1L2ZA

Cd2bp2-gyf domain in complex with proline-rich cd2 tail segment peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic interaction of CD2 with the GYF and the SH3 domain of compartmentalized effector molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding/signaling protein
molecule keywords CD2 ANTIGEN (CYTOPLASMIC TAIL)-BINDING PROTEIN 2
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2002-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1l2zA00
4BWSC 1L2ZA 3FMAA 3K3VA 1WH2A 1SYXB 1GYFA
chains in the Genus database with same CATH superfamily
4J9KA 4LF7H 4DL2A 5KFVA 2BQRA 2BR0A 4MTEA 4HNTA 2JA7G 2UUBH 4HQ6A 4LSAA 4DV6H 4MA5A 5EZYF 2R85A 3J81W 2R82A 2UVRA 3MWMA 4UCRA 3L2PA 2VUMA 4RUCA 3GILA 4O3QA 1E4EA 5DG8A 2WB1A 4DR7H 5C4XG 5KFFA 2C22A 4QWDA 2UUCH 2KSWA 3E5NA 2C28A 5FLXW 5I47A 4JV1A 4MV6A 3H4BA 4EEYA 2VQFH 5LA6F 3BABA 5L9XA 4EBEA 4RNMA 4QIWA 4Q45A 5KFJA 3GIKA 4O2AF 1B6SA 4ED1A 4XYMB 3G6YA 2RDIA 3R5FA 3BQ1A 4O3OA 5EWFA 4DV3H 2O03A 4DL6A 1GYFA 4YJ2F 4EBCA 4Y8VB 2W70A 4A3JG 2R8JA 2NVYA 1VAJA 5KT7A 1K1QA 4ECYA 4A3KG 3RB3A 2IP4A 1UNNC 3U9SA 4QW9A 4O4IF 2JEFA 5CAEB 1Z2OX 1BGWA 5KFWA 5D1OA 3RIZA 4DV4H 1HNWH 2I87A 2VOBA 3H0GG 4J9OA 5IWAH 1T36A 1UC9A 2PN1A 1M0TA 4RZQA 2E5LH 1KC7A 2W9CB 5DLGA 1BXRA 1WR2A 4JI6H 3I4MG 4R8UA 3V6HA 5JVDF 4DLKA 2X0SA 5KG4A 3QFFA 1FKAH 2W6PA 4LFCH 3Q1KA 5KFMA 1L2ZA 1E4GT 1TWCA 5FD5A 4ECRA 4DL5A 2NU7B 4A3MG 2E2HA 1S0OA 3UFXB 2JA6G 2R93G 4A3LG 4F4YA 2OLSA 2R87A 4MV7A 4Q44A 4UCVA 2VPSA 4ED3A 1V51A 3JRXA 3MR5A 2RF4A 3HOXG 3TQ1A 5A2QW 5L1IA 4BY7G 2W8KA 4B3MH 2FMAA 1GSHA 4A3BG 5LP6F 3GIPA 3RV3A 3BQ0A 3T5HA 4J9PA 1AN7A 3LMLA 5KT3A 2JA5A 3M4IA 5LMNH 1B33N 3FKIA 1Y1VG 2GPWA 1S03G 5T14A 5KFUA 3AYHB 5IT9W 4RAZA 1C3OA 4JI4H 2UVWA 2W6ZA 2YRXA 1Z2PX 4RNNA 2NUAB 2ZDQA 2ZDHA 4BY1G 3JAMW 3ETJA 1A9XA 2FJZA 4ED2A 4J0MA 4TV9F 3OTOH 2FP4B 4ED0A 3PW5A 4EYHB 4YAJB 2FLLA 1T94A 2VR1A 3DF7A 4APMA 2W6MA 4IWXA 4EG0A 4ECVA 4BBSG 3G8CA 4Q0YA 3V4SA 1KJ8A 4U6PA 2W7OA 3GIQA 4MV8A 4X64H 4LSXA 3Q8PB 3T1YH 3M9NB 4MTDA 2R92A 3ETHA 4R7RA 2BQUA 2YS7A 4RB0A 2FPPB 1UC8A 1AUVA 3Q8QB 2JA6A 3KHRA 3GV5B 3BG5A 3OHAA 2XCAA 4ED8A 2ZJTA 4NLGA 2R7ZG 2YL2A 4GLXA 1N34H 1VKZA 4ECUA 3N8DA 2UVUA 1V9PA 4EGQA 2XD4A 3WO0A 5KG2A 4FBTA 5KFLA 3GTMA 3ORRA 1Z2NX 4WD3A 4ETSA 4J9SA 3Q2OA 2P0AA 2DPJA 4XYLB 4LFBH 1WSCA 1I7LA 3KALA 4UCUA 5KFXA 2OH2A 3FDSA 4O4HF 4QWCA 5KFQA 5IP9G 3SI8A 2IBKA 2R8IA 3QZ8A 2WB1E 5IYZF 3MFHA 4A3EG 3JRWA 2IA6A 4E4TA 1A0IA 1SCUB 2DWCA 4ED6A 1T3NA 4ZI7F 3H20A 3WNZA 5KT5A 