5IP7G

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 33
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5ip7G01
1ASYA 3KF6A 2NVTH 3CCSA 4ALPA 4JI4L 2Q2TA 4DR1L 4GNXA 4NXNQ 4A3IG 3I4NG 2MNAA 3OW2A 1X3GA 1HNZL 2ATWA 1C0AA 4A3CH 2KCTA 1KRTA 2R7DA 3PIOA 4JV5L 1FVIA 2UUBQ 1TWAH 1NJIC 4JI2L 3KF8B 1X55A 1PH7A 2B63H 3PSIA 3RR5A 4A3BH 3F8TA 4DUYL 3RNUA 3PGZA 2UU9Q 3GTPH 4BY7G 4IFDJ 3G71A 5IP9H 4DV4Q 3ICEA 1VS0A 3W1BA 5C44G 4LF6Q 4IFDG 1RL2A 3RN5A 5C4XG 1PYSB 4PG3A 4DK3C 4OXPA 5IP7H 2YU9H 5M3MH 5LMNW 2UXCQ 1Q82C 2IHFA 3HOYH 3ULPA 3G48A 1IXRA 2K52A 3M9BA 4BY1G 3UE1A 1HH2P 3BZCA 3UDIA 4X66Q 3F2BA 1VQ4A 2ASBA 3GTGH 1YZ6A 5GQOA 5IYDG 4DV6Q 4IOCA 1KRSA 4DUZQ 1GD7A 1N8RC 3JC66 1PHJA 5IP9G 1ASZA 1XPRA 2ES2A 1N34Q 3CC4A 1N32Q 1IZ6A 1VQHA 1QVFA 4JYAQ 4DV3L 4K0KQ 1NMFA 2NZHA 1YI2A 1AE3A 4OWWB 5IWAQ 5IYBG 1XNQQ 2AWOA 2ZJRA 3E9IA 4JCVE 2R7FA 5IT9c 4BY1H 1SROA 4IOAA 2L15A 3OYYA 4JI8L 3HOXG 4GOPC 1HNXL 2ZM6L 4DR5Q 1FJGL 2NN6G 3GTMH 2F4VQ 1L1OA 5JEAJ 1VQLA 4KLKA 1X3EA 5LMNL 5FLMG 4JI3Q 1WFQA 4GN4B 1WCMH 3AEVA 1N9WA 1K3RA 3UDXA 1PH2A 2NVQH 2R92H 1Q7YC 4DV2L 2B29A 1IBKQ 2PI2A 3PUWA 4DV7Q 5IWAL 3HOUG 2A19A 3FHWA 3J81c 2I5LX 4DV5Q 3T1HL 1TWGH 1WYDA 3JAMc 1LYLA 1B8AA 1XPOA 3T1YL 4KHPQ 4A3MG 3S24A 5ELOA 1VQJA 2VL6A 3OTOL 1VQ7A 4LFCQ 1MJCA 2UXDL 4QL5A 2Z6KA 1A62A 1XNRL 4JBJA 4AQYL 1KAWA 4B3RQ 1YVCA 5C0XI 1G51A 1GKHA 1I94L 4JI1Q 1I3QH 4X66L 4P71A 1EQQA 4LW1A 1L1OC 2R93H 2JK8A 2ZJPA 1E7ZA 3AFQA 4KHZA 4UP7A 4J15A 3JAMi 3M4OH 1U0LA 4DV1L 4DK6C 2I5MX 3CCVA 4YWLA 1KC8C 4WJ3M 4X64L 5DLQE 2DUDA 2VUMH 4A3MH 3I4MH 4JI8Q 2K75A 3A0JA 1VQ6A 3RN2A 1R9TH 2K5VA 2UU9L 3A74A 2Y0SG 3L7ZC 2NVXH 5JJLA 1Y14B 1KIXA 2VQFQ 1OXVA 1OTCA 2OTLA 4AH6A 5IE8A 4PZ6A 1IYJB 1CKMA 2A1AA 1Q8KA 2MQHA 4JV5Q 2CWPA 2IY5B 1Y1WG 3BJUA 3HKZE 4GN3B 5FJ8H 4QY7A 2HHHL 2BH2A 3F2DA 5HY6A 4OO1I 3HKZG 1D8LA 1P16A 2VQEQ 4BBRH 4EX5A 5K36G 4NB3A 2R7ZH 4TQUS 5C4JH 1IBLL 4A3EH 3S2HH 4NXMQ 3NELA 1BBUA 4JBWA 2PNHA 4JG2A 5J3BA 5IY0A 4OO1G 3ER0A 4LFAL 2VNUD 1C9OA 1HZCA 2WAQE 3S1MH 2WFWA 1XMQL 2XTIA 3CCEA 3CCUA 1N36L 1Y1VH 4C3JH 1KL9A 1YEZA 4LF7L 5H1SE 3L2PA 4DV4L 2F52A 4P75A 4A3DG 4WJ4A 1EUJA 1VQDA 4A3LG 1VQ8A 1I94Q 1J5EL 1TWCH 4GN5A 4APVA 1AE2A 1VQAA 4IPGA 2IHEA 3J80c 1XJVA 4R4OA 2ZTCA 5C0XG 1L2FA 2UUAQ 2UUBL 4GLAC 4A3FG 4R1JA 5GAEC 1V43A 1YITA 1VQIA 1QUQA 4A3IH 3PUXA 3HKSA 4IJLA 2QEXA 1Q12A 4DV0L 1Y1VG 5M5YH 2UUCQ 1Q1BA 2H5XA 3PO3G 4A75A 2OTJA 1X54A 2HIVA 4AYBG 3TRZA 3CD6A 5EAYA 3S17H 1LTLA 1EIFA 1PH1A 2JA5G 2DGYA 1VQNA 1VQFA 2I0QA 3G4SA 4LUVA 1JMCA 5LMNQ 1EFWA 1L1OB 4GKKL 2Q2UA 1WOCA 3TQYA 4QJFA 5GAGC 1K9MC 4LF4L 4A3CG 2IX1A 4X6AH 1HR0L 1I5FA 2JJQA 2K14A 4BA1I 4JI7L 5M3MG 1W2BA 3ZJYC 3S1NH 2NN6I 3GTLH 4A3JG 4JC0A 3U50C 1UE6A 1N32L 5LMUL 4POGA 4R4QA 3UDFA 4L5SA 1XTDA 3HOUH 3BZKA 1YHBA 4Y7NH 1HZBA 4A3KH 2YV5A 1CUKA 4HIKA 4DR6L 4C3IH 2CCZA 2JA8G 5AJ3Q 3CXCA 3K7AH 1UE7A 1YBYA 4IJHA 1UWVA 4R4TA 1HZAA 3H0GH 5M3FH 3GTOH 4LF5Q 3H3VI 1NMGA 1XMOQ 1YNXA 4JI6Q 3E9HA 4HJ8A 4A93H 2JA9A 1X65A 4UY8C 2FXQA 4DAYB 1QUQB 4HJAA 2JA7G 4RMFA 2N3SA 1KQSA 2KHIA 3DLLA 2QGQA 4GLXA 4B3ML 2C35B 2CFMA 3PV0A 4JI5L 4EQ5A 1YHAA 1YHQA 4DV1Q 2B63G 2HQLA 4A3FH 1M1KC 1WCMG 3RZOH 5JJKA 2D0OA 3TEHB 1SN8A 4R4IA 2JEAI 1YJ9A 4JI0L 3G6EA 5C44H 1HNZQ 1EQRA 2R6GA 3K0XA 1JB7A 4JBMA 1N33L 2KBNA 4AQYQ 3CCQA 3D31A 4A4IA 2K5HA 1VQEA 1E1OA 2ALYB 1A0IA 3M85A 4A3GH 1HNWL 1CKNB 4C2MH 4JI4Q 1YIJA 1GM5A 4KHPL 2RHSB 4X65L 3W5OA 4MTNA 3GTQH 3KLWA 1YJNA 2K50A 2JQOA 3PCOB 3PIPA 3CC7A 1VQ5A 1XMOL 1EIYB 3AYHB 1EOVA 4DV7L 2R7ZG 2CWAA 4AYBE 5HGQA 4JBKA 1B70B 3AFPA 5IYCH 4OX9L 1A63A 2LXKA 4BXXG 2NZOA 4QIWE 2KCMA 4IPDA 4HIMA 1PH4A 2AWNA 4GNXB 3HOVG 2VS1A 3A5ZB 4TVAB 4JI3L 3CCJA 5FLXc 1K8AC 5JJIA 2MO1A 1KHIA 4O2DA 1X56A 5LMUQ 1E3PA 1BKBA 4YCWA 1XNQL 1DGSA 3W1GA 3EIVA 4B3SL 4P72A 4K0KL 3CAMA 1K0RA 4YY3Q 3F1ZA 4JYAL 3CF5A 5ELNA 4YWKA 1HR0Q 1N34L 2EIFA 3MXNB 4LUZA 3K8AA 2JA6G 1RIPA 4HIOA 2JE6I 4UPAA 4DR4Q 4OWXB 1UEBA 3E0EA 1Q86C 4B3RL 2GN5A 4DR2L 4DV6L 3L0OA 4DR4L 3KOJA 4YHHL 1HZ9A 1JJGA 2D62A 4JOIA 4UP9A 1VQGA 1PA6A 4PZ7A 4LF8L 1D7QA 2Y0SE 5C3EG 3H15A 3KDFB 3CP0A 1N33Q 5IYDH 4DV0Q 1J6QA 2N8NA 2PQAB 1CKNA 4DV2Q 2UUCL 4A3DH 2R92G 2HIXA 2E8GA 1XPUA 2R93G 1NTGA 2NVYH 3CW2C 1Q81C 3NBHB 4L5QA 4A3GG 3NEMA 3I4MG 2GVBA 1OXTA 4OX9Q 1PH3A 4IFDI 3J81j 4LF7Q 3WWVA 2WAQG 1GO3E 4HIDA 1VQCA 1WI5A 1PH5A 3I2ZA 4LWCA 1QVGA 4B3TL 1EWIA 1W3SA 2YTVA 4NXNL 2E5LQ 2BA1A 4DR1Q 3KF6B 4LFAQ 1IBMQ 3S1QH 4DR3L 1I50H 4PZ8A 1S3OA 4GLVB 5AJ3L 4DR6Q 4DUZL 3HFZB 4GKJL 3K7UC 3PUZA 3I55A 2VQEL 1P8LA 2BH8A 2D0PA 3F2CA 3PF5A 2OWOA 3GTKH 2Q2IA 2HT1A 3EN2A 1Q1EA 3CPFA 4FDBA 2QA4A 2UXCL 4PMWA 4IPHA 4X62L 3S16H 4B3TQ 4JI5Q 1MKHA 4RG1A 3BU2A 1K73C 1PH6A 2E2HH 1VQMA 1PYBA 3M7NA 1LM0A 1YJWA 2JA6H 4DR7L 3RLNA 2OQKA 1E1TA 4LNQA 2UXBL 3HOZH 3STBC 2LSSA 1BBWA 2VUMG 3FP9A 1UE1A 2ZTDA 1E24A 3ULJA 2YTYA 2WP8J 2OQ0A 3KJPA 4LF9L 4XTCS 4GOPB 2KHJA 1SFOH 4DPGA 4QQBX 3FKIG 2N49A 5M5WH 1E22A 1CSQA 4O0AA 4NPSA 1Z9FA 3CCMA 2K4KA 5GROA 3OTOQ 1JJ2A 4A3LH 5IYCG 3T1YQ 1UE5A 4BXXH 2RHQB 1O7IA 3KYHC 4P73A 1BVSA 4BY7H 3M3YH 2WB1E 1G291 2AHOB 3D0FA 4L5TA 2MO0A 3U4ZA 4BBRG 3HOWG 1JE5A 1IBKL 2VW9A 3SGIA 1X9NA 2GVAA 5C4XH 1GVPA 4GKKQ 4QGUA 5IP7G 1OXXK 2A8VA 1WJJA 5BR8Q 1IBLQ 3MEFA 3TREA 1QZHA 3B6YA 1N36Q 2WB1G 3HOYG 4B3SQ 2IX0A 2XGTA 1FL0A 4IPCA 2JA5H 4A3BG 3S14H 1M90C 3Q8DA 4YCVA 5FJ8G 4BBSG 1S40A 4NXML 1SLJA 1SR3A 3KJOA 2CQOA 3M4QA 3NENA 4YCUA 4A3KG 3GTJH 4LUOA 1NBWA 2LXJA 4GS3A 4A76A 3CCLA 1PVOA 1LUZA 4DV3Q 2JEBI 4H02A 4A3EG 3S1RH 2E2IH 1AH9A 2HHHQ 2Z0SA 1IL2A 3VDYA 3HOVH 4HJ7A 2OCEA 4YHHQ 1X3FA 3I7FA 3KDFA 5C3EH 1CKOA 4DAMA 2UUAL 2CKZB 3RLOA 1VQ9A 4YWMA 1HR0W 2VQFL 1KD1C 4X65Q 3HOXH 4DR7Q 1PFSA 1KXLA 4Y52H 3UDGA 3U4VA 1VQKA 4GOPA 4LFBQ 1HNWQ 2ZTEA 3AQQA 3LGJA 3K80C 4BA2I 1QZGA 1C7YA 1L0WA 2Q2HA 3CMEA 5JEAG 2ZJQA 4JI0Q 2MFIA 3H0GG 5M3FG 2IT1A 4JI1L 3U58A 2E2JH 3S15H 1T9HA 2KENA 3CQZH 2F3IA 3CC2A 3PO3H 4GKJQ 1PV4A 4JI2Q 1FGUA 1SMXA 3J81i 3TS2A 2K5NA 4HJ5A 2PI2E 4POFA 4OONA 1NE3A 4LFCL 4DR3Q 4P74A 2RCNA 1K8GA 1IBML 5GADC 2V1CC 2E5LL 3T1HQ 1G6PA 4JI6L 1TWHH 3KFUA 1SRUA 1Z47A 1K83H 4IO9A 4LF5L 3GD7A 1PH8A 1U5KA 2I5HA 3GDEA 4DNIA 3J7A5 2Z6KC 4X64Q 1VCIA 4JOIC 3PO2G 1TXYA 2RF4A 1Q46A 3UE0A 5BR8L 5IYBH 2ID0A 1QVCA 3J7ZC 2B3GA 2EQSA 1VQOA 1JJCB 4XIGS 3RLFA 1MJEA 2ZM6Q 4DR5L 1HNXQ 4BBSH 2VY3A 2VZAA 2BA0A 5GAHC 2JA7H 4L5RC 4B3MQ 5FLMH 2EXDA 1XNRQ 1JT8A 4JI7Q 4LFBL 1NY4A 2UXDQ 2JA8H 1Y1WH 1HJPA 4LF8Q 1VQPA 3DM3A 1B7YB 3J80i 4GNXC 4LF4Q 3CCRA 4OWTB 3PO2H 1H95A 4DV5L 1TWFH 3FKIH 1CSPA 4DR2Q 1S72A 3ULLA 3TS0A 2PQAA 2YYZA 4A93G 4LF9Q 1SE8A 4ME3A 3H3VH 4A3JH 1X6OA 2PMZE 1PH9A 5M5XH 4MZ9A 3M4PA 3IRBA 4UP8A 4YY3L 2AKWB 3ERSX 4KI0A 3PUYA 2N78A 2UXBQ 1OXSC 2YTXA 2F4VL 3HOWH 4MNOA 4LF6L 1V9PA 1FJGQ 1V1QA 3A5UA 1A8VA 4C3HH 4DUYQ 4HJ9A 3HOZG 3EBEA 2AMCB 1VQBA 4X62Q 3GO5A 3K81C 5C0XJ 3I56A 1J5EQ 3I4NH 1MIUA 5E7NA 3CPWA 4AIMA 4R4CA 3S2DH 3PUVA 3PF4A 1EYGA 3STBD 3RZDH 4DKAC 1OXUA 3I4OA 1XMQQ 3CMAA 1I6HH
chains in the Genus database with same CATH superfamily
2EOTA 4C3IG 1CS0A 4KY5A 4ALPA 5EWEA 4CDEC 2AQ4A 4DR1L 4F88A 3S16B 3H91A 1C0AA 1QNKA 4YY3H 1STAA 4LFCH 4XQQA 2KCTA 4JV5L 5NUCA 3VYRA 4A3EB 5LL6S 1NJIC 1X55A 2R92A 3PSIA 2WKDA 3F8TA 3GTPH 5CORA 4DAYA 4ECSA 5IP9H 3V96A 2YU9A 5D65A 2O4XA 4XDXA 1A3UA 4N8FA 5C4XG 1K8MA 1PYSB 2YU9H 5LMNW 1XWEA 2UXCQ 2FP4B 3K59A 1PZID 3H4DA 3M9BA 4FF2A 1TWGB 1GXDC 1VQ4A 3S1RB 3NWTA 2DNEA 5GQOA 4DV6Q 2UUAH 4FBTA 1GD7A 4DV4H 3V05A 2ES2A 2EJMA 4DV3L 5KIXA 2NZHA 3R8BA 1AE3A 4OWWB 2NYZD 1LTSD 1XNQQ 1UNNC 1MSGA 1SYGA 2AWOA 4BY1H 1KJ9A 4JCVE 2R7FA 2HD3A 3OYYA 3HOXG 4JI8L 1C4QA 2ZM6L 2F4VQ 4X3TA 1I4RA 1KBLA 5JEAJ 3NTIA 1X3EA 4KLKA 4JI3Q 2JEJA 3R23A 1NSNS 3QB3A 4GN4B 5KG3A 1M0TA 1E4FT 2JA7A 3AEVA 3MWEA 3EYYA 3MXPA 1JORA 2PI2A 3FHWA 4K8IA 3VYUA 3N42B 1WYDA 3HOUB 4B08A 3MR5A 3T1YL 3FPUB 3OSPA 4PDBA 1I6UA 2UXDL 1F2YA 3LP8A 3C2PA 4IRKA 2XNAC 1YVCA 4LF9H 4ED8A 5HURA 2JK8A 1JDBB 1E7ZA 2A68D 4UP7A 1M0WA 4J15A 3Q8QB 1U0LA 4DK6C 1B4OA 2UXBH 4ECWA 3CCVA 4YWLA 4WJ3M 5GONF 3OWEB 2UXDH 1ZXTA 2WTFA 2JA7B 1G2TA 3A0JA 3ETHA 1FNUA 1Y8NB 4I7HA 2NVYB 3M4IA 2K5VA 4YR2A 1JE4A 1PFNA 2Y0SG 2GA4B 1Y14B 2XSCA 1KIXA 1IYUA 4ZRZA 5C1OA 1SYFA 1AUXA 4MTEA 3BA9A 5IE8A 4Q44A 4ECZA 1SE4A 5CR3A 4JV5Q 1Y1WG 4GN3B 2K1BA 3FKIB 3KHLA 2HHHL 4ABNA 3PW7A 1DZ1A 3HKZG 1RK6A 2DLNA 1P16A 2F4IA 4PMCA 4BBRH 3PW2A 4F4YA 4A3EH 3NELA 5KFPA 1BXTA 5D1OB 1VAJA 1K83A 4LFAL 4G4KA 5HGTA 1HZCA 4M8AA 2GPSA 3S1MH 2WFWA 2XN9C 2XTIA 4XQJA 3CCUA 4G3IA 4QWCA 3RJ0A 3WO0A 4MA5A 1CA6A 2K32A 4IUPA 5H1SE 1XTCD 4DV4L 2L11A 1IL8A 5CV8A 1VQDA 1NAPA 1VQ8A 1TWCH 3M9MB 1XJVA 2IHEA 4R4OA 2ZTCA 3L4JA 4EBCA 4Q8FA 4K2KA 2UUBL 1I4GA 2AUKA 5CA1F 1YITA 2B63A 1VQIA 1UAPA 3I72A 3PUXA 2EVBA 4IJLA 3M9NB 1Y1VG 2HGSA 4RAYA 1DV1A 4HMIA 2H5XA 2OTJA 4EYIB 3BABA 5EAYA 3OWFA 3GIDA 1EIFA 5EGTA 1HFNA 4LSAA 1VQNA 1E2VA 2SEBD 1VMCA 3CHBD 1EFWA 1E2ZA 2Q2UA 1VDZA 5GAGC 5EDWA 4A3CG 5KFTA 2JJQA 1HNZH 4BA1I 4J1MA 1W2BA 2NN6I 1K1QA 2RVLA 4A3JG 5I4DA 2AQ1B 4FU0A 1UE6A 3S1NB 4KY6A 1CHQD 4A3KH 1IOWA 2J0TD 1H9JA 4C3IH 2CCZA 2SNMA 1E4GT 1S4ZA 4DV7H 4K5WA 1CT1D 3O13A 2H1EA 2N55A 4JI6Q 5KFKA 2KJXA 5DLFA 1G2SA 4UY8C 4JW0A 1V4YA 5D3IB 4QWAA 1D5MC 2EYOA 4QF4A 4YP3A 2K03A 4N9TA 4JI5L 2B39A 3MFGA 4EQ5A 3ITPA 4DV1Q 4BY1B 2HQLA 1EZ8A 3RZOH 3BJYA 2D0OA 1SN8A 2C22A 1RTNA 3G6EA 3Q6SA 1FKAH 2RQXA 3J80W 3J80L 4JBMA 3Q8RB 1AEXA 3E5SA 3QWNA 4ZUIA 3P1HA 2XIGA 3E5NA 3MJFA 2ALYB 2F0IA 3J81L 1S5BD 3KHHA 2XCPA 4YQWA 2QDLA 3L4KA 4YAJB 4XXEA 4KHPL 2YL2A 4DL7A 1WSCA 4MTNA 4KJNA 2EY2A 5L1JA 1VQ5A 4J9RA 1EIYB 3GTQA 1ICWA 4J9QA 5HGQA 4JBKA 1A63A 2C2EA 4EEYA 2LXKA 4IPDA 1PH4A 3DUZA 1TKWB 1TAEA 5AFWA 2YS7A 4O42A 4F4ZA 1BOSA 5JVDF 1TWAB 2ICIA 1STEA 1TY0A 5JJIA 2MO1A 4U673 2QF7A 2ICEC 2JP1A 2B63B 2R86A 5LMUQ 4DL3A 3NP8A 1E3PA 4YCWA 2HQEA 3OPOA 1DGSA 4HTHA 3KBXA 5FO8B 3FDTA 3MFIA 3CRLC 3F1ZA 1CTMA 2MHVA 2L1BA 4C3IB 4DR2L 5KFRA 3GTOA 5M5YB 4YHHL 1QJOA 2D62A 2NN6H 4LF8L 3T5KA 2F3VA 2K01A 4RNOA 4DL6A 3EQLC 1PYWD 3BG3A 3C1FA 3CP0A 1SNMA 1N33Q 5IYDH 4O4IF 1EL0A 2PQAB 4A3DH 3NGDA 1HCZA 3JAML 2W7OA 3NQTA 4RB3C 4CDCC 1C30A 1KNEA 4OL7A 5EJWA 5DM63 3HOWB 3NBHB 2CH4W 1JWUD 1TS5A 2F0KA 3DEPA 5KFDA 1SMYD 4TQRA 2Y0SB 3RB3A 1ICFB 2YU9B 1A15A 1B33N 2A6HC 5KG4A 1N32H 4XT3B 2CVRA 1VQCA 2B2TC 2SNSA 3BQ0A 2E5LH 4O1NA 1IHZA 1I50H 1Y1VA 5AJ3L 4XYOA 4UAIA 1HA6A 4G7HC 5FD6A 1AZQA 3TP7A 3F2CA 4TV9F 1JWSD 5G3LF 3SE7A 4ED6A 4L63B 4C3JB 2W6MA 4FDBA 3KHRA 2QA4A 1LO5D 3TMEA 1RJQA 3A56A 3KUPA 4BBSB 3E6ZX 5C44B 5J2TF 4TQSA 1PYBA 3GTMB 3DM1A 2JA6H 4CGYB 1VBGA 4X64H 4LNQA 1ONLA 5KX5F 3NWSA 3HBLA 5DG7A 1BO0A 3AMUA 1BBWA 3SR1A 1EUCB 3MXUA 1AW7A 2B2TA 1E24A 2XRSD 3EVQA 4EGVA 1UUPA 2HDMA 1KEEA 1GUOA 4XTCS 4DPGA 4C3JG 5M5WH 2RGRA 1RKNA 2ASJA 1CSQA 3OTOH 4MN3A 3BVGA 3OTOQ 2TSSA 2RHQB 5C8YF 3T1HH 1BVSA 4RUAA 4M1UB 2WB1E 4ED7A 4UFZA 1IBKL 2NWGA 4ED0A 3RBEA 3SGIA 5LXTF 4C3HG 1X9NA 5DQIA 5C4XH 4GKKQ 1OXXK 2R8IA 1WJJA 2NTSA 5J39A 2M9VA 1QWYA 2WB1G 1EZ1A 5C4XB 3WOFA 3N41B 5D1PA 5EOYA 2R8KA 2JA5H 1O7LA 5KFSA 4EBEA 2WINB 2WIIB 2WYOA 4KMUC 3OUZA 1GYFA 1I4PA 2XVSA 3M4QA 4IN3A 