5IP7G

Structure of rna polymerase ii-tfg1 peptide complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
total genus 33
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip7G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 5ip7G01
2YTYA 4A3FG 1HNXQ 2ZTDA 3JAMc 4TQUS 1OXVA 1PV4A 1YBYA 4L5RC 2R6GA 3HOXG 3UDXA 1N8RC 1N33L 4A3DH 1YNXA 1N36L 1D7QA 1A8VA 2CQOA 5C0XG 4DR1Q 3U58A 1PH9A 4KLKA 1X9NA 4A3IG 3I4MH 1TWGH 1TWAH 5IP7G 1I50H 4A93G 3HOWH 3PV0A 4JI8Q 2KCTA 1OXUA 4GS3A 4GOPC 3HOUH 2F3IA 1MIUA 2Z6KC 3I4NH 1XMQL 3E9IA 5K36G 2OQ0A 4HJ5A 1B8AA 3UDIA 1WCMH 4KHPL 1A0IA 1V43A 4DR5L 3TRZA 2UU9Q 1WI5A 3ER0A 3ZJYC 4AQYL 2R92H 1E1OA 4A3LG 2K5NA 4DK3C 3CMEA 2HQLA 3I4NG 4LUZA 3D0FA 2N49A 3T1YQ 2OWOA 3GDEA 1VQAA 1K73C 1XNQQ 2OTJA 1KRSA 1VQ7A 4A3CG 3AFPA 3RLFA 3HOYG 4DV1L 1HNWL 3KDFA 3PO3G 2ID0A 3A5ZB 2KHJA 3J81i 2JA6G 3NBHB 3GO5A 1P16A 1VQMA 5IP9G 4LF9Q 1CKNB 3KJPA 1IXRA 2OCEA 1PH3A 4YY3Q 1NJIC 3FHWA 5IYCH 2CCZA 1SRUA 4JI3Q 2PQAA 1BBWA 1N34L 1VS0A 4X6AH 3S2HH 4BBSH 2AWNA 4UP9A 4TVAB 4P71A 4YCVA 1Y14B 5M5YH 2EQSA 1C7YA 2DUDA 1KIXA 2I5HA 1OXTA 4DR4L 1YZ6A 1JJCB 1C9OA 2RHSB 4UP8A 4C3HH 5IYBH 4GNXC 1SN8A 4MTNA 2YYZA 4LFCQ 3M3YH 2AKWB 2AWOA 3L2PA 3HOZH 4A3JG 5IY0A 4YHHL 4X62L 2ATWA 4BXXG 4IFDG 4X65Q 4AIMA 1XPRA 5FJ8H 4B3RL 3W1BA 1I94Q 1EWIA 3U50C 1G291 1H95A 1FGUA 5M5WH 1Y1VH 3S14H 1S40A 1YVCA 2ZJRA 3PO2G 3S1QH 2UXCL 1NMFA 1X65A 3PF5A 1MJEA 3ERSX 4DV4L 2E2IH 3H15A 3HOYH 1OTCA 1NMGA 4HIDA 3I55A 1JMCA 1IL2A 1VQHA 4LFAQ 4JBMA 1HZBA 1UE1A 4HJ9A 3H0GH 3I2ZA 3GTKH 4JBWA 4ME3A 2UUBL 2VQFL 4GKJQ 4NXMQ 1Q12A 5EAYA 1FJGQ 1XNRL 1GO3E 4GLVB 4DR7Q 4QL5A 4GOPB 1I5FA 2VW9A 2NZOA 3OW2A 2UXDQ 2R7ZG 4LUVA 1N9WA 1LUZA 2IT1A 4B3MQ 4POGA 3S17H 2YTXA 4OWWB 1OXXK 2K14A 2GVAA 1IBML 4DUZQ 3RLNA 2BA1A 2PI2E 4DR2Q 2WAQG 3GTOH 4BY1H 2F4VL 1XTDA 3TQYA 3OTOQ 3K0XA 1VQLA 3E9HA 2ES2A 4B3SQ 2K75A 4YWLA 1VQ4A 4A3DG 1L0WA 3PIPA 2UXBQ 4EX5A 3B6YA 3I4MG 1IBLQ 1NBWA 1HNZQ 2A8VA 3CCUA 3TEHB 4HJ8A 3HOWG 3AEVA 5LMUL 5C3EH 3HOUG 3J81c 1VQ5A 1VQOA 3G48A 3L0OA 4R1JA 1JT8A 1RIPA 5GQOA 1WCMG 1UWVA 2JA9A 3K8AA 2JA7H 2R93H 2I5MX 2Z6KA 1E22A 1X56A 3PUXA 3PIOA 4A3EH 2CFMA 1PH6A 1IBKQ 2R92G 2KENA 3PUWA 1DGSA 3CCLA 1SMXA 1V9PA 4OO1G 1KD1C 5IWAL 3F2DA 4YCWA 3I56A 4C3IH 3CCJA 2NVTH 3KLWA 1KXLA 4UY8C 1WOCA 4JI6Q 1VQ9A 2WB1G 4DUYQ 5C0XI 3KJOA 2N8NA 2NN6G 2JA8H 4IO9A 2I0QA 2ALYB 4BA1I 4EQ5A 4DR6L 5BR8L 4Y52H 4JI1L 3KYHC 3AYHB 1EIFA 2KBNA 3RNUA 2ZM6L 3K81C 4JI2Q 2VQEL 4LFBL 1E1TA 5HY6A 1GKHA 4K0KL 5IYCG 4LF4L 3MXNB 1CSPA 1NTGA 5ELOA 3K7UC 5JJLA 2PNHA 2XTIA 3S1RH 4A3KH 3M4PA 4BBSG 2R7FA 5M3FH 2E2JH 2CWAA 3I7FA 1VQCA 1HR0L 2D62A 2ZJQA 4DKAC 1Q7YC 5LMNQ 3UE1A 1M1KC 1X3EA 4ALPA 1Q82C 4NPSA 1PH8A 5IYBG 2MQHA 4AYBE 2EXDA 3PGZA 3HOZG 5GADC 1SROA 2VZAA 4DV7Q 1BVSA 1KHIA 1PFSA 4DV0L 3D31A 5FJ8G 2KHIA 4GNXA 1M90C 1FL0A 4X62Q 1TWHH 3BU2A 4B3TQ 1Y1VG 3J81j 4DV2L 1PYBA 3W1GA 3J80i 1XMOQ 1VQFA 5AJ3Q 4LF5Q 3M9BA 1VQ8A 2JK8A 2XGTA 5DLQE 2LXKA 3M7NA 1UEBA 2IX0A 4LF7Q 2IY5B 4BY7H 1JE5A 3I4OA 4DV4Q 3PUVA 4R4OA 3H0GG 4JI7Q 2IX1A 3NEMA 3T1HL 2LSSA 2DGYA 1VQPA 4JI0Q 1U0LA 1QZHA 1D8LA 4IFDI 3W5OA 1YJ9A 2BH2A 2HHHL 3M85A 3H3VH 4BA2I 1KQSA 2Q2IA 4JOIC 2MO0A 4OONA 3CD6A 1VQBA 1B7YB 1LM0A 1FVIA 2OQKA 3G71A 4JI4L 3DLLA 1T9HA 3CP0A 4R4IA 4OX9L 1N32Q 1Q1BA 1BBUA 2Y0SG 4BY1G 3ULJA 2D0PA 4DV3L 4DR3Q 2NVXH 1XPOA 1V1QA 2N78A 4J15A 2YV5A 4LW1A 3STBD 3CC7A 3K7AH 3VDYA 1PHJA 3ICEA 4X64L 1RL2A 1SE8A 5IE8A 5C4XH 4LWCA 4IOAA 1E24A 2E8GA 1CKOA 3FKIH 4JOIA 4HIMA 2B63H 5C3EG 4DAYB 4MZ9A 4DV5Q 1HZCA 1KAWA 2JEAI 4JV5L 3KOJA 1YHQA 1CKNA 3GTLH 3BZKA 4LF8L 2MNAA 2ZTCA 2WFWA 5M3MH 2E5LL 4XTCS 4GKKQ 1XPUA 1Q46A 2JA7G 4PMWA 2R93G 4LF6Q 4PZ7A 1WJJA 2GVBA 3HOVH 4A3EG 1NY4A 1JJGA 2JA5H 1QVFA 4NB3A 3IRBA 1A62A 3T1YL 4C3JH 1XNQL 4DV6Q 2JA8G 2IHFA 3EN2A 3KF6B 3RN5A 2E2HH 1HR0W 4GLAC 4A76A 4QQBX 3FP9A 3CXCA 2RF4A 1L2FA 3UE0A 5M5XH 2ZTEA 3U4VA 2L15A 1YIJA 4LF9L 4RMFA 2QEXA 4DR6Q 5BR8Q 3BJUA 4QGUA 1JJ2A 4LNQA 4YY3L 4JI3L 3J80c 4IPGA 3GTPH 1VQIA 1N33Q 2YU9H 3NENA 4K0KQ 4A3KG 1N36Q 1WYDA 1HH2P 3CCQA 2HIXA 5M3FG 3AFQA 4OO1I 4JBJA 3HFZB 2V1CC 1P8LA 3MEFA 4LFCL 3CAMA 5FLMH 2NN6I 4GOPA 2D0OA 1HZAA 3SGIA 4X66L 1XMQQ 4WJ3M 4X65L 1L1OB 5C0XJ 1AH9A 4KHPQ 1I94L 1BKBA 2Z0SA 3PF4A 2WAQE 3BZCA 4DR5Q 1KL9A 4A3GH 1CSQA 2UUAL 3M4OH 4IPHA 4AQYQ 3U4ZA 1K3RA 1A63A 3AQQA 1EOVA 3UDFA 5GAEC 1YHBA 3OYYA 1K8AC 2JEBI 3GTGH 2NVQH 4BY7G 1MJCA 4LFAL 5FLXc 4OWXB 1HNWQ 1Q1EA 4DV1Q 1Y1WH 2UUCL 2RHQB 4JYAL 4BBRH 2HT1A 3G6EA 4NXML 1G6PA 5GAHC 1KC8C 1X3GA 3LGJA 1QUQA 1FJGL 3J7ZC 1IYJB 1NE3A 3CMAA 3S16H 1G51A 3S1MH 1PA6A 3HKSA 1SLJA 2NVYH 2AHOB 3RN2A 3CCSA 4NXNL 1J5EL 4B3ML 3RLOA 3HKZE 1N34Q 3EBEA 2FXQA 4JBKA 2VS1A 1Q81C 2HHHQ 3F2CA 3KFUA 4DUZL 3E0EA 4DR2L 3S2DH 4H02A 1QZGA 3PUZA 4JI4Q 3JC66 1X3FA 4DR4Q 1XJVA 3OTOL 4B3SL 3CW2C 4APVA 2WB1E 4DV3Q 1SR3A 4OWTB 4JC0A 1TWCH 2VUMH 1OXSC 1R9TH 4YHHQ 4IOCA 4A3MG 1JB7A 2UXBL 1KRTA 3KDFB 5C4XG 1IBLL 4A4IA 4B3RQ 1HNZL 4X64Q 1GVPA 2VY3A 3FKIG 1EYGA 2B63G 2ZJPA 2K4KA 4A3BH 2ASBA 1E7ZA 2IHEA 2UXCQ 1K9MC 4P74A 2PQAB 3CCVA 2KCMA 3RZOH 5JEAG 1VQKA 5M3MG 4JV5Q 4IFDJ 3TREA 4L5QA 4AH6A 2LXJA 2Q2TA 4LF8Q 1C0AA 1HZ9A 1PH7A 1O7IA 1IBKL 4L5SA 2E5LQ 3HOVG 3CQZH 4UP7A 2JA5G 2MO1A 5ELNA 5C44H 2UUBQ 1U5KA 3GTJH 4GN3B 2VQFQ 1L1OC 2CKZB 4YWMA 4HJ7A 2A1AA 1XNRQ 2OTLA 2F52A 4FDBA 3A5UA 4JI6L 4DUYL 2C35B 3ULPA 1PYSB 2GN5A 2I5LX 1E3PA 4HJAA 4JI5L 1EIYB 3F8TA 2B3GA 4QIWE 2WP8J 3J7A5 1VQNA 4UPAA 4XIGS 1IBMQ 3GTMH 1AE3A 2MFIA 4KI0A 5JJKA 1PH4A 1HNXL 3GD7A 4JI2L 4IJLA 2BA0A 5E7NA 4YCUA 4JG2A 3S24A 1VCIA 2F4VQ 4A3FH 1YITA 1K0RA 1QVGA 3RZDH 1TXYA 4DK6C 3KF8B 2EIFA 3PUYA 4DPGA 4DR1L 4A3MH 3HOXH 4WJ4A 1UE5A 1TWFH 1W2BA 1K8GA 4PZ8A 1YI2A 3Q8DA 2N3SA 4P72A 4P73A 4PZ6A 4JI8L 4A3IH 4R4CA 4HIOA 3CCMA 5LMNL 1VQDA 1SFOH 5IP7H 1ASYA 1LTLA 4A93H 2Q2HA 3G4SA 5LMUQ 5JJIA 4GLXA 5GAGC 5FLMG 3EIVA 4C2MH 4L5TA 4DV7L 1J6QA 1Q8KA 4KHZA 4A75A 2UU9L 1HJPA 1VQEA 3GTQH 4YWKA 2A19A 4X66Q 2JQOA 3NELA 1CUKA 1EQQA 2Y0SE 4B3TL 2PI2A 4A3GG 1X6OA 4A3LH 4GN5A 1XMOL 3CCRA 3K80C 4RG1A 3JAMi 5AJ3L 3CF5A 4POFA 1K83H 1YJWA 2Q2UA 5IWAQ 1B70B 2UUAQ 3L7ZC 3TS2A 4QJFA 3F2BA 1PH1A 4LF7L 1VQGA 4O2DA 4LF5L 4IPCA 4A3CH 1Y1WG 5J3BA 3M4QA 4R4TA 3WWVA 3CC4A 4JI7L 3PO3H 1IZ6A 4BBRG 1GM5A 5GROA 4JI1Q 2JA6H 4LUOA 1LYLA 5IT9c 2ZM6Q 5IP9H 5IYDG 2UUCQ 4JYAQ 2VQEQ 1UE6A 1Q86C 4JI0L 4LFBQ 1I3QH 2CWPA 3TS0A 1YJNA 4LF4Q 1S3OA 2JJQA 3CCEA 4DAMA 1J5EQ 4NXNQ 2RCNA 2HIVA 4R4QA 1HR0Q 1N32L 3F1ZA 4DR3L 1ASZA 2QGQA 4DNIA 2VUMG 1Z47A 4A3JH 1W3SA 2PMZE 1PH2A 3KF6A 1VQ6A 4BXXH 4DV0Q 4JCVE 1EUJA 3DM3A 2B29A 5C4JH 4A3BG 3UDGA 1YHAA 2K52A 3S1NH 4DV2Q 4DV5L 1QVCA 3S15H 2VL6A 1GD7A 2R7DA 3PO2H 1QUQB 4MNOA 2K5VA 1S72A 3H3VI 1I6HH 4HIKA 2H5XA 1X55A 4GKKL 4LF6L 1X54A 4O0AA 1MKHA 4GKJL 2BH8A 3PCOB 3CPFA 4Y7NH 1VQJA 3ULLA 3PSIA 4PG3A 3HKZG 4DR7L 5IYDH 3RR5A 5C44G 4IPDA 3CC2A 4OXPA 3A74A 3T1HQ 1EFWA 2QA4A 4IJHA 2JE6I 2UXDL 4GN4B 4P75A 5HGQA 4DV6L 3A0JA 4AYBG 3CPWA 1PVOA 2NZHA 1CKMA 5H1SE 1YEZA 2R7ZH 1WFQA 4QY7A 5JEAJ 2K5HA 1Z9FA 4GNXB 2AMCB 1L1OA 2VNUD 2YTVA 5LMNW 1PH5A 1UE7A 4JI5Q 1EQRA 1AE2A 2K50A 4OX9Q 3STBC
chains in the Genus database with same CATH superfamily
4G4KA 2FE3A 3SK4A 2VA2A 1SE4A 4RAUC 1HNXQ 1GJXA 4TQUS 4CKEA 3PIP3 1PV4A 1YBYA 1LT3D 3UDXA 1FNWA 2R82A 3X3MA 4RZQA 3LWBA 2CQOA 3M9MB 3U58A 2AGPA 1EZ6A 4A3IG 1N48A 1I50H 3I3CA 3PV0A 2B2WA 2KCTA 4C2MA 4C3JB 3JAML 3EA6A 5EKLA 1JC7A 3BVZA 2OQ0A 4JI3H 1B8AA 2DLNA 1A0IA 2EY5A 3V2TA 5IGDA 1WI5A 2R92H 2WYOA 1J9OA 1HUMA 4EEYA 4LUZA 2F0KA 1VF7A 2M9VA 5FKAC 2IBKA 4LFCH 1KRSA 4RNOA 1JWUD 5J1ZA 3HOYG 4DV1L 3KDFA 3PO3G 1K1QA 5KG1A 2KHJA 4GC6A 3H3VC 3GO5A 1P16A 4KD3A 1VQMA 4LF9Q 4UFZA 1IXRA 1S5FD 2ZDQA 2JA7B 4QWCA 1NJIC 1JIHA 4RUCA 5C5JA 1T3NA 1PXUA 5KFOA 4HAEA 2O4XA 4CDEC 4X6AH 4KJNA 2ZXPA 4UP9A 3A7LA 2LKVA 4YCVA 1Y14B 2EQSA 1CK1A 2DUDA 1JJCB 1C9OA 4UP8A 4O2BF 3PQIA 4QWBA 4NXMH 5IYBH 1LLRD 3H40A 3HOZH 1M0WA 4IFDG 2EYLA 2DY8A 4YHHL 3L4JA 4AIMA 1L0XB 5JVG3 4BBRB 4IN3A 4XQJA 3S14H 1Y1VH 4A2BA 4DR2H 2ZJRA 1J8IA 5E4XA 2R7KA 1LTSD 5D14A 2C2EA 5KG5A 2V9WA 1NMGA 4HIDA 4FS1A 2FJ2A 4LFAQ 3NPPA 1GSAA 1UE1A 1LACA 1T36A 3GTKH 4ME3A 4A2AA 3NTIA 2W6NA 1HNZH 5KNCA 5EGTA 2AQ3B 4DNRB 1G2TA 1E4FT 2XCAA 5IIFA 4DR7Q 2XN9C 4QL5A 2FINB 2UXDQ 1SYFA 3GIDA 2R7ZG 4B3MQ 3AU7A 1TT2A 2R87A 3MR5A 4EQOA 2WAQA 3PW4A 4DUZQ 2PI2E 4L1KA 4HTHA 4ZKBB 4BY1H 1CTMA 1EL0A 3NXWA 1RKNA 4FS2A 3K0XA 4B3SQ 2NTTA 1CFMA 1VQ4A 5I4DA 1TWGA 3PIPA 2IL8A 3B6YA 3H6MA 3I4MG 2F03A 1IBLQ 4J9NA 1GXDC 4JVZA 1PTOD 3IFDA 4DL3A 3AEVA 4HN7A 5C3EH 2W6MA 1QWYA 1VQ5A 3P75A 3BAAA 5I9OA 5KG7A 1WTOA 3K5OA 1F2MA 1JT8A 1Q8IA 1RIPA 4XT3B 3ND9A 1JORA 1UWVA 2JA9A 1W93A 2R93H 5KGUA 2I5MX 1SJED 5DNFA 2NVXB 3PUXA 3VYRA 3QWNA 2QF7A 3QJYA 1R4PB 1F2YA 5BN3A 3KLWA 3T53B 5C4XB 3D8GA 1WOCA 1KXLA 1JWSD 5C0XI 2J6UA 5KFFA 3TQTA 4IO9A 2W9BA 2W9CA 2I0QA 3OW7A 1SYDA 1SFOB 2O5IC 4EQ5A 5HBRB 5DG7A 4JI1L 4A93B 3T51B 2R7MA 2ZM6L 5CR3A 3MXNB 3ORRA 5ELOA 3BS1A 5JJLA 2XTIA 2SOBA 2X6LA 4A3KH 5D1OB 4BBSG 5M3FH 2E2JH 3DWQA 3MWMA 1TQOA 2DN8A 4DKAC 3UE1A 4JI7H 2R7NA 2WINB 4MV4A 3NGDA 5BN4A 1Q82C 4X3SA 2J7ZA 2MQHA 2E2HB 2JP1A 1EIHA 3PGZA 3J80E 2BOSA 3DWPA 2BQUA 4DV7Q 3WO1A 1IKLA 3SEBA 3D31A 5FJ8G 2KHIA 1V4YA 2ICIA 1FL0A 3L9AX 5KT2A 3EJIA 3J81E 3J81j 4DV2L 3R8BA 1STBA 1XMOQ 4YR3A 4M7EA 2I07B 5AJ3Q 4LF5Q 3SK5A 2E2IA 2FFKB 1KJ9A 2EYHA 4CKCA 3QZ7A 4O4HF 1S0NA 3T5LA 5KFZA 1BO0A 1TS5A 1EU4A 1KAAA 1IKMA 1VMCA 4DV4Q 3H0GG 2XGQA 2ZDHA 1X3PA 1H9MA 1VQPA 1HFGA 3GLKA 5DLGA 1QZHA 3EPGA 5J39A 4BA2I 3NP8A 1KQSA 4JOIC 3GTOA 1FVIA 1L2ZA 3DLLA 2F0TA 5KFIA 4KTAA 1BBUA 1HTPA 4DV3L 3GTGB 1EIGA 1E0BA 2KJXA 2NVQB 1XPOA 1SYXB 3MHBA 1PK8A 1Y1WB 3CC7A 3K7AH 4WRDA 1RL2A 3VR2A 5KIXA 4OL7A 5IE8A 2B2WC 3DM1A 4LWCA 2VOBA 1C3OA 1E24A 4MTDA 1CKOA 2B63H 1DOLA 3GIQA 4DV5Q 4JV5L 3A56A 4CKBA 1AZQA 4R8IA 3UQ8A 2ZTCA 1JCKB 4XTCS 4GKKQ 1B6RA 2JA7G 4PZ7A 4ECVA 1OWTA 1N36H 2VPQA 1WJJA 1QVFA 1EY8A 1EOTA 4NB3A 1NUCA 3OMGA 2NU9B 3BA9A 3K0YA 1R9TB 4MV8A 3N41B 2NUAB 2ZXOA 3A7AB 4DV6Q 3TP5A 4FM9A 1XMQH 3Q8QB 1HTLD 1HR0W 3OIQA 4A76A 1JOQA 3QFFA 1L2FA 5M5XH 4LF9L 4MAMA 2QEXA 4C5CA 3N44B 5BR8Q 1ESFA 1CHPD 3J80c 4KD4A 4RCNA 1VQIA 3MFIA 3CQZB 3NENA 2YU9H 5H80A 1FR3A 4GC7A 2BQRA 1CQVA 1WYDA 3E6ZX 3MAQA 4OO1I 1AN8A 3HFZB 5EWGA 5EDWA 4AYBB 4DL5A 1W96A 4DAVA 3CAMA 2NN6I 3SGIA 1CQJB 2C28A 1TWHA 1L1OB 4KHPQ 1JB3A 4DR5Q 1KL9A 4Q8EA 1CSQA 3M4OH 4F4XA 3HOXB 5GAEC 1EOVA 4B9XA 1YHBA 5KFYA 2XIWA 1T5XD 3OYYA 4DV3H 4EGVA 4OELB 1HQMC 5CBEE 4KKUA 4LFAL 4X62H 1HNWQ 5COYA 1PTOB 2RHQB 3N52A 4Q5VA 2AQ1B 2E76C 5AFWA 1AUVA 1G6PA 3PR4A 5DEHA 1KC8C 1QUQA 4IWXA 5C8YF 2KHSA 4UCRA 3RN2A 2NVYH 4G3IA 4NXNL 4B3ML 3RLOA 4JV5H 2C22A 1N34Q 4JBKA 2VS1A 3FDTA 3F2CA 4DUZL 3KFUA 3HBLA 2NBFA 4RB0A 2V4DA 2FP4B 4JI4Q 4DR4Q 3K59A 5FO9B 1A3VA 2C2RA 4B3SL 4APVA 3RFCA 1SR3A 2FMMA 2VUMH 4O3QA 2K01A 4QW9A 1ILQA 1S97A 4MIUA 4RKLA 4QWDA 1JB7A 1KRTA 3KDFB 3M4YA 5C4XG 3FEWX 4NDXA 1IBLL 2XD4A 4X64Q 1GVPA 2K4KA 1G6ZA 1CQIB 3N6RA 2UXCQ 4I55F 5KFJA 2W8LA 2KCMA 4ECUA 2OXPA 3SHLA 5M3MG 2QDBA 4L5QA 3CRKC 3TREA 4LF8Q 1VAJA 4X3TA 5L1JA 4ED3A 3VR3A 2E5LQ 3KXYT 1TS2A 5ELNA 2J4XA 