4RAZA

Crystal structure of magnetospirillum gryphiswaldense msr-1 holo-fur
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4razA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4razA02
3R0AA 4L0ZB 4PDKA 3R60A 2UZKA 3KP6A 4PZJA 1T6SA 4P5OA 5BS6A 3CDHA 2GAUA 2QQBA 4LLGF 4KUMA 2FQ3A 1DP7P 4K2EA 2V1UA 4I2OA 3H92A 3WTZA 2R3SA 5HDKA 3BWGA 4BAYA 4UVAA 3WGGA 2HGCA 4KN4X 4EJOA 2QLZA 4GO1A 1IXSB 1JHFA 4MGRA 1KYZA 1ZGAA 2LF8A 1GXQA 1FLIA 4EVIA 1USSA 4E70A 3QPHA 3J7AO 1W7PA 1YS6A 4I98B 1EV7A 5FD6A 5KVRA 2L01A 4N0BA 2EA2A 2OQRA 4L0YB 3OOPA 4NB5A 2BYVE 3SXYA 2BGCA 1YQAA 2KRFA 4XRFA 2DK5A 1JHHA 2IA1A 5HVQC 4M9XA 1DUXC 5IT3A 3Q5FA 3F3XA 2O6GE 1DDNA 2CYYA 2ZXJA 2K86A 2H6BA 2P7VB 2V1DA 3F6VA 4O5VA 5DCMB 4RAZA 3L00A 3F22A 1YFHA 2GA2A 1X3UA 4EMSA 2RC4A 3RYPA 2QZ8A 1MKMA 2K7LA 4B09A 2VC0A 4BYYA 3J81Z 2HQNA 1UCRA 3QAHA 4EM2A 2HTJA 2YU3A 2EFOA 2A6HF 2A69F 3ZN1A 1KU9A 1XMKA 1REPC 2BE5F 1KYWA 3JW4A 1G3SA 1KU2A 4ZH4F 1V4RA 3P9CA 3W6KB 2WC2A 2XRNA 1FX7A 2P6SA 4A2UA 2P5LC 4EV0A 2EFQA 4OIRF 2MH9A 1P2FA 1IF1A 1WRJA 1QZYA 3TO6A 2KIMA 2O0YA 5TRDA 2ACJA 5HLIA 2ZNZA 2ZMEB 4IRIA 2M87A 5FLXK 1HKQA 4ENKA 4A5NA 4I01A 2Z3YA 1YS7A 3TO7A 3V8KA 4U7DA 2PEXA 5E17F 3E3VA 1O7LA 2XAQA 1MDMA 5HOOA 5K5RA 3IRQA 3GF2A 1QBJA 4AWXB 3F8NA 2MA3A 3ABTA 1CF7A 4LB5A 4ON0A 3N97A 4ZYEA 2IPQX 2WTEA 1RUNA 1B59A 5D6EA 2Z5UA 1KQ9A 5LBQA 1R58A 2MC3A 2HS5A 1STZA 1BI1A 4KIGA 3QPTA 3FX3A 1FC3A 4LK1F 4Q48A 1FBQA 3J80K 4HX4A 2PFBA 4H0EA 4L18B 2FA5A 4HOBA 1XGMA 3DV8A 3GW2A 1R1UA 3BDDA 4RGXA 2UWMA 4OMZA 3I71A 1KA8A 2CWEA 2PBIA 3QP6A 4P9UA 3I4PA 4WXDA 3VB2A 3HRUA 4ZYDA 6PAXA 1LDKB 2W24A 4RB0A 4XSXF 4DNCA 5E8GA 5A2QZ 4CO8A 3C3WA 3TDZC 4HW0A 5LGUA 5LGTA 3GZ6A 5EEHA 4D0PA 1YIOA 2KKOA 4I0BA 2IA2A 3LQQA 3BP8A 5KK1A 2VE8A 2MLGA 3E5XA 4UNOA 3RPQA 3O6BB 1W5SA 2D45A 1IUYA 1BIAA 3GLXA 1BBYA 1H9GA 1OR7A 2EV5A 4BQAA 3DXJF 2OQGA 4G7HF 4S04A 3GO5A 4MHGA 3GVAA 4WXHA 4N9HA 1HXDA 3QP5A 2IJLA 3C18A 1CGPA 3KEQA 3O2PE 2OU2A 3ISPA 3HRMA 3EQLF 1IXCA 1JE8A 4LG0B 1QQIA 3ZN0A 2J5OA 1HBXG 5FO5A 3SZTA 4ZYHA 2R7FA 2QYOA 5CVJA 2PJPA 1FOKA 1LDDA 4RB3C 1XGNA 2XASA 3CUQB 5HDGA 1XDUA 3I53A 3HIFA 1A04A 2VODA 2QBYA 2RV8A 1T2KA 2PI0A 3Q9VA 1HW5A 5EEGA 1FBSA 1LEAA 5LHIA 3TOBA 3LAJA 3ZMUA 4M72A 3IWFA 4RB2C 1F4KA 3M7GA 3GYHX 5LHHA 1I1GA 1R23A 1TNTA 2HTSA 2IP2A 4KT5C 1L0OC 3WTSC 4ESFA 4U7BA 3E6CC 3V7CA 1XGOA 4WXCA 2EV0A 2BBYA 1V3FA 1YW9A 3MQ0A 2GZWA 1O3TA 1XDSA 2QQAA 2JZYA 1XCBA 3F8MA 4AIJA 4WK8F 1G4DA 2A6EF 2X0LA 5D5XB 2X4HA 5CJ9A 1ONVA 1YTYA 4I7HA 1IRFA 2YPRA 3U1DA 5L3CA 4ENJA 3GWZA 1U5TC 4EJUA 3L2CA 4CHUA 1QO0D 3R61A 4MEXF 4AD9A 2COMA 5AONA 4OIQF 1T38A 3HSRA 3R6SA 1P4WA 2D1VA 1IXRC 2XGXA 5LGNA 3V8JA 5E1XA 3WODF 2VOPA 5ICEA 3ABUA 4MQVA 4FT8A 3IHUA 2W57A 4M6YA 2P7CB 3IC7A 4UHTA 1KU3A 2VBWA 2XAJA 5FFXA 4FX4A 5L3EA 3FXRA 1FYMA 2HDCA 2PLYA 1MDMB 2HR3A 4EGZA 1D3YA 4IJAA 3I59B 5CVIA 1E2XA 4M9ZA 1OPCA 4XBFA 1PP7U 1XD7A 3PQJA 3IL2A 5HS7A 3KP3A 5H20A 1OKRA 2BV6A 5E1ZB 5L3FA 2L3DA 2XROA 1E17A 1BC8C 3TKYA 3FMSA 2P5KA 1FPQA 2BEOA 3E97A 3D5LA 4ZYGA 2PMUA 5K1YA 2M45A 1F1ZA 2OZUA 2W84A 2FRHA 1K7AA 3JTHA 1ZREA 4CICA 4A0XA 1Z1DA 1RNLA 2Y0MA 2PQ8A 3OV8A 1TW2A 3CLOA 4BNCA 3C1DA 2IT0A 1ZG3A 2FEZA 2JT1A 1R1TA 3WTUC 5JHUA 1ZG5A 4G7OF 2EFWA 2ZCWA 3M9AA 1H9TA 2ZKZA 2DAOA 4JK1X 4IRHA 1ZG1A 2QQ9A 3BJOA 1YW8A 5HDNA 1SD7A 3I54A 4LB6B 2P4WA 1RZ4A 2VN2A 3MAJA 4L9VA 4HF1A 2XAGA 1XSDA 3M8EA 2UXXA 1NHAA 3COAC 1PDNC 2DPDA 4HV6A 3BJAA 1Z91A 4M73A 4MTDA 3F8CA 4F7ZA 2LF7A 2VXZA 1TBXA 2ZMEA 1XSVA 5CYVA 3WTXC 1YO5C 3F8BA 1S3JA 1TQPA 1UB9A 3U9GA 2L54A 5CVVA 2V79A 2Q8KA 3KLOA 3KE2A 3T8TA 3CUQA 4IVNA 1P92A 3DPTA 3TDUC 2QWWA 1B6AA 1ZYRF 1P4AA 4ETSA 4A6DA 4O6JA 2F2EA 2HQRA 5DYMA 3RJPA 4WCGA 2V1XA 1LEBA 4NHJA 4LK0F 3MEXA 1S7AA 3V7SA 2XVCA 3C7JA 4LD5A 1WWXA 2M30A 1I6XA 2DBBA 2EK5A 4GXOA 3GUDA 2RNJA 3AAFA 5LLQA 2F5DA 2L4MA 2OA4A 1IN4A 1C0WA 4XLNF 1BIBA 1TTYA 4G9YA 1TLHB 5JI6A 3BROA 2B0LA 3ZQ7A 3GFJA 4L9TA 1IZ1A 1HW2A 2FNAA 2ZFWA 4A5MA 3DQVC 1K78A 1ZRCA 2CGPA 3BPXA 3E5QA 2XHKA 3R4KA 3T1BA 1TW3A 3B02A 2M8EA 4Q5SF 5FB2A 3TGNA 1XCVA 2A68F 3KCCA 1BN5A 1GXPA 2NS0A 5DD8A 4RGSA 4L5JA 4HQEA 2RN7A 2ZNYA 5ICGA 2HYGD 2H09A 4LG0A 3GXOA 1K6OA 3I59A 5D4RA 3N4MA 5D5UB 2ZJ2A 2RVCA 2Y75A 4OINF 1SD4A 3PFIA 4JBAA 3CUOA 3QRFF 3G73A 3E6DA 3BPVA 5LRSA 3KP7A 4UUVA 1Z6TA 1ZARA 2DQRA 3JAMZ 2D2WA 3EYIA 2GXGA 5FFZA 3FZVA 3QU6A 4R79A 2STTA 4CXFA 3PQKA 2DQLA 2PN6A 3E6MA 5E18F 4HQMA 3HHGA 5D5VB 5F1RA 1L3LA 3LA7A 2J5PA 4Y13A 2YX7A 5ILUA 2G9WA 2H94A 4KICA 1G3WA 2KJCA 4LLNA 4GYGA 2W85A 3F8FA 4S05A 5HLHA 3K69A 4YIIA 3MFKA 1I27A 2ZO4A 2QUFA 3RI4A 1IRGA 1I1SA 5D6FA 1W4MA 3HSEA 1ZGJA 3LAPA 2Y48A 2FNPA 1BC7C 4KA4A 1FYKA 4GYIA 1LB2A 1HSTA 5DEQA 3RKYA 3WTTC 3ERED 4KFCA 1RI7A 3ULQB 5A2QK 3W6JB 3FHZA 4HX8A 3KP5A 4EJWA 2E1CA 5F64A 3LA3A 1O3QA 1ZRFA 2CFXA 2HZTA 3WG9A 3ZMSA 4KIFA 5ICFA 3TQNA 4MNUA 3I0TA 1J2XA 3FM5A 1XB4A 4HX7A 5ILVA 2EB7A 2FE3A 5DV5A 4PCQA 1IAWA 2P8TA 4P55A 5LEKA 1IN6A 3LWFA 2E1NA 2FXAA 2VOOA 1FT9A 2UXNA 4LGWA 3L09A 5DUIA 4Z2YA 2QM3A 3M8FA 3QU3A 5HLGA 1BI3A 4ESBA 