3N42B

Crystal structures of the mature envelope glycoprotein complex (furin cleavage) of chikungunya virus.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
338
structure length
338
Chain Sequence
NFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNMGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords E3 envelope glycoprotein
publication title Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography.
pubmed doi rcsb
source organism Chikungunya virus
total genus 59
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2400 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n42B03
2.60.40.3200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n42B01
3.30.1490.280 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n42B02
3N40P 3N42B 3N43B 3N41B 3N44B 3MUUA
chains in the Genus database with same CATH superfamily
4K94L 4HUKB 2OYKA 3QNXB 2FO4B 5CIPB 3UTTA 1NCAH 4GW4B 1A7BA 3O4LA 4W6WB 4K55A 4DKTA 3OMNB 1ZD6A 5CD3B 2ETWA 3VSQA 2XG4B 1UCBH 1LLAA 3HMXA 4UMSA 1EHKB 2W8LA 3FCTB 2Y6SC 1JJUA 5D1XB 3BRDA 4NQED 3J27A 5CA1F 3QEUA 2FLLA 1BA9A 3I85A 2VNCA 3MJFA 5EDSA 4GRLD 3TCLB 4NZDA 1XIWD 5C3IA 1IKNA 2HVRA 2VDML 3RIKA 4HQQH 1B33N 5KW9L 2YARA 5CP7A 4F8LA 1O5PA 1QD0A 3KHHA 4OFIA 1BJMA 4GS7B 3Q0HA 2FWOB 2QSCH 4OZIF 3SD2A 4LSSH 1UFGA 3V6OE 4Z7NB 4Z3GA 2FQEA 3D39E 5AOIA 4JE4B 2IPTH 1S2EA 4G6MH 5IK3A 1CLYH 2UUDK 3TYGH 2B7DT 3LZRA 4WI8A 3UX9B 4LEEA 4ABUA 5LWYH 1P7QA 5KFMA 3AAZA 3T4AA 5CCGE 1DQIA 4NFBA 2NY2B 1U92B 3IFNH 1WZAA 2AJVL 4FABL 4HAGA 1CVRA 2WPGA 3Q5OA 3SKNB 2NW3A 4PI2A 2E7BA 2CDFB 4FQLL 2LV4A 4G8FA 3DKHA 4GQPH 1RZJH 4PW9A 1HCZA 4YDIL 5F8RC 2BWDA 2DEXX 1PIGA 5TH2B 1JIHA 3D39D 3DHJA 3OR6B 2A4ZA 1WEJH 3FPYA 4PH8A 4AIZB 4E9QA 4WSGA 5AKRA 1AKJD 2N1TE 1RUMH 3T09A 4DP1X 5L0QC 1MKFA 3RWFB 3CLEL 2EDXA 4AZ8A 5EO0A 3U9PH 3KYOA 1HKLL 1UWEH 2C26A 3EYQD 1R3KA 4G7YL 4YY3H 1EJFA 3IETA 2OSLB 3MV9A 5H37G 2CUAA 3VGHA 3EH5B 1NBZA 3H9SE 3AS0A 1OGAB 3TNNB 3K6SB 2XV3A 4Z5RA 5FPOA 4KDTC 1IB5A 2VZUA 3MYJB 4ECQA 2AW2A 1NFIB 4XE0A 2Q1EA 1LDPH 4NERA 2JELL 3EBIA 3PHQA 3ZHLA 5IFHL 3TWCL 4BGLA 2BZDA 1RJRA 3NGBC 2MKWA 4JAMA 4OB5L 3H9SD 1CFQB 3BZEA 3QNFA 4KGLA 4BA0A 1ACYL 4TUYF 2DWXA 2EYSA 3O8XB 5FYKE 2Z4QB 5IREA 1AZUA 1BQHA 4HIJB 5IB5A 1BAGA 4P46B 3HUJF 5I75C 3AREC 3RWGA 2DMCA 1FE8H 2W0PA 3GI9L 5C1MB 5IKCA 5ALBH 2B4CH 3IFOB 5AOMA 4LF8H 5D96B 3PGDA 4LSXA 4I5BA 1I7LA 5EU7C 4QTFA 2XICA 3T9WA 4LARL 3RGVD 2C1PA 5ETUB 4H1LG 4PJXF 3K3QA 3WL9B 5FYKD 4LBEB 4NZTL 1PW3A 3AWEA 5C09A 1RJLB 1F3JA 1VDGA 2XA3A 4DESA 1ZE3H 3FONA 3BPLB 1CFVH 1VB9A 1FPTH 1WFTA 4AYBE 1U8KB 1QG3A 3QRGL 3T2OA 3NSDA 4YHLH 4EZJA 2A9CA 4HZAA 3KHGA 2AJSH 4F80A 2FO4A 5CIPA 2RB8A 5FM5O 3WTWA 4N2FA 4GW4A 3U4BH 4NQCD 4OCRL 4OD2B 3PPEA 1KIQB 2VA2A 4KKBD 5CD3A 1NBCA 4OF8A 1A8JH 2XTJB 2XG4A 3HTLX 3BUTA 3OZKA 4PJ5B 2EO7A 2XWTB 3FCTA 5D1XA 1A3LL 2WLZA 5JW4Q 1T20B 3KJ6L 3AROA 3F04A 4PGZA 4XVSH 3WGUB 4XN4A 1ZY9A 2J8OA 2C3GA 2V2TB 3TCLA 1AH1A 1RJCA 1MFAH 2FEJA 4N2IA 1Q38A 4O5LL 1TOXA 2E74C 3MR2A 3RWHB 4W93A 5ICYB 3SKUD 2FWOA 4KHXL 1UOLA 1EXUB 3RZCB 3DPDA 4I18B 4XNYH 1AHMA 2YD1A 1UB6B 4XI5D 7TAAA 5J12B 2FPPB 3ZL4H 3HOWG 4WEEA 1ACZA 2VR7A 3SGJC 1XQ4A 1E4WL 3VPBA 1TQBB 4UTBL 1OK8A 4DSYA 1U92A 2P3YA 1TSHA 2H6UA 1TKWB 1CXLA 2XQYG 2IH3B 4MJ2A 5C08B 3SKNA 3U0WL 4N2BA 5B1AB 1YEDB 5FUZL 4DPRA 1HQRB 3ZVVA 3GS4A 2Y5QA 2VGLM 5F7BA 3MZGB 5HHOE 1HINL 5TH2A 5E2WL 1XNRH 1DBJL 4MNQD 2R8KA 2H1PL 3OR6A 4AIZA 2EEBA 4OLXH 5JW3L 3DX7B 1L0QA 1UGNA 1T5KA 2E47A 2FIKB 3O6MH 4B9CA 3TCXA 3D09A 2QADC 4B6ZA 1JGVL 3GSNB 1SOKA 3IGAB 3SGKA 2EVHA 3V0DA 1OTSC 4XPHL 5I1CH 1T4WA 3ATAA 4UYQA 5DWUH 1A1MB 4POZC 4AH2B 2LTQB 3V0EA 5HHOD 2OSLA 4RNOA 2W6MA 4A3JG 5EV7A 1OCWH 1T1WB 1OGAA 4JFYB 3TNNA 3K6SA 1IU1A 2VDOB 3GIQA 2AK1H 2MRYA 4I1NB 5C70A 3L54A 1B6UA 4I85A 4RUAA 4EN3C 5BXFB 4JUTA 3CFKB 1M6VA 3MYJA 3FT2B 1PY9A 2E7MA 3QAQA 1A9BA 4LOVA 5GZOD 1I1AD 3SBWC 4L9LC 2MH4A 3QCUH 1JBJA 4HSAC 1JKJB 4O3QA 1KBWA 1MCOL 3FRPG 4PJ9D 1HIML 1CE8A 5FLVA 1CFQA 5C0EB 4P05A 3LD8B 1S3KL 3ULVE 3VI3E 4Z8FH 2D03H 4JV5H 3O8XA 4AVIA 4CW1B 3TEWA 2Z4QA 4PM1A 4QRFA 3WNMA 4HIJA 2OMVB 5C2BH 5L4MA 1NCDH 4P46A 1IBKH 1D2PA 1Q72L 3WUWB 4KX7A 3AQYA 1E28B 4HS8L 3D6GA 3TJEL 2YL2A 1JGDB 4B3SH 3IFOA 2DQCH 3WSQL 3ZYJA 2WXQA 3CFNA 4WFED 2JIXB 1ZV9A 2RBLA 4ENEC 3KPNB 4TUKH 5ESAB 5ETUA 2ITFA 4JMNA 1HAWA 3WL9A 4LBEA 4JGMA 2E27H 3FTUA 1JGEB 1RJLA 2X88A 4PMFA 2DOCA 5CBAB 5HVHB 3RDTD 5J13B 4GFXA 1TEYA 2XTSA 2WGXA 1U8KA 2Z31C 4P4KB 3PW4A 2YZNA 3PJLA 4N86A 5T33H 4PCSA 4F9LC 2YFOA 1MIMH 3F58L 1P7HL 3CDCA 2WLIB 3C6LD 3IDNB 2A83B 2CUIA 5IP9G 4PJFE 1JNNL 2WN2A 1EPFA 3N85L 5KZCB 5KBDA 4OD2A 1KIQA 1F58H 3JXAA 2ICWB 1WF5A 3IJHA 2FK2A 4PJ5A 4XODA 2XG5A 1FH5L 4H8QA 1T21B 3K74B 3G08B 3DIFB 3K7UA 2RACA 1T20A 2ZKYA 5TQ0H 4OLWL 1ITCA 3W0WD 2HVQA 4RFNB 2V2TA 3R06B 4RMWA 3G04B 5EG6C 2CJUH 4M6NH 1ZHLB 2FNBA 2H26B 3BT0A 4GH7B 4WAFA 3RWHA 4J9PA 3MRNB 4GSXA 4QRRE 4CMMB 5ICYA 2R0LL 5DO2C 5HP5A 4XPTH 1EXUA 3RZCA 4I18A 4CDGC 2HTLD 4X5LA 1NC2D 4MD5B 1UB6A 2K45A 2HKAA 1W0WB 5A6MA 2A9ML 1WWCA 2AJYH 1LO2H 3FT3B 2OX5B 1KXVC 1N64L 1G7JB 4Y5VB 4XP4L 