2VQFQ 1ET6A 4A3JB 5LMUH 4YWMA 1XNRQ 2OTLA 2BE5D 3A5UA 2FKLA 2BQ3A 1O75A 5C4JB 2PQEA 1E3PA 4U673 4HJAA 5EPLA 3F8TA 2B3GA 2MP1A 3J7A5 5L1KA 4IRCA 5C6AA 2V4RA 2GA4B 4KI0A 5JJKA 1I6HB 5E7NA 1PZJD 3GTPA 4JG2A 2SNMA 4XYMB 4Z9CB 3V6HA 1YITA 2M2LA 3TBIB 1QVGA 3RZDH 1TXYA 2YRWA 3KF8B 2EIFA 3PUYA 3OUZA 5IWAH 4JV1A 4WJ4A 2I87A 1TWFH 2BDOA 1A3TA 4A3IH 4R4CA 4HIOA 1LTLA 3OMCA 2NVTB 2VXWA 1W6JA 2JA7A 4ZAIA 2R8HA 3EIVA 3BA8A 2VQEH 4LFBH 4DV7L 1J6QA 4KHZA 4A75A 4FF1A 1ML0D 1WD0A 4QUCA 2JYOA 2WAQB 3OWEB 4X66Q 2JQOA 3IL8A 5FD6A 3DWAA 1EQQA 2HVRA 2PI2A 4NXNH 1PDQA 1SYEA 4RHSA 1HR0H 1XMOL 1YJWA 2R8JA 5AJ3L 3CF5A 4LF5L 3TS2A 1K83H 3L7ZC 3CVZA 3T4AC 4RNNA 2X69A 1TY2A 3DHQA 1TWGB 5FLXW 3RB3A 4O2DA 4IPCA 2IW3A 1Y1WG 4DV0H 2N88A 3WWVA 3CC4A 3PO3H 1GHKA 4I65A 1BCPF 3A8JE 1XDNA 4HR7B 3RB6A 4DAYA 2VUGA 1Q86C 4FYDA 1I3QH 2XSCA 1BF4A 1CZGA 3R93A 3CCEA 5IOCA 1C4QA 2FHTA 3QOLA 4RCOA 3C3LA 1XXGA 5EKKA 3F1ZA 2IMWP 1S5ED 5JPMC 1XYIA 1STHA 1ZEQX 1M4VA 2DPJA 2K5QA 2A5HA 2W9CB 4IFDH 1VQ6A 3G6VA 1B3QA 2AQ2B 2B29A 2JEFA 5IGFA 1YHAA 4YJ2F 5KFRA 4DV5L 5CC4A 3S15H 4OX9H 3ERQA 4K8JA 2JEGA 1PYWD 3BVGA 5G3LF 1S72A 3I70A 2B2YA 1A9XA 4H0LC 3NHHA 4HIKA 3RV4A 3NWSA 4GKKL 4GKJL 3PCOB 4C3HB 2IA6A 1A3UA 4F50A 1FD7D 5IYDH 4OIJA 3CC2A 2BE5C 4FXGC 4OXPA 4TRDA 3D6CA 3T1HQ 2JE6I 2KA7A 3EROA 2NB0A 1STYA 1BUVT 1HUNA 5HGQA 4DV6L 1HA6A 2C2DA 2UU9H 4AYBG 1VDZA 5D65A 5D3DA 5C4ZA 3DF7A 2R7ZH 4PWQA 1Z9FA 3GTMA 1LT5D 2AMCB 1V8QA 1E2VA 1PH5A 2NU6B 4U6PA 1EQRA 1AE2A 4FVMA 3RIZA 1BDOA 2E2IB 1B4OA 2JEIA 5KYIA 4KV6A 3T1YH 1O78A 2CQAA 3R3OA 4X3KA 3HOXG 1N8RC 1YNXA 2EXZA 4WD3A 1SFOA 4DR1Q 2F0DA 5C0XG 4YR2A 1U4RA 4KLKA 1X9NA 3I4MH 1ILPA 2RQXA 1AFPA 1PRTD 4JI8Q 4GS3A 4I7ZC 3DEPA 2Z6KC 3GTQA 5T1GA 1E2ZA 2KQ3A 4YY3H 3UDIA 4HYKA 1E4EB 4KHPL 1E2WA 4G57A 1V43A 4DR5L 3TRZA 4IR1A 4K5WA 1RJTA 1E1OA 5DG9A 2KVMA 3CMEA 2HQLA 3M7GA 1JLLB 3SE7A 2FMCA 3D0FA 3MR6A 4EYIB 2OT2A 1XNQQ 3KBXA 2XNAC 4F4YA 4ZLTF 4A3CG 1HNWL 4Q44A 4X65H 5KG6A 5IT9W 5IGCA 3J81i 4IUTA 3I12A 2Z6BA 2UUAH 5IP9G 4DFAA 1I4XA 2OCEA 1FYCA 1SRUA 3VA7A 1BBWA 1N34L 1VS0A 3S2HH 1GUTA 1MSHA 4BBSH 2VPSA 4Q43A 3OHAA 4C3IB 4R7RA 1UNNC 1C7YA 4XYLB 1KIXA 4DR4L 5A2QE 1GYFA 3KHRA 2CH4W 3PN1A 1F9PA 2V58A 1FJGH 3M3YH 4A3JG 5IY0A 2ATWA 4BXXG 2XIGA 2NUCA 5FJ8H 1KDAA 1JWMD 3MEHA 2LS01 4OGQC 1I94Q 1EWIA 3U50C 2R61A 2NYZD 5M5WH 2RBMA 1H95A 4O3NA 3GTGA 2C9OA 1YVCA 2UXCL 2R84A 3S1QH 3S1RB 1NMFA 4ECYA 3N8DA 3PR5B 1A15A 1GUSA 3ERSX 3VR4A 1IL2A 4ETSA 1KNAA 3H0GH 3W2DA 2VQFL 3I73A 1Z2NX 1Z2PX 5EAYA 1Y8OB 1GO3E 1XNRL 2KSWA 2O03A 4TV9F 1TWCB 2WACA 3A8KE 4IRDA 2K33A 2VW9A 1ESRA 1TWHB 1N9WA 4UCVA 2YTXA 2GVAA 3P1HA 1WVLA 2BA1A 2WAQG 1K0SA 3JAMW 1CM9A 1XTDA 3TN2A 3OTOQ 2ES2A 1EUCB 1I7NA 1STGA 2F0HA 4JI6H 2IX3A 2UXBQ 4UAIA 2YL2A 3GTJB 3GV3A 3PW7A 3FPUB 3R23A 1I4RA 5KFPA 3OPOA 3G48A 1WCMA 1KBLA 3OHBA 4R1JA 4HSVA 1S03G 3K8AA 2JA7H 4ED7A 3KUPA 1PH6A 1WTVA 1SYBA 3IFTA 2A74C 2CW0D 2CFMA 1IBKQ 3RGZA 3J81L 3ITPA 3NE5B 3V05A 4AYBA 3KLSA 1DGSA 4N9PA 1SMXA 4OO1G 2NU7B 4UHVA 5JVLA 2FLPA 3RTXA 4UY8C 1VQ9A 4DUYQ 2N8NA 2NN6G 3FKIB 2LMCB 1CE8A 5KNDA 2NTSA 3J7AK 2F3WA 1I4GA 4JI2Q 1E1TA 3I8ZA 4K0KL 3ONAB 5IYCG 1SNMA 4IURA 5LA6F 1DM0B 1EQTA 4N8X1 3I91A 3BDLA 3NQIA 1VQCA 4K2KA 2D62A 1M1KC 5EQ0A 5LMNQ 5FPOA 4EGJA 4ALPA 4C3HG 3FMAA 4XZ3B 4IUQA 2IWHA 4NPSA 4J1MA 4R9WA 2EXDA 2L11A 4JI0H 5GADC 5KG0A 1PFSA 3FVQA 3SDZA 4GNXA 1M90C 4X62Q 5DQGA 4B3TQ 3WDNA 4IUNA 3GTPB 2B2YC 1FNUA 3C1FA 3W1GA 1N32H 1VQFA 2K03A 4ULLA 3M9BA 1VQ8A 2JK8A 2XGTA 4RA8A 5DLQE 5M9OA 4IUUA 2IX0A 4LF7Q 4J9OA 4RUAA 2Z9HA 4R4OA 1PLFA 4F4ZA 1PRTB 3T1HL 1B50A 3OOCA 2DGYA 3PVXA 1U0LA 3K5IA 1D8LA 3K58A 3W5OA 3R5XA 2HHHL 2PW7A 3J7AF 3H3VH 1BCPB 4KY5A 4A3GB 2W57A 2Q2IA 4MHEA 4LF6H 2VB3X 2OH2A 1T9HA 4R4IA 3PW2A 1Q1BA 3JRWA 3ULJA 4DR3Q 5CMDA 2Q8TA 2NVXH 4CDFC 4PDBA 1D1KA 1SE2A 1ZYRC 2WE6A 1V1QA 2IJ0A 1Q3LA 4J15A 2YV5A 3STBD 3LX0A 1PHJA 3VDYA 2R86A 2QCPX 1G91A 1SE8A 3A54A 4XX0B 1U4LA 5C4XH 1NR2A 2W6OA 4KN7C 4FO2A 3FMCA 1T94A 3GIJA 4DAYB 2G5DA 3KF8A 3T56B 3P20A 5CA0F 1PZID 2MNAA 1IW7D 5M3MH 3N40P 2CW0C 4PMWA 4C1NI 4K0KH 2RVLA 4CDDC 3WOEA 1KJJA 2EJGC 2WDTA 5JH7F 3KBGA 1K8MA 4DXGA 4YAJB 3GILA 4C3IG 4CBVA 1IHZA 2XRSD 1XNQL 3MR2A 2AQ4A 1KDBA 5BMVF 2IHFA 3EN2A 4ECQA 4A3BB 2E2HH 1O7LA 2F1MA 3FP9A 3CXCA 4F87A 1SNOA 3E5SA 2ZTEA 2L15A 1DD2A 5KKNB 3RZOB 4RMFA 1TA8A 4DR6Q 1JJ2A 4LNQA 4I4TF 4U7CA 3N42B 3OSNA 4IPGA 4RHRA 1N33Q 2DZDA 5CB4F 1JOKA 3GP7A 3HKZB 3R5FA 5FPRA 2K5WA 1HH2P 3CCQA 3URYA 4DV1H 1I4QA 4HR7A 3F8NA 4RB2C 5E3FA 2B2VC 3BG3A 5T14A 3BYTB 2D0OA 2EOTA 3GTMB 1AH9A 1I94L 4NP5A 2HHHH 3KAJA 2AUJD 3HGBA 4AQYQ 5J2TF 5F9NA 2L9HA 1K3RA 1A63A 1KLUD 5GONF 3GIKA 3GIIA 3C1EA 3GTGH 2NVQH 2YCHA 1MJCA 3K5HA 4YHHH 2N55A 5FLXc 3VPBA 1R4QB 1Y1WH 2UUCL 4JYAL 2HT1A 2E2DC 3DXJC 5I9PA 4K2LA 2DJFC 1AN7A 3LGJA 3J7ZC 3GTQB 3W3AA 5CA1F 3HKSA 1AEXA 2AHOB 1J5EL 3RV3A 3QG1A 3HKZE 3S9WA 2A6HD 3EBEA 4LH6A 3I4NB 5DM73 2VQDA 4DLKA 5KFQA 1Y1VB 3E0EA 4H02A 2FJZA 2R3ZA 1V51A 1QZGA 3PUZA 3X3NA 3JC66 2EYJA 3R5HA 5EOYA 4JV2A 1XJVA 4PMCA 3OTOL 1Y69U 4YBZB 2WB1E 3TQ1A 5L1LA 4R8NA 1R9TH 4M1UB 2RDIA 3V6KA 2UXBL 4L63B 1I6VC 4K14A 4A4IA 4B3RQ 1ET9A 2A69D 5DAUA 3FKIG 1EHIA 2F0LA 2ZJPA 3GTLA 2QK4A 3RUPA 1IW7C 4DK1A 3KALA 1K9MC 2W6PA 1CQFA 5C5MA 4IFDJ 1F9SA 1O80A 4AH6A 2ASDA 5E1FA 1HZ9A 2JA5A 1PH7A 1O7IA 1IBKL 2LY7A 3CQZH 1WTPA 2D5DA 2MO1A 1EQVA 4ED2A 1RHPA 2UUBQ 2HCIA 2A73B 3VPCA 4KHVA 1L1OC 2CKZB 4C3JG 1SEIA 2K5DA 4MN3A 4DUYL 4DU9A 2EY1A 4F8MA 2C35B 1E4EA 1DIKA 2GN5A 4JI5L 3H4DA 2XC9A 1VQNA 4UPAA 4XIGS 1EY0A 1IBMQ 3TDQA 2MFIA 1CS0A 3Q2OA 3RD4A 1PH4A 1HNXL 3KHLA 3GD7A 4JI2L 1TR5A 3S24A 1VCIA 1SEBD 2F4VQ 4A3MH 1PTOC 3ND8A 3HOXH 1B33N 2ALZA 1DZ1A 2R8IA 1K8GA 4PZ8A 5C0XH 1YI2A 5BPHA 3G7LA 4FU0A 5LMNL 2L5TA 1ASYA 4JI1H 5ISRA 5JJIA 2HD3A 5GAGC 2CW7A 1PTOH 2ZM6H 2UUCH 1RDPD 3Q6SA 4C2MH 2AGOA 3E0JA 3QO2A 4ODGA 1GOZA 2XCLA 4B3TL 2Y0SE 4A3GG 1J5EH 2X6GA 3K80C 2UUAQ 1GSOA 4A3DB 1B70B 3F2BA 4V0BA 4O4LF 4LF7L 4A3KB 1MGSA 1TWAB 1VQGA 5KT3A 3HOWB 4A3CH 4QB4A 3HOUB 4R4TA 1IZ6A 4BBRG 4LUOA 1MHWC 1LYLA 5IT9c 1GUNA 5IP9H 4DV2H 1UE6A 3TP7A 1WCMB 2Q8IB 3Q22A 2CWPA 4FBUA 2UVWA 5I6WA 2A6HC 4RB3C 4LF4Q 2JJQA 3MWYW 3TINA 5EWFA 2RCNA 3LNNA 5FD5A 2MGSA 1ASZA 4DR3L 3D4RA 2H4OA 1WTWA 1NCVA 1TWCA 3SE0A 4DNIA 4PMBA 4KY7A 3NQTA 4TSSA 1Z47A 4A3JH 5JUMA 1PH2A 2PMZE 2A69C 3KF6A 5C4HA 4BXXH 3MXUA 1IOWA 2RGVA 3JRXA 1EUJA 5DGAA 2CVRA 2PZUA 3E3XA 5C4JH 3Q24A 4A3BG 3GV7B 3OWFA 5C5LA 2EVBA 1QVCA 2FB9A 2VL6A 2O2LD 2R7DA 1RK5A 2K5VA 1HNXH 1I6HH 2VA3A 2H5XA 4KJOA 1X54A 1BJTA 2ASJA 4Y7NH 1VQJA 2ASLA 1EY5A 3GTJA 1Y8PB 3HKZG 5I2YA 4DR7L 1QOHA 3RR5A 2UVRA 2K32A 4IPDA 2F0EA 3A74A 3J7AV 2Z4IA 4IJHA 2UXDL 3V96A 2UVVA 3K7AB 3A0JA 2RSNA 3SVMA 1PVOA 2EY6A 1WFQA 1EEID 4GNXB 1EY4A 2YTVA 2B63B 1HQRD 1UE7A 3EPIA 5L9XA 4QCLA 1KTKA 1PFMA 2ZTDA 3JAMc 1HXYD 1WTXA 1OXVA 1N33L 4C5AA 4RZRA 3CKIB 3FKIA 1II3A 1A8VA 1D7QA 1JXLA 1CZWA 4ECZA 1TWGH 4EEQA 5IP7G 4A93G 2PVPA 4UCOA 5A2QL 1W6KA 1OXUA 1MIUA 4OHJA 4H13C 4LF9H 2R8GA 3S17B 3ETHA 5K36G 4ECSA 2SEBD 3VR6A 3PIO3 4RU9A 4LK1C 3TSSA 1B9MA 2QKIC 2UU9Q 4AQYL 3EYYA 3BABA 2K5NA 3I4NG 4Q0YA 4OO1H 1A6XA 2OWOA 3Q1KA 3GDEA 1F9RA 2YU9B 2OTJA 3K5LA 2NN6H 1DV1A 5DG8A 1Z2OX 3AFPA 2JA6A 2F0MA 2J6SA 3A5ZB 3VYSA 2WV6D 4YIJA 3NBHB 1DONA 1UC9A 3JSLA 3KJPA 5ELDA 3FPPA 4JI3Q 4IALA 5IYCH 4O3RA 2PQAA 4A3EB 3K5MA 4GZYC 2AWNA 2HVSA 4TVAB 3U9SA 5DM63 4LFAH 5M5YH 2M05A 2I5HA 3LMLA 4C3HH 2JA8B 2V5AA 4HNUA 4ZK9B 1SN8A 4MTNA 2YYZA 5KNBA 4LFCQ 2AWOA 3L2PA 1MD2D 2EPBA 3DMUA 4B3MH 1CI3M 4B3RL 2WTFA 4RGNA 5EJWA 1G291 4LSXA 1S5DD 5JJZA 3WNZA 1FGUA 1MZBA 4DUZH 1S40A 3MWDA 2NVYB 2ZDGA 2PO4A 5EPKA 3PF5A 1LV9A 1C48A 1MJEA 2W70A 4B3SH 1AW7A 4DV4L 2E2IH 2CZGA 1PFNA 3HOYH 2K04A 2I80A 3QZ8A 1S5CD 1VQHA 3EQLC 1YNJD 5CV7A 3I2ZA 3PW0A 1IBLH 2UUBL 4NXMQ 1Q12A 3M4IA 1DXMA 2R8KA 4J9RA 2DPIA 3MXPA 1XTCD 1LTRD 1I5FA 3IKJA 1RK6A 2NZOA 3OW2A 2F0OA 1D2BA 4LUVA 2IT1A 1LUZA 4POGA 3ZYYX 4J8QA 4LMQD 4OWWB 1OXXK 1IBML 4DR2Q 3GTOH 1QILA 3RBEA 3DUZA 2F4VL 4MV6A 2W6QA 4BY7B 1VQLA 2K75A 2HGSA 4YWLA 4A3DG 5KX5F 2EJMA 3TP6A 5KG2A 2A8VA 5CV6A 1HNZQ 3NUCA 3TEHB 3HOWG 1O7ZA 1EUDB 5DQIA 3HOUG 1QNKA 1S0MA 4ED1A 3GIMA 1BXTA 1U9RA 3L0OA 5JAVA 2K28A 3HKZA 1ENCA 4HNVA 1WCMG 3KTMA 4I50F 3MR3A 2R92A 2I8CA 3Q8PB 1E22A 3PIOA 2R85A 3CCLA 2V4QA 3BDOA 4MV7A 3G6XA 3CCJA 4YCWA 3I56A 4C3IH 3RZDB 2WB1A 2X0SA 2RDGA 2D9UA 1IYVA 4O4IF 3KJOA 1K28A 4DV7H 1EFID 2ALYB 4BA1I 5JOBA 3U9TA 4G7HC 4EQNA 4JW0A 3I90A 5BR8L 5CBAE 3GTLB 3AYHB 3NTHA 4MV9A 4TQRA 3RNUA 2L1BA 4UCTA 4ILWA 1VBHA 1GKHA 1ICFB 4J6HA 2DIKA 1XMOH 4LF5H 4LF4L 1DYQA 3HOVB 1NTGA 5EBCA 5KFWA 2JA5B 3S1RH 2EE1A 5A35A 3M4PA 2RA4A 4IRKA 2CWAA 1U4PA 1KEEA 2ZJQA 3O13A 1ZXTA 5KFLA 4DV4H 2WKCA 1WR2A 3K3PA 3BZDB 2FK1A 3NSWA 2HQEA 1BCPD 4F4WA 2ENBA 1SROA 2VZAA 3JZIA 4O3SA 1BVSA 3H4BA 2HCCA 4ECXA 3PO3B 1Y1VA 1TWHH 1ZQ7A 3ETJA 1JQYD 2WKDA 4LAAA 2QW7A 4O2AF 1B1ZA 1JKJB 1PYBA 3J80i 2TSSA 2GPSA 3VYTA 3N43B 4H7BA 3M7NA 2LXKA 1I7LA 1UEBA 2VR1A 4DL2A 1YNJC 2A6ED 3I4OA 3MFYA 3GTKA 4J9QA 4L6TB 4JI7Q 3NEMA 3KAKA 4ZUIA 5I2XA 2F0QA 2Q8RE 4DV5H 1UAPA 2BH2A 1BQQT 4CGYB 4O3OA 2PCFB 3M85A 1LTAD 4FBTA 1FNVA 5G3LD 4RKBA 4MV3A 2MO0A 2FK3A 4GKKH 1SYCA 1VQBA 2OQKA 3G71A 4JI4L 2EZVA 5ELBA 4V190 2Y0SA 3GIPA 4GKJH 3PMFA 3CP0A 3G6JB 1TS4A 5EWEA 2D0PA 4FF3A 2Z8LA 4ED0A 3K6OA 3D3RA 1BR9A 2HUGA 3AB9A 2N78A 4LW1A 4R8UB 1EZ1A 4DV6H 2Z1CA 4X64L 2C00A 1HPCA 3FRPB 2G9DA 1M6VA 3A8IE 3S16B 3V4ZA 3J81W 4J0MA 2E8GA 3FKIH 1D1IA 2PPBC 3S1MB 4YR0A 4MZ9A 2JEAI 1KAWA 2QEJC 3H09A 5CV9A 1YHQA 1CKNA 3MXGA 3BZKA 5BN5A 2PZTA 4LF8L 4G7OC 1D5ZC 2DWCA 2L4NA 2R93A 2E5LL 3S2DB 1KC7A 1D5MC 3I72A 3QIAA 4A3EG 5HURA 1RTOA 1NY4A 2UVUA 1JJGA 3C46A 3IRBA 4TV8F 2NWGA 1SJHD 1A62A 5TSSA 4IZOA 4PV1C 2XGPA 3KHHA 4NLGA 4C3JH 1M0TA 2BCOA 2RDJA 2YRXA 2L0CA 2JA8G 3KF6B 2PMZA 1GUOA 2RSOA 2F0WA 4QMGA 3RN5A 4N9TA 4KHPH 1RD9D 2RF4A 3UE0A 2ZJTA 3U4VA 4DR5H 3TP8A 3P7JA 3G6YA 4JI3L 2A68D 2KCCA 2F0NA 3GTPH 1V1PB 1TWAA 1PRTC 2DNEA 1AZPA 1N36Q 5C3WA 5C44B 2W7OA 1DJRD 2HIXA 1HNWH 4NKLA 1HCZA 3AFQA 1H9KA 2RDFA 4DNTB 4XXEA 2JEJA 1BCPC 3J80L 1P8LA 4LFCL 1G2SA 4RFBA 2FPGB 4GOPA 4X66L 1HZAA 1XMQQ 2P0AA 1I6UA 2J0TD 4C56C 5C0XJ 1N34H 4UCUA 3BZCA 2R7LA 4A3GH 4A3FB 1TU2B 4IPHA 3U4ZA 2MUYA 4DR4H 3HXLA 1IL8A 2A6EC 4RH6A 3BYYB 5KFEA 3CRLC 4BY7G 3L4KA 1S4ZA 4XQNA 4HMJA 1JOOA 2YS7A 1NNXA 1QCBD 3VPDA 4BBRH 3G6EA 4NXML 4EBEA 5GAHC 1X3GA 2QILA 3FDSA 5L37A 3K5NA 1G51A 3SK8A 1SLJA 2UXCH 4ZCKA 3IG0A 3MWEA 1Z6HA 2L55A 2MJ8A 3E5NA 3T5JA 4DA2A 4DR2L 2E5LH 3H20A 1X3FA 4K6DA 4IHJF 2VQFH 3MJFA 3CW2C 4BWSC 1HHVA 2YZNA 4DV3Q 1XNRH 4DAPA 4OWTB 4JC0A 2R6FA 1GHJA 1OXSC 4G7ZC 4IOCA 2JA6B 1C8CA 2B63A 1X32A 3H0GB 2OF1A 1HNZL 4QWAA 4CJ2C 5KFAA 3HS0C 4J9SA 4A3BH 1ZHQA 5ELFA 5E4WC 2ASBA 1SNQA 3K3VA 2FPPB 2HVQA 1ULZA 3MA2B 1TS3A 1DCZA 2PQAB 3CCVA 5KFNA 3RZOH 4JV5Q 5JEAG 1VQKA 1KJQA 3MC0B 1PX2A 4FNFA 4M9UA 4L8JA 3HOVG 1TVXA 2JA5G 1EYZA 1TIID 1U5KA 4DF7A 5JQWA 4HJ7A 4FDBA 1IYUA 5FLXE 3ULPA 1PYSB 3IAYA 2I5LX 1PTOF 3S1NB 1RJRA 4QIWE 3TZUA 1AUXA 4X66H 1LT6D 3PO2B 2V59A 3GTMH 2XWBB 2A68C 1DOKA 2BA0A 4IJLA 4YCUA 5EZYF 1VMPA 2YU9A 1K0RA 2PW5A 