1YW7A 4CDGA 2RKHA 3HYIA 5F6FA 1G3TA 3VEPA 1SFEA 1EH6A 3CO7C 1MJ9A 3CJNA 1FWZA 5H6RA 2R7DA 3FXUA 3K1MA 2A07F 1R36A 2MBFA 2NAZA 4CGZA 4EQQA 4KDPA 1ZLJA 2Z99A 3KP4A 5DCFA 3HTSB 4KMUX 5LEJA 1ODDA 4ENNA 2HWVA 4M74A 3I64A 2DO7A 1P6RA 1KGSA 2JSCA 2W25A 4A12A 3KP2A 2AXLA 3RYRA 1S7OA 4HLYA 1FSEA 4U0WA 2FBHA 1HKTA 2VBZA 5D8LB 4KIBA 3GFIA 2DI3A 3ZMDA 1B9MA 4HAMA 4ZZDA 3ZPLA 2DT5A 3H3ZA 1ZHFA 2ADUA 3KZZA 1WQ2A 2WV0A 1SD6A 5CVRA 2LKPA 3ECOA 5CLSA 4CYDA 3MZHA 1ZRDA 3ZMVA 4FHTA 3DF8A 4BXUA 5HS9A 3SFZA 2JPCA 4CZZA 2V9VA 4HZFA 4GCVA 4YFXF 2OZ6A 4RAYA 2JTVA 2XKPA 1OYIA 5E1WA 3DFGA 4U0VA 2C6YA 2K02A 1WI9A 4AVPA 1W7PD 3P9IA 5DD4A 4UVBA 4EM0B 3IKVA 2A3SA 4HA8A 1JGSA 1J59A 4M6XA 4IHTA 3P9KA 3IRRA 1Q1HA 4LJZF 3RTRA 1MJBA 1U78A 2HFHA 4G6DA 2AS5F 1RIOH 2M5WA 3FXQA 4PGGA 2F5FA 1TQMA 2XAFA 1FYLA 1I5ZA 3KZYA 4FX0A 3E6BA 4I0AA 4IPAA 1DPUA 1YYVA 1ON1A 1Z05A 1LJ9A 5J8FA 4A0ZA 4KMFA 4OOIA 1QNTA 1K78B 2O03A 3EETA 1R5HA 1DPRA 3G3ZA 3D0SA 2LDUA 2HEOA 4DQ2A 3Q9SA 4OIPF 1J7KA 4LFUA 2VC1A 3QOPA 1MJAA 2FOKA 3JSOA 3KEOA 1KU7A 4P9FA 2ZBKA 4YG2F 3J81K 2RDPA 4A6EA 2CW0F 4P96A 2E7WA 1S29A 3FWEA 4MEYF 4WWCA 4RB1A 1AOYA 1SFXA 4R1HA 1O3SA 4GGGA 2A61A 3GX4X 1GHCA 4WF2A 1SAXA 2ISZA 3HTUA 1OYWA 3J80Z 4ZZLA 2EA4A 3V8LA 2F5CA 3K1NA 5H6QA 5LHGA 1J9IA 1TQIA 1O3RA 3GFLA 1PP8F 2HKOA 1K79A 1PUEE 4RGRA 1U2WA 4OMYA 2OD5A 2VT2A 5BPIA 1BJAA 4R8HA 1OYYA 3U2RA 3JTGA 2WWYA 3HOTA 2K4BA 3L9FA 5BQTA 3I5UA 3RKWA 1U5TB 4G6QA 4HLXA 4QWQA 2FSWA 2EJRA 3RKXA 4OIOF 1UHMA 1FP1D 2L4AA 1B4AA 3WGHA 4EJTA 5ERIA 5FLXZ 5J6XA 1J0RA 3K1PA 1R5GA 2KIFA 1JXSA 5ILSA 4EM1A 4AIHA 3MZYA 2FBKA 1ON2A 3CUQC 2P6TA 4OU0A 1O57A 1ZAOA 1BI2A 4G94A 4L5IA 2XKOA 3DP7A 3NRVA 4MQ9F 3WTYC 1YLFA 3I58A 3VODA 2VT3A 4Y17A 3NEUA 4XLPF 4ASNA 2ESHA 5E20A 4EGYA 5L3BA 2FMYA 1AWCA 1J75A 3HSFA 4HDVA 2GA1A 3M1EA 2QBYB 2OAZA 2TDXA 3CO6C 3LSTA 1ZLKA 3MCZA 4AIKA 4G7ZF 2LSOA 2OBPA 4ENMA 4PGHA 5DUKA 2XAHA 3HUGA 5L3GA 1SMTA 3HRTA 2VONA 2H27A 2YSRA 3DEUA 4L9NA 2VBXA 4M71A 3B73A 1EH7A 2GWRA 5BOXA 3EUHA 5D8KB 4Q4ZF 2MLKA 3ELKA 3KLNA 1HW1A 3FF5A 2NRAC 2G7HA 4N9IA 3ZP5A 4HYEA 1IW7F 3DPLC 5JR3A 1U6GA 3F6OA 2FMLA 2ELHA 2NNYA 3K2ZA 1QGPA 1D8KA 3VFZA 3HOSA 4MTEA 2G7UA 3CTAA 1BI0A 4IXAA 2M1BA 1VTNC 1HKSA 1Y0UA 3ZMTA 2DTRA 1MZBA 1TNSA 1W7PB 2D1HA 2DK8A 2YX4A 3P7NA 5LRRA 4YFKF 1SFUA 4KNYA 2IW5A 4L9JA 1HQCA 1WKMA 1R7JA 2IA0A 3WE2A 2GIVA 2O61A 1XSXA 4JQFA 5IT9K 1UFMA 1F9NA 1YG2A 2PMHA 2HYFA 4RGUA 4G8XA 1Z9CA 1ZN2A 2XUBA 1R22A 2DW4A 1B1BA 4TV7A 5JFRA 3WU1B 1T98A 1J5YA 4YFNF 3O3KA 1MD0A 1QZZA 1XMAA 1R00A 1B9NA 2NNNA 1FP2A 3WTWC 3BZ6A 5E8IA 3RDIA 3V7RA 4Q47A 1U3EM 3JSPA 5IT9Z 1R1VA 1XN7A 4RS8A 2EFPA 3V4GA 2EFNA 3WU0A 5FGMA 2DFIA 3IKTA 4LMYA 1IN7A 2DLLA 1ULYA 3T8RA 5J8CA 1T0FA 1XGSA 3BJ6A 3NQOA 2K27A 4IF4A 2RGVA 5BMZA 2VBYA 5D4SA 2DU9A 3ZMZA 3JAMK 2QVOA 2KJBA 2YR2A 4I02A 1RUOA 2EWNA 1FSHA 3VOEA 5JVTA 5DCMA 2Q0OA 3TO9A 2ISYA 2FU4A 2MH2A 4HV5A 5K5OA 1KQ0A 4NQWA 4XSZF 4I09A 5FD5A 1LVAA 3ROUA 4U0YA 1Z6RA 3MWMA 3RIRA 3BOQA 1D8JA 3SHFA 1U8RA 2GQQA 3WGIA 2CSOA 1WSUA 3WE3A 2F5EA 4EJVA 1OMIA 3FMQA 4HF2A 4HBLA 3BY6A 4UV9A 1F5TA 2CG4A 4QLCU 1S6LA 1MGTA 2VE9A 2XIGA 2P5VA 5AIQA 3EYYA 2STWA 1SMYF 3K9TA 4IRGA 3F72A 3T5XA 2MD5A 1LQ1A 1S8NA 4ESJA 1P4XA 2DPUA 2QENA 5BPDA 3HRSA 3K0LA 1IN5A 4IHSA 2KIUA 3FM3A 4BH9A 1O7FA 1FBUA 5K5QA 2K4JA 5DDGA 3KETA 1ZH5A 2CO5A 3KFWX 1LNWA 2ETHA 2V6CA 1H0MA 2E7XA 3GEZA 3SZPA 3REOA 2IVMA 4WX9A 4KYWA 3EDPA 5CVUA 2EV6A 2HOEA 3RPUA 1D5VA 4BHCA 3LA2A 2LNBA 4YIFA 3F23A 3S2WA 1EH8A 2Z33A 3F21A 2PG4A 4UXNA 4O3MA 1CF7B 1HSJA 3DKWA 1FNNA 4UVCA 1QPMA 3WTVC 1FY7A 1LDJA 2A5YB 1IN8A 2NYXA 3GFMA 4UV8A 1USTA 1UHWA 3ML6A 2IRFG 3L7WA 3GZ5A 1BOAA 2O3FA 5HS8A 2Q2EA 4KN7X 2GXBA 1BM9A 5ED4A 2ESNA 4M9SA 1G6NA 3SQNA 2O8XA 4HF0A 5AIPA 3LQRA 2CQKA 3FMRA 4BHBA 1Z7UA 2Z9OA 5TJJA 2JRTA 3E5UA 1U5TA 3T0YA 2HKXA 1KQ8A 3H3UA 2RQPA 1SD5A 3IWZA 2FBIA 4Y15A 1FZPB 5L3DA 2L02A 2H6CA 3HHHA 4U88A 2XV4S 1T39A 1W5TA 2FF4A 3R0JA 3TOAA 4B8XA 4A0YA 4BHPA 2JPBA 3ECHA 5ICCA 1G3YA 4HDUA 1GVJA 3LFKA 5D5WB 4LLLA
chains in the Genus database with same CATH superfamily
4UCOA 3R0AA 5LD2C 4DL7A 4BJ5C 4BDZA 2N8GA 4L0ZB 4PDKA 4RNMA 2HU9A 2DN0A 3R60A 4B3XA 3DTIA 4J0MA 2FD5A 5FPOA 2UZKA 5LA6F 4O4LF 4Q43A 3KP6A 4PZJA 1G2HA 1GSHA 1T6SA 4PK4A 4DL2A 4KISA 4P5OA 5BS6A 3CDHA 4A3JG 2GAUA 2QQBA 4LLGF 4JI5H 1OLTA 3MVPA 3RFCA 4KUMA 2FQ3A 1H8AC 3DU6A 2DFFA 2O9LA 5FRMA 1Y1WG 1DP7P 4K2EA 2B7EA 2V1UA 3U1KA 1VQOI 3H92A 3WTZA 4I2OA 3GIIA 4MV8A 1W1WE 4A69C 3ETJA 2R3SA 5HDKA 1VBHA 5FROA 3BWGA 1D1CA 4BAYA 3S3MA 1KONA 4JI7H 2LY9A 4UVAA 3WGGA 2ASJA 4I4TF 2HPIA 2A05A 2M4KA 1U9OA 3H5RA 2HGCA 4Y3OA 4B3SH 4KN4X 4MFDA 2JEFA 4EJOA 4UB6C 2QLZA 4JV2A 5FKOA 2LG4A 4GO1A 1IXSB 1HDDC 1JHFA 4MGRA 4AUXA 1KYZA 4D1QA 1ZGAA 4MV7A 2LF8A 1N34H 1GXQA 1FLIA 1EA3A 3PW2A 4ZTJA 3MWEA 3S8PA 2X6WA 4EVIA 4A3MJ 1USSA 4NC8A 1IG7A 4E70A 4O4IF 3QPHA 3J7AO 3IH4A 1XMQH 1HNXH 1W7PA 2V9KA 3A01B 1YS6A 4I98B 2R7TA 1EV7A 5FD6A 2E2HJ 4ZDLA 2JRMA 3G8CA 5DG8A 2VQGA 4LIVA 2JA7J 5KVRA 2L01A 4N0BA 2EA2A 2YRWA 2OQRA 4L0YB 3A4CA 2B63A 