5IP7G

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5ip7G01
2VNUD 1D7QA 1YZ6A 2JEAI 3GTOH 3HKZG 5ELNA 1N8RC 4PZ8A 4A3KH 4LFAL 2JA7H 5JJKA 2KHJA 4IOAA 1AE2A 4L5TA 2ZJPA 3CF5A 2R6GA 1E1TA 1IXRA 1HZ9A 2E2IH 4XTCS 5FJ8G 2OQKA 3PUVA 3RLNA 1VQMA 2BA1A 5IYDG 4DV2Q 3HOYG 1VQFA 2VQEQ 3S1MH 3RLFA 3F2DA 4JYAQ 1ASYA 1MKHA 1IBLL 4A93G 2V1CC 4JCVE 1Q46A 4DV4Q 4B3SL 4GLAC 4GKKL 3JAMi 4DKAC 1L0WA 1VQ8A 2JJQA 2I0QA 3M3YH 5M3MH 4POFA 1OXVA 5BR8L 1PV4A 4L5SA 3CCJA 4NB3A 3CAMA 4NXNQ 1XPUA 3U50C 3ICEA 4GNXC 2ZJQA 4OWTB 3W1BA 2ALYB 4A3FH 1JB7A 1CKNA 4LF4Q 4A3CG 1X3GA 4PZ6A 1KHIA 3UDGA 4AIMA 2B3GA 1VQEA 3PO2G 2UXDQ 3J80i 1XPRA 1K8GA 2CFMA 1I50H 1N36Q 4OX9Q 2DUDA 1D8LA 4IO9A 4A75A 1HJPA 2KENA 1EIYB 1XMQL 2Y0SG 1G291 3K81C 5M5WH 1ASZA 4LF8Q 4GLXA 3TRZA 3RR5A 1XJVA 2N8NA 3FP9A 4GNXB 4BBSG 3JC66 3UE1A 3OTOL 2Z0SA 1N32L 5FJ8H 3CMAA 5IYBG 1J5EL 3CW2C 3K8AA 1Q8KA 4R4CA 1NMFA 1UEBA 1XNRQ 3HOZG 3GD7A 1HNXQ 3PV0A 1EYGA 2KBNA 4UP9A 1VQGA 5IWAQ 3KDFA 1JJCB 4YWLA 2VUMH 4B3MQ 3CCLA 4JV5Q 4DV0Q 1KXLA 4AYBG 2FXQA 1AH9A 2K4KA 1KL9A 1SROA 2MQHA 1UWVA 1EUJA 1QVCA 4B3TL 1WYDA 2OWOA 2R92G 2N78A 2AHOB 1SFOH 2B63G 1XPOA 4C3JH 5IP9H 3HFZB 4JBMA 3GTJH 2VW9A 4A3GG 2NVXH 3GTQH 3F2BA 4GS3A 4DR6Q 4IPGA 1XMOQ 2UUAQ 3CPWA 4AH6A 1PH8A 3W1GA 1KQSA 4DV2L 3I4MG 1HZBA 3PSIA 4JYAL 2VQEL 5GAHC 1QVGA 4KHPQ 2A8VA 4MZ9A 1N33Q 1U5KA 3CMEA 3GO5A 3CC7A 2ZM6Q 2VQFQ 3HOWG 4X62Q 4A3JG 3I7FA 4YHHL 1LM0A 2D0OA 1OXSC 4P75A 4X65Q 2JE6I 4BXXG 3ULJA 1VQ6A 2OTLA 2KHIA 4Y7NH 1G51A 5K36G 4NXNL 5FLMG 2NVYH 3PUYA 2HIXA 3J80c 4IFDJ 1I5FA 4HJ5A 1A62A 5IYCH 1PH5A 4X64Q 5C44G 4OXPA 5C0XI 4LF4L 3PIOA 4BBRG 3PF5A 2OTJA 1W2BA 4DR5Q 1AE3A 2UXDL 1SRUA 3WWVA 5IT9c 3I55A 4DV6Q 1N36L 3PO3H 4OX9L 1DGSA 3H3VH 3CD6A 1E3PA 1L1OA 3CC4A 3S1NH 2N49A 4JI3Q 4A3BG 5LMNW 4LF8L 4YY3Q 2WP8J 1X65A 2IX0A 1C7YA 3M7NA 4QQBX 2R93G 1A63A 2LXKA 2JA5G 3I2ZA 4DPGA 2JA8G 2NVQH 3L0OA 4GLVB 1N34Q 1VQNA 2IHFA 2CCZA 1YJ9A 3BZCA 4NXMQ 1WCMG 1XNRL 3J7A5 3H0GH 1E7ZA 1HNXL 1CUKA 3CXCA 2VL6A 5IWAL 2UXCQ 2ASBA 2XGTA 1IBKQ 4B3ML 1XMQQ 4DV0L 4RG1A 3U4VA 1NE3A 3HOVH 2BH8A 1FJGL 4PZ7A 3BU2A 5DLQE 4JI6Q 2NZHA 1PA6A 1OTCA 3S2HH 3T1YQ 2CQOA 1RL2A 4AQYQ 2UXBQ 3K7UC 3RN5A 4DR6L 1K83H 1LYLA 1XMOL 1PVOA 2UUAL 3E0EA 3KLWA 3PCOB 4O0AA 5GQOA 4HJ9A 3RLOA 4IOCA 4GOPA 4KHPL 4DUZQ 2QGQA 1GM5A 1K9MC 1N33L 2YTXA 2JA6G 1HH2P 2I5HA 3U4ZA 2ZM6L 2VQFL 2PQAA 4X62L 3UE0A 1X3FA 3HOXH 4OO1I 5C4XG 2RF4A 1GKHA 3DM3A 2UUBQ 1K0RA 4IPDA 2MO0A 4IPCA 2AWOA 4R1JA 2Z6KA 4X65L 2KCTA 3AFPA 1VQPA 1EFWA 4BY1H 3M4QA 3A5ZB 2R7ZG 1UE6A 3PGZA 4MTNA 2VZAA 1VQIA 2YYZA 4EQ5A 3PUXA 5M3FH 1PH2A 1WCMH 2CWPA 4LWCA 4PG3A 4X64L 3SGIA 1PH6A 3UDFA 4QY7A 4UY8C 3CC2A 4BY7H 1GO3E 4A3EG 2Q2IA 2HIVA 4DR5L 4A3MH 4YHHQ 4DV6L 3STBD 5H1SE 3A74A 5IY0A 4JOIA 3VDYA 4GN5A 3A0JA 2QA4A 1Z9FA 2H5XA 4JI3L 1HR0W 1B70B 1C9OA 1QZHA 4GN3B 3B6YA 4YY3L 3S1QH 1U0LA 3CCUA 4R4OA 5C0XG 1RIPA 3S14H 1C0AA 1J6QA 1BBUA 1N34L 2E2JH 3CCRA 2NN6I 2E8GA 2K5HA 3F2CA 1X55A 4JI0Q 4NXML 2BA0A 3CCQA 3L7ZC 1I6HH 4A3IH 1Y1WH 2ID0A 2UXCL 1IBKL 4IFDI 3CP0A 1I94Q 4OONA 5IP7G 4RMFA 4LW1A 1NBWA 2GN5A 3KF6A 1PH3A 1VQ9A 3MEFA 2Q2TA 4JI6L 3M85A 1JMCA 4HJAA 4YWKA 3W5OA 4L5QA 3T1YL 4LFBQ 4UP8A 1CSQA 3E9IA 2WB1G 4FDBA 5LMUQ 4AQYL 2HHHQ 1KRSA 4JBKA 2K5VA 4A4IA 3HOYH 2UXBL 5IYDH 4A93H 4Y52H 3TEHB 4JI7Q 5GAGC 1R9TH 4JI4Q 2HT1A 1GD7A 4DUZL 2CKZB 3G71A 1KD1C 5GAEC 2IX1A 3PUWA 3G4SA 2K5NA 4POGA 4A3DG 1FJGQ 4LFCQ 4UP7A 5HY6A 3D31A 3GTGH 3AQQA 1UE5A 2IT1A 4TVAB 1A8VA 3T1HQ 2UUBL 2D62A 1HZAA 1PYBA 1YI2A 4HJ7A 1CKMA 3S16H 1JJ2A 1UE1A 3OYYA 2Q2UA 4DR4Q 5ELOA 4A3CH 1HNZQ 1H95A 3K7AH 2A19A 2K50A 3PO2H 3UDXA 1MJEA 3CCEA 3M9BA 4OO1G 4IPHA 3K0XA 3KJOA 1YJNA 4LUVA 2WAQE 4LUZA 3GTLH 2AMCB 1TWGH 4DV7Q 1K73C 2C35B 4BBSH 2I5MX 1GVPA 4JI5L 1SE8A 3GTKH 5IYBH 2GVBA 3HOZH 3GDEA 1CKNB 4HJ8A 4PMWA 2K52A 3ULPA 5JEAJ 4JI0L 3NENA 1EQQA 2OCEA 1VQOA 1PH9A 1SN8A 3FKIG 1TWFH 1PH7A 3A5UA 2R92H 1QUQA 1Y1VG 1I94L 2B63H 1EOVA 5HGQA 3I4NG 4A3GH 1PH4A 2NN6G 3LGJA 2B29A 3CQZH 2E5LQ 2BH2A 4LFBL 5LMUL 2HHHL 1VQLA 2YU9H 3F8TA 3I4MH 1SLJA 5C4JH 4LF9Q 2RHSB 4DUYQ 3TS2A 4IFDG 3KDFB 3I4OA 2EIFA 2L15A 1WI5A 4DV1Q 1TWCH 4DK6C 1VQAA 4DR3Q 1KC8C 4JI4L 4A3JH 3HOWH 4P72A 1VQCA 4BA1I 4HIKA 2NVTH 3EN2A 4BXXH 2YTVA 3RNUA 4OWWB 4LFCL 4R4QA 3HOUG 3U58A 3T1HL 3KOJA 5FLMH 1E1OA 4B3TQ 4A3KG 2JA7G 2GVAA 5C44H 4DR4L 1HNZL 4BBRH 2MFIA 4A3LG 1Q1EA 5J3BA 1NTGA 1Z47A 1S3OA 2Y0SE 1V43A 2PMZE 4ME3A 3KYHC 1IYJB 3S17H 1FGUA 4A3BH 3NBHB 1Y1VH 1LTLA 2R93H 4JC0A 1L1OC 3I4NH 1VQHA 2JA5H 1LUZA 4DV7L 4QIWE 1QZGA 5M3MG 4APVA 4JI1Q 1Q82C 3KFUA 4GNXA 2NZOA 5AJ3Q 2DGYA 3AEVA 3ULLA 4QGUA 2CWAA 1EWIA 1YBYA 4DR7Q 1VQBA 1V9PA 4A3FG 2QEXA 1Q7YC 4AYBE 2A1AA 2JA8H 4GKJQ 2ZTCA 4TQUS 5FLXc 5JJLA 4X66Q 3M4OH 1TWAH 3NEMA 2MO1A 1L1OB 1YHAA 2WFWA 2JQOA 2IY5B 3S15H 4DR1Q 1NY4A 4JI5Q 3OW2A 2F4VQ 3K80C 2E5LL 5EAYA 2R7DA 3CCVA 4UPAA 1V1QA 1K3RA 2LXJA 1BVSA 3STBC 1YITA 4LF9L 4XIGS 2JA6H 4DUYL 4JI8Q 1YHBA 4DV5Q 2JEBI 4DV1L 1PFSA 4C3HH 1HR0L 5C4XH 4DR3L 4GOPC 2VUMG 4B3RQ 3AFQA 1P8LA 3PUZA 4YCUA 2AWNA 4JI2Q 2ATWA 2K75A 1PHJA 3ZJYC 3G48A 2R7ZH 1IL2A 1UE7A 2HQLA 1OXTA 2Z6KC 5JJIA 1EIFA 4WJ4A 5IP9G 4LF6Q 3S2DH 2Q2HA 1S72A 4KI0A 1XTDA 3F1ZA 1VQ7A 3NELA 4LUOA 1X3EA 4HIMA 1HZCA 2XTIA 4A3EH 1CSPA 2ZJRA 5LMNQ 4GOPB 1IBMQ 4JG2A 1XNQQ 3E9HA 2UUCQ 4YCWA 4C3IH 2PQAB 3EBEA 3ERSX 3RN2A 4JI7L 4JOIC 1P16A 4QJFA 3CCSA 1YIJA 1FL0A 1L2FA 4DAYB 3J81c 3Q8DA 4JI1L 2OQ0A 1A0IA 4KLKA 5AJ3L 1X54A 3RZDH 2VS1A 4LF5Q 1VQ4A 2KCMA 3MXNB 4IJLA 1N9WA 4DR7L 1NMGA 5IYCG 4HIDA 4DK3C 3KJPA 4JBWA 1SR3A 2RHQB 4HIOA 1TXYA 3UDIA 3PF4A 4GKJL 4MNOA 4DR2Q 4YCVA 3TREA 4X66L 5IP7H 1YHQA 4J15A 4NPSA 3PO3G 1VS0A 1X56A 2R7FA 3GTPH 4DV3Q 4R4IA 4C2MH 1VQJA 3D0FA 4A76A 1I3QH 4DR1L 5GROA 1VQ5A 5IE8A 4ALPA 1Q12A 1VQDA 4WJ3M 5M5YH 1FVIA 5E7NA 2F4VL 1YNXA 2F3IA 1T9HA 2ES2A 2UU9Q 1KRTA 4BA2I 1HNWQ 4LF7Q 5C3EG 3H15A 1W3SA 1SMXA 1IZ6A 1MJCA 4K0KQ 4YWMA 5M5XH 3CCMA 4X6AH 1BBWA 2PI2E 3S24A 3JAMc 1JJGA 3H0GG 4JI8L 1JE5A 4DV5L 1PYSB 2IHEA 3IRBA 1BKBA 4A3DH 4B3RL 3HKZE 3CPFA 1M90C 2EQSA 4GN4B 4DV4L 2K14A 1TWHH 1X9NA 4JI2L 1KAWA 3KF6B 3ER0A 1K8AC 1KIXA 3HOVG 4LFAQ 2JK8A 4LNQA 4OWXB 2MNAA 2E2HH 2PNHA 3KF8B 1B8AA 4LF6L 2I5LX 3J81j 1YVCA 4JBJA 1VCIA 3S1RH 1Q81C 1IBLQ 1Y14B 2RCNA 1OXXK 3M4PA 1HR0Q 4P73A 1B7YB 4B3SQ 5LMNL 1IBML 1QVFA 2YV5A 1XNQL 4GKKQ 5JEAG 1E24A 1MIUA 2UUCL 1G6PA 3FHWA 3I56A 2PI2A 4DNIA 2AKWB 2ZTDA 3HOXG 5BR8Q 1PH1A 1Q1BA 2EXDA 1Q86C 1E22A 3L2PA 1JT8A 4BY1G 2LSSA 1NJIC 1OXUA 2VY3A 4P71A 4DAMA 4QL5A 5C3EH 5M3FG 2ZTEA 4LF5L 2F52A 3J7ZC 3GTMH 4EX5A 3FKIH 4IJHA 4BY7G 1O7IA 1WJJA 4O2DA 5GADC 3TS0A 3DLLA 3HKSA 4DR2L 4A3MG 4JV5L 2D0PA 3G6EA 3TQYA 3PIPA 2WAQG 4DV3L 2WB1E 4H02A 2JA9A 3H3VI 1EQRA 2N3SA 3OTOQ 1N32Q 1X6OA 2YTYA 4P74A 1J5EQ 1S40A 4A3LH 1HNWL 3J81i 4KHZA 1VQKA 1WFQA 1M1KC 2UU9L 4LF7L 3BJUA 3EIVA 1WOCA 1CKOA 1YEZA 3AYHB 4L5RC 4K0KL 1YJWA 3RZOH 4R4TA 4A3IG 3BZKA 1Y1WG 1QUQB 5C0XJ 3HOUH
chains in the Genus database with same CATH superfamily
3AB9A 3R23A 4QWBA 1PRTC 5ELNA 4PZ8A 4A3KH 2LKVA 2W7OA 4L5TA 2ZJPA 2FMCA 4QUFA 5LL6X 2NUAB 4LFAH 4A3LH 2OQKA 2BA1A 1C4QA 1VQFA 2VQEQ 2R7LA 4MA5A 1RYRA 3NSWA 4JCVE 3SVMA 3Q6SA 1WTVA 5LHY1 5KFTA 5CYUA 1I6UA 5J2TF 3RJ0A 1EY7A 1L0WA 4DKAC 3K5NA 1VQ8A 2V9WA 4B3SH 5CC4A 4GKKH 4FP5D 2B63A 1EZ8A 3R5FA 4L5SA 3SDZA 4C3JG 4ED2A 1XPUA 3U50C 2R87A 1O80A 1ONLA 2EYHA 5FO7B 2C2DA 1TY2A 3CQZA 4LF4Q 4UCTA 4FU0A 2L12A 4M7EA 4PZ6A 1XPRA 3KAJA 3EA6A 3SK6A 2Z9HA 4IO9A 1D8LA 2K1BA 1TWCA 2KA7A 1HJPA 5EBDA 1FKAH 1EIYB 1U4LA 1G291 1O7LA 4E6IA 4GLXA 3TRZA 1XMQH 1CQIB 3GTGB 3OHXC 3PR5B 5CORA 4IWXA 3JC66 4C3JB 3OTOL 1N32L 1IHZA 4J6HA 2NVXB 5FJ8H 3CMAA 3EVQA 3K8AA 1NMFA 1UEBA 3PV0A 1EYGA 2VR1A 5EOYA 4ULLA 5IWAQ 3KDFA 4RKLA 4I55F 3CHBD 2P0AA 4B3MQ 1K8MA 4AYBG 1PXUA 3OWFA 5KFPA 1UWVA 1EUJA 2SEBD 4B3TL 3QZ7A 2OWOA 4HR7A 3GV5B 5KFJA 3M4IA 4CJ1B 1TWGB 3BYTB 3GTJH 4EGVA 1Z7TA 4Q5VA 4GS3A 4DR6Q 1XMOQ 2UUAQ 3N6XA 4LH6A 1E2ZA 3I4MG 3W1GA 1KQSA 5IGEA 1S68A 3PSIA 4EGJA 2VQEL 1QVGA 5KFOA 2A8VA 3SR1A 1N33Q 1VF7A 3GO5A 5C1PA 3RB6A 2ZM6Q 5CGKA 2FPIB 2RDJA 2W6NA 2NU9B 2UVWA 5FLXL 1NR4A 1LTTD 2SOBA 3DF7A 2CHBD 2OTLA 2VPQA 3KAKA 2XRQD 4YHHH 1G51A 1EYZA 1H9MA 3PUYA 2HIXA 4WJWA 1I5FA 3M9MB 4X64Q 4NXNH 2VUGA 4LF4L 2F0WA 4NP5A 5J1ZA 2PPBC 2CH4W 1AE3A 3H0GB 1SRUA 3WWVA 1TU2B 5M9OA 3I55A 3Q24A 1W6KA 1E3PA 4QQBX 1SMYD 4LMYA 1PZKD 1SEBD 3IFTA 3MWMA 3I2ZA 2NVQH 1VQNA 2W8KA 2IHFA 4ECWA 4UCUA 3J7A5 1GXDC 4OEMB 3MJFA 1XDNA 4HMIA 4F4ZA 1B1ZA 3EQLC 1XNRH 5IWAL 1PFBA 1IBKQ 4B3ML 1HA6A 3U4VA 5LP6F 3HOVH 1F9QA 3OHAA 2CVRA 1FJGL 4DV0H 3HOXB 1G2TA 2NZHA 3JZIA 3CRLC 1Z6HA 1WSCA 1IKMA 3RAXA 3JRXA 4DR6L 1PZJD 3J81L 1LYLA 2IW3A 3R2TA 1XMOL 2UUAL 2KCCA 3PCOB 3A56A 4O0AA 4HJ9A 4EQOA 2DJFC 4CDCC 2JA6G 4GZYC 1N33L 4X3TA 4FS1A 4XZ3B 2BQ3A 2VQDA 2ZM6L 1RF2D 1ESFA 2UUBQ 1K0RA 4IPCA 5FLXE 4O3SA 5CA0F 3AFPA 5JPNC 4CGYB 4C2MA 2R7ZG 4Y8VB 1UE6A 4HN7A 4HMJA 2YYZA 2Q8RE 5M3FH 3VPCA 2W9CA 2WB1A 1PH2A 2W7PA 1EY9A 3MXNA 4X64L 4OL7A 1BBXC 3IFDA 3UDFA 4BY7H 3H6MA 2GPWA 2JEGA 4GC6A 3PW5A 4JOIA 4DR5H 1Y1WB 4DV6H 1HR0W 1B70B 1QZHA 3LNNA 4GN3B 4RNOA 3CCUA 1MBYA 4K5WA 5DM73 5C0XG 2ZDQA 4YY3H 2R7ZB 1RIPA 3S14H 1DJRD 2K32A 2ZXPA 2E8GA 1MSGA 3VYRA 2VXWA 1B6RA 1JKJB 3SK8A 1ZHQA 4XQJA 3TQTA 4A3IH 2V4QA 1IBKL 3FEWX 2PW5A 4EQNA 2UXCH 3D4RA 3T4AC 5KG2A 3G6YA 3KF6A 3MEFA 1FNUA 1EWHA 2W70A 5JH7F 3IN5A 4NLGA 4YWKA 3W5OA 3VR6A 5KFSA 1JWSD 1CSQA 3E9IA 4JI6H 3HOYH 3S16B 3NGDA 4A4IA 4A93H 2F0QA 2TSSA 4OIKA 4MV3A 4JI7Q 1T5XD 3QWNA 5GAGC 1R9TH 1K0SA 4ECTA 2A6HD 1GD7A 4ECQA 4LFCQ 4KY6A 3WOEA 1Y1VA 4TVAB 2YZNA 1ILQA 3T1HQ 2UUBL 2C2RA 5CV7A 4RCOA 2D62A 4H7BA 4HJ7A 1QG7A 2WE6A 4EEQA 3TDQA 3OYYA 4DR4Q 4ED3A 1H95A 1BXRA 2K5QA 1HA5A 1B3AA 4MIUA 3V6JA 3M9BA 2PBZA 1S0OA 3SXHA 3UQ8A 3N44B 4O3RA 2F0LA 3GTLH 1ILPA 3QZ8A 2Z6BA 3PW7A 2B63B 2C35B 1D5MC 3GTOA 2KHSA 3CQZB 3F8NA 1PTOF 4K8JA 3FMAA 4XQQA 5JVLA 2DN8A 5C4JB 1GHKA 4F4WA 5KNBA 1ICFB 5KX5F 5ELEA 1TWFH 1WD0A 1TWCB 3OW7A 3M9NB 2R92H 3J7AK 4EYIB 1QUQA 3D6CA 1BDOA 3JSLA 4ZKCB 1EYDA 1I4XA 5ELCA 2FK2A 3MR2A 1I94H 4R8NA 5L1IA 2NN6G 2SCUB 3GV7B 4V190 3F8TA 2RA4A 2HHHH 3LWEA 4IFDG 3KDFB 4JI7L 2L15A 3BJYA 2FINB 2UVVA 5KFYA 1JICA 4X3SA 4BA1I 4CDFC 4JI4H 4HIKA 2NVTH 4BXXH 1TR5A 3Q8PB 4OWWB 4LFCL 4HR7B 3T1HL 3BS1A 5KFKA 2JA7G 5C44H 3G6JB 4DR4L 4KMUC 1AP0A 1C30A 2MFIA 2HJWA 4ME3A 1EU3A 3KYHC 2SNSA 2VUMA 3VPDA 3NBHB 3M4OB 4TUYF 1Y1VH 4I65A 1WTHA 4JC0A 2XIWA 1ZKOA 2IP4A 1PDQA 5M3MG 5EPLA 4JI1Q 1Q82C 5AJ3Q 4RFBA 3AEVA 1PFMA 1QE6A 4ZKBB 1VAJA 3GTQA 4DR7Q 1VQBA 1PRTD 2Z8LA 3C46A 4A3FG 3LWUA 2G9DA 4AYBE 2PZWA 2JA8H 2O5IC 4KY5A 2ZTCA 4IUUA 1E4EA 2R82A 2ICEC 2X69A 4EYHB 2O4XA 2WFWA 2ICIA 2VB3X 3S15H 1E2WA 1F9RA 3OMGA 4DF7A 4JI5Q 2PMZA 3V6KA 4U68A 3U9SA 5IODA 4L1KA 1WTRA 3JAMW 2R7DA 4IR1A 3CCVA 2YW2A 2EYPA 2KECA 2LXJA 3S2DB 1BVSA 4WBNF 2DPJA 3A7LA 3QOJA 4DV5Q 5LL6S 2WACA 1HR0L 4DUYH 3TIIA 3PUZA 2AWNA 4C3IB 4FVMA 3K57A 4IUQA 2FJZA 1AUXA 5JJIA 4IRDA 3LP8A 1EIFA 3KHGA 4LF6Q 1S72A 2CZGA 3F1ZA 4A3EH 1HZCA 4C1NK 5CBAE 4DL2A 4JG2A 2UUCQ 4IUVA 3DM1A 2XIGA 4JOIC 3J7AV 2BCOA 1FL0A 4C1NI 1L2FA 4DAYB 4C2MB 