3N42B

Crystal structures of the mature envelope glycoprotein complex (furin cleavage) of chikungunya virus.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
338
structure length
338
Chain Sequence
NFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNMGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 envelope glycoprotein
publication title Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography.
pubmed doi rcsb
source organism Chikungunya virus
molecule tags Viral protein
total genus 59
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2400 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n42B03
2.60.40.3200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n42B01
3.30.1490.280 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n42B02
3MUUA 3N43B 3N41B 3N42B 3N44B 3N40P
chains in the Genus database with same CATH superfamily
4K5NA 4ELMB 4MSWB 4ETQB 2KLRA 3IXAB 2XVBA 3M9NB 5IVZB 2A6KB 2XNAA 4A7GA 3D3VB 4JUTA 1BM7A 2UVVA 4ETYA 1J5HA 3LIZA 1FDLH 1T7YA 2X0UA 2QVFB 1GMEA 4QWCA 1HIML 5EG6C 1QUNB 2ORBL 1NC2A 3D0AA 3RX9A 5KTEL 2V9WA 1NGXA 3MZTA 3NSDA 3WG7B 5FM5O 2QFPA 3DA0A 4BBWA 2FWSA 3U9TA 2K6WA 2X4UA 4D8PB 2VOBA 3QH3A 4JFDA 4MZIA 4AG4H 3CN4A 1FVCB 4PJ8A 4AZUA 2YD5A 1WYJA 4R83A 4Z0BL 3RL1A 4NJ9H 2W8KA 1YY8A 1QQDB 5SWSB 5IJDC 5E8EB 3SDXA 3TYGH 1GPOL 4M4RA 3HBPA 3WO4C 3X1FA 3T08A 2JKLA 3X13A 3T1FA 5DR5L 3K1KC 4TPRL 3RZCA 3E6HA 2ZXDA 4CSTA 1DBAH 4D0DA 5ICZB 5EIIB 5GGSY 1SOXA 3JWNE 3D18B 5FB8B 2Z7YA 1PYWA 4KNTA 5GS1A 5J9PB 3SPIA 2Y7MA 3QQXA 1OANA 1PSKL 1MFEH 1BF8A 1EZLA 3HOYG 4ABUA 2XGQA 5FUZL 4P2RE 4PREB 4BZ1A 4DAGL 1DQMH 3CMOL 4JDZB 5I1CL 3OAWA 4KRMB 2DLFH 5CZKA 2HA1A 4MD0B 4KWUA 3C60B 7FABL 5AW0B 3VU1A 1JWSB 1EX0A 1HXYA 2XVKA 5D4JA 4UZGA 2FSEA 2PUQT 3DUHA 4M1GL 1BECA 4QXGH 5DJDB 4PJDB 1J5OH 1TWAA 3SE3C 5JO5B 3OMNB 2YCHA 3VD9A 1CLOL 1UKSA 4KQ0A 5JPNB 4MLSA 3PIQB 2ADIB 1PTZA 3DXAA 1HX0A 3FN0L 3VDBA 2ZSVA 1JPSL 4PWJA 4FL4C 3NJNA 3B2PA 3RWEA 3I85A 4HEMA 2RFXA 5KFVA 5INDA 4B5EA 4XXWC 4YY3H 3VG9C 1JPGA 1JRHL 1YMMD 4XMLL 2HFFB 1HWHB 4G6FD 1U0QA 4ZFZA 4BFRA 4X7SL 2K3HA 4PRHA 1YEEL 2WQAA 4MNGA 1NCUA 2HAZA 3QEUA 1BZ9B 2MPVA 4EN3C 5C0EA 2AU0A 3B1UA 3KBEA 2VLJA 4GSXA 2ILLA 4KKLC 4X0KA 4Y19E 1U42A 3CH8A 1NWOA 3T3ME 1S0MA 1FNAA 1XFPA 1WCQA 3G9VA 4QRSA 4RGNC 5IEHB 2F1AA 1L7IL 3UAAA 3O6LH 1BQKA 1MIEL 3JV4B 5DI8B 2G75B 4ZTPH 3IEAA 3QVAA 5B7EA 3HB9A 5CF3A 1DN0A 3PUUA 3Q1KA 1EJOH 2BHFA 2J8UB 4OB5H 4RDQG 5LGYA 3K6FA 2D3LA 5EEZA 2NVXA 4XNMA 1P5VA 2OMYB 2XWJB 5BRQA 3ZT7A 4XBPB 1X5IA 2R0WL 3PYCA 4XCCH 1RPUA 3WEAA 4IQHA 2YMOA 4B50A 2DQUH 2WP3O 3RE0A 4CNIA 5IVXF 2QVTA 2ZP0T 1NDGB 5F9JA 1NAKL 1C8QA 5HHVL 1PKOA 4DN4H 4ECWA 4AT6A 2D7OA 3QORD 5D96C 3ASNB 5HJ3A 5IOKA 2OYLA 5L1LA 5GGVH 3VI3E 3WUZA 4MTMA 5DXWA 4O2FA 3TWCL 3U9UA 4ERSL 3RGHA 1QATA 3QS3A 2WKGA 3GIQA 3BVTA 5I28A 1UADC 3JQOB 1S7SA 2NQDA 5KSVA 4C56B 5FA4A 4HXAL 5FKAA 1BFTA 2A5UA 2WWMC 4G8EA 3KWWA 2H3NA 2YD4A 2VXVH 1PQZA 1AHMA 3PP3H 5FGBC 4YXHH 5HYSB 3PXLA 2X41A 3HNSL 1I85A 3PPSA 1I8AA 2PYEE 4G80A 4HOMA 2CKBH 3B2UC 3GJFA 4IOIB 2F58L 2R6FA 5KFZA 4DP4X 5KKNB 4AKPA 5FYKU 4XNXL 1MW0A 5EZPA 1BNCA 4N2KA 4WTZG 2GAZA 3DX0A 4KK5D 1AKJD 2Z35B 3CVIH 3IJSA 4FQQB 3RVXD 2IH1B 4LOEA 2FT8A 1XZ0B 3WD5L 4WWOA 5BUGA 3CZLA 4AQYH 1PFOA 3EJSA 3MFGB 4N6RB 3TTSA 4FCAA 4ETSA 3NABL 3MFFA 4PJDF 2XCAA 4H8WL 4WHTB 3V55A 1A7NH 1KSRA 4IIQB 4OF0A 4QTIL 4LDCA 3WJMA 2Q5BA 2QHRH 4UQ9A 2A9BA 5SV4A 1F4WH 3FQUB 2BJMH 2V17H 4AYBA 3VYNA 3I4MG 3CZFA 1JXFA 1F4XH 4FQJL 5T5FH 4NIYE 1LDPL 3GK8H 4XC1L 1B04A 4U6VL 1XDNA 1JD7A 1JD9A 4IHOA 1ZV9A 5SWZE 1CCZA 3DMMC 3FCTB 3GMPA 4FS1A 4DV2H 2OJZL 3CLEL 1GGBH 2FATL 2MQ3A 3ES6B 2VT0A 3WJJA 4AL8H 1NJ9B 3JWNH 1WA2X 2WANA 4CJ0A 3CQZA 3BDBA 1MPAL 1SXSA 4QRUB 32C2A 5GGTH 1RIUL 4WU5B 3DGDA 5D8JH 4KTDL 1MCKA 5L7XL 2D2OA 4EVNB 4B97A 3BH8B 1SN0A 1FORH 2XUWA 2RQ8A 3B9KB 1K4CA 2C9AA 3QQ3A 4GXFA 4GLRH 3FU0A 5D1ZB 1TEGA 2F19L 3UYPB 4YSOA 5MEND 2E9GA 2MNJB 1A6TA 2E5EA 4E41A 1IMHC 1RUQH 4KUCF 5DYFA 3EYVA 1W72L 1BGXH 5C09D 1CGXA 5CBAB 3Q8RB 1S78C 2J8UF 5TK2A 4V1DE 4LSRH 4HKBA 3IGFA 1CFQA 1FI8C 2CK2A 2WWNA 3BUQA 2DW5A 1M0WA 4ECVA 5FXCH 1N3NB 1ZSDB 4G8GD 2NYYD 4JFHE 5EN2A 2XPYA 4H5SA 1E4XI 2BVYA 2OX5B 3FT0A 5GJTH 1GC1C 3QCTL 3DC0A 2BHZA 3ABLB 2AQ1A 4PLKC 4UIMB 3MR6A 3PWJB 3EJQA 1CL7I 3VW3L 2JTDA 3QDJA 4XP5H 4TNGA 2EZ0D 2DDQH 3LNEA 3TS8A 3WFCH 1A4CA 4WWKA 4BUQA 5FV1L 2NOYA 15C8L 3NVQA 1T89A 1B2WL 2VXQH 3OHMB 4DZ8A 2XKSA 3SGJC 1S7TA 3QUKA 2BS71 1OLZA 3KG5A 2QPEB 1ZVSB 2PP8A 1F97A 1H3WM 4DNLA 4EZJA 2X1WL 2AXGB 2KSWA 1KBKA 2WQSA 5D1QA 1MCHA 3GS7A 4X5WA 1HU8A 3JTTA 2HH0H 1IGJB 2FUQA 3RVWC 3OTTA 2FL5A 4JO1L 2VZOA 1S7XB 2EH7H 2FJFB 3SE4A 2WWKO 2VLKE 4UOW1 3F7RA 4LFHD 1QEXA 2R8JA 4FHJA 2ZXQA 5CEXA 3KWXA 3ME0B 1YUKB 1NZRA 3QIWC 1DBJL 4M7ZB 2V3FA 4J3WA 1IOVA 2WBWB 2BNRA 2EDXA 5AZEL 3SCMD 3K6DA 4PJCA 4JZOB 4O58L 1RLWA 5E2UH 1Z32X 3CSYB 1DFBL 1N8ZA 3Q6FB 3V0VA 1TJXA 3CUPA 3OXRB 3PR5B 3EYUH 4NHUB 5AW9B 3IRPX 5AOIA 5AOKA 4C83B 3JXAA 4JFXA 4JPIA 1MZZA 5TQ2H 3R1GH 1JDBB 2V3DA 4DW2L 2YZ1A 4PQXA 4EJ1C 3W9EA 4MNQA 2FK9A 2ZG1A 3W11C 4DEPC 4Y19B 2I60L 