4RAZA

Crystal structure of magnetospirillum gryphiswaldense msr-1 holo-fur
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
b'MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4razA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4razA02
2W85A 1V4RA 3GFIA 2HS5A 3SZPA 3KP4A 2LDUA 3DEUA 4ENMA 4KUMA 1USTA 2P5LC 4YIFA 1B1BA 5J8CA 1IN8A 4UUVA 2G7UA 3KP3A 4I02A 3GZ5A 4CO8A 1AOYA 1ZLJA 1MD0A 3WU1B 3WTVC 4KYWA 1LB2A 4LK0F 3J7AO 1YW8A 4EVIA 3KP7A 2NNYA 1JE8A 1LDDA 4KFCA 1SD6A 5H6RA 1BI3A 4P9UA 2XAGA 1W4MA 1T6SA 3BPXA 2ESHA 1C0WA 3K2ZA 2ZJ2A 3GZ6A 5ICFA 2P5KA 3RI4A 2VC0A 3HRTA 3K9TA 4G6QA 3M8FA 3FMRA 2H94A 1IXRC 1HW2A 3DQVC 5LRSA 2VOOA 1SMTA 3V7CA 1WWXA 2PI0A 3WTYC 5CJ9A 3F8NA 5BMZA 1TQPA 4ZZLA 2F5CA 2K27A 4DNCA 2JPCA 1J0RA 3QP6A 3Q5FA 4FX4A 4XLNF 3N97A 4HV6A 2L3DA 3KCCA 2YU3A 5H20A 2FMYA 1ZRDA 1GVJA 2AXLA 4I0AA 4R79A 4YIIA 5L3EA 4MGRA 2V1UA 5A2QZ 3FZVA 3RKYA 3RTRA 2R3SA 2L4MA 2YX7A 2FF4A 4L0ZB 3C3WA 1ZYRF 2V1XA 3RYRA 4A0YA 3ZQ7A 3WG9A 1RUOA 4Q4ZF 3CO6C 3GF2A 2NAZA 2VODA 1RUNA 4OU0A 2E1CA 4G94A 1R23A 2DT5A 4HF2A 1ZGAA 2A5YB 3HHHA 3I4PA 1UHWA 2EK5A 3TDUC 3QRFF 2BEOA 1LQ1A 1TTYA 3ELKA 3LWFA 2CQKA 2HEOA 1R5GA 3IWZA 4IVNA 1MKMA 1XD7A 4XLPF 4XSXF 2A3SA 3NRVA 3J81K 1T98A 2QVOA 2H27A 1R58A 3E6CC 1I27A 3D0SA 1TW2A 1EH6A 3I71A 3KEQA 3MZHA 3VFZA 2DQLA 3RIRA 4U0YA 2HKOA 3H3UA 1OMIA 2LNBA 5EEHA 2VT2A 2BV6A 4LG0A 2MLGA 3JTHA 1TLHB 4O6JA 1IF1A 3WTTC 4LGWA 3KEOA 2EV5A 1T0FA 3ZMUA 3IHUA 4UXNA 4IHSA 4LFUA 5D4RA 1SFXA 3PFIA 3NQOA 2NYXA 4GCVA 2BYVE 2DK8A 1BIBA 4YG2F 3T8TA 1J59A 1YS7A 1IRFA 4LLNA 3P9KA 1G3SA 1XN7A 5KK1A 2MLKA 2F5FA 2OZ6A 1TNTA 1D3YA 5DD4A 5D5UB 2QQ9A 4RB2C 1KQ8A 2QBYA 1GXPA 4UVBA 3WTXC 5FB2A 4PGGA 3WU0A 4A0ZA 5AIPA 4MHGA 4DQ2A 2P5VA 3I58A 3ISPA 3HSRA 1B9NA 3V7RA 5E8IA 1ZGJA 3KP2A 3EETA 2RC4A 4M74A 4L5JA 3IC7A 3GYHX 2O0YA 3OOPA 3U1DA 3ZMTA 2ZXJA 1WSUA 1S3JA 3KE2A 3VB2A 2XAFA 4ZZDA 5ICEA 2WC2A 4A0XA 3DFGA 3TGNA 3L2CA 1R1TA 2OBPA 5LGUA 3JAMK 1ZG3A 4S05A 2GXGA 2PEXA 4LMYA 2VC1A 5DEQA 1O3RA 2HTJA 2A61A 2IA1A 3DPTA 2FBHA 4MNUA 3HRMA 2E7XA 2RNJA 2HFHA 1SD5A 1XGNA 4CXFA 1KA8A 1R7JA 2B0LA 1EV7A 4I98B 5L3FA 4XRFA 1B9MA 3CUQC 3O3KA 2EV0A 5K5OA 3HRSA 4NHJA 1YW9A 1T39A 1R36A 3FF5A 2DQRA 2DBBA 3GUDA 2D45A 4HW0A 3WGIA 1F4KA 4E70A 1Z1DA 3F8BA 4N9IA 2BE5F 2HWVA 2KKOA 4G7OF 5DCMB 3IWFA 2L4AA 1ZLKA 3QP5A 4IRHA 4HAMA 2CSOA 3HIFA 3DPLC 5ILVA 5LEJA 3QAHA 1HSTA 2YSRA 2ISZA 1MJ9A 4KN7X 2BBYA 2FU4A 4U7DA 5TJJA 2F5EA 4UNOA 4A6EA 1BI0A 2DFIA 4A5NA 4G6DA 3GVAA 2L54A 3ERED 2PLYA 3U2RA 3CLOA 3M9AA 4EM0B 4LD5A 2OQRA 3MFKA 2XRNA 4Y13A 2RKHA 2IRFG 5HLGA 3TDZC 5LRRA 4M9ZA 5DCFA 4UHTA 1J75A 1SD4A 4CGZA 3HUGA 3T1BA 5L3DA 3DP7A 3CDHA 1ZG1A 5CVUA 2M5WA 2K4JA 4A2UA 3P9CA 3HSFA 4HDUA 2HOEA 3K1MA 1U8RA 5BS6A 2CGPA 1STZA 4KIFA 2Q8KA 1TQIA 5DDGA 1IZ1A 2QLZA 2KIUA 4BH9A 4CDGA 4KN4X 2GWRA 4I2OA 1U5TC 4AVPA 1OPCA 4TV7A 2Y48A 4P5OA 1QBJA 4LJZF 2Z3YA 3ULQB 2D1VA 4MTEA 3RKXA 3K0LA 5K1YA 2Z99A 3HTUA 2K7LA 1W7PB 3P7NA 3E5UA 3HOTA 4IHTA 2A68F 1G4DA 1E2XA 3ZN0A 2YX4A 3PQJA 3BP8A 4JK1X 5IT9K 1FBUA 5ICCA 2F2EA 3ZPLA 2QQAA 2QYOA 3HRUA 4EGZA 1YFHA 1IN5A 2MD5A 3BJ6A 4RB3C 5K5RA 3WTSC 2OQGA 4Q48A 2Q2EA 2EFWA 1GHCA 4IJAA 4ESFA 3L7WA 3F23A 3LFKA 4UV9A 4B8XA 4QWQA 4HX8A 4CYDA 2GA2A 1T2KA 1F5TA 3ECHA 1FT9A 4KDPA 3GO5A 5LEKA 2IA0A 4EM1A 2HQRA 3SQNA 1TW3A 1FZPB 2MA3A 1ODDA 3EYIA 1DDNA 1KYZA 2HZTA 5DCMA 3LSTA 2FSWA 3CTAA 4ZH4F 1U3EM 5HDNA 5D6EA 1W7PD 1KU2A 2DW4A 5DUIA 3B73A 1IUYA 4P9FA 1P2FA 1W5SA 4MQ9F 4CICA 2DI3A 3F72A 4PDKA 2Y75A 4JBAA 1KQ9A 3ZMSA 1YO5C 1IXSB 3V8LA 3COAC 3VEPA 4AIJA 2IW5A 4UV8A 5FO5A 4PZJA 2IVMA 1RI7A 3F22A 3I53A 1GXQA 5DD8A 4JQFA 5BOXA 1WI9A 1IRGA 4WCGA 5BPDA 1ZH5A 3LA2A 1P4XA 1FOKA 5DUKA 5HS8A 3ZP5A 3ABUA 2MC3A 2FA5A 5ILUA 3E5XA 2IA2A 2P8TA 1XDSA 4O3MA 1Z9CA 2KRFA 4EGYA 3JSOA 1QZZA 3H92A 2P7CB 3TQNA 4WK8F 3EQLF 3JTGA 5E8GA 4R8HA 4BYYA 1Y0UA 2COMA 3GFLA 3R60A 1FC3A 1L3LA 1ZARA 2JZYA 3WTZA 5F1RA 2H6BA 3TOBA 2M45A 3JSPA 1OYIA 5D8KB 2GZWA 2ESNA 2PMUA 4YFNF 5LLQA 1HKSA 1LEAA 2OAZA 1UB9A 4HA8A 4KMUX 4P96A 1MGTA 4OINF 4L9JA 3TKYA 1HBXG 3R6SA 4ZYDA 1BC7C 4KMFA 3D5LA 4U88A 1B6AA 5E20A 1H0MA 2UZKA 1VTNC 1S7OA 2JRTA 3K69A 3M7GA 1WRJA 2HR3A 2IPQX 1FNNA 1LVAA 4M6YA 1O57A 1YS6A 2LSOA 1ZG5A 4YFXF 4U7BA 1F1ZA 5D4SA 4NB5A 4ZYEA 1FSEA 1XSXA 1HXDA 3FMSA 2XKPA 3FXRA 1MDMA 4RS8A 4I01A 3REOA 3T8RA 4A5MA 2VONA 4BHBA 1KU3A 3L9FA 3NEUA 2FE3A 3J80K 2QWWA 2Y0MA 1HQCA 3PQKA 4KIBA 4RGSA 5FLXK 5AONA 4N0BA 4HYEA 2RV8A 3FM5A 4EV0A 5HLHA 5LGTA 1TQMA 1MJBA 5LGNA 5FD5A 1IW7F 1OYYA 1ZRFA 3GW2A 4WWCA 5JFRA 1BJAA 2W24A 2DAOA 1HW1A 2FRHA 2OU2A 2EFPA 1FYMA 1FP1D 1I5ZA 4RAZA 3GWZA 4IPAA 2DPDA 2E1NA 5CVRA 5CVJA 2ZFWA 5L3BA 3WGHA 1KQ0A 3R4KA 4M71A 2P7VB 1U78A 5FD6A 5ICGA 2KJCA 3S2WA 1QNTA 4F7ZA 2EA2A 4OIOF 4U0VA 2O6GE 1LNWA 3HTSB 5D5VB 3GFMA 5E1XA 5LBQA 2P4WA 2OD5A 2M87A 4ESBA 3J81Z 3O2PE 1XSDA 2D1HA 4HF1A 2FBKA 2NRAC 5TRDA 1YG2A 3BROA 3QPHA 1XCBA 1P4AA 2HGCA 4L5IA 1ZAOA 5JR3A 1LDJA 1HSJA 2ZNYA 3LQRA 4EJTA 2R7DA 4GYIA 4MQVA 4OMYA 2CO5A 3T0YA 4YFKF 1CGPA 4R1HA 2EFNA 4IRIA 5HVQC 