3HOWG

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 31
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3howG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3howG01
1YBYA 4DAMA 3K0XA 5FLMH 3PIPA 1IBKL 4A3GH 1OXVA 3ULLA 4L5SA 2B63G 1PH6A 1VQNA 5IP9G 1K0RA 4JI7Q 3PF4A 1HNWQ 1VQAA 1HZAA 2VUMH 1HH2P 2ID0A 3PV0A 3RN2A 2NVXH 1OXUA 3S14H 3T1YL 1K8GA 4KI0A 1N8RC 4OWWB 3U58A 5IYBH 3GTGH 4B3ML 4R4OA 1X54A 1SN8A 2E2HH 2KBNA 4BBSH 3G6EA 1LM0A 1NTGA 1Q1BA 1MIUA 4JC0A 1QZHA 2K4KA 3S2HH 1KHIA 1VQJA 2D62A 3GD7A 4A4IA 1D7QA 2PQAA 4DV5L 3HOUG 4MNOA 1JJ2A 4DAYB 5IWAQ 3KDFB 3UDGA 4JYAQ 1M90C 1VQ9A 2NN6G 3MEFA 1S3OA 4X64Q 2OCEA 2VY3A 1TWHH 4P75A 3F1ZA 4DV2Q 1Y1WH 3CC2A 1U5KA 4DNIA 1IBLL 1NMGA 1L0WA 4A75A 3M3YH 4GLVB 2MQHA 3I2ZA 4A3MH 5J3BA 5IYCG 1NY4A 4QL5A 5FJ8H 5GAHC 4JI3Q 3HOZH 3S1RH 1XMOL 1XPUA 4HJ8A 1JT8A 4OWXB 3PO2H 1G291 1Y14B 4GNXB 2ZTEA 4OONA 4LNQA 1P8LA 1XPRA 2A1AA 1SMXA 2WB1E 4KHZA 1NE3A 5IE8A 5E7NA 4B3TL 3EBEA 1CKNB 5EAYA 4DUZQ 1AE2A 3GTQH 3JAMi 5LMUQ 3U50C 3K7UC 2Y0SG 5ELOA 1Z47A 3VDYA 4FDBA 3HOXH 3A5UA 1K9MC 1VQLA 1I3QH 4QJFA 4DR7Q 1EWIA 4DUYQ 1HNXL 2E2JH 1GO3E 4JI5L 1S72A 1TXYA 1EIFA 3FP9A 3STBC 2UUCL 2AKWB 1PYSB 2K52A 2UUAL 1WI5A 4C3JH 3J80i 2WP8J 2ZJQA 4JI1L 1C9OA 1WYDA 4QGUA 1H95A 1XMQL 2UUBQ 3GTLH 2YTVA 4BXXG 5C4XH 4DKAC 2DUDA 5IP7G 1XNRQ 2JA8G 2WAQE 4KLKA 4HIOA 4JBMA 4LF9L 5HY6A 1B7YB 4KHPL 2YYZA 1IBKQ 1UE5A 3RN5A 1UWVA 2HIVA 3PUWA 2IHEA 4HJ9A 4K0KL 1KAWA 2DGYA 4A3KH 2UXDQ 3STBD 1ASYA 4JI6L 5GQOA 3T1HL 1VQ8A 4JBWA 3I4OA 2ATWA 3CCRA 3L2PA 2IHFA 3T1YQ 1E3PA 1P16A 1JMCA 2AMCB 3HOZG 4JCVE 1ASZA 3KOJA 4LFBL 4IPGA 2VW9A 1YJNA 4A3EG 1Q86C 1GKHA 4B3MQ 1A62A 1KIXA 1GD7A 4YY3L 3OTOQ 3D31A 3GTPH 4IJHA 5JJLA 1SROA 4YCVA 1NBWA 1X3EA 3K8AA 2NVQH 1XPOA 3ZJYC 3CF5A 2WAQG 3KF8B 4BBRG 2L15A 4OXPA 4YHHL 4B3RL 2N78A 2K14A 2GVBA 3A0JA 5BR8Q 5C44H 3I4NG 1CKOA 3I7FA 1EIYB 1BVSA 1UE7A 4DR5L 1VQEA 1IBLQ 3H0GH 1W3SA 2UXBL 4GLXA 3DLLA 3UDFA 4HJ7A 1EQQA 2F4VL 2XGTA 4C2MH 4P73A 1L1OA 1HZ9A 1IL2A 4LFCL 3W5OA 4A3BH 1EFWA 1X3FA 3UE1A 1N33L 2R6GA 3TS2A 4AYBE 2VQFL 2VS1A 1Q81C 4A93H 4LW1A 2K5VA 2I0QA 3KDFA 3NELA 4B3TQ 1I94L 1N34L 2F3IA 3CQZH 2CFMA 1E22A 4JI8L 4H02A 1J6QA 1WFQA 4AIMA 1PH4A 4LF5L 4GKKQ 4J15A 3RLOA 5H1SE 5C0XG 1EOVA 3H3VI 1KC8C 2K50A 1X65A 4O2DA 4BY7H 5M5WH 1HNXQ 4IFDI 3HOYG 3ERSX 2EIFA 1YZ6A 5C3EG 1IZ6A 3OW2A 2JA9A 3KYHC 4LWCA 2JA5G 3ULJA 4POGA 4GNXA 4C3HH 3CCMA 4TVAB 3HKZE 4A3JG 3RZOH 2E5LL 5HGQA 1KXLA 3ULPA 2YV5A 4A3LH 1BKBA 4GNXC 4KHPQ 4LF9Q 1MJCA 1KD1C 1CKNA 5C44G 2HIXA 4K0KQ 2K75A 1YHAA 4AYBG 4DV6L 1K73C 4B3SQ 4UPAA 4UP9A 3CAMA 3CPWA 2ZTCA 2I5MX 4QY7A 3CMEA 3T1HQ 3TS0A 4NXNQ 3PO3G 4AH6A 4WJ3M 2ZM6L 3GTKH 1J5EL 4JV5L 1SR3A 1WCMH 2RHQB 4PZ8A 4LFBQ 2LSSA 2VQEL 1Q7YC 1HNZL 1CSQA 1B70B 3G4SA 4JI2L 4LFAL 4OX9L 3FHWA 4YY3Q 1X3GA 3J81c 1EQRA 1SFOH 5M5XH 3KF6B 1PH8A 4PZ7A 5M3FG 2NVTH 3CCUA 3AEVA 2JA6G 4BY1H 5C0XI 2GVAA 1CUKA 3HKSA 3HKZG 1PVOA 1WOCA 2H5XA 2PNHA 4LUOA 4AQYL 2YTYA 4LF4L 2CKZB 1VCIA 3UDIA 1SLJA 1YJ9A 1Y1VH 5AJ3Q 5FLMG 2QGQA 4YHHQ 1JE5A 1S40A 1N36Q 3HOWH 4A3GG 4B3RQ 4P72A 3PUYA 2QEXA 1X55A 1NJIC 2IY5B 2JE6I 2AWNA 2JA7H 2VUMG 2MO1A 2Q2IA 4LUZA 5GAGC 3TRZA 2UXBQ 3S15H 3J81j 5IYBG 1U0LA 1UEBA 2R92H 4A3LG 3K7AH 4A3FH 1C0AA 3FKIH 2KHIA 3E0EA 4BBSG 4YCWA 4A3CH 4L5QA 4DV4L 3NEMA 2AWOA 3CCLA 1KRTA 2AHOB 1K8AC 1RIPA 1E7ZA 4LF7Q 1HJPA 2VQFQ 4DR6L 1N32Q 1R9TH 2Q2HA 1QUQA 4HIMA 1QVGA 1QVFA 3J7A5 2KHJA 1HR0W 2NN6I 3B6YA 4IPCA 4YWMA 1HR0L 2I5HA 1MKHA 3F2BA 1JJGA 4JI8Q 3KFUA 4LF5Q 4LF6L 2Z6KC 1BBUA 2RF4A 3CC7A 1Y1WG 1Q82C 2HHHL 1A63A 1VQBA 2WB1G 4GS3A 4DV3L 3ER0A 5C4JH 4BA2I 2PI2E 3TEHB 4A3MG 2OTJA 3CP0A 2IT1A 5FJ8G 3F2DA 1VS0A 2VNUD 4JI7L 3S1NH 3I4MH 4IPDA 3EN2A 3M85A 5M5YH 3PO2G 3CCQA 5IYDH 4P74A 3S1MH 2N49A 2XTIA 3DM3A 5M3MH 2VL6A 3HOWG 2LXJA 1HZCA 3PF5A 3JC66 4DV1L 3PIOA 4DV6Q 1JB7A 1EUJA 4X6AH 2JA7G 2R7ZH 4XTCS 4JI4L 1PH9A 4DV5Q 4A3DH 1JJCB 1X56A 1LYLA 3KJPA 1Z9FA 4EX5A 2R93H 3RLNA 1IYJB 3A74A 3K81C 2ZM6Q 3HOXG 2E2IH 4JV5Q 1KRSA 5GAEC 4OO1G 2VQEQ 3KJOA 1Q46A 4A3CG 1Q1EA 4PG3A 3PCOB 4OX9Q 4JYAL 2WFWA 4MZ9A 3CXCA 2A8VA 3PSIA 3CCJA 4APVA 1T9HA 4DV2L 2B63H 5JEAJ 2B29A 4DR4L 5IP9H 1VQFA 5C4XG 4DR2L 1XMOQ 4DPGA 4IFDJ 1BBWA 1VQHA 2R7FA 4OWTB 4X62L 1KQSA 2V1CC 1PHJA 1K3RA 1WJJA 3HOVH 2D0PA 4A3KG 3M7NA 2IX1A 1Q8KA 1LUZA 4JG2A 4XIGS 4Y7NH 1OTCA 1VQ5A 1D8LA 2BA1A 4IO9A 3CCVA 4JI0L 1YITA 1V9PA 1VQPA 1VQGA 1PYBA 4R4IA 4IOAA 4UP8A 1YNXA 1YIJA 1HZBA 2RCNA 3HOUH 3AFPA 5IYDG 4DUZL 1EYGA 1AH9A 3KF6A 1E1TA 4GN4B 4NXML 4JI5Q 2EXDA 1A8VA 3PGZA 1G51A 1I50H 4DV4Q 3J81i 1LTLA 4DV0L 2UUAQ 4DR7L 2JQOA 1O7IA 3U4ZA 2FXQA 4JI1Q 4DR1L 1N9WA 2OWOA 2D0OA 1PFSA 3S17H 3K80C 1XMQQ 1V1QA 2N3SA 1PH7A 1A0IA 3GTJH 1HR0Q 5GROA 4HJAA 4A76A 3RR5A 1OXTA 3L7ZC 4LF6Q 2IX0A 2JJQA 4TQUS 2BH8A 2OQ0A 4IOCA 3RZDH 2HHHQ 4RG1A 3CCEA 4JI6Q 4YWKA 4DV3Q 3H0GG 5C0XJ 1VQ4A 3J7ZC 2UXDL 1SE8A 1B8AA 3W1BA 4LUVA 2MFIA 2NVYH 4GKJL 1L2FA 3CMAA 1YJWA 4A3BG 4GLAC 4JOIA 3F2CA 1I5FA 1SRUA 3HOVG 1QZGA 5JJIA 2C35B 4R1JA 2UXCL 3E9IA 4A93G 1VQKA 4DV1Q 3W1GA 2GN5A 2LXKA 2F52A 4JOIC 4GOPB 1VQ7A 4JBKA 2NZHA 4JI4Q 4IJLA 3OTOL 1L1OB 5IT9c 1E1OA 1UE1A 3EIVA 1IBML 3BJUA 2JK8A 2A19A 2Q2TA 4BY7G 4MTNA 4BXXH 4R4QA 4YWLA 2CWPA 4X66L 5IP7H 2Y0SE 1W2BA 2UU9L 3GDEA 2JA8H 3PUZA 3I55A 2YU9H 4PMWA 1XJVA 1I6HH 5BR8L 4DR5Q 2N8NA 3ICEA 2PI2A 4X65L 3S16H 1X9NA 2F4VQ 4DR4Q 4Y52H 2EQSA 4DV7L 3SGIA 3A5ZB 4DR2Q 1YI2A 2OQKA 2BH2A 2ZJPA 4LFCQ 4X62Q 1VQ6A 5IY0A 3BZKA 1M1KC 1G6PA 1KL9A 4PZ6A 4HIDA 3LGJA 4ALPA 2QA4A 1TWFH 4LF8L 1N33Q 1XNQL 4RMFA 3TREA 2KCTA 4A3EH 1K83H 4DK3C 1PH1A 3M9BA 4EQ5A 2HT1A 4JI0Q 1I94Q 1N34Q 2Z6KA 3H3VH 4POFA 4YCUA 1YHQA 5LMNW 4IPHA 3H15A 4L5RC 1CSPA 1WCMG 1YHBA 4JBJA 3TQYA 5LMNL 2ES2A 4DR3L 1YVCA 3PUVA 1FJGL 1FGUA 3CPFA 2JEAI 4NXMQ 4GKKL 4BBRH 1MJEA 3NBHB 2PQAB 2I5LX 4DV0Q 4GN3B 3S2DH 4DR1Q 2B3GA 3AFQA 3D0FA 3L0OA 4BY1G 3KLWA 2MNAA 3GTOH 3I4NH 1HNWL 2ASBA 4R4CA 2E5LQ 3AYHB 3I56A 1Y1VG 1VQMA 1PH3A 1TWCH 1YEZA 1GVPA 3U4VA 2CQOA 1GM5A 4IFDG 3G71A 2BA0A 5DLQE 3G48A 5K36G 4A3IH 4B3SL 1RL2A 3RNUA 1OXXK 1VQIA 1VQOA 2R92G 1J5EQ 1FVIA 1UE6A 2K5NA 4NXNL 4A3FG 4GKJQ 3FKIG 1PA6A 3NENA 5IWAL 1HNZQ 3CC4A 3Q8DA 3JAMc 2K5HA 4LFAQ 3M4QA 2MO0A 4JI2Q 2ZJRA 2VZAA 2UXCQ 4QIWE 4X64L 2NZOA 3RLFA 5JEAG 3AQQA 2ZTDA 3HOYH 1CKMA 1V43A 5C3EH 4GN5A 4NB3A 5JJKA 3M4OH 4NPSA 4AQYQ 3E9HA 3CW2C 3J80c 2Q2UA 2RHSB 4UY8C 2KENA 1IBMQ 2HQLA 2JA5H 4JI3L 4LF4Q 2UUCQ 1XTDA 4A3JH 3M4PA 1NMFA 4R4TA 2KCMA 3WWVA 4X66Q 2UU9Q 4HJ5A 1N36L 1TWGH 2Z0SA 5AJ3L 1QUQB 5ELNA 1Q12A 1IXRA 1QVCA 2CWAA 1TWAH 3IRBA 5GADC 4X65Q 3CD6A 2CCZA 1AE3A 3F8TA 2YTXA 3MXNB 3S1QH 3I4MG 4WJ4A 3PUXA 2JEBI 4DV7Q 2R7DA 1X6OA 3HFZB 4O0AA 5LMUL 4GOPA 4P71A 3PO3H 1VQDA 5M3MG 4QQBX 3UDXA 4ME3A 1DGSA 4LF8Q 1OXSC 1VQCA 1E24A 3UE0A 4L5TA 1XNQQ 4DUYL 4DR6Q 4DK6C 4GOPC 2E8GA 1PV4A 4OO1I 2R7ZG 4A3DG 1L1OC 5FLXc 4UP7A 4LF7L 3BU2A 4A3IG 3BZCA 1C7YA 1N32L 2R93G 1FL0A 3CCSA 3GO5A 1PH2A 4BA1I 2UUBL 2OTLA 2PMZE 5M3FH 4C3IH 3S24A 5IYCH 5LMNQ 1PH5A 2JA6H 4DR3Q 1XNRL 4HIKA 3OYYA 1FJGQ 3GTMH 2ALYB
chains in the Genus database with same CATH superfamily
3K3VA 4RGTA 3JZIA 1OXVA 2I46A 5A2QL 2FMCA 2GA4B 1PH6A 1DCZA 4O3QA 2I07B 2PW5A 1HXYD 1VQAA 5CV6A 2BQUA 1S0OA 1JX4A 2FK1A 2IL8A 4QWDA 5IGEA 1ILPA 3OUZA 5D3IB 4LMYA 2QILA 4EQOA 1B9MA 4HQ6A 4DL4A 3A8JE 2E2HH 2KBNA 1NTGA 4DR5H 1MIUA 2K4KA 1KHIA 1VQJA 3N43B 4DV5L 4MNOA 2PYKA 3RB3A 4IURA 4K2KA 4JPBW 5IWAQ 4X62H 3KDFB 2A5HA 4JYAQ 1GUTA 1VQ9A 2NN6G 4FS2A 1EY4A 1TS5A 2VUMB 1S3OA 1PZKD 2OCEA 1TWHH 2HD3A 4P75A 2B2WC 3GP7A 4DV2Q 5C3WA 4F4WA 3H91A 1Y1WH 1UC9A 2R3ZA 4JI0H 1EWHA 2C2RA 1I94H 1SYGA 1PLFA 3MHBA 1NY4A 4BBSB 5JPMC 3HOZH 4X3KA 1T5EA 1XMOL 2QYZA 4UHVA 3TBIB 3PO2H 1JKJB 4NXMH 2K5WA 4CKEA 3NQTA 2CZGA 1IW7C 4KKUA 2ZTEA 4XYQA 2EZVA 3SE7A 4J8QA 3HBLA 3EA6A 5JVH3 4DFAA 1PFNA 4HMJA 5GONF 4RGNA 1BXRA 4J9SA 4DUZQ 3VR6A 1M8AA 5LMUQ 2WDTA 2Y0SG 5ELOA 3MC0B 5FLXL 3VDYA 4OO1H 1TS2A 2CHBD 3HOXH 4EGJA 4R8NA 1BXTA 4JI5L 1S72A 2R7ZA 3FP9A 1EIFA 2ICIA 3PZPA 2CQAA 1WI5A 3VR2A 5DG8A 2K33A 4JI1L 5EWEA 2R93A 1TY0A 2MGSA 4BXXG 5C4XH 5IP7G 2DUDA 1XNRQ 3ORQA 1CQVA 3MXNA 4KY7A 4HIOA 4TQRA 4JI2H 4RA8A 4RB0A 1Y69U 2RKSA 3PR4A 2YYZA 1E0BA 3RN5A 1IBKQ 1UWVA 2HIVA 3PUWA 2IHEA 4K0KL 5KFDA 5L1LA 4A3KH 2B63A 1HPCA 1NAPA 3D3RA 3IFDA 2K04A 1IBMH 5IT9W 3T1YQ 1P16A 2MUYA 3Q8QB 2NU8B 4G7HC 4S3SA 2VW9A 1PYWD 2P5ZX 5ELCA 2RVLA 3Q23A 1A62A 3X3MA 1GD7A 1KIXA 5KFJA 4UCVA 5KT3A 1T36A 4HSPA 3A56A 1N56A 3F8NA 4YCVA 4G3IA 1X3EA 3PN1A 1JCKB 2WKCA 1SAPA 2Q8RE 3TP5A 1BDOA 2WAQG 4YBZB 5CBAE 1SYFA 2UVVA 3A0JA 1XNQH 1V51A 4FF3A 1T5XD 5EKLA 3DWAA 4DR5L 2QDBA 1W3SA 4GLXA 4HJ7A 1I6VC 2XGTA 4C2MH 2X6LA 5C3EB 1HZ9A 4RU9A 1SYDA 3I73A 1B3QA 4RGMA 2QEJC 4IRKA 2RDIA 4DL5A 2G9DA 3W2DA 3BJYA 3UQ8A 4EVOA 4NLGA 5ELDA 3UE1A 2W6NA 4Q43A 4M1UB 4DAYA 4CC6A 1Q81C 4A93H 4LW1A 2I0QA 4XQNA 2O03A 4F50A 2W9BB 1HNWH 2F0LA 1I94L 3SVMA 3CQZH 3M9NB 1IHZA 2A6HC 1PH4A 5IODA 4AIMA 4ZHQF 4HYKA 3RLOA 5C0XG 1AZQA 1KC8C 4BY7H 4IFDI 1HNXQ 2CH4A 4RUAA 3ERSX 1YZ6A 1IZ6A 2TMPA 4LWCA 2JA5G 3HEJA 1K3BC 2EY1A 2XRQD 3HKZE 4A3JG 1M6VA 5E4XA 2C5CA 1EZ1A 3ULPA 2YV5A 1SEIA 2L9HA 1BKBA 4ZKBB 5C44G 3HKZB 4AYBG 1VDZA 1YHAA 4FP5D 1K73C 3SDZA 3CPWA 3T1HQ 4QY7A 3TS0A 2VB2X 5F9LA 1DIKA 4AH6A 5M5WB 5J1ZA 1KDBA 1QE6A 3J80L 2F0QA 2JN4A 2LSSA 1N36H 2Z4HA 4JI2L 3JSNA 3H40A 3VR4A 5EWGA 5JAVA 1EQRA 1FYCA 3DUZA 3TP6A 3Q0AA 3AEVA 5M3FG 1BF4A 2AU0A 1CUKA 3U9SA 4AQYL 2R8KA 4ECUA 4FM9A 5AJ3Q 2QGQA 1JE5A 1TQOA 1PZJD 2F0OA 2HUGA 3KAKA 4I7AA 4P72A 1I3QA 4DR7H 3GTOA 1X55A 1KDCA 2JE6I 3GTKB 2W6QA 5GAGC 2VUGA 2L11A 2RQXA 4O4IF 3GTLA 4RHSA 2NUCA 1Q90A 3Q8SB 4ED2A 4A3LG 3K7AH 2KHIA 2R7MA 5M5XB 2NVTB 3TP8A 3EROA 2XWJB 3CCLA 1KRTA 3E5NA 1CA6A 4DNRB 1E7ZA 3VPCA 5D14A 3MR6A 2UXDH 4QWEA 3NWSA 3GV6A 2KHJA 4ME6A 3SR1A 1STBA 1JC7A 2PBZA 1NR2A 4JI8Q 4LF5Q 2PCFB 5C6AA 1ENCA 1OO9B 2H4OA 4LF6L 2JA7B 4B3MH 1IOVA 3CC7A 1Y1WG 1Q82C 4MV8A 2HHHL 2KCCA 1JWUD 2WB1G 1S5CD 1SNQA 4UCUA 2V59A 2OTJA 1J8IA 3MWMA 3WOEA 1RK5A 1V8QA 2R8IA 4B9XA 2KUMA 3PO2G 3HOWG 5M3MH 3EYYA 3TMEA 1TWAA 5BR8H 1U9RA 3PF5A 2FK2A 4EEQA 4DV1L 2B2YA 4DV6Q 4KMUC 1SNDA 5H80A 3EFXD 1IBLH 4DV5Q 2XN9C 1PTOF 1STGA 3RLNA 1IYJB 4C1NK 4OO1G 3J81L 3HOXG 4JV5Q 5GAEC 2F0HA 5I9OA 1MSHA 4Q8FA 4Y8VB 4XQQA 1CT1D 4ZQ3A 3S1NB 1S0NA 2RDGA 2AGPA 3J7AV 5JQWA 3S1MB 2XD4A 4DR4L 4C5BA 1XTCD 5C4XG 3JRXA 1I4GA 5E1FA 1XMOQ 5D8DA 1BBWA 1VQHA 1KQSA 2V1CC 4J9LA 2A69C 1WJJA 1F2YA 3NK9A 4A3KG 4CJ0B 3M7NA 4Y7NH 2E2IB 1E4GT 1XWEA 3CCVA 2VUMA 2EY5A 2EYFA 1VQPA 4XQJA 4UP8A 2AUJD 5CV4A 4O4HF 3H4DA 1HZBA 3MR2A 2K05A 5LYJF 1GYFA 4C1NI 4IHJF 2W9CB 2IA6A 4GN4B 4KHPH 4LF9H 4IUTA 4JI5Q 1KBLA 1I50H 4DV0L 4NDXA 4DR7L 2JQOA 1O7IA 1UC8A 5DEHA 4JI1Q 3S17H 1ENFA 2D0OA 4XYMB 4RNOA 3K80C 3G6XA 1V1QA 3HOVB 4QF4A 1PH7A 4NXNH 1C4QA 3RR5A 4ECYA 4LFBH 1F9SA 2IX0A 4DU9A 2JJQA 4TQUS 1EOTA 1T94A 2I87A 1RKNA 1Z7TA 2BH8A 1HCZA 4IOCA 1Q8IA 4YY3H 4ED0A 3HOUB 1VQ4A 5FD5A 2UXDL 1SFOA 2MHVA 3FRPB 3O13A 2W8LA 4GKJL 4L6TB 4C3HB 4YHHH 1BNCA 4R1JA 3KLSX 2UXCL 3E9IA 4A93G 1VQKA 4O3SA 3W1GA 3K5IA 2GN5A 2LXKA 4GOPB 1VQ7A 4JBKA 5HURA 4IJLA 5IT9c 1CA5A 5KT4A 