3OOPA 4NB5A 3MR5A 1PYVA 1N75A 3G1LA 4GRIA 2BYVE 3ZQFA 3SXYA 2BGCA 2KFDA 2LD5A 1YQAA 4L1KA 1IUFA 2KRFA 2WA0A 3ZQGA 1Z3XA 4XRFA 3GTJJ 2DK5A 3L2VA 1JHHA 1VBGA 5FRNA 5IOYA 3CMYA 2IA1A 3CJTB 1JKOC 5HVQC 4XLCA 4M9XA 4OWRB 4MO7A 4Q8EA 4CSWA 3IH3A 4MLOA 1X2MA 3RF2A 4MFEA 1DUXC 5IT3A 3Q5FA 1ZKGA 1N32H 3F3XA 2O6GE 1DDNA 2CYYA 1E4FT 3QFFA 2ZXJA 3FIWA 2K86A 1MNEA 5LP6F 4BE0A 2OC6A 2H6BA 1KJJA 2DFEA 2XB0X 2VKHA 2P7VB 2V1DA 2F4IA 3EUKL 3F6VA 4RZRA 4DV7H 4O5VA 1WJCA 2TRTA 5DCMB 4B48A 2JQ7A 4RAZA 3L00A 3F22A 3BG5A 1YFHA 2GA2A 3CDIA 4PJNA 3OL3A 3CF5F 1WH5A 1X3UA 1TAEA 1QRYA 5F9NA 4EMSA 3H35A 1A35A 2OH2A 1N78A 3GTLA 4IHYA 3ABLH 2RC4A 2M7BA 2M2EA 2TCTA 3OWTA 1H89C 3GV7B 1NG7A 2ME6A 3RYPA 2IS2A 1QVUA 2QZ8A 4DLKA 5FLMG 3S1MJ 4X1EA 1MKMA 3BG3A 1LE8A 2HDWA 1B8IB 2K7LA 4B09A 4J9KA 2VC0A 5TGTA 5D1OA 2WAQN 3T5LA 2ECCA 4BYYA 3J81Z 2HQNA 1UCRA 1JDEA 1JLLB 1OJLA 1Y8RB 3E0JB 3QAHA 4EM2A 4IKFA 3D5RC 2HTJA 5KFCA 1X1AA 3L2UA 2JA5G 1Y39A 1PK8A 4C3IJ 5K2MA 2YU3A 2EFOA 2R5ZB 2A6HF 2A69F 3ZN1A 3DKYA 4JX5A 2R7ZG 2RDIA 1FKAH 1T56A 3FXLA 3OIQA 1JKQC 1B6SA 1KU9A 3DF7A 1SFOA 4HNTA 1BR2A 2K5CA 2XPUA 3DEWA 4ZJZA 5KFZA 4ME6A 4FISA 1ZELA 1XMKA 2R7UA 4TUYF 4X65H 1DU0A 5FLMJ 4HEA2 1AN7A 3HOYG 2Q1ZB 3RCOA 1REPC 3HGGA 3CCSI 2L7FP 2BE5F 3VDXA 1FJLA 3Q8RB 1GSOA 1KYWA 4R8UA 1I50J 3S15J 2KSWA 4O3PA 3PO2G 5C3EG 3JW4A 1G3SA 2FJ1A 4X62H 1KU2A 1V4RA 3P9CA 3W6KB 1QVTA 4E7SA 4ZH4F 3RIZA 3N44B 4C5BA 1FOXA 3WO0A 2Y0SN 4B43A 2WC2A 2XRNA 2PVPA 1FX7A 1OQYA 2P6SA 4A2UA 3B6AA 4EBEA 2Q2EB 4XM3A 3GCMA 2RDJA 2P5LC 2ID3A 2ZJRF 4EV0A 2EFQA 3H4BA 2XF6A 5CKTA 2LOOA 4BL0B 3CC7I 4OIRF 2MH9A 2DPIA 1P2FA 3DLLF 1IF1A 5KFIA 1WRJA 2FX0A 1QZYA 3Q8QB 2IEKA 1PJRA 1ETQA 3TO6A 2KIMA 2L7ZA 2EPFA 2O0YA 5TRDA 2ACJA 3N42B 5HLIA 1S9HA 2ZNZA 2ZMEB 3GTKA 5M5YJ 2M87A 4IRIA 1TWAJ 5FLXK 1VI0A 1UELB 2K40A 5CAEB 2WAFA 3K4LA 2HJWA 2KDZA 1HKQA 4RAGA 4ENKA 4A5NA 4MV9A 4JV0A 4I01A 1X3ZB 2Z3YA 4Z6YA 4B3TH 3E7LA 2VA3A 2BZTA 1YS7A 3TO7A 5KFHA 3HOVJ 4ECSA 3V8KA 4U7DA 4E7HA 4LF6H 2PEXA 5E17F 3E3VA 1LUJB 1O7LA 2XAQA 1MDMA 5A2QW 1M7JA 1MBJA 3FKIA 1S68A 3J80W 5HOOA 2DIKA 5K5RA 1YJNI 2DT6A 2M4GA 3IRQA 4JV5H 4LFBH 3OL4A 1QHHD 1V5FA 3BAAA 2VJ4A 3GF2A 1QBJA 4XOTA 1T8IA 2R7NA 4BQNA 4K0KH 5HV6A 3A0BC 1CS0A 4KITB 4AWXB 3F8NA 2MA3A 2WB1A 3ABTA 1CF7A 4LB5A 4ON0A 3N97A 4ZYEA 1XDNA 3MWDA 4LFCH 1YJWI 1S03G 1Y1VJ 2IPQX 2WTEA 4PJLA 1B59A 1RUNA 2QF7A 5D6EA 4JX4A 5KFUA 3KPHA 1XX5A 2IS1A 3GIKA 2Z5UA 3M1CA 4XZ3B 1KQ9A 5LBQA 2EZHA 4FS1A 5E79C 1JUPA 3JRDA 1R58A 4C5AA 4DR3H 2MC3A 4FTHA 1VZ0A 2R6FA 3HOYJ 4EBCA 3ZGKA 2HS5A 3OUZA 4DUYH 1STZA 4LOCA 1BI1A 4KIGA 3QPTA 3HG9A 2UVUA 3FX3A 1FC3A 4LK1F 4Q48A 4DW6A 4HPQA 1FBQA 3J80K 1P7IA 4HX4A 2PFBA 4H0EA 3RB6A 4L18B 2FA5A 2ELJA 1XMOH 2MC4A 2R7ZJ 4M6VA 3RB4A 2KISA 5KFLA 4HOBA 1GYFA 1XGMA 1OCCH 3DV8A 1RR7A 3GW2A 3WU2C 1R1UA 3BDDA 1NH3A 4RGXA 2UWMA 4M7EA 5F0HA 3JRGA 3PN1A 2R7OA 4OMZA 2JA5J 4IZOA 3I71A 1WHUA 5IP7G 2LBFA 2FPGB 1KA8A 2CWEA 2PBIA 4ITVA 1PX2A 3KEYA 2OJED 3QP6A 1HLVA 4BUPA 4P9UA 1DGRM 5JLWA 4A3BG 4PFOA 3I4PA 3GZNB 4KHPH 4WXDA 4U87A 3VB2A 3OYGA 3HRUA 5LXTF 4ZYDA 3DU5A 4LG3A 3V42A 5I47A 2YRXA 3BTJA 5FJ8J 1LDKB 1M1EB 2CJJA 2EINH 6PAXA 2W24A 1B72A 4YR3A 4RB0A 4XSXF 1Z21A 3VSLA 2I8CA 2QGUA 5E8GA 4DNCA 5A2QZ 4CO8A 4MA5A 4DL5A 3C3WA 2CUFA 3TDZC 4HW0A 3LSRA 2LMDA 5KFGA 1BNCA 4DUZH 4AU7A 5LGUA 3OYBA 5LGTA 4YELA 3GZ6A 5EEHA 3D1NI 4D0PA 1YIOA 2KKOA 5KG4A 5C44J 4YJ3F 4J9LA 1BOBA 1SANA 4I0BA 2FK2A 3JRXA 1YX3A 4BS9A 4JI6H 5KG7A 2VPRA 3FKJA 4B3RH 4ZOLF 2IAIA 3DBRB 1Z0XA 2IA2A 3I56I 1VQLI 4YQWA 2FLLA 1ZK8A 3LQQA 3BP8A 5KK1A 2WYOA 2VE8A 3OTOH 2MLGA 2XB5A 2DOEA 3BG9A 4CCMA 3ZQLA 4XNFA 3P5JA 4D7MA 4NQWB 1WJDA 2CQXA 3E5XA 2PMZN 3JZIA 2CMPA 4UNOA 3OYHA 1R4MB 2XCAA 4CC6A 2LVSA 3O6BB 3RPQA 3BQ0A 1W5SA 2D45A 1IUYA 1BIAA 3GLXA 2UXCH 1BBYA 1ETXA 1H9GA 2M0CA 1OR7A 3X2QH 4ED0A 2EV5A 2ZJTA 1XG1A 3MD2A 4BQAA 3DXJF 5JVGF 2OQGA 2ZXHA 1E3OC 4II3A 4S04A 4G7HF 3JAMW 1HOMA 5KG0A 3GO5A 4MHGA 1A36A 3GVAA 4WXHA 4RMNA 2XC7A 4N9HA 2XCLA 3LSKA 3VMMA 1MW7A 1T3NA 4UY8I 3MFHA 3LP8A 1HXDA 3QP5A 1NK3P 2PMZA 3QYFA 2IJLA 3C18A 2C35B 1NTCA 4E7LA 4X6AJ 1RETA 1CGPA 2MD0A 1D0YA 2DA7A 2OU2A 3KEQA 3O2PE 2BY1A 3ISPA 3KIOA 3HRMA 1GDTA 3BR0A 3EQLF 2DXIA 1IXCA 1JE8A 4LG0B 4Q44A 3GQCA 4BEHB 1IBLH 1QQIA 3ZN0A 2K3FA 2J5OA 2V26A 3DCFA 4JI1H 2KT0A 1HBXG 2UUZA 2VPLA 4S0HB 5FO5A 4ED7A 3SZTA 5F0CA 1JUMA 4EYIB 4ZYHA 1ZHSA 3QPSA 2R7FA 2BW3B 5KFFA 3J7AK 2QYOA 5CVJA 2PJPA 1FOKA 2NS7A 1LDDA 4RB3C 4QWEA 2RNGA 2BY0A 1XGNA 1Y6IA 3BABA 1TP4A 3RPUD 3RBEA 3NAUA 4C3JJ 4ZTFA 2XASA 4JYAH 3RGZA 2WY8Q 2NU7B 4BWSC 5KHDA 1YJ9I 3CUQB 3KALA 5HDGA 2H8RA 1XDUA 3K7AJ 3I53A 2FJZA 1IO2A 3HIFA 5KFSA 4NNJA 3CD6I 4IL6C 1A04A 3BR3A 2R5YA 1BL0A 2VODA 2NXNB 2QBYA 4WBNF 4ZI7F 2J6UA 2RV8A 3M07A 1T2KA 1S5LC 3BQZA 4ECUA 5E3LA 2PI0A 3Q9VA 2DA5A 4E7IA 1HW5A 3H20A 5EEGA 1FBSA 2QCOA 1FVIA 1X9NA 1LEAA 1DV1A 2R7MA 5LHIA 1E4EB 2C2RA 2C22A 2YZMA 2EILH 3TOBA 3ZMUA 3LAJA 3M8JA 2QK4A 3CLQA 4M72A 3IWFA 1D0XA 2YS9A 1LFPA 2VQLA 3BLYA 2NVYJ 3ONQA 9ANTA 4RB2C 3CDLA 1F4KA 5KG6A 4EFEA 