1QPMA 2MH9A 3E5QA 3CJNA 2GAUA 2PN6A 3J80Z 3E6BA 1XMKA 4HZFA 2AS5F 4WF2A 3ROUA 4D0PA 1ON2A 1F9NA 4L9VA 1B4AA 4HF0A 3RPUA 3U9GA 3BDDA 3R0AA 2PFBA 1XCVA 1FBSA 5LHGA 1IAWA 3T5XA 2K86A 1O7FA 3I0TA 3QOPA 4RB1A 3ECOA 3KLNA 2M1BA 2EFQA 6PAXA 2XASA 4L9NA 4BAYA 3BY6A 4HX7A 4CHUA 4KIGA 3V8JA 5D8LB 1IN4A 3G73A 2LKPA 4KNYA 3WE3A 4HQEA 3LAJA 1UFMA 4AIHA 3LA7A 2XAQA 2XGXA 5IT3A 1HKQA 2STWA 2DK5A 3SHFA 1CF7B 1REPC 3P9IA 3C18A 3BJAA 4UVCA 4OOIA 4PCQA 3JAMZ 2L01A 1KU9A 2FQ3A 2A69F 3VODA 1SD7A 5BPIA 5F6FA 5D5XB 2DTRA 1FBQA 1YYVA 2G9WA 1TNSA 4HQMA 2L02A 4G7HF 2G7HA 2ELHA 5DV5A 4M9XA 1RIOH 4EJOA 2LF8A 3VOEA 2VBYA 1BOAA 3GFJA 1USSA 1LJ9A 4ENNA 3V7SA 3LAPA 2V6CA 2O8XA 4GGGA 5FFXA 4KT5C 3KP6A 5CVVA 3EYYA 2OZUA 4A6DA 1PP8F 3GEZA 1J7KA 1D8JA 1B59A 2D2WA 5A2QK 1PP7U 1FYKA 4AIKA 2DO7A 1SAXA 1BI1A 3I54A 4IF4A 2PBIA 4CZZA 1O7LA 3F21A 1Z6TA 2ISYA 2WTEA 2V9VA 4LLLA 1KGSA 2FOKA 3CUOA 1ZHFA 2DPUA 3MEXA 3F3XA 1S7AA 4L18B 1H9TA 3CUQB 1G3WA 1IN6A 3W6KB 2FMLA 3HSEA 5HDGA 2HQNA 4UVAA 4NQWA 4HDVA 5JHUA 4BHCA 1FPQA 1XGOA 1BI2A 3BJOA 1XGSA 3WODF 1L0OC 3BWGA 2STTA 2ZNZA 2HKXA 5J6XA 1WKMA 1I1GA 1XB4A 1NHAA 1EH8A 2WWYA 5LHHA 3M8EA 4BXUA 2GA1A 1S8NA 3IRQA 2YR2A 5F64A 1I1SA 4FHTA 3KLOA 2ZBKA 3ZMVA 1R1VA 3R61A 2IP2A 2QBYB 4XSZF 5H6QA 2GXBA 2O61A 1PUEE 1Z91A 3TOAA 2ZMEB 3K1PA 4EM2A 3HHGA 4M9SA 2VT3A 3DV8A 2CG4A 3F8FA 1XDUA 2VBZA 1XSVA 3W6JB 1DUXC 3WTWC 5AIQA 5E18F 4MEXF 3DKWA 1OKRA 3QU6A 1BN5A 3FM3A 3N4MA 5J8FA 3IRRA 2JPBA 1RZ4A 1UCRA 3LA3A 2P6TA 1K79A 2HYFA 4RGUA 3BZ6A 1IXCA 4K2EA 4RB0A 4XBFA 5D5WB 4G9YA 5JVTA 4N9HA 1CF7A 3RYPA 3OV8A 3GX4X 2WV0A 1K6OA 5L3CA 1OYWA 1FWZA 5IT9Z 2QQBA 2R7FA 1FYLA 3CO7C 1P92A 4AD9A 1LDKB 3HOSA 1SMYF 4FT8A 3KZZA 4ZYGA 2O3FA 4OIPF 1U5TB 1S29A 2PMHA 3F6VA 2EB7A 2KIMA 1J2XA 2OA4A 2KJBA 4HX4A 2VXZA 4H0EA 4RGXA 2VBXA 5ERIA 3E97A 3ZMDA 1W7PA 4PGHA 1ZRCA 2P6SA 1O3QA 4Q5SF 1D8KA 4G7ZF 2HTSA 1G3YA 5ED4A 2FNAA 1XMAA 4FX0A 2PJPA 2NS0A 2K02A 2CWEA 4Q47A 4HOBA 3QU3A 1MJAA 2VE9A 4M72A 1YTYA 3I64A 2VN2A 1I6XA 2FXAA 1Z05A 2QZ8A 4G8XA 2A6EF 2W84A 4IXAA 3GXOA 2RGVA 1ONVA 2GQQA 3CUQA 4OIRF 2UXXA 4WXHA 1SFUA 2JSCA 4B09A 2M30A 4GXOA 3K1NA 4KICA 5D6FA 2W25A 2J5PA 3BPVA 3RKWA 4BNCA 5CLSA 1BBYA 2BGCA 3Q9VA 4GYGA 5E1WA 3GLXA 1KU7A 1QGPA 1JHFA 4LLGF 4LB5A 2UXNA 3I59B 1R5HA 4KA4A 2VE8A 3C1DA 1G6NA 3ABTA 2F5DA 1J5YA 2ZKZA 1AWCA 1FY7A 4U0WA 4RGRA 2ZMEA 2FEZA 1SFEA 1ULYA 3BOQA 1W5TA 2Z5UA 3R0JA 3SFZA 2ZCWA 1ON1A 4HV5A 3G3ZA 1K78B 2ADUA 2V79A 1U6GA 2UWMA 1D5VA 1J9IA 2W57A 4ENJA 2K4BA 3ML6A 1G3TA 3MAJA 3MQ0A 5EEGA 3HYIA 5HDKA 4MTDA 4WXCA 2C6YA 3MWMA 1RNLA 3KZYA 2M8EA 2ETHA 1FSHA 4I0BA 3MCZA 2A6HF 2XKOA 4WXDA 1O3TA 2CFXA 2ACJA 4ETSA 2YPRA 4LB6B 4LK1F 4P55A 3M1EA 1FP2A 2PQ8A 3DXJF 1O3SA 3ZMZA 4EQQA 3C7JA 3E6DA 3E6MA 2A07F 2HDCA 1JHHA 3KFWX 2HYGD 4WX9A 3F6OA 1U5TA 3KP5A 4L9TA 1YIOA 4Z2YA 1FX7A 2QM3A 2MBFA 4ZYHA 5E17F 3WTUC 3O6BB 5FLXZ 2RQPA 4EMSA 2LF7A 4ESJA 2XIGA 3WE2A 4O5VA 4ASNA 1T38A 3WGGA 2Z9OA 4HBLA 1QQIA 2DLLA 1H9GA 5HS7A 1WQ2A 2TDXA 1S6LA 3B02A 2H09A 2X4HA 2RVCA 2RDPA 1JGSA 3EUHA 2EFOA 1DPRA 1R22A 3F8CA 3RDIA 2CYYA 3V8KA 2IT0A 3FWEA 4S04A 1R1UA 5CVIA 2XUBA 2X0LA 5LHIA 3JW4A 2FBIA 4Y17A 3IKVA 2EA4A 2XHKA 2RN7A 1ZREA 2Q0OA 2XROA 1TBXA 4A12A 2Z33A 3L00A 1YQAA 5BQTA 4OIQF 4ON0A 2EJRA 1KYWA 1QZYA 5JI6A 4GO1A 1R00A 3ZN1A 2H6CA 2XAHA 1ZN2A 3FHZA 2QENA 1U2WA 3DF8A 3MZYA 4EJUA 3AAFA 1BC8C 2FNPA 2EV6A 1DP7P 1FLIA 2IJLA 5FFZA 2XAJA 1Q1HA 2MH2A 1DPUA 5K5QA 4MEYF 3I59A 4HLXA 4I7HA 4HLYA 4AWXB 4I09A 1IN7A 1BIAA 1HKTA 4M73A 4L0YB 5FGMA 3FX3A 2XVCA 4EJVA 1LEBA 2VBWA 2CW0F 5E1ZB 3IL2A 1Z7UA 2VOPA 1UHMA 2EWNA 3E3VA 1PDNC 5ILSA 1BM9A 3LQQA 2JTVA 3FXQA 1YLFA 1P6RA 3IKTA 3RPQA 2E7WA 4M6XA 3SXYA 2J5OA 3TO7A 3Q9SA 1A04A 1V3FA 1K78A 2QUFA 5DYMA 4Y15A 1YW7A 1XGMA 2JT1A 5HS9A 2O03A 2DU9A 1P4WA 4RAYA 3L09A 3RJPA 3FXUA 5HOOA 4BQAA 5KVRA 4EJWA 3H3ZA 5L3GA 1EH7A 1JXSA 2KIFA 3V4GA 3KETA 4BHPA 3F8MA 4ENKA 1QO0D 2PG4A 1HW5A 3QPTA 1OR7A 3EDPA 4IRGA 4QLCU 1K7AA 2NNNA 4LG0B 3SZTA 5HLIA 2V1DA 3I5UA 4OMZA 3TO9A 2GIVA 2ZO4A 1MDMB 1E17A 1X3UA 1Z6RA 3FMQA 1MZBA 2XV4S 3TO6A 5CYVA
chains in the Genus database with same CATH superfamily
1P8LA 2W85A 2W70A 4I4TF 1V4RA 3Q8SB 4FBTA 3BABA 2EZIA 3GFIA 4BXFA 1VQ5I 2HS5A 1I3AA 2HOSA 2XGPA 1RKTA 3SZPA 3KP4A 1A0IA 2KQRA 1OCZH 2LDUA 3GTKJ 2HNHA 3DEUA 3RGXA 4TV8F 3H4DA 2LD5A 2M34A 3S93A 2VQDA 3DU5A 4ENMA 5LMUH 4KUMA 1USTA 2EPFA 3Q0UA 2P5LC 4YIFA 4RM3A 1B1BA 2X1DA 5J8CA 1IN8A 4UUVA 2G7UA 2X51A 3KP3A 4I02A 2CQYA 3GZ5A 3PL8A 3PZPA 3LSPA 4CO8A 2V9WA 4D1QA 4OAYA 1AOYA 4ZQIA 3BZKA 1ZLJA 1MD0A 2DMPA 3WU1B 1NG6A 3WTVC 4KYWA 3FIWA 2WAQA 2VQCA 1LB2A 4BE1A 4LK0F 3J7AO 2FP4B 1YW8A 4EVIA 3M9OB 4DV4H 3KP7A 2L7ZA 1MBFA 2CZGA 4O3PA 2NNYA 2CW8A 1JE8A 1PX2A 1LDDA 4ECRA 2VI6A 1SD6A 4KFCA 2R8JA 5H6RA 1BI3A 4PFOA 4P9UA 3S3OA 2R82A 2XAGA 1W4MA 2Y69H 3OSPA 3KZIC 3DKXA 4Y33A 1T6SA 1IBMH 3BPXA 2ESHA 4NNJA 1C0WA 5FRMA 3K2ZA 3GTMA 4RU9A 2ZJ2A 3GZ6A 1G8XA 5ICFA 2X1CA 2P5KA 3RI4A 3IH3A 3MJFA 2VC0A 5KFPA 2BXYA 3ABLH 4QIWE 3HRTA 4AYBE 2YU9A 1KONA 3K9TA 2K9LA 4G6QA 2DMQA 3ABKH 