3N42B

Crystal structures of the mature envelope glycoprotein complex (furin cleavage) of chikungunya virus.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
338
structure length
338
Chain Sequence
NFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNMGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 envelope glycoprotein
publication title Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography.
pubmed doi rcsb
source organism Chikungunya virus
molecule tags Viral protein
total genus 59
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2400 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n42B03
2.60.40.3200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n42B01
3.30.1490.280 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n42B02
3N44B 3N41B 3MUUA 3N42B 3N43B 3N40P
chains in the Genus database with same CATH superfamily
1JI1A 1S9WB 1IM9A 2K7PA 4FG4A 2UYLB 2ZCHH 3OXRA 3HE7A 3BP7B 3VWJD 4H25B 4BKLA 4MB4A 4WRLA 1G7MB 1DP0A 2OMTB 3B1UA 2CZNA 3N1MC 5FYJH 1XIWA 3ARTA 2VXQH 4PD4K 1MCDA 4G8GE 3SE9L 1RZ8B 2WXMA 4MQTB 3IMRA 1BF8A 2YCHA 4JFDD 3GDCA 3U1SH 4RISH 5T3ZH 3G6JB 3D12B 5JQ6H 1DO6A 3NACH 1P7HL 3MLUL 4ZMAT 5KUMA 1S9YB 3FU0A 3HCVB 5DURB 2XXCB 5L6YH 1N8ZA 3EYOB 1BD2D 4O9HH 4QLRA 2O6CA 3VRLF 4BFJA 1K5NB 1T5XB 3TIIA 2P7TB 2XQYG 1AQMA 1JOIA 4Z7OF 1U3JA 4AEIL 2GK0A 4N2HA 3D2TA 4GKZA 3OMIB 5JUMA 1ROCA 3FHQA 3ECQA 4QCIA 1FNSH 4L3CB 1EHNA 5D1XC 2VN3A 3F7VB 1H6FA 2JI2A 2NQ3A 2H26A 3O6LH 4A66A 2OJ1A 1FHNA 3ATBA 4P46A 2YAMA 1B9ZA 4GEJA 4FBTA 1OSPL 2EC9T 4TF4A 1XZ0B 3RU8H 3MTXA 4CC0A 4PN6A 3SDXF 5CKAA 3RYMA 3D9AH 4KGJA 2D8KA 2VO8A 4N9GB 1SMAA 2SCUB 3X2QB 1I8LA 4JDVA 3MJ9H 3V6OC 3MV7E 3IDGA 2VA3A 4KQ3H 3PLYA 4RAUA 5GQBA 1I1YA 4FQJH 1JF5A 1OF2A 5LB1A 4Z5RA 2OK0L 1E8XA 3CFDA 4QXWA 3KAJA 3V0IA 1FVEB 4TUYF 1QBMH 1O6TA 3BYYA 2F54D 3WKYA 5JUEL 2WANA 2N56A 1FF5A 4JFFA 1H3UA 4X8CA 3QXAA 1MFAL 5D70H 4L4VA 4AYSA 5H35A 2FRGP 2W94A 4YFDB 1M3IA 3C60B 4DK5A 3O9WD 2XA8H 3KVDD 5HYJA 3R5XA 4APQA 1QD0A 5JIQA 1ADQH 2F58L 4YH6A 1YNTB 4P99A 3RWFB 5DR5L 1YDPB 2WXLA 1HHHB 3VXMA 1CICC 4QRAA 1PQZA 5DHXB 1N10A 3QRLA 1Z3GH 4WKZA 4LLYA 1E4WH 5T1MA 1R4XA 3UTSA 1WZ1L 4X7DC 5IEKB 1ZE3H 4FFWD 2XXMB 3MGTA 2D7TH 4F5CE 3OAZH 4RMBA 3MRJB 1W72A 2O61B 4PVBA 3ECUA 3VD2A 3BDXA 3T2QA 1M6OA 3TLRA 4XCNA 5AW7B 2X0VA 1JKJB 3BC9A 4LU5H 3QO0B 2EADA 2VM4A 5DEFB 3F7KA 3QZ7A 1U8LB 1R6VA 1NGZB 2UX7A 3VXSB 1JNLH 4OJFL 3FCUB 4D8PB 1MIML 2VAJA 2Y0SE 3MBWA 1J0KA 1CTMA 4HGMA 4PJCB 1EQWA 4XMPL 3OKMB 4AEHH 1KJMB 2FEEL 2W9LA 1EEYA 4GW4A 2ZWSA 5LG6A 3NIDE 1IC4L 1ZT1A 5BVPL 2CJ3A 3MACH 2Y1AA 3KM1A 4OI9A 3E6FB 2WXFA 3IGUA 4DEPB 5KSBE 3RPIB 2XWBA 4AW4A 3CVBA 4IK6A 2RGSA 5IBUB 1KT2B 5FUZL 1DE4A 1PKQE 4NQUA 1AGFA 3SO3B 2OZ4L 2GITB 1UZGA 1JYNA 3Q2NA 2VQ1A 3HUJA 4V1DA 3GUFA 4WK0B 3MV8A 4BKTC 3FS9A 3L3OC 3H1ZA 1E9QA 2VSKB 4ZUSA 2FLPA 2C9UA 2YXWA 2KHAA 2A4ZA 5I8OH 4TOYH 2DLNA 4ZUVB 1J5EH 1X7QB 2BVOB 4G6FD 3OPZL 4YL4A 3RILA 4IWXA 5AW9B 3ETBJ 4QIWE 4CJ0A 3QIUC 3QJSB 1JPSL 4EI6A 1IGFH 5CUSL 3CZJA 2DQHL 3QISA 1CBVH 2YD3A 1RPUA 2G4EA 3LIUA 1FIGH 5C0RL 3CN0A 3NFNA 4NAMA 4XO9A 5D93B 2IWFA 1KJ8A 1SOQA 1YMHB 4RAZA 4XP9L 2KZ1B 3VXTB 3RGZA 1SF5A 2QL1A 2R0ZH 3LCYA 5DUMH 3U9PH 2ADJA 2E9BA 2W0FB 4P3DA 1JI2A 4JDZA 2J6EA 1X5XA 1NKOA 1O5PA 5JHLL 1KWGA 2FWLB 2IV8A 4AI7A 1P6AB 3K5IA 5I6OA 4K5NA 2BXZA 3RBDA 3KPPA 2BNRB 2QVTA 3E7JA 2P8MB 3OKOA 3OR6B 5HSFA 5FKAA 5DJYB 4J3OG 5CJQH 3JWNG 2CR0A 3B2UC 4R90L 5T1KB 1MNNA 4F4XA 3FUJA 4JQIA 4F37F 4LVHC 3CDFA 3F6IA 4WCYH 1NDMB 4MMZC 3GIMA 1GIGL 3FDWA 1F4YL 1CQYA 2VITB 5M95B 5TE7L 5KG9B 4WFHD 2WP3O 3PHSA 1EHLH 1Y14B 4YK4B 3VWJA 1HZLA 2I7OA 2YEZB 2Z7ZA 4MNGE 4QHKI 2YD7A 1TMCB 5J13B 3PJNA 3GBMH 3D09A 4K3EL 2C2EA 3F12B 4EZJA 1ETJA 1EERB 4GUPB 2DAVA 3O0RH 4PVLA 3QWOB 1NSNL 1RURL 4TQEL 3L4WA 5B3JE 4N4YB 4J5VA 5E94B 3O2DH 2JSFA 2BWIA 5KKNB 4JFDA 4OGZA 2VW6A 3CD4A 4X8JA 3ZL2A 2P48B 1KJ3L 5DEJA 2FIKB 4UQ9A 5DJ0B 1S9FA 4U7SA 1YEDA 2YGVA 5I6KA 2R92A 3JZYA 4YX2L 1ZK5A 3BSZL 2P5PA 3LXCA 1BD2A 1Y7VA 2LOEA 4YC2B 4JS7A 5J56B 3AROA 4OQTH 5KFWA 3ARWA 2P43B 5KVGH 1AC6A 5BUAA 2JKSA 4P23B 2NPLX 2MQ3A 1DUYB 3RVUD 4Z1PA 3T0EE 3BCFA 4LCUB 1CLOH 3SE3A 1GVIA 3V8OA 5TDNB 3QNFA 1CDCA 4QI3A 5HHPA 5I1HH 4Z77B 4IKLA 1FSKC 1GS7A 1JZJA 1C08A 5H2BB 4JYAH 3LRHA 4D3CH 1A7RL 3KL0A 3QEUA 3QUZB 4TUOA 4WGWB 3ESVF 1FNEA 2HT4D 1SXCA 2QPDB 4JPQA 1P1ZB 4UBDC 5CLTA 2DQTH 2NNRA 1OGAD 3LN4A 3BAYA 3MFHA 1TAEA 2X3CA 1EO5A 1F4AA 1KGJA 3I3DA 4YE4L 2APWA 1R3JB 2NZ9C 1QYGH 5AZEH 5BS0D 4GQ9H 4PJHB 1QNZH 3CK0L 3S3BB 5MEPB 4IOSD 3ILPA 4FTVB 4YEFA 3IJEA 5AD0B 5C8JA 4HFWA 1FHGA 3MRQA 3NJKA 4WI3A 1ZLVH 3D4GA 3W9EB 4ZMVA 1XXFC 2AHIA 2HJFB 2ATKB 4JFFE 1U3NA 3QS3A 5IEHB 1NCWH 5KG7A 4A55A 2IH1B 4HJUA 1KGUA 3OSNA 2F54A 1L0QA 1BIIB 1KC5H 3MGAA 1FFQA 4J3SA 4L4VE 4GS7B 3S48A 1PEZA 2GJ6D 3SEPA 1BW8A 3MV9B 2SODB 4RGNC 3B8YA 3T3PB 1A9BA 1UQSA 1PLGH 3O9WA 5DMKA 3ELAT 1I8MB 2HB0A 3Q1KA 3VXME 5J2TF 4RZCB 4X6BB 4DW2L 2R2BB 1A6VL 5KN5B 3C0FB 3GI8H 1G5AA 3MBEB 1XQ4A 3GO1L 4FC3E 1PZDA 1N6UA 3BKYH 2XWDA 1TQVA 4LE8A 2W95A 1V5JA 3B4NA 4BCYA 3SGEH 3DRTB 4GRWF 4Q9BA 4K3JL 