4RAZA

Crystal structure of magnetospirillum gryphiswaldense msr-1 holo-fur
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4razA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4razA02
3M8FA 4HDUA 3J80Z 1RUNA 3TOBA 1R58A 1HKSA 2FQ3A 5HDGA 1ZAOA 4UHTA 1UB9A 2K27A 5DEQA 2Y48A 4AIKA 1R22A 1HSTA 1TW3A 2ADUA 2HZTA 1KGSA 4KFCA 2IW5A 1QZYA 3K1MA 3SFZA 2MLKA 3ABUA 3BZ6A 2EV6A 4LB5A 3WU0A 2K86A 1IRGA 2PBIA 4F7ZA 1SFUA 1YFHA 1OYWA 2F5EA 4IRGA 4YIFA 1W7PD 1OKRA 5KVRA 1J9IA 3S2WA 2JPBA 5ERIA 2KIUA 3Q9SA 3SZTA 3O3KA 2KKOA 3B73A 5ICCA 1XCVA 1FBUA 4CZZA 2BV6A 1H0MA 2GXGA 1FSHA 1EH8A 1SAXA 3KZZA 1J5YA 3K9TA 3HRTA 3F8NA 4CXFA 3VFZA 5D8KB 4R79A 3L09A 3DPTA 4QLCU 2FRHA 2GA1A 5F6FA 1P92A 3I0TA 1LNWA 1B1BA 5E8IA 2NNYA 2DFIA 3KP5A 2XAFA 2QLZA 3E6MA 1QZZA 5LRRA 4LGWA 1LB2A 2OZUA 1FP2A 5E1WA 3KP3A 2WWYA 4RB3C 2BE5F 1WWXA 3TQNA 2AXLA 3RPQA 4EM0B 3MCZA 3GFMA 1XGOA 3WTZA 3GF2A 1Q1HA 5A2QZ 2PJPA 3QRFF 1OYIA 2ISZA 3WTSC 1TNTA 4WXDA 3EYYA 1PDNC 4HYEA 1OYYA 1MD0A 1AOYA 2HOEA 2VBYA 2VN2A 4BHBA 3ELKA 2UZKA 2VC0A 1ODDA 2E1NA 2XKPA 3T8TA 2HTJA 4UXNA 2J5OA 2VBWA 1T38A 5LGNA 1A04A 1ZG3A 1ZARA 3K1PA 4WCGA 5FLXZ 2LKPA 2VBXA 2W24A 1BC7C 4I7HA 4Y15A 5ILSA 4MHGA 3T1BA 1K78B 4BNCA 3ZMZA 2GWRA 3LA2A 3RJPA 1OMIA 1DDNA 2Z3YA 1ULYA 2O0YA 1QO0D 5J8FA 3RKXA 3MFKA 1S3JA 3FMQA 5KK1A 2LF8A 1YIOA 2CW0F 4PDKA 1KQ9A 4EJUA 1F4KA 4KT5C 3WE3A 3V8KA 3H3ZA 1TLHB 1K79A 4IJAA 3QPTA 2GIVA 4ENJA 1J75A 3I4PA 3ERED 1D8JA 4EVIA 1V3FA 3FZVA 3REOA 4U0WA 4M74A 2EWNA 3JAMZ 4Q48A 4AVPA 1IN8A 3JSOA 2OAZA 2DK5A 3P9KA 1I6XA 1BIBA 1XGNA 3E5XA 1MDMA 4RGSA 4ZZDA 1KU7A 5E18F 3ULQB 2FNAA 4LG0B 2A5YB 1AWCA 4NB5A 2DQRA 3BROA 1FC3A 1P6RA 2TDXA 4YFKF 1SD4A 1MZBA 2IJLA 4NHJA 1WQ2A 4XSXF 3RKWA 2QQAA 1O7FA 2D1HA 1U78A 4N9HA 4O5VA 2HYGD 2PQ8A 1HSJA 3CUQC 2M1BA 4L9NA 3RIRA 2KIFA 4RB2C 2EFPA 2FBIA 2EA2A 3TDUC 2HS5A 3Q5FA 4G6DA 2V6CA 2YSRA 4ON0A 2CGPA 5TRDA 4L9JA 2XROA 3HSEA 4A2UA 1G3YA 1T98A 3V7SA 3H92A 1O7LA 1PUEE 1H9GA 4R8HA 4OMZA 3LQQA 2YX4A 1RIOH 1MJ9A 3TO7A 2Q0OA 2EJRA 2GZWA 3FX3A 4Y17A 1BOAA 2P5KA 1R00A 3QOPA 3R0JA 4KN4X 3FF5A 2HYFA 5D5VB 4EGYA 3O2PE 5H20A 4S05A 2V1DA 2M45A 2PN6A 5L3CA 2COMA 2VE9A 2FF4A 1CF7B 1GVJA 3E5QA 1LEBA 1QNTA 3C1DA 3K0LA 2DTRA 3OV8A 4LLGF 4G7OF 4P55A 1YLFA 2FBKA 2BBYA 1U3EM 3GZ5A 4MNUA 1LQ1A 1HKQA 4H0EA 2O3FA 5HLGA 4RGRA 2XVCA 3HHGA 4UV9A 2UWMA 2R3SA 1G6NA 2QWWA 1R5GA 1YS7A 3AAFA 4U88A 4EM2A 4ASNA 4PZJA 4CYDA 2MH9A 2PFBA 5E1ZB 5LGTA 4MEXF 2QM3A 1FYLA 3DPLC 2KIMA 2P6SA 5JVTA 1ZN2A 3QPHA 4L5JA 3PQJA 4XLPF 2H94A 2RVCA 4UUVA 1XDSA 2BEOA 3E5UA 4UVCA 3I71A 4GO1A 5E8GA 3WTVC 5D5WB 3SQNA 1G3WA 2H09A 1NHAA 4L5IA 4HV5A 3DF8A 3CDHA 3FXQA 4M6YA 3ZMDA 1JHFA 1XB4A 3ROUA 1JE8A 2LF7A 4UNOA 2O03A 2OA4A 3ZN0A 4G7ZF 2DPDA 4ZZLA 1ZHFA 4KNYA 4KMFA 1QGPA 2GXBA 4HW0A 2MC3A 1G3TA 3MEXA 3LSTA 5DUIA 3WGIA 2EFWA 1HKTA 3G73A 3WTTC 2R7DA 2EFQA 2OQGA 1XD7A 1FBSA 3FM3A 4EJTA 3TDZC 5CYVA 3GXOA 1LEAA 3E6DA 1U6GA 2IVMA 1HQCA 3KP7A 1W7PB 4I0AA 3IKTA 1WI9A 2NNNA 2F5FA 3ZMSA 5DD8A 3C3WA 3GVAA 3IWZA 4U0VA 2JTVA 5CVIA 5LHIA 3SHFA 5JHUA 1B4AA 3PQKA 3BJ6A 5CLSA 4N0BA 1L0OC 3WTXC 2ZXJA 3ZP5A 2RQPA 5TJJA 3F8FA 4OINF 2Z5UA 4HDVA 5ICEA 3GW2A 2KJCA 2RV8A 2VE8A 3P9CA 4KIGA 1IXCA 2ZNZA 4AWXB 4HF0A 3RTRA 2W84A 1GXQA 4EM1A 3K1NA 5DCMB 2M30A 2MH2A 3IC7A 3RDIA 3I58A 1BI0A 2M5WA 1JXSA 4LMYA 5L3FA 2K02A 5L3GA 4LK1F 4KN7X 1JHHA 2H6CA 3IL2A 5LEKA 3TKYA 1D3YA 4Q47A 3GEZA 4DQ2A 4YIIA 5LGUA 3N97A 4TV7A 4YG2F 1SD7A 2O61A 5BS6A 5L3EA 4M73A 1E2XA 1OPCA 3QU3A 2XGXA 4HLXA 2JRTA 4LK0F 1T39A 2LDUA 5D6FA 4I01A 1DPUA 3EDPA 1TQIA 3OOPA 1TQMA 3HOTA 2NRAC 3FWEA 1MJBA 5ILUA 2K4JA 4HF1A 2ISYA 2CO5A 2HR3A 5HLHA 2WC2A 3V7CA 4HX4A 1KU9A 3EYIA 1E17A 4I02A 1OR7A 1SFEA 4HX8A 1LDJA 3R61A 1D5VA 1UHMA 3BJOA 1KA8A 4RAZA 3GZ6A 1KQ8A 1ZGJA 3E6CC 3NEUA 3RYPA 1F9NA 4A6DA 3D5LA 2QBYA 3F72A 2FSWA 3J80K 4IPAA 2A69F 2XAHA 3ABTA 3FMSA 3BPVA 3VB2A 4Y13A 1BN5A 5AONA 3ML6A 2M87A 1PP8F 1J7KA 1R7JA 1F5TA 2EA4A 1F1ZA 3BPXA 3KFWX 3GYHX 3L7WA 1U5TA 3GX4X 1IXSB 3GFLA 4S04A 1ZH5A 1WKMA 2J5PA 2MD5A 2MLGA 3BOQA 2Z33A 2QYOA 2EV5A 3RYRA 4A0XA 3BWGA 2STTA 4WF2A 5FFXA 1TBXA 4G8XA 2OQRA 3QAHA 1K7AA 2A6EF 5K5OA 5IT9K 1SD6A 4EMSA 2A61A 4CGZA 1XMKA 1I1SA 1FLIA 3ZQ7A 1RI7A 3L00A 2L02A 1SFXA 2K7LA 3IRRA 2JZYA 1YW7A 5FGMA 1I5ZA 2L01A 1Y0UA 1KQ0A 5D4RA 4XRFA 5LEJA 1HW2A 4D0PA 1W4MA 3MZYA 4LG0A 4WWCA 5J8CA 2IA1A 1W7PA 1IAWA 4HV6A 1IN4A 2HQNA 1Z9CA 1RUOA 3HRUA 3W6KB 3J81K 3T8RA 2PMUA 4MTEA 3KCCA 4YFNF 3GFJA 4GXOA 1O3RA 2CQKA 2LNBA 2ZCWA 2XRNA 4PCQA 1ZRDA 2D2WA 2OU2A 2VT2A 1YS6A 4G6QA 4RS8A 3ZPLA 5D6EA 4ENNA 5K1YA 3DV8A 2A68F 2D45A 4GGGA 4OIRF 2P7CB 1J59A 3ECHA 1SMYF 1CGPA 3C7JA 4HAMA 1MJAA 3RPUA 4I0BA 3L2CA 2FOKA 2W25A 1XDUA 1LVAA 5LHHA 4RB0A 1XSXA 2D1VA 4IVNA 2BYVE 3DEUA 5IT3A 4GYIA 2V79A 1U2WA 3N4MA 3I64A 3M7GA 5HLIA 5BPIA 3DFGA 4HZFA 1TQPA 4HF2A 4I2OA 4FX4A 2QQ9A 3V7RA 5DDGA 1S29A 3E6BA 3HHHA 5LLQA 2P8TA 1RZ4A 1TW2A 4KUMA 1X3UA 4XBFA 1LDDA 4EJOA 3M1EA 4HBLA 4IHSA 1KYZA 4RAYA 4M9XA 1K78A 4OIQF 2AS5F 5ICFA 2DW4A 1Z6TA 4IHTA 3MWMA 2L54A 2ZNYA 1Z1DA 1HBXG 