3HOWG

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 31
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3howG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3howG01
1KHIA 2L15A 4IPGA 4YCVA 3I4NH 4MNOA 4YHHL 4POFA 3I55A 5IYDH 1XPUA 4OX9L 5LMNW 2ZJRA 4DPGA 2B29A 1U0LA 4A3DG 3KDFB 1HNZL 1VQ5A 1A8VA 3KF6B 4LF4L 1XMQQ 3PUXA 4JI3Q 4GLAC 3S1RH 2MQHA 4KHPL 1BKBA 1UE7A 3CC2A 4L5QA 4DV2Q 3A5ZB 3GTOH 2RF4A 3F2CA 4GOPB 1A0IA 3PIPA 4RMFA 1IBML 5C0XG 4LFBQ 1KRSA 1BBWA 4MZ9A 2E8GA 2UUCQ 5GAGC 2NZOA 3KOJA 5C3EH 3UDFA 3JAMc 1CSQA 4BBSH 4OXPA 2BA1A 4KI0A 2Z0SA 3HOWH 3I4OA 5M5YH 5IYBG 1N36L 2ASBA 4DR5L 3GTPH 4A3GH 4YY3L 1YHAA 1CKMA 5IYBH 4GLXA 4AQYQ 1K73C 1K8AC 2I0QA 3DLLA 4JI1Q 1EUJA 1I94L 4TQUS 4LFBL 3GTMH 4EQ5A 1MKHA 5J3BA 1CKOA 1SN8A 4PG3A 5IP9G 3CP0A 3T1YQ 4PZ8A 1KD1C 1YVCA 3IRBA 1EQQA 2Y0SE 2R92H 4LUOA 1L1OA 4JI7Q 3PO2G 4R1JA 1W2BA 4Y7NH 1SLJA 5AJ3L 4DR5Q 2Q2UA 1C7YA 2AHOB 4KLKA 3FKIH 5IE8A 4UY8C 2WB1E 1VQGA 1PYSB 4JCVE 5H1SE 4DV5Q 4GKKL 4A76A 4DV7L 1NE3A 1XMOL 1BVSA 2H5XA 4LF5Q 4AH6A 2JA6H 2B3GA 2VUMH 1YJWA 1VQ7A 1JJGA 1VQKA 3KJOA 1E3PA 3HOZH 2ZM6Q 1JT8A 1I50H 1GVPA 1NMGA 2RCNA 1QUQA 4DR1Q 3U4ZA 4JV5L 1PFSA 1P16A 4A3GG 5FLMH 3M4PA 1D8LA 2OTJA 3CCQA 3H3VI 4GKKQ 4TVAB 3S1QH 4A3CG 3K7UC 2JA7G 4LF5L 2K50A 1SE8A 3CCMA 5M3FG 3HOWG 2WB1G 4JI5L 4LF7L 3L0OA 1PYBA 1PH2A 3CC4A 2NVTH 4NPSA 2HHHQ 2JE6I 4P72A 3MEFA 1S3OA 1HNXL 5JJLA 1IXRA 2XTIA 2NVQH 5ELOA 4A4IA 1RL2A 2JEBI 1N33Q 4A3EG 4LNQA 2VQEQ 4B3SQ 3HOUH 1Q8KA 1CUKA 3RZDH 3E9HA 2OQKA 1G6PA 4UP9A 1HR0W 1VQJA 1JJ2A 1E22A 4GNXA 1FGUA 4BY1G 3OYYA 4LF8L 4OX9Q 1FJGL 3J7A5 4DV4Q 1EIFA 4DV1L 4JBMA 2CWAA 4P75A 4DR6Q 4JI7L 4DNIA 3W1BA 2R7FA 1TWGH 3B6YA 4QIWE 2RHQB 3UE0A 4A3LG 4JG2A 2UXCQ 4X65Q 3TS2A 4JI8L 1X3EA 4X64L 1N34L 4R4IA 3GTLH 4A3LH 3OW2A 3CW2C 1EOVA 1TWAH 2OTLA 1JMCA 4OO1I 2PNHA 4A3MH 3F8TA 5IYDG 3F1ZA 1VQEA 2LSSA 2EQSA 1QVGA 1FVIA 1XNRQ 2JA5G 4B3TQ 3DM3A 3JAMi 4A3BG 1YZ6A 1E1TA 1UE6A 2HIVA 3KFUA 2KCTA 1B8AA 2K75A 4X64Q 1PH6A 1WCMH 2K52A 3HOXG 3H15A 4YWKA 4DUYL 4GNXB 4GOPC 4EX5A 2R7ZH 2KCMA 4BBRH 3OTOQ 4HIKA 1Z47A 5C0XI 5IP7H 1JB7A 1N9WA 3NELA 4BY7H 2R93G 4IPDA 3PF5A 2MFIA 1K0RA 1FL0A 3BZCA 4R4QA 4BA1I 4DAMA 1IBKL 1XNRL 2IHFA 1OXXK 3AFQA 2VQFQ 3S15H 5JJKA 4LFCL 3UDIA 2JQOA 5FLMG 5JJIA 2BH8A 3ULPA 1MIUA 4H02A 3HOYG 4UP8A 5IY0A 3KF8B 4YWMA 4HJAA 1VQLA 2IT1A 2CWPA 2N49A 3PUWA 4JC0A 3T1HQ 3OTOL 2ES2A 2B63G 3S2DH 2ZJQA 4JBKA 3TREA 4DV4L 2IX1A 4JYAL 4GKJQ 3EIVA 1V9PA 1UE5A 4X62Q 3M85A 4JI4L 3PIOA 1E1OA 2OWOA 1KXLA 4R4CA 2R6GA 4O0AA 1Y1VG 1GKHA 2Q2TA 2JA5H 2D62A 4A75A 1PVOA 2R93H 4NXMQ 1MJEA 4PZ6A 2IY5B 4JI0Q 1VQHA 4JI5Q 4DR7L 4WJ3M 2UUAQ 2JA9A 4LW1A 4L5SA 2JA8G 5IT9c 4DUZQ 2DGYA 5GAEC 1HNXQ 3I4MH 2ZTCA 2E2JH 1HZ9A 4LUZA 2F52A 2KHJA 3RNUA 4DR3Q 4WJ4A 4K0KQ 3PF4A 1CSPA 1KAWA 1XPOA 3F2BA 1X9NA 4PMWA 4DV5L 3GD7A 3CMAA 1HH2P 3LGJA 4AYBG 3RN2A 1TWCH 2AKWB 3STBC 4A3DH 1TXYA 1CKNA 1KL9A 4HJ5A 3KYHC 4HJ8A 1V1QA 3PUZA 3CCRA 3RZOH 3J80i 4LFAQ 3AEVA 1DGSA 2UXCL 3CPFA 3AYHB 1TWFH 1A62A 5JEAJ 2CCZA 1WYDA 4ME3A 3SGIA 4JI1L 1XNQQ 1S40A 2UXBQ 5GROA 1SMXA 4OWXB 4DK3C 4NXNL 3CC7A 1L2FA 3HOZG 2ZTDA 2NN6G 3CQZH 3HOVG 4JYAQ 2Q2IA 3L7ZC 2BA0A 1NY4A 1HJPA 4OONA 4XIGS 1HNZQ 5C44H 2ZTEA 2YYZA 1HNWL 1PH1A 3J81c 2F3IA 3ZJYC 1WFQA 1LM0A 1YNXA 3FHWA 4QL5A 4DAYB 2CQOA 5C4XH 1XJVA 3STBD 3CCJA 3TRZA 4A3KH 1OTCA 2NVXH 2UUCL 1X6OA 2UXDL 2B63H 3G6EA 3W5OA 5FJ8G 1XTDA 4C3HH 5M3MG 3HKZG 3U4VA 3D31A 3EBEA 4DUZL 1IL2A 2N3SA 4AIMA 5IP9H 4UPAA 2DUDA 3NENA 2VQFL 4L5TA 5LMUQ 4HIOA 2GN5A 1P8LA 4YY3Q 3TQYA 2EXDA 5LMNL 4IFDI 3CCVA 4DV0L 4GOPA 1N8RC 1HZCA 1G51A 1N34Q 4LUVA 2C35B 2R92G 2VUMG 4JI2Q 1GD7A 1MJCA 4BBRG 1X54A 2OCEA 4DK6C 2WP8J 2R7ZG 4LF6Q 1LTLA 4IFDJ 1NTGA 1L1OC 2PQAB 3HOXH 4DR2Q 4A3JH 2D0OA 3I56A 2MO0A 2HT1A 4HIMA 1EFWA 3I7FA 4AYBE 3H0GH 1M90C 2K5HA 2VQEL 4B3SL 3F2DA 1KRTA 1WJJA 2ID0A 1HZAA 5ELNA 4YWLA 2D0PA 2I5HA 2MO1A 3PUVA 5C0XJ 5LMNQ 1N33L 2CFMA 1EWIA 1OXTA 3PV0A 4BXXG 3RLNA 3H0GG 2KENA 2VW9A 4ALPA 4JI6L 2E5LL 5BR8Q 4BA2I 1VQAA 3K0XA 3KDFA 1GM5A 4DR3L 3KLWA 1VCIA 2GVAA 1YI2A 1VQCA 1OXVA 4IPHA 3WWVA 1M1KC 1X56A 2YV5A 4BBSG 3G48A 1I94Q 1K9MC 2F4VQ 4A3IH 2YTVA 1VQFA 1H95A 4BY1H 4X66Q 4LF7Q 2E2HH 1VS0A 4Y52H 2N78A 3G4SA 1QVCA 3RN5A 3PCOB 5IWAL 4RG1A 3T1YL 1PH5A 2E2IH 1GO3E 3M7NA 5IYCH 5HGQA 4DKAC 5LMUL 1X55A 3K8AA 1YBYA 4FDBA 5C4XG 4KHPQ 1SROA 1BBUA 3HKSA 2IHEA 3K7AH 1C0AA 2YTXA 1HR0Q 3GTQH 1PH9A 4DUYQ 1J5EQ 3PSIA 4JOIC 1JE5A 2N8NA 4NB3A 4OWTB 1LUZA 4P73A 3TEHB 3VDYA 1UWVA 3S24A 3Q8DA 1LYLA 2AWOA 3ER0A 4OWWB 1PHJA 2GVBA 3UE1A 4DV1Q 3NBHB 4IO9A 4LF9L 3PO3H 4DR1L 2VS1A 2JEAI 3BU2A 4IFDG 2UU9Q 4AQYL 2VY3A 3TS0A 4X65L 1B70B 1QZGA 3FKIG 1HR0L 3CD6A 1HZBA 1IYJB 3CF5A 4IOAA 1Q12A 1VQNA 1YHBA 5IYCG 1S72A 5IP7G 1QVFA 4JBJA 1PV4A 2OQ0A 2K5VA 3HFZB 2CKZB 2MNAA 3AFPA 1W3SA 2JJQA 4X62L 5C3EG 2HHHL 1WCMG 1XMQL 2HIXA 2NN6I 4A3IG 4IJLA 2PQAA 1K8GA 4GN3B 1J6QA 4YCWA 1Y14B 3CCSA 2UUBQ 1VQPA 3GTGH 3M3YH 4DV3L 4YCUA 2LXJA 1C9OA 3U58A 1VQ9A 4NXML 4QQBX 2UXBL 1I6HH 1VQ6A 4A3MG 1OXSC 1R9TH 3CCEA 3S14H 3K80C 4NXNQ 1YEZA 3S1MH 4DR7Q 4PZ7A 5GQOA 4DR4Q 3RR5A 2KBNA 2KHIA 4JBWA 4R4TA 1WOCA 2JK8A 1IBLL 3BZKA 4DV6L 1Q86C 3I4NG 4K0KL 1O7IA 4IOCA 3CXCA 4A3EH 1IZ6A 2PMZE 2R7DA 1NMFA 2A1AA 1X3FA 2ATWA 2JA8H 4A3JG 3AQQA 1VQDA 1E24A 2K5NA 5EAYA 2E5LQ 1Q82C 3D0FA 3KJPA 4XTCS 5AJ3Q 4LF4Q 4A3KG 1Q1BA 1PH4A 5K36G 4A93G 3A74A 1Q46A 3GDEA 1NBWA 4UP7A 1B7YB 2AMCB 3G71A 3CMEA 3ULJA 3HOYH 4X6AH 1XMOQ 1VQBA 1VQ8A 4R4OA 2Y0SG 3A5UA 2A19A 1XNQL 3CPWA 4LF8Q 1VQ4A 2QA4A 3H3VH 4LF6L 2VNUD 4QGUA 2ZM6L 2YU9H 1IBKQ 3UDXA 2JA7H 2Z6KA 2WFWA 1XPRA 1JJCB 5JEAG 1Y1VH 1EQRA 2A8VA 3ULLA 3ERSX 4QJFA 1ASZA 3J80c 1UE1A 2ALYB 1L0WA 4A3BH 2IX0A 3PO2H 1PH7A 1PH8A 1AE3A 3HOVH 2QEXA 3GTJH 3BJUA 3UDGA 4C2MH 3FP9A 4GLVB 4A3FG 1IBLQ 1NJIC 3CCLA 1KC8C 4B3MQ 4L5RC 3S1NH 4LFAL 2UU9L 3E9IA 1VQMA 3M4OH 5C44G 4B3RL 4KHZA 4GN5A 4POGA 1I5FA 2QGQA 2YTYA 2WAQG 4GN4B 1K3RA 4LWCA 3U50C 4DV7Q 1KQSA 4HJ9A 1I3QH 5E7NA 1YJ9A 2UUAL 1X3GA 1CKNB 2AWNA 3E0EA 3JC66 3KF6A 3PUYA 4DR2L 1FJGQ 2RHSB 1A63A 4IPCA 4C3JH 1E7ZA 3J7ZC 1VQOA 4P74A 4BXXH 1Q81C 3M4QA 3K81C 4JV5Q 2PI2E 1EIYB 4LFCQ 1HNWQ 2UUBL 4C3IH 1KIXA 5M5XH 1OXUA 4APVA 1N32Q 1SRUA 3ICEA 3S16H 4DV3Q 2NVYH 3J81i 3T1HL 2K14A 4JOIA 1VQIA 4A3FH 2I5MX 1X65A 1AE2A 1SR3A 3RLOA 5C4JH 1ASYA 5HY6A 4DR4L 1RIPA 1EYGA 4JI6Q 1PH3A 2BH2A 1WI5A 1YIJA 4QY7A 4JI3L 3S17H 1YITA 5DLQE 4B3TL 1N32L 2VZAA 4DV2L 3GTKH 3I4MG 2F4VL 2LXKA 3I2ZA 3PGZA 5M5WH 2K4KA 1G291 2EIFA 5GADC 2I5LX 4J15A 4O2DA 4GNXC 1Q7YC 4X66L 4JI0L 4JI2L 1L1OB 1T9HA 3W1GA 1D7QA 3NEMA 5M3MH 3J81j 1YJNA 5FJ8H 5IWAQ 2V1CC 5M3FH 4MTNA 3RLFA 4DR6L 3HOUG 2JA6G 3A0JA 4B3ML 1K83H 2WAQE 2XGTA 5GAHC 2Q2HA 1N36Q 3S2HH 1Y1WH 3L2PA 4B3RQ 1SFOH 4JI8Q 2NZHA 1Y1WG 1J5EL 2ZJPA 3PO3G 3HKZE 2UXDQ 2VL6A 1Q1EA 3CCUA 4IJHA 2Z6KC 3EN2A 4YHHQ 1V43A 2HQLA 4BY7G 1QUQB 4GKJL 4HIDA 5BR8L 4A3CH 1TWHH 1UEBA 2PI2A 4HJ7A 3GO5A 4JI4Q 4DV6Q 1QZHA 4LF9Q 1Z9FA 1AH9A 4P71A 1PA6A 1U5KA 5FLXc 4A93H 3CAMA 3MXNB 4GS3A 2FXQA 1YHQA 4OO1G 4DV0Q 3M9BA 1IBMQ
chains in the Genus database with same CATH superfamily
4OL7A 3KUPA 3Q22A 2WTFA 4POFA 4KY7A 5IYDH 4I7HA 3RIZA 4DPGA 4NP5A 1U0LA 4MV6A 3V4SA 5CA0F 1HNZL 4I7ZC 1YNJD 1ZKOA 2I46A 4L5QA 4J8QA 3V6KA 4B9WA 3JAMW 4S3SA 2RF4A 3MFIA 1DOLA 1IBML 2ZJTA 4RMFA 4LFBQ 4EYIB 2E8GA 2RQXA 2B2YA 2ZDQA 5KFCA 1HFGA 2K05A 1CZGA 1ZEQX 3PIP3 1CSQA 3N6XA 3GTPA 3ONAB 1B4OA 2K04A 2FP4B 2E75C 1YHAA 3QIAA 4GLXA 1K8AC 1U4MA 2E2IB 4LF5H 2QDLA 2F3VA 4LFBL 2Z6BA 5H80A 1E2WA 4ECWA 1SN8A 4X3TA 3ORRA 1N48A 2QKIC 2WE6A 4MA0A 4ECZA 4G7OC 4RZQA 1KTKA 3MXPA 5FD6A 2K1BA 5K5PA 1WD0A 2AQ2B 4UY8C 4I55F 2X6LA 3GP7A 1PYSB 4CHTB 1H9MA 1BVSA 3OW7A 1G2TA 2JA6H 2CQAA 2HHHH 2EYMA 3BYTB 3CKIB 1EY4A 4DK1A 1GVPA 2PZUA 2RCNA 1S5CD 2W6QA 3T56B 3R8BA 5I4DA 5DQHA 5FLMH 1HNWH 1GLVA 2OTJA 4Q44A 3H3VI 1PTOB 5KFAA 3N40P 3M9NB 3K7UC 4RGMA 1WTXA 5E3FA 3CCMA 4U68A 3EJIA 3CC4A 1JE4A 5KNDA 4ED2A 2NVYB 1S3OA 4P2CB 4RAZA 1IXRA 4A4IA 4YJ2F 1S0MA 5CGKA 5EOYA 4LNQA 1CUKA 1XMOH 4IAJA 1HR0H 4UP9A 5FD5A 1S5BD 1DOKA 2LKVA 1EHIA 4OX9Q 2R61A 3N44B 2R93B 1TWHB 2DY7A 4P75A 4A3IB 1KBLA 1CI3M 4UHVA 4WRDA 4RCOA 2R7FA 4QIWE 2PMZA 5LXTF 2RHQB 4MTEA 4Q8EA 2I8CA 4X65Q 3NPPA 2YCHA 4LFCH 4JI8L 1N33H 3MFGA 2W8KA 4X64L 4JI2H 3CW2C 4DV3H 3OHAA 4OO1I 1JMCA 2WB1B 4LF6H 4RB1A 1U9RA 2FJ2A 2EQSA 2B63A 4B3MH 1XNRQ 2FLPA 1NAPA 2HIVA 1UE6A 3NP8A 1JDEA 2NZ1D 4X64Q 1B8AA 4EFBA 3RZOB 3H15A 4ECYA 4GOPC 1FNVA 3OTOQ 1ICFB 2R7ZB 5BR8H 2R93A 3TZDA 5C0XI 5IP7H 2Q8IB 3PF5A 2MFIA 2VUMA 3BZCA 2EJMA 4DAMA 1XNRL 4HCEA 3AFQA 1XTCD 2CW0C 4ECUA 3HB9A 2OXPA 2JQOA 3FDSA 5JJIA 1GSHA 2BH8A 5JJZA 3GTGB 1MIUA 3I4MB 4H02A 1VQLA 4YWMA 1DXMA 2CWPA 3PIO3 3OTOL 2W6ZA 5JVG3 2ZJQA 4PWQA 4JBKA 4C3JB 4DV4L 2IX1A 4JYAL 3R23A 3M9OB 4JI4L 1V9PA 4X62Q 2KVMA 1CA6A 2OWOA 1LACA 4R4CA 3N8DA 3H20A 4FS2A 4R8UB 5KFYA 5KG7A 4AQYH 4DUYH 3RV4A 1I4RA 5KYLA 4NXMQ 3M4YA 2IY5B 1VQHA 4JI5Q 1SEIA 4DR7L 3IAYA 2RVLA 5FO8B 3VPBA 2JA8G 4ME5A 4DUZQ 2DGYA 2HDMA 1BXTA 1HNXQ 2V9WA 2KHSA 2ZTCA 4CDCC 4OEMB 3RNUA 2KHJA 4K14A 2KSWA 2QDBA 3GTKB 1S5DD 1XPOA 1NR2A 4A93B 3F2BA 4DV5L 3OSOA 1AUXA 1VKZA 1VMPA 4C3HB 4ECVA 3HBLA 4A3DH 3NTHA 4HJ8A 1V1QA 3S1QB 3CCRA 5L1JA 1DGSA 2FMAA 3V6HA 1H9KA 3AYHB 4F7XA 1RF2D 2CCZA 2M05A 1TS4A 2L11A 5EKIA 3RAQA 1XDNA 4JI1L 3GIIA 3IFTA 1RJTA 3FEWX 1XNQQ 1D2BA 5C1OA 4E6IA 3P7JA 4OWXB 4K8IA 4NXNL 1L2FA 2BA0A 4FVMA 1NY4A 1DCZA 1HJPA 1I4GA 4L6TB 4OONA 4XIGS 4JUZA 3E6ZX 4JV0A 1CQIB 1EY8A 2FLNA 4HAEA 1PFMA 3ZJYC 5KFPA 2VQEH 1VBGA 4U7CA 1OTCA 2NVXH 1X6OA 2UXDL 2B63H 5FJ8G 5KFWA 2TMPA 1PRTD 2N3SA 4AIMA 3HOUB 1N56A 5CV8A 2VQFL 4DR6H 1D1IA 4HIOA 5LMUQ 2R86A 4F4WA 3UFXB 1P8LA 3TQYA 2NVQB 5KT5A 4DAPA 1PXUA 1PX2A 3BYYB 1HZCA 1G51A 5KFHA 2C35B 1IL8A 2VUMG 4LF8H 1X54A 3KBGA 1L1OC 2PQAB 3HOXH 4DR2Q 4G7ZC 3RAXA 3I56A 5F2DA 2MO0A 3RB4A 2C2EA 4HIMA 3VYTA 5K36H 4RGNA 2K5HA 4TQSA 4B3SL 1SJED 3F2DA 1WJJA 2ID0A 1HZAA 5ELNA 4IR9A 2E2IA 4F4YA 2TSSA 4EVOA 3MHBA 2V58A 2W7PA 3RBEA 4O3SA 1JWSD 3RLNA 4K5VA 2SDFA 1UC8A 4MAMA 2NU8B 1IYVA 4OX9H 3TDQA 2AUKA 1EY9A 3MEHA 4DR3L 3KLWA 4LF9H 3DEPA 5KGUA 2V4RA 4RAYA 2XGPA 4BBSG 1GGOA 3FPUB 4FXDA 1A6XA 4X65H 2BE5C 1I6VC 4ECSA 2V5AA 1F9QA 4BY1H 2X69A 2NU6B 5I6YA 4X66Q 3J7AK 3HEJA 4Y52H 2N78A 1JR0D 5IWAL 4RG1A 2BQUA 2LFNA 2RGRA 1GO3E 2IL8A 1B6SA 3I72A 1QJOA 3O13A 5JVDF 1JORA 4KJOA 2HUGA 1BO0A 1YBYA 3K8AA 2G9HD 5C4XG 2W6NA 5C44B 4XZ3B 3QOJA 3GTQH 1PH9A 1J5EQ 2GLTA 4JOIC 2XCAA 1FGBD 4F4ZA 2N8NA 4IWXA 1S10A 3LWUA 1LUZA 5M3FB 1TWAB 1TU2B 2PW7A 1NCVA 1UWVA 3S24A 3TQ1A 5J1ZA 4DAYA 1LYLA 2AWOA 3G6JB 3VR3A 2WYOA 2GVBA 4CGYB 2F0LA 2D5DA 3LWEA 3PO3H 1S0NA 1PLFA 5DM63 3MWEA 3D4RA 4ETSA 3GTMA 1VF5C 2VY3A 3TS0A 2MPMA 1HZBA 4QIWB 1TWHA 4RHSA 2OQ0A 4UCSA 3H3VC 1W3SA 1RJQA 2A6HC 1WCMG 3E3XA 3IG0A 1WSCA 2F0DA 2FPGB 2PQAA 3J81L 1HA5A 1TY0A 1AN8A 3MWDA 4YCUA 2L4NA 3U58A 5KT3A 3GIMA 1CA5A 4R7RA 5C4ZA 5FK9C 3WNZA 1I6HH 4A3MG 1OXSC 1R9TH 2A69C 3CCEA 2R7NA 4JI5H 1YEZA 2DN8A 2V4QA 3VA7A 2A6EC 2ZDGA 4RUAA 1RTOA 2KHIA 3KHGA 3FKIA 3K5HA 1AUVA 4EBCA 1LTAD 4KN4C 1O7IA 2R7DA 4BWSC 1V51A 2A1AA 3NBIA 2OLSA 1VDZA 3NHHA 