1V4YA 4G3IA 5LL6b 2HGSA 1XMOH 4DUYH 5KFNA 2VQDA 5JQWA 3TIIA 1MZBA 1I7NA 5DQGA 1ZQ7A 5EOYA 2VUMG 4ZHQF 2WAQA 4PWQA 1JDBB 3PW2A 3GIDA 1FVIA 5DGBA 4ECZA 2CW7A 5D1OB 3M9OB 2PVPA 3PR4A 2C2DA 4GC6A 2JA8G 4A3CG 1WCMG 3MR3A 1I3QA 3PO2G 3RFCA 1EYZA 4C2MA 4DV7H 1EZ1A 1RJRA 4LH7A 5KFHA 2FK3A 3N6XA 4YR0A 4DR2H 2AGQA 4X62H 2UVVA 1S97A 3HBLA 5KG0A 3BJYA 3PO3G 1RYRA 2XC9A 2NU6B 1CE8A 5D8DA 2W8LA 2WAQE 4RZRA 4A93G 3GTOA 2YU9A 3GTQA 2JEJA 5H80A 2GLTA 2VA3A 1I6UA 4R8UB 4JI7H 3UQ8A 4NXMH 4MAMA 5HV6A 1GSOA 2ZM6H 1B6RA 4ME6A 1EUCB 2AQ4A 5L1LA 3PW4A 1J5EH 3T5JA 4IR9A 4GKJH 1PK8A 3R23A 5KFAA 3V6JA 2W57A 3MJFA 1TWHA 4YHHH 3PW7A 3F8NA 1ZETA 1IBLH 2HHHH 2R8KA 2OWOA 4A3GG 2E2IA 5IYDG 5DGAA 2R93A 2YZMA 2CZGA 5KT4A 4JYAH 3J80W 2I8CA 1FJGH 4QIWE 3N41B 4AYBE 2NU9B 4UCSA 3RAQA 5KG5A 1Y14B 4EFBA 1JKJB 1E4FT 2W9BB 1HR0H 4DUZH 4M9UA 2VQEH 3J7AK 3HKZA 2V9WA 2WDTA 2J6TA 4A2AA 2R8HA 3GTLA 2HVRA 1I50A 3TIGA 4C5AA 4I50F 2V5AA 1N56A 3MFIA 5KFBA 1SYXB 2CKZB 4A3DG 3G6XA 2HVQA 5KKNB 4DL3A 3KHGA 5LXTF 5K2MA 2V4QA 2PBZA 2PMZA 4UCOA 4AYBA 4ZQIA 4J9MA 2ATLA 1SFOA 1DIKA 2HJWA 5LOVF 4EEQA 4FU0A 2GPSA 5IYCG 1RK6A 2JEGA 1KJJA 4ECSA 1JDEA 4UFZA 5L1JA 3RTXA 2Q2UA 1EUDB 3IN5A 4JUZA 1HNZH 4JI0H 1ZHQA 2SCUB 3BAAA 1M0WA 3T1HH 3BA9A 3R5HA 2YS6A 5FPOA 4K0KH 1I94H 1ULZA 3OSNA 5DLFA 3PW0A 1WCMA 4QWBA 2J6UA 1HNXH 1DV2A 4RAYA 5KFCA 2W9BA 3IG0A 1XNQH 2W7PA 3R5XA 1VBGA 2YZGA 4J9NA 3QZ7A 3KTMA 3OUZA 5EDWA 3EPIA 2UU9H 3EYYA 2C00A 1VBHA 2WE6A 4QJFA 5KFGA 4QWAA 1GLVA 1N32H 3PN1A 4CC6A 4CC5A 5EWGA 2FE3A 4MA0A 3PZPA 2UXCH 3RUPA 2ASDA 1KBLA 5KFRA 2FPGB 4YBZB 1KJQA 2B63A 4MV4A 1M7JA 4UCTA 3H40A 5KG1A 3N43B 3SE7A 2W9CA 3BQ2A 2J6SA 2UUAH 2R8GA 1RJQA 3KXYT 3MWDA 4TQRA 3VMMA 3JSNA 4PDBA 4TQSA 1S68A 4YB8B 2C2RA 2BQ3A 3RB6A 1EHIA 3RGXA 5DQHA 4IR1A 1GSAA 3CVZA 4ECXA 4EFEA 2R7ZA 4X66H 3GQCA 3GTKA 5JH7F 3OHBA 2AU0A 2Y0SA 5HBRB 5DQIA 2V4RA 5LMUH 4KHPH 1TA8A 4IWYA 2QYZA 2DLNA 5KFTA 5C3EG 2VPQA 3VPDA 4JV0A 2ALZA 1TWAA 5JUMA 2YZNA 3PR5B 5C1OA 3GTPA 4O2BF 2R92G 4C5BA 4ECTA 3RF2A 2PMZE 4LF9H 5EWEA 1KJIA 2IMWP 4JI5H 1N48A 3RGZA 3C0FB 2XCPA 1CQIB 2Q2TA 2XCLA 3N42B 1BJTA 1P8LA 2VUGA 4DV1H 4O3SA 3V6KA 4TUYF 4EBDA 3K5IA 4HNUA 2R7NA 4J9RA 4J9LA 1K83A 2FLPA 2W6OA 4RB2C 1DGSA 4B3TH 5KFSA 5KFOA 2QK4A 3L4JA 1W96A 2WTFA 2VA2A 2JA7A 1RYSA 4WBNF 1IOWA 3RB4A 4HYKA 1B04A 1PX2A 2V59A 4O3NA 4F4XA 4YAKB 4QW8A 2ASJA 4A3IG 3JZIA 3T5LA 3GV8B 1S9FA 4YY3H 3CQZA 2UXDH 4A3FG 3TINA 3U9TA 5L1KA 5J2UF 5D1PA 4RNOA 3BA8A 3MWEA 2R7LA 5KFIA 1S10A 3GTGA 5KG6A 4EGJA 1W93A 3T5KA 4ECWA 1JXLA 3LP8A 