5IP7G

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5ip7G01
5LMUQ 1HR0W 1JMCA 2R7ZH 4A3GH 2IT1A 2R7DA 2ZJRA 1N36L 4NXMQ 2PI2E 4DR3L 1PH7A 1SR3A 5IWAQ 2DGYA 3CCUA 1VQEA 1IBLL 3CC2A 4A3KH 4WJ4A 3KLWA 2DUDA 2YV5A 1GM5A 1HNZL 1E1TA 1Q7YC 1HZAA 1D8LA 4DR3Q 4DK3C 4QGUA 1IBLQ 4DV4L 2AKWB 1W2BA 1B8AA 1A63A 1HZ9A 3HOZG 1PV4A 3GTOH 1HJPA 1HNWL 1HNZQ 2ZTCA 3F8TA 3T1HL 2OQ0A 1LYLA 4DV4Q 1TWAH 1FVIA 2IX0A 1HNWQ 1G51A 2JA7G 1YEZA 4AYBE 3RN2A 3K7AH 4GOPA 3T1HQ 3G6EA 4JBKA 1E1OA 2ZM6L 1PFSA 4DPGA 3I4MG 3E0EA 1VQ4A 1YVCA 2L15A 1YJWA 4L5TA 4BBRH 4A3CH 2CQOA 4GLAC 4DUZQ 1NMFA 2JJQA 1IBKL 5IP7G 1FL0A 1WI5A 3Q8DA 4NB3A 5EAYA 1AH9A 2ZM6Q 1JT8A 1Q81C 4OWXB 1VQ8A 1X65A 3G48A 4HIKA 1UE7A 2Z6KC 4A4IA 2N78A 2HT1A 3H0GG 5J3BA 3CD6A 4DV7L 1IBKQ 1GKHA 1KL9A 1NE3A 1Y1VH 2EIFA 4XIGS 4EX5A 4UY8C 2RHSB 3S1RH 2BH2A 3HOUG 4DV7Q 2PNHA 2JEAI 3PV0A 3PIPA 3HFZB 4A3LG 4HIOA 1EIFA 3ULJA 4JOIA 2A8VA 1EIYB 5C3EH 3F2DA 3PF5A 1N33L 2E2HH 3W5OA 2CKZB 5M5WH 2VW9A 4OWWB 4BA1I 2OTLA 1K0RA 1X3FA 3UDGA 5IYBG 2R92G 3J7ZC 4DR6L 1MJCA 4R4CA 4WJ3M 2K75A 3JAMc 3G71A 2KHIA 2XGTA 2IHEA 4APVA 4JV5L 1HZBA 1VQCA 1K8AC 1ASZA 3KJPA 2R6GA 4P71A 4RMFA 4DR6Q 1XNQL 3W1GA 1VQKA 2F4VL 2ASBA 3PF4A 3HOZH 1E7ZA 1UE1A 4JV5Q 1AE2A 4DV6L 1CSPA 3RLOA 1EFWA 1MJEA 2Q2TA 4L5RC 1XNQQ 2F4VQ 3RZOH 1IL2A 1WOCA 5GQOA 4LNQA 2AHOB 4KHPQ 4UP9A 5FLMG 2JA7H 3HOVH 4DV6Q 2K52A 1LTLA 2HQLA 4HJ5A 2HHHL 2UUBL 3VDYA 3EN2A 1TWHH 2OCEA 3ER0A 4JI6L 3H3VI 3MXNB 1Q1EA 3I4MH 3BZCA 3NEMA 4JC0A 4C3HH 2CFMA 5C44G 4DR4L 4OO1I 3GD7A 2HHHQ 4DR5L 4HIDA 2UUBQ 1KAWA 1OXVA 5IP7H 4JI6Q 3S14H 1XPRA 3UDXA 1SROA 2JEBI 3PGZA 2BA0A 5M5XH 2I5MX 4HJ9A 1OXSC 3GTLH 4DR4Q 4GNXB 3PUYA 3H0GH 4DR5Q 1VQ5A 3CCRA 2WB1E 3ERSX 2D0PA 4TVAB 3L2PA 1X3GA 1UWVA 5JEAG 1YJNA 4DV3L 1VQLA 5H1SE 4A3EG 1C9OA 3CAMA 1MKHA 3KF8B 5GAHC 4GKKQ 2JA9A 3HOUH 1JJGA 4A3LH 1A0IA 4R4QA 4DV3Q 2E5LL 1SE8A 1G6PA 4KI0A 4R4TA 4MTNA 4OO1G 3E9HA 1LM0A 1PH6A 5IYBH 1L2FA 2R92H 4OXPA 2E5LQ 3TREA 4JI0L 4LF9L 4LFAL 1L1OB 1K73C 3RR5A 4OWTB 3L7ZC 1A62A 4JI3L 2LXJA 4DV5L 4O2DA 1T9HA 1VQGA 3STBC 1G291 5DLQE 4X64L 4DR1L 1PH1A 4LFAQ 4JI0Q 4LF9Q 4IOAA 2OTJA 4A76A 4YWLA 4JI3Q 4DV5Q 2HIVA 3GTPH 3K0XA 4AYBG 2CWAA 3K80C 3LGJA 4DR2L 2RHQB 3PCOB 4MNOA 4P74A 3HOWG 5GADC 3F2BA 1FJGL 3KFUA 4JBJA 5FLMH 3J81c 4GS3A 3HOXG 3DM3A 4YWKA 4A93G 4DR2Q 1VQAA 1Z47A 3ULLA 4GN3B 2I0QA 5JJKA 2K5NA 1FJGQ 1N36Q 4IPGA 5C0XI 5C44H 2CWPA 1Z9FA 2Y0SE 2N8NA 4IO9A 1JJCB 2NVQH 2UUCL 4UP8A 5LMNL 1KD1C 4ME3A 3NBHB 1B70B 2K14A 4A3MG 3PO3G 3F1ZA 3FHWA 4DV1L 4R1JA 4AH6A 2UXDL 4LF5L 1J5EL 5LMNQ 4BBSG 1SRUA 1QVCA 3HKSA 4IJLA 4LFCL 4QQBX 4A3EH 3CCMA 1YIJA 3AFQA 4TQUS 3CCVA 2YYZA 4DV1Q 4POGA 4LF5Q 1J5EQ 1K3RA 4UPAA 4DUYL 4JYAL 1YHAA 2VUMG 2QA4A 5JEAJ 4B3ML 4LFCQ 4GKJL 3OTOL 2Q2HA 5C0XG 1X55A 2Z6KA 1OXTA 3PUVA 4JYAQ 4DUYQ 1PYSB 3OYYA 2B3GA 1YITA 1HNXL 4B3MQ 4GKJQ 2R93G 5BR8L 1SFOH 3OTOQ 3J81j 3PUXA 2QEXA 2EQSA 4GOPB 1KQSA 1O7IA 1HNXQ 4PZ7A 5BR8Q 2YTXA 1OXUA 3J81i 4A3DG 4YHHL 1X6OA 2IX1A 3KDFA 3HOWH 2A19A 5IYDG 4JI7L 2ZTEA 4JI5L 1PVOA 2YTYA 3BJUA 1YJ9A 5C4XG 1V9PA 4P75A 1Y14B 3E9IA 4FDBA 4YWMA 4A3JG 1XMQL 3HOXH 1N33Q 2VL6A 4A93H 4A3FG 2Q2IA 4JI7Q 4P72A 4JI5Q 2K4KA 3ICEA 1R9TH 3KYHC 1HH2P 3JC66 1L0WA 1X3EA 3EBEA 4IFDI 5JJIA 2RCNA 3I4OA 3SGIA 1XMQQ 3KF6A 2B63G 4HJAA 1FGUA 2Z0SA 4JI1L 4A3MH 3PO3H 3OW2A 3HOVG 1XPOA 2NVTH 4XTCS 4YCWA 3KDFB 5GAGC 4LFBL 4BBSH 3S1MH 4BXXG 2OQKA 1I3QH 1VQPA 1YI2A 1Y1WG 1DGSA 3ZJYC 3A74A 4JI1Q 5IP9G 3I55A 1N8RC 3S17H 2QGQA 1LUZA 1NJIC 1V1QA 1KC8C 4QJFA 1I94L 1VQ6A 3F2CA 4X66L 2BH8A 2ES2A 3M4OH 5K36G 2VUMH 2PMZE 2C35B 5HY6A 3S15H 2FXQA 3KF6B 1BKBA 1KRTA 5M3MG 5GAEC 4IFDG 2RF4A 1P8LA 1I94Q 3AEVA 4GLXA 4X66Q 3M7NA 1QVGA 4X62L 2OWOA 3DLLA 3CCJA 2UXCL 2ATWA 4GN4B 4GN5A 3KOJA 3W1BA 2R93H 1X56A 1UEBA 1MIUA 5C0XJ 3K7UC 4HIMA 3HKZE 1VQBA 2WAQE 4X62Q 3U4ZA 4DNIA 2UXCQ 4DK6C 1KHIA 3U50C 3PUWA 1WYDA 4LUZA 5C4JH 4POFA 4LF7L 4L5SA 2E8GA 1EQRA 1RL2A 4R4OA 2ZJPA 2D0OA 4A3DH 4LUVA 5IYDH 1VQHA 3GTQH 2JA6G 4A3BG 1D7QA 5C4XH 2UUAL 3I56A 4JCVE 2NVXH 4A3JH 2UXBL 1PH3A 2JQOA 3GDEA 1ASYA 1N32L 3D0FA 3T1YL 4LW1A 4A3FH 1XMOL 4EQ5A 4AIMA 2AWNA 2WP8J 3AYHB 1AE3A 4QY7A 3ULPA 1S40A 5ELNA 3CPWA 2UUAQ 1I6HH 1QUQA 1K83H 2K5VA 2K5HA 3M9BA 2B29A 3T1YQ 1N32Q 1S3OA 1NTGA 2B63H 5IE8A 1XMOQ 3RLFA 2Q2UA 1EOVA 4IPHA 3FKIG 1VQ7A 1V43A 4LF6L 4X64Q 4YCVA 3CP0A 4IJHA 1E3PA 1U0LA 3A5UA 4DR1Q 1EYGA 1XNRL 1C0AA 4BXXH 4B3SL 3L0OA 1Y1WH 4JI4L 2GVAA 5IP9H 5M5YH 4ALPA 1PH5A 4LF6Q 1QZGA 3NENA 1BBUA 1TWGH 1KIXA 1TWCH 2YTVA 4NPSA 3UE1A 1XNRQ 2PQAA 3AFPA 2VQEL 4JI4Q 4OX9L 2JA8G 4Y52H 3RLNA 3U4VA 4R4IA 1QUQB 3TQYA 3CCSA 1JE5A 2K50A 5M3MH 2KENA 1CKOA 2MFIA 3NELA 3H3VH 1RIPA 1YZ6A 1VQNA 2VQEQ 3S1QH 3UDIA 2IHFA 4OX9Q 3S1NH 1S72A 1VQ9A 3J80i 4JBMA 1BVSA 2H5XA 2UUCQ 4RG1A 3I7FA 5FJ8G 1OTCA 3HOYG 4JI2L 2NN6I 3KJOA 3UE0A 2E2JH 1IXRA 2V1CC 4MZ9A 3D31A 4IFDJ 1VCIA 1VQIA 1GO3E 3I4NG 2NZOA 1JJ2A 1IBML 2UXDQ 1UE6A 1TXYA 2JK8A 2HIXA 5C3EG 1YBYA 4JI2Q 1Q8KA 2PQAB 4BY1G 1N34L 1CSQA 1PH8A 1IBMQ 2KHJA 3PUZA 1J6QA 3CC4A 1GD7A 1VQJA 4K0KL 5IYCG 2LSSA 3M4QA 3CPFA 1XPUA 4A3IG 2JA6H 2MNAA 4A3BH 2GN5A 3AQQA 3CC7A 3G4SA 1N34Q 3TS0A 3K81C 1WJJA 3GO5A 3TEHB 4K0KQ 2NVYH 3CF5A 1U5KA 1VQFA 4L5QA 2AWOA 4DUZL 4BY7G 4GOPC 2NN6G 1YNXA 4DAYB 2BA1A 1WFQA 3RNUA 1I5FA 3CXCA 5JJLA 3CCQA 2YU9H 3A0JA 2WFWA 4QL5A 3FKIH 1I50H 1SLJA 1NBWA 2ALYB 1E22A 1PA6A 5HGQA 2JA5G 4KHZA 4YHHQ 1VQMA 4DV0L 1A8VA 3TS2A 4JI8L 3A5ZB 4PMWA 3S16H 2UU9L 1HZCA 4J15A 3RZDH 3UDFA 1OXXK 3K8AA 4DR7L 3B6YA 1W3SA 2EXDA 4C3JH 2VS1A 3STBD 2JA8H 1PHJA 1EUJA 2KCTA 3FP9A 4JI8Q 4DKAC 4DV0Q 3M3YH 2WB1G 4UP7A 2UU9Q 2MO0A 4KLKA 5GROA 4LF8L 4DR7Q 1Q12A 4JOIC 3CMAA 3GTMH 3HKZG 4PZ8A 2WAQG 4YCUA 5FLXc 5LMNW 4DAMA 3CCEA 1IYJB 1SN8A 2F52A 2ID0A 5FJ8H 1IZ6A 2VQFL 3HOYH 2VNUD 1KXLA 3PO2G 3RN5A 3CMEA 4JBWA 3EIVA 4LF8Q 3CCLA 2KBNA 4Y7NH 3I4NH 1YHBA 1M1KC 3PSIA 4BA2I 4LFBQ 2GVBA 4NXNL 2VQFQ 5M3FG 4IOCA 4C2MH 4YY3L 4BY1H 4LF4L 1HR0L 4PZ6A 2ZJQA 2I5LX 1WCMG 2E2IH 1Q1BA 4X6AH 4KHPL 4OONA 4NXNQ 5IYCH 4GNXA 4A3IH 1K8GA 4GNXC 1QZHA 1YHQA 1VQDA 4YY3Q 4DV2L 3U58A 2A1AA 3H15A 1HR0Q 1C7YA 4LF4Q 2R7ZG 3GTGH 4HJ8A 4A3GG 5E7NA 1H95A 3I2ZA 4B3TL 1B7YB 1VS0A 1X9NA 3CQZH 3S2HH 4A3KG 1EWIA 4BY7H 1PYBA 4DV2Q 1E24A 4X65L 3J80c 3PIOA 3S2DH 1NMGA 4B3TQ 4LUOA 1Q86C 2VZAA 2KCMA 1KRSA 1P16A 2VY3A 1GVPA 4P73A 4X65Q 4QIWE 4GLVB 2CCZA 3CW2C 1M90C 1CKNA 4IPDA 4LF7Q 4JG2A 4GKKL 4B3RL 1Q82C 2JA5H 2Y0SG 1L1OA 3MEFA 4C3IH 1QVFA 1NY4A 1L1OC 1X54A 3TRZA 1BBWA 1TWFH 2MO1A 1PH2A 2MQHA 2LXKA 2N49A 2R7FA 4LWCA 3WWVA 4B3RQ 2JE6I 2UXBQ 5IT9c 3IRBA 4IPCA 4BBRG 2AMCB 2NZHA 4A3CG 1JB7A 4H02A 1VQOA 4O0AA 2XTIA 4PG3A 3JAMi 4AQYL 2ZTDA 1SMXA 2I5HA 2F3IA 3BU2A 1EQQA 1CKNB 4HJ7A 3GTKH 1K9MC 3J7A5 3PO2H 3M85A 1XJVA 4A75A 1Q46A 4AQYQ 5ELOA 1Y1VG 3S24A 1CUKA 2PI2A 5AJ3L 2D62A 2N3SA 5M3FH 4B3SQ 2IY5B 5LMUL 1PH9A 3M4PA 1WCMH 1XTDA 1CKMA 5IY0A 4NXML 3GTJH 1N9WA 1PH4A 5AJ3Q 5IWAL 3BZKA 1UE5A
chains in the Genus database with same CATH superfamily
5LMUQ 4EQNA 1HR0W 1JMCA 4A3EB 3T53B 2W9BB 3CCUA 1VQEA 1RDPD 4CJ2C 2YV5A 3IL8A 1GM5A 1UC8A 1ONLA 3FKIA 1HNZL 1E1TA 4R8NA 1I50A 4PV1C 4LFAH 1JORA 1IBLQ 4Q45A 1STBA 1B8AA 1PRTC 1XMOH 1HNWL 4X64H 4DR1H 3T1HL 4F87A 2VR1A 2OQ0A 3G6VA 4CC6A 1TWAH 2W71A 1FVIA 1F2YA 3QWNA 4QF4A 3KTMA 1DOKA 1G51A 2QDBA 1FR3A 3K7AH 4GOPA 2I87A 3NGDA 1E1OA 4Q43A 1PFSA 4E6IA 4JPBW 5FKAC 1RJPA 3RFCA 3H3VH 2JJQA 1O7LA 1FL0A 1WI5A 3Q8DA 3MAQA 5HV6A 3OWEB 4ID6A 3I3CA 1X65A 3O13A 1TS2A 1PFMA 1A2TA 2Z6KC 2N78A 1WTQA 2F0GA 2HT1A 5LMNH 3K5LA 1GKHA 1KL9A 5DM63 1HXYD 1Y1VH 5DAUA 4PQXA 2E2IA 3M3YB 4EX5A 2BH2A 4DV7Q 4O2AF 5L1JA 4A3LG 4HIOA 2NVTB 4F4YA 2YCHA 3KLRA 4XZ3B 2A8VA 3HEJA 3GTGA 5KFCA 2RSOA 3GP7A 2VW9A 3CQZA 3I90A 4ZRZA 4M8AA 1T5EA 1KBLA 1K0RA 3UDGA 3I4NB 2VPSA 3SEBA 3HS0C 3J7ZC 2EXZA 3N44B 1MZBA 3K5OA 1O75A 2NU6B 3OSOA 2VUMB 3SDZA 4M1UB 4BY1B 4I7AA 1CZGA 3KLSX 3KJPA 4P71A 3HP3A 1XNQL 2XCAA 2ASBA 4J9RA 1EZ6A 1PZKD 4JV5Q 2BCOA 4DLKA 1EFWA 2L5TA 1TWFA 3OSPA 4NKLA 1IL8A 5GQOA 2AHOB 4U673 4YHHH 4UP9A 2JA7H 2HHHL 2K52A 1EQTA 2HQLA 3DUZA 5C4JB 2WB1A 3GIJA 3ER0A 3H3VI 3KK7A 1Q1EA 3NEMA 1D1KA 4C3HH 4MV6A 4OO1I 1XMQH 5FPOA 4DR5L 5TSSA 1OXVA 5IP7H 5C4XB 1DD2A 3PVXA 1SROA 4ECYA 1PRTD 5KFKA 2KSWA 3IFDA 1AEXA 2D0PA 1IKLA 2M9VA 2NBFA 4JI1H 1MD2D 1STNA 1HUNA 1K83B 1C9OA 3CAMA 1MKHA 1ESRA 2WB1B 4LH7A 4DXGA 3HG9A 1L2ZA 3HOUH 1JJGA 4EBEA 2VXWA 3NK9A 3L4JA 3NWSA 2XWBB 2R7ZA 2KCCA 3OW7A 4R4TA 1K1SA 3E9HA 1LM0A 1VMPA 4LF4H 5KKNB 1HR0H 1L2FA 1RTNA 2R92H 2E5LQ 3ORRA 4LF9L 2HGSA 5C1PA 5EWEA 3GV3A 1A62A 4JI3L 4X62H 3P75A 1T9HA 2B2UC 4O2DA 1JB3A 4KD3A 5IGGA 3BG3A 3QOLA 1S68A 4N8X1 2L9HA 2R8IA 3A7AB 4RAUC 3I8ZA 4DV5Q 1SE4A 5BN3A 3DMUA 3HOWG 4DR2L 4EFBA 3PCOB 1GLVA 1PX2A 1KJ8A 4JBJA 5FLMH 3J81c 2KEDA 4GS3A 3DM3A 4A93G 3M7GA 1Z47A 3F2UA 2I0QA 2UUAH 3VR4A 1H9SA 5KFBA 2ALZA 1PFNA 2N8NA 4G7OC 1CM9A 4ME3A 1KJIA 1ZQ7A 2K14A 4A3MG 1H9KA 3FHWA 3S9WA 4DV1L 2HDMA 4AH6A 4P2CB 3K5IA 3QFFA 1J5EL 1G6ZA 3HKSA 1EY6A 1B3AA 2WIIB 3CCMA 1YIJA 3AFQA 2YYZA 4POGA 2R7MA 2OT2A 4HTHA 5E4WC 2W6OA 2V4DA 4B3SH 4HR7A 2E2HA 2JSOA 1H9SB 4JYAL 1I4QA 2QA4A 4LFCQ 1IKMA 3H4BA 1DXMA 2AQ2B 2HVRA 4WORA 1KLGD 4YJ3F 3OTOL 4CDFC 4QWBA 2LMCB 4GZYC 1YITA 4XYMB 5K2MA 1TR5A 2P5ZX 5T14A 1SFOH 2F0DA 1QB5D 1V1OA 3J81j 2FLPA 2QEXA 2W6QA 1SCUB 1B1ZA 3KHRA 2PNRC 1RTOA 1NNXA 3EVQA 1HNXQ 4OHJA 5EBDA 2YTXA 5BR8Q 1H9MA 1NAPA 4CKBA 3J81i 4IWYA 4HR7B 4HCEA 5FO8B 2E2HB 2JP1A 1WR2A 4DR3H 4GC6A 2JEFA 3I70A 3JRWA 4JI5L 4O1NA 3MZ5A 2YTYA 1YJ9A 3C2PA 5JPNC 4YWMA 1N33Q 4JK1C 5KFWA 1TQOA 1I4PA 4CDDC 4A3FG 4JI7Q 2O2LD 4P72A 2K4KA 2R7KA 3KYHC 5L1IA 2C22A 3K5MA 4YAKB 1E2ZA 3I4OA 1E0BA 3KF6A 5ELCA 3I12A 2Z0SA 4YP3A 1Y8OB 5KFZA 3FDTA 2F0SA 4BBSH 1M6VA 3I4LA 1EY7A 5D65A 1LT5D 3I4MB 3S2DB 3I55A 1N8RC 4XT1B 2QGQA 1LUZA 3MR2A 1W6KA 5FLXE 1KC8C 2C28A 3PW4A 4EGVA 1VQ6A 4X66L 4DV0H 3S14B 5EKIA 1A3TA 5D1OA 5KFYA 4MTDA 3KF6B 1GXDC 3GQBA 3VR5A 5C0XH 4IFDG 2RF4A 2CW0C 2AUKA 4NDXA 4MN3A 3CCJA 2UXCL 4GN4B 5FK9C 1VBHA 1X56A 2BE5C 2IMWP 4HIMA 3HKZE 3HRZC 4IUPA 2FMAA 2Q8IB 1HPCA 5L9XA 1BDOA 3NSWA 5E1FA 3Q8SB 2VQFH 5CB4F 3GTPA 1A3VA 2E76C 4POFA 2WAQB 2F0TA 3NHHA 4R4OA 4A3DH 1UEAB 4LUVA 2EVBA 3K0YA 1BXRA 4A3BG 1EFID 4YY3H 2B2YC 2FJZA 3L4KA 5KFVA 2UXBL 4DL6A 5IT9L 2JQOA 1A9XA 4YIJA 5M3FB 3T1YL 2AGOA 2XRSD 4JUZA 1XMOL 2AWNA 4QY7A 1KABA 1AE3A 3ULPA 3I72A 1S40A 3CPWA 1I6HH 4DV2H 4B3TH 1N32Q 2B29A 2VUGA 1HCZA 1S3OA 2RVLA 1AN8A 1F2LA 5D3IB 2FPPB 5FLXW 2FLLA 4TV8F 1TIID 1B33N 2MCTA 3HOVH 1EYGA 1E3PA 3K3VA 4FU0A 4XQQA 5KT4A 3EROA 4BXXH 4K6DA 1NCVA 3L0OA 4JI4L 2A68C 1EY5A 4RKLA 1HHVA 2NUAB 3BJYA 1K1QA 5CYUA 1SDFA 2ZXPA 2AGQA 2B2TC 2JA8G 5BN4A 4Y52H 5K36H 4LSAA 2K50A 4KKTA 5G3LF 2KENA 2L55A 3WO0A 1TWAB 1IOWA 1B53A 4IN3A 2O5JC 2VQEQ 3S1NH 3BZDB 3EFXD 1S72A 3KBXA 2H5XA 1ILQA 2QF7A 2UUCQ 3K7AB 3HOYG 1S0NA 1V8QA 4IFDJ 1HQRD 2EPBA 3GV5B 3GV6A 5I6WA 1IYUA 1I7LA 2UXDQ 5COYA 1HUMA 3Q8PB 4ECVA 4JI2Q 5EWFA 4U7CA 5JQWA 4G3IA 5JJZA 3NTKA 4K2LA 2B2WC 1J6QA 3K58A 2C9OA 3SHLA 2N55A 5CV7A 2DZDA 5ELFA 1N34Q 4IUNA 4ZYSA 1R9TA 1CFMA 3LWEA 2EYPA 2BE5D 1MSHA 4MHEA 1WD0A 1VQFA 1BCPD 