4RAZA

Crystal structure of magnetospirillum gryphiswaldense msr-1 holo-fur
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4razA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4razA02
3V7CA 2WC2A 2DTRA 3E5QA 1BJAA 5ERIA 1P6RA 2LDUA 1Z9CA 1UB9A 3KP7A 4PGHA 4EMSA 4XSZF 4AIHA 2GWRA 4Z2YA 2HKOA 1IN7A 5FLXZ 3SQNA 3QU6A 1E17A 2O03A 1XSVA 2OQRA 3WE3A 3IKTA 4I2OA 3BOQA 1LEAA 3U2RA 3SZTA 3T8TA 4NQWA 1ZLKA 4I01A 3LQQA 2PBIA 3QP6A 4A5NA 2EJRA 2M1BA 2VBYA 3T0YA 1K78A 4Y17A 3VEPA 1U5TC 2UXXA 4M9XA 5E20A 1YS6A 4BHCA 2LSOA 2FU4A 2IA0A 3K1NA 1JHFA 2VC0A 4A0ZA 2L4AA 2RNJA 4JQFA 4YIIA 3JAMZ 2P6SA 4A5MA 4ZYHA 3DEUA 2HEOA 1YS7A 2AS5F 4ZZDA 1U2WA 4O6JA 1TNTA 1BIAA 1HQCA 3VOEA 3ROUA 1YFHA 4RGUA 4LGWA 2STWA 2V1XA 1XGNA 3F8NA 2GA2A 1BIBA 4KT5C 4ZZLA 1ZRFA 4EV0A 4Q4ZF 2KIUA 3MEXA 5LEJA 1R58A 1FOKA 2COMA 3CJNA 2FBKA 4EJOA 2M45A 3TQNA 3RKXA 5DCMA 2L4MA 5CVVA 1QPMA 2GIVA 5DD8A 3V8JA 1EV7A 2P6TA 2DLLA 4CDGA 1G3TA 5DDGA 2FQ3A 3GZ6A 4EVIA 2CO5A 1DDNA 2HS5A 3J80Z 3E6MA 2A68F 1U78A 4S04A 5LGTA 3ZMVA 3IKVA 1JGSA 4AD9A 1SFUA 4HBLA 3L2CA 4O3MA 3GF2A 1T0FA 1ZH5A 4UV9A 3V7RA 1ULYA 1S3JA 5J6XA 5LHHA 3QOPA 1G6NA 3GW2A 4UNOA 3KP6A 4TV7A 3K2ZA 2VE8A 3V8KA 1XCBA 2JSCA 3MZHA 4G94A 3FF5A 3EDPA 2EB7A 3L09A 2ZJ2A 3F8FA 4P5OA 3M7GA 5DD4A 5BQTA 4S05A 1ON2A 3LAJA 2DFIA 1XDSA 4KYWA 1ZN2A 4ENMA 2L01A 5H6RA 3RKWA 5L3FA 1Y0UA 3QPHA 1BN5A 4A6EA 2F5EA 5BPDA 2EV6A 2A07F 2FRHA 1K78B 4BNCA 3MAJA 4RGSA 1MDMA 3AAFA 2RDPA 2VBWA 3HRTA 1YG2A 5E1XA 4ETSA 4WX9A 3HRUA 2ZNZA 3ZP5A 3FM3A 3E6DA 1B6AA 1TNSA 1FSEA 5D5UB 2QBYA 3ZMZA 5D5VB 1TBXA 1TW2A 5LRSA 3FM5A 1DP7P 4KDPA 1B1BA 2M30A 1D8KA 2ZMEA 2ISZA 4UV8A 1QO0D 2A6EF 3CTAA 1P4XA 4B09A 3D0SA 1STZA 1H9GA 3GWZA 3SFZA 2YU3A 4BHBA 4HDUA 2PFBA 3ABTA 3IHUA 1FYLA 5CLSA 1R7JA 2NS0A 1FP2A 2XKOA 1LNWA 2XUBA 2DBBA 2CQKA 1FPQA 3GFJA 3DXJF 1SD7A 3F21A 2DPUA 3S2WA 1IN5A 3IWZA 3FWEA 2VC1A 3HSFA 3F22A 1R00A 5EEGA 3KZZA 4ZYDA 3I59B 2V79A 4H0EA 2K4BA 1NHAA 4JBAA 1W7PA 4WXHA 1IUYA 3WGHA 3K9TA 1MKMA 2FNAA 3F6OA 1S7OA 3QRFF 4ESBA 4XBFA 4HOBA 4N0BA 2A61A 2HTSA 1TTYA 2VONA 1FT9A 4L0YB 1AOYA 4OMYA 3E6BA 3ZPLA 2XAHA 4HF0A 3R61A 3F3XA 1R1VA 4NB5A 2PJPA 4OINF 3P9IA 4ESFA 2FXAA 1XD7A 3SZPA 3RI4A 3F72A 1O3QA 5HLGA 2HQRA 2H6CA 1SD6A 3GZ5A 3NQOA 2VE9A 4PDKA 3R60A 1O3SA 4R79A 3BP8A 2XAJA 4UUVA 1FBUA 4PGGA 2IRFG 5D6EA 3LWFA 4CZZA 2F5CA 2O6GE 3CLOA 1ZGAA 2BYVE 4JK1X 2H6BA 3I71A 4UVCA 2OAZA 2NNYA 2FOKA 2IA1A 2DI3A 4I7HA 4F7ZA 5D4RA 1EH8A 4PZJA 2QBYB 2OBPA 3MCZA 2NRAC 1CF7A 1PDNC 4HZFA 2BBYA 3FXRA 5E1WA 2EV5A 4WWCA 2ZMEB 4A0XA 2ZKZA 3CUOA 4MGRA 1S8NA 1FYMA 4U7BA 4RB2C 2Y0MA 1I5ZA 4EJVA 1H9TA 5HLIA 2HOEA 3GFLA 1OYIA 1IAWA 3BPVA 4XLPF 1LDKB 2PI0A 4IRIA 3C3WA 3I58A 1K6OA 2MLGA 1ZREA 4CGZA 4IHTA 1W5TA 4LD5A 2UWMA 3GUDA 3WGGA 4EJWA 4EGYA 1IRGA 4UVBA 2HR3A 4Y15A 4MQVA 2FEZA 1O7FA 4RB1A 3ERED 4AIKA 4OOIA 3FZVA 3M8EA 2Y75A 3WTUC 5LGUA 2H94A 1W5SA 3HOSA 2GQQA 2R7DA 2PG4A 4M72A 1KYZA 3PQJA 1HKSA 5AIQA 1YW7A 4IXAA 4U0WA 2OU2A 1DPUA 2WWYA 1LDJA 5ED4A 3V8LA 3ZMTA 2YX4A 4DNCA 3CDHA 3L9FA 1EH6A 1VTNC 1YLFA 5BOXA 2OZ6A 1K7AA 2BE5F 2V6CA 4HA8A 3ZMSA 3C1DA 3K1PA 3CO7C 2MA3A 5BS6A 1H0MA 3HIFA 2ZCWA 2FF4A 4Y13A 2P8TA 5ILUA 1UCRA 2H09A 3J81K 3F8CA 3VB2A 3QU3A 3EUHA 4ESJA 5JI6A 4I09A 5LHIA 1BI0A 2EA2A 5F64A 2G9WA 4I0AA 1CF7B 2DQRA 3E5XA 2M8EA 3NEUA 2UXNA 3IC7A 2L54A 3B73A 2ISYA 4RAZA 1XSXA 1BI2A 4HLXA 3WTTC 3RYPA 2KJBA 2C6YA 5TJJA 1UFMA 1MJBA 4LB6B 1XCVA 4MTDA 3WGIA 2QM3A 1LEBA 2V1UA 1HW5A 2JRTA 3L7WA 5DCFA 3TGNA 3I54A 4G7HF 3VFZA 4N9IA 2KJCA 4M71A 1Z7UA 5FD6A 3TOAA 2XAFA 5ICFA 1PP7U 2O0YA 1MJ9A 2DT5A 1ZGJA 2DU9A 1USTA 2GXGA 4G9YA 3P7NA 3HHGA 5D6FA 3I5UA 2FNPA 3TDZC 2VODA 2EFQA 2YSRA 5HS8A 1GVJA 4ENJA 3KZYA 5K5OA 1F1ZA 4IJAA 2IT0A 5HDGA 2ELHA 1J75A 2ACJA 1MZBA 2XASA 3B02A 4RGRA 2F2EA 1LJ9A 5FB2A 5KVRA 2QQBA 4KMFA 5K5RA 2FE3A 5DYMA 3ECHA 4HF2A 2B0LA 3MWMA 2BGCA 2D45A 5JR3A 1TQMA 3ULQB 2KKOA 2QZ8A 2XAGA 1W4MA 4YFXF 2Z5UA 2A69F 2BV6A 4LK1F 2IJLA 1LVAA 3HTSB 2DAOA 1PP8F 5IT9K 5HS9A 1OR7A 3I59A 5F1RA 1XGMA 3DPLC 3C18A 4D0PA 3KEQA 1R36A 1J59A 5HVQC 4IRHA 5CYVA 3M9AA 4G6DA 1FBQA 1QNTA 5FGMA 3ZMUA 3WTWC 1SD5A 3KP5A 1R23A 2VN2A 2JPCA 3HRSA 2MLKA 3HOTA 4M74A 4ZYEA 1FZPB 1XMKA 4GYIA 2KIMA 3HYIA 1ODDA 3F23A 2FA5A 2XHKA 2E1CA 4YIFA 2EA4A 1R1TA 3DPTA 3DFGA 2DQLA 4KN4X 4OMZA 2AXLA 5CVUA 2JZYA 4HX8A 3MZYA 2RKHA 2ADUA 4LJZF 5JFRA 1G4DA 4HF1A 1T2KA 3NRVA 3K0LA 4HAMA 2F5FA 1FLIA 2QUFA 4RAYA 1FSHA 5A2QK 1P4WA 2HWVA 1G3YA 4P9FA 1T39A 1S7AA 5JHUA 1SFEA 3SXYA 1CGPA 1OYYA 1QBJA 5ICEA 4HW0A 3V4GA 3HUGA 4A2UA 5D8KB 3DKWA 1DUXC 4KNYA 3P9CA 4ON0A 1A04A 2R7FA 3BJOA 4BHPA 3W6KB 2EFWA 5DV5A 4IRGA 4P96A 4KIBA 1HW1A 1ZRCA 1JXSA 2D1VA 1BI3A 4FT8A 4BH9A 3KP4A 1Z05A 1WRJA 1AWCA 4L5JA 3SHFA 1YW9A 4L9TA 2JTVA 2P5KA 5L3CA 5CJ9A 5AONA 1WSUA 2QWWA 3WTYC 1OYWA 2EFNA 2CWEA 2E1NA 5H6QA 1SFXA 3ZN1A 4G6QA 2Q0OA 4PCQA 4IVNA 4MHGA 2ZO4A 3J81Z 3RIRA 1B9MA 2DPDA 4WK8F 1JHHA 1KU3A 3CUQA 5DUKA 1YQAA 4IF4A 4U0VA 2GAUA 1KU2A 4GGGA 4O5VA 1S6LA 5D5WB 1FY7A 3COAC 3ELKA 3JTGA 4BAYA 4EM2A 2H27A 3TOBA 4BQAA 2P7CB 