1L2ZA

Cd2bp2-gyf domain in complex with proline-rich cd2 tail segment peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
62
structure length
62
Chain Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2 ANTIGEN (CYTOPLASMIC TAIL)-BINDING PROTEIN 2
publication title Dynamic interaction of CD2 with the GYF and the SH3 domain of compartmentalized effector molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding/signaling protein
total genus 8
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2002-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02213 GYF GYF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.40 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 1l2zA00
1SYXB 1GYFA 1WH2A 3FMAA 1L2ZA 3K3VA 4BWSC
chains in the Genus database with same CATH superfamily
5L1LA 3Q2OA 3EPGA 3JZIA 2W8LA 4RZQA 3BQ1A 5DQHA 1S68A 3TQ1A 4MV7A 5KFIA 5L1IA 5KFCA 5KG5A 1VBGA 3HXLA 3IG0A 2JA7A 2YZMA 5DGAA 1VKZA 1B6SA 3LP8A 1GSHA 2XCLA 4XYLB 1KJIA 5DQGA 1WH2A 2SCUB 5KT4A 2R8HA 3RV3A 4F50A 1I94H 1TA8A 2B63A 1WR2A 4MV3A 4RB1A 1VBHA 3VPBA 4ZQIA 1ZHSA 4R8UB 4EYHB 3RF2A 3UQ8A 3T1HH 4J9OA 4DR5H 4Q45A 2ASDA 4LH6A 4ECWA 2VQEH 2X0SA 4MV9A 3RUPA 2Y0SE 1ZETA 2E2IA 4ED0A 3HKZA 4DR3H 4E4TA 4IRDA 4LFCH 4O3SA 3VPDA 3JSLA 4Q0YA 5C8YF 3WNZA 5EWEA 4CC6A 3QZ7A 4Q8FA 3N42B 2R7NA 2VUMG 3K5HA 4JI0H 3HOUG 3CVZA 4NLGA 5H80A 2IA6A 2W9CB 1XDNA 2JA5A 1PK8A 5IWAH 4ED1A 3JAMW 4ECZA 2PVPA 4UCRA 4G3IA 4MV1A 5DLGA 4DV5H 4LH7A 1FJGH 5IYDG 1C3OA 1V9PA 3EYYA 5EZYF 4LF9H 5FLMG 2WAQE 3GIPA 5KFPA 4HQ6A 4O3OA 3MR5A 2C35B 3GLKA 1KJJA 4ECVA 4GC7A 3T5HA 3GV5B 3GTLA 2C22A 1BGWA 2P0AA 5DQIA 2R82A 2YW2A 4R8UA 5KFGA 3GIQA 3KHLA 2UUCH 1OWTA 1E4EB 3KAKA 2FLPA 3M9MB 3HOVG 3I4NG 1I7NA 2R93G 1CE8A 2V5AA 2I8CA 5KG3A 4BBRG 5KFBA 2J6TA 4O2AF 1DIKA 3V4SA 2Q2UA 4DV4H 1HR0H 4A3LG 2FK1A 3CQZA 3EPIA 1S0OA 4XZ3B 4QWEA 4GKKH 2R92G 4ED6A 2HHHH 2KSWA 5L1JA 4EYIB 1Z2OX 4MAMA 3MWMA 3ORRA 4F4XA 5KFTA 2R6FA 4LSXA 3L4JA 2BQUA 2JEGA 2R8GA 2YU9A 5FPRA 4RAZA 5KFXA 4WBNF 4A3EG 3HOWG 3PW7A 5L9XA 3K3VA 1BNCA 4DL5A 4A3FG 3OSNA 4ECUA 4HNTA 1S03G 4TV8F 5JVLA 2CKZB 4J0MA 1TAEA 4ED7A 3T5JA 4A3MG 2C2RA 3Q1KA 1I7LA 4JI4H 3BA9A 4ZHQF 5KFDA 4YR3A 2UUBH 5T14A 2ZDGA 3T1YH 2YS6A 1S0MA 4QW8A 1AN7A 1E4EA 3R23A 2BQ3A 3H4DA 5FLXW 4J9RA 4GLXA 4O3RA 2W6OA 5BMVF 2NU8B 3G6XA 2ALZA 3H4BA 3T5KA 2XC9A 2JEJA 5KG1A 1KBLA 2GLTA 2YYAA 4DL6A 2W6MA 4GKJH 2CW7A 1B6RA 4UCSA 5KFUA 1B33N 5J2TF 2W8KA 4A3DG 4DV7H 2WE6A 4BY1G 3H20A 3QZ8A 4C2MA 5KG7A 4DL4A 5DGBA 3HB9A 1HNXH 4X62H 4J9QA 2HJWA 2AU0A 3Q8RB 1Y1VA 