4RAZA

Crystal structure of magnetospirillum gryphiswaldense msr-1 holo-fur
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
134
structure length
134
Chain Sequence
MVSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELYGVPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding transcriptional dual regulator of siderophore bi
publication title Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Metal binding protein
total genus 44
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4razA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4razA02
2VBXA 2DI3A 3ABTA 5HVQC 1O7LA 1FT9A 3KETA 4L9TA 2K4BA 3HRUA 4UVBA 1HW1A 1V4RA 1YFHA 2JTVA 3FXUA 1H0MA 4U7BA 4OINF 5J6XA 2OAZA 3BPXA 2E7WA 3JTHA 4Q5SF 5K1YA 4L0YB 1LDKB 1BI0A 2IA2A 4QLCU 1QBJA 2K02A 2LDUA 4G8XA 1F5TA 2HS5A 3EDPA 4EVIA 2GQQA 4YIIA 4IRGA 4HBLA 5BS6A 1UHWA 4HLYA 2FOKA 4OIOF 1SD4A 4FX0A 4KICA 2FSWA 3E6MA 2M45A 1HXDA 2V6CA 1XDSA 4YFXF 1U6GA 2OQGA 1SAXA 3HUGA 2FEZA 1BC8C 3ELKA 2EWNA 4KIGA 4OIPF 4M9ZA 2NNNA 2H6CA 4YG2F 2VT2A 4G7HF 5HLIA 3E6DA 4ENJA 3IC7A 3IHUA 1P6RA 3GZ5A 3WE2A 2X4HA 1OPCA 3EQLF 1ZG3A 3CTAA 4LB6B 5IT9K 1ZLKA 2L02A 3I4PA 5AONA 4OMYA 2MC3A 2XKPA 2D1HA 5LRSA 3GX4X 5LGTA 2Z9OA 2WWYA 3F23A 1PP7U 3GZ6A 2M30A 5F64A 2DK8A 2B0LA 2XAFA 4MTEA 2PI0A 5LEJA 3O2PE 4HZFA 4Y15A 1FLIA 4GYIA 3I59A 4A6DA 2XAQA 5CVRA 1U5TB 2JPBA 4I0BA 3GF2A 4LG0A 2VC1A 1IXSB 4IPAA 4L5JA 4Q48A 2NS0A 1L3LA 4Y17A 4F7ZA 3EUHA 3PQJA 2BEOA 4I01A 1Z6TA 2D1VA 5LRRA 4LGWA 5ED4A 3VODA 1LJ9A 3P9CA 4WX9A 3T8RA 1SFEA 2QBYB 3I58A 4AIHA 1I6XA 1CF7B 4KMUX 5E8IA 1IW7F 1PUEE 5DDGA 3DP7A 4KN7X 3HTUA 1G6NA 1I1GA 2Q8KA 3MQ0A 5D8KB 1W7PA 1KYZA 1B9MA 3DFGA 2E1NA 1LNWA 4XBFA 4PGGA 4EQQA 1TTYA 1YG2A 1TQIA 3G3ZA 3WTXC 2IJLA 1EH7A 4CGZA 3ZMDA 2CW0F 2A07F 1R22A 1FSEA 1QQIA 2DQRA 1ZH5A 1D3YA 4CDGA 3F3XA 5HS9A 4P9FA 4UHTA 4P55A 2ZMEA 2QVOA 4IHSA 3LQRA 5HDGA 4IRHA 2O61A 3F8MA 2G7HA 3ML6A 1O3TA 5HLGA 3T0YA 4L9VA 1QPMA 1U8RA 5J8CA 3B73A 3TO6A 3GW2A 1P4XA 5IT9Z 2FF4A 5D6EA 1GVJA 4Y13A 1ULYA 2ZNZA 1S8NA 3CO6C 2P5LC 2A3SA 5D5VB 5A2QK 3PQKA 2XHKA 2VC0A 1LDJA 1KQ0A 3K2ZA 1YYVA 5FFXA 2PEXA 1IN8A 3GWZA 3U2RA 4M9SA 4ZZLA 4A2UA 4A5NA 2MH2A 5JVTA 2CGPA 2XIGA 3LA7A 2VONA 1MDMA 4HDUA 1R1VA 5K5RA 3WTTC 3W6JB 3T5XA 4A5MA 3J80K 3F21A 2IVMA 1XDUA 3CLOA 1FX7A 4WCGA 3BPVA 5JHUA 3CUQB 2VBZA 4LLLA 4UUVA 4G94A 1SD5A 2RC4A 1BOAA 4HF0A 2JPCA 2LSOA 2LF8A 4DQ2A 4L9JA 3LAPA 2GXGA 3DF8A 2GA1A 1KA8A 4BHPA 1K78B 2FMLA 1FZPB 3J7AO 4WXHA 2DPUA 1XCVA 4OU0A 1Z9CA 1IF1A 3N97A 3BROA 3O3KA 4HX8A 5J8FA 3FMQA 2EK5A 3QOPA 2EA4A 3F22A 5BPIA 4N0BA 4ZZDA 5HLHA 2EJRA 1HSTA 1OYIA 1P2FA 1I1SA 4N9HA 5ILUA 2ADUA 2PG4A 3WGIA 3HHGA 2ESNA 3CO7C 3GO5A 1WSUA 1UFMA 3FXQA 1Z91A 2PN6A 5HS7A 4U88A 1WRJA 3J81K 3EETA 2EFNA 3TDZC 1XMAA 3Q9VA 1H9GA 1O57A 3P9KA 1TNTA 2Q2EA 3S2WA 4OMZA 4UVAA 5DV5A 2ELHA 2COMA 3GFMA 5FO5A 4M9XA 1H9TA 5E1WA 4CXFA 1R5HA 2VE9A 3TDUC 5FD5A 2H6BA 5L3DA 5A2QZ 2P5KA 3SFZA 5DUIA 2VODA 1XCBA 4AVPA 4XRFA 3QRFF 1OYYA 1J75A 2QYOA 1LEBA 3F8BA 3FM5A 3ISPA 1IN6A 4HOBA 2VBWA 5CYVA 2XAGA 2QLZA 2ACJA 4GCVA 2HFHA 4PGHA 5LLQA 3J80Z 1YW8A 4EM2A 4A12A 3IRRA 1O3SA 2YSRA 1IUYA 1AOYA 1T39A 3K0LA 2STTA 1FSHA 1IN5A 2XUBA 4PZJA 2ZXJA 4KIBA 1ZRCA 2O03A 1W5TA 4AD9A 4OIQF 3IL2A 1HW5A 3F72A 2OQRA 1YW9A 2UZKA 3M7GA 4ON0A 1P4AA 2XGXA 1HW2A 1P4WA 2FRHA 5K5OA 2R3SA 4A0YA 1DPUA 1SMTA 3V4GA 3KP5A 5LBQA 3OOPA 5FB2A 4BHCA 5H20A 5JR3A 2EFQA 4LLNA 4LB5A 3KZYA 2BGCA 4LK1F 4XLPF 3B02A 1O7FA 1TQPA 4R79A 1RUOA 2HTSA 3E3VA 4RB3C 4NB5A 4UVCA 3DPTA 3R0AA 3BWGA 2A5YB 5F1RA 5D8LB 3M8EA 2HKXA 2BV6A 2C6YA 4DNCA 1ZYRF 4OIRF 1AWCA 1KU2A 1TBXA 1FP2A 3CUOA 4RAZA 3J81Z 2F5EA 4I0AA 3GUDA 3QPTA 1F4KA 1YTYA 4YFNF 1YW7A 1J0RA 1T0FA 4JBAA 1WQ2A 4ZYDA 1DDNA 3FXRA 3LFKA 1SD7A 3BJ6A 1QZYA 4LD5A 2D2WA 1B59A 3LA3A 1G3SA 2W24A 3GEZA 4ENMA 2QENA 2CSOA 4ESFA 1USTA 2Y75A 1YIOA 4KMFA 3HOTA 5E20A 3KE2A 2FQ3A 4RGSA 3DKWA 2GZWA 1PDNC 2DO7A 1EV7A 2QZ8A 2K27A 4XLNF 3DV8A 2G9WA 3KFWX 4HQMA 1J7KA 2KIMA 2V9VA 2IT0A 4Z2YA 2RKHA 2G7UA 4I98B 4P96A 1R58A 1OKRA 4AIJA 1J2XA 3I0TA 1XB4A 2EFWA 2HEOA 2PMHA 3LAJA 2DQLA 5EEGA 1BIAA 1LB2A 5D5WB 3EYYA 3L00A 2UXXA 3V7SA 3MAJA 5DEQA 2HGCA 4RS8A 5TJJA 1BI3A 2R7FA 4KT5C 1YS7A 1KU3A 4FHTA 3LQQA 3I59B 2P5VA 4GO1A 1XMKA 4BYYA 4TV7A 1R1UA 5D5XB 2MLKA 1MKMA 3I64A 5LGUA 4HYEA 4LG0B 1QGPA 2HKOA 1I5ZA 4WF2A 2R7DA 3VB2A 3H3ZA 3RIRA 2PQ8A 1ZG5A 4RGUA 1A04A 2EA2A 5LEKA 4UNOA 4LMYA 1D8KA 3DQVC 1RZ4A 4HDVA 2VT3A 4EM0B 1U5TC 2P6TA 4HV5A 3E5XA 1MGTA 3WG9A 2OZUA 1BN5A 2ETHA 4MQ9F 3TO9A 3K1MA 4GXOA 5HDKA 3WE3A 2NRAC 2HYFA 3RPUA 1BI1A 2DLLA 1QNTA 3RKXA 5DYMA 5BQTA 2ISZA 1W7PB 5ILVA 3ZQ7A 1R7JA 4MQVA 1YS6A 1MJ9A 3HRMA 2O8XA 2QQBA 3TQNA 1JE8A 1FBSA 3KP4A 2CQKA 2WC2A 3RDIA 4KN4X 2EV6A 1TQMA 1K6OA 4BNCA 1S3JA 3SXYA 1UB9A 2P7VB 1Z1DA 1UHMA 2KJBA 3HHHA 4EV0A 4E70A 5JI6A 1SMYF 2P6SA 2IA1A 3GFIA 1ONVA 1USSA 2DTRA 2ZMEB 5LHHA 3R0JA 1DUXC 2OBPA 2NYXA 3K69A 3E97A 3ZN0A 4M74A 2F5CA 3K9TA 1YQAA 4M6XA 2DFIA 5E1XA 1G3TA 2JRTA 3U1DA 4A0XA 5D4RA 2K4JA 5HOOA 3FMRA 3WGHA 4RB0A 2DW4A 2LNBA 3FZVA 4CZZA 4L0ZB 2QQ9A 2Z99A 4RB1A 4G7OF 3FMSA 