4B08A 4ZYSA 2PBZA 2LFNA 4YQWA 4ECTA 1EZ8A 4CDCC 4DR1L 1B9NA 1T5EA 1UE5A 1SBBB 4P73A 2N3SA 4JI8L 4PZ6A 1SFOH 3NBHA 4BWGB 5IP7H 4A93H 3G4SA 5LMUQ 1F77A 4GLXA 3T13A 2ZXRA 1FGBD 5FLMG 1ZETA 2B2UA 4LJZC 5K36H 1HJPA 3GTQH 4EYHB 2A19A 2KEEA 3NELA 3CHBD 1X6OA 2MPMA 4GN5A 3CCRA 2Q2UA 3NWTA 4RG1A 3I4NH 4POFA 5IWAQ 4QJFA 4K8IA 1PH1A 1N56A 2BR0A 4JPBW 1HFNA 1I50B 1LT4D 1QE6A 3KLRA 4QF4A 1E4GT 4JUZA 3KK7A 3M4QA 5ELEA 4JI7L 1GM5A 1PMRA 2F0SA 5CV4A 1A2TA 2W6ZA 2PYKA 2NVYA 5IYDG 4WORA 2VQEQ 1BBXC 4LFBQ 1B2TA 1BNCA 1YJNA 3MVVA 5L1IA 1KABA 4XYQA 2R92B 4HNTA 2PNRC 4NXNQ 4PQXA 4R4QA 1HR0Q 3HP3A 1G8ZD 5LL6S 2WB1B 4JV0A 2XCPA 1CHQD 1XWEA 3H91A 3T1HH 2DJGC 1RYSA 2VUMA 4ID6A 2SNSA 1MSGA 1X3QA 4E4TA 4PNYA 4DV0Q 3DM3A 4I7AA 5KT5A 3G8CA 4NMZA 3UDGA 1K1SA 1F2ZA 5KEEA 3HEJA 4K5XA 3VA5A 4MNOA 2KUMA 3MFHA 2CQYA 2H1EA 4O0AA 4HQ6A 3WOFA 1MKHA 2BH8A 3CPFA 4ZHQF 4DR1H 3V6JA 3PSIA 3BQ1A 5K5PA 1EY9A 4OEMB 5C44G 3HOZB 2K05A 2QA4A 1CA5A 4JI8H 3BVMA 4RB1A 1FKAH 4GN4B 3M9OB 1BNZA 4RGMA 3CPWA 4X3UA 3MFGA 5JEAJ 4DGZA 2K5HA 3S14B 2G9HD 5JPNC 2VNUD 5LMNW 2B39A 5IT9E 2W71A 1NSNS 4OX9Q 3STBC 4FXKC 5I47A 4KMUC 1EY7A 2YTYA 4A3FG 5LL6b 4ED8A 5CV8A 2Z4HA 3RGXA 2DY7A 3L3OC 5M3MB 3AMUA 4L5RC 1TWFA 2R6GA 5C1PA 1XNQH 4A3DH 1N36L 4H44C 2IPKD 1B44D 5ELCA 3GTKB 2GLTA 5HV6A 1PH9A 1HRJA 2F0VA 1TWAH 3BJYA 1RJQA 3HOWH 1TAEA 3VYUA 1GLVA 4HEDA 4GOPC 3HOUH 2F3IA 4ABNA 1ONLA 2I46A 4XT1B 1XMQL 1K3BC 3E9IA 4HJ5A 4HCSA 1WCMH 4IQZA 2EYOA 2Y0SB 4BY1B 1JE4A 3H94A 3Q8SB 1EYCA 1S9FA 1RCVD 3ER0A 3ZJYC 4A3LG 1K83A 5KRUA 4DK3C 4Q45A 2N49A 3T1YQ 1VQAA 1K73C 3BQ0A 2ICEC 2IP4A 3CU7A 3OHXC 1VQ7A 3TZDA 3RLFA 5C3EB 2YZMA 4RNMA 5C3XA 4ZQ3A 2ID0A 1I94H 2JA6G 1XX8A 1I3QA 1H9SA 1CKNB 2VB2X 1UNSA 4DL7A 4IUPA 5LYJF 1PH3A 2R93B 4YY3Q 3HG9A 3FHWA 2CCZA 4MV1A 5LXTF 3RAQA 1NAPA 4RAZA 4P71A 4XYOA 1OXTA 5EPJA 1STEA 1MI2A 1YZ6A 4JYAH 2RHSB 3JAME 4NW2A 4GNXC 4EG0A 1A2UA 4EFBA 1HA5A 2AKWB 1JICA 2PMZB 4X62L 4MTEA 4X65Q 3BQ2A 1XPRA 1SAPA 1KDCA 3W1BA 2KOLA 1RF2D 4JK1C 3PO2G 1X65A 4R8UA 5K2MA 3WO0A 3OTOH 5M3FB 2E2JB 2CHBD 3H15A 1OTCA 1JMCA 3I55A 4IZ8A 1LABA 3BDCA 4JBMA 2UXBH 4CHTB 1HZBA 4HJ9A 4JBWA 4LH7A 4GKJQ 4KKTA 1RTNA 5FO7B 4DK0A 1FJGQ 1IOVA 4GLVB 2R7ZA 1I4HA 4GOPB 4ZRZA 2EYPA 4MA0A 4QW8A 3S17H 1O7YA 1RODA 2K14A 1PFBA 5IGEA 3VR5A 3RLNA 1IBKH 2F0JA 5A2QW 2PN1A 1I4PA 5KFSA 3LP8A 4WBNF 3TQYA 4TUYF 3E9HA 4F88A 3Q23A 1QJOA 4K6LA 2NU8B 5KFMA 3N6XA 4ZQIA 1L0WA 4DUYH 4YB8B 1YNND 3LWEA 4EX5A 1NBWA 5FK9C 1VBGA 4JI5H 2M00A 3CCUA 4HJ8A 5LL6X 5LMUL 1CT1D 2B2UC 3J81c 1QNUA 2YW2A 4ECWA 1VQOA 4JI2H 1V1PA 2JN4A 4TQSA 1SMYD 1STAA 4QWEA 5GQOA 3RB0A 2F0GA 3U9OA 2OLSA 1H9RA 2Z6KA 1X56A 1K8OA 4KN4C 4A3EH 2R92G 5BPFA 1LTGD 2KENA 3PUWA 5IODA 3HB9A 5LMNH 4DN4M 1V9PA 5KG4A 1KD1C 5IWAL 3F2DA 2NVTH 4A3MB 2P5ZX 4O42A 4JI6Q 2WB1G 1EWCA 3RB4A 2JA8H 3PW5A 4P2CB 1EY6A 2XVSA 4ECRA 2QDLA 1ENAA 1LTID 5KT7A 4DR6L 4Y52H 4HCEA 3KYHC 4N8FA 2CW8A 1EIFA 2KBNA 4B3TH 1WD1A 3J7YW 1LTBD 3K81C 2VQEL 4LFBL 3IN5A 5HY6A 4C2MB 1KLGD 1CSPA 2DNCA 3K7UC 2PNHA 4LF7H 2R7FA 1H9JA 3RUZA 1SCUB 3I7FA 1HR0L 1KNEA 1X3EA 1JDBB 5FOBB 5LOVF 1PH8A 3OSPA 5IYBG 4AYBE 3HOZG 4TKOB 2E75C 1KHIA 5M5XB 4DV0L 5CAEB 4MTKA 1ZKOA 4QIWA 2B8GA 5IYZF 4FXDA 1F2LA 4ZI7F 4Q8FA 3BU2A 1QB5D 2EDGA 5LP6F 1Y1VG 4IAJA 5C1OA 1EYAA 1QG7A 1V1OA 2B8FA 4EVOA 1JR0D 4DR3H 3EVQA 4CJ0B 2IY5B 4BY7H 1JE5A 3H0GA 3PUVA 2IX1A 3M9NB 1SNPA 1MBYA 4CJ1B 1JDEA 4XDXA 2LSSA 4YJ3F 1Y8NB 5T1IA 1LO5D 4WFN3 4JI0Q 1GUWA 2HJWA 4IFDI 1YJ9A 1S5BD 4HSPA 5IGGA 4Y8VB 5F9LA 3M4OB 2OEOA 3CD6A 2K7VA 4OONA 2WIIB 1B7YB 1LM0A 4DL4A 2FLLA 3SK6A 3T5HA 2SDFA 4OX9L 1N32Q 1BXRA 2Y0SG 4UCSA 4BY1G 5KG3A 5KFCA 1EWHA 5KT6A 4DR7H 1EYDA 5KT4A 2YZGA 5KFXA 4ME5A 2UXDH 2NZ1D 3C2PA 1YNNC 2F0UA 1SE3A 4M8AA 5KFUA 3ICEA 4Y7NB 2HDMA 4ZKCB 1UUPA 4IOAA 3HZXA 4APMA 4HIMA 4S3SA 5C3EG 1SMYC 2W8KA 1HZCA 3KOJA 3GTLH 4DR6H 4HMIA 2WFWA 5JEAH 3SXHA 1KJ8A 1XPUA 1Q46A 1D5XC 2R93G 1N33H 4LF6Q 1B6SA 1SDFA 2GVBA 3HOVH 2YS6A 2JA5H 3SI8A 2AU0A 2VUMB 4ZUJA 3T1YL 4I7HA 3KHGA 2RKSA 4B9WA 3OUUA 1PRTF 1EU3A 1Q90A 4EQPA 4GLAC 2YYAA 2B2TA 4QQBX 4CC6A 1DV2A 1BOSA 1YIJA 5IGBA 4EBCA 2BDNA 4AQYH 4Q0FA 3BJUA 4QGUA 2F4IA 4YY3L 5F2DA 1S0OA 1SNDA 1GGOA 3GQBA 4YAKB 1I50A 3TMEA 4K0KQ 4A3KG 3D4DA 2F0FA 5M3FG 5D8DA 4EGQA 1JX4A 1GUGA 4JBJA 1B3AA 3MTSA 5CORA 2V1CC 1OO9B 3MEFA 5CGKA 2FLNA 5FLMH 2F0IA 4WJ3M 2JXMB 4X65L 2PZWA 1SYGA 2W9BB 1BKBA 2Z0SA 3PF4A 5KFKA 1SNCA 2KEDA 2WAQE 5D1PA 4O3PA 4F7XA 5NUCA 2UUAL 3R2IA 2EJFC 5J2UF 4DL6A 3AQQA 3UDFA 4OIKA 1TWFB 3A55A 1K8AC 2JEBI 4A3IB 5JVDF 3RMHA 1S68A 4OWXB 5M5YB 1Q1EA 4DV1Q 4B3RH 2EYFA 4BS9A 3D4WA 4RGTA 1TY0A 3Q8RB 3OSOA 1FJGL 3S16H 1F9QA 2RDHA 1NE3A 1IYJB 3CMAA 2CH4A 1PA6A 3S1MH 2J9GA 3CCSA 1PZKD 2KECA 5FLXL 1U4MA 4U68A 2FXQA 2L12A 1Q81C 2HHHQ 3BG5A 1K83B 2F3VA 3S2DH 2NVXA 1LTTD 1STNA 2E74C 2C5CA 1KJIA 3V4SA 4J9KA 3NTKA 2UUBH 1AP0A 3LWUA 1SXTA 3HOYB 2D2CC 1TWCH 5EKIA 3VMMA 4FF4A 2RCFA 5KFHA 4YHHQ 4A3MG 4XQQA 5KFBA 2ZT9C 2FMAA 4UDUC 5HGTA 1M8AA 2VY3A 3HRZC 4RWSC 1EYGA 2B63G 5KFGA 1I3QB 1H9SB 1IBMH 4RGOS 5CYUA 4KY6A 5DGBA 1E7ZA 2IHEA 5DQHA 4EBDA 4O1NA 4P74A 1SSOA 4FF2A 2F4VH 4RAYA 3MXNA 2Q2TA 2LXJA 1B04A 1C0AA 2QYZA 5KYLA 3RJ0A 3I4LA 4L5SA 5D1OA 3GTOB 4UP7A 2W7PA 5C44H 3GTJH 3QOJA 4GN3B 3Q0AA 1WTHA 1VF5C 5KFDA 3F2UA 5D3IB 2A1AA 2F52A 2E2HA 5KFTA 4JI6L 4IR9A 1RYRA 3T5KA 1NR4A 4C5BA 3UI2A 3UFXB 1EIYB 1B53A 2WP8J 3S15B 5J22A 3JSNA 1AE3A 1ICWA 4IWYA 3GV5B 5FO8B 4ZOLF 3T16A 2MCTA 3J80W 3QB3A 3RAXA 3TIGA 1S10A 2RGRA 4QUFA 4K5VA 4A3FH 4DK6C 4DPGA 1Z7TA 2JSOA 3NK9A 1W2BA 2HDLA 3Q8DA 1Q7YC 4P72A 3CCMA 1VQDA 4E6IA 5BR8H 2Q2HA 1RJPA 5KFVA 3QR8A 2R7ZB 2FPIB 4KK7A 1C30A 2J6TA 4L5TA 4KKSA 1Q8KA 1ENFA 4LF4H 2UU9L 1VQEA 4WJWA 5I6YA 2FK2A 3TIIA 4YWKA 4YP3A 2B2VA 3ORQA 4C1NK 1CUKA 3EFXD 4A3LH 2ATLA 3OIPA 2EYMA 3JAMi 2EY2A 1CA6A 3C0FB 3I4MB 1Y1WA 1EEFD 5J3BA 5CV5A 5GROA 4JI1Q 2JA6H 1VKZA 2ZM6Q 2UUCQ 1WTQA 5LHY1 4JI0L 4JYAQ 4J9MA 3TS0A 1BGWA 2K1BA 1S3OA 4DAMA 3PZPA 1UEAB 1WSCA 1J5EQ 3RF2A 2O5JC 2HIVA 5IT9L 5JVH3 1N32L 1WH2A 2TMPA 1ZHSA 3GQCA 2XRQD 1WTRA 1DOMA 1UC8A 4J9PA 1R9TA 2QGQA 4CC5A 4LSAA 2VUMG 3RBDA 1W3SA 3SR1A 4JCVE 2GPWA 1ZYRD 3R2TA 1L0YB 3GV6A 3NBIA 2K52A 4JI4H 4J9LA 3DEOA 3S1NH 4DV2Q 5DLFA 2F0PA 4FP5D 5EBDA 1GD7A 4DXFA 3PO2H 1QUQB 3H3VI 3MZ5A 3S2HB 2AUKA 2KCNA 4BBSB 4ED6A 1X55A 3KLSX 2SCUB 3CQZA 4LF6L 1D6EC 1M7JA 4MA5A 4X64H 3ULLA 3K57A 4PG3A 4LMYA 3M3YB 2K6AA 1EFWA 4P75A 4ME6A 2MHVA 3D6WA 1GSHA 1TKWB 2NZHA 1CKMA 2B2TC 5H1SE 1YEZA 4LF8H 4QIWB 4QY7A 2XWJB 5M5WB 1L1OA 2AGQA 2W9AA 4IUVA 3S1QB 4EFEA 4JI5Q 4JOIA 2K50A 3GV8B
chains in the Genus database with same CATH topology
2YTYA 4A3FG 1HNXQ 2ZTDA 3JAMc 4TQUS 1OXVA 1PV4A 1YBYA 4L5RC 2R6GA 3HOXG 3UDXA 1N8RC 1N33L 4A3DH 1YNXA 1N36L 1D7QA 1A8VA 2CQOA 5C0XG 4DR1Q 3U58A 1PH9A 4KLKA 1X9NA 4A3IG 3I4MH 1TWGH 1TWAH 5IP7G 1I50H 4A93G 3HOWH 3PV0A 4JI8Q 2KCTA 1OXUA 4GS3A 4GOPC 3HOUH 2F3IA 1MIUA 2Z6KC 3I4NH 1XMQL 3E9IA 5K36G 2OQ0A 4HJ5A 1B8AA 3UDIA 1WCMH 4KHPL 1A0IA 1V43A 4DR5L 3TRZA 2UU9Q 1WI5A 3ER0A 3ZJYC 4AQYL 2R92H 1E1OA 4A3LG 2K5NA 4DK3C 3CMEA 2HQLA 3I4NG 4LUZA 3D0FA 2N49A 3T1YQ 2OWOA 3GDEA 1VQAA 1K73C 1XNQQ 2OTJA 1KRSA 1VQ7A 4A3CG 3AFPA 3RLFA 3HOYG 4DV1L 1HNWL 3KDFA 3PO3G 2ID0A 3A5ZB 2KHJA 3J81i 2JA6G 3NBHB 3GO5A 1P16A 1VQMA 5IP9G 4LF9Q 1CKNB 3KJPA 1IXRA 2OCEA 1PH3A 4YY3Q 1NJIC 3FHWA 5IYCH 2CCZA 1SRUA 4JI3Q 2PQAA 1BBWA 1N34L 1VS0A 4X6AH 3S2HH 4BBSH 2AWNA 4UP9A 4TVAB 4P71A 4YCVA 1Y14B 5M5YH 2EQSA 1C7YA 2DUDA 1KIXA 2I5HA 1OXTA 4DR4L 1YZ6A 1JJCB 1C9OA 2RHSB 4UP8A 4C3HH 5IYBH 4GNXC 1SN8A 4MTNA 2YYZA 4LFCQ 3M3YH 2AKWB 2AWOA 3L2PA 3HOZH 4A3JG 5IY0A 4YHHL 4X62L 2ATWA 4BXXG 4IFDG 4X65Q 4AIMA 1XPRA 5FJ8H 4B3RL 3W1BA 1I94Q 1EWIA 3U50C 1G291 1H95A 1FGUA 5M5WH 1Y1VH 3S14H 1S40A 1YVCA 2ZJRA 3PO2G 3S1QH 2UXCL 1NMFA 1X65A 3PF5A 1MJEA 3ERSX 4DV4L 2E2IH 3H15A 3HOYH 1OTCA 1NMGA 4HIDA 3I55A 1JMCA 1IL2A 1VQHA 4LFAQ 4JBMA 1HZBA 1UE1A 4HJ9A 3H0GH 3I2ZA 3GTKH 4JBWA 4ME3A 2UUBL 2VQFL 4GKJQ 4NXMQ 1Q12A 5EAYA 1FJGQ 1XNRL 1GO3E 4GLVB 4DR7Q 4QL5A 4GOPB 1I5FA 2VW9A 2NZOA 3OW2A 2UXDQ 2R7ZG 4LUVA 1N9WA 1LUZA 2IT1A 4B3MQ 4POGA 3S17H 2YTXA 4OWWB 1OXXK 2K14A 2GVAA 1IBML 4DUZQ 3RLNA 2BA1A 2PI2E 4DR2Q 2WAQG 3GTOH 4BY1H 2F4VL 1XTDA 3TQYA 3OTOQ 3K0XA 1VQLA 3E9HA 2ES2A 4B3SQ 2K75A 4YWLA 1VQ4A 4A3DG 1L0WA 3PIPA 2UXBQ 4EX5A 3B6YA 3I4MG 1IBLQ 1NBWA 1HNZQ 2A8VA 3CCUA 3TEHB 4HJ8A 3HOWG 3AEVA 5LMUL 5C3EH 3HOUG 3J81c 1VQ5A 1VQOA 3G48A 3L0OA 4R1JA 1JT8A 1RIPA 5GQOA 1WCMG 1UWVA 2JA9A 3K8AA 2JA7H 2R93H 2I5MX 2Z6KA 1E22A 1X56A 3PUXA 3PIOA 4A3EH 2CFMA 1PH6A 1IBKQ 2R92G 2KENA 3PUWA 1DGSA 3CCLA 1SMXA 1V9PA 4OO1G 1KD1C 5IWAL 3F2DA 4YCWA 3I56A 4C3IH 3CCJA 2NVTH 3KLWA 1KXLA 4UY8C 1WOCA 4JI6Q 1VQ9A 2WB1G 4DUYQ 5C0XI 3KJOA 2N8NA 2NN6G 2JA8H 4IO9A 2I0QA 2ALYB 4BA1I 4EQ5A 4DR6L 5BR8L 4Y52H 4JI1L 3KYHC 3AYHB 1EIFA 2KBNA 3RNUA 2ZM6L 3K81C 4JI2Q 2VQEL 4LFBL 1E1TA 5HY6A 1GKHA 4K0KL 5IYCG 4LF4L 3MXNB 1CSPA 1NTGA 5ELOA 3K7UC 5JJLA 2PNHA 2XTIA 3S1RH 4A3KH 3M4PA 4BBSG 2R7FA 5M3FH 2E2JH 2CWAA 3I7FA 1VQCA 1HR0L 2D62A 2ZJQA 4DKAC 1Q7YC 5LMNQ 3UE1A 1M1KC 1X3EA 4ALPA 1Q82C 4NPSA 1PH8A 5IYBG 2MQHA 4AYBE 2EXDA 3PGZA 3HOZG 5GADC 1SROA 2VZAA 4DV7Q 1BVSA 1KHIA 1PFSA 4DV0L 3D31A 5FJ8G 2KHIA 4GNXA 1M90C 1FL0A 4X62Q 1TWHH 3BU2A 4B3TQ 1Y1VG 3J81j 4DV2L 1PYBA 3W1GA 3J80i 1XMOQ 1VQFA 5AJ3Q 4LF5Q 3M9BA 1VQ8A 2JK8A 2XGTA 5DLQE 2LXKA 3M7NA 1UEBA 2IX0A 4LF7Q 2IY5B 4BY7H 1JE5A 3I4OA 4DV4Q 3PUVA 4R4OA 3H0GG 4JI7Q 2IX1A 3NEMA 3T1HL 2LSSA 2DGYA 1VQPA 4JI0Q 1U0LA 1QZHA 1D8LA 4IFDI 3W5OA 1YJ9A 2BH2A 2HHHL 3M85A 3H3VH 4BA2I 1KQSA 2Q2IA 4JOIC 2MO0A 4OONA 3CD6A 1VQBA 1B7YB 1LM0A 1FVIA 2OQKA 3G71A 4JI4L 3DLLA 1T9HA 3CP0A 4R4IA 4OX9L 1N32Q 1Q1BA 1BBUA 2Y0SG 4BY1G 3ULJA 2D0PA 4DV3L 4DR3Q 2NVXH 1XPOA 1V1QA 2N78A 4J15A 2YV5A 4LW1A 3STBD 3CC7A 3K7AH 3VDYA 1PHJA 3ICEA 4X64L 1RL2A 1SE8A 5IE8A 5C4XH 4LWCA 4IOAA 1E24A 2E8GA 1CKOA 3FKIH 4JOIA 4HIMA 2B63H 5C3EG 4DAYB 4MZ9A 4DV5Q 1HZCA 1KAWA 2JEAI 4JV5L 3KOJA 1YHQA 1CKNA 3GTLH 3BZKA 4LF8L 2MNAA 2ZTCA 2WFWA 5M3MH 2E5LL 4XTCS 4GKKQ 1XPUA 1Q46A 2JA7G 4PMWA 2R93G 4LF6Q 4PZ7A 1WJJA 2GVBA 3HOVH 4A3EG 1NY4A 1JJGA 2JA5H 1QVFA 4NB3A 3IRBA 1A62A 3T1YL 4C3JH 1XNQL 4DV6Q 2JA8G 2IHFA 3EN2A 3KF6B 3RN5A 2E2HH 1HR0W 4GLAC 4A76A 4QQBX 3FP9A 3CXCA 2RF4A 1L2FA 3UE0A 5M5XH 2ZTEA 3U4VA 2L15A 1YIJA 4LF9L 4RMFA 2QEXA 4DR6Q 5BR8Q 3BJUA 4QGUA 1JJ2A 4LNQA 4YY3L 4JI3L 3J80c 4IPGA 3GTPH 1VQIA 1N33Q 2YU9H 3NENA 4K0KQ 4A3KG 1N36Q 1WYDA 1HH2P 3CCQA 2HIXA 5M3FG 3AFQA 4OO1I 4JBJA 3HFZB 2V1CC 1P8LA 3MEFA 4LFCL 3CAMA 5FLMH 2NN6I 4GOPA 2D0OA 1HZAA 3SGIA 4X66L 1XMQQ 4WJ3M 4X65L 1L1OB 5C0XJ 1AH9A 4KHPQ 1I94L 1BKBA 2Z0SA 3PF4A 2WAQE 3BZCA 4DR5Q 1KL9A 4A3GH 1CSQA 2UUAL 3M4OH 4IPHA 4AQYQ 3U4ZA 1K3RA 1A63A 3AQQA 1EOVA 3UDFA 5GAEC 1YHBA 3OYYA 1K8AC 2JEBI 3GTGH 2NVQH 4BY7G 1MJCA 4LFAL 5FLXc 4OWXB 1HNWQ 1Q1EA 4DV1Q 1Y1WH 2UUCL 2RHQB 4JYAL 4BBRH 2HT1A 3G6EA 4NXML 1G6PA 5GAHC 1KC8C 1X3GA 3LGJA 1QUQA 1FJGL 3J7ZC 1IYJB 1NE3A 3CMAA 3S16H 1G51A 3S1MH 1PA6A 3HKSA 1SLJA 2NVYH 2AHOB 3RN2A 3CCSA 4NXNL 1J5EL 4B3ML 3RLOA 3HKZE 1N34Q 3EBEA 2FXQA 4JBKA 2VS1A 1Q81C 2HHHQ 3F2CA 3KFUA 4DUZL 3E0EA 4DR2L 3S2DH 