FS1 A;  1LTB D;  1XNQ H;  4M7E A;  4GLA C;  3VPC A;  3J81 E;  1BNZ A;  5IGF A;  2R7Z H;  2HCC A;  4ALP A;  3T1H Q;  2O5I C;  2E2J B;  3NHH A;  3PVX A;  4FYD A;  4RWS C;  1I3Q B;  2EYM A;  1U4R A;  4EEY A;  1LTG D;  3OOC A;  1UUP A;  5KFH A;  5IYC H;  4O3S A;  3GIL A;  4IRD A;  1I7L A;  4O3O A;  4N8F A;  3FMA A;  5GQO A;  3LML A;  4J8Q A;  2JA6 H;  4ULL A;  2KJX A;  5M5Y H;  4PQX A;  4ABN A;  5EJW A;  4PWQ A;  4KKT A;  4A3B H;  1I94 H;  3U9O A;  4LWC A;  3PO3 B;  4JYA Q;  1LT3 D;  2F0K A;  4RKB A;  4IPC A;  1I5F A;  5JOB A;  2A68 D;  2E5L H;  2K05 A;  3KLS X;  1KLG D;  3AQQ A;  3S1Q B;  2BQ3 A;  1SEB D;  3RV4 A;  5IYD G;  2B63 H;  3ORR A;  3OTO L;  2YTY A;  5ISR A;  3T1H H;  1CHQ D;  1SLJ A;  3U4V A;  2JA6 G;  1VQE A;  3EFX D;  3GLK A;  4ECW A;  1KNE A;  2OTL A;  1CQV A;  1GUW A;  3DWP A;  4QL5 A;  3GTL A;  1N36 Q;  1SE3 A;  4IJH A;  1HXY D;  4GNX B;  4K0K L;  3UI2 A;  1UE6 A;  5EKI A;  1L0X B;  2LKV A;  2A19 A;  3NWT A;  2B2T A;  3M4O B;  3OW2 A;  1PFB A;  3S14 B;  3KHR A;  4RZR A;  4FXD A;  4Q0Y A;  3F2B A;  2CVR A;  3E5S A;  2ZDH A;  2R85 A;  1PYS B;  4A3F H;  4Y7N B;  3TZD A;  4A3J H;  4ECY A;  3KF8 B;  5LA6 F;  2BDN A;  4H44 C;  2M00 A;  4DV3 L;  2OLS A;  5ELN A;  4C3I B;  2R93 G;  4BA2 I;  5ELO A;  4DPG A;  1GD7 A;  2CWA A;  1BUV T;  3K57 A;  1VQ6 A;  2OH2 A;  4RZQ A;  1WCM B;  2LXK A;  1X3P A;  5EBC A;  1WR2 A;  5KT6 A;  3J7Y W;  1LTL A;  4RNO A;  2KOL A;  3DM1 A;  3FVQ A;  3HKZ G;  5D1P A;  3A7L A;  1TS2 A;  3E0E A;  3H40 A;  4J9M A;  4X64 Q;  4DV2 L;  2C2R A;  3BYY B;  4QY7 A;  3V4S A;  1FGU A;  4DGZ A;  3H3V H;  2I5L X;  2JP1 A;  3GTG B;  3KOJ A;  4C3I G;  3CW2 C;  3HOU G;  2R93 B;  4MV8 A;  4U7C A;  3J7A K;  1LTS D;  3CXC A;  1PYW D;  4E4T A;  3Q2O A;  3FHW A;  1M6V A;  1ZET A;  2F0T A;  3FP9 A;  3AMU A;  5D3D A;  4HIM A;  2B2U A;  4FBU A;  5KFF A;  3STB C;  2G9H D;  2VA3 A;  4Q8F A;  3SK5 A;  2JA7 A;  5FO8 B;  1KJJ A;  2E2I B;  3TN2 A;  1XJV A;  1N32 H;  3GTL H;  3OSP A;  2QKI C;  5IT9 c;  1H9S A;  1X55 A;  2W8L A;  1WVL A;  