1S7AA 1SFUA 2IP2A 2MBFA 1XGNA 3IWZA 3C3WA 3MEXA 2FBKA 2FXAA 1IN4A 2DK5A 5L3GA 5E18F 3EYIA 4ZH4F 5LHIA 5CVUA 5ILSA 3T8TA 1WWXA 2BBYA 3F8NA 3IWFA 3WTWC 1W4MA 1S29A 5L3EA 4WXCA 1MDMB 3V8KA 3GFJA 2A6HF 2Z5UA 2F5DA 1BIBA 2MD5A 3GXOA 2RV8A 1E2XA 1STZA 1BI2A 4N9IA 1V3FA 2HZTA 3MCZA 3ERED 4O3MA 4HAMA 2K86A 3N4MA 1P92A 1E17A 3IKTA 3OV8A 4IXAA 4YIFA 2M8EA 2P4WA 5L3BA 1ON2A 3BY6A 4B8XA 1EH8A 2AS5F 3CUQC 2FBHA 1T38A 3KP6A 3WTUC 3AAFA 4I2OA 2BYVE 3R6SA 3V8LA 2NNYA 4O6JA 4NQWA 2YR2A 1FBUA 3ZMTA 2HDCA 3R4KA 1FY7A 3JAMK 4EGZA 1REPC 4L9NA 3WTZA 2MLGA 1TW3A 2W25A 2Z33A 2O6GE 1HQCA 2ZCWA 1XN7A 4MHGA 1PP8F 3LA2A 3GFLA 2IA0A 1B9NA 5BMZA 4KYWA 3DXJF 3QU6A 2QUFA 1SD6A 2CWEA 6PAXA 3SHFA 2DBBA 1K79A 3E6CC 4H0EA 5D4SA 1ZRFA 3NQOA 4HF2A 2VXZA 3ZMZA 5CJ9A 2GXBA 4I02A 2XAJA 5E1ZB 4AIKA 1JHHA 1HSJA 3I71A 1ZLJA 2HQRA 2ZKZA 2ZNYA 3FX3A 3E6BA 5CLSA 2IRFG 4FT8A 2VE8A 5DD8A 4IRIA 2L01A 4ASNA 4AWXB 5L3FA 3KP7A 3V7RA 4MTDA 1HBXG 4YFKF 1XSXA 2O3FA 4G9YA 1J59A 4HV6A 1RUNA 3DPLC 5DCMA 2F5FA 2IPQX 2CFXA 1OR7A 2OA4A 3HIFA 1G3WA 3JTGA 1R00A 1TLHB 3HSFA 3RKWA 1BJAA 2WTEA 3KLNA 3F8FA 2EV0A 4HA8A 4U0YA 3D5LA 1TW2A 3RKYA 1ZREA 3ECOA 1KYWA 2W57A 2HR3A 3ZN1A 1YLFA 4BH9A 3QP5A 1TNSA 3G73A 2BE5F 1CGPA 1LQ1A 3REOA 2OZ6A 1U78A 3C7JA 3F8CA 2L4MA 5EEHA 1UCRA 3E5QA 4BQAA 2ZFWA 2CYYA 3QAHA 3W6KB 4P5OA 4KFCA 4M73A 5ICCA 1T6SA 3HRSA 3MZHA 4RGRA 1R1TA 1WKMA 3KZZA 2EFPA 4RAYA 2PJPA 4M72A 1VTNC 2VOOA 3COAC 1JXSA 1DPRA 4ZYEA 4KUMA 3RI4A 5ICEA 3WTVC 1ZN2A 1KQ9A 2E1CA 3V8JA 2RVCA 2XRNA 3BJOA 2XASA 4L5IA 2J5PA 4IHTA 4EJUA 4CO8A 3JAMZ 2OD5A 3HRTA 2PLYA 2W85A 2PMUA 2GA2A 5F6FA 1I27A 3WTYC 3KEOA 3IKVA 3T1BA 1R36A 4MEXF 1ZHFA 3QU3A 3WGGA 3MFKA 1ZRDA 1XGSA 2ISYA 2FE3A 1IN7A 3K1NA 4GGGA 1DP7P 2GIVA 4LLGF 4CYDA 1FNNA 2KKOA 2ZO4A 4LJZF 1BM9A 3TOAA 3ZMUA 3TO7A 2O0YA 3GLXA 4PDKA 2ZJ2A 1R23A 3V7CA 5D6FA 3WU1B 5HDNA 1IRGA 4EGYA 5CVVA 2E7XA 2Q0OA 3Q9SA 4XSZF 2MA3A 2STWA 1B1BA 4G6QA 4EM1A 4ZYHA 2YU3A 1W5SA 3MZYA 1IAWA 2QWWA 2QQAA 3WTSC 2Y48A 3C1DA 3VOEA 4A0ZA 3TOBA 2A68F 1MD0A 3HTSB 1OMIA 3QPHA 2H27A 3KEQA 3L09A 1G3YA 1Z05A 1Q1HA 1FYMA 2KIFA 4BXUA 3H3UA 1FPQA 4D0PA 1D5VA 3Q5FA 4BAYA 1HKSA 2EV5A 4EJWA 4HX7A 4FX4A 4G7ZF 2RDPA 2V1XA 3F6OA 5CVIA 3KP3A 3LSTA 1FYKA 1ODDA 3BJAA 3U9GA 1XGOA 3D0SA 1LDDA 1RI7A 3CJNA 4I09A 5KK1A 4ZYGA 2EB7A 1HKTA 5K5QA 4KDPA 3SZPA 1IZ1A 4U0WA 4U7DA 3NRVA 4EJTA 2PBIA 2XROA 4G6DA 4MEYF 2KRFA 4B09A 1S6LA 1Y0UA 3FM3A 4IJAA 2VN2A 1U3EM 3SQNA 4BHBA 1S7OA 5BOXA 2VBYA 5DCFA 3FF5A 3ZPLA 3R60A 1U5TA 2YX7A 3VEPA 4HW0A 2HOEA 1NHAA 2OU2A 3H92A 2JSCA 2XKOA 2TDXA 3M9AA 3ULQB 3IRQA 4JK1X 1ZG1A 3M1EA 4EMSA 4GYGA 1XGMA 4XSXF 2CO5A 4WXDA 4ENNA 4A6EA 2Z3YA 2A6EF 2QBYA 2AXLA 2PFBA 1FBQA 4HQEA 1KGSA 3I53A 2H09A 1CF7A 3P9IA 3E5UA 2RNJA 3PFIA 2JZYA 5IT3A 1Z7UA 4M6YA 2KIUA 3ZP5A 1ZGAA 3F6VA 1O3RA 1F1ZA 5ICGA 3MWMA 3HOSA 4UV9A 1O3QA 3RYPA 1MJBA 2FNAA 2DAOA 2DU9A 3HSEA 5CVJA 1YO5C 2JT1A 3K1PA 1U2WA 1KU9A 3RJPA 3BZ6A 2RGVA 5DD4A 4U0VA 5JFRA 2L54A 4UV8A 3HSRA 2FMYA 4IVNA 3BOQA 2VOPA 4RB2C 1ZARA 4WK8F 3ROUA 2M87A 4HX4A 1GXPA 2P8TA 5H6RA 5FFZA 2FA5A 5H6QA 4WWCA 4P9UA 1X3UA 2GWRA 1J5YA 1R5GA 4KNYA 2XVCA 3WODF 1C0WA 2ZBKA 4LK0F 4RGXA 2ESHA 3JSOA 4EJOA 4CHUA 4R1HA 3RYRA 2UXNA 2V79A 1GXQA 4LFUA 1GHCA 2FNPA 3ABUA 1MZBA 4M71A 4QWQA 2YX4A 1EH6A 1ZGJA 2X0LA 3NEUA 2HYGD 5E17F 5E8GA 4R8HA 1FC3A 3L2CA 2QM3A 2H94A 2RN7A 1MJAA 5FGMA 3HYIA 3KCCA 3FHZA 1L0OC 3BP8A 2F2EA 1RNLA 2J5OA 4IF4A 2P7CB 3CUQA 3RTRA 2KJCA 1JHFA 2FBIA 1FOKA 1BBYA 1HKQA 1ZAOA 4S05A 1T98A 4UXNA 2HTJA 1LEAA 3SZTA 2A69F 1OYWA 1B4AA 5ICFA 4Q4ZF 3I54A 1LVAA 5L3CA 1K78A 2M1BA 3DEUA 1WI9A 5DUKA 3LWFA 1K7AA 1D8JA 1XSVA 1SFXA 4L18B 5FLXK 4CICA 1FYLA 4ESBA 3I5UA 2EFOA 1IXCA 5AIQA 2MH9A 2XV4S 1Z6RA 5BPDA 2V1DA 1J9IA 3WU0A 4EJVA 2L3DA 5LHGA 3CDHA 3GVAA 2DT5A 4I7HA 1XD7A 2K7LA 3VFZA 5TRDA 2XAHA 1IXRC 1JGSA 4JQFA 2W84A 1IRFA 4KA4A 3RPQA 4OOIA 1W7PD 5FD6A 3P7NA 4ESJA 4K2EA 5LGNA 1KU7A 1KQ8A 2HWVA 5DCMB 1G4DA 5AIPA 4MNUA 1BC7C 1ON1A 4Q47A 3L9FA 1QO0D 3ZMSA 1F9NA 3BDDA 5D5UB 1RIOH 5HS8A 2L4AA 3TKYA 3R61A 3ECHA 3ZMVA 1XSDA 2M5WA 4ENKA 1QZZA 3JW4A 5KVRA 2WV0A 3TGNA 3KLOA 2A61A 4ETSA 2D45A 4NHJA 1FWZA 2DPDA 3GYHX 1T2KA 3C18A 4MGRA 2UWMA 2Y0MA 1FP1D 2IW5A 3FWEA 3KP2A 2CG4A 2LKPA 4HLXA 2RQPA 3JSPA 2LF7A 2YPRA 2NAZA 4PCQA 2FU4A 2GAUA 3L7WA 4O5VA 3M8FA 3QP6A 5ERIA 2HQNA 3O6BB 5FLXZ 1B6AA 4KIFA 4HF1A 2V1UA 4S04A
chains in the Genus database with same CATH superfamily