3ZDZE 2V2TA 3H7BB 1BYNA 2E6PA 3K91A 5G5DA 3EGSB 4ZMNA 4GRWH 3GT6A 1WFIA 3A6CL 2AQ1A 5TFSH 1HFUA 2PO6D 3EGDB 4DERA 2XJKA 4TULH 3U0TA 2ED8A 5JA9A 3G08B 5JR1L 1BZOA 3A21A 3EJSA 5BZDB 3OJDB 3G6DL 2NY6C 4CN1A 3DX6B 1WISA 5D1XB 4MXQC 4LNRA 1WH0A 1ZK9A 1G1KA 1GGYA 4MJ5B 2EIMB 4XNMA 2XV6B 2D2CC 3SKOA 3CFJA 1CS6A 1AGCB 2XVBA 2F0CA 5B1CA 3EGXA 4XP6H 4YXHL 4LLDA 4JMNA 3O41A 2RR3A 3MV8E 2HJLB 3BZDA 3QP3A 5F8QC 5IW1A 1NC2B 2AJSL 15C8H 3MREA 4JY4A 3H9SB 2P49B 4LCIH 1LVEA 3VFPA 3IRCA 5I0DA 2EINB 2ZP9A 4JO2L 1XF5B 3SPJA 2C9VA 4D8OA 5T3XE 1FL6A 2BOLA 3VG0L 1E2WA 2F2HA 3T2PA 3U46B 1NLBH 1AC0A 3SE4A 5HHME 1ZS8B 1ETB1 2XQ0A 4M9OA 3KZ8A 1U8JA 2VOBA 5M94B 3BFOA 1S7UB 2YQGA 4ICWA 1TIUA 1NMBH 2EDFA 2WBJC 3ECBB 2EYRB 1QMUA 3IMBA 1T66C 3VFWA 1NLDL 2BP0A 2QGEA 3ULAB 2AV1B 5IYDG 1GGCL 1YAIA 3TWCH 4QHPA 3WCYA 4DQOL 3KM2A 2R2HB 4LOUC 1HI6B 3D5OF 5GGQL 3AREC 3TIEB 4MD0B 2E8ZA 4X9IA 3LPGA 1MZYA 5I1JL 5D4JA 2F7OA 1MW2A 3NPSB 1CICB 4BSVB 5E8OB 4WWOA 5KBNC 3FMGL 1LILA 3QS2A 3RB5A 4YLBA 3MJ7A 2QPUA 4RCAA 5JPNA 3UTPE 2FR4B 1ERNA 1LM8V 3MVSA 4L4TB 1F18A 2OCJA 2MCPH 3DV6B 4RAHA 5DHVH 2ETWA 4J9LA 5C92A 2I8CA 4XX1E 4JFOB 5KJRL 1BWMA 3N44B 3JTSA 2WXPA 4BFEA 2I9TA 3KPRD 4JKLA 5I24A 4BH8A 1KIQB 3P0YL 1HAWA 1IQWH 3B7RL 2FEDD 2QHLA 2X4UA 4MNQD 3JV6B 4Q6IA 4Y5YA 3N42B 1OSYA 5ENWB 4JFWA 4PIRF 3WD5L 2FGZA 4FDWA 4OBSA 1JMZA 5HYSB 5EIIB 4HWZB 5I17B 1JV5B 1R34A 1G1YA 1UZ8A 2E7HA 3I4NG 3QDME 4FOMA 3DV4A 2PW1A 1VA9A 2E5EA 3CHXA 4P04A 3BH4A 4MQ7B 3I75A 3OJ2C 5IVZA 5JDJA 1JRHI 1S8DA 4OCWH 2QMJA 3FUNA 4KKAC 2YS6A 1MJ7H 4N25A 5FFLA 1HH6A 3GXIA 2EE0A 4JFQA 3X12A 1INDL 4LNVA 4KX9A 2X09A 3AAZB 2DBLH 3I84A 3C6LD 4FNSA 5TGBB 4LEOB 3QUMB 1E30A 2OMVA 2R56L 4J28A 1QP1A 3DSNA 1CFTB 1J8RA 2NUPB 3EJYC 1ZIAA 3GMNB 3FRUB 3O3AB 4QDGA 2G2RB 2WJ7A 4PGZA 2XQBH 1TUPA 3HAEA 3SY0A 4V33A 3LKPB 2ODIA 4F7TA 2N59A 2HVBA 5AWNH 2YPVL 4L1BA 1TMQA 1H9DA 4KKQA 4WHCA 5DJZB 5DG7A 3QARA 2LHAA 3JUZA 1BVNT 5DK2B 5E8PA 4KRPC 1J9CT 4EDWH 1WTLA 3UROR 1QEWB 1BGXL 1T4KB 4KK5C 4EN3D 3FJTA 1AP2B 1QKZL 3IWVA 2KH2B 3SHSA 5IB3A 3WNOA 2YZGA 5L7XH 4NM4H 3BJLA 3GPEA 4FL4B 3VD3A 1B04A 3VMMA 4JN2B 4OF5A 4LEXH 4LOVA 3OXSB 4I2XA 1KJQA 3FT0A 2C7UA 1Q9OB 1WVZA 1OGAA 3GIVA 2DQCL 5IMLA 1HE7A 4TS6A 3UC0L 5FO8B 2NNXA 4RMVA 2NSQA 4JGJA 3PUUA 4PWHA 5BS0A 3GRGA 4UT9L 1H3PL 4S0HA 4IOSA 2ATPB 2WZ6A 3BEWB 4X7EC 2F54E 3V4PB 5JNYB 3GMLA 3OX8A 5DC2A 5IP9G 1W6WA 3ZHLA 1XVSA 3EO1B 1AXTL 4LVHB 4DHLA 4MMZB 2OX5B 3HBGA 3CFEB 4G8FB 2NYYD 5B39B 2G5BA 2GJ6A 1ORSA 2X42A 4KVPA 4ODUA 3DUUA 2X4SB 4O4YL 1F5WA 1SDDA 1LEKB 3CTTA 4X7TB 3LRKA 3PWPB 5AOZA 2Q5BA 3VFUA 4AYBA 4TQHA 1Q1JL 4BE6A 3TVMD 4G42B 1CD1A 4MA5A 1ZHSA 4JN1H 4LSTH 4TQ8A 3FPXA 1CDGA 4HNTA 3WEXB 2G2PA 1IBMH 3DARA 3NCFB 5DEGA 1GTFA 3QPXH 1ULVA 2HLFC 1I7UA 1FFOA 3VD0A 3T3MF 5IR1A 3B5TA 2FJFB 4HCRL 4AZ8B 3Q6GL 2NZIA 4NKMA 5H8DA 5DFTA 2F19L 1I9IL 4LQFL 4JQVC 2ZWKA 5DJ2A 3OHXC 3WSQL 4KJWC 3ZT6A 2IANB 3SZKC 5MHSD 4HA1A 1ZD6A 4I77L 4S1QL 2PO6A 3OG4B 4RMSA 1DJXA 1G43A 5C0FA 5F1SA 3B9EA 2HFGH 4I0PD 4A6YH 2Z0BA 1IGTB 2VRQA 1JWMB 1LD9A 1OAQH 4ZYKB 4XNXL 4PGDB 2ALZA 2Y36H 4H2AA 3D48R 3GV7B 5DHMC 5F7BA 4FXKA 4L37A 3S6CA 4X5WB 4BZ2H 2NW2B 4M29A 2I5YH 3W39A 4GAGH 1SLWA 2WYIA 4HH9B 3GS7A 5DD0H 3AWEA 1OM9A 3F7LA 4MQXD 2P26A 3RUGA 2NDGA 4HIEA 4QOKE 3GSQA 4XBGA 3HG4A 4JHAL 2J56A 1MREH 4YOKA 3WUWA 2DN7A 1RYSA 4AQOA 1FVCB 1FUNA 2XG5A 3P9MA 4XMKH 4PWFA 4N8PA 4Z8FH 3GHBH 1OWWA 1VACA 5IJVA 4Q56A 4YAJB 4JQXA 3CSBA 4AC2A 4OZFB 2WWMC 4XNQA 1AQDB 1FIEA 1VERA 2J5WA 4X6FB 2G4GA 4KMTH 4I89A 1XH2A 3LEVH 4HVBA 4KITB 5C0JB 5FA4A 5GGTA 3GSRA 1JGEB 1OT1A 1UYWL 1IAOA 1GPOL 1B33N 5CZRA 2R92G 4ZX3A 4YHKH 1CU4H 1V7MH 2WWKT 3C08L 1YAZA 5DT1L 2DOCA 2ZAHA 3A3YB 2OLDA 2Q3XA 2I80A 1QRND 3RX5A 3V0HA 3HZKA 3RWIA 1WFOA 1GGBH 3UJTL 4UMSA 4LSXA 1NBQA 1HIMH 1WCBB 5DDHA 1F6LL 2ZUQC 3HHRB 4R0LC 1UWEH 5BVJA 2RB8A 4L1LA 4FQCH 3FQYA 1J8HB 3OMAB 4JFSA 4CSZA 2H3NA 5CB4F 4QY8B 4KOCA 5AOMA 4BXVA 1I85A 4DV7H 5I66B 1EJOL 2E3VA 4G9FD 2DLGA 1PZSA 2AJ3A 5HHXH 1GKEA 3KPRA 3GSVB 4LARH 5ICXB 3RFRA 3G5ZA 3V6ZA 4M9PA 4MNQA 3R5HA 5EBWB 5MEOA 1HCZA 4QWWC 2JJSC 4PJ9D 5FS5A 4M62H 3FSOA 3EBIA 4S2SA 4LSAA 1QATA 2NNAA 1XX9C 1BOGB 1CXHA 2ZSVB 1RMFH 1RERA 1MCEA 3C9NA 4LCYA 2IFFH 1OHZA 3PGDB 4TUUA 4LLQB 1XNQH 1PIFA 1SZNA 2G3MA 3IFPB 3DF7A 5J89A 3OR7A 4X5LA 3D2UB 1YMMB 1RKRA 1VSCA 3HI5L 1I1RA 4LESA 5SWZB 3X14B 3KHHA 3SKNA 1QFUL 1WFMA 1ZHKA 4ABVA 3C6LA 4Y89A 3EO0A 4XXWC 5C0BB 2ZX8A 4KVNL 4PJ7A 5D6DA 1GHFH 3QO1B 5DJCA 3MLTB 5HD8C 5IY5B 2R6FA 1A9EA 4JRXB 4MDIB 4R3SB 1M1XB 2OR9L 3KYMA 4IS6A 4UM9B 5IREA 2PYFA 4JI3H 3N55A 3JV5A 5HHVL 1WZMA 2A74B 3KD4A 3H20A 2ITEA 5LBSL 1K9TA 1MJJA 5IFAL 4N9OB 1ZQ7A 4DGUA 1B4JH 2WBJB 4P3WA 3DGGB 4YDIL 2GSMB 3AQZA 4Z7VA 5CNHA 3LS5L 4PU2A 4WGKA 3SOBL 4EN3A 2XZQL 4AJYV 1OWTA 4OV5B 3AREB 5SWQA 1BV8A 5IQ9B 2FD6L 2VLMD 1K6QL 3QH3A 4R8UA 4YSPA 3IDNA 5E2WH 5D71L 5JW4Q 2ZSWB 3GSNH 2C2DA 2H1PL 2FYVA 3RX8A 3IAPA 5BS0E 4DEWA 1G7IA 3DX7A 5F88B 3KLKA 4C4KT 3JWOL 4YHMH 5IKCA 1YYML 5J06A 3QPQD 1NBYB 1JZHA 1OE2A 2FH8A 3GJFH 2HUEA 4J27A 4QT5A 3HI1A 4AJWA 1JGIA 2NXZC 4C2MA 1CD0A 5FGSA 1HCFX 3CH8A 