1L2ZA

Cd2bp2-gyf domain in complex with proline-rich cd2 tail segment peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding/signaling protein
molecule keywords CD2 ANTIGEN (CYTOPLASMIC TAIL)-BINDING PROTEIN 2
publication title Dynamic interaction of CD2 with the GYF and the SH3 domain of compartmentalized effector molecules
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2002-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1l2zA00
1SYXB 1L2ZA 4BWSC 1WH2A 3FMAA 3K3VA 1GYFA
chains in the Genus database with same CATH superfamily
2R85A 2OLSA 1DIKA 3RJ0A 3V6JA 5LL6b 4A2BA 2FE3A 4DL7A 3T1HH 4MV7A 5KFGA 5FJ8G 1IBKH 2JA5G 1RJRA 5A2QW 3MR6A 2AGPA 1R9TA 2UUBH 4HNUA 4RZQA 1KEEA 3I4NG 4C5CA 5D1OB 4JI8H 4X66H 4JI6H 3H0GA 1VS0A 1UC8A 1GYFA 2R7MA 4MV3A 4Y8VB 4LFAH 4YAKB 5CA0F 2ASJA 3F8NA 2Y0SE 4DV0H 3RFCA 3GIQA 2R8JA 2XCAA 3BA9A 4DV7H 4HYKA 3Q8RB 2XGPA 2XC9A 5KFUA 5IYDG 5C4XG 2JEGA 4YY3H 3GV7B 4ZQIA 4J9OA 5C5JA 5FD5A 1BGWA 1KBLA 4DL6A 2W70A 4ED1A 3PW4A 1SYXB 5EZYF 2VOBA 3MWMA 3J81W 2R7NA 5DQGA 4JV0A 3V4SA 4J9PA 1HNWH 5KG6A 3T1YH 5KFWA 2ZJTA 5JVLA 1P8LA 4O2BF 4MTEA 4TQRA 3RAQA 4EYIB 2XD4A 4PWQA 4A3JG 5KT4A 2VQFH 2RDIA 4ED0A 3PW5A 3HOWG 2W9CB 1S0NA 4GLXA 4NXMH 3GV5B 1S03G 1VBGA 4K0KH 3RBDA 1K83A 3PW0A 2ALZA 2W9BA 2R93G 1E4FT 1S97A 4E4TA 4YJ2F 2W7PA 4XYMB 5KFKA 4QWEA 1EZ1A 4MV1A 2VQDA 4RZRA 1IBLH 4YBZB 2V9WA 3PW2A 2FLPA 1X9NA 4O4HF 3HKZA 2FP4B 1JIHA 2WDTA 3BG5A 2CKZB 2VR1A 2ZM6H 2R8KA 3JSNA 4A93G 2NVXA 3VPBA 5EWGA 4JYAH 2YYAA 1M0WA 1TWCA 5KFBA 3KTMA 2CQYA 2C22A 4LF5H 2VA3A 5H80A 1DV2A 5EDWA 4JUZA 2VA2A 3H20A 3RUPA 4DV3H 1JXLA 1ZHSA 1ZQ7A 2BQ3A 2NUAB 3MFHA 3PW7A 4QWBA 4LH7A 3R23A 4MV6A 2PMZE 3QFFA 4BY1G 3SE7A 4F4ZA 4O3SA 3JSLA 5L9XA 4BY7G 4DR7H 3HOUG 5C1PA 4U7CA 2FK2A 3GIPA 3OSNA 4ED8A 2IMWP 4B3SH 4IRKA 4JI7H 4J9NA 1HNZH 1T94A 1A9XA 4ECXA 1Z2PX 5BPFA 4O3OA 1TWAA 2F4VH 5D1OA 4ED2A 2W8LA 2W6OA 3UQ8A 2YL2A 4RB2C 5J2UF 3G6VA 4ZI7F 4KHPH 2J9GA 3SI8A 3J7AK 3MR2A 2Q2TA 2YW2A 2AGOA 4DR1H 2R7KA 2YRXA 4ZOLF 4J9KA 1Y1VA 4M9UA 5FPRA 1RK6A 3ETHA 5BPHA 1Y1VG 1KJ8A 4XZ3B 4QW9A 4MA5A 5LMUH 1RYSA 4EEYA 4A3BG 1Z2NX 3N43B 5KFPA 2VQEH 2XCLA 1N36H 1HR0H 4LMYA 1SFOA 4HNVA 4RNMA 5KFAA 2CW7A 1FVIA 3QZ7A 3TIGA 4HQ6A 4RB0A 5JQWA 2BQRA 4FM9A 3RV4A 2GLTA 5LOVF 2VUGA 5IYCG 1PX2A 4EGJA 5J2TF 2JA6G 3KAKA 3K5IA 5HV6A 2R7ZA 1AUXA 2QK4A 1WCMG 1KJIA 3H40A 2HVQA 2FB9A 3RIZA 2YRWA 2AU0A 3BA8A 2R7ZG 4BXXG 4IAJA 5DLFA 3G6XA 2DLNA 1K1SA 5L1IA 4YR3A 1S0MA 4UCSA 4DR3H 1E4GT 4ECZA 1M7JA 2O03A 2UVUA 2W9AA 5FLMG 2NU7B 