4RAZA

Crystal structure of magnetospirillum gryphiswaldense msr-1 holo-fur
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4razA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4razA02
2XUBA 2RDPA 1F4KA 2O8XA 4KYWA 4AVPA 1QPMA 2RV8A 3DP7A 1MDMB 1U5TA 1YW9A 5E1WA 3IL2A 4H0EA 5CVRA 3JAMZ 3D5LA 4TV7A 2DPDA 1KA8A 1F5TA 4Q47A 3J80K 3WGHA 2JT1A 1E2XA 3ABUA 4RS8A 1B59A 4LK0F 4B09A 4L18B 1ON2A 1DP7P 1V3FA 2K4JA 1OYYA 1SD4A 1IN6A 2W24A 3FM3A 1HKQA 1TW3A 2K27A 4U0YA 4Y15A 2PEXA 3M9AA 4WXCA 3LA2A 2XIGA 3CJNA 1W7PD 3R0AA 4I02A 4RB2C 2XAQA 3MWMA 5DD4A 2D2WA 2JTVA 1EH6A 3DF8A 1XMKA 2VBWA 2AXLA 5HLHA 3RYPA 1BI3A 2IT0A 3V7CA 3P9IA 1DDNA 5A2QZ 4Q4ZF 1TNSA 1IZ1A 1UHMA 2F5EA 4ZYDA 1NHAA 1YQAA 1R1VA 3ERED 4GXOA 2RN7A 2VBYA 2NS0A 3E6CC 2RNJA 2JRTA 4LB6B 3VB2A 4ENKA 1UCRA 1ZRDA 1WKMA 4MEYF 1J5YA 3GO5A 2EFWA 3BWGA 5EEGA 1GHCA 3R4KA 3BJOA 4KFCA 4KNYA 2W84A 5BPDA 2EB7A 3F23A 5BOXA 5FD5A 3U2RA 3O2PE 3I4PA 1XSDA 4KICA 2FU4A 3C1DA 2M30A 4UUVA 4OOIA 1SMTA 5DCMA 3U9GA 5LRSA 5D5WB 1BI0A 3CUQC 2OD5A 2TDXA 4HQMA 4P9FA 3K1MA 3LQRA 4BHPA 2ZXJA 2HTSA 2GWRA 1JXSA 2FOKA 3KP7A 5D6EA 3GLXA 3RTRA 1I27A 3CO6C 2D45A 3KP4A 4ZYEA 4EGYA 2XAGA 4ZYGA 3Q9VA 2MLKA 1FZPB 3QPHA 2BBYA 2GXBA 4MEXF 1FLIA 2LKPA 3MFKA 2X0LA 5CLSA 4UNOA 1XGOA 3GW2A 4M9XA 1P6RA 3HRUA 4KIFA 1LJ9A 2E1NA 1BI2A 4LD5A 4WWCA 4NQWA 1SD5A 3GFLA 4BXUA 1U78A 5CVIA 5CJ9A 3V7SA 2H6CA 1B6AA 2PN6A 2XKPA 4DQ2A 2DW4A 3WTWC 2JSCA 5HOOA 2KJBA 3JTHA 5DEQA 1ZARA 2DBBA 2A6HF 2HZTA 5A2QK 1FSHA 1WI9A 3RKXA 1IN5A 4IJAA 2L3DA 5L3FA 2MD5A 2MH2A 1EH8A 2A61A 4U7DA 1GXQA 5D4RA 4EGZA 2A69F 2RC4A 2E7XA 1HW1A 1MJAA 4I09A 2DQLA 2FBHA 1HKTA 4PZJA 2EFPA 3VFZA 3DFGA 3PQJA 4HF2A 5DDGA 2Y75A 4L9NA 2OA4A 1MJ9A 4CGZA 4A5NA 3QRFF 1QO0D 4A0YA 3LA7A 3WGGA 2KIUA 5FFXA 4HYEA 4I7HA 4IHSA 3F6VA 1SMYF 3MEXA 4G7OF 3FF5A 3JW4A 4CXFA 5IT9K 3DEUA 3QPTA 3CUOA 4WCGA 4CDGA 2BYVE 3DV8A 3BROA 3KFWX 2QQ9A 3T1BA 5AIPA 1Z05A 1IN7A 2KJCA 1XD7A 4S05A 2YU3A 4U0WA 2H09A 3TGNA 1J7KA 3LFKA 2DK5A 2VN2A 3BZ6A 2JZYA 1O3TA 2EK5A 1ZLJA 2PLYA 4QLCU 1J59A 2IW5A 4L9JA 2YPRA 3IKVA 5KK1A 3E6MA 3F21A 2WV0A 1BC8C 3JSPA 2Q8KA 2QENA 3WTUC 3CDHA 4BHCA 3HOSA 3MAJA 5D5XB 3O6BB 1QNTA 1YO5C 2A5YB 2OZ6A 1T98A 3GXOA 3FMRA 2D1HA 2JPCA 1CF7A 4IRHA 4Q48A 1HW5A 1FBUA 5ICCA 3O3KA 4AIKA 3SXYA 2VT3A 1BJAA 1YYVA 3GFMA 3I59A 2ZNZA 2DPUA 3BPXA 1D3YA 1L3LA 1LB2A 4HF1A 2FXAA 2GA2A 2ZCWA 3K1NA 3CTAA 2KIMA 1IF1A 3B73A 3IC7A 2PG4A 3E5XA 3RJPA 3K69A 5LHIA 4HV6A 1LDJA 1OPCA 5D5VB 3P9KA 5BQTA 4A6DA 2V1DA 2LF8A 3HSRA 1B4AA 2FRHA 2CWEA 2G7UA 4HV5A 4HOBA 4PCQA 1IUYA 3HTSB 3J81K 1TTYA 1FNNA 3C7JA 2BGCA 1B9NA 2ZMEA 2IA0A 2QM3A 3F72A 3HTUA 3W6KB 5CYVA 4JQFA 1I6XA 3KEOA 2M5WA 5CVVA 1Y0UA 2O03A 4IF4A 3QU3A 2PFBA 2OZUA 2EJRA 4ZH4F 3JTGA 3GZ5A 3ZPLA 4JK1X 3RYRA 1YFHA 1V4RA 1BIBA 2M8EA 3ELKA 1I1GA 5FD6A 1O7FA 3EYYA 4EM1A 3S2WA 3FX3A 4CICA 3OOPA 4EJOA 1WRJA 2ELHA 2G9WA 4EJWA 2ZMEB 3F22A 2F2EA 1YW8A 3GVAA 1RUOA 3W6JB 1TW2A 2OU2A 3WODF 4NHJA 3HRSA 1XCBA 1GVJA 4LG0B 1CGPA 5IT3A 2O0YA 4KA4A 3BJAA 2P7VB 4MNUA 5L3CA 1IRGA 3TQNA 1ULYA 2CQKA 3KEQA 2P7CB 1ZG3A 5FLXZ 1BC7C 2ACJA 2BV6A 2IA1A 1K78A 3D0SA 1MDMA 3KP6A 1D8KA 4UV8A 2XASA 1U3EM 4CZZA 2ISZA 3DQVC 1REPC 1MGTA 2KRFA 2QLZA 3R61A 3ZMTA 1T38A 3WTXC 2COMA 5LGNA 3I53A 1QZYA 4HLYA 5JVTA 3GFIA 5F1RA 2VC0A 5LHGA 3BP8A 1HQCA 3Q9SA 3LA3A 4M6YA 2VT2A 2DLLA 2IRFG 1FYKA 1F1ZA 3F6OA 4R8HA 2GAUA 3I71A 3H92A 2IA2A 2NRAC 3FMSA 1XDUA 1R22A 3M1EA 1K7AA 2K02A 4O5VA 1BM9A 4RAYA 2OBPA 2CO5A 1TLHB 1XGSA 2Z33A 4Y13A 1ZRCA 1U6GA 5LGTA 3FXUA 4QWQA 2NNNA 4O6JA 2FBKA 3HRMA 5ICFA 3VEPA 1WWXA 1VTNC 1W4MA 1IRFA 1FWZA 3MZYA 4KIBA 2PMUA 5DUKA 4UXNA 2ADUA 1HKSA 3KP3A 1O57A 1U5TC 2P5KA 2EV5A 1SD7A 2ZNYA 3ULQB 2MBFA 2HGCA 2P6SA 5LEJA 2VOOA 2VODA 5LEKA 2ISYA 2K7LA 4L5IA 3F8BA 5HS9A 2HQNA 2Z5UA 1B1BA 3I59B 4RGRA 2QQBA 2DTRA 3E5UA 3QU6A 1P4AA 3HHHA 2R7DA 1QQIA 4Z2YA 2VE9A 5HDKA 1W5TA 5BS6A 1TNTA 3C3WA 4M72A 1LDDA 5FGMA 2QVOA 1P4WA 1IN4A 4NB5A 3CO7C 3J7AO 1R1TA 2QUFA 4P96A 2QBYA 2M45A 1ODDA 3FZVA 2EA2A 4HX7A 2V9VA 1W7PA 2RGVA 1KYZA 4GCVA 2XAHA 3ZN1A 3OV8A 1HXDA 2DO7A 1QGPA 2Z3YA 4PGHA 4KMFA 4Q5SF 1C0WA 3ZMVA 4BHBA 2FE3A 1H9GA 5E18F 2GXGA 1BOAA 4IRGA 5F6FA 4OIQF 2FEZA 2LDUA 3QAHA 1IXCA 3FHZA 1G6NA 3N97A 3FXQA 4YFXF 1JE8A 2R7FA 3FWEA 5K5QA 5ILUA 4LB5A 1LVAA 1XDSA 4EJUA 3EDPA 2VONA 3NEUA 2V79A 3IRQA 2XAJA 4DNCA 3ZP5A 1G3WA 1MJBA 2WTEA 2V6CA 2A3SA 3ZMSA 2G7HA 3BDDA 3DKWA 1W7PB 4L9VA 1S7OA 1AWCA 5E17F 3RI4A 5D8LB 2P5VA 2O6GE 1FT9A 1RI7A 4M9SA 2FBIA 4O3MA 2HKXA 1O7LA 1YS6A 3LSTA 2J5OA 1MD0A 2DQRA 5KVRA 4OIPF 2Z9OA 4HZFA 5K1YA 3DPTA 4KT5C 1U8RA 1UHWA 4N9IA 3QP6A 2OQGA 2Y0MA 3CLOA 3ECHA 4IPAA 5H20A 3WE2A 4GYIA 2KKOA 3I58A 2Q2EA 3IRRA 4BYYA 2PJPA 1Z7UA 5L3GA 2NNYA 2F5DA 1Z6TA 2DT5A 1OMIA 4FX4A 1KU9A 4LMYA 1P92A 1QZZA 2RKHA 2P6TA 4IXAA 4OIOF 1FPQA 2VC1A 3BOQA 4KN4X 1SD6A 1B9MA 1KU3A 3KZZA 5FB2A 4P9UA 5HDGA 4LGWA 2H6BA 4LLLA 5JR3A 1FSEA 1ZRFA 2JPBA 2XVCA 3ZMZA 2CFXA 5K5RA 1XMAA 4ESFA 3IWZA 1Z1DA 4HAMA 1UB9A 1FY7A 2A68F 4KUMA 2EFNA 2O3FA 1R23A 4I2OA 2BEOA 4IVNA 2MC3A 2K4BA 