1L2ZA

Cd2bp2-gyf domain in complex with proline-rich cd2 tail segment peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
b'DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2 ANTIGEN (CYTOPLASMIC TAIL)-BINDING PROTEIN 2
molecule tags Peptide binding/signaling protein
source organism Homo sapiens
publication title Dynamic interaction of CD2 with the GYF and the SH3 domain of compartmentalized effector molecules
pubmed doi rcsb
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2002-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1l2zA00
1SYXB 3FMAA 1GYFA 3K3VA 4BWSC 1WH2A 1L2ZA
chains in the Genus database with same CATH superfamily
4ZOLF 4ETSA 1KEEA 4Q45A 3JAMW 1ULZA 4JV0A 2R93A 2E5LH 3E5NA 3M9OB 4J9OA 2J6UA 4M7EA 3VPBA 3GV8B 2WYOA 5FLXW 4ECYA 2OH2A 3H0GG 5LOVF 4X66H 1RYRA 2XC9A 4ED1A 5KG4A 4EBCA 2NU7B 4GC6A 5DQIA 3K5HA 2NU8B 3Q8RB 1N33H 3GIMA 1UC8A 3WO0A 4HYKA 1S0NA 2R86A 4DV7H 2X0SA 4QIWA 1TWAA 4DL6A 1WR2A 3SI8A 5D1OB 4HNUA 3GIJA 4TUYF 2Q2TA 2AGPA 4A3LG 3SE7A 1S0OA 4MTDA 1HR0H 4ECZA 2PN1A 4RU9A 3HKZE 1M0WA 2YYAA 3GLKA 3BJYA 4JI8H 3AYHB 5FPOA 5DLFA 2Y0SA 1OWTA 2ZM6H 1S68A 1TWGA 3MWMA 3G6VA 3R5HA 4X62H 2FPPB 3KHHA 3JZIA 5IP7G 3Q1KA 3T1YH 2E2IA 5IT9W 1S03G 4EEQA 3T5LA 2JA5G 5D1PA 2RDJA 2W6PA 4EFEA 1VKZA 4JV1A 5KX5F 4X65H 1HNXH 4RB0A 5C4XG 3GTJA 4JI4H 2HHHH 3GV5B 3UQ8A 5LMUH 2F4VH 4I7HA 2PVPA 3VPDA 4EBEA 1KJJA 3PW2A 2XD4A 3J81W 4J0MA 5LL6b 4EGQA 5FJ8G 4GKKH 1UC9A 3RB6A 4A93G 3PZPA 4J9NA 4U7CA 5IYDG 2AGQA 4MA0A 1S10A 1IBMH 5KFGA 2DLNA 4O4HF 3GTLA 2R8HA 4F4XA 1Y1WG 4DUZH 4QJFA 2V9WA 2VUMG 3JSLA 4QW9A 4UCTA 1WCMA 4DL4A 3I4NG 2CW7A 2FK1A 3N42B 5KFCA 4WBNF 2W7OA 1KJ9A 1BXRA 2DPJA 3G6YA 4QWDA 2GPWA 1TAEA 4ZHQF 3RB3A 3ETJA 4ZQIA 4BWSC 4QWAA 2CKZB 2UU9H 3PW7A 4RZQA 5IWAH 4F4ZA 5LA6F 3K3VA 5GONF 5KFSA 1WSCA 3V6HA 5KFMA 2UUAH 4LF9H 3RV3A 3N43B 3MJFA 4JV2A 3K3PA 4DR7H 2JA8G 1CQJB 1C30A 2QK4A 1SYXB 4UFZA 1AUVA 2YRXA 2FK2A 2ALZA 4EEYA 2JEFA 4KHPH 1M0TA 2R82A 1PX2A 4LSAA 5EWFA 3HBLA 4MV9A 2V5AA 5KFPA 4DR6H 5KFAA 5C1OA 2RGVA 4HNVA 3PW4A 1ZHSA 2CZGA 1T94A 2R7ZG 4O3RA 4E4TA 3KAKA 4UCUA 4TV9F 1KC7A 5HBRB 4LF6H 1BNCA 2W57A 5KFBA 4A3BG 3BA9A 4LFBH 5EOYA 5DQHA 4ED8A 2FLNA 4RNMA 4B3TH 3GTMA 3GIQA 2RF4A 4ECVA 5DG8A 3TINA 4DV4H 3WNZA 3H4BA 4QWCA 1W96A 2P0AA 4AYBA 3HOUG 4GC7A 1RYSA 1KJ8A 1P8LA 2R8IA 4GKJH 3PO2G 2SCUB 2XCPA 5KFHA 5KT3A 4YHHH 5KG5A 4F4WA 3CQZA 2FLLA 3R23A 3Q8PB 2B63A 1K1QA 3VPCA 2VPSA 4MV1A 4DL5A 3MFIA 2C2RA 3KHGA 3OHBA 4GLXA 3F8NA 1GSAA 5KFUA 4LF5H 1FKAH 3Q8QB 2MCTA 3KTMA 4YR0A 