4RAZA

Crystal structure of magnetospirillum gryphiswaldense msr-1 holo-fur
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
b'MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4razA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4razA02
3CUQB 3GO5A 2ZO4A 1ON2A 4CZZA 3ZN1A 3ZN0A 4HZFA 4KT5C 4JK1X 5HDGA 4B09A 2MBFA 1HW1A 1XGSA 2CGPA 1FZPB 1VTNC 4RGUA 4PGHA 2L01A 2FF4A 3B02A 2DW4A 5ICGA 4M71A 1J7KA 1YTYA 3MZHA 5L3DA 4ZYEA 2ELHA 2FA5A 1G3WA 4IRIA 3IKVA 2B0LA 2UXXA 3J80Z 5TJJA 1IXRC 1XD7A 5BQTA 2M8EA 2IVMA 3RIRA 4FHTA 4M72A 4HLXA 2XKOA 3ISPA 1WSUA 4U0YA 1XMKA 3GFLA 1W7PA 1QGPA 1U5TB 2KRFA 5ILSA 2IA2A 3BPXA 2AS5F 1ZG5A 3JAMK 2LF7A 2W57A 3W6JB 2F5DA 1FNNA 3LQQA 4CO8A 2YX4A 2RGVA 4U88A 2EJRA 3RKXA 4PCQA 2QUFA 3RKYA 4HBLA 4E70A 2OZ6A 3WE3A 5ERIA 3DV8A 1FBUA 4R8HA 1O3SA 4CGZA 1ZRCA 1BOAA 3BDDA 2VBYA 1FYMA 4N9HA 4O3MA 4A6DA 5JI6A 2HKXA 2IP2A 3I64A 1T0FA 1F9NA 4G7OF 3K2ZA 2EV0A 5ILUA 5IT9K 2JTVA 3CUQC 1QO0D 5D5UB 1ZN2A 4HQEA 1USSA 2Z5UA 1MJBA 1ZREA 2GQQA 3T5XA 4IPAA 4B8XA 5DCMB 4DNCA 3D0SA 3MAJA 1UB9A 5BS6A 3GF2A 4XLNF 4HA8A 4BHPA 3Q9VA 1W7PD 3EYIA 3FF5A 1R1TA 3M8FA 3ZMDA 2V6CA 3P7NA 2DPUA 1QBJA 2BYVE 3COAC 3ABUA 1JHFA 3P9KA 2VC0A 3ZMSA 1QQIA 2OU2A 4Y17A 2KJBA 3WE2A 2K4JA 3H3ZA 1ZGJA 2COMA 1LDKB 2UWMA 4KICA 5DDGA 1S7AA 3EETA 3TO9A 2K02A 1IRGA 4EGZA 1IN6A 1TNTA 3L09A 4YIFA 1KYWA 4Q47A 2PBIA 3F72A 1U5TC 2OZUA 3QPTA 3F8BA 2VXZA 3TOAA 3HSFA 3BWGA 4RB0A 3R0AA 4RGRA 1XGNA 2EFPA 2MC3A 2CQKA 2MLGA 1F1ZA 5LEJA 4RS8A 3MEXA 4ZZDA 2AXLA 2P7VB 2DT5A 2W24A 4OU0A 1KA8A 1CGPA 1IZ1A 3E6BA 4EJVA 5FFXA 3K0LA 3M8EA 1R36A 4ZYGA 5E8GA 1IN5A 1JGSA 4G6DA 2NYXA 1UFMA 2JPBA 5FLXK 5K5QA 1KU2A 3P9CA 4AD9A 1O3QA 4PZJA 5E1WA 2ESNA 4MHGA 4S04A 2R7DA 3MCZA 4ZYDA 1ZHFA 3E5QA 3ZPLA 1OKRA 2MH2A 5LHHA 1FSEA 1KU3A 3TKYA 2ZXJA 1SD5A 4OIQF 3GLXA 3LA7A 2PMUA 4Y15A 1OYIA 4LB6B 2DTRA 1HKQA 1DDNA 2FMLA 1R22A 2GXBA 1EH6A 3TO7A 3RKWA 1KQ8A 2VE9A 1SAXA 2GA2A 4MEXF 4KDPA 5LGUA 5DD8A 1IN4A 4I0BA 3K1MA 1K78A 3LAJA 4HF2A 5JVTA 3VODA 3CDHA 1S6LA 4LGWA 1ONVA 4FX0A 4HAMA 2VOPA 2JSCA 1OYYA 1J0RA 2ZCWA 4IJAA 4WCGA 5EEHA 2NS0A 1F4KA 4M73A 2F2EA 4GYGA 2M5WA 1U8RA 2R3SA 1P92A 3F6OA 3HRTA 3M1EA 2GAUA 2PQ8A 1PDNC 3CUQA 4O5VA 3F8NA 3EQLF 3K1NA 4G7ZF 2YSRA 1T2KA 2HKOA 1QZZA 2O3FA 1Y0UA 3HSRA 2G9WA 4UUVA 2PFBA 3V7SA 3VB2A 2K27A 2A61A 1ZGAA 3GW2A 2EWNA 3RDIA 1J5YA 1SFXA 5L3FA 3F22A 4CYDA 1FWZA 4MTDA 5FD6A 3I5UA 2FEZA 2HS5A 3KLOA 4N0BA 4LLGF 5A2QZ 1UHMA 5LBQA 3V7CA 2A6EF 1XCVA 4ETSA 1X3UA 1XGOA 1W5SA 3DKWA 3CO7C 4ENMA 4PGGA 3ZP5A 2WTEA 3CLOA 1Z91A 2XAGA 5LHIA 3TOBA 3BJOA 2XAHA 4ENNA 4HQMA 2WC2A 2V9VA 4KIBA 4L9JA 3F21A 1KU7A 2QQ9A 2Z9OA 3E5UA 4IRGA 2H09A 4LMYA 4I01A 2QZ8A 5F64A 3WU0A 5ILVA 2V1DA 1U5TA 5L3CA 1EH8A 4A0XA 4EGYA 5H6QA 1Z1DA 4CICA 5D6FA 2H27A 1S8NA 3CO6C 2LF8A 3C7JA 4GGGA 5F6FA 3KCCA 5E17F 1XDSA 1YW9A 3H92A 2KIMA 4I2OA 2ADUA 2E1CA 3JSPA 3N4MA 1P6RA 1MJAA 2VOOA 2EV5A 4YFNF 4Z2YA 4RB1A 3DXJF 1G6NA 3FMSA 1ZG1A 1P4AA 2NAZA 4KN4X 1RZ4A 1ZH5A 3IWFA 5CJ9A 5FFZA 4UVCA 4LG0B 4UV8A 2FU4A 1H9GA 2STWA 3R60A 4ON0A 2BBYA 4HOBA 4A12A 4U0VA 4IVNA 1MGTA 1SD7A 4MTEA 1TTYA 1MJ9A 3E3VA 4HF0A 3BROA 5HDKA 1L0OC 2VE8A 3IWZA 3G73A 1P4XA 1SFEA 4UHTA 4BAYA 1GHCA 1WRJA 2IPQX 2HGCA 4L5IA 2YU3A 3J81Z 2EK5A 1FP2A 2Y0MA 2EFQA 2K86A 5JFRA 1R58A 3F8FA 2MLKA 3NQOA 3F6VA 4OINF 2A68F 2V79A 1BBYA 1BC8C 3SZTA 5D5WB 1IF1A 3QOPA 1MDMB 1U6GA 4AIJA 3HUGA 3KEOA 1SFUA 2JZYA 4P9UA 4CXFA 4IHTA 2HDCA 1W4MA 3GZ5A 4GYIA 1FPQA 4GO1A 4L9VA 5DUIA 2A69F 1KGSA 2STTA 1KQ9A 5D5XB 3W6KB 5EEGA 2EA2A 4WK8F 4HX4A 5LRRA 1MKMA 2DFIA 4D0PA 3ZMTA 1K7AA 4MGRA 3R61A 2CWEA 1HW2A 3GFIA 4EJUA 1Z7UA 3M7GA 4CDGA 4M74A 2HTSA 1XSXA 3JTGA 5FB2A 5ICFA 4G9YA 3DPTA 2CG4A 4M9SA 3WTYC 4I09A 4HDVA 1PUEE 2RKHA 3WGGA 3ZMUA 6PAXA 5ED4A 3SFZA 4EM1A 1H0MA 1BI0A 3V8JA 4I7HA 3MQ0A 3SQNA 1FYKA 4QWQA 2ZMEB 3BJAA 1DP7P 1FC3A 2EV6A 4ESJA 5E1XA 1HSTA 3U1DA 4HDUA 1USTA 1Z6RA 1V4RA 1FBQA 2D2WA 1S29A 5H20A 2VN2A 5DV5A 3IRQA 3F8CA 4ZYHA 3P9IA 4I98B 1S3JA 3I59B 2OD5A 1LJ9A 2KJCA 1B59A 3HHHA 3FMQA 3GFMA 1XN7A 1LEAA 3VOEA 2CYYA 2F5FA 2JPCA 1I1GA 1TLHB 1KU9A 2ZFWA 4YFXF 3WTUC 1E17A 4HW0A 4AIHA 2Z99A 1OMIA 3VEPA 4TV7A 4P55A 4RB3C 2PN6A 2WV0A 5H6RA 2Y75A 2V1XA 4UVBA 5K1YA 1V3FA 5E18F 2TDXA 1R7JA 2XVCA 3OV8A 2YR2A 2EA4A 5E1ZB 2Z3YA 1T98A 1IRFA 4OMYA 3I0TA 1R5GA 3RYRA 4RAYA 2DO7A 2HWVA 2QLZA 2XAFA 3QRFF 1KQ0A 3ABTA 1B9NA 3RYPA 3HRSA 1D8KA 3ELKA 4LK0F 3WTWC 1L3LA 2ZNYA 4Y13A 1W5TA 2D45A 5CYVA 2XROA 2LKPA 4U7BA 2L4MA 2CFXA 2ZKZA 1RNLA 2IW5A 2QBYB 2A07F 4KYWA 2F5CA 2GWRA 3HRMA 3JW4A 1YS7A 3FX3A 1SMTA 3DF8A 1SMYF 5D8LB 3CTAA 3MFKA 2BGCA 1ZG3A 1Z9CA 2KIUA 3TQNA 2XRNA 1RI7A 1HXDA 1TBXA 2O0YA 1GXQA 3ZMVA 1IXSB 3LAPA 2RC4A 2VONA 4CHUA 4LK1F 2DK8A 4S05A 4N9IA 4IXAA 4Q48A 1J9IA 1GVJA 1ZARA 2E7WA 3JAMZ 2FNAA 2RV8A 3GWZA 4LB5A 3EYYA 5L3GA 1BN5A 3T8RA 2A3SA 2MD5A 4A2UA 1YLFA 3TDZC 2KIFA 2FOKA 1FX7A 5CVJA 3IL2A 1REPC 4KNYA 2G7HA 5HOOA 2XUBA 5HS8A 2IT0A 1JHHA 4LJZF 1BI1A 4G6QA 2VC1A 4XBFA 2HR3A 1FBSA 1LDJA 2E1NA 4I02A 3N97A 3NEUA 4LG0A 2K7LA 2P5LC 1DPUA 3B73A 