1BG9A 2YKLH 4FKEA 1FORH 3WENA 4YFLI 2QQLH 2ADYA 1YY9D 4UT7H 4P05A 1BVNP 4HCIA 3KCWA 3E5NA 2YAPA 3A6OA 3N1FC 4OGAC 2Y3NA 1OGSA 5EFIA 4AYBE 4HWEL 2R39A 5L4IA 1QBBA 4HJTA 2WD0A 5FM5M 3UBXI 5KFIA 1XWVA 1E5CA 5AL8A 1LP9B 1UOVA 5FM5O 4WI0B 4AL8H 5IM7A 4GW5B 1K72A 3TVMA 5EEWA 4AEEA 3KHRA 4DL7A 3VGGA 4PJIA 4WW1A 1MFBH 1RIHL 1MHHB 1MH5B 2J43A 1IC1A 4A7TA 4OZIB 1CLZL 2XDHA 1C5BH 3FZUD 2FLMA 1HQRB 3T1FB 3W0WB 3ZBMA 4AKOA 1JPFB 4BH7B 2EDJA 1MHEB 1W72L 5I8KH 3Q6FB 5F7EH 3F00A 4RU9A 5F6HJ 2X1QA 1EFXB 4S0SD 1YUHB 4NZTL 4WO0A 4YIQB 1I1FA 2VDMH 2F9BT 4GY4A 1VEOA 4AQAA 2FB4H 4O3PA 3RIZA 2GY7B 2HWZL 4OW6A 5AW5B 3T4AC 5JOPD 3FFCA 5JPMC 1KIUB 3HFFA 4OKVA 4TRPH 2XCAA 3O6FC 1AGBB 1DDHA 1E4EB 1V4YA 4QNPF 3KPNA 3WFBL 1UM5L 4I0PA 1OQOA 1KJVB 3II3A 4EI5B 5EWFA 1W96A 1TEGA 3A67L 5I76A 4PWKA 2CMRH 3EZ8A 1SBBA 4N1HB 2GJZA 1J0JA 2XGQA 4FFTA 1JAEA 4FNPA 4HPOL 4TNVF 3WO1A 2Y5QA 4OZHE 5C07E 4YGVB 4Y16D 4XNUL 4NI3A 2IGFH 5HXMA 4LLMB 1KXTB 5ESVA 3ZTJH 4UUJB 4DVRH 3L7EA 3QUHA 2CGRL 1T20B 4NKOB 3ZTCC 2COVD 2OXHA 4POZD 5L2JA 4LKXB 1VB9A 4CMHC 1XGZA 1NMCC 4LEBA 4F37K 1XCQB 3TO2A 1M0TA 2BVQA 4N24A 5E5RB 5B3SB 4Z7UE 2Q10A 1RK5A 4DP1X 5F9DC 3FFDB 2ITFA 2X4PA 2EAEA 3BT0A 1BZDA 3HAEG 3B7YA 5I1KL 2GTQA 1AYOA 3CFMA 1CFVH 3TTSA 1YN7B 2Z31D 2Z1PA 2BOCA 3ZTNH 2OBGA 3BUQA 3QFJD 3VRJA 2ZM6H 2MEJB 3DPBB 4AQ8A 1AZZC 1QRNA 1ZANH 2QQKH 4F8QA 2MCTA 3VWKB 3DBXB 4GMSH 3PW2A 1GZQB 3NCYP 4IKJA 3NCXA 2QEJA 1F4WL 5DGAA 5KFDA 5G4OA 3CSYB 3C2AH 1XCTB 2CLZB 4MAYD 5DUBB 2EIZA 2NQCA 1AQHA 1Z32X 4BFIB 1JPTL 2ITDB 4M00A 4U6YB 4DOHE 3EYYA 2R9HD 2O03A 3H0GA 2AXGB 2E9JA 3C87A 4G9FA 4JHVA 3J2PA 5ILTH 4CADB 2M1KA 4ZFQA 4XPGH 1I9EA 3D3VD 3IGFA 3T4YA 5I23A 3VPDA 1U8IA 4PRHE 1ASOA 4YHPA 2WSDA 1THAA 2QLYA 3K72A 4JQIL 4PJ9A 5JW3L 3DECA 2X9WA 3BUYB 2UZXB 4JV5H 4JFPB 2L7EA 5HI5C 3HHMA 4XCYB 3RWDA 1A3RH 1UHVA 1NC4D 5DMGC 1KENL 3UAEA 2V9UA 4ELKA 2IALB 3VD1A 3BQ2A 4JB9L 4WI5A 1YNTF 3X11A 1OGTA 5DS8B 4KKZA 4KKCD 1A22B 3V7MA 1HNWH 4HXAL 3VRIA 1EXGA 4K71B 3QJUB 4LP8A 4PJDE 5KVMC 2AJZB 4KFZC 2OW6A 1SJEA 4ZQIA 4ZFZA 4PJ7E 1DBAH 3O8XD 2HFEB 1ZLVK 3MJFA 1JNHB 4B7IA 2KT6A 3L13A 2OMWA 1HJBC 1FGNH 1SYXB 4LSDA 1KCUL 4K9JA 5IV2A 4J7RA 2H32A 2VT0A 4YWGL 4HKBA 5EDSA 3NCJL 3RL1B 3QQ9C 2GTWA 1VRSA 5E23A 4PLJD 3NQIA 4MCNA 4LH6A 1KCKA 4PJCF 2AITA 1MPAH 4P2QB 3BPLC 1MAKA 1RUQL 1DJSA 1TNMA 2HKHH 4QYOB 2IADB 4F7MA 4WW2C 4HC1H 3E9TA 1FE8L 4LF3B 2F5BH 3TA3C 2X1PA 1I9RH 2J8UA 3BD3A 2B4CL 3CFBB 3DUSA 2R8SH 2ZUQB 3HC3L 3OD3A 5JHMA 2VXUH 2R2EA 4S1SL 3REWA 2DLFL 1S9VB 3RVXC 3UTQB 3LXUX 1UD6A 3FQWA 1JRHH 3BPOC 3L5JA 1AFVL 2EC9U 3HS0B 2WLLB 3GZOA 4CBPA 4I1RA 2C9AA 4NC1E 1Q0EA 4YSAA 3G5YB 4XVUD 4RNNA 1TU2A 1TTBA 3QC6X 4EAEA 2WLKA 4AMWA 5JVDF 3RBSA 3V5DB 2BQRA 4H8WH 1URLA 4UU9A 1CCZA 4PLOB 1MHPL 4YHZH 3WUWG 1KLGB 4MA3A 3RPBA 2ZUYA 3VA6A 3M7OA 4Y2LA 5T1LD 5E56A 2E9WA 1PZAA 2ZNWA 3O4OB 4FFYL 4MWFB 2Y72A 2MHAB 4LSVH 5CJOH 3VFNA 1Z1WA 3Q2LA 2PBZA 4N2MA 3ZZLA 2YJQA 1KLFA 2UWEA 3C6SB 1KYOK 1NFDF 3LPWA 4L9DA 3WXWH 2OP4H 3IJ8A 2HLAA 4PJIE 1YEFH 5FHBH 3L3KB 3R0NA 2Q8AL 3ZRCC 5T5FL 3TJHD 1DJYA 3ARQA 3UAFA 3ZYIA 3L1OL 2J5LB 5E6IA 5JW4M 3MRKA 3JXAA 4DL2A 3WNZA 1ONQA 2VDOH 4LRNH 4ZFFB 1U8CA 3F7QA 5T33H 4M3JA 2R69H 1UCBL 5MHSE 1U8MB 1KGIA 5GGVY 3FFCE 4MA7H 3MRRB 4BYHA 2X0WA 3AS3A 3N6YA 3AYHB 3HS9A 3WTVA 3ABKB 2E8YA 1J9RA 3CDGA 4FX5A 3EYQC 1EBAA 1F3JB 1EDQA 5EU7C 1TNNA 3S8FB 5FYJU 5LAXB 4P5MB 5J8OA 1X7SA 4ZQKA 1A6UL 1PBYA 2XTJB 5J0BA 3ULVD 2VW4A 3OKDA 4EUPB 3CLEL 3OM3B 1RU9L 3HPJA 5JIIA 1BM3L 5CD3A 4TXVB 2NY1D 2P44B 1LEGA 1SJHB 4MAUL 1FZMB 1DQVA 1H3WM 3SPHA 4MYPA 4Y9GA 3D0LA 3EH1A 3KE0A 4LB8A 4XPFL 2WXJA 3OKNB 3NIGB 5ACLA 1RULH 2VZOA 1ZETA 1MRDH 2CIKB 2CR3A 3EO9H 2KS0A 2A99A 1C5CL 3FF7A 4PS7A 1E28A 1FPTH 4JY5H 3F5WB 3DETC 3IB4A 1MI5D 4V2CB 1OAXH 3JTBA 5EZLA 2HTLD 4LBEA 1N32H 2FJGB 1U2HA 4TLTA 2MMXA 2Y06H 1QFWI 4HUNB 4NNPH 5FF6A 4BY1G 4GB9A 3ARXA 1S5HA 4X4XA 1ZHBB 3LRGA 4LCWD 1RIUL 3VI4B 4F33B 4L8CB 1C9SA 1DN0A 1BZ9B 1BEYL 3LEXB 2DLIA 4JHUA 1V55B 2IIJA 4XO5A 1M71B 1YN6B 2EE3A 3SQBA 5KFSA 1CFQB 2HRGA 3ARRA 2AQTA 3RDJA 2Z31A 3MR3A 3HOXG 3W11D 4Z7QE 1KCVH 3QFJA 2PPFA 2FJHB 2WQWA 5TTRA 4GKSA 1IARB 2HYMA 3CSPA 3L3JB 1S4IA 4JM2D 4L5FE 3DO7A 2IPUK 2ED9A 4NZRL 4UILL 4DIXA 4UQ3A 1ZA3B 4KI5F 1BQLH 1IC5H 1S7WB 3GHPA 4MAYA 4DN4H 1TQBB 3EIFA 5AAMC 3QRFM 4AGLA 3H4BA 2WMPB 4G9FE 4GG6A 2XA3A 4PJHF 3MOBL 3SN6N 5CEXB 3LP8A 5FPOA 2NXYD 4HUVA 1F3DH 2OTPA 1NFKA 4M1DH 4NRXB 3V0VA 2YAFA 1F2QA 2R0WL 3T4AB 5J6HA 3WTXA 1DLFL 4NKDA 1MVFA 1FG9C 4HOMA 4FJ6A 5C86A 4OTXL 5HHNB 1U9KA 4EOWL 3IAGC 4LDCA 5LNEA 5HP5A 5CP7A 1N7ML 4Q52A 3RAJH 25C8L 3HZ3A 5A2LH 3T3PF 1NC4A 2HG0A 4M4RB 1JDDA 3H6JA 2CKBA 4OCMC 5C2BL 1U8KB 3RFZC 3NSJA 4XOBA 1SN0A 2C3XA 1XBRA 1MRCH 3UCQA 3NBNA 1FZOB 2O5XL 3HZVA 2XG4B 4G1MB 4FYSA 5IMKB 3LIZH 3QJOA 3QG7H 3O8XA 1YUKB 1ZHNA 5EOCH 2VR6A 3FU6A 1ECYA 4UFZA 2WXIA 4L8SA 4OCYL 3KWUA 1SF3A 4N90E 4YE0A 12E8H 2JB6A 3QHFH 4TVSa 5E8EA 4KNSA 5ABZA 3IU4L 4CMHB 2A6KA 1EXUA 1MFNA 4FXGC 4PJAB 4HUKB 4BSWA 3RAQA 2EKSB 4JFEB 2Q7NA 2YBGA 3KXFE 5HHOE 5CLWA 1IGMH 2FEJA 1WP6A 2ICWA 2OQJA 1G0XA 1GZPA 1KN2L 4AMXA 2PYEB 3Q2CA 