4ANJA 3M7GA 3GYHX 5C4JJ 1AU7A 5LHHA 4XONA 4A3IJ 3Q2OA 1IOWA 1B6RA 5HNFA 3T1YH 2AGOA 1I1GA 1Q1VA 1R23A 3A01A 4R8UB 1XTAA 1TNTA 5KFRA 2EBIA 2HTSA 2IP2A 3GTKJ 5GTHC 4KT5C 2V59A 4ED2A 1TWAA 1L0OC 3BG6A 1RRJA 3RTXA 5EWFA 3HZJA 2HXOA 2E1MB 4XOPA 3WTSC 4ESFA 4U7BA 1O4XA 2XGQA 3GTLJ 5TISC 1LVKA 4M9UA 1TWGA 4O2BF 3E6CC 1ZQ7A 5DLFA 3V7CA 5C1PA 4ED8A 1XGOA 4WXCA 2EV0A 1ENHA 1BR1A 4JI4H 1MBKA 3MR2A 2BBYA 1BJTA 1V3FA 1YW9A 2OTJI 3MQ0A 2Q2UA 5EOYA 2Y31A 1I39A 1R6RA 4B4CA 2PJRA 4ECQA 2BOLA 1R4NB 2GZWA 2L9VA 3ASNH 1O3TA 4JX6A 1JTYA 4GC7A 4JUZA 2RF4A 3RV3A 4LF5H 1AKHA 1XDSA 3V6HA 2F4VH 2VQEH 4XKWA 2QQAA 2JZYA 2CRGA 3UNGC 2J6SA 1XCBA 3F8MA 2VIXA 3CCJI 5C4XG 1P9QC 4AIJA 1Y8QB 2BHZA 4WK8F 4DV6H 2V4RA 3ASOH 3Q0WA 3K70C 1G4DA 2A6EF 2X0LA 3DBHB 3GTQJ 5D5XB 2X4HA 2MGQA 3FHNA 4XKVA 1VAJA 2QYZA 3PW5A 2Z16A 2WAQE 2W70A 4DL3A 5CJ9A 3RB3A 1R5ID 3QWLA 2V9PA 1ONVA 4W1UA 1YTYA 4I7HA 4RNOA 1IRFA 2YPRA 3U1DA 5L3CA 5EGOA 4O3QA 4ENJA 1AHDP 4YR2A 3GWZA 4O2AF 1U5TC 4DOZA 3DBLB 5J40A 2W48A 4EJUA 4RU9A 2ZB9A 3L2CA 3HOZG 4X66H 2BXZA 3CCMI 5EZHA 4CHUA 2KHMA 3ZQHA 4D5FA 3SE7A 1WVRA 1QO0D 3R61A 4MEXF 4AD9A 2COMA 1S97A 5AONA 4OIQF 2MABA 1T38A 3HSRA 5J1UA 3R6SA 1P4WA 2D1VA 2UUBH 4YY3H 1GLVA 5BNGA 1IXRC 2XGXA 1WFXA 2HI3A 5LGNA 2LP0A 2X51A 2FB9A 4DV2H 1V5EA 2O7OA 3V8JA 3RQIA 1FTTA 3BR1A 5E1XA 3WODF 2I10A 1JJ8C 2VOPA 5ICEA 3ABUA 3A02A 3QYEA 4MQVA 4FT8A 2XF7A 2QA4I 3R5FA 3RUPA 3KYLA 1KJ9A 4PWQA 3IHUA 2W57A 4M6YA 2P7CB 3IC7A 5KFPA 3IUOA 4Y8VB 4UHTA 4LSXA 3M4OJ 1YOVB 3Q3SA 1Z7LA 2CQQA 1KU3A 4JV1A 4QIWE 2WE6A 4JYKA 2Y0SA 3QZ7A 1VF9A 2VBWA 2XAJA 5FFXA 4FX4A 2CV0A 5BMVF 3KTMA 5GPAA 5L3EA 2R7KA 1ETWA 3FXRA 3BG7A 1FYMA 3I4MG 3CP8A 1BJZA 2Y69H 1KJ8A 2HDCA 4OX9H 2PLYA 1MDMB 1P7JA 3K10A 2Z2SB 5IYBJ 1XPXA 3S1QJ 2HR3A 3M9MB 2IGKA 4EGZA 3BQ2A 1D3YA 2PJRB 2DA3A 2LBFB 4DR1H 4IJAA 2XF5A 3I59B 1FJGH 5CVIA 1E2XA 3FBIB 4M9ZA 1OPCA 3JRAA 3GTJA 4AQYH 3TINA 2AXTC 2JA7G 3S3NA 2HQAA 3SFIA 4D7NA 3RV4A 1OCZH 1FOWA 4XBFA 3I55I 2MYSA 2AU0A 1VS0A 1PP7U 2BXYA 3LSGA 2KZVA 1XD7A 2LC2A 3IAS2 4IAJA 4IHJF 3TP0A 3PQJA 3HOWG 3IL2A 1S9FA 4ED1A 3M9OB 3PNTA 5EGOB 4FE4A 3HL2A 5HS7A 4HRIA 3KP3A 5H20A 1OKRA 2BV6A 5JUMA 2VI6A 3TP3A 2BHYA 4C3HJ 3PNVA 4DBRA 5E1ZB 5L3FA 3OYMA 2L3DA 2XROA 1E17A 4NBQA 2WAQA 1BC8C 1SVLA 3TKYA 1X1BA 4A3DG 2C2EA 1XMXA 3FMSA 4QJFA 1X1DA 2P5KA 2COBA 3K6GA 1E4GT 1FPQA 1POGA 5B3SH 2BEOA 3S1NJ 2X1CA 3E97A 3D5LA 4ZYGA 2PMUA 5K1YA 1WCMG 2M45A 1HF0A 1F1ZA 4XRSA 3L2QA 2GLOA 2FP4B 2DMNA 2OZUA 2K3PA 2W84A 2R7QA 1Y1VA 2XCPA 2W6QA 2UUCH 2FRHA 1XS9A 1K7AA 3JTHA 2R7SA 1ZREA 2KMUA 4A0XA 4CICA 1C30A 1TWHJ 1RNLA 1Z1DA 2MCTA 2UVRA 2W4SA 2Y0MA 2W8KA 1IC8A 3AFHA 1V55H 2PQ8A 4MV1A 3OV8A 2ZJPF 4EGJA 3HPHA 1TW2A 3CLOA 4BNCA 2KDOA 4AYBE 4GC6A 2VQCA 5IYCJ 1KBLA 3C1DA 5KG5A 2IT0A 3KHLA 1ZG3A 4LF7H 2FEZA 2O8KA 2HDDA 3SDBA 2VUGA 3G6YA 2JT1A 3EPIA 1RR8C 3A1YA 3BC8A 3EPZA 2R93G 2VUMA 1R1TA 3WTUC 5JHUA 1V9PA 2YS6A 1Y1WA 3EPGA 1ZG5A 3K4CA 1IDYA 4G7OF 4AC0A 2EFWA 4ECXA 3OYFA 2ZCWA 2LK2A 4APMA 2PMZE 4B47A 2MW8A 3M9AA 3OYAA 1H9TA 2ZKZA 2DAOA 2VB6A 4JK1X 2HGSA 3ETHA 5LYJF 3TEDA 3ZCOA 4V2FA 4IRHA 4C2MJ 1ZG1A 2QQ9A 3AG2H 3BJOA 3PIOF 2YCHA 3KAJA 1U9NA 1YW8A 3HOVG 1MMAA 3SEZA 5HDNA 2YL2A 1SD7A 3I54A 4LB6B 2P4WA 1RZ4A 2VN2A 3MAJA 4L9VA 3OYLA 1VQ7I 4HF1A 3JRWA 4LH7A 2ZM6H 3BA8A 2UVVA 1TT0A 2XAGA 1I3QA 3NARA 5GP9A 1XSDA 3M8EA 2UXXA 2P81A 2W6NA 4QWBA 3LFKA 2V1NA 5HLTA 1NHAA 2ZSHB 1DGWY 2OPTA 2JUGA 3NWSA 1YHQI 2W6MA 2NVYA 1E3PA 2H1LA 3CQZA 3COAC 4A3EJ 2ZXWH 1PDNC 2DPDA 4HV6A 2CW7A 3BJAA 2D5VA 5KFMA 1Z91A 2XD4A 4M73A 1IBMH 5FJ8G 3GTPA 1DP3A 4MTDA 1ZGWA 4E7ZA 1WR2A 3F8CA 3PJRA 4F7ZA 2LF7A 2VXZA 4C9YA 3H3VK 1TBXA 2ZMEA 3GTMJ 1XSVA 1JKRC 1MMSA 3HB9A 2MG4A 5CYVA 3L1PA 3OUUA 3WTXC 2X1EA 1YO5C 3F8BA 1WJ5A 1S3JA 1TQPA 1UB9A 4GFBA 2BY2A 2W6OA 3U9GA 2L54A 5CVVA 2BVLA 2V79A 2Q8KA 3JSNA 3VSKA 3GTOA 2AHQA 3KLOA 3KE2A 2DCEA 5GAHJ 3T8TA 1APLC 3CUQA 4IVNA 4JI8H 2R5ZA 1P92A 2XSJC 1V5GA 3DPTA 3TDUC 2JEJA 2QWWA 1RKTA 1RJQA 1WCMA 3M3YJ 1B6AA 1ZYRF 2VXDA 4MIMA 4X0GA 2DOFA 1P4AA 2X1DA 4ETSA 3ABKH 2BR0A 4A6DA 3RAQA 4O6JA 2F2EA 4AYBA 2W9BA 1WJBA 2HQRA 5DYMA 3RJPA 4WCGA 1IBKH 3I4NG 4N4OB 2V1XA 4UFZA 1N77A 1LEBA 4NHJA 1DU6A 4LK0F 3MEXA 1S7AA 1TC3C 4Y33A 2LKSA 1JT0A 3VWBA 4MV6A 2HVQA 2KRHA 3V7SA 1FTZA 2XVCA 3H9JA 2KLOA 3WNZA 3C7JA 4LD5A 1WWXA 4RBOA 2M30A 1RK5A 1I6XA 1Z3YA 5FLVA 2YYAA 4J19A 4MAMA 2DBBA 4DYCA 3LL7A 2HZDA 4J9NA 2EK5A 4GXOA 2QKMB 5KFKA 1IRZA 3OR1C 3K4KA 3BA9A 3H36A 5IYZF 4IHVA 5DQIA 1T94A 2R8KA 3H5NA 4XK4A 2UXDH 4A3CG 3KX2A 1W36D 3H0GG 3GUDA 2RNJA 2R84A 3AAFA 5LLQA 1YI2I 1MNMC 1ZETA 2F5DA 1TA8A 4ECZA 4BBRJ 3NGDA 3C2BA 2L4MA 3BCAA 3ORRA 4O3SA 3N05A 2R8IA 2OA4A 2E2HA 1IN4A 1C0WA 3KHHA 3JREA 3SJMA 3K4BA 4XLNF 1IV8A 1BIBA 1VQMI 4XL9A 1TTYA 4G9YA 1TLHB 5KNLA 5JI6A 3BROA 4XLAA 2B0LA 3ZQ7A 3GFJA 1VKZA 4L9TA 1UAAA 3OSNA 2VOBA 3B6CA 2ZMEC 2VQFH 1IZ1A 2IBDA 2L7KA 4EEFG 1HW2A 2FNAA 4FM9A 3PSIA 2R85A 5L1KA 2ZFWA 3DEEA 3DQVC 4A5MA 2R92G 2DDAA 4A3CJ 4XQFA 1K78A 1ZRCA 2CGPA 3BPXA 2DFHA 1B72B 2KRCA 3E5QA 2XHKA 3IP4B 3R4KA 3T1BA 