1T98A 4E70A 3KFWX 5E17F 3Q9SA 3MQ0A 1QZZA 4ASNA 1QGPA 3FMSA 2DK5A 4GYGA 1O7LA 3WU0A 1XGOA 3O3KA 3H3ZA 2ZXJA 1RIOH 4L9JA 3Q5FA 2DW4A 3KLNA 3FHZA 1WI9A 1XGSA 2PMUA 3KE2A 5LEKA 3QPTA 1V3FA 4R1HA 3KETA 4L0ZB 3L00A 5J8CA 5E8IA 3J80K 3IL2A 5HLHA 2VOPA 3WODF 1C0WA 1FNNA 1GXPA 4M6YA 3M8FA 2MH2A 3TKYA 4CYDA 2W84A 5ICCA 2GXBA 1MJAA 3RTRA 4WXCA 5DEQA 5L3BA 1RI7A 2Z33A 1J5YA 2MH9A 2FMLA 2X0LA 4OIOF 2CFXA 4A6DA 3N97A 2J5OA 2CW0F 4G8XA 3MFKA 1USSA 1TLHB 2Q2EA 4YG2F 5DUIA 4G7ZF 3H3UA 2EFPA 6PAXA 4Q47A 2QVOA 2XVCA 1XDUA 3V7SA 4CO8A 1KA8A 2HKXA 3LSTA 1ZG3A 4OIPF 4HLYA 3JTHA 3IRRA 2HYGD 1F4KA 1XB4A 4HX4A 2ETHA 3KCCA 3R6SA 1WWXA 4AVPA 4GCVA 2DO7A 4Q48A 4OIQF 4EGZA 3OV8A 3E97A 3CUQB 3EYYA 3TO9A 1OMIA 3T5XA 4DQ2A 3R4KA 2M5WA 2Z99A 4IHSA 4HV5A 3BJAA 2LNBA 2JPBA 2EFOA 2K7LA 2TDXA 3Q9VA 1O3TA 3PFIA 2PEXA 4BXUA 3LA3A 1IXRC 4UHTA 4LLLA 2QLZA 2HFHA 4OIRF 1UHMA 2FMYA 2W25A 3IRQA 3R0JA 5L3DA 1V4RA 1IN8A 4UVAA 5FD5A 1U6GA 2A3SA 3WTXC 3TDUC 3I53A 2E7XA 1SMTA 4LK0F 1R5HA 1R1UA 4WXDA 4YFKF 3REOA 2ZNYA 3HSEA 4M6XA 5A2QZ 4HDVA 5HDKA 1ONVA 2VBXA 1ZHFA 3F8BA 3KP3A 5LLQA 3ML6A 5ILVA 2ESNA 2GA1A 1KU9A 1G3SA 1D5VA 3OOPA 4QLCU 1YYVA 4Q5SF 1R5GA 2LKPA 2OZUA 1IXSB 3K69A 1ZG5A 1F5TA 3GEZA 5CVRA 3C7JA 3G73A 1WKMA 3H92A 1DPRA 2P4WA 1MD0A 2CGPA 3ZQ7A 2WV0A 1ZRDA 1O57A 2P7VB 4EM0B 5HS7A 1TQPA 1YW8A 5D5XB 2ZBKA 4MEYF 2YR2A 3G3ZA 1ZLJA 1B59A 3JW4A 4MEXF 1U5TB 4HQEA 1IF1A 5D8LB 3E3VA 2QENA 1B9NA 1IXCA 3QP5A 2ZFWA 1J9IA 2GZWA 3W6JB 3EETA 3RDIA 2L02A 3FXUA 1LDDA 2K27A 5D4SA 3RPQA 4GXOA 4GO1A 1TQIA 2IA2A 1BC7C 3WE2A 2XROA 3GVAA 4I0BA 3E6CC 3KEOA 2IPQX 2G7HA 4A0YA 1XN7A 4I98B 1RUOA 4A12A 2FBHA 2OA4A 2IP2A 1T6SA 3IWFA 3WU1B 4UXNA 1QQIA 5FO5A 1D8JA 1TW3A 2FBIA 1HKTA 4WCGA 1PUEE 1FBSA 3FMRA 4FX4A 3J7AO 4EM1A 3RJPA 4CHUA 2JT1A 2VXZA 1P4AA 3LA7A 4ENKA 5KK1A 4K2EA 3ABUA 1D3YA 1ZG1A 4G7OF 3M1EA 3KP2A 2M87A 5HOOA 3ISPA 2RQPA 2EK5A 4B8XA 3E5UA 1J7KA 4AWXB 1ZYRF 2PLYA 2NNNA 4U7DA 3FXQA 4EQQA 1LB2A 3HRMA 5ICGA 1HSTA 1Z1DA 5AIPA 4KA4A 2MD5A 1QZYA 3DV8A 3ZMDA 2VT2A 3CO6C 1HBXG 3DF8A 3WTSC 3LAPA 3RKYA 1WQ2A 2HTJA 2EWNA 2K02A 3I0TA 1YIOA 1FWZA 2D2WA 3U1DA 4KIFA 1ON1A 1O3RA 3F8MA 1KQ0A 1LQ1A 1F9NA 3GX4X 4U88A 1Z91A 4LG0A 1E2XA 4LMYA 5E8GA 3VODA 2WTEA 3JSPA 3BY6A 5FFXA 1YO5C 2HQNA 1BM9A 1RUNA 1JE8A 2NYXA 1I6XA 2RN7A 2O61A 2X4HA 1T38A 3FMQA 2XRNA 4KICA 5E18F 2Q8KA 3BZ6A 2STTA 2HZTA 3WG9A 3EYIA 5FLXK 4XLNF 5BMZA 3DP7A 5L3GA 1KQ8A 1REPC 4P55A 4ZYGA 4RB3C 1FC3A 3U9GA 5L3EA 3BWGA 2ESHA 4RGXA 4L5IA 2NAZA 1BOAA 2L3DA 3RYRA 5E1ZB 5LBQA 4MQ9F 1IRFA 5IT3A 2KRFA 4RS8A 4CXFA 2QYOA 2A6HF 5K1YA 2VBZA 1P92A 2QQ9A 2EV0A 5DCMB 1X3UA 3LA2A 2CG4A 3O6BB 3PQKA 3HHHA 3BJ6A 1GXQA 3BDDA 1HXDA 1FYKA 3JAMK 3GLXA 1KU7A 3T8RA 3DQVC 4ENNA 2VOOA 2RC4A 1HW2A 1KYWA 2BEOA 4FHTA 2CYYA 5LHGA 2XGXA 2CSOA 1OPCA 4YFNF 3I4PA 4KFCA 4NHJA 3QAHA 3GXOA 3GYHX 3GO5A 2MBFA 2HGCA 5J8FA 3WTVC 2OD5A 3GFIA 2LF8A 3N4MA 2OQGA 4L9NA 1IN6A 3WTZA 1UHWA 2O8XA 1Q1HA 2XIGA 1S29A 4M9SA 2PQ8A 2O3FA 4ZH4F 1G3WA 5JVTA 4WF2A 2G7UA 5TRDA 4LG0B 1KQ9A 2XAQA 4U0YA 5ILSA 2DK8A 5F6FA 1HSJA 4AIJA 2KIFA 4HYEA 4KIGA 3HTUA 4P9UA 1SMYF 2Z9OA 2VT3A 3JSOA 1BC8C 1W7PD 1Z6RA 1MDMB 1HKQA 3KLOA 2K86A 1ZARA 2YPRA 2K4JA 1SAXA 4MNUA 4HV6A 2UZKA 3F6VA 1Z6TA 1K79A 3EQLF 1OKRA 4N9HA 1EH7A 1MGTA 3HSRA 5BPIA 1L3LA 4OU0A 1XMAA 5FFZA 2MC3A 5CVJA 1KGSA 2A5YB 2V9VA 4LLGF 3P9KA 3GFMA 4MTEA 3O2PE 5HDNA 4XRFA 1SD4A 4XSXF 4L18B 2W85A 2IW5A 4M73A 1U3EM 3LFKA 2Y48A 1B4AA 2PN6A 2F5DA 3T1BA 4I02A 1YTYA 1U5TA 2W57A 4HX7A 1FP1D 4KMUX 2R3SA 1L0OC 4IPAA 1IW7F 2HYFA 3TO7A 3ECOA 1FX7A 5IT9Z 2QQAA 3D5LA 1IN4A 1R22A 2P5VA 4EJTA 1RNLA 1I1GA 4LLNA 2IVMA 3BPXA 4HQMA 2HDCA 4FX0A 1W7PB 2P5LC 3I64A 2E7WA 3R0AA 1IZ1A 1ZAOA 2W24A 2RVCA 1P2FA 3RPUA 3CUQC 3ZN0A 4L9VA 1BBYA 5EEHA 2V1DA 4R8HA 2RGVA 4EJUA 4LFUA 2PMHA 3FX3A 1U8RA 1XSDA 1J2XA 1J0RA 5H20A 2RV8A 5LGNA 4QWQA 2XV4S 1I1SA 4LB5A 2Z3YA 4KUMA 2LF7A 5K5QA 5CVIA 4CICA 3LQRA 3BROA 4M9ZA 3TO6A 1GHCA 3K1MA 4RB0A 2XKPA 4KN7X 5LRRA 2J5PA 2YX7A 1I27A 2D1HA 1BI1A 1RZ4A 4BYYA 2FSWA
chains in the Genus database with same CATH superfamily
2MD0A 3V7CA 4C2MA 2N8GA 2WC2A 4DIQA 5EZGA 4EBDA 2DTRA 3E5QA 1BJAA 5ERIA 1P6RA 4BXXG 1I6UA 2LDUA 1Z9CA 2IMWP 1JUMA 5KFFA 2VKHA 3JRAA 1UB9A 3MKLA 1APLC 2KMUA 2R8HA 3KP7A 2W6ZA 2V1NA 4QIWE 4PGHA 4EMSA 3M3YJ 4XSZF 1GDTA 4AIHA 5C4JJ 2BW3B 2GWRA 4Z2YA 1GLNA 1SVMA 3DEEA 2JN6A 3TQTA 3HM5A 2E2HJ 2KIQA 2RQQA 2HKOA 3VPBA 1X9NA 1IN7A 1E3PA 1SVLA 3GIMA 2OTLI 5FPRA 3E7LA 5FLXZ 3S1MJ 3SQNA 3QU6A 1E17A 1MH3A 4E7LA 2AGOA 5KT7A 4XLEA 4DBRA 5KFZA 5EG0B 2O03A 1XSVA 2OQRA 3WE3A 3IKTA 2PMZN 4I2OA 2JA5J 3OS0A 3ZRGA 3BOQA 4FETA 1LEAA 1OCCH 4EATA 1AN7A 3HOWJ 4B3AA 4LFCH 3U2RA 2UVUA 2R93A 1G2HA 4ECVA 3SZTA 1GUUA 3T8TA 1LE8A 5KFOA 3CMAI 2CV2A 4NQWA 2ZJQF 3ZQHA 3W2AA 1ZLKA 2BY2A 4I01A 3LQQA 3LSHA 3GIJA 3RAQA 2PBIA 3Q8PB 3QP6A 4A5NA 4XQFA 5KFLA 4FBTA 4CYCA 2CU7A 1LPQA 3S1NJ 2EJRA 3S17J 2V4JC 3MFHA 3FXMA 2M1BA 1WJ5A 2VBYA 3T0YA 4DV1H 2K9LA 1K78A 4Y17A 2R7ZG 1Y6IA 3H35A 3VEPA 4DV2H 1U5TC 1RJRA 3H0GJ 3LSPA 3I56I 5DTDA 3GV7B 1DGRM 