4EBDA 1GLVA 4J9SA 3I4MG 1V4YA 5FPOA 4JI7H 4MTDA 2UXCH 3N6XA 4DL2A 1A9XA 4DV3H 3LMLA 3R5HA 1J5EH 2R7ZG 4ECQA 4DLKA 3E5NA 1TWAA 2IMWP 3GIKA 2DWCA 3KHGA 3GILA 3SE7A 4RNMA 2FB9A 4RUCA 1FVIA 3RJ0A 3FDSA 3BJYA 3PO2G 4QWCA 5JH7F 2W9BB 5KFMA 4Q44A 3Q8PB 1ZQ7A 3H3VH 2HVQA 4JI5H 4RB0A 3RB0A 4JI8H 5LMNH 2JA6A 2IP4A 4MTEA 1EYZA 3VMMA 4JV2A 2ZDHA 5KX5F 5KFHA 2CQYA 3U9SA 2AGOA 2WYOA 2IBKA 2VA3A 2W6PA 1S97A 4RNOA 3PVXA 4J9KA 4LF6H 2QYZA 5DG9A 4BXXG 3RGZA 5KT6A 1ZHQA 2VOBA 4A93G 1VAJA 4ECYA 2V59A 2R86A 3BG5A 4PDBA 4FS1A 4HNUA 1T36A 5EWGA 4RZRA 4IRKA 3H40A 5EOYA 2DZDA 2VQDA 1JIHA 3K5IA 2RF4A 3BQ0A 3KALA 1E4FT 1X9NA 4TQRA 2VQFH 2YZNA 4LMYA 4RB2C 2JA8G 4APMA 2WDTA 1M0WA 4QIWA 1KJ9A 5FJ8G 3JRXA 2W9BA 4ECSA 2YRWA 3L4KA 2VPQA 2NU9B 2XGPA 2UXDH 1RJPA 4CC5A 4EFBA 1SCUB 4ECXA 4DR6H 3JSNA 3GQCA 2PMZA 2ZM6H 4FM9A 2WTFA 4ED8A 1GYFA 2RGVA 4I55F 4QJFA 1R9TA 3FMAA 4FU0A 4DR7H 3MWEA 4LF7H 1IBKH 2V4QA 1Z2PX 2W7PA 4K0KH 4DV6H 4NXNH 2O03A 5LA6F 2RDJA 4X64H 4OX9H 5CB4F 3LWBA 3RGXA 1TWHA 5KFNA 2ASLA 1RYRA 5K2MA 2NVXA 5KG2A 2WB1A 3PZPA 4B3RH 3ETHA 3N44B 1N56A 3T5LA 1RJQA 4TV9F 4L1KA 4UCOA 3SI8A 4JI3H 4I7HA 1XNQH 1DGSA 4EEQA 3GTQA 2I87A 2J6SA 3MR3A 4YR0A 1N48A 3PW4A 1KJ8A 3C0FB 4IZOA 3H0GG 3KXYT 3N43B 4ME6A 1TWFA 5KFVA 4A3IG 1I6UA 2YS7A 3N40P 2AGQA 5C1PA 4LF5H 5F9LA 1C30A 3GIJA 3OUZA 4A3BG 2DPJA 2XCAA 3MWDA 2OH2A 2FK2A 3MJFA 1ULZA 4X65H 4FBTA 2CZGA 1HNZH 1FKAH 5EWFA 2C2DA 4YP3A 2W9CA 4NXMH 4JYAH 5GONF 1HNWH 1UNNC 4ZOLF 4J9NA 4O2BF 3GV7B 5D1OB 5CA1F 4HNVA 5IP7G 2HVRA 2FPGB 1TWCA 4JI2H 1I50A 2VA2A 4YBZB 1AUXA 1W93A 5J2UF 3RB4A 2ATLA 1BJTA 3BA8A 2R7LA 4AYBA 3M9OB 2Q2TA 3RV4A 3GIIA 1IOWA 3PR5B 2V4RA 3M9NB 1S0NA 1WCMG 4BY7G 1MZBA 3JRWA 4LFAH 1XMQH 3K3PA 1AUVA 3PN1A 1CQJB 1Y1VG 3FKIA 3N8DA 4QIWE 5DLFA 2E5LH 4O4LF 5IYZF 4AQYH 5KT7A 1EUCB 3R5FA 1KJQA 5KFZA 3G6VA 4EFEA 5KFQA 3HKZE 1GSAA 4J9LA 2FE3A 1GO3E 2FPIB 1XNRH 2PMZE 2YZGA 1N34H 5C5JA 2R8JA 4FBUA 1Y1WG 5EDWA 1Y14B 4RU9A 5KT3A 2R7MA 1S10A 2R92A 1EHIA 2W57A 5KFAA 4UCUA 5BPHA 3NGDA 1IBLH 4A3JG 2Y0SA 3KTMA 2J6UA 5D1OA 1JX4A 2FP4B 4JUZA 4U6PA 2DIKA 4PWQA 1P8LA 1K83A 2R8KA 4A2BA 5KFFA 2HGSA 2WB1E 4BBSG 4UCTA 5C3EG 2GPSA 5KG6A 4IR9A 5KFRA 1WSCA 4RUAA 1XMOH 4MV6A 3M4IA 2J9GA 2R84A 5KFSA 4LFBH 4DL3A 2C00A 2JA7G 4C5AA 4O4IF 4HR7A 4YQWA 3MFIA 4QWBA 5D8DA 3BAAA 2FMAA 2UVRA 2B63G 2WAQA 2W9AA 3KHHA 5KFYA 1L2ZA 1K1SA 5BR8H 3V6KA 5LOVF 3F8NA 1GGOA 3PO3G 3TIGA 4YAKB 4EG0A 1TWGA 4IWYA 2FK3A 5D1PA 1KEEA 1T3NA 5HV6A 1EZ1A 4LSAA 5IP9G 3RIZA 5IYCG 2YL2A 4EGJA 5IT9W 3OSPA 2PN1A 4RNNA 1V51A 2QK4A 2HVSA 2UVWA 1N32H 