5E1XA 4CHUA 1G3YA 1XGMA 1R00A 2WC2A 5HS7A 4EJTA 4AWXB 4RAZA 3ISPA 4BNCA 5FO5A 1FOKA 1W5SA 1PP8F 4HBLA 2STTA 2QWWA 4ASNA 1LQ1A 3IHUA 3L00A 3J80Z 2HFHA 4ESBA 4L9TA 3N4MA 4FX0A 2X4HA 1IN8A 2IPQX 3U1DA 2HYGD 1KGSA 2HTJA 5EEHA 2B0LA 4G6DA 3I64A 2GZWA 3SZPA 4ZZLA 1WSUA 1TQMA 2MA3A 3E6DA 1YG2A 2YR2A 5IT9Z 5ERIA 2YSRA 3T8TA 3GFJA 5D6FA 2XROA 4PGGA 2HEOA 4I01A 2LSOA 2PI0A 2FMLA 1KQ9A 2QYOA 3TO7A 1R7JA 3M8FA 1BIAA 4M73A 2MLGA 2VBXA 3MCZA 4LG0A 3WTSC 1FP1D 3ZMDA 3R0JA 5HVQC 1SFXA 4LLGF 1TQIA 1XCVA 1O3QA 6PAXA 5AIQA 4ENNA 1DPUA 4R1HA 1EV7A 2QZ8A 1HBXG 4ETSA 3KETA 1ZYRF 3KLOA 2ZKZA 3F8NA 2VXZA 1ZGJA 2EWNA 2DAOA 4IRIA 5JHUA 3F8CA 2XKOA 4I0AA 4ZYHA 3HSEA 5FFZA 1J2XA 5ILVA 4AD9A 2YX4A 1J9IA 2L4MA 3V4GA 3ZMUA 4MQVA 5HLGA 1XSVA 3P9CA 4ENMA 1R5GA 4G6QA 2V1UA 5K5OA 4M9ZA 5L3BA 4KN7X 2PQ8A 1SFEA 3L09A 2GA1A 1BN5A 4HLXA 4L0ZB 1JHHA 3IKTA 1R58A 1S7AA 2Y48A 3E97A 1LEBA 5DCMB 2K86A 4XLPF 5L3DA 3HUGA 3KE2A 5TRDA 2ZBKA 3NRVA 1T6SA 1D5VA 4MHGA 3AAFA 1K6OA 2A07F 2H27A 3DXJF 2EFQA 3WTTC 3WGIA 4KIGA 3HYIA 1X3UA 1TQPA 2PBIA 5BMZA 4CYDA 3TOBA 3G3ZA 4FT8A 2ESNA 4MQ9F 5E20A 3E6BA 2EFOA 3EUHA 3MQ0A 2R3SA 4KMUX 4YFKF 2W25A 1P2FA 3REOA 1ZGAA 5CVUA 5JFRA 1K79A 3WU1B 3HRTA 1FBSA 4N9HA 1R36A 2Q0OA 4Y17A 3K9TA 5TJJA 4HA8A 3NQOA 4ZZDA 3GYHX 1ZLKA 4M71A 4XBFA 4YIFA 3KP2A 1HSJA 3F8FA 5AONA 2CG4A 2XHKA 1KU2A 4RGSA 2FF4A 3QP5A 1YIOA 3HSFA 5D5UB 3WG9A 3PQKA 4WX9A 3I54A 2LF7A 2DI3A 2RQPA 3TO9A 3L9FA 1STZA 3B02A 2HKOA 1L0OC 4RB3C 1RUNA 5D8KB 2VBZA 3BJ6A 2CYYA 4B8XA 1WQ2A 4WF2A 5ED4A 2V1XA 5CVJA 2ZFWA 1GXPA 4G9YA 1E17A 4UVAA 1Z91A 2DK8A 3KZYA 4EQQA 5LRRA 1LNWA 3H3ZA 2A6EF 3HOTA 1HW2A 3Q5FA 3SFZA 5E8GA 3GX4X 3IWFA 2RVCA 1J75A 2UXXA 4ENJA 3PFIA 4R79A 1MZBA 4L5JA 2DFIA 1S29A 3I5UA 4EM2A 4LLNA 3JAMK 4OU0A 4G94A 3BY6A 4GYGA 1FX7A 3K0LA 4FHTA 5LBQA 1CF7B 4N0BA 2XGXA 3WE3A 2E7WA 1MKMA 2AS5F 1OKRA 3FM5A 1XGNA 5J6XA 1R1UA 3FXRA 1G3TA 2PMHA 1IAWA 3GF2A 5LHHA 3QOPA 3BPVA 3ROUA 4U88A 2QBYB 4GO1A 3RPUA 2L4AA 4M74A 1O3SA 4LK1F 2GIVA 2L54A 4HF0A 5H6QA 2FQ3A 1J0RA 4HDUA 3DPLC 3RIRA 1LEAA 4PDKA 4U0VA 4OINF 1KQ8A 1SAXA 1Q1HA 1YW7A 2Z99A 2W85A 1USTA 2CW0F 2YX7A 1ZG1A 2F5CA 2FNPA 2LNBA 4A0XA 5HS8A 2HDCA 3R6SA 3CUQB 3GUDA 5ILSA 2OAZA 4P5OA 4EMSA 2IVMA 2L02A 4I98B 4KDPA 4WXDA 5HDNA 1DUXC 4MGRA 5FLXK 1RIOH 1KU7A 4G7HF 1SFUA 3GWZA 1AOYA 4RB0A 3ZN0A 3HIFA 1KYWA 2D1VA 5HLIA 3K2ZA 1USSA 2ETHA 4E70A 3K1PA 3E3VA 4EVIA 4YFNF 1F9NA 3L2CA 3L7WA 3HHGA 1ONVA 2O61A 5DUIA 5LLQA 4G8XA 1U2WA 5ICEA 5DD8A 2MH9A 2EV6A 5F64A 3FMQA 1LDKB 2XAFA 4F7ZA 4YIIA 2UZKA 1OYWA 2IJLA 1ON1A 2CGPA 3F8MA 1FC3A 4UVCA 3EQLF 1HSTA 4MTDA 3TKYA 4D0PA 1OR7A 3VOEA 4A2UA 3SHFA 4OMZA 5DCFA 4IHTA 1YLFA 3TDZC 1G3SA 4I0BA 3RPQA 1PDNC 1XN7A 1ZREA 1U5TB 1ZAOA 2XV4S 2P4WA 5J8CA 3V8KA 1O3RA 3EETA 4MTEA 4XRFA 3JSOA 1ZN2A 4BQAA 3E5QA 3H3UA 1JGSA 2NYXA 4WXHA 1YS7A 3V7RA 4A5MA 1FYLA 4OIRF 4CO8A 4YG2F 3WTZA 2J5PA 3ZQ7A 1BBYA 1S3JA 3TOAA 3T8RA 3WTYC 3TO6A 1UFMA 4M6XA 4A6EA 2E1CA 1IXSB 3RKYA 1I5ZA 4JBAA 2STWA 1IXRC 2CSOA 1IW7F 3T5XA 4ESJA 1T39A 3R60A 5DYMA 2F5FA 3EYIA 1QBJA 3MZHA 3LQQA 4UVBA 4XLNF 4HX8A 5DV5A 1R5HA 3GEZA 2OQRA 4OMYA 3ECOA 1G4DA 2P8TA 2P5LC 2ESHA 1Z6RA 3LAPA 4UV9A 2FA5A 3G73A 4EJVA 2UXNA 5L3EA 4AIHA 4XSXF 4EV0A 4ON0A 4HDVA 4LJZF 2HQRA 4BH9A 3P7NA 3TDUC 4EM0B 4G7ZF 3LAJA 1H9TA 3F3XA 2BE5F 4K2EA 3T0YA 3J81Z 3KLNA 2C6YA 1RNLA 3SZTA 1XSXA 1FP2A 2HOEA 2M87A 1JHFA 3ABTA 5H6RA 1A04A 4BAYA 1PP7U 2EA4A 1ZH5A 4XSZF 4HW0A 3SQNA 1ZG5A 4HQEA 4AIJA 2W57A 1OYIA 2ZO4A 3M8EA 4U7BA 4WK8F 2KIFA 3VODA 1FYMA 2NAZA 5JI6A 1S8NA 2QQAA 3CUQA 4HX4A 4P55A 5E1ZB 2HR3A 4A0ZA 1XB4A 1Z9CA 2VE8A 1RZ4A 1ZHFA 2WWYA 1H0MA 2HS5A 3M7GA 3WTVC 2FMYA 4LFUA 3RDIA 1P4XA 3COAC 3V8JA 2XRNA 2HWVA 2EV0A 1K78B 5LGUA 2ZJ2A 1EH7A 2DU9A 4GGGA 2UWMA 2IP2A 3GZ6A 1YTYA 4L0YB 2FSWA 4UHTA 4A12A 2GQQA 5D4SA 1T0FA 2FNAA 1PUEE 1TBXA 5J8FA 3WU0A 5ICGA 1T2KA 3I0TA 1S6LA 2H94A 1D8JA 4RGUA 1KQ0A 1I1SA 4RB1A 2M1BA 4RGXA 1FBQA 4S04A 5E8IA 2HYFA 3ML6A 2L01A 5BPIA 3KCCA 3V8LA 3KP5A 1BI1A 2VOPA 3RKWA 1DPRA 3C18A 3LWFA
chains in the Genus database with same CATH superfamily
2XUBA 4BBRG 1E3HA 2L7MP 2RDPA 4DL4A 5B5EC 1EJ9A 1F4KA 4DV0H 3T5KA 3OYMA 2O8XA 3VSLA 4QIWN 3H4DA 4KYWA 4GC7A 3Q8PB 4AVPA 2NVYA 4JI5H 1QPMA 4RA2A 1B8IB 2RV8A 1ETKA 1TWGJ 3DP7A 4D9JA 5HLTA 1MDMB 4A2AA 1U5TA 1A6QA 1YW9A 5E1WA 3IL2A 4H0EA 2JA6G 2NS7A 2W71A 5CVRA 3DTKA 1VFCA 3W6VA 4CUGA 3JAMZ 5K2MA 1Z3XA 3KEYA 3D5LA 2C35B 4TV7A 4CH7A 2DPDA 1KA8A 4QWBA 3PNTA 1F5TA 4Q47A 4DZPA 3PW2A 3ABMH 1D1BA 1XPXA 2KT0A 3J80K 3WGHA 4LFAH 2JT1A 1TWAJ 1E2XA 2HHHH 4BQQA 3ABUA 4XRMA 4RS8A 5CKTA 2LC2A 1X1BA 2BOLA 1B59A 2DYRH 4QIWA 4LK0F 2MYSA 4B09A 4DGWB 4L18B 1JKQC 1DV2A 1ON2A 1TWFA 1OCRH 1DP7P 1V3FA 2K4JA 1OYYA 4CCNA 3J7AK 2ID3A 5J40A 3M4IA 2M7BA 3TBIA 4D5CA 1SD4A 5E3OA 3I4NJ 1IN6A 2VKHA 3G1LA 2W24A 2WB1A 3TW6A 2DIKA 3QZ7A 2KP6A 2R5ZB 1Y1WJ 2R6FA 3HKZN 3FM3A 1B72B 4FE7A 1HKQA 1TW3A 5CQGA 4B48A 2UXDH 1BA5A 3RZDJ 1MNMC 4RNMA 2K27A 4ZTFA 4U0YA 1ZGWA 4X66H 3DBRB 4Y15A 2NU8B 2PEXA 3M9AA 2NS8A 2KIQA 3LA2A 4WXCA 3PNYA 4XM3A 2E19A 