4YAJB 5C1OA 2YCHA 4DL3A 4JI0H 4O3QA 4DL4A 2VUMG 2JA5A 2FPIB 1M0TA 5KT6A 1EHIA 2R84A 2YZNA 3GLKA 1B6RA 5KT2A 4JV1A 3MWDA 4LH6A 2JEIA 1KJQA 1V51A 3H4DA 2I8CA 4RU9A 5GONF 3RB6A 5EOYA 3GQCA 3OHBA 4M7EA 3PN1A 4J9SA 5CB4F 1GO3E 5LP6F 4EBDA 1HNXH 1EUDB 2RF4A 2KSWA 4U6PA 4YR0A 1TA8A 4C2MA 3GILA 4G3IA 1ZHQA 5KFVA 1BXRA 4QWCA 3WO0A 2W8KA 4Q8FA 1KJJA 1JX4A 4X65H 3BAAA 3GV8B 3GTOA 2UXBH 1JLLB 2C35B 2AQ4A 4FS2A 3LP8A 2BQUA 5IT9W 3MR3A 4DV6H 3N6XA 4AQYH 3T5JA 4DL5A 2E5LH 4DR6H 1RJPA 1SCUB 2R92G 1AUVA 2HJWA 3CQZA 4ED3A 3V4ZA 2P0AA 5LXTF 3GTLA 4RUAA 3N41B 4TV9F 3HBLA 3GTMA 4O4LF 3AYHB 3GIKA 3T5HA 5KFLA 4GC6A 4ECWA 3TINA 3MJFA 2V59A 4A3MG 2R93A 2W71A 4O3RA 2QYZA 2W6NA 1I3QA 4NXNH 3N8DA 4MV4A 5KKNB 5JUMA 4QIWE 2I87A 2RGRA 1W96A 4RB1A 2BR0A 3WO1A 1WH2A 2ZDGA 4J0MA 5KFXA 5DLGA 3BQ1A 1Y1WG 4QW8A 2JA8G 3NGDA 1CQJB 1C30A 4L1KA 5KG1A 2M05A 2JEJA 1I50A 4JV2A 2WTFA 4IZOA 4MAMA 3HKZE 1S9FA 4ECVA 3M4IA 3PR4A 4FS1A 3GIDA 1S10A 2MCTA 3IG0A 4TUYF 3RGZA 3EPGA 2HVSA 1W93A 3HOZG 2UXCH 3U9TA 4A2AA 4C5AA 3DF7A 2WB1A 3VPCA 4DR2H 4XX0B 2NU9B 3BJYA 3HXLA 4JI2H 3RTXA 5DG8A 5I47A 4A3KG 1C3OA 1B33N 1DGSA 2ZDQA 5JH7F 2W7OA 1E4EB 4LFBH 4RNNA 3L4KA 4GC7A 2V4RA 4RAYA 3V6KA 4YQWA 5IYZF 2AGQA 1RJQA 4DLKA 1BNCA 2WAQE 4HNTA 5KT7A 4LF8H 2FJZA 4MA0A 4Q45A 4A3DG 3N40P 3N42B 2J6UA 4DUZH 3GIMA 2FPPB 1V4YA 3HOYG 4I4TF 4C5BA 1S0OA 3Q2OA 4IRCA 1CQIB 5F9NA 4EBEA 4NLGA 4ED6A 1TWFA 3BQ2A 1Y14B 2C2DA 3V6HA 4WBNF 1MZBA 3K3VA 3N44B 3RB3A 2YU9A 5KG7A 4A3IG 1XMOH 3FKIA 2FLLA 3OUZA 5K2MA 2C2RA 2NVYA 4F50A 3FKIG 3JAMW 5IWAH 2R8GA 2JA6A 4F4YA 4RUCA 5C44G 2XIGA 1WCMA 2FKLA 1M6VA 3RB4A 4TV8F 3MFIA 3JRXA 4UCUA 4LF7H 4X62H 2FPGB 4GKKH 3PVXA 1N32H 4UCRA 3TQTA 1IBMH 4FBUA 3KAJA 5CA1F 3WNZA 2HHHH 2ATLA 2W6ZA 2YS7A 4UCTA 4LFCH 3PO3G 5FPOA 2V58A 4O4IF 2W6PA 4ECYA 2VUMA 4ZHQF 4Q0YA 3RGXA 1CE8A 2J6TA 3OUUA 1GSAA 1GSOA 3HOVG 1TWGA 3C0FB 2UVVA 1JDBB 4AYBA 1T36A 4IWYA 5F9LA 1KC7A 4ECSA 5DG9A 2ASLA 3GTJA 1N48A 2UU9H 3OSPA 5KFSA 4J9QA 1A0IA 2FK3A 4J9MA 3KHGA 4QWDA 4B3MH 4EFBA 4A3FG 2UUCH 4PDBA 5HBRB 5DGAA 5KFYA 5LMNH 3H4BA 3I12A 5KFIA 5BR8H 5KFEA 2SCUB 3J80W 2C00A 5KFFA 3FMAA 5KX5F 2UVWA 4A3CG 2WE6A 4YJ3F 5FLXW 1FJGH 4O3PA 1GGOA 3RV3A 3K5HA 3U9SA 5KFTA 4CC6A 4I55F 3ORQA 3RAXA 4IRDA 3I4MG 1E4EA 1I7NA 3HB9A 2R86A 3Q8QB 2CW8A 3GIIA 3M9NB 3MWEA 3GTQA 2RDJA 2R92A 1PK8A 4R7RA 4J9RA 4UCVA 1IOWA 1VKZA 2Y0SA 3H0GG 3GIJA 5DQIA 4JI5H 2UXDH 4LSAA 5KT3A 3Q8SB 2W57A 5IP9G 4ECRA 2FK1A 3CVZA 2PVPA 4F4XA 5L1KA 2PBZA 4RB3C 4DV4H 5D8DA 2OWOA 1DV1A 4RAZA 4UFZA 5DQHA 3G8CA 