4H02A 1QZGA 3PUZA 4JI4Q 3JC66 1X3FA 4DR4Q 1XJVA 3OTOL 4B3SL 3CW2C 4APVA 2WB1E 4DV3Q 1SR3A 4OWTB 4JC0A 1TWCH 2VUMH 1OXSC 1R9TH 4YHHQ 4IOCA 4A3MG 1JB7A 2UXBL 1KRTA 3KDFB 5C4XG 1IBLL 4A4IA 4B3RQ 1HNZL 4X64Q 1GVPA 2VY3A 3FKIG 1EYGA 2B63G 2ZJPA 2K4KA 4A3BH 2ASBA 1E7ZA 2IHEA 2UXCQ 1K9MC 4P74A 2PQAB 3CCVA 2KCMA 3RZOH 5JEAG 1VQKA 5M3MG 4JV5Q 4IFDJ 3TREA 4L5QA 4AH6A 2LXJA 2Q2TA 4LF8Q 1C0AA 1HZ9A 1PH7A 1O7IA 1IBKL 4L5SA 2E5LQ 3HOVG 3CQZH 4UP7A 2JA5G 2MO1A 5ELNA 5C44H 2UUBQ 1U5KA 3GTJH 4GN3B 2VQFQ 1L1OC 2CKZB 4YWMA 4HJ7A 2A1AA 1XNRQ 2OTLA 2F52A 4FDBA 3A5UA 4JI6L 4DUYL 2C35B 3ULPA 1PYSB 2GN5A 2I5LX 1E3PA 4HJAA 4JI5L 1EIYB 3F8TA 2B3GA 4QIWE 2WP8J 3J7A5 1VQNA 4UPAA 4XIGS 1IBMQ 3GTMH 1AE3A 2MFIA 4KI0A 5JJKA 1PH4A 1HNXL 3GD7A 4JI2L 4IJLA 2BA0A 5E7NA 4YCUA 4JG2A 3S24A 1VCIA 2F4VQ 4A3FH 1YITA 1K0RA 1QVGA 3RZDH 1TXYA 4DK6C 3KF8B 2EIFA 3PUYA 4DPGA 4DR1L 4A3MH 3HOXH 4WJ4A 1UE5A 1TWFH 1W2BA 1K8GA 4PZ8A 1YI2A 3Q8DA 2N3SA 4P72A 4P73A 4PZ6A 4JI8L 4A3IH 4R4CA 4HIOA 3CCMA 5LMNL 1VQDA 1SFOH 5IP7H 1ASYA 1LTLA 4A93H 2Q2HA 3G4SA 5LMUQ 5JJIA 4GLXA 5GAGC 5FLMG 3EIVA 4C2MH 4L5TA 4DV7L 1J6QA 1Q8KA 4KHZA 4A75A 2UU9L 1HJPA 1VQEA 3GTQH 4YWKA 2A19A 4X66Q 2JQOA 3NELA 1CUKA 1EQQA 2Y0SE 4B3TL 2PI2A 4A3GG 1X6OA 4A3LH 4GN5A 1XMOL 3CCRA 3K80C 4RG1A 3JAMi 5AJ3L 3CF5A 4POFA 1K83H 1YJWA 2Q2UA 5IWAQ 1B70B 2UUAQ 3L7ZC 3TS2A 4QJFA 3F2BA 1PH1A 4LF7L 1VQGA 4O2DA 4LF5L 4IPCA 4A3CH 1Y1WG 5J3BA 3M4QA 4R4TA 3WWVA 3CC4A 4JI7L 3PO3H 1IZ6A 4BBRG 1GM5A 5GROA 4JI1Q 2JA6H 4LUOA 1LYLA 5IT9c 2ZM6Q 5IP9H 5IYDG 2UUCQ 4JYAQ 2VQEQ 1UE6A 1Q86C 4JI0L 4LFBQ 1I3QH 2CWPA 3TS0A 1YJNA 4LF4Q 1S3OA 2JJQA 3CCEA 4DAMA 1J5EQ 4NXNQ 2RCNA 2HIVA 4R4QA 1HR0Q 1N32L 3F1ZA 4DR3L 1ASZA 2QGQA 4DNIA 2VUMG 1Z47A 4A3JH 1W3SA 2PMZE 1PH2A 3KF6A 1VQ6A 4BXXH 4DV0Q 4JCVE 1EUJA 3DM3A 2B29A 5C4JH 4A3BG 3UDGA 1YHAA 2K52A 3S1NH 4DV2Q 4DV5L 1QVCA 3S15H 2VL6A 1GD7A 2R7DA 3PO2H 1QUQB 4MNOA 2K5VA 1S72A 3H3VI 1I6HH 4HIKA 2H5XA 1X55A 4GKKL 4LF6L 1X54A 4O0AA 1MKHA 4GKJL 2BH8A 3PCOB 3CPFA 4Y7NH 1VQJA 3ULLA 3PSIA 4PG3A 3HKZG 4DR7L 5IYDH 3RR5A 5C44G 4IPDA 3CC2A 4OXPA 3A74A 3T1HQ 1EFWA 2QA4A 4IJHA 2JE6I 2UXDL 4GN4B 4P75A 5HGQA 4DV6L 3A0JA 4AYBG 3CPWA 1PVOA 2NZHA 1CKMA 5H1SE 1YEZA 2R7ZH 1WFQA 4QY7A 5JEAJ 2K5HA 1Z9FA 4GNXB 2AMCB 1L1OA 2VNUD 2YTVA 5LMNW 1PH5A 1UE7A 4JI5Q 1EQRA 1AE2A 2K50A 4OX9Q 3STBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTY A;  4A3F G;  1HNX Q;  2ZTD A;  3JAM c;  4TQU S;  1OXV A;  1PV4 A;  1YBY A;  4L5R C;  2R6G A;  3HOX G;  3UDX A;  1N8R C;  1N33 L;  4A3D H;  1YNX A;  1N36 L;  1D7Q A;  1A8V A;  2CQO A;  5C0X G;  4DR1 Q;  3U58 A;  1PH9 A;  4KLK A;  1X9N A;  4A3I G;  3I4M H;  1TWG H;  1TWA H;  5IP7 G;  1I50 H;  4A93 G;  3HOW H;  3PV0 A;  4JI8 Q;  2KCT A;  1OXU A;  4GS3 A;  4GOP C;  3HOU H;  2F3I A;  1MIU A;  2Z6K C;  3I4N H;  1XMQ L;  3E9I A;  5K36 G;  2OQ0 A;  4HJ5 A;  1B8A A;  3UDI A;  1WCM H;  4KHP L;  1A0I A;  1V43 A;  4DR5 L;  3TRZ A;  2UU9 Q;  1WI5 A;  3ER0 A;  3ZJY C;  4AQY L;  2R92 H;  1E1O A;  4A3L G;  2K5N A;  4DK3 C;  3CME A;  2HQL A;  3I4N G;  4LUZ A;  3D0F A;  2N49 A;  3T1Y Q;  2OWO A;  3GDE A;  1VQA A;  1K73 C;  1XNQ Q;  2OTJ A;  1KRS A;  1VQ7 A;  4A3C G;  3AFP A;  3RLF A;  3HOY G;  4DV1 L;  1HNW L;  3KDF A;  3PO3 G;  2ID0 A;  3A5Z B;  2KHJ A;  3J81 i;  2JA6 G;  3NBH B;  3GO5 A;  1P16 A;  1VQM A;  5IP9 G;  4LF9 Q;  1CKN B;  3KJP A;  1IXR A;  2OCE A;  1PH3 A;  4YY3 Q;  1NJI C;  3FHW A;  5IYC H;  2CCZ A;  1SRU A;  4JI3 Q;  2PQA A;  1BBW A;  1N34 L;  1VS0 A;  4X6A H;  3S2H H;  4BBS H;  2AWN A;  4UP9 A;  4TVA B;  4P71 A;  4YCV A;  1Y14 B;  5M5Y H;  2EQS A;  1C7Y A;  2DUD A;  1KIX A;  2I5H A;  1OXT A;  4DR4 L;  1YZ6 A;  1JJC B;  1C9O A;  2RHS B;  4UP8 A;  4C3H H;  5IYB H;  4GNX C;  1SN8 A;  4MTN A;  2YYZ A;  4LFC Q;  3M3Y H;  2AKW B;  2AWO A;  3L2P A;  3HOZ H;  4A3J G;  5IY0 A;  4YHH L;  4X62 L;  2ATW A;  4BXX G;  4IFD G;  4X65 Q;  4AIM A;  1XPR A;  5FJ8 H;  4B3R L;  3W1B A;  1I94 Q;  1EWI A;  3U50 C;  1G29 1;  1H95 A;  1FGU A;  5M5W H;  1Y1V H;  3S14 H;  1S40 A;  1YVC A;  2ZJR A;  3PO2 G;  3S1Q H;  2UXC L;  1NMF A;  1X65 A;  3PF5 A;  1MJE A;  3ERS X;  4DV4 L;  2E2I H;  3H15 A;  3HOY H;  1OTC A;  1NMG A;  4HID A;  3I55 A;  1JMC A;  1IL2 A;  1VQH A;  4LFA Q;  4JBM A;  1HZB A;  1UE1 A;  4HJ9 A;  3H0G H;  3I2Z A;  3GTK H;  4JBW A;  4ME3 A;  2UUB L;  2VQF L;  4GKJ Q;  4NXM Q;  1Q12 A;  5EAY A;  1FJG Q;  1XNR L;  1GO3 E;  4GLV B;  4DR7 Q;  4QL5 A;  4GOP B;  1I5F A;  2VW9 A;  2NZO A;  3OW2 A;  2UXD Q;  2R7Z G;  4LUV A;  1N9W A;  1LUZ A;  2IT1 A;  4B3M Q;  4POG A;  3S17 H;  2YTX A;  4OWW B;  1OXX K;  2K14 A;  2GVA A;  1IBM L;  4DUZ Q;  3RLN A;  2BA1 A;  2PI2 E;  4DR2 Q;  2WAQ G;  3GTO H;  4BY1 H;  2F4V L;  1XTD A;  3TQY A;  3OTO Q;  3K0X A;  1VQL A;  3E9H A;  2ES2 A;  4B3S Q;  2K75 A;  4YWL A;  1VQ4 A;  4A3D G;  1L0W A;  3PIP A;  2UXB Q;  4EX5 A;  3B6Y A;  3I4M G;  1IBL Q;  1NBW A;  1HNZ Q;  2A8V A;  3CCU A;  3TEH B;  4HJ8 A;  3HOW G;  3AEV A;  5LMU L;  5C3E H;  3HOU G;  3J81 c;  1VQ5 A;  1VQO A;  3G48 A;  3L0O A;  4R1J A;  1JT8 A;  1RIP A;  5GQO A;  1WCM G;  1UWV A;  2JA9 A;  3K8A A;  2JA7 H;  2R93 H;  2I5M X;  2Z6K A;  1E22 A;  1X56 A;  3PUX A;  3PIO A;  4A3E H;  2CFM A;  1PH6 A;  1IBK Q;  2R92 G;  2KEN A;  3PUW A;  1DGS A;  3CCL A;  1SMX A;  1V9P A;  4OO1 G;  1KD1 C;  5IWA L;  3F2D A;  4YCW A;  3I56 A;  4C3I H;  3CCJ A;  2NVT H;  3KLW A;  1KXL A;  4UY8 C;  1WOC A;  4JI6 Q;  1VQ9 A;  2WB1 G;  4DUY Q;  5C0X I;  3KJO A;  2N8N A;  2NN6 G;  2JA8 H;  4IO9 A;  2I0Q A;  2ALY B;  4BA1 I;  4EQ5 A;  4DR6 L;  5BR8 L;  4Y52 H;  4JI1 L;  3KYH C;  3AYH B;  1EIF A;  2KBN A;  3RNU A;  2ZM6 L;  3K81 C;  4JI2 Q;  2VQE L;  4LFB L;  1E1T A;  5HY6 A;  1GKH A;  4K0K L;  5IYC G;  4LF4 L;  3MXN B;  1CSP A;  1NTG A;  5ELO A;  3K7U C;  5JJL A;  2PNH A;  2XTI A;  3S1R H;  4A3K H;  3M4P A;  4BBS G;  2R7F A;  5M3F H;  2E2J H;  2CWA A;  3I7F A;  1VQC A;  1HR0 L;  2D62 A;  2ZJQ A;  4DKA C;  1Q7Y C;  5LMN Q;  3UE1 A;  1M1K C;  1X3E A;  4ALP A;  1Q82 C;  4NPS A;  1PH8 A;  5IYB G;  2MQH A;  4AYB E;  2EXD A;  3PGZ A;  3HOZ G;  5GAD C;  1SRO A;  2VZA A;  4DV7 Q;  1BVS A;  1KHI A;  1PFS A;  4DV0 L;  3D31 A;  5FJ8 G;  2KHI A;  4GNX A;  1M90 C;  1FL0 A;  4X62 Q;  1TWH H;  3BU2 A;  4B3T Q;  1Y1V G;  3J81 j;  4DV2 L;  1PYB A;  3W1G A;  3J80 i;  1XMO Q;  1VQF A;  5AJ3 Q;  4LF5 Q;  3M9B A;  1VQ8 A;  2JK8 A;  2XGT A;  5DLQ E;  2LXK A;  3M7N A;  1UEB A;  2IX0 A;  4LF7 Q;  2IY5 B;  4BY7 H;  1JE5 A;  3I4O A;  4DV4 Q;  3PUV A;  4R4O A;  3H0G G;  4JI7 Q;  2IX1 A;  3NEM A;  3T1H L;  2LSS A;  2DGY A;  1VQP A;  4JI0 Q;  1U0L A;  1QZH A;  1D8L A;  4IFD I;  3W5O A;  1YJ9 A;  2BH2 A;  2HHH L;  3M85 A;  3H3V H;  4BA2 I;  1KQS A;  2Q2I A;  4JOI C;  2MO0 A;  4OON A;  3CD6 A;  1VQB A;  1B7Y B;  1LM0 A;  1FVI A;  2OQK A;  3G71 A;  4JI4 L;  3DLL A;  1T9H A;  3CP0 A;  4R4I A;  4OX9 L;  1N32 Q;  1Q1B A;  1BBU A;  2Y0S G;  4BY1 G;  3ULJ A;  2D0P A;  4DV3 L;  4DR3 Q;  2NVX H;  1XPO A;  1V1Q A;  2N78 A;  4J15 A;  2YV5 A;  4LW1 A;  3STB D;  3CC7 A;  3K7A H;  3VDY A;  1PHJ A;  3ICE A;  4X64 L;  1RL2 A;  1SE8 A;  5IE8 A;  5C4X H;  4LWC A;  4IOA A;  1E24 A;  2E8G A;  1CKO A;  3FKI H;  4JOI A;  4HIM A;  2B63 H;  5C3E G;  4DAY B;  4MZ9 A;  4DV5 Q;  1HZC A;  1KAW A;  2JEA I;  4JV5 L;  3KOJ A;  1YHQ A;  1CKN A;  3GTL H;  3BZK A;  4LF8 L;  2MNA A;  2ZTC A;  2WFW A;  5M3M H;  2E5L L;  4XTC S;  4GKK Q;  1XPU A;  1Q46 A;  2JA7 G;  4PMW A;  2R93 G;  4LF6 Q;  4PZ7 A;  1WJJ A;  2GVB A;  3HOV H;  4A3E G;  1NY4 A;  1JJG A;  2JA5 H;  1QVF A;  4NB3 A;  3IRB A;  1A62 A;  3T1Y L;  4C3J H;  1XNQ L;  4DV6 Q;  2JA8 G;  2IHF A;  3EN2 A;  3KF6 B;  3RN5 A;  2E2H H;  1HR0 W;  4GLA C;  4A76 A;  4QQB X;  3FP9 A;  3CXC A;  2RF4 A;  1L2F A;  3UE0 A;  5M5X H;  2ZTE A;  3U4V A;  2L15 A;  1YIJ A;  4LF9 L;  4RMF A;  2QEX A;  4DR6 Q;  5BR8 Q;  3BJU A;  4QGU A;  1JJ2 A;  4LNQ A;  4YY3 L;  4JI3 L;  3J80 c;  4IPG A;  3GTP H;  1VQI A;  1N33 Q;  2YU9 H;  3NEN A;  4K0K Q;  4A3K G;  1N36 Q;  1WYD A;  1HH2 P;  3CCQ A;  2HIX A;  5M3F G;  3AFQ A;  4OO1 I;  4JBJ A;  3HFZ B;  2V1C C;  1P8L A;  3MEF A;  4LFC L;  3CAM A;  5FLM H;  2NN6 I;  4GOP A;  2D0O A;  1HZA A;  3SGI A;  4X66 L;  1XMQ Q;  4WJ3 M;  4X65 L;  1L1O B;  5C0X J;  1AH9 A;  4KHP Q;  1I94 L;  1BKB A;  2Z0S A;  3PF4 A;  2WAQ E;  3BZC A;  4DR5 Q;  1KL9 A;  4A3G H;  1CSQ A;  2UUA L;  3M4O H;  4IPH A;  4AQY Q;  3U4Z A;  1K3R A;  1A63 A;  3AQQ A;  1EOV A;  3UDF A;  5GAE C;  1YHB A;  3OYY A;  1K8A C;  2JEB I;  3GTG H;  2NVQ H;  4BY7 G;  1MJC A;  4LFA L;  5FLX c;  4OWX B;  1HNW Q;  1Q1E A;  4DV1 Q;  1Y1W H;  2UUC L;  2RHQ B;  4JYA L;  4BBR H;  2HT1 A;  3G6E A;  4NXM L;  1G6P A;  5GAH C;  1KC8 C;  1X3G A;  3LGJ A;  1QUQ A;  1FJG L;  3J7Z C;  1IYJ B;  1NE3 A;  3CMA A;  3S16 H;  1G51 A;  3S1M H;  1PA6 A;  3HKS A;  1SLJ A;  2NVY H;  2AHO B;  3RN2 A;  3CCS A;  4NXN L;  1J5E L;  4B3M L;  3RLO A;  3HKZ E;  1N34 Q;  3EBE A;  2FXQ A;  4JBK A;  2VS1 A;  1Q81 C;  2HHH Q;  3F2C A;  3KFU A;  4DUZ L;  3E0E A;  4DR2 L;  3S2D H;  4H02 A;  1QZG A;  3PUZ A;  4JI4 Q;  3JC6 6;  1X3F A;  4DR4 Q;  1XJV A;  3OTO L;  4B3S L;  3CW2 C;  4APV A;  2WB1 E;  4DV3 Q;  1SR3 A;  4OWT B;  4JC0 A;  1TWC H;  2VUM H;  1OXS C;  1R9T H;  4YHH Q;  4IOC A;  4A3M G;  1JB7 A;  2UXB L;  1KRT A;  3KDF B;  5C4X G;  1IBL L;  4A4I A;  4B3R Q;  1HNZ L;  4X64 Q;  1GVP A;  2VY3 A;  3FKI G;  1EYG A;  2B63 G;  2ZJP A;  2K4K A;  4A3B H;  2ASB A;  1E7Z A;  2IHE A;  2UXC Q;  1K9M C;  4P74 A;  2PQA B;  3CCV A;  2KCM A;  3RZO H;  5JEA G;  1VQK A;  5M3M G;  4JV5 Q;  4IFD J;  3TRE A;  4L5Q A;  4AH6 A;  2LXJ A;  2Q2T A;  4LF8 Q;  1C0A A;  1HZ9 A;  1PH7 A;  1O7I A;  1IBK L;  4L5S A;  2E5L Q;  3HOV G;  3CQZ H;  4UP7 A;  2JA5 G;  2MO1 A;  5ELN A;  5C44 H;  2UUB Q;  1U5K A;  3GTJ H;  4GN3 B;  2VQF Q;  1L1O C;  2CKZ B;  4YWM A;  4HJ7 A;  2A1A A;  1XNR Q;  2OTL A;  2F52 A;  4FDB A;  3A5U A;  4JI6 L;  4DUY L;  2C35 B;  3ULP A;  1PYS B;  2GN5 A;  2I5L X;  1E3P A;  4HJA A;  4JI5 L;  1EIY B;  3F8T A;  2B3G A;  4QIW E;  2WP8 J;  3J7A 5;  1VQN A;  4UPA A;  4XIG S;  1IBM Q;  3GTM H;  1AE3 A;  2MFI A;  4KI0 A;  5JJK A;  1PH4 A;  1HNX L;  3GD7 A;  4JI2 L;  4IJL A;  2BA0 A;  5E7N A;  4YCU A;  4JG2 A;  3S24 A;  1VCI A;  2F4V Q;  4A3F H;  1YIT A;  1K0R A;  1QVG A;  3RZD H;  1TXY A;  4DK6 C;  3KF8 B;  2EIF A;  3PUY A;  4DPG A;  4DR1 L;  4A3M H;  3HOX H;  4WJ4 A;  1UE5 A;  1TWF H;  1W2B A;  1K8G A;  4PZ8 A;  1YI2 A;  3Q8D A;  2N3S A;  4P72 A;  4P73 A;  4PZ6 A;  4JI8 L;  4A3I H;  4R4C A;  4HIO A;  3CCM A;  5LMN L;  1VQD A;  1SFO H;  5IP7 H;  1ASY A;  1LTL A;  4A93 H;  2Q2H A;  3G4S A;  5LMU Q;  5JJI A;  4GLX A;  5GAG C;  5FLM G;  3EIV A;  4C2M H;  4L5T A;  4DV7 L;  1J6Q A;  1Q8K A;  4KHZ A;  4A75 A;  2UU9 L;  1HJP A;  1VQE A;  3GTQ H;  4YWK A;  2A19 A;  4X66 Q;  2JQO A;  3NEL A;  1CUK A;  1EQQ A;  2Y0S E;  4B3T L;  2PI2 A;  4A3G G;  1X6O A;  4A3L H;  4GN5 A;  1XMO L;  3CCR A;  3K80 C;  4RG1 A;  3JAM i;  5AJ3 L;  3CF5 A;  4POF A;  1K83 H;  1YJW A;  2Q2U A;  5IWA Q;  1B70 B;  2UUA Q;  3L7Z C;  3TS2 A;  4QJF A;  3F2B A;  1PH1 A;  4LF7 L;  1VQG A;  4O2D A;  4LF5 L;  4IPC A;  4A3C H;  1Y1W G;  5J3B A;  3M4Q A;  4R4T A;  3WWV A;  3CC4 A;  4JI7 L;  3PO3 H;  1IZ6 A;  4BBR G;  1GM5 A;  5GRO A;  4JI1 Q;  2JA6 H;  4LUO A;  1LYL A;  5IT9 c;  2ZM6 Q;  5IP9 H;  5IYD G;  2UUC Q;  4JYA Q;  2VQE Q;  1UE6 A;  1Q86 C;  4JI0 L;  4LFB Q;  1I3Q H;  2CWP A;  3TS0 A;  1YJN A;  4LF4 Q;  1S3O A;  2JJQ A;  3CCE A;  4DAM A;  1J5E Q;  4NXN Q;  2RCN A;  2HIV A;  4R4Q A;  1HR0 Q;  1N32 L;  3F1Z A;  4DR3 L;  1ASZ A;  2QGQ A;  4DNI A;  2VUM G;  1Z47 A;  4A3J H;  1W3S A;  2PMZ E;  1PH2 A;  3KF6 A;  1VQ6 A;  4BXX H;  4DV0 Q;  4JCV E;  1EUJ A;  3DM3 A;  2B29 A;  5C4J H;  4A3B G;  3UDG A;  1YHA A;  2K52 A;  3S1N H;  4DV2 Q;  4DV5 L;  1QVC A;  3S15 H;  2VL6 A;  1GD7 A;  2R7D A;  3PO2 H;  1QUQ B;  4MNO A;  2K5V A;  1S72 A;  3H3V I;  1I6H H;  4HIK A;  2H5X A;  1X55 A;  4GKK L;  4LF6 L;  1X54 A;  4O0A A;  1MKH A;  4GKJ L;  2BH8 A;  3PCO B;  3CPF A;  4Y7N H;  1VQJ A;  3ULL A;  3PSI A;  4PG3 A;  3HKZ G;  4DR7 L;  5IYD H;  3RR5 A;  5C44 G;  4IPD A;  3CC2 A;  4OXP A;  3A74 A;  3T1H Q;  1EFW A;  2QA4 A;  4IJH A;  2JE6 I;  2UXD L;  4GN4 B;  4P75 A;  5HGQ A;  4DV6 L;  3A0J A;  4AYB G;  3CPW A;  1PVO A;  2NZH A;  1CKM A;  5H1S E;  1YEZ A;  2R7Z H;  1WFQ A;  4QY7 A;  5JEA J;  2K5H A;  1Z9F A;  4GNX B;  2AMC B;  1L1O A;  2VNU D;  2YTV A;  5LMN W;  1PH5 A;  1UE7 A;  4JI5 Q;  1EQR A;  1AE2 A;  2K50 A;  4OX9 Q;  3STB C; 