2R8JA 1ZYRC 4JI1L 2LS01 5AJ3L 5JAVA 2WB1B 1K1QA 5M5YB 1VQ4A 4HAEA 5BN3A 3MXNB 5DNFA 5G3LD 4DR7L 5IYCG 3RAQA 5KYLA 4EFEA 1K83A 2RHQB 2W57A 1SE3A 1B3QA 1DV1A 3H4DA 4GKJH 2WDTA 2EYOA 4LSXA 4DV3Q 4X66H 4ZAIA 2ATLA 3D0FA 4A76A 1I3QH 4ALPA 1Q12A 1VQDA 4DR1H 2A73B 3C1FA 5ISRA 2ES2A 2PW7A 1HNWQ 3T5HA 2QF7A 2F4VH 4RNNA 1MJCA 2NTTA 4KJNA 1BNCA 5M5XH 1SNMA 1B53A 4WFN3 3EJIA 3CCMA 5BN4A 4DV5L 1FNVA 1IYVA 4RB2C 2EQSA 2PCFB 2QCPX 3SK5A 2NB0A 1KAWA 1TT2A 3ER0A 3ITPA 3KF6B 4DLKA 2C22A 3BYYB 1EZ6A 2JK8A 4LNQA 4OWXB 4LF6L 3JRWA 3J81j 2RDFA 4G57A 4TSSA 1Y14B 3MFIA 3AU7A 1E4GT 1STHA 1OXXK 4J9SA 4P73A 1B7YB 5ELBA 4J9MA 1SNCA 4HSPA 3MZ5A 2UUCL 1YNNC 4K8IA 3FHWA 5LMNH 1IBMH 2PI2A 2NU6B 1EL0A 5BMVF 4MAMA 2ZXOA 5BR8Q 1WTPA 1PH1A 4ED6A 2FPGB 5K2MA 2EXDA 3L2PA 2J9GA 1OXUA 4DAMA 1UAPA 2Z1CA 4DAPA 5C3EH 2YS7A 5JVH3 1TQOA 3FDSA 3MFYA 4IHJF 4UFZA 3FKIH 3HG9A 4YR2A 1ZXTA 1O7IA 1GUGA 1WJJA 5GADC 4O3OA 3CU7A 5IWAH 2D0PA 3TQYA 5JVDF 4DV3L 1LTAD 4QW8A 3GTGA 2RSOA 3GTOB 4JV2A 4RZQA 4JPBW 1X6OA 2YTYA 4DNRB 1HNWL 4CJ2C 3J81i 1IL8A 1WFQA 2L0CA 3EIVA 3S1MB 5C4HA 2R7NA 3RZOH 1XMOH 2B8GA 4K0KH 2UVRA 1AFPA 3BZKA 1QUQB 2XWJB 3RN2A 4YB8B 2VNUD 3GIMA 3M3YB 1LV9A 1N8RC 1TWGA 3C0FB 3LMLA 1LLRD 5JJKA 1EY4A 4IOAA 2XGQA 3CF5A 2W6ZA 4ME6A 2IX3A 4XTCS 5I47A 1XTCD 2QYZA 1A3UA 5K5PA 3A54A 1ASYA 2B2YA 1Q46A 3RUPA 1IBLH 2AUKA 4GLAC 3DUZA 4AYBA 1EIGA 2JJQA 3QJYA 3RUZA 4MN3A 5M5WB 5BR8L 1GUTA 5E3FA 1KDCA 3CAMA 3KLRA 2CW7A 3SHLA 2A6EC 3ICEA 3K5HA 2ZJQA 4XYLB 4RGTA 3W1BA 5COYA 4ZUJA 1CKNA 1JB7A 4A3CG 1X3GA 2V5AA 3SE0A 3A8IE 1KHIA 3N40P 3KHLA 3PO2G 1NR2A 2F0HA 2CFMA 4OX9Q 5D1OA 2DUDA 3WO1A 4LK1C 2VUMB 2F0EA 2F4IA 1HQMC 4R7RA 1ASZA 4ECXA 2AU0A 4QWAA 4MA0A 4BS9A 1ENCA 4BBSG 3UE1A 2Z0SA 3GTQB 3T16A 5IYBG 4R4CA 3HOZG 1DXMA 3GD7A 4F4YA 2KBNA 4UP9A 4JV0A 1J5EH 3PO2B 5EWEA 1C3OA 3CCLA 1HPCA 2IBKA 1AH9A 4O4HF 2K4KA 1SROA 3O13A 2MQHA 4EEYA 2J6UA 2PMZB 4C3JH 4JBMA 4A3GG 4Y7NB 2NVXH 4LAAA 3F2BA 2HGSA 3HS0C 4IPGA 1PLFA 3CPWA 1T36A 1HZBA 1BGWA 5J39A 4MZ9A 3IL8A 2Z4HA 3CMEA 4FS2A 4JYAH 3HOWG 4X62Q 4IAJA 3PO3B 2OXPA 4DU9A 1TWAA 1ZHSA 1OXSC 1MHWC 4X65Q 5IT9E 2JE6I 4GC7A 3TINA 5KFWA 1GUOA 4KN4C 5K36G 5JJZA 4KKUA 3I72A 3J80c 4TQSA 5EGTA 4J9QA 3MR6A 3PIOA 2EZVA 3K3VA 1KNAA 5ELDA 1W2BA 2W8LA 4O3QA 5L1LA 2W6PA 2JA6A 2E75C 5IT9c 4OX9L 3CD6A 2UXDH 1L1OA 1N36H 2N49A 2M9VA 4A3BG 4RGMA 5LMNW 2R93G 1X65A 2IX0A 3CVZA 2JA5G 4LF8H 2R7ZA 4MHEA 3R3OA 4KKSA 3GV6A 1N34Q 1QNKA 3T5JA 4NXMQ 3MFHA 3FMCA 1K83B 3H0GH 5TSSA 5C5LA 1WD1A 1AUVA 2OEOA 2ASBA 2XGTA 1WTXA 1HNXH 3VYTA 4RG1A 2K5WA 1K8OA 3E6ZX 2ZT9C 2R8KA 5DLQE 2F0IA 4M8AA 1PTOC 3T1YQ 3NQTA 4KY7A 4AQYQ 3PW0A 3T1HH 2NU8B 1EY0A 1KABA 1Z2PX 1PVOA 5KYIA 3E0EA 4F88A 3NTIA 3NHHA 3RLOA 4KD3A 2QGQA 1GM5A 1VBGA 2FK3A 2I5HA 4OO1I 4C3HG 4KHPH 4X62L 4A3MB 5C4XG 3HOXH 2ASJA 2RF4A 4ZCKA 3DWPA 3MAQA 5DLGA 2AWOA 4R1JA 4CHTB 1PTOB 1IW7D 4X65L 2VQFH 4BY1H 3GTPA 1SAPA 2K01A 5HGTA 4MTNA 2VZAA 1VQIA 4RZRA 3Q8SB 1RDPD 1PH6A 2E2JB 5EZYF 5KT4A 1CK1A 3CC2A 2R7MA 2Q2IA 2HIVA 2XN9C 5FD5A 3VR4A 2XSCA 5H1SE 3A74A 3BDCA 1V51A 2FK1A 2L1BA 1SEIA 1TAEA 2RDHA 3MFGA 2PQEA 4JI3H 4R4OA 3FPUB 4HCSA 4DK1A 5IGGA 4C5AA 1C0AA 1S4ZA 1N34L 3CCRA 3ORQA 3F2CA 2K5HA 1X55A 4NXML 4IZOA 5KFGA 2F0GA 2XCAA 1OWTA 3K3PA 3TP6A 1Y1WH 2MUYA 2PNRC 5IP7G 5ELFA 4RMFA 1VF5C 2EYLA 2BQUA 4TV8F 1NBWA 4K14A 1PMRA 2BR0A 1VQ9A 3M85A 3GIIA 5KNDA 5T14A 4L5QA 3T1YL 4LFBQ 4UP8A 3BABA 3KF8A 4AQYL 4JBKA 5IYDH 2BDOA 5L1KA 2NU7B 1PK8A 2UXBH 1NSNS 1JOOA 4J9KA 4EVOA 4LH7A 1D5ZC 3GTMA 3G71A 2B2YC 2Q8IB 2DWCA 5FD6A 1FJGQ 4KD4A 4DUZH 4YAKB 5HY6A 3D31A 4XX0B 1UE5A 1A8VA 1PYWD 4QWEA 3C1EA 3S16H 5T1GA 1UE1A 1IYUA 3N52A 5ELOA 1HNZQ 3AMUA 3TBIB 2VB2X 2K50A 2R3ZA 3ERQA 1GSOA 3RGXA 3PN1A 2K28A 2Q8TA 3TZDA 3KJOA 3NWTA 3NBHA 4AYBB 4RHRA 4LUZA 5KFIA 3OPOA 1SYBA 5A35A 1L0XB 1KLGD 1DD2A 1K1SA 1R4QB 2I5MX 4IQZA 1SE8A 1JWUD 2GVBA 2JA7A 4JI5H 3GIPA 2DJGC 1CKNB 1O7YA 4HJ8A 1V1PA 3FRPB 4K6LA 4PMWA 3ULPA 1TS5A 3MTSA 4S3SA 3I4MB 2E2IA 3TN2A 2OCEA 1Y8OB 2FHTA 1SN8A 1KJJA 5D1OB 1PH7A 4F4XA 3GLKA 4ECRA 4JI0H 4RAZA 1JB3A 2C28A 2B63H 4QB4A 2RCFA 3I4NG 2J4XA 2WAQA 5CV5A 4EG0A 3R2IA 3CQZH 1O7ZA 1RODA 3A55A 4LFBL 3R5HA 1TA8A 1VQLA 3KUPA 2V4DA 5C4JH 2RHSB 4LF9Q 5LMUH 5CV4A 2J6TA 3PW4A 1AN8A 3Q8QB 4L8JA 4DV1Q 1WI5A 1HRJA 1TWCH 4A3JH 3V2TA 1VQCA 2R85A 3M4YA 3MXGA 3S17B 5NUCA 4N8FA 1GUWA 3HOUG 4B9XA 3U58A 3I4NB 2A68D 5FLMH 2F0OA 4ZQ3A 5C6AA 1E1OA 3EFXD 3K5LA 1Z2NX 1N48A 1S5FD 4A3KG 2GVAA 5EJWA 2FB9A 1HNZL 4BBRH 4A3LG 1MSHA 1D6EC 4KV6A 2KSWA 5J3BA 2VA2A 3H09A 2PMZE 2FPPB 3I90A 3RBDA 1FGUA 5CBEE 2LMCB 5D14A 1TWAB 1L1OC 4APMA 4DAYA 3V4ZA 4GNXA 2NZOA 1SFOA 2DGYA 4O3PA 1L2ZA 4QGUA 1YBYA 4U6PA 1H9JA 2KOLA 5KT6A 1SYEA 2F0MA 1AN7A 1R4PB 5FPRA 3D4DA 4F8MA 5FLXc 2JA6B 5JJLA 3M4OH 2PYKA 3VPBA 1L1OB 4DGZA 1YHAA 5D8DA 2JQOA 4QW9A 4V0BA 2IPKD 1ESRA 3MEHA 5I9PA 3OMCA 4DA2A 3K80C 2ZXRA 2D5DA 3QOLA 2NVYA 4TQRA 3STBC 2E5LH 2OH2A 2D9UA 4LF9L 4U673 1UNSA 3MR3A 2K6AA 3KBGA 1T94A 4DV1L 3IG0A 1RKNA 3E5SA 4B3RQ 2L4NA 1LTGD 1JX4A 1I4QA 3BQ0A 4JI2Q 4DR3H 4N9TA 3RMHA 3G48A 2HQLA 1OXTA 2BE5D 2Y0SA 3S2DH 2B8FA 4KI0A 1YNJC 3GP7A 3RZDB 1VQ7A 3J81E 5AFWA 5KFXA 1X3EA 5KG6A 1CSPA 2ZJRA 3E0JA 3X3NA 2DY7A 1XNQQ 1BR9A 3E9HA 3G7LA 3I8ZA 5KFAA 4C3IH 4C5BA 5FPOA 2JEJA 2HCCA 2W71A 2QDBA 4QJFA 3GTPB 3CCSA 2R61A 4KHVA 2EY1A 3J81c 3Q8DA 4K2LA 1A0IA 4KLKA 2XC9A 1GOZA 3NUCA 2VS1A 4LF5Q 4FXGC 4H13C 2WTFA 4ME5A 4XQNA 4HIOA 3PF4A 5CAEB 1EY5A 4DR2Q 1EQVA 1VS0A 2F0DA 2W9BB 3GIKA 4C2MH 5LA6F 1VQJA 3TIGA 1VQ5A 5IE8A 3ND8A 5M5YH 1FVIA 1RTOA 5DG8A 4RGOS 4BA2I 2DPIA 1J9OA 1IZ6A 4DXGA 2R86A 3N42B 4FO2A 2PI2E 1HFGA 2CW0D 4O3NA 4A3DH 2IHEA 1BKBA 4B3RL 4K5XA 4ZRZA 1M90C 4JI8H 5DQGA 4DV4L 4UCOA 1WVLA 4PMBA 4JI2L 4ZHQF 3HOVG 1K8AC 1KIXA 1AZQA 2EYJA 2BDNA 4LFAQ 2M00A 3LX0A 3DWQA 2X0SA 4K2KA 2EDGA 3EYYA 3KF8B 1LT5D 2O2LD 1U4MA 1BCPD 2AGQA 2EPBA 1HTLD 4OELB 4JBJA 4OO1H 2FLNA 3S1RH 1SE2A 2L5TA 4OIJA 3M4PA 1HR0Q 2RVLA 4RH6A 4B3SQ 3GTMB 2XCLA 4IR9A 3GV3A 4BWSC 4GKKQ 1XNQL 5JEAG 1E24A 4YAJB 1EY8A 3I56A 4FXDA 2ZTDA 1JOKA 2B2UA 1CA6A 2VOBA 4IUPA 1Q86C 4QWDA 3TP5A 5E4WC 1NJIC 4EBCA 2VY3A 4P71A 1MI2A 4F50A 5M3FG 1G6ZA 2ZTEA 4LF5L 3ORRA 2F52A 4WD3A 4MTEA 3N6RA 1IOWA 4FF4A 1DOMA 4WORA 4BY7G 4O2DA 3BZDB 4DR2L 4JV5L 5EKLA 3M9OB 2WAQG 4ZOLF 2EYMA 4H02A 1EQRA 2C00A 2N3SA 1X3QA 2E76C 1B9NA 1SYDA 3MWYW 4P74A 2JA7B 3DEPA 3NQIA 2KCNA 1V1PB 1KDBA 4HSVA 5C5JA 1QCBD 1BUVT 2E2IB 4ECVA 1WOCA 5C3WA 2UU9H 2QK4A 2KEEA 2NZ1D 5KRUA 3RV4A 2L9HA 1YJWA 1ET6A 3HXLA 3V96A 4A3IG 2PO4A 2PZUA 5C0XJ 2XD4A 4CC6A 2NBFA 2WAQB 3HKZG 3GTOH 5M3MB 1CFMA 3P75A 3WNZA 5EKIA 4O2BF 4LFAL 1BO0A 1CA5A 4LMQD 4X65H 2R6GA 1E1TA 1IXRA 3GTKA 3HOYG 1FD7D 1VQMA 4FNFA 3S1MH 4A3FB 4X3KA 3F2DA 4A93G 1DV2A 5L9XA 5KG5A 4I7AA 4B3SL 1I50B 4GKKL 2ZDGA 3RBEA 3J80W 1STYA 1HXYD 2NYZD 3M3YH 1M0TA 4POFA 2CW8A 1PV4A 5IGFA 4NB3A 3CCJA 4NXNQ 1XWEA 3KALA 1STGA 4GNXC 1D5XC 5IT9W 5G3LF 2IA6A 4QUCA 2ALYB 5KFEA 3GIDA 2YU9A 2B3GA 3N43B 1VQEA 5JQWA 3VR2A 4PNYA 1SSOA 1KJIA 1SE4A 1SNPA 2V4RA 2KENA 2W6QA 5JUMA 1XMQL 4C56C 1ET9A 3K81C 5M5WH 4Q45A 4R8UA 4TRDA 1IKLA 3FP9A 4GNXB 1SFOB 1CI3M 4IWYA 3I73A 5IYZF 5KGUA 1XNRQ 3CW2C 1N32H 1Q8KA 1RK5A 2WKDA 3OTOH 3N41B 4EBEA 3TQ1A 2F0NA 3N8DA 3IAYA 1RK6A 4NDXA 1JJCB 5E4XA 2VUMH 4DV0Q 4TKOB 1T3NA 2FXQA 1KL9A 4RB3C 1QVCA 2HCIA 2R92G 4ZQIA 1MZBA 2N78A 5HV6A 1KC7A 2AHOB 3H3VC 5KFBA 2HVSA 2R93A 3Q1KA 3TZUA 1XPOA 4I4TF 4B3TH 5EWFA 5IP9H 2JA5A 1F2ZA 2AGPA 3P1HA 3X3MA 3GTQH 4X3UA 1VBHA 1CQJB 1UNNC 2L11A 5C5MA 2NVYB 2VA3A 3RTXA 2V59A 3OUZA 4AH6A 1PH8A 1I4HA 2EE1A 2YZMA 1U5KA 2MJ8A 5I6WA 2VQEH 3IKJA 4MV6A 5A2QW 3I7FA 4YHHL 1Y8NB 5LOVF 1K3BC 5HBRB 4P75A 4BXXG 3BG3A 3S1NB 3GQCA 2F0JA 4Y7NH 3EPGA 4ECYA 4KK7A 2OLSA 4NXNL 1DYQA 3MXPA 4IFDJ 1A62A 3I12A 5C44G 4OXPA 5C0XI 1A3TA 1QILA 4MTKA 1XYIA 4LF4H 4DR5Q 4DV6Q 2R8GA 3PO3H 3OOCA 1F2MA 2I87A 5LXTF 4ECUA 3RB3A 3M7NA 4YY3Q 2EJFC 2WP8J 1C7YA 2NVTB 1WTQA 2LXKA 3U9OA 2K04A 2K03A 2KVMA 5KIXA 4ED0A 3S2HB 3UFXB 1PZID 2C9OA 2RDIA 2CCZA 1XNRL 1WCMG 1B44D 1W96A 1E7ZA 1SYCA 3TP8A 1CUKA 3FPPA 4JW0A 1EY6A 1O75A 4E4TA 1N56A 2UXCQ 2FMMA 1I6VC 4DV0L 1SJED 1TY0A 1NE3A 2BH8A 2FE3A 1CHPD 5D1PA 4RB1A 4B3MH 4PZ7A 2F0TA 4JI6Q 1HCZA 1PA6A 1OTCA 4XXEA 1FJGH 3K7UC 4HYKA 3PMFA 1ZQ7A 1K83H 1EUDB 1WCMB 3KLWA 4UHVA 5GQOA 1H9SB 4DR6H 1LT4D 2YCHA 2H1EA 2UUAH 5D3DA 1HH2P 3U4ZA 1T5EA 3UE0A 1N33H 1RJTA 1TS2A 1LACA 2ZM6H 1KLUD 2MO0A 1VQPA 2NUCA 2Z6KA 3Q2OA 3PQIA 1NUCA 1EFWA 1DONA 1KEEA 2UVUA 3VMMA 3PGZA 5D3IB 1JE4A 3PUXA 4LWCA 2B2TA 4PG3A 5H80A 3SGIA 5BPHA 1ENAA 4QY7A 1I6HB 4HEDA 4Z9CB 4A3EG 4O2AF 4X64H 4DR5L 4IN3A 4A3MH 4DV6L 3STBD 2C2EA 3VDYA 3JAML 1H9KA 2B2VA 1Z9FA 2QA4A 1PTOH 3C2PA 1EUCB 4ID6A 1TWHA 3R5XA 4YY3L 1B50A 1U0LA 2ZJTA 1S5DD 5DAUA 2DY8A 5KFZA 1B33N 1M4VA 1LTRD 1J6QA 2E2HA 3MHBA 2E2JH 4MV8A 2NN6I 2A69C 3OUUA 1E4FT 1SJHD 4Q43A 3CCQA 3L7ZC 4LSAA 2CH4A 3MR5A 2EOTA 4A3EB 1YNJD 4RKBA 2N88A 2UXCL 4IFDI 1I94Q 5DQHA 5KFDA 5J2UF 1IBKH 1STEA 4CKEA 1PH3A 3P20A 1CZWA 2Q2TA 1MD2D 4JI6L 1VMPA 1CE8A 2V58A 4DAVA 4H44C 2HHHQ 3R8BA 1KRSA 2K5VA 3T13A 3ETHA 5KKNB 3K7AB 2LFNA 4JI4Q 2HT1A 2IL8A 5DQIA 3BA9A 5KFLA 3G4SA 5DLFA 2FKLA 1U4PA 4UP7A 3GTGH 2IT1A 4JVZA 1EHIA 1VDZA 1BXTA 3G6XA 1HZAA 3E5NA 4IUTA 4BBSB 3W3AA 1JJ2A 2W6MA 2UUBH 3TMEA 4K5VA 4RHSA 1HTPA 2A6HC 3GTKB 5CA1F 1KNEA 3HOZB 3I3CA 5FKAC 4PMCA 2DIKA 4IPHA 3BQ2A 1F9SA 2F0VA 3NPPA 1BNZA 4Q0YA 4LUVA 4J9NA 2WAQE 2HQEA 5F2DA 4HNVA 2KQ3A 3TP7A 5KFHA 3JAME 5KG7A 1I4GA 2AQ3B 1TWGH 2AUJD 5I6YA 4DV7Q 1K73C 2RSNA 3FVQA 4A3GB 4CBVA 5FLXW 1EIHA 3W2DA 3HEJA 1M0WA 2K52A 2J6SA 2YU9B 2HVQA 3NENA 1EQQA 4G7OC 3HBLA 1VQOA 4HQ6A 1A2UA 1KJ8A 2JEIA 3FKIG 3BVMA 3S1QB 3HOWB 3A5UA 2XVSA 2K05A 3KBXA 4ODGA 1I94L 3PR4A 3BA8A 1M8AA 5KG0A 4R8UB 3BDLA 3DWAA 1PH4A 3LGJA 2B29A 1B6SA 1L0YB 2BH2A 1EZ1A 3OIQA 3HRZC 2WYOA 1FR3A 3BAAA 4FBTA 2HHHL 3I4MH 1A15A 1SLJA 2YL2A 2ASLA 4H0LC 4DUYQ 1QJOA 3OSNA 2D2CC 2JEFA 4JI4L 4LJZC 4DK6C 1VQAA 2YS6A 5KT5A 2EJGC 4P72A 3VYSA 1JIHA 4JI7H 4A2BA 2E2DC 4A3BB 2HUGA 5L1JA 2R93B 3I4LA 3T56B 5HURA 3KOJA 2JA5B 4LFCH 1FYCA 1CQVA 2J0TD 2O03A 4HCEA 1F9PA 5BN5A 5KT2A 4DR4H 3T5LA 1Q1EA 4QCLA 2LY7A 1NTGA 1Z47A 1S3OA 5T1IA 2R7KA 1V43A 1A9XA 1IYJB 3S17H 4FF3A 3J81W 2ALZA 2GA4B 3I4NH 2NWGA 4G7HC 4C5CA 1LUZA 4DV7L 1TS4A 4QIWE 4APVA 1JORA 3UI2A 4ZLTF 1HUNA 1RTNA 3KXYT 4CJ0B 3NE5B 2CWAA 1BF4A 3GTJA 1EWIA 4L63B 3MWDA 5CV8A 1V9PA 5C4ZA 2QEXA 1Q7YC 3PIO3 3PW2A 2A1AA 3JSNA 1KBLA 4GKJQ 1DM0B 1EFID 4TQUS 2XGPA 4U7CA 2BQRA 1A3VA 4X66Q 1RJQA 1TWAH 3NEMA 3SK4A 2MO1A 4XYMB 4C3HB 5C4XB 2W9BA 5EDWA 5JOBA 1S97A 4RB0A 2IY5B 4DR1Q 1NY4A 4ECZA 4XYQA 2JYOA 2RGRA 1RHPA 3K5IA 3OW2A 2F4VQ 3QG1A 3ONAB 2SDFA 3TSSA 3D8GA 3H94A 1V1QA 3H40A 4RCNA 2EY6A 4Q8EA 4XIGS 2JA6H 4DUYL 2SNMA 1S5CD 4B08A 3NP8A 4PWQA 3AFQA 1HHVA 4R8IA 1P8LA 4YCUA 4P2CB 4J9LA 5KT3A 1HR0H 4ABNA 2K75A 1PRTB 3RD4A 2R7ZH 1UE7A 4YJ2F 2Z6KC 2QEJC 3PVXA 1BOSA 4RAUC 2J7ZA 4PQXA 1S9FA 4LUOA 5IGBA 1JDEA 1ZYRD 2B2TC 4HIMA 3NXWA 2XTIA 1RJPA 3VYUA 1JOQA 2AQ2B 3QR8A 5LMNQ 1IBMQ 3RIZA 3ERSX 5FO9B 1GSAA 1P16A 3G8CA 1UC9A 2B2VC 2FJ2A 3QO2A 4KKTA 5C0XH 1E0BA 1YIJA 4KTAA 2QKIC 