1BC8C 2PG4A 2P7VB 5HS8A 3K2ZA 3GO5A 3TO6A 5BPDA 1IZ1A 2EFNA 3CUQA 2ZMEA 3I54A 4ESFA 2GAUA 4ZYEA 4CDGA 5DCMA 4EGZA 1FNNA 4OOIA 4U7DA 1S7AA 1PP7U 3KE2A 3GFIA 1VTNC 2A07F 4MQVA 3J7AO 1R23A 1GHCA 1MGTA 1LJ9A 1QPMA 1G3SA 2XKOA 3WTYC 4ESJA 2QZ8A 3LA3A 4LLLA 5BOXA 3HSFA 1FP1D 4N9IA 4Q4ZF 3VEPA 4M71A 3CUOA 4ENMA 5HS7A 1UFMA 4OMYA 3TO9A 1T2KA 1BIAA 2H27A 3L9FA 1U8RA 2G7UA 3D0SA 1XGMA 1MKMA 5HDNA 3FHZA 1FT9A 2RGVA 4JK1X 2P4WA 2W85A 3ZN1A 1MDMB 4HQEA 2VOOA 3ISPA 4U7BA 4LD5A 4P9UA 4HOBA 3WTWC 4WXHA 2QENA 2VBZA 2HGCA 3HRMA 4UV8A 3ECOA 2VT3A 5L3BA 3EUHA 1DP7P 4EQQA 4OIPF 3PFIA 4MEYF 1USSA 1S8NA 3Q9VA 1FX7A 5DCFA 4YFXF 1XGSA 4AIJA 5ILVA 4HX7A 1LDKB 3CLOA 3IWFA 2IA2A 2FU4A 5JFRA 5A2QK 5AIQA 1IUYA 1FOKA 2X0LA 2ZJ2A 3FXRA 2ZFWA 2L3DA 4FHTA 3HSRA 2OBPA 2V1XA 3HTSB 2ELHA 2VOPA 2PI0A 4OIOF 3KP4A 3F21A 5HDKA 3KLOA 2Y75A 2DLLA 3W6JB 1CF7A 1Z05A 1ZREA 2VC1A 3JAMK 2V1UA 4O6JA 1R1TA 1BI1A 3SZPA 2P6TA 3HIFA 4A0ZA 4CHUA 5BMZA 1IXRC 3I53A 4PGGA 5JR3A 3TOAA 3DQVC 4RGXA 1TNSA 1UCRA 1Z7UA 4EV0A 1GXPA 3GWZA 2EB7A 1ZLKA 4KIBA 1SD5A 1BI3A 3MZHA 5FO5A 2HQRA 3V4GA 3JTHA 3LA7A 4IRHA 1QBJA 2A3SA 4O3MA 1P4AA 4BHPA 1O57A 3WGHA 4I98B 2DU9A 4EJWA 1FBQA 1ZYRF 2IP2A 2L4AA 4I09A 4HQMA 5E1XA 1ON1A 4XLNF 2YPRA 2VODA 5FD5A 3JTGA 4L9TA 2VXZA 2FEZA 5LRSA 1ZG5A 4Q5SF 3R60A 1REPC 2P5VA 1XN7A 2A6HF 4KDPA 2UXXA 2Q2EA 1IN7A 3QP5A 2FMYA 3ZMTA 3V8JA 5F64A 2WV0A 4BH9A 4KICA 2DI3A 3F3XA 4A0YA 3T0YA 3WU1B 3FMRA 3BY6A 3WE2A 3RKYA 3CTAA 1V4RA 2F5DA 4NQWA 2XV4S 1QQIA 2R7FA 2EV0A 5J6XA 2UXNA 2NS0A 1EH7A 2CSOA 4KIFA 4P5OA 2HEOA 3U1DA 2EFOA 4UVBA 2ESHA 1P4XA 3KZYA 3KEQA 2QBYB 1P2FA 2CYYA 1USTA 1BM9A 3HOSA 1BJAA 1ONVA 3BDDA 3WTUC 4ZYGA 3BJAA 2RKHA 4G94A 3O6BB 4M9SA 4HA8A 3P9IA 1XSDA 4FX0A 3TGNA 2FNPA 4ESBA 3NRVA 3KETA 1B9MA 4ZYDA 1D8KA 4OU0A 1IN6A 3R0AA 3RI4A 4M9ZA 1H9TA 5D8LB 4BXUA 2LSOA 1FYKA 4BHCA 4RB1A 1O3SA 2CWEA 3U9GA 4CICA 2FBHA 4P96A 2ACJA 2OZ6A 3JW4A 3E97A 3IKVA 3F8BA 2B0LA 1ZGAA 3F22A 2YX7A 1JGSA 2DT5A 2CFXA 3HTUA 3ZMUA 2DPUA 1EV7A 1B6AA 2QUFA 3COAC 1YG2A 3M8EA 1ZLJA 2Z9OA 4XSZF 2VONA 4WX9A 4L9VA 5LHGA 5E20A 2YR2A 3QU6A 4GCVA 1T6SA 5CVVA 3BP8A 1KU2A 1P4WA 4MGRA 1S6LA 4A6EA 3J81Z 1BI2A 3C18A 5LBQA 5FD6A 3FXUA 2ESNA 3WGGA 3CO7C 2HFHA 3E3VA 5F1RA 2HTSA 2JSCA 4IF4A 1EH6A 3WG9A 2F2EA 3ZMVA 1YO5C 4U0YA 2ZBKA 1XSVA 2Q8KA 2STWA 2KJBA 1J2XA 3F8CA 4LB6B 5FB2A 2RDPA 2XAJA 4L0ZB 5BQTA 3LQRA 1FYMA 2O8XA 1U5TC 5FLXK 5EEGA 5DUKA 1I27A 1KYWA 5CJ9A 3CO6C 2BGCA 4G9YA 1R5HA 3F8MA 4P9FA 4AD9A 2OD5A 2MBFA 1RNLA 3IHUA 2RN7A 4BAYA 2W57A 4HLYA 2GQQA 4ZYHA 2XASA 1W5SA 1IF1A 4KA4A 4IRIA 3P7NA 3VODA 5ED4A 4EJVA 1R1UA 1HXDA 1C0WA 4L0YB 1SMTA 1FPQA 3U2RA 1KU3A 3I5UA 5H6RA 2PMHA 3DXJF 4BYYA 5EEHA 2HWVA 4WK8F 3I59B 3T5XA 3WODF 3KLNA 2YU3A 4LLNA 3EETA 3G3ZA 2JT1A 1ZRFA 3LWFA 1IN5A 1U5TB 2E7WA 3CJNA 4AIHA 4DNCA 2FXAA 3KP2A 1ZRCA 2P5LC 4PGHA 2DQLA 1G4DA 2IRFG 1FY7A 2XUBA 4BQAA 1Z6RA 5K5QA 2NYXA 3GUDA 5AIPA 6PAXA 2ZMEB 2Y0MA 2EK5A 3HRSA 4M72A 2KRFA 4M6XA 2XHKA 1I1GA 2PLYA 4RGUA 1S7OA 1STZA 4CO8A 2XAGA 5D5XB 2H6BA 3F6VA 3R6SA 2RNJA 1O3QA 2MA3A 2JPCA 1T0FA 5E17F 3DP7A 1DPRA 4ZH4F 1YYVA 2CG4A 2HKOA 4K2EA 4JQFA 1FWZA 2DBBA 4MTDA 4KMUX 4ETSA 4Z2YA 4B09A 1WRJA 3JSPA 1XMAA 2V9VA 1ZG1A 3MQ0A 1R36A 2E7XA 2ETHA 5HVQC 4LJZF 1YQAA 2C6YA 4LFUA 5DV5A 2FE3A 3KP6A 1YW9A 2O6GE 4G7HF 5D5UB 4JBAA 3EQLF 2ZO4A 4FT8A 2IPQX 2WTEA 2HDCA 1TTYA 3F6OA 4R1HA 5ICGA 4A5NA 5L3DA 2IT0A 1IRFA 5H6QA 3SXYA 2NAZA 3M9AA 4E70A 4UVAA 2DAOA 1HW1A 1YTYA 5CVRA 1FZPB 3VOEA 4IXAA 3V8LA 5FFZA 1IW7F 2E1CA 2DK8A 2HKXA 4A5MA 1DUXC 1R1VA 4A12A 4L18B 3LAJA 3GLXA 1L3LA 1B9NA 3LFKA 3B02A 3I59A 5K5RA 2L4MA 2PEXA 1J0RA 5D4SA 2FA5A 1W5TA 4WXCA 2K4BA 2Z99A 4ENKA 2RC4A 1FSEA 3QP6A 1O3TA 2G9WA 2F5CA 3K69A 5DD4A 2XAQA 2G7HA 2GA2A 5IT9Z 2DO7A 2XIGA 3FM5A 3H3UA 3CUQB 2FMLA 2ZKZA 2M8EA 1XCBA 4B8XA 5DYMA 2QQBA 1UHWA 3HUGA 5CVJA 4GYGA 3DKWA 1ON2A 3KEOA 4KYWA 2X4HA 4QWQA 3MAJA 3F23A 5CVUA 1YW8A 3IRQA 1BBYA 1B59A 3R4KA 5JI6A 3HYIA 5HOOA 1HW5A 1WSUA 1K6OA 2IA0A 3NQOA 1Z91A 2QVOA 3LAPA 4MQ9F 5HS9A
chains in the Genus database with same CATH superfamily
3M8FA 3G71I 4HDUA 3J80Z 2OH2A 4MV9A 1R9TJ 1RK5A 2W48A 2IA6A 4BEHA 1RUNA 3TOBA 4HR7A 3V6HA 3CCVI 4EEFG 1R58A 2NU9B 1HKSA 2FQ3A 5HDGA 1H89C 2XCPA 4IZOA 2ZJTA 5F9LA 1ZAOA 4UHTA 1UB9A 1TAEA 1IDZA 1ACIA 2K27A 5DEQA 2Y48A 4AIKA 3IN5A 5GAGJ 2MYSA 4RM3A 3H3VH 4MV7A 4B3TH 1R22A 1HSTA 3VWBA 1TW3A 2NVYA 4XRMA 1U9NA 2ADUA 2HZTA 1KGSA 4QTRA 3KPHA 4KFCA 4MV6A 2DTZA 2IW5A 1VKZA 1QZYA 3K1MA 1VAJA 2IP4A 3SFZA 4BEHB 4PWQA 5JQWA 3K4BA 2V4QA 1VQMI 4MIMA 2MLKA 2YS9A 3UQ8A 3ABUA 4JI3H 3BZ6A 2EV6A 3H1CA 1B6SA 3PW2A 4LB5A 3WU0A 2K86A 1IGNA 1IRGA 1TZLA 1UJ8A 2PBIA 1GV5A 1XPXA 1E4EB 4F7ZA 3GTQJ 4NC8A 5EZYF 1SFUA 1YFHA 4G3IA 2HU9A 2ZM6H 5A2QW 5C3EG 1OYWA 1EUCB 1WPKA 2F5EA 2KLOA 3I4MJ 3IH3A 3HM5A 4IRGA 2E71A 4YIFA 3H20A 1W7PD 1OKRA 5KVRA 1J9IA 1L2ZA 3S2WA 4UCUA 3R23A 4A2BA 4DUZH 2HGSA 4FM9A 3OL4A 4TUYF 2JPBA 5ERIA 2KIUA 2B63J 3Q9SA 3ZQLA 3SZTA 3RB0A 4YHHH 3O3KA 2V5AA 2KKOA 2M7BA 3B73A 5ICCA 4I50F 2V9WA 5KG5A 3KIOA 1XCVA 1FBUA 