4A3CG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3cG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3cG01
2ZTEA 4LFCL 4DR2Q 1Y14B 3PF4A 1N9WA 3CCEA 2HHHQ 4A3LH 1H95A 3W1GA 1GM5A 5IYBG 5FJ8H 5JEAJ 2OCEA 4RG1A 3PIOA 1LTLA 1L2FA 1N36Q 3JAMi 1X3FA 2NVYH 4B3MQ 3KOJA 1SR3A 4P73A 4PZ6A 4TVAB 4YWKA 2R92G 4LFBL 5C0XJ 2UU9Q 4JI5Q 4DR2L 2N49A 2Y0SE 1VQ4A 1MJEA 1X55A 2VNUD 3D0FA 4L5QA 4HJ9A 5C0XG 1OXTA 3H3VI 2R6GA 1N8RC 2VUMH 4DKAC 4PZ7A 1N36L 4R4QA 1PYBA 4B3ML 4DV6Q 4DV0Q 1I94Q 5GROA 3HFZB 5IWAQ 2AWOA 1Y1VH 1IZ6A 5M5WH 4BY7G 4X66L 2JA5H 4JI2L 3CCJA 2Z6KA 2VQEL 1VS0A 4LW1A 3JC66 4AQYL 2JA9A 2R7DA 4HIOA 3UDGA 3J80i 4YY3Q 2Q2HA 3NEMA 4DV6L 3CF5A 4DV0L 1I94L 3PUVA 4DV4Q 1VCIA 1HZBA 3FKIG 1Z9FA 4IJLA 4A3MG 1S72A 4AIMA 3ULPA 2E2IH 4IFDI 1NE3A 1WCMG 4YCVA 4GLAC 2UXDQ 3I55A 4JBWA 2F4VQ 3CMAA 4OONA 2K5VA 2UXCQ 4DV5Q 3KLWA 3J7ZC 2B63G 1YI2A 1VQ8A 2WAQG 4A3KG 3TQYA 4YY3L 4HIMA 1YJ9A 4BXXH 4IO9A 5GQOA 4A3JH 4DR7L 5IT9c 4DV7Q 1VQJA 3H0GG 2CFMA 3K80C 3M4QA 1PH9A 1YJWA 3EN2A 4A75A 3CCUA 3HOYG 2UXDL 4X6AH 2GN5A 4JG2A 2UXCL 2AKWB 2HIVA 4DV5L 1GD7A 4LFAL 1E22A 1EYGA 1Y1WG 2Z6KC 5GAEC 3RNUA 3PO2H 3Q8DA 1IXRA 3HOZH 1OTCA 3CCMA 2VQFQ 2V1CC 1YHQA 4BY1H 3KF6B 4DAMA 3F2CA 1K73C 4NXNL 1BBWA 5M3FG 1TWCH 1Z47A 4GOPC 4C3JH 3DM3A 4JI0L 4IOCA 1K3RA 3RZOH 1MJCA 2HQLA 2NN6G 4HJ8A 1E3PA 1J6QA 2K75A 4HJ7A 2E2HH 1EIFA 3ULJA 3S14H 1FL0A 2N78A 1KL9A 2NVXH 3FHWA 4POFA 1EUJA 1NMFA 1YJNA 3HOWG 1I5FA 4BA1I 3TRZA 4H02A 1V1QA 3GTLH 3KDFA 2A19A 3CCVA 1N33L 1HR0Q 3U50C 2AWNA 1C7YA 3CD6A 4LF4Q 4JV5L 2Y0SG 3BZCA 3CMEA 3U58A 2KCMA 4QL5A 3S2HH 2JA7H 3RLOA 3KJOA 1YNXA 4FDBA 3U4VA 4EQ5A 1VQ9A 4B3RQ 3GO5A 4KHPL 1IBLQ 1QZGA 4DR4Q 4MNOA 2PQAB 4NB3A 4BBRH 4HJAA 1U5KA 4P72A 4MTNA 3CC2A 2WFWA 4GLVB 3PUXA 5IP9G 1AE2A 2OTLA 3A0JA 1OXVA 3B6YA 1N34Q 3CC4A 4LF4L 1XMOL 3PIPA 1EQRA 3PO3H 1BKBA 4JYAQ 4B3RL 3KF6A 4UPAA 1IBLL 1DGSA 1LYLA 1PH5A 2OWOA 4LNQA 2N8NA 4PZ8A 4DR5Q 1N32Q 3CAMA 1PFSA 4Y7NH 4LF9Q 1JJCB 5E7NA 2IHFA 3GTOH 3CCRA 3RN2A 3CPFA 2OQ0A 2ZJPA 4LFCQ 3S15H 1G291 3UE0A 1CKOA 1OXSC 5FLMG 1N34L 2Q2UA 3OYYA 3CQZH 1HNZQ 2NZOA 5C4XG 3VDYA 1NBWA 4A3JG 4JYAL 4HIDA 1HNXL 5ELNA 1CKNB 4NXML 4DUYL 2JQOA 1VQ6A 3I4NH 3BU2A 3K7AH 1D7QA 2QA4A 4LF9L 3WWVA 2ZTCA 4R4CA 4DNIA 4DUZL 1WOCA 4AH6A 4DR1L 4HJ5A 3CCSA 4OWWB 3S2DH 4A3CG 4LFBQ 2YYZA 4IFDJ 3HOXG 4JI1Q 5AJ3L 2UUCQ 1HNZL 5LMUQ 1JE5A 4BY1G 3I2ZA 4X64L 4DR6L 5H1SE 2AMCB 1VQKA 1L1OB 4LUVA 1PV4A 2PQAA 4AYBE 4RMFA 5IE8A 1GVPA 2ZM6Q 1Q86C 2K50A 4WJ3M 4PG3A 2MQHA 4IPCA 1VQBA 5JEAG 3MXNB 1HZCA 2KHIA 4B3SQ 1GKHA 2K4KA 4JBMA 3GTQH 1CSPA 3PUYA 1NMGA 1UE6A 4R4OA 3KYHC 5HY6A 4JI1L 4X66Q 1R9TH 4JI2Q 4DAYB 5IP7G 3J81c 2ZJRA 5LMUL 2R7ZH 2VQEQ 3CW2C 1IL2A 2D62A 1XJVA 3IRBA 3F8TA 1PH2A 3I4MH 3L2PA 5JJLA 4AQYQ 2LSSA 2ZM6L 4A3IH 3E9HA 4A3DH 1SRUA 4BBSG 4LF8L 2I5HA 4B3SL 4A76A 5C3EG 1Q12A 4JOIC 1FVIA 2E5LL 1VQLA 1W3SA 4A4IA 2Q2IA 1CKMA 2NZHA 3A5ZB 1CKNA 5IYDG 1EOVA 1TWHH 1BBUA 1PH6A 3HOUG 1K0RA 3STBD 1V9PA 1V43A 2IX0A 4DR7Q 4DV3Q 4LF7L 3HOVG 1X3GA 1E1TA 1E24A 2IHEA 2GVAA 3OTOQ 4A3EG 3H3VH 4BA2I 2OTJA 5M3MH 2H5XA 2JA8G 1KC8C 3PGZA 4LFAQ 2NVTH 1Q1EA 1AH9A 2VW9A 4YHHL 3G48A 2B29A 2I0QA 1JT8A 1WI5A 3D31A 2IY5B 1X54A 5K36G 2UUCL 4DV3L 2PMZE 4NXNQ 1VQCA 3L7ZC 4GN4B 4YWMA 4JI3L 3OTOL 1SFOH 4JI0Q 4A3GH 1L0WA 3K7UC 1VQHA 3TREA 2F3IA 1K83H 4A3FH 1Q7YC 2Q2TA 3EBEA 1T9HA 4GN5A 1YHBA 3CCLA 2WP8J 1NY4A 4DR3L 4R4TA 5C44G 4UY8C 3K8AA 2JA6H 2XGTA 4UP7A 1WJJA 1M1KC 3W1BA 1PYSB 2R93H 1G6PA 4A3LG 1XNRQ 1K9MC 3AFQA 3CP0A 1I6HH 1X56A 4DV1L 4C3IH 5FJ8G 1QVCA 3RZDH 2YTXA 1N33Q 5C0XI 3F1ZA 5ELOA 4JV5Q 2LXJA 5HGQA 3S1NH 3K0XA 1SN8A 4KHPQ 4K0KQ 4OO1G 3M9BA 2QGQA 2D0OA 3PV0A 2JE6I 1Q46A 1XNRL 3GD7A 3OW2A 2R7ZG 2D0PA 3AEVA 5IY0A 2UUAL 2VUMG 4LF5L 1FGUA 2BA0A 3BZKA 4LWCA 2BH8A 5DLQE 3UE1A 1EQQA 2CWPA 2K5NA 5IYBH 1KD1C 1IBML 4MZ9A 1TWFH 1XMOQ 4APVA 4K0KL 3GTGH 3JAMc 2R92H 1Y1VG 1TWAH 3RR5A 2JA5G 4X65L 1XNQL 1PVOA 1UE1A 1Q8KA 3EIVA 1KQSA 4JCVE 4DR4L 3KJPA 1SLJA 4OWTB 4C2MH 3M85A 2ZJQA 1JMCA 2PNHA 2ID0A 4Y52H 4GS3A 1HNXQ 4NXMQ 4DUYQ 1PH4A 1HJPA 3I7FA 1VQNA 1B8AA 4HIKA 1WYDA 4JBJA 4DR1Q 4DUZQ 2KHJA 4OX9L 4B3TL 4BY7H 1BVSA 3ERSX 4IOAA 2K14A 3GTJH 3M4PA 4A3BH 4L5RC 1XMQQ 4O0AA 4IPGA 4GNXB 5AJ3Q 3T1HL 4IPDA 2VL6A 2UUBQ 1S3OA 1JJ2A 1M90C 4BXXG 1HR0W 3TS2A 4X64Q 4DR6Q 1I3QH 4JC0A 4LUZA 1S40A 3M3YH 1SROA 2C35B 3ULLA 2WAQE 4GLXA 4A3GG 4YWLA 3FKIH 1UEBA 3K81C 4A3MH 1KIXA 3KF8B 1A8VA 1WCMH 4LF6L 1VQ5A 4GKJL 2KENA 4TQUS 3J81j 1XMQL 1Q81C 3PO2G 5GAHC 1OXXK 2JK8A 2NN6I 5LMNL 2UUBL 1X65A 1LM0A 2B63H 3HOZG 4A3KH 1HNWL 1XPRA 2ZTDA 4IFDG 2K52A 5J3BA 3G6EA 1VQOA 1YBYA 4XIGS 1E7ZA 2EXDA 3GTPH 3NENA 4LF8Q 1PH7A 2N3SA 3BJUA 1YVCA 3L0OA 2YV5A 2E5LQ 1P16A 1UWVA 3AQQA 1Y1WH 1HZAA 3F2DA 1X9NA 1J5EL 4GOPB 3W5OA 4QGUA 2MO0A 1B70B 4R4IA 3UDXA 1C9OA 5M3FH 4C3HH 3KFUA 4EX5A 3G71A 2EQSA 3A5UA 2A8VA 4LF7Q 4DK3C 4GNXA 1Q1BA 3F2BA 2BA1A 2I5MX 2JA7G 3J7A5 2FXQA 4NPSA 4JI4Q 5IYCH 1I50H 3PUZA 2DUDA 3STBC 1VQGA 5C4JH 4BBRG 3M7NA 2HHHL 4P75A 1UE5A 2OQKA 4YHHQ 1QZHA 1LUZA 1QUQB 2CQOA 4J15A 3HOWH 3PF5A 2PI2A 5BR8Q 3S1QH 1KAWA 1PH8A 4UP9A 4P71A 2F52A 1C0AA 1JJGA 2MO1A 1EIYB 2YU9H 1OXUA 4JI7Q 4JI3Q 3PO3G 4JI4L 3HKZE 4A93H 3SGIA 4POGA 4JBKA 1MIUA 2UU9L 1E1OA 4JI5L 3E0EA 2RCNA 1L1OA 1IYJB 2NVQH 2WB1E 4DR3Q 1VQAA 4IJHA 3CXCA 1CUKA 5BR8L 1SE8A 1U0LA 4X62Q 5IP9H 4A3BG 3S24A 2B3GA 1SMXA 3ER0A 2HIXA 4L5TA 1RL2A 3E9IA 1VQPA 4JI7L 1TWGH 2KCTA 3MEFA 3S1RH 3H15A 1VQIA 4DV1Q 1FJGQ 1EFWA 4L5SA 4GNXC 3CC7A 4GOPA 1JB7A 3RLNA 3I4NG 1D8LA 1K8GA 2MNAA 4PMWA 1QVGA 5IWAL 2ES2A 3M4OH 1O7IA 4OWXB 2E2JH 1RIPA 3KDFB 4X62L 2DGYA 2E8GA 1YEZA 2HT1A 3A74A 1AE3A 3CCQA 1HH2P 1KRSA 3LGJA 5GAGC 4YCUA 5M5YH 1PH1A 5FLMH 2UUAQ 3T1YQ 2ATWA 4LF5Q 1FJGL 4QQBX 4DV4L 1A0IA 1TXYA 2VS1A 3GDEA 4KLKA 5M5XH 1IBKQ 2UXBQ 1IBMQ 1YIJA 4QIWE 2L15A 1QUQA 1ASYA 3TS0A 2BH2A 1XPUA 1VQFA 1L1OC 5FLXc 4DV2Q 2F4VL 4UP8A 3J81i 1PHJA 1A62A 4A3CH 2CWAA 4KI0A 4O2DA 3AYHB 2JEBI 1X3EA 4AYBG 4X65Q 2CKZB 1XNQQ 3HOXH 2I5LX 3T1YL 3I4MG 1QVFA 3S1MH 4DV7L 3NBHB 4R1JA 1XTDA 1IBKL 2UXBL 4A3IG 3G4SA 1WFQA 4GN3B 4A3DG 4DV2L 2RF4A 5C4XH 3I56A 2A1AA 2EIFA 2CCZA 2YTVA 3RLFA 1VQDA 2VZAA 1P8LA 2IT1A 4JI8Q 4DK6C 1YITA 5IYCG 1K8AC 3S17H 1A63A 4OX9Q 4B3TQ 3DLLA 4WJ4A 2VQFL 1G51A 4KHZA 3ZJYC 5IP7H 2VY3A 5EAYA 1YZ6A 5GADC 1UE7A 3CPWA 3T1HQ 2Z0SA 3AFPA 3UDFA 1VQEA 4LUOA 3HKSA 3PSIA 1KRTA 2QEXA 2IX1A 2GVBA 4BBSH 4GKKQ 1VQ7A 3GTKH 4JI8L 5C3EH 4A93G 1GO3E 2MFIA 1ASZA 4YCWA 5M3MG 4QJFA 3U4ZA 4LF6Q 4GKJQ 1CSQA 1PH3A 1YHAA 1B7YB 5LMNQ 5IYDH 3UDIA 2YTYA 3HOUH 1HNWQ 3HKZG 2JEAI 2LXKA 1KHIA 3J80c 4ALPA 4GKKL 1HR0L 3PUWA 5JJKA 3HOVH 2WB1G 4A3FG 4A3EH 1HZ9A 1X6OA 1W2BA 3PCOB 2ASBA 4IPHA 3FP9A 1PA6A 2JA8H 3I4OA 4JI6Q 2JA6G 2AHOB 2ALYB 1KXLA 2R93G 3RN5A 1J5EQ 1NJIC 1EWIA 2PI2E 1Q82C 3ICEA 4OXPA 2RHQB 4DPGA 1NTGA 4QY7A 2RHSB 1XPOA 4OO1I 3H0GH 2K5HA 1MKHA 2R7FA 2XTIA 3S16H 2JJQA 3GTMH 4P74A 3HOYH 1VQMA 1N32L 4ME3A 4JI6L 4DR5L 2KBNA 5JJIA 4XTCS 4JOIA 3NELA 3TEHB 5C44H 5LMNW
chains in the Genus database with same CATH superfamily
2CZGA 2YRXA 4DR2Q 2K32A 3PF4A 2R7ZB 4AYBB 2YW2A 5FPOA 5KFJA 5KFLA 1GM5A 4ZKBB 4B3MH 5JEAJ 4CBVA 3RV3A 3PIOA 5E4WC 5C1PA 1LTLA 4YJ2F 1L2FA 2PVPA 2QCPX 2NVYH 5IGGA 4YWKA 3F8NA 1N48A 3SE7A 4X66H 2JA5B 3BVGA 3OMCA 4Q43A 2KCCA 2QW7A 4OEMB 2QK4A 1X55A 2VNUD 1Z6HA 3D0FA 4L5QA 2ASDA 1SEIA 4O3RA 4LMYA 4DKAC 3C0FB 4DV0H 2PBZA 1WTXA 1N36L 2VOBA 4R4QA 4DV6Q 2XC9A 4DA2A 3VR5A 3GIIA 5GROA 3E5NA 5LL6X 4G7HC 1IZ6A 3KLSA 1HXYD 3CCJA 4OL7A 2VQEL 1VS0A 2NBFA 2A68C 4YQWA 2VA3A 2W6MA 4ZCKA 3T5JA 2R7DA 4HIOA 1EU4A 3J7AF 3J80i 5KFXA 4DR7H 2Q2HA 4DL2A 3CF5A 1M0WA 1STAA 4DV4Q 1VCIA 4FBTA 5IT9E 2R7ZA 4IJLA 1Z9FA 2WB1B 1S72A 1K83B 2E2IH 1WCMG 5KFKA 4YCVA 4LFAH 4ECVA 3K59A 2ZDGA 2XIWA 2NU7B 2ICIA 2UXCQ 3HOZB 5IOCA 1VQ8A 4E4TA 3K5HA 4NXNH 5C4HA 2JA5A 1VQJA 1ZETA 3K80C 1PH9A 3RZDB 5E1FA 2FLPA 3HOYG 2UXDL 4CJ2C 3FDTA 3RF2A 1GD7A 4HSVA 3K5LA 1PZID 1Y1WG 2Z6KC 4H13C 4E6IA 1I4HA 4F7XA 2DPJA 2M00A 1YHQA 1LTTD 4DK0A 2L9HA 1BBWA 4EG0A 2J0TD 4C3JH 3PN1A 1N33H 5I6WA 3QWNA 1VMPA 4KN7C 2O5JC 3BG5A 3K5IA 2TSSA 1GUWA 1TAEA 1EIFA 1R4QB 4POFA 2FINB 1JKJB 2RKSA 4ECTA 1EY4A 5F2DA 5I47A 5L1JA 1K83A 4H02A 3GTLH 1UUPA 1XMOH 5AFWA 5FLXW 4ECUA 1C7YA 4RZRA 4JV5L 3I4LA 1DV1A 1KLGD 1IBLH 1S0MA 1ZYRC 2JA7H 3TP5A 3U4VA 3GO5A 2NB0A 1QZGA 1EU3A 2AUKA 4MNOA 1K3BC 2WACA 4BY7B 2PQAB 3AMUA 4DL6A 4DL3A 4HJAA 3CC2A 4A3BB 5C4ZA 2OTLA 1CS0A 1N34H 3ONAB 4IALA 3VR3A 2DWCA 4JYAH 4MTEA 4FYDA 4ECRA 3T53B 3PIPA 1F9QA 3I4NB 1KJ8A 1O78A 3E5SA 4UPAA 5FO8B 2V5AA 1PH5A 4DR5Q 4MTDA 3CAMA 4ABNA 4HAEA 5K2MA 2IHFA 3GTOH 3CCRA 3KLRA 3TDQA 2Z4HA 4F87A 4ZAIA 2UUBH 4ECYA 1H9JA 1CKOA 2KEDA 3I3CA 4EQNA 5FLMG 1EFID 2NZOA 5A2QL 4HIDA 1ILPA 3E6ZX 5ELNA 2W7PA 4DUYL 2JQOA 3D4DA 1JQYD 3PW0A 5FPRA 3K7AH 3R5XA 2QA4A 2MPMA 4LF9L 4N9PA 4DR1L 3VA7A 2UVVA 1WOCA 4AH6A 4LFBQ 4HJ5A 3CCSA 2UUCH 3MFGA 4IFDJ 3K3PA 3T56B 1TS3A 4BY1G 3I2ZA 3OWFA 4DN4M 4A3IB 2AMCB 1VQKA 2PQAA 5IGFA 2K50A 2SDFA 3V96A 5JEAG 4B3SQ 3LWBA 1GKHA 2K4KA 2C2RA 1GUTA 1NMGA 5DGBA 3S9WA 3J7YW 5H80A 3CW2C 1XJVA 3IRBA 3TMEA 4HNUA 3L2PA 4AQYQ 4WD3A 2ZM6L 1IYUA 1SNPA 3E9HA 4A3DH 2YU9B 4LF8L 1PK8A 5LHY1 2XN9C 4MTKA 4A76A 5FO7B 3U9TA 1CKMA 1E4FT 2NZHA 2G9DA 4RNMA 1K0RA 3LMLA 1I4QA 3STBD 3WO1A 1V9PA 4QWDA 3RB3A 4FP5D 4RCOA 4LF7L 1KJQA 1X3GA 1E1TA 2IHEA 4A3EG 1AFPA 3G6XA 5D3DA 3J7AK 1RJQA 1YNJD 2HDMA 1A3UA 5M3MH 2H5XA 2NVTH 2EY1A 1JT8A 1WI5A 4RB2C 1LTID 3D31A 5JVH3 2EYFA 2Z8LA 2IY5B 4DV3L 3D6WA 1VQCA 3L7ZC 1SFOH 5ELBA 4YWMA 1ZHQA 4Q0FA 5M5XB 4J9KA 4KKTA 5KG3A 1KNAA 1PFBA 1T9HA 3CCLA 2WP8J 1AN7A 5KT6A 3T5LA 1GSHA 5DG7A 1Z2PX 1VAJA 2JA6H 2RGRA 2YU9A 1PTOC 4Z9CB 4K2LA 1BNZA 4K5VA 2CVRA 1K9MC 3FPPA 1S4ZA 1I6HH 3GP7A 3Q8PB 1X56A 1A3VA 5FJ8G 1TS4A 1QVCA 1TWFB 2W9BB 4K0KH 5C4XB 4M8AA 1MGSA 4KY7A 3S1NH 1BGWA 3K0XA 4X3UA 4JV0A 3ZYYX 1O7LA 3GD7A 4DR4H 5LA6F 5J22A 2R7ZG 1ZEQX 2MHVA 3MR3A 2IBKA 2KECA 5IT9W 2R84A 5KG0A 2XCAA 1PZJD 4I65A 2W6OA 3MJFA 1IBML 4RZQA 1F2MA 2OF1A 3L9AX 1SJED 4APVA 3N44B 3JAMc 2R92H 3RAQA 4B3TH 3RR5A 2JA5G 3H3VC 1HTPA 3BJYA 3V6JA 1PVOA 1WTPA 1EZ6A 2JN4A 3EIVA 4TRDA 3T1HH 1SLJA 2ZJQA 4C2MH 2ZXRA 1JMCA 2PNHA 2Z9HA 2FJ2A 4FM9A 1GOZA 2BE5D 1HNXQ 5JVLA 3FKIB 3KK7A 3TZUA 2KJXA 2B2UA 5HBRB 4RUCA 1WVLA 1WYDA 4LF6H 4DUZQ 2KHJA 4OX9L 1XMQH 2JA8B 5C5MA 3ERSX 4IOAA 5LMNH 2K14A 3M4PA 1TWFA 4L5RC 1FNUA 2W9BA 3DWPA 1I4GA 4UCTA 1D5ZC 4IPDA 3HG9A 1S3OA 1JJ2A 1M90C 5ELFA 1HR0W 1ICFB 4X64Q 1JWUD 3H0GB 1S40A 4DR6Q 2DIKA 3RB6A 1IW7C 4YWLA 4KJNA 4A3MH 1A8VA 5JAVA 2V4QA 1RCVD 4GKJL 1VQ5A 2MCTA 3C46A 1OXXK 2JK8A 2B63H 3HOZG 2HJWA 3KAJA 4A3KH 3J81E 1GGOA 3EPGA 3HXLA 1TS2A 4IFDG 1VQOA 1YBYA 3G8CA 2K1BA 4UCSA 3RGZA 1I7NA 3I72A 5KT7A 1PH7A 3BJUA 3JRXA 3VMMA 2YV5A 1S9FA 4IRKA 4HTHA 4RAYA 2LY7A 1I3QA 1HZAA 3Q2OA 4GOPB 1CQJB 3FKIA 2N55A 4QGUA 5CV4A 2O2LD 2MO0A 4EQPA 4R4IA 1C9OA 1FNVA 2EXZA 2Q8TA 4N9TA 5M3FH 5KFQA 4C3HH 3OHAA 3G71A 3A5UA 4LH7A 2FPGB 