3MWDA 3M8FA 2WAEA 4A3LG 3FMRA 2H94A 1IXRC 2HPIA 1HW2A 1Y6IA 3DQVC 5GAHJ 5LRSA 3RB0A 1WZ2A 2M05A 1SYXB 4MO7A 2VOOA 1SMTA 3OYLA 3V7CA 4DR3H 1WWXA 2PI0A 4NUBA 3WTYC 4TV9F 5CJ9A 5KFEA 2BHYA 4ZYAA 1KJQA 3F8NA 5BMZA 3R5HA 5EWGA 4AU7A 1TQPA 4ZZLA 2F5CA 3JRWA 2DA7A 2K27A 4DNCA 2JPCA 4A3IJ 1J0RA 3QP6A 3Q5FA 3FDYA 1OISA 4NDLA 3CMEI 4XLNF 4FX4A 4PJNA 3N97A 3HOZG 3BR3A 4HV6A 3H5NA 3IAM2 2UUZA 5C4XG 3HKZN 4CC6A 4XZ3B 2L3DA 1FTTA 2BR0A 4XICA 3G1OA 2LLKA 2YU3A 3KCCA 2LY2A 4BKXA 1V4YA 2E36A 1JI8A 4JX4A 5H20A 5KFDA 4J9QA 1LE8A 2V4RA 2JJ7A 3FKIA 5KFSA 2FMYA 2JA5G 1ZRDA 1GVJA 3ZQIA 4Q43A 3K5HA 2AXLA 4ZTJA 5IYZF 5FLMG 3GV5B 2HGSA 1IOWA 1E4EB 4BY7J 4I0AA 4CSWA 1VQKI 4R79A 3G2BA 5FPRA 2VKDA 3JREA 4YIIA 5L3EA 4MGRA 2V1UA 4LIVA 5A2QZ 1MIJA 2BY2A 2CH0A 3FZVA 3RKYA 4DR2H 3RTRA 5C44G 3CD6I 2R3SA 2L4MA 2YX7A 3IN5A 2FF4A 4L0ZB 4QWDA 1S10A 3C3WA 1ZYRF 5TISC 1I3QA 2V1XA 3RYRA 1OR7C 4A0YA 3ZQ7A 2R5ZA 2RREA 4DV7H 3WG9A 4O2AF 1RUOA 1VQ7I 2GOXB 2IBKA 2WADA 2WAQN 4BWSC 4Q4ZF 3CO6C 2W6PA 5M5WJ 5L1KA 3GF2A 2NAZA 2VODA 4DV6H 3S1QJ 4D5FA 4EATA 4YY3H 2FLPA 2K3FA 1RUNA 4A3BG 3HGYA 3JRGA 2QEXI 4OU0A 2E1CA 2FX0A 5C1PA 1GV5A 4G94A 1DGWY 2B7EA 5KT5A 1R23A 2DT5A 1YX3A 5L1IA 3J80W 4HF2A 3BQ1A 2W9CB 1ENHA 2R7RA 1UAAA 4HQ6A 1YX5A 5FLXW 1ZGAA 1LFUP 2A5YB 3HHHA 4IHWA 3I4PA 5FRNA 1S9FA 1UHWA 2EK5A 3TDUC 3QRFF 2BEOA 2QF7A 3K2AA 2Y9ZA 1LQ1A 1TTYA 2R7MA 3ELKA 2ZFUA 2NVTJ 3B6CA 3LWFA 4D5CA 5EGOA 2JA6J 2CQKA 2HEOA 2O9LA 3DEEA 5KX5F 1R5GA 1VKZA 3IWZA 4TQSA 4IVNA 5EDNA 3CC4I 3CQZA 1MKMA 1XD7A 4XLPF 1T95A 4XSXF 2A3SA 2KRHA 5E3MA 3H40A 3NRVA 3J81K 1T98A 2QVOA 4A3KG 2TRTA 4IWXA 2JA7A 2H27A 2L7KA 1R58A 3E6CC 3OHAA 4PUSA 3NGDA 2QA4I 2YW2A 1I27A 1JTXA 3FXKA 3D0SA 1TW2A 4B48A 1EH6A 4AM3A 2J6UA 3DTKA 1QA6A 1QVTA 4Q0YA 1AA7A 1AHDP 3I71A 2ZJPF 4HEA2 2M9HA 5CB4F 3KEQA 3MZHA 3VFZA 2DQLA 3RIRA 1OCTC 4U0YA 3GTLJ 2FPIB 2MC4A 4HNUA 1MBGA 1LUJB 2KSWA 2HKOA 3H3UA 1OMIA 2MYSA 5I47A 4V19K 2ZC2A 5H2FC 2LNBA 5EEHA 2VT2A 2BV6A 2QCOA 3Q0WA 3WG7H 3LSMA 4LG0A 1S72I 2MLGA 3L4JA 5J1YA 3JTHA 1TLHB 4M3EA 4O6JA 2EIJH 3WTTC 1IF1A 1IDZA 5FKLA 3GLKA 4EYIB 4LGWA 3KEOA 2EV5A 1T0FA 1RJRA 4DV2H 3ZMUA 1BR1A 4E7ZA 1SFOA 3IHUA 4UXNA 4IHSA 3PO2G 5IP7G 4LFUA 2YZGA 5D4RA 1SFXA 3PFIA 1DIKA 5JLWA 3OYKA 1RJPA 3NQOA 3GTQA 2NYXA 3GIMA 4UUSB 1XX5A 3SFIA 4GCVA 2BYVE 1LFBA 1E3PA 1D1CA 2DK8A 1BIBA 4YG2F 2DLNA 2W6NA 3T8TA 3OSNA 3BR0A 1WCMJ 1J59A 3T1YH 3JAMW 1YS7A 3CCUI 4ECXA 1IRFA 4LLNA 2R7VA 3BR5A 3P9KA 1G3SA 4C2MA 2VKEA 2R5YB 1KC7A 1XN7A 5FJ8J 3HUGB 2W48A 5KT2A 5KK1A 2MLKA 2LKSA 4BY1J 4DL7A 4MV8A 4JI5H 4DJAA 4EEFG 4CCMA 2F5FA 2HPMA 3ZQGA 1LVKA 2XGCA 2OZ6A 4ED3A 4XL9A 1TNTA 2Y2ZA 1D3YA 2MD0A 1FTZA 2FK3A 1K61A 5DD4A 5D5UB 1ZELA 2NVYA 3BCAA 4XONA 2QQ9A 2LMDA 1IJWC 4RB2C 5J4YA 1KQ8A 3R5XA 5KT4A 4IQ4A 2QBYA 1GXPA 4UVBA 2Z2SB 2BOLA 3WTXC 3S1MJ 3LNQA 5FB2A 4BBSJ 4PGGA 2IMWP 5IOYA 3WU0A 1N75A 4A0ZA 5DS9A 5EEAA 2K9MA 4QJFA 1A9XA 4LIUA 1RPWA 2DJIA 5AIPA 2I10A 4MHGA 1U8BA 4DQ2A 2P5VA 1MW7A 2WBMA 3OYNA 3I58A 2CUZA 3RPUD 2R7OA 3HSRA 1B9NA 3ISPA 3OWTA 3RQIA 3IH2A 3V7RA 1ZGJA 5E8IA 1E3HA 3KP2A 3EETA 2LVSA 4J9KA 1APLC 4JV5H 2RC4A 3BTLA 3DTEA 2LTPA 2JA7G 3TL4X 4BQNA 4UCSA 1TWCJ 3VYTB 1SCUB 3ZGKA 5F27A 4M74A 1R9TJ 1WJFA 1WR2A 4A2AA 4L5JA 2LG4A 3IC7A 2GPWA 3SEQA 4ZDPA 1TWGA 3GYHX 2O0YA 3OOPA 2DA4A 1EKEA 3U1DA 3ZMTA 2ZXJA 3PIOF 1WSUA 4C5AA 1S3JA 3T5JA 3KE2A 2HI3A 3VB2A 3VYUB 2XAFA 4ZZDA 2X6YA 3JSLA 2C22A 5ICEA 2WC2A 3GIJA 5KAFC 4A0XA 3DFGA 3TGNA 2BY1A 3SJMA 1FKAH 2E71A 2XF6A 3L2CA 1R1TA 4QIWA 2Y0SE 2OBPA 5LGUA 3JAMK 4FTHA 1ZG3A 4S05A 4MV9A 2YS7A 3SZGA 2GXGA 2ECCA 2PEXA 4LMYA 2DFHA 3N41B 2VC1A 2W7OA 4J0MA 5DEQA 4RLQA 3GIIA 2IXSA 5C3EJ 2RF4A 1O3RA 1E4EA 2HTJA 2A61A 4BEHB 1RR8C 2IA1A 3MR3A 1SEUA 5CKTA 3DPTA 2EIMH 5JVLA 2H8RA 2FBHA 4MNUA 3HRMA 3LMLA 2WDTA 2E7XA 2RNJA 2HFHA 3QYBA 1X1CA 1MNEA 5DGAA 4A3MG 1SD5A 3CCMI 2R8HA 1U9NA 1MBKA 4BXXJ 2FMAA 1XGNA 4JOMA 3QYFA 4PSWA 1KA8A 4CXFA 1IRZA 3H0GA 2QSHX 1R7JA 4OAZA 1WSCA 2B0LA 2Q2EB 1B6RA 4YR0A 1EV7A 4I98B 5L3FA 4XRFA 5KFFA 1BGWA 2VLAA 3AFHA 1B9MA 2QKLB 1HCRA 3HOVJ 1EF4A 3CUQC 3O3KA 2EV0A 4YQWA 2WY7Q 2LFBA 2O8KA 3D5SC 3OOUA 1T0FC 2AQFA 5K5OA 4I99C 4A3CJ 3HRSA 4NHJA 1YW9A 2DJNA 1T39A 2DA1A 1YRNB 3BR6A 1R36A 1JKJB 4O4IF 3FF5A 3DKYA 2DQRA 2DBBA 3GUDA 2D45A 4HW0A 2R8GA 5FLVA 4UCUA 5TGTA 4DIQA 1ULZA 3WGIA 4LF8H 2K5CA 4ED2A 3T5LA 1F4KA 4E70A 3OYDA 2ASLA 1Z1DA 4XRSG 2M7AA 3F8BA 5FJ8G 2GBYA 4B44A 4N9IA 2W9CA 3ZRGA 4WBNF 2BE5F 2HWVA 4B47A 3MKLA 3T5HA 3HC7A 2KKOA 3I4NG 2GLOA 5DCMB 4G7OF 5IYCJ 4XYLB 2E2HJ 3IWFA 5EWEA 2ZJRF 1BXRA 5EZGA 2WTFA 5BNGA 3EPIA 2L4AA 5D1OB 4B3XA 3PFYA 1ZLKA 4ABZA 2C2RA 3J7YJ 3QP5A 1Y1VA 4IRHA 4HAMA 1FOWA 3OYJA 3R23A 1PJRA 2CSOA 1AU7A 3HIFA 4UCVA 2L2OA 3ASNH 3DPLC 2ZJQF 5ILVA 3H20A 1OCRH 2V4JC 5LEJA 4UCRA 2W8KA 4D7NA 3QAHA 1HSTA 3SYTA 4ZOLF 1UMQA 3OTOH 4LITA 2YSRA 1FOXA 4B3AA 1HF0A 1V55H 2ISZA 3S1NJ 1MJ9A 4AYBN 4QIWN 2ZMEC 2IEKA 4KN7X 4QTRA 4QW8A 4QWBA 2BBYA 2FU4A 4U7DA 5TJJA 3HOWJ 2F5EA 2ZM6H 3N42B 2HZDA 4UNOA 4A6EA 3MR6A 1BR2A 1D1AA 3OL4A 4XIDA 1BI0A 2DFIA 4A5NA 1ZGWA 1LPQA 