4BY7G 1FJGH 3H6MA 5KGUA 2BA1A 1WFQA 3JZIA 2RSNA 5JJLA 1B50A 3GIPA 3KALA 4QL5A 3FKIH 1I50H 3G7LA 3T5JA 1GSAA 1HNZH 3OPOA 1U4MA 3HOXB 5KYLA 2JA5G 2EJMA 3QZ8A 1R9TB 1HNWH 5F9LA 4F7XA 3LNNA 4J15A 3T1HH 1IYVA 4MV4A 3K8AA 4DR7L 1JWUD 5KFMA 3IG0A 4Z9CB 1NUCA 4J8QA 3M3YH 5KFGA 1BR9A 1VF7A 1HRJA 2MO0A 2R93A 2M05A 1Q12A 3CMAA 5FLXc 5KFHA 4DAMA 1G8ZD 5C5JA 3A8JE 2F52A 1KXLA 5FJ8H 1IZ6A 2VNUD 3M9MB 4LF8Q 3CMEA 4JBWA 5ELEA 3RBDA 4Y7NH 3I4NH 5KFQA 2A68D 4BA2I 3M4OB 4LFBQ 4NXNL 3R3OA 4IOCA 3K3PA 5KG5A 1IOVA 2A6HC 4BY1H 4LF4L 2HVQA 1HR0L 4PZ6A 2ZJQA 2I5LX 2E2IH 2AGPA 4X6AH 2DPJA 2R92A 2NVXA 2D2CC 3NTIA 2R93B 4U6PA 4NMZA 1YHQA 3U58A 2A1AA 3H15A 1H95A 4QIWA 4A3GG 1UAPA 3GTGH 3I2ZA 5KG7A 3BG5A 3HOUB 3CQZH 1TY2A 2B63A 4A3KG 2HDLA 2FK1A 1E24A 1E4FT 2XIGA 4ZAIA 4WRDA 1EZ1A 3UI2A 2UVVA 1KRSA 4F50A 1JKJB 1DOLA 1F9SA 3EPIA 3RUZA 5EQ0A 1Y1WA 1A15A 4X65Q 1SJHD 2R92B 4UCSA 4LF7Q 1LLRD 1TT2A 3NQIA 3NUCA 4KN4C 1TWGA 4B3RL 4UDUC 4DL2A 4FXGC 1TWCA 2I8CA 4J9QA 4FS1A 1I7NA 1L1OA 1SAPA 3BVZA 4QIWB 4YBZB 1L1OC 1TWFH 4J9OA 1LACA 1PH2A 2MQHA 5CBEE 3WWVA 1A3UA 1Y8PB 2B63B 1Y69U 5D1PA 1PRTF 3Q0AA 3IRBA 4IPCA 2NU8B 2HHHH 2DJFC 4XDXA 4A3CG 1XWEA 5LOVF 1VQOA 1R4PB 2XTIA 2YL2A 4L63B 2ZTDA 3VPDA 1GSOA 1Y1WB 3NTHA 1C8CA 1B3QA 1I94H 3D6WA 3BU2A 1ENFA 4C5CA 4DR5H 3OOCA 2IA6A 3RJ0A 2A6ED 1CT1D 4F8MA 1JDEA 1TWCB 4ECRA 1Q46A 3JSLA 3S24A 4HCSA 1CUKA 3IAYA 4ED8A 1S03G 2IY5B 3ETHA 2R7NA 4BS9A 1QE6A 1XTDA 5IY0A 4NXML 3GV7B 2J4XA 3NBHA 2XD4A 3J81L 5IWAL 3BZKA 2F0QA 2NVYA 1SBBB 2R7ZH 5F9NA 2IT1A 2HJWA 2R7DA 2ZJRA 2PI2E 4DR3L 2SCUB 1S4ZA 4LMQD 4DAPA 4EQOA 1D8LA 4DK3C 4DV4L 2A6HD 1W2BA 1U4LA 4MTKA 1SFOB 1E2WA 4MA0A 5KFLA 3CU7A 4NW2A 1SNMA 1V1PA 2IX0A 1K8OA 4LF6H 4AYBE 4DR2H 5IT9W 2EE1A 1EYAA 3D8GA 2W8KA 1VQ4A 3GTMA 1YVCA 5AFWA 1YJWA 4L5TA 2SNMA 1ESFA 4GLAC 3AU7A 5EAYA 5F2DA 2ZM6Q 5KFSA 4OWXB 2SDFA 3G48A 5HURA 3S16B 1LTBD 1IBKQ 5KG6A 4C2MA 2YRWA 1V1PB 2EIFA 1JICA 1HFGA 5KFPA 1J5EH 1CI3M 3PV0A 4XT3B 3K5NA 3R8BA 3GTMB 1XX8A 3MVVA 4JOIA 3ULJA 1S0OA 5C3EH 3F2DA 4BBSB 1N33L 4BWGB 1B44D 3W5OA 2E2HH 4RNMA 3RF2A 2OTLA 4ME6A 3BDLA 5IYBG 3T56B 3OTOH 2N88A 1F9PA 3T5LA 2K75A 3TMEA 2KHIA 2XGTA 2IHEA 3UQ8A 1ASZA 2UVUA 2WKCA 4RMFA 4DR6Q 3W1GA 2EJFC 3NE5B 2F4VL 3PF4A 3HOZH 1CE8A 1KNEA 2A5HA 3T1YH 4DV6L 3H09A 1CSPA 1C4QA 2K5QA 1JC7A 2R82A 4FBTA 3AB9A 1WOCA 1WTOA 4ME5A 1CHQD 2YZMA 4ZHQF 4DN4M 2DY8A 3EN2A 3L9AX 3H20A 4JI5H 3I4MH 2C2EA 2CFMA 4G7ZC 2J9GA 3GD7A 2PW7A 2UUBQ 2YS7A 3IFTA 4JI6Q 3S14H 1XPRA 1SMYC 3UDXA 4J6HA 1OXSC 4DR4Q 3VYTA 4C3IB 4GNXB 1LO5D 4O3RA 5EGTA 5KG2A 3DWAA 3H0GH 1VQ5A 4RHSA 4ABNA 1I6HB 5KNBA 3T16A 4DV3L 5H1SE 4A3EG 1WCMA 3KF8B 3UFXB 3PN1A 1TS4A 3HOVB 1BJTA 2CQAA 1S5ED 4ECXA 1F9RA 2F0VA 1SE8A 4KI0A 1JOKA 3D6CA 2F0KA 4MTNA 4X66H 4N9TA 4O42A 2JYOA 2L11A 2VOBA 4H44C 1KTKA 3N8DA 5C6AA 1ZHQA 5I4DA 2GA4B 4JI0L 5EZYF 3MR5A 3FDSA 2DNEA 3CVZA 2UXCH 1JCKB 3GTOA 4LFAQ 2XIWA 3N43B 4A76A 5EKLA 3S1NB 1RK6A 2ASJA 3GTPH 5EBCA 2RHQB 4TRDA 3DEPA 4UAIA 3F2BA 3Q24A 1FJGL 3KFUA 2DPIA 2EYFA 4RZRA 1S5FD 4ZLTF 2R84A 2F0WA 2K28A 3A54A 1JE4A 4IPGA 5C44H 3MFHA 2UXBH 1Z9FA 5ELBA 3R2IA 3C46A 4EBCA 1KJQA 2RGVA 2F3VA 3J81E 2NVQH 3LMLA 2UUCL 4UP8A 5DG9A 3V6HA 1D5ZC 5CC4A 5DQHA 3EPGA 3N40P 5JOBA 1EY9A 4UCUA 5DQGA 5KEEA 4ZKBB 3PR5B 2UXDL 3P1HA 5LMNQ 1SRUA 1QVCA 5CV9A 2CZGA 3OHBA 3CCVA 4IRDA 4LF5Q 3EA6A 4BBRB 4JI4H 3FKIB 1I50B 3RGZA 4UPAA 4DUYL 2VUMG 4B3ML 4GKJL 3TZUA 1PRTB 2Q2HA 3G6XA 4I7ZC 4B9XA 2Z6KA 3C1EA 4OO1H 1SMYD 1ML0D 4CGYB 4Y8VB 1J8IA 4FVMA 1O7YA 4C5AA 2XCLA 3GQCA 1B4OA 3S1RB 1VF5C 2QDLA 2JEIA 2NU7B 4GOPB 3BAAA 2ICIA 2IPKD 2KHSA 1HA6A 2JEJA 1EUCB 1L0XB 3NXWA 2IX1A 1DV2A 1S97A 3KDFA 3J81W 1TWHA 4Y7NB 5C4XG 1V9PA 2QKIC 1BCPF 4XQJA 4RGOS 2V58A 3HOXH 2MPMA 2Q2IA 2YZNA 1R9TH 1AZQA 3JC66 4IUUA 1L0WA 3WDNA 2E2IB 5FLXL 4IFDI 3SGIA 1XMQQ 2RKSA 3MEHA 3GTLA 3SE0A 1GUSA 1ET6A 3RZOB 3GTGB 3PO3H 4XTCS 3KDFB 4G4KA 5GAGC 2Z9HA 3CQZB 4LFBL 2PQEA 3RAQA 1TWHB 1VQPA 2QEJC 2XGPA 1DGSA 5DQIA 4JI1Q 3TP8A 3G8CA 1JQYD 1V1QA 1VKZA 1I94L 1I4HA 2SNSA 3HKZA 1WTHA 3A55A 1RK5A 2BH8A 1HTLD 3M4OH 3TZDA 3CHBD 1KLUD 2C35B 4PWQA 4EGQA 2KOLA 1KRTA 2BQ3A 4DR7H 3K59A 1ICFB 2HD3A 1GGOA 3Q6SA 3U9TA 3URYA 1RJRA 1TWFB 2R93H 3KOJA 4TV9F 1K0SA 3VR6A 1VQBA 1TKWB 2LS01 2LKVA 1I4GA 4X62Q 1KJJA 2V59A 4DK6C 3U50C 4GC7A 3K57A 1EWCA 3HKZB 4LF7L 3KAKA 2ZJPA 2D0OA 2W7OA 2BQUA 3GIMA 4NXNH 3FPUB 1VQHA 5IYDH 1WSCA 4YR0A 1STYA 1D7QA 4MAMA 3I56A 5LL6S 2NVXH 1RYRA 4A3JH 3LWBA 4CJ0B 1PH3A 1ASYA 4UFZA 3IN5A 3A8IE 2B2UA 2F0UA 5EOYA 3DEOA 2UUAQ 2EYHA 5ELNA 5L1LA 3M9BA 2B63H 5IE8A 2WKDA 4DL3A 4IPHA 2R7ZB 4LF6L 3BVMA 3CP0A 1U0LA 1S5BD 2XNAC 2MUYA 5LP6F 4ECQA 2K04A 5I2YA 1Y1WH 5IP9H 4JVZA 2DWCA 4EYHB 1TWGH 1T3NA 1KIXA 1TWCH 2YTVA 3LX0A 4MIUA 1XNRQ 4B3RH 1QNUA 3KAJA 4OX9L 4KV6A 5CBAE 1SYFA 3T5KA 2R7LA 5J22A 2B8GA 5M3MH 4CKCA 4NP5A 2AU0A 3NELA 4ED2A 1VQNA 3S1QH 4J0MA 2CW7A 4JBMA 3J80i 1BVSA 3KJOA 3D31A 5JEAH 4WJWA 2VB3X 1GO3E 1IBML 4ZUJA 1UE6A 2JK8A 1BNCA 3PMFA 2M00A 5JAVA 1SYEA 3BQ0A 2KJXA 2O5IC 1SYCA 2R3ZA 2XRQD 2KHJA 3CC4A 1GD7A 1VQJA 4K0KL 2JA6H 2MNAA 3G4SA 2J6SA 4R8IA 4NXMH 4O3OA 4R8UA 1IW7C 5IWAH 4Q0FA 3TEHB 2EZVA 1QNKA 2NVYH 3GIDA 3JRXA 4L5QA 3KUPA 4XXEA 2F0MA 2NN6G 4RWSC 1EU4A 4IALA 5C3EB 2H1EA 4IUTA 1KDCA 3CCQA 2YU9H 3HOWB 2FKLA 3A0JA 2C00A 4IWXA 4O3QA 1SLJA 4RAYA 2R8GA 1PA6A 4EVOA 5HGQA 4DV4H 4A93B 1STAA 2I80A 4KHZA 5KFIA 1A8VA 5D14A 3D4WA 2K32A 3S16H 2UU9L 4R8UB 3RZDH 2KQ3A 3B6YA 1SEBD 3HOZB 4LAAA 4BWSC 2C2RA 4DV0Q 3FP9A 4JI8Q 4MV7A 2WE6A 4A3MB 3H0GA 5KRUA 4IR1A 4LFCH 2DNCA 5GROA 1TS5A 4IURA 3GTMH 2EYLA 2WAQG 3D4DA 3S1MB 4RB3C 4XYLB 4O4HF 1I4XA 2R8JA 3SR1A 5EJWA 1FKAH 3RN5A 5T1IA 1SE2A 3CCLA 1GUGA 5EWGA 1YHBA 3QR8A 1U4RA 2GVBA 1MI2A 5IIFA 2VQFQ 5M3FG 4C2MH 3V6KA 2AUJD 3GTQA 2JEGA 4LMYA 3H0GB 5IYCH 4QCLA 4A3IH 2KCNA 4YB8B 4YY3Q 4J9PA 5DLGA 1RJQA 1S9FA 3T13A 1N33H 1XDNA 3MFIA 4JI7H 4ECTA 4LJZC 4DV2Q 3V2TA 3PIOA 2M2LA 4B3TQ 4OIKA 5C4HA 4X3KA 2PN1A 5DGAA 5D1OB 3GTQB 3H94A 5IGCA 2W9CA 4P73A 1FNVA 1VDZA 4FF1A 2B2YA 1M90C 2F4VH 3T51B 4DAVA 5JVLA 2Y0SG 4C3IH 5M9OA 1QVFA 1X54A 4DV6H 1BCPB 4L6TB 3GLKA 1IW7D 5KFUA 4HNUA 2JE6I 1Q8IA 3GTPB 3FVQA 1EYCA 3QB3A 2F0PA 1ZEQX 2AMCB 2EY1A 4ED1A 4O0AA 3JAMi 1I4RA 2W9CB 4HSVA 1MBYA 1SMXA 5EPJA 1JX4A 3J7A5 1SJED 3VA5A 3PO2H 3M85A 1Z2NX 2B2TA 5C44B 5ELOA 1PYWD 4AQYQ 2RGRA 1Y1VG 3HBLA 2PI2A 2NVQB 5AJ3L 2D62A 5LMUL 3M4PA 1SNCA 1WCMH 2F0NA 1CKMA 3X3MA 4DV3H 1MGSA 1PH4A 4M9UA 2K5WA 4HAEA 2AQ1B 1UE5A 4C1NI 4C5BA 1AN7A 2E2JB 5KT5A 1BGWA 1QWYA 1SSOA 3MXGA 4DL4A 3DXJC 4OELB 2ZXRA 1PH7A 1SR3A 1IBLL 4IUQA 1E4GT 3U9SA 3KLWA 2DUDA 3N42B 2AQ4A 2NTTA 3BABA 3RB6A 3OWFA 4AYBA 2W6NA 2EY5A 1HZAA 2ZXOA 2GLTA 4JI0H 3R5XA 2B2WA 2AKWB 1HFNA 4A3BB 1PV4A 3GTOH 3DF7A 2DY7A 2QILA 3F8TA 1HNZQ 2CW0D 3MWDA 1LYLA 5DNFA 5KFDA 2IX3A 1HNWQ 4NLGA 1B6SA 2JA7G 3Q8RB 1YEZA 2HCIA 3RN2A 3T1HQ 3Q2OA 3G6EA 1LTGD 4ZCKA 4I65A 4C3HG 2IWHA 2L15A 4AYBB 4QWDA 4BBRH 5C5MA 5E4XA 1VMCA 4DFAA 2CQOA 2KUMA 4DUZQ 1NMFA 2LFNA 5IP7G 2BOSA 2FPIB 2MHVA 2PBZA 1SNDA 1JT8A 1Q81C 1VQ8A 4IZOA 1UE7A 4A4IA 3MWEA 4KTAA 2UUCH 2WACA 5J3BA 1U4PA 1BUVT 5KNCA 4DV7L 4JV0A 1KNAA 2RDGA 4C3JB 4OGQC 5J2UF 1XXGA 2RDHA 4XIGS 3RGXA 4ECWA 1LTID 4UY8C 2UXDH 3S1RH 1WTWA 3NP8A 3ND8A 3HOUG 3MA2B 3PO3B 3PIPA 2P0AA 4MTEA 4S3SA 1EIFA 3RB4A 2RBMA 2J0TD 5CORA 3HOYB 1GUNA 1PDQA 4DUYH 4JV2A 5C8YF 3BDOA 1X3FA 4B3MH 4GKJH 1S0MA 2K1BA 2R92G 1AZPA 3MFYA 3G71A 1LTSD 4B08A 4JV5L 3K5HA 4ED7A 1PMRA 3R5HA 5BMVF 3RB3A 2EY2A 4YAJB 2R6GA 1RF2D 4QMGA 1FGBD 3WO1A 4IQZA 2O03A 2JA5A 1E7ZA 4K5XA 1AE2A 5KYIA 4LH6A 4I55F 3RLOA 2FFKB 1MJEA 4XYQA 2Q2TA 2JN4A 4L5RC 1XNQQ 3ONAB 3RZOH 1IL2A 5IGEA 5CA1F 4KHPQ 4LNQA 3OUZA 3NQTA 1Z6HA 2MGSA 5FLMG 2EDGA 4UCOA 3VDYA 1TWHH 2OCEA 1G91A 1GJXA 4RFBA 3BYYB 3H4DA 2X6LA 3BZCA 4JC0A 4YQWA 4RH6A 4K14A 5JVH3 4PMBA 2HHHQ 4ILWA 1EIHA 1KAWA 1PTOC 1RHPA 2Z1CA 4QB4A 1EHIA 2NVXB 3PGZA 5C3XA 2I5MX 4A3JB 3W3AA 3GTLH 4QW9A 3E6ZX 3PUYA 4DR5Q 2R87A 4ED0A 3ERSX 4I4TF 2FE3A 3SK6A 3L2PA 1X3GA 3TIIA 4LF8H 1VBGA 1UWVA 5JEAG 1SXTA 4O3NA 1VQLA 4GKKQ 3DWPA 3EYYA 4LFBH 1ICWA 2JA9A 2DN8A 2RDJA 5JVDF 5LYJF 4A3LH 1A0IA 4R4QA 4TUYF 2C5CA 1B04A 2E5LL 1J9OA 1ENCA 5KIXA 4ECSA 2F3WA 4RNOA 1TWGB 4FF3A 1DJRD 1TVXA 5IYZF 3GIIA 4KJOA 1F2ZA 1GUOA 4OXPA 2W8LA 2B2VC 1L1OB 5IGBA 1K73C 4H7BA 4OWTB 1MSGA 1B9MA 2KA7A 4DV5L 2QYZA 1VQGA 3STBC 5M3MB 5DLQE 3OSNA 4LF9Q 4UHVA 2JA6A 3S1QB 5T1GA 4QWEA 4YWLA 4JI3Q 1STEA 2WTFA 4O3SA 2HIVA 5I9PA 4A3GB 2CWAA 1RKNA 5GADC 4LF7H 2KECA 2RQXA 2IP4A 1ZKOA 5KG1A 4YWKA 3ERQA 4CDCC 4DR2Q 1FNWA 2YU9A 2FMCA 2K5NA 1N36Q 4PNYA 4X3UA 3PIP3 2CWPA 2A74C 2L12A 2Y0SE 5EPKA 1N48A 1X32A 1PXUA 1SNOA 4DXFA 2JA6B 2NU9B 1M8AA 3NBHB 3TP5A 1B70B 2RDFA 2MP1A 3N41B 4ZQIA 4CKEA 5I47A 2NVYB 4F4ZA 4BBSG 2J6TA 4EFEA 4IJLA 4LFCL 1DIKA 4QQBX 1QJOA 2EOTA 4DV1Q 1EQVA 2YU9B 5LHY1 2HUGA 2ASDA 1J5EQ 1D5MC 1K3RA 4HEDA 1D1IA 5JEAJ 2Q8TA 1PTOD 5C0XG 4EQPA 1X55A 3J7AF 1OXTA 4HMJA 4KKSA 4OX9H 5CA0F 4JYAQ 1W6JA 1PYSB 4JV1A 1HNXL 3RZDB 1SYDA 5BR8L 3KLSA 3OTOQ 4I50F 4KD4A 5KG4A 1QOHA 3E5NA 2PZWA 4G7HC 2XGQA 4XX0B 5D8DA 1OXUA 1M7JA 1DONA 4MV8A 4K8JA 4A3DG 1IBMH 1X6OA 3HOWH 2W70A 4YR3A 3KHGA 4JI7L 1PVOA 1GHKA 2FLNA 2O4XA 3DWQA 1JDBB 1LT6D 1Q3LA 3WOEA 1STHA 5KFXA 4A93H 4K0KH 5I9OA 4C2MB 1K3BC 5K5PA 4JI5Q 4J9KA 4IRCA 1HH2P 4G57A 5CMDA 5JJIA 1GUWA 1ZYRC 3A8KE 4CDEC 4A3IB 1DCZA 4HJAA 4QUFA 2L0CA 3ITPA 4A3MH 3V6JA 4RB0A 1RODA 3HOVG 2W57A 3MHBA 1XPOA 1B6RA 4YCWA 3PZPA 3T4AC 3JAML 1GYFA 3QJYA 3A56A 3S1MH 2G9HD 1O78A 4BXXG 2OQKA 2K05A 1YI2A 1IBKH 3ZJYC 3A74A 1NJIC 1YNJC 2WYOA 4QJFA 5KNDA 3F2CA 2ES2A 5K36G 4EG0A 5KG3A 2PMZE 2UU9H 3S15H 2FXQA 4UCTA 1BKBA 5GAEC 5LL6b 3SE7A 1P8LA 3AEVA 3MJFA 1CK1A 4X66Q 3M7NA 2OWOA 3HXLA 1E2VA 2ATWA 4GN5A 5E3FA 1QCBD 4RCOA 2A73B 1MIUA 5C0XJ 2ATLA 1TS3A 4RAZA 5DEHA 1LABA 2UXCQ 3PUWA 1WYDA 4ECZA 4LUZA 3K6OA 2E8GA 1EQRA 1RL2A 4KN7C 4CHTB 2FPGB 2A69C 3PO2B 3EQLC 3TDQA 4FF2A 3GTQH 4ED3A 3J80E 3BQ1A 1BOSA 4JCVE 5KX5F 5KT3A 3GDEA 1N32L 2F0EA 3D0FA 4A3FH 2PZTA 3C3LA 4EQ5A 4AIMA 2PVPA 1WCMB 3AYHB 2NTSA 2F03A 2NB0A 4EYIB 2K5VA 2K5HA 3T1YQ 5KFNA 4RB2C 4HNTA 5CV6A 3RLFA 1XMOQ 4PMCA 3FKIG 4X64Q 4DR1Q 4IJHA 1N56A 3Q23A 1C0AA 1FYCA 2PCFB 3NWTA 5G3LD 2Z6BA 2GVAA 4ECUA 3KHLA 1CHPD 2TSSA 2Z4IA 3NENA 1BBUA 3MWYW 1S5CD 1TA8A 2PQAA 2VQEL 4JI4Q 3GTOB 4J9MA 3U4VA 4R4IA 2F0OA 1EU3A 3CCSA 1JE5A 1ZYRD 1CKOA 4IFDH 2V4RA 2G9DA 1Y8NB 2FK2A 1AW7A 3TQTA 1VQ9A 4RG1A 2CHBD 3I7FA 5FJ8G 5L1KA 4JI2L 2NN6I 3T5HA 2E2JH 4MZ9A 1VQIA 3I4NG 2DLNA 1KDBA 2TMPA 3J80W 3TP7A 4Q8FA 1TXYA 2KEEA 1YBYA 4MV9A 1YNJD 1A2UA 2PQAB 5L37A 2FP4B 4BY1G 4CJ1B 1N34L 1VAJA 1CS0A 1MHWC 4FS2A 3LWUA 4DU9A 5JVG3 4O3PA 2XC9A 4RUCA 2LSSA 1XPUA 1KAAA 3CPFA 5LMUH 4A3BH 1S5DD 3AQQA 3CC7A 2YZGA 4J9SA 3TS0A 2K03A 3KBGA 1WJJA 3GO5A 3FMAA 4TKOB 4ZI7F 4FNFA 1V4YA 3CF5A 5JUMA 4DUZL 1Q90A 4GOPC 2H4OA 4MV3A 5IODA 3RIZA 3RNUA 5KT7A 1I5FA 1IBLH 2J6UA 1ET9A 1WVLA 1I3QA 2A69D 4R7RA 1E22A 5I6YA 1OWTA 2F4IA 4N9PA 1KC7A 3RV4A 3I73A 4J9NA 4RGNA 4YHHQ 4QUCA 5KFTA 1PFBA 3A5ZB 3OMGA 3Q1KA 2VUMA 1HZCA 5KFJA 4FBUA 2ICEC 2FB9A 1W3SA 2JA8H 4C3JH 2VS1A 4LF5H 1PHJA 3OUUA 3QIAA 