2E5LQ 3K7AB 1ZETA 3MA2B 5K36G 4RGOS 4QWAA 4A93G 2C28A 1NBWA 4C56C 3G71A 3CMEA 3HOYH 3BJYA 1VQBA 1CQVA 1RD9D 2B2UC 1K3BC 1PFNA 3CPWA 1Z2PX 5D1PA 1VQ4A 2XRQD 1J8IA 1IBLH 2B8FA 2FMCA 3UDXA 2Z6KA 2WFWA 2JA7H 1MZBA 1RJPA 2WB1A 4UAIA 4KN7C 5JEAG 4O3NA 3MJFA 5JVLA 2KA7A 4J9QA 3JAML 1K1QA 4BWGB 2F0WA 4A3BH 2RDJA 2I87A 3BQ0A 3FMAA 1S0OA 4K2KA 2JSOA 1EUDB 1QNKA 4IZ8A 2FHTA 2Z8LA 4GLVB 1BDOA 1ET6A 4A3KB 1IBKH 1VMCA 4LFAL 2BOSA 5HGTA 3M4OH 4MTDA 1SYXB 3M4IA 2JEFA 3EFXD 4GN5A 3QR8A 3A8JE 3HP3A 1K3RA 2Y0SB 4IUNA 4HJ9A 3PN1A 1SE4A 5E7NA 1B44D 4O2AF 1BR9A 2UUAL 5KFNA 3KHRA 2ENBA 5IIFA 5KFZA 2RHSB 1BCPD 1VQOA 4J1MA 4C3JH 3H6MA 3RGXA 2PVPA 5A2QE 2JA6B 4YQWA 3K81C 2UXCH 1HNWQ 1N32Q 5F9LA 3ICEA 3S16H 3S15B 3J81i 1LTGD 1TVXA 5DGBA 1TY2A 2IBKA 4JOIA 4A3FH 2I5MX 1SR3A 4FF3A 3C46A 3GV6A 4WBNF 3Q8SB 2RSOA 2O03A 2BH2A 3Q1KA 4KKSA 4QY7A 4JI3L 2ASJA 1PTOC 1N32L 2ZXRA 3T5HA 5L37A 1M0TA 1G291 4J15A 1AP0A 2KUMA 1LT5D 1L1OB 3Q8PB 1YJNA 5M3FH 5M3MB 4RH6A 1CE8A 1HUNA 3A0JA 5A2QL 2XGTA 1N36Q 2FK1A 1E2VA 1Y1WH 4X3SA 5CAEB 4DV0H 3L2PA 1F9PA 1M8AA 4HEDA 1EZ6A 1SFOH 2UUBH 2C5CA 1BOSA 1Q3LA 2J9GA 4YR0A 3MZ5A 3HKZE 5ELBA 3CCUA 3C1EA 4IJHA 5HBRB 4KKTA 3HOZB 4YHHQ 2KECA 2K32A 3VMMA 1TWHH 4HJ7A 3GO5A 4XX0B 1QZHA 2PN1A 1Z9FA 2LS01 2R85A 2BDOA 5FLXc 4RKBA 2FXQA 2R8IA 3PUXA 3M9BA 1KHIA 3I4NH 4QWCA 4YHHL 3I55A 1S97A 3RTXA 2FJZA 3KDFB 5KFBA 4ECRA 1VQ5A 2NU7B 1B33N 3V05A 1AZPA 2A69D 3DWAA 3FDTA 1EWCA 3KF6B 1XMQQ 4LF4L 1TWFA 1Y1VA 4WD3A 3S1RH 3V4ZA 1S5ED 4DV2Q 4DNTB 2CW0D 3F2CA 1ZYRC 4GOPB 1Q90A 1A0IA 3PIPA 1CK1A 4Q0YA 4ZOLF 5I2XA 2NZOA 3KOJA 3UDFA 4KV6A 1TS5A 5EPKA 2EYJA 2Z0SA 3I4OA 1SNCA 5M5YH 1EIGA 3TZUA 3GTPH 1K73C 1CKMA 4AQYQ 3DLLA 4JI1Q 4TQUS 4QCLA 5LL6S 2M9VA 5IP9G 4ED3A 2HGSA 3HGBA 3T1YQ 4PZ8A 3VYSA 3NBHA 1HNXH 4RNNA 4DR1H 2R92H 4JI7Q 1L1OA 4HNVA 2BR0A 2JA5A 5CBEE 2OH2A 1SLJA 5C4HA 4DAVA 2AHOB 1C7YA 3FKIH 5IE8A 3GIKA 1SMYC 3OWFA 3J7YW 5H1SE 2DJGC 2M00A 4YP3A 1PZID 4A76A 2W9AA 4DV7L 1XMOL 4I7AA 3T53B 2B3GA 4KJNA 1Z2NX 1VQ7A 3VR2A 1JJGA 2UVWA 3RV3A 1E3PA 3UI2A 2ZM6Q 3J81W 2XGQA 2E2HA 3U4ZA 4JV5L 4A3GG 1JWUD 1CQFA 5BPFA 4DR5H 3CCQA 4TVAB 3S1QH 3RFCA 4EQNA 1EY7A 1VF7A 2JA7G 3H0GB 4H44C 4DNRB 1I6UA 1PYBA 2ICEC 3W3AA 1PH2A 2NVTH 4A2BA 4B9XA 2VXWA 4XYMB 4J9SA 2XTIA 5ELOA 4DL6A 2F0MA 2VQEQ 1G2SA 1Q8KA 4RA8A 2OQKA 2RKSA 4GKKH 1E22A 1FJGL 3OYYA 1MGSA 2F0HA 2J7ZA 1SYCA 2BQ3A 4DR6Q 1PZKD 5A2QW 2AU0A 4DNIA 4IRKA 3B6YA 3UE0A 3M4OB 2HVQA 4A3LG 1KDCA 3SHLA 2DJFC 2UXCQ 3GTPB 4ME6A 2F4VH 2W8LA 4EBEA 1N34L 4R4IA 3NWTA 4LF7H 4OHJA 1ILPA 1TWCA 3J80L 1TWAH 4MV9A 1PFBA 4A3MH 3F8TA 2JA7A 3F1ZA 5D65A 2L12A 2DLNA 3WDNA 3VR6A 5LA6F 4JI4H 2JA5G 4F87A 4B3TQ 4V190 1YZ6A 1E1TA 1Q8IA 2YL2A 1E0BA 2CHBD 3KFUA 2FMMA 2KCTA 2KEDA 1PH6A 1GUTA 4PV1C 4YWKA 4DUYL 4GNXB 3RBDA 2A68D 3A8IE 4BBRH 1LT6D 4G7HC 4DL4A 4JVZA 1N9WA 3NELA 4BY7H 4DR7H 5I2YA 2PZTA 1OXXK 2UU9H 5BN4A 3UDIA 3MAQA 2ATLA 1I50A 4JC0A 2ES2A 3S2DH 1KNEA 2YW2A 4GKJQ 1SNQA 3EIVA 1UE5A 3MR3A 1E1OA 3CHBD 2R8HA 2R6GA 1KEEA 1S03G 1Y1WB 2Q2TA 1DV1A 3PO3B 4NKLA 3KAKA 4O4IF 4PZ6A 2R7ZA 2R8KA 1STHA 1F2YA 4A3JB 2G9DA 2UUAQ 4WORA 4L5SA 1WCMA 5KG1A 5C0XH 2W57A 1LABA 1LT4D 2R6FA 1AN7A 4YIJA 3H91A 1KAWA 4CKEA 1X9NA 4PMWA 3JAME 4ULLA 1BBXC 3GLKA 1X32A 2ICIA 4H7BA 1TWCH 3STBC 1D5ZC 1TXYA 1GJXA 3TIIA 3HKZB 1IOWA 2L0CA 2LY7A 1KL9A 5KFQA 4E4TA 4O4LF 3SK6A 2VPQA 3K5LA 2VA2A 1KAAA 4DL7A 3RZOH 1MI2A 4LFAQ 2EXZA 2Z4HA 3CPFA 1TWFH 1V1PB 5KX5F 1WYDA 2A74C 5E4XA 1DOMA 1S40A 3EPIA 3OSPA 5GROA 4O1NA 3CC7A 3A7AB 2EYFA 2ZTDA 1IOVA 1CT1D 3HOVG 5C3EB 3L7ZC 4JYAQ 3JSLA 1WTOA 2YZMA 4C5AA 5C44H 4HNTA 5TSSA 1HNWL 1F9RA 3CRLC 4LMQD 5JQWA 2F3IA 1LM0A 4B3SH 2OF1A 3FHWA 5D1OA 4DAYB 4AYBB 3CCJA 2A6ED 1Y8NB 5EKKA 2UUCL 2E5LH 2YRXA 3GTMB 4UCUA 3E5NA 1SNOA 4C3HH 2CH4W 1LO5D 1K28A 1FNWA 4DUZL 5F9NA 5IP9H 4UPAA 5FO7B 2GPSA 1BCPC 2DUDA 3NENA 2E2JB 5T1IA 4DXGA 4WJWA 4QWDA 2GN5A 5LMNL 3GTJA 1EYZA 3CQZA 3PW0A 3I70A 1TWGA 1MJCA 1IKMA 4BBRG 2OCEA 5BPHA 2WP8J 2QCPX 3KXYT 1NTGA 4DL3A 5EWEA 5LL6b 4YAJB 2D0OA 2DPIA 4K2LA 4TRDA 4AYBE 4ZRZA 2F0GA 3H0GH 2IWHA 3GQCA 5C4XB 3H40A 5LMNQ 1N33L 2D0PA 2I5HA 3D6CA 4MV1A 4JK1C 1JXLA 2B2WA 3S14B 2Z4IA 3OHXC 3BQ1A 4DU9A 4ALPA 4HQ6A 1ICWA 1EEID 3R2IA 2Q8RE 1W93A 3C2PA 3VR5A 5LL6X 1T3NA 3KDFA 3BAAA 2K5DA 3C1FA 1GM5A 2GVAA 4C3IG 2RDHA 1VQCA 2B2TC 3SR1A 1M1KC 5IYZF 1X56A 3G48A 1I94Q 2L1BA 2F4VQ 5IGCA 4PMCA 1H95A 4LF7Q 2F1MA 2GA4B 4FNFA 3T1YL 2F0IA 1G8ZD 3M7NA 2HCIA 5IYCH 5E1FA 3NSWA 5LMUL 1X55A 5FOBB 4FDBA 1JOKA 3H0GA 4B3TH 1SROA 2IHEA 4APMA 4FP5D 2YTXA 3TIGA 2DPJA 5JEAH 5KG5A 4O42A 3EYYA 4OWTB 4LFBH 1CZWA 1CHQD 3VDYA 4DK0A 4DV4H 3PR5B 3Q8DA 3TQTA 2W70A 1HQMC 5L1LA 1XX8A 4EGVA 3OUUA 2DZDA 3GTLB 1Y8PB 4IFDG 5KFJA 2B2VA 1GOZA 3SVMA 4AQYL 2UU9Q 1B70B 2RSNA 2I80A 1IYJB 3KAJA 1Q12A 5FPRA 3GIPA 4HCSA 1QVFA 5BMVF 1HPCA 4JBJA 1PV4A 5C1PA 5C5LA 2J6UA 3Q23A 3CQZB 2HHHL 5C3EG 1SFOA 4K8JA 4Q43A 3MC0B 1XMQL 3WOFA 4A3IG 1VBHA 3GTQB 4J9KA 4IJLA 2EYPA 2KJXA 1Y14B 3Q8RB 2UUBQ 1VQPA 3M3YH 3H4BA 4MV3A 4IR1A 5KKNB 2AQ1B 1ZXTA 2UXBL 4IQZA 4GC6A 4HNUA 4YAKB 3T5JA 3LP8A 4PZ7A 1QWYA 3GIQA 3RD4A 2JK8A 1IBLL 4DV6L 3I4NG 4K0KL 3ND8A 3MXUA 5KNBA 4IOCA 3IL8A 3RJ0A 2JEJA 5A35A 2W7OA 3GILA 4FF4A 5EZYF 1X3FA 2SNSA 4O2BF 4A3JG 1RYSA 1E24A 2JA8B 5DAUA 3KJPA 4XTCS 1TT2A 1WVLA 1A3TA 3A7LA 3N52A 4A3KG 1Q1BA 3LMLA 1PH4A 3NQTA 4FS1A 2F0EA 5I47A 3GDEA 4YY3H 3CVZA 1ZHSA 5DG8A 1XMOQ 4R4OA 1D6EC 2A19A 3MFHA 2D9UA 2A5HA 4LF6L 5CB4F 2ZXPA 4QGUA 2ZM6L 2YU9H 3TBIB 1JJCB 3I12A 1QE6A 1Y1VH 1EQRA 4MHEA 3BVMA 3ULLA 2A8VA 1ASZA 3N43B 3J80c 2J0TD 2R7LA 3MR6A 3PO2H 5FLXE 1PH7A 1T5XD 2A73B 3OPOA 2QEXA 2VA3A 2CW7A 3GTJH 3K3VA 4IUTA 1EY0A 4Q45A 3CCLA 4C2MH 3H4DA 4B3MQ 2R7MA 3E9IA 3GIJA 4CC6A 2VPSA 2XIWA 4PDBA 1PZJD 3M9MB 1I5FA 2YTYA 2WAQG 1SBBB 3QB3A 5KG4A 1I3QH 3T51B 5D3IB 5CV4A 4EEQA 2PZWA 3PW5A 2CW8A 5J2UF 3PUYA 3DEOA 2AWNA 4R9WA 4C3JG 4CC5A 1YNNC 1V1OA 1E7ZA 3J7ZC 2KOLA 3M4QA 4ZKCB 4KY6A 4A3BB 1KIXA 2V4DA 3GTOA 1ESFA 4TV9F 3R5FA 4F4XA 3L4KA 2NB0A 4I65A 4O4HF 3D4WA 1VQIA 3BVZA 3RLOA 4BY7B 1RIPA 1EYGA 4JI6Q 1BCPB 2VB2X 3AU7A 1YIJA 3F2UA 3C3LA 4B3RH 1YITA 1T94A 3H09A 1KDAA 1FR3A 4C2MB 3GTKH 4NMZA 4QW9A 4J9OA 2NYZD 5GADC 2I5LX 4O2DA 1ENFA 3URYA 4MV4A 5KG0A 5T1GA 1T9HA 3W1GA 3NEMA 5CMDA 2L55A 2VR1A 5FJ8H 4EQPA 2V1CC 2EY6A 1I3QB 1X3PA 3HOUG 1I7LA 5KFKA 5GAHC 4K6DA 4CDDC 1DD2A 3F8NA 1Y1VB 4KD4A 3RMHA 2QW7A 4JI8Q 2NZHA 1JDBB 1IBMH 3T1HH 3V96A 1H9RA 2VL6A 4QB4A 2C00A 2XD4A 3PW4A 4GKJL 4RNOA 1V43A 2HQLA 3FPPA 1QUQB 3G6YA 4A3CH 1EUCB 2PI2A 4DR4H 1UNNC 5COYA 4JI4Q 1RHPA 4UCVA 4KHVA 1SMYD 1PA6A 1U5KA 5M9OA 4GS3A 1YHQA 1BNZA 4OO1G 5IT9L 5M5YB 3Q8QB 1RTNA 4ZLTF 4JI0H 2EY1A 4YCVA 4IPGA 2HVRA 3D6WA 4MNOA 4ZHQF 4RAUC 4C1NK 2B29A 2F0OA 4A3DG 2HDLA 1NUCA 4K5XA 4JI3Q 2JA5B 1S9FA 4EG0A 1U4PA 4GLAC 1E4EA 1IW7C 4LSXA 4KHPL 1BKBA 5EPLA 3A5ZB 3NTIA 3GTOH 1AEXA 1X3QA 2XSCA 5C0XG 3WOEA 5L9XA 2UUCQ 4MZ9A 2OEOA 4ZYSA 2ALZA 2K6AA 1SJHD 2H1EA 5C3EH 3DHQA 3JAMc 4J9MA 4DFAA 1STEA 3SXHA 1VAJA 1FNUA 4L63B 4OXPA 2Z1CA 4BBSH 2BA1A 3HOWH 1FD7D 5IYBG 1N36L 4G4KA 2ASBA 5KFOA 5I6WA 4LSAA 4OO1H 2K33A 2AGPA 4JV1A 2WAQB 1EUJA 4CJ2C 1I94L 4QW8A 3GTMH 4EQ5A 2RDFA 3RGZA 3GTLA 4FXKC 1YVCA 3IRBA 3EA6A 5C6AA 1EQQA 1Y69U 3A55A 3S1MB 1KJQA 5KFRA 4R1JA 1EFID 3U9SA 1W2BA 5AJ3L 4IZOA 2Q2UA 1IYUA 4KLKA 4J9PA 2WB1E 1VQGA 1EYDA 3I3CA 5KFGA 4JCVE 3BVGA 4DV5Q 3IN5A 2X0SA 5DLFA 4FBTA 3T16A 4LF5Q 4AH6A 2VUMH 3SK5A 1YJWA 2IPKD 1U4LA 1FJGH 4LAAA 2BCOA 1I50H 1NMGA 2R8GA 4LFAH 1QUQA 1WD1A 1PFSA 1NNXA 2V59A 3DMUA 3M4PA 2DWCA 5IOCA 3RF2A 1I4PA 4LF5L 5FLXW 2K50A 1ESRA 1SE8A 3HOWG 2O4XA 2WB1G 4LF7L 3TINA 3BDOA 4DF7A 4NPSA 2HHHQ 4R8UA 1KABA 2JE6I 2HVSA 3PO2B 3MEFA 1HXYD 3S2DB 5JJLA 1K83A 1SXTA 1N33Q 2YZGA 4A3EG 4B3SQ 3Q6SA 2W6MA 3HOUH 1E4FT 2ZT9C 3RZDH 4L1KA 5EWFA 2AQ4A 4O3OA 2NU9B 1HTPA 1VQJA 1HR0W 5LOVF 1F2ZA 4BY1G 3J7A5 5DGAA 2XCLA 1EIFA 4ZQIA 3DUZA 4JBMA 2O5IC 2C2RA 2CWAA 1SYFA 1XNRH 1Z7TA 3GTKA 4JI7L 1XYIA 3W1BA 1F2MA 1TWGH 4QUCA 2FE3A 4JG2A 1UAPA 3NQIA 2R3ZA 3TP8A 3TS2A 2B2WC 5C5MA 4F88A 3OTOH 2K03A 4ECXA 5J2TF 2PCFB 1EOVA 1HFNA 2SCUB 2EYLA 4UDUC 5IYDG 1VQEA 2NUCA 1BCPF 1QNUA 5KRUA 3JAMi 4A3BG 3JZIA 4Y7NB 3ND9A 3FKIB 1W96A 2K75A 1WCMH 3HOXG 3W2DA 3K0YA 1NR4A 3K3PA 4DV1H 1QCBD 4HIKA 2K5WA 1Z47A 4TKOB 4RGTA 1MSGA 4N9PA 4BA1I 1K0RA 2IHFA 3NXWA 3S15H 5JJKA 1I4XA 1O7YA 2XVSA 3DWPA 3M3YB 3J80E 4ED6A 4ZAIA 1U4RA 3KF8B 4ZCKA 4JV2A 2MHVA 4C3HG 2IT1A 2N49A 3T1HQ 5DM73 2LMCB 2PYKA 3GTOB 3OUZA 3M85A 1LTTD 1GUNA 1EZ1A 5EBCA 1L2ZA 2JXMB 4XT1B 4O0AA 1Y1VG 5J22A 1GKHA 4IUUA 2D62A 1CFMA 1PVOA 1C4QA 4GZYC 1I4HA 4JI0Q 4X3KA 4NXNH 5C4JB 5KT6A 3VPCA 4WJ3M 4LW1A 4EGJA 5DEHA 3I4MH 4TV8F 3PR4A 2HD3A 2F52A 4LUZA 4R8IA 1CSPA 4MTKA 4QUFA 3GQBA 1STYA 3HS0C 3GD7A 4K6LA 3CMAA 1HH2P 5KEEA 5KFIA 3LGJA 4HSPA 2UXDH 5JPMC 2R7KA 3P75A 2W9BA 4R8NA 2UUCH 1CKNA 5L1KA 1B9MA 3K58A 1V8QA 4EEYA 1ZHQA 1QB5D 2UXCL 1BXRA 3TP6A 5JEAJ 1B2TA 1STGA 1A9XA 3QFFA 4NDXA 1ET9A 2H4OA 2WIIB 3LNNA 2RA4A 3K5MA 1SMXA 1BJTA 1B9NA 3QWNA 1TKWB 3HOZG 1PK8A 3CQZH 2NN6G 3G6VA 2KCNA 2XNAC 5NUCA 3GIDA 3MR2A 4FBUA 4RFBA 3OOCA 1JC7A 2P5ZX 1WFQA 3BZDB 2ASLA 1XJVA 3STBD 3TRZA 4A3KH 5KG2A 3PW7A 4HMIA 3NGDA 3G6EA 3KBXA 1XTDA 5M3MG 1K8MA 3R2TA 3U4VA 3D31A 3NUCA 1IL2A 4CJ1B 5KT2A 3J81E 1YNND 2JEIA 3QO2A 3I4NB 4C5CA 4C3IB 4U673 2SOBA 5JOBA 4YY3Q 3S16B 1SCUB 4IFDI 3CCVA 2B39A 4DV0L 1NSNS 1Z6HA 3OIQA 4LUVA 4RU9A 1GD7A 2PBZA 3D8GA 4DK6C 1PRTF 2BDNA 5IGGA 1LTLA 2Z9HA 2C22A 5J39A 3KHHA 1PDQA 3I7FA 3DM1A 2JN4A 5EBDA 1KRTA 3AB9A 3WO1A 3HOYB 4A3LH 5D1OB 1B1ZA 1PTOH 2MO1A 4ZK9B 3PV0A 3DF7A 2WKDA 4BXXG 3H0GG 4JI6L 4ID6A 4XQNA 4BA2I 5CV6A 4IURA 1VQAA 1O7ZA 5D14A 1LTSD 1VCIA 1YI2A 1OXVA 4RKLA 3TSSA 3PZPA 1SAPA 1K9MC 4XYQA 2R92B 2AQ3B 1EL0A 1E4EB 1VQFA 2E2HH 4XQQA 1WTRA 3UQ8A 1G91A 5T14A 4UFZA 1QVCA 3RN5A 2B2UA 3PCOB 2E2IH 5JUMA 3KHLA 4ILWA 1O7LA 3MTSA 4A3FB 1WH2A 5IODA 4KHPQ 3H94A 3HKSA 4HR7A 1A3VA 3P1HA 1C0AA 1HR0Q 3R5XA 4I4TF 1WTPA 2YZNA 1JE5A 2CH4A 4TSSA 1EEFD 3X3MA 4M1UB 2EPBA 1STNA 3ER0A 1HA6A 4DV1Q 4CKBA 3NBHB 4Y8VB 5KFTA 4DR1L 2VS1A 2JEAI 3BU2A 2MCTA 3R5HA 5L1IA 4WFN3 1QILA 3J80W 1HR0L 2RCFA 2XIGA 4YBZB 3OHBA 4IOAA 2KCCA 5DQIA 1YHBA 1S72A 1C30A 5IP7G 1HUMA 1GHKA 4EYHB 3U9OA 2K5VA 2PMZB 4DN4M 2CKZB 2NBFA 4X62L 4ECQA 2HIXA 2NN6I 3KLRA 3MR5A 5CA1F 2W6PA 2Y0SA 4IRDA 1SDFA 4EQOA 5CYUA 3CCSA 4JI8H 4X64H 2IX3A 4UCOA 1PRTB 4DV3L 5IT9E 2LXJA 1VQ9A 2YU9B 4J0MA 4NXNQ 2EYOA 2F4IA 4DR4Q 1SYGA 3DXJC 2KBNA 4CKCA 4JBWA 1HTLD 3BZKA 2ZM6H 1HNZH 1F77A 2EZVA 1KJ9A 4A3EH 2IW3A 2PMZE 4XQJA 4QIWA 1RK6A 3GV5B 3FVQA 1NMFA 2ATWA 3TP5A 2JA8H 2JYOA 3AQQA 4C5BA 1VQDA 3MFYA 1GUSA 5EAYA 4FF2A 5D8DA 3D0FA 5AJ3Q 2EJGC 4LF4Q 4DL5A 5M5WB 1B7YB 4HN7A 3ULJA 3GV7B 4NXMH 3Q0AA 1ILQA 2Y0SG 3A5UA 4ZKBB 1TWCB 4ED0A 1MBYA 1SE2A 2HCCA 3H3VH 1GUOA 4DUZH 1IBKQ 1R9TB 2MP1A 3SK8A 5EQ0A 5EJWA 2N55A 1UNSA 3ERSX 4CDFC 1HQRD 3N41B 2CZGA 3RZDB 5KFEA 1UE1A 2ALYB 3CRKC 1R4QB 1PH8A 4KKUA 1AE3A 3QZ8A 3G7LA 3SEBA 2NN6H 5IGFA 1EY5A 3IFDA 2SEBD 2KEEA 1DV2A 4XXEA 3MXNA 4A3FG 1IBLQ 1NJIC 1A63A 1KC8C 2VUGA 4XYLB 3S1NH 1N32H 2UU9L 5K2MA 1VQMA 2F0NA 4G57A 4B3RL 1FKAH 4O3PA 4DV5H 4KHZA 