3NENA 5C4ZA 4A3KG 2C2RA 1NBWA 3CCLA 3GTOB 1D1IA 3R2TA 2NZ1D 4A3EG 2E2IH 4M7EA 2BDOA 1IL2A 2VOBA 3TIGA 3HOVH 2B2VA 2OCEA 4IR1A 1ZEQX 5E4XA 1CKOA 3N43B 4I7ZC 1R4PB 4YWMA 1HR0W 4UCOA 3HOXH 1KXLA 1VQKA 3U4VA 1NR4A 5EPLA 2UUCH 2KVMA 4LFBQ 1HNWQ 2ZTEA 2HCIA 3AQQA 2ZXRA 3K80C 4FO2A 1KDBA 4K5XA 3SDZA 4FXGC 1C7YA 4C5AA 2UXCH 4PNYA 4IUUA 2MFIA 3H0GG 5M3FG 3U58A 5JQWA 4DV6H 4A3MB 1PV4A 4JI2Q 1SMXA 1DOMA 2K5NA 4POFA 3BZDB 5K2MA 5G3LD 2ZM6H 1TWHA 3GTKB 1SNOA 1JICA 1IKMA 2MUYA 2FHTA 4JI6L 2JA5A 3BDOA 4H44C 4LF5L 5IT9L 3T5LA 2Q8RE 2CW0C 2Z6KC 1LTID 4LSXA 4GC6A 3PO2G 4F87A 5LL6b 2RF4A 4RNMA 1F77A 1Q82C 3J7ZC 5KFEA 3RLFA 2EY1A 4DR5L 2L12A 1O7ZA 4J9MA 2XD4A 2VY3A 2BA0A 2OEOA 1B2TA 1WCMA 2A69C 1BUVT 5IGEA 4ID6A 3QOJA 2J4XA 5FLMH 4JI7Q 4LFBL 2AQ2B 5CV9A 5I6YA 2F0WA 1Y1WH 4F50A 4ED1A 2EYMA 4GNXC 1WTXA 3CCRA 4OWTB 4HNVA 4XX0B 4QB4A 1S72A 3HKZA 1LT4D 1PRTF 2PQAA 4Y8VB 4LF9Q 1SE8A 5I2YA 2K5WA 1N34H 4C5CA 4UP8A 5KFUA 4B3MH 2YTXA 4ZOLF 4MNOA 3M3YB 3SEBA 1SYBA 1EY0A 2FPPB 4C3HH 1TS3A 3M4YA 1EQTA 3QG1A 2AGQA 4IR9A 4LFBH 3K5HA 4XT1B 2FLNA 1IW7D 5KFXA 5L37A 4X62Q 3K81C 2DWCA 2OF1A 3JZIA 5E7NA 3S2DH 2JXMB 4AIMA 5DGBA 3PF4A 5IGBA 5KNBA 4DKAC 1N56A 1OXUA 3L9AX 3I4OA 2G9HD 1JOOA 3HRZC 5FPRA 5F9NA 3Q23A 1I6HH 1ASYA 4QW9A 1SNPA 2NVTH 1DCZA 4J6HA 4JI4L 2Q2TA 2L0CA 5EQ0A 2F0HA 4A3IG 4NXNQ 2CH4A 2ZT9C 2FFKB 3I4NG 2MNAA 2EYJA 3OW2A 1X3GA 4A3CH 2WB1A 2R7DA 1Y1VB 2FMCA 4GKKH 3EROA 3RAQA 4CC5A 1LT3D 4JI2L 1U4PA 3KF8B 2QKIC 4H0LC 4BWSC 1S10A 2J6SA 2B63H 3RR5A 4JI1H 2RDHA 2LFNA 3GIQA 1FYCA 3ICEA 3W1BA 1KLUD 5C44G 4IFDG 2SOBA 5I2XA 2Z9HA 4HR7B 4NMZA 4DK3C 1JOQA 4JVZA 4DXFA 5M3MH 1MBYA 1V51A 3HOYH 3G48A 2PPBC 3V4ZA 3UDIA 4X66Q 1U4MA 1LTGD 1I3QA 3GTGH 2VQFH 5IYDG 3TP6A 1KRSA 5KFCA 1ILQA 1IW7C 3JC66 5L1LA 2DIKA 3JSLA 4DF7A 3N6RA 4ULLA 3H3VC 4EGJA 1N34Q 2FINB 3CC4A 3ORRA 4LF7H 4F4XA 2V58A 2YZGA 4HQ6A 3RMHA 2HVRA 4IHJF 1N36H 3NK9A 1YI2A 3S2HB 2L55A 1V1OA 4IUTA 2XGQA 1E2WA 3Q8PB 5IT9c 1HNXL 1FJGL 1BCPF 3VYSA 3GTMH 3TINA 4CC6A 4J0MA 5KFMA 1TA8A 4MV1A 1CQFA 3HEJA 1L1OA 2R87A 5FLMG 2R82A 5FPOA 4DA2A 1WCMH 5CA0F 1PH2A 4FF4A 1WTVA 1Q7YC 4HSVA 5KFFA 2B29A 1IBKQ 4DV7Q 5IWAL 1H9KA 3V4SA 2NVQB 4DV5Q 5FLXE 3QZ7A 3PVXA 3AU7A 1AN7A 5ELOA 1VQJA 2VL6A 3OTOL 1VQ7A 1ENAA 1ZETA 1G8ZD 2Z6KA 1A62A 4JBJA 3ZYYX 4UCTA 4P71A 4IQZA 4LW1A 1L1OC 2R93H 1DONA 1GSAA 4X66H 5KT7A 3M4OH 4NP5A 4DV1L 1ML0D 1NNXA 4KKTA 1WVLA 4C3HB 3D6WA 4OELB 1XXGA 1PTOF 4X64L 5DLQE 5K36H 2DNCA 1MSHA 4A3MH 3I4MH 2K75A 1FGBD 1R9TH 1DIKA 2RBMA 5BPFA 2UU9L 3A74A 2WDTA 3L7ZC 5JJLA 4DK1A 1F9PA 1DD2A 5L9XA 2WV6D 1OXVA 3MR3A 2LY7A 2OTLA 4AH6A 1IYJB 3RB6A 2MQHA 1Q8KA 2FMMA 2IY5B 2CWPA 3HB9A 3HKZE 5FJ8H 2IX3A 4QY7A 5IYZF 1EYDA 4OO1I 1D8LA 1QCBD 2VQEQ 1DV2A 5KYIA 4TQUS 5C3EB 5DQHA 3K0YA 5IY0A 1BBUA 3D3RA 4JBWA 2MP1A 2UU9H 4OO1G 2BQUA 1EU3A 3GTJA 2IP4A 5F9LA 1S5DD 1V1PB 3CCEA 2E2IA 4MV3A 1GGOA 1E4EB 2KHSA 5FK9C 4ECTA 3HXLA 2RDIA 4WJ4A 2K5QA 1YNNC 4ZQIA 4APVA 3HOYB 4IPGA 4YB8B 1L2FA 2UUAQ 5I9PA 1V43A 3I91A 3F2UA 4FP5D 3RZDB 2I8CA 4IZ8A 1Q12A 2UUCQ 1JDEA 5JVLA 2BR0A 1Q1BA 2W7PA 3PO3G 4A75A 4I4TF 1S03G 1HA5A 1T36A 4LF8H 3S17H 4OEMB 2NVYA 3ETJA 4YHHH 2R8JA 1VQFA 2KEEA 2I0QA 3G4SA 1T5XD 2BOSA 3DMUA 4LUVA 4PV1C 3T56B 1L1OB 2V4RA 4EQOA 5FD5A 3TQYA 2CQYA 1K9MC 1FJGH 2IX1A 2VUMB 2Z8LA 1HR0L 2AUJD 4JI7L 3S1NH 4IWXA 1PXUA 4G7OC 3U50C 5CV6A 5LL6X 1N32L 4POGA 3C3LA 3UDFA 2FPIB 4F8MA 1FNVA 3I70A 2FPGB 4RGOS 4KY7A 2YV5A 3T13A 2ZJTA 3R5FA 2D9UA 1BGWA 2OT2A 1KJ8A 1EYCA 1UE7A 4Q5VA 4IJHA 1UWVA 4TSSA 5KEEA 1JX4A 5KFLA 5IT9E 1NMGA 1XMOQ 2F03A 1B1ZA 3X3NA 4XYQA 5KFBA 2FXQA 1DYQA 2KHIA 3DLLA 4GLXA 4ECRA 2CFMA 4BY7G 3KF8A 2B63G 4JI2H 3RV4A 4R4IA 2JEAI 3FRPB 1YJ9A 5C44H 1SMYC 3BYYB 3GTPA 2N88A 3HZXA 4JYAH 3K0XA 4S3SA 4J9SA 2KBNA 1AN8A 2NU7B 1HTLD 3IL8A 3M85A 4A3GH 1C3OA 4DV5H 1A0IA 2IBKA 3UI2A 1PRTD 1WTPA 1SJED 2NVXA 4JI4H 1GM5A 4X65L 1GHKA 2FK2A 3I4LA 2K50A 3MEHA 2PBZA 3PIPA 3D4WA 3VPDA 1XMOL 4WORA 4G57A 3AYHB 4DFAA 1EOVA 5M5XB 1DJRD 2RSOA 1ZQ7A 5IYCH 5CB4F 2WACA 4HIMA 3VR2A 1T3NA 3A5ZB 3FVQA 4TVAB 3VMMA 5FLXc 1UC8A 1KHIA 1Z6HA 1EIHA 1PMRA 4LMYA 2J6TA 3C46A 1I6VC 3ORQA 4P72A 4K0KL 3CAMA 4YY3Q 2V4QA 5ELNA 5CBAE 1HR0Q 3PO3B 1TWCA 4RB2C 3MXNB 5KYLA 1D2BA 4LUZA 1EY6A 1CZWA 2D5DA 1RIPA 1JIHA 2O03A 2JE6I 4DR4Q 3Q8SB 5BN5A 5CC4A 4B3RL 2GN5A 4ECUA 1RJTA 4JI5H 2F0PA 1BNCA 4A2AA 1EWCA 1G6ZA 1E0BA 1K83B 5D1OA 1B50A 1VQGA 1PA6A 3D6CA 1GSOA 4EVOA 4C2MA 3SK4A 1PDQA 2VB3X 2N8NA 3J7YW 4DV0Q 3K5IA 2W57A 2R93G 3OHXC 3RB0A 1A2UA 4DL2A 4O3NA 1F9QA 3I4MG 1Y8PB 2GVBA 5JVG3 4OX9Q 1PH3A 3J81j 1PFMA 2PCFB 2WAQG 4LF7Q 2R7ZA 4LF5H 3RIZA 3MFHA 2MCTA 4LWCA 2R7NA 4B9WA 4BBRB 1G91A 2BA1A 4LFAH 2UVRA 4PZ8A 1S3OA 2FJ2A 2C9OA 1UC9A 1B9NA 2DY8A 4FM9A 1I50A 3HFZB 2EDGA 3K7UC 3I55A 1P8LA 3R5HA 4RUCA 4Q43A 2Q2IA 2HT1A 3EN2A 2BE5C 4B9XA 2M2LA 3S16H 4MV6A 4MAMA 5KG7A 4B3TQ 4JI5Q 4CKEA 4RG1A 3BU2A 2R8HA 2AU0A 4FYDA 1B9MA 3GIPA 3G6VA 2DY7A 3RZOB 5L1IA 3OMGA 2OQKA 1I4XA 3VYTA 1X3PA 2VUMG 3ULJA 2A6ED 3H20A 3J81W 5LA6F 2YTYA 2OQ0A 4LF9L 4GOPB 2F0LA 4QQBX 4KHVA 3FKIG 3G6JB 5F2DA 1E22A 5EBDA 5C5LA 3PIO3 1XMQH 3CCMA 4NLGA 2XCAA 4FBUA 5GROA 4ZK9B 4NXMH 4NDXA 5IYCG 3T1YQ 2FKLA 4IUVA 1O7IA 4CKCA 5DLGA 3GV8B 1WH2A 3J80E 3HOWG 1JE5A 5I6WA 3CKIB 4CKBA 1VF7A 2SDFA 1ILPA 1WTOA 4Q45A 1HTPA 4QGUA 4DXGA 4FS1A 3MEFA 4HR7A 1ESFA 3B6YA 1EWHA 1N36Q 3HOYG 3S2DB 4B3SQ 1LTTD 3CU7A 4O3SA 4QMGA 1HNXH 4IUQA 4JI8H 4A3BG 1KAAA 3Q8DA 1M90C 2XRQD 5FJ8G 4NXML 3KJOA 3AB9A 5E1FA 4NXNH 1V1PA 2E2IB 4YCUA 1EY5A 1T5EA 2LXJA 1LUZA 2NTTA 4NKLA 4DV3Q 2JEBI 1KJJA 3V2TA 2F0NA 3OOCA 2Z0SA 2HHHQ 5H80A 1TWFA 3N44B 1RF2D 4YHHQ 3IFDA 1X3FA 3S17B 1HUMA 3RV3A 4JV0A 4ETSA 2VQFL 3BQ2A 2I07B 4G7ZC 3RD4A 4DR7Q 2CW0D 1DOLA 4ZUJA 3UDGA 3LX0A 2A74C 4XYMB 2JA6B 4BA2I 2QW7A 3NHHA 2Q2HA 5C6AA 5JEAG 2CHBD 2HJWA 3R93A 2W9BA 2DPIA 4JI1L 2E2JH 2KENA 4RGNA 4U6PA 4RZRA 4DLKA 5C3XA 3PO3H 4RGMA 3TS2A 1S5ED 1FGUA 4GKJQ 4HJ5A 1BQQT 4OONA 1NE3A 4LFCL 3K5NA 1D6EC 3KALA 2V1CC 2E5LL 2EZVA 2FJZA 5DQGA 3LWEA 3MZ5A 5FLXL 3U9SA 1EUDB 3LWUA 4JV2A 1STYA 3VR4A 2I5HA 2Z4HA 3GDEA 3QOLA 4DNIA 1W93A 1PTOD 1STBA 4JOIC 3VR6A 4CJ0B 1BF4A 4CJ2C 2W6OA 1VQOA 2EQSA 1MJEA 4I50F 5KFHA 2ZM6Q 1HNXQ 2E2HB 3PR5B 3C0FB 5GAHC 1K0SA 2RDFA 3MHBA 4B3MQ 2F0EA 2R3ZA 2O5IC 1ZHQA 2UXDQ 1SFOB 5BN4A 1VQPA 4Y7NB 5K5PA 3J80i 4Q0YA 3GIIA 2VXWA 4LF4Q 4ODGA 1H95A 1N33H 3FKIH 5C4HA 2PYKA 2EJGC 4U68A 3ULLA 2CQAA 2XC9A 3H3VH 1CE8A 1PK8A 1X6OA 1PH9A 4J9LA 1TQOA 2IL8A 5M5XH 4YY3L 2AKWB 4MV8A 4LH7A 4XQNA 1BCPC 1OXSC 3BDLA 3HOWH 4I7AA 1FJGQ 1JLLB 1V1QA 3QIAA 1KNAA 4RA8A 3T5JA 4DUYQ 2BQ3A 1ET9A 2BCOA 3KLSX 3EBEA 4TKOB 3MR2A 3GIMA 1F2ZA 4ECYA 1VKZA 3QR8A 3CQZA 1Z2PX 4ILWA 2C00A 2E74C 1I50B 2F0UA 2P5ZX 5KFAA 2EJFC 2FE3A 2HUGA 4FF3A 4UHVA 3CMAA 3KF6A 3CCSA 2PW7A 4GNXA 2B2VC 3A8IE 2HCCA 3RTXA 2B2YA 1M7JA 3G8CA 5KG0A 3SK5A 4K8JA 2UUBQ 1TWAH 3MXGA 4TUYF 5KNDA 2GPWA 3RNUA 2UU9Q 2F0TA 2W6NA 1STNA 1VS0A 1TIID 3DF7A 3KAKA 5EKKA 1RL2A 3RN5A 5DM73 4OXPA 1W96A 5ELDA 3HKZB 2A6HD 3HP3A 2IHFA 3ULPA 2NU8B 2ENBA 1IXRA 2K52A 4BY1G 3F2BA 1KDAA 2VR1A 2B2YC 1GUTA 5JVH3 4IZOA 5IGCA 1RDPD 3NSWA 1KLGD 4DUZQ 4C2MB 2PW5A 1X3QA 5IP9G 5KKNB 1ASZA 3OSNA 4ZYSA 2PVPA 1N32Q 2E2DC 1IZ6A 4K0KQ 1NMFA 5IWAQ 2ZJRA 3E9IA 1HR0H 1SROA 2C28A 3L3OC 4P2CB 4ZLTF 1RJRA 2KOLA 1Y8OB 5T14A 3K57A 1N9WA 1GLVA 2B2WA 4XZ3B 1K3RA 1SNQA 2NVQH 2R92H 3FDSA 4DV2L 3KLSA 3HOUG 2W6QA 2A19A 4H13C 3J81c 3H09A 3T1HL 1QB5D 1TWGH 5KFIA 1LYLA 1MI2A 1XPOA 2SCUB 3H6MA 4LFCQ 5J22A 4DAPA 4QL5A 1W6JA 1XNRL 1KDCA 1UEAB 1KAWA 4B3RQ 5DNFA 4QIWA 1G51A 1GKHA 1II3A 4X66L 4O2BF 2F0FA 2RDGA 1EQQA 4ZI7F 5EWFA 1F9RA 4KHZA 4WFN3 4A93B 3I4NB 1MD2D 3D8GA 1SYDA 2DUDA 2VUMH 1SDFA 4JI8Q 5KNCA 1VQ6A 3RN2A 4IRCA 1TT2A 2JSOA 5IGDA 2NVXH 2NVTB 1R4QB 1OTCA 5IWAH 5EBCA 4DV2H 3H94A 2I80A 2A1AA 2HHHH 1WTHA 2QILA 1RYRA 2BH2A 1ZYRD 2QK4A 3F2DA 2F0OA 4C56C 4EX5A 4DUZH 2R7ZH 2EY5A 4RKLA 5C4JH 1EYAA 3S2HH 5J3BA 3PR4A 2PNHA 2F0VA 3RF2A 3P75A 2VNUD 3PIP3 3ONAB 2WAQE 1BCPD 1IYVA 1N36L 1Y1VH 4ED2A 2BDNA 2YCHA 4DV1H 1YEZA 3S1MB 3L2PA 4DL5A 3Q2OA 3BA8A 1EUJA 4A3LG 5DAUA 2KEDA 4GN5A 1VQAA 2W8KA 1GUNA 4GLAC 4A3FG 2M05A 5E4WC 4R8UB 3TZDA 2V59A 1QUQA 4A3IH 4H7BA 3SHLA 2KA7A 2QEXA 3SK8A 4QWDA 5DEHA 5TSSA 3N52A 2A68C 4X3SA 4DNTB 3TRZA 3JAMW 1I7NA 1LTLA 2YZNA 3OHAA 1I4QA 3D4RA 3EPIA 1JMCA 2PN1A 5C1PA 4HEDA 4DR2H 1FD7D 1TY2A 4GKKL 1WOCA 4QJFA 1A3VA 4X6AH 4DR3H 4L8JA 2EYLA 3BG5A 1XYIA 3GV3A 5JH7F 2K14A 3C1EA 4RCOA 5HV6A 5M3MG 4GC7A 3ZJYC 1TU2B 3GTLH 4EFEA 4JC0A 1BNZA 2W9BB 5LMUL 5LYJF 2A6EC 4WBNF 1XTDA 3HOUH 3BZKA 4O2AF 3JRWA 1SNCA 1M6VA 3LMLA 2YRXA 4RCNA 1CUKA 2CZGA 1EY4A 1S9FA 3H0GB 5M3FB 5AJ3Q 3CXCA 3KK7A 4K14A 1YBYA 3GTJB 4AYBB 4DK0A 1HZAA 3EJIA 1GSHA 5L1KA 4LF5Q 5D8DA 1SE3A 1YNXA 3VA5A 3E9HA 4HJ8A 1KC7A 1U9RA 1E4EA 1SYCA 4DAYB 2F0GA 2YS6A 3MR6A 1QUQB 1TVXA 2N3SA 1I3QB 4RMFA 1KQSA 1WTQA 2C35B 4B3ML 2R93B 1YHQA 1YHAA 1MGSA 3NTHA 1M1KC 1ZYRC 1WCMG 5JJKA 4EQPA 2XGPA 3TEHB 2V9WA 1SFOA 1EZ6A 1EIGA 2G9DA 1JB7A 1N33L 3CCQA 4YIJA 1E1OA 1KTKA 1RHPA 1Z2OX 1XNQH 1V8QA 1CKNB 2B2WC 1YIJA 1SJHD 2EPBA 2RHSB 4HCEA 4JK1C 3A54A 3GTQH 3KLWA 5HBRB 3CC7A 4UCUA 3A7LA 4DV7L 2R7ZG 4AYBE 1CI3M 4HAEA 1HPCA 2NZOA 3EFXD 4QIWE 5T1GA 2KCMA 3QJYA 4IFDH 2W71A 2AWNA 4DR6H 4DGZA 1JQYD 2VS1A 1JOKA 3GV6A 1CK1A 2FLPA 1SEIA 3UQ8A 4RFBA 4O2DA 1A3TA 1EY8A 2KECA 1BKBA 3K5LA 1XNQL 2J6UA 4ECVA 3VPCA 1QG7A 2E75C 4JI6H 2F1MA 3CQZB 3DWAA 5IGGA 4YWKA 1N34L 2EIFA 4UPAA 3K7AB 3E0EA 4DV6L 2Z1CA 3W3AA 4FNFA 4OO1H 1EY9A 4IAJA 2EE1A 1JJGA 2R85A 4JOIA 4UP9A 2PO4A 4C5BA 5CV7A 4HMJA 5C5MA 1RTOA 5A2QL 2KUMA 3PZPA 2JYOA 4DV2Q 2WAQA 2O5JC 2FB9A 2E8GA 1XPUA 4BY7B 3PW5A 1EFID 2IMWP 3CW2C 2JN4A 4KTAA 1Q81C 4ED3A 1U4LA 4JV1A 4J9PA 4A3GG 1DXMA 3NEMA 2AGPA 1J5EH 2E2JB 2F0MA 3WWVA 1BJTA 4ECXA 5KFVA 1AP0A 1J9OA 1WI5A 1PH5A 2JA5B 5J2UF 4Z9CB 2E5LQ 4NXNL 4A3IB 3PW0A 3I12A 1TWHB 3S1QH 4DR3L 1JXLA 3BQ1A 1LV9A 3T16A 4DR6Q 2ATLA 3PUZA 4OIJA 3GTKH 3PF5A 2BH8A 2OWOA 3I8ZA 3HOVB 4O4HF 3H0GA 1Q1EA 4IWYA 4J9NA 1IBKH 2UXCL 4OHJA 4PMWA 4IPHA 3GQCA 1IKLA 4A3DB 3NQIA 3MFYA 3M4OB 5I47A 4DV0H 2WB1B 1LTAD 4MV4A 3A8JE 3M7NA 2R7LA 1OWTA 3RLNA 4CBVA 3GIKA 1RCVD 2RGVA 2UXBL 3HOZH 2QEJC 1H9SB 2LSSA 2PZWA 5FO9B 2YW2A 1UE1A 2ZTDA 1HQMC 1QILA 3R5XA 3KJPA 1K1SA 2ZDQA 2KHJA 4DN4M 4AQYH 2N49A 3OIQA 1O75A 2KCCA 4MIUA 4O0AA 3GTQB 4K6LA 2K4KA 1JJ2A 2EYFA 4EGQA 3GTGB 1EU4A 2LKVA 1SCUB 2FLLA 3KYHC 3GTLA 4BY7H 3J81E 2O2LD 3M3YH 4ECQA 1G291 2AHOB 4YJ2F 4CJ1B 1JKJB 2K05A 2VW9A 3K58A 4UCRA 5KFQA 3X3MA 4ZHQF 2QDBA 4GZYC 1EHIA 3H4BA 5EPJA 5LMNH 3N40P 2K7VA 3TREA 1QZHA 1C48A 1M4VA 2IX0A 2XGTA 4QUFA 1FL0A 1XX8A 3S14H 4BBSG 1S40A 3ERQA 1SLJA 3QZ8A 2CQOA 4ZKCB 2F3WA 1SEBD 4LUOA 1Y1WA 5E3FA 4MV7A 2MGSA 2ZDHA 4AYBA 3I7FA 2UUAL 5C4JB 2B2UC 4DAMA 4KV6A 1VQ9A 5I9OA 5CMDA 1XNRH 2XCLA 4QWEA 2C2DA 1GUSA 5KG2A 1L2ZA 2V5AA 2NB0A 4GOPA 3MVVA 3LGJA 2JA6A 2K6AA 4OIKA 5JOBA 5BMVF 4RNNA 4RH6A 5IOCA 1HQRD 3CMEA 4X62H 4F4WA 1TWCB 3A55A 2ZJQA 3PQIA 2CW7A 2IT1A 1LACA 1WR2A 3CC2A 3J81i 2X6GA 4JV5H 1L0YB 1U4RA 3EA6A 2RCNA 1K8GA 1IBML 1CQIB 5GADC 4A3JB 4KK7A 3T1HQ 1G6PA 4K0KH 4QCLA 1K8OA 1Z47A 5A2QE 4IO9A 