4F3QA 2XIGA 4XRSA 4IO9F 3CJNA 1W7PD 3R0AA 4I02A 3CC7I 5J2UF 4RB2C 2XAQA 2W8LA 3MWMA 5DD4A 2MG4A 2D2WA 2JTVA 2DJIA 2ZJTA 1EH6A 4D1QA 3DF8A 1XMKA 2VBWA 2AXLA 5HLHA 1SFOA 2JA7J 2UU9H 3RYPA 1BI3A 2IT0A 1VQ6I 4BY7G 1MSFC 3V7CA 3P9IA 1WH2A 3KALA 1DDNA 1QPIA 2UV1A 4V19K 5A2QZ 4Q4ZF 1TNSA 1IZ1A 1UHMA 2LLKA 3CMEI 5KT2A 1F43A 3A0BC 5EEAA 2F5EA 4ED6A 3JRWA 4ZYDA 1T08B 1NHAA 2KFDA 1B04A 4OAYA 1GV5A 5IYZF 5C4XG 1YQAA 2OCCH 4LF4H 4A93G 1R1VA 3ERED 1RKTA 3RQ4A 4GXOA 2I8CA 2DN0A 1N32H 2RN7A 2VBYA 3K4CA 3HOYG 2NS0A 1JTYA 1IBKH 1N33H 2HNHA 3E6CC 1I6UA 4C3HJ 2RNJA 4O4HF 2JRTA 4BXXJ 1WZ2A 4LB6B 3I4MJ 4JI8H 1T56A 3VB2A 4ENKA 5KFMA 1UCRA 1Y0NA 4NBQA 1WKMA 3MKYB 4MEYF 1ZRDA 4E7SA 3PR4A 4BY1G 1J5YA 3OSGA 3GO5A 1B6RA 3OYKA 1P9QC 3CMAI 3GMEA 2OH2A 1B6SA 2EFWA 5KG4A 5LL6b 3H0GJ 4YHHH 2W6QA 4RAGA 3BWGA 5GTHC 5EEGA 3HL2A 1I50J 4I50F 5HNHA 1QZEA 2LBFB 3S3NA 1GHCA 3TIGA 1X58A 3R4KA 2V6EA 4DL7A 5EZGA 3K7AJ 2HOTA 2R7MA 5GPCA 3BJOA 5C3EJ 4KFCA 4KNYA 4EBEA 2W84A 2XF6A 2EZIA 5BPDA 4MO7A 4MV4A 3ETJA 1BR1A 5KX5F 1W0TA 3LSJA 5EJCA 3HBLA 2EB7A 4XR6A 3F23A 5BOXA 5FD5A 4YRVA 2BR0A 2W6MA 1UELB 3U2RA 3JRFA 2BXYA 2EH3A 3O2PE 4A3JG 4XORA 1K61A 3J7ZI 4DV7H 2E2IJ 2GLTA 3I4PA 4GLXA 1XSDA 1YRNB 2L0KA 4KICA 2OCEA 2FU4A 5CA0F 4QWEA 3C1DA 1OFCX 2M30A 4UUVA 2M4GA 3K4NA 2LOOA 4EEYA 4OOIA 1SMTA 5DCMA 3U9GA 4RLQA 2VI6A 1IDYA 5LRSA 2HQ5A 5D5WB 2ASJA 1BI0A 3CUQC 3F9KA 1VQ5I 2QK4A 2FLPA 2OD5A 2TDXA 1QHGA 5KG0A 2V9KA 4EG0A 2KRCA 4HQMA 2BHYA 2CUEA 4K0KH 3S2DJ 4P9FA 3K1MA 4ECTA 2R87A 3LQRA 1JJ6C 1OCOH 4BHPA 2ASLA 2KQRA 1S9FA 1WH7A 2BY2A 2ZXJA 2I10A 2HTSA 1ZHQA 2GWRA 5FKKA 2FOKA 1LFUP 1HC8A 1JXSA 5K7FA 3RAQA 4LSAA 3KP7A 1JI8A 1G2HA 3KZIC 2FK3A 3FBIB 5D6EA 3GLXA 3RTRA 2WE6A 1HNWH 2DMTA 3UQ8A 3ZCOA 1KONA 1I27A 3CO6C 2L2OA 2D45A 5DG8A 3KP4A 3I12A 5KHDA 4QWAA 4ZYEA 1HR0H 3E5NA 4EGYA 3GTOA 1MBJA 2XAGA 4ZYGA 4JV2A 3Q9VA 3CCYA 1WJEA 2MLKA 4NC7A 2I87A 4I6ZA 2Y0SN 1FZPB 3QPHA 2DDBA 3S2HJ 2BXZA 3GIDA 2DJNA 2BBYA 3QOEA 2GXBA 4MEXF 4C5CA 3PO3G 1EUCB 5KFYA 2BW3B 1FLIA 1MIJA 3K5IA 2LKPA 3MFKA 5EWEA 2FLNA 4IR9A 2X0LA 5CLSA 2JVHA 1KJJA 4UNOA 4A3LJ 5FRNA 1ZETA 3BT9A 1XGOA 1GSOA 1L2ZA 2CUZA 3GW2A 4M9XA 3CCUI 2ATLA 1P6RA 3HRUA 3EPGA 2CU7A 4KIFA 5GADJ 1LJ9A 2C2RA 4J9QA 3I9V2 3H0DA 4YJ2F 1TAEA 2E1NA 3OMYA 1BI2A 4BUPA 3RB6A 2IGKA 4LD5A 4IWYA 1B72A 3CF5F 4WWCA 2BQ3A 4NQWA 1K83A 1SD5A 3GFLA 4BXUA 5DLFA 3UNGC 1U78A 5CVIA 3BR2A 4RNOA 5CJ9A 2IEKA 2H6CA 3V7SA 3SEQA 4CCLA 2R85A 2V58A 5KT6A 1B6AA 2PN6A 2JVGA 2RQQA 3RAXA 2XKPA 4DQ2A 2DW4A 3WTWC 2JSCA 5HOOA 3DF7A 2A5WA 2KJBA 3JTHA 5DEQA 3GIKA 1ZARA 4RDUA 2DBBA 2AQEA 4BY7J 4Q8FA 2A6HF 3ZRGA 2HZTA 3AG3H 5A2QK 5J1UA 3MJFA 1FJGH 3A03A 2HXIA 3S1RJ 1FSHA 2IA6A 1WI9A 2IBDA 3RKXA 1A5JA 1IN5A 4OAZA 4RM2A 1VQ4I 4S0HB 2VQFH 2DOEA 4IJAA 4QTRA 2KDZA 2L3DA 4IAJA 3DU5A 5L3FA 1YITI 2IGMA 2MD5A 1VI0A 4X65H 1BXRA 5KFTA 4UCOA 2MH2A 2JA7A 3WO0A 3B6AA 1EH8A 2A61A 4PJ0C 4IRDA 4BXXG 4U7DA 4IZOA 3OYIA 1KBLA 3CQZJ 1GLVA 1GXQA 5D4RA 4EGZA 2R7VA 1YOVB 2A69F 2B63J 2RC4A 3GTGA 2E7XA 2VQHA 1NTCA 2XB5A 3JZIA 2JN6A 2Y0SE 1W36C 4A3DG 2BVMA 1HW1A 4RUAA 4NNJA 1UNNC 2UVUA 1MJAA 4KITB 4I09A 3GTLJ 3HC7A 5KFSA 5EYRA 2DQLA 2FBHA 1HKTA 2LRDA 2JWTA 2FP4B 5CB4F 4PZJA 3R23A 2EFPA 1UAAA 3VFZA 2WAQA 3DFGA 3PQJA 4HF2A 3H3VK 5DDGA 5FLXW 2Y75A 4L9NA 5LA6F 2M3AA 5EWGA 2R7KA 4QWDA 2DT6A 2W9AA 2OA4A 5F9NA 5J4VA 2UUZA 5FLMG 3OYCA 4YP3A 1B8IA 1MJ9A 4MV9A 4ZJZA 3CCEI 1KJQA 3S32A 2FD5A 1LE8B 4CGZA 5KT3A 4A5NA 3QRFF 4DLKA 1QO0D 4JI1H 4A0YA 3PM1A 5IP9J 3LA7A 2AGOA 3H4BA 1SVMA 2KIUA 5FFXA 4HYEA 3WGGA 4I7HA 5HODA 4ZDOA 4IHSA 2RDIA 3AG4H 4UCRA 1V51A 1SANA 3F6VA 2ZJPF 2RDJA 3K2AA 1SMYF 3QZ8A 3MEXA 4G7OF 4PJNA 3FF5A 3JW4A 4CXFA 2FMAA 3U21A 2JA5A 2UVWA 5IT9K 2LP0A 4XMYA 3DEUA 4QIWE 4AU7A 3MFIA 4AYBA 2L7KA 3QPTA 3CUOA 1GSAA 4WCGA 4CDGA 2BYVE 3H35A 3U9SA 3PW5A 3DV8A 3BROA 3KFWX 2QQ9A 1DIKA 3AG1H 2M7AA 3T1BA 3H36A 1S68A 5AIPA 1Z05A 1IN7A 3ASOH 3M4OJ 2KJCA 3Q0UA 2ZSHB 1XD7A 4NDLA 4XKWA 2YU3A 2Y9YA 4S05A 3CCSI 2XRLA 4U0WA 2PMZA 4GC6A 2DA6A 1YJWI 2R8KA 4XONA 2H09A 3GBGA 3LSMA 4HEA2 3TGNA 1J7KA 1Y1VJ 2PJRA 4ECVA 4DUZH 3LFKA 4J9PA 4MFDA 4O4LF 2DK5A 3HOYJ 5KG5A 1IBLH 5IP9G 2VN2A 5EF6A 3BZ6A 2BVLA 1JGGA 2JZYA 1O3TA 2WBMA 3HGGA 2EK5A 2F6CA 1ZLJA 2C00A 3ONQA 1YRNA 2PLYA 4QLCU 4O3NA 4A69C 4UUSB 2BHZA 2B7EA 1J59A 4B43A 4L1KA 2IW5A 4F4WA 3AL0B 4L9JA 2YPRA 4DR6H 3IKVA 1ZR2A 3EUHC 3H3VH 5KK1A 3E6MA 3F21A 2WV0A 1BC8C 2CQQA 3JSPA 4LIUA 2Q8KA 3CDIA 2QENA 3WTUC 3RB3A 2Q2UA 2FJ1A 1YIJI 3CDHA 2M0CA 2OC6A 2HZDA 4BHCA 4F50A 4IHJF 1T95A 2UXBH 3HOSA 2JA2A 3MAJA 4G12A 5D5XB 5J47A 3O6BB 1QNTA 4XL9A 1YO5C 1I3QA 2FK2A 4XOPA 1FMVA 3HKZA 2A5YB 1IGNA 2X51A 5HBRB 2OZ6A 3UFXB 1T98A 1MH3A 4FASD 3GIMA 1PVEA 3GXOA 3FMRA 3I56I 2V26A 3VDXA 2D1HA 1RK6A 4F93B 2JPCA 5JUMA 4RNNA 3DKYA 1CF7A 1VNDA 1E0EA 4IRHA 4Q48A 3V42A 2XD4A 1HW5A 4J9RA 3K4BA 4BWSC 2IGNA 2K9SA 3BTLA 1FBUA 5M5WJ 3G6EI 4M3EA 5ICCA 3O3KA 4QW9A 4AIKA 4Y3OA 3SXYA 1R9TJ 2Y69H 2VT3A 4II3A 3JREA 3MWDA 1BJAA 2EBIA 3SE7A 3HJEA 1YYVA 4DL2A 4PSXA 1MBEA 3DU6A 3GFMA 4QW8A 2XCAA 1JX4A 