4JI4H 2PNRC 1MHWC 1QILA 1Q1BA 2W9CB 2BA1A 2F0OA 2FXQA 3DWQA 3PVXA 1BXTA 1I50H 3PUZA 1FNWA 5FO9B 3H0GA 5FD5A 4NW2A 2CQYA 3OPOA 1VQGA 4DXGA 3M7NA 2J6SA 2HHHL 1A2TA 4YHHQ 1QUQB 2R82A 3NSWA 3PF5A 3S1QH 3T13A 1EYZA 4QW8A 1JOOA 2F52A 1C0AA 4J9RA 1JDEA 4JI7Q 4JI3Q 2HVQA 3PO3G 3A7AB 2MGSA 3HKZE 3TQTA 4EGJA 2O4XA 2E2IB 2W71A 1E1OA 1RJTA 1JIHA 1VQAA 4IJHA 3MHBA 1LT6D 1SE8A 2I07B 3NTKA 3X3NA 5IP9H 5EBDA 4A3BG 3S24A 3PW2A 2B3GA 2FK2A 3J7AV 2OXPA 4ZYSA 4CKBA 5KT2A 3DEOA 1VQPA 5KT5A 1PRTD 4XT3B 4DV4H 2XWBB 1E4GT 1DYQA 1VMCA 3K5OA 1EFWA 4L5SA 4GOPA 3I4NG 5K5PA 2EY2A 4DL4A 2MNAA 3ND8A 4IRDA 1SYEA 3QG1A 1O7IA 3R8BA 2HVRA 2W7OA 5KG1A 3SEBA 5C3XA 3A74A 3T1YH 2XSCA 1KRSA 2W9CA 1K8OA 3H09A 4H7BA 1IBKH 3NUCA 2ATWA 2W9AA 4QQBX 1MSHA 1A0IA 4LH6A 1TXYA 2DY8A 2NTSA 4KLKA 5KFYA 2UXBQ 1ESRA 1ET9A 4QIWE 1QUQA 1ASYA 1U9RA 3PW7A 4DV2Q 1ENCA 3DMUA 3I90A 1O7ZA 4A3CH 1WH2A 4O2DA 1XNQQ 2BQ3A 1X3EA 3HOXH 2X0SA 3A54A 3I4MG 2BR0A 1BCPC 4R1JA 5LXTF 4MAMA 4A3IG 1EZ8A 1T94A 3TSSA 1EUDB 4LJZC 2J6TA 2SNSA 3GTKB 3QFFA 1EHIA 3I56A 5C3EB 4HYKA 4KKSA 1OWTA 1ONLA 2D5DA 2XIGA 2D9UA 2JA7B 4HNTA 1C3OA 5COYA 1NNXA 4IAJA 1YZ6A 1KDCA 1UE7A 3CPWA 2F0SA 2Z0SA 4J8QA 4LUOA 4Y8VB 4GKKH 2X69A 2I46A 5C5JA 4U7CA 3OWEB 3J80E 5KFUA 2MFIA 4ED1A 1SNMA 4YCWA 3GV3A 2F0UA 1KEEA 2Q8RE 5CA1F 4NP5A 5CBAE 2YTYA 2F0GA 1U4MA 3HOUH 2PZTA 3BA9A 1HR0L 3PUWA 2ZJTA 1EYDA 3OUZA 4DR5H 3K7AB 2XGQA 1PA6A 1I4XA 2FKLA 5C44B 4GZYC 2AHOB 3RN5A 2M2LA 1J5EQ 2PI2E 5ISRA 3GTKA 2JSOA 3ICEA 2RHQB 4DPGA 3X3MA 5L1IA 4QY7A 1L0YB 2K5HA 1S5BD 1SXTA 2Z4IA 1HUNA 2JJQA 4UHVA 3GTMH 3H6MA 3OSNA 4P74A 1SNQA 1YNNC 3N52A 4ME3A 4XYQA 4LFBH 4RU9A 3QOLA 2NUCA 4JOIA 3BQ2A 3NELA 1EY6A 3TEHB 1XX8A 4LFCL 3MAQA 4CJ0B 3JRWA 1FKAH 2HVSA 5IYBG 3P75A 1M0TA 1CA5A 4A3DB 4I7ZC 1N36Q 4B3SH 5C4XG 1SR3A 4ME6A 5BPHA 3MXPA 4JI5Q 4OO1H 5KFRA 4ED3A 2O03A 1SE2A 4BWSC 2Y0SE 3LX0A 1VQ4A 1MJEA 3H3VI 5C0XG 4C5CA 4AQYH 3NQTA 3KHLA 2R6GA 5CGKA 3HB9A 2EYHA 2VB3X 1KBLA 1I94H 2R8HA 4MV9A 4PZ7A 4B3ML 2EVBA 4HMJA 3NQIA 1CQFA 3EYYA 2ASJA 4X66L 2NVTB 1RK6A 4RWSC 2Z6KA 5EQ0A 4YY3H 1RD9D 4FXGC 3C1FA 2JA9A 4A2AA 1W6JA 5BMVF 4DV0L 2R7MA 2F3WA 1D5XC 1SFOB 1EY5A 4IHJF 3FKIG 4IFDI 2VUMA 4DV5H 4GLAC 3VPDA 2UXDQ 3I55A 4JBWA 2F4VQ 4RHSA 1H9SB 3KLWA 3J7ZC 2JA6B 2XNAC 1YI2A 1SYXB 4IQZA 3MEHA 4HIMA 4C5BA 4YR0A 4BXXH 4IO9A 1HUMA 4KY5A 1Y1VA 4A3JH 2WTFA 4DR7L 1I6HB 2F0KA 3H0GG 4J9QA 1A9XA 1XWEA 1YJWA 1JB3A 2LKVA 3EN2A 2QYZA 4K14A 4RGNA 2AGOA 2GN5A 2E2HB 3S1NB 4FF2A 4LFAL 5KFOA 1STHA 5EWFA 4RGOS 1EYGA 1B50A 5DQIA 5GAEC 3GV8B 1L0XB 3PO2H 3FMCA 4UAIA 3Q8DA 1IXRA 5IYZF 4G7OC 5KFSA 1BDOA 3KF6B 4DAMA 1JORA 1ZQ7A 4NXNL 1EWHA 4C5AA 1TWCH 4GOPC 3DM3A 2F0PA 4IOCA 2NU9B 3RZOH 2AQ4A 1EQVA 2ENBA 1E3PA 4X3SA 3QO2A 2NVXH 2F03A 1SFOA 1RODA 4BBRB 1YJNA 2KOLA 3RMHA 3HOWG 1I5FA 1LTGD 3TRZA 4EQOA 3NK9A 1B33N 1V1QA 3KDFA 3IN5A 1AEXA 2A19A 1N33L 3V6HA 1H9SA 2BDOA 3CD6A 1EEFD 1PDQA 3CMEA 4QL5A 3S2HH 4JK1C 3KJOA 1YNXA 2QDLA 1WD1A 3N40P 4Y7NB 1GJXA 3MZ5A 4NB3A 4MTNA 2EZVA 2J6UA 4PMCA 1AE2A 2E2HA 2NZ1D 3CQZB 1ICWA 3VPBA 1OXVA 3CC4A 4LF4L 2FFKB 1HNXH 4G7ZC 4EBEA 1XMOL 1KLUD 1EQRA 3M9NB 1BKBA 2RVLA 4B3RL 3KF6A 3BVMA 1A15A 4A3MB 4RB0A 1IBLL 4DUZH 1N32Q 2W6ZA 4PZ8A 4FBUA 4LF9Q 3OOCA 2CH4W 4MA0A 1LTSD 5KFTA 1HNZH 2OQ0A 3S15H 2WAQB 1G291 1N34L 4X64H 5G3LD 4DR6H 4IWYA 3VDYA 4JYAL 2RDJA 2KUMA 2ASLA 5JH7F 1JOKA 2HUGA 2B2YC 4WRDA 2K7VA 1D7QA 3C1EA 2IL8A 4O2BF 4DNIA 1EY9A 4JI1H 4M7EA 2EJGC 3QR8A 3ORRA 1LABA 5LMUH 2K05A 3J80W 3KXYT 4ODGA 2IJ0A 3RUZA 2I87A 4QW9A 3DEPA 2EY5A 4C3HB 1S5FD 5IE8A 1Q86C 2ZM6Q 4WJ3M 2NYZD 1VQBA 4JBMA 3MXNB 1HZCA 3GV6A 3GTQH 3CQZA 4FU0A 4R4OA 2UUCL 4JI2Q 4DAYB 5IP7G 2ZJRA 1IL2A 5D14A 2D62A 4B08A 1PH2A 5JJLA 1QNUA 1MZBA 1SAPA 4M1UB 1SE4A 4EYHB 1EL0A 1SRUA 4CHTB 4BBSG 2I5HA 2A6HD 5C3EG 1Q12A 4JOIC 1FVIA 4ZQ3A 1EWCA 4F88A 3J81L 4MIUA 2Q2IA 1BQQT 3ERQA 4JW0A 4YHHH 3A5ZB 3V6KA 4YR3A 1EOVA 3CRKC 3DM1A 3WOEA 1PH6A 3FDSA 2B39A 5CV5A 4J9OA 5J1ZA 5EPJA 1V1OA 4JI3H 3OTOH 2E75C 4DV3Q 2IA6A 3I91A 1KTKA 1QWYA 4AYBA 4A3FB 1FR3A 4CDFC 5EGTA 4LK1C 1RTNA 3H4BA 5BN5A 4O4IF 3SK5A 2RSOA 1KC8C 1EOTA 2VW9A 2R93B 1K1QA 3LNNA 2CW0D 1I4PA 2GA4B 2PO4A 2DPIA 2WV6D 4BS9A 4CC5A 4GC6A 3MXNA 1EUCB 2AQ2B 2PMZE 1TR5A 1U4RA 4GN4B 4A3GH 4JI0Q 4DAYA 1DM0B 4XT1B 4J9LA 1E2WA 4IZ8A 4R9WA 4GC7A 1J9OA 4L6TB 4IUUA 2JEIA 4I7HA 2MUYA 1XNRH 2C5CA 1TQOA 3K8AA 5C44G 2YZGA 1CHQD 1ENFA 4FF3A 4A3LG 3HOXB 3NBIA 3AFQA 3CP0A 4EGVA 4QUCA 3R2IA 2L1BA 1SYDA 4C3IH 5T14A 3KBXA 2IPKD 4C1NI 5C0XI 3I12A 4X3KA 5ELOA 5HGQA 3SVMA 2VQDA 2A6ED 4KHPQ 3R3OA 1XNQH 2DLNA 1GUOA 4TV9F 4Q8EA 3PV0A 1IL8A 2WB1A 5KFBA 3AEVA 4ECQA 3Q1KA 5KFDA 2A74C 2VUMG 1FGUA 2BA0A 3BZKA 2BH8A 2RDIA 2WKDA 1SMYD 2W70A 2R93A 4MZ9A 4K0KL 3V4SA 3GTGH 1Y1VG 4IUNA 1TWAH 4S3SA 2C9OA 1BOSA 1E4EB 4IZOA 1WSCA 1XDNA 3OHXC 1ZKOA 4DR4L 1ML0D 2PCFB 2RSNA 3MXUA 2YRWA 1Q90A 3M85A 4Y52H 2R61A 3JSLA 1BUVT 4Q44A 2AGQA 4GS3A 5IGEA 3D6CA 4NXMQ 1F9RA 1U4PA 1PRTB 4K5WA 3L3OC 4HIKA 3BYTB 5KX5F 4HQ6A 2KVMA 4B3TL 1K8MA 2HCCA 2CHBD 3GTJH 2R8IA 2WDTA 4IPGA 3T1HL 5AJ3Q 4O3NA 3NTIA 3TP8A 1KDBA 3CHBD 1HRJA 3TS2A 4LUZA 3GTPB 1GSOA 2IX3A 3GTMB 5D65A 3K81C 4JVZA 4O3PA 3KF8B 1WCMH 1HHVA 5DLFA 4LF6L 4QUFA 1XMQL 3J81j 1J5EH 3N41B 5LMNL 3TP6A 5I6YA 1X65A 3CRLC 1PTOF 1XPRA 2K52A 4DGZA 1S5DD 1E7ZA 1E4EA 3N6XA 1NR4A 2B2WC 1CHPD 2D2CC 3UI2A 2FK3A 5D1OB 1KJIA 2E5LQ 1P16A 1BCPB 1Y1WH 3OUUA 3F2DA 1EYAA 2AGPA 1DZ1A 3W5OA 4F50A 1XYIA 3UDXA 4LMQD 4UCOA 4IR1A 3LP8A 4RA8A 2I5MX 4JI5H 4NPSA 5IYCH 3K5NA 4HCEA 2QILA 2DUDA 2EOTA 2VPQA 3STBC 3GTPA 2QF7A 4BBRG 3P20A 4A2BA 5LP6F 3K0YA 2OQKA 1QZHA 4R8IA 1KAWA 1DOLA 1PH8A 1VKZA 4P71A 1JJGA 1G6ZA 3S1RB 5L1LA 1YNJC 3U9SA 4ZUIA 4JI4L 1BNCA 3VYRA 3RB4A 4DK1A 3E0EA 2RCNA 2NVQH 4X62H 2A5HA 4DR3Q 3CXCA 2A69D 5BR8L 4TQSA 5D1OA 4NLGA 1CI3M 4TQRA 5M5YB 2BCOA 4KY6A 3ER0A 2HIXA 1FJGH 1SJHD 3E9IA 1TWGH 4A3JB 3MR2A 2F0EA 1CZGA 4CDCC 4DV1Q 4GNXC 3CC7A 1JB7A 3RLNA 3RAXA 4PMWA 1WTRA 2ES2A 3M4OH 2F4VH 2L0CA 2E2JH 5KG6A 4OIKA 1RIPA 5CV7A 1D2BA 4XQQA 5KT3A 1UEAB 2PMZB 4WORA 4UCUA 3PO2B 2VA2A 3CCQA 2VUGA 5FOBB 5JUMA 1ET6A 2MP1A 5ELCA 5LL6S 1PH1A 5FLMH 3P7JA 2UUAQ 3H40A 5HGTA 4LF5Q 1XXGA 1TWCB 4DV4L 3M7GA 2VS1A 3RZOB 4I7AA 1DD2A 2DNCA 2L15A 2L4NA 3TS0A 5JQWA 2YS6A 4RKBA 2NUAB 4FXKC 4ZI7F 4KI0A 4X65Q 4AYBG 2CKZB 3T1YL 2YZMA 2C2EA 3S1MH 2DZDA 1IBKL 3H20A 1GXDC 5FLXL 2F0WA 2RF4A 3G6YA 2CCZA 5JEAH 4Q0YA 3RLFA 1C8CA 2FPIB 3CU7A 2IT1A 4RB3C 2M05A 3S17H 2RBMA 4JPBW 4ECSA 2K5WA 2NU6B 3DLLA 4WJ4A 4UFZA 4J9NA 1ESFA 4TV8F 2BE5C 5EAYA 1BO0A 3AB9A 1WTVA 1QOHA 3UDFA 3RFCA 4P2CB 3PSIA 1VBGA 4FS1A 2QEXA 2IX1A 1DV2A 3HOVB 2K03A 5IIFA 5EZYF 4JI8L 3Q24A 1T5EA 1GO3E 3V4ZA 4NKLA 4B9XA 5J39A 3U4ZA 1TWCA 4RGTA 1JDBB 1PH3A 4XXEA 3S15B 1QB5D 1HNWQ 3NHHA 1KHIA 3IAYA 3L4KA 4GKKL 3JAMW 2WB1G 4KK7A 4KKUA 4A3FG 2VXWA 4A3EH 1W2BA 4F4YA 4JI6H 1N32H 1LTAD 3BAAA 5L9XA 1WR2A 4RCNA 1SCUB 2ALYB 3VYUA 2R93G 1KXLA 1AUVA 2E2DC 1EWIA 3PR4A 1Q82C 1G2SA 2F0FA 4IWXA 1XPOA 4K6LA 5LL6b 3S16H 3WO0A 1S0NA 2NVYB 1NSNS 1HPCA 4RGMA 4ZK9B 1D6EC 3GTQB 1EQTA 5CR3A 4DR5L 2DY7A 3Q8SB 2KBNA 3FRPB 4DR2H 1UNSA 1X3PA 4R8UB 5KFIA 1PZKD 3IG0A 4G3IA 1JX4A 2ZTEA 2JYOA 5EPKA 1N9WA 3CCEA 3M9OB 3R2TA 4CKEA 4V190 5EKLA 5BN4A 1HQRD 1BCPF 5FJ8H 2OCEA 2F0TA 4RG1A 3JAMi 2R7LA 1X3FA 4B3MQ 3KOJA 1MI2A 4P73A 4PZ6A 4YAKB 4YIJA 4LFBL 5C0XJ 2UU9Q 4F4XA 3BDOA 4JI2H 5KFVA 1WTOA 3EPIA 2K5DA 4K2KA 1QG7A 4HJ9A 2BDNA 5IODA 1SYCA 1S5CD 3EFXD 4DV6H 1G91A 1EIHA 3EJIA 5KIXA 1S97A 1PYBA 4DV0Q 4HEDA 2R3ZA 3HFZB 5KT4A 5IWAQ 2AWOA 2OLSA 5M5WH 1T36A 4BY7G 2UVWA 3GV5B 4F4WA 2JA5H 2J9GA 4UCVA 4JV1A 2X6GA 3TIGA 1PRTC 4LW1A 2E76C 2F0IA 2NVYA 4AQYL 3UDGA 1SDFA 1I94L 1JCKB 2KCNA 3NXWA 3PUVA 1RTOA 4A3GB 4MV7A 4HNVA 1UNNC 2B8GA 2F0VA 4AIMA 1NE3A 2YCHA 3RUPA 2UXCH 4BWGB 2B8FA 2EYJA 3HEJA 5CV6A 1C30A 4YBZB 2OEOA 2YL2A 3G6JB 4YY3L 3KLSX 5CMDA 2AUJD 2JXMB 1YJ9A 3V05A 5GQOA 4C3JB 2J4XA 3NWSA 4DV7Q 4JI0H 3M4QA 4C3IB 4XYOA 3Q23A 3CCUA 1PFNA 4JG2A 3KHGA 4DV5L 2HIVA 4LSXA 2PQEA 1ULZA 1O7YA 3MFYA 4U673 3HOZH 1A6XA 2VQFQ 2V1CC 2E2IA 5IT9L 2F0JA 3GTLB 1STNA 1K3RA 5NUCA 1MJCA 2HQLA 1STYA 2NN6G 3N42B 1PFMA 4O3SA 4KHPH 1J6QA 2K75A 1AUXA 4DLKA 3GTGB 3S14H 1FL0A 5KNDA 2ZXPA 1TWAB 2N78A 4ZLTF 1CT1D 2F0HA 5DNFA 2YS7A 1NMFA 4R7RA 4J9PA 3KHRA 4BA1I 3QOJA 3GLKA 2ZXOA 4L8JA 4PDBA 2RGVA 2ZT9C 1B04A 2W57A 1DOMA 4DNRB 4YR2A 4ID6A 5I2XA 3CCVA 2EYMA 1GHJA 3QIAA 3U9OA 3U50C 1EZ1A 1KJJA 1F9SA 4LF4Q 3BZCA 1D1KA 1NUCA 2KCMA 2B2YA 2PW5A 2FMMA 3RLOA 4XQJA 4EQ5A 1VQ9A 4B3RQ 1FD7D 1LT5D 1IBLQ 3GTOB 1LT3D 3GQCA 1KABA 3GTJB 1B1ZA 1QJOA 2WFWA 3RIZA 3PUXA 1WTWA 3MR5A 3W3AA 2SOBA 4ECWA 3I70A 3I8ZA 1N34Q 4NXMH 1TKWB 2L55A 3PO3H 2FLLA 4JYAQ 2W6PA 4RFBA 1V1PB 2V58A 4U68A 1DGSA 3GTLA 1WCMB 1A2UA 4K8IA 3KALA 3FPUB 5E7NA 3RN2A 1AZPA 1JC7A 3CPFA 5A35A 2ZJPA 3SDZA 2JA7A 1DCZA 3UE0A 1OXSC 1LACA 1TT2A 5KFMA 4NMZA 3OYYA 3GTGA 3TP7A 4A3JG 3T5HA 1HNXL 3I4NH 1VQ6A 1I6VC 4EFEA 4TKOB 4ECZA 3BU2A 2XVSA 5KFPA 5KNBA 3Q8QB 2ZTCA 4DUZL 3QZ8A 2YYZA 5HV6A 1UC9A 2UUCQ 1HNZL 3C2PA 4IUQA 3MR6A 4X64L 4DR6L 4MV4A 3GTOA 1L1OB 4LUVA 4AYBE 4RMFA 4J0MA 3GTJA 1CTMA 4QCLA 4DL7A 4RKLA 5FKAC 4PG3A 2MQHA 3UFXB 2E5LH 3RD4A 1TA8A 3FMAA 3PUYA 4JI1L 4ILWA 5HY6A 1R9TH 3J81c 5LMUL 2VQEQ 4DAVA 4DXFA 3K57A 1V1PA 1DONA 3I4MH 2Z1CA 1Y8OB 4ZKCB 2PZWA 4A3IH 3BG3A 3T5KA 1IYVA 4UCRA 5T1GA 5M3MB 1VQLA 1W3SA 4A4IA 3SK4A 2LFNA 5CBEE 5IYDG 1TWHH 1BBUA 2KHSA 3K3VA 2HDLA 4O2AF 2OT2A 3HKZB 2RCFA 2R6FA 1JICA 1V43A 1ZHSA 1TWGB 4J9MA 3HOVG 1PMRA 1PX2A 2OTJA 1II3A 3WOFA 1CA6A 4DR3H 2JA8G 2E2JB 3PGZA 1Q1EA 1AH9A 1TY0A 5DM73 4EBDA 4YHHL 2EPBA 1HFNA 2B29A 2I0QA 4ZUJA 5K36G 1X54A 1AN8A 3ND9A 2R87A 4RHRA 4DV1H 3SI8A 4JI3L 3OTOL 2WE6A 1L0WA 1B6SA 5TSSA 4CDEC 1VQHA 5E3FA 3TREA 2PPBC 1W96A 4HN7A 1H9MA 2K6AA 4R4TA 2PW7A 1STGA 2FK1A 2XGTA 3A8IE 4UP7A 5FK9C 3W1BA 1M1KC 4FF1A 4RNNA 3DUZA 4K5XA 5EKIA 4QIWB 3SE0A 4EVOA 5KFGA 2UUAH 4LF5H 3S1MB 2LS01 2YTXA 3T16A 4JV5Q 3FEWX 4XQNA 3HKZA 2R92B 1SN8A 1GUGA 2G5DA 4K0KQ 3M9BA 4X65H 5EWGA 4C1NK 1BF4A 2D0OA 2FJZA 1XNRL 1Q46A 1SNDA 1VF5C 1SYGA 3OW2A 5KFZA 4J1MA 2D0PA 1EEID 4C2MB 4R8NA 3UE1A 1EQQA 1KD1C 4DR4Q 4O3QA 1IOWA 2K5NA 5IYBH 2JA6A 4CGYB 1TWFH 1CQVA 5KG5A 1CE8A 1XNQL 5CYUA 2HCIA 4CDDC 1QNKA 3KJPA 4N8X1 4OWTB 4M9UA 4PMBA 2ID0A 3MWMA 5IGCA 2PYKA 3NWTA 4ECXA 1U4LA 4DUYQ 2B2WA 1PH4A 2GPSA 4A3EB 5I9PA 2GLTA 4QIWA 3I7FA 1VQNA 1JOQA 1RJPA 5DQHA 4JBJA 4DR1Q 3RBEA 1HA5A 3SK8A 2B63B 5CORA 2F0NA 4A3KB 1XMQQ 1HNWH 4GNXB 2VL6A 2R92A 4O42A 3BDCA 5EDWA 1Q3LA 1SSOA 4HCSA 1I3QH 4JC0A 2AU0A 3RJ0A 3GIDA 3M3YH 3S16B 4J6HA 4GLXA 1Y69U 4A3GG 4PQXA 4EEYA 1IHZA 3FKIH 1UEBA 4C2MA 4KD3A 2V59A 1Q81C 4XZ3B 5GAHC 2NN6I 2UUBL 3HBLA 2FMCA 1SYBA 5J3BA 1NCVA 3G6EA 5D3IB 5M3FB 1AZQA 1V51A 4C3JG 2EXDA 5A2QW 1IKMA 5I9OA 3K6OA 3BQ1A 3EQLC 1RYSA 2B2TC 3CKIB 4LF8Q 3A8KE 2N3SA 1YVCA 3L0OA 1I50B 2O5IC 1UWVA 3VR4A 1J5EL 4QF4A 3WDNA 3S1QB 1KJ9A 3A7LA 3T4AC 3BDLA 1STEA 2A6HC 2JEJA 2EQSA 3PMFA 4IRCA 