2IJ0A 3RZDH 1X54A 5JVG3 4RUCA 4QF4A 4JI1H 2KUMA 2KCMA 1N9WA 4HIDA 1FGBD 1I4PA 4DK3C 5KEEA 4JBWA 3KJPA 1SNQA 2EJMA 4DR7H 1DOLA 1TXYA 4GKJL 3U9TA 4ZI7F 4MNOA 1YHQA 4X66L 3TREA 3A8KE 4NPSA 4M9UA 2R7FA 5I2XA 3GTPH 2HDMA 1TWHB 4Q0FA 3NWSA 1I4RA 1KJ9A 4DR1L 4OHJA 1M7JA 3DMUA 2F0FA 5E7NA 2F4VL 1YNXA 2F3IA 4J9RA 1KRTA 2E2HB 3BQ1A 4LF7Q 1DZ1A 5F9NA 3FDTA 2B2WA 3K59A 4K0KQ 1JJGA 1BBWA 3L4JA 4DK0A 4F7XA 3H0GG 1JE5A 2F3WA 5E1FA 2F0PA 3IRBA 2R8IA 3CPFA 4GN4B 4J9PA 1SNDA 4DV5H 4YR3A 3URYA 2W6OA 1JLLB 1YNND 2MNAA 2FFKB 1WTOA 1V1OA 1B8AA 4UCSA 2I5LX 4KJOA 1VCIA 4LF6H 1IBLQ 3HGBA 2RCNA 4ILWA 1CS0A 1U4RA 5LMNL 1IBML 2F0UA 1QVFA 1I50A 2A74C 4K6DA 2FMAA 5CV9A 3L3OC 3OIPA 4DNIA 4A2AA 3HOXG 2HVRA 2JN4A 4HNUA 2UUCH 1GUNA 3HKZA 4NMZA 1GJXA 1JT8A 4BY1G 4DL4A 1LT3D 1ZETA 4O4IF 1S03G 4MV7A 1QWYA 4FYDA 3GTMH 4EX5A 4IJHA 1R9TA 3K5OA 4I7ZC 1SCUB 3I70A 4PV1C 4ED8A 4J0MA 3G6EA 3DXJC 5KFVA 1JXLA 4J9OA 3HOUB 1CM9A 2NN6H 4DV3H 3T5KA 1E2VA 4BY1B 4A3KB 3H20A 2RKSA 1J5EQ 5KFNA 3OHBA 5KG1A 1M1KC 3OSOA 1S5ED 2KEDA 4LF7L 4IFDH 5KFUA 3G6VA 3CRKC 3AYHB 4K0KL 1JR0D 4RWSC 4L5RC 4YBZB 1HNWH 4ZUIA 1ULZA 2YZGA 5JEAH 1LTBD 1H9RA 4R4TA 3K5MA 2MCTA 1Y1WG 5KFRA 3PIPA 2VPSA 3GTLA 2M2LA 1D7QA 1YZ6A 2JEAI 4TV9F 4UDUC 2K33A 3K0YA 2JA7H 2KHJA 1AE2A 2H4OA 4DL3A 4QIWA 4IRKA 1HZ9A 3DEOA 2E2IH 5FJ8G 2QW7A 3PUVA 3RLNA 5IYDG 1JC7A 4DV2Q 4JYAQ 2GPSA 3PZPA 2A6ED 3RLFA 4NKLA 1MKHA 1IBLL 1TIID 2V1CC 2HDLA 4DV4Q 3S9WA 2A69D 3L9AX 3JAMi 1TWFA 4UCVA 3NBIA 1SXTA 2I0QA 2R92A 1STBA 5M3MH 1OXVA 1STAA 2YYAA 4DL7A 5J22A 5BR8H 5FOBB 4CDEC 4OWTB 4A3FH 4I50F 2AGOA 4NW2A 3UDGA 4AIMA 4YJ3F 2UXDQ 3J80i 1K8GA 1N36Q 1I50H 3ND9A 1IOVA 5KG3A 4ECSA 2QILA 4A75A 2R84A 1KDAA 2Y0SG 2F0KA 4RU9A 4LF8Q 4DFAA 3EROA 3RR5A 5EPKA 1XJVA 1I7LA 4FXKC 2N8NA 4O42A 1DCZA 4J1MA 1CQFA 3HB9A 1B04A 2OT2A 3GTJB 1GSHA 1J5EL 2WKCA 3RF2A 1S0MA 2WINB 1HNXQ 1VQGA 1Y8PB 4YWLA 3BVZA 4JV5Q 1QOHA 2Z4IA 1KXLA 4OGQC 5KNCA 3GQBA 5IIFA 1WYDA 2Y0SB 3PIP3 3K6OA 5I2YA 1SFOH 1NAPA 2B63G 4G4KA 3HFZB 2VW9A 4RA8A 1BCPF 4ED7A 4BWGB 5C8YF 4Q44A 5EWGA 1WCMA 3NK9A 1H9SA 4B9WA 4DNTB 4DV2L 4JYAL 2I07B 5GAHC 4KHPQ 4QMGA 2EXZA 5GONF 1KTKA 3CC7A 1B2TA 2VQFQ 1UUPA 4A3JG 1EYCA 4ETSA 3BDOA 1LM0A 2D0OA 4O4LF 1SNOA 1HQRD 3MVVA 3ULJA 1VQ6A 2KHIA 5KFQA 1Z2OX 4ED1A 5FLMG 2NVYH 4HJ5A 2PVPA 5IYCH 2NVQB 1PH5A 2I46A 4YIJA 3GILA 4BBRG 1Q3LA 5C1OA 3PF5A 2OTJA 3KLSA 1WH2A 2UXDL 2RGVA 1G8ZD 1N36L 1DGSA 3H3VH 1JQYD 3CC4A 5DG7A 4A3JB 3S1NH 2B39A 4JI3Q 4OX9H 4ZYSA 4MV1A 4LF8L 3HOVB 1A63A 1VKZA 2XRSD 3WDNA 4DPGA 1PRTF 3RB0A 3L0OA 4GLVB 4PDBA 1UC8A 1K28A 3BZCA 1YJ9A 4JV1A 1TKWB 1PTOD 4XT3B 4Q8FA 2B2WC 4BBRB 1HNXL 3OWEB 3CXCA 2VL6A 1XMQQ 2DLNA 3WO0A 2K7VA 3BU2A 1HUMA 3S2HH 2CQOA 5I4DA 1F77A 4CKCA 3Q0AA 1RL2A 2R6FA 2UXBQ 1UEAB 2CQYA 3RN5A 5M3FB 3M7GA 3KHRA 3J7AF 4IOCA 3D6WA 4GOPA 4DUZQ 4KHPL 4I7HA 1K9MC 2YTXA 4BY7B 5DEHA 5LYJF 2VQFL 2PQAA 3D4WA 1X3FA 1GKHA 3DM3A 1I7NA 4IPDA 2KJXA 4X62H 2KCTA 3M4QA 3A5ZB 2EYFA 4XT1B 4EGQA 1I3QA 2FLLA 4EQ5A 4DV7H 1WCMH 1W6JA 2CWPA 3S14B 1KJQA 5JPMC 4UY8C 1EEID 1GO3E 1CZGA 2DNCA 4YHHQ 1IW7C 1M6VA 4FF2A 5IY0A 3QFFA 2IMWP 4A3IB 4GN5A 2WIIB 3A0JA 5EKKA 4C3IG 3RFCA 2H5XA 4JI3L 5CMDA 1C9OA 3V05A 3B6YA 3HKZB 2OF1A 4FF1A 3J7YW 4JUZA 4G3IA 1BBUA 4YQWA 3HOYB 1O78A 2I80A 1I6HH 4JI0Q 2BA0A 1N34H 4A93B 4DN4M 1EYAA 4NXMH 3F2UA 1R9TB 2RBMA 5DGAA 5DM63 2ID0A 2ASDA 3CP0A 3LWBA 5KFMA 4OONA 3V6HA 1EWCA 4LW1A 2GN5A 1CTMA 4MV9A 1PX2A 1JMCA 4HJAA 3Q22A 1V4YA 5KFFA 5LMUQ 4FDBA 1DIKA 2WB1G 5FK9C 2XWBB 2UXBL 1ML0D 3T1YH 1SYFA 5IOCA 4Y52H 1PFNA 3TEHB 1AZPA 4AQYH 4J8QA 5EBCA 2PN1A 5D65A 2CKZB 4DUZL 1KD1C 5GAEC 3FKIA 2IX1A 3PUWA 1FNWA 2K5NA 1G2SA 4IURA 4POGA 3R93A 4A3DG 3SE7A 3MXUA 1Q8IA 3AQQA 3GTLB 1BJTA 4F87A 1PYBA 4WRDA 1YI2A 1CKMA 1V8QA 2F0SA 4XDXA 4CC5A 3T51B 3A7AB 2Q2UA 4A3CH 1X32A 4QIWB 1TS3A 1DOKA 2W9CB 2C5CA 3K7AH 2A19A 1QNUA 3OSPA 1RD9D 3PO2H 3UDXA 3VR3A 1GLVA 1MJEA 3CCEA 2G9HD 4OO1G 1F2YA 3K0XA 3QIAA 1D1KA 2MPMA 4IZ8A 1LO5D 1YJNA 3KK7A 1WTWA 1G91A 4YR0A 1TWFB 4A3DB 3NTKA 2DZDA 1SYGA 2WV6D 1Y69U 1NCVA 2AMCB 2X6LA 5IGDA 2F03A 2R92B 1SYXB 4BBSH 2IWHA 1GVPA 3SI8A 4JI5L 5KT7A 3GTKH 5IYBH 3P7JA 2P5ZX 3HOZH 1C48A 1XX8A 3GDEA 4MTDA 5JEAJ 2E74C 4JI0L 1A2TA 2BOSA 2XNAC 2X6GA 1EOTA 3S1RB 1LTSD 2ZDHA 1PH9A 3Q8RB 3RV3A 1B9MA 3QB3A 1Y1VG 1NNXA 4DL5A 1EOVA 5HGQA 4A3GH 1GUSA 2E5LQ 5CB4F 1VMCA 4N9PA 4RGNA 5LMUL 1ENFA 2YU9H 5C44B 3I91A 4LFBH 4EFBA 3TS2A 2GLTA 3I4OA 2EIFA 4CDDC 2JA8G 1SMYC 1X3PA 3MA2B 4DR3Q 1KC8C 3HOWH 3S1QH 3DHQA 2F1MA 2R8HA 3EN2A 2YTVA 3RNUA 1Y1VB 4MV4A 4R4QA 4R9WA 3HZXA 5K36H 4EBDA 1C8CA 2O5JC 4XYOA 4DXFA 4RAYA 2JSOA 3WOFA 4O1NA 1SBBB 5IGCA 2W9AA 4UAIA 1HNZH 2Y0SE 1GYFA 2JA8B 2QDLA 2A68C 4A3BH 2JXMB 1LTLA 2R93H 3BG5A 2HD3A 1VQHA 4L6TB 1F2LA 3CKIB 2JA5H 2B2UC 1MGSA 2JP1A 1QZGA 1AEXA 2I8CA 1S10A 3A8JE 3KFUA 3S15B 5CV6A 3ULLA 4G7ZC 3KLSX 2NVXA 3VA7A 4CKBA 1JWMD 3E3XA 1U9RA 3ETJA 4LF7H 4N8X1 4YP3A 5L37A 1RCVD 2AQ1B 5BPFA 5EPJA 3V4SA 2E5LL 5EAYA 4UPAA 2EY2A 1BQQT 1K3RA 3RB4A 1RYSA 3H91A 1YITA 5F9LA 4JI8Q 4HTHA 3J80L 1YHBA 2JEBI 4LF9H 1PFSA 4C3HH 5C4XH 4DR3L 4GOPC 2VUMG 2RQXA 1EEFD 3KHHA 4DV1H 2EVBA 3VR5A 2ATWA 2K5DA 1STNA 5IT9L 1PHJA 3ZJYC 1IL2A 2N55A 2MP1A 3VA5A 5IP9G 4WJ4A 4RNMA 2Q2HA 1XTDA 3NELA 5KFCA 2DNEA 1J8IA 3Q23A 5LL6b 4GOPB 3H0GA 3BVGA 3GIQA 2G5DA 4YCWA 2PQAB 3EBEA 1B4OA 2BE5C 2RDGA 1ZEQX 1HFNA 1GHJA 5KG4A 1I3QB 2OQ0A 1ICWA 2ENBA 3GV8B 4IJLA 1NMGA 5C3XA 1SR3A 1OO9B 3UDIA 5I9OA 5M5XB 2AQ4A 2MGSA 1S0NA 1E4EB 4YCVA 1TVXA 5IP7H 4J15A 3PO3G 1X56A 3L4KA 5CR3A 4R4IA 3KTMA 3GIJA 5GROA 3NTHA 2PZTA 4WJ3M 1QB5D 1T9HA 2UU9Q 5C3EG 3H15A 1W3SA 1SMXA 4IUNA 2FP4B 5DG9A 1LABA 1D2BA 4YWMA 2TMPA 5A2QL 4X6AH 3S24A 1LT6D 3JAMc 3J80E 4JI8L 4HNTA 1PYSB 4M1UB 4DV2H 4IRCA 3HKZE 2K14A 3HP3A 1TWHH 3T53B 1X9NA 1A6XA 4DL6A 4B3RH 3RGZA 1CHQD 4DV4H 1CT1D 4JI2H 3K58A 2FLPA 2E2HH 1II3A 2PNHA 4QWCA 2CW0C 4RUAA 3EPIA 1Q90A 1YVCA 5C3EB 2XCPA 2MHVA 1Q81C 1JDBB 4FM9A 1EQTA 2YRXA 2EY5A 3FKIB 2YV5A 1G6PA 1MIUA 4EQPA 3C3LA 1Y1WA 2AKWB 1XNQH 1EU4A 3H4BA 1Q1BA 1BCPC 1GGOA 2F3VA 1E22A 4KN7C 1KAAA 2LSSA 2NTSA 4QL5A 3SEBA 4UCRA 3J7ZC 4LF5H 2A5HA 3TS0A 3DLLA 5DGBA 3RZOB 1JCKB 3HKSA 4A3MG 2L55A 1RJRA 1BCPB 1S5BD 4DR2H 4JV5H 2WB1E 3D3RA 2JA9A 5EQ0A 3H3VI 4ZK9B 1WR2A 2M05A 1N32Q 1AW7A 3OTOQ 2CQAA 1S40A 1D1IA 1LTID 4KHZA 4JK1C 1VQKA 5FO8B 2UU9L 3BJUA 5A2QE 1CKOA 1YEZA 2YRWA 1XXGA 4FBUA 3MC0B 3MWEA 4B3TQ 1SDFA 3ZYYX 1W93A 3HOUH 4IALA
chains in the Genus database with same CATH topology
2VNUD 1D7QA 1YZ6A 2JEAI 3GTOH 3HKZG 5ELNA 1N8RC 4PZ8A 4A3KH 4LFAL 2JA7H 5JJKA 2KHJA 4IOAA 1AE2A 4L5TA 2ZJPA 3CF5A 2R6GA 1E1TA 1IXRA 1HZ9A 2E2IH 4XTCS 5FJ8G 2OQKA 3PUVA 3RLNA 1VQMA 2BA1A 5IYDG 4DV2Q 3HOYG 1VQFA 2VQEQ 3S1MH 3RLFA 3F2DA 4JYAQ 1ASYA 1MKHA 1IBLL 4A93G 2V1CC 4JCVE 1Q46A 4DV4Q 4B3SL 4GLAC 4GKKL 3JAMi 4DKAC 1L0WA 1VQ8A 2JJQA 2I0QA 3M3YH 5M3MH 4POFA 1OXVA 5BR8L 1PV4A 4L5SA 3CCJA 4NB3A 3CAMA 4NXNQ 1XPUA 3U50C 3ICEA 4GNXC 2ZJQA 4OWTB 3W1BA 2ALYB 4A3FH 1JB7A 1CKNA 4LF4Q 4A3CG 1X3GA 4PZ6A 1KHIA 3UDGA 4AIMA 2B3GA 1VQEA 3PO2G 2UXDQ 3J80i 1XPRA 1K8GA 2CFMA 1I50H 1N36Q 4OX9Q 2DUDA 1D8LA 4IO9A 4A75A 1HJPA 2KENA 1EIYB 1XMQL 2Y0SG 1G291 3K81C 5M5WH 1ASZA 4LF8Q 4GLXA 3TRZA 3RR5A 1XJVA 2N8NA 3FP9A 4GNXB 4BBSG 3JC66 3UE1A 3OTOL 2Z0SA 1N32L 5FJ8H 3CMAA 5IYBG 1J5EL 3CW2C 3K8AA 1Q8KA 4R4CA 1NMFA 1UEBA 1XNRQ 3HOZG 3GD7A 1HNXQ 3PV0A 1EYGA 2KBNA 4UP9A 1VQGA 5IWAQ 3KDFA 1JJCB 4YWLA 2VUMH 4B3MQ 3CCLA 4JV5Q 4DV0Q 1KXLA 4AYBG 2FXQA 1AH9A 2K4KA 1KL9A 1SROA 2MQHA 1UWVA 1EUJA 1QVCA 4B3TL 1WYDA 2OWOA 2R92G 2N78A 2AHOB 1SFOH 2B63G 1XPOA 4C3JH 5IP9H 3HFZB 4JBMA 3GTJH 2VW9A 4A3GG 2NVXH 3GTQH 3F2BA 4GS3A 4DR6Q 4IPGA 1XMOQ 2UUAQ 3CPWA 4AH6A 1PH8A 3W1GA 1KQSA 4DV2L 3I4MG 1HZBA 3PSIA 4JYAL 2VQEL 5GAHC 1QVGA 4KHPQ 2A8VA 4MZ9A 1N33Q 1U5KA 3CMEA 3GO5A 3CC7A 2ZM6Q 2VQFQ 3HOWG 4X62Q 4A3JG 3I7FA 4YHHL 1LM0A 2D0OA 1OXSC 4P75A 4X65Q 2JE6I 4BXXG 3ULJA 1VQ6A 2OTLA 2KHIA 4Y7NH 1G51A 5K36G 4NXNL 5FLMG 2NVYH 3PUYA 2HIXA 3J80c 4IFDJ 1I5FA 4HJ5A 1A62A 5IYCH 1PH5A 4X64Q 5C44G 4OXPA 5C0XI 4LF4L 3PIOA 4BBRG 3PF5A 2OTJA 1W2BA 4DR5Q 1AE3A 2UXDL 1SRUA 3WWVA 5IT9c 3I55A 4DV6Q 1N36L 3PO3H 4OX9L 1DGSA 3H3VH 3CD6A 1E3PA 1L1OA 3CC4A 3S1NH 2N49A 4JI3Q 4A3BG 5LMNW 4LF8L 4YY3Q 2WP8J 1X65A 2IX0A 1C7YA 3M7NA 4QQBX 2R93G 1A63A 2LXKA 2JA5G 3I2ZA 4DPGA 2JA8G 2NVQH 3L0OA 4GLVB 1N34Q 1VQNA 2IHFA 2CCZA 1YJ9A 3BZCA 4NXMQ 1WCMG 1XNRL 3J7A5 3H0GH 1E7ZA 1HNXL 1CUKA 3CXCA 2VL6A 5IWAL 2UXCQ 2ASBA 2XGTA 1IBKQ 4B3ML 1XMQQ 4DV0L 4RG1A 3U4VA 1NE3A 3HOVH 2BH8A 1FJGL 4PZ7A 3BU2A 5DLQE 4JI6Q 2NZHA 1PA6A 1OTCA 3S2HH 3T1YQ 2CQOA 1RL2A 4AQYQ 2UXBQ 3K7UC 3RN5A 4DR6L 1K83H 1LYLA 1XMOL 1PVOA 2UUAL 3E0EA 3KLWA 3PCOB 4O0AA 5GQOA 4HJ9A 3RLOA 4IOCA 4GOPA 4KHPL 4DUZQ 2QGQA 1GM5A 1K9MC 1N33L 2YTXA 2JA6G 1HH2P 2I5HA 3U4ZA 2ZM6L 2VQFL 2PQAA 4X62L 3UE0A 1X3FA 3HOXH 4OO1I 5C4XG 2RF4A 1GKHA 3DM3A 2UUBQ 1K0RA 4IPDA 2MO0A 4IPCA 2AWOA 4R1JA 2Z6KA 4X65L 2KCTA 3AFPA 1VQPA 1EFWA 4BY1H 3M4QA 3A5ZB 2R7ZG 1UE6A 3PGZA 4MTNA 2VZAA 1VQIA 2YYZA 4EQ5A 3PUXA 5M3FH 1PH2A 1WCMH 2CWPA 4LWCA 4PG3A 4X64L 3SGIA 1PH6A 3UDFA 4QY7A 4UY8C 3CC2A 4BY7H 1GO3E 4A3EG 2Q2IA 2HIVA 4DR5L 4A3MH 4YHHQ 4DV6L 3STBD 5H1SE 3A74A 5IY0A 4JOIA 3VDYA 4GN5A 3A0JA 2QA4A 1Z9FA 2H5XA 4JI3L 1HR0W 1B70B 1C9OA 1QZHA 4GN3B 3B6YA 4YY3L 3S1QH 1U0LA 3CCUA 4R4OA 5C0XG 1RIPA 3S14H 1C0AA 1J6QA 1BBUA 1N34L 2E2JH 3CCRA 2NN6I 2E8GA 2K5HA 3F2CA 1X55A 4JI0Q 4NXML 2BA0A 3CCQA 3L7ZC 1I6HH 4A3IH 1Y1WH 2ID0A 2UXCL 1IBKL 4IFDI 3CP0A 1I94Q 4OONA 5IP7G 4RMFA 4LW1A 1NBWA 2GN5A 3KF6A 1PH3A 1VQ9A 3MEFA 2Q2TA 4JI6L 3M85A 1JMCA 4HJAA 4YWKA 3W5OA 4L5QA 3T1YL 4LFBQ 4UP8A 1CSQA 3E9IA 2WB1G 4FDBA 5LMUQ 4AQYL 2HHHQ 1KRSA 4JBKA 2K5VA 4A4IA 3HOYH 2UXBL 5IYDH 4A93H 4Y52H 3TEHB 4JI7Q 5GAGC 1R9TH 4JI4Q 2HT1A 1GD7A 4DUZL 2CKZB 3G71A 1KD1C 5GAEC 2IX1A 3PUWA 3G4SA 2K5NA 4POGA 4A3DG 1FJGQ 4LFCQ 4UP7A 5HY6A 3D31A 3GTGH 3AQQA 1UE5A 2IT1A 4TVAB 1A8VA 3T1HQ 2UUBL 2D62A 1HZAA 1PYBA 1YI2A 4HJ7A 1CKMA 3S16H 1JJ2A 1UE1A 3OYYA 2Q2UA 4DR4Q 5ELOA 4A3CH 1HNZQ 1H95A 3K7AH 2A19A 2K50A 3PO2H 3UDXA 1MJEA 3CCEA 3M9BA 4OO1G 4IPHA 3K0XA 3KJOA 1YJNA 4LUVA 2WAQE 4LUZA 3GTLH 2AMCB 1TWGH 4DV7Q 1K73C 2C35B 4BBSH 2I5MX 1GVPA 4JI5L 1SE8A 3GTKH 5IYBH 2GVBA 3HOZH 3GDEA 1CKNB 4HJ8A 4PMWA 2K52A 3ULPA 5JEAJ 4JI0L 3NENA 1EQQA 2OCEA 1VQOA 1PH9A 1SN8A 3FKIG 1TWFH 1PH7A 3A5UA 2R92H 1QUQA 1Y1VG 1I94L 2B63H 1EOVA 5HGQA 3I4NG 4A3GH 1PH4A 2NN6G 3LGJA 2B29A 3CQZH 2E5LQ 2BH2A 4LFBL 5LMUL 2HHHL 1VQLA 2YU9H 3F8TA 3I4MH 1SLJA 5C4JH 4LF9Q 2RHSB 4DUYQ 3TS2A 4IFDG 3KDFB 3I4OA 2EIFA 2L15A 1WI5A 4DV1Q 1TWCH 4DK6C 1VQAA 4DR3Q 1KC8C 4JI4L 4A3JH 3HOWH 4P72A 1VQCA 4BA1I 4HIKA 2NVTH 3EN2A 4BXXH 2YTVA 3RNUA 4OWWB 4LFCL 4R4QA 3HOUG 3U58A 3T1HL 3KOJA 5FLMH 1E1OA 4B3TQ 4A3KG 2JA7G 2GVAA 5C44H 4DR4L 1HNZL 4BBRH 2MFIA 4A3LG 1Q1EA 5J3BA 1NTGA 1Z47A 1S3OA 2Y0SE 1V43A 2PMZE 4ME3A 3KYHC 1IYJB 3S17H 1FGUA 4A3BH 3NBHB 1Y1VH 1LTLA 2R93H 4JC0A 1L1OC 3I4NH 1VQHA 2JA5H 1LUZA 4DV7L 4QIWE 1QZGA 5M3MG 4APVA 4JI1Q 1Q82C 3KFUA 4GNXA 2NZOA 5AJ3Q 2DGYA 3AEVA 3ULLA 4QGUA 2CWAA 1EWIA 1YBYA 4DR7Q 1VQBA 1V9PA 4A3FG 2QEXA 1Q7YC 4AYBE 