4HNVA 3HOUG 1CS0A 3KHHA 1IOVA 4MV3A 5CA0F 3N44B 2M05A 4Q43A 5LYJF 4YR2A 3H4DA 4DR1H 5KFKA 2YW2A 2V58A 4O3PA 4F50A 3GV7B 2ZDGA 5C44G 4GKKH 1N33H 4LH6A 3HB9A 4LF6H 2MCTA 3KAKA 2W6NA 3EPGA 4I7HA 5FD6A 4JI3H 5F9LA 1XDNA 3HOYG 4LMYA 1E4EB 3GIJA 3WO1A 4F4ZA 4RB3C 3FMAA 4L1KA 3GIMA 3MR2A 5KG7A 2DPIA 2NVXA 4MV1A 2YRWA 4IHJF 4U7CA 4B3RH 1KEEA 3GIIA 4IRDA 1TWGA 2FLNA 2ASLA 1WH2A 4YJ3F 5F9NA 3NGDA 2XGPA 4O3RA 4BWSC 4AQYH 2F4VH 4DR4H 4JV5H 4IRKA 1DV1A 4A2BA 4FS1A 3RB0A 5KFEA 2XIGA 1IBMH 1JLLB 4X65H 4J9QA 2J9GA 5KT2A 4YQWA 1C30A 4DV5H 5BR8H 4I55F 4DL7A 3HOWG 3MR6A 4Q8EA 2W9AA 5BMVF 4XZ3B 4YR3A 3H3VH 2HVSA 2JEIA 4Q8FA 2R86A 2R6FA 4RUAA 3FKIG 3VPCA 4I4TF 1XNRH 2AGPA 1JX4A 1X9NA 4IAJA 2RGRA 3PVXA 3RBEA 3GTJA 4RB1A 3Q8RB 2DIKA 5FLMG 4NXNH 1GGOA 1R9TA 2DZDA 2I80A 4XX0B 1S0NA 3M9MB 4JI2H 2NU8B 2CQYA 3I12A 3RV4A 4BBRG 3OSPA 2JA5G 4YP3A 3I4NG 3L4KA 5BPFA 4QWEA 1Y1VA 3K3VA 2FK1A 1RJPA 2C35B 4FM9A 1N36H 1Y1WG 4C5CA 5DG9A 3KHLA 3KAJA 3K3PA 5KT6A 3HOVG 5CA1F 4RU9A 5FPRA 3H0GA 3V4ZA 5KFZA 4IZOA 4BXXG 3JSLA 2C2EA 3Q8SB 4F4WA 1AUXA 5J2TF 3K5HA 4DV0H 5DG7A 4EYIB 1XMQH 3OUUA 1OWTA 4JI8H 4B3SH 4FBUA 1VS0A 3HOZG 4MV9A 2RGVA 2FK2A 4O4LF 3RJ0A 4DR6H 2Y0SE 3GLKA 4JV2A 4DV2H 2R7MA 5C5JA 1TWFA 2WYOA 2FB9A 2R84A 5GONF 4GC7A 2YCHA 5KFPA 4LF8H 3TQTA 1Y1WA 2AGOA 1O75A 3G6VA 4ED7A 4OX9H 4TV8F 5KFDA 4DL4A 1GO3E 1M6VA 1JIHA 5CB4F 5IP7G 1S0MA 4DR3H 3RAXA 4ECQA 1ZHSA 1IBKH 4M7EA 5BPHA 1RK5A 2B63G 4JI1H 2W6QA 3HXLA 1K1SA 1TAEA 3ORQA 3LWBA 5FJ8G 1KJ9A 4DR5H 5IYBG 1CQJB 2XGQA 4FS2A 4LF4H 2FPIB 4IRCA 2YYAA 3HKZE 3N40P 2RDJA 2CW8A 5KG3A 3VPBA 1SEIA 2W71A 5JVLA 4LF5H 4LFAH 4HR7A 5KFYA 2FKLA 5C8YF 2R7KA 5KX5F 3RBDA 5C1PA 1BNCA 4ZOLF 2UXBH
chains in the Genus database with same CATH topology
4LF7H 4LFBH 4RB3C 3FMAA 1HNXH 3KALA 4UCUA 4MTEA 4RAYA 1XNQH 3IG0A 2UUBH 4LSAA 4B3RH 4DV6H 3J81W 3MWMA 4UCRA 3L2PA 2UU9H 3EYYA 1WH2A 1A0IA 2WE6A 4DR7H 1N32H 4BWSC 4AQYH 2UUCH 2KSWA 3PN1A 4CC5A 4CC6A 2FE3A 3H20A 4A2BA 5FLXW 2F4VH 4DR4H 4JV5H 2XIGA 5LL6b 2HGSA 2VQFH 1XMOH 4X65H 3BABA 4DUYH 1IBMH 4DV5H 5BR8H 1MZBA 5EOYA 4UCTA 3N43B 2UUAH 1FVIA 4DV3H 3KXYT 2CW7A 2O03A 5D1OB 1GYFA 3JSNA 4PDBA 1S68A 2HVSA 3RGXA 3CVZA 4EFEA 4DV7H 1XNRH 1Z2OX 1BGWA 4LH7A 5D1OA 3RIZA 3N6XA 4X66H 4DV4H 4DR2H 2VOBA 4X62H 1HNWH 5IWAH 4IAJA 1X9NA 5LMUH 1M0TA 4RZQA 2E5LH 2RGRA 1TA8A 4KHPH 4RB1A 4NXNH 4JI6H 1FKAH 4JI2H 4LFCH 1L2ZA 1E4GT 5FD5A 3L4KA 1I6UA 3RF2A 4JI7H 3UQ8A 4NXMH 3K3VA 4MV7A 4LF9H 2ZM6H 4UCVA 2VPSA 4JI5H 4FM9A 1N36H 1J5EH 3RGZA 3C0FB 5A2QW 4GKJH 3KAJA 2Q2TA 