2B63A 3OIQA 1C4QA 2A8VA 2QKIC 4DK3C 4LF7Q 2WAQA 5KG2A 2Y0SB 4YP3A 4GNXA 3F2BA 2UU9H 2JA7G 4JI4Q 4LAAA 2MJ8A 2BQUA 5M5WB 1G2TA 5DGAA 5C4JH 2NU8B 2R7KA 2E74C 4P75A 1UE5A 3HOWH 1LUZA 2WKCA 4KHVA 2PI2A 3HRZC 5BR8Q 1HA6A 2W8LA 4JI7H 3D4RA 2MO1A 4A93H 3SGIA 5IWAH 4JBKA 4V0BA 2CW0C 4JI5L 5DLGA 1TIID 5JPMC 1IYJB 1CUKA 4K6DA 3VYTA 1SMXA 4L5TA 1I50A 1RL2A 5KFHA 2KCTA 2GPWA 3MEFA 1CZWA 1VQIA 2B2VA 5CV9A 2A68D 4XDXA 1FYCA 1D8LA 1QVGA 1JXLA 4ED8A 1R4PB 4Q8FA 3Q0AA 4X62L 2DGYA 1YEZA 2IP4A 5F9LA 3EVQA 2Y0SA 1HH2P 4FVMA 5GAGC 4YCUA 4DV7H 4ZHQF 2UXBH 3T1YQ 1FJGL 1K28A 3RB0A 4DAPA 2A6EC 5KKNB 1IBKQ 1IBMQ 1EYCA 4DV2H 3H4DA 1YIJA 2FP4B 4KJOA 2BH2A 1VQFA 1L1OC 5FLXc 2F4VL 3S14B 3HP3A 3JAME 1PHJA 1A62A 1M4VA 2VQFH 3AYHB 3IFDA 1SMYC 2K28A 3OSOA 4RAUC 1QVFA 5EPLA 4CC6A 1XTDA 4RUAA 3G4SA 1WFQA 1Z2OX 4A3DG 2IMWP 3BZDB 3RTXA 4ZQIA 2EIFA 3JZIA 1VQDA 4JI8Q 1YITA 2VB2X 5IYCG 3RBDA 4OX9Q 4KHZA 3ZJYC 5IP7H 4HR7B 3HOUB 3FVQA 3M9MB 3AFPA 3BVZA 1VQEA 2R8KA 1CM9A 3HKSA 1KRTA 4KTAA 4YAJB 3SK6A 2GVBA 4LF4H 4BBSH 1AP0A 1MD2D 4HSPA 3PO3B 4GKKQ 1VQ7A 4WJWA 3GTKH 5C3EH 4B3RH 5JJZA 1ASZA 2FMAA 5M3MG 4QJFA 3WNZA 4GKJQ 4RB1A 4MN3A 4YJ3F 1ZYRD 5ELDA 1RK5A 1HTLD 3HKZG 2JEAI 1CFMA 3PIO3 3KUPA 1GSAA 4ALPA 2EYPA 4APMA 3NTHA 5DM63 2ALZA 2I8CA 2BOSA 2ASBA 3W2DA 2R85A 4IPHA 1ILQA 4RAZA 3I4OA 2JA6G 4FO2A 2KEEA 1BBXC 3J80L 2UVRA 1F77A 1HQMC 5KFWA 2RHSB 1Q8IA 2XTIA 3BS1A 2W8KA 3GIJA 1E2VA 3HOYH 1BXRA 4IUTA 4HR7A 1N32L 2I80A 4JI6L 4ME5A 5JJIA 5T1IA 5C44H 1R9TB 1Y14B 1WTQA 1F9PA 2HHHQ 4A3LH 1H95A 2XWJB 3GIMA 2QEJC 3W1GA 4F8MA 3I4MB 1N36H 1SE3A 4O1NA 1NR2A 3C3LA 4L1KA 4MV1A 5ELEA 3VA5A 1K0SA 1MSGA 1UAPA 4TVAB 5DG8A 3M4YA 3PQIA 2R92G 3VR6A 3F2UA 4DR2L 4ED0A 3GTMA 1LT4D 5KFAA 2N49A 3E3XA 2VQEH 3NE5B 3R93A 1TWHB 3KF8A 1OXTA 4IR9A 1N8RC 2VUMH 3RV4A 1RDPD 4KD4A 1I94Q 3MFIA 3TIIA 2A69C 3EROA 4B9WA 1Y1VH 2FHTA 4JI2L 3HGBA 4XX0B 3TN2A 4XYLB 3JC66 5E4XA 4H44C 4CKCA 4YY3Q 3NEMA 4DV6L 1V8QA 4QWCA 1HZBA 1R9TA 1LTRD 2UXDH 4A3MG 1STBA 3ULPA 4PWQA 3KBGA 3MXGA 2V4RA 3K5MA 3CMAA 4OONA 2K5VA 3Q6SA 4DV5Q 1VF7A 2B63G 5C8YF 5KFEA 2WAQG 5JOBA 5M9OA 3TQYA 4A3KG 4I55F 1B2TA 2JEFA 5IT9c 2RDHA 2CFMA 1J8IA 3UQ8A 2RA4A 1TWHA 4A75A 4EBCA 4X6AH 4LSAA 3OHBA 3PZPA 2R86A 5CA0F 2UXCL 2AKWB 2NVXB 1E22A 2XGPA 1JWSD 3RNUA 1F2LA 4TSSA 1OTCA 3CCMA 4BY1H 3D8GA 3F2CA 1K73C 2X6LA 2B2VC 2L5TA 3ORQA 3PIP3 1DJRD 5M3FG 2EYLA 1Z47A 4C3HG 2C00A 4JI0L 1PTOD 1QCBD 5LOVF 1WTHA 3R5FA 4JV5H 1EY8A 4HJ8A 2R7NA 2PN1A 1SNOA 3S2HB 2EJMA 4HJ7A 2E2HH 3ULJA 3LWUA 2YZNA 1W93A 3BABA 1JR0D 1TVXA 1KL9A 1QE6A 3FHWA 1EUJA 2K04A 1T5XD 4ZRZA 1C48A 2FLNA 2PMZA 3DHQA 4MV3A 3E0JA 1HR0Q 1N56A 2AWNA 2Y0SG 3U58A 3QZ7A 4FDBA 4IUPA 4KHPL 5KYLA 1CQIB 1W6KA 4BBRH 1U5KA 4P72A 1PRTF 4GLVB 5IP9G 5CV8A 1CK1A 1PLFA 2TMPA 3VR2A 3A0JA 5EWEA 2NVXA 1BR9A 2HGSA 3B6YA 1I3QB 3N8DA 4DUYH 1RF2D 5C6AA 4K8JA 3M3YB 4LF9H 3G7LA 1KDAA 1RKNA 2OWOA 1LYLA 4LNQA 5L1KA 4DR1H 2N8NA 3QJYA 1PFSA 4Y7NH 1JJCB 1S03G 4LFCQ 4H0LC 1E2ZA 4DL5A 1SNCA 2H4OA 2Q2UA 1HNZQ 3CQZH 4Q5VA 1NBWA 1CKNB 4NXML 2KSWA 4MHEA 3DXJC 2HQEA 1WD0A 3WWVA 4R4CA 5EJWA 4OWWB 3S2DH 4A3CG 1IW7D 3EA6A 1H9RA 3MWYW 1MBYA 4JI1Q 5AJ3L 3D3RA 3HOXG 4IURA 5DAUA 1JE5A 5LMUQ 4KMUC 5H1SE 2ZM6H 5CC4A 1VBHA 5DQGA 1TU2B 1PV4A 4LF8H 1S68A 1GVPA 1T3NA 2F0QA 2ZDQA 1I4RA 3D4WA 4IPCA 1PTOH 1Z2NX 2KHIA 1I6UA 1CSPA 5KYIA 1UE6A 5J2UF 3KYHC 4X66Q 4JUZA 2PZUA 5C4JB 2R7ZH 3HOWB 5FD6A 5J2TF 3F8TA 4WFN3 2P5ZX 2LSSA 2EJFC 4G57A 4LF7H 3MC0B 4B3SL 4EFBA 5GONF 1DXMA 1LLRD 4A93B 2E5LL 5EBCA 3TBIB 3DF7A 3MWEA 4MV8A 4ZOLF 2EDGA 1GLVA 1CKNA 2F1MA 5BR8H 1IOVA 1TY2A 2W6NA 2WYOA 3HOUG 4IN3A 2QDBA 4DV3H 3GTQA 2RQXA 4R8UA 4DFAA 2IX0A 5D1PA 2KA7A 4DR7Q 2C22A 3IFTA 3MWDA 1GUSA 3TQ1A 3H3VH 1E24A 2GVAA 3OTOQ 1Y8PB 4BA2I 1M6VA 2WINB 3AU7A 4LFAQ 4O4LF 2CQAA 5DEHA 3K58A 2VPSA 1OO9B 2SEBD 3G48A 1O80A 1RHPA 2RDFA 4DU9A 4NXNQ 3A8JE 1SYFA 3OW7A 5F9NA 5KFCA 4QWBA 3PW5A 4J9SA 3P1HA 3K7UC 4A3FH 2F3IA 1K83H 1Q7YC 2Q2TA 3EBEA 4GN5A 1B9MA 1YHBA 1NY4A 4N8FA 4ULLA 3TZDA 4DR3L 3KHHA 3IL8A 4WBNF 4JV2A 4UY8C 1WJJA 2R93H 4QWEA 1PYSB 1G6PA 4IFDH 2HD3A 1XNRQ 5CB4F 3NGDA 3OIPA 2J7ZA 5EOYA 3HS0C 1VDZA 4KN4C 4UDUC 4DV1L 1IBMH 3MTSA 3IKJA 3RZDH 1S0OA 3NPPA 1N33Q 3F1ZA 3A55A 3VPCA 2LXJA 4U6PA 2UVUA 1LO5D 1B3QA 2V9WA 1FGBD 4FF4A 3GQBA 4OO1G 5HURA 2QGQA 2BQRA 2JE6I 5EKKA 3Q8RB 2SCUB 3RGXA 2N88A 1G8ZD 5IY0A 5L37A 2UUAL 4Q45A 2DJFC 4LF5L 1KAAA 2F0MA 4LWCA 5DLQE 1JLLB 1O75A 2CWPA 3VYSA 2JP1A 1XMOQ 2Z6BA 4FXDA 4BBSB 1BCPD 4JI8H 5A2QE 4C56C 1KC7A 4OX9H 1AW7A 4OHJA 4X65L 3GV7B 2EY6A 1UE1A 3SXHA 4OELB 2L11A 1Q8KA 1Y8NB 1KQSA 4JCVE 1V4YA 2C2DA 1S10A 3N43B 1EY0A 3I73A 4I50F 1LV9A 2JEGA 1PYWD 1F2ZA 5KFNA 3JAML 3CVZA 1HJPA 3GIQA 1A3TA 2AQ1B 2B2TA 3H91A 1B8AA 4GKJH 1I7LA 4BY7H 1BVSA 1D5MC 2IWHA 2G9HD 2RDGA 4A3BH 2DJGC 3URYA 4O0AA 1HCZA 2UUBQ 4BXXG 4PNYA 1TWAA 3TINA 3NP8A 3PW4A 2C28A 2XRSD 1SROA 2C35B 3ULLA 2WAQE 3GIKA 3HOYB 4MV6A 1JE4A 1KIXA 2K33A 4ED7A 1B4OA 5C3WA 2F4IA 2KENA 4TQUS 5KEEA 1Y1WB 3PO2G 4QWAA 2CW7A 2IW3A 1LM0A 2VR1A 1HNWL 1ENAA 2ZTDA 4DNTB 2M9VA 1RJRA 4XIGS 1X3QA 5C5LA 3R23A 3GTPH 1X32A 3NENA 3OSPA 4X3TA 2P0AA 2B2UC 4QMGA 2K5QA 3ITPA 1PXUA 2Q8IB 3AQQA 1YNND 4NDXA 3HZXA 1X9NA 2HHHH 1HFGA 4EYIB 1WCMA 5KGUA 1B70B 4HMIA 2VUMB 2ZDHA 2WIIB 3KFUA 4EX5A 4O3OA 3BQ0A 1GUNA 1BJTA 4CJ1B 2NN6H 3JSNA 3J7A5 3L4JA 2NVQB 3V2TA 1Y1VB 4OGQC 2XRQD 4J15A 2CQOA 3BA8A 1JWMD 1KNEA 2FB9A 4UP9A 5CAEB 1LTBD 2NWGA 1Y1WA 1EIYB 4TUYF 2CW8A 2YU9H 1OXUA 1B3AA 4POGA 3M4OB 1MIUA 2UU9L 2FE3A 2KQ3A 4KV6A 3J81W 1L1OA 2WB1E 3BYYB 5G3LF 4YB8B 1U0LA 4X62Q 5KG7A 2AQ3B 2LMCB 4RH6A 3ETHA 4JI7L 3S1RH 3H15A 1NAPA 5D8DA 1FJGQ 2YYAA 2V4DA 3N6RA 1K8GA 1S5ED 3MFHA 1GYFA 5IWAL 4ED6A 3OMGA 4OWXB 3Q22A 3KDFB 5FLXE 1F2YA 4OIJA 4FS2A 2E8GA 3T51B 1B9NA 2HT1A 1AE3A 3LGJA 4BY1B 5M5YH 1UC8A 1D1IA 3GDEA 5M5XH 1Z7TA 3R5HA 1IKLA 4ED2A 1XPUA 3KAKA 3GILA 1TWGA 3S17B 4UP8A 3J81i 1B44D 2ATLA 2CWAA 2JEBI 2XCPA 2W6QA 4RNOA 1B6RA 2I5LX 2L12A 2F3VA 2R8GA 2NTTA 3NBHB 4G4KA 4DV7L 2UXBL 4GN3B 3MA2B 4I4TF 1SEBD 4DV2L 5C4XH 5KNCA 2A1AA 2YTVA 4EGQA 1EY7A 2VZAA 3MVVA 1P8LA 4IUVA 3SR1A 4DK6C 5KRUA 1K8AC 1A63A 3GIPA 3PR5B 4B3TQ 5C0XH 1G51A 2VQFL 2FPPB 2ICEC 2VY3A 5GADC 5BPFA 2F0DA 3T1HQ 3H94A 2R8JA 4EEQA 1HR0H 1EIGA 1H9KA 3KTMA 2EYOA 5LYJF 5KG4A 4A93G 1K1SA 5JVG3 2EE1A 5I2YA 4LF6Q 3G6VA 1CSQA 1YHAA 3QB3A 1B7YB 5LMNQ 5IYDH 3UDIA 1SBBB 2XCLA 2SNMA 2LXKA 2CH4A 3J80c 5KFFA 4PV1C 3SHLA 1XTCD 5JJKA 3M4IA 3HOVH 1HZ9A 1X6OA 4DF7A 3PCOB 1GHKA 1ZXTA 3FP9A 3NBHA 5IGDA 2JA8H 4XYMB 4JI6Q 2DN8A 4MA5A 3S2DB 1DOKA 2DNEA 4LFCH 3O13A 5JPNC 3ETJA 4L63B 1M8AA 1NJIC 2K01A 2OH2A 4OXPA 5BN3A 2A73B 2H1EA 5K36H 4F4ZA 4O4HF 1NTGA 5C1OA 5JVDF 3LWEA 4OO1I 5DG9A 1RYRA 3H0GH 1MKHA 2R7FA 4C3IG 1DIKA 1B53A 5I4DA 4FNFA 2F0LA 1E0BA 1VQMA 2XD4A 1L2ZA 5IGBA 1PTOB 4QB4A 1M7JA 4ETSA 4XTCS 3A56A 1TS5A 3DWAA 5LMNW
chains in the Genus database with same CATH topology
2ZTEA 4LFCL 4DR2Q 1Y14B 3PF4A 1N9WA 3CCEA 2HHHQ 4A3LH 1H95A 3W1GA 1GM5A 5IYBG 5FJ8H 5JEAJ 2OCEA 4RG1A 3PIOA 1LTLA 1L2FA 1N36Q 3JAMi 1X3FA 2NVYH 4B3MQ 3KOJA 1SR3A 4P73A 4PZ6A 4TVAB 4YWKA 2R92G 4LFBL 5C0XJ 2UU9Q 4JI5Q 4DR2L 2N49A 2Y0SE 1VQ4A 1MJEA 1X55A 2VNUD 3D0FA 4L5QA 4HJ9A 5C0XG 1OXTA 3H3VI 2R6GA 1N8RC 2VUMH 4DKAC 4PZ7A 1N36L 4R4QA 1PYBA 4B3ML 4DV6Q 4DV0Q 1I94Q 5GROA 3HFZB 5IWAQ 2AWOA 1Y1VH 1IZ6A 5M5WH 4BY7G 4X66L 2JA5H 4JI2L 3CCJA 2Z6KA 2VQEL 1VS0A 4LW1A 3JC66 4AQYL 2JA9A 2R7DA 4HIOA 3UDGA 3J80i 4YY3Q 2Q2HA 3NEMA 4DV6L 3CF5A 4DV0L 1I94L 3PUVA 4DV4Q 1VCIA 1HZBA 3FKIG 1Z9FA 4IJLA 4A3MG 1S72A 4AIMA 3ULPA 2E2IH 4IFDI 1NE3A 1WCMG 4YCVA 4GLAC 2UXDQ 3I55A 4JBWA 2F4VQ 3CMAA 4OONA 2K5VA 2UXCQ 4DV5Q 3KLWA 3J7ZC 2B63G 1YI2A 1VQ8A 2WAQG 4A3KG 3TQYA 4YY3L 4HIMA 1YJ9A 4BXXH 4IO9A 5GQOA 4A3JH 4DR7L 5IT9c 4DV7Q 1VQJA 3H0GG 2CFMA 3K80C 3M4QA 1PH9A 1YJWA 3EN2A 4A75A 3CCUA 3HOYG 2UXDL 4X6AH 2GN5A 4JG2A 2UXCL 2AKWB 2HIVA 4DV5L 1GD7A 4LFAL 1E22A 1EYGA 1Y1WG 2Z6KC 5GAEC 3RNUA 3PO2H 3Q8DA 1IXRA 3HOZH 1OTCA 3CCMA 2VQFQ 2V1CC 1YHQA 4BY1H 3KF6B 4DAMA 3F2CA 1K73C 4NXNL 1BBWA 5M3FG 1TWCH 1Z47A 4GOPC 4C3JH 3DM3A 4JI0L 4IOCA 1K3RA 3RZOH 1MJCA 2HQLA 2NN6G 4HJ8A 1E3PA 1J6QA 2K75A 4HJ7A 2E2HH 1EIFA 3ULJA 3S14H 1FL0A 2N78A 1KL9A 2NVXH 3FHWA 4POFA 1EUJA 1NMFA 1YJNA 3HOWG 1I5FA 4BA1I 3TRZA 4H02A 1V1QA 3GTLH 3KDFA 2A19A 3CCVA 1N33L 1HR0Q 3U50C 2AWNA 1C7YA 3CD6A 4LF4Q 4JV5L 2Y0SG 3BZCA 3CMEA 3U58A 2KCMA 4QL5A 3S2HH 2JA7H 3RLOA 3KJOA 1YNXA 4FDBA 3U4VA 4EQ5A 1VQ9A 4B3RQ 3GO5A 4KHPL 1IBLQ 1QZGA 4DR4Q 4MNOA 2PQAB 4NB3A 4BBRH 4HJAA 1U5KA 4P72A 4MTNA 3CC2A 2WFWA 4GLVB 3PUXA 5IP9G 1AE2A 2OTLA 3A0JA 1OXVA 3B6YA 1N34Q 3CC4A 4LF4L 1XMOL 3PIPA 1EQRA 3PO3H 1BKBA 4JYAQ 4B3RL 3KF6A 4UPAA 1IBLL 1DGSA 1LYLA 1PH5A 2OWOA 4LNQA 2N8NA 4PZ8A 4DR5Q 1N32Q 3CAMA 1PFSA 4Y7NH 4LF9Q 1JJCB 5E7NA 2IHFA 3GTOH 3CCRA 3RN2A 3CPFA 2OQ0A 2ZJPA 4LFCQ 3S15H 1G291 3UE0A 1CKOA 1OXSC 5FLMG 1N34L 2Q2UA 3OYYA 3CQZH 1HNZQ 2NZOA 5C4XG 3VDYA 1NBWA 4A3JG 4JYAL 4HIDA 1HNXL 5ELNA 1CKNB 4NXML 4DUYL 2JQOA 1VQ6A 3I4NH 3BU2A 3K7AH 1D7QA 2QA4A 4LF9L 3WWVA 2ZTCA 4R4CA 4DNIA 4DUZL 1WOCA 4AH6A 4DR1L 4HJ5A 3CCSA 4OWWB 3S2DH 4A3CG 4LFBQ 2YYZA 4IFDJ 3HOXG 4JI1Q 5AJ3L 2UUCQ 1HNZL 5LMUQ 1JE5A 4BY1G 3I2ZA 4X64L 4DR6L 5H1SE 2AMCB 1VQKA 1L1OB 4LUVA 1PV4A 2PQAA 4AYBE 4RMFA 5IE8A 1GVPA 2ZM6Q 1Q86C 2K50A 4WJ3M 4PG3A 2MQHA 4IPCA 1VQBA 5JEAG 3MXNB 1HZCA 2KHIA 4B3SQ 1GKHA 2K4KA 4JBMA 3GTQH 1CSPA 3PUYA 1NMGA 1UE6A 4R4OA 3KYHC 5HY6A 4JI1L 4X66Q 1R9TH 4JI2Q 4DAYB 5IP7G 3J81c 2ZJRA 5LMUL 2R7ZH 2VQEQ 3CW2C 1IL2A 2D62A 1XJVA 3IRBA 3F8TA 1PH2A 3I4MH 3L2PA 5JJLA 4AQYQ 2LSSA 2ZM6L 4A3IH 3E9HA 4A3DH 1SRUA 4BBSG 4LF8L 2I5HA 4B3SL 4A76A 5C3EG 1Q12A 4JOIC 1FVIA 2E5LL 1VQLA 1W3SA 4A4IA 2Q2IA 1CKMA 2NZHA 3A5ZB 1CKNA 5IYDG 1EOVA 1TWHH 1BBUA 1PH6A 3HOUG 1K0RA 3STBD 1V9PA 1V43A 2IX0A 4DR7Q 4DV3Q 4LF7L 3HOVG 1X3GA 1E1TA 1E24A 2IHEA 2GVAA 3OTOQ 4A3EG 3H3VH 4BA2I 2OTJA 5M3MH 2H5XA 2JA8G 1KC8C 3PGZA 4LFAQ 2NVTH 1Q1EA 1AH9A 2VW9A 4YHHL 3G48A 2B29A 2I0QA 1JT8A 1WI5A 3D31A 2IY5B 1X54A 5K36G 2UUCL 4DV3L 2PMZE 4NXNQ 1VQCA 3L7ZC 4GN4B 4YWMA 4JI3L 3OTOL 1SFOH 4JI0Q 4A3GH 1L0WA 3K7UC 1VQHA 3TREA 2F3IA 1K83H 4A3FH 1Q7YC 2Q2TA 3EBEA 1T9HA 4GN5A 1YHBA 3CCLA 2WP8J 1NY4A 4DR3L 4R4TA 5C44G 4UY8C 3K8AA 2JA6H 2XGTA 4UP7A 1WJJA 1M1KC 3W1BA 1PYSB 2R93H 1G6PA 4A3LG 1XNRQ 1K9MC 3AFQA 3CP0A 1I6HH 1X56A 4DV1L 4C3IH 5FJ8G 1QVCA 3RZDH 2YTXA 1N33Q 5C0XI 3F1ZA 5ELOA 4JV5Q 2LXJA 5HGQA 3S1NH 3K0XA 1SN8A 4KHPQ 4K0KQ 4OO1G 3M9BA 2QGQA 2D0OA 3PV0A 2JE6I 1Q46A 1XNRL 3GD7A 3OW2A 2R7ZG 2D0PA 3AEVA 5IY0A 2UUAL 2VUMG 4LF5L 1FGUA 2BA0A 3BZKA 4LWCA 2BH8A 5DLQE 3UE1A 1EQQA 2CWPA 2K5NA 5IYBH 1KD1C 1IBML 4MZ9A 1TWFH 1XMOQ 4APVA 4K0KL 3GTGH 3JAMc 2R92H 1Y1VG 1TWAH 3RR5A 2JA5G 4X65L 1XNQL 1PVOA 1UE1A 1Q8KA 3EIVA 1KQSA 4JCVE 4DR4L 3KJPA 1SLJA 4OWTB 4C2MH 3M85A 2ZJQA 1JMCA 2PNHA 2ID0A 4Y52H 4GS3A 1HNXQ 4NXMQ 4DUYQ 1PH4A 1HJPA 3I7FA 1VQNA 1B8AA 4HIKA 1WYDA 4JBJA 4DR1Q 4DUZQ 2KHJA 4OX9L 