3N42B

Crystal structures of the mature envelope glycoprotein complex (furin cleavage) of chikungunya virus.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
338
structure length
338
Chain Sequence
b'NFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNMGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 envelope glycoprotein
publication title Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography.
pubmed doi rcsb
source organism Chikungunya virus
molecule tags Viral protein
total genus 59
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2400 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n42B03
2.60.40.3200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n42B01
3.30.1490.280 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n42B02
3N40P 3N42B 3MUUA 3N43B 3N41B 3N44B
chains in the Genus database with same CATH superfamily
3QQDA 1CLVA 1S7WA 1JPST 3HC4H 4MCYB 4ZMQA 1H0DA 2QVKA 3OAYH 4NI6A 4LNRA 1FCCA 2XFGB 3ORJA 4M3JA 1FNSH 1TQUA 3L2MA 2W88A 4G6KL 4I55F 3CK0H 3HZVA 3ULUF 1ODUA 3L7EA 4O3RA 2ZUSA 4L4VA 4V1DD 5J13C 1CI5A 1H8SA 2N4IA 2E47A 4JFPB 4WW2B 2W9LA 3P77B 8FABB 4Y5VA 1NDMA 3I3DA 1NGQH 1R4XA 3GSUB 3SB3A 4ZXBA 3VFNA 5FYKE 1FO0H 4WNQA 4HBQA 2WNXA 1BZ7B 4FBTA 1J5EH 5L7XL 4FTVB 4RMVA 3VI4B 5ANHA 5H4YA 4JRXB 5CZXD 3UDWC 3IB4A 1DVZA 1T22B 1XGQB 5IQMA 1QO3A 1DANT 1I1CA 4FKKA 2DIJA 2VRKA 4U1HA 4WWKC 1BQ5A 3QXDB 4Y2DD 1BMWA 3L3IA 4L8DB 4LCWA 2F5BL 1I7TB 1W15A 3GIIA 2BNRD 1RSYA 5F1OB 2MQCA 3K74B 1TIUA 4FQJL 1QYGH 2CU9A 3RUGE 5I1LB 1OM9A 5DD5H 4WDIB 3AT9A 2D3VA 2OL3B 4MNQD 3HPLA 4QYOA 4YSQA 5IOPA 4Y4FB 1Z1WA 4CU7A 1UB5A 2VXQA 4K3EL 4IOSA 1UA6L 4Y16C 1M6UA 3KTMA 2Q10A 2H3NB 2FNBA 1Q9WB 3EFFA 4PMEA 1XF5B 3C8DA 2UZYA 3DX0A 3LV3A 2Q7NA 5C0AB 5C3EG 5FDWB 2YPLB 3NT0A 5FB8A 1E3FA 3L5HA 2YRLA 2F8XC 4G83A 4OD2A 2QKSA 5EZIL 1AQHA 3SY6A 1LO4H 3NRFA 2IBBA 3DMMC 3SDCC 3RZCA 1VRSA 4Z23A 3WNPA 1IILE 4ECYA 1IGTB 3BLPX 1KLGA 3KYMB 4I2XA 1TENA 4X6EB 4CA4A 2JB5L 3GUFA 4FQXA 2HX9A 4AYFB 1JVLA 1MAMH 3G08A 5J2TF 5FCSH 3WIAA 2CDFA 5AZ2H 2VA2A 3OJMB 4AYBA 3ZE2E 5HHVH 4QJ5B 1IU1A 4HPYH 1AHKA 5EN3A 4MMYA 2H9GA 4Z3HA 1JDCA 4ANXA 2VIRB 1OT4A 1ADQL 1S3KL 2JCCA 5C0IB 4WKZA 3UBHA 1BVKA 1OB1B 2V2WB 3WNMA 4WK2B 1I8AA 4DCQA 2CO6A 3K0WA 4FQ2H 4NP9A 4CW1B 4ZMYA 1DBAL 1NAMB 1ZHNB 5KSAD 5C8YF 3H4BA 4MAYC 1IUZA 3N1GC 2YPVA 2XPGB 3QQ9D 5IHUH 2PCPA 3UAJA 2DAVA 3TYGH 3ZYIA 2HRLA 5CILH 4OIFA 4WGKA 1SVCP 3CMOL 2XYBA 3K46A 3LD8C 4AXWA 5D6DA 4MA1C 3IXTA 4NKIL 2DYRB 2FGWH 1TJIL 3QNZB 4I1NB 1I3RA 5F7AA 3VU2A 4K23L 2R2HB 4HJJH 3BLBA 5E9DB 4K8RD 2JF1A 3OUUA 2JJTA 1LGVA 1QI5A 2OP4H 3ZXAC 5ISZB 3UYRL 5KG9B 1RH8A 1YPZE 4O51B 3LPFA 1I1AA 3ASOB 1HEZA 1NUNB 4IKKA 1NEZB 1L5GB 2E2HA 4YBQC 3PDGA 4PRPE 3RPKA 5DK2A 3QAZC 1EEYA 1NAKL 4MTMA 4B5ZA 1WAPA 3SYAA 4P4KA 1NBVL 3MOBL 2AK1H 3TA3A 1M05B 3V4PA 4AL8C 2AEIT 1NJ9B 2QDWA 4QO1B 1PX2A 1R3JB 2QKIB 1HH6B 2WVTA 2X0WA 1YY9D 1OKEA 2VABB 3ESUF 4TXVB 2OWOA 3GI8L 3DX8A 3ZJAA 5FHAL 2PPEA 4QRRB 2Q6WB 4HC1H 2D0HA 1OT2A 4W4OA 5H35B 3ZGIA 2DL2A 3QI9C 3ZKND 1JPFB 2O30A 4HIEA 4E0RA 1P7QD 5DHMC 5TQ0H 3ZVVA 1ZKAA 3MCKA 4NQDA 2BZCA 1QLFA 5HGGS 4RISH 5JQHC 1KPVB 5EPMB 4BFIA 1J9CT 2HG0A 2XQYA 4TMPA 1I9RH 3FH8A 3V5HB 2RQ8A 3RUGF 4Y4KD 5CUSL 5KS9B 4BH7B 1LMIA 1NCIA 3SE9L 3VH8A 1ACXA 1YJDL 4PY7A 3RAJH 1CDGA 4MS8D 1FZJB 3EJZC 5DJZA 4PB0L 4M5YL 5MEQB 3BH4A 1WA1X 4OSUL 4KDTA 4B50A 32C2A 2YXMA 3B8YA 4ZDHA 3GS7A 5JHLH 4DV7H 4CVWA 4GI9A 4XO3A 3MJWA 1IOWA 4ZFFA 1R34A 3QFJD 5BOJA 4GOSA 4PB9H 3RQ3A 4MAMA 5CEZE 1HXKA 1I82A 1OD7A 4KU1A 4GRLC 4UOJA 4JI2H 3FS9A 2NYYD 5GHWL 2NZ9D 4ZOEA 3RPIA 5I75C 1ADQA 5JW3L 3MROB 1VEMA 5E2WH 3X1BA 4R97C 4Q9CA 3GSWB 3KYKL 4D0DA 4UM9B 2HVRA 2RGSA 3Q2OA 4DL6A 3AXHA 3RI5F 3SI8A 2P44B 4QAWA 2VXVH 1NOAA 4MZIA 2C9QA 3H0GA 1RZJL 1A9BB 3O6FD 3OHMB 2ATPB 4XAWH 5HHPA 2WUCL 5SWSE 3JWNG 3T3PE 3ARFD 4RNRB 2P80D 3C9NB 1CBJA 1DEEA 5FYKU 4YDZA 3CQQA 3ZE2F 4P46C 1I1FA 4X7CC 4UCUA 4F8LA 5AEAA 1FZOA 3IDIA 4O5LH 2AGQA 1CLYH 1UXWA 1YNLL 4XMKH 1INEH 1UM5L 3WKYA 4WJ5A 1DDHB 1BXUA 5LAXA 3ZU8A 4K94C 5FWRA 3PG2A 1G6RL 1QTSA 4ZFZB 4OZGE 2YQ3A 1A02N 2F4VH 4XNMA 4MRCA 1DUZB 2WIIA 1J8KA 4JRLA 4BRVA 5IQ7L 5M7QA 5KG4A 1CFQB 1K4DA 5TFSL 2EQDA 5EORL 4H40A 4FDWA 3OKMB 3CLFL 3PU7A 5GRVL 1UWXH 4F7CA 3UCQA 5GGSA 3T0VA 5JH7F 3MLWH 1YPZF 5C0RH 4M00A 4AY0A 3U7YL 3FQWA 1P2CA 1JPSH 1RMFH 5ADOL 2V9RA 1HNFA 1P5UB 3BT2L 3HRZC 5EC2A 4BQ8A 4EIUA 1CFTA 1C12A 3HC3H 2GKIA 3E9TA 1KCRH 1CICB 1CVRA 2BFVL 1W72H 3HB3C 4LLQB 3B7YA 5HPOA 1VZIA 2LV4A 2V5MA 3VRLE 3ULAB 1JOIA 4G8EB 2L8AA 4AW7A 1K4CA 2DMKA 4NRZA 4XBGB 4BWSC 4U49A 1HSAB 2VM3A 4GXVH 4ZQKB 2AJVH 2GSGA 4A7GF 3ZMRA 5CNHA 3VFRA 3ZO0A 1HWWA 1BLNB 1M42A 2W8KA 2V17L 1AS8A 1SFOA 2PNDA 4MKTA 3WIHL 2VSCA 1D5BB 4LFCH 2H0JA 2WP3T 4CC1A 3OB0H 1KIQA 3BKYH 3EJYD 2BIOA 2B63A 4NRXB 5INDA 1AI1L 4OUOA 5M95B 1CXEA 2VSMB 2IH3A 1IC7L 2DLTA 1EO5A 3CFIC 4FD0A 5T1DH 3P11H 2J1YA 4XXWC 3UTTD 1YAIA 2DI7A 1SJMA 2W91A 2XG4A 2VLMD 4WTZA 1M7IA 4Q43A 1TPXB 5EC1A 4EYIB 4ELKA 5KAQG 3TBVA 1TFPA 3RU8H 2VN3A 4ZXBD 2X4UB 3BH8A 4XPTH 3WLBA 1TJGL 3VSQA 4QF1B 4HX1B 1FH5H 2OZNA 4PP2A 