2UXXA 2JEJA 4M9XA 4CCMA 5E20A 1JKRC 2X6OA 1YS6A 2BXZA 5L1JA 3RBDA 1Y56A 2IBDA 4BHCA 2LSOA 2FU4A 2IA0A 3K1NA 3M4IA 4JYAH 1ETVA 1JHFA 2VC0A 4J9RA 4A0ZA 2L4AA 2RNJA 4JQFA 4S0HB 4YIIA 4TV8F 4YIRX 3BG9A 5KKNB 4NXNH 3JAMZ 3BQ0A 1S9FA 2UUAH 2W8LA 4D5CA 2P6SA 1VQPI 4DR7H 3JSLA 4A5MA 4ED0A 2HOTA 4ZYHA 5DG8A 3DEUA 2HEOA 2R8GA 3R5FA 5KX5F 1RC9A 4Q0YA 3K10A 4PK4A 2OWOA 2JA6J 1YS7A 2AS5F 4ZZDA 1U2WA 1IJWC 4O6JA 1TNTA 4EBEA 4AIDA 1BIAA 1HQCA 4N4OB 3VOEA 4M3BA 5L9XA 4Y3OA 3ROUA 3ABLH 5JVLA 1YFHA 4RGUA 4LGWA 4EEFG 3LSMA 5DM7F 3RKQA 2YRWA 2R7TA 3E5NA 2STWA 5DG7A 2V1XA 1XGNA 3F8NA 4FS2A 2GA2A 3FBNB 2R8KA 1RJQA 1BIBA 4KT5C 1OJLA 2VXDA 4ZZLA 2LLKA 1ZRFA 4EV0A 1IRZA 1TWAJ 4Q4ZF 1Y1VG 2ZB9A 2YYAA 4A3KG 5B1BH 3L4JA 3ESWB 2KIUA 3MEXA 1FJLA 3LFUA 1ACIA 2R7SA 2VQCA 5LEJA 1R58A 4BEHA 1FOKA 4EFEA 2COMA 1UG0A 3CJNA 2WAFA 2NS8A 2FBKA 2XPVA 4EJOA 2JUCA 2XC7A 4M3EA 4Q8FA 3VYTB 1KJJA 2M45A 3K4BA 3TQNA 1Z3YA 1BGWA 3RKXA 5DCMA 3HG9A 1I6HJ 2L4MA 5CVVA 4E7ZA 4FM9A 1QPMA 4RZQA 3G2BA 1S0OA 2GIVA 2M2EA 4LF7H 5DD8A 5LL6b 3V8JA 1EV7A 3PJRA 2P6TA 4A2AA 3T5KA 2DLLA 3H1CA 2YL2A 4CDGA 3ERMA 1G3TA 5DDGA 2FQ3A 3KXYT 3GZ6A 4EVIA 2CO5A 1DDNA 2HS5A 3J80Z 3E6MA 2A68F 1WPKA 2EPFA 5KFRA 3LOCA 3TIIA 1U78A 4ECRA 3T1HH 4FASD 4MA5A 4S04A 5LGTA 4PUSA 3ZMVA 4JV1A 1JUSA 1ETKA 2TRTA 3IKVA 4XZ3B 1JGSA 3ZOBA 2VQGA 1RR7A 2IP4A 4G6TB 4IX7A 3FK6A 3QYEA 2C22A 2LFBA 4AD9A 1SFUA 1M0WA 4HBLA 3L2CA 4O3MA 3GF2A 1T0FA 1ZH5A 1TP4A 2LY2A 2IEKA 2L9VA 3KEYA 4UV9A 3BG3A 5LFAA 3V7RA 1YRNA 1ULYA 1S3JA 5J6XA 3CMYA 4QWBA 4B3RH 3H9JA 5LHHA 2DA2A 3U9TA 3QOPA 1G6NA 4ED1A 3BA9A 3GW2A 4UNOA 3KP6A 4TV7A 3K2ZA 1H88C 2VE8A 1W5CC 1LUJB 1AUXA 1POGA 3V8KA 4C5AA 1DU0A 3HOVG 1XCBA 5DS9A 2JSCA 3CCEI 3KYDB 2XRLA 4G94A 3MZHA 1WH7A 2FJ1A 2DMUA 3FF5A 4QW8A 4UUSA 2BXYA 4DUZH 1MBKA 3EDPA 1OLTA 5C44G 4XN0A 2EB7A 4BE0A 2W1OA 3L09A 5J47A 1WJDA 2L2OA 2ZJ2A 3F8FA 4P5OA 2YRXA 3M7GA 5DD4A 5BQTA 4S05A 3B6CA 1ON2A 1TWCJ 1T94A 3K3VA 3LAJA 2DFIA 2WB1A 5DQGA 1XDSA 5HV6A 3KHLA 4KYWA 1ZN2A 5EF6A 1NTCA 5KFYA 1K83A 4KHPH 4ENMA 2L01A 3PNVA 1LE8B 2NVYJ 3EPZA 5DQIA 2DZDA 4LF5H 3LSJA 3F9KA 4JI8H 5H6RA 4NQWB 2EINH 3JRWA 3RKWA 5L3FA 3X2QH 4BBRG 4IO9F 1Y0UA 3QPHA 1BN5A 4A6EA 1VQ7I 2F5EA 4CYCB 5BPDA 3GTOA 2EV6A 4A3JJ 4A3GG 3BLYA 2A07F 2FRHA 1K78B 4BNCA 3MR2A 4F92B 5K7HA 3MAJA 4RGSA 4RBOA 3PUFA 1MDMA 3AAFA 2EILH 1B8IA 4QWAA 3V6KA 2RDPA 1WHUA 1GSHA 2IBKA 1WCMG 1JGGA 2BY1A 4XORA 2VBWA 3HRTA 2M05A 4MV6A 1YG2A 5E1XA 4LH7A 4ETSA 3HOYG 3AYHB 4WX9A 3HRUA 2PVPA 2ZNZA 2BOLA 2BQUA 5B3SH 3ZP5A 4EFBA 3FM3A 3E6DA 4UB6C 2ZJPF 4DZJA 1B6AA 4EEQA 1TNSA 1FSEA 1X2MA 1BJTA 1BA5A 5D5UB 4O4IF 2QBYA 2ZXIA 3M8JA 3ZMZA 5D5VB 4ECZA 5KFMA 2HDDA 1TBXA 1TW2A 5LRSA 1IOWA 3FM5A 1DP7P 3FXLA 4KDPA 4IL6C 1B1BA 2NVUB 2M30A 2R5YA 5K2MA 4F4XA 2JA5A 1D8KA 2FX0A 4BGDA 4AU7A 2ZMEA 3DWLE 2ISZA 1QA6A 3KIOA 1I7NA 1MNMC 4UV8A 1QO0D 5I47A 3HOUG 2RF4A 4MV7A 2COBA 2A6EF 2M0MA 3CTAA 1P4XA 2CRGA 4NUBA 4JX5A 4B09A 3D0SA 1STZA 1H9GA 1GO3E 2R87A 1HOMA 3NGDA 3GWZA 3SFZA 2YU3A 2Y0SA 3V6HA 1D1AA 4AM3A 2VPSA 3BA8A 2B63G 4Y7NJ 4BHBA 4IQJA 1I50A 4A3BG 2L9NA 4YR2A 4HDUA 2PFBA 4IEJA 3ABTA 3IHUA 5IWAH 1FYLA 5CLSA 4CUGA 4QWCA 2ME6A 4QIWN 5M5WJ 1K61A 1E3HA 2XPWA 5LMUH 1R7JA 2NS0A 4BEHB 4LH6A 3PVXA 1FP2A 3C2HA 3T1YH 4DR2H 1SFOJ 3OYEA 5C1OA 2BVLA 2XKOA 4I55F 2XGPA 4Q8EA 2FPGB 3H0GA 2CW8A 2LH9A 4BBSG 1IDZA 5D1OB 1LNWA 2XUBA 2XCLA 3S1QJ 2R5ZB 2VUMJ 2DBBA 4HRIA 4BY7G 1GV2A 2CQKA 3CC7I 4JV2A 1JT0A 1FPQA 2LMDA 2KLOA 3GFJA 1PUFA 1BW5A 2GPWA 3UFXB 2H8RA 1N25A 1WR2A 3DXJF 2R7ZJ 4A3FG 3CP8A 5D1PA 4XRSG 1FTZA 4DYRA 4I76A 3G4SI 1SD7A 4H4KC 3F21A 2DPUA 3S2WA 3RB4A 4RAGA 1A6IA 1N56A 1IN5A 3IWZA 3FWEA 2VC1A 3GBGA 1Z7LA 4BQOA 3HSFA 2FB9A 3F22A 1R00A 2L7MP 5EEGA 2DLNA 3KZZA 3QYBA 2JA6A 4ZYDA 3I59B 2V79A 4H0EA 2K4BA 1QHHD 5DLFA 1NHAA 4JBAA 1TL8A 4LF9H 2DMNA 1W7PA 3BR3A 1RESA 2HGSA 4XM3A 4WXHA 2JEGA 1IUYA 2W6PA 3KALA 3WGHA 1EA3A 1MKMA 2LVSA 2G0EA 2FNAA 3K9TA 3JZIA 3F6OA 4NBQA 5LP6F 4ED2A 4DLKA 1S7OA 2UV1A 4J9KA 3QRFF 3VWBA 4R8UA 3QZ8A 2JVGA 3I4NG 5BR8H 4ESBA 2DDAA 2KHMA 2KZGA 4XBFA 1FIPA 2OPTA 2ZJTA 5CA0F 4HOBA 4N0BA 4HNTA 1GYFA 5KT4A 2VQLA 4F3QA 1Q1VA 3I4MG 2A61A 4PWQA 3MR3A 4ITVA 2HTSA 2DA7A 1TTYA 1T0FC 4DYCA 1WJCA 2VONA 5KFTA 4C2MJ 3CC2I 4R7RA 1FT9A 4L0YB 1AOYA 3PW5A 4UUSB 1JTXA 4OMYA 3E6BA 3ZPLA 2XAHA 4HF0A 3R61A 3F3XA 2JA7A 2KL4A 1R1VA 4MO7A 4NB5A 3TQ1A 2PJPA 4OINF 3PFYA 3P9IA 3H0DA 3DBRB 4ESFA 3P5JA 3PO3J 2FXAA 1XD7A 3SZPA 3RI4A 3F72A 2KPMA 4MFEA 1O3QA 2PMZA 5HLGA 2W6OA 3Q8RB 2HQRA 5F0CA 2IGNA 1OCZH 2W48A 2GOMA 2H6CA 4NLGA 2DDBA 4JI2H 1SD6A 2BR0A 2WV1A 3GZ5A 2EZKA 2YW2A 4ED8A 4DR5H 3NQOA 3PUBA 5EDNA 4HEA2 1S68A 4IHJF 4MV9A 3RB0A 2VE9A 4PDKA 3R60A 2RDIA 1O3SA 4R79A 2I10A 3BP8A 2R93J 2XAJA 3TP0A 4UUVA 1BR4A 1UC9A 2HYJA 2ID6A 3RAXA 4O3PA 5E3NA 1FBUA 4PGGA 2HZDA 2IRFG 5D6EA 3LWFA 1JT6A 1SAUA 2NU9B 2KZVA 2ZXHA 2Y69H 4CZZA 4RM2A 1B8IB 4A3CJ 2R85A 2PX9A 3GILA 2MG4A 4DL3A 2F5CA 2MSYA 3BG7A 4G12A 4BDZA 2O6GE 3ZXSA 3CLOA 1ZGAA 2BYVE 5FJ8J 2ICWG 1OCPA 4JK1X 4FE4A 1AHDP 2H6BA 2LKSA 3BZCA 4GFBA 1E4FT 