4B3TL 4BY7H 1BVSA 3ERSX 4IOAA 2K14A 3GTJH 3M4PA 4A3BH 4L5RC 1XMQQ 4O0AA 4IPGA 4GNXB 5AJ3Q 3T1HL 4IPDA 2VL6A 2UUBQ 1S3OA 1JJ2A 1M90C 4BXXG 1HR0W 3TS2A 4X64Q 4DR6Q 1I3QH 4JC0A 4LUZA 1S40A 3M3YH 1SROA 2C35B 3ULLA 2WAQE 4GLXA 4A3GG 4YWLA 3FKIH 1UEBA 3K81C 4A3MH 1KIXA 3KF8B 1A8VA 1WCMH 4LF6L 1VQ5A 4GKJL 2KENA 4TQUS 3J81j 1XMQL 1Q81C 3PO2G 5GAHC 1OXXK 2JK8A 2NN6I 5LMNL 2UUBL 1X65A 1LM0A 2B63H 3HOZG 4A3KH 1HNWL 1XPRA 2ZTDA 4IFDG 2K52A 5J3BA 3G6EA 1VQOA 1YBYA 4XIGS 1E7ZA 2EXDA 3GTPH 3NENA 4LF8Q 1PH7A 2N3SA 3BJUA 1YVCA 3L0OA 2YV5A 2E5LQ 1P16A 1UWVA 3AQQA 1Y1WH 1HZAA 3F2DA 1X9NA 1J5EL 4GOPB 3W5OA 4QGUA 2MO0A 1B70B 4R4IA 3UDXA 1C9OA 5M3FH 4C3HH 3KFUA 4EX5A 3G71A 2EQSA 3A5UA 2A8VA 4LF7Q 4DK3C 4GNXA 1Q1BA 3F2BA 2BA1A 2I5MX 2JA7G 3J7A5 2FXQA 4NPSA 4JI4Q 5IYCH 1I50H 3PUZA 2DUDA 3STBC 1VQGA 5C4JH 4BBRG 3M7NA 2HHHL 4P75A 1UE5A 2OQKA 4YHHQ 1QZHA 1LUZA 1QUQB 2CQOA 4J15A 3HOWH 3PF5A 2PI2A 5BR8Q 3S1QH 1KAWA 1PH8A 4UP9A 4P71A 2F52A 1C0AA 1JJGA 2MO1A 1EIYB 2YU9H 1OXUA 4JI7Q 4JI3Q 3PO3G 4JI4L 3HKZE 4A93H 3SGIA 4POGA 4JBKA 1MIUA 2UU9L 1E1OA 4JI5L 3E0EA 2RCNA 1L1OA 1IYJB 2NVQH 2WB1E 4DR3Q 1VQAA 4IJHA 3CXCA 1CUKA 5BR8L 1SE8A 1U0LA 4X62Q 5IP9H 4A3BG 3S24A 2B3GA 1SMXA 3ER0A 2HIXA 4L5TA 1RL2A 3E9IA 1VQPA 4JI7L 1TWGH 2KCTA 3MEFA 3S1RH 3H15A 1VQIA 4DV1Q 1FJGQ 1EFWA 4L5SA 4GNXC 3CC7A 4GOPA 1JB7A 3RLNA 3I4NG 1D8LA 1K8GA 2MNAA 4PMWA 1QVGA 5IWAL 2ES2A 3M4OH 1O7IA 4OWXB 2E2JH 1RIPA 3KDFB 4X62L 2DGYA 2E8GA 1YEZA 2HT1A 3A74A 1AE3A 3CCQA 1HH2P 1KRSA 3LGJA 5GAGC 4YCUA 5M5YH 1PH1A 5FLMH 2UUAQ 3T1YQ 2ATWA 4LF5Q 1FJGL 4QQBX 4DV4L 1A0IA 1TXYA 2VS1A 3GDEA 4KLKA 5M5XH 1IBKQ 2UXBQ 1IBMQ 1YIJA 4QIWE 2L15A 1QUQA 1ASYA 3TS0A 2BH2A 1XPUA 1VQFA 1L1OC 5FLXc 4DV2Q 2F4VL 4UP8A 3J81i 1PHJA 1A62A 4A3CH 2CWAA 4KI0A 4O2DA 3AYHB 2JEBI 1X3EA 4AYBG 4X65Q 2CKZB 1XNQQ 3HOXH 2I5LX 3T1YL 3I4MG 1QVFA 3S1MH 4DV7L 3NBHB 4R1JA 1XTDA 1IBKL 2UXBL 4A3IG 3G4SA 1WFQA 4GN3B 4A3DG 4DV2L 2RF4A 5C4XH 3I56A 2A1AA 2EIFA 2CCZA 2YTVA 3RLFA 1VQDA 2VZAA 1P8LA 2IT1A 4JI8Q 4DK6C 1YITA 5IYCG 1K8AC 3S17H 1A63A 4OX9Q 4B3TQ 3DLLA 4WJ4A 2VQFL 1G51A 4KHZA 3ZJYC 5IP7H 2VY3A 5EAYA 1YZ6A 5GADC 1UE7A 3CPWA 3T1HQ 2Z0SA 3AFPA 3UDFA 1VQEA 4LUOA 3HKSA 3PSIA 1KRTA 2QEXA 2IX1A 2GVBA 4BBSH 4GKKQ 1VQ7A 3GTKH 4JI8L 5C3EH 4A93G 1GO3E 2MFIA 1ASZA 4YCWA 5M3MG 4QJFA 3U4ZA 4LF6Q 4GKJQ 1CSQA 1PH3A 1YHAA 1B7YB 5LMNQ 5IYDH 3UDIA 2YTYA 3HOUH 1HNWQ 3HKZG 2JEAI 2LXKA 1KHIA 3J80c 4ALPA 4GKKL 1HR0L 3PUWA 5JJKA 3HOVH 2WB1G 4A3FG 4A3EH 1HZ9A 1X6OA 1W2BA 3PCOB 2ASBA 4IPHA 3FP9A 1PA6A 2JA8H 3I4OA 4JI6Q 2JA6G 2AHOB 2ALYB 1KXLA 2R93G 3RN5A 1J5EQ 1NJIC 1EWIA 2PI2E 1Q82C 3ICEA 4OXPA 2RHQB 4DPGA 1NTGA 4QY7A 2RHSB 1XPOA 4OO1I 3H0GH 2K5HA 1MKHA 2R7FA 2XTIA 3S16H 2JJQA 3GTMH 4P74A 3HOYH 1VQMA 1N32L 4ME3A 4JI6L 4DR5L 2KBNA 5JJIA 4XTCS 4JOIA 3NELA 3TEHB 5C44H 5LMNW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTE A;  4LFC L;  4DR2 Q;  1Y14 B;  3PF4 A;  1N9W A;  3CCE A;  2HHH Q;  4A3L H;  1H95 A;  3W1G A;  1GM5 A;  5IYB G;  5FJ8 H;  5JEA J;  2OCE A;  4RG1 A;  3PIO A;  1LTL A;  1L2F A;  1N36 Q;  3JAM i;  1X3F A;  2NVY H;  4B3M Q;  3KOJ A;  1SR3 A;  4P73 A;  4PZ6 A;  4TVA B;  4YWK A;  2R92 G;  4LFB L;  5C0X J;  2UU9 Q;  4JI5 Q;  4DR2 L;  2N49 A;  2Y0S E;  1VQ4 A;  1MJE A;  1X55 A;  2VNU D;  3D0F A;  4L5Q A;  4HJ9 A;  5C0X G;  1OXT A;  3H3V I;  2R6G A;  1N8R C;  2VUM H;  4DKA C;  4PZ7 A;  1N36 L;  4R4Q A;  1PYB A;  4B3M L;  4DV6 Q;  4DV0 Q;  1I94 Q;  5GRO A;  3HFZ B;  5IWA Q;  2AWO A;  1Y1V H;  1IZ6 A;  5M5W H;  4BY7 G;  4X66 L;  2JA5 H;  4JI2 L;  3CCJ A;  2Z6K A;  2VQE L;  1VS0 A;  4LW1 A;  3JC6 6;  4AQY L;  2JA9 A;  2R7D A;  4HIO A;  3UDG A;  3J80 i;  4YY3 Q;  2Q2H A;  3NEM A;  4DV6 L;  3CF5 A;  4DV0 L;  1I94 L;  3PUV A;  4DV4 Q;  1VCI A;  1HZB A;  3FKI G;  1Z9F A;  4IJL A;  4A3M G;  1S72 A;  4AIM A;  3ULP A;  2E2I H;  4IFD I;  1NE3 A;  1WCM G;  4YCV A;  4GLA C;  2UXD Q;  3I55 A;  4JBW A;  2F4V Q;  3CMA A;  4OON A;  2K5V A;  2UXC Q;  4DV5 Q;  3KLW A;  3J7Z C;  2B63 G;  1YI2 A;  1VQ8 A;  2WAQ G;  4A3K G;  3TQY A;  4YY3 L;  4HIM A;  1YJ9 A;  4BXX H;  4IO9 A;  5GQO A;  4A3J H;  4DR7 L;  5IT9 c;  4DV7 Q;  1VQJ A;  3H0G G;  2CFM A;  3K80 C;  3M4Q A;  1PH9 A;  1YJW A;  3EN2 A;  4A75 A;  3CCU A;  3HOY G;  2UXD L;  4X6A H;  2GN5 A;  4JG2 A;  2UXC L;  2AKW B;  2HIV A;  4DV5 L;  1GD7 A;  4LFA L;  1E22 A;  1EYG A;  1Y1W G;  2Z6K C;  5GAE C;  3RNU A;  3PO2 H;  3Q8D A;  1IXR A;  3HOZ H;  1OTC A;  3CCM A;  2VQF Q;  2V1C C;  1YHQ A;  4BY1 H;  3KF6 B;  4DAM A;  3F2C A;  1K73 C;  4NXN L;  1BBW A;  5M3F G;  1TWC H;  1Z47 A;  4GOP C;  4C3J H;  3DM3 A;  4JI0 L;  4IOC A;  1K3R A;  3RZO H;  1MJC A;  2HQL A;  2NN6 G;  4HJ8 A;  1E3P A;  1J6Q A;  2K75 A;  4HJ7 A;  2E2H H;  1EIF A;  3ULJ A;  3S14 H;  1FL0 A;  2N78 A;  1KL9 A;  2NVX H;  3FHW A;  4POF A;  1EUJ A;  1NMF A;  1YJN A;  3HOW G;  1I5F A;  4BA1 I;  3TRZ A;  4H02 A;  1V1Q A;  3GTL H;  3KDF A;  2A19 A;  3CCV A;  1N33 L;  1HR0 Q;  3U50 C;  2AWN A;  1C7Y A;  3CD6 A;  4LF4 Q;  4JV5 L;  2Y0S G;  3BZC A;  3CME A;  3U58 A;  2KCM A;  4QL5 A;  3S2H H;  2JA7 H;  3RLO A;  3KJO A;  1YNX A;  4FDB A;  3U4V A;  4EQ5 A;  1VQ9 A;  4B3R Q;  3GO5 A;  4KHP L;  1IBL Q;  1QZG A;  4DR4 Q;  4MNO A;  2PQA B;  4NB3 A;  4BBR H;  4HJA A;  1U5K A;  4P72 A;  4MTN A;  3CC2 A;  2WFW A;  4GLV B;  3PUX A;  5IP9 G;  1AE2 A;  2OTL A;  3A0J A;  1OXV A;  3B6Y A;  1N34 Q;  3CC4 A;  4LF4 L;  1XMO L;  3PIP A;  1EQR A;  3PO3 H;  1BKB A;  4JYA Q;  4B3R L;  3KF6 A;  4UPA A;  1IBL L;  1DGS A;  1LYL A;  1PH5 A;  2OWO A;  4LNQ A;  2N8N A;  4PZ8 A;  4DR5 Q;  1N32 Q;  3CAM A;  1PFS A;  4Y7N H;  4LF9 Q;  1JJC B;  5E7N A;  2IHF A;  3GTO H;  3CCR A;  3RN2 A;  3CPF A;  2OQ0 A;  2ZJP A;  4LFC Q;  3S15 H;  1G29 1;  3UE0 A;  1CKO A;  1OXS C;  5FLM G;  1N34 L;  2Q2U A;  3OYY A;  3CQZ H;  1HNZ Q;  2NZO A;  5C4X G;  3VDY A;  1NBW A;  4A3J G;  4JYA L;  4HID A;  1HNX L;  5ELN A;  1CKN B;  4NXM L;  4DUY L;  2JQO A;  1VQ6 A;  3I4N H;  3BU2 A;  3K7A H;  1D7Q A;  2QA4 A;  4LF9 L;  3WWV A;  2ZTC A;  4R4C A;  4DNI A;  4DUZ L;  1WOC A;  4AH6 A;  4DR1 L;  4HJ5 A;  3CCS A;  4OWW B;  3S2D H;  4A3C G;  4LFB Q;  2YYZ A;  4IFD J;  3HOX G;  4JI1 Q;  5AJ3 L;  2UUC Q;  1HNZ L;  5LMU Q;  1JE5 A;  4BY1 G;  3I2Z A;  4X64 L;  4DR6 L;  5H1S E;  2AMC B;  1VQK A;  1L1O B;  4LUV A;  1PV4 A;  2PQA A;  4AYB E;  4RMF A;  5IE8 A;  1GVP A;  2ZM6 Q;  1Q86 C;  2K50 A;  4WJ3 M;  4PG3 A;  2MQH A;  4IPC A;  1VQB A;  5JEA G;  3MXN B;  1HZC A;  2KHI A;  4B3S Q;  1GKH A;  2K4K A;  4JBM A;  3GTQ H;  1CSP A;  3PUY A;  1NMG A;  1UE6 A;  4R4O A;  3KYH C;  5HY6 A;  4JI1 L;  4X66 Q;  1R9T H;  4JI2 Q;  4DAY B;  5IP7 G;  3J81 c;  2ZJR A;  5LMU L;  2R7Z H;  2VQE Q;  3CW2 C;  1IL2 A;  2D62 A;  1XJV A;  3IRB A;  3F8T A;  1PH2 A;  3I4M H;  3L2P A;  5JJL A;  4AQY Q;  2LSS A;  2ZM6 L;  4A3I H;  3E9H A;  4A3D H;  1SRU A;  4BBS G;  4LF8 L;  2I5H A;  4B3S L;  4A76 A;  5C3E G;  1Q12 A;  4JOI C;  1FVI A;  2E5L L;  1VQL A;  1W3S A;  4A4I A;  2Q2I A;  1CKM A;  2NZH A;  3A5Z B;  1CKN A;  5IYD G;  1EOV A;  1TWH H;  1BBU A;  1PH6 A;  3HOU G;  1K0R A;  3STB D;  1V9P A;  1V43 A;  2IX0 A;  4DR7 Q;  4DV3 Q;  4LF7 L;  3HOV G;  1X3G A;  1E1T A;  1E24 A;  2IHE A;  2GVA A;  3OTO Q;  4A3E G;  3H3V H;  4BA2 I;  2OTJ A;  5M3M H;  2H5X A;  2JA8 G;  1KC8 C;  3PGZ A;  4LFA Q;  2NVT H;  1Q1E A;  1AH9 A;  2VW9 A;  4YHH L;  3G48 A;  2B29 A;  2I0Q A;  1JT8 A;  1WI5 A;  3D31 A;  2IY5 B;  1X54 A;  5K36 G;  2UUC L;  4DV3 L;  2PMZ E;  4NXN Q;  1VQC A;  3L7Z C;  4GN4 B;  4YWM A;  4JI3 L;  3OTO L;  1SFO H;  4JI0 Q;  4A3G H;  1L0W A;  3K7U C;  1VQH A;  3TRE A;  2F3I A;  1K83 H;  4A3F H;  1Q7Y C;  2Q2T A;  3EBE A;  1T9H A;  4GN5 A;  1YHB A;  3CCL A;  2WP8 J;  1NY4 A;  4DR3 L;  4R4T A;  5C44 G;  4UY8 C;  3K8A A;  2JA6 H;  2XGT A;  4UP7 A;  1WJJ A;  1M1K C;  3W1B A;  1PYS B;  2R93 H;  1G6P A;  4A3L G;  1XNR Q;  1K9M C;  3AFQ A;  3CP0 A;  1I6H H;  1X56 A;  4DV1 L;  4C3I H;  5FJ8 G;  1QVC A;  3RZD H;  2YTX A;  1N33 Q;  5C0X I;  3F1Z A;  5ELO A;  4JV5 Q;  2LXJ A;  5HGQ A;  3S1N H;  3K0X A;  1SN8 A;  4KHP Q;  4K0K Q;  4OO1 G;  3M9B A;  2QGQ A;  2D0O A;  3PV0 A;  2JE6 I;  1Q46 A;  1XNR L;  3GD7 A;  3OW2 A;  2R7Z G;  2D0P A;  3AEV A;  5IY0 A;  2UUA L;  2VUM G;  4LF5 L;  1FGU A;  2BA0 A;  3BZK A;  4LWC A;  2BH8 A;  5DLQ E;  3UE1 A;  1EQQ A;  2CWP A;  2K5N A;  5IYB H;  1KD1 C;  1IBM L;  4MZ9 A;  1TWF H;  1XMO Q;  4APV A;  4K0K L;  3GTG H;  3JAM c;  2R92 H;  1Y1V G;  1TWA H;  3RR5 A;  2JA5 G;  4X65 L;  1XNQ L;  1PVO A;  1UE1 A;  1Q8K A;  3EIV A;  1KQS A;  4JCV E;  4DR4 L;  3KJP A;  1SLJ A;  4OWT B;  4C2M H;  3M85 A;  2ZJQ A;  1JMC A;  2PNH A;  2ID0 A;  4Y52 H;  4GS3 A;  1HNX Q;  4NXM Q;  4DUY Q;  1PH4 A;  1HJP A;  3I7F A;  1VQN A;  1B8A A;  4HIK A;  1WYD A;  4JBJ A;  4DR1 Q;  4DUZ Q;  2KHJ A;  4OX9 L;  4B3T L;  4BY7 H;  1BVS A;  3ERS X;  4IOA A;  2K14 A;  3GTJ H;  3M4P A;  4A3B H;  4L5R C;  1XMQ Q;  4O0A A;  4IPG A;  4GNX B;  5AJ3 Q;  3T1H L;  4IPD A;  2VL6 A;  2UUB Q;  1S3O A;  1JJ2 A;  1M90 C;  4BXX G;  1HR0 W;  3TS2 A;  4X64 Q;  4DR6 Q;  1I3Q H;  4JC0 A;  4LUZ A;  1S40 A;  3M3Y H;  1SRO A;  2C35 B;  3ULL A;  2WAQ E;  4GLX A;  4A3G G;  4YWL A;  3FKI H;  1UEB A;  3K81 C;  4A3M H;  1KIX A;  3KF8 B;  1A8V A;  1WCM H;  4LF6 L;  1VQ5 A;  4GKJ L;  2KEN A;  4TQU S;  3J81 j;  1XMQ L;  1Q81 C;  3PO2 G;  5GAH C;  1OXX K;  2JK8 A;  2NN6 I;  5LMN L;  2UUB L;  1X65 A;  1LM0 A;  2B63 H;  3HOZ G;  4A3K H;  1HNW L;  1XPR A;  2ZTD A;  4IFD G;  2K52 A;  5J3B A;  3G6E A;  1VQO A;  1YBY A;  4XIG S;  1E7Z A;  2EXD A;  3GTP H;  3NEN A;  4LF8 Q;  1PH7 A;  2N3S A;  3BJU A;  1YVC A;  3L0O A;  2YV5 A;  2E5L Q;  1P16 A;  1UWV A;  3AQQ A;  1Y1W H;  1HZA A;  3F2D A;  1X9N A;  1J5E L;  4GOP B;  3W5O A;  4QGU A;  2MO0 A;  1B70 B;  4R4I A;  3UDX A;  1C9O A;  5M3F H;  4C3H H;  3KFU A;  4EX5 A;  3G71 A;  2EQS A;  3A5U A;  2A8V A;  4LF7 Q;  4DK3 C;  4GNX A;  1Q1B A;  3F2B A;  2BA1 A;  2I5M X;  2JA7 G;  3J7A 5;  2FXQ A;  4NPS A;  4JI4 Q;  5IYC H;  1I50 H;  3PUZ A;  2DUD A;  3STB C;  1VQG A;  5C4J H;  4BBR G;  3M7N A;  2HHH L;  4P75 A;  1UE5 A;  2OQK A;  4YHH Q;  1QZH A;  1LUZ A;  1QUQ B;  2CQO A;  4J15 A;  3HOW H;  3PF5 A;  2PI2 A;  5BR8 Q;  3S1Q H;  1KAW A;  1PH8 A;  4UP9 A;  4P71 A;  2F52 A;  1C0A A;  1JJG A;  2MO1 A;  1EIY B;  2YU9 H;  1OXU A;  4JI7 Q;  4JI3 Q;  3PO3 G;  4JI4 L;  3HKZ E;  4A93 H;  3SGI A;  4POG A;  4JBK A;  1MIU A;  2UU9 L;  1E1O A;  4JI5 L;  3E0E A;  2RCN A;  1L1O A;  1IYJ B;  2NVQ H;  2WB1 E;  4DR3 Q;  1VQA A;  4IJH A;  3CXC A;  1CUK A;  5BR8 L;  1SE8 A;  1U0L A;  4X62 Q;  5IP9 H;  4A3B G;  3S24 A;  2B3G A;  1SMX A;  3ER0 A;  2HIX A;  4L5T A;  1RL2 A;  3E9I A;  1VQP A;  4JI7 L;  1TWG H;  2KCT A;  3MEF A;  3S1R H;  3H15 A;  1VQI A;  4DV1 Q;  1FJG Q;  1EFW A;  4L5S