4DR5H 1VBHA 2GPWA 5BMVF 5D1PA 4RNOA 4F4WA 4LF9H 5KFHA 3GTGA 3G6YA 3RBEA 3KHLA 5KFNA 1Y1WA 2NU8B 3R5HA 4FBTA 2DIKA 3Q8PB 4DR4H 5KFQA 1L2ZA 1O75A 5KFJA 2DZDA 3EPIA 4QWAA 1N56A 5L1JA 1J5EH 4ECQA 3K3PA 5DG7A 2HVRA 5KT5A 5IP7G 1GLVA 1TAEA 3RF2A 3FDSA 3TQ1A 1XMQH 1XNRH 1B04A 5KG0A 4EGQA 5EWFA 2VPSA 5KG5A 4DV5H 2IA6A 4UCOA 4DV2H 3MR5A 3GTKA 4IR9A 3E5NA 5JVDF 3EYYA 4QIWA 4X64H 4ED7A 4R8UA 2WB1E 3M9OB 2E2IA 2DWCA 5KFZA 2R87A 4YHHH 1XDNA 4FU0A 3RB0A 3Q1KA 4APMA 5DGBA 2VPQA 4EYHB 5L1LA 4EBCA 4A3LG 1ULZA 4DL2A 3JRWA 3OTOH 2I80A 4LF6H 3TIIA 5KFMA 4Q43A 4ECUA 3LWBA 2UVRA 1XNQH 4LF4H 5KG2A 4WD3A 3VPDA 2PN1A 3PR5B 3PZPA 3JZIA 3GTPA 3BABA 5LYJF 3R5FA 4TQSA 3KHHA 2FMAA 2UUAH 4Q8EA 4YR2A 4EFEA 2R8IA 2W6MA 3BQ0A 1WR2A 4Q44A 5CAEB 3LMLA 1B6SA 2PMZA 4LSXA 3ETJA 1FKAH 5KG4A 5KFRA 4MTDA 4DV1H 4MV8A 1T3NA 2FLNA 2R7LA 4JI3H 2HGSA 2XGQA 2ZDHA 1KJ9A 2W6QA 4I7HA 3ORRA 4MV9A 3L2PA 2IP4A 3PO2G 2R6FA 4A3EG 2WAQA 5LA6F 2V5AA 2ASDA 4O2AF 1RK5A 1EUCB 4IHJF 4B3TH 4JI4H 4GKJH 1SEIA 4OX9H 2V4QA 4IWXA 1OWTA 2Q2UA 1BJTA 1JKJB 5T14A 3OHAA 1I7LA 4ETSA 1I94H 3L4JA 2JA7A 4JV5H 4EG0A 2R8HA 3KALA 1IOVA 2OH2A 1ZETA 2JA7G 1K1QA 1WSCA 2IBKA 4DUYH 1CS0A 2X0SA 3UFXB 1AN7A 1UC9A 1V9PA 4BBSG 3HOXG 2C2EA 5C3EG 2W9BB 2B63A 4YP3A 2DPIA 3QZ8A 2E2HA 4R8UB 3R5XA 3T5KA 2B63G 1I6UA 4QJFA 3KXYT 4XYLB 5KFOA 1VAJA 2XCPA 4IR1A 2YS6A 4BWSC 5FD6A 5C8YF 4CC5A 4A3GG 1N33H 1EYZA 2C28A 3IN5A 4B3RH 4EEQA 2DPJA 2JEFA 3M9MB 4HR7A 2CZGA 4ME6A 2GPSA 2WYOA 4O3NA 4AYBE 5KG3A 5EWEA 1RYRA 2NU6B 1N34H 2W9CA 5KFDA 1GSHA 2YZMA 1UNNC 2J6SA 5KFCA 2RGVA 4YB8B 5IYBG 4J9LA 4ECTA 3T5LA 1Z2OX 1JDEA 3KHRA 2R82A 3H3VH 4JI1H 1TWHA 2YZGA 3VMMA 1S68A 4BBRG 4I50F
chains in the Genus database with same CATH topology
2VQEH 5D1PA 3HXLA 4JI2H 3RTXA 1HR0H 4LF9H 3RJ0A 4LMYA 1DGSA 5LL6b 4A2BA 2CW7A 1FVIA 2FE3A 3T1HH 4LFBH 4MV7A 4RB0A 1IBKH 2UUBH 5A2QW 3L4KA 4DR4H 4FM9A 4RZQA 4RAYA 1L2ZA 1O75A 5D1OB 4JI8H 4X66H 4JI6H 1VS0A 1J5EH 4LF8H 2VUGA 1GYFA 4LFAH 3N40P 3KAKA 2HVRA 3N42B 3F8NA 1TAEA 4DV0H 4DUZH 3RF2A 1XMQH 1XNRH 3BA9A 1B04A 2HVQA 3RIZA 4DV7H 2VPSA 4DV5H 3BA8A 4UCOA 4IAJA 4YY3H 4DV2H 3EYYA 5FD5A 4X64H 1BGWA 4UCSA 4DR3H 1E4GT 1SYXB 2O03A 2VOBA 3MWMA 3J81W 1HNWH 4YHHH 1XDNA 2YCHA 4JI0H 3T1YH 1MZBA 3K3VA 2ZJTA 3N44B 4APMA 1M0TA 3OTOH 1P8LA 4LF6H 1XMOH 1XNQH 4MTEA 4LF4H 3JAMW 5IWAH 4LH6A 2VQFH 2XIGA 3BABA 4GLXA 2UUAH 5EOYA 4DR5H 4NXMH 4UCUA 1S03G 4LF7H 4X62H 4EFEA 4M7EA 3PN1A 4GKKH 4K0KH 3LMLA 4UCRA 1HNXH 1N32H 1IBMH 4LSXA 3KAJA 2KSWA 1FKAH 1TA8A 2HHHH 1E4FT 1ZHQA 4MTDA 4DV1H 