5IP7G

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 33
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5ip7G01
2BH8A 5C0XG 5BR8L 3BU2A 1A62A 2PQAA 1M1KC 1GD7A 3CMEA 4BBRG 1JMCA 3UDGA 2R7FA 2YV5A 3TRZA 1Q1EA 4YCWA 5LMNQ 3FP9A 1N34Q 4P75A 2VY3A 3Q8DA 5HY6A 2VUMH 4JI1Q 3HOZH 2K14A 3L2PA 3PF5A 4AQYL 1XTDA 2E8GA 1SLJA 2F4VL 4A3IG 2WFWA 4BBSH 1N32Q 1A8VA 3KF6B 2VQFL 1K83H 2QEXA 4DV4Q 4A3CG 5M3FH 1CKMA 1Y14B 1JJGA 1SRUA 3HKZE 3TS0A 3D31A 3S1RH 1L2FA 4JYAQ 1VQKA 1W3SA 1X3GA 3GDEA 2JE6I 3T1YQ 3RR5A 3DM3A 1EQQA 1PVOA 4GKKL 4EQ5A 3HOUH 2UUCL 4RMFA 2UXDL 2A19A 3FKIG 4LWCA 2ZM6L 2R93H 2VQEQ 4A3LH 5M5WH 2WB1E 5IYDH 1QVFA 3PSIA 4ME3A 2ALYB 3HOXH 2HIVA 4X66L 1Y1VH 5FLMH 4DR3L 3H0GG 4JI7Q 3I55A 4IFDI 2NN6G 3EN2A 4QL5A 2UUAL 2HT1A 4UPAA 1VQGA 4DR5Q 3I4MG 1KC8C 3J80i 3PO2G 2ATWA 1PH4A 4LF8L 5FLXc 4DR6Q 2RHSB 1G291 4DV1L 4IFDJ 1QZGA 1VQJA 4YCVA 2R7ZH 3CQZH 1I5FA 3EIVA 1W2BA 3PO3H 4HIMA 1OXVA 3S14H 4JG2A 4JI2Q 1EUJA 2B63G 1SROA 1GO3E 1YJ9A 2DUDA 5JJIA 2I5HA 3CPFA 4QIWE 1AE2A 4A3GG 1OXUA 3AFQA 2ZJQA 1CUKA 1UWVA 1YEZA 5M3MG 1HR0Q 4GS3A 2R7DA 4HIOA 4OWWB 2BA0A 1VQHA 2JEAI 3I4MH 3PO2H 4JI4Q 3UE0A 4GNXC 1LYLA 4DK6C 1HNWQ 4BA1I 2ES2A 1I94Q 4JI5L 5IYBG 1R9TH 1C7YA 4KHPL 4J15A 1X9NA 3STBD 4B3SL 4B3TQ 5H1SE 4GN5A 4R4CA 4L5SA 3S2DH 1YI2A 3A0JA 3U4VA 2E5LQ 3M4OH 2R93G 4RG1A 3KYHC 4O0AA 4A4IA 4A3EH 3PUXA 4LF7L 1XJVA 2I5LX 3U50C 1ASYA 4A3EG 2Z6KA 1K8GA 1HR0W 1KL9A 2EQSA 4DV5Q 2CWAA 3A5UA 4LFCL 2NVYH 5C44G 3H3VH 3K7AH 3W1GA 3E0EA 4C3HH 5IP7H 3BJUA 2UUBL 1TXYA 1VQLA 1Q7YC 4GN4B 1TWGH 2NVXH 4DV2Q 4B3RL 1X56A 4JOIA 4DR4L 2AWOA 5C0XJ 3CCQA 1VQ6A 4YHHL 4DV6Q 2MFIA 5C3EG 1C9OA 2RCNA 3RLOA 2A1AA 3GO5A 3KDFB 2WP8J 4DKAC 2IX0A 1VQFA 3J81j 2B63H 3M9BA 4LF9L 2ID0A 3RZDH 1N36Q 1FJGL 1YHAA 2OQ0A 3GTGH 3F8TA 4PZ8A 2OWOA 1WCMH 2PI2A 3PO3G 1PH3A 4PG3A 4HJ5A 1QZHA 5J3BA 1FGUA 4P73A 3GTPH 4WJ4A 3PIPA 2GN5A 4GN3B 2R92H 1Y1WH 4A3LG 2K5HA 4UP9A 3K0XA 1QVGA 3F1ZA 1RIPA 4OO1G 1QVCA 4DV7L 1RL2A 2LXKA 3OTOQ 1K73C 1TWAH 1Q1BA 3OYYA 1PH9A 2AMCB 4DV3L 1I3QH 5C44H 4NPSA 4POFA 1A0IA 4PMWA 3JAMi 1KIXA 4IPGA 4B3MQ 4L5RC 1Z9FA 2OTLA 4A3CH 2Z0SA 1KD1C 4HJAA 3S17H 1UE1A 4QY7A 3KJPA 1SFOH 2VS1A 1SR3A 2KHIA 5AJ3Q 4A3JG 4A3DH 3U58A 3M85A 4QJFA 5M3MH 4DV6L 1YBYA 4R4QA 4A3MH 3RZOH 2GVAA 3UDIA 4DR4Q 4JI8Q 2ZM6Q 4DV0L 5JJLA 4LW1A 1NMGA 3RLFA 4DV2L 1E3PA 4BBRH 1IBMQ 4APVA 3PGZA 3CCUA 3GTQH 3T1YL 5C3EH 4JYAL 5LMUL 1J6QA 5IP9G 2ASBA 2CCZA 4H02A 4IFDG 2IX1A 3GTJH 4LFAQ 2K5VA 1EQRA 2VZAA 4BXXH 2YTXA 3S1QH 2VNUD 3T1HQ 2F4VQ 2R7ZG 1HJPA 4JI3Q 4DPGA 1PH8A 1B7YB 1IYJB 3H0GH 5IYCG 4YY3Q 2BH2A 3AEVA 1X55A 1J5EL 5HGQA 3BZCA 3M4PA 1J5EQ 4KHPQ 4A93G 3HOUG 1K0RA 1E24A 1X3EA 2KCMA 3FKIH 4MTNA 4FDBA 4DNIA 1MJEA 1IZ6A 4O2DA 2R6GA 2WAQE 2E2HH 3T1HL 4QQBX 1NY4A 3ERSX 1AE3A 3TREA 1HNXQ 4JI0Q 4LFAL 1HR0L 1LTLA 3ULJA 4GOPC 1PV4A 1JJ2A 4LF8Q 4OX9Q 3HOYH 4NB3A 3S1NH 1Q86C 1I50H 3GTKH 1YHBA 2DGYA 2Z6KC 3CC2A 4JV5Q 1LUZA 3UDXA 1PFSA 4GLVB 3W5OA 2IHEA 5C4JH 1YIJA 1PH2A 4JI2L 4BBSG 1D7QA 1N33Q 2E2JH 3ICEA 3IRBA 1IBML 1VQ5A 1KRTA 5DLQE 1E1OA 5M3FG 1V9PA 1JT8A 5C0XI 1SMXA 4JI8L 4LF4L 1Q8KA 4HIDA 1XNQL 2HHHQ 4P71A 2ZTEA 1L1OC 1PYBA 2F52A 3KJOA 3STBC 3L7ZC 1NE3A 1EOVA 1U5KA 4Y7NH 1L0WA 1WYDA 3CCJA 4IJHA 5AJ3L 5ELOA 4DR3Q 4JI7L 4ALPA 4X66Q 4A93H 1EWIA 3GD7A 1UE7A 2HHHL 2K52A 3KDFA 2R92G 1E7ZA 4B3ML 1NBWA 4IJLA 3JC66 3F2BA 4LF4Q 2F3IA 4DAMA 4R4TA 4GKKQ 3DLLA 1X3FA 1PH5A 1I6HH 3OTOL 1QUQB 1VQ9A 2ZJPA 1NTGA 1K9MC 4LNQA 1GM5A 3K81C 5GAEC 5LMNW 1YVCA 1HZBA 2JJQA 1S72A 1OTCA 2RF4A 2L15A 4BXXG 3PUVA 4JI0L 4OX9L 2MNAA 5GQOA 4DUYL 2YYZA 4IPDA 4NXML 1YJNA 3HOWH 5EAYA 3HOVG 1CSPA 3GTMH 1MKHA 1N36L 1EFWA 1FJGQ 4BA2I 4HJ7A 5ELNA 4DAYB 3L0OA 3KOJA 1N8RC 5M5XH 4A3JH 2K50A 4KLKA 1VQ8A 3I56A 2JA6G 2MO1A 1T9HA 2HQLA 4YHHQ 3HOYG 1CKNB 4YY3L 1KXLA 2JK8A 1PH6A 4JI6L 4JI3L 3CMAA 2KBNA 3GTOH 4DUZQ 3HOZG 2Q2IA 1QUQA 3G48A 3CCMA 1VQMA 2V1CC 3HOWG 2UUBQ 3CCLA 2A8VA 1OXTA 1GVPA 1X6OA 2UXCQ 3J81c 3EBEA 2JA7G 1BVSA 2PMZE 4LFCQ 4DV5L 1VQ7A 2JA9A 4YWLA 3KLWA 4KI0A 3G71A 5LMUQ 3J7A5 1HNZQ 1WCMG 3K80C 4DR2L 3CC4A 1VQEA 2Q2HA 3I4NG 1HZ9A 1EIYB 1G6PA 4C3IH 4LFBQ 4JBWA 2E5LL 4DV0Q 4X64Q 1DGSA 5FJ8H 3PV0A 3W1BA 5IYCH 3F2CA 4B3TL 4OO1I 3K7UC 4GNXB 1UEBA 2N3SA 1I94L 2N49A 4A3FG 1VQDA 1HZCA 4A75A 1BBWA 4JOIC 4OONA 3TQYA 1HNWL 3KFUA 4XTCS 2AHOB 3NEMA 1FVIA 2YTYA 4AYBG 2UXBL 1SN8A 1XNRL 4YCUA 4A76A 1OXXK 3U4ZA 1IBKL 1TWHH 2JA5H 1LM0A 1CSQA 3BZKA 1PA6A 3NELA 4LF6L 4GLAC 1N34L 3I4OA 4DV3Q 4PZ7A 2XTIA 2LXJA 4DV7Q 3HKZG 3E9IA 4R1JA 4BY1G 1KQSA 4JCVE 2D62A 1VQIA 2E2IH 4GOPA 1VQAA 5IY0A 3I4NH 4BY7H 4UP7A 5IWAQ 1YZ6A 4DV1Q 3CC7A 3M7NA 3S15H 4DR6L 5C4XG 2BA1A 1Z47A 3ULLA 3HKSA 1IBLL 3HOXG 1EIFA 2KCTA 4LF5Q 1TWCH 5IYDG 1PHJA 1TWFH 1WFQA 2K5NA 2JA7H 2VUMG 1EYGA 4LF9Q 4A3KG 5IYBH 3D0FA 1L1OA 3CXCA 1VQBA 1WI5A 2EXDA 2MO0A 2Y0SE 2Y0SG 1KHIA 2EIFA 3PUZA 4OWTB 3S2HH 3CAMA 2RHQB 4P72A 2PNHA 1XMOL 2JEBI 5GROA 4X6AH 1PYSB 2B3GA 2VQEL 1MJCA 4B3RQ 2UXDQ 4QGUA 3RN2A 2YTVA 2LSSA 1GKHA 1P16A 3PIOA 2MQHA 4IPHA 2Q2UA 2UUCQ 4K0KL 1Y1WG 1G51A 1VQCA 5IE8A 4BY1H 4P74A 2OCEA 2OTJA 1UE5A 4GOPB 1VQPA 1Q81C 2KHJA 1XPUA 1IBLQ 4A3GH 5IP9H 4DV4L 1M90C 5IWAL 3I2ZA 2K75A 1XPOA 1VCIA 2JA5G 4C3JH 4LF7Q 3G4SA 2VW9A 1V43A 2WAQG 4AYBE 3LGJA 3H15A 3KF8B 1VQNA 1VQOA 4B3SQ 4A3MG 5IP7G 5FJ8G 4X62Q 1B70B 2KENA 2NZHA 5LMNL 2PQAB 3M4QA 4GKJQ 1Q82C 1IXRA 4JI5Q 3J80c 4R4OA 1JB7A 3CP0A 4HJ8A 1XMQL 2UXBQ 5JJKA 4DK3C 3E9HA 5K36G 3SGIA 1YITA 2B29A 4MNOA 2UU9L 2UU9Q 4JI4L 4A3BH 4DR7L 4DR7Q 3OW2A 1XMQQ 1UE6A 3WWVA 3H3VI 4YWMA 1Y1VG 5FLMG 3CD6A 4GKJL 4X62L 1E1TA 1KAWA 4DR1L 2IT1A 3HFZB 4JBJA 1D8LA 4TVAB 3AQQA 5IT9c 4X64L 4GLXA 2ZTDA 2D0PA 3GTLH 4A3BG 4LFBL 3PUYA 4C2MH 4BY7G 1PH1A 1ASZA 1C0AA 1HH2P 3S16H 1HNZL 5E7NA 1K3RA 1VS0A 3CCSA 3PCOB 2I0QA 4JBKA 1Q12A 1WJJA 2N78A 1CKOA 1O7IA 2QGQA 3A5ZB 3MXNB 4OWXB 4AH6A 5JEAJ 5C4XH 1SE8A 3NENA 4TQUS 2ZJRA 4IOCA 1N9WA 2JQOA 5JEAG 4DR5L 2Q2TA 3ER0A 4EX5A 4UY8C 4L5QA 2QA4A 2UUAQ 2OQKA 2CWPA 3J7ZC 3G6EA 3VDYA 1BBUA 4DUZL 1YNXA 1OXSC 3RNUA 4K0KQ 2AWNA 1S3OA 5GADC 4L5TA 4JI6Q 4POGA 4LUOA 1CKNA 3NBHB 3S24A 2WB1G 5GAGC 1YHQA 2H5XA 2ZTCA 3HOVH 1XMOQ 4R4IA 4HIKA 1Q46A 4X65Q 4OXPA 1X65A 3J81i 3CF5A 2IHFA 2PI2E 3MEFA 4AIMA 2FXQA 1V1QA 3CCRA 4A3FH 3TEHB 1E22A 3CCEA 1B8AA 1WOCA 1X54A 1K8AC 1AH9A 1XPRA 4LF5L 2I5MX 4NXMQ 1P8LA 4DUYQ 4YWKA 4LUVA 1BKBA 2VQFQ 1N32L 1VQ4A 3UE1A 3RN5A 2C35B 4PZ6A 2YU9H 4A3KH 4LUZA 3CCVA 2HIXA 4AQYQ 2NVTH 2GVBA 4XIGS 4JI1L 1PH7A 4JC0A 2CKZB 4X65L 3S1MH 1HZAA 4LF6Q 3A74A 3RLNA 4UP8A 3AYHB 4GNXA 1IBKQ 2CQOA 4A3IH 1XNRQ 3PUWA 2NVQH 3ULPA 5BR8Q 5GAHC 4IO9A 3FHWA 4NXNL 4A3DG 2IY5B 1S40A 2VL6A 5M5YH 1NMFA 2JA6H 2NZOA 2NN6I 1XNQQ 3JAMc 4WJ3M 3TS2A 3CW2C 2K4KA 2CFMA 3ZJYC 2XGTA 3K8AA 3CPWA 4JBMA 1IL2A 3UDFA 1N33L 4DR2Q 4Y52H 1NJIC 1YJWA 1JE5A 3B6YA 4KHZA 2AKWB 3KF6A 4JV5L 2N8NA 2JA8H 1FL0A 4MZ9A 1JJCB 1MIUA 4IOAA 4DR1Q 2JA8G 3M3YH 3PF4A 1KRSA 2UXCL 1H95A 3AFPA 4IPCA 1U0LA 1HNXL 3I7FA 4NXNQ 3F2DA 1L1OB 2D0OA 1A63A 4HJ9A
chains in the Genus database with same CATH superfamily
3P75A 1U4LA 3CMEA 4DV6H 4RNMA 1EIGA 4TV9F 2DJGC 1JOOA 4H7BA 2XIGA 3L2PA 3G6XA 1AUVA 2EVBA 3T1YH 2F0GA 4JYAH 4BBSH 5LXTF 3V4ZA 3RV4A 1K83H 4DV4Q 3MFIA 4A3CG 5M3FH 2GPWA 2FB9A 5FPRA 1JJGA 3G7LA 3S1RH 4RZRA 4I4TF 4ME5A 3TDQA 1W3SA 2DPIA 2F0IA 3RR5A 3DM3A 1PVOA 4NP5A 3HOZB 2UUCL 1EZ1A 5DG9A 4IRKA 4RMFA 3R5XA 3FKIG 2ZM6L 1UC8A 1Z7TA 2P5ZX 2XD4A 2EYLA 5EKLA 3HOXH 4JVZA 1I3QB 5FLMH 4DR3L 4JI7Q 3I55A 1WTQA 5KFRA 4QL5A 5I9PA 2UUAL 2ZT9C 4ED0A 5AFWA 1K1QA 1VQGA 1Q8IA 4M1UB 3I4MG 1HA6A 2WDTA 2YL2A 1S0OA 4ILWA 4LF8L 4DR6Q 1ENAA 3W3AA 2QILA 5CMDA 2R7ZH 3CQZH 5L1JA 2A69D 5LOVF 3NGDA 1TWAA 2F03A 1YJ9A 2DUDA 4QIWE 1F9RA 5KIXA 4RB2C 3AFQA 2VR1A 2DN8A 4RGNA 3NWSA 2R7DA 4RUAA 4OWWB 5A2QE 4YR3A 4MV6A 1PXUA 5KFTA 1K0SA 3R2TA 5KFCA 5K2MA 2ES2A 2G5DA 3C3LA 3CRKC 2AQ3B 1PRTB 5A2QL 3K57A 1SE3A 1X9NA 4B3SL 3KAJA 4EGQA 4GN5A 4R4CA 3HGBA 5M3MB 4L5SA 2OT2A 1YI2A 4OO1H 3U4VA 4CKEA 2GLTA 4A3EH 3PUXA 1XJVA 2WAQB 4C3HB 3HOXB 1B6SA 5KFSA 3C46A 1WTOA 4GZYC 2Z6KA 2HVSA 2F1MA 1KL9A 1EQTA 4DV5Q 2CWAA 2I07B 2RA4A 2SDFA 1F2LA 3MFYA 3KHGA 2JA6A 3PQIA 3VMMA 4ECSA 5IP7H 3MXNA 2Z9HA 3BQ2A 4MV3A 2OF1A 2B8GA 1TAEA 4GN4B 1TWGH 4DV2Q 4JI1H 2K5QA 1ZHSA 2VUMB 3L4JA 1Y1VB 2ZDHA 2DPJA 3Q24A 1WD0A 4YHHL 1SEIA 3J7AF 3NBHA 1IW7C 3KLSX 4DKAC 1T3NA 1W6JA 4NXNH 3RZDH 4K5WA 1FJGL 1YHAA 2OQ0A 3NQIA 2R7ZB 5G3LF 3BDLA 1QZHA 1IOWA 1FGUA 1PFMA 3PIPA 4TV8F 4GN3B 2F0HA 2CH4A 4A3LG 5JUMA 4UP9A 3R23A 3F1ZA 5KNCA 5CR3A 3U9TA 1RIPA 1QVCA 3KHLA 2ALZA 4KJNA 1TWAH 2SNSA 3OYYA 1FGBD 2AMCB 5C44H 1EL0A 2Q8RE 4R8NA 1Y1VA 2B2UC 3GTQB 2Z0SA 1CQIB 4HJAA 1UE1A 1GSAA 1S5ED 1SFOH 2E2DC 5KFXA 2FFKB 2YU9B 2QK4A 3OWFA 1KJ9A 5CA1F 2PMZB 4A3MH 3FMAA 1TVXA 2OEOA 3NTIA 5C5MA 5HBRB 3RLFA 1JOQA 4FS1A 1IBMQ 2C2DA 3MEHA 4APVA 4IUPA 1HTLD 3T1YL 3M4IA 3BJYA 2BQUA 2OH2A 4PV1C 4TRDA 2F0NA 4IFDG 4IN3A 1GSHA 4YAJB 1EQRA 5L1LA 4ECWA 3NBIA 4A3BB 3U9SA 2FJ2A 3CKIB 5KG1A 2W9AA 3HOWB 1QE6A 5I2XA 4EFBA 3H0GH 4H44C 2Q8TA 2G9HD 2K1BA 2BH2A 1XMOH 1X55A 2E74C 1J5EL 1J5EQ 4A93G 1I4PA 2YRXA 4UCRA 5KT4A 3HOUG 5KFWA 1E2ZA 1E24A 3HKZB 1X3EA 3LP8A 4FDBA 4C3JB 1BXRA 4NLGA 2GA4B 3E0JA 3V96A 2UUAH 4QQBX 3T13A 4ZYSA 1HNXQ 5DM63 2RVLA 1LTLA 3ULJA 5ISRA 1PV4A 1EHIA 5E1FA 1DJRD 1Q86C 1I50H 3V6KA 4DV1H 2DGYA 2Z6KC 1U4PA 1Z6HA 2NBFA 2V58A 1LTGD 3NXWA 2A6EC 4HCSA 3A54A 1F77A 4IRDA 5C0XI 1Z2PX 1SMXA 4J9PA 4LF4L 1PTOF 3J7YW 5IT9E 1L1OC 5JVH3 3J81E 2F52A 3KJOA 1KLGD 4A3DB 4AYBA 1XMQH 1I50A 1ICFB 1L0WA 3WOFA 4DAYA 1JB3A 3QZ7A 3CCJA 4IJHA 5ELOA 2NVXB 4C5CA 4X66Q 4FXGC 1X3PA 1UE7A 2EYHA 4GKJH 5C4HA 2KEDA 1E7ZA 1PYWD 1NBWA 4B3ML 1SNCA 1JDEA 5CBEE 3UI2A 3AU7A 4R4TA 3DLLA 2HCIA 2QDLA 2ZJPA 1K9MC 3H0GA 2NTTA 3EVQA 3K81C 2V4DA 5GAEC 4MTDA 1STAA 3MFHA 4BXXG 4JI0L 5GQOA 2BOSA 2KUMA 4DUYL 1EY4A 5HV6A 2HJWA 3GTKA 4DAYB 3KOJA 4OIKA 3RBEA 3K3VA 1VQ8A 3J80E 2O5IC 3FPPA 2JA6G 3T5KA 1CKNB 5EBDA 4EQOA 4C3IB 1E2WA 4MV7A 2SNMA 4HNVA 2JK8A 1PH6A 3VYUA 5KFIA 1LACA 3S2HB 1S5DD 4CBVA 4CJ0B 3WNZA 1CQJB 2AQ2B 4RHRA 3G48A 5J2TF 2V1CC 1FJGH 1IYVA 4IHJF 2A8VA 5I47A 1OXTA 1GVPA 2L12A 4LF5H 5M5WB 1GXDC 1UUPA 5M3FB 5EOYA 2R3ZA 4MTKA 1VQ7A 4YWLA 5LMUQ 3MR5A 2MUYA 5JPMC 4K6DA 3FMCA 3HEJA 3K80C 5EWGA 4IR9A 3S9WA 2SOBA 1W6KA 4DV7H 2DY8A 4LK1C 4EFEA 3H3VC 4DV0Q 4X64Q 5JOBA 3JAME 3DWAA 3QWNA 2R7NA 5IYCH 4IUQA 4J9MA 4EYHB 3K7UC 2VUMA 2N3SA 2N49A 4JK1C 1HZCA 4WJWA 2FINB 4OONA 1CZGA 1I4GA 3TQYA 1GHJA 2R8HA 4M9UA 3Q0AA 2UXBL 1SN8A 2JYOA 4YCUA 3U4ZA 2R7MA 3RZOB 2DNEA 1QOHA 5CV5A 4CDCC 3VYRA 4DL3A 1DOLA 3RB6A 4PZ7A 4YR0A 1TT2A 3GV6A 2MGSA 3HS0C 5HGTA 3MZ5A 3K58A 1KQSA 1BCPC 2D62A 2E2IH 2W70A 2E2HB 1N33H 3D6CA 4C1NI 2PQEA 1BCPB 1D5MC 1BCPD 5C4XG 3S15H 2BA1A 1Z47A 2TSSA 3PZPA 2UXCH 2K28A 1BNZA 3TIGA 1KDAA 4BY7B 4TSSA 1EYGA 4LF9Q 4A2AA 4A3KG 5IYBH 3Q8RB 1FNWA 4ZOLF 1L1OA 2MJ8A 1VQBA 2Y0SG 3S2HH 1KHIA 3PUZA 2C5CA 1RJTA 2EIFA 1WCMA 2RHQB 4P72A 2PNHA 1XMOL 4KN4C 1PFBA 4Q5VA 2YZMA 4X6AH 1PYSB 1O75A 1MJCA 4J9LA 4B3RQ 1CZWA 1TS5A 2BE5C 4QGUA 2YTVA 4K8IA 4TKOB 4IPHA 1RDPD 3JAMW 1VQCA 5IE8A 4BY1H 2OTJA 1BXTA 2AQ1B 1GHKA 3I90A 1UNNC 3VR2A 