3PUX A;  5G3L D;  2D9U A;  2EYL A;  2O2L D;  4L8J A;  4LSA A;  1Q3L A;  4RKL A;  5LXT F;  3GIJ A;  1IBK Q;  3URY A;  4OEM B;  2E2H H;  5L1J A;  2NTS A;  5CAE B;  4ECT A;  5FJ8 H;  3R3O A;  1OXV A;  4C3J B;  2B63 G;  2BE5 D;  1PZJ D;  1HQM C;  3Q8R B;  2V4R A;  2JEB I;  2A69 C;  2Z4H A;  1IL2 A;  1TT2 A;  1TWH A;  3QJY A;  2ICI A;  3J81 j;  1WD1 A;  4L5Q A;  4RH6 A;  3P75 A;  1HNZ L;  3H3V I;  3BS1 A;  1T3N A;  3MC0 B;  2UUB L;  4GKK L;  2EIF A;  2RKS A;  1CA5 A;  4JV1 A;  4OX9 L;  1HFN A;  2ZXP A;  4YIJ A;  2Q2H A;  3TS0 A;  1SND A;  4LF8 L;  2P0A A;  1RTN A;  4ETS A;  2C2E A;  5C44 B;  3ERQ A;  3R8B A;  4UPA A;  4DAY A;  1FGB D;  5C3X A;  1BCP B;  5DM7 3;  4O0A A;  3H0G A;  4LF8 H;  5KFW A;  1Y1W A;  1W6J A;  4K8I A;  4LF9 Q;  3EYY A;  4YP3 A;  2DN8 A;  3PO2 H;  2PI2 A;  1PFM A;  2WDT A;  4JI5 H;  1WI5 A;  4LFA L;  3ER0 A;  3Q23 A;  1LAB A;  3RTX A;  4XYQ A;  1KDB A;  4GC6 A;  4MV7 A;  4UDU C;  4DLK A;  1C0A A;  2YU9 A;  4NXM L;  1NR4 A;  4HJA A;  3A5U A;  2R93 A;  5D14 A;  1U4M A;  4EBE A;  3S14 H;  4YJ3 F;  4O42 A;  3E9H A;  1ILP A;  5KEE A;  5ELC A;  1S9F A;  3IKJ A;  4BBS G;  2F0P A;  2IBK A;  2TMP A;  2MFI A;  1HR0 L;  2Z1C A;  4CDC C;  2HQL A;  3HKZ A;  3RIZ A;  2F4V Q;  1ASY A;  4X62 L;  4IFD H;  4UCU A;  4IUN A;  5KFQ A;  2JA5 H;  3S2H B;  4JBM A;  4DV0 Q;  1T5X D;  4UCS A;  4ED6 A;  3EA6 A;  3TZU A;  3JAM W;  1QVC A;  3MR5 A;  3WOE A;  2MO1 A;  4L5T A;  3HOZ G;  5CA0 F;  3HOZ H;  3OTO Q;  4DUY L;  2PW5 A;  5BN3 A;  3MXN B;  2BA0 A;  3PO3 H;  3OUU A;  1H9J A;  3T53 B;  2KED A;  5JPM C;  2R61 A;  3OMC A;  1VBH A;  3LWU A;  1E2V A;  5L1L A;  1BBU A;  2JA5 G;  4BXX H;  2R92 A;  3OSO A;  2WV6 D;  1EY5 A;  2C9O A;  4P74 A;  1PZK D;  2GA4 B;  1VCI A;  4B3R H;  1TWF H;  2NB0 A;  2RDF A;  2W6Q A;  1RK5 A;  2ES2 A;  3RZD B;  1SMY C;  2SNM A;  5HUR A;  2VY3 A;  3OIQ A;  4A3M H;  1I4H A;  2F4V H;  4GC7 A;  2J4X A;  2AUK A;  4FXG C;  1S5E D;  2J9G A;  2B29 A;  5A2Q L;  3GTM B;  1EYA A;  4R4I A;  4BWG B;  1XNQ Q;  4X6A H;  1D7Q A;  2AKW