3T3MB 1ORSB 3L5IA 5JA9A 2VUMG 4MA7L 3VFVB 2UVFA 3CDGA 4JM2A 5D1XE 3GGWB 1GJUA 3E8UL 3WNJA 4Q14A 4ODUB 3KPOB 4W4NA 1COBA 1MIML 1KCKA 3AITA 4HIXH 4HUWB 3LEVL 1Q1JH 4HK0B 1CGTA 3CCHB 4FMFA 2AEWA 4GT7A 1XQ4A 5I1LA 4UAHA 3HFML 3VGEA 4HHGA 3BUPA 4TUUA 2AERT 2VXTH 5FUOL 4XMWA 4BY7G 4JPSA 3HRZC 4DLKA 3EH5B 5D1PA 4HKXB 1XH0A 3ECWA 1ZA6B 3SJVD 4RAVB 5KEZA 4ME6A 5GSVB 2DIJA 3QYCA 1BOGB 1CK0L 5JHDA 3INOA 3JV0A 4APQB 1A1NA 5KVFE 3ETTA 3UERA 3IGKA 1FNGA 4BM7A 1J1XL 4OCXL 3MZGB 3V9EA 5EA0H 5F1NB 1I94H 3MTXA 3FUDA 1J1PH 2IH3B 2A77H 1U93A 1N4XH 4WQOA 1RLBA 2A38A 5DD1L 4LO9A 1I9IL 2WKLA 2Y7NA 4HS3A 3EOBB 3F7VB 4JFFE 3W0WD 4MKTA 3S3JA 2YRLA 4ANUA 2GITB 2PYEB 2DB8A 3BIKB 5IB1B 4LQFH 3RB6A 4KVCL 3HOXG 5LAPA 4JMXA 1JTTA 5T1LA 1HJBC 2TAAA 4GW4B 1UHVA 4UQDA 1RJZA 2FBRA 3QUXB 3SE8H 3QXVA 5SX4I 4AYDC 4CC4C 3HS0C 3L7EA 4LLQA 3ELAT 4X6DB 5C0ND 3FQYA 4PWIA 1R5WB 1FJ1B 3AS1A 3II3A 3VVVA 3NEOA 2AJSH 3STZA 1NGZA 2DJMA 1XGTB 4WFGD 2CQVA 5IM7A 4B9KC 1CBVL 1J1OL 3H9SD 4HBCL 5D7JA 3PL6A 1CS6A 2DKSA 2MQCA 5HI3D 4E68A 3VE0B 5CGTA 4DEUA 3EOTH 5K9OA 3CQPA 4AE0A 2QEJA 4IBSA 3N2JA 4JFSA 3NT0A 4QXUH 2X2YA 4XZUB 3Q8AA 4N68A 3UZVA 3UJTL 3E1ZA 1A6WL 3ARGD 2DIKA 2GTQA 2FX8L 1D6EB 3VD4A 2YEZB 2JEJA 5SWZB 4LSVL 1XMWA 2R0ZL 4NZFA 3RWFA 3BKCH 5FLMG 2NZ1A 4N0CD 2R0LH 3QFJD 3QR1A 3VB8A 5DGAA 2ENQA 3L08A 7PCYA 2BIHA 4EQ3A 4EUPG 5TF1L 4YPJA 4NKDB 1RP9A 2GY5A 4GPVA 5IG7A 5I8OH 1JS4A 5IIEB 3MJWA 2R23B 1SMDA 1I3UA 5CINH 4PJXF 4X62H 3GB7B 3OAUL 3D39D 5AVUB 1P1ZB 5G4OA 1TTBA 2FIKA 3KDMB 2LE9A 4MAYC 1DVFC 1X9RA 1SUHA 2QGCA 4DFHA 4F1ZA 4F8QA 4Z7QE 5KSAD 3FTSA 5IJKA 3OKNB 1NL0H 3ALWA 2FT6A 2FK1A 4RFOH 4ODHL 4BFKA 4HVBA 2IJ0C 1G9EA 1UOLA 5KG9B 3RWDB 3L5XL 4Y2OB 3N0PB 5I6PA 2EIZA 4V1DB 1YN6B 3UBXI 4UQ3B 1ZDQA 3NGBB 5ICYA 2HJKB 4AI7A 1FPTH 2WC7A 5I8CB 3Q5TA 3U9SA 2DZEA 3VGAC 1HHIA 2WAQA 4AGPA 2QADD 3HHSA 2FZ3B 3O2VH 3RJOA 3MRJB 3MCKB 4B7IA 3WXWH 2JCCE 2APVA 2HP4A 3WN5A 3WYRA 4PJIE 5F9WC 5F7HA 1ULVA 4F2EA 5HDLA 2EDHA 3WIHL 3SDCC 4N8CL 5LGJB 4NXNH 2FE0A 2V5TA 3DPBA 5TGBB 1KEML 4H8VA 3VI3F 4HJJH 4EDXA 5T1MA 1OSYA 2VQTA 5DC2A 3SKNA 3KPRA 3QDGE 4G8IB 3KPQB 3PWUA 1S46A 4G43B 4ECXA 5C1PA 4QR7A 1RZKH 4NPKA 4EIZC 4GKKH 3STLB 4D9LL 2QSQA 4A1RA 3MA7A 4JRWA 4X7FC 5I9QC 4F3FA 4L3FA 5JIQA 4XP6L 4JI3H 3F05A 4OIBA 2UXTA 4NBYB 4Q6KA 2P5WE 5K39B 4PG9A 1K8DB 3M17B 2Y2WA 3GLZA 3W37A 4HMDA 2LV4A 4QY8B 1KGYE 2UZPA 2VLKB 1ETZB 3WV0A 5DQHA 2VJ8A 5HI4D 2V7HB 5EC1B 3O6MH 2C3WA 4NN5C 2IH8A 1RL1A 4U6XA 2P80A 4OT1L 3ZE2B 4FZ8H 4IRJA 5EFIA 1KLFB 1FF5A 3VFRA 2KT6A 2UUCH 2QFRA 1MCSA 2CPCA 4G6KL 2OP4L 3CHPA 4H88H 3DJRA 2G5BA 3OGOE 5KFLA 1QOKA 1VZIA 1Z2NX 4ECTA 2Z7UA 2HRLA 2VLRE 5KVFH 1T7ZA 4LAQL 4MDJB 4NENB 1LE5A 3F8UB 1BCIA 3JUZA 2MOVA 4HUXA 3EUUA 4QJ3B 1WDAA 4K3DL 5HDOA 1XGYL 5IW3A 3V5KB 4AYID 3ETHA 5HHMD 2C9UA 2B59A 5HPOA 1ICTA 4AUJA 5D1XB 3HAEB 5GRJL 1UZGA 1SPDA 2QPFA 3UG5A 4UFZA 4W4OC 1NOFA 2YS7A 2FJZA 1D5RA 3EH3B 4YHOH 1DIKA 1L9PA 1WAPA 3TCLB 1Z6JT 3NIGB 5DUPH 4TUKH 2CRIA 5LAXA 4M6MH 5EU3A 1O7SA 1D5IL 4A3BG 2CMRL 4I88A 3DO7A 3MA9L 5DC9B 3FKUS 1BX2B 1I7RA 3LX9A 4K7PH 1ACYH 4P2QE 4YHIA 1OVZA 1DANU 2XSKA 4EKJA 1A3RL 5DC0A 5FFOA 1FGNL 5KFKA 3N1FC 2EIMB 3NGDA 3IDGB 4G7YH 3ZDZE 3L17A 1J0HA 5GZOC 3QJSB 1TCRA 3KCWA 4I0PD 1IAIH 3DO4A 2ALZA 1TU2B 1F90H 4PWEA 2LU7A 1UM6L 5ESQA 3F8NA 3P77B 3SJVB 1AANA 1D5MA 1NWPA 4PN6A 2H5UA 1DQLH 3E6FA 4U2ZA 4BK8A 5JW3H 5JXED 4AK2A 4YR0A 4IAJA 3BEWB 4K23H 3R7QA 3G6AB 3MPCA 3TBYA 4KAQH 4JRFA 5FM4A 3LKPB 3PAVA 1UWEH 1SBSH 4GW5A 3QFFA 4PRBB 1RSFA 1RZPA 1I8IB 5DZ9A 5E8NA 5IMKA 3RHWF 1DV1A 3J7AK 4DR4H 5KT5A 2AGQA 4RUAA 2BMKA 2KLTA 3LKRB 4QO1B 3EGDB 5D71L 1TVDA 3ZMRA 5CIPH 1FH5H 3W81A 3FOMA 3ML8A 1NEZB 3A6BH 4JHAL 4P4RB 3TZVD 3BKML 3ATAA 3NJMA 3BGFC 2FD6L 1KBWA 5EZLA 1MJJA 5E4EB 1CXFA 3L4WA 2NVYA 3OJVC 4YL9A 4Y4KB 4EYIB 2ATKA 1P4BL 2JQZA 1B0GA 1OAQL 4ED0A 2AJVL 4UCSA 3HHRB 4QKTA 4MASA 2AXHA 4FFTA 3KHOA 3WEXB 3MLXH 3JYCA 1U2CA 3QULB 1M57B 3EO9L 3L3JA 1U41A 4RESB 2W60A 2W07A 1Q94A 4JY6B 1JZDC 4R3SB 1XCQB 2YUXA 4R4ND 1RUMH 4L3EA 4WJ5B 1MUJA 2IQAB 4NGHH 4GKSB 1SEIA 1NBZB 3LIUA 4EEYA 3H9SB 2DYSB 1K4DA 2XPGA 1MEXL 3DRTB 2ZZUT 2BZCA 1PZ5B 3NZSA 4NPYA 3UGEA 2VDKH 3CQFA 4X98A 3ARRA 1WZ1L 8CGTA 3MOAL 5TH2B 3L3KA 2LT9A 4M6NH 5F3BA 4H8PA 1KBVA 1DDTA 4KX9A 5CIPB 1RURL 3OF6A 4ABVA 1A6ZA 1DBKH 2YPKA 2F18A 1KTDB 5IHZA 3ARGB 2Z6FA 2CJUL 3U0TA 3HIZA 1QLFB 5C9KA 5E2VL 4GEJA 2HFGL 3MJ7B 4HC1A 5AZ2H 3KMDA 3H85A 4N3TA 3P30L 4Z7QB 1QWHA 1N5AB 5CJQL 3V0IA 4FKHA 4YHLL 2I7OA 1V7NH 3N41B 4CN6A 2HRPL 3GHEH 2WPGA 2JSFA 4MDIB 1G87A 1KB5L 4BGLA 1OSEA 4H1LA 5K59E 1JDAA 3EADA 2GEQA 3MV7E 4NX0A 2I9LA 5A6LA 4IOSD 2VDKB 4PJBA 1TCMA 3VCLA 3ZPDA 1XF3A 2CRYA 1C5CH 1RZIA 2LGNA 1MHHB 5EBMA 5F6HI 4AQOA 3BPNC 5C0GB 2BHUA 4PB0H 2JB6B 3QA3A 4GQQA 1RZ8B 3PHSA 5E6ZA 4AV4A 3S37L 3UIZA 4G3YH 4PJIB 2HPTA 3V0WH 5DZJA 2NZ9D 3IF1B 1A4KB 3GMLA 2W0KA 3O81A 4HIIB 4NRZA 3PWPD 1DQDH 3AU1B 3AG1B 5AAWA 4UWQB 3RIAK 4U1SB 3SE9L 4AQZA 4KOBA 4FQIL 3SKMB 4XAKD 4AE1A 5FJ8G 4PJ8C 2A3TA 1I7TB 4Z7IA 3L45A 4DO5A 3DSNA 2CLZA 2DQCH 2PW1A 1F3JB 3NFNA 3IJYB 4BE5A 4M7JL 2X4RB 5IYZF 2FLNA 3ILPB 1J05A 