1XPUA 1BJTA 5KG7A 5IP9H 4XZ3B 1B9MA 3QZ8A 3I2ZA 3JAML 5BN4A 2R8IA 2HDMA 1BR9A 2VW9A 1V43A 1I4HA 1STHA 4AYBE 3TMEA 5C6AA 5IP7G 3L4KA 2KENA 2NZHA 5LMNL 2PQAB 1Q82C 3J80c 1XMQL 3GTJA 5IIFA 1OO9B 5JJKA 1A3TA 4FF4A 3A8KE 5K36G 3SGIA 1II3A 2B29A 2NYZD 2UU9L 2UU9Q 4JI4L 2YS6A 3PR5B 5KNBA 3N41B 3OW2A 5FO7B 2KOLA 5KT6A 3H3VI 1UE6A 3GV8B 2XCAA 2BR0A 3R3OA 1HUNA 2IT1A 2RDIA 4Z9CB 1AEXA 4X64L 5IT9c 2WAQA 3GTLH 4LFBL 3PUYA 5C3XA 1CA5A 3EA6A 1SFOB 4K8JA 1KJJA 3DXJC 1VS0A 4JBKA 4OWXB 2N78A 1O7IA 4DK0A 5JEAJ 4OX9H 1Z2OX 4IOCA 1DYQA 1ML0D 2H4OA 3NK9A 5JEAG 4DR5L 4UY8C 2R7LA 5FD6A 1NR2A 1IOVA 1N36H 1JC7A 2OQKA 4DUZL 2RSNA 4JI6Q 4POGA 4F4YA 3NBHB 2AGPA 4IR1A 3GTPB 2N88A 4XYMB 1JWUD 4X65Q 4OXPA 1X65A 4K14A 1EZ6A 3N40P 5C5JA 5JPNC 2R6FA 1YNJC 3GTLA 5J22A 1WOCA 1X54A 2EXZA 1XPRA 2W6ZA 2F0SA 1P8LA 1J9OA 4KD4A 5FOBB 4YWKA 2I46A 3KBGA 4UCSA 1VQ4A 1VBGA 4ZUIA 4A3KH 3VYSA 5L9XA 5ELFA 3FPUB 1PH7A 5I6YA 2E5LH 1G2SA 4DR4H 3A74A 1DOMA 5D8DA 4B3TH 3AYHB 5IGGA 2CQOA 2CH4W 3PUWA 4FF2A 4EBEA 1I94H 3ULPA 2Q8IB 1HNWH 4A3EB 5CV9A 4LH6A 5KFVA 2EOTA 4H13C 3GTLB 1RKNA 3KHRA 4XT3B 3AMUA 5A2QW 1NMFA 4DXFA 1XNQQ 3TS2A 3MHBA 1HQMC 2CFMA 3ZJYC 3GTGB 2XGTA 4ECUA 3HXLA 3CPWA 4JBMA 3UDFA 4RKBA 4DR2Q 1RJRA 1JE5A 3I91A 5CGKA 4PMCA 4N9PA 1S4ZA 1FL0A 2ZXRA 1JJCB 1S10A 5I9OA 2W9BA 2H1EA 1U0LA 4ECVA 2FK1A 5M5YB 1S5BD 3C1FA 3WOEA 2CW0D 5BR8L 5ELDA 1M1KC 1CS0A 3JRWA 4J0MA 3UDGA 2K5WA 1Q1EA 1SYDA 2QF7A 3OIQA 1O78A 3FP9A 4P75A 4EBCA 2JA8B 2VUMH 1SYXB 4LMQD 2K14A 4AQYL 3WO1A 3H40A 2LY7A 2FMCA 2WFWA 1QNUA 1Y69U 3KF6B 2D5DA 5IGCA 2QEXA 1GJXA 2UVVA 1Y14B 5C3EB 3HKZE 3D31A 2J6SA 1VQKA 4PDBA 3GDEA 2QKIC 3MTSA 5EPJA 2R93A 1W96A 3OUZA 3M4OB 2UXDL 2A19A 5LL6S 4A3LH 5M5WH 4HAEA 1QVFA 1EY9A 3EPIA 2ALYB 1G6ZA 1W93A 4RGTA 5C44B 2HIVA 4J6HA 4QB4A 4X66L 2M2LA 2NN6G 4JI4H 4XT1B 4Q44A 4UPAA 2F0KA 4O3NA 5FPOA 3DHQA 4OELB 4DR5Q 3MR3A 3PW0A 3TP7A 5J39A 4U7CA 3PO2G 4QW8A 1SXTA 3J80i 5JVLA 4RGMA 2CVRA 2KCNA 4FYDA 1G291 1A3VA 2PBZA 5CORA 1VQJA 1H9JA 3DUZA 4YCVA 3PO3H 1AZPA 4HIMA 2VXWA 3S14H 4JI2Q 4K2LA 1VDZA 2B63G 1GO3E 2GPSA 5D1OB 1JLLB 2I5HA 4A3GG 5KFEA 1AE2A 1UWVA 3I8ZA 1HR0Q 1XNQH 2KECA 5KFFA 4P2CB 2AUKA 4IALA 1E2VA 3PO2H 1N48A 1S68A 4DK6C 1HNWQ 1L0XB 1JX4A 3S2DB 1PRTD 1I94Q 2RSOA 4JI5L 4ZUJA 3GTPA 1AN7A 2YYAA 1F9PA 4B3TQ 5H1SE 1V51A 1F2YA 4PQXA 3M4OH 3A0JA 3NUCA 2E5LQ 4BWSC 3KYHC 3MWMA 4MV8A 2UVWA 3U50C 2J7ZA 4FBTA 4X3TA 2FMAA 3H4BA 2NU6B 1I6HB 1K8GA 2HCCA 1HR0W 3GTGA 1FR3A 4R8UA 3H3VH 2C22A 3FDTA 4C3HH 1WVLA 1J8IA 1N32H 3KLRA 2UUBL 1VQLA 1JICA 1X3QA 2NVXH 2WV6D 5L1KA 2A5HA 5C5LA 2R92B 4X65H 1LT4D 4DR4L 2DZDA 2FPIB 4R8IA 4EVOA 4FBUA 1AP0A 1B33N 1C9OA 3RLOA 4JI6H 3GO5A 2JN4A 4CJ1B 1X32A 3QOJA 1VQFA 4ED6A 1EYDA 1N36Q 2OWOA 1WCMH 2PI2A 4PG3A 1EY7A 3GTPH 1DV2A 3HOVB 4J9KA 2OXPA 2GN5A 3OMCA 3RZDB 4IURA 3H20A 4G3IA 3NWTA 1QVGA 3K0XA 5KRUA 3F2UA 5EDWA 4C3HG 4Y8VB 4FS2A 4NPSA 3JAMi 3LWBA 5JH7F 3BQ0A 3R8BA 4QF4A 4LJZC 4KJOA 3K59A 4A3CH 2CZGA 5CB4F 4ZRZA 1K8OA 4QY7A 2VS1A 5AJ3Q 4MAMA 2ZXOA 3M85A 2F0QA 3L9AX 1EOTA 4HYKA 5M3MH 5C4XB 1YBYA 1IBKH 2GVAA 4O4IF 1QNKA 4U68A 3MAQA 4J9RA 4DV0L 4G57A 1EUDB 4DAVA 1M0TA 1G8ZD 1VKZA 3GV3A 3PGZA 3SK4A 3CCUA 2R84A 4AQYH 3GTQH 5FLXE 1J6QA 1AFPA 3G8CA 1UNSA 1T5XD 3G6JB 4BXXH 2YTXA 2W71A 2KVMA 2YS7A 2R93B 3S1QH 3N6RA 1HJPA 4DPGA 1PH8A 3CU7A 1T36A 2I80A 1IW7D 4L8JA 1IYJB 3BS1A 4ED1A 1H9RA 1HUMA 3BZCA 2K5DA 1K0RA 5FK9C 4K0KH 4MTNA 1IZ6A 3NHHA 2R6GA 2MCTA 5KG2A 2E2HH 4WFN3 1NY4A 1AE3A 1SNDA 3TREA 2FKLA 2XIWA 4GOPC 1JJ2A 1HTPA 3S1NH 4LF8H 3GTKH 1YHBA 5F9LA 1TWAB 2RDFA 3SK8A 5C4JH 4GLVB 1PZJD 3W5OA 2IHEA 1YIJA 1PH2A 2BCOA 1ET9A 4RKLA 1N33Q 4F4ZA 1L2ZA 3ICEA 1VQ5A 2XGPA 3OIPA 5DLQE 1E1OA 2JA6B 3V6HA 1YNJD 1STNA 2HHHQ 2ZTEA 1DOKA 3DM1A 2XGQA 1ZEQX 3M7GA 5DGAA 2EY2A 1WYDA 4G7ZC 5AJ3L 3GIMA 4OIJA 4DR3Q 4JI7L 2BDNA 4JI5H 1EWIA 1KDBA 2L5TA 2HHHL 2R92G 4X62H 4LF4Q 2PCFB 2O5JC 3LWUA 4DAMA 4X64H 3OTOL 1QUQB 2B2WA 3CVZA 1B2TA 1YVCA 2EZVA 1GSOA 1OTCA 1EYCA 2RF4A 1SSOA 2YCHA 5CV7A 3PUVA 4A3IB 1H9KA 4IFDH 1EEID 2F0EA 4KD3A 2LKVA 3P1HA 4IPDA 4NXML 3HOWH 5EAYA 2W9CB 3IG0A 1EFWA 1FJGQ 5FKAC 3CQZB 4HJ7A 2K33A 5ELNA 1T5EA 2XWJB 2IPKD 2B2TA 2YW2A 4KLKA 1I6UA 4QWCA 1PK8A 4B9WA 3BG5A 5DG7A 5KG0A 4B08A 4YY3L 5KFAA 1KXLA 2YU9A 3MWYW 1O7LA 3FDSA 2XCPA 1D2BA 1QWYA 4MIUA 3HOWG 2R7ZA 2FHTA 4KY5A 3CCLA 1S97A 1HRJA 3DF7A 4WD3A 4KHVA 3BABA 4PMBA 3PW7A 3X3MA 4DV5L 4ECXA 5FO9B 3KLWA 3PMFA 3G71A 3J7A5 2K7VA 1WCMG 4E6IA 4DR2L 3CC4A 1HZ9A 1G6PA 4FM9A 2RQXA 2FJZA 4C2MA 4DV3H 5FJ8H 5IYZF 2D2CC 2A73B 4C5BA 2K32A 3T56B 1M4VA 1UEBA 2MHVA 5KFZA 1LT6D 3R2IA 5JAVA 1BBWA 2DY7A 4JOIC 4ZLTF 1HNWL 3OPOA 5CAEB 4XTCS 2AHOB 2EYFA 1FVIA 3NEMA 4UHVA 3SK5A 2PMZA 3WDNA 1CSQA 3BZKA 4LF6L 1SJHD 3GIKA 4DXGA 5FLXL 2MPMA 3GTOA 2R8KA 4DV3Q 2C9OA 3SI8A 4QWEA 2XTIA 2LXJA 2F0UA 3HKZG 4R1JA 3K5IA 1QB5D 1VQIA 1VQAA 5IY0A 2M00A 1EU4A 4JPBW 4J8QA 4DV1Q 5JJIA 4ZI7F 4DR6L 2W6MA 4RAUC 2A68C 1I4RA 1IBLL 2KCTA 2LFNA 1TS4A 4HSPA 4DF7A 5IYDG 1HNXH 1WFQA 1A15A 2F0FA 1CQVA 1E4EB 2EY6A 1EUCB 1WI5A 3SEBA 1IHZA 1CTMA 5EWEA 2EYPA 4R9WA 4LAAA 4A2BA 5GROA 1J5EH 1M8AA 3GTJB 3S16B 3GV5B 1I7LA 2HVRA 1EQVA 3RN2A 4RCNA 2KHSA 4MA5A 2MQHA 5CA0F 1PX2A 1Y1WG 2NUAB 1G51A 3M4YA 5EWFA 1R9TA 2W8LA 1M6VA 1GUGA 1V1PB 1K83B 5IGFA 2KHJA 4A3GH 4UCOA 4DV4L 5M5XB 1D6EC 5IWAL 4F88A 3JSNA 1VAJA 3G4SA 3PW2A 2WAQG 2AGQA 3M9MB 1IBMH 2NN6H 5IODA 4DL2A 1RF2D 1I7NA 5L37A 1WCMB 4HEDA 4X62Q 4LF4H 2LS01 2B2YC 2B2TC 4JI5Q 1KJIA 1PTOD 5JQWA 1RYRA 4DR3H 2M05A 4A3BH 1YITA 3RB0A 5E4WC 2F0WA 1EIHA 4EBDA 5EKIA 4O4HF 5FLMG 2HHHH 5DQIA 1KAWA 3HFZB 4NW2A 4F7XA 1TIID 4TVAB 3MJFA 2ZTDA 2D0PA 3DWPA 3KTMA 4ED3A 5CBAE 3BDCA 1C0AA 1XWEA 3S16H 1CFMA 5E7NA 3DWQA 3CCSA 3PCOB 4LF8Q 2EY1A 4K5XA 1Q12A 1WJJA 1CKOA 3A5ZB 2Z8LA 3MXNB 5C4XH 2VUMG 4IAJA 5KG3A 4DFAA 2XVSA 4TQUS 4UFZA 1N9WA 2JQOA 2BDOA 3CQZA 3ER0A 1RYSA 4L5QA 5F2DA 3VDYA 4CDDC 1YNXA 1OXSC 4K0KQ 3HBLA 3JRXA 2UVUA 4KY6A 2F0DA 1ONLA 3IKJA 3VR5A 3S24A 2WB1G 1TS3A 1YHQA 2W6OA 3O13A 1NR4A 1Q46A 2B39A 4LH7A 4BY1B 2IHFA 1AUXA 1BDOA 3NTHA 2CW7A 2FXQA 1V1QA 4G7HC 1XDNA 1E22A 3CCEA 4O42A 4Q8FA 2DLNA 1WTVA 3T51B 1HXYD 4LUVA 4N8X1 3EFXD 1O7YA 1DXMA 4DV5H 4YBZB 3UE1A 2RDHA 4PZ6A 3N8DA 1M7JA 4CC6A 4AQYQ 2FLLA 2HIXA 4IZOA 3RAXA 2R87A 3Q22A 4DNRB 4X65L 2IJ0A 1HZAA 3MR6A 4UP8A 4FXDA 4F87A 4GNXA 1IBKQ 1WTWA 3A7LA 5KG5A 1JR0D 3J80L 3R5FA 3TBIB 2JA5B 4IO9A 4MHEA 4WORA 1F2MA 1FD7D 2L9HA 1S40A 3V6JA 1Y8NB 4NMZA 1F2ZA 5TSSA 2JA6H 4Q0FA 3JAMc 4WJ3M 1XXGA 3CW2C 5KFNA 2W6PA 3K8AA 1EWHA 3TQTA 3VR6A 5KT5A 1IL2A 5CV8A 5BPFA 1NJIC 1YJWA 3B6YA 4KHZA 4UCTA 1EFID 3KF6A 1GUWA 2N8NA 2K04A 4MZ9A 4F4WA 4DR6H 4QMGA 3M3YH 2JA8G 1BCPF 4QIWA 1KRSA 3R5HA 2FPGB 4FNFA 1HNXL 1RJQA 2X69A 4ME6A 1JOKA 4RB3C 3TN2A 2D0OA 4IWXA 2JA5A 2BE5D 2BH8A 5C0XG 3E5NA 1A62A 2PQAA 1SNOA 1GD7A 4G7OC 5IGEA 1JMCA 4YCWA 4X3UA 3Q8DA 5IT9W 3OHAA 3PF5A 1SAPA 1XTDA 3M9NB 5JEAH 4K5VA 1N32Q 5T14A 2DIKA 2VQFL 4O2BF 2WTFA 3PN1A 3LNNA 4DV4H 5JVDF 4MV9A 4XDXA 1KC7A 1L2FA 4JYAQ 4HMJA 3T1YQ 2JE6I 2ICIA 5EJWA 4E4TA 1DD2A 4J9OA 4GKKL 3QOLA 1B4OA 1G2TA 3M9OB 4YQWA 3Q2OA 4KN7C 4LWCA 5IYDH 3IN5A 3T4AC 5KYIA 2R7KA 4BBSB 1IYUA 3H0GG 1A6XA 3KBXA 5CV4A 4FF3A 2E2IB 2HT1A 1S5FD 1ZETA 4KKTA 3S15B 1PRTF 1HR0H 2R85A 3VR4A 1KLUD 4ZKCB 2RHSB 1K83A 1STBA 4DV1L 1QZGA 3RD4A 5L1IA 1I5FA 4JI2H 1SFOA 2W6NA 1EUJA 4ODGA 2UVRA 3CPFA 4FF1A 5C4ZA 2ZJQA 1YEZA 5M3MG 5DLGA 3GIIA 4HIOA 2KCCA 2BA0A 4DR5H 1JWSD 2JEAI 3I4MH 3GV7B 4JI4Q 3UE0A 5ELBA 4BWGB 4GNXC 2B63A 2AGOA 1PRTC 2PW5A 4BA1I 2RCFA 3J81L 2NVXA 4Q0YA 5IYBG 4KHPL 3IFDA 3RF2A 3TIIA 1ZYRC 3CRLC 2WKDA 2SCUB 3S2DH 4HQ6A 3RB4A 5KNDA 4RG1A 1CHQD 4A4IA 3LWEA 2I5LX 2ZDGA 1RCVD 2V59A 1KNEA 1ESFA 2VQDA 2XWBB 3A5UA 3SE7A 3KAKA 5C44G 2O2LD 3W1GA 2W8KA 4DUYH 1TQOA 3BJUA 2F3VA 3NSWA 1V8QA 4I7HA 4Q45A 4A3FB 1Q7YC 2P0AA 3J7AK 3K6OA 4IUTA 3GTKB 3I3CA 1RK5A 4OL7A 4B3RL 4C3JG 5DGBA 3PR4A 4JOIA 2AWOA 3Q6SA 5C0XJ 5C3EG 4QCLA 2RCNA 5LHY1 2WP8J 1KNAA 3J81j 3K5NA 2B63H 1KABA 3E5SA 3OHBA 2B2UA 2ASJA 4K2KA 3PO3G 5C3WA 5KFBA 1O80A 3MWDA 2MP1A 4A3GB 2F0MA 4OGQC 5EBCA 2R92H 1Y1WH 2FE3A 4R8UB 1SYCA 3HOYB 1VF7A 4L6TB 4RWSC 1TWFA 4DR2H 4I50F 1SNQA 4ECQA 1RJPA 1RL2A 1HPCA 5CV6A 3OTOQ 2J0TD 1Q1BA 1HCZA 1K73C 4DV3L 1PH9A 3TSSA 3ETJA 3UFXB 5LYJF 3PO2B 1VBHA 3D4RA 4IPGA 1KIXA 4B3MQ 1TWHA 4TUYF 3A7AB 5BMVF 1KD1C 3KJPA 1C48A 2KHIA 5JJZA 2VUGA 3MXGA 3DMUA 1A9XA 2FLNA 3TP5A 3ORRA 4CDEC 4DV6L 4R4QA 2ASDA 3RZOH 1ENCA 3UDIA 3RUPA 4DR4Q 1EY5A 4RH6A 3V05A 4JI8Q 4LW1A 1NMGA 4HNTA 4DV2L 1E3PA 4BBRH 1CHPD 2IW3A 4L1KA 1UC9A 2EPBA 4JYAL 5IP9G 1B44D 2EDGA 1NUCA 4H02A 4L63B 1JQYD 1S9FA 3GTMA 2K5VA 2VZAA 5D1OA 5KG4A 1B3AA 2QEJC 2EY5A 1JCKB 2B2VC 2R7ZG 3VPCA 2W9BB 3OSPA 2B2YA 1DV1A 2AQ4A 3NPPA 4LMYA 1WTHA 5EPLA 5NUCA 3X3NA 1SJED 5HGQA 2Z1CA 1I3QA 3TP8A 3RGXA 3FKIH 4ZQIA 3BVZA 4DNIA 1MJEA 3T53B 4O2DA 4RHSA 3T1HL 1KJ8A 1EU3A 3ERSX 3ND9A 3V4SA 1WSCA 1LO5D 5D3IB 4OX9Q 4PWQA 1JIHA 4XYOA 4F4XA 3IFTA 1C8CA 3C2PA 1BGWA 2WB1A 4JV5Q 3CC2A 3A56A 1JE4A 1LUZA 2X0SA 3UDXA 1BQQT 2R82A 3H0GB 1QILA 5I6WA 4BBSG 1D7QA 2E2JH 3IRBA 1IBML 1KRTA 1IKLA 5M3FG 1JT8A 1Y8PB 1E4EA 2IA6A 4JI8L 1Q8KA 4P71A 3OSOA 1PYBA 3MA2B 1GOZA 1SE4A 2L11A 3L7ZC 3STBC 4DGZA 5EZYF 1EOVA 1U5KA 4Y7NH 1AZQA 5KEEA 4IUVA 4MV4A 2UU9H 3RV3A 3BYYB 4CJ2C 4ALPA 1JXLA 4A93H 3GD7A 2JA7A 2PVPA 3FKIA 4IJLA 1LT3D 3JC66 3MR2A 4WBNF 1K1SA 3NTKA 4YJ2F 3DEPA 2BQ3A 1PH5A 4LFBH 3J7AV 1VQ9A 3QB3A 1NTGA 1L0YB 2RBMA 4LNQA 1GM5A 4DLKA 1HNZH 4QW9A 2A69C 2JJQA 1S72A 3LMLA 4ZHQF 1ICWA 2YYZA 3D4DA 2VA3A 1YJNA 3GTMH 2K6AA 1GYFA 5KFHA 1N36L 4BA2I 1RTOA 3PO3B 4DUZH 3ND8A 2ENBA 1C4QA 3RUZA 5M5XH 1LTRD 4MTEA 4B3RH 1DM0B 3H6MA 3DEOA 3BVMA 3I56A 3K5LA 2MO1A 1T9HA 2HQLA 4YHHQ 3HOYG 5EPKA 3EROA 3KK7A 3TZDA 3FRPB 4JI6L 2FPPB 1LTID 4KKSA 5KFKA 5T1GA 4JI3L 3CMAA 2KBNA 1A2TA 1MGSA 1K28A 2Q2IA 2XSCA 1QUQA 3CCMA 1VQMA 3HOZG 4LF9H 2UUBQ 2Z4IA 4HR7A 1X6OA 1BUVT 4CHTB 1LTBD 2UXCQ 2JA7G 3HZXA 4LFCQ 3ZYYX 1F9QA 4MA0A 1ULZA 2FMMA 3I12A 2KA7A 4RA8A 2Q2HA 2C2RA 1EIYB 2HVQA 4DL5A 3MVVA 4C3IH 2E5LL 3D6WA 4ZCKA 2RKSA 2TMPA 3OUUA 4JV2A 4RUCA 2R92A 2PZWA 4GNXB 3W2DA 4A3FG 4A75A 4N8FA 1S03G 3KFUA 1H9SA 2XCLA 4AYBG 3GQBA 3QO2A 4TQRA 4HR7B 1TWHH 1LM0A 4B9XA 1C3OA 1PA6A 3K0YA 4UCVA 1N34L 3IAYA 3I4OA 4DV0H 4DV7Q 3KHHA 4BY1G 4JCVE 4IQZA 1ZXTA 4UAIA 2WYOA 1S0MA 3EPGA 1CA6A 5KT2A 3I4NH 1D5ZC 5LMUH 1O7ZA 1TWFB 4UP7A 4UDUC 5IWAQ 3M7NA 2WB1B 5EKKA 3ULLA 3G6YA 2R8JA 2NVYB 3HKSA 3GILA 4WRDA 4LF5Q 1ZQ7A 2G9DA 4ABNA 1OWTA 2K5NA 1S5CD 2JEGA 4F8MA 1DZ1A 4CDFC 2IX3A 3CXCA 2Y0SE 2EXDA 4ZK9B 4MV1A 4OWTB 1SCUB 4I7AA 3CAMA 1ESRA 1EY0A 1I4QA 4XQQA 2B3GA 4I7ZC 3N52A 2UXDQ 2LMCB 2ASLA 2A74C 2PNRC 4RZQA 2LSSA 1P16A 2UUCQ 2ZDQA 1PZID 5DQGA 1Y8OB 5BPHA 2F4VH 3T1HH 4EQNA 4P74A 2OCEA 2X6GA 1MZBA 2E2HA 1V1OA 1VQPA 1Q81C 4LFAH 3M3YB 1IBLQ 2EJFC 4A3JB 1M90C 3BAAA 5F9NA 1VCIA 4C3JH 4M8AA 3SE0A 3C1EA 2HD3A 2XN9C 3LGJA 3H15A 5KFMA 3GIJA 3T16A 3BA8A 4UCUA 3KF8B 1VQNA 2ZM6H 1SBBB 3OW7A 5FJ8G 4A3MG 1B70B 1N34Q 4QWBA 4GKJQ 1NAPA 3F8NA 3URYA 1I50B 4ECZA 1JB7A 4R4OA 4FU0A 3CP0A 2NU9B 4X66H 2UXBQ 3RJ0A 1PMRA 4DK3C 3HKZA 2PZUA 4IZ8A 1XMQQ 4EGVA 4YWMA 