B;  2NVX A;  3MWM A;  3NP8 A;  4JI7 L;  4IFD I;  3M4Y A;  2B2W A;  3JSL A;  3H0G B;  3CCM A;  4R4C A;  2IPK D;  4ZHQ F;  4DV5 H;  2CZG A;  3QFF A;  3E3X A;  4HJ9 A;  1W2B A;  4I7Z C;  3A74 A;  3HOW H;  1IL8 A;  4LUO A;  3S15 B;  3RGZ A;  4ZLT F;  4ECR A;  2OT2 A;  3GTQ B;  5DQH A;  4DL4 A;  1LM0 A;  1LTT D;  2F0D A;  2F0O A;  1VQI A;  4QMG A;  1ASZ A;  5IOD A;  2VUM G;  5FD6 A;  3J80 W;  4KD4 A;  3T1Y Q;  5BN5 A;  3GD7 A;  3GID A;  1IW7 C;  3FKI B;  3AB9 A;  1W96 A;  1PLF A;  3SK8 A;  4KHP H;  3GDE A;  1S72 A;  4Q43 A;  1H9M A;  1E2Z A;  1X65 A;  1E1T A;  3RFC A;  1TS3 A;  1Y8O B;  3GO5 A;  1M4V A;  1XTD A;  3MAQ A;  3CCJ A;  3BDC A;  4B3R L;  1VQ5 A;  1RJR A;  5A2Q W;  3F1Z A;  4O2B F;  3MR3 A;  3M9M B;  1W3S A;  3K5M A;  3EVQ A;  3NBH B;  1K73 C;  3F2D A;  2QA4 A;  1MI2 A;  1MSH A;  1Z2P X;  2XTI A;  3G6J B;  5BR8 Q;  5KYL A;  1KQS A;  1EIH A;  3T5L A;  4N9T A;  3ETH A;  3SI8 A;  5L9X A;  5IGE A;  1HR0 H;  2K04 A;  1MD2 D;  4POG A;  5FLM G;  3MFI A;  2YCH A;  2B39 A;  2E75 C;  2L11 A;  1I6H H;  1G2S A;  2D62 A;  1TWG A;  3BVZ A;  4UCR A;  3H94 A;  4CJ0 B;  1X56 A;  3FRP B;  3BQ1 A;  4DR6 L;  4A3C H;  4H13 C;  4XDX A;  1LT5 D;  2KCT A;  4U67 3;  2J0T D;  2WAQ A;  5J2U F;  1JCK B;  4L6T B;  4RFB A;  3JSN A;  1HR0 W;  3S9W A;  2QGQ A;  4CBV A;  4J9R A;  2JEI A;  2DUD A;  3HOW G;  3TP7 A;  1QJO A;  1VMC A;  1E3P A;  4A3L G;  4OL7 A;  4EVO A;  4JI3 L;  4B3T L;  4NDX A;  2LFN A;  1TY0 A;  2DNE A;  2LSS A;  4JW0 A;  3RN5 A;  4I50 F;  4YBZ B;  1SNO A;  2PZU A;  1TWA A;  1E1O A;  3I7F A;  1AZQ A;  4MHE A;  1A8V A;  1EEF D;  2ALY B;  1EQR A;  1DJR D;  1SNP A;  2RBM A;  4KMU C;  4QUF A;  1N33 Q;  4JV5 Q;  1CE8 A;  5EWF A;  2W8K A;  1S03 G;  2XCP A;  3T56 B;  1VQJ A;  1Z9F A;  3BDL A;  4K6D A;  1E4G T;  5LOV F;  1ML0 D;  3SK6 A;  2B63 A;  2NN6 H;  1JWS D;  4DNI A;  3L2P A;  4EQO A;  2YTX A;  5IYB H;  4K5W A;  3OWE B;  3PMF A;  3DWA A;  3DWQ A;  4MZ9 A;  4O3Q A;  2AQ4 A;  1TII D;  3EBE A;  5HY6 A;  4LF7 L;  1SYC A;  3PV0 A;  1EEI D;  3VR5 A;  2VQF H;  1STA A;  3ETJ A;  5FLX L; 