5GGVL 1I53A 2IH3A 3BN9C 2BNQE 4H8UA 5C08A 1YEDA 4QRRD 2R0WH 4JY4B 1HQRA 1Z9LA 3IF1B 4YQXH 4GP4B 3PP3K 4DN3L 1E43A 5TGBB 3S37H 3OAZH 5CZVH 1FLRH 4WWNA 4DFHA 3DX7A 4PP2B 3LS5L 4K7PX 2FIKA 2DDQH 4K3DH 5A6LA 4F7PB 1Z5LB 3X3FL 3KLDA 1BQLH 3DXAD 3GSNA 3IGAA 4WQOA 4AENB 5HHQB 2CO4A 1J1OL 2NY1C 1BG9A 4R8WH 2FJFB 1KB5H 5C0BB 1K4DB 4AH2A 3AUWB 4DEPC 4E2OA 8PAZA 3POHA 3PAZA 4ZNCD 4V11A 1T1WA 4K94H 1WA2X 2V3EA 4JFYA 5D6DC 2BWIA 5BPHA 4U1GC 3CX5J 2RDJA 3DROB 2JJSA 4IK7A 4NWTL 4PPTA 5EHFA 2CPCA 5BXFA 3MGAA 3FT2A 4LIQL 5GS0C 3N6YA 2EH8L 2ENSA 5GGVY 2F0CA 1GJIA 1I3VA 3U7WL 3D85D 3T71A 4P2OD 5C0EA 1JCVA 4Q4IA 2VDMH 4CW1A 4Z7VE 5KOMC 5KW9H 2DLFL 5JO5B 2OMVA 1O7DC 3QJXA 4M1GL 4CDHA 5AL0A 1T6BX 1BG1A 4Q43A 1KB9J 1JGDA 3FN3A 3UBFA 2R8GA 3FUFA 4EBQL 1KYOJ 3P11L 3CX2A 5BV7L 1BF2A 1QLEB 4WFGE 3ZGIA 4PP1D 2JIXA 5C0AD 1N19A 1R5VB 3KPNA 5ESAA 1XSJA 3GUTB 4FABH 2AJVH 1XZWA 3OR7B 5L9DL 1JGEA 2MMXA 4BV1A 4UQ3A 4FQLH 4YDIH 1R5WB 1W9XA 5KFDA 2RD0A 1I85C 4BRVA 5CBAA 3QFJD 5E94B 2J55A 4HNVA 3K2KA 3RB0A 2E5LH 3CLWA 4P4KA 3F7PC 1CBVL 2XGQA 1VFBB 4LSTL 4Z7WF 3KBFA 3KS0H 1AR1C 2WLIA 3C08H 3SE4C 3GRWA 4XNAA 2A83A 4DIXA 4A3IG 3W2DL 1R24B 4L4TD 4EXPX 4G7YH 3ORQA 2L3BA 4IWYA 2V8LA 1G1KA 2IPUG 4MXVE 2ICWA 4DEWA 4RAYA 1I3QA 3EOYG 4TQPA 5L1LA 2NR6A 3CDGB 3L5XL 4O02H 1T21A 3BVDB 3G08A 4DV7H 1XR9B 2CRYA 2Q86A 4NZ8A 5KFUA 4B9GA 1KTRL 4FNTA 3ECUA 4XGZB 3VG0H 4XAKE 3F64A 5MENB 4JI5H 1LQBC 2X1XR 1J88A 3T2LA 1GY2A 3G04A 3T3PE 3MCYA 1ZHLA 1SXSA 2WB1E 2JELH 1OIOA 1IM3D 4BY1G 3TWCH 1OD9A 3OX8B 4CMMA 3QXWA 1WJ3A 3HG4A 3RU8L 4OB5H 5B3SB 4MAYC 3M1BA 2QSVA 3V0HA 3GMNB 4MD5A 4YBLC 2PETA 4YDKL 1W0WA 5CD5D 4NC2B 1R3IL 4Q6IB 3HHSB 1ZCRA 3FT3A 5FUCC 2OX5A 4AIXA 4EN2A 1LHZA 1I9EA 1G7JA 4Y5VA 4ZAKB 3CSFA 4OM0L 3PS6A 4JV1A 1HS6A 2C35B 1E4FT 3RIFK 2D2CC 3GI9H 3NIFE 4W9CC 4BZ2H 3CZGA 4JY4A 1EBPA 2EDWA 1H15B 3IF1A 1QSEE 2J6UA 5C4XG 4KVPA 1JWSA 3SY6A 3GPSA 5CEZL 5TGBA 3R19A 4QCIB 4TSCL 1MI5E 4PJ7E 1GGTA 2A73B 4XN1A 1Y1WG 1U3JA 1ZHSA 4NZTH 2OPCA 4M1CC 1UWFA 4PP2A 4DPCX 3H0TB 4GKSB 1I4FB 4F7PA 1Z5LA 2MQCA 2AMUA 3ABMB 4AENA 5DMKB 3KAKA 2R7ZG 1YJDC 4QTHB 3MV11 3VI4B 4LF6H 4M7LT 2FJFA 1HNYA 1QSED 3QRGH 1K4DA 5C0BA 2ZUUA 3KPSE 3ET9F 4NUJB 2BC4B 2GJ6E 5D4JA 1MI5D 3WTSA 3IDYC 4XYLB 4RDBA 4LCWE 3DROA 4OCRH 2FP4B 4JV2A 3UTTE 4G80B 1TEFA 1YNTF 3WNNA 3O4LE 2L7EA 2UY6B 4W1TA 1G6RL 4AV5A 2AQ4A 2EUZA 3OGCB 3QQ4B 1A3LH 3QXUA 3TVMD 4PJFF 1AHWB 3KJ6H 3KPSD 3APNA 2NNCA 3B2DC 4FE9A 2GJ6D 2YD0A 4MQSB 3ASOB 4YHIA 2ICCA 2FSEB 3D51A 1JYXA 1JLLB 2WQSA 4O5LH 3UTTD 4PWKA 3RL2B 4FNUA 5JO5A 2ZT9C 3O4LD 4I8DA 5IQNA 2HFGL 2W8CA 4EBDA 4M8QB 3LKOA 5ICZB 1OL0A 2JJTC 4NNYB 1QWHA 2WXHA 5DJYB 3BO8B 2EXSA 1R5VA 4CGUB 1E4WH 1X4YA 4UTBH 3GUTA 5GPRA 2ITCB 3U0WH 1ZS8B 3OR7A 3N8DA 5FUZH 1DCLA 5EZYF 4DV2H 1J0ZA 3W11C 1R5WA 1MCWM 2NZ1A 2DMKA 2WNWA 5E94A 5EC2A 1HINH 2ITDB 5E2WH 1X5AA 1DBJH 1CN4A 2H1PH 3JWNE 4LF5H 5FFGA 1VFBA 5C0DB 2OXHB 4ONHB 1J0YA 3K8LA 2WCGA 4LE8A 4HETA 3ECBB 1P7QD 1XCWA 2DQJL 4UQIM 1FGVH 1JGVH 2JA6A 4JANB 4FMFA 1UHVA 1R24A 4L1DA 4TQSA 2GTZB 2VN5A 3POCA 3NP3A 3WDIA 2BJML 3CDGA 5FFOA 3ZDYE 5IWLA 4F33A 1XR9A 4TLUA 5IGXH 5K39A 2E7HA 3A0OA 3MV9E 1J8SA 3B7YA 3OMIB 4XGZA 2BNUB 1DBKL 5MENA 2VR9A 4DP5X 4PRIB 1A7RL 1REIA 3IE9A 4ODSL 3Q1SL 3L4KA 1RK5A 3X3GL 3HRZB 3QPQD 3ZE1E 2KPNA 2P8MB 1F5WA 4RZRA 3ARBB 2Q9OA 3NIDB 3OKMB 3DVGB 1F45A 3N44B 1GYCA 4Z7QE 4GUQA 2DJ4A 3OX8A 1MCOH 1MFEL 1WA1X 4HKXB 3T0WA 2YRZA 3W81A 5AW9B 3APFA 3B34A 1WFOA 2A0LD 1HIMH 1H5BB 5KFAA 4MJJA 4CKQA 1NAKL 3MV9D 3GMNA 1JZDC 3BAKA 1S3KH 4RFEB 3P0VL 4G9FB 4Q6IA 3HHSA 4AXWB 5IHUL 3TC9A 3O3DA 4ZAKA 2YKLL 4IIQB 3O6LL 4MA5A 35C8L 4FYRA 2LR4A 4HS8H 3TJEH 3UTSA 3PW5A 2HKHL 1H15A 1ICTA 1KDIA 1JPFB 3LRKA 3NJLA 4Y5YC 1CFNB 5A43C 4K07A 4Z7VF 3PXHA 1MJ7L 1URLA 4QCIA 3EJSA 3ELQA 2VO8A 3PCYA 4JKKA 2A73A 4ZO8A 1ET5A 5KKNB 3C09C 4FS0A 2ADJB 4JS7A 4ZQKB 2FJSA 2IV8A 2NXZB 3EBGA 3GILA 1MREL 3H0TA 4GKSA 1I4FA 1KCVH 3ZQXA 5MHSD 5DMKA 5C09E 3HR6A 1TZIB 5E6IC 4QTHA 2RDIA 2XRAL 5KS9E 3VI4A 4JFEE 2LT9A 4KK6D 4JQIA 4NUJA 4JKNA 3F58H 3SE3C 2BC4A 2WBJB 1JNNH 4XMVA 4B5EA 2VQEH 4ZMLA 5FFLA 5HPOA 3N85H 3HG5A 5C1PA 3QA3B 4C56E 1M56B 4G80A 3HPLB 1FRGL 2UY6A 5C09D 3AMKA 1FH5H 3HN8A 3L1GA 4KXZI 3C87A 1W93A 4JFED 3OGCA 4PJCB 3QQ4A 1MFVA 5JHBA 2BCKA 1AHWA 4OLWH 5IBUB 4BDVB 5D1XE 5KT7A 2LFGA 4ZFFB 2JE8A 4HUNB 4MXVF 3TBCA 1MLBA 2FSEA 4XB8A 4OI7A 3E9UA 1UKSA 3RL2A 3MRGB 4FL4C 4RGOL 4FA7B 2C4FT 4PY8J 3I3BA 4DZBB 3EDEA 5LMUH 2Y06L 1PQZB 4R4ND 2ZYHA 4Y7MA 5EWIL 1P53A 5ICZA 4TQRA 3T3PF 4CBZA 4NNYA 4WGWB 3I6LE 5D1XD 2A9MH 1PL3A 1N34H 1CR9L 3BO8A 3CG8A 2OKMA 3KGSA 4XP4H 5GGVH 2WLJA 2ITCA 1ZS8A 4UAHA 1DV2A 3Q13A 3F8NA 1ASPA 2GKIA 4YSOA 5GRUH 4N2LA 2ITDA 3QPXL 3FH7A 1CFBA 1TTCA 2YPVL 3QJFB 1PVHA 3ZX1A 4DN3H 2GBUA 1TWFA 43CAB 3I6LD 5D6CB 3WHE0 4EIUA 5ERWB 5C0DA 3K5IA 4GAFB 3NIFF 2OXHA 4ONHA 5T5NF 1PZCA 3LS5H 3BUPA 4L0ZA 3ECBA 1NOAA 3C75A 1TR7A 3X3FH 4ZNEE 1X4ZA 3N2JA 4JANA 3JUZA 1J1OH 2NY2D 3QJTB 5JQIB 2FEDD 2W9EL 1WZ1L 4PJ7F 4UV7L 2BDNL 2GTZA 3RWJB 1R4XA 1CE6B 1SY6A 2IDQA 3C9NB 5JIMA 4Y89A 4YSDA 5DHMC 2NUPA 1WD8A 4NENB 1DJGA 2ZSVB 2BNUA 