1LTRD 1IW7D 2QGQA 1XNQH 3U50C 4CBVA 4DV7Q 2I07B 1B50A 2C9OA 1YJ9A 1BNCA 1X3GA 4DR2L 1FJGQ 3JC66 4J6HA 3TN2A 4F50A 2NTTA 4IPCA 5IGBA 4DXFA 5CV5A 3E5SA 1V4YA 1TA8A 5IGEA 2MJ8A 2PI2E 4JV5Q 2UUBL 2P0AA 4IALA 1ULZA 4C3IH 3K5IA 4APVA 4DGZA 1C8CA 5KFDA 2F0KA 4HTHA 5HURA 4OGQC 2NVYH 1GUGA 1EQVA 2B2TA 3T1HL 2K14A 4BBRB 3P20A 5LYJF 2DNCA 1AE2A 5C4JH 4K5WA 1PH3A 2WV6D 3QJYA 1Z2OX 1WI5A 5LMUH 4IN3A 3S17H 2F0JA 5DLQE 1JIHA 2RGVA 4B3TL 4M7EA 1IHZA 4M9UA 1LLRD 3I4MG 1E2ZA 2XC9A 2PO4A 2IA6A 4GNXC 4A3GH 2EIFA 4AYBA 4KK7A 4YHHH 3EROA 4X66L 4JI0L 4JI2L 1EWHA 1KLUD 2RDGA 3HXLA 5KFLA 1I4QA 3J81j 3N6RA 1B3QA 3A56A 5IWAQ 4MTNA 2UUAH 3BG3A 2MUYA 4HMJA 3RLFA 4DR6L 2VQFH 1XXGA 2NTSA 2JA6G 3V2TA 4B3ML 1K83H 2Q2HA 4KY5A 3ETHA 3BG5A 2A68C 1J5EL 5KT7A 2R8JA 1F9SA 1TWGB 1WTHA 5KFSA 1V1PA 4BY1B 2E2HB 4HIDA 3OIPA 5BR8L 1UEBA 2EVBA 2IMWP 1XMQH 4LK1C 2FB9A 5C5JA 4QWBA 1EU3A 4LF9Q 4PQXA 1BGWA 4PNYA 1AH9A 4MA5A 4P71A 4DV2H 1SYEA 1D5XC 3CAMA 4A93H 3MXNB 1AFPA 1N36H 4IRCA 1TIID 2K5QA 4DV0Q 5JPNC 2L5TA 2L15A 3L4JA 1JLLB 3T5LA 1XPUA 4OX9L 5LMNW 2ZJRA 3HRZC 4ED1A 4JYAH 4DR3H 1G6ZA 1RODA 4K0KH 1A8VA 1LV9A 5KNCA 5BN5A 3BA9A 4F8MA 2J4XA 2FK2A 2MQHA 1UE7A 4LJZC 3CC2A 2ZXOA 2UVUA 3R93A 3U9TA 5G3LF 5C8YF 2R92A 5IT9W 3SE0A 2EY2A 2HQEA 1KRSA 1BBWA 4DLKA 5GAGC 1KJJA 2XCPA 3GTJB 2F0TA 2B8GA 2QF7A 4KI0A 1WTVA 1WR2A 1GHJA 4XT3B 1MHWC 1CS0A 2E2DC 4DR5L 1OWTA 4YY3L 1TS2A 5IYBH 1HCZA 2I0QA 3S17B 4FU0A 2O2LD 1C3OA 2FFKB 2WINB 2JA7B 1GSOA 2B63B 1MKHA 4U6PA 2L9HA 5J3BA 1CKOA 4PG3A 1EIHA 4I50F 3Q2OA 3CP0A 3N42B 1KD1C 1YNJC 2Y0SE 1RJRA 3LWBA 1CHPD 4LUOA 3T5KA 1S5FD 1W6JA 3K5OA 3PO2G 2IP4A 4Y7NH 2EDGA 2EE1A 4ABNA 4DR5Q 2QEJC 1K83B 3S2HB 4ECTA 4GKKL 4IFDH 3NK9A 2AUJD 3BDCA 4OELB 5DLGA 1NE3A 2H5XA 1KDBA 4OIKA 2VUMB 4FXGC 1AW7A 1SYDA 1TQOA 3VYRA 3G8CA 1KJ8A 1VQKA 1RYRA 2NWGA 3KJOA 2X6GA 3HOZH 1JT8A 1B04A 2G5DA 3KTMA 5KIXA 4DR1Q 4JI7H 1P16A 5LP6F 1D8LA 4JW0A 1N34H 4GKKQ 2WKCA 3K6OA 4HR7B 3E0JA 5ELFA 4A3CG 4LH6A 5KFMA 4RB2C 2XWBB 2NVXA 5M3FG 2ASDA 4JI5L 5KT4A 3L0OA 1M6VA 2Q8TA 3ITPA 2VB3X 4Z9CB 5HV6A 4P72A 1EY6A 1HNXL 1TWAA 3VYUA 3ZYYX 5C3WA 1RCVD 2NVQH 1RL2A 2A6HD 1ZQ7A 2JEBI 2K01A 4QMGA 4J9NA 1LTBD 3A54A 3AMUA 4RZRA 3E9HA 1G6PA 1ONLA 4MIUA 4J9LA 1JJ2A 1XWEA 4GNXA 1FGUA 3ERQA 4DV7H 4LF8L 4DV4Q 1SNMA 4DV1L 3RB3A 1Y8OB 3MVVA 1SFOB 4YB8B 3GV8B 1SSOA 1B3AA 3M7GA 3S1NB 1JB3A 4JV5H 5FLXL 4MN3A 3RUPA 3GTGA 1X3EA 4UCTA 2D2CC 3GTLH 2OTLA 4A3MB 3FMCA 1E4GT 1R9TA 2PNHA 1CTMA 4FO2A 5CV9A 2W71A 2LSSA 2YU9A 1QVGA 1FVIA 5EDWA 1KLGD 3DM3A 4L8JA 1MSHA 2QILA 2RDIA 1Y1WA 2K52A 1DM0B 3TMEA 4HSVA 4EX5A 2KCMA 2R7ZH 4GKJH 2DY8A 1T36A 4RWSC 4PMBA 1BUVT 4YR2A 1JB7A 1FYCA 2R93G 4IPDA 1FL0A 1S4ZA 4R4QA 5I9OA 1IBKL 2VQFQ 3IKJA 4LFCL 5FLMG 3ULPA 3SDZA 3HOYG 1B6RA 4UP8A 5IY0A 5LHY1 2ZDHA 4HJAA 1DYQA 2F3WA 2NVTB 2PNRC 3PUWA 2C2DA 4KTAA 2B63G 3D3RA 3FRPB 2W9BB 3TREA 3VR4A 3PIOA 3I91A 4GC7A 1KXLA 3OSNA 4KHPH 2E74C 2JA5H 4OIJA 2NVYA 4A75A 1H9SB 2R93H 1GSAA 1MJEA 5I9PA 1DZ1A 3LX0A 1ENAA 5D3DA 2JA9A 5IT9c 5GAEC 4CDEC 1SNDA 4O3RA 4IWYA 1HZ9A 3Q24A 4DR3Q 4FYDA 4K0KQ 3PF4A 3KK7A 1O78A 4WJ4A 1EQTA 4MV8A 3VA5A 4KMUC 5EKLA 3MWYW 2W6OA 2YRWA 4AYBG 3RN2A 1JQYD 2AKWB 3HG9A 4A3DB 3EVQA 4HJ5A 3KYHC 4XYOA 3PUZA 1BQQT 2JA6A 3J80i 4RHRA 1JICA 1JOQA 2OT2A 1WTWA 3AEVA 4DL2A 1A62A 2E76C 4Q0FA 2F03A 5M5XB 4ME3A 3SGIA 2UXBQ 4DK3C 1O80A 1K8OA 4FF1A 3ORQA 5AFWA 2Q2IA 2MGSA 1HNZQ 2ZTEA 2YYZA 1PH1A 3J81c 2FKLA 1YNXA 4QL5A 4H0LC 2CQOA 2RBMA 5C4XH 1B53A 3K59A 2BQRA 4IUVA 1I6HB 4RB3C 3PQIA 5FKAC 1UUPA 5DG7A 1M4VA 3KF8A 3W5OA 3HKZG 3EBEA 4ZI7F 1IKLA 4LF4H 1SNPA 2NUAB 4Q5VA 1PTOD 4L5TA 2JP1A 1M7JA 1W6KA 2WDTA 4JI1H 2EXDA 1D5MC 1C48A 4GOPA 1KNAA 4ODGA 3KLSA 1N8RC 3NE5B 1N34Q 2R92G 3BS1A 4LH7A 5KFVA 1PTOF 4JI2Q 5DG9A 3OWEB 5KYIA 1K0SA 2R7ZG 4JPBW 3T1YH 4LF6Q 1H9SA 5IGDA 4IFDJ 1D1KA 1LTID 4A3JH 3ETJA 3I73A 3I4LA 2HT1A 1EFWA 2PQEA 1M90C 2AGOA 4CJ0B 2VQEL 4HYKA 3BA8A 5C0XJ 4YWLA 3PUVA 2IJ0A 2EJFC 2CFMA 1EWIA 1OXTA 3HOWB 1SE3A 1BF4A 2KENA 2VW9A 2E5LL 5BR8Q 2B2YC 3K0XA 3RB6A 3D4DA 2B2VC 4BS9A 3HKZA 4A3EB 1QG7A 4IPHA 3EPGA 1PMRA 2EYHA 3WWVA 5EPJA 2YV5A 1EYCA 3JRWA 1TWFB 2O5JC 4A3IH 1MD2D 2YTVA 3CU7A 2F0VA 1VS0A 3G4SA 1PH5A 4RB0A 5HGQA 3JRXA 5JH7F 3VPDA 1PRTC 4DKAC 4DA2A 3SI8A 1L0XB 3PW2A 1A3UA 3GTQA 4TUYF 1BBUA 5KFXA 3TP7A 3K7AH 2QYZA 3OMGA 4DUYQ 1EOTA 3PSIA 2AGQA 1I94H 4P73A 3V6JA 4NB3A 3K57A 3TEHB 3BDLA 1TR5A 3SE7A 2WAQA 4OWWB 1PHJA 3QZ7A 3UE1A 4DV6H 4IO9A 4LF9L 4J9RA 2WACA 5FPOA 2F0QA 1K1SA 1QZGA 3CD6A 1J9OA 4X65L 3FKIG 1QOHA 1EU4A 3HOXB 3CF5A 1WTQA 1JCKB 4YR3A 4ED8A 1OO9B 3T13A 1VQNA 2UVVA 5IYCG 5IWAH 3X3NA 4LMYA 1ZYRD 3HFZB 2W9CB 2MNAA 1JWMD 3AFPA 2JJQA 5CC4A 5GONF 3S9WA 1SEBD 4N9TA 1PYWD 2F0UA 4QF4A 4GN3B 1J6QA 4YCWA 5ELEA 1K8GA 2VOBA 4A2AA 3G6XA 3GTGH 1TAEA 4TQRA 5CBAE 2DNEA 1C9OA 4QQBX 4NXML 4MV7A 2NVXB 2EOTA 1VQ6A 1CQJB 1TS3A 3K80C 3S14H 4DR7Q 3S1MH 2FK3A 2XWJB 5GQOA 3HZXA 3RR5A 5E4WC 2CVRA 3JSNA 1A15A 2K7VA 4H13C 1WOCA 4R4TA 5DNFA 4B08A 1EYAA 3J7AV 2VQDA 1Q86C 3R3OA 4C1NI 3CXCA 4V0BA 1IZ6A 4ZUIA 1ENCA 2SNMA 1HHVA 3GV3A 2W9CA 2K5NA 1DJRD 2FPIB 2EY5A 1Q82C 3SK4A 1RDPD 1M0WA 2F0PA 4M8AA 3BABA 2JEGA 2F0FA 3L9AX 1RK5A 2J6SA 4A3GB 3KALA 3A74A 1Q46A 4UP7A 2AMCB 4X6AH 3BQ2A 4ED7A 3A8KE 1VQ8A 2CQYA 1I3QA 1XNQL 2F0SA 2FPPB 2K28A 2N88A 4LF8Q 4XDXA 2UXBH 2QA4A 2VNUD 1UC9A 4Q8FA 4DR2H 2QK4A 5BN3A 2FLLA 1XPRA 4EFEA 4NW2A 5C3XA 4YJ3F 1A2TA 5ELCA 5CR3A 4QJFA 5ISRA 2DIKA 1II3A 4BBSB 1O75A 1L0WA 1STAA 3OMCA 4ZQ3A 2IX0A 4RUCA 5KFUA 1L0YB 1CM9A 1GUWA 3HOVH 3MXGA 2PPBC 2BE5D 1KJIA 2YS6A 1DIKA 1AZQA 3BJUA 3UDGA 3FP9A 3QG1A 4EGQA 1GXDC 3KLSX 4N8FA 4L5RC 2HJWA 1F2LA 5C44G 3DWQA 4X3UA 4POGA 1I50B 4GN4B 4LWCA 5EGTA 1KQSA 3NTKA 1LT3D 2PW5A 1JKJB 5JAVA 4JI6H 1CKNB 3E0EA 3KF6A 4X66H 1S68A 4EBDA 4O3QA 3RUZA 4P74A 4BXXH 1Q81C 5FO9B 1EIYB 4LFCQ 4NLGA 4RCNA 1OXUA 5M5XH 5CV7A 1SRUA 4DV3Q 2R87A 1UEAB 4KD3A 3C0FB 1J5EH 1GYFA 3QOLA 1X65A 1EZ8A 1ASYA 4G3IA 5EWGA 5HY6A 1STBA 4DR4L 1H9JA 4UCRA 5CORA 4N8X1 1WCMB 3I90A 2GPWA 3K5NA 2J6TA 5JVH3 3T4AC 2VZAA 4DV2L 5KFFA 1JX4A 2F4VL 1HRJA 2LXKA 2XN9C 3I2ZA 3PGZA 1ML0D 2K4KA 4IUPA 5M5WH 1Q7YC 2R82A 3J7AF 3EQLC 4RNMA 1JOOA 5DQGA 1D7QA 2YS7A 5M3MH 1DONA 3PVXA 3L3OC 3I8ZA 2M2LA 3NWSA 5ELDA 2WAQE 2UVRA 1R4PB 3S2HH 1RKNA 5G3LD 5LMNH 2XRSD 4B3RQ 3MWMA 1Y1WG 5KG3A 3WO0A 1KC7A 4QWEA 1A2UA 2ZJPA 2KQ3A 3PO3G 4IHJF 3S1RB 2FINB 1T5EA 2UXDQ 1Q1EA 2Z6KC 3EN2A 4BY7G 2R84A 4X62H 1SYBA 5KG6A 4IUQA 3HOVB 4JI3H 4DV6Q 4FM9A 3PMFA 4C2MA 3RB0A 2YYAA 4ZUJA 3OW2A 1I7NA 2E2JH 1IBMQ
chains in the Genus database with same CATH topology
1KHIA 2L15A 4IPGA 4YCVA 3I4NH 4MNOA 4YHHL 4POFA 3I55A 5IYDH 1XPUA 4OX9L 5LMNW 2ZJRA 4DPGA 2B29A 1U0LA 4A3DG 3KDFB 1HNZL 1VQ5A 1A8VA 3KF6B 4LF4L 1XMQQ 3PUXA 4JI3Q 4GLAC 3S1RH 2MQHA 4KHPL 1BKBA 1UE7A 3CC2A 4L5QA 4DV2Q 3A5ZB 3GTOH 2RF4A 3F2CA 4GOPB 1A0IA 3PIPA 4RMFA 1IBML 5C0XG 4LFBQ 1KRSA 1BBWA 4MZ9A 2E8GA 2UUCQ 5GAGC 2NZOA 3KOJA 5C3EH 3UDFA 3JAMc 1CSQA 4BBSH 4OXPA 2BA1A 4KI0A 2Z0SA 3HOWH 3I4OA 5M5YH 5IYBG 1N36L 2ASBA 4DR5L 3GTPH 4A3GH 4YY3L 1YHAA 1CKMA 5IYBH 4GLXA 4AQYQ 1K73C 1K8AC 2I0QA 3DLLA 4JI1Q 1EUJA 1I94L 4TQUS 4LFBL 3GTMH 4EQ5A 1MKHA 5J3BA 1CKOA 1SN8A 4PG3A 5IP9G 3CP0A 3T1YQ 4PZ8A 1KD1C 1YVCA 3IRBA 1EQQA 2Y0SE 2R92H 4LUOA 1L1OA 4JI7Q 3PO2G 4R1JA 1W2BA 4Y7NH 1SLJA 5AJ3L 4DR5Q 2Q2UA 1C7YA 2AHOB 4KLKA 3FKIH 5IE8A 4UY8C 2WB1E 1VQGA 1PYSB 4JCVE 5H1SE 4DV5Q 4GKKL 4A76A 4DV7L 1NE3A 1XMOL 1BVSA 2H5XA 4LF5Q 4AH6A 2JA6H 2B3GA 2VUMH 1YJWA 1VQ7A 1JJGA 1VQKA 3KJOA 1E3PA 3HOZH 2ZM6Q 1JT8A 1I50H 1GVPA 1NMGA 2RCNA 1QUQA 4DR1Q 3U4ZA 4JV5L 1PFSA 1P16A 4A3GG 5FLMH 3M4PA 1D8LA 2OTJA 3CCQA 3H3VI 4GKKQ 4TVAB 3S1QH 4A3CG 3K7UC 2JA7G 4LF5L 2K50A 1SE8A 3CCMA 5M3FG 3HOWG 2WB1G 4JI5L 4LF7L 3L0OA 1PYBA 1PH2A 3CC4A 2NVTH 4NPSA 2HHHQ 2JE6I 4P72A 3MEFA 1S3OA 1HNXL 5JJLA 1IXRA 2XTIA 2NVQH 5ELOA 4A4IA 1RL2A 2JEBI 1N33Q 4A3EG 4LNQA 2VQEQ 4B3SQ 3HOUH 1Q8KA 1CUKA 3RZDH 3E9HA 2OQKA 1G6PA 4UP9A 1HR0W 1VQJA 1JJ2A 1E22A 4GNXA 1FGUA 4BY1G 3OYYA 4LF8L 4OX9Q 1FJGL 3J7A5 4DV4Q 1EIFA 4DV1L 4JBMA 2CWAA 4P75A 4DR6Q 4JI7L 4DNIA 3W1BA 2R7FA 1TWGH 3B6YA 4QIWE 2RHQB 3UE0A 4A3LG 4JG2A 2UXCQ 4X65Q 3TS2A 4JI8L 1X3EA 4X64L 1N34L 4R4IA 3GTLH 4A3LH 3OW2A 3CW2C 1EOVA 1TWAH 2OTLA 1JMCA 4OO1I 2PNHA 4A3MH 3F8TA 5IYDG 3F1ZA 1VQEA 2LSSA 2EQSA 1QVGA 1FVIA 1XNRQ 2JA5G 4B3TQ 3DM3A 3JAMi 4A3BG 1YZ6A 1E1TA 1UE6A 2HIVA 3KFUA 2KCTA 1B8AA 2K75A 4X64Q 1PH6A 1WCMH 2K52A 3HOXG 3H15A 4YWKA 4DUYL 4GNXB 4GOPC 4EX5A 2R7ZH 2KCMA 4BBRH 3OTOQ 4HIKA 1Z47A 5C0XI 5IP7H 1JB7A 1N9WA 3NELA 4BY7H 2R93G 4IPDA 3PF5A 2MFIA 1K0RA 1FL0A 3BZCA 4R4QA 4BA1I 4DAMA 1IBKL 1XNRL 2IHFA 1OXXK 3AFQA 2VQFQ 3S15H 5JJKA 4LFCL 3UDIA 2JQOA 5FLMG 5JJIA 2BH8A 3ULPA 1MIUA 4H02A 3HOYG 4UP8A 5IY0A 3KF8B 4YWMA 4HJAA 1VQLA 2IT1A 2CWPA 2N49A 3PUWA 4JC0A 3T1HQ 3OTOL 2ES2A 2B63G 3S2DH 2ZJQA 4JBKA 3TREA 4DV4L 2IX1A 4JYAL 4GKJQ 3EIVA 1V9PA 1UE5A 4X62Q 3M85A 4JI4L 3PIOA 1E1OA 2OWOA 1KXLA 4R4CA 2R6GA 4O0AA 1Y1VG 1GKHA 2Q2TA 2JA5H 2D62A 4A75A 1PVOA 2R93H 4NXMQ 1MJEA 4PZ6A 2IY5B 4JI0Q 1VQHA 4JI5Q 4DR7L 4WJ3M 2UUAQ 2JA9A 4LW1A 4L5SA 2JA8G 5IT9c 4DUZQ 2DGYA 5GAEC 1HNXQ 3I4MH 2ZTCA 2E2JH 1HZ9A 4LUZA 2F52A 2KHJA 3RNUA 4DR3Q 4WJ4A 4K0KQ 3PF4A 1CSPA 1KAWA 1XPOA 3F2BA 1X9NA 4PMWA 4DV5L 3GD7A 3CMAA 1HH2P 3LGJA 4AYBG 3RN2A 1TWCH 2AKWB 3STBC 4A3DH 1TXYA 1CKNA 1KL9A 4HJ5A 3KYHC 4HJ8A 1V1QA 3PUZA 3CCRA 3RZOH 3J80i 4LFAQ 3AEVA 1DGSA 2UXCL 3CPFA 3AYHB 1TWFH 1A62A 5JEAJ 2CCZA 1WYDA 4ME3A 3SGIA 4JI1L 1XNQQ 1S40A 2UXBQ 5GROA 1SMXA 4OWXB 4DK3C 4NXNL 3CC7A 1L2FA 3HOZG 2ZTDA 2NN6G 3CQZH 3HOVG 4JYAQ 2Q2IA 3L7ZC 2BA0A 1NY4A 1HJPA 4OONA 4XIGS 1HNZQ 5C44H 2ZTEA 2YYZA 1HNWL 1PH1A 3J81c 2F3IA 3ZJYC 1WFQA 1LM0A 1YNXA 3FHWA 4QL5A 4DAYB 2CQOA 5C4XH 1XJVA 3STBD 3CCJA 3TRZA 4A3KH 1OTCA 2NVXH 2UUCL 1X6OA 2UXDL 2B63H 3G6EA 3W5OA 5FJ8G 1XTDA 4C3HH 5M3MG 3HKZG 3U4VA 3D31A 3EBEA 4DUZL 1IL2A 2N3SA 4AIMA 5IP9H 4UPAA 2DUDA 3NENA 2VQFL 4L5TA 5LMUQ 4HIOA 2GN5A 1P8LA 4YY3Q 3TQYA 2EXDA 5LMNL 4IFDI 3CCVA 4DV0L 4GOPA 1N8RC 1HZCA 1G51A 1N34Q 4LUVA 2C35B 2R92G 2VUMG 4JI2Q 1GD7A 1MJCA 4BBRG 1X54A 2OCEA 4DK6C 2WP8J 2R7ZG 4LF6Q 1LTLA 4IFDJ 1NTGA 1L1OC 2PQAB 3HOXH 4DR2Q 4A3JH 2D0OA 3I56A 2MO0A 2HT1A 4HIMA 1EFWA 3I7FA 4AYBE 3H0GH 1M90C 2K5HA 2VQEL 4B3SL 3F2DA 1KRTA 1WJJA 2ID0A 1HZAA 5ELNA 4YWLA 2D0PA 2I5HA 2MO1A 3PUVA 5C0XJ 5LMNQ 1N33L 2CFMA 1EWIA 1OXTA 3PV0A 4BXXG 3RLNA 3H0GG 2KENA 2VW9A 4ALPA 4JI6L 2E5LL 5BR8Q 4BA2I 1VQAA 3K0XA 3KDFA 1GM5A 4DR3L 3KLWA 1VCIA 2GVAA 1YI2A 1VQCA 1OXVA 4IPHA 3WWVA 1M1KC 1X56A 2YV5A 4BBSG 3G48A 1I94Q 1K9MC 2F4VQ 4A3IH 2YTVA 1VQFA 1H95A 4BY1H 4X66Q 4LF7Q 2E2HH 1VS0A 4Y52H 2N78A 3G4SA 1QVCA 3RN5A 3PCOB 5IWAL 4RG1A 3T1YL 1PH5A 2E2IH 1GO3E 3M7NA 5IYCH 5HGQA 4DKAC 5LMUL 1X55A 3K8AA 1YBYA 4FDBA 5C4XG 4KHPQ 1SROA 1BBUA 3HKSA 2IHEA 3K7AH 1C0AA 2YTXA 1HR0Q 3GTQH 1PH9A 4DUYQ 1J5EQ 3PSIA 4JOIC 1JE5A 2N8NA 4NB3A 4OWTB 1LUZA 4P73A 3TEHB 3VDYA 1UWVA 3S24A 3Q8DA 1LYLA 2AWOA 3ER0A 4OWWB 1PHJA 2GVBA 3UE1A 4DV1Q 3NBHB 4IO9A 4LF9L 3PO3H 4DR1L 2VS1A 2JEAI 3BU2A 4IFDG 2UU9Q 4AQYL 2VY3A 3TS0A 4X65L 1B70B 1QZGA 3FKIG 1HR0L 3CD6A 1HZBA 1IYJB 3CF5A 4IOAA 1Q12A 