3RZCC 2P5WB 1ZHBA 4UTAH 4JI4H 4IBLT 2DM4A 4BH8A 3FF7A 3N9GL 1UH4A 2QBWA 2WSDA 4GAJL 5EUOA 3ZTCC 3BIBX 4ZMOA 3U46A 3PGCA 4FHBD 4DV7H 1W16A 1NCIA 1WPCA 5GS1C 1QAWA 3UTPE 3UJJH 2IG2L 1OW0A 4X42A 2QVIA 5I30H 1WWBX 2NRDA 3RKDC 1FNEA 5AD0B 2O61B 4AIZA 4CDHA 2PNDA 4YDVA 2LAGB 2GTWB 3TA3A 3GTVA 4P4KD 4RAUA 5KG7A 4NLGA 1N6VA 4I5BA 4ODTH 5MEPB 2AEPL 2QDVA 1LK3L 4HJEA 2HX7A 2VLRB 1BD2E 4KMLB 2Q2UA 1FIGL 1INDL 4QCIA 1T1XB 3PGDA 5CLTA 1GKOA 2ZX8A 3TIGA 3JBG7 4WK0B 2F5AL 4PCSA 1JBJA 1V9PA 1PU0A 2WINA 3ROLB 1MNNA 4OGXH 2RR3A 3AT8A 3RWHB 4LEOA 1LMKA 5IB5B 1TYEB 1D9KA 4PJ9A 2ZYRA 1QI4A 1RZFH 3GRWL 4J4PD 4NQQA 2EADA 5IUCA 1IGFL 3ZHLA 4EGQA 4HAGA 5D7SL 1Y1DA 5C0CA 4Y0GA 5HHMB 2RGRA 3HFFA 2WZAA 4LASH 2JIXA 4KY1L 4PWQA 1KN2H 3UGXA 2QKIB 1WTLA 1TDQA 4CVZA 4XAWL 1FVIA 2ZAHA 4I1RA 4QOKD 1EBPA 3ASOB 5IBUB 4FNLH 1Z5LB 5GISL 4HX1B 4DV3H 3LZRA 2YKLH 1CT8B 3F5WA 1PVHA 5GRUH 4KH9A 1YAIA 3WMQA 4P2QB 2YW2A 2BLFA 2WTOA 1UA6H 2R56L 5DLGA 2FQFA 1QSFD 4O3NA 2F61A 5CZVH 5BZXA 2F7OA 2K1MA 5IF0B 4P9HC 3ZDZB 1B6RA 1FFNB 1RK7A 3M9OB 1UQSB 5F6IC 3ZU8A 1NC4B 4R84A 5D72H 1W0YT 3STBA 3P4MB 2QQKH 4HV8B 5TDOA 3T1WA 5IROD 1YNLH 1YPZB 4DERA 2OZNA 3NJFA 2V2TA 1NMAH 3MV9E 3MRPA 5C0DB 1BBDL 4KFZC 2XYBA 3VXNB 4QIWE 1P7QA 5ACZA 5I1DB 4DUVA 2HT4D 3KPSD 1WFIA 1ZANL 3FFCA 2P43B 3WDIA 3HI5H 2G9KA 5EOQL 2JCCF 1G5AA 5I5JA 3O8XB 1QI3A 4PJIF 2UXDH 3VXSA 4WO4B 1E40A 2J9GA 1XVSA 1Z9OA 3OKLA 1CGVA 5AUMB 1T1YA 3MX0B 5DS1A 2YAEA 3FUKA 1IJNA 4R8UB 4KTYA 4ALAH 4HLZH 5CKGA 5BVJA 2DBLL 2HKHL 2C9QA 5C8JB 1BZDA 1GR7A 1QLEH 3B9EA 4KRNA 4Q6YA 4Q52A 2Q87A 2GG1A 2A2QT 4POZD 4A67A 1EZVY 1KXTA 1LEGA 1VFAB 3TBSB 3O3DB 3GBNL 5CEZD 2DWYA 5ICUA 4QHLB 4LBEB 5HHOD 5CEZL 4MZ3A 4I4WA 2ESVD 3L1OH 3BMWA 4F2ME 1AKPA 1TQUA 4IR1A 1PKQB 3QPQD 4N86A 4HU8A 5ICXB 1I85C 3HJEA 1J8RA 1E6JL 4JI2H 1KCVH 2PYFB 5DU7A 5E8DL 1HH6A 1N0LA 1BFSA 4PV8B 1INQA 4ELMA 3VNYA 3S3PA 3WO1A 4ETQA 4I77H 4OD1H 4DGYL 1W6LA 3AWFA 4ZT1A 4DO4A 2M05A 3MRNB 2HT2C 1CFNB 3WSQL 1GSOA 3R5XA 2VSCA 4HALA 2KUTA 3ZL4L 5HHXL 1SLXA 2QELA 4LKCB 1Q0EA 2HMIC 3ILDA 3SYAA 1KEGL 2YC1B 4KXZH 4Q2ZB 1QLEB 3BA9A 3JWDL 4WNQA 3CIAA 4UQIM 5AG8A 1TZIA 2IAAC 1ADQL 1HE7A 2Y2YA 4AYSA 4ZSOE 4J9KA 1I82A 2VW7A 3X14A 1VERA 3ROOA 4PB9H 1BP3B 3I6LD 5SWSA 1F2QA 1YO4A 1MWAA 2R8GA 5CN1A 5I74B 2R7MA 4PVBA 1HOEA 2VERA 3B7SA 4AKOA 3ZRCC 1S7QA 4GUPA 3M9MB 3H9ZA 1XCWA 2Q7AA 3MV7B 2NR6D 3BCDA 1VZHA 3RILA 4MJJA 3T0BA 5IWLA 3IU4L 2BVQA 2R1WA 3DHUA 3D18A 3QB7C 5I16B 3GSUB 3WJJC 5IQMA 2EDNA 2CDGB 4JR9H 4PJHF 4RGMB 5J9PA 4PJEA 3KXFE 1QFWH 3VXOB 5FCSH 5IBLD 1EGJL 2Y1AA 4UOQA 3QUYA 5AOLA 4CBZA 3H3PL 1A9EA 3OPUA 2AV7A 2O4EA 3SODB 4JDZA 4NO0B 2DS4A 4BFNA 5BQ7A 3B2VL 3P3RA 5DSCA 4D9RE 3DX7B 4DR2H 3C60A 4NLAA 3WNKA 3WFDH 1JWSA 1E90A 4DGWC 3NCMA 1UD5A 3U48A 1RUAL 1AR1B 1MHPL 2CG9X 3DGCR 2DYPA 2RIKA 2X4OB 4BY1G 5JO5A 1YA5A 5T3XD 1IFHH 4BQ8A 5E9DE 1NAMH 5T3XL 4UM8B 4MMYB 3QQ9C 1GGCH 3WHE0 1E28B 2OM5A 1MRDL 5IUSA 5JORA 1CFVH 4UT6L 1KDIA 1YEWA 3LJ3A 2GBVA 4WNSA 4OCWH 4FZEL 3U1SL 1BG1A 4WY7H 2XGPA 5C0AD 3Q2WA 4GB9A 4UNTA 2B2XL 5D5ME 3SOBL 5IQ9B 3QIBA 4S0TD 3SDAB 1TVBB 3TT1H 2H2PC 4G6JL 3ULUC 4QRTB 2IMMA 3O9WD 4WWKC 5I6XC 4H1LG 4NN7C 1X5FA 1T89C 4NQVB 4R6UA 3RIAF 3VSVA 2QSTA 5DHMC 3MV8A 2VR9A 3I9IA 3WLBB 2A4ZA 2IEPA 4N5UA 1TJIH 3U4BL 1JK8B 1MQKL 4O3QA 1LQSR 3P0YH 3HE7B 2XA8L 5D1QC 1G1YA 4LLUB 3X1NA 1BD2B 5FM8A 1TSRA 4X4XB 3SGDI 5GSRA 1NAMB 3GIDA 4EKXA 25C8L 3JV4A 3AABA 2G75A 3NCBB 4BXSV 3VXMD 1HSAA 5ISZE 2Y5TB 2EIEA 2FEEI 3O2DL 5PAZA 3OD3A 3SE4C 4TL4A 4OIIH 3NFPB 4JG1H 5GRZA 2OMYA 5IW6B 2MSPA 3ORJA 2VIRB 2LTQC 3FPYA 3NIFB 5HYIA 2ICCA 4QRRD 4K2UH 5TK4A 3W2DL 3QJHB 4FXLA 2EVJA 2DIEA 1PX3A 2CRMA 4GOSA 1F11B 2A73A 3IJ8A 1E7UA 2Y22A 4LMQI 5A2IH 4N2CA 3TYGL 1Z9SB 3HOZG 4JX0A 3BRFA 1KGCD 1HSBB 3CFCL 4OFYA 3F2LA 3IBEA 2UY6B 3HA0A 4UDTA 1LO2L 5B39B 3LSOA 1DBAL 1FNFA 4HAKA 2ZD0A 3GKWL 5FEBA 3EW3B 3US1A 1SEBA 3PW4A 4JM2C 4NAMA 3KPLA 2DQTH 4ZS7L 4P04A 1MHEB 1WIPA 5AB1A 4AY0A 2WMPA 3WY3A 5KFFA 2ZCLH 3D07A 3MV9B 2EDEA 4PFEA 5K59F 2D03H 1O6TA 1FFQA 4R7NA 1DQML 2CO6A 2D0HA 3QUZB 5JW5A 3FH5A 3NPSB 4CADA 2XY1A 4KK6D 4F80A 5FD5A 4TKWA 3BYYA 3VRIB 4RMVA 2H1PL 2AJXL 4AVKA 1BA9A 1R3IL 3CH1B 4TTDC 5ILTL 2Z35A 4G3IA 3O3UN 4KUCD 3H40A 1NLDL 1XZ0A 1ANUA 3LRSB 3VWKD 1G7JA 1VA9A 2WBXA 2ZQKA 5BXFB 1KJQA 3WXVL 4QHKI 5FHAL 4XCEB 4LLYB 1IKNA 1KIUA 3D85D 4FM9A 3M7FB 4QTHB 4FG2A 3IMUA 2YLKA 4WHTA 1AQKL 3KHHA 3FT2B 2I9TA 3AC0A 3KCPB 5FW8A 5I1JL 3FQUA 4U1NB 2DIBA 2H41A 4JFOB 4LPYA 1S9XB 3QRGH 5EU7E 3PW2A 3AZUA 3GT6A 4L3CA 5KFWA 4F2MB 5IYBG 4BZ2L 2WCSA 2V8LA 2HVQA 2DQIH 4XVUC 1JZFA 3N42B 4PRAA 4NQED 1TQSA 3DVIA 2X12A 3QZMA 4LCUB 2PO6A 5A16B 2VQDA 4LF9H 1G7IB 5IZ7A 1NJ9A 2OMVB 3B8SA 1RZ7H 3DTXB 2BC4B 5HHQB 3CFTA 3S35L 3WY1A 1UOKA 3O6LL 2X53A 1NSNL 1MJUH 5EWIH 3MREB 3MR3A 4M1CD 1CYWA 4EVNA 1KCSH 4XBEL 3VXUA 3PW0A 2Z8RA 3B9KA 1B4JH 1CC3A 3J27A 4J3OD 5C71A 5D7JC 5B1BB 3PL6C 5DLFA 3DETD 3MLRH 1EERB 4FJ6A 1IGIH 2DQMA 4MD4A 5F1IA 1WFOA 2DQDL 4ES9A 5K69A 2N01B 4ZSOB 5CBAA 4Y16D 4FKKA 5IW1B 1ZXKA 2G9HB 3IDIA 4L8SA 5JMRA 5ALBL 4F4XA 3F3HA 1AQ8A 4FULA 2DD8H 4LHUB 4D0BB 5MEOB 4ZS6D 3ARUA 