#chains in the Genus database with same CATH topology
 4G4K A;  2FE3 A;  3SK4 A;  2VA2 A;  1SE4 A;  4RAU C;  1HNX Q;  1GJX A;  4TQU S;  4CKE A;  3PIP 3;  1PV4 A;  1YBY A;  1LT3 D;  3UDX A;  1FNW A;  2R82 A;  3X3M A;  4RZQ A;  3LWB A;  2CQO A;  3M9M B;  3U58 A;  2AGP A;  1EZ6 A;  4A3I G;  1N48 A;  1I50 H;  3I3C A;  3PV0 A;  2B2W A;  2KCT A;  4C2M A;  4C3J B;  3JAM L;  3EA6 A;  5EKL A;  1JC7 A;  3BVZ A;  2OQ0 A;  4JI3 H;  1B8A A;  2DLN A;  1A0I A;  2EY5 A;  3V2T A;  5IGD A;  1WI5 A;  2R92 H;  2WYO A;  1J9O A;  1HUM A;  4EEY A;  4LUZ A;  2F0K A;  1VF7 A;  2M9V A;  5FKA C;  2IBK A;  4LFC H;  1KRS A;  4RNO A;  1JWU D;  5J1Z A;  3HOY G;  4DV1 L;  3KDF A;  3PO3 G;  1K1Q A;  5KG1 A;  2KHJ A;  4GC6 A;  3H3V C;  3GO5 A;  1P16 A;  4KD3 A;  1VQM A;  4LF9 Q;  4UFZ A;  1IXR A;  1S5F D;  2ZDQ A;  2JA7 B;  4QWC A;  1NJI C;  1JIH A;  4RUC A;  5C5J A;  1T3N A;  1PXU A;  5KFO A;  4HAE A;  2O4X A;  4CDE C;  4X6A H;  4KJN A;  2ZXP A;  4UP9 A;  3A7L A;  2LKV A;  4YCV A;  1Y14 B;  2EQS A;  1CK1 A;  2DUD A;  1JJC B;  1C9O A;  4UP8 A;  4O2B F;  3PQI A;  4QWB A;  4NXM H;  5IYB H;  1LLR D;  3H40 A;  3HOZ H;  1M0W A;  4IFD G;  2EYL A;  2DY8 A;  4YHH L;  3L4J A;  4AIM A;  1L0X B;  5JVG 3;  4BBR B;  4IN3 A;  4XQJ A;  3S14 H;  1Y1V H;  4A2B A;  4DR2 H;  2ZJR A;  1J8I A;  5E4X A;  2R7K A;  1LTS D;  5D14 A;  2C2E A;  5KG5 A;  2V9W A;  1NMG A;  4HID A;  4FS1 A;  2FJ2 A;  4LFA Q;  3NPP A;  1GSA A;  1UE1 A;  1LAC A;  1T36 A;  3GTK H;  4ME3 A;  4A2A A;  3NTI A;  2W6N A;  1HNZ H;  5KNC A;  5EGT A;  2AQ3 B;  4DNR B;  1G2T A;  1E4F T;  2XCA A;  5IIF A;  4DR7 Q;  2XN9 C;  4QL5 A;  2FIN B;  2UXD Q;  1SYF A;  3GID A;  2R7Z G;  4B3M Q;  3AU7 A;  1TT2 A;  2R87 A;  3MR5 A;  4EQO A;  2WAQ A;  3PW4 A;  4DUZ Q;  2PI2 E;  4L1K A;  4HTH A;  4ZKB B;  4BY1 H;  1CTM A;  1EL0 A;  3NXW A;  1RKN A;  4FS2 A;  3K0X A;  4B3S Q;  2NTT A;  1CFM A;  1VQ4 A;  5I4D A;  1TWG A;  3PIP A;  2IL8 A;  3B6Y A;  3H6M A;  3I4M G;  2F03 A;  1IBL Q;  4J9N A;  1GXD C;  4JVZ A;  1PTO D;  3IFD A;  4DL3 A;  3AEV A;  4HN7 A;  5C3E H;  2W6M A;  1QWY A;  1VQ5 A;  3P75 A;  3BAA A;  5I9O A;  5KG7 A;  1WTO A;  3K5O A;  1F2M A;  1JT8 A;  1Q8I A;  1RIP A;  4XT3 B;  3ND9 A;  1JOR A;  1UWV A;  2JA9 A;  1W93 A;  2R93 H;  5KGU A;  2I5M X;  1SJE D;  5DNF A;  2NVX B;  3PUX A;  3VYR A;  3QWN A;  2QF7 A;  3QJY A;  1R4P B;  1F2Y A;  5BN3 A;  3KLW A;  3T53 B;  5C4X B;  3D8G A;  1WOC A;  1KXL A;  1JWS D;  5C0X I;  2J6U A;  5KFF A;  3TQT A;  4IO9 A;  2W9B A;  2W9C A;  2I0Q A;  3OW7 A;  1SYD A;  1SFO B;  2O5I C;  4EQ5 A;  5HBR B;  5DG7 A;  4JI1 L;  4A93 B;  3T51 B;  2R7M A;  2ZM6 L;  5CR3 A;  3MXN B;  3ORR A;  5ELO A;  3BS1 A;  5JJL A;  2XTI A;  2SOB A;  2X6L A;  4A3K H;  5D1O B;  4BBS G;  5M3F H;  2E2J H;  3DWQ A;  3MWM A;  1TQO A;  2DN8 A;  4DKA C;  3UE1 A;  4JI7 H;  2R7N A;  2WIN B;  4MV4 A;  3NGD A;  5BN4 A;  1Q82 C;  4X3S A;  2J7Z A;  2MQH A;  2E2H B;  2JP1 A;  1EIH A;  3PGZ A;  3J80 E;  2BOS A;  3DWP A;  2BQU A;  4DV7 Q;  3WO1 A;  1IKL A;  3SEB A;  3D31 A;  5FJ8 G;  2KHI A;  1V4Y A;  2ICI A;  1FL0 A;  3L9A X;  5KT2 A;  3EJI A;  3J81 E;  3J81 j;  4DV2 L;  3R8B A;  1STB A;  1XMO Q;  4YR3 A;  4M7E A;  2I07 B;  5AJ3 Q;  4LF5 Q;  3SK5 A;  2E2I A;  2FFK B;  1KJ9 A;  2EYH A;  4CKC A;  3QZ7 A;  4O4H F;  1S0N A;  3T5L A;  5KFZ A;  1BO0 A;  1TS5 A;  1EU4 A;  1KAA A;  1IKM A;  1VMC A;  4DV4 Q;  3H0G G;  2XGQ A;  2ZDH A;  1X3P A;  1H9M A;  1VQP A;  1HFG A;  3GLK A;  5DLG A;  1QZH A;  3EPG A;  5J39 A;  4BA2 I;  3NP8 A;  1KQS A;  4JOI C;  3GTO A;  1FVI A;  1L2Z A;  3DLL A;  2F0T A;  5KFI A;  4KTA A;  1BBU A;  1HTP A;  4DV3 L;  3GTG B;  1EIG A;  1E0B A;  2KJX A;  2NVQ B;  1XPO A;  1SYX B;  3MHB A;  1PK8 A;  1Y1W B;  3CC7 A;  3K7A H;  4WRD A;  1RL2 A;  3VR2 A;  5KIX A;  4OL7 A;  5IE8 A;  2B2W C;  3DM1 A;  4LWC A;  2VOB A;  1C3O A;  1E24 A;  4MTD A;  1CKO A;  2B63 H;  1DOL A;  3GIQ A;  4DV5 Q;  4JV5 L;  3A56 A;  4CKB A;  1AZQ A;  4R8I A;  3UQ8 A;  2ZTC A;  1JCK B;  4XTC S;  4GKK Q;  1B6R A;  2JA7 G;  4PZ7 A;  4ECV A;  1OWT A;  1N36 H;  2VPQ A;  1WJJ A;  1QVF A;  1EY8 A;  1EOT A;  4NB3 A;  1NUC A;  3OMG A;  2NU9 B;  3BA9 A;  3K0Y A;  1R9T B;  4MV8 A;  3N41 B;  2NUA B;  2ZXO A;  3A7A B;  4DV6 Q;  3TP5 A;  4FM9 A;  1XMQ H;  3Q8Q B;  1HTL D;  1HR0 W;  3OIQ A;  4A76 A;  1JOQ A;  3QFF A;  1L2F A;  5M5X H;  4LF9 L;  4MAM A;  2QEX A;  4C5C A;  3N44 B;  5BR8 Q;  1ESF A;  1CHP D;  3J80 c;  4KD4 A;  4RCN A;  1VQI A;  3MFI A;  3CQZ B;  3NEN A;  2YU9 H;  5H80 A;  1FR3 A;  4GC7 A;  2BQR A;  1CQV A;  1WYD A;  3E6Z X;  3MAQ A;  4OO1 I;  1AN8 A;  3HFZ B;  5EWG A;  5EDW A;  4AYB B;  4DL5 A;  1W96 A;  4DAV A;  3CAM A;  2NN6 I;  3SGI A;  1CQJ B;  2C28 A;  1TWH A;  1L1O B;  4KHP Q;  1JB3 A;  4DR5 Q;  1KL9 A;  4Q8E A;  1CSQ A;  3M4O H;  4F4X A;  3HOX B;  5GAE C;  1EOV A;  4B9X A;  1YHB A;  5KFY A;  2XIW A;  1T5X D;  3OYY A;  4DV3 H;  4EGV A;  4OEL B;  1HQM C;  5CBE E;  4KKU A;  4LFA L;  4X62 H;  1HNW Q;  5COY A;  1PTO B;  2RHQ B;  3N52 A;  4Q5V A;  2AQ1 B;  2E76 C;  5AFW A;  1AUV A;  1G6P A;  3PR4 A;  5DEH A;  1KC8 C;  1QUQ A;  4IWX A;  5C8Y F;  2KHS A;  4UCR A;  3RN2 A;  2NVY H;  4G3I A;  4NXN L;  4B3M L;  3RLO A;  4JV5 H;  2C22 A;  1N34 Q;  4JBK A;  2VS1 A;  3FDT A;  3F2C A;  4DUZ L;  3KFU A;  3HBL A;  2NBF A;  4RB0 A;  2V4D A;  2FP4 B;  4JI4 Q;  4DR4 Q;  3K59 A;  5FO9 B;  1A3V A;  2C2R A;  4B3S L;  4APV A;  3RFC A;  1SR3 A;  2FMM A;  2VUM H;  4O3Q A;  2K01 A;  4QW9 A;  1ILQ A;  1S97 A;  4MIU A;  4RKL A;  4QWD A;  1JB7 A;  1KRT A;  3KDF B;  3M4Y A;  5C4X G;  3FEW X;  4NDX A;  1IBL L;  2XD4 A;  4X64 Q;  1GVP A;  2K4K A;  1G6Z A;  1CQI B;  3N6R A;  2UXC Q;  4I55 F;  5KFJ A;  2W8L A;  2KCM A;  4ECU A;  2OXP A;  3SHL A;  5M3M G;  2QDB A;  4L5Q A;  3CRK C;  3TRE A;  4LF8 Q;  1VAJ A;  4X3T A;  5L1J A;  4ED3 A;  3VR3 A;  2E5L Q;  3KXY T;  1TS2 A;  5ELN A;  2J4X A;  2VQF Q;  1ET6 A;  4A3J B;  5LMU H;  4YWM A;  1XNR Q;  2OTL A;  2BE5 D;  3A5U A;  2FKL A;  2BQ3 A;  1O75 A;  5C4J B;  2PQE A;  1E3P A;  4U67 3;  4HJA A;  5EPL A;  3F8T A;  2B3G A;  2MP1 A;  3J7A 5;  5L1K A;  4IRC A;  5C6A A;  2V4R A;  2GA4 B;  4KI0 A;  5JJK A;  1I6H B;  5E7N A;  1PZJ D;  3GTP A;  4JG2 A;  2SNM A;  4XYM B;  4Z9C B;  3V6H A;  1YIT A;  2M2L A;  3TBI B;  1QVG A;  3RZD H;  1TXY A;  2YRW A;  3KF8 B;  2EIF A;  3PUY A;  3OUZ A;  5IWA H;  4JV1 A;  4WJ4 A;  2I87 A;  1TWF H;  2BDO A;  1A3T A;  4A3I H;  4R4C A;  4HIO A;  1LTL A;  3OMC A;  2NVT B;  2VXW A;  1W6J A;  2JA7 A;  4ZAI A;  2R8H A;  3EIV A;  3BA8 A;  2VQE H;  4LFB H;  4DV7 L;  1J6Q A;  4KHZ A;  4A75 A;  4FF1 A;  1ML0 D;  1WD0 A;  4QUC A;  2JYO A;  2WAQ B;  3OWE B;  4X66 Q;  2JQO A;  3IL8 A;  5FD6 A;  3DWA A;  1EQQ A;  2HVR A;  2PI2 A;  4NXN H;  1PDQ A;  1SYE A;  4RHS A;  1HR0 H;  1XMO L;  1YJW A;  2R8J A;  5AJ3 L;  3CF5 A;  4LF5 L;  3TS2 A;  1K83 H;  3L7Z C;  3CVZ A;  3T4A C;  4RNN A;  2X69 A;  1TY2 A;  3DHQ A;  1TWG B;  5FLX W;  3RB3 A;  4O2D A;  4IPC A;  2IW3 A;  1Y1W G;  4DV0 H;  2N88 A;  3WWV A;  3CC4 A;  3PO3 H;  1GHK A;  4I65 A;  1BCP F;  3A8J E;  1XDN A;  4HR7 B;  3RB6 A;  4DAY A;  2VUG A;  1Q86 C;  4FYD A;  1I3Q H;  2XSC A;  1BF4 A;  1CZG A;  3R93 A;  3CCE A;  5IOC A;  1C4Q A;  2FHT A;  3QOL A;  4RCO A;  3C3L A;  1XXG A;  5EKK A;  3F1Z A;  2IMW P;  1S5E D;  5JPM C;  1XYI A;  1STH A;  1ZEQ X;  1M4V A;  2DPJ A;  2K5Q A;  2A5H A;  2W9C B;  4IFD H;  1VQ6 A;  3G6V A;  1B3Q A;  2AQ2 B;  2B29 A;  2JEF A;  5IGF A;  1YHA A;  4YJ2 F;  5KFR A;  4DV5 L;  5CC4 A;  3S15 H;  4OX9 H;  3ERQ A;  4K8J A;  2JEG A;  1PYW D;  3BVG A;  5G3L F;  1S72 A;  3I70 A;  2B2Y A;  1A9X A;  4H0L C;  3NHH A;  4HIK A;  3RV4 A;  3NWS A;  4GKK L;  4GKJ L;  3PCO B;  4C3H B;  2IA6 A;  1A3U A;  4F50 A;  1FD7 D;  5IYD H;  4OIJ A;  3CC2 A;  2BE5 C;  4FXG C;  4OXP A;  4TRD A;  3D6C A;  3T1H Q;  2JE6 I;  2KA7 A;  3ERO A;  2NB0 A;  1STY A;  1BUV T;  1HUN A;  5HGQ A;  4DV6 L;  1HA6 A;  2C2D A;  2UU9 H;  4AYB G;  1VDZ A;  5D65 A;  5D3D A;  5C4Z A;  3DF7 A;  2R7Z H;  4PWQ A;  1Z9F A;  3GTM A;  1LT5 D;  2AMC B;  1V8Q A;  1E2V A;  1PH5 A;  2NU6 B;  4U6P A;  1EQR A;  1AE2 A;  4FVM A;  3RIZ A;  1BDO A;  2E2I B;  1B4O A;  2JEI A;  5KYI A;  4KV6 A;  3T1Y H;  1O78 A;  2CQA A;  3R3O A;  4X3K A;  3HOX G;  1N8R C;  1YNX A;  2EXZ A;  4WD3 A;  1SFO A;  4DR1 Q;  2F0D A;  5C0X G;  4YR2 A;  1U4R A;  4KLK A;  1X9N A;  3I4M H;  1ILP A;  2RQX A;  1AFP A;  1PRT D;  4JI8 Q;  4GS3 A;  4I7Z C;  3DEP A;  2Z6K C;  3GTQ A;  5T1G A;  1E2Z A;  2KQ3 A;  4YY3 H;  3UDI A;  4HYK A;  1E4E B;  4KHP L;  1E2W A;  4G57 A;  1V43 A;  4DR5 L;  3TRZ A;  4IR1 A;  4K5W A;  1RJT A;  1E1O A;  5DG9 A;  2KVM A;  3CME A;  2HQL A;  3M7G A;  1JLL B;  3SE7 A;  2FMC A;  3D0F A;  3MR6 A;  4EYI B;  2OT2 A;  1XNQ Q;  3KBX A;  2XNA C;  4F4Y A;  4ZLT F;  4A3C G;  1HNW L;  4Q44 A;  4X65 H;  5KG6 A;  5IT9 W;  5IGC A;  3J81 i;  4IUT A;  3I12 A;  2Z6B A;  2UUA H;  5IP9 G;  4DFA A;  1I4X A;  2OCE A;  1FYC A;  1SRU A;  3VA7 A;  1BBW A;  1N34 L;  1VS0 A;  3S2H H;  1GUT A;  1MSH A;  4BBS H;  2VPS A;  4Q43 A;  3OHA A;  4C3I B;  4R7R A;  1UNN C;  1C7Y A;  4XYL B;  1KIX A;  4DR4 L;  5A2Q E;  1GYF A;  3KHR A;  2CH4 W;  3PN1 A;  1F9P A;  2V58 A;  1FJG H;  3M3Y H;  4A3J G;  5IY0 A;  2ATW A;  4BXX G;  2XIG A;  2NUC A;  5FJ8 H;  1KDA A;  1JWM D;  3MEH A;  2LS0 1;  4OGQ C;  1I94 Q;  1EWI A;  3U50 C;  2R61 A;  2NYZ D;  5M5W H;  2RBM A;  1H95 A;  4O3N A;  