1DVZA 2GSIA 3DX9B 3U9UB 3V10A 4XN1A 4LH7A 1WT5A 4U2YA 4M7KL 2ZXWB 2OH2A 5EEYA 1U36A 1KY6A 2ZICA 2AK4B 4OIIL 43CAA 1QX1A 2EABA 1NTDA 5IT2L 4XVJL 4HDIA 3NOIA 3RVVD 1Y6NR 3EKCA 4AG4L 1INEH 5ACZB 1GAFL 4ZG1A 1BJTA 3V6FB 3PQYE 5I1IH 1P4IL 4D9QE 3INUL 1ZVHA 2DMCA 5KYUB 1SOSA 4IRSB 1JVLA 1KXQA 3WJJA 3UTOA 3D18B 2N0MA 3UTZB 4AGOA 3ZW3A 2BSSB 3EOAB 3MC0A 1PYWA 5KFLA 4J8RB 3TCLA 4E5XA 4WU7B 3AB0C 1J1OH 4XYMB 2K45A 3AGWA 5IBTL 4U1SB 3ATFA 5LO7A 4M3KB 5T1LA 2UWEE 4D0BB 4DVBA 1NUNB 1MCQA 2AFNA 3MCKA 1U30A 4XP4L 4ZDHA 2RAMA 1XGRB 4K94L 1VFOA 5FHAH 5HGBB 4KK9D 1BZEA 2J7LA 2P5ED 3MLVH 4P48A 2A1WL 2NLJA 3W82A 2CDGB 1YZZA 3O2WH 5JQHC 1JF1A 4N0CD 4RB2C 3PWNB 1SEBA 1QLEH 4ZO9A 4DKEH 5AZ2L 2NU6B 4JPVL 4C47A 2JE8A 3NSYA 3QIWD 3P3YA 5B4MD 4KXCA 4WTZA 4JLRB 3FT3B 1OV8A 1WITA 4NN6C 1H0DB 4KV5E 4N28A 1Z66A 4KK8D 3N44F 4EEEA 1E27B 1U91B 4UTBL 5LNGA 4LZKA 1ZV9A 2WYHA 2AABL 1FO0A 3OGCB 1Q72L 2GCYA 4HF5H 5GSRA 1B0WA 4X5QA 1JZ2A 1QHQA 5FW7A 4NP4L 2FL5B 4M1GL 3N42F 1T6BX 3ZUCA 2GUOA 2Q7YB 4YPGB 2HX9A 2XV3A 2QZQA 1J0ZA 4ADIA 1DFXA 3H0GG 4YFLF 5L1JA 4O51A 3KLLA 3NCCB 3BXNA 5BXFA 4ONFH 4AK2A 2DWDB 1I3RA 3VXRB 1KMGA 4YR2A 5TK2A 4CVXB 4DPRA 2NCEA 1GOFA 2G75A 3DXAD 5C70A 3NZ8A 3MXVL 3GIQA 1S3RA 2LU7A 4H0IA 5E1HB 3HR6A 4TQPA 4UQ2A 5INCA 2CDEB 5GGVL 5BRZE 3MR9B 5HYQB 4F57L 1WBXB 3BJ91 2ZPKH 2E7DA 4R4NC 3B56A 5HHQA 4FNTA 4ZXBD 3UO1L 3EF4A 3RWHA 4W93A 3DIFB 4PGBB 2E27L 2VMJA 4XXCA 1Z9SA 2ZUXA 1XGYH 3VM5A 4M8UA 1MI5A 1DBKL 2IGLA 5DD5L 4MCYA 3VB8A 2JKRM 4PP2B 2GJJA 4AVHA 3T0BA 1RV6X 2OMYA 2J25A 4LCWA 5GGTL 1QSVA 4HWUA 1D9KD 1UFUA 1A7NH 1JERA 5F7MC 1KTLA 1OIOA 2EIDA 4HD9A 5IVOA 3RNQB 1U33A 5LOVF 3QFJE 4FI7A 5AOJA 5HTSA 4DZ8B 4PG2A 1YEIL 5D7JC 1ORQB 2VH5L 2YEQA 4QHUB 1JV2A 2GI7A 1AO7B 3JV0A 2QGBA 2CM5A 3NCEB 4HJ0C 4DKAA 2W7PA 3LN9A 5LGJB 4DL5A 2L4OA 4NJ9H 4BELD 2EH7H 1GSOA 1OE3A 4JM2A 2V7HA 5JW5A 3QQ3B 2NY2B 2ESVD 1ZS2A 1QA9B 3QPKA 4XBEH 4KKPA 1VFAA 1MIEL 3SD5A 2L0DA 5KSAD 4YZFE 4MAMA 2PXYC 3TCXA 1EVTC 4K7PH 4NQXA 3T0EC 3BVTA 2BWQA 4F7EB 3R06A 3RZCD 2XUWA 1DQIA 5CR8A 3LEYL 1DL7H 5GS2H 3LDBC 2FK3A 2R27A 1AH1A 4BZYA 1UC9A 4XRCA 2GHWB 1V51A 3ULSA 3RWEA 2XX0A 2GSGB 5JYMA 1D5IH 1KJ2B 5CN2A 3WLBB 3K2UH 5GGRY 1U8HB 2IP4A 1I8LC 3JWOC 5E6UB 1E5UI 3L2LA 2DWTA 2BNQA 2HN7A 3BEVA 4JI1H 4IU3A 2MJWA 1I31A 2C5DC 3EHBC 1ET8A 3OG6B 1L9QA 2DMKA 5D2LB 2PW2B 3BZFB 3GLEA 4X6EA 4CUCA 4P0DA 3SOTA 5MENB 3GJFK 2HCZX 2FEEI 3PJSA 1JGVL 3K0YA 5CBEA 2EH8H 3AXLB 4AIZA 1A66A 4Y2DD 2ICEB 3JSSA 2VL4A 3INOA 3KYOA 4LLWB 2UY6B 3U6RA 5L88L 3ETSA 3IETA 4M8QB 3FT2B 4GFXA 2X7LB 3FQ2A 4G6KL 4ZX4A 3LKRA 4IKKA 2ZYSA 5EU3B 1C3OA 2MCG1 1RZJH 4X5XB 3O6ML 5JIDA 2X6VA 1QVOB 2ED7A 3PREA 4JE4B 4HR7A 1YY8B 3R7RA 5E4EC 2YZNA 1F97A 1W16A 3DJ9A 2W5PA 3QWRD 2VERA 4ZW6A 4F9LC 3MRHA 4UOZA 1TZIA 3TBTB 4U1JB 5CO1A 3DRQA 1KYUA 3MAWA 5DLGA 5CJ5A 2XWJB 4BFRA 1FYTB 1A4KA 2W9EL 1SXSA 3U4EB 2NT1A 1CDHA 1RZGA 5ABDE 3D0VA 3CFQA 3NFSH 5DJXB 4UTAH 1UTDA 1M05B 1WAAE 4FQ1L 2H0PA 4JDEB 4ABQA 4HZLA 1DVXA 3CMOL 3HR5B 3JWDL 3SDDD 4BQ9A 2NUAB 1VZIA 5CCHE 4IJ3C 1HEZB 3VVVA 3QWNA 3IBEA 2F53D 4ZMTA 3V6JA 5FXCH 1YPZB 3ARBB 3QCTH 5EC2B 2Z7UA 1KXQE 2V2WB 4HT1H 2EEDA 5T1DH 3CHQA 3I9PA 4TSCH 3FW6A 1XR8B 5FYLH 4RIRA 4F9PC 2OTWB 3CNKA 2MFNA 4PR5B 4OZFH 4BXXG 2A6JA 3UYPA 5ALCL 5BNXD 3PGFH 4PJGA 4GXUM 2CD0A 4GAYA 5EA0H 4TLUA 1Y1WA 1MWAL 1XB3A 2VUYA 2K78A 1R5WA 3VQLA 2ZKXA 4QHLB 4NJAH 3LQZA 1NCCL 2VC2B 3IKCA 2K4WA 1TCMA 3LSOB 4NZFA 5DGQA 2FX7L 3GSWB 3QIWA 4JM4H 5FFOA 1A6WL 3HA0A 3ZYZA 1ZGLM 5L1IA 5AOKA 1WFNA 1MUJA 1KIPA 1A7QH 1RLWA 4OT1H 4TN9A 4HGWB 2NY4C 3MX0A 1RJPA 2QK4A 1N64H 5FCSH 3NGBC 3GTGA 1QO3A 1SEQL 4G8AC 4ECZA 2EEBA 1SQ2N 3V0WL 3ZPDA 4RBPH 3S3PA 4IHBA 3A6BH 1U3HD 3BWUC 4RGOL 1NAMH 2WO2B 1EZLA 1SY6A 2XU9A 1JZ7A 2F15A 4X6DA 4KXZI 2D3LA 2PTTB 4NBZB 2FGWL 2E4TA 1YEGH 2JFCA 2WLJA 3VW3L 5CA0F 4W4OA 1VCBC 3TONA 1RHHA 3B2PA 1KNOB 3T8MA 2HG5B 3R4RA 4RFEB 2Y6SD 5EHFA 1N0XH 3ZZQA 1DQMH 4X8XA 2GG1A 3FB5B 1Z5YD 2WXHA 3DXAA 2W71A 2J6TA 1ZLEA 2NY5L 3UDWC 3BRDA 1A14L 1C5DA 4ODHH 4PEEA 5I71B 5C6TH 4UCUA 4MKMA 4XCCL 4DP6X 1KC7A 1K3ZA 1MJ8H 2QJDA 2D9CA 4DGIL 1HILB 1EEZA 4CDHA 3S5ZA 5LWYH 1M7IA 5D8JL 4HWBL 4X6CA 4X7FC 5GRYA 3RI5F 1HR0H 1MI5E 5F97E 4ZXBA 1K3IA 1OALA 4M5YH 5DMYA 4N0YL 5B1JC 2JCCB 1QI3A 4WDIB 3RVWD 1FVDB 3SBWA 5TE4L 1UATA 4LCWE 4RNRA 2NY0B 3KS0J 3WL9A 3L2PA 3AS0A 3HFMH 2NDFA 2DQDH 1B4LA 3CLFH 4OFKA 3AB0B 3H40A 3C5JA 1D9KA 2B59A 4JKPH 4XWGH 2JEIA 5MERB 1JG9A 4K3DH 1MFCL 2KDGA 4M48H 3PP4H 4HK0A 4LFCH 4KVCL 4XO8A 1KEML 2VUOA 2BDNL 5IWLA 3QDJE 1CE6B 2J57A 2VN6A 1R46A 4BCZA 3EF7A 4F27A 4IRDA 3QQNA 2R7KA 5F89A 5KVFH 1A0QL 4RAVB 4AQEB 2VXVH 4NQDB 3WDJA 3GIZL 2ESVA 5GRWA 4NN6B 5FPRA 4L5FL 4ES8A 3FO2B 3A4EA 4JNXA 3ZE0E 3K3QA 3PW7A 3CIAA 1A4AA 4XNZC 3AG4B 1FLRH 1MCJA 3SE3C 4KDVA 4KPHL 4NQCD 3AY2A 5KSAA 5DI8B 1AVAA 1MAMH 3CMGA 3WFCH 3WO4B 4KMQA 3RZCA 3II2A 4BGLA 2B4CC 1XGUA 5ITBL 5KFRA 1JIBA 3BQUD 3RGHA 3CX5K 2VDNH 4OFYD 4L18A 4PY7A 3QEQE 5CEZD 2BNQE 2VLJE 5I2IB 4K9EH 1J1XH 3EJRA 2P1YA 3M88A 4DZBA 4BQBA 3HMXA 1QFWH 1HWHB 4TV3A 2AKRB 4E5XG 1LP9F 3FQRB 2PP7A 4LLVA 3TURA 4L3EB 2DQGL 4RQQA 4B9PA 5I19H 