3S8GB 5H80A 1WCBB 4NQCA 3GSQA 1IKNC 4YHHH 4KJQD 2C8NA 2YPKB 5AQ0A 1FBIL 5C0NC 5LVEA 1EPFA 2FBOJ 2Q86A 2UVRA 1YYLL 5DLML 4MB5A 4GBXA 7TAAA 2J9GA 3NFSL 3RB6A 4B9KC 1QR1A 1MCFA 1OAYL 3E80A 3RVWD 1USZA 4CN4A 2CO2A 3GBNH 5T5FL 5IB3A 2KHAA 3FT2A 5C1MB 3GILA 3VD3A 3SKUD 1DUYB 1Q1JL 3ELQA 4H8WL 1NGYA 1JWMB 4KMQA 4R5VA 3FJTA 2AJYH 3DV4B 3N2JA 2EXYC 5A16A 1NCCH 4KRPB 3WNKA 1QZNA 1K3IA 4N3UA 3ZTJG 4KBPA 3NVQA 3VFWB 2X4PB 3OKKB 4RB2C 3ROLA 3U30B 2R0ZL 2R69H 4H1LA 5D7SL 3IFOB 1NICA 4JDEB 4PVNA 1JCVA 4OCLC 4GG6A 3GMOB 2P5EB 2F61A 1QUNA 2IANB 3CFQA 3QXTA 4MVBC 4XVSH 3U1SH 3CN0A 1F1AA 5AZUA 3TPKA 5KYUB 4Z78B 4OZGF 4BFRA 4QWBA 1YMHA 1MVUB 2HKHL 3I84A 2EDJA 2PXYA 2BSSA 3L7FA 4XCEB 3T5WA 3QDGE 4J1UB 5FYLL 3RJOA 3B37A 2IPKB 2P8PA 3EDKA 1XH0A 1A4JA 5C2BH 4GO6B 3RJ0A 4XZUA 4F93B 4O02L 1NUDA 3GMNA 2QQKH 4R90L 5D1XE 5AOMA 4DGIL 4DW2L 4HIIB 1BOGA 2WWKT 3PL6C 1J5OL 2BP0B 4HBCH 1DLHB 2RA1A 5E6IA 1JNHB 3D08A 1X9LA 4TVSa 4ONGL 2CJUH 1V3JA 4JRFA 4NBZB 2VLKE 4G8FB 1P69B 4M7LT 4XMVA 4FQ1H 1BFOA 4ZBJA 2ARWA 5J4MA 2DQUL 1GAFH 1A6PA 3KXFB 5AAWC 3T0AA 3U9WA 3VRLF 1TVHB 3H55A 3OR7A 5HHNA 3T71A 3T1HH 3QUYD 1N3NA 4IEFA 3MRHB 3UAJD 3NRQA 3TT3H 1CFBA 3MJGX 2YGOA 4HUCA 1JMZA 4A6YH 1IE4A 1BD2E 4YLBA 4EN3D 4LHUA 3ASWA 4DOHB 4CSPA 4A3DG 4B97A 4CKVX 3QSKB 4H88L 5EDXA 3LRGA 1OTTC 5I23A 5D7IA 4BXVA 2UZPA 5J6SA 2BVPA 3QXAA 2OX5B 2AEQH 1KGWA 2GITA 2DZDA 3HMWH 1QNZH 3MRNA 1KCVH 4FMFA 5AAPA 1ZWIB 2WLKA 1I1AD 4AH2A 5HVWA 4N0FB 3CU7A 4IU2A 2OR9H 4P5RA 4E42A 4HT1H 2VDRH 2C35B 4P4KD 4HU2A 3L4TA 1Q90A 4EE2A 4QIWA 1IBFA 2HLFD 5HI4D 5EUOA 3TA3D 4J9NA 4DP9X 3Q0HA 3O3EA 1OTUD 1SLXA 4N22A 2Y06H 1PU0A 3CFCL 5DS1A 5J1SC 2XJKA 5EZOH 5T1LA 4DQOH 1MEXL 2P48B 2C9SA 3P3UA 1YA5A 2ZWKA 3A21A 4HWZA 4Y19A 4FYTA 1SDDA 1NKOA 1O6VA 3LXBA 4KROB 4LCYA 4TTDD 1HYSD 4PS8A 3ZL2A 3FB7B 4P2QB 2DQGH 4W6WB 1YQVL 1AQMA 2DQEL 4LF4H 3RIKA 4JM2D 3JV0A 3T3MF 3O8XB 1OWRM 2QR0B 5FA4B 3VXSB 4XRCB 4NQDD 1PIGA 1BEYH 3S37H 4JKPH 3NOIA 1XMEB 1ZV2A 2WV3A 4AM0Q 4HCRH 3CFJA 1MHHB 4QLWA 1NC4A 3SY0A 5J1AB 1N0LB 3LS4L 1PDKA 4PBWD 5F72S 1HS6A 5F71A 4X5XB 3WU1A 2R4SL 3Q6FB 2EKSB 1NGXA 1EDQA 1KTKE 3NZ8B 1HCZA 1YYCA 5FOJA 5D1OA 4GUPA 3IXAA 4LLMB 1YDPB 5MHSD 3G6VA 4FHKA 2ENSA 3NA9L 1EZSA 4Q44A 2VKWA 3I9GH 1CDJA 4HOZA 4ZNCD 4EBDA 1RUQL 2Z64C 2H2PD 3ILDA 1N26A 4TQEH 3SJVB 1O0VA 3KNBA 3AWEA 4KXZH 4F58H 2XNAA 5C1PA 1JIHA 1V55B 4A2AA 3OB8A 4XPAL 1UD4A 3LN4A 3O2DL 5I74B 3VFMB 4M7ZC 2HVKA 1PYWB 1RZ8A 5F0LB 3BDXA 2VC2B 2A83B 4NHUA 3DHUA 4M8QA 4HLEA 2K8QA 5T1KB 3LNIA 4N8VB 5FKPA 5TH2B 4UTAH 3S0PA 3Q8PB 2V5RA 3SCMD 4NO3B 1T04A 4IDLA 3FCBA 2QT6A 2VB5A 3GKWL 4TF4A 3L3KB 3SE4A 2VR9A 4YQXL 5C0GB 1A6TB 4WO0A 4LPCA 1G7IB 1YLBB 2PMZA 5E2VH 5JIDA 2FJUB 4JN2B 3CFKB 2MQ3A 3FU3A 1EHIA 2NOYA 4JHBA 1E4GT 2HJKB 3JWNH 5EDWA 3WSQH 5BPFA 3F64A 2FIKB 2C34A 4NN7C 1MFVA 1T2QL 1AJ7L 2Y5TA 3I6GA 5IK3A 4PRHD 3X3FL 4A67A 4G9DB 2OS7A 5J13B 4HKZA 5DEFA 5L2KB 2BRQA 3CSYA 3BZ4A 3AG1B 3GXUB 4U6VL 2G5RA 2R2EA 3GDBA 3DARA 1ESOA 3VPBA 4XHJD 1ZS8A 3IJHB 1M3JA 3CLWA 4ISVB 3DRTA 3NQKA 3GUTA 3BCDA 4LQFH 3VXME 3LKQB 5IG7A 1QRNE 4OI8A 1NCOA 2KPNA 5KFSA 4R8UB 4CN6A 4X9GA 1ETB1 4NM4L 3SYOA 1IBHA 3I6SA 3NZUA 4K7FA 3EYVA 1V54B 4NAMA 1D2PA 5FYJU 4FYSA 2ADIA 1YCSA 1RK7A 2IALA 4L4TA 3U2SB 5IEKB 4XBEH 4ELDA 4B53A 1SEQL 3G5ZA 4JDZB 4WWKB 5DUML 4QD2E 4EDWH 4HOWA 3D9AL 4ZX6A 4EI6B 3RV4A 3VE0B 2B9BA 3RI5K 2A4ZA 5DHDA 4M61A 3PO3G 2O6PA 1NCHA 2G3MA 2XVBA 3T6ZA 1JHKH 4N68A 2EYTA 3BIKA 1I3VA 1EVTC 1OPGL 3BWUF 3P9LB 5EOTB 5KG6A 3GSRA 3FDWA 3VNZA 1XF4B 4NAQA 2LU5A 4Y16B 5B4MD 4HMEA 4LRIC 3MJ9A 4OFKA 3ZZ1A 4LF6H 2GJ6A 1OGAA 1BQHG 5AAMC 4J6RH 2YEVB 3QWRD 5FC9A 1SN5A 1UWGH 5PCYA 4QTIH 4YDIL 1E27B 1FFPA 3ATEA 2PR4H 4LT7A 4ATTA 4KKNA 3C5SA 4FA7B 4M7EA 3V0EA 5JVLA 1E7UA 3SDCB 3DMMB 3O2DA 2E6JA 2HXAA 1HHIB 4PJBA 3GTOA 2YAEA 4LVNC 1Y6KR 2R23B 2WLHA 4I3RL 4J5VA 4QRSB 1S7XB 5LBSA 4B9ZA 4NHCH 2I24N 3QO1A 1BQLH 1DLFL 1A7QL 5H2BA 2VSKB 2EIMB 2LLGA 2BVTA 4ORGA 1T83C 4F4WA 1M2OA 5LDUA 2YQ2A 1TZ8A 4JFEB 3WFHA 4DSYA 1U3HC 2NU8B 5KFQA 1N67A 4YXHL 2BSTB 5SWQA 2YGPA 5IJCC 1K3ZA 3PPEA 2V2XB 4NQCD 2AQPA 2B4CH 3IWVA 3HUJA 1N5AB 1A14L 4JPVL 1B0RB 4WF7A 1G7MB 2CSPA 5AW1B 3CWGA 2VCOA 3QPQD 1T36A 4OCYL 2DQDH 1KGIA 3OTOH 4PJIB 1DHKA 2FTAA 2R1YA 2VE6B 4MAYB 5D7LB 3KS0J 4LBEB 4Y1AB 5C07E 2UUBH 3LD8B 3PDOB 1S7QB 2EEXA 2IAMA 4MA1B 3QIUC 5HDBE 5SV3A 1H3XA 4P2YA 2GJZB 5DQ9A 5DZNA 5FUOH 4K3DL 3LKSB 3CHQA 5FO7B 1EUUA 3MJ7B 1FFRA 2JLLA 1IV8A 3RGXA 3IDUA 3ZTJH 4IJ3C 2Z9TA 4PJXB 1NWOA 4RNMA 1F1DA 2W65A 4O2FA 1WEJH 4PJ7B 2HVSA 2O61A 4GQZA 1A2YA 2X09A 4JM0A 5A2KH 4H0HB 3QAZB 1ZEAL 2DWEA 2NVYA 3NJJA 4XCFL 5IREA 2WQUA 2OTUB 4JO8A 3OM3B 3GTKA 3V10A 3ZR6A 3R5FA 1I3GL 2IOIA 5BUAA 3FUEA 9PCYA 3GXPA 5E8PA 4ZUSA 2PXYD 3L54A 5I2IB 4TUUA 3HXLA 3SDDA 4JFOA 4JG5A 4XN5A 5EBWB 3V9EA 2C5DC 5FX3A 3SE6A 4ABVA 1BZ8A 2X4NB 3VWKC 1FHNA 4PRAB 5DC0A 2HJLB 3LMJH 1AD9A 3IU3B 4AQYH 3QI9B 5E6ID 4LRNH 3B9KD 1L9NA 3VQ1C 1LO3H 1T4KB 4U1LB 1TQWA 3ABGA 1JVOA 1J5HA 3VXPB 3ECQA 4WKXA 1NFKA 4YHZL 2O5XL 4DH2A 2I32A 2XZCL 2J2ZB 3RWDA 1JN6A 3VCLA 3OMNB 4UT6H 2R0WL 3MOQA 4QHMB 4ETYA 3U7WH 5CKGA 1FAKT 2ICEA 