A;  4GNX C;  3CC7 A;  4GOP A;  1JB7 A;  3RLN A;  3I4N G;  1D8L A;  1K8G A;  2MNA A;  4PMW A;  1QVG A;  5IWA L;  2ES2 A;  3M4O H;  1O7I A;  4OWX B;  2E2J H;  1RIP A;  3KDF B;  4X62 L;  2DGY A;  2E8G A;  1YEZ A;  2HT1 A;  3A74 A;  1AE3 A;  3CCQ A;  1HH2 P;  1KRS A;  3LGJ A;  5GAG C;  4YCU A;  5M5Y H;  1PH1 A;  5FLM H;  2UUA Q;  3T1Y Q;  2ATW A;  4LF5 Q;  1FJG L;  4QQB X;  4DV4 L;  1A0I A;  1TXY A;  2VS1 A;  3GDE A;  4KLK A;  5M5X H;  1IBK Q;  2UXB Q;  1IBM Q;  1YIJ A;  4QIW E;  2L15 A;  1QUQ A;  1ASY A;  3TS0 A;  2BH2 A;  1XPU A;  1VQF A;  1L1O C;  5FLX c;  4DV2 Q;  2F4V L;  4UP8 A;  3J81 i;  1PHJ A;  1A62 A;  4A3C H;  2CWA A;  4KI0 A;  4O2D A;  3AYH B;  2JEB I;  1X3E A;  4AYB G;  4X65 Q;  2CKZ B;  1XNQ Q;  3HOX H;  2I5L X;  3T1Y L;  3I4M G;  1QVF A;  3S1M H;  4DV7 L;  3NBH B;  4R1J A;  1XTD A;  1IBK L;  2UXB L;  4A3I G;  3G4S A;  1WFQ A;  4GN3 B;  4A3D G;  4DV2 L;  2RF4 A;  5C4X H;  3I56 A;  2A1A A;  2EIF A;  2CCZ A;  2YTV A;  3RLF A;  1VQD A;  2VZA A;  1P8L A;  2IT1 A;  4JI8 Q;  4DK6 C;  1YIT A;  5IYC G;  1K8A C;  3S17 H;  1A63 A;  4OX9 Q;  4B3T Q;  3DLL A;  4WJ4 A;  2VQF L;  1G51 A;  4KHZ A;  3ZJY C;  5IP7 H;  2VY3 A;  5EAY A;  1YZ6 A;  5GAD C;  1UE7 A;  3CPW A;  3T1H Q;  2Z0S A;  3AFP A;  3UDF A;  1VQE A;  4LUO A;  3HKS A;  3PSI A;  1KRT A;  2QEX A;  2IX1 A;  2GVB A;  4BBS H;  4GKK Q;  1VQ7 A;  3GTK H;  4JI8 L;  5C3E H;  4A93 G;  1GO3 E;  2MFI A;  1ASZ A;  4YCW A;  5M3M G;  4QJF A;  3U4Z A;  4LF6 Q;  4GKJ Q;  1CSQ A;  1PH3 A;  1YHA A;  1B7Y B;  5LMN Q;  5IYD H;  3UDI A;  2YTY A;  3HOU H;  1HNW Q;  3HKZ G;  2JEA I;  2LXK A;  1KHI A;  3J80 c;  4ALP A;  4GKK L;  1HR0 L;  3PUW A;  5JJK A;  3HOV H;  2WB1 G;  4A3F G;  4A3E H;  1HZ9 A;  1X6O A;  1W2B A;  3PCO B;  2ASB A;  4IPH A;  3FP9 A;  1PA6 A;  2JA8 H;  3I4O A;  4JI6 Q;  2JA6 G;  2AHO B;  2ALY B;  1KXL A;  2R93 G;  3RN5 A;  1J5E Q;  1NJI C;  1EWI A;  2PI2 E;  1Q82 C;  3ICE A;  4OXP A;  2RHQ B;  4DPG A;  1NTG A;  4QY7 A;  2RHS B;  1XPO A;  4OO1 I;  3H0G H;  2K5H A;  1MKH A;  2R7F A;  2XTI A;  3S16 H;  2JJQ A;  3GTM H;  4P74 A;  3HOY H;  1VQM A;  1N32 L;  4ME3 A;  4JI6 L;  4DR5 L;  2KBN A;  5JJI A;  4XTC S;  4JOI A;  3NEL A;  3TEH B;  5C44 H;  5LMN W; 
#chains in the Genus database with same CATH topology
 2CZG A;  2YRX A;  4DR2 Q;  2K32 A;  3PF4 A;  2R7Z B;  4AYB B;  2YW2 A;  5FPO A;  5KFJ A;  5KFL A;  1GM5 A;  4ZKB B;  4B3M H;  5JEA J;  4CBV A;  3RV3 A;  3PIO A;  5E4W C;  5C1P A;  1LTL A;  4YJ2 F;  1L2F A;  2PVP A;  2QCP X;  2NVY H;  5IGG A;  4YWK A;  3F8N A;  1N48 A;  3SE7 A;  4X66 H;  2JA5 B;  3BVG A;  3OMC A;  4Q43 A;  2KCC A;  2QW7 A;  4OEM B;  2QK4 A;  1X55 A;  2VNU D;  1Z6H A;  3D0F A;  4L5Q A;  2ASD A;  1SEI A;  4O3R A;  4LMY A;  4DKA C;  3C0F B;  4DV0 H;  2PBZ A;  1WTX A;  1N36 L;  2VOB A;  4R4Q A;  4DV6 Q;  2XC9 A;  4DA2 A;  3VR5 A;  3GII A;  5GRO A;  3E5N A;  5LL6 X;  4G7H C;  1IZ6 A;  3KLS A;  1HXY D;  3CCJ A;  4OL7 A;  2VQE L;  1VS0 A;  2NBF A;  2A68 C;  4YQW A;  2VA3 A;  2W6M A;  4ZCK A;  3T5J A;  2R7D A;  4HIO A;  1EU4 A;  3J7A F;  3J80 i;  5KFX A;  4DR7 H;  2Q2H A;  4DL2 A;  3CF5 A;  1M0W A;  1STA A;  4DV4 Q;  1VCI A;  4FBT A;  5IT9 E;  2R7Z A;  4IJL A;  1Z9F A;  2WB1 B;  1S72 A;  1K83 B;  2E2I H;  1WCM G;  5KFK A;  4YCV A;  4LFA H;  4ECV A;  3K59 A;  2ZDG A;  2XIW A;  2NU7 B;  2ICI A;  2UXC Q;  3HOZ B;  5IOC A;  1VQ8 A;  4E4T A;  3K5H A;  4NXN H;  5C4H A;  2JA5 A;  1VQJ A;  1ZET A;  3K80 C;  1PH9 A;  3RZD B;  5E1F A;  2FLP A;  3HOY G;  2UXD L;  4CJ2 C;  3FDT A;  3RF2 A;  1GD7 A;  4HSV A;  3K5L A;  1PZI D;  1Y1W G;  2Z6K C;  4H13 C;  4E6I A;  1I4H A;  4F7X A;  2DPJ A;  2M00 A;  1YHQ A;  1LTT D;  4DK0 A;  2L9H A;  1BBW A;  4EG0 A;  2J0T D;  4C3J H;  3PN1 A;  1N33 H;  5I6W A;  3QWN A;  1VMP A;  4KN7 C;  2O5J C;  3BG5 A;  3K5I A;  2TSS A;  1GUW A;  1TAE A;  1EIF A;  1R4Q B;  4POF A;  2FIN B;  1JKJ B;  2RKS A;  4ECT A;  1EY4 A;  5F2D A;  5I47 A;  5L1J A;  1K83 A;  4H02 A;  3GTL H;  1UUP A;  1XMO H;  5AFW A;  5FLX W;  4ECU A;  1C7Y A;  4RZR A;  4JV5 L;  3I4L A;  1DV1 A;  1KLG D;  1IBL H;  1S0M A;  1ZYR C;  2JA7 H;  3TP5 A;  3U4V A;  3GO5 A;  2NB0 A;  1QZG A;  1EU3 A;  2AUK A;  4MNO A;  1K3B C;  2WAC A;  4BY7 B;  2PQA B;  3AMU A;  4DL6 A;  4DL3 A;  4HJA A;  3CC2 A;  4A3B B;  5C4Z A;  2OTL A;  1CS0 A;  1N34 H;  3ONA B;  4IAL A;  3VR3 A;  2DWC A;  4JYA H;  4MTE A;  4FYD A;  4ECR A;  3T53 B;  3PIP A;  1F9Q A;  3I4N B;  1KJ8 A;  1O78 A;  3E5S A;  4UPA A;  5FO8 B;  2V5A A;  1PH5 A;  4DR5 Q;  4MTD A;  3CAM A;  4ABN A;  4HAE A;  5K2M A;  2IHF A;  3GTO H;  3CCR A;  3KLR A;  3TDQ A;  2Z4H A;  4F87 A;  4ZAI A;  2UUB H;  4ECY A;  1H9J A;  1CKO A;  2KED A;  3I3C A;  4EQN A;  5FLM G;  1EFI D;  2NZO A;  5A2Q L;  4HID A;  1ILP A;  3E6Z X;  5ELN A;  2W7P A;  4DUY L;  2JQO A;  3D4D A;  1JQY D;  3PW0 A;  5FPR A;  3K7A H;  3R5X A;  2QA4 A;  2MPM A;  4LF9 L;  4N9P A;  4DR1 L;  3VA7 A;  2UVV A;  1WOC A;  4AH6 A;  4LFB Q;  4HJ5 A;  3CCS A;  2UUC H;  3MFG A;  4IFD J;  3K3P A;  3T56 B;  1TS3 A;  4BY1 G;  3I2Z A;  3OWF A;  4DN4 M;  4A3I B;  2AMC B;  1VQK A;  2PQA A;  5IGF A;  2K50 A;  2SDF A;  3V96 A;  5JEA G;  4B3S Q;  3LWB A;  1GKH A;  2K4K A;  2C2R A;  1GUT A;  1NMG A;  5DGB A;  3S9W A;  3J7Y W;  5H80 A;  3CW2 C;  1XJV A;  3IRB A;  3TME A;  4HNU A;  3L2P A;  4AQY Q;  4WD3 A;  2ZM6 L;  1IYU A;  1SNP A;  3E9H A;  4A3D H;  2YU9 B;  4LF8 L;  1PK8 A;  5LHY 1;  2XN9 C;  4MTK A;  4A76 A;  5FO7 B;  3U9T A;  1CKM A;  1E4F T;  2NZH A;  2G9D A;  4RNM A;  1K0R A;  3LML A;  1I4Q A;  3STB D;  3WO1 A;  1V9P A;  4QWD A;  3RB3 A;  4FP5 D;  4RCO A;  4LF7 L;  1KJQ A;  1X3G A;  1E1T A;  2IHE A;  4A3E G;  1AFP A;  3G6X A;  5D3D A;  3J7A K;  1RJQ A;  1YNJ D;  2HDM A;  1A3U A;  5M3M H;  2H5X A;  2NVT H;  2EY1 A;  1JT8 A;  1WI5 A;  4RB2 C;  1LTI D;  3D31 A;  5JVH 3;  2EYF A;  2Z8L A;  2IY5 B;  4DV3 L;  3D6W A;  1VQC A;  3L7Z C;  1SFO H;  5ELB A;  4YWM A;  1ZHQ A;  4Q0F A;  5M5X B;  4J9K A;  4KKT A;  5KG3 A;  1KNA A;  1PFB A;  1T9H A;  3CCL A;  2WP8 J;  1AN7 A;  5KT6 A;  3T5L A;  1GSH A;  5DG7 A;  1Z2P X;  1VAJ A;  2JA6 H;  2RGR A;  2YU9 A;  1PTO C;  4Z9C B;  4K2L A;  1BNZ A;  4K5V A;  2CVR A;  1K9M C;  3FPP A;  1S4Z A;  1I6H H;  3GP7 A;  3Q8P B;  1X56 A;  1A3V A;  5FJ8 G;  1TS4 A;  1QVC A;  1TWF B;  2W9B B;  4K0K H;  5C4X B;  4M8A A;  1MGS A;  4KY7 A;  3S1N H;  1BGW A;  3K0X A;  4X3U A;  4JV0 A;  3ZYY X;  1O7L A;  3GD7 A;  4DR4 H;  5LA6 F;  5J22 A;  2R7Z G;  1ZEQ X;  2MHV A;  3MR3 A;  2IBK A;  2KEC A;  5IT9 W;  2R84 A;  5KG0 A;  2XCA A;  1PZJ D;  4I65 A;  2W6O A;  3MJF A;  1IBM L;  4RZQ A;  1F2M A;  2OF1 A;  3L9A X;  1SJE D;  4APV A;  3N44 B;  3JAM c;  2R92 H;  3RAQ A;  4B3T H;  3RR5 A;  2JA5 G;  3H3V C;  1HTP A;  3BJY A;  3V6J A;  1PVO A;  1WTP A;  1EZ6 A;  2JN4 A;  3EIV A;  4TRD A;  3T1H H;  1SLJ A;  2ZJQ A;  4C2M H;  2ZXR A;  1JMC A;  2PNH A;  2Z9H A;  2FJ2 A;  4FM9 A;  1GOZ A;  2BE5 D;  1HNX Q;  5JVL A;  3FKI B;  3KK7 A;  3TZU A;  2KJX A;  2B2U A;  5HBR B;  4RUC A;  1WVL A;  1WYD A;  4LF6 H;  4DUZ Q;  2KHJ A;  4OX9 L;  1XMQ H;  2JA8 B;  5C5M A;  3ERS X;  4IOA A;  5LMN H;  2K14 A;  3M4P A;  1TWF A;  4L5R C;  1FNU A;  2W9B A;  3DWP A;  1I4G A;  4UCT A;  1D5Z C;  4IPD A;  3HG9 A;  1S3O A;  1JJ2 A;  1M90 C;  5ELF A;  1HR0 W;  1ICF B;  4X64 Q;  1JWU D;  3H0G B;  1S40 A;  4DR6 Q;  2DIK A;  3RB6 A;  1IW7 C;  4YWL A;  4KJN A;  4A3M H;  1A8V A;  5JAV A;  2V4Q A;  1RCV D;  4GKJ L;  1VQ5 A;  2MCT A;  3C46 A;  1OXX K;  2JK8 A;  2B63 H;  3HOZ G;  2HJW A;  3KAJ A;  4A3K H;  3J81 E;  1GGO A;  3EPG A;  3HXL A;  1TS2 A;  4IFD G;  1VQO A;  1YBY A;  3G8C A;  2K1B A;  4UCS A;  3RGZ A;  1I7N A;  3I72 A;  5KT7 A;  1PH7 A;  3BJU A;  3JRX A;  3VMM A;  2YV5 A;  1S9F A;  4IRK A;  4HTH A;  4RAY A;  2LY7 A;  1I3Q A;  1HZA A;  3Q2O A;  4GOP B;  1CQJ B;  3FKI A;  2N55 A;  4QGU A;  5CV4 A;  2O2L D;  2MO0 A;  4EQP A;  4R4I A;  1C9O A;  1FNV A;  2EXZ A;  2Q8T A;  4N9T A;  5M3F H;  5KFQ A;  4C3H H;  3OHA A;  3G71 A;  3A5U A;  4LH7 A;  2FPG B;  4JI4 H;  2PNR C;  1MHW C;  1QIL A;  1Q1B A;  2W9C B;  2BA1 A;  2F0O A;  2FXQ A;  3DWQ A;  3PVX A;  1BXT A;  1I50 H;  3PUZ A;  1FNW A;  5FO9 B;  3H0G A;  5FD5 A;  4NW2 A;  2CQY A;  3OPO A;  1VQG A;  4DXG A;  3M7N A;  2J6S A;  2HHH L;  1A2T A;  4YHH Q;  1QUQ B;  2R82 A;  3NSW A;  3PF5 A;  3S1Q H;  3T13 A;  1EYZ A;  4QW8 A;  1JOO A;  2F52 A;  1C0A A;  4J9R A;  1JDE A;  4JI7 Q;  4JI3 Q;  2HVQ A;  3PO3 G;  3A7A B;  2MGS A;  3HKZ E;  3TQT A;  4EGJ A;  2O4X A;  2E2I B;  2W71 A;  1E1O A;  1RJT A;  1JIH A;  1VQA A;  4IJH A;  3MHB A;  1LT6 D;  1SE8 A;  2I07 B;  3NTK A;  3X3N A;  5IP9 H;  5EBD A;  4A3B G;  3S24 A;  3PW2 A;  2B3G A;  2FK2 A;  3J7A V;  2OXP A;  4ZYS A;  4CKB A;  5KT2 A;  3DEO A;  1VQP A;  5KT5 A;  1PRT D;  4XT3 B;  4DV4 H;  2XWB B;  1E4G T;  1DYQ A;  1VMC A;  3K5O A;  1EFW A;  4L5S A;  4GOP A;  3I4N G;  5K5P A;  2EY2 A;  4DL4 A;  2MNA A;  3ND8 A;  4IRD A;  1SYE A;  3QG1 A;  1O7I A;  3R8B A;  2HVR A;  2W7O A;  5KG1 A;  3SEB A;  5C3X A;  3A74 A;  3T1Y H;  2XSC A;  1KRS A;  2W9C A;  1K8O A;  3H09 A;  4H7B A;  1IBK H;  3NUC A;  2ATW A;  2W9A A;  4QQB X;  1MSH A;  1A0I A;  4LH6 A;  1TXY A;  2DY8 A;  2NTS A;  4KLK A;  5KFY A;  2UXB Q;  1ESR A;  1ET9 A;  4QIW E;  1QUQ A;  1ASY A;  1U9R A;  3PW7 A;  4DV2 Q;  1ENC A;  3DMU A;  3I90 A;  1O7Z A;  4A3C H;  1WH2 A;  4O2D A;  1XNQ Q;  2BQ3 A;  1X3E A;  3HOX H;  2X0S A;  3A54 A;  3I4M G;  2BR0 A;  1BCP C;  4R1J A;  5LXT F;  4MAM A;  4A3I G;  1EZ8 A;  1T94 A;  3TSS A;  1EUD B;  4LJZ C;  2J6T A;  2SNS A;  3GTK B;  3QFF A;  1EHI A;  3I56 A;  5C3E B;  4HYK A;  4KKS A;  1OWT A;  1ONL A;  2D5D A;  2XIG A;  2D9U A;  2JA7 B;  4HNT A;  1C3O A;  5COY A;  1NNX A;  4IAJ A;  1YZ6 A;  1KDC A;  1UE7 A;  3CPW A;  2F0S A;  2Z0S A;  4J8Q A;  4LUO A;  4Y8V B;  4GKK H;  2X69 A;  2I46 A;  5C5J A;  4U7C A;  3OWE B;  3J80 E;  5KFU A;  2MFI A;  4ED1 A;  1SNM A;  4YCW A;  3GV3 A;  2F0U A;  1KEE A;  2Q8R E;  5CA1 F;  4NP5 A;  5CBA E;  2YTY A;  2F0G A;  1U4M A;  3HOU H;  2PZT A;  3BA9 A;  1HR0 L;  3PUW A;  2ZJT A;  1EYD A;  3OUZ A;  4DR5 H;  3K7A B;  2XGQ A;  1PA6 A;  1I4X A;  2FKL A;  5C44 B;  4GZY C;  2AHO B;  3RN5 A;  2M2L A;  1J5E Q;  2PI2 E;  5ISR A;  3GTK A;  2JSO A;  3ICE A;  2RHQ B;  4DPG A;  3X3M A;  5L1I A;  4QY7 A;  1L0Y B;  2K5H A;  1S5B D;  1SXT A;  2Z4I A;  1HUN A;  2JJQ A;  4UHV A;  3GTM H;  3H6M A;  3OSN A;  4P74 A;  1SNQ A;  1YNN C;  3N52 A;  4ME3 A;  4XYQ A;  4LFB H;  4RU9 A;  3QOL A;  2NUC A;  4JOI A;  3BQ2 A;  3NEL A;  1EY6 A;  3TEH B;  1XX8 A;  4LFC L;  3MAQ A;  4CJ0 B;  3JRW A;  1FKA H;  2HVS A;  5IYB G;  3P75 A;  1M0T A;  1CA5 A;  4A3D B;  4I7Z C;  1N36 Q;  4B3S H;  5C4X G;  1SR3 A;  4ME6 A;  5BPH A;  3MXP A;  4JI5 Q;  4OO1 H;  5KFR A;  4ED3 