2A1AA 2JA8H 4GKJQ 2ZTCA 4TQUS 5FLXc 5JJLA 4X66Q 3M4OH 1TWAH 3NEMA 2MO1A 1L1OB 1YHAA 2WFWA 2JQOA 2IY5B 3S15H 4DR1Q 1NY4A 4JI5Q 3OW2A 2F4VQ 3K80C 2E5LL 5EAYA 2R7DA 3CCVA 4UPAA 1V1QA 1K3RA 2LXJA 1BVSA 3STBC 1YITA 4LF9L 4XIGS 2JA6H 4DUYL 4JI8Q 1YHBA 4DV5Q 2JEBI 4DV1L 1PFSA 4C3HH 1HR0L 5C4XH 4DR3L 4GOPC 2VUMG 4B3RQ 3AFQA 1P8LA 3PUZA 4YCUA 2AWNA 4JI2Q 2ATWA 2K75A 1PHJA 3ZJYC 3G48A 2R7ZH 1IL2A 1UE7A 2HQLA 1OXTA 2Z6KC 5JJIA 1EIFA 4WJ4A 5IP9G 4LF6Q 3S2DH 2Q2HA 1S72A 4KI0A 1XTDA 3F1ZA 1VQ7A 3NELA 4LUOA 1X3EA 4HIMA 1HZCA 2XTIA 4A3EH 1CSPA 2ZJRA 5LMNQ 4GOPB 1IBMQ 4JG2A 1XNQQ 3E9HA 2UUCQ 4YCWA 4C3IH 2PQAB 3EBEA 3ERSX 3RN2A 4JI7L 4JOIC 1P16A 4QJFA 3CCSA 1YIJA 1FL0A 1L2FA 4DAYB 3J81c 3Q8DA 4JI1L 2OQ0A 1A0IA 4KLKA 5AJ3L 1X54A 3RZDH 2VS1A 4LF5Q 1VQ4A 2KCMA 3MXNB 4IJLA 1N9WA 4DR7L 1NMGA 5IYCG 4HIDA 4DK3C 3KJPA 4JBWA 1SR3A 2RHQB 4HIOA 1TXYA 3UDIA 3PF4A 4GKJL 4MNOA 4DR2Q 4YCVA 3TREA 4X66L 5IP7H 1YHQA 4J15A 4NPSA 3PO3G 1VS0A 1X56A 2R7FA 3GTPH 4DV3Q 4R4IA 4C2MH 1VQJA 3D0FA 4A76A 1I3QH 4DR1L 5GROA 1VQ5A 5IE8A 4ALPA 1Q12A 1VQDA 4WJ3M 5M5YH 1FVIA 5E7NA 2F4VL 1YNXA 2F3IA 1T9HA 2ES2A 2UU9Q 1KRTA 4BA2I 1HNWQ 4LF7Q 5C3EG 3H15A 1W3SA 1SMXA 1IZ6A 1MJCA 4K0KQ 4YWMA 5M5XH 3CCMA 4X6AH 1BBWA 2PI2E 3S24A 3JAMc 1JJGA 3H0GG 4JI8L 1JE5A 4DV5L 1PYSB 2IHEA 3IRBA 1BKBA 4A3DH 4B3RL 3HKZE 3CPFA 1M90C 2EQSA 4GN4B 4DV4L 2K14A 1TWHH 1X9NA 4JI2L 1KAWA 3KF6B 3ER0A 1K8AC 1KIXA 3HOVG 4LFAQ 2JK8A 4LNQA 4OWXB 2MNAA 2E2HH 2PNHA 3KF8B 1B8AA 4LF6L 2I5LX 3J81j 1YVCA 4JBJA 1VCIA 3S1RH 1Q81C 1IBLQ 1Y14B 2RCNA 1OXXK 3M4PA 1HR0Q 4P73A 1B7YB 4B3SQ 5LMNL 1IBML 1QVFA 2YV5A 1XNQL 4GKKQ 5JEAG 1E24A 1MIUA 2UUCL 1G6PA 3FHWA 3I56A 2PI2A 4DNIA 2AKWB 2ZTDA 3HOXG 5BR8Q 1PH1A 1Q1BA 2EXDA 1Q86C 1E22A 3L2PA 1JT8A 4BY1G 2LSSA 1NJIC 1OXUA 2VY3A 4P71A 4DAMA 4QL5A 5C3EH 5M3FG 2ZTEA 4LF5L 2F52A 3J7ZC 3GTMH 4EX5A 3FKIH 4IJHA 4BY7G 1O7IA 1WJJA 4O2DA 5GADC 3TS0A 3DLLA 3HKSA 4DR2L 4A3MG 4JV5L 2D0PA 3G6EA 3TQYA 3PIPA 2WAQG 4DV3L 2WB1E 4H02A 2JA9A 3H3VI 1EQRA 2N3SA 3OTOQ 1N32Q 1X6OA 2YTYA 4P74A 1J5EQ 1S40A 4A3LH 1HNWL 3J81i 4KHZA 1VQKA 1WFQA 1M1KC 2UU9L 4LF7L 3BJUA 3EIVA 1WOCA 1CKOA 1YEZA 3AYHB 4L5RC 4K0KL 1YJWA 3RZOH 4R4TA 4A3IG 3BZKA 1Y1WG 1QUQB 5C0XJ 3HOUH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VNU D;  1D7Q A;  1YZ6 A;  2JEA I;  3GTO H;  3HKZ G;  5ELN A;  1N8R C;  4PZ8 A;  4A3K H;  4LFA L;  2JA7 H;  5JJK A;  2KHJ A;  4IOA A;  1AE2 A;  4L5T A;  2ZJP A;  3CF5 A;  2R6G A;  1E1T A;  1IXR A;  1HZ9 A;  2E2I H;  4XTC S;  5FJ8 G;  2OQK A;  3PUV A;  3RLN A;  1VQM A;  2BA1 A;  5IYD G;  4DV2 Q;  3HOY G;  1VQF A;  2VQE Q;  3S1M H;  3RLF A;  3F2D A;  4JYA Q;  1ASY A;  1MKH A;  1IBL L;  4A93 G;  2V1C C;  4JCV E;  1Q46 A;  4DV4 Q;  4B3S L;  4GLA C;  4GKK L;  3JAM i;  4DKA C;  1L0W A;  1VQ8 A;  2JJQ A;  2I0Q A;  3M3Y H;  5M3M H;  4POF A;  1OXV A;  5BR8 L;  1PV4 A;  4L5S A;  3CCJ A;  4NB3 A;  3CAM A;  4NXN Q;  1XPU A;  3U50 C;  3ICE A;  4GNX C;  2ZJQ A;  4OWT B;  3W1B A;  2ALY B;  4A3F H;  1JB7 A;  1CKN A;  4LF4 Q;  4A3C G;  1X3G A;  4PZ6 A;  1KHI A;  3UDG A;  4AIM A;  2B3G A;  1VQE A;  3PO2 G;  2UXD Q;  3J80 i;  1XPR A;  1K8G A;  2CFM A;  1I50 H;  1N36 Q;  4OX9 Q;  2DUD A;  1D8L A;  4IO9 A;  4A75 A;  1HJP A;  2KEN A;  1EIY B;  1XMQ L;  2Y0S G;  1G29 1;  3K81 C;  5M5W H;  1ASZ A;  4LF8 Q;  4GLX A;  3TRZ A;  3RR5 A;  1XJV A;  2N8N A;  3FP9 A;  4GNX B;  4BBS G;  3JC6 6;  3UE1 A;  3OTO L;  2Z0S A;  1N32 L;  5FJ8 H;  3CMA A;  5IYB G;  1J5E L;  3CW2 C;  3K8A A;  1Q8K A;  4R4C A;  1NMF A;  1UEB A;  1XNR Q;  3HOZ G;  3GD7 A;  1HNX Q;  3PV0 A;  1EYG A;  2KBN A;  4UP9 A;  1VQG A;  5IWA Q;  3KDF A;  1JJC B;  4YWL A;  2VUM H;  4B3M Q;  3CCL A;  4JV5 Q;  4DV0 Q;  1KXL A;  4AYB G;  2FXQ A;  1AH9 A;  2K4K A;  1KL9 A;  1SRO A;  2MQH A;  1UWV A;  1EUJ A;  1QVC A;  4B3T L;  1WYD A;  2OWO A;  2R92 G;  2N78 A;  2AHO B;  1SFO H;  2B63 G;  1XPO A;  4C3J H;  5IP9 H;  3HFZ B;  4JBM A;  3GTJ H;  2VW9 A;  4A3G G;  2NVX H;  3GTQ H;  3F2B A;  4GS3 A;  4DR6 Q;  4IPG A;  1XMO Q;  2UUA Q;  3CPW A;  4AH6 A;  1PH8 A;  3W1G A;  1KQS A;  4DV2 L;  3I4M G;  1HZB A;  3PSI A;  4JYA L;  2VQE L;  5GAH C;  1QVG A;  4KHP Q;  2A8V A;  4MZ9 A;  1N33 Q;  1U5K A;  3CME A;  3GO5 A;  3CC7 A;  2ZM6 Q;  2VQF Q;  3HOW G;  4X62 Q;  4A3J G;  3I7F A;  4YHH L;  1LM0 A;  2D0O A;  1OXS C;  4P75 A;  4X65 Q;  2JE6 I;  4BXX G;  3ULJ A;  1VQ6 A;  2OTL A;  2KHI A;  4Y7N H;  1G51 A;  5K36 G;  4NXN L;  5FLM G;  2NVY H;  3PUY A;  2HIX A;  3J80 c;  4IFD J;  1I5F A;  4HJ5 A;  1A62 A;  5IYC H;  1PH5 A;  4X64 Q;  5C44 G;  4OXP A;  5C0X I;  4LF4 L;  3PIO A;  4BBR G;  3PF5 A;  2OTJ A;  1W2B A;  4DR5 Q;  1AE3 A;  2UXD L;  1SRU A;  3WWV A;  5IT9 c;  3I55 A;  4DV6 Q;  1N36 L;  3PO3 H;  4OX9 L;  1DGS A;  3H3V H;  3CD6 A;  1E3P A;  1L1O A;  3CC4 A;  3S1N H;  2N49 A;  4JI3 Q;  4A3B G;  5LMN W;  4LF8 L;  4YY3 Q;  2WP8 J;  1X65 A;  2IX0 A;  1C7Y A;  3M7N A;  4QQB X;  2R93 G;  1A63 A;  2LXK A;  2JA5 G;  3I2Z A;  4DPG A;  2JA8 G;  2NVQ H;  3L0O A;  4GLV B;  1N34 Q;  1VQN A;  2IHF A;  2CCZ A;  1YJ9 A;  3BZC A;  4NXM Q;  1WCM G;  1XNR L;  3J7A 5;  3H0G H;  1E7Z A;  1HNX L;  1CUK A;  3CXC A;  2VL6 A;  5IWA L;  2UXC Q;  2ASB A;  2XGT A;  1IBK Q;  4B3M L;  1XMQ Q;  4DV0 L;  4RG1 A;  3U4V A;  1NE3 A;  3HOV H;  2BH8 A;  1FJG L;  4PZ7 A;  3BU2 A;  5DLQ E;  4JI6 Q;  2NZH A;  1PA6 A;  1OTC A;  3S2H H;  3T1Y Q;  2CQO A;  1RL2 A;  4AQY Q;  2UXB Q;  3K7U C;  3RN5 A;  4DR6 L;  1K83 H;  1LYL A;  1XMO L;  1PVO A;  2UUA L;  3E0E A;  3KLW A;  3PCO B;  4O0A A;  5GQO A;  4HJ9 A;  3RLO A;  4IOC A;  4GOP A;  4KHP L;  4DUZ Q;  2QGQ A;  1GM5 A;  1K9M C;  1N33 L;  2YTX A;  2JA6 G;  1HH2 P;  2I5H A;  3U4Z A;  2ZM6 L;  2VQF L;  2PQA A;  4X62 L;  3UE0 A;  1X3F A;  3HOX H;  4OO1 I;  5C4X G;  2RF4 A;  1GKH A;  3DM3 A;  2UUB Q;  1K0R A;  4IPD A;  2MO0 A;  4IPC A;  2AWO A;  4R1J A;  2Z6K A;  4X65 L;  2KCT A;  3AFP A;  1VQP A;  1EFW A;  4BY1 H;  3M4Q A;  3A5Z B;  2R7Z G;  1UE6 A;  3PGZ A;  4MTN A;  2VZA A;  1VQI A;  2YYZ A;  4EQ5 A;  3PUX A;  5M3F H;  1PH2 A;  1WCM H;  2CWP A;  4LWC A;  4PG3 A;  4X64 L;  3SGI A;  1PH6 A;  3UDF A;  4QY7 A;  4UY8 C;  3CC2 A;  4BY7 H;  1GO3 E;  4A3E G;  2Q2I A;  2HIV A;  4DR5 L;  4A3M H;  4YHH Q;  4DV6 L;  3STB D;  5H1S E;  3A74 A;  5IY0 A;  4JOI A;  3VDY A;  4GN5 A;  3A0J A;  2QA4 A;  1Z9F A;  2H5X A;  4JI3 L;  1HR0 W;  1B70 B;  1C9O A;  1QZH A;  4GN3 B;  3B6Y A;  4YY3 L;  3S1Q H;  1U0L A;  3CCU A;  4R4O A;  5C0X G;  1RIP A;  3S14 H;  1C0A A;  1J6Q A;  1BBU A;  1N34 L;  2E2J H;  3CCR A;  2NN6 I;  2E8G A;  2K5H A;  3F2C A;  1X55 A;  4JI0 Q;  4NXM L;  2BA0 A;  3CCQ A;  3L7Z C;  1I6H H;  4A3I H;  1Y1W H;  2ID0 A;  2UXC L;  1IBK L;  4IFD I;  3CP0 A;  1I94 Q;  4OON A;  5IP7 G;  4RMF A;  4LW1 A;  1NBW A;  2GN5 A;  3KF6 A;  1PH3 A;  1VQ9 A;  3MEF A;  2Q2T A;  4JI6 L;  3M85 A;  1JMC A;  4HJA A;  4YWK A;  3W5O A;  4L5Q A;  3T1Y L;  4LFB Q;  4UP8 A;  1CSQ A;  3E9I A;  2WB1 G;  4FDB A;  5LMU Q;  4AQY L;  2HHH Q;  1KRS A;  4JBK A;  2K5V A;  4A4I A;  3HOY H;  2UXB L;  5IYD H;  4A93 H;  4Y52 H;  3TEH B;  4JI7 Q;  5GAG C;  1R9T H;  4JI4 Q;  2HT1 A;  1GD7 A;  4DUZ L;  2CKZ B;  3G71 A;  1KD1 C;  5GAE C;  2IX1 A;  3PUW A;  3G4S A;  2K5N A;  4POG A;  4A3D G;  1FJG Q;  4LFC Q;  4UP7 A;  5HY6 A;  3D31 A;  3GTG H;  3AQQ A;  1UE5 A;  2IT1 A;  4TVA B;  1A8V A;  3T1H Q;  2UUB L;  2D62 A;  1HZA A;  1PYB A;  1YI2 A;  4HJ7 A;  1CKM A;  3S16 H;  1JJ2 A;  1UE1 A;  3OYY A;  2Q2U A;  4DR4 Q;  5ELO A;  4A3C H;  1HNZ Q;  1H95 A;  3K7A H;  2A19 A;  2K50 A;  3PO2 H;  3UDX A;  1MJE A;  3CCE A;  3M9B A;  4OO1 G;  4IPH A;  3K0X A;  3KJO A;  1YJN A;  4LUV A;  2WAQ E;  4LUZ A;  3GTL H;  2AMC B;  1TWG H;  4DV7 Q;  1K73 C;  2C35 B;  4BBS H;  2I5M X;  1GVP A;  4JI5 L;  1SE8 A;  3GTK H;  5IYB H;  2GVB A;  3HOZ H;  3GDE A;  1CKN B;  4HJ8 A;  4PMW A;  2K52 A;  3ULP A;  5JEA J;  4JI0 L;  3NEN A;  1EQQ A;  2OCE A;  1VQO A;  1PH9 A;  1SN8 A;  3FKI G;  1TWF H;  1PH7 A;  3A5U A;  2R92 H;  1QUQ A;  1Y1V G;  1I94 L;  2B63 H;  1EOV A;  5HGQ A;  3I4N G;  4A3G H;  1PH4 A;  2NN6 G;  3LGJ A;  2B29 A;  3CQZ H;  2E5L Q;  2BH2 A;  4LFB L;  5LMU L;  2HHH L;  1VQL A;  2YU9 H;  3F8T A;  3I4M H;  1SLJ A;  5C4J H;  4LF9 Q;  2RHS B;  4DUY Q;  3TS2 A;  4IFD G;  3KDF B;  3I4O A;  2EIF A;  2L15 A;  1WI5 A;  4DV1 Q;  1TWC H;  4DK6 C;  1VQA A;  4DR3 Q;  1KC8 C;  4JI4 L;  4A3J H;  3HOW H;  4P72 A;  1VQC A;  4BA1 I;  4HIK A;  2NVT H;  3EN2 A;  4BXX H;  2YTV A;  3RNU A;  4OWW B;  4LFC L;  4R4Q A;  3HOU G;  3U58 A;  3T1H L;  3KOJ A;  5FLM H;  1E1O A;  4B3T Q;  4A3K G;  2JA7 G;  2GVA A;  5C44 H;  4DR4 L;  1HNZ L;  4BBR H;  2MFI A;  4A3L G;  1Q1E A;  5J3B A;  1NTG A;  1Z47 A;  1S3O A;  2Y0S E;  1V43 A;  2PMZ E;  4ME3 A;  3KYH C;  1IYJ B;  3S17 H;  1FGU A;  4A3B H;  3NBH B;  1Y1V H;  1LTL A;  2R93 H;  4JC0 A;  1L1O C;  3I4N H;  1VQH A;  2JA5 H;  1LUZ A;  4DV7 L;  4QIW E;  1QZG A;  5M3M G;  4APV A;  4JI1 Q;  1Q82 C;  3KFU A;  4GNX A;  2NZO A;  5AJ3 Q;  2DGY A;  3AEV A;  3ULL A;  4QGU A;  2CWA A;  1EWI A;  1YBY A;  4DR7 Q;  1VQB A;  1V9P A;  4A3F G;  2QEX A;  1Q7Y C;  4AYB E;  2A1A A;  2JA8 H;  4GKJ Q;  2ZTC A;  4TQU S;  5FLX c;  5JJL A;  4X66 Q;  3M4O H;  1TWA H;  3NEM A;  2MO1 A;  1L1O B;  1YHA A;  2WFW A;  2JQO A;  2IY5 B;  3S15 H;  4DR1 Q;  1NY4 A;  4JI5 Q;  3OW2 A;  2F4V Q;  3K80 C;  2E5L L;  5EAY A;  2R7D A;  3CCV A;  4UPA A;  1V1Q A;  1K3R A;  2LXJ A;  1BVS A;  3STB C;  1YIT A;  4LF9 L;  4XIG S;  2JA6 H;  4DUY L;  4JI8 Q;  1YHB A;  4DV5 Q;  2JEB I;  4DV1 L;  1PFS A;  4C3H H;  1HR0 L;  5C4X H;  4DR3 L;  4GOP C;  2VUM G;  4B3R Q;  3AFQ A;  1P8L A;  3PUZ A;  4YCU A;  2AWN A;  4JI2 Q;  2ATW A;  2K75 A;  1PHJ A;  3ZJY C;  3G48 A;  2R7Z H;  1IL2 A;  1UE7 A;  2HQL A;  1OXT A;  2Z6K C;  5JJI A;  1EIF A;  4WJ4 A;  5IP9 G;  4LF6 Q;  3S2D H;  2Q2H A;  1S72 A;  4KI0 A;  1XTD A;  3F1Z A;  1VQ7 A;  3NEL A;  4LUO A;  1X3E A;  4HIM A;  1HZC A;  2XTI A;  4A3E H;  1CSP A;  2ZJR A;  5LMN Q;  4GOP B;  1IBM Q;  4JG2 A;  1XNQ Q;  3E9H A;  2UUC Q;  4YCW A;  4C3I H;  2PQA B;  3EBE A;  3ERS X;  3RN2 A;  4JI7 L;  4JOI C;  1P16 A;  4QJF A;  3CCS A;  1YIJ A;  1FL0 A;  1L2F A;  4DAY B;  3J81 c;  3Q8D A;  4JI1 L;  2OQ0 A;  1A0I A;  4KLK A;  5AJ3 L;  1X54 A;  3RZD H;  2VS1 A;  4LF5 Q;  1VQ4 A;  2KCM A;  3MXN B;  4IJL A;  1N9W A;  4DR7 L;  1NMG A;  5IYC G;  4HID A;  4DK3 C;  3KJP A;  4JBW A;  1SR3 A;  2RHQ B;  4HIO A;  1TXY A;  3UDI A;  3PF4 A;  4GKJ L;  4MNO A;  4DR2 Q;  4YCV A;  3TRE A;  4X66 L;  5IP7 H;  1YHQ A;  4J15 A;  4NPS A;  3PO3 G;  1VS0 A;  1X56 A;  2R7F A;  3GTP H;  4DV3 Q;  4R4I A;  4C2M H;  1VQJ A;  3D0F A;  4A76 A;  1I3Q H;  4DR1 L;  5GRO A;  1VQ5 A;  5IE8 A;  4ALP A;  1Q12 A;  1VQD A;  4WJ3 M;  5M5Y H;  1FVI A;  5E7N A;  2F4V L;  1YNX A;  2F3I A;  1T9H A;  2ES2 A;  2UU9 Q;  1KRT A;  4BA2 I;  1HNW Q;  4LF7 Q;  5C3E G;  3H15 A;  1W3S A;  1SMX A;  1IZ6 A;  1MJC A;  4K0K Q;  4YWM A;  5M5X H;  3CCM A;  4X6A H;  1BBW A;  2PI2 E;  3S24 A;  3JAM c;  1JJG A;  3H0G G;  4JI8 L;  1JE5 A;  4DV5 L;  1PYS B;  2IHE A;  3IRB A;  1BKB A;  4A3D H;  4B3R L;  3HKZ E;  3CPF A;  1M90 C;  2EQS A;  4GN4 B;  4DV4 L;  2K14 A;  1TWH H;  1X9N A;  4JI2 L;  1KAW A;  3KF6 B;  3ER0 A;  1K8A C;  1KIX A;  3HOV G;  4LFA Q;  2JK8 A;  4LNQ A;  4OWX B;  2MNA A;  2E2H H;  2PNH A;  3KF8 B;  1B8A A;  4LF6 L;  2I5L X;  3J81 j;  1YVC A;  4JBJ A;  1VCI A;  3S1R H;  1Q81 C;  1IBL Q;  1Y14 B;  2RCN A;  1OXX K;  3M4P A;  1HR0 Q;  4P73 A;  1B7Y B;  4B3S Q;  5LMN L;  1IBM L;  1QVF A;  2YV5 A;  1XNQ L;  4GKK Q;  5JEA G;  1E24 A;  1MIU A;  2UUC L;  1G6P A;  3FHW A;  3I56 A;  2PI2 A;  4DNI A;  2AKW B;  2ZTD A;  3HOX G;  5BR8 Q;  1PH1 A;  1Q1B A;  2EXD A;  1Q86 C;  1E22 A;  3L2P A;  1JT8 A;  4BY1 G;  2LSS A;  1NJI C;  1OXU A;  2VY3 A;  4P71 A;  4DAM A;  4QL5 A;  5C3E H;  5M3F G;  2ZTE A;  4LF5 L;  2F52 A;  3J7Z C;  3GTM H;  4EX5 A;  3FKI H;  4IJH A;  4BY7 G;  1O7I A;  1WJJ A;  4O2D A;  5GAD C;  3TS0 A;  3DLL A;  3HKS A;  4DR2 L;  4A3M G;  4JV5 L;  2D0P A;  3G6E A;  3TQY A;  3PIP A;  2WAQ G;  4DV3 L;  2WB1 E;  4H02 A;  2JA9 A;  3H3V I;  1EQR A;  2N3S A;  3OTO Q;  1N32 Q;  1X6O A;  2YTY A;  4P74 A;  1J5E Q;  1S40 A;  4A3L H;  1HNW L;  3J81 i;  4KHZ A;  1VQK A;  1WFQ A;  1M1K C;  2UU9 L;  4LF7 L;  3BJU A;  3EIV A;  1WOC A;  1CKO A;  1YEZ A;  3AYH B;  4L5R C;  4K0K L;  1YJW A;  3RZO H;  4R4T A;  4A3I G;  3BZK A;  1Y1W G;  1QUQ B;  5C0X J;  3HOU H; 