3RCOA 2VBXA 2DI3A 3ABTA 2NVUB 2CUFA 1FMWA 2EIKH 5HVQC 1ERDA 1O7LA 1FT9A 2CKZB 1W36C 2W71A 2UVWA 3KETA 5K2MA 3FKJA 1WHUA 2FQ4A 2CMPA 4L9TA 3FXLA 2FUG2 3PR4A 2P81A 2UVUA 4E7JA 3V6JA 1KZHA 2K4BA 2DJIA 3HRUA 5KG6A 3H20A 3GTKJ 2R5YA 2F6CA 2MC4A 5KT3A 4A3DG 4UVBA 1HW1A 1V4RA 4FS1A 1YFHA 3V6HA 2JTVA 2NUAB 4XNFA 3FXUA 2M4GA 3L4KA 2MFZA 2OV7A 1MIJA 1H0MA 2H8RA 3PO2J 3BABA 5KFGA 4JI0H 4E4HA 1IJWC 1Y1VA 1GDTA 4U7BA 4BXXJ 3SE7A 2MW8A 4Y3OA 5EG0B 2CV0A 3BR0A 4OINF 5J6XA 2OAZA 3L2UA 3RV3A 2BW3A 3BPXA 1X9NA 2E7WA 3JTHA 2FLPA 1VBGA 4RM3A 4Q5SF 4AYBA 3CJTB 3E5NA 2UXBH 5K1YA 4DYCA 4L0YB 3LSRA 1LDKB 4X1EA 1BI0A 1TP4A 3G6XA 2Z2SB 2DLNA 2JEIA 2R6FA 2IA2A 4QLCU 1QBJA 4JYAH 5F0HA 2K02A 2LDUA 4G8XA 1F5TA 1T0FC 3JAMW 3ZQFA 3K10A 1WJEA 2HS5A 3M4IA 3KHRA 3CVZA 3EDPA 4EVIA 2GQQA 3FMAA 4YIIA 4IRGA 2CU7A 2R7MA 2EINH 4HBLA 3IAM2 1UHWA 3U1KA 5BS6A 1E0EA 3CCYA 4ZDLA 1B6SA 2HDDA 1V51A 2IP4A 4HLYA 3FDSA 2FOKA 1A9XA 4OIOF 4R8UA 4BDZA 2DA5A 1XDNA 1SD4A 2L7FP 4AC0A 5J4VA 4FX0A 3A0BC 4KICA 2FSWA 3FIWA 5DGAA 3GLLA 4DOZA 3CQZJ 3E6MA 4DZPA 3RGZA 2JQ7A 4D7MA 5GAEJ 3HC7A 1JUSA 2M45A 4RZRA 3ETHA 1HXDA 1UG2A 4IRCA 2V6CA 1VQKI 1XDSA 4QSHA 4GKKH 2J6TA 2NS7A 4PJ0C 3WG7H 4YFXF 1U6GA 3HB9A 1N36H 3G71I 2OQGA 5JVGF 1SAXA 1E3OC 4XX0B 1N75A 4NC8A 3HUGA 1ETXA 2FEZA 4FISA 1BC8C 3ELKA 4B44A 2EWNA 2W7OA 4KIGA 4OIPF 3RZOJ 4M9ZA 3V42A 1D1BA 1RJPA 3VYUB 4DGWB 2NNNA 3A03A 3LNQA 2H6CA 2XF6A 2VT2A 4NDLA 4YG2F 3M9MB 2UXDH 4G7HF 4O2BF 2FLNA 2JA6A 5HLIA 2LBFB 2IGOA 2NOJB 3E6DA 3AG3H 4ENJA 2DN0A 4FBTA 3IC7A 1VBHA 4BJ6C 3IHUA 2NU9B 1P6RA 2FPGB 3D5SC 2A6TA 3BCAA 2D5VA 2BQ3A 4A3LG 3GZ5A 3WE2A 2X4HA 1RK6A 4J9MA 2YU9A 1IBLH 1OPCA 3L2RA 5KFDA 3K6GA 3PW4A 1GSOA 3EQLF 1ZG3A 5M5WJ 3CTAA 2PX9A 4LB6B 5IT9K 4C2TA 1ZLKA 3O8HA 1AU7A 2VQLA 2L02A 3I4PA 2QQ8A 5AONA 3QYFA 4E7ZA 2AQFA 4OMYA 2MC3A 2XKPA 4ZJZA 4XR6A 2D1HA 1JKOC 2VPLA 5LRSA 3GX4X 4IWYA 5LGTA 2Z9OA 4IO9F 2WWYA 3F23A 1ZHSA 1PP7U 2XC9A 4DR7H 2C2DA 3H4DA 5DLGA 3MR6A 5CA0F 3GZ6A 3P5JA 2M30A 5F64A 5GPCA 1RR8C 2DK8A 2R7NA 2B0LA 2XAFA 2ZSHB 3MR2A 1W0TA 4CCMA 4E7IA 4MTEA 3N44B 2PI0A 1CE8A 3RBEA 1YJ9I 5LEJA 3O2PE 5FPRA 2DMNA 2LREA 4HZFA 4Y15A 1FLIA 4GYIA 3HOYJ 3I59A 3GIMA 4JV1A 4IWXA 4LF6H 4A6DA 3DU5A 2XAQA 5F04A 2UUZA 3OSFA 5CVRA 1K61A 1WJFA 1Y14B 2BHYA 1U5TB 2JPBA 3OR1C 4I0BA 1U0JA 3L1PA 1LE8A 3GF2A 1MBFA 4LG0A 3I4NJ 2KDOA 2VC1A 2LOOA 4ED1A 1E3PA 2HU9A 2XGEA 1IXSB 3EUKL 4IPAA 3RF2A 3KHLA 4L5JA 4Q48A 2NS0A 5LFAA 4Y17A 1L3LA 4F7ZA 2KRHA 5KX5F 2EIJH 3EUHA 2W9CA 3PQJA 4XICA 2BEOA 4I01A 4UCRA 3IP4B 3VSLA 1Z6TA 3RB4A 1WH2A 2VQEH 2VA3A 4II2A 5KFVA 3Q0VA 5D8DA 2D1VA 3K3PA 2VKHA 5LRRA 4X6AJ 2VUMG 2F4VH 4J9SA 1D1AA 4E7HA 4LGWA 5ED4A 4C3IJ 2EBIA 3VODA 4XLAA 1LJ9A 3P9CA 3GTOJ 3H9GA 1A6QA 4I50F 3CLQA 2JA8J 5LP6F 2A05A 2JMWA 4WX9A 5IYZF 3T8RA 1SFEA 3HPGA 3BAAA 2ZJTA 2KDZA 2QBYB 3I58A 2DODA 1QA6A 4AIHA 3CZ6A 1SEIA 2WYOA 4Q8EA 1I6XA 1R6RA 2M2EA 3M3YJ 2K85A 1OCPA 1CF7B 4CCKA 4KMUX 5E8IA 1IW7F 1PUEE 3HM5A 2V6EA 4QWCA 3Q2OA 3BR2A 5DDGA 2P0WA 3DP7A 5DTDA 4KN7X 4PJLA 1Y1WG 3HTUA 1G6NA 1R4NB 2JN6A 4JX5A 1I1GA 2Q8KA 3B6AA 3UNGC 4D5CA 2Q1ZB 2E5NA 1KC7A 3MQ0A 3MVPA 3TL4X 5D8KB 3CCSI 3CCLI 1W7PA 2QCOA 1KYZA 2YS6A 1B9MA 3DFGA 2E1NA 3OYBA 4M9UA 5KFEA 1LNWA 4XBFA 2AGPA 4ME6A 4PGGA 2PJRA 4LFCH 4C30A 4EQQA 2GBYA 5KG1A 1TTYA 4B3TH 5IP6A 1YG2A 5TISC 1TQIA 5TGTA 2B63J 2YUSA 1R71A 1A35A 3NWTA 5DLFA 2R8JA 5KAIC 4AM3A 1X4PA 1BR4A 2L7MP 3AYHB 3G3ZA 3GIQA 3WTXC 2ZXWH 2IJLA 4HG2A 1EH7A 4CGZA 2DA4A 3ZMDA 1KJ8A 1JT6A 1DV1A 1ZR4A 5CQEA 1W36D 2R8GA 1E3HA 2CW0F 4AUXA 2A07F 1R22A 3OWTA 2ZM6H 1FSEA 2IS1A 2L7ZA 2R7ZG 2DA1A 1QQIA 2DQRA 4XKBA 4V2GA 1ZH5A 2RF4A 4DR2H 1D3YA 2L2OA 2Z1DA 4CDGA 2WAQE 3BA8A 3F3XA 3CMEI 2ZSIB 4XRSA 4ZTFA 3L2PA 5HS9A 1N56A 4P9FA 4ZC3A 2KMUA 2DOAA 4UHTA 1OCTC 4P55A 2ZMEA 1AUXA 1RRJA 1OCRH 2VASA 2QVOA 1HOMA 2Y2ZA 2OTLI 4PWQA 4IHSA 3GTKA 3HOWJ 3LQRA 1O4XA 2FK2A 2GOXB 4ED3A 2UUAH 5HDGA 4IRHA 2BHZA 1N77A 1T3NA 2O61A 4NXNH 4GFBA 2HHHH 3F8MA 1VAJA 1QHHD 2G7HA 3AFHA 3ML6A 1O3TA 5FKLA 3ZXSA 1NG7A 2HOAA 5LYJF 5HLGA 3DKYA 3RV4A 1TWFJ 4JUZA 3H0GJ 3T0YA 2CUJA 4L9VA 1QPMA 1U8RA 2K40A 3PR5B 4MV8A 1HNZH 2CQ7A 5J8CA 2KISA 4CCNA 3B73A 3TO6A 5T14A 4O3PA 2HDWA 3EPGA 4MA5A 3GW2A 1P4XA 2LMDA 3I3LA 3HG9A 2EILH 5IT9Z 2FF4A 5D6EA 3OUZA 5GPAA 1GVJA 2UV1A 1MMSA 1V55H 4Y13A 1A6IA 3TQTA 5LXTF 3J7AK 2MCTA 2AQ4A 1ULYA 2ZNZA 4Q0YA 1S8NA 3RSNA 4B4CA 2A3SA 3CO6C 2P5LC 5D5VB 4RNNA 5A2QK 1S68A 1X1BA 2LG4A 4ZOLF 2YZMA 3PQKA 3PIOF 1OFCX 2XDVA 2XHKA 2VC0A 1N78A 1LDJA 3QODA 1KQ0A 3K2ZA 1YYVA 5FFXA 4UCVA 2R8KA 5K7ZA 3I4MG 3RZDJ 2PEXA 1IN8A 2VJIA 3GWZA 4A3CG 1XPXA 3N42B 1WI3A 3U2RA 3MFIA 1YRNA 5EGOA 2JEGA 1VQ5I 2JA7G 2VQCA 4YRVA 4M9SA 4ZZLA 4YJ3F 1EJ9A 2ATLA 4A2UA 4A5NA 2H1KA 3N40P 3CQZA 2MH2A 5JVTA 2CGPA 5KKNB 2XIGA 3LA7A 4A3GJ 2VONA 1MDMA 2DMQA 3ERMA 1R1VA 4HDUA 5K5RA 2FPPB 2R92G 4CA0A 3WTTC 1WVRA 3X2QH 2VA2A 4MA0A 3W6JB 4XLEA 3T5XA 5F27A 1WZ2A 5LOVF 4A5MA 3QFFA 3J80K 3F21A 5FLMG 1Y56A 2IVMA 2GIZA 2M8GX 3FXJA 1XDUA 4A3FJ 4C5AA 3CLOA 1FX7A 5KFSA 3HOZG 4WCGA 5B3SH 3BPVA 4B47A 4Y7NJ 3CUQB 5JHUA 2VBZA 4LLLA 4O4HF 2MGQA 4UUVA 1U9OA 3K2AA 2GLTA 4G94A 1SD5A 2B7EA 2E34A 2RC4A 3BTIA 4HPQA 2BOLA 1HCRA 3MD2A 3QYBA 1BOAA 4HF0A 2JPCA 4QW8A 4QWDA 3O8GA 3PW2A 3GV7B 3PSFA 5KG2A 2X9DA 1RETA 2LSOA 2LF8A 3QPLA 3S93A 1NK3P 4A3BJ 5DM6F 4ZTJA 4DQ2A 3OR2C 2B9SA 4LOCA 2E35A 3ZGKA 2CQXA 3IH4A 4L9JA 4F3QA 3LAPA 2K5CA 1VQLI 2GXGA 5FLVA 2FLLA 2IGMA 1H8AC 4TQRA 3DF8A 2CW8A 2GA1A 3C2BA 4EEFG 2QF7A 5GADJ 2YZGA 1KA8A 2ZB9A 4BHPA 5H2FC 5KG0A 5KT5A 1K78B 3QWLA 3RUPA 5J2TF 5J3LA 3SI8A 2FMLA 4DR3H 3D5RC 4IL6C 1FZPB 4J01A 5KG5A 3M8JA 4DYRA 4F4WA 3J7AO 2OLSA 4WXHA 1GV5A 1EF4A 5BPHA 3H3VH 4B48A 4ZQIA 4OAYA 2DPUA 1YIJI 1XCVA 4OU0A 4DV7H 1Z9CA 4J9PA 1W0UA 2HPIA 1IF1A 5LL6b 3N97A 3BROA 