1EUJA 4DKAC 1EWHA 2WB1G 4UP7A 4ETSA 2IBKA 1EZ8A 5CR3A 4LF8L 4DR7Q 2F0JA 1LV9A 3HKZG 4PZ8A 1M4VA 1I3QB 2F1MA 1SN8A 2ID0A 3HOYH 3S17B 3KHHA 3EIVA 1D6EC 2KBNA 1EYZA 2EYJA 1ILPA 1M1KC 3PSIA 1JIHA 4ULLA 2C2DA 2PW5A 2L1BA 4DV7H 1CA6A 1WH2A 1TU2B 5LXTF 1RJTA 2WINB 3GTLB 3F8NA 5HBRB 1Q1BA 4RGMA 1EY0A 4KHPL 3PW2A 4OONA 4NXNQ 3JAME 4IZ8A 3J7YW 1K8GA 2D9UA 5FO9B 1QZHA 1QG7A 5CV8A 1VQDA 4LF4Q 1HR0Q 4KKUA 2R7ZG 3H40A 5E7NA 1ZHSA 3C1FA 1B7YB 1VS0A 1X9NA 4FF4A 1K83A 1O7ZA 4UCRA 4BY7H 1EWIA 3QOJA 3GIQA 4X65L 3J80c 2PPBC 2CW8A 4LUOA 2VZAA 2RA4A 4ZKCB 2VY3A 2F0HA 1GVPA 3RB0A 4JV5H 2R86A 2F0IA 3CW2C 2CH4A 1CKNA 4H0LC 4IPDA 4JG2A 2KVMA 4GKKL 2JA5H 2J7ZA 3I91A 3HB9A 4RGTA 3TRZA 1BBWA 2MO1A 5DG8A 2I46A 2N49A 2R7FA 4B3RQ 1GHJA 2E74C 4KY6A 4HYKA 4Q0YA 1WTRA 4V0BA 2NZHA 1AUXA 4RUAA 1HQMC 4H02A 3FEWX 3U9OA 4WD3A 1DYQA 4K5VA 1JWSD 1PTOH 3BQ2A 5M5YB 4DGZA 1EQQA 1DZ1A 1CKNB 4HJ7A 4IR9A 3RTXA 1XJVA 4A75A 3JAMW 3JSNA 2W9AA 4B3SQ 2ENBA 3C0FB 2W6PA 2OXPA 5JH7F 3GTJH 3RBEA 1N9WA 2E2DC 3L3OC 3BVGA 5C3EG 4O4LF 5EDWA 5IGDA 1T94A 4Q5VA 4K2KA 4C56C 4XYOA 1V51A 4A3GH 1LT3D 4MV1A 1N36L 4NXMQ 4H13C 2E5LH 1C30A 5CV4A 1X3QA 5IWAQ 3CC2A 2DGYA 1U9RA 4C1NK 4A3KH 4WJ4A 1JOQA 1BO0A 1CQFA 2EY6A 1Q7YC 1STGA 5J1ZA 4DR3Q 3NBIA 4QGUA 4O4IF 2FINB 3H91A 4FO2A 1RCVD 1A63A 3VYUA 1HZ9A 3HOZG 4DV5H 1HJPA 4FM9A 2ZTCA 4ED6A 2L4NA 4DV4Q 4N8FA 5DM73 5A2QL 4QW8A 5J39A 2VA3A 5DG7A 4KY7A 2XSCA 4JBKA 3RUPA 2BQRA 1CZWA 1XNRH 2ZM6L 4DPGA 3I4MG 5IGFA 3E0EA 4IAJA 4RNNA 3P7JA 1BNZA 4A3CH 1IBKL 4NB3A 1YNNC 1AH9A 5ELDA 2QW7A 1CQIB 2UVRA 4HIKA 4M7EA 1ENAA 3H0GG 3CD6A 1TY0A 4RZQA 4DL5A 3MXPA 4UCVA 1NE3A 2RHSB 4RA8A 2X69A 1I6VC 1PTOF 2HCCA 2PNHA 2JEAI 3HFZB 1DV1A 1EIYB 2ZDQA 3PF5A 3GIKA 2CKZB 5M5WH 4OWWB 2Z4HA 3BA8A 4BA1I 5KT2A 5KFRA 5BN5A 4FXDA 4HMIA 5KFAA 2BR0A 1DM0B 4EBDA 4DR6L 1MJCA 5CAEB 1NR2A 4FXKC 4R4CA 4WJ3M 3TP6A 1ZETA 3MXNA 3JAMc 2B8FA 4APVA 4J1MA 2RDIA 1HZBA 1VQCA 1EEFD 1R4QB 1K8AC 3S15B 5KT6A 3MR3A 5BR8H 1HNXH 1M0TA 2V9WA 2BDOA 5DGBA 1VQKA 1UE1A 4L8JA 1EOTA 3TSSA 5IOCA 3VR3A 2F4VQ 4EEQA 1AFPA 3S2HB 3FPPA 1CA5A 4DV6Q 1LTLA 4HJ5A 2UUBL 1AUVA 4PDBA 2V4QA 2W6MA 1GUTA 4JI6L 3MXNB 1WD1A 3TINA 2LY7A 1QILA 1ULZA 1LTAD 3MXUA 5C44G 4DR4L 4OL7A 2WAQA 1HA5A 4HIDA 4JI8H 4DF7A 1JOOA 2DJGC 5D3DA 3GTKA 3DM1A 3QG1A 2JEBI 2BA0A 5M5XH 4HN7A 4HJ9A 2E75C 4WBNF 4A3FB 4L1KA 3CCRA 2WB1E 4FP5D 4TVAB 1UC9A 1YJNA 1BCPC 5GAHC 2W6ZA 1EYDA 1PZJD 3OHXC 1LTRD 1H9RA 4DV3Q 2IW3A 1G6PA 2AQ3B 4CBVA 1O80A 4KHVA 3GTKB 1EL0A 1RD9D 4OO1G 1YNND 4K8IA 3TN2A 1AP0A 1PH6A 5FD6A 5IYBH 5C5LA 1IHZA 3TREA 4LFAL 3RV3A 5H80A 3RR5A 3L7ZC 2LXJA 5ISRA 1G291 4X64L 4DR1L 2Z8LA 1PH1A 2OTJA 4JI0Q 3VYSA 4IOAA 2X0SA 1TWAA 2Y0SA 3P20A 1LTTD 3K0XA 4AYBG 3K80C 1KDAA 3LGJA 5C1OA 4MNOA 4P74A 1HTPA 3BYTB 1PZID 3MWMA 3HOXG 2FK3A 2R61A 5JJKA 1VQAA 3ULLA 2XVSA 4GN3B 1C3OA 3VPCA 1ZXTA 1FJGQ 3GV8B 3PW5A 4KMUC 1BF4A 3H3VC 2F0LA 5C0XI 2VA2A 4C3JG 4ODGA 2CQYA 1N32H 3PQIA 1JJCB 4IO9A 4KJNA 5LMNL 1KD1C 3MC0B 2YS6A 2OEOA 3PO3G 2Y0SB 3F1ZA 3J7AV 4R1JA 1Y1VA 2CH4W 4LF5L 1M0WA 5J2TF 3A7LA 4A3EH 1E4EA 4AQYH 4TQUS 3J7AK 3WNZA 2F0FA 1YHAA 3N6XA 1JLLB 4JW0A 5EPLA 5BPHA 1GOZA 2FJ2A 5FOBB 2VQEH 3PUVA 5A2QE 4DUYQ 2D5DA 3OYYA 2B3GA 1D2BA 4B3MQ 4F4WA 1Y1VB 4GKJQ 2R93G 1CTMA 2JA8B 3PUXA 3D3RA 3BA9A 3TBIB 3PIO3 2EQSA 5JPMC 2IJ0A 1E4EB 1KQSA 1O7IA 3QZ7A 4PZ7A 3QO2A 4JI2H 2UVWA 3G6YA 2HQEA 4KY5A 3PW0A 1CQJB 2WV6D 4YHHL 2A19A 5IYDG 2JA7A 2ZTEA 1D5XC 4IRKA 1XYIA 3BJUA 1N34H 1FD7D 2A6EC 4P75A 1Y14B 1WTXA 3E9IA 2IL8A 3FMCA 4FDBA 3WOFA 5LL6X 4A3JG 2FMMA 1XMQL 2VL6A 1KEEA 4RHRA 3N52A 4F88A 3ICEA 4YJ2F 1X3EA 3EBEA 1UNNC 2RCNA 2XCPA 4A2BA 2B63G 4K5WA 3D4RA 4DUZH 1FGUA 4ZUIA 4JI1L 2PMZA 3OW2A 1L0YB 2YW2A 2NVTH 4MA5A 1FNUA 1NSNS 2JA7B 4DNRB 4BY7B 1I3QH 1C48A 1Y1WG 3OHAA 1SNPA 5IP9G 5KFFA 1T36A 3CRKC 4ZK9B 4C3HB 3S17H 5A2QW 2K6AA 1H9JA 3CKIB 1Z7TA 1JWMD 2CVRA 2VUMH 1PLFA 4X3SA 4E4TA 1W93A 5HY6A 5M3MG 5KFOA 5I2XA 2JA5B 1BQQT 1I94Q 4HQ6A 4GLXA 2K01A 2PMZB 1QVGA 4X62L 3DLLA 3W1BA 3J80L 4DL7A 1UEBA 3RMHA 1UNSA 3K7UC 3N6RA 3MR6A 2WAQE 2GPSA 4F4XA 3GTJA 3U4ZA 4DNIA 1KHIA 2VB2X 4CC5A 5C4JH 2QK4A 4L5SA 3V96A 1PTOB 2NYZD 3LP8A 1KJ9A 2YRXA 2JA6G 5C4XH 2UUAL 1EIGA 1SNQA 2B2VA 2BDNA 1XNQH 4FYDA 4KHPH 3TIGA 4LW1A 4Q44A 3VR2A 1LT4D 4DK0A 2B39A 2WP8J 3GTJB 3SK8A 1QUQA 1K83H 1WTVA 2OLSA 5NUCA 1NTGA 2Q2UA 4EGJA 4TQSA 1EOVA 2R6FA 5LA6F 3M9NB 1VQ7A 1V43A 2ASLA 4X65H 4YCVA 3A5UA 2HVSA 1Z2OX 2R8KA 1XNRL 3SXHA 1BXTA 4A2AA 1UUPA 2X6GA 4A3KB 5IT9E 3OMCA 5BPFA 4B3SL 5M5YH 4ALPA 4LF6Q 1PH5A 1QZGA 2FHTA 4APMA 1DOMA 3UE1A 4NPSA 3R93A 5C3WA 1G2TA 4GKKH 1GSHA 3AFPA 3DHQA 1B2TA 3MTSA 2VPQA 2JXMB 2ZDGA 3RLNA 4ZOLF 1QUQB 1B9NA 3TQYA 3R23A 1F9QA 4X3TA 2MFIA 1RIPA 1JR0D 1YZ6A 1NR4A 4HNVA 3UDIA 1SFOA 2IHFA 3ZYYX 4OX9Q 1OO9B 5CGKA 3HGBA 3E5SA 1OTCA 4LSXA 4IUVA 3UE0A 1IXRA 2V1CC 5CV5A 3R5FA 1JXLA 1VCIA 4K6LA 3VPBA 2NZOA 1JJ2A 2NWGA 4DAYA 2G5DA 3TQ1A 2HIXA 2PO4A 5FPRA 1Q8KA 4QWCA 4LF9H 3E0JA 5A35A 1CSQA 2ZDHA 2R8HA 1PH8A 1IBMQ 3PUZA 4JI3H 4QWAA 1K28A 1EY8A 2SEBD 4R9WA 3W2DA 5IYCG 3M4QA 5HGTA 4A3IG 2GN5A 3OIQA 1W96A 2OH2A 3K81C 4J9LA 1SEIA 4KK7A 4RCNA 1F2MA 1EEID 4K0KQ 2NZ1D 1U5KA 3G6JB 2AWOA 2PZUA 1YNXA 4I7HA 1N36H 4DAYB 4RKBA 2K33A 3AMUA 1SYXB 3CXCA 2OF1A 2XWJB 5M5WB 3HZXA 1CQVA 2WFWA 2GPWA 1NBWA 3BS1A 2ALYB 2EYMA 3V05A 1WTPA 3VMMA 5C4ZA 4LK1C 1VQMA 4DV0L 3TS2A 1EY4A 4JI8L 4C3IG 4PMWA 2EYOA 3UDFA 1OXXK 3Q22A 4WFN3 1Z2PX 3ORQA 3PR4A 4DV1H 2EXDA 3PW7A 3STBD 1BBXC 1EUDB 4O2BF 2KCTA 1A6XA 4IHJF 1F77A 2UU9Q 4KLKA 5EKKA 4JOIC 2ZM6H 5LMNW 4YCUA 4DA2A 4YR2A 3CCEA 5DLFA 4HSPA 1IYJB 4JYAH 2QCPX 3FRPB 4OIJA 2VQFL 4V190 3PO2G 3V4SA 3NPPA 4EEYA 3EJIA 4B9WA 1T5XD 3X3NA 5GONF 1I6UA 1SYGA 5FD5A 3SK4A 3ETJA 4YY3L 2EJGC 2Q8RE 5M5XB 1WCMG 3SI8A 3M4YA 2SOBA 3ND9A 5FO7B 2DIKA 4GNXA 4GNXC 3OIPA 3CRLC 4DV2L 2VQDA 1C7YA 4HJ8A 4B3TL 1II3A 3S2HH 3KF8A 3IKJA 1SYBA 1PYBA 3RAXA 2NN6H 3S2DH 4A3DB 1NMGA 1Q86C 3E3XA 4DR6H 2KCMA 3VA7A 1P16A 4OEMB 1SE3A 2PYKA 4RB1A 4Q8EA 1K8MA 4QIWE 4GLVB 4ZQ3A 2CCZA 4TSSA 4TQRA 2W7PA 3GILA 5KFEA 1Q82C 4DK1A 4XQNA 1XTCD 2K5DA 3MEFA 1NY4A 1RYSA 3M9OB 1X3PA 2LXKA 3BDCA 4LWCA 3RD4A 2YYAA 3SVMA 2UXBQ 3MFGA 5IT9c 2WDTA 4RU9A 2UUBH 4BBRG 1JB7A 5KG0A 4JI6H 4PG3A 3M4IA 4AQYL 3KXYT 4U68A 4DR4H 3SK5A 1G2SA 2I5HA 3Q8QB 2F3IA 3GTKH 2I07B 2W9BA 2MJ8A 1K9MC 1TAEA 3V4ZA 3VYRA 3R2TA 2NUCA 2ZT9C 1PK8A 2V5AA 2RCFA 2N3SA 5M3FH 1PH9A 2R85A 2K7VA 4DNTB 2ZJTA 5AJ3Q 1S10A 2XN9C
chains in the Genus database with same CATH topology
5LMUQ 1HR0W 1JMCA 2R7ZH 4A3GH 2IT1A 2R7DA 2ZJRA 1N36L 4NXMQ 2PI2E 4DR3L 1PH7A 1SR3A 5IWAQ 2DGYA 3CCUA 1VQEA 1IBLL 3CC2A 4A3KH 4WJ4A 3KLWA 2DUDA 2YV5A 1GM5A 1HNZL 1E1TA 1Q7YC 1HZAA 1D8LA 4DR3Q 4DK3C 4QGUA 1IBLQ 4DV4L 2AKWB 1W2BA 1B8AA 1A63A 1HZ9A 3HOZG 1PV4A 3GTOH 1HJPA 1HNWL 1HNZQ 2ZTCA 3F8TA 3T1HL 2OQ0A 1LYLA 4DV4Q 1TWAH 1FVIA 2IX0A 1HNWQ 1G51A 2JA7G 1YEZA 4AYBE 3RN2A 3K7AH 4GOPA 3T1HQ 3G6EA 4JBKA 1E1OA 2ZM6L 1PFSA 4DPGA 3I4MG 3E0EA 1VQ4A 1YVCA 2L15A 1YJWA 4L5TA 4BBRH 4A3CH 2CQOA 4GLAC 4DUZQ 1NMFA 2JJQA 1IBKL 5IP7G 1FL0A 1WI5A 3Q8DA 4NB3A 5EAYA 1AH9A 2ZM6Q 1JT8A 1Q81C 4OWXB 1VQ8A 1X65A 3G48A 4HIKA 1UE7A 2Z6KC 4A4IA 2N78A 2HT1A 3H0GG 5J3BA 3CD6A 4DV7L 1IBKQ 1GKHA 1KL9A 1NE3A 1Y1VH 2EIFA 4XIGS 4EX5A 4UY8C 2RHSB 3S1RH 2BH2A 3HOUG 4DV7Q 2PNHA 2JEAI 3PV0A 3PIPA 3HFZB 4A3LG 4HIOA 1EIFA 3ULJA 4JOIA 2A8VA 1EIYB 5C3EH 3F2DA 3PF5A 1N33L 2E2HH 3W5OA 2CKZB 5M5WH 2VW9A 4OWWB 4BA1I 2OTLA 1K0RA 1X3FA 3UDGA 5IYBG 2R92G 3J7ZC 4DR6L 1MJCA 4R4CA 4WJ3M 2K75A 3JAMc 3G71A 2KHIA 2XGTA 2IHEA 4APVA 4JV5L 1HZBA 1VQCA 1K8AC 1ASZA 3KJPA 2R6GA 4P71A 4RMFA 4DR6Q 1XNQL 3W1GA 1VQKA 2F4VL 2ASBA 3PF4A 3HOZH 1E7ZA 1UE1A 4JV5Q 1AE2A 4DV6L 1CSPA 3RLOA 1EFWA 1MJEA 2Q2TA 4L5RC 1XNQQ 2F4VQ 3RZOH 1IL2A 1WOCA 5GQOA 4LNQA 2AHOB 4KHPQ 4UP9A 5FLMG 2JA7H 3HOVH 4DV6Q 2K52A 1LTLA 2HQLA 4HJ5A 2HHHL 2UUBL 3VDYA 3EN2A 1TWHH 2OCEA 3ER0A 4JI6L 3H3VI 3MXNB 1Q1EA 3I4MH 3BZCA 3NEMA 4JC0A 4C3HH 2CFMA 5C44G 4DR4L 4OO1I 3GD7A 2HHHQ 4DR5L 4HIDA 2UUBQ 1KAWA 1OXVA 5IP7H 4JI6Q 3S14H 1XPRA 3UDXA 1SROA 2JEBI 3PGZA 2BA0A 5M5XH 2I5MX 4HJ9A 1OXSC 3GTLH 4DR4Q 4GNXB 3PUYA 3H0GH 4DR5Q 1VQ5A 3CCRA 2WB1E 3ERSX 2D0PA 4TVAB 3L2PA 1X3GA 1UWVA 5JEAG 1YJNA 4DV3L 1VQLA 5H1SE 4A3EG 1C9OA 3CAMA 1MKHA 3KF8B 5GAHC 4GKKQ 2JA9A 3HOUH 1JJGA 4A3LH 1A0IA 4R4QA 4DV3Q 2E5LL 1SE8A 1G6PA 4KI0A 4R4TA 4MTNA 4OO1G 3E9HA 1LM0A 1PH6A 5IYBH 1L2FA 2R92H 4OXPA 2E5LQ 3TREA 4JI0L 4LF9L 4LFAL 1L1OB 1K73C 3RR5A 4OWTB 3L7ZC 1A62A 4JI3L 2LXJA 4DV5L 4O2DA 1T9HA 1VQGA 3STBC 1G291 5DLQE 4X64L 4DR1L 1PH1A 4LFAQ 4JI0Q 4LF9Q 4IOAA 2OTJA 4A76A 4YWLA 4JI3Q 4DV5Q 2HIVA 3GTPH 3K0XA 4AYBG 2CWAA 3K80C 3LGJA 4DR2L 2RHQB 3PCOB 4MNOA 4P74A 3HOWG 5GADC 3F2BA 1FJGL 3KFUA 4JBJA 5FLMH 3J81c 4GS3A 3HOXG 3DM3A 4YWKA 4A93G 4DR2Q 1VQAA 1Z47A 3ULLA 4GN3B 2I0QA 5JJKA 2K5NA 1FJGQ 1N36Q 4IPGA 5C0XI 5C44H 2CWPA 1Z9FA 2Y0SE 2N8NA 4IO9A 1JJCB 2NVQH 2UUCL 4UP8A 5LMNL 1KD1C 4ME3A 3NBHB 1B70B 2K14A 4A3MG 3PO3G 3F1ZA 3FHWA 4DV1L 4R1JA 4AH6A 2UXDL 4LF5L 1J5EL 5LMNQ 4BBSG 1SRUA 1QVCA 3HKSA 4IJLA 4LFCL 4QQBX 4A3EH 3CCMA 1YIJA 3AFQA 4TQUS 3CCVA 2YYZA 4DV1Q 4POGA 4LF5Q 1J5EQ 1K3RA 4UPAA 4DUYL 4JYAL 1YHAA 2VUMG 2QA4A 5JEAJ 4B3ML 4LFCQ 4GKJL 3OTOL 2Q2HA 5C0XG 1X55A 2Z6KA 1OXTA 3PUVA 4JYAQ 4DUYQ 1PYSB 3OYYA 2B3GA 1YITA 1HNXL 4B3MQ 4GKJQ 2R93G 5BR8L 1SFOH 3OTOQ 3J81j 3PUXA 2QEXA 2EQSA 4GOPB 1KQSA 1O7IA 1HNXQ 4PZ7A 5BR8Q 2YTXA 1OXUA 3J81i 4A3DG 4YHHL 1X6OA 2IX1A 3KDFA 3HOWH 2A19A 5IYDG 4JI7L 2ZTEA 4JI5L 1PVOA 2YTYA 3BJUA 1YJ9A 5C4XG 1V9PA 4P75A 1Y14B 3E9IA 4FDBA 4YWMA 4A3JG 1XMQL 3HOXH 1N33Q 2VL6A 4A93H 4A3FG 2Q2IA 4JI7Q 4P72A 4JI5Q 2K4KA 3ICEA 1R9TH 3KYHC 1HH2P 3JC66 1L0WA 1X3EA 3EBEA 4IFDI 5JJIA 2RCNA 3I4OA 3SGIA 1XMQQ 3KF6A 2B63G 4HJAA 1FGUA 2Z0SA 4JI1L 4A3MH 3PO3H 3OW2A 3HOVG 1XPOA 2NVTH 4XTCS 4YCWA 3KDFB 5GAGC 4LFBL 4BBSH 3S1MH 4BXXG 2OQKA 1I3QH 1VQPA 1YI2A 1Y1WG 1DGSA 3ZJYC 3A74A 4JI1Q 5IP9G 3I55A 1N8RC 3S17H 2QGQA 1LUZA 1NJIC 1V1QA 1KC8C 4QJFA 1I94L 1VQ6A 3F2CA 4X66L 2BH8A 2ES2A 3M4OH 5K36G 2VUMH 2PMZE 2C35B 5HY6A 3S15H 2FXQA 3KF6B 1BKBA 1KRTA 5M3MG 5GAEC 4IFDG 2RF4A 1P8LA 1I94Q 3AEVA 4GLXA 4X66Q 3M7NA 1QVGA 4X62L 2OWOA 3DLLA 3CCJA 2UXCL 2ATWA 4GN4B 4GN5A 3KOJA 3W1BA 2R93H 1X56A 1UEBA 1MIUA 5C0XJ 3K7UC 4HIMA 3HKZE 1VQBA 2WAQE 4X62Q 3U4ZA 4DNIA 2UXCQ 4DK6C 1KHIA 3U50C 3PUWA 1WYDA 4LUZA 5C4JH 4POFA 4LF7L 4L5SA 2E8GA 1EQRA 1RL2A 4R4OA 2ZJPA 2D0OA 4A3DH 4LUVA 5IYDH 1VQHA 3GTQH 2JA6G 4A3BG 1D7QA 5C4XH 2UUAL 3I56A 4JCVE 2NVXH 4A3JH 2UXBL 1PH3A 2JQOA 3GDEA 1ASYA 1N32L 3D0FA 3T1YL 4LW1A 4A3FH 1XMOL 4EQ5A 4AIMA 2AWNA 2WP8J 3AYHB 1AE3A 4QY7A 3ULPA 1S40A 5ELNA 3CPWA 2UUAQ 1I6HH 1QUQA 1K83H 2K5VA 2K5HA 3M9BA 2B29A 3T1YQ 1N32Q 1S3OA 1NTGA 2B63H 5IE8A 1XMOQ 3RLFA 2Q2UA 1EOVA 4IPHA 3FKIG 1VQ7A 1V43A 4LF6L 4X64Q 4YCVA 3CP0A 4IJHA 1E3PA 1U0LA 3A5UA 4DR1Q 1EYGA 1XNRL 1C0AA 4BXXH 4B3SL 3L0OA 1Y1WH 4JI4L 2GVAA 5IP9H 5M5YH 4ALPA 1PH5A 4LF6Q 1QZGA 3NENA 1BBUA 1TWGH 1KIXA 1TWCH 2YTVA 4NPSA 3UE1A 1XNRQ 2PQAA 3AFPA 2VQEL 4JI4Q 4OX9L 2JA8G 4Y52H 3RLNA 3U4VA 4R4IA 1QUQB 3TQYA 3CCSA 1JE5A 2K50A 5M3MH 2KENA 1CKOA 2MFIA 3NELA 3H3VH 1RIPA 