4NDLA 2J9GA 1LFUP 1R9TA 4DL6A 1TW3A 3B02A 2M8EA 5IP7J 3BR6A 2R7WA 3S14J 4Q5SF 5FB2A 2WAEA 2R7LA 1JX4A 3TGNA 1RYSA 4EBDA 2ELKA 3L2WA 1VQNI 1XCVA 2A68F 1BW5A 1K1QA 5CA1F 2XGPA 3KCCA 4XLHA 2Z1DA 1BN5A 1FMWA 2K85A 1GXPA 2NS0A 5DD8A 4RGSA 4L5JA 4HQEA 2CZGA 2RN7A 3N40P 4GDFA 2ZNYA 2OCCH 5ICGA 2HYGD 5IP9J 2H09A 4LG0A 4BQOA 3CCUI 3GXOA 1K6OA 5DM6F 1ZR4A 3I59A 5D4RA 4DBQA 5DM7F 3N4MA 5KFDA 2EIJH 3RJ0A 5D5UB 4EATA 1F43A 2ZJ2A 2RVCA 2Y75A 2BQ3A 4OINF 1SD4A 3PFIA 5IP9G 4JBAA 4V19K 3HKZN 1HR0H 4C5CA 4A3KG 3CUOA 3QRFF 3GTGA 4QPQA 5KT4A 5IP6A 4M3EA 4MV4A 4IRDA 2HHHH 3G73A 3E6DA 3QZ8A 3BPVA 5LRSA 4UUSB 1BGWA 2R82A 1I3AA 3KP7A 1HDPA 2NVUB 3S2DJ 2JVGA 3H4DA 3R5HA 2NU6B 4HG2A 2JSPA 4QWAA 2ID6A 4XRSG 1JGGA 4UUVA 1GLNA 3QPLA 1Z6TA 5M5WJ 1S72I 4J9OA 3FXKA 1I3QJ 5F27A 1W36C 1ZARA 2DQRA 3IH2A 3JAMZ 2BQUA 2D2WA 3EYIA 2R92J 4M3FA 1EKEA 2GXGA 5FFZA 4QWCA 3S32A 3FZVA 3QU6A 4R79A 4RZQA 2STTA 4CXFA 2B63J 2E2IJ 3PQKA 2V9WA 1RC9A 2DQLA 3OS2A 2PN6A 5KT7A 4YBZB 3T5KA 3E6MA 5JLXA 5E18F 4HQMA 5KFWA 3HHGA 5D5VB 4LF4H 5F1RA 5IOZA 1LKXA 1L3LA 2FPPB 4IEJA 1X58A 5IYBG 3LA7A 4BY7G 3CMEI 2J5PA 4Y13A 3PR5B 2G0EA 2YX7A 5ILUA 4PJ0C 1WSCA 2G9WA 3FXOA 1B33N 2R7VA 2IP4A 4FASD 3TQTA 3PZPA 2H94A 3OYIA 2I80A 2FLNA 3KYDB 1G3WA 2KJCA 4KICA 1K61A 4LLNA 4GYGA 1T95A 2W85A 3DPUA 5FKMA 3HOXG 3F9KA 3F8FA 3VPRA 5IY5H 4S05A 4A3LJ 3EUHC 1X4PA 5HLHA 3V4SA 3K69A 4YIIA 3MFKA 4J9MA 3G6VA 4O3NA 3MMYB 2YU9A 1I27A 2ZO4A 1E4EA 2DODA 2QUFA 3RI4A 1IRGA 4YHHH 1ETKA 2KIQA 1I1SA 3CC4I 5D6FA 1XNQH 3ZQQA 1KJIA 3H3VH 1W4MA 3HSEA 3U9TA 1ZGJA 4AYBN 1V51A 3LAPA 3LFUA 1Z2NX 5IT9W 2Y48A 2WBMA 2FNPA 3G6EI 1BC7C 5FKNA 5GPCA 1VQ6I 1S0NA 2PBZA 2P0AA 3ZXSA 4KA4A 1FYKA 4GYIA 1LB2A 3V6JA 1TWFA 1HSTA 1RPWA 1LPQA 3K4JA 5DEQA 1SC7A 1QU3A 3RKYA 3OR2C 1TWFJ 3WTTC 2FPIB 4KJZA 1KEEA 1C3OA 3ERED 4KFCA 2GBYA 1RI7A 1WPKA 4X64H 3ULQB 3AKZA 5A2QK 4UUSA 4G3IA 3BZCA 3W6JB 2GIZA 4BGDA 2HOSA 3FHZA 4HX8A 4FE7A 3KP5A 4EJWA 2E1CA 5F64A 2VJJA 1SEIA 3LA3A 5KFAA 5KFNA 2ALZA 1YE9A 1O3QA 1ZRFA 4Y4RA 1OCPA 2CFXA 2HZTA 3WG9A 2VKEA 3ZMSA 4UCUA 2W9AA 4KIFA 4JI2H 4GKJH 5B5EC 4H4KC 5ICFA 2V58A 4U6PA 3TQNA 5H2FC 4MNUA 3I0TA 4PJMA 3BQ1A 4BKXA 4ED6A 1E3HA 2VPQA 3KHGA 1MBFA 1J2XA 3FM5A 2R87A 1XB4A 2IGNA 3D5SC 4ZDOA 4JI0H 4HX7A 5ILVA 2EB7A 2FE3A 4RLFA 5DV5A 2L0KA 1UC9A 2JA7A 4BJ6C 2OV7A 2CS3A 3G4SI 4C2UA 1CQIB 1AA7A 4PCQA 1T08B 1IAWA 4PSXA 2LRDA 2P8TA 4P55A 5LEKA 1IN6A 2CW8A 4O4HF 3QODA 3K4NA 1A5JA 3PM1A 5E3MA 3LWFA 3GMEA 5JHFA 2E1NA 5F1JA 2FXAA 5EEAA 3JRBA 3C2HA 2VOOA 1FT9A 2UXNA 2Y9YA 3FISA 4LGWA 3L09A 5DUIA 4Z2YA 2QM3A 1W0TA 3M8FA 1DGSA 2E35A 2X6OA 2ATLA 2ECBA 2XDVA 3QU3A 1BI3A 5HLGA 4ESBA 2CQYA 1YW7A 4UCRA 2JA6J 4CDGA 1EUCB 4I50F 1UG0A 2RKHA 3HYIA 1T33A 5F6FA 2JA6A 1GV2A 4BY1G 1G3TA 3VEPA 1SFEA 4DR6H 1EH6A 3CO7C 1MJ9A 3CJNA 1M6VA 1FWZA 3FBNB 4DR4H 5H6RA 2DA2A 2R7DA 1X1PA 3FXUA 1OCRH 1NG6A 2GPWA 3K1MA 2HQ5A 4BY7J 2A07F 1R36A 2MBFA 1MMNA 5D1PA 2AGQA 1JI8A 1GO3E 5DG7A 4RAFA 3FKIG 4DV3H 2JN6A 2W9BB 2NAZA 4CGZA 2R93J 4EQQA 3S17J 4M3BA 1N36H 4KDPA 3A0HC 3FXMA 2DWCA 4ECYA 3GIPA 4O3RA 3HOUG 1ZLJA 2Z99A 3KP4A 4J01A 1PUFA 3BQYA 3FK6A 3A03A 1I7NA 1TT5B 4GLXA 5DCFA 2W7OA 3GTGJ 5KT3A 4XR6A 3CCEI 3HTSB 3ESWB 4A3GJ 4KMUX 1G8XA 5LEJA 4E4TA 4YJ2F 3GTQA 1ODDA 4ENNA 2RAEA 2RQQA 2BVMA 4XORA 3CCVI 2HWVA 4M74A 1YRNA 3I64A 2DO7A 4BDYA 1P6RA 2W6ZA 1KGSA 3RB0A 2JSCA 2R7ZA 2W25A 4A12A 2HYJA 3KP2A 2AXLA 3TIIA 4DV1H 5LMUH 3RYRA 2FOWA 4I55F 1S7OA 3CP2A 4HLYA 2NU9B 2FQ4A 1MMGA 1FSEA 2M34A 3PVXA 4U0WA 2FBHA 4LH6A 1HKTA 2EH3A 4IHWA 2HNHA 4UUTA 1GV5A 2VBZA 5D8LB 5L9XA 3RZOJ 2JA2A 4KIBA 1IRXA 3GFIA 1WH2A 3UR3C 2DI3A 3TL4X 3ZMDA 1B9MA 2R86A 4HAMA 4ZZDA 3ZPLA 4QWDA 3OYCA 5CPRB 3HKZE 1RK6A 3HOWJ 2V4QA 2DT5A 2QSHX 3AL0B 3H3ZA 1ZHFA 2ADUA 3SEQA 2DMQA 3KZZA 1WQ2A 4UCTA 3J7ZI 4ZC3A 2ZJQF 2WV0A 1SD6A 5CVRA 4HSTA 4XKCA 2UVWA 3OIOA 2VQHA 1SFOJ 2F4MB 3FDYA 3WG7H 2LKPA 1MSEC 3ECOA 5CLSA 4NC6A 3KZIC 4CYDA 3MZHA 1ZRDA 3PNYA 3DKXA 4I76A 3ZMVA 4FHTA 1RJRA 5BPFA 3DF8A 4CC5A 4BXUA 1XNRH 5FKKA 1B04A 4BQQA 5HS9A 4LF9H 2HPMA 5EG0A 3SFZA 2JPCA 1Z2PX 1K4SA 1K6YA 3EUAA 4MV3A 2EZIA 1X4OA 2W00A 1VQPI 1Y1VG 2CFOA 4CZZA 1Z67A 3AYHB 4DIQA 1HNZH 2QEXI 2V9VA 3OHAA 3OOUA 1A6IA 4HZFA 4GCVA 4II2A 2HOTA 2DJIA 2DMUA 4YFXF 1OISA 3G1MA 4FU0A 4QW9A 5L1IA 2OZ6A 4ECWA 1U8BA 1ITYA 3GV8B 4RAYA 3J7YJ 3HXLA 2JTVA 2XKPA 1OYIA 5E1WA 2YW2A 3DFGA 4U0VA 3MR6A 2SCUB 2C6YA 4A3EG 2K02A 1KC7A 3JRCA 5KFYA 1WI9A 1UMQA 3NWTA 1M0WA 4E7KA 5IYDJ 1X2NA 1BA5A 3HC7A 4AVPA 4DL4A 4NXNH 1W7PD 2DTZA 3P9IA 4BBSJ 5EZGA 2UU9H 1PUFB 3CC2I 1FIPA 5DD4A 4UVBA 2HXIA 2VL8A 1D0ZA 2DA6A 4EM0B 1EYZA 1V4YA 3R23A 1YIJI 3IKVA 4WD3A 3WHBA 1M0TA 2A3SA 3LMLA 4O3OA 4HA8A 1JGSA 4PJJA 3ORQA 3I3LA 2ASDA 4EGQA 2NVXA 2E5ZA 4M6XA 1J59A 1QA6A 3P9KA 3MKYB 4IHTA 3CCRI 4TQRA 3IRRA 4CYCA 1Q1HA 4LJZF 5K7HA 1FEXA 1VQ5I 2M0MA 4J9SA 3RTRA 2CUEA 4UCSA 1MJBA 4BXFA 3IG0A 3BZKA 1U78A 4XICA 4G6TB 3V4ZA 2XRLA 5BR8H 2HFHA 2CV1A 3U9SA 4G6DA 2AS5F 3QOEA 2DYSH 1RIOH 5KAFC 2UV1A 5C4XJ 2M5WA 3FXQA 4CCNA 1XC5A 3S2HJ 1ETOA 4PGGA 3HDDA 3E5NA 2F5FA 1TQMA 