2CQVA 2Q3XA 4NWTH 2QQQA 1E5AA 1BZQK 1DJYA 1KYUA 2AQ1A 2ZCHL 4FFYA 1AQHA 3HRZA 2IH9A 1HDMB 2P8MA 3ARBA 3GDCA 4LIQH 5LCVL 3OKMA 3VXMA 3DVGA 3UBXG 2EH8H 3M1CA 5DHYB 5MEQB 3R0NA 5DMJB 3QQNA 1H5BA 4KY2A 4AL8C 2WWNA 2QVFB 2XZCL 2ZKWA 4RFEA 4G9FA 2J21A 2DLFH 4XBMA 4AXWA 1HWGB 2EXWC 3T8XB 2Y7SA 1UA7A 1WBXB 3JSNA 4M1GH 4IIQA 1JNLL 2HAZA 3RI5F 4B9FA 4JGUA 1GGUA 1T5XB 2EEXA 2V3FA 4GJTB 4BFRA 4WWPA 2I9LB 4P9MH 3SDDB 3T6WA 4EBQH 1JPFA 3P11H 1CFNA 4QWEA 5BV7H 2X4RB 1JXDA 5I73B 3V52L 2BQUA 2QPFA 4YC2C 1XCQB 3BFWA 3OZ9L 4M3JA 2QZQA 5E8NB 5K9QG 4ZQKA 5L9DH 2UWEB 3O8XD 1HSAB 4FDWA 3RFZB 1TZIA 2YZ1A 2NYYC 4P46D 3KVDD 3X2QB 4WCYL 4P48A 1CBVH 4D2NA 3WN5C 1QQDB 1OT4A 3TU6A 4PS3A 1QHOA 4LSTH 1GHFL 3RURA 1IKOP 1R3JB 3CGTA 1AVAA 2WBJA 4XX0B 5I71B 2YAHA 3NESA 4ZMNA 3TP4A 3BUYA 5E99L 3QA3A 2H32B 2IPKB 4L29B 3W2DH 3JSSA 4R6UA 4ZOCA 3HPLA 3KXFB 4WSJA 4BE6A 4F7KA 4M5YH 5FV2A 2A99A 3L5XH 3MJGX 3VACA 2W95A 1Z9MA 2B16A 2F1EA 2R59A 4PJCA 4JY6A 4XVJL 3BI9X 3HE7B 4YBHA 2CH8A 4RWYL 3MRQB 4KTEL 4D0CB 3NFNB 4LSVL 3SYCA 4BDVA 3E8VA 1G0XA 1NOFA 5A2KH 4ZFFA 1GSAA 3ZDYF 3UFXB 1VSCA 4WBNF 2OMYB 4LHQB 3MRGA 3B3BA 4WWKC 3WY1A 4DZBA 4IS6B 2Z64C 4OUOA 3RU8H 1PQZA 2XTJD 4G42B 4PJ5D 4MXWH 3UYRL 1KN2L 2VXQL 5I0XA 1FL6A 3VFSB 1GZQB 3WS6C 3ZE1F 4AUUA 3EYUL 4YDKH 1R3IH 3OKKB 3R8QA 1XB8A 5JOEA 2KQMA 3QHFL 4Z7QF 3RWCA 1UWYA 5AALA 4OM0H 2O03A 3S5YA 3O41B 1NDTA 2YC1B 1V7NL 4X4KA 1P9MA 2DS4A 1OAYH 4TSCH 43CAA 1TTFA 4HV8B 3FQ4A 3AC0A 4Q6KA 1WVZA 5D6CA 2HRGA 2ZIDA 3HI5L 5FGSA 3WNOA 5ERWA 5HI5C 1D5MB 2ZCKL 5IJKC 1V5JA 4MDJB 4FQCL 1LE9B 5FR3A 5GJSL 6CGTA 2O5XL 5LGJB 4IGBC 2DQGL 4HPYH 1O6VA 4XX1G 5C08D 4KXZH 2VSKB 1SF5A 3RWJA 3C9NA 3TEUA 2WB7A 3VAEA 4N5EC 3TWYA 5D1QB 4YLCA 4NENA 1XEDA 3BSZA 2WXIA 2ZSVA 3DO7B 1HL8A 3RVXC 5KS9F 3H0GA 1U91B 3HLKA 4KI5C 3FO0L 5LXGL 2O6PA 2Y1AA 3CE1A 1QP1A 2RA1A 5GRVL 1W91A 4ETQB 2CK2A 3UAJA 3J7AK 1MF2L 1KCKA 3FTSA 5KG9B 4LDEB 5DHYA 3ZT6A 2AK4E 4MS8C 5MEQA 3DTDA 3MRDB 3D06A 2JKRM 4WI6A 4E42B 3JWOL 4KH2A 2EQDA 2XKNA 2QR0B 3D0LB 3N0PB 3IGFA 1WPCA 2PCFB 3T8XA 5DJCB 1QRNE 1WBXA 4UU9B 3UAAA 4BFJA 4CVZB 1XMEB 4N9OB 4PVNA 1FDLL 3HN3A 1T5XA 2I9LA 1UYWL 5GJTL 3SDDA 4C4UA 5J89A 4NQXB 2FJZA 4MV3A 2X4RA 3BA8A 1Y6MR 4ED1A 2XPZA 1XCQA 2NY6B 5T1MA 1G7LB 5E8NA 3VMPA 4D3CH 3F6LA 2UWEA 3VD0A 4AQEB 1X7SA 1HSAA 5F72S 4Z7NF 4XMLL 3RFZA 1CGYA 3L1EA 1QQDA 1NAMB 5B39B 2VAJA 4OGQC 1S0MA 4IKKA 1TQUA 1AGEB 1R3JA 3CFJB 4CNIB 3RB4A 4A93G 2DQJH 2JIXD 2K0RA 3JT2A 3KD4A 3V8CA 2H32A 2IPKA 4L29A 3SYPA 4QHUB 4HK0B 3SDAB 4MA3B 5FOBB 4W9LC 4I2XB 4DVRL 3KXFA 3VDCA 2BJMH 3NZUA 2WZPD 3GIVB 1U30A 3MLVL 4PHZA 3H2QA 5FPIA 1KCUL 3LN4B 3HE7A 4Z3IA 1GIGL 2GQHA 2PYEB 3MRQA 4D0CA 1PGRB 3NFNA 2EEFA 5C9JB 3ESVF 3UAFA 3P0YL 4P4KD 1DBKH 4HG4J 1J9QA 1O6TA 1A7RH 4I88A 4ODSH 1T03L 3Q1SH 5EEVA 2NTSP 4U2YA 3X3GH 4FLOA 5C0ND 2DM2A 4X0KB 1MCWW 2MCPL 1DQML 4ZFGL 2R92A 5KZCD 1U8PB 5J3HC 1MFEH 1H8LA 4IS6A 4LHUG 3S35L 2VZ1A 3IMUA 1WCMG 4G42A 3D3VE 3QUZC 2NR6D 1NAKH 3SY0B 4DW2L 1ROWA 4JL2A 1S7UB 5DO8A 3VFSA 1GZQA 3CXHK 1XB3A 3WNLA 2G60L 1JDEA 3OKKA 3P0VH 3S36L 5C8JB 2HN7B 2V9TA 1WFUA 3INOA 3LIZL 3P73B 1WD9A 1NMCC 4GP8B 2P5EE 5IHUH 2YGQA 3U2IA 1Z9NA 5MP6L 2YKLH 1QRKA 35C8H 2YRBA 5KG7A 5A7BA 3ZDZE 4QIWA 3O41A 3NEXA 1E4XL 3AM8C 4U0QB 4F9PC 3T3ME 4WDIA 2HKHH 3PY9A 2YC1A 1PPIA 2YPKB 2X44D 2J5LC 1MJ7H 2EDFA 4NAQA 4FKHA 2P24B 3C5JB 4HV8A 2R2BB 3FUJA 4HKZB 5CS7A 1MELA 4BUQA 5SWSB 3GV7B 4Z76B 4Y4FC 1MREH 4MDJA 5C07B 4AM0B 3MBWB 1LE9A 5LGJA 5F1NB 1GGCL 3AACA 4BFBD 1ZLWK 2XRAH 1MXGA 4HUXB 1AHKA 3MA7B 3GXIA 1CLZL 1G6RB 2Y24A 3MBEC 1G4RA 3GPEA 3GUFA 2H0EA 4OGZA 5LUMA 4UT9L 3PN1A 3SYQA 3GEFA 1CS6A 3ZE0B 1ADQA 1PX4A 25C8L 1IZJA 5EBMB 4YN3A 5BO0D 4Q9RL 3X1BA 1FRGH 1OZTG 1FFPB 4ETQA 3S4SG 3SO3B 1FC1A 4I3SL 5KG9A 5DVPA 4BWTA 4X8GA 4FFTA 3RJOA 3MRDA 4DUVA 5IV2B 4E42A 2NUAB 4OJDH 1RUPL 5C0BD 5KSVB 5JH7F 3BP7B 1X5GA 5AZEL 1M3IA 5CB4F 1ZAGA 2H8PB 3U46B 3QI9C 4X0NA 1H3TA 3OLIA 2QR0A 3D0LA 4Y16A 4N2EA 3F83A 4P3WA 2PCFA 4XNZC 2IJ0C 4UU9A 5DJCA 3V5HB 4Y8DC 2GSMB 2QKIB 2Y06H 1D5IL 4CVZA 4HOZA 5EWIH 4CC6A 2FGWH 3P4MB 4JFTA 2DZEA 3DYOA 2X2UA 4NQXA 4TLTA 4F24A 4LEBA 4U7SA 3US0A 3OTOH 5FXCH 2IAMC 4FJZA 2F19L 2P49B 3SODB 2F5BL 3ALWA 3WCYA 2ODIA 1G7LA 4JRLA 1DJZA 4AQEA 4BJLA 1GZHA 4OR1A 2ATKB 3OB0H 3UDWA 3MNDA 3QPXH 3EYVA 4DTGL 4N8VG 3LNGA 3ORRA 3F6IA 1NAMA 3ZDWA 5B39A 3VXTB 1G9EA 1AGEA 5KFCA 3CFJA 3T1YH 2HP4A 4CNIA 4LLQB 2W6NA 4PJ8B 2UXTA 2GSIB 4NIYE 4ONGL 1I94H 1KJIA 1MCFA 4QHUA 2W9EH 3HB3C 1WZ1H 4HK0A 4MA3A 4I2XA 2JCCB 4OFDA 2BDNH 4Q8BA 4UV7H 5FOBA 5TF0A 4J3BA 1AZRA 3GIVA 4QT5B 1GYWA 3JWOC 4N1HB 3S5ZA 5D1ZB 5DXWA 2EICA 1MVUB 1UD5A 3LN4A 4MA0A 2FD6L 2PYEA 4F3FB 3MJ9L 4E41E 3A6OA 5C9JA 3BC9A 2PP8A 2EILB 2GBVA 2WIIB 1IGML 4XCFL 3ETHA 2DIAA 2ZCHH 3BZFB 3D33A 4YE4L 5D2NB 3FCSB 3IMTA 4X0KA 5T14A 1J0KA 2OR7A 3D4CA 5LCVH 1QHPA 2NY3B 1U8PA 4MRBA 5I1LB 1N5YL 2HT3C 3L2PA 2QVTA 3VGAB 4K0OA 3IDJB 4L3AA 2H0FA 1PBYA 3E5NA 3SY0A 2IANE 2AAAA 1S7UA 3CBJB 3L4XA 1A6UL 4YDLB 3A4EA 5IMOB 2X41A 2HN7A 3PAYA 1SOSA 3LNDA 3VXSA 3P73A 2F53B 4EI5B 5MEND 5J7CC 1SLXA 4JRYE 4EOWH 4FQXC 4RSVA 3LKRB 2HZHA 3TH4T 