3E0GA 5I18L 3QYMA 2OX5A 2WYHA 5HGAB 4WUUD 3RTXA 3PWJA 4I55F 4OZGE 4WEUD 3LZLA 4UTBH 4MBOA 5H35B 2ARWA 2FLMA 3KXFB 1CFSB 2W9DL 1T7WA 4WEBH 2R4SH 5E6YA 5EZOL 1AFVL 2ZKYA 2AI0H 1TZHA 5B21A 5CGMA 3L8QA 4NO2A 2VXVL 2ZPKH 1I7ZB 1LP9F 3BVNA 3WO3B 1ZVSA 4KRLB 1P8LA 4DK6A 4IEFB 5IJKC 1DBBH 4WVRA 1CDBA 3B1TA 4OJAA 3INUH 1WCMA 4DV5H 1GIGL 3B2XA 2CKBL 4O4YL 2C2RA 2MTAA 4ZW5A 4XXCA 1RZJH 3U25A 1HNWH 2G60L 3ZKXB 3ZR5A 3WFHA 3O11B 3LHPL 4WSKA 2YD9A 2J6EL 4FFZH 1CIUA 3T5WA 5EEVA 2XZAL 2DM7A 3NIDE 1S7XA 1IBDA 2FJFA 3LPOA 5H2BB 5IK3B 3Q3GB 5T3ZD 2A0LD 3RVUD 3D6GA 5T3ZL 3ME0A 3PHQB 1CVSC 3J2PA 2MOGA 3N44B 3ZL2A 2AJUH 1RI8A 2W0LA 1QHQA 3WN5C 2KZBA 4JZOA 4K94C 1H6EA 3AGWA 3MFIA 3LKQB 1SDAB 3CSYA 4MA3B 4CILA 4YJ2F 2VXQA 2BJML 2VDLH 1TTAA 2AK4E 3OXRA 4NHUA 4Z7NB 4C83A 1I3VA 2FAUA 4L23A 5EIIG 4J5VA 1JMXA 1UFGA 2BNQE 1KGIA 1BQLL 1CU4H 3D8MA 1BIHA 3DX9B 5A2CA 1YMMA 1JGVH 4NUJB 1A3LH 1XH1A 3VYPA 3V5HB 1EAPB 4M93C 1AQDB 5DK0B 3WFBH 1XH2A 2VW4A 5EF1A 1BOYA 4IWYA 2EXTA 4ODUA 3KPOA 2WLYA 4H8QA 3VSQA 4ZFFA 4JJOA 4LSPH 5DHYB 5JW4M 5EHFA 2XQBH 3LXBA 1DE4B 3MRHB 5ACLA 1TENA 3CCHA 4U1LB 2QGDA 3D4ZA 1AD9B 4QHPA 3MBED 4PRDB 1ODUA 1FORL 3BN3B 3HZMA 5DURD 4CMHB 1YEHL 2B9AA 2Z8WC 3GF8A 5EWGA 1HL4A 2P0AA 4L18A 3SY0A 4IRJC 4CDGC 3BAYA 3HC3H 4JV2A 3Q01A 3MRIB 2VDLB 3MLZH 3N43B 1G5GA 3RKPA 4JCMA 2VDPH 4YGAB 1BOGA 5JW4R 3D09A 3D2UB 1W8NA 4PJ7F 4C58B 4Z5RB 2J1YA 5I1AA 1NMBL 1LILA 1RPKA 1UURA 5GZND 4JPKL 1DLHB 4F4WA 3LAFA 1MI5D 5EIQA 2BVUA 5GJTL 4ODVH 4BCXA 3N1MC 4EDWH 1NBYA 4P2OB 3GXMA 4Y9CA 1SXNA 5FECB 2H3KA 3HI6H 1R3HA 4FQ2L 4U4BA 2IH3A 3JTSB 1PLGH 4NYLB 3T9WA 1JPFB 3UYRL 1I8MA 4QW8A 4R5XA 4NKQB 3TU6A 2ICWB 1ODAA 4JPQA 3MJGX 4OVVA 1BWWA 5ESVB 4GQRA 4K3JH 4N2AA 2GITA 3BIKA 4I4TF 3ORRA 4TUJA 2APXA 2RD0A 1I8KA 4FFYL 4GW4A 4YLBA 2CM6A 4OI8A 4WW2F 2ZSWA 4B5ZA 4X6DA 4XNQA 4MXQD 1F13A 2EDOA 3ZRSA 3GFUA 3ORQA 2VDPB 1LNUB 4P46D 4ANVA 5I73C 3LDBC 1HCZA 1D5XB 2FO8A 3NFSH 3GS4A 3PXHA 1U36A 1KPUB 1RV6X 2EH7L 1Y18B 2VRKA 4U49A 2EH8H 3VD1A 4GUCA 3M46A 2YARA 3EGSB 4OLWH 1SXBA 4FNQA 4YAQB 4MV7A 1AKJA 5DD3H 1B3JA 4ZG1A 5CILH 5EN3A 5E5LA 4J27A 1F1DA 1SHWA 1P7HL 3B7UX 1GO3E 3BWAA 4YHYC 1IM3D 2R29L 3UTSD 1SDDA 1G9HA 1MFDL 3OZLA 3EYUL 4IBVA 2JA7A 2YEZA 2NT1A 4RGNE 5ACMA 1B9KA 2DEWX 1TTUA 5D5MF 5EU6D 4A37A 4RBPH 5CN3A 2YZMA 4TQRA 3LVTA 3DVGA 1BEYH 1YNKH 2V2WB 4NKDA 2HG5B 4L5FE 3VQMA 5HYSG 3FSOA 4XWGH 4ESKA 2CCWA 3UFXB 3RWIB 1YEDB 4QAMB 3EDFA 5HGDA 3I84A 2DMHA 4HIXL 4YHZH 1IC0A 1P1ZA 4P3CL 3NSJA 3CQQA 4E9XA 3KDMA 4RA3A 5CNHA 3B4NA 5HVHC 3OKNA 4FI8A 5L4IA 4UBDC 4OJEH 2LAAA 5KBPA 4X9IA 4UUJA 3JSNA 4U1GC 2VXTL 4TSCH 1N7MH 1EFXD 3CPUA 3IMVA 3P02A 1K2DB 5KG9A 3UAJD 4CN4A 3VXQA 1U6AH 3M8OH 4PRID 2GB2A 3HLAB 5BMFH 1IQWH 3EJYC 4OZFH 3VTMA 2HX8A 2Y36H 4UQ3A 4WCYH 4X8JB 4MYPA 5EBWB 3VPBA 4DL6A 4B3RH 3G08B 4Y4HD 5A7EA 5MENA 4X7EC 5C0RH 5FGRA 1Y1VA 5C09A 5K9KB 3MCKA 2C3VA 1DSFH 2E9IA 4GSRA 4YHML 1J7VR 2X0SA 1YEIH 4A39A 1U8CB 3TA4D 4R0LB 4G8GA 4XBGA 3VFUA 3SO3B 5TE6L 3T65B 5LGJA 3H3KA 2A9AA 2WXOA 2I07A 5CP3H 1HJCA 3IWVA 4YSAA 1NTDA 1CICD 3LZPA 1Z2PX 1H15A 4KHXL 4G43A 2V8MA 4U1KB 2ODIA 4HWBH 1I9JH 4DCQB 3U4EB 1ZS8A 5BRZD 3STLA 4RVBA 4OCRH 4UOZA 4Y89A 5MHSD 2PTTA 1E8XA 1KYAA 1KZQA 4OZFB 5JZ7D 1K8DA 4MYWB 3M17A 1S9KC 2WIIB 5AYQA 5D4HA 3NIDB 1AS6A 1M1XB 2C5DC 2WLLB 4XP1L 2AJSL 1G6RH 4X6BB 1N8OE 1JHTA 4WV1A 1NBCA 5H37H 2I5YH 5JNYB 1W6WA 3C08H 3HVNA 5LBSL 4F93B 3HBLA 1BZ7B 4YEEA 2O6DA 4E9TA 1XEDA 3QNZA 5AKTA 1CQIB 4JFED 4ACTA 5ABDE 2OR7A 2XZQL 1VBHA 1CF8H 3QWNA 1SN5A 4YXKH 5BZWA 2AK4B 1AMYA 3LNFA 4PS4H 5AAWC 2FLPA 1TF4A 1CGYA 1J8HE 1F6AB 4MAMA 3SCMA 2BNQB 2E6QA 1VKXB 3K2UH 4LE8A 4FOMA 4JNXA 2WZ0A 3UROR 3CVHA 2CNZA 1BYPA 5EB9A 2IBZX 1C08A 3BKCL 4FTVE 1DR9A 2N7AA 2J5LC 4ZTOH 5IGXH 2NLJA 1F42A 1QZ1A 2R9HC 4M8VA 2FYYB 2XV2A 1INEL 1YRKA 3HAEA 4LPCA 5E7BA 5F1OB 4BFBD 3FCBA 3I6SA 4CN1A 3QEGL 3RY6A 3BKJL 1FZKB 1L9SA 2ZJSL 4OM0L 1G7LB 2VSMB 5I8OL 4W9EC 4OKVB 1G6RB 2AEQH 4ONGL 1XF4B 5CINL 1N18A 2YGNA 3PABB 4LSTH 3TCLA 1REIA 4J8RB 2B20A 4X80L 2P45B 5CXPA 3QG6A 5D4IA 3ABKB 3EYOB 4Y7MA 1N34H 2EXSA 1FVEB 2X6CA 4J1UB 5EBLB 1QSZA 3TA3C 3KYAA 3CJJA 5IMMB 3VRLF 3RB5A 3LVEA 4TNWF 4UNUA 1ZHKB 3PAUA 3CHSA 2GC4C 3X11B 2GJ6E 5TDPB 1FPTL 2K45A 1ZKAA 3ECVA 3SZKC 2E7MA 5JA8B 1PZAA 1TU2A 1L9MA 1KIPB 2AZAA 1MW1A 4LCWE 3VWJD 4MS6A 4PBDA 5KBLA 5KG1A 3P77A 3SJVA 4U1JB 3IB4A 3MUJA 2O5XH 4TLTA 4OZHA 2GABA 2H6UA 4NQDD 3V4VL 3LKPA 4CC1A 1EMTH 1F6FB 4L9LA 1D9KC 4PJ9C 5E99L 3U6RB 1I8IA 5DGQA 4GG6E 1JGEB 3T8MA 2XTJD 5F9AC 1R5VA 5ADPH 2ZKHL 1DJZA 3K8KA 3ZTNH 3BWUF 3IDXH 2XTSA 2Z7ZA 4OZGF 3EGDA 3GMOB 4QO1A 3KHQA 3IFOB 2Z0UA 3JYBA 3K4ZA 4JRYD 2X6MA 3D4YA 1CFTA 1LO3H 2QL1A 1Q9WB 1TEFA 1J5CA 1ML0A 3UO1L 5DRZA 4X4ME 2MCMA 4L5FH 4U0RB 1LMIA 3D30A 4FL4B 3UPRB 4XE0A 2WTRA 3ESVF 2VSDA 4LPVA 5DRXA 3RVTD 1N67A 2VE6A 5IQNA 2WXNA 3I75B 3MLYH 3VG9B 4N8UA 3O6ML 2VDMH 4WLCA 4YPGB 5KG2A 1Z1WA 3QULA 3CU1A 2BVOA 4NWTH 5IB2A 3ULVC 4O51B 4R3SA 4FF9A 3MRKB 4FZ8L 2K4AA 2VN3A 3FU5A 4Y1TA 1QNIA 4NNXB 2FEDD 3DK2A 3NIDF 2E6JA 1NBZA 4ABQA 3H9SA 4N8VB 4EN3B 1OGAE 4G11A 2A1WL 2BH0A 4GO9A 3TIIA 2QJDA 2VL5B 1F2XK 