3N42B 4B3MH 1BJTA 1P8LA 2VUGA 5FPRA 4DV1H 2W57A 4YHHH 2HHHH 3F8NA 1AN7A 3LMLA 1IBLH 2OWOA 3M4IA 3JSLA 5LMNH 4JYAH 1S03G 4RB2C 1DGSA 3J80W 1FJGH 4B3TH 3N41B 4DV0H 5IT9W 4RAZA 4JI4H 1XMQH 4UCSA 3L4JA 4JI8H 2UXCH 4B3SH 1VS0A 1Z2PX 4EFBA 4MV9A 2RGVA 1B04A 3RJ0A 3JAMW 4DR6H 1E4FT 1HR0H 4DV2H 4DUZH 4J0MA 2VQEH 3J7AK 3OTOH 2WYOA 2WDTA 4A2AA 4YY3H 2UXDH 2HVRA 3DF7A 2YCHA 4APMA 4LF8H 5D1PA 1O75A 4OX9H 4Q0YA 3BA8A 1SYXB 3T1YH 4X64H 4LSXA 2HVQA 4MTDA 4DR3H 4R7RA 4RB0A 4UCOA 1ZHSA 1IBKH 4M7EA 4EEQA 3N44B 4JI1H 3HXLA 2ZJTA 1TAEA 4UFZA 2Q2UA 3RTXA 4DR5H 4GLXA 1N34H 4DR1H 1HNZH 4JI0H 4LF4H 1ZHQA 3BAAA 1M0WA 3T1HH 3N40P 3BA9A 1N33H 1V9PA 4GKKH 4LH6A 2CW8A 5FPOA 4K0KH 4LF6H 1SEIA 2MCTA 3KAKA 4LF5H 4LFAH 4I7HA 5FD6A 1Z2NX 1I94H 4JI3H 4ETSA 1XDNA 4LMYA 2UXBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWS C;  1L2Z A;  3FMA A;  3K3V A;  1WH2 A;  1SYX B;  1GYF A; 
#chains in the Genus database with same CATH topology
 4J9K A;  4LF7 H;  4DL2 A;  5KFV A;  2BQR A;  2BR0 A;  4MTE A;  4HNT A;  2JA7 G;  2UUB H;  4HQ6 A;  4LSA A;  4DV6 H;  4MA5 A;  5EZY F;  2R85 A;  3J81 W;  2R82 A;  2UVR A;  3MWM A;  4UCR A;  3L2P A;  2VUM A;  4RUC A;  3GIL A;  4O3Q A;  1E4E A;  5DG8 A;  2WB1 A;  4DR7 H;  5C4X G;  5KFF A;  2C22 A;  4QWD A;  2UUC H;  2KSW A;  3E5N A;  2C28 A;  5FLX W;  5I47 A;  4JV1 A;  4MV6 A;  3H4B A;  4EEY A;  2VQF H;  5LA6 F;  3BAB A;  5L9X A;  4EBE A;  4RNM A;  4QIW A;  4Q45 A;  5KFJ A;  3GIK A;  4O2A F;  1B6S A;  4ED1 A;  4XYM B;  3G6Y A;  2RDI A;  3R5F A;  3BQ1 A;  4O3O A;  5EWF A;  4DV3 H;  2O03 A;  4DL6 A;  1GYF A;  4YJ2 F;  4EBC A;  4Y8V B;  2W70 A;  4A3J G;  2R8J A;  2NVY A;  1VAJ A;  5KT7 A;  1K1Q A;  4ECY A;  4A3K G;  3RB3 A;  2IP4 A;  1UNN C;  3U9S A;  4QW9 A;  4O4I F;  2JEF A;  5CAE B;  1Z2O X;  1BGW A;  5KFW A;  5D1O A;  3RIZ A;  4DV4 H;  1HNW H;  2I87 A;  2VOB A;  3H0G G;  4J9O A;  5IWA H;  1T36 A;  1UC9 A;  2PN1 A;  1M0T A;  4RZQ A;  2E5L H;  1KC7 A;  2W9C B;  5DLG A;  1BXR A;  1WR2 A;  4JI6 H;  3I4M G;  4R8U A;  3V6H A;  5JVD F;  4DLK A;  2X0S A;  5KG4 A;  3QFF A;  1FKA H;  2W6P A;  4LFC H;  3Q1K A;  5KFM A;  1L2Z A;  1E4G T;  1TWC A;  5FD5 A;  4ECR A;  4DL5 A;  2NU7 B;  4A3M G;  2E2H A;  1S0O A;  3UFX B;  2JA6 G;  2R93 G;  4A3L G;  4F4Y A;  2OLS A;  2R87 A;  4MV7 A;  4Q44 A;  4UCV A;  2VPS A;  4ED3 A;  1V51 A;  3JRX A;  3MR5 A;  2RF4 A;  3HOX G;  3TQ1 A;  5A2Q W;  5L1I A;  4BY7 G;  2W8K A;  4B3M H;  2FMA A;  1GSH A;  4A3B G;  5LP6 F;  3GIP A;  3RV3 A;  3BQ0 A;  3T5H A;  4J9P