3GTOA 3H3VH 1E4EA 5BMVF 3KAJA 4JYAH 3GIIA 1A9XA 4O2AF 4EFBA 2UUBH 4IRCA 3FKIA 3GILA 1ZETA 2VUGA 3LMLA 2I8CA 3QZ8A 4EGJA 2W6ZA 1GLVA 4LF8H 4R8UB 4O2BF 4J9KA 2ZDQA 4I4TF 5LXTF 1A0IA 1EUDB 2I87A 4A3FG 1S9FA 2FMAA 2C35B 1EZ1A 1JKJB 5FLMG 5KT4A 2W9CA 5IP9G 5KT7A 5K2MA 4JI3H 4OX9H 1IOWA 2NU6B 3RAQA 5C5JA 5EDWA 4C5CA 4ECWA 5DG9A 2W71A 1XMQH 2CQYA 2C2EA 5KFQA 4J9MA 1IBKH 3HOVG 4NLGA 4LH6A 2I80A 4YJ3F 2XIGA 1RJQA 3ORQA 4UCRA 1WH2A 3M4IA 2W9BB 1W93A 4XYMB 4QWEA 3BQ2A 3KHRA 3UFXB 4LFCH 1S97A 4RB3C 1E4GT 3HOZG 4DL2A 2UXCH 2PMZE 2ZDHA 4A3GG 4O4IF 4ZI7F 3J80W 4RUCA 2XCAA 1KJQA 3V4SA 4RUAA 1MZBA 1T3NA 4LF7H 2UXBH 2VUMA 3OSPA 3MR2A 3BG5A 4ECXA 3KXYT 5KT2A 2WDTA 3BQ1A 4YQWA 4IR9A 5DLGA 5KFWA 4F4YA 4A3EG 2WAQE 4FBTA 3L2PA 1K83A 1TWCA 4A2BA 2YS6A 1GGOA 5KFNA 2YZNA 4ED6A 4DLKA 3RV4A 1DIKA 2DIKA 3RTXA 2FPIB 3NGDA 4JV5H 4ED3A 4M9UA 5KG1A 2OWOA 2B63G 5KFLA 1N48A 4DV6H 2R8GA 1BJTA 3TIGA 5KFFA 2FK3A 2VQDA 4YR2A 3L4JA 3H0GA 2W6MA 1Y14B 4ECSA 1RJPA 2YS7A 3OUZA 4TQRA 5KFKA 1K1SA 2RDIA 2YZGA 5KG6A 3GQCA 1I6UA 3I4MG 5JUMA 4NXNH 4MV4A 1L2ZA 5KFOA 4DL7A 3J7AK 5EZYF 2R8KA 2HVQA 3TQ1A 2GLTA 4G3IA 1XDNA 3OSNA 2AQ4A 4Y8VB 1VBHA 1AUXA 3G8CA 4Q0YA 1Z2NX 2W8LA 3GTKA 2HGSA 5KFXA 5EWEA 5L1IA 4IWYA 4J9LA 4C2MA 4JI7H 4APMA 4JI6H 5F9LA 4XYLB 4Q43A 3GIKA 3H4DA 4BXXG 2UUCH 2R7MA 4HR7A 2JEIA 2E2HA 2PBZA 3PW5A 4TQSA 5BPFA 2BQ3A 2FB9A 2YZMA 3IN5A 3GTQA 5IYCG 4LH7A 5LP6F 4RNNA 4EYIB 2RGRA 1T36A 4HNTA 1AN7A 3TIIA 4JI0H 4A3JG 3HOXG 3KHLA 4FBUA 4J9SA 5F9NA 3RGXA 3EYYA 3M9NB 4JI2H 4B3SH 4MV3A 5DQGA 4LSXA 4DV3H 3OTOH 5KFVA 2VR1A 1O75A 5LYJF 4IWXA 5KFRA 2R7LA 5KFDA 2BQUA 4Q8FA 5L1KA 1BGWA 1HNWH 5C1PA 2M05A 3M9MB 2WTFA 2JA6A 4JUZA 1Z2OX 4BBRG 5JH7F 4PDBA 2FPGB 3IG0A 3GTGA 3GIPA 2DPIA 5FPRA 4YP3A 5KFEA 1XNQH 3Q2OA 2V59A 3BQ0A 3LWBA 1R9TA 2O03A 4A2AA 1RK5A 1I7LA 3HB9A 1N56A 4B3RH 1SCUB 4ECTA 4EG0A 4DV2H 3TQTA 5J2TF 2OLSA 1I7NA 2W6NA 3N40P 1CS0A 3QFFA 4TV8F 2YCHA 3H20A 1KBLA 1KJIA 4EBDA 1M7JA 4A3KG 3N8DA 1X9NA 2YW2A 3FMAA 4DR4H 4MV8A 3PR5B 1EUCB 5KG3A 2UVUA 2UVWA 4I55F 4J9QA 2R92A 2FE3A 4FS2A 4CC5A 4FM9A 3RB0A 2HJWA 3MR5A 4BBSG 2R87A 3HOWG 3LP8A 1V9PA 5HV6A 3GV7B 3BAAA 2W9BA 2ASLA 4ED0A 1C3OA 1S0MA 4QIWE 4RAYA 5CAEB 4DR3H 3RBEA 4DV5H 4MV7A 3H40A 4AQYH 1B33N 1CE8A 1EHIA 4X64H 1J5EH 1JX4A 4JI1H 3PN1A 2IBKA 1DV2A 4DV1H 2ASDA 1N36H 5FD6A 2W6OA 1B04A 2V58A 4LF4H 5C8YF 3RFCA 2BR0A 1ZHQA 1EYZA 4UCOA 4LFAH 1GSHA 4L1KA 1SFOA 5A2QW 4R8UA 5L1LA 1Z2PX 2R93G 2VA3A 2W70A 3HKZA 2R8JA 4DL3A 2UVRA 3I12A 2IA6A 3VMMA 1HNZH 2DWCA 1N34H 5KT6A 2AU0A 4IRKA 1Y1WA 4O3PA 