5TH2A 5J3HD 2BS8A 3KNBA 4ZI7F 2NY4C 4LIQE 5C92A 3T0ED 3CHOA 3EJCA 3NAAH 1I1FA 1ET8A 2EECA 1LHZA 2P1YA 4MRBA 1ULZA 5KYWB 3UTSB 4HNVA 3L3DB 4GIOA 3ARGA 3EFFB 2P48B 3KBFA 5BV7L 2PXYB 1A66A 2X89D 4MS8D 2EXYC 4O2EA 4ZPTB 3F6JA 2JEGA 5F9OL 1JDEA 1ILUA 3QFJA 1A7OH 4H20H 2OL3B 3K2KA 2IBGA 3N50A 2VDMB 4WZ9A 3NQKA 3N40F 4TUKL 4LSQL 4Q4IA 3MRDA 1NGYB 3OG4B 4PY8I 3V2AR 4GUOA 5EORH 3AXLA 3ARPA 3C6SA 1AOHA 2YA1A 3S7GA 2CAKA 1WE5A 1T66D 3BKYL 2FX9L 3D39A 5JXAH 1Z2KA 5D96B 3AVEA 5IP4A 1B90A 3DX2A 1E2ZA 2VGLM 4M6OL 5KSAA 1A4JB 2EIBA 5KVGL 1AO7D 1BFVL 1MHHA 3MVSA 3FT3A 1CE6A 5C0GA 2IQ9H 1DUYB 4MAUL 3LHAA 5HHNA 1QA9B 1MDAA 2WGNB 3HN5A 2B9BA 3QAZC 3DECA 4YR6A 5LMUH 2JA7G 4F57L 1CD8A 4GO6B 4KAQL 3QXAB 4U1SA 5FWRA 1WZLA 2ENJA 1UWEL 3ALPA 4HIJB 3P4NA 3FFDB 3TT3H 4KKCD 3ZTEA 4Z7VE 3SKMA 3TJHD 5C4XG 3LRLA 3TNMB 1I7TA 1N59A 3SGEI 3CFJB 5LXTF 1TQBC 5KFMA 3ISRA 1DVQA 3WTYA 2I7SA 1OPGH 4IS6B 3P40A 4EOWH 1BSIA 3PCYA 4P3DA 1HOCB 3LD8C 4MJHA 5BZZA 3ZVVA 3VFTB 2JI2A 2XN9D 2DI9A 5AW6B 4E4TA 2WTFA 5IWLC 4R90H 3UIYA 1TWCA 2JJSA 4EMZA 1OSPL 5EO9B 4ICWA 1AE6H 5F2FA 4C57C 5AZUA 2XYCA 2JA5A 3D25B 3BPOB 4LPUA 4K8RC 1A0QL 3QUYC 5J6HB 4C47A 3G5VA 3L95B 5GS0H 5JPMB 1FBIL 5JTWA 1H5BB 1UZ6E 3GSOB 2GTWA 2ZUUA 3C60C 4GKNB 1I7UB 3FTGB 5L4MA 1ADWA 1RD6A 2WZPD 1R0AH 5MEPA 1MQ8A 3GC3A 1Y1VG 1P4IH 3L4XA 1M05B 4PP2B 1GC1H 1QO3B 4YHNA 1J8HB 1JP5A 3MRMB 1Q8MA 4ZUVB 1WF5A 1VJSA 4LLWB 1HEZB 2RAMA 5DQDL 2IDFA 5KS9E 4FTVB 4LXFA 4DKEL 1QVOA 1T1XA 1AAJA 2HVJB 2WUCH 5FC9A 3MSPA 3V6ZA 2WVVB 2Y1ZA 1DBKL 3OLEA 2CJTA 5DT1L 1DLFL 1QW9A 3RUGE 3RWHA 2XWBB 43CAA 2V4LA 3D50A 4H2CA 4L1DA 4Y1AE 5CSZB 2UZXA 4HUCA 3SQRA 5AZ2L 3NA9H 2F68X 3KGSA 2HJFB 3QIBC 3D69B 1T0NB 4RZCB 2W5PA 3N91A 3TBVA 1ZWIB 2BXYA 3AQYA 4EF3A 3HB3C 3US9A 3I12A 1FYTE 3ESMA 4AJYV 4HGKC 3GHEL 4DK3A 4GAFB 2UUDK 4KK8D 3F12B 2QTEA 3IJ9A 4IK6A 3OHAA 4C4UA 2YQ2A 3CV5A 3R8QA 4MNHB 5JLZA 3FUFA 5IF0A 4J39A 2IPKB 4F9PA 2E4TA 5I1IH 1FFNA 4UYPA 2GJ6B 3IGLA 3ML9A 5DHXB 5K1NA 3BABA 4QWWC 1HI6B 5D70H 1KTBA 1C5CL 3P4MA 4HV8A 4KGLA 4JB9H 1YPZA 3Q1SL 5DUMH 2NY7L 4PB0L 3FULA 1KJ2B 4XGZB 3F83A 3OL2A 1HVXA 4ODBD 3A6CL 5FYLD 4G3YL 3UCRA 5TFSL 4PLJC 2JKRM 3QCUH 2HTLC 3M86A 4I0PA 1X5GA 2Q76B 1FCGA 4JPVH 3AWEA 3V52H 4KKRA 4IKLA 4NZTL 1JPTH 4LVHC 5JXEA 1OAXH 2ZXCA 3BD3A 3P2TA 4UQ2B 1KYOK 3D4GA 4U1MB 1IEAB 4LIQH 2IV8A 2J55A 3AUVA 1OPOA 3M7OA 4UT7H 3BN9D 3APMA 5IOPB 4JGUA 2WLNA 3WTSA 4R8UA 2GIYA 1KENL 4NZRH 1RK0B 1BXXA 3BOVA 5C8JA 1T1ZB 2AQNA 3QIWB 3UCQA 5BS0E 2WBKA 4TRPH 3VD3A 2OZ4H 1NIAA 2UXGA 3DROA 2R2BB 3P9LA 1SZNA 3UBGA 3QNYB 1KIRB 4F7EA 4BFGA 3TZVA 4PG2A 3E3QC 4YSUA 3UJJL 1NDMB 4DTGL 2XIIA 2QSCH 1CGSH 1GSKA 1XX9C 2NW2A 5M94B 4LEXH 5I30L 1GTNA 1KYOJ 3QJZA 3V79C 1PKQA 1WFMA 5DJ8A 5ICXA 3SPCA 4DKFL 2NY6D 2YRPA 4IOFD 4XVTH 5HV6A 1BVKB 3GBEA 2Y0SE 1V3MA 1LDSA 1M71A 2PYFA 4ACPA 1OGAB 1QR1A 4IBYA 1JRHI 3BDXA 1OK0A 1YEJL 3PNWA 5H4ZA 4YMPA 4KHTH 4PBXA 3D08A 3D1MC 2UUDH 3U30B 2YPLD 3DVNA 3HCVA 4Z7AA 2VH5H 1E5CA 5KFSA 1S7WA 3X17A 4DUZH 1IKNC 1GS6X 4OIAA 4Q2ZA 4QRPD 4CJ1A 5F0LB 4A6YH 1QR4A 2MHAB 3ZKNC 4N9GB 3P1VA 3SPHA 3BSGA 4N2IA 2EYRB 2OW7A 2BP5M 2X6AA 4I3RH 4IHJF 4DV6H 1AY1L 3HRZB 5AVWB 1NEZG 5AVXB 1FH2A 4LASL 1N10A 1KN2L 2K4WA 1V51A 3QHZL 2EC9T 4KJQC 4X6CF 5B8CB 1OB0A 2OS7A 1YCSA 5DHVH 2FX7L 3TBTB 3HMXH 3ZJAA 1E4XH 2YKLL 1EAQA 1AZCA 3LQAC 3MRRA 5FGCE 4NQSB 4HNUA 5KYUA 1UCBH 4JS7A 2W94A 1DJGA 5L9DH 1UA6L 3U6XS 1TQVA 3HJ0A 2IGFL 2P5EE 1CL7H 2PO6C 5DJ6B 5I16A 3GSUA 1T03H 1II4E 5JQ6H 3KL0A 1THCA 4LP4A 2DQJH 2ICEA 3O0RL 1UM4H 4NI6A 4AGLA 4GXUM 1YNLL 3KYNB 5C3TA 4O2BF 3GTOA 1NMAL 3B9KC 4RISH 2EE3A 2E2IA 1FGVH 3VXRE 3BXNB 3F64A 2VJ0A 5AVSB 3HZYB 5T33H 5CCJA 4A6YB 5DG8A 4F50A 4RX4D 1A6VL 4YWGL 3QFDA 5F7AA 1BZOA 5GJSH 4HEPA 1OTSD 3K5RA 1KACB 2KH2B 3HS0B 1U95B 2ZUSA 1H3PL 3HI5L 4K5OA 3EPGA 4L8SC 3T2NH 4UM8A 3PWPA 3JUYA 4MMYA 5DHVB 2XXMB 3O6FB 1E28A 1CGWA 3RB3A 2ITFA 2YKKA 3U36B 2YEVB 1E9PB 4KU1A 3FQTB 4DR3H 1CE1H 5ITBH 2AS5M 4GG6F 1IBBA 4GRWF 1ZLUH 3W39B 4MJID 2BRQA 2WN3A 2X4NA 4GFTB 3FMGH 1A7PL 3UMTA 4WK4B 4BA0A 1NCWL 1QFOA 2EXWD 4LLDA 1TVBA 1DJYA 5K9QI 3C9NA 1I1AB 2R4RL 3MXVH 2N0KA 4J9LA 3HC4H 4LPXA 1OOAA 1NKOA 1E4GT 4PGEA 1QBLL 3SYQA 2XN9B 1MFCH 4AIXA 4ZOLF 3IT8D 4PJGA 5E1GA 4GMTL 5D7IF 4DP1X 4M9UA 1NGQL 4PD4J 4TV8F 3GLAA 4KO5A 3H1ZA 2ZP9A 1DQVA 1JFHA 2DI8A 5I0ZA 5KBNC 2YYAA 3HE7A 2O1AA 3QJFB 3CZJA 1KCVL 1OE2A 1BW8A 4XXCC 2YGOA 3KVDD 4HISA 4N1CA 4X4XA 1NFAA 1NAMA 3PZPA 1A65A 1IL1A 4KY2A 5GIRA 1IARB 4P4KA 4KKPA 1WCBB 4FYSA 4CC5A 2Y5EA 5EULV 2FGWH 3S36L 5CCKH 1HZHL 1QSED 1ZTXH 4NSKB 3RUGB 4JFYB 4MAYB 2W1NA 1DVFB 3BPCA 2VQ1A 2GSGA 3KLHD 4G5ZL 4HUKB 1KTLB 1JI2A 3QUMH 4KNUA 4Y1AB 1URIA 2PABA 4B95C 5IVNA 1B4TA 4YK4B 4Q7DA 2FNWA 1OAYH 4M5ZH 5EWEA 1A7QL 1AZRA 3CFIC 1F11A 2V6HA 2WBJD 3LKOA 3PG2A 1KC5L 4HIEA 4JRLA 3GV8B 2VO5A 3O4OC 1KCWA 4PB9L 4FE9A 2NY5L 5DDHB 4R8WH 4TQPA 5HJDA 3LZNA 2MPAH 5EZYF 4J4PA 4MKMA 4ZAKD 5IB3B 1UC6A 5JOPD 2UY6A 1TNNA 2N0MA 3AY4A 3BLPX 1LWRA 3WNLA 2X0VA 3JVGA 4WKZB 2PCYA 1GTFA 1WTGT 1QEWB 2V5YA 2YAHA 5CMAB 4JR9L 4X66H 2C00A 1L0PA 1QFWL 1NCHA 3SDCB 1QSFA 2A9NH 1WWAX 5I8KL 4FNSA 2AGJH 