1L2ZA

Cd2bp2-gyf domain in complex with proline-rich cd2 tail segment peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2 ANTIGEN (CYTOPLASMIC TAIL)-BINDING PROTEIN 2
publication title Dynamic interaction of CD2 with the GYF and the SH3 domain of compartmentalized effector molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding/signaling protein
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2002-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1l2zA00
1L2ZA 4BWSC 1GYFA 3FMAA 1SYXB 3K3VA 1WH2A
chains in the Genus database with same CATH superfamily
3T5HA 2YL2A 1KEEA 2VQFH 5KFQA 1DV2A 2ZDGA 4LFAH 4DR2H 3TQ1A 1N32H 2RGRA 3RTXA 3JSLA 4A2AA 4BWSC 4I50F 2UXDH 2NU8B 2R87A 4YJ2F 3J81W 2HHHH 1FJGH 2RDJA 4UCTA 4EGQA 2DZDA 2YYAA 3RBEA 1E4EB 1SCUB 1S0MA 4DV0H 4BBSG 2UUAH 1XNQH 3GTLA 4IRKA 2C2DA 1SFOA 5KFGA 4O4HF 4ED6A 4IR9A 2VUGA 5IYDG 4J9NA 3V6JA 5BMVF 2JA7G 2V9WA 2FP4B 3RFCA 3KXYT 1T94A 1A0IA 4AYBA 5J2UF 5KFMA 5KFAA 5K2MA 3PW7A 2YU9A 3JZIA 4B3RH 3DF7A 4M9UA 5KG6A 3M9OB 4ED0A 3UFXB 4A3EG 5KFBA 3BJYA 2ASDA 1HNXH 1IBLH 2GPSA 1UNNC 5LMUH 5DLGA 1DGSA 4MV1A 5LXTF 4A3FG 1VS0A 4IRCA 4JI8H 1RJQA 4X64H 3LWBA 1I7LA 4GKJH 1ZQ7A 4LH6A 5KFYA 3TINA 1Y1WG 5L1IA 4JV0A 4UCRA 1R9TA 4IRDA 4DR3H 4JI3H 5IYCG 4FM9A 5LP6F 1EUCB 3E5NA 2AQ4A 2IBKA 3GIKA 2R6FA 1RK5A 2ZDQA 2Q2TA 1XDNA 5LA6F 1HR0H 1WR2A 1JLLB 4R8UB 1KJJA 4HYKA 2AGPA 1K1QA 3VMMA 4AYBE 3KTMA 3G8CA 4LH7A 2NU6B 5FD6A 3RV4A 4DV4H 2JEGA 4GC7A 4JV1A 4I7HA 2DWCA 4HNUA 1I3QA 5I47A 5KT5A 4DLKA 5KX5F 5EWEA 3J80W 4DL6A 4RAYA 2R8GA 4O3SA 4HNTA 5DLFA 4DR4H 1WH2A 2FB9A 4WD3A 3CVZA 1B6SA 3RBDA 3OUZA 5KFXA 3L4KA 3Q1KA 4XX0B 5DGBA 4QIWA 4F4YA 2PVPA 5KT6A 2C2EA 1IBMH 3KHHA 2O03A 2QYZA 3OSPA 1M0TA 4G3IA 4JUZA 3L2PA 4A3CG 4TUYF 2WDTA 1T3NA 2HVRA 2RDIA 3OHAA 2CKZB 1IOWA 4C5BA 1WSCA 1N36H 3HOUG 2VUMG 3M4IA 1TA8A 4YJ3F 1BGWA 4I4TF 2XC9A 4A3BG 2VQEH 3G6XA 4DV5H 2XIGA 4R7RA 2RGVA 3M9MB 5EOYA 2FJZA 1E4EA 1XNRH 4DV6H 3VPBA 4LFCH 5FLMG 3T5JA 2V58A 2SCUB 1GSAA 3V4SA 2W7PA 1BNCA 4XYMB 4K0KH 2PN1A 1EZ1A 2R7MA 3JSNA 2XCAA 4A3KG 1RK6A 4O3OA 4JI7H 4A3MG 2DPIA 3HB9A 1RJPA 5F9LA 4LSXA 4HQ6A 5KFTA 1TWGA 4J9LA 1M6VA 5FLXW 5KFIA 2JA6G 3Q8RB 4RAZA 4FBUA 2ZJTA 4UCVA 4DR7H 1DIKA 4BBRG 2PMZA 4MV6A 4B3SH 2B63A 2PBZA 3VPDA 2R92A 1GSHA 2GPWA 3K3VA 3BA8A 5JVDF 3Q8PB 4JV2A 1VBGA 2FPIB 1PX2A 2UVVA 1KJQA 4J9MA 1T36A 4ECWA 4LF9H 4HR7A 1B33N 5HBRB 4EG0A 3FDSA 1Z2PX 3PN1A 4MTEA 2VA3A 1CQIB 2R84A 4QWBA 4ZI7F 2WAQA 4QJFA 3GTQA 4RB2C 5DQHA 3H40A 4QWEA 1TAEA 5IP9G 5LMNH 1ZHQA 5KG5A 