4JI3H 4UCTA 4LFCH 2HGSA 5FPOA 1IBLH 4X65H 3BAAA 4I7HA 4MV9A 4Q0YA 3RGXA 3L2PA 2UXBH 1X9NA 3C0FB 4GKJH 4JI4H 5IT9W 2ZM6H 4B3TH 2WDTA 1SEIA 3JSNA 3N6XA 4DV6H 4AQYH 2E5LH 2UU9H 4OX9H 4DR6H 4JYAH 1M0WA 1A0IA 2Q2UA 1BJTA 4B3MH 4EFBA 4PDBA 2UUCH 4ETSA 1I94H 3L4JA 4LF5H 4JV5H 3N41B 3KALA 5LMNH 4DUYH 3H20A 1AN7A 4DV3H 1V9PA 1ZHSA 5BR8H 3J80W 3FMAA 4LH7A 2WE6A 4NXNH 5FLXW 1FJGH 4DR7H 3JSLA 1I6UA 3KXYT 2RGRA 4RB1A 5FD6A 4BWSC 4CC5A 1WH2A 4CC6A 4J0MA 4B3SH 4JI7H 1N33H 1HNZH 1Z2PX 4EEQA 4B3RH 2CW8A 2F4VH 5D1OA 2WYOA 4R7RA 4UCVA 3UQ8A 4RB2C 4KHPH 3M4IA 1N34H 3J7AK 4JI5H 1N36H 2UXDH 4LSAA 2Q2TA 2MCTA 3IG0A 2W57A 3RGZA 4DR1H 2HVSA 2UXCH 3CVZA 2RGVA 5FPRA 4A2AA 3DF7A 1Z2OX 4RB3C 5LMUH 4DV4H 4DR2H 2OWOA 4JI1H 4RAZA 4UFZA 1Z2NX 1S68A 3N43B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYX B;  1L2Z A;  4BWS C;  1WH2 A;  3FMA A;  3K3V A;  1GYF A; 
#chains in the Genus database with same CATH topology
 2R85 A;  2OLS A;  1DIK A;  3RJ0 A;  3V6J A;  5LL6 b;  4A2B A;  2FE3 A;  4DL7 A;  3T1H H;  4MV7 A;  5KFG A;  5FJ8 G;  1IBK H;  2JA5 G;  1RJR A;  5A2Q W;  3MR6 A;  2AGP A;  1R9T A;  2UUB H;  4HNU A;  4RZQ A;  1KEE A;  3I4N G;  4C5C A;  5D1O B;  4JI8 H;  4X66 H;  4JI6 H;  3H0G A;  1VS0 A;  1UC8 A;  1GYF A;  2R7M A;  4MV3 A;  4Y8V B;  4LFA H;  4YAK B;  5CA0 F;  2ASJ A;  3F8N A;  2Y0S E;  4DV0 H;  3RFC A;  3GIQ A;  2R8J A;  2XCA A;  3BA9 A;  4DV7 H;  4HYK A;  3Q8R B;  2XGP A;  2XC9 A;  5KFU A;  5IYD G;  5C4X G;  2JEG A;  4YY3 H;  3GV7 B;  4ZQI A;  4J9O A;  5C5J A;  5FD5 A;  1BGW A;  1KBL A;  4DL6 A;  2W70 A;  4ED1 A;  3PW4 A;  1SYX B;  5EZY F;  2VOB A;  3MWM A;  3J81 W;  2R7N A;  5DQG A;  4JV0 A;  3V4S A;  4J9P A;  1HNW H;  5KG6 A;  3T1Y H;  5KFW A;  2ZJT A;  5JVL A;  1P8L A;  4O2B F;  4MTE A;  4TQR A;  3RAQ A;  4EYI B;  2XD4 A;  4PWQ A;  4A3J G;  5KT4 A;  2VQF H;  2RDI A;  4ED0 A;  3PW5 A;  3HOW G;  2W9C B;  1S0N A;  4GLX A;  4NXM H;  3GV5 B;  1S03 G;  1VBG A;  4K0K H;  3RBD A;  1K83 A;  3PW0 A;  2ALZ A;  2W9B A;  2R93 G;  1E4F T;  1S97 A;  4E4T A;  4YJ2 F;  2W7P A;  4XYM B;  5KFK A;  4QWE A;  1EZ1 A;  4MV1 A;  2VQD A;  4RZR A;  1IBL H;  4YBZ B;  2V9W A;  3PW2 A;  2FLP A;  1X9N A;  4O4H F;  3HKZ A;  2FP4 B;  1JIH A;  2WDT A;  3BG5 A;  2CKZ B;  2VR1 A;  2ZM6 H;  2R8K A;  3JSN A;  4A93 G;  2NVX A;  3VPB A;  5EWG A;  4JYA H;  2YYA A;  1M0W A;  1TWC A;  5KFB A;  3KTM A;  2CQY A;  2C22 A;  4LF5 H;  2VA3 A;  5H80 A;  1DV2 A;  5EDW A;  4JUZ A;  2VA2 A;  3H20 A;  3RUP A;  4DV3 H;  1JXL A;  1ZHS A;  