4TUOB 4XOAA 2XCAA 3QG7H 5FA3B 5I1DA 1KB9K 4BEIA 5IJKA 2EC9T 5KZCB 4ECVA 2APWA 3UTQB 5E1AA 3QORD 1KTDA 5EEZA 1W0YT 4IW4C 4AM0B 3LHPH 1ZGLP 1D7FA 5DD3H 2F7OA 4LHUD 2VXUH 3CXHK 3WMQA 3B9EA 4TRPH 1M4KA 3WEOA 4AQOA 4GRLB 4ECNA 1U8JB 3NIGE 1N6QL 5DVNA 5I75B 1BVNP 3HOVG 1VB9A 2AQ4A 1DBKH 4R97B 5G4NA 5F6IC 4OCSL 1G7HB 5LNGA 3PW4A 3SDXB 1ZGLA 3AZUA 3BE1H 4JKNA 1BF8A 1TZIA 2IDTA 3PO2G 5D2LA 4ZS6C 1J8SA 3KPLA 5AW2B 2Q76B 4J9PA 3OVUB 1CC3A 2QSCH 3NIFF 3K72B 5DCCA 3UO8B 4LCVA 4MJ4A 4NNYB 4PCKA 1S7RB 4EVNB 1BBJB 4HUMB 3A24A 4YEFA 2DYSB 3ELAT 5FFGA 4OM1H 1CIUA 2X4TA 4JRWA 4Z3FA 4H25A 5KW9L 4P46B 1RUKH 4QHLA 5IW3A 4DN3L 1KMGA 4Y19D 1F3RB 2NRDA 4KK5D 1RZGA 2RTTA 4DWHA 1TUPA 3O9WD 5AVUB 5FPRA 3DIVA 2AS5M 4ODSL 4LOUD 2D03L 4K3JH 4PJAB 4UU9B 2AEPL 2X2IA 1F90L 4NRYA 4KAQL 3DDGA 3HAEG 1MRCH 2I07A 2QTEA 2W71A 4DP6X 1NC4D 1P9MA 3C5JB 3LS5L 3KYOB 1AGCA 1U95B 4NM8L 5J89A 5JLZB 3F6JA 5JO5A 5IT9W 2DI9A 5IKCB 1UVQA 2JCCF 3GIVB 4QXTA 5EA0H 5CA1F 3HZKA 2GEEA 3UZQB 3ZRFC 2NNCA 3MODL 2YK1L 1XL6A 1YN6A 4X4MA 5DGBA 4C4KO 1A6UH 3O3UN 4Y2LA 1CD9B 4O9HL 3GJFB 4GXUN 4NNXA 4PLOB 4OFYA 5DTFA 5AZEH 3V0FA 3BQ2A 3SQBA 4D9QE 3RFZA 4LDEB 4WK0B 4UQ3A 3GIMA 3HRZB 4X50A 3VGFA 5ECGA 2B2XH 4LARH 4Y9EA 4ADGA 1EJFA 4POYA 5LXGH 3IFPA 4RU9A 2IPTL 3HB3B 5DD0L 1XT5A 4ANUA 4MHHG 3STLB 2AJ3B 3SPJA 3EOTL 1J1PH 5CZKA 5KYWB 4X4XA 1DR9A 1AZVA 3C5ZD 4DO6A 4QTHB 1WFIA 3RURA 3WS3A 1NL0L 3FUMA 4GSRA 3V0WL 3W2DL 3PR5B 1RYSA 4DP2X 5KVGL 5HJBA 2EZ0C 4BRJA 1AZNA 2Z8RA 3S2CA 3L16A 2VDOH 1KGXA 1ES0B 5CBEB 3MNWB 3HOXG 5CD5D 1UT1A 1PZUB 1XH3B 4FXKC 5HHQB 4LSPH 2VZTA 3LNHA 4NZUH 2IXQB 1WZ1L 1QX1A 3RVXC 1J8HD 1EIBA 4LPVA 1GOFA 3FF7A 4QXUH 2R7EA 4U2YA 4XP6H 4GAJL 2GK0A 5FV2A 4I0CC 1TYJA 4P3CH 3BDBA 5CN1A 2QSTA 4CDHA 5BS0D 3DOHA 3GBMH 3SE8H 1HE8A 1T03L 5TGBB 4BZ1L 1DYZA 1PY0A 4G3YL 2PPAA 2XBZA 4YO0B 2VDNL 5L1KA 2Q2UA 1ASOA 3SBRA 4M56A 2Y7QB 4B27A 1U8HB 2ZWNA 4IOFD 1A9EB 3PP3K 5TQ2L 1E4XH 2VMEA 1D2OA 5DQDL 5JPNC 2YL2A 2DV6A 4Y5XC 3BP6B 4N0RA 4QT5B 2HP4A 4WTQA 5DVKA 1EHNA 1OGTA 3MMEA 4X6CB 4R4BB 4XP5H 3OKEA 4ODBD 4L4TD 4PV8A 4TOYH 1XAKA 4MDRA 3NN8B 1BJMA 5BRZA 2ZKXA 1JXGA 3O45A 5BVPL 3IT8D 3BP4A 4M62H 5CAEB 3U4BL 2KDYA 3EHBD 5DJ0B 1TQVA 3EYFA 4PI2A 4UTBH 1X7QB 4F7TB 4QXVA 1FG2B 5D1QC 1AOZA 2NY3D 4Z7OB 2O5ZH 2X2HA 1FGVL 3QDMB 4YBLC 4Q4EA 3V0VB 1ZT7A 2VA3A 3ULVE 1YEHL 1JF6A 2RMNA 1JHTB 1N59A 1OGAD 5JR1H 2FPIB 2G2NA 1AY1L 3KGRA 1OGPA 1ORQA 1UYWL 2ARJQ 2MMXA 1TVBB 4RFOH 4Q4IA 3TO2B 4E9TA 4X4YA 2F8OA 2GBTA 1B4JH 2XDHA 5CJOH 1U36A 1L6ZA 4HLJA 3FTXA 4IBVA 4IDJL 4NI3A 3U0TB 4FC3E 4A3MG 1KELL 1U8NB 4KJPC 3C75A 4ZTOH 4F20A 3G6AA 4GEJA 3RL2B 1CDHA 4WNSA 3ZHKA 1TTBA 3PAUA 3KWVA 2DQHL 3HVDA 4JQIH 3KJ6H 3LPOA 3P9MA 1K2DB 3FHQA 1K5NA 2CNZA 1YAZA 3PL6B 1UATA 2PCFA 3W9EB 3HE7A 5TE7L 5E08L 1KZQA 3PPSA 3KAAA 2MOGA 4KFMA 2D9QB 4F8TA 3MNMA 3ZE0B 3W0WA 2DLGA 4CILA 3OPZL 4PJDE 2ENYA 2WLMA 4XX5A 1B2WH 5DXWA 4KQ3H 4QHNA 5JQ6H 2H2SC 5FGCE 1JXKA 2ALZA 1IE5A 2R4RL 2JTDA 3GT6A 3SDAD 1P4LB 2FLMA 3BDYL 1R5WA 5J0BA 2IAMD 3PYCA 1HVXA 5BXFA 1VENA 2D31A 5J06A 1CE6B 2WXGA 4NUQA 1U8CA 4RGOH 4OT1L 3D39B 3EGXA 4LOVA 4NZTH 4WUKL 5IQ9A 3L5XL 4P3DB 1N6UA 1WF5A 2PP7A 2IPUK 2K3HA 2ZX9A 4EI5D 2V2TA 4UQ9A 3O0RH 2K8MA 1VERA 3QIWA 2MNUA 3SKOB 3V4LA 1FDLL 3IEAA 1BPLB 5AYTA 4CVZB 1HQ4B 4I87A 5ID1B 1UQSB 3HPJB 2BOCA 1RZIB 1MJJA 4TLTA 1BJ8A 1RZFL 3MO1A 4NQEA 5F7DB 5CJ5A 5IV2A 1MIML 3PNWB 5LGJA 2WXHA 4HUWA 1IAII 2NNRA 4MD0A 3O3DB 4BY1G 3ZTCC 5L0QC 2EJ1A 3TTSA 3S3CB 1JGVL 1NBZA 1C08B 3TN0C 1IZKA 3WKNA 4UYQA 3FO0L 4WV1A 1PZDA 1E4EB 1U58B 5A3ID 1SEBA 4XCYB 1MRDH 3TCXA 4Z3EA 3BFOA 4LSSL 5FYKD 4FTVE 2DJMA 3H8NA 3ZZQA 3VI4E 1KCWA 4JRXE 4MQ7B 1U93B 4PR5B 2BS71 4WI4A 5BZDA 2FR4B 1C5BL 4MAUL 3MRBB 3NYKA 4U6XA 3ZSTA 3UPCA 4NUJB 2G5BB 2IFFH 1KTRL 4JFQA 4O2EB 2E7LA 2PWHA 1CFMA 4QUOA 3PJSA 3D25B 4BBWA 4DAGH 5B39G 4ENEC 5IMKA 1ET5A 1UJ3A 4JY4B 1UZGA 3AJ7A 4Y2OA 4JY6A 4U6HA 2WYTA 4ERSH 2XG5B 4FQQA 4L8CA 1CGTA 1MUJB 3Q8EA 4UQCA 3K5HA 3KR3L 3L2LA 1BIIA 3DJTA 2HH0L 3UADA 1I8LA 4PBXA 5GGVY 2GBUA 5GSVB 2XWXA 1GS7A 5EBGA 3V9FA 5F9AC 3NFNB 4NKDB 4M7ZB 3MNDA 3D85B 4BZ2A 3D6GA 4GW5B 5FYLE 5T3XH 1OF2A 1HQRB 1MFAH 3UL4A 4LEXH 5C0AE 2ZPKH 3ZK0A 2WOBA 1QPKA 2YPLE 3M1BB 4FZEL 2A5UA 4ZT1A 5AOIA 4LL1A 2H8PA 1U92B 2UWEB 3D0LA 2BNQA 3P3RA 4N2AA 4F9PC 2HVJB 2YMTA 3QZLA 4P5TC 2WQVA 4P9ML 3AACA 3N0AA 5DFAA 1EUDB 1OM3H 4IRDA 3EZ8A 4YXKL 3MRPB 4Y9CA 4LASL 2JI1A 4NN7B 2YKKA 4M3HA 3AFLA 7PCYA 3ENEA 2W70A 1LNUB 4A66A 4R8WL 3MLUL 1JK9A 5E2TH 3T0XA 1MFCL 5CINH 3HAEH 1RIHL 2WBJA 5I5MA 1R0AL 4LKXB 5ECJE 4N2HA 4RBPH 3LHAA 3NBNA 5IGXH 2I60L 3IGLA 3AQDA 4K94L 3OXSA 2BFGA 5BW7C 3WJJA 1MHEA 1T20A 1DGSA 1F13A 1I3QA 5JOFA 4P9HC 3ESMA 2VDQH 1CD0A 5TD4A 1RZQA 3MRDB 5T5NF 5HBRB 3JV6A 3AMLA 4U3SA 4IRZH 4OFYD 1KZYA 3IKCA 4QWWC 5E9DE 3ZKXC 5KSBA 1UNNC 5EEYA 3SO5A 3EPGA 4P59H 1PKQB 1RIVL 4DKEH 5ISZE 4PJFA 2QHRL 3U4AA 1HNGA 2CRIA 1XWVA 2L04A 2Q8BL 3B7TA 5D7IF 3BQUC 2VH5L 2NX5B 4AC4A 1LLAA 4WW2F 3HG5A 2HA1A 1WO2A 2LLLA 4WNJA 5E8EA 5FXCH 3VYOA 6FABH 2EUXA 3KPSA 1DJGA 1AR2A 1QFPA 1Q9OA 4Z7UB 1QBAA 5EUKA 5TDOB 1IM9B 4FKEA 5F9OL 2YRZA 2Z92B 5IB5A 1N8ZB 