4KHPH 2UVUA 2R7ZA 4DV1H 2BQRA 4AYBE 3RB6A 4BWSC 5KKNB 2JA5G 4J9PA 4JI1H 4IAJA 3I12A 1W96A 2UXBH 5KG0A 4DUYH 4C5CA 5DG7A 5LYJF 5LL6b 4A3CG 4EGQA 4DUZH 4RB3C 2VUGA 3ORQA 4Q43A 4GC6A 4DR1H 2DPIA 4A2AA 4LF8H 2V58A 2UU9H 2C28A 3GIDA 4JV5H 2ZJTA 3OTOH 1RJRA 4TQSA 2RGRA 4UFZA 3RBDA 3HOYG 4YHHH 4ECTA 3RBEA 2UVVA 3PW0A 2E2HA 5A2QW 5FD6A 3GTOA 4A3GG 4MA0A 4R7RA 4XX0B 4X66H 4QWDA 2W6NA 4U7CA 3HBLA 5LMUH 2AGPA 3OUUA 5F9NA 2M05A 2XIGA 5KFOA 2NUAB 4FS2A 2R7KA 3U9TA 3QFFA 4M9UA 3MR6A 2F4VH 5KFKA 2BR0A 2W6ZA 2C2EA 3MR2A 4EBCA 3KHRA 4A3KG 2R8IA 2NU7B 4YR2A 5CA0F 1BXRA 1M0TA 1S9FA 5JUMA 3V4ZA 1M6VA 4QWAA 2NU6B 4I50F 1I3QA 4IRCA 1EUDB 3WO1A 1IBMH 5LP6F 2V9WA 4B3TH 5I47A 4IHJF 4Y8VB 5KFWA 2VUMA 4O3NA 1K1QA 4B3MH 3FKIG 2R85A 3G8CA 2PBZA 5JQWA 3TQTA 5KFLA 2W71A 1M7JA 1GSOA 4O3QA 2DLNA 4ZI7F 3PW5A 4YY3H 2I80A 3J81W 4WD3A 5L1KA 3RAXA 2OLSA 1RK5A 2FKLA 2ASJA 3GTJA 4O3PA 2JEIA 2AQ4A 3Q8SB 2CW8A 3G6YA 1JDEA 3Q8QB 5BPFA 4C5BA 4XYMB 3DF7A 3L2PA 2R87A 4IWXA 3GV8B 1CS0A 3J80W 3IN5A 2XGQA 2R93A 5KT5A 4ED3A 3RAQA 4DV2H 1JKJB 3H0GA 2ZDQA 4IR1A 3HOZG 2W7OA 3GIMA 4B3SH 1JLLB 2VR1A 2NVYA 5KG4A 1KC7A 2FJZA 4DV0H 2FLNA 1UC9A 3TIIA 5DG8A 1DV2A 3TINA 2FPPB 5KFJA 5C44G 1SFOA 4YJ2F 5CAEB 4YJ3F 4DR2H 4DL7A 1JXLA 2JA6G 4MA5A 3OHBA 2W70A 3MFHA 4J9MA 4Q8EA 2XCPA 2MCTA 3UFXB 1N36H 4LF4H 1A0IA 1T94A 1Z2NX 3RTXA 1JDBB 4M7EA 2VPSA 5FD5A 3PR4A 3HOXG 1DV1A 1IOVA 4MV8A 3J7AK 3GTPA 3KAJA 4DR4H 2RDIA 3ETJA 4YB8B 3BQ2A 2XD4A 4TUYF 4UCVA 4ECRA 5C4XG 3WO0A 3V6JA 3RB3A 1E4GT 3V6HA 1SEIA 3GTMA 1WCMA 4I4TF 4MV4A 3AYHB 2OWOA 1SYXB 1VS0A 4JV1A 4ETSA 5IYBG 3OHAA 3VPCA 1RYSA 4ED2A 4QW9A 5JVDF 4EEYA 3GTGA 4YAJB 2UUAH 1RK6A 5KFEA 2JEFA 3PW2A 4EBEA 4F4ZA 2FLLA 1UC8A 4O4HF 3N41B 5C1OA 2YRXA 1CQIB 1O75A 4HYKA 4JI6H 1Y1WA 3BABA 2YCHA 4JV0A 1B04A 4F4YA 2W6QA 5LXTF 1PX2A 3RFCA 4RAYA 3R5XA 5KT2A 2GPWA 4F4WA 5HBRB 3GTKA 1N33H
chains in the Genus database with same CATH topology
5LMUH 2WE6A 4DV7H 3H20A 1HNXH 2XIGA 4JI2H 4X62H 1BJTA 3BA8A 4RZQA 4JI7H 5FPOA 2Q2TA 2F4VH 4MTDA 2UXCH 3N6XA 1S68A 4MV7A 4DV3H 3LMLA 1J5EH 3HXLA 3IG0A 1MZBA 4LFAH 1XMQH 1M0TA 3PN1A 1FVIA 3RJ0A 1WH2A 1I94H 1TA8A 2E5LH 4RB1A 4AQYH 2HVQA 1IBMH 4RB0A 4B3TH 3T1HH 5LMNH 1ZHSA 4JI5H 4JI8H 3RF2A 3UQ8A 4EFEA 4MTEA 4DR5H 4LH6A 2FE3A 2VQEH 1XNRH 4B3MH 4MV9A 1N34H 2WYOA 4DR3H 2W57A 4LF6H 4LFCH 4UCUA 1IBLH 3JSLA 4Q0YA 3RGZA 1ZHQA 2VOBA 5D1OA 4CC6A 3N42B 4JI0H 4YY3H 3J81W 3CVZA 1P8LA 4PDBA 2CW8A 1XDNA 4A2BA 5IWAH 3JAMW 2HGSA 4UCRA 5EOYA 3DF7A 4UCTA 3L2PA 4DV5H 4LH7A 3KALA 3J80W 1XMOH 1E4FT 3M4IA 1V9PA 3EYYA 1X9NA 2VQFH 