2P0AA 3MWEA 4ZOLF 3GTGA 3V4ZA 5EWGA 3IG0A 4DR6H 2C00A 4R8UA 4ZHQF 1CS0A 2FK3A 5KFKA 2NU7B 2KSWA 2ZM6H 2UVWA 3VPCA 4TV9F 1UC9A 3R5HA 5KFFA 4ED1A 4ED2A 2PMZE 3OHBA 1ULZA 2AGOA 2JA8G 3RB4A 4Q8FA 4GLXA 5FD5A 4FS2A 1I94H 5KFLA 5JQWA 4ECYA 2FLNA 2XCLA 2R7ZA 3BQ2A 4YR2A 2CW8A 4AQYH 1Y1VA 2UU9H 2C35B 2NU9B 4XZ3B 5KFZA 2UXCH 4A2BA 4BY7G 1E4GT 5JUMA 4BXXG 5KFPA 2OH2A 5LL6b 3CQZA 3I12A 4A3LG 5C3EG 1S0NA 2FK2A 3N42B 4LF8H 1GLVA 4Q43A 1KJ8A 1S97A 2R93G 3RF2A 3WO1A 3PO2G 4JI4H 1GYFA 5KFNA 5DG7A 1JKJB 5L1LA 1ZETA 4Q8EA 5CA0F 3GTOA 2R86A 3RIZA 5KT4A 5KG0A 3SI8A 4B3TH 3PW5A 3GILA 2R7KA 1FVIA 4O3PA 3RV3A 2WB1A 3FMAA 5D1PA 4ETSA 3L4JA 4GC6A 4FS1A 2FPGB 1XMQH 4MV8A 5DQIA 5IT9W 4DV2H 1I6UA 4JYAH 2YZNA 4J9SA 5EWFA 2R8JA 4FBTA 2W7OA 2I80A 1GSOA 5A2QW 4U7CA 3KAKA 3MWMA 4Y8VB 5T14A 5D8DA 3PW2A 4DL7A 2M05A 1KJIA 3RGZA 2V59A 4DL2A 3M9NB 5D1OB 3GTJA 4F50A 2E2IA 2FKLA 2ALZA 5KG4A 3V6KA 5FJ8G 4YB8B 4O3QA 4J9PA 4ECRA 2JEIA 3HOVG 3TIIA 1Y14B 2YS6A 5BPHA 4RU9A 5FPOA 2J6TA 2W71A 2WYOA 2AU0A 2R8IA 2OLSA 5BR8H 2FK1A 4HNVA 1XMOH 2E2HA 5DG9A 3OUUA 4MA5A 2C22A 2C28A 2YS7A 5IYZF 4A3DG 2WB1E 2J6UA 3PZPA 3I4MG 4EFEA 2XGQA 3MFIA 1N33H 4RUAA 4OX9H 4DL5A 4EYHB 2JEJA 2I87A 4NXNH 1AUVA 2AGQA 3PVXA 3H20A 4J9OA 3UQ8A 2HJWA 4JI6H 2NUAB 2UUBH 4RNNA 2UVRA 4YP3A 3WO0A 4X66H 2W8KA 3N40P 3RB3A 3N6XA 4GKKH 2VPSA 4X65H 5BPFA 4DL3A 3WNZA 4NLGA 4MTDA 1PK8A 3KHLA 4L1KA 3BQ0A 1Y1WA 4UCOA 3MR6A 4MV4A 5DGAA 2QK4A 1WCMA 3PR5B 3LMLA 5C44G 4ECSA 2NVXA 4QWDA 2RF4A 2W6MA 2UUCH 1I7NA 1IOVA 3H0GA 2W9BB 4DV7H 4EBEA 1S0OA 2R7ZG 2ASLA 3GIDA 1KC7A 2BR0A 4MV9A 1JIHA 5CAEB 2VPQA 2W9AA 4QIWE 3TQTA 4MV3A 4LF4H 5L1KA 2JA5A 3R23A 1O75A 3ORQA 3RB6A 1BXRA 2W70A 1V51A 1EHIA 2FPPB 2IMWP 3N43B 3MJFA 3HOXG 3KHRA 2VQDA 1EUDB 3H4BA 2HGSA 2NVYA 3AYHB 4EFBA 1OWTA 2W6NA 5KFWA 2XCPA 3RJ0A 5KG2A 3MR2A 2W9CB 4LF6H 4IZOA 1RYRA 1TWAA 4Q45A 1BJTA 4JI2H 4ECUA 1FKAH 4E4TA 1I50A 3GTMA 2VR1A 4DUYH 4EEQA 2YW2A 3U9TA 4A3IG 5D1OA 1VBHA 4LF7H 2HVQA 2R85A 3BQ1A 2R7NA 4U6PA 4B3MH 4TQSA 5KT7A 3HKZA 3RAQA 3FKIA 4QW9A 4MA0A 2JEFA 3QFFA 2CZGA 2E5LH 4DR5H 2XD4A 5KFCA 4ECVA 4MAMA 3KALA 1EYZA 3JRWA 4RZQA 1C30A 2ATLA 3HBLA 4APMA 4I55F 5C4XG 5KFJA 5KFEA 2V4QA 4EEYA 5KT3A 5LOVF 3BABA 4DV3H 5KFHA 2V5AA 3Q8QB 3JAMW 1L2ZA 1UC8A 3T1HH 5H80A 5L1JA 2YZMA 2DLNA 2WAQE 2Y0SA 1VAJA 3U9SA 3KHGA 2R8HA 1JX4A 2C2RA 3N41B 1S03G 1DV1A 4TV8F 1C3OA 3GIMA 3R5FA 4MV7A 5HV6A 3Q2OA 4QWCA 3K5IA 4RB3C 4DV1H 2YCHA 3GIJA 3RAXA 1A9XA 3HKZE 4PWQA 3PO3G 3GTKA 1W96A 2UVUA 4J9QA 2HVSA 2R82A 1V9PA 3BG5A 3PW4A 4F4ZA 2FLLA 