2YD6A 2WB7A 3QFGA 2X7LA 3GIPA 3QFFA 5B21A 4WUUB 5EUOF 1JFQH 1TJHH 4U05A 3WO3B 2GT9B 4N85A 5AWNL 4QRRE 3P3SA 4G1EA 5AALA 1E9PB 4AYMC 4EDXB 1RPUA 5DO2C 1OAZH 1SFHA 1EEQA 3MLYH 5BQ7A 2GJPA 1NCWH 1UT2A 3MRGB 1FVDB 3ZDYB 4LVNB 1SJHB 5ENWB 4JDVB 2R85A 3L81A 4J3VA 5E00A 2KZBA 1OSPH 5ERWB 1IL1A 1NC2D 2VM9A 2HT3C 1JRHL 1N12A 2XIIA 4JB9L 3IS1X 4YDKL 3WV0A 5KS9E 5D6CB 3VFGL 4Z8FH 1TZGL 1U3HB 4LVHC 3T4AA 4HEPG 1MPAL 2WXJA 4MNGB 4RFEB 3Q1SL 4Y9FA 3V7AE 1E2WA 3IM1A 3QJHB 4B6ZA 5CSBA 3TL5A 5JZ7C 3F6LA 5HYQA 2PO6A 3MRFA 4KGLA 3NIDB 1TTRA 5J6GB 3G6DL 4M5TA 5C0EB 3K2UL 5BZXA 3DVGB 4KTDH 1X9QA 1EFXB 1M6OB 4GMSL 3FQUB 4A04A 4U1MA 4WWPA 3BHBB 4GSUA 3B5TA 2GJJA 4AYDC 4X5WA 2H0PA 3GJEA 3QIUB 4ADJA 3UG5A 5B7EA 3TNNB 4ED7A 4BKTC 3UZVB 1SEIA 1TZHA 1UCTA 2PCXA 4P23B 1G84A 3NCEB 1HE7A 4GSDH 1PCSA 3W11D 3BVWA 3U7AA 4G9FA 4N2EA 1KTLA 4JO3L 4IJ3B 5ELIA 4I18C 2Z7ZA 1MVFA 5KFRA 3CVIH 43CAA 1Z5HA 4UOW1 5KFYA 4FQLH 5SWSD 3A22A 2NMSA 5MERB 1T94A 3HOWG 4A2DA 1U33A 4KKAC 3A67L 4DTGH 3DGGB 4JCWA 2X6CA 4HD5A 2UXFA 4WU7A 5EWIH 3R7RA 3S7GA 5KFCA 3S3DB 4M6OL 4ZUUB 4F8QA 4M7JL 3IN0A 2ITDB 4DK6A 3WUWB 3FPXA 4P2RB 3BP5A 3UPRB 2JVUA 2ZOUA 1JZFA 3MGAA 3VWKB 2XQYK 4HWEL 2DKSA 1VPOH 2ZYHA 4BK5A 3HE7D 1PW3A 3PV6A 4KVNL 4Z5RA 2W6PA 2X0UA 1OD9A 4AVKA 4U7SA 3L17A 4JKMA 5KG3A 2XN1A 5ID0A 1J0JA 1MG3C 4L8BB 2HFGL 3O2VL 9CGTA 1TO4A 1SN0A 3BEWA 3W0WD 1MG2C 4AQ1A 2GABA 3IAPA 1T4WA 5HI5D 2Y6TE 1GZQA 1K8IB 2ENJA 4XN7A 3CZFB 2H32A 3MLZL 3NH7L 2NY4C 4YPJA 2RCSH 5E8NA 2W9CA 4GIAA 5GJSH 2B1HL 5B8CA 1ZT1B 3FUHA 1YZZA 2L4OA 3DI3B 4GAYB 4R83A 2O6CA 3FB8A 2FWSA 5AW8B 3BAKA 3AGWA 2Y7NA 2O6FA 2J7LA 3QO0B 2OMWB 1Q72H 3MKKA 4YUEH 5IT2L 1TKWA 4XR8C 6PCYA 4EBEA 3B9DA 3C5XA 5CN3A 3W9DA 2DQJL 4Y89A 3RILA 4LBAA 1W72B 3PLYA 4CMHC 3G5WA 5CF3A 5IFJA 1Z5LA 1T7XA 1LDSA 2Y23A 4FZ8L 2C7UB 1FSKC 2GG1A 3MXVH 4PM1A 4UDUA 4E9XA 7FABH 5F6IB 3T1FB 3QIWD 2AITA 4PJEE 3HOYG 2CMRH 3MBEA 4MS6A 1LILA 3Q43A 2F8VA 2EXWC 3S9DB 1ZGLM 2WXLA 3IJYB 3DBSA 2GSIA 1MHPL 4KNTA 3RTQC 3UYOD 3RWJB 3ABKB 3RGHA 3LN5A 2KMWA 4NXMH 2ALAA 4HHGA 3MA7A 4O58H 1RJZA 2BOBA 4F7KA 4FX5A 4Y8DC 1UWEH 4UIMA 3MRIB 4LCCA 5I6XC 4AEHH 1O9VA 2BVUA 3A4EA 1QSVA 3QE5A 4ECTA 4IU3A 4P0DA 3UOAB 4LSVH 4IBSA 4JFDE 1FVCA 1B0IA 1C16A 3UZEC 1CO1A 1E3ZA 4FFYH 2VW4A 1Z5YD 4W9KC 4JO5A 1FNSL 2ZAHA 1X5HA 5GGRB 3CXDL 1A9XA 3FW6A 4C57C 4G6JH 1KWKA 2ZZUT 3CK0L 4A2LA 2BMKB 5IIEA 2R7LA 2JIXA 1F97A 2QZQA 1F42A 3RBDA 4GIPD 4Q6IC 3FU0A 3HUJF 1PEZA 3RKPA 1G87A 3DTXB 3I6KB 1ZLSL 3GLDA 4X8XA 3QG6B 1NGQL 4F7MB 4FE9A 2HRPH 1FO0L 4V11A 5K1NA 2WDTA 2NY5L 3QC6X 3ATFA 4IBTA 1MCWM 5ETUB 4ZW7A 5TDPA 3NACH 2X05A 3PW0A 3OR6B 4DL5A 2W6QA 4G7VL 2A1WH 3T65A 2AJZA 1AXTH 2V3DA 3FKUS 2UXDH 2V7HA 2WINA 3TWCL 5CGMA 1F6LL 4X7TB 4XTRD 5I6NA 1M9SA 4UDTA 1VGKB 3VXTA 5KVFH 1D6VH 2CIKA 4XMLH 2P5EE 2HT2C 3MVSA 3QVAA 2IANE 1I75A 4NENB 2RDIA 3VD4A 3F83A 3BVVA 3LRSA 1NDGA 4BQ6A 2NVXA 1DQQA 3HBPA 4OZHB 3K6OA 4HUUA 1IQDA 5CJXA 1QYGL 4KH2A 4HG4J 5GZOD 1KJVA 1GC1L 5E0FA 4P4RA 1OARL 1YO4A 2OMXA 5DD5L 1NBYB 3UROR 2DS4A 2C1PB 4C5AA 4FXKB 4ME6A 2A73A 2EO1A 2HYMA 2W0KA 4XWGL 5FW6A 2QPEB 4JMXA 3SPIA 4BE5A 4KXZI 3BYYA 1IAOA 1M7UA 3T6QC 4LH6A 1QASA 3O3AA 2NNFA 4FNRA 2ZQKA 4GLRH 4OFQA 1GJWA 2XTJC 5D1XD 2ZNXA 5J3HD 1NIBA 3MTXA 3HJ0A 4LFHD 3IDJB 5GRUH 3EYQC 3QDJB 2ED8A 4W93A 1Q94A 5GGVL 2AJUH 2O5YL 1EGJA 3B7RL 1RVFH 4Y8AA 2HN7B 1P4BH 2VLKD 1LO4L 3TYFA 3K6NA 3KXFE 5LN8A 4D8PB 4X6FA 4ZFOB 3KW8A 2LFEA 3MGOB 1FNGB 3QZPA 5JPNB 2OLSA 1M56B 1E42A 1TU2B 4Y5XB 5CLWA 5TPWL 1Y18A 3PHOB 1MAML 2RGRA 1G7LB 2AABH 2HT4C 4DOHE 4XNUH 1XGRB 1ND0B 3AY4C 5AZ2L 2XRAH 5E6SB 1MIEL 4ELMB 3OBAA 1Q0XH 1FN4B 1RJQA 1ETA1 1CDUA 4U4IA 5HHVL 4HPYL 4PJEF 5C8JA 3GQCA 1QSZA 3OAZK 3KLHD 2WXPA 1HXMA 3S37X 3Q8SB 1CL7I 4FFVC 5GRVK 1TTGA 4HULB 1S7VB 5KFIA 1ZDQA 5E23A 1PFCA 3KXYT 3C09C 5IUCA 4FQ2L 2DM2A 3K3PA 3MRRA 2P46B 1AGFA 2VDKH 1EBPA 5HYSA 5I82A 5ESVA 1A5FH 5IHUL 5D1QB 3TYGL 3U1PA 1NEUA 5CILL 4O2CA 4WHTB 5CD3B 1N34H 4IK6A 5IFHH 1ZHLB 3MNVB 1S5HB 3DPBB 1RJCA 4XC3H 3TBSB 1IAIL 2FGWL 4KVPA 4WFEE 2FWUA 5D2LF 1GYCA 2IWGA 5KUMA 5KG0A 4HJJL 2VR7A 4R9HA 2VDRB 1UD8A 1EO7A 2X41A 2OP4L 5IBLD 2ZX7A 2QPDB 1RJLB 3BMVA 4MD4B 1AQ8A 3B2MA 1JZ8A 4P2QE 1Q38A 2C3HA 3EH5B 4QRQA 3X3GH 5DQIA 1E6JH 2DQCH 4MDJA 4BWWA 3K8MA 1G1OA 5E8OB 3VXSE 4MV7A 1D5ZA 1LP9A 4GAGH 2AK1L 4GEIA 1VSCA 4LEOA 1ZSHA 4JLRA 1AH1A 3QZWA 3HCVA 1AGEB 3H6JA 5IR1A 5L6YL 1QQDB 1CYGA 3D8MA 3VNYA 4OIAA 3P69A 3ML9A 35C8H 3FFCA 5TTRA 3JZ7A 1HHKA 1PY9A 4NJ9H 1NCAH 4QAMB 4EKXA 4PJCB 3N1PC 1SOSA 4HC1L 4F33B 3TX4A 4DZBB 3B2VL 2AERT 2OJ1A 2Z4TA 5EFIB 3MFIA 1ZV9A 5JW4M 2DWTA 3S96B 2YD1A 3BABA 4PLKC 3SJVE 5TQ0L 1J0IA 2VDPH 5LKNA 5KVGE 5DJXB 4RISL 3FUJA 3CN2A 1EV2E 5K1JA 1I9RL 5EU6A 1ZVNA 4IBUA 2ZP0T 3ARBC 4Z7QF 2XHNA 4YVUA 5BUGA 3PWJB 2OCCB 1JL8A 4QW8A 2HUHA 1KXHA 1MZYA 3S97C 4OF0A 3HE6A 4Z95L 1X5KA 1RL1A 1TWGA 1EMTH 2XXFA 4AUJA 4HS3A 1YUHA 2W60B 1ZLVH 1KXTA 3IE4A 2ADFH 4DZ8B 4G9FD 3S5ZA 2YZ8A 1SBSH 4PB9L 1Z6JT 3Q06A 1TTFA 4JEGB 5KWYC 3NSJA 3HR6A 2Y3NA 5C9KA 3ULUC 1X6LA 5L1LA 5CBAB 5HY9B 4EKJA 3CZNA 4F91B 1IBZA 3EYOA 3AITA 2APFA 3KGTA 4JFYB 4NIKB 5DK0A 3CZEA 