1PRTB 2K03A 1A6XA 2K5QA 5CORA 4BY7G 2L12A 2UU9L 2R82A 1I7LA 2ZXPA 3I55A 1VF7A 1AUXA 4PMWA 1E2VA 1S0MA 5BR8L 4DR5Q 1JXLA 2N8NA 2R61A 2PI2A 3PIO3 2CVRA 4F4ZA 1X9NA 2C9OA 4N8FA 5ELFA 2HVSA 4DV7L 5CMDA 1O75A 2BDNA 3SGIA 1YI2A 2NTSA 1A3VA 3URYA 4X62Q 1VQ6A 2XGPA 2O5JC 3MR5A 4HIDA 2F3WA 2QA4A 1PZID 1TWFH 2RCFA 3OSNA 1B44D 2KCTA 4A3EH 4DK3C 4RNNA 2LMCB 2CW0D 1JORA 2C00A 4EQ5A 4XT3B 2HT1A 1BCPD 4JI0Q 5IGDA 1I94Q 3Q24A 2MCTA 4MV4A 4RUCA 3S1QB 2B2VC 5LMNW 1QWYA 2W6ZA 4DR3L 1YVCA 3PUVA 5CAEB 1FJGL 4G7OC 1K28A 4J9KA 4CJ1B 3OW7A 4FBTA 4IUPA 4ZOLF 4NXMQ 1F2MA 1MJEA 2J7ZA 2Q8IB 2GLTA 4H0LC 2YS6A 3Q8RB 5KFZA 2N88A 3L0OA 3I4NH 1SNCA 3X3NA 1SJED 5KFQA 3AYHB 1S5BD 2E75C 1WTRA 1IYUA 2VB3X 4UCRA 2VQEH 4OX9H 2CQOA 4K2LA 1C30A 4HSVA 4I55F 1RL2A 1KNAA 5JJZA 1EHIA 4BBRB 1UE6A 4NXNL 3ERQA 4DF7A 3NENA 5IWAL 3CC4A 3Q8DA 4Q44A 4JI2Q 3J80E 1GUWA 1KLUD 2JP1A 3A54A 2PZTA 3RLFA 5KFOA 1SYCA 1HFNA 2F0MA 1B6SA 4B9WA 3QFFA 5JJKA 5C3EH 1TWCB 4IWXA 2F0IA 3RB6A 4AQYQ 5L9XA 1IBMQ 1RTNA 5CV8A 3NBIA 3P1HA 3TDQA 2R93B 3KBGA 1TWGH 1FD7D 1G8ZD 1QUQB 3OOCA 2UUAH 2CWAA 1CI3M 4OHJA 4DGZA 5J39A 3MXNB 3D4WA 2W7PA 4O1NA 1HR0H 1SJHD 3H4BA 3HFZB 5LMUL 2B63B 2KEDA 5M3MG 3HOYB 1OXSC 3QZ8A 2NN6H 4L5TA 1XNQQ 4JI6H 4DV3H 1B3AA 4UP7A 3ZYYX 4ZCKA 1MHWC 3CCSA 4RAYA 4KV6A 4RZRA 4DL2A 1WCMA 1JICA 3S24A 2JA6H 2NU6B 2NVYA 3SK4A 1EY5A 1XNRL 4HIKA 4JV1A 4E4TA 2Y0SA 5I9PA 5KFKA 2F03A 1YBYA 5FLMH 5A2QW 1IBKL 3BQ0A 4L5SA 1LTTD 1U4MA 1YNND 1VQNA 3PO3B 1K0RA 4JI4H 1HNWQ 3P75A 3BG5A 3PV0A 3RN2A 1FR3A 1L2ZA 2DLNA 5IIFA 3S14H 3T1YL 1BUVT 1GHKA 4OWWB 1BO0A 1F9QA 2XCLA 5IYBH 4R8IA 2W9AA 2DPJA 4R4OA 2YU9A 1X54A 1SN8A 3PVXA 4C3IB 2IPKD 3I70A 4JV2A 4JC0A 4EYHB 2AQ4A 1STEA 3JAML 4KHVA 2D62A 4RKBA 1FKAH 3GD7A 5EBCA 1CQFA 3A55A 2PQAA 2ENBA 4DR2H 3FKIA 4DAYB 4JV0A 5KFXA 5LL6S 3CRLC 2VQDA 3MXUA 1M90C 2CQYA 2B8FA 1R9TA 2IBKA 4MV7A 2O5IC 4DNIA 2F0KA 4U68A 1W93A 1NMGA 1L0WA 2ZDQA 4IR9A 3GTGB 4LSXA 4A3MH 1O78A 5GAHC 3L3OC 3S1RH 4I65A 4HJ8A 1JT8A 1ZHSA 1Y14B 4MIUA 4L1KA 5KFNA 1LV9A 4CHTB 2HQEA 2EYJA 1B53A 4Q45A 4IWYA 1ZXTA 4R7RA 2FJ2A 4QW8A 4KHZA 1I6HB 1KJ9A 1S10A 3PW4A 5EAYA 1PTOB 4MV3A 1AE2A 5FLXW 3K7UC 1ZYRD 1Z47A 1C48A 3A5UA 1K9MC 1GOZA 5CV5A 1VQLA 2HJWA 4QJFA 4DR7Q 4QIWA 2BE5D 1HNXL 1GO3E 4ZI7F 2AKWB 2UUAL 4C3JH 3J80i 4TV8F 2ZJQA 3ONAB 1DONA 3VMMA 2E2IA 4APMA 2CW7A 1J5EH 2LS01 1B33N 3D6CA 4DKAC 3BA8A 1CZWA 4LFAH 1I4PA 4LH7A 4ECXA 3BVZA 5EPKA 2UXDQ 1Y8PB 1KAWA 3GTQB 3R5XA 4JI6L 3N41B 5GQOA 3T1HL 1VQ8A 1I3QB 4RKLA 2ATWA 2E2JB 2UUCH 2IHFA 4RWSC 1EU4A 4ED8A 1S5ED 1D1IA 2KEEA 2A6EC 3KLSA 4X66H 1AFPA 4A3EG 4B3MQ 1GKHA 1B50A 4EBCA 3GTLB 4FBUA 2FB9A 3D31A 3GTPH 5D1PA 4IJHA 5FOBB 4A2BA 1X3QA 2O4XA 2ZXOA 3KHGA 3ZJYC 2VA2A 2F0VA 2L15A 4LF8H 3PQIA 4QMGA 2K14A 5BR8Q 1JOKA 5C44H 4CKCA 3PMFA 4K6DA 3I4NG 1BVSA 3T16A 5KFRA 1UE7A 4FNFA 1VQEA 1IBLQ 1SYEA 1DOMA 3H0GH 3LWBA 3KHLA 3DLLA 3R8BA 5EOYA 1DM0B 5F2DA 4F4YA 5LP6F 3GTMA 2XIWA 1RTOA 3W5OA 1WVLA 3GQCA 1X3FA 2NVQB 1TY2A 2ICEC 2K5VA 5KT2A 4JI7H 2ZDGA 2ASLA 2KA7A 1LTBD 3RFCA 2Z8LA 4JI8L 3RMHA 1WFQA 4LF5L 1WTQA 3GLKA 3G6YA 3V6JA 3GIJA 1EOVA 1KDAA 4EFBA 2K50A 2RSNA 5DLFA 3Q8PB 3V6KA 2EIFA 5C3EG 3CU7A 1FNVA 2JA9A 1MBYA 1EEID 1E4EB 4POGA 4A3BB 4C3HH 3RZOH 4K6LA 1ZKOA 4A3LH 2W71A 2A6HD 4KHPQ 4LF9Q 1MJCA 5KFWA 1KD1C 5FO9B 2XVSA 5CR3A 3VYTA 5JVG3 2DZDA 2HIXA 2K75A 4DV6L 1NSNS 3C3LA 4UP9A 3CMEA 4A2AA 4NXNQ 3V2TA 1VMPA 1EIHA 2FJZA 1H9MA 1LT4D 2B2WA 1A3TA 4WJ3M 1J5EL 4JV5L 3J80W 2RHQB 4LFBQ 4U673 1B70B 4LFAL 1QG7A 5EKIA 4YY3Q 3CCUA 4C56C 2MP1A 5EQ0A 2JA6G 5C0XI 1PTOD 2GVAA 1G91A 3HKZG 1PVOA 2DY7A 3A8KE 2PNHA 2H5XA 5EJWA 3TSSA 5KNDA 3S2HB 4LF4L 1H9SA 1VCIA 2CKZB 1SLJA 2UUCL 2HVRA 5FLMG 4YHHQ 3HOWH 3KTMA 3PUYA 4DUYH 2R7NA 5LXTF 4J6HA 4ED1A 1Z2PX 3IKJA 2IY5B 5EGTA 4B08A 2AWNA 3VPBA 4OGQC 2PZUA 2MO1A 1NCVA 2KQ3A 5K36H 2J6UA 4MV9A 2EYMA 2UUBH 3BS1A 2PQEA 3WO1A 1TWCA 3J81j 5IYBG 1VBGA 3M3YB 4OELB 1TR5A 5I6YA 1SFOB 3IG0A 1KTKA 2AHOB 5CV7A 1HJPA 4UCOA 2E74C 3KF8A 1PRTF 1QUQA 4WRDA 4RCOA 4HIMA 1Y1VB 4M8AA 1Q3LA 3NE5B 5KG4A 4IPCA 4RCNA 2XIGA 2I5HA 2J6TA 2R85A 2EJGC 1JJGA 1UUPA 4Z9CB 4RAZA 2Z6KC 3K5HA 1LTAD 3ER0A 2R92B 3I91A 2PI2E 3TEHB 4A3MG 5D3DA 3F2DA 1GUNA 1SDFA 4JI7L 5DM63 5T1IA 3LX0A 3M85A 5M5YH 1ZEQX 4DA2A 3TP7A 2FLPA 3JC66 2K7VA 1TAEA 3R5FA 4X6AH 2JA7G 2R7ZH 5JUMA 4A3DH 5I2YA 1AUVA 1JJCB 1X56A 4E6IA 4WORA 2R93H 1W6JA 1SMYD 5TSSA 1LTGD 2D9UA 2VQEQ 1S68A 1VF5C 1ZHQA 2CH4W 1Q1EA 4OX9Q 2RGRA 1M0TA 4MZ9A 3P7JA 1EWCA 4C3JG 3I4MB 2FPIB 1PXUA 2B63H 3I72A 1VQFA 2F0SA 2P0AA 4MA0A 5KG6A 4B3TH 3TN2A 5ELEA 4Q5VA 2NZ1D 4X62L 4ETSA 4IZOA 4HCSA 1TVXA 4WFN3 2D0PA 5BMVF 1Q8KA 1RD9D 3RGZA 1DV1A 2NU7B 2EJFC 2Z9HA 1KAAA 2BA1A 3T5KA 3NTHA 2J0TD 4JI0L 4CBVA 2NVXA 1VQGA 1PYBA 4R4IA 4IOAA 1E4FT 1Z2NX 1I7NA 3NSWA 5CBEE 1EYGA 4IR1A 3GTGA 1UEAB 1AH9A 3RJ0A 3G6JB 1E1TA 4ABNA 4NXML 1R4QB 2EXDA 1A8VA 2A69D 3PGZA 5EPLA 5K5PA 1LTLA 2UUAQ 5DNFA 4B3SH 2EYOA 1B6RA 1VKZA 3FPUB 2N3SA 4IUNA 4ZAIA 4ILWA 1HR0Q 4PDBA 5GROA 2GPSA 4A76A 3ITPA 1AN7A 1OXTA 3V96A 2XSCA 2F0WA 2IX3A 5CA0F 1STYA 5L1KA 4JW0A 4JI6Q 4YWKA 4DV3Q 3H0GG 1AZPA 2W57A 1B8AA 3W1BA 1LO5D 2PNRC 3OMCA 2MFIA 4HN7A 2HDLA 2FPPB 1YJWA 4JOIA 3GV3A 3F2UA 1I5FA 4BS9A 3HOVG 2SCUB 4EG0A 4B3RH 3DXJC 2E2DC 3Q6SA 4JOIC 1KJJA 4G4KA 2F0GA 5EWFA 1Y8OB 4JI4Q 1ESRA 2VPSA 3GTQA 1E1OA 2UXBH 3EIVA 1IBML 3TIIA 2CW8A 3RZDB 5C8YF 4O3RA 1O7LA 3T51B 2AGOA 5KFAA 3MAQA 3PW5A 1EQTA 2JA8H 1AW7A 1TT2A 2Y0SE 3GDEA 3PUZA 1XJVA 1I6HH 1S03G 4ZK9B 1WCMB 4LF7H 2NVYB 1PTOH 1MSGA 4U7CA 2VQFH 1JB3A 2W70A 1H9JA 1HUMA 4C3HG 1SNPA 4PQXA 3OSPA 2Y0SB 2EQSA 4Y52H 3U9TA 3A5ZB 4DR2Q 2ZJPA 3NGDA 1M1KC 5KFVA 2F4IA 1KL9A 4ECWA 4L63B 3T5JA 2BOSA 1XNQL 4RMFA 3GV5B 3TREA 4JK1C 4UAIA 1Z2OX 3EJIA 1PH1A 2B2TC 3H3VH 4YCUA 4L5RC 2YU9B 1CSPA 3CHBD 2ES2A 1D2BA 5KT6A 3HB9A 3QZ7A 1FGUA 3S16B 3S15B 2W6MA 5A2QE 2PQAB 3R3OA 4HTHA 4A3FB 1FNUA 3FKIB 3D0FA 3NHHA 5DAUA 4F88A 3GTOH 1HNWL 1AP0A 3MTSA 1H9RA 4NP5A 1R9TB 1EQVA 2R7LA 3RIZA 2ZM6H 3H09A 4HEDA 1SEBD 2F0TA 3G71A 2BA0A 5DLQE 1KJQA 5K36G 4B3SL 1SSOA 1OXXK 4FU0A 4YQWA 1VQOA 1J5EQ 1FVIA 1X3PA 1E4EA 1PA6A 3S2DB 1QNUA 4LFAQ 3M4QA 2MO0A 2ZDHA 4QIWE 2K32A 2X6GA 5JEAG 3AQQA 4M7EA 2VOBA 5BN4A 4NPSA 3GIPA 4ZUIA 3CW2C 3J80c 4IFDG 4QIWB 2HQLA 4LF4Q 3WO0A 1LABA 1LT3D 2UUCQ 3MWYW 1XTDA 1GUGA 3WWVA 4R4TA 2KCMA 4X66Q 4A3IB 4M9UA 1N36L 1GJXA 4DV4H 1BJTA 1IXRA 1TWAH 5GADC 4K5VA 1FGBD 2CCZA 3CD6A 3F8TA 4ECQA 4WJ4A 2JEBI 2R7DA 1EU3A 1X6OA 4O0AA 4ID6A 3MFGA 3LWUA 5FLXE 4C5AA 3RB0A 3UDXA 4LF8Q 1VQCA 3KBXA 4O3OA 3Q22A 5LL6b 4O3NA 2R7ZG 4GZYC 1ESFA 2RDFA 4A3DG 1L1OC 5FD6A 4LF7L 4A3JB 1C7YA 5KFIA 3QG1A 2R93G 2J6SA 5E4WC 3GQBA 1WTOA 3BVGA 1PH5A 4FYDA 2HVQA 4AYBB 4KKSA 2ALYB 3RBEA 4DAMA 3PIPA 3K0XA 2EY6A 3KK7A 3GIDA 3ULLA 2B63G 1KC7A 3V05A 5CGKA 1IL8A 4JI7Q 1HZAA 2VUMH 1HH2P 5JH7F 1OXUA 2EJMA 1DD2A 3QWNA 1Y1VA 3SK5A 5DG7A 1K8GA 4KI0A 1KABA 3LNNA 5A35A 4B3ML 2KVMA 1O7ZA 4BBSH 1LM0A 3MFYA 2SEBD 1QNKA 1QZHA 3S2HH 1G6ZA 3JAMW 5LOVF 4RNMA 3GTMB 4OEMB 3DM1A 2B39A 4ZRZA 3NBHA 2R92A 1CHPD 3RD4A 2L55A 4MAMA 4LFCH 4RHRA 3UDGA 1TWFA 4J9NA 3BVMA 3G7LA 4IUVA 2R87A 4XZ3B 3RTXA 2F1MA 2Z6BA 2F0DA 1F9PA 1U5KA 3I8ZA 3HGBA 1IBLL 4A75A 3M3YH 4HCEA 3TQ1A 2MQHA 4RGOS 4C3IG 5FJ8H 2E2HB 2FK3A 4EEYA 5DG9A 1XPUA 3V4SA 4TV9F 3K59A 1CM9A 1IKMA 2B2VA 1HTLD 1D5XC 4OONA 4LNQA 1JDBB 4K14A 1XPRA 4DR1H 4CGYB 3MZ5A 2WB1E 2IW3A 1NE3A 5IE8A 5E7NA 1K8OA 4DK0A 4RAUC 1G2SA 1TWHB 1EZ6A 5ELBA 1Y1WB 3N40P 4FXKC 4LAAA 4FDBA 2WB1B 4PV1C 1EWIA 4DUYQ 3L4KA 3STBC 2M05A 3ETHA 1PYSB 2K52A 3HOZB 4QWBA 2BDOA 2WP8J 3VR5A 1WYDA 3PO2B 4QGUA 2OXPA 1H95A 2UUBQ 1MI2A 3LMLA 1HNZH 4XT1B 2JA8G 4Q8EA 4KHPL 4LF9L 3MXPA 3MR3A 5HGTA 1RJPA 4LMQD 5G3LF 3DWQA 5HV6A 4XYOA 4HJ9A 2DGYA 1TU2B 1H9SB 5KFFA 3IAYA 5KT7A 1D5ZC 1PFBA 3HOXB 3TQTA 2JXMB 1SCUB 3CKIB 3L2PA 3RUZA 1JMCA 4FF4A 4JCVE 1ASZA 4FF2A 1EIGA 1K8MA 4IPGA 4LFBL 3IFTA 2WV6D 3A8IE 1TS3A 3VA5A 1PMRA 3PR5B 3T4AC 3UI2A 4YY3L 3NUCA 5C4XB 3VPDA 1BQQT 4X65H 1J9OA 5T1GA 1NBWA 4MTDA 3K8AA 2AQ1B 2LKVA 1XPOA 5EBDA 4A3KB 3CF5A 2PW7A 3KF8B 2A73B 4YHHL 5ISRA 4DN4M 2EYHA 2N78A 2A6ED 4C5CA 2GVBA 4N9TA 3QOLA 3SEBA 5KG5A 3EPGA 1W6KA 1CKOA 3I7FA 1EIYB 3GTJA 4OIJA 2FPGB 5FK9C 2FMAA 2JA6A 2ZT9C 2QDLA 4P73A 5LMNH 4YJ2F 3DHQA 4LFCL 1EYCA 5KYLA 3K3PA 3FMCA 1EFWA 5NUCA 1WTXA 3N44B 2VS1A 4K5WA 2UVRA 1DOLA 4LH6A 4B3TQ 3C0FB 2F3IA 4CDDC 1ENAA 2EDGA 4YP3A 1J6QA 2F0NA 4J15A 2O2LD 3ND8A 3BDLA 4Q0FA 1X65A 5M5WH 1R4PB 4ZYSA 4C2MB 1WSCA 2YZMA 4PWQA 3RGXA 1PRTD 3KYHC 3D4RA 3KAJA 1NNXA 3T53B 3ULJA 4J1MA 1HTPA 4GNXA 3CCMA 1K1QA 2W8KA 3MXGA 1M7JA 4IUUA 4F4XA 1KXLA 2J4XA 4ECZA 1QILA 4A93B 2D2CC 4GNXC 4FF1A 1CKNA 3C1EA 1N48A 2JEGA 4X64H 4YR2A 2IP4A 4OIKA 1LTSD 4N8X1 4B3SQ 4EFEA 4UPAA 2ZTCA 4A3GB 3BAAA 4GC7A 3DMUA 5CV9A 3KLRA 3J81E 4JI3H 3AU7A 3GTKH 1WCMH 4PZ8A 1RHPA 3RV3A 2OF1A 2VQEL 2DJGC 3J7YW 1HNZL 4HR7A 5K2MA 2NVXB 5C1PA 1K83A 4DK1A 4OX9L 1S5DD 2UVUA 3RAQA 3FHWA 1DYQA 2M2LA 1WR2A 2FFKB 2ALZA 5M5XH 1PH8A 4IRDA 2NVTH 1S4ZA 3WNZA 3T5LA 1WOCA 1BGWA 1EZ8A 2YTYA 3Q1KA 3UDIA 2WAQA 1YJ9A 1N36Q 5KNCA 4DAPA 4B3RQ 3NWTA 4IAJA 5KFHA 1V1PA 1KNEA 3ND9A 3WOFA 2NB0A 5I6WA 3BABA 2CW0C 2VUMG 2JA7H 3FVQA 1BCPC 1CTMA 2B2UC 3L4JA 4LUZA 2UXBQ 2VXWA 1GXDC 3TRZA 2DWCA 1EY6A 3S15H 2OH2A 2BQ3A 5KYIA 5KEEA 2ZJTA 4A3FH 3FKIH 3VYRA 5M9OA 2K6AA 2K28A 3E0EA 4BBSG 4L5QA 4MN3A 1DV2A 1IW7D 1M4VA 3NEMA 1TA8A 2W7OA 1K8AC 4LF7Q 2DJFC 2VQFQ 1R9TH 3AB9A 3E0JA 3J7A5 4U6PA 2NN6I 1SNOA 3B6YA 3KUPA 4YWMA 1HR0L 3G6VA 1LLRD 4R8UA 1D5MC 1VMCA 3KFUA 1B2TA 2DIKA 4G7ZC 4MHEA 3H6MA 2XRSD 1A63A 4GS3A 4DV3L 3OTOH 3QO2A 4BA2I 3GTPA 3K7AB 5DQIA 3CP0A 2JA5A 5FJ8G 3N6RA 2VNUD 5L37A 1F2LA 3S1NH 4IPDA 4WD3A 5DQGA 2HCIA 3CCQA 3S1MH 2KJXA 1JDEA 2JYOA 2XTIA 4KD3A 2VL6A 5J2UF 2LXJA 4AYBA 4JI4L 1LYLA 3KJPA 1Z9FA 4EX5A 2E2IH 3A74A 3K81C 3I4LA 2ZM6Q 3BYYB 1IKLA 1EY8A 3KJOA 1Q46A 4A3CG 4DLKA 4PG3A 3PCOB 4PMBA 4EGVA 3EPIA 2WFWA 2V4RA 5J22A 1SE2A 3CXCA 2A8VA 2X0SA 4UFZA 3CCJA 4APVA 1DOKA 1L0YB 2B29A 2NWGA 5JEAJ 1V4YA 5IP9H 1A3UA 5M3MB 4I7ZC 5KFBA 4DR2L 4DPGA 4IFDJ 5T14A 1XYIA 2R7FA 1YNJC 4GKKH 1HQMC 1FNWA 3HOVH 1K3RA 3NPPA 2B8GA 4TSSA 4KJNA 1SYBA 2PZWA 4HAEA 2G9HD 4XIGS 2M00A 1OTCA 5KFCA 1D8LA 4N9PA 3GIKA 1V9PA 4JI1H 3SXHA 4X3SA 2IJ0A 1XDNA 2QW7A 5C5LA 1YIJA 3FEWX 3HOUH 3AFPA 5IYDG 1RJRA 1O80A 3KF6A 2L0CA 4IN3A 5BN3A 3R5HA 2XCPA 2H1EA 2E2HA 1G2TA 1G51A 1ZETA 1F9RA 4DV4Q 3OWFA 1HA5A 3J81i 3LWEA 4IUQA 4K0KH 4YIJA 3U4ZA 2FXQA 1TKWB 3OHAA 3MFIA 1TS4A 4ED6A 1A0IA 3FMAA 5F9NA 4Y7NB 3RF2A 2EXZA 3WDNA 5J2TF 2RBMA 1TWHA 2OEOA 1Y1WA 2OQ0A 2QCPX 2WE6A 4XDXA 4RG1A 2WB1A 1DJRD 2YRWA 5DGAA 1ILQA 3EVQA 4LUVA 3KHHA 3K57A 1CZGA 1I50B 1STHA 4MV6A 4YAJB 3S17B 4GLAC 3F2CA 1SRUA 1EY9A 2D5DA 1QZGA 5JJIA 1EUDB 2C35B 4K5XA 3PW0A 3SHLA 5EZYF 2F52A 1WTPA 2NZHA 4DXFA 1HA6A 3OTOL 1L1OB 1ICWA 4J9OA 1UAPA 1UE1A 4KK7A 1RJTA 1OWTA 4O3PA 4OL7A 2Z1CA 3NTKA 1A2TA 1D1KA 2JK8A 2A19A 2RGVA 2YCHA 4MTNA 5I2XA 4R4QA 4YWLA 2CWPA 4X66L 1W2BA 1BBXC 3S1QH 2R8JA 4G57A 3M7GA 1EYZA 1I6UA 2W6PA 1N32H 2PN1A 5EDWA 2AUKA 4J9QA 3U9OA 5L1JA 2OQKA 3KHRA 4LFCQ 5KT5A 5C1OA 3BZKA 1ZYRC 4PZ6A 1NUCA 4ALPA 4BY1B 4LF8L 5KFGA 2EVBA 4YAKB 