4DQ2A 4NHJA 5IT9Z 5IT3A 1CF7A 2RNJA 1YW8A 1JE8A 3KP3A 1PP8F 2R7FA 5DCFA 1AWCA 3I54A 3V7RA 3I71A 4BQAA 4EQQA 2FXAA 2HYFA 3KP4A 4G94A 4EV0A 1RUNA 3HOTA 5BOXA 2CO5A 2UXNA 3L7WA 4NQWA 4YFKF 3HTSB 1MZBA 2XV4S 2A6HF 3KP6A 4KFCA 3GVAA 2P5KA 4JQFA 5LLQA 2QWWA 1AOYA 3QP6A 1G3TA 3WU1B 1UHWA 4F7ZA 3PFIA 3E97A 2RDPA 3J80K 1R23A 4EMSA 1ON1A 2A5YB 2OBPA 2P7CB 2BV6A 1KYZA 1XSVA 3VFZA 4HV6A 1BM9A 5JHUA 4EJTA 2L4AA 2L54A 3BOQA 2IJLA 1SD6A 1LQ1A 5K5OA 2CSOA 2DI3A 2DK5A 3RTRA 1J59A 1UCRA 3DQVC 1D8JA 3F3XA 4L0YB 4BNCA 1YFHA 3HHGA 4BYYA 4KMFA 2O6GE 2HQNA 3QP5A 3L2CA 5KK1A 2X0LA 3QAHA 5JR3A 2IA0A 2G7UA 1U3EM 3R6SA 2P8TA 2XASA 2NNNA 2XGXA 3F8MA 5FLXZ 3IKTA 3L9FA 1FP1D 2H94A 4A5MA 4HV5A 3H3UA 4LLLA 4KN7X 3K9TA 3SHFA 2PJPA 3V8KA 4XSZF 5D5VB 2MA3A 2PG4A 3K1PA 3AAFA 4XRFA 2LNBA 3GX4X 3HYIA 4WXCA 4XSXF 4JBAA 1LVAA 2QQAA 3JTHA 5TRDA 3O6BB 5AIPA 2ZMEA 3ECHA 3IRRA 2JT1A 4HX8A 5E20A 2RVCA 4G8XA 2X4HA 3DPLC 1IUYA 2D1VA 1JXSA 2FBHA 3QU3A 1TQPA 3FXRA 4UV9A 4OIPF 1FOKA 2LDUA 4U7DA 1O3TA 5DCMA 3L00A 3I59A 4IF4A 3FXQA 4ENKA 1U78A 2HZTA 1C0WA 3GYHX 4EVIA 1IN8A 2L02A 2O61A 4G7HF 5LGTA 1ZYRF 4WXDA 1QNTA 3HTUA 3DP7A 1I27A 1A04A 2FRHA 2W84A 5J6XA 3WTZA 2E7XA 2F5EA 4HX7A 1B4AA 3FHZA 2HEOA 5FGMA 1BI3A 1XSDA 5CVRA 4KIFA 5L3BA 5FD5A 1B9MA 4MQVA 5BMZA 4OOIA 4L18B 4XLPF 4QLCU 2DAOA 3PQKA 3GXOA 3SXYA 2ACJA 4YG2F 1XGMA 4A0YA 3J7AO 5AIQA 1IAWA 2UZKA 5L3EA 4I0AA 5BPDA 3WTTC 1R1VA 1ODDA 2O03A 1XCBA 3KP2A 2VT2A 3MZYA 4M6YA 4A6EA 3R0JA 2VBZA 2FBKA 4IRHA 5E8IA 4BXUA 3V8LA 3ZQ7A 4KA4A 3U9GA 1O57A 2QBYA 3Q5FA 2YPRA 4L0ZB 1G3SA 1YW7A 1O7FA 4OIOF 1R5HA 1WQ2A 1ZRDA 3ULQB 4M9XA 2GXGA 5CVIA 3GUDA 4U0WA 2WWYA 1FT9A 4AWXB 1EH7A 1EV7A 5AONA 3KZYA 5DEQA 1HQCA 3DFGA 3K69A 2PI0A 3BP8A 2P6SA 3G3ZA 1B1BA 3ERED 4RGSA 3LA3A 2JRTA 2HQRA 2K4BA 2RQPA 2DQRA 3I53A 1RIOH 2FMYA 2W85A 5DUKA 1Z05A 4ESBA 4HF1A 4ZH4F 3LFKA 3CJNA 2OAZA 2XKPA 2QYOA 2P5VA 2KKOA 3FWEA 1I6XA 3BZ6A 1YIOA 4L9NA 4ASNA 4R79A 2H6BA 2Q0OA 1U2WA 2EFNA 2D1HA 5J8FA 4ESFA 1R00A 3RPUA 2L3DA 1K79A 1DUXC 3C3WA 2VODA 5HVQC 3LSTA 2NRAC 2Q2EA 1I1SA 4KIGA 1YG2A 5HS9A 3GZ6A 2FBIA 1G4DA 5D6EA 4RAZA 4ENJA 2OQGA 5LRSA 1TW3A 3I4PA 3ECOA 3LQRA 4L5JA 3WTVC 1TQIA 1ZLJA 1HKTA 2M45A 5CVUA 1HW5A 4WWCA 5A2QK 3MWMA 3D5LA 3OOPA 1NHAA 3TO6A 4OMZA 2ZJ2A 1O7LA 3HSEA 3F23A 2ISYA 1Q1HA 1ZAOA 1F5TA 4YIIA 4MEYF 3EDPA 5BPIA 3ML6A 1LB2A 1R1UA 4MNUA 3FZVA 1ULYA 2XAJA 3WG9A 2BEOA 2DBBA 3WTSC 1Z6TA 3LA2A 1G3YA 3EUHA 1OPCA 1T39A 1K6OA 3WTXC 3HIFA 3R4KA 5HLIA 4P96A 4EJOA 1YQAA 4KUMA 1IXCA 1W7PB 3RI4A 2HOEA 3E6MA 3I58A 1WWXA 1XB4A 4UVAA 4LD5A 2RN7A 2ZBKA 1YO5C 1IW7F 1ZRFA 1FYLA 5HLHA 4H0EA 1TW2A 1WI9A 3JSOA 2EB7A 5HS7A 3CUOA 4WX9A 5D8KB 4NB5A 1PP7U 3Q9SA 2MH9A 4RGXA 2J5PA 4EM2A 3E6CC 1T6SA 4R1HA 3DEUA 1FY7A 2DU9A 5J8CA 1STZA 2LSOA 4OIRF 1TNSA 4EJWA 3KLNA 2Q8KA 1J2XA 4Q4ZF 2J5OA 1E2XA 2YX7A 4FX4A 2DLLA 2ZNZA 1XMAA 2XAQA 2IA1A 5ICCA 3KP5A 2FE3A 1OR7A 4EM0B 1SD4A 3QPHA 4O6JA 3FM3A 3BY6A 1LEBA 2GA1A 2O8XA 3M9AA 3HOSA 3ROUA 2ISZA 3TDUC 4WXHA 3SZPA 3KE2A 3J81K 2DQLA 2FQ3A 2QVOA 2M1BA 2VT3A 2W25A 3WGHA 1BJAA 3FM5A 2V1UA 4KMUX 1DPRA 3RPQA 1HBXG 1IN7A 1QPMA 5FO5A 2QM3A 3PQJA 4ZZLA 2VBWA 1GXPA 3BPVA 2EFOA 1WKMA 1O3RA 2HYGD 3NRVA 5D4RA 4RB2C 2XHKA 4LFUA 3QU6A 2HTJA 2VBXA 3S2WA 2M87A 3T1BA 3RJPA 1ZLKA 1MDMA 3E6DA 3HRUA 4IHSA 2GZWA 4GCVA 3C18A 1P4WA 1D5VA 3U2RA 3T0YA 5F1RA 1P2FA 4AVPA 3IHUA 4GXOA 3O2PE 1QZYA 3T8TA 4AIKA 3ZMZA 3KZZA 4A0ZA 3WGIA 2QQBA 1HSJA 1I5ZA 1OYWA 5LHGA 1RUOA 2P4WA 5KVRA 2Z33A 4K2EA 1T38A 2C6YA 3FMRA 1LNWA 4BHCA 5LEKA 1FLIA 2ESHA 2HFHA 3WODF 4M9ZA 1YS6A 4WF2A 5CVVA 1TQMA 1YYVA 2FSWA 1XDUA 2CW0F 4BHBA 4MQ9F 1BI2A 2PMHA 4PDKA 4FT8A 1BIBA 2FNPA 1S7OA 2EFWA 2XIGA 1B6AA 2PLYA 4LLNA 1J75A 3GEZA 4UNOA 2DPDA 3E5XA 4M6XA 1D3YA 2NNYA 1HKSA 4Q5SF 2OA4A 5CLSA 3KP7A 3V4GA 2H6CA 1BIAA 5D4SA 4L9TA 2P6TA 2OQRA 4UXNA 1K78B 3BJ6A 5HLGA 4HYEA 2ETHA 3KFWX 5DYMA 3KETA 3GFJA 5K5RA 2BE5F 5HDNA 5DD4A 2GIVA 3KEQA 4HLYA 2QENA 1BC7C 2Y48A 3IC7A 4P9FA 2PEXA 3REOA 1CF7B 3TGNA 1FSHA 4A5NA 3O3KA 5LGNA 3FXUA 2IRFG 1LDDA 3C1DA 3LWFA 1H9TA 5ICEA 4BH9A 1MD0A 4P5OA 2M30A
chains in the Genus database with same CATH superfamily
2PX9A 3CUQB 3GO5A 4IZOA 2ZO4A 3K4KA 4BE2A 1KJ9A 1ON2A 2WB1E 2R8GA 4CZZA 3ZN1A 2CV1A 4MV4A 3ZN0A 1T3NA 1R4MB 3N40P 1TZLA 3GMEA 4HZFA 4KT5C 1V4YA 4JK1X 5D1OA 5KFCA 1TAEA 2TCTA 5HDGA 1FVIA 3N05A 3SDBA 4DYCA 3KEYA 1AKHA 2E2IA 1JTYA 2XF6A 4EEFG 4B09A 2VPLA 2NXNB 3L2VA 2MBFA 2RREA 2NU8B 2HU9A 2FK2A 4F3QA 3IH4A 1UMQA 4A93J 1HW1A 2OTLI 1XGSA 3JRWA 3OMYA 1OLTA 3ABMH 2CGPA 3PO3J 2KMUA 5J3LA 4M6VA 4B3AA 3WG7H 1FZPB 4O3NA 1VTNC 4RGUA 3MR3A 4PGHA 4QIWN 1JUPA 4BUPA 2ZDQA 3G8CA 1RR7A 2R8IA 5CQEA 2JA8J 2L01A 3UR3C 2FF4A 3B02A 4B1RA 2DW4A 3L1PA 4ECQA 1Y8RB 1ETYA 1T56A 5ICGA 4DOZA 1FOXA 4M71A 1N75A 5DM6F 1J7KA 1MH4A 1YTYA 5M5YJ 4OWRB 2DMTA 3MZHA 3KAKA 2VA3A 4DR1H 2KL4A 5L3DA 4BDYA 1W96A 1TWHJ 2RDJA 1YOVB 4JI8H 3M3YJ 2V4QA 3FBNB 3ESWB 2R7TA 5KNLA 4ZYEA 3KXYT 2ELHA 2FA5A 2R6FA 1JKJB 1G3WA 3SFIA 4IRIA 2LMDA 3IKVA 2B0LA 2IA6A 4DV0H 1SFOA 2UXXA 2JVHA 4JX4A 5J2UF 1BA5A 4QWEA 