4LF9H 4LMYA 4RB2C 1FJGH 4LFBH 4DV2H 4APMA 2WDTA 1M0WA 4B3SH 3BAAA 4DV0H 1BGWA 3L4KA 2UXDH 4CC5A 4EFBA 2UUCH 4DR6H 3JSNA 1L2ZA 3KAKA 4DR2H 5BR8H 2ZM6H 4FM9A 3F8NA 1GYFA 2RGVA 2Q2UA 2MCTA 4DV4H 1HR0H 1N36H 3FMAA 4LF4H 1A0IA 4DR7H 4LF7H 1Z2NX 5D1PA 3RTXA 4M7EA 1IBKH 4GKKH 2VPSA 1Z2PX 5FD5A 2HHHH 4K0KH 2KSWA 4DV6H 1Z2OX 4LSAA 3MWMA 4NXNH 2O03A 3RIZA 4OX9H 4X64H 3J7AK 5IT9W 3KAJA 3RGXA 4LSXA 3L4JA 2HVSA 4DR4H 1N32H 5FPRA 4RAZA 4UCVA 4KHPH 4B3RH 3N44B 4DV1H 1E4GT 3K3VA 1SEIA 4BWSC 2OWOA 1SYXB 4UCOA 1VS0A 4IAJA 4JI1H 4JI3H 4I7HA 1XNQH 2UXBH 1DGSA 4EEQA 1S03G 4ETSA 4DUYH 4J0MA 1TAEA 4JI4H 3C0FB 5LL6b 3BA9A 4DUZH 3KXYT 3N43B 4RB3C 2VUGA 2UUBH 1N33H 1I6UA 2UUAH 3N40P 3T1YH 4DR1H 4LF5H 1AN7A 4A2AA 5FLXW 4JI6H 4LF8H 3N41B 4GLXA 2UU9H 1O75A 4JV5H 2ZJTA 3OTOH 3BABA 2YCHA 1B04A 2RGRA 4UFZA 4X65H 4YHHH 4RAYA 1HNZH 4GKJH 2CW7A 5A2QW 5FD6A 1FKAH 4NXMH 4R7RA 4JYAH 4UCSA 4X66H 1HNWH 2HVRA 5D1OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYX B;  1GYF A;  1WH2 A;  3FMA A;  1L2Z A;  3K3V A;  4BWS C; 
#chains in the Genus database with same CATH topology
 5L1L A;  3Q2O A;  3EPG A;  3JZI A;  2W8L A;  4RZQ A;  3BQ1 A;  5DQH A;  1S68 A;  3TQ1 A;  4MV7 A;  5KFI A;  5L1I A;  5KFC A;  5KG5 A;  1VBG A;  3HXL A;  3IG0 A;  2JA7 A;  2YZM A;  5DGA A;  1VKZ A;  1B6S A;  3LP8 A;  1GSH A;  2XCL A;  4XYL B;  1KJI A;  5DQG A;  1WH2 A;  2SCU B;  5KT4 A;  2R8H A;  3RV3 A;  4F50 A;  1I94 H;  1TA8 A;  2B63 A;  1WR2 A;  4MV3 A;  4RB1 A;  1VBH A;  3VPB A;  4ZQI A;  1ZHS A;  4R8U B;  4EYH B;  3RF2 A;  3UQ8 A;  3T1H H;  4J9O A;  4DR5 H;  4Q45 A;  2ASD A;  4LH6 A;  4ECW A;  2VQE H;  2X0S A;  4MV9 A;  3RUP A;  2Y0S E;  1ZET A;  2E2I A;  4ED0 A;  3HKZ A;  4DR3 H;  4E4T A;  4IRD A;  4LFC H;  4O3S A;  3VPD A;  3JSL A;  4Q0Y A;  5C8Y F;  3WNZ A;  5EWE A;  4CC6 A;  3QZ7 A;  4Q8F A;  3N42 B;  2R7N A;  2VUM G;  3K5H A;  4JI0 H;  3HOU G;  3CVZ A;  4NLG A;  5H80 A;  2IA6 A;  2W9C B;  1XDN A;  2JA5 A;  1PK8 A;  5IWA H;  4ED1 A;  3JAM W;  4ECZ A;  2PVP A;  4UCR A;  4G3I A;  4MV1 A;  5DLG A;  4DV5 H;  4LH7 A;  1FJG H;  5IYD G;  1C3O A;  1V9P A;  3EYY A;  5EZY F;  4LF9 H;  5FLM G;  2WAQ E;  3GIP A;  5KFP A;  4HQ6 A;  4O3O A;  3MR5 A;  2C35 B;  3GLK A;  1KJJ A;  4ECV A;  4GC7 A;  3T5H A;  3GV5 B;  3GTL A;  2C22 A;  1BGW A;  2P0A A;  5DQI A;  2R82 A;  2YW2 A;  4R8U A;  5KFG A;  3GIQ A;  3KHL A;  2UUC H;  1OWT A;  1E4E B;  3KAK A;  2FLP A;  3M9M B;  3HOV G;  3I4N G;  1I7N A;  2R93 G;  1CE8 A;  2V5A A;  2I8C A;  5KG3 A;  4BBR G;  5KFB A;  2J6T A;  4O2A F;  