4RMRA 2EDEA 3KYNB 5E2WL 2J6EH 1H8OA 1RHHA 2XI9A 1QPPA 5L0QB 3UABA 1ASPA 5L2KE 2VXVL 4RB3C 1Z9NA 2W9EH 2CRMA 3TN0B 3MDJA 3WFZA 1FAIL 2AVFA 3H3PH 5DYOB 4D0CA 5AVRB 2VMFA 1BFVH 5DUJA 2JJVA 2RFXA 1TLMA 1T1ZB 4XAWL 4HEMA 2EE2A 1HNXH 1L9QA 3KLKA 1IFHH 1PJ9A 2ZKHH 3DK2A 1IGCH 2DIBA 2XIDA 1FVIA 2WXKA 2Z1KA 3VXMD 4RZRA 3MZTA 1QRND 3FUNA 3CFEB 3VGEA 4O5LL 4ECSA 1CLYL 3IDNB 2P5WB 4GLXA 1FUNA 2JKJA 2XX0A 4G8AC 1DFBH 2KL6A 1LK2B 4YZFE 4ZUTA 4Y9GA 4U31A 5CU9A 2JB6B 3UTSB 4K8RH 4ODHH 1ZSDB 3VXUA 2EDDA 2VLJB 2CKZB 1DN0B 1WV7T 3B1UA 3GMMB 4PP1D 5I1JH 2NR6C 3AS0A 3BVTA 4HIQA 4HJTA 3MR2A 3HW7A 4MCNA 4A68A 2CBPA 4RAHA 4IMLB 2ZJSH 3WE6A 3R4RA 2E6QA 3AAZB 3GTLA 2CW8A 1TOXA 4KI5D 2CKBA 3MLWL 5C0RL 3N9GH 3ETTA 3WO0A 1IC4L 3PWNA 3ZE1F 1JPSL 1RMFL 3VMOA 2Q2LA 2ZXEB 2NUAB 3EJRA 1WBYA 3D09A 3HC3L 2ROXA 4IKLA 1KCRL 3IMTA 2EH8H 1W72L 1N64H 3DXAB 5LNDA 3RL1B 2ZYSA 2GY5A 5F3BB 1GW0A 2QZ5A 3RWEA 2LE9A 1BZOA 1AYOA 1FC1A 2AI0H 4XMWA 1XVSA 2XQYG 4GXVL 3RIFK 2CDGA 1P84J 4P5TB 2VAAA 3CFUA 1MCJA 2FQGA 3QXVA 2V4QA 2FBJH 3F5WA 4IBWA 2F2HA 1JZEA 4BCYA 3TINA 3VH8G 4RNNA 3A3YB 1BV8A 5C0DB 4JFEE 5JXAH 4NQSA 5FGBC 4ATWA 3KW7A 2HVQA 1QFOA 1J0KA 2YLKA 1AHMA 5KSUB 2JWYA 5L1IA 1YEJH 3V2AR 4NO5B 1GMIA 1NANI 1YRKA 5T1DL 3P11L 1UACH 4PJDA 1G7QA 3C08H 5D9SA 3MNZB 2JIXD 5AW3B 1WAAA 4PJIE 2FWOA 1ZA6B 5F93C 2I80A 5D7LE 5E8DL 2ZP9A 3OLDA 2YFNA 5LDSA 4H8UA 5B7FA 1QATA 1Z0MA 2W6MA 2GC7C 4JHWL 3FCTA 1IIKA 1A1MB 4XPTL 4POUB 1WHPA 3H0GG 3FT4A 3MRMB 1AXSA 2JJSC 3ZKXB 4M3KB 4CC4C 4FG6D 5BV7H 1WZLA 3E1ZA 3DROA 1LWRA 3BUDA 5GXBB 4PJXE 1J9QA 4RMSA 4PJ7E 1JX4A 1OE3A 1OEZW 3BQUB 3RNQA 4LSRL 4NKOA 4ONHB 4U1NB 2NDGA 3GBNL 4HFUH 3BZFB 2DBJA 2XWTA 1I4FA 3ABLB 1DDTA 3AC0A 4HKBA 1IM3B 3ORRA 1VCBC 5I76B 1YMMB 3C60C 3ZBMA 1KBVA 5CEXB 3QZ7A 2FE0A 3KPPB 2AJYL 1NCCL 4LU5H 4PS4H 1Q9KB 3Q2VA 4DJMA 1DZBA 2H0EA 2R69L 4YNYB 4H13C 3MV9B 4FQPA 3P77A 1YEFH 5EWEA 1T5XB 3GSUA 4FXGA 4I9XA 3Q8RB 2HFFB 1BOYA 2OCJA 4PJ9A 5A43C 3U1SL 1CXIA 2APXA 2COVD 3P30L 4MJIA 1TQCC 3FYIB 1P4IH 2I25N 4LSAA 5ICYA 3WIIH 1UFUA 3VI4A 2E2IA 1A4KB 1FLRH 1FORH 1GGIH 1NIAA 4JRXA 3UTPE 1X9NA 2YSTA 2JSFA 4HGKC 4LVHB 4WK4B 4B7IA 2BJMH 2R1XB 1SXNA 2A74A 4K2UH 5DSCB 5T3ZE 3V4VL 3EO1B 4R0LC 3RB4A 3E1F1 3QXDA 3WEXB 1EJ8A 4HA1A 3CQZA 4L8DA 2JKIS 4OLYH 4HBCL 4ZW6A 4NFCA 4AJYV 5CAYB 5I1CL 5EZPA 5GGUB 1BMZA 1ROWA 1V10A 5IMOA 3KDMB 2DM7A 5JPMC 2W6ZA 3LN9A 4FQ1L 2OL3A 5C08E 5D4IA 4N90E 1UOLA 4G6FD 2XWJB 5CJQL 1HHGA 4PRIB 4FABH 4OKVB 1GAFL 5F7KC 3Q5YA 2B63G 2PTUA 2B3RA 5F0PB 3DKHA 3VFSB 1HESA 4L2YA 3SDXE 3CX5K 1IGYA 2CR3A 1IX2A 3K2IA 4OF7A 4KV5E 1KC5L 3I02A 1XF5A 4JDTH 4PG2C 4PGDB 1QWUA 3CDYA 2F54A 3TT3L 4NC1C 4P2AA 3FQXB 1PG7H 4A6YL 4AC2A 2AP2A 4YHLH 1U42A 4WTZG 2EDFA 4E9YA 1W0VA 1JGDB 3QUML 3S36X 4TPRH 1JXDA 4WENB 4OFVA 4B9YA 5JYMA 3L5WA 2AEQL 3CN3A 3S34H 1JD7A 1ZCRA 3W5MA 2HG5A 4PEEA 1WUNT 5I30H 3HMWL 3V95A 3EBIA 1AFVH 1KCVL 3WFDH 4FADA 5IEHA 3QUXC 1XF3B 2XKSA 2J8UB 4ZMVA 4PJAE 1EAPA 1HXYB 2P45B 1JV5A 3HNSH 3H9HA 2CGRH 4HDIB 5SWZB 4LCIL 3U6XS 4HT1L 1Y7VA 2VDRL 3HC2A 4AEIH 1BX2B 4CGUB 3TBTB 2J1WA 3D51A 5IJVB 1PFOA 4A2HA 1ZHBB 2Y06L 3IDMA 1CD1A 1FL5B 4WBNF 2DQFB 1OB1A 2V2WA 4I89A 3BWAB 4L3EA 5EZOL 4DQOL 2QHLA 4MXQD 2VR3A 2AVGA 1VFBB 3FTZA 2A0LC 3FFCD 2WZPA 4LIQE 2FX9L 3REWB 2CE6A 4CW1A 2OJZH 3VPCA 1MWAA 3OLIA 2X2UA 4RGMC 1K8DB 3CFBB 1JZJA 4U1SA 1H3TA 3MJ8B 4KZ0A 4F1ZA 4O3NA 2BIHA 2PWGA 2C4FT 2DQGL 1WBZB 2JI2A 3B6SA 4PJXF 3D4CA 4PJ7F 2MEJB 2FEJA 2NY4B 4WEUD 3C6SA 1LE5B 4LVOC 1UGNA 1IRAY 4H1LG 3S37L 1BEYL 3EJCA 1MCPH 2R2HA 2R9HC 2WVVA 4JKPL 4JPKH 5HGDB 4X7SH 4HCRL 1ACYH 3GBDA 2Y3AA 4OGYL 5DJ2A 1KBGH 1XGPB 1B04A 3LKRB 3F3HA 4X8GA 5KG9A 1OAXH 1LD9B 2ZG3A 1B0WA 4PJFF 2WXMA 1XF2B 4CMHB 1AKJD 5C6WH 3V4VA 3J7HA 5CIPB 3I9GL 1FSKB 2ZUWA 3PHQA 4TQEL 2UY7B 5ESQA 3VTTA 1KJIA 3WCYA 4ED0A 3WTSA 2ZXAA 4NCC2 2FYVA 2QKIA 3V7MA 2BY2A 2UVWA 2VDOB 4QPEA 1WWAX 2GC4C 4EN2A 2VZUA 1H3GA 2R51A 3VTMA 2E74C 3VDCA 3HI5H 1KIRB 1S7TB 2MQ0A 3RTQB 3I6LE 2UYLB 5C0BB 5EOCJ 3G04A 4AIEA 5HYJB 4UTAL 1JPFA 3UEQA 3RV3A 4F4YA 1O75A 4I0PD 1NCJA 5GRWA 2J1KA 4XOEA 4YDNA 1ILUA 5I6XB 1KEGH 5E2VL 2JA5A 3M1OA 1BPVA 4ZYKB 2WVUA 3CVBA 4URKA 1BM7A 1KLUA 1I7LA 3PWLB 4G6KH 1WT5C 5IQOA 1VADB 1L2ZA 3BSHA 2FSEB 1GYUA 1ZHKB 2YPVH 3QUMA 1KCUH 3U6RA 2R93A 4R2GD 1PBYA 3WSQL 2VRQA 3QZMA 3NCJH 1FZJA 4FFWC 1GCYA 4YHPB 4X6CE 5ICXB 5FEBA 1URZA 3BG5A 1G43A 4LO9A 4FS2A 3GMQB 3RWHB 1RSFA 4Q6IB 3DOIA 4KV5F 3SD5A 1JZIA 1SLUA 2E46A 1I31A 4KKCD 1CK0L 3N43B 4P07A 1CL7L 4G43B 2JLPA 5BMFH 4CJ0A 5L7XH 3ZUCA 1R5VB 1GGBL 2EYSA 2P42B 4LQFL 3JZYA 4KZDH 3R1GH 4XGZB 3V6HA 4LAQL 3MRLB 2J8OA 2KLTA 5FOBB 4F2MB 5GS2D 1LTXA 1ZJBA 2ROYA 3TJEL 1KPRA 1OP4A 4B41A 3JWDC 2YXFA 4XOCA 4B9IA 4TSCH 4Z7OE 4IMKC 2C3WA 5DMKB 1ACCA 3QDME 1FL6A 2CIIA 1OY3B 3D2UB 2DIAA 1H5BA 1L9TA 3DSFL 3U46B 4XBEL 4XNXL 3V4PH 1KF9B 1I9JH 4MLSA 1A9BA 4DPRA 4GKNB 4EDWL 5KANI 1MHCA 3NGBC 1JS4A 3QC5X 3ULVD 1SYSB 5CWSA 3RTLA 4N6RB 3V0IA 4A55A 4DEPC 1UB6B 4PD4K 2XV3A 2WSKA 4Y5YA 2H26B 1JHKL 3NJLA 4ED2A 4MJ5B 4H5SA 2XN2A 3V4ZA 5ABAA 1FE8H 4O2AF 2ZOKB 1KCBA 2EXSA 2XTJB 1XCWA 2M26A 4YSEA 4Q0XH 4HETA 1UWGL 2X0VA 