1YZ6A 1VQNA 2VQEQ 3S1QH 3UDIA 2IHFA 4OX9Q 3S1NH 1S72A 1VQ9A 3J80i 4JBMA 1BVSA 2H5XA 2UUCQ 4RG1A 3I7FA 5FJ8G 1OTCA 3HOYG 4JI2L 2NN6I 3KJOA 3UE0A 2E2JH 1IXRA 2V1CC 4MZ9A 3D31A 4IFDJ 1VCIA 1VQIA 1GO3E 3I4NG 2NZOA 1JJ2A 1IBML 2UXDQ 1UE6A 1TXYA 2JK8A 2HIXA 5C3EG 1YBYA 4JI2Q 1Q8KA 2PQAB 4BY1G 1N34L 1CSQA 1PH8A 1IBMQ 2KHJA 3PUZA 1J6QA 3CC4A 1GD7A 1VQJA 4K0KL 5IYCG 2LSSA 3M4QA 3CPFA 1XPUA 4A3IG 2JA6H 2MNAA 4A3BH 2GN5A 3AQQA 3CC7A 3G4SA 1N34Q 3TS0A 3K81C 1WJJA 3GO5A 3TEHB 4K0KQ 2NVYH 3CF5A 1U5KA 1VQFA 4L5QA 2AWOA 4DUZL 4BY7G 4GOPC 2NN6G 1YNXA 4DAYB 2BA1A 1WFQA 3RNUA 1I5FA 3CXCA 5JJLA 3CCQA 2YU9H 3A0JA 2WFWA 4QL5A 3FKIH 1I50H 1SLJA 1NBWA 2ALYB 1E22A 1PA6A 5HGQA 2JA5G 4KHZA 4YHHQ 1VQMA 4DV0L 1A8VA 3TS2A 4JI8L 3A5ZB 4PMWA 3S16H 2UU9L 1HZCA 4J15A 3RZDH 3UDFA 1OXXK 3K8AA 4DR7L 3B6YA 1W3SA 2EXDA 4C3JH 2VS1A 3STBD 2JA8H 1PHJA 1EUJA 2KCTA 3FP9A 4JI8Q 4DKAC 4DV0Q 3M3YH 2WB1G 4UP7A 2UU9Q 2MO0A 4KLKA 5GROA 4LF8L 4DR7Q 1Q12A 4JOIC 3CMAA 3GTMH 3HKZG 4PZ8A 2WAQG 4YCUA 5FLXc 5LMNW 4DAMA 3CCEA 1IYJB 1SN8A 2F52A 2ID0A 5FJ8H 1IZ6A 2VQFL 3HOYH 2VNUD 1KXLA 3PO2G 3RN5A 3CMEA 4JBWA 3EIVA 4LF8Q 3CCLA 2KBNA 4Y7NH 3I4NH 1YHBA 1M1KC 3PSIA 4BA2I 4LFBQ 2GVBA 4NXNL 2VQFQ 5M3FG 4IOCA 4C2MH 4YY3L 4BY1H 4LF4L 1HR0L 4PZ6A 2ZJQA 2I5LX 1WCMG 2E2IH 1Q1BA 4X6AH 4KHPL 4OONA 4NXNQ 5IYCH 4GNXA 4A3IH 1K8GA 4GNXC 1QZHA 1YHQA 1VQDA 4YY3Q 4DV2L 3U58A 2A1AA 3H15A 1HR0Q 1C7YA 4LF4Q 2R7ZG 3GTGH 4HJ8A 4A3GG 5E7NA 1H95A 3I2ZA 4B3TL 1B7YB 1VS0A 1X9NA 3CQZH 3S2HH 4A3KG 1EWIA 4BY7H 1PYBA 4DV2Q 1E24A 4X65L 3J80c 3PIOA 3S2DH 1NMGA 4B3TQ 4LUOA 1Q86C 2VZAA 2KCMA 1KRSA 1P16A 2VY3A 1GVPA 4P73A 4X65Q 4QIWE 4GLVB 2CCZA 3CW2C 1M90C 1CKNA 4IPDA 4LF7Q 4JG2A 4GKKL 4B3RL 1Q82C 2JA5H 2Y0SG 1L1OA 3MEFA 4C3IH 1QVFA 1NY4A 1L1OC 1X54A 3TRZA 1BBWA 1TWFH 2MO1A 1PH2A 2MQHA 2LXKA 2N49A 2R7FA 4LWCA 3WWVA 4B3RQ 2JE6I 2UXBQ 5IT9c 3IRBA 4IPCA 4BBRG 2AMCB 2NZHA 4A3CG 1JB7A 4H02A 1VQOA 4O0AA 2XTIA 4PG3A 3JAMi 4AQYL 2ZTDA 1SMXA 2I5HA 2F3IA 3BU2A 1EQQA 1CKNB 4HJ7A 3GTKH 1K9MC 3J7A5 3PO2H 3M85A 1XJVA 4A75A 1Q46A 4AQYQ 5ELOA 1Y1VG 3S24A 1CUKA 2PI2A 5AJ3L 2D62A 2N3SA 5M3FH 4B3SQ 2IY5B 5LMUL 1PH9A 3M4PA 1WCMH 1XTDA 1CKMA 5IY0A 4NXML 3GTJH 1N9WA 1PH4A 5AJ3Q 5IWAL 3BZKA 1UE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU Q;  1HR0 W;  1JMC A;  2R7Z H;  4A3G H;  2IT1 A;  2R7D A;  2ZJR A;  1N36 L;  4NXM Q;  2PI2 E;  4DR3 L;  1PH7 A;  1SR3 A;  5IWA Q;  2DGY A;  3CCU A;  1VQE A;  1IBL L;  3CC2 A;  4A3K H;  4WJ4 A;  3KLW A;  2DUD A;  2YV5 A;  1GM5 A;  1HNZ L;  1E1T A;  1Q7Y C;  1HZA A;  1D8L A;  4DR3 Q;  4DK3 C;  4QGU A;  1IBL Q;  4DV4 L;  2AKW B;  1W2B A;  1B8A A;  1A63 A;  1HZ9 A;  3HOZ G;  1PV4 A;  3GTO H;  1HJP A;  1HNW L;  1HNZ Q;  2ZTC A;  3F8T A;  3T1H L;  2OQ0 A;  1LYL A;  4DV4 Q;  1TWA H;  1FVI A;  2IX0 A;  1HNW Q;  1G51 A;  2JA7 G;  1YEZ A;  4AYB E;  3RN2 A;  3K7A H;  4GOP A;  3T1H Q;  3G6E A;  4JBK A;  1E1O A;  2ZM6 L;  1PFS A;  4DPG A;  3I4M G;  3E0E A;  1VQ4 A;  1YVC A;  2L15 A;  1YJW A;  4L5T A;  4BBR H;  4A3C H;  2CQO A;  4GLA C;  4DUZ Q;  1NMF A;  2JJQ A;  1IBK L;  5IP7 G;  1FL0 A;  1WI5 A;  3Q8D A;  4NB3 A;  5EAY A;  1AH9 A;  2ZM6 Q;  1JT8 A;  1Q81 C;  4OWX B;  1VQ8 A;  1X65 A;  3G48 A;  4HIK A;  1UE7 A;  2Z6K C;  4A4I A;  2N78 A;  2HT1 A;  3H0G G;  5J3B A;  3CD6 A;  4DV7 L;  1IBK Q;  1GKH A;  1KL9 A;  1NE3 A;  1Y1V H;  2EIF A;  4XIG S;  4EX5 A;  4UY8 C;  2RHS B;  3S1R H;  2BH2 A;  3HOU G;  4DV7 Q;  2PNH A;  2JEA I;  3PV0 A;  3PIP A;  3HFZ B;  4A3L G;  4HIO A;  1EIF A;  3ULJ A;  4JOI A;  2A8V A;  1EIY B;  5C3E H;  3F2D A;  3PF5 A;  1N33 L;  2E2H H;  3W5O A;  2CKZ B;  5M5W H;  2VW9 A;  4OWW B;  4BA1 I;  2OTL A;  1K0R A;  1X3F A;  3UDG A;  5IYB G;  2R92 G;  3J7Z C;  4DR6 L;  1MJC A;  4R4C A;  4WJ3 M;  2K75 A;  3JAM c;  3G71 A;  2KHI A;  2XGT A;  2IHE A;  4APV A;  4JV5 L;  1HZB A;  1VQC A;  1K8A C;  1ASZ A;  3KJP A;  2R6G A;  4P71 A;  4RMF A;  4DR6 Q;  1XNQ L;  3W1G A;  1VQK A;  2F4V L;  2ASB A;  3PF4 A;  3HOZ H;  1E7Z A;  1UE1 A;  4JV5 Q;  1AE2 A;  4DV6 L;  1CSP A;  3RLO A;  1EFW A;  1MJE A;  2Q2T A;  4L5R C;  1XNQ Q;  2F4V Q;  3RZO H;  1IL2 A;  1WOC A;  5GQO A;  4LNQ A;  2AHO B;  4KHP Q;  4UP9 A;  5FLM G;  2JA7 H;  3HOV H;  4DV6 Q;  2K52 A;  1LTL A;  2HQL A;  4HJ5 A;  2HHH L;  2UUB L;  3VDY A;  3EN2 A;  1TWH H;  2OCE A;  3ER0 A;  4JI6 L;  3H3V I;  3MXN B;  1Q1E A;  3I4M H;  3BZC A;  3NEM A;  4JC0 A;  4C3H H;  2CFM A;  5C44 G;  4DR4 L;  4OO1 I;  3GD7 A;  2HHH Q;  4DR5 L;  4HID A;  2UUB Q;  1KAW A;  1OXV A;  5IP7 H;  4JI6 Q;  3S14 H;  1XPR A;  3UDX A;  1SRO A;  2JEB I;  3PGZ A;  2BA0 A;  5M5X H;  2I5M X;  4HJ9 A;  1OXS C;  3GTL H;  4DR4 Q;  4GNX B;  3PUY A;  3H0G H;  4DR5 Q;  1VQ5 A;  3CCR A;  2WB1 E;  3ERS X;  2D0P A;  4TVA B;  3L2P A;  1X3G A;  1UWV A;  5JEA G;  1YJN A;  4DV3 L;  1VQL A;  5H1S E;  4A3E G;  1C9O A;  3CAM A;  1MKH A;  3KF8 B;  5GAH C;  4GKK Q;  2JA9 A;  3HOU H;  1JJG A;  4A3L H;  1A0I A;  4R4Q A;  4DV3 Q;  2E5L L;  1SE8 A;  1G6P A;  4KI0 A;  4R4T A;  4MTN A;  4OO1 G;  3E9H A;  1LM0 A;  1PH6 A;  5IYB H;  1L2F A;  2R92 H;  4OXP A;  2E5L Q;  3TRE A;  4JI0 L;  4LF9 L;  4LFA L;  1L1O B;  1K73 C;  3RR5 A;  4OWT B;  3L7Z C;  1A62 A;  4JI3 L;  2LXJ A;  4DV5 L;  4O2D A;  1T9H A;  1VQG A;  3STB C;  1G29 1;  5DLQ E;  4X64 L;  4DR1 L;  1PH1 A;  4LFA Q;  4JI0 Q;  4LF9 Q;  4IOA A;  2OTJ A;  4A76 A;  4YWL A;  4JI3 Q;  4DV5 Q;  2HIV A;  3GTP H;  3K0X A;  4AYB G;  2CWA A;  3K80 C;  3LGJ A;  4DR2 L;  2RHQ B;  3PCO B;  4MNO A;  4P74 A;  3HOW G;  5GAD C;  3F2B A;  1FJG L;  3KFU A;  4JBJ A;  5FLM H;  3J81 c;  4GS3 A;  3HOX G;  3DM3 A;  4YWK A;  4A93 G;  4DR2 Q;  1VQA A;  1Z47 A;  3ULL A;  4GN3 B;  2I0Q A;  5JJK A;  2K5N A;  1FJG Q;  1N36 Q;  4IPG A;  5C0X I;  5C44 H;  2CWP A;  1Z9F A;  2Y0S E;  2N8N A;  4IO9 A;  1JJC B;  2NVQ H;  2UUC L;  4UP8 A;  5LMN L;  1KD1 C;  4ME3 A;  3NBH B;  1B70 B;  2K14 A;  4A3M G;  3PO3 G;  3F1Z A;  3FHW A;  4DV1 L;  4R1J A;  4AH6 A;  2UXD L;  4LF5 L;  1J5E L;  5LMN Q;  4BBS G;  1SRU A;  1QVC A;  3HKS A;  4IJL A;  4LFC L;  4QQB X;  4A3E H;  3CCM A;  1YIJ A;  3AFQ A;  4TQU S;  3CCV A;  2YYZ A;  4DV1 Q;  4POG A;  4LF5 Q;  1J5E Q;  1K3R A;  4UPA A;  4DUY L;  4JYA L;  1YHA A;  2VUM G;  2QA4 A;  5JEA J;  4B3M L;  4LFC Q;  4GKJ L;  3OTO L;  2Q2H A;  5C0X G;  1X55 A;  2Z6K A;  1OXT A;  3PUV A;  4JYA Q;  4DUY Q;  1PYS B;  3OYY A;  2B3G A;  1YIT A;  1HNX L;  4B3M Q;  4GKJ Q;  2R93 G;  5BR8 L;  1SFO H;  3OTO Q;  3J81 j;  3PUX A;  2QEX A;  2EQS A;  4GOP B;  1KQS A;  1O7I A;  1HNX Q;  4PZ7 A;  5BR8 Q;  2YTX A;  1OXU A;  3J81 i;  4A3D G;  4YHH L;  1X6O A;  2IX1 A;  3KDF A;  3HOW H;  2A19 A;  5IYD G;  4JI7 L;  2ZTE A;  4JI5 L;  1PVO A;  2YTY A;  3BJU A;  1YJ9 A;  5C4X G;  1V9P A;  4P75 A;  1Y14 B;  3E9I A;  4FDB A;  4YWM A;  4A3J G;  1XMQ L;  3HOX H;  1N33 Q;  2VL6 A;  4A93 H;  4A3F G;  2Q2I A;  4JI7 Q;  4P72 A;  4JI5 Q;  2K4K A;  3ICE A;  1R9T H;  3KYH C;  1HH2 P;  3JC6 6;  1L0W A;  1X3E A;  3EBE A;  4IFD I;  5JJI A;  2RCN A;  3I4O A;  3SGI A;  1XMQ Q;  3KF6 A;  2B63 G;  4HJA A;  1FGU A;  2Z0S A;  4JI1 L;  4A3M H;  3PO3 H;  3OW2 A;  3HOV G;  1XPO A;  2NVT H;  4XTC S;  4YCW A;  3KDF B;  5GAG C;  4LFB L;  4BBS H;  3S1M H;  4BXX G;  2OQK A;  1I3Q H;  1VQP A;  1YI2 A;  1Y1W G;  1DGS A;  3ZJY C;  3A74 A;  4JI1 Q;  5IP9 G;  3I55 A;  1N8R C;  3S17 H;  2QGQ A;  1LUZ A;  1NJI C;  1V1Q A;  1KC8 C;  4QJF A;  1I94 L;  1VQ6 A;  3F2C A;  4X66 L;  2BH8 A;  2ES2 A;  3M4O H;  5K36 G;  2VUM H;  2PMZ E;  2C35 B;  5HY6 A;  3S15 H;  2FXQ A;  3KF6 B;  1BKB A;  1KRT A;  5M3M G;  5GAE C;  4IFD G;  2RF4 A;  1P8L A;  1I94 Q;  3AEV A;  4GLX A;  4X66 Q;  3M7N A;  1QVG A;  4X62 L;  2OWO A;  3DLL A;  3CCJ A;  2UXC L;  2ATW A;  4GN4 B;  4GN5 A;  3KOJ A;  3W1B A;  2R93 H;  1X56 A;  1UEB A;  1MIU A;  5C0X J;  3K7U C;  4HIM A;  3HKZ E;  1VQB A;  2WAQ E;  4X62 Q;  3U4Z A;  4DNI A;  2UXC Q;  4DK6 C;  1KHI A;  3U50 C;  3PUW A;  1WYD A;  4LUZ A;  5C4J H;  4POF A;  4LF7 L;  4L5S A;  2E8G A;  1EQR A;  1RL2 A;  4R4O A;  2ZJP A;  2D0O A;  4A3D H;  4LUV A;  5IYD H;  1VQH A;  3GTQ H;  2JA6 G;  4A3B G;  1D7Q A;  5C4X H;  2UUA L;  3I56 A;  4JCV E;  2NVX H;  4A3J H;  2UXB L;  1PH3 A;  2JQO A;  3GDE A;  1ASY A;  1N32 L;  3D0F A;  3T1Y L;  4LW1 A;  4A3F H;  1XMO L;  4EQ5 A;  4AIM A;  2AWN A;  2WP8 J;  3AYH B;  1AE3 A;  4QY7 A;  3ULP A;  1S40 A;  5ELN A;  3CPW A;  2UUA Q;  1I6H H;  1QUQ A;  1K83 H;  2K5V A;  2K5H A;  3M9B A;  2B29 A;  3T1Y Q;  1N32 Q;  1S3O A;  1NTG A;  2B63 H;  5IE8 A;  1XMO Q;  3RLF A;  2Q2U A;  1EOV A;  4IPH A;  3FKI G;  1VQ7 A;  1V43 A;  4LF6 L;  4X64 Q;  4YCV A;  3CP0 A;  4IJH A;  1E3P A;  1U0L A;  3A5U A;  4DR1 Q;  1EYG A;  1XNR L;  1C0A A;  4BXX H;  4B3S L;  3L0O A;  1Y1W H;  4JI4 L;  2GVA A;  5IP9 H;  5M5Y H;  4ALP A;  1PH5 A;  4LF6 Q;  1QZG A;  3NEN A;  1BBU A;  1TWG H;  1KIX A;  1TWC H;  2YTV A;  4NPS A;  3UE1 A;  1XNR Q;  2PQA A;  3AFP A;  2VQE L;  4JI4 Q;  4OX9 L;  2JA8 G;  4Y52 H;  3RLN A;  3U4V A;  4R4I A;  1QUQ B;  3TQY A;  3CCS A;  1JE5 A;  2K50 A;  5M3M H;  2KEN A;  1CKO A;  2MFI A;  3NEL A;  3H3V H;  1RIP A;  1YZ6 A;  1VQN A;  2VQE Q;  3S1Q H;  3UDI A;  2IHF A;  4OX9 Q;  3S1N H;  1S72 A;  1VQ9 A;  3J80 i;  4JBM A;  1BVS A;  2H5X A;  2UUC Q;  4RG1 A;  3I7F A;  5FJ8 G;  1OTC A;  3HOY G;  4JI2 L;  2NN6 I;  3KJO A;  3UE0 A;  2E2J H;  1IXR A;  2V1C C;  4MZ9 A;  3D31 A;  4IFD J;  1VCI A;  1VQI A;  1GO3 E;  3I4N G;  2NZO A;  1JJ2 A;  1IBM L;  2UXD Q;  1UE6 A;  1TXY A;  2JK8 A;  2HIX A;  5C3E G;  1YBY A;  4JI2 Q;  1Q8K A;  2PQA B;  4BY1 G;  1N34 L;  1CSQ A;  1PH8 A;  1IBM Q;  2KHJ A;  3PUZ A;  1J6Q A;  3CC4 A;  1GD7 A;  1VQJ A;  4K0K L;  5IYC G;  2LSS A;  3M4Q A;  3CPF A;  1XPU A;  4A3I G;  2JA6 H;  2MNA A;  4A3B H;  2GN5 A;  3AQQ A;  3CC7 A;  3G4S A;  1N34 Q;  3TS0 A;  3K81 C;  1WJJ A;  3GO5 A;  3TEH B;  4K0K Q;  2NVY H;  3CF5 A;  1U5K A;  1VQF A;  4L5Q A;  2AWO A;  4DUZ L;  4BY7 G;  4GOP C;  2NN6 G;  1YNX A;  4DAY B;  2BA1 A;  1WFQ A;  3RNU A;  1I5F A;  3CXC A;  5JJL A;  3CCQ A;  2YU9 H;  3A0J A;  2WFW A;  4QL5 A;  3FKI H;  1I50 H;  1SLJ A;  1NBW A;  2ALY B;  1E22 A;  1PA6 A;  5HGQ A;  2JA5 G;  4KHZ A;  4YHH Q;  1VQM A;  4DV0 L;  1A8V A;  3TS2 A;  4JI8 L;  3A5Z B;  4PMW A;  3S16 H;  2UU9 L;  1HZC A;  4J15 A;  3RZD H;  3UDF A;  1OXX K;  3K8A A;  4DR7 L;  3B6Y A;  1W3S A;  2EXD A;  4C3J H;  2VS1 A;  3STB D;  2JA8 H;  1PHJ A;  1EUJ A;  2KCT A;  3FP9 A;  4JI8 Q;  4DKA C;  4DV0 Q;  3M3Y H;  2WB1 G;  4UP7 A;  2UU9 Q;  2MO0 A;  4KLK A;  5GRO A;  4LF8 L;  4DR7 Q;  1Q12 A;  4JOI C;  3CMA A;  3GTM H;  3HKZ G;  4PZ8 A;  2WAQ G;  4YCU A;  5FLX c;  5LMN W;  4DAM A;  3CCE A;  1IYJ B;  1SN8 A;  2F52 A;  2ID0 A;  5FJ8 H;  1IZ6 A;  2VQF L;  3HOY H;  2VNU D;  1KXL A;  3PO2 G;  3RN5 A;  3CME A;  4JBW A;  3EIV A;  4LF8 Q;  3CCL A;  2KBN A;  4Y7N H;  3I4N H;  1YHB A;  1M1K C;  3PSI A;  4BA2 I;  4LFB Q;  2GVB A;  4NXN L;  2VQF Q;  5M3F G;  4IOC A;  4C2M H;  4YY3 L;  4BY1 H;  4LF4 L;  1HR0 L;  4PZ6 A;  2ZJQ A;  2I5L X;  1WCM G;  2E2I H;  1Q1B A;  4X6A H;  4KHP L;  4OON A;  4NXN Q;  5IYC H;  4GNX A;  4A3I H;  1K8G A;  4GNX C;  1QZH A;  1YHQ A;  1VQD A;  4YY3 Q;  4DV2 L;  3U58 A;  2A1A A;  3H15 A;  1HR0 Q;  1C7Y A;  4LF4 Q;  2R7Z G;  3GTG H;  4HJ8 A;  4A3G G;  5E7N A;  1H95 A;  3I2Z A;  4B3T L;  1B7Y B;  1VS0 A;  1X9N A;  3CQZ H;  3S2H H;  4A3K G;  1EWI A;  4BY7 H;  1PYB A;  4DV2 Q;  1E24 A;  4X65 L;  3J80 c;  3PIO A;  3S2D H;  1NMG A;  4B3T Q;  4LUO A;  1Q86 C;  2VZA A;  2KCM A;  1KRS A;  1P16 A;  2VY3 A;  1GVP A;  4P73 A;  4X65 Q;  4QIW E;  4GLV B;  2CCZ A;  3CW2 C;  1M90 C;  1CKN A;  4IPD A;  4LF7 Q;  4JG2 A;  4GKK L;  4B3R L;  1Q82 C;  2JA5 H;  2Y0S G;  1L1O A;  3MEF A;  4C3I H;  1QVF A;  1NY4 A;  1L1O C;  1X54 A;  3TRZ A;  1BBW A;  1TWF H;  2MO1 A;  1PH2 A;  2MQH A;  2LXK A;  2N49 A;  2R7F A;  4LWC A;  3WWV A;  4B3R Q;  2JE6 I;  2UXB Q;  5IT9 c;  3IRB A;  4IPC A;  4BBR G;  2AMC B;  2NZH A;  4A3C G;  1JB7 A;  4H02 A;  1VQO A;  4O0A A;  2XTI A;  4PG3 A;  3JAM i;  4AQY L;  2ZTD A;  1SMX A;  2I5H A;  2F3I A;  3BU2 A;  1EQQ A;  1CKN B;  4HJ7 A;  3GTK H;  1K9M C;  3J7A 5;  3PO2 H;  3M85 A;  1XJV A;  4A75 A;  1Q46 A;  4AQY Q;  5ELO A;  1Y1V G;  3S24 A;  1CUK A;  2PI2 A;  5AJ3 L;  2D62 A;  2N3S A;  5M3F H;  4B3S Q;  2IY5 B;  5LMU L;  1PH9 A;  3M4P A;  1WCM H;  1XTD A;  1CKM A;  5IY0 A;  4NXM L;  3GTJ H;  1N9W A;  1PH4 A;  5AJ3 Q;  5IWA L;  3BZK A;  1UE5 A; 