4MV1A 3J80Z 4FCYA 5TJJA 3HOWJ 1IXRC 4IRCA 5L1JA 1XD7A 2HYJA 2DDAA 4F4WA 2XPWA 2HQAA 2R92G 2WB1N 5BQTA 1K4TA 2M8EA 3RGXA 2IVMA 3RIRA 4FHTA 2NU6B 4QW8A 4NC8A 4M72A 4BWSC 4HLXA 2XKOA 3GTOJ 2ZDGA 4EFBA 4JI1H 3ISPA 1CE8A 4LIVA 4U0YA 4MLOA 1XMKA 3GFLA 1WSUA 2HXIA 3VPDA 1W7PA 2VKVA 5C5JA 4U6PA 1QGPA 1U5TB 2KRFA 5ILSA 4LH7A 1I3AA 2IA2A 2GPWA 3BPXA 2AS5F 1ETQA 1O4XA 1ZG5A 3JAMK 3PVXA 4FBTA 2LF7A 2W57A 3H3VH 2EILH 1DIKA 3W6JB 2F5DA 1FNNA 3LQQA 4CO8A 3OYNA 2QEXI 3KAJA 2YX4A 1IV6A 2R82A 3G6VA 2RGVA 1FJLA 4DV6H 2JN6A 4G6TB 4U88A 1Y6IA 2EJRA 1HR0H 5KG6A 3PSIA 1SVLA 4EGQA 3RKXA 3PIPF 1JKRC 2NVTJ 4PCQA 2QUFA 2NVUB 4XN3A 3RKYA 2FP4B 3H0DA 4FS2A 4HBLA 4E70A 2OZ6A 3IAM2 3WE3A 5ERIA 1O75A 2YZNA 3DV8A 1VKZA 2R84A 1FBUA 4R8HA 1O3SA 3T5HA 2BQRA 4CGZA 3PFYA 2CUFA 5K7FA 1IO2A 3S93A 1ZRCA 1LKXA 2NOJB 3BR0A 3E1SA 3PR4A 1BOAA 1GLVA 3GIMA 4V2GA 4QJFA 4PK4A 3CMEI 1VQ6I 4LF6H 5DQHA 3BDDA 2PJRA 3RZOJ 2VBYA 4XKCA 1YE9A 3LNQA 3FHNA 4RM3A 4N9HA 1FYMA 4DV1H 4M3FA 2LRDA 4O3MA 1WGXA 5KFIA 4A6DA 4NLGA 2EBIA 1MH3A 5JI6A 2JA7G 2Y0SE 2HKXA 1U8BA 2IP2A 2GBYA 1T0FA 3I64A 4II2A 4DIQA 1F9NA 4G7OF 3K2ZA 2DYRH 2DMPA 2EV0A 5A2QW 5ILUA 5IT9K 3BAAA 2JTVA 3E0JB 3CF2A 2M05A 3CUQC 2ZJRF 1QO0D 1LFBA 2UVUA 5D5UB 4M3DA 1ZN2A 3BCBA 4HQEA 3HKZE 1ZKGA 1USSA 2Z5UA 1M1EB 1MJBA 1ZREA 4O2AF 4ABZA 5KT5A 2R93A 5TGTA 2MYSA 2GQQA 1CQJB 4MA5A 3K7AJ 3T5XA 1LFUP 3OR2C 2FB9A 4IPAA 2XGQA 2X6YA 4XICA 3MWEA 5FPOA 4B8XA 3K4JA 2G0EA 4AQYH 5DCMB 2I8DA 3ETHA 4X65H 3RV4A 4DNCA 1RK6A 5KG7A 2LP0A 3CCYA 3D0SA 3MAJA 1UB9A 3ZGKA 3HJEA 5BS6A 4QWBA 3GF2A 4XLNF 4HA8A 5KT7A 1X2MA 3Q8SB 2OH2A 4BHPA 3Q9VA 4LOCA 1Z3XA 4DBQA 4A3JJ 1W7PD 5IP6A 3EYIA 3FF5A 1R1TA 3M8FA 4BJ5C 5HNHA 3ZMDA 2V6CA 3P7NA 4LIUA 2DPUA 2H1KA 2VOBA 4DR5H 4S0HB 5JHFA 4ECVA 2VA2A 4JI6H 1QBJA 2BYVE 3MKWB 1X1AA 3COAC 3ABUA 1JHFA 4DV3H 3P9KA 2VC0A 3ZMSA 2ZXWH 1J09A 4I4TF 4JV5H 1QQIA 1X3ZB 2OU2A 2O5RA 2VL8A 1BJTA 3B6AA 2CUJA 2KJBA 4Y17A 1S0MA 3IG0A 2XC7A 2YCHA 3LSHA 1VQ5I 3FISA 3WE2A 2OC6A 4BEHA 4U7CA 4A3GJ 3BT9A 4HSTA 5KFYA 2ZC2A 3WHBA 4EGJA 2XB5A 5FKLA 3PW4A 1TWFJ 2ID6A 3SDGA 2K4JA 2Y0SN 1GT0C 1ETKA 2FK1A 1Y1VA 4AYBE 3H3ZA 3BABA 1ZGJA 2WYOA 2COMA 4AIDA 1SEUA 3WNZA 2W6NA 4Y52J 1LDKB 2UWMA 2V6EA 4KICA 5DDGA 4J9RA 4YR0A 4EYHB 1S7AA 2IGOA 4UUSB 5KAFC 2DTZA 2HPIA 3EETA 3WO1A 4A93G 3TO9A 2K02A 4Z6YA 3HUGB 1QVTA 5M5WJ 4EGZA 3HKZN 1IRGA 5KG2A 3DU5A 1IN6A 4YR2A 1TNTA 3L09A 4YIFA 3PO3G 1KYWA 4Q47A 5DTDA 2PBIA 3F72A 1BNCA 4CSWA 4ED7A 4J9OA 3R23A 1U5TC 2P0AA 2OZUA 1OISA 3QPTA 4XLFA 3K3VA 5FKKA 4BBRJ 2C00A 1N34H 3F8BA 2HGSA 3LSPA 2VXZA 3TOAA 1M0WA 3HSFA 4ECRA 2JA8G 3BWGA 5IP7J 4RB0A 1WPKA 3R0AA 4UFZA 4RGRA 2DOFA 2X6XA 1XGNA 2EFPA 2MC3A 2KSWA 5KG3A 1RKTA 2CQKA 3BTLA 2NVYA 2MLGA 3N43B 4A3IJ 1F1ZA 1TA8A 5LEJA 1RYRA 3A03A 3MEXA 2F4OB 1Q1VA 4RS8A 5EF6A 4A3DJ 1K6YA 2JA2A 4HNUA 4ZZDA 2AXLA 2Y2ZA 2P7VB 3OHAA 2ID3A 2DA7A 2DT5A 2W24A 5HBRB 2W48A 4OU0A 1KA8A 1CGPA 4ITVA 1IZ1A 3E6BA 2K9NA 5KFDA 4EJVA 5FFXA 3K0LA 1E4GT 3RBEA 3M8EA 1R36A 4RNMA 3GTPJ 3KYDB 4ZYGA 4JP0A 5E8GA 2WV1A 5F9LA 1IN5A 1JGSA 3ORQA 3HOWG 4G6DA 3MFIA 1Z0XA 1FMVA 4P1WA 3LL7A 2ZSHB 3HOYJ 1ETXA 1RJQA 2ATLA 2NYXA 2VPRA 1UFMA 2YRXA 3GQCA 1RYSA 4B3MH 2JPBA 3VDXA 5K5QA 5FLXK 1KU2A 3P9CA 4XN0A 1OCTC 2BY3A 3WO0A 3QYEA 3DTKA 4AD9A 3W6VA 1O3QA 3Q0WA 3H0GJ 2IMWP 4PZJA 2DODA 3EUKL 5E1WA 4AYBN 2LTPA 2VJIA 2ESNA 2KFDA 4MHGA 2E71A 2R7DA 4S04A 4AM3A 3MCZA 4PJ0C 4ZYDA 2R86A 4ECZA 3BCAA 1ZHFA 1S03G 4IHYA 2VUMA 2WAFA 2W8KA 3E5QA 4J00A 3ZPLA 3T1HH 1OKRA 1WJEA 2E2HJ 5LMNH 4ZC3A 3L2WA 2MH2A 5LHHA 2NU9B 4HG2A 5KFBA 3J81W 2E5LH 1FSEA 1KU3A 3HEFA 2CMPA 3TKYA 2YU9J 2ZXJA 1SD5A 2YS9A 1GSOA 4OIQF 1D1AA 3GLXA 2IGNA 4JOMA 3LA7A 2PMUA 2MD0A 3HGGA 4Y15A 1BXRA 1E3PA 4J9KA 3T5JA 1OYIA 4LB6B 2DTRA 3RSNA 4DW6A 3A01A 1HKQA 3I4MJ 3VMMA 1DDNA 1FIPA 2FMLA 1R22A 2GXBA 5FRMA 4ZOLF 1EH6A 3G6EI 1FKAH 3TO7A 5IP9J 1X4PA 4TV9F 3RKWA 5JVGF 3RV3A 3JRGA 1KQ8A 1R9TJ 2VE9A 2VXDA 1LVKA 2VIXA 2CH0A 3K3PA 3TBIA 3BR2A 2VR1A 3PW0A 1SAXA 2UUBH 2DJNA 2PVPA 2GA2A 3PO2J 3K4BA 3VYSB 2M0MA 1I6HJ 1JI8A 4LFAH 2JEIA 5FPRA 4MEXF 4KDPA 3SE7A 2QQ8A 5LGUA 2XB0X 5DD8A 1IN4A 4I0BA 1X1CA 3K1MA 1K78A 4GLXA 3OR1C 3RB0A 4IOCF 2W7NA 5C3EJ 3LAJA 4HF2A 2DPIA 5JVTA 3VODA 3CDHA 1S6LA 3M07A 4LGWA 4JYKA 1VQLI 2I8CA 1ONVA 2KZGA 1YHQI 2IS2A 4EBCA 3V4SA 3AG2H 5IOYA 4FX0A 3BG3A 4IHWA 4HAMA 4RA2A 4CCLA 3MWDA 3R5FA 2VOPA 2R8JA 2JSCA 3T5KA 1OYYA 1J0RA 1V55H 4Q8FA 1AA7A 4F92B 2ZCWA 4IJAA 2L9RA 1U9OA 4PFPA 4WCGA 5EEHA 2NS0A 4C2MJ 3DBRB 1F4KA 4M73A 2VJ5A 3JRIA 4MO7A 2F2EA 4IZZA 4GYGA 1UC9A 4U87A 2M5WA 2Q2EB 3H35A 1U8RA 2NUAB 4YELA 2FX0A 3TMOA 1K1QA 1OCZH 1IJWC 1Y1WA 5EGOA 1W0UA 2R3SA 1P92A 5JVDF 4A3JG 3F6OA 1WH7A 3HRTA 1WJDA 3M1EA 2GAUA 2FLPA 2PQ8A 1PDNC 4MFDA 3JRAA 3CUQA 1HDDC 5KFAA 4YP3A 4RUCA 1QHGA 4O5VA 3F8NA 2BW3B 2KPMA 3EQLF 3K1NA 4G7ZF 2M9HA 5KFZA 2YSRA 1T2KA 2HKOA 2HHHH 3DKYA 4XRSA 1PK8A 3GIJA 1N33H 4QTRA 2NS7A 1QZZA 2XCLA 2O3FA 3J7YJ 1K83J 1FEXA 1Y0UA 3HSRA 2G9WA 3WHCA 4UUVA 2VJJA 4LFCH 4A3GG 1XTAA 5LMUH 2PFBA 2KISA 3V7SA 3VB2A 3S2HJ 2J9GA 2K27A 2A61A 1ZGAA 3GW2A 