2FP4B 4DUYH 4O3SA 2WAQA 1I94H 1E4EB 1E4FT 2W6QA 1GO3E 3N41B 4YJ2F 4U6PA 4MA5A 4O3OA 3Q8SB 4XZ3B 1SEIA 3L4KA 1TWHA 2YRWA 1I50A 2C2DA 3N44B 3BABA 4MTEA 4RNOA 3CVZA 3OUUA 2HVSA 4EYHB 2NVXA 3HXLA 3WO1A 2C28A 4XX0B 3RGZA 4FS1A 2W9AA 2FJZA 3JRWA 3KALA 4ME6A 2FKLA 2NU9B 3RF2A 5BPHA 2J6SA 2JA6G 2FLPA 1N32H 5KFJA 5EWGA 5JVLA 5KFIA 1M6VA 3HOYG 2BQRA 4C5BA 4YB8B 4QWBA 5L9XA 4K0KH 2R7ZA 1CQIB 5CB4F 1FJGH 4DR2H 4O3QA 2Q2UA 4DV0H 1GYFA 2ZJTA 4RB2C 5IYBG 1FVIA 2PMZA 3JRXA 4ED7A 4RZRA 1JDBB 3MR3A 3RJ0A 3U9TA 2VPQA 2W8KA 4Q44A 2C22A 4DR1H 5DG7A 1RJRA 3G6XA 3EPIA 4F50A 2R6FA 4RAZA 1UNNC 4UCSA 1V51A 3GTPA 5T14A 4J9RA 5KFYA 2ASJA 3RUPA 2IMWP 3MWDA 3R5FA 5JQWA 1TWFA 3T1HH 3FDSA 5C44G 1DGSA 5DGBA 4CC6A 3RAXA 4HQ6A 4Q8EA 2QYZA 1B6SA 1ZQ7A 2GPSA 5IYZF 5L1JA 3T5HA 4IR1A 1VAJA 2V4QA 3DF7A 2IP4A 2VA2A 5KG7A 4ED2A 5KFTA 2HVRA 2CW8A 1TA8A 5BR8H 4BY7G 5D8DA 2XCLA 1JIHA 5FD5A 3GIDA 1VS0A 5KG0A 3V6KA 4DR5H 2JEGA 4A3MG 1XMOH 4QW8A 2R7KA 2Y0SE 4WD3A 2ATLA 1XNRH 3MFHA 1GSOA 2R84A 4R7RA 3PO3G 1WCMG 2NVYA 4ECRA 2VQEH 3OHAA 4I50F 2AGOA 3BA8A 4J9PA 4NXMH 1VBGA 4O4LF 4UCVA 4BY1G 2UVVA 4MAMA 2J9GA 5JVDF 3RBDA 4O3NA 3RB4A 3R5XA 3QZ7A 1B6RA 2V4RA 4YR3A 4ECQA 3V4ZA 2R7NA 1DV1A 5C3EG 1JXLA 4MV6A 4LMYA 1PK8A 2WE6A 4IAJA 1Y1VG 4YAJB 3ORRA 5J2UF 2J6TA 4IZOA 3C0FB 5H80A 3K5IA 3MR6A 1IOVA 1JDEA 4IRDA 4PWQA 2WB1A 5CA1F 2YL2A 2JA7A 1V4YA 3N6XA 4YY3H 2WB1E 1Y1VA 2C00A 4IHJF 5KG2A 3PR4A 3PVXA 4FU0A 2UXDH 3MWEA 2ZDGA 1RK6A 3RIZA 3JSNA 5LMNH 3V6JA 4A3IG 5KKNB 2R85A 4AYBE 3U9SA 4A3DG 5D1OA 2DZDA 4ECUA 2YU9A 3T5KA 2W9CB 2NUAB 4RB1A 5DGAA 1IBLH 2JEJA 4YBZB 2VOBA 2VQFH 4B3MH 3ETHA 4C5AA 2KSWA 5KT5A 2JA7G 5I47A 3PW0A 4YAKB 2R92G 5KFZA 2W7PA 3FKIG 1I3QA 3EPGA 4A3CG 3T5JA 4JI5H 2JA5A 2XGQA 1JLLB 2XGPA 5CA0F
chains in the Genus database with same CATH topology
2UUCH 4ETSA 4LF6H 2W57A 3BA9A 4LFBH 5EOYA 4B3TH 3JAMW 2E5LH 1FJGH 4DR2H 4DV4H 4M7EA 4LH7A 2WYOA 5FLXW 2Q2UA 2RGRA 4DV0H 1GYFA 2ZJTA 1AN7A 4RB2C 4JI0H 4X66H 1FVIA 4GKJH 1P8LA 3RJ0A 4YHHH 3RGXA 1N33H 3EYYA 4JI2H 4B3SH 4DV7H 4LSXA 2VPSA 4DV3H 4DR1H 3OTOH 1O75A 5D1OB 4GLXA 3F8NA 4LF5H 1FKAH 2MCTA 2Q2TA 4RAZA 4UCSA 1BGWA 1HNWH 1HR0H 4MTDA 3KAJA 4JYAH 4EFBA 3T1HH 2UUBH 1M0WA 1DGSA 4PDBA 1Z2OX 2VUGA 3LMLA 4CC6A 3IG0A 5FPOA 4JI8H 1XNQH 5FPRA 4UCUA 2ZM6H 1S68A 3MWMA 4LF8H 3DF7A 2O03A 4A2AA 4X62H 1A0IA 2HVRA 2CW8A 1TA8A 5BR8H 3T1YH 5IT9W 4B3RH 4DV2H 1S03G 4EEQA 4JI3H 4OX9H 3N40P 5FD5A 1VS0A 4DR5H 2YCHA 3H20A 5D1PA 4EFEA 1XMOH 4X65H 1HNXH 1X9NA 1XMQH 1IBKH 3FMAA 4RB0A 1XNRH 4R7RA 4DR4H 4LH6A 2HHHH 