1ZQ7 A;  2BQ3 A;  2NUA B;  3MFH A;  3PW7 A;  4QWB A;  4LH7 A;  3R23 A;  4MV6 A;  2PMZ E;  3QFF A;  4BY1 G;  3SE7 A;  4F4Z A;  4O3S A;  3JSL A;  5L9X A;  4BY7 G;  4DR7 H;  3HOU G;  5C1P A;  4U7C A;  2FK2 A;  3GIP A;  3OSN A;  4ED8 A;  2IMW P;  4B3S H;  4IRK A;  4JI7 H;  4J9N A;  1HNZ H;  1T94 A;  1A9X A;  4ECX A;  1Z2P X;  5BPF A;  4O3O A;  1TWA A;  2F4V H;  5D1O A;  4ED2 A;  2W8L A;  2W6O A;  3UQ8 A;  2YL2 A;  4RB2 C;  5J2U F;  3G6V A;  4ZI7 F;  4KHP H;  2J9G A;  3SI8 A;  3J7A K;  3MR2 A;  2Q2T A;  2YW2 A;  2AGO A;  4DR1 H;  2R7K A;  2YRX A;  4ZOL F;  4J9K A;  1Y1V A;  4M9U A;  5FPR A;  1RK6 A;  3ETH A;  5BPH A;  1Y1V G;  1KJ8 A;  4XZ3 B;  4QW9 A;  4MA5 A;  5LMU H;  1RYS A;  4EEY A;  4A3B G;  1Z2N X;  3N43 B;  5KFP A;  2VQE H;  2XCL A;  1N36 H;  1HR0 H;  4LMY A;  1SFO A;  4HNV A;  4RNM A;  5KFA A;  2CW7 A;  1FVI A;  3QZ7 A;  3TIG A;  4HQ6 A;  4RB0 A;  5JQW A;  2BQR A;  4FM9 A;  3RV4 A;  2GLT A;  5LOV F;  2VUG A;  5IYC G;  1PX2 A;  4EGJ A;  5J2T F;  2JA6 G;  3KAK A;  3K5I A;  5HV6 A;  2R7Z A;  1AUX A;  2QK4 A;  1WCM G;  1KJI A;  3H40 A;  2HVQ A;  2FB9 A;  3RIZ A;  2YRW A;  2AU0 A;  3BA8 A;  2R7Z G;  4BXX G;  4IAJ A;  5DLF A;  3G6X A;  2DLN A;  1K1S A;  5L1I A;  4YR3 A;  1S0M A;  4UCS A;  4DR3 H;  1E4G T;  4ECZ A;  1M7J A;  2O03 A;  2UVU A;  2W9A A;  5FLM G;  2NU7 B;  4YAJ B;  5C1O A;  2YCH A;  4DL3 A;  4JI0 H;  4O3Q A;  4DL4 A;  2VUM G;  2JA5 A;  2FPI B;  1M0T A;  5KT6 A;  1EHI A;  2R84 A;  2YZN A;  3GLK A;  1B6R A;  5KT2 A;  4JV1 A;  3MWD A;  4LH6 A;  2JEI A;  1KJQ A;  1V51 A;  3H4D A;  2I8C A;  4RU9 A;  5GON F;  3RB6 A;  5EOY A;  3GQC A;  3OHB A;  4M7E A;  3PN1 A;  4J9S A;  5CB4 F;  1GO3 E;  5LP6 F;  4EBD A;  1HNX H;  1EUD B;  2RF4 A;  2KSW A;  4U6P A;  4YR0 A;  1TA8 A;  4C2M A;  3GIL A;  4G3I A;  1ZHQ A;  5KFV A;  1BXR A;  4QWC A;  3WO0 A;  2W8K A;  4Q8F A;  1KJJ A;  1JX4 A;  4X65 H;  3BAA A;  3GV8 B;  3GTO A;  2UXB H;  1JLL B;  2C35 B;  2AQ4 A;  4FS2 A;  3LP8 A;  2BQU A;  5IT9 W;  3MR3 A;  4DV6 H;  3N6X A;  4AQY H;  3T5J A;  4DL5 A;  2E5L H;  4DR6 H;  1RJP A;  1SCU B;  2R92 G;  1AUV A;  2HJW A;  3CQZ A;  4ED3 A;  3V4Z A;  2P0A A;  5LXT F;  3GTL A;  4RUA A;  3N41 B;  4TV9 F;  3HBL A;  3GTM A;  4O4L F;  3AYH B;  3GIK A;  3T5H A;  5KFL A;  4GC6 A;  4ECW A;  3TIN A;  3MJF A;  2V59 A;  4A3M G;  2R93 A;  2W71 A;  4O3R A;  2QYZ A;  2W6N A;  1I3Q A;  4NXN H;  3N8D A;  4MV4 A;  5KKN B;  5JUM A;  4QIW E;  2I87 A;  2RGR A;  1W96 A;  4RB1 A;  2BR0 A;  3WO1 A;  1WH2 A;  2ZDG A;  