1JHTB 1ZLUH 1ZVSB 1U8PB 5I1EH 2OJZH 2HPTA 3D85D 5C0AD 5IGXL 1KB3A 1QBLL 2FE3A 1DFBL 4IAJA 4DO6A 1P4BH 3PYCA 2E0PA 1ZPUA 4H40A 4ODXB 4Y2DA 4K7PX 2J1KA 3GXFA 5EU6B 1IM9B 3QHTC 3FQXA 3LZLA 1K4CA 3OXRB 3HE7B 2UUDH 1MXGA 4BKLB 2D7NA 5ADOL 3O9WC 1VPOL 5CILL 4WTZG 3CH1A 1UA3A 1HXKA 1XIWB 2X5PA 3BIBX 3VX0A 3T6VA 5CINH 1I1CA 1D5BA 3QXUA 4PBVC 4XODA 4ZODA 4Z76A 3OLDA 4JGMA 2CBOA 4K07A 1S78C 1CGXA 2Y25A 3O3EA 3QEGH 4LMQE 1UACL 4FFWC 4TKWA 2Z9TA 4LF9H 4HW6A 2WUCL 1DBBH 1NCTA 3S35L 5KOVC 4ZTOL 3FFOA 3FU7A 4OLZH 3F84A 1N8ZB 3UJIL 1FZJA 4XYLB 4N0FA 2LLNA 1N5YH 4M93C 3FQUA 3SDDA 5DC9B 4GKZB 5BMVF 3CCHB 4NGHH 3NPZB 4QCIB 4Q9QH 4FBUA 4CAGA 2F53A 3RJOA 3JYCA 2W65A 3KYKH 5FLUA 4B96A 4EBCA 3U30C 1FGVH 1JS4A 4FULA 3VDBA 4P46B 2DKSA 3T2LA 1WRFA 3FCSA 5IK3A 4OB5H 4PJGE 3WN6A 3GV5B 3QUXD 1E50A 3TV8A 2ZWZA 3A22A 3AQDA 3DX3A 1ODAA 4JDVB 1BXUA 2V8LA 4OVUA 1CF8L 3IDGB 4J6RH 2NZ1A 3HI6L 4PJ8D 4RAUB 4HD5A 5J7CC 3IJSA 1K5WA 1UH2A 1I1YB 1LO4L 2BSBA 1LO0L 5GXBB 5K59E 1OF2B 4Z5RB 4E0RA 2HT2D 3WAJA 2WN3A 4UAOC 3TGXA 3CFDB 4PJ6A 4QXGH 3UABA 5IG7A 4U7CA 3APDA 1JP5A 4H8PA 5GRJL 5I6LA 4PGCA 1J9SA 3A4FA 2FWUA 4JFFB 2X41A 5IQNA 3QXAB 2C3WA 1RUML 4GP8B 1VKXA 2LE9A 4L4VB 4B5EA 4JO1L 5H35B 3PG2A 5HYJB 1LHZA 1UFGA 2OI9C 4APQB 4LASL 1Z6JT 4HQQH 3FTVA 5AKTA 5K9QI 4X6DE 4JREB 1U3HA 1E2ZA 2IOOA 2K9UA 3PV7A 1SDYA 1WGVA 4WK4B 5ETUA 1EJ8A 1PQZB 3VXMB 4JJ5B 4GOSA 4WKZB 4LLYB 5T1MB 1A7PL 5FOBA 5JPNC 3MUGA 3UTSB 3TZVD 4AGPA 3L9RA 1TJHL 2SEBA 3MGTB 4PYHA 3WG7B 3DXAE 4NQSA 1W72B 2EE9A 1NGPL 3FO1A 4LVOC 4TL5A 3MUZ1 3S37H 4XAWL 4A7GA 1M6OB 1HINH 4XCNB 5F9JA 3K6NA 3K6DA 1B0GA 2QQNH 4CNIA 1J0YA 4GRLB 4Q6IC 3EZJB 4Y5YC 1CFBA 5T5NF 3PIQA 4XB7A 4BFOA 4DKFL 2IPKA 2VERN 4IJ3B 3NDYE 4ZMPA 5FDWA 2HA1A 4QR7A 3AMKA 4PB0H 2ARJA 1XF2A 3MBWB 3LXBA 3LYRA 3NRQA 4GW4B 4IBQA 1EEYB 3MLZH 1UWGH 1RK0A 3STZA 4XMWA 1BQHA 1ZT1B 3BLKA 1KCRH 2YD4A 3OAWA 5KT4A 5F6IB 1BMZA 2XWBB 4PRBA 1ZTXE 4E9QA 1A6TB 4Z7NE 4ZMZA 2YR3A 2OJEA 1T5KA 1BQ5A 4XWOC 1DE4B 1UXMA 3SE9H 4E9WA 1TO5A 4OGXL 1AGFB 2YPLD 3D39E 1F42A 1UXLA 3MJGX 4ED0A 5H80A 4LGPB 4XPHL 2HMID 2QDVA 2VQ1B 3EBHA 3HUJB 4V1DB 3MV8B 1CI5A 3KDMA 1I7RA 1CMOA 1E9QB 3I50L 4ZUSB 2FO4A 3MLUH 1RQ5A 4Y0GA 3HC4L 4QKXB 2ESVE 2J4WL 2DL9A 4W4NA 1B2YA 1G7JA 2J73A 4WFGD 4FGMA 2LW3A 3QYCA 3LWBA 1X5FA 2G5UA 4N1CA 1U6AL 3DX2A 4EI6B 1T22A 3QO0A 2AP2A 2EEXA 3NGBB 4HBCH 3RVUC 4YSSA 2R1WB 3NFNB 2VL5A 3RAXA 3GMRA 4NQCA 2V3EA 1V54B 3T2OA 1TEYA 2I24N 2ILLA 2G2NA 3ULUD 4ZPVA 2XXGA 4NS0A 2ADJB 2XZCL 2YD9A 5E6ZA 2EUWA 2Y7QA 4W6YB 1OSPH 4P3DB 3LPOA 3MA7A 4PREA 3BQUA 2WN2A 4JDZB 1JHKH 1RJQA 3MJWA 1X5AA 4OFYA 1DANU 1CTOA 1CB4A 4V11A 5ACMA 4GSQA 4PBDA 1LDPL 3K8LA 4ZD3H 1L9OA 2XOTA 4P3CL 4PJFA 4OD3L 4U31A 2CKBL 3RB6A 1WA0X 4KQ0A 3KPPB 3Q1SL 2QTEA 3OKOB 5FYKH 1J0IA 5FKAB 5T14A 4R8WL 4GXVL 3D85A 2OK0H 2KKQA 5C0AA 1Y1WG 3I02A 3QZPA 5E08L 4U4IA 1O9ZA 3MZTA 1QFHA 1OK8A 5D9SA 3LKSA 2FK1A 5J2UF 4FQPA 4BKSC 2IAMD 5LUMA 2DQUH 1EAQA 1MFAH 1KCSL 2FHBA 3VWJB 1X5MA 4JVWA 5FPIA 3FRPA 5DYFA 5AW4B 2XX1A 4I0CC 4P4KC 4TQIA 4W9CC 4EGQA 3C5ZC 2F58H 5B8CA 2W60A 4Q8BA 2XCPA 5DR5H 4K3GA 3VXPB 2GI0A 3E8VA 2WBWB 4J1UA 4NM8H 2WQ8A 4PJ5D 1RJRA 4JFDB 4X8JB 5DGRA 5AL0A 2BRQA 3C8DA 3OSVA 4XC1L 2A4CA 2VZ3A 1YEDB 4X2UA 3MODL 4EUPH 2BPBA 1YECH 1XR9A 1BD2B 5ECGA 4NWUH 4MJID 5DZOA 2PO6C 4AYMC 4EZLA 3BAWA 3CHOA 5SWSD 3REVA 5EOCJ 1RIVL 4KZCA 3S34H 4G7VH 5C09D 1A6PA 3CHSA 4OJFH 5DFVC 1MIMH 4RRPM 4APXA 5C0ND 4ODVL 4FXKC 5HHPB 4JV1A 1UEMA 5ICZB 1C08B 1OSZA 2VSDA 3E8UL 1IC4H 4GQQA 5BVPH 3QEUB 2LAAA 5IJDC 2BSCA 1FNEB 4PUBL 1N4XH 2XJLA 3QUXA 4L4JA 4AZUA 3QWOA 4Q97A 1I3QA 3QNZA 3LN4B 2YD8A 2PCPA 4KJPC 4FG6D 2VQEH 3VMPA 2DQEL 1DBJL 3CU1A 3G6JE 3OWEA 2AZAA 4A04A 4KXDA 1TJIH 4PJ8A 3F6LA 2HX8A 3ILPB 1S9KC 3NK4A 3FYEB 3ISWA 4HALA 4XI5D 5D7LD 4Y88A 1USZA 3IJEB 1ES0A 4HFWB 5C8JB 3MRQB 1TJMA 4XP1H 2IA6A 4TLKA 2UXFA 5F93C 5D7IF 3BAEH 3UL4A 3B9KD 3OPZH 2F54B 2XGPA 1TTAA 1JZDC 5T3ZD 2D03L 2MTAA 1QEXA 2ISDA 3WY1A 1WE5A 4DP8X 1NM4A 2VDQH 1JPSH 5I1GL 4PTUA 3VD5A 3FUMA 2DQHH 3D50A 1A9BB 1UQSB 4FLOA 1E6JH 2Z35B 3O9WB 2YUWA 5DMKB 1FO0L 4LCUA 3VQ1C 3HNSL 4TNFA 1GLVA 4DUZH 1R0AL 1ZEAH 4ODWA 2B9BA 1WG3A 4WLCA 5BV7H 3Q7JA 1PG7X 4B3VA 1RZKC 4EYHB 1YNLH 4DUYH 1A2YA 3TZVA 2WTPA 1EMTH 3I2CL 5JHLH 4A2LA 3UH8A 3ULVL 1NL0H 1M57B 4GP4B 4Y1AD 3QJFA 3D06A 5FWQA 5K9JL 2V2TB 2VDKL 5C0IA 2CGZA 4RWYL 5G5DB 1BJ1J 3PJLA 1GC1C 4DETA 3V52H 3O4LD 5EDWA 5FA3A 3U6XA 7FABL 1JJUA 3U0TB 3S5LA 3ZHKA 1E5ZA 3QJXA 4M93B 2HTKD 2FNWA 1E3FA 2YRPA 4OM0H 5BMFH 3B2XA 3QG6A 4DR6H 5EBGA 4P5TD 5ANMA 4LNRB 4OF6A 3X1FA 1AXIB 2H5UA 3M9OB 3WTTA 4B3SH 1W6LA 2NMSA 3HE6D 1XL4A 4HPYL 4HK3J 3U30B 4R5TA 2AQ2A 4MKTA 4XNMB 5C7XL 1CTNA 3SKOB 3CFJB 3AMLA 3GC3A 5E51A 4EO5A 4J3WA 4K3EH 4RDQF 4A38A 3EGXB 1KXVA 3Q8RB 4LLDB 5D5MF 1NSNH 1RURH 2EIKB 1XDTT 3KJ4C 3O41B 4LP4A 3RA7L 5KT2A 2YPLA 3C6LC 3KPSD 5IW1B 2BINA 3LNFA 5AVRB 3MREB 5D6DC 4ZFGH 1RUKL 1KJ3H 1PJWA 3VFPB 4KXZH 1TSHA 1FL6B 4UAOB 4DAGH 2I87A 3VFGL 3TYFA 3BSZH 1IBZA 1OTSD 5A7BA 1R5VA 2MTPA 5CMAA 4AQ1A 1U8JB 4YEEA 3MV01 4JHWL 4FADA 4KO5A 3N41F 3VXSE 5I1DA 3UTTD 4Y2NA 4R7DA 3VFWB 1BLNA 2BP0B 