3I71A 1ZKGA 4UVCA 2OAZA 3ZQGA 2W71A 2C28A 2NNYA 3CVZA 1SEIA 4UCRA 4KITB 2FOKA 2LK2A 2IA1A 2DI3A 4I7HA 1G8XA 4F7ZA 2X6XA 2Z2SB 3BCAA 5D4RA 4BE2A 1TWGA 2WDTA 1EH8A 1LFUP 3PR5B 3OHBA 4PZJA 2MFZA 3OYMA 2QBYB 2OBPA 3MCZA 2NRAC 3GIIA 1JI8A 2K9QA 1CF7A 4JUZA 5EDWA 1T56A 1PDNC 4HZFA 5GAEJ 2BBYA 3FXRA 3FKIA 2XC9A 5E1WA 2EV5A 2EIKH 4WWCA 3HKZA 1B72B 1BL0A 3HOVJ 3FXOA 1TWCA 1M6VA 3VMMA 2ZMEB 4A0XA 2ZKZA 2BW3A 2HJWA 3CUOA 4DL2A 3R23A 3A1YA 5GAGJ 3H3VK 4HPQA 1JTYA 4MGRA 2NU8B 1S8NA 2NVYA 1FYMA 5C44J 5FKKA 2Y31A 4U7BA 2Y0MA 4RB2C 4X6AJ 1I5ZA 5KFVA 4EJVA 3FBIB 3F0CA 1X2NA 1H9TA 5HLIA 4J01A 1T3NA 4MV8A 2HOEA 5CA1F 1X19A 3GFLA 1OYIA 2ZMEC 2UU9H 2NXNB 2VL8A 3BPVA 3S3MA 1IAWA 3LSGA 1B6SA 3FIWA 4XLPF 1LDKB 5EWEA 2PI0A 1A6QA 2DT6A 4IRIA 3C3WA 3I58A 2D5VA 3G1OA 2LR8A 1K6OA 1M1EB 2MLGA 1ZREA 2PJRA 4CGZA 2DWCA 4BY1G 4IHTA 5C5JA 1W5TA 4LD5A 2HVRA 2C35B 4M9UA 4A3GJ 2UWMA 5KNLA 3GUDA 3WGGA 3DTKA 3I12A 2I5UA 4FCYA 4C2TA 2ZM6H 2JMWA 3PNYA 2Z16A 4FISA 4Y4RA 3WHCA 5J1UA 3TL4X 3K7AJ 4EJWA 3GTLJ 4F55A 4EGYA 1IRGA 5F9LA 2KRCA 4UVBA 2HR3A 4Y15A 4TQSA 4MQVA 3VPRA 2FEZA 2E5LH 4RM3A 1O7FA 4RB1A 5KFPA 5EWFA 3ERED 4AIKA 4OOIA 5E79C 3S2HJ 5GPCA 1HF0A 3HOYJ 1VBHA 3T5HA 3FZVA 3M8EA 4D7NA 3GTKA 2Y75A 4YY3H 2DMTA 5GTHC 2FUG2 4APMA 2DFEA 3WTUC 5LGUA 2K9NA 1O75A 2H94A 3H5RA 1KJ9A 1W5SA 3HOSA 2PBZA 3QQAA 3KHGA 3MFIA 1Z67A 3OYCA 3CCSI 1QU3A 1W93A 2WY8Q 2GQQA 3PNTA 1ENHA 4JOMA 1FVIA 4R8UB 5KFIA 2R7DA 2PG4A 4M72A 1VQKI 1KYZA 2XB5A 3PQJA 1VI0A 1HKSA 3HOZG 2JJ7A 5AIQA 1E3OC 3HOUJ 1ZQ3P 1YW7A 4GC6A 5LD2C 2E1MB 3BT9A 4IXAA 3RV3A 1MBJA 4IAJA 2QQ8A 3CDLA 1OWTA 4U0WA 3A01A 2UUZA 2OU2A 3ABMH 1DPUA 1FOXA 2M8GX 2WWYA 1LDJA 1ZR4A 5ED4A 3V8LA 3ZMTA 2A6TA 3GTPA 3BCBA 2YX4A 1B04A 3J81W 2NU7B 2OLSA 3T5JA 1W0UA 4I50F 2XF7A 1DV1A 4CSWA 2KT0A 4XICA 4DNCA 3CDHA 3OSPA 2R7ZA 3GV8B 3L9FA 1EH6A 5KG6A 1RK6A 4M3DA 3BG6A 2M3AA 5H2FC 4BBSJ 2DT7B 4BACA 1VTNC 1JDBB 1YLFA 1Y1WG 3DPUA 4BY7J 5BOXA 2YS7A 4B4CA 3JSNA 1QPIA 2OZ6A 3L2UA 1K7AA 5F0FA 2BE5F 2O5RA 2V6CA 4HA8A 3ZMSA 4A3FJ 3C1DA 2RNGA 1K83J 4A93G 3JRFA 2VKVA 3K1PA 5BPHA 3CO7C 2MA3A 5BS6A 1IUFA 3HIFA 1H0MA 1JX4A 2ZCWA 2FF4A 4Y13A 3OYIA 4B3MH 2W6QA 1VQOI 2P8TA 2K40A 3BC8A 1IGNA 4LF8H 5ILUA 1UCRA 3OSNA 2H09A 4QPOA 3J81K 3F8CA 3VB2A 1PX2A 3QU3A 3PM1A 3EUHA 2HOSA 4ESJA 5IYZF 5JI6A 4B3XA 5FLVA 5IY5H 3FISA 4I09A 1CE8A 5LHIA 1BI0A 4O3QA 2WAEA 3N43B 3DU5A 2EBIA 2EA2A 1RJPA 1MMDA 5IP6A 2XAUA 5F64A 1FOWA 2G9WA 4I0AA 1CF7B 2OH2A 2LOOA 2DQRA 2ME0A 4XMYA 3E5XA 1JKJB 2M8EA 3NEUA 3I4MJ 2AQEA 2DN0A 1Y1VA 3TP3A 1JKOC 2UXNA 3IC7A 5C8YF 2L54A 4I99C 4ANJA 2ALZA 3B73A 3QZ7A 2ISYA 4RAZA 1OISA 3R5HA 3IUOA 1XSXA 3G1MA 1BI2A 3BG5A 5GONF 1TZLA 3CLQA 4HLXA 5CKTA 3WTTC 1YJ9I 3RYPA 2Z1DA 4KISA 1GV5A 1D1BA 2KJBA 4XR6A 2C6YA 1TT5B 5TJJA 1SC7A 1UFMA 1WJEA 3KHRA 1MJBA 4LB6B 2YS6A 4BDYA 5KFJA 2FK2A 1XCVA 4MTDA 4YB8B 1DP3A 3WGIA 3IAS2 2JK3A 2CW7A 2DCEA 5KFCA 2QM3A 5IP7J 2OUMA 2V1UA 1U9OA 1LEBA 3G6YA 2AXTC 1HW5A 1K4SA 5FKLA 4IWXA 2SCUB 1BR2A 2JRTA 4LIVA 5EGOA 2JWTA 4O4HF 3GIQA 4MV3A 1WGXA 1KJIA 5IYBG 3DU6A 2CUFA 1I50J 2DA5A 4DL6A 2WBMA 2PJRB 3PIPF 3L7WA 5KFDA 5DCFA 3RSNA 2DPJA 3H40A 3PZPA 2X6WA 3TGNA 2V26A 1YJWI 4TUYF 3I54A 4B48A 4G7HF 3VFZA 1Z2OX 4O4LF 4N9IA 3G1LA 2KJCA 4M71A 1Z7UA 2E35A 4PSWA 5FD6A 2VJJA 1ULZA 2P81A 3TOAA 3PO2G 4UUTA 1V9PA 2XAFA 2VJIA 5ICFA 4YBZB 5DLGA 3OYGA 1PP7U 1U9NA 2O0YA 5C3EJ 3HJEA 1MJ9A 5HNHA 2DT5A 1ZGJA 2DU9A 3PR4A 1USTA 2GXGA 4G9YA 4A3MJ 3P7NA 3HHGA 1WH2A 1HNZH 5D6FA 2CQYA 3I5UA 2FNPA 2DOAA 4LFBH 2XGEA 3TDZC 1RETA 2VODA 4MA0A 2VA3A 5J2TF 2EFQA 4A3DJ 3N8DA 1Z21A 2YSRA 1WJBA 3LSRA 5HS8A 3C2GA 3PL8A 1GVJA 3SEZA 4ZDPA 4ENJA 3MZ8A 4QPQA 1CQIB 2CQQA 2Y30A 4F91B 3KZYA 3ZQFA 4O2BF 4G3IA 1X4OA 5K5OA 2R7MA 4OX9H 1F1ZA 3AG1H 2DA4A 1D1CA 4IJAA 2JVHA 1JLLB 2GPSA 2IT0A 4JI5H 2Q2UA 4DZPA 4IR1A 3RF2A 1T36A 2CUEA 5HDGA 2ELHA 2X9DA 1J75A 3H9QA 4CC6A 2ACJA 1MZBA 2XASA 3B02A 2OTJI 3A01B 4RGRA 3GLKA 2F2EA 1LJ9A 5FB2A 3OYBA 2JSPA 3J7AY 4A3LG 5KVRA 2QQBA 5IT9W 3GTQJ 5HLTA 4KMFA 5K5RA 2MYSA 2FE3A 2QK4A 5FRNA 5DYMA 3ECHA 9ANTA 2UXDH 1N48A 1D0YA 4HF2A 2B0LA 4JYKA 2IS2A 4J9OA 4GC7A 3GTLA 1HNXH 2W00A 3MWMA 2XCPA 2BGCA 3VDXA 2D45A 2ASJA 3IV5A 5JR3A 1OCRH 1TQMA 3ULQB 2KKOA 2QZ8A 2XAGA 3TW7A 4BY1J 2JA7J 1WCMA 5D1OA 2R5ZA 4RNMA 1W4MA 3FXKA 4YFXF 3S3NA 3ETHA 4FTHA 2UUCH 2Z5UA 2A69F 2BV6A 4LK1F 3HL2A 2IJLA 4RZRA 1LVAA 4IOCF 3CQZJ 3LMMA 4ME6A 1X1DA 4DBQA 3HOXJ 1CQJB 4GRIA 5KFHA 2E5NA 3GTMJ 1N78A 4ZTJA 1UHSA 3HTSB 4UCVA 2DAOA 3RTXA 2AO9A 2JA8G 1PP8F 2GBYA 2M7AA 5IT9K 4E4TA 5HS9A 2XD4A 1OR7A 5IPAA 3OUUA 3JCUC 5GADJ 2DOEA 2QSGX 3L2VA 2F48A 2F4MB 4LG3A 3I59A 2XF6A 5F1RA 1WJAA 1XGMA 4J9SA 1HR0H 3DPLC 4E7JA 3ABKH 3C18A 4D0PA 3M9OB 4PJNA 3V42A 3KEQA 1R36A 1K1SA 1J59A 5HVQC 4IRHA 5B5EC 5CYVA 1WI3A 3M9AA 2B63A 3PW7A 3GTGJ 3OR2C 4G6DA 1FBQA 1QNTA 3CESA 4DW6A 2HPMA 5FGMA 1B33N 3ZMUA 4UCSA 3K70C 3WTWC 3HOZJ 4K0KH 1SD5A 3KP5A 1R23A 2VN2A 1VNDA 2VQFH 2JPCA 3HRSA 4PDBA 1SFKA 2MLKA 1TWGJ 3HOTA 2W70A 4M74A 3ZR8X 1XPXA 2V59A 4ZYEA 3HEFA 1W96A 4A3IJ 1FZPB 2UVWA 1XMKA 5A2QW 