4J0M A;  5KFX A;  5DLG A;  3BQ1 A;  1Y1W G;  4QW8 A;  2JA8 G;  3NGD A;  1CQJ B;  1C30 A;  4L1K A;  5KG1 A;  2M05 A;  2JEJ A;  1I50 A;  4JV2 A;  2WTF A;  4IZO A;  4MAM A;  3HKZ E;  1S9F A;  4ECV A;  3M4I A;  3PR4 A;  4FS1 A;  3GID A;  1S10 A;  2MCT A;  3IG0 A;  4TUY F;  3RGZ A;  3EPG A;  2HVS A;  1W93 A;  3HOZ G;  2UXC H;  3U9T A;  4A2A A;  4C5A A;  3DF7 A;  2WB1 A;  3VPC A;  4DR2 H;  4XX0 B;  2NU9 B;  3BJY A;  3HXL A;  4JI2 H;  3RTX A;  5DG8 A;  5I47 A;  4A3K G;  1C3O A;  1B33 N;  1DGS A;  2ZDQ A;  5JH7 F;  2W7O A;  1E4E B;  4LFB H;  4RNN A;  3L4K A;  4GC7 A;  2V4R A;  4RAY A;  3V6K A;  4YQW A;  5IYZ F;  2AGQ A;  1RJQ A;  4DLK A;  1BNC A;  2WAQ E;  4HNT A;  5KT7 A;  4LF8 H;  2FJZ A;  4MA0 A;  4Q45 A;  4A3D G;  3N40 P;  3N42 B;  2J6U A;  4DUZ H;  3GIM A;  2FPP B;  1V4Y A;  3HOY G;  4I4T F;  4C5B A;  1S0O A;  3Q2O A;  4IRC A;  1CQI B;  5F9N A;  4EBE A;  4NLG A;  4ED6 A;  1TWF A;  3BQ2 A;  1Y14 B;  2C2D A;  3V6H A;  4WBN F;  1MZB A;  3K3V A;  3N44 B;  3RB3 A;  2YU9 A;  5KG7 A;  4A3I G;  1XMO H;  3FKI A;  2FLL A;  3OUZ A;  5K2M A;  2C2R A;  2NVY A;  4F50 A;  3FKI G;  3JAM W;  5IWA H;  2R8G A;  2JA6 A;  4F4Y A;  4RUC A;  5C44 G;  2XIG A;  1WCM A;  2FKL A;  1M6V A;  3RB4 A;  4TV8 F;  3MFI A;  3JRX A;  4UCU A;  4LF7 H;  4X62 H;  2FPG B;  4GKK H;  3PVX A;  1N32 H;  4UCR A;  3TQT A;  1IBM H;  4FBU A;  3KAJ A;  5CA1 F;  3WNZ A;  2HHH H;  2ATL A;  2W6Z A;  2YS7 A;  4UCT A;  4LFC H;  3PO3 G;  5FPO A;  2V58 A;  4O4I F;  2W6P A;  4ECY A;  2VUM A;  4ZHQ F;  4Q0Y A;  3RGX A;  1CE8 A;  2J6T A;  3OUU A;  1GSA A;  1GSO A;  3HOV G;  1TWG A;  3C0F B;  2UVV A;  1JDB B;  4AYB A;  1T36 A;  4IWY A;  5F9L A;  1KC7 A;  4ECS A;  5DG9 A;  2ASL A;  3GTJ A;  1N48 A;  2UU9 H;  3OSP A;  5KFS A;  4J9Q A;  1A0I A;  2FK3 A;  4J9M A;  3KHG A;  4QWD A;  4B3M H;  4EFB A;  4A3F G;  2UUC H;  4PDB A;  5HBR B;  5DGA A;  5KFY A;  5LMN H;  3H4B A;  3I12 A;  5KFI A;  5BR8 H;  5KFE A;  2SCU B;  3J80 W;  2C00 A;  5KFF A;  3FMA A;  5KX5 F;  2UVW A;  4A3C G;  2WE6 A;  4YJ3 F;  5FLX W;  1FJG H;  4O3P A;  1GGO A;  3RV3 A;  3K5H A;  3U9S A;  5KFT A;  4CC6 A;  4I55 F;  3ORQ A;  3RAX A;  4IRD A;  3I4M G;  1E4E A;  1I7N A;  3HB9 A;  2R86 A;  3Q8Q B;  2CW8 A;  3GII A;  3M9N B;  3MWE A;  3GTQ A;  2RDJ A;  2R92 A;  1PK8 A;  4R7R A;  4J9R A;  4UCV A;  1IOW A;  1VKZ A;  2Y0S A;  3H0G G;  3GIJ A;  5DQI A;  4JI5 H;  2UXD H;  4LSA A;  5KT3 A;  3Q8S B;  2W57 A;  5IP9 G;  4ECR A;  2FK1 A;  3CVZ A;  2PVP A;  4F4X A;  5L1K A;  2PBZ A;  4RB3 