5AFAA 1DJWA 2NNFA 1U2CA 2YPKA 1WFMA 4RMVA 4Z3FA 3BW9B 4ZMPA 5KAQF 2D7OA 1JPEA 1TLKA 2IAND 3EJTA 2JFCA 3V52H 3LZLA 4F2FA 2P24A 2HRHA 3C5JA 2R2BA 3G6YA 2WZ0A 4HKZA 4IBSA 4LHJB 4LLYB 5IHLB 1TVDA 5SWSA 2CO7A 4Z76A 2R7LA 1F4XH 4O3OA 4DK3A 1J10A 5C07A 4AM0A 3KL3A 1E4XI 3MBWA 4JRYD 5F1NA 4ZAKD 1BVZA 1SPDA 8FABB 4HUXA 4WCYH 1AIZA 1UEMA 2X53A 3GSOB 3MA7A 5JXED 1G6RA 2F54B 5FW7A 1GHFH 3VI4E 1JP5A 1T3NA 1WCQA 3NACL 4XHJD 2V59A 4B7LA 2WE6A 1BLNB 3P3SA 5HHVL 5E99H 1BMWA 3QBTB 5EBMA 5FGRA 1FG9C 4LGSB 1FL3B 4N90E 1FFPA 1K5NB 4OF5A 3QJZA 3VGBA 2FMAA 3TS8A 1KWGA 3NUKA 3MUY1 2VDPL 4RWYH 4LSVH 5FOJA 5IV2A 4WD3A 3DV6B 5KSVA 3BP7A 2BHUA 5T3XL 5B3NA 3VSVA 2H8PA 2CXGA 3U46A 5I5IA 1WIUA 1A9VA 1IZKA 4LF3B 1E8ZA 3FU8A 4OD1L 2IDUA 2DY2A 1Z0MA 1PLCA 2PKDA 4YGAB 2AC0A 1JTTA 4UCRA 3V5HA 5KG1A 2F8IA 2QKIA 5E9DB 4A37A 4F7TB 3R8BB 1U8HB 4XNDA 1TFHA 4YBQD 1XH1A 2HX8A 3P4MA 3UYRH 3ZHDA 3GSVB 2VXQH 3HNVL 3QWRD 4XXWC 1J5OL 3EYUH 5CSZB 5PCYA 2FDBP 3QHFH 2AZAA 1RIVH 4JPVL 1ID2A 3L16A 4AX3A 4IRSC 3BH8B 4UFZA 3FTZA 4G82A 5IFAH 3FKIA 4AKPA 2R1XB 1W6WA 2ATKA 5IF0B 1K8DB 2HH0L 1KFAL 2AXWA 4GC7A 4HCRL 3HI5H 1EXHA 3GIPA 3VXTA 5G4NA 3SIKA 3ZDZF 2J6WA 2ZCKH 3MR5A 4KO6A 1EEUA 4LLQA 4RA3A 4PJ8A 4D7PA 2ZSWB 2GSIA 2O5XH 4AMXA 1FFOB 2QV2A 2DQGH 1J11A 1NGQL 2JCCA 1MCLA 3BVNB 3G6JB 2XHNA 3ZY7A 3D69B 1NCNA 1OSZA 4QT5A 5CHNB 1BVNP 1BVKB 3T04D 5D1ZA 3TJHC 1MVUA 4G59C 4F3FA 4MCNA 4LDLB 4ZO7A 1H9DA 3A67L 2JEJA 1DBAL 5TK2A 4ESKA 1J5DA 5KSAB 2WIIA 2VQDA 5LXGH 3BZFA 3FO0H 1GZPB 5D2NA 5DC9B 3SPIA 3FCSA 2EIDA 4PRIE 5DHXB 4Q8EA 4KDVA 2NVYA 1MF2H 2OZ4L 2BX5A 1KY7A 5FK9B 2VQ1B 5I1LA 4M93B 4GI9A 2AMGA 3HN5A 1BQRA 3CPUA 3JWOH 3IDJA 3L9YA 3NCYS 4W9KC 5LN4A 3WEBA 5F6HJ 3BABA 4X6CB 2W7OA 1JDCA 3V79C 2EDMA 5IMOA 4F37F 4JHUA 4K23H 1VERA 1D5XB 1FYTB 2F53A 3D34A 3GI8L 4EI5A 3DDGA 4PRID 2J7LA 5DWPA 5BPPA 4WHTB 1XMWA 1FDLH 3RPIB 3O3BB 1IEHA 3ARBD 3LKRA 1UYWH 3R1GL 4M6OL 5FGCE 4JFOB 5FHBL 2VM4A 1I1YB 2WUBL 2AJXL 3BW9A 3HC3L 5GZNC 3PV7A 2NY4B 1EDQA 4Q2ZB 32C2B 4LLYA 1B6DA 4JREB 4UQCA 4XO5A 4JR9L 3DIDA 1I50A 2FJHB 1QFWM 3AGVA 4DL4A 1NQBA 1XAKA 2H4EA 4XMLH 1DZBA 3LH9A 5A2IH 2ITEA 8FABA 1TQVA 3GSOA 5L6YH 2F54A 4NN6B 4TVPL 4H7VA 2VLLB 4O4YH 2UXVA 1JHKL 1BZDA 1G7HB 1J8RA 3FW6A 3NJKA 1BLNA 1RU9L 1TTBA 2J57A 3H4BA 5CF3A 5A2AA 4DVRH 4IM8A 1WE5A 3LPPA 4Y1AB 4I3RL 1K5NA 3ZTNH 3BIAX 4GFTB 3MLVH 2C28A 1JF6A 4JY5L 4U6HB 3VFVB 3AXLB 4RRPA 2WCSA 1GIGH 4ADIA 3U1PA 4YO0A 5I9QB 2OI9C 4PJCE 2JJVA 3DV6A 3P0YH 4ZFZB 5KFOA 3PE9A 1I1FB 1ZJBA 5ISZB 1T03H 3JT0A 4PJAB 4WV1C 3LNFA 2XDHA 1VLXA 2MCPH 2WBJD 1DQMH 4ZFGH 4A2DA 3E8UL 5I1EH 2FO1A 1YPZB 3PJSB 5E9DA 3DETD 4RB2C 4F7TA 4OLVL 1NIEA 1U8HA 1A64A 1Z9OA 4BKLB 1J48A 1G1OA 2CM5A 3GSVA 4DW2H 4MA1B 2G60H 4N2MA 5CSZA 3S36H 3A4AA 2YPVA 3LRGA 3MTXA 3LIZH 2J1YA 5MP6H 2V5YA 2XX1A 5D72L 4EPSA 2V37A 3PJNA 3BH8A 4MCMA 3BAAA 1MCRA 4GBXB 5HHPB 2R1XA 5IF0A 1EZSA 1K8DA 3K4AA 3TV8A 3GBDA 3EJCA 3KALA 1X5ZA 3WEOA 3UGUA 3P4NB 1BPVA 1DGSA 1A7OL 4KK8D 4KFZC 4QDGA 1GGCH 1I8KB 5FPRA 2X2JA 1FFOA 2YD5A 4QLWA 3GMRA 3BVNA 3G6JA 1CI5A 4NO2B 3D69A 3ARGB 5I5RA 1BVKA 1JGLL 2JKIS 5F7YC 1TTAA 2X05A 1EFXB 2FO8A 2CDEB 2H0JA 4WNQB 5SV3A 3VRJB 5HYQB 25C8H 2MHAB 5KSAA 4Q9RH 5TTRA 2OCJA 2AABH 1GZPA 2I25N 2ZWNA 1RUQL 3VI4F 1RPQA 1T04B 2ZICA 4UF7C 3BFQG 4I3SH 5FK9A 2VQ1A 1AD9B 1RUPH 4AQ8A 5AZEH 3W9DB 1N0XL 1OGSA 2FX9L 3L2LA 4X6CA 3TT1L 5GISH 3A3YB 3QIUB 2UVVA 3U2SB 1XL4A 4RCAA 5A2BA 1D5XA 1FYTA 3TZVC 4I77L 4WHTA 3Q8SB 3RPIA 3O3BA 1M7DB 2QYZA 4MMXC 1A9EB 5ENWB 3UAJD 4MV8A 3E2HB 3GK8L 4JFOA 1I1YA 4Z0XB 2PP7A 1G9NC 1C5BL 4Q2ZA 2AXFA 2EE0A 3RFRA 5D5ME 2F5BH 4R97C 4Z9KB 4BUHA 3TL5A 2W0FB 4EJ1C 2UXCH 1P5UB 2FJHA 3T0XA 4RBPH 5AAMC 3W5NA 3K6DA 3T6ZA 4RU9A 2X89A 4NSKB 2AQ2A 4ZOLF 1LO4L 1CYXA 2EDBA 5JHLA 1XH2A 3HHRB 4ONFH 4QKXB 3Q5YA 5D7JC 3GZKA 1KPRA 4JPWL 4IR1A 2XGPA 2ZP8A 1ZJAA 1G7HA 3PL6B 5I1KL 1RPUA 5IROC 2AJUL 1SVCP 1SRDA 1RK0B 5IVXB 1HZKA 4FQIL 1T7ZA 4Y1AA 2Z93A 3KXFE 2FVNA 4KTYA 3VYPA 2WWMD 4U6HA 3BJLA 3AXLA 3VFVA 2FD6H 3ESMA 3VWJC 3MJ9H 1LEIB 4U6PA 2W9BB 4XNXH 3E6HB 3ZKXC 4ZFZA 4HNTA 1RURL 1I1FA 4EQ2A 5ISZA 4XCFH 1IGMH 1X5JA 4PJAA 4YE4H 1GS8A 3EJPA 5HJGA 4POYA 4M7KL 1A6PA 3V6KA 1N5YH 4N2GA 3TLRA 1YPZA 3PJSA 1NBQA 5I8OH 1UADC 3MV7E 1P7BA 3BQVA 5LVEA 3AU0A 3KXFD 4WW2B 1U8NB 5E1HB 5FHAL 4NJAL 4BKLA 3BPOC 3DJSA 5ICXB 1RIUH 3HE7D 2YAMA 4MJ5B 4ACTA 3M4IA 1I3GL 5F3BB 3WIHL 1CF8L 1HVXA 1QR1B 1FH2A 3FDWA 3N44F 4BYHA 2AEIT 4K7PL 3QG6B 1UACL 1V3JA 1NA8A 4OM1L 3PWPB 5HHPA 4HQ6A 2CUMA 2ZAHA 3OVUB 4KKCC 4MJHA 4WI7A 4QIWE 1N0LB 2IP4A 1Q9OB 1E2WA 2A9BA 4PJIB 1Y1DA 4E9TA 3LZNA 2NZ9D 2VZ3A 4OU3A 3SBPA 1KBLA 4ZTOL 2H3XC 4ODVL 3OWEA 1I8KA 1VCBC 2XV2A 4FKEA 3C6EA 1ET7A 2VAAB 2HT2C 1J9CT 4ZHQF 5IWAH 2Y2YA 4NO2A 1GMEA 3UO1L 3ARGA 4BEIA 2YQ3A 1FZKB 4D9RE 4LIQE 1EFXA 3NACH 2CDEA 3PR5B 4WNQA 4R7RA 3VRJA 5HYQA 2NCEA 5HHVH 4K3HA 1UJ3B 4BCXA 2V0AA 2MHAA 5D1QE 2J73A 3KHOA 2WOBA 3VFNB 2DQMA 1WS8A 3OM3B 5AKTA 1MVYA 1T04A 3BJ91 4UNTA 3BMVA 2VDPH 2R1WB 2YBGA 3KPLB 4HJJL 1AD9A 2OYPA 1FJ1A 1MCEA 2HPTA 3W9DA 3AYHB 3WFBL 4DPBX 3DTXB 2H2PD 5AW6B 3PGCB 2VL5B 3QIUA 1W8EA 5I16B 1JXLA 3C2AL 4OD1H 