1X1CA 2E60A 4XONA 1LE8A 4CZZA 2DXIA 2BV6A 3HOVJ 4F92B 1H0MA 2GXGA 1FSHA 5KFVA 1EH8A 1SAXA 1X4OA 3KZZA 1J5YA 3K9TA 4N4OB 4NNJA 3NARA 3TIIA 1RR7A 2FPPB 4J9QA 3HRTA 3LSPA 2OV7A 2E1MB 1ETQA 4A3CJ 3F8NA 4CXFA 3VFZA 2BXZA 5D8KB 3BA9A 4XX0B 4JV5H 4R79A 3BR1A 2LTPA 3L09A 1SANA 3DPTA 4QLCU 1KJIA 3I56I 2FRHA 2R82A 3GTMJ 3LSRA 2GA1A 4M9UA 4DL6A 4LF4H 2JA7J 1IV8A 1WI3A 3DF7A 4BXFA 3HXLA 2EZIA 2HPMA 2Y9ZA 1XMQH 5F6FA 1TWCJ 3PO3J 1P92A 3UKGA 4E7JA 1O75A 3DTEA 3I0TA 1IDYA 2IGMA 3LSGA 1LNWA 2VUGA 2BQUA 2JA5G 1AKHA 5KT7A 1B1BA 4J9NA 1WZ2A 4D7NA 3Q0WA 3DTKA 3ZQQA 5E8IA 5KFWA 2JA7A 2NNYA 1YI2I 3KHGA 5KFXA 5J4YA 2IS6A 3PIPF 3D1NI 5DGBA 3KYCB 2GLOA 2DFIA 5IP6A 1UNNC 1VQLI 3KP5A 4B48A 5FPRA 1FJLA 4XIDA 2L7MP 1QVUA 2DT6A 1P7IA 4J19A 2XAFA 2QLZA 3E6MA 3OYCA 3KXYT 1QZZA 4A3FJ 5LRRA 4AYBA 5KFPA 4QWEA 5F0HA 4LGWA 2XF7A 2CUJA 2BY1A 2HDDA 4QIWN 1LB2A 3BJYA 4ZOLF 5DLFA 2OZUA 1FP2A 1MMSA 5E1WA 3BTLA 4E7KA 3KP3A 2WWYA 2R0QC 4RB3C 4FE4A 2VUMG 2BE5F 5IOYA 3CCLI 4YR3A 1N77A 4FU0A 1B8IA 5J1YA 1QU3A 1SC7A 5HBRB 1WWXA 1HNXH 4BQNA 2L0KA 2M34A 3TQNA 2UVRA 2AXLA 3C0FB 3RPQA 4EM0B 3CC2I 3MCZA 5KFKA 4IHJF 2FLLA 4C2MA 3GFMA 1XGOA 4WBNF 3WTZA 3GF2A 1Q1HA 5A2QZ 2PJPA 3QRFF 2PMZA 3T5KA 1OYIA 2RF4A 2ISZA 3WTSC 2ZSIB 3CCQI 1YJNI 1TNTA 4WXDA 2FK2A 2ELJA 2FKLA 3EYYA 3ABKH 1PDNC 4HYEA 1OYYA 2VQDA 2A05A 1MD0A 2F4VH 3PZPA 1X1AA 1AOYA 2HOEA 2VBYA 2VN2A 1G2HA 3OTOH 4BHBA 4X66H 2GPSA 3ELKA 2CV2A 3ZRGA 2UZKA 4JV2A 2ECBA 2VC0A 2ZXWH 1APLC 5F9NA 4N4NB 1ODDA 2E1NA 3W2WA 2FX0A 5EDWA 2XKPA 4V19K 3T8TA 4IWYA 2RNGA 4XM3A 2HTJA 3DBRB 4UXNA 3V6JA 2R4GA 4A3LJ 1KJ8A 2R8GA 2H1LA 2J5OA 1T3NA 2HQ5A 2QQ8A 2VBWA 3SEZA 1T38A 3JRWA 3QOEA 5K7ZA 5KG3A 1OCZH 2E5ZA 3HKZN 2LR8A 1A04A 1ZG3A 5EZHA 5LGNA 3PIOF 5IP9J 2H1KA 1TWFA 1ZARA 2W6QA 3K1PA 3MR5A 3A0HC 4WCGA 5FLXZ 2BOLA 2LKPA 2VBXA 2W24A 1BC7C 4I7HA 2W9BA 3GIIA 2BZTA 4CYCA 4Y15A 5ILSA 1GUUA 4MHGA 1I3QJ 3Q8QB 2FOWA 3T1BA 1K78B 2JN6A 4CC5A 4BNCA 3ZMZA 2GWRA 3BZKA 2M9HA 2ZJQF 3LA2A 4II2A 1MH4A 3K4NA 2C28A 3K4KA 1TWHJ 3RJPA 1Q1VA 3HOXG 1OMIA 3FK7A 2EQRA 1DDNA 2Z3YA 3BG3A 1LFUP 1ULYA 2IBKA 2O0YA 5EGOA 3GTGJ 1QO0D 3CDIA 5J8FA 1KJ9A 3CF2A 4PFPA 3HZJA 1BL0A 1I3QA 4GC7A 3RKXA 3MFKA 2CQ7A 5KFNA 3PW5A 1S3JA 3GTQA 1WH7A 3FMQA 3LSJA 4I76A 3FK6A 2Q2EB 2JK3A 4CCKA 4U6PA 2DIKA 4CZCA 1UG0A 5KK1A 2LF8A 2I10A 1U9OA 4A3LG 2AO9A 5FRMA 1WH5A 1YIOA 2VPLA 3IH2A 2CW0F 4PDKA 2WB1E 1KQ9A 2VJJA 4EJUA 1F4KA 1V54H 4KT5C 5KFLA 3S14J 3WE3A 4DR2H 1NG6A 3AG3H 3V8KA 4EBDA 2R93A 1RKTA 3H3ZA 3TMOA 3HEFA 1TLHB 1Y8RB 1K79A 2XAUA 4LF5H 2ECCA 1FMWA 5DG9A 5KFMA 4IJAA 4ZJZA 2VPQA 3QPTA 2GIVA 4MA0A 4ENJA 1J75A 4GDFA 3I4PA 3Q0VA 3AYHB 2Q1ZB 3ERED 3J81W 4IRKA 4XICA 1D8JA 5KFRA 1WCMG 1YRNA 3S16J 5D1PA 4EVIA 1DGRM 1V3FA 1JKRC 2R8KA 4BY7G 4X1EA 3FZVA 3BTCA 3REOA 4FCYA 3I9V2 4U0WA 3VSLA 1QA6A 1VBHA 3LL7A 1VF9A 3O8HA 4M74A 3BQZA 2EWNA 2OF7A 3GCMA 3JAMZ 3QYFA 4E7IA 4BY7J 3HOYG 4QPOA 4Q48A 3DLLF 3MKLA 4AVPA 1FOXA 1IN8A 3CMMA 3JSOA 2OAZA 5GTIC 5KT5A 5F27A 2VB6A 2DK5A 3P9KA 4C2MJ 1I6XA 3BR6A 1ETWA 2R7RA 1BIBA 1Y6IA 1XGNA 3E5XA 5KFOA 4O3QA 5I47A 1E3PA 5JLXA 2CS3A 2E2IA 1MDMA 1PVEA 4UB8C 5KKNB 4RGSA 4ZZDA 1KU7A 3K5IA 3ZQHA 5KG6A 5E18F 1SCUB 3CVZA 3FDSA 3ULQB 3MR2A 3G1LA 4A3GJ 4MV4A 1PUFA 2FNAA 2VJIA 3PNTA 4BE0A 4LG0B 2R8IA 2A5YB 1AWCA 4NB5A 1YIJI 2DQRA 2OC6A 1KBLA 3BROA 3KHHA 4O4HF 3BC8A 1FC3A 4XKWA 2BR0A 2V59A 4DV7H 1P6RA 3CCYA 2TDXA 4JP0A 4YFKF 3C2HA 1HDDC 2QKLB 4F91B 5IYBG 3AG1H 4H4KC 4D5CA 2DLNA 1AN7A 3CQZJ 3MWEA 2JA7G 1SD4A 1N25A 1MZBA 2HI3A 2IJLA 3GIDA 1T08B 4XRSG 1GDTA 1RK6A 4ECVA 4NHJA 1WJCA 4JV1A 1WQ2A 4Y33A 4XSXF 3RKWA 2QQAA 1N36H 1O7FA 2D1HA 1U78A 2FQ4A 4N9HA 2YYAA 5IY5H 5HNHA 4O5VA 3ZQIA 2HYGD 2PQ8A 4LH7A 3Q0UA 1HSJA 1T8IA 3CUQC 2DMNA 2M1BA 2MFZA 2TRTA 4L9NA 3F9KA 5M5YJ 4I6ZA 3GTOJ 4DLKA 4BQOA 3RIRA 2NVTJ 2KIFA 4DZJA 4RB2C 2EFPA 3H3VK 2FBIA 4AU7A 5IPAA 2EA2A 2B63G 3EUAA 4NC6A 3TDUC 2HS5A 3Q5FA 5FJ8G 4G6DA 1WFXA 2V6CA 2YSRA 5E3NA 4IRDA 4ON0A 3LP8A 3BZCA 4I55F 2CGPA 4UY8I 5TRDA 4MV3A 4L9JA 2XROA 3HSEA 4A2UA 1A9XA 1LPQA 3I4MG 1G3YA 3HPGA 3IH4A 1T98A 3V7SA 4QWDA 3H92A 1O7LA 1PUEE 5D8DA 1H9GA 4R8HA 4OMZA 3ASNH 1OCOH 2DT7B 1BOBA 3SDBA 5DQHA 1XMXA 3LQQA 3EPZA 3LSIA 1F36A 2DDAA 4J00A 3DKYA 3SFIA 2YX4A 3BCAA 1MJ9A 3H0DA 1RIOH 2FLPA 3TO7A 3QZ8A 3T1HH 2Q0OA 2EJRA 2GZWA 3C2BA 3FX3A 2DJNA 2MABA 4Y17A 1K1SA 1BOAA 2P5KA 1UC9A 3NGDA 1R00A 2X1DA 2R85A 3I4NJ 4A93J 1TT5B 3QOPA 1TP4A 3R0JA 1E3HA 4KN4X 1SYXB 3PW7A 3FF5A 4E4HA 1MW7A 2HYFA 2VIXA 2P81A 3M8JA 4JI8H 1E4EA 2P0AA 2QGUA 3OHBA 2O7OA 5D5VB 3WO1A 4EGYA 3O2PE 5H20A 3ERMA 2X48A 2Q2TA 4S05A 2V1DA 2M45A 2JSPA 2UUCH 4O2BF 5IYCJ 2PN6A 2ZFUA 1ITYA 1FKAH 5L3CA 2COMA 3GIMA 2VE9A 1Y1VJ 1ETOA 1JI8A 5DM7F 2FF4A 4AIDA 1CF7B 4NLGA 1GVJA 3E5QA 5CQGA 3GTGA 5FKOA 1LEBA 1QNTA 3CMYA 2GPWA 3C1DA 2HPIA 3HOUJ 4JYAH 1UG2A 2A6TA 2W6NA 3K0LA 3KHRA 2DTRA 3OV8A 4A3JG 1DQUA 4KT6A 3GZNB 2JWTA 2C35B 4LLGF 3KTMA 4YQWA 5DLGA 1ZK8A 1JTXA 4G7OF 3PNVA 3QODA 4P55A 1YLFA 1BA5A 2FBKA 2BBYA 1QHGA 5KFQA 4A3DG 2XDVA 2I8DA 2VA2A 2L7KA 5M3MJ 1U3EM 1Y1VA 3LMLA 2WY7Q 