3L2PA 2XAFA 3C2GA 2LKXA 5LL6b 3CJQB 1FYLA 2R7RA 4BXXJ 2FK1A 3N43B 5EZYF 1I5ZA 5EG0B 5D8DA 3KZYA 1SVOA 4FX0A 3E6BA 3JSLA 1N48A 3CQZJ 4I0AA 4XMYA 2K9NA 1TWCJ 4DV4H 2H1KA 4IPAA 3V6KA 5J1YA 2FK3A 3OYDA 3RZDJ 1DPUA 3OYJA 2AGPA 1YYVA 3HGYA 3W2WA 3JRIA 4PSWA 1ON1A 4JOMA 1Z05A 1LJ9A 5J3LA 3JRFA 5DQGA 5J8FA 2K9SA 3VPCA 1HNWH 1MH3A 2CH0A 4A0ZA 5HODA 3BCBA 4KMFA 5BPHA 4OOIA 1QNTA 1K78B 2O03A 4C30A 3EETA 2EIKH 4W97A 3O8GA 1R5HA 2C00A 5JVDF 1J5EH 1DPRA 2DDBA 3G3ZA 2R92A 3D0SA 2E34A 3OIPA 2LDUA 3RSNA 3DTEA 2HEOA 1N56A 4PFPA 4DQ2A 5DS9A 5E3NA 3Q9SA 1ERDA 2KZGA 3HKZA 4OIPF 1J7KA 4LFUA 3VYSB 2VC1A 4G12A 2X9DA 2DOAA 2JWTA 3QOPA 2DYRH 1MJAA 2FOKA 4IR1A 3JSOA 2W82A 4F4YA 3S1RJ 3KEOA 3S93A 1KU7A 4P9FA 3OYEA 2R8HA 2UXBH 4RM2A 2ZBKA 1D5YA 4YG2F 3J81K 4IOAF 2RDPA 3LNQA 4A6EA 4AVZA 4ABZA 2CW0F 5KFBA 4P96A 2E7WA 1S29A 2LR8A 4A3GG 3FWEA 3HOUJ 3H9GA 3RKQA 2Y30A 4MEYF 3I4MJ 4F4WA 3T5JA 4WWCA 2X6YA 5J2UF 1S7EA 4JP0A 4RB1A 1H88C 1AOYA 3GTOJ 4Y7NJ 1SFXA 5CB4F 4R1HA 5GADJ 4IZZA 1O3SA 2B63G 4GGGA 2A61A 2DZDA 3GX4X 1GHCA 1DV2A 3HOXJ 5IWAH 4LIUA 4WF2A 2DT7B 1SAXA 2AQEA 1S0OA 2ISZA 3HTUA 4F93B 4Q0YA 4PDBA 2ICWG 1WZ2A 1OYWA 3DWLE 5EYRA 1BXRA 2PX9A 4J9PA 3J80Z 1Y0NA 4ZZLA 2WB1N 2EA4A 3V8LA 4MA0A 2F5CA 3K1NA 3K3VA 4N4NB 4TV8F 5H6QA 5LHGA 1J9IA 3F0CA 1TQIA 3PFYA 1O3RA 1HCRA 3GFLA 1PP8F 2WDTA 2HKOA 4J9RA 3L2RA 1CQJB 1K79A 1J09A 3LOCA 5KG1A 1PUEE 3AG1H 4RGRA 2FMAA 1U2WA 3OSFA 1ZQ3P 4DGWB 4OMYA 3ABMH 5J4VA 4E7JA 2OD5A 5KX5F 2Y9ZA 2VT2A 3MN2A 2KQRA 2GOMA 5BPIA 2NOGA 1JIHA 4YB8B 4A2AA 3OYNA 3H9QA 1BJAA 1EJ9A 1JDBB 4F52A 4R8HA 3QYBA 4NC7A 1OYYA 2WY7Q 3LSJA 1K83A 4IR9A 2M3AA 3IN5A 3U2RA 1X1CA 3VYRB 1JT6A 3JTGA 5KT2A 4BXXG 5CQGA 2WWYA 3HOTA 2VJIA 2B9SA 3UQ8A 3LSPA 4BU2A 2K4BA 5DGBA 4HNUA 3L9FA 3ZOBA 5BQTA 5B1BH 1W0UA 2C28A 3I5UA 4FS2A 2JUCA 3RKWA 1U5TB 1ZHQA 3PW0A 4G6QA 4HLXA 4QWQA 3GV5B 3G1OA 2NU8B 2FSWA 5DLGA 2EJRA 3RKXA 4NLGA 3QQAA 4OIOF 1UHMA 4OAYA 2PN1A 1FP1D 3K70D 2L4AA 2M9HA 1JKPC 1B4AA 3WGHA 3CJRB 2CV2A 4RUAA 1I50A 1Y56A 2X6XA 1O75A 2OUMA 1B8IA 4EJTA 5ERIA 5FLXZ 3VPBA 3WO1A 2YZNA 5J6XA 1J0RA 5HBRB 3K1PA 2OWOA 1R5GA 2KIFA 1JXSA 5ILSA 4EM1A 1G59A 4AIHA 3MZYA 2FBKA 1ON2A 2CU7A 3CUQC 2P6TA 2NVQJ 4YIRX 2R4GA 5GAEJ 4OU0A 1O57A 2GOXB 4BBSG 4ECTA 1VNDA 3HBLA 1SAUA 5J4YA 3DLAA 3T1HH 2UUAH 3PW7A 1ZAOA 2ZDQA 2GXAA 1BI2A 1VQ8I 4G94A 2OF7A 3FKIJ 4L5IA 3PL8A 2XKOA 5CA0F 3DP7A 3NRVA 4CA0A 4M3GA 4MQ9F 3MJFA 3WTYC 1YRNB 3S3OA 2Q2TA 1T36A 1YLFA 2MFZA 2AQ4A 4QIWN 4A3LG 2EQRA 1Z77A 2L9SA 2NVTJ 3BT9A 3I58A 3GILA 4E4HA 3JRHA 3VODA 3H0DA 2VT3A 4CZCA 1E0EA 4Y17A 4ZYAA 5F0FA 3NEUA 4CCJA 4I99C 2YS7A 3ZRGA 4XLPF 1X3WB 4ASNA 4AM3A 2ESHA 5E20A 4BJTA 1EUDB 2ME0A 2ZSIB 3O8HA 4EGYA 5IYCG 3H5AA 1EHIA 5L3BA 2FMYA 3FXJA 1AWCA 2BQRA 2NS8A 5FPRA 4IWYA 3OY9A 1J75A 1IGNA 3HSFA 4HDVA 4LF8H 1GVDA 5C3EJ 2GA1A 1RESA 3M1EA 2QBYB 2CUZA 2XC9A 2OAZA 1WJAA 2TDXA 1CE8A 3CO6C 3GIJA 5JVLA 4C2MA 5K7FA 2XAUA 3LSTA 4ZDPA 1L2ZA 1ZLKA 2QSFX 3MCZA 1JUSA 4IOCF 4AIKA 1WGXA 2R7XA 5EWEA 3PO2J 1LE8B 4G7ZF 4Y52J 2NVXJ 2LSOA 2I87A 2OBPA 4ENMA 4PGHA 4V2GA 1N25A 5DUKA 2XAHA 3HUGA 2IMWP 5L3GA 1SMTA 3HRTA 4IHXA 1KZHA 2VONA 4A3BJ 2H27A 4NXMH 2YSRA 3DEUA 4A3DJ 1QZEA 4L9NA 3CCLI 2VBXA 1SEUA 2V6EA 2XPVA 4M71A 4YRVA 1ZR2A 3G6XA 3B73A 2E2IA 2LLKA 4EG0A 3RBDA 1I94H 1EH7A 2GWRA 3KYCB 5BOXA 2F48A 2NOJB 5KFQA 4BEHA 3EUHA 2XGDA 3JR9A 4DYRA 1UC8A 2AQFA 5KT5A 5D8KB 4Q4ZF 3PUFA 5LOVF 2MLKA 3ELKA 3GTMA 3KLNA 4CH7A 1HW1A 3FF5A 1VFCA 3SDGA 1YITI 4A3KJ 2XSDC 2G7HA 2NRAC 4N9IA 3CF2A 3ZP5A 4HYEA 1MNDA 1IW7F 3DPLC 5KT6A 3WHCA 2WTFA 5K7ZA 4BACA 5JR3A 1U6GA 3F6OA 1HA8A 1EZ1A 1A31A 2J6TA 3LSHA 2FMLA 5F08A 3FMAA 1TWCA 3GLKA 4XYLB 2ELHA 1PVEA 4QSHA 3VYUB 2NNYA 2DMTA 3JCUC 3GIMA 3K2ZA 1ACIA 1QGPA 4YAJB 1D8KA 2I8DA 1TZLA 3VFZA 5EF6A 3HOSA 4MTEA 4FBTA 2G7UA 3CTAA 4EYHB 2L9RA 3CVZA 1UZCA 1R71A 1HC8A 4R7RA 1BI0A 5GTIC 2JMWA 2QQ8A 2M05A 4Q8FA 4A3JJ 5C1OA 4IXAA 1RYRA 1UJ8A 2M1BA 1VTNC 1WI3A 1HKSA 5KAIC 3AG4H 1Y0UA 5KG2A 3ZMTA 2DTRA 2EIMH 3KXYT 1MZBA 2QKLB 1TNSA 4LITA 1X19A 2E1MC 3OS0A 1W7PB 3PR4A 1DQUA 2D1HA 2VJ5A 2DK8A 3H1CA 2YX4A 3P7NA 5LRRA 4YFKF 5EDNA 1D1BA 1SFUA 1OCOH 4KNYA 3GTPJ 4BE1A 2VLAA 2IW5A 4L9JA 1HQCA 1ORKA 5CQEA 1SFKA 4JI3H 1WKMA 5KFXA 2FLPA 1R7JA 2IA0A 3ZQIA 1D1AA 3WE2A 2GIVA 2O61A 1XSXA 4JQFA 1UHSA 3TQ1A 5IT9K 4DR5H 3UFXB 3ZR8X 2RGRA 1SCUB 4E6KG 1UFMA 1VQ4I 2VQDA 1F9NA 1MBHA 1YG2A 3FK7A 2DLNA 1K83J 2PMHA 4HR7A 1F36A 2HYFA 4G8XA 4RGUA 2IGOA 4UCVA 3H0GA 2H8WA 1BR4A 1RKWA 1Z9CA 2HOAA 3H0GJ 3OSGA 1ZN2A 5B66C 3LMMA 2XUBA 3K2AA 1R22A 1I6HJ 2DW4A 1B1BA 1GGOA 2K9LA 4BBRG 3MFIA 1IJWC 4TV7A 5JFRA 1VQ9I 2K9MA 3WU1B 4DZPA 3J7AY 1T98A 2DA1A 2L9NA 1J5YA 3CCQI 3PUBA 4YFNF 4B3MH 4FQGA 3UKGA 3O3KA 3N6XA 2M8GX 1MD0A 2VASA 4A93G 5C5JA 5F9LA 1QZZA 2E19A 4HQ6A 1XMAA 1R49A 3I4NJ 1R00A 1B9NA 2LREA 4C2TA 4YEJA 3PO3G 4P1WA 2F4OB 2DA4A 3G2BA 2NNNA 4QIWA 1WJFA 1FP2A 3WTWC 4ECRA 3BZ6A 2NUAB 4B1RA 5E8IA 4QW8A 4M3DA 5L1JA 3N41B 3FDSA 3OS1A 4U7CA 3RDIA 3V7RA 4Q47A 2W9CB 1U3EM 3JSPA 5IT9Z 2IXSA 5GAGJ 1R1VA 1XN7A 3PSFA 2IS6A 1MBGA 2KP6A 1A9XA 