1VQNA 1YHBA 5IYCG 1S72A 5IP7G 1QVFA 4JBJA 1PV4A 2OQ0A 2K5VA 3HFZB 2CKZB 2MNAA 3AFPA 1W3SA 2JJQA 4X62L 5C3EG 2HHHL 1WCMG 1XMQL 2HIXA 2NN6I 4A3IG 4IJLA 2PQAA 1K8GA 4GN3B 1J6QA 4YCWA 1Y14B 3CCSA 2UUBQ 1VQPA 3GTGH 3M3YH 4DV3L 4YCUA 2LXJA 1C9OA 3U58A 1VQ9A 4NXML 4QQBX 2UXBL 1I6HH 1VQ6A 4A3MG 1OXSC 1R9TH 3CCEA 3S14H 3K80C 4NXNQ 1YEZA 3S1MH 4DR7Q 4PZ7A 5GQOA 4DR4Q 3RR5A 2KBNA 2KHIA 4JBWA 4R4TA 1WOCA 2JK8A 1IBLL 3BZKA 4DV6L 1Q86C 3I4NG 4K0KL 1O7IA 4IOCA 3CXCA 4A3EH 1IZ6A 2PMZE 2R7DA 1NMFA 2A1AA 1X3FA 2ATWA 2JA8H 4A3JG 3AQQA 1VQDA 1E24A 2K5NA 5EAYA 2E5LQ 1Q82C 3D0FA 3KJPA 4XTCS 5AJ3Q 4LF4Q 4A3KG 1Q1BA 1PH4A 5K36G 4A93G 3A74A 1Q46A 3GDEA 1NBWA 4UP7A 1B7YB 2AMCB 3G71A 3CMEA 3ULJA 3HOYH 4X6AH 1XMOQ 1VQBA 1VQ8A 4R4OA 2Y0SG 3A5UA 2A19A 1XNQL 3CPWA 4LF8Q 1VQ4A 2QA4A 3H3VH 4LF6L 2VNUD 4QGUA 2ZM6L 2YU9H 1IBKQ 3UDXA 2JA7H 2Z6KA 2WFWA 1XPRA 1JJCB 5JEAG 1Y1VH 1EQRA 2A8VA 3ULLA 3ERSX 4QJFA 1ASZA 3J80c 1UE1A 2ALYB 1L0WA 4A3BH 2IX0A 3PO2H 1PH7A 1PH8A 1AE3A 3HOVH 2QEXA 3GTJH 3BJUA 3UDGA 4C2MH 3FP9A 4GLVB 4A3FG 1IBLQ 1NJIC 3CCLA 1KC8C 4B3MQ 4L5RC 3S1NH 4LFAL 2UU9L 3E9IA 1VQMA 3M4OH 5C44G 4B3RL 4KHZA 4GN5A 4POGA 1I5FA 2QGQA 2YTYA 2WAQG 4GN4B 1K3RA 4LWCA 3U50C 4DV7Q 1KQSA 4HJ9A 1I3QH 5E7NA 1YJ9A 2UUAL 1X3GA 1CKNB 2AWNA 3E0EA 3JC66 3KF6A 3PUYA 4DR2L 1FJGQ 2RHSB 1A63A 4IPCA 4C3JH 1E7ZA 3J7ZC 1VQOA 4P74A 4BXXH 1Q81C 3M4QA 3K81C 4JV5Q 2PI2E 1EIYB 4LFCQ 1HNWQ 2UUBL 4C3IH 1KIXA 5M5XH 1OXUA 4APVA 1N32Q 1SRUA 3ICEA 3S16H 4DV3Q 2NVYH 3J81i 3T1HL 2K14A 4JOIA 1VQIA 4A3FH 2I5MX 1X65A 1AE2A 1SR3A 3RLOA 5C4JH 1ASYA 5HY6A 4DR4L 1RIPA 1EYGA 4JI6Q 1PH3A 2BH2A 1WI5A 1YIJA 4QY7A 4JI3L 3S17H 1YITA 5DLQE 4B3TL 1N32L 2VZAA 4DV2L 3GTKH 3I4MG 2F4VL 2LXKA 3I2ZA 3PGZA 5M5WH 2K4KA 1G291 2EIFA 5GADC 2I5LX 4J15A 4O2DA 4GNXC 1Q7YC 4X66L 4JI0L 4JI2L 1L1OB 1T9HA 3W1GA 1D7QA 3NEMA 5M3MH 3J81j 1YJNA 5FJ8H 5IWAQ 2V1CC 5M3FH 4MTNA 3RLFA 4DR6L 3HOUG 2JA6G 3A0JA 4B3ML 1K83H 2WAQE 2XGTA 5GAHC 2Q2HA 1N36Q 3S2HH 1Y1WH 3L2PA 4B3RQ 1SFOH 4JI8Q 2NZHA 1Y1WG 1J5EL 2ZJPA 3PO3G 3HKZE 2UXDQ 2VL6A 1Q1EA 3CCUA 4IJHA 2Z6KC 3EN2A 4YHHQ 1V43A 2HQLA 4BY7G 1QUQB 4GKJL 4HIDA 5BR8L 4A3CH 1TWHH 1UEBA 2PI2A 4HJ7A 3GO5A 4JI4Q 4DV6Q 1QZHA 4LF9Q 1Z9FA 1AH9A 4P71A 1PA6A 1U5KA 5FLXc 4A93H 3CAMA 3MXNB 4GS3A 2FXQA 1YHQA 4OO1G 4DV0Q 3M9BA 1IBMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KHI A;  2L15 A;  4IPG A;  4YCV A;  3I4N H;  4MNO A;  4YHH L;  4POF A;  3I55 A;  5IYD H;  1XPU A;  4OX9 L;  5LMN W;  2ZJR A;  4DPG A;  2B29 A;  1U0L A;  4A3D G;  3KDF B;  1HNZ L;  1VQ5 A;  1A8V A;  3KF6 B;  4LF4 L;  1XMQ Q;  3PUX A;  4JI3 Q;  4GLA C;  3S1R H;  2MQH A;  4KHP L;  1BKB A;  1UE7 A;  3CC2 A;  4L5Q A;  4DV2 Q;  3A5Z B;  3GTO H;  2RF4 A;  3F2C A;  4GOP B;  1A0I A;  3PIP A;  4RMF A;  1IBM L;  5C0X G;  4LFB Q;  1KRS A;  1BBW A;  4MZ9 A;  2E8G A;  2UUC Q;  5GAG C;  2NZO A;  3KOJ A;  5C3E H;  3UDF A;  3JAM c;  1CSQ A;  4BBS H;  4OXP A;  2BA1 A;  4KI0 A;  2Z0S A;  3HOW H;  3I4O A;  5M5Y H;  5IYB G;  1N36 L;  2ASB A;  4DR5 L;  3GTP H;  4A3G H;  4YY3 L;  1YHA A;  1CKM A;  5IYB H;  4GLX A;  4AQY Q;  1K73 C;  1K8A C;  2I0Q A;  3DLL A;  4JI1 Q;  1EUJ A;  1I94 L;  4TQU S;  4LFB L;  3GTM H;  4EQ5 A;  1MKH A;  5J3B A;  1CKO A;  1SN8 A;  4PG3 A;  5IP9 G;  3CP0 A;  3T1Y Q;  4PZ8 A;  1KD1 C;  1YVC A;  3IRB A;  1EQQ A;  2Y0S E;  2R92 H;  4LUO A;  1L1O A;  4JI7 Q;  3PO2 G;  4R1J A;  1W2B A;  4Y7N H;  1SLJ A;  5AJ3 L;  4DR5 Q;  2Q2U A;  1C7Y A;  2AHO B;  4KLK A;  3FKI H;  5IE8 A;  4UY8 C;  2WB1 E;  1VQG A;  1PYS B;  4JCV E;  5H1S E;  4DV5 Q;  4GKK L;  4A76 A;  4DV7 L;  1NE3 A;  1XMO L;  1BVS A;  2H5X A;  4LF5 Q;  4AH6 A;  2JA6 H;  2B3G A;  2VUM H;  1YJW A;  1VQ7 A;  1JJG A;  1VQK A;  3KJO A;  1E3P A;  3HOZ H;  2ZM6 Q;  1JT8 A;  1I50 H;  1GVP A;  1NMG A;  2RCN A;  1QUQ A;  4DR1 Q;  3U4Z A;  4JV5 L;  1PFS A;  1P16 A;  4A3G G;  5FLM H;  3M4P A;  1D8L A;  2OTJ A;  3CCQ A;  3H3V I;  4GKK Q;  4TVA B;  3S1Q H;  4A3C G;  3K7U C;  2JA7 G;  4LF5 L;  2K50 A;  1SE8 A;  3CCM A;  5M3F G;  3HOW G;  2WB1 G;  4JI5 L;  4LF7 L;  3L0O A;  1PYB A;  1PH2 A;  3CC4 A;  2NVT H;  4NPS A;  2HHH Q;  2JE6 I;  4P72 A;  3MEF A;  1S3O A;  1HNX L;  5JJL A;  1IXR A;  2XTI A;  2NVQ H;  5ELO A;  4A4I A;  1RL2 A;  2JEB I;  1N33 Q;  4A3E G;  4LNQ A;  2VQE Q;  4B3S Q;  3HOU H;  1Q8K A;  1CUK A;  3RZD H;  3E9H A;  2OQK A;  1G6P A;  4UP9 A;  1HR0 W;  1VQJ A;  1JJ2 A;  1E22 A;  4GNX A;  1FGU A;  4BY1 G;  3OYY A;  4LF8 L;  4OX9 Q;  1FJG L;  3J7A 5;  4DV4 Q;  1EIF A;  4DV1 L;  4JBM A;  2CWA A;  4P75 A;  4DR6 Q;  4JI7 L;  4DNI A;  3W1B A;  2R7F A;  1TWG H;  3B6Y A;  4QIW E;  2RHQ B;  3UE0 A;  4A3L G;  4JG2 A;  2UXC Q;  4X65 Q;  3TS2 A;  4JI8 L;  1X3E A;  4X64 L;  1N34 L;  4R4I A;  3GTL H;  4A3L H;  3OW2 A;  3CW2 C;  1EOV A;  1TWA H;  2OTL A;  1JMC A;  4OO1 I;  2PNH A;  4A3M H;  3F8T A;  5IYD G;  3F1Z A;  1VQE A;  2LSS A;  2EQS A;  1QVG A;  1FVI A;  1XNR Q;  2JA5 G;  4B3T Q;  3DM3 A;  3JAM i;  4A3B G;  1YZ6 A;  1E1T A;  1UE6 A;  2HIV A;  3KFU A;  2KCT A;  1B8A A;  2K75 A;  4X64 Q;  1PH6 A;  1WCM H;  2K52 A;  3HOX G;  3H15 A;  4YWK A;  4DUY L;  4GNX B;  4GOP C;  4EX5 A;  2R7Z H;  2KCM A;  4BBR H;  3OTO Q;  4HIK A;  1Z47 A;  5C0X I;  5IP7 H;  1JB7 A;  1N9W A;  3NEL A;  4BY7 H;  2R93 G;  4IPD A;  3PF5 A;  2MFI A;  1K0R A;  1FL0 A;  3BZC A;  4R4Q A;  4BA1 I;  4DAM A;  1IBK L;  1XNR L;  2IHF A;  1OXX K;  3AFQ A;  2VQF Q;  3S15 H;  5JJK A;  4LFC L;  3UDI A;  2JQO A;  5FLM G;  5JJI A;  2BH8 A;  3ULP A;  1MIU A;  4H02 A;  3HOY G;  4UP8 A;  5IY0 A;  3KF8 B;  4YWM A;  4HJA A;  1VQL A;  2IT1 A;  2CWP A;  2N49 A;  3PUW A;  4JC0 A;  3T1H Q;  3OTO L;  2ES2 A;  2B63 G;  3S2D H;  2ZJQ A;  4JBK A;  3TRE A;  4DV4 L;  2IX1 A;  4JYA L;  4GKJ Q;  3EIV A;  1V9P A;  1UE5 A;  4X62 Q;  3M85 A;  4JI4 L;  3PIO A;  1E1O A;  2OWO A;  1KXL A;  4R4C A;  2R6G A;  4O0A A;  1Y1V G;  1GKH A;  2Q2T A;  2JA5 H;  2D62 A;  4A75 A;  1PVO A;  2R93 H;  4NXM Q;  1MJE A;  4PZ6 A;  2IY5 B;  4JI0 Q;  1VQH A;  4JI5 Q;  4DR7 L;  4WJ3 M;  2UUA Q;  2JA9 A;  4LW1 A;  4L5S A;  2JA8 G;  5IT9 c;  4DUZ Q;  2DGY A;  5GAE C;  1HNX Q;  3I4M H;  2ZTC A;  2E2J H;  1HZ9 A;  4LUZ A;  2F52 A;  2KHJ A;  3RNU A;  4DR3 Q;  4WJ4 A;  4K0K Q;  3PF4 A;  1CSP A;  1KAW A;  1XPO A;  3F2B A;  1X9N A;  4PMW A;  4DV5 L;  3GD7 A;  3CMA A;  1HH2 P;  3LGJ A;  4AYB G;  3RN2 A;  1TWC H;  2AKW B;  3STB C;  4A3D H;  1TXY A;  1CKN A;  1KL9 A;  4HJ5 A;  3KYH C;  4HJ8 A;  1V1Q A;  3PUZ A;  3CCR A;  3RZO H;  3J80 i;  4LFA Q;  3AEV A;  1DGS A;  2UXC L;  3CPF A;  3AYH B;  1TWF H;  1A62 A;  5JEA J;  2CCZ A;  1WYD A;  4ME3 A;  3SGI A;  4JI1 L;  1XNQ Q;  1S40 A;  2UXB Q;  5GRO A;  1SMX A;  4OWX B;  4DK3 C;  4NXN L;  3CC7 A;  1L2F A;  3HOZ G;  2ZTD A;  2NN6 G;  3CQZ H;  3HOV G;  4JYA Q;  2Q2I A;  3L7Z C;  2BA0 A;  1NY4 A;  1HJP A;  4OON A;  4XIG S;  1HNZ Q;  5C44 H;  2ZTE A;  2YYZ A;  1HNW L;  1PH1 A;  3J81 c;  2F3I A;  3ZJY C;  1WFQ A;  1LM0 A;  1YNX A;  3FHW A;  4QL5 A;  4DAY B;  2CQO A;  5C4X H;  1XJV A;  3STB D;  3CCJ A;  3TRZ A;  4A3K H;  1OTC A;  2NVX H;  2UUC L;  1X6O A;  2UXD L;  2B63 H;  3G6E A;  3W5O A;  5FJ8 G;  1XTD A;  4C3H H;  5M3M G;  3HKZ G;  3U4V A;  3D31 A;  3EBE A;  4DUZ L;  1IL2 A;  2N3S A;  4AIM A;  5IP9 H;  4UPA A;  2DUD A;  3NEN A;  2VQF L;  4L5T A;  5LMU Q;  4HIO A;  2GN5 A;  1P8L A;  4YY3 Q;  3TQY A;  2EXD A;  5LMN L;  4IFD I;  3CCV A;  4DV0 L;  4GOP A;  1N8R C;  1HZC A;  1G51 A;  1N34 Q;  4LUV A;  2C35 B;  2R92 G;  2VUM G;  4JI2 Q;  1GD7 A;  1MJC A;  4BBR G;  1X54 A;  2OCE A;  4DK6 C;  2WP8 J;  2R7Z G;  4LF6 Q;  1LTL A;  4IFD J;  1NTG A;  1L1O C;  2PQA B;  3HOX H;  4DR2 Q;  4A3J H;  2D0O A;  3I56 A;  2MO0 A;  2HT1 A;  4HIM A;  1EFW A;  3I7F A;  4AYB E;  3H0G H;  1M90 C;  2K5H A;  2VQE L;  4B3S L;  3F2D A;  1KRT A;  1WJJ A;  2ID0 A;  1HZA A;  5ELN A;  4YWL A;  2D0P A;  2I5H A;  2MO1 A;  3PUV A;  5C0X J;  5LMN Q;  1N33 L;  2CFM A;  1EWI A;  1OXT A;  3PV0 A;  4BXX G;  3RLN A;  3H0G G;  2KEN A;  2VW9 A;  4ALP A;  4JI6 L;  2E5L L;  5BR8 Q;  4BA2 I;  1VQA A;  3K0X A;  3KDF A;  1GM5 A;  4DR3 L;  3KLW A;  1VCI A;  2GVA A;  1YI2 A;  1VQC A;  1OXV A;  4IPH A;  3WWV A;  1M1K C;  1X56 A;  2YV5 A;  4BBS G;  3G48 A;  1I94 Q;  1K9M C;  2F4V Q;  4A3I H;  2YTV A;  1VQF A;  1H95 A;  4BY1 H;  4X66 Q;  4LF7 Q;  2E2H H;  1VS0 A;  4Y52 H;  2N78 A;  3G4S A;  1QVC A;  3RN5 A;  3PCO B;  5IWA L;  4RG1 A;  3T1Y L;  1PH5 A;  2E2I H;  1GO3 E;  3M7N A;  5IYC H;  5HGQ A;  4DKA C;  5LMU L;  1X55 A;  3K8A A;  1YBY A;  4FDB A;  5C4X G;  4KHP Q;  1SRO A;  1BBU A;  3HKS A;  2IHE A;  3K7A H;  1C0A A;  2YTX A;  1HR0 Q;  3GTQ H;  1PH9 A;  4DUY Q;  1J5E Q;  3PSI A;  4JOI C;  1JE5 A;  2N8N A;  4NB3 A;  4OWT B;  1LUZ A;  4P73 A;  3TEH B;  3VDY A;  1UWV A;  3S24 A;  3Q8D A;  1LYL A;  2AWO A;  3ER0 A;  4OWW B;  1PHJ A;  2GVB A;  3UE1 A;  4DV1 Q;  3NBH B;  4IO9 A;  4LF9 L;  3PO3 H;  4DR1 L;  2VS1 A;  2JEA I;  3BU2 A;  4IFD G;  2UU9 Q;  4AQY L;  2VY3 A;  3TS0 A;  4X65 L;  1B70 B;  1QZG A;  3FKI G;  1HR0 L;  3CD6 A;  1HZB A;  1IYJ B;  3CF5 A;  4IOA A;  1Q12 A;  1VQN A;  1YHB A;  5IYC G;  1S72 A;  5IP7 G;  1QVF A;  4JBJ A;  1PV4 A;  2OQ0 A;  2K5V A;  3HFZ B;  2CKZ B;  2MNA A;  3AFP A;  1W3S A;  2JJQ A;  4X62 L;  5C3E G;  2HHH L;  1WCM G;  1XMQ L;  2HIX A;  2NN6 I;  4A3I G;  4IJL A;  2PQA A;  1K8G A;  4GN3 B;  1J6Q A;  4YCW A;  1Y14 B;  3CCS A;  2UUB Q;  1VQP A;  3GTG H;  3M3Y H;  4DV3 L;  4YCU A;  2LXJ A;  1C9O A;  3U58 A;  1VQ9 A;  4NXM L;  4QQB X;  2UXB L;  1I6H H;  1VQ6 A;  4A3M G;  1OXS C;  1R9T H;  3CCE A;  3S14 H;  3K80 C;  4NXN Q;  1YEZ A;  3S1M H;  4DR7 Q;  4PZ7 A;  5GQO A;  4DR4 Q;  3RR5 A;  2KBN A;  2KHI A;  4JBW A;  4R4T A;  1WOC A;  2JK8 A;  1IBL L;  3BZK A;  4DV6 L;  1Q86 C;  3I4N G;  4K0K L;  1O7I A;  4IOC A;  3CXC A;  4A3E H;  1IZ6 A;  2PMZ E;  2R7D A;  1NMF A;  2A1A A;  1X3F A;  2ATW A;  2JA8 H;  4A3J G;  3AQQ A;  1VQD A;  1E24 A;  2K5N A;  5EAY A;  2E5L Q;  1Q82 C;  3D0F A;  3KJP A;  4XTC S;  5AJ3 Q;  4LF4 Q;  4A3K G;  1Q1B A;  1PH4 A;  5K36 G;  4A93 G;  3A74 A;  1Q46 A;  3GDE A;  1NBW A;  4UP7 A;  1B7Y B;  2AMC B;  3G71 A;  3CME A;  3ULJ A;  3HOY H;  4X6A H;  1XMO Q;  1VQB A;  1VQ8 A;  4R4O A;  2Y0S G;  3A5U A;  2A19 A;  1XNQ L;  3CPW A;  4LF8 Q;  1VQ4 A;  2QA4 A;  3H3V H;  4LF6 L;  2VNU D;  4QGU A;  2ZM6 L;  2YU9 H;  1IBK Q;  3UDX A;  2JA7 H;  2Z6K A;  2WFW A;  1XPR A;  1JJC B;  5JEA G;  1Y1V H;  1EQR A;  2A8V A;  3ULL A;  3ERS X;  4QJF A;  1ASZ A;  3J80 c;  1UE1 A;  2ALY B;  1L0W A;  4A3B H;  2IX0 A;  3PO2 H;  1PH7 A;  1PH8 A;  1AE3 A;  3HOV H;  2QEX A;  3GTJ H;  3BJU A;  3UDG A;  4C2M H;  3FP9 A;  4GLV B;  4A3F G;  1IBL Q;  1NJI C;  3CCL A;  1KC8 C;  4B3M Q;  4L5R C;  3S1N H;  4LFA L;  2UU9 L;  3E9I A;  1VQM A;  3M4O H;  5C44 G;  4B3R L;  4KHZ A;  4GN5 A;  4POG A;  1I5F A;  2QGQ A;  2YTY A;  2WAQ G;  4GN4 B;  1K3R A;  4LWC A;  3U50 C;  4DV7 Q;  1KQS A;  4HJ9 A;  1I3Q H;  5E7N A;  1YJ9 A;  2UUA L;  1X3G A;  1CKN B;  2AWN A;  3E0E A;  3JC6 6;  3KF6 A;  3PUY A;  4DR2 L;  1FJG Q;  2RHS B;  1A63 A;  4IPC A;  4C3J H;  1E7Z A;  3J7Z C;  1VQO A;  4P74 A;  4BXX H;  1Q81 C;  3M4Q A;  3K81 C;  4JV5 Q;  2PI2 E;  1EIY B;  4LFC Q;  1HNW Q;  2UUB L;  4C3I H;  1KIX A;  5M5X H;  1OXU A;  4APV A;  1N32 Q;  1SRU A;  3ICE A;  3S16 H;  4DV3 Q;  2NVY H;  3J81 i;  3T1H L;  2K14 A;  4JOI A;  1VQI A;  4A3F H;  2I5M X;  1X65 A;  1AE2 A;  1SR3 A;  3RLO A;  5C4J H;  1ASY A;  5HY6 A;  4DR4 L;  1RIP A;  1EYG A;  4JI6 Q;  1PH3 A;  2BH2 A;  1WI5 A;  1YIJ A;  4QY7 A;  4JI3 L;  3S17 H;  1YIT A;  5DLQ E;  4B3T L;  1N32 L;  2VZA A;  4DV2 L;  3GTK H;  3I4M G;  2F4V L;  2LXK A;  3I2Z A;  3PGZ A;  5M5W H;  2K4K A;  1G29 1;  2EIF A;  5GAD C;  2I5L X;  4J15 A;  4O2D A;  4GNX C;  1Q7Y C;  4X66 L;  4JI0 L;  4JI2 L;  1L1O B;  1T9H A;  3W1G A;  1D7Q A;  3NEM A;  5M3M H;  3J81 j;  1YJN A;  5FJ8 H;  5IWA Q;  2V1C C;  5M3F H;  4MTN A;  3RLF A;  4DR6 L;  3HOU G;  2JA6 G;  3A0J A;  4B3M L;  1K83 H;  2WAQ E;  2XGT A;  5GAH C;  2Q2H A;  1N36 Q;  3S2H H;  1Y1W H;  3L2P A;  4B3R Q;  1SFO H;  4JI8 Q;  2NZH A;  1Y1W G;  1J5E L;  2ZJP A;  3PO3 G;  3HKZ E;  2UXD Q;  2VL6 A;  1Q1E A;  3CCU A;  4IJH A;  2Z6K C;  3EN2 A;  4YHH Q;  1V43 A;  2HQL A;  4BY7 G;  1QUQ B;  4GKJ L;  4HID A;  5BR8 L;  4A3C H;  1TWH H;  1UEB A;  2PI2 A;  4HJ7 A;  3GO5 A;  4JI4 Q;  4DV6 Q;  1QZH A;  4LF9 Q;  1Z9F A;  1AH9 A;  4P71 A;  1PA6 A;  1U5K A;  5FLX c;  4A93 H;  3CAM A;  3MXN B;  4GS3 A;  2FXQ A;  1YHQ A;  4OO1 G;  4DV0 Q;  3M9B A;  1IBM Q; 