3MWEA 4JV2A 4BU2A 5IOYA 1YJWI 3O3KA 3QZ8A 3PO3G 3HZJA 1I39A 5KFCA 4IHXA 3PN1A 4U6PA 1Y6IA 3PUFA 2RNGA 5J2UF 3H40A 4HX8A 4XLFA 5J8FA 3FMQA 2EK5A 3QOPA 3C2HA 2C28A 2K3FA 1B72A 2EA4A 3GBGA 1S9FA 3F22A 4M3BA 3NWSA 5BPIA 4YQWA 3ONQA 1J5EH 4N0BA 1OWTA 4ZZDA 4TUYF 5HLHA 3TIGA 2EJRA 1HSTA 1OYIA 1P2FA 1I1SA 4N9HA 2WTFA 5ILUA 3W2AA 3SYTA 5HV6A 4ECTA 3Q8SB 2ADUA 4Z6YA 2DIKA 3M07A 5L1IA 2PG4A 4IR1A 4MFDA 3WGIA 1YOVB 3HHGA 2ESNA 2LRDA 3GO5A 3CO7C 3G6VA 3H5NA 1WSUA 2R87A 3H36A 2E5LH 1XNQH 1N34H 4JI7H 1OCCH 3MMYB 3T5KA 4ZYAA 2FD5A 3SJMA 3PNYA 1UFMA 2CQYA 5IT9W 2JVHA 2MG4A 3FXQA 3ZQLA 2DA3A 1Z91A 2EIMH 1T08B 2DCEA 2CV2A 2PN6A 5HS7A 4U88A 1WRJA 3EETA 3J81K 2CS3A 2EFNA 3ZQQA 2OPTA 3TDZC 2YW2A 4IHJF 5C3EG 1XMAA 4B3AA 4BY7J 1V9PA 1UELB 1MMNA 3Q9VA 1H9GA 2VJ5A 4O3QA 3MR5A 3RQ4A 1O57A 3P9KA 2DDBA 1TNTA 3LMMA 1QRYA 3VPDA 1SANA 3M4OJ 4EYHB 2Q2EA 3S2WA 4OMZA 4J9KA 3LL7A 4UVAA 5DV5A 5KFMA 2ELHA 2DPIA 4N4NB 3H3VK 2COMA 2JUCA 2KZGA 3GFMA 5FO5A 5J40A 1IDZA 4M9XA 1H9TA 2NS8A 4M7EA 1TL8A 5E1WA 3GCMA 1DIKA 3GILA 5B5EC 2LR8A 4FETA 3LFUA 4CXFA 1R5HA 2VE9A 5KCMA 3TDUC 3UKGA 5FD5A 3I12A 2VJ4A 3TINA 2H6BA 5L3DA 5A2QZ 2P5KA 4TV9F 1FIAA 2IXSA 2VUGA 5DG9A 1QHGA 2H1LA 1KJIA 3ABMH 1IBKH 2M7BA 1V54H 3SFZA 5DUIA 5HLTA 1LPQA 2E19A 3TP0A 1I50J 4NBQA 1AKHB 4E4TA 2VODA 1XCBA 5EJCA 2B63A 2O9LA 4AVPA 3S17J 4AYBE 4XRFA 1IV8A 3QRFF 1VS0A 5LA6F 3M9OB 3GTJJ 4EBCA 5IYDG 4TQSA 3S32A 4DL5A 1OYYA 3J7YJ 3ESWB 2H8WA 5EEAA 1J75A 2QYOA 1B33N 4M3GA 4JYKA 1PJRA 5IYCJ 1V5EA 1LEBA 4MV9A 4MV3A 2W6OA 3F8BA 3FM5A 3ISPA 3K4JA 1NH3A 4IAJA 3HOUJ 3OL4A 1V4YA 2WV1A 2FP4B 1IN6A 3R5HA 4HOBA 4RLFA 2VBWA 5CYVA 5GONF 2XAGA 1FJGH 4GLXA 2QLZA 2X1CA 3AL0B 4BBRG 2ACJA 4GCVA 4BE0A 2R93J 1M0WA 1OR7C 9ANTA 1JKRC 4XL9A 2HFHA 4PGHA 5LLQA 1WJBA 2I10A 3BQ0A 3HOVG 3J80Z 1I7LA 1YW8A 4A3KG 1I6HJ 4EM2A 3WO0A 3NARA 4A12A 3IRRA 4ITVA 1O3SA 4C5BA 1E4EA 1MNMC 2KHMA 3LSHA 4DR5H 2YSRA 1MW7A 3MN2A 4MIMA 1IUYA 1AOYA 1T39A 3K0LA 1BR1A 2STTA 1FSHA 1TWFA 4LF9H 1IN5A 2XUBA 2VL8A 4PZJA 4XOTA 3S1RJ 2ZJPF 3AL0C 3H0GA 2VB6A 4MV6A 2ZXJA 3BA9A 4KIBA 1ZRCA 2O03A 4DV4H 1W5TA 4AD9A 4OIQF 3IL2A 1LKXA 4DW6A 1HW5A 3F72A 4CZCA 5LMNH 2OQRA 1YW9A 2HVSA 3M1CA 2UZKA 3L2WA 3M7GA 4ON0A 1P4AA 2XGXA 1HW2A 4L1KA 3S3NA 2V5AA 5M5YJ 1P4WA 2FRHA 1K4SA 2R7RA 1FTTA 1FJLA 3DBLB 1TT5B 5K5OA 2R3SA 1MMDA 4M3FA 4A0YA 1DPUA 1SMTA 2PBZA 1I7NA 3V4GA 1ORKA 1DGWY 5EZGA 5FKNA 1VQ9I 3RB0A 1MSEC 2R85A 3CDLA 3KP5A 5LBQA 5GP9A 3OOPA 1L2ZA 5FB2A 2YS7A 3KHHA 4BHCA 5H20A 3K70C 2NU8B 5JR3A 5FROA 1W1WE 4DLKA 1KEEA 2EFQA 4LLNA 2XSJC 3OYAA 2DA2A 4LB5A 5KT7A 2KPMA 3KZYA 1Z21A 2BGCA 4LK1F 4XLPF 2ELKA 3DF7A 1IOVA 3B02A 1O7FA 4J00A 3FKIG 2XD4A 2DWCA 3FXMA 2QEXI 3KZIC 3S14J 1TQPA 5F08A 1RR7A 4R79A 1RUOA 2JK3A 4OAZA 2HTSA 3KYCB 3E3VA 4RB3C 2HXOA 4NB5A 1MBKA 2R5YB 4UVCA 2V59A 2QKLB 3DPTA 2A5WA 2DFFA 3R0AA 3BWGA 1JI8A 2L9VA 5LD2C 2A5YB 5F1RA 5KFJA 4ECWA 1MMAA 5D8LB 1FIPA 3M8EA 4HSTA 2HKXA 2BV6A 2YRWA 5D1OA 4HR7A 3JRAA 2XGQA 4B3RH 2C6YA 2ICWG 3DKXA 4HEA2 1ZYRF 4OIRF 4DNCA 3OYCA 1AWCA 1KU2A 1TBXA 3N41B 1LUJB 1N25A 1UMQA 2BW3B 1FP2A 3CUOA 2DTZA 3ORQA 4RAZA 2VQGA 3J81Z 1PVEA 2LYCA 2F5EA 4I0AA 5A2QW 4A2AA 3GUDA 3OSGA 3QPTA 4S0HB 3FISA 3LSKA 1F4KA 1TWAJ 1YTYA 3G1OA 5LMUH 3A4CA 2WB1N 4YFNF 5IPAA 3EPZA 1YW7A 1J0RA 1T0FA 2NU6B 3IG0A 3H35A 4JBAA 3CP2A 1Y1VG 4XYMB 2XGCA 4ED7A 1WQ2A 5C5JA 1BGWA 4ZYDA 1DDNA 3FXRA 3T1HH 2BVLA 3LFKA 4W97A 1SD7A 5JH7F 3MFHA 5JVDF 3BJ6A 1QZYA 2GLOA 4LD5A 2O5RA 1MNDA 1KONA 3SDBA 4R8UB 1T95A 4UCTA 1E4GT 2D2WA 3K4BA 3IH2A 2E1OA 4W1UA 2FK3A 1B59A 3LA3A 1G3SA 1RK5A 4AQYH 2WADA 4A3MJ 2W24A 3W6VA 1GUUA 1RKWA 2OC6A 3GEZA 3PW0A 3DTIA 4ENMA 4BBSJ 4EBDA 3QQAA 3J80W 3HGYA 2QENA 2CSOA 4ESFA 3BTLA 1USTA 2Y75A 1YIOA 2EPFA 4KMFA 3HOTA 4DL4A 2NU7B 1IUFA 5E20A 3KE2A 4C3HJ 2DJNA 2FQ3A 2JJ7A 4RGSA 4YELA 3DKWA 5J1YA 1X58A 2GZWA 4C3JJ 1PDNC 3HUGB 4ED8A 2DO7A 1EV7A 2QZ8A 2K27A 3CP8A 4XLNF 4ECRA 3T1YH 1FTZA 4IRKA 3DV8A 2G9WA 3KFWX 1SC7A 4HQMA 1N32H 4RNOA 3HOXG 5EZHA 1J7KA 2Y0SN 2GXAA 4O2AF 1JKJB 3VYTB 4PJMA 2KIMA 2V9VA 1PUFB 2IT0A 4Z2YA 1HNXH 4KISA 2RKHA 2G7UA 2K9LA 2RQQA 4TV8F 2YRXA 2W9BA 4I98B 4P96A 1XX5A 1R58A 1OISA 2W6MA 1WCMG 2BXZA 1OKRA 4AIJA 1BOBA 1J2XA 2LY1A 3I0TA 2HPMA 3GTQJ 1P7JA 2R7TA 1XB4A 1T33A 4XMYA 2CRGA 2AXTC 2EFWA 1H88C 1BA5A 1WR2A 4IOCF 2JA6G 2HEOA 2PMHA 3U9SA 3LAJA 2DQLA 5EEGA 1TAEA 2YL2A 5F9LA 1BIAA 1LB2A 4JI2H 5D5WB 3EYYA 3L00A 2UXXA 4CCJA 4UCOA 1ACIA 3V7SA 5IP9G 2WB1E 2DMUA 3SEZA 3MAJA 5FLXW 4O3OA 2VPQA 4J9RA 3MKLA 5DEQA 2FJZA 2HGCA 1AUVA 2UVRA 4RS8A 3JRIA 4BWSC 4JI5H 3UFXB 3G8CA 1YHQI 2F4IA 1BI3A 2R7FA 5TJJA 1RYRA 4KT5C 3BTCA 1YS7A 1KU3A 2WY8Q 1HR0H 2WAEA 4FHTA 2QSGX 3LQQA 3A1YA 4A3IJ 2UUBH 5IYBG 3ZR8X 4M3DA 4A2BA 1IRZA 3BT9A 4MAMA 1I50A 2UU9H 2ZC2A 2Y30A 3I59B 2P5VA 4GO1A 1XMKA 1E4FT 1XMQH 4BYYA 1VQMI 2NVQJ 4TV7A 2VJJA 3DEEA 4BY1G 3GTJA 1R1UA 5D5XB 2MLKA 1MKMA 3I64A 1DU6A 5LGUA 4FBUA 2DPJA 1LE8B 4HYEA 5B1BH 4LG0B 2X6XA 1QGPA 2HKOA 4ANJA 1I5ZA 4WF2A 1YX3A 2R7DA 3VB2A 3H3ZA 5DM7F 2M05A 2W9CB 3RIRA 3J81W 2PQ8A 1ZG5A 2OCEA 3MJFA 2GOMA 4RGUA 3RQIA 2R93A 1A04A 2XB5A 2Y0SE 2EA2A 5LEKA 