5IP7G

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5ip7G01
1VQCA 1O7IA 3K8AA 2UUBQ 1HJPA 1VQGA 2JA7G 4P75A 3K7AH 1GKHA 4EX5A 3W5OA 5C0XJ 1WFQA 3RLFA 1NTGA 1Y14B 3KF6A 4DV3Q 4GLXA 2JA8H 3E0EA 2R92H 3HOVG 3PUWA 1PYSB 5M5XH 3RZDH 2ZTDA 2Q2TA 5JJLA 3CCLA 2HIXA 2R7ZH 4YCVA 4B3SL 2CCZA 4JBKA 4QIWE 1K8GA 1CSPA 2UU9L 4H02A 1FJGL 2A8VA 3GTOH 1VQ4A 1EFWA 1VQ5A 2CFMA 2PI2A 1PH9A 4BY7H 1XNRL 2F3IA 2Q2IA 4AH6A 1HZ9A 3RN5A 4A3MH 2UUCQ 1SFOH 4AIMA 1E24A 5IY0A 3G6EA 4DV2Q 1X3EA 2ZTCA 2MQHA 1YHAA 2VQEL 4OWWB 2FXQA 3STBC 3PF4A 1X6OA 4DV0L 3HOVH 3H3VH 2ATWA 3HOUG 5M3MG 3S1NH 1VQMA 3RR5A 2Z0SA 1CUKA 2CKZB 4A3IG 1JT8A 2K5NA 3J7ZC 4DV5Q 4BBSH 1OXTA 1BVSA 1EQRA 2N78A 1VQJA 2VZAA 4KHPQ 1VQKA 3A5UA 3U58A 3PUYA 1GVPA 1YI2A 2H5XA 4FDBA 4GN3B 1HNZL 2ZM6L 3OW2A 3KDFB 4JYAQ 1UWVA 3KF8B 2E2IH 4DAYB 3JAMi 3GTJH 4NXNQ 1T9HA 2I5HA 4A75A 1PH2A 4B3RQ 4A3DH 4IOCA 4UP8A 4DR7Q 4DV1Q 4A93G 3F2CA 1D8LA 1FVIA 5IWAL 1TWCH 3W1GA 1PH8A 1QVCA 4LF7Q 4DUYL 4LWCA 1PHJA 1Z9FA 4LF8Q 1KAWA 4DNIA 1HZAA 4J15A 5AJ3L 1PH3A 2UUAQ 4NXMQ 2RHQB 3UDIA 4X62Q 4HIDA 1HR0Q 3MEFA 4HIKA 1GO3E 4GS3A 1P16A 3BZCA 3PUZA 4IPHA 4JI5L 1CKMA 4POFA 4DV4Q 4A3FG 1YITA 1PH4A 4A3GG 2GVBA 5GAHC 4P72A 2F4VL 1XPRA 3CPWA 5DLQE 4JCVE 1HNWQ 3SGIA 1TWAH 3JAMc 3HOZG 2OTJA 4DR3Q 3FP9A 2KBNA 2C35B 1X56A 3H0GG 4QJFA 3FHWA 3CPFA 4DKAC 5C0XI 1QUQA 1OXXK 2MNAA 2IHEA 3S24A 5M3FG 2E5LL 3CXCA 4DUZL 2JA5H 4LF6L 2KHIA 1IL2A 3I4MH 1HNXQ 1QZHA 4GNXB 3TRZA 2KENA 3ZJYC 4JV5Q 1EIFA 5C44G 4UP9A 1I5FA 3GDEA 3RNUA 4KHZA 3F8TA 3KJPA 3KYHC 3M7NA 2ZTEA 4GOPB 2B3GA 4L5RC 3CCSA 1PH6A 4PZ7A 4B3SQ 1K83H 1N8RC 1RIPA 3FKIG 3K7UC 1Z47A 4NPSA 4BBRG 2UU9Q 1FJGQ 4A3CH 4L5TA 1I94L 3S16H 3S2DH 4K0KQ 1EWIA 2HT1A 1HH2P 3CMAA 4NB3A 2MFIA 1VQEA 3KLWA 4OONA 2JA8G 2R92G 2QGQA 4HJ7A 1W2BA 1XTDA 1LTLA 4LFCL 2NN6I 1G51A 2AKWB 2R7ZG 3A5ZB 4KLKA 3AFQA 4GLVB 2VQEQ 5HGQA 4DV0Q 1K9MC 2NZOA 2RF4A 5IP9H 3AFPA 4C2MH 1V43A 5LMUL 2K4KA 4JI2L 4DV7L 4BY7G 3CF5A 5GADC 2JEAI 3F2DA 3EN2A 3K81C 4LFAL 3PUVA 1VQDA 2L15A 3J7A5 1MJCA 1IBKL 2AWOA 3D31A 5C0XG 4A3BH 4JI1L 4JOIA 4DAMA 5BR8L 4B3ML 2BH2A 5LMNL 3BJUA 4R4CA 3ULPA 1IZ6A 1J6QA 3ULJA 1BBWA 4UPAA 3I55A 4A3LH 4JI3L 1IYJB 1YZ6A 1WI5A 4JBJA 4XTCS 1HNZQ 1JB7A 2ZM6Q 3ER0A 4GLAC 5IP7H 5GROA 1TXYA 4P73A 3HKZG 2GVAA 1PH5A 1XJVA 1BKBA 1ASZA 3I4NH 3PIPA 4BBSG 2WP8J 4BY1G 5IWAQ 3U50C 1A62A 5FLMH 5C3EH 2WB1G 4A76A 5E7NA 4JI8Q 2UXDL 1L1OB 1XMOQ 4LF5L 2N49A 1E1TA 3NENA 1KD1C 2DUDA 5AJ3Q 2NN6G 1D7QA 2CWPA 1YBYA 2OQKA 4R4QA 3NBHB 2A19A 2K5VA 2WAQE 3UDGA 5J3BA 4JI5Q 1XNQL 4A3DG 1WCMH 3CAMA 2K50A 2OTLA 1YVCA 2F4VQ 3CC7A 1XMQL 1C9OA 4JOIC 4JI7L 3U4ZA 4JI6L 4X65L 1Q1BA 3K80C 1UE5A 1OTCA 4DK6C 2E5LQ 1W3SA 3KJOA 2BA0A 3DLLA 1Q8KA 1MIUA 1UE1A 4DUZQ 1PH7A 3PUXA 1VQBA 3TEHB 1RL2A 4GN4B 3T1YL 1S40A 1Q82C 1WOCA 4BY1H 3HOWH 1JJCB 4OX9L 5IYBH 2UXCL 2UXBQ 2K5HA 5IT9c 1CSQA 5C4JH 4WJ3M 4TQUS 1IBLQ 1N33L 2HQLA 2YV5A 2IX0A 2RHSB 1A0IA 1NBWA 3M85A 1PH1A 3CD6A 4C3JH 1Q1EA 3EIVA 1I94Q 2WFWA 1SR3A 2JA9A 3KF6B 3TQYA 5M5YH 2JA5G 4B3TL 3I4MG 1A63A 1AH9A 4KI0A 4DR4L 3HKZE 4ME3A 4YCWA 4C3HH 1AE2A 4X66L 2UUBL 4BA2I 3I2ZA 2RCNA 3PV0A 4BXXH 2R93H 4Y52H 2I0QA 4LFCQ 3L7ZC 4IJLA 4UY8C 3D0FA 4IFDJ 1PVOA 1YJ9A 4JBWA 4UP7A 3KFUA 2WB1E 3F1ZA 2GN5A 2D0OA 4OO1I 1HZBA 2QA4A 4X64L 1PV4A 2YTYA 4QGUA 1PFSA 3I4OA 2D0PA 3M4OH 1ASYA 1SMXA 4A3CG 3WWVA 5IYCH 4JI2Q 3G71A 5LMUQ 4DV7Q 1VS0A 4TVAB 1YHQA 5C4XH 2XTIA 2I5LX 4LFAQ 3CW2C 1VCIA 3S14H 4DR6L 2NVTH 2QEXA 2K14A 1VQNA 4PZ6A 4JI1Q 4HIOA 5BR8Q 1N34L 4B3MQ 1Q7YC 1OXVA 1LYLA 4JI0L 1YHBA 1JJGA 1VQ9A 1KHIA 3J81i 3T1HL 4JI3Q 4POGA 3PO2H 1KRTA 2K75A 4PMWA 4GNXC 5IP9G 3M4PA 2E2JH 2ASBA 1NMGA 2AHOB 2EXDA 1I6HH 2R7FA 1HZCA 2KCMA 2VY3A 4Y7NH 2VQFL 4JI4L 1VQ6A 4DR1L 3HOXH 1K0RA 1QVGA 1YEZA 1TWHH 3S15H 4A3JH 1U5KA 4GOPC 2ALYB 3NELA 1EOVA 2B63H 1IXRA 4A3BG 1A8VA 2LSSA 5EAYA 2JA6G 2JEBI 4YWKA 4JC0A 4HJ9A 1OXUA 1XNRQ 4A3LG 4QQBX 4DR2L 2IT1A 1VQPA 1N36L 1VQ7A 2PQAB 2WAQG 3DM3A 1XPOA 4LF5Q 4YHHL 1E7ZA 4DV6L 2MO0A 4QY7A 5IP7G 3RLOA 3S1RH 4HJAA 1MJEA 4APVA 4OWTB 1V9PA 2CWAA 3KOJA 3OYYA 1XNQQ 3I4NG 3J81c 4OO1G 3PO3H 2Z6KC 3UDXA 1C0AA 3J80i 2PI2E 1TWGH 1VQLA 4JBMA 1XMQQ 4JI7Q 1L2FA 1GD7A 5FLMG 4JI6Q 5C3EG 3RLNA 1I50H 4X65Q 4YWMA 2PMZE 3MXNB 4GKKL 1E3PA 1Y1VH 2NZHA 1Q86C 1CKOA 3A0JA 1JMCA 2YTXA 1EUJA 2KHJA 5JEAJ 3T1YQ 1H95A 4XIGS 4R4OA 2JA6H 2D62A 1R9TH 4GN5A 4OX9Q 3L0OA 3VDYA 3RN2A 4A3EH 1KXLA 1UE7A 1WCMG 5LMNW 1V1QA 1J5EL 2E2HH 1N33Q 1QUQB 2B29A 4LUZA 4DR5L 1SE8A 2VUMG 4HJ8A 3CCVA 2IHFA 4MTNA 3CCQA 1LUZA 1K3RA 1JE5A 3TREA 1SLJA 1SRUA 4B3TQ 4OXPA 1SN8A 3J80c 3PIOA 4DR3L 4LF4L 4IOAA 3KDFA 1GM5A 1EIYB 4IFDI 3CCUA 3GO5A 3HOWG 4X66Q 2ZJPA 2Y0SE 5IYBG 1M1KC 3H15A 4DUYQ 3ICEA 3S17H 5IYDH 2BH8A 4R1JA 1HNXL 4JV5L 3S1QH 1E22A 5ELNA 1IBML 2JJQA 2EIFA 4AYBE 2IX1A 3CP0A 4PG3A 4RMFA 2KCTA 1L1OC 1OXSC 3E9HA 4IPDA 3A74A 3GTKH 3RZOH 1P8LA 4X64Q 1X3FA 2VS1A 1E1OA 5JJKA 1CKNB 2ZJQA 3TS0A 4A3KH 3GTQH 2UXBL 3OTOL 1TWFH 2MO1A 4IJHA 2JK8A 1N32L 4HIMA 2VUMH 3GTPH 4K0KL 4PZ8A 4OWXB 4BXXG 4DR6Q 1UEBA 3K0XA 2R93G 3M3YH 4LF6Q 1XPUA 1N34Q 1KIXA 2YU9H 3TS2A 4YY3L 3BZKA 4DPGA 1I3QH 1Y1WH 1KQSA 4JI0Q 1VQHA 4LW1A 2XGTA 3T1HQ 2R7DA 4LUVA 2JA7H 2LXJA 3AQQA 1KL9A 1B7YB 5IYCG 3CMEA 2LXKA 2HHHL 2CQOA 4JI4Q 2VQFQ 1G291 1YJNA 4LFBL 5C4XG 1PYBA 4DR1Q 4GNXA 3L2PA 2IY5B 1X55A 2JQOA 1MKHA 3IRBA 1B8AA 1QZGA 1VQIA 2F52A 4LF9L 1VQAA 3UDFA 4GKJL 1SROA 1KRSA 1K73C 4A4IA 1WYDA 1JJ2A 2JE6I 2R6GA 3JC66 5IE8A 4AQYL 3E9IA 1Q81C 4IFDG 4GOPA 1VQFA 4DR2Q 1NE3A 1S72A 1N36Q 3PO2G 1C7YA 4YHHQ 3STBD 4DV6Q 4ALPA 2VL6A 3G48A 2E8GA 1FL0A 3AYHB 2ZJRA 1Q12A 4YCUA 4DV3L 2OQ0A 3CCEA 5FLXc 3HOXG 4A3JG 1U0LA 2B63G 2NVQH 4IPGA 1WJJA 3PCOB 2PQAA 3Q8DA 2YYZA 4L5SA 3NEMA 3PF5A 3W1BA 2OWOA 3EBEA 2Z6KA 1QVFA 4GKKQ 3CCJA 3GTMH 3HOUH 1FGUA 4JG2A 2Q2HA 4MZ9A 5M3MH 1IBKQ 3B6YA 5HY6A 3GTLH 4L5QA 5LMNQ 1G6PA 4JI8L 2PNHA 5JJIA 4A3IH 1XMOL 3GD7A 2UUCL 2Q2UA 3PO3G 4RG1A 5M5WH 5FJ8G 2ID0A 2N3SA 1X3GA 1B70B 3CQZH 3I56A 4DV2L 1J5EQ 4P71A 3HOYG 4MNOA 4IO9A 2BA1A 4DR5Q 1NMFA 4QL5A 2EQSA 1X9NA 4LNQA 1YJWA 1Y1VG 2YTVA 2Y0SG 4DK3C 2NVXH 4A93H 4LF4Q 1EYGA 4AYBG 3PGZA 1S3OA 1X54A 4A3EG 3I7FA 4DV5L 2UXDQ 3AEVA 5GAEC 1DGSA 3UE1A 4EQ5A 1IBMQ 4KHPL 1BBUA 4R4IA 5H1SE 5GAGC 2V1CC 3H3VI 3S2HH 2OCEA 4C3IH 1IBLL 4JYAL 2HIVA 3HFZB 3U4VA 3CCMA 2N8NA 5FJ8H 4NXNL 3CCRA 3OTOQ 1L1OA 3BU2A 1AE3A 1L0WA 3HOYH 3M4QA 4R4TA 1N9WA 3CC2A 4B3RL 5K36G 4A3FH 1N32Q 2AWNA 4O2DA 3G4SA 4HJ5A 4A3GH 5IYDG 5JEAG 4DV1L 4DR7L 1NY4A 1M90C 4O0AA 4X6AH 1VQ8A 1X65A 1CKNA 1EQQA 3ERSX 4YY3Q 1K8AC 4LF7L 3HOZH 1UE6A 3H0GH 5ELOA 1VQOA 4LF8L 3S1MH 1LM0A 2I5MX 5M3FH 5GQOA 4IPCA 1NJIC 3UE0A 1YNXA 4LUOA 3ULLA 3GTGH 2UXCQ 4NXML 2UUAL 4A3KG 3PSIA 2A1AA 3F2BA 2K52A 4X62L 1HR0L 2HHHQ 5C44H 1Q46A 3M9BA 2VNUD 4DV4L 3CC4A 2VW9A 4LFBQ 1KC8C 3J81j 4YWLA 3HKSA 1HR0W 2NVYH 1PA6A 4P74A 4LF9Q 4GKJQ 3LGJA 1HNWL 4WJ4A 2DGYA 4AQYQ 4DR4Q 3FKIH 2AMCB 4BA1I 4BBRH 4A3MG 1Y1WG 2ES2A 1YIJA
chains in the Genus database with same CATH superfamily
1O7IA 3K8AA 4H0LC 2WINB 1GKHA 4YIJA 3IG0A 1TAEA 4ID6A 2EVBA 5C0XJ 1NTGA 1Y14B 4RGNA 2JA8H 2NWGA 5DGBA 4RUCA 1RTOA 3D6WA 3I8ZA 2CVRA 2JEFA 3PR5B 2A74C 3RZDH 2FLNA 4V0BA 2HIXA 5EBDA 4YCVA 4QIWE 1K8GA 1CSPA 4J0MA 5CR3A 4Q8EA 2F0TA 2CFMA 1XNRL 2F3IA 4ZUJA 1TWHA 1VF7A 5KG6A 2B63A 1SFOH 2YZMA 2G9HD 2CW0C 3WO1A 2VQEL 3NSWA 2FXQA 5DNFA 3STBC 4DV0L 3NTIA 2ATWA 3TDQA 1M7JA 5M3MG 4YR3A 2Z0SA 1CUKA 2CKZB 3J7AV 4JI5H 4KY5A 2K5NA 2F4VH 3VR5A 5KG3A 1VQJA 2VZAA 3BVGA 1I50A 4JVZA 4EEYA 3PUYA 5ELDA 1YI2A 4GN3B 1MSGA 3OW2A 1J8IA 3D4RA 1HA5A 3TP8A 1PH2A 4A75A 4G3IA 1JCKB 2DN8A 4FF1A 4A3DH 2DPIA 2WAQA 3BS1A 3SEBA 3VA5A 3BDLA 4ZAIA 4DUYL 1T3NA 1Z9FA 4DAVA 1ZYRC 3FEWX 4FXDA 1HZAA 1RYSA 4V190 2UUAQ 1VMCA 4X62Q 4RUAA 4HIKA 2MP1A 1YITA 4IPHA 2F0FA 4M8AA 5GAHC 3VPBA 2J7ZA 4YAKB 3NP8A 4JCVE 1HNWQ 1CZGA 2O4XA 1TWAH 2QEJC 4DXFA 3JAMc 1ZYRD 4P2CB 3FP9A 5DEHA 4HAEA 1X56A 5EWFA 2MNAA 3FHWA 5C0XI 2E5LL 2UVUA 2F0HA 2F3WA 3S24A 4DUZL 5LMUH 3PW7A 2KHIA 2EZVA 5LL6S 2ASLA 3GTGB 1UEAB 4EYIB 3GTPA 1HQRD 3RNUA 1Y8NB 1D5ZC 3EJIA 2EY1A 2XVSA 3M7NA 5FD6A 1I3QA 4IAJA 2B3GA 2QK4A 1STYA 3VYRA 1K83H 2UU9Q 4B08A 2IWHA 1LABA 3H6MA 4BBRB 3S2DH 5CV9A 1N48A 2PNRC 2HVQA 1HH2P 4NB3A 2MFIA 1CHQD 1VQEA 4A2BA 3NXWA 2H1EA 3FPUB 1FGBD 2AUKA 2A6EC 4I4TF 5LHY1 5A2QW 2VB3X 1ICWA 3BZDB 3A5ZB 4KLKA 3AFQA 2FKLA 4LF5H 1A2UA 4MTKA 3NK9A 1V43A 1HHVA 4DV7L 1S0MA 3CF5A 4MIUA 4LJZC 3MR5A 1F9QA 5IT9E 1OWTA 2Z8LA 3EN2A 4Q44A 3PUVA 1DCZA 4KD3A 2A6ED 1R4PB 1EYDA 2B2UA 5D3DA 3J7A5 5KFWA 2FLLA 2FLPA 3PN1A 1GUNA 4JI1L 2DNEA 1CM9A 2I07B 4A3LH 1J9OA 4JI3L 1IYJB 5IT9L 1HNZQ 1O78A 1JB7A 4K8IA 5LL6b 1KDCA 1A3UA 5IP7H 2ZDGA 3EQLC 3T1YH 3OMCA 1JQYD 1TXYA 4P73A 2GVAA 4IHJF 1BKBA 3I4NH 4NDXA 2G9DA 2X6GA 1FNWA 3HB9A 4BBSG 1EIGA 5JAVA 3E5NA 1TVXA 3U50C 3DXJC 1OO9B 2FMCA 2J0TD 2WB1G 3K5NA 4JI8Q 3SR1A 1Y8OB 1XMOQ 4ZQ3A 2DUDA 5AJ3Q 1RJQA 4M7EA 2NN6G 5KFLA 2CWPA 5KFAA 5FO7B 1KLGD 4BWGB 4MV1A 3IFTA 3D3RA 3ND8A 4F4ZA 2W9AA 4JI7L 4JOIC 3KALA 4RFBA 3V6HA 4X64H 4X65L 1Q1BA 3K80C 1UE5A 2N55A 1OTCA 3KXYT 5F9LA 2HUGA 3MVVA 4QWDA 2WYOA 1EHIA 2BA0A 1U4LA 1JWUD 3M9OB 5KEEA 2R8IA 5C4JH 1N34H 3H4DA 3QR8A 2IX0A 1PH1A 1T5EA 3GQBA 4TV9F 4AYBA 2R8HA 1I4HA 4H44C 2CHBD 2RDFA 1B3AA 1I94Q 1ESFA 2JA5G 3I4MG 5KFIA 4HEDA 1B1ZA 3J81E 4DR4L 4JI4H 1CZWA 1I6VC 4QIWA 4YCWA 1AE2A 5CV4A 2XCPA 1EQTA 2X69A 4BA2I 4Y52H 4LFCQ 4BWSC 3L7ZC 2R8KA 4UP7A 5T14A 4FBUA 2QA4A 5E3FA 3J81L 1PV4A 2XWJB 3M4OH 1Z6HA 3TZUA 1ASYA 4K2LA 5IYCH 1LTID 4JI2Q 3VR2A 5KFOA 2AU0A 4CJ1B 5C4XH 3TBIB 4J9PA 3G6VA 4LFAQ 4CDEC 1VCIA 4DR6L 4XX0B 4QWBA 5KNBA 1I4QA 5DQGA 4HIOA 4C5CA 1AZPA 1OXVA 4ED3A 3LMLA 1Z2NX 5DG8A 1JC7A 3J81i 4GKKH 4IFDH 4C5BA 5KKNB 1S5DD 4RA8A 1KRTA 1UNNC 5IP9G 2HVRA 2ASBA 1NMGA 3OWEB 3G8CA 5EKKA 5KRUA 2KCMA 2VQFL 1Y1WA 5IYZF 1F2LA 1AFPA 2NZ1D 4DR1L 1QVGA 1YEZA 1TWHH 1I50B 1U5KA 2ALYB 2B63H 1EOVA 1IXRA 1WSCA 3HBLA 4GC6A 4IUVA 3R5FA 4DR5H 2JEBI 4YWKA 1A3TA 2OLSA 1SNDA 1TT2A 4DR2L 3DM3A 5E4XA 3W3AA 4DV6L 2MO0A 1DJRD 3RLOA 2WAQB 4KTAA 1C30A 2K32A 1BR9A 2I87A 4APVA 1S68A 3A8IE 4OO1G 2UXDH 2X6LA 2Z6KC 4QW8A 1C0AA 2BOSA 5KNCA 2RDJA 5KT3A 1XMQQ 1RJPA 1S9FA 1GD7A 1I50H 3D4WA 2NZHA 5C3EB 1WTRA 2W6OA 4RZRA 3A0JA 1JMCA 3GTJA 2YTXA 2Q8IB 3OTOH 2UXBH 2KHJA 4DL2A 4OEMB 1N32H 4R4OA 1LLRD 1JICA 3VYSA 3RN2A 1WCMG 2XSCA 2MJ8A 3GTLA 1J5EL 2F0WA 1BCPF 1K1SA 3CVZA 1LACA 5IT9W 1FNUA 1SE8A 4HJ8A 3A8KE 4ED8A 4MTNA 3CQZA 2XCAA 2KA7A 5FLXE 4B3TQ 3J80c 1SN8A 4LF4L 5K36H 3BQ1A 3TP5A 2HHHH 1ESRA 4LFBH 1GM5A 4XQQA 1BDOA 4BS9A 1I3QB 1F2YA 2F0UA 4X66Q 2Y0SE 5JEAH 1M1KC 1Z2PX 2YL2A 2BH8A 3HOWB 2VXWA 3DWAA 2F0KA 1IBML 3TIIA 5FPOA 2IX1A 3I90A 2KCTA 3TSSA 4ZK9B 5FPRA 5C1OA 5FLXL 3E9HA 4ED1A 4HNVA 3GIQA 1X3FA 3D8GA 4WD3A 4C3JB 1CKNB 4JV1A 4B9XA 2ZJQA 1PLFA 2WIIB 2B8FA 5F9NA 3V96A 4DV3H 1JB3A 5BMVF 2F03A 3GTPH 2L11A 2B8GA 4BXXG 4WFN3 2R93G 3K0XA 2VUGA 4C3HB 2W7PA 4RWSC 4LF6Q 2SDFA 2FK2A 3TS2A 3BZKA 1I3QH 4JI0Q 2XGTA 3T1HQ 2KEDA 1EWHA 1ONLA 2JA7H 3AQQA 1KL9A 3OUUA 2CQOA 1JX4A 1G291 5T1GA 4EFEA 3RTXA 1X55A 2JQOA 3D6CA 4DV2H 2EOTA 3RD4A 1EY6A 1JJ2A 1K73C 2IBKA 2JE6I 2R6GA 1DOKA 1YNNC 