3GZ5A 4DR1H 1J5EH 4MNUA 3GBGA 1LQ1A 1HKQA 2V26A 3TP3A 2XSDC 4Y3OA 3M3YJ 2FPGB 3KYLA 1D1CA 2VKDA 2Y9YA 1KZHA 2R7WA 3OYNA 4H0EA 1U8BA 1QPIA 1E0EA 4XYMB 4JX5A 2JA5J 2EPFA 2UV1A 4YJ2F 4G6TB 1J09A 4LH6A 2O3FA 1YITI 3S15J 5HLGA 2HVQA 2KSWA 5KG0A 3BLYA 4RGRA 2IGNA 2XVCA 3HHGA 1S5LC 4EEQA 3OSPA 2WTFA 2XGQA 1W0UA 2R7XA 4UV9A 2UWMA 5EWGA 2YW2A 2R3SA 3CP8A 1G6NA 2QWWA 3WG7H 1R5GA 4UUTA 4AYBN 3IAM2 1YS7A 3G6YA 1U0JA 3AAFA 4FBUA 4U88A 4EM2A 4ED2A 5KX5F 4ASNA 4PZJA 4CYDA 2MH9A 3DU5A 2Y69H 2PFBA 4PDBA 5E1ZB 5LGTA 4MEXF 3GV8B 2PN1A 5EWFA 2FUG2 4OAZA 2QM3A 1FYLA 3DPLC 2JVHA 2FLNA 2KIMA 1S03G 5C8YF 4OX9H 1RC9A 3H9JA 2P6SA 5JVTA 1ZN2A 5KFTA 1TT0A 2IGOA 2NS7A 3QPHA 4L5JA 2IS1A 2GM4A 4F4ZA 3PQJA 2CFOA 4CH7A 4XLPF 2H94A 2RVCA 3S1RJ 2IS4A 5DS9A 4UUVA 1XDSA 4BY1J 2VUMA 1SAUA 2BEOA 1Y14B 2I8CA 2EZLA 4O3RA 3E5UA 5C3EJ 4UVCA 4YBZB 4II3A 3I71A 4GO1A 5LMUH 5E8GA 3WTVC 1M0TA 1SFKA 5D5WB 1CQTA 3PUBA 4MFDA 4GRIA 3SQNA 2WADA 3ABMH 1G3WA 2H09A 2PMZN 3MJFA 1XX5A 2LOOA 1NHAA 3DPUA 4HPQA 4L5IA 1RJQA 1XMOH 4HV5A 4NBQA 2XB5A 3DF8A 5IP7J 2LKXA 2R93J 2OTJI 3OUUA 3CDHA 5JUMA 2JA8J 4QW9A 3GTKA 3FXQA 3OY9A 1B04A 4M6YA 3ZMDA 1JHFA 1XB4A 1N75A 4PJNA 3ROUA 1NK2P 1JE8A 2LF7A 2C00A 1ETXA 4UNOA 2R8JA 2O03A 4EGJA 4E7LA 2JA6A 2DA1A 2OA4A 4FETA 3ZN0A 2KRHA 1VQNI 2SCUB 4G7ZF 4BE2A 2DPDA 4ZZLA 1ZHFA 4KNYA 4KMFA 3RSNA 1QGPA 2NVYJ 2GXBA 1RRJA 4HW0A 2MC3A 1G3TA 2A5WA 3MEXA 3LSTA 5DUIA 5F08A 3WGIA 2EFWA 1HKTA 5JVGF 2R5YB 3G73A 3WTTC 3OYKA 2R7DA 2EFQA 2OQGA 1LUJB 1W36D 1ZR2A 1BJTA 1XD7A 5JVDF 1FBSA 5J40A 3FM3A 3JREA 4EJTA 2JA6J 2K9NA 3G6VA 3CMAI 3R5HA 2KFDA 3TDZC 5CYVA 3GXOA 4E6KG 1IJWC 1LEAA 3E6DA 2ZMEC 1U6GA 2IVMA 2LBFB 1HQCA 3UR3C 3KP7A 1W7PB 4I0AA 3IKTA 1WI9A 2LP0A 2F5FA 2NNNA 3ZMSA 3FKJA 5DD8A 1Z2PX 3C3WA 3GVAA 2W00A 4IQ4A 2UXDH 3IWZA 1JDBB 4U0VA 2JTVA 4MLOA 2VJ5A 2ID6A 1GO3E 3MFHA 2Q2UA 2I80A 3TBIA 5CVIA 3ZR8X 5LHIA 3SHFA 2Z2SB 3BG5A 3VPDA 2V4JC 4JV0A 2JEFA 5JHUA 1XC5A 1B4AA 3GTPJ 3PQKA 1I39A 5LL6b 3BJ6A 5CLSA 4N0BA 1L0OC 3X2QH 3WTXC 2DFHA 4YR0A 2VR1A 2ZXJA 4JI6H 2VQCA 4J9RA 1BR4A 2KQRA 1UAAA 3Q3SA 4XK4A 1DGSA 2LMDA 3ZP5A 1N48A 2RQPA 4EEYA 5TJJA 2WAQE 1I6UA 3F8FA 4OINF 2Z5UA 2V4RA 5KHDA 4HDVA 1TWCA 5J2TF 5ICEA 2R93G 3GW2A 2KJCA 1JLLB 4XYLB 2RV8A 2VE8A 3P9CA 4KIGA 1YX5A 3H9GA 2DWCA 2UUBH 3ETHA 2XGCA 3U1KA 3BABA 5LA6F 4B3AA 4EYIB 1IXCA 3N41B 2CQXA 4APMA 2NU8B 5EGOB 2K40A 4JYKA 3H5RA 4UCVA 5C44J 4PSXA 4M6VA 5KFBA 2ZNZA 4E7SA 2VA3A 3OMYA 4A3BG 4D1QA 2K9LA 3I55I 3KYDB 3FKIA 4AWXB 5F0FA 3S3OA 4HF0A 3RTRA 2W84A 1AU7A 1GXQA 4RA2A 3K1NA 4RAFA 5DCMB 2M30A 4EM1A 2MH2A 1ETVA 2VUMJ 3IC7A 3ORRA 3RDIA 3OUZA 2R7TA 2BY3A 2DA4A 1LE8B 3I58A 1BI0A 2DMTA 2JUGA 2M5WA 1JXSA 2RDJA 4LMYA 5L3FA 4MV8A 4A3FG 2E35A 2K02A 5L3GA 1UELB 2XB0X 3LSKA 4LK1F 4GFBA 3MD2A 2WYOA 4KN7X 2V6EA 1JHHA 2H6CA 1JT6A 4DGWB 3TKYA 1D3YA 5LEKA 3IL2A 2UVVA 3FIWA 4Q47A 2DZDA 3EPIA 3TP0A 3GEZA 4XKVA 2C2RA 3H0GJ 4XL9A 3G8CA 5KFCA 3HOWG 4EYHB 3RJ0A 1T33A 4DQ2A 2KMUA 1XG1A 2PJRB 3N8DA 4YIIA 5LGUA 3BQ0A 3N97A 1A6QA 2VQLA 2NU6B 4DR6H 3AKZA 3KHLA 2OCCH 3QPSA 4TV7A 4YG2F 1SD7A 2O61A 5BS6A 5L3EA 4BE1A 2JMWA 4M73A 1V55H 4QW8A 1E2XA 1OPCA 3QU3A 2XGXA 4HLXA 4BU2A 4CC6A 4C3JJ 4J9LA 3C2GA 2JRTA 3OYIA 4LK0F 4IQJA 4DV0H 1T39A 4ZDLA 2BVMA 2LDUA 5D6FA 2VQFH 3VSKA 1EF4A 4I01A 2ALZA 1GYFA 1DPUA 3EDPA 4C3IJ 3HG9A 5T14A 4A3KJ 1TQIA 1LKXA 3OOPA 5E3LA 4DZPA 1ZQ7A 2LY9A 4S0HB 3PR4A 2HOTA 1Z3XA 1WJBA 4UCTA 1TQMA 1NH3A 1Y1VG 4ECQA 2NVXA 5L1IA 3HOTA 2NRAC 3FWEA 1MJBA 4QWCA 3RCOA 5ILUA 2K4JA 4HF1A 2ISYA 4BBRG 2CO5A 2HR3A 1VQ6I 2HXOA 2R84A 4YR2A 2CKZB 5HLHA 2WC2A 5EEAA 3V7CA 1T36A 4HX4A 2X1CA 1KU9A 4AC0A 1WJDA 1MSEC 3HKZE 3EYIA 2QKMB 1E17A 3KAKA 2P0WA 5LP6F 1N33H 4I02A 2R5ZA 1RJPA 1OR7A 1MBHA 1SFEA 4HX8A 3V4ZA 2WA0A 3H9QA 1LDJA 4IEJA 3R61A 5HODA 1D5VA 4YAKB 4JI0H 1UHMA 1SVOA 5EG0B 3BJOA 4AQYH 5KFEA 4DR7H 5TGTA 3NWTA 1WVRA 1KA8A 4KISA 4G12A 3Q1KA 2R87A 4RAZA 5FKNA 2BQRA 3OYFA 3GZ6A 1KQ8A 1ZGJA 5KFHA 3E6CC 3NEUA 3RYPA 2R92G 1F9NA 2WBMA 5JLWA 1R4NB 3MZ8A 3RQ4A 3UFXB 2R7OA 3D5LA 4A6DA 2QBYA 4Y4RA 3F72A 1W96A 3H0GA 1SFOA 1QZEA 2FSWA 3K5HA 3J80K 4IPAA 2ATLA 2A69F 2XAHA 3ABTA 3EUKL 1K6YA 3FMSA 3QWLA 3LNQA 1RPWA 3LSMA 5KT6A 4MO7A 2BHYA 3RAQA 3BPVA 2HVSA 3VB2A 5KG2A 2ZXHA 1BN5A 5AONA 4Y13A 3ML6A 2M87A 1DP3A 4ECWA 1PP8F 2LY2A 4BWSC 2EZHA 1TWAJ 3GIQA 1J7KA 1R7JA 2ZDGA 2F4IA 1F5TA 2DOAA 3CJQB 2EA4A 3FKIJ 1F1ZA 1JTYA 2YRXA 4BDYA 3BPXA 1BR1A 3KFWX 4FS2A 2O5RA 3GYHX 3L7WA 1BR2A 2KP6A 2L7ZA 1D1BA 1U5TA 3GX4X 4YB8B 2J6SA 1IXSB 3VYRB 3GFLA 4S04A 2X6XA 5E3MA 1ZH5A 1WKMA 2J5PA 2E2JJ 4C5CA 1WGXA 2MD5A 2MLGA 2R7KA 3BCBA 1OWTA 3BOQA 5GADJ 2Z33A 2QYOA 2EV5A 2HDWA 5IYBJ 3RYRA 2ZSHB 4A0XA 3BWGA 3QFFA 2STTA 2HHHH 3HC7A 1T0FC 4WF2A 5FFXA 5J47A 3L4JA 2OUMA 4JX4A 1TBXA 4D9JA 1K83J 4G8XA 2W4SA 3GTJA 2OQRA 3QAHA 1K7AA 4O3PA 4A3IJ 3H40A 2YZNA 3JCUC 2B7EA 2A6EF 2KIQA 5K5OA 5IT9K 2AHQA 5KCMA 3OYLA 3PW0A 4FQGA 1SD6A 1UZCA 4RZQA 2ME0A 4M7EA 1K83A 4EMSA 4C2TA 2A61A 4CGZA 3LOCA 5IOZA 3GTJJ 1XMKA 2R92A 1I1SA 1FLIA 3U9TA 2BW3A 1RI7A 3L00A 3ZQ7A 3RQIA 2L02A 3JRCA 