2BE5C 3KALA 4YR0A 2L5TA 5JEAH 1CFMA 4UDUC 5FO7B 5FO8B 5KNBA 3G8CA 5KFUA 2Z6KA 3HZXA 2BCOA 4POFA 1STNA 2A68C 4IFDH 1LT5D 1GHJA 4IPHA 3RB4A 1WCMG 4JBJA 2IWHA 3TQYA 1RDPD 4JUZA 4GC6A 4YB8B 4J9RA 3CPFA 4GKKL 4BBRH 3NBHB 2I5LX 5KFTA 1XX8A 4GN3B 4H7BA 4DR1Q 2RDHA 3AFQA 2K01A 1V1OA 2MNAA 4EYIB 2OT2A 2ASBA 1TWFB 1EY7A 2KECA 1ET9A 4R4CA 5C5JA 3M4IA 5AFWA 4A3EB 2MJ8A 3E6ZX 4FXDA 4J0MA 2SNSA 4QWAA 1TWCH 3VYUA 2KCNA 1YEZA 1QCBD 1RODA 2KOLA 1GVPA 4QUFA 5D1OB 1GM5A 5C4HA 3JAME 1PFMA 4X3UA 3RNUA 4C2MA 5C3XA 1VQIA 2KSWA 3J81W 1GSOA 1B4OA 4AQYH 5C4JB 4A3FG 3FKIG 1HNZQ 4J9PA 4WJWA 2K5HA 2ZJRA 4EQPA 3I4NB 5KG1A 2R86A 1CK1A 3K5OA 2JEIA 2ZTDA 3HOYH 1B1ZA 1CKMA 1V43A 2EYLA 2PO4A 2X69A 3CQZA 3E9HA 3BDOA 1SXTA 1LT6D 1CE8A 5FPOA 3A7LA 1UNSA 3M4PA 3SK8A 1HHVA 4HJ5A 2Z0SA 4ZKCB 3V4ZA 1EYAA 1Q12A 1QVCA 3CRKC 4K8IA 1RJQA 3IRBA 4KTAA 5KFYA 4X65Q 1XMQH 4RB2C 3D8GA 3PUXA 2G5DA 4NMZA 3PO3H 4ME3A 1DGSA 4LF6H 1E24A 3SE0A 3UE0A 4DUYL 1PV4A 2HHHH 4OO1I 1HUNA 2E76C 2EE1A 5FLXc 3JRWA 3BU2A 4A3IG 3BZCA 1N32L 3TIGA 1FL0A 3TZUA 3GO5A 1PH2A 3T5HA 2UUBL 1TWGB 2WACA 2PMZE 4C3IH 4P2CB 3MA2B 5LMNQ 3OUUA 3OYYA 3CVZA 3ORRA 4A3GH 2LY7A 2WTFA 2PMZB 1KEEA 3R23A 4DV1H 5IP9G 3PF4A 3M4YA 2V5AA 1NR4A 2F0FA 2ID0A 2NVXH 1QJOA 1N8RC 3HRZC 3U58A 4EGQA 3GTJB 2RA4A 3GTGH 1MD2D 5DM73 4O2BF 5G3LD 3G6EA 2JA6B 1Q1BA 1EY0A 2AGQA 3H94A 3HG9A 2J9GA 4RZQA 2F4VH 4A4IA 4DR4H 3IN5A 1D7QA 3HOUG 4ECSA 1PTOC 1K1SA 4V0BA 1JJ2A 4ODGA 1F2ZA 3BYTB 3MEFA 4KY5A 2YW2A 1N33H 1E2ZA 3W3AA 4X3TA 4X64Q 2VY3A 3OHBA 1E2WA 2F0PA 3F1ZA 2RDJA 3S14B 1SE3A 3CC2A 4HMIA 3S9WA 5DQHA 2A74C 1N34H 4GLVB 1CQIB 3I2ZA 2NTTA 5J3BA 5IYCG 4JI3Q 4QL5A 2V9WA 3HXLA 3A7AB 3H3VC 2B2TA 3IL8A 4TKOB 4OWXB 1G291 5C4ZA 2JEFA 3R93A 3DEPA 4GNXB 3K5LA 4DV0H 2FMMA 3R2IA 1P8LA 5KFMA 2PVPA 2A1AA 2VR1A 1SMXA 1BOSA 5DLGA 4B3TL 2AQ2B 2E5LH 3EBEA 1CKNB 3GTQH 3RAXA 4CJ2C 3JAMi 3U50C 4EBDA 2NBFA 5I4DA 3QJYA 1I3QH 5EKKA 2E2JH 4A3MB 1TXYA 3DEOA 5JPNC 2R6FA 3RV4A 3S1RB 5L1IA 2FHTA 1C9OA 4HR7B 1EUCB 4O2AF 2C2EA 1K83B 1XMQL 3GTLH 1TIID 4GKJH 2YTVA 5CA1F 2R8GA 1XXGA 2WAQE 4KLKA 4JBMA 5HY6A 1B7YB 4RH6A 2UXCH 1UE5A 1CHQD 3J7AK 2XGQA 4KKTA 2ASJA 3VYSA 3STBD 1C8CA 1BNZA 2WAQB 1ASYA 4J9MA 3D4DA 3I4OA 4JBWA 3MWEA 4QW9A 1BCPB 3CCRA 4NW2A 5LA6F 1V1PB 1GUOA 5IGGA 1E3PA 1SMYC 5IT9L 2AMCB 4NKLA 3HOZG 5KFLA 3KOJA 4C3JB 3GIQA 5BN5A 1A9XA 2UU9H 2JSOA 1YJNA 1Q86C 1X32A 4FVMA 4F87A 1VBHA 1WD0A 3J7AF 1ICFB 3K5NA 3PIP3 3OTOQ 2YRXA 1RYRA 5JJLA 1SROA 4FO2A 3MVVA 1K0SA 4DV7H 2NVQH 1C3OA 3D6WA 3FPPA 2YYAA 5IGFA 2B2YC 3JSLA 1I50A 4BBRG 4OXPA 4B3RL 3NTIA 4CDFC 3VA7A 4RB3C 4DR6H 4R8UB 1II3A 2EY2A 2DY8A 5CYUA 4CDCC 1KLGD 2OLSA 5IGBA 2UXBL 1HQRD 3UDFA 2F4VL 1EQQA 2BQRA 1L1OA 4CC5A 3NP8A 3M4OB 4DR3H 1IL2A 3GIMA 1FJGH 3GTPB 3C1FA 5EPJA 4A3BH 2JA5B 3UFXB 1O7YA 2QF7A 1N33L 2R6GA 1JWMD 5KRUA 3TS2A 4AYBE 2K1BA 2VQFL 3Q2OA 4TUYF 3GIIA 5BPFA 3KDFA 5KFSA 3NELA 4PNYA 4I50F 1N34L 1ONLA 2CFMA 1E22A 5C44B 3P20A 4H02A 4GKKQ 2F0EA 3C46A 1Z6HA 5H1SE 3OWEB 3H3VI 3H0GB 4O2DA 3HOYG 4UCTA 2FE3A 3OW2A 4ME5A 3K5MA 2ATLA 1QOHA 4KD4A 1STAA 3FDSA 3I3CA 4TVAB 2E5LL 5HGQA 1I4HA 1U4LA 1T3NA 5IWAH 1ULZA 4ED3A 3VR3A 4JYAH 5M3FB 4FXGC 4ZQIA 2V4QA 5JVLA 1PK8A 4EBEA 4K0KQ 4DV2H 1PDQA 2F3VA 4ULLA 3CAMA 2QKIC 2I5MX 1EL0A 2R84A 2XNAC 1SE4A 3DWPA 2Z4IA 3NQIA 3SK6A 3T13A 3K58A 3PO3G 3N6XA 3PW7A 2ZM6L 1SR3A 3V6HA 4PMCA 1Q7YC 1CSQA 1EFID 2L4NA 3G4SA 2SDFA 2XWBB 3RZOB 1X3GA 4R9WA 3J81c 5LHY1 1SFOH 1I4QA 5D1OA 3KF6B 4PZ7A 4QWCA 4XXEA 3E3XA 4KY6A 4BY1H 3HKSA 1UNNC 4MV1A 4LSAA 4DUZH 4LUOA 3KXYT 5LMUH 3K6OA 1S40A 3N52A 1Y1VH 4A3GG 1A2UA 4ECTA 2Q8TA 5IYZF 2QEXA 2N55A 2TSSA 1NJIC 1GSHA 2R8HA 4ECRA 2UVWA 1GUSA 4HNTA 2Q2IA 3OIPA 3R2TA 2LFNA 5KIXA 5KFEA 3PW2A 3BQ2A 1JOOA 3QB3A 1U0LA 1UEBA 2R92H 3MWDA 5FPRA 1XNRH 1C0AA 1H9KA 1JR0D 2YS7A 1PX2A 4YCWA 4A3CH 4EQNA 4DV4L 2AWOA 1IBKH 1RIPA 4DR6L 1N32Q 4DL7A 2EPBA 1JLLB 4DL6A 2Q2HA 1RCVD 1QVGA 1QVFA 1A15A 5JVDF 3BZDB 1HR0W 3HOWB 2WKDA 2I80A 4ED7A 1MKHA 3F2BA 3T1YH 4K8JA 1D6EC 1BBUA 2RF4A 1WTWA 4ZLTF 1VQBA 1WTHA 5C4JH 2NU9B 2IT1A 1VS0A 3BQ1A 3I4MH 4BWSC 3EN2A 1EYDA 5IYDH 4P74A 2YZGA 1TWGA 2W9BA 2N49A 1WTVA 3OSOA 3DM3A 1JOQA 4XYLB 1HZCA 3PIOA 3C2PA 3M9MB 1I4XA 1EUJA 1JB7A 5KG3A 4XTCS 2PMZA 1PH9A 1JQYD 5I47A 4DAVA 3BDCA 3GILA 1S9FA 1KRSA 4CDEC 1MZBA 4L8JA 3SI8A 4RFBA 2FLNA 2QK4A 4JYAL 1ML0D 2HCCA 4IALA 1AEXA 3PSIA 5M5YB 4MTEA 4DV2L 1T9HA 5KX5F 3HKZA 3FDTA 4OWTB 2EOTA 3RUPA 3K0YA 2R7ZB 1PHJA 2F0JA 4A3DB 2HDMA 1HNXH 2IX1A 1LUZA 4JG2A 1LTID 1ZQ7A 4I7HA 1VQ5A 1B04A 4IO9A 3T56B 1YITA 1JE4A 2K5DA 1YNXA 2RCNA 1KJ8A 1GGOA 4H13C 4DUZL 5E3FA 1YNJD 5IGCA 4O4LF 1MGSA 3TINA 5KFPA 2OWOA 4DR1L 1N9WA 1PFSA 5KGUA 1XMQQ 3T1HH 2XCAA 2HGSA 1S97A 3GTJH 2R7KA 2VA3A 2DN8A 1VAJA 4HJAA 4KN4C 3GTKA 3BA9A 3L7ZC 4LF6Q 1AN8A 3CQZB 1DZ1A 2I8CA 5KKNB 3RZDH 2HHHQ 3MFHA 5BPHA 1ET6A 1HFGA 3BG3A 4BWGB 3CCEA 5C0XJ 2NUAB 3J7ZC 5KG7A 1SE8A 4BY7B 4IZ8A 1GLVA 3NXWA 2NVYH 3QIAA 1L2FA 2GPWA 3CMAA 4A3BG 5IT9E 4FS1A 2YL2A 2FLLA 4MA5A 3LP8A 2DNEA 1KJIA 4DV1Q 3E5SA 4QCLA 2DNCA 1SNMA 2KHSA 1JWSD 5KG0A 4I4TF 4O42A 2JA7A 4CKBA 3OIQA 2F0UA 5D65A 3BJUA 2RSOA 2Q2TA 3ETJA 4BXXH 4HNVA 2B2UA 4QUCA 5IP7H 1RF2D 4ZUJA 5LL6X 2YU9H 5HBRB 1IOWA 2M9VA 4H44C 3ICEA 4WBNF 2WINB 5COYA 4X65L 3S16H 2SNMA 2F4VQ 2DPIA 4DR4Q 1IYVA 2ZXRA 2BH2A 3QR8A 5CB4F 4JVZA 2WYOA 4JI8H 1G6PA 1LTRD 4MTKA 5IY0A 2FP4B 4LF5H 2ASDA 3LGJA 1CQJB 3EQLC 1N33Q 4HNUA 1B9NA 1K83H 1DXMA 4KJOA 3M9BA 2WIIB 1QB5D 1N34Q 3H20A 1YHQA 2JA8B 3H15A 1YHBA 5LMNL 5KG2A 1BR9A 2C2DA 3OMGA 4F8MA 1WH2A 2PPBC 2JEAI 4DV0Q 5CC4A 4YR3A 3S2DH 4F7XA 4DV6H 2B3GA 4BY1G 3KLWA 4DV5H 2V4DA 5C5MA 4QB4A 2E5LQ 1I4RA 2FKLA 2A68D 3I56A 1Y1VG 1VQMA 1PH3A 4JV5H 4KN7C 4IRCA 4LJZC 1HRJA 4UCSA 3U4VA 4XX0B 3MEHA 4DL3A 3G48A 3H0GA 2W9CA 2C28A 2EYPA 4DNTB 4A3IH 4IQZA 2V58A 2R92G 3RBDA 2K5NA 4GKJQ 1XMOH 2NYZD 4LK1C 4LF4H 3JAMc 3GTOB 2FINB 2VZAA 3N8DA 2UXCQ 5C0XH 4X64L 1JIHA 2NZOA 1CS0A 2IMWP 2L1BA 2MPMA 4TRDA 1F77A 4V190 4GN5A 4NB3A 4YJ3F 3M4OH 3QOJA 3OPOA 2Q2UA 4UY8C 2RHSB 1Y8NB 2KENA 3OHXC 2JA5H 4JI3L 3HP3A 2JEJA 5IOCA 4A3JH 1U4PA 1NMFA 2UU9Q 4JI5H 5AJ3L 5ELNA 4DXGA 4Q0YA 3GV7B 1LACA 2W6OA 3GV8B 1U4RA 1BCPF 3I12A 1AE3A 1SYXB 2YTXA 4ECVA 3I4MG 1M0WA 1EEFD 3HS0C 4DV7Q 1RYSA 2SOBA 4GOPA 4P71A 1VQDA 1RK6A 4QQBX 1W96A 3I90A 5JOBA 3TZDA 2AQ3B 4RB1A 3M9OB 4DR6Q 4DK6C 4GOPC 1YNNC 2E8GA 3L9AX 3MJFA 2BR0A 3N42B 2VPQA 1WD1A 1GSAA 2YZNA 1SBBB 5FKAC 1PRTC 4BA1I 3AMUA 2OTLA 5M3FH 2XC9A 5IYCH 5DGBA 1S5FD 1TWAB 4DR3Q 3DF7A 1FJGQ 3GTMH 4TQSA 1L0XB 2C22A
chains in the Genus database with same CATH topology
1YBYA 4DAMA 3K0XA 5FLMH 3PIPA 1IBKL 4A3GH 1OXVA 3ULLA 4L5SA 2B63G 1PH6A 1VQNA 5IP9G 1K0RA 4JI7Q 3PF4A 1HNWQ 1VQAA 1HZAA 2VUMH 1HH2P 2ID0A 3PV0A 3RN2A 2NVXH 1OXUA 3S14H 3T1YL 1K8GA 4KI0A 1N8RC 4OWWB 3U58A 5IYBH 3GTGH 4B3ML 4R4OA 1X54A 1SN8A 2E2HH 2KBNA 4BBSH 3G6EA 1LM0A 1NTGA 1Q1BA 1MIUA 4JC0A 1QZHA 2K4KA 3S2HH 1KHIA 1VQJA 2D62A 3GD7A 4A4IA 1D7QA 2PQAA 4DV5L 3HOUG 4MNOA 1JJ2A 4DAYB 5IWAQ 3KDFB 3UDGA 4JYAQ 1M90C 1VQ9A 2NN6G 3MEFA 1S3OA 4X64Q 2OCEA 2VY3A 1TWHH 4P75A 3F1ZA 4DV2Q 1Y1WH 3CC2A 1U5KA 4DNIA 1IBLL 1NMGA 1L0WA 4A75A 3M3YH 4GLVB 2MQHA 3I2ZA 4A3MH 5J3BA 5IYCG 1NY4A 4QL5A 5FJ8H 5GAHC 4JI3Q 3HOZH 3S1RH 1XMOL 1XPUA 4HJ8A 1JT8A 4OWXB 3PO2H 1G291 1Y14B 4GNXB 2ZTEA 4OONA 4LNQA 1P8LA 1XPRA 2A1AA 1SMXA 2WB1E 4KHZA 1NE3A 5IE8A 5E7NA 4B3TL 3EBEA 1CKNB 5EAYA 4DUZQ 1AE2A 3GTQH 3JAMi 5LMUQ 3U50C 3K7UC 2Y0SG 5ELOA 1Z47A 3VDYA 4FDBA 3HOXH 3A5UA 1K9MC 1VQLA 1I3QH 4QJFA 4DR7Q 1EWIA 4DUYQ 1HNXL 2E2JH 1GO3E 4JI5L 1S72A 1TXYA 1EIFA 3FP9A 3STBC 2UUCL 2AKWB 1PYSB 2K52A 2UUAL 1WI5A 4C3JH 3J80i 2WP8J 2ZJQA 4JI1L 1C9OA 1WYDA 4QGUA 1H95A 1XMQL 2UUBQ 3GTLH 2YTVA 4BXXG 5C4XH 4DKAC 2DUDA 5IP7G 1XNRQ 2JA8G 2WAQE 4KLKA 4HIOA 4JBMA 4LF9L 5HY6A 1B7YB 4KHPL 2YYZA 1IBKQ 1UE5A 3RN5A 1UWVA 2HIVA 3PUWA 2IHEA 4HJ9A 4K0KL 1KAWA 2DGYA 4A3KH 2UXDQ 3STBD 1ASYA 4JI6L 5GQOA 3T1HL 1VQ8A 4JBWA 3I4OA 2ATWA 3CCRA 3L2PA 2IHFA 3T1YQ 1E3PA 1P16A 1JMCA 2AMCB 3HOZG 4JCVE 1ASZA 3KOJA 4LFBL 4IPGA 2VW9A 1YJNA 4A3EG 1Q86C 1GKHA 4B3MQ 1A62A 1KIXA 1GD7A 4YY3L 3OTOQ 3D31A 3GTPH 4IJHA 5JJLA 1SROA 4YCVA 1NBWA 1X3EA 3K8AA 2NVQH 1XPOA 3ZJYC 3CF5A 2WAQG 3KF8B 4BBRG 2L15A 4OXPA 4YHHL 4B3RL 2N78A 2K14A 2GVBA 3A0JA 5BR8Q 5C44H 3I4NG 1CKOA 3I7FA 1EIYB 1BVSA 1UE7A 4DR5L 1VQEA 1IBLQ 3H0GH 1W3SA 2UXBL 4GLXA 3DLLA 3UDFA 4HJ7A 1EQQA 2F4VL 2XGTA 4C2MH 4P73A 1L1OA 1HZ9A 1IL2A 4LFCL 3W5OA 4A3BH 1EFWA 1X3FA 3UE1A 1N33L 2R6GA 3TS2A 4AYBE 2VQFL 2VS1A 1Q81C 4A93H 4LW1A 2K5VA 2I0QA 3KDFA 3NELA 4B3TQ 1I94L 1N34L 2F3IA 3CQZH 2CFMA 1E22A 4JI8L 4H02A 1J6QA 1WFQA 4AIMA 1PH4A 4LF5L 4GKKQ 4J15A 3RLOA 5H1SE 5C0XG 1EOVA 3H3VI 1KC8C 2K50A 1X65A 4O2DA 4BY7H 5M5WH 1HNXQ 4IFDI 3HOYG 3ERSX 2EIFA 1YZ6A 5C3EG 1IZ6A 3OW2A 2JA9A 3KYHC 4LWCA 2JA5G 3ULJA 4POGA 4GNXA 4C3HH 3CCMA 4TVAB 3HKZE 4A3JG 3RZOH 2E5LL 5HGQA 1KXLA 3ULPA 2YV5A 4A3LH 1BKBA 4GNXC 4KHPQ 4LF9Q 1MJCA 1KD1C 1CKNA 5C44G 2HIXA 4K0KQ 2K75A 1YHAA 4AYBG 4DV6L 1K73C 4B3SQ 4UPAA 4UP9A 3CAMA 3CPWA 2ZTCA 2I5MX 4QY7A 3CMEA 3T1HQ 3TS0A 4NXNQ 3PO3G 4AH6A 4WJ3M 2ZM6L 3GTKH 1J5EL 4JV5L 1SR3A 1WCMH 2RHQB 4PZ8A 4LFBQ 2LSSA 2VQEL 1Q7YC 1HNZL 1CSQA 1B70B 3G4SA 4JI2L 4LFAL 4OX9L 3FHWA 4YY3Q 1X3GA 3J81c 1EQRA 1SFOH 5M5XH 3KF6B 1PH8A 4PZ7A 5M3FG 2NVTH 3CCUA 3AEVA 2JA6G 4BY1H 5C0XI 2GVAA 1CUKA 3HKSA 3HKZG 1PVOA 1WOCA 2H5XA 2PNHA 4LUOA 4AQYL 2YTYA 4LF4L 2CKZB 1VCIA 3UDIA 1SLJA 1YJ9A 1Y1VH 5AJ3Q 5FLMG 2QGQA 4YHHQ 1JE5A 1S40A 1N36Q 3HOWH 4A3GG 4B3RQ 4P72A 3PUYA 2QEXA 1X55A 1NJIC 2IY5B 2JE6I 2AWNA 2JA7H 2VUMG 2MO1A 2Q2IA 4LUZA 5GAGC 3TRZA 2UXBQ 3S15H 3J81j 5IYBG 1U0LA 1UEBA 2R92H 4A3LG 3K7AH 4A3FH 1C0AA 3FKIH 2KHIA 3E0EA 4BBSG 4YCWA 4A3CH 4L5QA 4DV4L 3NEMA 2AWOA 3CCLA 1KRTA 2AHOB 1K8AC 1RIPA 1E7ZA 4LF7Q 1HJPA 2VQFQ 4DR6L 1N32Q 1R9TH 2Q2HA 1QUQA 4HIMA 1QVGA 1QVFA 3J7A5 2KHJA 1HR0W 2NN6I 3B6YA 4IPCA 4YWMA 1HR0L 2I5HA 1MKHA 3F2BA 1JJGA 4JI8Q 3KFUA 4LF5Q 4LF6L 2Z6KC 1BBUA 2RF4A 3CC7A 1Y1WG 1Q82C 2HHHL 1A63A 1VQBA 2WB1G 4GS3A 4DV3L 3ER0A 5C4JH 4BA2I 2PI2E 3TEHB 4A3MG 2OTJA 3CP0A 2IT1A 5FJ8G 3F2DA 1VS0A 2VNUD 4JI7L 3S1NH 3I4MH 4IPDA 3EN2A 3M85A 5M5YH 3PO2G 3CCQA 5IYDH 4P74A 3S1MH 2N49A 2XTIA 3DM3A 5M3MH 2VL6A 3HOWG 2LXJA 1HZCA 3PF5A 3JC66 4DV1L 3PIOA 4DV6Q 1JB7A 1EUJA 4X6AH 2JA7G 2R7ZH 4XTCS 4JI4L 1PH9A 4DV5Q 4A3DH 1JJCB 1X56A 1LYLA 3KJPA 1Z9FA 4EX5A 2R93H 3RLNA 1IYJB 3A74A 3K81C 2ZM6Q 3HOXG 2E2IH 4JV5Q 1KRSA 5GAEC 4OO1G 2VQEQ 3KJOA 1Q46A 4A3CG 1Q1EA 4PG3A 3PCOB 4OX9Q 4JYAL 2WFWA 4MZ9A 3CXCA 2A8VA 3PSIA 3CCJA 4APVA 1T9HA 4DV2L 2B63H 5JEAJ 2B29A 4DR4L 5IP9H 1VQFA 5C4XG 4DR2L 1XMOQ 4DPGA 4IFDJ 1BBWA 1VQHA 2R7FA 4OWTB 4X62L 1KQSA 2V1CC 1PHJA 1K3RA 1WJJA 3HOVH 2D0PA 4A3KG 3M7NA 2IX1A 1Q8KA 1LUZA 4JG2A 4XIGS 4Y7NH 1OTCA 1VQ5A 1D8LA 2BA1A 4IO9A 3CCVA 4JI0L 1YITA 1V9PA 1VQPA 1VQGA 1PYBA 4R4IA 4IOAA 4UP8A 1YNXA 1YIJA 1HZBA 2RCNA 3HOUH 3AFPA 5IYDG 4DUZL 1EYGA 1AH9A 3KF6A 1E1TA 4GN4B 4NXML 4JI5Q 2EXDA 1A8VA 3PGZA 1G51A 1I50H 4DV4Q 3J81i 1LTLA 4DV0L 2UUAQ 4DR7L 2JQOA 1O7IA 3U4ZA 2FXQA 4JI1Q 4DR1L 1N9WA 2OWOA 2D0OA 1PFSA 3S17H 3K80C 1XMQQ 1V1QA 2N3SA 1PH7A 1A0IA 3GTJH 1HR0Q 