3I59A 1VBGA 3K3PA 2ZNZA 5E3LA 2DPUA 3BPXA 2V9PA 4O3PA 1N75A 1A31A 4YBZB 3SEZA 3H9GA 1D3YA 5EWFA 3K10A 1LB2A 1L3LA 2H1LA 2FXAA 2GA2A 1IUFA 4HF1A 4O4IF 3LL7A 3EPIA 1W5CC 2DMPA 2JEFA 4U87A 5B66C 5IP7G 1HNZH 3V6HA 2K85A 4CC6A 4DR3H 3RB4A 4ZOLF 3CP8A 2ZCWA 4UUSA 2W70A 2LH9A 3K1NA 3FBNB 1K1QA 1WH5A 2BW3A 3CTAA 3E7LA 2KIMA 3TEDA 2K3PA 1ETVA 2N8GA 5EGOA 1IF1A 3B73A 3IAM2 3IC7A 2PG4A 3E5XA 2YZGA 1OQYA 4YEJA 3N05A 3RJPA 3K69A 5LHIA 4PSWA 1RR7A 4HV6A 1LDJA 2L9VA 1OPCA 5D5VB 2V1NA 1SVOA 5F04A 2IS2A 2AHQA 3P9KA 5BQTA 3N6XA 3FKIJ 4A6DA 2V1DA 2JEJA 5C1PA 4X1EA 2ME0A 3FISA 3OS1A 3C2HA 2VUGA 3U1KA 3K4MA 3OYFA 2X0SA 2LF8A 3HSRA 1B4AA 2ZXHA 2FRHA 5BR8H 3CMMA 2O7OA 3RCOA 2VA3A 4BGDA 2UVVA 2CWEA 2G7UA 1TA8A 3QPLA 2DWCA 2EZHA 2YS7A 4HV5A 4YAKB 5DG9A 4HOBA 1RYRA 4PCQA 2E35A 3WHBA 1IUYA 3HTSB 4FCYA 3J81K 1TTYA 2ZFUA 2XCPA 4TV8F 1KEEA 4F4ZA 1N77A 2W9BA 1CQTA 1FNNA 3C7JA 3OSFA 3FK7A 4M3BA 3JR9A 5C1OA 2V4RA 1Q1VA 2BGCA 3OYGA 1B9NA 2ZMEA 3BR3A 2IA0A 4AUXA 2QM3A 4DR1H 3F72A 4NQWB 1WJBA 3PVXA 3HTUA 3W6KB 1JDEA 2AQFA 5CYVA 1HDDC 4AYBN 1YI2I 1VQ8I 1WJ5A 1I39A 1S0MA 4JQFA 4YR3A 4ZC3A 2B63A 4B3XA 3GTQA 1I6XA 3KEOA 1OWTA 4MIMA 2M5WA 1X19A 3ERMA 5CVVA 3WNZA 4Q45A 1Y0UA 5KNLA 2O03A 4IF4A 3QU3A 5F0FA 1MBFA 2PFBA 1SVLA 2OZUA 4W97A 3JRBA 1IRZA 2X6OA 2C2EA 2EJRA 3T5LA 4ZH4F 4MV6A 2LFBA 3JTGA 2KMUA 4D7NA 3GZ5A 2YZNA 2XPVA 3RTXA 3ZPLA 5KFOA 3RV3A 4JK1X 2FX0A 2ICWG 3RYRA 3NWSA 2W7OA 1YFHA 4ED8A 1V4RA 1BIBA 3GTKA 2M8EA 3ELKA 1I1GA 5FD6A 3H1CA 1IV8A 2R86A 1VF9A 5L9XA 4E7ZA 4J9LA 1O7FA 1IOVA 3EYYA 4EM1A 3S1MJ 2OTLI 3S2WA 3FX3A 4CICA 3JSLA 2M34A 4EBCA 4DV2H 3PW4A 1V5GA 3OOPA 3PSIA 4EJOA 2VR1A 5DGBA 1WRJA 3QFFA 4B1RA 5FRMA 3HUGB 1I50A 3BJYA 2EILH 2XPWA 2ELHA 1FOWA 4HSTA 2G9WA 1W0UA 4E7IA 4EJWA 4BBSJ 3VYUB 5KFDA 2ZMEB 3F22A 2DTZA 4AQYH 4CYCB 3FKJA 4BDZA 2F2EA 1JTXA 2YU9J 4IHXA 1YW8A 3GVAA 1A9XA 5KFFA 1RUOA 2L5QA 3W6JB 1MNEA 1TW2A 4AM3A 4XLCA 2OU2A 2OJED 3WODF 4Y8VB 2LY2A 2LREA 4NHJA 4F52A 1AKHA 1ZKGA 4A3JJ 3RGXA 3HRSA 2YYAA 2NOJB 1XCBA 2VUMJ 4N4OB 1GVJA 4LG0B 4DV1H 1CGPA 2DFFA 5KFJA 5IYBG 1HNXH 5IT3A 4YELA 5JHFA 2O0YA 4BE1A 4KA4A 2QCOA 3BJAA 1C30A 5TGTA 2P7VB 4MNUA 2FKLA 2D5VA 3FKIG 2PBZA 5L3CA 1IRGA 1JIHA 3TQNA 2XGCA 4JX6A 3FXKA 1ULYA 2MD0A 1RK5A 3HOZJ 2CQKA 3KEQA 3BA9A 2P7CB 4IOCF 3OIPA 2Q2TA 1ZG3A 5FLXZ 4BE2A 1BC7C 3TP3A 3LSIA 4IEJA 3GLKA 3HZJA 2ACJA 2B63G 2BV6A 2CUFA 3E1SA 3SJMA 2IA1A 3H5AA 2H1KA 1K78A 2GM4A 3D0SA 1MDMA 2CQXA 1D8KA 3KP6A 4UV8A 2XASA 2AXTC 1U3EM 1XDNA 1ETQA 1I3AA 4CZZA 1IOWA 2NVUB 4MV8A 2JA5G 2PMZE 3WU2C 4F91B 4XQFA 2ISZA 4TV9F 4C30A 4LG3A 2WA0A 3DQVC 1REPC 2GOXB 2YRXA 4ECUA 1S7EA 2DFEA 1MGTA 2KRFA 2QLZA 3R61A 4O2BF 3MVPA 3ZMTA 1T38A 3OSNA 5F0HA 3WTXC 2COMA 5LGNA 3I53A 4ABZA 1QZYA 4BXFA 3I55I 1WSCA 2Y2ZA 3LSPA 5JVTA 3GFIA 4HLYA 2JA5J 5F1RA 2CZGA 2UUAH 2VC0A 5LHGA 4YAJB 3BP8A 1HQCA 3Q9SA 1XTAA 2KLOA 3CP2A 2K5CA 3S17J 3LA3A 4M6YA 2YCHA 2DMQA 4XK4A 2VT2A 4A3IJ 2DLLA 4M3DA 2IRFG 3G71I 3CCMI 3JRCA 1FYKA 1A0IA 4JI4H 3PO2G 1GO3E 2HXOA 5EG0A 1SCUB 3DPUA 2R93A 1F1ZA 2XB0X 5GP9A 2HVQA 2NU6B 2JA7G 3F6OA 2VIXA 5KAFC 5D1OA 1OCCH 4X64H 4R8HA 2E5NA 2GAUA 4DYRA 2W1OA 3I71A 5B1AH 3H92A 3OSPA 1VBHA 2WADA 4EFEA 1LKXA 2IA2A 2NRAC 3CMYA 3N44B 3FMSA 2F4OB 1R5ID 4PJMA 2R8GA 2HOSA 4QPQA 1XDUA 3GCMA 2IS4A 3BQ1A 5FKLA 3OR1C 5BNGA 1H88C 4C9YA 5KFBA 2XC9A 2PJRB 1R22A 3M1EA 1K7AA 2HDWA 1WJDA 4LF7H 1QVUA 2W6OA 2K02A 4IWXA 3S14J 5M3FJ 1DGWY 2FUG2 4O5VA 4AC0A 4J9NA 2IP4A 1JUMA 4LIVA 1CS0A 1BM9A 5KFLA 2HVRA 4RAYA 2OBPA 1Z77A 1AU7A 1WJCA 2CO5A 2W6ZA 3HOXG 1TLHB 1WVRA 4A3FJ 3S3OA 1V9PA 1IJWC 2ZDGA 1XGSA 2Z33A 4HR7A 1JLLB 4Y13A 1ZRCA 1U6GA 5LGTA 3S1QJ 3RSNA 3Q2OA 4O2AF 3TINA 1HA8A 5KT7A 3FXUA 4A3BG 4QWQA 4ZI7F 2MC4A 3IN5A 3Q0WA 2NNNA 2R92G 4O6JA 2FBKA 3HRMA 5ICFA 3VEPA 1WWXA 1M1EB 4GDFA 1CQIB 4TQRA 4J9KA 3FMAA 2HI3A 2QF7A 1VTNC 2QSGX 3OYEA 3OYLA 3GTKJ 3NGDA 1TT5B 3M9OB 1W4MA 2W9CA 2GIZA 1M7JA 2R8IA 1IRFA 1FWZA 3MZYA 4KIBA 2PMUA 4M6VA 5CQEA 5DUKA 2BY1A 1T3NA 2KDOA 3ZR8X 3S1NJ 4UXNA 2ADUA 3PIOF 5BPFA 1K4TA 1HKSA 3KP3A 4YJ3F 1MBHA 4HSRA 3LOCA 1LFPA 1O57A 1U5TC 2P5KA 2EV5A 4I55F 4O3OA 3J7AY 1SD7A 3GV7B 2ZNYA 5IP6A 3VPBA 3ULQB 2MBFA 4D7MA 2KZVA 2HGCA 4ED0A 2P6SA 2OWOA 5LEJA 2BQRA 3CJQB 2VOOA 2AO9A 2VODA 5LEKA 1E4EA 2ISYA 4ZTJA 2K7LA 4L5IA 3PO2J 2R82A 2QEXI 1P7IA 4FU0A 3F8BA 2ZJQF 1Y6IA 5HS9A 1XNRH 2HQNA 4TUYF 3G6VA 2Z5UA 1B1BA 4PJLA 5F0CA 2BY3A 4B44A 1KJ8A 3I59B 4RGRA 3PO3J 2QQBA 2FK1A 5C3EG 2DTRA 3JRXA 3E5UA 3QU6A 1P4AA 2R5YB 2DOFA 3HHHA 3OWTA 2R7DA 1ULZA 3O8GA 1QQIA 4Z2YA 1PX2A 2VE9A 5HDKA 3OYJA 1ZQ7A 1W5TA 2ALZA 5BS6A 1TNTA 2MSYA 2DPIA 3C3WA 3SDBA 5KAIC 2I8DA 4M72A 2VPQA 1LDDA 5FGMA 3PFYA 2QVOA 2V4JC 4DL5A 1P4WA 1IN4A 4NB5A 3CO7C 2VASA 4ECYA 3ZQHA 3J7AO 4AIDA 2LY9A 1Y39A 4XX0B 1R1TA 3LWBA 4CSWA 3PR5B 2E5LH 2XDVA 2VUMG 2DLNA 2QUFA 4P96A 5B3SH 1PYVA 2HYJA 2RNGA 3VYTB 3CJTB 2QBYA 2LBFA 3MFHA 1EA3A 4YIRX 4E6KG 2M45A 4V2GA 1ODDA 2XGPA 2W48A 3FZVA 1DQUA 2EA2A 3FIWA 1UMQA 4HX7A 1ETYA 2V9VA 1VAJA 1W7PA 5GPAA 2RGVA 1KYZA 4GCVA 2R7QA 1JT0A 2AQ4A 1X1AA 1XC5A 2XAHA 