2AGOA 4M3EA 1HF0A 1SFXA 2K7LA 3IRRA 2JZYA 4BUPA 4J01A 1DV2A 1YW7A 3KAJA 5FGMA 1I5ZA 3L4KA 2H8RA 1PJRA 2L01A 1Y0UA 4JI1H 3ZOBA 1KQ0A 5GPCA 3HOYJ 3NAUA 4LF8H 3VPBA 5M5XJ 4XRFA 5D4RA 4ZI7F 4GKJH 4X65H 5LEJA 3TQTA 1HW2A 2WY8Q 2L5QA 1W4MA 3MZYA 4D0PA 4LG0A 3Q8SB 4WWCA 1MBGA 2M7AA 2IA1A 3KEYA 5J8CA 1W7PA 2JA8G 1IAWA 4HV6A 3QZ7A 2KZGA 1IN4A 2HQNA 1Z9CA 4B43A 1FJGH 1RUOA 3HRUA 1JKQC 3W6KB 1WHUA 3J81K 3CCMI 3S8PA 4DBQA 4DV6H 3T8RA 2PMUA 1MIJA 4AYBE 4MTEA 3PSFA 5GP9A 3KCCA 4YFNF 5J1RA 3H4BA 3GFJA 4ECYA 2VKVA 4X64H 1W0TA 4L1KA 4GXOA 3OS2A 1O3RA 1GSHA 2CQKA 2LNBA 2Y2ZA 2ZCWA 2XRNA 4PCQA 2XD4A 5EG0A 1ZRDA 2D2WA 1BXRA 2OU2A 1ZETA 1QRYA 2L2OA 1QVTA 1K61A 2R5ZB 3BR3A 2VT2A 4QPQA 4I99C 1YS6A 4ITVA 5E79C 1V51A 4GC6A 1IRZA 3JRBA 4HRIA 4G6QA 2BVLA 3BTJA 3L2RA 4RS8A 3ZPLA 5D6EA 4ENNA 5K1YA 3DV8A 1RYSA 1EKEA 2JEJA 2A68F 2W70A 3DU6A 3RBDA 2D45A 1C30A 4O3SA 2X51A 4GGGA 4OIRF 1JT0A 1IBLH 5L1JA 1ZQ3P 3FXLA 4UUSB 1VQ4I 2P7CB 4XR6A 1J59A 2IXSA 3AL0C 5EOYA 3ECHA 1PK8A 1SMYF 3QYBA 4W97A 4QSHA 1CGPA 3SI8A 1MMAA 3KALA 2WE6A 3C7JA 4HAMA 1MJAA 4F3QA 2FB9A 1MBKA 3OYGA 4IKFA 1FOWA 3RPUA 5DTDA 4I0BA 3RAXA 4A3MJ 4BDZA 3L2CA 4BBSJ 2FOKA 1E3OC 3M4IA 3MR6A 4M3FA 5B5EC 5KFAA 2W25A 2HVRA 5EF6A 1KEEA 1AHDP 4IHWA 5KFIA 4B3XA 1XDUA 1LVAA 5LHHA 4Y52J 4RB0A 2C2DA 1XSXA 2WAFA 2D1VA 1EHIA 5EWEA 2YU9A 3JRGA 1EZ1A 5EDNA 2DPJA 1S9HA 4IVNA 2RGRA 4JI7H 2BYVE 3DEUA 3G2BA 3PO2J 1Y1WJ 3I12A 5FLXW 4DW6A 5IT3A 4J0MA 1POGA 3PM1A 1ZELA 4GYIA 2V79A 2XRLA 4AUXA 2VPSA 4TQRA 4J9SA 1U2WA 3N4MA 1B33N 4BXXJ 5KT2A 3I64A 4HSRA 2GLTA 2CW7A 3M7GA 5HLIA 5BPIA 1GSAA 3DFGA 5HV6A 4JX6A 4Q0YA 4HZFA 2WDTA 1TQPA 4HF2A 1JXLA 2YS7A 1IRXA 4I2OA 3FHNA 2YL2A 3H4DA 1R4MB 3OSGA 3GIJA 5FKLA 4FX4A 2QQ9A 5KAFC 3GIKA 2CUEA 3V7RA 1X3ZB 5DDGA 5KT3A 1S29A 3E6BA 3HHHA 2CRGA 3DTIA 5LLQA 4B44A 5C4JJ 5KG7A 2CJJA 1N56A 2P8TA 1RZ4A 2W8KA 1TW2A 1Y8QB 4KUMA 2ICWG 1W93A 1WH2A 2W6ZA 1I50A 1X3UA 5IYDG 4XBFA 2V58A 2J6TA 1LDDA 4EJOA 3M1EA 2PX9A 4HBLA 1NK3P 4IHSA 3EPGA 3S1QJ 2HZDA 2XCLA 1KYZA 3OR1C 4Q45A 1CS0A 2FMAA 1FOYA 4RAYA 4M9XA 4ECXA 4O3NA 5KFUA 4RLQA 4W1UA 1K78A 1VQOI 4JI5H 4BBRJ 4OIQF 1UC8A 3LWBA 3KX2A 2AS5F 5ICFA 3T5JA 3A01B 2DW4A 1Z6TA 4IHTA 3MWMA 5L1LA 2L54A 2ZNYA 1Z1DA 4YELA 4B1RA 1R5ID 3LSHA 1HBXG 1OLTA 1BC8C 2Y0SE 3CC4I 4AVZA 2PG4A 2P7VB 4IRCA 1RETA 4NC7A 4XLEA 2PBZA 5HS8A 3K2ZA 3GO5A 1JKPC 2AQFA 2E36A 4V2FA 3BR5A 1F43A 4MAMA 3VPCA 4HNVA 3ESWB 3TO6A 1JKOC 5F0CA 2DMPA 4CCNA 3OYJA 5BPDA 2M0CA 2GXAA 1IZ1A 2EFNA 5LMNH 3PO3G 3CUQA 2ZMEA 1WJ5A 3I54A 4ESFA 2GAUA 3PUFA 1JJ8C 4ZYEA 1XTAA 4CDGA 4XLHA 2R8HA 1ZGWA 1I7LA 3OYMA 5DCMA 2ZDHA 4EGZA 1FNNA 4OOIA 4JOMA 4U7DA 1IOWA 4A3CG 1S7AA 1PP7U 3HDDA 1LFBA 3W2VA 3KE2A 2RREA 5J1UA 3GFIA 3H5AA 3HL2A 1VTNC 3UNGC 2A07F 1FTZA 1BW6A 3K6GA 4MQVA 1ZHQA 3J7AO 1V4YA 1R23A 1IC8A 2HYJA 1GHCA 1MGTA 1LJ9A 4A2AA 3A4CA 3JRXA 1QPMA 1G3SA 4DUYH 2XKOA 4A93G 2E1OA 3IAS2 3WTYC 4ESJA 2QZ8A 3M9NB 4MV1A 1Y0NA 1RESA 3LA3A 4LLLA 1ENHA 5BOXA 3HSFA 1FP1D 2V9PA 4N9IA 4Q4ZF 3DKXA 2C2EA 1JJ6C 4XOTA 1M0WA 3VEPA 2VLAA 4M71A 4ECZA 3CUOA 5DQGA 2CW8A 4ZDPA 4XN0A 4ENMA 3GILA 5EJCA 3ZXSA 5HS7A 2DYRH 1UFMA 5F1JA 4OMYA 3TW7A 4UCSA 5GAEJ 3TO9A 2K3PA 1T2KA 3BAAA 3RIZA 1VNDA 3H5NA 1BIAA 2H27A 3L9FA 3BQYA 3TL4X 1U8RA 2G7UA 3CDLA 4D5FA 5L9XA 1GVDA 3D0SA 1XGMA 1MKMA 2X1EA 3ZGKA 4BL0B 4BS9A 5HLTA 5HDNA 3FHZA 2UU9H 1FT9A 2PVPA 4CSWA 2RGVA 2ASLA 4XMYA 1UHSA 4JK1X 5J3LA 1G8XA 1D0ZA 2E1MC 2VJ4A 2P4WA 2W85A 3ZN1A 1MDMB 1JUSA 1N32H 4HQEA 3CCSI 2VOOA 2ZXIA 2VQEH 3ISPA 1XNRH 4EG0A 4U7BA 1IUFA 4LD5A 4RMNA 2RAEA 2XPVA 2MSYA 4P9UA 4HOBA 5GONF 3WTWC 4KITB 1W36C 2CUZA 4Q43A 2HOAA 4WXHA 1S0OA 2Y0SN 3G4SI 2QENA 4LIVA 2VBZA 2XCAA 2HGCA 2I5UA 1FMVA 1ZKGA 1JDEA 2DOEA 3HRMA 1T94A 4UV8A 1X2MA 1LVKA 3ECOA 2VT3A 1Z2OX 3RB3A 3ETJA 4RUAA 5L3BA 1JKJB 4HYKA 1WJAA 3EUHA 1DP7P 1E4GT 4EQQA 4OIPF 4DYRA 3PFIA 3K70D 4MEYF 2JEIA 3CCEI 1USSA 4C5BA 3V42A 3OIQA 1S8NA 3Q9VA 4XKBA 1FX7A 5DCFA 4YFXF 3OSFA 1XGSA 4AIJA 4Q44A 1S10A 5H2FC 1RKWA 4E7HA 2IEKA 1HDPA 3R5XA 3MFIA 5ILVA 2NOJB 5JH7F 3ZQFA 4IHXA 2XC9A 5CA1F 3OYHA 1JX4A 4PJJA 3D5RC 1X3WB 4HX7A 2B9SA 1LDKB 3CLOA 3OHAA 4FTHA 1R9TA 2HJWA 4RZRA 3TQ1A 1X58A 4QWAA 4DL4A 3IWFA 1Z21A 2IA2A 2QYZA 1S97A 2FU4A 1MMDA 3AFHA 3G1MA 5JFRA 5A2QK 4ED0A 3W6VA 1N34H 3JRIA 5AIQA 1V5FA 2R5YA 1IUYA 1R6RA 1FOKA 2KZVA 2X0LA 2ZJ2A 1V5EA 4B47A 3K7AJ 3FXRA 4XLCA 2R86A 3DWLE 4GKKH 9ANTA 2K5CA 1NTCA 2DCEA 2L3DA 2ZFWA 1I50J 2LFBA 5K7HA 3RZDJ 4FHTA 1Z3YA 2OCEA 3HSRA 2NVQJ 2HOSA 4ED6A 2OBPA 2V1XA 1IG7A 1FIAA 4LFAH 3HTSB 2ELHA 4O2AF 1BGWA 3OWTA 4O4IF 1HNWH 2VOPA 2PI0A 2DODA 4OIOF 2DA6A 5FLVA 3KP4A 4YAJB 1D0XA 1KC7A 4ED1A 4QIWA 3PL8A 2X6YA 3F21A 1RJRA 5BMVF 5HDKA 4RNNA 2W9CA 1MMNA 3KLOA 2E2IJ 1AUVA 1MSFC 2M05A 3T5LA 2Y75A 3CESA 4DJAA 1XDNA 2DLLA 3RFCA 3W6JB 2DA5A 2X6OA 3IV5A 1CF7A 4DL5A 2JQ7A 2Y30A 1Z05A 3OL3A 1ZREA 2VC1A 2MC4A 4QWBA 1LFPA 3JAMK 5KT4A 3BR0A 2DFFA 2V1UA 1MH3A 1R1TA 4O6JA 5K7FA 3PN1A 1BI1A 4DL7A 3SZPA 4A3EJ 4EBEA 2P6TA 3HIFA 4M3DA 4A0ZA 4CHUA 4CUGA 4XLAA 2FK3A 3JSNA 5BMZA 4ED3A 4NXMH 3AG2H 3N44B 