1RYSA 3S93A 4GYIA 2KIMA 1RK5A 3HYIA 2WB1E 1ODDA 2X1CA 3FKIJ 2W9CA 3F23A 2UXCH 2FA5A 2GOXB 1SCUB 1R6RA 1XNRH 3JRBA 2XHKA 2E1CA 3PSIA 4J9NA 4YIFA 2EA4A 3O8HA 1R1TA 1YX3A 3DPTA 4XRSA 1A31A 1HNWH 3DFGA 2DQLA 4KN4X 1FTTA 2DMQA 1X1AA 2AXLA 3DKXA 4OMZA 3U21A 5CVUA 5M3MJ 2JZYA 5EGOB 2FJZA 1P7JA 4HX8A 3MZYA 1UZCA 2RKHA 1U8BA 1Y1WJ 2ADUA 5EOYA 3ONQA 3R5XA 4LJZF 4E6KG 4NDLA 4PJ0C 5KT6A 1EF4A 5JFRA 1G4DA 3SDGA 4HF1A 1T2KA 1KZHA 3SEQA 1UMQA 2LY9A 2UVVA 2DMPA 3K0LA 3NRVA 4HAMA 2F5FA 1FLIA 2IXSA 1S0NA 2E1OA 2C2EA 3GTJA 2QUFA 4RAYA 2YZMA 2R7XA 2MCTA 3CCVI 1FSHA 5A2QK 1P4WA 3M07A 4IRDA 4O3OA 4EYHB 2HWVA 1PVEA 1G3YA 4P9FA 1T39A 1S7AA 5JHUA 4YELA 1SFEA 3SXYA 2E2IJ 5DM6F 3PIOF 1CGPA 1J5EH 3RQ4A 4ZQIA 1OYYA 3S2DJ 4ECYA 5F27A 4UCUA 1X1BA 3J7AK 3SE7A 2YCHA 3D5SC 1QBJA 3JREA 1IBMH 2IA6A 1MNDA 4U87A 2NVQJ 5ICEA 4HW0A 3RV4A 3Q0WA 4BJ5C 4MFDA 4LOCA 4JX6A 3CD6I 3V4GA 1RKTA 3QWLA 1YOVB 3FXJA 3HUGA 4A2UA 2AU0A 4YAJB 5D8KB 3DKWA 2E19A 2HQAA 3GTKJ 1DUXC 4KT6A 4KNYA 4QJFA 3P9CA 4ZC3A 4ON0A 1B72A 4DR6H 2L7ZA 4PSXA 1A04A 2K9MA 1OQYA 2R7FA 3BJOA 3H20A 3JRXA 1RYRA 4BHPA 5IOYA 1BXRA 3W6KB 2EFWA 5DV5A 1DGSA 1PK8A 2WAQE 4IRGA 2GIZA 4P96A 1V5GA 4KIBA 5DG9A 3U1KA 1UC8A 2R6FA 1HW1A 1ZRCA 2KDZA 2RREA 3TMOA 1JXSA 2R7VA 4ECWA 2D1VA 5KFSA 5JH7F 2V4RA 1K1QA 1BI3A 4DR4H 4FT8A 2HVQA 4BH9A 3KP4A 2IGOA 1J09A 2KFDA 2V6EA 2DJIA 1Z05A 2W9AA 1WRJA 2O7OA 1AWCA 1YIJI 4RNOA 3GTPJ 4L5JA 2VPRA 4BL0B 4FE7A 3SHFA 4II2A 3QYFA 5FLMG 2E60A 3HC7A 3LMLA 1YW9A 4L9TA 4O3SA 2JTVA 2ASDA 2XSDC 3DLLF 1AA7A 2P5KA 5L3CA 4C2UA 4QTRA 3MWDA 1NG6A 4HG2A 5CJ9A 1ETQA 4LSXA 3Q0VA 5AONA 4WBNF 1CS0A 4JI1H 1WSUA 2QWWA 3WTYC 3TW6A 1IV6A 4ED3A 4UCOA 1OYWA 2EFNA 1IBLH 2CWEA 2V5AA 2E1NA 1WH5A 1MMSA 2R86A 4YJ2F 2P0WA 5H6QA 4YJ3F 4O3RA 1S72I 1SFXA 1MBHA 3MD2A 2KDOA 3VPDA 5KG0A 3V4SA 3ZN1A 3EUAA 2Q0OA 4G6QA 4IVNA 4PCQA 2W9BA 4IR9A 3VSLA 1HLVA 4MHGA 5JLWA 3UQ8A 2ZO4A 3J81Z 1EUDB 4UB8C 3RIRA 1B9MA 5KFNA 4DV4H 1JKQC 4AQYH 5JUMA 3WG7H 3H4BA 1OR7C 2DPDA 4NC6A 4WK8F 2WE6A 2HQ5A 4EYIB 1JHHA 3GTQA 1KU3A 3CUQA 5DUKA 3H3VH 1YQAA 4IF4A 2EIMH 4U0VA 3TIGA 2FPIB 1FMWA 2GAUA 1KU2A 4GGGA 4BKXA 3VYUB 1Z77A 1S6LA 4O5VA 5D5WB 3EPIA 4PJLA 2V7FA 1ZETA 3I55I 3BJYA 1FY7A 3COAC 3ELKA 2CUZA 2CUJA 2LREA 4BAYA 3JTGA 4EM2A 5KT5A 4B3SH 2H27A 2CS3A 3TOBA 4BQAA 2P7CB 1T98A 4ZYAA 4E70A 3L2RA 4A3LJ 4A2BA 3KFWX 3QFFA 1E4GT 2W9CB 4DL7A 4ZTFA 1Y1VJ 4E7KA 1SVOA 1XX5A 3H9GA 5E17F 4A3KJ 3OMYA 1DV2A 1HDPA 3OYHA 4MIMA 1O4XA 1RPWA 3Q9SA 3MQ0A 1MW7A 1QZZA 3J80W 4ASNA 1BOBA 1QGPA 3FMSA 3CQZA 4ED7A 3GCMA 5J3LA 3OIPA 2DK5A 3GTMA 4O2AF 1W36D 4GYGA 2FLPA 1O7LA 3DEWA 1HDDC 2K3FA 3WU0A 1R5ID 1XGOA 1I94H 3O3KA 1YHQI 3H5NA 1KEEA 3H3ZA 2ZXJA 4B3TH 4DR3H 1ORKA 3JRCA 4L9JA 2DYRH 3NWTA 4PFPA 2DW4A 2R0QC 3KLNA 3Q5FA 1RIOH 2I8CA 3FHZA 2K85A 5M5YJ 3C0FB 1TT0A 4MAMA 3BTLA 2ZSHB 1WI9A 1XGSA 2PMUA 5JVGF 5C1PA 3KE2A 2ELKA 2R7UA 2DIKA 5DGBA 5LEKA 2JRMA 4TQRA 1DU6A 3QPTA 1V3FA 1T8IA 2NVXJ 4R1HA 4DOZA 2JA8J 5BMVF 3KETA 2IS1A 4Q43A 1WSCA 4IHXA 4DV3H 2L9RA 3GTGA 2J6SA 5LA6F 4QWDA 4L0ZB 3MR6A 3L00A 5J8CA 5E8IA 3J80K 3CF2A 2F4OB 3IL2A 5DGAA 1LKXA 5HLHA 2VOPA 3Q8QB 4XOTA 3WODF 3I3LA 1C0WA 2C2RA 1BR1A 1FNNA 3RQIA 2HI3A 1MIJA 3OYLA 1ZR2A 1GGOA 5EEAA 2H8WA 3M8FA 4M6YA 2MH2A 4C3IJ 1GXPA 1AU7A 3TKYA 4BUPA 4CYDA 4YAKB 3HKZE 4GLXA 2W84A 1NG7A 3HUGB 5ICCA 2GXBA 4YR3A 5IYCG 1MJAA 4XOPA 3H4DA 3BR2A 1VF9A 4M3GA 4RLQA 3A0HC 2R8IA 3RTRA 4WXCA 2M4GA 5DEQA 3ZQCA 5L3BA 3VYSB 5EJCA 1RI7A 2Z33A 2HVSA 1X1PA 5LMNH 1J5YA 2MH9A 2VASA 3LNQA 3PW0A 1Y1WA 1ETWA 2FMLA 2CJJA 2HNHA 4Y52J 2X0LA 4XLFA 4OIOF 2CFXA 3W2VA 4A6DA 3N97A 2W82A 4Y33A 3CCUI 3KAKA 2J5OA 2IS6A 3OYAA 2AQ4A 2CW0F 2IAIA 1DIKA 4CCJA 4G8XA 3MFKA 3KX2A 4IOAF 4XLAA 1EUCB 1USSA 1TLHB 4BBRJ 2IS4A 1C3OA 2Q2EA 3E0JB 4YG2F 5FPOA 1R9TA 2WB1N 5DUIA 3CC4I 3V4ZA 4G7ZF 4ZJZA 2JEFA 2E2IA 3H3UA 2AGPA 1X4PA 2EFPA 6PAXA 1YE9A 4Q47A 2QVOA 2XVCA 3J7ZI 1JJ6C 1XDUA 5KFUA 3V7SA 4CO8A 1KA8A 2CZGA 2R84A 4NC8A 4HNUA 2IGKA 2HKXA 3LSTA 1ZG3A 2QSFX 5F0HA 2OJED 4ED6A 4DJAA 4RA2A 2M9HA 4OIPF 2YUSA 3ZQLA 2ATLA 1WCMJ 3Q2OA 4HLYA 2FMAA 3JTHA 3IRRA 3S3OA 2HYGD 2ZDQA 1F4KA 1S03G 1XB4A 3OYKA 4LIUA 4HX4A 2ETHA 3KCCA 3R6SA 3FDSA 5H80A 2IGMA 5HODA 5T14A 1WWXA 2L0KA 4AVPA 2W9BB 1P7IA 4GCVA 4A3EG 3JRHA 5L1KA 5CQEA 3EUKL 1V5FA 5J40A 2DO7A 2FKLA 4D9JA 2ZDHA 1GLVA 4Q48A 4OIQF 4EGZA 3HXLA 3OV8A 2VPQA 1MH4A 4II3A 2X1EA 3ZGKA 3I9V2 5BNGA 3E97A 3CUQB 3EYYA 3GLLA 3TO9A 2MW8A 1R71A 1OMIA 4XNFA 2C00A 1S7EA 3T5XA 2BHZA 5K7ZA 4EBCA 2FLLA 3B6AA 1NH3A 3R4KA 2M5WA 2Z99A 4DQ2A 4IHSA 4HV5A 3BJAA 3GIKA 4AYBE 1IV8A 2LNBA 2JPBA 2EFOA 2K7LA 2TDXA 3Q9VA 4FU0A 1O3TA 5BPFA 3RGZA 4X1EA 3PFIA 4HSTA 2PEXA 4CZCA 2B63J 3NWSA 4BXUA 1VBGA 4A3BJ 1KJQA 3LA3A 1IXRC 4UHTA 5JHFA 5KFXA 2J9GA 4GKKH 3M9NB 4LLLA 2NOGA 2E34A 5KG4A 2QLZA 3BR6A 2HFHA 4OIRF 1UHMA 2FMYA 1SEUA 2W25A 3IRQA 3R0JA 2VQDA 5IYDG 4I4TF 1WVRA 3A03A 4J9MA 5L3DA 2XGDA 2Y9YA 4MV4A 2E1MC 1V4RA 1FJGH 2Q2TA 4M6VA 1IN8A 2KP6A 4UVAA 4RUAA 5FD5A 2ZFUA 3DCFA 1FIAA 3K6GA 4X0GA 4D5FA 4J9PA 1KJ8A 3S1RJ 2WAQN 1Y8RB 5EZHA 4HQ6A 1U6GA 