2PQEA 4F7XA 3GD7A 2XWJB 3TDQA 1U5KA 4DAVA 2FMAA 2GLTA 2NBFA 4LH6A 2LS01 1WTRA 1VCIA 1B04A 1EQVA 1VBHA 2YZMA 5BR8L 1IBLL 5IYBH 2ID0A 4L5SA 2B3GA 1JJCB 2VZAA 2K04A 2JA7H 1XMOH 1B3QA 3IKJA 4L5RC 4MV9A 2PMZB 4FVMA 5FO7B 5KFJA 2EXDA 5C0XH 1EOTA 1XNRQ 2IWHA 1JCKB 1JT8A 1NY4A 1AFPA 2J9GA 3K3VA 2R8GA 2E2HA 3CVZA 1TWGA 3A8KE 2TMPA 3PO2H 4DUYH 4DR4H 4DV5L 1O7YA 4IURA 1TWFH 3P20A 5EKIA 1CSPA 4DR2Q 1S0OA 5CBEE 2WAQB 2YYZA 1YNND 5COYA 4ME3A 2ASLA 4A3JH 1LABA 4YBZB 1F2MA 4RAUC 3GIJA 3IRBA 1GUWA 4KKSA 4KI0A 3PUYA 1VF5C 4KD3A 2UXBQ 1PLFA 3FMAA 3HG9A 5JEAH 1KABA 1V9PA 4LF6L 3PN1A 2HDLA 3A5UA 1PX2A 4WRDA 2VUMA 2KSWA 3MAQA 3S14B 3S15B 1EEFD 3QO2A 3GO5A 5C0XJ 3I56A 3I4NH 2R6FA 1MIUA 5M3MB 3CPWA 3PUVA 3QFFA 1EYGA 1Q8IA 4JUZA 3STBD 5BR8H 1IBLH 2G5DA 4O3OA 4DNRB 4J8QA 1KJQA 3DEOA 1A9XA 1BR9A 3MXNA 5CAEB 3RBDA 1EYZA 5M9OA 1TS4A 4WJWA 4JI7H 1GJXA 2R7MA 1HNZL 2ATWA 5KGUA 2IPKD 1IBMH 5D3DA 4APMA 1KRTA 4JI0H 3PIOA 1X32A 1FVIA 4QW8A 1BXRA 1PH7A 1H9SA 5EZYF 3GV5B 1MZBA 4A3BH 3NXWA 2L4NA 1HXYD 3PGZA 4DUYL 4RHSA 4IFDJ 3G71A 4DV4Q 3PMFA 3VA7A 4I55F 5DG8A 4A3BB 4LF6Q 3T53B 3GTPB 3LWBA 4PG3A 5IP7H 3S9WA 5EWGA 1JC7A 1IOVA 1CFMA 2ZXOA 4HN7A 4ZKBB 4K2LA 1EY7A 1PTOB 1HH2P 3BZCA 3UE1A 2NVXB 4L1KA 2UUBH 2ASBA 2ZDGA 3I73A 1YZ6A 3J7AK 1PTOH 4IOCA 4JPBW 1SNDA 2MPMA 1N8RC 1PHJA 2Z6BA 1GUGA 3M9OB 1S68A 2L9HA 1XPRA 4M9UA 2K33A 1VQHA 4JYAQ 1QVFA 5KFNA 4RWSC 2VA2A 2I46A 1CQVA 2YYAA 5IYBG 1TS2A 3TBIB 1S5FD 4Y52H 4IOAA 2L15A 4EQNA 4GOPC 4LF4H 4DR5Q 3GTLB 2NN6G 3H40A 1AZPA 1VQLA 5LMNL 5KT4A 5KFOA 1WFQA 3U9OA 2NUAB 5JUMA 2JEGA 2W9AA 3UDXA 3ND9A 4O3PA 3PUWA 4UCSA 1DOKA 2I5LX 4O3QA 4RKBA 1M8AA 4MA0A 3JAMc 2EXZA 1B8AA 4KHPQ 1SE2A 4A3MG 3S24A 3LNNA 2VPSA 1MJCA 3J7AV 5KG5A 4HNUA 4AQYL 5C0XI 1HHVA 3HGBA 1I94L 4JI1Q 2RA4A 1I3QH 1J8IA 4RZQA 3T5HA 2ZJPA 2X6LA 3AFQA 4RB0A 3JAMi 3V6JA 3A7AB 2I5MX 1KC8C 2W6ZA 4EYHB 3JSNA 1NCVA 4IRDA 1GHJA 4DR7H 3T1YH 2C5CA 4PWQA 5T1IA 3I4MB 3Q1KA 2VQFQ 1B6RA 2PZTA 4RB1A 4X3UA 4PZ6A 1CKMA 4PQXA 3I90A 4O4LF 3SVMA 5ISRA 3BJUA 3TP8A 1KJIA 4A3KB 2R7ZB 3J7AF 3VPBA 4YR3A 5HY6A 5JPMC 2DJFC 3F8NA 4RU9A 4GKJH 5IIFA 1ESRA 5K36G 3N6XA 4NB3A 4KD4A 1PTOC 2Y0SA 1BCPB 4K5VA 4NXMQ 4JG2A 5KG1A 3KAJA 3WOEA 3ER0A 2DZDA 1C9OA 4FXDA 1HUNA 1XMQL 2W9CA 3R2IA 3WNZA 4DV3H 2EY6A 4C3JH 3IFTA 1KL9A 4LF7L 3N8DA 2F52A 2H4OA 3DXJC 4P75A 1GOZA 4A3DG 5IGFA 1WCMB 1J5EL 1I94Q 1I94H 1AE2A 5CV5A 3J80c 2R7KA 3TQTA 3NBHA 5C0XG 1F2LA 4R1JA 5C3WA 5GAEC 2ALZA 2B8GA 3HKSA 3BAAA 2KCNA 4DV0L 5M5YH 3OHBA 2E76C 1X54A 2HIVA 1R9TA 4AYBG 1H9RA 2F0QA 3CD6A 4BS9A 3FMCA 2Q8TA 2RCFA 3T51B 4R8UA 3BS1A 1PH1A 2JA5G 1HRJA 2DGYA 5LOVF 4WD3A 5KT6A 1OO9B 5LMNQ 3IAYA 3R3OA 2DN8A 3HS0C 2FK1A 3KLRA 5FLXW 2F0JA 3NTKA 4LF4L 4C1NI 2NUCA 3JAME 3OW7A 1I5FA 1O80A 3TP5A 2L5TA 3GILA 1ZKOA 3GTMA 4R4QA 2W6PA 1PRTC 4R8IA 2YRWA 3E0JA 1YHBA 4Y7NH 5JJZA 1HZBA 1LT5D 5BPHA 4HIKA 4DR6L 1L0XB 1RODA 4ME5A 2JA8G 3K7AH 3P7JA 3KBGA 4QWBA 1NUCA 2A73B 4R4TA 3H0GH 5M3FH 3GTOH 3MWDA 3H3VI 3V6HA 4HSPA 4A93H 2P0AA 2JA9A 1X65A 3G6XA 3FKIA 4HJAA 2JA7G 4A3FB 1HNWH 4R9WA 2QGQA 4DL4A 1STGA 2F0DA 2WKCA 3PV0A 3KXYT 4A3FH 2VPQA 4B3RH 1SYXB 3RGXA 3RGZA 4JI0L 3HOZB 2B8FA 3BYTB 1STHA 3GQBA 4KKUA 1EQRA 1PRTB 1I4HA 3VR3A 1HNZQ 2R6GA 3OUUA 2R93A 1T94A 4AQYQ 3D31A 4A4IA 1VQEA 2K5HA 3Q22A 3Q24A 2LMCB 1HNWL 1ENFA 5C5JA 4DR1H 4C2MH 4JI4Q 3MWYW 3K3PA 4UDUC 2QCPX 1CM9A 3W5OA 2RSNA 1YJNA 2JQOA 2OXPA 3PCOB 1RJPA 1RK5A 4QIWB 3WO1A 3EPGA 1YNJD 5J1ZA 2CWAA 1B70B 3AFPA 4OX9L 4LMQD 4BXXG 1RYSA 4GNXB 3HOVG 3RAXA 2IJ0A 5CYUA 2V4DA 4JI3L 5A35A 3CCJA 1DM0B 1WD0A 1K8AC 4X65H 3ND8A 4EG0A 4XYLB 1X56A 1SSOA 4V0BA 4I65A 3PW4A 1S97A 4LF6H 3W1GA 4B3SL 3EIVA 2F4VH 1K0RA 4JYAL 5CGKA 3CF5A 1QOHA 2EYPA 3G6YA 3K8AA 2JA6G 4HIOA 5EPKA 1AUVA 4OWXB 1UEBA 4YAKB 1Q86C 1LTBD 5FKAC 2MJ8A 3D4DA 3WDNA 4LAAA 5ELBA 3L0OA 4DR4L 3KOJA 1HZ9A 3DHQA 4CDDC 4PZ7A 3MA2B 1D7QA 2Y0SE 2ASDA 5C3EG 3H15A 3KDFB 2VUGA 1FR3A 5KRUA 3NPPA 3GV7B 3NUCA 1J6QA 3FPPA 1F9SA 1CHPD 1CKNA 3URYA 2UUCL 2R92G 2HIXA 5EKLA 1B44D 1SAPA 1ENCA 1JWMD 1NTGA 2NVYH 2UVWA 1TR5A 5IT9W 4L5QA 3RUZA 1OXTA 2IW3A 3SXHA 4RAZA 3TZUA 2AQ3B 4IFDI 1NR2A 5LMUH 1D5ZC 4HIDA 1GO3E 4TRDA 2A5HA 3CRKC 1N48A 3I2ZA 1QVGA 4B3TL 1EWIA 1W3SA 2YTVA 3K5OA 2WE6A 3GP7A 4J9KA 4DR1Q 1IBMQ 3KF6B 4LFAQ 1I7LA 3RB4A 4GLVB 5ELFA 1PZJD 4DUZL 4N9PA 1H9MA 4K6DA 4GKJL 2PMZA 2VQEL 3NE5B 2D0PA 3KHGA 4YJ3F 1ET6A 3CPFA 4EEQA 3Q0AA 2X0SA 2W70A 4OGQC 4X62L 5CV4A 1ULZA 1MKHA 2R61A 2KQ3A 1K73C 1PH6A 2E2HH 3T4AC 1VQMA 1LM0A 4LK1C 1YJWA 4DR7L 1CZGA 3SE0A 1E1TA 3TSSA 3STBC 1XDNA 1UNSA 1TWAA 1B3AA 3KTMA 3V6KA 3FP9A 2Q8IB 1TWFB 4E4TA 3OMCA 4EBDA 2Z4IA 2WP8J 4KJOA 5ELCA 1SFOH 1A6XA 2D2CC 3RFCA 1Y69U 1C8CA 4L6TB 1Q3LA 4NPSA 1Z9FA 2J7ZA 3BDCA 3TIIA 4A3LH 4Q0FA 1UE5A 4BXXH 3DWPA 1QNUA 4J9OA 2HVSA 4P73A 4FXKC 2CW8A 3OSOA 4EFBA 3D0FA 1SYEA 3BVMA 1ZHSA 4L5TA 2MO0A 2K5DA 3U4ZA 4BBRG 5KT2A 2XWBB 4IUNA 3BVZA 4TV8F 3RUPA 2XIWA 1EEID 2GVAA 1GVPA 4CHTB 3IG0A 2W8LA 5IP7G 2A8VA 5BR8Q 1IBLQ 2I87A 2X69A 3UFXB 3W2DA 2RKSA 3I3CA 4IPCA 5LHY1 2AGOA 1LT6D 4YCVA 1CA5A 4PMBA 2UVVA 1SR3A 5KT5A 2W9CB 4B3TH 4RHRA 3GTJH 4GS3A 4ZCKA 4A76A 1Y1WB 1PVOA 2R84A 5KFZA 3NBIA 2BE5D 4H02A 5IODA 2A69D 3S1RH 1AH9A 1B53A 3DWQA 4C1NK 4N8X1 3VDYA 4HYKA 4MTKA 4HJ7A 5DGAA 4KN7C 1S5CD 3KDFA 5C3EH 2CKZB 3RLOA 3U9TA 2EYHA 2VA3A 2JEFA 2M00A 1VMPA 1KD1C 1LTRD 4X65Q 5KFYA 1K28A 1PFBA 1PFSA 1K3BC 4FS2A 4O3RA 2FK3A 1D1KA 3JRXA 4UCVA 1SBBB 3M7GA 1L0WA 1QZGA 1BBXC 1A2TA 4RGTA 3GTGA 4JI0Q 2HVQA 3MTSA 2JA8B 2QYZA 3S15H 5LP6F 1T9HA 1MHWC 3CQZH 2F3IA 2R92B 2VQEH 2NU6B 4KN4C 2NU9B 1O78A 2PI2E 5M5WB 1W6KA 1R9TB 4DR3Q 2JEIA 4P74A 3K6OA 3SK6A 3IN5A 4X3KA 2B2UA 3TN2A 1TWHH 4NW2A 1SRUA 3KFUA 3S1QB 4B3SH 1QE6A 1K83H 4ME6A 5KFGA 2RDJA 1PH8A 4V190 1FNWA 5BN3A 1BDOA 3J7A5 3GLKA 3GTKA 4X64Q 4A2BA 1PZKD 1TXYA 3SI8A 3HOXB 4QUCA 1Q46A 4R8NA 3UE0A 1Q90A 1QVCA 5DG9A 3K5MA 4XIGS 5A2QW 4BBSH 5KT3A 1S0MA 4OX9H 1JR0D 3OIPA 1WTWA 5JAVA 1Z2NX 5KFWA 2OLSA 1D5XC 4E6IA 2JA8H 4KHPH 1HJPA 4LF8Q 2PNRC 4MHEA 3DM3A 1B7YB 4A3GB 1I6HB 3VR5A 4R7RA 4DU9A 2IA6A 4U7CA 1S0NA 1Z7TA 2PZUA 5D14A 3PO2B 3TS0A 1HFGA 4A93G 4BWGB 1CQJB 2BQRA 4ZAIA 2OH2A 2PMZE 2VB2X 4MZ9A 1JB3A 3M4PA 1YNJC 5JPNC 1LLRD 3ERSX 3G7LA 2N78A 3MC0B 3TQ1A 3E3XA 2ZXPA 3FEWX 2F4VL 3MWMA 1B6SA 4Q8EA 1A8VA 4HCSA 1SXTA 5FOBB 2DJGC 4HJ9A 3HOZG 2AMCB 1VQBA 2UVUA 4JI3H 1J5EQ 5ELEA 4FF1A 4HNTA 2DPJA 2F0SA 4ZQ3A 4R4CA 1WD1A 2K28A 3RZDH 4YR0A 2VQDA 4MTDA 1RD9D 4DR5H 1XMQQ 5KG6A 4LJZC 4CDFC 4IALA
chains in the Genus database with same CATH topology
1ASYA 3KF6A 2NVTH 3CCSA 4ALPA 4JI4L 2Q2TA 4DR1L 4GNXA 4NXNQ 4A3IG 3I4NG 2MNAA 3OW2A 1X3GA 1HNZL 2ATWA 1C0AA 4A3CH 2KCTA 1KRTA 2R7DA 3PIOA 4JV5L 1FVIA 2UUBQ 1TWAH 1NJIC 4JI2L 3KF8B 1X55A 1PH7A 2B63H 3PSIA 3RR5A 4A3BH 3F8TA 4DUYL 3RNUA 3PGZA 2UU9Q 3GTPH 4BY7G 4IFDJ 3G71A 5IP9H 4DV4Q 3ICEA 1VS0A 3W1BA 5C44G 4LF6Q 4IFDG 1RL2A 3RN5A 5C4XG 1PYSB 4PG3A 4DK3C 4OXPA 5IP7H 2YU9H 5M3MH 5LMNW 2UXCQ 1Q82C 2IHFA 3HOYH 3ULPA 3G48A 1IXRA 2K52A 3M9BA 4BY1G 3UE1A 1HH2P 3BZCA 3UDIA 4X66Q 3F2BA 1VQ4A 2ASBA 3GTGH 1YZ6A 5GQOA 5IYDG 4DV6Q 4IOCA 1KRSA 4DUZQ 1GD7A 1N8RC 3JC66 1PHJA 5IP9G 1ASZA 1XPRA 2ES2A 1N34Q 3CC4A 1N32Q 1IZ6A 1VQHA 1QVFA 4JYAQ 4DV3L 4K0KQ 1NMFA 2NZHA 1YI2A 1AE3A 4OWWB 5IWAQ 5IYBG 1XNQQ 2AWOA 2ZJRA 3E9IA 4JCVE 2R7FA 5IT9c 4BY1H 1SROA 4IOAA 2L15A 3OYYA 4JI8L 3HOXG 4GOPC 1HNXL 2ZM6L 4DR5Q 1FJGL 2NN6G 3GTMH 2F4VQ 1L1OA 5JEAJ 1VQLA 4KLKA 1X3EA 5LMNL 5FLMG 4JI3Q 1WFQA 4GN4B 1WCMH 3AEVA 1N9WA 1K3RA 3UDXA 1PH2A 2NVQH 2R92H 1Q7YC 4DV2L 2B29A 1IBKQ 2PI2A 3PUWA 4DV7Q 5IWAL 3HOUG 2A19A 3FHWA 3J81c 2I5LX 4DV5Q 3T1HL 1TWGH 1WYDA 3JAMc 1LYLA 1B8AA 1XPOA 3T1YL 4KHPQ 4A3MG 3S24A 5ELOA 1VQJA 2VL6A 3OTOL 1VQ7A 4LFCQ 1MJCA 2UXDL 4QL5A 2Z6KA 1A62A 1XNRL 4JBJA 4AQYL 1KAWA 4B3RQ 1YVCA 5C0XI 1G51A 1GKHA 1I94L 4JI1Q 1I3QH 4X66L 4P71A 1EQQA 4LW1A 1L1OC 2R93H 2JK8A 2ZJPA 1E7ZA 3AFQA 4KHZA 4UP7A 4J15A 3JAMi 3M4OH 1U0LA 4DV1L 4DK6C 2I5MX 3CCVA 4YWLA 1KC8C 4WJ3M 4X64L 5DLQE 2DUDA 2VUMH 4A3MH 3I4MH 4JI8Q 2K75A 3A0JA 1VQ6A 3RN2A 1R9TH 2K5VA 2UU9L 3A74A 2Y0SG 3L7ZC 2NVXH 5JJLA 1Y14B 1KIXA 2VQFQ 1OXVA 1OTCA 2OTLA 4AH6A 5IE8A 4PZ6A 1IYJB 1CKMA 2A1AA 1Q8KA 2MQHA 4JV5Q 2CWPA 2IY5B 1Y1WG 3BJUA 3HKZE 4GN3B 5FJ8H 4QY7A 2HHHL 2BH2A 3F2DA 5HY6A 4OO1I 3HKZG 1D8LA 1P16A 2VQEQ 4BBRH 4EX5A 5K36G 4NB3A 2R7ZH 4TQUS 5C4JH 1IBLL 4A3EH 3S2HH 4NXMQ 3NELA 1BBUA 4JBWA 2PNHA 4JG2A 5J3BA 5IY0A 4OO1G 3ER0A 4LFAL 2VNUD 1C9OA 1HZCA 2WAQE 3S1MH 2WFWA 1XMQL 2XTIA 3CCEA 3CCUA 1N36L 1Y1VH 4C3JH 1KL9A 1YEZA 4LF7L 5H1SE 3L2PA 4DV4L 2F52A 4P75A 4A3DG 4WJ4A 1EUJA 1VQDA 4A3LG 1VQ8A 1I94Q 1J5EL 1TWCH 4GN5A 4APVA 1AE2A 1VQAA 4IPGA 2IHEA 3J80c 1XJVA 4R4OA 2ZTCA 5C0XG 1L2FA 2UUAQ 2UUBL 4GLAC 4A3FG 4R1JA 5GAEC 1V43A 1YITA 1VQIA 1QUQA 4A3IH 3PUXA 3HKSA 4IJLA 2QEXA 1Q12A 4DV0L 1Y1VG 5M5YH 2UUCQ 1Q1BA 2H5XA 3PO3G 4A75A 2OTJA 1X54A 2HIVA 4AYBG 3TRZA 3CD6A 5EAYA 3S17H 1LTLA 1EIFA 1PH1A 2JA5G 2DGYA 1VQNA 1VQFA 2I0QA 3G4SA 4LUVA 1JMCA 5LMNQ 1EFWA 1L1OB 4GKKL 2Q2UA 1WOCA 3TQYA 4QJFA 5GAGC 1K9MC 4LF4L 4A3CG 2IX1A 4X6AH 1HR0L 1I5FA 2JJQA 2K14A 4BA1I 4JI7L 5M3MG 1W2BA 3ZJYC 3S1NH 2NN6I 3GTLH 4A3JG 4JC0A 3U50C 1UE6A 1N32L 5LMUL 4POGA 4R4QA 3UDFA 4L5SA 1XTDA 3HOUH 3BZKA 1YHBA 4Y7NH 1HZBA 4A3KH 2YV5A 1CUKA 4HIKA 4DR6L 4C3IH 2CCZA 2JA8G 5AJ3Q 3CXCA 3K7AH 1UE7A 1YBYA 4IJHA 1UWVA 4R4TA 1HZAA 3H0GH 5M3FH 3GTOH 4LF5Q 3H3VI 1NMGA 1XMOQ 1YNXA 4JI6Q 3E9HA 4HJ8A 4A93H 2JA9A 1X65A 4UY8C 2FXQA 4DAYB 1QUQB 4HJAA 2JA7G 4RMFA 2N3SA 1KQSA 2KHIA 3DLLA 2QGQA 4GLXA 4B3ML 2C35B 2CFMA 3PV0A 4JI5L 4EQ5A 1YHAA 1YHQA 4DV1Q 2B63G 2HQLA 4A3FH 1M1KC 1WCMG 3RZOH 5JJKA 2D0OA 3TEHB 1SN8A 4R4IA 2JEAI 1YJ9A 4JI0L 3G6EA 5C44H 1HNZQ 1EQRA 2R6GA 3K0XA 1JB7A 4JBMA 1N33L 2KBNA 4AQYQ 3CCQA 3D31A 4A4IA 2K5HA 1VQEA 1E1OA 2ALYB 1A0IA 3M85A 4A3GH 1HNWL 1CKNB 4C2MH 4JI4Q 1YIJA 1GM5A 4KHPL 2RHSB 4X65L 3W5OA 4MTNA 3GTQH 3KLWA 1YJNA 2K50A 2JQOA 3PCOB 3PIPA 3CC7A 1VQ5A 1XMOL 1EIYB 3AYHB 1EOVA 4DV7L 2R7ZG 2CWAA 4AYBE 5HGQA 4JBKA 1B70B 3AFPA 5IYCH 4OX9L 1A63A 2LXKA 4BXXG 2NZOA 4QIWE 2KCMA 4IPDA 4HIMA 1PH4A 2AWNA 4GNXB 3HOVG 2VS1A 3A5ZB 4TVAB 4JI3L 3CCJA 5FLXc 1K8AC 5JJIA 2MO1A 1KHIA 4O2DA 1X56A 5LMUQ 1E3PA 1BKBA 4YCWA 1XNQL 1DGSA 3W1GA 3EIVA 4B3SL 4P72A 4K0KL 3CAMA 1K0RA 4YY3Q 3F1ZA 4JYAL 3CF5A 5ELNA 4YWKA 1HR0Q 1N34L 2EIFA 3MXNB 4LUZA 3K8AA 2JA6G 1RIPA 4HIOA 2JE6I 4UPAA 4DR4Q 4OWXB 1UEBA 3E0EA 1Q86C 4B3RL 2GN5A 4DR2L 4DV6L 3L0OA 4DR4L 3KOJA 4YHHL 1HZ9A 1JJGA 2D62A 4JOIA 4UP9A 1VQGA 1PA6A 4PZ7A 4LF8L 1D7QA 2Y0SE 5C3EG 3H15A 3KDFB 3CP0A 1N33Q 5IYDH 4DV0Q 1J6QA 2N8NA 2PQAB 1CKNA 4DV2Q 2UUCL 4A3DH 2R92G 2HIXA 2E8GA 1XPUA 2R93G 1NTGA 2NVYH 3CW2C 1Q81C 3NBHB 4L5QA 4A3GG 3NEMA 3I4MG 2GVBA 1OXTA 4OX9Q 1PH3A 4IFDI 3J81j 4LF7Q 3WWVA 2WAQG 1GO3E 4HIDA 1VQCA 1WI5A 1PH5A 3I2ZA 4LWCA 1QVGA 4B3TL 1EWIA 1W3SA 2YTVA 4NXNL 2E5LQ 2BA1A 4DR1Q 3KF6B 4LFAQ 1IBMQ 3S1QH 4DR3L 1I50H 4PZ8A 1S3OA 4GLVB 5AJ3L 4DR6Q 4DUZL 3HFZB 4GKJL 3K7UC 3PUZA 3I55A 2VQEL 1P8LA 2BH8A 2D0PA 3F2CA 3PF5A 2OWOA 3GTKH 2Q2IA 2HT1A 3EN2A 1Q1EA 3CPFA 4FDBA 2QA4A 2UXCL 4PMWA 4IPHA 4X62L 3S16H 4B3TQ 4JI5Q 1MKHA 4RG1A 3BU2A 