#chains in the Genus database with same CATH homology
 4EQ5 A;  4UP9 A;  4DR5 Q;  4DV6 L;  4IFD G;  4A3G G;  1JJC B;  1AE3 A;  1OTC A;  2VQF Q;  4JI7 Q;  2E5L L;  4DR4 L;  4NB3 A;  3K81 C;  3KYH C;  4X65 Q;  4YCW A;  4YHH Q;  1JB7 A;  4DV0 L;  1HNX Q;  1Q7Y C;  2I5M X;  2YV5 A;  1X3E A;  1WYD A;  2OQK A;  4GN3 B;  2R7F A;  4KHZ A;  1TWG H;  1Q1B A;  5AJ3 Q;  2UUA Q;  4LFB L;  2BA1 A;  1Z47 A;  2UU9 L;  4JYA L;  4LF4 Q;  2IT1 A;  3CC7 A;  1PH7 A;  1K0R A;  1E22 A;  1B70 B;  1EUJ A;  1V1Q A;  1VQB A;  3WWV A;  2UU9 Q;  4LF8 Q;  1QVF A;  2CFM A;  3PO3 G;  2PMZ E;  2ID0 A;  2R7D A;  2WAQ G;  4GS3 A;  4A3E G;  1YVC A;  2RHS B;  1LYL A;  2GVB A;  4JBK A;  3CCL A;  4LF6 L;  4KLK A;  4WJ4 A;  3JC6 6;  1V9P A;  3AYH B;  4WJ3 M;  5C4X G;  4C3I H;  1VQP A;  4IJL A;  2UXC L;  4DV7 Q;  5LMN Q;  2JA7 H;  5IP9 G;  1KXL A;  4Y7N H;  1KL9 A;  3J80 c;  3HOX H;  3CCV A;  2HIX A;  1YIT A;  1N33 L;  1J5E Q;  1G51 A;  1GKH A;  2KBN A;  4UP8 A;  3S24 A;  1YJ9 A;  4GLV B;  1XPR A;  1PH9 A;  1XNR L;  3DLL A;  3HOY H;  4IPG A;  3UDF A;  4A3K G;  4X66 L;  4BY1 H;  2NN6 I;  1S40 A;  1YJN A;  4HJ5 A;  1SRO A;  4JV5 L;  2WAQ E;  4P72 A;  3M4Q A;  1KIX A;  4JCV E;  1T9H A;  3H0G G;  1QUQ A;  1GM5 A;  1VQ8 A;  4JI5 L;  2H5X A;  1MJE A;  1PVO A;  5IYD H;  5M3F H;  4YWL A;  5C4X H;  3S15 H;  4IPH A;  1Q82 C;  1U0L A;  5C0X J;  2MO0 A;  4P73 A;  3AFP A;  3UDG A;  3S2D H;  1Q46 A;  2AHO B;  1E24 A;  2K50 A;  2KHJ A;  1U5K A;  1XPU A;  3FKI H;  2VQF L;  2N3S A;  3VDY A;  3OYY A;  3I55 A;  2VW9 A;  4DV3 Q;  3KDF A;  3W5O A;  3J81 c;  1PFS A;  3KJO A;  4DV6 Q;  4YY3 L;  3HOX G;  2B3G A;  3RLN A;  1L1O C;  2JQO A;  3HFZ B;  2A1A A;  3M9B A;  2UXD Q;  4DR6 Q;  5AJ3 L;  2VNU D;  4YWM A;  2UUC Q;  1XNQ L;  3U58 A;  4XTC S;  1YIJ A;  1UE7 A;  5C4J H;  4A75 A;  4A76 A;  3PUW A;  3AFQ A;  3GTM H;  1RIP A;  4LUV A;  2HHH L;  4YHH L;  1DGS A;  3J81 i;  4A3G H;  1IBL Q;  2ZTE A;  1SE8 A;  4JI1 L;  5JEA J;  5M3F G;  3BU2 A;  1N9W A;  1PH2 A;  3PGZ A;  4JI6 Q;  1VQC A;  2YYZ A;  4A3M G;  3S1M H;  3H0G H;  1XMQ Q;  5JJK A;  1A62 A;  3KJP A;  4DR1 Q;  1Y1W H;  4A3D G;  2ZJP A;  2F52 A;  2RHQ B;  1KD1 C;  2HHH Q;  4NXN L;  4JI1 Q;  4JI6 L;  3SGI A;  1VQO A;  5IE8 A;  2K4K A;  2CWP A;  3J7Z C;  1X3G A;  5IYC G;  1L1O B;  1IXR A;  1PHJ A;  2FXQ A;  3T1Y L;  4UY8 C;  2Z6K C;  2Q2I A;  3DM3 A;  4LF9 L;  3I4N H;  4YCU A;  1YNX A;  2MNA A;  4JI0 L;  1CKO A;  3KFU A;  3PCO B;  1X3F A;  4P75 A;  4AYB G;  1XMO L;  3CCR A;  1CSQ A;  4DV1 Q;  1NJI C;  2N8N A;  2N49 A;  1CKM A;  2WFW A;  1XPO A;  4DAM A;  1QZH A;  4B3M L;  3GTP H;  4QQB X;  3RN2 A;  1J5E L;  2F3I A;  5GAG C;  3GTJ H;  4GLA C;  3PF5 A;  1VQA A;  1SMX A;  1VQM A;  5IYB G;  2ZTC A;  4JI8 L;  4BBR H;  2R7Z H;  3HKS A;  1KC8 C;  4ALP A;  3T1H Q;  1VQH A;  2VQE Q;  4B3M Q;  5LMU L;  2VZA A;  1O7I A;  1OXT A;  5M5W H;  4DR7 L;  4KHP L;  2D0O A;  5IP7 H;  5FJ8 G;  3M4O H;  2PNH A;  3ERS X;  4AYB E;  5IYC H;  2VQE L;  1B8A A;  2E2I H;  5GAD C;  1Q8K A;  1JJG A;  4R4O A;  1YZ6 A;  5GQO A;  2D0P A;  4DV4 Q;  4JOI C;  1B7Y B;  2JA6 H;  2JK8 A;  5M5Y H;  4A3B H;  1EFW A;  1WCM H;  1JMC A;  3EIV A;  4LWC A;  4DV5 L;  3I4O A;  3LGJ A;  4JYA Q;  3S1Q H;  2XGT A;  1IBL L;  4IPC A;  1I5F A;  2NN6 G;  4OX9 Q;  1BBW A;  1JJ2 A;  5JEA G;  4BY7 H;  1YJW A;  3I4M G;  1L2F A;  5C3E H;  3AQQ A;  1KHI A;  1TXY A;  1UE5 A;  1YHA A;  4LW1 A;  4NXN Q;  1VQG A;  4JI2 Q;  2ASB A;  5IYD G;  2B63 H;  3OTO L;  2YTY A;  1SLJ A;  4LFC L;  3U4V A;  2JA6 G;  1VQE A;  3HOU H;  1VQL A;  4LFC Q;  2OTL A;  1VQ7 A;  3S17 H;  2UXC Q;  5H1S E;  4QL5 A;  4C3J H;  2BH2 A;  5J3B A;  4KI0 A;  3RLO A;  1HNW Q;  1N36 Q;  3ULJ A;  4BBS H;  2V1C C;  4IPD A;  1G29 1;  2Y0S G;  4IJH A;  1D8L A;  4BY1 G;  2VS1 A;  1IZ6 A;  4GNX B;  4K0K L;  2JA8 G;  4HID A;  1M1K C;  4LF5 Q;  4DKA C;  3CCE A;  1UE6 A;  4GLX A;  1KRS A;  3L7Z C;  2A19 A;  4ME3 A;  3CPW A;  1Q86 C;  3I4M H;  4KHP Q;  3OW2 A;  5M3M G;  5M3M H;  3F2B A;  1E7Z A;  3T1H L;  3CQZ H;  1N34 L;  3D0F A;  3NEN A;  1PYS B;  5C3E