#chains in the Genus database with same CATH topology
 4OL7 A;  3KUP A;  3Q22 A;  2WTF A;  4POF A;  4KY7 A;  5IYD H;  4I7H A;  3RIZ A;  4DPG A;  4NP5 A;  1U0L A;  4MV6 A;  3V4S A;  5CA0 F;  1HNZ L;  4I7Z C;  1YNJ D;  1ZKO A;  2I46 A;  4L5Q A;  4J8Q A;  3V6K A;  4B9W A;  3JAM W;  4S3S A;  2RF4 A;  3MFI A;  1DOL A;  1IBM L;  2ZJT A;  4RMF A;  4LFB Q;  4EYI B;  2E8G A;  2RQX A;  2B2Y A;  2ZDQ A;  5KFC A;  1HFG A;  2K05 A;  1CZG A;  1ZEQ X;  3PIP 3;  1CSQ A;  3N6X A;  3GTP A;  3ONA B;  1B4O A;  2K04 A;  2FP4 B;  2E75 C;  1YHA A;  3QIA A;  4GLX A;  1K8A C;  1U4M A;  2E2I B;  4LF5 H;  2QDL A;  2F3V A;  4LFB L;  2Z6B A;  5H80 A;  1E2W A;  4ECW A;  1SN8 A;  4X3T A;  3ORR A;  1N48 A;  2QKI C;  2WE6 A;  4MA0 A;  4ECZ A;  4G7O C;  4RZQ A;  1KTK A;  3MXP A;  5FD6 A;  2K1B A;  5K5P A;  1WD0 A;  2AQ2 B;  4UY8 C;  4I55 F;  2X6L A;  3GP7 A;  1PYS B;  4CHT B;  1H9M A;  1BVS A;  3OW7 A;  1G2T A;  2JA6 H;  2CQA A;  2HHH H;  2EYM A;  3BYT B;  3CKI B;  1EY4 A;  4DK1 A;  1GVP A;  2PZU A;  2RCN A;  1S5C D;  2W6Q A;  3T56 B;  3R8B A;  5I4D A;  5DQH A;  5FLM H;  1HNW H;  1GLV A;  2OTJ A;  4Q44 A;  3H3V I;  1PTO B;  5KFA A;  3N40 P;  3M9N B;  3K7U C;  4RGM A;  1WTX A;  5E3F A;  3CCM A;  4U68 A;  3EJI A;  3CC4 A;  1JE4 A;  5KND A;  4ED2 A;  2NVY B;  1S3O A;  4P2C B;  4RAZ A;  1IXR A;  4A4I A;  4YJ2 F;  1S0M A;  5CGK A;  5EOY A;  4LNQ A;  1CUK A;  1XMO H;  4IAJ A;  1HR0 H;  4UP9 A;  5FD5 A;  1S5B D;  1DOK A;  2LKV A;  1EHI A;  4OX9 Q;  2R61 A;  3N44 B;  2R93 B;  1TWH B;  2DY7 A;  4P75 A;  4A3I B;  1KBL A;  1CI3 M;  4UHV A;  4WRD A;  4RCO A;  2R7F A;  4QIW E;  2PMZ A;  5LXT F;  2RHQ B;  4MTE A;  4Q8E A;  2I8C A;  4X65 Q;  3NPP A;  2YCH A;  4LFC H;  4JI8 L;  1N33 H;  3MFG A;  2W8K A;  4X64 L;  4JI2 H;  3CW2 C;  4DV3 H;  3OHA A;  4OO1 I;  1JMC A;  2WB1 B;  4LF6 H;  4RB1 A;  1U9R A;  2FJ2 A;  2EQS A;  2B63 A;  4B3M H;  1XNR Q;  2FLP A;  1NAP A;  2HIV A;  1UE6 A;  3NP8 A;  1JDE A;  2NZ1 D;  4X64 Q;  1B8A A;  4EFB A;  3RZO B;  3H15 A;  4ECY A;  4GOP C;  1FNV A;  3OTO Q;  1ICF B;  2R7Z B;  5BR8 H;  2R93 A;  3TZD A;  5C0X I;  5IP7 H;  2Q8I B;  3PF5 A;  2MFI A;  2VUM A;  3BZC A;  2EJM A;  4DAM A;  1XNR L;  4HCE A;  3AFQ A;  1XTC D;  2CW0 C;  4ECU A;  3HB9 A;  2OXP A;  2JQO A;  3FDS A;  5JJI A;  1GSH A;  2BH8 A;  5JJZ A;  3GTG B;  1MIU A;  3I4M B;  4H02 A;  1VQL A;  4YWM A;  1DXM A;  2CWP A;  3PIO 3;  3OTO L;  2W6Z A;  5JVG 3;  2ZJQ A;  4PWQ A;  4JBK A;  4C3J B;  4DV4 L;  2IX1 A;  4JYA L;  3R23 A;  3M9O B;  4JI4 L;  1V9P A;  4X62 Q;  2KVM A;  1CA6 A;  2OWO A;  1LAC A;  4R4C A;  3N8D A;  3H20 A;  4FS2 A;  4R8U B;  5KFY A;  5KG7 A;  4AQY H;  4DUY H;  3RV4 A;  1I4R A;  5KYL A;  4NXM Q;  3M4Y A;  2IY5 B;  1VQH A;  4JI5 Q;  1SEI A;  4DR7 L;  3IAY A;  2RVL A;  5FO8 B;  3VPB A;  2JA8 G;  4ME5 A;  4DUZ Q;  2DGY A;  2HDM A;  1BXT A;  1HNX Q;  2V9W A;  2KHS A;  2ZTC A;  4CDC C;  4OEM B;  3RNU A;  2KHJ A;  4K14 A;  2KSW A;  2QDB A;  3GTK B;  1S5D D;  1XPO A;  1NR2 A;  4A93 B;  3F2B A;  4DV5 L;  3OSO A;  1AUX A;  1VKZ A;  1VMP A;  4C3H B;  4ECV A;  3HBL A;  4A3D H;  3NTH A;  4HJ8 A;  1V1Q A;  3S1Q B;  3CCR A;  5L1J A;  1DGS A;  2FMA A;  3V6H A;  1H9K A;  3AYH B;  4F7X A;  1RF2 D;  2CCZ A;  2M05 A;  1TS4 A;  2L11 A;  5EKI A;  3RAQ A;  1XDN A;  4JI1 L;  3GII A;  3IFT A;  1RJT A;  3FEW X;  1XNQ Q;  1D2B A;  5C1O A;  4E6I A;  3P7J A;  4OWX B;  4K8I A;  4NXN L;  1L2F A;  2BA0 A;  4FVM A;  1NY4 A;  1DCZ A;  1HJP A;  1I4G A;  4L6T B;  4OON A;  4XIG S;  4JUZ A;  3E6Z X;  4JV0 A;  1CQI B;  1EY8 A;  2FLN A;  4HAE A;  1PFM A;  3ZJY C;  5KFP A;  2VQE H;  1VBG A;  4U7C A;  1OTC A;  2NVX H;  1X6O A;  2UXD L;  2B63 H;  5FJ8 G;  5KFW A;  2TMP A;  1PRT D;  2N3S A;  4AIM A;  3HOU B;  1N56 A;  5CV8 A;  2VQF L;  4DR6 H;  1D1I A;  4HIO A;  5LMU Q;  2R86 A;  4F4W A;  3UFX B;  1P8L A;  3TQY A;  2NVQ B;  5KT5 A;  4DAP A;  1PXU A;  1PX2 A;  3BYY B;  1HZC A;  1G51 A;  5KFH A;  2C35 B;  1IL8 A;  2VUM G;  4LF8 H;  1X54 A;  3KBG A;  1L1O C;  2PQA B;  3HOX H;  4DR2 Q;  4G7Z C;  3RAX A;  3I56 A;  5F2D A;  2MO0 A;  3RB4 A;  2C2E A;  4HIM A;  3VYT A;  5K36 H;  4RGN A;  2K5H A;  4TQS A;  4B3S L;  1SJE D;  3F2D A;  1WJJ A;  2ID0 A;  1HZA A;  5ELN A;  4IR9 A;  2E2I A;  4F4Y A;  2TSS A;  4EVO A;  3MHB A;  2V58 A;  2W7P A;  3RBE A;  4O3S A;  1JWS D;  3RLN A;  4K5V A;  2SDF A;  1UC8 A;  4MAM A;  2NU8 B;  1IYV A;  4OX9 H;  3TDQ A;  2AUK A;  1EY9 A;  3MEH A;  4DR3 L;  3KLW A;  4LF9 H;  3DEP A;  5KGU A;  2V4R A;  4RAY A;  2XGP A;  4BBS G;  1GGO A;  3FPU B;  4FXD A;  1A6X A;  4X65 H;  2BE5 C;  1I6V C;  4ECS A;  2V5A A;  1F9Q A;  4BY1 H;  2X69 A;  2NU6 B;  5I6Y A;  4X66 Q;  3J7A K;  3HEJ A;  4Y52 H;  2N78 A;  1JR0 D;  5IWA L;  4RG1 A;  2BQU A;  2LFN A;  2RGR A;  1GO3 E;  2IL8 A;  1B6S A;  3I72 A;  1QJO A;  3O13 A;  5JVD F;  1JOR A;  4KJO A;  2HUG A;  1BO0 A;  1YBY A;  3K8A A;  2G9H D;  5C4X G;  2W6N A;  5C44 B;  4XZ3 B;  3QOJ A;  3GTQ H;  1PH9 A;  1J5E Q;  2GLT A;  4JOI C;  2XCA A;  1FGB D;  4F4Z A;  2N8N A;  4IWX A;  1S10 A;  3LWU A;  1LUZ A;  5M3F B;  1TWA B;  1TU2 B;  2PW7 A;  1NCV A;  1UWV A;  3S24 A;  3TQ1 A;  5J1Z A;  4DAY A;  1LYL A;  2AWO A;  3G6J B;  3VR3 A;  2WYO A;  2GVB A;  4CGY B;  2F0L A;  2D5D A;  3LWE A;  3PO3 H;  1S0N A;  1PLF A;  5DM6 3;  3MWE A;  3D4R A;  4ETS A;  3GTM A;  1VF5 C;  2VY3 A;  3TS0 A;  2MPM A;  1HZB A;  4QIW B;  1TWH A;  4RHS A;  2OQ0 A;  4UCS A;  3H3V C;  1W3S A;  1RJQ A;  2A6H C;  1WCM G;  3E3X A;  3IG0 A;  1WSC A;  2F0D A;  2FPG B;  2PQA A;  3J81 L;  1HA5 A;  1TY0 A;  1AN8 A;  3MWD A;  4YCU A;  2L4N A;  3U58 A;  5KT3 A;  3GIM A;  1CA5 A;  4R7R A;  5C4Z A;  5FK9 C;  3WNZ A;  1I6H H;  4A3M G;  1OXS C;  1R9T H;  2A69 C;  3CCE A;  2R7N A;  4JI5 H;  1YEZ A;  2DN8 A;  2V4Q A;  3VA7 A;  2A6E C;  2ZDG A;  4RUA A;  1RTO A;  2KHI A;  3KHG A;  3FKI A;  3K5H A;  1AUV A;  4EBC A;  1LTA D;  4KN4 C;  1O7I A;  2R7D A;  4BWS C;  1V51 A;  2A1A A;  3NBI A;  2OLS A;  1VDZ A;  3NHH A;  2E5L Q;  3K7A B;  1ZET A;  3MA2 B;  5K36 G;  4RGO S;  4QWA A;  4A93 G;  2C28 A;  1NBW A;  4C56 C;  3G71 A;  3CME A;  3HOY H;  3BJY A;  1VQB A;  1CQV A;  1RD9 D;  2B2U C;  1K3B C;  1PFN A;  3CPW A;  1Z2P X;  5D1P A;  1VQ4 A;  2XRQ D;  1J8I A;  1IBL H;  2B8F A;  2FMC A;  3UDX A;  2Z6K A;  2WFW A;  2JA7 H;  1MZB A;  1RJP A;  2WB1 A;  4UAI A;  4KN7 C;  5JEA G;  4O3N A;  3MJF A;  5JVL A;  2KA7 A;  4J9Q A;  3JAM L;  1K1Q A;  4BWG B;  2F0W A;  4A3B H;  2RDJ A;  2I87 A;  3BQ0 A;  3FMA A;  1S0O A;  4K2K A;  2JSO A;  1EUD B;  1QNK A;  4IZ8 A;  2FHT A;  2Z8L A;  4GLV B;  1BDO A;  1ET6 A;  4A3K B;  1IBK H;  1VMC A;  4LFA L;  2BOS A;  5HGT A;  3M4O H;  4MTD A;  1SYX B;  3M4I A;  2JEF A;  3EFX D;  4GN5 A;  3QR8 A;  3A8J E;  3HP3 A;  1K3R A;  2Y0S B;  4IUN A;  4HJ9 A;  3PN1 A;  1SE4 A;  5E7N A;  1B44 D;  4O2A F;  1BR9 A;  2UUA L;  5KFN A;  3KHR A;  2ENB A;  5IIF A;  5KFZ A;  2RHS B;  1BCP D;  1VQO A;  4J1M A;  4C3J H;  3H6M A;  3RGX A;  2PVP A;  5A2Q E;  2JA6 B;  4YQW A;  3K81 C;  2UXC H;  1HNW Q;  1N32 Q;  5F9L A;  3ICE A;  3S16 H;  3S15 B;  3J81 i;  1LTG D;  1TVX A;  5DGB A;  1TY2 A;  2IBK A;  4JOI A;  4A3F H;  2I5M X;  1SR3 A;  4FF3 A;  3C46 A;  3GV6 A;  4WBN F;  3Q8S B;  2RSO A;  2O03 A;  2BH2 A;  3Q1K A;  4KKS A;  4QY7 A;  4JI3 L;  2ASJ A;  1PTO C;  1N32 L;  2ZXR A;  3T5H A;  5L37 A;  1M0T A;  1G29 1;  4J15 A;  1AP0 A;  2KUM A;  1LT5 D;  1L1O B;  3Q8P B;  1YJN A;  5M3F H;  5M3M B;  4RH6 A;  1CE8 A;  1HUN A;  3A0J A;  5A2Q L;  2XGT A;  1N36 Q;  2FK1 A;  1E2V A;  1Y1W H;  4X3S A;  5CAE B;  4DV0 H;  3L2P A;  1F9P A;  1M8A A;  4HED A;  1EZ6 A;  1SFO H;  2UUB H;  2C5C A;  1BOS A;  1Q3L A;  2J9G A;  4YR0 A;  3MZ5 A;  3HKZ E;  5ELB A;  3CCU A;  3C1E A;  4IJH A;  5HBR B;  4KKT A;  3HOZ B;  4YHH Q;  2KEC A;  2K32 A;  3VMM A;  1TWH H;  4HJ7 A;  3GO5 A;  4XX0 B;  1QZH A;  2PN1 A;  1Z9F A;  2LS0 1;  2R85 A;  2BDO A;  5FLX c;  4RKB A;  2FXQ A;  2R8I A;  3PUX A;  3M9B A;  1KHI A;  3I4N H;  4QWC A;  4YHH L;  3I55 A;  1S97 A;  3RTX A;  2FJZ A;  3KDF B;  5KFB A;  4ECR A;  1VQ5 A;  2NU7 B;  1B33 N;  3V05 A;  1AZP A;  2A69 D;  3DWA A;  3FDT A;  1EWC A;  3KF6 B;  1XMQ Q;  4LF4 L;  1TWF A;  1Y1V A;  4WD3 A;  3S1R H;  3V4Z A;  1S5E D;  4DV2 Q;  4DNT B;  2CW0 D;  3F2C A;  1ZYR C;  4GOP B;  1Q90 A;  1A0I A;  3PIP A;  1CK1 A;  4Q0Y A;  4ZOL F;  5I2X A;  2NZO A;  3KOJ A;  3UDF A;  4KV6 A;  1TS5 A;  5EPK A;  2EYJ A;  2Z0S A;  3I4O A;  1SNC A;  5M5Y H;  1EIG A;  3TZU A;  3GTP H;  1K73 C;  1CKM A;  4AQY Q;  3DLL A;  4JI1 Q;  4TQU S;  4QCL A;  5LL6 S;  2M9V A;  5IP9 G;  4ED3 A;  2HGS A;  3HGB A;  3T1Y Q;  4PZ8 A;  3VYS A;  3NBH A;  1HNX H;  4RNN A;  4DR1 H;  2R92 H;  4JI7 Q;  1L1O A;  4HNV A;  2BR0 A;  2JA5 A;  5CBE E;  2OH2 A;  1SLJ A;  5C4H A;  4DAV A;  2AHO B;  1C7Y A;  3FKI H;  5IE8 A;  3GIK A;  1SMY C;  3OWF A;  3J7Y W;  5H1S E;  2DJG C;  2M00 A;  4YP3 A;  1PZI D;  4A76 A;  2W9A A;  4DV7 L;  1XMO L;  4I7A A;  3T53 B;  2B3G A;  4KJN A;  1Z2N X;  1VQ7 A;  3VR2 A;  1JJG A;  2UVW A;  3RV3 A;  1E3P A;  3UI2 A;  2ZM6 Q;  3J81 W;  2XGQ A;  2E2H A;  3U4Z A;  4JV5 L;  4A3G G;  1JWU D;  1CQF A;  5BPF A;  4DR5 H;  3CCQ A;  4TVA B;  3S1Q H;  3RFC A;  4EQN A;  1EY7 A;  1VF7 A;  2JA7 G;  3H0G B;  4H44 C;  4DNR B;  1I6U A;  1PYB A;  2ICE C;  3W3A A;  1PH2 A;  2NVT H;  4A2B A;  4B9X A;  2VXW A;  4XYM B;  4J9S A;  2XTI A;  5ELO A;  4DL6 A;  2F0M A;  2VQE Q;  1G2S A;  1Q8K A;  4RA8 A;  2OQK A;  2RKS