5GROA 4HJAA 4A76A 3RR5A 1OXTA 3L7ZC 4LF6Q 2IX0A 2JJQA 4TQUS 2BH8A 2OQ0A 4IOCA 3RZDH 2HHHQ 4RG1A 3CCEA 4JI6Q 4YWKA 4DV3Q 3H0GG 5C0XJ 1VQ4A 3J7ZC 2UXDL 1SE8A 1B8AA 3W1BA 4LUVA 2MFIA 2NVYH 4GKJL 1L2FA 3CMAA 1YJWA 4A3BG 4GLAC 4JOIA 3F2CA 1I5FA 1SRUA 3HOVG 1QZGA 5JJIA 2C35B 4R1JA 2UXCL 3E9IA 4A93G 1VQKA 4DV1Q 3W1GA 2GN5A 2LXKA 2F52A 4JOIC 4GOPB 1VQ7A 4JBKA 2NZHA 4JI4Q 4IJLA 3OTOL 1L1OB 5IT9c 1E1OA 1UE1A 3EIVA 1IBML 3BJUA 2JK8A 2A19A 2Q2TA 4BY7G 4MTNA 4BXXH 4R4QA 4YWLA 2CWPA 4X66L 5IP7H 2Y0SE 1W2BA 2UU9L 3GDEA 2JA8H 3PUZA 3I55A 2YU9H 4PMWA 1XJVA 1I6HH 5BR8L 4DR5Q 2N8NA 3ICEA 2PI2A 4X65L 3S16H 1X9NA 2F4VQ 4DR4Q 4Y52H 2EQSA 4DV7L 3SGIA 3A5ZB 4DR2Q 1YI2A 2OQKA 2BH2A 2ZJPA 4LFCQ 4X62Q 1VQ6A 5IY0A 3BZKA 1M1KC 1G6PA 1KL9A 4PZ6A 4HIDA 3LGJA 4ALPA 2QA4A 1TWFH 4LF8L 1N33Q 1XNQL 4RMFA 3TREA 2KCTA 4A3EH 1K83H 4DK3C 1PH1A 3M9BA 4EQ5A 2HT1A 4JI0Q 1I94Q 1N34Q 2Z6KA 3H3VH 4POFA 4YCUA 1YHQA 5LMNW 4IPHA 3H15A 4L5RC 1CSPA 1WCMG 1YHBA 4JBJA 3TQYA 5LMNL 2ES2A 4DR3L 1YVCA 3PUVA 1FJGL 1FGUA 3CPFA 2JEAI 4NXMQ 4GKKL 4BBRH 1MJEA 3NBHB 2PQAB 2I5LX 4DV0Q 4GN3B 3S2DH 4DR1Q 2B3GA 3AFQA 3D0FA 3L0OA 4BY1G 3KLWA 2MNAA 3GTOH 3I4NH 1HNWL 2ASBA 4R4CA 2E5LQ 3AYHB 3I56A 1Y1VG 1VQMA 1PH3A 1TWCH 1YEZA 1GVPA 3U4VA 2CQOA 1GM5A 4IFDG 3G71A 2BA0A 5DLQE 3G48A 5K36G 4A3IH 4B3SL 1RL2A 3RNUA 1OXXK 1VQIA 1VQOA 2R92G 1J5EQ 1FVIA 1UE6A 2K5NA 4NXNL 4A3FG 4GKJQ 3FKIG 1PA6A 3NENA 5IWAL 1HNZQ 3CC4A 3Q8DA 3JAMc 2K5HA 4LFAQ 3M4QA 2MO0A 4JI2Q 2ZJRA 2VZAA 2UXCQ 4QIWE 4X64L 2NZOA 3RLFA 5JEAG 3AQQA 2ZTDA 3HOYH 1CKMA 1V43A 5C3EH 4GN5A 4NB3A 5JJKA 3M4OH 4NPSA 4AQYQ 3E9HA 3CW2C 3J80c 2Q2UA 2RHSB 4UY8C 2KENA 1IBMQ 2HQLA 2JA5H 4JI3L 4LF4Q 2UUCQ 1XTDA 4A3JH 3M4PA 1NMFA 4R4TA 2KCMA 3WWVA 4X66Q 2UU9Q 4HJ5A 1N36L 1TWGH 2Z0SA 5AJ3L 1QUQB 5ELNA 1Q12A 1IXRA 1QVCA 2CWAA 1TWAH 3IRBA 5GADC 4X65Q 3CD6A 2CCZA 1AE3A 3F8TA 2YTXA 3MXNB 3S1QH 3I4MG 4WJ4A 3PUXA 2JEBI 4DV7Q 2R7DA 1X6OA 3HFZB 4O0AA 5LMUL 4GOPA 4P71A 3PO3H 1VQDA 5M3MG 4QQBX 3UDXA 4ME3A 1DGSA 4LF8Q 1OXSC 1VQCA 1E24A 3UE0A 4L5TA 1XNQQ 4DUYL 4DR6Q 4DK6C 4GOPC 2E8GA 1PV4A 4OO1I 2R7ZG 4A3DG 1L1OC 5FLXc 4UP7A 4LF7L 3BU2A 4A3IG 3BZCA 1C7YA 1N32L 2R93G 1FL0A 3CCSA 3GO5A 1PH2A 4BA1I 2UUBL 2OTLA 2PMZE 5M3FH 4C3IH 3S24A 5IYCH 5LMNQ 1PH5A 2JA6H 4DR3Q 1XNRL 4HIKA 3OYYA 1FJGQ 3GTMH 2ALYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YBY A;  4DAM A;  3K0X A;  5FLM H;  3PIP A;  1IBK L;  4A3G H;  1OXV A;  3ULL A;  4L5S A;  2B63 G;  1PH6 A;  1VQN A;  5IP9 G;  1K0R A;  4JI7 Q;  3PF4 A;  1HNW Q;  1VQA A;  1HZA A;  2VUM H;  1HH2 P;  2ID0 A;  3PV0 A;  3RN2 A;  2NVX H;  1OXU A;  3S14 H;  3T1Y L;  1K8G A;  4KI0 A;  1N8R C;  4OWW B;  3U58 A;  5IYB H;  3GTG H;  4B3M L;  4R4O A;  1X54 A;  1SN8 A;  2E2H H;  2KBN A;  4BBS H;  3G6E A;  1LM0 A;  1NTG A;  1Q1B A;  1MIU A;  4JC0 A;  1QZH A;  2K4K A;  3S2H H;  1KHI A;  1VQJ A;  2D62 A;  3GD7 A;  4A4I A;  1D7Q A;  2PQA A;  4DV5 L;  3HOU G;  4MNO A;  1JJ2 A;  4DAY B;  5IWA Q;  3KDF B;  3UDG A;  4JYA Q;  1M90 C;  1VQ9 A;  2NN6 G;  3MEF A;  1S3O A;  4X64 Q;  2OCE A;  2VY3 A;  1TWH H;  4P75 A;  3F1Z A;  4DV2 Q;  1Y1W H;  3CC2 A;  1U5K A;  4DNI A;  1IBL L;  1NMG A;  1L0W A;  4A75 A;  3M3Y H;  4GLV B;  2MQH A;  3I2Z A;  4A3M H;  5J3B A;  5IYC G;  1NY4 A;  4QL5 A;  5FJ8 H;  5GAH C;  4JI3 Q;  3HOZ H;  3S1R H;  1XMO L;  1XPU A;  4HJ8 A;  1JT8 A;  4OWX B;  3PO2 H;  1G29 1;  1Y14 B;  4GNX B;  2ZTE A;  4OON A;  4LNQ A;  1P8L A;  1XPR A;  2A1A A;  1SMX A;  2WB1 E;  4KHZ A;  1NE3 A;  5IE8 A;  5E7N A;  4B3T L;  3EBE A;  1CKN B;  5EAY A;  4DUZ Q;  1AE2 A;  3GTQ H;  3JAM i;  5LMU Q;  3U50 C;  3K7U C;  2Y0S G;  5ELO A;  1Z47 A;  3VDY A;  4FDB A;  3HOX H;  3A5U A;  1K9M C;  1VQL A;  1I3Q H;  4QJF A;  4DR7 Q;  1EWI A;  4DUY Q;  1HNX L;  2E2J H;  1GO3 E;  4JI5 L;  1S72 A;  1TXY A;  1EIF A;  3FP9 A;  3STB C;  2UUC L;  2AKW B;  1PYS B;  2K52 A;  2UUA L;  1WI5 A;  4C3J H;  3J80 i;  2WP8 J;  2ZJQ A;  4JI1 L;  1C9O A;  1WYD A;  4QGU A;  1H95 A;  1XMQ L;  2UUB Q;  3GTL H;  2YTV A;  4BXX G;  5C4X H;  4DKA C;  2DUD A;  5IP7 G;  1XNR Q;  2JA8 G;  2WAQ E;  4KLK A;  4HIO A;  4JBM A;  4LF9 L;  5HY6 A;  1B7Y B;  4KHP L;  2YYZ A;  1IBK Q;  1UE5 A;  3RN5 A;  1UWV A;  2HIV A;  3PUW A;  2IHE A;  4HJ9 A;  4K0K L;  1KAW A;  2DGY A;  4A3K H;  2UXD Q;  3STB D;  1ASY A;  4JI6 L;  5GQO A;  3T1H L;  1VQ8 A;  4JBW A;  3I4O A;  2ATW A;  3CCR A;  3L2P A;  2IHF A;  3T1Y Q;  1E3P A;  1P16 A;  1JMC A;  2AMC B;  3HOZ G;  4JCV E;  1ASZ A;  3KOJ A;  4LFB L;  4IPG A;  2VW9 A;  1YJN A;  4A3E G;  1Q86 C;  1GKH A;  4B3M Q;  1A62 A;  1KIX A;  1GD7 A;  4YY3 L;  3OTO Q;  3D31 A;  3GTP H;  4IJH A;  5JJL A;  1SRO A;  4YCV A;  1NBW A;  1X3E A;  3K8A A;  2NVQ H;  1XPO A;  3ZJY C;  3CF5 A;  2WAQ G;  3KF8 B;  4BBR G;  2L15 A;  4OXP A;  4YHH L;  4B3R L;  2N78 A;  2K14 A;  2GVB A;  3A0J A;  5BR8 Q;  5C44 H;  3I4N G;  1CKO A;  3I7F A;  1EIY B;  1BVS A;  1UE7 A;  4DR5 L;  1VQE A;  1IBL Q;  3H0G H;  1W3S A;  2UXB L;  4GLX A;  3DLL A;  3UDF A;  4HJ7 A;  1EQQ A;  2F4V L;  2XGT A;  4C2M H;  4P73 A;  1L1O A;  1HZ9 A;  1IL2 A;  4LFC L;  3W5O A;  4A3B H;  1EFW A;  1X3F A;  3UE1 A;  1N33 L;  2R6G A;  3TS2 A;  4AYB E;  2VQF L;  2VS1 A;  1Q81 C;  4A93 H;  4LW1 A;  2K5V A;  2I0Q A;  3KDF A;  3NEL A;  4B3T Q;  1I94 L;  1N34 L;  2F3I A;  3CQZ H;  2CFM A;  1E22 A;  4JI8 L;  4H02 A;  1J6Q A;  1WFQ A;  4AIM A;  1PH4 A;  4LF5 L;  4GKK Q;  4J15 A;  3RLO A;  5H1S E;  5C0X G;  1EOV A;  3H3V I;  1KC8 C;  2K50 A;  1X65 A;  4O2D A;  4BY7 H;  5M5W H;  1HNX Q;  4IFD I;  3HOY G;  3ERS X;  2EIF A;  1YZ6 A;  5C3E G;  1IZ6 A;  3OW2 A;  2JA9 A;  3KYH C;  4LWC A;  2JA5 G;  3ULJ A;  4POG A;  4GNX A;  4C3H H;  3CCM A;  4TVA B;  3HKZ E;  4A3J G;  3RZO H;  2E5L L;  5HGQ A;  1KXL A;  3ULP A;  2YV5 A;  4A3L H;  1BKB A;  4GNX C;  4KHP Q;  4LF9 Q;  1MJC A;  1KD1 C;  1CKN A;  5C44 G;  2HIX A;  4K0K Q;  2K75 A;  1YHA A;  4AYB G;  4DV6 L;  1K73 C;  4B3S Q;  4UPA A;  4UP9 A;  3CAM A;  3CPW A;  2ZTC A;  2I5M X;  4QY7 A;  3CME A;  3T1H Q;  3TS0 A;  4NXN Q;  3PO3 G;  4AH6 A;  4WJ3 M;  2ZM6 L;  3GTK H;  1J5E L;  4JV5 L;  1SR3 A;  1WCM H;  2RHQ B;  4PZ8 A;  4LFB Q;  2LSS A;  2VQE L;  1Q7Y C;  1HNZ L;  1CSQ A;  1B70 B;  3G4S A;  4JI2 L;  4LFA L;  4OX9 L;  3FHW A;  4YY3 Q;  1X3G A;  3J81 c;  1EQR A;  1SFO H;  5M5X H;  3KF6 B;  1PH8 A;  4PZ7 A;  5M3F G;  2NVT H;  3CCU A;  3AEV A;  2JA6 G;  4BY1 H;  5C0X I;  2GVA A;  1CUK A;  3HKS A;  3HKZ G;  1PVO A;  1WOC A;  2H5X A;  2PNH A;  4LUO A;  4AQY L;  2YTY A;  4LF4 L;  2CKZ B;  1VCI A;  3UDI A;  1SLJ A;  1YJ9 A;  1Y1V H;  5AJ3 Q;  5FLM G;  2QGQ A;  4YHH Q;  1JE5 A;  1S40 A;  1N36 Q;  3HOW H;  4A3G G;  4B3R Q;  4P72 A;  3PUY A;  2QEX A;  1X55 A;  1NJI C;  2IY5 B;  2JE6 I;  2AWN A;  2JA7 H;  2VUM G;  2MO1 A;  2Q2I A;  4LUZ A;  5GAG C;  3TRZ A;  2UXB Q;  3S15 H;  3J81 j;  5IYB G;  1U0L A;  1UEB A;  2R92 H;  4A3L G;  3K7A H;  4A3F H;  1C0A A;  3FKI H;  2KHI A;  3E0E A;  4BBS G;  4YCW A;  4A3C H;  4L5Q A;  4DV4 L;  3NEM A;  2AWO A;  3CCL A;  1KRT A;  2AHO B;  1K8A C;  1RIP A;  1E7Z A;  4LF7 Q;  1HJP A;  2VQF Q;  4DR6 L;  1N32 Q;  1R9T H;  2Q2H A;  1QUQ A;  4HIM A;  1QVG A;  1QVF A;  3J7A 5;  2KHJ A;  1HR0 W;  2NN6 I;  3B6Y A;  4IPC A;  4YWM A;  1HR0 L;  2I5H A;  1MKH A;  3F2B A;  1JJG A;  4JI8 Q;  3KFU A;  4LF5 Q;  4LF6 L;  2Z6K C;  1BBU A;  2RF4 A;  3CC7 A;  1Y1W G;  1Q82 C;  2HHH L;  1A63 A;  1VQB A;  2WB1 G;  4GS3 A;  4DV3 L;  3ER0 A;  5C4J H;  4BA2 I;  2PI2 E;  3TEH B;  4A3M G;  2OTJ A;  3CP0 A;  2IT1 A;  5FJ8 G;  3F2D A;  1VS0 A;  2VNU D;  4JI7 L;  3S1N H;  3I4M H;  4IPD A;  3EN2 A;  3M85 A;  5M5Y H;  3PO2 G;  3CCQ A;  5IYD H;  4P74 A;  3S1M H;  2N49 A;  2XTI A;  3DM3 A;  5M3M H;  2VL6 A;  3HOW G;  2LXJ A;  1HZC A;  3PF5 A;  3JC6 6;  4DV1 L;  3PIO A;  4DV6 Q;  1JB7 A;  1EUJ A;  4X6A H;  2JA7 G;  2R7Z H;  4XTC S;  4JI4 L;  1PH9 A;  4DV5 Q;  4A3D H;  1JJC B;  1X56 A;  1LYL A;  3KJP A;  1Z9F A;  4EX5 A;  2R93 H;  3RLN A;  1IYJ B;  3A74 A;  3K81 C;  2ZM6 Q;  3HOX G;  2E2I H;  4JV5 Q;  1KRS A;  5GAE C;  4OO1 G;  2VQE Q;  3KJO A;  1Q46 A;  4A3C G;  1Q1E A;  4PG3 A;  3PCO B;  4OX9 Q;  4JYA L;  2WFW A;  4MZ9 A;  3CXC A;  2A8V A;  3PSI A;  3CCJ A;  4APV A;  1T9H A;  4DV2 L;  2B63 H;  5JEA J;  2B29 A;  4DR4 L;  5IP9 H;  1VQF A;  5C4X G;  4DR2 L;  1XMO Q;  4DPG A;  4IFD J;  1BBW A;  1VQH A;  2R7F A;  4OWT B;  4X62 L;  1KQS A;  2V1C C;  1PHJ A;  1K3R A;  1WJJ A;  3HOV H;  2D0P A;  4A3K G;  3M7N A;  2IX1 A;  1Q8K A;  1LUZ A;  4JG2 A;  4XIG S;  4Y7N H;  1OTC A;  1VQ5 A;  1D8L A;  2BA1 A;  4IO9 A;  3CCV A;  4JI0 L;  1YIT A;  1V9P A;  1VQP A;  1VQG A;  1PYB A;  4R4I A;  4IOA A;  4UP8 A;  1YNX A;  1YIJ A;  1HZB A;  2RCN A;  3HOU H;  3AFP A;  5IYD G;  4DUZ L;  1EYG A;  1AH9 A;  3KF6 A;  1E1T A;  4GN4 B;  4NXM L;  4JI5 Q;  2EXD A;  1A8V A;  3PGZ A;  1G51 A;  1I50 H;  4DV4 Q;  3J81 i;  1LTL A;  4DV0 L;  2UUA Q;  4DR7 L;  2JQO A;  1O7I A;  3U4Z A;  2FXQ A;  4JI1 Q;  4DR1 L;  1N9W A;  2OWO A;  2D0O A;  1PFS A;  3S17 H;  3K80 C;  1XMQ Q;  1V1Q A;  2N3S A;  1PH7 A;  1A0I A;  3GTJ H;  1HR0 Q;  5GRO A;  4HJA A;  4A76 A;  3RR5 A;  1OXT A;  3L7Z C;  4LF6 Q;  2IX0 A;  2JJQ A;  4TQU S;  2BH8 A;  2OQ0 A;  4IOC A;  3RZD H;  2HHH Q;  4RG1 A;  3CCE A;  4JI6 Q;  4YWK A;  4DV3 Q;  3H0G G;  5C0X J;  1VQ4 A;  3J7Z C;  2UXD L;  1SE8 A;  1B8A A;  3W1B A;  4LUV A;  2MFI A;  2NVY H;  4GKJ L;  1L2F A;  3CMA A;  1YJW A;  4A3B G;  4GLA C;  4JOI A;  3F2C A;  1I5F A;  1SRU A;  3HOV G;  1QZG A;  5JJI A;  2C35 B;  4R1J A;  2UXC L;  3E9I A;  4A93 G;  1VQK A;  4DV1 Q;  3W1G A;  2GN5 A;  2LXK A;  2F52 A;  4JOI C;  4GOP B;  1VQ7 A;  4JBK A;  2NZH A;  4JI4 Q;  4IJL A;  3OTO L;  1L1O B;  5IT9 c;  1E1O A;  1UE1 A;  3EIV A;  1IBM L;  3BJU A;  2JK8 A;  2A19 A;  2Q2T A;  4BY7 G;  4MTN A;  4BXX H;  4R4Q A;  4YWL A;  2CWP A;  4X66 L;  5IP7 H;  2Y0S E;  1W2B A;  2UU9 L;  3GDE A;  2JA8 H;  3PUZ A;  3I55 A;  2YU9 H;  4PMW A;  1XJV A;  1I6H H;  5BR8 L;  4DR5 Q;  2N8N A;  3ICE A;  2PI2 A;  4X65 L;  3S16 H;  1X9N A;  2F4V Q;  4DR4 Q;  4Y52 H;  2EQS A;  4DV7 L;  3SGI A;  3A5Z B;  4DR2 Q;  1YI2 A;  2OQK A;  2BH2 A;  2ZJP A;  4LFC Q;  4X62 Q;  1VQ6 A;  5IY0 A;  3BZK A;  1M1K C;  1G6P A;  1KL9 A;  4PZ6 A;  4HID A;  3LGJ A;  4ALP A;  2QA4 A;  1TWF H;  4LF8 L;  1N33 Q;  1XNQ L;  4RMF A;  3TRE A;  2KCT A;  4A3E H;  1K83 H;  4DK3 C;  1PH1 A;  3M9B A;  4EQ5 A;  2HT1 A;  4JI0 Q;  1I94 Q;  1N34 Q;  2Z6K A;  3H3V H;  4POF A;  4YCU A;  1YHQ A;  5LMN W;  4IPH A;  3H15 A;  4L5R C;  1CSP A;  1WCM G;  1YHB A;  4JBJ A;  3TQY A;  5LMN L;  2ES2 A;  4DR3 L;  1YVC A;  3PUV A;  1FJG L;  1FGU A;  3CPF A;  2JEA I;  4NXM Q;  4GKK L;  4BBR H;  1MJE A;  3NBH B;  2PQA B;  2I5L X;  4DV0 Q;  4GN3 B;  3S2D H;  4DR1 Q;  2B3G A;  3AFQ A;  3D0F A;  3L0O A;  4BY1 G;  3KLW A;  2MNA A;  3GTO H;  3I4N H;  1HNW L;  2ASB A;  4R4C A;  2E5L Q;  3AYH B;  3I56 A;  1Y1V G;  1VQM A;  1PH3 A;  1TWC H;  1YEZ A;  1GVP A;  3U4V A;  2CQO A;  1GM5 A;  4IFD G;  3G71 A;  2BA0 A;  5DLQ E;  3G48 A;  5K36 G;  4A3I H;  4B3S L;  1RL2 A;  3RNU A;  1OXX K;  1VQI A;  1VQO A;  2R92 G;  1J5E Q;  1FVI A;  1UE6 A;  2K5N A;  4NXN L;  4A3F G;  4GKJ Q;  3FKI G;  1PA6 A;  3NEN A;  5IWA L;  1HNZ Q;  3CC4 A;  3Q8D A;  3JAM c;  2K5H A;  4LFA Q;  3M4Q A;  2MO0 A;  4JI2 Q;  2ZJR A;  2VZA A;  2UXC Q;  4QIW E;  4X64 L;  2NZO A;  3RLF A;  5JEA G;  3AQQ A;  2ZTD A;  3HOY H;  1CKM A;  1V43 A;  5C3E H;  4GN5 A;  4NB3 A;  5JJK A;  3M4O H;  4NPS A;  4AQY Q;  3E9H A;  3CW2 C;  3J80 c;  2Q2U A;  2RHS B;  4UY8 C;  2KEN A;  1IBM Q;  2HQL A;  2JA5 H;  4JI3 L;  4LF4 Q;  2UUC Q;  1XTD A;  4A3J H;  3M4P A;  1NMF A;  4R4T A;  2KCM A;  3WWV A;  4X66 Q;  2UU9 Q;  4HJ5 A;  1N36 L;  1TWG H;  2Z0S A;  5AJ3 L;  1QUQ B;  5ELN A;  1Q12 A;  1IXR A;  1QVC A;  2CWA A;  1TWA H;  3IRB A;  5GAD C;  4X65 Q;  3CD6 A;  2CCZ A;  1AE3 A;  3F8T A;  2YTX A;  3MXN B;  3S1Q H;  3I4M G;  4WJ4 A;  3PUX A;  2JEB I;  4DV7 Q;  2R7D A;  1X6O A;  3HFZ B;  4O0A A;  5LMU L;  4GOP A;  4P71 A;  3PO3 H;  1VQD A;  5M3M G;  4QQB X;  3UDX A;  4ME3 A;  1DGS A;  4LF8 Q;  1OXS C;  1VQC A;  1E24 A;  3UE0 A;  4L5T A;  1XNQ Q;  4DUY L;  4DR6 Q;  4DK6 C;  4GOP C;  2E8G A;  1PV4 A;  4OO1 I;  2R7Z G;  4A3D G;  1L1O C;  5FLX c;  4UP7 A;  4LF7 L;  3BU2 A;  4A3I G;  3BZC A;  1C7Y A;  1N32 L;  2R93 G;  1FL0 A;  3CCS A;  3GO5 A;  1PH2 A;  4BA1 I;  2UUB L;  2OTL A;  2PMZ E;  5M3F H;  4C3I H;  3S24 A;  5IYC H;  5LMN Q;  1PH5 A;  2JA6 H;  4DR3 Q;  1XNR L;  4HIK A;  3OYY A;  1FJG Q;  3GTM H;  2ALY B; 