1Y1VG 2XC9A 4GKJL 5KFYA 4EG0A 2R61A 2B2VA 3GLKA 4CGYB 1D8LA 4IRCA 2L1BA 3LX0A 4GLXA 3N6XA 4LSAA 4C2MH 4BY7G 3ONAB 5DG8A 1PH1A 3MWEA 1FNVA 1HH2P 1F9SA 4JUZA 1ET6A 1HNZL 1Q3LA 1K3RA 2I0QA 2QGQA 1CM9A 3PIP3 3NENA 2PYKA 5DNFA 2Q2TA 4EX5A 4C56C 2EYMA 2QA4A 5EGTA 2UUAQ 4QWAA 2CWPA 1BBUA 4AYBB 1TY2A 3RNUA 3BA9A 2AWNA 1S3OA 4IWYA 4L5TA 1WR2A 4LUOA 2H5XA 4C5AA 4DK1A 4ECYA 5IGDA 1XMOQ 5LP6F 4XYLB 4R4IA 2V4RA 3J81i 3RBDA 4I55F 3CF5A 1TKWB 2PI2E 5EQ0A 4C1NK 1T94A 3MEFA 2NU7B 4KMUC 1NNXA 3TEHB 4DA2A 4ECRA 3SDZA 1AH9A 3D3RA 4ULLA 2I5MX 4NXMQ 3G6VA 1BKBA 1GUTA 1WTPA 3T5LA 2EE1A 3L3OC 1SMYC 3RN5A 2C35B 4XYQA 2YU9H 4ETSA 5CYUA 3A8JE 2NVTH 3TZUA 2GVBA 4XIGS 2Z6BA 2NVQB 2JEFA 1B1ZA 2CKZB 3S1MH 2F4IA 3Q8QB 3IL8A 1VF5C 3RLNA 1EZ8A 1E4GT 4Q8EA 4O3OA 4A3IH 5KT7A 1KJQA 3SXHA 3RB3A 4NXNL 4A3DG 4X3SA 2O4XA 1B6RA 4EEYA 2NN6I 4FVMA 1K3BC 3MXUA 1SNMA 3HOUB 4EYIB 5E3FA 2QW7A 3OWEB 4XQJA 1QCBD 5IGBA 4TQSA 2AU0A 1N33L 3V2TA 3A55A 4Y52H 4R7RA 4N9TA 1MI2A 5M9OA 5I2YA 3VYTA 2J6UA 1MIUA 1KDCA 4DR1Q 2NTSA 3K5MA 2UXCL 4I65A 2YRWA 3AFPA 4NDXA 4H0LC 3I7FA 5A35A 4NXNQ 1L1OB 3FEWX 1A63A 4HJ9A 3BU2A 4S3SA 5K5PA 2FK2A 4BBRG 2R7FA 2YV5A 3TRZA 3K5OA 1UEAB 2CW0C 1VMCA 5LMNQ 2ATLA 2VQEH 2VY3A 2IL8A 1HQRD 3CHBD 5HY6A 4JI1Q 3HOZH 2HUGA 1Z2NX 4RAZA 3HB9A 3S1MB 4DV2H 3S1QB 1R9TB 4J9SA 2E8GA 3GTOB 1RD9D 1SLJA 2F4VL 4A3IG 2BQRA 3RMHA 1A8VA 3K5HA 3VR3A 2WE6A 2D9UA 5IT9L 1C30A 1CKMA 2Y0SA 1SRUA 1DIKA 3TS0A 2RDGA 4QUFA 5JVG3 1SE2A 4YJ3F 1X3GA 4DL6A 3BYTB 2F0LA 4RB0A 4O3PA 1EQQA 5KFQA 4HCEA 3OSNA 4NKLA 4EQ5A 3HOUH 2RGRA 3K7AB 2J9GA 1Y1WB 2JP1A 2CW8A 2R93H 2EYOA 2VQEQ 2WB1E 3GIDA 5C1PA 5LMNH 4ZQ3A 3PSIA 4ME3A 4EQPA 1SYBA 2R8GA 1PDQA 1BBXC 1TY0A 1Y1VH 4IFDI 2VPQA 3OMGA 4HNUA 2JEJA 1STEA 3EN2A 3GIPA 1PFNA 2PZTA 2N55A 2CQAA 4O3RA 1CI3M 1KC8C 1U4RA 2ATWA 1R4PB 1PH4A 1LTAD 3R93A 1DONA 4DR1H 1V1PA 3KLSA 5FLXc 4O4LF 2C00A 4IFDJ 2C2EA 1A3UA 4APMA 5KFJA 3EIVA 2DWCA 1W2BA 3Q8PB 3EYYA 4DL7A 1OXVA 1GUOA 4JG2A 1SROA 3JZIA 5C4JB 1OXUA 1CUKA 2DJFC 4GS3A 3KF8A 5GONF 1VQHA 1D1IA 3PIO3 2WACA 1LYLA 3T5HA 4JI7H 1JWMD 3ERQA 1TWGA 1R9TH 3SK6A 1C7YA 2ZJTA 3NP8A 2B8FA 4J15A 4KTAA 1TU2B 3STBD 1KEEA 1S0NA 1WTXA 3H91A 2R93G 2QYZA 4O0AA 3OHXC 4LF7L 5KT3A 3KXYT 1ILQA 1ASYA 4A3EG 2K03A 5KX5F 2A6ED 2JXMB 2EQSA 4LFCL 2NVYH 3K7AH 3E0EA 1CQFA 1BF4A 4J9QA 4NXMH 4JW0A 1HFGA 2YZGA 4C2MB 1TXYA 5K36H 3RAQA 3E6ZX 2F0VA 4ID6A 5H80A 1TR5A 4J9NA 1TA8A 1X56A 1IKMA 3OOCA 1TWCA 3TQ1A 4FO2A 3CCQA 4CC5A 4CKBA 1VQ6A 4DV6Q 2MFIA 4PNYA 5C1OA 1H9SB 2A1AA 3KDFB 1PTOC 4U673 3RTXA 2IX0A 3ETHA 1EY6A 3M9BA 4LF9L 2ID0A 5ELEA 1PTOH 3GTGH 3F8TA 4PZ8A 1PH3A 4HJ5A 5J3BA 4P73A 1I6VC 4WJ4A 2NZ1D 1RK6A 5J2UF 3PW5A 5G3LD 1JDBB 4A93B 5D65A 4OHJA 2OLSA 2K5HA 3PVXA 5FLXW 4OO1G 4DV7L 2LXKA 3N42B 3RGZA 3N43B 1I3QH 3QJYA 1A0IA 1RHPA 4PMWA 4POFA 3I4MB 5KFUA 2Z4HA 4L5RC 1E0BA 1UAPA 3I70A 1Z9FA 5DEHA 1N56A 4V0BA 5DQHA 2OTLA 3S17H 2A6HD 3ORQA 5ELCA 3BQ1A 1SR3A 4DU9A 4A3JG 4A3DH 5BR8H 3U58A 2O03A 2WKCA 2UXBH 4QJFA 1XNRH 3HP3A 1FYCA 4LF6H 1N34H 2ZM6Q 5JJLA 1K8MA 4DAPA 2A68D 2PW7A 5C3EH 5D3DA 5LMUL 4V190 4BBRB 1KBLA 2ASBA 2VQFH 2CCZA 2NB0A 1IBLH 2IX1A 3GTJH 4LFAQ 1ILPA 1ZHQA 2F0PA 2VNUD 3T1HQ 2F4VQ 4HTHA 4JI3Q 1B7YB 1XX8A 1NCVA 2F0TA 5LL6b 2UUCH 2UXDH 5IYCG 5C8YF 4YY3Q 3U9OA 3AEVA 1B50A 4DL4A 3M4PA 5COYA 1PTOB 4KHPQ 1EEFD 2B63B 1BO0A 1H9MA 5DLFA 2A6HC 2KCMA 2CQYA 3NQTA 1E4FT 2VB3X 2WAQE 2FP4B 3GTQA 1B53A 2NVTB 4KV6A 2R86A 2V9WA 3FKIB 4JI0Q 4LFAL 1U4MA 1HR0L 3HOYH 4CKCA 1SYGA 4NB3A 3VA7A 1WTRA 4M7EA 5IWAH 4JV1A 2HQEA 3EJIA 1PFSA 4JI2L 2X6LA 5D1PA 3QFFA 3S17B 4JV0A 4O3QA 1EY8A 1V9PA 2WIIB 4HIDA 1XNQL 4ED2A 2E2JB 4O2AF 3BVGA 2L4NA 1NE3A 4OEMB 2VPSA 4DR7H 3S14B 3SVMA 2HDLA 4ZKBB 1TWGB 4F50A 3S1NB 1RODA 2E2IA 5DM73 2K52A 3KDFA 5KGUA 4B3SH 3F2BA 1GUNA 2F3IA 1MD2D 4A3KB 4GKKQ 1X3FA 1I6HH 3BG3A 4LF7H 1D1KA 2QDBA 2IP4A 4Y7NB 5LMNW 1HZBA 5D14A 5DAUA 4Q43A 2L15A 4YIJA 2HGSA 4LFCH 1VMPA 4RFBA 4OX9L 2MNAA 1HHVA 1GGOA 3HOVG 1HFNA 3P7JA 1CSPA 2UUBH 1MKHA 5BN5A 2IMWP 1N8RC 3L0OA 4QUCA 5J1ZA 1SNPA 4A3JH 2K50A 3MXPA 1TWCB 3GP7A 5LA6F 1HA5A 4YHHH 4YB8B 4RGOS 1B3QA 3GTOH 4DUZQ 3KALA 1SEBD 3BZDB 1SYEA 4KK7A 1STGA 1LV9A 5CC4A 4A3MB 4RNOA 3J81c 3EBEA 2NUCA 3I73A 3UQ8A 2JSOA 1BVSA 2PMZE 1B04A 1R4QB 5HURA 2JA9A 4ECTA 4KI0A 1HNZQ 3T5JA 4YR2A 2W9CA 1VQEA 3I4NG 2C28A 4LFBQ 2JEIA 4JBWA 2YZNA 1YNNC 4XQNA 1ENFA 1DGSA 4MN3A 3PV0A 2VA2A 3W1BA 3F2CA 4B3TL 4OO1I 1SYFA 2EYJA 2NWGA 4KKUA 3Q23A 1I94L 3VPDA 2FLPA 1VQDA 1MHWC 1LTSD 4DNTB 1I4XA 1FNUA 2RGVA 2YTYA 1MSHA 2EJGC 1XNRL 4A76A 1OXXK 1IBKL 2JA5H 1CK1A 1G91A 3NELA 4RCOA 3D4WA 4GLAC 2I8CA 3FVQA 3E9IA 3WO0A 3D8GA 4IUNA 4GOPA 4U6PA 4BY7H 1RTNA 4G4KA 4JV5H 1YZ6A 2W7PA 5LL6X 3CC7A 3GTMB 2XNAC 3Q8SB 3HOXG 1EIFA 1QG7A 1TWCH 1PHJA 2JA7H 1TWFH 4QWDA 1TWHB 2E75C 1Y1WA 3BDOA 1LLRD 1TS2A 3D0FA 4X3KA 2RDJA 1Q90A 1EYZA 2MO0A 1JKJB 2XRSD 4LSXA 2KJXA 4IUUA 3H4DA 1U9RA 2EJMA 2JEBI 3QR8A 5IOCA 5KKNB 2VQEL 5KFLA 3I72A 5KFPA 2Q2UA 1GKHA 3PIOA 4K0KL 3J81W 4GC6A 1NSNS 3TP6A 1V4YA 1PZKD 3SR1A 1YNND 4ED8A 1BOSA 1UE5A 4GOPB 1FKAH 2WINB 4RAYA 1SMYD 3NE5B 3JSLA 5BN3A 2KSWA 2AUJD 2B2WC 1WD1A 4EEQA 2K75A 1XPOA 2JA5G 5E4XA 4LF7Q 5KG6A 4XX0B 4GKKH 1ZKOA 3I4LA 1KAAA 1VQOA 4B3SQ 4JI8H 2IWHA 3M4QA 2F0OA 3VA5A 1IXRA 2J4XA 2PPBC 4HJ8A 1MSGA 2W6QA 3E9HA 1BNCA 4DR7L 4MNOA 4DR7Q 2K01A 2K05A 5FD5A 3WWVA 2JA7B 5I4DA 3CD6A 1MBYA 5KFOA 4X62L 1E1TA 4B3MH 4DR1L 3MFGA 5FO8B 4JBJA 4HN7A 3AQQA 2M9VA 1DCZA 3HG9A 3I4NB 4BS9A 4A3BG 3GIQA 3OTOH 2Y0SB 1CT1D 4O1NA 1ASZA 3E3XA 3ITPA 1M0WA 2L0CA 4AH6A 4JI0H 1SE8A 2ZJRA 4K6LA 4FP5D 1KTKA 1LT5D 1EWCA 2E76C 3AB9A 4YAKB 1ZYRD 3J7ZC 3G6EA 3J80W 1GLVA 2J6TA 4KY7A 1IL8A 5GADC 3TINA 2XRQD 1D5XC 1CKNA 1SDFA 5GAGC 4KHPH 3HOVH 2ZTCA 1AN8A 2PN1A 2VB2X 4HMIA 4YY3H 3MC0B 4HIKA 4GC7A 1XYIA 4DN4M 3K3PA 4JI3H 4AIMA 3CCRA 4A3FH 1JORA 5C0XH 1PLFA 1B8AA 1K8AC 4LF5L 3H09A 4DUYQ 4J1MA 2VQFQ 3A8IE 2QCPX 4C3IG 1N32L 1A2UA 1XTCD 3QG1A 4LUZA 2F0JA 3H94A 4HSVA 3CCVA 1CE8A 2I87A 4O3SA 4FXKC 3KUPA 4JI1L 2KEEA 4JC0A 1LTTD 3RFCA 4QIWB 4RU9A 3SHLA 4LF6Q 4RNNA 2V4QA 2VOBA 2IBKA 3Q1KA 2FK3A 1XNRQ 2DNCA 4RB1A 2NVQH 4ZAIA 5BR8Q 1STYA 5GAHC 3QIAA 2W57A 3FHWA 1QJOA 3P20A 2IY5B 2VL6A 3S1RB 1EYAA 5M5YH 2PO4A 2NZOA 2ZXPA 2CHBD 3PW4A 2V5AA 2L55A 2F3WA 2K4KA 5KYLA 5KFGA 1GUSA 2KQ3A 2SEBD 3GQCA 3VPBA 4ED7A 1LABA 1B9NA 3RIZA 3HRZC 2AKWB 1AW7A 5T1IA 4JV5L 2ICEC 2JA8H 2NVYA 4XXEA 3N44B 4IOAA 3PF4A 1WH2A 3EQLC 1H95A 4YP3A 4EGJA 4IPCA 3F2DA 5KFDA 2W7OA 2NU8B 3C0FB
chains in the Genus database with same CATH topology
2BH8A 5C0XG 5BR8L 3BU2A 1A62A 2PQAA 1M1KC 1GD7A 3CMEA 4BBRG 1JMCA 3UDGA 2R7FA 2YV5A 3TRZA 1Q1EA 4YCWA 5LMNQ 3FP9A 1N34Q 4P75A 2VY3A 3Q8DA 5HY6A 2VUMH 4JI1Q 3HOZH 2K14A 3L2PA 3PF5A 4AQYL 1XTDA 2E8GA 1SLJA 2F4VL 4A3IG 2WFWA 4BBSH 1N32Q 1A8VA 3KF6B 2VQFL 1K83H 2QEXA 4DV4Q 4A3CG 5M3FH 1CKMA 1Y14B 1JJGA 1SRUA 3HKZE 3TS0A 3D31A 3S1RH 1L2FA 4JYAQ 1VQKA 1W3SA 1X3GA 3GDEA 2JE6I 3T1YQ 3RR5A 3DM3A 1EQQA 1PVOA 4GKKL 4EQ5A 3HOUH 2UUCL 4RMFA 2UXDL 2A19A 3FKIG 4LWCA 2ZM6L 2R93H 2VQEQ 4A3LH 5M5WH 2WB1E 5IYDH 1QVFA 3PSIA 4ME3A 2ALYB 3HOXH 2HIVA 4X66L 1Y1VH 5FLMH 4DR3L 3H0GG 4JI7Q 3I55A 4IFDI 2NN6G 3EN2A 4QL5A 2UUAL 2HT1A 4UPAA 1VQGA 4DR5Q 3I4MG 1KC8C 3J80i 3PO2G 2ATWA 1PH4A 4LF8L 5FLXc 4DR6Q 2RHSB 1G291 4DV1L 4IFDJ 1QZGA 1VQJA 4YCVA 2R7ZH 3CQZH 1I5FA 3EIVA 1W2BA 3PO3H 4HIMA 1OXVA 3S14H 4JG2A 4JI2Q 1EUJA 2B63G 1SROA 1GO3E 1YJ9A 2DUDA 5JJIA 2I5HA 3CPFA 4QIWE 1AE2A 4A3GG 1OXUA 3AFQA 2ZJQA 1CUKA 1UWVA 1YEZA 5M3MG 1HR0Q 4GS3A 2R7DA 4HIOA 4OWWB 2BA0A 1VQHA 2JEAI 3I4MH 3PO2H 4JI4Q 3UE0A 4GNXC 1LYLA 4DK6C 1HNWQ 4BA1I 2ES2A 1I94Q 4JI5L 5IYBG 1R9TH 1C7YA 4KHPL 4J15A 1X9NA 3STBD 4B3SL 4B3TQ 5H1SE 4GN5A 4R4CA 4L5SA 3S2DH 1YI2A 3A0JA 3U4VA 2E5LQ 3M4OH 2R93G 4RG1A 3KYHC 4O0AA 4A4IA 4A3EH 3PUXA 4LF7L 1XJVA 2I5LX 3U50C 1ASYA 4A3EG 2Z6KA 1K8GA 1HR0W 1KL9A 2EQSA 4DV5Q 2CWAA 3A5UA 4LFCL 2NVYH 5C44G 3H3VH 3K7AH 3W1GA 3E0EA 4C3HH 5IP7H 3BJUA 2UUBL 1TXYA 1VQLA 1Q7YC 4GN4B 1TWGH 2NVXH 4DV2Q 4B3RL 1X56A 4JOIA 4DR4L 2AWOA 5C0XJ 3CCQA 1VQ6A 4YHHL 4DV6Q 2MFIA 5C3EG 1C9OA 2RCNA 3RLOA 2A1AA 3GO5A 3KDFB 2WP8J 4DKAC 2IX0A 1VQFA 3J81j 2B63H 3M9BA 4LF9L 2ID0A 3RZDH 1N36Q 1FJGL 1YHAA 2OQ0A 3GTGH 3F8TA 4PZ8A 2OWOA 1WCMH 2PI2A 3PO3G 1PH3A 4PG3A 4HJ5A 1QZHA 5J3BA 1FGUA 4P73A 3GTPH 4WJ4A 3PIPA 2GN5A 4GN3B 2R92H 1Y1WH 4A3LG 2K5HA 4UP9A 3K0XA 1QVGA 3F1ZA 1RIPA 4OO1G 1QVCA 4DV7L 1RL2A 2LXKA 3OTOQ 1K73C 1TWAH 1Q1BA 3OYYA 1PH9A 2AMCB 4DV3L 1I3QH 5C44H 4NPSA 4POFA 1A0IA 4PMWA 3JAMi 1KIXA 4IPGA 4B3MQ 4L5RC 1Z9FA 2OTLA 4A3CH 2Z0SA 1KD1C 4HJAA 3S17H 1UE1A 4QY7A 3KJPA 1SFOH 2VS1A 1SR3A 2KHIA 5AJ3Q 4A3JG 4A3DH 3U58A 3M85A 4QJFA 5M3MH 4DV6L 1YBYA 4R4QA 4A3MH 3RZOH 2GVAA 3UDIA 4DR4Q 4JI8Q 2ZM6Q 4DV0L 5JJLA 4LW1A 1NMGA 3RLFA 4DV2L 1E3PA 4BBRH 1IBMQ 4APVA 3PGZA 3CCUA 3GTQH 3T1YL 5C3EH 4JYAL 5LMUL 1J6QA 5IP9G 2ASBA 2CCZA 4H02A 4IFDG 2IX1A 3GTJH 4LFAQ 2K5VA 1EQRA 2VZAA 4BXXH 2YTXA 3S1QH 2VNUD 3T1HQ 2F4VQ 2R7ZG 1HJPA 4JI3Q 4DPGA 1PH8A 1B7YB 1IYJB 3H0GH 5IYCG 4YY3Q 2BH2A 3AEVA 1X55A 1J5EL 5HGQA 3BZCA 3M4PA 1J5EQ 4KHPQ 4A93G 3HOUG 1K0RA 1E24A 1X3EA 2KCMA 3FKIH 4MTNA 4FDBA 4DNIA 1MJEA 1IZ6A 4O2DA 2R6GA 2WAQE 2E2HH 3T1HL 4QQBX 1NY4A 3ERSX 1AE3A 3TREA 1HNXQ 4JI0Q 4LFAL 1HR0L 1LTLA 3ULJA 4GOPC 1PV4A 1JJ2A 4LF8Q 4OX9Q 3HOYH 4NB3A 3S1NH 1Q86C 1I50H 3GTKH 1YHBA 2DGYA 2Z6KC 3CC2A 4JV5Q 1LUZA 3UDXA 1PFSA 4GLVB 3W5OA 2IHEA 5C4JH 1YIJA 1PH2A 4JI2L 4BBSG 1D7QA 1N33Q 2E2JH 3ICEA 3IRBA 1IBML 1VQ5A 1KRTA 5DLQE 1E1OA 5M3FG 1V9PA 1JT8A 5C0XI 1SMXA 4JI8L 4LF4L 1Q8KA 4HIDA 1XNQL 2HHHQ 4P71A 2ZTEA 1L1OC 1PYBA 2F52A 3KJOA 3STBC 3L7ZC 1NE3A 1EOVA 1U5KA 4Y7NH 1L0WA 1WYDA 3CCJA 4IJHA 5AJ3L 5ELOA 4DR3Q 4JI7L 4ALPA 4X66Q 4A93H 1EWIA 3GD7A 1UE7A 2HHHL 2K52A 3KDFA 2R92G 1E7ZA 4B3ML 1NBWA 4IJLA 3JC66 3F2BA 4LF4Q 2F3IA 4DAMA 4R4TA 4GKKQ 3DLLA 1X3FA 1PH5A 1I6HH 3OTOL 1QUQB 1VQ9A 2ZJPA 1NTGA 1K9MC 4LNQA 1GM5A 3K81C 5GAEC 5LMNW 1YVCA 1HZBA 2JJQA 1S72A 1OTCA 2RF4A 2L15A 4BXXG 3PUVA 4JI0L 4OX9L 2MNAA 5GQOA 4DUYL 2YYZA 4IPDA 4NXML 1YJNA 3HOWH 5EAYA 3HOVG 1CSPA 3GTMH 1MKHA 1N36L 1EFWA 1FJGQ 4BA2I 4HJ7A 5ELNA 4DAYB 3L0OA 3KOJA 1N8RC 5M5XH 4A3JH 2K50A 4KLKA 1VQ8A 3I56A 2JA6G 2MO1A 1T9HA 2HQLA 4YHHQ 3HOYG 1CKNB 4YY3L 1KXLA 2JK8A 1PH6A 4JI6L 4JI3L 3CMAA 2KBNA 3GTOH 4DUZQ 3HOZG 2Q2IA 1QUQA 3G48A 3CCMA 1VQMA 2V1CC 3HOWG 2UUBQ 3CCLA 2A8VA 1OXTA 1GVPA 1X6OA 2UXCQ 3J81c 3EBEA 2JA7G 1BVSA 2PMZE 4LFCQ 4DV5L 1VQ7A 2JA9A 4YWLA 3KLWA 4KI0A 3G71A 5LMUQ 3J7A5 1HNZQ 1WCMG 3K80C 4DR2L 3CC4A 1VQEA 2Q2HA 3I4NG 1HZ9A 1EIYB 1G6PA 4C3IH 4LFBQ 4JBWA 2E5LL 4DV0Q 4X64Q 1DGSA 5FJ8H 3PV0A 3W1BA 5IYCH 3F2CA 4B3TL 4OO1I 3K7UC 4GNXB 1UEBA 2N3SA 1I94L 2N49A 4A3FG 1VQDA 1HZCA 4A75A 1BBWA 4JOIC 4OONA 3TQYA 1HNWL 3KFUA 4XTCS 2AHOB 3NEMA 1FVIA 2YTYA 4AYBG 2UXBL 1SN8A 1XNRL 4YCUA 4A76A 1OXXK 3U4ZA 1IBKL 1TWHH 2JA5H 1LM0A 1CSQA 3BZKA 1PA6A 3NELA 4LF6L 4GLAC 1N34L 3I4OA 4DV3Q 4PZ7A 2XTIA 2LXJA 4DV7Q 3HKZG 3E9IA 4R1JA 4BY1G 1KQSA 4JCVE 2D62A 1VQIA 2E2IH 4GOPA 1VQAA 5IY0A 3I4NH 4BY7H 4UP7A 5IWAQ 1YZ6A 4DV1Q 3CC7A 3M7NA 3S15H 4DR6L 5C4XG 2BA1A 1Z47A 3ULLA 3HKSA 1IBLL 3HOXG 1EIFA 2KCTA 