A;  4GKK H;  1E22 A;  1FJG L;  3OYY A;  1MGS A;  2F0H A;  2J7Z A;  1SYC A;  2BQ3 A;  4DR6 Q;  1PZK D;  5A2Q W;  2AU0 A;  4DNI A;  4IRK A;  3B6Y A;  3UE0 A;  3M4O B;  2HVQ A;  4A3L G;  1KDC A;  3SHL A;  2DJF C;  2UXC Q;  3GTP B;  4ME6 A;  2F4V H;  2W8L A;  4EBE A;  1N34 L;  4R4I A;  3NWT A;  4LF7 H;  4OHJ A;  1ILP A;  1TWC A;  3J80 L;  1TWA H;  4MV9 A;  1PFB A;  4A3M H;  3F8T A;  2JA7 A;  3F1Z A;  5D65 A;  2L12 A;  2DLN A;  3WDN A;  3VR6 A;  5LA6 F;  4JI4 H;  2JA5 G;  4F87 A;  4B3T Q;  4V19 0;  1YZ6 A;  1E1T A;  1Q8I A;  2YL2 A;  1E0B A;  2CHB D;  3KFU A;  2FMM A;  2KCT A;  2KED A;  1PH6 A;  1GUT A;  4PV1 C;  4YWK A;  4DUY L;  4GNX B;  3RBD A;  2A68 D;  3A8I E;  4BBR H;  1LT6 D;  4G7H C;  4DL4 A;  4JVZ A;  1N9W A;  3NEL A;  4BY7 H;  4DR7 H;  5I2Y A;  2PZT A;  1OXX K;  2UU9 H;  5BN4 A;  3UDI A;  3MAQ A;  2ATL A;  1I50 A;  4JC0 A;  2ES2 A;  3S2D H;  1KNE A;  2YW2 A;  4GKJ Q;  1SNQ A;  3EIV A;  1UE5 A;  3MR3 A;  1E1O A;  3CHB D;  2R8H A;  2R6G A;  1KEE A;  1S03 G;  1Y1W B;  2Q2T A;  1DV1 A;  3PO3 B;  4NKL A;  3KAK A;  4O4I F;  4PZ6 A;  2R7Z A;  2R8K A;  1STH A;  1F2Y A;  4A3J B;  2G9D A;  2UUA Q;  4WOR A;  4L5S A;  1WCM A;  5KG1 A;  5C0X H;  2W57 A;  1LAB A;  1LT4 D;  2R6F A;  1AN7 A;  4YIJ A;  3H91 A;  1KAW A;  4CKE A;  1X9N A;  4PMW A;  3JAM E;  4ULL A;  1BBX C;  3GLK A;  1X32 A;  2ICI A;  4H7B A;  1TWC H;  3STB C;  1D5Z C;  1TXY A;  1GJX A;  3TII A;  3HKZ B;  1IOW A;  2L0C A;  2LY7 A;  1KL9 A;  5KFQ A;  4E4T A;  4O4L F;  3SK6 A;  2VPQ A;  3K5L A;  2VA2 A;  1KAA A;  4DL7 A;  3RZO H;  1MI2 A;  4LFA Q;  2EXZ A;  2Z4H A;  3CPF A;  1TWF H;  1V1P B;  5KX5 F;  1WYD A;  2A74 C;  5E4X A;  1DOM A;  1S40 A;  3EPI A;  3OSP A;  5GRO A;  4O1N A;  3CC7 A;  3A7A B;  2EYF A;  2ZTD A;  1IOV A;  1CT1 D;  3HOV G;  5C3E B;  3L7Z C;  4JYA Q;  3JSL A;  1WTO A;  2YZM A;  4C5A A;  5C44 H;  4HNT A;  5TSS A;  1HNW L;  1F9R A;  3CRL C;  4LMQ D;  5JQW A;  2F3I A;  1LM0 A;  4B3S H;  2OF1 A;  3FHW A;  5D1O A;  4DAY B;  4AYB B;  3CCJ A;  2A6E D;  1Y8N B;  5EKK A;  2UUC L;  2E5L H;  2YRX A;  3GTM B;  4UCU A;  3E5N A;  1SNO A;  4C3H H;  2CH4 W;  1LO5 D;  1K28 A;  1FNW A;  4DUZ L;  5F9N A;  5IP9 H;  4UPA A;  5FO7 B;  2GPS A;  1BCP C;  2DUD A;  3NEN A;  2E2J B;  5T1I A;  4DXG A;  4WJW A;  4QWD A;  2GN5 A;  5LMN L;  3GTJ A;  1EYZ A;  3CQZ A;  3PW0 A;  3I70 A;  1TWG A;  1MJC A;  1IKM A;  4BBR G;  2OCE A;  5BPH A;  2WP8 J;  2QCP X;  3KXY T;  1NTG A;  4DL3 A;  5EWE A;  5LL6 b;  4YAJ B;  2D0O A;  2DPI A;  4K2L A;  4TRD A;  4AYB E;  4ZRZ A;  2F0G A;  3H0G H;  2IWH A;  3GQC A;  5C4X B;  3H40 A;  5LMN Q;  1N33 L;  2D0P A;  2I5H A;  3D6C A;  4MV1 A;  4JK1 C;  1JXL A;  2B2W A;  3S14 B;  2Z4I A;  3OHX C;  3BQ1 A;  4DU9 A;  4ALP A;  4HQ6 A;  1ICW A;  1EEI D;  3R2I A;  2Q8R E;  1W93 A;  3C2P A;  3VR5 A;  5LL6 X;  1T3N A;  3KDF A;  3BAA A;  2K5D A;  3C1F A;  1GM5 A;  2GVA A;  4C3I G;  2RDH A;  1VQC A;  2B2T C;  3SR1 A;  1M1K C;  5IYZ F;  1X56 A;  3G48 A;  1I94 Q;  2L1B A;  2F4V Q;  5IGC A;  4PMC A;  1H95 A;  4LF7 Q;  2F1M A;  2GA4 B;  4FNF A;  3T1Y L;  2F0I A;  1G8Z D;  3M7N A;  2HCI A;  5IYC H;  5E1F A;  3NSW A;  5LMU L;  1X55 A;  5FOB B;  4FDB A;  1JOK A;  3H0G A;  4B3T H;  1SRO A;  2IHE A;  4APM A;  4FP5 D;  2YTX A;  3TIG A;  2DPJ A;  5JEA H;  5KG5 A;  4O42 A;  3EYY A;  4OWT B;  4LFB H;  1CZW A;  1CHQ D;  3VDY A;  4DK0 A;  4DV4 H;  3PR5 B;  3Q8D A;  3TQT A;  2W70 A;  1HQM C;  5L1L A;  1XX8 A;  4EGV A;  3OUU A;  2DZD A;  3GTL B;  1Y8P B;  4IFD G;  5KFJ A;  2B2V A;  1GOZ A;  3SVM A;  4AQY L;  2UU9 Q;  1B70 B;  2RSN A;  2I80 A;  1IYJ B;  3KAJ A;  1Q12 A;  5FPR A;  3GIP A;  4HCS A;  1QVF A;  5BMV F;  1HPC A;  4JBJ A;  1PV4 A;  5C1P A;  5C5L A;  2J6U A;  3Q23 A;  3CQZ B;  2HHH L;  5C3E G;  1SFO A;  4K8J A;  4Q43 A;  3MC0 B;  1XMQ L;  3WOF A;  4A3I G;  1VBH A;  3GTQ B;  4J9K A;  4IJL A;  2EYP A;  2KJX A;  1Y14 B;  3Q8R B;  2UUB Q;  1VQP A;  3M3Y H;  3H4B A;  4MV3 A;  4IR1 A;  5KKN B;  2AQ1 B;  1ZXT A;  2UXB L;  4IQZ A;  4GC6 A;  4HNU A;  4YAK B;  3T5J A;  3LP8 A;  4PZ7 A;  1QWY A;  3GIQ A;  3RD4 A;  2JK8 A;  1IBL L;  4DV6 L;  3I4N G;  4K0K L;  3ND8 A;  3MXU A;  5KNB A;  4IOC A;  3IL8 A;  3RJ0 A;  2JEJ A;  5A35 A;  2W7O A;  3GIL A;  4FF4 A;  5EZY F;  1X3F A;  2SNS A;  4O2B F;  4A3J G;  1RYS A;  1E24 A;  2JA8 B;  5DAU A;  3KJP A;  4XTC S;  1TT2 A;  1WVL A;  1A3T A;  3A7L A;  3N52 A;  4A3K G;  1Q1B A;  3LML A;  1PH4 A;  3NQT A;  4FS1 A;  2F0E A;  5I47 A;  3GDE A;  4YY3 H;  3CVZ A;  1ZHS A;  5DG8 A;  1XMO Q;  4R4O A;  1D6E C;  2A19 A;  3MFH A;  2D9U A;  2A5H A;  4LF6 L;  5CB4 F;  2ZXP A;  4QGU A;  2ZM6 L;  2YU9 H;  3TBI B;  1JJC B;  3I12 A;  1QE6 A;  1Y1V H;  1EQR A;  4MHE A;  3BVM A;  3ULL A;  2A8V A;  1ASZ A;  3N43 B;  3J80 c;  2J0T D;  2R7L A;  3MR6 A;  3PO2 H;  5FLX E;  1PH7 A;  1T5X D;  2A73 B;  3OPO A;  2QEX A;  2VA3 A;  2CW7 A;  3GTJ H;  3K3V A;  4IUT A;  1EY0 A;  4Q45 A;  3CCL A;  4C2M H;  3H4D A;  4B3M Q;  2R7M A;  3E9I A;  3GIJ A;  4CC6 A;  2VPS A;  2XIW A;  4PDB A;  1PZJ D;  3M9M B;  1I5F A;  2YTY A;  2WAQ G;  1SBB B;  3QB3 A;  5KG4 A;  1I3Q H;  3T51 B;  5D3I B;  5CV4 A;  4EEQ A;  2PZW A;  3PW5 A;  2CW8 A;  5J2U F;  3PUY A;  3DEO A;  2AWN A;  4R9W A;  4C3J G;  4CC5 A;  1YNN C;  1V1O A;  1E7Z A;  3J7Z C;  2KOL A;  3M4Q A;  4ZKC B;  4KY6 A;  4A3B B;  1KIX A;  2V4D A;  3GTO A;  1ESF A;  4TV9 F;  3R5F A;  4F4X A;  3L4K A;  2NB0 A;  4I65 A;  4O4H F;  3D4W A;  1VQI A;  3BVZ A;  3RLO A;  4BY7 B;  1RIP A;  1EYG A;  4JI6 Q;  1BCP B;  2VB2 X;  3AU7 A;  1YIJ A;  3F2U A;  3C3L A;  4B3R H;  1YIT A;  1T94 A;  3H09 A;  1KDA A;  1FR3 A;  4C2M B;  3GTK H;  4NMZ A;  4QW9 A;  4J9O A;  2NYZ D;  5GAD C;  2I5L X;  4O2D A;  1ENF A;  3URY A;  4MV4 A;  5KG0 A;  5T1G A;  1T9H A;  3W1G A;  3NEM A;  5CMD A;  2L55 A;  2VR1 A;  5FJ8 H;  4EQP A;  2V1C C;  2EY6 A;  1I3Q B;  1X3P A;  3HOU G;  1I7L A;  5KFK A;  5GAH C;  4K6D A;  4CDD C;  1DD2 A;  3F8N A;  1Y1V B;  4KD4 A;  3RMH A;  2QW7 A;  4JI8 Q;  2NZH A;  1JDB B;  1IBM H;  3T1H H;  3V96 A;  1H9R A;  2VL6 A;  4QB4 A;  2C00 A;  2XD4 A;  3PW4 A;  4GKJ L;  4RNO A;  1V43 A;  2HQL A;  3FPP A;  1QUQ B;  3G6Y A;  4A3C H;  1EUC B;  2PI2 A;  4DR4 H;  1UNN C;  5COY A;  4JI4 Q;  1RHP A;  4UCV A;  4KHV A;  1SMY D;  1PA6 A;  1U5K A;  5M9O A;  4GS3 A;  1YHQ A;  1BNZ A;  4OO1 G;  5IT9 L;  5M5Y B;  3Q8Q B;  1RTN A;  4ZLT F;  4JI0 H;  2EY1 A;  4YCV A;  4IPG A;  2HVR A;  3D6W A;  4MNO A;  4ZHQ F;  4RAU C;  4C1N K;  2B29 A;  2F0O A;  4A3D G;  2HDL A;  1NUC A;  4K5X A;  4JI3 Q;  2JA5 B;  1S9F A;  4EG0 A;  1U4P A;  4GLA C;  1E4E A;  1IW7 C;  4LSX A;  4KHP L;  1BKB A;  5EPL A;  3A5Z B;  3NTI A;  3GTO H;  1AEX A;  1X3Q A;  2XSC A;  5C0X G;  3WOE A;  5L9X A;  2UUC Q;  4MZ9 A;  2OEO A;  4ZYS A;  2ALZ A;  2K6A A;  1SJH D;  2H1E A;  5C3E H;  3DHQ A;  3JAM c;  4J9M A;  4DFA A;  1STE A;  3SXH A;  1VAJ A;  1FNU A;  4L63 B;  4OXP A;  2Z1C A;  4BBS H;  2BA1 A;  3HOW H;  1FD7 D;  5IYB G;  1N36 L;  4G4K A;  2ASB A;  5KFO A;  5I6W A;  4LSA A;  4OO1 H;  2K33 A;  2AGP A;  4JV1 A;  2WAQ B;  1EUJ A;  4CJ2 C;  1I94 L;  4QW8 A;  3GTM H;  4EQ5 A;  2RDF A;  3RGZ A;  3GTL A;  4FXK C;  1YVC A;  3IRB A;  3EA6 A;  5C6A A;  1EQQ A;  1Y69 U;  3A55 A;  3S1M B;  1KJQ A;  5KFR A;  4R1J A;  1EFI D;  3U9S A;  1W2B A;  5AJ3 L;  4IZO A;  2Q2U A;  1IYU A;  4KLK A;  4J9P A;  2WB1 E;  1VQG A;  1EYD A;  3I3C A;  5KFG A;  4JCV E;  3BVG A;  4DV5 Q;  3IN5 A;  2X0S A;  5DLF A;  4FBT A;  3T16 A;  4LF5 Q;  4AH6 A;  2VUM H;  3SK5 A;  1YJW A;  2IPK D;  1U4L A;  1FJG H;  4LAA A;  2BCO A;  1I50 H;  1NMG A;  2R8G A;  4LFA H;  1QUQ A;  1WD1 A;  1PFS A;  1NNX A;  2V59 A;  3DMU A;  3M4P A;  2DWC A;  5IOC A;  3RF2 A;  1I4P A;  4LF5 L;  5FLX W;  2K50 A;  1ESR A;  1SE8 A;  3HOW G;  2O4X A;  2WB1 G;  4LF7 L;  3TIN A;  3BDO A;  4DF7 A;  4NPS A;  2HHH Q;  4R8U A;  1KAB A;  2JE6 I;  2HVS A;  3PO2 B;  3MEF A;  1HXY D;  3S2D B;  5JJL A;  1K83 A;  1SXT A;  1N33 Q;  2YZG A;  4A3E G;  4B3S Q;  3Q6S A;  2W6M A;  3HOU H;  1E4F T;  2ZT9 C;  3RZD H;  4L1K A;  5EWF A;  2AQ4 A;  4O3O A;  2NU9 B;  1HTP A;  1VQJ A;  1HR0 W;  5LOV F;  1F2Z A;  4BY1 G;  3J7A 5;  5DGA A;  2XCL A;  1EIF A;  4ZQI A;  3DUZ A;  4JBM A;  2O5I C;  2C2R A;  2CWA A;  1SYF A;  1XNR H;  1Z7T A;  3GTK A;  4JI7 L;  1XYI A;  3W1B A;  1F2M A;  1TWG H;  4QUC A;  2FE3 A;  4JG2 A;  1UAP A;  3NQI A;  2R3Z A;  3TP8 A;  3TS2 A;  2B2W C;  5C5M A;  4F88 A;  3OTO H;  2K03 A;  4ECX A;  5J2T F;  2PCF B;  1EOV A;  1HFN A;  2SCU B;  2EYL A;  4UDU C;  5IYD G;  1VQE A;  2NUC A;  1BCP F;  1QNU A;  5KRU A;  3JAM i;  4A3B G;  3JZI A;  4Y7N B;  3ND9 A;  3FKI B;  1W96 A;  2K75 A;  1WCM H;  3HOX G;  3W2D A;  3K0Y A;  1NR4 A;  3K3P A;  4DV1 H;  1QCB D;  4HIK A;  2K5W A;  1Z47 A;  4TKO B;  4RGT A;  1MSG A;  4N9P A;  4BA1 I;  1K0R A;  2IHF A;  3NXW A;  3S15 H;  5JJK A;  1I4X A;  1O7Y A;  2XVS A;  3DWP A;  3M3Y B;  3J80 E;  4ED6 A;  4ZAI A;  1U4R A;  3KF8 B;  4ZCK A;  4JV2 A;  2MHV A;  4C3H G;  2IT1 A;  2N49 A;  3T1H Q;  5DM7 3;  2LMC B;  2PYK A;  3GTO B;  3OUZ A;  3M85 A;  1LTT D;  1GUN A;  1EZ1 A;  5EBC A;  1L2Z A;  2JXM B;  4XT1 B;  4O0A A;  1Y1V G;  5J22 A;  1GKH A;  4IUU A;  2D62 A;  1CFM A;  1PVO A;  1C4Q A;  4GZY C;  1I4H A;  4JI0 Q;  4X3K A;  4NXN H;  5C4J B;  5KT6 A;  3VPC A;  4WJ3 M;  4LW1 A;  4EGJ A;  5DEH A;  3I4M H;  4TV8 F;  3PR4 A;  2HD3 A;  2F52 A;  4LUZ A;  4R8I A;  1CSP A;  4MTK A;  4QUF A;  3GQB A;  1STY A;  3HS0 C;  3GD7 A;  4K6L A;  3CMA A;  1HH2 P;  5KEE A;  5KFI A;  3LGJ A;  4HSP A;  2UXD H;  5JPM C;  2R7K A;  3P75 A;  2W9B A;  4R8N A;  2UUC H;  1CKN A;  5L1K A;  1B9M A;  3K58 A;  1V8Q A;  4EEY A;  1ZHQ A;  1QB5 D;  2UXC L;  1BXR A;  3TP6 A;  5JEA J;  1B2T A;  1STG A;  1A9X A;  3QFF A;  4NDX A;  1ET9 A;  2H4O A;  2WII B;  3LNN A;  2RA4 A;  3K5M A;  1SMX A;  1BJT A;  1B9N A;  3QWN A;  1TKW B;  3HOZ G;  1PK8 A;  3CQZ H;  2NN6 G;  3G6V A;  2KCN A;  2XNA C;  5NUC A;  3GID A;  3MR2 A;  4FBU A;  4RFB A;  3OOC A;  1JC7 A;  2P5Z X;  1WFQ A;  3BZD B;  2ASL A;  1XJV A;  3STB D;  3TRZ A;  4A3K H;  5KG2 A;  3PW7 A;  4HMI A;  3NGD A;  3G6E A;  3KBX A;  1XTD A;  5M3M G;  1K8M A;  3R2T A;  3U4V A;  3D31 A;  3NUC A;  1IL2 A;  4CJ1 B;  5KT2 A;  3J81 E;  1YNN D;  2JEI A;  3QO2 A;  3I4N B;  4C5C A;  4C3I B;  4U67 3;  2SOB A;  5JOB A;  4YY3 Q;  3S16 B;  1SCU B;  4IFD I;  3CCV A;  2B39 A;  4DV0 L;  1NSN S;  1Z6H A;  3OIQ A;  4LUV A;  4RU9 A;  1GD7 A;  2PBZ A;  3D8G A;  4DK6 C;  1PRT F;  2BDN A;  5IGG A;  1LTL A;  2Z9H A;  2C22 A;  5J39 A;  3KHH A;  1PDQ A;  3I7F A;  3DM1 A;  2JN4 A;  5EBD A;  1KRT A;  3AB9 A;  3WO1 A;  3HOY B;  4A3L H;  5D1O B;  1B1Z A;  1PTO H;  2MO1 A;  4ZK9 B;  3PV0 A;  3DF7 A;  2WKD A;  4BXX G;  3H0G G;  4JI6 L;  4ID6 A;  4XQN A;  4BA2 I;  5CV6 A;  4IUR A;  1VQA A;  1O7Z A;  5D14 A;  1LTS D;  1VCI A;  1YI2 A;  1OXV A;  4RKL A;  3TSS A;  3PZP A;  1SAP A;  1K9M C;  4XYQ A;  2R92 B;  2AQ3 B;  1EL0 A;  1E4E B;  1VQF A;  2E2H H;  4XQQ A;  1WTR