4O4LF 2W6QA 5DQGA 4F4XA 3N44B 5EDWA 1E4FT 4CC5A 1CE8A 4O4IF 4WBNF 2W9BA 5GONF 4IHJF 3BAAA 5JH7F 3LP8A 3T5LA 2Y0SE 2GLTA 4Q0YA 3NGDA 2OWOA 1HNZH 4EGJA 3RB0A 4NXMH 4EBDA 2V4RA 3GV5B 2X0SA 2WE6A 5KFDA 3MR3A 4JV5H 2VOBA 1RJRA 2R7LA 2W6ZA 3QZ7A 4O3NA 5KFVA 2FLPA 4J9KA 4YBZB 1MZBA 4IAJA 4DUZH 3GQCA 5KFOA 5IP7G 2W9CA 4ED8A 4YHHH 3I4NG 3ETHA 3OTOH 4J9RA 1J5EH 3N8DA 3F8NA 4YQWA 3JRXA 2XGPA 4IR1A 3K3PA 4LFBH 2CW7A 1WCMG 3K5HA 3C0FB 2ASJA 1TWCA 5C8YF 1SYXB 1IBKH 2VA2A 5FPRA 2JA7A 4ECTA 3H0GG 3MR5A 2BQUA 1M7JA 3IN5A 2BQ3A 3GV8B 4YY3H 1Z2NX 1KJ9A 4FU0A 2DIKA 4LMYA 5KG1A 3ORRA 2J9GA 5L9XA 3TIGA 4RNOA 3HOYG 3H3VH 2R93A 3HOWG 2JA6A 4RZRA 4DR1H 2JA5G 3EYYA 1W93A 1JDEA 4RNMA 2IA6A 5KG7A 3PR4A 1B04A 1RYSA 1X9NA 4JI5H 2B63G 4ED3A 5CA1F 3SE7A 3MFHA 2R92G 3G6YA 2BQRA 1S10A 4JI1H 1AN7A 4X62H 5JVLA 4CC6A 3T1YH 2W6OA 4J0MA 5KT2A 4EBCA 1M0WA 4RB1A 1JDBB 4C5AA 5J2TF 3KAJA 4QW8A 3GIIA 5C1OA 3RGXA 1S68A 1Z2OX 3BA9A 2J6SA 3ETJA 4UCSA 5EZYF 2W6PA 3MWDA 3V6HA 5KKNB 3T5KA 5F9NA 5IWAH 3FKIG 1GO3E 5KFRA 4O2BF 5IYBG 3Q8SB 1N56A 4UCUA 5KFSA 2UXBH 3GIQA 3HOZG 4O3RA 2W57A 3GV7B 4ECZA 5DG8A 1P8LA 1TWFA 2FE3A 2FMAA 4IWYA 1K83A 4JI0H 3J7AK 5C1PA 1TWHA 4RB0A 1KBLA 2Q2UA 4IWXA 2W8LA 2YZGA 5KG3A 3GIPA 4O2AF 3R5XA 2MCTA 4ME6A 4C5CA 4LF5H 4YAKB 4RUCA 3OSNA 3PW0A 4A3GG 1SEIA 3EPGA 4KHPH 1B6RA 1ZHSA 1Y1VG 1N48A 2ZDHA 1N34H 4LSAA 1JXLA 1K1SA 3G6VA 1V4YA 3H4DA 3EPIA 4ED7A 3GTPA 4ZQIA 1CQJB 4ECXA 2VUMA 4M7EA 2DPJA 4DL4A 3RUPA 2R8KA 1AUXA 4C2MA 4YR0A 4A3JG 1HNWH 2F4VH 4PDBA 4XYLB 2I8CA 4QWAA 4EYIB 2IP4A 5LYJF 4YR3A 2WTFA 2CQYA 4ECQA 5KFUA 4UFZA 4Q44A 4F4WA 1GGOA 2YRXA 4TQRA 3QZ8A 5CB4F 3HXLA 1S9FA 4YAJB 4A93G 1VKZA 4BY1G 3GLKA 2YRWA 5C5JA
chains in the Genus database with same CATH topology
4Q0YA 2VQFH 2OWOA 1HNZH 3H20A 4LSXA 4NXMH 4LFAH 3UQ8A 5FLXW 4DR2H 4JI6H 2WE6A 4JV5H 4RAZA 1N32H 2VOBA 2ZJTA 3RTXA 3JSLA 2UUBH 2RGRA 4UCVA 4DR7H 4B3SH 4A2AA 4X66H 3N40P 4BWSC 3N6XA 1MZBA 2VPSA 3BA8A 3K3VA 4X65H 4GKKH 4IAJA 2UXDH 4DUZH 3J81W 2HHHH 1FJGH 4MTDA 4UCTA 4LF9H 4UCOA 4YHHH 1Z2PX 3PN1A 4MTEA 3OTOH 1J5EH 3F8NA 3LMLA 4RB2C 4LFBH 2CW7A 4DV0H 3C0FB 2UUCH 1TAEA 2UUAH 1SYXB 1XNQH 4DV7H 1IBKH 5FPRA 5LMNH 1ZHQA 4MV9A 2VUGA 4DR6H 3IG0A 4YY3H 1Z2NX 3KXYT 4LMYA 1A0IA 4LF4H 2KSWA 2ZM6H 4B3RH 1O75A 3DF7A 1HNXH 4DR1H 1IBLH 3EYYA 3N43B 4JI5H 1B04A 1X9NA 2HGSA 5LMUH 1DGSA 1VS0A 4EFBA 4JI8H 4GLXA 4JI1H 1AN7A 4X64H 4X62H 5FD5A 1I94H 4GKJH 4CC6A 3RJ0A 4LH6A 3T1YH 4LF6H 4UCRA 2CW8A 4J0MA 1BJTA 4JI2H 4DR3H 4AQYH 1FKAH 4JI3H 1M0WA 4RB1A 2UU9H 4FM9A 4DUYH 