4JI4H 2XIGA 4UCRA 3M4IA 1WH2A 2VQEH 3UQ8A 5LMUH 2F4VH 3BA8A 4I7HA 4LFCH 4NXMH 4RB3C 1E4GT 2FE3A 4CC5A 4J0MA 3J81W 5LL6b 4UCVA 4FM9A 2UXCH 4GKKH 3J80W 1V9PA 1MZBA 4LF7H 3BAAA 2UXBH 1IBMH 4RAYA 3KXYT 2WDTA 4DR3H 4DV5H 4MV7A 4K0KH 4DUZH 4AQYH 4X64H 1J5EH 4JI1H 3L2PA 3PN1A 3JSLA 4A2BA 4DV1H 4UCTA 1N36H 5FD6A 2CW7A 1B04A 4LF4H 3N42B 1ZHQA 4LMYA 2WE6A 4UCOA 4IAJA 4LFAH 3RTXA 5A2QW 4JV5H 3C0FB 1TAEA 1Z2PX 2OWOA 4BWSC 4DV6H 2UU9H 1BJTA 3N6XA 4RZQA 4YY3H 5IWAH 3L4JA 3K3VA 1HNZH 4LF9H 2UXDH 1N34H 2UUAH 3RIZA 4DUYH 3JSNA 5LMNH 1I94H 3N43B 1E4FT 1I6UA 3N41B 3L4KA 4DR7H 1SEIA 4NXNH 1L2ZA 5D1OA 1SYXB 3J7AK 3N44B 2HVQA 3BABA 4MTEA 4UFZA 3CVZA 1XDNA 4KHPH 4RB1A 1IBLH 2HVSA 4B3MH 2VQFH 1M0TA 2VOBA 3HXLA 2KSWA 3RGZA 4LSAA 4Q0YA 4MV9A 1Z2NX 3KALA 4DR6H 3RF2A 2HGSA 2RGVA 1N32H 1ZHSA 4JI5H 4JI7H 3KAKA 4APMA 4JI6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYX B;  3FMA A;  1GYF A;  3K3V A;  4BWS C;  1WH2 A;  1L2Z A; 
#chains in the Genus database with same CATH topology
 4ZOL F;  4ETS A;  1KEE A;  4Q45 A;  3JAM W;  1ULZ A;  4JV0 A;  2R93 A;  2E5L H;  3E5N A;  3M9O B;  4J9O A;  2J6U A;  4M7E A;  3VPB A;  3GV8 B;  2WYO A;  5FLX W;  4ECY A;  2OH2 A;  3H0G G;  5LOV F;  4X66 H;  1RYR A;  2XC9 A;  4ED1 A;  5KG4 A;  4EBC A;  2NU7 B;  4GC6 A;  5DQI A;  3K5H A;  2NU8 B;  3Q8R B;  1N33 H;  3GIM A;  1UC8 A;  3WO0 A;  4HYK A;  1S0N A;  2R86 A;  4DV7 H;  2X0S A;  4QIW A;  1TWA A;  4DL6 A;  1WR2 A;  3SI8 A;  5D1O B;  4HNU A;  3GIJ A;  4TUY F;  2Q2T A;  2AGP A;  4A3L G;  3SE7 A;  1S0O A;  4MTD A;  1HR0 H;  4ECZ A;  2PN1 A;  4RU9 A;  3HKZ E;  1M0W A;  2YYA A;  3GLK A;  3BJY A;  4JI8 H;  3AYH B;  5FPO A;  5DLF A;  2Y0S A;  1OWT A;  2ZM6 H;  1S68 A;  1TWG A;  3MWM A;  3G6V A;  3R5H A;  4X62 H;  2FPP B;  3KHH A;  3JZI A;  5IP7 G;  3Q1K A;  3T1Y H;  2E2I A;  5IT9 W;  1S03 G;  4EEQ A;  3T5L A;  2JA5 G;  5D1P A;  2RDJ A;  2W6P A;  4EFE A;  1VKZ A;  4JV1 A;  5KX5 F;  4X65 H;  1HNX H;  4RB0 A;  5C4X G;  3GTJ A;  4JI4 H;  2HHH H;  3GV5 B;  3UQ8 A;  5LMU H;  2F4V H;  4I7H A;  2PVP A;  3VPD A;  4EBE A;  1KJJ A;  3PW2 A;  2XD4 A;  3J81 W;  4J0M A;  5LL6 b;  4EGQ A;  5FJ8 G;  4GKK H;  1UC9 A;  3RB6 A;  4A93 G;  3PZP A;  4J9N A;  4U7C A;  5IYD G;  2AGQ A;  4MA0 A;  1S10 A;  1IBM H;  5KFG A;  2DLN A;  4O4H F;  3GTL A;  2R8H A;  4F4X A;  1Y1W G;  4DUZ H;  4QJF A;  2V9W A;  2VUM G;  3JSL A;  4QW9 A;  4UCT A;  1WCM A;  4DL4 A;  3I4N G;  2CW7 A;  2FK1 A;  3N42 B;  5KFC A;  4WBN F;  2W7O A;  1KJ9 A;  1BXR A;  2DPJ A;  3G6Y A;  4QWD A;  