#chains in the Genus database with same CATH topology
 3K3V A;  4RGT A;  3JZI A;  1OXV A;  2I46 A;  5A2Q L;  2FMC A;  2GA4 B;  1PH6 A;  1DCZ A;  4O3Q A;  2I07 B;  2PW5 A;  1HXY D;  1VQA A;  5CV6 A;  2BQU A;  1S0O A;  1JX4 A;  2FK1 A;  2IL8 A;  4QWD A;  5IGE A;  1ILP A;  3OUZ A;  5D3I B;  4LMY A;  2QIL A;  4EQO A;  1B9M A;  4HQ6 A;  4DL4 A;  3A8J E;  2E2H H;  2KBN A;  1NTG A;  4DR5 H;  1MIU A;  2K4K A;  1KHI A;  1VQJ A;  3N43 B;  4DV5 L;  4MNO A;  2PYK A;  3RB3 A;  4IUR A;  4K2K A;  4JPB W;  5IWA Q;  4X62 H;  3KDF B;  2A5H A;  4JYA Q;  1GUT A;  1VQ9 A;  2NN6 G;  4FS2 A;  1EY4 A;  1TS5 A;  2VUM B;  1S3O A;  1PZK D;  2OCE A;  1TWH H;  2HD3 A;  4P75 A;  2B2W C;  3GP7 A;  4DV2 Q;  5C3W A;  4F4W A;  3H91 A;  1Y1W H;  1UC9 A;  2R3Z A;  4JI0 H;  1EWH A;  2C2R A;  1I94 H;  1SYG A;  1PLF A;  3MHB A;  1NY4 A;  4BBS B;  5JPM C;  3HOZ H;  4X3K A;  1T5E A;  1XMO L;  2QYZ A;  4UHV A;  3TBI B;  3PO2 H;  1JKJ B;  4NXM H;  2K5W A;  4CKE A;  3NQT A;  2CZG A;  1IW7 C;  4KKU A;  2ZTE A;  4XYQ A;  2EZV A;  3SE7 A;  4J8Q A;  3HBL A;  3EA6 A;  5JVH 3;  4DFA A;  1PFN A;  4HMJ A;  5GON F;  4RGN A;  1BXR A;  4J9S A;  4DUZ Q;  3VR6 A;  1M8A A;  5LMU Q;  2WDT A;  2Y0S G;  5ELO A;  3MC0 B;  5FLX L;  3VDY A;  4OO1 H;  1TS2 A;  2CHB D;  3HOX H;  4EGJ A;  4R8N A;  1BXT A;  4JI5 L;  1S72 A;  2R7Z A;  3FP9 A;  1EIF A;  2ICI A;  3PZP A;  2CQA A;  1WI5 A;  3VR2 A;  5DG8 A;  2K33 A;  4JI1 L;  5EWE A;  2R93 A;  1TY0 A;  2MGS A;  4BXX G;  5C4X H;  5IP7 G;  2DUD A;  1XNR Q;  3ORQ A;  1CQV A;  3MXN A;  4KY7 A;  4HIO A;  4TQR A;  4JI2 H;  4RA8 A;  4RB0 A;  1Y69 U;  2RKS A;  3PR4 A;  2YYZ A;  1E0B A;  3RN5 A;  1IBK Q;  1UWV A;  2HIV A;  3PUW A;  2IHE A;  4K0K L;  5KFD A;  5L1L A;  4A3K H;  2B63 A;  1HPC A;  1NAP A;  3D3R A;  3IFD A;  2K04 A;  1IBM H;  5IT9 W;  3T1Y Q;  1P16 A;  2MUY A;  3Q8Q B;  2NU8 B;  4G7H C;  4S3S A;  2VW9 A;  1PYW D;  2P5Z X;  5ELC A;  2RVL A;  3Q23 A;  1A62 A;  3X3M A;  1GD7 A;  1KIX A;  5KFJ A;  4UCV A;  5KT3 A;  1T36 A;  4HSP A;  3A56 A;  1N56 A;  3F8N A;  4YCV A;  4G3I A;  1X3E A;  3PN1 A;  1JCK B;  2WKC A;  1SAP A;  2Q8R E;  3TP5 A;  1BDO A;  2WAQ G;  4YBZ B;  5CBA E;  1SYF A;  2UVV A;  3A0J A;  1XNQ H;  1V51 A;  4FF3 A;  1T5X D;  5EKL A;  3DWA A;  4DR5 L;  2QDB A;  1W3S A;  4GLX A;  4HJ7 A;  1I6V C;  2XGT A;  4C2M H;  2X6L A;  5C3E B;  1HZ9 A;  4RU9 A;  1SYD A;  3I73 A;  1B3Q A;  4RGM A;  2QEJ C;  4IRK A;  2RDI A;  4DL5 A;  2G9D A;  3W2D A;  3BJY A;  3UQ8 A;  4EVO A;  4NLG A;  5ELD A;  3UE1 A;  2W6N A;  4Q43 A;  4M1U B;  4DAY A;  4CC6 A;  1Q81 C;  4A93 H;  4LW1 A;  2I0Q A;  4XQN A;  2O03 A;  4F50 A;  2W9B B;  1HNW H;  2F0L A;  1I94 L;  3SVM A;  3CQZ H;  3M9N B;  1IHZ A;  2A6H C;  1PH4 A;  5IOD A;  4AIM A;  4ZHQ F;  4HYK A;  3RLO A;  5C0X G;  1AZQ A;  1KC8 C;  4BY7 H;  4IFD I;  1HNX Q;  2CH4 A;  4RUA A;  3ERS X;  1YZ6 A;  1IZ6 A;  2TMP A;  4LWC A;  2JA5 G;  3HEJ A;  1K3B C;  2EY1 A;  2XRQ D;  3HKZ E;  4A3J G;  1M6V A;  5E4X A;  2C5C A;  1EZ1 A;  3ULP A;  2YV5 A;  1SEI A;  2L9H A;  1BKB A;  4ZKB B;  5C44 G;  3HKZ B;  4AYB G;  1VDZ A;  1YHA A;  4FP5 D;  1K73 C;  3SDZ A;  3CPW A;  3T1H Q;  4QY7 A;  3TS0 A;  2VB2 X;  5F9L A;  1DIK A;  4AH6 A;  5M5W B;  5J1Z A;  1KDB A;  1QE6 A;  3J80 L;  2F0Q A;  2JN4 A;  2LSS A;  1N36 H;  2Z4H A;  4JI2 L;  3JSN A;  3H40 A;  3VR4 A;  5EWG A;  5JAV A;  1EQR A;  1FYC A;  3DUZ A;  3TP6 A;  3Q0A A;  3AEV A;  5M3F G;  1BF4 A;  2AU0 A;  1CUK A;  3U9S A;  4AQY L;  2R8K A;  4ECU A;  4FM9 A;  5AJ3 Q;  2QGQ A;  1JE5 A;  1TQO A;  1PZJ D;  2F0O A;  2HUG A;  3KAK A;  4I7A A;  4P72 A;  1I3Q A;  4DR7 H;  3GTO A;  1X55 A;  1KDC A;  2JE6 I;  3GTK B;  2W6Q A;  5GAG C;  2VUG A;  2L11 A;  2RQX A;  4O4I F;  3GTL A;  4RHS A;  2NUC A;  1Q90 A;  3Q8S B;  4ED2 A;  4A3L G;  3K7A H;  2KHI A;  2R7M A;  5M5X B;  2NVT B;  3TP8 A;  3ERO A;  2XWJ B;  3CCL A;  1KRT A;  3E5N A;  1CA6 A;  4DNR B;  1E7Z A;  3VPC A;  5D14 A;  3MR6 A;  2UXD H;  4QWE A;  3NWS A;  3GV6 A;  2KHJ A;  4ME6 A;  3SR1 A;  1STB A;  1JC7 A;  2PBZ A;  1NR2 A;  4JI8 Q;  4LF5 Q;  2PCF B;  5C6A A;  1ENC A;  1OO9 B;  2H4O A;  4LF6 L;  2JA7 B;  4B3M H;  1IOV A;  3CC7 A;  1Y1W G;  1Q82 C;  4MV8 A;  2HHH L;  2KCC A;  1JWU D;  2WB1 G;  1S5C D;  1SNQ A;  4UCU A;  2V59 A;  2OTJ A;  1J8I A;  3MWM A;  3WOE A;  1RK5 A;  1V8Q A;  2R8I A;  4B9X A;  2KUM A;  3PO2 G;  3HOW G;  5M3M H;  3EYY A;  3TME A;  1TWA A;  5BR8 H;  1U9R A;  3PF5 A;  2FK2 A;  4EEQ A;  4DV1 L;  2B2Y A;  4DV6 Q;  4KMU C;  1SND A;  5H80 A;  3EFX D;  1IBL H;  4DV5 Q;  2XN9 C;  1PTO F;  1STG A;  3RLN A;  1IYJ B;  4C1N K;  4OO1 G;  3J81 L;  3HOX G;  4JV5 Q;  5GAE C;  2F0H A;  5I9O A;  1MSH A;  4Q8F A;  4Y8V B;  4XQQ A;  1CT1 D;  4ZQ3 A;  3S1N B;  1S0N A;  2RDG A;  2AGP A;  3J7A V;  5JQW A;  3S1M B;  2XD4 A;  4DR4 L;  4C5B A;  1XTC D;  5C4X G;  3JRX A;  1I4G A;  5E1F A;  1XMO Q;  5D8D A;  1BBW A;  1VQH A;  1KQS A;  2V1C C;  4J9L A;  2A69 C;  1WJJ A;  1F2Y A;  3NK9 A;  4A3K G;  4CJ0 B;  3M7N A;  4Y7N H;  2E2I B;  1E4G T;  1XWE A;  3CCV A;  2VUM A;  2EY5 A;  2EYF A;  1VQP A;  4XQJ A;  4UP8 A;  2AUJ D;  5CV4 A;  4O4H F;  3H4D A;  1HZB A;  3MR2 A;  2K05 A;  5LYJ F;  1GYF A;  4C1N I;  4IHJ F;  2W9C B;  2IA6 A;  4GN4 B;  4KHP H;  4LF9 H;  4IUT A;  4JI5 Q;  1KBL A;  1I50 H;  4DV0 L;  4NDX A;  4DR7 L;  2JQO A;  1O7I A;  1UC8 A;  5DEH A;  4JI1 Q;  3S17 H;  1ENF A;  2D0O A;  4XYM B;  4RNO A;  3K80 C;  3G6X A;  1V1Q A;  3HOV B;  4QF4 A;  1PH7 A;  4NXN H;  1C4Q A;  3RR5 A;  4ECY A;  4LFB H;  1F9S A;  2IX0 A;  4DU9 A;  2JJQ A;  4TQU S;  1EOT A;  1T94 A;  2I87 A;  1RKN A;  1Z7T A;  2BH8 A;  1HCZ A;  4IOC A;  1Q8I A;  4YY3 H;  4ED0 A;  3HOU B;  1VQ4 A;  5FD5 A;  2UXD L;  1SFO A;  2MHV A;  3FRP B;  3O13 A;  2W8L A;  4GKJ L;  4L6T B;  4C3H B;  4YHH H;  1BNC A;  4R1J A;  3KLS X;  2UXC L;  3E9I A;  4A93 G;  1VQK A;  4O3S A;  3W1G A;  3K5I A;  2GN5 A;  2LXK A;  4GOP B;  1VQ7 A;  4JBK A;  5HUR A;  4IJL A;  5IT9 c;  1CA5 A;  5KT4 A;  1PRT B;  2K03 A;  1A6X A;  2K5Q A;  5COR A;  4BY7 G;  2L12 A;  2UU9 L;  2R82 A;  1I7L A;  2ZXP A;  3I55 A;  1VF7 A;  1AUX A;  4PMW A;  1E2V A;  1S0M A;  5BR8 L;  4DR5 Q;  1JXL A;  2N8N A;  2R61 A;  2PI2 A;  3PIO 3;  2CVR A;  4F4Z A;  1X9N A;  2C9O A;  4N8F A;  5ELF A;  2HVS A;  4DV7 L;  5CMD A;  1O75 A;  2BDN A;  3SGI A;  1YI2 A;  2NTS A;  1A3V A;  3URY A;  4X62 Q;  1VQ6 A;  2XGP A;  2O5J C;  3MR5 A;  4HID A;  2F3W A;  2QA4 A;  1PZI D;  1TWF H;  2RCF A;  3OSN A;  1B44 D;  2KCT A;  4A3E H;  4DK3 C;  4RNN A;  2LMC B;  2CW0 D;  1JOR A;  2C00 A;  4EQ5 A;  4XT3 B;  2HT1 A;  1BCP D;  4JI0 Q;  5IGD A;  1I94 Q;  3Q24 A;  2MCT A;  4MV4 A;  4RUC A;  3S1Q B;  2B2V C;  5LMN W;  1QWY A;  2W6Z A;  4DR3 L;  1YVC A;  3PUV A;  5CAE B;  1FJG L;  4G7O C;  1K28 A;  4J9K A;  4CJ1 B;  3OW7 A;  4FBT A;  4IUP A;  4ZOL F;  4NXM Q;  1F2M A;  1MJE A;  2J7Z A;  2Q8I B;  2GLT A;  4H0L C;  2YS6 A;  3Q8R B;  5KFZ A;  2N88 A;  3L0O A;  3I4N H;  1SNC A;  3X3N A;  1SJE D;  5KFQ A;  3AYH B;  1S5B D;  2E75 C;  1WTR A;  1IYU A;  2VB3 X;  4UCR A;  2VQE H;  4OX9 H;  2CQO A;  4K2L A;  1C30 A;  4HSV A;  4I55 F;  1RL2 A;  1KNA A;  5JJZ A;  1EHI A;  4BBR B;  1UE6 A;  4NXN L;  3ERQ A;  4DF7 A;  3NEN A;  5IWA L;  3CC4 A;  3Q8D A;  4Q44 A;  4JI2 Q;  3J80 E;  1GUW A;  1KLU D;  2JP1 A;  3A54 A;  2PZT A;  3RLF A;  5KFO A;  1SYC A;  1HFN A;  2F0M A;  1B6S A;  4B9W A;  3QFF A;  5JJK A;  5C3E H;  1TWC B;  4IWX A;  2F0I A;  3RB6 A;  4AQY Q;  5L9X A;  1IBM Q;  1RTN A;  5CV8 A;  3NBI A;  3P1H A;  3TDQ A;  2R93 B;  3KBG A;  1TWG H;  1FD7 D;  1G8Z D;  1QUQ B;  3OOC A;  2UUA H;  2CWA A;  1CI3 M;  4OHJ A;  4DGZ A;  5J39 A;  3MXN B;  3D4W A;  2W7P A;  4O1N A;  1HR0 H;  1SJH D;  3H4B A;  3HFZ B;  5LMU L;  2B63 B;  2KED A;  5M3M G;  3HOY B;  1OXS C;  3QZ8 A;  2NN6 H;  4L5T A;  1XNQ Q;  4JI6 H;  4DV3 H;  1B3A A;  4UP7 A;  3ZYY X;  4ZCK A;  1MHW C;  3CCS A;  4RAY A;  4KV6 A;  4RZR A;  4DL2 A;  1WCM A;  1JIC A;  3S24 A;  2JA6 H;  2NU6 B;  2NVY A;  3SK4 A;  1EY5 A;  1XNR L;  4HIK A;  4JV1 A;  4E4T A;  2Y0S A;  5I9P A;  5KFK A;  2F03 A;  1YBY A;  5FLM H;  5A2Q W;  1IBK L;  3BQ0 A;  4L5S A;  1LTT D;  1U4M A;  1YNN D;  1VQN A;  3PO3 B;  1K0R A;  4JI4 H;  1HNW Q;  3P75 A;  3BG5 A;  3PV0 A;  3RN2 A;  1FR3 A;  1L2Z A;  2DLN A;  5IIF A;  3S14 H;  3T1Y L;  1BUV T;  1GHK A;  4OWW B;  1BO0 A;  1F9Q A;  2XCL A;  5IYB H;  4R8I A;  2W9A A;  2DPJ A;  4R4O A;  2YU9 A;  1X54 A;  1SN8 A;  3PVX A;  4C3I B;  2IPK D;  3I70 A;  4JV2 A;  4JC0 A;  4EYH B;  2AQ4 A;  1STE A;  3JAM L;  4KHV A;  2D62 A;  4RKB A;  1FKA H;  3GD7 A;  5EBC A;  1CQF A;  3A55 A;  2PQA A;  2ENB A;  4DR2 H;  3FKI A;  4DAY B;  4JV0 A;  5KFX A;  5LL6 S;  3CRL C;  2VQD A;  3MXU A;  1M90 C;  2CQY A;  2B8F A;  1R9T A;  2IBK A;  4MV7 A;  2O5I C;  4DNI A;  2F0K A;  4U68 A;  1W93 A;  1NMG A;  1L0W A;  2ZDQ A;  4IR9 A;  3GTG B;  4LSX A;  4A3M H;  1O78 A;  5GAH C;  3L3O C;  3S1R H;  4I65 A;  4HJ8 A;  1JT8 A;  1ZHS A;  1Y14 B;  4MIU A;  4L1K A;  5KFN A;  1LV9 A;  4CHT B;  2HQE A;  2EYJ A;  1B53 A;  4Q45 A;  4IWY A;  1ZXT A;  4R7R A;  2FJ2 A;  4QW8 A;  4KHZ A;  1I6H B;  1KJ9 A;  1S10 A;  3PW4 A;  5EAY A;  1PTO B;  4MV3 A;  1AE2 A;  5FLX W;  3K7U C;  1ZYR D;  1Z47 A;  1C48 A;  3A5U A;  1K9M C;  1GOZ A;  5CV5 A;  1VQL A;  2HJW A;  4QJF A;  4DR7 Q;  4QIW A;  2BE5 D;  1HNX L;  1GO3 E;  4ZI7 F;  2AKW B;  2UUA L;  4C3J H;  3J80 i;  4TV8 F;  2ZJQ A;  3ONA B;  1DON A;  3VMM A;  2E2I