1K73C 1PH6A 2E2HH 1VQMA 1PYBA 3M7NA 1LM0A 1YJWA 2JA6H 4DR7L 3RLNA 2OQKA 1E1TA 4LNQA 2UXBL 3HOZH 3STBC 2LSSA 1BBWA 2VUMG 3FP9A 1UE1A 2ZTDA 1E24A 3ULJA 2YTYA 2WP8J 2OQ0A 3KJPA 4LF9L 4XTCS 4GOPB 2KHJA 1SFOH 4DPGA 4QQBX 3FKIG 2N49A 5M5WH 1E22A 1CSQA 4O0AA 4NPSA 1Z9FA 3CCMA 2K4KA 5GROA 3OTOQ 1JJ2A 4A3LH 5IYCG 3T1YQ 1UE5A 4BXXH 2RHQB 1O7IA 3KYHC 4P73A 1BVSA 4BY7H 3M3YH 2WB1E 1G291 2AHOB 3D0FA 4L5TA 2MO0A 3U4ZA 4BBRG 3HOWG 1JE5A 1IBKL 2VW9A 3SGIA 1X9NA 2GVAA 5C4XH 1GVPA 4GKKQ 4QGUA 5IP7G 1OXXK 2A8VA 1WJJA 5BR8Q 1IBLQ 3MEFA 3TREA 1QZHA 3B6YA 1N36Q 2WB1G 3HOYG 4B3SQ 2IX0A 2XGTA 1FL0A 4IPCA 2JA5H 4A3BG 3S14H 1M90C 3Q8DA 4YCVA 5FJ8G 4BBSG 1S40A 4NXML 1SLJA 1SR3A 3KJOA 2CQOA 3M4QA 3NENA 4YCUA 4A3KG 3GTJH 4LUOA 1NBWA 2LXJA 4GS3A 4A76A 3CCLA 1PVOA 1LUZA 4DV3Q 2JEBI 4H02A 4A3EG 3S1RH 2E2IH 1AH9A 2HHHQ 2Z0SA 1IL2A 3VDYA 3HOVH 4HJ7A 2OCEA 4YHHQ 1X3FA 3I7FA 3KDFA 5C3EH 1CKOA 4DAMA 2UUAL 2CKZB 3RLOA 1VQ9A 4YWMA 1HR0W 2VQFL 1KD1C 4X65Q 3HOXH 4DR7Q 1PFSA 1KXLA 4Y52H 3UDGA 3U4VA 1VQKA 4GOPA 4LFBQ 1HNWQ 2ZTEA 3AQQA 3LGJA 3K80C 4BA2I 1QZGA 1C7YA 1L0WA 2Q2HA 3CMEA 5JEAG 2ZJQA 4JI0Q 2MFIA 3H0GG 5M3FG 2IT1A 4JI1L 3U58A 2E2JH 3S15H 1T9HA 2KENA 3CQZH 2F3IA 3CC2A 3PO3H 4GKJQ 1PV4A 4JI2Q 1FGUA 1SMXA 3J81i 3TS2A 2K5NA 4HJ5A 2PI2E 4POFA 4OONA 1NE3A 4LFCL 4DR3Q 4P74A 2RCNA 1K8GA 1IBML 5GADC 2V1CC 2E5LL 3T1HQ 1G6PA 4JI6L 1TWHH 3KFUA 1SRUA 1Z47A 1K83H 4IO9A 4LF5L 3GD7A 1PH8A 1U5KA 2I5HA 3GDEA 4DNIA 3J7A5 2Z6KC 4X64Q 1VCIA 4JOIC 3PO2G 1TXYA 2RF4A 1Q46A 3UE0A 5BR8L 5IYBH 2ID0A 1QVCA 3J7ZC 2B3GA 2EQSA 1VQOA 1JJCB 4XIGS 3RLFA 1MJEA 2ZM6Q 4DR5L 1HNXQ 4BBSH 2VY3A 2VZAA 2BA0A 5GAHC 2JA7H 4L5RC 4B3MQ 5FLMH 2EXDA 1XNRQ 1JT8A 4JI7Q 4LFBL 1NY4A 2UXDQ 2JA8H 1Y1WH 1HJPA 4LF8Q 1VQPA 3DM3A 1B7YB 3J80i 4GNXC 4LF4Q 3CCRA 4OWTB 3PO2H 1H95A 4DV5L 1TWFH 3FKIH 1CSPA 4DR2Q 1S72A 3ULLA 3TS0A 2PQAA 2YYZA 4A93G 4LF9Q 1SE8A 4ME3A 3H3VH 4A3JH 1X6OA 2PMZE 1PH9A 5M5XH 4MZ9A 3M4PA 3IRBA 4UP8A 4YY3L 2AKWB 3ERSX 4KI0A 3PUYA 2N78A 2UXBQ 1OXSC 2YTXA 2F4VL 3HOWH 4MNOA 4LF6L 1V9PA 1FJGQ 1V1QA 3A5UA 1A8VA 4C3HH 4DUYQ 4HJ9A 3HOZG 3EBEA 2AMCB 1VQBA 4X62Q 3GO5A 3K81C 5C0XJ 3I56A 1J5EQ 3I4NH 1MIUA 5E7NA 3CPWA 4AIMA 4R4CA 3S2DH 3PUVA 3PF4A 1EYGA 3STBD 3RZDH 4DKAC 1OXUA 3I4OA 1XMQQ 3CMAA 1I6HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASY A;  3KF6 A;  2NVT H;  3CCS A;  4ALP A;  4JI4 L;  2Q2T A;  4DR1 L;  4GNX A;  4NXN Q;  4A3I G;  3I4N G;  2MNA A;  3OW2 A;  1X3G A;  1HNZ L;  2ATW A;  1C0A A;  4A3C H;  2KCT A;  1KRT A;  2R7D A;  3PIO A;  4JV5 L;  1FVI A;  2UUB Q;  1TWA H;  1NJI C;  4JI2 L;  3KF8 B;  1X55 A;  1PH7 A;  2B63 H;  3PSI A;  3RR5 A;  4A3B H;  3F8T A;  4DUY L;  3RNU A;  3PGZ A;  2UU9 Q;  3GTP H;  4BY7 G;  4IFD J;  3G71 A;  5IP9 H;  4DV4 Q;  3ICE A;  1VS0 A;  3W1B A;  5C44 G;  4LF6 Q;  4IFD G;  1RL2 A;  3RN5 A;  5C4X G;  1PYS B;  4PG3 A;  4DK3 C;  4OXP A;  5IP7 H;  2YU9 H;  5M3M H;  5LMN W;  2UXC Q;  1Q82 C;  2IHF A;  3HOY H;  3ULP A;  3G48 A;  1IXR A;  2K52 A;  3M9B A;  4BY1 G;  3UE1 A;  1HH2 P;  3BZC A;  3UDI A;  4X66 Q;  3F2B A;  1VQ4 A;  2ASB A;  3GTG H;  1YZ6 A;  5GQO A;  5IYD G;  4DV6 Q;  4IOC A;  1KRS A;  4DUZ Q;  1GD7 A;  1N8R C;  3JC6 6;  1PHJ A;  5IP9 G;  1ASZ A;  1XPR A;  2ES2 A;  1N34 Q;  3CC4 A;  1N32 Q;  1IZ6 A;  1VQH A;  1QVF A;  4JYA Q;  4DV3 L;  4K0K Q;  1NMF A;  2NZH A;  1YI2 A;  1AE3 A;  4OWW B;  5IWA Q;  5IYB G;  1XNQ Q;  2AWO A;  2ZJR A;  3E9I A;  4JCV E;  2R7F A;  5IT9 c;  4BY1 H;  1SRO A;  4IOA A;  2L15 A;  3OYY A;  4JI8 L;  3HOX G;  4GOP C;  1HNX L;  2ZM6 L;  4DR5 Q;  1FJG L;  2NN6 G;  3GTM H;  2F4V Q;  1L1O A;  5JEA J;  1VQL A;  4KLK A;  1X3E A;  5LMN L;  5FLM G;  4JI3 Q;  1WFQ A;  4GN4 B;  1WCM H;  3AEV A;  1N9W A;  1K3R A;  3UDX A;  1PH2 A;  2NVQ H;  2R92 H;  1Q7Y C;  4DV2 L;  2B29 A;  1IBK Q;  2PI2 A;  3PUW A;  4DV7 Q;  5IWA L;  3HOU G;  2A19 A;  3FHW A;  3J81 c;  2I5L X;  4DV5 Q;  3T1H L;  1TWG H;  1WYD A;  3JAM c;  1LYL A;  1B8A A;  1XPO A;  3T1Y L;  4KHP Q;  4A3M G;  3S24 A;  5ELO A;  1VQJ A;  2VL6 A;  3OTO L;  1VQ7 A;  4LFC Q;  1MJC A;  2UXD L;  4QL5 A;  2Z6K A;  1A62 A;  1XNR L;  4JBJ A;  4AQY L;  1KAW A;  4B3R Q;  1YVC A;  5C0X I;  1G51 A;  1GKH A;  1I94 L;  4JI1 Q;  1I3Q H;  4X66 L;  4P71 A;  1EQQ A;  4LW1 A;  1L1O C;  2R93 H;  2JK8 A;  2ZJP A;  1E7Z A;  3AFQ A;  4KHZ A;  4UP7 A;  4J15 A;  3JAM i;  3M4O H;  1U0L A;  4DV1 L;  4DK6 C;  2I5M X;  3CCV A;  4YWL A;  1KC8 C;  4WJ3 M;  4X64 L;  5DLQ E;  2DUD A;  2VUM H;  4A3M H;  3I4M H;  4JI8 Q;  2K75 A;  3A0J A;  1VQ6 A;  3RN2 A;  1R9T H;  2K5V A;  2UU9 L;  3A74 A;  2Y0S G;  3L7Z C;  2NVX H;  5JJL A;  1Y14 B;  1KIX A;  2VQF Q;  1OXV A;  1OTC A;  2OTL A;  4AH6 A;  5IE8 A;  4PZ6 A;  1IYJ B;  1CKM A;  2A1A A;  1Q8K A;  2MQH A;  4JV5 Q;  2CWP A;  2IY5 B;  1Y1W G;  3BJU A;  3HKZ E;  4GN3 B;  5FJ8 H;  4QY7 A;  2HHH L;  2BH2 A;  3F2D A;  5HY6 A;  4OO1 I;  3HKZ G;  1D8L A;  1P16 A;  2VQE Q;  4BBR H;  4EX5 A;  5K36 G;  4NB3 A;  2R7Z H;  4TQU S;  5C4J H;  1IBL L;  4A3E H;  3S2H H;  4NXM Q;  3NEL A;  1BBU A;  4JBW A;  2PNH A;  4JG2 A;  5J3B A;  5IY0 A;  4OO1 G;  3ER0 A;  4LFA L;  2VNU D;  1C9O A;  1HZC A;  2WAQ E;  3S1M H;  2WFW A;  1XMQ L;  2XTI A;  3CCE A;  3CCU A;  1N36 L;  1Y1V H;  4C3J H;  1KL9 A;  1YEZ A;  4LF7 L;  5H1S E;  3L2P A;  4DV4 L;  2F52 A;  4P75 A;  4A3D G;  4WJ4 A;  1EUJ A;  1VQD A;  4A3L G;  1VQ8 A;  1I94 Q;  1J5E L;  1TWC H;  4GN5 A;  4APV A;  1AE2 A;  1VQA A;  4IPG A;  2IHE A;  3J80 c;  1XJV A;  4R4O A;  2ZTC A;  5C0X G;  1L2F A;  2UUA Q;  2UUB L;  4GLA C;  4A3F G;  4R1J A;  5GAE C;  1V43 A;  1YIT A;  1VQI A;  1QUQ A;  4A3I H;  3PUX A;  3HKS A;  4IJL A;  2QEX A;  1Q12 A;  4DV0 L;  1Y1V G;  5M5Y H;  2UUC Q;  1Q1B A;  2H5X A;  3PO3 G;  4A75 A;  2OTJ A;  1X54 A;  2HIV A;  4AYB G;  3TRZ A;  3CD6 A;  5EAY A;  3S17 H;  1LTL A;  1EIF A;  1PH1 A;  2JA5 G;  2DGY A;  1VQN A;  1VQF A;  2I0Q A;  3G4S A;  4LUV A;  1JMC A;  5LMN Q;  1EFW A;  1L1O B;  4GKK L;  2Q2U A;  1WOC A;  3TQY A;  4QJF A;  5GAG C;  1K9M C;  4LF4 L;  4A3C G;  2IX1 A;  4X6A H;  1HR0 L;  1I5F A;  2JJQ A;  2K14 A;  4BA1 I;  4JI7 L;  5M3M G;  1W2B A;  3ZJY C;  3S1N H;  2NN6 I;  3GTL H;  4A3J G;  4JC0 A;  3U50 C;  1UE6 A;  1N32 L;  5LMU L;  4POG A;  4R4Q A;  3UDF A;  4L5S A;  1XTD A;  3HOU H;  3BZK A;  1YHB A;  4Y7N H;  1HZB A;  4A3K H;  2YV5 A;  1CUK A;  4HIK A;  4DR6 L;  4C3I H;  2CCZ A;  2JA8 G;  5AJ3 Q;  3CXC A;  3K7A H;  1UE7 A;  1YBY A;  4IJH A;  1UWV A;  4R4T A;  1HZA A;  3H0G H;  5M3F H;  3GTO H;  4LF5 Q;  3H3V I;  1NMG A;  1XMO Q;  1YNX A;  4JI6 Q;  3E9H A;  4HJ8 A;  4A93 H;  2JA9 A;  1X65 A;  4UY8 C;  2FXQ A;  4DAY B;  1QUQ B;  4HJA A;  2JA7 G;  4RMF A;  2N3S A;  1KQS A;  2KHI A;  3DLL A;  2QGQ A;  4GLX A;  4B3M L;  2C35 B;  2CFM A;  3PV0 A;  4JI5 L;  4EQ5 A;  1YHA A;  1YHQ A;  4DV1 Q;  2B63 G;  2HQL A;  4A3F H;  1M1K C;  1WCM G;  3RZO H;  5JJK A;  2D0O A;  3TEH B;  1SN8 A;  4R4I A;  2JEA I;  1YJ9 A;  4JI0 L;  3G6E A;  5C44 H;  1HNZ Q;  1EQR A;  2R6G A;  3K0X A;  1JB7 A;  4JBM A;  1N33 L;  2KBN A;  4AQY Q;  3CCQ A;  3D31 A;  4A4I A;  2K5H A;  1VQE A;  1E1O A;  2ALY B;  1A0I A;  3M85 A;  4A3G H;  1HNW L;  1CKN B;  4C2M H;  4JI4 Q;  1YIJ A;  1GM5 A;  4KHP L;  2RHS B;  4X65 L;  3W5O A;  4MTN A;  3GTQ H;  3KLW A;  1YJN A;  2K50 A;  2JQO A;  3PCO B;  3PIP A;  3CC7 A;  1VQ5 A;  1XMO L;  1EIY B;  3AYH B;  1EOV A;  4DV7 L;  2R7Z G;  2CWA A;  4AYB E;  5HGQ A;  4JBK A;  1B70 B;  3AFP A;  5IYC H;  4OX9 L;  1A63 A;  2LXK A;  4BXX G;  2NZO A;  4QIW E;  2KCM A;  4IPD A;  4HIM A;  1PH4 A;  2AWN A;  4GNX B;  3HOV G;  2VS1 A;  3A5Z B;  4TVA B;  4JI3 L;  3CCJ A;  5FLX c;  1K8A C;  5JJI A;  2MO1 A;  1KHI A;  4O2D A;  1X56 A;  5LMU Q;  1E3P A;  1BKB A;  4YCW A;  1XNQ L;  1DGS A;  3W1G A;  3EIV A;  4B3S L;  4P72 A;  4K0K L;  3CAM A;  1K0R A;  4YY3 Q;  3F1Z A;  4JYA L;  3CF5 A;  5ELN A;  4YWK A;  1HR0 Q;  1N34 L;  2EIF A;  3MXN B;  4LUZ A;  3K8A A;  2JA6 G;  1RIP A;  4HIO A;  2JE6 I;  4UPA A;  4DR4 Q;  4OWX B;  1UEB A;  3E0E A;  1Q86 C;  4B3R L;  2GN5 A;  4DR2 L;  4DV6 L;  3L0O A;  4DR4 L;  3KOJ A;  4YHH L;  1HZ9 A;  1JJG A;  2D62 A;  4JOI A;  4UP9 A;  1VQG A;  1PA6 A;  4PZ7 A;  4LF8 L;  1D7Q A;  2Y0S E;  5C3E G;  3H15 A;  3KDF B;  3CP0 A;  1N33 Q;  5IYD H;  4DV0 Q;  1J6Q A;  2N8N A;  2PQA B;  1CKN A;  4DV2 Q;  2UUC L;  4A3D H;  2R92 G;  2HIX A;  2E8G A;  1XPU A;  2R93 G;  1NTG A;  2NVY H;  3CW2 C;  1Q81 C;  3NBH B;  4L5Q A;  4A3G G;  3NEM A;  3I4M G;  2GVB A;  1OXT A;  4OX9 Q;  1PH3 A;  4IFD I;  3J81 j;  4LF7 Q;  3WWV A;  2WAQ G;  1GO3 E;  4HID A;  1VQC A;  1WI5 A;  1PH5 A;  3I2Z A;  4LWC A;  1QVG A;  4B3T L;  1EWI A;  1W3S A;  2YTV A;  4NXN L;  2E5L Q;  2BA1 A;  4DR1 Q;  3KF6 B;  4LFA Q;  1IBM Q;  3S1Q H;  4DR3 L;  1I50 H;  4PZ8 A;  1S3O A;  4GLV B;  5AJ3 L;  4DR6 Q;  4DUZ L;  3HFZ B;  4GKJ L;  3K7U C;  3PUZ A;  3I55 A;  2VQE L;  1P8L A;  2BH8 A;  2D0P A;  3F2C A;  3PF5 A;  2OWO A;  3GTK H;  2Q2I A;  2HT1 A;  3EN2 A;  1Q1E A;  3CPF A;  4FDB A;  2QA4 A;  2UXC L;  4PMW A;  4IPH A;  4X62 L;  3S16 H;  4B3T Q;  4JI5 Q;  1MKH A;  4RG1 A;  3BU2 A;  1K73 C;  1PH6 A;  2E2H H;  1VQM A;  1PYB A;  3M7N A;  1LM0 A;  1YJW A;  2JA6 H;  4DR7 L;  3RLN A;  2OQK A;  1E1T A;  4LNQ A;  2UXB L;  3HOZ H;  3STB C;  2LSS A;  1BBW A;  2VUM G;  3FP9 A;  1UE1 A;  2ZTD A;  1E24 A;  3ULJ A;  2YTY A;  2WP8 J;  2OQ0 A;  3KJP A;  4LF9 L;  4XTC S;  4GOP B;  2KHJ A;  1SFO H;  4DPG A;  4QQB X;  3FKI G;  2N49 A;  5M5W H;  1E22 A;  1CSQ A;  4O0A A;  4NPS A;  1Z9F A;  3CCM A;  2K4K A;  5GRO A;  3OTO Q;  1JJ2 A;  4A3L H;  5IYC G;  3T1Y Q;  1UE5 A;  4BXX H;  2RHQ B;  1O7I A;  3KYH C;  4P73 A;  1BVS A;  4BY7 H;  3M3Y H;  2WB1 E;  1G29 1;  2AHO B;  3D0F A;  4L5T A;  2MO0 A;  3U4Z A;  4BBR G;  3HOW G;  1JE5 A;  1IBK L;  2VW9 A;  3SGI A;  1X9N A;  2GVA A;  5C4X H;  1GVP A;  4GKK Q;  4QGU A;  5IP7 G;  1OXX K;  2A8V A;  1WJJ A;  5BR8 Q;  1IBL Q;  3MEF A;  3TRE A;  1QZH A;  3B6Y A;  1N36 Q;  2WB1 G;  3HOY G;  4B3S Q;  2IX0 A;  2XGT A;  1FL0 A;  4IPC A;  2JA5 H;  4A3B G;  3S14 H;  1M90 C;  3Q8D A;  4YCV A;  5FJ8 G;  4BBS G;  1S40 A;  4NXM L;  1SLJ A;  1SR3 A;  3KJO A;  2CQO A;  3M4Q A;  3NEN A;  4YCU A;  4A3K G;  3GTJ H;  4LUO A;  1NBW A;  2LXJ A;  4GS3 A;  4A76 A;  3CCL A;  1PVO A;  1LUZ A;  4DV3 Q;  2JEB I;  4H02 A;  4A3E G;  3S1R H;  2E2I H;  1AH9 A;  2HHH Q;  2Z0S A;  1IL2 A;  3VDY A;  3HOV H;  4HJ7 A;  2OCE A;  4YHH Q;  1X3F A;  3I7F A;  3KDF A;  5C3E H;  1CKO A;  4DAM A;  2UUA L;  2CKZ B;  3RLO A;  1VQ9 A;  4YWM A;  1HR0 W;  2VQF L;  1KD1 C;  4X65 Q;  3HOX H;  4DR7 Q;  1PFS A;  1KXL A;  4Y52 H;  3UDG A;  3U4V A;  1VQK A;  4GOP A;  4LFB Q;  1HNW Q;  2ZTE A;  3AQQ A;  3LGJ A;  3K80 C;  4BA2 I;  1QZG A;  1C7Y A;  1L0W A;  2Q2H A;  3CME A;  5JEA G;  2ZJQ A;  4JI0 Q;  2MFI A;  3H0G G;  5M3F G;  2IT1 A;  4JI1 L;  3U58 A;  2E2J H;  3S15 H;  1T9H A;  2KEN A;  3CQZ H;  2F3I A;  3CC2 A;  3PO3 H;  4GKJ Q;  1PV4 A;  4JI2 Q;  1FGU A;  1SMX A;  3J81 i;  3TS2 A;  2K5N A;  4HJ5 A;  2PI2 E;  4POF A;  4OON A;  1NE3 A;  4LFC L;  4DR3 Q;  4P74 A;  2RCN A;  1K8G A;  1IBM L;  5GAD C;  2V1C C;  2E5L L;  3T1H Q;  1G6P A;  4JI6 L;  1TWH H;  3KFU A;  1SRU A;  1Z47 A;  1K83 H;  4IO9 A;  4LF5 L;  3GD7 A;  1PH8 A;  1U5K A;  2I5H A;  3GDE A;  4DNI A;  3J7A 5;  2Z6K C;  4X64 Q;  1VCI A;  4JOI C;  3PO2 G;  1TXY A;  2RF4 A;  1Q46 A;  3UE0 A;  5BR8 L;  5IYB H;  2ID0 A;  1QVC A;  3J7Z C;  2B3G A;  2EQS A;  1VQO A;  1JJC B;  4XIG S;  3RLF A;  1MJE A;  2ZM6 Q;  4DR5 L;  1HNX Q;  4BBS H;  2VY3 A;  2VZA A;  2BA0 A;  5GAH C;  2JA7 H;  4L5R C;  4B3M Q;  5FLM H;  2EXD A;  1XNR Q;  1JT8 A;  4JI7 Q;  4LFB L;  1NY4 A;  2UXD Q;  2JA8 H;  1Y1W H;  1HJP A;  4LF8 Q;  1VQP A;  3DM3 A;  1B7Y B;  3J80 i;  4GNX C;  4LF4 Q;  3CCR A;  4OWT B;  3PO2 H;  1H95 A;  4DV5 L;  1TWF H;  3FKI H;  1CSP A;  4DR2 Q;  1S72 A;  3ULL A;  3TS0 A;  2PQA A;  2YYZ A;  4A93 G;  4LF9 Q;  1SE8 A;  4ME3 A;  3H3V H;  4A3J H;  1X6O A;  2PMZ E;  1PH9 A;  5M5X H;  4MZ9 A;  3M4P A;  3IRB A;  4UP8 A;  4YY3 L;  2AKW B;  3ERS X;  4KI0 A;  3PUY A;  2N78 A;  2UXB Q;  1OXS C;  2YTX A;  2F4V L;  3HOW H;  4MNO A;  4LF6 L;  1V9P A;  1FJG Q;  1V1Q A;  3A5U A;  1A8V A;  4C3H H;  4DUY Q;  4HJ9 A;  3HOZ G;  3EBE A;  2AMC B;  1VQB A;  4X62 Q;  3GO5 A;  3K81 C;  5C0X J;  3I56 A;  1J5E Q;  3I4N H;  1MIU A;  5E7N A;  3CPW A;  4AIM A;  4R4C A;  3S2D H;  3PUV A;  3PF4 A;  1EYG A;  3STB D;  3RZD H;  4DKA C;  1OXU A;  3I4O A;  1XMQ Q;  3CMA A;  1I6H H; 