2ASJA 4MA0A 4G6DA 3MVPA 4DZJA 4IHXA 4QSHA 3GVAA 5GADJ 2KISA 2XPUA 3T1HH 2L54A 3OIPA 1K6YA 2V4QA 3ERED 2K40A 2PLYA 3U2RA 3CLOA 1Y1WJ 3M9AA 3H0GG 4MV4A 5IYDG 3ERMA 4EM0B 4LD5A 4CCJA 2OQRA 3RCOA 5B3SH 3MFKA 2CRGA 2JEIA 4BS9A 4PJJA 2XRNA 1JUSA 3QPSA 4Y13A 4UUSA 5E3LA 2RKHA 2HDWA 5GAGJ 2IRFG 4BE0A 5HLGA 3K3VA 1L2ZA 1GV2A 3TDZC 4MV3A 2UVUA 5LRRA 3M8JA 4DL3A 5IT9W 4M9ZA 5DCFA 1K4SA 2FLNA 4UB6C 1I7NA 2L9VA 2J6TA 1RR7A 4LF6H 4UHTA 1J75A 1GSOA 4B3TH 1SD4A 2R5YA 4CGZA 2ZXWH 3HUGA 4M9UA 3T1BA 3QQAA 5L3DA 3DP7A 1B72B 3K70C 3CDHA 1ZG1A 4RUAA 3CCLI 1W96A 1OCOH 5CVUA 2M5WA 5KFRA 1FMVA 2K4JA 5KG0A 4A2UA 3P9CA 3HSFA 2LYCA 1VQ6I 4C5BA 4W1UA 4HDUA 2HOEA 2I87A 1X9NA 3K1MA 2DA6A 1U8RA 4ED0A 4RZRA 5BS6A 2CGPA 1STZA 1RYSA 2E2IA 3F9KA 4KIFA 2Q8KA 1TQIA 2BY3A 1VBGA 2EQRA 5BR8H 2M0MA 5DDGA 1RYRA 1IZ1A 2QLZA 2KIUA 3JRBA 4BH9A 3TIGA 4B3RH 4CDGA 4KN4X 2GWRA 2W4SA 4I2OA 1HR0H 1U5TC 4AVPA 1A31A 1OPCA 3GLLA 4TV7A 3OMYA 1S5LC 2Y48A 3KXYT 1HC8A 3KPHA 4ECVA 1HNZH 2H8WA 1JX4A 4P5OA 1QBJA 4JI3H 4LJZF 3CC7I 5KFNA 3CZ6A 2Z3YA 1RRJA 3ULQB 5KFTA 2D1VA 2FLLA 4MTEA 3VSKA 1K83J 5KFIA 3RKXA 3HOZJ 2MSYA 3K0LA 5IYCG 5K1YA 1X2MA 2WB1N 4KJZA 1N25A 5C4XJ 2CMPA 2Z99A 3RB6A 2HQ5A 3HTUA 4B4CA 4XM3A 2K7LA 3N05A 1W7PB 3HG9A 3P7NA 2LKXA 4YHHH 3Q8QB 3E5UA 3RZOJ 5BPHA 4IAJA 3HOTA 1W36D 2JA5J 2A68F 5EZHA 4IHTA 4M6VA 2CUEA 5B1AH 3S3NA 3JSNA 3KHHA 1G4DA 5FLMJ 5IWAH 3L2PA 1E2XA 4UUTA 3ZN0A 4LF7H 2YX4A 3PQJA 3BP8A 4JK1X 2E5LH 3Q3SA 2CUJA 1TWFA 4XLHA 5IT9K 2DPJA 1CQJB 1FBUA 1XPXA 5KFCA 1T3NA 3GILA 5ICCA 3V4ZA 5LOVF 3GCMA 2F2EA 4E4HA 1JIHA 3HKZA 3ZPLA 4HR7A 2QQAA 3KYDB 1T94A 3JRXA 3H9GA 2QYOA 3HRUA 4BGDA 4EGZA 1YFHA 2LR8A 5KNLA 2ZDGA 2OJED 2NOGA 1IN5A 1V5FA 2IS1A 3ZQHA 2MD5A 2VPSA 2X1EA 2V9KA 3BT9A 1N36H 3BJ6A 4FETA 4RB3C 4EFEA 4IKFA 3KYCB 4XLFA 4E7HA 5K5RA 3WTSC 3L2UA 3QZ7A 1M0WA 5K7HA 4IZOA 5EDWA 2OQGA 1Y1WG 4Q48A 4JI6H 2Q2EA 3AG3H 2EFWA 1GHCA 2R7ZA 4BACA 2P81A 4IJAA 5CA1F 2R7TA 3HPHA 3N6XA 2FJ1A 1B33N 4A2BA 4ESFA 3L7WA 3F23A 5BMVF 3LFKA 4UV9A 4A3BJ 4LSAA 4B8XA 4TQRA 1GGOA 1WH2A 4QWQA 5KFHA 4GLXA 4HX8A 4M3DA 4CYDA 1YRNA 1OJLA 1UNNC 2GA2A 1VFCA 4BDZA 2FUG2 1T2KA 3FK7A 1F5TA 3ECHA 1FT9A 3WNZA 4KDPA 3GO5A 5LEKA 2IA0A 4EM1A 2HQRA 2QSFX 1E0EA 5KG7A 3SQNA 1TW3A 3I55I 1FZPB 3KTMA 3HOUG 5KFYA 1GO3E 3SI8A 2MA3A 2E34A 1ZHSA 1ODDA 3EYIA 1D5YA 1EHIA 2AGQA 1DDNA 2K9SA 3M9MB 1KYZA 3K4JA 1BR4A 3I9V2 2OPTA 1Y14B 4UFZA 2HZTA 5DCMA 1NK2P 3LSTA 1DGSA 2HVSA 5J1RA 1GSAA 4MV1A 3ETHA 2NUAB 2FSWA 3KEYA 5CPRB 5LA6F 4A3KJ 4FE7A 3CTAA 4ZH4F 2MG4A 1U3EM 4MLOA 5HDNA 2UV1A 2XPVA 5D6EA 3U1KA 2EILH 3ONQA 2JA8G 1W7PD 4BE2A 2LREA 1KU2A 2DW4A 1KZHA 5DUIA 1PVEA 2BW3B 1VQNI 3B73A 2FQ4A 3PNYA 1IUYA 2DOAA 3FKIJ 3K4KA 1M1EB 4P9FA 4RAGA 1YI2I 2BQUA 1AUVA 1P2FA 1W5SA 4MQ9F 4DUYH 2R93A 4CICA 2DI3A 2NXNB 3F72A 5J1UA 4PDKA 3E7LA 2Y75A 4JBAA 1KQ9A 3ZMSA 4X64H 1YO5C 1IXSB 4ECZA 2PN1A 3TQ1A 4CUGA 1E4FT 1HDPA 1FIPA 3V8LA 5M3FJ 3MR5A 2VQLA 1TT0A 2DT6A 1WJ5A 2VJ5A 3COAC 3Q8RB 3GTGA 2O5RA 5FKNA 3VEPA 4AIJA 1WJAA 3FHNA 2MGQA 2MFZA 2IW5A 4UV8A 1JT0A 5FO5A 4PZJA 2M7BA 2CV2A 3VPCA 2IVMA 5JH7F 1RI7A 3F22A 3I53A 1GXQA 5DD8A 4JQFA 1I3QJ 4KITB 5BOXA 3PO2J 1WVRA 5IP7J 2FK1A 1WI9A 1IRGA 4IR9A 2XSDC 3PN1A 3BQ2A 1VQ4I 2NVQJ 4WCGA 5BPDA 1WPKA 2DT7B 2M4KA 1ZH5A 4LF5H 3LA2A 5KFKA 2F4MB 4BU2A 2BY0A 2OH2A 2R7ZG 1P4XA 1FOKA 5DUKA 1TAEA 4A69C 2TCTA 5J4VA 3WO1A 2W6ZA 5HS8A 3ZP5A 3L2WA 2Y0SN 3ABUA 2MC3A 2AGOA 2FA5A 5ILUA 3E5XA 3HBLA 1T33A 2IA2A 2P8TA 4MA5A 1XDSA 2Q2UA 4O3MA 1Z9CA 2KRFA 4EGYA 3JSOA 1QZZA 1A6IA 2E1MC 2E5NA 2W82A 3H92A 3LSGA 1F43A 4EG0A 2P7CB 3TQNA 3KHLA 3OL3A 2JEFA 3K4MA 2R7XA 3UQ8A 3I4MG 4BJ5C 4WK8F 4QWCA 3PO3G 1N77A 3HDDA 3EQLF 3JTGA 5DQHA 5E8GA 1B72A 3CESA 2XAUA 4JI8H 4EBCA 4R8HA 1YJ9I 2LH9A 4BYYA 3GTPA 2LK2A 2IGOA 1B6SA 3TP3A 1Y0UA 5F04A 1VQ9I 4FQGA 2COMA 2FOWA 4ECUA 3GFLA 2VPQA 1MBHA 1SVMA 3CQZJ 3R60A 3FK6A 4XKBA 3TW6A 5FPOA 1R6RA 2NU9B 4AQYH 4A3JG 1FEXA 3PW5A 2PMZE 3VMMA 1FC3A 2RQQA 3PIPF 2WY8Q 1L3LA 1EYZA 2FPGB 3H9QA 2JA7J 4V2FA 1ZARA 2JZYA 3VPRA 3WTZA 5F1RA 1GYFA 2H6BA 3TOBA 2JUGA 4U7CA 2M45A 3JSPA 3RB3A 2JQ7A 2WB1E 1OYIA 1T36A 1ZHQA 5D8KB 2F4IA 2C2DA 3OYCA 2DOFA 3QYEA 3O8HA 2KZVA 4II2A 2GZWA 3LWBA 2R93G 3AKZA 3G6YA 2ESNA 4IEJA 2DMTA 2PMUA 3HZJA 2Y31A 1ZTRA 4YFNF 5LLQA 3L2RA 5K7ZA 1HKSA 1LEAA 2OAZA 2IP4A 4A3GG 1UB9A 4HA8A 4KMUX 4P96A 1MGTA 1XMXA 5K7FA 4C2UA 4OINF 4L9JA 4D9JA 5J2UF 4W97A 3BQZA 3TKYA 4PJ0C 3K4LA 4XORA 1HBXG 4LH7A 3R6SA 2AQ4A 1YHQI 4ZYDA 1BC7C 4KMFA 3D5LA 1X3WB 4U88A 1QHHD 1B6AA 1Z0XA 5E20A 1H0MA 2C35B 5KHDA 2UZKA 4RA2A 1VTNC 1S7OA 2JRTA 3K69A 3OS0A 2E2JJ 2W1OA 3M7GA 4I76A 1WRJA 2HR3A 3S2DJ 3FKIG 2IPQX 4NXNH 4ECQA 3GTQJ 1FNNA 1LVAA 1NG7A 4M6YA 1PK8A 1O57A 4C30A 1R5ID 1YS6A 4IL6C 4IZZA 2LSOA 2K85A 1ZG5A 4C2TA 4YFXF 4U7BA 1Z77A 2L7MP 4F52A 5K2MA 1F1ZA 5D4SA 3GMEA 4NB5A 4DZPA 5GAEJ 2MW8A 4YELA 4XOTA 4ZYEA 4A3MJ 1UELB 1FSEA 2RAEA 3K6GA 1XSXA 3K4CA 1HXDA 3FMSA 2E5ZA 2HVQA 2VUMA 2OTLI 1D0XA 1MMGA 2NU6B 2XKPA 4IX7A 3FXRA 3I12A 4M3FA 1MDMA 4RS8A 2VQEH 4I01A 3REOA 1XG1A 3T8RA 4DYCA 1VQPI 3GIQA 5EOYA 