5D1QD 1JF5A 5CBEB 5FO2A 4L5FL 4KUCD 4PJCF 1ZVSA 3QZBA 3UC0L 4OGAC 1M7DA 1A9EA 3HNVH 1J5OH 1F6FB 4Z0XA 1P4LB 5BZDB 4G7SB 3HOXG 2YQGA 4QOKE 4KHTL 1BVLB 4P06A 3VYNA 4JI8H 3LH2L 2ENJA 1E5BA 2XA8H 4RETB 2W0FA 4AC2A 1DANU 1AQDB 3MKGA 1P5UA 5IG7A 2ZWZA 2ZXWB 2X0SA 4NQDE 3F65A 1YEEH 3EDDA 2D7PA 4GKNB 5JW4N 5FWQA 1KFAH 1IFHL 4JCWA 3WOVA 2XN2A 2WYIA 4HCRH 3TINA 2FKLA 1CT8B 4IJTA 2YA2A 3VFWB 4P57A 2LVEA 4M7LH 3PL6A 2VW4A 1WH0A 4WZ9A 1UD8A 3RX5A 4GQ9L 2XWBB 4O3SA 5EZOL 3SE9H 1RK0A 1GH7A 2OL3L 3IDGB 4L23A 5IVXA 4P59L 3GLZA 2FEEL 3IS1X 4MZIA 4I2XE 3OLEA 4RLDA 1LEIA 5ADPL 2Z35B 2W9BA 4YSEA 1DQVA 3BH9B 3E6HA 5EU3B 1DBAH 2MWCA 4WGKA 5L0QB 4CU8A 4F15C 4YSAA 4NB7A 1UD4A 2VN6A 1YMHA 1HHHB 2OZ4H 3V5DB 2DZDA 1FNLA 3GXFA 3SDAD 3SBRA 4OY9A 1U8NA 2FLPA 1HHKB 3HMWL 3TXAA 5ICXA 3LB6D 4ELMB 4MJ5A 2W9LA 1BWWA 2HSIA 3FTXA 3LIUA 3B83A 4HISA 5F3BA 2D8KA 5DZ9A 5AW0B 1QR1A 2B39A 2MOQA 4HJ0D 4P49A 1Q0EA 1P1ZB 3QG6A 5CNHA 4YOKA 4A55A 3VE0B 3PWPA 3R1GH 4OCSL 1L9TA 3NGBB 1JXKA 1I9IL 1OAQL 2AEQL 1N0LA 2AJXH 3QJVB 3ROLB 1VFUA 1J1PL 1Q9OA 3IDMB 1GAFL 4PJIA 3RTQC 5ID0B 5L4FA 2E2HA 3PWVB 3BDXA 4N0YL 1XGZA 4FHJA 4WKZB 4XN8A 5B4MC 1NGYB 4JR9H 2QV4A 1OWTA 5IHWA 3TTYA 2NYKA 4UT9A 3ARQA 5CEZD 2YIHA 4YHMH 1CICD 5I75B 3GTPA 3AREB 3LP8A 5KFTA 5C07E 4PG2A 2VAAA 2BY3A 3T5WA 1S46A 5D5MF 5K5YA 5JOPD 3P9LB 3SN6N 4TVPH 1FZKA 3ZK0A 4TQEL 2YWYA 1JHKH 2L4OA 5L1IA 4MBRA 1H8SA 5F9AC 2OR9L 3S96B 1RU9H 1UJ3A 2YD8A 4KO9A 5FCSH 5SWSD 3VFNA 3TO2B 1E2ZA 1EMTL 5DGAA 2X4TB 4I3RH 1UH4A 3D05A 5C07D 4OQTL 3QYNA 5C7ZA 1WBZA 4Y1SA 4JY5H 3VWKB 1WK0A 3LQMA 4JFXB 2R1WA 4U6VL 2OYLA 1J8HB 5TF1H 3K2IA 4NN7C 1FIEA 4JJOA 2DI7A 1E5ZA 4HMCA 1J1XL 5JMRA 2V7NB 3DTXA 4JDEB 3PGCA 2J6EL 1DO6A 2XN1A 4YX2H 5I16A 5JHDA 1D5RA 4YEEA 3JQOB 4H1LB 4UCFA 4YZFE 1INEL 5JLZA 2XZQL 4L8CA 4QJ3B 4WIQA 4XN7A 2HXAA 4XVTL 4U7KA 4P23C 3P4LA 1EDHA 1BF5A 3KPOB 3CSYB 1S78D 2O5YH 3U0TB 5KYUB 4XHQA 1P4LA 2APWA 3SYAA 5BZDA 4QGTA 5KTEL 1X5HA 2FLRT 4PEEA 3FZUD 5SWQB 1BVLA 2P0AA 1E30A 3WE6B 2QPDB 5D72H 1COBA 1JGUL 1RZFH 1AQDA 1IARB 3BAIA 2Y0SE 4HC1A 1OP3H 2BSDA 4GKNA 1SOQA 1X9UA 4KRLB 2K7PA 3MR6A 2R8HA 2VB5A 1BMGA 1ZA3B 2XZAL 2DMGA 4X62H 3ARVA 1CT8A 1YCSA 3FFOA 3FOMB 3VYOA 1JZJA 3VFWA 1T66C 4NHUB 2ZOTA 1ITBB 1CFMA 2AQNA 2X1WL 4XWOC 4HULB 2XWXA 5JORB 5M7QA 3IDGA 2J4WL 1UC8A 2R2CA 4LF4H 1G0DA 1TZAA 1JGLH 1U8JB 1J5HA 1SBBA 2Z35A 2KMWA 4DGYL 3ABZA 3GNML 5EU3A 1Q9WA 4W9DC 1ZT1B 4K71B 5JNYB 2IWKA 4X6DE 2QADB 3RBSA 2DQHL 3BEVB 3AWGA 1E5CA 4KITB 1MJJB 2DKUA 1HHHA 4LOUD 4PJ8D 4UOZA 3V5DA 3T5KA 2FEEI 4LSUH 4BSWB 5K2MA 1SBSL 2UZYB 4IBYA 4G6KL 5E95B 3ECVA 1HHKA 1N0XH 1BZ7B 1W2KT 4KUCF 3TN0B 4ELMA 5D1ZD 3TT1H 4KDTA 3UBHA 1SN2A 1KZQA 1U3HC 3KLAB 3MV8E 4I77H 2F7QA 4N4YB 2WTFA 3NCFB 2F53E 4XCCL 1P1ZA 3TH3T 4ZT1A 5H2BB 3RAJL 1YC7A 3RGBA 4QWWC 3MOAL 1DVFC 4LAQL 4Y9EA 2NY3D 4XNMB 4D94A 1E4EA 1GS7A 1M9WA 3ROLA 3CFBB 2IMWP 1C5BH 4ICXA 2AGPA 3IDMA 5ID0A 1WAAE 3PWVA 3VNZA 3MUGB 4WKZA 1NGYA 4FEIA 2WBWB 5F9NA 1ZANL 2A6IA 2YUZA 1KJMB 2F53D 3AREA 1GL4B 1WUZA 4OUUB 4HUMB 4JPSA 4RMTA 1JZGA 4GI8A 1LO4H 4Y19B 2XXCB 3EGXB 3DBXB 1QPPA 3ZR5A 2V7HB 3ASWA 4C83B 3WHXB 3GIZL 4JPWH 1AS7A 3SYOA 2F54E 3FRPB 2X4UB 4B7IA 4OVVA 2WXNA 4LK4A 3S96A 5I1KH 1Y07A 5E2JA 1U95B 1HK6A 2YGNA 2AJUH 3EFFB 2L0DA 4KKAD 3TO2A 3V7AG 4L3CB 4FQIH 2X4TA 5LNGA 2JI3A 5FJ8G 3GC3A 4U3XA 1HI6B 2NNXA 3U6RB 2V9WA 2Z31B 4P2CG 3VWKA 4ETYA 4JFXA 3ZQWA 2W6OA 1J8HA 4IRZL 3KYNB 2F54D 4KI5E 4QMEA 5BUAA 3FB7B 2V7NA 1BXVA 4MHHI 1MZBA 3Q8AA 4KK9D 5G5DB 2Z1KA 5C44G 1IGJB 1VA9A 4GAYB 4H1LA 3BSGA 4YP3A 4XX1E 4JZJC 2NNAB 1EJ8A 5FHAH 4BK8A 2YFNA 3B9EA 4NJAH 3KPOA 3CSYA 3U0TA 1AZVA 1CLOH 5EIVA 5KYUA 2PXYB 2VO5A 3ZHNA 1GGOA 3W37A 2FE3A 2R7MA 3ROOA 5SWQA 2OK0L 2AFNA 3WIHH 4HGKC 3LJ3A 4Y1TA 1CF8H 1OPGL 2CKNA 3OAZK 5DQDH 3WE6A 4BA8A 2BIHA 4B97A 4WI9A 4K7PH 4PJEB 1UACH 4PV1C 1RUAL 4V2BA 4OM1H 3QDMB 1MCBA 2DLNA 3Q01A 4TXVB 4MZRA 3L3IB 2XT1B 3OKLB 4MXQC 3B5GA 2R0KH 3EHBB 1KNOB 3RX8A 5E9DD 4HEPG 1V05A 1ZA3A 3HAEG 4ACPA 1IOWA 3QRLA 1KXHA 3FOMA 2C3HA 4H0LC 3RUGE 1IE5A 5D7IE 1RUKL 2OMNA 4ZTOH 1TA8A 2Q2EB 1OPOA 1F4HA 2UUAH 4NHUA 4ODVH 3OAUL 3H85A 3WO0A 1QUNB 5JORA 2HFTA 4LKCB 1DDHB 3BWSA 1QW8A 3UO1H 1F6AB 2YHGA 3QULB 3QZMA 1HE7A 3VM7A 4RUCA 3QFDA 4B0MB 5CSGA 2WXOA 1AP2B 3RY6A 1E8WA 2XQYK 2ZQKA 2G0KA 4UCOA 1P84K 2LLGA 1CXHA 1ZT1A 3QUXB 4NLHA 1MCCA 5JNYA 2XV6B 4ODWB 1MAKA 1MJJA 3U6XS 4BSWA 3QVAA 2UZYA 1F42A 3HS9A 3FAXA 4HJJH 5F96L 4DEPB 3D4GA 3SDXB 4ZUWB 3RY4A 5HV6A 2F4VH 1T0NB 3WFBH 1BZ7A 3TN0A 3ZE0F 4V33A 4E36A 2V58A 5E8DL 1HN1A 3C2AH 3QW9A 1OEZW 3AG1B 2VLKB 3KLAA 4L5FH 1I31A 2QHLA 1HSBB 3AY4A 4TS6A 5KSAD 3TO4C 1IBBA 3M86A 3SBWA 3UC0H 3VFOA 3K8KA 5H2BA 5AUMB 5HDWA 1FHNA 2YXVA 4XNMA 1NL0L 3ILPB 3CFMA 3CFBA 1UA3A 3VMNA 4KHTH 1N3NB 4YZFF 1U4FA 4KK5D 1THAA 1HNXH 3MUGA 4DR5H 1FFRA 4X5WA 4U3SB 4KJWC 3FYIB 1QWNA 5DRZA 1NIBA 1LO0H 1WLHA 2GG1A 3ATBA 1KJMA 1FYTD 4OUUA 4Y19A 5F9DC 4DKAA 3F00A 1IFHH 1M6UA 4JO4L 5JPMB 2ESVE 2AJZB 3EGXA 3DBXA 4NCC2 3GM0A 2V7HA 4C83A 5FLUA 1FO0L 3FRPA 4DO6A 1T83C 2NT1A 2VMJA 3A4DA 3QJOA 5E4AA 4MV4A 3GB7B 1TT6A 2NY4D 3GSRB 4MQXC 1U95A 4GQ9H 4Y9GA 