3GTG A;  2C9O A;  1YVC A;  2UXC L;  2R84 A;  3S1Q H;  3S1R B;  1NMF A;  4ECY A;  3N8D A;  3PR5 B;  1A15 A;  1GUS A;  3ERS X;  3VR4 A;  1IL2 A;  4ETS A;  1KNA A;  3H0G H;  3W2D A;  2VQF L;  3I73 A;  1Z2N X;  1Z2P X;  5EAY A;  1Y8O B;  1GO3 E;  1XNR L;  2KSW A;  2O03 A;  4TV9 F;  1TWC B;  2WAC A;  3A8K E;  4IRD A;  2K33 A;  2VW9 A;  1ESR A;  1TWH B;  1N9W A;  4UCV A;  2YTX A;  2GVA A;  3P1H A;  1WVL A;  2BA1 A;  2WAQ G;  1K0S A;  3JAM W;  1CM9 A;  1XTD A;  3TN2 A;  3OTO Q;  2ES2 A;  1EUC B;  1I7N A;  1STG A;  2F0H A;  4JI6 H;  2IX3 A;  2UXB Q;  4UAI A;  2YL2 A;  3GTJ B;  3GV3 A;  3PW7 A;  3FPU B;  3R23 A;  1I4R A;  5KFP A;  3OPO A;  3G48 A;  1WCM A;  1KBL A;  3OHB A;  4R1J A;  4HSV A;  1S03 G;  3K8A A;  2JA7 H;  4ED7 A;  3KUP A;  1PH6 A;  1WTV A;  1SYB A;  3IFT A;  2A74 C;  2CW0 D;  2CFM A;  1IBK Q;  3RGZ A;  3J81 L;  3ITP A;  3NE5 B;  3V05 A;  4AYB A;  3KLS A;  1DGS A;  4N9P A;  1SMX A;  4OO1 G;  2NU7 B;  4UHV A;  5JVL A;  2FLP A;  3RTX A;  4UY8 C;  1VQ9 A;  4DUY Q;  2N8N A;  2NN6 G;  3FKI B;  2LMC B;  1CE8 A;  5KND A;  2NTS A;  3J7A K;  2F3W A;  1I4G A;  4JI2 Q;  1E1T A;  3I8Z A;  4K0K L;  3ONA B;  5IYC G;  1SNM A;  4IUR A;  5LA6 F;  1DM0 B;  1EQT A;  4N8X 1;  3I91 A;  3BDL A;  3NQI A;  1VQC A;  4K2K A;  2D62 A;  1M1K C;  5EQ0 A;  5LMN Q;  5FPO A;  4EGJ A;  4ALP A;  4C3H G;  3FMA A;  4XZ3 B;  4IUQ A;  2IWH A;  4NPS A;  4J1M A;  4R9W A;  2EXD A;  2L11 A;  4JI0 H;  5GAD C;  5KG0 A;  1PFS A;  3FVQ A;  3SDZ A;  4GNX A;  1M90 C;  4X62 Q;  5DQG A;  4B3T Q;  3WDN A;  4IUN A;  3GTP B;  2B2Y C;  1FNU A;  3C1F A;  3W1G A;  1N32 H;  1VQF A;  2K03 A;  4ULL A;  3M9B A;  1VQ8 A;  2JK8 A;  2XGT A;  4RA8 A;  5DLQ E;  5M9O A;  4IUU A;  2IX0 A;  4LF7 Q;  4J9O A;  4RUA A;  2Z9H A;  4R4O A;  1PLF A;  4F4Z A;  1PRT B;  3T1H L;  1B50 A;  3OOC A;  2DGY A;  3PVX A;  1U0L A;  3K5I A;  1D8L A;  3K58 A;  3W5O A;  3R5X A;  2HHH L;  2PW7 A;  3J7A F;  3H3V H;  1BCP B;  4KY5 A;  4A3G B;  2W57 A;  2Q2I A;  4MHE A;  4LF6 H;  2VB3 X;  2OH2 A;  1T9H A;  4R4I A;  3PW2 A;  1Q1B A;  3JRW A;  3ULJ A;  4DR3 Q;  5CMD A;  2Q8T A;  2NVX H;  4CDF C;  4PDB A;  1D1K A;  1SE2 A;  1ZYR C;  2WE6 A;  1V1Q A;  2IJ0 A;  1Q3L A;  4J15 A;  2YV5 A;  3STB D;  3LX0 A;  1PHJ A;  3VDY A;  2R86 A;  2QCP X;  1G91 A;  1SE8 A;  3A54 A;  4XX0 B;  1U4L A;  5C4X H;  1NR2 A;  2W6O A;  4KN7 C;  4FO2 A;  3FMC A;  1T94 A;  3GIJ A;  4DAY B;  2G5D A;  3KF8 A;  3T56 B;  3P20 A;  5CA0 F;  1PZI D;  2MNA A;  1IW7 D;  5M3M H;  3N40 P;  2CW0 C;  4PMW A;  4C1N I;  4K0K H;  2RVL A;  4CDD C;  3WOE A;  1KJJ A;  2EJG C;  2WDT A;  5JH7 F;  3KBG A;  1K8M A;  4DXG A;  4YAJ B;  3GIL A;  4C3I G;  4CBV A;  1IHZ A;  2XRS D;  1XNQ L;  3MR2 A;  2AQ4 A;  1KDB A;  5BMV F;  2IHF A;  3EN2 A;  4ECQ A;  4A3B B;  2E2H H;  1O7L A;  2F1M A;  3FP9 A;  3CXC A;  4F87 A;  1SNO A;  3E5S A;  2ZTE A;  2L15 A;  1DD2 A;  5KKN B;  3RZO B;  4RMF A;  1TA8 A;  4DR6 Q;  1JJ2 A;  4LNQ A;  4I4T F;  4U7C A;  3N42 B;  3OSN A;  4IPG A;  4RHR A;  1N33 Q;  2DZD A;  5CB4 F;  1JOK A;  3GP7 A;  3HKZ B;  3R5F A;  5FPR A;  2K5W A;  1HH2 P;  3CCQ A;  3URY A;  4DV1 H;  1I4Q A;  4HR7 A;  3F8N A;  4RB2 C;  5E3F A;  2B2V C;  3BG3 A;  5T14 A;  3BYT B;  2D0O A;  2EOT A;  3GTM B;  1AH9 A;  1I94 L;  4NP5 A;  2HHH H;  3KAJ A;  2AUJ D;  3HGB A;  4AQY Q;  5J2T F;  5F9N A;  2L9H A;  1K3R A;  1A63 A;  1KLU D;  5GON F;  3GIK A;  3GII A;  3C1E A;  3GTG H;  2NVQ H;  2YCH A;  1MJC A;  3K5H A;  4YHH H;  2N55 A;  5FLX c;  3VPB A;  1R4Q B;  1Y1W H;  2UUC L;  4JYA L;  2HT1 A;  2E2D C;  3DXJ C;  5I9P A;  4K2L A;  2DJF C;  1AN7 A;  3LGJ A;  3J7Z C;  3GTQ B;  3W3A A;  5CA1 F;  3HKS A;  1AEX A;  2AHO B;  1J5E L;  3RV3 A;  3QG1 A;  3HKZ E;  3S9W A;  2A6H D;  3EBE A;  4LH6 A;  3I4N B;  5DM7 3;  2VQD A;  4DLK A;  5KFQ A;  1Y1V B;  3E0E A;  4H02 A;  2FJZ A;  2R3Z A;  1V51 A;  1QZG A;  3PUZ A;  3X3N A;  3JC6 6;  2EYJ A;  3R5H A;  5EOY A;  4JV2 A;  1XJV A;  4PMC A;  3OTO L;  1Y69 U;  4YBZ B;  2WB1 E;  3TQ1 A;  5L1L A;  4R8N A;  1R9T H;  4M1U B;  2RDI A;  3V6K A;  2UXB L;  4L63 B;  1I6V C;  4K14 A;  4A4I A;  4B3R Q;  1ET9 A;  2A69 D;  5DAU A;  3FKI G;  1EHI A;  2F0L A;  2ZJP A;  3GTL A;  2QK4 A;  3RUP A;  1IW7 C;  4DK1 A;  3KAL A;  1K9M C;  2W6P A;  1CQF A;  5C5M A;  4IFD J;  1F9S A;  1O80 A;  4AH6 A;  2ASD A;  5E1F A;  1HZ9 A;  2JA5 A;  1PH7 A;  1O7I A;  1IBK L;  2LY7 A;  3CQZ H;  1WTP A;  2D5D A;  2MO1 A;  1EQV A;  4ED2 A;  1RHP A;  2UUB Q;  2HCI A;  2A73 B;  3VPC A;  4KHV A;  1L1O C;  2CKZ B;  4C3J G;  1SEI A;  2K5D A;  4MN3 A;  4DUY L;  4DU9 A;  2EY1 A;  4F8M A;  2C35 B;  1E4E A;  1DIK A;  2GN5 A;  4JI5 L;  3H4D A;  2XC9 A;  1VQN A;  4UPA A;  4XIG S;  1EY0 A;  1IBM Q;  3TDQ A;  2MFI A;  1CS0 A;  3Q2O A;  3RD4 A;  1PH4 A;  1HNX L;  3KHL A;  3GD7 A;  4JI2 L;  1TR5 A;  3S24 A;  1VCI A;  1SEB D;  2F4V Q;  4A3M H;  1PTO C;  3ND8 A;  3HOX H;  1B33 N;  2ALZ A;  1DZ1 A;  2R8I A;  1K8G A;  4PZ8 A;  5C0X H;  1YI2 A;  5BPH A;  3G7L A;  4FU0 A;  5LMN L;  2L5T A;  1ASY A;  4JI1 H;  5ISR A;  5JJI A;  2HD3 A;  5GAG C;  2CW7 A;  1PTO H;  2ZM6 H;  2UUC H;  1RDP D;  3Q6S A;  4C2M H;  2AGO A;  3E0J A;  3QO2 A;  4ODG A;  1GOZ A;  2XCL A;  4B3T L;  2Y0S E;  4A3G G;  1J5E H;  2X6G A;  3K80 C;  2UUA Q;  1GSO A;  4A3D B;  1B70 B;  3F2B A;  4V0B A;  4O4L F;  4LF7 L;  4A3K B;  1MGS A;  1TWA B;  1VQG A;  5KT3 A;  3HOW B;  4A3C H;  4QB4 A;  3HOU B;  4R4T A;  1IZ6 A;  4BBR G;  4LUO A;  1MHW C;  1LYL A;  5IT9 c;  1GUN A;  5IP9 H;  4DV2 H;  1UE6 A;  3TP7 A;  1WCM B;  2Q8I B;  3Q22 A;  2CWP A;  4FBU A;  2UVW A;  5I6W A;  2A6H C;  4RB3 C;  4LF4 Q;  2JJQ A;  3MWY W;  3TIN A;  5EWF A;  2RCN A;  3LNN A;  5FD5 A;  2MGS A;  1ASZ A;  4DR3 L;  3D4R A;  2H4O A;  1WTW A;  1NCV A;  1TWC A;  3SE0 A;  4DNI A;  4PMB A;  4KY7 A;  3NQT A;  4TSS A;  1Z47 A;  4A3J H;  5JUM A;  1PH2 A;  2PMZ E;  2A69 C;  3KF6 A;  5C4H A;  4BXX H;  3MXU A;  1IOW A;  2RGV A;  3JRX A;  1EUJ A;  5DGA A;  2CVR A;  2PZU A;  3E3X A;  5C4J H;  3Q24 A;  4A3B G;  3GV7 B;  3OWF A;  5C5L A;  2EVB A;  1QVC A;  2FB9 A;  2VL6 A;  2O2L D;  2R7D A;  1RK5 A;  2K5V A;  1HNX H;  1I6H H;  2VA3 A;  2H5X A;  4KJO A;  1X54 A;  1BJT A;  2ASJ A;  4Y7N H;  1VQJ A;  2ASL A;  1EY5 A;  3GTJ A;  1Y8P B;  3HKZ G;  5I2Y A;  4DR7 L;  1QOH A;  3RR5 A;  2UVR A;  2K32 A;  4IPD A;  2F0E A;  3A74 A;  3J7A V;  2Z4I A;  4IJH A;  2UXD L;  3V96 A;  2UVV A;  3K7A B;  3A0J A;  2RSN A;  3SVM A;  1PVO A;  2EY6 A;  1WFQ A;  1EEI D;  4GNX B;  1EY4 A;  2YTV A;  2B63 B;  1HQR D;  1UE7 A;  3EPI A;  5L9X A;  4QCL A;  1KTK A;  1PFM A;  2ZTD A;  3JAM c;  1HXY D;  1WTX A;  1OXV A;  1N33 L;  4C5A A;  4RZR A;  3CKI B;  3FKI A;  1II3 A;  1A8V A;  1D7Q A;  1JXL A;  1CZW A;  4ECZ A;  1TWG H;  4EEQ A;  5IP7 G;  4A93 G;  2PVP A;  4UCO A;  5A2Q L;  1W6K A;  1OXU A;  1MIU A;  4OHJ A;  4H13 C;  4LF9 H;  2R8G A;  3S17 B;  3ETH A;  5K36 G;  4ECS A;  2SEB D;  3VR6 A;  3PIO 3;  4RU9 A;  4LK1 C;  3TSS A;  1B9M A;  2QKI C;  2UU9 Q;  4AQY L;  3EYY A;  3BAB A;  2K5N A;  3I4N G;  4Q0Y A;  4OO1 H;  1A6X A;  2OWO A;  3Q1K A;  3GDE A;  1F9R A;  2YU9 B;  2OTJ A;  3K5L A;  2NN6 H;  1DV1 A;  5DG8 A;  1Z2O X;  3AFP A;  2JA6 A;  2F0M A;  2J6S A;  3A5Z B;  3VYS A;  2WV6 D;  4YIJ A;  3NBH B;  1DON A;  1UC9 A;  3JSL A;  3KJP A;  5ELD A;  3FPP A;  4JI3 Q;  4IAL A;  5IYC H;  4O3R A;  2PQA A;  4A3E B;  3K5M A;  4GZY C;  2AWN A;  2HVS A;  4TVA B;  3U9S A;  5DM6 3;  4LFA H;  5M5Y H;  2M05 A;  2I5H A;  3LML A;  4C3H H;  2JA8 B;  2V5A A;  4HNU A;  4ZK9 B;  1SN8 A;  4MTN A;  2YYZ A;  5KNB A;  4LFC Q;  2AWO A;  3L2P A;  1MD2 D;  2EPB A;  3DMU A;  4B3M H;  1CI3 M;  4B3R L;  2WTF A;  4RGN A;  5EJW A;  1G29 1;  4LSX A;  1S5D D;  5JJZ A;  3WNZ A;  1FGU A;  1MZB A;  4DUZ H;  1S40 A;  3MWD A;  2NVY B;  2ZDG A;  2PO4 A;  5EPK A;  3PF5 A;  1LV9 A;  1C48 A;  1MJE A;  2W70 A;  4B3S H;  1AW7 A;  4DV4 L;  2E2I H;  2CZG A;  1PFN A;  3HOY H;  2K04 A;  2I80 A;  3QZ8 A;  1S5C D;  1VQH A;  3EQL C;  1YNJ D;  5CV7 A;  3I2Z A;  3PW0 A;  1IBL H;  2UUB L;  4NXM Q;  1Q12 A;  3M4I A;  1DXM A;  2R8K A;  4J9R A;  2DPI A;  3MXP A;  1XTC D;  1LTR D;  1I5F A;  3IKJ A;  1RK6 A;  2NZO A;  3OW2 A;  2F0O A;  1D2B A;  4LUV A;  2IT1 A;  1LUZ A;  4POG A;  3ZYY X;  4J8Q A;  4LMQ D;  4OWW B;  1OXX K;  1IBM L;  4DR2 Q;  3GTO H;  1QIL A;  3RBE A;  3DUZ A;  2F4V L;  4MV6 A;  2W6Q A;  4BY7 B;  1VQL A;  2K75 A;  2HGS A;  4YWL A;  4A3D G;  5KX5 F;  2EJM A;  3TP6 A;  5KG2 A;  2A8V A;  5CV6 A;  1HNZ Q;  3NUC A;  3TEH B;  3HOW G;  1O7Z A;  1EUD B;  5DQI A;  3HOU G;  1QNK A;  1S0M A;  4ED1 A;  3GIM A;  1BXT A;  1U9R A;  3L0O A;  5JAV A;  2K28 A;  3HKZ A;  1ENC A;  4HNV A;  1WCM G;  3KTM A;  4I50 F;  3MR3 A;  2R92 A;  2I8C A;  3Q8P B;  1E22 A;  3PIO A;  2R85 A;  3CCL A;  2V4Q A;  3BDO A;  4MV7 A;  3G6X A;  3CCJ A;  4YCW A;  3I56 A;  4C3I H;  3RZD B;  2WB1 A;  2X0S A;  2RDG A;  2D9U A;  1IYV A;  4O4I F;  3KJO A;  1K28 A;  4DV7 H;  1EFI D;  2ALY B;  4BA1 I;  5JOB A;  3U9T A;  4G7H C;  4EQN A;  4JW0 A;  3I90 A;  5BR8 L;  5CBA E;  3GTL B;  3AYH B;  3NTH A;  4MV9 A;  4TQR A;  3RNU A;  2L1B A;  4UCT A;  4ILW A;  1VBH A;  1GKH A;  1ICF B;  4J6H A;  2DIK A;  1XMO H;  4LF5 H;  4LF4 L;  1DYQ A;  3HOV B;  1NTG A;  5EBC A;  5KFW A;  2JA5 B;  3S1R H;  2EE1 A;  5A35 A;  3M4P A;  2RA4 A;  4IRK A;  2CWA A;  1U4P A;  1KEE A;  2ZJQ A;  3O13 A;  1ZXT A;  5KFL A;  4DV4 H;  2WKC A;  1WR2 A;  3K3P A;  3BZD B;  2FK1 A;  3NSW A;  2HQE A;  1BCP D;  4F4W A;  2ENB A;  1SRO A;  2VZA A;  3JZI A;  4O3S A;  1BVS A;  3H4B A;  2HCC A;  4ECX A;  3PO3 B;  1Y1V A;  1TWH H;  1ZQ7 A;  3ETJ A;  1JQY D;  2WKD A;  4LAA A;  2QW7 A;  4O2A F;  1B1Z A;  1JKJ B;  1PYB A;  3J80 i;  2TSS A;  2GPS A;  3VYT A;  3N43 B;  4H7B A;  3M7N A;  2LXK A;  1I7L A;  1UEB A;  2VR1 A;  4DL2 A;  1YNJ C;  2A6E D;  3I4O A;  3MFY A;  3GTK A;  4J9Q A;  4L6T B;  4JI7 Q;  3NEM A;  3KAK A;  4ZUI A;  5I2X A;  2F0Q A;  2Q8R E;  4DV5 H;  1UAP A;  2BH2 A;  1BQQ T;  4CGY B;  4O3O A;  2PCF B;  3M85 A;  1LTA D;  4FBT A;  1FNV A;  5G3L D;  4RKB A;  4MV3 A;  2MO0 A;  2FK3 A;  4GKK H;  1SYC A;  1VQB A;  2OQK A;  3G71 A;  4JI4 L;  2EZV A;  5ELB A;  4V19 0;  2Y0S A;  3GIP A;  4GKJ H;  3PMF A;  3CP0 A;  3G6J B;  1TS4 A;  5EWE A;  2D0P A;  4FF3 A;  2Z8L A;  4ED0 A;  3K6O A;  3D3R A;  1BR9 A;  2HUG A;  3AB9 A;  2N78 A;  4LW1 A;  4R8U B;  1EZ1 A;  4DV6 H;  2Z1C A;  4X64 L;  2C00 A;  1HPC A;  3FRP B;  2G9D A;  1M6V A;  3A8I E;  3S16 B;  3V4Z A;  3J81 W;  4J0M A;  2E8G A;  3FKI H;  1D1I A;  2PPB C;  3S1M B;  4YR0 A;  4MZ9 A;  2JEA I;  1KAW A;  2QEJ C;  3H09 A;  5CV9 A;  1YHQ A;  1CKN A;  3MXG A;  3BZK A;  5BN5 A;  2PZT A;  4LF8 L;  4G7O C;  1D5Z C;  2DWC A;  2L4N A;  2R93 A;  2E5L L;  3S2D B;  1KC7 A;  1D5M C;  3I72 A;  3QIA A;  4A3E G;  5HUR A;  1RTO A;  1NY4 A;  2UVU A;  1JJG A;  3C46 A;  3IRB A;  4TV8 F;  2NWG A;  1SJH D;  1A62 A;  5TSS A;  4IZO A;  4PV1 C;  2XGP A;  3KHH A;  4NLG A;  4C3J H;  1M0T A;  2BCO A;  2RDJ A;  2YRX A;  2L0C