2UXCH 4A2BA 4EEQA 1E4GT 3KAJA 5D1OA 4LF7H 2Q2TA 1XDNA 2HVQA 3RGXA 1S68A 1Z2OX 3BA9A 5LL6b 1HR0H 4UCSA 4B3MH 3N42B 4LF8H 2E5LH 4LH7A 5IWAH 4DR5H 3RF2A 5FD6A 1GYFA 4JI4H 4DV4H 4UCUA 2UXBH 3KALA 4I7HA 3RIZA 2W57A 4RZQA 3J7AK 1P8LA 2FE3A 4B3TH 4JI0H 4APMA 1FVIA 4RB0A 4ETSA 3FMAA 5D1PA 2Q2UA 3L4JA 3J80W 1XMQH 4RAYA 3BABA 4DV3H 4DR4H 1WH2A 5IT9W 4DV2H 1I6UA 3CVZA 4JYAH 2MCTA 3JAMW 1L2ZA 3T1HH 3L4KA 4LF5H 5A2QW 3KAKA 1SEIA 3MWMA 4KHPH 1ZHSA 1IBMH 3N41B 3RGZA 1S03G 2O03A 1N34H 4LSAA 5D1OB 1M0TA 4MV7A 3L2PA 4RB3C 2WDTA 4DV1H 2HVRA 2YCHA 4M7EA 1N36H 3M4IA 1TA8A 1BGWA 2VQEH 5FPOA 2HVSA 2WYOA 1V9PA 4DV5H 1HNWH 2F4VH 4PDBA 2XIGA 4R7RA 2RGVA 5BR8H 5EOYA 1XMOH 1XNRH 4DV6H 3N44B 1E4FT 4CC5A 4LFCH 4UFZA 3HXLA 4EFEA 4K0KH 3BAAA 1N33H 3JSNA 4OX9H 4JI7H 4NXNH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2Z A;  4BWS C;  1GYF A;  3FMA A;  1SYX B;  3K3V A;  1WH2 A; 
#chains in the Genus database with same CATH topology
 3T5H A;  2YL2 A;  1KEE A;  2VQF H;  5KFQ A;  1DV2 A;  2ZDG A;  4LFA H;  4DR2 H;  3TQ1 A;  1N32 H;  2RGR A;  3RTX A;  3JSL A;  4A2A A;  4BWS C;  4I50 F;  2UXD H;  2NU8 B;  2R87 A;  4YJ2 F;  3J81 W;  2HHH H;  1FJG H;  2RDJ A;  4UCT A;  4EGQ A;  2DZD A;  2YYA A;  3RBE A;  1E4E B;  1SCU B;  1S0M A;  4DV0 H;  4BBS G;  2UUA H;  1XNQ H;  3GTL A;  4IRK A;  2C2D A;  1SFO A;  5KFG A;  4O4H F;  4ED6 A;  4IR9 A;  2VUG A;  5IYD G;  4J9N A;  3V6J A;  5BMV F;  2JA7 G;  2V9W A;  2FP4 B;  3RFC A;  3KXY T;  1T94 A;  1A0I A;  4AYB A;  5J2U F;  5KFM A;  5KFA A;  5K2M A;  3PW7 A;  2YU9 A;  3JZI A;  4B3R H;  3DF7 A;  4M9U A;  5KG6 A;  3M9O B;  4ED0 A;  3UFX B;  4A3E G;  5KFB A;  3BJY A;  2ASD A;  1HNX H;  1IBL H;  2GPS A;  1UNN C;  5LMU H;  5DLG A;  1DGS A;  4MV1 A;  5LXT F;  4A3F G;  1VS0 A;  4IRC A;  4JI8 H;  1RJQ A;  4X64 H;  3LWB A;  1I7L A;  4GKJ H;  1ZQ7 A;  4LH6 A;  5KFY A;  3TIN A;  1Y1W G;  5L1I A;  4JV0 A;  4UCR A;  1R9T A;  4IRD A;  4DR3 H;  4JI3 H;  5IYC G;  4FM9 A;  5LP6 F;  1EUC B;  3E5N A;  2AQ4 A;  2IBK A;  3GIK A;  2R6F A;  1RK5 A;  2ZDQ A;  2Q2T A;  1XDN A;  5LA6 F;  1HR0 H;  1WR2 A;  1JLL B;  4R8U B;  1KJJ A;  4HYK A;  2AGP A;  1K1Q A;  3VMM A;  4AYB E;  3KTM A;  3G8C A;  4LH7 A;  2NU6 B;  5FD6 A;  3RV4 A;  4DV4 H;  2JEG A;  4GC7 A;  4JV1 A;  4I7H A;  2DWC A;  4HNU A;  1I3Q A;  5I47 A;  5KT5 A;  4DLK A;  5KX5 F;  5EWE A;  3J80 W;  4DL6 A;  4RAY A;  2R8G A;  4O3S A;  4HNT A;  5DLF A;  4DR4 H;  1WH2 A;  2FB9 A;  4WD3 A;  3CVZ A;  1B6S A;  3RBD A;  3OUZ A;  5KFX A;  3L4K A;  3Q1K