2F0LA 2EYMA 5IE8A 4AQYL 3KLSA 3GIIA 3E9IA 2ZDHA 2WKDA 2W8LA 4C2MA 2YZNA 4YHHQ 2UVRA 4ALPA 3OW7A 3G48A 4KKSA 2XIWA 2ZT9C 3OUZA 1I6HB 1EYCA 2RDIA 1U0LA 3HOXB 1EY8A 1YNND 2B39A 3TP7A 1WJJA 3TQ1A 2QILA 2YYZA 3PF5A 3W1BA 1CK1A 1QVFA 2TSSA 2XN9C 2Q2HA 4IN3A 2F0MA 3NHHA 1IBKQ 4XT1B 5HY6A 1E4EA 2DJGC 4QWEA 2QW7A 2J6TA 4JI8L 4KJNA 1XMOL 4ZHQF 2K5QA 3TQTA 2ID0A 2D2CC 2NU7B 2B2TA 3LWBA 3HOYG 4LF7H 5J2UF 4MNOA 2IP4A 3K0YA 4LF8H 1CQFA 1TWGB 2EQSA 2QDLA 1SFOA 4WORA 5I9OA 1Y1VG 5KFJA 4NXMH 1DYQA 1HR0H 2K5DA 1UUPA 2R7KA 4KKUA 4G7HC 1TQOA 2RKSA 1X54A 2FFKB 3MZ5A 4AYBB 4DV5L 4A3EG 3AEVA 4R4IA 1X32A 3S2HH 4JYAL 1IW7C 2LKVA 2QYZA 4NXNL 3KUPA 2KSWA 1GOZA 1STGA 4R4TA 3U9SA 1WD0A 4A3FH 2AWNA 4O2DA 4A3GH 5KFTA 3VR6A 4DR7L 4DV1L 5C5LA 2BCOA 4O3NA 3NBHA 4X6AH 1BXRA 1DOLA 3FDSA 3NWSA 1EQQA 2V5AA 3T53B 4F4WA 4YY3Q 3BG5A 3H0GH 1IW7D 3K57A 1VQOA 1EU3A 1LM0A 1DM0B 2KQ3A 4FXGC 4G57A 3ULLA 2YW2A 2A1AA 2K52A 5EQ0A 3MXPA 1Q46A 1SYEA 1CA5A 4A3KB 4DV4L 1BNZA 3CC4A 5KFYA 3J81j 2BDNA 2EYOA 1B6SA 1D1KA 1PA6A 2JSOA 4LF9Q 4GKJQ 1STEA 1RJTA 2HCCA 2FPGB 1E2ZA 2VQEH 3IN5A 4DV0H 1YIJA 1Y1WB 1SNMA 2UUBQ 1KDBA 1VQGA 2KCNA 2B2VA 1I7NA 2YS6A 2IA6A 3W5OA 1TWAA 2R92H 5CB4F 2R7MA 3V4SA 2K1BA 3PUWA 3UQ8A 5KFHA 5M5XH 1PRTF 3HOVB 2Q2TA 4PNYA 2R7ZH 4B3SL 4J9KA 4JBKA 4Q0YA 1EWCA 1FJGL 1S5ED 1ZHSA 1RK5A 1SDFA 1VQ4A 1IKLA 1EFWA 5KFRA 3M7GA 4KN4C 1PH9A 4BY7H 1SCUB 1TS2A 2FK1A 4AH6A 2L5TA 1RCVD 2AUJD 4JW0A 4IR1A 2UUCQ 4AIMA 5C0XH 1EUDB 3G6EA 5JVG3 3ERQA 2MQHA 2NVQB 3GTJB 2UVVA 1EUCB 3HOVH 3K5HA 2IX3A 2R87A 2VQDA 3HOUB 3SK6A 3GTLB 2M00A 1O80A 1JT8A 3J7ZC 4A3IB 1CHPD 1B44D 1EQRA 4F4YA 5LOVF 3Q6SA 1EZ6A 4KHPQ 4RNMA 3CQZB 2BE5C 5C5JA 1GVPA 2E5LH 1D1IA 2ZM6L 1EEID 4DUZH 3T16A 4J9QA 1B6RA 5DG9A 2JA6A 1PZID 3GTJH 1C8CA 1T9HA 1QJOA 4B3RQ 5KT2A 2F0IA 2NU6B 3PW5A 4UP8A 2K5WA 5JVDF 1D8LA 1EYAA 4N9TA 5LYJF 2BE5D 5IWAL 1TWCH 1FKAH 3J7AF 3FMAA 1PHJA 4TQSA 3KK7A 2MGSA 4J15A 4DN4M 1L0XB 4C3IB 4CC5A 3UDIA 4HIDA 3BDCA 4KV6A 1GO3E 2C9OA 1CKMA 1I4XA 4POFA 2W6ZA 3RBEA 2EJGC 4QWAA 3MFYA 1H9SA 1Q3LA 2HDLA 3MXGA 3GTKA 2OTJA 1S10A 5KT7A 4DKAC 1NNXA 3HOZB 3RGXA 2A73B 4LF6L 2EE1A 1TWFA 1M4VA 4DV7H 5M3FB 4JV5Q 2V4RA 5KFEA 3J7AK 4NW2A 2HJWA 3RF2A 5C44B 5C1PA 4JI1H 5BN3A 3KJPA 2EYJA 4XYOA 4OELB 3P7JA 4L5RC 1WH2A 5A2QE 3KHLA 3CCSA 1PH6A 5DQIA 1ML0D 4JPBW 1RIPA 3K7UC 4BBRG 1Z47A 5KYLA 3GIDA 4APMA 4JI3H 1FR3A 2CH4W 4L5TA 1AP0A 3FKIB 1UC9A 4K0KQ 3IFDA 1KNAA 4O4IF 2HT1A 2XIGA 1HRJA 4ME6A 3I70A 4C1NI 1XTCD 4LMQD 3KLWA 1LO5D 5KFXA 3PW4A 4OONA 5A2QL 2RQXA 1W2BA 3H94A 1XTDA 2JA8B 2NN6I 1G51A 3OPOA 4MN3A 2H4OA 4PQXA 4KD4A 1K9MC 1E4EB 3T5LA 3AFPA 4C2MH 1MBYA 2K4KA 1MI2A 3BG3A 4JUZA 2JEAI 1IYUA 4XYQA 1LT4D 2XRSD 1IBKL 3A7AB 4A3BH 3D31A 1W6JA 5JVH3 4B3ML 5BR8L 1PRTD 1SFOB 4JI7H 3BYTB 4MTDA 1J6QA 4X65H 1BBWA 3PVXA 3I55A 2JEIA 4JBJA 1WI5A 4XTCS 1PMRA 5I4DA 4EFBA 3LWEA 5KFDA 2KVMA 3K59A 4MV7A 4PMCA 3MJFA 3DWQA 1E0BA 2F0VA 2R6FA 1XJVA 1ASZA 2VB2X 3EA6A 2WP8J 4RGTA 2DNCA 1JWSD 5FLMH 1KJ9A 4BY1B 3G7LA 4DFAA 4UCSA 1CI3M 1GSOA 4O1NA 4Q0FA 1QNUA 1D2BA 3RV3A 2IL8A 4KK7A 3NBHB 2A19A 4JI5Q 3HG9A 5J3BA 1XNQL 4DNRB 5JOBA 2K50A 1WTXA 5E4WC 4A3DB 2F4VQ 3K58A 3V05A 4JI6L 5JVLA 1EFID 1W3SA 1PH7A 1Q8KA 1MIUA 1VQBA 5DM73 5L9XA 4BY1H 4OX9L 4DAPA 5IYBH 4MV9A 4DR6H 2K5HA 5IT9c 3QJYA 1ZXTA 1N33L 1SMYC 2RHSB 1A0IA 3S9WA 3CD6A 4XQJA 1E4FT 1TWAB 1QE6A 2JA9A 4KI0A 2VQFH 3HKZE 4ME3A 3V4ZA 1TIID 4DR1H 3RAXA 1GXDC 3DMUA 2UUBL 3I2ZA 2RCNA 3PV0A 5EPKA 2CW8A 1SMYD 4UY8C 1PVOA 3D0FA 5CYUA 1YJ9A 3KFUA 5CGKA 5I6WA 4OO1I 1S5FD 4A3CG 2YTYA 4DR2H 1HXYD 1SMXA 1K83B 4UCOA 3WWVA 4DV6H 4PMBA 3G71A 5LMUQ 3H20A 2CQYA 3S2DB 1YHQA 5D8DA 1ZHQA 3N44B 4NKLA 4FF2A 2I5LX 5J39A 2ZXPA 3S14H 2DWCA 3QZ8A 4PZ6A 3RB3A 5DGAA 3S1RB 3GTOA 1KHIA 3RIZA 5C3XA 3PO2H 4OHJA 2PW7A 1STHA 5IODA 2E2JH 2AHOB 5LMNH 3AMUA 2VY3A 1VQ6A 1STBA 1K0RA 3S15H 2JA7A 4A3JH 4J9MA 1J5EH 2VR1A 5EAYA 1E2VA 3G6JB 1I4PA 4HJ9A 4QQBX 2JA6B 3A55A 1B3QA 1VQPA 1B9MA 2K03A 4CJ0B 1N36L 2WAQG 4LF5Q 1SJHD 4DL4A 3S1RH 4LF4H 4TV8F 4XYMB 2E2DC 1BF4A 3OMGA 4O3SA 3ETJA 4HJAA 1MJEA 5J22A 5CA0F 3MA2B 4EGJA 3SI8A 3QG1A 3J81c 3PO3H 1XXGA 1KAAA 1IBMH 3I4NB 1S5CD 1CS0A 2J9GA 4JBMA 1EIHA 5C3EG 3R5XA 3JRWA 2PMZE 1VKZA 1Z7TA 1E3PA 2OH2A 2E2IA 5KYIA 3EROA 2B2TC 4ULLA 3T1YQ 4XIGS 2JA6H 5BPFA 2D62A 1VBGA 3GV7B 2RVLA 3KAKA 1UE7A 4C5AA 5JPNC 4XXEA 1VBHA 1WTQA 3P1HA 4LUZA 1TWFB 5CBEE 3CCVA 2IHFA 4ZRZA 2C5CA 4PWQA 2UXCH 1EQVA 2PO4A 4RNNA 3I73A 3TREA 1SLJA 1SRUA 1PTOH 2R3ZA 1PDQA 4Z9CB 4HSPA 3KDFA 1EIYB 3CCUA 1PTOF 3HOWG 4ECTA 3KF8A 3S17H 2SEBD 4DAYA 5IYDH 3ICEA 5KFZA 4JV5L 3S1QH 4EGQA 2EIFA 4AQYH 2FMMA 5C4JB 1OXSC 3GV3A 5CV6A 3MAQA 4C3JG 3GTKH 1DD2A 4X64Q 1E1OA 3K5OA 5ELEA 4FP5D 5CAEB 1TWFH 5IGEA 1TA8A 4C3HG 1K1QA 4K0KL 3OHBA 3RB6A 4PZ8A 5D14A 1UEBA 1NR2A 2PCFB 4CDCC 3M3YH 1JOOA 1N34Q 2YU9H 4EYHB 2MUYA 3N6RA 1KQSA 3O13A 3EYYA 1VMPA 4J9OA 5C4ZA 3MR3A 3MWMA 2C2DA 2GA4B 3M4OB 1TR5A 4JI4Q 3H0GA 2DY7A 2YCHA 1EY0A 1PYBA 3MEHA 4GNXA 3JSNA 2IY5B 5C4XB 3IRBA 1QZGA 1B8AA 2F52A 1VQAA 2B2VC 3RUPA 1WYDA 3KBXA 1RODA 2O5JC 2XRQD 1LTRD 1SNPA 2F0PA 1NE3A 1AUXA 5KT5A 1C7YA 5IOCA 1MZBA 4HN7A 1R4QB 2P5ZX 4LMYA 2VL6A 4ECUA 1A15A 2E8GA 1FL0A 2ZJRA 3GIKA 4YCUA 5FLXc 3HOXG 4DV5H 5FK9C 5I2YA 2ASJA 3T4AC 3RGZA 3TMEA 3EPGA 3K3PA 1TWHB 3Q8DA 3PCOB 1NAPA 2PQAA 3M4YA 2PYKA 5EWGA 2JYOA 2B63B 2R92A 1K3BC 1ET6A 4KY7A 4GKKQ 4RZQA 4JYAH 3CCJA 4MZ9A 4NXNH 5M3MH 2F0DA 1SE2A 2R7ZA 4L5QA 4I55F 3L4JA 1GUOA 1YNJC 5D65A 4DR7H 4DV1H 3U9TA 5M5WH 2N3SA 2W6QA 3MXNA 3SK4A 4KHVA 1C3OA 5D1PA 4P71A 3T13A 4DL7A 3R3OA 1XX8A 4DR5Q 1SNQA 1X9NA 4YR0A 4LNQA 2W8KA 1STNA 2HD3A 1YNJD 4KN7C 1BUVT 1BQQT 1EYGA 1W96A 4IWXA 3DHQA 4AYBG 1WCMA 4DV4H 1S3OA 3BVZA 3I7FA 3VYTA 2UXDQ 5GAEC 1DGSA 4EVOA 4K5XA 5ELFA 4EQ5A 1BCPB 3E3XA 3QB3A 3HKZA 4DR3H 5H1SE 2M05A 5GAGC 4MV3A 5FO8B 3U4VA 3CCMA 2EY6A 1HNXH 4LSXA 2EY5A 4FO2A 1L1OA 3OTOQ 3CCRA 2UXBQ 3M4QA 4KKTA 1N9WA 4RAUC 1M6VA 1N32Q 4E6IA 4K8JA 4R9WA 3G4SA 2V4DA 4WRDA 1NY4A 1WTVA 4O0AA 1VQ8A 4B3SH 4K5VA 3ERSX 2YRWA 1K8AC 1FJGH 1UE6A 5CV5A 3S1MH 2R84A 3V2TA 1NJIC 1YNXA 4LUOA 2KUMA 3FPPA 2UUAL 4A3KG 1AUVA 4X62L 1TWCA 1KDAA 2HHHQ 1JDBB 2VNUD 2B2YA 1AN7A 2VW9A 4LFBQ 2F0JA 4IURA 5CA1F 3HKSA 2NVYH 3GLKA 1LTSD 3GTOB 2Z4IA 3GTPB 3LGJA 1HNWL 4PDBA 4MA5A 4DL3A 4BA1I 1Y1WG 4YBZB 2W70A 3SE7A 4OL7A 5LXTF 1VQCA 3GIPA 4QUFA 4A3MB 3SHLA 3RJ0A 2FJ2A 3K7AH 4Q43A 3X3NA 2JA7B 3RLFA 4J9RA 1TS5A 3KF6A 4DV3Q 4GLXA 2NUAB 3E0EA 2RGVA 4QWCA 3HOVG 1PYSB 2XGPA 2ZDQA 5JJLA 3VPDA 1IHZA 5EDWA 1TKWB 3CHBD 2CCZA 4QW9A 4F50A 2UU9L 2A8VA 1BGWA 3GTOH 1EYZA 4RB3C 1EY9A 2ZM6H 4CDDC 3HEJA 1SYFA 1VQ5A 4RKBA 5JPMC 1XDNA 4A3MH 3BDOA 5J1ZA 1O7LA 3K5IA 3I72A 1E24A 5IY0A 5EPJA 4DV2Q 1GSHA 1KJQA 4UFZA 3WNZA 1K0SA 1RKNA 5IWAH 2ZTCA 1YHAA 4OWWB 3PF4A 1X6OA 4YP3A 3H3VH 3HOUG 2DLNA 3OSPA 2V58A 3S1NH 4XDXA 1VQMA 2RSOA 3RR5A 5T1IA 3M9NB 3M9MB 3U9OA 4A3IG 2XWBB 5G3LF 4IR9A 3JAMW 1KNEA 2NBFA 5C3WA 4BBSH 1T36A 2SOBA 4ECVA 1OXTA 1BVSA 4R7RA 2N78A 2SNMA 1HFNA 2L9HA 3A5UA 3NTKA 3OIQA 3BQ0A 1Y1VA 2H5XA 3H91A 4FDBA 4ABNA 1HNZL 4RB1A 3KDFB 3KF8B 2RA4A 4DAYB 2E2IH 4KY6A 1R9TA 2W6MA 2R8JA 1MSHA 1HA6A 3C46A 4IOCA 3T56B 1BJTA 1IBLH 3F2CA 4M9UA 2RDGA 1FVIA 4O2BF 4A93B 1PH8A 2RSNA 1QVCA 4LF7Q 2GPSA 3N41B 4LF8Q 3BA9A 1KAWA 4ZUIA 4C3IG 4ED6A 4GZYC 4O3PA 4DNIA 5AJ3L 3S2HB 4NXMQ 2RHQB 1HR0Q 3MEFA 2EXZA 1P16A 2LS01 2K05A 3BZCA 1PH4A 2IPKD 5FD5A 2WV6D 3QZ7A 2GVBA 4C1NK 1PFBA 2QCPX 4A3FB 4FF3A 3GV5B 4A3GB 1XPRA 3PW2A 1RHPA 3CPWA 2F0OA 5DLQE 3VYUA 1UC8A 2FJZA 4ZI7F 2WACA 3HOZG 2KBNA 2PPBC 3BAAA 1PYWD 1VAJA 3CPFA 1OXXK 3GTQA 5M3FG 1IL2A 2GPWA 3H0GB 2JA5H 3I4MH 4A93H 2FMAA 4CKCA 4GNXB 3ZJYC 1EIFA 3ITPA 5C44G 2VUMA 1LT5D 3GQCA 2LFNA 3F8TA 1BCPC 4B3MH 5BR8H 3GILA 1HPCA 2NU8B 4QIWB 2ZTEA 1WTPA 2A68C 2C00A 5KFCA 1F9SA 4QB4A 3FKIG 1DV2A 1KC7A 2MPMA 2OXPA 1I94L 1SNOA 1CTMA 2D5DA 3J80L 3S16H 5KT6A 1CA6A 3CMAA 4ETSA 2ICIA 1V4YA 5CC4A 1CQJB 4RB2C 1BCPD 2JA8G 5EBCA 1E4GT 2QGQA 3VPCA 4F88A 3NGDA 4LFCL 2R92B 5DAUA 1G8ZD 1PRTB 3HZXA 2A68D 3AU7A 4RGOS 1IL8A 1XNRH 5M5XB 3KTMA 1GSAA 4GLVB 2VQEQ 2FPIB 5HGQA 2R7ZB 4MA0A 4DV0Q 2BQ3A 4HSVA 2RF4A 5IP9H 3RAQA 4EBEA 2F1MA 4JI2L 4RAYA 4HTHA 3K81C 4BY7B 1XNQH 1BOSA 4LFAL 1STAA 1VQDA 1MJCA 2D9UA 2PW5A 3GV6A 4JOIA 3BJUA 1M0WA 4R4CA 3ULPA 4JI6H 1IZ6A 5KFKA 4UPAA 4U6PA 3GTMA 5BN4A 1YZ6A 4PV1C 5C8YF 3ER0A 4GLAC 3MFHA 5GROA 1RYRA 5HGTA 4OX9H 1HCZA 2J6UA 3NUCA 4OO1H 4FVMA 3G6XA 3HKZB 3H3VC 1FYCA 3PIPA 5EWEA 1N33H 2E76C 5KGUA 4BY1G 4CGYB 1WTWA 1A62A 4UCTA 1JOQA 4A76A 5E7NA 1BXTA 2UXDL 1L1OB 2PZUA 4K2KA 1E1TA 3NENA 5HV6A 2JEGA 4O42A 4ECRA 3Q8RB 1D7QA 1ENFA 1YBYA 1MGSA 4RHRA 3UDGA 2WAQE 4DUYH 2SNSA 1WCMH 3CAMA 2OT2A 3MHBA 4A3DG 1YVCA 5DQHA 4UHVA 5DM63 2K6AA 2B2UC 1HTPA 2W9BA 4E4TA 1XMQL 1GUWA 1JLLB 2G5DA 2HVSA 2Q8RE 1TWCB 4DK6C 2F3VA 3AB9A 2E5LQ 4DUZQ 3PUXA 1T5XD 5KNDA 4GN4B 1Q82C 3QWNA 1WOCA 3D4DA 4WJWA 1JJCB 1QOHA 3MXUA 2CW7A 4G7ZC 4WJ3M 3OHXC 1CSQA 2Y0SA 2R61A 4LSAA 4DK1A 2YV5A 1CE8A 1ENCA 4I7AA 1NBWA 1MD2D 1Q1EA 1HTLD 2K7VA 2FPPB 2WFWA 2V4QA 1SR3A 3KF6B 3TQYA 5M5YH 4B3TL 4R8UA 1SSOA 4X66L 1RTNA 1VDZA 5C6AA 4BXXH 2R93H 3QFFA 1XYIA 4JBWA 2WB1E 1ILPA 4YR2A 2D0OA 1HZBA 4XYLB 1SYCA 1N36H 4WBNF 1CFMA 1PFSA 1KJ8A 1ZQ7A 2K28A 5L1JA 4Q8FA 2NB0A 1V51A 4DV7Q 4TVAB 4TUYF 1S97A 2XTIA 1EZ1A 1GHKA 2NVTH 3NWTA 2QEXA 4RHSA 5KX5F 2UVWA 4JI1Q 1S03G 1O7ZA 1Q7YC 3RB4A 1LYLA 4JI0L 4KJOA 1VQ9A 4FS2A 3T1HL 4JI3Q 4DF7A 2K75A 4PMWA 4GNXC 3R23A 3TIGA 3M4PA 3CRLC 2YU9A 2EXDA 1H9RA 4Y7NH 4C2MB 2C28A 1DV1A 3V6JA 4TSSA 2GLTA 4ED7A 2M2LA 1A8VA 2A69D 1HFGA 2JA6G 4A3BB 2RDHA 4JC0A 4Q45A 4A3LG 3J80W 4IRDA 4YHHL 3A56A 5IP7G 3URYA 4F4XA 4DL6A 3SE0A 1B33N 1QWYA 5CV8A 1BNCA 4OWTB 1V9PA 3KOJA 1C48A 3OYYA 1PRTC 3I4NG 2DIKA 3MC0B 4H7BA 4I7HA 1L2ZA 1FNVA 2PI2E 1W6KA 5ELCA 4JI7Q 1L2FA 2DZDA 1V8QA 3T51B 4X65Q 1KEEA 1Y1VH 3WO0A 2PVPA 1CKOA 1Q90A 1C4QA 2WKCA 3MWYW 1KJJA 2ZXOA 1R9TH 1F2MA 4FU0A 1KXLA 4A3EH 3RZOB 2CH4A 1V1QA 3W2DA 1JDEA 3DEPA 3QO2A 2B29A 1KJIA 3GTQB 5L1KA 2AQ1B 5KFGA 1SYBA 1V1PA 1LUZA 2VUMB 4ECQA 1JE5A 3I4LA 2C2RA 3MFIA 3PIOA 3SXHA 4IOAA 3K5MA 2F0EA 5D1OA 3E6ZX 4ZYSA 3H15A 1H9KA 1HQMC 3V6KA 3VR3A 4R1JA 5E1FA 4IZOA 1E22A 5KIXA 2JJQA 2LMCB 4AYBE 3RMHA 4FNFA 4RMFA 4DR4H 2WTFA 1L1OC 1VF5C 4HCSA 4IPDA 3RZOH 5KG1A 1EL0A 2VS1A 5COYA 1Y69U 1WR2A 5EGTA 3KBGA 3TS0A 3C2PA 3GTQH 5M9OA 2MO1A 3VMMA 2EJFC 4IJHA 4L63B 2VUMH 1IOWA 4DR6Q 1GLVA 5FO9B 4QCLA 2N88A 1B53A 1JXLA 1EZ8A 1XPUA 3VA7A 2ZXRA 4YY3L 1SE3A 4DPGA 3QOJA 1VQHA 2B2YC 4LW1A 4CBVA 3Q0AA 4ECXA 2LXJA 5IYCG 1JORA 1B4OA 3CMEA 5KFFA 2HGSA 2VQFQ 1YJNA 2EYFA 5C4XG 3N42B 4DR1Q 5IGFA 4GC7A 1MKHA 4LF9L 1VQIA 3GTMB 4GKJL 3S14B 1SROA 1KRSA 2E74C 2I0QA 4C56C 3JC66 3HGBA 1RK6A 4IFDG 4GOPA 1VQFA 4CDFC 4DR2Q 1ZKOA 2NVYA 5LA6F 2CW0D 1N56A 4ECZA 3GIMA 3STBD 4DV6Q 3PO2B 1EY4A 3AYHB 2LY7A 2E2JB 2OQ0A 3CCEA 4CKBA 3KLRA 4F87A 2XC9A 2QKIC 2B63G 2L1BA 3S15B 3Q8QB 2K04A 3MTSA 4A3JB 5DG7A 4L5SA 3NEMA 1NSNS 3N52A 4IZ8A 4N9PA 3EBEA 2OWOA 3M4IA 3R93A 3GTMH 2JXMB 1FGUA 4RB0A 2ATLA 2W6NA 4K5WA 4OIJA 5KG2A 3LWUA 3I3CA 5LMNQ 1G6PA 2F0QA 5JJIA 4IQZA 1ENAA 1Z2OX 2UUCL 1K8OA 2W9BB 1PFNA 