1IXRC 4RNOA 4ECRA 2CQQA 1K1QA 3MKYB 3I53A 4DV5H 2NU7B 4PGGA 5JR3A 3TOAA 3W3CA 4QJFA 3DQVC 2YZMA 3GMEA 2VKHA 4DR3H 4FS1A 4U87A 4RGXA 5C1OA 3EUHC 1WR2A 1B6RA 3WNZA 1TNSA 2Y0SA 4IO9F 1UCRA 1Z7UA 2Y31A 1JGGA 1WSCA 4BQQA 4EV0A 1GXPA 5FLMG 3GWZA 2EB7A 2RQQA 4EFBA 3A02A 1YE9A 1FIPA 4XZ3B 2R6FA 1VQ8I 1ZLKA 4KIBA 1SD5A 3AG4H 1BI3A 3PR5B 3MZHA 5JVLA 4QIWE 3J7YJ 3Q8RB 1Z0XA 3T5HA 4F4XA 5FO5A 1P7JA 2HQRA 4TQSA 3V4GA 3JTHA 2X0SA 5JHFA 3LA7A 1BNCA 3ZCOA 3BG7A 3FXKA 4IRHA 3IG0A 2X9DA 1IBKH 4A3IG 3PVXA 2KPMA 1ZR4A 1QBJA 1OCPA 1ULZA 4NUBA 4ZTJA 3BR2A 1VQ9I 4HG2A 3CC7I 2DDBA 3M07A 2A3SA 4EGQA 3K3VA 3RKQA 4O3MA 3IUOA 1P4AA 2K9SA 4BHPA 1O57A 3HGGA 3WGHA 4I98B 4JUZA 4XQFA 3ZQGA 1B72B 2AQ4A 2OJED 3GQCA 5LXTF 1T95A 2R7UA 5C1PA 2DA2A 3IP4B 2DU9A 4EJWA 3HOWJ 3H0GG 3N43B 1FBQA 3ZQCA 1ZYRF 4YJ3F 2IP2A 1EJ9A 3J7AK 2L4AA 4I09A 2E5NA 2XC7A 1KJQA 2XGEA 4IHVA 1T56A 2F6CA 4P1WA 4HQMA 5CA0F 5E1XA 1ON1A 4PFOA 4YEJA 3J7AY 2W71A 3ONQA 4XLNF 4GLXA 3B6CA 4FE7A 1HA8A 3OS1A 4IR9A 4PK4A 4A3JJ 4RAGA 2KDOA 2YPRA 4C30A 3PSIA 4CCMA 2GIZA 2VODA 4LSAA 1S0NA 3HOUG 5FD5A 2IAIA 1H8AC 3VYSB 3JTGA 4L9TA 2IS2A 2VXZA 2FEZA 5LRSA 1ZG5A 2XPUA 4Q5SF 3R60A 2W6OA 3PW4A 2AGPA 2FPIB 2NVUB 2MCTA 3OIOA 1PYVA 1REPC 3RB4A 3L2VA 2JJ7A 2R7ZG 5DGAA 2LY1A 4K0KH 5KFGA 2CV0A 1OJLA 3CCRI 4ED7A 5IYDJ 2P5VA 1XN7A 1TWGA 1YX3A 1SVMA 2A6HF 1E4FT 4KDPA 3WO0A 2UXXA 4V2GA 4E7ZA 1OISA 2Q2EA 5C44G 3V6KA 3CD6I 1IN7A 3DCFA 1AKHB 3GTLJ 3QP5A 2FMYA 2R7SA 4JI4H 3ZMTA 1D0YA 5FROA 3V8JA 1HC8A 5F64A 4X0GA 3MKWB 2WV0A 4BH9A 4KICA 2YS6A 2DI3A 3F3XA 4A0YA 3T0YA 3WU1B 5FPOA 1HNZH 1GT0C 3DEWA 3CLQA 3FMRA 4BXXG 2GBYA 3BY6A 4BJ5C 4EBCA 2JA5A 2OTLI 3WE2A 3RKYA 1SEUA 3CTAA 1V4RA 2F5DA 4C9YA 4NQWA 1M7JA 2XV4S 1QQIA 3FBIB 3HB9A 5B1BH 3K4LA 1G59A 3OYAA 5M5WJ 2R7FA 2EV0A 3S32A 5J6XA 1R49A 3N40P 2XGDA 2UXNA 3J80W 2LBFA 3GLLA 3E5NA 2W8LA 2NS0A 5DG7A 1EH7A 2CSOA 4KIFA 4P5OA 4ZHQF 2X6WA 2HEOA 2EBIA 2JEGA 3U1DA 2DA3A 4NDLA 3WHCA 4ED8A 2MGQA 5C4XJ 2EFOA 4UVBA 2K9MA 2ESHA 3OS0A 1X1PA 3K4MA 1P4XA 2VL8A 4A3KG 4FBTA 5D1OB 3KZYA 4DBRA 1BW5A 4A3MG 4LF7H 3KEQA 4BBSG 2QBYB 2MG4A 1P2FA 2CYYA 1USTA 1BM9A 3HOSA 3BA8A 1BJAA 2R7QA 3S1MJ 1VQ7I 2QCOA 3WU2C 3G6EI 2DMQA 1ONVA 1CQJB 3BDDA 5KFSA 1ZTRA 1X1BA 2JA6G 3WTUC 4ZYGA 3BJAA 2EIJH 1VS0A 2ASDA 5KAIC 2M0MA 2DMUA 1CE8A 2V9KA 4EFEA 2RKHA 4B3MH 1QHHD 3HKZA 1JUPA 2ASJA 1PUFB 4G94A 3O6BB 4M9SA 4X62H 4HA8A 3P9IA 4JI2H 2LYCA 3JRAA 1TA8A 3A03A 4FX0A 3TGNA 1XSDA 4IWXA 3JAMW 3FBNB 4PUSA 3S2HJ 4DV1H 2FNPA 4B3SH 3VYTB 3J7ZI 5KFJA 3GTMA 1MMGA 1VQKI 4ESBA 3NRVA 1K4TA 2ELKA 3KETA 3CP2A 2EIMH 1B9MA 2ME6A 4ZYDA 1D8KA 4A3GG 4OU0A 3E7LA 1IO2A 1IN6A 2IMWP 2Z1DA 1B72A 3R0AA 1UMQA 3BG9A 2LD5A 3RI4A 4ZTFA 1FTTA 3P5JA 4M9ZA 1H9TA 2PJRA 5D8LB 4BXUA 2LSOA 2C22A 1FYKA 4BHCA 2W7PA 2JRMA 4MFEA 4RB1A 2E5LH 4UB6C 5IP7G 3FXJA 4Z6YA 2F5VA 4PJLA 1O3SA 1XNQH 2CWEA 3U9GA 3HOZJ 3MR3A 1I94H 3L2WA 5GAHJ 4CICA 2W6MA 4A3EG 5CAEB 2R7MA 2FBHA 2ZJPF 4P96A 4IX7A 1IBMH 2ACJA 2OZ6A 1RYRA 3JW4A 2BW3B 3E97A 2DFEA 2XSJC 3IKVA 1FEXA 3F0CA 3F8BA 4LIUA 2B0LA 1DU0A 1ZGAA 2D5VA 4CYCB 3F22A 4BY1G 2UVWA 2YX7A 1JGSA 4ZQIA 2W1OA 2DT5A 2W9BB 2CFXA 4TV9F 2BQ3A 1WCMJ 3HTUA 3ZMUA 5CB4F 1Z67A 3DEEA 2DPUA 3JZIA 1EV7A 1B6AA 5BPHA 1A0IA 2LRDA 2M8GX 2QUFA 3ORQA 2WAQA 3WHBA 3COAC 1EUDB 1YG2A 4RBOA 4XLFA 3M8EA 1ZLJA 2MW8A 3S3MA 2E2HJ 2Z9OA 2J6UA 3GTLA 4XSZF 3BTIA 4PJMA 2VONA 4WX9A 2CQYA 2FJZA 4L9VA 3RB6A 4TV8F 5LHGA 5E20A 2MD0A 2YR2A 4KJZA 1Y1WG 3QU6A 4GCVA 1DIKA 5D1OA 2V7FA 4ZC3A 1Z77A 1T6SA 5CVVA 3A2KA 2EILH 5KG1A 5BPFA 3BP8A 1KU2A 1P4WA 4MGRA 1S6LA 4A6EA 3GTPA 3J81Z 3E1SA 1BI2A 3M4OJ 1A31A 2RDIA 3A1YA 3C18A 5LBQA 1I6HJ 5FD6A 4M3BA 4PSWA 3FXUA 2DN0A 2ESNA 3WGGA 3SJMA 3K4JA 3CO7C 5C5JA 2HFHA 2YU9J 1SVLA 3LFUA 3E3VA 3KZIC 3S2DJ 5F1RA 4HNUA 1MNMC 2LLKA 3JSLA 1YHQI 3RGZA 2JUCA 2HTSA 2JSCA 4NQWB 2AGQA 4IF4A 2WAQN 4U7CA 1EH6A 5EYRA 2FD5A 2GOXB 3WG9A 3SE7A 4DL2A 1RR8C 1TWAA 1X1DA 2LKSA 3D5SC 4I4TF 4LFCH 2I87A 3GTOA 2F2EA 3TW6A 1PX2A 3ZMVA 3CCJI 1YO5C 4U0YA 2ZBKA 2M4GA 1XSVA 3CQZA 2L9RA 2Q8KA 3S3NA 2DOFA 2ZJRF 2STWA 3TEDA 3HUGB 2KJBA 4BACA 1J2XA 2ID3A 4F52A 3L1PA 3F8CA 2VPRA 4LB6B 2VASA 5FB2A 3QPLA 4C3HJ 2ZB9A 2RDPA 4DV4H 2XAJA 5TISC 2JA2A 1W1WE 4L0ZB 5BQTA 4XKCA 2W6PA 3OYBA 3RF2A 3LQRA 4RLFA 4YY3H 5IP9G 4RU9A 2IGKA 5LD2C 1FYMA 3DBLB 2DJIA 2O8XA 2CQNA 2KISA 2XF5A 2QA4I 3S1NJ 2OLSA 1U5TC 5FLXK 5EEGA 1WCMA 2R92J 5DUKA 1I27A 1KYWA 1N78A 4R8UA 1M6VA 5CJ9A 2JVGA 2YUSA 1S68A 2UVUA 3CO6C 4ABZA 3SYTA 4Q8FA 3K2AA 2AU0A 5IWAH 2BGCA 2K85A 5LFAA 2QSFX 4G9YA 1R5HA 4OWRB 3R5FA 3T1YH 3L2PA 3RGXA 3F8MA 4P9FA 4AD9A 5J4VA 2OD5A 2OWOA 2OPTA 1YOVB 2MBFA 4YP3A 1JIHA 1XS9A 4HNTA 3CCUI 1RNLA 2Z16A 3IHUA 1H88C 2L9NA 1GLVA 2RN7A 4IOAF 4BAYA 2QK4A 5HNFA 4DR4H 4ECTA 2W57A 3U21A 2K3FA 1MNDA 4HLYA 1MNEA 1I3AA 2GQQA 1GLNA 2L7FP 3NWSA 2XASA 4ZYHA 1A5JA 1W5SA 3HJEA 4DV3H 3MVPA 1IF1A 2G0EA 3CJTB 1YJWI 4KA4A 3AL0B 3N42B 4IRIA 3P7NA 4DL3A 3VODA 5CKTA 5ED4A 4MA5A 4EJVA 3I3LA 1Y39A 1R1UA 4IL6C 3JRFA 1HXDA 1C0WA 4L0YB 1SMTA 3W2AA 1FPQA 3U2RA 2VKEA 4IOCF 1KU3A 3I5UA 4C5AA 