A;  4XX0 B;  5DGB A;  4QIW A;  4F4Y A;  2PVP A;  5KT6 A;  2C2E A;  1IBM H;  3KHH A;  2O03 A;  2QYZ A;  3OSP A;  1M0T A;  4G3I A;  4JUZ A;  3L2P A;  4A3C G;  4TUY F;  2WDT A;  1T3N A;  2HVR A;  2RDI A;  3OHA A;  2CKZ B;  1IOW A;  4C5B A;  1WSC A;  1N36 H;  3HOU G;  2VUM G;  3M4I A;  1TA8 A;  4YJ3 F;  1BGW A;  4I4T F;  2XC9 A;  4A3B G;  2VQE H;  3G6X A;  4DV5 H;  2XIG A;  4R7R A;  2RGV A;  3M9M B;  5EOY A;  2FJZ A;  1E4E A;  1XNR H;  4DV6 H;  3VPB A;  4LFC H;  5FLM G;  3T5J A;  2V58 A;  2SCU B;  1GSA A;  3V4S A;  2W7P A;  1BNC A;  4XYM B;  4K0K H;  2PN1 A;  1EZ1 A;  2R7M A;  3JSN A;  2XCA A;  4A3K G;  1RK6 A;  4O3O A;  4JI7 H;  4A3M G;  2DPI A;  3HB9 A;  1RJP A;  5F9L A;  4LSX A;  4HQ6 A;  5KFT A;  1TWG A;  4J9L A;  1M6V A;  5FLX W;  5KFI A;  2JA6 G;  3Q8R B;  4RAZ A;  4FBU A;  2ZJT A;  4UCV A;  4DR7 H;  1DIK A;  4BBR G;  2PMZ A;  4MV6 A;  4B3S H;  2B63 A;  2PBZ A;  3VPD A;  2R92 A;  1GSH A;  2GPW A;  3K3V A;  3BA8 A;  5JVD F;  3Q8P B;  4JV2 A;  1VBG A;  2FPI B;  1PX2 A;  2UVV A;  1KJQ A;  4J9M A;  1T36 A;  4ECW A;  4LF9 H;  4HR7 A;  1B33 N;  5HBR B;  4EG0 A;  3FDS A;  1Z2P X;  3PN1 A;  4MTE A;  2VA3 A;  1CQI B;  2R84 A;  4QWB A;  4ZI7 F;  2WAQ A;  4QJF A;  3GTQ A;  4RB2 C;  5DQH A;  3H40 A;  4QWE A;  1TAE A;  5IP9 G;  5LMN H;  1ZHQ A;  5KG5 A;  2P0A A;  3MWE A;  4ZOL F;  3GTG A;  3V4Z A;  5EWG A;  3IG0 A;  4DR6 H;  2C00 A;  4R8U A;  4ZHQ F;  1CS0 A;  2FK3 A;  5KFK A;  2NU7 B;  2KSW A;  2ZM6 H;  2UVW A;  3VPC A;  4TV9 F;  1UC9 A;  3R5H A;  5KFF A;  4ED1 A;  4ED2 A;  2PMZ E;  3OHB A;  1ULZ A;  2AGO A;  2JA8 G;  3RB4 A;  4Q8F A;  4GLX A;  5FD5 A;  4FS2 A;  1I94 H;  5KFL A;  5JQW A;  4ECY A;  2FLN A;  2XCL A;  2R7Z A;  3BQ2 A;  4YR2 A;  2CW8 A;  4AQY H;  1Y1V A;  2UU9 H;  2C35 B;  2NU9 B;  4XZ3 B;  5KFZ A;  2UXC H;  4A2B A;  4BY7 G;  1E4G T;  5JUM A;  4BXX G;  5KFP A;  2OH2 A;  5LL6 b;  3CQZ A;  3I12 A;  4A3L G;  5C3E G;  1S0N A;  2FK2 A;  3N42 B;  4LF8 H;  1GLV A;  4Q43 A;  1KJ8 A;  1S97 A;  2R93 G;  3RF2 A;  3WO1 A;  3PO2 G;  4JI4 H;  1GYF A;  5KFN A;  5DG7 A;  1JKJ B;  5L1L A;  1ZET A;  4Q8E A;  5CA0 F;  3GTO A;  2R86 A;  3RIZ A;  5KT4 A;  5KG0 A;  3SI8 A;  4B3T H;  3PW5 A;  3GIL A;  2R7K A;  1FVI A;  4O3P A;  3RV3 A;  2WB1 A;  3FMA A;  5D1P A;  4ETS A;  3L4J A;  4GC6 A;  4FS1 A;  2FPG B;  1XMQ H;  4MV8 A;  5DQI A;  5IT9 W;  4DV2 H;  1I6U A;  4JYA H;  2YZN A;  4J9S A;  5EWF A;  2R8J A;  4FBT A;  2W7O A;  2I80 A;  1GSO A;  5A2Q W;  4U7C A;  3KAK A;  3MWM A;  4Y8V B;  5T14 A;  