4J19A 4UNOA 2NOGA 2FJ1A 4LMYA 1D8KA 2DZDA 2I8CA 2CW7A 3DQVC 4I99C 1MNEA 1RZ4A 2VT3A 4HDVA 4UB8C 4EM0B 1U5TC 2P6TA 3A2KA 4HV5A 3E5XA 1MGTA 4KJZA 3WO1A 2ASJA 3WG9A 3G2BA 3OSNA 3Q8PB 1GSAA 2OZUA 1BN5A 2Q2UA 1XC5A 4YP3A 1SEUA 2ETHA 4MQ9F 3TO9A 5M3MJ 3K1MA 2E71A 4GXOA 5HDKA 3WE3A 1RYSA 2NRAC 2XGDA 4DL6A 1WJDA 3VYSB 3S1QJ 1GLVA 2HYFA 3RPUA 4YR2A 1BI1A 5KFUA 5C44G 2HNHA 4DR4H 2DLLA 1QNTA 3S2HJ 3RKXA 5DYMA 2L5QA 5HNFA 5BQTA 3GTGJ 2ISZA 1W7PB 5HBRB 1Y8RB 2ZXHA 5ILVA 4RUCA 3ZQ7A 1UC8A 1R7JA 1S9HA 3C0FB 4MQVA 1YS6A 1VQNI 1RESA 1MJ9A 2ASDA 1P9QC 2VKEA 2PJRB 3HRMA 5C4XJ 2O8XA 2QQBA 3OTOH 4FE4A 4RNMA 3TQNA 3WHCA 3K70D 1JE8A 1FBSA 3KP4A 5IP7G 2CQKA 2WC2A 2K9QA 2L0KA 4EEQA 3SZGA 2Y69H 3RDIA 4KN4X 4B1RA 1KJ9A 5KFXA 1JUMA 1ZTRA 3PSIA 2EV6A 1TQMA 1K6OA 4BNCA 4WD3A 1S3JA 3SXYA 4IZZA 1B6RA 1UB9A 2P7VB 1Z1DA 5M3FJ 1TZLA 1UHMA 2KJBA 3HHHA 1VQ7I 4EV0A 1W5CC 3KX2A 1RC9A 3RTXA 3DTEA 4O3SA 4E70A 5JI6A 5IOZA 1SMYF 2P6SA 3FXOA 3OYLA 4II3A 1CS0A 4D5FA 2XSDC 4A69C 2IA1A 3GFIA 1ONVA 3BZKA 1USSA 2WB1A 1VQ8I 1UZCA 1ZQ7A 5L1LA 4E7KA 2DTRA 2ZMEB 1YITI 2DYSH 5LHHA 3R0JA 2EZHA 1DUXC 2OBPA 5FJ8G 5C1PA 1TT0A 4ECXA 4IR9A 2NYXA 1JKQC 3K69A 3CF5F 1WJCA 3E97A 4XRMA 3MWDA 2GM4A 3ORRA 5CA1F 3CCEI 3ZN0A 4M74A 4A3EJ 5BMVF 2ID6A 4XRSG 3I9V2 2F5CA 1V5FA 1YQAA 3K9TA 4M6XA 2DFIA 5E1XA 5B66C 4EG0A 5JLWA 1G3TA 2JRTA 3U1DA 3QOEA 4A0XA 5D4RA 2M0MA 2K4JA 2V9KA 2NXNB 4XN3A 5HOOA 2X0SA 3FMRA 3H9JA 3WGHA 4RB0A 2DW4A 2LNBA 3FZVA 4CZZA 4L0ZB 2QQ9A 1LFPA 3DBRB 2Z99A 4BQOA 1JJ6C 5EOYA 1TWAA 3PJRA 4RB1A 2W7NA 2GPWA 4G7OF 2VLAA 3FMSA 1S7AA 3VDXA 2CQNA 1SFUA 1T56A 2JUGA 1JKPC 2IP2A 5DQHA 2MBFA 4BXXG 1XGNA 4LF8H 1Z2OX 2XRLA 4GRIA 2V1NA 3C3WA 2FBKA 2FXAA 3IWZA 2KFDA 2V4JC 3MEXA 4BL0B 5JHFA 1JJ8C 1A36A 1IN4A 4DYQA 4X64H 4D9JA 4OWRB 4A93J 5EDNA 3RIZA 4JV0A 2DK5A 4YHHH 4X66H 5L3GA 1EA3A 2HGSA 2Y0SA 4B3MH 3OMYA 4UY8I 4LSXA 2Y31A 4UUSA 3BQ1A 2O7OA 5E18F 4ZH4F 2LLKA 5LHIA 2JA5J 3EYIA 5CVUA 4DV1H 3T5HA 4XOPA 5ILSA 4RA2A 1YRNB 3T8TA 5EGOB 2DMTA 5J47A 1WWXA 4MFEA 4R7RA 2BBYA 4XONA 3G4SI 3F8NA 3IWFA 3WTWC 4BACA 4A3JJ 1W4MA 1S29A 4F52A 5L3EA 4WXCA 3HKZN 4KHPH 1MDMB 3V8KA 3GFJA 2A6HF 2Z5UA 2R5ZA 2F5DA 1I6UA 2FOWA 1BIBA 4C5CA 5CPRB 2E2IJ 2L9SA 3BQZA 2R7LA 2MD5A 1ETVA 3GXOA 5JQWA 2RV8A 3OUUA 3GTMA 1E2XA 1STZA 4BQQA 2VIXA 5KFKA 1BI2A 4N9IA 2KP6A 1V3FA 4IQJA 3A0HC 4C9YA 2XGPA 2HZTA 2FKLA 3CMMA 3MCZA 3ERED 4A3DJ 2CH0A 4O3MA 4HAMA 3OS2A 3MKYB 2VOBA 2R4GA 3OYEA 3DCFA 1AHDP 3ZQHA 2K86A 3N4MA 1S0NA 2EQRA 1P92A 1E17A 4B3XA 3IKTA 2VI6A 3RKQA 3GTQA 3OV8A 3PW5A 2OF7A 4IXAA 4YIFA 2M8EA 2P4WA 3DBHB 1JIHA 1HDPA 4N4OB 4BGDA 4DZJA 2K9NA 2DT6A 4F92B 3PZPA 4G12A 5E3OA 2IGNA 2NVXJ 4JI6H 2W1OA 5L3BA 1ON2A 2ALZA 3HJEA 3BY6A 4B8XA 1A0IA 3LWBA 3QYEA 4Y33A 1EH8A 4LH7A 2AS5F 3CUQC 3IN5A 2BQRA 3AG1H 2FBHA 2XF7A 2LY2A 1Z67A 1VQ4I 1T38A 3KP6A 5H80A 3OIOA 3OY9A 2M3AA 1X1PA 1X2NA 3H5RA 1SFOJ 2ME0A 1Z2NX 4YBZB 3GV5B 2LTPA 5KFIA 3WTUC 3AAFA 4I2OA 2BYVE 3R6SA 3V8LA 3A01A 3K4CA 2WE6A 3H9QA 1Q1VA 2NNYA 1BJTA 4XYLB 1NTCA 4O6JA 1EZ1A 1IBMH 4NQWA 3K4NA 5KG4A 1APLC 2QKMB 4X62H 1W93A 2JVGA 4PSWA 3L2VA 4EYIB 1JDBB 3ASOH 2YR2A 4YB8B 1FBUA 3RB6A 3ZMTA 1JGGA 2XB0X 4J0MA 1X1DA 1B72B 2HDCA 3MR3A 4F91B 3R4KA 1FY7A 3HKZE 3JAMK 2LH9A 2MD0A 4EGZA 1REPC 4LG3A 2HVRA 1DGSA 4L9NA 3TEDA 1WJAA 1RJRA 1K83J 1WH5A 1DGRM 3WTZA 2MLGA 4PSXA 4JI4H 1K6YA 2O8KA 2R0QC 3N8DA 1TW3A 2W25A 2Z33A 3OHAA 2O6GE 3VYRB 3JR9A 4HRIA 1HQCA 2ZCWA 1DP3A 4XN0A 1XN7A 4MHGA 1PP8F 3LA2A 3N6XA 3HOYG 3GFLA 2CUZA 3QPSA 2NVYJ 2IA0A 3CDIA 1B9NA 2HOTA 3BR5A 4FQGA 5BMZA 3S8PA 1EKEA 1IV6A 3TBIA 1YX5A 4NC7A 5J1UA 5KHDA 2CUEA 3DXJF 4KYWA 3RAQA 3I4NG 3QU6A 4BEHA 2QUFA 1SD6A 4A3LJ 3RFCA 2FMAA 5KFPA 2CWEA 5F9NA 2LFBA 1VQ6I 3KALA 6PAXA 3SHFA 2DBBA 5KFOA 1OLTA 4FU0A 5J1RA 1K79A 2XCAA 3E6CC 3CCQI 2Q2EB 4KITB 3AKZA 4C2UA 4O4IF 4CH7A 4H0EA 2DA7A 3Q3SA 4DIQA 1DU0A 3G1MA 4IKFA 2FX0A 2Z16A 5D4SA 1JLLB 1ZRFA 3NQOA 5EWEA 2MSYA 4HF2A 2W8LA 3S16J 2JA8G 2IAIA 2VXZA 4BDYA 3GTGA 4AVZA 3ZMZA 5CJ9A 2GXBA 4I02A 1QZEA 2VQFH 4B43A 2XAJA 4HSRA 5E1ZB 2L9RA 4AIKA 1JHHA 1HSJA 3I71A 1WJ5A 3FK6A 3GIKA 4LIUA 1ZLJA 2JRMA 2HQRA 2YYAA 2ZKZA 2ZNYA 1AN7A 3FX3A 4RU9A 3E6BA 5CLSA 3LSIA 4XLCA 2IRFG 3CC4I 4BQNA 1ETKA 4FT8A 1R5ID 4IX7A 1J09A 1SYXB 1S03G 2QSHX 2E36A 3IAS2 2VE8A 3GTPJ 5DD8A 3EUAA 3CMYA 4IRIA 2L01A 5F1JA 3K5IA 4ASNA 2BXYA 3TMOA 2CZGA 2ECCA 3SFIA 4AWXB 1G59A 3VPBA 4ED0A 1XNRH 2EZLA 4I76A 5L3FA 4C2MJ 3KP7A 3E0JB 2IS4A 1JUPA 3V7RA 4MTDA 1HBXG 4I6ZA 3ZOBA 1XSXA 4YFKF 3L2QA 2O3FA 2DXIA 4DUZH 4OX9H 4G9YA 3CMAI 1TA8A 5KFBA 1BXRA 1J59A 4HV6A 1RUNA 3DPLC 3CCJI 5DCMA 2F5FA 2IPQX 4CYCA 2C35B 2B63G 2CFXA 5F0FA 1OR7A 2ZDGA 2OA4A 3F9KA 3HIFA 4XORA 1G3WA 3JTGA 1R00A 1TLHB 3HSFA 3DLAA 3HEFA 1BJAA 3RKWA 2WTEA 3KLNA 3ZCOA 4V19K 2P0AA 2F48A 2R86A 4JV5H 4PJNA 3F8FA 2EV0A 4HA8A 4U0YA 3D5LA 2WA0A 2IBDA 1TW2A 4XQFA 2VUMJ 1E4EB 3RKYA 1ZREA 3ECOA 5M5XJ 1KYWA 2XCLA 2W57A 4H4KC 1KBLA 4PJJA 2HR3A 2KQRA 1VF9A 3ZN1A 3LSGA 2X6YA 1YLFA 4BH9A 5C1OA 1C30A 3QP5A 2XPWA 2W82A 1TNSA 5FRNA 3G73A 1Z2PX 2BE5F 1OCZH 2R8IA 1CGPA 1LQ1A 1P7IA 3REOA 2OZ6A 1K1QA 1U78A 2YS9A 3C7JA 