4RG1A 4YAJB 1I4RA 2AGQA 1X3GA 1B70B 1JKJB 2DPJA 2PZWA 1J5EQ 3PO3B 5BPHA 3K3VA 5IGCA 1SEBD 3Q22A 1NMFA 4OIKA 3R5HA 2IJ0A 3OOCA 5KG0A 4L8JA 1YJWA 3JSLA 3VR4A 2B2WA 2UUAH 1WVLA 4X62H 1JE4A 2ZJTA 4LF4Q 2Y0SB 2KHSA 3RBDA 3PGZA 3JZIA 2PBZA 3L9AX 5IIFA 4YJ3F 4Q5VA 3PR4A 3UE1A 1HNWH 1IBMQ 1EY5A 1F77A 4KHPL 1IKMA 2FINB 3IAYA 5EKIA 2V1CC 4R8UB 3OSOA 1ZETA 1A3VA 2OCEA 3R2TA 5EKLA 2JP1A 4JV2A 2HIVA 3NBIA 5FJ8H 4OGQC 3BU2A 1L0WA 1AE3A 5K36G 1EU4A 5F2DA 4B3RL 5ISRA 2WB1A 2C2EA 4UDUC 1PTOB 3SVMA 3NE5B 4HJ5A 5JEAG 3IL8A 2AQ3B 4J9SA 1H9JA 4TRDA 3S17B 1X65A 2J4XA 1CKNA 4L1KA 2FHTA 5LL6X 2UU9H 3S1QB 2RBMA 5ELOA 5KFVA 1H9SB 1F2ZA 2EPBA 3J7YW 4J8QA 4FM9A 3UE0A 3GTGH 2UXCQ 3GTKB 1G91A 4ECSA 4KMUC 3M9BA 4QMGA 5KFQA 3DF7A 1KC8C 1TS4A 5DLFA 3LNNA 1HR0W 1LV9A 2Q8TA 5KFNA 4P74A 3HXLA 5EJWA 2KECA 4WJ4A 3M3YB 4AQYQ 2AMCB 4BBRH 1U9RA 4A3MG 2YU9B 2EY2A 3N6XA 4NLGA 2JA7G 1HJPA 2F0NA 4ME5A 4P75A 4EX5A 1EOTA 2CQAA 3CKIB 1WFQA 1KTKA 4NMZA 2JA5A 3A54A 3L3OC 2ZTDA 3CCLA 3LP8A 3C3LA 5AFWA 4CJ2C 3C1FA 4H02A 1HNZH 1RJRA 4HNTA 2ICEC 2PI2A 4XQNA 2W7OA 5JJZA 3C0FB 2EJMA 2Q2IA 3F2UA 1HZ9A 3TN2A 3RN5A 2Z6BA 4HR7A 2MCTA 3JAME 4TQRA 1CQVA 4DGZA 1X3EA 1XWEA 2O2LD 1GJXA 3E0JA 4U673 3KHRA 4JI8H 1XMOH 1JWMD 4DLKA 4ILWA 5D3IB 1AZQA 4LK1C 1G2SA 1RD9D 4IALA 5IGGA 3P20A 2AGPA 2R7NA 4O4HF 3JAML 2ASDA 5M3MB 1JR0D 1F9RA 1D5XC 4U68A 2K33A 2I8CA 3EVQA 4I7ZC 2O5IC 5K5PA 4DV5Q 1TWGA 2W9CA 2HQEA 4R8NA 2AGOA 1V1PB 5HBRB 3WOFA 4G4KA 2VPSA 5M5WB 4MAMA 1VQKA 3U58A 3Q2OA 1D5MC 3TP6A 3N40P 3BJYA 3BQ2A 5D1OB 4JYAQ 5JUMA 3T5KA 3BA8A 1UWVA 4NXNQ 3JAMi 2I5HA 1WD1A 2EYPA 4HYKA 1DIKA 2XCLA 2W71A 4ECYA 5EOYA 4DR7Q 4DV1Q 2E2HA 4A93G 1SXTA 3RB0A 5L1LA 3W1GA 4HNUA 4J6HA 4EBDA 4UCUA 2NU9B 1ICFB 1M8AA 1TS3A 4LWCA 4RH6A 1I94H 3H40A 4QUCA 5CBAE 1PH3A 3GV8B 2YYAA 1DZ1A 3Q24A 4EBCA 4GS3A 4RCNA 3PUZA 1PZKD 4JI5L 3RUZA 4DV4Q 4A3FG 3NQIA 5FKAC 4A3GG 2DJFC 4RKLA 2RCFA 4LFCH 4P72A 3MWEA 1LT3D 2F4VL 3NTHA 1A2TA 3SGIA 2A6HC 4O3QA 4DR3Q 2CZGA 2C35B 3H0GG 4QJFA 5K2MA 3A8JE 2P0AA 1QUQA 2IHEA 3CXCA 3S1MB 3TRZA 2L4NA 4JI2H 4K14A 1QZHA 1HNXQ 2KENA 4UP9A 4ED0A 1I5FA 3GDEA 4J1MA 4LFAH 1H9MA 4KHZA 3KAJA 4LH6A 2EYHA 3PQIA 2A6HD 3KYHC 4UCVA 2L0CA 1SAPA 2NVYB 4GOPB 1JIHA 4B3SQ 4PZ7A 2IW3A 1N8RC 4NPSA 3WOEA 3SK8A 4A3CH 4RAZA 2IMWP 1FJGQ 4FS1A 1S5BD 1EWIA 4J9LA 1PTOC 2KEEA 4F7XA 1AEXA 3K7AB 2R92G 4O3OA 2OF1A 4S3SA 4HJ7A 1LTLA 1ILQA 3MFGA 2I46A 1I6UA 1BBXC 2AKWB 2R7ZG 3T5JA 2J6SA 2R93A 5IGBA 2OEOA 3OWFA 2R7LA 2NZOA 1PTOD 3EFXD 4FXKC 5LMUL 1WTOA 4BY7G 4TKOB 5GADC 3F2DA 1SYDA 2PZTA 4N8X1 1UNSA 2L15A 2AWOA 5C0XG 4DAMA 2BH2A 5LMNL 1XMQH 3C1EA 3ULJA 2FE3A 3RV4A 3OHAA 2NTSA 2ZM6Q 4ZQIA 2FK3A 1PK8A 2DY8A 4IRCA 3HKZG 1PH5A 1L0YB 3S1NB 3Q8PB 1U4RA 4EEQA 1PX2A 3BABA 2MHVA 1ZEQX 5A35A 5KFMA 5IWAQ 1CT1D 5ELBA 4BBSB 2BQRA 5C3EH 1LTGD 1SE4A 2HCIA 4LF5L 4LH7A 2N49A 2WB1B 1KD1C 1FD7D 1DXMA 3QIAA 2PMZA 5JH7F 4B3TH 2NVXA 3Q8SB 2OQKA 4R4QA 1Q8IA 3SK5A 4X66H 3ETHA 4X3UA 2K5VA 2E2IB 5L37A 1II3A 3CU7A 2OTLA 1I7LA 2A5HA 3CC7A 1C9OA 3GP7A 3U4ZA 3HS0C 4L6TB 4IWYA 4EQNA 2NYZD 1ULZA 2AQ2B 3ORQA 4O3RA 3KJOA 3DUZA 3DLLA 1UE1A 1LTAD 2M9VA 3T5HA 3N8DA 3TEHB 1RL2A 3T1YL 1S40A 3X3MA 2XNAC 3HOWH 2UXCL 2E75C 4LF6H 4TQUS 1IBLQ 5I47A 2HQLA 1G2TA 4MV4A 2NN6H 4O4LF 4JI0H 3M85A 4DNTB 3NPPA 4C3JH 3T1HH 4O2AF 3EIVA 1T94A 5L1IA 5GONF 3PMFA 1DONA 2F4IA 4XZ3B 2NUCA 1A63A 1AH9A 5I9PA 1A6XA 2JA5B 3I4MB 1E2WA 4C3HH 1MHWC 3GIJA 3DM1A 4JV0A 1QILA 1TU2B 2VA2A 5J2TF 4IJLA 2YS7A 3RFCA 4IFDJ 3ZYYX 3FKIA 4HCEA 4FYDA 3F1ZA 2GN5A 5I6YA 2FB9A 5IGDA 3MWDA 4X64L 4QGUA 1IYVA 3I4OA 2D0PA 3H09A 4IUTA 2TMPA 4YHHH 3K6OA 1PXUA 4HR7B 3J81W 1VS0A 3S16B 1NUCA 1CQIB 3LX0A 4G7OC 1LTTD 1U4MA 1U4PA 4EQOA 3CW2C 3FDTA 4A2AA 4DK0A 2AQ4A 4HMIA 2K01A 2K14A 5EPLA 1PZJD 1VQNA 4B3MQ 4ZKCB 3F8NA 5BR8Q 1Y8PB 1N34L 2L55A 3PIP3 2ALZA 2SCUB 1SYGA 3OSNA 4MHEA 3PZPA 1YHBA 1JJGA 2XGQA 1KBLA 5KFSA 3J80E 4POGA 4K6LA 2PQEA 1IBKH 3JRXA 4RCOA 2QF7A 5CV7A 1I6HH 2R7FA 3FRPB 1HZCA 3TZDA 4JI4L 2W9CB 5KFBA 2PN1A 3HOXH 4MTEA 2X0SA 2YZGA 1RF2D 1B50A 3HRZC 4GOPC 3NELA 4A3BG 4RGMA 3UI2A 2KCCA 2LSSA 3L4KA 1OXUA 1XNRQ 3TINA 3SDZA 1S0OA 2VA3A 2IT1A 1VQ7A 1B04A 1O75A 2PQAB 1XPOA 4YB8B 1RDPD 1E7ZA 1QNKA 2O03A 1SJED 4QY7A 4DL5A 2E2HB 4IUPA 5C5MA 2BDOA 4ED2A 2CWAA 4EQPA 1XNQQ 1F9PA 1A9XA 1B2TA 3UDXA 1X3PA 3J80i 3ND9A 3KHHA 1TWGH 1PFMA 3BYYB 1VQLA 5FLMG 1GYFA 4JI6Q 4X3SA 3RLNA 2JEJA 4YWMA 4GKKL 3MXNB 1GGOA 2R82A 3E5SA 1Q86C 3MR6A 1EUJA 2VOBA 5JEAJ 5KG5A 2QDBA 1H95A 2JN4A 1BO0A 5HURA 4GN5A 4OX9Q 3L0OA 3VDYA 4MV8A 4R8IA 3KHGA 5LMNW 1GUSA 2B2WC 1WCMB 2E2HH 1N33Q 4YY3H 2XD4A 5KT4A 1EEFD 1QUQB 4CKEA 3PW0A 1LT6D 4DR5L 2W6PA 4RU9A 2VUMG 1G6ZA 4HMJA 3CCQA 4X3KA 1K3RA 1GHJA 4OXPA 3KLSX 4DR3L 3ONAB 3QOLA 4IFDI 3GO5A 1KABA 2ZJPA 3UFXB 3CRKC 5IYBG 4DUYQ 2HDMA 4FF4A 4LF9H 1HNXL 2C22A 4GKJH 3IKJA 5ELNA 3R2IA 1K8MA 3CP0A 4PG3A 3A74A 2V9WA 1P8LA 2UUBH 5JJKA 4F8MA 4JK1C 5FLXW 5G3LD 4A3KH 4HQ6A 2UXBL 3OTOL 2I80A 3OIPA 1GUTA 5TSSA 2Z9HA 2JK8A 5M5YB 1N32L 4HIMA 2R86A 2F0SA 3P75A 3I91A 4OWXB 1UAPA 4RNOA 2R93B 1NR4A 1KIXA 1K83A 1Y1WH 4B9WA 4DA2A 4IRKA 1QCBD 2R7DA 4IUNA 4LUVA 4MV6A 2Z4HA 1KLUD 1B7YB 1I4GA 1M0TA 2LXKA 2HHHL 2WE6A 5H80A 2FP4B 4LFBL 5KFUA 2EDGA 2UUCH 4CC6A 3L2PA 3GTGA 4Y8VB 2V59A 3UDFA 4YQWA 4I65A 2NVTB 4A4IA 2YRXA 4ECWA 4IUUA 3WDNA 4ZKBB 5KFPA 1Q81C 2F0GA 2W57A 1N36Q 1S72A 1V1OA 4UAIA 4EGVA 3PO2G 4QF4A 4ZCKA 1S4ZA 1B9NA 1Q12A 5CORA 4DV3L 4H13C 4Y7NB 3DWPA 4A3JG 3K5LA 4FBTA 5JQWA 2NVQH 4KHPH 4IPGA 2PMZB 2NVXB 3Q1KA 5LP6F 2Z6KA 3HOUH 4X3TA 4JG2A 4NP5A 4J9NA 3B6YA 3N43B 3GTLH 1SEIA 4B3RH 5FOBB 4ZLTF 2PNHA 3PIO3 4A3IH 1QG7A 2A69C 3GD7A 2Q2UA 1D6EC 3PO3G 5FJ8G 4I50F 3I12A 2L12A 3CQZH 2KJXA 1HUMA 3I56A 4DV2L 4U7CA 4YJ2F 4IO9A 2BA1A 4QL5A 3HOYB 2EYLA 5C4HA 1TY2A 2YTVA 2Z1CA 2Y0SG 1DOMA 1SNCA 4DK3C 2NVXH 1Y1VB 3H4BA 2R8GA 4IUQA 3BVMA 4DU9A 5KG7A 1R9TB 1X3QA 1W93A 3NQTA 1EY7A 4A3EB 2ENBA 1BBUA 2VPQA 3H3VI 5DLGA 5CMDA 4C3IH 1IBLL 3HFZB 2KOLA 1QB5D 1ET9A 2N8NA 2BQUA 4JV5H 1SYXB 4UCRA 1AW7A 1SBBB 4XT3B 3FMCA 3CC2A 5BN5A 3HOYH 3R8BA 2R85A 4EG0A 1K28A 5IYDG 3FVQA 1M90C 3G6YA 4CHTB 1TY0A 1LTBD 1AN8A 4LF7L 3HOZH 2NTTA 4DXGA 4LF8L 1IOVA 2I5MX 4M1UB 5GQOA 4IPCA 5M3FH 4ZOLF 4K0KH 1HUNA 2WDTA 3ORRA 4NXML 1GUGA 3EPIA 5KG4A 3PSIA 3F2BA 5I2XA 1HR0L 3A7LA 3RZDB 5EZYF 3MR2A 5C44H 1S0NA 4LAAA 1JOKA 1O7YA 4YWLA 3HP3A 4K6DA 2RGRA 5NUCA 4ODGA 1NCVA 3DEOA 3Q23A 2DGYA 4N8FA 4DR4Q 3FKIH 2ES2A 1WTHA 2BR0A
chains in the Genus database with same CATH topology
1VQCA 1O7IA 3K8AA 2UUBQ 1HJPA 1VQGA 2JA7G 4P75A 3K7AH 1GKHA 4EX5A 3W5OA 5C0XJ 1WFQA 3RLFA 1NTGA 1Y14B 3KF6A 4DV3Q 4GLXA 2JA8H 3E0EA 2R92H 3HOVG 3PUWA 1PYSB 5M5XH 3RZDH 2ZTDA 2Q2TA 5JJLA 3CCLA 2HIXA 2R7ZH 4YCVA 4B3SL 2CCZA 4JBKA 4QIWE 1K8GA 1CSPA 2UU9L 4H02A 1FJGL 2A8VA 3GTOH 1VQ4A 1EFWA 1VQ5A 2CFMA 2PI2A 1PH9A 4BY7H 1XNRL 2F3IA 2Q2IA 4AH6A 1HZ9A 3RN5A 4A3MH 2UUCQ 1SFOH 4AIMA 1E24A 5IY0A 3G6EA 4DV2Q 1X3EA 2ZTCA 2MQHA 1YHAA 2VQEL 4OWWB 2FXQA 3STBC 3PF4A 1X6OA 4DV0L 3HOVH 3H3VH 2ATWA 3HOUG 5M3MG 3S1NH 1VQMA 3RR5A 2Z0SA 1CUKA 2CKZB 4A3IG 1JT8A 2K5NA 3J7ZC 4DV5Q 4BBSH 1OXTA 1BVSA 1EQRA 2N78A 1VQJA 2VZAA 4KHPQ 1VQKA 3A5UA 3U58A 3PUYA 1GVPA 1YI2A 2H5XA 4FDBA 4GN3B 1HNZL 2ZM6L 3OW2A 3KDFB 4JYAQ 1UWVA 3KF8B 2E2IH 4DAYB 3JAMi 3GTJH 4NXNQ 1T9HA 2I5HA 4A75A 1PH2A 4B3RQ 4A3DH 4IOCA 4UP8A 4DR7Q 4DV1Q 4A93G 3F2CA 1D8LA 1FVIA 5IWAL 1TWCH 3W1GA 1PH8A 1QVCA 4LF7Q 4DUYL 4LWCA 1PHJA 1Z9FA 4LF8Q 1KAWA 4DNIA 1HZAA 4J15A 5AJ3L 1PH3A 2UUAQ 4NXMQ 2RHQB 3UDIA 4X62Q 4HIDA 1HR0Q 3MEFA 4HIKA 1GO3E 4GS3A 1P16A 3BZCA 3PUZA 4IPHA 4JI5L 1CKMA 4POFA 4DV4Q 4A3FG 1YITA 1PH4A 4A3GG 2GVBA 5GAHC 4P72A 2F4VL 1XPRA 3CPWA 5DLQE 4JCVE 1HNWQ 3SGIA 1TWAH 3JAMc 3HOZG 2OTJA 4DR3Q 3FP9A 2KBNA 2C35B 1X56A 3H0GG 4QJFA 3FHWA 3CPFA 4DKAC 5C0XI 1QUQA 1OXXK 2MNAA 2IHEA 3S24A 5M3FG 2E5LL 3CXCA 4DUZL 2JA5H 4LF6L 2KHIA 1IL2A 3I4MH 1HNXQ 1QZHA 4GNXB 3TRZA 2KENA 3ZJYC 4JV5Q 1EIFA 5C44G 4UP9A 1I5FA 3GDEA 3RNUA 4KHZA 3F8TA 3KJPA 3KYHC 3M7NA 2ZTEA 4GOPB 2B3GA 4L5RC 3CCSA 1PH6A 4PZ7A 4B3SQ 1K83H 1N8RC 1RIPA 3FKIG 3K7UC 1Z47A 4NPSA 4BBRG 2UU9Q 1FJGQ 4A3CH 4L5TA 1I94L 3S16H 3S2DH 4K0KQ 1EWIA 2HT1A 1HH2P 3CMAA 4NB3A 2MFIA 1VQEA 3KLWA 4OONA 2JA8G 2R92G 2QGQA 4HJ7A 1W2BA 1XTDA 1LTLA 4LFCL 2NN6I 1G51A 2AKWB 2R7ZG 3A5ZB 4KLKA 3AFQA 4GLVB 2VQEQ 5HGQA 4DV0Q 1K9MC 2NZOA 2RF4A 5IP9H 3AFPA 4C2MH 1V43A 5LMUL 2K4KA 4JI2L 4DV7L 4BY7G 3CF5A 5GADC 2JEAI 3F2DA 3EN2A 3K81C 4LFAL 3PUVA 1VQDA 2L15A 3J7A5 1MJCA 1IBKL 2AWOA 3D31A 5C0XG 4A3BH 4JI1L 4JOIA 4DAMA 5BR8L 4B3ML 2BH2A 5LMNL 3BJUA 4R4CA 3ULPA 1IZ6A 1J6QA 3ULJA 1BBWA 4UPAA 3I55A 4A3LH 4JI3L 1IYJB 1YZ6A 1WI5A 4JBJA 4XTCS 1HNZQ 1JB7A 2ZM6Q 3ER0A 4GLAC 5IP7H 5GROA 1TXYA 4P73A 3HKZG 2GVAA 1PH5A 1XJVA 1BKBA 1ASZA 3I4NH 3PIPA 4BBSG 2WP8J 4BY1G 5IWAQ 3U50C 1A62A 5FLMH 5C3EH 2WB1G 4A76A 5E7NA 4JI8Q 2UXDL 1L1OB 1XMOQ 4LF5L 2N49A 1E1TA 3NENA 1KD1C 2DUDA 5AJ3Q 2NN6G 1D7QA 2CWPA 1YBYA 2OQKA 4R4QA 3NBHB 2A19A 2K5VA 2WAQE 3UDGA 5J3BA 4JI5Q 1XNQL 4A3DG 1WCMH 3CAMA 2K50A 2OTLA 1YVCA 2F4VQ 3CC7A 1XMQL 1C9OA 4JOIC 4JI7L 3U4ZA 4JI6L 4X65L 1Q1BA 3K80C 1UE5A 1OTCA 4DK6C 2E5LQ 1W3SA 3KJOA 2BA0A 3DLLA 1Q8KA 1MIUA 1UE1A 4DUZQ 1PH7A 3PUXA 1VQBA 3TEHB 1RL2A 4GN4B 3T1YL 1S40A 1Q82C 1WOCA 4BY1H 3HOWH 1JJCB 4OX9L 5IYBH 2UXCL 2UXBQ 2K5HA 5IT9c 1CSQA 5C4JH 4WJ3M 4TQUS 1IBLQ 1N33L 2HQLA 2YV5A 2IX0A 2RHSB 1A0IA 1NBWA 3M85A 1PH1A 3CD6A 4C3JH 1Q1EA 3EIVA 1I94Q 2WFWA 1SR3A 2JA9A 3KF6B 3TQYA 5M5YH 2JA5G 4B3TL 3I4MG 1A63A 1AH9A 4KI0A 4DR4L 3HKZE 4ME3A 4YCWA 4C3HH 1AE2A 4X66L 2UUBL 4BA2I 3I2ZA 2RCNA 3PV0A 4BXXH 2R93H 4Y52H 2I0QA 4LFCQ 3L7ZC 4IJLA 4UY8C 3D0FA 4IFDJ 1PVOA 1YJ9A 4JBWA 4UP7A 3KFUA 2WB1E 3F1ZA 2GN5A 2D0OA 4OO1I 1HZBA 2QA4A 4X64L 1PV4A 2YTYA 4QGUA 1PFSA 3I4OA 2D0PA 3M4OH 1ASYA 1SMXA 4A3CG 3WWVA 5IYCH 4JI2Q 3G71A 5LMUQ 4DV7Q 1VS0A 4TVAB 1YHQA 5C4XH 2XTIA 2I5LX 4LFAQ 3CW2C 1VCIA 3S14H 4DR6L 2NVTH 2QEXA 2K14A 1VQNA 4PZ6A 4JI1Q 4HIOA 5BR8Q 1N34L 4B3MQ 1Q7YC 1OXVA 1LYLA 4JI0L 1YHBA 1JJGA 1VQ9A 1KHIA 3J81i 3T1HL 4JI3Q 4POGA 3PO2H 1KRTA 2K75A 4PMWA 4GNXC 5IP9G 3M4PA 2E2JH 2ASBA 1NMGA 2AHOB 2EXDA 1I6HH 2R7FA 1HZCA 2KCMA 2VY3A 4Y7NH 2VQFL 4JI4L 1VQ6A 4DR1L 3HOXH 1K0RA 1QVGA 1YEZA 1TWHH 3S15H 4A3JH 1U5KA 4GOPC 2ALYB 3NELA 1EOVA 2B63H 1IXRA 4A3BG 1A8VA 2LSSA 5EAYA 2JA6G 2JEBI 4YWKA 4JC0A 4HJ9A 1OXUA 1XNRQ 4A3LG 4QQBX 4DR2L 2IT1A 1VQPA 1N36L 1VQ7A 2PQAB 2WAQG 3DM3A 1XPOA 4LF5Q 4YHHL 1E7ZA 4DV6L 2MO0A 4QY7A 5IP7G 3RLOA 3S1RH 4HJAA 1MJEA 4APVA 4OWTB 1V9PA 2CWAA 3KOJA 3OYYA 1XNQQ 3I4NG 3J81c 4OO1G 3PO3H 2Z6KC 3UDXA 1C0AA 3J80i 2PI2E 1TWGH 1VQLA 4JBMA 1XMQQ 4JI7Q 1L2FA 1GD7A 5FLMG 4JI6Q 5C3EG 3RLNA 1I50H 4X65Q 4YWMA 2PMZE 3MXNB 4GKKL 1E3PA 1Y1VH 2NZHA 1Q86C 1CKOA 3A0JA 1JMCA 2YTXA 1EUJA 2KHJA 5JEAJ 3T1YQ 1H95A 4XIGS 4R4OA 2JA6H 2D62A 1R9TH 4GN5A 4OX9Q 3L0OA 3VDYA 3RN2A 4A3EH 1KXLA 1UE7A 1WCMG 5LMNW 1V1QA 1J5EL 2E2HH 1N33Q 1QUQB 2B29A 4LUZA 4DR5L 1SE8A 2VUMG 4HJ8A 3CCVA 2IHFA 4MTNA 3CCQA 1LUZA 1K3RA 1JE5A 3TREA 1SLJA 1SRUA 4B3TQ 4OXPA 1SN8A 3J80c 3PIOA 4DR3L 4LF4L 4IOAA 3KDFA 1GM5A 1EIYB 4IFDI 3CCUA 3GO5A 3HOWG 4X66Q 2ZJPA 2Y0SE 5IYBG 1M1KC 