3EFFA 4J3VA 2OL3H 3ISWA 1Q8MA 1NFKA 1NEZG 3F5WB 4P59H 1MCSA 4G8EB 1X9LA 1TQTA 3CSGA 1HI6A 3HFFA 2EEDA 3QS2A 2Z31A 1RZKL 2X89D 2FLBT 4NO0B 3U6RA 5ADPH 1KJ9A 1KT2B 4L1SA 4F9LA 1PS3A 3KYNA 2NSXA 5ACMA 3M9NB 5I26A 2VYRE 2F7IA 3GMQB 3N9GL 1RZ8B 4OLZL 4HEMA 5G5DA 5ISZE 4N28A 1EEQA 5AVUB 5EOQL 2IOIA 1IGJA 4PJAE 4GAYA 1A7QL 3PG2A 1RVFL 4U31A 1FFNB 3LKSB 2E4TA 4ZFOL 2NNAA 1Z32X 1EHLL 5JUMA 3HMWH 3QIWC 2UZXB 4OTXL 3KVQA 4P2RE 2CUHA 4X6DF 2EE6A 1A25A 1CQIB 1AZNA 3CCHB 2PXYA 4Y5XB 4JEGB 1A4JB 2AVFA 3JZ7A 5ISZD 3PDOB 2CCVA 1BXAA 1UWXK 2YXMA 2OMUB 1G7QB 2P5WE 4PJEA 5JQ6L 3QDMA 2YUWA 3OKEB 3WTUA 4PR5B 1OAQH 2AEQH 2BSED 2F2HA 3DVFA 3L3IA 3OKLA 4MAYB 4YSPA 1B0RB 1KNOA 3OJDB 4BFKA 1J1PH 1GAFH 4F8TA 4FADA 4X6EB 1ZHKB 1XAUA 4LP8A 4N0YH 4RGNC 1J12A 1EUUA 2CHXA 4Y4KC 2GPWA 2XETA 4EFEA 2B77A 4B3VA 2P5WD 3KJ4C 5IQOA 1QUNA 4UDTB 4EKXA 5H4ZA 3FQXA 2P44B 1DDHA 4LKCA 1DHKA 1F6AA 3KHQA 3QULA 4GBXD 4UBDC 3VFRB 4TQEH 4AQ1B 2MOGA 3PP4L 4EYHB 3SDCC 4OIIL 1WUNT 4QWDA 4ODUB 4PJGE 4OIBA 3O45B 2P45B 1INDL 5IFJA 3BD5A 2P42B 4MZ3A 5DZNA 4ODWA 5DZVA 3RYMA 5L1JA 4JI3H 1RZPA 4OQTH 5D93C 2EC8A 2BSTB 2XCPA 3PVXA 4U6VH 3ZTDC 3C2SA 4QUOA 4OFVA 1E4KA 4U2ZA 5E1AB 4ZUWA 4H8WC 3ARGD 1J1XH 1T0NA 4QKTA 2NQ3A 5DRNB 1LTXA 2H3NB 2J6EH 4NJ9L 1EFXD 4JHAH 2R69L 1VGKB 4H5SB 3HAEH 2VLKA 1INEH 4UM8B 1HSBA 2XZQH 3BMWA 5A1AA 5C6PB 1P5VB 3TPUB 4XVTH 2G2RB 4P5TC 1EV2E 5AUMA 3P0GB 4DP8X 4O3NA 5J1AA 1Z1WA 2HX7A 5KTEH 3ILPA 1FYHB 4GRWB 2R29L 2B63G 4FTVB 3MC0A 4KJQC 4YAQB 5CN1A 2ZOLB 1JGUH 4U3SA 2PO6B 3QIUD 2XFGB 5GGSB 3CXFA 1FAIH 3UIZA 2BOBB 5KJ7E 2GAZA 1WISA 5JPMA 3FFCE 2AJZA 4RA0C 5AB9A 4PVLA 2E9GA 4GAJH 4HNUA 3MROB 5DJ0B 1AN7A 4N0CD 2D4DA 2IOOA 3GB7A 4Q4EA 3GSRA 1P6FA 1H3GA 4IW4C 2RQEA 1A7PH 3CZJA 5LBSL 2J43A 2GW5A 5DVKA 2J4WH 3NDYE 4KVCL 1I85A 4NP9A 3F5WA 3FCGA 1DVTA 5CM1A 2C3WA 4G8EA 5D7IF 4NO0A 1KXQE 4DGYH 5F9LA 1KT2A 1TF4A 1TPXB 3AGWA 3GNMH 2IGTA 4W6XB 1YNLH 3CFQA 5IZ7A 3UZVB 3GMQA 3TA3B 1RZ8A 4GINA 1HILB 3L1FA 3B2MA 3WNJA 1SN0A 3G6JF 1WZLA 3PL6D 1ZSDB 2WGNB 3K5SA 1SBSH 1FFNA 3FTVA 3P9WB 3LKSA 4G6KH 1JNHA 3M7FB 4UZSA 5AOLA 5INDB 4J3XA 2A74B 4KMQA 1H3PL 2UZXA 3KCPB 1S7WB 4KJYB 4HOXA 2OXGB 1Y14B 1YMME 5MEOB 3U2JA 1E65A 1MZZA 2IPUK 4NQSB 2R9HD 3MJ7B 1A4JA 3H53A 3PDOA 3ZR6A 2J88L 4XCCH 2OMUA 1G7QA 3QZWG 4UTAL 2EDRA 3GTNA 3WJLA 3RAJH 4ED7A 1LVEA 3OKEA 2WXRA 3TM6A 4PR5A 3MOAH 4LAQH 1ID5I 4J3SA 1IGTB 1SXNA 3KAAA 4MAYA 4X6CF 1B0RA 3OJDA 3K4ZA 3PWPE 3EH4B 4PS4L 1ZHKA 4X6EA 1TLMA 3V4VB 3HBPA 3WFZA 2EDKA 3N41B 4AEIL 1ZANH 3K81A 3IG0A 4FG4A 1QSZA 1PZBA 2B2XH 2ERJC 1LWRA 4UDTA 2I32A 4ZG1A 4DP0X 3TJPA 1TMCB 4TV9F 1IMHC 2BZ7A 4AQ1A 3PWPD 3DWTA 1T94A 4CVWA 5B3JE 3IGLA 4K8RC 3DO3A 1BZEA 4W81A 2XBDA 3HNTL 3IAQA 4CN1A 4ODUA 3BLKA 3O45A 5GQBA 5FD6A 1SJEB 3MUHL 1CK0L 1FC2D 5E4IA 4F7EB 1KIUB 2D7TL 3NCYP 2WO2B 1LM8V 1YO4A 3QUYC 2J12B 5EN2B 2CRZA 5E6IB 3MV01 2BSTA 2XFXB 4EYIB 2WLNA 4EF3A 2G3ZA 1JTPA 2KT6A 4EEQA 4IRZH 1JTOA 2OSYA 5HPMB 5E1AA 1T3FB 4PY7B 3IN5A 3OJVC 2IQ9H 2UZPA 2Y23A 4TM9A 4F4XA 5DRNA 2P5PA 2H3NA 5AZUA 4LQ1A 4A3DG 4JX0A 1VGKA 1WGOA 4H5SA 4JG1L 5I6LA 4XTRD 5KANI 1Y1WA 4M6AA 4UM8A 4BELD 1P5VA 4DT2A 4EI0A 3TPUA 3FYEB 1ZHQA 1NBYB 2G2RA 2VXVL 3IWUA 2WAQE 5KVGH 1O5DT 5DD1L 3WXVL 4YR6B 4TNVF 4PJAF 4I87A 4YXKL 4DERA 3O0RL 3BGFC 4FTVA 1OPGH 4YAQA 1JGIA 2APXA 2ZOLA 4UQ9A 4ZRGA 5C0JA 2PO6A 5E24E 5KG4A 5GGSA 1Y1VA 1OF2B 2D9QB 2BOBA 1MY7A 1RL1A 3P1VA 4BH8B 4K15A 1XIWC 3R4RA 2JJTA 4TKWA 5DHEA 5KVDL 1CFSB 3LMLA 2MOVA 3KLHD 2WWKO 3MROA 5DJ0A 3APMA 1TQCC 3OAUH 1KACB 2IH8A 3QEQB 4O9HL 5ABZA 1BDYA 1HCFX 3WN6A 1Y7VA 2G5BB 3NP4A 2E9BA 4XN9A 1EO7A 2QT6A 5F2FA 2WQ8A 4KQ0A 4ZMOA 3I12A 5DUML 1E5UI 2PTTB 3CHPA 1BF8A 1SEBB 3NSJA 2KDGA 4KXBA 2HVKA 2KZWA 5F0JB 4S1RL 2B14A 2VMFA 2H1LM 3ERXA 3UZVA 3TA3A 1M57B 3V6OC 2NU6B 4PIRF 2EUWA 3WENA 1ZSDA 2R4RL 4DV0H 3CSBA 4NO3B 3HJEA 1IGYB 5F96H 5FGBA 3MJWA 5INDA 4WI5A 4PJGF 2A74A 4ME6A 3CN0A 3GXDA 2X3CA 1S7WA 2OXGA 2EO9A 5E8DH 3DOIA 5MEOA 4NC0B 1UA6L 2YR3A 3I74A 4H8PA 4BIKA 4NQSA 1U41A 4ABVA 3MJ7A 4N2KA 5C0GB 2VZOA 4I4WB 2EE2A 5AW8B 1RJYB 1X3DA 1QKZH 2M8XA 4MSWB 4QRSB 4ED8A 1X9NA 3PUCA 4X5PA 2GPSA 2HVBA 1QATA 2BVQB 5BZXA 1IGTA 1NL0H 1W8OA 4Y2DB 3SSGA 4WY7L 2BRRL 5MI0C 1SYXB 3OZLA 1OAKL 5JXAH 5LNEA 3V4VA 2ARJA 2F7OA 3NCXA 3VFGL 3WD5H 5C0IB 5B8CB 5JPNC 3ML8A 1X5XA 4UNIA 1ET8A 4OZGB 3Q1KA 4JO4H 4CN6A 2ZKHL 2W92A 5I8CB 1ZLEA 3KHRA 4EBEA 3UBXB 3NJJA 1JVKA 2EADA 1KN4L 2VLRB 5I1GL 5AL8A 2X6MA 3II1A 4KNTA 3H1ZA 4U05A 1C16B 5FF6B 5J6SA 5FUOL 3L3KA 4UV4L 1SJEA 3S3JA 5GGUB 4F7EA 1KIUA 3ZZLA 4I1RA 1O6SB 5T3XE 4HF5L 2GBTA 1DUZB 5E6IA 2XFXA 2F58L 3ARED 2WANA 1LEGB 3RGVC 3QUML 3RGHA 1ZGLB 2BS71 3FULA 4WUKH 5GS3A 1T3FA 4PY7A 5HPMA 5KFGA 1X5MA 3N9GH 4K8RH 4OLZH 5E70A 5EOQH 5F7WC 4P2AA 1A7QH 1RVFH 1WYJA 4FI8A 4HBCL 4WUUB 2ICES 5T3XD 2AANA 4R0LB 2XUWA 1NBYA 1EHLH 1ES0B 1R0AL 4XT1C 2YN3A 4FFZA 3EOBB 4OTXH 2X4OB 4AI7A 3H4DA 3QJRB 5DVOA 4N8UA 4N26A 7CGTA 4PI0A 4YR6A 1Z2KA 4N20A 3VWKD 1PSKL 1WTGT 1I9JL 4HJIA 4KKBC 3EJUA 1J8HD 5L2JB 3GXTA 1YEIL 3WTVA 1FVDB 1R6VA 3ZTEA 1WGVA 2CU9A 3CHQA 4JHBA 1DSYA 1ERNA 3N1PC 1RFDL 5CGBA 5BZZA 5JA9A 