4GKKH 1RR8C 1I7LA 3K5HA 2EWNA 3RDIA 4A3FJ 2Q2TA 4HNVA 2EINH 2L7ZA 3KIOA 1J5YA 1SFXA 1Y8QB 3S8PA 5L3FA 2M7AA 4CYDA 3F22A 4E7SA 3DLLF 1FWZA 2R5YB 4MTDA 2E60A 2FMAA 1E4FT 5FD6A 1S0OA 4JX5A 3RBDA 3I5UA 2Q2UA 4WBNF 2WTFA 2FLLA 4B47A 2FEZA 4YQWA 2HS5A 4JI4H 5BR8H 3V6KA 3KLOA 4N0BA 5EZYF 3CD6I 4LLGF 3ZRGA 5A2QZ 1D0ZA 1UHMA 2F48A 2R5ZB 4XKWA 5LBQA 1Z77A 2J6UA 4K0KH 3V7CA 3IAS2 2A6EF 1XCVA 1S0NA 4L5EA 1OQYA 1HC8A 3GTMA 4BBRG 2W71A 4ETSA 2BHYA 3K4NA 1X3UA 1XGOA 4A2BA 1W5SA 4DUZH 3DKWA 3CO7C 4ENMA 5IP7G 3QQAA 2VPQA 3KTMA 4PGGA 2KRCA 2WTEA 2EIKH 3OYDA 3ZP5A 4FBUA 3CLOA 3HPGA 4BY7J 2QKMB 1Z91A 2YS7A 4C3IJ 3ZXSA 4A3IG 2X6OA 2XAGA 5LHIA 3TOBA 3BJOA 2XAHA 3SJMA 1ZETA 4A3DG 3K10A 4ENNA 4HQMA 2CQ7A 2HOTA 2WC2A 3BQ0A 3S32A 4GC7A 2V9VA 2DFFA 2EIJH 4KIBA 4L9JA 1TWGA 3RF2A 3NARA 3F21A 4HEA2 1KU7A 2QQ9A 2Z9OA 2LY1A 3E5UA 4IRGA 3RUPA 2H09A 2WAQA 3CMMA 4LMYA 4I01A 2BXZA 2QZ8A 3BR5A 1SFKA 5F64A 3WU0A 2IEKA 4CCMA 5ILVA 2V1DA 3HOYG 3DBHB 2VQHA 1U5TA 2DFEA 1B8IB 2ZJTA 5KFPA 2B63A 5L3CA 1EH8A 4A0XA 4EGYA 2IGKA 3UQ8A 4LFBH 2L7FP 5H6QA 1K61A 1Z1DA 4A3MJ 4CICA 2YZMA 5D6FA 4XRMA 2H27A 1S8NA 4FS1A 4ECSA 1GYFA 3CO6C 3H0GG 5K7ZA 2ECCA 2CJJA 3FKIJ 4C2UA 1AN7A 2LF8A 3C7JA 3BR1A 4GGGA 3KCCA 5F6FA 3PNVA 2YS6A 1QPIA 1XDSA 1YW9A 5E17F 1E3HA 4XYLB 4JI2H 4RAGA 2DMQA 3C2GA 2R7QA 3V4ZA 5GAEJ 2AO9A 3I9V2 3H92A 3M9NB 2KIMA 3OYCA 1R49A 1JGGA 4I2OA 2ADUA 4FASD 1JUSA 2E1CA 3JSPA 5KFXA 2MW8A 3N4MA 5K2MA 1P6RA 1HNXH 2HDDA 1KEEA 1MJAA 5B3SH 3H4DA 2Y30A 3JRHA 2VOOA 2EV5A 4YFNF 2GLTA 4Z2YA 4RB1A 3ABKH 2R4GA 3C2BA 3GTKJ 2K9MA 3ERMA 4NC6A 5EG0B 1I50A 3PM1A 2W6PA 3DXJF 1G6NA 3FMSA 4BL0B 5FKOA 2KT0A 1ZG1A 1P4AA 2NAZA 4KN4X 3I4MG 1RZ4A 2Z1DA 1ZH5A 2QSGX 3D5RC 2R7LA 4DL7A 5IP9G 3IWFA 5KFUA 4RNOA 5CJ9A 5FFZA 1IRZA 4UVCA 4LG0B 4UV8A 2FU4A 2EH3A 4DR3H 1H9GA 2OCCH 2STWA 1MMSA 1APLC 3ASOH 1B72B 1F36A 3R60A 4ON0A 5DGAA 2BBYA 2OUMA 4NUBA 3PO2G 4HOBA 3OHBA 4A12A 2IAIA 1JX4A 4U0VA 4XMYA 2E2IJ 3VYTB 1H88C 2D5VA 5JQWA 3BTJA 1N56A 1A31A 4XM3A 3PW2A 2C2DA 2C35B 3HDDA 4IVNA 2I87A 2M3AA 5C3EG 1N77A 2KRHA 1MGTA 1SD7A 1GUUA 1MMDA 4D9JA 4MTEA 3LSRA 1TTYA 1MJ9A 3SEZA 3GTGA 2E5ZA 3K4LA 5D1PA 3E3VA 4HF0A 1JTXA 1TT0A 5KCMA 3RTXA 4JUZA 3BROA 5HDKA 3OYFA 4J9NA 1L0OC 2V9PA 2VE8A 3IWZA 2V7FA 3G73A 1YIJI 1E0EA 5EZGA 5J4VA 1S68A 2V9KA 2KLOA 3L2PA 1KZHA 3I12A 2F4IA 1P4XA 1S5LC 1SFEA 1WCMA 3H5RA 2HVSA 3OYEA 2ME6A 4C9YA 1SEIA 4UHTA 4XLEA 4BAYA 5F0FA 5FJ8J 2HPMA 2FQ4A 3CCLI 1GHCA 2W1OA 4Q8EA 1WRJA 2IPQX 2HZDA 2HGCA 4L5IA 4NQWB 2YU3A 2H8WA 3JRXA 3HPHA 3J81Z 4ANJA 4MV8A 2EK5A 3ZQFA 3OS0A 2VI6A 1FP2A 2Y0MA 1MSFC 2Y69H 2Z16A 2EFQA 2K86A 4NC7A 5JFRA 1R58A 2FKLA 5H80A 2MSYA 3F8FA 4ZTJA 2MLKA 3NQOA 4XL9A 2IS1A 1G8XA 3F6VA 4OINF 2A68F 1TC3C 4ME6A 2V79A 1BBYA 1BC8C 3SZTA 1PJRA 3Q2OA 5D5WB 4YIRX 1IF1A 2X9DA 3QOPA 1XMOH 3PUFA 4JYAH 3GIQA 1MDMB 1VBHA 2I5UA 4JI0H 4CH7A 4A3FG 2WAEA 3S3NA 1U6GA 1L2ZA 4AIJA 3HUGA 3KEOA 1SFUA 2JZYA 5KT3A 2IXSA 2JK3A 2DMNA 4P9UA 4XLAA 1SAUA 4CXFA 5B1AH 1D1CA 4IHTA 2HDCA 1OFCX 1W4MA 3GZ5A 4GYIA 3UFXB 1FPQA 3JREA 1GO3E 4GO1A 2FJZA 4IQ4A 5KFFA 4TUYF 1SVMA 1WI3A 4L9VA 2HOAA 4M3GA 5DUIA 2A69F 3GV8B 5GAGJ 1KGSA 2N8GA 3MR5A 2STTA 4KISA 1KQ9A 2AGQA 1GV2A 2P0WA 5D5XB 3W6KB 2Z2SB 2QKLB 3D1NI 2UUAH 5IT9W 3CF5F 3HGYA 2WDTA 5F1JA 4ZQIA 3VPBA 5EEGA 5JH7F 4TQSA 2EA2A 2F5VA 4WK8F 5F08A 3QZ7A 4HX4A 2YL2A 2XGPA 2W7OA 5JVLA 1MNMC 5LRRA 4BY7G 1MKMA 2K9QA 3OS2A 3CCJI 2ZFUA 2DFIA 4HNTA 4D0PA 3JZIA 3ZMTA 1K7AA 2CV0A 4MGRA 3R61A 4ECYA 2CWEA 3CP8A 4YBZB 5KFVA 4APMA 1HW2A 3QZ8A 3ZQIA 3GFIA 3IH2A 4EJUA 3CESA 3DKXA 3G71I 4MAMA 4EEYA 1N48A 4M9UA 2JVGA 1Z7UA 2VQCA 1RKWA 2LKXA 3M7GA 4CDGA 4M74A 2IBKA 4OAZA 2LH9A 3Q3SA 1QZEA 2HTSA 1XSXA 3JTGA 4MV3A 3NWSA 4DV5H 5FB2A 4O4IF 2BY2A 4II3A 5ICFA 2ZDHA 4G9YA 4ZI7F 1JT0A 1A9XA 5LL6b 4CC6A 1UNNC 3DPTA 1TWAA 1TWHA 2CG4A 1QRYA 4M9SA 3WTYC 4I09A 4HDVA 1XC5A 1PUEE 4RZQA 4XORA 4JI5H 2R93J 2F6CA 3TIGA 4A3MG 2RKHA 3WGGA 2WE6A 3JSLA 3JSNA 3D5SC 1D0YA 3ZMUA 6PAXA 3FKIG 5ED4A 5J40A 3SFZA 3RQ4A 3PNYA 4EM1A 2NU7B 3VSKA 1H0MA 1VZ0A 1D1BA 3PSFA 4GKJH 1BI0A 3SEQA 4ZDPA 3V8JA 1EUCB 1JT6A 4I7HA 3MQ0A 3SQNA 1FYKA 4QWQA 4EG0A 2ZMEB 3BJAA 2JA7A 1DP7P 1FC3A 2EV6A 3QODA 4ESJA 5E1XA 1HSTA 4J9LA 2VPSA 3U1DA 2YW2A 2LREA 1USTA 1Z6RA 5E79C 5HLTA 2QF7A 4HDUA 4BE1A 1JIHA 1V4RA 1IG7A 1VAJA 4F50A 1FBQA 3BG9A 1XNQH 2D2WA 1YX3A 1S29A 3GTQJ 2V4RA 3LOCA 5H20A 2MGQA 3BG5A 2DOEA 2VN2A 2XD4A 5DS9A 1UAAA 2GPSA 4BU2A 4XX0B 5DV5A 2YZGA 3RAXA 3OS1A 1M0TA 2V5AA 4DR7H 1ZELA 3IRQA 3F8CA 3LMMA 3A0BC 4ZYHA 5C4XJ 3P9IA 3L4KA 4I98B 1DU6A 1S3JA 1Y0NA 3IN5A 3I59B 2OD5A 3TQ1A 1LJ9A 2KJCA 4I50F 1B59A 3HHHA 3FMQA 2QGUA 3GFMA 4IO9F 1WVRA 3QPSA 3GLLA 1XN7A 1IV8A 1LEAA 2EZIA 2Y31A 3VOEA 4BKXA 1Y1VJ 2CYYA 2F5FA 2JPCA 1ZQ7A 1I1GA 1TLHB 5EDNA 1KU9A 2KZVA 2ZFWA 1SVOA 3LSIA 4YFXF 3WTUC 1E17A 4IKFA 2JA5A 5DQGA 4HW0A 2OLSA 4DZPA 4AIHA 3BA9A 3PZPA 2Z99A 2R7ZA 2NS8A 1OMIA 3LSKA 3VEPA 5DLFA 4TV7A 2W7PA 4P55A 4D5CA 4UCTA 5LXTF 4RB3C 4NXNH 2PN6A 1MBGA 4OAYA 1S9HA 2R85A 2UUZA 2WV0A 3H1CA 2M0CA 4PJNA 5H6RA 5KFLA 2Y75A 2SCUB 3Q8RB 