2MGQA 3ZN1A 3OV8A 1P7JA 5LYJF 1HXDA 2FQ4A 2DO7A 4M3GA 5C44J 1QGPA 2F5VA 3QWLA 1NH3A 3HOXJ 3GILA 4LFCH 2Z3YA 4ECRA 2K3FA 1D1AA 4PGHA 2X85A 4UUTA 4XICA 1ENHA 1MNDA 2R7ZJ 1YJNI 4KMFA 4Q5SF 4BU2A 1C0WA 3ZMVA 4BHBA 2FE3A 2R7NA 2E2IA 2EZLA 1H9GA 2Z2SB 5E18F 4XOTA 4BACA 4A3BJ 5GONF 2L9SA 2Q1ZB 3Q8SB 2GXGA 5LMNH 1BOAA 2O5RA 1I94H 1E3OC 4IRGA 3BAAA 5F6FA 1N34H 3OHBA 1J09A 2Y31A 2IGOA 3KTMA 3MWEA 4OIQF 2FEZA 2LDUA 4LF5H 2VB6A 3QAHA 1IXCA 2XGQA 3FHZA 1G6NA 1RPWA 4G3IA 3N97A 4DV6H 5DLGA 2B9SA 3FXQA 4YFXF 1JE8A 3H5NA 3KHRA 2R7FA 3FWEA 3H9QA 5CAEB 3NAUA 3K4LA 5FROA 2YZMA 5KG7A 5KKNB 3M9NB 5K5QA 2BQUA 4DR4H 5ILUA 4LB5A 1LVAA 1XDSA 1HCRA 1X4OA 4EJUA 3EDPA 2VONA 5B1BH 5LP6F 2HDDA 1S03G 2WV1A 5KFAA 2R5YA 1D0YA 3V4ZA 1EYZA 3ORQA 3NEUA 1EKEA 2V79A 2XAJA 3IRQA 3IG0A 4IR1A 1O4XA 2ZMEC 1I3QJ 4XNFA 3G4SI 4DNCA 3ZP5A 3N8DA 1G3WA 1MJBA 2WTEA 1U9NA 1UC8A 2V6CA 2A3SA 2Z16A 4ECXA 1ZK8A 3ZMSA 2G7HA 3ZQCA 3PL8A 4Y4RA 1IC8A 3BDDA 1M0WA 3DKWA 1W7PB 4L9VA 2C2DA 1Z3YA 1S7OA 4BEHA 1AWCA 4RZQA 3IAS2 5E17F 3ETHA 2Y30A 3RI4A 3GQCA 2WY8Q 1VQOI 5D8LB 5C5JA 2E2HA 3KHLA 2KISA 1WCMA 3JRDA 4Y33A 2P5VA 3ZGKA 2O6GE 1FT9A 2VQCA 1RI7A 4M9SA 1VQMI 1KZHA 2EPFA 1ZR4A 4JV1A 2FBIA 4O3MA 4IHVA 2HVSA 2HKXA 2GPSA 2WYOA 3BZKA 1O7LA 1YS6A 3LSTA 3MKLA 3CCVI 2DXIA 2J5OA 1MD0A 3OS2A 5IP7J 4ED7A 3BTCA 5GAGJ 2DQRA 5KVRA 4F4XA 2UVRA 4OIPF 2Z9OA 2VA2A 4HZFA 5K1YA 3DLLF 5IYDG 3DPTA 3UKGA 2LG4A 4KT5C 4NC6A 1U8RA 1UHWA 4J0MA 2VJ4A 4RMNA 4N9IA 1UC9A 2BZTA 4A3CJ 2R7UA 3QP6A 1SEUA 3RZOJ 4EATA 3RKQA 4MAMA 4J01A 1ETXA 2OQGA 5EZYF 2V59A 5L1IA 1JXLA 1YHQI 2Y0MA 3HXLA 1JUSA 3CLOA 3ECHA 4IPAA 1Y1WA 5H20A 3WE2A 4GYIA 4DIQA 2ECBA 4FETA 5A2QW 2KKOA 3M8JA 3A4CA 1JKJB 1TWHA 2QKLB 1K6YA 1QA6A 2CKZB 2Y9ZA 1SFKA 3HOVJ 2EIMH 2DCEA 2FOWA 2GPWA 3I58A 1ACIA 4NLGA 2Q2EA 3IRRA 3A1YA 4BYYA 2PJPA 1Z7UA 5L3GA 2NNYA 4A3KG 1MSEC 1Y56A 5C44G 2CH0A 4IL6C 1S0OA 1WJFA 2F5DA 3RB0A 1Z6TA 4W1UA 2DT5A 1OMIA 4FX4A 1KU9A 2MW8A 4O3RA 4LMYA 4E7HA 1P92A 1QZZA 2RKHA 2P6TA 2W00A 4XLAA 1V4YA 4IXAA 3T1YH 1FPQA 2VC1A 4OIOF 5KFWA 1HLVA 4O3SA 3BOQA 2W8KA 3UR3C 4CCMA 2OPTA 2K40A 3E0JB 4KN4X 4KISA 1E4FT 1SD6A 2JK3A 1B9MA 2PVPA 5KFVA 3FHNA 1BR2A 2AGPA 3MR2A 1KU3A 3KZZA 5FB2A 4XKCA 4B3TH 4P9UA 5HDGA 4LGWA 4A3FG 4J9SA 4JI0H 3C2GA 2VL8A 2H6BA 2XF7A 4LLLA 5JR3A 5I47A 4NXMH 1FSEA 4I99C 4ZYAA 2UXCH 4ED2A 1ZRFA 2JPBA 1D0ZA 3FDSA 2YU9A 4A3LG 3CCLI 2XVCA 2E34A 2ECCA 1DGRM 3ZMZA 1YJ9I 4R7RA 2MFZA 2XGEA 4DYCA 2P0AA 4C2MA 2A05A 3HPHA 4R8UA 3I4MG 2CFXA 5K5RA 1U8BA 1XMAA 2MABA 4ESFA 3IWZA 1Z1DA 4HAMA 4YB8B 1GYFA 4ME6A 2XSDC 4MA5A 1UB9A 4GKKH 2OV7A 1G59A 4DL6A 1FY7A 2HQAA 2CV1A 2A68F 3BA8A 3Q8QB 4KUMA 5H80A 3JAMW 2EFNA 2O3FA 3AYHB 1X2MA 2M05A 1R23A 3BQ2A 2EZKA 4I2OA 2BEOA 4IVNA 1FVIA 2MC3A 2VPRA 2K4BA 5E1XA 1G3YA 1XGMA 4CHUA 1R00A 2WC2A 5HS7A 4EJTA 1FOYA 4AWXB 2RREA 1CE8A 2KPMA 3GTMJ 1DU6A 5HV6A 2DDAA 3ZQQA 4RAZA 5BPHA 1XMOH 3A2KA 4BKXA 3I3LA 3ISPA 4IQ4A 4BNCA 3RJ0A 4Y52J 5TISC 2LK2A 3ORRA 2DODA 2ELJA 4II2A 3VPDA 5FO5A 1FOKA 1W5SA 3BQYA 1PP8F 3DKXA 4HBLA 3K6GA 2STTA 3HOVG 1K4SA 2QWWA 4ASNA 1MBKA 1LQ1A 4LSXA 2VUMA 3MZ8A 3L2VA 3IHUA 3S3MA 4FS2A 3L00A 3J80Z 4XYLB 4AVZA 2HFHA 4ESBA 2W9CB 5JQWA 4L9TA 5KFGA 3N4MA 3PW0A 4FX0A 3TQTA 2X4HA 1IN8A 2IPQX 3U1DA 2HPMA 2PX9A 2HYGD 1W96A 3BLYA 1KGSA 2HTJA 3OTOH 5EEHA 2K9LA 2B0LA 2DA1A 4G6DA 4LF8H 3QYEA 2HPIA 3K4JA 2X6YA 3I64A 5L1LA 4FS1A 2GZWA 3SZPA 3H40A 1N36H 2HU9A 5DM6F 3TQ1A 4ZZLA 1WSUA 1TQMA 1LPQA 1RKWA 2MA3A 1YG2A 3E6DA 2YR2A 5DGAA 4HYKA 5JH7F 5L1JA 5IT9Z 3M9MB 4IRKA 4JX4A 3BTJA 5ERIA 3Q8RB 1BW6A 2JA8G 1GV2A 2M2EA 2FJZA 5J2TF 4JV5H 4AYBE 2YSRA 3T8TA 3GFJA 5D6FA 1DP3A 3H9JA 3ZQIA 2XROA 4J9MA 4PGGA 2JMWA 2HEOA 2QYZA 5IOYA 2XPUA 4I01A 1ITYA 2X6XA 3EUKL 4HNVA 4DR2H 4DZJA 1XS9A 3PNVA 1SYXB 2DT7B 2LSOA 2PI0A 2FMLA 4P1WA 1Y14B 1KQ9A 2QYOA 2CQ7A 3TO7A 1O75A 1X3ZB 1VQ7I 1R7JA 3GTPA 3D5RC 1WFXA 4EGQA 5EGOB 3M8FA 5IYBJ 1BIAA 2K9NA 4M73A 2FB9A 2MLGA 2CQYA 1VS0A 3Q1KA 2VBXA 3MCZA 3QQAA 4LG0A 3WTSC 1KJIA 2J6UA 3CC2I 4ECZA 1FP1D 3ZMDA 3R0JA 5HVQC 1IRXA 4UB6C 4HNUA 1SFXA 1K1SA 4HG2A 3HEFA 3OS0A 3PJRA 2WB1N 1ZELA 2VPLA 4LLGF 1TQIA 3FXLA 3CCQI 5JVDF 1XCVA 1O3QA 3PUFA 1Y8RB 6PAXA 5AIQA 3G2BA 4ENNA 5IWAH 3H20A 4PWQA 1DPUA 4R1HA 1FTTA 4MV1A 1WHUA 2KRHA 1RR8C 3JRIA 2COBA 1CQJB 1AN7A 2JA8J 1EV7A 1WJAA 4A3CG 2E36A 2QZ8A 3D5SC 5LD2C 1HBXG 1DGSA 3LSGA 2ZC2A 5M5YJ 1VQPI 1KC7A 1WPKA 4ETSA 1LFBA 1ZYRF 5J4YA 2WAEA 2KL4A 3KETA 3KLOA 4IQJA 2YUSA 2QSFX 2Y0SA 2ZKZA 3F8NA 4B3SH 2ASDA 2VXZA 3LNQA 1T94A 1ZGJA 3IUOA 3K70C 2EWNA 1GVDA 2DAOA 3AKZA 4IRIA 1BGWA 3LP8A 5JHUA 3F8CA 2XKOA 4I0AA 4ZYHA 3HSEA 5FFZA 4JUZA 1J2XA 3W2VA 5ILVA 2R93J 4AD9A 1ORKA 2YX4A 1J9IA 2O8KA 2L4MA 3V4GA 4BS9A 3FKIA 5DQHA 1S72I 2WAQE 3ZMUA 1A6IA 3G6XA 4MQVA 1TZLA 4XIDA 4Z6YA 3DTEA 5F27A 5HLGA 1XSVA 3RIZA 3P9CA 4ENMA 1R5GA 5IYCG 3N40P 3PUBA 1MH4A 1HDPA 4G6QA 5K5OA 2V1UA 5FLMJ 5C4XJ 2I80A 4M9ZA 4LF6H 2O9LA 2W82A 5DQGA 1U0JA 5L3BA 1RESA 2YRWA 4KN7X 2PQ8A 2VKVA 3ZXSA 1SFEA 1PK8A 2VJ5A 3BC8A 3L09A 4RAFA 2GA1A 4DYQA 1MMSA 2ZM6H 1BN5A 4HLXA 4BEHB 1AHDP 