4LF5Q 1TWCH 5IYDG 1PHJA 1TWFH 1WFQA 2K5NA 2JA7H 2VUMG 1EYGA 4LF9Q 4A3KG 5IYBH 3D0FA 1L1OA 3CXCA 1VQBA 1WI5A 2EXDA 2MO0A 2Y0SE 2Y0SG 1KHIA 2EIFA 3PUZA 4OWTB 3S2HH 3CAMA 2RHQB 4P72A 2PNHA 1XMOL 2JEBI 5GROA 4X6AH 1PYSB 2B3GA 2VQEL 1MJCA 4B3RQ 2UXDQ 4QGUA 3RN2A 2YTVA 2LSSA 1GKHA 1P16A 3PIOA 2MQHA 4IPHA 2Q2UA 2UUCQ 4K0KL 1Y1WG 1G51A 1VQCA 5IE8A 4BY1H 4P74A 2OCEA 2OTJA 1UE5A 4GOPB 1VQPA 1Q81C 2KHJA 1XPUA 1IBLQ 4A3GH 5IP9H 4DV4L 1M90C 5IWAL 3I2ZA 2K75A 1XPOA 1VCIA 2JA5G 4C3JH 4LF7Q 3G4SA 2VW9A 1V43A 2WAQG 4AYBE 3LGJA 3H15A 3KF8B 1VQNA 1VQOA 4B3SQ 4A3MG 5IP7G 5FJ8G 4X62Q 1B70B 2KENA 2NZHA 5LMNL 2PQAB 3M4QA 4GKJQ 1Q82C 1IXRA 4JI5Q 3J80c 4R4OA 1JB7A 3CP0A 4HJ8A 1XMQL 2UXBQ 5JJKA 4DK3C 3E9HA 5K36G 3SGIA 1YITA 2B29A 4MNOA 2UU9L 2UU9Q 4JI4L 4A3BH 4DR7L 4DR7Q 3OW2A 1XMQQ 1UE6A 3WWVA 3H3VI 4YWMA 1Y1VG 5FLMG 3CD6A 4GKJL 4X62L 1E1TA 1KAWA 4DR1L 2IT1A 3HFZB 4JBJA 1D8LA 4TVAB 3AQQA 5IT9c 4X64L 4GLXA 2ZTDA 2D0PA 3GTLH 4A3BG 4LFBL 3PUYA 4C2MH 4BY7G 1PH1A 1ASZA 1C0AA 1HH2P 3S16H 1HNZL 5E7NA 1K3RA 1VS0A 3CCSA 3PCOB 2I0QA 4JBKA 1Q12A 1WJJA 2N78A 1CKOA 1O7IA 2QGQA 3A5ZB 3MXNB 4OWXB 4AH6A 5JEAJ 5C4XH 1SE8A 3NENA 4TQUS 2ZJRA 4IOCA 1N9WA 2JQOA 5JEAG 4DR5L 2Q2TA 3ER0A 4EX5A 4UY8C 4L5QA 2QA4A 2UUAQ 2OQKA 2CWPA 3J7ZC 3G6EA 3VDYA 1BBUA 4DUZL 1YNXA 1OXSC 3RNUA 4K0KQ 2AWNA 1S3OA 5GADC 4L5TA 4JI6Q 4POGA 4LUOA 1CKNA 3NBHB 3S24A 2WB1G 5GAGC 1YHQA 2H5XA 2ZTCA 3HOVH 1XMOQ 4R4IA 4HIKA 1Q46A 4X65Q 4OXPA 1X65A 3J81i 3CF5A 2IHFA 2PI2E 3MEFA 4AIMA 2FXQA 1V1QA 3CCRA 4A3FH 3TEHB 1E22A 3CCEA 1B8AA 1WOCA 1X54A 1K8AC 1AH9A 1XPRA 4LF5L 2I5MX 4NXMQ 1P8LA 4DUYQ 4YWKA 4LUVA 1BKBA 2VQFQ 1N32L 1VQ4A 3UE1A 3RN5A 2C35B 4PZ6A 2YU9H 4A3KH 4LUZA 3CCVA 2HIXA 4AQYQ 2NVTH 2GVBA 4XIGS 4JI1L 1PH7A 4JC0A 2CKZB 4X65L 3S1MH 1HZAA 4LF6Q 3A74A 3RLNA 4UP8A 3AYHB 4GNXA 1IBKQ 2CQOA 4A3IH 1XNRQ 3PUWA 2NVQH 3ULPA 5BR8Q 5GAHC 4IO9A 3FHWA 4NXNL 4A3DG 2IY5B 1S40A 2VL6A 5M5YH 1NMFA 2JA6H 2NZOA 2NN6I 1XNQQ 3JAMc 4WJ3M 3TS2A 3CW2C 2K4KA 2CFMA 3ZJYC 2XGTA 3K8AA 3CPWA 4JBMA 1IL2A 3UDFA 1N33L 4DR2Q 4Y52H 1NJIC 1YJWA 1JE5A 3B6YA 4KHZA 2AKWB 3KF6A 4JV5L 2N8NA 2JA8H 1FL0A 4MZ9A 1JJCB 1MIUA 4IOAA 4DR1Q 2JA8G 3M3YH 3PF4A 1KRSA 2UXCL 1H95A 3AFPA 4IPCA 1U0LA 1HNXL 3I7FA 4NXNQ 3F2DA 1L1OB 2D0OA 1A63A 4HJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH8 A;  5C0X G;  5BR8 L;  3BU2 A;  1A62 A;  2PQA A;  1M1K C;  1GD7 A;  3CME A;  4BBR G;  1JMC A;  3UDG A;  2R7F A;  2YV5 A;  3TRZ A;  1Q1E A;  4YCW A;  5LMN Q;  3FP9 A;  1N34 Q;  4P75 A;  2VY3 A;  3Q8D A;  5HY6 A;  2VUM H;  4JI1 Q;  3HOZ H;  2K14 A;  3L2P A;  3PF5 A;  4AQY L;  1XTD A;  2E8G A;  1SLJ A;  2F4V L;  4A3I G;  2WFW A;  4BBS H;  1N32 Q;  1A8V A;  3KF6 B;  2VQF L;  1K83 H;  2QEX A;  4DV4 Q;  4A3C G;  5M3F H;  1CKM A;  1Y14 B;  1JJG A;  1SRU A;  3HKZ E;  3TS0 A;  3D31 A;  3S1R H;  1L2F A;  4JYA Q;  1VQK A;  1W3S A;  1X3G A;  3GDE A;  2JE6 I;  3T1Y Q;  3RR5 A;  3DM3 A;  1EQQ A;  1PVO A;  4GKK L;  4EQ5 A;  3HOU H;  2UUC L;  4RMF A;  2UXD L;  2A19 A;  3FKI G;  4LWC A;  2ZM6 L;  2R93 H;  2VQE Q;  4A3L H;  5M5W H;  2WB1 E;  5IYD H;  1QVF A;  3PSI A;  4ME3 A;  2ALY B;  3HOX H;  2HIV A;  4X66 L;  1Y1V H;  5FLM H;  4DR3 L;  3H0G G;  4JI7 Q;  3I55 A;  4IFD I;  2NN6 G;  3EN2 A;  4QL5 A;  2UUA L;  2HT1 A;  4UPA A;  1VQG A;  4DR5 Q;  3I4M G;  1KC8 C;  3J80 i;  3PO2 G;  2ATW A;  1PH4 A;  4LF8 L;  5FLX c;  4DR6 Q;  2RHS B;  1G29 1;  4DV1 L;  4IFD J;  1QZG A;  1VQJ A;  4YCV A;  2R7Z H;  3CQZ H;  1I5F A;  3EIV A;  1W2B A;  3PO3 H;  4HIM A;  1OXV A;  3S14 H;  4JG2 A;  4JI2 Q;  1EUJ A;  2B63 G;  1SRO A;  1GO3 E;  1YJ9 A;  2DUD A;  5JJI A;  2I5H A;  3CPF A;  4QIW E;  1AE2 A;  4A3G G;  1OXU A;  3AFQ A;  2ZJQ A;  1CUK A;  1UWV A;  1YEZ A;  5M3M G;  1HR0 Q;  4GS3 A;  2R7D A;  4HIO A;  4OWW B;  2BA0 A;  1VQH A;  2JEA I;  3I4M H;  3PO2 H;  4JI4 Q;  3UE0 A;  4GNX C;  1LYL A;  4DK6 C;  1HNW Q;  4BA1 I;  2ES2 A;  1I94 Q;  4JI5 L;  5IYB G;  1R9T H;  1C7Y A;  4KHP L;  4J15 A;  1X9N A;  3STB D;  4B3S L;  4B3T Q;  5H1S E;  4GN5 A;  4R4C A;  4L5S A;  3S2D H;  1YI2 A;  3A0J A;  3U4V A;  2E5L Q;  3M4O H;  2R93 G;  4RG1 A;  3KYH C;  4O0A A;  4A4I A;  4A3E H;  3PUX A;  4LF7 L;  1XJV A;  2I5L X;  3U50 C;  1ASY A;  4A3E G;  2Z6K A;  1K8G A;  1HR0 W;  1KL9 A;  2EQS A;  4DV5 Q;  2CWA A;  3A5U A;  4LFC L;  2NVY H;  5C44 G;  3H3V H;  3K7A H;  3W1G A;  3E0E A;  4C3H H;  5IP7 H;  3BJU A;  2UUB L;  1TXY A;  1VQL A;  1Q7Y C;  4GN4 B;  1TWG H;  2NVX H;  4DV2 Q;  4B3R L;  1X56 A;  4JOI A;  4DR4 L;  2AWO A;  5C0X J;  3CCQ A;  1VQ6 A;  4YHH L;  4DV6 Q;  2MFI A;  5C3E G;  1C9O A;  2RCN A;  3RLO A;  2A1A A;  3GO5 A;  3KDF B;  2WP8 J;  4DKA C;  2IX0 A;  1VQF A;  3J81 j;  2B63 H;  3M9B A;  4LF9 L;  2ID0 A;  3RZD H;  1N36 Q;  1FJG L;  1YHA A;  2OQ0 A;  3GTG H;  3F8T A;  4PZ8 A;  2OWO A;  1WCM H;  2PI2 A;  3PO3 G;  1PH3 A;  4PG3 A;  4HJ5 A;  1QZH A;  5J3B A;  1FGU A;  4P73 A;  3GTP H;  4WJ4 A;  3PIP A;  2GN5 A;  4GN3 B;  2R92 H;  1Y1W H;  4A3L G;  2K5H A;  4UP9 A;  3K0X A;  1QVG A;  3F1Z A;  1RIP A;  4OO1 G;  1QVC A;  4DV7 L;  1RL2 A;  2LXK A;  3OTO Q;  1K73 C;  1TWA H;  1Q1B A;  3OYY A;  1PH9 A;  2AMC B;  4DV3 L;  1I3Q H;  5C44 H;  4NPS A;  4POF A;  1A0I A;  4PMW A;  3JAM i;  1KIX A;  4IPG A;  4B3M Q;  4L5R C;  1Z9F A;  2OTL A;  4A3C H;  2Z0S A;  1KD1 C;  4HJA A;  3S17 H;  1UE1 A;  4QY7 A;  3KJP A;  1SFO H;  2VS1 A;  1SR3 A;  2KHI A;  5AJ3 Q;  4A3J G;  4A3D H;  3U58 A;  3M85 A;  4QJF A;  5M3M H;  4DV6 L;  1YBY A;  4R4Q A;  4A3M H;  3RZO H;  2GVA A;  3UDI A;  4DR4 Q;  4JI8 Q;  2ZM6 Q;  4DV0 L;  5JJL A;  4LW1 A;  1NMG A;  3RLF A;  4DV2 L;  1E3P A;  4BBR H;  1IBM Q;  4APV A;  3PGZ A;  3CCU A;  3GTQ H;  3T1Y L;  5C3E H;  4JYA L;  5LMU L;  1J6Q A;  5IP9 G;  2ASB A;  2CCZ A;  4H02 A;  4IFD G;  2IX1 A;  3GTJ H;  4LFA Q;  2K5V A;  1EQR A;  2VZA A;  4BXX H;  2YTX A;  3S1Q H;  2VNU D;  3T1H Q;  2F4V Q;  2R7Z G;  1HJP A;  4JI3 Q;  4DPG A;  1PH8 A;  1B7Y B;  1IYJ B;  3H0G H;  5IYC G;  4YY3 Q;  2BH2 A;  3AEV A;  1X55 A;  1J5E L;  5HGQ A;  3BZC A;  3M4P A;  1J5E Q;  4KHP Q;  4A93 G;  3HOU G;  1K0R A;  1E24 A;  1X3E A;  2KCM A;  3FKI H;  4MTN A;  4FDB A;  4DNI A;  1MJE A;  1IZ6 A;  4O2D A;  2R6G A;  2WAQ E;  2E2H H;  3T1H L;  4QQB X;  1NY4 A;  3ERS X;  1AE3 A;  3TRE A;  1HNX Q;  4JI0 Q;  4LFA L;  1HR0 L;  1LTL A;  3ULJ A;  4GOP C;  1PV4 A;  1JJ2 A;  4LF8 Q;  4OX9 Q;  3HOY H;  4NB3 A;  3S1N H;  1Q86 C;  1I50 H;  3GTK H;  1YHB A;  2DGY A;  2Z6K C;  3CC2 A;  4JV5 Q;  1LUZ A;  3UDX A;  1PFS A;  4GLV B;  3W5O A;  2IHE A;  5C4J H;  1YIJ A;  1PH2 A;  4JI2 L;  4BBS G;  1D7Q A;  1N33 Q;  2E2J H;  3ICE A;  3IRB A;  1IBM L;  1VQ5 A;  1KRT A;  5DLQ E;  1E1O A;  5M3F G;  1V9P A;  1JT8 A;  5C0X I;  1SMX A;  4JI8 L;  4LF4 L;  1Q8K A;  4HID A;  1XNQ L;  2HHH Q;  4P71 A;  2ZTE A;  1L1O C;  1PYB A;  2F52 A;  3KJO A;  3STB C;  3L7Z C;  1NE3 A;  1EOV A;  1U5K A;  4Y7N H;  1L0W A;  1WYD A;  3CCJ A;  4IJH A;  5AJ3 L;  5ELO A;  4DR3 Q;  4JI7 L;  4ALP A;  4X66 Q;  4A93 H;  1EWI A;  3GD7 A;  1UE7 A;  2HHH L;  2K52 A;  3KDF A;  2R92 G;  1E7Z A;  4B3M L;  1NBW A;  4IJL A;  3JC6 6;  3F2B A;  4LF4 Q;  2F3I A;  4DAM A;  4R4T A;  4GKK Q;  3DLL A;  1X3F A;  1PH5 A;  1I6H H;  3OTO L;  1QUQ B;  1VQ9 A;  2ZJP A;  1NTG A;  1K9M C;  4LNQ A;  1GM5 A;  3K81 C;  5GAE C;  5LMN W;  1YVC A;  1HZB A;  2JJQ A;  1S72 A;  1OTC A;  2RF4 A;  2L15 A;  4BXX G;  3PUV A;  4JI0 L;  4OX9 L;  2MNA A;  5GQO A;  4DUY L;  2YYZ A;  4IPD A;  4NXM L;  1YJN A;  3HOW H;  5EAY A;  3HOV G;  1CSP A;  3GTM H;  1MKH A;  1N36 L;  1EFW A;  1FJG Q;  4BA2 I;  4HJ7 A;  5ELN A;  4DAY B;  3L0O A;  3KOJ A;  1N8R C;  5M5X H;  4A3J H;  2K50 A;  4KLK A;  1VQ8 A;  3I56 A;  2JA6 G;  2MO1 A;  1T9H A;  2HQL A;  4YHH Q;  3HOY G;  1CKN B;  4YY3 L;  1KXL A;  2JK8 A;  1PH6 A;  4JI6 L;  4JI3 L;  3CMA A;  2KBN A;  3GTO H;  4DUZ Q;  3HOZ G;  2Q2I A;  1QUQ A;  3G48 A;  3CCM A;  1VQM A;  2V1C C;  3HOW G;  2UUB Q;  3CCL A;  2A8V A;  1OXT A;  1GVP A;  1X6O A;  2UXC Q;  3J81 c;  3EBE A;  2JA7 G;  1BVS A;  2PMZ E;  4LFC Q;  4DV5 L;  1VQ7 A;  2JA9 A;  4YWL A;  3KLW A;  4KI0 A;  3G71 A;  5LMU Q;  3J7A 5;  1HNZ Q;  1WCM G;  3K80 C;  4DR2 L;  3CC4 A;  1VQE A;  2Q2H A;  3I4N G;  1HZ9 A;  1EIY B;  1G6P A;  4C3I H;  4LFB Q;  4JBW A;  2E5L L;  4DV0 Q;  4X64 Q;  1DGS A;  5FJ8 H;  3PV0 A;  3W1B A;  5IYC H;  3F2C A;  4B3T L;  4OO1 I;  3K7U C;  4GNX B;  1UEB A;  2N3S A;  1I94 L;  2N49 A;  4A3F G;  1VQD A;  1HZC A;  4A75 A;  1BBW A;  4JOI C;  4OON A;  3TQY A;  1HNW L;  3KFU A;  4XTC S;  2AHO B;  3NEM A;  1FVI A;  2YTY A;  4AYB G;  2UXB L;  1SN8 A;  1XNR L;  4YCU A;  4A76 A;  1OXX K;  3U4Z A;  1IBK L;  1TWH H;  2JA5 H;  1LM0 A;  1CSQ A;  3BZK A;  1PA6 A;  3NEL A;  4LF6 L;  4GLA C;  1N34 L;  3I4O A;  4DV3 Q;  4PZ7 A;  2XTI A;  2LXJ A;  4DV7 Q;  3HKZ G;  3E9I A;  4R1J A;  4BY1 G;  1KQS A;  4JCV E;  2D62 A;  1VQI A;  2E2I H;  4GOP A;  1VQA A;  5IY0 A;  3I4N H;  4BY7 H;  4UP7 A;  5IWA Q;  1YZ6 A;  4DV1 Q;  3CC7 A;  3M7N A;  3S15 H;  4DR6 L;  5C4X G;  2BA1 A;  1Z47 A;  3ULL A;  3HKS A;  1IBL L;  3HOX G;  1EIF A;  2KCT A;  4LF5 Q;  1TWC H;  5IYD G;  1PHJ A;  1TWF H;  1WFQ A;  2K5N A;  2JA7 H;  2VUM G;  1EYG A;  4LF9 Q;  4A3K G;  5IYB H;  3D0F A;  1L1O A;  3CXC A;  1VQB A;  1WI5 A;  2EXD A;  2MO0 A;  2Y0S E;  2Y0S G;  1KHI A;  2EIF A;  3PUZ A;  4OWT B;  3S2H H;  3CAM A;  2RHQ B;  4P72 A;  2PNH A;  1XMO L;  2JEB I;  5GRO A;  4X6A H;  1PYS B;  2B3G A;  2VQE L;  1MJC A;  4B3R Q;  2UXD Q;  4QGU A;  3RN2 A;  2YTV A;  2LSS A;  1GKH A;  1P16 A;  3PIO A;  2MQH A;  4IPH A;  2Q2U A;  2UUC Q;  4K0K L;  1Y1W G;  1G51 A;  1VQC A;  5IE8 A;  4BY1 H;  4P74 A;  2OCE A;  2OTJ A;  1UE5 A;  4GOP B;  1VQP A;  1Q81 C;  2KHJ A;  1XPU A;  1IBL Q;  4A3G H;  5IP9 H;  4DV4 L;  1M90 C;  5IWA L;  3I2Z A;  2K75 A;  1XPO A;  1VCI A;  2JA5 G;  4C3J H;  4LF7 Q;  3G4S A;  2VW9 A;  1V43 A;  2WAQ G;  4AYB E;  3LGJ A;  3H15 A;  3KF8 B;  1VQN A;  1VQO A;  4B3S Q;  4A3M G;  5IP7 G;  5FJ8 G;  4X62 Q;  1B70 B;  2KEN A;  2NZH A;  5LMN L;  2PQA B;  3M4Q A;  4GKJ Q;  1Q82 C;  1IXR A;  4JI5 Q;  3J80 c;  4R4O A;  1JB7 A;  3CP0 A;  4HJ8 A;  1XMQ L;  2UXB Q;  5JJK A;  4DK3 C;  3E9H A;  5K36 G;  3SGI A;  1YIT A;  2B29 A;  4MNO A;  2UU9 L;  2UU9 Q;  4JI4 L;  4A3B H;  4DR7 L;  4DR7 Q;  3OW2 A;  1XMQ Q;  1UE6 A;  3WWV A;  3H3V I;  4YWM A;  1Y1V G;  5FLM G;  3CD6 A;  4GKJ L;  4X62 L;  1E1T A;  1KAW A;  4DR1 L;  2IT1 A;  3HFZ B;  4JBJ A;  1D8L A;  4TVA B;  3AQQ A;  5IT9 c;  4X64 L;  4GLX A;  2ZTD A;  2D0P A;  3GTL H;  4A3B G;  4LFB L;  3PUY A;  4C2M H;  4BY7 G;  1PH1 A;  1ASZ A;  1C0A A;  1HH2 P;  3S16 H;  1HNZ L;  5E7N A;  1K3R A;  1VS0 A;  3CCS A;  3PCO B;  2I0Q A;  4JBK A;  1Q12 A;  1WJJ A;  2N78 A;  1CKO A;  1O7I A;  2QGQ A;  3A5Z B;  3MXN B;  4OWX B;  4AH6 A;  5JEA J;  5C4X H;  1SE8 A;  3NEN A;  4TQU S;  2ZJR A;  4IOC A;  1N9W A;  2JQO A;  5JEA G;  4DR5 L;  2Q2T A;  3ER0 A;  4EX5 A;  4UY8 C;  4L5Q A;  2QA4 A;  2UUA Q;  2OQK A;  2CWP A;  3J7Z C;  3G6E A;  3VDY A;  1BBU A;  4DUZ L;  1YNX A;  1OXS C;  3RNU A;  4K0K Q;  2AWN A;  1S3O A;  5GAD C;  4L5T A;  4JI6 Q;  4POG A;  4LUO A;  1CKN A;  3NBH B;  3S24 A;  2WB1 G;  5GAG C;  1YHQ A;  2H5X A;  2ZTC A;  3HOV H;  1XMO Q;  4R4I A;  4HIK A;  1Q46 A;  4X65 Q;  4OXP A;  1X65 A;  3J81 i;  3CF5 A;  2IHF A;  2PI2 E;  3MEF A;  4AIM A;  2FXQ A;  1V1Q A;  3CCR A;  4A3F H;  3TEH B;  1E22 A;  3CCE A;  1B8A A;  1WOC A;  1X54 A;  1K8A C;  1AH9 A;  1XPR A;  4LF5 L;  2I5M X;  4NXM Q;  1P8L A;  4DUY Q;  4YWK A;  4LUV A;  1BKB A;  2VQF Q;  1N32 L;  1VQ4 A;  3UE1 A;  3RN5 A;  2C35 B;  4PZ6 A;  2YU9 H;  4A3K H;  4LUZ A;  3CCV A;  2HIX A;  4AQY Q;  2NVT H;  2GVB A;  4XIG S;  4JI1 L;  1PH7 A;  4JC0 A;  2CKZ B;  4X65 L;  3S1M H;  1HZA A;  4LF6 Q;  3A74 A;  3RLN A;  4UP8 A;  3AYH B;  4GNX A;  1IBK Q;  2CQO A;  4A3I H;  1XNR Q;  3PUW A;  2NVQ H;  3ULP A;  5BR8 Q;  5GAH C;  4IO9 A;  3FHW A;  4NXN L;  4A3D G;  2IY5 B;  1S40 A;  2VL6 A;  5M5Y H;  1NMF A;  2JA6 H;  2NZO A;  2NN6 I;  1XNQ Q;  3JAM c;  4WJ3 M;  3TS2 A;  3CW2 C;  2K4K A;  2CFM A;  3ZJY C;  2XGT A;  3K8A A;  3CPW A;  4JBM A;  1IL2 A;  3UDF A;  1N33 L;  4DR2 Q;  4Y52 H;  1NJI C;  1YJW A;  1JE5 A;  3B6Y A;  4KHZ A;  2AKW B;  3KF6 A;  4JV5 L;  2N8N A;  2JA8 H;  1FL0 A;  4MZ9 A;  1JJC B;  1MIU A;  4IOA A;  4DR1 Q;  2JA8 G;  3M3Y H;  3PF4 A;  1KRS A;  2UXC L;  1H95 A;  3AFP A;  4IPC A;  1U0L A;  1HNX L;  3I7F A;  4NXN Q;  3F2D A;  1L1O B;  2D0O A;  1A63 A;  4HJ9 A; 