#chains in the Genus database with same CATH topology
 3AB9 A;  3R23 A;  4QWB A;  1PRT C;  5ELN A;  4PZ8 A;  4A3K H;  2LKV A;  2W7O A;  4L5T A;  2ZJP A;  2FMC A;  4QUF A;  5LL6 X;  2NUA B;  4LFA H;  4A3L H;  2OQK A;  2BA1 A;  1C4Q A;  1VQF A;  2VQE Q;  2R7L A;  4MA5 A;  1RYR A;  3NSW A;  4JCV E;  3SVM A;  3Q6S A;  1WTV A;  5LHY 1;  5KFT A;  5CYU A;  1I6U A;  5J2T F;  3RJ0 A;  1EY7 A;  1L0W A;  4DKA C;  3K5N A;  1VQ8 A;  2V9W A;  4B3S H;  5CC4 A;  4GKK H;  4FP5 D;  2B63 A;  1EZ8 A;  3R5F A;  4L5S A;  3SDZ A;  4C3J G;  4ED2 A;  1XPU A;  3U50 C;  2R87 A;  1O80 A;  1ONL A;  2EYH A;  5FO7 B;  2C2D A;  1TY2 A;  3CQZ A;  4LF4 Q;  4UCT A;  4FU0 A;  2L12 A;  4M7E A;  4PZ6 A;  1XPR A;  3KAJ A;  3EA6 A;  3SK6 A;  2Z9H A;  4IO9 A;  1D8L A;  2K1B A;  1TWC A;  2KA7 A;  1HJP A;  5EBD A;  1FKA H;  1EIY B;  1U4L A;  1G29 1;  1O7L A;  4E6I A;  4GLX A;  3TRZ A;  1XMQ H;  1CQI B;  3GTG B;  3OHX C;  3PR5 B;  5COR A;  4IWX A;  3JC6 6;  4C3J B;  3OTO L;  1N32 L;  1IHZ A;  4J6H A;  2NVX B;  5FJ8 H;  3CMA A;  3EVQ A;  3K8A A;  1NMF A;  1UEB A;  3PV0 A;  1EYG A;  2VR1 A;  5EOY A;  4ULL A;  5IWA Q;  3KDF A;  4RKL A;  4I55 F;  3CHB D;  2P0A A;  4B3M Q;  1K8M A;  4AYB G;  1PXU A;  3OWF A;  5KFP A;  1UWV A;  1EUJ A;  2SEB D;  4B3T L;  3QZ7 A;  2OWO A;  4HR7 A;  3GV5 B;  5KFJ A;  3M4I A;  4CJ1 B;  1TWG B;  3BYT B;  3GTJ H;  4EGV A;  1Z7T A;  4Q5V A;  4GS3 A;  4DR6 Q;  1XMO Q;  2UUA Q;  3N6X A;  4LH6 A;  1E2Z A;  3I4M G;  3W1G A;  1KQS A;  5IGE A;  1S68 A;  3PSI A;  4EGJ A;  2VQE L;  1QVG A;  5KFO A;  2A8V A;  3SR1 A;  1N33 Q;  1VF7 A;  3GO5 A;  5C1P A;  3RB6 A;  2ZM6 Q;  5CGK A;  2FPI B;  2RDJ A;  2W6N A;  2NU9 B;  2UVW A;  5FLX L;  1NR4 A;  1LTT D;  2SOB A;  3DF7 A;  2CHB D;  2OTL A;  2VPQ A;  3KAK A;  2XRQ D;  4YHH H;  1G51 A;  1EYZ A;  1H9M A;  3PUY A;  2HIX A;  4WJW A;  1I5F A;  3M9M B;  4X64 Q;  4NXN H;  2VUG A;  4LF4 L;  2F0W A;  4NP5 A;  5J1Z A;  2PPB C;  2CH4 W;  1AE3 A;  3H0G B;  1SRU A;  3WWV A;  1TU2 B;  5M9O A;  3I55 A;  3Q24 A;  1W6K A;  1E3P A;  4QQB X;  1SMY D;  4LMY A;  1PZK D;  1SEB D;  3IFT A;  3MWM A;  3I2Z A;  2NVQ H;  1VQN A;  2W8K A;  2IHF A;  4ECW A;  4UCU A;  3J7A 5;  1GXD C;  4OEM B;  3MJF A;  1XDN A;  4HMI A;  4F4Z A;  1B1Z A;  3EQL C;  1XNR H;  5IWA L;  1PFB A;  1IBK Q;  4B3M L;  1HA6 A;  3U4V A;  5LP6 F;  3HOV H;  1F9Q A;  3OHA A;  2CVR A;  1FJG L;  4DV0 H;  3HOX B;  1G2T A;  2NZH A;  3JZI A;  3CRL C;  1Z6H A;  1WSC A;  1IKM A;  3RAX A;  3JRX A;  4DR6 L;  1PZJ D;  3J81 L;  1LYL A;  2IW3 A;  3R2T A;  1XMO L;  2UUA L;  2KCC A;  3PCO B;  3A56 A;  4O0A A;  4HJ9 A;  4EQO A;  2DJF C;  4CDC C;  2JA6 G;  4GZY C;  1N33 L;  4X3T A;  4FS1 A;  4XZ3 B;  2BQ3 A;  2VQD A;  2ZM6 L;  1RF2 D;  1ESF A;  2UUB Q;  1K0R A;  4IPC A;  5FLX E;  4O3S A;  5CA0 F;  3AFP A;  5JPN C;  4CGY B;  4C2M A;  2R7Z G;  4Y8V B;  1UE6 A;  4HN7 A;  4HMJ A;  2YYZ A;  2Q8R E;  5M3F H;  3VPC A;  2W9C A;  2WB1 A;  1PH2 A;  2W7P A;  1EY9 A;  3MXN A;  4X64 L;  4OL7 A;  1BBX C;  3IFD A;  3UDF A;  4BY7 H;  3H6M A;  2GPW A;  2JEG A;  4GC6 A;  3PW5 A;  4JOI A;  4DR5 H;  1Y1W B;  4DV6 H;  1HR0 W;  1B70 B;  1QZH A;  3LNN A;  4GN3 B;  4RNO A;  3CCU A;  1MBY A;  4K5W A;  5DM7 3;  5C0X G;  2ZDQ A;  4YY3 H;  2R7Z B;  1RIP A;  3S14 H;  1DJR D;  2K32 A;  2ZXP A;  2E8G A;  1MSG A;  3VYR A;  2VXW A;  1B6R A;  1JKJ B;  3SK8 A;  1ZHQ A;  4XQJ A;  3TQT A;  4A3I H;  2V4Q A;  1IBK L;  3FEW X;  2PW5 A;  4EQN A;  2UXC H;  3D4R A;  3T4A C;  5KG2 A;  3G6Y A;  3KF6 A;  3MEF A;  1FNU A;  1EWH A;  2W70 A;  5JH7 F;  3IN5 A;  4NLG A;  4YWK A;  3W5O A;  3VR6 A;  5KFS A;  1JWS D;  1CSQ A;  3E9I A;  4JI6 H;  3HOY H;  3S16 B;  3NGD A;  4A4I A;  4A93 H;  2F0Q A;  2TSS A;  4OIK A;  4MV3 A;  4JI7 Q;  1T5X D;  3QWN A;  5GAG C;  1R9T H;  1K0S A;  4ECT A;  2A6H D;  1GD7 A;  4ECQ A;  4LFC Q;  4KY6 A;  3WOE A;  1Y1V A;  4TVA B;  2YZN A;  1ILQ A;  3T1H Q;  2UUB L;  2C2R A;  5CV7 A;  4RCO A;  2D62 A;  4H7B A;  4HJ7 A;  1QG7 A;  2WE6 A;  4EEQ A;  3TDQ A;  3OYY A;  4DR4 Q;  4ED3 A;  1H95 A;  1BXR A;  2K5Q A;  1HA5 A;  1B3A A;  4MIU A;  3V6J A;  3M9B A;  2PBZ A;  1S0O A;  3SXH A;  3UQ8 A;  3N44 B;  4O3R A;  2F0L A;  3GTL H;  1ILP A;  3QZ8 A;  2Z6B A;  3PW7 A;  2B63 B;  2C35 B;  1D5M C;  3GTO A;  2KHS A;  3CQZ B;  3F8N A;  1PTO F;  4K8J A;  3FMA A;  4XQQ A;  5JVL A;  2DN8 A;  5C4J B;  1GHK A;  4F4W A;  5KNB A;  1ICF B;  5KX5 F;  5ELE A;  1TWF H;  1WD0 A;  1TWC B;  3OW7 A;  3M9N B;  2R92 H;  3J7A K;  4EYI B;  1QUQ A;  3D6C A;  1BDO A;  3JSL A;  4ZKC B;  1EYD A;  1I4X A;  5ELC A;  2FK2 A;  3MR2 A;  1I94 H;  4R8N A;  5L1I A;  2NN6 G;  2SCU B;  3GV7 B;  4V19 0;  3F8T A;  2RA4 A;  2HHH H;  3LWE A;  4IFD G;  3KDF B;  4JI7 L;  2L15 A;  3BJY A;  2FIN B;  2UVV A;  5KFY A;  1JIC A;  4X3S A;  4BA1 I;  4CDF C;  4JI4 H;  4HIK A;  2NVT H;  4BXX H;  1TR5 A;  3Q8P B;  4OWW B;  4LFC L;  4HR7 B;  3T1H L;  3BS1 A;  5KFK A;  2JA7 G;  5C44 H;  3G6J B;  4DR4 L;  4KMU C;  1AP0 A;  1C30 A;  2MFI A;  2HJW A;  4ME3 A;  1EU3 A;  3KYH C;  2SNS A;  2VUM A;  3VPD A;  3NBH B;  3M4O B;  4TUY F;  1Y1V H;  4I65 A;  1WTH A;  4JC0 A;  2XIW A;  1ZKO A;  2IP4 A;  1PDQ A;  5M3M G;  5EPL A;  4JI1 Q;  1Q82 C;  5AJ3 Q;  4RFB A;  3AEV A;  1PFM A;  1QE6 A;  4ZKB B;  1VAJ A;  3GTQ A;  4DR7 Q;  1VQB A;  1PRT D;  2Z8L A;  3C46 A;  4A3F G;  3LWU A;  2G9D A;  4AYB E;  2PZW A;  2JA8 H;  2O5I C;  4KY5 A;  2ZTC A;  4IUU A;  1E4E A;  2R82 A;  2ICE C;  2X69 A;  4EYH B;  2O4X A;  2WFW A;  2ICI A;  2VB3 X;  3S15 H;  1E2W A;  1F9R A;  3OMG A;  4DF7 A;  4JI5 Q;  2PMZ A;  3V6K A;  4U68 A;  3U9S A;  5IOD A;  4L1K A;  1WTR A;  3JAM W;  2R7D A;  4IR1 A;  3CCV A;  2YW2 A;  2EYP A;  2KEC A;  2LXJ A;  3S2D B;  1BVS A;  4WBN F;  2DPJ A;  3A7L A;  3QOJ A;  4DV5 Q;  5LL6 S;  2WAC A;  1HR0 L;  4DUY H;  3TII A;  3PUZ A;  2AWN A;  4C3I B;  4FVM A;  3K57 A;  4IUQ A;  2FJZ A;  1AUX A;  5JJI A;  4IRD A;  3LP8 A;  1EIF A;  3KHG A;  4LF6 Q;  1S72 A;  2CZG A;  3F1Z A;  4A3E H;  1HZC A;  4C1N K;  5CBA E;  4DL2 A;  4JG2 A;  2UUC Q;  4IUV A;  3DM1 A;  2XIG A;  4JOI C;  3J7A V;  2BCO A;  1FL0 A;  4C1N I;  1L2F A;  4DAY B;  4C2M B;  2R8J A;  1ZYR C;  4JI1 L;  2LS0 1;  5AJ3 L;  5JAV A;  2WB1 B;  1K1Q A;  5M5Y B;  1VQ4 A;  4HAE A;  5BN3 A;  3MXN B;  5DNF A;  5G3L D;  4DR7 L;  5IYC G;  3RAQ A;  5KYL A;  4EFE A;  1K83 A;  2RHQ B;  2W57 A;  1SE3 A;  1B3Q A;  1DV1 A;  3H4D A;  4GKJ H;  2WDT A;  2EYO A;  4LSX A;  4DV3 Q;  4X66 H;  4ZAI A;  2ATL A;  3D0F A;  4A76 A;  1I3Q H;  4ALP A;  1Q12 A;  1VQD A;  4DR1 H;  2A73 B;  3C1F A;  5ISR A;  2ES2 A;  2PW7 A;  1HNW Q;  3T5H A;  2QF7 A;  2F4V H;  4RNN A;  1MJC A;  2NTT A;  4KJN A;  1BNC A;  5M5X H;  1SNM A;  1B53 A;  4WFN 3;  3EJI A;  3CCM A;  5BN4 A;  4DV5 L;  1FNV A;  1IYV A;  4RB2 C;  2EQS A;  2PCF B;  2QCP X;  3SK5 A;  2NB0 A;  1KAW A;  1TT2 A;  3ER0 A;  3ITP A;  3KF6 B;  4DLK A;  2C22 A;  3BYY B;  1EZ6 A;  2JK8 A;  4LNQ A;  4OWX B;  4LF6 L;  3JRW A;  3J81 j;  2RDF A;  4G57 A;  4TSS A;  1Y14 B;  3MFI A;  3AU7 A;  1E4G T;  1STH A;  1OXX K;  4J9S A;  4P73 A;  1B7Y B;  5ELB A;  4J9M A;  1SNC A;  4HSP A;  3MZ5 A;  2UUC L;  1YNN C;  4K8I A;  3FHW A;  5LMN H;  1IBM H;  2PI2 A;  2NU6 B;  1EL0 A;  5BMV F;  4MAM A;  2ZXO A;  5BR8 Q;  1WTP A;  1PH1 A;  4ED6 A;  2FPG B;  5K2M A;  2EXD A;  3L2P A;  2J9G A;  1OXU A;  4DAM A;  1UAP A;  2Z1C A;  4DAP A;  5C3E H;  2YS7 A;  5JVH 3;  1TQO A;  3FDS A;  3MFY A;  4IHJ F;  4UFZ A;  3FKI H;  3HG9 A;  4YR2 A;  1ZXT A;  1O7I A;  1GUG A;  1WJJ A;  5GAD C;  4O3O A;  3CU7 A;  5IWA H;  2D0P A;  3TQY A;  5JVD F;  4DV3 L;  1LTA D;  4QW8 A;  3GTG A;  2RSO A;  3GTO B;  4JV2 A;  4RZQ A;  4JPB W;  1X6O A;  2YTY A;  4DNR B;  1HNW L;  4CJ2 C;  3J81 i;  1IL8 A;  1WFQ A;  2L0C A;  3EIV A;  3S1M B;  5C4H A;  2R7N A;  3RZO H;  1XMO H;  2B8G A;  4K0K H;  2UVR A;  1AFP A;  3BZK A;  1QUQ B;  2XWJ B;  3RN2 A;  4YB8 B;  2VNU D;  3GIM A;  3M3Y B;  1LV9 A;  1N8R C;  1TWG A;  3C0F B;  3LML A;  1LLR D;  5JJK A;  1EY4 A;  4IOA A;  2XGQ A;  3CF5 A;  2W6Z A;  4ME6 A;  2IX3 A;  4XTC S;  5I47 A;  1XTC D;  2QYZ A;  1A3U A;  5K5P A;  3A54 A;  1ASY A;  2B2Y A;  1Q46 A;  3RUP A;  1IBL H;  2AUK A;  4GLA C;  3DUZ A;  4AYB A;  1EIG A;  2JJQ A;  3QJY A;  3RUZ A;  4MN3 A;  5M5W B;  5BR8 L;  1GUT A;  5E3F A;  1KDC A;  3CAM A;  3KLR A;  2CW7 A;  3SHL A;  2A6E C;  3ICE A;  3K5H A;  2ZJQ A;  4XYL B;  4RGT A;  3W1B A;  5COY A;  4ZUJ A;  1CKN A;  1JB7 A;  4A3C G;  1X3G A;  2V5A A;  3SE0 A;  3A8I E;  1KHI A;  3N40 P;  3KHL A;  3PO2 G;  1NR2 A;  2F0H A;  2CFM A;  4OX9 Q;  5D1O A;  2DUD A;  3WO1 A;  4LK1 C;  2VUM B;  2F0E A;  2F4I A;  1HQM C;  4R7R A;  1ASZ A;  4ECX A;  2AU0 A;  4QWA A;  4MA0 A;  4BS9 A;  1ENC A;  4BBS G;  3UE1 A;  2Z0S A;  3GTQ B;  3T16 A;  5IYB G;  4R4C A;  3HOZ G;  1DXM A;  3GD7 A;  4F4Y A;  2KBN A;  4UP9 A;  4JV0 A;  1J5E H;  3PO2 B;  5EWE A;  1C3O A;  3CCL A;  1HPC A;  2IBK A;  1AH9 A;  4O4H F;  2K4K A;  1SRO A;  3O13 A;  2MQH A;  4EEY A;  2J6U A;  2PMZ B;  4C3J H;  4JBM A;  4A3G G;  4Y7N B;  2NVX H;  4LAA A;  3F2B A;  2HGS A;  3HS0 C;  4IPG A;  1PLF A;  3CPW A;  1T36 A;  1HZB A;  1BGW A;  5J39 A;  4MZ9 A;  3IL8 A;  2Z4H A;  3CME A;  4FS2 A;  4JYA H;  3HOW G;  4X62 Q;  4IAJ A;  3PO3 B;  2OXP A;  4DU9 A;  1TWA A;  1ZHS A;  1OXS C;  1MHW C;  4X65 Q;  5IT9 E;  2JE6 I;  4GC7 A;  3TIN A;  5KFW A;  1GUO A;  4KN4 C;  5K36 G;  5JJZ A;  4KKU A;  3I72 A;  3J80 c;  4TQS A;  5EGT A;  4J9Q A;  3MR6 A;  3PIO A;  2EZV A;  3K3V A;  1KNA A;  5ELD