A;  2JA8 G;  3KF6 B;  2PMZ A;  1GUO A;  2RSO A;  2F0W A;  4QMG A;  3RN5 A;  4N9T A;  4KHP H;  1RD9 D;  2RF4 A;  3UE0 A;  2ZJT A;  3U4V A;  4DR5 H;  3TP8 A;  3P7J A;  3G6Y A;  4JI3 L;  2A68 D;  2KCC A;  2F0N A;  3GTP H;  1V1P B;  1TWA A;  1PRT C;  2DNE A;  1AZP A;  1N36 Q;  5C3W A;  5C44 B;  2W7O A;  1DJR D;  2HIX A;  1HNW H;  4NKL A;  1HCZ A;  3AFQ A;  1H9K A;  2RDF A;  4DNT B;  4XXE A;  2JEJ A;  1BCP C;  3J80 L;  1P8L A;  4LFC L;  1G2S A;  4RFB A;  2FPG B;  4GOP A;  4X66 L;  1HZA A;  1XMQ Q;  2P0A A;  1I6U A;  2J0T D;  4C56 C;  5C0X J;  1N34 H;  4UCU A;  3BZC A;  2R7L A;  4A3G H;  4A3F B;  1TU2 B;  4IPH A;  3U4Z A;  2MUY A;  4DR4 H;  3HXL A;  1IL8 A;  2A6E C;  4RH6 A;  3BYY B;  5KFE A;  3CRL C;  4BY7 G;  3L4K A;  1S4Z A;  4XQN A;  4HMJ A;  1JOO A;  2YS7 A;  1NNX A;  1QCB D;  3VPD A;  4BBR H;  3G6E A;  4NXM L;  4EBE A;  5GAH C;  1X3G A;  2QIL A;  3FDS A;  5L37 A;  3K5N A;  1G51 A;  3SK8 A;  1SLJ A;  2UXC H;  4ZCK A;  3IG0 A;  3MWE A;  1Z6H A;  2L55 A;  2MJ8 A;  3E5N A;  3T5J A;  4DA2 A;  4DR2 L;  2E5L H;  3H20 A;  1X3F A;  4K6D A;  4IHJ F;  2VQF H;  3MJF A;  3CW2 C;  4BWS C;  1HHV A;  2YZN A;  4DV3 Q;  1XNR H;  4DAP A;  4OWT B;  4JC0 A;  2R6F A;  1GHJ A;  1OXS C;  4G7Z C;  4IOC A;  2JA6 B;  1C8C A;  2B63 A;  1X32 A;  3H0G B;  2OF1 A;  1HNZ L;  4QWA A;  4CJ2 C;  5KFA A;  3HS0 C;  4J9S A;  4A3B H;  1ZHQ A;  5ELF A;  5E4W C;  2ASB A;  1SNQ A;  3K3V A;  2FPP B;  2HVQ A;  1ULZ A;  3MA2 B;  1TS3 A;  1DCZ A;  2PQA B;  3CCV A;  5KFN A;  3RZO H;  4JV5 Q;  5JEA G;  1VQK A;  1KJQ A;  3MC0 B;  1PX2 A;  4FNF A;  4M9U A;  4L8J A;  3HOV G;  1TVX A;  2JA5 G;  1EYZ A;  1TII D;  1U5K A;  4DF7 A;  5JQW A;  4HJ7 A;  4FDB A;  1IYU A;  5FLX E;  3ULP A;  1PYS B;  3IAY A;  2I5L X;  1PTO F;  3S1N B;  1RJR A;  4QIW E;  3TZU A;  1AUX A;  4X66 H;  1LT6 D;  3PO2 B;  2V59 A;  3GTM H;  2XWB B;  2A68 C;  1DOK A;  2BA0 A;  4IJL A;  4YCU A;  5EZY F;  1VMP A;  2YU9 A;  1K0R A;  2PW5 A;  4B08 A;  4ZYS A;  2PBZ A;  2LFN A;  4YQW A;  4ECT A;  1EZ8 A;  4CDC C;  4DR1 L;  1B9N A;  1T5E A;  1UE5 A;  1SBB B;  4P73 A;  2N3S A;  4JI8 L;  4PZ6 A;  1SFO H;  3NBH A;  4BWG B;  5IP7 H;  4A93 H;  3G4S A;  5LMU Q;  1F77 A;  4GLX A;  3T13 A;  2ZXR A;  1FGB D;  5FLM G;  1ZET A;  2B2U A;  4LJZ C;  5K36 H;  1HJP A;  3GTQ H;  4EYH B;  2A19 A;  2KEE A;  3NEL A;  3CHB D;  1X6O A;  2MPM A;  4GN5 A;  3CCR A;  2Q2U A;  3NWT A;  4RG1 A;  3I4N H;  4POF A;  5IWA Q;  4QJF A;  4K8I A;  1PH1 A;  1N56 A;  2BR0 A;  4JPB W;  1HFN A;  1I50 B;  1LT4 D;  1QE6 A;  3KLR A;  4QF4 A;  1E4G T;  4JUZ A;  3KK7 A;  3M4Q A;  5ELE A;  4JI7 L;  1GM5 A;  1PMR A;  2F0S A;  5CV4 A;  1A2T A;  2W6Z A;  2PYK A;  2NVY A;  5IYD G;  4WOR A;  2VQE Q;  1BBX C;  4LFB Q;  1B2T A;  1BNC A;  1YJN A;  3MVV A;  5L1I A;  1KAB A;  4XYQ A;  2R92 B;  4HNT A;  2PNR C;  4NXN Q;  4PQX A;  4R4Q A;  1HR0 Q;  3HP3 A;  1G8Z D;  5LL6 S;  2WB1 B;  4JV0 A;  2XCP A;  1CHQ D;  1XWE A;  3H91 A;  3T1H H;  2DJG C;  1RYS A;  2VUM A;  4ID6 A;  2SNS A;  1MSG A;  1X3Q A;  4E4T A;  4PNY A;  4DV0 Q;  3DM3 A;  4I7A A;  5KT5 A;  3G8C A;  4NMZ A;  3UDG A;  1K1S A;  1F2Z A;  5KEE A;  3HEJ A;  4K5X A;  3VA5 A;  4MNO A;  2KUM A;  3MFH A;  2CQY A;  2H1E A;  4O0A A;  4HQ6 A;  3WOF A;  1MKH A;  2BH8 A;  3CPF A;  4ZHQ F;  4DR1 H;  3V6J A;  3PSI A;  3BQ1 A;  5K5P A;  1EY9 A;  4OEM B;  5C44 G;  3HOZ B;  2K05 A;  2QA4 A;  1CA5 A;  4JI8 H;  3BVM A;  4RB1 A;  1FKA H;  4GN4 B;  3M9O B;  1BNZ A;  4RGM A;  3CPW A;  4X3U A;  3MFG A;  5JEA J;  4DGZ A;  2K5H A;  3S14 B;  2G9H D;  5JPN C;  2VNU D;  5LMN W;  2B39 A;  5IT9 E;  2W71 A;  1NSN S;  4OX9 Q;  3STB C;  4FXK C;  5I47 A;  4KMU C;  1EY7 A;  2YTY A;  4A3F G;  5LL6 b;  4ED8 A;  5CV8 A;  2Z4H A;  3RGX A;  2DY7 A;  3L3O C;  5M3M B;  3AMU A;  4L5R C;  1TWF A;  2R6G A;  5C1P A;  1XNQ H;  4A3D H;  1N36 L;  4H44 C;  2IPK D;  1B44 D;  5ELC A;  3GTK B;  2GLT A;  5HV6 A;  1PH9 A;  1HRJ A;  2F0V A;  1TWA H;  3BJY A;  1RJQ A;  3HOW H;  1TAE A;  3VYU A;  1GLV A;  4HED A;  4GOP C;  3HOU H;  2F3I A;  4ABN A;  1ONL A;  2I46 A;  4XT1 B;  1XMQ L;  1K3B C;  3E9I A;  4HJ5 A;  4HCS A;  1WCM H;  4IQZ A;  2EYO A;  2Y0S B;  4BY1 B;  1JE4 A;  3H94 A;  3Q8S B;  1EYC A;  1S9F A;  1RCV D;  3ER0 A;  3ZJY C;  4A3L G;  1K83 A;  5KRU A;  4DK3 C;  4Q45 A;  2N49 A;  3T1Y Q;  1VQA A;  1K73 C;  3BQ0 A;  2ICE C;  2IP4 A;  3CU7 A;  3OHX C;  1VQ7 A;  3TZD A;  3RLF A;  5C3E B;  2YZM A;  4RNM A;  5C3X A;  4ZQ3 A;  2ID0 A;  1I94 H;  2JA6 G;  1XX8 A;  1I3Q A;  1H9S A;  1CKN B;  2VB2 X;  1UNS A;  4DL7 A;  4IUP A;  5LYJ F;  1PH3 A;  2R93 B;  4YY3 Q;  3HG9 A;  3FHW A;  2CCZ A;  4MV1 A;  5LXT F;  3RAQ A;  1NAP A;  4RAZ A;  4P71 A;  4XYO A;  1OXT A;  5EPJ A;  1STE A;  1MI2 A;  1YZ6 A;  4JYA H;  2RHS B;  3JAM E;  4NW2 A;  4GNX C;  4EG0 A;  1A2U A;  4EFB A;  1HA5 A;  2AKW B;  1JIC A;  2PMZ B;  4X62 L;  4MTE A;  4X65 Q;  3BQ2 A;  1XPR A;  1SAP A;  1KDC A;  3W1B A;  2KOL A;  1RF2 D;  4JK1 C;  3PO2 G;  1X65 A;  4R8U A;  5K2M A;  3WO0 A;  3OTO H;  5M3F B;  2E2J B;  2CHB D;  3H15 A;  1OTC A;  1JMC A;  3I55 A;  4IZ8 A;  1LAB A;  3BDC A;  4JBM A;  2UXB H;  4CHT B;  1HZB A;  4HJ9 A;  4JBW A;  4LH7 A;  4GKJ Q;  4KKT A;  1RTN A;  5FO7 B;  4DK0 A;  1FJG Q;  1IOV A;  4GLV B;  2R7Z A;  1I4H A;  4GOP B;  4ZRZ A;  2EYP A;  4MA0 A;  4QW8 A;  3S17 H;  1O7Y A;  1ROD A;  2K14 A;  1PFB A;  5IGE A;  3VR5 A;  3RLN A;  1IBK H;  2F0J A;  5A2Q W;  2PN1 A;  1I4P A;  5KFS A;  3LP8 A;  4WBN F;  3TQY A;  4TUY F;  3E9H A;  4F88 A;  3Q23 A;  1QJO A;  4K6L A;  2NU8 B;  5KFM A;  3N6X A;  4ZQI A;  1L0W A;  4DUY H;  4YB8 B;  1YNN D;  3LWE A;  4EX5 A;  1NBW A;  5FK9 C;  1VBG A;  4JI5 H;  2M00 A;  3CCU A;  4HJ8 A;  5LL6 X;  5LMU L;  1CT1 D;  2B2U C;  3J81 c;  1QNU A;  2YW2 A;  4ECW A;  1VQO A;  4JI2 H;  1V1P A;  2JN4 A;  4TQS A;  1SMY D;  1STA A;  4QWE A;  5GQO A;  3RB0 A;  2F0G A;  3U9O A;  2OLS A;  1H9R A;  2Z6K A;  1X56 A;  1K8O A;  4KN4 C;  4A3E H;  2R92 G;  5BPF A;  1LTG D;  2KEN A;  3PUW A;  5IOD A;  3HB9 A;  5LMN H;  4DN4 M;  1V9P A;  5KG4 A;  1KD1 C;  5IWA L;  3F2D A;  2NVT H;  4A3M B;  2P5Z X;  4O42 A;  4JI6 Q;  2WB1 G;  1EWC A;  3RB4 A;  2JA8 H;  3PW5 A;  4P2C B;  1EY6 A;  2XVS A;  4ECR A;  2QDL A;  1ENA A;  1LTI D;  5KT7 A;  4DR6 L;  4Y52 H;  4HCE A;  3KYH C;  4N8F A;  2CW8 A;  1EIF A;  2KBN A;  4B3T H;  1WD1 A;  3J7Y W;  1LTB D;  3K81 C;  2VQE L;  4LFB L;  3IN5 A;  5HY6 A;  4C2M B;  1KLG D;  1CSP A;  2DNC A;  3K7U C;  2PNH A;  4LF7 H;  2R7F A;  1H9J A;  3RUZ A;  1SCU B;  3I7F A;  1HR0 L;  1KNE A;  1X3E A;  1JDB B;  5FOB B;  5LOV F;  1PH8 A;  3OSP A;  5IYB G;  4AYB E;  3HOZ G;  4TKO B;  2E75 C;  1KHI A;  5M5X B;  4DV0 L;  5CAE B;  4MTK A;  1ZKO A;  4QIW A;  2B8G A;  5IYZ F;  4FXD A;  1F2L A;  4ZI7 F;  4Q8F A;  3BU2 A;  1QB5 D;  2EDG A;  5LP6 F;  1Y1V G;  4IAJ A;  5C1O A;  1EYA A;  1QG7 A;  1V1O A;  2B8F A;  4EVO A;  1JR0 D;  4DR3 H;  3EVQ A;  4CJ0 B;  2IY5 B;  4BY7 H;  1JE5 A;  3H0G A;  3PUV A;  2IX1 A;  3M9N B;  1SNP A;  1MBY A;  4CJ1 B;  1JDE A;  4XDX A;  2LSS A;  4YJ3 F;  1Y8N B;  5T1I A;  1LO5 D;  4WFN 3;  4JI0 Q;  1GUW A;  2HJW A;  4IFD I;  1YJ9 A;  1S5B D;  4HSP A;  5IGG A;  4Y8V B;  5F9L A;  3M4O B;  2OEO A;  3CD6 A;  2K7V A;  4OON A;  2WII B;  1B7Y B;  1LM0 A;  4DL4 A;  2FLL A;  3SK6 A;  3T5H A;  2SDF A;  4OX9 L;  1N32 Q;  1BXR A;  2Y0S G;  4UCS A;  4BY1 G;  5KG3 A;  5KFC A;  1EWH A;  5KT6 A;  4DR7 H;  1EYD A;  5KT4 A;  2YZG A;  5KFX A;  4ME5 A;  2UXD H;  2NZ1 D;  3C2P A;  1YNN C;  2F0U A;  1SE3 A;  4M8A A;  5KFU A;  3ICE A;  4Y7N B;  2HDM A;  4ZKC B;  1UUP A;  4IOA A;  3HZX A;  4APM A;  4HIM A;  4S3S A;  5C3E G;  1SMY C;  2W8K A;  1HZC A;  3KOJ A;  3GTL H;  4DR6 H;  4HMI A;  2WFW A;  5JEA H;  3SXH A;  1KJ8 A;  1XPU A;  1Q46 A;  1D5X C;  2R93 G;  1N33 H;  4LF6 Q;  1B6S A;  1SDF A;  2GVB A;  3HOV H;  2YS6 A;  2JA5 H;  3SI8 A;  2AU0 A;  2VUM B;  4ZUJ A;  3T1Y L;  4I7H A;  3KHG A;  2RKS A;  4B9W A;  3OUU A;  1PRT F;  1EU3 A;  1Q90 A;  4EQP A;  4GLA C;  2YYA A;  2B2T A;  4QQB X;  4CC6 A;  1DV2 A;  1BOS A;  1YIJ A;  5IGB A;  4EBC A;  2BDN A;  4AQY H;  4Q0F A;  3BJU A;  4QGU A;  2F4I A;  4YY3 L;  5F2D A;  1S0O A;  1SND A;  1GGO A;  3GQB A;  4YAK B;  1I50 A;  3TME A;  4K0K Q;  4A3K G;  3D4D A;  2F0F A;  5M3F G;  5D8D A;  4EGQ A;  1JX4 A;  1GUG A;  4JBJ A;  1B3A A;  3MTS A;  5COR A;  2V1C C;  1OO9 B;  3MEF A;  5CGK A;  2FLN A;  5FLM H;  2F0I A;  4WJ3 M;  2JXM B;  4X65 L;  2PZW A;  1SYG A;  2W9B B;  1BKB A;  2Z0S A;  3PF4 A;  5KFK A;  1SNC A;  2KED A;  2WAQ E;  5D1P A;  4O3P A;  4F7X A;  5NUC A;  2UUA L;  3R2I A;  2EJF C;  5J2U F;  4DL6 A;  3AQQ A;  3UDF A;  4OIK A;  1TWF B;  3A55 A;  1K8A C;  2JEB I;  4A3I B;  5JVD F;  3RMH A;  1S68 A;  4OWX B;  5M5Y B;  1Q1E A;  4DV1 Q;  4B3R H;  2EYF A;  4BS9 A;  3D4W A;  4RGT A;  1TY0 A;  3Q8R B;  3OSO A;  1FJG L;  3S16 H;  1F9Q A;  2RDH A;  1NE3 A;  1IYJ B;  3CMA A;  2CH4 A;  1PA6 A;  3S1M H;  2J9G A;  3CCS A;  1PZK D;  2KEC A;  5FLX L;  1U4M A;  4U68 A;  2FXQ A;  2L12 A;  1Q81 C;  2HHH Q;  3BG5 A;  1K83 B;  2F3V A;  3S2D H;  2NVX A;  1LTT D;  1STN A;  2E74 C;  2C5C A;  1KJI A;  3V4S A;  4J9K A;  3NTK A;  2UUB H;  1AP0 A;  3LWU A;  1SXT A;  3HOY B;  2D2C C;  1TWC H;  5EKI A;  3VMM A;  4FF4 A;  2RCF A;  5KFH A;  4YHH Q;  4A3M G;  4XQQ A;  5KFB A;  2ZT9 C;  2FMA A;  4UDU C;  5HGT A;  1M8A A;  2VY3 A;  3HRZ C;  4RWS C;  1EYG A;  2B63 G;  5KFG A;  1I3Q B;  1H9S B;  1IBM H;  4RGO S;  5CYU A;  4KY6 A;  5DGB A;  1E7Z A;  2IHE A;  5DQH A;  4EBD A;  4O1N A;  4P74 A;  1SSO A;  4FF2 A;  2F4V H;  4RAY A;  3MXN A;  2Q2T A;  2LXJ A;  1B04 A;  1C0A A;  2QYZ A;  5KYL A;  3RJ0 A;  3I4L A;  4L5S A;  5D1O A;  3GTO B;  4UP7 A;  2W7P A;  5C44 H;  3GTJ H;  3QOJ A;  4GN3 B;  3Q0A A;  1WTH A;  1VF5 C;  5KFD A;  3F2U A;  5D3I B;  2A1A A;  2F52 A;  2E2H A;  5KFT A;  4JI6 L;  4IR9 A;  1RYR A;  3T5K A;  1NR4 A;  4C5B A;  3UI2 A;  3UFX B;  1EIY B;  1B53 A;  2WP8 J;  3S15 B;  5J22 A;  3JSN A;  1AE3 A;  1ICW A;  4IWY A;  3GV5 B;  5FO8 B;  4ZOL F;  3T16 A;  2MCT A;  3J80 W;  3QB3 A;  3RAX A;  3TIG A;  1S10 A;  2RGR A;  4QUF A;  4K5V A;  4A3F H;  4DK6 C;  4DPG A;  1Z7T A;  2JSO A;  3NK9 A;  1W2B A;  2HDL A;  3Q8D A;  1Q7Y C;  4P72 A;  3CCM A;  1VQD A;  4E6I A;  5BR8 H;  2Q2H A;  1RJP A;  5KFV A;  3QR8 A;  2R7Z B;  2FPI B;  4KK7 A;  1C30 A;  2J6T A;  4L5T A;  4KKS A;  1Q8K A;  1ENF A;  4LF4 H;  2UU9 L;  1VQE A;  4WJW A;  5I6Y A;  2FK2 A;  3TII A;  4YWK A;  4YP3 A;  2B2V A;  3ORQ A;  4C1N K;  1CUK A;  3EFX D;  4A3L H;  2ATL A;  3OIP A;  2EYM A;  3JAM i;  2EY2 A;  1CA6 A;  3C0F B;  3I4M B;  1Y1W A;  1EEF D;  5J3B A;  5CV5 A;  5GRO A;  4JI1 Q;  2JA6 H;  1VKZ A;  2ZM6 Q;  2UUC Q;  1WTQ A;  5LHY 1;  4JI0 L;  4JYA Q;  4J9M A;  3TS0 A;  1BGW A;  2K1B A;  1S3O A;  4DAM A;  3PZP A;  1UEA B;  1WSC A;  1J5E Q;  3RF2 A;  2O5J C;  2HIV A;  5IT9 L;  5JVH 3;  1N32 L;  1WH2 A;  2TMP A;  1ZHS A;  3GQC A;  2XRQ D;  1WTR A;  1DOM A;  1UC8 A;  4J9P A;  1R9T A;  2QGQ A;  4CC5 A;  4LSA A;  2VUM G;  3RBD A;  1W3S A;  3SR1 A;  4JCV E;  2GPW A;  1ZYR D;  3R2T A;  1L0Y B;  3GV6 A;  3NBI A;  2K52 A;  4JI4 H;  4J9L A;  3DEO A;  3S1N H;  4DV2 Q;  5DLF A;  2F0P A;  4FP5 D;  5EBD A;  1GD7 A;  4DXF A;  3PO2 H;  1QUQ B;  3H3V I;  3MZ5 A;  3S2H B;  2AUK A;  2KCN A;  4BBS B;  4ED6 A;  1X55 A;  3KLS X;  2SCU B;  3CQZ A;  4LF6 L;  1D6E C;  1M7J A;  4MA5 A;  4X64 H;  3ULL A;  3K57 A;  4PG3 A;  4LMY A;  3M3Y B;  2K6A A;  1EFW A;  4P75 A;  4ME6 A;  2MHV A;  3D6W A;  1GSH A;  1TKW B;  2NZH A;  1CKM A;  2B2T C;  5H1S E;  1YEZ A;  4LF8 H;  4QIW B;  4QY7 A;  2XWJ B;  5M5W B;  1L1O A;  2AGQ A;  2W9A A;  4IUV A;  3S1Q B;  4EFE A;  4JI5 Q;  4JOI A;  2K50 A;  3GV8 B; 