#chains in the Genus database with same CATH topology
 2EOT A;  4C3I G;  1CS0 A;  4KY5 A;  4ALP A;  5EWE A;  4CDE C;  2AQ4 A;  4DR1 L;  4F88 A;  3S16 B;  3H91 A;  1C0A A;  1QNK A;  4YY3 H;  1STA A;  4LFC H;  4XQQ A;  2KCT A;  4JV5 L;  5NUC A;  3VYR A;  4A3E B;  5LL6 S;  1NJI C;  1X55 A;  2R92 A;  3PSI A;  2WKD A;  3F8T A;  3GTP H;  5COR A;  4DAY A;  4ECS A;  5IP9 H;  3V96 A;  2YU9 A;  5D65 A;  2O4X A;  4XDX A;  1A3U A;  4N8F A;  5C4X G;  1K8M A;  1PYS B;  2YU9 H;  5LMN W;  1XWE A;  2UXC Q;  2FP4 B;  3K59 A;  1PZI D;  3H4D A;  3M9B A;  4FF2 A;  1TWG B;  1GXD C;  1VQ4 A;  3S1R B;  3NWT A;  2DNE A;  5GQO A;  4DV6 Q;  2UUA H;  4FBT A;  1GD7 A;  4DV4 H;  3V05 A;  2ES2 A;  2EJM A;  4DV3 L;  5KIX A;  2NZH A;  3R8B A;  1AE3 A;  4OWW B;  2NYZ D;  1LTS D;  1XNQ Q;  1UNN C;  1MSG A;  1SYG A;  2AWO A;  4BY1 H;  1KJ9 A;  4JCV E;  2R7F A;  2HD3 A;  3OYY A;  3HOX G;  4JI8 L;  1C4Q A;  2ZM6 L;  2F4V Q;  4X3T A;  1I4R A;  1KBL A;  5JEA J;  3NTI A;  1X3E A;  4KLK A;  4JI3 Q;  2JEJ A;  3R23 A;  1NSN S;  3QB3 A;  4GN4 B;  5KG3 A;  1M0T A;  1E4F T;  2JA7 A;  3AEV A;  3MWE A;  3EYY A;  3MXP A;  1JOR A;  2PI2 A;  3FHW A;  4K8I A;  3VYU A;  3N42 B;  1WYD A;  3HOU B;  4B08 A;  3MR5 A;  3T1Y L;  3FPU B;  3OSP A;  4PDB A;  1I6U A;  2UXD L;  1F2Y A;  3LP8 A;  3C2P A;  4IRK A;  2XNA C;  1YVC A;  4LF9 H;  4ED8 A;  5HUR A;  2JK8 A;  1JDB B;  1E7Z A;  2A68 D;  4UP7 A;  1M0W A;  4J15 A;  3Q8Q B;  1U0L A;  4DK6 C;  1B4O A;  2UXB H;  4ECW A;  3CCV A;  4YWL A;  4WJ3 M;  5GON F;  3OWE B;  2UXD H;  1ZXT A;  2WTF A;  2JA7 B;  1G2T A;  3A0J A;  3ETH A;  1FNU A;  1Y8N B;  4I7H A;  2NVY B;  3M4I A;  2K5V A;  4YR2 A;  1JE4 A;  1PFN A;  2Y0S G;  2GA4 B;  1Y14 B;  2XSC A;  1KIX A;  1IYU A;  4ZRZ A;  5C1O A;  1SYF A;  1AUX A;  4MTE A;  3BA9 A;  5IE8 A;  4Q44 A;  4ECZ A;  1SE4 A;  5CR3 A;  4JV5 Q;  1Y1W G;  4GN3 B;  2K1B A;  3FKI B;  3KHL A;  2HHH L;  4ABN A;  3PW7 A;  1DZ1 A;  3HKZ G;  1RK6 A;  2DLN A;  1P16 A;  2F4I A;  4PMC A;  4BBR H;  3PW2 A;  4F4Y A;  4A3E H;  3NEL A;  5KFP A;  1BXT A;  5D1O B;  1VAJ A;  1K83 A;  4LFA L;  4G4K A;  5HGT A;  1HZC A;  4M8A A;  2GPS A;  3S1M H;  2WFW A;  2XN9 C;  2XTI A;  4XQJ A;  3CCU A;  4G3I A;  4QWC A;  3RJ0 A;  3WO0 A;  4MA5 A;  1CA6 A;  2K32 A;  4IUP A;  5H1S E;  1XTC D;  4DV4 L;  2L11 A;  1IL8 A;  5CV8 A;  1VQD A;  1NAP A;  1VQ8 A;  1TWC H;  3M9M B;  1XJV A;  2IHE A;  4R4O A;  2ZTC A;  3L4J A;  4EBC A;  4Q8F A;  4K2K A;  2UUB L;  1I4G A;  2AUK A;  5CA1 F;  1YIT A;  2B63 A;  1VQI A;  1UAP A;  3I72 A;  3PUX A;  2EVB A;  4IJL A;  3M9N B;  1Y1V G;  2HGS A;  4RAY A;  1DV1 A;  4HMI A;  2H5X A;  2OTJ A;  4EYI B;  3BAB A;  5EAY A;  3OWF A;  3GID A;  1EIF A;  5EGT A;  1HFN A;  4LSA A;  1VQN A;  1E2V A;  2SEB D;  1VMC A;  3CHB D;  1EFW A;  1E2Z A;  2Q2U A;  1VDZ A;  5GAG C;  5EDW A;  4A3C G;  5KFT A;  2JJQ A;  1HNZ H;  4BA1 I;  4J1M A;  1W2B A;  2NN6 I;  1K1Q A;  2RVL A;  4A3J G;  5I4D A;  2AQ1 B;  4FU0 A;  1UE6 A;  3S1N B;  4KY6 A;  1CHQ D;  4A3K H;  1IOW A;  2J0T D;  1H9J A;  4C3I H;  2CCZ A;  2SNM A;  1E4G T;  1S4Z A;  4DV7 H;  4K5W A;  1CT1 D;  3O13 A;  2H1E A;  2N55 A;  4JI6 Q;  5KFK A;  2KJX A;  5DLF A;  1G2S A;  4UY8 C;  4JW0 A;  1V4Y A;  5D3I B;  4QWA A;  1D5M C;  2EYO A;  4QF4 A;  4YP3 A;  2K03 A;  4N9T A;  4JI5 L;  2B39 A;  3MFG A;  4EQ5 A;  3ITP A;  4DV1 Q;  4BY1 B;  2HQL A;  1EZ8 A;  3RZO H;  3BJY A;  2D0O A;  1SN8 A;  2C22 A;  1RTN A;  3G6E A;  3Q6S A;  1FKA H;  2RQX A;  3J80 W;  3J80 L;  4JBM A;  3Q8R B;  1AEX A;  3E5S A;  3QWN A;  4ZUI A;  3P1H A;  2XIG A;  3E5N A;  3MJF A;  2ALY B;  2F0I A;  3J81 L;  1S5B D;  3KHH A;  2XCP A;  4YQW A;  2QDL A;  3L4K A;  4YAJ B;  4XXE A;  4KHP L;  2YL2 A;  4DL7 A;  1WSC A;  4MTN A;  4KJN A;  2EY2 A;  5L1J A;  1VQ5 A;  4J9R A;  1EIY B;  3GTQ A;  1ICW A;  4J9Q A;  5HGQ A;  4JBK A;  1A63 A;  2C2E A;  4EEY A;  2LXK A;  4IPD A;  1PH4 A;  3DUZ A;  1TKW B;  1TAE A;  5AFW A;  2YS7 A;  4O42 A;  4F4Z A;  1BOS A;  5JVD F;  1TWA B;  2ICI A;  1STE A;  1TY0 A;  5JJI A;  2MO1 A;  4U67 3;  2QF7 A;  2ICE C;  2JP1 A;  2B63 B;  2R86 A;  5LMU Q;  4DL3 A;  3NP8 A;  1E3P A;  4YCW A;  2HQE A;  3OPO A;  1DGS A;  4HTH A;  3KBX A;  5FO8 B;  3FDT A;  3MFI A;  3CRL C;  3F1Z A;  1CTM A;  2MHV A;  2L1B A;  4C3I B;  4DR2 L;  5KFR A;  3GTO A;  5M5Y B;  4YHH L;  1QJO A;  2D62 A;  2NN6 H;  4LF8 L;  3T5K A;  2F3V A;  2K01 A;  4RNO A;  4DL6 A;  3EQL C;  1PYW D;  3BG3 A;  3C1F A;  3CP0 A;  1SNM A;  1N33 Q;  5IYD H;  4O4I F;  1EL0 A;  2PQA B;  4A3D H;  3NGD A;  1HCZ A;  3JAM L;  2W7O A;  3NQT A;  4RB3 C;  4CDC C;  1C30 A;  1KNE A;  4OL7 A;  5EJW A;  5DM6 3;  3HOW B;  3NBH B;  2CH4 W;  1JWU D;  1TS5 A;  2F0K A;  3DEP A;  5KFD A;  1SMY D;  4TQR A;  2Y0S B;  3RB3 A;  1ICF B;  2YU9 B;  1A15 A;  1B33 N;  2A6H C;  5KG4 A;  1N32 H;  4XT3 B;  2CVR A;  1VQC A;  2B2T C;  2SNS A;  3BQ0 A;  2E5L H;  4O1N A;  1IHZ A;  1I50 H;  1Y1V A;  5AJ3 L;  4XYO A;  4UAI A;  1HA6 A;  4G7H C;  5FD6 A;  1AZQ A;  3TP7 A;  3F2C A;  4TV9 F;  1JWS D;  5G3L F;  3SE7 A;  4ED6 A;  4L63 B;  4C3J B;  2W6M A;  4FDB A;  3KHR A;  2QA4 A;  1LO5 D;  3TME A;  1RJQ A;  3A56 A;  3KUP A;  4BBS B;  3E6Z X;  5C44 B;  5J2T F;  4TQS A;  1PYB A;  3GTM B;  3DM1 A;  2JA6 H;  4CGY B;  1VBG A;  4X64 H;  4LNQ A;  1ONL A;  5KX5 F;  3NWS A;  3HBL A;  5DG7 A;  1BO0 A;  3AMU A;  1BBW A;  3SR1 A;  1EUC B;  3MXU A;  1AW7 A;  2B2T A;  1E24 A;  2XRS D;  3EVQ A;  4EGV A;  1UUP A;  2HDM A;  1KEE A;  1GUO A;  4XTC S;  4DPG A;  4C3J G;  5M5W H;  2RGR A;  1RKN A;  2ASJ A;  1CSQ A;  3OTO H;  4MN3 A;  3BVG A;  3OTO Q;  2TSS A;  2RHQ B;  5C8Y F;  3T1H H;  1BVS A;  4RUA A;  4M1U B;  2WB1 E;  4ED7 A;  4UFZ A;  1IBK L;  2NWG A;  4ED0 A;  3RBE A;  3SGI A;  5LXT F;  4C3H G;  1X9N A;  5DQI A;  5C4X H;  4GKK Q;  1OXX K;  2R8I A;  1WJJ A;  2NTS A;  5J39 A;  2M9V A;  1QWY A;  2WB1 G;  1EZ1 A;  5C4X B;  3WOF A;  3N41 B;  5D1P A;  5EOY A;  2R8K A;  2JA5 H;  1O7L A;  5KFS A;  4EBE A;  2WIN B;  2WII B;  2WYO A;  4KMU C;  3OUZ A;  1GYF A;  1I4P A;  2XVS A;  3M4Q A;  4IN3 A;  3NEN A;  5C4Z A;  4A3K G;  2C2R A;  1NBW A;  3CCL A;  3GTO B;  1D1I A;  3R2T A;  2NZ1 D;  4A3E G;  2E2I H;  4M7E A;  2BDO A;  1IL2 A;  2VOB A;  3TIG A;  3HOV H;  2B2V A;  2OCE A;  4IR1 A;  1ZEQ X;  5E4X A;  1CKO A;  3N43 B;  4I7Z C;  1R4P B;  4YWM A;  1HR0 W;  4UCO A;  3HOX H;  1KXL A;  1VQK A;  3U4V A;  1NR4 A;  5EPL A;  2UUC H;  2KVM A;  4LFB Q;  1HNW Q;  2ZTE A;  2HCI A;  3AQQ A;  2ZXR A;  3K80 C;  4FO2 A;  1KDB A;  4K5X A;  3SDZ A;  4FXG C;  1C7Y A;  4C5A A;  2UXC H;  4PNY A;  4IUU A;  2MFI A;  3H0G G;  5M3F G;  3U58 A;  5JQW A;  4DV6 H;  4A3M B;  1PV4 A;  4JI2 Q;  1SMX A;  1DOM A;  2K5N A;  4POF A;  3BZD B;  5K2M A;  5G3L D;  2ZM6 H;  1TWH A;  3GTK B;  1SNO A;  1JIC A;  1IKM A;  2MUY A;  2FHT A;  4JI6 L;  2JA5 A;  3BDO A;  4H44 C;  4LF5 L;  5IT9 L;  3T5L A;  2Q8R E;  2CW0 C;  2Z6K C;  1LTI D;  4LSX A;  4GC6 A;  3PO2 G;  4F87 A;  5LL6 b;  2RF4 A;  4RNM A;  1F77 A;  1Q82 C;  3J7Z C;  5KFE A;  3RLF A;  2EY1 A;  4DR5 L;  2L12 A;  1O7Z A;  4J9M A;  2XD4 A;  2VY3 A;  2BA0 A;  2OEO A;  1B2T A;  1WCM A;  2A69 C;  1BUV T;  5IGE A;  4ID6 A;  3QOJ A;  2J4X A;  5FLM H;  4JI7 Q;  4LFB L;  2AQ2 B;  5CV9 A;  5I6Y A;  2F0W A;  1Y1W H;  4F50 A;  4ED1 A;  2EYM A;  4GNX C;  1WTX A;  3CCR A;  4OWT B;  4HNV A;  4XX0 B;  4QB4 A;  1S72 A;  3HKZ A;  1LT4 D;  1PRT F;  2PQA A;  4Y8V B;  4LF9 Q;  1SE8 A;  5I2Y A;  2K5W A;  1N34 H;  4C5C A;  4UP8 A;  5KFU A;  4B3M H;  2YTX A;  4ZOL F;  4MNO A;  3M3Y B;  3SEB A;  1SYB A;  1EY0 A;  2FPP B;  4C3H H;  1TS3 A;  3M4Y A;  1EQT A;  3QG1 A;  2AGQ A;  4IR9 A;  4LFB H;  3K5H A;  4XT1 B;  2FLN A;  1IW7 D;  5KFX A;  5L37 A;  4X62 Q;  3K81 C;  2DWC A;  2OF1 A;  3JZI A;  5E7N A;  3S2D H;  2JXM B;  4AIM A;  5DGB A;  3PF4 A;  5IGB A;  5KNB A;  4DKA C;  1N56 A;  1OXU A;  3L9A X;  3I4O A;  2G9H D;  1JOO A;  3HRZ C;  5FPR A;  5F9N A;  3Q23 A;  1I6H H;  1ASY A;  4QW9 A;  1SNP A;  2NVT H;  1DCZ A;  4J6H A;  4JI4 L;  2Q2T A;  2L0C A;  5EQ0 A;  2F0H A;  4A3I G;  4NXN Q;  2CH4 A;  2ZT9 C;  2FFK B;  3I4N G;  2MNA A;  2EYJ A;  3OW2 A;  1X3G A;  4A3C H;  2WB1 A;  2R7D A;  1Y1V B;  2FMC A;  4GKK H;  3ERO A;  3RAQ A;  4CC5 A;  1LT3 D;  4JI2 L;  1U4P A;  3KF8 B;  2QKI C;  4H0L C;  4BWS C;  1S10 A;  2J6S A;  2B63 H;  3RR5 A;  4JI1 H;  2RDH A;  2LFN A;  3GIQ A;  1FYC A;  3ICE A;  3W1B A;  1KLU D;  5C44 G;  4IFD G;  2SOB A;  5I2X A;  2Z9H A;  4HR7 B;  4NMZ A;  4DK3 C;  1JOQ A;  4JVZ A;  4DXF A;  5M3M H;  1MBY A;  1V51 A;  3HOY H;  3G48 A;  2PPB C;  3V4Z A;  3UDI A;  4X66 Q;  1U4M A;  1LTG D;  1I3Q A;  3GTG H;  2VQF H;  5IYD G;  3TP6 A;  1KRS A;  5KFC A;  1ILQ A;  1IW7 C;  3JC6 6;  5L1L A;  2DIK A;  3JSL A;  4DF7 A;  3N6R A;  4ULL A;  3H3V C;  4EGJ A;  1N34 Q;  2FIN B;  3CC4 A;  3ORR A;  4LF7 H;  4F4X A;  2V58 A;  2YZG A;  4HQ6 A;  3RMH A;  2HVR A;  4IHJ F;  1N36 H;  3NK9 A;  1YI2 A;  3S2H B;  2L55 A;  1V1O A;  4IUT A;  2XGQ A;  1E2W A;  3Q8P B;  5IT9 c;  1HNX L;  1FJG L;  1BCP F;  3VYS A;  3GTM H;  3TIN A;  4CC6 A;  4J0M A;  5KFM A;  1TA8 A;  4MV1 A;  1CQF A;  3HEJ A;  1L1O A;  2R87 A;  5FLM G;  2R82 A;  5FPO A;  4DA2 A;  1WCM H;  5CA0 F;  1PH2 A;  4FF4 A;  1WTV A;  1Q7Y C;  4HSV A;  5KFF A;  2B29 A;  1IBK Q;  4DV7 Q;  5IWA L;  1H9K A;  3V4S A;  2NVQ B;  4DV5 Q;  5FLX E;  3QZ7 A;  3PVX A;  3AU7 A;  1AN7 A;  5ELO A;  1VQJ A;  2VL6 A;  3OTO L;  1VQ7 A;  1ENA A;  1ZET A;  1G8Z D;  2Z6K A;  1A62 A;  