3GBLA 1BVOA 5JQ6H 1OF2A 5C0CE 4HH8A 3MLSL 4WW2F 4YHPB 4BKTC 3VQ1C 4MV7A 2J25A 4Z7UB 3EGDA 4BH8A 2B9BA 2Z7WA 4JKMA 2X1QA 2OULB 1PZUB 1LGVA 2FBJL 3IMBA 4I4TF 1CFSA 2VSDA 1UC6A 3J8F7 1M05A 3EZJB 1IC7L 5HYFA 3QWOB 1OE2A 1TG8A 3BSHA 3HI1B 3WHE1 3QEQA 4JDZB 5C0CD 4XI5C 1QSFE 2CR3A 2G5BA 2V5MA 3RZWA 4FXKC 4A66A 1C8PA 2PTTA 3PP4H 4YLQT 5LO7A 3MI6A 4OIIH 5IY5B 1INDH 1CXFA 5DHVB 3MO1B 4UQEA 2D3NA 5TD4A 1X4XA 5A6IA 4UOW0 1ED3B 5B3JF 1YHPA 2B1OA 5CEYB 3SJVB 4NO3A 5HD8C 4YHOL 5DEFB 3MNMA 3ZMNA 5FECB 1W15A 4BQCA 4WO0A 1GTNA 2CGYA 1S7XB 3FN0L 3UP1A 1FNSL 1WS7A 4NJ9H 4PWEA 2YA0A 3WNIA 1PJ9A 2R82A 4HKBB 2R69H 3QB7C 1T22B 5IVNA 2GSGB 4N6QA 3D4YA 3HG1B 5C0GA 3APCA 4I4WA 1RJYA 4MTMA 3GSWA 2QADD 4MSWA 4QRSA 1IM9A 2EIEA 2BVYA 3O4OB 4P5MB 1BEYL 1TETL 1CCZA 2BVQA 4TSAH 2ZDHA 4Y2DA 1DO5A 3WY2A 3HI6L 3RAQA 2YK1L 4RNMA 2R29H 2N59A 2UYLB 1F00I 1A0IA 3M46A 5GZOC 1I1AC 2ICWJ 3TN0D 1FO0B 4D8OA 4G6AD 2DQIL 4LL4A 4PWHA 5KEZA 1PZ3A 4TVPE 5B8CA 5C0IA 4TOYL 2XI9A 4MD4B 4WTQA 4XP6H 3CDYA 4PJ9C 3WEXB 2DYSB 5K9JH 1KG0B 4OZGA 5SWZA 5L2KE 4JVUA 4XO4A 2B1AL 2AZUA 3UBXA 2VLRA 2MKLC 1GSMA 2K78A 3WEAA 2ZUWA 1JPTL 4IRZA 1C16A 3R4DA 5FF6A 4IMKA 5LBSH 4K9JA 1GPOL 4NN5B 1FVEB 2Y22A 4PRBB 4TVPD 3VPDA 4HD9A 4MRCA 5GGUA 4ZMQA 4N3TA 3QQ3B 1O6SA 4ZI8A 1AXTL 1LP9B 3AXHA 1DUZA 2J3SA 4NLAA 4WK2B 4FLSA 4ZBJA 1WBYB 1CXIA 3ZUCA 1AOZA 1USZA 2KSWA 4Y19D 3MOQA 3B7TA 1ZGLA 3JRWA 2NU9B 4IOSA 4NLGA 3K0WA 5IVOA 1WRFA 1N8ZB 1BJ1H 2N56A 1F4WL 3RDTC 3BGMB 1X6NA 1KXTB 4WUUA 5I8EB 4R0LA 4XB7A 3C6LC 3QCTL 3WTYA 1ES0A 2YO3A 1H3PH 2AI0H 3EOBA 4NWUL 2X4OA 1CTNA 2VMCA 3DJ9A 2Z31D 1YYLL 5IBTL 1UASA 2R56H 5D4IA 5FYKH 5L2JA 5FYKU 1FVDA 5HVGB 2GJJA 5KG0A 3RB5A 4UDUB 3T0VA 2J88H 1OE1A 3BVTA 2YD2A 4UTAH 3BZ4B 3PIQB 1FZJB 1E6JL 3D87B 3NTCL 4YHPA 4PJEE 3X1FA 4IIZA 4ELMF 4Z7UA 3F7YA 3QUZB 3RGXA 2WUCL 5FC9A 2DD8L 5GSRB 3LMJL 4K73A 2AXHA 4LFHD 5HI3D 2PXYD 3TCTA 3N42F 3EH3B 2AS5M 4U6XB 4ZTPL 3NRFA 3QWOA 3HI1A 2CK0H 4JDZA 4PTUB 5I8KL 4LLVB 5IYDG 4EEEA 3VO0A 2J1ZA 3QDMD 2Z8WC 3NFSL 5CJQL 2ARWA 4EUPG 3WNPA 4CC4A 2I8CA 3EHBD 1CD1B 1T89C 2WTPA 3HNTH 4AW4A 2L8AA 3E6FA 5DHVA 3GGWB 3MO1A 4FMVA 1CK0H 5EUOB 5J56B 1JZ7A 1FFQA 1I7TB 2VR6A 4X5RA 4IJ3B 3SZKC 1IIIA 3KGUA 3LSOB 1ED3A 1XGRB 2DWDB 1IV8A 2QHRL 3HMXL 4IGBA 4LPVA 5CEYA 3ZRSA 4A7SA 5DEFA 5FECA 3WFDL 1FN4B 2DL2A 4AGMA 4OCXL 3FUIA 3S3SA 1S7XA 2CGZA 1T80A 1KTDB 3F05A 4JFZL 3SDXE 1F1GA 4ECVA 4J12A 3V2AR 4HKBA 5DVLA 1WFJA 4LOEA 1XCTB 2I85A 4JG1H 1T22A 4NCC1 3OHAA 4L4VB 3IFPB 4PBDA 2GSGA 4PMEA 3HG1A 2CO6B 1OB0A 2VABB 1A6TB 3CC1A 1YDPB 3QUXD 2O4EA 5KYYB 2VLKE 2VXVH 3MLYL 3I4NG 4WJKB 4P5MA 2VUMG 5DD1H 5EBWB 2V8MA 1EIBA 3OB0K 2ORBL 2EYTB 3PNWB 2HG5B 3QI9B 1J9SA 2DAVA 2UYLA 2GABA 2VIRB 3BQ0A 5LBVA 4A67A 5CZXD 1FO0A 1KV7A 2EVIA 3GZPA 5TE6H 3RIAF 2V3DA 3BFOA 4R3SA 4Y2NA 1L9PA 4XNZB 4MD4A 2VLKD 2APBA 3TOPA 3WEXA 2OSXA 1GW0A 1KG0A 4QJ5B 5BRZB 3AS1A 4OZHB 4P2OC 4AKQA 5GS0D 5KVDH 3S4SB 1WA0X 3I6KB 4IKJA 4Y4HC 2P46B 1EHXA 3SOTA 2XVKA 4IKIA 2CZGA 1K85A 5HHXL 2QPEB 3ZKNC 3QJUB 5HBRB 1KEEA 5DFAA 4DGUA 2F5AL 1ZHNB 4YFDB 4PRBA 1FVEA 4O9HH 2VWEE 4XPBL 3QQ3A 1OAUL 1GYFA 4N2HA 1LP9A 4XMPH 3EADA 4PP1C 3ARUA 4E9SA 4OT1L 5DUMH 4HXBH 2Z1PA 4NRZB 3B1TA 3H2WA 5BRPA 2HLAB 4PCYA 2GK0B 4S1RH 1K1SA 3MA9H 1MQKL 3EYSL 4XNBA 3O2WL 2B8OT 1ZTMA 3DX9B 4QRPB 3BGMA 1KXTA 3DTUB 5I8EA 2H6PB 3LPGA 1CDYA 3HZYB 3GEWB 5F7KC 3LRSB 2Y07L 2W07B 4HAKA 2L7QA 4AUYA 4ECRA 2BERA 4PRPB 3S5LG 4RNNA 3VX1A 4N3UA 4N8VB 2BVEA 1ASOA 4NO0D 3RB6A 1UA6H 1ZIAA 3QE5A 1RLWA 1AXIB 2CBPA 5HDQL 3MWEA 3UCRA 4UDUA 4HGWB 3ISYA 4HLZG 4QNPE 3BZ4A 2X0WA 3MLZL 3PIQA 3ARYA 3TURA 1FZJA 1K4CB 1PYWB 1H8OA 4RMRA 3IEAA 3HZVB 3QUZA 1PD0A 2BRRH 4WY7H 1FBIL 1D5ZB 1OAKH 3NJFA 4PGJA 5GSRA 5DZJA 2OJZL 1QFWH 2J8UE 3GSUB 3VFGH 1LNUB 1F90H 2WC7A 3HKFA 4JRFA 2DLGA 4AYEC 4U6XA 3I6SA 1PFOA 4F9PA 3AM8A 2YWZA 4PTUA 4OGXH 2ZKHH 3HBQA 4LLVA 2DTSA 4H25B 2R86A 5CD5C 1EHAA 2YMOA 5SV4A 5C0FB 1KN4H 2JJWA 3FO9B 5I1GH 2X9XA 5EOYA 3ATEA 1IAMA 4FNSA 1CD1A 5T5NG 1WCMA 4DR3H 2L7JA 5FUOH 4UV4H 1KCLA 3L9RB 4XZ4A 4J9KA 3GGWA 5EUOA 4FEMA 3F7VB 4Q6YA 1I7TA 1QEXA 4LFCH 4HF5H 2VLJB 2DQDL 2Y69B 3LSOA 1XGRA 2DWDA 5GHWL 2F58H 5D7LB 3PLYA 3NAAL 4ZS7L 3S0PA 2HPOA 3QUMH 4I0KA 1FN4A 2D3LA 4L5FE 2HJWA 4J6RH 2Y36L 4G5ZH 3KS0J 1UM5L 3KLQA 4HSCX 2X40A 3FT1A 1DFXA 2C3XA 3MCLL 4JQVC 1MG3C 1A21A 5GXBB 3MN8A 1XCTA 4DHLA 4L4VA 1N18A 2JA8G 2UVRA 2AQQA 2CO6A 2VABA 4HBCH 1A6TA 1BBDL 1YDPA 5KYYA 1ZSHA 4PSRA 3WMPA 4AYSA 1R0AH 2VDKL 4H2CA 1K3ZA 2OH2A 5EBWA 3VD7A 1FZOB 1ECZA 2EH7L 1WSST 1PSKH 1I9JH 2EYTA 3PNWA 5HHNB 1YEIH 2HG5A 3OV6A 3QI9A 3CBKB 2VIRA 4KRPB 2QELA 4V2CB 5AW7B 2IBZX 1NM9A 2X4NB 5LLIC 2CHNA 1AMXA 1MWOA 4FTVE 4KKNA 3TVMC 4AJYV 2EAEA 3VD2A 3MLSH 2J71A 2MIZA 4PIBA 5BRZA 4JI1H 4OZHA 1PKQB 3LV3B 5E8PB 1FA4A 3S4SA 2FBJH 3I6KA 4KUZH 4ELDA 2MPAL 2MTAA 2WY3B 1XBDA 2D0GA 2E8YA 2W71A 4PJEF 2FQDA 1IC7H 4JUZA 5IJDC 2I27N 1VGEH 4L0YA 5DR5L 1ZHNA 4FTVD 4IRSB 1M7IB 3C5XA 2PO6D 1N7MH 3M8OL 4WLCA 4JPQA 5TDOB 1HL4A 4NRZA 2HLAA 2GK0A 3H3BC 1BYNA 3H9HB 4UI2A 1UM6H 3QC6X 2A4CA 3UADA 3BAEL 1P7KA 1TNMA 1GC1L 3WG7B 3ZJAA 3HXLA 1XWVA 2R15A 2EDTA 3JWNG 