3H15A 4DUYQ 3ICEA 3S17H 5IYDH 2BH8A 4R1JA 1HNXL 4JV5L 3S1QH 1E22A 5ELNA 1IBML 2JJQA 2EIFA 4AYBE 2IX1A 3CP0A 4PG3A 4RMFA 2KCTA 1L1OC 1OXSC 3E9HA 4IPDA 3A74A 3GTKH 3RZOH 1P8LA 4X64Q 1X3FA 2VS1A 1E1OA 5JJKA 1CKNB 2ZJQA 3TS0A 4A3KH 3GTQH 2UXBL 3OTOL 1TWFH 2MO1A 4IJHA 2JK8A 1N32L 4HIMA 2VUMH 3GTPH 4K0KL 4PZ8A 4OWXB 4BXXG 4DR6Q 1UEBA 3K0XA 2R93G 3M3YH 4LF6Q 1XPUA 1N34Q 1KIXA 2YU9H 3TS2A 4YY3L 3BZKA 4DPGA 1I3QH 1Y1WH 1KQSA 4JI0Q 1VQHA 4LW1A 2XGTA 3T1HQ 2R7DA 4LUVA 2JA7H 2LXJA 3AQQA 1KL9A 1B7YB 5IYCG 3CMEA 2LXKA 2HHHL 2CQOA 4JI4Q 2VQFQ 1G291 1YJNA 4LFBL 5C4XG 1PYBA 4DR1Q 4GNXA 3L2PA 2IY5B 1X55A 2JQOA 1MKHA 3IRBA 1B8AA 1QZGA 1VQIA 2F52A 4LF9L 1VQAA 3UDFA 4GKJL 1SROA 1KRSA 1K73C 4A4IA 1WYDA 1JJ2A 2JE6I 2R6GA 3JC66 5IE8A 4AQYL 3E9IA 1Q81C 4IFDG 4GOPA 1VQFA 4DR2Q 1NE3A 1S72A 1N36Q 3PO2G 1C7YA 4YHHQ 3STBD 4DV6Q 4ALPA 2VL6A 3G48A 2E8GA 1FL0A 3AYHB 2ZJRA 1Q12A 4YCUA 4DV3L 2OQ0A 3CCEA 5FLXc 3HOXG 4A3JG 1U0LA 2B63G 2NVQH 4IPGA 1WJJA 3PCOB 2PQAA 3Q8DA 2YYZA 4L5SA 3NEMA 3PF5A 3W1BA 2OWOA 3EBEA 2Z6KA 1QVFA 4GKKQ 3CCJA 3GTMH 3HOUH 1FGUA 4JG2A 2Q2HA 4MZ9A 5M3MH 1IBKQ 3B6YA 5HY6A 3GTLH 4L5QA 5LMNQ 1G6PA 4JI8L 2PNHA 5JJIA 4A3IH 1XMOL 3GD7A 2UUCL 2Q2UA 3PO3G 4RG1A 5M5WH 5FJ8G 2ID0A 2N3SA 1X3GA 1B70B 3CQZH 3I56A 4DV2L 1J5EQ 4P71A 3HOYG 4MNOA 4IO9A 2BA1A 4DR5Q 1NMFA 4QL5A 2EQSA 1X9NA 4LNQA 1YJWA 1Y1VG 2YTVA 2Y0SG 4DK3C 2NVXH 4A93H 4LF4Q 1EYGA 4AYBG 3PGZA 1S3OA 1X54A 4A3EG 3I7FA 4DV5L 2UXDQ 3AEVA 5GAEC 1DGSA 3UE1A 4EQ5A 1IBMQ 4KHPL 1BBUA 4R4IA 5H1SE 5GAGC 2V1CC 3H3VI 3S2HH 2OCEA 4C3IH 1IBLL 4JYAL 2HIVA 3HFZB 3U4VA 3CCMA 2N8NA 5FJ8H 4NXNL 3CCRA 3OTOQ 1L1OA 3BU2A 1AE3A 1L0WA 3HOYH 3M4QA 4R4TA 1N9WA 3CC2A 4B3RL 5K36G 4A3FH 1N32Q 2AWNA 4O2DA 3G4SA 4HJ5A 4A3GH 5IYDG 5JEAG 4DV1L 4DR7L 1NY4A 1M90C 4O0AA 4X6AH 1VQ8A 1X65A 1CKNA 1EQQA 3ERSX 4YY3Q 1K8AC 4LF7L 3HOZH 1UE6A 3H0GH 5ELOA 1VQOA 4LF8L 3S1MH 1LM0A 2I5MX 5M3FH 5GQOA 4IPCA 1NJIC 3UE0A 1YNXA 4LUOA 3ULLA 3GTGH 2UXCQ 4NXML 2UUAL 4A3KG 3PSIA 2A1AA 3F2BA 2K52A 4X62L 1HR0L 2HHHQ 5C44H 1Q46A 3M9BA 2VNUD 4DV4L 3CC4A 2VW9A 4LFBQ 1KC8C 3J81j 4YWLA 3HKSA 1HR0W 2NVYH 1PA6A 4P74A 4LF9Q 4GKJQ 3LGJA 1HNWL 4WJ4A 2DGYA 4AQYQ 4DR4Q 3FKIH 2AMCB 4BA1I 4BBRH 4A3MG 1Y1WG 2ES2A 1YIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQC A;  1O7I A;  3K8A A;  2UUB Q;  1HJP A;  1VQG A;  2JA7 G;  4P75 A;  3K7A H;  1GKH A;  4EX5 A;  3W5O A;  5C0X J;  1WFQ A;  3RLF A;  1NTG A;  1Y14 B;  3KF6 A;  4DV3 Q;  4GLX A;  2JA8 H;  3E0E A;  2R92 H;  3HOV G;  3PUW A;  1PYS B;  5M5X H;  3RZD H;  2ZTD A;  2Q2T A;  5JJL A;  3CCL A;  2HIX A;  2R7Z H;  4YCV A;  4B3S L;  2CCZ A;  4JBK A;  4QIW E;  1K8G A;  1CSP A;  2UU9 L;  4H02 A;  1FJG L;  2A8V A;  3GTO H;  1VQ4 A;  1EFW A;  1VQ5 A;  2CFM A;  2PI2 A;  1PH9 A;  4BY7 H;  1XNR L;  2F3I A;  2Q2I A;  4AH6 A;  1HZ9 A;  3RN5 A;  4A3M H;  2UUC Q;  1SFO H;  4AIM A;  1E24 A;  5IY0 A;  3G6E A;  4DV2 Q;  1X3E A;  2ZTC A;  2MQH A;  1YHA A;  2VQE L;  4OWW B;  2FXQ A;  3STB C;  3PF4 A;  1X6O A;  4DV0 L;  3HOV H;  3H3V H;  2ATW A;  3HOU G;  5M3M G;  3S1N H;  1VQM A;  3RR5 A;  2Z0S A;  1CUK A;  2CKZ B;  4A3I G;  1JT8 A;  2K5N A;  3J7Z C;  4DV5 Q;  4BBS H;  1OXT A;  1BVS A;  1EQR A;  2N78 A;  1VQJ A;  2VZA A;  4KHP Q;  1VQK A;  3A5U A;  3U58 A;  3PUY A;  1GVP A;  1YI2 A;  2H5X A;  4FDB A;  4GN3 B;  1HNZ L;  2ZM6 L;  3OW2 A;  3KDF B;  4JYA Q;  1UWV A;  3KF8 B;  2E2I H;  4DAY B;  3JAM i;  3GTJ H;  4NXN Q;  1T9H A;  2I5H A;  4A75 A;  1PH2 A;  4B3R Q;  4A3D H;  4IOC A;  4UP8 A;  4DR7 Q;  4DV1 Q;  4A93 G;  3F2C A;  1D8L A;  1FVI A;  5IWA L;  1TWC H;  3W1G A;  1PH8 A;  1QVC A;  4LF7 Q;  4DUY L;  4LWC A;  1PHJ A;  1Z9F A;  4LF8 Q;  1KAW A;  4DNI A;  1HZA A;  4J15 A;  5AJ3 L;  1PH3 A;  2UUA Q;  4NXM Q;  2RHQ B;  3UDI A;  4X62 Q;  4HID A;  1HR0 Q;  3MEF A;  4HIK A;  1GO3 E;  4GS3 A;  1P16 A;  3BZC A;  3PUZ A;  4IPH A;  4JI5 L;  1CKM A;  4POF A;  4DV4 Q;  4A3F G;  1YIT A;  1PH4 A;  4A3G G;  2GVB A;  5GAH C;  4P72 A;  2F4V L;  1XPR A;  3CPW A;  5DLQ E;  4JCV E;  1HNW Q;  3SGI A;  1TWA H;  3JAM c;  3HOZ G;  2OTJ A;  4DR3 Q;  3FP9 A;  2KBN A;  2C35 B;  1X56 A;  3H0G G;  4QJF A;  3FHW A;  3CPF A;  4DKA C;  5C0X I;  1QUQ A;  1OXX K;  2MNA A;  2IHE A;  3S24 A;  5M3F G;  2E5L L;  3CXC A;  4DUZ L;  2JA5 H;  4LF6 L;  2KHI A;  1IL2 A;  3I4M H;  1HNX Q;  1QZH A;  4GNX B;  3TRZ A;  2KEN A;  3ZJY C;  4JV5 Q;  1EIF A;  5C44 G;  4UP9 A;  1I5F A;  3GDE A;  3RNU A;  4KHZ A;  3F8T A;  3KJP A;  3KYH C;  3M7N A;  2ZTE A;  4GOP B;  2B3G A;  4L5R C;  3CCS A;  1PH6 A;  4PZ7 A;  4B3S Q;  1K83 H;  1N8R C;  1RIP A;  3FKI G;  3K7U C;  1Z47 A;  4NPS A;  4BBR G;  2UU9 Q;  1FJG Q;  4A3C H;  4L5T A;  1I94 L;  3S16 H;  3S2D H;  4K0K Q;  1EWI A;  2HT1 A;  1HH2 P;  3CMA A;  4NB3 A;  2MFI A;  1VQE A;  3KLW A;  4OON A;  2JA8 G;  2R92 G;  2QGQ A;  4HJ7 A;  1W2B A;  1XTD A;  1LTL A;  4LFC L;  2NN6 I;  1G51 A;  2AKW B;  2R7Z G;  3A5Z B;  4KLK A;  3AFQ A;  4GLV B;  2VQE Q;  5HGQ A;  4DV0 Q;  1K9M C;  2NZO A;  2RF4 A;  5IP9 H;  3AFP A;  4C2M H;  1V43 A;  5LMU L;  2K4K A;  4JI2 L;  4DV7 L;  4BY7 G;  3CF5 A;  5GAD C;  2JEA I;  3F2D A;  3EN2 A;  3K81 C;  4LFA L;  3PUV A;  1VQD A;  2L15 A;  3J7A 5;  1MJC A;  1IBK L;  2AWO A;  3D31 A;  5C0X G;  4A3B H;  4JI1 L;  4JOI A;  4DAM A;  5BR8 L;  4B3M L;  2BH2 A;  5LMN L;  3BJU A;  4R4C A;  3ULP A;  1IZ6 A;  1J6Q A;  3ULJ A;  1BBW A;  4UPA A;  3I55 A;  4A3L H;  4JI3 L;  1IYJ B;  1YZ6 A;  1WI5 A;  4JBJ A;  4XTC S;  1HNZ Q;  1JB7 A;  2ZM6 Q;  3ER0 A;  4GLA C;  5IP7 H;  5GRO A;  1TXY A;  4P73 A;  3HKZ G;  2GVA A;  1PH5 A;  1XJV A;  1BKB A;  1ASZ A;  3I4N H;  3PIP A;  4BBS G;  2WP8 J;  4BY1 G;  5IWA Q;  3U50 C;  1A62 A;  5FLM H;  5C3E H;  2WB1 G;  4A76 A;  5E7N A;  4JI8 Q;  2UXD L;  1L1O B;  1XMO Q;  4LF5 L;  2N49 A;  1E1T A;  3NEN A;  1KD1 C;  2DUD A;  5AJ3 Q;  2NN6 G;  1D7Q A;  2CWP A;  1YBY A;  2OQK A;  4R4Q A;  3NBH B;  2A19 A;  2K5V A;  2WAQ E;  3UDG A;  5J3B A;  4JI5 Q;  1XNQ L;  4A3D G;  1WCM H;  3CAM A;  2K50 A;  2OTL A;  1YVC A;  2F4V Q;  3CC7 A;  1XMQ L;  1C9O A;  4JOI C;  4JI7 L;  3U4Z A;  4JI6 L;  4X65 L;  1Q1B A;  3K80 C;  1UE5 A;  1OTC A;  4DK6 C;  2E5L Q;  1W3S A;  3KJO A;  2BA0 A;  3DLL A;  1Q8K A;  1MIU A;  1UE1 A;  4DUZ Q;  1PH7 A;  3PUX A;  1VQB A;  3TEH B;  1RL2 A;  4GN4 B;  3T1Y L;  1S40 A;  1Q82 C;  1WOC A;  4BY1 H;  3HOW H;  1JJC B;  4OX9 L;  5IYB H;  2UXC L;  2UXB Q;  2K5H A;  5IT9 c;  1CSQ A;  5C4J H;  4WJ3 M;  4TQU S;  1IBL Q;  1N33 L;  2HQL A;  2YV5 A;  2IX0 A;  2RHS B;  1A0I A;  1NBW A;  3M85 A;  1PH1 A;  3CD6 A;  4C3J H;  1Q1E A;  3EIV A;  1I94 Q;  2WFW A;  1SR3 A;  2JA9 A;  3KF6 B;  3TQY A;  5M5Y H;  2JA5 G;  4B3T L;  3I4M G;  1A63 A;  1AH9 A;  4KI0 A;  4DR4 L;  3HKZ E;  4ME3 A;  4YCW A;  4C3H H;  1AE2 A;  4X66 L;  2UUB L;  4BA2 I;  3I2Z A;  2RCN A;  3PV0 A;  4BXX H;  2R93 H;  4Y52 H;  2I0Q A;  4LFC Q;  3L7Z C;  4IJL A;  4UY8 C;  3D0F A;  4IFD J;  1PVO A;  1YJ9 A;  4JBW A;  4UP7 A;  3KFU A;  2WB1 E;  3F1Z A;  2GN5 A;  2D0O A;  4OO1 I;  1HZB A;  2QA4 A;  4X64 L;  1PV4 A;  2YTY A;  4QGU A;  1PFS A;  3I4O A;  2D0P A;  3M4O H;  1ASY A;  1SMX A;  4A3C G;  3WWV A;  5IYC H;  4JI2 Q;  3G71 A;  5LMU Q;  4DV7 Q;  1VS0 A;  4TVA B;  1YHQ A;  5C4X H;  2XTI A;  2I5L X;  4LFA Q;  3CW2 C;  1VCI A;  3S14 H;  4DR6 L;  2NVT H;  2QEX A;  2K14 A;  1VQN A;  4PZ6 A;  4JI1 Q;  4HIO A;  5BR8 Q;  1N34 L;  4B3M Q;  1Q7Y C;  1OXV A;  1LYL A;  4JI0 L;  1YHB A;  1JJG A;  1VQ9 A;  1KHI A;  3J81 i;  3T1H L;  4JI3 Q;  4POG A;  3PO2 H;  1KRT A;  2K75 A;  4PMW A;  4GNX C;  5IP9 G;  3M4P A;  2E2J H;  2ASB A;  1NMG A;  2AHO B;  2EXD A;  1I6H H;  2R7F A;  1HZC A;  2KCM A;  2VY3 A;  4Y7N H;  2VQF L;  4JI4 L;  1VQ6 A;  4DR1 L;  3HOX H;  1K0R A;  1QVG A;  1YEZ A;  1TWH H;  3S15 H;  4A3J H;  1U5K A;  4GOP C;  2ALY B;  3NEL A;  1EOV A;  2B63 H;  1IXR A;  4A3B G;  1A8V A;  2LSS A;  5EAY A;  2JA6 G;  2JEB I;  4YWK A;  4JC0 A;  4HJ9 A;  1OXU A;  1XNR Q;  4A3L G;  4QQB X;  4DR2 L;  2IT1 A;  1VQP A;  1N36 L;  1VQ7 A;  2PQA B;  2WAQ G;  3DM3 A;  1XPO A;  4LF5 Q;  4YHH L;  1E7Z A;  4DV6 L;  2MO0 A;  4QY7 A;  5IP7 G;  3RLO A;  3S1R H;  4HJA A;  1MJE A;  4APV A;  4OWT B;  1V9P A;  2CWA A;  3KOJ A;  3OYY A;  1XNQ Q;  3I4N G;  3J81 c;  4OO1 G;  3PO3 H;  2Z6K C;  3UDX A;  1C0A A;  3J80 i;  2PI2 E;  1TWG H;  1VQL A;  4JBM A;  1XMQ Q;  4JI7 Q;  1L2F A;  1GD7 A;  5FLM G;  4JI6 Q;  5C3E G;  3RLN A;  1I50 H;  4X65 Q;  4YWM A;  2PMZ E;  3MXN B;  4GKK L;  1E3P A;  1Y1V H;  2NZH A;  1Q86 C;  1CKO A;  3A0J A;  1JMC A;  2YTX A;  1EUJ A;  2KHJ A;  5JEA J;  3T1Y Q;  1H95 A;  4XIG S;  4R4O A;  2JA6 H;  2D62 A;  1R9T H;  4GN5 A;  4OX9 Q;  3L0O A;  3VDY A;  3RN2 A;  4A3E H;  1KXL A;  1UE7 A;  1WCM G;  5LMN W;  1V1Q A;  1J5E L;  2E2H H;  1N33 Q;  1QUQ B;  2B29 A;  4LUZ A;  4DR5 L;  1SE8 A;  2VUM G;  4HJ8 A;  3CCV A;  2IHF A;  4MTN A;  3CCQ A;  1LUZ A;  1K3R A;  1JE5 A;  3TRE A;  1SLJ A;  1SRU A;  4B3T Q;  4OXP A;  1SN8 A;  3J80 c;  3PIO A;  4DR3 L;  4LF4 L;  4IOA A;  3KDF A;  1GM5 A;  1EIY B;  4IFD I;  3CCU A;  3GO5 A;  3HOW G;  4X66 Q;  2ZJP A;  2Y0S E;  5IYB G;  1M1K C;  3H15 A;  4DUY Q;  3ICE A;  3S17 H;  5IYD H;  2BH8 A;  4R1J A;  1HNX L;  4JV5 L;  3S1Q H;  1E22 A;  5ELN A;  1IBM L;  2JJQ A;  2EIF A;  4AYB E;  2IX1 A;  3CP0 A;  4PG3 A;  4RMF A;  2KCT A;  1L1O C;  1OXS C;  3E9H A;  4IPD A;  3A74 A;  3GTK H;  3RZO H;  1P8L A;  4X64 Q;  1X3F A;  2VS1 A;  1E1O A;  5JJK A;  1CKN B;  2ZJQ A;  3TS0 A;  4A3K H;  3GTQ H;  2UXB L;  3OTO L;  1TWF H;  2MO1 A;  4IJH A;  2JK8 A;  1N32 L;  4HIM A;  2VUM H;  3GTP H;  4K0K L;  4PZ8 A;  4OWX B;  4BXX G;  4DR6 Q;  1UEB A;  3K0X A;  2R93 G;  3M3Y H;  4LF6 Q;  1XPU A;  1N34 Q;  1KIX A;  2YU9 H;  3TS2 A;  4YY3 L;  3BZK A;  4DPG A;  1I3Q H;  1Y1W H;  1KQS A;  4JI0 Q;  1VQH A;  4LW1 A;  2XGT A;  3T1H Q;  2R7D A;  4LUV A;  2JA7 H;  2LXJ A;  3AQQ A;  1KL9 A;  1B7Y B;  5IYC G;  3CME A;  2LXK A;  2HHH L;  2CQO A;  4JI4 Q;  2VQF Q;  1G29 1;  1YJN A;  4LFB L;  5C4X G;  1PYB A;  4DR1 Q;  4GNX A;  3L2P A;  2IY5 B;  1X55 A;  2JQO A;  1MKH A;  3IRB A;  1B8A A;  1QZG A;  1VQI A;  2F52 A;  4LF9 L;  1VQA A;  3UDF A;  4GKJ L;  1SRO A;  1KRS A;  1K73 C;  4A4I A;  1WYD A;  1JJ2 A;  2JE6 I;  2R6G A;  3JC6 6;  5IE8 A;  4AQY L;  3E9I A;  1Q81 C;  4IFD G;  4GOP A;  1VQF A;  4DR2 Q;  1NE3 A;  1S72 A;  1N36 Q;  3PO2 G;  1C7Y A;  4YHH Q;  3STB D;  4DV6 Q;  4ALP A;  2VL6 A;  3G48 A;  2E8G A;  1FL0 A;  3AYH B;  2ZJR A;  1Q12 A;  4YCU A;  4DV3 L;  2OQ0 A;  3CCE A;  5FLX c;  3HOX G;  4A3J G;  1U0L A;  2B63 G;  2NVQ H;  4IPG A;  1WJJ A;  3PCO B;  2PQA A;  3Q8D A;  2YYZ A;  4L5S A;  3NEM A;  3PF5 A;  3W1B A;  2OWO A;  3EBE A;  2Z6K A;  1QVF A;  4GKK Q;  3CCJ A;  3GTM H;  3HOU H;  1FGU A;  4JG2 A;  2Q2H A;  4MZ9 A;  5M3M H;  1IBK Q;  3B6Y A;  5HY6 A;  3GTL H;  4L5Q A;  5LMN Q;  1G6P A;  4JI8 L;  2PNH A;  5JJI A;  4A3I H;  1XMO L;  3GD7 A;  2UUC L;  2Q2U A;  3PO3 G;  4RG1 A;  5M5W H;  5FJ8 G;  2ID0 A;  2N3S A;  1X3G A;  1B70 B;  3CQZ H;  3I56 A;  4DV2 L;  1J5E Q;  4P71 A;  3HOY G;  4MNO A;  4IO9 A;  2BA1 A;  4DR5 Q;  1NMF A;  4QL5 A;  2EQS A;  1X9N A;  4LNQ A;  1YJW A;  1Y1V G;  2YTV A;  2Y0S G;  4DK3 C;  2NVX H;  4A93 H;  4LF4 Q;  1EYG A;  4AYB G;  3PGZ A;  1S3O A;  1X54 A;  4A3E G;  3I7F A;  4DV5 L;  2UXD Q;  3AEV A;  5GAE C;  1DGS A;  3UE1 A;  4EQ5 A;  1IBM Q;  4KHP L;  1BBU A;  4R4I A;  5H1S E;  5GAG C;  2V1C C;  3H3V I;  3S2H H;  2OCE A;  4C3I H;  1IBL L;  4JYA L;  2HIV A;  3HFZ B;  3U4V A;  3CCM A;  2N8N A;  5FJ8 H;  4NXN L;  3CCR A;  3OTO Q;  1L1O A;  3BU2 A;  1AE3 A;  1L0W A;  3HOY H;  3M4Q A;  4R4T A;  1N9W A;  3CC2 A;  4B3R L;  5K36 G;  4A3F H;  1N32 Q;  2AWN A;  4O2D A;  3G4S A;  4HJ5 A;  4A3G H;  5IYD G;  5JEA G;  4DV1 L;  4DR7 L;  1NY4 A;  1M90 C;  4O0A A;  4X6A H;  1VQ8 A;  1X65 A;  1CKN A;  1EQQ A;  3ERS X;  4YY3 Q;  1K8A C;  4LF7 L;  3HOZ H;  1UE6 A;  3H0G H;  5ELO A;  1VQO A;  4LF8 L;  3S1M H;  1LM0 A;  2I5M X;  5M3F H;  5GQO A;  4IPC A;  1NJI C;  3UE0 A;  1YNX A;  4LUO A;  3ULL A;  3GTG H;  2UXC Q;  4NXM L;  2UUA L;  4A3K G;  3PSI A;  2A1A A;  3F2B A;  2K52 A;  4X62 L;  1HR0 L;  2HHH Q;  5C44 H;  1Q46 A;  3M9B A;  2VNU D;  4DV4 L;  3CC4 A;  2VW9 A;  4LFB Q;  1KC8 C;  3J81 j;  4YWL A;  3HKS A;  1HR0 W;  2NVY H;  1PA6 A;  4P74 A;  4LF9 Q;  4GKJ Q;  3LGJ A;  1HNW L;  4WJ4 A;  2DGY A;  4AQY Q;  4DR4 Q;  3FKI H;  2AMC B;  4BA1 I;  4BBR H;  4A3M G;  1Y1W G;  2ES2 A;  1YIJ A; 