5FRMA 2F5VA 5KT2A 1VFCA 1V5GA 4EFEA 2RDIA 3F8CA 2CFOA 2L4MA 3HKZA 4NUBA 1I3AA 5EEHA 3HOWG 1UCRA 3E5QA 4G6TB 1MH3A 2W48A 1UHSA 4BQAA 2R8HA 2ZFWA 1X1AA 2CYYA 3QAHA 3W6KB 4P5OA 3PVXA 1Y1WJ 1UJ8A 2COBA 4KFCA 5KG3A 3OSPA 3K4KA 1ZK8A 4M73A 5ICCA 1T6SA 2ZDHA 3HRSA 2R7OA 3MZHA 1T8IA 4JOMA 1A31A 5KG7A 4QW9A 3H0GG 4RGRA 3SDGA 3KEYA 1R1TA 3AG2H 3OHBA 1WKMA 3JRFA 2L7KA 4DBRA 3A02A 1Z7LA 2RREA 2EFPA 3KZZA 4RAYA 2M0CA 1BW6A 1I3QJ 5HNHA 2R7XA 3DEWA 4ABZA 3R23A 4DV2H 4JI3H 1S5LC 2PJPA 4M72A 1VTNC 2WBMA 2VOOA 3COAC 1O75A 1JXSA 4YEJA 4FM9A 1DPRA 4ZYEA 4KUMA 4F93B 5L9XA 4GC7A 2JA5A 2V26A 3RI4A 1BW5A 2C22A 5ICEA 3WTVC 1ZN2A 5KFFA 1KQ9A 2E1CA 1GO3E 3V8JA 4ZI7F 3GTLJ 2RVCA 1TWCA 1IOWA 1A5JA 4APMA 2CQQA 2EH3A 2XRNA 3BJOA 2W6QA 2XASA 3JRHA 4L5IA 2J5PA 2RDJA 4IHTA 2W6ZA 4EJUA 4CO8A 2R7ZJ 1IG7A 2J6SA 1EHIA 1MMGA 4E7SA 3JAMZ 4QIWN 2OD5A 3HRTA 4YAJB 3GQCA 2ZJQF 2E2IA 2PLYA 2W85A 1P8LA 1TWHJ 2PMUA 4DV3H 2GA2A 5F6FA 1I27A 1M0TA 3WTYC 2VPRA 3KEOA 4Q44A 3U9TA 3IKVA 3T1BA 1R36A 4MEXF 1ZHFA 4O3NA 2XAUA 2AHQA 1TWGJ 4M3EA 3W2VA 5D1OB 2KT0A 5E3LA 4A3GG 1UC9A 3QU3A 3H1CA 3OYGA 1HC8A 3CJQB 4CUGA 1B8IA 3WGGA 4M6VA 3MFKA 1ZRDA 1JXLA 1CQJB 3HL2A 4F4XA 1MBGA 1GGOA 4ECSA 1WFXA 1XGSA 2ISYA 4BJTA 1OQYA 4L5EA 3H4BA 2FE3A 1IN7A 3K1NA 2K9MA 4DBQA 2KRCA 4GGGA 4J9OA 1DP7P 5EZYF 4A3FG 3U21A 2GIVA 1FOXA 2Q2TA 4LLGF 4CYDA 1FOWA 2XCPA 1FNNA 4BKXA 2KKOA 2M7AA 2ZO4A 5KNLA 2NVXA 3R5XA 3HDDA 4XLHA 3OYHA 4LJZF 2MABA 2V58A 4YY3H 4RDUA 1BM9A 5L1KA 4ECUA 5IWAH 1D0ZA 2XF5A 1WGXA 5L1JA 3TOAA 3ZMUA 5EG0A 1XG1A 1YI2I 3TO7A 1SFOA 2O0YA 3GLXA 4PDKA 2J6UA 4A3BG 1M1EB 2ZJ2A 1R23A 3V7CA 1R9TJ 1JX4A 3K4LA 3JRBA 5KT4A 3CF2A 2R7VA 5IY5H 5D6FA 3WU1B 5HDNA 3I4MJ 1IRGA 3T5JA 4EFBA 2QGUA 4EGYA 4QTRA 4A3CJ 3CCUI 4RM2A 5CVVA 2E7XA 1QVTA 3JREA 3TQ1A 4LF7H 4JI1H 2ZXIA 2Q0OA 3Q9SA 2JA7J 2F4MB 4XSZF 1HNWH 2MA3A 4GC6A 2STWA 1X19A 4DV0H 4Y52J 1B1BA 3GLKA 2JEFA 4G6QA 1JT0A 5GAHJ 1EUDB 4EM1A 2R92J 1ENHA 1Z3YA 2YU3A 3HBLA 1W5SA 3MZYA 4ZYHA 1S97A 1IAWA 2QWWA 3GTMJ 2R7UA 2PVPA 2R7WA 2QQAA 3WTSC 2CJJA 4QIWE 1K83A 3W3CA 2Y48A 2UVVA 3C1DA 3VOEA 4MO7A 5JVLA 5FLMJ 1F36A 2LY9A 1M6VA 3PO2G 4A0ZA 3HOZJ 5F0CA 1K1SA 3JZIA 3TOBA 5GTIC 2A68F 1MD0A 3HTSB 4XK4A 1T94A 1OMIA 3GMEA 2I5UA 4DV5H 3QPHA 2H27A 2W9BB 3KEQA 2NVYA 3NGDA 3L09A 3OYMA 1G3YA 1ZQ3P 5K7HA 2KIQA 4BXFA 1Z05A 1X1CA 5CAEB 1Q1HA 2V4RA 1FYMA 1PK8A 4J9QA 4Q8FA 2KIFA 4F4ZA 1WCMA 4YR0A 1B04A 4MV4A 1KJQA 4BXUA 3H3UA 2JEJA 3PM1A 3JRGA 3VSKA 1D0XA 1FPQA 2LVSA 4D0PA 4RMNA 4IHYA 1D5VA 3Q5FA 4HNUA 3H0DA 4BAYA 2XC7A 4EGQA 4DV6H 4YJ2F 1HKSA 4U7CA 3V6KA 1PUFA 3GIJA 2EV5A 2LBFA 4EJWA 4HX7A 2E2HJ 2WDTA 2UXCH 1LFBA 4ECZA 5KFTA 4FX4A 4G7ZF 2W6NA 2RDPA 2V1XA 3F6OA 5CVIA 4Q43A 4AIDA 3KP3A 5BNGA 5J4YA 4JI8H 5KFLA 4BY7G 3LSTA 1FYKA 1ODDA 3BJAA 4PK4A 5DS9A 3U9GA 1XGOA 1GVDA 3D0SA 5EF6A 2YCHA 3GIDA 1LDDA 1RI7A 2M9HA 4P1WA 3WHBA 4CCLA 2V7FA 4DR1H 1PX2A 3DPUA 3CJNA 1F43A 3OOUA 4I09A 3S1MJ 3C2GA 3PW7A 1FEXA 3PO3J 1G8XA 1IGNA 4O4LF 5KK1A 4FASD 4ZYGA 2VR1A 1ETWA 2EB7A 2X51A 3OYJA 1K4TA 2X1EA 1HKTA 1SAUA 3GTPA 4XIDA 5K5QA 4KDPA 4FS2A 3I56I 3SZPA 1IZ1A 4U0WA 4U7DA 3I55I 5KFHA 3NRVA 2M4KA 4EJTA 5B1AH 5KFRA 2PBIA 3V4ZA 4C2MA 4F55A 2XROA 4B3SH 3KAKA 2L9NA 5GTHC 4YAKB 4G6DA 3KTMA 4MEYF 3IH3A 1FOYA 1ZETA 3KIOA 2KRFA 4EATA 4B09A 1S6LA 1Y0UA 1ETYA 4JX4A 5E3MA 4DR6H 5EWFA 1RPWA 3FM3A 4IJAA 2PMZN 2VN2A 1MBHA 3OIPA 2BY0A 3KAJA 5KFQA 1U3EM 2HQ5A 3SQNA 4BHBA 3MKZA 3G6YA 2IMWP 2LK2A 3CJRB 3CESA 4PFPA 4AU7A 3CD6I 1S7OA 5EWGA 2OJED 4UUTA 1ETQA 4EEYA 5BOXA 2R7KA 2VBYA 5DCFA 2AGOA 3FF5A 3VPRA 4D7NA 3E1SA 3ZPLA 2VUMA 3R60A 3OYIA 3HOUG 1U5TA 4IHVA 2YX7A 2WAQN 3VEPA 1M7JA 4HW0A 2RAEA 2HOEA 1DV2A 1NHAA 1SVMA 1SFKA 2OU2A 1JDEA 3RGXA 5C3EJ 2R93G 2M34A 3KXYT 3H92A 2F4OB 2JSCA 2XKOA 2TDXA 3M9AA 3EUHC 3ULQB 1SVLA 1IC8A 2ME6A 3IRQA 5BPFA 1IRXA 1VNDA 3OL3A 4JK1X 1ZG1A 3RAXA 5BR8H 2JWTA 3M1EA 1HF0A 4EMSA 4GYGA 2K9SA 4EGJA 1XGMA 2DFHA 1XMOH 2BR0A 4XSXF 2CO5A 3ETJA 3TIIA 1OCOH 3ABLH 1D5YA 4RZQA 1Y0NA 1XS9A 4WXDA 5EDWA 2RGRA 1Y1WA 4QIWA 3Q8RB 4ENNA 4A6EA 1QU3A 2Z3YA 3K5HA 4IQ4A 2A6EF 2QBYA 2PN1A 2AXLA 2PFBA 1S72I 3FXKA 1FBQA 3OYNA 4HQEA 1KGSA 2IS6A 2FB9A 3EPIA 1GSHA 3OS1A 3I53A 2H09A 1VKZA 1Y8QB 1CF7A 3P9IA 2HVQA 1G2HA 1I3QA 3JRXA 5KFYA 4QWAA 1GYFA 2BY3A 2OTJI 1ZHQA 3E5UA 2W6PA 5IYDJ 3PIPF 5KT6A 1NG6A 2RNJA 3RBDA 3GIIA 3BC8A 2VQDA 3GTLA 3PFIA 1EYZA 2KZVA 2JZYA 3BR1A 5IYCG 5IT3A 1SVOA 1Z7UA 4M6YA 2KIUA 1ZELA 3ZP5A 2AQEA 1IDYA 1ZGAA 3BQ2A 2R7ZA 4ECQA 5D1PA 1XTAA 3BG7A 3FK7A 3HXLA 4BBRJ 2JSPA 2WY7Q 3ZQGA 3F6VA 1O3RA 3VPCA 3KYLA 2JA2A 3N05A 1F1ZA 5ICGA 5C4JJ 3BCBA 2ZJRF 1TWHA 3MWMA 2PMZE 4HNVA 3HOSA 4D1QA 3HOVJ 4UV9A 4A3KJ 1O3QA 3RYPA 4RBOA 3CC2I 1MJBA 2FNAA 3HPHA 3QZ7A 2DDAA 2DAOA 1TWGA 2IBKA 2DU9A 3HSEA 2FPIB 5CVJA 1YO5C 2JT1A 3BTJA 3K1PA 1U2WA 4KT6A 4MLOA 1KU9A 3RJPA 3BZ6A 4LF5H 2DMPA 2RGVA 5DD4A 3DU6A 4QWEA 4U0VA 3LSMA 2LC2A 1ZR2A 4UFZA 5JFRA 4F4YA 3JSLA 4BJ5C 2L54A 3Q1KA 2HQAA 4UV8A 3HSRA 2FMYA 4IVNA 3DTKA 4FE7A 2ZMEC 1Z3XA 3JRDA 3BOQA 2X6OA 2VOPA 2N8GA 3FBNB 1ZARA 4RB2C 2IEKA 3LSJA 4WK8F 3GZNB 2W4SA 3H5AA 3ROUA 4FCYA 2M87A 3V4SA 4HX4A 1GXPA 2P8TA 2KLOA 2DFEA 5H6RA 5FFZA 3DLLF 4U87A 2FA5A 5H6QA 3CCVI 4WWCA 4XKWA 3ABKH 5K7FA 4P9UA 1X3UA 5EYRA 2GWRA 3BQYA 2ZFUA 4E6KG 1FVIA 1WSCA 1J5YA 2QK4A 4ECYA 4E7LA 2KL4A 1R5GA 3G1LA 3OYKA 4KNYA 4QJFA 2XVCA 4QPOA 3WODF 3FHNA 4HNTA 3KYDB 1X3WB 4UUSB 1C0WA 2ZBKA 1R9TA 4LK0F 2LD5A 4X0GA 2V4QA 4RGXA 3G6EI 1D0YA 2ESHA 4FTHA 4RLQA 3JSOA 3N43B 2ID3A 5DG8A 4DUYH 3SEQA 4EJOA 4CHUA 4O3RA 4R1HA 3RYRA 2LKSA 1TWCJ 2TRTA 2QA4I 2UXNA 4NNJA 4LSAA 2V79A 3S3OA 2JA7A 2R5ZB 1GXQA 2W00A 5FKOA 4LFUA 2OCCH 4GDFA 1GHCA 1XMXA 2FNPA 1FKAH 3ABUA 4PDBA 2I8DA 3FKIJ 4YIRX 1MZBA 1MH4A 4M71A 4QWQA 2R92A 2YX4A 1PYVA 1EH6A 3BLYA 1ZGJA 5CB4F 4A3MG 1POGA 2X0LA 4BBSG 3NEUA 4JX6A 2HYGD 3J7AY 5E17F 5E8GA 5DQIA 3HGGA 3ZQCA 4MV7A 5C8YF 4R8HA 2R7QA 1FC3A 3JCUC 4JP0A 3L2CA 2QM3A 2H94A 4ZHQF 2DOFA 2RN7A 5JLXA 1MJAA 3JRCA 5FGMA 3HYIA 3KCCA 3FHZA 4RAGA 3TP3A 2Y9ZA 1L0OC 2BY2A 1H89C 1LVKA 1LFUP 3BP8A 3MZ8A 1CQTA 2F2EA 1QVUA 5GAGJ 1RNLA 2UUCH 1U9NA 2J5OA 1QPIA 4IF4A 2P7CB 3CUQA 3IUOA 4UCUA 4IEJA 2J9GA 2QSFX 3KPHA 1IO2A 1Y1VJ 3RTRA 3Q8QB 2E2HA 2KJCA 4PFOA 2FK1A 1FMVA 1JHFA 1YE9A 2E5ZA 1R4MB 2FBIA 2X6WA 1FOKA 1BBYA 1HKQA 1ZAOA 3TW7A 4S05A 3A01B 3RJ0A 1T98A 4UXNA 2HTJA 2PMZA 1LEAA 1ZKGA 3SZTA 4NQWB 3UQ8A 4GKJH 2A69F 3DWLE 5JUMA 1OYWA 1B4AA 3VMMA 4LF4H 4NXMH 4IRDA 5ICFA 3FBIB 1D1CA 4Q4ZF 4HQ6A 3NAUA 2HI3A 2V9PA 1JTYA 3I54A 2IS2A 1LVAA 2WAQA 5L3CA 2HYJA 3KHGA 3WU2C 1K78A 4J9NA 3D1NI 2NVTJ 2M1BA 3DEUA 1ITYA 1T36A 4ED2A 2HXIA 1WI9A 5DUKA 4DJAA 2K3PA 3LWFA 4Q45A 5DG7A 1K7AA 2E1MB 1D8JA 1XSVA 3PNTA 1SFXA 3PUBA 3S3MA 4L18B 5FLXK 1RJQA 2AU0A 1CQIB 1UG0A 1N48A 2GPSA 1MBJA 1WPKA 4A3IG 4AYBN 2W70A 3ASNH 3HOXJ 3CCRI 4CICA 1FYLA 4Y8VB 1VQPI 4ESBA 3I5UA 2EFOA 2HJWA 4V2FA 2QYZA 1IXCA 1S0MA 5AIQA 2MH9A 2XV4S 1Z6RA 3ZRGA 4CCOA 1R49A 2I87A 2IA6A 1BR2A 4RUAA 1GV2A 2BZTA 4EBEA 4IOAF 1HA8A 5BPDA 4BEHB 2V1DA 1HDDC 1Z77A 4HYKA 1WCMJ 3Q0UA 3LSPA 2R7SA 1J9IA 2E1MC 3WU0A 4EJVA 3MKWB 1BL0A 5CKTA 3S15J 4CC6A 2X48A 2L3DA 5I47A 4IHWA 5LHGA 5HODA 2JA6J 3CDHA 3GVAA 2ECBA 2W9AA 1S0OA 5E79C 2DT5A 4I7HA 4UCSA 4BUPA 1XD7A 2DOEA 2K7LA 4NLGA 3VFZA 3T5LA 3S2DJ 5TRDA 1W96A 2E60A 1U8BA 5IP9J 2V9WA 2XAHA 1EUCB 3LMLA 1MSFC 1IXRC 1JGSA 5FKMA 1AA7A 4JQFA 3GTOA 2C2EA 2YU9J 2ELJA 1ULZA 3J7ZI 2W84A 4XKCA 4I55F 4XKVA 2HZDA 4CSWA 2BY1A 2X85A 4XZ3B 3BJYA 1VZ0A 3CC7I 3TW6A 3RPUD 1IRFA 4ED6A 1MBEA 4KA4A 3UR3C 3RPQA 2XPVA 2VXDA 3PL8A 2EZIA 3OYFA 4OOIA 1GLNA 1GT0C 4QWBA 3Q0WA 2OH2A 4UB6C 5KAFC 4X65H 1W7PD 5FD6A 1VQOI 3K3VA 5IYBJ 4NC6A 3BG3A 5CQGA 4J9LA 3P7NA 3JRWA 1N33H 4G3IA 4DL3A 1VI0A 5FKKA 3K4MA 5DQGA 1ETOA 4BY1J 5KFNA 3R5FA 4ESJA 4K2EA 5LGNA 3BG6A 5C4XG 1KU7A 2ZDQA 1KQ8A 3LP8A 2HWVA 1KJJA 3BR3A 5DCMB 1BNCA 1X2MA 4CYCB 4LITA 2BQUA 1G4DA 2DA6A 2X1DA 5AIPA 4MNUA 1BC7C 1ON1A 2OUMA 4Q47A 4YR3A 3L9FA 4XM3A 1AKHA 1QO0D 3ZMSA 2VQHA 4LH6A 1HLVA 2W8KA 1Z0XA 4WBNF 1F9NA 3GIPA 3BDDA 3K7AJ 2HOSA 3JSNA 5D5UB 2VKVA 1RIOH 5DGBA 4ZDOA 5HS8A 2L4AA 3TKYA 1S10A 3R61A 3F0CA 1UNNC 2MYSA 3PFYA 3ECHA 3ZMVA 1XSDA 1X4OA 4Y4RA 3W2WA 2DYRH 2M5WA 4LFBH 2R82A 2CV1A 4ENKA 3OIQA 1QZZA 4PUSA 4BE1A 3JW4A 2W7PA 4CC5A 2G0EA 5KVRA 2WV0A 1ZGWA 3TGNA 3WNZA 2SCUB 3KLOA 2YZNA 2A61A 4K0KH 5C44J 3BG5A 4ETSA 2TCTA 4A3EG 4BS9A 2C2RA 1SCUB 3BG9A 5E3NA 2D45A 3M9NB 4NHJA 1FWZA 2DPDA 1BJZA 2BVMA 1NK2P 3VWBA 3GYHX 1YJNI 1T2KA 5KFZA 3L4JA 3C18A 4ZDPA 2I80A 4MGRA 3AG4H 4BE2A 1RKTA 2UWMA 2LP0A 1S7EA 3GV8B 2ASLA 2Y0MA 1FP1D 4ECVA 2Y9YA 3PNVA 2IW5A 3FDYA 4MV1A 1X3ZB 3FWEA 5IP7J 1UAAA 3BZCA 3KP2A 4DL2A 2CG4A 1TC3C 4RAFA 2LKXA 2LKPA 4HLXA 3ZQIA 1I94H 2RQPA 3JSPA 3BR6A 2LF7A 2YPRA 4IZOA 4F50A 2NAZA 1OJLA 3E7LA 5FPOA 2VPSA 1JTXA 4PCQA 2FU4A 1DQUA 2GAUA 3L7WA 4LIVA 3OYDA 4O5VA 2C00A 4A93G 3M8FA 3B6CA 3QP6A 2E2JJ 3CCMI 2XPUA 1WH7A 2WAFA 5ERIA 2HQNA 5KFWA 2JA5G 3FKIA 4DL7A 1Y39A 3O6BB 5KFAA 5FLXZ 1C3OA 1B6AA 4I4TF 2IGKA 3RB3A 4A3JG 4KIFA 2OWOA 3S1NJ 3IV5A 4HF1A 2VKDA 2V1UA 2AO9A 2EZKA 5FJ8J 4QPQA 2DT7B 4S04A 1B8IB 2KSWA 4LFAH 2AGQA 2R84A 3LOCA 3OS0A
chains in the Genus database with same CATH topology
2VBXA 2DI3A 3ABTA 5HVQC 1O7LA 1FT9A 3KETA 4L9TA 2K4BA 3HRUA 3H20A 4UVBA 1HW1A 1V4RA 1YFHA 2JTVA 3FXUA 3L4KA 1H0MA 3BABA 4JI0H 4U7BA 4OINF 5J6XA 2OAZA 1X9NA 3BPXA 2E7WA 3JTHA 4Q5SF 2UXBH 5K1YA 4L0YB 1LDKB 1BI0A 2IA2A 4QLCU 1QBJA 4JYAH 2K02A 2LDUA 4G8XA 1F5TA 2HS5A 3M4IA 3CVZA 3EDPA 4EVIA 2GQQA 3FMAA 4YIIA 4IRGA 4HBLA 5BS6A 1UHWA 4HLYA 2FOKA 4OIOF 1XDNA 1SD4A 4FX0A 4KICA 2FSWA 3E6MA 3RGZA 2M45A 1HXDA 2V6CA 1XDSA 4GKKH 4YFXF 1U6GA 1N36H 2OQGA 1SAXA 3HUGA 2FEZA 1BC8C 3ELKA 2EWNA 4KIGA 4OIPF 4M9ZA 2NNNA 2H6CA 4YG2F 2VT2A 2UXDH 4G7HF 5HLIA 3E6DA 4ENJA 3IC7A 3IHUA 1P6RA 3GZ5A 3WE2A 2X4HA 1IBLH 1OPCA 3EQLF 1ZG3A 3CTAA 4LB6B 5IT9K 1ZLKA 2L02A 3I4PA 5AONA 4OMYA 2MC3A 2XKPA 2D1HA 5LRSA 3GX4X 5LGTA 2Z9OA 2WWYA 3F23A 1ZHSA 1PP7U 4DR7H 3GZ6A 2M30A 5F64A 2DK8A 2B0LA 2XAFA 4MTEA 3N44B 2PI0A 5LEJA 3O2PE 5FPRA 4HZFA 4Y15A 1FLIA 4GYIA 3I59A 4LF6H 4A6DA 2XAQA 5CVRA 1U5TB 2JPBA 4I0BA 3GF2A 4LG0A 2VC1A 1IXSB 4IPAA 3RF2A 4L5JA 4Q48A 2NS0A 1L3LA 4Y17A 4F7ZA 3EUHA 3PQJA 2BEOA 4I01A 4UCRA 1Z6TA 1WH2A 2VQEH 2D1VA 5LRRA 