1N5AA 4EN3C 3SE6A 5EEVA 3U25A 4KY1H 2R51A 4X65H 2NVXA 3NTCL 2EDQA 1MCPL 3CVHA 4JI7H 3ZE1F 5ESQA 5HDLA 3CSTA 4ERSL 2X6AA 3JWDC 1BIHA 5IHUH 3GJEB 2DQ6A 4HG4K 1A7RH 4Y9CA 3MJ7B 3L4VA 5JPNB 2VN7A 1JPST 1N0LA 3NDZE 4HIHA 1BBJA 3HRZA 3P54A 3EFDH 3HPLA 3K74B 4XNAA 1TJXA 4IJTA 4YE4H 4LVOB 1HJCA 3JTSB 1M7DA 4JV2A 1RZ7H 3FB8A 1BPVA 1GGUA 1NPJA 2B15A 1IRAY 3CK0H 5C0AE 2I9TB 1XCWA 4JDTL 4BH8B 1HYSC 4JI5H 3LH2H 4B9KC 2X4UB 4NC1C 3TT3L 1UA6L 1K8IA 1UZ6F 4XXDA 4Q6IB 4P2RD 4Y5YB 3SCMC 4OJAA 2FLRT 4OUUA 5FM8A 4C59B 1YYLL 2WWOA 2EQDA 2L3BA 1UZ8B 2IAMA 1HNZH 1CXIA 2DQIH 3DV4B 2PW1B 4UINL 3G6YA 1JBJA 2EYRA 1P7BA 3SDCC 5C2UB 4J9RA 3I75B 4MA1C 4WWPA 5IVZB 3TJEL 2OFQA 1V3JA 5HDRA 1OAKL 1S8DB 2HT3C 3TVMC 2FATH 4DGYL 3MLRH 2H41A 3VXNA 4DW2H 1HH6B 5FUOH 1A6VH 2Q7AA 3F8UB 3VUAA 4JFQB 4J2QA 3X12B 3GO1H 3W2DL 4AT6A 2X87A 5JH7F 1FH5L 2OMVB 2QPFA 1K8DA 3DSNB 4P06A 4PJ5A 4CSPA 5KS9A 2EYTA 4MTMA 2Q20A 3RWCA 3ILDA 1KBVA 1SHXA 1LK3L 2H6UA 2KLSA 3U6XS 3WGUB 4K3JH 4CKVX 4PJEF 3HAEB 3SY0B 1MQKH 3TN0D 4P2OC 3IDMA 4L29A 4F7TB 3GF8A 4MJIA 3QORC 2XN9D 5E6YA 4LO9A 5SWSA 5EORL 4PRID 5E8PB 4JG9A 1XV8A 3WIFA 3IDUA 1CPUA 5CHNB 2NOYA 4GMTL 5C09A 3MOAL 4G43A 2BIMA 2GIYA 5GISL 5IYBG 5E7FA 2YQ3A 5IB3B 2IPTH 3LZFH 5CLZA 5F1NA 2EZ0D 2NY5C 1IE4A 1SVZA 5EBMA 1GZHA 2J71A 5CLXA 5CBAA 4E9LA 4UTCA 2W6ZA 4F92B 4MQXC 3V0FA 2CA4A 4I2XB 3IS1X 2C7UB 4JO3L 1OGAB 4AITA 4BFNA 1BQHG 3GIVB 3IDJA 5IMLB 3VD9A 2R1YA 3TYGH 2AJSH 2XV2A 1NCNA 3P2DA 5BS0B 4ED1A 1F45A 2VXQA 1WGOA 3QDAA 2VR1A 4LSRL 5CIPH 5D7LA 5DZVA 3U0WL 4JO2H 2ZUTA 2H0FA 4X7SL 1RVFL 3VG0H 3GMLB 3OX8B 4XVOA 3RI5K 5DEZA 3B9KA 1FNFA 4PWGA 5DD1L 3N8DA 2G5BB 2GJ6B 4NKIH 2XTLA 2E46A 4ODUB 5BZZA 3DUUB 3HEIB 3P3TA 1EJFA 2AMUA 2R1XA 1SDDB 3NZUA 1GGCH 3W5MA 4OCRL 5BJTA 1MEXL 3QUYD 4DQOH 4AQ8C 4KZDL 2B20A 5AW2B 1CD1B 5DHYB 5A3IC 5FJ8G 4UQBA 5GGQH 3EYVA 4W9LC 4NO0D 5I1JH 5J12B 1SY6L 4AE1A 1V05A 4DLKA 4UQCA 1DJGA 3SKMA 4JN2A 2DLEA 1FFOB 2WGNB 4PSPA 5IR1B 2HLEB 2B08A 4MMXA 4NKMB 4Y1AA 4B5ZA 3LXAA 4H0GA 5CGYD 4PJHE 3ZE2E 2DTML 1RUAL 2CJSA 4FTVE 5F7YC 5DJ2B 5BOJA 3H6AA 3O4LA 2PO6B 5ALBL 3P0YH 3RDTC 4NOFA 5I5MA 4MFHA 3PCYA 4G59C 4XH2A 1KELL 5ANME 4OU3A 4PJ9C 3MJ9A 4IIZA 3WD5H 3RIKA 1E65A 4S10A 3UZEC 3BZEA 3HW7A 1MJUH 1LD9B 1OHQA 2LFGA 5GJSL 2VAAA 3N04A 4G8FA 1MFVA 3HE6A 5B39A 4FXKB 1EV2E 4L37B 4M8VA 4BQ6A 1TR7A 1SXZA 3QIBD 3SGJC 3W39B 4A3FG 5AAPA 1QTSA 2X6UA 1MWOA 4MB3A 4Y5VC 3PWPA 3SZ6A 3WEAA 1ILUA 4M03A 3RUGB 1S5IL 4HIEB 1BF2A 1IFRA 3RHWF 2FT8A 4I7HA 3RV3A 2CO7A 3FRPG 3GSQB 4K4KA 4XBGB 4ANKA 1ZTXL 1ZLUK 2BNUA 3KPSA 1X9LA 3WUWB 2XG5B 3S96B 3P9MB 5H94A 2AVGA 1ADQA 2X4OA 1VACB 4R96A 5IJVB 1S97A 4G6ML 4M7LL 1EK3A 4E41D 5IVNA 2LAGB 3QCUL 2W70A 4XNQB 3HG1D 2O6DA 2VZ1A 2UUDK 5FA4B 2YPVH 2CO6A 3GINA 2HKAA 4ZS7L 2DICA 5BW7A 3GSRB 1TLMA 2DWYA 4U1GB 2MOGA 1IAOB 1IIIA 3O3DA 3UTTA 1AZCA 2V17L 4OAWA 3BOVA 5C44G 3EYFA 4WI8A 3RY6C 2V9RA 2FWSA 2FSDA 2YIHA 3L3DA 3S3JA 1QKZH 4OX9H 4YY3H 3HZKB 3RWIB 1IBDA 2R15A 2R86A 1R3HA 3RGXA 5DDHB 2XIDA 4HSQA 2A7BA 4C56D 5BVJB 4U33A 2V6HA 5H37H 3MLSH 2GBTA 4J3OF 3EG9A 3ZRFC 1AQ8A 3US9A 4F8PA 2H3NB 4K15A 3HMXL 5JHAA 4QWEA 2CUIA 3RTQC 5HGDA 4TTDD 2QKIA 2V2XA 3QPQC 1KYDA 4HJJH 3BT2L 2Y4SA 2AJ3B 5GSVA 4DOHB 3KPRB 3BHBA 5FGCB 4H1LH 3V6ZB 3G5ZB 2EIJB 3RUPA 4MNQB 1JWSA 4U2ZA 4P2RA 1IC7L 2OMBA 3VGBA 1I1AD 2H2PD 4S2SB 1TKWA 2AANA 1AXTH 2DLTA 5LMNH 2VMCA 2NNAB 4FMKA 5DZ9A 2ZZUT 3LHPL 2PR9A 1G6RL 3AZUA 3LRLA 4KX8A 4Z95L 2CH8A 4IBUA 5FLVA 3C9NB 4LCYB 1BLIA 5JHDD 3ZKNC 5LDUA 2E9IA 2OMUA 4M5ZH 4O4YH 5ID0B 4OF3A 4Z3JA 1V3LA 5C5JA 4DR7H 3CQQA 2CUHA 3NZHL 3N5AA 3OR7B 1ICTA 1Q1JH 3GZKA 5DA4A 1EZSA 1T7YA 3Q2WA 4ZUUA 5INDA 3SKNB 4PJ5E 3LNGA 5E6IC 5JW4N 3KJ4B 1ZHKB 1AIZA 2GBAA 3C6LB 2AEQL 2DI9A 2ZX5A 3EO0B 2VDRB 4H20L 1KBPA 1X4XA 2YOCA 1Z5LA 4RX4D 3ZKMD 3FUHA 1MN4A 3R1GH 4IDLA 4PJ7B 3G6AA 5DJCB 3RZWA 4XVTL 1Y0LA 2H47C 4K7FA 4HCRH 1A9EB 1IBGL 2G60L 3Q6GH 4MJIE 5IB5A 2CGYA 1U93A 2F19H 2EVIA 4LQFH 4EXPX 3KYMB 3QNYA 4IS6B 5SWSE 3TN0A 1CGTA 5C3EG 3WSQH 4O4LF 4JZNA 5HVGB 2PCFA 2XWXA 2K8QA 4A3KG 4I77H 2XN9A 4KROD 4OGYH 4R2GD 1E8YA 4S1QH 1E4JA 4IOFD 1P4LA 4S0TD 3DO3A 4AK1A 1KN4H 5EEZA 4RZQA 1MJJB 2FBJH 4PRIA 4I5BA 3CQPA 1F4XL 1LWJA 1WUZA 3I12A 3ARDD 4Z7VB 4BV1A 1OT2A 2JTYA 2UXTA 4EN3B 4HYTB 2JCCF 3S5LG 2IQAA 5EN2A 2B1OA 4XNXH 4H88L 3ZVVA 2YQ2A 1XO8A 2E7BA 1WV7T 3TO4C 4IRJD 5SWQB 2QELA 3NIDF 3PZPA 1YG9A 4L1HA 5KSBF 4ZOBA 3QH3B 3VFMA 4R8UB 1IGIL 3IDNB 1A9XA 5EOQL 5D7KD 4WO4C 3WLWC 2YMTA 1AMYA 5SWZA 1CGYA 3IPEA 1SNRA 3J8F7 5I26A 1SXNA 5JQIB 1G7IB 1QSFD 1QNIA 1YEHL 3DX7B 4HS8L 4JHAH 2O1AA 5IKCB 4GXFA 4NQED 2MIZA 5L2KD 4OH2A 5C0BA 3U9WA 4DUVA 1JD7A 1XGQA 4QT5B 3UJJL 1UD8A 1IVLA 2NSMA 3HI1B 3MLTA 2A9NL 4I3RL 4OLYL 1ESOA 4R4FH 4L8BA 5F21B 1H8LA 1BVLA 4FD0A 4JRXA 2J9GA 1YQVL 4H8HA 4HOXA 2AGOA 2IBGA 2H4EA 3OUZA 1R19A 4NXNH 3S7GA 1ETZA 4PV1C 5KFTA 5A2BA 1G87A 4F2FA 3KLQA 1UYWH 5EFIB 1KTBA 2EVJA 1JDBB 1ED3A 4ZBJA 2DD8H 3X1EA 1B4TA 3DA0A 2BFVL 3PWLA 4KJQC 5KFBA 4XP5L 4OQTA 3QUYA 1CFNA 5IM7B 4QTHA 5CZKA 3TVMB 3ZTDC 3VPCA 4WUUD 3E3QE 2EDOA 4PJIB 4WW1B 1BJ8A 2J6WA 1S3KL 4NO0A 2FQFA 4UB0L 4O3NA 1MOEA 