4QTIL 4IZOA 3ZE0E 4NDMB 3LP8A 5CZXC 1LEKB 3BQ0A 5B38G 5MENA 2PR4L 4JO1H 1KPUA 5KOVC 2OTPA 3VU1A 2H41A 4ZAKC 5KFMA 1F41A 4HV8B 1V3LA 1MW3A 4X9YA 5EU5B 3H9SB 3WHE0 2VLLB 1NFDB 4MQXD 4C83A 3FAWA 4F8OA 1TWAA 1AYRA 2HX7A 4X4KA 2ENPA 2TRHA 4XX0B 1NFAA 4FGMA 5B3JF 4MA5A 4NHCL 1BQLL 2DOCA 1P5UA 3TIEB 5CMAA 1T89A 2NUTB 1ID5I 2HPTA 1ADQH 2OTWA 1CICA 2N0MA 3LIZL 1S9WA 1JWSB 3FU7B 3EAKA 2EE0A 2YN5A 3D39E 1C8PA 5JHDA 2B4CL 1TQTA 3CVHB 1QI4A 3GEWB 3SGEH 3DUSA 3SODB 3D18B 5IJDC 1S9XB 4LXFA 3C09B 5I6MA 1BLNA 2DQDL 5FK9B 1PLBA 5C86A 4DL4A 3PREA 1V7NH 4C4KT 2XN0A 3REVB 4PUBH 4Z7WB 1L3WA 4N87A 2ICWJ 1D5BA 2IQAB 4K23H 5IP7G 4Y7MA 3MAWA 2X70B 3EDDA 5TDNA 3BD5A 3W57A 1WGOA 3IPEA 3F7VB 4NGHH 4B9FA 4QOKE 5FUOL 5FGRA 1JXLA 2XCLA 4CVXB 4ZTPH 1CXFA 2FD6H 3FQ4A 1OAKH 5J2UF 4MRBA 4ODXB 2FJGB 3GBEA 5GRZA 4IAJA 4K9JA 1KN4H 2RAMA 1BHGA 1VKXA 2RALA 4Z7VB 4M7LL 5B22A 1I8IB 5FCUH 3HC0B 4HX1A 1ROCA 5DWUH 3K7UA 4DR5H 4JI1H 5DHYB 4JV2A 2F53A 3ZL4H 4FTVD 4E41A 1FIEA 2YPKA 4R7DA 4JRXD 4TVPL 3U0PA 2Q0ZX 2WCSA 2YC1B 3L3GB 1KJ8A 3QQ9C 3O11B 1AQDA 2P24A 5HI3C 4BXXG 1G9HA 4K0KH 1T66D 2YZGA 1QSEA 1KIPB 5L1JA 2PPCA 4Z7OF 4RQQB 2JKLA 1KYOK 1VFMA 3LMJL 1DVFA 5F9DC 2NPLX 2GTZA 4W9HC 3ARGA 3DSNB 2DQIH 3Q3GA 1LO3L 3N1QC 2AJSH 2WJ7A 3DHMA 2VXTL 3D3VE 4NSKB 4BWUA 4HGMA 3RBGA 1YJDH 3PQYB 5KG1A 1KNOA 2XWBB 4M5YH 4PB0H 3ARBB 4Y4FD 5D7KE 1VAHA 2E4FA 1JGEA 2X4PA 3F7PC 4OSUH 4UT6L 1LE9A 3CGTA 1Y14B 2K70A 1QFWI 3QG7L 4ZO6A 2W7OA 5ITFA 3R8BB 2M2DA 1E5BA 1S7SB 5E5UB 3H0TB 5C0AD 1KG0B 1QVOA 4XMPH 3CZLA 2IMNA 2M05A 2VXUL 1HL9A 2I27N 1YY9C 3LIZA 2ZOLB 1P7BA 1Z3GH 5D7EA 3MFHA 2NSMA 2NY1C 3DVNB 5H37H 3PGCB 2A6KA 4ZPVA 5DFTA 5I1GL 5MEOA 2NU6B 2XV6B 3B3IA 2NU9B 2BP0A 3BE1L 2R8HA 1PSKH 2JKTM 2QSCL 1DE4B 1QKZH 1HHHB 3ATBA 2ZAGA 2IDSA 4Y4KC 4U3CA 4FI6A 1G5AA 1BQUA 5E7FA 3GK8H 2AV1B 4XT1C 5KYXB 4OM1L 1KGUA 4LPYA 3KXFA 4R3SB 3WBDA 1RUKL 4L9DA 1J88A 4UUJA 4A93G 4BFFA 4LF3B 2X6UA 3FRUB 3HAEB 3MUGA 4LLVB 5F44A 4UTCA 2R2CA 5J5EA 1QEWA 1URLA 1DJSA 1HNYA 1MRCL 4FLQA 2FK9A 4Z77B 4KQ4L 1U8LB 4Z7NF 1E9QB 1PKQE 5AW9B 3OAZH 3OJDA 4IM8A 2VDQB 5DMIH 3GZKA 5E9DD 4E9QA 3WLWD 2O93L 3QHFH 4H1LH 4WZ9A 4BFGA 1VGEH 1ZOXA 2KZKA 2NX5E 1JWUA 4I48A 5EA0L 4WTXA 3U7YH 5BV7C 2VQDA 3KWXA 3U2JA 3BI9X 4Z7UE 3TBBA 1A6UL 2FPGB 4L3CA 2PN1A 5DD6B 2BFVH 1A7RH 1IC5H 2FWLB 4WUUE 2IAAC 4H0IA 4FYRA 4HOMA 2B2XL 4W4NA 1A7BA 4O3PA 1WWWX 2UV3A 5LXGL 3MX0B 4KKBC 2OH2A 3WMPA 3ZDXF 2Z34A 3N42F 1TA8A 1GIGL 1IJNA 2YIHA 4IHOB 4JZJA 1XR9A 4M03A 2V17H 4L5FL 4QRRD 4C5BA 4F27A 2WMPB 3ZDYE 2R0KL 4OJDH 2DRUA 1DBJL 1ZLWK 4Z0XA 4P2QA 4B0MB 4XPHH 4MA3B 3AY2A 4GQPH 1A8ZA 1RI8A 2VDOL 3VXSA 4DO4A 4KK8D 1U4EA 1M3IA 1H3WM 2VITA 4KC3B 3FN0L 4PJHA 3UAAA 1IC7H 1MHHA 1LP9F 4HXBH 1E8XA 4YHOL 1N0LA 4MGXA 4MNGE 4LSPL 5B1KA 1A4AA 4ZK8A 4NZUL 4IWYA 2DD8H 1OSYA 5AW6B 4LEBA 4N0UB 5F1SA 1U8PA 4KZEH 1WC7A 2X6AA 3NIDE 3CX2A 2JA7A 3O4LB 4XP6L 5I8EB 3ZMEA 1IGFH 4P3CL 2VMCA 4KK6C 3GBML 3SE8L 1IEAB 3TO4A 4N28A 3ZTNL 2ZSWA 4R84A 4QI3A 1JV2B 2G2RB 4MAZA 4A7TA 4J4PC 5HGAB 4EXPX 3TZVA 3BUYB 1T0OA 2NTFB 2W9DH 5LYJF 1HOCA 4JBSA 3CHXA 3DK0A 3LRHA 2Y0SA 5FM5M 3ZTEA 3BAJA 1E67A 1E8YA 2VDML 1J5CA 2A83A 3L45A 5HHOE 4QMEA 1EBAA 1D5RA 2GFBA 3MRQB 4UM9D 5T1KA 3WTUA 1T0MA 4JQXA 4C47A 5C0JA 4XP5L 4X66H 3EGDA 3FSWA 3ETHA 4J9RA 4TOYL 4OQTA 4L1DA 1S9FA 1Q1JH 1B9KA 2D7MA 2EIZB 1EZVX 4FXTA 4OIIH 2FKLA 3CFKA 3QCUH 2C3VB 2WC7A 4N4YB 4M62L 2DB8A 3C60B 3OKYA 4RGNC 2XCPA 2BVOA 2R0ZH 3KD4A 3SBWC 1HSBA 4PJ8A 5C71A 2DW5A 1M71B 3UCRA 2N01B 4KX9A 1WH2A 4Y5VC 1E50A 2OSLB 2X1WL 5DT1L 2YD7A 1E4JA 2O5ZL 1RUAH 5GS3A 3FO2B 1TCMA 4ES8A 2J71A 5JR1L 5F9JA 4X5PA 2BINA 2IF7A 3U36A 1EZVY 4KJQC 4U6YA 1BVNT 2FX8H 2BSRB 3F58H 3GUTB 2CHZA 3W3BA 2PUQT 3FO1B 4R8UA 1DJWA 1H8LA 5C09B 4UNTA 3LXAA 3FAXA 3PFQA 4XN9A 4ZTOL 4P3WA 4DGIH 4DW2H 1LO2H 3MV7A 5JUMA 3SKMA 2A6DA 4GQQA 5F1NA 1L7IH 5JIQA 3CFDB 4JQIL 3OQRA 3KJ6L 4TQ8A 5IEKA 4KJWC 4JDZA 4R0LB 1CT8A 1MREH 2CO4A 4Z7UF 4L1KA 3QJOA 3QEGH 5I1AB 2UXCH 1IJ9A 1IBBA 2ZOOA 4UQIM 3P4MB 1CICD 1NCTA 2G75B 2LU7A 3FSVA 3ULSA 2P7TB 2P8LB 2XIBA 2FX7H 2OW6A 4GI8A 4LLDA 1F6AA 4XB7A 4CAGA 5JPMB 5EOTA 3P9LA 5K39A 5LNEA 3VGGA 2EUVA 2IQ9L 3KLAB 3A6CH 1XGTB 1B2WL 4GUCA 1A1OB 3D4YA 4X8JA 4Y16A 1AZUA 1KEEA 5JQ6L 1RK0B 4LFAH 4I5BA 1FZMA 5A6LA 2APBA 3RY4A 5I9QC 3EGSB 2O1AA 2OK0H 3HHRB 3SE3C 4H88H 2WSDA 3B8SA 4HXAL 3HG1B 4IRSA 1E27A 3RZCC 4TUJA 2NTSP 3QUHA 2Y5QA 4RGOL 4NZTL 3GJFK 1HHIA 2J25A 2HLEB 3OKOA 1O7DC 3DJ9A 4FQXC 4HQQH 3LNDA 3FFDA 4FFZL 3N6XA 4FM9A 3O0RL 4QRSA 2WP3O 3DNKA 3NIDF 3NMEA 3QUXB 1U41A 3IVKA 1MZZA 2EEFA 3CFCH 5DMYA 4C4UA 2V2XA 2F53D 5ANMB 3DURA 2MIZA 3RDTA 3UAJC 3RY6A 2FCBA 4ECUA 2HTKD 2WLNA 1D5MA 1JPGB 1QSED 4AYSA 1HK6A 3NDYE 4MAYA 4RGMB 1I1RA 2YA2A 2FE3A 3L13A 3ZT6A 2B08A 4LBEA 4Y1AA 4PCSA 1MRDL 4LPTA 1DVFD 3T2NL 1FNHA 4BDVA 4F7EA 4A3BG 5DDHB 5I28A 2QV4A 2QQLH 3J2PA 4LVOB 1TG8A 3Q05A 2I69A 2JJTC 4HHAA 3LOWA 4QHKI 3VWJA 1R3KA 5F97E 2N1KA 4KRPD 1UOVA 1TSHA 3LKSA 4HJIA 1AAJA 1I1AC 3MJ9H 2NDFA 3I75A 4P5MB 5B39B 5DI8A 3I3BA 2IFFL 1MXDA 3ARXA 4X64H 1MRFH 4KJYB 3FN3A 5HI4C 4OZHE 3IDGA 4CU8A 2P5ED 1NCNA 3B43A 3GNMH 5FF6B 