#chains in the Genus database with same CATH homology
 2YTY A;  4A3F G;  1HNX Q;  2ZTD A;  3JAM c;  4TQU S;  1OXV A;  1PV4 A;  1YBY A;  4L5R C;  2R6G A;  3HOX G;  3UDX A;  1N8R C;  1N33 L;  4A3D H;  1YNX A;  1N36 L;  1D7Q A;  1A8V A;  2CQO A;  5C0X G;  4DR1 Q;  3U58 A;  1PH9 A;  4KLK A;  1X9N A;  4A3I G;  3I4M H;  1TWG H;  1TWA H;  5IP7 G;  1I50 H;  4A93 G;  3HOW H;  3PV0 A;  4JI8 Q;  2KCT A;  1OXU A;  4GS3 A;  4GOP C;  3HOU H;  2F3I A;  1MIU A;  2Z6K C;  3I4N H;  1XMQ L;  3E9I A;  5K36 G;  2OQ0 A;  4HJ5 A;  1B8A A;  3UDI A;  1WCM H;  4KHP L;  1A0I A;  1V43 A;  4DR5 L;  3TRZ A;  2UU9 Q;  1WI5 A;  3ER0 A;  3ZJY C;  4AQY L;  2R92 H;  1E1O A;  4A3L G;  2K5N A;  4DK3 C;  3CME A;  2HQL A;  3I4N G;  4LUZ A;  3D0F A;  2N49 A;  3T1Y Q;  2OWO A;  3GDE A;  1VQA A;  1K73 C;  1XNQ Q;  2OTJ A;  1KRS A;  1VQ7 A;  4A3C G;  3AFP A;  3RLF A;  3HOY G;  4DV1 L;  1HNW L;  3KDF A;  3PO3 G;  2ID0 A;  3A5Z B;  2KHJ A;  3J81 i;  2JA6 G;  3NBH B;  3GO5 A;  1P16 A;  1VQM A;  5IP9 G;  4LF9 Q;  1CKN B;  3KJP A;  1IXR A;  2OCE A;  1PH3 A;  4YY3 Q;  1NJI C;  3FHW A;  5IYC H;  2CCZ A;  1SRU A;  4JI3 Q;  2PQA A;  1BBW A;  1N34 L;  1VS0 A;  4X6A H;  3S2H H;  4BBS H;  2AWN A;  4UP9 A;  4TVA B;  4P71 A;  4YCV A;  1Y14 B;  5M5Y H;  2EQS A;  1C7Y A;  2DUD A;  1KIX A;  2I5H A;  1OXT A;  4DR4 L;  1YZ6 A;  1JJC B;  1C9O A;  2RHS B;  4UP8 A;  4C3H H;  5IYB H;  4GNX C;  1SN8 A;  4MTN A;  2YYZ A;  4LFC Q;  3M3Y H;  2AKW B;  2AWO A;  3L2P A;  3HOZ H;  4A3J G;  5IY0 A;  4YHH L;  4X62 L;  2ATW A;  4BXX G;  4IFD G;  4X65 Q;  4AIM A;  1XPR A;  5FJ8 H;  4B3R L;  3W1B A;  1I94 Q;  1EWI A;  3U50 C;  1G29 1;  1H95 A;  1FGU A;  5M5W H;  1Y1V H;  3S14 H;  1S40 A;  1YVC A;  2ZJR A;  3PO2 G;  3S1Q H;  2UXC L;  1NMF A;  1X65 A;  3PF5 A;  1MJE A;  3ERS X;  4DV4 L;  2E2I H;  3H15 A;  3HOY H;  1OTC A;  1NMG A;  4HID A;  3I55 A;  1JMC A;  1IL2 A;  1VQH A;  4LFA Q;  4JBM A;  1HZB A;  1UE1 A;  4HJ9 A;  3H0G H;  3I2Z A;  3GTK H;  4JBW A;  4ME3 A;  2UUB L;  2VQF L;  4GKJ Q;  4NXM Q;  1Q12 A;  5EAY A;  1FJG Q;  1XNR L;  1GO3 E;  4GLV B;  4DR7 Q;  4QL5 A;  4GOP B;  1I5F A;  2VW9 A;  2NZO A;  3OW2 A;  2UXD Q;  2R7Z G;  4LUV A;  1N9W A;  1LUZ A;  2IT1 A;  4B3M Q;  4POG A;  3S17 H;  2YTX A;  4OWW B;  1OXX K;  2K14 A;  2GVA A;  1IBM L;  4DUZ Q;  3RLN A;  2BA1 A;  2PI2 E;  4DR2 Q;  2WAQ G;  3GTO H;  4BY1 H;  2F4V L;  1XTD A;  3TQY A;  3OTO Q;  3K0X A;  1VQL A;  3E9H A;  2ES2 A;  4B3S Q;  2K75 A;  4YWL A;  1VQ4 A;  4A3D G;  1L0W A;  3PIP A;  2UXB Q;  4EX5 A;  3B6Y A;  3I4M G;  1IBL Q;  1NBW A;  1HNZ Q;  2A8V A;  3CCU A;  3TEH B;  4HJ8 A;  3HOW G;  3AEV A;  5LMU L;  5C3E H;  3HOU G;  3J81 c;  1VQ5 A;  1VQO A;  3G48 A;  3L0O A;  4R1J A;  1JT8 A;  1RIP A;  5GQO A;  1WCM G;  1UWV A;  2JA9 A;  3K8A A;  2JA7 H;  2R93 H;  2I5M X;  2Z6K A;  1E22 A;  1X56 A;  3PUX A;  3PIO A;  4A3E H;  2CFM A;  1PH6 A;  1IBK Q;  2R92 G;  2KEN A;  3PUW A;  1DGS A;  3CCL A;  1SMX A;  1V9P A;  4OO1 G;  1KD1 C;  5IWA L;  3F2D A;  4YCW A;  3I56 A;  4C3I H;  3CCJ A;  2NVT H;  3KLW A;  1KXL A;  4UY8 C;  1WOC A;  4JI6 Q;  1VQ9 A;  2WB1 G;  4DUY Q;  5C0X I;  3KJO A;  2N8N A;  2NN6 G;  2JA8 H;  4IO9 A;  2I0Q A;  2ALY B;  4BA1 I;  4EQ5 A;  4DR6 L;  5BR8 L;  4Y52 H;  4JI1 L;  3KYH C;  3AYH B;  1EIF A;  2KBN A;  3RNU A;  2ZM6 L;  3K81 C;  4JI2 Q;  2VQE L;  4LFB L;  1E1T A;  5HY6 A;  1GKH A;  4K0K L;  5IYC G;  4LF4 L;  3MXN B;  1CSP A;  1NTG A;  5ELO A;  3K7U C;  5JJL A;  2PNH A;  2XTI A;  3S1R H;  4A3K H;  3M4P A;  4BBS G;  2R7F A;  5M3F H;  2E2J H;  2CWA A;  3I7F A;  1VQC A;  1HR0 L;  2D62 A;  2ZJQ A;  4DKA C;  1Q7Y C;  5LMN Q;  3UE1 A;  1M1K C;  1X3E A;  4ALP A;  1Q82 C;  4NPS A;  1PH8 A;  5IYB G;  2MQH A;  4AYB E;  2EXD A;  3PGZ A;  3HOZ G;  5GAD C;  1SRO A;  2VZA A;  4DV7 Q;  1BVS A;  1KHI A;  1PFS A;  4DV0 L;  3D31 A;  5FJ8 G;  2KHI A;  4GNX A;  1M90 C;  1FL0 A;  4X62 Q;  1TWH H;  3BU2 A;  4B3T Q;  1Y1V G;  3J81 j;  4DV2 L;  1PYB A;  3W1G A;  3J80 i;  1XMO Q;  1VQF A;  5AJ3 Q;  4LF5 Q;  3M9B A;  1VQ8 A;  2JK8 A;  2XGT A;  5DLQ E;  2LXK A;  3M7N A;  1UEB A;  2IX0 A;  4LF7 Q;  2IY5 B;  4BY7 H;  1JE5 A;  3I4O A;  4DV4 Q;  3PUV A;  4R4O A;  3H0G G;  4JI7 Q;  2IX1 A;  3NEM A;  3T1H L;  2LSS A;  2DGY A;  1VQP A;  4JI0 Q;  1U0L A;  1QZH A;  1D8L A;  4IFD I;  3W5O A;  1YJ9 A;  2BH2 A;  2HHH L;  3M85 A;  3H3V H;  4BA2 I;  1KQS A;  2Q2I A;  4JOI C;  2MO0 A;  4OON A;  3CD6 A;  1VQB A;  1B7Y B;  1LM0 A;  1FVI A;  2OQK A;  3G71 A;  4JI4 L;  3DLL A;  1T9H A;  3CP0 A;  4R4I A;  4OX9 L;  1N32 Q;  1Q1B A;  1BBU A;  2Y0S G;  4BY1 G;  3ULJ A;  2D0P A;  4DV3 L;  4DR3 Q;  2NVX H;  1XPO A;  1V1Q A;  2N78 A;  4J15 A;  2YV5 A;  4LW1 A;  3STB D;  3CC7 A;  3K7A H;  3VDY A;  1PHJ A;  3ICE A;  4X64 L;  1RL2 A;  1SE8 A;  5IE8 A;  5C4X H;  4LWC A;  4IOA A;  1E24 A;  2E8G A;  1CKO A;  3FKI H;  4JOI A;  4HIM A;  2B63 H;  5C3E G;  4DAY B;  4MZ9 A;  4DV5 Q;  1HZC A;  1KAW A;  2JEA I;  4JV5 L;  3KOJ A;  1YHQ A;  1CKN A;  3GTL H;  3BZK A;  4LF8 L;  2MNA A;  2ZTC A;  2WFW A;  5M3M H;  2E5L L;  4XTC S;  4GKK Q;  1XPU A;  1Q46 A;  2JA7 G;  4PMW A;  2R93 G;  4LF6 Q;  4PZ7 A;  1WJJ A;  2GVB A;  3HOV H;  4A3E G;  1NY4 A;  1JJG A;  2JA5 H;  1QVF A;  4NB3 A;  3IRB A;  1A62 A;  3T1Y L;  4C3J H;  1XNQ L;  4DV6 Q;  2JA8 G;  2IHF A;  3EN2 A;  3KF6 B;  3RN5 A;  2E2H H;  1HR0 W;  4GLA C;  4A76 A;  4QQB X;  3FP9 A;  3CXC A;  2RF4 A;  1L2F A;  3UE0 A;  5M5X H;  2ZTE A;  3U4V A;  2L15 A;  1YIJ A;  4LF9 L;  4RMF A;  2QEX A;  4DR6 Q;  5BR8 Q;  3BJU A;  4QGU A;  1JJ2 A;  4LNQ A;  4YY3 L;  4JI3 L;  3J80 c;  4IPG A;  3GTP H;  1VQI A;  1N33 Q;  2YU9 H;  3NEN A;  4K0K Q;  4A3K G;  1N36 Q;  1WYD A;  1HH2 P;  3CCQ A;  2HIX A;  5M3F G;  3AFQ A;  4OO1 I;  4JBJ A;  3HFZ B;  2V1C C;  1P8L A;  3MEF A;  4LFC L;  3CAM A;  5FLM H;  2NN6 I;  4GOP A;  2D0O A;  1HZA A;  3SGI A;  4X66 L;  1XMQ Q;  4WJ3 M;  4X65 L;  1L1O B;  5C0X J;  1AH9 A;  4KHP Q;  1I94 L;  1BKB A;  2Z0S A;  3PF4 A;  2WAQ E;  3BZC A;  4DR5 Q;  1KL9 A;  4A3G H;  1CSQ A;  2UUA L;  3M4O H;  4IPH A;  4AQY Q;  3U4Z A;  1K3R A;  1A63 A;  3AQQ A;  1EOV A;  3UDF A;  5GAE C;  1YHB A;  3OYY A;  1K8A C;  2JEB I;  3GTG H;  2NVQ H;  4BY7 G;  1MJC A;  4LFA L;  5FLX c;  4OWX B;  1HNW Q;  1Q1E A;  4DV1 Q;  1Y1W H;  2UUC L;  2RHQ B;  4JYA L;  4BBR H;  2HT1 A;  3G6E A;  4NXM L;  1G6P A;  5GAH C;  1KC8 C;  1X3G A;  3LGJ A;  1QUQ A;  1FJG L;  3J7Z C;  1IYJ B;  1NE3 A;  3CMA A;  3S16 H;  1G51 A;  3S1M H;  1PA6 A;  3HKS A;  1SLJ A;  2NVY H;  2AHO B;  3RN2 A;  3CCS A;  4NXN L;  1J5E L;  4B3M L;  3RLO A;  3HKZ E;  1N34 Q;  3EBE A;  2FXQ A;  4JBK A;  2VS1 A;  1Q81 C;  2HHH Q;  3F2C A;  3KFU A;  4DUZ L;  3E0E A;  4DR2 L;  3S2D H;  4H02 A;  1QZG A;  3PUZ A;  4JI4 Q;  3JC6 6;  1X3F A;  4DR4 Q;  1XJV A;  3OTO L;  4B3S L;  3CW2 C;  4APV A;  2WB1 E;  4DV3 Q;  1SR3 A;  4OWT B;  4JC0 A;  1TWC H;  2VUM H;  1OXS C;  1R9T H;  4YHH Q;  4IOC A;  4A3M G;  1JB7 A;  2UXB L;  1KRT A;  3KDF B;  5C4X G;  1IBL L;  4A4I A;  4B3R Q;  1HNZ L;  4X64 Q;  1GVP A;  2VY3 A;  3FKI G;  1EYG A;  2B63 G;  2ZJP A;  2K4K A;  4A3B H;  2ASB A;  1E7Z A;  2IHE A;  2UXC Q;  1K9M C;  4P74 A;  2PQA B;  3CCV A;  2KCM A;  3RZO H;  5JEA G;  1VQK A;  5M3M G;  4JV5 Q;  4IFD J;  3TRE A;  4L5Q A;  4AH6 A;  2LXJ A;  2Q2T A;  4LF8 Q;  1C0A A;  1HZ9 A;  1PH7 A;  1O7I A;  1IBK L;  4L5S A;  2E5L Q;  3HOV G;  3CQZ H;  4UP7 A;  2JA5 G;  2MO1 A;  5ELN A;  5C44 H;  2UUB Q;  1U5K A;  3GTJ H;  4GN3 B;  2VQF Q;  1L1O C;  2CKZ B;  4YWM A;  4HJ7 A;  2A1A A;  1XNR Q;  2OTL A;  2F52 A;  4FDB A;  3A5U A;  4JI6 L;  4DUY L;  2C35 B;  3ULP A;  1PYS B;  2GN5 A;  2I5L X;  1E3P A;  4HJA A;  4JI5 L;  1EIY B;  3F8T A;  2B3G A;  4QIW E;  2WP8 J;  3J7A 5;  1VQN A;  4UPA A;  4XIG S;  1IBM Q;  3GTM H;  1AE3 A;  2MFI A;  4KI0 A;  5JJK A;  1PH4 A;  1HNX L;  3GD7 A;  4JI2 L;  4IJL A;  2BA0 A;  5E7N A;  4YCU A;  4JG2 A;  3S24 A;  1VCI A;  2F4V Q;  4A3F H;  1YIT A;  1K0R A;  1QVG A;  3RZD H;  1TXY A;  4DK6 C;  3KF8 B;  2EIF A;  3PUY A;  4DPG A;  4DR1 L;  4A3M H;  3HOX H;  4WJ4 A;  1UE5 A;  1TWF H;  1W2B A;  1K8G A;  4PZ8 A;  1YI2 A;  3Q8D A;  2N3S A;  4P72 A;  4P73 A;  4PZ6 A;  4JI8 L;  4A3I H;  4R4C A;  4HIO A;  3CCM A;  5LMN L;  1VQD A;  1SFO H;  5IP7 H;  1ASY A;  1LTL A;  4A93 H;  2Q2H A;  3G4S A;  5LMU Q;  5JJI A;  4GLX A;  5GAG C;  5FLM G;  3EIV A;  4C2M H;  4L5T A;  4DV7 L;  1J6Q A;  1Q8K A;  4KHZ A;  4A75 A;  2UU9 L;  1HJP A;  1VQE A;  3GTQ H;  4YWK A;  2A19 A;  4X66 Q;  2JQO A;  3NEL A;  1CUK A;  1EQQ A;  2Y0S E;  4B3T L;  2PI2 A;  4A3G G;  1X6O A;  4A3L H;  4GN5 A;  1XMO L;  3CCR A;  3K80 C;  4RG1 A;  3JAM i;  5AJ3 L;  3CF5 A;  4POF A;  1K83 H;  1YJW A;  2Q2U A;  5IWA Q;  1B70 B;  2UUA Q;  3L7Z C;  3TS2 A;  4QJF A;  3F2B A;  1PH1 A;  4LF7 L;  1VQG A;  4O2D A;  4LF5 L;  4IPC A;  4A3C H;  1Y1W G;  5J3B A;  3M4Q A;  4R4T A;  3WWV A;  3CC4 A;  4JI7 L;  3PO3 H;  1IZ6 A;  4BBR G;  1GM5 A;  5GRO A;  4JI1 Q;  2JA6 H;  4LUO A;  1LYL A;  5IT9 c;  2ZM6 Q;  5IP9 H;  5IYD G;  2UUC Q;  4JYA Q;  2VQE Q;  1UE6 A;  1Q86 C;  4JI0 L;  4LFB Q;  1I3Q H;  2CWP A;  3TS0 A;  1YJN A;  4LF4 Q;  1S3O A;  2JJQ A;  3CCE A;  4DAM A;  1J5E Q;  4NXN Q;  2RCN A;  2HIV A;  4R4Q A;  1HR0 Q;  1N32 L;  3F1Z A;  4DR3 L;  1ASZ A;  2QGQ A;  4DNI A;  2VUM G;  1Z47 A;  4A3J H;  1W3S A;  2PMZ E;  1PH2 A;  3KF6 A;  1VQ6 A;  4BXX H;  4DV0 Q;  4JCV E;  1EUJ A;  3DM3 A;  2B29 A;  5C4J H;  4A3B G;  3UDG A;  1YHA A;  2K52 A;  3S1N H;  4DV2 Q;  4DV5 L;  1QVC A;  3S15 H;  2VL6 A;  1GD7 A;  2R7D A;  3PO2 H;  1QUQ B;  4MNO A;  2K5V A;  1S72 A;  3H3V I;  1I6H H;  4HIK A;  2H5X A;  1X55 A;  4GKK L;  4LF6 L;  1X54 A;  4O0A A;  1MKH A;  4GKJ L;  2BH8 A;  3PCO B;  3CPF A;  4Y7N H;  1VQJ A;  3ULL A;  3PSI A;  4PG3 A;  3HKZ G;  4DR7 L;  5IYD H;  3RR5 A;  5C44 G;  4IPD A;  3CC2 A;  4OXP A;  3A74 A;  3T1H Q;  1EFW A;  2QA4 A;  4IJH A;  2JE6 I;  2UXD L;  4GN4 B;  4P75 A;  5HGQ A;  4DV6 L;  3A0J A;  4AYB G;  3CPW A;  1PVO A;  2NZH A;  1CKM A;  5H1S E;  1YEZ A;  2R7Z H;  1WFQ A;  4QY7 A;  5JEA J;  2K5H A;  1Z9F A;  4GNX B;  2AMC B;  1L1O A;  2VNU D;  2YTV A;  5LMN W;  1PH5 A;  1UE7 A;  4JI5 Q;  1EQR A;  1AE2 A;  2K50 A;  4OX9 Q;  3STB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...