1DIK A;  3V4S A;  2Q2U A;  4DV4 H;  1HR0 H;  4A3L G;  2FK1 A;  3CQZ A;  3EPI A;  1S0O A;  4XZ3 B;  4QWE A;  4GKK H;  2R92 G;  4ED6 A;  2HHH H;  2KSW A;  5L1J A;  4EYI B;  1Z2O X;  4MAM A;  3MWM A;  3ORR A;  4F4X A;  5KFT A;  2R6F A;  4LSX A;  3L4J A;  2BQU A;  2JEG A;  2R8G A;  2YU9 A;  5FPR A;  4RAZ A;  5KFX A;  4WBN F;  4A3E G;  3HOW G;  3PW7 A;  5L9X A;  3K3V A;  1BNC A;  4DL5 A;  4A3F G;  3OSN A;  4ECU A;  4HNT A;  1S03 G;  4TV8 F;  5JVL A;  2CKZ B;  4J0M A;  1TAE A;  4ED7 A;  3T5J A;  4A3M G;  2C2R A;  3Q1K A;  1I7L A;  4JI4 H;  3BA9 A;  4ZHQ F;  5KFD A;  4YR3 A;  2UUB H;  5T14 A;  2ZDG A;  3T1Y H;  2YS6 A;  1S0M A;  4QW8 A;  1AN7 A;  1E4E A;  3R23 A;  2BQ3 A;  3H4D A;  5FLX W;  4J9R A;  4GLX A;  4O3R A;  2W6O A;  5BMV F;  2NU8 B;  3G6X A;  2ALZ A;  3H4B A;  3T5K A;  2XC9 A;  2JEJ A;  5KG1 A;  1KBL A;  2GLT A;  2YYA A;  4DL6 A;  2W6M A;  4GKJ H;  2CW7 A;  1B6R A;  4UCS A;  5KFU A;  1B33 N;  5J2T F;  2W8K A;  4A3D G;  4DV7 H;  2WE6 A;  4BY1 G;  3H20 A;  3QZ8 A;  4C2M A;  5KG7 A;  4DL4 A;  5DGB A;  3HB9 A;  1HNX H;  4X62 H;  4J9Q A;  2HJW A;  2AU0 A;  3Q8R B;  1Y1V A;  4EBD A;  1GLV A;  4J9S A;  3I4M G;  1V4Y A;  5FPO A;  4JI7 H;  4MTD A;  2UXC H;  3N6X A;  4DL2 A;  1A9X A;  4DV3 H;  3LML A;  3R5H A;  1J5E H;  2R7Z G;  4ECQ A;  4DLK A;  3E5N A;  1TWA A;  2IMW P;  3GIK A;  2DWC A;  3KHG A;  3GIL A;  3SE7 A;  4RNM A;  2FB9 A;  4RUC A;  1FVI A;  3RJ0 A;  3FDS A;  3BJY A;  3PO2 G;  4QWC A;  5JH7 F;  2W9B B;  5KFM A;  4Q44 A;  3Q8P B;  1ZQ7 A;  3H3V H;  2HVQ A;  4JI5 H;  4RB0 A;  3RB0 A;  4JI8 H;  5LMN H;  2JA6 A;  2IP4 A;  4MTE A;  1EYZ A;  3VMM A;  4JV2 A;  2ZDH A;  5KX5 F;  5KFH A;  2CQY A;  3U9S A;  2AGO A;  2WYO A;  2IBK A;  2VA3 A;  2W6P A;  1S97 A;  4RNO A;  3PVX A;  4J9K A;  4LF6 H;  2QYZ A;  5DG9 A;  4BXX G;  3RGZ A;  5KT6 A;  1ZHQ A;  2VOB A;  4A93 G;  1VAJ A;  4ECY A;  2V59 A;  2R86 A;  3BG5 A;  4PDB A;  4FS1 A;  4HNU A;  1T36 A;  5EWG A;  4RZR A;  4IRK A;  3H40 A;  5EOY A;  2DZD A;  2VQD A;  1JIH A;  3K5I A;  2RF4 A;  3BQ0 A;  3KAL A;  1E4F T;  1X9N A;  4TQR A;  2VQF H;  2YZN A;  4LMY A;  4RB2 C;  2JA8 G;  4APM A;  2WDT A;  1M0W A;  4QIW A;  1KJ9 A;  5FJ8 G;  3JRX A;  2W9B A;  4ECS A;  2YRW A;  3L4K A;  2VPQ A;  2NU9 B;  2XGP A;  2UXD H;  1RJP A;  4CC5 A;  4EFB A;  1SCU B;  4ECX A;  4DR6 H;  3JSN A;  3GQC A;  2PMZ A;  2ZM6 H;  4FM9 A;  2WTF A;  4ED8 A;  1GYF A;  2RGV A;  4I55 F;  4QJF A;  1R9T A;  3FMA A;  4FU0 A;  4DR7 H;  3MWE A;  4LF7 H;  1IBK H;  2V4Q A;  1Z2P X;  2W7P A;  4K0K H;  4DV6 H;  