A;  1AN7 A;  3LML A;  5KT3 A;  2JA5 A;  3M4I A;  5LMN H;  1B33 N;  3FKI A;  1Y1V G;  2GPW A;  1S03 G;  5T14 A;  5KFU A;  3AYH B;  5IT9 W;  4RAZ A;  1C3O A;  4JI4 H;  2UVW A;  2W6Z A;  2YRX A;  1Z2P X;  4RNN A;  2NUA B;  2ZDQ A;  2ZDH A;  4BY1 G;  3JAM W;  3ETJ A;  1A9X A;  2FJZ A;  4ED2 A;  4J0M A;  4TV9 F;  3OTO H;  2FP4 B;  4ED0 A;  3PW5 A;  4EYH B;  4YAJ B;  2FLL A;  1T94 A;  2VR1 A;  3DF7 A;  4APM A;  2W6M A;  4IWX A;  4EG0 A;  4ECV A;  4BBS G;  3G8C A;  4Q0Y A;  3V4S A;  1KJ8 A;  4U6P A;  2W7O A;  3GIQ A;  4MV8 A;  4X64 H;  4LSX A;  3Q8P B;  3T1Y H;  3M9N B;  4MTD A;  2R92 A;  3ETH A;  4R7R A;  2BQU A;  2YS7 A;  4RB0 A;  2FPP B;  1UC8 A;  1AUV A;  3Q8Q B;  2JA6 A;  3KHR A;  3GV5 B;  3BG5 A;  3OHA A;  2XCA A;  4ED8 A;  2ZJT A;  4NLG A;  2R7Z G;  2YL2 A;  4GLX A;  1N34 H;  1VKZ A;  4ECU A;  3N8D A;  2UVU A;  1V9P A;  4EGQ A;  2XD4 A;  3WO0 A;  5KG2 A;  4FBT A;  5KFL A;  3GTM A;  3ORR A;  1Z2N X;  4WD3 A;  4ETS A;  4J9S A;  3Q2O A;  2P0A A;  2DPJ A;  4XYL B;  4LFB H;  1WSC A;  1I7L A;  3KAL A;  4UCU A;  5KFX A;  2OH2 A;  3FDS A;  4O4H F;  4QWC A;  5KFQ A;  5IP9 G;  3SI8 A;  2IBK A;  2R8I A;  3QZ8 A;  2WB1 E;  5IYZ F;  3MFH A;  4A3E G;  3JRW A;  2IA6 A;  4E4T A;  1A0I A;  1SCU B;  2DWC A;  4ED6 A;  1T3N A;  4ZI7 F;  3H20 A;  3WNZ A;  5KT5 A;  1V4Y A;  4G3I A;  5LL6 b;  2HGS A;  1XMO H;  4DUY H;  5KFN A;  2VQD A;  5JQW A;  3TII A;  1MZB A;  1I7N A;  5DQG A;  1ZQ7 A;  5EOY A;  2VUM G;  4ZHQ F;  2WAQ A;  4PWQ A;  1JDB B;  3PW2 A;  3GID A;  1FVI A;  5DGB A;  4ECZ A;  2CW7 A;  5D1O B;  3M9O B;  2PVP A;  3PR4 A;  2C2D A;  4GC6 A;  2JA8 G;  4A3C G;  1WCM G;  3MR3 A;  1I3Q A;  3PO2 G;  3RFC A;  1EYZ A;  4C2M A;  4DV7 H;  1EZ1 A;  1RJR A;  4LH7 A;  5KFH A;  2FK3 A;  3N6X A;  4YR0 A;  4DR2 H;  2AGQ A;  4X62 H;  2UVV A;  1S97 A;  3HBL A;  5KG0 A;  3BJY A;  3PO3 G;  1RYR A;  2XC9 A;  2NU6 B;  1CE8 A;  5D8D A;  2W8L A;  2WAQ E;  4RZR A;  4A93 G;  3GTO A;  2YU9 A;  3GTQ A;  2JEJ A;  5H80 A;  2GLT A;  2VA3 A;  1I6U A;  4R8U B;  4JI7 H;  3UQ8 A;  4NXM H;  4MAM A;  5HV6 A;  1GSO A;  2ZM6 H;  1B6R A;  4ME6 A;  1EUC B;  2AQ4 A;  5L1L A;  3PW4 A;  1J5E H;  3T5J A;  4IR9 A;  4GKJ H;  1PK8 A;  3R23 A;  5KFA A;  3V6J A;  2W57 A;  3MJF A;  1TWH A;  4YHH H;  3PW7 A;  3F8N A;  1ZET A;  1IBL H;  2HHH H;  2R8K A;  2OWO A;  4A3G G;  2E2I A;  5IYD G;  5DGA A;  2R93 A;  2YZM A;  2CZG A;  5KT4 A;  4JYA H;  3J80 W;  2I8C A;  1FJG H;  4QIW E;  3N41 B;  4AYB E;  2NU9 B;  4UCS A;  3RAQ A;  5KG5 A;  1Y14 B;  