4L0ZB 5IOZA 4RZRA 3KHHA 1JHHA 3TP0A 2R8HA 2C22A 3ASNH 3OYDA 3IKTA 3LMLA 5KFIA 3J80W 1R58A 1S7AA 2BY0A 4BQOA 2Y48A 2DA3A 2R0QC 3E97A 2IS1A 3OYBA 1LEBA 2DA5A 5DCMB 5IYDJ 4UB8C 2K86A 3MR3A 4LH7A 2W9BB 4EYIB 4XLPF 3CQZA 2CS3A 1GGOA 3F0CA 3KX2A 5L3DA 3IV5A 2JJ7A 3HUGA 2J6TA 3KE2A 4ECWA 2J9GA 1Z2OX 1T8IA 1E4GT 5TRDA 5DTDA 5KG6A 2CW7A 3EPZA 1Y1VA 2ZBKA 3A02A 3NRVA 1T6SA 4UY8I 4YQWA 1D5VA 5E3MA 4MHGA 5BMVF 4F92B 4E7JA 3DEEA 3MN2A 3CCRI 1D1CA 4APMA 3AAFA 1Y8QB 2VQGA 4KT6A 1OCZH 2GBYA 4BJ6C 1K6OA 3DXJF 2A07F 2H27A 1BR4A 3HPGA 2EFQA 3WTTC 2VKDA 3WGIA 1C3OA 5KFEA 4KIGA 3HYIA 3LSKA 1OR7C 1X3UA 1TQPA 4CC5A 2PBIA 1ZHSA 3PN1A 3V6JA 5KFNA 4M3FA 1I7NA 3SZGA 4MLOA 5BMZA 2Q2EB 2ZDQA 4CYDA 3TOBA 1UG2A 3FXOA 3G3ZA 3BQZA 3OUUA 4FT8A 2XGDA 2ESNA 2Z1DA 4MQ9F 5E20A 2XC7A 4A93J 2WDTA 4J19A 3E6BA 3MD2A 3LSRA 3AL0C 2IS6A 3MKWB 2EFOA 4JI2H 4JI7H 4PJJA 1APLC 2W7NA 1S5LC 1XG1A 1R4MB 3EUHA 1IV6A 2FPGB 3MQ0A 3HGYA 1PJRA 1QHHD 2R3SA 5LFAA 4KMUX 2W6NA 1J5EH 4YFKF 2W25A 1P2FA 3BTIA 3REOA 1ZGAA 5CVUA 5JFRA 1K79A 1H8AC 3WU1B 5KFXA 4E4HA 3HRTA 2ELKA 1FBSA 4N9HA 3TL4X 4A3KJ 3OR2C 3GIQA 3GTJA 2DZDA 2OTJI 3AFHA 2F4MB 1R36A 2Q0OA 3K4KA 4Y17A 4I4TF 1MMNA 4M7EA 3K9TA 4JOMA 3CVZA 5TJJA 1R6RA 4HA8A 3NQOA 4ZZDA 5KFRA 1JKRC 4FBUA 4EEFG 5JVGF 3ESWB 3GYHX 4HNTA 3D1NI 1RJPA 5K7ZA 1ZLKA 4M71A 3M07A 4CCKA 1BNCA 4XBFA 2AU0A 3MKZA 4YIFA 1YX5A 3KP2A 1TWGA 4QSHA 4A3MG 1HSJA 2JEGA 4FQGA 3F8FA 3L2RA 5AONA 1DV1A 4EYHB 2WAFA 2CG4A 4GFBA 5KFHA 1GLNA 1VKZA 2XHKA 1FMWA 1N48A 1KU2A 4RGSA 1JT6A 4Q44A 3PW7A 2FF4A 3FK6A 2ZXIA 2EINH 3QP5A 1YIOA 3HSFA 4ECQA 2NOGA 4ZDLA 5D5UB 4E7LA 3VPCA 3NARA 3WG9A 3PQKA 4WX9A 4A3EG 3RF2A 3I54A 2LF7A 2DOAA 4WBNF 4X0GA 1N78A 1RYSA 1EZ1A 2DI3A 1LUJB 2RQPA 1N56A 3TO9A 3MMYB 3L9FA 3DWLE 1WGXA 1STZA 3QPSA 4PFOA 3RPUD 4JI3H 4WD3A 4X62H 3BCBA 1MMDA 1XNQH 3B02A 4BBSG 2HKOA 2K9QA 5JLWA 2CMPA 1LE8A 1GSHA 2F4IA 4IOAF 1L0OC 3ABLH 4OWRB 4RB3C 4UCSA 2F4VH 1RUNA 3CC4I 3BG7A 3VYSB 2VOBA 1R4NB 1OLTA 5D8KB 4GRIA 1UHSA 3ABKH 2VBZA 4V2FA 3BJ6A 3DTIA 4JYAH 2CYYA 3SYTA 4B8XA 1TWCA 1WQ2A 4XLHA 1I6HJ 4WF2A 5LOVF 5ED4A 2E1MB 2DYSH 2V1XA 4C2TA 4G6TB 5CVJA 4LF9H 2ZFWA 3QODA 2VQDA 1GXPA 1X2NA 4G9YA 3GLLA 4XRSG 1E17A 4UVAA 1Z91A 1BJTA 2DK8A 4CCJA 4U6PA 3KZYA 3O8HA 3A0HC 2W7PA 3FXMA 2LR8A 2H8RA 4QWCA 4EQQA 5LRRA 5KFQA 1OCTC 1XX5A 4ZHQF 1LNWA 3VMMA 1YX3A 1Z0XA 2A6TA 3HOZG 4PFPA 3B6CA 3H3ZA 2CRGA 2A6EF 3HOTA 4B3AA 5DG7A 5M3MJ 3RUPA 1HW2A 3HKZE 2JA6J 1G8XA 3Q5FA 4RM3A 5CPRB 1X1PA 4BJTA 3C2BA 3SFZA 1GUUA 3TW7A 4DR5H 1Y1WG 3ZOBA 5E8GA 1R49A 2M4KA 3RGZA 3L2QA 3IH4A 3GX4X 1R9TA 2M0MA 4BJ5C 3IWFA 5FPOA 5EDWA 2R7WA 2RVCA 3K70D 5KFPA 1J75A 3SFIA 5KFCA 2UXXA 4ENJA 3PFIA 3RBEA 2CV2A 4RLFA 4R79A 1MZBA 4L5JA 1BL0A 1NK3P 4EGJA 3BQ0A 2M9HA 2RF4A 4J00A 2CW8A 2DFIA 3PZPA 1S29A 4JX5A 3BG5A 3I5UA 4EM2A 4A3EJ 4LLNA 2IMWP 3JAMK 2NU7B 3Q0VA 2KHMA 4OU0A 3PSFA 1QU3A 4G94A 2NVXA 3N42B 3BY6A 2G0EA 1D0XA 2NXNB 2MCTA 4D5FA 4GYGA 1FX7A 4RU9A 3K0LA 4FHTA 5LBQA 3JRHA 1MMGA 1CF7B 3T5HA 4MV7A 3KHGA 2IBKA 1OISA 4N0BA 2R84A 3L2PA 2E60A 3S93A 2XGXA 5J1RA 3HM5A 2QKMB 2LYCA 3WE3A 2E7WA 1MKMA 1TWCJ 2AS5F 3OHAA 4EEQA 2VJIA 3SI8A 1FKAH 4GKJH 1NK2P 3GZNB 1OKRA 3PIPF 2R7ZG 1W36D 3R5HA 5HNFA 3G6YA 3FM5A 5GAEJ 3HOUG 1Z7LA 1XGNA 5J6XA 1R1UA 1Z67A 3V4SA 3FXRA 4XKVA 1G3TA 2PMHA 2X9DA 1N25A 3OYNA 4HPQA 1IAWA 1T33A 3K3VA 3GTJJ 3GF2A 5LHHA 3H5RA 5CA1F 2HGSA 2PN1A 3QOPA 5J3LA 3BPVA 5GAHJ 3ROUA 2NVQJ 4U88A 2QBYB 4GO1A 3RPUA 5KT5A 2L4AA 1FTZA 1V54H 1W93A 3OYAA 3G8CA 4M74A 1O3SA 1V5EA 4PUSA 3BCAA 4LK1F 1WR2A 1H89C 3HDDA 3TIIA 4EFBA 3KAKA 2GIVA 2L54A 2VXDA 4Q8EA 4OX9H 4HF0A 5H6QA 1VQ9I 4J9OA 2FQ3A 3BZCA 1J0RA 2R7XA 3OL3A 4HDUA 4BDYA 4PK4A 3DPLC 2SCUB 3RIRA 1MMAA 3GTLA 1LEAA 1QRYA 4PDKA 4U0VA 4OINF 3BR0A 1KQ8A 1SAXA 4JI6H 1Q1HA 1YW7A 1NG7A 2VLAA 2LKSA 4UCVA 2Z99A 3T5JA 3S15J 1ERDA 2W85A 1USTA 1OJLA 4Y7NJ 2CW0F 1SC7A 2YX7A 4C3IJ 1ZG1A 2F5CA 4ITVA 2FNPA 3JRGA 3EUAA 2LNBA 1IG7A 3GTGJ 1SEIA 4A0XA 4C5BA 5HS8A 1JUPA 2JSPA 2HDCA 4QPOA 1UJ8A 3R6SA 1RC9A 1VQNI 1WCMG 3CUQB 4H4KC 2GLOA 3KIOA 4DV4H 1BJZA 3HOUJ 3BG6A 3GUDA 5ILSA 3L4JA 2J6SA 2OAZA 4P5OA 5D8DA 4EMSA 4E7KA 3X2QH 2IVMA 2L02A 1A36A 4I98B 3HG9A 4KDPA 3P5JA 4WXDA 3A01B 4DUYH 1X3WB 2L7FP 4XN3A 5FJ8G 5F9LA 3K5HA 5HDNA 5LMUH 5KFKA 1DUXC 4XLEA 4MGRA 2FPIB 5FLXK 3MR6A 2LKXA 2TRTA 4FTHA 1RIOH 2JA6A 1KU7A 4BE0A 4G7HF 1SFUA 2E2HJ 3GWZA 3VWBA 4YR0A 1AOYA 5L1KA 5M5XJ 4RB0A 3CESA 3ZN0A 2WTFA 4I76A 1BOBA 3HIFA 1KYWA 1B33N 4DL3A 2UUCH 3S8PA 2D1VA 5HLIA 4A3GJ 2XF5A 2IAIA 1MBGA 3K2ZA 4CZCA 1USSA 2ETHA 2XSJC 4E70A 4ED3A 2QGUA 3K1PA 3KPHA 2DA4A 1X9NA 2JEIA 3E3VA 1K83J 2X48A 4EVIA 4YFNF 1F9NA 2DA7A 1S0NA 2I5UA 3L2CA 3L7WA 3HHGA 4NUBA 5EG0B 4F4YA 2UUBH 1ONVA 1GT0C 1S97A 5IT9W 2O61A 5DUIA 5LLQA 4G8XA 1U2WA 2GXAA 5ICEA 5DD8A 2MH9A 3OIQA 3GIIA 4LFBH 2EV6A 4YR2A 5F64A 3FMQA 1LDKB 3WO1A 3RFCA 2LMDA 5J1YA 2CV0A 2XAFA 4N4NB 4XZ3B 2H8WA 5KG2A 1FIPA 4F7ZA 2JQ7A 3FDYA 4YIIA 5C4JJ 2UZKA 1AUVA 3GIJA 3RBDA 1AA7A 1POGA 1OYWA 2IJLA 1ON1A 3ZQGA 3SDGA 2CGPA 3F8MA 1A35A 4XLFA 5DS9A 2KSWA 3S16J 1FC3A 