2V1XA 1ETOA 2MG4A 4UVBA 5K1YA 3GV7B 3CC2I 3KPHA 1V3FA 1OCPA 4XOPA 5E18F 2AU0A 2TDXA 1EHIA 1R7JA 2XVCA 2ZJQF 3OV8A 1HF0A 3ORRA 5IYZF 2YR2A 4E6KG 1RETA 1MBHA 2DJIA 4DGWB 2EA4A 1E4EB 5B1BH 2NVYJ 5FLXW 3SZGA 3OL4A 5BMVF 5E1ZB 5EEAA 2Z3YA 1T98A 5H2FC 3HL2A 1WZ2A 4B3TH 1IRFA 3QPLA 4XONA 4BS9A 4OMYA 3I0TA 2DA3A 3IP4B 2BW3A 2IBDA 4XNFA 2JWTA 1A0IA 1I7NA 2R7KA 5FJ8G 1R5GA 3RYRA 4RAYA 1YRNB 2DO7A 2XDVA 3KZIC 2FK3A 4LF8H 2HWVA 4RAFA 2QLZA 2XAFA 2VUGA 5CB4F 4Q44A 3QRFF 1GSHA 3CJRB 1IUFA 4F55A 1X19A 5FRNA 2HJWA 3FXJA 1KQ0A 1VQNI 3TIIA 1X1DA 3ABTA 1HOMA 2KDOA 1RRJA 4IHJF 1X1PA 1B9NA 3RYPA 3HRSA 2BVLA 3BQYA 2M2EA 1D8KA 3ELKA 4LK0F 3UNGC 3K70C 2WB1A 4DL2A 4O3PA 2KHMA 3G1MA 2ZNYA 3WTWC 1L3LA 4Y13A 4BY1J 1JLLB 1I39A 1W5TA 1T36A 4UB6C 2C28A 5M3MJ 4B48A 1DV1A 2ASDA 2R5YA 2D45A 5CYVA 2XROA 2GXAA 3CVZA 4G3IA 3TINA 2LKPA 4U7BA 4DR4H 2L4MA 2YUSA 3ZQLA 3BC8A 3DWLE 2CFXA 2WAQE 1NK2P 2ZKZA 1RNLA 2R5ZA 1DU0A 2V26A 2AHQA 2VUMJ 4BACA 1ETWA 2IW5A 1SCUB 4YY3H 2QBYB 1I3QA 3KX2A 1JKPC 2A07F 4KYWA 3CZ6A 2O8KA 2F5CA 2GWRA 2HI3A 3HRMA 2BHZA 3JRBA 2CUEA 3A1YA 1YS7A 3JW4A 5IYCJ 2B9SA 3FX3A 4CA0A 5CAEB 1SMTA 3DF8A 2NVXA 2V4JC 1Z21A 4LSXA 3E5NA 1SMYF 2E34A 5D8LB 4DV7H 5JUMA 1XMQH 1ULZA 3TP3A 4LF7H 5L1LA 5GADJ 5DG8A 1VBGA 1Z7LA 4Q43A 3VSLA 4DL3A 3CTAA 3H5AA 2AXTC 3RQIA 4QWCA 3MFKA 4EEQA 2BGCA 1ZG3A 1Z9CA 2KIUA 1Z2NX 4F4YA 3TQNA 2XRNA 2ZMEC 1RI7A 2FD5A 1HXDA 5FROA 1TBXA 1OJLA 1JKOC 4A3LJ 1CQIB 2VKDA 2O0YA 3H9GA 3P5JA 1GXQA 3S16J 1KJQA 2XPUA 2XCPA 3ZMVA 1VQKI 1IXSB 3LAPA 3A2KA 2DMUA 2RC4A 4XIDA 4Y7NJ 3QYFA 2VONA 2Y9ZA 3BZKA 4CHUA 2L0KA 4LK1F 4PFOA 5GTHC 2DK8A 1Z2OX 4S05A 3G6YA 4N9IA 3V6JA 4IXAA 3H5NA 3ZOBA 2C2RA 4O3OA 2BVMA 3HBLA 1B8IA 2XC9A 3GTJA 2KDZA 4X1EA 4Q48A 2CQYA 3OIOA 2R7MA 4C5CA 4GRIA 1J9IA 1SC7A 1GVJA 2B7EA 2MABA 4E7HA 1ZARA 3M4IA 2E7WA 1PUFB 2K85A 3JAMZ 3HOUJ 2FNAA 4PSWA 2HOSA 2RV8A 3GWZA 4LSAA 1U9NA 2L9VA 4A2AA 4LB5A 4DV4H 5EWFA 3MN2A 1IOVA 3EYYA 5L3GA 5F9NA 2R93G 1ZQ3P 1BN5A 1V5GA 3S2DJ 3T8RA 2XCAA 5KFTA 4YAKB 3QOEA 5GTIC 1AUVA 3MMYB 3PUBA 3IH3A 2XPVA 2A3SA 3CCEI 4J19A 1BJZA 2MD5A 2WAQN 3A02A 1YLFA 4A2UA 3TDZC 5KFGA 4DBRA 2KIFA 2FOKA 1FX7A 5CVJA 4E4HA 5EDWA 1N32H 5F0CA 3IL2A 1REPC 4KNYA 2G7HA 5HOOA 1X3WB 2W6OA 2LVSA 2XUBA 5HS8A 2IT0A 5EG0A 1JHHA 4LJZF 3BZCA 1BI1A 4CCOA 3OYMA 4G6QA 2JEJA 1FMWA 2VC1A 1K4SA 1A6IA 4XBFA 2HR3A 3E7LA 1FBSA 1JXLA 1NH3A 4FQGA 4R7RA 4BXXJ 4ED0A 1LDJA 2E1NA 4I02A 1M7JA 2FLNA 3N97A 3NEUA 4PUSA 2W9AA 1Y39A 1W36C 3EPGA 1KONA 2JMWA 3OYKA 5KFOA 4LG0A 2K7LA 4BE0A 1WFXA 2P5LC 2LLKA 3B73A 3RKQA 1DPUA 1KBLA 2LK2A 1B72A 4DQ2A 4E7LA 5KG1A 3K4MA 4NHJA 5KT2A 3CQZJ 2UV1A 5IT9Z 5C4XG 5IT3A 2YU9A 2QSFX 1CF7A 2ASJA 4RM2A 3H40A 1EJ9A 2RNJA 4UCUA 5GONF 4YAJB 3SI8A 2XGCA 3HG9A 1YW8A 1JE8A 2HVRA 2R8HA 4FE4A 3KP3A 4O3QA 2ZXHA 1PP8F 3PW5A 2BQUA 2R7FA 5DCFA 2AQ4A 2LD5A 1OCCH 5C4JJ 1S9FA 1MMNA 3HOVJ 1Y1VG 1AWCA 3I54A 4RLFA 1KC7A 2CS3A 1C30A 1R4NB 3V7RA 3I71A 4B3XA 4BQAA 4QPOA 3FXMA 1P9QC 3HZJA 2XRLA 1I94H 4UB8C 1V5FA 4EQQA 3FIWA 3MVPA 2FXAA 5GPCA 1WR2A 3DU6A 3FDYA 3JCUC 1RC9A 2HYFA 3KP4A 4G94A 3GTMJ 2W6MA 4ED2A 4EV0A 5DG7A 3V42A 2WY7Q 2AQEA 1RUNA 3CC7I 2YYAA 2LYCA 4RUAA 3HOTA 5BOXA 5KG0A 2CO5A 1DQUA 3WU2C 2WBMA 3HOXJ 1FOWA 4I6ZA 2UXNA 3L7WA 4NQWA 3DF7A 3MFHA 1BR1A 4YFKF 3BQ2A 3HTSB 2PBZA 2QK4A 3W2AA 1MZBA 1JKQC 4XQFA 2UU9H 1CQTA 2KQRA 2W6QA 3J7AK 2OWOA 2W4SA 2XV4S 2A6HF 3W2WA 3L4JA 1X58A 2XF5A 3KP6A 4KFCA 3GVAA 1TWGJ 2P5KA 4JQFA 5LLQA 2QWWA 2DA2A 1AOYA 3QP6A 1FTZA 1VQ7I 3RB3A 4C2MA 1G3TA 3WU1B 1UHWA 3JRCA 2CQQA 3PFIA 4F7ZA 2RNGA 1YJWI 3E97A 3EUAA 4BQNA 3MKZA 5KFQA 2RDPA 1T95A 1X9NA 3J80K 2ELJA 1R23A 1VNDA 4EMSA 3NWTA 4BY1G 2DIKA 4JV2A 5IWAH 1ON1A 2A5YB 2OBPA 3CLQA 2L9NA 2R7WA 2K9LA 2XSDC 4BJTA 4FISA 4AYBA 1ERDA 3PN1A 2DYSH 1EA3A 2P7CB 2BV6A 1V51A 2W00A 2FUG2 1KYZA 2W9BB 2CQXA 3BG7A 1QA6A 2A05A 1SANA 1XSVA 3CJQB 1BM9A 3M1CA 4HV6A 2M4KA 3VFZA 4E7ZA 5JHUA 5LFAA 2JQ7A 4W97A 2L4AA 2L54A 3BOQA 2JA6J 5DG9A 2IJLA 1SD6A 2W82A 4NBQA 2VUMG 1LQ1A 5K5OA 1JJ8C 4B3SH 2CSOA 4DV2H 2DI3A 2DK5A 4I99C 3RTRA 3OYBA 1J59A 1UCRA 2VQFH 1WJ5A 1RK5A 3DQVC 5LD2C 1D8JA 3F3XA 3HOZJ 5IYCG 2EZHA 4L0YB 2F4VH 2QSHX 4BNCA 3W3CA 1UJ8A 1YFHA 2EQRA 5E3MA 1ITYA 2KIQA 1B6SA 1NK3P 2UVRA 3HHGA 4C5BA 4BYYA 5IPAA 4KMFA 2O6GE 2R7UA 3OIPA 3DTIA 2HQNA 3QP5A 4CCJA 3L2CA 2X1DA 5KK1A 1P8LA 1QHHD 2X0LA 3K6GA 2MCTA 3QAHA 1MMGA 5JR3A 1LE8B 3EPZA 4FETA 4A3LG 4HSRA 1BR4A 2IA0A 3J7AY 5D8DA 5KFWA 4YJ3F 2G7UA 2TRTA 2WY8Q 3R6SA 1U3EM 3TQTA 2P8TA 2XASA 5KG5A 3OYHA 2R92A 2WADA 3BTIA 4IR1A 2NNNA 2XGXA 1VFCA 3F8MA 5FLXZ 2R7VA 3IKTA 3L9FA 1M6VA 2LFBA 1FP1D 2H94A 2M34A 2VJ4A 3GIKA 3NGDA 2LKSA 4HV5A 4A5MA 4YJ2F 2L2OA 1MMAA 2OF7A 4XLHA 3FMAA 5C1OA 4PDBA 4YR3A 3H3UA 4LLLA 4KN7X 3H9QA 3K9TA 4R8UB 3SHFA 2PJPA 2DCEA 3V8KA 2UXBH 2EPFA 2PMZA 4XSZF 5D5VB 2MA3A 2PG4A 5J1UA 3HOUG 3K1PA 3AAFA 4XRFA 2LNBA 4RLQA 3HYIA 3GX4X 3CCMI 1JJ6C 4UY8I 2IS4A 3GTLA 2DT6A 4WXCA 4XSXF 4X66H 2I10A 4JBAA 4DYRA 1LVAA 3GTGJ 3H4BA 2QQAA 4BDZA 3PW7A 3JTHA 1PYVA 1BL0A 4RDUA 4QWAA 3VYUB 5TRDA 3F0CA 3ABLH 3O6BB 5AIPA 3V6HA 2ZMEA 