A;  1W2B A;  2W8L A;  4O3Q A;  5L1L A;  2W6P A;  2JA6 A;  2E75 C;  5IT9 c;  4OX9 L;  3CD6 A;  2UXD H;  1L1O A;  1N36 H;  2N49 A;  2M9V A;  4A3B G;  4RGM A;  5LMN W;  2R93 G;  1X65 A;  2IX0 A;  3CVZ A;  2JA5 G;  4LF8 H;  2R7Z A;  4MHE A;  3R3O A;  4KKS A;  3GV6 A;  1N34 Q;  1QNK A;  3T5J A;  4NXM Q;  3MFH A;  3FMC A;  1K83 B;  3H0G H;  5TSS A;  5C5L A;  1WD1 A;  1AUV A;  2OEO A;  2ASB A;  2XGT A;  1WTX A;  1HNX H;  3VYT A;  4RG1 A;  2K5W A;  1K8O A;  3E6Z X;  2ZT9 C;  2R8K A;  5DLQ E;  2F0I A;  4M8A A;  1PTO C;  3T1Y Q;  3NQT A;  4KY7 A;  4AQY Q;  3PW0 A;  3T1H H;  2NU8 B;  1EY0 A;  1KAB A;  1Z2P X;  1PVO A;  5KYI A;  3E0E A;  4F88 A;  3NTI A;  3NHH A;  3RLO A;  4KD3 A;  2QGQ A;  1GM5 A;  1VBG A;  2FK3 A;  2I5H A;  4OO1 I;  4C3H G;  4KHP H;  4X62 L;  4A3M B;  5C4X G;  3HOX H;  2ASJ A;  2RF4 A;  4ZCK A;  3DWP A;  3MAQ A;  5DLG A;  2AWO A;  4R1J A;  4CHT B;  1PTO B;  1IW7 D;  4X65 L;  2VQF H;  4BY1 H;  3GTP A;  1SAP A;  2K01 A;  5HGT A;  4MTN A;  2VZA A;  1VQI A;  4RZR A;  3Q8S B;  1RDP D;  1PH6 A;  2E2J B;  5EZY F;  5KT4 A;  1CK1 A;  3CC2 A;  2R7M A;  2Q2I A;  2HIV A;  2XN9 C;  5FD5 A;  3VR4 A;  2XSC A;  5H1S E;  3A74 A;  3BDC A;  1V51 A;  2FK1 A;  2L1B A;  1SEI A;  1TAE A;  2RDH A;  3MFG A;  2PQE A;  4JI3 H;  4R4O A;  3FPU B;  4HCS A;  4DK1 A;  5IGG A;  4C5A A;  1C0A A;  1S4Z A;  1N34 L;  3CCR A;  3ORQ A;  3F2C A;  2K5H A;  1X55 A;  4NXM L;  4IZO A;  5KFG A;  2F0G A;  2XCA A;  1OWT A;  3K3P A;  3TP6 A;  1Y1W H;  2MUY A;  2PNR C;  5IP7 G;  5ELF A;  4RMF A;  1VF5 C;  2EYL A;  2BQU A;  4TV8 F;  1NBW A;  4K14 A;  1PMR A;  2BR0 A;  1VQ9 A;  3M85 A;  3GII A;  5KND A;  5T14 A;  4L5Q A;  3T1Y L;  4LFB Q;  4UP8 A;  3BAB A;  3KF8 A;  4AQY L;  4JBK A;  5IYD H;  2BDO A;  5L1K A;  2NU7 B;  1PK8 A;  2UXB H;  1NSN S;  1JOO A;  4J9K A;  4EVO A;  4LH7 A;  1D5Z C;  3GTM A;  3G71 A;  2B2Y C;  2Q8I B;  2DWC A;  5FD6 A;  1FJG Q;  4KD4 A;  4DUZ H;  4YAK B;  5HY6 A;  3D31 A;  4XX0 B;  1UE5 A;  1A8V A;  1PYW D;  4QWE A;  3C1E A;  3S16 H;  5T1G A;  1UE1 A;  1IYU A;  3N52 A;  5ELO A;  1HNZ Q;  3AMU A;  3TBI B;  2VB2 X;  2K50 A;  2R3Z A;  3ERQ A;  1GSO A;  3RGX A;  3PN1 A;  2K28 A;  2Q8T A;  3TZD A;  3KJO A;  3NWT A;  3NBH A;  4AYB B;  4RHR A;  4LUZ A;  5KFI A;  3OPO A;  1SYB A;  5A35 A;  1L0X B;  1KLG D;  1DD2 A;  1K1S A;  1R4Q B;  2I5M X;  4IQZ A;  1SE8 A;  1JWU D;  2GVB A;  2JA7 A;  4JI5 H;  3GIP A;  2DJG C;  1CKN B;  1O7Y A;  4HJ8 A;  1V1P A;  3FRP B;  4K6L A;  4PMW A;  3ULP A;  1TS5 A;  3MTS A;  4S3S A;  3I4M B;  2E2I A;  3TN2 A;  2OCE A;  1Y8O B;  2FHT A;  1SN8 A;  1KJJ A;  5D1O B;  1PH7 A;  4F4X A;  3GLK A;  4ECR A;  4JI0 H;  4RAZ A;  1JB3 A;  2C28 A;  2B63 H;  4QB4 A;  2RCF A;  3I4N G;  2J4X A;  2WAQ A;  5CV5 A;  4EG0 A;  3R2I A;  3CQZ H;  1O7Z A;  1ROD A;  3A55 A;  4LFB L;  3R5H A;  1TA8 A;  1VQL A;  3KUP A;  2V4D A;  5C4J H;  2RHS B;  4LF9 Q;  5LMU H;  5CV4 A;  2J6T A;  3PW4 A;  1AN8 A;  3Q8Q B;  4L8J A;  4DV1 Q;  1WI5 A;  1HRJ A;  1TWC H;  4A3J H;  3V2T A;  1VQC A;  2R85 A;  3M4Y A;  3MXG A;  3S17 B;  5NUC A;  4N8F A;  1GUW A;  3HOU G;  4B9X A;  3U58 A;  3I4N B;  2A68 D;  5FLM H;  2F0O A;  4ZQ3 A;  5C6A A;  1E1O A;  3EFX D;  3K5L A;  1Z2N X;  1N48 A;  1S5F D;  4A3K G;  2GVA A;  5EJW A;  2FB9 A;  1HNZ L;  4BBR H;  4A3L G;  1MSH A;  1D6E C;  4KV6 A;  2KSW A;  5J3B A;  2VA2 A;  3H09 A;  2PMZ E;  2FPP B;  3I90 A;  3RBD A;  1FGU A;  5CBE E;  2LMC B;  5D14 A;  1TWA B;  1L1O C;  4APM A;  4DAY A;  3V4Z A;  4GNX A;  2NZO A;  1SFO A;  2DGY A;  4O3P A;  1L2Z A;  4QGU A;  1YBY A;  4U6P A;  1H9J A;  2KOL A;  5KT6 A;  1SYE A;  2F0M A;  1AN7 A;  1R4P B;  5FPR A;  3D4D A;  4F8M A;  5FLX c;  2JA6 B;  5JJL A;  3M4O H;  2PYK A;  3VPB A;  1L1O B;  4DGZ A;  1YHA A;  5D8D A;  2JQO A;  4QW9 A;  4V0B A;  2IPK D;  1ESR A;  3MEH A;  5I9P A;  3OMC A;  4DA2 A;  3K80 C;  2ZXR A;  2D5D A;  3QOL A;  2NVY A;  4TQR A;  3STB C;  2E5L H;  2OH2 A;  2D9U A;  4LF9 L;  4U67 3;  1UNS A;  3MR3 A;  2K6A A;  3KBG A;  1T94 A;  4DV1 L;  3IG0 A;  1RKN A;  3E5S A;  4B3R Q;  2L4N A;  1LTG D;  1JX4 A;  1I4Q A;  3BQ0 A;  4JI2 Q;  4DR3 H;  4N9T A;  3RMH A;  3G48 A;  2HQL A;  1OXT A;  2BE5 D;  2Y0S A;  3S2D H;  2B8F A;  4KI0 A;  1YNJ C;  3GP7 A;  3RZD B;  1VQ7 A;  3J81 E;  5AFW A;  5KFX A;  1X3E A;  5KG6 A;  1CSP A;  2ZJR A;  3E0J A;  3X3N A;  2DY7 A;  1XNQ Q;  1BR9 A;  3E9H A;  3G7L A;  3I8Z A;  5KFA A;  4C3I H;  4C5B A;  5FPO A;  2JEJ A;  2HCC A;  2W71 A;  2QDB A;  4QJF A;  3GTP B;  3CCS A;  2R61 A;  4KHV A;  2EY1 A;  3J81 c;  3Q8D A;  4K2L A;  1A0I A;  4KLK A;  2XC9 A;  1GOZ A;  3NUC A;  2VS1 A;  4LF5 Q;  4FXG C;  4H13 C;  2WTF A;  4ME5 A;  4XQN A;  4HIO A;  3PF4 A;  5CAE B;  1EY5 A;  4DR2 Q;  1EQV A;  1VS0 A;  2F0D A;  2W9B B;  3GIK A;  4C2M H;  5LA6 F;  1VQJ A;  3TIG A;  1VQ5 A;  5IE8 A;  3ND8 A;  5M5Y H;  1FVI A;  1RTO A;  5DG8 A;  4RGO S;  4BA2 I;  2DPI A;  1J9O A;  1IZ6 A;  4DXG A;  2R86 A;  3N42 B;  4FO2 A;  2PI2 E;  1HFG A;  2CW0 D;  4O3N A;  4A3D H;  2IHE A;  1BKB A;  4B3R L;  4K5X A;  4ZRZ A;  1M90 C;  4JI8 H;  5DQG A;  4DV4 L;  4UCO A;  1WVL A;  4PMB A;  4JI2 L;  4ZHQ F;  3HOV G;  1K8A C;  1KIX A;  1AZQ A;  2EYJ A;  2BDN A;  4LFA Q;  2M00 A;  3LX0 A;  3DWQ A;  2X0S A;  4K2K A;  2EDG A;  3EYY A;  3KF8 B;  1LT5 D;  2O2L D;  1U4M A;  1BCP D;  2AGQ A;  2EPB A;  1HTL D;  4OEL B;  4JBJ A;  4OO1 H;  2FLN A;  3S1R H;  1SE2 A;  2L5T A;  4OIJ A;  3M4P A;  1HR0 Q;  2RVL A;  4RH6 A;  4B3S Q;  3GTM B;  2XCL A;  4IR9 A;  3GV3 A;  4BWS C;  4GKK Q;  1XNQ L;  5JEA G;  1E24 A;  4YAJ B;  1EY8 A;  3I56 A;  4FXD A;  2ZTD A;  1JOK A;  2B2U A;  1CA6 A;  2VOB A;  4IUP A;  1Q86 C;  4QWD A;  3TP5 A;  5E4W C;  1NJI C;  4EBC A;  2VY3 A;  4P71 A;  1MI2 A;  4F50 A;  5M3F G;  1G6Z A;  2ZTE A;  4LF5 L;  3ORR A;  2F52 A;  4WD3 A;  4MTE A;  3N6R A;  1IOW A;  4FF4 A;  1DOM A;  4WOR A;  4BY7 G;  4O2D A;  3BZD B;  4DR2 L;  4JV5 L;  5EKL A;  3M9O B;  2WAQ G;  4ZOL F;  2EYM A;  4H02 A;  1EQR A;  2C00 A;  2N3S A;  1X3Q A;  2E76 C;  1B9N A;  1SYD A;  3MWY W;  4P74 A;  2JA7 B;  3DEP A;  3NQI A;  2KCN A;  1V1P B;  1KDB A;  4HSV A;  5C5J A;  1QCB D;  1BUV T;  2E2I B;  4ECV A;  1WOC A;  5C3W A;  2UU9 H;  2QK4 A;  2KEE A;  2NZ1 D;  5KRU A;  3RV4 A;  2L9H A;  1YJW A;  1ET6 A;  3HXL A;  3V96 A;  4A3I G;  2PO4 A;  2PZU A;  5C0X J;  2XD4 A;  4CC6 A;  2NBF A;  2WAQ B;  3HKZ G;  3GTO H;  5M3M B;  1CFM A;  3P75 A;  3WNZ A;  5EKI A;  4O2B F;  4LFA L;  1BO0 A;  1CA5 A;  4LMQ D;  4X65 H;  2R6G A;  1E1T A;  1IXR A;  3GTK A;  3HOY G;  1FD7 D;  1VQM A;  4FNF A;  3S1M H;  4A3F B;  4X3K A;  3F2D A;  4A93 G;  1DV2 A;  5L9X A;  5KG5 A;  4I7A A;  4B3S L;  1I50 B;  4GKK L;  2ZDG A;  3RBE A;  3J80 W;  1STY A;  1HXY D;  2NYZ D;  3M3Y H;  1M0T A;  4POF A;  2CW8 A;  1PV4 A;  5IGF A;  4NB3 A;  3CCJ A;  4NXN Q;  1XWE A;  3KAL A;  1STG A;  4GNX C;  1D5X C;  5IT9 W;  5G3L F;  2IA6 A;  4QUC A;  2ALY B;  5KFE A;  3GID A;  2YU9 A;  2B3G A;  3N43 B;  1VQE A;  5JQW A;  3VR2 A;  4PNY A;  1SSO A;  1KJI A;  1SE4 A;  1SNP A;  2V4R A;  2KEN A;  2W6Q A;  5JUM A;  1XMQ L;  4C56 C;  1ET9 A;  3K81 C;  5M5W H;  4Q45 A;  4R8U A;  4TRD A;  1IKL A;  3FP9 A;  4GNX B;  1SFO B;  1CI3 M;  4IWY A;  3I73 A;  5IYZ F;  5KGU A;  1XNR Q;  3CW2 C;  1N32 H;  1Q8K A;  1RK5 A;  2WKD A;  3OTO H;  3N41 B;  4EBE A;  3TQ1 A;  2F0N A;  3N8D A;  3IAY A;  1RK6 A;  4NDX A;  1JJC B;  5E4X A;  2VUM H;  4DV0 Q;  4TKO B;  1T3N A;  2FXQ A;  1KL9 A;  4RB3 C;  1QVC A;  2HCI A;  2R92 G;  4ZQI A;  1MZB A;  2N78 A;  5HV6 A;  1KC7 A;  2AHO B;  3H3V C;  5KFB A;  2HVS A;  2R93 A;  3Q1K A;  3TZU A;  1XPO A;  4I4T F;  4B3T H;  5EWF A;  5IP9 H;  2JA5 A;  1F2Z A;  2AGP A;  3P1H A;  3X3M A;  3GTQ H;  4X3U A;  1VBH A;  1CQJ B;  1UNN C;  2L11 A;  5C5M A;  2NVY B;  2VA3 A;  3RTX A;  2V59 A;  3OUZ A;  4AH6 A;  1PH8 A;  1I4H A;  2EE1 A;  2YZM A;  1U5K A;  2MJ8 A;  5I6W A;  2VQE H;  3IKJ A;  4MV6 A;  5A2Q W;  3I7F A;  4YHH L;  1Y8N B;  5LOV F;  1K3B C;  5HBR B;  4P75 A;  4BXX G;  3BG3 A;  3S1N B;  3GQC A;  2F0J A;  4Y7N H;  3EPG A;  4ECY A;  4KK7 A;  2OLS A;  4NXN L;  1DYQ A;  3MXP A;  4IFD J;  1A62 A;  3I12 A;  5C44 G;  4OXP A;  5C0X I;  1A3T A;  1QIL A;  4MTK A;  1XYI A;  4LF4 H;  4DR5 Q;  4DV6 Q;  2R8G A;  3PO3 H;  3OOC A;  1F2M A;  2I87 A;  5LXT F;  4ECU A;  3RB3 A;  3M7N A;  4YY3 Q;  2EJF C;  2WP8 J;  1C7Y A;  2NVT B;  1WTQ A;  2LXK A;  3U9O A;  2K04 A;  2K03 A;  2KVM A;  5KIX A;  4ED0 A;  3S2H B;  3UFX B;  1PZI D;  2C9O A;  2RDI A;  2CCZ A;  1XNR L;  1WCM G;  1B44 D;  1W96 A;  1E7Z A;  1SYC A;  3TP8 A;  1CUK A;  3FPP A;  4JW0 A;  1EY6 A;  1O75 A;  4E4T A;  1N56 A;  2UXC Q;  2FMM A;  1I6V C;  4DV0 L;  1SJE D;  1TY0 A;  1NE3 A;  2BH8 A;  2FE3 A;  1CHP D;  5D1P A;  4RB1 A;  4B3M H;  4PZ7 A;  2F0T A;  4JI6 Q;  1HCZ A;  1PA6 A;  1OTC A;  4XXE A;  1FJG H;  3K7U C;  4HYK A;  3PMF A;  1ZQ7 A;  1K83 H;  1EUD B;  1WCM B;  3KLW A;  4UHV A;  5GQO A;  1H9S B;  4DR6 H;  1LT4 D;  2YCH A;  2H1E A;  2UUA H;  5D3D A;  1HH2 P;  3U4Z A;  1T5E A;  3UE0 A;  1N33 H;  1RJT A;  1TS2 A;  1LAC A;  2ZM6 H;  1KLU D;  2MO0 A;  1VQP A;  2NUC A;  2Z6K A;  3Q2O A;  3PQI A;  1NUC A;  1EFW A;  1DON A;  1KEE A;  2UVU A;  3VMM A;  3PGZ A;  5D3I B;  1JE4 A;  3PUX A;  4LWC A;  2B2T A;  4PG3 A;  5H80 A;  3SGI A;  5BPH A;  1ENA A;  4QY7 A;  1I6H B;  4HED A;  4Z9C B;  4A3E G;  4O2A F;  4X64 H;  4DR5 L;  4IN3 A;  4A3M H;  4DV6 L;  3STB D;  2C2E A;  3VDY A;  3JAM L;  1H9K A;  2B2V A;  1Z9F A;  2QA4 A;  1PTO H;  3C2P A;  1EUC B;  4ID6 A;  1TWH A;  3R5X A;  4YY3 L;  1B50 A;  1U0L A;  2ZJT A;  1S5D D;  5DAU A;  2DY8 A;  5KFZ A;  1B33 N;  1M4V A;  1LTR D;  1J6Q A;  2E2H A;  3MHB A;  2E2J H;  4MV8 A;  2NN6 I;  2A69 C;  3OUU A;  1E4F T;  1SJH D;  4Q43 A;  3CCQ A;  3L7Z C;  4LSA A;  2CH4 A;  3MR5 A;  2EOT A;  4A3E B;  1YNJ D;  4RKB A;  2N88 A;  2UXC L;  4IFD I;  1I94 Q;  5DQH A;  5KFD A;  5J2U F;  1IBK H;  1STE A;  4CKE A;  1PH3 A;  3P20 A;  1CZW A;  2Q2T A;  1MD2 D;  4JI6 L;  1VMP A;  1CE8 A;  2V58 A;  4DAV A;  4H44 C;  2HHH Q;  3R8B A;  1KRS A;  2K5V A;  3T13 A;  3ETH A;  5KKN B;  3K7A B;  2LFN A;  4JI4 Q;  2HT1 A;  2IL8 A;  5DQI A;  3BA9 A;  5KFL A;  3G4S A;  5DLF A;  2FKL A;  1U4P A;  4UP7 A;  3GTG H;  2IT1 A;  4JVZ A;  1EHI A;  1VDZ A;  1BXT A;  3G6X A;  1HZA A;  3E5N A;  4IUT A;  4BBS B;  3W3A A;  1JJ2 A;  2W6M A;  2UUB H;  3TME A;  4K5V A;  4RHS A;  1HTP A;  2A6H C;  3GTK B;  5CA1 F;  1KNE A;  3HOZ B;  3I3C A;  5FKA C;  4PMC A;  2DIK A;  4IPH A;  3BQ2 A;  1F9S A;  2F0V A;  3NPP A;  1BNZ A;  4Q0Y A;  4LUV A;  4J9N A;  2WAQ E;  2HQE A;  5F2D A;  4HNV A;  2KQ3 A;  3TP7 A;  5KFH A;  3JAM E;  5KG7 A;  1I4G A;  2AQ3 B;  1TWG H;  2AUJ D;  5I6Y A;  4DV7 Q;  1K73 C;  2RSN A;  3FVQ A;  4A3G B;  4CBV A;  5FLX W;  1EIH A;  3W2D A;  3HEJ A;  1M0W A;  2K52 A;  2J6S A;  2YU9 B;  2HVQ A;  3NEN A;  1EQQ A;  4G7O C;  3HBL A;  1VQO A;  4HQ6 A;  1A2U A;  1KJ8 A;  2JEI A;  3FKI G;  3BVM A;  3S1Q B;  3HOW B;  3A5U