5D8D A;  3PW2 A;  4DL7 A;  2M05 A;  1KJI A;  3RGZ A;  2V59 A;  4DL2 A;  3M9N B;  5D1O B;  3GTJ A;  4F50 A;  2E2I A;  2FKL A;  2ALZ A;  5KG4 A;  3V6K A;  5FJ8 G;  4YB8 B;  4O3Q A;  4J9P A;  4ECR A;  2JEI A;  3HOV G;  3TII A;  1Y14 B;  2YS6 A;  5BPH A;  4RU9 A;  5FPO A;  2J6T A;  2W71 A;  2WYO A;  2AU0 A;  2R8I A;  2OLS A;  5BR8 H;  2FK1 A;  4HNV A;  1XMO H;  2E2H A;  5DG9 A;  3OUU A;  4MA5 A;  2C22 A;  2C28 A;  2YS7 A;  5IYZ F;  4A3D G;  2WB1 E;  2J6U A;  3PZP A;  3I4M G;  4EFE A;  2XGQ A;  3MFI A;  1N33 H;  4RUA A;  4OX9 H;  4DL5 A;  4EYH B;  2JEJ A;  2I87 A;  4NXN H;  1AUV A;  2AGQ A;  3PVX A;  3H20 A;  4J9O A;  3UQ8 A;  2HJW A;  4JI6 H;  2NUA B;  2UUB H;  4RNN A;  2UVR A;  4YP3 A;  3WO0 A;  4X66 H;  2W8K A;  3N40 P;  3RB3 A;  3N6X A;  4GKK H;  2VPS A;  4X65 H;  5BPF A;  4DL3 A;  3WNZ A;  4NLG A;  4MTD A;  1PK8 A;  3KHL A;  4L1K A;  3BQ0 A;  1Y1W A;  4UCO A;  3MR6 A;  4MV4 A;  5DGA A;  2QK4 A;  1WCM A;  3PR5 B;  3LML A;  5C44 G;  4ECS A;  2NVX A;  4QWD A;  2RF4 A;  2W6M A;  2UUC H;  1I7N A;  1IOV A;  3H0G A;  2W9B B;  4DV7 H;  4EBE A;  1S0O A;  2R7Z G;  2ASL A;  3GID A;  1KC7 A;  2BR0 A;  4MV9 A;  1JIH A;  5CAE B;  2VPQ A;  2W9A A;  4QIW E;  3TQT A;  4MV3 A;  4LF4 H;  5L1K A;  2JA5 A;  3R23 A;  1O75 A;  3ORQ A;  3RB6 A;  1BXR A;  2W70 A;  1V51 A;  1EHI A;  2FPP B;  2IMW P;  3N43 B;  3MJF A;  3HOX G;  3KHR A;  2VQD A;  1EUD B;  3H4B A;  2HGS A;  2NVY A;  3AYH B;  4EFB A;  1OWT A;  2W6N A;  5KFW A;  2XCP A;  3RJ0 A;  5KG2 A;  3MR2 A;  2W9C B;  4LF6 H;  4IZO A;  1RYR A;  1TWA A;  4Q45 A;  1BJT A;  4JI2 H;  4ECU A;  1FKA H;  4E4T A;  1I50 A;  3GTM A;  2VR1 A;  4DUY H;  4EEQ A;  2YW2 A;  3U9T A;  4A3I G;  5D1O A;  1VBH A;  4LF7 H;  2HVQ A;  2R85 A;  3BQ1 A;  2R7N A;  4U6P A;  4B3M H;  4TQS A;  5KT7 A;  3HKZ A;  3RAQ A;  3FKI A;  4QW9 A;  4MA0 A;  2JEF A;  3QFF A;  2CZG A;  2E5L H;  4DR5 H;  2XD4 A;  5KFC A;  4ECV A;  4MAM A;  3KAL A;  1EYZ A;  3JRW A;  4RZQ A;  1C30 A;  2ATL A;  3HBL A;  4APM A;  4I55 F;  5C4X G;  5KFJ A;  5KFE A;  2V4Q A;  4EEY A;  5KT3 A;  5LOV F;  3BAB A;  4DV3 H;  5KFH A;  2V5A A;  3Q8Q B;  3JAM W;  1L2Z A;  1UC8 A;  3T1H H;  5H80 A;  5L1J A;  2YZM A;  2DLN A;  2WAQ E;  2Y0S A;  1VAJ A;  3U9S A;  3KHG A;  2R8H A;  1JX4 A;  2C2R A;  3N41 B;  1S03 G;  1DV1 A;  4TV8 F;  1C3O A;  3GIM A;  3R5F A;  4MV7 A;  5HV6 A;  3Q2O A;  4QWC A;  3K5I A;  4RB3 C;  4DV1 H;  2YCH A;  3GIJ A;  3RAX A;  1A9X A;  3HKZ E;  4PWQ A;  3PO3 G;  3GTK A;  1W96 A;  2UVU A;  4J9Q A;  2HVS