2GPW A;  1TAE A;  4ZHQ F;  3RB3 A;  3ETJ A;  4ZQI A;  4BWS C;  4QWA A;  2CKZ B;  2UU9 H;  3PW7 A;  4RZQ A;  5IWA H;  4F4Z A;  5LA6 F;  3K3V A;  5GON F;  5KFS A;  1WSC A;  3V6H A;  5KFM A;  2UUA H;  4LF9 H;  3RV3 A;  3N43 B;  3MJF A;  4JV2 A;  3K3P A;  4DR7 H;  2JA8 G;  1CQJ B;  1C30 A;  2QK4 A;  1SYX B;  4UFZ A;  1AUV A;  2YRX A;  2FK2 A;  2ALZ A;  4EEY A;  2JEF A;  4KHP H;  1M0T A;  2R82 A;  1PX2 A;  4LSA A;  5EWF A;  3HBL A;  4MV9 A;  2V5A A;  5KFP A;  4DR6 H;  5KFA A;  5C1O A;  2RGV A;  4HNV A;  3PW4 A;  1ZHS A;  2CZG A;  1T94 A;  2R7Z G;  4O3R A;  4E4T A;  3KAK A;  4UCU A;  4TV9 F;  1KC7 A;  5HBR B;  4LF6 H;  1BNC A;  2W57 A;  5KFB A;  4A3B G;  3BA9 A;  4LFB H;  5EOY A;  5DQH A;  4ED8 A;  2FLN A;  4RNM A;  4B3T H;  3GTM A;  3GIQ A;  2RF4 A;  4ECV A;  5DG8 A;  3TIN A;  4DV4 H;  3WNZ A;  3H4B A;  4QWC A;  1W96 A;  2P0A A;  4AYB A;  3HOU G;  4GC7 A;  1RYS A;  1KJ8 A;  1P8L A;  2R8I A;  4GKJ H;  3PO2 G;  2SCU B;  2XCP A;  5KFH A;  5KT3 A;  4YHH H;  5KG5 A;  4F4W A;  3CQZ A;  2FLL A;  3R23 A;  3Q8P B;  2B63 A;  1K1Q A;  3VPC A;  2VPS A;  4MV1 A;  4DL5 A;  3MFI A;  2C2R A;  3KHG A;  3OHB A;  4GLX A;  3F8N A;  1GSA A;  5KFU A;  4LF5 H;  1FKA H;  3Q8Q B;  2MCT A;  3KTM A;  4YR0 A;  3GTO A;  3H3V H;  1E4E A;  5BMV F;  3KAJ A;  4JYA H;  3GII A;  1A9X A;  4O2A F;  4EFB A;  2UUB H;  4IRC A;  3FKI A;  3GIL A;  1ZET A;  2VUG A;  3LML A;  2I8C A;  3QZ8 A;  4EGJ A;  2W6Z A;  1GLV A;  4LF8 H;  4R8U B;  4O2B F;  4J9K A;  2ZDQ A;  4I4T F;  5LXT F;  1A0I A;  1EUD B;  2I87 A;  4A3F G;  1S9F A;  2FMA A;  2C35 B;  1EZ1 A;  1JKJ B;  5FLM G;  5KT4 A;  2W9C A;  5IP9 G;  5KT7 A;  5K2M A;  4JI3 H;  4OX9 H;  1IOW A;  2NU6 B;  3RAQ A;  5C5J A;  5EDW A;  4C5C A;  4ECW A;  5DG9 A;  2W71 A;  1XMQ H;  2CQY A;  2C2E A;  5KFQ A;  4J9M A;  1IBK H;  3HOV G;  4NLG A;  4LH6 A;  2I80 A;  4YJ3 F;  2XIG A;  1RJQ A;  3ORQ A;  4UCR A;  1WH2 A;  3M4I A;  2W9B B;  1W93 A;  4XYM B;  4QWE A;  3BQ2 A;  3KHR A;  3UFX B;  4LFC H;  1S97 A;  4RB3 C;  1E4G T;  3HOZ G;  4DL2 A;  2UXC H;  2PMZ E;  2ZDH A;  4A3G G;  4O4I F;  4ZI7 F;  3J80 W;  4RUC A;  2XCA A;  1KJQ A;  3V4S A;  4RUA A;  1MZB A;  1T3N A;  4LF7 H;  2UXB H;  2VUM A;  3OSP A;  3MR2 A;  3BG5 A;  4ECX A;  3KXY T;  5KT2 A;  2WDT A;  3BQ1 A;  4YQW A;  4IR9 A;  5DLG A;  5KFW A;  4F4Y A;  4A3E G;  2WAQ E;  4FBT A;  3L2P A;  1K83 A;  1TWC A;  4A2B A;  2YS6 A;  1GGO A;  5KFN A;  2YZN A;  4ED6 A;  4DLK A;  3RV4 A;  1DIK A;  2DIK A;  3RTX A;  2FPI B;  3NGD A;  4JV5 H;  4ED3 A;  4M9U