3U2IA 4C55A 3EXLA 1EIBA 4URTB 3EUUA 3NA4A 2BP3A 1YEWA 1D5ZA 2J72A 3RIAK 1TZAA 5FK9A 3LD8C 5K9OA 2CUMA 4WEUD 5CF3A 3O4LE 1NCJA 1I1FB 4JO5A 4M56A 5AENA 3LNHA 4AQAB 4ED6A 1U4FA 1GYFA 4IRKA 2YN5A 2FWOA 3FFCB 2ASJA 4R9HA 3VG9C 1Z7JA 4OKVB 1NQBA 4HEMA 1DDHB 1ZIBA 2B9AA 1IU1A 3KPNB 4I0PB 5E5UB 2G3NA 5E2TL 2AEOA 2AXWA 1G5GA 4KHXL 3WS6A 5ISZD 2RDJA 3H56A 1P9MA 5AVQB 5I76B 4EEQA 3PWPE 2AERT 1BYPA 3QIBA 1VENA 4IBSA 4OF0A 4X9GA 3QJZA 4YSCA 3T5JA 2WSKA 2MPVA 4ISVA 3ARGD 4DR3H 2FQGA 2XWZA 3BCDA 3BQVA 1IT9H 3HI5H 3T1WA 3CVZA 1QFUH 3FOMA 1O7DE 1NH6A 4YDJA 4HIXL 5B3JF 5ESVB 2HVJA 2LV4A 3S8GB 4TQRA 1X5LA 2XN1A 4KVNH 5EC1A 1XSIA 4OSUH 1GKOA 2OXHB 3BIAX 5G2NA 5L2JB 1CXLA 3E80A 3TNMA 2IANE 4E41A 4HSCX 3Q6FA 3HG1A 3D05A 2OR9H 3QI9C 1JZ8A 1L9NA 4X4ZA 1IL1A 3TO2B 2BVQB 3UTTE 4M9UA 3GXMA 2X9XA 3PL6D 5HHVH 3UPCA 2AW2A 3DSFL 3GZPA 2X4PB 5E9DD 4EBQL 3VQ2C 5LBSH 1UH4A 2QTVA 3MUJA 4JRYA 4WHDA 4J8QA 2MKLC 1UT9A 5IJKA 4Z6AT 2BOCB 4YDIH 4JKKA 3SI8A 3B7UX 1GY2A 3VRJB 4EI5A 3SOBH 1QRNB 1Q0YL 4U6HA 2DDQH 3GTNA 4OKDA 1YEEL 5LJYH 2FD6H 4PVMA 1K6QH 4C56A 1W0YT 2IFGA 3MNWA 3V4UL 1DQTA 3CC1A 4RMTA 1D2OA 2BRRL 2H1PH 5CEZL 5IHWA 1J5HA 4EF3A 2N4IA 3QRGL 1LO3L 3C2SA 4Q89A 1YYMH 3M8OL 1F8TL 3P77A 3QR2A 4ILDA 4G9FB 4UIKL 3WJJC 1GSHA 1Q90A 3MA9H 3T4YB 5J11B 4DL4A 2FPIB 1U8IB 1MCFA 2DIBA 1KPRA 2QLVB 4YHPB 5F3HA 3MFGB 1Q8MA 4ABUA 1SLUA 2R23A 3K72B 1XCQA 4PHXA 4PJ9B 1I1AA 4OIFA 2WYOA 5F71A 5D1QD 3RWDB 2PMZA 3L4CA 4UNUA 1ZCRA 3LQAL 4ACTA 2DWEA 3BRFA 5I9QC 3DHPA 2Y5TA 4ELKB 4HWEH 4XOEA 5JHDA 3MJ8A 3HN8A 3X11B 1M9SA 5BRQA 3KBFA 1OGTB 4BBWA 1VGEH 3HRPA 4U1HB 4J0MA 2ZOWA 4JL1A 3VRIB 2TAAA 5A2IH 5BUGA 3TJHC 2WUBL 2RQ8A 1PFOA 1SJEB 2EO9A 2R7NA 3VU2A 3B3IA 3PF2A 3MZGB 1H6EA 4ZFZB 3DOHA 2F6AA 1J8HE 4RX4A 1NGWA 5HGAA 2OAAA 1D5MA 1GXEA 2ALWA 2EDNA 4L3FA 1UWFA 4FZ8L 2W9CA 2F8OA 3BAJA 2PVPA 2OMWB 3LH8A 3ZDZF 3HOYG 3MLYL 4JY6A 4LRIA 3O0LA 5IV2B 1OOAA 1W9XA 4X64H 2H32B 2HWZH 3RGVD 3UERA 5LNDA 4ODTL 4HKBB 2ZE0A 4WVRA 1NPUA 2VLRD 5DHVA 4F20A 2GTWB 4CVZA 1DQQA 3LS4L 2ZG1A 2B16A 2EIBA 5KFGA 4WJG3 4TMPA 4OLEA 3ARDA 3IBOA 2Z3FA 4XCEB 4ELMA 4YMPA 3EUDA 4F7MB 3WJMA 2DYPD 4IRJA 2W6OA 2VPQA 2J8UB 2JI3A 5SWZE 4NPYA 1N34H 4HPOH 4FQ2L 3ZT7A 3BQ0A 4OLXH 2R2EB 2YAOA 5EUKA 5B39G 5C0BE 4XNUH 3BE1L 3FQWB 1QSFA 3L3IA 2Z34A 5LN4A 5KVDE 4NQEA 2FO8A 4PWEA 5L2KA 4CDGC 2YEVB 2CGRH 4JRXE 3W38A 1BOYA 3GTMA 3S88H 1TU2B 1AJ7L 3SPIA 2XV0A 4N8UA 4DKTA 4UU9B 1G7PA 2XBDA 3KEHA 1WD8A 4MA3B 2IOIA 2UZPA 1J1PH 3C09C 5KJ7E 3ZMEA 3LPFA 1Q4NX 5T3XH 2D73A 3DVIA 2XSKA 4JG0L 1HAUA 3VFNB 1LTXA 4BDVA 1HXMA 2NT0A 4N3UA 5I1KH 1H5BA 1KLFB 2UWEB 1KCLA 2A83A 35C8L 3V6BR 4AIXA 2CW8A 3W11C 1G0DA 5HY9A 5KVGE 3J7AK 2VR8A 4HGKC 1KEEA 1I3VA 1JUFA 3BWUF 4QRPD 1IGJA 2PCYA 4WUUA 4NQVA 5KFMA 4ZAKD 3WNLA 4JM2C 5E6IB 3OLIA 4UV4L 2WAHA 1F4WH 2G5RA 2K6WA 4Y4KD 1ONQB 1PMYA 1U8CB 1MCBA 4N1EA 1NMAL 2EDKA 1T2XA 2R87A 2Y24A 5AVVB 2W80C 1WAPA 4HEME 1PDKA 2ZWLT 2C35B 2VZUA 3Q48A 1XAKA 4TPRL 3WJLA 2JWYA 4JQIH 2ZXGA 4O5LL 4ZQKB 4O2FA 4R97C 3OKDB 3CHRA 5ISZA 2CBMA 3P3UA 4HIIA 3HPJB 5DQIA 5L1LA 3EJTA 5FR3A 5CD3B 1LEGB 4J9PA 1LP9E 1ACYL 4EKXA 1UM6L 3DMMD 1AQKL 3D0LB 4ODBD 4HXAH 4JFXA 3GHEL 5C9JA 3ARGA 4IMKA 4PS4L 3VFTA 4Y16B 1X9NA 4OZIE 1FZKA 2OZNA 2VDLL 32C2A 1HZKA 5SV4A 3W0WE 4M7JL 1E28B 4E41E 3VCLA 1T1WA 5KFXA 2BERA 1JNJA 1JXKA 4PLNC 5EZLB 5FEBA 1QW9A 4LBEB 1XXDC 3SO5A 3F58L 1S5HB 4X4XB 1B3JA 1UKSA 2WQXA 4JRYE 2ZDHA 1DN0B 3PL6A 3BAIA 4YWGH 2BH0A 3NCJH 5I0XA 2DKUA 1IC0A 1MF2L 4XZUA 3SQBB 1FAIH 2Z31B 3KYNA 5BCAA 4N2LA 3QFJB 2IO5A 3FKUS 4UT6L 5I0WA 3FU3A 4GKSB 4I87A 5FAAA 4KTEL 4C56E 1FE8H 3CVHL 4JO4H 1NCDL 3ULUL 1L9TA 4GSRA 4QXTA 3DO7B 3L2MA 1NOFA 4GBXD 2B4CH 2XPYA 5D1ZC 4A6YA 5DS2A 4UQ3B 3PXLA 1OAZH 4K8RD 4GT0A 4MAYB 5CN3A 4FJZA 4S1SH 5DRNA 2YAHA 4BZ2A 4GG6B 3LD8B 5SX5H 1AFVH 1QTPA 1H19A 3GM8A 4HUVB 1TZHA 3WN5A 5CCKL 2LU4A 2ZKMX 3V0VB 3EAKA 5J6HB 3D3VB 2PUQT 4NKDB 3VG9B 1PAMA 1YNKL 5JOFA 1VFBB 1MHPH 3IDXL 3Q1EA 2CLVA 3OSKA 3P1VA 4N2EA 4F33A 1IMHC 5D1QA 5JHDE 4FFYH 1PKOA 1T1YA 3LKOA 1NC4B 2IQ9H 4FFZA 2E2IA 1A47A 2CKBB 3GZQA 3NRPA 4XMZA 2FHCA 5DURD 4Y4FD 5I8EA 3Q01A 4YSUA 5DFAA 3E1F1 1U8OA 1IAIL 2V5YA 2Q8AH 3TJPA 4DV1H 5T5FH 3HZVB 4PLKC 4WK2B 5JHBA 4Q7DA 2ODHA 3FL7A 3L1OH 3LQMA 1QFWM 4S1RL 3O8XB 4G7YH 1ZHNB 3TV3H 3UAJD 3BN9C 3L4XA 4JG1L 4L8SB 3SYPA 1RZIA 2JB6B 4BWUA 5E8EB 1C12A 1S7TA 1CR9H 4J2XA 2A6KB 5I74C 1EXUB 3RB4A 2QSCL 1KFGA 3KNBA 4BSWB 1UENA 4N5EC 3KLHD 4B3EA 5GZND 3NCWA 3RGVA 3K2KA 2XCLA 3ZHDA 2VLRA 2ICWB 1NKRA 2OQJB 2CHXA 1GZPB 4YHOL 2CWRA 1A6UH 4PBWD 2VIRA 1WIUA 4MVBD 2ZCLL 4W4OC 5AB1A 2W9BA 2GSIB 4FEMA 3CLEH 1QPXA 1RU9H 4HKJA 1T7XA 4F80A 4MAUH 2DYPA 2H3XC 4A67A 5LLIC 43CAB 5D7KE 4DGWC 2WZ0A 3HNVL 4NENA 2YARA 2Y7SA 4HDIB 5TPWL 1XEDA 4IU2B 4BE5A 4NQEE 5KAQF 2XG4A 5I1CH 2H45A 4KO6A 4PRAA 1C5CH 2X4QA 3QUML 4HV8A 1WO2A 1XFPA 2FUQA 3P11H 1OEZW 1F1GA 3SBWC 4LIQE 5CZXC 1TWHA 4HNVA 2KPWA 3BKJH 4F2MA 1PYWB 3TCLB 4E5XB 2CO2A 4YDNA 3TS8A 5T1LB 1RIUH 5C9KA 2CQYA 4DVBB 4ENED 2WB7A 4XN5A 3BA9A 3MCKB 4ZDHB 1W8EA 5JQ6L 5F6HI 4P2QE 3NACL 5I9QB 2E75C 1MELA 1P4UA 2BHUA 3UPRA 2NLJB 4KI1A 1CD8A 3F62A 5L6YL 