2W7PA 4RS8A 2EFPA 2V4JC 3V4GA 2EFNA 3WU0A 3I12A 3OSPA 1U0JA 5FGMA 5KG3A 2DFIA 2VR1A 5IPAA 2HVRA 2CKZB 3MR3A 1S0MA 1I6UA 5M3MJ 1JXLA 5T14A 3IKTA 1VQKI 2BW3A 5M3FJ 1QPIA 3GIQA 5D1OB 3IV5A 4LMYA 3SYTA 4DR7H 3MKLA 1EF4A 1IN7A 2DLLA 2WADA 2FUG2 2ASLA 1P8LA 3HM5A 4F3QA 1ULYA 3RQ4A 3T8RA 3BR5A 5J8CA 1T0FA 1XGSA 3BJ6A 2F6CA 3NQOA 1WJEA 2I5UA 5KKNB 2K27A 3LSMA 1WH7A 3TBIA 4IF4A 2A5WA 2RGVA 4BY1J 4L5EA 3C0FB 1TWGJ 2DJNA 4UB8C 5BMZA 2VBYA 5JH7F 5DGAA 5D4SA 2R5YB 2DU9A 2M7AA 2L5QA 3ZMZA 2R8JA 3JAMK 2QVOA 2JA5A 3GIDA 2KJBA 2YR2A 4XYMB 4I02A 5EWGA 2L2OA 1RUOA 2EWNA 1IV6A 3VOEA 5JVTA 5DCMA 1FSHA 2Q0OA 3K5HA 3TO9A 2ISYA 5IYDG 5C44G 2FU4A 2MH2A 4HV5A 5K5OA 5EJCA 1KQ0A 2LTPA 4NQWA 4DJAA 4XSZF 1ETVA 4FETA 3PW4A 4I09A 3KHRA 4CYCB 4A3FJ 2R8GA 5FD5A 2F5VA 2VUMG 2R93A 2YZGA 1LVAA 3I9V2 3W2VA 5KFTA 3ROUA 3VYTB 1Z6RA 4F92B 4U0YA 1OR7C 4DR2H 3SI8A 4YAKB 1FOYA 3MWMA 2JK3A 3RIRA 3W3CA 2E5NA 2JEIA 3BOQA 2K9QA 1YX5A 1D8JA 4B3AA 1JTXA 2JJ7A 3SHFA 2V5AA 2CUJA 5DQHA 3WGIA 2GQQA 3DTKA 1U8RA 4F4XA 2ZFUA 2W6PA 4XKBA 2CSOA 1WSUA 2YU9J 3WE3A 2F5EA 4EJVA 4YP3A 1OMIA 5J1RA 2JA8J 2LY1A 2IGMA 3FMQA 1SVMA 4HF2A 4HBLA 3BY6A 4UV9A 2BY3A 1MSFC 2IA6A 1F5TA 2CG4A 4QLCU 2IS4A 1S6LA 4I6ZA 1MGTA 3GBGA 3M4IA 2EZKA 3S16J 2VE9A 2XIGA 5GONF 4RUCA 2P5VA 4RLQA 5AIQA 3MKZA 3EYYA 4IQ4A 4EEYA 4A3MG 4EEQA 2STWA 3Q0VA 4LSAA 1KJQA 2OCEA 2VKVA 1A0IA 1SMYF 3K9TA 2LY2A 1WCMJ 2VPSA 4IRGA 3F72A 2V7FA 3T5XA 5LFAA 2C2DA 3H40A 3IAM2 4Q45A 2W7NA 2MD5A 1LQ1A 1S8NA 4ESJA 1P4XA 4J00A 2DPUA 4A93J 5LMNH 2QENA 4QTRA 5BPDA 4XLEA 3Q1KA 2EZLA 3R5XA 1JKJB 3HRSA 1LFBA 5KFOA 2W1OA 3K0LA 2JEGA 2VUMJ 1IN5A 4D5CA 1OCTC 3HUGB 4IHSA 2VKDA 4A3FG 2LH9A 2KIUA 3FM3A 4BH9A 1CQTA 2FKLA 1O7FA 1Y1WJ 2CQ7A 5KFVA 3GLLA 3HJEA 1FBUA 4TQSA 5K5QA 2K4JA 2ZDGA 2W9CA 3U21A 3CESA 1W96A 5DDGA 4XRMA 3A2KA 3RGXA 3KETA 5F04A 1ZH5A 2CO5A 4IX7A 1TL8A 3OYKA 3KFWX 5JQWA 4TV9F 1LNWA 1TWHA 3Q0UA 2ETHA 4FCYA 5B1AH 1MBEA 2L7MP 2V6CA 4LFAH 2X85A 4DZJA 1GT0C 4D9JA 1H0MA 2E7XA 3GEZA 1MH4A 3SZPA 2JVHA 2ZDHA 1DIKA 3REOA 5L1LA 3LWBA 2KPMA 5KCMA 1GUUA 2IVMA 3BTCA 4NUBA 4IO9F 4WX9A 4KYWA 3EDPA 5CVUA 3BTIA 4F50A 1AUXA 2EV6A 3K3PA 5FKLA 5J2TF 3CMMA 2P0WA 2HOEA 3RPUA 2XGEA 4IRKA 1D5VA 4BHCA 4CCLA 4CCOA 3LA2A 2LNBA 2GPSA 4RA2A 4YIFA 3F23A 3S2WA 1EH8A 2IBKA 3Q8PB 3BR2A 2Z33A 4HNVA 1NK2P 2HVSA 3VPDA 2YUSA 2E2JJ 4F55A 3F21A 2JA6G 5J47A 1ETYA 3ZQCA 2Y0SE 2PG4A 4UXNA 1R9TJ 5M5XJ 4O3MA 2XPWA 5FLXW 1CF7B 3Q8SB 2E71A 1N33H 1MMDA 4IRCA 2GM4A 3LSIA 1HSJA 3DKWA 4XIDA 3K4MA 2Y2ZA 1FNNA 3G71I 3HOZJ 2WV1A 1Y14B 2OLSA 4RDUA 4QPOA 3PIPF 1K1SA 1I7LA 2XGCA 2ZC2A 1AUVA 2CQNA 3E1SA 4UVCA 2R0QC 2DPJA 4BE2A 1QPMA 3WTVC 1FY7A 1LDJA 2A5YB 3MZ8A 3SZGA 1AKHB 2RREA 4IWXA 1A6QA 4DV0H 3W2AA 1IN8A 2NYXA 2JA8G 3GFMA 4UV8A 3AL0C 1USTA 1UHWA 1IOVA 1ZTRA 2MSYA 2AO9A 3ML6A 4B44A 2IRFG 5H80A 2W8LA 1MIJA 3L7WA 3GZ5A 1BOAA 3OMYA 2O3FA 1OWTA 3PO3J 5E3OA 5HS8A 4XX0B 2Q2EA 2E5LH 4RNNA 4KN7X 2GXBA 3M9NB 2KL4A 4F91B 5EDWA 2VA2A 2DMPA 3OHBA 3HEFA 3CMAI 3J81W 1FIAA 4DYQA 2GLTA 1BM9A 5ED4A 2ESNA 4M9SA 1UNNC 1G6NA 3SQNA 2E60A 4AIDA 4RM3A 1QHGA 1S10A 1W5CC 2O8XA 2OTLI 5KFEA 3T5HA 4HF0A 5AIPA 4ECVA 3LQRA 2CQKA 3FMRA 4BHBA 3AG3H 3L4KA 2E1OA 1Z7UA 4HSRA 3MKWB 3W6VA 4FBUA 4CUGA 2Z9OA 1GSAA 2LYCA 3TW7A 4DV5H 5TJJA 4ED3A 1ULZA 2JRTA 2X48A 2ZXIA 4J9QA 2O5RA 3E5UA 4IQJA 1SYXB 1U5TA 3T0YA 1W93A 2HKXA 3KAKA 3BJYA 1T0FC 2W71A 3N8DA 5C8YF 3TMOA 3H3UA 1KQ8A 1K4TA 5HNHA 3CZ6A 2RQPA 1SD5A 3IWZA 2FBIA 4PUSA 4Y15A 4YR0A 1RJPA 1FZPB 4XN0A 4OAZA 5L3DA 2L02A 2H6CA 3HHHA 4CCKA 2WB1E 2A6TA 2QSGX 4U88A 1Z2OX 2X0SA 2XV4S 4XN3A 1UG2A 2LFBA 5DG9A 1T39A 2E36A 1W5TA 4A3IG 4EFBA 2FF4A 4ZHQF 4ZQIA 3TIGA 1JJ6C 3R0JA 4A2BA 4GKKH 3ERMA 3TOAA 3L4JA 4XLFA 4B8XA 4F4ZA 3RAXA 1FMVA 3BTLA 4A0YA 4BHPA 3K5IA 1OFCX 2JPBA 3ECHA 1G3YA 4KT6A 3TW6A 1BW6A 5DTDA 5ICCA 3CCYA 4HDUA 1IDZA 1GVJA 1V54H 5KFJA 3HPGA 5D5WB 4HYKA 4LLLA
chains in the Genus database with same CATH topology
4UCOA 3R0AA 4L0ZB 4PDKA 3R60A 4J0MA 5FPOA 2UZKA 3KP6A 4PZJA 1T6SA 4P5OA 5BS6A 3CDHA 2GAUA 2QQBA 4LLGF 4JI5H 4KUMA 2FQ3A 1DP7P 4K2EA 2V1UA 4I2OA 3H92A 3WTZA 2R3SA 5HDKA 3BWGA 4BAYA 4JI7H 4UVAA 3WGGA 4B3SH 2HGCA 4KN4X 4EJOA 2QLZA 4GO1A 1IXSB 1JHFA 4MGRA 1KYZA 4MV7A 1ZGAA 2LF8A 1N34H 1GXQA 1FLIA 4EVIA 1USSA 4E70A 3QPHA 3J7AO 1XMQH 1HNXH 1W7PA 1YS6A 4I98B 1EV7A 5FD6A 5KVRA 2L01A 4N0BA 2EA2A 2OQRA 4L0YB 3OOPA 4NB5A 2BYVE 3SXYA 2BGCA 1YQAA 2KRFA 4XRFA 2DK5A 1JHHA 2IA1A 5HVQC 4M9XA 3RF2A 1DUXC 5IT3A 3Q5FA 1N32H 3F3XA 2O6GE 1DDNA 2CYYA 1E4FT 2ZXJA 2K86A 2H6BA 2P7VB 2V1DA 4DV7H 3F6VA 4O5VA 5DCMB 4RAZA 3L00A 3F22A 1YFHA 2GA2A 1X3UA 1TAEA 4EMSA 2RC4A 3RYPA 2QZ8A 1MKMA 2K7LA 4B09A 2VC0A 5D1OA 4BYYA 3J81Z 2HQNA 1UCRA 3QAHA 4EM2A 2HTJA 2YU3A 2EFOA 2A6HF 2A69F 3ZN1A 1FKAH 3DF7A 1KU9A 1XMKA 4X65H 1AN7A 1REPC 2BE5F 1KYWA 2KSWA 3JW4A 1G3SA 4X62H 1KU2A 4ZH4F 1V4RA 3P9CA 3W6KB 3RIZA 3N44B 2WC2A 2XRNA 1FX7A 2P6SA 4A2UA 2P5LC 4EV0A 2EFQA 4OIRF 2MH9A 1P2FA 1IF1A 1WRJA 1QZYA 3TO6A 2KIMA 2O0YA 5TRDA 2ACJA 3N42B 5HLIA 2ZNZA 2ZMEB 4IRIA 2M87A 5FLXK 1HKQA 4ENKA 4A5NA 