4NXN H;  2O03 A;  5LA6 F;  2RDJ A;  4X64 H;  4OX9 H;  5CB4 F;  3LWB A;  3RGX A;  1TWH A;  5KFN A;  2ASL A;  1RYR A;  5K2M A;  2NVX A;  5KG2 A;  2WB1 A;  3PZP A;  4B3R H;  3ETH A;  3N44 B;  1N56 A;  3T5L A;  1RJQ A;  4TV9 F;  4L1K A;  4UCO A;  3SI8 A;  4JI3 H;  4I7H A;  1XNQ H;  1DGS A;  4EEQ A;  3GTQ A;  2I87 A;  2J6S A;  3MR3 A;  4YR0 A;  1N48 A;  3PW4 A;  1KJ8 A;  3C0F B;  4IZO A;  3H0G G;  3KXY T;  3N43 B;  4ME6 A;  1TWF A;  5KFV A;  4A3I G;  1I6U A;  2YS7 A;  3N40 P;  2AGQ A;  5C1P A;  4LF5 H;  5F9L A;  1C30 A;  3GIJ A;  3OUZ A;  4A3B G;  2DPJ A;  2XCA A;  3MWD A;  2OH2 A;  2FK2 A;  3MJF A;  1ULZ A;  4X65 H;  4FBT A;  2CZG A;  1HNZ H;  1FKA H;  5EWF A;  2C2D A;  4YP3 A;  2W9C A;  4NXM H;  4JYA H;  5GON F;  1HNW H;  1UNN C;  4ZOL F;  4J9N A;  4O2B F;  3GV7 B;  5D1O B;  5CA1 F;  4HNV A;  5IP7 G;  2HVR A;  2FPG B;  1TWC A;  4JI2 H;  1I50 A;  2VA2 A;  4YBZ B;  1AUX A;  1W93 A;  5J2U F;  3RB4 A;  2ATL A;  1BJT A;  3BA8 A;  2R7L A;  4AYB A;  3M9O B;  2Q2T A;  3RV4 A;  3GII A;  1IOW A;  3PR5 B;  2V4R A;  3M9N B;  1S0N A;  1WCM G;  4BY7 G;  1MZB A;  3JRW A;  4LFA H;  1XMQ H;  3K3P A;  1AUV A;  3PN1 A;  1CQJ B;  1Y1V G;  3FKI A;  3N8D A;  4QIW E;  5DLF A;  2E5L H;  4O4L F;  5IYZ F;  4AQY H;  5KT7 A;  1EUC B;  3R5F A;  1KJQ A;  5KFZ A;  3G6V A;  4EFE A;  5KFQ A;  3HKZ E;  1GSA A;  4J9L A;  2FE3 A;  1GO3 E;  2FPI B;  1XNR H;  2PMZ E;  2YZG A;  1N34 H;  5C5J A;  2R8J A;  4FBU A;  1Y1W G;  5EDW A;  1Y14 B;  4RU9 A;  5KT3 A;  2R7M A;  1S10 A;  2R92 A;  1EHI A;  2W57 A;  5KFA A;  4UCU A;  5BPH A;  3NGD A;  1IBL H;  4A3J G;  2Y0S A;  3KTM A;  2J6U A;  5D1O A;  1JX4 A;  2FP4 B;  4JUZ A;  4U6P A;  2DIK A;  4PWQ A;  1P8L A;  1K83 A;  2R8K A;  4A2B A;  5KFF A;  2HGS A;  2WB1 E;  4BBS G;  4UCT A;  5C3E G;  2GPS A;  5KG6 A;  4IR9 A;  5KFR A;  1WSC A;  4RUA A;  1XMO H;  4MV6 A;  3M4I A;  2J9G A;  2R84 A;  5KFS A;  4LFB H;  4DL3 A;  2C00 A;  2JA7 G;  4C5A A;  4O4I F;  4HR7 A;  4YQW A;  3MFI A;  4QWB A;  5D8D A;  3BAA A;  2FMA A;  2UVR A;  2B63 G;  2WAQ A;  2W9A A;  3KHH A;  5KFY A;  1L2Z A;  1K1S A;  5BR8 H;  3V6K A;  5LOV F;  3F8N A;  1GGO A;  3PO3 G;  3TIG A;  4YAK B;  4EG0 A;  1TWG A;  4IWY A;  2FK3 A;  5D1P A;  1KEE A;  1T3N A;  5HV6 A;  1EZ1 A;  4LSA A;  5IP9 G;  3RIZ A;  5IYC G;  2YL2 A;  4EGJ A;  5IT9 W;  3OSP A;  2PN1 A;  4RNN A;  1V51 A;  2QK4 A;  2HVS A;  2UVW A;  1N32 H;  4KHP H;  2UVU A;  2R7Z A;  4DV1 H;  2BQR A;  4AYB E;  3RB6 A;  4BWS C;  5KKN B;  2JA5 G;  4J9P A;  4JI1 H;  4IAJ A;  3I12 A;  1W96 A;  2UXB