3ECHA 4DUYH 3M4OJ 1V5EA 1XMXA 4LH6A 5HNFA 3IRRA 1A5JA 3G6XA 3TW6A 3M8JA 4IEJA 2JT1A 2QA4I 3OY9A 4HX8A 4ECWA 1VQ8I 5E20A 1RESA 2RVCA 1G59A 4G8XA 1WCMJ 4E7KA 3ONQA 1P7JA 1WH5A 2X4HA 1QVUA 3DPLC 1HA8A 1IUYA 2D1VA 2E36A 1JXSA 2FBHA 3QU3A 4F52A 4L1KA 2VQLA 5EOYA 1TQPA 2AQFA 2ICWG 1X2NA 3FXRA 4UV9A 3FKIA 4OIPF 4BXXG 1FOKA 1WJFA 5KFKA 3N41B 1T33A 1EUDB 1AHDP 2LDUA 4RNNA 4ED6A 4MV9A 4U7DA 3OSPA 2VLAA 2R8KA 2X51A 1O3TA 3LSJA 4DR6H 2FPIB 5DCMA 4ZTFA 3L00A 3I59A 4IF4A 3FXQA 4ENKA 2VKHA 1W93A 1TWCA 3VPCA 3FXLA 1U78A 2HZTA 1C0WA 5DM7F 3GYHX 4IOAF 2CZGA 2C2EA 4XRSG 4D7NA 1S7EA 1YJNI 4EVIA 1IDYA 1IN8A 2L02A 2CKZB 2OTJI 2EIMH 2O61A 4G7HF 5CKTA 2LBFB 2W70A 4LF9H 3K70D 1KJJA 5LGTA 1ZYRF 4UCSA 1N36H 4Y8VB 4WXDA 5IOZA 5EGOB 1QNTA 3S14J 5CA1F 2A5WA 3JRDA 3HOVG 1YJ9I 3HTUA 3DP7A 1I27A 1A04A 2FRHA 3N42B 5CPRB 2W84A 5J6XA 5I47A 3BA8A 2L7KA 2X1EA 3QYBA 4IWYA 3WTZA 3H3VK 5KFSA 1SYXB 5DLGA 3JAMW 3EUHC 2E7XA 4Q0YA 3FDSA 2W6ZA 4JI7H 1WJCA 3DEWA 2F5EA 3G1LA 1IDZA 2CFOA 4HX7A 3O8HA 1VS0A 2DFHA 3OL3A 1SFOJ 4V19K 3FKJA 4JI3H 1B4AA 2Q1ZB 2DA6A 3AL0B 2DOAA 3FHZA 2GM4A 1FTTA 2HEOA 5KX5F 5FGMA 1RJPA 1BI3A 1XSDA 1E4EA 5CVRA 1Z2PX 4KIFA 5L3BA 1T8IA 5FD5A 1B9MA 3AG4H 1BW5A 4MQVA 5BMZA 4DL4A 4OOIA 3Q0VA 3BR6A 3VWBA 5LOVF 4L18B 4XLPF 3I4NG 4QLCU 1DGWY 4CYCB 1YRNA 2NVQJ 3HOXG 2DAOA 3PQKA 4UUSA 3GXOA 3ZQQA 4F4XA 3TL4X 3DCFA 3SXYA 2ACJA 1Y14B 2CQNA 3FK7A 3QWLA 4ZDLA 4YG2F 5L1KA 5M3FJ 3OYIA 1XGMA 4OX9H 1MBKA 1VQMI 2VQEH 4A0YA 3J7AO 5AIQA 2JJ7A 1IAWA 3TP0A 3DPUA 1GDTA 2BQ3A 1GGOA 2X85A 4C5AA 3LSMA 3RB4A 1TP4A 4D7MA 5L3EA 4I0AA 3KYLA 2UZKA 5BPDA 3WTTC 4HQ6A 1R1VA 1FIAA 1ODDA 3L2UA 2O03A 2L5QA 1XCBA 2R7OA 2VT2A 3KP2A 4HR7A 3CCQI 3DLAA 3MZYA 2X6WA 4M6YA 1GV5A 4B44A 1TWAJ 4LG3A 2R7NA 1X4OA 2EZLA 5EWEA 3G4SI 1UG2A 4KT6A 4Y3OA 4A6EA 2RF4A 3R0JA 2VBZA 2A6TA 2FBKA 4IRHA 2B63G 5E8IA 4BXUA 3V8LA 3ZQ7A 4KA4A 3U9GA 5IY5H 4ECXA 2J6SA 1O57A 3GIIA 2QBYA 4IX7A 1NG6A 3Q5FA 1IRXA 3KYCB 2YPRA 3MD2A 4L0ZB 1G3SA 3ASNH 5BPHA 4ECTA 1YW7A 2JA6G 1O7FA 1H89C 4A3CJ 4A3KJ 4OIOF 3ZQCA 3S1NJ 2RDIA 2ECBA 3AKZA 1R5HA 1WQ2A 2H1LA 5KFRA 3GV5B 1ZRDA 3ULQB 2JA7J 2UVVA 4M9XA 3NAUA 5C44J 5KFEA 4E7JA 2GXGA 5CVIA 3HOZG 1W0TA 4X6AJ 3GUDA 4U0WA 2WWYA 4B3RH 1FT9A 3QFFA 1MSEC 4AWXB 1FJGH 1EH7A 2RGRA 4XKVA 1EV7A 4DL6A 5M5XJ 5J1RA 1OR7C 3TEDA 5AONA 1NTCA 2E1OA 3KZYA 5DEQA 3PL8A 1W36D 1HQCA 3A0HC 2W9CB 3DFGA 4ED1A 3K69A 1IBMH 2PI0A 1MBEA 3BP8A 4CC5A 1QU3A 3GBGA 3ZQHA 2P6SA 3G3ZA 1B1BA 2ALZA 3OSGA 3ERED 4UCOA 5BPFA 2OPTA 2ZSIB 1PUFA 1NG7A 3AYHB 3GTOA 4RGSA 3LA3A 2JRTA 2HQRA 2K4BA 2RQPA 2DQRA 3K5IA 4MV7A 2ZXIA 2K40A 3I53A 4QSHA 4GFBA 5TISC 1RIOH 1VQ4I 2JA5J 2CUZA 5IYDJ 1VF9A 2OCEA 2FMYA 4X62H 2W85A 1J5EH 5DUKA 4XKBA 4DLKA 2UXCH 1Z05A 4ZJZA 4NNJA 2R7ZJ 2ELKA 4ESBA 4HF1A 4ZH4F 5FKNA 1BOBA 3LFKA 4E7IA 2MFZA 3CJNA 2OAZA 1XS9A 2V58A 2M7BA 2XKPA 3Q8QB 3S1QJ 2COBA 4ED3A 2QYOA 1S10A 3LWBA 2P5VA 2XAUA 4FTHA 4IHVA 2KKOA 4LF4H 4GC6A 3FWEA 1I6XA 4CCKA 1I6UA 3BZ6A 1YIOA 1RPWA 4L9NA 4ASNA 4R79A 2H6BA 1KJ8A 1ACIA 5E3NA 4ECUA 2Q0OA 1U2WA 2UXDH 2EFNA 1WCMG 2DZDA 2D1HA 3W2VA 2LOOA 1MBFA 3AL0C 4DL5A 1EZ1A 4N4NB 4JV1A 2WA0A 5J8FA 2BXYA 1XNRH 4FM9A 4ESFA 4IRDA 1R00A 2BR0A 4QWDA 5CQGA 3RPUA 4QIWA 2L3DA 4PSXA 1K79A 3C3WA 3OYAA 1DUXC 2VODA 1T94A 5HVQC 4M7EA 3OSNA 3LP8A 4BQOA 2HVQA 3X2QH 3LSTA 2O7OA 5GAHJ 2NRAC 2FPPB 2FPGB 2RQQA 1OCOH 3OUZA 2K3FA 5J2TF 2Q2EA 1I1SA 2L9SA 4KIGA 3CDLA 5B5EC 3BLYA 1YG2A 2PN1A 5D1OB 4C3JJ 3M9OB 5HS9A 3CCRI 1XX5A 3GZ6A 2X48A 3GTQA 2FBIA 1G4DA 5D6EA 3MR6A 1VI0A 4RAZA 4ENJA 1AKHB 5KT6A 2HQ5A 2OV7A 2LG4A 2OQGA 2BOLA 1ZHSA 4GDFA 5DGBA 5LRSA 3T1YH 1TW3A 2XSJC 2DA1A 4JV0A 4YRVA 3I4PA 4MA0A 3ECOA 3LQRA 4L5JA 4RBOA 4HYKA 3WTVC 4X64H 1XG1A 1R5ID 1BW6A 1MBJA 1TQIA 3IUOA 5CA0F 2CRGA 1ZLJA 3ZCOA 2DA4A 1HKTA 1I3QJ 3BQZA 2M45A 2V1NA 1YX5A 5CVUA 1HW5A 4J01A 5C1PA 5J4YA 4WWCA 3KHHA 4EBEA 2VQDA 5A2QK 2DPJA 5GP9A 2NVXJ 3MWMA 2AGOA 3JRFA 1AUXA 1GVDA 4EBDA 2Y9YA 3D5LA 3OOPA 4CCNA 1NHAA 1Y56A 3TO6A 4I76A 2IS6A 1JDBB 4OMZA 2ZJ2A 2E19A 4UCRA 1O7LA 3HSEA 3F23A 4H4KC 4BJ6C 1DV2A 2ISYA 1Q1HA 1ZAOA 1F5TA 3BR3A 3GLKA 4YIIA 4MEYF 2IGMA 3Q8PB 3EDPA 4WD3A 2GOMA 5BPIA 3ML6A 3PIOF 3KHLA 1LB2A 1ETVA 1R1UA 4MNUA 1DP3A 1ZR2A 3FZVA 1WJBA 1ULYA 2XAJA 3WG9A 4EATA 2BEOA 5LP6F 3OIQA 2DBBA 3RB6A 4IR9A 5KHDA 3WTSC 1Z6TA 4BQQA 4YHHH 3SYTA 3LA2A 2GLOA 4O3RA 3GCMA 3Q1KA 1G3YA 1YI2I 3EUHA 1OPCA 1N78A 3S3OA 1T39A 1TWFA 3OTOH 3GTJJ 5E3LA 3KHRA 1UZCA 1K6OA 2R7RA 2JUCA 4BBSJ 3WTXC 3OYGA 2QYZA 1HDPA 5L9XA 5BNGA 1HNZH 2K9SA 3HIFA 2CU7A 4BXFA 3R4KA 5HLIA 4P96A 3H36A 3LSGA 4EJOA 2YRWA 3OSFA 3G2BA 2W9BA 4MV6A 3MR2A 1YQAA 2M8GX 4KUMA 1IXCA 1MNEA 1W7PB 3RI4A 1S72I 2HOEA 2H8RA 3N44B 4DJAA 1IC8A 1LUJB 3E6MA 3I58A 3RPUD 4A3BJ 1WWXA 1XB4A 3N6XA 2J6TA 3CCVI 4UVAA 4LD5A 2BZTA 1KJIA 4IWXA 2RN7A 1ZHQA 4A3CG 2R7XA 3OWTA 2JSPA 4A3KG 2ZBKA 1YO5C 2PMZE 1IW7F 4JX6A 1ZRFA 1FYLA 4KITB 5HLHA 4H0EA 2E1MB 4KJZA 4D5FA 3RZDJ 2KP6A 1HNWH 3AFHA 3I3LA 1W1WE 2HXOA 4MFEA 3CC4I 5C44G 2RAEA 1TW2A 2VB6A 1IGNA 5E3OA 1WI9A 3JSOA 2EB7A 3GIDA 3K4CA 2V59A 5HS7A 3CUOA 4XYMB 