#chains in the Genus database with same CATH topology
 5LMU Q;  4EQN A;  1HR0 W;  1JMC A;  4A3E B;  3T53 B;  2W9B B;  3CCU A;  1VQE A;  1RDP D;  4CJ2 C;  2YV5 A;  3IL8 A;  1GM5 A;  1UC8 A;  1ONL A;  3FKI A;  1HNZ L;  1E1T A;  4R8N A;  1I50 A;  4PV1 C;  4LFA H;  1JOR A;  1IBL Q;  4Q45 A;  1STB A;  1B8A A;  1PRT C;  1XMO H;  1HNW L;  4X64 H;  4DR1 H;  3T1H L;  4F87 A;  2VR1 A;  2OQ0 A;  3G6V A;  4CC6 A;  1TWA H;  2W71 A;  1FVI A;  1F2Y A;  3QWN A;  4QF4 A;  3KTM A;  1DOK A;  1G51 A;  2QDB A;  1FR3 A;  3K7A H;  4GOP A;  2I87 A;  3NGD A;  1E1O A;  4Q43 A;  1PFS A;  4E6I A;  4JPB W;  5FKA C;  1RJP A;  3RFC A;  3H3V H;  2JJQ A;  1O7L A;  1FL0 A;  1WI5 A;  3Q8D A;  3MAQ A;  5HV6 A;  3OWE B;  4ID6 A;  3I3C A;  1X65 A;  3O13 A;  1TS2 A;  1PFM A;  1A2T A;  2Z6K C;  2N78 A;  1WTQ A;  2F0G A;  2HT1 A;  5LMN H;  3K5L A;  1GKH A;  1KL9 A;  5DM6 3;  1HXY D;  1Y1V H;  5DAU A;  4PQX A;  2E2I A;  3M3Y B;  4EX5 A;  2BH2 A;  4DV7 Q;  4O2A F;  5L1J A;  4A3L G;  4HIO A;  2NVT B;  4F4Y A;  2YCH A;  3KLR A;  4XZ3 B;  2A8V A;  3HEJ A;  3GTG A;  5KFC A;  2RSO A;  3GP7 A;  2VW9 A;  3CQZ A;  3I90 A;  4ZRZ A;  4M8A A;  1T5E A;  1KBL A;  1K0R A;  3UDG A;  3I4N B;  2VPS A;  3SEB A;  3HS0 C;  3J7Z C;  2EXZ A;  3N44 B;  1MZB A;  3K5O A;  1O75 A;  2NU6 B;  3OSO A;  2VUM B;  3SDZ A;  4M1U B;  4BY1 B;  4I7A A;  1CZG A;  3KLS X;  3KJP A;  4P71 A;  3HP3 A;  1XNQ L;  2XCA A;  2ASB A;  4J9R A;  1EZ6 A;  1PZK D;  4JV5 Q;  2BCO A;  4DLK A;  1EFW A;  2L5T A;  1TWF A;  3OSP A;  4NKL A;  1IL8 A;  5GQO A;  2AHO B;  4U67 3;  4YHH H;  4UP9 A;  2JA7 H;  2HHH L;  2K52 A;  1EQT A;  2HQL A;  3DUZ A;  5C4J B;  2WB1 A;  3GIJ A;  3ER0 A;  3H3V I;  3KK7 A;  1Q1E A;  3NEM A;  1D1K A;  4C3H H;  4MV6 A;  4OO1 I;  1XMQ H;  5FPO A;  4DR5 L;  5TSS A;  1OXV A;  5IP7 H;  5C4X B;  1DD2 A;  3PVX A;  1SRO A;  4ECY A;  1PRT D;  5KFK A;  2KSW A;  3IFD A;  1AEX A;  2D0P A;  1IKL A;  2M9V A;  2NBF A;  4JI1 H;  1MD2 D;  1STN A;  1HUN A;  1K83 B;  1C9O A;  3CAM A;  1MKH A;  1ESR A;  2WB1 B;  4LH7 A;  4DXG A;  3HG9 A;  1L2Z A;  3HOU H;  1JJG A;  4EBE A;  2VXW A;  3NK9 A;  3L4J A;  3NWS A;  2XWB B;  2R7Z A;  2KCC A;  3OW7 A;  4R4T A;  1K1S A;  3E9H A;  1LM0 A;  1VMP A;  4LF4 H;  5KKN B;  1HR0 H;  1L2F A;  1RTN A;  2R92 H;  2E5L Q;  3ORR A;  4LF9 L;  2HGS A;  5C1P A;  5EWE A;  3GV3 A;  1A62 A;  4JI3 L;  4X62 H;  3P75 A;  1T9H A;  2B2U C;  4O2D A;  1JB3 A;  4KD3 A;  5IGG A;  3BG3 A;  3QOL A;  1S68 A;  4N8X 1;  2L9H A;  2R8I A;  3A7A B;  4RAU C;  3I8Z A;  4DV5 Q;  1SE4 A;  5BN3 A;  3DMU A;  3HOW G;  4DR2 L;  4EFB A;  3PCO B;  1GLV A;  1PX2 A;  1KJ8 A;  4JBJ A;  5FLM H;  3J81 c;  2KED A;  4GS3 A;  3DM3 A;  4A93 G;  3M7G A;  1Z47 A;  3F2U A;  2I0Q A;  2UUA H;  3VR4 A;  1H9S A;  5KFB A;  2ALZ A;  1PFN A;  2N8N A;  4G7O C;  1CM9 A;  4ME3 A;  1KJI A;  1ZQ7 A;  2K14 A;  4A3M G;  1H9K A;  3FHW A;  3S9W A;  4DV1 L;  2HDM A;  4AH6 A;  4P2C B;  3K5I A;  3QFF A;  1J5E L;  1G6Z A;  3HKS A;  1EY6 A;  1B3A A;  2WII B;  3CCM A;  1YIJ A;  3AFQ A;  2YYZ A;  4POG A;  2R7M A;  2OT2 A;  4HTH A;  5E4W C;  2W6O A;  2V4D A;  4B3S H;  4HR7 A;  2E2H A;  2JSO A;  1H9S B;  4JYA L;  1I4Q A;  2QA4 A;  4LFC Q;  1IKM A;  3H4B A;  1DXM A;  2AQ2 B;  2HVR A;  4WOR A;  1KLG D;  4YJ3 F;  3OTO L;  4CDF C;  4QWB A;  2LMC B;  4GZY C;  1YIT A;  4XYM B;  5K2M A;  1TR5 A;  2P5Z X;  5T14 A;  1SFO H;  2F0D A;  1QB5 D;  1V1O A;  3J81 j;  2FLP A;  2QEX A;  2W6Q A;  1SCU B;  1B1Z A;  3KHR A;  2PNR C;  1RTO A;  1NNX A;  3EVQ A;  1HNX Q;  4OHJ A;  5EBD A;  2YTX A;  5BR8 Q;  1H9M A;  1NAP A;  4CKB A;  3J81 i;  4IWY A;  4HR7 B;  4HCE A;  5FO8 B;  2E2H B;  2JP1 A;  1WR2 A;  4DR3 H;  4GC6 A;  2JEF A;  3I70 A;  3JRW A;  4JI5 L;  4O1N A;  3MZ5 A;  2YTY A;  1YJ9 A;  3C2P A;  5JPN C;  4YWM A;  1N33 Q;  4JK1 C;  5KFW A;  1TQO A;  1I4P A;  4CDD C;  4A3F G;  4JI7 Q;  2O2L D;  4P72 A;  2K4K A;  2R7K A;  3KYH C;  5L1I A;  2C22 A;  3K5M A;  4YAK B;  1E2Z A;  3I4O A;  1E0B A;  3KF6 A;  5ELC A;  3I12 A;  2Z0S A;  4YP3 A;  1Y8O B;  5KFZ A;  3FDT A;  2F0S A;  4BBS H;  1M6V A;  3I4L A;  1EY7 A;  5D65 A;  1LT5 D;  3I4M B;  3S2D B;  3I55 A;  1N8R C;  4XT1 B;  2QGQ A;  1LUZ A;  3MR2 A;  1W6K A;  5FLX E;  1KC8 C;  2C28 A;  3PW4 A;  4EGV A;  1VQ6 A;  4X66 L;  4DV0 H;  3S14 B;  5EKI A;  1A3T A;  5D1O A;  5KFY A;  4MTD A;  3KF6 B;  1GXD C;  3GQB A;  3VR5 A;  5C0X H;  4IFD G;  2RF4 A;  2CW0 C;  2AUK A;  4NDX A;  4MN3 A;  3CCJ A;  2UXC L;  4GN4 B;  5FK9 C;  1VBH A;  1X56 A;  2BE5 C;  2IMW P;  4HIM A;  3HKZ E;  3HRZ C;  4IUP A;  2FMA A;  2Q8I B;  1HPC A;  5L9X A;  1BDO A;  3NSW A;  5E1F A;  3Q8S B;  2VQF H;  5CB4 F;  3GTP A;  1A3V A;  2E76 C;  4POF A;  2WAQ B;  2F0T A;  3NHH A;  4R4O A;  4A3D H;  1UEA B;  4LUV A;  2EVB A;  3K0Y A;  1BXR A;  4A3B G;  1EFI D;  4YY3 H;  2B2Y C;  2FJZ A;  3L4K A;  5KFV A;  2UXB L;  4DL6 A;  5IT9 L;  2JQO A;  1A9X A;  4YIJ A;  5M3F B;  3T1Y L;  2AGO A;  2XRS D;  4JUZ A;  1XMO L;  2AWN A;  4QY7 A;  1KAB A;  1AE3 A;  3ULP A;  3I72 A;  1S40 A;  3CPW A;  1I6H H;  4DV2 H;  4B3T H;  1N32 Q;  2B29 A;  2VUG A;  1HCZ A;  1S3O A;  2RVL A;  1AN8 A;  1F2L A;  5D3I B;  2FPP B;  5FLX W;  2FLL A;  4TV8 F;  1TII D;  1B33 N;  2MCT A;  3HOV H;  1EYG A;  1E3P A;  3K3V A;  4FU0 A;  4XQQ A;  5KT4 A;  3ERO A;  4BXX H;  4K6D A;  1NCV A;  3L0O A;  4JI4 L;  2A68 C;  1EY5 A;  4RKL A;  1HHV A;  2NUA B;  3BJY A;  1K1Q A;  5CYU A;  1SDF A;  2ZXP A;  2AGQ A;  2B2T C;  2JA8 G;  5BN4 A;  4Y52 H;  5K36 H;  4LSA A;  2K50 A;  4KKT A;  5G3L F;  2KEN A;  2L55 A;  3WO0 A;  1TWA B;  1IOW A;  1B53 A;  4IN3 A;  2O5J C;  2VQE Q;  3S1N H;  3BZD B;  3EFX D;  1S72 A;  3KBX A;  2H5X A;  1ILQ A;  2QF7 A;  2UUC Q;  3K7A B;  3HOY G;  1S0N A;  1V8Q A;  4IFD J;  1HQR D;  2EPB A;  3GV5 B;  3GV6 A;  5I6W A;  1IYU A;  1I7L A;  2UXD Q;  5COY A;  1HUM A;  3Q8P B;  4ECV A;  4JI2 Q;  5EWF A;  4U7C A;  5JQW A;  4G3I A;  5JJZ A;  3NTK A;  4K2L A;  2B2W C;  1J6Q A;  3K58 A;  2C9O A;  3SHL A;  2N55 A;  5CV7 A;  2DZD A;  5ELF A;  1N34 Q;  4IUN A;  4ZYS A;  1R9T A;  1CFM A;  3LWE A;  2EYP A;  2BE5 D;  1MSH A;  4MHE A;  1WD0 A;  1VQF A;  1BCP D;  4BY7 G;  1FJG H;  3H6M A;  5KGU A;  2BA1 A;  1WFQ A;  3JZI A;  2RSN A;  5JJL A;  1B50 A;  3GIP A;  3KAL A;  4QL5 A;  3FKI H;  1I50 H;  3G7L A;  3T5J A;  1GSA A;  1HNZ H;  3OPO A;  1U4M A;  3HOX B;  5KYL A;  2JA5 G;  2EJM A;  3QZ8 A;  1R9T B;  1HNW H;  5F9L A;  4F7X A;  3LNN A;  4J15 A;  3T1H H;  1IYV A;  4MV4 A;  3K8A A;  4DR7 L;  1JWU D;  5KFM A;  3IG0 A;  4Z9C B;  1NUC A;  4J8Q A;  3M3Y H;  5KFG A;  1BR9 A;  1VF7 A;  1HRJ A;  2MO0 A;  2R93 A;  2M05 A;  1Q12 A;  3CMA A;  5FLX c;  5KFH A;  4DAM A;  1G8Z D;  5C5J A;  3A8J E;  2F52 A;  1KXL A;  5FJ8 H;  1IZ6 A;  2VNU D;  3M9M B;  4LF8 Q;  3CME A;  4JBW A;  5ELE A;  3RBD A;  4Y7N H;  3I4N H;  5KFQ A;  2A68 D;  4BA2 I;  3M4O B;  4LFB Q;  4NXN L;  3R3O A;  4IOC A;  3K3P A;  5KG5 A;  1IOV A;  2A6H C;  4BY1 H;  4LF4 L;  2HVQ A;  1HR0 L;  4PZ6 A;  2ZJQ A;  2I5L X;  2E2I H;  2AGP A;  4X6A H;  2DPJ A;  2R92 A;  2NVX A;  2D2C C;  3NTI A;  2R93 B;  4U6P A;  4NMZ A;  1YHQ A;  3U58 A;  2A1A A;  3H15 A;  1H95 A;  4QIW A;  4A3G G;  1UAP A;  3GTG H;  3I2Z A;  5KG7 A;  3BG5 A;  3HOU B;  3CQZ H;  1TY2 A;  2B63 A;  4A3K G;  2HDL A;  2FK1 A;  1E24 A;  1E4F T;  2XIG A;  4ZAI A;  4WRD A;  1EZ1 A;  3UI2 A;  2UVV A;  1KRS A;  4F50 A;  1JKJ B;  1DOL A;  1F9S A;  3EPI A;  3RUZ A;  5EQ0 A;  1Y1W A;  1A15 A;  4X65 Q;  1SJH D;  2R92 B;  4UCS A;  4LF7 Q;  1LLR D;  1TT2 A;  3NQI A;  3NUC A;  4KN4 C;  1TWG A;  4B3R L;  4UDU C;  4DL2 A;  4FXG C;  1TWC A;  2I8C A;  4J9Q A;  4FS1 A;  1I7N A;  1L1O A;  1SAP A;  3BVZ A;  4QIW B;  4YBZ B;  1L1O C;  1TWF H;  4J9O A;  1LAC A;  1PH2 A;  2MQH A;  5CBE E;  3WWV A;  1A3U A;  1Y8P B;  2B63 B;  1Y69 U;  5D1P A;  1PRT F;  3Q0A A;  3IRB A;  4IPC A;  2NU8 B;  2HHH H;  2DJF C;  4XDX A;  4A3C G;  1XWE A;  5LOV F;  1VQO A;  1R4P B;  2XTI A;  2YL2 A;  4L63 B;  2ZTD A;  3VPD A;  1GSO A;  1Y1W B;  3NTH A;  1C8C A;  1B3Q A;  1I94 H;  3D6W A;  3BU2 A;  1ENF A;  4C5C A;  4DR5 H;  3OOC A;  2IA6 A;  3RJ0 A;  2A6E D;  1CT1 D;  4F8M A;  1JDE A;  1TWC B;  4ECR A;  1Q46 A;  3JSL A;  3S24 A;  4HCS A;  1CUK A;  3IAY A;  4ED8 A;  1S03 G;  2IY5 B;  3ETH A;  2R7N A;  4BS9 A;  1QE6 A;  1XTD A;  5IY0 A;  4NXM L;  3GV7 B;  2J4X A;  3NBH A;  2XD4 A;  3J81 L;  5IWA L;  3BZK A;  2F0Q A;  2NVY A;  1SBB B;  2R7Z H;  5F9N A;  2IT1 A;  2HJW A;  2R7D A;  2ZJR A;  2PI2 E;  4DR3 L;  2SCU B;  1S4Z A;  4LMQ D;  4DAP A;  4EQO A;  1D8L A;  4DK3 C;  4DV4 L;  2A6H D;  1W2B A;  1U4L A;  4MTK A;  1SFO B;  1E2W A;  4MA0 A;  5KFL A;  3CU7 A;  4NW2 A;  1SNM A;  1V1P A;  2IX0 A;  1K8O A;  4LF6 H;  4AYB E;  4DR2 H;  5IT9 W;  2EE1 A;  1EYA A;  3D8G A;  2W8K A;  1VQ4 A;  3GTM A;  1YVC A;  5AFW A;  1YJW A;  4L5T A;  2SNM A;  1ESF A;  4GLA C;  3AU7 A;  5EAY A;  5F2D A;  2ZM6 Q;  5KFS A;  4OWX B;  2SDF A;  3G48 A;  5HUR A;  3S16 B;  1LTB D;  1IBK Q;  5KG6 A;  4C2M A;  2YRW A;  1V1P B;  2EIF A;  1JIC A;  1HFG A;  5KFP A;  1J5E H;  1CI3 M;  3PV0 A;  4XT3 B;  3K5N A;  3R8B A;  3GTM B;  1XX8 A;  3MVV A;  4JOI A;  3ULJ A;  1S0O A;  5C3E H;  3F2D A;  4BBS B;  1N33 L;  4BWG B;  1B44 D;  3W5O A;  2E2H H;  4RNM A;  3RF2 A;  2OTL A;  4ME6 A;  3BDL A;  5IYB G;  3T56 B;  3OTO H;  2N88 A;  1F9P A;  3T5L A;  2K75 A;  3TME A;  2KHI A;  2XGT A;  2IHE A;  3UQ8 A;  1ASZ A;  2UVU A;  2WKC A;  4RMF A;  4DR6 Q;  3W1G A;  2EJF C;  3NE5 B;  2F4V L;  3PF4 A;  3HOZ H;  1CE8 A;  1KNE A;  2A5H A;  3T1Y H;  4DV6 L;  3H09 A;  1CSP A;  1C4Q A;  2K5Q A;  1JC7 A;  2R82 A;  4FBT A;  3AB9 A;  1WOC A;  1WTO A;  4ME5 A;  1CHQ D;  2YZM A;  4ZHQ F;  4DN4 M;  2DY8 A;  3EN2 A;  3L9A X;  3H20 A;  4JI5 H;  3I4M H;  2C2E A;  2CFM A;  4G7Z C;  2J9G A;  3GD7 A;  2PW7 A;  2UUB Q;  2YS7 A;  3IFT A;  4JI6 Q;  3S14 H;  1XPR A;  1SMY C;  3UDX A;  4J6H A;  1OXS C;  4DR4 Q;  3VYT A;  4C3I B;  4GNX B;  1LO5 D;  4O3R A;  5EGT A;  5KG2 A;  3DWA A;  3H0G H;  1VQ5 A;  4RHS A;  4ABN A;  1I6H B;  5KNB A;  3T16 A;  4DV3 L;  5H1S E;  4A3E G;  1WCM A;  3KF8 B;  3UFX B;  3PN1 A;  1TS4 A;  3HOV B;  1BJT A;  2CQA A;  1S5E D;  4ECX A;  1F9R A;  2F0V A;  1SE8 A;  4KI0 A;  1JOK A;  3D6C A;  2F0K A;  4MTN A;  4X66 H;  4N9T A;  4O42 A;  2JYO A;  2L11 A;  2VOB A;  4H44 C;  1KTK A;  3N8D A;  5C6A A;  1ZHQ A;  5I4D A;  2GA4 B;  4JI0 L;  5EZY F;  3MR5 A;  3FDS A;  2DNE A;  3CVZ A;  2UXC H;  1JCK B;  3GTO A;  4LFA Q;  2XIW A;  3N43 B;  4A76 A;  5EKL A;  3S1N B;  1RK6 A;  2ASJ A;  3GTP H;  5EBC A;  2RHQ B;  4TRD A;  3DEP A;  4UAI A;  3F2B A;  3Q24 A;  1FJG L;  3KFU A;  2DPI A;  2EYF A;  4RZR A;  1S5F D;  4ZLT F;  2R84 A;  2F0W A;  2K28 A;  3A54 A;  1JE4 A;  4IPG A;  5C44 H;  3MFH A;  2UXB H;  1Z9F A;  5ELB A;  3R2I A;  3C46 A;  4EBC A;  1KJQ A;  2RGV A;  2F3V A;  3J81 E;  2NVQ H;  3LML A;  2UUC L;  4UP8 A;  5DG9 A;  3V6H A;  1D5Z C;  5CC4 A;  5DQH A;  3EPG A;  3N40 P;  5JOB A;  1EY9 A;  4UCU A;  5DQG A;  5KEE A;  4ZKB B;  3PR5 B;  2UXD L;  3P1H A;  5LMN Q;  1SRU A;  1QVC A;  5CV9 A;  2CZG A;  3OHB A;  3CCV A;  4IRD A;  4LF5 Q;  3EA6 A;  4BBR B;  4JI4 H;  3FKI B;  1I50 B;  3RGZ A;  4UPA A;  4DUY L;  2VUM G;  4B3M L;  4GKJ L;  3TZU A;  1PRT B;  2Q2H A;  3G6X A;  4I7Z C;  4B9X A;  2Z6K A;  3C1E A;  4OO1 H;  1SMY D;  1ML0 D;  4CGY B;  4Y8V B;  1J8I A;  4FVM A;  1O7Y A;  4C5A A;  2XCL A;  3GQC A;  1B4O A;  3S1R B;  1VF5 C;  2QDL A;  2JEI A;  2NU7 B;  4GOP B;  3BAA A;  2ICI A;  2IPK D;  2KHS A;  1HA6 A;  2JEJ A;  1EUC B;  1L0X B;  3NXW A;  2IX1 A;  1DV2 A;  1S97 A;  3KDF A;  3J81 W;  1TWH A;  4Y7N B;  5C4X G;  1V9P A;  2QKI C;  1BCP F;  4XQJ A;  4RGO S;  2V58 A;  3HOX H;  2MPM A;  2Q2I A;  2YZN A;  1R9T H;  1AZQ A;  3JC6 6;  4IUU A;  1L0W A;  3WDN A;  2E2I B;  5FLX L;  4IFD I;  3SGI A;  1XMQ Q;  2RKS A;  3MEH A;  3GTL A;  3SE0 A;  1GUS A;  1ET6 A;  3RZO B;  3GTG B;  3PO3 H;  4XTC S;  3KDF B;  4G4K A;  5GAG C;  2Z9H A;  3CQZ B;  4LFB L;  2PQE A;  3RAQ A;  1TWH B;  1VQP A;  2QEJ C;  2XGP A;  1DGS A;  5DQI A;  4JI1 Q;  3TP8 A;  3G8C A;  1JQY D;  1V1Q A;  1VKZ A;  1I94 L;  1I4H A;  2SNS A;  3HKZ A;  1WTH A;  3A55 A;  1RK5 A;  2BH8 A;  1HTL D;  3M4O H;  3TZD A;  3CHB D;  1KLU D;  2C35 B;  4PWQ A;  4EGQ A;  2KOL A;  1KRT A;  2BQ3 A;  4DR7 H;  3K59 A;  1ICF B;  2HD3 A;  1GGO A;  3Q6S A;  3U9T A;  3URY A;  1RJR A;  1TWF B;  2R93 H;  3KOJ A;  4TV9 F;  1K0S A;  3VR6 A;  1VQB A;  1TKW B;  2LS0 1;  2LKV A;  1I4G A;  4X62 Q;  1KJJ A;  2V59 A;  4DK6 C;  3U50 C;  4GC7 A;  3K57 A;  1EWC A;  3HKZ B;  4LF7 L;  3KAK A;  2ZJP A;  2D0O A;  2W7O A;  2BQU A;  3GIM A;  4NXN H;  3FPU B;  1VQH A;  5IYD H;  1WSC A;  4YR0 A;  1STY A;  1D7Q A;  4MAM A;  3I56 A;  5LL6 S;  2NVX H;  1RYR A;  4A3J H;  3LWB A;  4CJ0 B;  1PH3 A;  1ASY A;  4UFZ A;  3IN5 A;  3A8I E;  2B2U A;  2F0U A;  5EOY A;  3DEO A;  2UUA Q;  2EYH A;  5ELN A;  5L1L A;  3M9B A;  2B63 H;  5IE8 A;  2WKD A;  4DL3 A;  4IPH A;  2R7Z B;  4LF6 L;  3BVM A;  3CP0 A;  1U0L A;  1S5B D;  2XNA C;  2MUY A;  5LP6 F;  4ECQ A;  2K04 A;  5I2Y A;  1Y1W H;  5IP9 H;  4JVZ A;  2DWC A;  4EYH B;  1TWG H;  1T3N A;  1KIX A;  1TWC H;  2YTV A;  3LX0 A;  4MIU A;  1XNR Q;  4B3R H;  1QNU A;  3KAJ A;  4OX9 L;  4KV6 A;  5CBA E;  1SYF A;  3T5K A;  2R7L A;  5J22 A;  2B8G A;  5M3M H;  4CKC A;  4NP5 A;  2AU0 A;  3NEL A;  4ED2 A;  1VQN A;  3S1Q H;  4J0M A;  2CW7 A;  4JBM A;  3J80 i;  1BVS A;  3KJO A;  3D31 A;  5JEA H;  4WJW A;  2VB3 X;  1GO3 E;  1IBM L;  4ZUJ A;  1UE6 A;  2JK8 A;  1BNC A;  3PMF A;  2M00 A;  5JAV A;  1SYE A;  3BQ0 A;  2KJX A;  2O5I C;  1SYC A;  2R3Z A;  2XRQ D;  2KHJ A;  3CC4 A;  1GD7 A;  1VQJ A;  4K0K L;  2JA6 H;  2MNA A;  3G4S A;  2J6S A;  4R8I A;  4NXM H;  4O3O A;  4R8U A;  1IW7 C;  5IWA H;  4Q0F A;  3TEH B;  2EZV A;  1QNK A;  2NVY H;  3GID A;  3JRX A;  4L5Q A;  3KUP A;  4XXE A;  2F0M A;  2NN6 G;  4RWS C;  1EU4 A;  4IAL A;  5C3E B;  2H1E A;  4IUT A;  1KDC A;  3CCQ A;  2YU9 H;  3HOW B;  2FKL A;  3A0J A;  2C00 A;  4IWX A;  4O3Q A;  1SLJ A;  4RAY A;  2R8G A;  1PA6 A;  4EVO A;  5HGQ A;  4DV4 H;  4A93 B;  1STA A;  2I80 A;  4KHZ A;  5KFI A;  1A8V A;  5D14 A;  3D4W A;  2K32 A;  3S16 H;  2UU9 L;  4R8U B;  3RZD H;  2KQ3 A;  3B6Y A;  1SEB D;  3HOZ B;  4LAA A;  4BWS C;  2C2R A;  4DV0 Q;  3FP9 A;  4JI8 Q;  4MV7 A;  2WE6 A;  4A3M B;  3H0G A;  5KRU A;  4IR1 A;  4LFC H;  2DNC A;  5GRO A;  1TS5 A;  4IUR A;  3GTM H;  2EYL A;  2WAQ G;  3D4D A;  3S1M B;  4RB3 C;  4XYL B;  4O4H F;  1I4X A;  2R8J A;  3SR1 A;  5EJW A;  1FKA H;  3RN5 A;  5T1I A;  1SE2 A;  3CCL A;  1GUG A;  5EWG A;  1YHB A;  3QR8 A;  1U4R A;  2GVB A;  1MI2 A;  5IIF A;  2VQF Q;  5M3F G;  4C2M H;  3V6K A;  2AUJ D;  3GTQ A;  2JEG A;  4LMY A;  3H0G B;  5IYC H;  4QCL A;  4A3I H;  2KCN A;  4YB8 B;  4YY3 Q;  4J9P A;  5DLG A;  1RJQ A;  1S9F A;  3T13 A;  1N33 H;  1XDN A;  3MFI A;  4JI7 H;  4ECT A;  4LJZ C;  4DV2 Q;  3V2T A;  3PIO A;  2M2L A;  4B3T Q;  4OIK A;  5C4H A;  4X3K A;  2PN1 A;  5DGA A;  5D1O B;  3GTQ B;  3H94 A;  5IGC A;  2W9C A;  4P73 A;  1FNV A;  1VDZ A;  4FF1 A;  2B2Y A;  1M90 C;  2F4V H;  3T51 B;  4DAV A;  5JVL A;  2Y0S G;  4C3I H;  5M9O A;  1QVF A;  1X54 A;  4DV6 H;  1BCP B;  4L6T B;  3GLK A;  1IW7 D;  5KFU A;  4HNU A;  2JE6 I;  1Q8I A;  3GTP B;  3FVQ A;  1EYC A;  3QB3 A;  2F0P A;  1ZEQ X;  2AMC B;  2EY1 A;  4ED1 A;  4O0A A;  3JAM i;  1I4R A;  2W9C B;  4HSV A;  1MBY A;  1SMX A;  5EPJ A;  1JX4 A;  3J7A 5;  1SJE D;  3VA5 A;  3PO2 H;  3M85 A;  1Z2N X;  2B2T A;  5C44 B;  5ELO A;  1PYW D;  4AQY Q;  2RGR A;  1Y1V G;  3HBL A;  2PI2 A;  2NVQ B;  5AJ3 L;  2D62 A;  5LMU L;  3M4P A;  1SNC A;  1WCM H;  2F0N A;  1CKM A;  3X3M A;  4DV3 H;  1MGS A;  1PH4 A;  4M9U A;  2K5W A;  4HAE A;  2AQ1 B;  1UE5 A;  4C1N I;  4C5B A;  1AN7 A;  2E2J B;  5KT5 A;  1BGW A;  1QWY A;  1SSO A;  3MXG A;  4DL4 A;  3DXJ C;  4OEL B;  2ZXR A;  1PH7 A;  1SR3 A;  1IBL L;  4IUQ A;  1E4G T;  3U9S A;  3KLW A;  2DUD A;  3N42 B;  2AQ4 A;  2NTT A;  3BAB A;  3RB6 A;  3OWF A;  4AYB A;  2W6N A;  2EY5 A;  1HZA A;  2ZXO A;  2GLT A;  4JI0 H;  3R5X A;  2B2W A;  2AKW B;  1HFN A;  4A3B B;  1PV4 A;  3GTO H;  3DF7 A;  2DY7 A;  2QIL A;  3F8T A;  1HNZ Q;  2CW0 D;  3MWD A;  1LYL A;  5DNF A;  5KFD A;  2IX3 A;  1HNW Q;  4NLG A;  1B6S A;  2JA7 G;  3Q8R B;  1YEZ A;  2HCI A;  3RN2 A;  3T1H Q;  3Q2O A;  3G6E A;  1LTG D;  4ZCK A;  4I65 A;  4C3H G;  2IWH A;  2L15 A;  4AYB B;  4QWD A;  4BBR H;  5C5M A;  5E4X A;  1VMC A;  4DFA A;  2CQO A;  2KUM A;  4DUZ Q;  1NMF A;  2LFN A;  5IP7 G;  2BOS A;  2FPI B;  2MHV A;  2PBZ A;  1SND A;  1JT8 A;  1Q81 C;  1VQ8 A;  4IZO A;  1UE7 A;  4A4I A;  3MWE A;  4KTA A;  2UUC H;  2WAC A;  5J3B A;  1U4P A;  1BUV T;  5KNC A;  4DV7 L;  4JV0 A;  1KNA A;  2RDG A;  4C3J B;  4OGQ C;  5J2U F;  1XXG A;  2RDH A;  4XIG S;  3RGX A;  4ECW A;  1LTI D;  4UY8 C;  2UXD H;  3S1R H;  1WTW A;  3NP8 A;  3ND8 A;  3HOU G;  3MA2 B;  3PO3 B;  3PIP A;  2P0A A;  4MTE A;  4S3S A;  1EIF A;  3RB4 A;  2RBM A;  2J0T D;  5COR A;  3HOY B;  1GUN A;  1PDQ A;  4DUY H;  4JV2 A;  5C8Y F;  3BDO A;  1X3F A;  4B3M H;  4GKJ H;  1S0M A;  2K1B A;  2R92 G;  1AZP A;  3MFY A;  3G71 A;  1LTS D;  4B08 A;  4JV5 L;  3K5H A;  4ED7 A;  1PMR A;  3R5H A;  5BMV F;  3RB3 A;  2EY2 A;  4YAJ B;  2R6G A;  1RF2 D;  4QMG A;  1FGB D;  3WO1 A;  4IQZ A;  2O03 A;  2JA5 A;  1E7Z A;  4K5X A;  1AE2 A;  5KYI A;  4LH6 A;  4I55 F;  3RLO A;  2FFK B;  1MJE A;  4XYQ A;  2Q2T A;  2JN4 A;  4L5R C;  1XNQ Q;  3ONA B;  3RZO H;  1IL2 A;  5IGE A;  5CA1 F;  4KHP Q;  4LNQ A;  3OUZ A;  3NQT A;  1Z6H A;  2MGS A;  5FLM G;  2EDG A;  4UCO A;  3VDY A;  1TWH H;  2OCE A;  1G91 A;  1GJX A;  4RFB A;  3BYY B;  3H4D A;  2X6L A;  3BZC A;  4JC0 A;  4YQW A;  4RH6 A;  4K14 A;  5JVH 3;  4PMB A;  2HHH Q;  4ILW A;  1EIH A;  1KAW A;  1PTO C;  1RHP A;  2Z1C A;  4QB4 A;  1EHI A;  2NVX B;  3PGZ A;  5C3X A;  2I5M X;  4A3J B;  3W3A A;  3GTL H;  4QW9 A;  3E6Z X;  3PUY A;  4DR5 Q;  2R87 A;  4ED0 A;  3ERS X;  4I4T F;  2FE3 A;  3SK6 A;  3L2P A;  1X3G A;  3TII A;  4LF8 H;  1VBG A;  1UWV A;  5JEA G;  1SXT A;  4O3N A;  1VQL A;  4GKK Q;  3DWP A;  3EYY A;  4LFB H;  1ICW A;  2JA9 A;  2DN8 A;  2RDJ A;  5JVD F;  5LYJ F;  4A3L H;  1A0I A;  4R4Q A;  4TUY F;  2C5C A;  1B04 A;  2E5L L;  1J9O A;  1ENC A;  5KIX A;  4ECS A;  2F3W A;  4RNO A;  1TWG B;  4FF3 A;  1DJR D;  1TVX A;  5IYZ F;  3GII A;  4KJO A;  1F2Z A;  1GUO A;  4OXP A;  2W8L A;  2B2V C;  1L1O B;  5IGB A;  1K73 C;  4H7B A;  4OWT B;  1MSG A;  1B9M A;  2KA7 A;  4DV5 L;  2QYZ A;  1VQG A;  3STB C;  5M3M B;  5DLQ E;  3OSN A;  4LF9 Q;  4UHV A;  2JA6 A;  3S1Q B;  5T1G A;  4QWE A;  4YWL A;  4JI3 Q;  1STE A;  2WTF A;  4O3S A;  2HIV A;  5I9P A;  4A3G B;  2CWA A;  1RKN A;  5GAD C;  4LF7 H;  2KEC A;  2RQX A;  2IP4 A;  1ZKO A;  5KG1 A;  4YWK A;  3ERQ A;  4CDC C;  4DR2 Q;  1FNW A;  2YU9 A;  2FMC A;  2K5N A;  1N36 Q;  4PNY A;  4X3U A;  3PIP 3;  2CWP A;  2A74 C;  2L12 A;  2Y0S E;  5EPK A;  1N48 A;  1X32 A;  1PXU A;  1SNO A;  4DXF A;  2JA6 B;  2NU9 B;  1M8A A;  3NBH B;  3TP5 A;  1B70 B;  2RDF A;  2MP1 A;  3N41 B;  4ZQI A;  4CKE A;  5I47 A;  2NVY B;  4F4Z A;  4BBS G;  2J6T A;  4EFE A;  4IJL A;  4LFC L;  1DIK A;  4QQB X;  1QJO A;  2EOT A;  4DV1 Q;  1EQV A;  2YU9 B;  5LHY 1;  2HUG A;  2ASD A;  1J5E Q;  1D5M C;  1K3R A;  4HED A;  1D1I A;  5JEA J;  2Q8T A;  1PTO D;  5C0X G;  4EQP A;  1X55 A;  3J7A F;  1OXT A;  4HMJ A;  4KKS A;  4OX9 H;  5CA0 F;  4JYA Q;  1W6J A;  1PYS B;  4JV1 A;  1HNX L;  3RZD B;  1SYD A;  5BR8 L;  3KLS A;  3OTO Q;  4I50 F;  4KD4 A;  5KG4 A;  1QOH A;  3E5N A;  2PZW A;  4G7H C;  2XGQ A;  4XX0 B;  5D8D A;  1OXU A;  1M7J A;  1DON A;  4MV8 A;  4K8J A;  4A3D G;  1IBM H;  1X6O A;  3HOW H;  2W70 A;  4YR3 A;  3KHG A;  4JI7 L;  1PVO A;  1GHK A;  2FLN A;  2O4X A;  3DWQ A;  1JDB B;  1LT6 D;  1Q3L A;  3WOE A;  1STH A;  5KFX A;  4A93 H;  4K0K H;  5I9O A;  4C2M B;  1K3B C;  5K5P A;  4JI5 Q;  4J9K A;  4IRC A;  1HH2 P;  4G57 A;  5CMD A;  5JJI A;  1GUW A;  1ZYR C;  3A8K E;  4CDE C;  4A3I B;  1DCZ A;  4HJA A;  4QUF A;  2L0C A;  3ITP A;  4A3M H;  3V6J A;  4RB0 A;  1ROD A;  3HOV G;  2W57 A;  3MHB A;  1XPO A;  1B6R A;  4YCW A;  3PZP A;  3T4A C;  3JAM L;  1GYF A;  3QJY A;  3A56 A;  3S1M H;  2G9H D;  1O78 A;  4BXX G;  2OQK A;  2K05 A;  1YI2 A;  1IBK H;  3ZJY C;  3A74 A;  1NJI C;  1YNJ C;  2WYO A;  4QJF A;  5KND A;  3F2C A;  2ES2 A;  5K36 G;  4EG0 A;  5KG3 A;  2PMZ E;  2UU9 H;  3S15 H;  2FXQ A;  4UCT A;  1BKB A;  5GAE C;  5LL6 b;  3SE7 A;  1P8L A;  3AEV A;  3MJF