#chains in the Genus database with same CATH topology
 1O7I A;  3K8A A;  4H0L C;  2WIN B;  1GKH A;  4YIJ A;  3IG0 A;  1TAE A;  4ID6 A;  2EVB A;  5C0X J;  1NTG A;  1Y14 B;  4RGN A;  2JA8 H;  2NWG A;  5DGB A;  4RUC A;  1RTO A;  3D6W A;  3I8Z A;  2CVR A;  2JEF A;  3PR5 B;  2A74 C;  3RZD H;  2FLN A;  4V0B A;  2HIX A;  5EBD A;  4YCV A;  4QIW E;  1K8G A;  1CSP A;  4J0M A;  5CR3 A;  4Q8E A;  2F0T A;  2CFM A;  1XNR L;  2F3I A;  4ZUJ A;  1TWH A;  1VF7 A;  5KG6 A;  2B63 A;  1SFO H;  2YZM A;  2G9H D;  2CW0 C;  3WO1 A;  2VQE L;  3NSW A;  2FXQ A;  5DNF A;  3STB C;  4DV0 L;  3NTI A;  2ATW A;  3TDQ A;  1M7J A;  5M3M G;  4YR3 A;  2Z0S A;  1CUK A;  2CKZ B;  3J7A V;  4JI5 H;  4KY5 A;  2K5N A;  2F4V H;  3VR5 A;  5KG3 A;  1VQJ A;  2VZA A;  3BVG A;  1I50 A;  4JVZ A;  4EEY A;  3PUY A;  5ELD A;  1YI2 A;  4GN3 B;  1MSG A;  3OW2 A;  1J8I A;  3D4R A;  1HA5 A;  3TP8 A;  1PH2 A;  4A75 A;  4G3I A;  1JCK B;  2DN8 A;  4FF1 A;  4A3D H;  2DPI A;  2WAQ A;  3BS1 A;  3SEB A;  3VA5 A;  3BDL A;  4ZAI A;  4DUY L;  1T3N A;  1Z9F A;  4DAV A;  1ZYR C;  3FEW X;  4FXD A;  1HZA A;  1RYS A;  4V19 0;  2UUA Q;  1VMC A;  4X62 Q;  4RUA A;  4HIK A;  2MP1 A;  1YIT A;  4IPH A;  2F0F A;  4M8A A;  5GAH C;  3VPB A;  2J7Z A;  4YAK B;  3NP8 A;  4JCV E;  1HNW Q;  1CZG A;  2O4X A;  1TWA H;  2QEJ C;  4DXF A;  3JAM c;  1ZYR D;  4P2C B;  3FP9 A;  5DEH A;  4HAE A;  1X56 A;  5EWF A;  2MNA A;  3FHW A;  5C0X I;  2E5L L;  2UVU A;  2F0H A;  2F3W A;  3S24 A;  4DUZ L;  5LMU H;  3PW7 A;  2KHI A;  2EZV A;  5LL6 S;  2ASL A;  3GTG B;  1UEA B;  4EYI B;  3GTP A;  1HQR D;  3RNU A;  1Y8N B;  1D5Z C;  3EJI A;  2EY1 A;  2XVS A;  3M7N A;  5FD6 A;  1I3Q A;  4IAJ A;  2B3G A;  2QK4 A;  1STY A;  3VYR A;  1K83 H;  2UU9 Q;  4B08 A;  2IWH A;  1LAB A;  3H6M A;  4BBR B;  3S2D H;  5CV9 A;  1N48 A;  2PNR C;  2HVQ A;  1HH2 P;  4NB3 A;  2MFI A;  1CHQ D;  1VQE A;  4A2B A;  3NXW A;  2H1E A;  3FPU B;  1FGB D;  2AUK A;  2A6E C;  4I4T F;  5LHY 1;  5A2Q W;  2VB3 X;  1ICW A;  3BZD B;  3A5Z B;  4KLK A;  3AFQ A;  2FKL A;  4LF5 H;  1A2U A;  4MTK A;  3NK9 A;  1V43 A;  1HHV A;  4DV7 L;  1S0M A;  3CF5 A;  4MIU A;  4LJZ C;  3MR5 A;  1F9Q A;  5IT9 E;  1OWT A;  2Z8L A;  3EN2 A;  4Q44 A;  3PUV A;  1DCZ A;  4KD3 A;  2A6E D;  1R4P B;  1EYD A;  2B2U A;  5D3D A;  3J7A 5;  5KFW A;  2FLL A;  2FLP A;  3PN1 A;  1GUN A;  4JI1 L;  2DNE A;  1CM9 A;  2I07 B;  4A3L H;  1J9O A;  4JI3 L;  1IYJ B;  5IT9 L;  1HNZ Q;  1O78 A;  1JB7 A;  4K8I A;  5LL6 b;  1KDC A;  1A3U A;  5IP7 H;  2ZDG A;  3EQL C;  3T1Y H;  3OMC A;  1JQY D;  1TXY A;  4P73 A;  2GVA A;  4IHJ F;  1BKB A;  3I4N H;  4NDX A;  2G9D A;  2X6G A;  1FNW A;  3HB9 A;  4BBS G;  1EIG A;  5JAV A;  3E5N A;  1TVX A;  3U50 C;  3DXJ C;  1OO9 B;  2FMC A;  2J0T D;  2WB1 G;  3K5N A;  4JI8 Q;  3SR1 A;  1Y8O B;  1XMO Q;  4ZQ3 A;  2DUD A;  5AJ3 Q;  1RJQ A;  4M7E A;  2NN6 G;  5KFL A;  2CWP A;  5KFA A;  5FO7 B;  1KLG D;  4BWG B;  4MV1 A;  3IFT A;  3D3R A;  3ND8 A;  4F4Z A;  2W9A A;  4JI7 L;  4JOI C;  3KAL A;  4RFB A;  3V6H A;  4X64 H;  4X65 L;  1Q1B A;  3K80 C;  1UE5 A;  2N55 A;  1OTC A;  3KXY T;  5F9L A;  2HUG A;  3MVV A;  4QWD A;  2WYO A;  1EHI A;  2BA0 A;  1U4L A;  1JWU D;  3M9O B;  5KEE A;  2R8I A;  5C4J H;  1N34 H;  3H4D A;  3QR8 A;  2IX0 A;  1PH1 A;  1T5E A;  3GQB A;  4TV9 F;  4AYB A;  2R8H A;  1I4H A;  4H44 C;  2CHB D;  2RDF A;  1B3A A;  1I94 Q;  1ESF A;  2JA5 G;  3I4M G;  5KFI A;  4HED A;  1B1Z A;  3J81 E;  4DR4 L;  4JI4 H;  1CZW A;  1I6V C;  4QIW A;  4YCW A;  1AE2 A;  5CV4 A;  2XCP A;  1EQT A;  2X69 A;  4BA2 I;  4Y52 H;  4LFC Q;  4BWS C;  3L7Z C;  2R8K A;  4UP7 A;  5T14 A;  4FBU A;  2QA4 A;  5E3F A;  3J81 L;  1PV4 A;  2XWJ B;  3M4O H;  1Z6H A;  3TZU A;  1ASY A;  4K2L A;  5IYC H;  1LTI D;  4JI2 Q;  3VR2 A;  5KFO A;  2AU0 A;  4CJ1 B;  5C4X H;  3TBI B;  4J9P A;  3G6V A;  4LFA Q;  4CDE C;  1VCI A;  4DR6 L;  4XX0 B;  4QWB A;  5KNB A;  1I4Q A;  5DQG A;  4HIO A;  4C5C A;  1AZP A;  1OXV A;  4ED3 A;  3LML A;  1Z2N X;  5DG8 A;  1JC7 A;  3J81 i;  4GKK H;  4IFD H;  4C5B A;  5KKN B;  1S5D D;  4RA8 A;  1KRT A;  1UNN C;  5IP9 G;  2HVR A;  2ASB A;  1NMG A;  3OWE B;  3G8C A;  5EKK A;  5KRU A;  2KCM A;  2VQF L;  1Y1W A;  5IYZ F;  1F2L A;  1AFP A;  2NZ1 D;  4DR1 L;  1QVG A;  1YEZ A;  1TWH H;  1I50 B;  1U5K A;  2ALY B;  2B63 H;  1EOV A;  1IXR A;  1WSC A;  3HBL A;  4GC6 A;  4IUV A;  3R5F A;  4DR5 H;  2JEB I;  4YWK A;  1A3T A;  2OLS A;  1SND A;  1TT2 A;  4DR2 L;  3DM3 A;  5E4X A;  3W3A A;  4DV6 L;  2MO0 A;  1DJR D;  3RLO A;  2WAQ B;  4KTA A;  1C30 A;  2K32 A;  1BR9 A;  2I87 A;  4APV A;  1S68 A;  3A8I E;  4OO1 G;  2UXD H;  2X6L A;  2Z6K C;  4QW8 A;  1C0A A;  2BOS A;  5KNC A;  2RDJ A;  5KT3 A;  1XMQ Q;  1RJP A;  1S9F A;  1GD7 A;  1I50 H;  3D4W A;  2NZH A;  5C3E B;  1WTR A;  2W6O A;  4RZR A;  3A0J A;  1JMC A;  3GTJ A;  2YTX A;  2Q8I B;  3OTO H;  2UXB H;  2KHJ A;  4DL2 A;  4OEM B;  1N32 H;  4R4O A;  1LLR D;  1JIC A;  3VYS A;  3RN2 A;  1WCM G;  2XSC A;  2MJ8 A;  3GTL A;  1J5E L;  2F0W A;  1BCP F;  1K1S A;  3CVZ A;  1LAC A;  5IT9 W;  1FNU A;  1SE8 A;  4HJ8 A;  3A8K E;  4ED8 A;  4MTN A;  3CQZ A;  2XCA A;  2KA7 A;  5FLX E;  4B3T Q;  3J80 c;  1SN8 A;  4LF4 L;  5K36 H;  3BQ1 A;  3TP5 A;  2HHH H;  1ESR A;  4LFB H;  1GM5 A;  4XQQ A;  1BDO A;  4BS9 A;  1I3Q B;  1F2Y A;  2F0U A;  4X66 Q;  2Y0S E;  5JEA H;  1M1K C;  1Z2P X;  2YL2 A;  2BH8 A;  3HOW B;  2VXW A;  3DWA A;  2F0K A;  1IBM L;  3TII A;  5FPO A;  2IX1 A;  3I90 A;  2KCT A;  3TSS A;  4ZK9 B;  5FPR A;  5C1O A;  5FLX L;  3E9H A;  4ED1 A;  4HNV A;  3GIQ A;  1X3F A;  3D8G A;  4WD3 A;  4C3J B;  1CKN B;  4JV1 A;  4B9X A;  2ZJQ A;  1PLF A;  2WII B;  2B8F A;  5F9N A;  3V96 A;  4DV3 H;  1JB3 A;  5BMV F;  2F03 A;  3GTP H;  2L11 A;  2B8G A;  4BXX G;  4WFN 3;  2R93 G;  3K0X A;  2VUG A;  4C3H B;  2W7P A;  4RWS C;  4LF6 Q;  2SDF A;  2FK2 A;  3TS2 A;  3BZK A;  1I3Q H;  4JI0 Q;  2XGT A;  3T1H Q;  2KED A;  1EWH A;  1ONL A;  2JA7 H;  3AQQ A;  1KL9 A;  3OUU A;  2CQO A;  1JX4 A;  1G29 1;  5T1G A;  4EFE A;  3RTX A;  1X55 A;  2JQO A;  3D6C A;  4DV2 H;  2EOT A;  3RD4 A;  1EY6 A;  1JJ2 A;  1K73 C;  2IBK A;  2JE6 I;  2R6G A;  1DOK A;  1YNN C;  2F0L A;  2EYM A;  5IE8 A;  4AQY L;  3KLS A;  3GII A;  3E9I A;  2ZDH A;  2WKD A;  2W8L A;  4C2M A;  2YZN A;  4YHH Q;  2UVR A;  4ALP A;  3OW7 A;  3G48 A;  4KKS A;  2XIW A;  2ZT9 C;  3OUZ A;  1I6H B;  1EYC A;  2RDI A;  1U0L A;  3HOX B;  1EY8 A;  1YNN D;  2B39 A;  3TP7 A;  1WJJ A;  3TQ1 A;  2QIL A;  2YYZ A;  3PF5 A;  3W1B A;  1CK1 A;  1QVF A;  2TSS A;  2XN9 C;  2Q2H A;  4IN3 A;  2F0M A;  3NHH A;  1IBK Q;  4XT1 B;  5HY6 A;  1E4E A;  2DJG C;  4QWE A;  2QW7 A;  2J6T A;  4JI8 L;  4KJN A;  1XMO L;  4ZHQ F;  2K5Q A;  3TQT A;  2ID0 A;  2D2C C;  2NU7 B;  2B2T A;  3LWB A;  3HOY G;  4LF7 H;  5J2U F;  4MNO A;  2IP4 A;  3K0Y A;  4LF8 H;  1CQF A;  1TWG B;  2EQS A;  2QDL A;  1SFO A;  4WOR A;  5I9O A;  1Y1V G;  5KFJ A;  4NXM H;  1DYQ A;  1HR0 H;  2K5D A;  1UUP A;  2R7K A;  4KKU A;  4G7H C;  1TQO A;  2RKS A;  1X54 A;  2FFK B;  3MZ5 A;  4AYB B;  4DV5 L;  4A3E G;  3AEV A;  4R4I A;  1X32 A;  3S2H H;  4JYA L;  1IW7 C;  2LKV A;  2QYZ A;  4NXN L;  3KUP A;  2KSW A;  1GOZ A;  1STG A;  4R4T A;  3U9S A;  1WD0 A;  4A3F H;  2AWN A;  4O2D A;  4A3G H;  5KFT A;  3VR6 A;  4DR7 L;  4DV1 L;  5C5L A;  2BCO A;  4O3N A;  3NBH A;  4X6A H;  1BXR A;  1DOL A;  3FDS A;  3NWS A;  1EQQ A;  2V5A A;  3T53 B;  4F4W A;  4YY3 Q;  3BG5 A;  3H0G H;  1IW7 D;  3K57 A;  1VQO A;  1EU3 A;  1LM0 A;  1DM0 B;  2KQ3 A;  4FXG C;  4G57 A;  3ULL A;  2YW2 A;  2A1A A;  2K52 A;  5EQ0 A;  3MXP A;  1Q46 A;  1SYE A;  1CA5 A;  4A3K B;  4DV4 L;  1BNZ A;  3CC4 A;  5KFY A;  3J81 j;  2BDN A;  2EYO A;  1B6S A;  1D1K A;  1PA6 A;  2JSO A;  4LF9 Q;  4GKJ Q;  1STE A;  1RJT A;  2HCC A;  2FPG B;  1E2Z A;  2VQE H;  3IN5 A;  4DV0 H;  1YIJ A;  1Y1W B;  1SNM A;  2UUB Q;  1KDB A;  1VQG A;  2KCN A;  2B2V A;  1I7N A;  2YS6 A;  2IA6 A;  3W5O A;  1TWA A;  2R92 H;  5CB4 F;  2R7M A;  3V4S A;  2K1B A;  3PUW A;  3UQ8 A;  5KFH A;  5M5X H;  1PRT F;  3HOV B;  2Q2T A;  4PNY A;  2R7Z H;  4B3S L;  4J9K A;  4JBK A;  4Q0Y A;  1EWC A;  1FJG L;  1S5E D;  1ZHS A;  1RK5 A;  1SDF A;  1VQ4 A;  1IKL A;  1EFW A;  5KFR A;  3M7G A;  4KN4 C;  1PH9 A;  4BY7 H;  1SCU B;  1TS2 A;  2FK1 A;  4AH6 A;  2L5T A;  1RCV D;  2AUJ D;  4JW0 A;  4IR1 A;  2UUC Q;  4AIM A;  5C0X H;  1EUD B;  3G6E A;  5JVG 3;  3ERQ A;  2MQH A;  2NVQ B;  3GTJ B;  2UVV A;  1EUC B;  3HOV H;  3K5H A;  2IX3 A;  2R87 A;  2VQD A;  3HOU B;  3SK6 A;  3GTL B;  2M00 A;  1O80 A;  1JT8 A;  3J7Z C;  4A3I B;  1CHP D;  1B44 D;  1EQR A;  4F4Y A;  5LOV F;  3Q6S A;  1EZ6 A;  4KHP Q;  4RNM A;  3CQZ B;  2BE5 C;  5C5J A;  1GVP A;  2E5L H;  1D1I A;  2ZM6 L;  1EEI D;  4DUZ H;  3T16 A;  4J9Q A;  1B6R A;  5DG9 A;  2JA6 A;  1PZI D;  3GTJ H;  1C8C A;  1T9H A;  1QJO A;  4B3R Q;  5KT2 A;  2F0I A;  2NU6 B;  3PW5 A;  4UP8 A;  2K5W A;  5JVD F;  1D8L A;  1EYA A;  4N9T A;  5LYJ F;  2BE5 D;  5IWA L;  1TWC H;  1FKA H;  3J7A F;  3FMA A;  1PHJ A;  4TQS A;  3KK7 A;  2MGS A;  4J15 A;  4DN4 M;  1L0X B;  4C3I B;  4CC5 A;  3UDI A;  4HID A;  3BDC A;  4KV6 A;  1GO3 E;  2C9O A;  1CKM A;  1I4X A;  4POF A;  2W6Z A;  3RBE A;  2EJG C;  4QWA A;  3MFY A;  1H9S A;  1Q3L A;  2HDL A;  3MXG A;  3GTK A;  2OTJ A;  1S10 A;  5KT7 A;  4DKA C;  1NNX A;  3HOZ B;  3RGX A;  2A73 B;  4LF6 L;  2EE1 A;  1TWF A;  1M4V A;  4DV7 H;  5M3F B;  4JV5 Q;  2V4R A;  5KFE A;  3J7A K;  4NW2 A;  2HJW A;  3RF2 A;  5C44 B;  5C1P A;  4JI1 H;  5BN3 A;  3KJP A;  2EYJ A;  4XYO