2BOBB 4MV4A 2Z3FA 2CCVA 2AXWA 2HVKA 3OUUA 2VPSA 1IFRA 3HNTL 2ARJB 2YSSA 2B8OT 4BDVB 4JFDE 1P1VA 3QUMB 2D7TL 1JK9B 3WFDL 5IROA 4QRBA 3A24A 3BZ5A 4M1DH 5I1HH 5KT3A 2Y6SD 1L3NA 3NJGA 1YYMH 1YEKL 2BSDA 2QQQA 2D7PA 3CVBA 4EZMA 2X7LA 4JW3A 3DUSA 3ZHFA 3O3BB 3KPSA 1IBKH 5BXFA 1GGCL 1YN7B 2WM0A 3H4BA 4LLYA 4G6MH 4S1RH 4R4BA 2OQJB 5IMOB 4QTHA 4ZFOB 1CLCA 4NN5B 5F93C 4MV1A 4OCWL 4Z7VF 4DFIA 2IDTA 2FPPB 2R8IA 5IBUG 2B08A 4BSJA 2D7NA 2XKUA 3LH2H 1JNNH 4JFOA 1V10A 2Y24A 3DOSB 12E8H 3ILQD 3QDMD 3WNOA 4BUHA 5E8OA 3BQ1A 1C5DB 3CXDL 3AQXA 3L54A 2WD0A 4FLRA 2XG4B 1KGWA 2NTSP 3NEXA 2NPLX 5ALCH 2Z34A 3EYSL 2HXAA 2OTUA 3VH8A 1ITBB 2WQVA 2EABA 4ANKA 4LCUA 1W0WB 5FO8A 1YY9D 1E65A 1TJIL 2LU5A 3QUXC 5A16A 1YEFH 5HHOA 2OMVA 3DTXA 3GXFA 2XIGA 3IDUA 4TOYL 2ESVA 5HHQA 4P23D 5DJ0B 5D2LF 3FO0L 3DXAE 4ODXA 4RSYA 1UZ6F 3G9AB 5J89A 3KE0A 3GS0A 2NXYD 1TIUA 4OVUA 2ITDB 4HEME 2L4OA 3KAKA 5D6CB 1Q1PA 4JG1L 3F6LA 2H9GA 1WC7A 3LKSB 1UYWL 2A83B 3KYMB 1Q0XL 4KK5C 5AKVA 3ZBMA 5F0MB 3RVXC 5IMLB 1OCZB 4XMKH 2CK0H 5G4MA 3TO4D 5KS9F 1RZQA 2Q0ZX 4PRHE 5IW1A 4PGBA 2XPZA 2G9HA 4MNGE 4ODSL 3MJ9H 3BIAX 4AM0B 5E6ID 4QXTA 3SDYH 1EJFA 4D0BA 4H8WC 5MEOA 4GKZA 3QCVH 3E9TA 3GWJA 2VLJE 5D6DA 3VFSA 2EKSB 2FJHB 2WLIB 2FECL 5FGCB 2YD0A 1MCJA 4BCYA 1KLGA 4ZXBB 4AIEA 2B0SH 1R24B 2RQEA 2P5EB 5BO1L 1TQTA 4OM1H 2VISB 3QXDB 1KYUA 1QX1A 1YMHB 4PS3A 3W56A 1ZAGA 1C12B 1CFSA 1PZCA 1FZMB 5DVPA 3PWLA 4PVNA 1WITA 3WTVA 3NRPA 2ZUVA 4HLEA 2NR6A 3UOAB 1I7ZA 2R2EB 2BIIA 1EXUB 1SLVA 2GJZB 1WUZA 2D03L 3L5WB 5EOTA 3VXRB 3QDAA 5E94B 3PUCA 3HG0A 1EGJA 3O3EB 3T2LA 4IEFA 4W81A 1F56A 5AVYB 3V0GA 2IALA 4PJ6A 3AG3B 1I8LA 5DFVD 5EDXA 4QWAA 4M9PA 3N0AA 4TQ8A 4UI2A 1RIVH 3UBXB 4BH7B 3BCFA 1IKFH 3BGFB 1IM9D 3EUDA 1M7DA 1NCJA 3M4IA 2PCXA 1J9QA 3LTVA 5EPMA 4AQ1A 4ELKA 1VEPA 2C7UA 3NGBC 1UZ8A 4OH2A 3Q3GA 4O9HH 4XB8A 5DTFA 3ESOA 1D6VH 1N6UA 1VLXA 3D06A 3EFOB 4URTB 3HUJA 4XI5D 3VJ6B 1YNTB 3C5JB 2BVPB 4JHWH 2CO4A 4NXSA 4N2GA 5E1IA 5FLUA 2AABH 4UTBA 5FS5A 4HJGB 5AVQB 1IQDA 4XYMB 4UT6A 4PS7A 4KHPH 3FXIC 1JHKL 4PRNB 2NYYC 4HWEL 5DRWA 3ESUF 4DETA 2HCZX 2OMBA 1KJVA 1M42A 2H8PB 1SVZA 2GFBB 2UY7B 5DZVA 2YWYA 3LS4L 4JFWA 4P5TB 3QIUD 5BZDB 5E1HB 2EZ0C 3A3YB 3HMWH 3O9WA 3DV6A 1EAPA 4HAFA 2DTMH 3V5HA 4GIPD 4XO9A 4NRXA 3FO2A 5PCYA 4JQXA 4JN1L 4R96B 4RDQF 1ZT4A 4J3XA 3RDJA 3TF7C 4Q9QH 5HYJD 2E7LA 2BRRL 1MJUL 3F7QA 1DE4A 5ABAA 4H26B 4NOBA 3UH8A 3TO2B 1B4JL 2X6UA 3BP4B 2WKOF 4KFMA 4X83A 2F7RA 2CKNA 4WV1C 3HBGA 4KJYA 4Q0XH 4ED8A 5DRNB 4DEWA 2CJ3A 2B1HH 4Q4EA 4MV3A 3FB6B 4AYBE 3O2DA 4FJZA 3KBHE 2X4PA 2X40A 3IKCA 4FN0A 2ZIDA 4P49A 3LKNA 3K46A 4FHKA 4M8UA 4WI4A 5LGKA 1N33H 5E9DD 4B6ZA 1QSEB 2J4WL 4EIBA 4Q58C 5KFTA 2J88H 2BFGA 2YUWA 4XN2A 4QRRA 2Q6WB 1E4KC 1MZYA 3QK0A 5E9AA 3SCMC 3RNQB 1C5BL 1QFWM 3CDZA 2OWOA 1IV8A 2E4FA 5BOZG 2VITB 4IR9A 3S8WA 1RZKC 2NY3D 2WBJB 4P2OA 4WW1B 3GXUB 3NCCB 4OGAD 3L9YA 1X4YA 1EUDB 1AXIB 2MTPA 1M6VA 1EAOA 4NYLA 3WO0A 5FF6A 4BZ1H 3DRQA 1AR2A 1GZHA 1PFCA 3KD4A 5FO9A 1CDYA 4NFCA 3RY6C 5IR1A 2UX7A 4KROD 1D7CA 3VSUA 1NC2B 4UZUA 2MWCA 1BZEA 3OAYK 2AI0L 5CLWA 3OG6B 2MCAA 4X64H 1NGXB 2EE6A 4WUKH 3UTTD 3LP8A 1A0IA 1PX2A 3IN0A 2BSSB 1SFOA 3BX7C 2X4UB 4E41E 1N68A 4JFUA 4JFDB 4OZIA 3K5IA 3RL1B 5CFHA 1U21A 2YUVA 1FLRH 5EEUA 4IRZL 1X9QA 1A4AA 2D9CA 1CI3M 3BUYA 4M4RB 5CA0F 2XWEA 3X13B 4JREB 1UWYA 2DQFA 3T1FB 2P7TA 5J56B 3US0A 5ANHA 3RZCB 3E6HB 2X44D 1NCCH 3OZKA 1A9BA 4FLQA 4FFZL 2QGEA 4MMZA 4GI6A 1A14L 1HC1A 1NA8A 4A2FA 4D0DB 1KPUA 4PVLA 4OV5B 2FB9A 1MN4A 1PYWB 3QDJE 2WXQA 2QYZA 3GJFK 3ULUE 5HGBB 2CA4A 1XIWB 5DD0L 4KTEL 4LDLB 4NC1C 2W95A 5A2AA 4UOW0 5DEZA 1VGKA 5E8PA 1O7VA 3D85A 2AV1B 4C8XA 4ZFGL 2VDLL 4L9LC 5C08D 1YNTF 5B39G 1ZDSA 4WTXA 4NUGH 2FSEB 4P9HH 5FCUH 4XP4H 2NUPB 3QDMB 2OW6A 1RYRA 3OLGA 4XO4A 2V2WA 1BIIB 4TXVB 4DHLA 1VACB 3WFBL 3DXAB 3FT1A 5BO0D 3CN3A 2EAEA 3RWIA 4F58H 3S37X 2WIMA 3D34A 5DD5H 3IMRA 4GAGH 4LSPL 4NBXB 4NQEA 4PTTB 4ZD3L 3W57A 1LLAA 4KXCA 1P7BA 3RWEB 2BNRE 2O6CA 4R4FL 2QT6A 2Y69B 4DKTA 4PJCE 5C0NC 5I66A 3OKDA 1JPGB 2NXZD 1FVDA 3CBRA 3F58L 3IJEA 4FNUA 4CSSA 3KH3A 4PHXA 4U6YA 5ENWA 2GK2A 2HYMA 3L9RA 4ZFZB 2NXYB 4LU5H 4PUBL 4PRHB 4MNGB 3VFOB 2VTFA 3QEUB 3MLZL 1DEEB 3MLTA 5D55A 5C0EB 4MNQE 3DKHA 3G08A 5A43C 4X0KB 2GUYA 4FG4A 4YFDB 4EFEA 4PW4A 5F6IB 4QRSB 3TO4B 5L4FA 5JVDF 4Y16A 5D8DA 4K0KH 4FLSA 3DUUB 4IGBD 1UXWA 4XN9A 4E9YA 2H26A 2C3HA 3RYMA 5JQHC 5KVEE 1DN0B 4RWHA 4RB2C 4LP8A 4R0LA 1EHIA 3HI6L 4ZO9A 3ARGC 1PLGL 4A3KG 3T65A 5JORB 4Y9BA 3U7AA 1ECYA 1P5VB 5AW1B 4A3JG 5IP9G 4DQOL 4AVJA 4MQTB 4S1QH 4WUUA 4EBQH 3DWTA 3APCA 4N0CC 4M61A 3GJFH 4XMVA 4QXWA 1JF5A 1B6SA 2QMJA 2CE6A 4U1KA 1EHLH 3CFNA 1AQHA 3TV3L 4F4ZA 1SMAA 4CNIB 1AIZA 4HH9A 5MP6H 3QZPA 5JHDE 4AT6B 2WO4A 3ETBF 3O4LD 5D7LE 4P06A 4ZMAT 1Z7JA 5IFHL 3GXNA 3TVMD 4YDKL 3RX7A 5KSAC 4BFOA 4O2FB 3KLLA 2XVGA 5CWSA 3U9UB 3UPCA 4X6BA 1NUDA 5EZIH 3WN6A 2VSKB 1BLNA 1NFIA 2IBBA 1ZJBA 4GRMA 4HHAA 4N28A 4ANWA 5LQBH 2EH8L 5LCVH 3SDXF 1S7SB 2HUHA 2DAVA 5KSVB 2J6EA 5FA4B 1J9RA 1IM9B 1FSKB 2VDQL 1KBLA 1OCWH 3KWWB 2H3NB 4LHUG 5DD3L 3RP1A 3ZDWA 3EH2A 1PQZB 5GGVY 3EO0B 3N1PC 4OCNC 5TE7H 1EUCB 4RAHA 8FABA 