A;  2O03 A;  1SE2 A;  4BWS C;  2Y0S E;  3LX0 A;  1VQ4 A;  1MJE A;  3H3V I;  5C0X G;  4C5C A;  4AQY H;  3NQT A;  3KHL A;  2R6G A;  5CGK A;  3HB9 A;  2EYH A;  2VB3 X;  1KBL A;  1I94 H;  2R8H A;  4MV9 A;  4PZ7 A;  4B3M L;  2EVB A;  4HMJ A;  3NQI A;  1CQF A;  3EYY A;  2ASJ A;  4X66 L;  2NVT B;  1RK6 A;  4RWS C;  2Z6K A;  5EQ0 A;  4YY3 H;  1RD9 D;  4FXG C;  3C1F A;  2JA9 A;  4A2A A;  1W6J A;  5BMV F;  4DV0 L;  2R7M A;  2F3W A;  1D5X C;  1SFO B;  1EY5 A;  4IHJ F;  3FKI G;  4IFD I;  2VUM A;  4DV5 H;  4GLA C;  3VPD A;  2UXD Q;  3I55 A;  4JBW A;  2F4V Q;  4RHS A;  1H9S B;  3KLW A;  3J7Z C;  2JA6 B;  2XNA C;  1YI2 A;  1SYX B;  4IQZ A;  3MEH A;  4HIM A;  4C5B A;  4YR0 A;  4BXX H;  4IO9 A;  1HUM A;  4KY5 A;  1Y1V A;  4A3J H;  2WTF A;  4DR7 L;  1I6H B;  2F0K A;  3H0G G;  4J9Q A;  1A9X A;  1XWE A;  1YJW A;  1JB3 A;  2LKV A;  3EN2 A;  2QYZ A;  4K14 A;  4RGN A;  2AGO A;  2GN5 A;  2E2H B;  3S1N B;  4FF2 A;  4LFA L;  5KFO A;  1STH A;  5EWF A;  4RGO S;  1EYG A;  1B50 A;  5DQI A;  5GAE C;  3GV8 B;  1L0X B;  3PO2 H;  3FMC A;  4UAI A;  3Q8D A;  1IXR A;  5IYZ F;  4G7O C;  5KFS A;  1BDO A;  3KF6 B;  4DAM A;  1JOR A;  1ZQ7 A;  4NXN L;  1EWH A;  4C5A A;  1TWC H;  4GOP C;  3DM3 A;  2F0P A;  4IOC A;  2NU9 B;  3RZO H;  2AQ4 A;  1EQV A;  2ENB A;  1E3P A;  4X3S A;  3QO2 A;  2NVX H;  2F03 A;  1SFO A;  1ROD A;  4BBR B;  1YJN A;  2KOL A;  3RMH A;  3HOW G;  1I5F A;  1LTG D;  3TRZ A;  4EQO A;  3NK9 A;  1B33 N;  1V1Q A;  3KDF A;  3IN5 A;  1AEX A;  2A19 A;  1N33 L;  3V6H A;  1H9S A;  2BDO A;  3CD6 A;  1EEF D;  1PDQ A;  3CME A;  4QL5 A;  3S2H H;  4JK1 C;  3KJO A;  1YNX A;  2QDL A;  1WD1 A;  3N40 P;  4Y7N B;  1GJX A;  3MZ5 A;  4NB3 A;  4MTN A;  2EZV A;  2J6U A;  4PMC A;  1AE2 A;  2E2H A;  2NZ1 D;  3CQZ B;  1ICW A;  3VPB A;  1OXV A;  3CC4 A;  4LF4 L;  2FFK B;  1HNX H;  4G7Z C;  4EBE A;  1XMO L;  1KLU D;  1EQR A;  3M9N B;  1BKB A;  2RVL A;  4B3R L;  3KF6 A;  3BVM A;  1A15 A;  4A3M B;  4RB0 A;  1IBL L;  4DUZ H;  1N32 Q;  2W6Z A;  4PZ8 A;  4FBU A;  4LF9 Q;  3OOC A;  2CH4 W;  4MA0 A;  1LTS D;  5KFT A;  1HNZ H;  2OQ0 A;  3S15 H;  2WAQ B;  1G29 1;  1N34 L;  4X64 H;  5G3L D;  4DR6 H;  4IWY A;  3VDY A;  4JYA L;  2RDJ A;  2KUM A;  2ASL A;  5JH7 F;  1JOK A;  2HUG A;  2B2Y C;  4WRD A;  2K7V A;  1D7Q A;  3C1E A;  2IL8 A;  4O2B F;  4DNI A;  1EY9 A;  4JI1 H;  4M7E A;  2EJG C;  3QR8 A;  3ORR A;  1LAB A;  5LMU H;  2K05 A;  3J80 W;  3KXY T;  4ODG A;  2IJ0 A;  3RUZ A;  2I87 A;  4QW9 A;  3DEP A;  2EY5 A;  4C3H B;  1S5F D;  5IE8 A;  1Q86 C;  2ZM6 Q;  4WJ3 M;  2NYZ D;  1VQB A;  4JBM A;  3MXN B;  1HZC A;  3GV6 A;  3GTQ H;  3CQZ A;  4FU0 A;  4R4O A;  2UUC L;  4JI2 Q;  4DAY B;  5IP7 G;  2ZJR A;  1IL2 A;  5D14 A;  2D62 A;  4B08 A;  1PH2 A;  5JJL A;  1QNU A;  1MZB A;  1SAP A;  4M1U B;  1SE4 A;  4EYH B;  1EL0 A;  1SRU A;  4CHT B;  4BBS G;  2I5H A;  2A6H D;  5C3E G;  1Q12 A;  4JOI C;  1FVI A;  4ZQ3 A;  1EWC A;  4F88 A;  3J81 L;  4MIU A;  2Q2I A;  1BQQ T;  3ERQ A;  4JW0 A;  4YHH H;  3A5Z B;  3V6K A;  4YR3 A;  1EOV A;  3CRK C;  3DM1 A;  3WOE A;  1PH6 A;  3FDS A;  2B39 A;  5CV5 A;  4J9O A;  5J1Z A;  5EPJ A;  1V1O A;  4JI3 H;  3OTO H;  2E75 C;  4DV3 Q;  2IA6 A;  3I91 A;  1KTK A;  1QWY A;  4AYB A;  4A3F B;  1FR3 A;  4CDF C;  5EGT A;  4LK1 C;  1RTN A;  3H4B A;  5BN5 A;  4O4I F;  3SK5 A;  2RSO A;  1KC8 C;  1EOT A;  2VW9 A;  2R93 B;  1K1Q A;  3LNN A;  2CW0 D;  1I4P A;  2GA4 B;  2PO4 A;  2DPI A;  2WV6 D;  4BS9 A;  4CC5 A;  4GC6 A;  3MXN A;  1EUC B;  2AQ2 B;  2PMZ E;  1TR5 A;  1U4R A;  4GN4 B;  4A3G H;  4JI0 Q;  4DAY A;  1DM0 B;  4XT1 B;  4J9L A;  1E2W A;  4IZ8 A;  4R9W A;  4GC7 A;  1J9O A;  4L6T B;  4IUU A;  2JEI A;  4I7H A;  2MUY A;  1XNR H;  2C5C A;  1TQO A;  3K8A A;  5C44 G;  2YZG A;  1CHQ D;  1ENF A;  4FF3 A;  4A3L G;  3HOX B;  3NBI A;  3AFQ A;  3CP0 A;  4EGV A;  4QUC A;  3R2I A;  2L1B A;  1SYD A;  4C3I H;  5T14 A;  3KBX A;  2IPK D;  4C1N I;  5C0X I;  3I12 A;  4X3K A;  5ELO A;  5HGQ A;  3SVM A;  2VQD A;  2A6E D;  4KHP Q;  3R3O A;  1XNQ H;  2DLN A;  1GUO A;  4TV9 F;  4Q8E A;  3PV0 A;  1IL8 A;  2WB1 A;  5KFB A;  3AEV A;  4ECQ A;  3Q1K A;  5KFD A;  2A74 C;  2VUM G;  1FGU A;  2BA0 A;  3BZK A;  2BH8 A;  2RDI A;  2WKD A;  1SMY D;  2W70 A;  2R93 A;  4MZ9 A;  4K0K L;  3V4S A;  3GTG H;  1Y1V G;  4IUN A;  1TWA H;  4S3S A;  2C9O A;  1BOS A;  1E4E B;  4IZO A;  1WSC A;  1XDN A;  3OHX C;  1ZKO A;  4DR4 L;  1ML0 D;  2PCF B;  2RSN A;  3MXU A;  2YRW A;  1Q90 A;  3M85 A;  4Y52 H;  2R61 A;  3JSL A;  1BUV T;  4Q44 A;  2AGQ A;  4GS3 A;  5IGE A;  3D6C A;  4NXM Q;  1F9R A;  1U4P A;  1PRT B;  4K5W A;  3L3O C;  4HIK A;  3BYT B;  5KX5 F;  4HQ6 A;  2KVM A;  4B3T L;  1K8M A;  2HCC A;  2CHB D;  3GTJ H;  2R8I A;  2WDT A;  4IPG A;  3T1H L;  5AJ3 Q;  4O3N A;  3NTI A;  3TP8 A;  1KDB A;  3CHB D;  1HRJ A;  3TS2 A;  4LUZ A;  3GTP B;  1GSO A;  2IX3 A;  3GTM B;  5D65 A;  3K81 C;  4JVZ A;  4O3P A;  3KF8 B;  1WCM H;  1HHV A;  5DLF A;  4LF6 L;  4QUF A;  1XMQ L;  3J81 j;  1J5E H;  3N41 B;  5LMN L;  3TP6 A;  5I6Y A;  1X65 A;  3CRL C;  1PTO F;  1XPR A;  2K52 A;  4DGZ A;  1S5D D;  1E7Z A;  1E4E A;  3N6X A;  1NR4 A;  2B2W C;  1CHP D;  2D2C C;  3UI2 A;  2FK3 A;  5D1O B;  1KJI A;  2E5L Q;  1P16 A;  1BCP B;  1Y1W H;  3OUU A;  3F2D A;  1EYA A;  2AGP A;  1DZ1 A;  3W5O A;  4F50 A;  1XYI A;  3UDX A;  4LMQ D;  4UCO A;  4IR1 A;  3LP8 A;  4RA8 A;  2I5M X;  4JI5 H;  4NPS A;  5IYC H;  3K5N A;  4HCE A;  2QIL A;  2DUD A;  2EOT A;  2VPQ A;  3STB C;  3GTP A;  2QF7 A;  4BBR G;  3P20 A;  4A2B A;  5LP6 F;  3K0Y A;  2OQK A;  1QZH A;  4R8I A;  1KAW A;  1DOL A;  1PH8 A;  1VKZ A;  4P71 A;  1JJG A;  1G6Z A;  3S1R B;  5L1L A;  1YNJ C;  3U9S A;  4ZUI A;  4JI4 L;  1BNC A;  3VYR A;  3RB4 A;  4DK1 A;  3E0E A;  2RCN A;  2NVQ H;  4X62 H;  2A5H A;  4DR3 Q;  3CXC A;  2A69 D;  5BR8 L;  4TQS A;  5D1O A;  4NLG A;  1CI3 M;  4TQR A;  5M5Y B;  2BCO A;  4KY6 A;  3ER0 A;  2HIX A;  1FJG H;  1SJH D;  3E9I A;  1TWG H;  4A3J B;  3MR2 A;  2F0E A;  1CZG A;  4CDC C;  4DV1 Q;  4GNX C;  3CC7 A;  1JB7 A;  3RLN A;  3RAX A;  4PMW A;  1WTR A;  2ES2 A;  3M4O H;  2F4V H;  2L0C A;  2E2J H;  5KG6 A;  4OIK A;  1RIP A;  5CV7 A;  1D2B A;  4XQQ A;  5KT3 A;  1UEA B;  2PMZ B;  4WOR A;  4UCU A;  3PO2 B;  2VA2 A;  3CCQ A;  2VUG A;  5FOB B;  5JUM A;  1ET6 A;  2MP1 A;  5ELC A;  5LL6 S;  1PH1 A;  5FLM H;  3P7J A;  2UUA Q;  3H40 A;  5HGT A;  4LF5 Q;  1XXG A;  1TWC B;  4DV4 L;  3M7G A;  2VS1 A;  3RZO B;  4I7A A;  1DD2 A;  2DNC A;  2L15 A;  2L4N A;  3TS0 A;  5JQW A;  2YS6 A;  4RKB A;  2NUA B;  4FXK C;  4ZI7 F;  4KI0 A;  4X65 Q;  4AYB G;  2CKZ B;  3T1Y L;  2YZM A;  2C2E A;  3S1M H;  2DZD A;  1IBK L;  3H20 A;  1GXD C;  5FLX L;  2F0W A;  2RF4 A;  3G6Y A;  2CCZ A;  5JEA H;  4Q0Y A;  3RLF A;  1C8C A;  2FPI B;  3CU7 A;  2IT1 A;  4RB3 C;  2M05 A;  3S17 H;  2RBM A;  4JPB W;  4ECS A;  2K5W A;  2NU6 B;  3DLL A;  4WJ4 A;  4UFZ A;  4J9N A;  1ESF A;  4TV8 F;  2BE5 C;  5EAY A;  1BO0 A;  3AB9 A;  1WTV A;  1QOH A;  3UDF A;  3RFC A;  4P2C B;  3PSI A;  1VBG A;  4FS1 A;  2QEX A;  2IX1 A;  1DV2 A;  3HOV B;  2K03 A;  5IIF A;  5EZY F;  4JI8 L;  3Q24 A;  1T5E A;  1GO3 E;  3V4Z A;  4NKL A;  4B9X A;  5J39 A;  3U4Z A;  1TWC A;  4RGT A;  1JDB B;  1PH3 A;  4XXE A;  3S15 B;  1QB5 D;  1HNW Q;  3NHH A;  1KHI A;  3IAY A;  3L4K A;  4GKK L;  3JAM W;  2WB1 G;  4KK7 A;  4KKU A;  4A3F G;  2VXW A;  4A3E H;  1W2B A;  4F4Y A;  4JI6 H;  1N32 H;  1LTA D;  3BAA A;  5L9X A;  1WR2 A;  4RCN A;  1SCU B;  2ALY B;  3VYU A;  2R93 G;  1KXL A;  1AUV A;  2E2D C;  1EWI A;  3PR4 A;  1Q82 C;  1G2S A;  2F0F A;  4IWX A;  1XPO A;  4K6L A;  5LL6 b;  3S16 H;  3WO0 A;  1S0N A;  2NVY B;  1NSN S;  1HPC A;  4RGM A;  4ZK9 B;  1D6E C;  3GTQ B;  1EQT A;  5CR3 A;  4DR5 L;  2DY7 A;  3Q8S B;  2KBN A;  3FRP B;  4DR2 H;  1UNS A;  1X3P A;  4R8U B;  5KFI A;  1PZK D;  3IG0 A;  4G3I A;  1JX4 A;  2ZTE A;  2JYO A;  5EPK A;  1N9W A;  3CCE A;  3M9O B;  3R2T A;  4CKE A;  4V19 0;  5EKL A;  5BN4 A;  1HQR D;  1BCP F;  5FJ8 H;  2OCE A;  2F0T A;  4RG1 A;  3JAM i;  2R7L A;  1X3F A;  4B3M Q;  3KOJ A;  1MI2 A;  4P73 A;  4PZ6 A;  4YAK B;  4YIJ A;  4LFB L;  5C0X J;  2UU9 Q;  4F4X A;  3BDO A;  4JI2 H;  5KFV A;  1WTO A;  3EPI A;  2K5D A;  4K2K A;  1QG7 A;  4HJ9 A;  2BDN A;  5IOD A;  1SYC A;  1S5C D;  3EFX D;  4DV6 H;  1G91 A;  1EIH A;  3EJI A;  5KIX A;  1S97 A;  1PYB A;  4DV0 Q;  4HED A;  2R3Z A;  3HFZ B;  5KT4 A;  5IWA Q;  2AWO A;  2OLS A;  5M5W H;  1T36 A;  4BY7 G;  2UVW A;  3GV5 B;  4F4W A;  2JA5 H;  2J9G A;  4UCV A;  4JV1 A;  2X6G A;  3TIG A;  1PRT C;  4LW1 A;  2E76 C;  2F0I A;  2NVY A;  4AQY L;  3UDG A;  1SDF A;  1I94 L;  1JCK B;  2KCN A;  3NXW A;  3PUV A;  1RTO A;  4A3G B;  4MV7 A;  4HNV A;  1UNN C;  2B8G A;  2F0V A;  4AIM A;  1NE3 A;  2YCH A;  3RUP A;  2UXC H;  4BWG B;  2B8F A;  2EYJ A;  3HEJ A;  5CV6 A;  1C30 A;  4YBZ B;  2OEO A;  2YL2 A;  3G6J B;  4YY3 L;  3KLS X;  5CMD A;  2AUJ D;  2JXM B;  1YJ9 A;  3V05 A;  5GQO A;  4C3J B;  2J4X A;  3NWS A;  4DV7 Q;  4JI0 H;  3M4Q A;  4C3I B;  4XYO A;  3Q23 A;  3CCU A;  1PFN A;  4JG2 A;  3KHG A;  4DV5 L;  2HIV A;  4LSX A;  2PQE A;  1ULZ A;  1O7Y A;  3MFY A;  4U67 3;  3HOZ H;  1A6X A;  2VQF Q;  2V1C C;  2E2I A;  5IT9 L;  2F0J A;  3GTL B;  1STN A;  1K3R A;  5NUC A;  1MJC A;  2HQL A;  1STY A;  2NN6 G;  3N42 B;  1PFM A;  4O3S A;  4KHP H;  1J6Q A;  2K75 A;  1AUX A;  4DLK A;  3GTG B;  3S14 H;  1FL0 A;  5KND A;  2ZXP A;  1TWA B;  2N78 A;  4ZLT F;  1CT1 D;  2F0H A;  5DNF A;  2YS7 A;  1NMF A;  4R7R A;  4J9P A;  3KHR A;  4BA1 I;  3QOJ A;  3GLK A;  2ZXO A;  4L8J A;  4PDB A;  2RGV A;  2ZT9 C;  1B04 A;  2W57 A;  1DOM A;  4DNR B;  4YR2 A;  4ID6 A;  5I2X A;  3CCV A;  2EYM A;  1GHJ A;  3QIA A;  3U9O A;  3U50 C;  1EZ1 A;  1KJJ A;  1F9S A;  4LF4 Q;  3BZC A;  1D1K A;  1NUC A;  2KCM A;  2B2Y A;  2PW5 A;  2FMM A;  3RLO A;  4XQJ A;  4EQ5 A;  1VQ9 A;  4B3R Q;  1FD7 D;  1LT5 D;  1IBL Q;  3GTO B;  1LT3 D;  3GQC A;  1KAB A;  3GTJ B;  1B1Z A;  1QJO A;  2WFW A;  3RIZ A;  3PUX A;  1WTW A;  3MR5 A;  3W3A A;  2SOB A;  4ECW A;  3I70 A;  3I8Z A;  1N34 Q;  4NXM H;  1TKW B;  2L55 A;  3PO3 H;  2FLL A;  4JYA Q;  2W6P A;  4RFB A;  1V1P B;  2V58 A;  4U68 A;  1DGS A;  3GTL A;  1WCM B;  1A2U A;  4K8I A;  3KAL A;  3FPU B;  5E7N A;  3RN2 A;  1AZP A;  1JC7 A;  3CPF A;  5A35 A;  2ZJP A;  3SDZ A;  2JA7 A;  1DCZ A;  3UE0 A;  1OXS C;  1LAC A;  1TT2 A;  5KFM A;  4NMZ A;  3OYY A;  3GTG A;  3TP7 A;  4A3J G;  3T5H A;  1HNX L;  3I4N H;  1VQ6 A;  1I6V C;  4EFE A;  4TKO B;  4ECZ A;  3BU2 A;  2XVS A;  5KFP A;  5KNB A;  3Q8Q B;  2ZTC A;  4DUZ L;  3QZ8 A;  2YYZ A;  5HV6 A;  1UC9 A;  2UUC Q;  1HNZ L;  3C2P A;  4IUQ A;  3MR6 A;  4X64 L;  4DR6 L;  4MV4 A;  3GTO A;  1L1O B;  4LUV A;  4AYB E;  4RMF A;  4J0M A;  3GTJ A;  1CTM A;  4QCL A;  4DL7 A;  4RKL A;  5FKA C;  4PG3 A;  2MQH A;  3UFX B;  2E5L