A;  4APM A;  2CW7 A;  1J5E H;  2LS0 1;  1B33 N;  3D6C A;  4DKA C;  3BA8 A;  1CZW A;  4LFA H;  1I4P A;  4LH7 A;  4ECX A;  3BVZ A;  5EPK A;  2UXD Q;  1Y8P B;  1KAW A;  3GTQ B;  3R5X A;  4JI6 L;  3N41 B;  5GQO A;  3T1H L;  1VQ8 A;  1I3Q B;  4RKL A;  2ATW A;  2E2J B;  2UUC H;  2IHF A;  4RWS C;  1EU4 A;  4ED8 A;  1S5E D;  1D1I A;  2KEE A;  2A6E C;  3KLS A;  4X66 H;  1AFP A;  4A3E G;  4B3M Q;  1GKH A;  1B50 A;  4EBC A;  3GTL B;  4FBU A;  2FB9 A;  3D31 A;  3GTP H;  5D1P A;  4IJH A;  5FOB B;  4A2B A;  1X3Q A;  2O4X A;  2ZXO A;  3KHG A;  3ZJY C;  2VA2 A;  2F0V A;  2L15 A;  4LF8 H;  3PQI A;  4QMG A;  2K14 A;  5BR8 Q;  1JOK A;  5C44 H;  4CKC A;  3PMF A;  4K6D A;  3I4N G;  1BVS A;  3T16 A;  5KFR A;  1UE7 A;  4FNF A;  1VQE A;  1IBL Q;  1SYE A;  1DOM A;  3H0G H;  3LWB A;  3KHL A;  3DLL A;  3R8B A;  5EOY A;  1DM0 B;  5F2D A;  4F4Y A;  5LP6 F;  3GTM A;  2XIW A;  1RTO A;  3W5O A;  1WVL A;  3GQC A;  1X3F A;  2NVQ B;  1TY2 A;  2ICE C;  2K5V A;  5KT2 A;  4JI7 H;  2ZDG A;  2ASL A;  2KA7 A;  1LTB D;  3RFC A;  2Z8L A;  4JI8 L;  3RMH A;  1WFQ A;  4LF5 L;  1WTQ A;  3GLK A;  3G6Y A;  3V6J A;  3GIJ A;  1EOV A;  1KDA A;  4EFB A;  2K50 A;  2RSN A;  5DLF A;  3Q8P B;  3V6K A;  2EIF A;  5C3E G;  3CU7 A;  1FNV A;  2JA9 A;  1MBY A;  1EEI D;  1E4E B;  4POG A;  4A3B B;  4C3H H;  3RZO H;  4K6L A;  1ZKO A;  4A3L H;  2W71 A;  2A6H D;  4KHP Q;  4LF9 Q;  1MJC A;  5KFW A;  1KD1 C;  5FO9 B;  2XVS A;  5CR3 A;  3VYT A;  5JVG 3;  2DZD A;  2HIX A;  2K75 A;  4DV6 L;  1NSN S;  3C3L A;  4UP9 A;  3CME A;  4A2A A;  4NXN Q;  3V2T A;  1VMP A;  1EIH A;  2FJZ A;  1H9M A;  1LT4 D;  2B2W A;  1A3T A;  4WJ3 M;  1J5E L;  4JV5 L;  3J80 W;  2RHQ B;  4LFB Q;  4U67 3;  1B70 B;  4LFA L;  1QG7 A;  5EKI A;  4YY3 Q;  3CCU A;  4C56 C;  2MP1 A;  5EQ0 A;  2JA6 G;  5C0X I;  1PTO D;  2GVA A;  1G91 A;  3HKZ G;  1PVO A;  2DY7 A;  3A8K E;  2PNH A;  2H5X A;  5EJW A;  3TSS A;  5KND A;  3S2H B;  4LF4 L;  1H9S A;  1VCI A;  2CKZ B;  1SLJ A;  2UUC L;  2HVR A;  5FLM G;  4YHH Q;  3HOW H;  3KTM A;  3PUY A;  4DUY H;  2R7N A;  5LXT F;  4J6H A;  4ED1 A;  1Z2P X;  3IKJ A;  2IY5 B;  5EGT A;  4B08 A;  2AWN A;  3VPB A;  4OGQ C;  2PZU A;  2MO1 A;  1NCV A;  2KQ3 A;  5K36 H;  2J6U A;  4MV9 A;  2EYM A;  2UUB H;  3BS1 A;  2PQE A;  3WO1 A;  1TWC A;  3J81 j;  5IYB G;  1VBG A;  3M3Y B;  4OEL B;  1TR5 A;  5I6Y A;  1SFO B;  3IG0 A;  1KTK A;  2AHO B;  5CV7 A;  1HJP A;  4UCO A;  2E74 C;  3KF8 A;  1PRT F;  1QUQ A;  4WRD A;  4RCO A;  4HIM A;  1Y1V B;  4M8A A;  1Q3L A;  3NE5 B;  5KG4 A;  4IPC A;  4RCN A;  2XIG A;  2I5H A;  2J6T A;  2R85 A;  2EJG C;  1JJG A;  1UUP A;  4Z9C B;  4RAZ A;  2Z6K C;  3K5H A;  1LTA D;  3ER0 A;  2R92 B;  3I91 A;  2PI2 E;  3TEH B;  4A3M G;  5D3D A;  3F2D A;  1GUN A;  1SDF A;  4JI7 L;  5DM6 3;  5T1I A;  3LX0 A;  3M85 A;  5M5Y H;  1ZEQ X;  4DA2 A;  3TP7 A;  2FLP A;  3JC6 6;  2K7V A;  1TAE A;  3R5F A;  4X6A H;  2JA7 G;  2R7Z H;  5JUM A;  4A3D H;  5I2Y A;  1AUV A;  1JJC B;  1X56 A;  4E6I A;  4WOR A;  2R93 H;  1W6J A;  1SMY D;  5TSS A;  1LTG D;  2D9U A;  2VQE Q;  1S68 A;  1VF5 C;  1ZHQ A;  2CH4 W;  1Q1E A;  4OX9 Q;  2RGR A;  1M0T A;  4MZ9 A;  3P7J A;  1EWC A;  4C3J G;  3I4M B;  2FPI B;  1PXU A;  2B63 H;  3I72 A;  1VQF A;  2F0S A;  2P0A A;  4MA0 A;  5KG6 A;  4B3T H;  3TN2 A;  5ELE A;  4Q5V A;  2NZ1 D;  4X62 L;  4ETS A;  4IZO A;  4HCS A;  1TVX A;  4WFN 3;  2D0P A;  5BMV F;  1Q8K A;  1RD9 D;  3RGZ A;  1DV1 A;  2NU7 B;  2EJF C;  2Z9H A;  1KAA A;  2BA1 A;  3T5K A;  3NTH A;  2J0T D;  4JI0 L;  4CBV A;  2NVX A;  1VQG A;  1PYB A;  4R4I A;  4IOA A;  1E4F T;  1Z2N X;  1I7N A;  3NSW A;  5CBE E;  1EYG A;  4IR1 A;  3GTG A;  1UEA B;  1AH9 A;  3RJ0 A;  3G6J B;  1E1T A;  4ABN A;  4NXM L;  1R4Q B;  2EXD A;  1A8V A;  2A69 D;  3PGZ A;  5EPL A;  5K5P A;  1LTL A;  2UUA Q;  5DNF A;  4B3S H;  2EYO A;  1B6R A;  1VKZ A;  3FPU B;  2N3S A;  4IUN A;  4ZAI A;  4ILW A;  1HR0 Q;  4PDB A;  5GRO A;  2GPS A;  4A76 A;  3ITP A;  1AN7 A;  1OXT A;  3V96 A;  2XSC A;  2F0W A;  2IX3 A;  5CA0 F;  1STY A;  5L1K A;  4JW0 A;  4JI6 Q;  4YWK A;  4DV3 Q;  3H0G G;  1AZP A;  2W57 A;  1B8A A;  3W1B A;  1LO5 D;  2PNR C;  3OMC A;  2MFI A;  4HN7 A;  2HDL A;  2FPP B;  1YJW A;  4JOI A;  3GV3 A;  3F2U A;  1I5F A;  4BS9 A;  3HOV G;  2SCU B;  4EG0 A;  4B3R H;  3DXJ C;  2E2D C;  3Q6S A;  4JOI C;  1KJJ A;  4G4K A;  2F0G A;  5EWF A;  1Y8O B;  4JI4 Q;  1ESR A;  2VPS A;  3GTQ A;  1E1O A;  2UXB H;  3EIV A;  1IBM L;  3TII A;  2CW8 A;  3RZD B;  5C8Y F;  4O3R A;  1O7L A;  3T51 B;  2AGO A;  5KFA A;  3MAQ A;  3PW5 A;  1EQT A;  2JA8 H;  1AW7 A;  1TT2 A;  2Y0S E;  3GDE A;  3PUZ A;  1XJV A;  1I6H H;  1S03 G;  4ZK9 B;  1WCM B;  4LF7 H;  2NVY B;  1PTO H;  1MSG A;  4U7C A;  2VQF H;  1JB3 A;  2W70 A;  1H9J A;  1HUM A;  4C3H G;  1SNP A;  4PQX A;  3OSP A;  2Y0S B;  2EQS A;  4Y52 H;  3U9T A;  3A5Z B;  4DR2 Q;  2ZJP A;  3NGD A;  1M1K C;  5KFV A;  2F4I A;  1KL9 A;  4ECW A;  4L63 B;  3T5J A;  2BOS A;  1XNQ L;  4RMF A;  3GV5 B;  3TRE A;  4JK1 C;  4UAI A;  1Z2O X;  3EJI A;  1PH1 A;  2B2T C;  3H3V H;  4YCU A;  4L5R C;  2YU9 B;  1CSP A;  3CHB D;  2ES2 A;  1D2B A;  5KT6 A;  3HB9 A;  3QZ7 A;  1FGU A;  3S16 B;  3S15 B;  2W6M A;  5A2Q E;  2PQA B;  3R3O A;  4HTH A;  4A3F B;  1FNU A;  3FKI B;  3D0F A;  3NHH A;  5DAU A;  4F88 A;  3GTO H;  1HNW L;  1AP0 A;  3MTS A;  1H9R A;  4NP5 A;  1R9T B;  1EQV A;  2R7L A;  3RIZ A;  2ZM6 H;  3H09 A;  4HED A;  1SEB D;  2F0T A;  3G71 A;  2BA0 A;  5DLQ E;  1KJQ A;  5K36 G;  4B3S L;  1SSO A;  1OXX K;  4FU0 A;  4YQW A;  1VQO A;  1J5E Q;  1FVI A;  1X3P A;  1E4E A;  1PA6 A;  3S2D B;  1QNU A;  4LFA Q;  3M4Q A;  2MO0 A;  2ZDH A;  4QIW E;  2K32 A;  2X6G A;  5JEA G;  3AQQ A;  4M7E A;  2VOB A;  5BN4 A;  4NPS A;  3GIP A;  4ZUI A;  3CW2 C;  3J80 c;  4IFD G;  4QIW B;  2HQL A;  4LF4 Q;  3WO0 A;  1LAB A;  1LT3 D;  2UUC Q;  3MWY W;  1XTD A;  1GUG A;  3WWV A;  4R4T A;  2KCM A;  4X66 Q;  4A3I B;  4M9U A;  1N36 L;  1GJX A;  4DV4 H;  1BJT A;  1IXR A;  1TWA H;  5GAD C;  4K5V A;  1FGB D;  2CCZ A;  3CD6 A;  3F8T A;  4ECQ A;  4WJ4 A;  2JEB I;  2R7D A;  1EU3 A;  1X6O A;  4O0A A;  4ID6 A;  3MFG A;  3LWU A;  5FLX E;  4C5A A;  3RB0 A;  3UDX A;  4LF8 Q;  1VQC A;  3KBX A;  4O3O A;  3Q22 A;  5LL6 b;  4O3N A;  2R7Z G;  4GZY C;  1ESF A;  2RDF A;  4A3D G;  1L1O C;  5FD6 A;  4LF7 L;  4A3J B;  1C7Y A;  5KFI A;  3QG1 A;  2R93 G;  2J6S A;  5E4W C;  3GQB A;  1WTO A;  3BVG A;  1PH5 A;  4FYD A;  2HVQ A;  4AYB B;  4KKS A;  2ALY B;  3RBE A;  4DAM A;  3PIP A;  3K0X A;  2EY6 A;  3KK7 A;  3GID A;  3ULL A;  2B63 G;  1KC7 A;  3V05 A;  5CGK A;  1IL8 A;  4JI7 Q;  1HZA A;  2VUM H;  1HH2 P;  5JH7 F;  1OXU A;  2EJM A;  1DD2 A;  3QWN A;  1Y1V A;  3SK5 A;  5DG7 A;  1K8G A;  4KI0 A;  1KAB A;  3LNN A;  5A35 A;  4B3M L;  2KVM A;  1O7Z A;  4BBS H;  1LM0 A;  3MFY A;  2SEB D;  1QNK A;  1QZH A;  3S2H H;  1G6Z A;  3JAM W;  5LOV F;  4RNM A;  3GTM B;  4OEM B;  3DM1 A;  2B39 A;  4ZRZ A;  3NBH A;  2R92 A;  1CHP D;  3RD4 A;  2L55 A;  4MAM A;  4LFC H;  4RHR A;  3UDG A;  1TWF A;  4J9N A;  3BVM A;  3G7L A;  4IUV A;  2R87 A;  4XZ3 B;  3RTX A;  2F1M A;  2Z6B A;  2F0D A;  1F9P A;  1U5K A;  3I8Z A;  3HGB A;  1IBL L;  4A75 A;  3M3Y H;  4HCE A;  3TQ1 A;  2MQH A;  4RGO S;  4C3I G;  5FJ8 H;  2E2H B;  2FK3 A;  4EEY A;  5DG9 A;  1XPU A;  3V4S A;  4TV9 F;  3K59 A;  1CM9 A;  1IKM A;  2B2V A;  1HTL D;  1D5X C;  4OON A;  4LNQ A;  1JDB B;  4K14 A;  1XPR A;  4DR1 H;  4CGY B;  3MZ5 A;  2WB1 E;  2IW3 A;  1NE3 A;  5IE8 A;  5E7N A;  1K8O A;  4DK0 A;  4RAU C;  1G2S A;  1TWH B;  1EZ6 A;  5ELB A;  1Y1W B;  3N40 P;  4FXK C;  4LAA A;  4FDB A;  2WB1 B;  4PV1 C;  1EWI A;  4DUY Q;  3L4K A;  3STB C;  2M05 A;  3ETH A;  1PYS B;  2K52 A;  3HOZ B;  4QWB A;  2BDO A;  2WP8 J;  3VR5 A;  1WYD A;  3PO2 B;  4QGU A;  2OXP A;  1H95 A;  2UUB Q;  1MI2 A;  3LML A;  1HNZ H;  4XT1 B;  2JA8 G;  4Q8E A;  4KHP L;  4LF9 L;  3MXP A;  3MR3 A;  5HGT A;  1RJP A;  4LMQ D;  5G3L F;  3DWQ A;  5HV6 A;  4XYO A;  4HJ9 A;  2DGY A;  1TU2 B;  1H9S B;  5KFF A;  3IAY A;  5KT7 A;  1D5Z C;  1PFB A;  3HOX B;  3TQT A;  2JXM B;  1SCU B;  3CKI B;  3L2P A;  3RUZ A;  1JMC A;  4FF4 A;  4JCV E;  1ASZ A;  4FF2 A;  1EIG A;  1K8M A;  4IPG A;  4LFB L;  3IFT A;  2WV6 D;  3A8I E;  1TS3 A;  3VA5 A;  1PMR A;  3PR5 B;  3T4A C;  3UI2 A;  4YY3 L;  3NUC A;  5C4X B;  3VPD A;  1BQQ T;  4X65 H;  1J9O A;  5T1G A;  1NBW A;  4MTD A;  3K8A A;  2AQ1 B;  2LKV A;  1XPO A;  5EBD A;  4A3K B;  3CF5 A;  2PW7 A;  3KF8 B;  2A73 B;  4YHH L;  5ISR A;  4DN4 M;  2EYH A;  2N78 A;  2A6E D;  4C5C A;  2GVB A;  4N9T A;  3QOL A;  3SEB A;  5KG5 A;  3EPG A;  1W6K A;  1CKO A;  3I7F A;  1EIY B;  3GTJ A;  4OIJ A;  2FPG B;  5FK9 C;  2FMA A;  2JA6 A;  2ZT9 C;  2QDL A;  4P73 A;  5LMN H;  4YJ2 F;  3DHQ A;  4LFC L;  1EYC A;  5KYL A;  3K3P A;  3FMC A;  1EFW A;  5NUC A;  1WTX A;  3N44 B;  2VS1 A;  4K5W A;  2UVR A;  1DOL A;  4LH6 A;  4B3T Q;  3C0F B;  2F3I A;  4CDD C;  1ENA A;  2EDG A;  4YP3 A;  1J6Q A;  2F0N A;  4J15 A;  2O2L D;  3ND8 A;  3BDL A;  4Q0F A;  1X65 A;  5M5W H;  1R4P B;  4ZYS A;  4C2M B;  1WSC A;  2YZM A;  4PWQ A;  3RGX A;  1PRT D;  3KYH C;  3D4R A;  3KAJ A;  1NNX A;  3T53 B;  3ULJ A;  4J1M A;  1HTP A;  4GNX A;  3CCM A;  1K1Q A;  2W8K A;  3MXG A;  1M7J A;  4IUU A;  4F4X A;  1KXL A;  2J4X A;  4ECZ A;  1QIL A;  4A93 B;  2D2C C;  4GNX C;  4FF1 A;  1CKN A;  3C1E A;  1N48 A;  2JEG A;  4X64 H;  4YR2 A;  2IP4 A;  4OIK A;  1LTS D;  4N8X 1;  4B3S Q;  4EFE A;  4UPA A;  2ZTC A;  4A3G B;  3BAA A;  4GC7 A;  3DMU A;  5CV9 A;  3KLR A;  3J81 E;  4JI3 H;  3AU7 A;  3GTK H;  1WCM H;  4PZ8 A;  1RHP A;  3RV3 A;  2OF1 A;  2VQE L;  2DJG C;  3J7Y W;  1HNZ L;  4HR7 A;  5K2M A;  2NVX B;  5C1P A;  1K83 A;  4DK1 A;  4OX9 L;  1S5D D;  2UVU A;  3RAQ A;  3FHW A;  1DYQ A;  2M2L A;  1WR2 A;  2FFK B;  2ALZ A;  5M5X H;  1PH8 A;  4IRD A;  2NVT H;  1S4Z A;  3WNZ A;  3T5L A;  1WOC A;  1BGW A;  1EZ8 A;  2YTY A;  3Q1K A;  3UDI A;  2WAQ A;  1YJ9 A;  1N36 Q;  5KNC A;  4DAP A;  4B3R Q;  3NWT A;  4IAJ A;  5KFH A;  1V1P A;  1KNE A;  3ND9 A;  3WOF A;  2NB0 A;  5I6W A;  3BAB A;  2CW0 C;  2VUM G;  2JA7 H;  3FVQ A;  1BCP C;  1CTM A;  2B2U C;  3L4J A;  4LUZ A;  2UXB Q;  2VXW A;  1GXD C;  3TRZ A;  2DWC A;  1EY6 A;  3S15 H;  2OH2 A;  2BQ3 A;  5KYI A;  5KEE A;  2ZJT A;  4A3F H;  3FKI H;  3VYR A;  5M9O A;  2K6A A;  2K28 A;  3E0E A;  4BBS G;  4L5Q A;  4MN3 A;  1DV2 A;  1IW7 D;  1M4V A;  3NEM A;  1TA8 A;  2W7O A;  1K8A C;  4LF7 Q;  2DJF C;  2VQF Q;  1R9T H;  3AB9 A;  3E0J A;  3J7A 5;  4U6P A;  2NN6 I;  1SNO A;  3B6Y A;  3KUP A;  4YWM A;  1HR0 L;  3G6V A;  1LLR D;  4R8U A;  1D5M C;  1VMC A;  3KFU A;  1B2T A;  2DIK A;  4G7Z C;  4MHE A;  3H6M A;  2XRS D;  1A63 A;  4GS3 A;  4DV3 L;  3OTO H;  3QO2 A;  4BA2 I;  3GTP A;  3K7A B;  5DQI A;  3CP0 A;  2JA5 A;  5FJ8 G;  3N6R A;  2VNU D;  5L37 A;  1F2L A;  3S1N H;  4IPD A;  4WD3 A;  5DQG A;  2HCI A;  3CCQ A;  3S1M H;  2KJX A;  1JDE A;  2JYO A;  2XTI A;  4KD3 A;  2VL6 A;  5J2U F;  2LXJ A;  4AYB A;  4JI4 L;  1LYL A;  3KJP A;  1Z9F