1KTRL 2V5RA 4G80B 3GNML 1HDMA 3GJFB 5A2QW 1N19A 2BNQA 3ZO9A 1VKXA 4TVPD 4DVRH 5CD5D 2VERN 1MZBA 3B9DA 4TVPL 1WVZA 4TSAL 1XR9B 3GIKA 2E75C 3QC6X 3RB0A 4WEEA 4YFLF 4TUYF 2QK4A 3VD2A 1FYHB 2BIQA 2Q1EA 1OM3H 1IGMH 1TLMA 3WDHA 5I1KH 5I6OA 3APDA 3QG7H 3P69A 3K6SB 2O5YH 4YBZB 2JKTM 4G8FB 4XPGH 1AXTH 2YPVL 2JJSC 1J0YA 3PABA 2RACA 4P59H 2A6DB 3IDJB 5B7MA 2HJWA 3EYOA 2OFQA 1IAKB 2W0FA 3ABMB 2HPOA 3QO0A 3CZFB 3N85H 4TSCL 4A2GA 1FVEA 4FLOA 2EE9A 4PVMA 4J1UA 2VR7A 4E42B 3B2DC 3BT2H 1O9VA 1H6TA 1U92A 1G7PA 3MBEA 4TM9A 4IHOB 5HI4C 4K5LA 1U6AL 3V10A 5I5RA 5BMFL 2YFOA 4WO0A 2QQLH 4P5RA 2J21A 2YU9A 1KIPA 1DCLA 2HVBA 4J8QA 5C0RL 2B77A 1P9MA 32C2B 3QRFM 3VA6A 2Y3AA 4U1JA 4WFFD 4YX2L 5IBTH 1QFUL 2FB4L 3EHBD 4X8GA 5JHMA 4OTXH 3N55A 1VPOH 1YEIL 4NQCD 4UDUB 3GIZL 5A7BA 2VN6A 4HPYH 5GZNA 2IWEA 4IRSD 1MH5A 4LF5H 4FQLH 1MI5A 3U6RA 5KYXB 1CDJA 2D8KA 2NY3B 5DMJB 5GGQH 3WE6A 4GO8A 4JI1H 3DIFB 1A6TB 4N25A 2QMKA 2YIHA 4KDTA 4U3XA 3EYVB 3GBDA 4MZ2A 4HQQH 2GCYA 2K7PA 3GXTA 2VR1A 3Q5OA 3IJHB 1PG7L 5DJZB 4JVWA 1JG9A 2A9DA 4WFHE 3ZYJA 1CIDA 1IC7H 1JNLL 1T94A 2O6PA 4MCMA 5FPOA 4PWKA 4FFYA 4H5SB 3T8VA 43C9B 4MXWL 2WAQE 1BJMA 2XFGB 4JUZA 4F9PC 4F33A 1P6FA 1WD9A 1U8OB 2E8YA 5BPFA 5K93A 2L7EA 3D0VA 3I75A 1PZBA 2UZIH 4GH7B 4YPGA 2Q20A 5I6XB 1W91A 1R5IB 2CO7B 3C08L 3EH4B 4I18A 4O51A 4NN7B 4P46A 3THMH 1VCAA 4DV0H 1IGCH 1YYCA 4DZ8B 5CU5A 4BQ9A 1S7TB 3A4FA 3MRCA 4N8VA 2E56A 1CF8L 4YXKL 3RBDA 2YBGA 3KPRE 4XN8A 1PDKA 2WOYA 3OR7A 3D48R 4PS4L 1JWUB 2YGQA 2JJTA 4DGVH 3AQDA 2LW3A 4Q9CA 3BRDA 5JXEC 4UCTA 3K2UL 3JTTB 4M7KH 1I3GH 5C9JA 1ZV2A 2Q86B 1E6OL 1IM3A 2KL6A 3RI5F 3VMMA 2R29A 2VYRE 4KDVA 5IGXL 2VUGA 5ESAB 2FL5B 5KYWA 3UTSA 5KVEH 3L3DA 1ZA3B 2PXYA 5F88A 2XVLA 4ZPTA 4M5YH 1CLYH 1F4AA 5CEXB 1QMUA 1S5IH 5EU6A 4LDOB 4OJFL 2LTQB 5FO2A 4I50F 1MCWM 2BNRB 2ZUQC 5EWFA 3DYMA 4ODWA 2OL3A 1MRFH 1MF2H 1BEXA 4LSTL 4PG2C 4JKPL 4PJCB 2WB7A 3TZVC 2UVUA 2F8IA 5BPPA 1N8ZB 1S9VB 3V0VB 2X2JA 3BUIA 3X3GL 3CUPB 4OLVH 5KYYA 4JFXB 4JPIB 2IV9A 1GY2A 2L7UA 5E5MA 3TIDA 1RMFL 5IJBC 3W9EB 3LQZB 3GHBH 1M56B 4MV8A 1F45A 4PJFA 1A4JA 3ZKQD 1Q72L 1P53A 2ZONA 1EFXA 1CFMA 4AEEA 3A4DA 5F7BA 4YQWA 4OGQC 2LLNA 4JM2B 2Y7OA 2WQRA 3MBWB 3UAJA 4HWNA 5LO7A 1QA9A 4PRIA 2IFFH 3GM8A 4GQZA 3TCTA 3WL9B 1NOAA 4WBNF 2W6ZA 2IXQA 2VABB 2XHNA 1SVCP 4ALAC 1M6UA 2GKIA 4Y4HA 3WFEL 1TA8A 3QXAA 2ID5A 1U8PB 1XZWA 3IK2A 3RPIA 1IT9H 2BCKA 3FQ4A 4KKLD 4B0MB 4OI7A 2BW5A 4DR1H 3TNMA 3BP6A 4U6HA 2VW6A 2E76C 2XN0A 3CFJA 4KDWA 3IAPA 3IDXL 5KFCA 3ARXA 2YXFA 1DVZA 4TNEA 2LU4A 5LWYH 1NANI 1L4IA 3QRLA 1A1NB 4GRLD 4KC3B 2CQYA 3S0PA 3WIFA 4MJ2A 1X5HA 5D7LB 4ENED 1MREL 3KW7A 3WGUB 4KMTH 1JLLB 2X9YA 4LGRB 5EO9A 1SOKA 1WAAF 4B9CA 4Z7OB 3CXHK 1AJ7H 4J0MA 1I9RL 4UIKL 2ICEC 1J9SA 5HPMB 3MLYL 4M03A 4U1IA 4DZBA 1JJUA 1Z3GL 4J3OG 4DN3H 5JPMA 5L1KA 4ED2A 1VF5C 1F1GA 1H5BA 3GSOA 1TETL 5DA4A 4GKNA 1I7UA 1SYSA 1WBZB 2DJ4A 4JHVA 1S0NA 4HCRL 3ZT6A 3SZ6A 5LBSA 3GKZA 2WVUA 5L4JA 3MGTA 1QO3A 1UD6A 1DL7L 2NYKA 3VX1A 1RJZB 3MRQB 3SGDH 5IHWA 2HKFL 3ULUF 4LLWA 2G5UA 2LOEA 3L7EB 2YD6A 2MRYA 4H8UA 4LLQB 4M62H 1I4FA 4JFEA 4ONHA 1S3RA 2NZ9C 3KAAA 1UENA 3CXHJ 4A2LA 3CVDA 4R97B 3P4OA 3LPPA 3NAAL 3WJLA 3ZQWA 3QP3A 1QUPA 2OYPA 3STZB 1NGZB 2Z1KA 5IM7B 1YJDL 4QHKJ 5D7JB 3PL6B 5CSZA 3FTWA 3WEOA 5K9OB 1OP5H 1A47A 4RZCA 2HJFA 3D69A 1A7OL 4TVSa 4AGMA 3UZEA 2KHAA 1QRKA 4L3EE 3X3FH 2MCPL 3ZE0E 5AVZB 4OZFG 3UZVB 1RUPL 2JCWA 3ARED 2YSTA 3TOPA 3MROA 1Y1WG 4BSVA 2IPKA 4N2EA 3RWFB 2KLSA 3CIQA 5A1AA 2J20A 3MQIA 3HE7C 4PJCF 4RMSA 3IPFA 3GXPA 3C2SA 1ZLWK 4Q74A 3FSAA 1WS7A 5IT2H 4NXMH 4K94H 2XRAL 4P4KC 1KJ2A 2IQ9L 4XGZA 4G83A 2EC9U 1PW3A 2P5PA 5LGHH 4ZW7A 1G7MB 4CVWA 1L2ZA 3ARBD 2FIKB 1ES0A 5I0XA 2Q76A 3T0XA 3VWJA 2F5BH 3IFNH 4MJ5A 4DGUA 3WNIA 3KHLA 1U8QA 4JM2F 1Q4NX 1LXMA 3ATDA 3V4VA 1WR2A 5BVPL 4NQDA 3A67H 3GUTB 2DQHH 2ICES 3RAJH 4U1MA 5B1KA 1MHCB 2EIZB 1OPGL 4UT9H 3S35X 4J4PC 3UL4A 1V3KA 3MLUL 2I27N 4ZZFA 1RK0A 4PJBE 2FIRT 1HHIB 3RV3A 5FDWA 5H37G 3HHSB 3FTZA 3AY4C 4DPBX 3M1BA 4XNUL 4HZLB 4FXGA 3ECBA 3FTXA 3JVGC 4HUNB 1Q9OA 4JRYA 3G6DH 3OQ3B 5DVNA 5KVDH 4K15A 4N0RA 2YK1H 3LZQA 3V4PA 5ADOL 1XGPA 1ID2A 2DTSA 1AE6L 3R06A 3WN5B 1Q38A 4XMUA 1HR0H 1T1WA 4HJUA 2JEFA 3ISWA 4B3VA 3IYLW 3P0GB 1WFNA 2NCEA 5KSBF 4NP4H 1B4RA 1QKZL 5C7XL 3DYOA 1DEDA 2DQEL 3DPBB 5KT6A 5EDWA 4EDXB 5T1MB 3DX6B 3SKNB 3KPRB 5IROC 1FNSH 1MCQA 1DVXA 4PLKD 2BFVH 2AEIT 1ZGLM 1TJHH 1GC1L 4HUVA 4M93B 2BR0A 3MA7B 3F7KA 2NNCA 3OJ2C 5CO1A 4F3FB 4NFDA 3GTPA 1W8OA 2NY0B 4PG9B 3QJTB 1UXSA 1EA9C 2Q7YA 3H42H 2P42B 4Q8BA 1GOGA 4AZ8B 4N9GA 4D0CA 5HYQB 1ZLWH 4BELD 4GLXA 5LBVA 3T0EA 4GUQA 4DF9A 1MFMA 4IRJB 3Q6GH 2IPUG 5CBEB 3TBCA 5EFIB 5LG6A 3ZY7A 3H7LA 1ZHLA 5IV2B 2VXSH 2NX5D 2YD1A 2X89A 5B8CA 3C8KA 1G9NL 4XPFL 4I89A 2JI1A 4HU2A 3ARDD 1OP9A 2EDFA 4U4IA 5KFQA 3UC0H 5I76B 2NSXA 4NQSA 1UWGH 3ASWA 5F9LA 4BCZA 1LE5B 3HC2A 4ZDHA 1KOAA 4HUXB 2B63G 4JO3H 1IILE 1LVEA 2B59B 1GHFL 4RMQA 4NO5A 4R7XA 2W59A 3OXSB 3T09A 1IBLH 4FYQA 4I9WD 3M88A 1ASPA 1J88A 2HTKD 3MLSH 4L8BA 2OXGA 4QXVA 3GSWA 3NCEB 3W5MA 1QYGH 4HMEA 1AO7A 5C0CE 3BAAA 4TQHA 2CXKA 2UX6A 3KPTA 4AITA 5LAXB 3W11D 1TWHA 3NCJH 4JPVL 