3FMAA 4OAYA 3K70C 5H6RA 2PMHA 3Q8PB 1K4SA 4E4TA 1WJEA 3S93A 5KNLA 3DXJF 3DBHB 4BYYA 2E34A 2CH0A 3OSNA 2LC2A 3FDYA 1ERDA 5EEHA 2HWVA 4LSXA 4WK8F 3I59B 3T5XA 3WODF 3RV3A 3MMYB 1OCRH 3KLNA 3JRDA 2YU3A 4LLNA 4F4WA 4DYCA 4Y7NJ 1TWFJ 3EETA 3H35A 1X19A 3G3ZA 3GV5B 2PMZE 2JT1A 1ZRFA 3LWFA 1B8IB 3RBEA 4B3RH 5B66C 3ASOH 2KL4A 5CPRB 2E2HA 1IN5A 2N8GA 2QEXI 1VZ0A 1U5TB 5BR8H 2E7WA 3CJNA 4HSTA 2M3AA 2VOBA 4IHYA 3A01A 4AIHA 4J9KA 1DU6A 4DNCA 1HOMA 1WJFA 2FXAA 3KP2A 4L5EA 2COBA 3CF5F 1AA7A 1A36A 1ZRCA 4LF9H 3O8GA 2P5LC 2KT0A 2VI6A 4PGHA 5EZGA 4FISA 2DQLA 1G4DA 2IRFG 3TINA 4XNFA 1O4XA 4BJTA 1FY7A 2XUBA 3ABLH 4X6AJ 4BQAA 2WAEA 4ZYAA 1Z6RA 2QF7A 1OFCX 5K5QA 5C4XG 2NYXA 3GUDA 5AIPA 3OYEA 6PAXA 4ME6A 2ZMEB 3RUPA 1TWHA 2Y0MA 2EK5A 1FVIA 4XORA 3HRSA 4M72A 2O8KA 1YRNB 2KRFA 2XGPA 3FKIG 3HOVG 4F50A 3QQAA 2ZC2A 2W9AA 4M6XA 5J2UF 2GOMA 2XHKA 3MKZA 2EZKA 3SZGA 4DYQA 1I1GA 2PLYA 1GGOA 4RGUA 1IV6A 3BG6A 1S7OA 2B63A 1MBEA 2K9QA 3VPRA 1STZA 4CO8A 2XAGA 2LREA 5D5XB 1TL8A 1VBGA 2H6BA 3F6VA 1YJ9I 4A3BJ 3R6SA 2EH3A 2RNJA 5IYCG 3BQ1A 3L2UA 1S0MA 2LG4A 1BJZA 4ANJA 2YCHA 3SDGA 4BGDA 1O3QA 5DQIA 1OR7C 2MA3A 5M3FJ 2JPCA 4YRVA 2R7ZA 1T0FA 5E17F 1HLVA 3DP7A 1DPRA 4ZH4F 4ECUA 1YYVA 3VYUB 1JUMA 2CG4A 3QYEA 2V1NA 3OYDA 3I4NG 1S7EA 3CJRB 3FXMA 2HKOA 1MBFA 4K2EA 3H36A 1CQIB 4JQFA 3PJRA 1FWZA 2FJ1A 4LOCA 4R7RA 2EINH 2DBBA 1SEIA 4Q8EA 4MTDA 2R7ZJ 4KMUX 1S9FA 4ETSA 4Z2YA 3CMEI 4B09A 1WRJA 1GSOA 3PNYA 3JSPA 4IZZA 4R8UB 2J9GA 2R7NA 1XMAA 2V9VA 4D7MA 1DV1A 1ZG1A 5KFFA 3MQ0A 4XOPA 1R36A 3OOUA 5H80A 2E7XA 5IYZF 3PO2G 2ETHA 4DV2H 5GPAA 1ETYA 4DOZA 2CZGA 2NOGA 2VXDA 5HVQC 5B1AH 4J9MA 4LJZF 1EA3A 4FASD 1YQAA 3HGYA 2C6YA 4LFUA 5FJ8J 4EATA 4RNMA 3G1OA 5DV5A 3N6XA 2FE3A 1MBJA 3KP6A 1R71A 1YW9A 2O6GE 4G7HF 5KFZA 5D5UB 5KFDA 4JBAA 3EQLF 3MWDA 2LH9A 4B4CA 4C2UA 1ORKA 2EIKH 1VI0A 2ZO4A 3FISA 4BJ6C 1VFCA 4FT8A 2QSGX 2WV1A 4XRSA 3V4SA 3N05A 2IPQX 3FXOA 2WTEA 2HDCA 2AQEA 1TTYA 3RZOJ 3F6OA 2HNHA 3HOXJ 1I7NA 4R1HA 4NXNH 3S17J 5ICGA 4A5NA 5L3DA 2NXNB 3HPHA 5B3SH 1IRFA 2VQHA 1ETKA 3LMMA 5H6QA 2IT0A 1C3OA 2DA7A 4UCRA 1AUXA 4PJ0C 3SXYA 1Z7LA 4Y8VB 5KG4A 2BHZA 2NUAB 1V5GA 2NAZA 1SFOJ 5F04A 4WD3A 3M9AA 3VMMA 2UXBH 3RPUD 1IOVA 4E70A 1NG7A 2O9LA 2NS8A 3Q2OA 4UVAA 5E3OA 1Y56A 2BXYA 2X85A 2DAOA 2KDZA 1HW1A 2W7NA 4ZDOA 1YTYA 2H8WA 1GV2A 5CVRA 4RM2A 2CUFA 2E19A 5GTHC 1FZPB 4CA0A 1KJJA 2BY2A 2M4KA 1TWGJ 2LVSA 1HCRA 3VOEA 4LG3A 2LK2A 4IXAA 1P9QC 5FLMJ 3V8LA 1TC3C 3G6XA 5DG8A 5L1KA 5FFZA 4CCLA 1IW7F 2E1CA 4F93B 5FRNA 2DK8A 2HKXA 5IT9W 4A5MA 3RTXA 3K4CA 4IR1A 5LOVF 4O4LF 4YIRX 1DUXC 1R1VA 4RDUA 1OQYA 3DLAA 2M2EA 2IBDA 2UXCH 3HBLA 4AM3A 4A12A 2UUAH 5K2MA 2UUZA 3M9OB 4L18B 2F48A 3LAJA 3K3PA 3RV4A 3GLXA 4DR5H 1L3LA 4LF6H 1B9NA 3LFKA 2YRWA 3B02A 5LYJF 3I59A 5K5RA 2QSHX 5DM6F 1A6IA 2L4MA 2F4MB 4ECSA 3OIPA 4A69C 2PEXA 3BQ2A 1J0RA 3MN2A 2DPIA 2HQAA 2VQGA 4F55A 1S72I 1X2NA 2F4OB 5D4SA 3GIPA 2FA5A 1W5TA 4RUCA 4WXCA 1P8LA 1VQ5I 4IAJA 2K4BA 2Z99A 4ENKA 2RC4A 2CV1A 5KFYA 3JR9A 1FSEA 3QP6A 2KHMA 3M1CA 4CCJA 1O3TA 3M9MB 1X9NA 2G9WA 1DGWY 2F5CA 3BT9A 3K69A 3HOZG 2HXIA 5DD4A 2XPWA 4O3OA 2W9CB 2XF6A 1X4PA 2AXTC 2XAQA 4M3GA 3GV7B 4HEA2 2G7HA 4BKXA 3CZ6A 2GA2A 5IT9Z 2DO7A 2XIGA 2L9VA 3FM5A 3H3UA 4UUSA 3CUQB 2FMLA 4UFZA 2ZKZA 4J9PA 3L2QA 2M8EA 1XCBA 1A35A 4LFBH 2DYSH 4B8XA 2WB1A 4DIQA 1HR0H 4HQ6A 5DYMA 3VDXA 3U9SA 2KRCA 2BY0A 2QQBA 2W82A 2YZGA 1UHWA 3HUGA 3GTKJ 5CVJA 1ZHSA 4KHPH 3TIGA 3OR2C 3A0BC 4GYGA 3DKWA 1V9PA 3K10A 1W5CC 4F4YA 1ON2A 2L9SA 3KEOA 1Y1WA 2CMPA 2FK1A 4KYWA 2X4HA 4UCOA 4QWQA 4J9OA 2ZDQA 1D1AA 3MAJA 5CQEA 3F23A 2R7LA 3E0JB 5CVUA 1YW8A 5FKKA 3IRQA 1D5YA 1Z2NX 1BBYA 1KONA 4LITA 2W7OA 1B59A 1OCCH 3R4KA 4CCOA 5JI6A 2FP4B 1VQPI 3HYIA 5HOOA 4A3DJ 2R7VA 3GLKA 5FKMA 1HW5A 1WSUA 2WB1N 1K6OA 2IA0A 5BNGA 3NQOA 2CU7A 1Z91A 2QVOA 4XN3A 3LAPA 2TCTA 3B6AA 2NVXJ 1EYZA 4MQ9F 5HS9A 1OCTC 3PFYA 1M1EB 3JRHA 3SEQA
chains in the Genus database with same CATH topology
3M8FA 4HDUA 3J80Z 4MV9A 1RUNA 3TOBA 1R58A 1HKSA 2FQ3A 5HDGA 2ZJTA 1ZAOA 4UHTA 1UB9A 1TAEA 2K27A 5DEQA 2Y48A 4AIKA 4MV7A 4B3TH 1R22A 1HSTA 1TW3A 2ADUA 2HZTA 1KGSA 4KFCA 2IW5A 1QZYA 3K1MA 3SFZA 2MLKA 3UQ8A 3ABUA 4JI3H 3BZ6A 2EV6A 4LB5A 3WU0A 2K86A 1IRGA 2PBIA 4F7ZA 1SFUA 1YFHA 2ZM6H 5A2QW 1OYWA 2F5EA 3H20A 4IRGA 4YIFA 1W7PD 1OKRA 5KVRA 1J9IA 1L2ZA 3S2WA 4UCUA 4A2BA 4DUZH 2HGSA 4FM9A 2JPBA 5ERIA 2KIUA 3Q9SA 3SZTA 4YHHH 3O3KA 2KKOA 3B73A 5ICCA 1XCVA 1FBUA 4CZZA 2BV6A 1H0MA 2GXGA 1FSHA 1EH8A 1SAXA 3KZZA 1J5YA 3K9TA 3HRTA 4JV5H 3F8NA 4CXFA 3VFZA 3BA9A 5D8KB 4R79A 3L09A 3DPTA 4QLCU 2FRHA 2GA1A 4LF4H 3DF7A 3HXLA 1XMQH 5F6FA 1P92A 1O75A 2VUGA 3I0TA 1LNWA 1B1BA 5E8IA 2NNYA 2DFIA 3KP5A 5FPRA 2XAFA 2QLZA 3E6MA 3KXYT 1QZZA 5LRRA 4LGWA 1LB2A 2OZUA 1FP2A 5E1WA 3KP3A 2WWYA 4RB3C 2BE5F 1WWXA 1HNXH 3TQNA 2AXLA 3C0FB 3RPQA 4EM0B 3MCZA 3GFMA 1XGOA 3WTZA 3GF2A 1Q1HA 5A2QZ 2PJPA 3QRFF 1OYIA 2ISZA 3WTSC 1TNTA 4WXDA 3EYYA 1PDNC 4HYEA 1OYYA 1MD0A 2F4VH 1AOYA 2HOEA 2VBYA 2VN2A 3OTOH 4BHBA 4X66H 3ELKA 2UZKA 2VC0A 1ODDA 2E1NA 2XKPA 3T8TA 2HTJA 4UXNA 2J5OA 2VBWA 1T38A 