4JBJ A;  3ZYY X;  4UCT A;  4P71 A;  4IQZ A;  4LW1 A;  1L1O C;  2R93 H;  1DON A;  1GSA A;  4X66 H;  5KT7 A;  3M4O H;  4NP5 A;  4DV1 L;  1ML0 D;  1NNX A;  4KKT A;  1WVL A;  4C3H B;  3D6W A;  4OEL B;  1XXG A;  1PTO F;  4X64 L;  5DLQ E;  5K36 H;  2DNC A;  1MSH A;  4A3M H;  3I4M H;  2K75 A;  1FGB D;  1R9T H;  1DIK A;  2RBM A;  5BPF A;  2UU9 L;  3A74 A;  2WDT A;  3L7Z C;  5JJL A;  4DK1 A;  1F9P A;  1DD2 A;  5L9X A;  2WV6 D;  1OXV A;  3MR3 A;  2LY7 A;  2OTL A;  4AH6 A;  1IYJ B;  3RB6 A;  2MQH A;  1Q8K A;  2FMM A;  2IY5 B;  2CWP A;  3HB9 A;  3HKZ E;  5FJ8 H;  2IX3 A;  4QY7 A;  5IYZ F;  1EYD A;  4OO1 I;  1D8L A;  1QCB D;  2VQE Q;  1DV2 A;  5KYI A;  4TQU S;  5C3E B;  5DQH A;  3K0Y A;  5IY0 A;  1BBU A;  3D3R A;  4JBW A;  2MP1 A;  2UU9 H;  4OO1 G;  2BQU A;  1EU3 A;  3GTJ A;  2IP4 A;  5F9L A;  1S5D D;  1V1P B;  3CCE A;  2E2I A;  4MV3 A;  1GGO A;  1E4E B;  2KHS A;  5FK9 C;  4ECT A;  3HXL A;  2RDI A;  4WJ4 A;  2K5Q A;  1YNN C;  4ZQI A;  4APV A;  3HOY B;  4IPG A;  4YB8 B;  1L2F A;  2UUA Q;  5I9P A;  1V43 A;  3I91 A;  3F2U A;  4FP5 D;  3RZD B;  2I8C A;  4IZ8 A;  1Q12 A;  2UUC Q;  1JDE A;  5JVL A;  2BR0 A;  1Q1B A;  2W7P A;  3PO3 G;  4A75 A;  4I4T F;  1S03 G;  1HA5 A;  1T36 A;  4LF8 H;  3S17 H;  4OEM B;  2NVY A;  3ETJ A;  4YHH H;  2R8J A;  1VQF A;  2KEE A;  2I0Q A;  3G4S A;  1T5X D;  2BOS A;  3DMU A;  4LUV A;  4PV1 C;  3T56 B;  1L1O B;  2V4R A;  4EQO A;  5FD5 A;  3TQY A;  2CQY A;  1K9M C;  1FJG H;  2IX1 A;  2VUM B;  2Z8L A;  1HR0 L;  2AUJ D;  4JI7 L;  3S1N H;  4IWX A;  1PXU A;  4G7O C;  3U50 C;  5CV6 A;  5LL6 X;  1N32 L;  4POG A;  3C3L A;  3UDF A;  2FPI B;  4F8M A;  1FNV A;  3I70 A;  2FPG B;  4RGO S;  4KY7 A;  2YV5 A;  3T13 A;  2ZJT A;  3R5F A;  2D9U A;  1BGW A;  2OT2 A;  1KJ8 A;  1EYC A;  1UE7 A;  4Q5V A;  4IJH A;  1UWV A;  4TSS A;  5KEE A;  1JX4 A;  5KFL A;  5IT9 E;  1NMG A;  1XMO Q;  2F03 A;  1B1Z A;  3X3N A;  4XYQ A;  5KFB A;  2FXQ A;  1DYQ A;  2KHI A;  3DLL A;  4GLX A;  4ECR A;  2CFM A;  4BY7 G;  3KF8 A;  2B63 G;  4JI2 H;  3RV4 A;  4R4I A;  2JEA I;  3FRP B;  1YJ9 A;  5C44 H;  1SMY C;  3BYY B;  3GTP A;  2N88 A;  3HZX A;  4JYA H;  3K0X A;  4S3S A;  4J9S A;  2KBN A;  1AN8 A;  2NU7 B;  1HTL D;  3IL8 A;  3M85 A;  4A3G H;  1C3O A;  4DV5 H;  1A0I A;  2IBK A;  3UI2 A;  1PRT D;  1WTP A;  1SJE D;  2NVX A;  4JI4 H;  1GM5 A;  4X65 L;  1GHK A;  2FK2 A;  3I4L A;  2K50 A;  3MEH A;  2PBZ A;  3PIP A;  3D4W A;  3VPD A;  1XMO L;  4WOR A;  4G57 A;  3AYH B;  4DFA A;  1EOV A;  5M5X B;  1DJR D;  2RSO A;  1ZQ7 A;  5IYC H;  5CB4 F;  2WAC A;  4HIM A;  3VR2 A;  1T3N A;  3A5Z B;  3FVQ A;  4TVA B;  3VMM A;  5FLX c;  1UC8 A;  1KHI A;  1Z6H A;  1EIH A;  1PMR A;  4LMY A;  2J6T A;  3C46 A;  1I6V C;  3ORQ A;  4P72 A;  4K0K L;  3CAM A;  4YY3 Q;  2V4Q A;  5ELN A;  5CBA E;  1HR0 Q;  3PO3 B;  1TWC A;  4RB2 C;  3MXN B;  5KYL A;  1D2B A;  4LUZ A;  1EY6 A;  1CZW A;  2D5D A;  1RIP A;  1JIH A;  2O03 A;  2JE6 I;  4DR4 Q;  3Q8S B;  5BN5 A;  5CC4 A;  4B3R L;  2GN5 A;  4ECU A;  1RJT A;  4JI5 H;  2F0P A;  1BNC A;  4A2A A;  1EWC A;  1G6Z A;  1E0B A;  1K83 B;  5D1O A;  1B50 A;  1VQG A;  1PA6 A;  3D6C A;  1GSO A;  4EVO A;  4C2M A;  3SK4 A;  1PDQ A;  2VB3 X;  2N8N A;  3J7Y W;  4DV0 Q;  3K5I A;  2W57 A;  2R93 G;  3OHX C;  3RB0 A;  1A2U A;  4DL2 A;  4O3N A;  1F9Q A;  3I4M G;  1Y8P B;  2GVB A;  5JVG 3;  4OX9 Q;  1PH3 A;  3J81 j;  1PFM A;  2PCF B;  2WAQ G;  4LF7 Q;  2R7Z A;  4LF5 H;  3RIZ A;  3MFH A;  2MCT A;  4LWC A;  2R7N A;  4B9W A;  4BBR B;  1G91 A;  2BA1 A;  4LFA H;  2UVR A;  4PZ8 A;  1S3O A;  2FJ2 A;  2C9O A;  1UC9 A;  1B9N A;  2DY8 A;  4FM9 A;  1I50 A;  3HFZ B;  2EDG A;  3K7U C;  3I55 A;  1P8L A;  3R5H A;  4RUC A;  4Q43 A;  2Q2I A;  2HT1 A;  3EN2 A;  2BE5 C;  4B9X A;  2M2L A;  3S16 H;  4MV6 A;  4MAM A;  5KG7 A;  4B3T Q;  4JI5 Q;  4CKE A;  4RG1 A;  3BU2 A;  2R8H A;  2AU0 A;  4FYD A;  1B9M A;  3GIP A;  3G6V A;  2DY7 A;  3RZO B;  5L1I A;  3OMG A;  2OQK A;  1I4X A;  3VYT A;  1X3P A;  2VUM G;  3ULJ A;  2A6E D;  3H20 A;  3J81 W;  5LA6 F;  2YTY A;  2OQ0 A;  4LF9 L;  4GOP B;  2F0L A;  4QQB X;  4KHV A;  3FKI G;  3G6J B;  5F2D A;  1E22 A;  5EBD A;  5C5L A;  3PIO 3;  1XMQ H;  3CCM A;  4NLG A;  2XCA A;  4FBU A;  5GRO A;  4ZK9 B;  4NXM H;  4NDX A;  5IYC G;  3T1Y Q;  2FKL A;  4IUV A;  1O7I A;  4CKC A;  5DLG A;  3GV8 B;  1WH2 A;  3J80 E;  3HOW G;  1JE5 A;  5I6W A;  3CKI B;  4CKB A;  1VF7 A;  2SDF A;  1ILP A;  1WTO A;  4Q45 A;  1HTP A;  4QGU A;  4DXG A;  4FS1 A;  3MEF A;  4HR7 A;  1ESF A;  3B6Y A;  1EWH A;  1N36 Q;  3HOY G;  3S2D B;  4B3S Q;  1LTT D;  3CU7 A;  4O3S A;  4QMG A;  1HNX H;  4IUQ A;  4JI8 H;  4A3B G;  1KAA A;  3Q8D A;  1M90 C;  2XRQ D;  5FJ8 G;  4NXM L;  3KJO A;  3AB9 A;  5E1F A;  4NXN H;  1V1P A;  2E2I B;  4YCU A;  1EY5 A;  1T5E A;  2LXJ A;  1LUZ A;  2NTT A;  4NKL A;  4DV3 Q;  2JEB I;  1KJJ A;  3V2T A;  2F0N A;  3OOC A;  2Z0S A;  2HHH Q;  5H80 A;  1TWF A;  3N44 B;  1RF2 D;  4YHH Q;  3IFD A;  1X3F A;  3S17 B;  1HUM A;  3RV3 A;  4JV0 A;  4ETS A;  2VQF L;  3BQ2 A;  2I07 B;  4G7Z C;  3RD4 A;  4DR7 Q;  2CW0 D;  1DOL A;  4ZUJ A;  3UDG A;  3LX0 A;  2A74 C;  4XYM B;  2JA6 B;  4BA2 I;  2QW7 A;  3NHH A;  2Q2H A;  5C6A A;  5JEA G;  2CHB D;  2HJW A;  3R93 A;  2W9B A;  2DPI A;  4JI1 L;  2E2J H;  2KEN A;  4RGN A;  4U6P A;  4RZR A;  4DLK A;  5C3X A;  3PO3 H;  4RGM A;  3TS2 A;  1S5E D;  1FGU A;  4GKJ Q;  4HJ5 A;  1BQQ T;  4OON A;  1NE3 A;  4LFC L;  3K5N A;  1D6E C;  3KAL A;  2V1C C;  2E5L L;  2EZV A;  2FJZ A;  5DQG A;  3LWE A;  3MZ5 A;  5FLX L;  3U9S A;  1EUD B;  3LWU A;  4JV2 A;  1STY A;  3VR4 A;  2I5H A;  2Z4H A;  3GDE A;  3QOL A;  4DNI A;  1W93 A;  1PTO D;  1STB A;  4JOI C;  3VR6 A;  4CJ0 B;  1BF4 A;  4CJ2 C;  2W6O A;  1VQO A;  2EQS A;  1MJE A;  4I50 F;  5KFH A;  2ZM6 Q;  1HNX Q;  2E2H B;  3PR5 B;  3C0F B;  5GAH C;  1K0S A;  2RDF A;  3MHB A;  4B3M Q;  2F0E A;  2R3Z A;  2O5I C;  1ZHQ A;  2UXD Q;  1SFO B;  5BN4 A;  1VQP A;  4Y7N B;  5K5P A;  3J80 i;  4Q0Y A;  3GII A;  2VXW A;  4LF4 Q;  4ODG A;  1H95 A;  1N33 H;  3FKI H;  5C4H A;  2PYK A;  2EJG C;  4U68 A;  3ULL A;  2CQA A;  2XC9 A;  3H3V H;  1CE8 A;  1PK8 A;  1X6O A;  1PH9 A;  4J9L A;  1TQO A;  2IL8 A;  5M5X H;  4YY3 L;  2AKW B;  4MV8 A;  4LH7 A;  4XQN A;  1BCP C;  1OXS C;  3BDL A;  3HOW H;  4I7A A;  1FJG Q;  1JLL B;  1V1Q A;  3QIA A;  1KNA A;  4RA8 A;  3T5J A;  4DUY Q;  2BQ3 A;  1ET9 A;  2BCO A;  3KLS X;  3EBE A;  4TKO B;  3MR2 A;  3GIM A;  1F2Z A;  4ECY A;  1VKZ A;  3QR8 A;  3CQZ A;  1Z2P X;  4ILW A;  2C00 A;  2E74 C;  1I50 B;  2F0U A;  2P5Z X;  5KFA A;  2EJF C;  2FE3 A;  2HUG A;  4FF3 A;  4UHV A;  3CMA A;  3KF6 A;  3CCS A;  2PW7 A;  4GNX A;  2B2V C;  3A8I E;  2HCC A;  3RTX A;  2B2Y A;  1M7J A;  3G8C A;  5KG0 A;  3SK5 A;  4K8J A;  2UUB Q;  1TWA H;  3MXG A;  4TUY F;  5KND A;  2GPW A;  3RNU A;  2UU9 Q;  2F0T A;  2W6N A;  1STN A;  1VS0 A;  1TII D;  3DF7 A;  3KAK A;  5EKK A;  1RL2 A;  3RN5 A;  5DM7 3;  4OXP A;  1W96 A;  5ELD A;  3HKZ B;  2A6H D;  3HP3 A;  2IHF A;  3ULP A;  2NU8 B;  2ENB A;  1IXR A;  2K52 A;  4BY1 G;  3F2B A;  1KDA A;  2VR1 A;  2B2Y C;  1GUT A;  5JVH 3;  4IZO A;  5IGC A;  1RDP D;  3NSW A;  1KLG D;  4DUZ Q;  4C2M B;  2PW5 A;  1X3Q A;  5IP9 G;  5KKN B;  1ASZ A;  3OSN A;  4ZYS A;  2PVP A;  1N32 Q;  2E2D C;  1IZ6 A;  4K0K Q;  1NMF A;  5IWA Q;  2ZJR A;  3E9I A;  1HR0 H;  1SRO A;  2C28 A;  3L3O C;  4P2C B;  4ZLT F;  1RJR A;  2KOL A;  1Y8O B;  5T14 A;  3K57 A;  1N9W A;  1GLV A;  2B2W A;  4XZ3 B;  1K3R A;  1SNQ A;  2NVQ H;  2R92 H;  3FDS A;  4DV2 L;  3KLS A;  3HOU G;  2W6Q A;  2A19 A;  4H13 C;  3J81 c;  3H09 A;  3T1H L;  1QB5 D;  1TWG H;  5KFI A;  1LYL A;  1MI2 A;  1XPO A;  2SCU B;  3H6M A;  4LFC Q;  5J22 A;  4DAP A;  4QL5 A;  1W6J A;  1XNR L;  1KDC A;  1UEA B;  1KAW A;  4B3R Q;  5DNF A;  4QIW A;  1G51 A;  1GKH A;  1II3 A;  4X66 L;  4O2B F;  2F0F A;  2RDG A;  1EQQ A;  4ZI7 F;  5EWF A;  1F9R A;  4KHZ A;  4WFN 3;  4A93 B;  3I4N B;  1MD2 D;  3D8G A;  1SYD A;  2DUD A;  2VUM H;  1SDF A;  4JI8 Q;  5KNC A;  1VQ6 A;  3RN2 A;  4IRC A;  1TT2 A;  2JSO A;  5IGD A;  2NVX H;  2NVT B;  1R4Q B;  1OTC A;  5IWA H;  5EBC A;  4DV2 H;  3H94 A;  2I80 A;  2A1A A;  2HHH H;  1WTH A;  2QIL A;  1RYR A;  2BH2 A;  1ZYR D;  2QK4 A;  3F2D A;  2F0O A;  4C56 C;  4EX5 A;  4DUZ H;  2R7Z H;  2EY5 A;  4RKL A;  5C4J H;  1EYA A;  3S2H H;  5J3B A;  3PR4 A;  2PNH A;  2F0V A;  3RF2 A;  3P75 A;  2VNU D;  3PIP 3;  3ONA B;  2WAQ E;  1BCP D;  1IYV A;  1N36 L;  1Y1V H;  4ED2 A;  2BDN A;  2YCH A;  4DV1 H;  1YEZ A;  3S1M B;  3L2P A;  4DL5 A;  3Q2O A;  3BA8 A;  1EUJ A;  4A3L G;  5DAU A;  2KED A;  4GN5 A;  1VQA A;  2W8K A;  1GUN A;  4GLA C;  4A3F G;  2M05 A;  5E4W C;  4R8U B;  3TZD A;  2V59 A;  1QUQ A;  4A3I H;  4H7B A;  3SHL A;  2KA7 A;  2QEX A;  3SK8 A;  4QWD A;  5DEH A;  5TSS A;  3N52 A;  2A68 C;  4X3S A;  4DNT B;  3TRZ A;  3JAM W;  1I7N A;  1LTL A;  2YZN A;  3OHA A;  1I4Q A;  3D4R A;  3EPI A;  1JMC A;  2PN1 A;  5C1P A;  4HED A;  4DR2 H;  1FD7 D;  1TY2 A;  4GKK L;  1WOC A;  4QJF A;  1A3V A;  4X6A H;  4DR3 H;  4L8J A;  2EYL A;  3BG5 A;  1XYI A;  3GV3 A;  5JH7 F;  2K14 A;  3C1E A;  4RCO A;  5HV6 A;  5M3M G;  4GC7 A;  3ZJY C;  1TU2 B;  3GTL H;  4EFE A;  4JC0 A;  1BNZ A;  2W9B B;  5LMU L;  5LYJ F;  2A6E C;  4WBN F;  1XTD A;  3HOU H;  3BZK A;  4O2A F;  3JRW A;  1SNC A;  1M6V A;  3LML A;  2YRX A;  4RCN A;  1CUK A;  2CZG A;  1EY4 A;  1S9F A;  3H0G B;  5M3F B;  5AJ3 Q;  3CXC A;  3KK7 A;  4K14 A;  1YBY A;  3GTJ B;  4AYB B;  4DK0 A;  1HZA A;  3EJI A;  1GSH A;  5L1K A;  4LF5 Q;  5D8D A;  1SE3 A;  1YNX A;  3VA5 A;  3E9H A;  4HJ8 A;  1KC7 A;  1U9R A;  1E4E A;  1SYC A;  4DAY B;  2F0G A;  2YS6 A;  3MR6 A;  1QUQ B;  1TVX A;  2N3S A;  1I3Q B;  4RMF A;  1KQS A;  1WTQ A;  2C35 B;  4B3M L;  2R93 B;  1YHQ A;  1YHA A;  1MGS A;  3NTH A;  1M1K C;  1ZYR C;  1WCM G;  5JJK A;  4EQP A;  2XGP A;  3TEH B;  2V9W A;  1SFO A;  1EZ6 A;  1EIG A;  2G9D A;  1JB7 A;  1N33 L;  3CCQ A;  4YIJ A;  1E1O A;  1KTK A;  1RHP A;  1Z2O X;  1XNQ H;  1V8Q A;  1CKN B;  2B2W C;  1YIJ A;  1SJH D;  2EPB A;  2RHS B;  4HCE A;  4JK1 C;  3A54 A;  3GTQ H;  3KLW A;  5HBR B;  3CC7 A;  4UCU A;  3A7L A;  4DV7 L;  2R7Z G;  4AYB E;  1CI3 M;  4HAE A;  1HPC A;  2NZO A;  3EFX D;  4QIW E;  5T1G A;  2KCM A;  3QJY A;  4IFD H;  2W71 A;  2AWN A;  4DR6 H;  4DGZ A;  1JQY D;  2VS1 A;  1JOK A;  3GV6 A;  1CK1 A;  2FLP A;  1SEI A;  3UQ8 A;  4RFB A;  4O2D A;  1A3T A;  1EY8 A;  2KEC A;  1BKB A;  3K5L A;  1XNQ L;  2J6U A;  4ECV A;  3VPC A;  1QG7 A;  2E75 C;  4JI6 H;  2F1M A;  3CQZ B;  3DWA A;  5IGG A;  4YWK A;  1N34 L;  2EIF A;  4UPA A;  3K7A B;  3E0E A;  4DV6 L;  2Z1C A;  3W3A A;  4FNF A;  4OO1 H;  1EY9 A;  4IAJ A;  2EE1 A;  1JJG A;  2R85 A;  4JOI A;  4UP9 A;  2PO4 A;  4C5B A;  5CV7 A;  4HMJ A;  5C5M A;  1RTO A;  5A2Q L;  2KUM A;  3PZP A;  2JYO A;  4DV2 Q;  2WAQ A;  2O5J C;  2FB9 A;  2E8G A;  1XPU A;  4BY7 B;  3PW5 A;  1EFI D;  2IMW P;  3CW2 C;  2JN4 A;  4KTA A;  1Q81 C;  4ED3 A;  1U4L A;  4JV1 A;  4J9P A;  4A3G G;  1DXM A;  