4PLJD 5DK3A 4NP4L 2ZYRA 3ECQA 3DX9A 2B5IB 3CUPB 2YD7A 4QRPA 4YHOH 2H6PA 5DT1L 3UPCA 2W80C 3W11D 4MX7B 3CX5K 3DX4A 4X50A 5EOCL 3LRSA 4NUPA 2W07A 1MAML 3WLBB 3JVFC 3VW3L 2VLMD 4PRPA 3BWAB 1SUHA 1FNSH 4N8VA 1YYCA 3T4AC 5AWNL 3FTYA 4XMUA 1CJYA 4WEMB 1DQKA 5EBGA 3TIDB 3EGSB 5DJZB 1HNFA 4XH2B 3QWQB 1MW0A 4N0UE 4HGWA 3TA3D 3UFIA 4FU0A 3JWNC 1VEMA 2W9CB 2G2PA 3SDXF 2DKSA 1BEYH 1K4CA 1TETH 1PYWA 3AS2A 3HZVA 3HI6H 1K2DB 2YK1H 1D5ZA 4G6FB 1QEWB 4KGJA 2APTA 4ZZKA 2PPEA 1NDGB 2DQIH 3GSUA 3K46A 1LNUA 4TOYH 4X7TB 4ZOBA 4GMSL 5CGYD 3VUAA 4O58L 4RDQF 3DECA 2A0LC 4XVUD 4Y9CA 1KYOK 3VH8G 2EDEA 5KFKA 1F3DH 2WQRA 4H25A 3VM5A 1JHTB 5C0FA 5KJ4A 5GGRB 3FO9A 1BQHG 3LPWA 1JPTH 2QTEA 4NOBA 4WEBL 4WO4C 3NZHL 4DUYH 5I47A 3GF8A 3OHXB 3L9RA 2ZF9A 3PWLB 1GSHA 3F7VA 5B7FA 1PZDA 2ZDQA 2I9TB 4RIRB 1AXTH 2VLJA 4RAUB 3LRLA 3P69A 1S9YB 4ZXBB 5AYUL 1FI8C 2WYOA 1XTMA 1XSKA 4GB9A 4PRHB 5D7LA 4JK0D 3P3YA 4HLZH 15C8L 2ZPKH 3DOSB 1K5WA 1CDCA 4LPUA 2IO5A 1SLWA 2IOMA 4RRPM 3VCLB 1IIKA 5DYOB 1E4JA 3OGOE 4LAJH 1F4WH 4ZZFA 1KCRH 3V0VB 4H0GA 3P02A 4U1IB 5D2LA 2FT6A 4KK6C 2SCUB 3BA9A 2Y7QB 3DHUA 3QCTH 3GIDA 1K83A 3HE6D 3MXVL 2OI9B 4JFVA 4Q7DA 1FZOA 5D7HA 5IBTH 3BUDA 4TQ8A 5HHNA 3HNSL 4DGIL 2A3TA 4WV1B 2X4NA 3ETBF 4DPAX 3MLXL 1KYDA 3ABGA 2H3KA 1E6JH 2Q6WB 4CSTA 2GLTA 4IDJL 4LMQI 1KULA 3FN9A 1L3WA 3IMVA 1IJNA 1PKQA 4X9HA 3LV3A 4XNQB 2FHCA 3KHLA 5J11C 3CZEA 4L2LA 3CQZA 4I50F 3WIFB 2DD8H 1ZV5A 3GTTA 3LMJH 4DV5H 4QNPF 3ZYIA 2I5YL 4R4NC 4ZTPH 1L7IL 4IRSA 3THML 3HOYG 5I8KH 3GSNL 2DQUL 3GHEH 2CJTA 2BW5A 5D1XC 2YN5A 1MZYA 4HXAL 3NFSH 5CJQH 1GVIA 5TDOA 3A23A 3GFUA 4WTXA 2ZX9A 4XXCA 3H9HA 2VDOL 1KC5H 1UB5B 3CZNA 1RERA 5ANME 3JUYA 3WI9A 2NT0A 4HT1L 3HG0A 3L17A 4AK1A 1BM3H 1E67A 1OQXA 2CDGB 2QHRH 4GS7C 3HMXH 3US9A 4BXVA 5EFIB 1RJZB 3CUPA 3NCMA 4MD0B 3QEQD 3WFDH 3B9KB 4MX7A 1A4BA 4OCXH 5D8JH 4FG6D 3WLBA 4GY4A 3BWAA 1HOCA 2VXUL 4JFZH 4UINH 1VESA 3RWIB 2K4AA 4RNRB 3TIDA 2FEDC 3EGSA 5DJZA 1Q9KB 4XH2A 5DMGD 4XMKL 3FQTB 2VDLL 3MLYH 2W9CA 4TTDD 5DDHA 4MGXA 3T0EE 4KTDL 3FU5A 3L4ZA 1OB1B 2ORBH 3AQXA 5G2NA 3DUHA 1K2DA 3OHBA 4BSVA 4DNLA 1OD7A 4FQ2L 1NDGA 3O81A 3SGKC 3TZVB 4X7TA 3PZPA 4U1KA 3UTPE 4ZMXA 3QDGB 3OSPA 3WO4B 3MOBL 4RGNE 3FQ2A 3JWNH 4HUWB 3U9TA 1JHTA 4C59B 5HHXH 4Y2DD 4JRWA 4XWGL 4QHNB 3GRWL 4XPAL 1R75A 2P80A 4M56A 2XIGA 3OHXA 1CYWA 2XCMC 3PWLA 4XPBH 3NCEB 4A1RA 4RIRA 1OAUH 4MBOA 4RAUA 3UTPD 4ZXBA 2I9TA 1S9YA 4XO3A 4OT1H 4DZ8A 4PRHA 5AAWA 2RFXB 5F44A 3DOSA 4JFQB 1U33A 1G0YR 3MJ6A 1DV1A 2GEQA 3VCLA 4Y7OC 1VKXB 3O8XC 2VLRD 1MQKH 3EYSH 3VDBA 5DYOA 1S5HB 5E4EB 3MMEA 2QPSA 2UXFA 4P46C 1QW9A 3O2WH 3V0VA 1XNQH 4U1IA 3DV4A 2BCMA 2VXSL 3G6AB 2Y7QA 2JSFA 1OW0A 3QHTC 4IRJB 4JFUA 5ESVB 5D96C 2Y07H 2ILLA 3UG3A 3VWJB 5ID1B 2NYYD 1HL9A 1LMIA 4NX0A 1NKOA 1TCMA 3K3PA 4I7ZC 3ZL1A 1VFMA 5DF0A 3T0BA 1BD2E 2NDFA 5HDQH 4PVBA 4IOSD 2VQ4A 3UOAB 1QABA 4WV1A 3FFDA 2KC0A 1F13A 1U42A 3H55A 4RESB 4DOHB 3BPLC 2PN1A 1A66A 4XOBA 3C12A 2Q6WA 2ATAA 1JZ8A 3KE0A 1HCYA 3SQBB 2RR3A 4LZKA 3CFEB 4WUUD 4QJ4B 5I6XB 3QAZB 1J87A 1OCRB 4XNQA 1UATA 4LP5A 1MUJB 3BPNB 1LWJA 2A6KB 3QZNA 3WIFA 2X2YA 2J1WA 3TF7C 1SGKA 2WKLA 1JWUB 5DGQA 1I7RB 1EGJL 1YRKA 2WOYA 2XTJC 3BWUF 3NJVA 1IEBB 5AVSB 5BUGA 2JQMA 1FQ9C 3V9CA 2V5AA 1DEEB 3SCMD 4EDWH 3INUL 5CKAA 4ZMVA 2FT7A 5F9JB 3JVGA 2XV0A 4YHHH 3N41F 1EAPB 2QMJA 5CIPH 1UB5A 1E40A 5AB1A 1KBKA 3HUJE 3L1OL 3QEUB 1SDDB 1FORL 5I30L 3FO1B 4BQ8A 1B2WL 4PGCB 2CDGA 1MW3A 4CU6A 5GHWH 5EFIA 1RJZA 4BWUA 4MD0A 3GJFB 1QASA 4LCVA 4ZS7H 1G84A 3B9KA 1RZJC 1WQVT 5J12C 3SJVE 4Z23A 2Y36H 3D07A 4CSZA 5I0DA 1UM5H 1EZLA 3MCLH 3G9VA 2BLFA 4OJAA 3RWIA 4TNWF 4RNRA 1G1YA 4KQ4L 1Q9KA 3GXMA 2C9QA 1BBDH 4LCYB 3AABA 5F70A 3I9PA 2YAPA 3FQTA 2W9AA 2VDKH 3IXTB 4I9XA 4HJUA 2A1WL 2YEVB 3SJVD 5KSBA 1OB1A 2EVGA 2IDCA 4UILL 1HKFA 4IBVA 1OF0A 1QLEL 5GS1B 4K3EL 2ZWYA 4N5ED 3NPZB 4YXHH 3QJQB 3PHOB 2GVYA 4P3CH 4TSBL 3TZVA 1JRHH 3QUHA 4ZS6D 2J6SA 3HG1D 3QDGA 5DUBB 2LTQC 4IRDA 1N48A 4J6IA 5KAQG 4HUWA 2XVGA 4M8UA 5A7EA 1GJUA 2MPAH 3S7GA 1C5CL 4D7BA 4UCVA 3MLPA 4J0MA 1ACCA 3QHZL 1PDKB 4QHNA 3WUWG 1RJPA 1U0QA 5DR5H 3PYCA 1QI5A 3HCVB 3IM1A 1EX0A 5AAMA 3EH1A 4NAMA 3M8OH 3FS9A 1DL7L 4XBGB 3DHMA 4A7GA 5EUKB 3HVDA 1C1EL 3SB3A 2RFXA 3N40P 5HDBB 3D08A 4JFQA 3D25A 3LD8C 4GG8B 3BAEH 1S7VB 2ATPB 2E5EA 3KBEA 2FHFA 3LX9A 1Q0XL 1S5HA 4NP4H 5IROA 3U48A 4HCGA 4LF9H 3QT2A 2OZNA 1UXMA 3G6AA 4IRJA 5DT1H 2ARJQ 5ESVA 1KJVB 1EYZA 5EOCH 1G9ML 2G5RA 2Q8BL 3VWJA 5ID1A 1A9XA 4DJMA 3JRXA 3CQQA 3CFUA 5AWNH 4UZGA 2F8XC 4B3MH 1U4EA 4OZFB 4ZODA 4F15B 5IHBA 4AEFA 5LXTF 4R4FL 5J13C 2VW6A 1WAEA 2D0FA 3IU4L 3WMQA 2LAAA 4GAAA 3SQBA 4M02A 3CFEA 4HIQA 5CP3A 1XXFC 2E7CA 5C0NC 2A6KA 4IBUA 3DIVA 1LE5B 2EEAA 5J5EA 1JVLA 5DC0A 3I6GB 1JWUA 5DD0L 1JI1A 1I7RA 4AYMC 4GMSH 4Y9FA 1T5WA 4O58H 4HBQA 5DMIL 3IN2A 1V9PA 2APVA 1CU4L 2WLLB 1IEBA 1I1CA 4M00A 3MNVB 1DEEA 2G0LA 4NHCL 4Y2LA 5B1CA 4ANKA 3CC5A 1SQMA 4JQIL 4LGRB 4GPVA 4IK6A 4RFNC 4WEBH 4LEOB 4EGQA 3NZHH 5F9JA 3GJFK 2PYFB 2XIDA 4F5CA 1EAPA 2WXMA 3QR1A 4PUBL 4DKEL 4F57L 4TTGA 1A7NL 3ZE2E 2DLHA 1SDDA 1T6WA 5BRQA 3QQ9D 3FO1A 4BWSC 3FQ1A 1IRAY 4JDTH 4PGCA 5EUOE 5AYUH 5K69A