C;  4DV4 H;  5D8D A;  2OWO A;  1DV1 A;  4RAZ A;  4UFZ A;  5DQH A;  3G8C A;  4DR5 H;  1VBH A;  2GPW A;  5BMV F;  5D1P A;  4RNO A;  4F4W A;  4LF9 H;  5KFH A;  3GTG A;  3G6Y A;  3RBE A;  3KHL A;  5KFN A;  1Y1W A;  2NU8 B;  3R5H A;  4FBT A;  2DIK A;  3Q8P B;  4DR4 H;  5KFQ A;  1L2Z A;  1O75 A;  5KFJ A;  2DZD A;  3EPI A;  4QWA A;  1N56 A;  5L1J A;  1J5E H;  4ECQ A;  3K3P A;  5DG7 A;  2HVR A;  5KT5 A;  5IP7 G;  1GLV A;  1TAE A;  3RF2 A;  3FDS A;  3TQ1 A;  1XMQ H;  1XNR H;  1B04 A;  5KG0 A;  4EGQ A;  5EWF A;  2VPS A;  5KG5 A;  4DV5 H;  2IA6 A;  4UCO A;  4DV2 H;  3MR5 A;  3GTK A;  4IR9 A;  3E5N A;  5JVD F;  3EYY A;  4QIW A;  4X64 H;  4ED7 A;  4R8U A;  2WB1 E;  3M9O B;  2E2I A;  2DWC A;  5KFZ A;  2R87 A;  4YHH H;  1XDN A;  4FU0 A;  3RB0 A;  3Q1K A;  4APM A;  5DGB A;  2VPQ A;  4EYH B;  5L1L A;  4EBC A;  4A3L G;  1ULZ A;  4DL2 A;  3JRW A;  3OTO H;  2I80 A;  4LF6 H;  3TII A;  5KFM A;  4Q43 A;  4ECU A;  3LWB A;  2UVR A;  1XNQ H;  4LF4 H;  5KG2 A;  4WD3 A;  3VPD A;  2PN1 A;  3PR5 B;  3PZP A;  3JZI A;  3GTP A;  3BAB A;  5LYJ F;  3R5F A;  4TQS A;  3KHH A;  2FMA A;  2UUA H;  4Q8E A;  4YR2 A;  4EFE A;  2R8I A;  2W6M A;  3BQ0 A;  1WR2 A;  4Q44 A;  5CAE B;  3LML A;  1B6S A;  2PMZ A;  4LSX A;  3ETJ A;  1FKA H;  5KG4 A;  5KFR A;  4MTD A;  4DV1 H;  4MV8 A;  1T3N A;  2FLN A;  2R7L A;  4JI3 H;  2HGS A;  2XGQ A;  2ZDH A;  1KJ9 A;  2W6Q A;  4I7H A;  3ORR A;  4MV9 A;  3L2P A;  2IP4 A;  3PO2 G;  2R6F A;  4A3E G;  2WAQ A;  5LA6 F;  2V5A A;  2ASD A;  4O2A F;  1RK5 A;  1EUC B;  4IHJ F;  4B3T H;  4JI4 H;  4GKJ H;  1SEI A;  4OX9 H;  2V4Q A;  4IWX A;  1OWT A;  2Q2U A;  1BJT A;  1JKJ B;  5T14 A;  3OHA A;  1I7L A;  4ETS A;  1I94 H;  3L4J A;  2JA7 A;  4JV5 H;  4EG0 A;  2R8H A;  3KAL A;  1IOV A;  2OH2 A;  1ZET A;  2JA7 G;  1K1Q A;  1WSC A;  2IBK A;  4DUY H;  1CS0 A;  2X0S A;  3UFX B;  1AN7 A;  1UC9 A;  1V9P A;  4BBS G;  3HOX G;  2C2E A;  5C3E G;  2W9B B;  2B63 A;  4YP3 A;  2DPI A;  3QZ8 A;  2E2H A;  4R8U B;  3R5X A;  3T5K A;  2B63 G;  1I6U A;  4QJF A;  3KXY T;  4XYL B;  5KFO A;  1VAJ A;  2XCP A;  4IR1 A;  2YS6 A;  4BWS C;  5FD6 A;  5C8Y F;  4CC5 A;  4A3G G;  1N33 H;  1EYZ A;  2C28 A;  3IN5 A;  4B3R H;  4EEQ A;  2DPJ A;  2JEF A;  3M9M B;  4HR7 A;  2CZG A;  4ME6 A;  2GPS A;  2WYO A;  4O3N A;  4AYB E;  5KG3 A;  5EWE A;  1RYR A;  2NU6 B;  1N34 H;  2W9C A;  5KFD A;  1GSH A;  2YZM A;  1UNN C;  2J6S A;  5KFC A;  2RGV A;  4YB8 B;  5IYB G;  4J9L A;  4ECT A;  3T5L A;  1Z2O X;  1JDE A;  3KHR A;  2R82 A;  3H3V H;  4JI1 H;  1TWH A;  2YZG A;  3VMM A;  1S68 A;  4BBR G;  4I50 F; 