3NEM A;  2AGP A;  1J5E H;  2E2J B;  2F0M A;  3WWV A;  1BJT A;  4ECX A;  5KFV A;  1AP0 A;  1J9O A;  1WI5 A;  1PH5 A;  2JA5 B;  5J2U F;  4Z9C B;  2E5L Q;  4NXN L;  4A3I B;  3PW0 A;  3I12 A;  1TWH B;  3S1Q H;  4DR3 L;  1JXL A;  3BQ1 A;  1LV9 A;  3T16 A;  4DR6 Q;  2ATL A;  3PUZ A;  4OIJ A;  3GTK H;  3PF5 A;  2BH8 A;  2OWO A;  3I8Z A;  3HOV B;  4O4H F;  3H0G A;  1Q1E A;  4IWY A;  4J9N A;  1IBK H;  2UXC L;  4OHJ A;  4PMW A;  4IPH A;  3GQC A;  1IKL A;  4A3D B;  3NQI A;  3MFY A;  3M4O B;  5I47 A;  4DV0 H;  2WB1 B;  1LTA D;  4MV4 A;  3A8J E;  3M7N A;  2R7L A;  1OWT A;  3RLN A;  4CBV A;  3GIK A;  1RCV D;  2RGV A;  2UXB L;  3HOZ H;  2QEJ C;  1H9S B;  2LSS A;  2PZW A;  5FO9 B;  2YW2 A;  1UE1 A;  2ZTD A;  1HQM C;  1QIL A;  3R5X A;  3KJP A;  1K1S A;  2ZDQ A;  2KHJ A;  4DN4 M;  4AQY H;  2N49 A;  3OIQ A;  1O75 A;  2KCC A;  4MIU A;  4O0A A;  3GTQ B;  4K6L A;  2K4K A;  1JJ2 A;  2EYF A;  4EGQ A;  3GTG B;  1EU4 A;  2LKV A;  1SCU B;  2FLL A;  3KYH C;  3GTL A;  4BY7 H;  3J81 E;  2O2L D;  3M3Y H;  4ECQ A;  1G29 1;  2AHO B;  4YJ2 F;  4CJ1 B;  1JKJ B;  2K05 A;  2VW9 A;  3K58 A;  4UCR A;  5KFQ A;  3X3M A;  4ZHQ F;  2QDB A;  4GZY C;  1EHI A;  3H4B A;  5EPJ A;  5LMN H;  3N40 P;  2K7V A;  3TRE A;  1QZH A;  1C48 A;  1M4V A;  2IX0 A;  2XGT A;  4QUF A;  1FL0 A;  1XX8 A;  3S14 H;  4BBS G;  1S40 A;  3ERQ A;  1SLJ A;  3QZ8 A;  2CQO A;  4ZKC B;  2F3W A;  1SEB D;  4LUO A;  1Y1W A;  5E3F A;  4MV7 A;  2MGS A;  2ZDH A;  4AYB A;  3I7F A;  2UUA L;  5C4J B;  2B2U C;  4DAM A;  4KV6 A;  1VQ9 A;  5I9O A;  5CMD A;  1XNR H;  2XCL A;  4QWE A;  2C2D A;  1GUS A;  5KG2 A;  1L2Z A;  2V5A A;  2NB0 A;  4GOP A;  3MVV A;  3LGJ A;  2JA6 A;  2K6A A;  4OIK A;  5JOB A;  5BMV F;  4RNN A;  4RH6 A;  5IOC A;  1HQR D;  3CME A;  4X62 H;  4F4W A;  1TWC B;  3A55 A;  2ZJQ A;  3PQI A;  2CW7 A;  2IT1 A;  1LAC A;  1WR2 A;  3CC2 A;  3J81 i;  2X6G A;  4JV5 H;  1L0Y B;  1U4R A;  3EA6 A;  2RCN A;  1K8G A;  1IBM L;  1CQI B;  5GAD C;  4A3J B;  4KK7 A;  3T1H Q;  1G6P A;  4K0K H;  4QCL A;  1K8O A;  1Z47 A;  5A2Q E;  4IO9 A;  2PQE A;  4F7X A;  3GD7 A;  2XWJ B;  3TDQ A;  1U5K A;  4DAV A;  2FMA A;  2GLT A;  2NBF A;  4LH6 A;  2LS0 1;  1WTR A;  1VCI A;  1B04 A;  1EQV A;  1VBH A;  2YZM A;  5BR8 L;  1IBL L;  5IYB H;  2ID0 A;  4L5S A;  2B3G A;  1JJC B;  2VZA A;  2K04 A;  2JA7 H;  1XMO H;  1B3Q A;  3IKJ A;  4L5R C;  4MV9 A;  2PMZ B;  4FVM A;  5FO7 B;  5KFJ A;  2EXD A;  5C0X H;  1EOT A;  1XNR Q;  2IWH A;  1JCK B;  1JT8 A;  1NY4 A;  1AFP A;  2J9G A;  3K3V A;  2R8G A;  2E2H A;  3CVZ A;  1TWG A;  3A8K E;  2TMP A;  3PO2 H;  4DUY H;  4DR4 H;  4DV5 L;  1O7Y A;  4IUR A;  1TWF H;  3P20 A;  5EKI A;  1CSP A;  4DR2 Q;  1S0O A;  5CBE E;  2WAQ B;  2YYZ A;  1YNN D;  5COY A;  4ME3 A;  2ASL A;  4A3J H;  1LAB A;  4YBZ B;  1F2M A;  4RAU C;  3GIJ A;  3IRB A;  1GUW A;  4KKS A;  4KI0 A;  3PUY A;  1VF5 C;  4KD3 A;  2UXB Q;  1PLF A;  3FMA A;  3HG9 A;  5JEA H;  1KAB A;  1V9P A;  4LF6 L;  3PN1 A;  2HDL A;  3A5U A;  1PX2 A;  4WRD A;  2VUM A;  2KSW A;  3MAQ A;  3S14 B;  3S15 B;  1EEF D;  3QO2 A;  3GO5 A;  5C0X J;  3I56 A;  3I4N H;  2R6F A;  1MIU A;  5M3M B;  3CPW A;  3PUV A;  3QFF A;  1EYG A;  1Q8I A;  4JUZ A;  3STB D;  5BR8 H;  1IBL H;  2G5D A;  4O3O A;  4DNR B;  4J8Q A;  1KJQ A;  3DEO A;  1A9X A;  1BR9 A;  3MXN A;  5CAE B;  3RBD A;  1EYZ A;  5M9O A;  1TS4 A;  4WJW A;  4JI7 H;  1GJX A;  2R7M A;  1HNZ L;  2ATW A;  5KGU A;  2IPK D;  1IBM H;  5D3D A;  4APM A;  1KRT A;  4JI0 H;  3PIO A;  1X32 A;  1FVI A;  4QW8 A;  1BXR A;  1PH7 A;  1H9S A;  5EZY F;  3GV5 B;  1MZB A;  4A3B H;  3NXW A;  2L4N A;  1HXY D;  3PGZ A;  4DUY L;  4RHS A;  4IFD J;  3G71 A;  4DV4 Q;  3PMF A;  3VA7 A;  4I55 F;  5DG8 A;  4A3B B;  4LF6 Q;  3T53 B;  3GTP B;  3LWB A;  4PG3 A;  5IP7 H;  3S9W A;  5EWG A;  1JC7 A;  1IOV A;  1CFM A;  2ZXO A;  4HN7 A;  4ZKB B;  4K2L A;  1EY7 A;  1PTO B;  1HH2 P;  3BZC A;  3UE1 A;  2NVX B;  4L1K A;  2UUB H;  2ASB A;  2ZDG A;  3I73 A;  1YZ6 A;  3J7A K;  1PTO H;  4IOC A;  4JPB W;  1SND A;  2MPM A;  1N8R C;  1PHJ A;  2Z6B A;  1GUG A;  3M9O B;  1S68 A;  2L9H A;  1XPR A;  4M9U A;  2K33 A;  1VQH A;  4JYA Q;  1QVF A;  5KFN A;  4RWS C;  2VA2 A;  2I46 A;  1CQV A;  2YYA A;  5IYB G;  1TS2 A;  3TBI B;  1S5F D;  4Y52 H;  4IOA A;  2L15 A;  4EQN A;  4GOP C;  4LF4 H;  4DR5 Q;  3GTL B;  2NN6 G;  3H40 A;  1AZP A;  1VQL A;  5LMN L;  5KT4 A;  5KFO A;  1WFQ A;  3U9O A;  2NUA B;  5JUM A;  2JEG A;  2W9A A;  3UDX A;  3ND9 A;  4O3P A;  3PUW A;  4UCS A;  1DOK A;  2I5L X;  4O3Q A;  4RKB A;  1M8A A;  4MA0 A;  3JAM c;  2EXZ A;  1B8A A;  4KHP Q;  1SE2 A;  4A3M G;  3S24 A;  3LNN A;  2VPS A;  1MJC A;  3J7A V;  5KG5 A;  4HNU A;  4AQY L;  5C0X I;  1HHV A;  3HGB A;  1I94 L;  4JI1 Q;  2RA4 A;  1I3Q H;  1J8I A;  4RZQ A;  3T5H A;  2ZJP A;  2X6L A;  3AFQ A;  4RB0 A;  3JAM i;  3V6J A;  3A7A B;  2I5M X;  1KC8 C;  2W6Z A;  4EYH B;  3JSN A;  1NCV A;  4IRD A;  1GHJ A;  4DR7 H;  3T1Y H;  2C5C A;  4PWQ A;  5T1I A;  3I4M B;  3Q1K A;  2VQF Q;  1B6R A;  2PZT A;  4RB1 A;  4X3U A;  4PZ6 A;  1CKM A;  4PQX A;  3I90 A;  4O4L F;  3SVM A;  5ISR A;  3BJU A;  3TP8 A;  1KJI A;  4A3K B;  2R7Z B;  3J7A F;  3VPB A;  4YR3 A;  5HY6 A;  5JPM C;  2DJF C;  3F8N A;  4RU9 A;  4GKJ H;  5IIF A;  1ESR A;  5K36 G;  3N6X A;  4NB3 A;  4KD4 A;  1PTO C;  2Y0S A;  1BCP B;  4K5V A;  4NXM Q;  4JG2 A;  5KG1 A;  3KAJ A;  3WOE A;  3ER0 A;  2DZD A;  1C9O A;  4FXD A;  1HUN A;  1XMQ L;  2W9C A;  3R2I A;  3WNZ A;  4DV3 H;  2EY6 A;  4C3J H;  3IFT A;  1KL9 A;  4LF7 L;  3N8D A;  2F52 A;  2H4O A;  3DXJ C;  4P75 A;  1GOZ A;  4A3D G;  5IGF A;  1WCM B;  1J5E L;  1I94 Q;  1I94 H;  1AE2 A;  5CV5 A;  3J80 c;  2R7K A;  3TQT A;  3NBH A;  5C0X G;  1F2L A;  4R1J A;  5C3W A;  5GAE C;  2ALZ A;  2B8G A;  3HKS A;  3BAA A;  2KCN A;  4DV0 L;  5M5Y H;  3OHB A;  2E76 C;  1X54 A;  2HIV A;  1R9T A;  4AYB G;  1H9R A;  2F0Q A;  3CD6 A;  4BS9 A;  3FMC A;  2Q8T A;  2RCF A;  3T51 B;  4R8U A;  3BS1 A;  1PH1 A;  2JA5 G;  1HRJ A;  2DGY A;  5LOV F;  4WD3 A;  5KT6 A;  1OO9 B;  5LMN Q;  3IAY A;  3R3O A;  2DN8 A;  3HS0 C;  2FK1 A;  3KLR A;  5FLX W;  2F0J A;  3NTK A;  4LF4 L;  4C1N I;  2NUC A;  3JAM E;  3OW7 A;  1I5F A;  1O80 A;  3TP5 A;  2L5T A;  3GIL A;  1ZKO A;  3GTM A;  4R4Q A;  2W6P A;  1PRT C;  4R8I A;  2YRW A;  3E0J A;  1YHB A;  4Y7N H;  5JJZ A;  1HZB A;  1LT5 D;  5BPH A;  4HIK A;  4DR6 L;  1L0X B;  1ROD A;  4ME5 A;  2JA8 G;  3K7A H;  3P7J A;  3KBG A;  4QWB A;  1NUC A;  2A73 B;  4R4T A;  3H0G H;  5M3F H;  3GTO H;  3MWD A;  3H3V I;  3V6H A;  4HSP A;  4A93 H;  2P0A A;  2JA9 A;  1X65 A;  3G6X A;  3FKI A;  4HJA A;  2JA7 G;  4A3F B;  1HNW H;  4R9W A;  2QGQ A;  4DL4 A;  1STG A;  2F0D A;  2WKC A;  3PV0 A;  3KXY T;  4A3F H;  2VPQ A;  4B3R H;  1SYX B;  3RGX A;  3RGZ A;  4JI0 L;  3HOZ B;  2B8F A;  3BYT B;  1STH A;  3GQB A;  4KKU A;  1EQR A;  1PRT B;  1I4H A;  3VR3 A;  1HNZ Q;  2R6G A;  3OUU A;  2R93 A;  1T94 A;  4AQY Q;  3D31 A;  4A4I A;  1VQE A;  2K5H A;  3Q22 A;  3Q24 A;  2LMC B;  1HNW L;  1ENF A;  5C5J A;  4DR1 H;  4C2M H;  4JI4 Q;  3MWY W;  3K3P A;  4UDU C;  2QCP X;  1CM9 A;  3W5O A;  2RSN A;  1YJN A;  2JQO A;  2OXP A;  3PCO B;  1RJP A;  1RK5 A;  4QIW B;  3WO1 A;  3EPG A;  1YNJ D;  5J1Z A;  2CWA A;  1B70 B;  3AFP A;  4OX9 L;  4LMQ D;  4BXX G;  1RYS A;  4GNX B;  3HOV G;  3RAX A;  2IJ0 A;  5CYU A;  2V4D A;  4JI3 L;  5A35 A;  3CCJ A;  1DM0 B;  1WD0 A;  1K8A C;  4X65 H;  3ND8 A;  4EG0 A;  4XYL B;  1X56 A;  1SSO A;  4V0B A;  4I65 A;  3PW4 A;  1S97 A;  4LF6 H;  3W1G A;  4B3S L;  3EIV A;  2F4V H;  1K0R A;  4JYA L;  5CGK A;  3CF5 A;  1QOH A;  2EYP A;  3G6Y A;  3K8A A;  2JA6 G;  4HIO A;  5EPK A;  1AUV A;  4OWX B;  1UEB A;  4YAK B;  1Q86 C;  1LTB D;  5FKA C;  2MJ8 A;  3D4D A;  3WDN A;  4LAA A;  5ELB A;  3L0O A;  4DR4 L;  3KOJ A;  1HZ9 A;  3DHQ A;  4CDD C;  4PZ7 A;  3MA2 B;  1D7Q A;  2Y0S E;  2ASD A;  5C3E G;  3H15 A;  3KDF B;  2VUG A;  1FR3 A;  5KRU A;  3NPP A;  3GV7 B;  3NUC A;  1J6Q A;  3FPP A;  1F9S A;  1CHP D;  1CKN A;  3URY A;  2UUC L;  2R92 G;  2HIX A;  5EKL A;  1B44 D;  1SAP A;  1ENC A;  1JWM D;  1NTG A;  2NVY H;  2UVW A;  1TR5 A;  5IT9 W;  4L5Q A;  3RUZ A;  1OXT A;  2IW3 A;  3SXH A;  4RAZ A;  3TZU A;  2AQ3 B;  4IFD I;  1NR2 A;  5LMU H;  1D5Z C;  4HID A;  1GO3 E;  4TRD A;  2A5H A;  3CRK C;  1N48 A;  3I2Z A;  1QVG A;  4B3T L;  1EWI A;  1W3S A;  2YTV A;  3K5O A;  2WE6 A;  3GP7 A;  4J9K A;  4DR1 Q;  1IBM Q;  3KF6 B;  4LFA Q;  1I7L A;  3RB4 A;  4GLV B;  5ELF A;  1PZJ D;  4DUZ L;  4N9P A;  1H9M A;  4K6D A;  4GKJ L;  2PMZ A;  2VQE L;  3NE5 B;  2D0P A;  3KHG A;  4YJ3 F;  1ET6 A;  3CPF A;  4EEQ A;  3Q0A A;  2X0S A;  2W70 A;  4OGQ C;  4X62 L;  5CV4 A;  1ULZ A;  1MKH A;  2R61 A;  2KQ3 A;  1K73 C;  1PH6 A;  2E2H H;  3T4A C;  1VQM A;  1LM0 A;  4LK1 C;  1YJW A;  4DR7 L;  1CZG A;  3SE0 A;  1E1T A;  3TSS A;  3STB C;  1XDN A;  1UNS A;  1TWA A;  1B3A A;  3KTM A;  3V6K A;  3FP9 A;  2Q8I B;  1TWF B;  4E4T A;  3OMC A;  4EBD A;  2Z4I A;  2WP8 J;  4KJO A;  5ELC A;  1SFO H;  1A6X A;  2D2C C;  3RFC A;  1Y69 U;  1C8C A;  4L6T B;  1Q3L A;  4NPS A;  1Z9F A;  2J7Z A;  3BDC A;  3TII A;  4A3L H;  4Q0F A;  1UE5 A;  4BXX H;  3DWP A;  1QNU A;  4J9O A;  2HVS A;  4P73 A;  4FXK C;  2CW8 A;  3OSO A;  4EFB A;  3D0F A;  1SYE A;  3BVM A;  1ZHS A;  4L5T A;  2MO0 A;  2K5D A;  3U4Z A;  4BBR G;  5KT2 A;  2XWB B;  4IUN A;  3BVZ A;  4TV8 F;  3RUP A;  2XIW A;  1EEI D;  2GVA A;  1GVP A;  4CHT B;  3IG0 A;  2W8L A;  5IP7 G;  2A8V A;  5BR8 Q;  1IBL Q;  2I87 A;  2X69 A;  3UFX B;  3W2D A;  2RKS A;  3I3C A;  4IPC A;  5LHY 1;  2AGO A;  1LT6 D;  4YCV A;  1CA5 A;  4PMB A;  2UVV A;  1SR3 A;  5KT5 A;  2W9C B;  4B3T H;  4RHR A;  3GTJ H;  4GS3 A;  4ZCK A;  4A76 A;  1Y1W B;  1PVO A;  2R84 A;  5KFZ A;  3NBI A;  2BE5 D;  4H02 A;  5IOD A;  2A69 D;  3S1R H;  1AH9 A;  1B53 A;  3DWQ A;  4C1N K;  4N8X 1;  3VDY A;  4HYK A;  4MTK A;  4HJ7 A;  5DGA A;  4KN7 C;  1S5C D;  3KDF A;  5C3E H;  2CKZ B;  3RLO A;  3U9T A;  2EYH A;  2VA3 A;  2JEF A;  2M00 A;  1VMP A;  1KD1 C;  1LTR D;  4X65 Q;  5KFY A;  1K28 A;  1PFB A;  1PFS A;  1K3B C;  4FS2 A;  4O3R A;  2FK3 A;  1D1K A;  3JRX A;  4UCV A;  1SBB B;  3M7G A;  1L0W A;  1QZG A;  1BBX C;  1A2T A;  4RGT A;  3GTG A;  4JI0 Q;  2HVQ A;  3MTS A;  2JA8 B;  2QYZ A;  3S15 H;  5LP6 F;  1T9H A;  1MHW C;  3CQZ H;  2F3I A;  2R92 B;  2VQE H;  2NU6 B;  4KN4 C;  2NU9 B;  1O78 A;  2PI2 E;  5M5W B;  1W6K A;  1R9T B;  4DR3 Q;  2JEI A;  4P74 A;  3K6O A;  3SK6 A;  3IN5 A;  4X3K A;  2B2U A;  3TN2 A;  1TWH H;  4NW2 A;  1SRU A;  3KFU A;  3S1Q B;  4B3S H;  1QE6 A;  1K83 H;  4ME6 A;  5KFG A;  2RDJ A;  1PH8 A;  4V19 0;  1FNW A;  5BN3 A;  1BDO A;  3J7A 5;  3GLK A;  3GTK A;  4X64 Q;  4A2B A;  1PZK D;  1TXY A;  3SI8 A;  3HOX B;  4QUC A;  1Q46 A;  4R8N A;  3UE0 A;  1Q90 A;  1QVC A;  5DG9 A;  3K5M A;  4XIG S;  5A2Q W;  4BBS H;  5KT3 A;  1S0M A;  4OX9 H;  1JR0 D;  3OIP A;  1WTW A;  5JAV A;  1Z2N X;  5KFW A;  2OLS A;  1D5X C;  4E6I A;  2JA8 H;  4KHP H;  1HJP A;  4LF8 Q;  2PNR C;  4MHE A;  3DM3 A;  1B7Y B;  4A3G B;  1I6H B;  3VR5 A;  4R7R A;  4DU9 A;  2IA6 A;  4U7C A;  1S0N A;  1Z7T A;  2PZU A;  5D14 A;  3PO2 B;  3TS0 A;  1HFG A;  4A93 G;  4BWG B;  1CQJ B;  2BQR A;  4ZAI A;  2OH2 A;  2PMZ E;  2VB2 X;  4MZ9 A;  1JB3 A;  3M4P A;  1YNJ C;  5JPN C;  1LLR D;  3ERS X;  3G7L A;  2N78 A;  3MC0 B;  3TQ1 A;  3E3X A;  2ZXP A;  3FEW X;  2F4V L;  3MWM A;  1B6S A;  4Q8E A;  1A8V A;  4HCS A;  1SXT A;  5FOB B;  2DJG C;  4HJ9 A;  3HOZ G;  2AMC B;  1VQB A;  2UVU A;  4JI3 H;  1J5E Q;  5ELE A;  4FF1 A;  4HNT A;  2DPJ A;  2F0S A;  4ZQ3 A;  4R4C A;  1WD1 A;  2K28 A;  3RZD H;  4YR0 A;  2VQD A;  4MTD A;  1RD9 D;  4DR5 H;  1XMQ Q;  5KG6 A;  4LJZ C;  4CDF C;  4IAL A; 