H;  5KG0 A;  4DUY H;  4C5C A;  5DG7 A;  5LYJ F;  5LL6 b;  4A3C G;  4EGQ A;  4DUZ H;  4RB3 C;  2VUG A;  3ORQ A;  4Q43 A;  4GC6 A;  4DR1 H;  2DPI A;  4A2A A;  4LF8 H;  2V58 A;  2UU9 H;  2C28 A;  3GID A;  4JV5 H;  2ZJT A;  3OTO H;  1RJR A;  4TQS A;  2RGR A;  4UFZ A;  3RBD A;  3HOY G;  4YHH H;  4ECT A;  3RBE A;  2UVV A;  3PW0 A;  2E2H A;  5A2Q W;  5FD6 A;  3GTO A;  4A3G G;  4MA0 A;  4R7R A;  4XX0 B;  4X66 H;  4QWD A;  2W6N A;  4U7C A;  3HBL A;  5LMU H;  2AGP A;  3OUU A;  5F9N A;  2M05 A;  2XIG A;  5KFO A;  2NUA B;  4FS2 A;  2R7K A;  3U9T A;  3QFF A;  4M9U A;  3MR6 A;  2F4V H;  5KFK A;  2BR0 A;  2W6Z A;  2C2E A;  3MR2 A;  4EBC A;  3KHR A;  4A3K G;  2R8I A;  2NU7 B;  4YR2 A;  5CA0 F;  1BXR A;  1M0T A;  1S9F A;  5JUM A;  3V4Z A;  1M6V A;  4QWA A;  2NU6 B;  4I50 F;  1I3Q A;  4IRC A;  1EUD B;  3WO1 A;  1IBM H;  5LP6 F;  2V9W A;  4B3T H;  5I47 A;  4IHJ F;  4Y8V B;  5KFW A;  2VUM A;  4O3N A;  1K1Q A;  4B3M H;  3FKI G;  2R85 A;  3G8C A;  2PBZ A;  5JQW A;  3TQT A;  5KFL A;  2W71 A;  1M7J A;  1GSO A;  4O3Q A;  2DLN A;  4ZI7 F;  3PW5 A;  4YY3 H;  2I80 A;  3J81 W;  4WD3 A;  5L1K A;  3RAX A;  2OLS A;  1RK5 A;  2FKL A;  2ASJ A;  3GTJ A;  4O3P A;  2JEI A;  2AQ4 A;  3Q8S B;  2CW8 A;  3G6Y A;  1JDE A;  3Q8Q B;  5BPF A;  4C5B A;  4XYM B;  3DF7 A;  3L2P A;  2R87 A;  4IWX A;  3GV8 B;  1CS0 A;  3J80 W;  3IN5 A;  2XGQ A;  2R93 A;  5KT5 A;  4ED3 A;  3RAQ A;  4DV2 H;  1JKJ B;  3H0G A;  2ZDQ A;  4IR1 A;  3HOZ G;  2W7O A;  3GIM A;  4B3S H;  1JLL B;  2VR1 A;  2NVY A;  5KG4 A;  1KC7 A;  2FJZ A;  4DV0 H;  2FLN A;  1UC9 A;  3TII A;  5DG8 A;  1DV2 A;  3TIN A;  2FPP B;  5KFJ A;  5C44 G;  1SFO A;  4YJ2 F;  5CAE B;  4YJ3 F;  4DR2 H;  4DL7 A;  1JXL A;  2JA6 G;  4MA5 A;  3OHB A;  2W70 A;  3MFH A;  4J9M A;  4Q8E A;  2XCP A;  2MCT A;  3UFX B;  1N36 H;  4LF4 H;  1A0I A;  1T94 A;  1Z2N X;  3RTX A;  1JDB B;  4M7E A;  2VPS A;  5FD5 A;  3PR4 A;  3HOX G;  1DV1 A;  1IOV A;  4MV8 A;  3J7A K;  3GTP A;  3KAJ A;  4DR4 H;  2RDI A;  3ETJ A;  4YB8 B;  3BQ2 A;  2XD4 A;  4TUY F;  4UCV A;  4ECR A;  5C4X G;  3WO0 A;  3V6J A;  3RB3 A;  1E4G T;  3V6H A;  1SEI A;  3GTM A;  1WCM A;  4I4T F;  4MV4 A;  3AYH B;  2OWO A;  1SYX B;  1VS0 A;  4JV1 A;  4ETS A;  5IYB G;  3OHA A;  3VPC A;  1RYS A;  4ED2 A;  4QW9 A;  5JVD F;  4EEY A;  3GTG A;  4YAJ B;  2UUA H;  1RK6 A;  5KFE A;  2JEF A;  3PW2 A;  4EBE A;  4F4Z A;  2FLL A;  1UC8 A;  4O4H F;  3N41 B;  5C1O A;  2YRX A;  1CQI B;  1O75 A;  4HYK A;  4JI6 H;  1Y1W A;  3BAB A;  2YCH A;  4JV0 A;  1B04 A;  4F4Y A;  2W6Q A;  5LXT F;  1PX2 A;  3RFC A;  4RAY A;  3R5X A;  5KT2 A;  2GPW A;  4F4W A;  5HBR B;  3GTK A;  1N33 H; 