1A6QA 5JLXA 4WX9A 5D8KB 4NB5A 1TT5B 1PP7U 1K1SA 5J1YA 2ZJPF 1LE8A 4AUXA 3Q9SA 4FU0A 1H8AC 1VQ9I 2L7MP 2MH9A 1ZR4A 3GIPA 4AU7A 4F93B 1F43A 4RGXA 2J5PA 4EM2A 4PJLA 5KFNA 3HB9A 3E6CC 4J0MA 2PJRB 4D1QA 2BY1A 5GPAA 2I80A 1T6SA 3GTPA 5KFMA 4R1HA 3DEUA 3ETJA 1FY7A 4XR6A 4YB8B 3RGZA 2X1CA 3OYLA 1MW7A 3FXOA 3UKGA 4R8UA 4ZYAA 3KHGA 2DU9A 3A4CA 5J8CA 1STZA 2LSOA 4RU9A 2CW8A 4OIRF 4A3EJ 1IOWA 4M3BA 1TNSA 3I55I 5FLMJ 3B6CA 4XOTA 4EJWA 2JEGA 3KLNA 2Q8KA 1Y1WJ 3H0GA 1J2XA 4Q4ZF 1UC8A 2J5OA 5IYDG 5IYBJ 3DEEA 2X0SA 3R5XA 2JA5G 1E2XA 2YX7A 3AG3H 4FX4A 4O3SA 2FJ1A 4BGDA 3FBIB 1XPXA 4XK4A 2DLLA 4X0GA 2ZNZA 1XMAA 5F27A 1E3OC 2R7ZG 2ASLA 2R7SA 3S17J 2XAQA 5FKMA 2IA1A 3DBLB 5ICCA 5KFHA 2E2HA 3HXLA 4CUGA 3KP5A 2FE3A 2JEFA 2DDBA 3TW7A 5KAIC 4IRKA 1OR7A 3ZQGA 4EM0B 1SD4A 2ZM6H 3QPHA 1S97A 3J80W 3CDIA 4O6JA 4QPQA 3HC7A 4DYQA 3FM3A 3BY6A 2Y0SA 2PMZN 1ENHA 1LEBA 2GA1A 1V54H 3N8DA 3ZR8X 3L2RA 4NDLA 4TV8F 1OCRH 2O8XA 3OOUA 1XDNA 2E2JJ 1B33N 3M9AA 3HOSA 2DN0A 2M4GA 3ROUA 1R9TA 3GILA 3DTEA 3HKZA 3Q0UA 1UELB 2ISZA 3TDUC 3MZ8A 3H20A 4WXHA 3SZPA 2W8LA 3BJYA 3KE2A 2DLNA 3J81K 2OJED 2LBFA 1A36A 2DA5A 2DQLA 2FQ3A 2QVOA 3C2HA 2M1BA 4BEHB 1TL8A 2VT3A 1EF4A 3BQ1A 2W25A 3WGHA 2CV2A 1BJAA 3FM5A 2V1UA 2R87A 5J47A 4EFEA 4LF5H 1IBKH 4NXMH 4KMUX 3I4NJ 3VYRB 5F04A 3AG1H 1U0JA 2XGEA 1WH2A 1DPRA 4M3EA 4ZHQF 3RPQA 1HBXG 1IN7A 2MC4A 5HV6A 1QPMA 2FOWA 5FO5A 1ZTRA 1DGRM 4DR2H 4UUTA 2QM3A 3PQJA 3O8GA 4ZZLA 2VBWA 1X1BA 1VQPI 1GXPA 1B6RA 3RCOA 2NOGA 3RJ0A 1HCRA 1EYZA 1PVEA 3BPVA 1MNDA 1WKMA 2EFOA 1O3RA 3CQZA 2HYGD 4C2TA 3NRVA 5D4RA 9ANTA 4ZDOA 2K5CA 2VKEA 1W5CC 1EKEA 2XHKA 4V2FA 4Y4RA 4LFUA 4RB2C 2DXIA 3QU6A 3CCUI 3MKLA 2HNHA 2DT7B 3C0FB 2HTJA 2VBXA 5KFJA 3S2WA 5L1IA 2P81A 1B04A 4CYCA 2M87A 3T1BA 1G2HA 3RJPA 1ZLKA 1RJRA 1MDMA 3E6DA 3HRUA 4IHSA 2GZWA 1N25A 2R0QC 4GCVA 4QW9A 1WHUA 1ZGWA 5LA6F 3C18A 4AVZA 3CP2A 2B63J 4EYIB 1GLNA 2XF7A 2GIZA 3OYJA 5B66C 1P4WA 1D5VA 1JUMA 3U2RA 3T0YA 5F1RA 5DQIA 1DGSA 1YITI 1P2FA 4J9PA 4AVPA 2E1MC 3IHUA 4DZJA 4GXOA 3U1KA 3O2PE 1Z3YA 3LFUA 1QZYA 3GZNB 2K3PA 4J9QA 1HLVA 3T8TA 2XGDA 1D5YA 1K83A 4AIKA 1BR2A 4IQJA 3ZMZA 2R92J 1LPQA 1A35A 4PJJA 5EWGA 4EJTA 3KZZA 3U21A 4A0ZA 3WGIA 2QQBA 4IL6C 3OUUA 3CCSI 2ME0A 1HSJA 3LMLA 1I5ZA 4PWQA 3FK6A 1OYWA 4BBSG 5LHGA 4F4ZA 2HDWA 2CW7A 3BG6A 1RUOA 1R6RA 4C30A 3K2AA 1I50J 1C3OA 2P4WA 3KALA 4J9MA 5KVRA 5C8YF 5EZHA 2Z33A 4K2EA 5HODA 3RFCA 3GTLJ 1T0FC 3I56I 4FE7A 1T38A 2C6YA 2AGPA 1ZK8A 3FMRA 5KKNB 3PNTA 1LNWA 1VQOI 4BHCA 5LEKA 1FLIA 2DWCA 5KG4A 1WJAA 4RZRA 1IBLH 2UUCH 1LFPA 1Z67A 1WSCA 3RIZA 4A3BG 1OWTA 4J9SA 3MKYB 2O9LA 2ESHA 4Y33A 2HFHA 3CJTB 3WODF 4M9ZA 1YS6A 3HM5A 4WF2A 5CVVA 1TQMA 4F91B 2QCOA 1YYVA 2E35A 3BTCA 2FSWA 2F4MB 4HRIA 1XDUA 5EJCA 3FXKA 3VPRA 2CW0F 4BHBA 4MQ9F 1BI2A 1JDEA 4UCVA 1UG0A 3M9MB 4I55F 2JUGA 2E5NA 2PMHA 2EZKA 4PDKA 4FT8A 1BIBA 2LY2A 2FNPA 1PX2A 4E4TA 1S7OA 1UHSA 3A01B 2EFWA 2XIGA 1CS0A 2JA6A 2W9CA 1B6AA 1POGA 2PLYA 4LLNA 2IP4A 1J75A 3GEZA 4UNOA 4Q45A 2DPDA 3EPIA 3U9TA 3E5XA 4M6XA 1D3YA 5FLVA 2JRMA 3PJRA 1TWCJ 2NNYA 1HKSA 4Q5SF 2OA4A 5CLSA 4MIMA 5F0HA 4HPQA 1GSAA 4AC0A 3KP7A 3V4GA 4B4CA 4KHPH 2H6CA 1BIAA 5K7HA 5D4SA 4LITA 4XZ3B 2VASA 5T14A 2LR8A 3CMYA 4L9TA 3S3MA 3G1OA 4B43A 1R71A 2P6TA 2BY0A 1P7IA 3JR9A 4O4LF 2LY9A 1D0XA 5JLWA 2OQRA 3MJFA 4UXNA 4A3EG 1K78B 3BJ6A 3J7ZI 4N4OB 5FLMG 3PR5B 5HLGA 4G12A 2ETHA 1MIJA 4HYEA 3S1MJ 3KFWX 5DYMA 3KETA 4IAJA 4QIWE 1Y1WG 3GFJA 5K5RA 3L2QA 5IYBG 2BE5F 5HDNA 3F9KA 2GIVA 5DD4A 4PJMA 3CMAI 4IHXA 4TQRA 3KEQA 3RAQA 4HLYA 4W1UA 2QENA 1BC7C 2ZB9A 2Y48A 3IC7A 4YEJA 2LC2A 2VQGA 4O2BF 4P9FA 5KT4A 4XLCA 2PEXA 4O4HF 3REOA 1BGWA 1CF7B 3TGNA 1FOYA 3T5LA 5LYJF 2C22A 2GOXB 2UVWA 1V9PA 3H9JA 1FSHA 4A5NA 4C3HJ 3R5HA 4CZCA 5EYRA 3O3KA 3GTKA 3U9SA 1ORKA 5LGNA 3FXUA 2IRFG 3IV5A 4ED8A 1LDDA 3C1DA 3S15J 1T08B 3LWFA 4A69C 5ICEA 1H9TA 4BH9A 1AU7A 1MD0A 4P5OA 3S1RJ 4RMNA 2M30A 2V9WA
chains in the Genus database with same CATH topology
3CUQB 3GO5A 2ZO4A 1ON2A 4CZZA 3ZN1A 3ZN0A 3N40P 5D1OA 4HZFA 4KT5C 4JK1X 1TAEA 5HDGA 1FVIA 4B09A 2MBFA 1HW1A 1XGSA 2CGPA 1FZPB 1VTNC 4RGUA 4PGHA 2L01A 2FF4A 3B02A 2DW4A 5ICGA 4M71A 1J7KA 1YTYA 3MZHA 3KAKA 4DR1H 5L3DA 4JI8H 3KXYT 4ZYEA 2ELHA 2FA5A 1G3WA 4IRIA 3IKVA 2B0LA 4DV0H 2UXXA 3J80Z 5TJJA 1IXRC 1XD7A 5BQTA 3RGXA 2M8EA 2IVMA 3RIRA 4FHTA 4M72A 4BWSC 4HLXA 2XKOA 4EFBA 4JI1H 3ISPA 1WSUA 4U0YA 1XMKA 3GFLA 1W7PA 1QGPA 1U5TB 2KRFA 5ILSA 4LH7A 2IA2A 3BPXA 2AS5F 1ZG5A 3JAMK 2LF7A 2W57A 3W6JB 2F5DA 1FNNA 3LQQA 4CO8A 3KAJA 2YX4A 2RGVA 4DV6H 4U88A 2EJRA 1HR0H 3RKXA 4PCQA 2QUFA 3RKYA 4HBLA 4E70A 2OZ6A 3WE3A 5ERIA 1O75A 3DV8A 1FBUA 4R8HA 1O3SA 4CGZA 1ZRCA 1BOAA 4LF6H 3BDDA 2VBYA 1FYMA 4N9HA 4DV1H 4O3MA 4A6DA 5JI6A 2HKXA 2IP2A 3I64A 1T0FA 1F9NA 4G7OF 3K2ZA 2EV0A 5A2QW 5ILUA 5IT9K 3BAAA 2JTVA 3CUQC 1QO0D 5D5UB 1ZN2A 4HQEA 1USSA 2Z5UA 1MJBA 1ZREA 2GQQA 3T5XA 4IPAA 5FPOA 4B8XA 4AQYH 5DCMB 4X65H 4DNCA 3D0SA 3MAJA 1UB9A 5BS6A 3GF2A 4XLNF 4HA8A 4BHPA 3Q9VA 1W7PD 3EYIA 3FF5A 1R1TA 3M8FA 3ZMDA 2V6CA 3P7NA 2DPUA 2VOBA 4DR5H 4JI6H 1QBJA 2BYVE 3COAC 3ABUA 