#chains in the Genus database with same CATH topology
 3P75 A;  1U4L A;  3CME A;  4DV6 H;  4RNM A;  1EIG A;  4TV9 F;  2DJG C;  1JOO A;  4H7B A;  2XIG A;  3L2P A;  3G6X A;  1AUV A;  2EVB A;  3T1Y H;  2F0G A;  4JYA H;  4BBS H;  5LXT F;  3V4Z A;  3RV4 A;  1K83 H;  4DV4 Q;  3MFI A;  4A3C G;  5M3F H;  2GPW A;  2FB9 A;  5FPR A;  1JJG A;  3G7L A;  3S1R H;  4RZR A;  4I4T F;  4ME5 A;  3TDQ A;  1W3S A;  2DPI A;  2F0I A;  3RR5 A;  3DM3 A;  1PVO A;  4NP5 A;  3HOZ B;  2UUC L;  1EZ1 A;  5DG9 A;  4IRK A;  4RMF A;  3R5X A;  3FKI G;  2ZM6 L;  1UC8 A;  1Z7T A;  2P5Z X;  2XD4 A;  2EYL A;  5EKL A;  3HOX H;  4JVZ A;  1I3Q B;  5FLM H;  4DR3 L;  4JI7 Q;  3I55 A;  1WTQ A;  5KFR A;  4QL5 A;  5I9P A;  2UUA L;  2ZT9 C;  4ED0 A;  5AFW A;  1K1Q A;  1VQG A;  1Q8I A;  4M1U B;  3I4M G;  1HA6 A;  2WDT A;  2YL2 A;  1S0O A;  4ILW A;  4LF8 L;  4DR6 Q;  1ENA A;  3W3A A;  2QIL A;  5CMD A;  2R7Z H;  3CQZ H;  5L1J A;  2A69 D;  5LOV F;  3NGD A;  1TWA A;  2F03 A;  1YJ9 A;  2DUD A;  4QIW E;  1F9R A;  5KIX A;  4RB2 C;  3AFQ A;  2VR1 A;  2DN8 A;  4RGN A;  3NWS A;  2R7D A;  4RUA A;  4OWW B;  5A2Q E;  4YR3 A;  4MV6 A;  1PXU A;  5KFT A;  1K0S A;  3R2T A;  5KFC A;  5K2M A;  2ES2 A;  2G5D A;  3C3L A;  3CRK C;  2AQ3 B;  1PRT B;  5A2Q L;  3K57 A;  1SE3 A;  1X9N A;  4B3S L;  3KAJ A;  4EGQ A;  4GN5 A;  4R4C A;  3HGB A;  5M3M B;  4L5S A;  2OT2 A;  1YI2 A;  4OO1 H;  3U4V A;  4CKE A;  2GLT A;  4A3E H;  3PUX A;  1XJV A;  2WAQ B;  4C3H B;  3HOX B;  1B6S A;  5KFS A;  3C46 A;  1WTO A;  4GZY C;  2Z6K A;  2HVS A;  2F1M A;  1KL9 A;  1EQT A;  4DV5 Q;  2CWA A;  2I07 B;  2RA4 A;  2SDF A;  1F2L A;  3MFY A;  3KHG A;  2JA6 A;  3PQI A;  3VMM A;  4ECS A;  5IP7 H;  3MXN A;  2Z9H A;  3BQ2 A;  4MV3 A;  2OF1 A;  2B8G A;  1TAE A;  4GN4 B;  1TWG H;  4DV2 Q;  4JI1 H;  2K5Q A;  1ZHS A;  2VUM B;  3L4J A;  1Y1V B;  2ZDH A;  2DPJ A;  3Q24 A;  1WD0 A;  4YHH L;  1SEI A;  3J7A F;  3NBH A;  1IW7 C;  3KLS X;  4DKA C;  1T3N A;  1W6J A;  4NXN H;  3RZD H;  4K5W A;  1FJG L;  1YHA A;  2OQ0 A;  3NQI A;  2R7Z B;  5G3L F;  3BDL A;  1QZH A;  1IOW A;  1FGU A;  1PFM A;  3PIP A;  4TV8 F;  4GN3 B;  2F0H A;  2CH4 A;  4A3L G;  5JUM A;  4UP9 A;  3R23 A;  3F1Z A;  5KNC A;  5CR3 A;  3U9T A;  1RIP A;  1QVC A;  3KHL A;  2ALZ A;  4KJN A;  1TWA H;  2SNS A;  3OYY A;  1FGB D;  2AMC B;  5C44 H;  1EL0 A;  2Q8R E;  4R8N A;  1Y1V A;  2B2U C;  3GTQ B;  2Z0S A;  1CQI B;  4HJA A;  1UE1 A;  1GSA A;  1S5E D;  1SFO H;  2E2D C;  5KFX A;  2FFK B;  2YU9 B;  2QK4 A;  3OWF A;  1KJ9 A;  5CA1 F;  2PMZ B;  4A3M H;  3FMA A;  1TVX A;  2OEO A;  3NTI A;  5C5M A;  5HBR B;  3RLF A;  1JOQ A;  4FS1 A;  1IBM Q;  2C2D A;  3MEH A;  4APV A;  4IUP A;  1HTL D;  3T1Y L;  3M4I A;  3BJY A;  2BQU A;  2OH2 A;  4PV1 C;  4TRD A;  2F0N A;  4IFD G;  4IN3 A;  1GSH A;  4YAJ B;  1EQR A;  5L1L A;  4ECW A;  3NBI A;  4A3B B;  3U9S A;  2FJ2 A;  3CKI B;  5KG1 A;  2W9A A;  3HOW B;  1QE6 A;  5I2X A;  4EFB A;  3H0G H;  4H44 C;  2Q8T A;  2G9H D;  2K1B A;  2BH2 A;  1XMO H;  1X55 A;  2E74 C;  1J5E L;  1J5E Q;  4A93 G;  1I4P A;  2YRX A;  4UCR A;  5KT4 A;  3HOU G;  5KFW A;  1E2Z A;  1E24 A;  3HKZ B;  1X3E A;  3LP8 A;  4FDB A;  4C3J B;  1BXR A;  4NLG A;  2GA4 B;  3E0J A;  3V96 A;  2UUA H;  4QQB X;  3T13 A;  4ZYS A;  1HNX Q;  5DM6 3;  2RVL A;  1LTL A;  3ULJ A;  5ISR A;  1PV4 A;  1EHI A;  5E1F A;  1DJR D;  1Q86 C;  1I50 H;  3V6K A;  4DV1 H;  2DGY A;  2Z6K C;  1U4P A;  1Z6H A;  2NBF A;  2V58 A;  1LTG D;  3NXW A;  2A6E C;  4HCS A;  3A54 A;  1F77 A;  4IRD A;  5C0X I;  1Z2P X;  1SMX A;  4J9P A;  4LF4 L;  1PTO F;  3J7Y W;  5IT9 E;  1L1O C;  5JVH 3;  3J81 E;  2F52 A;  3KJO A;  1KLG D;  4A3D B;  4AYB A;  1XMQ H;  1I50 A;  1ICF B;  1L0W A;  3WOF A;  4DAY A;  1JB3 A;  3QZ7 A;  3CCJ A;  4IJH A;  5ELO A;  2NVX B;  4C5C A;  4X66 Q;  4FXG C;  1X3P A;  1UE7 A;  2EYH A;  4GKJ H;  5C4H A;  2KED A;  1E7Z A;  1PYW D;  1NBW A;  4B3M L;  1SNC A;  1JDE A;  5CBE E;  3UI2 A;  3AU7 A;  4R4T A;  3DLL A;  2HCI A;  2QDL A;  2ZJP A;  1K9M C;  3H0G A;  2NTT A;  3EVQ A;  3K81 C;  2V4D A;  5GAE C;  4MTD A;  1STA A;  3MFH A;  4BXX G;  4JI0 L;  5GQO A;  2BOS A;  2KUM A;  4DUY L;  1EY4 A;  5HV6 A;  2HJW A;  3GTK A;  4DAY B;  3KOJ A;  4OIK A;  3RBE A;  3K3V A;  1VQ8 A;  3J80 E;  2O5I C;  3FPP A;  2JA6 G;  3T5K A;  1CKN B;  5EBD A;  4EQO A;  4C3I B;  1E2W A;  4MV7 A;  2SNM A;  4HNV A;  2JK8 A;  1PH6 A;  3VYU A;  5KFI A;  1LAC A;  3S2H B;  1S5D D;  4CBV A;  4CJ0 B;  3WNZ A;  1CQJ B;  2AQ2 B;  4RHR A;  3G48 A;  5J2T F;  2V1C C;  1FJG H;  1IYV A;  4IHJ F;  2A8V A;  5I47 A;  1OXT A;  1GVP A;  2L12 A;  4LF5 H;  5M5W B;  1GXD C;  1UUP A;  5M3F B;  5EOY A;  2R3Z A;  4MTK A;  1VQ7 A;  4YWL A;  5LMU Q;  3MR5 A;  2MUY A;  5JPM C;  4K6D A;  3FMC A;  3HEJ A;  3K80 C;  5EWG A;  4IR9 A;  3S9W A;  2SOB A;  1W6K A;  4DV7 H;  2DY8 A;  4LK1 C;  4EFE A;  3H3V C;  4DV0 Q;  4X64 Q;  5JOB A;  3JAM E;  3DWA A;  3QWN A;  2R7N A;  5IYC H;  4IUQ A;  4J9M A;  4EYH B;  3K7U C;  2VUM A;  2N3S A;  2N49 A;  4JK1 C;  1HZC A;  4WJW A;  2FIN B;  4OON A;  1CZG A;  1I4G A;  3TQY A;  1GHJ A;  2R8H A;  4M9U A;  3Q0A A;  2UXB L;  1SN8 A;  2JYO A;  4YCU A;  3U4Z A;  2R7M A;  3RZO B;  2DNE A;  1QOH A;  5CV5 A;  4CDC C;  3VYR A;  4DL3 A;  1DOL A;  3RB6 A;  4PZ7 A;  4YR0 A;  1TT2 A;  3GV6 A;  2MGS A;  3HS0 C;  5HGT A;  3MZ5 A;  3K58 A;  1KQS A;  1BCP C;  2D62 A;  2E2I H;  2W70 A;  2E2H B;  1N33 H;  3D6C A;  4C1N I;  2PQE A;  1BCP B;  1D5M C;  1BCP D;  5C4X G;  3S15 H;  2BA1 A;  1Z47 A;  2TSS A;  3PZP A;  2UXC H;  2K28 A;  1BNZ A;  3TIG A;  1KDA A;  4BY7 B;  4TSS A;  1EYG A;  4LF9 Q;  4A2A A;  4A3K G;  5IYB H;  3Q8R B;  1FNW A;  4ZOL F;  1L1O A;  2MJ8 A;  1VQB A;  2Y0S G;  3S2H H;  1KHI A;  3PUZ A;  2C5C A;  1RJT A;  2EIF A;  1WCM A;  2RHQ B;  4P72 A;  2PNH A;  1XMO L;  4KN4 C;  1PFB A;  4Q5V A;  2YZM A;  4X6A H;  1PYS B;  1O75 A;  1MJC A;  4J9L A;  4B3R Q;  1CZW A;  1TS5 A;  2BE5 C;  4QGU A;  2YTV A;  4K8I A;  4TKO B;  4IPH A;  1RDP D;  3JAM W;  1VQC A;  5IE8 A;  4BY1 H;  2OTJ A;  1BXT A;  2AQ1 B;  1GHK A;  3I90 A;  1UNN C;  3VR2 A;  1XPU A;  1BJT A;  5KG7 A;  5IP9 H;  4XZ3 B;  1B9M A;  3QZ8 A;  3I2Z A;  3JAM L;  5BN4 A;  2R8I A;  2HDM A;  1BR9 A;  2VW9 A;  1V43 A;  1I4H A;  1STH A;  4AYB E;  3TME A;  5C6A A;  5IP7 G;  3L4K A;  2KEN A;  2NZH A;  5LMN L;  2PQA B;  1Q82 C;  3J80 c;  1XMQ L;  3GTJ A;  5IIF A;  1OO9 B;  5JJK A;  1A3T A;  4FF4 A;  3A8K E;  5K36 G;  3SGI A;  1II3 A;  2B29 A;  2NYZ D;  2UU9 L;  2UU9 Q;  4JI4 L;  2YS6 A;  3PR5 B;  5KNB A;  3N41 B;  3OW2 A;  5FO7 B;  2KOL A;  5KT6 A;  3H3V I;  1UE6 A;  3GV8 B;  2XCA A;  2BR0 A;  3R3O A;  1HUN A;  2IT1 A;  2RDI A;  4Z9C B;  1AEX A;  4X64 L;  5IT9 c;  2WAQ A;  3GTL H;  4LFB L;  3PUY A;  5C3X A;  1CA5 A;  3EA6 A;  1SFO B;  4K8J A;  1KJJ A;  3DXJ C;  1VS0 A;  4JBK A;  4OWX B;  2N78 A;  1O7I A;  4DK0 A;  5JEA J;  4OX9 H;  1Z2O X;  4IOC A;  1DYQ A;  1ML0 D;  2H4O A;  3NK9 A;  5JEA G;  4DR5 L;  4UY8 C;  2R7L A;  5FD6 A;  1NR2 A;  1IOV A;  1N36 H;  1JC7 A;  2OQK A;  4DUZ L;  2RSN A;  4JI6 Q;  4POG A;  4F4Y A;  3NBH B;  2AGP A;  4IR1 A;  3GTP B;  2N88 A;  4XYM B;  1JWU D;  4X65 Q;  4OXP A;  1X65 A;  4K14 A;  1EZ6 A;  3N40 P;  5C5J A;  5JPN C;  2R6F A;  1YNJ C;  3GTL A;  5J22 A;  1WOC A;  1X54 A;  2EXZ A;  1XPR A;  2W6Z A;  2F0S A;  1P8L A;  1J9O A;  4KD4 A;  5FOB B;  4YWK A;  2I46 A;  3KBG A;  4UCS A;  1VQ4 A;  1VBG A;  4ZUI A;  4A3K H;  3VYS A;  5L9X A;  5ELF A;  3FPU B;  1PH7 A;  5I6Y A;  2E5L H;  1G2S A;  4DR4 H;  3A74 A;  1DOM A;  5D8D A;  4B3T H;  3AYH B;  5IGG A;  2CQO A;  2CH4 W;  3PUW A;  4FF2 A;  4EBE A;  1I94 H;  3ULP A;  2Q8I B;  1HNW H;  4A3E B;  5CV9 A;  4LH6 A;  5KFV A;  2EOT A;  4H13 C;  3GTL B;  1RKN A;  3KHR A;  4XT3 B;  3AMU A;  5A2Q W;  1NMF A;  4DXF A;  1XNQ Q;  3TS2 A;  3MHB A;  1HQM C;  2CFM A;  3ZJY C;  3GTG B;  2XGT A;  4ECU A;  3HXL A;  3CPW A;  4JBM A;  3UDF A;  4RKB A;  4DR2 Q;  1RJR A;  1JE5 A;  3I91 A;  5CGK A;  4PMC A;  4N9P A;  1S4Z A;  1FL0 A;  2ZXR A;  1JJC B;  1S10 A;  5I9O A;  2W9B A;  2H1E A;  1U0L A;  4ECV A;  2FK1 A;  5M5Y B;  1S5B D;  3C1F A;  3WOE A;  2CW0 D;  5BR8 L;  5ELD A;  1M1K C;  1CS0 A;  3JRW A;  4J0M A;  3UDG A;  2K5W A;  1Q1E A;  1SYD A;  2QF7 A;  3OIQ A;  1O78 A;  3FP9 A;  4P75 A;  4EBC A;  2JA8 B;  2VUM H;  1SYX B;  4LMQ D;  2K14 A;  4AQY L;  3WO1 A;  3H40 A;  2LY7 A;  2FMC A;  2WFW A;  1QNU A;  1Y69 U;  3KF6 B;  2D5D A;  5IGC A;  2QEX A;  1GJX A;  2UVV A;  1Y14 B;  5C3E B;  3HKZ E;  3D31 A;  2J6S A;  1VQK A;  4PDB A;  3GDE A;  2QKI C;  3MTS A;  5EPJ A;  2R93 A;  1W96 A;  3OUZ A;  3M4O B;  2UXD L;  2A19 A;  5LL6 S;  4A3L H;  5M5W H;  4HAE A;  1QVF A;  1EY9 A;  3EPI A;  2ALY B;  1G6Z A;  1W93 A;  4RGT A;  5C44 B;  2HIV A;  4J6H A;  4QB4 A;  4X66 L;  2M2L A;  2NN6 G;  4JI4 H;  4XT1 B;  4Q44 A;  4UPA A;  2F0K A;  4O3N A;  5FPO A;  3DHQ A;  4OEL B;  4DR5 Q;  3MR3 A;  3PW0 A;  3TP7 A;  5J39 A;  4U7C A;  3PO2 G;  4QW8 A;  1SXT A;  3J80 i;  5JVL A;  4RGM A;  2CVR A;  2KCN A;  4FYD A;  1G29 1;  1A3V A;  2PBZ A;  5COR A;  1VQJ A;  1H9J A;  3DUZ A;  4YCV A;  3PO3 H;  1AZP A;  4HIM A;  2VXW A;  3S14 H;  4JI2 Q;  4K2L A;  1VDZ A;  2B63 G;  1GO3 E;  2GPS A;  5D1O B;  1JLL B;  2I5H A;  4A3G G;  5KFE A;  1AE2 A;  1UWV A;  3I8Z A;  1HR0 Q;  1XNQ H;  2KEC A;  5KFF A;  4P2C B;  2AUK A;  4IAL A;  1E2V A;  3PO2 H;  1N48 A;  1S68 A;  4DK6 C;  1HNW Q;  1L0X B;  1JX4 A;  3S2D B;  1PRT D;  1I94 Q;  2RSO A;  4JI5 L;  4ZUJ A;  3GTP A;  1AN7 A;  