1JF1B 3QYMA 4WUUE 1SEBB 5DVNA 4GAJL 2YUXA 1V10A 4QRPA 3NN8A 4IGBC 3QJTB 4N8CH 3MUUA 4HS3A 2F08A 1R24A 1C16A 4ZAKA 1FNSL 1O9WA 1FL5A 3SDAC 4NXMH 4NZRH 4UILH 1FFRA 1BM7A 1KOAA 1HWWA 3NYKA 4Y4KA 5KANG 1JGLL 4MV4A 5L9XA 4JCLA 4AH2A 3C5SA 3SJVD 1X4ZA 5A7EA 4R7NA 3I6GA 1FO0B 3IDYB 3MOBH 5KT6A 2NU7B 2GCYB 3ARSA 1MCSA 1LMIA 3I9GL 5DZNA 5GSRB 4AEFA 5CJXA 3I4MG 1FH2A 2R0WH 2GUOB 4JFYA 3GSNA 1J87A 1DLFH 4YZWA 1AD0A 4LF5H 2X38A 4Q2ZA 3V4PL 3BMWA 4O51B 4EOWH 4ETYA 4H26A 3BXNB 5BXFB 1VBHA 3QHZH 3GJFA 4KQ3L 1I3RB 5HVHB 2PCXA 4NERA 2JA6A 2VDKB 25C8H 1WDAA 2NY1B 2G75B 2Z4QA 2ZF9A 1E42A 3NZ8B 5C2BH 4E36A 2F74B 2E86A 3FPYA 2JJTC 5FDYA 3DMMA 5KBDA 4UQ2B 5INCB 4HIPA 1KTKE 3G8CA 3MBXL 4KKLC 3KJ6L 2Q6WA 3UAAA 3L95A 4B9ZA 1IBYA 5E1AA 2BX5A 4Y2DC 5HHQB 1H8SA 4X80L 3RWHB 5JZ7C 1BWWA 5F9AC 3GTLA 3VGAC 1Z9SB 5ES4B 1QSED 3EJUA 3MLWH 1HL9A 4OCYH 1MI5B 2LQRA 1F11A 3BAAA 4O4IF 1JWUB 3QYNA 3KLAA 1BZ8A 3IU4H 1DQJA 4MMYA 3SDYH 3RV4A 3HAEH 4A3DG 3HB9A 2VKXA 4MCYB 2X28A 3SBPA 5DZPA 5HJ3A 1WC7A 1Z3GL 4L2LA 1E4WL 2OMYB 4LCWB 2WXNA 3NCMA 2FBOJ 5BPFA 5C08D 5K1JA 1I8KA 2XTJE 1KTLB 5DLLA 2D7TL 4Z7WB 1A65A 2YPKA 4PCYA 2YMXL 1F02I 1KN2H 2FLLA 3MXWL 3VXRA 3BWSA 1JV2B 2XVGA 1HHGA 5DRXA 4YQXL 1INQA 3AY4A 1TWFA 3WS3A 4IOIA 2NR6D 3IPFA 3NIGE 4OIIH 4JM2B 2WLIA 4GBXA 2V7HB 2VQUA 5JW5B 2ZX6A 4XVJH 3VFVA 4MA8L 3D4ZA 4AG4H 1VESA 4G11A 1GAFH 1VFAB 1HKLH 5C0CD 4AEHL 3VXUD 3HTLX 4MCMA 4CGUB 3INUH 3MACL 2NXYB 4NQXB 1EO8L 3CXHK 3R06B 2QSQA 2Z6FA 3ZMNA 3VI4E 2PETA 3IN5A 2EP6A 1BQSA 1NAKH 4XRCB 4RUCA 3ULSB 1XSJA 3VXQA 2E74C 1M7XA 1P5VA 5IBTH 3ET9F 1UCTA 5AOIA 1EX0A 1T89A 1IAMA 4HIJA 4XP4H 3GB7A 1U2YA 3OSPA 4Z3FA 2HN7B 4AJVA 3BEVB 4IU3B 4DZ8A 2C4XA 2A1WH 3FULA 4JFTA 3LV3A 4TOYL 4Y4FA 3V4LA 1NIAA 3ALPA 3H2QA 5KYYA 4X6EB 5F0PB 4FMFA 5AZ2H 2IPUG 3RLSA 5BZWA 1PZUB 1BECA 4X5RA 1KBWA 3PJSB 5CGBA 1E7VA 3E38A 4XBPA 4P59L 2DBJA 2FNBA 4IHOA 4AIZB 3S3CB 5CBEB 1FIGL 3KYOB 3UAJA 3FSVA 3IETB 5GGUA 3KBHE 4HMCA 2WNXA 3LKRB 4JZJA 4UTBH 2ADGA 5KWYC 3S5YA 2P5WD 3EYSH 5DUML 5HBRB 3V5HA 1Q72H 4AYFB 1BMGA 2VLRE 3HJ0A 4ZW7A 3BISA 2FT7A 5GZNA 4HJ1A 3ESMA 1P84J 4ATTA 3OAYH 3MRHB 2I60L 3NT0A 1TZIB 4KI5D 4TVUA 3PP3H 1GOGA 1ASPA 1BREA 1L0XA 1ZA6A 1FNAA 3DRQB 3GBDA 3Q13A 1RZQA 5DQ9A 3WLBA 4D0CA 1A4KB 4B60A 2Y6SC 5DZJA 1MY5A 1DJHA 4MHHI 5JMRA 1RZGB 3D0VB 1OF0A 3V0AC 5IW6A 1NZRA 4HZLB 4KH2A 2HP4A 3V4VH 3X1BA 3ZZ1A 2RALA 4OZHF 5GGVH 5D2LA 2PW2A 5F9WC 1Z5HA 4LBAA 1E4KA 3ILQD 4BINA 4F57H 2K3TA 3V2AR 1R75A 4LVNB 1DTUA 3QUKA 4OZ4A 3FTSA 1KF9B 2FX8L 2E27H 3GBML 2E7LA 4F2ME 1E4HA 4AYGA 3RVWC 5KVDL 2W6NA 1ODUA 4PJAE 4EIBA 1DBKH 3C60C 4RIRB 4B9YA 3SKJH 5DD5H 5JIKA 5AFAA 2AJVL 2AQSA 2A6JB 5FKPA 2DZDA 3UYPB 1D5XA 3NH7L 2N7BA 5L8KB 4Z7UF 5GGTH 2J20A 2VOTA 3OHMB 4PJGB 2PYEE 4GAYB 5LP6F 3ASNB 1OCRB 3GNML 1TPXB 3EOYG 2XY1A 1R5WB 2K8MA 5MI0B 4QRFA 2VH5H 4WNQA 3LQZB 5HJBA 3WGVB 5IESL 2AK4E 2CALA 3NAAL 3IKCB 2VXSL 5KG3A 5KVGL 4EMZA 1WS8A 1P7KA 3QIWB 4TNWF 3AITA 4BEIA 1MUJB 1KIPB 1IOVA 2A77L 1RZKH 3LKQA 2A2QT 3HR5A 4UYQA 5D1XD 3MX0B 4A2DA 5E2JA 1CLOL 3QAQA 1QO3B 4HC1A 1PY4A 5K93A 3SJVA 3AT8A 1MIEH 5DWPA 1G9ML 1JXLA 3PO2G 4D3CL 1PAZA 3F8NA 1GC1H 1ZLWH 5DUPL 4IM8A 1E5BA 4DEPC 2X3BA 2OTWA 3EOTL 4X6DB 1TZ8A 2GC4C 2CW7A 1ZMYA 5AB9A 1E6OL 4ETSA 4AUYA 5IHBA 1G1CA 5CCGE 5EOTA 1IQDA 5AZEL 2O5YL 1RHHB 4FP8L 4GQ9L 3SO3C 5LGYA 1QOKA 3QSKB 5EWGA 2Z7WA 4JI0H 5JLZA 3DXAB 2JA7A 1A6ZA 1M4KA 1P6FA 4KGLA 1MCWM 1C5DB 4RGMB 1ADWA 1Y1DA 4ECXA 4F15B 4PJDF 2UUBH 3F83A 1RJLA 1EEZB 1QWNA 1AHWA 1RUPL 1M7IB 2WLMA 2KSWA 4X6CB 1JGVH 1N26A 4PJ7F 2F61A 3APFA 4ZXBB 5L88H 5DHDA 1QHPA 2PR4H 4NUMA 2D7MA 5GIRA 5HGHA 1QSEA 2JB5L 5IBLD 1DIKA 4GKJH 1NFDA 4PRPD 2W9AA 5D93C 4XT1C 1B2WL 2VZTA 4RNRB 5L4JA 3OZKA 3GI8L 1AGDA 1UJ3A 5I1AA 3FB7A 2ICCA 3W81A 3BKYL 5B8CC 3MLXH 2BIIA 1D9KB 2B59B 3C5JB 5CU9A 5C08A 2OM5A 1TCRA 1A7BA 2VUGA 1NICA 2EO1A 3PDOA 1BJMA 4HK0B 3VXRE 4GI8A 3TASA 2KZKA 2RHEA 5IB2A 4CA4A 1G7LA 3BWAA 3IM1A 4UCFA 2W9EH 3RNKA 7PCYA 2D4FA 3G04A 2NX5D 2KDYA 1EDYA 2A6IA 5F89B 1WHOA 4FQ1H 1BDYA 4HHGA 3GTPA 2XIGA 2ICES 4AGQA 2ESVB 3CMOH 3QGVA 5DD3L 1DJIA 3FBKA 5F7DA 5F7HA 2DEYX 4QF1A 3UPAA 5C0CA 3TM6A 3LNEA 4YAQA 2EDDA 3VXUA 4ZOEA 5KYWA 2P8PA 5KSAB 3HXLA 5DRZA 3NIFB 4YK4C 3RZCB 2YK1L 4YSRA 5CGMA 2OTUA 2CCVA 4G82A 1XGUB 4NDMA 4AVJA 5J13C 4PS3A 3UG3A 2P42B 4MXVF 2DJUA 2ZAGA 5DJ6A 1ZV2A 4PY7B 2Y2WA 1ZTMA 3AM8A 5ALCH 1IBBA 4DZBB 4EZKA 1QLRA 2F7QA 4LLVB 1MWAH 1AO7E 2ATLA 5AKSA 4RQQB 3PABA 1P8LA 2HT2C 3CDYA 4PJIF 1NGYA 4OLUH 2YZ1A 4P49A 4AUJA 3QIUD 1MHCA 5E00A 1HH9A 1A6WH 3W9DA 3WFDL 4ZQTA 4CL7A 4Y2DB 4W9JC 3FQXB 1SYVA 4HETA 4NQDA 1K4CB 4P23C 3TC9A 2I32A 5KFFA 1W91A 4NT6A 1SEQH 3RY5A 2FYYA 4AYEC 3CH1B 2P5WA 3LY6A 3V0WH 4DN3L 4EQ2A 1FBIL 4G5AA 1D5BB 2IEPA 4Z76B 1CWVA 4PJXA 4RGOH 4FM9A 2YN3A 3VTMA 2N3JA 4YDMA 5ANHA 4WQOA 3LNDA 1D6EA 3TZVC 3O3EB 2FGWH 2APVA 3VW3H 2A0LD 5I0VA 1OK0A 5DJAA 2X4RA 3FU7B 4YDLC 3W1ZA 4FZEH 5CCJA 1Q94A 5F1KC 5GS2D 3FQRA 5E1IA 5D2LE 1CDIA 3UGEA 1JNNL 1FZJB 2DKMA 5EULV 1A14H 4N0FB 3VTTA 1JK9A 4ECSA 5TDPA 3TF4A 2JA6G 1WWAX 3FQUB 3SDDB 4XCCH 1T6WA 3MKGA 3HOVG 5FO9B 2WTFA 1V3KA 2F53B 2JLPA 5E9AA