5K2MA 4XP9L 2BSCA 1UCTA 1I7NA 3DO7B 5CS7A 3V0HA 3X12B 4ED7A 1FFOA 1PD0A 2D0FA 4JRXE 2JB5L 1I7RB 4FQXB 4ZJ9A 2PR4H 3JWDC 3GSNL 3S5LA 4B96A 4YHIB 3O6FA 3RIKA 3V6BR 5I73B 3TASA 3QYNA 5BMVF 3U36A 5D6DC 1V5JA 2D9QB 1IAOB 2DWDA 3EAKA 1EZ1A 1OOWA 3SY6A 4A66A 3CZSA 1TCRB 1TXKA 2NSMA 1VFBA 5HGGS 3T2QA 3W39A 2ADFL 4EEEA 2NUAB 4K7PY 3ULVE 2G2PA 5GS2D 4B9GA 2OZ4L 2Y7QA 4LHQB 2XBTA 1WGVA 5FYJD 4YDIL 1TUPA 1I1AA 5FYJL 2R1YA 2AK1H 3ETSA 1WLHA 3TBYB 5LXGH 5C70A 3VFWA 2QSCL 2XN9A 2YZGA 2NR6C 1Q9KA 2MEJB 4GW5B 4QJ5B 4DV1H 3SYCA 3NH7H 1D5BB 5E8NB 1C7SA 3FFCE 5I2IA 1KJ9A 3K6IA 2OJEA 4DWHA 5F72S 5G2NA 5IP7G 5LB1A 5IBLC 1G94A 1ZLVK 4F37K 1I8LC 1JMZA 3VXSE 1U4FA 1ND0A 4ZUUA 2DWCA 3BH4A 3ZKXC 2YMTA 1I1RA 5ANMA 3TV8A 3LV3B 4RRPM 1N5YH 2ASJA 1I6UA 5EZLB 5JDSA 1NCGA 5IQ7H 3CDYA 4AQ1C 2M8XA 1MJJB 3UDWA 1LEKB 2AJ3A 2VH5L 3BSZL 4OLZL 1CTNA 2ATKB 4HC1H 1B0GB 4NM8H 5GHWL 3WNNA 1L6PA 2J44A 3OKMA 5HVHB 5AWNH 4IKKA 4ZO6A 1U8NB 2B16A 2O5ZH 3IS1X 4A6YL 1IEHA 1AGCA 4U1GB 2I85A 3L3JB 2W07B 3SDDD 4RGOL 4QTFA 2KZWA 4L3EB 2J1KA 5CJXC 1SFDA 5DDHA 3DVFA 5L2KD 1MUJB 5KT7A 1BXAA 4M7EA 1XGZA 3QZBA 2WN2A 5CJ5A 1K4DB 1WS8A 2ZF8A 4UB0H 4KZDL 4K5PA 2HWZL 4KPHH 4W93A 3MUZ1 4RFEB 3X1GA 3HMXL 1KWKA 4NPYB 1QHOA 4YUEL 2FK2A 4A7SA 3CK0H 4ZHQF 4X98B 3O9WC 4FXKB 3I02B 4X7DC 3L3KB 5L9DL 2DLNA 1WSCA 5AALA 2BDNH 4HETA 1WK0A 4WENB 3ZIYA 4BKTC 2WQXA 4Y8DC 5M7QA 4B3MH 5FUCC 4JQXC 3RQ3A 3LXCA 2YPKB 1KCRH 4NKIL 5IHZB 1CWVA 4HOXA 1XF5A 3U0TB 4OUOA 2E7LC 3PHOB 1AZUA 1UM4L 3E1F1 4GQ9L 3HKZA 2J6TA 2XC9A 3QZWB 1ED3A 1MFBH 2GT9B 5KFHA 2UVEA 5CJOL 1CO1A 1U2HA 3U4AA 5J5EA 1T0MB 2ARJA 1CJYA 1R75A 5F7FA 3UMNA 4BDVA 2VAAB 4WFEE 3CSFA 3NJVA 1QTPA 3E2HB 2GK0A 3DSFH 5SWSE 3QEQE 4WF7A 3Q13A 5GJSL 2GUOA 1GOHA 5ITFB 3UADA 1VGEH 3F62A 3T2NL 4N0YH 3O3BA 3QHTC 1KLUB 1NEUA 4K3GA 3D9AH 4RQQA 3G6JA 3WKMH 4LESA 4C54A 1YN7A 1JXGA 3FRPB 4L4VD 4PJBB 3TPKA 2JXMB 3VCLB 1XF3B 2BK8A 1JYXA 4FNTA 5BW7A 4PJEE 1RZIB 1ZLVH 5EBMB 3PR4A 3OWRA 1WFTA 4P2OC 2XKNB 4EPSA 4XODA 3AADB 4PMEA 2SODB 1R46A 3DOSA 4KJPD 2OK0H 1GZHC 3GMLB 5E7FA 3RA7L 1UB5B 2DI7A 3NK4A 3FB5B 3FOLA 3HC4L 2ZKWA 2BSED 2BSBA 3DLQR 1HAUA 1SDYA 2Z91A 4DKAA 2FMAA 1BXVA 4HPOH 2EO7A 2VXUL 1HKFA 3H0GA 1HAWA 1LQBC 5D1ZI 2BP0B 1FFTB 5K9JH 2VDNB 3CDCA 3J07A 1F5WA 2QTVA 3L13A 3QI9B 1A5FH 2R93A 3TJEH 3NK3A 2XWRA 3DSNB 4XE5B 1PLBA 2CLZB 2PW1B 3NFNB 5DJ0A 2ZG3A 2LLGA 1PY0A 2WY3B 3VAEA 1ZHBB 2ZWYA 3SQBA 4BH8B 4MMZC 4I87A 4KK6C 4KXBA 3KYKH 1W0VA 2ITDA 5E0FA 3QHFH 3U46B 1QWNA 5D6CA 5CCKL 3WTXA 3PGCB 1RAMA 4NT6A 5DMKB 3VFGH 3WUWA 4UM9D 3LKSA 1J87A 1O5DT 2XZCH 3DARA 3OB8A 1TWGA 1BHGA 2ZUXA 4L1KA 1NMCC 1UJ3A 2EINB 2EDDA 4KVNH 2TSAA 3GTLA 1FNEB 2YPLA 4AIZB 3MV8E 3N6XA 4YDVB 1J5IA 3U7YL 1R9FA 4RAUB 4QRPA 2Q2LA 4FG6D 3K80A 4I5BB 1TMQA 3BZ4A 5EOCH 2AEOA 1K5WA 2EKSA 1KPVA 1FO0L 3HI1B 3P11H 5BRPA 3A47A 2Z31D 4ZXBA 1PD1A 4JQIA 2XQYG 3MMEA 3GIVA 4M29A 2XLLA 3NACH 3GI8L 4QJFA 4JAMA 4I2XE 3ULVH 1FZMA 2XCMC 2XQ0A 3ZE0F 1RVFH 2JMRA 3GV7B 4MTDA 1FLTX 1QNZH 4GAYA 2F8VA 2XFXA 4UQAA 1D9KB 1B6UA 4PJ9B 2RF4A 5D7KD 2AGJL 2GJZA 1DVUA 1JZIA 5E94A 3O6KL 3O3EA 4RZKA 1B9ZA 3EJPA 5EOYA 4C5BA 2JIXB 1ASOA 3C5ZD 4KKNA 3FSWA 4CVZB 1KIQA 2C1OA 4M1DL 4M1CC 4O5LL 4X0NA 3UBXA 5I1HL 5TQ0H 5FA3A 3W5NA 1YYML 1MCEA 4JRXB 3F5WB 1KUMA 4J3OC 2IMWP 1IC5H 4LSAA 2CIIA 3DETC 3PGFH 2MQGA 4M43L 2OMUA 5EU5B 4FA7B 9CGTA 2B39A 2E2HA 2NDFA 3C5JA 2BVPA 4OGYL 1NPNA 3DTUB 3PAYA 2R0KH 5C86A 4QT5B 1L9QA 3RGXA 3QISA 4Y16C 4PAZA 3E3QE 2UWEF 2VAJA 4C5AA 4HJGA 5TDOB 2WYZA 2V2TB 3MRPB 3AM8A 4R0LC 4ZS6C 3GMMB 1P7QB 4G70B 4DPAX 4BV1A 5IEKB 4OQTL 1KTKE 2LFGA 4PJBF 4MJIA 4S10A 4N2BA 1MJ8L 2EDBA 1ZE3C 1I31A 4HG4K 1L0XA 1TJGH 2YL2A 2ASLA 4GXVL 4PJAA 4AEIH 1H8SA 1KY6A 3FHAA 3GSQB 5DYOB 3VXSB 3OKLB 3QNXA 4R96A 3PV7A 4HS8L 1EUTA 3J7HA 1OAUL 5BVJB 4LKXB 2HZHA 4PV1C 2Y06H 3TO2A 4WI9A 3BP4A 2NMSA 3TINA 3WEBA 2WGXA 3MBXH 2VLMD 4ORGA 4W9IC 1KXTB 1SY6L 3G5XB 2WLZA 5DGRA 3MNVA 5DHEA 1C1EL 4HG4J 1P4LA 4OD2A 3VO0A 4I4WB 1NLBL 4O02A 1GSHA 3I9GL 1MWAH 2A99A 3FW6A 1QSEA 2A0LC 4GNKB 5EUOF 3RVUC 2X10A 1TZ8A 3MJ9L 3PY9A 3V8OA 3SDYL 5L1JA 4NZUH 4PJ5D 4Q89A 4F37F 2FHFA 1A9XA 3AXHA 2CBPA 1HH6B 1N0LB 3BPLC 4B9PA 2NTFA 1INQB 3OGCA 2VITA 3SO5A 3SDDB 4RWYH 2WBJA 2ZYSA 4WW1A 5DUBA 3ZDXE 5CD3A 1OKEA 4K8RH 2WJ5A 1RFDH 3HS8A 4H25A 3GQFA 5L2KB 2EVIA 3QAZB 3VXUE 2Y72A 4ZAKA 2DIAA 1JZ5A 1CR9L 1S2EA 3KWVA 1IUZA 1BF5A 2UVWA 4ORZC 4ZTEA 4WNQB 1V27A 1TZIB 1MAML 1SEQH 4WGKA 2BSSA 5D7EA 3X14B 2JA6A 3ROOB 5KJRL 3JZIA 4PP1C 1TQBB 2Y23A 3QEQB 5FHBL 2WCPA 3Q06A 3LEXA 3R4DA 4L1TA 3IWUA 4PY8J 3AUWB 1MWAB 4XN5A 1PAZA 4FU0A 3GZQA 2ZAIA 6FABH 3MBEC 3AT0A 3NP4A 2W9CA 4OCMC 3HR6A 2IH9A 1S7QB 3LD8B 4DL4A 4GUPB 2OI9C 3TEYA 1AGDB 3RBGA 1KZYA 3H2QA 2BVQB 2R1WB 4M7LH 4OV5A 2FO1A 3EDJA 2H32A 2WQ8A 4PJEB 3REWB 3U9WA 1WH2A 1P9MC 5HGBA 4U3SA 1H3UA 1XIWA 3QUYB 2CGRH 4BKSC 1I7LA 2ATPA 1BQHB 4QD2E 3TM6A 1A9EB 3DI3B 2AV7B 4N9OB 5E00A 4KV5E 3MO1B 5BQ7B 5DSCB 1RY7B 1TO4A 3QW9A 3TEXA 4Z3JA 1H3GA 2ED9A 1WBXB 2YXWA 4QPEA 2AV1A 2ZX6A 5CHNB 3RWCA 3U0WL 5GZNC 1BZ8A 5FWQA 1EDHA 3V0DA 3EFDH 4XHJD 3KR3L 1NDTA 4KXAA 3U2JA 2DYPB 4KDTC 4PBVC 2YS6A 1E9OA