A;  2R82 A;  1V9P A;  3BG5 A;  3PW4 A;  4F4Z A;  2FLL A;  4O4L F;  2W6Q A;  5DQG A;  4F4X A;  3N44 B;  5EDW A;  1E4F T;  4CC5 A;  1CE8 A;  4O4I F;  4WBN F;  2W9B A;  5GON F;  4IHJ F;  3BAA A;  5JH7 F;  3LP8 A;  3T5L A;  2Y0S E;  2GLT A;  4Q0Y A;  3NGD A;  2OWO A;  1HNZ H;  4EGJ A;  3RB0 A;  4NXM H;  4EBD A;  2V4R A;  3GV5 B;  2X0S A;  2WE6 A;  5KFD A;  3MR3 A;  4JV5 H;  2VOB A;  1RJR A;  2R7L A;  2W6Z A;  3QZ7 A;  4O3N A;  5KFV A;  2FLP A;  4J9K A;  4YBZ B;  1MZB A;  4IAJ A;  4DUZ H;  3GQC A;  5KFO A;  5IP7 G;  2W9C A;  4ED8 A;  4YHH H;  3I4N G;  3ETH A;  3OTO H;  4J9R A;  1J5E H;  3N8D A;  3F8N A;  4YQW A;  3JRX A;  2XGP A;  4IR1 A;  3K3P A;  4LFB H;  2CW7 A;  1WCM G;  3K5H A;  3C0F B;  2ASJ A;  1TWC A;  5C8Y F;  1SYX B;  1IBK H;  2VA2 A;  5FPR A;  2JA7 A;  4ECT A;  3H0G G;  3MR5 A;  2BQU A;  1M7J A;  3IN5 A;  2BQ3 A;  3GV8 B;  4YY3 H;  1Z2N X;  1KJ9 A;  4FU0 A;  2DIK A;  4LMY A;  5KG1 A;  3ORR A;  2J9G A;  5L9X A;  3TIG A;  4RNO A;  3HOY G;  3H3V H;  2R93 A;  3HOW G;  2JA6 A;  4RZR A;  4DR1 H;  2JA5 G;  3EYY A;  1W93 A;  1JDE A;  4RNM A;  2IA6 A;  5KG7 A;  3PR4 A;  1B04 A;  1RYS A;  1X9N A;  4JI5 H;  2B63 G;  4ED3 A;  5CA1 F;  3SE7 A;  3MFH A;  2R92 G;  3G6Y A;  2BQR A;  1S10 A;  4JI1 H;  1AN7 A;  4X62 H;  5JVL A;  4CC6 A;  3T1Y H;  2W6O A;  4J0M A;  5KT2 A;  4EBC A;  1M0W A;  4RB1 A;  1JDB B;  4C5A A;  5J2T F;  3KAJ A;  4QW8 A;  3GII A;  5C1O A;  3RGX A;  1S68 A;  1Z2O X;  3BA9 A;  2J6S A;  3ETJ A;  4UCS A;  5EZY F;  2W6P A;  3MWD A;  3V6H A;  5KKN B;  3T5K A;  5F9N A;  5IWA H;  3FKI G;  1GO3 E;  5KFR A;  4O2B F;  5IYB G;  3Q8S B;  1N56 A;  4UCU A;  5KFS A;  2UXB H;  3GIQ A;  3HOZ G;  4O3R A;  2W57 A;  3GV7 B;  4ECZ A;  5DG8 A;  1P8L A;  1TWF A;  2FE3 A;  2FMA A;  4IWY A;  1K83 A;  4JI0 H;  3J7A K;  5C1P A;  1TWH A;  4RB0 A;  1KBL A;  2Q2U A;  4IWX A;  2W8L A;  2YZG A;  5KG3 A;  3GIP A;  4O2A F;  3R5X A;  2MCT A;  4ME6 A;  4C5C A;  4LF5 H;  4YAK B;  4RUC A;  3OSN A;  3PW0 A;  4A3G G;  1SEI A;  3EPG A;  4KHP H;  1B6R A;  1ZHS A;  1Y1V G;  1N48 A;  2ZDH A;  1N34 H;  4LSA A;  1JXL A;  1K1S A;  3G6V A;  1V4Y A;  3H4D A;  3EPI A;  4ED7 A;  3GTP A;  4ZQI A;  1CQJ B;  4ECX A;  2VUM A;  4M7E A;  2DPJ A;  4DL4 A;  3RUP A;  2R8K A;  1AUX A;  4C2M A;  4YR0 A;  4A3J G;  1HNW H;  2F4V H;  4PDB A;  4XYL B;  2I8C A;  4QWA A;  4EYI B;  2IP4 A;  5LYJ F;  4YR3 A;  2WTF A;  2CQY A;  4ECQ A;  5KFU A;  4UFZ A;  4Q44 A;  4F4W A;  1GGO A;  2YRX A;  4TQR A;  3QZ8 A;  5CB4 F;  3HXL A;  1S9F A;  4YAJ B;  4A93 G;  1VKZ A;  4BY1 G;  3GLK A;  2YRW A;  5C5J A; 