2F4VH 4LGWA 5ED4A 3VODA 1LJ9A 3P9CA 4WX9A 3T8RA 1SFEA 3BAAA 2ZJTA 2QBYB 3I58A 4AIHA 1SEIA 2WYOA 1I6XA 1CF7B 4KMUX 5E8IA 1IW7F 1PUEE 5DDGA 3DP7A 4KN7X 3HTUA 1G6NA 1I1GA 2Q8KA 3MQ0A 5D8KB 1W7PA 1KYZA 1B9MA 3DFGA 2E1NA 1LNWA 4XBFA 4LFCH 4PGGA 4EQQA 1TTYA 4B3TH 1YG2A 1TQIA 3G3ZA 3WTXC 2IJLA 1EH7A 4CGZA 3ZMDA 2CW0F 2A07F 1R22A 2ZM6H 1FSEA 1QQIA 2DQRA 4DR2H 1ZH5A 1D3YA 3BA8A 4CDGA 3F3XA 3L2PA 5HS9A 4P9FA 4UHTA 4P55A 2ZMEA 2QVOA 4IHSA 3LQRA 2UUAH 5HDGA 4IRHA 2O61A 4NXNH 2HHHH 3F8MA 2G7HA 3ML6A 1O3TA 5HLGA 3T0YA 4L9VA 1QPMA 1U8RA 1HNZH 5J8CA 3B73A 3TO6A 3GW2A 1P4XA 5IT9Z 2FF4A 5D6EA 1GVJA 4Y13A 3J7AK 2MCTA 1ULYA 2ZNZA 4Q0YA 1S8NA 3CO6C 2P5LC 2A3SA 5D5VB 5A2QK 1S68A 3PQKA 2XHKA 2VC0A 1LDJA 1KQ0A 3K2ZA 1YYVA 5FFXA 4UCVA 2PEXA 1IN8A 3GWZA 3N42B 3U2RA 4M9SA 4ZZLA 4A2UA 4A5NA 3N40P 2MH2A 5JVTA 2CGPA 2XIGA 3LA7A 2VONA 1MDMA 4HDUA 1R1VA 5K5RA 3WTTC 3W6JB 3T5XA 4A5MA 3J80K 3F21A 2IVMA 1XDUA 3CLOA 1FX7A 4WCGA 3BPVA 5JHUA 3CUQB 2VBZA 4LLLA 4UUVA 4G94A 1SD5A 2RC4A 1BOAA 4HF0A 2JPCA 2LSOA 2LF8A 4DQ2A 4L9JA 3LAPA 2GXGA 3DF8A 2CW8A 2GA1A 1KA8A 4BHPA 1K78B 2FMLA 4DR3H 1FZPB 3J7AO 4WXHA 2DPUA 1XCVA 4OU0A 4DV7H 1Z9CA 1IF1A 5LL6b 3N97A 3BROA 3O3KA 3PN1A 4HX8A 5J8FA 3FMQA 2EK5A 3QOPA 2EA4A 3F22A 5BPIA 1J5EH 4N0BA 4ZZDA 5HLHA 2EJRA 1HSTA 1OYIA 1P2FA 1I1SA 4N9HA 5ILUA 2ADUA 2PG4A 3WGIA 3HHGA 2ESNA 3CO7C 3GO5A 2E5LH 1WSUA 1XNQH 1N34H 4JI7H 1UFMA 5IT9W 3FXQA 1Z91A 2PN6A 5HS7A 4U88A 1WRJA 3J81K 3EETA 2EFNA 3TDZC 1XMAA 1V9PA 3Q9VA 1H9GA 1O57A 3P9KA 1TNTA 2Q2EA 3S2WA 4OMZA 4UVAA 5DV5A 2ELHA 2COMA 3GFMA 5FO5A 4M9XA 1H9TA 4M7EA 5E1WA 4CXFA 1R5HA 2VE9A 3TDUC 5FD5A 2H6BA 5L3DA 5A2QZ 2P5KA 2VUGA 1IBKH 3SFZA 5DUIA 2VODA 1XCBA 4AVPA 4XRFA 3QRFF 1VS0A 1OYYA 1J75A 2QYOA 1LEBA 4MV9A 3F8BA 3FM5A 3ISPA 4IAJA 1IN6A 4HOBA 1FJGH 2VBWA 5CYVA 2XAGA 4GLXA 2QLZA 2ACJA 4GCVA 1M0WA 2HFHA 4PGHA 5LLQA 3J80Z 1YW8A 4EM2A 4A12A 3IRRA 1O3SA 4DR5H 2YSRA 1IUYA 1AOYA 1T39A 3K0LA 2STTA 1FSHA 4LF9H 1IN5A 2XUBA 4PZJA 2ZXJA 3BA9A 4KIBA 1ZRCA 2O03A 4DV4H 1W5TA 4AD9A 4OIQF 3IL2A 1HW5A 3F72A 5LMNH 2OQRA 1YW9A 2HVSA 2UZKA 3M7GA 4ON0A 1P4AA 2XGXA 1HW2A 1P4WA 2FRHA 5K5OA 2R3SA 4A0YA 1DPUA 1SMTA 3V4GA 3KP5A 5LBQA 3OOPA 1L2ZA 5FB2A 4BHCA 5H20A 5JR3A 2EFQA 4LLNA 4LB5A 3KZYA 2BGCA 4LK1F 3DF7A 4XLPF 3B02A 1O7FA 1TQPA 4R79A 1RUOA 2HTSA 3E3VA 4RB3C 4NB5A 4UVCA 3DPTA 3R0AA 3BWGA 2A5YB 5F1RA 5D8LB 3M8EA 5D1OA 2HKXA 2BV6A 4B3RH 2C6YA 4DNCA 1ZYRF 4OIRF 1AWCA 1KU2A 1TBXA 3N41B 1FP2A 3CUOA 4RAZA 3J81Z 5A2QW 2F5EA 4I0AA 4A2AA 3GUDA 3QPTA 1F4KA 1YTYA 5LMUH 4YFNF 1YW7A 1J0RA 1T0FA 3IG0A 4JBAA 1WQ2A 1BGWA 4ZYDA 1DDNA 3FXRA 3T1HH 3LFKA 1SD7A 3BJ6A 1QZYA 4LD5A 4UCTA 1E4GT 2D2WA 1B59A 3LA3A 1G3SA 4AQYH 2W24A 3GEZA 4ENMA 3J80W 2QENA 2CSOA 4ESFA 1USTA 2Y75A 1YIOA 4KMFA 3HOTA 5E20A 3KE2A 2FQ3A 4RGSA 3DKWA 2GZWA 1PDNC 2DO7A 1EV7A 2QZ8A 2K27A 4XLNF 3T1YH 3DV8A 2G9WA 3KFWX 4HQMA 1N32H 1J7KA 2KIMA 2V9VA 2IT0A 4Z2YA 1HNXH 2RKHA 2G7UA 4I98B 4P96A 1R58A 1OKRA 4AIJA 1J2XA 3I0TA 1XB4A 2EFWA 2HEOA 2PMHA 3LAJA 2DQLA 5EEGA 1TAEA 1BIAA 1LB2A 4JI2H 5D5WB 3EYYA 3L00A 2UXXA 4UCOA 3V7SA 5FLXW 3MAJA 5DEQA 2HGCA 4RS8A 4BWSC 4JI5H 5TJJA 1BI3A 2R7FA 4KT5C 1YS7A 1KU3A 1HR0H 4FHTA 3LQQA 2UUBH 4A2BA 2UU9H 3I59B 2P5VA 4GO1A 1XMKA 1E4FT 1XMQH 4BYYA 4TV7A 1R1UA 5D5XB 2MLKA 1MKMA 3I64A 5LGUA 4HYEA 4LG0B 1QGPA 2HKOA 1I5ZA 4WF2A 2R7DA 3VB2A 3H3ZA 3RIRA 3J81W 2PQ8A 1ZG5A 4RGUA 1A04A 2EA2A 5LEKA 4UNOA 4LMYA 1D8KA 2CW7A 3DQVC 1RZ4A 4HDVA 2VT3A 4EM0B 1U5TC 2P6TA 4HV5A 3E5XA 1MGTA 3WG9A 2OZUA 1BN5A 2Q2UA 2ETHA 4MQ9F 3TO9A 3K1MA 4GXOA 5HDKA 3WE3A 2NRAC 2HYFA 3RPUA 1BI1A 4DR4H 2DLLA 1QNTA 3RKXA 5DYMA 5BQTA 2ISZA 1W7PB 5ILVA 3ZQ7A 1R7JA 3C0FB 4MQVA 1YS6A 1MJ9A 3HRMA 2O8XA 2QQBA 3OTOH 3TQNA 1JE8A 1FBSA 3KP4A 2CQKA 2WC2A 4EEQA 3RDIA 4KN4X 2EV6A 1TQMA 1K6OA 4BNCA 1S3JA 3SXYA 1UB9A 2P7VB 1Z1DA 1UHMA 2KJBA 3HHHA 4EV0A 3RTXA 4E70A 5JI6A 1SMYF 2P6SA 2IA1A 3GFIA 1ONVA 1USSA 2DTRA 2ZMEB 5LHHA 3R0JA 1DUXC 2OBPA 2NYXA 3K69A 3E97A 3ZN0A 4M74A 2F5CA 3K9TA 1YQAA 4M6XA 2DFIA 5E1XA 1G3TA 2JRTA 3U1DA 4A0XA 5D4RA 2K4JA 5HOOA 3FMRA 3WGHA 4RB0A 2DW4A 2LNBA 3FZVA 4CZZA 4L0ZB 2QQ9A 2Z99A 5EOYA 4RB1A 4G7OF 3FMSA 1S7AA 1SFUA 2IP2A 2MBFA 1XGNA 4LF8H 1Z2OX 3IWZA 3C3WA 3MEXA 2FBKA 2FXAA 4X64H 1IN4A 3RIZA 2DK5A 4YHHH 4X66H 5L3GA 2HGSA 4B3MH 4LSXA 5E18F 3EYIA 4ZH4F 4DV1H 5LHIA 5CVUA 5ILSA 3T8TA 1WWXA 4R7RA 2BBYA 3F8NA 3IWFA 3WTWC 1W4MA 1S29A 4KHPH 5L3EA 4WXCA 1MDMB 3V8KA 3GFJA 2A6HF 2Z5UA 2F5DA 1I6UA 1BIBA 2MD5A 3GXOA 2RV8A 1E2XA 1STZA 1BI2A 4N9IA 1V3FA 2HZTA 3MCZA 3ERED 4O3MA 4HAMA 2VOBA 2K86A 3N4MA 1P92A 1E17A 3IKTA 3OV8A 4IXAA 4YIFA 2M8EA 2P4WA 4JI6H 5L3BA 1ON2A 3BY6A 4B8XA 1A0IA 1EH8A 4LH7A 2AS5F 3CUQC 2FBHA 1T38A 3KP6A 1Z2NX 3WTUC 3AAFA 4I2OA 2BYVE 3R6SA 3V8LA 2WE6A 1IBMH 2NNYA 1BJTA 4O6JA 4NQWA 4X62H 2YR2A 1FBUA 3ZMTA 4J0MA 2HDCA 3R4KA 1FY7A 3JAMK 4EGZA 1REPC 2HVRA 1DGSA 4L9NA 3WTZA 2MLGA 4JI4H 1TW3A 2W25A 2Z33A 2O6GE 1HQCA 2ZCWA 3N6XA 1XN7A 4MHGA 1PP8F 3LA2A 3GFLA 2IA0A 1B9NA 5BMZA 4KYWA 3DXJF 3QU6A 2QUFA 1SD6A 2CWEA 3KALA 6PAXA 3SHFA 2DBBA 1K79A 3E6CC 4H0EA 5D4SA 1ZRFA 3NQOA 4HF2A 2VXZA