4EFB A;  1JKJ B;  1E4F T;  2W9B B;  1HR0 H;  4DUZ H;  4M9U A;  2VQE H;  3J7A K;  3HKZ A;  2V9W A;  2WDT A;  2J6T A;  4A2A A;  2R8H A;  3GTL A;  2HVR A;  1I50 A;  3TIG A;  4C5A A;  4I50 F;  2V5A A;  1N56 A;  3MFI A;  5KFB A;  1SYX B;  2CKZ B;  4A3D G;  3G6X A;  2HVQ A;  5KKN B;  4DL3 A;  3KHG A;  5LXT F;  5K2M A;  2V4Q A;  2PBZ A;  2PMZ A;  4UCO A;  4AYB A;  4ZQI A;  4J9M A;  2ATL A;  1SFO A;  1DIK A;  2HJW A;  5LOV F;  4EEQ A;  4FU0 A;  2GPS A;  5IYC G;  1RK6 A;  2JEG A;  1KJJ A;  4ECS A;  1JDE A;  4UFZ A;  5L1J A;  3RTX A;  2Q2U A;  1EUD B;  3IN5 A;  4JUZ A;  1HNZ H;  4JI0 H;  1ZHQ A;  2SCU B;  3BAA A;  1M0W A;  3T1H H;  3BA9 A;  3R5H A;  2YS6 A;  5FPO A;  4K0K H;  1I94 H;  1ULZ A;  3OSN A;  5DLF A;  3PW0 A;  1WCM A;  4QWB A;  2J6U A;  1HNX H;  1DV2 A;  4RAY A;  5KFC A;  2W9B A;  3IG0 A;  1XNQ H;  2W7P A;  3R5X A;  1VBG A;  2YZG A;  4J9N A;  3QZ7 A;  3KTM A;  3OUZ A;  5EDW A;  3EPI A;  2UU9 H;  3EYY A;  2C00 A;  1VBH A;  2WE6 A;  4QJF A;  5KFG A;  4QWA A;  1GLV A;  1N32 H;  3PN1 A;  4CC6 A;  4CC5 A;  5EWG A;  2FE3 A;  4MA0 A;  3PZP A;  2UXC H;  3RUP A;  2ASD A;  1KBL A;  5KFR A;  2FPG B;  4YBZ B;  1KJQ A;  2B63 A;  4MV4 A;  1M7J A;  4UCT A;  3H40 A;  5KG1 A;  3N43 B;  3SE7 A;  2W9C A;  3BQ2 A;  2J6S A;  2UUA H;  2R8G A;  1RJQ A;  3KXY T;  3MWD A;  4TQR A;  3VMM A;  3JSN A;  4PDB A;  4TQS A;  1S68 A;  4YB8 B;  2C2R A;  2BQ3 A;  3RB6 A;  1EHI A;  3RGX A;  5DQH A;  4IR1 A;  1GSA A;  3CVZ A;  4ECX A;  4EFE A;  2R7Z A;  4X66 H;  3GQC A;  3GTK A;  5JH7 F;  3OHB A;  2AU0 A;  2Y0S A;  5HBR B;  5DQI A;  2V4R A;  5LMU H;  4KHP H;  1TA8 A;  4IWY A;  2QYZ A;  2DLN A;  5KFT A;  5C3E G;  2VPQ A;  3VPD A;  4JV0 A;  2ALZ A;  1TWA A;  5JUM A;  2YZN A;  3PR5 B;  5C1O A;  3GTP A;  4O2B F;  2R92 G;  4C5B A;  4ECT A;  3RF2 A;  2PMZ E;  4LF9 H;  5EWE A;  1KJI A;  2IMW P;  4JI5 H;  1N48 A;  3RGZ A;  3C0F B;  2XCP A;  1CQI B;  2Q2T A;  2XCL A;  3N42 B;  1BJT A;  1P8L A;  2VUG A;  4DV1 H;  4O3S A;  3V6K A;  4TUY F;  4EBD A;  3K5I A;  4HNU A;  2R7N A;  4J9R A;  4J9L A;  1K83 A;  2FLP A;  2W6O A;  4RB2 C;  1DGS A;  4B3T H;  5KFS A;  5KFO A;  2QK4 A;  3L4J A;  1W96 A;  2WTF A;  2VA2 A;  2JA7 A;  1RYS A;  4WBN F;  1IOW A;  3RB4 A;  4HYK A;  1B04 A;  1PX2 A;  2V59 A;  4O3N A;  4F4X A;  4YAK B;  4QW8 A;  2ASJ A;  4A3I G;  3JZI A;  3T5L A;  3GV8 B;  1S9F A;  4YY3 H;  3CQZ A;  2UXD H;  4A3F G;  3TIN A;  3U9T A;  5L1K A;  5J2U F;  5D1P A;  4RNO A;  3BA8 A;  3MWE A;  2R7L A;  5KFI A;  1S10 A;  3GTG A;  5KG6 