A;  4EX5 A;  2E2I H;  3A74 A;  3K81 C;  3I4L A;  2ZM6 Q;  3BYY B;  1IKL A;  1EY8 A;  3KJO A;  1Q46 A;  4A3C G;  4DLK A;  4PG3 A;  3PCO B;  4PMB A;  4EGV A;  3EPI A;  2WFW A;  2V4R A;  5J22 A;  1SE2 A;  3CXC A;  2A8V A;  2X0S A;  4UFZ A;  3CCJ A;  4APV A;  1DOK A;  1L0Y B;  2B29 A;  2NWG A;  5JEA J;  1V4Y A;  5IP9 H;  1A3U A;  5M3M B;  4I7Z C;  5KFB A;  4DR2 L;  4DPG A;  4IFD J;  5T14 A;  1XYI A;  2R7F A;  1YNJ C;  4GKK H;  1HQM C;  1FNW A;  3HOV H;  1K3R A;  3NPP A;  2B8G A;  4TSS A;  4KJN A;  1SYB A;  2PZW A;  4HAE A;  2G9H D;  4XIG S;  2M00 A;  1OTC A;  5KFC A;  1D8L A;  4N9P A;  3GIK A;  1V9P A;  4JI1 H;  3SXH A;  4X3S A;  2IJ0 A;  1XDN A;  2QW7 A;  5C5L A;  1YIJ A;  3FEW X;  3HOU H;  3AFP A;  5IYD G;  1RJR A;  1O80 A;  3KF6 A;  2L0C A;  4IN3 A;  5BN3 A;  3R5H A;  2XCP A;  2H1E A;  2E2H A;  1G2T A;  1G51 A;  1ZET A;  1F9R A;  4DV4 Q;  3OWF A;  1HA5 A;  3J81 i;  3LWE A;  4IUQ A;  4K0K H;  4YIJ A;  3U4Z A;  2FXQ A;  1TKW B;  3OHA A;  3MFI A;  1TS4 A;  4ED6 A;  1A0I A;  3FMA A;  5F9N A;  4Y7N B;  3RF2 A;  2EXZ A;  3WDN A;  5J2T F;  2RBM A;  1TWH A;  2OEO A;  1Y1W A;  2OQ0 A;  2QCP X;  2WE6 A;  4XDX A;  4RG1 A;  2WB1 A;  1DJR D;  2YRW A;  5DGA A;  1ILQ A;  3EVQ A;  4LUV A;  3KHH A;  3K57 A;  1CZG A;  1I50 B;  1STH A;  4MV6 A;  4YAJ B;  3S17 B;  4GLA C;  3F2C A;  1SRU A;  1EY9 A;  2D5D A;  1QZG A;  5JJI A;  1EUD B;  2C35 B;  4K5X A;  3PW0 A;  3SHL A;  5EZY F;  2F52 A;  1WTP A;  2NZH A;  4DXF A;  1HA6 A;  3OTO L;  1L1O B;  1ICW A;  4J9O A;  1UAP A;  1UE1 A;  4KK7 A;  1RJT A;  1OWT A;  4O3P A;  4OL7 A;  2Z1C A;  3NTK A;  1A2T A;  1D1K A;  2JK8 A;  2A19 A;  2RGV A;  2YCH A;  4MTN A;  5I2X A;  4R4Q A;  4YWL A;  2CWP A;  4X66 L;  1W2B A;  1BBX C;  3S1Q H;  2R8J A;  4G57 A;  3M7G A;  1EYZ A;  1I6U A;  2W6P A;  1N32 H;  2PN1 A;  5EDW A;  2AUK A;  4J9Q A;  3U9O A;  5L1J A;  2OQK A;  3KHR A;  4LFC Q;  5KT5 A;  5C1O A;  3BZK A;  1ZYR C;  4PZ6 A;  1NUC A;  4ALP A;  4BY1 B;  4LF8 L;  5KFG A;  2EVB A;  4YAK B;  2BE5 C;  3KAL A;  4YR0 A;  2L5T A;  5JEA H;  1CFM A;  4UDU C;  5FO7 B;  5FO8 B;  5KNB A;  3G8C A;  5KFU A;  2Z6K A;  3HZX A;  2BCO A;  4POF A;  1STN A;  2A68 C;  4IFD H;  1LT5 D;  1GHJ A;  4IPH A;  3RB4 A;  1WCM G;  4JBJ A;  2IWH A;  3TQY A;  1RDP D;  4JUZ A;  4GC6 A;  4YB8 B;  4J9R A;  3CPF A;  4GKK L;  4BBR H;  3NBH B;  2I5L X;  5KFT A;  1XX8 A;  4GN3 B;  4H7B A;  4DR1 Q;  2RDH A;  3AFQ A;  2K01 A;  1V1O A;  2MNA A;  4EYI B;  2OT2 A;  2ASB A;  1TWF B;  1EY7 A;  2KEC A;  1ET9 A;  4R4C A;  5C5J A;  3M4I A;  5AFW A;  4A3E B;  2MJ8 A;  3E6Z X;  4FXD A;  4J0M A;  2SNS A;  4QWA A;  1TWC H;  3VYU A;  2KCN A;  1YEZ A;  1QCB D;  1ROD A;  2KOL A;  1GVP A;  4QUF A;  5D1O B;  1GM5 A;  5C4H A;  3JAM E;  1PFM A;  4X3U A;  3RNU A;  4C2M A;  5C3X A;  1VQI A;  2KSW A;  3J81 W;  1GSO A;  1B4O A;  4AQY H;  5C4J B;  4A3F G;  3FKI G;  1HNZ Q;  4J9P A;  4WJW A;  2K5H A;  2ZJR A;  4EQP A;  3I4N B;  5KG1 A;  2R86 A;  1CK1 A;  3K5O A;  2JEI A;  2ZTD A;  3HOY H;  1B1Z A;  1CKM A;  1V43 A;  2EYL A;  2PO4 A;  2X69 A;  3CQZ A;  3E9H A;  3BDO A;  1SXT A;  1LT6 D;  1CE8 A;  5FPO A;  3A7L A;  1UNS A;  3M4P A;  3SK8 A;  1HHV A;  4HJ5 A;  2Z0S A;  4ZKC B;  3V4Z A;  1EYA A;  1Q12 A;  1QVC A;  3CRK C;  4K8I A;  1RJQ A;  3IRB A;  4KTA A;  5KFY A;  4X65 Q;  1XMQ H;  4RB2 C;  3D8G A;  3PUX A;  2G5D A;  4NMZ A;  3PO3 H;  4ME3 A;  1DGS A;  4LF6 H;  1E24 A;  3SE0 A;  3UE0 A;  4DUY L;  1PV4 A;  2HHH H;  4OO1 I;  1HUN A;  2E76 C;  2EE1 A;  5FLX c;  3JRW A;  3BU2 A;  4A3I G;  3BZC A;  1N32 L;  3TIG A;  1FL0 A;  3TZU A;  3GO5 A;  1PH2 A;  3T5H A;  2UUB L;  1TWG B;  2WAC A;  2PMZ E;  4C3I H;  4P2C B;  3MA2 B;  5LMN Q;  3OUU A;  3OYY A;  3CVZ A;  3ORR A;  4A3G H;  2LY7 A;  2WTF A;  2PMZ B;  1KEE A;  3R23 A;  4DV1 H;  5IP9 G;  3PF4 A;  3M4Y A;  2V5A A;  1NR4 A;  2F0F A;  2ID0 A;  2NVX H;  1QJO A;  1N8R C;  3HRZ C;  3U58 A;  4EGQ A;  3GTJ B;  2RA4 A;  3GTG H;  1MD2 D;  5DM7 3;  4O2B F;  5G3L D;  3G6E A;  2JA6 B;  1Q1B A;  1EY0 A;  2AGQ A;  3H94 A;  3HG9 A;  2J9G A;  4RZQ A;  2F4V H;  4A4I A;  4DR4 H;  3IN5 A;  1D7Q A;  3HOU G;  4ECS A;  1PTO C;  1K1S A;  4V0B A;  1JJ2 A;  4ODG A;  1F2Z A;  3BYT B;  3MEF A;  4KY5 A;  2YW2 A;  1N33 H;  1E2Z A;  3W3A A;  4X3T A;  4X64 Q;  2VY3 A;  3OHB A;  1E2W A;  2F0P A;  3F1Z A;  2RDJ A;  3S14 B;  1SE3 A;  3CC2 A;  4HMI A;  3S9W A;  5DQH A;  2A74 C;  1N34 H;  4GLV B;  1CQI B;  3I2Z A;  2NTT A;  5J3B A;  5IYC G;  4JI3 Q;  4QL5 A;  2V9W A;  3HXL A;  3A7A B;  3H3V C;  2B2T A;  3IL8 A;  4TKO B;  4OWX B;  1G29 1;  5C4Z A;  2JEF A;  3R93 A;  3DEP A;  4GNX B;  3K5L A;  4DV0 H;  2FMM A;  3R2I A;  1P8L A;  5KFM A;  2PVP A;  2A1A A;  2VR1 A;  1SMX A;  1BOS A;  5DLG A;  4B3T L;  2AQ2 B;  2E5L H;  3EBE A;  1CKN B;  3GTQ H;  3RAX A;  4CJ2 C;  3JAM i;  3U50 C;  4EBD A;  2NBF A;  5I4D A;  3QJY A;  1I3Q H;  5EKK A;  2E2J H;  4A3M B;  1TXY A;  3DEO A;  5JPN C;  2R6F A;  3RV4 A;  3S1R B;  5L1I A;  2FHT A;  1C9O A;  4HR7 B;  1EUC B;  4O2A F;  2C2E A;  1K83 B;  1XMQ L;  3GTL H;  1TII D;  4GKJ H;  2YTV A;  5CA1 F;  2R8G A;  1XXG A;  2WAQ E;  4KLK A;  4JBM A;  5HY6 A;  1B7Y B;  4RH6 A;  2UXC H;  1UE5 A;  1CHQ D;  3J7A K;  2XGQ A;  4KKT A;  2ASJ A;  3VYS A;  3STB D;  1C8C A;  1BNZ A;  2WAQ B;  1ASY A;  4J9M A;  3D4D A;  3I4O A;  4JBW A;  3MWE A;  4QW9 A;  1BCP B;  3CCR A;  4NW2 A;  5LA6 F;  1V1P B;  1GUO A;  5IGG A;  1E3P A;  1SMY C;  5IT9 L;  2AMC B;  4NKL A;  3HOZ G;  5KFL A;  3KOJ A;  4C3J B;  3GIQ A;  5BN5 A;  1A9X A;  2UU9 H;  2JSO A;  1YJN A;  1Q86 C;  1X32 A;  4FVM A;  4F87 A;  1VBH A;  1WD0 A;  3J7A F;  1ICF B;  3K5N A;  3PIP 3;  3OTO Q;  2YRX A;  1RYR A;  5JJL A;  1SRO A;  4FO2 A;  3MVV A;  1K0S A;  4DV7 H;  2NVQ H;  1C3O A;  3D6W A;  3FPP A;  2YYA A;  5IGF A;  2B2Y C;  3JSL A;  1I50 A;  4BBR G;  4OXP A;  4B3R L;  3NTI A;  4CDF C;  3VA7 A;  4RB3 C;  4DR6 H;  4R8U B;  1II3 A;  2EY2 A;  2DY8 A;  5CYU A;  4CDC C;  1KLG D;  2OLS A;  5IGB A;  2UXB L;  1HQR D;  3UDF A;  2F4V L;  1EQQ A;  2BQR A;  1L1O A;  4CC5 A;  3NP8 A;  3M4O B;  4DR3 H;  1IL2 A;  3GIM A;  1FJG H;  3GTP B;  3C1F A;  5EPJ A;  4A3B H;  2JA5 B;  3UFX B;  1O7Y A;  2QF7 A;  1N33 L;  2R6G A;  1JWM D;  5KRU A;  3TS2 A;  4AYB E;  2K1B A;  2VQF L;  3Q2O A;  4TUY F;  3GII A;  5BPF A;  3KDF A;  5KFS A;  3NEL A;  4PNY A;  4I50 F;  1N34 L;  1ONL A;  2CFM A;  1E22 A;  5C44 B;  3P20 A;  4H02 A;  4GKK Q;  2F0E A;  3C46 A;  1Z6H A;  5H1S E;  3OWE B;  3H3V I;  3H0G B;  4O2D A;  3HOY G;  4UCT A;  2FE3 A;  3OW2 A;  4ME5 A;  3K5M A;  2ATL A;  1QOH A;  4KD4 A;  1STA A;  3FDS A;  3I3C A;  4TVA B;  2E5L L;  5HGQ A;  1I4H A;  1U4L A;  1T3N A;  5IWA H;  1ULZ A;  4ED3 A;  3VR3 A;  4JYA H;  5M3F B;  4FXG C;  4ZQI A;  2V4Q A;  5JVL A;  1PK8 A;  4EBE A;  4K0K Q;  4DV2 H;  1PDQ A;  2F3V A;  4ULL A;  3CAM A;  2QKI C;  2I5M X;  1EL0 A;  2R84 A;  2XNA C;  1SE4 A;  3DWP A;  2Z4I A;  3NQI A;  3SK6 A;  3T13 A;  3K58 A;  3PO3 G;  3N6X A;  3PW7 A;  2ZM6 L;  1SR3 A;  3V6H A;  4PMC A;  1Q7Y C;  1CSQ A;  1EFI D;  2L4N A;  3G4S A;  2SDF A;  2XWB B;  3RZO B;  1X3G A;  4R9W A;  3J81 c;  5LHY 1;  1SFO H;  1I4Q A;  5D1O A;  3KF6 B;  4PZ7 A;  4QWC A;  4XXE A;  3E3X A;  4KY6 A;  4BY1 H;  3HKS A;  1UNN C;  4MV1 A;  4LSA A;  4DUZ H;  4LUO A;  3KXY T;  5LMU H;  3K6O A;  1S40 A;  3N52 A;  1Y1V H;  4A3G G;  1A2U A;  4ECT A;  2Q8T A;  5IYZ F;  2QEX A;  2N55 A;  2TSS A;  1NJI C;  1GSH A;  2R8H A;  4ECR A;  2UVW A;  1GUS A;  4HNT A;  2Q2I A;  3OIP A;  3R2T A;  2LFN A;  5KIX A;  5KFE A;  3PW2 A;  3BQ2 A;  1JOO A;  3QB3 A;  1U0L A;  1UEB A;  2R92 H;  3MWD A;  5FPR A;  1XNR H;  1C0A A;  1H9K A;  1JR0 D;  2YS7 A;  1PX2 A;  4YCW A;  4A3C H;  4EQN A;  4DV4 L;  2AWO A;  1IBK H;  1RIP A;  4DR6 L;  1N32 Q;  4DL7 A;  2EPB A;  1JLL B;  4DL6 A;  2Q2H A;  1RCV D;  1QVG A;  1QVF A;  1A15 A;  5JVD F;  3BZD B;  1HR0 W;  3HOW B;  2WKD A;  2I80 A;  4ED7 A;  1MKH A;  3F2B A;  3T1Y H;  4K8J A;  1D6E C;  1BBU A;  2RF4 A;  1WTW A;  4ZLT F;  1VQB A;  1WTH A;  5C4J H;  2NU9 B;  2IT1 A;  1VS0 A;  3BQ1 A;  3I4M H;  4BWS C;  3EN2 A;  1EYD A;  5IYD H;  4P74 A;  2YZG A;  1TWG A;  2W9B A;  2N49 A;  1WTV A;  3OSO A;  3DM3 A;  1JOQ A;  4XYL B;  1HZC A;  3PIO A;  3C2P A;  3M9M B;  1I4X A;  1EUJ A;  1JB7 A;  5KG3 A;  4XTC S;  2PMZ A;  1PH9 A;  1JQY D;  5I47 A;  4DAV A;  3BDC A;  3GIL A;  1S9F A;  1KRS A;  4CDE C;  1MZB A;  4L8J A;  3SI8 A;  4RFB A;  2FLN A;  2QK4 A;  4JYA L;  1ML0 D;  2HCC A;  4IAL A;  1AEX A;  3PSI A;  5M5Y B;  4MTE A;  4DV2 L;  1T9H A;  5KX5 F;  3HKZ A;  3FDT A;  4OWT B;  2EOT A;  3RUP A;  3K0Y A;  2R7Z B;  1PHJ A;  2F0J A;  4A3D B;  2HDM A;  1HNX H;  2IX1 A;  1LUZ A;  4JG2 A;  1LTI D;  1ZQ7 A;  4I7H A;  1VQ5 A;  1B04 A;  4IO9 A;  3T56 B;  1YIT A;  1JE4 A;  2K5D A;  1YNX A;  2RCN A;  1KJ8 A;  1GGO A;  4H13 C;  4DUZ L;  5E3F A;  1YNJ D;  5IGC A;  4O4L F;  1MGS A;  3TIN A;  5KFP A;  2OWO A;  4DR1 L;  1N9W A;  1PFS A;  5KGU A;  1XMQ Q;  3T1H H;  2XCA A;  2HGS A;  1S97 A;  3GTJ H;  2R7K A;  2VA3 A;  2DN8 A;  1VAJ A;  4HJA A;  4KN4 C;  3GTK A;  3BA9 A;  3L7Z C;  4LF6 Q;  1AN8 A;  3CQZ B;  1DZ1 A;  2I8C A;  5KKN B;  3RZD H;  2HHH Q;  3MFH A;  5BPH A;  1ET6 A;  1HFG A;  3BG3 A;  4BWG B;  3CCE A;  5C0X J;  2NUA B;  3J7Z C;  5KG7 A;  1SE8 A;  4BY7 B;  4IZ8 A;  1GLV A;  3NXW A;  2NVY H;  3QIA A;  1L2F A;  2GPW A;  3CMA A;  4A3B G;  5IT9 E;  4FS1 A;  2YL2 A;  2FLL A;  4MA5 A;  3LP8 A;  2DNE A;  1KJI A;  4DV1 Q;  3E5S A;  4QCL A;  2DNC A;  1SNM A;  2KHS A;  1JWS D;  5KG0 A;  4I4T F;  4O42 A;  2JA7 A;  4CKB A;  3OIQ A;  2F0U A;  5D65 A;  3BJU A;  2RSO A;  2Q2T A;  3ETJ A;  4BXX H;  4HNV A;  2B2U A;  4QUC A;  5IP7 H;  1RF2 D;  4ZUJ A;  5LL6 X;  2YU9 H;  5HBR B;  1IOW A;  2M9V A;  4H44 C;  3ICE A;  4WBN F;  2WIN B;  5COY A;  4X65 L;  3S16 H;  2SNM A;  2F4V Q;  2DPI A;  4DR4 Q;  1IYV A;  2ZXR A;  2BH2 A;  3QR8 A;  5CB4 F;  4JVZ A;  2WYO A;  4JI8 H;  1G6P A;  1LTR D;  4MTK A;  5IY0 A;  2FP4 B;  4LF5 H;  2ASD A;  3LGJ A;  1CQJ B;  3EQL C;  1N33 Q;  4HNU A;  1B9N A;  1K83 H;  1DXM A;  4KJO A;  3M9B A;  2WII B;  1QB5 D;  1N34 Q;  3H20 A;  1YHQ A;  2JA8 B;  3H15 A;  1YHB A;  5LMN L;  5KG2 A;  1BR9 A;  2C2D A;  3OMG A;  4F8M A;  1WH2 A;  2PPB C;  2JEA I;  4DV0 Q;  5CC4 A;  4YR3 A;  3S2D H;  4F7X A;  4DV6 H;  2B3G A;  4BY1 G;  3KLW A;  4DV5 H;  2V4D A;  5C5M A;  4QB4 A;  2E5L Q;  1I4R A;  2FKL A;  2A68 D;  3I56 A;  1Y1V G;  1VQM A;  1PH3 A;  4JV5 H;  4KN7 C;  4IRC A;  4LJZ C;  1HRJ A;  4UCS A;  3U4V A;  4XX0 B;  3MEH A;  4DL3 A;  3G48 A;  3H0G A;  2W9C A;  2C28 A;  2EYP A;  4DNT B;  4A3I H;  4IQZ A;  2V58 A;  2R92 G;  3RBD A;  2K5N A;  4GKJ Q;  1XMO H;  2NYZ D;  4LK1 C;  4LF4 H;  3JAM c;  3GTO B;  2FIN B;  2VZA A;  3N8D A;  2UXC Q;  5C0X H;  4X64 L;  1JIH A;  2NZO A;  1CS0 A;  2IMW P;  2L1B A;  2MPM A;  4TRD A;  1F77 A;  4V19 0;  4GN5 A;  4NB3 A;  4YJ3 F;  3M4O H;  3QOJ A;  3OPO A;  2Q2U A;  4UY8 C;  2RHS B;  1Y8N B;  2KEN A;  3OHX C;  2JA5 H;  4JI3 L;  3HP3 A;  2JEJ A;  5IOC A;  4A3J H;  1U4P A;  1NMF A;  2UU9 Q;  4JI5 H;  5AJ3 L;  5ELN A;  4DXG A;  4Q0Y A;  3GV7 B;  1LAC A;  2W6O A;  3GV8 B;  1U4R A;  1BCP F;  3I12 A;  1AE3 A;  1SYX B;  2YTX A;  4ECV A;  3I4M G;  1M0W A;  1EEF D;  3HS0 C;  4DV7 Q;  1RYS A;  2SOB A;  4GOP A;  4P71 A;  1VQD A;  1RK6 A;  4QQB X;  1W96 A;  3I90 A;  5JOB A;  3TZD A;  2AQ3 B;  4RB1 A;  3M9O B;  4DR6 Q;  4DK6 C;  4GOP C;  1YNN C;  2E8G A;  3L9A X;  3MJF A;  2BR0 A;  3N42 B;  2VPQ A;  1WD1 A;  1GSA A;  2YZN A;  1SBB B;  5FKA C;  1PRT C;  4BA1 I;  3AMU A;  2OTL A;  5M3F H;  2XC9 A;  5IYC H;  5DGB A;  1S5F D;  1TWA B;  4DR3 Q;  3DF7 A;  1FJG Q;  3GTM H;  4TQS A;  1L0X B;  2C22 A; 