4O3SA 2UXDH 2UXCH 4A5MA 1TZLA 3JRAA 3RIZA 5B5EC 3AL0C 2VONA 4BHBA 2JVGA 2NVYJ 1KU3A 2VASA 3PSFA 3L9FA 5E79C 1ZK8A 1Y39A 1EZ1A 3WHCA 4RDUA 3NEUA 4E7KA 3K5IA 1WJBA 2FE3A 3J80K 2QWWA 2Y0MA 3VYRB 4J9MA 3M4OJ 3TQTA 4ECYA 1HQCA 3PQKA 4KIBA 4RGSA 1R49A 5FLXK 3C0FB 5AONA 1MSEC 2J6SA 2R85A 4N0BA 4HYEA 4X66H 2ZXIA 4DBRA 2RV8A 3AG2H 3CCEI 5HBRB 3FM5A 2P0WA 4EV0A 1BJTA 1JTYA 4IHVA 5HLHA 5LGTA 5IP9J 1TQMA 1MJBA 5LGNA 2PVPA 5FD5A 2IA6A 2NS8A 3I4NJ 3UFXB 4U6PA 3CJTB 5CQGA 3KHGA 1OCCH 1TWGJ 4NC7A 4L1KA 3ESWB 1IW7F 1TWAA 1XDNA 3ETJA 1KJIA 2XCAA 1OYYA 2C28A 1TL8A 1WJDA 5DM7F 2VQHA 5LXTF 2PX9A 2PBZA 2UVRA 5F0FA 1IUFA 4M3BA 2KZGA 3RV3A 3HM5A 1ZRFA 3GW2A 4WWCA 1I6HJ 1KJ8A 2OF7A 1FJLA 5JFRA 1BJAA 1S68A 2XRLA 2W24A 2DAOA 3GTOA 1A5JA 5KT6A 4BUPA 1HW1A 2FRHA 2OU2A 2EFPA 1YJWI 1FYMA 1FP1D 5KFVA 1I5ZA 4JV1A 2BW3A 2OC6A 2P0AA 3NARA 1EA3A 3GWZA 4RAZA 5GPCA 4IPAA 3SDGA 2DPDA 2VB6A 3GIKA 2CS3A 2XC9A 2E1NA 1UG2A 2LY1A 5CVRA 2A6TA 4F4YA 1X19A 3BAAA 2R7QA 4DR6H 2ZFWA 5CVJA 3WGHA 5L3BA 3C2GA 1KQ0A 1H89C 4JP0A 3R4KA 5FKMA 3OYBA 4EEYA 2R87A 4ECWA 2OWOA 3PW4A 4XYMB 4M71A 1JKQC 3EPGA 4A3DJ 4DV0H 2P7VB 1TT5B 5KFWA 1U78A 2R6FA 4E6KG 2FPPB 2VA3A 3LFUA 5FD6A 5ICGA 1UC9A 3H0GJ 2KJCA 1UC8A 1POGA 1EUDB 2QYZA 3S2WA 5IYDJ 3SEZA 2VUMG 1QNTA 1X2NA 3NWSA 5GP9A 4AYBA 3EPZA 4LFCH 2SCUB 5EYRA 1OCPA 2H1KA 2ID3A 4U87A 3ABMH 3S32A 2AXTC 1HDDC 3M07A 1QU3A 2IS2A 2KDOA 4XN0A 2CU7A 4F7ZA 5CAEB 4F4ZA 3IV5A 4FS1A 2EA2A 4OIOF 1G2HA 4NC8A 4U0VA 1BA5A 3OYMA 4YRVA 1YJNI 2O6GE 5J3LA 4JUZA 1LNWA 2BHZA 5DG9A 3U21A 2E35A 4GDFA 4A93J 4FASD 3HTSB 5D5VB 1I7LA 3J7AK 3GFMA 5E1XA 1TWHA 3L2QA 2VL8A 3PNVA 5LBQA 2P4WA 2V58A 2VUGA 1S0OA 2OD5A 4R7RA 2M87A 1DGRM 1Z3YA 2UVWA 1RC9A 4AC0A 4ESBA 3J81Z 3MD2A 4RMNA 3E1SA 2VPRA 4NLGA 3O2PE 1XSDA 2D1HA 4HF1A 2FBKA 4UCTA 4GRIA 2W7PA 5L1LA 2NRAC 1YOVB 1IV6A 2RDJA 2M4GA 2W9AA 4CYCB 5TRDA 3RAQA 1YG2A 3BROA 1N34H 3QPHA 3JCUC 1XCBA 1B04A 3GTJA 2DWCA 1WFXA 1P4AA 2HGCA 1ZQ7A 4L5IA 1MH3A 3BQ0A 2HJWA 5EG0B 3NAUA 4RNNA 1ZAOA 5JR3A 5KFJA 1LDJA 1HSJA 2VXDA 3BJYA 3HOXG 1A35A 1KBLA 2ZNYA 3CMYA 2HDDA 4NQWB 1RKWA 1KJ9A 1MMAA 2QQ8A 4HNTA 3V6HA 1IOVA 2KT0A 4B3MH 2KP6A 1J09A 1WJCA 1T56A 1X1BA 3LQRA 4EJTA 1Y1VJ 5HNHA 2R7DA 3JRIA 3S16J 4GYIA 2XGQA 4MQVA 4XR6A 3BG3A 1MMNA 3CCYA 3MR2A 4OMYA 2IS6A 1WHUA 2CO5A 3T0YA 5C5JA 4YFKF 1CGPA 4PSXA 1GLNA 4R1HA 2R7SA 2EFNA 4IRIA 2WE6A 2LBFB 3UR3C 5HVQC 1QPMA 2MH9A 1T08B 4ZC3A 5IP9G 3MFHA 3E5QA 2CJJA 3H9JA 3AG1H 3CJNA 2CFOA 2GAUA 3CJQB 2PN6A 3J80Z 3TBIA 4QPOA 4DGWB 1F36A 3E6BA 4F93B 3OYEA 2KMUA 1GT0C 2DYSH 3QFFA 1XMKA 4HZFA 4JI4H 1P7JA 3OSFA 3S3MA 2AS5F 3B6AA 3BTCA 1D0ZA 3H1CA 2ZB9A 4WF2A 4XKVA 3ROUA 4D0PA 1ON2A 1F9NA 2VKVA 1K4TA 4IHJF 1W93A 1WH5A 4L9VA 2DCEA 1B4AA 4C9YA 5JQWA 4HF0A 3KAJA 4PJMA 5KFUA 4N4NB 3RPUA 3U9GA 3KX2A 4CH7A 3BDDA 3R0AA 2K3PA 4O2BF 2FKLA 4JV2A 2PFBA 3GBGA 1XCVA 4AIDA 4EBDA 2AHQA 1M6VA 1Z2OX 5FKOA 1DU0A 1DV1A 2WB1A 1FBSA 2BXZA 3BR1A 5LHGA 3T5XA 4FCYA 2K86A 3FXLA 1IAWA 2V6EA 1O7FA 4GKJH 1SVLA 2ZDQA 4ANJA 3QZ8A 3I0TA 2OUMA 1ETQA 3GIPA 3QOPA 3BCBA 2W6QA 4RB1A 3BR2A 4RLFA 5LL6b 3ECOA 3F0CA 3KLNA 3IP4B 1R71A 3RZDJ 2V5AA 2ME6A 1GDTA 3G6EI 3DLAA 2BQ3A 3LOCA 2M1BA 2EFQA 6PAXA 3KALA 2XASA 5KFZA 4A3DG 1ZR2A 3NWTA 2ALZA 3HGGA 4J9SA 4L9NA 3HEFA 3IH4A 4BAYA 3BY6A 4HX7A 4CHUA 2XD4A 1V5GA 4KIGA 3A01B 3RBDA 3WHBA 3PJRA 3V8JA 3K4BA 5D8LB 5EF6A 1IN4A 1VQLI 3OIQA 3G73A 1J5EH 2LKPA 4KNYA 3Q2OA 3WE3A 1CQTA 3H3VK 4HQEA 4PDBA 4HG2A 3LAJA 1UFMA 3BG7A 1DV2A 4AIHA 4F50A 3LA7A 2XAQA 1X4OA 1MSFC 1ORKA 2XGXA 2E2IJ 2B63A 5IT3A 1HKQA 1UG0A 1MMDA 2DK5A 2STWA 3RAXA 2JEJA 4A93G 3VWBA 3SHFA 1CF7B 1REPC 3OR1C 3P9IA 2I8DA 5A2QW 3V42A 2A5WA 3C18A 3K3PA 2CQNA 3BJAA 3GIDA 3KHRA 4YJ3F 4IRDA 4UVCA 2V1NA 4OOIA 5EJCA 4RBOA 4PCQA 3JAMZ 3L4KA 2CQQA 1QZEA 2L01A 1KU9A 1RETA 3HOUJ 2FQ3A 2A69F 3ORRA 3VODA 1SD7A 5BPIA 1HNWH 5F6FA 5D5XB 5B66C 2DTRA 2YRWA 4DV5H 3LSIA 4YP3A 2M2EA 1FBQA 3Q1KA 2LP0A 3FXOA 5KG3A 2XF7A 1YYVA 2FK2A 2M8GX 4ZHQF 2G9WA 1AN7A 3JRHA 4HSTA 3BG6A 2X85A 2JA8J 1TNSA 1JLLB 4HQMA 1IRXA 2L02A 4G7HF 2G7HA 2NVXA 1R4MB 3PUBA 5FROA 2BZTA 3HXLA 2ELHA 4XLEA 3IG0A 5DV5A 1Y1VG 1S0NA 2YZNA 4LFBH 4XOPA 4M9XA 1X4PA 1ETYA 4EGJA 2QGUA 2Z1DA 2L7FP 3CCVI 1RIOH 3SDBA 3TEDA 3E0JB 4YAKB 4JX6A 4EJOA 5F08A 1ETXA 2LF8A 1TWFJ 2HYJA 2PMZN 3OY9A 2HQAA 3VOEA 2OTJI 1MH4A 5IY5H 2VBYA 1BOAA 5JLXA 4A3FJ 3V6JA 1V5EA 3GFJA 3K7AJ 5C8YF 1USSA 1LJ9A 4ENNA 3CF5F 3V7SA 3LAPA 4LFAH 2AO9A 4MFEA 2DA2A 2V6CA 2XCPA 2O8XA 3V6KA 4LF9H 1VI0A 2K9QA 4GGGA 5FFXA 3JRDA 3PW0A 1MNDA 4KT5C 4ZI7F 3KP6A 3QWLA 5CVVA 3A1YA 3EYYA 2OZUA 4A6DA 3I56I 5GTHC 3G6VA 4DV3H 1PP8F 3GEZA 1J7KA 4J9OA 4DUZH 1HA8A 2DPIA 1IV8A 3IUOA 4Y3OA 1D8JA 1B59A 4B43A 5LFAA 4IHYA 5D8DA 2R4GA 2D2WA 2R7ZJ 1TA8A 4C5CA 3H36A 4BQQA 5A2QK 1PP7U 1FYKA 4ED8A 3BTIA 4AIKA 1G59A 2DO7A 3D1NI 3TMOA 4Q8FA 3CLQA 2L9RA 2X6WA 1SAXA 1BI1A 3G1LA 3BG5A 3I54A 5EWFA 5H80A 4IF4A 2PBIA 4BEHA 5HODA 4CCNA 4JYKA 4CZZA 4C3JJ 1O7LA 4A3EG 2VOBA 5C44J 3F21A 1Z6TA 3SE7A 2CUFA 3I4MJ 2ISYA 1I50A 2WTEA 2VJIA 2V9VA 1V54H 2OV7A 3PO3J 4LLLA 5DM6F 3CP2A 3MMYB 