1OTUC 2IAND 1E40A 2EVIA 3RHWF 4XPAH 2FB9A 1N18A 3D52A 3QJVB 4ERSL 5C0FA 5BR8H 3O2DH 2PTTA 5I19L 1NGWA 4LK4A 4N0CD 4TQPA 3VXRA 3F7YB 3FQYA 3MREA 5BZWB 4ETSA 3IYLW 2FH6A 2BS8A 1OSZA 2JFCA 5LBSH 4W4OC 4HQ6A 2AXFA 2BNUB 3L3JB 3UO1H 2FJFB 2P8MB 5T3XL 1MFAL 4ORZC 4CADB 4YQXH 4KUCF 1AKPA 3HNVH 4KKLC 4W6XB 3QDJE 2HJLA 5IHHA 1BAFH 5KVDH 3TF4A 3H3VH 4EBCA 1F2XK 3HRPA 4HR7A 4APXA 1T4KA 5BMVF 1A4BA 1HX0A 4OV6F 1XDTT 4JGNA 1SN2A 3WELA 4XC1H 4LLWB 1OOWA 2ESVB 4FU0A 2VQFH 3KXFD 2WWKO 2EDNA 4QHMA 4KDTC 4TUOA 1OM3L 5FA3A 1NOFA 4Y4HB 2FZ3A 2N7BA 2IBKA 1P1ZA 4ZQIA 2IADB 1MI5A 4FFZA 3RVVD 4ELME 1MDTA 1A3RL 3ECWA 3AXLA 4UQBA 2WLIB 3K6DA 5CINL 1X9UA 3ARDA 3WL9B 1MXGA 4PY8I 4EIGB 3VGDA 4M48H 2G9HB 3GC3A 1HR0H 5LA6F 5D1QE 3ERXA 5AUMB 1JVKA 4HK3N 5DUMH 3SDXA 2WQWA 5AKTA 1BG1A 4KK9D 3WDJA 3D9AH 3W38A 5KG5A 1FYTB 1FFTB 2AAAA 2VDQL 4L3FA 2ADGB 3LKOA 2VDKB 4IRZL 4NNYA 4OZIA 4FJZA 4N6QA 1BBJA 3BISA 3NGBB 3IN5A 2WCPA 1UCBH 3NRPA 1EEZA 4JFFA 4P59L 2BXYA 4DKEL 4DEPB 1U0QA 4NWUH 4V1DB 1A47A 2IC2A 4S1DD 2UU9H 1CTOA 4KROD 2AZAA 3L95B 4U3XA 3L2NA 6FABL 4P2QD 4PJAA 2A6JA 4XNQA 4A3CG 3T8MA 5DQHA 4N2OA 4F9LA 1AACA 3BLKA 3O8XD 4YDIH 4U0RC 3VXSD 4ETQA 1R75A 3P3YA 4TL4A 5IB4A 4UF7C 3Q2CA 5HSFA 3C5JA 1NMCC 4LDOB 1JFQL 1MW0A 4WHYG 5JLZA 3RA7H 1FWXA 2WBWB 2LU4A 4PJCE 2AQRA 3GIVA 4ZAKB 3IE9A 1OAZL 5JW5A 5AB9A 1EWHA 1UM6L 2H0FA 2V8LA 3MLYL 3QS3A 1GZPB 1DLFH 1A7QH 3MACH 3Q8BA 4U1JB 3OSKA 4GUQA 2DQ6A 1AO7A 5D2NA 2PW1B 5HBBA 5ICZA 1UC8A 2VUYA 3M8OL 4PJ5A 1OSPL 4ALAH 3II3A 3SQRA 1HN1A 3SJVD 5KYNA 2YQGA 3SKNA 4C8XA 1Z66A 3NCYS 3OAYK 5BO1H 5FO9B 4Z8FL 4MNQB 3N40F 1U6AH 4JO4H 3STLA 2VDPB 2VQTA 2X53A 4XCNB 5K9QI 3AU1B 1N2RA 2BY1A 1YJDC 1BSIA 4TYUA 1V4YA 1NMBH 2VR4A 4W81A 5B4MC 1U9KA 5CCGE 2EICA 5T1KD 3AYHB 2A9MH 5IB2B 4JFXB 5HVHC 4MV8A 4AOFA 4ZNEA 1DANU 4KTDL 4ZD3L 5EZJB 5J9PB 3IETB 2IGTA 1UWFA 1GR7A 4N2MA 4U7CA 2WKLA 4U6TA 1JF1A 2YAOA 3ZKQD 5ABZA 5IW1A 2IMWP 3ZQWA 1JNLH 2OMVB 3TIIA 1AHWC 3D1MC 2H3KA 4KI1A 3T0WA 3FT3B 2RHEA 5SX4I 2OJEA 4X6BB 4GKLA 2AV7B 4KNQA 5EBMA 1L9MA 1TEFA 5ESAB 4XXWA 2Z4QA 3PAZA 3JWNE 2W94A 4XO5A 3RWFA 4X6DA 3T3MB 3KPMA 2GI0A 4GYBA 4GSDL 5DVOA 4OGZA 2UY6A 2WCGA 2Z93A 3RB0A 5I6PA 3CVIL 5G5DB 3M46A 1KBBA 4PRNA 1MOEA 5C0CA 5KSVA 4FQLL 2EDKA 5EOQH 3WUZA 3E3QC 4DTGL 2MFNA 3FPYA 4XP4H 2P5WE 4RAUB 5DLFA 4GBXC 1DSYA 1VZHA 4G42A 4D0BB 3BP6A 4QT5A 2FJHA 1JNNL 4W9FC 5DRNA 3FNKA 2BSCA 4UV7H 4MFHA 5HGBB 5CLXA 1SGKA 4CNIB 2D3JA 1IBYA 3JWOL 4GI6A 1DEDA 4WQOA 3UTSE 1HTYA 1U21A 3NEXA 3RGBA 2VLJE 2GW5A 1VPOL 3O4OC 4YHZH 4ODWB 1REIA 1SNRA 1L0YA 3FB5B 1LK3L 3ARRA 3R0NA 4P48A 3CPLA 2OCFD 3O2WH 4YN3A 3MRKB 2K6ZA 3R4DA 1L0XA 1VKZA 3MR3A 1I8MA 1U2CA 3ZIYA 1S0MA 2P3YA 3QARA 5EO0A 4Y16D 3QEQA 2PYFB 2RCSL 4CRPA 2D7OA 1T6VN 1N5YH 5GJSL 3KPRA 3S2AA 1YY8B 5CHNB 1EK3A 7CGTA 3CFTA 4N1EA 5DVPA 1ZA3B 5I66B 4HGWB 1TVBA 3DXAE 3FTGB 2DLHA 5FM8A 2V7NA 4AIXA 1N6QH 3EJPA 4YUEL 1AC0A 4NPYA 3ALPA 4KO5A 4ZOAA 3SDCD 2AKRB 3VI3A 1X4ZA 3OKLA 2DWCA 2FT7A 4GG8B 3B2PA 4PJCF 5JIKA 5KFLA 3KWWB 3GINA 1XIWA 4OJYA 4OVVA 3MXVL 1QHOA 1KTBA 2JE8A 3N6YA 1K2DA 4BSJA 2BVYA 2ZDQA 1P7QB 2AK4A 4PV9B 3RX9A 1XB6A 2OI9C 4S11A 2CMRL 1HI6B 3L1OH 4ZI7F 4MJJA 2IBZX 2XU9A 3KG5A 4TQIA 3BP7B 1ZLUH 5I8CB 4LKCB 4C54A 1CG9A 4Y4KB 5JQIB 2FL5A 3OG6B 5BZZA 5IMMA 3C0FB 1O6SB 4OAWB 4TV8F 1ZRUA 1PY4A 5F2FA 5AAWA 4YR2A 4O3OA 1JZHA 2D03H 1UWEL 4YDJB 3OZKA 1CWVA 3CG8A 4MAYD 4NT6B 5D7LD 3QFJB 4Y1AD 4QCIA 4N9OB 4AEHL 3BGMB 1P4LA 4OLXL 5KYYA 4LSVL 1E5YA 3LS5H 3W39B 4PJGA 1K6QH 3SGJA 1QPXA 2Q5BA 2IBZY 3OMZA 4FFYL 2UVFA 4YHNB 4NKQB 3EBHA 2NLJA 3FHEA 4PTTB 3BKML 2YK1H 3VDAA 1K85A 4J9MA 3OG4B 4YK4C 5FV1L 3BA8A 2E56A 5LAPA 1A1NA 1EAQA 4O9HH 5BV7B 3SKOA 1N56A 2FSDA 2R39A 3OGOE 2ZX6A 4YBQD 2CO7A 1YMME 4YHMH 4H8WC 2IH1B 4QJ4B 1VEPA 3EZJB 4N2FA 4ECXA 1R3HB 4PD4J 4HJUA 3TNMB 5CP3H 2CUHA 4YE4H 4DVBA 1AXTL 3S6CA 3EXJA 1XZ0B 4KK5C 1C08A 1CS0A 2AEWA 3GSOA 1NL0H 3KBEA 4FHBD 1D6VL 1ID2A 4LOUC 4JRYB 3C2AH 4XMLL 3US9A 1E4EA 4FNTA 4YLQT 5DQJB 3T2QA 4P2OA 4FHJA 3UBGA 3F6IA 4UQ2A 4FJ6A 5GSRB 5LUMA 2L3BA 4G5ZH 4MQ7A 5DJ8B 1U93A 2F7RA 3RGVA 3DX4A 3ARYA 4YGVB 1Z9PA 1OHZA 1M1XA 1WFOA 3UTPD 2X4SA 2EDLA 4JVUA 1YN7A 3W82A 1X5AA 3P40A 3V6JA 2VLRB 3US1A 3KPNA 4EQ3A 3MYZA 3KWTA 1ORSB 3GXNA 5T3ZD 1YEKL 4MCZA 1HCVA 5KZCD 5IVNA 1CLCA 1Q9LA 2HZHA 3DLQR 4UCSA 4JY4A 3KWUA 2VZ3A 4GW4A 3VFTA 4NQUA 2AJUL 1M2VB 4G8IB 4RZCB 1MUJA 5F7BA 1RVFL 3DX9A 4H8PA 1P4BL 5DQDH 1MDAA 4KZCA 2OXHA 4PRIE 4GRLD 1ED3A 2V4LA 1ZTXH 2P43B 4UI2A 4N90D 3RHWK 2DLIA 5KJRL 2XJLA 5ALCH 5KFJA 1ZT4A 1I1YB 1GPOH 2D3NA 4OCXH 4KY1H 4BQBA 1KBWA 5KFGA 2J1XA 4OFIA 2B1AH 5IM7B 1L4IA 5F7LB 2AABL 1HL8A 4OZ4A 4XNUL 1J1XH 2CUIA 5C70A 4XYMB 3BXNB 2GTWA 2FYYB 1AG6A 1HZHH 2UWEA 2XRAL 3BQVA 4JHUA 1Q0XL 4CBZA 4P49A 3QZOA 5LCVH 3P4OA 1HEJC 3CHOA 2WAQA 1H0DB 4GT0A 3WJLA 1P8LA 1OGSA 2VDLH 4NXSA 3ME0A 4LNRB 4WFHE 1UWXK 2AAVA 1AZRA 1MJ7H 2OMZA 5J11C 4K5OA 2OULB 3HZVB 4P46D 3H9ZA 3L7EB 4RGNB 5KAQF 1FGVH 2J8UE 1FYHB 4L4VB 5I16A 1VIWA 5L8JB 3N85H 4MNHB 2VDKL 3RB7A 2ATLA 3BD4A 1A5FL 3DPDA 4FQCH 5SWZE 4Y5VB 1NDMB 3UGUA 5IFHL 1AY1H 2OMBA 3VFNB 2ZDHA 2XD4A 4XC3L 3SGKA 4WNQB 