A;  4OEL B;  3P7J A;  4L5R C;  1WH2 A;  5A2Q E;  3KHL A;  3CCS A;  1PH6 A;  5DQI A;  1ML0 D;  4JPB W;  1RIP A;  3K7U C;  4BBR G;  1Z47 A;  5KYL A;  3GID A;  4APM A;  4JI3 H;  1FR3 A;  2CH4 W;  4L5T A;  1AP0 A;  3FKI B;  1UC9 A;  4K0K Q;  3IFD A;  1KNA A;  4O4I F;  2HT1 A;  2XIG A;  1HRJ A;  4ME6 A;  3I70 A;  4C1N I;  1XTC D;  4LMQ D;  3KLW A;  1LO5 D;  5KFX A;  3PW4 A;  4OON A;  5A2Q L;  2RQX A;  1W2B A;  3H94 A;  1XTD A;  2JA8 B;  2NN6 I;  1G51 A;  3OPO A;  4MN3 A;  2H4O A;  4PQX A;  4KD4 A;  1K9M C;  1E4E B;  3T5L A;  3AFP A;  4C2M H;  1MBY A;  2K4K A;  1MI2 A;  3BG3 A;  4JUZ A;  2JEA I;  1IYU A;  4XYQ A;  1LT4 D;  2XRS D;  1IBK L;  3A7A B;  4A3B H;  3D31 A;  1W6J A;  5JVH 3;  4B3M L;  5BR8 L;  1PRT D;  1SFO B;  4JI7 H;  3BYT B;  4MTD A;  1J6Q A;  4X65 H;  1BBW A;  3PVX A;  3I55 A;  2JEI A;  4JBJ A;  1WI5 A;  4XTC S;  1PMR A;  5I4D A;  4EFB A;  3LWE A;  5KFD A;  2KVM A;  3K59 A;  4MV7 A;  4PMC A;  3MJF A;  3DWQ A;  1E0B A;  2F0V A;  2R6F A;  1XJV A;  1ASZ A;  2VB2 X;  3EA6 A;  2WP8 J;  4RGT A;  2DNC A;  1JWS D;  5FLM H;  1KJ9 A;  4BY1 B;  3G7L A;  4DFA A;  4UCS A;  1CI3 M;  1GSO A;  4O1N A;  4Q0F A;  1QNU A;  1D2B A;  3RV3 A;  2IL8 A;  4KK7 A;  3NBH B;  2A19 A;  4JI5 Q;  3HG9 A;  5J3B A;  1XNQ L;  4DNR B;  5JOB A;  2K50 A;  1WTX A;  5E4W C;  4A3D B;  2F4V Q;  3K58 A;  3V05 A;  4JI6 L;  5JVL A;  1EFI D;  1W3S A;  1PH7 A;  1Q8K A;  1MIU A;  1VQB A;  5DM7 3;  5L9X A;  4BY1 H;  4OX9 L;  4DAP A;  5IYB H;  4MV9 A;  4DR6 H;  2K5H A;  5IT9 c;  3QJY A;  1ZXT A;  1N33 L;  1SMY C;  2RHS B;  1A0I A;  3S9W A;  3CD6 A;  4XQJ A;  1E4F T;  1TWA B;  1QE6 A;  2JA9 A;  4KI0 A;  2VQF H;  3HKZ E;  4ME3 A;  3V4Z A;  1TII D;  4DR1 H;  3RAX A;  1GXD C;  3DMU A;  2UUB L;  3I2Z A;  2RCN A;  3PV0 A;  5EPK A;  2CW8 A;  1SMY D;  4UY8 C;  1PVO A;  3D0F A;  5CYU A;  1YJ9 A;  3KFU A;  5CGK A;  5I6W A;  4OO1 I;  1S5F D;  4A3C G;  2YTY A;  4DR2 H;  1HXY D;  1SMX A;  1K83 B;  4UCO A;  3WWV A;  4DV6 H;  4PMB A;  3G71 A;  5LMU Q;  3H20 A;  2CQY A;  3S2D B;  1YHQ A;  5D8D A;  1ZHQ A;  3N44 B;  4NKL A;  4FF2 A;  2I5L X;  5J39 A;  2ZXP A;  3S14 H;  2DWC A;  3QZ8 A;  4PZ6 A;  3RB3 A;  5DGA A;  3S1R B;  3GTO A;  1KHI A;  3RIZ A;  5C3X A;  3PO2 H;  4OHJ A;  2PW7 A;  1STH A;  5IOD A;  2E2J H;  2AHO B;  5LMN H;  3AMU A;  2VY3 A;  1VQ6 A;  1STB A;  1K0R A;  3S15 H;  2JA7 A;  4A3J H;  4J9M A;  1J5E H;  2VR1 A;  5EAY A;  1E2V A;  3G6J B;  1I4P A;  4HJ9 A;  4QQB X;  2JA6 B;  3A55 A;  1B3Q A;  1VQP A;  1B9M A;  2K03 A;  4CJ0 B;  1N36 L;  2WAQ G;  4LF5 Q;  1SJH D;  4DL4 A;  3S1R H;  4LF4 H;  4TV8 F;  4XYM B;  2E2D C;  1BF4 A;  3OMG A;  4O3S A;  3ETJ A;  4HJA A;  1MJE A;  5J22 A;  5CA0 F;  3MA2 B;  4EGJ A;  3SI8 A;  3QG1 A;  3J81 c;  3PO3 H;  1XXG A;  1KAA A;  1IBM H;  3I4N B;  1S5C D;  1CS0 A;  2J9G A;  4JBM A;  1EIH A;  5C3E G;  3R5X A;  3JRW A;  2PMZ E;  1VKZ A;  1Z7T A;  1E3P A;  2OH2 A;  2E2I A;  5KYI A;  3ERO A;  2B2T C;  4ULL A;  3T1Y Q;  4XIG S;  2JA6 H;  5BPF A;  2D62 A;  1VBG A;  3GV7 B;  2RVL A;  3KAK A;  1UE7 A;  4C5A A;  5JPN C;  4XXE A;  1VBH A;  1WTQ A;  3P1H A;  4LUZ A;  1TWF B;  5CBE E;  3CCV A;  2IHF A;  4ZRZ A;  2C5C A;  4PWQ A;  2UXC H;  1EQV A;  2PO4 A;  4RNN A;  3I73 A;  3TRE A;  1SLJ A;  1SRU A;  1PTO H;  2R3Z A;  1PDQ A;  4Z9C B;  4HSP A;  3KDF A;  1EIY B;  3CCU A;  1PTO F;  3HOW G;  4ECT A;  3KF8 A;  3S17 H;  2SEB D;  4DAY A;  5IYD H;  3ICE A;  5KFZ A;  4JV5 L;  3S1Q H;  4EGQ A;  2EIF A;  4AQY H;  2FMM A;  5C4J B;  1OXS C;  3GV3 A;  5CV6 A;  3MAQ A;  4C3J G;  3GTK H;  1DD2 A;  4X64 Q;  1E1O A;  3K5O A;  5ELE A;  4FP5 D;  5CAE B;  1TWF H;  5IGE A;  1TA8 A;  4C3H G;  1K1Q A;  4K0K L;  3OHB A;  3RB6 A;  4PZ8 A;  5D14 A;  1UEB A;  1NR2 A;  2PCF B;  4CDC C;  3M3Y H;  1JOO A;  1N34 Q;  2YU9 H;  4EYH B;  2MUY A;  3N6R A;  1KQS A;  3O13 A;  3EYY A;  1VMP A;  4J9O A;  5C4Z A;  3MR3 A;  3MWM A;  2C2D A;  2GA4 B;  3M4O B;  1TR5 A;  4JI4 Q;  3H0G A;  2DY7 A;  2YCH A;  1EY0 A;  1PYB A;  3MEH A;  4GNX A;  3JSN A;  2IY5 B;  5C4X B;  3IRB A;  1QZG A;  1B8A A;  2F52 A;  1VQA A;  2B2V C;  3RUP A;  1WYD A;  3KBX A;  1ROD A;  2O5J C;  2XRQ D;  1LTR D;  1SNP A;  2F0P A;  1NE3 A;  1AUX A;  5KT5 A;  1C7Y A;  5IOC A;  1MZB A;  4HN7 A;  1R4Q B;  2P5Z X;  4LMY A;  2VL6 A;  4ECU A;  1A15 A;  2E8G A;  1FL0 A;  2ZJR A;  3GIK A;  4YCU A;  5FLX c;  3HOX G;  4DV5 H;  5FK9 C;  5I2Y A;  2ASJ A;  3T4A C;  3RGZ A;  3TME A;  3EPG A;  3K3P A;  1TWH B;  3Q8D A;  3PCO B;  1NAP A;  2PQA A;  3M4Y A;  2PYK A;  5EWG A;  2JYO A;  2B63 B;  2R92 A;  1K3B C;  1ET6 A;  4KY7 A;  4GKK Q;  4RZQ A;  4JYA H;  3CCJ A;  4MZ9 A;  4NXN H;  5M3M H;  2F0D A;  1SE2 A;  2R7Z A;  4L5Q A;  4I55 F;  3L4J A;  1GUO A;  1YNJ C;  5D65 A;  4DR7 H;  4DV1 H;  3U9T A;  5M5W H;  2N3S A;  2W6Q A;  3MXN A;  3SK4 A;  4KHV A;  1C3O A;  5D1P A;  4P71 A;  3T13 A;  4DL7 A;  3R3O A;  1XX8 A;  4DR5 Q;  1SNQ A;  1X9N A;  4YR0 A;  4LNQ A;  2W8K A;  1STN A;  2HD3 A;  1YNJ D;  4KN7 C;  1BUV T;  1BQQ T;  1EYG A;  1W96 A;  4IWX A;  3DHQ A;  4AYB G;  1WCM A;  4DV4 H;  1S3O A;  3BVZ A;  3I7F A;  3VYT A;  2UXD Q;  5GAE C;  1DGS A;  4EVO A;  4K5X A;  5ELF A;  4EQ5 A;  1BCP B;  3E3X A;  3QB3 A;  3HKZ A;  4DR3 H;  5H1S E;  2M05 A;  5GAG C;  4MV3 A;  5FO8 B;  3U4V A;  3CCM A;  2EY6 A;  1HNX H;  4LSX A;  2EY5 A;  4FO2 A;  1L1O A;  3OTO Q;  3CCR A;  2UXB Q;  3M4Q A;  4KKT A;  1N9W A;  4RAU C;  1M6V A;  1N32 Q;  4E6I A;  4K8J A;  4R9W A;  3G4S A;  2V4D A;  4WRD A;  1NY4 A;  1WTV A;  4O0A A;  1VQ8 A;  4B3S H;  4K5V A;  3ERS X;  2YRW A;  1K8A C;  1FJG H;  1UE6 A;  5CV5 A;  3S1M H;  2R84 A;  3V2T A;  1NJI C;  1YNX A;  4LUO A;  2KUM A;  3FPP A;  2UUA L;  4A3K G;  1AUV A;  4X62 L;  1TWC A;  1KDA A;  2HHH Q;  1JDB B;  2VNU D;  2B2Y A;  1AN7 A;  2VW9 A;  4LFB Q;  2F0J A;  4IUR A;  5CA1 F;  3HKS A;  2NVY H;  3GLK A;  1LTS D;  3GTO B;  2Z4I A;  3GTP B;  3LGJ A;  1HNW L;  4PDB A;  4MA5 A;  4DL3 A;  4BA1 I;  1Y1W G;  4YBZ B;  2W70 A;  3SE7 A;  4OL7 A;  5LXT F;  1VQC A;  3GIP A;  4QUF A;  4A3M B;  3SHL A;  3RJ0 A;  2FJ2 A;  3K7A H;  4Q43 A;  3X3N A;  2JA7 B;  3RLF A;  4J9R A;  1TS5 A;  3KF6 A;  4DV3 Q;  4GLX A;  2NUA B;  3E0E A;  2RGV A;  4QWC A;  3HOV G;  1PYS B;  2XGP A;  2ZDQ A;  5JJL A;  3VPD A;  1IHZ A;  5EDW A;  1TKW B;  3CHB D;  2CCZ A;  4QW9 A;  4F50 A;  2UU9 L;  2A8V A;  1BGW A;  3GTO H;  1EYZ A;  4RB3 C;  1EY9 A;  2ZM6 H;  4CDD C;  3HEJ A;  1SYF A;  1VQ5 A;  4RKB A;  5JPM C;  1XDN A;  4A3M H;  3BDO A;  5J1Z A;  1O7L A;  3K5I A;  3I72 A;  1E24 A;  5IY0 A;  5EPJ A;  4DV2 Q;  1GSH A;  1KJQ A;  4UFZ A;  3WNZ A;  1K0S A;  1RKN A;  5IWA H;  2ZTC A;  1YHA A;  4OWW B;  3PF4 A;  1X6O A;  4YP3 A;  3H3V H;  3HOU G;  2DLN A;  3OSP A;  2V58 A;  3S1N H;  4XDX A;  1VQM A;  2RSO A;  3RR5 A;  5T1I A;  3M9N B;  3M9M B;  3U9O A;  4A3I G;  2XWB B;  5G3L F;  4IR9 A;  3JAM W;  1KNE A;  2NBF A;  5C3W A;  4BBS H;  1T36 A;  2SOB A;  4ECV A;  1OXT A;  1BVS A;  4R7R A;  2N78 A;  2SNM A;  1HFN A;  2L9H A;  3A5U A;  3NTK A;  3OIQ A;  3BQ0 A;  1Y1V A;  2H5X A;  3H91 A;  4FDB A;  4ABN A;  1HNZ L;  4RB1 A;  3KDF B;  3KF8 B;  2RA4 A;  4DAY B;  2E2I H;  4KY6 A;  1R9T A;  2W6M A;  2R8J A;  1MSH A;  1HA6 A;  3C46 A;  4IOC A;  3T56 B;  1BJT A;  1IBL H;  3F2C A;  4M9U A;  2RDG A;  1FVI A;  4O2B F;  4A93 B;  1PH8 A;  2RSN A;  1QVC A;  4LF7 Q;  2GPS A;  3N41 B;  4LF8 Q;  3BA9 A;  1KAW A;  4ZUI A;  4C3I G;  4ED6 A;  4GZY C;  4O3P A;  4DNI A;  5AJ3 L;  3S2H B;  4NXM Q;  2RHQ B;  1HR0 Q;  3MEF A;  2EXZ A;  1P16 A;  2LS0 1;  2K05 A;  3BZC A;  1PH4 A;  2IPK D;  5FD5 A;  2WV6 D;  3QZ7 A;  2GVB A;  4C1N K;  1PFB A;  2QCP X;  4A3F B;  4FF3 A;  3GV5 B;  4A3G B;  1XPR A;  3PW2 A;  1RHP A;  3CPW A;  2F0O A;  5DLQ E;  3VYU A;  1UC8 A;  2FJZ A;  4ZI7 F;  2WAC A;  3HOZ G;  2KBN A;  2PPB C;  3BAA A;  1PYW D;  1VAJ A;  3CPF A;  1OXX K;  3GTQ A;  5M3F G;  1IL2 A;  2GPW A;  3H0G B;  2JA5 H;  3I4M H;  4A93 H;  2FMA A;  4CKC A;  4GNX B;  3ZJY C;  1EIF A;  3ITP A;  5C44 G;  2VUM A;  1LT5 D;  3GQC A;  2LFN A;  3F8T A;  1BCP C;  4B3M H;  5BR8 H;  3GIL A;  1HPC A;  2NU8 B;  4QIW B;  2ZTE A;  1WTP A;  2A68 C;  2C00 A;  5KFC A;  1F9S A;  4QB4 A;  3FKI G;  1DV2 A;  1KC7 A;  2MPM A;  2OXP A;  1I94 L;  1SNO A;  1CTM A;  2D5D A;  3J80 L;  3S16 H;  5KT6 A;  1CA6 A;  3CMA A;  4ETS A;  2ICI A;  1V4Y A;  5CC4 A;  1CQJ B;  4RB2 C;  1BCP D;  2JA8 G;  5EBC A;  1E4G T;  2QGQ A;  3VPC A;  4F88 A;  3NGD A;  4LFC L;  2R92 B;  5DAU A;  1G8Z D;  1PRT B;  3HZX A;  2A68 D;  3AU7 A;  4RGO S;  1IL8 A;  1XNR H;  5M5X B;  3KTM A;  1GSA A;  4GLV B;  2VQE Q;  2FPI B;  5HGQ A;  2R7Z B;  4MA0 A;  4DV0 Q;  2BQ3 A;  4HSV A;  2RF4 A;  5IP9 H;  3RAQ A;  4EBE A;  2F1M A;  4JI2 L;  4RAY A;  4HTH A;  3K81 C;  4BY7 B;  1XNQ H;  1BOS A;  4LFA L;  1STA A;  1VQD A;  1MJC A;  2D9U A;  2PW5 A;  3GV6 A;  4JOI A;  3BJU A;  1M0W A;  4R4C A;  3ULP A;  4JI6 H;  1IZ6 A;  5KFK A;  4UPA A;  4U6P A;  3GTM A;  5BN4 A;  1YZ6 A;  4PV1 C;  5C8Y F;  3ER0 A;  4GLA C;  3MFH A;  5GRO A;  1RYR A;  5HGT A;  4OX9 H;  1HCZ A;  2J6U A;  3NUC A;  4OO1 H;  4FVM A;  3G6X A;  3HKZ B;  3H3V C;  1FYC A;  3PIP A;  5EWE A;  1N33 H;  2E76 C;  5KGU A;  4BY1 G;  4CGY B;  1WTW A;  1A62 A;  4UCT A;  1JOQ A;  4A76 A;  5E7N A;  1BXT A;  2UXD L;  1L1O B;  2PZU A;  4K2K A;  1E1T A;  3NEN A;  5HV6 A;  2JEG A;  4O42 A;  4ECR A;  3Q8R B;  1D7Q A;  1ENF A;  1YBY A;  1MGS A;  4RHR A;  3UDG A;  2WAQ E;  4DUY H;  2SNS A;  1WCM H;  3CAM A;  2OT2 A;  3MHB A;  4A3D G;  1YVC A;  5DQH A;  4UHV A;  5DM6 3;  2K6A A;  2B2U C;  1HTP A;  2W9B A;  4E4T A;  1XMQ L;  1GUW A;  1JLL B;  2G5D A;  2HVS A;  2Q8R E;  1TWC B;  4DK6 C;  2F3V A;  3AB9 A;  2E5L Q;  4DUZ Q;  3PUX A;  1T5X D;  5KND A;  4GN4 B;  1Q82 C;  3QWN A;  1WOC A;  3D4D A;  4WJW A;  1JJC B;  1QOH A;  3MXU A;  2CW7 A;  4G7Z C;  4WJ3 M;  3OHX C;  1CSQ A;  2Y0S A;  2R61 A;  4LSA A;  4DK1 A;  2YV5 A;  1CE8 A;  1ENC A;  4I7A A;  1NBW A;  1MD2 D;  1Q1E A;  1HTL D;  2K7V A;  2FPP B;  2WFW A;  2V4Q A;  1SR3 A;  3KF6 B;  3TQY A;  5M5Y H;  4B3T L;  4R8U A;  1SSO A;  4X66 L;  1RTN A;  1VDZ A;  5C6A A;  4BXX H;  2R93 H;  3QFF A;  1XYI A;  4JBW A;  2WB1 E;  1ILP A;  4YR2 A;  2D0O A;  1HZB A;  4XYL B;  1SYC A;  1N36 H;  4WBN F;  1CFM A;  1PFS A;  1KJ8 A;  1ZQ7 A;  2K28 A;  5L1J A;  4Q8F A;  2NB0 A;  1V51 A;  4DV7 Q;  4TVA B;  4TUY F;  1S97 A;  2XTI A;  1EZ1 A;  1GHK A;  2NVT H;  3NWT A;  2QEX A;  4RHS A;  5KX5 F;  2UVW A;  4JI1 Q;  1S03 G;  1O7Z A;  1Q7Y C;  3RB4 A;  1LYL A;  4JI0 L;  4KJO A;  1VQ9 A;  4FS2 A;  3T1H L;  4JI3 Q;  4DF7 A;  2K75 A;  4PMW A;  4GNX C;  3R23 A;  3TIG A;  3M4P A;  3CRL C;  2YU9 A;  2EXD A;  1H9R A;  4Y7N H;  4C2M B;  2C28 A;  1DV1 A;  3V6J A;  4TSS A;  2GLT A;  4ED7 A;  2M2L A;  1A8V A;  2A69 D;  1HFG A;  2JA6 G;  4A3B B;  2RDH A;  4JC0 A;  4Q45 A;  4A3L G;  3J80 W;  4IRD A;  4YHH L;  3A56 A;  5IP7 G;  3URY A;  4F4X A;  4DL6 A;  3SE0 A;  1B33 N;  1QWY A;  5CV8 A;  1BNC A;  4OWT