H;  3RD4 A;  1TA8 A;  3FMA A;  3PUY A;  4JI1 L;  4ILW A;  5HY6 A;  1R9T H;  3J81 c;  5LMU L;  2VQE Q;  4DAV A;  4DXF A;  3K57 A;  1V1P A;  1DON A;  3I4M H;  2Z1C A;  1Y8O B;  4ZKC B;  2PZW A;  4A3I H;  3BG3 A;  3T5K A;  1IYV A;  4UCR A;  5T1G A;  5M3M B;  1VQL A;  1W3S A;  4A4I A;  3SK4 A;  2LFN A;  5CBE E;  5IYD G;  1TWH H;  1BBU A;  2KHS A;  3K3V A;  2HDL A;  4O2A F;  2OT2 A;  3HKZ B;  2RCF A;  2R6F A;  1JIC A;  1V43 A;  1ZHS A;  1TWG B;  4J9M A;  3HOV G;  1PMR A;  1PX2 A;  2OTJ A;  1II3 A;  3WOF A;  1CA6 A;  4DR3 H;  2JA8 G;  2E2J B;  3PGZ A;  1Q1E A;  1AH9 A;  1TY0 A;  5DM7 3;  4EBD A;  4YHH L;  2EPB A;  1HFN A;  2B29 A;  2I0Q A;  4ZUJ A;  5K36 G;  1X54 A;  1AN8 A;  3ND9 A;  2R87 A;  4RHR A;  4DV1 H;  3SI8 A;  4JI3 L;  3OTO L;  2WE6 A;  1L0W A;  1B6S A;  5TSS A;  4CDE C;  1VQH A;  5E3F A;  3TRE A;  2PPB C;  1W96 A;  4HN7 A;  1H9M A;  2K6A A;  4R4T A;  2PW7 A;  1STG A;  2FK1 A;  2XGT A;  3A8I E;  4UP7 A;  5FK9 C;  3W1B A;  1M1K C;  4FF1 A;  4RNN A;  3DUZ A;  4K5X A;  5EKI A;  4QIW B;  3SE0 A;  4EVO A;  5KFG A;  2UUA H;  4LF5 H;  3S1M B;  2LS0 1;  2YTX A;  3T16 A;  4JV5 Q;  3FEW X;  4XQN A;  3HKZ A;  2R92 B;  1SN8 A;  1GUG A;  2G5D A;  4K0K Q;  3M9B A;  4X65 H;  5EWG A;  4C1N K;  1BF4 A;  2D0O A;  2FJZ A;  1XNR L;  1Q46 A;  1SND A;  1VF5 C;  1SYG A;  3OW2 A;  5KFZ A;  4J1M A;  2D0P A;  1EEI D;  4C2M B;  4R8N A;  3UE1 A;  1EQQ A;  1KD1 C;  4DR4 Q;  4O3Q A;  1IOW A;  2K5N A;  5IYB H;  2JA6 A;  4CGY B;  1TWF H;  1CQV A;  5KG5 A;  1CE8 A;  1XNQ L;  5CYU A;  2HCI A;  4CDD C;  1QNK A;  3KJP A;  4N8X 1;  4OWT B;  4M9U A;  4PMB A;  2ID0 A;  3MWM A;  5IGC A;  2PYK A;  3NWT A;  4ECX A;  1U4L A;  4DUY Q;  2B2W A;  1PH4 A;  2GPS A;  4A3E B;  5I9P A;  2GLT A;  4QIW A;  3I7F A;  1VQN A;  1JOQ A;  1RJP A;  5DQH A;  4JBJ A;  4DR1 Q;  3RBE A;  1HA5 A;  3SK8 A;  2B63 B;  5COR A;  2F0N A;  4A3K B;  1XMQ Q;  1HNW H;  4GNX B;  2VL6 A;  2R92 A;  4O42 A;  3BDC A;  5EDW A;  1Q3L A;  1SSO A;  4HCS A;  1I3Q H;  4JC0 A;  2AU0 A;  3RJ0 A;  3GID A;  3M3Y H;  3S16 B;  4J6H A;  4GLX A;  1Y69 U;  4A3G G;  4PQX A;  4EEY A;  1IHZ A;  3FKI H;  1UEB A;  4C2M A;  4KD3 A;  2V59 A;  1Q81 C;  4XZ3 B;  5GAH C;  2NN6 I;  2UUB L;  3HBL A;  2FMC A;  1SYB A;  5J3B A;  1NCV A;  3G6E A;  5D3I B;  5M3F B;  1AZQ A;  1V51 A;  4C3J G;  2EXD A;  5A2Q W;  1IKM A;  5I9O A;  3K6O A;  3BQ1 A;  3EQL C;  1RYS A;  2B2T C;  3CKI B;  4LF8 Q;  3A8K E;  2N3S A;  1YVC A;  3L0O A;  1I50 B;  2O5I C;  1UWV A;  3VR4 A;  1J5E L;  4QF4 A;  3WDN A;  3S1Q B;  1KJ9 A;  3A7L A;  3T4A C;  3BDL A;  1STE A;  2A6H C;  2JEJ A;  2EQS A;  3PMF A;  4IRC A;  2B63 A;  3OIQ A;  1C4Q A;  2A8V A;  2QKI C;  4DK3 C;  4LF7 Q;  2WAQ A;  5KG2 A;  2Y0S B;  4YP3 A;  4GNX A;  3F2B A;  2UU9 H;  2JA7 G;  4JI4 Q;  4LAA A;  2MJ8 A;  2BQU A;  5M5W B;  1G2T A;  5DGA A;  5C4J H;  2NU8 B;  2R7K A;  2E74 C;  4P75 A;  1UE5 A;  3HOW H;  1LUZ A;  2WKC A;  4KHV A;  2PI2 A;  3HRZ C;  5BR8 Q;  1HA6 A;  2W8L A;  4JI7 H;  3D4R A;  2MO1 A;  4A93 H;  3SGI A;  5IWA H;  4JBK A;  4V0B A;  2CW0 C;  4JI5 L;  5DLG A;  1TII D;  5JPM C;  1IYJ B;  1CUK A;  4K6D A;  3VYT A;  1SMX A;  4L5T A;  1I50 A;  1RL2 A;  5KFH A;  2KCT A;  2GPW A;  3MEF A;  1CZW A;  1VQI A;  2B2V A;  5CV9 A;  2A68 D;  4XDX A;  1FYC A;  1D8L A;  1QVG A;  1JXL A;  4ED8 A;  1R4P B;  4Q8F A;  3Q0A A;  4X62 L;  2DGY A;  1YEZ A;  2IP4 A;  5F9L A;  3EVQ A;  2Y0S A;  1HH2 P;  4FVM A;  5GAG C;  4YCU A;  4DV7 H;  4ZHQ F;  2UXB H;  3T1Y Q;  1FJG L;  1K28 A;  3RB0 A;  4DAP A;  2A6E C;  5KKN B;  1IBK Q;  1IBM Q;  1EYC A;  4DV2 H;  3H4D A;  1YIJ A;  2FP4 B;  4KJO A;  2BH2 A;  1VQF A;  1L1O C;  5FLX c;  2F4V L;  3S14 B;  3HP3 A;  3JAM E;  1PHJ A;  1A62 A;  1M4V A;  2VQF H;  3AYH B;  3IFD A;  1SMY C;  2K28 A;  3OSO A;  4RAU C;  1QVF A;  5EPL A;  4CC6 A;  1XTD A;  4RUA A;  3G4S A;  1WFQ A;  1Z2O X;  4A3D G;  2IMW P;  3BZD B;  3RTX A;  4ZQI A;  2EIF A;  3JZI A;  1VQD A;  4JI8 Q;  1YIT A;  2VB2 X;  5IYC G;  3RBD A;  4OX9 Q;  4KHZ A;  3ZJY C;  5IP7 H;  4HR7 B;  3HOU B;  3FVQ A;  3M9M B;  3AFP A;  3BVZ A;  1VQE A;  2R8K A;  1CM9 A;  3HKS A;  1KRT A;  4KTA A;  4YAJ B;  3SK6 A;  2GVB A;  4LF4 H;  4BBS H;  1AP0 A;  1MD2 D;  4HSP A;  3PO3 B;  4GKK Q;  1VQ7 A;  4WJW A;  3GTK H;  5C3E H;  4B3R H;  5JJZ A;  1ASZ A;  2FMA A;  5M3M G;  4QJF A;  3WNZ A;  4GKJ Q;  4RB1 A;  4MN3 A;  4YJ3 F;  1ZYR D;  5ELD A;  1RK5 A;  1HTL D;  3HKZ G;  2JEA I;  1CFM A;  3PIO 3;  3KUP A;  1GSA A;  4ALP A;  2EYP A;  4APM A;  3NTH A;  5DM6 3;  2ALZ A;  2I8C A;  2BOS A;  2ASB A;  3W2D A;  2R85 A;  4IPH A;  1ILQ A;  4RAZ A;  3I4O A;  2JA6 G;  4FO2 A;  2KEE A;  1BBX C;  3J80 L;  2UVR A;  1F77 A;  1HQM C;  5KFW A;  2RHS B;  1Q8I A;  2XTI A;  3BS1 A;  2W8K A;  3GIJ A;  1E2V A;  3HOY H;  1BXR A;  4IUT A;  4HR7 A;  1N32 L;  2I80 A;  4JI6 L;  4ME5 A;  5JJI A;  5T1I A;  5C44 H;  1R9T B;  1Y14 B;  1WTQ A;  1F9P A;  2HHH Q;  4A3L H;  1H95 A;  2XWJ B;  3GIM A;  2QEJ C;  3W1G A;  4F8M A;  3I4M B;  1N36 H;  1SE3 A;  4O1N A;  1NR2 A;  3C3L A;  4L1K A;  4MV1 A;  5ELE A;  3VA5 A;  1K0S A;  1MSG A;  1UAP A;  4TVA B;  5DG8 A;  3M4Y A;  3PQI A;  2R92 G;  3VR6 A;  3F2U A;  4DR2 L;  4ED0 A;  3GTM A;  1LT4 D;  5KFA A;  2N49 A;  3E3X A;  2VQE H;  3NE5 B;  3R93 A;  1TWH B;  3KF8 A;  1OXT A;  4IR9 A;  1N8R C;  2VUM H;  3RV4 A;  1RDP D;  4KD4 A;  1I94 Q;  3MFI A;  3TII A;  2A69 C;  3ERO A;  4B9W A;  1Y1V H;  2FHT A;  4JI2 L;  3HGB A;  4XX0 B;  3TN2 A;  4XYL B;  3JC6 6;  5E4X A;  4H44 C;  4CKC A;  4YY3 Q;  3NEM A;  4DV6 L;  1V8Q A;  4QWC A;  1HZB A;  1R9T A;  1LTR D;  2UXD H;  4A3M G;  1STB A;  3ULP A;  4PWQ A;  3KBG A;  3MXG A;  2V4R A;  3K5M A;  3CMA A;  4OON A;  2K5V A;  3Q6S A;  4DV5 Q;  1VF7 A;  2B63 G;  5C8Y F;  5KFE A;  2WAQ G;  5JOB A;  5M9O A;  3TQY A;  4A3K G;  4I55 F;  1B2T A;  2JEF A;  5IT9 c;  2RDH A;  2CFM A;  1J8I A;  3UQ8 A;  2RA4 A;  1TWH A;  4A75 A;  4EBC A;  4X6A H;  4LSA A;  3OHB A;  3PZP A;  2R86 A;  5CA0 F;  2UXC L;  2AKW B;  2NVX B;  1E22 A;  2XGP A;  1JWS D;  3RNU A;  1F2L A;  4TSS A;  1OTC A;  3CCM A;  4BY1 H;  3D8G A;  3F2C A;  1K73 C;  2X6L A;  2B2V C;  2L5T A;  3ORQ A;  3PIP 3;  1DJR D;  5M3F G;  2EYL A;  1Z47 A;  4C3H G;  2C00 A;  4JI0 L;  1PTO D;  1QCB D;  5LOV F;  1WTH A;  3R5F A;  4JV5 H;  1EY8 A;  4HJ8 A;  2R7N A;  2PN1 A;  1SNO A;  3S2H B;  2EJM A;  4HJ7 A;  2E2H H;  3ULJ A;  3LWU A;  2YZN A;  1W93 A;  3BAB A;  1JR0 D;  1TVX A;  1KL9 A;  1QE6 A;  3FHW A;  1EUJ A;  2K04 A;  1T5X D;  4ZRZ A;  1C48 A;  2FLN A;  2PMZ A;  3DHQ A;  4MV3 A;  3E0J A;  1HR0 Q;  1N56 A;  2AWN A;  2Y0S G;  3U58 A;  3QZ7 A;  4FDB A;  4IUP A;  4KHP L;  5KYL A;  1CQI B;  1W6K A;  4BBR H;  1U5K A;  4P72 A;  1PRT F;  4GLV B;  5IP9 G;  5CV8 A;  1CK1 A;  1PLF A;  2TMP A;  3VR2 A;  3A0J A;  5EWE A;  2NVX A;  1BR9 A;  2HGS A;  3B6Y A;  1I3Q B;  3N8D A;  4DUY H;  1RF2 D;  5C6A A;  4K8J A;  3M3Y B;  4LF9 H;  3G7L A;  1KDA A;  1RKN A;  2OWO A;  1LYL A;  4LNQ A;  5L1K A;  4DR1 H;  2N8N A;  3QJY A;  1PFS A;  4Y7N H;  1JJC B;  1S03 G;  4LFC Q;  4H0L C;  1E2Z A;  4DL5 A;  1SNC A;  2H4O A;  2Q2U A;  1HNZ Q;  3CQZ H;  4Q5V A;  1NBW A;  1CKN B;  4NXM L;  2KSW A;  4MHE A;  3DXJ C;  2HQE A;  1WD0 A;  3WWV A;  4R4C A;  5EJW A;  4OWW B;  3S2D H;  4A3C G;  1IW7 D;  3EA6 A;  1H9R A;  3MWY W;  1MBY A;  4JI1 Q;  5AJ3 L;  3D3R A;  3HOX G;  4IUR A;  5DAU A;  1JE5 A;  5LMU Q;  4KMU C;  5H1S E;  2ZM6 H;  5CC4 A;  1VBH A;  5DQG A;  1TU2 B;  1PV4 A;  4LF8 H;  1S68 A;  1GVP A;  1T3N A;  2F0Q A;  2ZDQ A;  1I4R A;  3D4W A;  4IPC A;  1PTO H;  1Z2N X;  2KHI A;  1I6U A;  1CSP A;  5KYI A;  1UE6 A;  5J2U F;  3KYH C;  4X66 Q;  4JUZ A;  2PZU A;  5C4J B;  2R7Z H;  3HOW B;  5FD6 A;  5J2T F;  3F8T A;  4WFN 3;  2P5Z X;  2LSS A;  2EJF C;  4G57 A;  4LF7 H;  3MC0 B;  4B3S L;  4EFB A;  5GON F;  1DXM A;  1LLR D;  4A93 B;  2E5L L;  5EBC A;  3TBI B;  3DF7 A;  3MWE A;  4MV8 A;  4ZOL F;  2EDG A;  1GLV A;  1CKN A;  2F1M A;  5BR8 H;  1IOV A;  1TY2 A;  2W6N A;  2WYO A;  3HOU G;  4IN3 A;  2QDB A;  4DV3 H;  3GTQ A;  2RQX A;  4R8U A;  4DFA A;  2IX0 A;  5D1P A;  2KA7 A;  4DR7 Q;  2C22 A;  3IFT A;  3MWD A;  1GUS A;  3TQ1 A;  3H3V H;  1E24 A;  2GVA A;  3OTO Q;  1Y8P B;  4BA2 I;  1M6V A;  2WIN B;  3AU7 A;  4LFA Q;  4O4L F;  2CQA A;  5DEH A;  3K58 A;  2VPS A;  1OO9 B;  2SEB D;  3G48 A;  1O80 A;  1RHP A;  2RDF A;  4DU9 A;  4NXN Q;  3A8J E;  1SYF A;  3OW7 A;  5F9N A;  5KFC A;  4QWB A;  3PW5 A;  4J9S A;  3P1H A;  3K7U C;  4A3F H;  2F3I A;  1K83 H;  1Q7Y C;  2Q2T A;  3EBE A;  4GN5 A;  1B9M A;  1YHB A;  1NY4 A;  4N8F A;  4ULL A;  3TZD A;  4DR3 L;  3KHH A;  3IL8 A;  4WBN F;  4JV2 A;  4UY8 C;  1WJJ A;  2R93 H;  4QWE A;  1PYS B;  1G6P A;  4IFD H;  2HD3 A;  1XNR Q;  5CB4 F;  3NGD A;  3OIP A;  2J7Z A;  5EOY A;  3HS0 C;  1VDZ A;  4KN4 C;  4UDU C;  4DV1 L;  1IBM H;  3MTS A;  3IKJ A;  3RZD H;  1S0O A;  3NPP A;  1N33 Q;  3F1Z A;  3A55 A;  3VPC A;  2LXJ A;  4U6P A;  2UVU A;  1LO5 D;  1B3Q A;  2V9W A;  1FGB D;  4FF4 A;  3GQB A;  4OO1 G;  5HUR A;  2QGQ A;  2BQR A;  2JE6 I;  5EKK A;  3Q8R B;  2SCU B;  3RGX A;  2N88 A;  1G8Z D;  5IY0 A;  5L37 A;  2UUA L;  4Q45 A;  2DJF C;  4LF5 L;  1KAA A;  2F0M A;  4LWC A;  5DLQ E;  1JLL B;  1O75 A;  2CWP A;  3VYS A;  2JP1 A;  1XMO Q;  2Z6B A;  4FXD A;  4BBS B;  1BCP D;  4JI8 H;  5A2Q E;  4C56 C;  1KC7 A;  4OX9 H;  1AW7 A;  4OHJ A;  4X65 L;  3GV7 B;  2EY6 A;  1UE1 A;  3SXH A;  4OEL B;  2L11 A;  1Q8K A;  1Y8N B;  1KQS A;  4JCV E;  1V4Y A;  2C2D A;  1S10 A;  3N43 B;  1EY0 A;  3I73 A;  4I50 F;  1LV9 A;  2JEG A;  1PYW D;  1F2Z A;  5KFN A;  3JAM L;  3CVZ A;  1HJP A;  3GIQ A;  1A3T A;  2AQ1 B;  2B2T A;  3H91 A;  1B8A A;  4GKJ H;  1I7L A;  4BY7 H;  1BVS A;  1D5M C;  2IWH A;  2G9H D;  2RDG A;  4A3B H;  2DJG C;  3URY A;  4O0A A;  1HCZ A;  2UUB Q;  4BXX G;  4PNY A;  1TWA A;  3TIN A;  3NP8 A;  3PW4 A;  2C28 A;  2XRS D;  1SRO A;  2C35 B;  3ULL A;  2WAQ E;  3GIK A;  3HOY B;  4MV6 A;  1JE4 A;  1KIX A;  2K33 A;  4ED7 A;  1B4O A;  5C3W A;  2F4I A;  2KEN A;  4TQU S;  5KEE A;  1Y1W B;  3PO2 G;  4QWA A;  2CW7 A;  2IW3 A;  1LM0 A;  2VR1 A;  1HNW L;  1ENA A;  2ZTD A;  4DNT B;  2M9V A;  1RJR A;  4XIG S;  1X3Q A;  5C5L A;  3R23 A;  3GTP H;  1X32 A;  3NEN A;  3OSP A;  4X3T A;  2P0A A;  2B2U C;  4QMG A;  2K5Q A;  3ITP A;  1PXU A;  2Q8I B;  3AQQ A;  1YNN D;  4NDX A;  3HZX A;  1X9N A;  2HHH H;  1HFG A;  4EYI B;  1WCM A;  5KGU A;  1B70 B;  4HMI A;  2VUM B;  2ZDH A;  2WII B;  3KFU A;  4EX5 A;  4O3O A;  3BQ0 A;  1GUN A;  1BJT A;  4CJ1 B;  2NN6 H;  3JSN A;  3J7A 5;  3L4J A;  2NVQ B;  3V2T A;  1Y1V B;  4OGQ C;  2XRQ D;  4J15 A;  2CQO A;  3BA8 A;  1JWM D;  1KNE A;  2FB9 A;  4UP9 A;  5CAE B;  1LTB D;  2NWG A;  1Y1W A;  1EIY B;  4TUY F;  2CW8 A;  2YU9 H;  1OXU A;  1B3A A;  4POG A;  3M4O B;  1MIU A;  2UU9 