5KFZA 3ZQFA 4UVCA 3DLAA 4BBRJ 4MV3A 3EQLF 4UCTA 1HSTA 2L7ZA 4MTDA 4IHYA 4ANJA 4KHPH 3TKYA 1TT0A 5FKMA 4D0PA 1OR7A 1UZCA 3VOEA 4A3DJ 4A2UA 3CDLA 3U9TA 3SHFA 4OMZA 3GTQJ 5DCFA 4IHTA 5D1OB 1T36A 3CLQA 3VYRB 1YLFA 3G1OA 3AG2H 3OYHA 2WAQN 4A2BA 2X1DA 3TDZC 1S10A 3C0FB 2FLLA 4LOCA 2IXSA 1G3SA 5IPAA 4RUCA 1VZ0A 2R7RA 1D5YA 3CZ6A 4I0BA 4B3MH 1W1WE 1FIAA 2JRMA 3RPQA 1PDNC 1XN7A 2M8GX 5FJ8J 5FLVA 4C2MJ 1ZREA 1U5TB 4BL0B 4DR7H 3TMOA 3GV5B 1ZAOA 2XV4S 2P4WA 4DOZA 2AGQA 5KG1A 3HB9A 5J8CA 2VQEH 3V8KA 1O3RA 2YS9A 3EETA 2W4SA 4MTEA 4DV5H 4XRFA 3JSOA 2WY7Q 4O3QA 5C8YF 1ZN2A 2DFHA 2VQLA 2QA4I 1E3PA 4BQAA 2ZJRF 2R4GA 3KXYT 3LFUA 3E5QA 3R5FA 3H3UA 3L4KA 1JGSA 2NYXA 4WXHA 2CUJA 4DBQA 4IKFA 3KYDB 2NVTJ 1YS7A 3V7RA 4A5MA 4FM9A 3CJRB 1V55H 2RAEA 1FYLA 4U7CA 4OIRF 4CO8A 4YG2F 4F55A 3ZQLA 3WTZA 3BG9A 1HF0A 3GTOJ 2X1CA 4A3IG 5IY5H 1F36A 2J5PA 3ZQ7A 1X1CA 5K7HA 2E1MC 4JYKA 3JCUC 1BBYA 1S3JA 3A01A 4C5AA 3JSNA 3TOAA 3T8RA 3WTYC 1R71A 3TO6A 1UFMA 2GOMA 4M6XA 4XKBA 2YL2A 3H0GA 1X1DA 1Z21A 4A6EA 3OY9A 2E1CA 1IXSB 4MFEA 2DMNA 3IH2A 3RKYA 2EQRA 2C28A 1LVKA 2NVXJ 4A3GG 1I5ZA 1U9OA 4JBAA 2STWA 3DBLB 5JVLA 4Q43A 4DW6A 4FE4A 1XMXA 1IXRC 3W3CA 2E1OA 2CSOA 2L9RA 1PUFB 1BW5A 1IW7F 3T5XA 4ESJA 5DM7F 1T39A 4JV0A 2F48A 3RV4A 4E4TA 5T14A 3R60A 5DYMA 2F5FA 3LMMA 3EYIA 1QBJA 2HJWA 1NG6A 9ANTA 2V5AA 1SAUA 3OIOA 2R5ZA 3LQQA 4UVBA 4XLNF 3MZHA 4UFZA 4HX8A 5D1PA 5DV5A 1R5HA 3QYBA 4B3RH 2X1EA 3R5XA 3GEZA 3OL4A 2R7TA 3H0GG 2OQRA 2R92A 3CCJI 3WG7H 4OMYA 3ECOA 3W2AA 1Z2NX 4Q0YA 5GTIC 1WI3A 1G4DA 2P8TA 2P5LC 2ESHA 2YW2A 1Z6RA 2CFOA 3LAPA 1RJQA 2VKEA 4UV9A 2FA5A 5E79C 3G73A 5FPRA 4C3JJ 4EJVA 3KYLA 2UXNA 1TP4A 5L3EA 3L2WA 1JJ8C 4AIHA 1VQKI 5KFUA 1WCMJ 4XSXF 4EV0A 3BG3A 1QVTA 4ON0A 3BR1A 4LJZF 4HDVA 4B4CA 2ID6A 3IH3A 4DBRA 2HQRA 4BH9A 3P7NA 3TDUC 4ECSA 4EM0B 1HOMA 1T0FC 1RJRA 3V6KA 4G7ZF 4EBDA 3LAJA 1IBMH 1H9TA 2ZB9A 1M0TA 3F3XA 2R8JA 3IP4B 2BE5F 4K2EA 3NWTA 3T0YA 3J81Z 3KLNA 4NXNH 2C6YA 1RNLA 3SZTA 2E2JJ 4B47A 2R93G 1XSXA 4L5EA 1FP2A 3GIPA 2K9MA 2V4QA 4KJZA 4ZDPA 1VQLI 2HOEA 4C2UA 3DBHB 1TL8A 2M87A 3LSHA 2XCLA 1JHFA 3ABTA 3FXJA 5H6RA 1PUFA 1A04A 2ZSIB 1ETOA 1RRJA 4FBTA 4BAYA 3RQIA 1I7LA 1PP7U 1YE9A 3G1MA 1Z2PX 3OOUA 2EA4A 1ZH5A 1ZQ3P 1UG0A 3HOWJ 4LITA 3I4NG 4XSZF 4HW0A 1TC3C 3SQNA 1ZG5A 5KCMA 4HQEA 5EZHA 2CQNA 2ZDHA 2V9WA 4AIJA 1KJ9A 2PMZN 1ZTRA 5F08A 2W57A 1EHIA 1OYIA 2ZO4A 3M8EA 2FPPB 4U7BA 4WK8F 2KIFA 3VODA 1FYMA 2CJJA 2LY1A 1OCPA 2R7ZA 1V5FA 2NAZA 5JI6A 1S8NA 5LXTF 1TWHJ 4CCOA 4UCUA 2YS6A 2QQAA 4TQSA 2QQ8A 3L1PA 2EIJH 5H2FC 3CUQA 4IHWA 3KAJA 4HX4A 4ED1A 4P55A 4HQ6A 3CF2A 1X4PA 5E1ZB 2HR3A 4A0ZA 1XMQH 2NUAB 5JLXA 1XB4A 3MR5A 1Z9CA 2VE8A 1RZ4A 5KT4A 1ZHFA 2XAUA 2ZXWH 1GDTA 1JKPC 2WWYA 3N43B 4A3MJ 1MW7A 1H0MA 3GTPJ 4IRCA 3WHCA 2DMUA 2NU9B 2DPJA 2HS5A 1EUDB 2OLSA 2X6WA 4LH6A 3J7YJ 3M7GA 3WTVC 2FMYA 3M3YJ 4IZZA 1TWFJ 3Q3SA 5FKNA 4LFUA 4JP0A 5E3NA 3RDIA 2ME6A 1IO2A 3JRAA 2P81A 2RGRA 1P4XA 1IDZA 4QJFA 4CYCA 3COAC 3V8JA 4BY1J 1FJLA 3L2UA 2XRNA 2HWVA 2EV0A 1TWAA 3BR5A 1K78B 5LGUA 2ZJ2A 4XN0A 3DCFA 3W2WA 1EH7A 1E4EB 4RBOA 2WB1E 3BR6A 2DU9A 4XYMB 2JUCA 5FKOA 2V7FA 4GGGA 2UWMA 2JUGA 2E5ZA 2IP2A 3VPRA 3GZ6A 1YTYA 5KG3A 4YY3H 3VSKA 4L0YB 2FSWA 4UHTA 2R7OA 4BQNA 4A12A 2QSHX 4MA0A 2VJJA 2GQQA 3DEWA 1M6VA 2R7LA 2NVYJ 5D4SA 1T0FA 2FNAA 1DU0A 3M1CA 1PUEE 1P8LA 2E71A 2R7SA 2HOAA 4M9UA 1TBXA 4CA0A 2P0WA 5IYCJ 5EOYA 5DQIA 3QYFA 2L9NA 4FISA 4DV3H 4X6AJ 5J8FA 2W6PA 3OUZA 2DA2A 3WU0A 1Y1VG 4NC8A 1FOXA 5ICGA 1T2KA 4PDBA 3I0TA 1S6LA 3BABA 2H94A 3GV8B 1D8JA 4RGUA 3N41B 1KQ0A 1I1SA 4RB1A 1JDBB 2M1BA 3T1HH 3J81W 4RGXA 2KZGA 1FBQA 5EDNA 1RETA 1JKOC 3GTMA 4IX7A 4S04A 2LD5A 2EIKH 4R8UB 2LVSA 1SFOJ 1AKHB 5E8IA 1ETWA 4HRIA 3HOWG 2HYFA 4ZQIA 1S9HA 3ML6A 2L01A 2LTPA 3KCCA 5BPIA 3V8LA 5F1JA 3KYCB 2VPSA 2OUMA 3KP5A 1BI1A 2OF7A 4DJAA 2R92J 2TCTA 2VOPA 1AUXA 3RKWA 3CD6I 1DPRA 3C18A 3LWFA 1EF4A 1FEXA
chains in the Genus database with same CATH topology
2XUBA 2RDPA 1F4KA 2O8XA 4KYWA 4AVPA 4JI5H 1QPMA 2RV8A 3DP7A 1MDMB 4A2AA 1U5TA 1YW9A 5E1WA 3IL2A 4H0EA 5CVRA 3JAMZ 3D5LA 4TV7A 2DPDA 1KA8A 1F5TA 4Q47A 3J80K 3WGHA 4LFAH 2JT1A 1E2XA 2HHHH 3ABUA 4RS8A 1B59A 4LK0F 4B09A 4L18B 1ON2A 1DP7P 1V3FA 2K4JA 1OYYA 3J7AK 3M4IA 1SD4A 1IN6A 2W24A 3FM3A 1HKQA 1TW3A 2UXDH 2K27A 4U0YA 4X66H 4Y15A 2PEXA 3M9AA 4WXCA 3LA2A 2XIGA 3CJNA 1W7PD 3R0AA 4I02A 4RB2C 2XAQA 3MWMA 5DD4A 2D2WA 2JTVA 2ZJTA 1EH6A 3DF8A 1XMKA 2VBWA 2AXLA 5HLHA 2UU9H 3RYPA 1BI3A 2IT0A 3V7CA 3P9IA 1WH2A 3KALA 1DDNA 5A2QZ 4Q4ZF 1TNSA 1IZ1A 1UHMA 2F5EA 4ZYDA 1NHAA 1B04A 1YQAA 4LF4H 1R1VA 3ERED 4GXOA 1N32H 2RN7A 2VBYA 2NS0A 1IBKH 1N33H 3E6CC 1I6UA 2RNJA 2JRTA 4LB6B 4JI8H 3VB2A 4ENKA 1UCRA 1ZRDA 1WKMA 4MEYF 1J5YA 3GO5A 2EFWA 5LL6b 4YHHH 3BWGA 5EEGA 1GHCA 3R4KA 3BJOA 4KFCA 4KNYA 2W84A 5BPDA 2EB7A 3F23A 5BOXA 5FD5A 3U2RA 3O2PE 4DV7H 3I4PA 4GLXA 1XSDA 4KICA 2FU4A 3C1DA 2M30A 4UUVA 4OOIA 1SMTA 5DCMA 3U9GA 5LRSA 5D5WB 1BI0A 3CUQC 2OD5A 2TDXA 4HQMA 4K0KH 4P9FA 3K1MA 3LQRA 4BHPA 2ZXJA 1ZHQA 2HTSA 2GWRA 1JXSA 2FOKA 4LSAA 3KP7A 5D6EA 3GLXA 3RTRA 2WE6A 1HNWH 