2YYA A;  1F9P A;  4B3T Q;  5H1S E;  1V51 A;  1F2Y A;  4PQX A;  3M4O H;  3A0J A;  3NUC A;  2E5L Q;  4BWS C;  3KYH C;  3MWM A;  4MV8 A;  2UVW A;  3U50 C;  2J7Z A;  4FBT A;  4X3T A;  2FMA A;  3H4B A;  2NU6 B;  1I6H B;  1K8G A;  2HCC A;  1HR0 W;  3GTG A;  1FR3 A;  4R8U A;  3H3V H;  2C22 A;  3FDT A;  4C3H H;  1WVL A;  1J8I A;  1N32 H;  3KLR A;  2UUB L;  1VQL A;  1JIC A;  1X3Q A;  2NVX H;  2WV6 D;  5L1K A;  2A5H A;  5C5L A;  2R92 B;  4X65 H;  1LT4 D;  4DR4 L;  2DZD A;  2FPI B;  4R8I A;  4EVO A;  4FBU A;  1AP0 A;  1B33 N;  1C9O A;  3RLO A;  4JI6 H;  3GO5 A;  2JN4 A;  4CJ1 B;  1X32 A;  3QOJ A;  1VQF A;  4ED6 A;  1EYD A;  1N36 Q;  2OWO A;  1WCM H;  2PI2 A;  4PG3 A;  1EY7 A;  3GTP H;  1DV2 A;  3HOV B;  4J9K A;  2OXP A;  2GN5 A;  3OMC A;  3RZD B;  4IUR A;  3H20 A;  4G3I A;  3NWT A;  1QVG A;  3K0X A;  5KRU A;  3F2U A;  5EDW A;  4C3H G;  4Y8V B;  4FS2 A;  4NPS A;  3JAM i;  3LWB A;  5JH7 F;  3BQ0 A;  3R8B A;  4QF4 A;  4LJZ C;  4KJO A;  3K59 A;  4A3C H;  2CZG A;  5CB4 F;  4ZRZ A;  1K8O A;  4QY7 A;  2VS1 A;  5AJ3 Q;  4MAM A;  2ZXO A;  3M85 A;  2F0Q A;  3L9A X;  1EOT A;  4HYK A;  5M3M H;  5C4X B;  1YBY A;  1IBK H;  2GVA A;  4O4I F;  1QNK A;  4U68 A;  3MAQ A;  4J9R A;  4DV0 L;  4G57 A;  1EUD B;  4DAV A;  1M0T A;  1G8Z D;  1VKZ A;  3GV3 A;  3PGZ A;  3SK4 A;  3CCU A;  2R84 A;  4AQY H;  3GTQ H;  5FLX E;  1J6Q A;  1AFP A;  3G8C A;  1UNS A;  1T5X D;  3G6J B;  4BXX H;  2YTX A;  2W71 A;  2KVM A;  2YS7 A;  2R93 B;  3S1Q H;  3N6R A;  1HJP A;  4DPG A;  1PH8 A;  3CU7 A;  1T36 A;  2I80 A;  1IW7 D;  4L8J A;  1IYJ B;  3BS1 A;  4ED1 A;  1H9R A;  1HUM A;  3BZC A;  2K5D A;  1K0R A;  5FK9 C;  4K0K H;  4MTN A;  1IZ6 A;  3NHH A;  2R6G A;  2MCT A;  5KG2 A;  2E2H H;  4WFN 3;  1NY4 A;  1AE3 A;  1SND A;  3TRE A;  2FKL A;  2XIW A;  4GOP C;  1JJ2 A;  1HTP A;  3S1N H;  4LF8 H;  3GTK H;  1YHB A;  5F9L A;  1TWA B;  2RDF A;  3SK8 A;  5C4J H;  4GLV B;  1PZJ D;  3W5O A;  2IHE A;  1YIJ A;  1PH2 A;  2BCO A;  1ET9 A;  4RKL A;  1N33 Q;  4F4Z A;  1L2Z A;  3ICE A;  1VQ5 A;  2XGP A;  3OIP A;  5DLQ E;  1E1O A;  2JA6 B;  3V6H A;  1YNJ D;  1STN A;  2HHH Q;  2ZTE A;  1DOK A;  3DM1 A;  2XGQ A;  1ZEQ X;  3M7G A;  5DGA A;  2EY2 A;  1WYD A;  4G7Z C;  5AJ3 L;  3GIM A;  4OIJ A;  4DR3 Q;  4JI7 L;  2BDN A;  4JI5 H;  1EWI A;  1KDB A;  2L5T A;  2HHH L;  2R92 G;  4X62 H;  4LF4 Q;  2PCF B;  2O5J C;  3LWU A;  4DAM A;  4X64 H;  3OTO L;  1QUQ B;  2B2W A;  3CVZ A;  1B2T A;  1YVC A;  2EZV A;  1GSO A;  1OTC A;  1EYC A;  2RF4 A;  1SSO A;  2YCH A;  5CV7 A;  3PUV A;  4A3I B;  1H9K A;  4IFD H;  1EEI D;  2F0E A;  4KD3 A;  2LKV A;  3P1H A;  4IPD A;  4NXM L;  3HOW H;  5EAY A;  2W9C B;  3IG0 A;  1EFW A;  1FJG Q;  5FKA C;  3CQZ B;  4HJ7 A;  2K33 A;  5ELN A;  1T5E A;  2XWJ B;  2IPK D;  2B2T A;  2YW2 A;  4KLK A;  1I6U A;  4QWC A;  1PK8 A;  4B9W A;  3BG5 A;  5DG7 A;  5KG0 A;  4B08 A;  4YY3 L;  5KFA A;  1KXL A;  2YU9 A;  3MWY W;  1O7L A;  3FDS A;  2XCP A;  1D2B A;  1QWY A;  4MIU A;  3HOW G;  2R7Z A;  2FHT A;  4KY5 A;  3CCL A;  1S97 A;  1HRJ A;  3DF7 A;  4WD3 A;  4KHV A;  3BAB A;  4PMB A;  3PW7 A;  3X3M A;  4DV5 L;  4ECX A;  5FO9 B;  3KLW A;  3PMF A;  3G71 A;  3J7A 5;  2K7V A;  1WCM G;  4E6I A;  4DR2 L;  3CC4 A;  1HZ9 A;  1G6P A;  4FM9 A;  2RQX A;  2FJZ A;  4C2M A;  4DV3 H;  5FJ8 H;  5IYZ F;  2D2C C;  2A73 B;  4C5B A;  2K32 A;  3T56 B;  1M4V A;  1UEB A;  2MHV A;  5KFZ A;  1LT6 D;  3R2I A;  5JAV A;  1BBW A;  2DY7 A;  4JOI C;  4ZLT F;  1HNW L;  3OPO A;  5CAE B;  4XTC S;  2AHO B;  2EYF A;  1FVI A;  3NEM A;  4UHV A;  3SK5 A;  2PMZ A;  3WDN A;  1CSQ A;  3BZK A;  4LF6 L;  1SJH D;  3GIK A;  4DXG A;  5FLX L;  2MPM A;  3GTO A;  2R8K A;  4DV3 Q;  2C9O A;  3SI8 A;  4QWE A;  2XTI A;  2LXJ A;  2F0U A;  3HKZ G;  4R1J A;  3K5I A;  1QB5 D;  1VQI A;  1VQA A;  5IY0 A;  2M00 A;  1EU4 A;  4JPB W;  4J8Q A;  4DV1 Q;  5JJI A;  4ZI7 F;  4DR6 L;  2W6M A;  4RAU C;  2A68 C;  1I4R A;  1IBL L;  2KCT A;  2LFN A;  1TS4 A;  4HSP A;  4DF7 A;  5IYD G;  1HNX H;  1WFQ A;  1A15 A;  2F0F A;  1CQV A;  1E4E B;  2EY6 A;  1EUC B;  1WI5 A;  3SEB A;  1IHZ A;  1CTM A;  5EWE A;  2EYP A;  4R9W A;  4LAA A;  4A2B A;  5GRO A;  1J5E H;  1M8A A;  3GTJ B;  3S16 B;  3GV5 B;  1I7L A;  2HVR A;  1EQV A;  3RN2 A;  4RCN A;  2KHS A;  4MA5 A;  2MQH A;  5CA0 F;  1PX2 A;  1Y1W G;  2NUA B;  1G51 A;  3M4Y A;  5EWF A;  1R9T A;  2W8L A;  1M6V A;  1GUG A;  1V1P B;  1K83 B;  5IGF A;  2KHJ A;  4A3G H;  4UCO A;  4DV4 L;  5M5X B;  1D6E C;  5IWA L;  4F88 A;  3JSN A;  1VAJ A;  3G4S A;  3PW2 A;  2WAQ G;  2AGQ A;  3M9M B;  1IBM H;  2NN6 H;  5IOD A;  4DL2 A;  1RF2 D;  1I7N A;  5L37 A;  1WCM B;  4HED A;  4X62 Q;  4LF4 H;  2LS0 1;  2B2Y C;  2B2T C;  4JI5 Q;  1KJI A;  1PTO D;  5JQW A;  1RYR A;  4DR3 H;  2M05 A;  4A3B H;  1YIT A;  3RB0 A;  5E4W C;  2F0W A;  1EIH A;  4EBD A;  5EKI A;  4O4H F;  5FLM G;  2HHH H;  5DQI A;  1KAW A;  3HFZ B;  4NW2 A;  4F7X A;  1TII D;  4TVA B;  3MJF A;  2ZTD A;  2D0P A;  3DWP A;  3KTM A;  4ED3 A;  5CBA E;  3BDC A;  1C0A A;  1XWE A;  3S16 H;  1CFM A;  5E7N A;  3DWQ A;  3CCS A;  3PCO B;  4LF8 Q;  2EY1 A;  4K5X A;  1Q12 A;  1WJJ A;  1CKO A;  3A5Z B;  2Z8L A;  3MXN B;  5C4X H;  2VUM G;  4IAJ A;  5KG3 A;  4DFA A;  2XVS A;  4TQU S;  4UFZ A;  1N9W A;  2JQO A;  2BDO A;  3CQZ A;  3ER0 A;  1RYS A;  4L5Q A;  5F2D A;  3VDY A;  4CDD C;  1YNX A;  1OXS C;  4K0K Q;  3HBL A;  3JRX A;  2UVU A;  4KY6 A;  2F0D A;  1ONL A;  3IKJ A;  3VR5 A;  3S24 A;  2WB1 G;  1TS3 A;  1YHQ A;  2W6O A;  3O13 A;  1NR4 A;  1Q46 A;  2B39 A;  4LH7 A;  4BY1 B;  2IHF A;  1AUX A;  1BDO A;  3NTH A;  2CW7 A;  2FXQ A;  1V1Q A;  4G7H C;  1XDN A;  1E22 A;  3CCE A;  4O42 A;  4Q8F A;  2DLN A;  1WTV A;  3T51 B;  1HXY D;  4LUV A;  4N8X 1;  3EFX D;  1O7Y A;  1DXM A;  4DV5 H;  4YBZ B;  3UE1 A;  2RDH A;  4PZ6 A;  3N8D A;  1M7J A;  4CC6 A;  4AQY Q;  2FLL A;  2HIX A;  4IZO A;  3RAX A;  2R87 A;  3Q22 A;  4DNR B;  4X65 L;  2IJ0 A;  1HZA A;  3MR6 A;  4UP8 A;  4FXD A;  4F87 A;  4GNX A;  1IBK Q;  1WTW A;  3A7L A;  5KG5 A;  1JR0 D;  3J80 L;  3R5F A;  3TBI B;  2JA5 B;  4IO9 A;  4MHE A;  4WOR A;  1F2M A;  1FD7 D;  2L9H A;  1S40 A;  3V6J A;  1Y8N B;  4NMZ A;  1F2Z A;  5TSS A;  2JA6 H;  4Q0F A;  3JAM c;  4WJ3 M;  1XXG A;  3CW2 C;  5KFN A;  2W6P A;  3K8A A;  1EWH A;  3TQT A;  3VR6 A;  5KT5 A;  1IL2 A;  5CV8 A;  5BPF A;  1NJI C;  1YJW A;  3B6Y A;  4KHZ A;  4UCT A;  1EFI D;  3KF6 A;  1GUW A;  2N8N A;  2K04 A;  4MZ9 A;  4F4W A;  4DR6 H;  4QMG A;  3M3Y H;  2JA8 G;  1BCP F;  4QIW A;  1KRS A;  3R5H A;  2FPG B;  4FNF A;  1HNX L;  1RJQ A;  2X69 A;  4ME6 A;  1JOK A;  4RB3 C;  3TN2 A;  2D0O A;  4IWX A;  2JA5 A;  2BE5 D;  2BH8 A;  5C0X G;  3E5N A;  1A62 A;  2PQA A;  1SNO A;  1GD7 A;  4G7O C;  5IGE A;  1JMC A;  4YCW A;  4X3U A;  3Q8D A;  5IT9 W;  3OHA A;  3PF5 A;  1SAP A;  1XTD A;  3M9N B;  5JEA H;  4K5V A;  1N32 Q;  5T14 A;  2DIK A;  2VQF L;  4O2B F;  2WTF A;  3PN1 A;  3LNN A;  4DV4 H;  5JVD F;  4MV9 A;  4XDX A;  1KC7 A;  1L2F A;  4JYA Q;  4HMJ A;  3T1Y Q;  2JE6 I;  2ICI A;  5EJW A;  4E4T A;  1DD2 A;  4J9O A;  4GKK L;  3QOL A;  1B4O A;  1G2T A;  3M9O B;  4YQW A;  3Q2O A;  4KN7 C;  4LWC A;  5IYD H;  3IN5 A;  3T4A C;  5KYI A;  2R7K A;  4BBS B;  1IYU A;  3H0G G;  1A6X A;  3KBX A;  5CV4 A;  4FF3 A;  2E2I B;  2HT1 A;  1S5F D;  1ZET A;  4KKT A;  3S15 B;  1PRT F;  1HR0 H;  2R85 A;  3VR4 A;  1KLU D;  4ZKC B;  2RHS B;  1K83 A;  1STB A;  4DV1 L;  1QZG A;  3RD4 A;  5L1I A;  1I5F A;  4JI2 H;  1SFO A;  2W6N A;  1EUJ A;  4ODG A;  2UVR A;  3CPF A;  4FF1 A;  5C4Z A;  2ZJQ A;  1YEZ A;  5M3M G;  5DLG A;  3GII A;  4HIO A;  2KCC A;  2BA0 A;  4DR5 H;  1JWS D;  2JEA I;  3I4M H;  3GV7 B;  4JI4 Q;  3UE0 A;  5ELB A;  4BWG B;  4GNX C;  2B63 A;  2AGO A;  1PRT C;  2PW5 A;  4BA1 I;  2RCF A;  3J81 L;  2NVX A;  4Q0Y A;  5IYB G;  4KHP L;  3IFD A;  3RF2 A;  3TII A;  1ZYR C;  3CRL C;  2WKD A;  2SCU B;  3S2D H;  4HQ6 A;  3RB4 A;  5KND A;  4RG1 A;  1CHQ D;  4A4I A;  3LWE A;  2I5L X;  2ZDG A;  1RCV D;  2V59 A;  1KNE A;  1ESF A;  2VQD A;  2XWB B;  3A5U A;  3SE7 A;  3KAK A;  5C44 G;  2O2L D;  3W1G A;  2W8K A;  4DUY H;  1TQO A;  3BJU A;  2F3V A;  3NSW A;  1V8Q A;  4I7H A;  4Q45 A;  4A3F B;  1Q7Y C;  2P0A A;  3J7A K;  3K6O A;  4IUT A;  3GTK B;  3I3C A;  1RK5 A;  4OL7 A;  4B3R L;  4C3J G;  5DGB A;  3PR4 A;  4JOI A;  2AWO A;  3Q6S A;  5C0X J;  5C3E G;  4QCL A;  2RCN A;  5LHY 1;  2WP8 J;  1KNA A;  3J81 j;  3K5N A;  2B63 H;  1KAB A;  3E5S A;  3OHB A;  2B2U A;  2ASJ A;  4K2K A;  3PO3 G;  5C3W A;  5KFB A;  1O80 A;  3MWD A;  2MP1 A;  4A3G B;  2F0M A;  4OGQ C;  5EBC A;  2R92 H;  1Y1W H;  2FE3 A;  4R8U B;  1SYC A;  3HOY B;  1VF7 A;  4L6T B;  4RWS C;  1TWF A;  4DR2 H;  4I50 F;  1SNQ A;  4ECQ A;  1RJP A;  1RL2 A;  1HPC A;  5CV6 A;  3OTO Q;  2J0T D;  1Q1B A;  1HCZ A;  1K73 C;  4DV3 L;  1PH9 A;  3TSS A;  3ETJ A;  3UFX B;  5LYJ F;  3PO2 B;  1VBH A;  3D4R A;  4IPG A;  1KIX A;  4B3M Q;  1TWH A;  4TUY F;  3A7A B;  5BMV F;  1KD1 C;  3KJP A;  1C48 A;  2KHI A;  5JJZ A;  2VUG A;  3MXG A;  3DMU A;  1A9X A;  2FLN A;  3TP5 A;  3ORR A;  4CDE C;  4DV6 L;  4R4Q A;  2ASD A;  3RZO H;  1ENC A;  3UDI A;  3RUP A;  4DR4 Q;  1EY5 A;  4RH6 A;  3V05 A;  4JI8 Q;  4LW1 A;  1NMG A;  4HNT A;  4DV2 L;  1E3P A;  4BBR H;  1CHP D;  2IW3 A;  4L1K A;  1UC9 A;  2EPB A;  4JYA L;  5IP9 G;  1B44 D;  2EDG A;  1NUC A;  4H02 A;  4L63 B;  1JQY D;  1S9F A;  3GTM A;  2K5V A;  2VZA A;  5D1O A;  5KG4 A;  1B3A A;  2QEJ C;  2EY5 A;  1JCK B;  2B2V C;  2R7Z G;  3VPC A;  2W9B B;  3OSP A;  2B2Y A;  1DV1 A;  2AQ4 A;  3NPP A;  4LMY A;  1WTH A;  5EPL A;  5NUC A;  3X3N A;  1SJE D;  5HGQ A;  2Z1C A;  1I3Q A;  3TP8 A;  3RGX A;  3FKI H;  4ZQI A;  3BVZ A;  4DNI A;  1MJE A;  3T53 B;  4O2D A;  4RHS A;  3T1H L;  1KJ8 A;  1EU3 A;  3ERS X;  3ND9 A;  3V4S A;  1WSC A;  1LO5 D;  5D3I B;  4OX9 Q;  4PWQ A;  1JIH A;  4XYO A;  4F4X A;  3IFT A;  1C8C A;  3C2P A;  1BGW A;  2WB1 A;  4JV5 Q;  3CC2 A;  3A56 A;  1JE4 A;  1LUZ A;  2X0S A;  3UDX A;  1BQQ T;  2R82 A;  3H0G B;  1QIL A;  5I6W A;  4BBS G;  1D7Q A;  2E2J H;  3IRB A;  1IBM L;  1KRT A;  1IKL A;  5M3F G;  1JT8 A;  1Y8P B;  1E4E A;  2IA6 A;  4JI8 L;  1Q8K A;  4P71 A;  3OSO A;  1PYB A;  3MA2 B;  1GOZ A;  1SE4 A;  2L11 A;  3L7Z C;  3STB C;  4DGZ A;  5EZY F;  1EOV A;  1U5K A;  4Y7N H;  1AZQ A;  5KEE A;  4IUV A;  4MV4 A;  2UU9 H;  3RV3 A;  3BYY B;  4CJ2 C;  4ALP A;  1JXL A;  4A93 H;  3GD7 A;  2JA7 A;  2PVP A;  3FKI A;  4IJL A;  1LT3 D;  3JC6 6;  3MR2 A;  4WBN F;  1K1S A;  3NTK A;  4YJ2 F;  3DEP A;  2BQ3 A;  1PH5 A;  4LFB H;  3J7A V;  1VQ9 A;  3QB3 A;  1NTG A;  1L0Y B;  2RBM A;  4LNQ A;  1GM5 A;  4DLK A;  1HNZ H;  4QW9 A;  2A69 C;  2JJQ A;  1S72 A;  3LML A;  4ZHQ F;  1ICW A;  2YYZ A;  3D4D A;  2VA3 A;  1YJN A;  3GTM H;  2K6A A;  1GYF A;  5KFH A;  1N36 L;  4BA2 I;  1RTO A;  3PO3 B;  4DUZ H;  3ND8 A;  2ENB A;  1C4Q A;  3RUZ A;  5M5X H;  1LTR D;  4MTE A;  4B3R H;  1DM0 B;  3H6M A;  3DEO A;  3BVM A;  3I56 A;  3K5L A;  2MO1 A;  1T9H A;  2HQL A;  4YHH Q;  3HOY G;  5EPK A;  3ERO A;  