A;  2XVS A;  2K05 A;  3KBX A;  4ODG A;  1I94 L;  3PR4 A;  3BA8 A;  1M8A A;  5KG0 A;  4R8U B;  3BDL A;  3DWA A;  1PH4 A;  3LGJ A;  2B29 A;  1B6S A;  1L0Y B;  2BH2 A;  1EZ1 A;  3OIQ A;  3HRZ C;  2WYO A;  1FR3 A;  3BAA A;  4FBT A;  2HHH L;  3I4M H;  1A15 A;  1SLJ A;  2YL2 A;  2ASL A;  4H0L C;  4DUY Q;  1QJO A;  3OSN A;  2D2C C;  2JEF A;  4JI4 L;  4LJZ C;  4DK6 C;  1VQA A;  2YS6 A;  5KT5 A;  2EJG C;  4P72 A;  3VYS A;  1JIH A;  4JI7 H;  4A2B A;  2E2D C;  4A3B B;  2HUG A;  5L1J A;  2R93 B;  3I4L A;  3T56 B;  5HUR A;  3KOJ A;  2JA5 B;  4LFC H;  1FYC A;  1CQV A;  2J0T D;  2O03 A;  4HCE A;  1F9P A;  5BN5 A;  5KT2 A;  4DR4 H;  3T5L A;  1Q1E A;  4QCL A;  2LY7 A;  1NTG A;  1Z47 A;  1S3O A;  5T1I A;  2R7K A;  1V43 A;  1A9X A;  1IYJ B;  3S17 H;  4FF3 A;  3J81 W;  2ALZ A;  2GA4 B;  3I4N H;  2NWG A;  4G7H C;  4C5C A;  1LUZ A;  4DV7 L;  1TS4 A;  4QIW E;  4APV A;  1JOR A;  3UI2 A;  4ZLT F;  1HUN A;  1RTN A;  3KXY T;  4CJ0 B;  3NE5 B;  2CWA A;  1BF4 A;  3GTJ A;  1EWI A;  4L63 B;  3MWD A;  5CV8 A;  1V9P A;  5C4Z A;  2QEX A;  1Q7Y C;  3PIO 3;  3PW2 A;  2A1A A;  3JSN A;  1KBL A;  4GKJ Q;  1DM0 B;  1EFI D;  4TQU S;  2XGP A;  4U7C A;  2BQR A;  1A3V A;  4X66 Q;  1RJQ A;  1TWA H;  3NEM A;  3SK4 A;  2MO1 A;  4XYM B;  4C3H B;  5C4X B;  2W9B A;  5EDW A;  5JOB A;  1S97 A;  4RB0 A;  2IY5 B;  4DR1 Q;  1NY4 A;  4ECZ A;  4XYQ A;  2JYO A;  2RGR A;  1RHP A;  3K5I A;  3OW2 A;  2F4V Q;  3QG1 A;  3ONA B;  2SDF A;  3TSS A;  3D8G A;  3H94 A;  1V1Q A;  3H40 A;  4RCN A;  2EY6 A;  4Q8E A;  4XIG S;  2JA6 H;  4DUY L;  2SNM A;  1S5C D;  4B08 A;  3NP8 A;  4PWQ A;  3AFQ A;  1HHV A;  4R8I A;  1P8L A;  4YCU A;  4P2C B;  4J9L A;  5KT3 A;  1HR0 H;  4ABN A;  2K75 A;  1PRT B;  3RD4 A;  2R7Z H;  1UE7 A;  4YJ2 F;  2Z6K C;  2QEJ C;  3PVX A;  1BOS A;  4RAU C;  2J7Z A;  4PQX A;  1S9F A;  4LUO A;  5IGB A;  1JDE A;  1ZYR D;  2B2T C;  4HIM A;  3NXW A;  2XTI A;  1RJP A;  3VYU A;  1JOQ A;  2AQ2 B;  3QR8 A;  5LMN Q;  1IBM Q;  3RIZ A;  3ERS X;  5FO9 B;  1GSA A;  1P16 A;  3G8C A;  1UC9 A;  2B2V C;  2FJ2 A;  3QO2 A;  4KKT A;  5C0X H;  1E0B A;  1YIJ A;  4KTA A;  2QKI C;  2IJ0 A;  3RZD H;  1X54 A;  5JVG 3;  4RUC A;  4QF4 A;  4JI1 H;  2KUM A;  2KCM A;  1N9W A;  4HID A;  1FGB D;  1I4P A;  4DK3 C;  5KEE A;  4JBW A;  3KJP A;  1SNQ A;  2EJM A;  4DR7 H;  1DOL A;  1TXY A;  4GKJ L;  3U9T A;  4ZI7 F;  4MNO A;  1YHQ A;  4X66 L;  3TRE A;  3A8K E;  4NPS A;  4M9U A;  2R7F A;  5I2X A;  3GTP H;  2HDM A;  1TWH B;  4Q0F A;  3NWS A;  1I4R A;  1KJ9 A;  4DR1 L;  4OHJ A;  1M7J A;  3DMU A;  2F0F A;  5E7N A;  2F4V L;  1YNX A;  2F3I A;  4J9R A;  1KRT A;  2E2H B;  3BQ1 A;  4LF7 Q;  1DZ1 A;  5F9N A;  3FDT A;  2B2W A;  3K59 A;  4K0K Q;  1JJG A;  1BBW A;  3L4J A;  4DK0 A;  4F7X A;  3H0G G;  1JE5 A;  2F3W A;  5E1F A;  2F0P A;  3IRB A;  2R8I A;  3CPF A;  4GN4 B;  4J9P A;  1SND A;  4DV5 H;  4YR3 A;  3URY A;  2W6O A;  1JLL B;  1YNN D;  2MNA A;  2FFK B;  1WTO A;  1V1O A;  1B8A A;  4UCS A;  2I5L X;  4KJO A;  1VCI A;  4LF6 H;  1IBL Q;  3HGB A;  2RCN A;  4ILW A;  1CS0 A;  1U4R A;  5LMN L;  1IBM L;  2F0U A;  1QVF A;  1I50 A;  2A74 C;  4K6D A;  2FMA A;  5CV9 A;  3L3O C;  3OIP A;  4DNI A;  4A2A A;  3HOX G;  2HVR A;  2JN4 A;  4HNU A;  2UUC H;  1GUN A;  3HKZ A;  4NMZ A;  1GJX A;  1JT8 A;  4BY1 G;  4DL4 A;  1LT3 D;  1ZET A;  4O4I F;  1S03 G;  4MV7 A;  1QWY A;  4FYD A;  3GTM H;  4EX5 A;  4IJH A;  1R9T A;  3K5O A;  4I7Z C;  1SCU B;  3I70 A;  4PV1 C;  4ED8 A;  4J0M A;  3G6E A;  3DXJ C;  5KFV A;  1JXL A;  4J9O A;  3HOU B;  1CM9 A;  2NN6 H;  4DV3 H;  3T5K A;  1E2V A;  4BY1 B;  4A3K B;  3H20 A;  2RKS A;  1J5E Q;  5KFN A;  3OHB A;  5KG1 A;  1M1K C;  3OSO A;  1S5E D;  2KED A;  4LF7 L;  4IFD H;  5KFU A;  3G6V A;  3CRK C;  3AYH B;  4K0K L;  1JR0 D;  4RWS C;  4L5R C;  4YBZ B;  1HNW H;  4ZUI A;  1ULZ A;  2YZG A;  5JEA H;  1LTB D;  1H9R A;  4R4T A;  3K5M A;  2MCT A;  1Y1W G;  5KFR A;  3PIP A;  2VPS A;  3GTL A;  2M2L A;  1D7Q A;  1YZ6 A;  2JEA I;  4TV9 F;  4UDU C;  2K33 A;  3K0Y A;  2JA7 H;  2KHJ A;  1AE2 A;  2H4O A;  4DL3 A;  4QIW A;  4IRK A;  1HZ9 A;  3DEO A;  2E2I H;  5FJ8 G;  2QW7 A;  3PUV A;  3RLN A;  5IYD G;  1JC7 A;  4DV2 Q;  4JYA Q;  2GPS A;  3PZP A;  2A6E D;  3RLF A;  4NKL A;  1MKH A;  1IBL L;  1TII D;  2V1C C;  2HDL A;  4DV4 Q;  3S9W A;  2A69 D;  3L9A X;  3JAM i;  1TWF A;  4UCV A;  3NBI A;  1SXT A;  2I0Q A;  2R92 A;  1STB A;  5M3M H;  1OXV A;  1STA A;  2YYA A;  4DL7 A;  5J22 A;  5BR8 H;  5FOB B;  4CDE C;  4OWT B;  4A3F H;  4I50 F;  2AGO A;  4NW2 A;  3UDG A;  4AIM A;  4YJ3 F;  2UXD Q;  3J80 i;  1K8G A;  1N36 Q;  1I50 H;  3ND9 A;  1IOV A;  5KG3 A;  4ECS A;  2QIL A;  4A75 A;  2R84 A;  1KDA A;  2Y0S G;  2F0K A;  4RU9 A;  4LF8 Q;  4DFA A;  3ERO A;  3RR5 A;  5EPK A;  1XJV A;  1I7L A;  4FXK C;  2N8N A;  4O42 A;  1DCZ A;  4J1M A;  1CQF A;  3HB9 A;  1B04 A;  2OT2 A;  3GTJ B;  1GSH A;  1J5E L;  2WKC A;  3RF2 A;  1S0M A;  2WIN B;  1HNX Q;  1VQG A;  1Y8P B;  4YWL A;  3BVZ A;  4JV5 Q;  1QOH A;  2Z4I A;  1KXL A;  4OGQ C;  5KNC A;  3GQB A;  5IIF A;  1WYD A;  2Y0S B;  3PIP 3;  3K6O A;  5I2Y A;  1SFO H;  1NAP A;  2B63 G;  4G4K A;  3HFZ B;  2VW9 A;  4RA8 A;  1BCP F;  4ED7 A;  4BWG B;  5C8Y F;  4Q44 A;  5EWG A;  1WCM A;  3NK9 A;  1H9S A;  4B9W A;  4DNT B;  4DV2 L;  4JYA L;  2I07 B;  5GAH C;  4KHP Q;  4QMG A;  2EXZ A;  5GON F;  1KTK A;  3CC7 A;  1B2T A;  2VQF Q;  1UUP A;  4A3J G;  1EYC A;  4ETS A;  3BDO A;  1LM0 A;  2D0O A;  4O4L F;  1SNO A;  1HQR D;  3MVV A;  3ULJ A;  1VQ6 A;  2KHI A;  5KFQ A;  1Z2O X;  4ED1 A;  5FLM G;  2NVY H;  4HJ5 A;  2PVP A;  5IYC H;  2NVQ B;  1PH5 A;  2I46 A;  4YIJ A;  3GIL A;  4BBR G;  1Q3L A;  5C1O A;  3PF5 A;  2OTJ A;  3KLS A;  1WH2 A;  2UXD L;  2RGV A;  1G8Z D;  1N36 L;  1DGS A;  3H3V H;  1JQY D;  3CC4 A;  5DG7 A;  4A3J B;  3S1N H;  2B39 A;  4JI3 Q;  4OX9 H;  4ZYS A;  4MV1 A;  4LF8 L;  3HOV B;  1A63 A;  1VKZ A;  2XRS D;  3WDN A;  4DPG A;  1PRT F;  3RB0 A;  3L0O A;  4GLV B;  4PDB A;  1UC8 A;  1K28 A;  3BZC A;  1YJ9 A;  4JV1 A;  1TKW B;  1PTO D;  4XT3 B;  4Q8F A;  2B2W C;  4BBR B;  1HNX L;  3OWE B;  3CXC A;  2VL6 A;  1XMQ Q;  2DLN A;  3WO0 A;  2K7V A;  3BU2 A;  1HUM A;  3S2H H;  2CQO A;  5I4D A;  1F77 A;  4CKC A;  3Q0A A;  1RL2 A;  2R6F A;  2UXB Q;  1UEA B;  2CQY A;  3RN5 A;  5M3F B;  3M7G A;  3KHR A;  3J7A F;  4IOC A;  3D6W A;  4GOP A;  4DUZ Q;  4KHP L;  4I7H A;  1K9M C;  2YTX A;  4BY7 B;  5DEH A;  5LYJ F;  2VQF L;  2PQA A;  3D4W A;  1X3F A;  1GKH A;  3DM3 A;  1I7N A;  4IPD A;  2KJX A;  4X62 H;  2KCT A;  3M4Q A;  3A5Z B;  2EYF A;  4XT1 B;  4EGQ A;  1I3Q A;  2FLL A;  4EQ5 A;  4DV7 H;  1WCM H;  1W6J A;  2CWP A;  3S14 B;  1KJQ A;  5JPM C;  4UY8 C;  1EEI D;  1GO3 E;  1CZG A;  2DNC A;  4YHH Q;  1IW7 C;  1M6V A;  4FF2 A;  5IY0 A;  3QFF A;  2IMW P;  4A3I B;  4GN5 A;  2WII B;  3A0J A;  5EKK A;  4C3I G;  3RFC A;  2H5X A;  4JI3 L;  5CMD A;  1C9O A;  3V05 A;  3B6Y A;  3HKZ B;  2OF1 A;  4FF1 A;  3J7Y W;  4JUZ A;  4G3I A;  1BBU A;  4YQW A;  3HOY B;  1O78 A;  2I80 A;  1I6H H;  4JI0 Q;  2BA0 A;  1N34 H;  4A93 B;  4DN4 M;  1EYA A;  4NXM H;  3F2U A;  1R9T B;  2RBM A;  5DGA A;  5DM6 3;  2ID0 A;  2ASD A;  3CP0 A;  3LWB A;  5KFM A;  4OON A;  3V6H A;  1EWC A;  4LW1 A;  2GN5 A;  1CTM A;  4MV9 A;  1PX2 A;  1JMC A;  4HJA A;  3Q22 A;  1V4Y A;  5KFF A;  5LMU Q;  4FDB A;  1DIK A;  2WB1 G;  5FK9 C;  2XWB B;  2UXB L;  1ML0 D;  3T1Y H;  1SYF A;  5IOC A;  4Y52 H;  1PFN A;  3TEH B;  1AZP A;  4AQY H;  4J8Q A;  5EBC A;  2PN1 A;  5D65 A;  2CKZ B;  4DUZ L;  1KD1 C;  5GAE C;  3FKI A;  2IX1 A;  3PUW A;  1FNW A;  2K5N A;  1G2S A;  4IUR A;  4POG A;  3R93 A;  4A3D G;  3SE7 A;  3MXU A;  1Q8I A;  3AQQ A;  3GTL B;  1BJT A;  4F87 A;  1PYB A;  4WRD A;  1YI2 A;  1CKM A;  1V8Q A;  2F0S A;  4XDX A;  4CC5 A;  3T51 B;  3A7A B;  2Q2U A;  4A3C H;  1X32 A;  4QIW B;  1TS3 A;  1DOK A;  2W9C B;  2C5C A;  3K7A H;  2A19 A;  1QNU A;  3OSP A;  1RD9 D;  3PO2 H;  3UDX A;  3VR3 A;  1GLV A;  1MJE A;  3CCE A;  2G9H D;  4OO1 G;  1F2Y A;  3K0X A;  3QIA A;  1D1K A;  2MPM A;  4IZ8 A;  1LO5 D;  1YJN A;  3KK7 A;  1WTW A;  1G91 A;  4YR0 A;  1TWF B;  4A3D B;  3NTK A;  2DZD A;  1SYG A;  2WV6 D;  1Y69 U;  1NCV A;  2AMC B;  2X6L A;  5IGD A;  2F03 A;  2R92 B;  1SYX B;  4BBS H;  2IWH A;  1GVP A;  3SI8 A;  4JI5 L;  5KT7 A;  3GTK H;  5IYB H;  3P7J A;  2P5Z X;  3HOZ H;  1C48 A;  1XX8 A;  3GDE A;  4MTD A;  5JEA J;  2E74 C;  4JI0 L;  1A2T A;  2BOS A;  2XNA C;  2X6G A;  1EOT A;  3S1R B;  1LTS D;  2ZDH A;  1PH9 A;  3Q8R B;  3RV3 A;  1B9M A;  3QB3 A;  1Y1V G;  1NNX A;  4DL5 A;  1EOV A;  5HGQ A;  4A3G H;  1GUS A;  2E5L Q;  5CB4 F;  1VMC A;  4N9P A;  4RGN A;  5LMU L;  1ENF A;  2YU9 H;  5C44 B;  3I91 A;  4LFB H;  4EFB A;  3TS2 A;  2GLT A;  3I4O A;  2EIF A;  4CDD C;  2JA8 G;  1SMY C;  1X3P A;  3MA2 B;  4DR3 Q;  1KC8 C;  3HOW H;  3S1Q H;  3DHQ A;  2F1M A;  2R8H A;  3EN2 A;  2YTV A;  3RNU A;  1Y1V B;  4MV4 A;  4R4Q A;  4R9W A;  3HZX A;  5K36 H;  4EBD A;  1C8C A;  2O5J C;  4XYO A;  4DXF A;  4RAY A;  2JSO A;  3WOF A;  4O1N A;  1SBB B;  5IGC A;  2W9A A;  4UAI A;  1HNZ H;  2Y0S E;  1GYF A;  2JA8 B;  2QDL A;  2A68 C;  4A3B H;  2JXM B;  1LTL A;  2R93 H;  3BG5 A;  2HD3 A;  1VQH A;  4L6T B;  1F2L A;  3CKI B;  2JA5 H;  2B2U C;  1MGS A;  2JP1 A;  1QZG A;  1AEX A;  2I8C A;  1S10 A;  3A8J E;  3KFU A;  3S15 B;  5CV6 A;  3ULL A;  4G7Z C;  3KLS X;  2NVX A;  3VA7 A;  4CKB A;  1JWM D;  3E3X A;  1U9R A;  3ETJ A;  4LF7 H;  4N8X 1;  4YP3 A;  5L37 A;  1RCV D;  2AQ1 B;  5BPF A;  5EPJ A;  3V4S A;  2E5L L;  5EAY A;  4UPA A;  2EY2 A;  1BQQ T;  1K3R A;  3RB4 A;  1RYS A;  3H91 A;  1YIT A;  5F9L A;  4JI8 Q;  4HTH A;  3J80 L;  1YHB A;  2JEB I;  4LF9 H;  1PFS A;  4C3H H;  5C4X H;  4DR3 L;  4GOP C;  2VUM G;  2RQX A;  1EEF D;  3KHH A;  4DV1 H;  2EVB A;  3VR5 A;  2ATW A;  2K5D A;  1STN A;  5IT9 L;  1PHJ A;  3ZJY C;  1IL2 A;  2N55 A;  2MP1 A;  3VA5 A;  5IP9 G;  4WJ4 A;  4RNM A;  2Q2H A;  1XTD A;  3NEL A;  5KFC A;  2DNE A;  1J8I A;  3Q23 A;  5LL6 b;  4GOP B;  3H0G A;  3BVG A;  3GIQ A;  2G5D A;  4YCW A;  2PQA B;  3EBE A;  1B4O A;  2BE5 C;  2RDG A;  1ZEQ X;  1HFN A;  1GHJ A;  5KG4 A;  1I3Q B;  2OQ0 A;  1ICW A;  2ENB A;  3GV8 B;  4IJL A;  1NMG A;  5C3X A;  1SR3 A;  1OO9 B;  3UDI A;  5I9O A;  5M5X B;  2AQ4 A;  2MGS A;  1S0N A;  1E4E B;  4YCV A;  1TVX A;  5IP7 H;  4J15 A;  3PO3 G;  1X56 A;  3L4K A;  5CR3 A;  4R4I A;  3KTM A;  3GIJ A;  5GRO A;  3NTH A;  2PZT A;  4WJ3 M;  1QB5 D;  1T9H A;  2UU9 Q;  5C3E G;  3H15 A;  1W3S A;  1SMX A;  4IUN A;  2FP4 B;  5DG9 A;  1LAB A;  1D2B A;  4YWM A;  2TMP A;  5A2Q L;  4X6A H;  3S24 A;  1LT6 D;  3JAM c;  3J80 E;  4JI8 L;  4HNT A;  1PYS B;  4M1U B;  4DV2 H;  4IRC A;  3HKZ E;  2K14 A;  3HP3 A;  1TWH H;  3T53 B;  1X9N A;  1A6X A;  4DL6 A;  4B3R H;  3RGZ A;  1CHQ D;  4DV4 H;  1CT1 D;  4JI2 H;  3K58 A;  2FLP A;  2E2H H;  1II3 A;  2PNH A;  4QWC A;  2CW0 C;  4RUA A;  3EPI A;  1Q90 A;  1YVC A;  5C3E B;  2XCP A;  2MHV A;  1Q81 C;  1JDB B;  4FM9 A;  1EQT A;  2YRX A;  2EY5 A;  3FKI B;  2YV5 A;  1G6P A;  1MIU A;  4EQP A;  3C3L A;  1Y1W A;  2AKW B;  1XNQ H;  1EU4 A;  3H4B A;  1Q1B A;  1BCP C;  1GGO A;  2F3V A;  1E22 A;  4KN7 C;  1KAA A;  2LSS A;  2NTS A;  4QL5 A;  3SEB A;  4UCR A;  3J7Z C;  4LF5 H;  2A5H A;  3TS0 A;  3DLL A;  5DGB A;  3RZO B;  1JCK B;  3HKS A;  4A3M G;  2L55 A;  1RJR A;  1BCP B;  1S5B D;  4DR2 H;  4JV5 H;  2WB1 E;  3D3R A;  2JA9 A;  5EQ0 A;  3H3V I;  4ZK9 B;  1WR2 A;  2M05 A;  1N32 Q;  1AW7 A;  3OTO Q;  2CQA A;  1S40 A;  1D1I A;  1LTI D;  4KHZ A;  4JK1 C;  1VQK A;  5FO8 B;  2UU9 L;  3BJU A;  5A2Q E;  1CKO A;  1YEZ A;  2YRW A;  1XXG A;  4FBU A;  3MC0 B;  3MWE A;  4B3T Q;  1SDF A;  3ZYY X;  1W93 A;  3HOU H;  4IAL A; 