1JHFA 4DV3H 3P9KA 2VC0A 3ZMSA 4JV5H 1QQIA 2OU2A 1BJTA 4Y17A 2KJBA 3IG0A 2YCHA 3WE2A 2K4JA 3H3ZA 3BABA 1ZGJA 2WYOA 2COMA 1LDKB 2UWMA 4KICA 5DDGA 1S7AA 3EETA 3TO9A 2K02A 1IRGA 4EGZA 1IN6A 1TNTA 3L09A 4YIFA 1KYWA 4Q47A 2PBIA 3F72A 1U5TC 2OZUA 3QPTA 3K3VA 1N34H 3F8BA 2HGSA 2VXZA 3TOAA 1M0WA 3HSFA 3BWGA 4RB0A 3R0AA 4UFZA 4RGRA 1XGNA 2EFPA 2MC3A 2KSWA 2CQKA 2MLGA 3N43B 1F1ZA 1TA8A 5LEJA 4RS8A 3MEXA 4ZZDA 2AXLA 2P7VB 2DT5A 2W24A 4OU0A 1KA8A 1CGPA 1IZ1A 3E6BA 4EJVA 5FFXA 3K0LA 1E4GT 3M8EA 1R36A 4ZYGA 5E8GA 1IN5A 1JGSA 4G6DA 2NYXA 1UFMA 4B3MH 2JPBA 5FLXK 5K5QA 1KU2A 3P9CA 4AD9A 1O3QA 4PZJA 5E1WA 2ESNA 4MHGA 4S04A 2R7DA 3MCZA 4ZYDA 1ZHFA 1S03G 3E5QA 3ZPLA 3T1HH 1OKRA 5LMNH 2MH2A 5LHHA 3J81W 2E5LH 1FSEA 1KU3A 3TKYA 2ZXJA 1SD5A 4OIQF 3GLXA 3LA7A 2PMUA 4Y15A 1OYIA 4LB6B 2DTRA 1HKQA 1DDNA 2FMLA 1R22A 2GXBA 1FKAH 1EH6A 3TO7A 3RKWA 1KQ8A 2VE9A 1SAXA 2UUBH 2GA2A 4LFAH 5FPRA 4MEXF 4KDPA 5LGUA 5DD8A 1IN4A 4I0BA 4GLXA 3K1MA 1K78A 3LAJA 4HF2A 5JVTA 3VODA 3CDHA 1S6LA 4LGWA 1ONVA 4FX0A 4HAMA 2VOPA 2JSCA 1OYYA 1J0RA 2ZCWA 4IJAA 4WCGA 5EEHA 2NS0A 1F4KA 4M73A 2F2EA 4GYGA 2M5WA 1U8RA 2R3SA 1P92A 3F6OA 3HRTA 3M1EA 2GAUA 2PQ8A 1PDNC 3CUQA 4O5VA 3F8NA 3EQLF 3K1NA 4G7ZF 2YSRA 1T2KA 2HKOA 2HHHH 1N33H 1QZZA 2O3FA 1Y0UA 3HSRA 2G9WA 4UUVA 4LFCH 5LMUH 2PFBA 3V7SA 3VB2A 2K27A 2A61A 1ZGAA 3GW2A 4GKKH 2EWNA 3RDIA 2Q2TA 1J5YA 1SFXA 5L3FA 3F22A 4CYDA 1FWZA 4MTDA 1E4FT 5FD6A 3I5UA 2Q2UA 2FEZA 2HS5A 5BR8H 3KLOA 4N0BA 4LLGF 5A2QZ 1UHMA 4K0KH 5LBQA 3V7CA 2A6EF 1XCVA 4ETSA 1X3UA 1XGOA 4A2BA 1W5SA 4DUZH 3DKWA 3CO7C 4ENMA 4PGGA 3ZP5A 2WTEA 3CLOA 1Z91A 2XAGA 5LHIA 3TOBA 3BJOA 2XAHA 4ENNA 4HQMA 2WC2A 2V9VA 4KIBA 4L9JA 3RF2A 3F21A 1KU7A 2QQ9A 2Z9OA 3E5UA 4IRGA 2H09A 4LMYA 4I01A 2QZ8A 5F64A 3WU0A 5ILVA 2V1DA 1U5TA 2ZJTA 5L3CA 1EH8A 4A0XA 4EGYA 3UQ8A 4LFBH 5H6QA 1Z1DA 4CICA 5D6FA 2H27A 1S8NA 1GYFA 3CO6C 1AN7A 2LF8A 3C7JA 4GGGA 5F6FA 3KCCA 5E17F 1XDSA 1YW9A 4JI2H 3H92A 2KIMA 4I2OA 2ADUA 2E1CA 3JSPA 3N4MA 1HNXH 1P6RA 1MJAA 2VOOA 2EV5A 4YFNF 4Z2YA 4RB1A 3DXJF 1G6NA 3FMSA 1ZG1A 1P4AA 2NAZA 4KN4X 1RZ4A 1ZH5A 3IWFA 5CJ9A 5FFZA 4UVCA 4LG0B 4UV8A 2FU4A 4DR3H 1H9GA 2STWA 3R60A 4ON0A 2BBYA 4HOBA 4A12A 4U0VA 4IVNA 1MGTA 1SD7A 4MTEA 1TTYA 1MJ9A 5D1PA 3E3VA 4HF0A 3RTXA 3BROA 5HDKA 1L0OC 2VE8A 3IWZA 3G73A 1S68A 3L2PA 1P4XA 1SFEA 2HVSA 1SEIA 4UHTA 4BAYA 1GHCA 1WRJA 2IPQX 2HGCA 4L5IA 2YU3A 3J81Z 2EK5A 1FP2A 2Y0MA 2EFQA 2K86A 5JFRA 1R58A 3F8FA 2MLKA 3NQOA 3F6VA 4OINF 2A68F 2V79A 1BBYA 1BC8C 3SZTA 5D5WB 1IF1A 3QOPA 1XMOH 4JYAH 1MDMB 4JI0H 1U6GA 1L2ZA 4AIJA 3HUGA 3KEOA 1SFUA 2JZYA 4P9UA 4CXFA 4IHTA 2HDCA 1W4MA 3GZ5A 4GYIA 1FPQA 4GO1A 4L9VA 5DUIA 2A69F 1KGSA 2STTA 1KQ9A 5D5XB 3W6KB 5IT9W 2UUAH 2WDTA 5EEGA 2EA2A 4WK8F 4HX4A 5LRRA 1MKMA 2DFIA 4D0PA 3ZMTA 1K7AA 4MGRA 3R61A 2CWEA 4APMA 1HW2A 3GFIA 4EJUA 1Z7UA 3M7GA 4CDGA 4M74A 2HTSA 1XSXA 3JTGA 4DV5H 5FB2A 5ICFA 4G9YA 5LL6b 4CC6A 3DPTA 2CG4A 4M9SA 3WTYC 4I09A 4HDVA 1PUEE 4RZQA 4JI5H 2RKHA 3WGGA 2WE6A 3JSNA 3ZMUA 6PAXA 5ED4A 3SFZA 4EM1A 1H0MA 4GKJH 1BI0A 3V8JA 4I7HA 3MQ0A 3SQNA 1FYKA 4QWQA 2ZMEB 3BJAA 1DP7P 1FC3A 2EV6A 4ESJA 5E1XA 1HSTA 2VPSA 3U1DA 4HDUA 1USTA 1Z6RA 1V4RA 1FBQA 1XNQH 2D2WA 1S29A 5H20A 2VN2A 5DV5A 1M0TA 4DR7H 3IRQA 3F8CA 4ZYHA 3P9IA 3L4KA 4I98B 1S3JA 3I59B 2OD5A 1LJ9A 2KJCA 1B59A 3HHHA 3FMQA 3GFMA 1XN7A 1LEAA 3VOEA 2CYYA 2F5FA 2JPCA 1I1GA 1TLHB 1KU9A 2ZFWA 4YFXF 3WTUC 1E17A 4HW0A 4AIHA 3BA9A 2Z99A 1OMIA 3VEPA 4TV7A 4P55A 4UCTA 4RB3C 4NXNH 2PN6A 2WV0A 5H6RA 2Y75A 2V1XA 4UVBA 5K1YA 1V3FA 5E18F 2TDXA 1R7JA 2XVCA 3OV8A 2YR2A 2EA4A 5FLXW 5E1ZB 2Z3YA 1T98A 4B3TH 1IRFA 4OMYA 3I0TA 1A0IA 1R5GA 3RYRA 4RAYA 4LF8H 2DO7A 2HWVA 2QLZA 2XAFA 2VUGA 3QRFF 1KQ0A 3ABTA 1B9NA 3RYPA 3HRSA 1D8KA 3ELKA 4LK0F 3WTWC 1L3LA 2ZNYA 4Y13A 1W5TA 2D45A 5CYVA 2XROA 3CVZA 2LKPA 4U7BA 4DR4H 2L4MA 2CFXA 2ZKZA 1RNLA 2IW5A 4YY3H 2QBYB 2A07F 4KYWA 2F5CA 2GWRA 3HRMA 3JW4A 1YS7A 3FX3A 1SMTA 3DF8A 4LSXA 1SMYF 5D8LB 4DV7H 4LF7H 1XMQH 3CTAA 3MFKA 2BGCA 1ZG3A 1Z9CA 2KIUA 1Z2NX 3TQNA 2XRNA 1RI7A 1HXDA 1TBXA 2O0YA 1GXQA 3ZMVA 1IXSB 3LAPA 2RC4A 2VONA 4CHUA 4LK1F 2DK8A 1Z2OX 4S05A 4N9IA 4IXAA 4Q48A 1J9IA 1GVJA 1ZARA 3M4IA 2E7WA 3JAMZ 2FNAA 2RV8A 3GWZA 4LSAA 4A2AA 4LB5A 4DV4H 3EYYA 5L3GA 1BN5A 3T8RA 2A3SA 2MD5A 4A2UA 1YLFA 3TDZC 2KIFA 2FOKA 1FX7A 5CVJA 1N32H 3IL2A 1REPC 4KNYA 2G7HA 5HOOA 2XUBA 5HS8A 2IT0A 1JHHA 4LJZF 1BI1A 4G6QA 2VC1A 4XBFA 2HR3A 1FBSA 4R7RA 1LDJA 2E1NA 4I02A 3N97A 3NEUA 4LG0A 2K7LA 2P5LC 1DPUA 3B73A 4DQ2A 4NHJA 5IT9Z 5IT3A 1CF7A 2RNJA 4UCUA 1YW8A 1JE8A 2HVRA 3KP3A 1PP8F 2R7FA 5DCFA 1AWCA 3I54A 3V7RA 3I71A 4BQAA 1I94H 4EQQA 2FXAA 2HYFA 3KP4A 4G94A 4EV0A 1RUNA 3HOTA 5BOXA 2CO5A 2UXNA 3L7WA 4NQWA 3DF7A 4YFKF 3HTSB 1MZBA 2UU9H 3J7AK 2OWOA 2XV4S 2A6HF 3L4JA 3KP6A 4KFCA 3GVAA 2P5KA 4JQFA 5LLQA 2QWWA 1AOYA 3QP6A 1G3TA 3WU1B 1UHWA 4F7ZA 3PFIA 3E97A 2RDPA 1X9NA 3J80K 1R23A 4EMSA 5IWAH 1ON1A 2A5YB 2OBPA 3PN1A 2P7CB 2BV6A 1KYZA 1XSVA 3VFZA 4HV6A 1BM9A 5JHUA 4EJTA 4EEQA 2L4AA 2L54A 3BOQA 2IJLA 1SD6A 1LQ1A 5K5OA 4B3SH 2CSOA 4DV2H 2DI3A 2DK5A 3RTRA <