5HNFA 2XF5A 2A3SA 3MKWB 1VQ5I 2CMPA 4Z6YA 3WTXC 3TDUC 2BVMA 3I53A 2E7XA 3SJMA 4J9LA 2NS7A 1SMTA 3DKYA 3KYCB 2DJNA 4LK0F 1R5HA 3K2AA 2XCAA 1R1UA 2TCTA 1UELB 4WXDA 4YFKF 2YS9A 2FOWA 3S8PA 3REOA 4CCNA 2ZNYA 3RZDJ 3BQZA 3HSEA 4M6XA 4F93B 4GDFA 2F5VA 3GTJJ 2WTFA 5A2QZ 3BQ1A 4HDVA 1Z3XA 4A3JG 5EYRA 5HDKA 3DTEA 1UNNC 1ONVA 2VBXA 1ZHFA 1ZELA 3F8BA 3KP3A 3VYRB 4UFZA 4FBUA 2R92G 5LLQA 3ML6A 5ILVA 1BJZA 3I4NJ 4E4HA 2ESNA 2GA1A 3T5LA 2ASLA 2ZXWH 1VFCA 4C30A 1KU9A 3RPUD 3OYFA 4FQGA 1G3SA 1YI2I 1D5VA 3S32A 3K4KA 4E7IA 4AVZA 3OOPA 4QLCU 2DPIA 2H1LA 2KQRA 4C3HJ 2VA2A 1YYVA 4Q5SF 1R5GA 3FHNA 5KFQA 1T33A 2LKPA 2OZUA 3G6EI 2KISA 1IXSB 5B1AH 3A4CA 3K69A 3OOUA 3KAJA 1MSEC 2Q1ZB 1ZG5A 3CF5F 1F5TA 2BY3A 2HU9A 2LY1A 1JXLA 2VOBA 1TWFJ 3GEZA 5CVRA 5GP9A 4BJTA 3C7JA 2NVTJ 3MVPA 1LFPA 3G73A 2XB0X 1PYVA 4XONA 1HCRA 1TC3C 4MLOA 2W6MA 5K7FA 1IOVA 1WKMA 3H92A 1DPRA 2P4WA 1MD0A 1KC7A 2CGPA 2MABA 4QIWA 3ZQ7A 2NVXA 3OL4A 5KG3A 2Q2EB 2WV0A 3GMEA 2LYCA 1EKEA 1VZ0A 1ZRDA 1MMNA 4IQ4A 1O57A 2P7VB 4EM0B 1R49A 5HS7A 3ORQA 1TQPA 3JRGA 3CDIA 1YW8A 1Z2NX 4QSHA 2XDVA 4ZDLA 2EZHA 4HYKA 5B66C 2R8JA 4XKCA 5D5XB 2ZBKA 2OF7A 1ERDA 2EZIA 4MEYF 2YR2A 3G3ZA 1MMAA 2JUGA 1ZLJA 3CJTB 3MR5A 3OYNA 1B59A 3JW4A 4MEXF 1U5TB 1R4MB 2HHHH 4HQEA 1HC8A 1IF1A 5D8LB 3C2BA 3E3VA 2VI6A 5KAIC 1UJ8A 2QENA 4ABZA 1B9NA 3JRIA 4J9QA 2KSWA 4X66H 2RDJA 2VUMG 4C5CA 3PW4A 1JIHA 2YZGA 1IXCA 3QP5A 3HB9A 5IP9G 3G6VA 2ZFWA 4F4WA 3V6JA 2L7KA 3K3PA 3K70D 1J9IA 4JI4H 1QVTA 2GZWA 2W6NA 3W6JB 3EETA 3RDIA 4PJMA 1G59A 2L02A 1GSAA 1X3WB 3FXUA 1LDDA 3JRDA 4JV5H 2X85A 2L5QA 2K27A 5D4SA 5IYCJ 3RPQA 4YRVA 2FP4B 2I8DA 4GXOA 4IHWA 4GO1A 1TQIA 1I3QJ 2M4KA 2M7BA 2R7NA 2IA2A 1VQMI 1BC7C 3WE2A 1U0JA 3GVAA 2XROA 4RNNA 3S14J 4I0BA 2BQRA 2LP0A 1S0MA 4BQNA 4LSAA 4BE1A 2K3PA 4B47A 2WY7Q 1S5LC 2LBFA 4B44A 3E6CC 3KEOA 2IPQX 5KFAA 2G7HA 1S97A 4A0YA 1XN7A 3HKZN 1GT0C 3ASOH 2UXBH 4HSRA 3RUPA 4I98B 3HDDA 4DL4A 1RUOA 1V54H 4FS1A 4A12A 1N77A 2FBHA 2OA4A 3WU2C 2IP2A 1V51A 4ZI7F 2ZDGA 1T6SA 3IWFA 3SFIA 3WU1B 3WHBA 4IRCA 4UXNA 1VAJA 2I80A 1QQIA 3GIDA 2UVRA 1I7LA 2EZLA 5M3FJ 5FO5A 4ZDOA 3FKJA 1DQUA 1D8JA 1QHGA 1IBKH 1TW3A 4JP0A 2FBIA 1V55H 1HKTA 4Q45A 1N34H 3BR1A 1A35A 4EG0A 4WCGA 1PUEE 1FBSA 3FMRA 3HPGA 4FX4A 3M9MB 4V19K 3QODA 4EM1A 3J7AO 1UAAA 1N32H 3RJPA 5KG2A 4GKJH 4CHUA 2JT1A 1Z0XA 3PO3G 4XKWA 2VXZA 2E71A 1P4AA 3AG3H 3OSFA 5F9NA 2AGQA 2ELJA 2YU9A 3LA7A 1Z2PX 2CQXA 2V4QA 3A0BC 4ENKA 5KK1A 1C30A 4K2EA 3ABUA 3E1SA 1D3YA 1ZG1A 1XC5A 4G7OF 3LL7A 4UCTA 1V5EA 2BZTA 3M1EA 5TGTA 2NU6B 4JI3H 3KP2A 5LOVF 3AG4H 2M87A 4A3EJ 5HOOA 3ISPA 1BW6A 2R93G 1ZTRA 2J6UA 2RQPA 2EK5A 1S9HA 1MBFA 3E5UA 2EH3A 3SZGA 1J7KA 4B8XA 4BQQA 4CH7A 4IHVA 3K5IA 3NAUA 4AWXB 4A3CG 1ZYRF 2PLYA 4XX0B 2ECBA 3PSFA 1I39A 2NNNA 2F4IA 3EUHC 1FMVA 4U7DA 1V4YA 5FJ8G 3FXQA 4EQQA 1LB2A 3HRMA 3BTJA 4XL9A 1EHIA 3L2QA 1LVKA 3PN1A 2HOAA 4OAYA 2R7WA 5FRMA 5ICGA 1JJ8C 1LFBA 2X51A 2WA0A 3QOEA 1HSTA 5KCMA 1F43A 5LYJF 1ZHQA 4XKVA 3BTCA 1Z1DA 5AIPA 4KA4A 2MD5A 2B7EA 2R82A 1QZYA 3DV8A 4BS9A 1KONA 4ECSA 5IYDJ 3BAAA 3IH4A 4IWYA 2LC2A 3N6XA 3ZMDA 1MNEA 2VT2A 3CO6C 1HBXG 3CJQB 3DF8A 3G71I 2A5WA 1XS9A 3WTSC 3LAPA 1IG7A 3RKYA 1WQ2A 1L2ZA 3A02A 4AYBN 2HTJA 3OY9A 1TAEA 2VPLA 2F4VH 2DTZA 2XSJC 2EWNA 4LFAH 2K02A 3I0TA 4L5EA 4N4NB 3GV5B 1YIOA 3AKZA 1FWZA 1P8LA 1IDYA 2D2WA 2XGQA 4RMNA 2VB6A 3U1DA 2RGRA 3OIQA 4KIFA 5CQGA 1ON1A 1O3RA 4A93J 2GXAA 3F8MA 4O3NA 3K4MA 3BZKA 3M4OJ 1ZHSA 1KQ0A 3DTIA 1LQ1A 1F9NA 1TWHA 1I3AA 3GIPA 2W7PA 4JI6H 3GX4X 2R7LA 3BQYA 2VQHA 5EZYF 2NOJB 4F52A 3BQ2A 4U88A 3D1NI 3N42B 1R9TJ 1Z91A 4LG0A 2JEIA 4HNVA 2XGCA 4XLCA 5KFWA 1E2XA 2JA2A 4LMYA 4M7EA 4XIDA 4DYQA 1D0ZA 1EJ9A 5E8GA 3VODA 1EYZA 4A69C 2WTEA 3CMMA 3PW2A 1XNQH 3IH2A 3MMYB 3JSPA 1A9XA 3TBIA 4BWSC 5FLXW 5M5XJ 3Q1KA 5F04A 3BY6A 2LRDA 3H36A 2GLOA 5FFXA 1YO5C 2FQ4A 2HQNA 2CQNA 2RAEA 1BM9A 4J19A 5KG7A 2R92J 2VLAA 1EZ1A 2V9KA 1D0XA 1RUNA 1VQLI 4IKFA 1JE8A 2NYXA 1I6XA 4IRKA 5FKOA 4QW9A 4MV1A 5GAHJ 1TWFA 2W8KA 2MGQA 2RN7A 1N33H 2OCEA 2O61A 5E3OA 2A05A 2FLNA 3CMEI 3CCQI 4JI7H 2X4HA 3DBHB 1T38A 2Y0SE 4DV7H 3FMQA 2QEXI 4YQWA 3EPGA 2LBFB 3OYDA 1W0TA 5GPAA 2XRNA 3H5AA 2E2HA 4KICA 5E18F 4QWEA 2Q8KA 3BZ6A 1ZGWA 2STTA 2HZTA 3WG9A 4U6PA 2CV0A 5J4VA 2VIXA 4XN3A 5CPRB 4W1UA 3EYIA 1QZEA 2DFHA 4XLNF 5KHDA 2K9SA 5FLXK 2CKZB 5BMZA 2FK1A 5C4XG 3DP7A 5L3GA 1P9QC 2QA4I 4XKBA 2O9LA 1REPC 1KQ8A 3RBEA 4P55A 2LKXA 4L1KA 2W4SA 3L1PA 4ZYGA 5IYBJ 3OSGA 4UY8I 4RB3C 1FC3A 4EGJA 1ETYA 1F36A 3QPSA 3U9GA 5KT2A 3BR5A 5L3EA 3BWGA 2ESHA 3K4JA 4F4YA 3RB3A 5L1IA 4RGXA 3IH3A 4EGQA 4L5IA 3JAMW 2NAZA 4RU9A 1BOAA 2QF7A 2L3DA 2FK3A 3RYRA 2WAQA 5E1ZB 4P1WA 1X58A 4AUXA 1PJRA 3KZIC 4X65H 5LBQA 1FKAH 2VJ4A 4MQ9F 1IRFA 2VJ5A 3PO2J 5IT3A 2R7OA 2KRFA 4RS8A 3RB6A 3CZ6A 2L7FP 3DBLB 4CXFA 4BJ6C 1M7JA 2DA6A 2DYSH 2QYOA 2A6HF 5K1YA 1XMXA 2VBZA 1P92A 2QQ9A 1JDEA 1QVUA 1VQ4I 2J6TA 1VQ8I 2EV0A 1FOYA 5E3MA 5DCMB 4JX4A 1X3UA 3CCMI 3U9SA 5IP9J 1I3QA 3LA2A 2CG4A 3O6BB 3ZQIA 2EQRA 3OUZA 5HBRB 2E36A 2ZC2A 2FPPB 3KTMA 2QKMB 5EWGA 3PQKA 1XMQH 3HHHA 3BJ6A 1GXQA 3BDDA 