A;  5KG1 A;  2OWO A;  2B63 G;  5KFL A;  1N48 A;  4DV6 H;  2R8G A;  1BJT A;  3TIG A;  5KFF A;  2FK3 A;  2VQD A;  4YR2 A;  3L4J A;  3H0G A;  2W6M A;  1Y14 B;  4ECS A;  1RJP A;  2YS7 A;  3OUZ A;  4TQR A;  5KFK A;  1K1S A;  2RDI A;  2YZG A;  5KG6 A;  3GQC A;  1I6U A;  3I4M G;  5JUM A;  4NXN H;  4MV4 A;  1L2Z A;  5KFO A;  4DL7 A;  3J7A K;  5EZY F;  2R8K A;  2HVQ A;  3TQ1 A;  2GLT A;  4G3I A;  1XDN A;  3OSN A;  2AQ4 A;  4Y8V B;  1VBH A;  1AUX A;  3G8C A;  4Q0Y A;  1Z2N X;  2W8L A;  3GTK A;  2HGS A;  5KFX A;  5EWE A;  5L1I A;  4IWY A;  4J9L A;  4C2M A;  4JI7 H;  4APM A;  4JI6 H;  5F9L A;  4XYL B;  4Q43 A;  3GIK A;  3H4D A;  4BXX G;  2UUC H;  2R7M A;  4HR7 A;  2JEI A;  2E2H A;  2PBZ A;  3PW5 A;  4TQS A;  5BPF A;  2BQ3 A;  2FB9 A;  2YZM A;  3IN5 A;  3GTQ A;  5IYC G;  4LH7 A;  5LP6 F;  4RNN A;  4EYI B;  2RGR A;  1T36 A;  4HNT A;  1AN7 A;  3TII A;  4JI0 H;  4A3J G;  3HOX G;  3KHL A;  4FBU A;  4J9S A;  5F9N A;  3RGX A;  3EYY A;  3M9N B;  4JI2 H;  4B3S H;  4MV3 A;  5DQG A;  4LSX A;  4DV3 H;  3OTO H;  5KFV A;  2VR1 A;  1O75 A;  5LYJ F;  4IWX A;  5KFR A;  2R7L A;  5KFD A;  2BQU A;  4Q8F A;  5L1K A;  1BGW A;  1HNW H;  5C1P A;  2M05 A;  3M9M B;  2WTF A;  2JA6 A;  4JUZ A;  1Z2O X;  4BBR G;  5JH7 F;  4PDB A;  2FPG B;  3IG0 A;  3GTG A;  3GIP A;  2DPI A;  5FPR A;  4YP3 A;  5KFE A;  1XNQ H;  3Q2O A;  2V59 A;  3BQ0 A;  3LWB A;  1R9T A;  2O03 A;  4A2A A;  1RK5 A;  1I7L A;  3HB9 A;  1N56 A;  4B3R H;  1SCU B;  4ECT A;  4EG0 A;  4DV2 H;  3TQT A;  5J2T F;  2OLS A;  1I7N A;  2W6N A;  3N40 P;  1CS0 A;  3QFF A;  4TV8 F;  2YCH A;  3H20 A;  1KBL A;  1KJI A;  4EBD A;  1M7J A;  4A3K G;  3N8D A;  1X9N A;  2YW2 A;  3FMA A;  4DR4 H;  4MV8 A;  3PR5 B;  1EUC B;  5KG3 A;  2UVU A;  2UVW A;  4I55 F;  4J9Q A;  2R92 A;  2FE3 A;  4FS2 A;  4CC5 A;  4FM9 A;  3RB0 A;  2HJW A;  3MR5 A;  4BBS G;  2R87 A;  3HOW G;  3LP8 A;  1V9P A;  5HV6 A;  3GV7 B;  3BAA A;  2W9B A;  2ASL A;  4ED0 A;  1C3O A;  1S0M A;  4QIW E;  4RAY A;  5CAE B;  4DR3 H;  3RBE A;  4DV5 H;  4MV7 A;  3H40 A;  4AQY H;  1B33 N;  1CE8 A;  1EHI A;  4X64 H;  1J5E H;  1JX4 A;  4JI1 H;  3PN1 A;  2IBK A;  1DV2 A;  4DV1 H;  2ASD A;  1N36 H;  5FD6 A;  2W6O A;  1B04 A;  2V58 A;  4LF4 H;  5C8Y F;  3RFC A;  2BR0 A;  1ZHQ A;  1EYZ A;  4UCO A;  4LFA H;  1GSH A;  4L1K A;  1SFO A;  5A2Q W;  4R8U A;  5L1L A;  1Z2P X;  2R93 G;  2VA3 A;  2W70 A;  3HKZ A;  2R8J A;  4DL3 A;  2UVR A;  3I12 A;  2IA6 A;  3VMM A;  1HNZ H;  2DWC A;  1N34 H;  5KT6 A;  2AU0 A;  4IRK A;  1Y1W A;  4O3P A;  2FP4 B;  4DUY