1ACIA 1KGSA 1OLTA 4OWRB 4F3QA 2FOKA 3CUOA 4GFBA 1IO2A 1ZHFA 2N8GA 1JGGA 2DPUA 4BBRG 4IRKA 3MEXA 4O4HF 2V7FA 2Y0SA 3TINA 3F3XA 2DIKA 2QK4A 3M4IA 1S7AA 4L18B 3ZCOA 1H9TA 4J01A 3CUQB 1G3WA 2R92A 4EFBA 1YITI 1IN6A 3MFIA 3W6KB 2FMLA 1E3OC 3HSEA 4A3JJ 5EG0A 3GTMJ 1H88C 5HDGA 2HQNA 4J19A 1E4GT 1HNXH 5KG6A 4UVAA 3CVZA 4NQWA 4HDVA 1TC3C 5F9NA 3U9TA 2YU9J 5JHUA 4BHCA 1FPQA 2IGMA 1XGOA 1BI2A 3ZQLA 3DCFA 2JMWA 3BJOA 3OYIA 1IG7A 3PW2A 1XGSA 3D5RC 3WODF 1I94H 2R7NA 3H0DA 4DL6A 2W7NA 2UU9H 1L0OC 4FU0A 3BWGA 3LSJA 2STTA 1KJJA 3CCRI 5HV6A 2ZNZA 2HKXA 2HOAA 5J6XA 2R93J 1N48A 4B3SH 3PR4A 2ASDA 2EZLA 2DN0A 3FISA 1WKMA 1I1GA 1XB4A 2DOEA 2LBFA 4CCOA 1NHAA 2VQGA 1EH8A 2WWYA 4A3GJ 5LHHA 1MMSA 5GONF 3LSKA 5L9XA 3M8EA 4BXUA 4EEQA 3GTGJ 3PNTA 2GA1A 4HNVA 3HOYG 1S8NA 3IRQA 2YR2A 5F64A 2F48A 1I1SA 4FHTA 2VA2A 2ID6A 3KLOA 2PJRB 4LH6A 5D1OA 2ZBKA 1VAJA 3QPLA 3ZMVA 1R1VA 3R61A 2IP2A 3H5AA 2KIQA 4DR7H 3ZR8X 2QBYB 4XSZF 4C3IJ 3HL2A 5H6QA 1OWTA 3O8GA 2ELKA 5KT3A 2GXBA 4E7JA 2O61A 1PUEE 1Z91A 5GPAA 3TOAA 1N56A 3GTKA 1VQOI 3KIOA 2NS7A 2VIXA 1EUCB 2NVUB 2ZMEB 3PUFA 3K1PA 2M3AA 3LP8A 4JV0A 2DFFA 1Y8RB 2RDIA 3LL7A 4ED1A 4EM2A 4HRIA 4A3FG 4KT6A 3HHGA 4M9SA 2VT3A 1X58A 3DV8A 5IP6A 4E7LA 2CG4A 4M3GA 3F8FA 2R8KA 1XDUA 2VBZA 1XSVA 3RSNA 3W6JB 2YS9A 1DUXC 3WTWC 5AIQA 5E18F 2BVMA 4MEXF 1ERDA 1O75A 3DU6A 4R8UB 5LP6F 2NU7B 2ELJA 3DKWA 2JA2A 1OKRA 5HLTA 2IGKA 2Q2TA 3QU6A 4XKCA 1CS0A 1BN5A 3FM3A 3W2AA 2JPBA 5J8FA 3IRRA 1RZ4A 1UCRA 3LA3A 3N4MA 5KFQA 4L5EA 3JRCA 1X3ZB 3K10A 2P6TA 3A01A 5J40A 5IYBG 4J9RA 3GTPJ 1H8AC 4E4TA 1BW5A 3L1PA 3MKZA 1K79A 4ME6A 3HB9A 2HYFA 4RGUA 5F0CA 3N43B 1FOYA 2R92G 3TP0A 3I3LA 3BZ6A 4HYKA 2YCHA 2HXOA 1IXCA 5FKKA 1W0TA 3E5NA 5DGBA 4K2EA 4RB0A 4XBFA 3A0HC 4G9YA 5D5WB 5JVTA 4N9HA 1I39A 1Y0NA 1CF7A 2GPSA 1U9OA 2KHMA 3RYPA 1D1BA 3FXMA 4UY8I 3H5RA 4YB8B 1QHGA 3OV8A 3J81W 1B8IB 4BL0B 1UJ8A 3MWEA 2XDVA 2VJJA 1Y56A 4M7EA 2DFEA 3GX4X 1NH3A 2F4VH 2O7OA 2WV0A 1K6OA 5L3CA 5DG8A 1SFKA 3MN2A 1VQMI 3KYLA 1OYWA 1FWZA 5IT9Z 2F6CA 3A2KA 5LYJF 2C2EA 4G3IA 2QQBA 2R7FA 4X6AJ 1FYLA 5JHFA 2W6MA 3Q0VA 3CO7C 1ZKGA 3TW7A 1IC8A 1P92A 4AD9A 2J9GA 2GIZA 5E3OA 1LDKB 1ETWA 4XMYA 4CCKA 5B1BH 4CZCA 3HOSA 4DL4A 3PVXA 1ITYA 2HU9A 2DA5A 4FS2A 1SMYF 4FT8A 3W2WA 3VPDA 3KZZA 1IDYA 3LMMA 4ZYGA 4G12A 2O3FA 2R7LA 2YZMA 4OIPF 3BQYA 1U5TB 1S29A 2ME0A 3ZQFA 2PMHA 4IQJA 3X2QH 4MFDA 2X9DA 3F6VA 2EB7A 5JVGF 2KIMA 5LD2C 1J2XA 4LOCA 2OA4A 1QRYA 2KJBA 2YS6A 4OX9H 5BPFA 1VF9A 4HX4A 4IRCA 2VXZA 4H0EA 1QVUA 2GXAA 4RGXA 2DTZA 3ORQA 5DLGA 2VBXA 1GVDA 1VQ8I 4J9PA 3OUUA 5ERIA 2G0EA 3E97A 3U9SA 4JI7H 3OS1A 2VUMJ 3ZMDA 2DDAA 3G1MA 1SANA 4RZQA 1W7PA 4PGHA 3RJ0A 4Q44A 4IWYA 1SFOJ 2R0QC 1ZRCA 4EBEA 2P6SA 3S17J 1WH7A 1O3QA 1Z2NX 4Q5SF 1D8KA 3W2VA 4G7ZF 3RFCA 2HTSA 2YYAA 1G3YA 5ED4A 2FNAA 3CP8A 1XMAA 1UHSA 3ZQQA 2W9BB 2XCLA 4FX0A 1ZR4A 2PJPA 1OQYA 2NS0A 3VDXA 4YJ2F 1FJGH 3HPGA 3CCQI 2CV1A 3QOEA 2K02A 3RTXA 2CWEA 4Q47A 4PJLA 4RAFA 3ZXSA 3JZIA 4MAMA 4HOBA 4IR1A 3QU3A 2YL2A 1MJAA 3DBHB 2F5VA 1W0UA 4AVZA 2VE9A 4II3A 4C2MJ 4YBZB 5JVDF 4M72A 4XKWA 1YTYA 3I64A 5KFMA 2IBDA 3JR9A 2LOOA 2YRXA 2X48A 2VN2A 4KHPH 3G71I 2WA0A 3OUZA 2JVHA 3K70D 1I6XA 2FXAA 4DL5A 3VSLA 1Z05A 2QZ8A 4G8XA 4NC6A 2JA6A 3GV8B 3T5KA 2A6EF 2VKHA 3HOXJ 1TWAJ 2KDZA 1S0MA 2W84A 4IXAA 3GXOA 4A3IG 4E7SA 2RGVA 4YEJA 1ONVA 4LG3A 3KAKA 2GQQA 5DQGA 2XC7A 2R84A 3CUQA 4OIRF 1P9QC 1M0TA 2UUCH 2KRCA 2UXXA 4MV6A 4WXHA 1YE9A 1W36C 4J9NA 4DR4H 2X6XA 1SFUA 1RESA 3PR5B 5KG5A 2JSCA 1SVOA 2AQEA 2E19A 4B09A 4RNOA 2M30A 4X62H 3V4SA 4DR5H 3RF2A 3GTOJ 4GXOA 4YIRX 3BTJA 4GKKH 3K1NA 4KICA 5D6FA 1XS9A 3GTLA 2W25A 1K1QA 2XB0X 1MNMC 1S7EA 2LRDA 5KFLA 4FBUA 4BY7G 2J5PA 2FD5A 3A0BC 3BPVA 3GZNB 2KFDA 3RKWA 5CA0F 4BNCA 2LY9A 1S97A 2JWTA 2I80A 2LC2A 5DLFA 1HOMA 4V2GA 5CLSA 3BLYA 1BBYA 2BGCA 3FDSA 3Q9VA 2V59A 4GYGA 5E1WA 3GLXA 1AUXA 1V51A 1KU7A 4QWEA 4X1EA 2AGPA 2QKMB 1NTCA 1QGPA 1JHFA 2OCCH 5F0HA 1BJZA 3OYAA 3P5JA 4LLGF 4LB5A 2UXNA 2UUBH 3M9NB 3I59B 3W3CA 2HVRA 1R5HA 1FVIA 3C2BA 1JDBB 4KA4A 1VNDA 2VE8A 3VYSB 1CQIB 3C1DA 4D7MA 2PJRA 2DZDA 4EGQA 1G6NA 2DMUA 3ABTA 4XLAA 2EINH 5IOZA 2F5DA 4JI0H 1J5YA 1MBJA 1XTAA 2ZKZA 1AWCA 2AU0A 1WGXA 3K4NA 3BA9A 1Z21A 1FY7A 1WCMA 5T14A 4Y52J 1D0YA 4U0WA 3H3VH 1A6QA 3BA8A 4RGRA 2ZSIB 1GLVA 2ZMEA 2FEZA 1ETKA 1SFEA 1ULYA 2V26A 3BOQA 1W5TA 2Z5UA 3R0JA 3SFZA 4BJTA 2CQXA 2ZCWA 1AKHB 2DXIA 1TWHJ 2ZJTA 1ON1A 1JKRC 4XRSA 4HV5A 5KFGA 3G3ZA 5KFBA 2WV1A 1K78B 4O3QA 2ADUA 2V79A 4O3RA 5KCMA 1DU6A 1U6GA 3S14J 4RUCA 2UWMA 2HXIA 1V9PA 2KLOA 5KT7A 1D5VA 1J9IA 1N33H 1CE8A 2JN6A 2W57A 2L5QA 4ENJA 1JUPA 2VJ4A 2UXBH 3OYFA 2ZXHA 3HKZE 4TUYF 2K4BA 4ITVA 4R8UA 2JK3A 5KAIC 2E60A 4O3NA 3ML6A 1G3TA 4G6TB 3MAJA 3MQ0A 1IGNA 5EEGA 3GTJJ 3CMAI 2IS4A 3HYIA 5HDKA 3PM1A 3OS2A 2JA6G 2ECBA 4MTDA 1N78A 4WXCA 2C6YA 1S9HA 3DWLE 4I50F 3MWMA 1RNLA 1I6UA 1IBLH 3A02A 3KZYA 1DP3A 1PUFB 1PYVA 3A4CA 3CF2A 2M8EA 4FISA 2ETHA 4QW9A 3OYGA 1FSHA 2XF5A 4I0BA 4XN3A 4DYQA 3DF7A 1JJ8C 3MCZA 2E1MB 3FKJA 1TWCA 4PWQA 2A6HF 1R9TA 1Z3XA 2XKOA 4WXDA 1IBKH 1Q1VA 2OLSA 1O3TA 1M7JA 2CFXA 