4MV9A 4I01A 2Z3YA 4B3TH 1YS7A 3TO7A 3V8KA 4U7DA 4LF6H 2PEXA 5E17F 3E3VA 1O7LA 2XAQA 1MDMA 5A2QW 1S68A 3J80W 5HOOA 5K5RA 3IRQA 4JV5H 4LFBH 3BAAA 3GF2A 1QBJA 4K0KH 4AWXB 3F8NA 2MA3A 3ABTA 1CF7A 4LB5A 4ON0A 3N97A 4ZYEA 1XDNA 4LFCH 1S03G 2IPQX 2WTEA 1RUNA 1B59A 5D6EA 2Z5UA 1KQ9A 5LBQA 1R58A 4DR3H 2MC3A 2HS5A 4DUYH 1STZA 1BI1A 4KIGA 3QPTA 3FX3A 1FC3A 4LK1F 4Q48A 1FBQA 3J80K 4HX4A 2PFBA 4H0EA 4L18B 2FA5A 1XMOH 4HOBA 1GYFA 1XGMA 3DV8A 3GW2A 1R1UA 3BDDA 4RGXA 2UWMA 4M7EA 3PN1A 4OMZA 3I71A 1KA8A 2CWEA 2PBIA 3QP6A 4P9UA 3I4PA 4KHPH 4WXDA 3VB2A 3HRUA 4ZYDA 6PAXA 1LDKB 2W24A 4RB0A 4XSXF 4DNCA 5E8GA 5A2QZ 4CO8A 3C3WA 3TDZC 4HW0A 4DUZH 5LGUA 5LGTA 3GZ6A 5EEHA 4D0PA 1YIOA 2KKOA 4I0BA 4JI6H 4B3RH 2IA2A 3LQQA 3BP8A 5KK1A 2WYOA 2VE8A 3OTOH 2MLGA 3E5XA 4UNOA 4CC6A 3RPQA 3O6BB 1W5SA 2D45A 1IUYA 1BIAA 3GLXA 2UXCH 1BBYA 1H9GA 1OR7A 2EV5A 2ZJTA 4BQAA 3DXJF 2OQGA 4G7HF 4S04A 3JAMW 3GO5A 4MHGA 3GVAA 4WXHA 4N9HA 1HXDA 3QP5A 2IJLA 3C18A 1CGPA 3KEQA 3O2PE 2OU2A 3ISPA 3HRMA 3EQLF 1IXCA 1JE8A 4LG0B 1IBLH 1QQIA 3ZN0A 2J5OA 4JI1H 1HBXG 5FO5A 3SZTA 4ZYHA 1ZHSA 2R7FA 3J7AK 2QYOA 5CVJA 2PJPA 1FOKA 1LDDA 4RB3C 1XGNA 3BABA 2XASA 4JYAH 3RGZA 4BWSC 3CUQB 3KALA 5HDGA 1XDUA 3I53A 3HIFA 1A04A 2VODA 2QBYA 2RV8A 1T2KA 2PI0A 3Q9VA 3H20A 1HW5A 5EEGA 1FBSA 1FVIA 1X9NA 1LEAA 5LHIA 3TOBA 3LAJA 3ZMUA 4M72A 3IWFA 4RB2C 1F4KA 4EFEA 3M7GA 3GYHX 5LHHA 3T1YH 1I1GA 1R23A 1TNTA 2HTSA 2IP2A 4KT5C 1L0OC 3RTXA 3WTSC 4ESFA 4U7BA 3E6CC 3V7CA 1XGOA 4WXCA 2EV0A 4JI4H 2BBYA 1BJTA 1V3FA 1YW9A 3MQ0A 2Q2UA 5EOYA 2GZWA 1O3TA 4LF5H 1XDSA 2F4VH 2VQEH 2QQAA 2JZYA 1XCBA 3F8MA 4AIJA 4WK8F 4DV6H 1G4DA 2A6EF 2X0LA 5D5XB 2X4HA 5CJ9A 1ONVA 1YTYA 4I7HA 1IRFA 2YPRA 3U1DA 5L3CA 4ENJA 3GWZA 1U5TC 4EJUA 3L2CA 4X66H 4CHUA 1QO0D 3R61A 4MEXF 4AD9A 2COMA 5AONA 4OIQF 1T38A 3HSRA 3R6SA 2UUBH 1P4WA 2D1VA 4YY3H 1IXRC 2XGXA 5LGNA 4DV2H 3V8JA 5E1XA 3WODF 2VOPA 5ICEA 3ABUA 4MQVA 4FT8A 3IHUA 2W57A 4M6YA 2P7CB 3IC7A 4UHTA 4LSXA 1KU3A 2WE6A 2VBWA 2XAJA 5FFXA 4FX4A 5L3EA 3FXRA 1FYMA 2HDCA 4OX9H 2PLYA 1MDMB 2HR3A 4EGZA 1D3YA 4DR1H 4IJAA 1FJGH 3I59B 5CVIA 1E2XA 4M9ZA 1OPCA 4AQYH 4XBFA 1VS0A 1PP7U 1XD7A 4IAJA 3PQJA 3IL2A 5HS7A 3KP3A 5H20A 1OKRA 2BV6A 5E1ZB 5L3FA 2L3DA 2XROA 1E17A 1BC8C 3TKYA 3FMSA 2P5KA 1E4GT 1FPQA 2BEOA 3E97A 3D5LA 4ZYGA 2PMUA 5K1YA 2M45A 1F1ZA 2OZUA 2W84A 2UUCH 2FRHA 1K7AA 3JTHA 1ZREA 4CICA 4A0XA 1Z1DA 1RNLA 2MCTA 2Y0MA 2PQ8A 3OV8A 1TW2A 3CLOA 4BNCA 3C1DA 2IT0A 1ZG3A 4LF7H 2FEZA 2VUGA 2JT1A 1R1TA 3WTUC 5JHUA 1V9PA 1ZG5A 4G7OF 2EFWA 2ZCWA 4APMA 3M9AA 1H9TA 2ZKZA 2DAOA 4JK1X 2HGSA 2YCHA 4IRHA 1ZG1A 3KAJA 2QQ9A 3BJOA 1YW8A 5HDNA 1SD7A 3I54A 4LB6B 2P4WA 1RZ4A 2VN2A 3MAJA 4L9VA 4HF1A 4LH7A 2ZM6H 3BA8A 2XAGA 1XSDA 3M8EA 2UXXA 1NHAA 3COAC 1PDNC 2DPDA 4HV6A 2CW7A 3BJAA 1Z91A 1IBMH 4M73A 4MTDA 3F8CA 4F7ZA 2LF7A 2VXZA 1TBXA 2ZMEA 1XSVA 5CYVA 3WTXC 1YO5C 3F8BA 1S3JA 1TQPA 1UB9A 3U9GA 2L54A 5CVVA 2V79A 2Q8KA 3JSNA 3KLOA 3KE2A 3T8TA 4JI8H 3CUQA 4IVNA 1P92A 3DPTA 3TDUC 2QWWA 1B6AA 1ZYRF 1P4AA 4ETSA 4A6DA 4O6JA 2F2EA 2HQRA 5DYMA 3RJPA 4WCGA 1IBKH 2V1XA 4UFZA 1LEBA 4NHJA 4LK0F 3MEXA 1S7AA 2HVQA 3V7SA 2XVCA 3C7JA 4LD5A 1WWXA 2M30A 1I6XA 2DBBA 2EK5A 4GXOA 3BA9A 2UXDH 3GUDA 2RNJA 3AAFA 5LLQA 2F5DA 1TA8A 2L4MA 2OA4A 1IN4A 1C0WA 4XLNF 1BIBA 1TTYA 4G9YA 1TLHB 5JI6A 3BROA 2B0LA 3ZQ7A 3GFJA 4L9TA 2VOBA 2VQFH 1IZ1A 4FM9A 1HW2A 2FNAA 2ZFWA 4A5MA 3DQVC 1K78A 1ZRCA 2CGPA 3BPXA 3E5QA 2XHKA 3R4KA 3T1BA 1TW3A 3B02A 2M8EA 4Q5SF 5FB2A 3TGNA 1XCVA 2A68F 3KCCA 1BN5A 1GXPA 2NS0A 5DD8A 4RGSA 4L5JA 4HQEA 2RN7A 3N40P 2ZNYA 5ICGA 2HYGD 2H09A 4LG0A 3GXOA 1K6OA 3I59A 5D4RA 3N4MA 3RJ0A 5D5UB 2ZJ2A 2RVCA 2Y75A 4OINF 1SD4A 3PFIA 4JBAA 1HR0H 3CUOA 3QRFF 2HHHH 3G73A 3E6DA 3BPVA 5LRSA 1BGWA 3KP7A 4UUVA 1Z6TA 1ZARA 2DQRA 3JAMZ 2D2WA 3EYIA 2GXGA 5FFZA 3FZVA 3QU6A 4R79A 4RZQA 2STTA 4CXFA 3PQKA 2DQLA 2PN6A 3E6MA 5E18F 4HQMA 3HHGA 5D5VB 4LF4H 5F1RA 1L3LA 3LA7A 2J5PA 4Y13A 2YX7A 5ILUA 2G9WA 2H94A 4KICA 1G3WA 2KJCA 4LLNA 4GYGA 2W85A 3F8FA 4S05A 5HLHA 3K69A 4YIIA 3MFKA 1I27A 2ZO4A 2QUFA 3RI4A 1IRGA 4YHHH 1I1SA 5D6FA 1XNQH 1W4MA 3HSEA 1ZGJA 3LAPA 1Z2NX 5IT9W 2Y48A 2FNPA 1BC7C 4KA4A 1FYKA 4GYIA 1LB2A 1HSTA 5DEQA 3RKYA 3WTTC 3ERED 4KFCA 1RI7A 4X64H 3ULQB 5A2QK 3W6JB 3FHZA 4HX8A 3KP5A 4EJWA 2E1CA 5F64A 1SEIA 3LA3A 1O3QA 1ZRFA 2CFXA 2HZTA 3WG9A 3ZMSA 4UCUA 4KIFA 4JI2H 4GKJH 5ICFA 3TQNA 4MNUA 3I0TA 1J2XA 3FM5A 1XB4A 4JI0H 4HX7A 5ILVA 2EB7A 2FE3A 5DV5A 4PCQA 1IAWA 2P8TA 4P55A 5LEKA 1IN6A 2CW8A 3LWFA 2E1NA 2FXAA 2VOOA 1FT9A 2UXNA 4LGWA 3L09A 5DUIA 4Z2YA 2QM3A 1DGSA 3M8FA 3QU3A 5HLGA 1BI3A 4ESBA 1YW7A 4UCRA 4CDGA 2RKHA 3HYIA 5F6FA 1G3TA 3VEPA 1SFEA 4DR6H 1EH6A 3CO7C 1MJ9A 3CJNA 1FWZA 4DR4H 5H6RA 2R7DA 3FXUA 3K1MA 2A07F 1R36A 2MBFA 5D1PA 4DV3H 2NAZA 4CGZA 1N36H 4EQQA 4KDPA 1ZLJA 2Z99A 3KP4A 4GLXA 5DCFA 3HTSB 4KMUX 5LEJA 1ODDA 4ENNA 2HWVA 4M74A 3I64A 2DO7A 1P6RA 1KGSA 2JSCA 2W25A 4A12A 3KP2A 2AXLA 4DV1H 5LMUH 3RYRA 1S7OA 4HLYA 1FSEA 4U0WA 2FBHA 4LH6A 1HKTA 2VBZA 5D8LB 4KIBA 3GFIA 1WH2A 2DI3A 3ZMDA 1B9MA 4HAMA 4ZZDA 3ZPLA 2DT5A 3H3ZA