H;  4O3S A;  2WAQ A;  1I94 H;  1E4E B;  1E4F T;  2W6Q A;  1GO3 E;  3N41 B;  4YJ2 F;  4U6P A;  4MA5 A;  4O3O A;  3Q8S B;  4XZ3 B;  1SEI A;  3L4K A;  1TWH A;  2YRW A;  1I50 A;  2C2D A;  3N44 B;  3BAB A;  4MTE A;  4RNO A;  3CVZ A;  3OUU A;  2HVS A;  4EYH B;  2NVX A;  3HXL A;  3WO1 A;  2C28 A;  4XX0 B;  3RGZ A;  4FS1 A;  2W9A A;  2FJZ A;  3JRW A;  3KAL A;  4ME6 A;  2FKL A;  2NU9 B;  3RF2 A;  5BPH A;  2J6S A;  2JA6 G;  2FLP A;  1N32 H;  5KFJ A;  5EWG A;  5JVL A;  5KFI A;  1M6V A;  3HOY G;  2BQR A;  4C5B A;  4YB8 B;  4QWB A;  5L9X A;  4K0K H;  2R7Z A;  1CQI B;  5CB4 F;  1FJG H;  4DR2 H;  4O3Q A;  2Q2U A;  4DV0 H;  1GYF A;  2ZJT A;  4RB2 C;  5IYB G;  1FVI A;  2PMZ A;  3JRX A;  4ED7 A;  4RZR A;  1JDB B;  3MR3 A;  3RJ0 A;  3U9T A;  2VPQ A;  2W8K A;  4Q44 A;  2C22 A;  4DR1 H;  5DG7 A;  1RJR A;  3G6X A;  3EPI A;  4F50 A;  2R6F A;  4RAZ A;  1UNN C;  4UCS A;  1V51 A;  3GTP A;  5T14 A;  4J9R A;  5KFY A;  2ASJ A;  3RUP A;  2IMW P;  3MWD A;  3R5F A;  5JQW A;  1TWF A;  3T1H H;  3FDS A;  5C44 G;  1DGS A;  5DGB A;  4CC6 A;  3RAX A;  4HQ6 A;  4Q8E A;  2QYZ A;  1B6S A;  1ZQ7 A;  2GPS A;  5IYZ F;  5L1J A;  3T5H A;  4IR1 A;  1VAJ A;  2V4Q A;  3DF7 A;  2IP4 A;  2VA2 A;  5KG7 A;  4ED2 A;  5KFT A;  2HVR A;  2CW8 A;  1TA8 A;  5BR8 H;  4BY7 G;  5D8D A;  2XCL A;  1JIH A;  5FD5 A;  3GID A;  1VS0 A;  5KG0 A;  3V6K A;  4DR5 H;  2JEG A;  4A3M G;  1XMO H;  4QW8 A;  2R7K A;  2Y0S E;  4WD3 A;  2ATL A;  1XNR H;  3MFH A;  1GSO A;  2R84 A;  4R7R A;  3PO3 G;  1WCM G;  2NVY A;  4ECR A;  2VQE H;  3OHA A;  4I50 F;  2AGO A;  3BA8 A;  4J9P A;  4NXM H;  1VBG A;  4O4L F;  4UCV A;  4BY1 G;  2UVV A;  4MAM A;  2J9G A;  5JVD F;  3RBD A;  4O3N A;  3RB4 A;  3R5X A;  3QZ7 A;  1B6R A;  2V4R A;  4YR3 A;  4ECQ A;  3V4Z A;  2R7N A;  1DV1 A;  5C3E G;  1JXL A;  4MV6 A;  4LMY A;  1PK8 A;  2WE6 A;  4IAJ A;  1Y1V G;  4YAJ B;  3ORR A;  5J2U F;  2J6T A;  4IZO A;  3C0F B;  5H80 A;  3K5I A;  3MR6 A;  1IOV A;  1JDE A;  4IRD A;  4PWQ A;  2WB1 A;  5CA1 F;  2YL2 A;  2JA7 A;  1V4Y A;  3N6X A;  4YY3 H;  2WB1 E;  1Y1V A;  2C00 A;  4IHJ F;  5KG2 A;  3PR4 A;  3PVX A;  4FU0 A;  2UXD H;  3MWE A;  2ZDG A;  1RK6 A;  3RIZ A;  3JSN A;  5LMN H;  3V6J A;  4A3I G;  5KKN B;  2R85 A;  4AYB E;  3U9S A;  4A3D G;  5D1O A;  2DZD A;  4ECU A;  2YU9 A;  3T5K A;  2W9C B;  2NUA B;  4RB1 A;  5DGA A;  1IBL H;  2JEJ A;  4YBZ B;  2VOB A;  2VQF H;  4B3M H;  3ETH A;  4C5A A;  2KSW A;  5KT5 A;  2JA7 G;  5I47 A;  3PW0 A;  4YAK B;  2R92 G;  5KFZ A;  2W7P A;  3FKI G;  1I3Q A;  3EPG A;  4A3C G;  3T5J A;  4JI5 H;  2JA5 A;  2XGQ A;  1JLL B;  2XGP A;  5CA0 F; 