#chains in the Genus database with same CATH homology
 4Q0Y A;  2VQF H;  2OWO A;  1HNZ H;  3H20 A;  4LSX A;  4NXM H;  4LFA H;  3UQ8 A;  5FLX W;  4DR2 H;  4JI6 H;  2WE6 A;  4JV5 H;  4RAZ A;  1N32 H;  2VOB A;  2ZJT A;  3RTX A;  3JSL A;  2UUB H;  2RGR A;  4UCV A;  4DR7 H;  4B3S H;  4A2A A;  4X66 H;  3N40 P;  4BWS C;  3N6X A;  1MZB A;  2VPS A;  3BA8 A;  3K3V A;  4X65 H;  4GKK H;  4IAJ A;  2UXD H;  4DUZ H;  3J81 W;  2HHH H;  1FJG H;  4MTD A;  4UCT A;  4LF9 H;  4UCO A;  4YHH H;  1Z2P X;  3PN1 A;  4MTE A;  3OTO H;  1J5E H;  3F8N A;  3LML A;  4RB2 C;  4LFB H;  2CW7 A;  4DV0 H;  3C0F B;  2UUC H;  1TAE A;  2UUA H;  1SYX B;  1XNQ H;  4DV7 H;  1IBK H;  5FPR A;  5LMN H;  1ZHQ A;  4MV9 A;  2VUG A;  4DR6 H;  3IG0 A;  4YY3 H;  1Z2N X;  3KXY T;  4LMY A;  1A0I A;  4LF4 H;  2KSW A;  2ZM6 H;  4B3R H;  1O75 A;  3DF7 A;  1HNX H;  4DR1 H;  1IBL H;  3EYY A;  3N43 B;  4JI5 H;  1B04 A;  1X9N A;  2HGS A;  5LMU H;  1DGS A;  1VS0 A;  4EFB A;  4JI8 H;  4GLX A;  4JI1 H;  1AN7 A;  4X64 H;  4X62 H;  5FD5 A;  1I94 H;  4GKJ H;  4CC6 A;  3RJ0 A;  4LH6 A;  3T1Y H;  4LF6 H;  4UCR A;  2CW8 A;  4J0M A;  1BJT A;  4JI2 H;  4DR3 H;  4AQY H;  1FKA H;  4JI3 H;  1M0W A;  4RB1 A;  2UU9 H;  4FM9 A;  4DUY H;  2UXC H;  4A2B A;  4EEQ A;  1E4G T;  3KAJ A;  5D1O A;  4LF7 H;  2Q2T A;  1XDN A;  2HVQ A;  3RGX A;  1S68 A;  1Z2O X;  3BA9 A;  5LL6 b;  1HR0 H;  4UCS A;  4B3M H;  3N42 B;  4LF8 H;  2E5L H;  4LH7 A;  5IWA H;  4DR5 H;  3RF2 A;  5FD6 A;  1GYF A;  4JI4 H;  4DV4 H;  4UCU A;  2UXB H;  3KAL A;  4I7H A;  3RIZ A;  2W57 A;  4RZQ A;  3J7A K;  1P8L A;  2FE3 A;  4B3T H;  4JI0 H;  4APM A;  1FVI A;  4RB0 A;  4ETS A;  3FMA A;  5D1P A;  2Q2U A;  3L4J A;  3J80 W;  1XMQ H;  4RAY A;  3BAB A;  4DV3 H;  4DR4 H;  1WH2 A;  5IT9 W;  4DV2 H;  1I6U A;  3CVZ A;  4JYA H;  2MCT A;  3JAM W;  1L2Z A;  3T1H H;  3L4K A;  4LF5 H;  5A2Q W;  3KAK A;  1SEI A;  3MWM A;  4KHP H;  1ZHS A;  1IBM H;  3N41 B;  3RGZ A;  1S03 G;  2O03 A;  1N34 H;  4LSA A;  5D1O B;  1M0T A;  4MV7 A;  3L2P A;  4RB3 C;  2WDT A;  4DV1 H;  2HVR A;  2YCH A;  4M7E A;  1N36 H;  3M4I A;  1TA8 A;  1BGW A;  2VQE H;  5FPO A;  2HVS A;  2WYO A;  1V9P A;  4DV5 H;  1HNW H;  2F4V H;  4PDB A;  2XIG A;  4R7R A;  2RGV A;  5BR8 H;  5EOY A;  1XMO H;  1XNR H;  4DV6 H;  3N44 B;  1E4F T;  4CC5 A;  4LFC H;  4UFZ A;  3HXL A;  4EFE A;  4K0K H;  3BAA A;  1N33 H;  3JSN A;  4OX9 H;  4JI7 H;  4NXN H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...