A;  4EGJ A;  1W93 A;  3T5K A;  4ECW A;  1JXL A;  3LP8 A;  4HNV A;  3HOU G;  1CS0 A;  3KHH A;  1IOV A;  4MV3 A;  5CA0 F;  3N44 B;  2M05 A;  4Q43 A;  5LYJ F;  4YR2 A;  3H4D A;  4DR1 H;  5KFK A;  2YW2 A;  2V58 A;  4O3P A;  4F50 A;  3GV7 B;  2ZDG A;  5C44 G;  4GKK H;  1N33 H;  4LH6 A;  3HB9 A;  4LF6 H;  2MCT A;  3KAK A;  2W6N A;  3EPG A;  4I7H A;  5FD6 A;  4JI3 H;  5F9L A;  1XDN A;  3HOY G;  4LMY A;  1E4E B;  3GIJ A;  3WO1 A;  4F4Z A;  4RB3 C;  3FMA A;  4L1K A;  3GIM A;  3MR2 A;  5KG7 A;  2DPI A;  2NVX A;  4MV1 A;  2YRW A;  4IHJ F;  4U7C A;  4B3R H;  1KEE A;  3GII A;  4IRD A;  1TWG A;  2FLN A;  2ASL A;  1WH2 A;  4YJ3 F;  5F9N A;  3NGD A;  2XGP A;  4O3R A;  4BWS C;  4AQY H;  2F4V H;  4DR4 H;  4JV5 H;  4IRK A;  1DV1 A;  4A2B A;  4FS1 A;  3RB0 A;  5KFE A;  2XIG A;  1IBM H;  1JLL B;  4X65 H;  4J9Q A;  2J9G A;  5KT2 A;  4YQW A;  1C30 A;  4DV5 H;  5BR8 H;  4I55 F;  4DL7 A;  3HOW G;  3MR6 A;  4Q8E A;  2W9A A;  5BMV F;  4XZ3 B;  4YR3 A;  3H3V H;  2HVS A;  2JEI A;  4Q8F A;  2R86 A;  2R6F A;  4RUA A;  3FKI G;  3VPC A;  4I4T F;  1XNR H;  2AGP A;  1JX4 A;  1X9N A;  4IAJ A;  2RGR A;  3PVX A;  3RBE A;  3GTJ A;  4RB1 A;  3Q8R B;  2DIK A;  5FLM G;  4NXN H;  1GGO A;  1R9T A;  2DZD A;  2I80 A;  4XX0 B;  1S0N A;  3M9M B;  4JI2 H;  2NU8 B;  2CQY A;  3I12 A;  3RV4 A;  4BBR G;  3OSP A;  2JA5 G;  4YP3 A;  3I4N G;  3L4K A;  5BPF A;  4QWE A;  1Y1V A;  3K3V A;  2FK1 A;  1RJP A;  2C35 B;  4FM9 A;  1N36 H;  1Y1W G;  4C5C A;  5DG9 A;  3KHL A;  3KAJ A;  3K3P A;  5KT6 A;  3HOV G;  5CA1 F;  4RU9 A;  5FPR A;  3H0G A;  3V4Z A;  5KFZ A;  4IZO A;  4BXX G;  3JSL A;  2C2E A;  3Q8S B;  4F4W A;  1AUX A;  5J2T F;  3K5H A;  4DV0 H;  5DG7 A;  4EYI B;  1XMQ H;  3OUU A;  1OWT A;  4JI8 H;  4B3S H;  4FBU A;  1VS0 A;  3HOZ G;  4MV9 A;  2RGV A;  2FK2 A;  4O4L F;  3RJ0 A;  4DR6 H;  2Y0S E;  3GLK A;  4JV2 A;  4DV2 H;  2R7M A;  5C5J A;  1TWF A;  2WYO A;  2FB9 A;  2R84 A;  5GON F;  4GC7 A;  2YCH A;  5KFP A;  4LF8 H;  3TQT A;  1Y1W A;  2AGO A;  1O75 A;  3G6V A;  4ED7 A;  4OX9 H;  4TV8 F;  5KFD A;  4DL4 A;  1GO3 E;  1M6V A;  1JIH A;  5CB4 F;  5IP7 G;  1S0M A;  4DR3 H;  3RAX A;  4ECQ A;  1ZHS A;  1IBK H;  4M7E A;  5BPH A;  1RK5 A;  2B63 G;  4JI1 H;  2W6Q A;  3HXL A;  1K1S A;  1TAE A;  3ORQ A;  3LWB A;  5FJ8 G;  1KJ9 A;  4DR5 H;  5IYB G;  1CQJ B;  2XGQ A;  4FS2 A;  4LF4 H;  2FPI B;  4IRC A;  2YYA A;  3HKZ E;  3N40 P;  2RDJ A;  2CW8 A;  5KG3 A;  3VPB A;  1SEI A;  2W71 A;  5JVL A;  4LF5 H;  4LFA H;  4HR7 A;  5KFY A;  2FKL A;  5C8Y F;  2R7K A;  5KX5 F;  3RBD A;  5C1P A;  1BNC A;  4ZOL F;  2UXB H; 