A;  1CK1 A;  4X66 Q;  3M7N A;  2OWO A;  3HXL A;  1E2V A;  2ATW A;  4GN5 A;  5E3F A;  1QCB D;  4RCO A;  2A73 B;  1MIU A;  5C0X J;  2ATL A;  1TS3 A;  4RAZ A;  5DEH A;  1LAB A;  2UXC Q;  3PUW A;  1WYD A;  4ECZ A;  4LUZ A;  3K6O A;  2E8G A;  1EQR A;  1RL2 A;  4KN7 C;  4CHT B;  2FPG B;  2A69 C;  3PO2 B;  3EQL C;  3TDQ A;  4FF2 A;  3GTQ H;  4ED3 A;  3J80 E;  3BQ1 A;  1BOS A;  4JCV E;  5KX5 F;  5KT3 A;  3GDE A;  1N32 L;  2F0E A;  3D0F A;  4A3F H;  2PZT A;  3C3L A;  4EQ5 A;  4AIM A;  2PVP A;  1WCM B;  3AYH B;  2NTS A;  2F03 A;  2NB0 A;  4EYI B;  2K5V A;  2K5H A;  3T1Y Q;  5KFN A;  4RB2 C;  4HNT A;  5CV6 A;  3RLF A;  1XMO Q;  4PMC A;  3FKI G;  4X64 Q;  4DR1 Q;  4IJH A;  1N56 A;  3Q23 A;  1C0A A;  1FYC A;  2PCF B;  3NWT A;  5G3L D;  2Z6B A;  2GVA A;  4ECU A;  3KHL A;  1CHP D;  2TSS A;  2Z4I A;  3NEN A;  1BBU A;  3MWY W;  1S5C D;  1TA8 A;  2PQA A;  2VQE L;  4JI4 Q;  3GTO B;  4J9M A;  3U4V A;  4R4I A;  2F0O A;  1EU3 A;  3CCS A;  1JE5 A;  1ZYR D;  1CKO A;  4IFD H;  2V4R A;  2G9D A;  1Y8N B;  2FK2 A;  1AW7 A;  3TQT A;  1VQ9 A;  4RG1 A;  2CHB D;  3I7F A;  5FJ8 G;  5L1K A;  4JI2 L;  2NN6 I;  3T5H A;  2E2J H;  4MZ9 A;  1VQI A;  3I4N G;  2DLN A;  1KDB A;  2TMP A;  3J80 W;  3TP7 A;  4Q8F A;  1TXY A;  2KEE A;  1YBY A;  4MV9 A;  1YNJ D;  1A2U A;  2PQA B;  5L37 A;  2FP4 B;  4BY1 G;  4CJ1 B;  1N34 L;  1VAJ A;  1CS0 A;  1MHW C;  4FS2 A;  3LWU A;  4DU9 A;  5JVG 3;  4O3P A;  2XC9 A;  4RUC A;  2LSS A;  1XPU A;  1KAA A;  3CPF A;  5LMU H;  4A3B H;  1S5D D;  3AQQ A;  3CC7 A;  2YZG A;  4J9S A;  3TS0 A;  2K03 A;  3KBG A;  1WJJ A;  3GO5 A;  3FMA A;  4TKO B;  4ZI7 F;  4FNF A;  1V4Y A;  3CF5 A;  5JUM A;  4DUZ L;  1Q90 A;  4GOP C;  2H4O A;  4MV3 A;  5IOD A;  3RIZ A;  3RNU A;  5KT7 A;  1I5F A;  1IBL H;  2J6U A;  1ET9 A;  1WVL A;  1I3Q A;  2A69 D;  4R7R A;  1E22 A;  5I6Y A;  1OWT A;  2F4I A;  4N9P A;  1KC7 A;  3RV4 A;  3I73 A;  4J9N A;  4RGN A;  4YHH Q;  4QUC A;  5KFT A;  1PFB A;  3A5Z B;  3OMG A;  3Q1K A;  2VUM A;  1HZC A;  5KFJ A;  4FBU A;  2ICE C;  2FB9 A;  1W3S A;  2JA8 H;  4C3J H;  2VS1 A;  4LF5 H;  1PHJ A;  3OUU A;  3QIA A;  1EUJ A;  4DKA C;  1EWH A;  2WB1 G;  4UP7 A;  4ETS A;  2IBK A;  1EZ8 A;  5CR3 A;  4LF8 L;  4DR7 Q;  2F0J A;  1LV9 A;  3HKZ G;  4PZ8 A;  1M4V A;  1I3Q B;  2F1M A;  1SN8 A;  2ID0 A;  3HOY H;  3S17 B;  3KHH A;  3EIV A;  1D6E C;  2KBN A;  1EYZ A;  2EYJ A;  1ILP A;  1M1K C;  3PSI A;  1JIH A;  4ULL A;  2C2D A;  2PW5 A;  2L1B A;  4DV7 H;  1CA6 A;  1WH2 A;  1TU2 B;  5LXT F;  1RJT A;  2WIN B;  3GTL B;  3F8N A;  5HBR B;  1Q1B A;  4RGM A;  1EY0 A;  4KHP L;  3PW2 A;  4OON A;  4NXN Q;  3JAM E;  4IZ8 A;  3J7Y W;  1K8G A;  2D9U A;  5FO9 B;  1QZH A;  1QG7 A;  5CV8 A;  1VQD A;  4LF4 Q;  1HR0 Q;  4KKU A;  2R7Z G;  3H40 A;  5E7N A;  1ZHS A;  3C1F A;  1B7Y B;  1VS0 A;  1X9N A;  4FF4 A;  1K83 A;  1O7Z A;  4UCR A;  4BY7 H;  1EWI A;  3QOJ A;  3GIQ A;  4X65 L;  3J80 c;  2PPB C;  2CW8 A;  4LUO A;  2VZA A;  2RA4 A;  4ZKC B;  2VY3 A;  2F0H A;  1GVP A;  3RB0 A;  4JV5 H;  2R86 A;  2F0I A;  3CW2 C;  2CH4 A;  1CKN A;  4H0L C;  4IPD A;  4JG2 A;  2KVM A;  4GKK L;  2JA5 H;  2J7Z A;  3I91 A;  3HB9 A;  4RGT A;  3TRZ A;  1BBW A;  2MO1 A;  5DG8 A;  2I46 A;  2N49 A;  2R7F A;  4B3R Q;  1GHJ A;  2E74 C;  4KY6 A;  4HYK A;  4Q0Y A;  1WTR A;  4V0B A;  2NZH A;  1AUX A;  4RUA A;  1HQM C;  4H02 A;  3FEW X;  3U9O A;  4WD3 A;  1DYQ A;  4K5V A;  1JWS D;  1PTO H;  3BQ2 A;  5M5Y B;  4DGZ A;  1EQQ A;  1DZ1 A;  1CKN B;  4HJ7 A;  4IR9 A;  3RTX A;  1XJV A;  4A75 A;  3JAM W;  3JSN A;  2W9A A;  4B3S Q;  2ENB A;  3C0F B;  2W6P A;  2OXP A;  5JH7 F;  3GTJ H;  3RBE A;  1N9W A;  2E2D C;  3L3O C;  3BVG A;  5C3E G;  4O4L F;  5EDW A;  5IGD A;  1T94 A;  4Q5V A;  4K2K A;  4C56 C;  4XYO A;  1V51 A;  4A3G H;  1LT3 D;  4MV1 A;  1N36 L;  4NXM Q;  4H13 C;  2E5L H;  1C30 A;  5CV4 A;  1X3Q A;  5IWA Q;  3CC2 A;  2DGY A;  1U9R A;  4C1N K;  4A3K H;  4WJ4 A;  1JOQ A;  1BO0 A;  1CQF A;  2EY6 A;  1Q7Y C;  1STG A;  5J1Z A;  4DR3 Q;  3NBI A;  4QGU A;  4O4I F;  2FIN B;  3H91 A;  4FO2 A;  1RCV D;  1A63 A;  3VYU A;  1HZ9 A;  3HOZ G;  4DV5 H;  1HJP A;  4FM9 A;  2ZTC A;  4ED6 A;  2L4N A;  4DV4 Q;  4N8F A;  5DM7 3;  5A2Q L;  4QW8 A;  5J39 A;  2VA3 A;  5DG7 A;  4KY7 A;  2XSC A;  4JBK A;  3RUP A;  2BQR A;  1CZW A;  1XNR H;  2ZM6 L;  4DPG A;  3I4M G;  5IGF A;  3E0E A;  4IAJ A;  4RNN A;  3P7J A;  1BNZ A;  4A3C H;  1IBK L;  4NB3 A;  1YNN C;  1AH9 A;  5ELD A;  2QW7 A;  1CQI B;  2UVR A;  4HIK A;  4M7E A;  1ENA A;  3H0G G;  3CD6 A;  1TY0 A;  4RZQ A;  4DL5 A;  3MXP A;  4UCV A;  1NE3 A;  2RHS B;  4RA8 A;  2X69 A;  1I6V C;  1PTO F;  2HCC A;  2PNH A;  2JEA I;  3HFZ B;  1DV1 A;  1EIY B;  2ZDQ A;  3PF5 A;  3GIK A;  2CKZ B;  5M5W H;  4OWW B;  2Z4H A;  3BA8 A;  4BA1 I;  5KT2 A;  5KFR A;  5BN5 A;  4FXD A;  4HMI A;  5KFA A;  2BR0 A;  1DM0 B;  4EBD A;  4DR6 L;  1MJC A;  5CAE B;  1NR2 A;  4FXK C;  4R4C A;  4WJ3 M;  3TP6 A;  1ZET A;  3MXN A;  3JAM c;  2B8F A;  4APV A;  4J1M A;  2RDI A;  1HZB A;  1VQC A;  1EEF D;  1R4Q B;  1K8A C;  3S15 B;  5KT6 A;  3MR3 A;  5BR8 H;  1HNX H;  1M0T A;  2V9W A;  2BDO A;  5DGB A;  1VQK A;  1UE1 A;  4L8J A;  1EOT A;  3TSS A;  5IOC A;  3VR3 A;  2F4V Q;  4EEQ A;  1AFP A;  3S2H B;  3FPP A;  1CA5 A;  4DV6 Q;  1LTL A;  4HJ5 A;  2UUB L;  1AUV A;  4PDB A;  2V4Q A;  2W6M A;  1GUT A;  4JI6 L;  3MXN B;  1WD1 A;  3TIN A;  2LY7 A;  1QIL A;  1ULZ A;  1LTA D;  3MXU A;  5C44 G;  4DR4 L;  4OL7 A;  2WAQ A;  1HA5 A;  4HID A;  4JI8 H;  4DF7 A;  1JOO A;  2DJG C;  5D3D A;  3GTK A;  3DM1 A;  3QG1 A;  2JEB I;  2BA0 A;  5M5X H;  4HN7 A;  4HJ9 A;  2E75 C;  4WBN F;  4A3F B;  4L1K A;  3CCR A;  2WB1 E;  4FP5 D;  4TVA B;  1UC9 A;  1YJN A;  1BCP C;  5GAH C;  2W6Z A;  1EYD A;  1PZJ D;  3OHX C;  1LTR D;  1H9R A;  4DV3 Q;  2IW3 A;  1G6P A;  2AQ3 B;  4CBV A;  1O80 A;  4KHV A;  3GTK B;  1EL0 A;  1RD9 D;  4OO1 G;  1YNN D;  4K8I A;  3TN2 A;  1AP0 A;  1PH6 A;  5FD6 A;  5IYB H;  5C5L A;  1IHZ A;  3TRE A;  4LFA L;  3RV3 A;  5H80 A;  3RR5 A;  3L7Z C;  2LXJ A;  5ISR A;  1G29 1;  4X64 L;  4DR1 L;  2Z8L A;  1PH1 A;  2OTJ A;  4JI0 Q;  3VYS A;  4IOA A;  2X0S A;  1TWA A;  2Y0S A;  3P20 A;  1LTT D;  3K0X A;  4AYB G;  3K80 C;  1KDA A;  3LGJ A;  5C1O A;  4MNO A;  4P74 A;  1HTP A;  3BYT B;  1PZI D;  3MWM A;  3HOX G;  2FK3 A;  2R61 A;  5JJK A;  1VQA A;  3ULL A;  2XVS A;  4GN3 B;  1C3O A;  3VPC A;  1ZXT A;  1FJG Q;  3GV8 B;  3PW5 A;  4KMU C;  1BF4 A;  3H3V C;  2F0L A;  5C0X I;  2VA2 A;  4C3J G;  4ODG A;  2CQY A;  1N32 H;  3PQI A;  1JJC B;  4IO9 A;  4KJN A;  5LMN L;  1KD1 C;  3MC0 B;  2YS6 A;  2OEO A;  3PO3 G;  2Y0S B;  3F1Z A;  3J7A V;  4R1J A;  1Y1V A;  2CH4 W;  4LF5 L;  1M0W A;  5J2T F;  3A7L A;  4A3E H;  1E4E A;  4AQY H;  4TQU S;  3J7A K;  3WNZ A;  2F0F A;  1YHA A;  3N6X A;  1JLL B;  4JW0 A;  5EPL A;  5BPH A;  1GOZ A;  2FJ2 A;  5FOB B;  2VQE H;  3PUV A;  5A2Q E;  4DUY Q;  2D5D A;  3OYY A;  2B3G A;  1D2B A;  4B3M Q;  4F4W A;  1Y1V B;  4GKJ Q;  2R93 G;  1CTM A;  2JA8 B;  3PUX A;  3D3R A;  3BA9 A;  3TBI B;  3PIO 3;  2EQS A;  5JPM C;  2IJ0 A;  1E4E B;  1KQS A;  1O7I A;  3QZ7 A;  4PZ7 A;  3QO2 A;  4JI2 H;  2UVW A;  3G6Y A;  2HQE A;  4KY5 A;  3PW0 A;  1CQJ B;  2WV6 D;  4YHH L;  2A19 A;  5IYD G;  2JA7 A;  2ZTE A;  1D5X C;  4IRK A;  1XYI A;  3BJU A;  1N34 H;  1FD7 D;  2A6E C;  4P75 A;  1Y14 B;  1WTX A;  3E9I A;  2IL8 A;  3FMC A;  4FDB A;  3WOF A;  5LL6 X;  4A3J G;  2FMM A;  1XMQ L;  2VL6 A;  1KEE A;  4RHR A;  3N52 A;  4F88 A;  3ICE A;  4YJ2 F;  1X3E A;  3EBE A;  1UNN C;  2RCN A;  2XCP A;  4A2B A;  2B63 G;  4K5W A;  3D4R A;  4DUZ H;  1FGU A;  4ZUI A;  4JI1 L;  2PMZ A;  3OW2 A;  1L0Y B;  2YW2 A;  2NVT H;  4MA5 A;  1FNU A;  1NSN S;  2JA7 B;  4DNR B;  4BY7 B;  1I3Q H;  1C48 A;  1Y1W G;  3OHA A;  1SNP A;  5IP9 G;  5KFF A;  1T36 A;  3CRK C;  4ZK9 B;  4C3H B;  3S17 H;  5A2Q W;  2K6A A;  1H9J A;  3CKI B;  1Z7T A;  1JWM D;  2CVR A;  2VUM H;  1PLF A;  4X3S A;  4E4T A;  1W93 A;  5HY6 A;  5M3M G;  5KFO A;  5I2X A;  2JA5 B;  1BQQ T;  1I94 Q;  4HQ6 A;  4GLX A;  2K01 A;  2PMZ B;  1QVG A;  4X62 L;  3DLL A;  3W1B A;  3J80 L;  4DL7 A;  1UEB A;  3RMH A;  1UNS A;  3K7U C;  3N6R A;  3MR6 A;  2WAQ E;  2GPS A;  4F4X A;  3GTJ A;  3U4Z A;  4DNI A;  1KHI A;  2VB2 X;  4CC5 A;  5C4J H;  2QK4 A;  4L5S A;  3V96 A;  1PTO B;  2NYZ D;  3LP8 A;  1KJ9 A;  2YRX A;  2JA6 G;  5C4X H;  2UUA L;  1EIG A;  1SNQ A;  2B2V A;  2BDN A;  1XNQ H;  4FYD A;  4KHP H;  3TIG A;  4LW1 A;  4Q44 A;  3VR2 A;  1LT4 D;  4DK0 A;  2B39 A;  2WP8 J;  3GTJ B;  3SK8 A;  1QUQ A;  1K83 H;  1WTV A;  2OLS A;  5NUC A;  1NTG A;  2Q2U A;  4EGJ A;  4TQS A;  1EOV A;  2R6F A;  5LA6 F;  3M9N B;  1VQ7 A;  1V43 A;  2ASL A;  4X65 H;  4YCV A;  3A5U A;  2HVS A;  1Z2O X;  2R8K A;  1XNR L;  3SXH A;  1BXT A;  4A2A A;  1UUP A;  2X6G A;  4A3K B;  5IT9 E;  3OMC A;  5BPF A;  4B3S L;  5M5Y H;  4ALP A;  4LF6 Q;  1PH5 A;  1QZG A;  2FHT A;  4APM A;  1DOM A;  3UE1 A;  4NPS A;  3R93 A;  5C3W A;  1G2T A;  4GKK H;  1GSH A;  3AFP A;  3DHQ A;  1B2T A;  3MTS A;  2VPQ A;  2JXM B;  2ZDG A;  3RLN A;  4ZOL F;  1QUQ B;  1B9N A;  3TQY A;  3R23 A;  1F9Q A;  4X3T A;  2MFI A;  1RIP A;  1JR0 D;  1YZ6 A;  1NR4 A;  4HNV A;  3UDI A;  1SFO A;  2IHF A;  3ZYY X;  4OX9 Q;  1OO9 B;  5CGK A;  3HGB A;  3E5S A;  1OTC A;  4LSX A;  4IUV A;  3UE0 A;  1IXR A;  2V1C C;  5CV5 A;  3R5F A;  1JXL A;  1VCI A;  4K6L A;  3VPB A;  2NZO A;  1JJ2 A;  2NWG A;  4DAY A;  2G5D A;  3TQ1 A;  2HIX A;  2PO4 A;  5FPR A;  1Q8K A;  4QWC A;  4LF9 H;  3E0J A;  5A35 A;  1CSQ A;  2ZDH A;  2R8H A;  1PH8 A;  1IBM Q;  3PUZ A;  4JI3 H;  4QWA A;  1K28 A;  1EY8 A;  2SEB D;  4R9W A;  3W2D A;  5IYC G;  3M4Q A;  5HGT A;  4A3I G;  2GN5 A;  3OIQ A;  1W96 A;  2OH2 A;  3K81 C;  4J9L A;  1SEI A;  4KK7 A;  4RCN A;  1F2M A;  1EEI D;  4K0K Q;  2NZ1 D;  1U5K A;  3G6J B;  2AWO A;  2PZU A;  1YNX A;  4I7H A;  1N36 H;  4DAY B;  4RKB A;  2K33 A;  3AMU A;  1SYX B;  3CXC A;  2OF1 A;  2XWJ B;  5M5W B;  3HZX A;  1CQV A;  2WFW A;  2GPW A;  1NBW A;  3BS1 A;  2ALY B;  2EYM A;  3V05 A;  1WTP A;  3VMM A;  5C4Z A;  4LK1 C;  1VQM A;  4DV0 L;  3TS2 A;  1EY4 A;  4JI8 L;  4C3I G;  4PMW A;  2EYO A;  3UDF A;  1OXX K;  3Q22 A;  4WFN 3;  1Z2P X;  3ORQ A;  3PR4 A;  4DV1 H;  2EXD A;  3PW7 A;  3STB D;  1BBX C;  1EUD B;  4O2B F;  2KCT A;  1A6X A;  4IHJ F;  1F77 A;  2UU9 Q;  4KLK A;  5EKK A;  4JOI C;  2ZM6 H;  5LMN W;  4YCU A;  4DA2 A;  4YR2 A;  3CCE A;  5DLF A;  4HSP A;  1IYJ B;  4JYA H;  2QCP X;  3FRP B;  4OIJ A;  2VQF L;  4V19 0;  3PO2 G;  3V4S A;  3NPP A;  4EEY A;  3EJI A;  4B9W A;  1T5X D;  3X3N A;  5GON F;  1I6U A;  1SYG A;  5FD5 A;  3SK4 A;  3ETJ A;  4YY3 L;  2EJG C;  2Q8R E;  5M5X B;  1WCM G;  3SI8 A;  3M4Y A;  2SOB A;  3ND9 A;  5FO7 B;  2DIK A;  4GNX A;  4GNX C;  3OIP A;  3CRL C;  4DV2 L;  2VQD A;  1C7Y A;  4HJ8 A;  4B3T L;  1II3 A;  3S2H H;  3KF8 A;  3IKJ A;  1SYB A;  1PYB A;  3RAX A;  2NN6 H;  3S2D H;  4A3D B;  1NMG A;  1Q86 C;  3E3X A;  4DR6 H;  2KCM A;  3VA7 A;  1P16 A;  4OEM B;  1SE3 A;  2PYK A;  4RB1 A;  4Q8E A;  1K8M A;  4QIW E;  4GLV B;  4ZQ3 A;  2CCZ A;  4TSS A;  4TQR A;  2W7P A;  3GIL A;  5KFE A;  1Q82 C;  4DK1 A;  4XQN A;  1XTC D;  2K5D A;  3MEF A;  1NY4 A;  1RYS A;  3M9O B;  1X3P A;  2LXK A;  3BDC A;  4LWC A;  3RD4 A;  2YYA A;  3SVM A;  2UXB Q;  3MFG A;  5IT9 c;  2WDT A;  4RU9 A;  2UUB H;  4BBR G;  1JB7 A;  5KG0 A;  4JI6 H;  4PG3 A;  3M4I A;  4AQY L;  3KXY T;  4U68 A;  4DR4 H;  3SK5 A;  1G2S A;  2I5H A;  3Q8Q B;  2F3I A;  3GTK H;  2I07 B;  2W9B A;  2MJ8 A;  1K9M C;  1TAE A;  3V4Z A;  3VYR A;  3R2T A;  2NUC A;  2ZT9 C;  1PK8 A;  2V5A A;  2RCF A;  2N3S A;  5M3F H;  1PH9 A;  2R85 A;  2K7V A;  4DNT B;  2ZJT A;  5AJ3 Q;  1S10 A;  2XN9 C; 