A;  3UQ8 A;  1G91 A;  5T14 A;  4UFZ A;  1QVC A;  3RN5 A;  2B2U A;  3PCO B;  2E2I H;  5JUM A;  3KHL A;  4ILW A;  1O7L A;  3MTS A;  4A3F B;  1WH2 A;  5IOD A;  4KHP Q;  3H94 A;  3HKS A;  4HR7 A;  1A3V A;  3P1H A;  1C0A A;  1HR0 Q;  3R5X A;  4I4T F;  1WTP A;  2YZN A;  1JE5 A;  2CH4 A;  4TSS A;  1EEF D;  3X3M A;  4M1U B;  2EPB A;  1STN A;  3ER0 A;  1HA6 A;  4DV1 Q;  4CKB A;  3NBH B;  4Y8V B;  5KFT A;  4DR1 L;  2VS1 A;  2JEA I;  3BU2 A;  2MCT A;  3R5H A;  5L1I A;  4WFN 3;  1QIL A;  3J80 W;  1HR0 L;  2RCF A;  2XIG A;  4YBZ B;  3OHB A;  4IOA A;  2KCC A;  5DQI A;  1YHB A;  1S72 A;  1C30 A;  5IP7 G;  1HUM A;  1GHK A;  4EYH B;  3U9O A;  2K5V A;  2PMZ B;  4DN4 M;  2CKZ B;  2NBF A;  4X62 L;  4ECQ A;  2HIX A;  2NN6 I;  3KLR A;  3MR5 A;  5CA1 F;  2W6P A;  2Y0S A;  4IRD A;  1SDF A;  4EQO A;  5CYU A;  3CCS A;  4JI8 H;  4X64 H;  2IX3 A;  4UCO A;  1PRT B;  4DV3 L;  5IT9 E;  2LXJ A;  1VQ9 A;  2YU9 B;  4J0M A;  4NXN Q;  2EYO A;  2F4I A;  4DR4 Q;  1SYG A;  3DXJ C;  2KBN A;  4CKC A;  4JBW A;  1HTL D;  3BZK A;  2ZM6 H;  1HNZ H;  1F77 A;  2EZV A;  1KJ9 A;  4A3E H;  2IW3 A;  2PMZ E;  4XQJ A;  4QIW A;  1RK6 A;  3GV5 B;  3FVQ A;  1NMF A;  2ATW A;  3TP5 A;  2JA8 H;  2JYO A;  3AQQ A;  4C5B A;  1VQD A;  3MFY A;  1GUS A;  5EAY A;  4FF2 A;  5D8D A;  3D0F A;  5AJ3 Q;  2EJG C;  4LF4 Q;  4DL5 A;  5M5W B;  1B7Y B;  4HN7 A;  3ULJ A;  3GV7 B;  4NXM H;  3Q0A A;  1ILQ A;  2Y0S G;  3A5U A;  4ZKB B;  1TWC B;  4ED0 A;  1MBY A;  1SE2 A;  2HCC A;  3H3V H;  1GUO A;  4DUZ H;  1IBK Q;  1R9T B;  2MP1 A;  3SK8 A;  5EQ0 A;  5EJW A;  2N55 A;  1UNS A;  3ERS X;  4CDF C;  1HQR D;  3N41 B;  2CZG A;  3RZD B;  5KFE A;  1UE1 A;  2ALY B;  3CRK C;  1R4Q B;  1PH8 A;  4KKU A;  1AE3 A;  3QZ8 A;  3G7L A;  3SEB A;  2NN6 H;  5IGF A;  1EY5 A;  3IFD A;  2SEB D;  2KEE A;  1DV2 A;  4XXE A;  3MXN A;  4A3F G;  1IBL Q;  1NJI C;  1A63 A;  1KC8 C;  2VUG A;  4XYL B;  3S1N H;  1N32 H;  2UU9 L;  5K2M A;  1VQM A;  2F0N A;  4G57 A;  4B3R L;  1FKA H;  4O3P A;  4DV5 H;  4KHZ A;  1LTR D;  1IW7 D;  2QGQ A;  1XNQ H;  3U50 C;  4CBV A;  4DV7 Q;  2I07 B;  1B50 A;  2C9O A;  1YJ9 A;  1BNC A;  1X3G A;  4DR2 L;  1FJG Q;  3JC6 6;  4J6H A;  3TN2 A;  4F50 A;  2NTT A;  4IPC A;  5IGB A;  4DXF A;  5CV5 A;  3E5S A;  1V4Y A;  1TA8 A;  5IGE A;  2MJ8 A;  2PI2 E;  4JV5 Q;  2UUB L;  2P0A A;  4IAL A;  1ULZ A;  4C3I H;  3K5I A;  4APV A;  4DGZ A;  1C8C A;  5KFD A;  2F0K A;  4HTH A;  5HUR A;  4OGQ C;  2NVY H;  1GUG A;  1EQV A;  2B2T A;  3T1H L;  2K14 A;  4BBR B;  3P20 A;  5LYJ F;  2DNC A;  1AE2 A;  5C4J H;  4K5W A;  1PH3 A;  2WV6 D;  3QJY A;  1Z2O X;  1WI5 A;  5LMU H;  4IN3 A;  3S17 H;  2F0J A;  5DLQ E;  1JIH A;  2RGV A;  4B3T L;  4M7E A;  1IHZ A;  4M9U A;  1LLR D;  3I4M G;  1E2Z A;  2XC9 A;  2PO4 A;  2IA6 A;  4GNX C;  4A3G H;  2EIF A;  4AYB A;  4KK7 A;  4YHH H;  3ERO A;  4X66 L;  4JI0 L;  4JI2 L;  1EWH A;  1KLU D;  2RDG A;  3HXL A;  5KFL A;  1I4Q A;  3J81 j;  3N6R A;  1B3Q A;  3A56 A;  5IWA Q;  4MTN A;  2UUA H;  3BG3 A;  2MUY A;  4HMJ A;  3RLF A;  4DR6 L;  2VQF H;  1XXG A;  2NTS A;  2JA6 G;  3V2T A;  4B3M L;  1K83 H;  2Q2H A;  4KY5 A;  3ETH A;  3BG5 A;  2A68 C;  1J5E L;  5KT7 A;  2R8J A;  1F9S A;  1TWG B;  1WTH A;  5KFS A;  1V1P A;  4BY1 B;  2E2H B;  4HID A;  3OIP A;  5BR8 L;  1UEB A;  2EVB A;  2IMW P;  1XMQ H;  4LK1 C;  2FB9 A;  5C5J A;  4QWB A;  1EU3 A;  4LF9 Q;  4PQX A;  1BGW A;  4PNY A;  1AH9 A;  4MA5 A;  4P71 A;  4DV2 H;  1SYE A;  1D5X C;  3CAM A;  4A93 H;  3MXN B;  1AFP A;  1N36 H;  4IRC A;  1TII D;  2K5Q A;  4DV0 Q;  5JPN C;  2L5T A;  2L15 A;  3L4J A;  1JLL B;  3T5L A;  1XPU A;  4OX9 L;  5LMN W;  2ZJR A;  3HRZ C;  4ED1 A;  4JYA H;  4DR3 H;  1G6Z A;  1ROD A;  4K0K H;  1A8V A;  1LV9 A;  5KNC A;  5BN5 A;  3BA9 A;  4F8M A;  2J4X A;  2FK2 A;  2MQH A;  1UE7 A;  4LJZ C;  3CC2 A;  2ZXO A;  2UVU A;  3R93 A;  3U9T A;  5G3L F;  5C8Y F;  2R92 A;  5IT9 W;  3SE0 A;  2EY2 A;  2HQE A;  1KRS A;  1BBW A;  4DLK A;  5GAG C;  1KJJ A;  2XCP A;  3GTJ B;  2F0T A;  2B8G A;  2QF7 A;  4KI0 A;  1WTV A;  1WR2 A;  1GHJ A;  4XT3 B;  1MHW C;  1CS0 A;  2E2D C;  4DR5 L;  1OWT A;  4YY3 L;  1TS2 A;  5IYB H;  1HCZ A;  2I0Q A;  3S17 B;  4FU0 A;  2O2L D;  1C3O A;  2FFK B;  2WIN B;  2JA7 B;  1GSO A;  2B63 B;  1MKH A;  4U6P A;  2L9H A;  5J3B A;  1CKO A;  4PG3 A;  1EIH A;  4I50 F;  3Q2O A;  3CP0 A;  3N42 B;  1KD1 C;  1YNJ C;  2Y0S E;  1RJR A;  3LWB A;  1CHP D;  4LUO A;  3T5K A;  1S5F D;  1W6J A;  3K5O A;  3PO2 G;  2IP4 A;  4Y7N H;  2EDG A;  2EE1 A;  4ABN A;  4DR5 Q;  2QEJ C;  1K83 B;  3S2H B;  4ECT A;  4GKK L;  4IFD H;  3NK9 A;  2AUJ D;  3BDC A;  4OEL B;  5DLG A;  1NE3 A;  2H5X A;  1KDB A;  4OIK A;  2VUM B;  4FXG C;  1AW7 A;  1SYD A;  1TQO A;  3VYR A;  3G8C A;  1KJ8 A;  1VQK A;  1RYR A;  2NWG A;  3KJO A;  2X6G A;  3HOZ H;  1JT8 A;  1B04 A;  2G5D A;  3KTM A;  5KIX A;  4DR1 Q;  4JI7 H;  1P16 A;  5LP6 F;  1D8L A;  4JW0 A;  1N34 H;  4GKK Q;  2WKC A;  3K6O A;  4HR7 B;  3E0J A;  5ELF A;  4A3C G;  4LH6 A;  5KFM A;  4RB2 C;  2XWB B;  2NVX A;  5M3F G;  2ASD A;  4JI5 L;  5KT4 A;  3L0O A;  1M6V A;  2Q8T A;  3ITP A;  2VB3 X;  4Z9C B;  5HV6 A;  4P72 A;  1EY6 A;  1HNX L;  1TWA A;  3VYU A;  3ZYY X;  5C3W A;  1RCV D;  2NVQ H;  1RL2 A;  2A6H D;  1ZQ7 A;  2JEB I;  2K01 A;  4QMG A;  4J9N A;  1LTB D;  3A54 A;  3AMU A;  4RZR A;  3E9H A;  1G6P A;  1ONL A;  4MIU A;  4J9L A;  1JJ2 A;  1XWE A;  4GNX A;  1FGU A;  3ERQ A;  4DV7 H;  4LF8 L;  4DV4 Q;  1SNM A;  4DV1 L;  3RB3 A;  1Y8O B;  3MVV A;  1SFO B;  4YB8 B;  3GV8 B;  1SSO A;  1B3A A;  3M7G A;  3S1N B;  1JB3 A;  4JV5 H;  5FLX L;  4MN3 A;  3RUP A;  3GTG A;  1X3E A;  4UCT A;  2D2C C;  3GTL H;  2OTL A;  4A3M B;  3FMC A;  1E4G T;  1R9T A;  2PNH A;  1CTM A;  4FO2 A;  5CV9 A;  2W71 A;  2LSS A;  2YU9 A;  1QVG A;  1FVI A;  5EDW A;  1KLG D;  3DM3 A;  4L8J A;  1MSH A;  2QIL A;  2RDI A;  1Y1W A;  2K52 A;  1DM0 B;  3TME A;  4HSV A;  4EX5 A;  2KCM A;  2R7Z H;  4GKJ H;  2DY8 A;  1T36 A;  4RWS C;  4PMB A;  1BUV T;  4YR2 A;  1JB7 A;  1FYC A;  2R93 G;  4IPD A;  1FL0 A;  1S4Z A;  4R4Q A;  5I9O A;  1IBK L;  2VQF Q;  3IKJ A;  4LFC L;  5FLM G;  3ULP A;  3SDZ A;  3HOY G;  1B6R A;  4UP8 A;  5IY0 A;  5LHY 1;  2ZDH A;  4HJA A;  1DYQ A;  2F3W A;  2NVT B;  2PNR C;  3PUW A;  2C2D A;  4KTA A;  2B63 G;  3D3R A;  3FRP B;  2W9B B;  3TRE A;  3VR4 A;  3PIO A;  3I91 A;  4GC7 A;  1KXL A;  3OSN A;  4KHP H;  2E74 C;  2JA5 H;  4OIJ A;  2NVY A;  4A75 A;  1H9S B;  2R93 H;  1GSA A;  1MJE A;  5I9P A;  1DZ1 A;  3LX0 A;  1ENA A;  5D3D A;  2JA9 A;  5IT9 c;  5GAE C;  4CDE C;  1SND A;  4O3R A;  4IWY A;  1HZ9 A;  3Q24 A;  4DR3 Q;  4FYD A;  4K0K Q;  3PF4 A;  3KK7 A;  1O78 A;  4WJ4 A;  1EQT A;  4MV8 A;  3VA5 A;  4KMU C;  5EKL A;  3MWY W;  2W6O A;  2YRW A;  4AYB G;  3RN2 A;  1JQY D;  2AKW B;  3HG9 A;  4A3D B;  3EVQ A;  4HJ5 A;  3KYH C;  4XYO A;  3PUZ A;  1BQQ T;  2JA6 A;  3J80 i;  4RHR A;  1JIC A;  1JOQ A;  2OT2 A;  1WTW A;  3AEV A;  4DL2 A;  1A62 A;  2E76 C;  4Q0F A;  2F03 A;  5M5X B;  4ME3 A;  3SGI A;  2UXB Q;  4DK3 C;  1O80 A;  1K8O A;  4FF1 A;  3ORQ A;  5AFW A;  2Q2I A;  2MGS A;  1HNZ Q;  2ZTE A;  2YYZ A;  1PH1 A;  3J81 c;  2FKL A;  1YNX A;  4QL5 A;  4H0L C;  2CQO A;  2RBM A;  5C4X H;  1B53 A;  3K59 A;  2BQR A;  4IUV A;  1I6H B;  4RB3 C;  3PQI A;  5FKA C;  1UUP A;  5DG7 A;  1M4V A;  3KF8 A;  3W5O A;  3HKZ G;  3EBE A;  4ZI7 F;  1IKL A;  4LF4 H;  1SNP A;  2NUA B;  4Q5V A;  1PTO D;  4L5T A;  2JP1 A;  1M7J A;  1W6K A;  2WDT A;  4JI1 H;  2EXD A;  1D5M C;  1C48 A;  4GOP A;  1KNA A;  4ODG A;  3KLS A;  1N8R C;  3NE5 B;  1N34 Q;  2R92 G;  3BS1 A;  4LH7 A;  5KFV A;  1PTO F;  4JI2 Q;  5DG9 A;  3OWE B;  5KYI A;  1K0S A;  2R7Z G;  4JPB W;  3T1Y H;  4LF6 Q;  1H9S A;  5IGD A;  4IFD J;  1D1K A;  1LTI D;  4A3J H;  3ETJ A;  3I73 A;  3I4L A;  2HT1 A;  1EFW A;  2PQE A;  1M90 C;  2AGO A;  4CJ0 B;  2VQE L;  4HYK A;  3BA8 A;  5C0X J;  4YWL A;  3PUV A;  2IJ0 A;  2EJF C;  2CFM A;  1EWI A;  1OXT A;  3HOW B;  1SE3 A;  1BF4 A;  2KEN A;  2VW9 A;  2E5L L;  5BR8 Q;  2B2Y C;  3K0X A;  3RB6 A;  3D4D A;  2B2V C;  4BS9 A;  3HKZ A;  4A3E B;  1QG7 A;  4IPH A;  3EPG A;  1PMR A;  2EYH A;  3WWV A;  5EPJ A;  2YV5 A;  1EYC A;  3JRW A;  1TWF B;  2O5J C;  4A3I H;  1MD2 D;  2YTV A;  3CU7 A;  2F0V A;  1VS0 A;  3G4S A;  1PH5 A;  4RB0 A;  5HGQ A;  3JRX A;  5JH7 F;  3VPD A;  1PRT C;  4DKA C;  4DA2 A;  3SI8 A;  1L0X B;  3PW2 A;  1A3U A;  3GTQ A;  4TUY F;  1BBU A;  5KFX A;  3TP7 A;  3K7A H;  2QYZ A;  3OMG A;  4DUY Q;  1EOT A;  3PSI A;  2AGQ A;  1I94 H;  4P73 A;  3V6J A;  4NB3 A;  3K57 A;  3TEH B;  3BDL A;  1TR5 A;  3SE7 A;  2WAQ A;  4OWW B;  1PHJ A;  3QZ7 A;  3UE1 A;  4DV6 H;  4IO9 A;  4LF9 L;  4J9R A;  2WAC A;  5FPO A;  2F0Q A;  1K1S A;  1QZG A;  3CD6 A;  1J9O A;  4X65 L;  3FKI G;  1QOH A;  1EU4 A;  3HOX B;  3CF5 A;  1WTQ A;  1JCK B;  4YR3 A;  4ED8 A;  1OO9 B;  3T13 A;  1VQN A;  2UVV A;  5IYC G;  5IWA H;  3X3N A;  4LMY A;  1ZYR D;  3HFZ B;  2W9C B;  2MNA A;  1JWM D;  3AFP A;  2JJQ A;  5CC4 A;  5GON F;  3S9W A;  1SEB D;  4N9T A;  1PYW D;  2F0U A;  4QF4 A;  4GN3 B;  1J6Q A;  4YCW A;  5ELE A;  1K8G A;  2VOB A;  4A2A A;  3G6X A;  3GTG H;  1TAE A;  4TQR A;  5CBA E;  2DNE A;  1C9O A;  4QQB X;  4NXM L;  4MV7 A;  2NVX B;  2EOT A;  1VQ6 A;  1CQJ B;  1TS3 A;  3K80 C;  3S14 H;  4DR7 Q;  3S1M H;  2FK3 A;  2XWJ B;  5GQO A;  3HZX A;  3RR5 A;  5E4W C;  2CVR A;  3JSN A;  1A15 A;  2K7V A;  4H13 C;  1WOC A;  4R4T A;  5DNF A;  4B08 A;  1EYA A;  3J7A V;  2VQD A;  1Q86 C;  3R3O A;  4C1N I;  3CXC A;  4V0B A;  1IZ6 A;  4ZUI A;  1ENC A;  2SNM A;  1HHV A;  3GV3 A;  2W9C A;  2K5N A;  1DJR D;  2FPI B;  2EY5 A;  1Q82 C;  3SK4 A;  1RDP D;  1M0W A;  2F0P A;  4M8A A;  3BAB A;  2JEG A;  2F0F A;  3L9A X;  1RK5 A;  2J6S A;  4A3G B;  3KAL A;  3A74 A;  1Q46 A;  4UP7 A;  2AMC B;  4X6A H;  3BQ2 A;  4ED7 A;  3A8K E;  1VQ8 A;  2CQY A;  1I3Q A;  1XNQ L;  2F0S A;  2FPP B;  2K28 A;  2N88 A;  4LF8 Q;  4XDX A;  2UXB H;  2QA4 A;  2VNU D;  1UC9 A;  4Q8F A;  4DR2 H;  2QK4 A;  5BN3 A;  2FLL A;  1XPR A;  4EFE A;  4NW2 A;  5C3X A;  4YJ3 F;  1A2T A;  5ELC A;  5CR3 A;  4QJF A;  5ISR A;  2DIK A;  1II3 A;  4BBS B;  1O75 A;  1L0W A;  1STA A;  3OMC A;  4ZQ3 A;  2IX0 A;  4RUC A;  5KFU A;  1L0Y B;  1CM9 A;  1GUW A;  3HOV H;  3MXG A;  2PPB C;  2BE5 D;  1KJI A;  2YS6 A;  1DIK A;  1AZQ A;  3BJU A;  3UDG A;  3FP9 A;  3QG1 A;  4EGQ A;  1GXD C;  3KLS X;  4N8F A;  4L5R C;  2HJW A;  1F2L A;  5C44 G;  3DWQ A;  4X3U A;  4POG A;  1I50 B;  4GN4 B;  4LWC A;  5EGT A;  1KQS A;  3NTK A;  1LT3 D;  2PW5 A;  1JKJ B;  5JAV A;  4JI6 H;  1CKN B;  3E0E A;  3KF6 A;  4X66 H;  1S68 A;  4EBD A;  4O3Q A;  3RUZ A;  4P74 A;  4BXX H;  1Q81 C;  5FO9 B;  1EIY B;  4LFC Q;  4NLG A;  4RCN A;  1OXU A;  5M5X H;  5CV7 A;  1SRU A;  4DV3 Q;  2R87 A;  1UEA B;  4KD3 A;  3C0F B;  1J5E H;  1GYF A;  3QOL A;  1X65 A;  1EZ8 A;  1ASY A;  4G3I A;  5EWG A;  5HY6 A;  1STB A;  4DR4 L;  1H9J A;  4UCR A;  5COR A;  4N8X 1;  1WCM B;  3I90 A;  2GPW A;  3K5N A;  2J6T A;  5JVH 3;  3T4A C;  2VZA A;  4DV2 L;  5KFF A;  1JX4 A;  2F4V L;  1HRJ A;  2LXK A;  2XN9 C;  3I2Z A;  3PGZ A;  1ML0 D;  2K4K A;  4IUP A;  5M5W H;  1Q7Y C;  2R82 A;  3J7A F;  3EQL C;  4RNM A;  1JOO A;  5DQG A;  1D7Q A;  2YS7 A;  5M3M H;  1DON A;  3PVX A;  3L3O C;  3I8Z A;  2M2L A;  3NWS A;  5ELD A;  2WAQ E;  2UVR A;  1R4P B;  3S2H H;  1RKN A;  5G3L D;  5LMN H;  2XRS D;  4B3R Q;  3MWM A;  1Y1W G;  5KG3 A;  3WO0 A;  1KC7 A;  4QWE A;  1A2U A;  2ZJP A;  2KQ3 A;  3PO3 G;  4IHJ F;  3S1R B;  2FIN B;  1T5E A;  2UXD Q;  1Q1E A;  2Z6K C;  3EN2 A;  4BY7 G;  2R84 A;  4X62 H;  1SYB A;  5KG6 A;  4IUQ A;  3HOV B;  4JI3 H;  4DV6 Q;  4FM9 A;  3PMF A;  4C2M A;  3RB0 A;  2YYA A;  4ZUJ A;  3OW2 A;  1I7N A;  2E2J H;  1IBM Q; 