3KK7 A;  3TZD A;  3FRP B;  4JI6 L;  2FPP B;  1LTI D;  4KKS A;  5KFK A;  5T1G A;  4JI3 L;  3CMA A;  2KBN A;  1A2T A;  1MGS A;  1K28 A;  2Q2I A;  2XSC A;  1QUQ A;  3CCM A;  1VQM A;  3HOZ G;  4LF9 H;  2UUB Q;  2Z4I A;  4HR7 A;  1X6O A;  1BUV T;  4CHT B;  1LTB D;  2UXC Q;  2JA7 G;  3HZX A;  4LFC Q;  3ZYY X;  1F9Q A;  4MA0 A;  1ULZ A;  2FMM A;  3I12 A;  2KA7 A;  4RA8 A;  2Q2H A;  2C2R A;  1EIY B;  2HVQ A;  4DL5 A;  3MVV A;  4C3I H;  2E5L L;  3D6W A;  4ZCK A;  2RKS A;  2TMP A;  3OUU A;  4JV2 A;  4RUC A;  2R92 A;  2PZW A;  4GNX B;  3W2D A;  4A3F G;  4A75 A;  4N8F A;  1S03 G;  3KFU A;  1H9S A;  2XCL A;  4AYB G;  3GQB A;  3QO2 A;  4TQR A;  4HR7 B;  1TWH H;  1LM0 A;  4B9X A;  1C3O A;  1PA6 A;  3K0Y A;  4UCV A;  1N34 L;  3IAY A;  3I4O A;  4DV0 H;  4DV7 Q;  3KHH A;  4BY1 G;  4JCV E;  4IQZ A;  1ZXT A;  4UAI A;  2WYO A;  1S0M A;  3EPG A;  1CA6 A;  5KT2 A;  3I4N H;  1D5Z C;  5LMU H;  1O7Z A;  1TWF B;  4UP7 A;  4UDU C;  5IWA Q;  3M7N A;  2WB1 B;  5EKK A;  3ULL A;  3G6Y A;  2R8J A;  2NVY B;  3HKS A;  3GIL A;  4WRD A;  4LF5 Q;  1ZQ7 A;  2G9D A;  4ABN A;  1OWT A;  2K5N A;  1S5C D;  2JEG A;  4F8M A;  1DZ1 A;  4CDF C;  2IX3 A;  3CXC A;  2Y0S E;  2EXD A;  4ZK9 B;  4MV1 A;  4OWT B;  1SCU B;  4I7A A;  3CAM A;  1ESR A;  1EY0 A;  1I4Q A;  4XQQ A;  2B3G A;  4I7Z C;  3N52 A;  2UXD Q;  2LMC B;  2ASL A;  2A74 C;  2PNR C;  4RZQ A;  2LSS A;  1P16 A;  2UUC Q;  2ZDQ A;  1PZI D;  5DQG A;  1Y8O B;  5BPH A;  2F4V H;  3T1H H;  4EQN A;  4P74 A;  2OCE A;  2X6G A;  1MZB A;  2E2H A;  1V1O A;  1VQP A;  1Q81 C;  4LFA H;  3M3Y B;  1IBL Q;  2EJF C;  4A3J B;  1M90 C;  3BAA A;  5F9N A;  1VCI A;  4C3J H;  4M8A A;  3SE0 A;  3C1E A;  2HD3 A;  2XN9 C;  3LGJ A;  3H15 A;  5KFM A;  3GIJ A;  3T16 A;  3BA8 A;  4UCU A;  3KF8 B;  1VQN A;  2ZM6 H;  1SBB B;  3OW7 A;  5FJ8 G;  4A3M G;  1B70 B;  1N34 Q;  4QWB A;  4GKJ Q;  1NAP A;  3F8N A;  3URY A;  1I50 B;  4ECZ A;  1JB7 A;  4R4O A;  4FU0 A;  3CP0 A;  2NU9 B;  4X66 H;  2UXB Q;  3RJ0 A;  1PMR A;  4DK3 C;  3HKZ A;  2PZU A;  4IZ8 A;  1XMQ Q;  4EGV A;  4YWM A;  1Y1V G;  2XC9 A;  4GKJ L;  5KFY A;  4EG0 A;  2R61 A;  2B2V A;  3GLK A;  4CGY B;  1D8L A;  4IRC A;  2L1B A;  3LX0 A;  4GLX A;  3N6X A;  4LSA A;  4C2M H;  4BY7 G;  3ONA B;  5DG8 A;  1PH1 A;  3MWE A;  1FNV A;  1HH2 P;  1F9S A;  4JUZ A;  1ET6 A;  1HNZ L;  1Q3L A;  1K3R A;  2I0Q A;  2QGQ A;  1CM9 A;  3PIP 3;  3NEN A;  2PYK A;  5DNF A;  2Q2T A;  4EX5 A;  4C56 C;  2EYM A;  2QA4 A;  5EGT A;  2UUA Q;  4QWA A;  2CWP A;  1BBU A;  4AYB B;  1TY2 A;  3RNU A;  3BA9 A;  2AWN A;  1S3O A;  4IWY A;  4L5T A;  1WR2 A;  4LUO A;  2H5X A;  4C5A A;  4DK1 A;  4ECY A;  5IGD A;  1XMO Q;  5LP6 F;  4XYL B;  4R4I A;  2V4R A;  3J81 i;  3RBD A;  4I55 F;  3CF5 A;  1TKW B;  2PI2 E;  5EQ0 A;  4C1N K;  1T94 A;  3MEF A;  2NU7 B;  4KMU C;  1NNX A;  3TEH B;  4DA2 A;  4ECR A;  3SDZ A;  1AH9 A;  3D3R A;  4ULL A;  2I5M X;  4NXM Q;  3G6V A;  1BKB A;  1GUT A;  1WTP A;  3T5L A;  2EE1 A;  3L3O C;  1SMY C;  3RN5 A;  2C35 B;  4XYQ A;  2YU9 H;  4ETS A;  5CYU A;  3A8J E;  2NVT H;  3TZU A;  2GVB A;  4XIG S;  2Z6B A;  2NVQ B;  2JEF A;  1B1Z A;  2CKZ B;  3S1M H;  2F4I A;  3Q8Q B;  3IL8 A;  1VF5 C;  3RLN A;  1EZ8 A;  1E4G T;  4Q8E A;  4O3O A;  4A3I H;  5KT7 A;  1KJQ A;  3SXH A;  3RB3 A;  4NXN L;  4A3D G;  4X3S A;  2O4X A;  1B6R A;  4EEY A;  2NN6 I;  4FVM A;  1K3B C;  3MXU A;  1SNM A;  3HOU B;  4EYI B;  5E3F A;  2QW7 A;  3OWE B;  4XQJ A;  1QCB D;  5IGB A;  4TQS A;  2AU0 A;  1N33 L;  3V2T A;  3A55 A;  4Y52 H;  4R7R A;  4N9T A;  1MI2 A;  5M9O A;  5I2Y A;  3VYT A;  2J6U A;  1MIU A;  1KDC A;  4DR1 Q;  2NTS A;  3K5M A;  2UXC L;  4I65 A;  2YRW A;  3AFP A;  4NDX A;  4H0L C;  3I7F A;  5A35 A;  4NXN Q;  1L1O B;  3FEW X;  1A63 A;  4HJ9 A;  3BU2 A;  4S3S A;  5K5P A;  2FK2 A;  4BBR G;  2R7F A;  2YV5 A;  3TRZ A;  3K5O A;  1UEA B;  2CW0 C;  1VMC A;  5LMN Q;  2ATL A;  2VQE H;  2VY3 A;  2IL8 A;  1HQR D;  3CHB D;  5HY6 A;  4JI1 Q;  3HOZ H;  2HUG A;  1Z2N X;  4RAZ A;  3HB9 A;  3S1M B;  4DV2 H;  3S1Q B;  1R9T B;  4J9S A;  2E8G A;  3GTO B;  1RD9 D;  1SLJ A;  2F4V L;  4A3I G;  2BQR A;  3RMH A;  1A8V A;  3K5H A;  3VR3 A;  2WE6 A;  2D9U A;  5IT9 L;  1C30 A;  1CKM A;  2Y0S A;  1SRU A;  1DIK A;  3TS0 A;  2RDG A;  4QUF A;  5JVG 3;  1SE2 A;  4YJ3 F;  1X3G A;  4DL6 A;  3BYT B;  2F0L A;  4RB0 A;  4O3P A;  1EQQ A;  5KFQ A;  4HCE A;  3OSN A;  4NKL A;  4EQ5 A;  3HOU H;  2RGR A;  3K7A B;  2J9G A;  1Y1W B;  2JP1 A;  2CW8 A;  2R93 H;  2EYO A;  2VQE Q;  2WB1 E;  3GID A;  5C1P A;  5LMN H;  4ZQ3 A;  3PSI A;  4ME3 A;  4EQP A;  1SYB A;  2R8G A;  1PDQ A;  1BBX C;  1TY0 A;  1Y1V H;  4IFD I;  2VPQ A;  3OMG A;  4HNU A;  2JEJ A;  1STE A;  3EN2 A;  3GIP A;  1PFN A;  2PZT A;  2N55 A;  2CQA A;  4O3R A;  1CI3 M;  1KC8 C;  1U4R A;  2ATW A;  1R4P B;  1PH4 A;  1LTA D;  3R93 A;  1DON A;  4DR1 H;  1V1P A;  3KLS A;  5FLX c;  4O4L F;  2C00 A;  4IFD J;  2C2E A;  1A3U A;  4APM A;  5KFJ A;  3EIV A;  2DWC A;  1W2B A;  3Q8P B;  3EYY A;  4DL7 A;  1OXV A;  1GUO A;  4JG2 A;  1SRO A;  3JZI A;  5C4J B;  1OXU A;  1CUK A;  2DJF C;  4GS3 A;  3KF8 A;  5GON F;  1VQH A;  1D1I A;  3PIO 3;  2WAC A;  1LYL A;  3T5H A;  4JI7 H;  1JWM D;  3ERQ A;  1TWG A;  1R9T H;  3SK6 A;  1C7Y A;  2ZJT A;  3NP8 A;  2B8F A;  4J15 A;  4KTA A;  1TU2 B;  3STB D;  1KEE A;  1S0N A;  1WTX A;  3H91 A;  2R93 G;  2QYZ A;  4O0A A;  3OHX C;  4LF7 L;  5KT3 A;  3KXY T;  1ILQ A;  1ASY A;  4A3E G;  2K03 A;  5KX5 F;  2A6E D;  2JXM B;  2EQS A;  4LFC L;  2NVY H;  3K7A H;  3E0E A;  1CQF A;  1BF4 A;  4J9Q A;  4NXM H;  4JW0 A;  1HFG A;  2YZG A;  4C2M B;  1TXY A;  5K36 H;  3RAQ A;  3E6Z X;  2F0V A;  4ID6 A;  5H80 A;  1TR5 A;  4J9N A;  1TA8 A;  1X56 A;  1IKM A;  3OOC A;  1TWC A;  3TQ1 A;  4FO2 A;  3CCQ A;  4CC5 A;  4CKB A;  1VQ6 A;  4DV6 Q;  2MFI A;  4PNY A;  5C1O A;  1H9S B;  2A1A A;  3KDF B;  1PTO C;  4U67 3;  3RTX A;  2IX0 A;  3ETH A;  1EY6 A;  3M9B A;  4LF9 L;  2ID0 A;  5ELE A;  1PTO H;  3GTG H;  3F8T A;  4PZ8 A;  1PH3 A;  4HJ5 A;  5J3B A;  4P73 A;  1I6V C;  4WJ4 A;  2NZ1 D;  1RK6 A;  5J2U F;  3PW5 A;  5G3L D;  1JDB B;  4A93 B;  5D65 A;  4OHJ A;  2OLS A;  2K5H A;  3PVX A;  5FLX W;  4OO1 G;  4DV7 L;  2LXK A;  3N42 B;  3RGZ A;  3N43 B;  1I3Q H;  3QJY A;  1A0I A;  1RHP A;  4PMW A;  4POF A;  3I4M B;  5KFU A;  2Z4H A;  4L5R C;  1E0B A;  1UAP A;  3I70 A;  1Z9F A;  5DEH A;  1N56 A;  4V0B A;  5DQH A;  2OTL A;  3S17 H;  2A6H D;  3ORQ A;  5ELC A;  3BQ1 A;  1SR3 A;  4DU9 A;  4A3J G;  4A3D H;  5BR8 H;  3U58 A;  2O03 A;  2WKC A;  2UXB H;  4QJF A;  1XNR H;  3HP3 A;  1FYC A;  4LF6 H;  1N34 H;  2ZM6 Q;  5JJL A;  1K8M A;  4DAP A;  2A68 D;  2PW7 A;  5C3E H;  5D3D A;  5LMU L;  4V19 0;  4BBR B;  1KBL A;  2ASB A;  2VQF H;  2CCZ A;  2NB0 A;  1IBL H;  2IX1 A;  3GTJ H;  4LFA Q;  1ILP A;  1ZHQ A;  2F0P A;  2VNU D;  3T1H Q;  2F4V Q;  4HTH A;  4JI3 Q;  1B7Y B;  1XX8 A;  1NCV A;  2F0T A;  5LL6 b;  2UUC H;  2UXD H;  5IYC G;  5C8Y F;  4YY3 Q;  3U9O A;  3AEV A;  1B50 A;  4DL4 A;  3M4P A;  5COY A;  1PTO B;  4KHP Q;  1EEF D;  2B63 B;  1BO0 A;  1H9M A;  5DLF A;  2A6H C;  2KCM A;  2CQY A;  3NQT A;  1E4F T;  2VB3 X;  2WAQ E;  2FP4 B;  3GTQ A;  1B53 A;  2NVT B;  4KV6 A;  2R86 A;  2V9W A;  3FKI B;  4JI0 Q;  4LFA L;  1U4M A;  1HR0 L;  3HOY H;  4CKC A;  1SYG A;  4NB3 A;  3VA7 A;  1WTR A;  4M7E A;  5IWA H;  4JV1 A;  2HQE A;  3EJI A;  1PFS A;  4JI2 L;  2X6L A;  5D1P A;  3QFF A;  3S17 B;  4JV0 A;  4O3Q A;  1EY8 A;  1V9P A;  2WII B;  4HID A;  1XNQ L;  4ED2 A;  2E2J B;  4O2A F;  3BVG A;  2L4N A;  1NE3 A;  4OEM B;  2VPS A;  4DR7 H;  3S14 B;  3SVM A;  2HDL A;  4ZKB B;  1TWG B;  4F50 A;  3S1N B;  1ROD A;  2E2I A;  5DM7 3;  2K52 A;  3KDF A;  5KGU A;  4B3S H;  3F2B A;  1GUN A;  2F3I A;  1MD2 D;  4A3K B;  4GKK Q;  1X3F A;  1I6H H;  3BG3 A;  4LF7 H;  1D1K A;  2QDB A;  2IP4 A;  4Y7N B;  5LMN W;  1HZB A;  5D14 A;  5DAU A;  4Q43 A;  2L15 A;  4YIJ A;  2HGS A;  4LFC H;  1VMP A;  4RFB A;  4OX9 L;  2MNA A;  1HHV A;  1GGO A;  3HOV G;  1HFN A;  3P7J A;  1CSP A;  2UUB H;  1MKH A;  5BN5 A;  2IMW P;  1N8R C;  3L0O A;  4QUC A;  5J1Z A;  1SNP A;  4A3J H;  2K50 A;  3MXP A;  1TWC B;  3GP7 A;  5LA6 F;  1HA5 A;  4YHH H;  4YB8 B;  4RGO S;  1B3Q A;  3GTO H;  4DUZ Q;  3KAL A;  1SEB D;  3BZD B;  1SYE A;  4KK7 A;  1STG A;  1LV9 A;  5CC4 A;  4A3M B;  4RNO A;  3J81 c;  3EBE A;  2NUC A;  3I73 A;  3UQ8 A;  2JSO A;  1BVS A;  2PMZ E;  1B04 A;  1R4Q B;  5HUR A;  2JA9 A;  4ECT A;  4KI0 A;  1HNZ Q;  3T5J A;  4YR2 A;  2W9C A;  1VQE A;  3I4N G;  2C28 A;  4LFB Q;  2JEI A;  4JBW A;  2YZN A;  1YNN C;  4XQN A;  1ENF A;  1DGS A;  4MN3 A;  3PV0 A;  2VA2 A;  3W1B A;  3F2C A;  4B3T L;  4OO1 I;  1SYF A;  2EYJ A;  2NWG A;  4KKU A;  3Q23 A;  1I94 L;  3VPD A;  2FLP A;  1VQD A;  1MHW C;  1LTS D;  4DNT B;  1I4X A;  1FNU A;  2RGV A;  2YTY A;  1MSH A;  2EJG C;  1XNR L;  4A76 A;  1OXX K;  1IBK L;  2JA5 H;  1CK1 A;  1G91 A;  3NEL A;  4RCO A;  3D4W A;  4GLA C;  2I8C A;  3FVQ A;  3E9I A;  3WO0 A;  3D8G A;  4IUN A;  4GOP A;  4U6P A;  4BY7 H;  1RTN A;  4G4K A;  4JV5 H;  1YZ6 A;  2W7P A;  5LL6 X;  3CC7 A;  3GTM B;  2XNA C;  3Q8S B;  3HOX G;  1EIF A;  1QG7 A;  1TWC H;  1PHJ A;  2JA7 H;  1TWF H;  4QWD A;  1TWH B;  2E75 C;  1Y1W A;  3BDO A;  1LLR D;  1TS2 A;  3D0F A;  4X3K A;  2RDJ A;  1Q90 A;  1EYZ A;  2MO0 A;  1JKJ B;  2XRS D;  4LSX A;  2KJX A;  4IUU A;  3H4D A;  1U9R A;  2EJM A;  2JEB I;  3QR8 A;  5IOC A;  5KKN B;  2VQE L;  5KFL A;  3I72 A;  5KFP A;  2Q2U A;  1GKH A;  3PIO A;  4K0K L;  3J81 W;  4GC6 A;  1NSN S;  3TP6 A;  1V4Y A;  1PZK D;  3SR1 A;  1YNN D;  4ED8 A;  1BOS A;  1UE5 A;  4GOP B;  1FKA H;  2WIN B;  4RAY A;  1SMY D;  3NE5 B;  3JSL A;  5BN3 A;  2KSW A;  2AUJ D;  2B2W C;  1WD1 A;  4EEQ A;  2K75 A;  1XPO A;  2JA5 G;  5E4X A;  4LF7 Q;  5KG6 A;  4XX0 B;  4GKK H;  1ZKO A;  3I4L A;  1KAA A;  1VQO A;  4B3S Q;  4JI8 H;  2IWH A;  3M4Q A;  2F0O A;  3VA5 A;  1IXR A;  2J4X A;  2PPB C;  4HJ8 A;  1MSG A;  2W6Q A;  3E9H A;  1BNC A;  4DR7 L;  4MNO A;  4DR7 Q;  2K01 A;  2K05 A;  5FD5 A;  3WWV A;  2JA7 B;  5I4D A;  3CD6 A;  1MBY A;  5KFO A;  4X62 L;  1E1T A;  4B3M H;  4DR1 L;  3MFG A;  5FO8 B;  4JBJ A;  4HN7 A;  3AQQ A;  2M9V A;  1DCZ A;  3HG9 A;  3I4N B;  4BS9 A;  4A3B G;  3GIQ A;  3OTO H;  2Y0S B;  1CT1 D;  4O1N A;  1ASZ A;  3E3X A;  3ITP A;  1M0W A;  2L0C A;  4AH6 A;  4JI0 H;  1SE8 A;  2ZJR A;  4K6L A;  4FP5 D;  1KTK A;  1LT5 D;  1EWC A;  2E76 C;  3AB9 A;  4YAK B;  1ZYR D;  3J7Z C;  3G6E A;  3J80 W;  1GLV A;  2J6T A;  4KY7 A;  1IL8 A;  5GAD C;  3TIN A;  2XRQ D;  1D5X C;  1CKN A;  1SDF A;  5GAG C;  4KHP H;  3HOV H;  2ZTC A;  1AN8 A;  2PN1 A;  2VB2 X;  4HMI A;  4YY3 H;  3MC0 B;  4HIK A;  4GC7 A;  1XYI A;  4DN4 M;  3K3P A;  4JI3 H;  4AIM A;  3CCR A;  4A3F H;  1JOR A;  5C0X H;  1PLF A;  1B8A A;  1K8A C;  4LF5 L;  3H09 A;  4DUY Q;  4J1M A;  2VQF Q;  3A8I E;  2QCP X;  4C3I G;  1N32 L;  1A2U A;  1XTC D;  3QG1 A;  4LUZ A;  2F0J A;  3H94 A;  4HSV A;  3CCV A;  1CE8 A;  2I87 A;  4O3S A;  4FXK C;  3KUP A;  4JI1 L;  2KEE A;  4JC0 A;  1LTT D;  3RFC A;  4QIW B;  4RU9 A;  3SHL A;  4LF6 Q;  4RNN A;  2V4Q A;  2VOB A;  2IBK A;  3Q1K A;  2FK3 A;  1XNR Q;  2DNC A;  4RB1 A;  2NVQ H;  4ZAI A;  5BR8 Q;  1STY A;  5GAH C;  3QIA A;  2W57 A;  3FHW A;  1QJO A;  3P20 A;  2IY5 B;  2VL6 A;  3S1R B;  1EYA A;  5M5Y H;  2PO4 A;  2NZO A;  2ZXP A;  2CHB D;  3PW4 A;  2V5A A;  2L55 A;  2F3W A;  2K4K A;  5KYL A;  5KFG A;  1GUS A;  2KQ3 A;  2SEB D;  3GQC A;  3VPB A;  4ED7 A;  1LAB A;  1B9N A;  3RIZ A;  3HRZ C;  2AKW B;  1AW7 A;  5T1I A;  4JV5 L;  2ICE C;  2JA8 H;  2NVY A;  4XXE A;  3N44 B;  4IOA A;  3PF4 A;  1WH2 A;  3EQL C;  1H95 A;  4YP3 A;  4EGJ A;  4IPC A;  3F2D A;  5KFD A;  2W7O A;  2NU8 B;  3C0F B; 