4UB8C 4KISA 2ACJA 4ETSA 1BL0A 2YPRA 1SEIA 2E1OA 5KFXA 1B8IA 4LB6B 2R7KA 4LK1F 3IAS2 4P55A 3LSRA 2ZDHA 2X0SA 4BJ6C 2Q1ZB 3M1EA 3S8PA 4JI2H 1FP2A 1T8IA 3AG4H 1WI3A 5KFOA 3RQ4A 2F4OB 1JT6A 2WAQE 3ZOBA 2EH3A 4O4LF 2PQ8A 3BZCA 2DA3A 3DXJF 1O3SA 3ZMZA 4NBQA 5DQIA 4LF4H 2MCTA 3EUKL 2C00A 3FXJA 1RK5A 3CJRB 2JUCA 4ZDLA 4EQQA 4IO9F 4K0KH 1W5CC 3C7JA 2VQFH 3E6DA 1P7IA 4I55F 3E6MA 2A07F 2DODA 2HDCA 4F4XA 1JHHA 2CQ7A 3KFWX 2HYGD 2EZKA 3F6OA 4CA0A 4WX9A 2HOTA 2Y30A 1U5TA 4Q8EA 3N40P 3KP5A 4APMA 4L9TA 1JXLA 3LSHA 1YIOA 1WCMG 3EUAA 4Z2YA 2R7UA 1FX7A 2QM3A 2MBFA 2WAFA 2CV0A 4ZYHA 5DTDA 5E17F 3WTUC 3WO0A 2R7WA 3O6BB 2CKZB 4F4WA 5FLXZ 5C1OA 2RQPA 4EMSA 3M3YJ 2LF7A 4ESJA 5J47A 1OFCX 2XIGA 1UZCA 3CMMA 4O5VA 3WE2A 4ASNA 3WGGA 3CCSI 1T38A 3J7AY 3TIIA 4H4KC 3M1CA 5M5XJ 4XRMA 2Z9OA 4HBLA 3OHBA 4DR1H 2EBIA 2EZHA 2UVVA 1ZETA 1QQIA 2DLLA 3ASOH 4BY1G 1H9GA 2MABA 5HS7A 3OYHA 1WQ2A 2TDXA 1S6LA 3B02A 2PMZA 1O4XA 2H09A 2X4HA 2RVCA 2OCEA 2L9SA 2RDPA 1JGSA 4E7IA 4JX5A 2W8LA 5F9LA 1HLVA 3Q8PB 3EUHA 5EZYF 2EFOA 1A36A 1DPRA 4ECSA 3CDIA 4IOCF 1R22A 3F8CA 4BBSG 4ED7A 3RDIA 4F92B 2CYYA 3PSIA 1K1SA 3V8KA 2IAIA 2IT0A 4B1RA 3FWEA 1YIJI 4S04A 1W1WE 4DL2A 3L2VA 1R1UA 5CVIA 2W9BA 2XUBA 4A3EJ 2X0LA 3MZ8A 5LHIA 4F91B 2B63J 3JW4A 1VBHA 2FBIA 1MBEA 4Y17A 3G8CA 3IKVA 3OR2C 2EA4A 4JYAH 2XHKA 4DBQA 2XB5A 2RN7A 5HNFA 4I6ZA 4O3OA 2BQRA 4J00A 2CW7A 2RNGA 3S1RJ 1ZREA 5LMNH 1FMWA 4DW6A 3DPUA 1Z2PX 2VR1A 2Q0OA 4BBRJ 2QSGX 2XROA 2YUSA 2ZSHB 1TBXA 4A12A 4P1WA 2Z33A 2XGDA 3FBNB 2COBA 4YAJB 2EIKH 1LKXA 4F55A 2E2HA 3AL0B 3N8DA 3L00A 1VS0A 2GM4A 5KFAA 1YQAA 4XK4A 3G6XA 1X1DA 5BQTA 4OIQF 1QPIA 1KEEA 4ON0A 2ATLA 1SC7A 4ZDOA 3GQCA 3DTIA 3FBIB 3DBLB 2EJRA 4WD3A 2L9NA 1KYWA 1DQUA 1QZYA 4BQOA 5JI6A 4CC5A 3A03A 1LE8B 4GO1A 4Z6YA 1R00A 3ZN1A 4MV7A 2NVXJ 2H6CA 4PFPA 3S2HJ 2XAHA 1ZN2A 5F1JA 1XNQH 3H4BA 3FHZA 1Y8QB 4DOZA 5J2TF 2M0CA 1N32H 3N44B 2QENA 5KKNB 4DYRA 2GOMA 1U2WA 2H1LA 4X0GA 1ETOA 4DV1H 3DF8A 3DLLF 3CDLA 3MZYA 5C3EG 4EJUA 3AAFA 1LFPA 3RKQA 4DLKA 1BC8C 4RM2A 2I8CA 5KG2A 2FNPA 4ECTA 1XNRH 2EV6A 1DP7P 4FE4A 3HOYJ 1FLIA 1C3OA 1GSHA 4Q45A 2IJLA 2W00A 4XLCA 5FFZA 2XAJA 3VPBA 2JEGA 4UCOA 3S15J 1Q1HA 2R5ZB 1XMQH 2MH2A 4QPQA 2B9SA 5KG1A 1Z7LA 1DPUA 1BOBA 2NOJB 4MIMA 2K9NA 3MKYB 4J9LA 2R8IA 2HHHH 3WU2C 4MEYF 5K5QA 3PW7A 1Y1WA 2D5VA 4BXXG 3I59A 4HLXA 4I7HA 5M3MJ 4HLYA 4AWXB 3CC2I 4I09A 1IN7A 1BIAA 4XNFA 1HKTA 4M73A 4L0YB 9ANTA 5GTIC 2KL4A 5M5YJ 2XSJC 2FJZA 5FGMA 1FIAA 2XVCA 3FX3A 4EJVA 1S03G 3BG9A 1C30A 4X65H 2VPLA 2BVLA 2ICWG 1LEBA 2Y9YA 1JKPC 2DDBA 2VBWA 3HOVG 3RGZA 2CW0F 5E1ZB 3IL2A 1JJ6C 4ZTFA 1Z7UA 4RNMA 3BC8A 2VOPA 1XMOH 1UHMA 2EWNA 3C2HA 4A3CG 3E3VA 1PDNC 4A3LJ 3RBEA 1SAUA 5ILSA 1JUMA 1BM9A 1U0JA 1RJQA 2W6OA 4GC6A 3LQQA 1ZQ3P 2JTVA 1AKHA 3FXQA 1YLFA 1P6RA 3IKTA 1WJEA 3DEWA 3QODA 2E7WA 3RPQA 1BNCA 4M6XA 2J5OA 3Q9SA 3SXYA 1V3FA 1A04A 3TO7A 4C3HJ 1I50J 1K78A 2QUFA 4CCLA 5DYMA 2UUAH 4Y15A 4Y4RA 1YW7A 4EYHB 2WYOA 4QWAA 3JRFA 1XGMA 2JT1A 2NU8B 5EGOB 1X1AA 3CCJI 4IOAF 4XX0B 1BW6A 3RB4A 5HS9A 1JDEA 3HJEA 5IYBJ 3FMAA 4LSXA 2V9PA 3H35A 2X6OA 4Y8VB 3RUPA 4N4OB 4YR2A 2JSPA 2DU9A 2O03A 4XQFA 1P4WA 1NK3P 5CQEA 4RAYA 3J7ZI 3L09A 2R92J 5D1PA 4AUXA 3RJPA 3W6VA 4Y7NJ 4ED6A 3FXUA 5HOOA 4BQAA 5KVRA 2FB9A 4HPQA 3G4SI 4EJWA 5KG4A 3RV4A 3H3ZA 5JUMA 5L3GA 3MKWB 1EH7A 2DMNA 2IGNA 1JXSA 3UNGC 3OSGA 1ETVA 1X1PA 1RK6A 2B63G 1Z67A 1XC5A 2KIFA 2KPMA 3EUHC 3V4GA 3KETA 1PUFA 4BHPA 2XGEA 2I5UA 3F8MA 3R5FA 4ZJZA 1JKOC 4JI1H 4ENKA 1R4NB 3UKGA 2R86A 1QO0D 2RGRA 3OIOA 2PG4A 1HW5A 5L1JA 2GLTA 3QPTA 2JRMA 1TP4A 4FM9A 1OR7A 3EDPA 4IRGA 5E3NA 5DG7A 4QLCU 1K7AA 1K83A 4NXMH 4CYCA 2NNNA 4LG0B 1EJ9A 3HOWG 2DYRH 1VZ0A 2Z16A 3SZTA 2W71A 3GV7B 2V1DA 5HLIA 5IPAA 3I5UA 4OMZA 3TO9A 2GIVA 3AYHB 2XPWA 3ZQCA 2ZO4A 1MDMB 1E17A 4YR3A 2L0KA 1X3UA 1Z6RA 3FMQA 1GUUA 4PK4A 1MZBA 4HSRA 4GC7A 4S0HB 4BDYA 2JA5A 2A05A 3DBRB 2XV4S 3TO6A 5C4JJ 5CYVA
chains in the Genus database with same CATH topology
1P8LA 2W85A 1V4RA 3BABA 3GFIA 2HS5A 3SZPA 3KP4A 1A0IA 2LDUA 3DEUA 3RGXA 4ENMA 5LMUH 4KUMA 1USTA 2P5LC 4YIFA 1B1BA 5J8CA 1IN8A 4UUVA 2G7UA 3KP3A 4I02A 3GZ5A 4CO8A 1AOYA 1ZLJA 1MD0A 3WU1B 3WTVC 4KYWA 1LB2A 4LK0F 3J7AO 1YW8A 4EVIA 4DV4H 3KP7A 2NNYA 2CW8A 1JE8A 1LDDA 4KFCA 1SD6A 5H6RA 1BI3A 4P9UA 2XAGA 1W4MA 1T6SA 1IBMH 3BPXA 2ESHA 1C0WA 3K2ZA 2ZJ2A 3GZ6A 5ICFA 2P5KA 3RI4A 2VC0A 3HRTA 3K9TA 4G6QA 3M8FA 3FMRA 2H94A 1IXRC 1HW2A 3DQVC 5LRSA 1SYXB 2VOOA 1SMTA 3V7CA 4DR3H 1WWXA 2PI0A 3WTYC 5CJ9A 3F8NA 5BMZA 1TQPA 4ZZLA 2F5CA 2K27A 4DNCA 2JPCA 1J0RA 3QP6A 3Q5FA 4FX4A 4XLNF 3N97A 4HV6A 4CC6A 2L3DA 3KCCA 2YU3A 5H20A 2FMYA 1ZRDA 1GVJA 2AXLA 2HGSA 4I0AA 4R79A 5FPRA 4YIIA 5L3EA 4MGRA 2V1UA 5A2QZ 3FZVA 3RKYA 4DR2H 3RTRA 2R3SA 2L4MA 2YX7A 2FF4A 4L0ZB 3C3WA 1ZYRF 2V1XA 3RYRA 4A0YA 3ZQ7A 4DV7H 3WG9A 1RUOA 4BWSC 4Q4ZF 3CO6C 3GF2A 2NAZA 2VODA 4DV6H 4YY3H 1RUNA 4OU0A 2E1CA 4G94A 1R23A 2DT5A 3J80W 4HF2A 5FLXW 1ZGAA 2A5YB 3HHHA 3I4PA 1UHWA 2EK5A 3TDUC 3QRFF 2BEOA 1LQ1A 1TTYA 3ELKA 3LWFA 2CQKA 2HEOA 1R5GA 3IWZA 4IVNA 1MKMA 1XD7A 4XLPF 4XSXF 2A3SA 3NRVA 3J81K 