#chains in the Genus database with same CATH homology
 1ASY A;  3KF6 A;  2NVT H;  3CCS A;  4ALP A;  4JI4 L;  2Q2T A;  4DR1 L;  4GNX A;  4NXN Q;  4A3I G;  3I4N G;  2MNA A;  3OW2 A;  1X3G A;  1HNZ L;  2ATW A;  1C0A A;  4A3C H;  2KCT A;  1KRT A;  2R7D A;  3PIO A;  4JV5 L;  1FVI A;  2UUB Q;  1TWA H;  1NJI C;  4JI2 L;  3KF8 B;  1X55 A;  1PH7 A;  2B63 H;  3PSI A;  3RR5 A;  4A3B H;  3F8T A;  4DUY L;  3RNU A;  3PGZ A;  2UU9 Q;  3GTP H;  4BY7 G;  4IFD J;  3G71 A;  5IP9 H;  4DV4 Q;  3ICE A;  1VS0 A;  3W1B A;  5C44 G;  4LF6 Q;  4IFD G;  1RL2 A;  3RN5 A;  5C4X G;  1PYS B;  4PG3 A;  4DK3 C;  4OXP A;  5IP7 H;  2YU9 H;  5M3M H;  5LMN W;  2UXC Q;  1Q82 C;  2IHF A;  3HOY H;  3ULP A;  3G48 A;  1IXR A;  2K52 A;  3M9B A;  4BY1 G;  3UE1 A;  1HH2 P;  3BZC A;  3UDI A;  4X66 Q;  3F2B A;  1VQ4 A;  2ASB A;  3GTG H;  1YZ6 A;  5GQO A;  5IYD G;  4DV6 Q;  4IOC A;  1KRS A;  4DUZ Q;  1GD7 A;  1N8R C;  3JC6 6;  1PHJ A;  5IP9 G;  1ASZ A;  1XPR A;  2ES2 A;  1N34 Q;  3CC4 A;  1N32 Q;  1IZ6 A;  1VQH A;  1QVF A;  4JYA Q;  4DV3 L;  4K0K Q;  1NMF A;  2NZH A;  1YI2 A;  1AE3 A;  4OWW B;  5IWA Q;  5IYB G;  1XNQ Q;  2AWO A;  2ZJR A;  3E9I A;  4JCV E;  2R7F A;  5IT9 c;  4BY1 H;  1SRO A;  4IOA A;  2L15 A;  3OYY A;  4JI8 L;  3HOX G;  4GOP C;  1HNX L;  2ZM6 L;  4DR5 Q;  1FJG L;  2NN6 G;  3GTM H;  2F4V Q;  1L1O A;  5JEA J;  1VQL A;  4KLK A;  1X3E A;  5LMN L;  5FLM G;  4JI3 Q;  1WFQ A;  4GN4 B;  1WCM H;  3AEV A;  1N9W A;  1K3R A;  3UDX A;  1PH2 A;  2NVQ H;  2R92 H;  1Q7Y C;  4DV2 L;  2B29 A;  1IBK Q;  2PI2 A;  3PUW A;  4DV7 Q;  5IWA L;  3HOU G;  2A19 A;  3FHW A;  3J81 c;  2I5L X;  4DV5 Q;  3T1H L;  1TWG H;  1WYD A;  3JAM c;  1LYL A;  1B8A A;  1XPO A;  3T1Y L;  4KHP Q;  4A3M G;  3S24 A;  5ELO A;  1VQJ A;  2VL6 A;  3OTO L;  1VQ7 A;  4LFC Q;  1MJC A;  2UXD L;  4QL5 A;  2Z6K A;  1A62 A;  1XNR L;  4JBJ A;  4AQY L;  1KAW A;  4B3R Q;  1YVC A;  5C0X I;  1G51 A;  1GKH A;  1I94 L;  4JI1 Q;  1I3Q H;  4X66 L;  4P71 A;  1EQQ A;  4LW1 A;  1L1O C;  2R93 H;  2JK8 A;  2ZJP A;  1E7Z A;  3AFQ A;  4KHZ A;  4UP7 A;  4J15 A;  3JAM i;  3M4O H;  1U0L A;  4DV1 L;  4DK6 C;  2I5M X;  3CCV A;  4YWL A;  1KC8 C;  4WJ3 M;  4X64 L;  5DLQ E;  2DUD A;  2VUM H;  4A3M H;  3I4M H;  4JI8 Q;  2K75 A;  3A0J A;  1VQ6 A;  3RN2 A;  1R9T H;  2K5V A;  2UU9 L;  3A74 A;  2Y0S G;  3L7Z C;  2NVX H;  5JJL A;  1Y14 B;  1KIX A;  2VQF Q;  1OXV A;  1OTC A;  2OTL A;  4AH6 A;  5IE8 A;  4PZ6 A;  1IYJ B;  1CKM A;  2A1A A;  1Q8K A;  2MQH A;  4JV5 Q;  2CWP A;  2IY5 B;  1Y1W G;  3BJU A;  3HKZ E;  4GN3 B;  5FJ8 H;  4QY7 A;  2HHH L;  2BH2 A;  3F2D A;  5HY6 A;  4OO1 I;  3HKZ G;  1D8L A;  1P16 A;  2VQE Q;  4BBR H;  4EX5 A;  5K36 G;  4NB3 A;  2R7Z H;  4TQU S;  5C4J H;  1IBL L;  4A3E H;  3S2H H;  4NXM Q;  3NEL A;  1BBU A;  4JBW A;  2PNH A;  4JG2 A;  5J3B A;  5IY0 A;  4OO1 G;  3ER0 A;  4LFA L;  2VNU D;  1C9O A;  1HZC A;  2WAQ E;  3S1M H;  2WFW A;  1XMQ L;  2XTI A;  3CCE A;  3CCU A;  1N36 L;  1Y1V H;  4C3J H;  1KL9 A;  1YEZ A;  4LF7 L;  5H1S E;  3L2P A;  4DV4 L;  2F52 A;  4P75 A;  4A3D G;  4WJ4 A;  1EUJ A;  1VQD A;  4A3L G;  1VQ8 A;  1I94 Q;  1J5E L;  1TWC H;  4GN5 A;  4APV A;  1AE2 A;  1VQA A;  4IPG A;  2IHE A;  3J80 c;  1XJV A;  4R4O A;  2ZTC A;  5C0X G;  1L2F A;  2UUA Q;  2UUB L;  4GLA C;  4A3F G;  4R1J A;  5GAE C;  1V43 A;  1YIT A;  1VQI A;  1QUQ A;  4A3I H;  3PUX A;  3HKS A;  4IJL A;  2QEX A;  1Q12 A;  4DV0 L;  1Y1V G;  5M5Y H;  2UUC Q;  1Q1B A;  2H5X A;  3PO3 G;  4A75 A;  2OTJ A;  1X54 A;  2HIV A;  4AYB G;  3TRZ A;  3CD6 A;  5EAY A;  3S17 H;  1LTL A;  1EIF A;  1PH1 A;  2JA5 G;  2DGY A;  1VQN A;  1VQF A;  2I0Q A;  3G4S A;  4LUV A;  1JMC A;  5LMN Q;  1EFW A;  1L1O B;  4GKK L;  2Q2U A;  1WOC A;  3TQY A;  4QJF A;  5GAG C;  1K9M C;  4LF4 L;  4A3C G;  2IX1 A;  4X6A H;  1HR0 L;  1I5F A;  2JJQ A;  2K14 A;  4BA1 I;  4JI7 L;  5M3M G;  1W2B A;  3ZJY C;  3S1N H;  2NN6 I;  3GTL H;  4A3J G;  4JC0 A;  3U50 C;  1UE6 A;  1N32 L;  5LMU L;  4POG A;  4R4Q A;  3UDF A;  4L5S A;  1XTD A;  3HOU H;  3BZK A;  1YHB A;  4Y7N H;  1HZB A;  4A3K H;  2YV5 A;  1CUK A;  4HIK A;  4DR6 L;  4C3I H;  2CCZ A;  2JA8 G;  5AJ3 Q;  3CXC A;  3K7A H;  1UE7 A;  1YBY A;  4IJH A;  1UWV A;  4R4T A;  1HZA A;  3H0G H;  5M3F H;  3GTO H;  4LF5 Q;  3H3V I;  1NMG A;  1XMO Q;  1YNX A;  4JI6 Q;  3E9H A;  4HJ8 A;  4A93 H;  2JA9 A;  1X65 A;  4UY8 C;  2FXQ A;  4DAY B;  1QUQ B;  4HJA A;  2JA7 G;  4RMF A;  2N3S A;  1KQS A;  2KHI A;  3DLL A;  2QGQ A;  4GLX A;  4B3M L;  2C35 B;  2CFM A;  3PV0 A;  4JI5 L;  4EQ5 A;  1YHA A;  1YHQ A;  4DV1 Q;  2B63 G;  2HQL A;  4A3F H;  1M1K C;  1WCM G;  3RZO H;  5JJK A;  2D0O A;  3TEH B;  1SN8 A;  4R4I A;  2JEA I;  1YJ9 A;  4JI0 L;  3G6E A;  5C44 H;  1HNZ Q;  1EQR A;  2R6G A;  3K0X A;  1JB7 A;  4JBM A;  1N33 L;  2KBN A;  4AQY Q;  3CCQ A;  3D31 A;  4A4I A;  2K5H A;  1VQE A;  1E1O A;  2ALY B;  1A0I A;  3M85 A;  4A3G H;  1HNW L;  1CKN B;  4C2M H;  4JI4 Q;  1YIJ A;  1GM5 A;  4KHP L;  2RHS B;  4X65 L;  3W5O A;  4MTN A;  3GTQ H;  3KLW A;  1YJN A;  2K50 A;  2JQO A;  3PCO B;  3PIP A;  3CC7 A;  1VQ5 A;  1XMO L;  1EIY B;  3AYH B;  1EOV A;  4DV7 L;  2R7Z G;  2CWA A;  4AYB E;  5HGQ A;  4JBK A;  1B70 B;  3AFP A;  5IYC H;  4OX9 L;  1A63 A;  2LXK A;  4BXX G;  2NZO A;  4QIW E;  2KCM A;  4IPD A;  4HIM A;  1PH4 A;  2AWN A;  4GNX B;  3HOV G;  2VS1 A;  3A5Z B;  4TVA B;  4JI3 L;  3CCJ A;  5FLX c;  1K8A C;  5JJI A;  2MO1 A;  1KHI A;  4O2D A;  1X56 A;  5LMU Q;  1E3P A;  1BKB A;  4YCW A;  1XNQ L;  1DGS A;  3W1G A;  3EIV A;  4B3S L;  4P72 A;  4K0K L;  3CAM A;  1K0R A;  4YY3 Q;  3F1Z A;  4JYA L;  3CF5 A;  5ELN A;  4YWK A;  1HR0 Q;  1N34 L;  2EIF A;  3MXN B;  4LUZ A;  3K8A A;  2JA6 G;  1RIP A;  4HIO A;  2JE6 I;  4UPA A;  4DR4 Q;  4OWX B;  1UEB A;  3E0E A;  1Q86 C;  4B3R L;  2GN5 A;  4DR2 L;  4DV6 L;  3L0O A;  4DR4 L;  3KOJ A;  4YHH L;  1HZ9 A;  1JJG A;  2D62 A;  4JOI A;  4UP9 A;  1VQG A;  1PA6 A;  4PZ7 A;  4LF8 L;  1D7Q A;  2Y0S E;  5C3E G;  3H15 A;  3KDF B;  3CP0 A;  1N33 Q;  5IYD H;  4DV0 Q;  1J6Q A;  2N8N A;  2PQA B;  1CKN A;  4DV2 Q;  2UUC L;  4A3D H;  2R92 G;  2HIX A;  2E8G A;  1XPU A;  2R93 G;  1NTG A;  2NVY H;  3CW2 C;  1Q81 C;  3NBH B;  4L5Q A;  4A3G G;  3NEM A;  3I4M G;  2GVB A;  1OXT A;  4OX9 Q;  1PH3 A;  4IFD I;  3J81 j;  4LF7 Q;  3WWV A;  2WAQ G;  1GO3 E;  4HID A;  1VQC A;  1WI5 A;  1PH5 A;  3I2Z A;  4LWC A;  1QVG A;  4B3T L;  1EWI A;  1W3S A;  2YTV A;  4NXN L;  2E5L Q;  2BA1 A;  4DR1 Q;  3KF6 B;  4LFA Q;  1IBM Q;  3S1Q H;  4DR3 L;  1I50 H;  4PZ8 A;  1S3O A;  4GLV B;  5AJ3 L;  4DR6 Q;  4DUZ L;  3HFZ B;  4GKJ L;  3K7U C;  3PUZ A;  3I55 A;  2VQE L;  1P8L A;  2BH8 A;  2D0P A;  3F2C A;  3PF5 A;  2OWO A;  3GTK H;  2Q2I A;  2HT1 A;  3EN2 A;  1Q1E A;  3CPF A;  4FDB A;  2QA4 A;  2UXC L;  4PMW A;  4IPH A;  4X62 L;  3S16 H;  4B3T Q;  4JI5 Q;  1MKH A;  4RG1 A;  3BU2 A;  1K73 C;  1PH6 A;  2E2H H;  1VQM A;  1PYB A;  3M7N A;  1LM0 A;  1YJW A;  2JA6 H;  4DR7 L;  3RLN A;  2OQK A;  1E1T A;  4LNQ A;  2UXB L;  3HOZ H;  3STB C;  2LSS A;  1BBW A;  2VUM G;  3FP9 A;  1UE1 A;  2ZTD A;  1E24 A;  3ULJ A;  2YTY A;  2WP8 J;  2OQ0 A;  3KJP A;  4LF9 L;  4XTC S;  4GOP B;  2KHJ A;  1SFO H;  4DPG A;  4QQB X;  3FKI G;  2N49 A;  5M5W H;  1E22 A;  1CSQ A;  4O0A A;  4NPS A;  1Z9F A;  3CCM A;  2K4K A;  5GRO A;  3OTO Q;  1JJ2 A;  4A3L H;  5IYC G;  3T1Y Q;  1UE5 A;  4BXX H;  2RHQ B;  1O7I A;  3KYH C;  4P73 A;  1BVS A;  4BY7 H;  3M3Y H;  2WB1 E;  1G29 1;  2AHO B;  3D0F A;  4L5T A;  2MO0 A;  3U4Z A;  4BBR G;  3HOW G;  1JE5 A;  1IBK L;  2VW9 A;  3SGI A;  1X9N A;  2GVA A;  5C4X H;  1GVP A;  4GKK Q;  4QGU A;  5IP7 G;  1OXX K;  2A8V A;  1WJJ A;  5BR8 Q;  1IBL Q;  3MEF A;  3TRE A;  1QZH A;  3B6Y A;  1N36 Q;  2WB1 G;  3HOY G;  4B3S Q;  2IX0 A;  2XGT A;  1FL0 A;  4IPC A;  2JA5 H;  4A3B G;  3S14 H;  1M90 C;  3Q8D A;  4YCV A;  5FJ8 G;  4BBS G;  1S40 A;  4NXM L;  1SLJ A;  1SR3 A;  3KJO A;  2CQO A;  3M4Q A;  3NEN A;  4YCU A;  4A3K G;  3GTJ H;  4LUO A;  1NBW A;  2LXJ A;  4GS3 A;  4A76 A;  3CCL A;  1PVO A;  1LUZ A;  4DV3 Q;  2JEB I;  4H02 A;  4A3E G;  3S1R H;  2E2I H;  1AH9 A;  2HHH Q;  2Z0S A;  1IL2 A;  3VDY A;  3HOV H;  4HJ7 A;  2OCE A;  4YHH Q;  1X3F A;  3I7F A;  3KDF A;  5C3E H;  1CKO A;  4DAM A;  2UUA L;  2CKZ B;  3RLO A;  1VQ9 A;  4YWM A;  1HR0 W;  2VQF L;  1KD1 C;  4X65 Q;  3HOX H;  4DR7 Q;  1PFS A;  1KXL A;  4Y52 H;  3UDG A;  3U4V A;  1VQK A;  4GOP A;  4LFB Q;  1HNW Q;  2ZTE A;  3AQQ A;  3LGJ A;  3K80 C;  4BA2 I;  1QZG A;  1C7Y A;  1L0W A;  2Q2H A;  3CME A;  5JEA G;  2ZJQ A;  4JI0 Q;  2MFI A;  3H0G G;  5M3F G;  2IT1 A;  4JI1 L;  3U58 A;  2E2J H;  3S15 H;  1T9H A;  2KEN A;  3CQZ H;  2F3I A;  3CC2 A;  3PO3 H;  4GKJ Q;  1PV4 A;  4JI2 Q;  1FGU A;  1SMX A;  3J81 i;  3TS2 A;  2K5N A;  4HJ5 A;  2PI2 E;  4POF A;  4OON A;  1NE3 A;  4LFC L;  4DR3 Q;  4P74 A;  2RCN A;  1K8G A;  1IBM L;  5GAD C;  2V1C C;  2E5L L;  3T1H Q;  1G6P A;  4JI6 L;  1TWH H;  3KFU A;  1SRU A;  1Z47 A;  1K83 H;  4IO9 A;  4LF5 L;  3GD7 A;  1PH8 A;  1U5K A;  2I5H A;  3GDE A;  4DNI A;  3J7A 5;  2Z6K C;  4X64 Q;  1VCI A;  4JOI C;  3PO2 G;  1TXY A;  2RF4 A;  1Q46 A;  3UE0 A;  5BR8 L;  5IYB H;  2ID0 A;  1QVC A;  3J7Z C;  2B3G A;  2EQS A;  1VQO A;  1JJC B;  4XIG S;  3RLF A;  1MJE A;  2ZM6 Q;  4DR5 L;  1HNX Q;  4BBS H;  2VY3 A;  2VZA A;  2BA0 A;  5GAH C;  2JA7 H;  4L5R C;  4B3M Q;  5FLM H;  2EXD A;  1XNR Q;  1JT8 A;  4JI7 Q;  4LFB L;  1NY4 A;  2UXD Q;  2JA8 H;  1Y1W H;  1HJP A;  4LF8 Q;  1VQP A;  3DM3 A;  1B7Y B;  3J80 i;  4GNX C;  4LF4 Q;  3CCR A;  4OWT B;  3PO2 H;  1H95 A;  4DV5 L;  1TWF H;  3FKI H;  1CSP A;  4DR2 Q;  1S72 A;  3ULL A;  3TS0 A;  2PQA A;  2YYZ A;  4A93 G;  4LF9 Q;  1SE8 A;  4ME3 A;  3H3V H;  4A3J H;  1X6O A;  2PMZ E;  1PH9 A;  5M5X H;  4MZ9 A;  3M4P A;  3IRB A;  4UP8 A;  4YY3 L;  2AKW B;  3ERS X;  4KI0 A;  3PUY A;  2N78 A;  2UXB Q;  1OXS C;  2YTX A;  2F4V L;  3HOW H;  4MNO A;  4LF6 L;  1V9P A;  1FJG Q;  1V1Q A;  3A5U A;  1A8V A;  4C3H H;  4DUY Q;  4HJ9 A;  3HOZ G;  3EBE A;  2AMC B;  1VQB A;  4X62 Q;  3GO5 A;  3K81 C;  5C0X J;  3I56 A;  1J5E Q;  3I4N H;  1MIU A;  5E7N A;  3CPW A;  4AIM A;  4R4C A;  3S2D H;  3PUV A;  3PF4 A;  1EYG A;  3STB D;  3RZD H;  4DKA C;  1OXU A;  3I4O A;  1XMQ Q;  3CMA A;  1I6H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...