B;  1V9P A;  3KOJ A;  1C48 A;  3OYY A;  1PRT C;  3I4N G;  2DIK A;  3MC0 B;  4H7B A;  4I7H A;  1L2Z A;  1FNV A;  2PI2 E;  1W6K A;  5ELC A;  4JI7 Q;  1L2F A;  2DZD A;  1V8Q A;  3T51 B;  4X65 Q;  1KEE A;  1Y1V H;  3WO0 A;  2PVP A;  1CKO A;  1Q90 A;  1C4Q A;  2WKC A;  3MWY W;  1KJJ A;  2ZXO A;  1R9T H;  1F2M A;  4FU0 A;  1KXL A;  4A3E H;  3RZO B;  2CH4 A;  1V1Q A;  3W2D A;  1JDE A;  3DEP A;  3QO2 A;  2B29 A;  1KJI A;  3GTQ B;  5L1K A;  2AQ1 B;  5KFG A;  1SYB A;  1V1P A;  1LUZ A;  2VUM B;  4ECQ A;  1JE5 A;  3I4L A;  2C2R A;  3MFI A;  3PIO A;  3SXH A;  4IOA A;  3K5M A;  2F0E A;  5D1O A;  3E6Z X;  4ZYS A;  3H15 A;  1H9K A;  1HQM C;  3V6K A;  3VR3 A;  4R1J A;  5E1F A;  4IZO A;  1E22 A;  5KIX A;  2JJQ A;  2LMC B;  4AYB E;  3RMH A;  4FNF A;  4RMF A;  4DR4 H;  2WTF A;  1L1O C;  1VF5 C;  4HCS A;  4IPD A;  3RZO H;  5KG1 A;  1EL0 A;  2VS1 A;  5COY A;  1Y69 U;  1WR2 A;  5EGT A;  3KBG A;  3TS0 A;  3C2P A;  3GTQ H;  5M9O A;  2MO1 A;  3VMM A;  2EJF C;  4IJH A;  4L63 B;  2VUM H;  1IOW A;  4DR6 Q;  1GLV A;  5FO9 B;  4QCL A;  2N88 A;  1B53 A;  1JXL A;  1EZ8 A;  1XPU A;  3VA7 A;  2ZXR A;  4YY3 L;  1SE3 A;  4DPG A;  3QOJ A;  1VQH A;  2B2Y C;  4LW1 A;  4CBV A;  3Q0A A;  4ECX A;  2LXJ A;  5IYC G;  1JOR A;  1B4O A;  3CME A;  5KFF A;  2HGS A;  2VQF Q;  1YJN A;  2EYF A;  5C4X G;  3N42 B;  4DR1 Q;  5IGF A;  4GC7 A;  1MKH A;  4LF9 L;  1VQI A;  3GTM B;  4GKJ L;  3S14 B;  1SRO A;  1KRS A;  2E74 C;  2I0Q A;  4C56 C;  3JC6 6;  3HGB A;  1RK6 A;  4IFD G;  4GOP A;  1VQF A;  4CDF C;  4DR2 Q;  1ZKO A;  2NVY A;  5LA6 F;  2CW0 D;  1N56 A;  4ECZ A;  3GIM A;  3STB D;  4DV6 Q;  3PO2 B;  1EY4 A;  3AYH B;  2LY7 A;  2E2J B;  2OQ0 A;  3CCE A;  4CKB A;  3KLR A;  4F87 A;  2XC9 A;  2QKI C;  2B63 G;  2L1B A;  3S15 B;  3Q8Q B;  2K04 A;  3MTS A;  4A3J B;  5DG7 A;  4L5S A;  3NEM A;  1NSN S;  3N52 A;  4IZ8 A;  4N9P A;  3EBE A;  2OWO A;  3M4I A;  3R93 A;  3GTM H;  2JXM B;  1FGU A;  4RB0 A;  2ATL A;  2W6N A;  4K5W A;  4OIJ A;  5KG2 A;  3LWU A;  3I3C A;  5LMN Q;  1G6P A;  2F0Q A;  5JJI A;  4IQZ A;  1ENA A;  1Z2O X;  2UUC L;  1K8O A;  2W9B B;  1PFN A;  4RG1 A;  4YAJ B;  1I4R A;  2AGQ A;  1X3G A;  1B70 B;  1JKJ B;  2DPJ A;  2PZW A;  1J5E Q;  3PO3 B;  5BPH A;  3K3V A;  5IGC A;  1SEB D;  3Q22 A;  1NMF A;  4OIK A;  3R5H A;  2IJ0 A;  3OOC A;  5KG0 A;  4L8J A;  1YJW A;  3JSL A;  3VR4 A;  2B2W A;  2UUA H;  1WVL A;  4X62 H;  1JE4 A;  2ZJT A;  4LF4 Q;  2Y0S B;  2KHS A;  3RBD A;  3PGZ A;  3JZI A;  2PBZ A;  3L9A X;  5IIF A;  4YJ3 F;  4Q5V A;  3PR4 A;  3UE1 A;  1HNW H;  1IBM Q;  1EY5 A;  1F77 A;  4KHP L;  1IKM A;  2FIN B;  3IAY A;  5EKI A;  2V1C C;  4R8U B;  3OSO A;  1ZET A;  1A3V A;  2OCE A;  3R2T A;  5EKL A;  2JP1 A;  4JV2 A;  2HIV A;  3NBI A;  5FJ8 H;  4OGQ C;  3BU2 A;  1L0W A;  1AE3 A;  5K36 G;  1EU4 A;  5F2D A;  4B3R L;  5ISR A;  2WB1 A;  2C2E A;  4UDU C;  1PTO B;  3SVM A;  3NE5 B;  4HJ5 A;  5JEA G;  3IL8 A;  2AQ3 B;  4J9S A;  1H9J A;  4TRD A;  3S17 B;  1X65 A;  2J4X A;  1CKN A;  4L1K A;  2FHT A;  5LL6 X;  2UU9 H;  3S1Q B;  2RBM A;  5ELO A;  5KFV A;  1H9S B;  1F2Z A;  2EPB A;  3J7Y W;  4J8Q A;  4FM9 A;  3UE0 A;  3GTG H;  2UXC Q;  3GTK B;  1G91 A;  4ECS A;  4KMU C;  3M9B A;  4QMG A;  5KFQ A;  3DF7 A;  1KC8 C;  1TS4 A;  5DLF A;  3LNN A;  1HR0 W;  1LV9 A;  2Q8T A;  5KFN A;  4P74 A;  3HXL A;  5EJW A;  2KEC A;  4WJ4 A;  3M3Y B;  4AQY Q;  2AMC B;  4BBR H;  1U9R A;  4A3M G;  2YU9 B;  2EY2 A;  3N6X A;  4NLG A;  2JA7 G;  1HJP A;  2F0N A;  4ME5 A;  4P75 A;  4EX5 A;  1EOT A;  2CQA A;  3CKI B;  1WFQ A;  1KTK A;  4NMZ A;  2JA5 A;  3A54 A;  3L3O C;  2ZTD A;  3CCL A;  3LP8 A;  3C3L A;  5AFW A;  4CJ2 C;  3C1F A;  4H02 A;  1HNZ H;  1RJR A;  4HNT A;  2ICE C;  2PI2 A;  4XQN A;  2W7O A;  5JJZ A;  3C0F B;  2EJM A;  2Q2I A;  3F2U A;  1HZ9 A;  3TN2 A;  3RN5 A;  2Z6B A;  4HR7 A;  2MCT A;  3JAM E;  4TQR A;  1CQV A;  4DGZ A;  1X3E A;  1XWE A;  2O2L D;  1GJX A;  3E0J A;  4U67 3;  3KHR A;  4JI8 H;  1XMO H;  1JWM D;  4DLK A;  4ILW A;  5D3I B;  1AZQ A;  4LK1 C;  1G2S A;  1RD9 D;  4IAL A;  5IGG A;  3P20 A;  2AGP A;  2R7N A;  4O4H F;  3JAM L;  2ASD A;  5M3M B;  1JR0 D;  1F9R A;  1D5X C;  4U68 A;  2K33 A;  2I8C A;  3EVQ A;  4I7Z C;  2O5I C;  5K5P A;  4DV5 Q;  1TWG A;  2W9C A;  2HQE A;  4R8N A;  2AGO A;  1V1P B;  5HBR B;  3WOF A;  4G4K A;  2VPS A;  5M5W B;  4MAM A;  1VQK A;  3U58 A;  3Q2O A;  1D5M C;  3TP6 A;  3N40 P;  3BJY A;  3BQ2 A;  5D1O B;  4JYA Q;  5JUM A;  3T5K A;  3BA8 A;  1UWV A;  4NXN Q;  3JAM i;  2I5H A;  1WD1 A;  2EYP A;  4HYK A;  1DIK A;  2XCL A;  2W71 A;  4ECY A;  5EOY A;  4DR7 Q;  4DV1 Q;  2E2H A;  4A93 G;  1SXT A;  3RB0 A;  5L1L A;  3W1G A;  4HNU A;  4J6H A;  4EBD A;  4UCU A;  2NU9 B;  1ICF B;  1M8A A;  1TS3 A;  4LWC A;  4RH6 A;  1I94 H;  3H40 A;  4QUC A;  5CBA E;  1PH3 A;  3GV8 B;  2YYA A;  1DZ1 A;  3Q24 A;  4EBC A;  4GS3 A;  4RCN A;  3PUZ A;  1PZK D;  4JI5 L;  3RUZ A;  4DV4 Q;  4A3F G;  3NQI A;  5FKA C;  4A3G G;  2DJF C;  4RKL A;  2RCF A;  4LFC H;  4P72 A;  3MWE A;  1LT3 D;  2F4V L;  3NTH A;  1A2T A;  3SGI A;  2A6H C;  4O3Q A;  4DR3 Q;  2CZG A;  2C35 B;  3H0G G;  4QJF A;  5K2M A;  3A8J E;  2P0A A;  1QUQ A;  2IHE A;  3CXC A;  3S1M B;  3TRZ A;  2L4N A;  4JI2 H;  4K14 A;  1QZH A;  1HNX Q;  2KEN A;  4UP9 A;  4ED0 A;  1I5F A;  3GDE A;  4J1M A;  4LFA H;  1H9M A;  4KHZ A;  3KAJ A;  4LH6 A;  2EYH A;  3PQI A;  2A6H D;  3KYH C;  4UCV A;  2L0C A;  1SAP A;  2NVY B;  4GOP B;  1JIH A;  4B3S Q;  4PZ7 A;  2IW3 A;  1N8R C;  4NPS A;  3WOE A;  3SK8 A;  4A3C H;  4RAZ A;  2IMW P;  1FJG Q;  4FS1 A;  1S5B D;  1EWI A;  4J9L A;  1PTO C;  2KEE A;  4F7X A;  1AEX A;  3K7A B;  2R92 G;  4O3O A;  2OF1 A;  4S3S A;  4HJ7 A;  1LTL A;  1ILQ A;  3MFG A;  2I46 A;  1I6U A;  1BBX C;  2AKW B;  2R7Z G;  3T5J A;  2J6S A;  2R93 A;  5IGB A;  2OEO A;  3OWF A;  2R7L A;  2NZO A;  1PTO D;  3EFX D;  4FXK C;  5LMU L;  1WTO A;  4BY7 G;  4TKO B;  5GAD C;  3F2D A;  1SYD A;  2PZT A;  4N8X 1;  1UNS A;  2L15 A;  2AWO A;  5C0X G;  4DAM A;  2BH2 A;  5LMN L;  1XMQ H;  3C1E A;  3ULJ A;  2FE3 A;  3RV4 A;  3OHA A;  2NTS A;  2ZM6 Q;  4ZQI A;  2FK3 A;  1PK8 A;  2DY8 A;  4IRC A;  3HKZ G;  1PH5 A;  1L0Y B;  3S1N B;  3Q8P B;  1U4R A;  4EEQ A;  1PX2 A;  3BAB A;  2MHV A;  1ZEQ X;  5A35 A;  5KFM A;  5IWA Q;  1CT1 D;  5ELB A;  4BBS B;  2BQR A;  5C3E H;  1LTG D;  1SE4 A;  2HCI A;  4LF5 L;  4LH7 A;  2N49 A;  2WB1 B;  1KD1 C;  1FD7 D;  1DXM A;  3QIA A;  2PMZ A;  5JH7 F;  4B3T H;  2NVX A;  3Q8S B;  2OQK A;  4R4Q A;  1Q8I A;  3SK5 A;  4X66 H;  3ETH A;  4X3U A;  2K5V A;  2E2I B;  5L37 A;  1II3 A;  3CU7 A;  2OTL A;  1I7L A;  2A5H A;  3CC7 A;  1C9O A;  3GP7 A;  3U4Z A;  3HS0 C;  4L6T B;  4IWY A;  4EQN A;  2NYZ D;  1ULZ A;  2AQ2 B;  3ORQ A;  4O3R A;  3KJO A;  3DUZ A;  3DLL A;  1UE1 A;  1LTA D;  2M9V A;  3T5H A;  3N8D A;  3TEH B;  1RL2 A;  3T1Y L;  1S40 A;  3X3M A;  2XNA C;  3HOW H;  2UXC L;  2E75 C;  4LF6 H;  4TQU S;  1IBL Q;  5I47 A;  2HQL A;  1G2T A;  4MV4 A;  2NN6 H;  4O4L F;  4JI0 H;  3M85 A;  4DNT B;  3NPP A;  4C3J H;  3T1H H;  4O2A F;  3EIV A;  1T94 A;  5L1I A;  5GON F;  3PMF A;  1DON A;  2F4I A;  4XZ3 B;  2NUC A;  1A63 A;  1AH9 A;  5I9P A;  1A6X A;  2JA5 B;  3I4M B;  1E2W A;  4C3H H;  1MHW C;  3GIJ A;  3DM1 A;  4JV0 A;  1QIL A;  1TU2 B;  2VA2 A;  5J2T F;  4IJL A;  2YS7 A;  3RFC A;  4IFD J;  3ZYY X;  3FKI A;  4HCE A;  4FYD A;  3F1Z A;  2GN5 A;  5I6Y A;  2FB9 A;  5IGD A;  3MWD A;  4X64 L;  4QGU A;  1IYV A;  3I4O A;  2D0P A;  3H09 A;  4IUT A;  2TMP A;  4YHH H;  3K6O A;  1PXU A;  4HR7 B;  3J81 W;  1VS0 A;  3S16 B;  1NUC A;  1CQI B;  3LX0 A;  4G7O C;  1LTT D;  1U4M A;  1U4P A;  4EQO A;  3CW2 C;  3FDT A;  4A2A A;  4DK0 A;  2AQ4 A;  4HMI A;  2K01 A;  2K14 A;  5EPL A;  1PZJ D;  1VQN A;  4B3M Q;  4ZKC B;  3F8N A;  5BR8 Q;  1Y8P B;  1N34 L;  2L55 A;  3PIP 3;  2ALZ A;  2SCU B;  1SYG A;  3OSN A;  4MHE A;  3PZP A;  1YHB A;  1JJG A;  2XGQ A;  1KBL A;  5KFS A;  3J80 E;  4POG A;  4K6L A;  2PQE A;  1IBK H;  3JRX A;  4RCO A;  2QF7 A;  5CV7 A;  1I6H H;  2R7F A;  3FRP B;  1HZC A;  3TZD A;  4JI4 L;  2W9C B;  5KFB A;  2PN1 A;  3HOX H;  4MTE A;  2X0S A;  2YZG A;  1RF2 D;  1B50 A;  3HRZ C;  4GOP C;  3NEL A;  4A3B G;  4RGM A;  3UI2 A;  2KCC A;  2LSS A;  3L4K A;  1OXU A;  1XNR Q;  3TIN A;  3SDZ A;  1S0O A;  2VA3 A;  2IT1 A;  1VQ7 A;  1B04 A;  1O75 A;  2PQA B;  1XPO A;  4YB8 B;  1RDP D;  1E7Z A;  1QNK A;  2O03 A;  1SJE D;  4QY7 A;  4DL5 A;  2E2H B;  4IUP A;  5C5M A;  2BDO A;  4ED2 A;  2CWA A;  4EQP A;  1XNQ Q;  1F9P A;  1A9X A;  1B2T A;  3UDX A;  1X3P A;  3J80 i;  3ND9 A;  3KHH A;  1TWG H;  1PFM A;  3BYY B;  1VQL A;  5FLM G;  1GYF A;  4JI6 Q;  4X3S A;  3RLN A;  2JEJ A;  4YWM A;  4GKK L;  3MXN B;  1GGO A;  2R82 A;  3E5S A;  1Q86 C;  3MR6 A;  1EUJ A;  2VOB A;  5JEA J;  5KG5 A;  2QDB A;  1H95 A;  2JN4 A;  1BO0 A;  5HUR A;  4GN5 A;  4OX9 Q;  3L0O A;  3VDY A;  4MV8 A;  4R8I A;  3KHG A;  5LMN W;  1GUS A;  2B2W C;  1WCM B;  2E2H H;  1N33 Q;  4YY3 H;  2XD4 A;  5KT4 A;  1EEF D;  1QUQ B;  4CKE A;  3PW0 A;  1LT6 D;  4DR5 L;  2W6P A;  4RU9 A;  2VUM G;  1G6Z A;  4HMJ A;  3CCQ A;  4X3K A;  1K3R A;  1GHJ A;  4OXP A;  3KLS X;  4DR3 L;  3ONA B;  3QOL A;  4IFD I;  3GO5 A;  1KAB A;  2ZJP A;  3UFX B;  3CRK C;  5IYB G;  4DUY Q;  2HDM A;  4FF4 A;  4LF9 H;  1HNX L;  2C22 A;  4GKJ H;  3IKJ A;  5ELN A;  3R2I A;  1K8M A;  3CP0 A;  4PG3 A;  3A74 A;  2V9W A;  1P8L A;  2UUB H;  5JJK A;  4F8M A;  4JK1 C;  5FLX W;  5G3L D;  4A3K H;  4HQ6 A;  2UXB L;  3OTO L;  2I80 A;  3OIP A;  1GUT A;  5TSS A;  2Z9H A;  2JK8 A;  5M5Y B;  1N32 L;  4HIM A;  2R86 A;  2F0S A;  3P75 A;  3I91 A;  4OWX B;  1UAP A;  4RNO A;  2R93 B;  1NR4 A;  1KIX A;  1K83 A;  1Y1W H;  4B9W A;  4DA2 A;  4IRK A;  1QCB D;  2R7D A;  4IUN A;  4LUV A;  4MV6 A;  2Z4H A;  1KLU D;  1B7Y B;  1I4G A;  1M0T A;  2LXK A;  2HHH L;  2WE6 A;  5H80 A;  2FP4 B;  4LFB L;  5KFU A;  2EDG A;  2UUC H;  4CC6 A;  3L2P A;  3GTG A;  4Y8V B;  2V59 A;  3UDF A;  4YQW A;  4I65 A;  2NVT B;  4A4I A;  2YRX A;  4ECW A;  4IUU A;  3WDN A;  4ZKB B;  5KFP A;  1Q81 C;  2F0G A;  2W57 A;  1N36 Q;  1S72 A;  1V1O A;  4UAI A;  4EGV A;  3PO2 G;  4QF4 A;  4ZCK A;  1S4Z A;  1B9N A;  1Q12 A;  5COR A;  4DV3 L;  4H13 C;  4Y7N B;  3DWP A;  4A3J G;  3K5L A;  4FBT A;  5JQW A;  2NVQ H;  4KHP H;  4IPG A;  2PMZ B;  2NVX B;  3Q1K A;  5LP6 F;  2Z6K A;  3HOU H;  4X3T A;  4JG2 A;  4NP5 A;  4J9N A;  3B6Y A;  3N43 B;  3GTL H;  1SEI A;  4B3R H;  5FOB B;  4ZLT F;  2PNH A;  3PIO 3;  4A3I H;  1QG7 A;  2A69 C;  3GD7 A;  2Q2U A;  1D6E C;  3PO3 G;  5FJ8 G;  4I50 F;  3I12 A;  2L12 A;  3CQZ H;  2KJX A;  1HUM A;  3I56 A;  4DV2 L;  4U7C A;  4YJ2 F;  4IO9 A;  2BA1 A;  4QL5 A;  3HOY B;  2EYL A;  5C4H A;  1TY2 A;  2YTV A;  2Z1C A;  2Y0S G;  1DOM A;  1SNC A;  4DK3 C;  2NVX H;  1Y1V B;  3H4B A;  2R8G A;  4IUQ A;  3BVM A;  4DU9 A;  5KG7 A;  1R9T B;  1X3Q A;  1W93 A;  3NQT A;  1EY7 A;  4A3E B;  2ENB A;  1BBU A;  2VPQ A;  3H3V I;  5DLG A;  5CMD A;  4C3I H;  1IBL L;  3HFZ B;  2KOL A;  1QB5 D;  1ET9 A;  2N8N A;  2BQU A;  4JV5 H;  1SYX B;  4UCR A;  1AW7 A;  1SBB B;  4XT3 B;  3FMC A;  3CC2 A;  5BN5 A;  3HOY H;  3R8B A;  2R85 A;  4EG0 A;  1K28 A;  5IYD G;  3FVQ A;  1M90 C;  3G6Y A;  4CHT B;  1TY0 A;  1LTB D;  1AN8 A;  4LF7 L;  3HOZ H;  2NTT A;  4DXG A;  4LF8 L;  1IOV A;  2I5M X;  4M1U B;  5GQO A;  4IPC A;  5M3F H;  4ZOL F;  4K0K H;  1HUN A;  2WDT A;  3ORR A;  4NXM L;  1GUG A;  3EPI A;  5KG4 A;  3PSI A;  3F2B A;  5I2X A;  1HR0 L;  3A7L A;  3RZD B;  5EZY F;  3MR2 A;  5C44 H;  1S0N A;  4LAA A;  1JOK A;  1O7Y A;  4YWL A;  3HP3 A;  4K6D A;  2RGR A;  5NUC A;  4ODG A;  1NCV A;  3DEO A;  3Q23 A;  2DGY A;  4N8F A;  4DR4 Q;  3FKI H;  2ES2 A;  1WTH A;  2BR0 A; 