#chains in the Genus database with same CATH homology
 2VNU D;  1D7Q A;  1YZ6 A;  2JEA I;  3GTO H;  3HKZ G;  5ELN A;  1N8R C;  4PZ8 A;  4A3K H;  4LFA L;  2JA7 H;  5JJK A;  2KHJ A;  4IOA A;  1AE2 A;  4L5T A;  2ZJP A;  3CF5 A;  2R6G A;  1E1T A;  1IXR A;  1HZ9 A;  2E2I H;  4XTC S;  5FJ8 G;  2OQK A;  3PUV A;  3RLN A;  1VQM A;  2BA1 A;  5IYD G;  4DV2 Q;  3HOY G;  1VQF A;  2VQE Q;  3S1M H;  3RLF A;  3F2D A;  4JYA Q;  1ASY A;  1MKH A;  1IBL L;  4A93 G;  2V1C C;  4JCV E;  1Q46 A;  4DV4 Q;  4B3S L;  4GLA C;  4GKK L;  3JAM i;  4DKA C;  1L0W A;  1VQ8 A;  2JJQ A;  2I0Q A;  3M3Y H;  5M3M H;  4POF A;  1OXV A;  5BR8 L;  1PV4 A;  4L5S A;  3CCJ A;  4NB3 A;  3CAM A;  4NXN Q;  1XPU A;  3U50 C;  3ICE A;  4GNX C;  2ZJQ A;  4OWT B;  3W1B A;  2ALY B;  4A3F H;  1JB7 A;  1CKN A;  4LF4 Q;  4A3C G;  1X3G A;  4PZ6 A;  1KHI A;  3UDG A;  4AIM A;  2B3G A;  1VQE A;  3PO2 G;  2UXD Q;  3J80 i;  1XPR A;  1K8G A;  2CFM A;  1I50 H;  1N36 Q;  4OX9 Q;  2DUD A;  1D8L A;  4IO9 A;  4A75 A;  1HJP A;  2KEN A;  1EIY B;  1XMQ L;  2Y0S G;  1G29 1;  3K81 C;  5M5W H;  1ASZ A;  4LF8 Q;  4GLX A;  3TRZ A;  3RR5 A;  1XJV A;  2N8N A;  3FP9 A;  4GNX B;  4BBS G;  3JC6 6;  3UE1 A;  3OTO L;  2Z0S A;  1N32 L;  5FJ8 H;  3CMA A;  5IYB G;  1J5E L;  3CW2 C;  3K8A A;  1Q8K A;  4R4C A;  1NMF A;  1UEB A;  1XNR Q;  3HOZ G;  3GD7 A;  1HNX Q;  3PV0 A;  1EYG A;  2KBN A;  4UP9 A;  1VQG A;  5IWA Q;  3KDF A;  1JJC B;  4YWL A;  2VUM H;  4B3M Q;  3CCL A;  4JV5 Q;  4DV0 Q;  1KXL A;  4AYB G;  2FXQ A;  1AH9 A;  2K4K A;  1KL9 A;  1SRO A;  2MQH A;  1UWV A;  1EUJ A;  1QVC A;  4B3T L;  1WYD A;  2OWO A;  2R92 G;  2N78 A;  2AHO B;  1SFO H;  2B63 G;  1XPO A;  4C3J H;  5IP9 H;  3HFZ B;  4JBM A;  3GTJ H;  2VW9 A;  4A3G G;  2NVX H;  3GTQ H;  3F2B A;  4GS3 A;  4DR6 Q;  4IPG A;  1XMO Q;  2UUA Q;  3CPW A;  4AH6 A;  1PH8 A;  3W1G A;  1KQS A;  4DV2 L;  3I4M G;  1HZB A;  3PSI A;  4JYA L;  2VQE L;  5GAH C;  1QVG A;  4KHP Q;  2A8V A;  4MZ9 A;  1N33 Q;  1U5K A;  3CME A;  3GO5 A;  3CC7 A;  2ZM6 Q;  2VQF Q;  3HOW G;  4X62 Q;  4A3J G;  3I7F A;  4YHH L;  1LM0 A;  2D0O A;  1OXS C;  4P75 A;  4X65 Q;  2JE6 I;  4BXX G;  3ULJ A;  1VQ6 A;  2OTL A;  2KHI A;  4Y7N H;  1G51 A;  5K36 G;  4NXN L;  5FLM G;  2NVY H;  3PUY A;  2HIX A;  3J80 c;  4IFD J;  1I5F A;  4HJ5 A;  1A62 A;  5IYC H;  1PH5 A;  4X64 Q;  5C44 G;  4OXP A;  5C0X I;  4LF4 L;  3PIO A;  4BBR G;  3PF5 A;  2OTJ A;  1W2B A;  4DR5 Q;  1AE3 A;  2UXD L;  1SRU A;  3WWV A;  5IT9 c;  3I55 A;  4DV6 Q;  1N36 L;  3PO3 H;  4OX9 L;  1DGS A;  3H3V H;  3CD6 A;  1E3P A;  1L1O A;  3CC4 A;  3S1N H;  2N49 A;  4JI3 Q;  4A3B G;  5LMN W;  4LF8 L;  4YY3 Q;  2WP8 J;  1X65 A;  2IX0 A;  1C7Y A;  3M7N A;  4QQB X;  2R93 G;  1A63 A;  2LXK A;  2JA5 G;  3I2Z A;  4DPG A;  2JA8 G;  2NVQ H;  3L0O A;  4GLV B;  1N34 Q;  1VQN A;  2IHF A;  2CCZ A;  1YJ9 A;  3BZC A;  4NXM Q;  1WCM G;  1XNR L;  3J7A 5;  3H0G H;  1E7Z A;  1HNX L;  1CUK A;  3CXC A;  2VL6 A;  5IWA L;  2UXC Q;  2ASB A;  2XGT A;  1IBK Q;  4B3M L;  1XMQ Q;  4DV0 L;  4RG1 A;  3U4V A;  1NE3 A;  3HOV H;  2BH8 A;  1FJG L;  4PZ7 A;  3BU2 A;  5DLQ E;  4JI6 Q;  2NZH A;  1PA6 A;  1OTC A;  3S2H H;  3T1Y Q;  2CQO A;  1RL2 A;  4AQY Q;  2UXB Q;  3K7U C;  3RN5 A;  4DR6 L;  1K83 H;  1LYL A;  1XMO L;  1PVO A;  2UUA L;  3E0E A;  3KLW A;  3PCO B;  4O0A A;  5GQO A;  4HJ9 A;  3RLO A;  4IOC A;  4GOP A;  4KHP L;  4DUZ Q;  2QGQ A;  1GM5 A;  1K9M C;  1N33 L;  2YTX A;  2JA6 G;  1HH2 P;  2I5H A;  3U4Z A;  2ZM6 L;  2VQF L;  2PQA A;  4X62 L;  3UE0 A;  1X3F A;  3HOX H;  4OO1 I;  5C4X G;  2RF4 A;  1GKH A;  3DM3 A;  2UUB Q;  1K0R A;  4IPD A;  2MO0 A;  4IPC A;  2AWO A;  4R1J A;  2Z6K A;  4X65 L;  2KCT A;  3AFP A;  1VQP A;  1EFW A;  4BY1 H;  3M4Q A;  3A5Z B;  2R7Z G;  1UE6 A;  3PGZ A;  4MTN A;  2VZA A;  1VQI A;  2YYZ A;  4EQ5 A;  3PUX A;  5M3F H;  1PH2 A;  1WCM H;  2CWP A;  4LWC A;  4PG3 A;  4X64 L;  3SGI A;  1PH6 A;  3UDF A;  4QY7 A;  4UY8 C;  3CC2 A;  4BY7 H;  1GO3 E;  4A3E G;  2Q2I A;  2HIV A;  4DR5 L;  4A3M H;  4YHH Q;  4DV6 L;  3STB D;  5H1S E;  3A74 A;  5IY0 A;  4JOI A;  3VDY A;  4GN5 A;  3A0J A;  2QA4 A;  1Z9F A;  2H5X A;  4JI3 L;  1HR0 W;  1B70 B;  1C9O A;  1QZH A;  4GN3 B;  3B6Y A;  4YY3 L;  3S1Q H;  1U0L A;  3CCU A;  4R4O A;  5C0X G;  1RIP A;  3S14 H;  1C0A A;  1J6Q A;  1BBU A;  1N34 L;  2E2J H;  3CCR A;  2NN6 I;  2E8G A;  2K5H A;  3F2C A;  1X55 A;  4JI0 Q;  4NXM L;  2BA0 A;  3CCQ A;  3L7Z C;  1I6H H;  4A3I H;  1Y1W H;  2ID0 A;  2UXC L;  1IBK L;  4IFD I;  3CP0 A;  1I94 Q;  4OON A;  5IP7 G;  4RMF A;  4LW1 A;  1NBW A;  2GN5 A;  3KF6 A;  1PH3 A;  1VQ9 A;  3MEF A;  2Q2T A;  4JI6 L;  3M85 A;  1JMC A;  4HJA A;  4YWK A;  3W5O A;  4L5Q A;  3T1Y L;  4LFB Q;  4UP8 A;  1CSQ A;  3E9I A;  2WB1 G;  4FDB A;  5LMU Q;  4AQY L;  2HHH Q;  1KRS A;  4JBK A;  2K5V A;  4A4I A;  3HOY H;  2UXB L;  5IYD H;  4A93 H;  4Y52 H;  3TEH B;  4JI7 Q;  5GAG C;  1R9T H;  4JI4 Q;  2HT1 A;  1GD7 A;  4DUZ L;  2CKZ B;  3G71 A;  1KD1 C;  5GAE C;  2IX1 A;  3PUW A;  3G4S A;  2K5N A;  4POG A;  4A3D G;  1FJG Q;  4LFC Q;  4UP7 A;  5HY6 A;  3D31 A;  3GTG H;  3AQQ A;  1UE5 A;  2IT1 A;  4TVA B;  1A8V A;  3T1H Q;  2UUB L;  2D62 A;  1HZA A;  1PYB A;  1YI2 A;  4HJ7 A;  1CKM A;  3S16 H;  1JJ2 A;  1UE1 A;  3OYY A;  2Q2U A;  4DR4 Q;  5ELO A;  4A3C H;  1HNZ Q;  1H95 A;  3K7A H;  2A19 A;  2K50 A;  3PO2 H;  3UDX A;  1MJE A;  3CCE A;  3M9B A;  4OO1 G;  4IPH A;  3K0X A;  3KJO A;  1YJN A;  4LUV A;  2WAQ E;  4LUZ A;  3GTL H;  2AMC B;  1TWG H;  4DV7 Q;  1K73 C;  2C35 B;  4BBS H;  2I5M X;  1GVP A;  4JI5 L;  1SE8 A;  3GTK H;  5IYB H;  2GVB A;  3HOZ H;  3GDE A;  1CKN B;  4HJ8 A;  4PMW A;  2K52 A;  3ULP A;  5JEA J;  4JI0 L;  3NEN A;  1EQQ A;  2OCE A;  1VQO A;  1PH9 A;  1SN8 A;  3FKI G;  1TWF H;  1PH7 A;  3A5U A;  2R92 H;  1QUQ A;  1Y1V G;  1I94 L;  2B63 H;  1EOV A;  5HGQ A;  3I4N G;  4A3G H;  1PH4 A;  2NN6 G;  3LGJ A;  2B29 A;  3CQZ H;  2E5L Q;  2BH2 A;  4LFB L;  5LMU L;  2HHH L;  1VQL A;  2YU9 H;  3F8T A;  3I4M H;  1SLJ A;  5C4J H;  4LF9 Q;  2RHS B;  4DUY Q;  3TS2 A;  4IFD G;  3KDF B;  3I4O A;  2EIF A;  2L15 A;  1WI5 A;  4DV1 Q;  1TWC H;  4DK6 C;  1VQA A;  4DR3 Q;  1KC8 C;  4JI4 L;  4A3J H;  3HOW H;  4P72 A;  1VQC A;  4BA1 I;  4HIK A;  2NVT H;  3EN2 A;  4BXX H;  2YTV A;  3RNU A;  4OWW B;  4LFC L;  4R4Q A;  3HOU G;  3U58 A;  3T1H L;  3KOJ A;  5FLM H;  1E1O A;  4B3T Q;  4A3K G;  2JA7 G;  2GVA A;  5C44 H;  4DR4 L;  1HNZ L;  4BBR H;  2MFI A;  4A3L G;  1Q1E A;  5J3B A;  1NTG A;  1Z47 A;  1S3O A;  2Y0S E;  1V43 A;  2PMZ E;  4ME3 A;  3KYH C;  1IYJ B;  3S17 H;  1FGU A;  4A3B H;  3NBH B;  1Y1V H;  1LTL A;  2R93 H;  4JC0 A;  1L1O C;  3I4N H;  1VQH A;  2JA5 H;  1LUZ A;  4DV7 L;  4QIW E;  1QZG A;  5M3M G;  4APV A;  4JI1 Q;  1Q82 C;  3KFU A;  4GNX A;  2NZO A;  5AJ3 Q;  2DGY A;  3AEV A;  3ULL A;  4QGU A;  2CWA A;  1EWI A;  1YBY A;  4DR7 Q;  1VQB A;  1V9P A;  4A3F G;  2QEX A;  1Q7Y C;  4AYB E;  2A1A A;  2JA8 H;  4GKJ Q;  2ZTC A;  4TQU S;  5FLX c;  5JJL A;  4X66 Q;  3M4O H;  1TWA H;  3NEM A;  2MO1 A;  1L1O B;  1YHA A;  2WFW A;  2JQO A;  2IY5 B;  3S15 H;  4DR1 Q;  1NY4 A;  4JI5 Q;  3OW2 A;  2F4V Q;  3K80 C;  2E5L L;  5EAY A;  2R7D A;  3CCV A;  4UPA A;  1V1Q A;  1K3R A;  2LXJ A;  1BVS A;  3STB C;  1YIT A;  4LF9 L;  4XIG S;  2JA6 H;  4DUY L;  4JI8 Q;  1YHB A;  4DV5 Q;  2JEB I;  4DV1 L;  1PFS A;  4C3H H;  1HR0 L;  5C4X H;  4DR3 L;  4GOP C;  2VUM G;  4B3R Q;  3AFQ A;  1P8L A;  3PUZ A;  4YCU A;  2AWN A;  4JI2 Q;  2ATW A;  2K75 A;  1PHJ A;  3ZJY C;  3G48 A;  2R7Z H;  1IL2 A;  1UE7 A;  2HQL A;  1OXT A;  2Z6K C;  5JJI A;  1EIF A;  4WJ4 A;  5IP9 G;  4LF6 Q;  3S2D H;  2Q2H A;  1S72 A;  4KI0 A;  1XTD A;  3F1Z A;  1VQ7 A;  3NEL A;  4LUO A;  1X3E A;  4HIM A;  1HZC A;  2XTI A;  4A3E H;  1CSP A;  2ZJR A;  5LMN Q;  4GOP B;  1IBM Q;  4JG2 A;  1XNQ Q;  3E9H A;  2UUC Q;  4YCW A;  4C3I H;  2PQA B;  3EBE A;  3ERS X;  3RN2 A;  4JI7 L;  4JOI C;  1P16 A;  4QJF A;  3CCS A;  1YIJ A;  1FL0 A;  1L2F A;  4DAY B;  3J81 c;  3Q8D A;  4JI1 L;  2OQ0 A;  1A0I A;  4KLK A;  5AJ3 L;  1X54 A;  3RZD H;  2VS1 A;  4LF5 Q;  1VQ4 A;  2KCM A;  3MXN B;  4IJL A;  1N9W A;  4DR7 L;  1NMG A;  5IYC G;  4HID A;  4DK3 C;  3KJP A;  4JBW A;  1SR3 A;  2RHQ B;  4HIO A;  1TXY A;  3UDI A;  3PF4 A;  4GKJ L;  4MNO A;  4DR2 Q;  4YCV A;  3TRE A;  4X66 L;  5IP7 H;  1YHQ A;  4J15 A;  4NPS A;  3PO3 G;  1VS0 A;  1X56 A;  2R7F A;  3GTP H;  4DV3 Q;  4R4I A;  4C2M H;  1VQJ A;  3D0F A;  4A76 A;  1I3Q H;  4DR1 L;  5GRO A;  1VQ5 A;  5IE8 A;  4ALP A;  1Q12 A;  1VQD A;  4WJ3 M;  5M5Y H;  1FVI A;  5E7N A;  2F4V L;  1YNX A;  2F3I A;  1T9H A;  2ES2 A;  2UU9 Q;  1KRT A;  4BA2 I;  1HNW Q;  4LF7 Q;  5C3E G;  3H15 A;  1W3S A;  1SMX A;  1IZ6 A;  1MJC A;  4K0K Q;  4YWM A;  5M5X H;  3CCM A;  4X6A H;  1BBW A;  2PI2 E;  3S24 A;  3JAM c;  1JJG A;  3H0G G;  4JI8 L;  1JE5 A;  4DV5 L;  1PYS B;  2IHE A;  3IRB A;  1BKB A;  4A3D H;  4B3R L;  3HKZ E;  3CPF A;  1M90 C;  2EQS A;  4GN4 B;  4DV4 L;  2K14 A;  1TWH H;  1X9N A;  4JI2 L;  1KAW A;  3KF6 B;  3ER0 A;  1K8A C;  1KIX A;  3HOV G;  4LFA Q;  2JK8 A;  4LNQ A;  4OWX B;  2MNA A;  2E2H H;  2PNH A;  3KF8 B;  1B8A A;  4LF6 L;  2I5L X;  3J81 j;  1YVC A;  4JBJ A;  1VCI A;  3S1R H;  1Q81 C;  1IBL Q;  1Y14 B;  2RCN A;  1OXX K;  3M4P A;  1HR0 Q;  4P73 A;  1B7Y B;  4B3S Q;  5LMN L;  1IBM L;  1QVF A;  2YV5 A;  1XNQ L;  4GKK Q;  5JEA G;  1E24 A;  1MIU A;  2UUC L;  1G6P A;  3FHW A;  3I56 A;  2PI2 A;  4DNI A;  2AKW B;  2ZTD A;  3HOX G;  5BR8 Q;  1PH1 A;  1Q1B A;  2EXD A;  1Q86 C;  1E22 A;  3L2P A;  1JT8 A;  4BY1 G;  2LSS A;  1NJI C;  1OXU A;  2VY3 A;  4P71 A;  4DAM A;  4QL5 A;  5C3E H;  5M3F G;  2ZTE A;  4LF5 L;  2F52 A;  3J7Z C;  3GTM H;  4EX5 A;  3FKI H;  4IJH A;  4BY7 G;  1O7I A;  1WJJ A;  4O2D A;  5GAD C;  3TS0 A;  3DLL A;  3HKS A;  4DR2 L;  4A3M G;  4JV5 L;  2D0P A;  3G6E A;  3TQY A;  3PIP A;  2WAQ G;  4DV3 L;  2WB1 E;  4H02 A;  2JA9 A;  3H3V I;  1EQR A;  2N3S A;  3OTO Q;  1N32 Q;  1X6O A;  2YTY A;  4P74 A;  1J5E Q;  1S40 A;  4A3L H;  1HNW L;  3J81 i;  4KHZ A;  1VQK A;  1WFQ A;  1M1K C;  2UU9 L;  4LF7 L;  3BJU A;  3EIV A;  1WOC A;  1CKO A;  1YEZ A;  3AYH B;  4L5R C;  4K0K L;  1YJW A;  3RZO H;  4R4T A;  4A3I G;  3BZK A;  1Y1W G;  1QUQ B;  5C0X J;  3HOU H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...