#chains in the Genus database with same CATH homology
 5LMU H;  2WE6 A;  4DV7 H;  3H20 A;  1HNX H;  2XIG A;  4JI2 H;  4X62 H;  1BJT A;  3BA8 A;  4RZQ A;  4JI7 H;  5FPO A;  2Q2T A;  2F4V H;  4MTD A;  2UXC H;  3N6X A;  1S68 A;  4MV7 A;  4DV3 H;  3LML A;  1J5E H;  3HXL A;  3IG0 A;  1MZB A;  4LFA H;  1XMQ H;  1M0T A;  3PN1 A;  1FVI A;  3RJ0 A;  1WH2 A;  1I94 H;  1TA8 A;  2E5L H;  4RB1 A;  4AQY H;  2HVQ A;  1IBM H;  4RB0 A;  4B3T H;  3T1H H;  5LMN H;  1ZHS A;  4JI5 H;  4JI8 H;  3RF2 A;  3UQ8 A;  4EFE A;  4MTE A;  4DR5 H;  4LH6 A;  2FE3 A;  2VQE H;  1XNR H;  4B3M H;  4MV9 A;  1N34 H;  2WYO A;  4DR3 H;  2W57 A;  4LF6 H;  4LFC H;  4UCU A;  1IBL H;  3JSL A;  4Q0Y A;  3RGZ A;  1ZHQ A;  2VOB A;  5D1O A;  4CC6 A;  3N42 B;  4JI0 H;  4YY3 H;  3J81 W;  3CVZ A;  1P8L A;  4PDB A;  2CW8 A;  1XDN A;  4A2B A;  5IWA H;  3JAM W;  2HGS A;  4UCR A;  5EOY A;  3DF7 A;  4UCT A;  3L2P A;  4DV5 H;  4LH7 A;  3KAL A;  3J80 W;  1XMO H;  1E4F T;  3M4I A;  1V9P A;  3EYY A;  1X9N A;  2VQF H;  4LF9 H;  4LMY A;  4RB2 C;  1FJG H;  4LFB H;  4DV2 H;  4APM A;  2WDT A;  1M0W A;  4B3S H;  3BAA A;  4DV0 H;  1BGW A;  3L4K A;  2UXD H;  4CC5 A;  4EFB A;  2UUC H;  4DR6 H;  3JSN A;  1L2Z A;  3KAK A;  4DR2 H;  5BR8 H;  2ZM6 H;  4FM9 A;  3F8N A;  1GYF A;  2RGV A;  2Q2U A;  2MCT A;  4DV4 H;  1HR0 H;  1N36 H;  3FMA A;  4LF4 H;  1A0I A;  4DR7 H;  4LF7 H;  1Z2N X;  5D1P A;  3RTX A;  4M7E A;  1IBK H;  4GKK H;  2VPS A;  1Z2P X;  5FD5 A;  2HHH H;  4K0K H;  2KSW A;  4DV6 H;  1Z2O X;  4LSA A;  3MWM A;  4NXN H;  2O03 A;  3RIZ A;  4OX9 H;  4X64 H;  3J7A K;  5IT9 W;  3KAJ A;  3RGX A;  4LSX A;  3L4J A;  2HVS A;  4DR4 H;  1N32 H;  5FPR A;  4RAZ A;  4UCV A;  4KHP H;  4B3R H;  3N44 B;  4DV1 H;  1E4G T;  3K3V A;  1SEI A;  4BWS C;  2OWO A;  1SYX B;  4UCO A;  1VS0 A;  4IAJ A;  4JI1 H;  4JI3 H;  4I7H A;  1XNQ H;  2UXB H;  1DGS A;  4EEQ A;  1S03 G;  4ETS A;  4DUY H;  4J0M A;  1TAE A;  4JI4 H;  3C0F B;  5LL6 b;  3BA9 A;  4DUZ H;  3KXY T;  3N43 B;  4RB3 C;  2VUG A;  2UUB H;  1N33 H;  1I6U A;  2UUA H;  3N40 P;  3T1Y H;  4DR1 H;  4LF5 H;  1AN7 A;  4A2A A;  5FLX W;  4JI6 H;  4LF8 H;  3N41 B;  4GLX A;  2UU9 H;  1O75 A;  4JV5 H;  2ZJT A;  3OTO H;  3BAB A;  2YCH A;  1B04 A;  2RGR A;  4UFZ A;  4X65 H;  4YHH H;  4RAY A;  1HNZ H;  4GKJ H;  2CW7 A;  5A2Q W;  5FD6 A;  1FKA H;  4NXM H;  4R7R A;  4JYA H;  4UCS A;  4X66 H;  1HNW H;  2HVR A;  5D1O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...