4CA0A 1GVDA 1HXDA 5FROA 4YEJA 3O8GA 1FYKA 2M34A 1AKHA 3JAMK 3GLXA 1KU7A 4Y8VB 3T8RA 3DQVC 5JVDF 4ENNA 4C9YA 4ZOLF 2VOOA 2DA1A 2RC4A 3Q3SA 1ETXA 1HW2A 2X0SA 1KYWA 2BEOA 4FHTA 1E4EA 2I87A 4X62H 3G8CA 2CYYA 4NC7A 3M1CA 2QYZA 2DXIA 5F08A 5LHGA 2XGXA 2DOFA 3AG2H 2CSOA 1OPCA 3QPLA 4YFNF 2V58A 2V9PA 4ECXA 1YRNB 3I4PA 4KFCA 2DFFA 4NHJA 1ZK8A 2MC4A 4OAZA 3QAHA 4RAFA 1X3ZB 2R7QA 3GXOA 1RRJA 2QSHX 4IHYA 5CB4F 2X1DA 3GYHX 4LF6H 1Y39A 4CCLA 3GO5A 3OIOA 2PMZE 3IAM2 2W7NA 2GM4A 2MBFA 2HGCA 3BTIA 5J8FA 3WTVC 1TWAA 1FEXA 4XYMB 2OD5A 1S10A 3RJ0A 3GFIA 2PN1A 1RKWA 3MKZA 2LF8A 3HGGA 3N4MA 1UG2A 4C3JJ 2JQ7A 1Y8QB 2OQGA 4BXFA 4L9NA 1IN6A 3WTZA 5D8DA 3N41B 2E5ZA 3OTOH 4EEYA 1UHWA 2O8XA 1Q1HA 2XIGA 1S29A 3CCYA 3K4CA 3GQCA 4M9SA 2PQ8A 1ETOA 3CCLI 1WJFA 2O3FA 3CJRB 3DF7A 4ZH4F 1VKZA 4YP3A 2JA5G 1G3WA 5JVTA 4YR0A 3ETJA 3HOWG 5IP7G 4WF2A 2QKLB 3UR3C 3L4KA 2G7UA 4CCKA 5TRDA 4LF4H 5JLXA 4LG0B 2AQFA 5L1LA 1KQ9A 2CFOA 2XAQA 4PFOA 1NK2P 1VQ9I 5J2UF 4U0YA 5ILSA 2DK8A 5F6FA 1HSJA 2F6CA 4AIJA 5KFGA 2KIFA 3BR0A 1A36A 1N75A 2ZSIB 4HYEA 4KIGA 3AL0B 3HTUA 4ECUA 4AC0A 1H8AC 2HDWA 4P9UA 1SMYF 3OS1A 2Z9OA 2VT3A 3JSOA 2YZNA 3IP4B 1BC8C 1W7PD 1MBEA 2X6YA 1Y0NA 3H0GG 1Z6RA 3L2PA 2VKDA 1MDMB 1WZ2A 3OL3A 3WNZA 5C3EG 1HKQA 1WFXA 3KLOA 2K86A 3A2KA 1ZARA 2YPRA 4A3MG 3N40P 2BY0A 4V2GA 2QCOA 2Y9ZA 3OYJA 2K4JA 1SAXA 3D5RC 3AL0C 4JV0A 4MNUA 3SDBA 3Q8SB 4HV6A 1XDNA 2UZKA 3F6VA 1Z6TA 2OC6A 1K79A 3EQLF 4XLHA 1OKRA 4XRMA 5IOZA 4A3DG 3KYLA 5KG1A 3OHAA 3MJFA 5LXTF 2R4GA 4N9HA 1EH7A 1MGTA 2BHYA 4V2FA 3HSRA 5BPIA 1A0IA 1L3LA 2L9SA 3DLAA 4OU0A 1XMAA 3HGYA 2JA6G 2R5YB 5FFZA 2MC3A 2C2DA 5KAFC 3WO1A 5CVJA 1KGSA 1JUPA 4IZZA 4TV9F 3TINA 2A5YB 4BXXJ 3J7YJ 1YX5A 2V9VA 3UNGC 4LLGF 3UKGA 3P9KA 3GFMA 1HA8A 4MTEA 2LTPA 3IG0A 3O2PE 3RFCA 2HPIA 4WD3A 5HDNA 4CC5A 4XRFA 4J0MA 1SD4A 4XSXF 4L18B 2W85A 5EG0A 2IW5A 1BNCA 4M73A 3FDYA 4CCOA 4DR1H 1VS0A 1U3EM 3LFKA 2Y48A 4LITA 5JQWA 2HXOA 3Q0UA 3LP8A 1B4AA 2PN6A 1OCTC 2F5DA 4ZHQF 1W1WE 3T1BA 2OCCH 4I02A 3G6XA 3SI8A 1YTYA 1U5TA 2W57A 4HX7A 2R92A 3RCOA 1FP1D 4KMUX 4JI0H 2R3SA 2VR1A 2JA7G 1L0OC 4XK4A 3RZOJ 4IPAA 4DV6H 2CQ7A 1GSOA 2QGUA 1IW7F 1NK3P 4D7MA 2HYFA 1XMOH 3RIZA 3W2WA 2LD5A 1T95A 3TO7A 1PUFB 4KJZA 4X64H 3AFHA 3ECOA 1W36C 5KG5A 1FX7A 1B6RA 5KFEA 5IT9Z 3JR9A 2QQAA 3HOXG 3D5LA 3LSIA 2YU9J 2M0CA 2B9SA 5GTIC 4NNJA 5FKNA 1XG1A 4BU2A 2CV1A 1IC8A 1AKHB 1M0TA 1TA8A 1IN4A 2ID3A 4B43A 4J00A 1AUVA 1R22A 4DUYH 2P5VA 4IZOA 4EJTA 4C5BA 3WO0A 1E4EB 1RNLA 3N05A 1H89C 1I1GA 2VQEH 4LLNA 2IVMA 3BPXA 3KPHA 4HQMA 3ZCOA 2HDCA 3LWBA 1MMGA 1ITYA 4XYLB 1MSFC 4U7CA 2BQ3A 3K4NA 2O8KA 2Y2ZA 2LG4A 4FX0A 1W7PB 2P5LC 3I64A 3LSKA 2E7WA 4D1QA 3R0AA 1IZ1A 2DA3A 3ASNH 5F1JA 2VUGA 1ZAOA 3W3CA 3ZQQA 2HXIA 2W24A 2RVCA 1P2FA 2AHQA 1K4TA 1OCOH 3ORRA 2W7OA 2XPUA 3RPUA 3CUQC 3CCJI 4F4ZA 4E7HA 3MKYB 1IO2A 1XTAA 2KRHA 1DGWY 1RR8C 1E0EA 3ZN0A 3BABA 1SANA 2ZJRF 5C4XJ 4L9VA 2R7KA 4YHHH 1YJNI 1QRYA 4HR7A 4I6ZA 4E7SA 4RUCA 2V9WA 1BBYA 3NARA 3HZJA 4DL5A 5EEHA 2V1DA 4NXMH 1JKPC 2WYOA 4R8HA 2Y0SN 2RGVA 4EJUA 4B1RA 3SYTA 2EIJH 4LFUA 5DQHA 1SFOA 2PMHA 3MWEA 5TISC 3FX3A 1U8RA 2ECCA 5J4YA 4RDUA 1XSDA 2FD5A 3OWTA 4AYBA 4OWRB 3W6VA 2OV7A 3CCRI 5FLMJ 5KT3A 4A3IG 2H1KA 1J2XA 3S16J 3K5HA 1J0RA 2VUMA 3FKIG 3VPCA 3FMAA 2VKEA 5H20A 2NUAB 2RV8A 1YITI 3OS2A 1T08B 1CQTA 4RLFA 1MBGA 1ZQ7A 3HPHA 3MN2A 5LGNA 4QWQA 1SYXB 2XV4S 3VSKA 4DV5H 2GLTA 2X48A 4W97A 1I1SA 3CP2A 4LB5A 2Z3YA 4DGWB 4KUMA 1A5JA 2P0AA 2LF7A 5K5QA 5CVIA 3RGXA 1OFCX 4CICA 2UUBH 4M3FA 1VQ6I 3LQRA 4ECQA 3BROA 4M9ZA 5KFKA 1TWHJ 2E2JJ 3S15J 2K5CA 3FK7A 1KBLA 3GZNB 3OR1C 3TEDA 3TO6A 1GHCA 1IRXA 3K1MA 5KFBA 4RB0A 3IN5A 4DV0H 2XKPA 1R4NB 3HBLA 4KN7X 5LRRA 1D5YA 2J5PA 4F50A 5FKMA 3N44B 1VQNI 2DODA 2CH0A 2YX7A 2R7RA 4PJJA 5J1YA 1I27A 2D1HA 1BI1A 5J1RA 3GTOJ 3KHHA 1X1CA 3L2WA 1RZ4A 3K4LA 5CAEB 5E3LA 2WADA 1Y14B 4ECTA 4BYYA 1K6YA 2FSWA 4Q44A 1N36H
chains in the Genus database with same CATH topology
3V7CA 2WC2A 2DTRA 3E5QA 1BJAA 5ERIA 1P6RA 1I6UA 2LDUA 1Z9CA 1UB9A 3KP7A 4PGHA 4EMSA 4XSZF 4AIHA 2GWRA 4Z2YA 2HKOA 1X9NA 1IN7A 5FPRA 5FLXZ 3SQNA 3QU6A 1E17A 2O03A 1XSVA 2OQRA 3WE3A 3IKTA 4I2OA 3BOQA 1LEAA 1AN7A 4LFCH 3U2RA 3SZTA 3T8TA 4NQWA 1ZLKA 4I01A 3LQQA 2PBIA 3QP6A 4A5NA 2EJRA 2M1BA 4DV1H 2VBYA 3T0YA 1K78A 4Y17A 3VEPA 4DV2H 1U5TC 2UXXA 4M9XA 5E20A 1YS6A 4BHCA 2LSOA 2FU4A 2IA0A 3K1NA 3M4IA 4JYAH 1JHFA 2VC0A 4A0ZA 2L4AA 2RNJA 4JQFA 4YIIA 4NXNH 3JAMZ 2UUAH 2P6SA 4DR7H 3JSLA 4A5MA 4ZYHA 3DEUA 2HEOA 4Q0YA 2OWOA 1YS7A 2AS5F 4ZZDA 1U2WA 4O6JA 1TNTA 1BIAA 1HQCA 3VOEA 3ROUA 1YFHA 4RGUA 4LGWA 2STWA 2V1XA 1XGNA 3F8NA 2GA2A 1BIBA 4KT5C 4ZZLA 1ZRFA 4EV0A 4Q4ZF 3L4JA 2KIUA 3MEXA 5LEJA 1R58A 1FOKA 4EFEA 2COMA 3CJNA 2FBKA 4EJOA 2M45A 3TQNA 1BGWA 3RKXA 5DCMA 2L4MA 5CVVA 4FM9A 1QPMA 4RZQA 2GIVA 4LF7H 5DD8A 5LL6b 3V8JA 1EV7A 2P6TA 4A2AA 2DLLA 4CDGA 1G3TA 5DDGA 2FQ3A 3KXYT 3GZ6A 4EVIA 2CO5A 1DDNA 2HS5A 3J80Z 3E6MA 2A68F 1U78A 3T1HH 4S04A 5LGTA 3ZMVA 3IKVA 1JGSA 4AD9A 1SFUA 1M0WA 4HBLA 3L2CA 4O3MA 3GF2A 1T0FA 1ZH5A 4UV9A 3V7RA 1ULYA 1S3JA 5J6XA 4B3RH 5LHHA 