#chains in the Genus database with same CATH homology
 1VQC A;  1O7I A;  3K8A A;  2UUB Q;  1HJP A;  1VQG A;  2JA7 G;  4P75 A;  3K7A H;  1GKH A;  4EX5 A;  3W5O A;  5C0X J;  1WFQ A;  3RLF A;  1NTG A;  1Y14 B;  3KF6 A;  4DV3 Q;  4GLX A;  2JA8 H;  3E0E A;  2R92 H;  3HOV G;  3PUW A;  1PYS B;  5M5X H;  3RZD H;  2ZTD A;  2Q2T A;  5JJL A;  3CCL A;  2HIX A;  2R7Z H;  4YCV A;  4B3S L;  2CCZ A;  4JBK A;  4QIW E;  1K8G A;  1CSP A;  2UU9 L;  4H02 A;  1FJG L;  2A8V A;  3GTO H;  1VQ4 A;  1EFW A;  1VQ5 A;  2CFM A;  2PI2 A;  1PH9 A;  4BY7 H;  1XNR L;  2F3I A;  2Q2I A;  4AH6 A;  1HZ9 A;  3RN5 A;  4A3M H;  2UUC Q;  1SFO H;  4AIM A;  1E24 A;  5IY0 A;  3G6E A;  4DV2 Q;  1X3E A;  2ZTC A;  2MQH A;  1YHA A;  2VQE L;  4OWW B;  2FXQ A;  3STB C;  3PF4 A;  1X6O A;  4DV0 L;  3HOV H;  3H3V H;  2ATW A;  3HOU G;  5M3M G;  3S1N H;  1VQM A;  3RR5 A;  2Z0S A;  1CUK A;  2CKZ B;  4A3I G;  1JT8 A;  2K5N A;  3J7Z C;  4DV5 Q;  4BBS H;  1OXT A;  1BVS A;  1EQR A;  2N78 A;  1VQJ A;  2VZA A;  4KHP Q;  1VQK A;  3A5U A;  3U58 A;  3PUY A;  1GVP A;  1YI2 A;  2H5X A;  4FDB A;  4GN3 B;  1HNZ L;  2ZM6 L;  3OW2 A;  3KDF B;  4JYA Q;  1UWV A;  3KF8 B;  2E2I H;  4DAY B;  3JAM i;  3GTJ H;  4NXN Q;  1T9H A;  2I5H A;  4A75 A;  1PH2 A;  4B3R Q;  4A3D H;  4IOC A;  4UP8 A;  4DR7 Q;  4DV1 Q;  4A93 G;  3F2C A;  1D8L A;  1FVI A;  5IWA L;  1TWC H;  3W1G A;  1PH8 A;  1QVC A;  4LF7 Q;  4DUY L;  4LWC A;  1PHJ A;  1Z9F A;  4LF8 Q;  1KAW A;  4DNI A;  1HZA A;  4J15 A;  5AJ3 L;  1PH3 A;  2UUA Q;  4NXM Q;  2RHQ B;  3UDI A;  4X62 Q;  4HID A;  1HR0 Q;  3MEF A;  4HIK A;  1GO3 E;  4GS3 A;  1P16 A;  3BZC A;  3PUZ A;  4IPH A;  4JI5 L;  1CKM A;  4POF A;  4DV4 Q;  4A3F G;  1YIT A;  1PH4 A;  4A3G G;  2GVB A;  5GAH C;  4P72 A;  2F4V L;  1XPR A;  3CPW A;  5DLQ E;  4JCV E;  1HNW Q;  3SGI A;  1TWA H;  3JAM c;  3HOZ G;  2OTJ A;  4DR3 Q;  3FP9 A;  2KBN A;  2C35 B;  1X56 A;  3H0G G;  4QJF A;  3FHW A;  3CPF A;  4DKA C;  5C0X I;  1QUQ A;  1OXX K;  2MNA A;  2IHE A;  3S24 A;  5M3F G;  2E5L L;  3CXC A;  4DUZ L;  2JA5 H;  4LF6 L;  2KHI A;  1IL2 A;  3I4M H;  1HNX Q;  1QZH A;  4GNX B;  3TRZ A;  2KEN A;  3ZJY C;  4JV5 Q;  1EIF A;  5C44 G;  4UP9 A;  1I5F A;  3GDE A;  3RNU A;  4KHZ A;  3F8T A;  3KJP A;  3KYH C;  3M7N A;  2ZTE A;  4GOP B;  2B3G A;  4L5R C;  3CCS A;  1PH6 A;  4PZ7 A;  4B3S Q;  1K83 H;  1N8R C;  1RIP A;  3FKI G;  3K7U C;  1Z47 A;  4NPS A;  4BBR G;  2UU9 Q;  1FJG Q;  4A3C H;  4L5T A;  1I94 L;  3S16 H;  3S2D H;  4K0K Q;  1EWI A;  2HT1 A;  1HH2 P;  3CMA A;  4NB3 A;  2MFI A;  1VQE A;  3KLW A;  4OON A;  2JA8 G;  2R92 G;  2QGQ A;  4HJ7 A;  1W2B A;  1XTD A;  1LTL A;  4LFC L;  2NN6 I;  1G51 A;  2AKW B;  2R7Z G;  3A5Z B;  4KLK A;  3AFQ A;  4GLV B;  2VQE Q;  5HGQ A;  4DV0 Q;  1K9M C;  2NZO A;  2RF4 A;  5IP9 H;  3AFP A;  4C2M H;  1V43 A;  5LMU L;  2K4K A;  4JI2 L;  4DV7 L;  4BY7 G;  3CF5 A;  5GAD C;  2JEA I;  3F2D A;  3EN2 A;  3K81 C;  4LFA L;  3PUV A;  1VQD A;  2L15 A;  3J7A 5;  1MJC A;  1IBK L;  2AWO A;  3D31 A;  5C0X G;  4A3B H;  4JI1 L;  4JOI A;  4DAM A;  5BR8 L;  4B3M L;  2BH2 A;  5LMN L;  3BJU A;  4R4C A;  3ULP A;  1IZ6 A;  1J6Q A;  3ULJ A;  1BBW A;  4UPA A;  3I55 A;  4A3L H;  4JI3 L;  1IYJ B;  1YZ6 A;  1WI5 A;  4JBJ A;  4XTC S;  1HNZ Q;  1JB7 A;  2ZM6 Q;  3ER0 A;  4GLA C;  5IP7 H;  5GRO A;  1TXY A;  4P73 A;  3HKZ G;  2GVA A;  1PH5 A;  1XJV A;  1BKB A;  1ASZ A;  3I4N H;  3PIP A;  4BBS G;  2WP8 J;  4BY1 G;  5IWA Q;  3U50 C;  1A62 A;  5FLM H;  5C3E H;  2WB1 G;  4A76 A;  5E7N A;  4JI8 Q;  2UXD L;  1L1O B;  1XMO Q;  4LF5 L;  2N49 A;  1E1T A;  3NEN A;  1KD1 C;  2DUD A;  5AJ3 Q;  2NN6 G;  1D7Q A;  2CWP A;  1YBY A;  2OQK A;  4R4Q A;  3NBH B;  2A19 A;  2K5V A;  2WAQ E;  3UDG A;  5J3B A;  4JI5 Q;  1XNQ L;  4A3D G;  1WCM H;  3CAM A;  2K50 A;  2OTL A;  1YVC A;  2F4V Q;  3CC7 A;  1XMQ L;  1C9O A;  4JOI C;  4JI7 L;  3U4Z A;  4JI6 L;  4X65 L;  1Q1B A;  3K80 C;  1UE5 A;  1OTC A;  4DK6 C;  2E5L Q;  1W3S A;  3KJO A;  2BA0 A;  3DLL A;  1Q8K A;  1MIU A;  1UE1 A;  4DUZ Q;  1PH7 A;  3PUX A;  1VQB A;  3TEH B;  1RL2 A;  4GN4 B;  3T1Y L;  1S40 A;  1Q82 C;  1WOC A;  4BY1 H;  3HOW H;  1JJC B;  4OX9 L;  5IYB H;  2UXC L;  2UXB Q;  2K5H A;  5IT9 c;  1CSQ A;  5C4J H;  4WJ3 M;  4TQU S;  1IBL Q;  1N33 L;  2HQL A;  2YV5 A;  2IX0 A;  2RHS B;  1A0I A;  1NBW A;  3M85 A;  1PH1 A;  3CD6 A;  4C3J H;  1Q1E A;  3EIV A;  1I94 Q;  2WFW A;  1SR3 A;  2JA9 A;  3KF6 B;  3TQY A;  5M5Y H;  2JA5 G;  4B3T L;  3I4M G;  1A63 A;  1AH9 A;  4KI0 A;  4DR4 L;  3HKZ E;  4ME3 A;  4YCW A;  4C3H H;  1AE2 A;  4X66 L;  2UUB L;  4BA2 I;  3I2Z A;  2RCN A;  3PV0 A;  4BXX H;  2R93 H;  4Y52 H;  2I0Q A;  4LFC Q;  3L7Z C;  4IJL A;  4UY8 C;  3D0F A;  4IFD J;  1PVO A;  1YJ9 A;  4JBW A;  4UP7 A;  3KFU A;  2WB1 E;  3F1Z A;  2GN5 A;  2D0O A;  4OO1 I;  1HZB A;  2QA4 A;  4X64 L;  1PV4 A;  2YTY A;  4QGU A;  1PFS A;  3I4O A;  2D0P A;  3M4O H;  1ASY A;  1SMX A;  4A3C G;  3WWV A;  5IYC H;  4JI2 Q;  3G71 A;  5LMU Q;  4DV7 Q;  1VS0 A;  4TVA B;  1YHQ A;  5C4X H;  2XTI A;  2I5L X;  4LFA Q;  3CW2 C;  1VCI A;  3S14 H;  4DR6 L;  2NVT H;  2QEX A;  2K14 A;  1VQN A;  4PZ6 A;  4JI1 Q;  4HIO A;  5BR8 Q;  1N34 L;  4B3M Q;  1Q7Y C;  1OXV A;  1LYL A;  4JI0 L;  1YHB A;  1JJG A;  1VQ9 A;  1KHI A;  3J81 i;  3T1H L;  4JI3 Q;  4POG A;  3PO2 H;  1KRT A;  2K75 A;  4PMW A;  4GNX C;  5IP9 G;  3M4P A;  2E2J H;  2ASB A;  1NMG A;  2AHO B;  2EXD A;  1I6H H;  2R7F A;  1HZC A;  2KCM A;  2VY3 A;  4Y7N H;  2VQF L;  4JI4 L;  1VQ6 A;  4DR1 L;  3HOX H;  1K0R A;  1QVG A;  1YEZ A;  1TWH H;  3S15 H;  4A3J H;  1U5K A;  4GOP C;  2ALY B;  3NEL A;  1EOV A;  2B63 H;  1IXR A;  4A3B G;  1A8V A;  2LSS A;  5EAY A;  2JA6 G;  2JEB I;  4YWK A;  4JC0 A;  4HJ9 A;  1OXU A;  1XNR Q;  4A3L G;  4QQB X;  4DR2 L;  2IT1 A;  1VQP A;  1N36 L;  1VQ7 A;  2PQA B;  2WAQ G;  3DM3 A;  1XPO A;  4LF5 Q;  4YHH L;  1E7Z A;  4DV6 L;  2MO0 A;  4QY7 A;  5IP7 G;  3RLO A;  3S1R H;  4HJA A;  1MJE A;  4APV A;  4OWT B;  1V9P A;  2CWA A;  3KOJ A;  3OYY A;  1XNQ Q;  3I4N G;  3J81 c;  4OO1 G;  3PO3 H;  2Z6K C;  3UDX A;  1C0A A;  3J80 i;  2PI2 E;  1TWG H;  1VQL A;  4JBM A;  1XMQ Q;  4JI7 Q;  1L2F A;  1GD7 A;  5FLM G;  4JI6 Q;  5C3E G;  3RLN A;  1I50 H;  4X65 Q;  4YWM A;  2PMZ E;  3MXN B;  4GKK L;  1E3P A;  1Y1V H;  2NZH A;  1Q86 C;  1CKO A;  3A0J A;  1JMC A;  2YTX A;  1EUJ A;  2KHJ A;  5JEA J;  3T1Y Q;  1H95 A;  4XIG S;  4R4O A;  2JA6 H;  2D62 A;  1R9T H;  4GN5 A;  4OX9 Q;  3L0O A;  3VDY A;  3RN2 A;  4A3E H;  1KXL A;  1UE7 A;  1WCM G;  5LMN W;  1V1Q A;  1J5E L;  2E2H H;  1N33 Q;  1QUQ B;  2B29 A;  4LUZ A;  4DR5 L;  1SE8 A;  2VUM G;  4HJ8 A;  3CCV A;  2IHF A;  4MTN A;  3CCQ A;  1LUZ A;  1K3R A;  1JE5 A;  3TRE A;  1SLJ A;  1SRU A;  4B3T Q;  4OXP A;  1SN8 A;  3J80 c;  3PIO A;  4DR3 L;  4LF4 L;  4IOA A;  3KDF A;  1GM5 A;  1EIY B;  4IFD I;  3CCU A;  3GO5 A;  3HOW G;  4X66 Q;  2ZJP A;  2Y0S E;  5IYB G;  1M1K C;  3H15 A;  4DUY Q;  3ICE A;  3S17 H;  5IYD H;  2BH8 A;  4R1J A;  1HNX L;  4JV5 L;  3S1Q H;  1E22 A;  5ELN A;  1IBM L;  2JJQ A;  2EIF A;  4AYB E;  2IX1 A;  3CP0 A;  4PG3 A;  4RMF A;  2KCT A;  1L1O C;  1OXS C;  3E9H A;  4IPD A;  3A74 A;  3GTK H;  3RZO H;  1P8L A;  4X64 Q;  1X3F A;  2VS1 A;  1E1O A;  5JJK A;  1CKN B;  2ZJQ A;  3TS0 A;  4A3K H;  3GTQ H;  2UXB L;  3OTO L;  1TWF H;  2MO1 A;  4IJH A;  2JK8 A;  1N32 L;  4HIM A;  2VUM H;  3GTP H;  4K0K L;  4PZ8 A;  4OWX B;  4BXX G;  4DR6 Q;  1UEB A;  3K0X A;  2R93 G;  3M3Y H;  4LF6 Q;  1XPU A;  1N34 Q;  1KIX A;  2YU9 H;  3TS2 A;  4YY3 L;  3BZK A;  4DPG A;  1I3Q H;  1Y1W H;  1KQS A;  4JI0 Q;  1VQH A;  4LW1 A;  2XGT A;  3T1H Q;  2R7D A;  4LUV A;  2JA7 H;  2LXJ A;  3AQQ A;  1KL9 A;  1B7Y B;  5IYC G;  3CME A;  2LXK A;  2HHH L;  2CQO A;  4JI4 Q;  2VQF Q;  1G29 1;  1YJN A;  4LFB L;  5C4X G;  1PYB A;  4DR1 Q;  4GNX A;  3L2P A;  2IY5 B;  1X55 A;  2JQO A;  1MKH A;  3IRB A;  1B8A A;  1QZG A;  1VQI A;  2F52 A;  4LF9 L;  1VQA A;  3UDF A;  4GKJ L;  1SRO A;  1KRS A;  1K73 C;  4A4I A;  1WYD A;  1JJ2 A;  2JE6 I;  2R6G A;  3JC6 6;  5IE8 A;  4AQY L;  3E9I A;  1Q81 C;  4IFD G;  4GOP A;  1VQF A;  4DR2 Q;  1NE3 A;  1S72 A;  1N36 Q;  3PO2 G;  1C7Y A;  4YHH Q;  3STB D;  4DV6 Q;  4ALP A;  2VL6 A;  3G48 A;  2E8G A;  1FL0 A;  3AYH B;  2ZJR A;  1Q12 A;  4YCU A;  4DV3 L;  2OQ0 A;  3CCE A;  5FLX c;  3HOX G;  4A3J G;  1U0L A;  2B63 G;  2NVQ H;  4IPG A;  1WJJ A;  3PCO B;  2PQA A;  3Q8D A;  2YYZ A;  4L5S A;  3NEM A;  3PF5 A;  3W1B A;  2OWO A;  3EBE A;  2Z6K A;  1QVF A;  4GKK Q;  3CCJ A;  3GTM H;  3HOU H;  1FGU A;  4JG2 A;  2Q2H A;  4MZ9 A;  5M3M H;  1IBK Q;  3B6Y A;  5HY6 A;  3GTL H;  4L5Q A;  5LMN Q;  1G6P A;  4JI8 L;  2PNH A;  5JJI A;  4A3I H;  1XMO L;  3GD7 A;  2UUC L;  2Q2U A;  3PO3 G;  4RG1 A;  5M5W H;  5FJ8 G;  2ID0 A;  2N3S A;  1X3G A;  1B70 B;  3CQZ H;  3I56 A;  4DV2 L;  1J5E Q;  4P71 A;  3HOY G;  4MNO A;  4IO9 A;  2BA1 A;  4DR5 Q;  1NMF A;  4QL5 A;  2EQS A;  1X9N A;  4LNQ A;  1YJW A;  1Y1V G;  2YTV A;  2Y0S G;  4DK3 C;  2NVX H;  4A93 H;  4LF4 Q;  1EYG A;  4AYB G;  3PGZ A;  1S3O A;  1X54 A;  4A3E G;  3I7F A;  4DV5 L;  2UXD Q;  3AEV A;  5GAE C;  1DGS A;  3UE1 A;  4EQ5 A;  1IBM Q;  4KHP L;  1BBU A;  4R4I A;  5H1S E;  5GAG C;  2V1C C;  3H3V I;  3S2H H;  2OCE A;  4C3I H;  1IBL L;  4JYA L;  2HIV A;  3HFZ B;  3U4V A;  3CCM A;  2N8N A;  5FJ8 H;  4NXN L;  3CCR A;  3OTO Q;  1L1O A;  3BU2 A;  1AE3 A;  1L0W A;  3HOY H;  3M4Q A;  4R4T A;  1N9W A;  3CC2 A;  4B3R L;  5K36 G;  4A3F H;  1N32 Q;  2AWN A;  4O2D A;  3G4S A;  4HJ5 A;  4A3G H;  5IYD G;  5JEA G;  4DV1 L;  4DR7 L;  1NY4 A;  1M90 C;  4O0A A;  4X6A H;  1VQ8 A;  1X65 A;  1CKN A;  1EQQ A;  3ERS X;  4YY3 Q;  1K8A C;  4LF7 L;  3HOZ H;  1UE6 A;  3H0G H;  5ELO A;  1VQO A;  4LF8 L;  3S1M H;  1LM0 A;  2I5M X;  5M3F H;  5GQO A;  4IPC A;  1NJI C;  3UE0 A;  1YNX A;  4LUO A;  3ULL A;  3GTG H;  2UXC Q;  4NXM L;  2UUA L;  4A3K G;  3PSI A;  2A1A A;  3F2B A;  2K52 A;  4X62 L;  1HR0 L;  2HHH Q;  5C44 H;  1Q46 A;  3M9B A;  2VNU D;  4DV4 L;  3CC4 A;  2VW9 A;  4LFB Q;  1KC8 C;  3J81 j;  4YWL A;  3HKS A;  1HR0 W;  2NVY H;  1PA6 A;  4P74 A;  4LF9 Q;  4GKJ Q;  3LGJ A;  1HNW L;  4WJ4 A;  2DGY A;  4AQY Q;  4DR4 Q;  3FKI H;  2AMC B;  4BA1 I;  4BBR H;  4A3M G;  1Y1W G;  2ES2 A;  1YIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...