#chains in the Genus database with same CATH homology
 1KHI A;  2L15 A;  4IPG A;  4YCV A;  3I4N H;  4MNO A;  4YHH L;  4POF A;  3I55 A;  5IYD H;  1XPU A;  4OX9 L;  5LMN W;  2ZJR A;  4DPG A;  2B29 A;  1U0L A;  4A3D G;  3KDF B;  1HNZ L;  1VQ5 A;  1A8V A;  3KF6 B;  4LF4 L;  1XMQ Q;  3PUX A;  4JI3 Q;  4GLA C;  3S1R H;  2MQH A;  4KHP L;  1BKB A;  1UE7 A;  3CC2 A;  4L5Q A;  4DV2 Q;  3A5Z B;  3GTO H;  2RF4 A;  3F2C A;  4GOP B;  1A0I A;  3PIP A;  4RMF A;  1IBM L;  5C0X G;  4LFB Q;  1KRS A;  1BBW A;  4MZ9 A;  2E8G A;  2UUC Q;  5GAG C;  2NZO A;  3KOJ A;  5C3E H;  3UDF A;  3JAM c;  1CSQ A;  4BBS H;  4OXP A;  2BA1 A;  4KI0 A;  2Z0S A;  3HOW H;  3I4O A;  5M5Y H;  5IYB G;  1N36 L;  2ASB A;  4DR5 L;  3GTP H;  4A3G H;  4YY3 L;  1YHA A;  1CKM A;  5IYB H;  4GLX A;  4AQY Q;  1K73 C;  1K8A C;  2I0Q A;  3DLL A;  4JI1 Q;  1EUJ A;  1I94 L;  4TQU S;  4LFB L;  3GTM H;  4EQ5 A;  1MKH A;  5J3B A;  1CKO A;  1SN8 A;  4PG3 A;  5IP9 G;  3CP0 A;  3T1Y Q;  4PZ8 A;  1KD1 C;  1YVC A;  3IRB A;  1EQQ A;  2Y0S E;  2R92 H;  4LUO A;  1L1O A;  4JI7 Q;  3PO2 G;  4R1J A;  1W2B A;  4Y7N H;  1SLJ A;  5AJ3 L;  4DR5 Q;  2Q2U A;  1C7Y A;  2AHO B;  4KLK A;  3FKI H;  5IE8 A;  4UY8 C;  2WB1 E;  1VQG A;  1PYS B;  4JCV E;  5H1S E;  4DV5 Q;  4GKK L;  4A76 A;  4DV7 L;  1NE3 A;  1XMO L;  1BVS A;  2H5X A;  4LF5 Q;  4AH6 A;  2JA6 H;  2B3G A;  2VUM H;  1YJW A;  1VQ7 A;  1JJG A;  1VQK A;  3KJO A;  1E3P A;  3HOZ H;  2ZM6 Q;  1JT8 A;  1I50 H;  1GVP A;  1NMG A;  2RCN A;  1QUQ A;  4DR1 Q;  3U4Z A;  4JV5 L;  1PFS A;  1P16 A;  4A3G G;  5FLM H;  3M4P A;  1D8L A;  2OTJ A;  3CCQ A;  3H3V I;  4GKK Q;  4TVA B;  3S1Q H;  4A3C G;  3K7U C;  2JA7 G;  4LF5 L;  2K50 A;  1SE8 A;  3CCM A;  5M3F G;  3HOW G;  2WB1 G;  4JI5 L;  4LF7 L;  3L0O A;  1PYB A;  1PH2 A;  3CC4 A;  2NVT H;  4NPS A;  2HHH Q;  2JE6 I;  4P72 A;  3MEF A;  1S3O A;  1HNX L;  5JJL A;  1IXR A;  2XTI A;  2NVQ H;  5ELO A;  4A4I A;  1RL2 A;  2JEB I;  1N33 Q;  4A3E G;  4LNQ A;  2VQE Q;  4B3S Q;  3HOU H;  1Q8K A;  1CUK A;  3RZD H;  3E9H A;  2OQK A;  1G6P A;  4UP9 A;  1HR0 W;  1VQJ A;  1JJ2 A;  1E22 A;  4GNX A;  1FGU A;  4BY1 G;  3OYY A;  4LF8 L;  4OX9 Q;  1FJG L;  3J7A 5;  4DV4 Q;  1EIF A;  4DV1 L;  4JBM A;  2CWA A;  4P75 A;  4DR6 Q;  4JI7 L;  4DNI A;  3W1B A;  2R7F A;  1TWG H;  3B6Y A;  4QIW E;  2RHQ B;  3UE0 A;  4A3L G;  4JG2 A;  2UXC Q;  4X65 Q;  3TS2 A;  4JI8 L;  1X3E A;  4X64 L;  1N34 L;  4R4I A;  3GTL H;  4A3L H;  3OW2 A;  3CW2 C;  1EOV A;  1TWA H;  2OTL A;  1JMC A;  4OO1 I;  2PNH A;  4A3M H;  3F8T A;  5IYD G;  3F1Z A;  1VQE A;  2LSS A;  2EQS A;  1QVG A;  1FVI A;  1XNR Q;  2JA5 G;  4B3T Q;  3DM3 A;  3JAM i;  4A3B G;  1YZ6 A;  1E1T A;  1UE6 A;  2HIV A;  3KFU A;  2KCT A;  1B8A A;  2K75 A;  4X64 Q;  1PH6 A;  1WCM H;  2K52 A;  3HOX G;  3H15 A;  4YWK A;  4DUY L;  4GNX B;  4GOP C;  4EX5 A;  2R7Z H;  2KCM A;  4BBR H;  3OTO Q;  4HIK A;  1Z47 A;  5C0X I;  5IP7 H;  1JB7 A;  1N9W A;  3NEL A;  4BY7 H;  2R93 G;  4IPD A;  3PF5 A;  2MFI A;  1K0R A;  1FL0 A;  3BZC A;  4R4Q A;  4BA1 I;  4DAM A;  1IBK L;  1XNR L;  2IHF A;  1OXX K;  3AFQ A;  2VQF Q;  3S15 H;  5JJK A;  4LFC L;  3UDI A;  2JQO A;  5FLM G;  5JJI A;  2BH8 A;  3ULP A;  1MIU A;  4H02 A;  3HOY G;  4UP8 A;  5IY0 A;  3KF8 B;  4YWM A;  4HJA A;  1VQL A;  2IT1 A;  2CWP A;  2N49 A;  3PUW A;  4JC0 A;  3T1H Q;  3OTO L;  2ES2 A;  2B63 G;  3S2D H;  2ZJQ A;  4JBK A;  3TRE A;  4DV4 L;  2IX1 A;  4JYA L;  4GKJ Q;  3EIV A;  1V9P A;  1UE5 A;  4X62 Q;  3M85 A;  4JI4 L;  3PIO A;  1E1O A;  2OWO A;  1KXL A;  4R4C A;  2R6G A;  4O0A A;  1Y1V G;  1GKH A;  2Q2T A;  2JA5 H;  2D62 A;  4A75 A;  1PVO A;  2R93 H;  4NXM Q;  1MJE A;  4PZ6 A;  2IY5 B;  4JI0 Q;  1VQH A;  4JI5 Q;  4DR7 L;  4WJ3 M;  2UUA Q;  2JA9 A;  4LW1 A;  4L5S A;  2JA8 G;  5IT9 c;  4DUZ Q;  2DGY A;  5GAE C;  1HNX Q;  3I4M H;  2ZTC A;  2E2J H;  1HZ9 A;  4LUZ A;  2F52 A;  2KHJ A;  3RNU A;  4DR3 Q;  4WJ4 A;  4K0K Q;  3PF4 A;  1CSP A;  1KAW A;  1XPO A;  3F2B A;  1X9N A;  4PMW A;  4DV5 L;  3GD7 A;  3CMA A;  1HH2 P;  3LGJ A;  4AYB G;  3RN2 A;  1TWC H;  2AKW B;  3STB C;  4A3D H;  1TXY A;  1CKN A;  1KL9 A;  4HJ5 A;  3KYH C;  4HJ8 A;  1V1Q A;  3PUZ A;  3CCR A;  3RZO H;  3J80 i;  4LFA Q;  3AEV A;  1DGS A;  2UXC L;  3CPF A;  3AYH B;  1TWF H;  1A62 A;  5JEA J;  2CCZ A;  1WYD A;  4ME3 A;  3SGI A;  4JI1 L;  1XNQ Q;  1S40 A;  2UXB Q;  5GRO A;  1SMX A;  4OWX B;  4DK3 C;  4NXN L;  3CC7 A;  1L2F A;  3HOZ G;  2ZTD A;  2NN6 G;  3CQZ H;  3HOV G;  4JYA Q;  2Q2I A;  3L7Z C;  2BA0 A;  1NY4 A;  1HJP A;  4OON A;  4XIG S;  1HNZ Q;  5C44 H;  2ZTE A;  2YYZ A;  1HNW L;  1PH1 A;  3J81 c;  2F3I A;  3ZJY C;  1WFQ A;  1LM0 A;  1YNX A;  3FHW A;  4QL5 A;  4DAY B;  2CQO A;  5C4X H;  1XJV A;  3STB D;  3CCJ A;  3TRZ A;  4A3K H;  1OTC A;  2NVX H;  2UUC L;  1X6O A;  2UXD L;  2B63 H;  3G6E A;  3W5O A;  5FJ8 G;  1XTD A;  4C3H H;  5M3M G;  3HKZ G;  3U4V A;  3D31 A;  3EBE A;  4DUZ L;  1IL2 A;  2N3S A;  4AIM A;  5IP9 H;  4UPA A;  2DUD A;  3NEN A;  2VQF L;  4L5T A;  5LMU Q;  4HIO A;  2GN5 A;  1P8L A;  4YY3 Q;  3TQY A;  2EXD A;  5LMN L;  4IFD I;  3CCV A;  4DV0 L;  4GOP A;  1N8R C;  1HZC A;  1G51 A;  1N34 Q;  4LUV A;  2C35 B;  2R92 G;  2VUM G;  4JI2 Q;  1GD7 A;  1MJC A;  4BBR G;  1X54 A;  2OCE A;  4DK6 C;  2WP8 J;  2R7Z G;  4LF6 Q;  1LTL A;  4IFD J;  1NTG A;  1L1O C;  2PQA B;  3HOX H;  4DR2 Q;  4A3J H;  2D0O A;  3I56 A;  2MO0 A;  2HT1 A;  4HIM A;  1EFW A;  3I7F A;  4AYB E;  3H0G H;  1M90 C;  2K5H A;  2VQE L;  4B3S L;  3F2D A;  1KRT A;  1WJJ A;  2ID0 A;  1HZA A;  5ELN A;  4YWL A;  2D0P A;  2I5H A;  2MO1 A;  3PUV A;  5C0X J;  5LMN Q;  1N33 L;  2CFM A;  1EWI A;  1OXT A;  3PV0 A;  4BXX G;  3RLN A;  3H0G G;  2KEN A;  2VW9 A;  4ALP A;  4JI6 L;  2E5L L;  5BR8 Q;  4BA2 I;  1VQA A;  3K0X A;  3KDF A;  1GM5 A;  4DR3 L;  3KLW A;  1VCI A;  2GVA A;  1YI2 A;  1VQC A;  1OXV A;  4IPH A;  3WWV A;  1M1K C;  1X56 A;  2YV5 A;  4BBS G;  3G48 A;  1I94 Q;  1K9M C;  2F4V Q;  4A3I H;  2YTV A;  1VQF A;  1H95 A;  4BY1 H;  4X66 Q;  4LF7 Q;  2E2H H;  1VS0 A;  4Y52 H;  2N78 A;  3G4S A;  1QVC A;  3RN5 A;  3PCO B;  5IWA L;  4RG1 A;  3T1Y L;  1PH5 A;  2E2I H;  1GO3 E;  3M7N A;  5IYC H;  5HGQ A;  4DKA C;  5LMU L;  1X55 A;  3K8A A;  1YBY A;  4FDB A;  5C4X G;  4KHP Q;  1SRO A;  1BBU A;  3HKS A;  2IHE A;  3K7A H;  1C0A A;  2YTX A;  1HR0 Q;  3GTQ H;  1PH9 A;  4DUY Q;  1J5E Q;  3PSI A;  4JOI C;  1JE5 A;  2N8N A;  4NB3 A;  4OWT B;  1LUZ A;  4P73 A;  3TEH B;  3VDY A;  1UWV A;  3S24 A;  3Q8D A;  1LYL A;  2AWO A;  3ER0 A;  4OWW B;  1PHJ A;  2GVB A;  3UE1 A;  4DV1 Q;  3NBH B;  4IO9 A;  4LF9 L;  3PO3 H;  4DR1 L;  2VS1 A;  2JEA I;  3BU2 A;  4IFD G;  2UU9 Q;  4AQY L;  2VY3 A;  3TS0 A;  4X65 L;  1B70 B;  1QZG A;  3FKI G;  1HR0 L;  3CD6 A;  1HZB A;  1IYJ B;  3CF5 A;  4IOA A;  1Q12 A;  1VQN A;  1YHB A;  5IYC G;  1S72 A;  5IP7 G;  1QVF A;  4JBJ A;  1PV4 A;  2OQ0 A;  2K5V A;  3HFZ B;  2CKZ B;  2MNA A;  3AFP A;  1W3S A;  2JJQ A;  4X62 L;  5C3E G;  2HHH L;  1WCM G;  1XMQ L;  2HIX A;  2NN6 I;  4A3I G;  4IJL A;  2PQA A;  1K8G A;  4GN3 B;  1J6Q A;  4YCW A;  1Y14 B;  3CCS A;  2UUB Q;  1VQP A;  3GTG H;  3M3Y H;  4DV3 L;  4YCU A;  2LXJ A;  1C9O A;  3U58 A;  1VQ9 A;  4NXM L;  4QQB X;  2UXB L;  1I6H H;  1VQ6 A;  4A3M G;  1OXS C;  1R9T H;  3CCE A;  3S14 H;  3K80 C;  4NXN Q;  1YEZ A;  3S1M H;  4DR7 Q;  4PZ7 A;  5GQO A;  4DR4 Q;  3RR5 A;  2KBN A;  2KHI A;  4JBW A;  4R4T A;  1WOC A;  2JK8 A;  1IBL L;  3BZK A;  4DV6 L;  1Q86 C;  3I4N G;  4K0K L;  1O7I A;  4IOC A;  3CXC A;  4A3E H;  1IZ6 A;  2PMZ E;  2R7D A;  1NMF A;  2A1A A;  1X3F A;  2ATW A;  2JA8 H;  4A3J G;  3AQQ A;  1VQD A;  1E24 A;  2K5N A;  5EAY A;  2E5L Q;  1Q82 C;  3D0F A;  3KJP A;  4XTC S;  5AJ3 Q;  4LF4 Q;  4A3K G;  1Q1B A;  1PH4 A;  5K36 G;  4A93 G;  3A74 A;  1Q46 A;  3GDE A;  1NBW A;  4UP7 A;  1B7Y B;  2AMC B;  3G71 A;  3CME A;  3ULJ A;  3HOY H;  4X6A H;  1XMO Q;  1VQB A;  1VQ8 A;  4R4O A;  2Y0S G;  3A5U A;  2A19 A;  1XNQ L;  3CPW A;  4LF8 Q;  1VQ4 A;  2QA4 A;  3H3V H;  4LF6 L;  2VNU D;  4QGU A;  2ZM6 L;  2YU9 H;  1IBK Q;  3UDX A;  2JA7 H;  2Z6K A;  2WFW A;  1XPR A;  1JJC B;  5JEA G;  1Y1V H;  1EQR A;  2A8V A;  3ULL A;  3ERS X;  4QJF A;  1ASZ A;  3J80 c;  1UE1 A;  2ALY B;  1L0W A;  4A3B H;  2IX0 A;  3PO2 H;  1PH7 A;  1PH8 A;  1AE3 A;  3HOV H;  2QEX A;  3GTJ H;  3BJU A;  3UDG A;  4C2M H;  3FP9 A;  4GLV B;  4A3F G;  1IBL Q;  1NJI C;  3CCL A;  1KC8 C;  4B3M Q;  4L5R C;  3S1N H;  4LFA L;  2UU9 L;  3E9I A;  1VQM A;  3M4O H;  5C44 G;  4B3R L;  4KHZ A;  4GN5 A;  4POG A;  1I5F A;  2QGQ A;  2YTY A;  2WAQ G;  4GN4 B;  1K3R A;  4LWC A;  3U50 C;  4DV7 Q;  1KQS A;  4HJ9 A;  1I3Q H;  5E7N A;  1YJ9 A;  2UUA L;  1X3G A;  1CKN B;  2AWN A;  3E0E A;  3JC6 6;  3KF6 A;  3PUY A;  4DR2 L;  1FJG Q;  2RHS B;  1A63 A;  4IPC A;  4C3J H;  1E7Z A;  3J7Z C;  1VQO A;  4P74 A;  4BXX H;  1Q81 C;  3M4Q A;  3K81 C;  4JV5 Q;  2PI2 E;  1EIY B;  4LFC Q;  1HNW Q;  2UUB L;  4C3I H;  1KIX A;  5M5X H;  1OXU A;  4APV A;  1N32 Q;  1SRU A;  3ICE A;  3S16 H;  4DV3 Q;  2NVY H;  3J81 i;  3T1H L;  2K14 A;  4JOI A;  1VQI A;  4A3F H;  2I5M X;  1X65 A;  1AE2 A;  1SR3 A;  3RLO A;  5C4J H;  1ASY A;  5HY6 A;  4DR4 L;  1RIP A;  1EYG A;  4JI6 Q;  1PH3 A;  2BH2 A;  1WI5 A;  1YIJ A;  4QY7 A;  4JI3 L;  3S17 H;  1YIT A;  5DLQ E;  4B3T L;  1N32 L;  2VZA A;  4DV2 L;  3GTK H;  3I4M G;  2F4V L;  2LXK A;  3I2Z A;  3PGZ A;  5M5W H;  2K4K A;  1G29 1;  2EIF A;  5GAD C;  2I5L X;  4J15 A;  4O2D A;  4GNX C;  1Q7Y C;  4X66 L;  4JI0 L;  4JI2 L;  1L1O B;  1T9H A;  3W1G A;  1D7Q A;  3NEM A;  5M3M H;  3J81 j;  1YJN A;  5FJ8 H;  5IWA Q;  2V1C C;  5M3F H;  4MTN A;  3RLF A;  4DR6 L;  3HOU G;  2JA6 G;  3A0J A;  4B3M L;  1K83 H;  2WAQ E;  2XGT A;  5GAH C;  2Q2H A;  1N36 Q;  3S2H H;  1Y1W H;  3L2P A;  4B3R Q;  1SFO H;  4JI8 Q;  2NZH A;  1Y1W G;  1J5E L;  2ZJP A;  3PO3 G;  3HKZ E;  2UXD Q;  2VL6 A;  1Q1E A;  3CCU A;  4IJH A;  2Z6K C;  3EN2 A;  4YHH Q;  1V43 A;  2HQL A;  4BY7 G;  1QUQ B;  4GKJ L;  4HID A;  5BR8 L;  4A3C H;  1TWH H;  1UEB A;  2PI2 A;  4HJ7 A;  3GO5 A;  4JI4 Q;  4DV6 Q;  1QZH A;  4LF9 Q;  1Z9F A;  1AH9 A;  4P71 A;  1PA6 A;  1U5K A;  5FLX c;  4A93 H;  3CAM A;  3MXN B;  4GS3 A;  2FXQ A;  1YHQ A;  4OO1 G;  4DV0 Q;  3M9B A;  1IBM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...