#chains in the Genus database with same CATH homology
 2BH8 A;  5C0X G;  5BR8 L;  3BU2 A;  1A62 A;  2PQA A;  1M1K C;  1GD7 A;  3CME A;  4BBR G;  1JMC A;  3UDG A;  2R7F A;  2YV5 A;  3TRZ A;  1Q1E A;  4YCW A;  5LMN Q;  3FP9 A;  1N34 Q;  4P75 A;  2VY3 A;  3Q8D A;  5HY6 A;  2VUM H;  4JI1 Q;  3HOZ H;  2K14 A;  3L2P A;  3PF5 A;  4AQY L;  1XTD A;  2E8G A;  1SLJ A;  2F4V L;  4A3I G;  2WFW A;  4BBS H;  1N32 Q;  1A8V A;  3KF6 B;  2VQF L;  1K83 H;  2QEX A;  4DV4 Q;  4A3C G;  5M3F H;  1CKM A;  1Y14 B;  1JJG A;  1SRU A;  3HKZ E;  3TS0 A;  3D31 A;  3S1R H;  1L2F A;  4JYA Q;  1VQK A;  1W3S A;  1X3G A;  3GDE A;  2JE6 I;  3T1Y Q;  3RR5 A;  3DM3 A;  1EQQ A;  1PVO A;  4GKK L;  4EQ5 A;  3HOU H;  2UUC L;  4RMF A;  2UXD L;  2A19 A;  3FKI G;  4LWC A;  2ZM6 L;  2R93 H;  2VQE Q;  4A3L H;  5M5W H;  2WB1 E;  5IYD H;  1QVF A;  3PSI A;  4ME3 A;  2ALY B;  3HOX H;  2HIV A;  4X66 L;  1Y1V H;  5FLM H;  4DR3 L;  3H0G G;  4JI7 Q;  3I55 A;  4IFD I;  2NN6 G;  3EN2 A;  4QL5 A;  2UUA L;  2HT1 A;  4UPA A;  1VQG A;  4DR5 Q;  3I4M G;  1KC8 C;  3J80 i;  3PO2 G;  2ATW A;  1PH4 A;  4LF8 L;  5FLX c;  4DR6 Q;  2RHS B;  1G29 1;  4DV1 L;  4IFD J;  1QZG A;  1VQJ A;  4YCV A;  2R7Z H;  3CQZ H;  1I5F A;  3EIV A;  1W2B A;  3PO3 H;  4HIM A;  1OXV A;  3S14 H;  4JG2 A;  4JI2 Q;  1EUJ A;  2B63 G;  1SRO A;  1GO3 E;  1YJ9 A;  2DUD A;  5JJI A;  2I5H A;  3CPF A;  4QIW E;  1AE2 A;  4A3G G;  1OXU A;  3AFQ A;  2ZJQ A;  1CUK A;  1UWV A;  1YEZ A;  5M3M G;  1HR0 Q;  4GS3 A;  2R7D A;  4HIO A;  4OWW B;  2BA0 A;  1VQH A;  2JEA I;  3I4M H;  3PO2 H;  4JI4 Q;  3UE0 A;  4GNX C;  1LYL A;  4DK6 C;  1HNW Q;  4BA1 I;  2ES2 A;  1I94 Q;  4JI5 L;  5IYB G;  1R9T H;  1C7Y A;  4KHP L;  4J15 A;  1X9N A;  3STB D;  4B3S L;  4B3T Q;  5H1S E;  4GN5 A;  4R4C A;  4L5S A;  3S2D H;  1YI2 A;  3A0J A;  3U4V A;  2E5L Q;  3M4O H;  2R93 G;  4RG1 A;  3KYH C;  4O0A A;  4A4I A;  4A3E H;  3PUX A;  4LF7 L;  1XJV A;  2I5L X;  3U50 C;  1ASY A;  4A3E G;  2Z6K A;  1K8G A;  1HR0 W;  1KL9 A;  2EQS A;  4DV5 Q;  2CWA A;  3A5U A;  4LFC L;  2NVY H;  5C44 G;  3H3V H;  3K7A H;  3W1G A;  3E0E A;  4C3H H;  5IP7 H;  3BJU A;  2UUB L;  1TXY A;  1VQL A;  1Q7Y C;  4GN4 B;  1TWG H;  2NVX H;  4DV2 Q;  4B3R L;  1X56 A;  4JOI A;  4DR4 L;  2AWO A;  5C0X J;  3CCQ A;  1VQ6 A;  4YHH L;  4DV6 Q;  2MFI A;  5C3E G;  1C9O A;  2RCN A;  3RLO A;  2A1A A;  3GO5 A;  3KDF B;  2WP8 J;  4DKA C;  2IX0 A;  1VQF A;  3J81 j;  2B63 H;  3M9B A;  4LF9 L;  2ID0 A;  3RZD H;  1N36 Q;  1FJG L;  1YHA A;  2OQ0 A;  3GTG H;  3F8T A;  4PZ8 A;  2OWO A;  1WCM H;  2PI2 A;  3PO3 G;  1PH3 A;  4PG3 A;  4HJ5 A;  1QZH A;  5J3B A;  1FGU A;  4P73 A;  3GTP H;  4WJ4 A;  3PIP A;  2GN5 A;  4GN3 B;  2R92 H;  1Y1W H;  4A3L G;  2K5H A;  4UP9 A;  3K0X A;  1QVG A;  3F1Z A;  1RIP A;  4OO1 G;  1QVC A;  4DV7 L;  1RL2 A;  2LXK A;  3OTO Q;  1K73 C;  1TWA H;  1Q1B A;  3OYY A;  1PH9 A;  2AMC B;  4DV3 L;  1I3Q H;  5C44 H;  4NPS A;  4POF A;  1A0I A;  4PMW A;  3JAM i;  1KIX A;  4IPG A;  4B3M Q;  4L5R C;  1Z9F A;  2OTL A;  4A3C H;  2Z0S A;  1KD1 C;  4HJA A;  3S17 H;  1UE1 A;  4QY7 A;  3KJP A;  1SFO H;  2VS1 A;  1SR3 A;  2KHI A;  5AJ3 Q;  4A3J G;  4A3D H;  3U58 A;  3M85 A;  4QJF A;  5M3M H;  4DV6 L;  1YBY A;  4R4Q A;  4A3M H;  3RZO H;  2GVA A;  3UDI A;  4DR4 Q;  4JI8 Q;  2ZM6 Q;  4DV0 L;  5JJL A;  4LW1 A;  1NMG A;  3RLF A;  4DV2 L;  1E3P A;  4BBR H;  1IBM Q;  4APV A;  3PGZ A;  3CCU A;  3GTQ H;  3T1Y L;  5C3E H;  4JYA L;  5LMU L;  1J6Q A;  5IP9 G;  2ASB A;  2CCZ A;  4H02 A;  4IFD G;  2IX1 A;  3GTJ H;  4LFA Q;  2K5V A;  1EQR A;  2VZA A;  4BXX H;  2YTX A;  3S1Q H;  2VNU D;  3T1H Q;  2F4V Q;  2R7Z G;  1HJP A;  4JI3 Q;  4DPG A;  1PH8 A;  1B7Y B;  1IYJ B;  3H0G H;  5IYC G;  4YY3 Q;  2BH2 A;  3AEV A;  1X55 A;  1J5E L;  5HGQ A;  3BZC A;  3M4P A;  1J5E Q;  4KHP Q;  4A93 G;  3HOU G;  1K0R A;  1E24 A;  1X3E A;  2KCM A;  3FKI H;  4MTN A;  4FDB A;  4DNI A;  1MJE A;  1IZ6 A;  4O2D A;  2R6G A;  2WAQ E;  2E2H H;  3T1H L;  4QQB X;  1NY4 A;  3ERS X;  1AE3 A;  3TRE A;  1HNX Q;  4JI0 Q;  4LFA L;  1HR0 L;  1LTL A;  3ULJ A;  4GOP C;  1PV4 A;  1JJ2 A;  4LF8 Q;  4OX9 Q;  3HOY H;  4NB3 A;  3S1N H;  1Q86 C;  1I50 H;  3GTK H;  1YHB A;  2DGY A;  2Z6K C;  3CC2 A;  4JV5 Q;  1LUZ A;  3UDX A;  1PFS A;  4GLV B;  3W5O A;  2IHE A;  5C4J H;  1YIJ A;  1PH2 A;  4JI2 L;  4BBS G;  1D7Q A;  1N33 Q;  2E2J H;  3ICE A;  3IRB A;  1IBM L;  1VQ5 A;  1KRT A;  5DLQ E;  1E1O A;  5M3F G;  1V9P A;  1JT8 A;  5C0X I;  1SMX A;  4JI8 L;  4LF4 L;  1Q8K A;  4HID A;  1XNQ L;  2HHH Q;  4P71 A;  2ZTE A;  1L1O C;  1PYB A;  2F52 A;  3KJO A;  3STB C;  3L7Z C;  1NE3 A;  1EOV A;  1U5K A;  4Y7N H;  1L0W A;  1WYD A;  3CCJ A;  4IJH A;  5AJ3 L;  5ELO A;  4DR3 Q;  4JI7 L;  4ALP A;  4X66 Q;  4A93 H;  1EWI A;  3GD7 A;  1UE7 A;  2HHH L;  2K52 A;  3KDF A;  2R92 G;  1E7Z A;  4B3M L;  1NBW A;  4IJL A;  3JC6 6;  3F2B A;  4LF4 Q;  2F3I A;  4DAM A;  4R4T A;  4GKK Q;  3DLL A;  1X3F A;  1PH5 A;  1I6H H;  3OTO L;  1QUQ B;  1VQ9 A;  2ZJP A;  1NTG A;  1K9M C;  4LNQ A;  1GM5 A;  3K81 C;  5GAE C;  5LMN W;  1YVC A;  1HZB A;  2JJQ A;  1S72 A;  1OTC A;  2RF4 A;  2L15 A;  4BXX G;  3PUV A;  4JI0 L;  4OX9 L;  2MNA A;  5GQO A;  4DUY L;  2YYZ A;  4IPD A;  4NXM L;  1YJN A;  3HOW H;  5EAY A;  3HOV G;  1CSP A;  3GTM H;  1MKH A;  1N36 L;  1EFW A;  1FJG Q;  4BA2 I;  4HJ7 A;  5ELN A;  4DAY B;  3L0O A;  3KOJ A;  1N8R C;  5M5X H;  4A3J H;  2K50 A;  4KLK A;  1VQ8 A;  3I56 A;  2JA6 G;  2MO1 A;  1T9H A;  2HQL A;  4YHH Q;  3HOY G;  1CKN B;  4YY3 L;  1KXL A;  2JK8 A;  1PH6 A;  4JI6 L;  4JI3 L;  3CMA A;  2KBN A;  3GTO H;  4DUZ Q;  3HOZ G;  2Q2I A;  1QUQ A;  3G48 A;  3CCM A;  1VQM A;  2V1C C;  3HOW G;  2UUB Q;  3CCL A;  2A8V A;  1OXT A;  1GVP A;  1X6O A;  2UXC Q;  3J81 c;  3EBE A;  2JA7 G;  1BVS A;  2PMZ E;  4LFC Q;  4DV5 L;  1VQ7 A;  2JA9 A;  4YWL A;  3KLW A;  4KI0 A;  3G71 A;  5LMU Q;  3J7A 5;  1HNZ Q;  1WCM G;  3K80 C;  4DR2 L;  3CC4 A;  1VQE A;  2Q2H A;  3I4N G;  1HZ9 A;  1EIY B;  1G6P A;  4C3I H;  4LFB Q;  4JBW A;  2E5L L;  4DV0 Q;  4X64 Q;  1DGS A;  5FJ8 H;  3PV0 A;  3W1B A;  5IYC H;  3F2C A;  4B3T L;  4OO1 I;  3K7U C;  4GNX B;  1UEB A;  2N3S A;  1I94 L;  2N49 A;  4A3F G;  1VQD A;  1HZC A;  4A75 A;  1BBW A;  4JOI C;  4OON A;  3TQY A;  1HNW L;  3KFU A;  4XTC S;  2AHO B;  3NEM A;  1FVI A;  2YTY A;  4AYB G;  2UXB L;  1SN8 A;  1XNR L;  4YCU A;  4A76 A;  1OXX K;  3U4Z A;  1IBK L;  1TWH H;  2JA5 H;  1LM0 A;  1CSQ A;  3BZK A;  1PA6 A;  3NEL A;  4LF6 L;  4GLA C;  1N34 L;  3I4O A;  4DV3 Q;  4PZ7 A;  2XTI A;  2LXJ A;  4DV7 Q;  3HKZ G;  3E9I A;  4R1J A;  4BY1 G;  1KQS A;  4JCV E;  2D62 A;  1VQI A;  2E2I H;  4GOP A;  1VQA A;  5IY0 A;  3I4N H;  4BY7 H;  4UP7 A;  5IWA Q;  1YZ6 A;  4DV1 Q;  3CC7 A;  3M7N A;  3S15 H;  4DR6 L;  5C4X G;  2BA1 A;  1Z47 A;  3ULL A;  3HKS A;  1IBL L;  3HOX G;  1EIF A;  2KCT A;  4LF5 Q;  1TWC H;  5IYD G;  1PHJ A;  1TWF H;  1WFQ A;  2K5N A;  2JA7 H;  2VUM G;  1EYG A;  4LF9 Q;  4A3K G;  5IYB H;  3D0F A;  1L1O A;  3CXC A;  1VQB A;  1WI5 A;  2EXD A;  2MO0 A;  2Y0S E;  2Y0S G;  1KHI A;  2EIF A;  3PUZ A;  4OWT B;  3S2H H;  3CAM A;  2RHQ B;  4P72 A;  2PNH A;  1XMO L;  2JEB I;  5GRO A;  4X6A H;  1PYS B;  2B3G A;  2VQE L;  1MJC A;  4B3R Q;  2UXD Q;  4QGU A;  3RN2 A;  2YTV A;  2LSS A;  1GKH A;  1P16 A;  3PIO A;  2MQH A;  4IPH A;  2Q2U A;  2UUC Q;  4K0K L;  1Y1W G;  1G51 A;  1VQC A;  5IE8 A;  4BY1 H;  4P74 A;  2OCE A;  2OTJ A;  1UE5 A;  4GOP B;  1VQP A;  1Q81 C;  2KHJ A;  1XPU A;  1IBL Q;  4A3G H;  5IP9 H;  4DV4 L;  1M90 C;  5IWA L;  3I2Z A;  2K75 A;  1XPO A;  1VCI A;  2JA5 G;  4C3J H;  4LF7 Q;  3G4S A;  2VW9 A;  1V43 A;  2WAQ G;  4AYB E;  3LGJ A;  3H15 A;  3KF8 B;  1VQN A;  1VQO A;  4B3S Q;  4A3M G;  5IP7 G;  5FJ8 G;  4X62 Q;  1B70 B;  2KEN A;  2NZH A;  5LMN L;  2PQA B;  3M4Q A;  4GKJ Q;  1Q82 C;  1IXR A;  4JI5 Q;  3J80 c;  4R4O A;  1JB7 A;  3CP0 A;  4HJ8 A;  1XMQ L;  2UXB Q;  5JJK A;  4DK3 C;  3E9H A;  5K36 G;  3SGI A;  1YIT A;  2B29 A;  4MNO A;  2UU9 L;  2UU9 Q;  4JI4 L;  4A3B H;  4DR7 L;  4DR7 Q;  3OW2 A;  1XMQ Q;  1UE6 A;  3WWV A;  3H3V I;  4YWM A;  1Y1V G;  5FLM G;  3CD6 A;  4GKJ L;  4X62 L;  1E1T A;  1KAW A;  4DR1 L;  2IT1 A;  3HFZ B;  4JBJ A;  1D8L A;  4TVA B;  3AQQ A;  5IT9 c;  4X64 L;  4GLX A;  2ZTD A;  2D0P A;  3GTL H;  4A3B G;  4LFB L;  3PUY A;  4C2M H;  4BY7 G;  1PH1 A;  1ASZ A;  1C0A A;  1HH2 P;  3S16 H;  1HNZ L;  5E7N A;  1K3R A;  1VS0 A;  3CCS A;  3PCO B;  2I0Q A;  4JBK A;  1Q12 A;  1WJJ A;  2N78 A;  1CKO A;  1O7I A;  2QGQ A;  3A5Z B;  3MXN B;  4OWX B;  4AH6 A;  5JEA J;  5C4X H;  1SE8 A;  3NEN A;  4TQU S;  2ZJR A;  4IOC A;  1N9W A;  2JQO A;  5JEA G;  4DR5 L;  2Q2T A;  3ER0 A;  4EX5 A;  4UY8 C;  4L5Q A;  2QA4 A;  2UUA Q;  2OQK A;  2CWP A;  3J7Z C;  3G6E A;  3VDY A;  1BBU A;  4DUZ L;  1YNX A;  1OXS C;  3RNU A;  4K0K Q;  2AWN A;  1S3O A;  5GAD C;  4L5T A;  4JI6 Q;  4POG A;  4LUO A;  1CKN A;  3NBH B;  3S24 A;  2WB1 G;  5GAG C;  1YHQ A;  2H5X A;  2ZTC A;  3HOV H;  1XMO Q;  4R4I A;  4HIK A;  1Q46 A;  4X65 Q;  4OXP A;  1X65 A;  3J81 i;  3CF5 A;  2IHF A;  2PI2 E;  3MEF A;  4AIM A;  2FXQ A;  1V1Q A;  3CCR A;  4A3F H;  3TEH B;  1E22 A;  3CCE A;  1B8A A;  1WOC A;  1X54 A;  1K8A C;  1AH9 A;  1XPR A;  4LF5 L;  2I5M X;  4NXM Q;  1P8L A;  4DUY Q;  4YWK A;  4LUV A;  1BKB A;  2VQF Q;  1N32 L;  1VQ4 A;  3UE1 A;  3RN5 A;  2C35 B;  4PZ6 A;  2YU9 H;  4A3K H;  4LUZ A;  3CCV A;  2HIX A;  4AQY Q;  2NVT H;  2GVB A;  4XIG S;  4JI1 L;  1PH7 A;  4JC0 A;  2CKZ B;  4X65 L;  3S1M H;  1HZA A;  4LF6 Q;  3A74 A;  3RLN A;  4UP8 A;  3AYH B;  4GNX A;  1IBK Q;  2CQO A;  4A3I H;  1XNR Q;  3PUW A;  2NVQ H;  3ULP A;  5BR8 Q;  5GAH C;  4IO9 A;  3FHW A;  4NXN L;  4A3D G;  2IY5 B;  1S40 A;  2VL6 A;  5M5Y H;  1NMF A;  2JA6 H;  2NZO A;  2NN6 I;  1XNQ Q;  3JAM c;  4WJ3 M;  3TS2 A;  3CW2 C;  2K4K A;  2CFM A;  3ZJY C;  2XGT A;  3K8A A;  3CPW A;  4JBM A;  1IL2 A;  3UDF A;  1N33 L;  4DR2 Q;  4Y52 H;  1NJI C;  1YJW A;  1JE5 A;  3B6Y A;  4KHZ A;  2AKW B;  3KF6 A;  4JV5 L;  2N8N A;  2JA8 H;  1FL0 A;  4MZ9 A;  1JJC B;  1MIU A;  4IOA A;  4DR1 Q;  2JA8 G;  3M3Y H;  3PF4 A;  1KRS A;  2UXC L;  1H95 A;  3AFP A;  4IPC A;  1U0L A;  1HNX L;  3I7F A;  4NXN Q;  3F2D A;  1L1O B;  2D0O A;  1A63 A;  4HJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...