#chains in the Genus database with same CATH homology
 4LF7 H;  4LFB H;  4RB3 C;  3FMA A;  1HNX H;  3KAL A;  4UCU A;  4MTE A;  4RAY A;  1XNQ H;  3IG0 A;  2UUB H;  4LSA A;  4B3R H;  4DV6 H;  3J81 W;  3MWM A;  4UCR A;  3L2P A;  2UU9 H;  3EYY A;  1WH2 A;  1A0I A;  2WE6 A;  4DR7 H;  1N32 H;  4BWS C;  4AQY H;  2UUC H;  2KSW A;  3PN1 A;  4CC5 A;  4CC6 A;  2FE3 A;  3H20 A;  4A2B A;  5FLX W;  2F4V H;  4DR4 H;  4JV5 H;  2XIG A;  5LL6 b;  2HGS A;  2VQF H;  1XMO H;  4X65 H;  3BAB A;  4DUY H;  1IBM H;  4DV5 H;  5BR8 H;  1MZB A;  5EOY A;  4UCT A;  3N43 B;  2UUA H;  1FVI A;  4DV3 H;  3KXY T;  2CW7 A;  2O03 A;  5D1O B;  1GYF A;  3JSN A;  4PDB A;  1S68 A;  2HVS A;  3RGX A;  3CVZ A;  4EFE A;  4DV7 H;  1XNR H;  1Z2O X;  1BGW A;  4LH7 A;  5D1O A;  3RIZ A;  3N6X A;  4X66 H;  4DV4 H;  4DR2 H;  2VOB A;  4X62 H;  1HNW H;  5IWA H;  4IAJ A;  1X9N A;  5LMU H;  1M0T A;  4RZQ A;  2E5L H;  2RGR A;  1TA8 A;  4KHP H;  4RB1 A;  4NXN H;  4JI6 H;  1FKA H;  4JI2 H;  4LFC H;  1L2Z A;  1E4G T;  5FD5 A;  3L4K A;  1I6U A;  3RF2 A;  4JI7 H;  3UQ8 A;  4NXM H;  3K3V A;  4MV7 A;  4LF9 H;  2ZM6 H;  4UCV A;  2VPS A;  4JI5 H;  4FM9 A;  1N36 H;  1J5E H;  3RGZ A;  3C0F B;  5A2Q W;  4GKJ H;  3KAJ A;  2Q2T A;  3N42 B;  4B3M H;  1BJT A;  1P8L A;  2VUG A;  5FPR A;  4DV1 H;  2W57 A;  4YHH H;  2HHH H;  3F8N A;  1AN7 A;  3LML A;  1IBL H;  2OWO A;  3M4I A;  3JSL A;  5LMN H;  4JYA H;  1S03 G;  4RB2 C;  1DGS A;  3J80 W;  1FJG H;  4B3T H;  3N41 B;  4DV0 H;  5IT9 W;  4RAZ A;  4JI4 H;  1XMQ H;  4UCS A;  3L4J A;  4JI8 H;  2UXC H;  4B3S H;  1VS0 A;  1Z2P X;  4EFB A;  4MV9 A;  2RGV A;  1B04 A;  3RJ0 A;  3JAM W;  4DR6 H;  1E4F T;  1HR0 H;  4DV2 H;  4DUZ H;  4J0M A;  2VQE H;  3J7A K;  3OTO H;  2WYO A;  2WDT A;  4A2A A;  4YY3 H;  2UXD H;  2HVR A;  3DF7 A;  2YCH A;  4APM A;  4LF8 H;  5D1P A;  1O75 A;  4OX9 H;  4Q0Y A;  3BA8 A;  1SYX B;  3T1Y H;  4X64 H;  4LSX A;  2HVQ A;  4MTD A;  4DR3 H;  4R7R A;  4RB0 A;  4UCO A;  1ZHS A;  1IBK H;  4M7E A;  4EEQ A;  3N44 B;  4JI1 H;  3HXL A;  2ZJT A;  1TAE A;  4UFZ A;  2Q2U A;  3RTX A;  4DR5 H;  4GLX A;  1N34 H;  4DR1 H;  1HNZ H;  4JI0 H;  4LF4 H;  1ZHQ A;  3BAA A;  1M0W A;  3T1H H;  3N40 P;  3BA9 A;  1N33 H;  1V9P A;  4GKK H;  4LH6 A;  2CW8 A;  5FPO A;  4K0K H;  4LF6 H;  1SEI A;  2MCT A;  3KAK A;  4LF5 H;  4LFA H;  4I7H A;  5FD6 A;  1Z2N X;  1I94 H;  4JI3 H;  4ETS A;  1XDN A;  4LMY A;  2UXB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...