#chains in the Genus database with same CATH homology
 1YBY A;  4DAM A;  3K0X A;  5FLM H;  3PIP A;  1IBK L;  4A3G H;  1OXV A;  3ULL A;  4L5S A;  2B63 G;  1PH6 A;  1VQN A;  5IP9 G;  1K0R A;  4JI7 Q;  3PF4 A;  1HNW Q;  1VQA A;  1HZA A;  2VUM H;  1HH2 P;  2ID0 A;  3PV0 A;  3RN2 A;  2NVX H;  1OXU A;  3S14 H;  3T1Y L;  1K8G A;  4KI0 A;  1N8R C;  4OWW B;  3U58 A;  5IYB H;  3GTG H;  4B3M L;  4R4O A;  1X54 A;  1SN8 A;  2E2H H;  2KBN A;  4BBS H;  3G6E A;  1LM0 A;  1NTG A;  1Q1B A;  1MIU A;  4JC0 A;  1QZH A;  2K4K A;  3S2H H;  1KHI A;  1VQJ A;  2D62 A;  3GD7 A;  4A4I A;  1D7Q A;  2PQA A;  4DV5 L;  3HOU G;  4MNO A;  1JJ2 A;  4DAY B;  5IWA Q;  3KDF B;  3UDG A;  4JYA Q;  1M90 C;  1VQ9 A;  2NN6 G;  3MEF A;  1S3O A;  4X64 Q;  2OCE A;  2VY3 A;  1TWH H;  4P75 A;  3F1Z A;  4DV2 Q;  1Y1W H;  3CC2 A;  1U5K A;  4DNI A;  1IBL L;  1NMG A;  1L0W A;  4A75 A;  3M3Y H;  4GLV B;  2MQH A;  3I2Z A;  4A3M H;  5J3B A;  5IYC G;  1NY4 A;  4QL5 A;  5FJ8 H;  5GAH C;  4JI3 Q;  3HOZ H;  3S1R H;  1XMO L;  1XPU A;  4HJ8 A;  1JT8 A;  4OWX B;  3PO2 H;  1G29 1;  1Y14 B;  4GNX B;  2ZTE A;  4OON A;  4LNQ A;  1P8L A;  1XPR A;  2A1A A;  1SMX A;  2WB1 E;  4KHZ A;  1NE3 A;  5IE8 A;  5E7N A;  4B3T L;  3EBE A;  1CKN B;  5EAY A;  4DUZ Q;  1AE2 A;  3GTQ H;  3JAM i;  5LMU Q;  3U50 C;  3K7U C;  2Y0S G;  5ELO A;  1Z47 A;  3VDY A;  4FDB A;  3HOX H;  3A5U A;  1K9M C;  1VQL A;  1I3Q H;  4QJF A;  4DR7 Q;  1EWI A;  4DUY Q;  1HNX L;  2E2J H;  1GO3 E;  4JI5 L;  1S72 A;  1TXY A;  1EIF A;  3FP9 A;  3STB C;  2UUC L;  2AKW B;  1PYS B;  2K52 A;  2UUA L;  1WI5 A;  4C3J H;  3J80 i;  2WP8 J;  2ZJQ A;  4JI1 L;  1C9O A;  1WYD A;  4QGU A;  1H95 A;  1XMQ L;  2UUB Q;  3GTL H;  2YTV A;  4BXX G;  5C4X H;  4DKA C;  2DUD A;  5IP7 G;  1XNR Q;  2JA8 G;  2WAQ E;  4KLK A;  4HIO A;  4JBM A;  4LF9 L;  5HY6 A;  1B7Y B;  4KHP L;  2YYZ A;  1IBK Q;  1UE5 A;  3RN5 A;  1UWV A;  2HIV A;  3PUW A;  2IHE A;  4HJ9 A;  4K0K L;  1KAW A;  2DGY A;  4A3K H;  2UXD Q;  3STB D;  1ASY A;  4JI6 L;  5GQO A;  3T1H L;  1VQ8 A;  4JBW A;  3I4O A;  2ATW A;  3CCR A;  3L2P A;  2IHF A;  3T1Y Q;  1E3P A;  1P16 A;  1JMC A;  2AMC B;  3HOZ G;  4JCV E;  1ASZ A;  3KOJ A;  4LFB L;  4IPG A;  2VW9 A;  1YJN A;  4A3E G;  1Q86 C;  1GKH A;  4B3M Q;  1A62 A;  1KIX A;  1GD7 A;  4YY3 L;  3OTO Q;  3D31 A;  3GTP H;  4IJH A;  5JJL A;  1SRO A;  4YCV A;  1NBW A;  1X3E A;  3K8A A;  2NVQ H;  1XPO A;  3ZJY C;  3CF5 A;  2WAQ G;  3KF8 B;  4BBR G;  2L15 A;  4OXP A;  4YHH L;  4B3R L;  2N78 A;  2K14 A;  2GVB A;  3A0J A;  5BR8 Q;  5C44 H;  3I4N G;  1CKO A;  3I7F A;  1EIY B;  1BVS A;  1UE7 A;  4DR5 L;  1VQE A;  1IBL Q;  3H0G H;  1W3S A;  2UXB L;  4GLX A;  3DLL A;  3UDF A;  4HJ7 A;  1EQQ A;  2F4V L;  2XGT A;  4C2M H;  4P73 A;  1L1O A;  1HZ9 A;  1IL2 A;  4LFC L;  3W5O A;  4A3B H;  1EFW A;  1X3F A;  3UE1 A;  1N33 L;  2R6G A;  3TS2 A;  4AYB E;  2VQF L;  2VS1 A;  1Q81 C;  4A93 H;  4LW1 A;  2K5V A;  2I0Q A;  3KDF A;  3NEL A;  4B3T Q;  1I94 L;  1N34 L;  2F3I A;  3CQZ H;  2CFM A;  1E22 A;  4JI8 L;  4H02 A;  1J6Q A;  1WFQ A;  4AIM A;  1PH4 A;  4LF5 L;  4GKK Q;  4J15 A;  3RLO A;  5H1S E;  5C0X G;  1EOV A;  3H3V I;  1KC8 C;  2K50 A;  1X65 A;  4O2D A;  4BY7 H;  5M5W H;  1HNX Q;  4IFD I;  3HOY G;  3ERS X;  2EIF A;  1YZ6 A;  5C3E G;  1IZ6 A;  3OW2 A;  2JA9 A;  3KYH C;  4LWC A;  2JA5 G;  3ULJ A;  4POG A;  4GNX A;  4C3H H;  3CCM A;  4TVA B;  3HKZ E;  4A3J G;  3RZO H;  2E5L L;  5HGQ A;  1KXL A;  3ULP A;  2YV5 A;  4A3L H;  1BKB A;  4GNX C;  4KHP Q;  4LF9 Q;  1MJC A;  1KD1 C;  1CKN A;  5C44 G;  2HIX A;  4K0K Q;  2K75 A;  1YHA A;  4AYB G;  4DV6 L;  1K73 C;  4B3S Q;  4UPA A;  4UP9 A;  3CAM A;  3CPW A;  2ZTC A;  2I5M X;  4QY7 A;  3CME A;  3T1H Q;  3TS0 A;  4NXN Q;  3PO3 G;  4AH6 A;  4WJ3 M;  2ZM6 L;  3GTK H;  1J5E L;  4JV5 L;  1SR3 A;  1WCM H;  2RHQ B;  4PZ8 A;  4LFB Q;  2LSS A;  2VQE L;  1Q7Y C;  1HNZ L;  1CSQ A;  1B70 B;  3G4S A;  4JI2 L;  4LFA L;  4OX9 L;  3FHW A;  4YY3 Q;  1X3G A;  3J81 c;  1EQR A;  1SFO H;  5M5X H;  3KF6 B;  1PH8 A;  4PZ7 A;  5M3F G;  2NVT H;  3CCU A;  3AEV A;  2JA6 G;  4BY1 H;  5C0X I;  2GVA A;  1CUK A;  3HKS A;  3HKZ G;  1PVO A;  1WOC A;  2H5X A;  2PNH A;  4LUO A;  4AQY L;  2YTY A;  4LF4 L;  2CKZ B;  1VCI A;  3UDI A;  1SLJ A;  1YJ9 A;  1Y1V H;  5AJ3 Q;  5FLM G;  2QGQ A;  4YHH Q;  1JE5 A;  1S40 A;  1N36 Q;  3HOW H;  4A3G G;  4B3R Q;  4P72 A;  3PUY A;  2QEX A;  1X55 A;  1NJI C;  2IY5 B;  2JE6 I;  2AWN A;  2JA7 H;  2VUM G;  2MO1 A;  2Q2I A;  4LUZ A;  5GAG C;  3TRZ A;  2UXB Q;  3S15 H;  3J81 j;  5IYB G;  1U0L A;  1UEB A;  2R92 H;  4A3L G;  3K7A H;  4A3F H;  1C0A A;  3FKI H;  2KHI A;  3E0E A;  4BBS G;  4YCW A;  4A3C H;  4L5Q A;  4DV4 L;  3NEM A;  2AWO A;  3CCL A;  1KRT A;  2AHO B;  1K8A C;  1RIP A;  1E7Z A;  4LF7 Q;  1HJP A;  2VQF Q;  4DR6 L;  1N32 Q;  1R9T H;  2Q2H A;  1QUQ A;  4HIM A;  1QVG A;  1QVF A;  3J7A 5;  2KHJ A;  1HR0 W;  2NN6 I;  3B6Y A;  4IPC A;  4YWM A;  1HR0 L;  2I5H A;  1MKH A;  3F2B A;  1JJG A;  4JI8 Q;  3KFU A;  4LF5 Q;  4LF6 L;  2Z6K C;  1BBU A;  2RF4 A;  3CC7 A;  1Y1W G;  1Q82 C;  2HHH L;  1A63 A;  1VQB A;  2WB1 G;  4GS3 A;  4DV3 L;  3ER0 A;  5C4J H;  4BA2 I;  2PI2 E;  3TEH B;  4A3M G;  2OTJ A;  3CP0 A;  2IT1 A;  5FJ8 G;  3F2D A;  1VS0 A;  2VNU D;  4JI7 L;  3S1N H;  3I4M H;  4IPD A;  3EN2 A;  3M85 A;  5M5Y H;  3PO2 G;  3CCQ A;  5IYD H;  4P74 A;  3S1M H;  2N49 A;  2XTI A;  3DM3 A;  5M3M H;  2VL6 A;  3HOW G;  2LXJ A;  1HZC A;  3PF5 A;  3JC6 6;  4DV1 L;  3PIO A;  4DV6 Q;  1JB7 A;  1EUJ A;  4X6A H;  2JA7 G;  2R7Z H;  4XTC S;  4JI4 L;  1PH9 A;  4DV5 Q;  4A3D H;  1JJC B;  1X56 A;  1LYL A;  3KJP A;  1Z9F A;  4EX5 A;  2R93 H;  3RLN A;  1IYJ B;  3A74 A;  3K81 C;  2ZM6 Q;  3HOX G;  2E2I H;  4JV5 Q;  1KRS A;  5GAE C;  4OO1 G;  2VQE Q;  3KJO A;  1Q46 A;  4A3C G;  1Q1E A;  4PG3 A;  3PCO B;  4OX9 Q;  4JYA L;  2WFW A;  4MZ9 A;  3CXC A;  2A8V A;  3PSI A;  3CCJ A;  4APV A;  1T9H A;  4DV2 L;  2B63 H;  5JEA J;  2B29 A;  4DR4 L;  5IP9 H;  1VQF A;  5C4X G;  4DR2 L;  1XMO Q;  4DPG A;  4IFD J;  1BBW A;  1VQH A;  2R7F A;  4OWT B;  4X62 L;  1KQS A;  2V1C C;  1PHJ A;  1K3R A;  1WJJ A;  3HOV H;  2D0P A;  4A3K G;  3M7N A;  2IX1 A;  1Q8K A;  1LUZ A;  4JG2 A;  4XIG S;  4Y7N H;  1OTC A;  1VQ5 A;  1D8L A;  2BA1 A;  4IO9 A;  3CCV A;  4JI0 L;  1YIT A;  1V9P A;  1VQP A;  1VQG A;  1PYB A;  4R4I A;  4IOA A;  4UP8 A;  1YNX A;  1YIJ A;  1HZB A;  2RCN A;  3HOU H;  3AFP A;  5IYD G;  4DUZ L;  1EYG A;  1AH9 A;  3KF6 A;  1E1T A;  4GN4 B;  4NXM L;  4JI5 Q;  2EXD A;  1A8V A;  3PGZ A;  1G51 A;  1I50 H;  4DV4 Q;  3J81 i;  1LTL A;  4DV0 L;  2UUA Q;  4DR7 L;  2JQO A;  1O7I A;  3U4Z A;  2FXQ A;  4JI1 Q;  4DR1 L;  1N9W A;  2OWO A;  2D0O A;  1PFS A;  3S17 H;  3K80 C;  1XMQ Q;  1V1Q A;  2N3S A;  1PH7 A;  1A0I A;  3GTJ H;  1HR0 Q;  5GRO A;  4HJA A;  4A76 A;  3RR5 A;  1OXT A;  3L7Z C;  4LF6 Q;  2IX0 A;  2JJQ A;  4TQU S;  2BH8 A;  2OQ0 A;  4IOC A;  3RZD H;  2HHH Q;  4RG1 A;  3CCE A;  4JI6 Q;  4YWK A;  4DV3 Q;  3H0G G;  5C0X J;  1VQ4 A;  3J7Z C;  2UXD L;  1SE8 A;  1B8A A;  3W1B A;  4LUV A;  2MFI A;  2NVY H;  4GKJ L;  1L2F A;  3CMA A;  1YJW A;  4A3B G;  4GLA C;  4JOI A;  3F2C A;  1I5F A;  1SRU A;  3HOV G;  1QZG A;  5JJI A;  2C35 B;  4R1J A;  2UXC L;  3E9I A;  4A93 G;  1VQK A;  4DV1 Q;  3W1G A;  2GN5 A;  2LXK A;  2F52 A;  4JOI C;  4GOP B;  1VQ7 A;  4JBK A;  2NZH A;  4JI4 Q;  4IJL A;  3OTO L;  1L1O B;  5IT9 c;  1E1O A;  1UE1 A;  3EIV A;  1IBM L;  3BJU A;  2JK8 A;  2A19 A;  2Q2T A;  4BY7 G;  4MTN A;  4BXX H;  4R4Q A;  4YWL A;  2CWP A;  4X66 L;  5IP7 H;  2Y0S E;  1W2B A;  2UU9 L;  3GDE A;  2JA8 H;  3PUZ A;  3I55 A;  2YU9 H;  4PMW A;  1XJV A;  1I6H H;  5BR8 L;  4DR5 Q;  2N8N A;  3ICE A;  2PI2 A;  4X65 L;  3S16 H;  1X9N A;  2F4V Q;  4DR4 Q;  4Y52 H;  2EQS A;  4DV7 L;  3SGI A;  3A5Z B;  4DR2 Q;  1YI2 A;  2OQK A;  2BH2 A;  2ZJP A;  4LFC Q;  4X62 Q;  1VQ6 A;  5IY0 A;  3BZK A;  1M1K C;  1G6P A;  1KL9 A;  4PZ6 A;  4HID A;  3LGJ A;  4ALP A;  2QA4 A;  1TWF H;  4LF8 L;  1N33 Q;  1XNQ L;  4RMF A;  3TRE A;  2KCT A;  4A3E H;  1K83 H;  4DK3 C;  1PH1 A;  3M9B A;  4EQ5 A;  2HT1 A;  4JI0 Q;  1I94 Q;  1N34 Q;  2Z6K A;  3H3V H;  4POF A;  4YCU A;  1YHQ A;  5LMN W;  4IPH A;  3H15 A;  4L5R C;  1CSP A;  1WCM G;  1YHB A;  4JBJ A;  3TQY A;  5LMN L;  2ES2 A;  4DR3 L;  1YVC A;  3PUV A;  1FJG L;  1FGU A;  3CPF A;  2JEA I;  4NXM Q;  4GKK L;  4BBR H;  1MJE A;  3NBH B;  2PQA B;  2I5L X;  4DV0 Q;  4GN3 B;  3S2D H;  4DR1 Q;  2B3G A;  3AFQ A;  3D0F A;  3L0O A;  4BY1 G;  3KLW A;  2MNA A;  3GTO H;  3I4N H;  1HNW L;  2ASB A;  4R4C A;  2E5L Q;  3AYH B;  3I56 A;  1Y1V G;  1VQM A;  1PH3 A;  1TWC H;  1YEZ A;  1GVP A;  3U4V A;  2CQO A;  1GM5 A;  4IFD G;  3G71 A;  2BA0 A;  5DLQ E;  3G48 A;  5K36 G;  4A3I H;  4B3S L;  1RL2 A;  3RNU A;  1OXX K;  1VQI A;  1VQO A;  2R92 G;  1J5E Q;  1FVI A;  1UE6 A;  2K5N A;  4NXN L;  4A3F G;  4GKJ Q;  3FKI G;  1PA6 A;  3NEN A;  5IWA L;  1HNZ Q;  3CC4 A;  3Q8D A;  3JAM c;  2K5H A;  4LFA Q;  3M4Q A;  2MO0 A;  4JI2 Q;  2ZJR A;  2VZA A;  2UXC Q;  4QIW E;  4X64 L;  2NZO A;  3RLF A;  5JEA G;  3AQQ A;  2ZTD A;  3HOY H;  1CKM A;  1V43 A;  5C3E H;  4GN5 A;  4NB3 A;  5JJK A;  3M4O H;  4NPS A;  4AQY Q;  3E9H A;  3CW2 C;  3J80 c;  2Q2U A;  2RHS B;  4UY8 C;  2KEN A;  1IBM Q;  2HQL A;  2JA5 H;  4JI3 L;  4LF4 Q;  2UUC Q;  1XTD A;  4A3J H;  3M4P A;  1NMF A;  4R4T A;  2KCM A;  3WWV A;  4X66 Q;  2UU9 Q;  4HJ5 A;  1N36 L;  1TWG H;  2Z0S A;  5AJ3 L;  1QUQ B;  5ELN A;  1Q12 A;  1IXR A;  1QVC A;  2CWA A;  1TWA H;  3IRB A;  5GAD C;  4X65 Q;  3CD6 A;  2CCZ A;  1AE3 A;  3F8T A;  2YTX A;  3MXN B;  3S1Q H;  3I4M G;  4WJ4 A;  3PUX A;  2JEB I;  4DV7 Q;  2R7D A;  1X6O A;  3HFZ B;  4O0A A;  5LMU L;  4GOP A;  4P71 A;  3PO3 H;  1VQD A;  5M3M G;  4QQB X;  3UDX A;  4ME3 A;  1DGS A;  4LF8 Q;  1OXS C;  1VQC A;  1E24 A;  3UE0 A;  4L5T A;  1XNQ Q;  4DUY L;  4DR6 Q;  4DK6 C;  4GOP C;  2E8G A;  1PV4 A;  4OO1 I;  2R7Z G;  4A3D G;  1L1O C;  5FLX c;  4UP7 A;  4LF7 L;  3BU2 A;  4A3I G;  3BZC A;  1C7Y A;  1N32 L;  2R93 G;  1FL0 A;  3CCS A;  3GO5 A;  1PH2 A;  4BA1 I;  2UUB L;  2OTL A;  2PMZ E;  5M3F H;  4C3I H;  3S24 A;  5IYC H;  5LMN Q;  1PH5 A;  2JA6 H;  4DR3 Q;  1XNR L;  4HIK A;  3OYY A;  1FJG Q;  3GTM H;  2ALY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...