G;  4A3F H;  1NMG A;  1CSP A;  4A3J H;  1CKN A;  3KF8 B;  4DV3 L;  2OTJ A;  1WOC A;  1K8A C;  4IFD J;  3A0J A;  1L1O A;  4PZ6 A;  5ELN A;  4HJ7 A;  5ELO A;  3I4N G;  2PQA A;  1GD7 A;  2CWA A;  4DAY B;  3E9I A;  4DPG A;  1VQ6 A;  1HZB A;  4RG1 A;  2LXK A;  1I3Q H;  1AE2 A;  4JG2 A;  3RZO H;  3PUY A;  3JAM c;  1LTL A;  1JE5 A;  2AWN A;  3A5Z B;  1VQF A;  3HKZ G;  3J80 i;  2NVT H;  3E0E A;  1WFQ A;  2N78 A;  4X64 Q;  4DV2 L;  4DR2 L;  4BBR G;  4QY7 A;  1FGU A;  3H3V H;  2I5L X;  1YBY A;  1HJP A;  4A3J G;  3PUZ A;  3M85 A;  3UE1 A;  3KOJ A;  5IWA Q;  3CW2 C;  3BJU A;  4DR1 L;  3HOU G;  3CXC A;  4OXP A;  3FHW A;  1XMQ L;  3PF4 A;  2VL6 A;  3FP9 A;  1FL0 A;  1IBM L;  4HIM A;  3CP0 A;  3K7U C;  2JJQ A;  5LMN L;  4HJ8 A;  4YWK A;  3STB C;  2A8V A;  4JI3 Q;  3CMA A;  4L5S A;  4R4Q A;  2JA9 A;  1FJG Q;  1TWA H;  3UDI A;  4PG3 A;  3PIP A;  1A0I A;  1XJV A;  3ICE A;  2CQO A;  3GTL H;  5IT9 c;  1JT8 A;  1X55 A;  1VQ4 A;  2R92 G;  2AWO A;  2HIV A;  3PUX A;  4UP7 A;  1EWI A;  4NXM Q;  1R9T H;  3PIO A;  2WB1 G;  4DV1 L;  5C0X G;  2NVY H;  4LFA Q;  1IBK Q;  1PH4 A;  3HOV H;  5IY0 A;  1VS0 A;  2E2H H;  4H02 A;  5IP7 G;  5FJ8 H;  2B63 G;  1OXV A;  3U50 C;  1EIF A;  1RL2 A;  1KAW A;  1YHQ A;  2JEB I;  3RR5 A;  2JA7 G;  4JOI A;  1L0W A;  1IL2 A;  3S1N H;  3CAM A;  3ZJY C;  3W1B A;  4A3I G;  2E2J H;  5JJI A;  3JAM i;  1GO3 E;  3J81 j;  3GTG H;  1BKB A;  2WB1 E;  1IYJ B;  4QIW E;  4A3L G;  5C44 G;  4L5Q A;  1MJC A;  5C0X I;  1HNZ L;  1QVG A;  4GKJ L;  1WCM G;  3H3V I;  4GNX A;  2K14 A;  3G4S A;  2ZM6 Q;  4DR3 Q;  2UUB L;  3HOV G;  4GKK L;  1NBW A;  2EIF A;  2R6G A;  1LUZ A;  2IX0 A;  4OX9 L;  4A3L H;  2Q2H A;  3TS0 A;  5E7N A;  4LF8 L;  1N32 L;  1VQN A;  1MIU A;  1SFO H;  4GN4 B;  4JI2 L;  1CKN B;  3CC2 A;  4POF A;  4HIO A;  4J15 A;  5IP9 H;  2PQA B;  4UPA A;  2WP8 J;  5GAH C;  1XMO Q;  2R93 G;  4O0A A;  2NZO A;  4TQU S;  2ZJR A;  4A3K H;  4BA2 I;  3CPF A;  3CCQ A;  3K8A A;  3CF5 A;  1EYG A;  1UEB A;  4JI5 Q;  4LF9 Q;  4JI0 Q;  3CC4 A;  4A3B G;  1SN8 A;  