5LGNA 1A04A 1ZG3A 1ZARA 3K1PA 4WCGA 5FLXZ 2LKPA 2VBXA 2W24A 1BC7C 4I7HA 4Y15A 5ILSA 4MHGA 3T1BA 1K78B 4CC5A 4BNCA 3ZMZA 2GWRA 3LA2A 3RJPA 1OMIA 1DDNA 2Z3YA 1ULYA 2O0YA 1QO0D 5J8FA 3RKXA 3MFKA 1S3JA 3FMQA 5KK1A 2LF8A 1YIOA 2CW0F 4PDKA 1KQ9A 4EJUA 1F4KA 4KT5C 3WE3A 4DR2H 3V8KA 3H3ZA 1TLHB 1K79A 4LF5H 4IJAA 3QPTA 2GIVA 4ENJA 1J75A 3I4PA 3ERED 3J81W 1D8JA 5D1PA 4EVIA 1V3FA 3FZVA 3REOA 4U0WA 4M74A 2EWNA 3JAMZ 4Q48A 4AVPA 1IN8A 3JSOA 2OAZA 2DK5A 3P9KA 1I6XA 1BIBA 1XGNA 3E5XA 1MDMA 4RGSA 4ZZDA 1KU7A 5E18F 3CVZA 3ULQB 2FNAA 4LG0B 2A5YB 1AWCA 4NB5A 2DQRA 3BROA 1FC3A 4DV7H 1P6RA 2TDXA 4YFKF 1AN7A 1SD4A 1MZBA 2IJLA 4NHJA 1WQ2A 4XSXF 3RKWA 2QQAA 1N36H 1O7FA 2D1HA 1U78A 4N9HA 4O5VA 2HYGD 2PQ8A 4LH7A 1HSJA 3CUQC 2M1BA 4L9NA 3RIRA 2KIFA 4RB2C 2EFPA 2FBIA 2EA2A 3TDUC 2HS5A 3Q5FA 4G6DA 2V6CA 2YSRA 4ON0A 2CGPA 5TRDA 4L9JA 2XROA 3HSEA 4A2UA 1G3YA 1T98A 3V7SA 3H92A 1O7LA 1PUEE 1H9GA 4R8HA 4OMZA 3LQQA 2YX4A 1RIOH 1MJ9A 3TO7A 3T1HH 2Q0OA 2EJRA 2GZWA 3FX3A 4Y17A 1BOAA 2P5KA 1R00A 3QOPA 3R0JA 4KN4X 1SYXB 3FF5A 2HYFA 4JI8H 5D5VB 4EGYA 3O2PE 5H20A 2Q2TA 4S05A 2V1DA 2M45A 2UUCH 2PN6A 1FKAH 5L3CA 2COMA 2VE9A 2FF4A 1CF7B 1GVJA 3E5QA 1LEBA 1QNTA 3C1DA 4JYAH 3K0LA 2DTRA 3OV8A 4LLGF 4G7OF 4P55A 1YLFA 2FBKA 2BBYA 1U3EM 3LMLA 4DR1H 3GZ5A 1J5EH 4MNUA 1LQ1A 1HKQA 4H0EA 4LH6A 2O3FA 5HLGA 2HVQA 2KSWA 4RGRA 2XVCA 3HHGA 4EEQA 4UV9A 2UWMA 2R3SA 1G6NA 2QWWA 1R5GA 1YS7A 3AAFA 4U88A 4EM2A 4ASNA 4PZJA 4CYDA 2MH9A 2PFBA 4PDBA 5E1ZB 5LGTA 4MEXF 2QM3A 1FYLA 3DPLC 2KIMA 1S03G 4OX9H 2P6SA 5JVTA 1ZN2A 3QPHA 4L5JA 3PQJA 4XLPF 2H94A 2RVCA 4UUVA 1XDSA 2BEOA 3E5UA 4UVCA 3I71A 4GO1A 5LMUH 5E8GA 3WTVC 1M0TA 5D5WB 3SQNA 1G3WA 2H09A 1NHAA 4L5IA 1XMOH 4HV5A 3DF8A 3CDHA 3FXQA 1B04A 4M6YA 3ZMDA 1JHFA 1XB4A 3ROUA 1JE8A 2LF7A 4UNOA 2O03A 2OA4A 3ZN0A 4G7ZF 2DPDA 4ZZLA 1ZHFA 4KNYA 4KMFA 1QGPA 2GXBA 4HW0A 2MC3A 1G3TA 3MEXA 3LSTA 5DUIA 3WGIA 2EFWA 1HKTA 3G73A 3WTTC 2R7DA 2EFQA 2OQGA 1BJTA 1XD7A 1FBSA 3FM3A 4EJTA 3TDZC 5CYVA 3GXOA 1LEAA 3E6DA 1U6GA 2IVMA 1HQCA 3KP7A 1W7PB 4I0AA 3IKTA 1WI9A 2NNNA 2F5FA 3ZMSA 5DD8A 1Z2PX 3C3WA 3GVAA 2UXDH 3IWZA 4U0VA 2JTVA 2Q2UA 5CVIA 5LHIA 3SHFA 5JHUA 1B4AA 3PQKA 5LL6b 3BJ6A 5CLSA 4N0BA 1L0OC 3WTXC 4JI6H 2ZXJA 1DGSA 3ZP5A 2RQPA 5TJJA 1I6UA 3F8FA 4OINF 2Z5UA 4HDVA 5ICEA 3GW2A 2KJCA 2RV8A 2VE8A 3P9CA 4KIGA 2UUBH 3BABA 1IXCA 3N41B 4APMA 4UCVA 2ZNZA 4AWXB 4HF0A 3RTRA 2W84A 1GXQA 4EM1A 3K1NA 5DCMB 2M30A 2MH2A 3IC7A 3RDIA 3I58A 1BI0A 2M5WA 1JXSA 4LMYA 5L3FA 2K02A 5L3GA 4LK1F 2WYOA 4KN7X 1JHHA 2H6CA 3IL2A 5LEKA 3TKYA 1D3YA 4Q47A 3GEZA 3RJ0A 4DQ2A 4YIIA 5LGUA 3N97A 4DR6H 4TV7A 4YG2F 1SD7A 2O61A 5BS6A 5L3EA 4M73A 1E2XA 1OPCA 3QU3A 2XGXA 4HLXA 4CC6A 2JRTA 4LK0F 4DV0H 1T39A 2LDUA 5D6FA 2VQFH 4I01A 1GYFA 1DPUA 3EDPA 1TQIA 3OOPA 4UCTA 1TQMA 3HOTA 2NRAC 3FWEA 1MJBA 5ILUA 2K4JA 4HF1A 2ISYA 2CO5A 2HR3A 5HLHA 2WC2A 3V7CA 4HX4A 1KU9A 3EYIA 1E17A 3KAKA 1N33H 4I02A 1OR7A 1SFEA 4HX8A 4JI0H 1LDJA 3R61A 1D5VA 1UHMA 3BJOA 4AQYH 4DR7H 1KA8A 4RAZA 3GZ6A 1KQ8A 1ZGJA 3E6CC 3NEUA 3RYPA 1F9NA 4A6DA 3D5LA 2QBYA 3F72A 2FSWA 3J80K 4IPAA 2A69F 2XAHA 3ABTA 3FMSA 3BPVA 2HVSA 3VB2A 4Y13A 1BN5A 5AONA 3ML6A 2M87A 1PP8F 4BWSC 1J7KA 1R7JA 1F5TA 2EA4A 1F1ZA 3BPXA 3KFWX 3GYHX 3L7WA 1U5TA 3GX4X 1IXSB 3GFLA 4S04A 1ZH5A 1WKMA 2J5PA 2MD5A 2MLGA 3BOQA 2Z33A 2QYOA 2EV5A 3RYRA 4A0XA 3BWGA 2STTA 2HHHH 4WF2A 5FFXA 3L4JA 1TBXA 4G8XA 2OQRA 3QAHA 1K7AA 2A6EF 5K5OA 5IT9K 1SD6A 4RZQA 4M7EA 4EMSA 2A61A 4CGZA 1XMKA 1I1SA 1FLIA 3ZQ7A 1RI7A 3L00A 2L02A 1SFXA 2K7LA 3IRRA 2JZYA 1YW7A 3KAJA 5FGMA 1I5ZA 3L4KA 2L01A 1Y0UA 4JI1H 1KQ0A 4LF8H 5D4RA 4XRFA 4GKJH 4X65H 5LEJA 1HW2A 4D0PA 1W4MA 3MZYA 4LG0A 4WWCA 5J8CA 2IA1A 1W7PA 1IAWA 4HV6A 1IN4A 2HQNA 1Z9CA 1FJGH 1RUOA 3HRUA 3W6KB 3J81K 4DV6H 3T8RA 2PMUA 4MTEA 3KCCA 4YFNF 3GFJA 4X64H 4GXOA 1O3RA 2CQKA 2LNBA 2ZCWA 2XRNA 4PCQA 1ZRDA 2D2WA 2OU2A 2VT2A 1YS6A 4G6QA 4RS8A 3ZPLA 5D6EA 4ENNA 5K1YA 3DV8A 2A68F 2D45A 4GGGA 4OIRF 1IBLH 2P7CB 1J59A 5EOYA 3ECHA 1SMYF 1CGPA 3KALA 2WE6A 3C7JA 4HAMA 1MJAA 3RPUA 4I0BA 3M4IA 3L2CA 2FOKA 2W25A 2HVRA 1XDUA 1LVAA 5LHHA 4RB0A 1XSXA 2D1VA 4IVNA 2RGRA 4JI7H 2BYVE 3DEUA 5FLXW 5IT3A 4J0MA 4GYIA 2V79A 2VPSA 1U2WA 3N4MA 3I64A 3M7GA 2CW7A 5HLIA 5BPIA 3DFGA 4Q0YA 4HZFA 2WDTA 1TQPA 4HF2A 4I2OA 4FX4A 2QQ9A 3V7RA 5DDGA 1S29A 3E6BA 3HHHA 5LLQA 2P8TA 1RZ4A 1TW2A 4KUMA 1WH2A 1X3UA 4XBFA 1LDDA 4EJOA 3M1EA 4HBLA 4IHSA 1KYZA 4RAYA 4M9XA 1K78A 4JI5H 4OIQF 2AS5F 5ICFA 2DW4A 1Z6TA 4IHTA 3MWMA 2L54A 2ZNYA 1Z1DA 1HBXG 1BC8C 2PG4A 2P7VB 5HS8A 3K2ZA 3GO5A 5IWAH 3TO6A 5BPDA 1IZ1A 2EFNA 5LMNH 3CUQA 2ZMEA 3I54A 4ESFA 2GAUA 4ZYEA 4CDGA 5DCMA 4EGZA 1FNNA 4OOIA 4U7DA 1S7AA 1PP7U 3KE2A 3GFIA 1VTNC 2A07F 4MQVA 1ZHQA 3J7AO 1R23A 1GHCA 1MGTA 1LJ9A 4A2AA 1QPMA 1G3SA 4DUYH 2XKOA 3WTYC 4ESJA 2QZ8A 3LA3A 4LLLA 5BOXA 3HSFA 1FP1D 4N9IA 4Q4ZF 1M0WA 3VEPA 4M71A 3CUOA 2CW8A 4ENMA 5HS7A 1UFMA 4OMYA 4UCSA 3TO9A 1T2KA 3BAAA 3RIZA 1BIAA 2H27A 3L9FA 1U8RA 2G7UA 3D0SA 1XGMA 1MKMA 5HDNA 3FHZA 2UU9H 1FT9A 2RGVA 4JK1X 2P4WA 2W85A 3ZN1A 1MDMB 1N32H 4HQEA 2VOOA 1XNRH