#chains in the Genus database with same CATH homology
 2UUC H;  4ETS A;  4LF6 H;  2W57 A;  3BA9 A;  4LFB H;  5EOY A;  4B3T H;  3JAM W;  2E5L H;  1FJG H;  4DR2 H;  4DV4 H;  4M7E A;  4LH7 A;  2WYO A;  5FLX W;  2Q2U A;  2RGR A;  4DV0 H;  1GYF A;  2ZJT A;  1AN7 A;  4RB2 C;  4JI0 H;  4X66 H;  1FVI A;  4GKJ H;  1P8L A;  3RJ0 A;  4YHH H;  3RGX A;  1N33 H;  3EYY A;  4JI2 H;  4B3S H;  4DV7 H;  4LSX A;  2VPS A;  4DV3 H;  4DR1 H;  3OTO H;  1O75 A;  5D1O B;  4GLX A;  3F8N A;  4LF5 H;  1FKA H;  2MCT A;  2Q2T A;  4RAZ A;  4UCS A;  1BGW A;  1HNW H;  1HR0 H;  4MTD A;  3KAJ A;  4JYA H;  4EFB A;  3T1H H;  2UUB H;  1M0W A;  1DGS A;  4PDB A;  1Z2O X;  2VUG A;  3LML A;  4CC6 A;  3IG0 A;  5FPO A;  4JI8 H;  1XNQ H;  5FPR A;  4UCU A;  2ZM6 H;  1S68 A;  3MWM A;  4LF8 H;  3DF7 A;  2O03 A;  4A2A A;  4X62 H;  1A0I A;  2HVR A;  2CW8 A;  1TA8 A;  5BR8 H;  3T1Y H;  5IT9 W;  4B3R H;  4DV2 H;  1S03 G;  4EEQ A;  4JI3 H;  4OX9 H;  3N40 P;  5FD5 A;  1VS0 A;  4DR5 H;  2YCH A;  3H20 A;  5D1P A;  4EFE A;  1XMO H;  4X65 H;  1HNX H;  1X9N A;  1XMQ H;  1IBK H;  3FMA A;  4RB0 A;  1XNR H;  4R7R A;  4DR4 H;  4LH6 A;  2HHH H;  4JI4 H;  2XIG A;  4UCR A;  3M4I A;  1WH2 A;  2VQE H;  3UQ8 A;  5LMU H;  2F4V H;  3BA8 A;  4I7H A;  4LFC H;  4NXM H;  4RB3 C;  1E4G T;  2FE3 A;  4CC5 A;  4J0M A;  3J81 W;  5LL6 b;  4UCV A;  4FM9 A;  2UXC H;  4GKK H;  3J80 W;  1V9P A;  1MZB A;  4LF7 H;  3BAA A;  2UXB H;  1IBM H;  4RAY A;  3KXY T;  2WDT A;  4DR3 H;  4DV5 H;  4MV7 A;  4K0K H;  4DUZ H;  4AQY H;  4X64 H;  1J5E H;  4JI1 H;  3L2P A;  3PN1 A;  3JSL A;  4A2B A;  4DV1 H;  4UCT A;  1N36 H;  5FD6 A;  2CW7 A;  1B04 A;  4LF4 H;  3N42 B;  1ZHQ A;  4LMY A;  2WE6 A;  4UCO A;  4IAJ A;  4LFA H;  3RTX A;  5A2Q W;  4JV5 H;  3C0F B;  1TAE A;  1Z2P X;  2OWO A;  4BWS C;  4DV6 H;  2UU9 H;  1BJT A;  3N6X A;  4RZQ A;  4YY3 H;  5IWA H;  3L4J A;  3K3V A;  1HNZ H;  4LF9 H;  2UXD H;  1N34 H;  2UUA H;  3RIZ A;  4DUY H;  3JSN A;  5LMN H;  1I94 H;  3N43 B;  1E4F T;  1I6U A;  3N41 B;  3L4K A;  4DR7 H;  1SEI A;  4NXN H;  1L2Z A;  5D1O A;  1SYX B;  3J7A K;  3N44 B;  2HVQ A;  3BAB A;  4MTE A;  4UFZ A;  3CVZ A;  1XDN A;  4KHP H;  4RB1 A;  1IBL H;  2HVS A;  4B3M H;  2VQF H;  1M0T A;  2VOB A;  3HXL A;  2KSW A;  3RGZ A;  4LSA A;  4Q0Y A;  4MV9 A;  1Z2N X;  3KAL A;  4DR6 H;  3RF2 A;  2HGS A;  2RGV A;  1N32 H;  1ZHS A;  4JI5 H;  4JI7 H;  3KAK A;  4APM A;  4JI6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...