3PO2 H;  2PI2 A;  5DLQ E;  3S2H H;  1PH5 A;  4DR7 Q;  2IHF A;  1VQ9 A;  1WI5 A;  2K5N A;  1IBK L;  2OWO A;  4LF7 Q;  4LFA L;  4OO1 I;  3ER0 A;  4L5R C;  4QJF A;  1C0A A;  1Q81 C;  4NXM L;  4HJA A;  3A5U A;  3I56 A;  3UE0 A;  3CCS A;  3S14 H;  1QZG A;  4A3D H;  3E9H A;  3CD6 A;  2HT1 A;  2UXB Q;  4BBS G;  1N34 Q;  1HZA A;  2MFI A;  2K52 A;  2AMC B;  1HR0 L;  2LXJ A;  2QEX A;  2IX1 A;  2HQL A;  3D31 A;  2Q2U A;  1VQK A;  4A4I A;  2Z0S A;  3M4P A;  5GAE C;  2F4V Q;  1ASY A;  4X62 L;  4YY3 Q;  1G6P A;  2JA5 H;  1HNZ Q;  2UUA L;  3KF6 A;  4DV0 Q;  1HNX L;  4JBM A;  1NTG A;  4A3C G;  4DR4 Q;  2UUB Q;  3I2Z A;  4YCV A;  1QVC A;  4NPS A;  4X65 L;  1Y14 B;  2MO1 A;  3K7A H;  3KLW A;  1I50 H;  4L5T A;  4DUZ Q;  3MEF A;  3HKZ E;  1YHB A;  1NE3 A;  4IO9 A;  1C7Y A;  3HOZ G;  3TQY A;  3HOZ H;  1K3R A;  2NZH A;  2YTV A;  4DK3 C;  3OTO Q;  4DUY L;  2KHI A;  3MXN B;  2BA0 A;  1J6Q A;  5EAY A;  5HGQ A;  4LF6 Q;  2JEA I;  3PO3 H;  4JI4 L;  1HZ9 A;  4JI4 Q;  1C9O A;  2CKZ B;  1SRU A;  4B3S L;  3J7A 5;  4B3R Q;  1HNW L;  1PH8 A;  1BBU A;  1IBM Q;  2JA5 G;  3S16 H;  4BXX H;  4OWT B;  1Q12 A;  4AQY L;  4P74 A;  3STB D;  1VCI A;  1OXS C;  1TWF H;  2K5V A;  1YEZ A;  4GOP C;  3NEL A;  4LUZ A;  2NVQ H;  1Y1W G;  2ES2 A;  4PZ7 A;  1P8L A;  1N36 L;  5LMN W;  1P16 A;  2VY3 A;  4A3M H;  1SR3 A;  3NEM A;  3PSI A;  4XIG S;  3S1R H;  4A3E H;  2F4V L;  3RNU A;  1K8G A;  2B29 A;  1M90 C;  1I94 Q;  2KCM A;  2EXD A;  1MKH A;  4R4I A;  1NY4 A;  4X6A H;  2UUC L;  1XNQ Q;  1D7Q A;  3K80 C;  2AKW B;  4GN5 A;  4JI7 L;  4IFD I;  4DV5 Q;  4JBW A;  5M5X H;  3FKI G;  2E5L Q;  1UE1 A;  4AH6 A;  1WJJ A;  4DR5 L;  3TS2 A;  4FDB A;  2PI2 E;  1TWC H;  4OO1 G;  3CCM A;  4R4C A;  2CCZ A;  5FLX c;  1YI2 A;  4C3H H;  4GOP B;  2UXD L;  2I5H A;  4QGU A;  4HJ9 A;  1W2B A;  1PH6 A;  4C2M H;  3A74 A;  1V43 A;  4LUO A;  3HOW H;  4IOA A;  3IRB A;  2BH8 A;  4DR2 Q;  1K9M C;  4GKK Q;  3M7N A;  4X62 Q;  4P71 A;  4A93 H;  2ZJQ A;  4LF4 L;  2EQS A;  1LM0 A;  2E8G A;  2OQ0 A;  1VQI A;  4PMW A;  1ASZ A;  