#chains in the Genus database with same CATH homology
 2VQE H;  5D1P A;  3HXL A;  4JI2 H;  3RTX A;  1HR0 H;  4LF9 H;  3RJ0 A;  4LMY A;  1DGS A;  5LL6 b;  4A2B A;  2CW7 A;  1FVI A;  2FE3 A;  3T1H H;  4LFB H;  4MV7 A;  4RB0 A;  1IBK H;  2UUB H;  5A2Q W;  3L4K A;  4DR4 H;  4FM9 A;  4RZQ A;  4RAY A;  1L2Z A;  1O75 A;  5D1O B;  4JI8 H;  4X66 H;  4JI6 H;  1VS0 A;  1J5E H;  4LF8 H;  2VUG A;  1GYF A;  4LFA H;  3N40 P;  3KAK A;  2HVR A;  3N42 B;  3F8N A;  1TAE A;  4DV0 H;  4DUZ H;  3RF2 A;  1XMQ H;  1XNR H;  3BA9 A;  1B04 A;  2HVQ A;  3RIZ A;  4DV7 H;  2VPS A;  4DV5 H;  3BA8 A;  4UCO A;  4IAJ A;  4YY3 H;  4DV2 H;  3EYY A;  5FD5 A;  4X64 H;  1BGW A;  4UCS A;  4DR3 H;  1E4G T;  1SYX B;  2O03 A;  2VOB A;  3MWM A;  3J81 W;  1HNW H;  4YHH H;  1XDN A;  2YCH A;  4JI0 H;  3T1Y H;  1MZB A;  3K3V A;  2ZJT A;  3N44 B;  4APM A;  1M0T A;  3OTO H;  1P8L A;  4LF6 H;  1XMO H;  1XNQ H;  4MTE A;  4LF4 H;  3JAM W;  5IWA H;  4LH6 A;  2VQF H;  2XIG A;  3BAB A;  4GLX A;  2UUA H;  5EOY A;  4DR5 H;  4NXM H;  4UCU A;  1S03 G;  4LF7 H;  4X62 H;  4EFE A;  4M7E A;  3PN1 A;  4GKK H;  4K0K H;  3LML A;  4UCR A;  1HNX H;  1N32 H;  1IBM H;  4LSX A;  3KAJ A;  2KSW A;  1FKA H;  1TA8 A;  2HHH H;  1E4F T;  1ZHQ A;  4MTD A;  4DV1 H;  4JI3 H;  4UCT A;  4LFC H;  2HGS A;  5FPO A;  1IBL H;  4X65 H;  3BAA A;  4I7H A;  4MV9 A;  4Q0Y A;  3RGX A;  3L2P A;  2UXB H;  1X9N A;  3C0F B;  4GKJ H;  4JI4 H;  5IT9 W;  2ZM6 H;  4B3T H;  2WDT A;  1SEI A;  3JSN A;  3N6X A;  4DV6 H;  4AQY H;  2E5L H;  2UU9 H;  4OX9 H;  4DR6 H;  4JYA H;  1M0W A;  1A0I A;  2Q2U A;  1BJT A;  4B3M H;  4EFB A;  4PDB A;  2UUC H;  4ETS A;  1I94 H;  3L4J A;  4LF5 H;  4JV5 H;  3N41 B;  3KAL A;  5LMN H;  4DUY H;  3H20 A;  1AN7 A;  4DV3 H;  1V9P A;  1ZHS A;  5BR8 H;  3J80 W;  3FMA A;  4LH7 A;  2WE6 A;  4NXN H;  5FLX W;  1FJG H;  4DR7 H;  3JSL A;  1I6U A;  3KXY T;  2RGR A;  4RB1 A;  5FD6 A;  4BWS C;  4CC5 A;  1WH2 A;  4CC6 A;  4J0M A;  4B3S H;  4JI7 H;  1N33 H;  1HNZ H;  1Z2P X;  4EEQ A;  4B3R H;  2CW8 A;  2F4V H;  5D1O A;  2WYO A;  4R7R A;  4UCV A;  3UQ8 A;  4RB2 C;  4KHP H;  3M4I A;  1N34 H;  3J7A K;  4JI5 H;  1N36 H;  2UXD H;  4LSA A;  2Q2T A;  2MCT A;  3IG0 A;  2W57 A;  3RGZ A;  4DR1 H;  2HVS A;  2UXC H;  3CVZ A;  2RGV A;  5FPR A;  4A2A A;  3DF7 A;  1Z2O X;  4RB3 C;  5LMU H;  4DV4 H;  4DR2 H;  2OWO A;  4JI1 H;  4RAZ A;  4UFZ A;  1Z2N X;  1S68 A;  3N43 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...