1EAOA 1DV2A 1AN7A 1Y6NR 4IDJH 1H8NA 4OCMC 2DZEA 4BQCA 2BVEA 4WU5A 1KXQE 4C58B 4FLRA 4DP4X 1M7DA 3QQ4A 2Z6FA 3O3BA 5KT6A 1R19A 3X3GL 4WHYH 4WY7L 1HL5A 3ISRA 4AVJA 2OMTB 4U1HB 1YC8A 2DQCL 3UBXI 4RMTA 1KJQA 1O7SA 2Y6SC 3L3IB 3D30A 3GSNL 2DWXA 1AO7D 2YXVA 4LCWB 4ODUA 4R4NC 3OB0K 3Q2NA 4GAGL 4FEIA 3GV8B 4BZ2H 1WG3A 4YPGA 3H20A 2F18A 2Y4SA 3HPLB 4QYOB 3HB3D 4HKJB 35C8L 5IOPB 5K5YA 1CYXA 1UB5B 1G7PA 1QD0A 2C1OA 4NJ9L 1NCAL 1R9TA 1YSOA 4TUYF 1Z9SA 1UASA 1QI3A 2HLAA 3NIFB 3C8HA 2TSAA 2UZYB 1VBGA 3BDYH 3LV3B 1E5AA 1TT6A 1IM9A 4OI9A 5TDOA 2Q20A 5FB8B 2E7CA 1Z9MA 2Z92A 5I9QB 3WTTA 5AAMA 3UTZA 2WVSA 4OT1H 1MCKA 4GFXA 4GRWF 4WUKH 3DX6A 3RZCB 3ZW3A 1CIDA 2XICA 1YEGH 2YAFA 3GM0A 4I2XB 5HDOA 3S3PA 2ALWA 5HYJE 1FVDA 5JHBA 1CBVH 4FQXB 5DGQA 5ENWA 2ARJA 4G7YH 2ADFL 3G08B 2HMIC 5LQBH 5C07B 2CDFB 1RZFH 2AMUA 3RG1C 1MIMH 5M94B 4MMYB 2H9GB 3CN1A 4C4BA 2X9YA 2JCCB 4XZ4A 5IB1B 2F5AH 4WKZB 1BVKB 1JGVH 1BWMA 4RFEA 4GC6A 4B3RH 1WWCA 4KRNA 4PJHF 4DCQB 5LGKA 2CO6B 1BP3B 2Q9OA 3CDGA 4UV4H 2J6EL 1AZZC 4F15C 1MLBA 1NCBL 2VYRE 5C0ND 4C56A 5ILTH 3DECA 1NIEA 3NABH 1BGXH 1DJZA 2PCPB 5J6GA 2J21A 2W9EL 2Z7UA 3KCPA 1FQ9C 1IAKA 3H3PL 4RRPA 1EFXA 4NFDA 1SVZA 4FA8A 1BFVL 4AXWB 2E9JA 4QRFA 2GBAA 2IAMC 3PIQB 4LSQH 1FF5A 3IXTB 5HYSG 1JGLL 4F57H 1I3RB 1GHFH 2AGPA 1IFHL 2ZKHL 5EF2A 1IGCL 4J3OD 4F2ME 2LAAA 4L37A 4W9CC 1PD0A 2EILB 4OLWH 5IFAH 2EXYD 2Y5EA 3QA3A 2LW3A 1I1AB 2AMGA 1P5VA 1HEZB 4NZJA 2GLTA 3QDMD 3T5KA 5DK2B 2B9AA 1EEYB 3F84A 4K8RL 4ODHL 3SYQA 2AQSA 1IMHC 2C7FA 3L9EA 3GSNA 2BCKA 2HH0H 1QLEH 1MFNA 3ZO9A 5I1JL 3V4PB 2X0SA 1E28A 2ZDGA 3DV6A 3ORQA 3DGGA 4G5AA 3SDDC 2WJ5A 3QZWG 4OJEH 2V3EA 2AXHA 3DX8B 3EBGA 4TUKH 3VGBA 2ITDA 2Q1EA 4ZODA 1UM4H 1I8UA 5A3IC 1GSAA 4MXVE 1MQ8A 4P2RA 4J9KA 2UUAH 3SPCA 3DGCR 2KBGA 3EH4B 3N9GL 3UPRA 2XTJE 2ZXCA 4OW6A 1KCSH 2WGNB 3BPCB 4HIEB 1F0LA 4E0RB 2DLNA 4LSXA 4DL7A 5GGTA 2AK4D 2COQA 2UZIH 2GCYA 3V0AC 4NQDB 1L6PA 1QLFB 4CU6A 4RIRA 4BFIB 3KLDA 3H7BA 2EH8L 2ZUYA 4H0LC 2J3SA 2IWFA 1N64L 3VACA 2XZAH 1F18A 3NCCB 4YDVB 4H8VA 3G5VB 3H9SE 1NFDE 3VH8B 2AI0L 2ICEC 4PY7B 1OZUA 5IJKC 1K8IA 5DJZB 2WLJA 4MQSB 2FBJL 4ZDHB 3FZUC 1GGOA 1JF5A 4EXKA 3MLPA 2JMRA 4R8WH 1ZT1A 3WS6C 4ZFFB 4RZQA 4DPCX 5KBDA 4PGZA 4HFWA 4WD3A 1MFCH 4D2NA 4Q8EA 4QRAA 4HK0A 2D7QA 3B56A 1YEJL 3RPIB 1OTTD 1MAKA 3D39D 5DJCA 1UACL 2I26N 4JJ5A 1SMDA 5DU7A 5JMRA 3C08L 4D0DB 4FI7A 1UXMA 4S1RH 3F85A 1PKOA 4CMMA 4Z7WE 3PHAA 4JN1H 2EH7H 3KPOA 2VL4A 4R4FH 3FOMA 3PW2A 1XSKA 1CXLA 4PI0A 5AW7B 5BRQA 1DBBH 2K1MA 2QHRH 3UAEA 4TQRA 1I1FB 3RWJA 1X5MA 1FZOB 3IDIB 1UXWB 3KHHA 4CC5A 4NKMA 4XB8A 2N56A 1SXSA 4WJ5B 5DS8A 1DL7L 4JI5H 2EDRA 5LAXB 5F9OH 1BZEA 4Z7VE 5HTSA 4U6PA 1SF3A 4HFUL 2CBTA 1CZ8H 2M83A 3HB9A 4L29A 3F8NA 4P2OD 3SPGA 3T9WA 4PG9A 1ERNA 2WIIB 1CQYA 4U0RB 4F7PA 5FS5A 1RLBA 2FK3A 3N06B 2BPBA 3F62A 2IJ0C 1CDYA 1K4DB 2H32H 1VS0A 4LU5L 2NXYD 2WKOA 3MSPA 4PS4L 5EG6C 3RGVD 4CSZA 1NMCB 5DHVB 1EUTA 1T80A 4BV1A 4BUGA 5I0WA 4J8RB 4ENZA 5A2CA 5GGSB 4HJ1A 4EO5A 3DTXA 1LYQA 1YEFL 1T1XA 3GSXA 3KZ8A 3FQWB 4F7MA 1P2CB 1B3JA 3CBKB 3HZYA 1S0NA 5C3LD 3RFZC 5EC2B 4YDKH 4A7VA 1CFTB 1C12B 3MV11 4CKQA 1TZGH 1DQVA 2VQ1A 3PQYE 4QNPE 2DLEA 2YD2A 3HG0A 1OOAA 1Y1VA 1DQJA 1FORL 1GGIL 2NXZD 3K4ZA 3VFOA 4F8PA 2Z0BA 4MA0A 3LKNA 4EJ1C 1K4CB 4NRZB 3VFUA 1FNLA 2BJML 2P52A 5D7KD 1J0HA 4CL7A 2H1PH 3G6DH 5C44G 3VFRB 3QCTL 3T8XA 4HCGA 4R7XA 1SXCA 4MXVF 4OLYL 5HVHB 5T3XE 3TLRA 4V2CB 5FKAA 3GSVA 2WYOA 5F9WC 1MJ8H 2MOVA 2OSXA 4AZ8A 5INDB 1EHXA 2IH3B 5GS1C 3TEWA 4DP1X 2Q7AA 1NPNA 5F88A 4FABL 5HGHA 1WD8A 3IAQA 1NFDF 1CGVA 1ADWA 3CDCA 4IOIB 3GZQA 1C5DB 4JDTL 5EC1B 3U48A 3WJMB 4ELKB 3IDJA 3TBVB 4DPAX 1PG7L 2W7PA 4PDBA 2IH9A 1MWOA 4YHLL 3BH8B 4DKAA 3MCYA 5F96H 4BIKA 3OKDB 3WLBB 3UQ8A 4K5LA 3A67H 5HYIA 4L8SA 4PP2B 4TPRL 1R33A 3GSQB 3V4SA 3D4GA 5C4XG 5KFFA 1TR7A 3ALXA 2QFPA 3S34L 1ZPLA 2VMDA 4I9WD 4N8UA 5I30L 1AFVL 3WFDL 1OTSC 1J0ZA 4GBXB 2FK1A 3O6FA 4Y5XA 1U3JA 3HNSL 3PHOA 4BK8A 2CGRL 4S2SA 1TEYA 1LEIA 2WM0A 5IB3B 2P80A 5DC2A 2MHAB 1URIA 3ECBA 3ZUNC 4UNUA 3QJQB 2HFGH 3O2VH 4BFBD 1JERA 1NGYB 3O4OB 3FQ2A 1PX3A 3MBWA 3FQNB 4PGBB 1I9IL 4EG0A 3BAXA 3WKQA 1E7VA 3VB8A 5A16B 1KY7A 2VZ1A 5KT3A 4G8GA 2QQQA 4XI5D 3MLZH 2OJZL 4PWJA 4YFLI 3JV5A 1G9MH 1WITA 3ROLB 4BH8A 5IMLA 2NX5D 4H1LB 4IRCA 3WGUB 1EHLH 4LQ1A 2F19H 3K5SA 3X12A 4EBQL 4WHTA 4GG6B 3WNJA 3Q1KA 2KZWA 3G6JA 2C9AA 1ZHLA 3EOYG 4MSWA 5E6RB 3BA9A 1QRKA 1QUNB 1IM9D 4WEMB 3RAQA 4R7NA 2R8KA 1MCPL 4JPKL 1QSFE 3GV7B 2ZAIA 1ACYL 4WUUD 2ZM6H 2WO4A 2BSSB 3EDEA 3L7FB 3ZGHA 4PYGA 2XTSA 3ECUA 3HBQA 1DSWA 3CZKA 2P8PB 3C2SA 4MD4A 1BZ9A 1A4JB 2BW4A 4LMQI 4N2GA 4ODTH 4XZUB 2GPWA 3MWEA 1ZV5A 3Q9PA 2V4RA 1EHAA 1BOGB 2AHIA 3HE7C 1EGJH 3L3DA 4PV1C 3ZR5A 2LTQC 4WI8A 3HR5A 2W8LA 4X0KB 2GB2A 4R26H 5IYZF 2OI9B 4FN0A 2ZNWA 4AITA 1OQOA 1QACA 4PGCA 5HI5C 1H9VA 1U3HD 2E0PA 1BFOB 3EUDA 4QNPF 1OZTG 1GMEA 3FONB 4FG4A 3HI5L 3O4LE 2XC8A 5HHNB 1HILB 2OSYA 2WAHA 4IEFB 1N3NB 3S96A 2KH2B 4ZX3A 3V5KA 1EFXD 2ORBH 1L9OA 2JCWA 4Q7DA 2EIBA 1KEGL 3APMA 4J8QA 2IG2H 2QVIA 5FDYA 4BFNA 2J6SA 3CXDH 5D8JH 3T6XA 3F12A 3UTTA 4PGEA 2DKUA 1L9PA 1NINA 4L48A 3PWJA 1CB4A 2FO4B 2JV6A