2VUM G;  3F2C A;  4A3F G;  3T1Y Q;  1PV4 A;  4B3S Q;  3W1G A;  3GD7 A;  1VQD A;  5IWA L;  4GNX C;  3BZK A;  3Q8D A;  3K0X A;  3GDE A;  2I0Q A;  1S72 A;  1X65 A;  4Y52 H;  2IY5 B;  1E1T A;  2GN5 A;  5FLM H;  2YU9 H;  4A3I H;  2Z6K A;  3GO5 A;  2R93 H;  4AQY Q;  1PYB A;  1XTD A;  3CCJ A;  2JA8 H;  5C44 H;  3PO2 G;  4IOC A;  3AEV A;  4B3R L;  1FJG L;  4K0K Q;  1VQ5 A;  4A93 G;  1X6O A;  3F1Z A;  4HIK A;  3KF6 B;  1W3S A;  1I94 L;  3NBH B;  1K73 C;  4LF5 L;  3ULP A;  4MNO A;  3F2D A;  4PZ8 A;  2QA4 A;  4BA1 I;  1S3O A;  1KRT A;  1HZC A;  2XTI A;  2C35 B;  3EN2 A;  1HR0 Q;  2GVA A;  1H95 A;  5BR8 Q;  1KQS A;  2MQH A;  1EOV A;  1EIY B;  1EQQ A;  3GTK H;  2NVX H;  2IHE A;  2Y0S E;  3UDX A;  3G71 A;  2OCE A;  4LNQ A;  2ATW A;  1AH9 A;  4DV4 L;  4POG A;  4RMF A;  3TRE A;  5FLM G;  1X54 A;  1TWH H;  4LFB Q;  2DGY A;  3TRZ A;  1OXU A;  4R4T A;  1I6H H;  3F8T A;  5GRO A;  2D62 A;  4APV A;  2KEN A;  2L15 A;  2RCN A;  1Q1E A;  1X56 A;  4BY7 G;  4OWX B;  1QUQ B;  2K75 A;  1N8R C;  4DR6 L;  4A3C H;  2ZTD A;  2ZM6 L;  4DR3 L;  3ULL A;  4DUY Q;  4X64 L;  2KCT A;  4DV2 Q;  4GKJ Q;  1Y1V H;  1HR0 W;  3GTO H;  2QGQ A;  1N32 Q;  2DUD A;  3HOW G;  1FVI A;  4DUZ L;  2JE6 I;  1OXX K;  4OON A;  4B3T Q;  3TEH B;  1E3P A;  2RF4 A;  3B6Y A;  3KDF B;  4B3T L;  4JI3 L;  2VUM H;  3HOY G;  1PH1 A;  4X66 Q;  2LSS A;  3RZD H;  3RN5 A;  3G6E A;  1E1O A;  3I7F A;  3H15 A;  1A8V A;  2K5H A;  1XNR Q;  2ALY B;  1EQR A;  4OWW B;  3GTQ H;  4JV5 Q;  1N33 Q;  3RLF A;  3CCU A;  3M3Y H;  1VQJ A;  4BXX G;  4DV7 L;  1A63 A;  1Z9F A;  4O2D A;  3CME A;  2R92 H;  1HH2 P;  1PH3 A;  4AIM A;  3BZC A;  1Y1V G;  4JI8 Q;  1GVP A;  4GOP A;  3L0O A;  4DNI A;  3L2P A;  3U4Z A;  2R7Z G;  1K83 H;  2YTX A;  4JC0 A;  5IYB H;  1PA6 A;  1UWV A;  5K36 G;  1NMF A;  4EX5 A;  1CUK A;  4MZ9 A;  4JBJ A;  3EBE A;  5HY6 A;  4R1J A;  3G48 A;  4TVA B;  4LF7 L;  3PV0 A;  1X9N A;  5BR8 L;  5LMU Q;  4DK6 C;  5JJL A;  1BVS A;  4MTN A;  2UXB L;  3PUV A;  2Q2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...