3UQ8A 1I27A 3CO6C 2D45A 3KP4A 4ZYEA 1HR0H 4EGYA 2XAGA 4ZYGA 3Q9VA 2MLKA 1FZPB 3QPHA 2BBYA 2GXBA 4MEXF 1FLIA 2LKPA 3MFKA 2X0LA 5CLSA 4UNOA 1XGOA 1L2ZA 3GW2A 4M9XA 1P6RA 3HRUA 4KIFA 1LJ9A 1TAEA 2E1NA 1BI2A 4LD5A 4WWCA 4NQWA 1SD5A 3GFLA 4BXUA 1U78A 5CVIA 5CJ9A 3V7SA 2H6CA 1B6AA 2PN6A 2XKPA 4DQ2A 2DW4A 3WTWC 2JSCA 5HOOA 3DF7A 2KJBA 3JTHA 5DEQA 1ZARA 2DBBA 2A6HF 2HZTA 5A2QK 1FJGH 1FSHA 1WI9A 3RKXA 1IN5A 2VQFH 4IJAA 2L3DA 4IAJA 5L3FA 2MD5A 4X65H 4UCOA 2MH2A 1EH8A 2A61A 4U7DA 1GXQA 5D4RA 4EGZA 2A69F 2RC4A 2E7XA 1HW1A 1MJAA 4I09A 2DQLA 2FBHA 1HKTA 4PZJA 2EFPA 3VFZA 3DFGA 3PQJA 4HF2A 5DDGA 5FLXW 2Y75A 4L9NA 2OA4A 4MV9A 1MJ9A 4CGZA 4A5NA 3QRFF 1QO0D 4JI1H 4A0YA 3LA7A 3WGGA 2KIUA 5FFXA 4HYEA 4I7HA 4IHSA 4UCRA 3F6VA 1SMYF 3MEXA 4G7OF 3FF5A 3JW4A 4CXFA 5IT9K 3DEUA 3QPTA 3CUOA 4WCGA 4CDGA 2BYVE 3DV8A 3BROA 3KFWX 2QQ9A 3T1BA 1S68A 5AIPA 1Z05A 1IN7A 2KJCA 4DV0H 1XD7A 4S05A 2YU3A 4U0WA 2H09A 3TGNA 1J7KA 4DUZH 3LFKA 2DK5A 1IBLH 2VN2A 3BZ6A 2JZYA 1O3TA 2EK5A 1ZLJA 2PLYA 4QLCU 1J59A 2IW5A 4DR6H 4L9JA 2YPRA 3IKVA 5KK1A 3E6MA 3F21A 2WV0A 1BC8C 3JSPA 2Q8KA 2QENA 3WTUC 2Q2UA 3CDHA 4BHCA 2UXBH 3HOSA 3MAJA 5D5XB 3O6BB 1QNTA 1YO5C 2A5YB 2OZ6A 1T98A 3GXOA 3FMRA 2D1HA 2JPCA 1CF7A 4IRHA 4Q48A 1HW5A 4BWSC 1FBUA 5ICCA 3O3KA 4AIKA 3SXYA 2VT3A 1BJAA 1YYVA 3GFMA 3I59A 2ZNZA 2DPUA 3BPXA 1D3YA 1L3LA 1LB2A 4HF1A 2FXAA 2GA2A 1HNZH 4CC6A 4DR3H 2ZCWA 3K1NA 3CTAA 2KIMA 1IF1A 3B73A 3IC7A 2PG4A 3E5XA 3RJPA 3K69A 5LHIA 4HV6A 1LDJA 1OPCA 5D5VB 3P9KA 5BQTA 3N6XA 4A6DA 2V1DA 2VUGA 2LF8A 3HSRA 1B4AA 2FRHA 5BR8H 2CWEA 2G7UA 1TA8A 4HV5A 4HOBA 4PCQA 1IUYA 3HTSB 3J81K 1TTYA 1FNNA 3C7JA 2BGCA 1B9NA 2ZMEA 2IA0A 2QM3A 4DR1H 3F72A 3HTUA 3W6KB 5CYVA 4JQFA 1I6XA 3KEOA 2M5WA 5CVVA 1Y0UA 2O03A 4IF4A 3QU3A 2PFBA 2OZUA 2EJRA 4ZH4F 3JTGA 3GZ5A 3RTXA 3ZPLA 4JK1X 3RYRA 1YFHA 1V4RA 1BIBA 2M8EA 3ELKA 1I1GA 5FD6A 1O7FA 3EYYA 4EM1A 3S2WA 3FX3A 4CICA 3JSLA 4DV2H 3OOPA 4EJOA 1WRJA 2ELHA 2G9WA 4EJWA 2ZMEB 3F22A 4AQYH 2F2EA 1YW8A 3GVAA 1RUOA 3W6JB 1TW2A 2OU2A 3WODF 4NHJA 3RGXA 3HRSA 1XCBA 1GVJA 4LG0B 4DV1H 1CGPA 1HNXH 5IT3A 2O0YA 4KA4A 3BJAA 2P7VB 4MNUA 5L3CA 1IRGA 3TQNA 1ULYA 2Q2TA 2CQKA 3KEQA 3BA9A 2P7CB 1ZG3A 5FLXZ 1BC7C 2ACJA 2BV6A 2IA1A 1K78A 3D0SA 1MDMA 3KP6A 1D8KA 4UV8A 2XASA 1XDNA 1U3EM 4CZZA 2ISZA 3DQVC 1REPC 1MGTA 2KRFA 2QLZA 3R61A 3ZMTA 1T38A 3WTXC 2COMA 5LGNA 3I53A 1QZYA 4HLYA 5JVTA 3GFIA 2UUAH 5F1RA 2VC0A 5LHGA 3BP8A 1HQCA 3Q9SA 3LA3A 4M6YA 2YCHA 2VT2A 2DLLA 2IRFG 1FYKA 1A0IA 4JI4H 1F1ZA 2HVQA 3F6OA 5D1OA 4X64H 4R8HA 2GAUA 3I71A 3H92A 4EFEA 2IA2A 2NRAC 3N44B 3FMSA 1XDUA 1R22A 3M1EA 1K7AA 4LF7H 2K02A 4O5VA 1BM9A 2HVRA 4RAYA 2OBPA 2CO5A 1TLHB 1V9PA 1XGSA 2Z33A 4Y13A 1ZRCA 1U6GA 5LGTA 3FXUA 4QWQA 2NNNA 4O6JA 2FBKA 3HRMA 5ICFA 3VEPA 1WWXA 3FMAA 1VTNC 1W4MA 1IRFA 1FWZA 3MZYA 4KIBA 2PMUA 5DUKA 4UXNA 2ADUA 1HKSA 3KP3A 1O57A 1U5TC 2P5KA 2EV5A 1SD7A 2ZNYA 3ULQB 2MBFA 2HGCA 2P6SA 2OWOA 5LEJA 2VOOA 2VODA 5LEKA 2ISYA 2K7LA 4L5IA 3F8BA 5HS9A 1XNRH 2HQNA 2Z5UA 1B1BA 3I59B 4RGRA 2QQBA 2DTRA 3E5UA 3QU6A 1P4AA 3HHHA 2R7DA 1QQIA 4Z2YA 2VE9A 5HDKA 1W5TA 5BS6A 1TNTA 3C3WA 4M72A 1LDDA 5FGMA 2QVOA 1P4WA 1IN4A 4NB5A 3CO7C 3J7AO 1R1TA 2E5LH 2QUFA 4P96A 2QBYA 2M45A 1ODDA 3FZVA 2EA2A 4HX7A 2V9VA 1W7PA 2RGVA 1KYZA 4GCVA 2XAHA 3ZN1A 3OV8A 1HXDA 2DO7A 4LFCH 1QGPA 2Z3YA 4PGHA 4KMFA 4Q5SF 1C0WA 3ZMVA 4BHBA 2FE3A 1H9GA 5E18F 2GXGA 5LMNH 1BOAA 1I94H 4IRGA 3BAAA 5F6FA 1N34H 4OIQF 2FEZA 2LDUA 4LF5H 3QAHA 1IXCA 3FHZA 1G6NA 3N97A 4DV6H 3FXQA 4YFXF 1JE8A 2R7FA 3FWEA 5K5QA 4DR4H 5ILUA 4LB5A 1LVAA 1XDSA 4EJUA 3EDPA 2VONA 1S03G 3NEUA 2V79A 3IRQA 2XAJA 3IG0A 4DNCA 3ZP5A 1G3WA 1MJBA 2WTEA 2V6CA 2A3SA 3ZMSA 2G7HA 3BDDA 1M0WA 3DKWA 1W7PB 4L9VA 1S7OA 1AWCA 4RZQA 5E17F 3RI4A 5D8LB 2P5VA 2O6GE 1FT9A 1RI7A 4M9SA 2FBIA 4O3MA 2HVSA 2HKXA 2WYOA 1O7LA 1YS6A 3LSTA 2J5OA 1MD0A 2DQRA 5KVRA 4OIPF 2Z9OA 4HZFA 5K1YA 3DPTA 4KT5C 1U8RA 1UHWA 4J0MA 4N9IA 3QP6A 2OQGA 2Y0MA 3HXLA 3CLOA 3ECHA 4IPAA 5H20A 3WE2A 4GYIA 5A2QW 2KKOA 3I58A 2Q2EA 3IRRA 4BYYA 2PJPA 1Z7UA 5L3GA 2NNYA 2F5DA 1Z6TA 2DT5A 1OMIA 4FX4A 1KU9A 4LMYA 1P92A 1QZZA 2RKHA 2P6TA 4IXAA 3T1YH 4OIOF 1FPQA 2VC1A 3BOQA 4KN4X 1E4FT 1SD6A 1B9MA 1KU3A 3KZZA 5FB2A 4B3TH 4P9UA 5HDGA 4LGWA 4JI0H 2H6BA 4LLLA 5JR3A 4NXMH 1FSEA 2UXCH 1ZRFA 2JPBA 2XVCA 3ZMZA 4R7RA 2CFXA 5K5RA 1XMAA 4ESFA 3IWZA 1Z1DA 4HAMA 1GYFA 1UB9A 4GKKH 1FY7A 2A68F 3BA8A 4KUMA 3JAMW 2EFNA 2O3FA 1R23A 4I2OA 2BEOA 4IVNA 1FVIA 2MC3A 2K4BA 5E1XA 4CHUA 1G3YA 1XGMA 1R00A 2WC2A 5HS7A 4EJTA 4AWXB 4RAZA 1XMOH 3ISPA 3RJ0A 4BNCA 5FO5A 1FOKA 1W5SA 1PP8F 4HBLA 2STTA 2QWWA 4ASNA 1LQ1A 4LSXA 3IHUA 3L00A 3J80Z 2HFHA 4ESBA 4L9TA 3N4MA 4FX0A 2X4HA 1IN8A 2IPQX 3U1DA 2HYGD 1KGSA 2HTJA 3OTOH 5EEHA 2B0LA 4G6DA 4LF8H 3I64A 2GZWA 3SZPA 1N36H 4ZZLA 1WSUA 1TQMA 2MA3A 3E6DA 1YG2A 2YR2A 5IT9Z 5ERIA 4JV5H 2YSRA 3T8TA 3GFJA 5D6FA 2XROA 4PGGA 2HEOA 4I01A 4DR2H 1SYXB 2LSOA 2PI0A 2FMLA 1KQ9A 2QYOA 1O75A 3TO7A 1R7JA 3M8FA 1BIAA 4M73A 2MLGA 1VS0A 2VBXA 3MCZA 4LG0A 3WTSC 1FP1D 3ZMDA 3R0JA 5HVQC 1SFXA 4LLGF 1TQIA 1XCVA 1O3QA 6PAXA