#chains in the Genus database with same CATH homology
 5LMU Q;  1HR0 W;  1JMC A;  2R7Z H;  4A3G H;  2IT1 A;  2R7D A;  2ZJR A;  1N36 L;  4NXM Q;  2PI2 E;  4DR3 L;  1PH7 A;  1SR3 A;  5IWA Q;  2DGY A;  3CCU A;  1VQE A;  1IBL L;  3CC2 A;  4A3K H;  4WJ4 A;  3KLW A;  2DUD A;  2YV5 A;  1GM5 A;  1HNZ L;  1E1T A;  1Q7Y C;  1HZA A;  1D8L A;  4DR3 Q;  4DK3 C;  4QGU A;  1IBL Q;  4DV4 L;  2AKW B;  1W2B A;  1B8A A;  1A63 A;  1HZ9 A;  3HOZ G;  1PV4 A;  3GTO H;  1HJP A;  1HNW L;  1HNZ Q;  2ZTC A;  3F8T A;  3T1H L;  2OQ0 A;  1LYL A;  4DV4 Q;  1TWA H;  1FVI A;  2IX0 A;  1HNW Q;  1G51 A;  2JA7 G;  1YEZ A;  4AYB E;  3RN2 A;  3K7A H;  4GOP A;  3T1H Q;  3G6E A;  4JBK A;  1E1O A;  2ZM6 L;  1PFS A;  4DPG A;  3I4M G;  3E0E A;  1VQ4 A;  1YVC A;  2L15 A;  1YJW A;  4L5T A;  4BBR H;  4A3C H;  2CQO A;  4GLA C;  4DUZ Q;  1NMF A;  2JJQ A;  1IBK L;  5IP7 G;  1FL0 A;  1WI5 A;  3Q8D A;  4NB3 A;  5EAY A;  1AH9 A;  2ZM6 Q;  1JT8 A;  1Q81 C;  4OWX B;  1VQ8 A;  1X65 A;  3G48 A;  4HIK A;  1UE7 A;  2Z6K C;  4A4I A;  2N78 A;  2HT1 A;  3H0G G;  5J3B A;  3CD6 A;  4DV7 L;  1IBK Q;  1GKH A;  1KL9 A;  1NE3 A;  1Y1V H;  2EIF A;  4XIG S;  4EX5 A;  4UY8 C;  2RHS B;  3S1R H;  2BH2 A;  3HOU G;  4DV7 Q;  2PNH A;  2JEA I;  3PV0 A;  3PIP A;  3HFZ B;  4A3L G;  4HIO A;  1EIF A;  3ULJ A;  4JOI A;  2A8V A;  1EIY B;  5C3E H;  3F2D A;  3PF5 A;  1N33 L;  2E2H H;  3W5O A;  2CKZ B;  5M5W H;  2VW9 A;  4OWW B;  4BA1 I;  2OTL A;  1K0R A;  1X3F A;  3UDG A;  5IYB G;  2R92 G;  3J7Z C;  4DR6 L;  1MJC A;  4R4C A;  4WJ3 M;  2K75 A;  3JAM c;  3G71 A;  2KHI A;  2XGT A;  2IHE A;  4APV A;  4JV5 L;  1HZB A;  1VQC A;  1K8A C;  1ASZ A;  3KJP A;  2R6G A;  4P71 A;  4RMF A;  4DR6 Q;  1XNQ L;  3W1G A;  1VQK A;  2F4V L;  2ASB A;  3PF4 A;  3HOZ H;  1E7Z A;  1UE1 A;  4JV5 Q;  1AE2 A;  4DV6 L;  1CSP A;  3RLO A;  1EFW A;  1MJE A;  2Q2T A;  4L5R C;  1XNQ Q;  2F4V Q;  3RZO H;  1IL2 A;  1WOC A;  5GQO A;  4LNQ A;  2AHO B;  4KHP Q;  4UP9 A;  5FLM G;  2JA7 H;  3HOV H;  4DV6 Q;  2K52 A;  1LTL A;  2HQL A;  4HJ5 A;  2HHH L;  2UUB L;  3VDY A;  3EN2 A;  1TWH H;  2OCE A;  3ER0 A;  4JI6 L;  3H3V I;  3MXN B;  1Q1E A;  3I4M H;  3BZC A;  3NEM A;  4JC0 A;  4C3H H;  2CFM A;  5C44 G;  4DR4 L;  4OO1 I;  3GD7 A;  2HHH Q;  4DR5 L;  4HID A;  2UUB Q;  1KAW A;  1OXV A;  5IP7 H;  4JI6 Q;  3S14 H;  1XPR A;  3UDX A;  1SRO A;  2JEB I;  3PGZ A;  2BA0 A;  5M5X H;  2I5M X;  4HJ9 A;  1OXS C;  3GTL H;  4DR4 Q;  4GNX B;  3PUY A;  3H0G H;  4DR5 Q;  1VQ5 A;  3CCR A;  2WB1 E;  3ERS X;  2D0P A;  4TVA B;  3L2P A;  1X3G A;  1UWV A;  5JEA G;  1YJN A;  4DV3 L;  1VQL A;  5H1S E;  4A3E G;  1C9O A;  3CAM A;  1MKH A;  3KF8 B;  5GAH C;  4GKK Q;  2JA9 A;  3HOU H;  1JJG A;  4A3L H;  1A0I A;  4R4Q A;  4DV3 Q;  2E5L L;  1SE8 A;  1G6P A;  4KI0 A;  4R4T A;  4MTN A;  4OO1 G;  3E9H A;  1LM0 A;  1PH6 A;  5IYB H;  1L2F A;  2R92 H;  4OXP A;  2E5L Q;  3TRE A;  4JI0 L;  4LF9 L;  4LFA L;  1L1O B;  1K73 C;  3RR5 A;  4OWT B;  3L7Z C;  1A62 A;  4JI3 L;  2LXJ A;  4DV5 L;  4O2D A;  1T9H A;  1VQG A;  3STB C;  1G29 1;  5DLQ E;  4X64 L;  4DR1 L;  1PH1 A;  4LFA Q;  4JI0 Q;  4LF9 Q;  4IOA A;  2OTJ A;  4A76 A;  4YWL A;  4JI3 Q;  4DV5 Q;  2HIV A;  3GTP H;  3K0X A;  4AYB G;  2CWA A;  3K80 C;  3LGJ A;  4DR2 L;  2RHQ B;  3PCO B;  4MNO A;  4P74 A;  3HOW G;  5GAD C;  3F2B A;  1FJG L;  3KFU A;  4JBJ A;  5FLM H;  3J81 c;  4GS3 A;  3HOX G;  3DM3 A;  4YWK A;  4A93 G;  4DR2 Q;  1VQA A;  1Z47 A;  3ULL A;  4GN3 B;  2I0Q A;  5JJK A;  2K5N A;  1FJG Q;  1N36 Q;  4IPG A;  5C0X I;  5C44 H;  2CWP A;  1Z9F A;  2Y0S E;  2N8N A;  4IO9 A;  1JJC B;  2NVQ H;  2UUC L;  4UP8 A;  5LMN L;  1KD1 C;  4ME3 A;  3NBH B;  1B70 B;  2K14 A;  4A3M G;  3PO3 G;  3F1Z A;  3FHW A;  4DV1 L;  4R1J A;  4AH6 A;  2UXD L;  4LF5 L;  1J5E L;  5LMN Q;  4BBS G;  1SRU A;  1QVC A;  3HKS A;  4IJL A;  4LFC L;  4QQB X;  4A3E H;  3CCM A;  1YIJ A;  3AFQ A;  4TQU S;  3CCV A;  2YYZ A;  4DV1 Q;  4POG A;  4LF5 Q;  1J5E Q;  1K3R A;  4UPA A;  4DUY L;  4JYA L;  1YHA A;  2VUM G;  2QA4 A;  5JEA J;  4B3M L;  4LFC Q;  4GKJ L;  3OTO L;  2Q2H A;  5C0X G;  1X55 A;  2Z6K A;  1OXT A;  3PUV A;  4JYA Q;  4DUY Q;  1PYS B;  3OYY A;  2B3G A;  1YIT A;  1HNX L;  4B3M Q;  4GKJ Q;  2R93 G;  5BR8 L;  1SFO H;  3OTO Q;  3J81 j;  3PUX A;  2QEX A;  2EQS A;  4GOP B;  1KQS A;  1O7I A;  1HNX Q;  4PZ7 A;  5BR8 Q;  2YTX A;  1OXU A;  3J81 i;  4A3D G;  4YHH L;  1X6O A;  2IX1 A;  3KDF A;  3HOW H;  2A19 A;  5IYD G;  4JI7 L;  2ZTE A;  4JI5 L;  1PVO A;  2YTY A;  3BJU A;  1YJ9 A;  5C4X G;  1V9P A;  4P75 A;  1Y14 B;  3E9I A;  4FDB A;  4YWM A;  4A3J G;  1XMQ L;  3HOX H;  1N33 Q;  2VL6 A;  4A93 H;  4A3F G;  2Q2I A;  4JI7 Q;  4P72 A;  4JI5 Q;  2K4K A;  3ICE A;  1R9T H;  3KYH C;  1HH2 P;  3JC6 6;  1L0W A;  1X3E A;  3EBE A;  4IFD I;  5JJI A;  2RCN A;  3I4O A;  3SGI A;  1XMQ Q;  3KF6 A;  2B63 G;  4HJA A;  1FGU A;  2Z0S A;  4JI1 L;  4A3M H;  3PO3 H;  3OW2 A;  3HOV G;  1XPO A;  2NVT H;  4XTC S;  4YCW A;  3KDF B;  5GAG C;  4LFB L;  4BBS H;  3S1M H;  4BXX G;  2OQK A;  1I3Q H;  1VQP A;  1YI2 A;  1Y1W G;  1DGS A;  3ZJY C;  3A74 A;  4JI1 Q;  5IP9 G;  3I55 A;  1N8R C;  3S17 H;  2QGQ A;  1LUZ A;  1NJI C;  1V1Q A;  1KC8 C;  4QJF A;  1I94 L;  1VQ6 A;  3F2C A;  4X66 L;  2BH8 A;  2ES2 A;  3M4O H;  5K36 G;  2VUM H;  2PMZ E;  2C35 B;  5HY6 A;  3S15 H;  2FXQ A;  3KF6 B;  1BKB A;  1KRT A;  5M3M G;  5GAE C;  4IFD G;  2RF4 A;  1P8L A;  1I94 Q;  3AEV A;  4GLX A;  4X66 Q;  3M7N A;  1QVG A;  4X62 L;  2OWO A;  3DLL A;  3CCJ A;  2UXC L;  2ATW A;  4GN4 B;  4GN5 A;  3KOJ A;  3W1B A;  2R93 H;  1X56 A;  1UEB A;  1MIU A;  5C0X J;  3K7U C;  4HIM A;  3HKZ E;  1VQB A;  2WAQ E;  4X62 Q;  3U4Z A;  4DNI A;  2UXC Q;  4DK6 C;  1KHI A;  3U50 C;  3PUW A;  1WYD A;  4LUZ A;  5C4J H;  4POF A;  4LF7 L;  4L5S A;  2E8G A;  1EQR A;  1RL2 A;  4R4O A;  2ZJP A;  2D0O A;  4A3D H;  4LUV A;  5IYD H;  1VQH A;  3GTQ H;  2JA6 G;  4A3B G;  1D7Q A;  5C4X H;  2UUA L;  3I56 A;  4JCV E;  2NVX H;  4A3J H;  2UXB L;  1PH3 A;  2JQO A;  3GDE A;  1ASY A;  1N32 L;  3D0F A;  3T1Y L;  4LW1 A;  4A3F H;  1XMO L;  4EQ5 A;  4AIM A;  2AWN A;  2WP8 J;  3AYH B;  1AE3 A;  4QY7 A;  3ULP A;  1S40 A;  5ELN A;  3CPW A;  2UUA Q;  1I6H H;  1QUQ A;  1K83 H;  2K5V A;  2K5H A;  3M9B A;  2B29 A;  3T1Y Q;  1N32 Q;  1S3O A;  1NTG A;  2B63 H;  5IE8 A;  1XMO Q;  3RLF A;  2Q2U A;  1EOV A;  4IPH A;  3FKI G;  1VQ7 A;  1V43 A;  4LF6 L;  4X64 Q;  4YCV A;  3CP0 A;  4IJH A;  1E3P A;  1U0L A;  3A5U A;  4DR1 Q;  1EYG A;  1XNR L;  1C0A A;  4BXX H;  4B3S L;  3L0O A;  1Y1W H;  4JI4 L;  2GVA A;  5IP9 H;  5M5Y H;  4ALP A;  1PH5 A;  4LF6 Q;  1QZG A;  3NEN A;  1BBU A;  1TWG H;  1KIX A;  1TWC H;  2YTV A;  4NPS A;  3UE1 A;  1XNR Q;  2PQA A;  3AFP A;  2VQE L;  4JI4 Q;  4OX9 L;  2JA8 G;  4Y52 H;  3RLN A;  3U4V A;  4R4I A;  1QUQ B;  3TQY A;  3CCS A;  1JE5 A;  2K50 A;  5M3M H;  2KEN A;  1CKO A;  2MFI A;  3NEL A;  3H3V H;  1RIP A;  1YZ6 A;  1VQN A;  2VQE Q;  3S1Q H;  3UDI A;  2IHF A;  4OX9 Q;  3S1N H;  1S72 A;  1VQ9 A;  3J80 i;  4JBM A;  1BVS A;  2H5X A;  2UUC Q;  4RG1 A;  3I7F A;  5FJ8 G;  1OTC A;  3HOY G;  4JI2 L;  2NN6 I;  3KJO A;  3UE0 A;  2E2J H;  1IXR A;  2V1C C;  4MZ9 A;  3D31 A;  4IFD J;  1VCI A;  1VQI A;  1GO3 E;  3I4N G;  2NZO A;  1JJ2 A;  1IBM L;  2UXD Q;  1UE6 A;  1TXY A;  2JK8 A;  2HIX A;  5C3E G;  1YBY A;  4JI2 Q;  1Q8K A;  2PQA B;  4BY1 G;  1N34 L;  1CSQ A;  1PH8 A;  1IBM Q;  2KHJ A;  3PUZ A;  1J6Q A;  3CC4 A;  1GD7 A;  1VQJ A;  4K0K L;  5IYC G;  2LSS A;  3M4Q A;  3CPF A;  1XPU A;  4A3I G;  2JA6 H;  2MNA A;  4A3B H;  2GN5 A;  3AQQ A;  3CC7 A;  3G4S A;  1N34 Q;  3TS0 A;  3K81 C;  1WJJ A;  3GO5 A;  3TEH B;  4K0K Q;  2NVY H;  3CF5 A;  1U5K A;  1VQF A;  4L5Q A;  2AWO A;  4DUZ L;  4BY7 G;  4GOP C;  2NN6 G;  1YNX A;  4DAY B;  2BA1 A;  1WFQ A;  3RNU A;  1I5F A;  3CXC A;  5JJL A;  3CCQ A;  2YU9 H;  3A0J A;  2WFW A;  4QL5 A;  3FKI H;  1I50 H;  1SLJ A;  1NBW A;  2ALY B;  1E22 A;  1PA6 A;  5HGQ A;  2JA5 G;  4KHZ A;  4YHH Q;  1VQM A;  4DV0 L;  1A8V A;  3TS2 A;  4JI8 L;  3A5Z B;  4PMW A;  3S16 H;  2UU9 L;  1HZC A;  4J15 A;  3RZD H;  3UDF A;  1OXX K;  3K8A A;  4DR7 L;  3B6Y A;  1W3S A;  2EXD A;  4C3J H;  2VS1 A;  3STB D;  2JA8 H;  1PHJ A;  1EUJ A;  2KCT A;  3FP9 A;  4JI8 Q;  4DKA C;  4DV0 Q;  3M3Y H;  2WB1 G;  4UP7 A;  2UU9 Q;  2MO0 A;  4KLK A;  5GRO A;  4LF8 L;  4DR7 Q;  1Q12 A;  4JOI C;  3CMA A;  3GTM H;  3HKZ G;  4PZ8 A;  2WAQ G;  4YCU A;  5FLX c;  5LMN W;  4DAM A;  3CCE A;  1IYJ B;  1SN8 A;  2F52 A;  2ID0 A;  5FJ8 H;  1IZ6 A;  2VQF L;  3HOY H;  2VNU D;  1KXL A;  3PO2 G;  3RN5 A;  3CME A;  4JBW A;  3EIV A;  4LF8 Q;  3CCL A;  2KBN A;  4Y7N H;  3I4N H;  1YHB A;  1M1K C;  3PSI A;  4BA2 I;  4LFB Q;  2GVB A;  4NXN L;  2VQF Q;  5M3F G;  4IOC A;  4C2M H;  4YY3 L;  4BY1 H;  4LF4 L;  1HR0 L;  4PZ6 A;  2ZJQ A;  2I5L X;  1WCM G;  2E2I H;  1Q1B A;  4X6A H;  4KHP L;  4OON A;  4NXN Q;  5IYC H;  4GNX A;  4A3I H;  1K8G A;  4GNX C;  1QZH A;  1YHQ A;  1VQD A;  4YY3 Q;  4DV2 L;  3U58 A;  2A1A A;  3H15 A;  1HR0 Q;  1C7Y A;  4LF4 Q;  2R7Z G;  3GTG H;  4HJ8 A;  4A3G G;  5E7N A;  1H95 A;  3I2Z A;  4B3T L;  1B7Y B;  1VS0 A;  1X9N A;  3CQZ H;  3S2H H;  4A3K G;  1EWI A;  4BY7 H;  1PYB A;  4DV2 Q;  1E24 A;  4X65 L;  3J80 c;  3PIO A;  3S2D H;  1NMG A;  4B3T Q;  4LUO A;  1Q86 C;  2VZA A;  2KCM A;  1KRS A;  1P16 A;  2VY3 A;  1GVP A;  4P73 A;  4X65 Q;  4QIW E;  4GLV B;  2CCZ A;  3CW2 C;  1M90 C;  1CKN A;  4IPD A;  4LF7 Q;  4JG2 A;  4GKK L;  4B3R L;  1Q82 C;  2JA5 H;  2Y0S G;  1L1O A;  3MEF A;  4C3I H;  1QVF A;  1NY4 A;  1L1O C;  1X54 A;  3TRZ A;  1BBW A;  1TWF H;  2MO1 A;  1PH2 A;  2MQH A;  2LXK A;  2N49 A;  2R7F A;  4LWC A;  3WWV A;  4B3R Q;  2JE6 I;  2UXB Q;  5IT9 c;  3IRB A;  4IPC A;  4BBR G;  2AMC B;  2NZH A;  4A3C G;  1JB7 A;  4H02 A;  1VQO A;  4O0A A;  2XTI A;  4PG3 A;  3JAM i;  4AQY L;  2ZTD A;  1SMX A;  2I5H A;  2F3I A;  3BU2 A;  1EQQ A;  1CKN B;  4HJ7 A;  3GTK H;  1K9M C;  3J7A 5;  3PO2 H;  3M85 A;  1XJV A;  4A75 A;  1Q46 A;  4AQY Q;  5ELO A;  1Y1V G;  3S24 A;  1CUK A;  2PI2 A;  5AJ3 L;  2D62 A;  2N3S A;  5M3F H;  4B3S Q;  2IY5 B;  5LMU L;  1PH9 A;  3M4P A;  1WCM H;  1XTD A;  1CKM A;  5IY0 A;  4NXM L;  3GTJ H;  1N9W A;  1PH4 A;  5AJ3 Q;  5IWA L;  3BZK A;  1UE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...