3QOPA 1G6NA 3BA9A 3GW2A 4UNOA 3KP6A 4TV7A 3K2ZA 2VE8A 3V8KA 1XCBA 2JSCA 3MZHA 4G94A 3FF5A 4DUZH 3EDPA 2EB7A 3L09A 2ZJ2A 3F8FA 4P5OA 3M7GA 5DD4A 5BQTA 4S05A 1ON2A 3K3VA 3LAJA 2DFIA 1XDSA 4KYWA 1ZN2A 4KHPH 4ENMA 2L01A 4LF5H 4JI8H 5H6RA 3RKWA 5L3FA 1Y0UA 3QPHA 1BN5A 4A6EA 2F5EA 5BPDA 2EV6A 2A07F 2FRHA 1K78B 4BNCA 3MAJA 4RGSA 1MDMA 3AAFA 2RDPA 2VBWA 3HRTA 1YG2A 5E1XA 4LH7A 4ETSA 4WX9A 3HRUA 2ZNZA 3ZP5A 4EFBA 3FM3A 3E6DA 4EEQA 1B6AA 1TNSA 1FSEA 1BJTA 5D5UB 2QBYA 3ZMZA 5D5VB 1TBXA 1TW2A 5LRSA 3FM5A 1DP7P 4KDPA 1B1BA 2M30A 1D8KA 2ZMEA 2ISZA 4UV8A 1QO0D 4MV7A 2A6EF 3CTAA 1P4XA 4B09A 3D0SA 1STZA 1H9GA 3GWZA 3SFZA 2YU3A 3BA8A 2VPSA 4BHBA 4HDUA 2PFBA 3ABTA 3IHUA 5IWAH 1FYLA 5CLSA 5LMUH 1R7JA 2NS0A 4LH6A 1FP2A 3T1YH 4DR2H 2XKOA 2CW8A 5D1OB 1LNWA 2XUBA 2DBBA 2CQKA 1FPQA 3GFJA 3DXJF 5D1PA 1SD7A 3F21A 2DPUA 3S2WA 1IN5A 3IWZA 3FWEA 2VC1A 3HSFA 3F22A 1R00A 5EEGA 3KZZA 4ZYDA 3I59B 2V79A 4H0EA 2K4BA 1NHAA 4JBAA 4LF9H 1W7PA 2HGSA 4WXHA 1IUYA 3KALA 3WGHA 3K9TA 1MKMA 2FNAA 3F6OA 1S7OA 3QRFF 5BR8H 4ESBA 4XBFA 2ZJTA 4HOBA 4N0BA 1GYFA 2A61A 2HTSA 1TTYA 2VONA 4R7RA 1FT9A 4L0YB 1AOYA 4OMYA 3E6BA 3ZPLA 2XAHA 4HF0A 3R61A 3F3XA 1R1VA 4NB5A 2PJPA 4OINF 3P9IA 4ESFA 2FXAA 1XD7A 3SZPA 3RI4A 3F72A 1O3QA 5HLGA 2HQRA 2H6CA 4JI2H 1SD6A 3GZ5A 4DR5H 3NQOA 4MV9A 1S68A 2VE9A 4PDKA 3R60A 1O3SA 4R79A 3BP8A 2XAJA 4UUVA 1FBUA 4PGGA 2IRFG 5D6EA 3LWFA 4CZZA 2F5CA 2O6GE 3CLOA 1ZGAA 2BYVE 4JK1X 2H6BA 1E4FT 3I71A 4UVCA 2OAZA 2NNYA 3CVZA 1SEIA 4UCRA 2FOKA 2IA1A 2DI3A 4I7HA 4F7ZA 5D4RA 2WDTA 1EH8A 4PZJA 2QBYB 2OBPA 3MCZA 2NRAC 1CF7A 1PDNC 4HZFA 2BBYA 3FXRA 5E1WA 2EV5A 4WWCA 2ZMEB 4A0XA 2ZKZA 3CUOA 4MGRA 1S8NA 1FYMA 4U7BA 4RB2C 2Y0MA 1I5ZA 4EJVA 1H9TA 5HLIA 2HOEA 3GFLA 1OYIA 2UU9H 1IAWA 3BPVA 4XLPF 1LDKB 2PI0A 4IRIA 3C3WA 3I58A 1K6OA 2MLGA 1ZREA 4CGZA 4IHTA 1W5TA 4LD5A 2HVRA 2UWMA 3GUDA 3WGGA 2ZM6H 4EJWA 4EGYA 1IRGA 4UVBA 2HR3A 4Y15A 4MQVA 2FEZA 2E5LH 1O7FA 4RB1A 3ERED 4AIKA 4OOIA 3FZVA 3M8EA 2Y75A 4YY3H 4APMA 3WTUC 5LGUA 1O75A 2H94A 1W5SA 3HOSA 2GQQA 1FVIA 2R7DA 2PG4A 4M72A 1KYZA 3PQJA 1HKSA 5AIQA 1YW7A 4IXAA 4IAJA 4U0WA 2OU2A 1DPUA 2WWYA 1LDJA 5ED4A 3V8LA 3ZMTA 2YX4A 1B04A 3J81W 4DNCA 3CDHA 3L9FA 1EH6A 1VTNC 1YLFA 5BOXA 3JSNA 2OZ6A 1K7AA 2BE5F 2V6CA 4HA8A 3ZMSA 3C1DA 3K1PA 3CO7C 2MA3A 5BS6A 1H0MA 3HIFA 2ZCWA 2FF4A 4Y13A 4B3MH 2P8TA 4LF8H 5ILUA 1UCRA 2H09A 3J81K 3F8CA 3VB2A 3QU3A 3EUHA 4ESJA 5JI6A 4I09A 5LHIA 1BI0A 3N43B 2EA2A 5F64A 2G9WA 4I0AA 1CF7B 2DQRA 3E5XA 2M8EA 3NEUA 2UXNA 3IC7A 2L54A 3B73A 2ISYA 4RAZA 1XSXA 1BI2A 4HLXA 3WTTC 3RYPA 2KJBA 2C6YA 5TJJA 1UFMA 1MJBA 4LB6B 1XCVA 4MTDA 3WGIA 2CW7A 2QM3A 1LEBA 2V1UA 1HW5A 2JRTA 3L7WA 5DCFA 3TGNA 3I54A 4G7HF 1Z2OX 3VFZA 4N9IA 2KJCA 4M71A 1Z7UA 5FD6A 3TOAA 1V9PA 2XAFA 5ICFA 1PP7U 2O0YA 1MJ9A 2DT5A 1ZGJA 2DU9A 1USTA 2GXGA 4G9YA 1WH2A 3P7NA 3HHGA 1HNZH 5D6FA 3I5UA 2FNPA 4LFBH 3TDZC 2VODA 2EFQA 2YSRA 5HS8A 1GVJA 4ENJA 3KZYA 5K5OA 4OX9H 1F1ZA 4IJAA 2IT0A 4JI5H 2Q2UA 3RF2A 5HDGA 2ELHA 1J75A 4CC6A 2ACJA 1MZBA 2XASA 3B02A 4RGRA 2F2EA 1LJ9A 5FB2A 5KVRA 2QQBA 5IT9W 4KMFA 5K5RA 2FE3A 5DYMA 3ECHA 2UXDH 4HF2A 2B0LA 1HNXH 3MWMA 2BGCA 2D45A 5JR3A 1TQMA 3ULQB 2KKOA 2QZ8A 2XAGA 5D1OA 1W4MA 4YFXF 2UUCH 2Z5UA 2A69F 2BV6A 4LK1F 2IJLA 1LVAA 3HTSB 4UCVA 2DAOA 3RTXA 1PP8F 5IT9K 5HS9A 1OR7A 3I59A 5F1RA 1XGMA 1HR0H 3DPLC 3C18A 4D0PA 3KEQA 1R36A 1J59A 5HVQC 4IRHA 5CYVA 3M9AA 4G6DA 1FBQA 1QNTA 4UCSA 5FGMA 3ZMUA 3WTWC 4K0KH 1SD5A 3KP5A 1R23A 2VN2A 2VQFH 2JPCA 3HRSA 4PDBA 2MLKA 3HOTA 4M74A 4ZYEA 1FZPB 1XMKA 5A2QW 4GYIA 2KIMA 3HYIA 1ODDA 3F23A 2UXCH 2FA5A 1XNRH 2XHKA 2E1CA 4YIFA 2EA4A 1R1TA 3DPTA 1HNWH 3DFGA 2DQLA 4KN4X 4OMZA 2AXLA 5CVUA 2JZYA 4HX8A 3MZYA 5EOYA 2RKHA 2ADUA 4LJZF 5JFRA 1G4DA 4HF1A 1T2KA 3NRVA 3K0LA 4HAMA 2F5FA 1FLIA 2QUFA 4RAYA 2MCTA 1FSHA 5A2QK 1P4WA 2HWVA 1G3YA 4P9FA 1T39A 1S7AA 5JHUA 1SFEA 3SXYA 1CGPA 1J5EH 1OYYA 4UCUA 3J7AK 2YCHA 1IBMH 1QBJA 5ICEA 4HW0A 3V4GA 3HUGA 4A2UA 5D8KB 3DKWA 1DUXC 4KNYA 3P9CA 4ON0A 4DR6H 1A04A 3H20A 2R7FA 3BJOA 4BHPA 3W6KB 2EFWA 5DV5A 1DGSA 4IRGA 4P96A 4KIBA 1HW1A 1ZRCA 1JXSA 2D1VA 4DR4H 1BI3A 4FT8A 2HVQA 4BH9A 3KP4A 1Z05A 1WRJA 1AWCA 4L5JA 3SHFA 3LMLA 1YW9A 4L9TA 2JTVA 2P5KA 5L3CA 5CJ9A 4LSXA 5AONA 4JI1H 1WSUA 2QWWA 3WTYC 4UCOA 1OYWA 2EFNA 1IBLH 2CWEA 2E1NA 5H6QA 1SFXA 3ZN1A 4G6QA 2Q0OA 4PCQA 4IVNA 4MHGA 3UQ8A 2ZO4A 3J81Z 3RIRA 1B9MA 4DV4H 4AQYH 2DPDA 4WK8F 2WE6A 1JHHA 1KU3A 3CUQA 5DUKA 1YQAA 4IF4A 4U0VA 2GAUA 1KU2A 4GGGA 4O5VA 1S6LA 5D5WB 1FY7A 3COAC 3ELKA 3JTGA 4BAYA 4B3SH 4EM2A 2H27A 3TOBA 4BQAA 2P7CB 1T98A 4E70A 4A2BA 3KFWX 1E4GT 5E17F 3Q9SA 3MQ0A 1QZZA 3J80W 4ASNA 1QGPA 3FMSA 2DK5A 4GYGA 1O7LA 3WU0A 1XGOA 1I94H 3O3KA 3H3ZA 2ZXJA 4B3TH 4DR3H 1RIOH 4L9JA 3Q5FA 2DW4A 3KLNA 3FHZA 3C0FB 1WI9A 1XGSA 2PMUA 3KE2A 5LEKA 3QPTA 1V3FA 4R1HA 3KETA 4DV3H 4L0ZB 3L00A 5J8CA 5E8IA 3J80K 3IL2A 5HLHA 2VOPA 3WODF 1C0WA 1FNNA 1GXPA 4M6YA 3M8FA 2MH2A 3TKYA 4CYDA 4GLXA 2W84A 5ICCA 2GXBA 1MJAA 3RTRA 4WXCA 5DEQA 5L3BA 1RI7A 2Z33A 2HVSA 5LMNH 1J5YA 2MH9A 2FMLA 2X0LA 4OIOF 2CFXA 4A6DA 3N97A 3KAKA