1T98A 2QVOA 2H27A 1R58A 3E6CC 1I27A 3D0SA 1TW2A 1EH6A 4Q0YA 3I71A 3KEQA 3MZHA 3VFZA 2DQLA 3RIRA 4U0YA 2KSWA 2HKOA 3H3UA 1OMIA 2LNBA 5EEHA 2VT2A 2BV6A 4LG0A 3L4JA 2MLGA 3JTHA 1TLHB 4O6JA 1IF1A 3WTTC 4LGWA 3KEOA 2EV5A 1T0FA 4DV2H 3ZMUA 3IHUA 4UXNA 4IHSA 4LFUA 5D4RA 1SFXA 3PFIA 3NQOA 2NYXA 4GCVA 2BYVE 2DK8A 1BIBA 4YG2F 3T8TA 1J59A 3T1YH 3JAMW 1YS7A 1IRFA 4LLNA 3P9KA 1G3SA 1XN7A 5KK1A 2MLKA 4JI5H 2F5FA 2OZ6A 1TNTA 1D3YA 5DD4A 5D5UB 2QQ9A 4RB2C 1KQ8A 2QBYA 1GXPA 4UVBA 3WTXC 5FB2A 4PGGA 3WU0A 4A0ZA 5AIPA 4MHGA 4DQ2A 2P5VA 3I58A 3ISPA 3HSRA 1B9NA 3V7RA 5E8IA 1ZGJA 3KP2A 3EETA 4JV5H 2RC4A 4UCSA 4M74A 4A2AA 4L5JA 3IC7A 3GYHX 2O0YA 3OOPA 3U1DA 3ZMTA 2ZXJA 1WSUA 1S3JA 3KE2A 3VB2A 2XAFA 4ZZDA 3JSLA 5ICEA 2WC2A 4A0XA 3DFGA 3TGNA 1FKAH 3L2CA 1R1TA 2OBPA 5LGUA 3JAMK 1ZG3A 4S05A 4MV9A 2GXGA 2PEXA 4LMYA 3N41B 2VC1A 4J0MA 5DEQA 1O3RA 2HTJA 2A61A 2IA1A 3DPTA 2FBHA 4MNUA 3HRMA 3LMLA 2WDTA 2E7XA 2RNJA 2HFHA 1SD5A 1XGNA 4CXFA 1KA8A 1R7JA 2B0LA 1EV7A 4I98B 5L3FA 4XRFA 1BGWA 1B9MA 3CUQC 3O3KA 2EV0A 5K5OA 3HRSA 4NHJA 1YW9A 1T39A 1R36A 3FF5A 2DQRA 2DBBA 3GUDA 2D45A 4HW0A 4UCUA 3WGIA 4LF8H 1F4KA 4E70A 1Z1DA 3F8BA 4N9IA 2BE5F 2HWVA 2KKOA 4G7OF 5DCMB 3IWFA 2L4AA 5D1OB 1ZLKA 3QP5A 4IRHA 4HAMA 4UCVA 2CSOA 3HIFA 3DPLC 5ILVA 3H20A 5LEJA 4UCRA 3QAHA 1HSTA 3OTOH 2YSRA 2ISZA 1MJ9A 4KN7X 2BBYA 2FU4A 4U7DA 5TJJA 2F5EA 2ZM6H 3N42B 4UNOA 4A6EA 4DV5H 1BI0A 2DFIA 4A5NA 4G6DA 3GVAA 3T1HH 2L54A 3ERED 2PLYA 3U2RA 3CLOA 3M9AA 4EM0B 4LD5A 2OQRA 3MFKA 2XRNA 4Y13A 2RKHA 2IRFG 5HLGA 3K3VA 1L2ZA 3TDZC 5LRRA 5IT9W 4M9ZA 5DCFA 4LF6H 4UHTA 1J75A 4B3TH 1SD4A 4CGZA 3HUGA 3T1BA 5L3DA 3DP7A 3CDHA 1ZG1A 5CVUA 2M5WA 2K4JA 4A2UA 3P9CA 3HSFA 4HDUA 2HOEA 1X9NA 3K1MA 1U8RA 5BS6A 2CGPA 1STZA 4KIFA 2Q8KA 1TQIA 5BR8H 5DDGA 1IZ1A 2QLZA 2KIUA 4BH9A 4B3RH 4CDGA 4KN4X 2GWRA 4I2OA 1HR0H 1U5TC 4AVPA 1OPCA 4TV7A 2Y48A 3KXYT 1HNZH 4P5OA 1QBJA 4JI3H 4LJZF 2Z3YA 3ULQB 2D1VA 4MTEA 3RKXA 3K0LA 5K1YA 2Z99A 3HTUA 2K7LA 1W7PB 3P7NA 4YHHH 3E5UA 4IAJA 3HOTA 4IHTA 2A68F 3JSNA 1G4DA 5IWAH 3L2PA 1E2XA 3ZN0A 4LF7H 2YX4A 3PQJA 3BP8A 4JK1X 2E5LH 5IT9K 1FBUA 5ICCA 2F2EA 3ZPLA 2QQAA 2QYOA 3HRUA 4EGZA 1YFHA 1IN5A 2MD5A 2VPSA 1N36H 3BJ6A 4RB3C 4EFEA 5K5RA 3WTSC 1M0WA 2OQGA 4Q48A 4JI6H 2Q2EA 2EFWA 1GHCA 4IJAA 3N6XA 4A2BA 4ESFA 3L7WA 3F23A 3LFKA 4UV9A 4LSAA 4B8XA 1WH2A 4QWQA 4GLXA 4HX8A 4CYDA 2GA2A 1T2KA 1F5TA 3ECHA 1FT9A 4KDPA 3GO5A 5LEKA 2IA0A 4EM1A 2HQRA 3SQNA 1TW3A 1FZPB 2MA3A 1ZHSA 1ODDA 3EYIA 1DDNA 1KYZA 4UFZA 2HZTA 5DCMA 3LSTA 1DGSA 2HVSA 2FSWA 3CTAA 4ZH4F 1U3EM 5HDNA 5D6EA 1W7PD 1KU2A 2DW4A 5DUIA 3B73A 1IUYA 4P9FA 1P2FA 1W5SA 4MQ9F 4DUYH 4CICA 2DI3A 3F72A 4PDKA 2Y75A 4JBAA 1KQ9A 3ZMSA 4X64H 1YO5C 1IXSB 1E4FT 3V8LA 3COAC 3VEPA 4AIJA 2IW5A 4UV8A 5FO5A 4PZJA 2IVMA 1RI7A 3F22A 3I53A 1GXQA 5DD8A 4JQFA 5BOXA 1WI9A 1IRGA 3PN1A 4WCGA 5BPDA 4LF5H 1ZH5A 3LA2A 1P4XA 1FOKA 5DUKA 1TAEA 5HS8A 3ZP5A 3ABUA 2MC3A 2FA5A 5ILUA 3E5XA 2IA2A 2P8TA 1XDSA 2Q2UA 4O3MA 1Z9CA 2KRFA 4EGYA 3JSOA 1QZZA 3H92A 2P7CB 3TQNA 3UQ8A 4WK8F 3EQLF 3JTGA 5E8GA 4JI8H 4R8HA 4BYYA 1Y0UA 2COMA 3GFLA 5FPOA 3R60A 4AQYH 1FC3A 1L3LA 1ZARA 2JZYA 3WTZA 5F1RA 1GYFA 2H6BA 3TOBA 2M45A 3JSPA 1OYIA 1ZHQA 5D8KB 2GZWA 2ESNA 2PMUA 4YFNF 5LLQA 1HKSA 1LEAA 2OAZA 1UB9A 4HA8A 4KMUX 4P96A 1MGTA 4OINF 4L9JA 3TKYA 1HBXG 4LH7A 3R6SA 4ZYDA 1BC7C 4KMFA 3D5LA 4U88A 1B6AA 5E20A 1H0MA 2UZKA 1VTNC 1S7OA 2JRTA 3K69A 3M7GA 4NXNH 1WRJA 2HR3A 2IPQX 1FNNA 1LVAA 4M6YA 1O57A 1YS6A 2LSOA 1ZG5A 4YFXF 4U7BA 1F1ZA 5D4SA 4NB5A 4ZYEA 1FSEA 1XSXA 1HXDA 3FMSA 2HVQA 2XKPA 3FXRA 1MDMA 4RS8A 2VQEH 4I01A 3REOA 5EOYA 3T8RA 2UXDH 2UXCH 4A5MA 3RIZA 2VONA 4BHBA 1KU3A 3L9FA 3NEUA 2FE3A 3J80K 2QWWA 2Y0MA 1HQCA 3PQKA 4KIBA 4RGSA 5FLXK 3C0FB 5AONA 4N0BA 4HYEA 4X66H 2RV8A 3FM5A 4EV0A 1BJTA 5HLHA 5LGTA 1TQMA 1MJBA 5LGNA 5FD5A 1IW7F 1XDNA 1OYYA 1ZRFA 3GW2A 4WWCA 5JFRA 1BJAA 1S68A 2W24A 2DAOA 1HW1A 2FRHA 2OU2A 2EFPA 1FYMA 1FP1D 1I5ZA 4RAZA 3GWZA 4IPAA 2DPDA 2E1NA 5CVRA 3BAAA 4DR6H 5CVJA 2ZFWA 5L3BA 3WGHA 1KQ0A 3R4KA 2OWOA 4M71A 4DV0H 2P7VB 1U78A 5FD6A 5ICGA 2KJCA 3S2WA 1QNTA 4LFCH 4F7ZA 2EA2A 4OIOF 4U0VA 2O6GE 1LNWA 3J7AK 3HTSB 5D5VB 3GFMA 5E1XA 5LBQA 2P4WA 2VUGA 2OD5A 4R7RA 2M87A 4ESBA 3J81Z 3O2PE 1XSDA 2D1HA 4HF1A 2FBKA 4UCTA 2NRAC 5TRDA 1YG2A 3BROA 1N34H 3QPHA 1XCBA 1B04A 1P4AA 2HGCA 4L5IA 1ZAOA 5JR3A 1LDJA 1HSJA 2ZNYA 4B3MH 3LQRA 4EJTA 2R7DA 4GYIA 4MQVA 4OMYA 2CO5A 3T0YA 4YFKF 1CGPA 4R1HA 2EFNA 4IRIA 2WE6A 5HVQC 1QPMA 2MH9A 3E5QA 3CJNA 2GAUA 2PN6A 3J80Z 3E6BA 1XMKA 4HZFA 4JI4H 2AS5F 4WF2A 3ROUA 4D0PA 1ON2A 1F9NA 4L9VA 1B4AA 4HF0A 3KAJA 3RPUA 3U9GA 3BDDA 3R0AA 2PFBA 1XCVA 1Z2OX 1FBSA 5LHGA 1IAWA 3T5XA 2K86A 1O7FA 4GKJH 3I0TA 3QOPA 4RB1A 5LL6b 3ECOA 3KLNA 2M1BA 2EFQA 6PAXA 3KALA 2XASA 4L9NA 4BAYA 3BY6A 4HX7A 4CHUA 4KIGA 3V8JA 5D8LB 1IN4A 3G73A 1J5EH 2LKPA 4KNYA 3WE3A 4HQEA 4PDBA 3LAJA 1UFMA 4AIHA 3LA7A 2XAQA 2XGXA 5IT3A 1HKQA 2STWA 2DK5A 3SHFA 1CF7B 1REPC 5A2QW 3P9IA 3C18A 3BJAA 4UVCA 4OOIA 4PCQA 3JAMZ 3L4KA 2L01A 1KU9A 2FQ3A 2A69F 3VODA 1SD7A 5BPIA 1HNWH 5F6FA 5D5XB 2DTRA 1FBQA <