L;  2FE3 A;  2KQ3 A;  4KV6 A;  3J81 W;  1L1O A;  2WB1 E;  3BYY B;  5G3L F;  4YB8 B;  1U0L A;  4X62 Q;  5KG7 A;  2AQ3 B;  2LMC B;  4RH6 A;  3ETH A;  4JI7 L;  3S1R H;  3H15 A;  1NAP A;  5D8D A;  1FJG Q;  2YYA A;  2V4D A;  3N6R A;  1K8G A;  1S5E D;  3MFH A;  1GYF A;  5IWA L;  4ED6 A;  3OMG A;  4OWX B;  3Q22 A;  3KDF B;  5FLX E;  1F2Y A;  4OIJ A;  4FS2 A;  2E8G A;  3T51 B;  1B9N A;  2HT1 A;  1AE3 A;  3LGJ A;  4BY1 B;  5M5Y H;  1UC8 A;  1D1I A;  3GDE A;  5M5X H;  1Z7T A;  3R5H A;  1IKL A;  4ED2 A;  1XPU A;  3KAK A;  3GIL A;  1TWG A;  3S17 B;  4UP8 A;  3J81 i;  1B44 D;  2ATL A;  2CWA A;  2JEB I;  2XCP A;  2W6Q A;  4RNO A;  1B6R A;  2I5L X;  2L12 A;  2F3V A;  2R8G A;  2NTT A;  3NBH B;  4G4K A;  4DV7 L;  2UXB L;  4GN3 B;  3MA2 B;  4I4T F;  1SEB D;  4DV2 L;  5C4X H;  5KNC A;  2A1A A;  2YTV A;  4EGQ A;  1EY7 A;  2VZA A;  3MVV A;  1P8L A;  4IUV A;  3SR1 A;  4DK6 C;  5KRU A;  1K8A C;  1A63 A;  3GIP A;  3PR5 B;  4B3T Q;  5C0X H;  1G51 A;  2VQF L;  2FPP B;  2ICE C;  2VY3 A;  5GAD C;  5BPF A;  2F0D A;  3T1H Q;  3H94 A;  2R8J A;  4EEQ A;  1HR0 H;  1EIG A;  1H9K A;  3KTM A;  2EYO A;  5LYJ F;  5KG4 A;  4A93 G;  1K1S A;  5JVG 3;  2EE1 A;  5I2Y A;  4LF6 Q;  3G6V A;  1CSQ A;  1YHA A;  3QB3 A;  1B7Y B;  5LMN Q;  5IYD H;  3UDI A;  1SBB B;  2XCL A;  2SNM A;  2LXK A;  2CH4 A;  3J80 c;  5KFF A;  4PV1 C;  3SHL A;  1XTC D;  5JJK A;  3M4I A;  3HOV H;  1HZ9 A;  1X6O A;  4DF7 A;  3PCO B;  1GHK A;  1ZXT A;  3FP9 A;  3NBH A;  5IGD A;  2JA8 H;  4XYM B;  4JI6 Q;  2DN8 A;  4MA5 A;  3S2D B;  1DOK A;  2DNE A;  4LFC H;  3O13 A;  5JPN C;  3ETJ A;  4L63 B;  1M8A A;  1NJI C;  2K01 A;  2OH2 A;  4OXP A;  5BN3 A;  2A73 B;  2H1E A;  5K36 H;  4F4Z A;  4O4H F;  1NTG A;  5C1O A;  5JVD F;  3LWE A;  4OO1 I;  5DG9 A;  1RYR A;  3H0G H;  1MKH A;  2R7F A;  4C3I G;  1DIK A;  1B53 A;  5I4D A;  4FNF A;  2F0L A;  1E0B A;  1VQM A;  2XD4 A;  1L2Z A;  5IGB A;  1PTO B;  4QB4 A;  1M7J A;  4ETS A;  4XTC S;  3A56 A;  1TS5 A;  3DWA A;  5LMN W; 
#chains in the Genus database with same CATH homology
 2ZTE A;  4LFC L;  4DR2 Q;  1Y14 B;  3PF4 A;  1N9W A;  3CCE A;  2HHH Q;  4A3L H;  1H95 A;  3W1G A;  1GM5 A;  5IYB G;  5FJ8 H;  5JEA J;  2OCE A;  4RG1 A;  3PIO A;  1LTL A;  1L2F A;  1N36 Q;  3JAM i;  1X3F A;  2NVY H;  4B3M Q;  3KOJ A;  1SR3 A;  4P73 A;  4PZ6 A;  4TVA B;  4YWK A;  2R92 G;  4LFB L;  5C0X J;  2UU9 Q;  4JI5 Q;  4DR2 L;  2N49 A;  2Y0S E;  1VQ4 A;  1MJE A;  1X55 A;  2VNU D;  3D0F A;  4L5Q A;  4HJ9 A;  5C0X G;  1OXT A;  3H3V I;  2R6G A;  1N8R C;  2VUM H;  4DKA C;  4PZ7 A;  1N36 L;  4R4Q A;  1PYB A;  4B3M L;  4DV6 Q;  4DV0 Q;  1I94 Q;  5GRO A;  3HFZ B;  5IWA Q;  2AWO A;  1Y1V H;  1IZ6 A;  5M5W H;  4BY7 G;  4X66 L;  2JA5 H;  4JI2 L;  3CCJ A;  2Z6K A;  2VQE L;  1VS0 A;  4LW1 A;  3JC6 6;  4AQY L;  2JA9 A;  2R7D A;  4HIO A;  3UDG A;  3J80 i;  4YY3 Q;  2Q2H A;  3NEM A;  4DV6 L;  3CF5 A;  4DV0 L;  1I94 L;  3PUV A;  4DV4 Q;  1VCI A;  1HZB A;  3FKI G;  1Z9F A;  4IJL A;  4A3M G;  1S72 A;  4AIM A;  3ULP A;  2E2I H;  4IFD I;  1NE3 A;  1WCM G;  4YCV A;  4GLA C;  2UXD Q;  3I55 A;  4JBW A;  2F4V Q;  3CMA A;  4OON A;  2K5V A;  2UXC Q;  4DV5 Q;  3KLW A;  3J7Z C;  2B63 G;  1YI2 A;  1VQ8 A;  2WAQ G;  4A3K G;  3TQY A;  4YY3 L;  4HIM A;  1YJ9 A;  4BXX H;  4IO9 A;  5GQO A;  4A3J H;  4DR7 L;  5IT9 c;  4DV7 Q;  1VQJ A;  3H0G G;  2CFM A;  3K80 C;  3M4Q A;  1PH9 A;  1YJW A;  3EN2 A;  4A75 A;  3CCU A;  3HOY G;  2UXD L;  4X6A H;  2GN5 A;  4JG2 A;  2UXC L;  2AKW B;  2HIV A;  4DV5 L;  1GD7 A;  4LFA L;  1E22 A;  1EYG A;  1Y1W G;  2Z6K C;  5GAE C;  3RNU A;  3PO2 H;  3Q8D A;  1IXR A;  3HOZ H;  1OTC A;  3CCM A;  2VQF Q;  2V1C C;  1YHQ A;  4BY1 H;  3KF6 B;  4DAM A;  3F2C A;  1K73 C;  4NXN L;  1BBW A;  5M3F G;  1TWC H;  1Z47 A;  4GOP C;  4C3J H;  3DM3 A;  4JI0 L;  4IOC A;  1K3R A;  3RZO H;  1MJC A;  2HQL A;  2NN6 G;  4HJ8 A;  1E3P A;  1J6Q A;  2K75 A;  4HJ7 A;  2E2H H;  1EIF A;  3ULJ A;  3S14 H;  1FL0 A;  2N78 A;  1KL9 A;  2NVX H;  3FHW A;  4POF A;  1EUJ A;  1NMF A;  1YJN A;  3HOW G;  1I5F A;  4BA1 I;  3TRZ A;  4H02 A;  1V1Q A;  3GTL H;  3KDF A;  2A19 A;  3CCV A;  1N33 L;  1HR0 Q;  3U50 C;  2AWN A;  1C7Y A;  3CD6 A;  4LF4 Q;  4JV5 L;  2Y0S G;  3BZC A;  3CME A;  3U58 A;  2KCM A;  4QL5 A;  3S2H H;  2JA7 H;  3RLO A;  3KJO A;  1YNX A;  4FDB A;  3U4V A;  4EQ5 A;  1VQ9 A;  4B3R Q;  3GO5 A;  4KHP L;  1IBL Q;  1QZG A;  4DR4 Q;  4MNO A;  2PQA B;  4NB3 A;  4BBR H;  4HJA A;  1U5K A;  4P72 A;  4MTN A;  3CC2 A;  2WFW A;  4GLV B;  3PUX A;  5IP9 G;  1AE2 A;  2OTL A;  3A0J A;  1OXV A;  3B6Y A;  1N34 Q;  3CC4 A;  4LF4 L;  1XMO L;  3PIP A;  1EQR A;  3PO3 H;  1BKB A;  4JYA Q;  4B3R L;  3KF6 A;  4UPA A;  1IBL L;  1DGS A;  1LYL A;  1PH5 A;  2OWO A;  4LNQ A;  2N8N A;  4PZ8 A;  4DR5 Q;  1N32 Q;  3CAM A;  1PFS A;  4Y7N H;  4LF9 Q;  1JJC B;  5E7N A;  2IHF A;  3GTO H;  3CCR A;  3RN2 A;  3CPF A;  2OQ0 A;  2ZJP A;  4LFC Q;  3S15 H;  1G29 1;  3UE0 A;  1CKO A;  1OXS C;  5FLM G;  1N34 L;  2Q2U A;  3OYY A;  3CQZ H;  1HNZ Q;  2NZO A;  5C4X G;  3VDY A;  1NBW A;  4A3J G;  4JYA L;  4HID A;  1HNX L;  5ELN A;  1CKN B;  4NXM L;  4DUY L;  2JQO A;  1VQ6 A;  3I4N H;  3BU2 A;  3K7A H;  1D7Q A;  2QA4 A;  4LF9 L;  3WWV A;  2ZTC A;  4R4C A;  4DNI A;  4DUZ L;  1WOC A;  4AH6 A;  4DR1 L;  4HJ5 A;  3CCS A;  4OWW B;  3S2D H;  4A3C G;  4LFB Q;  2YYZ A;  4IFD J;  3HOX G;  4JI1 Q;  5AJ3 L;  2UUC Q;  1HNZ L;  5LMU Q;  1JE5 A;  4BY1 G;  3I2Z A;  4X64 L;  4DR6 L;  5H1S E;  2AMC B;  1VQK A;  1L1O B;  4LUV A;  1PV4 A;  2PQA A;  4AYB E;  4RMF A;  5IE8 A;  1GVP A;  2ZM6 Q;  1Q86 C;  2K50 A;  4WJ3 M;  4PG3 A;  2MQH A;  4IPC A;  1VQB A;  5JEA G;  3MXN B;  1HZC A;  2KHI A;  4B3S Q;  1GKH A;  2K4K A;  4JBM A;  3GTQ H;  1CSP A;  3PUY A;  1NMG A;  1UE6 A;  4R4O A;  3KYH C;  5HY6 A;  4JI1 L;  4X66 Q;  1R9T H;  4JI2 Q;  4DAY B;  5IP7 G;  3J81 c;  2ZJR A;  5LMU L;  2R7Z H;  2VQE Q;  3CW2 C;  1IL2 A;  2D62 A;  1XJV A;  3IRB A;  3F8T A;  1PH2 A;  3I4M H;  3L2P A;  5JJL A;  4AQY Q;  2LSS A;  2ZM6 L;  4A3I H;  3E9H A;  4A3D H;  1SRU A;  4BBS G;  4LF8 L;  2I5H A;  4B3S L;  4A76 A;  5C3E G;  1Q12 A;  4JOI C;  1FVI A;  2E5L L;  1VQL A;  1W3S A;  4A4I A;  2Q2I A;  1CKM A;  2NZH A;  3A5Z B;  1CKN A;  5IYD G;  1EOV A;  1TWH H;  1BBU A;  1PH6 A;  3HOU G;  1K0R A;  3STB D;  1V9P A;  1V43 A;  2IX0 A;  4DR7 Q;  4DV3 Q;  4LF7 L;  3HOV G;  1X3G A;  1E1T A;  1E24 A;  2IHE A;  2GVA A;  3OTO Q;  4A3E G;  3H3V H;  4BA2 I;  2OTJ A;  5M3M H;  2H5X A;  2JA8 G;  1KC8 C;  3PGZ A;  4LFA Q;  2NVT H;  1Q1E A;  1AH9 A;  2VW9 A;  4YHH L;  3G48 A;  2B29 A;  2I0Q A;  1JT8 A;  1WI5 A;  3D31 A;  2IY5 B;  1X54 A;  5K36 G;  2UUC L;  4DV3 L;  2PMZ E;  4NXN Q;  1VQC A;  3L7Z C;  4GN4 B;  4YWM A;  4JI3 L;  3OTO L;  1SFO H;  4JI0 Q;  4A3G H;  1L0W A;  3K7U C;  1VQH A;  3TRE A;  2F3I A;  1K83 H;  4A3F H;  1Q7Y C;  2Q2T A;  3EBE A;  1T9H A;  4GN5 A;  1YHB A;  3CCL A;  2WP8 J;  1NY4 A;  4DR3 L;  4R4T A;  5C44 G;  4UY8 C;  3K8A A;  2JA6 H;  2XGT A;  4UP7 A;  1WJJ A;  1M1K C;  3W1B A;  1PYS B;  2R93 H;  1G6P A;  4A3L G;  1XNR Q;  1K9M C;  3AFQ A;  3CP0 A;  1I6H H;  1X56 A;  4DV1 L;  4C3I H;  5FJ8 G;  1QVC A;  3RZD H;  2YTX A;  1N33 Q;  5C0X I;  3F1Z A;  5ELO A;  4JV5 Q;  2LXJ A;  5HGQ A;  3S1N H;  3K0X A;  1SN8 A;  4KHP Q;  4K0K Q;  4OO1 G;  3M9B A;  2QGQ A;  2D0O A;  3PV0 A;  2JE6 I;  1Q46 A;  1XNR L;  3GD7 A;  3OW2 A;  2R7Z G;  2D0P A;  3AEV A;  5IY0 A;  2UUA L;  2VUM G;  4LF5 L;  1FGU A;  2BA0 A;  3BZK A;  4LWC A;  2BH8 A;  5DLQ E;  3UE1 A;  1EQQ A;  2CWP A;  2K5N A;  5IYB H;  1KD1 C;  1IBM L;  4MZ9 A;  1TWF H;  1XMO Q;  4APV A;  4K0K L;  3GTG H;  3JAM c;  2R92 H;  1Y1V G;  1TWA H;  3RR5 A;  2JA5 G;  4X65 L;  1XNQ L;  1PVO A;  1UE1 A;  1Q8K A;  3EIV A;  1KQS A;  4JCV E;  4DR4 L;  3KJP A;  1SLJ A;  4OWT B;  4C2M H;  3M85 A;  2ZJQ A;  1JMC A;  2PNH A;  2ID0 A;  4Y52 H;  4GS3 A;  1HNX Q;  4NXM Q;  4DUY Q;  1PH4 A;  1HJP A;  3I7F A;  1VQN A;  1B8A A;  4HIK A;  1WYD A;  4JBJ A;  4DR1 Q;  4DUZ Q;  2KHJ A;  4OX9 L;  4B3T L;  4BY7 H;  1BVS A;  3ERS X;  4IOA A;  2K14 A;  3GTJ H;  3M4P A;  4A3B H;  4L5R C;  1XMQ Q;  4O0A A;  4IPG A;  4GNX B;  5AJ3 Q;  3T1H L;  4IPD A;  2VL6 A;  2UUB Q;  1S3O A;  1JJ2 A;  1M90 C;  4BXX G;  1HR0 W;  3TS2 A;  4X64 Q;  4DR6 Q;  1I3Q H;  4JC0 A;  4LUZ A;  1S40 A;  3M3Y H;  1SRO A;  2C35 B;  3ULL A;  2WAQ E;  4GLX A;  4A3G G;  4YWL A;  3FKI H;  1UEB A;  3K81 C;  4A3M H;  1KIX A;  3KF8 B;  1A8V A;  1WCM H;  4LF6 L;  1VQ5 A;  4GKJ L;  2KEN A;  4TQU S;  3J81 j;  1XMQ L;  1Q81 C;  3PO2 G;  5GAH C;  1OXX K;  2JK8 A;  2NN6 I;  5LMN L;  2UUB L;  1X65 A;  1LM0 A;  2B63 H;  3HOZ G;  4A3K H;  1HNW L;  1XPR A;  2ZTD A;  4IFD G;  2K52 A;  5J3B A;  3G6E A;  1VQO A;  1YBY A;  4XIG S;  1E7Z A;  2EXD A;  3GTP H;  3NEN A;  4LF8 Q;  1PH7 A;  2N3S A;  3BJU A;  1YVC A;  3L0O A;  2YV5 A;  2E5L Q;  1P16 A;  1UWV A;  3AQQ A;  1Y1W H;  1HZA A;  3F2D A;  1X9N A;  1J5E L;  4GOP B;  3W5O A;  4QGU A;  2MO0 A;  1B70 B;  4R4I A;  3UDX A;  1C9O A;  5M3F H;  4C3H H;  3KFU A;  4EX5 A;  3G71 A;  2EQS A;  3A5U A;  2A8V A;  4LF7 Q;  4DK3 C;  4GNX A;  1Q1B A;  3F2B A;  2BA1 A;  2I5M X;  2JA7 G;  3J7A 5;  2FXQ A;  4NPS A;  4JI4 Q;  5IYC H;  1I50 H;  3PUZ A;  2DUD A;  3STB C;  1VQG A;  5C4J H;  4BBR G;  3M7N A;  2HHH L;  4P75 A;  1UE5 A;  2OQK A;  4YHH Q;  1QZH A;  1LUZ A;  1QUQ B;  2CQO A;  4J15 A;  3HOW H;  3PF5 A;  2PI2 A;  5BR8 Q;  3S1Q H;  1KAW A;  1PH8 A;  4UP9 A;  4P71 A;  2F52 A;  1C0A A;  1JJG A;  2MO1 A;  1EIY B;  2YU9 H;  1OXU A;  4JI7 Q;  4JI3 Q;  3PO3 G;  4JI4 L;  3HKZ E;  4A93 H;  3SGI A;  4POG A;  4JBK A;  1MIU A;  2UU9 L;  1E1O A;  4JI5 L;  3E0E A;  2RCN A;  1L1O A;  1IYJ B;  2NVQ H;  2WB1 E;  4DR3 Q;  1VQA A;  4IJH A;  3CXC A;  1CUK A;  5BR8 L;  1SE8 A;  1U0L A;  4X62 Q;  5IP9 H;  4A3B G;  3S24 A;  2B3G A;  1SMX A;  3ER0 A;  2HIX A;  4L5T A;  1RL2 A;  3E9I A;  1VQP A;  4JI7 L;  1TWG H;  2KCT A;  3MEF A;  3S1R H;  3H15 A;  1VQI A;  4DV1 Q;  1FJG Q;  1EFW A;  4L5S A;  4GNX C;  3CC7 A;  4GOP A;  1JB7 A;  3RLN A;  3I4N G;  1D8L A;  1K8G A;  2MNA A;  4PMW A;  1QVG A;  5IWA L;  2ES2 A;  3M4O H;  1O7I A;  4OWX B;  2E2J H;  1RIP A;  3KDF B;  4X62 L;  2DGY A;  2E8G A;  1YEZ A;  2HT1 A;  3A74 A;  1AE3 A;  3CCQ A;  1HH2 P;  1KRS A;  3LGJ A;  5GAG C;  4YCU A;  5M5Y H;  1PH1 A;  5FLM H;  2UUA Q;  3T1Y Q;  2ATW A;  4LF5 Q;  1FJG L;  4QQB X;  4DV4 L;  1A0I A;  1TXY A;  2VS1 A;  3GDE A;  4KLK A;  5M5X H;  1IBK Q;  2UXB Q;  1IBM Q;  1YIJ A;  4QIW E;  2L15 A;  1QUQ A;  1ASY A;  3TS0 A;  2BH2 A;  1XPU A;  1VQF A;  1L1O C;  5FLX c;  4DV2 Q;  2F4V L;  4UP8 A;  3J81 i;  1PHJ A;  1A62 A;  4A3C H;  2CWA A;  4KI0 A;  4O2D A;  3AYH B;  2JEB I;  1X3E A;  4AYB G;  4X65 Q;  2CKZ B;  1XNQ Q;  3HOX H;  2I5L X;  3T1Y L;  3I4M G;  1QVF A;  3S1M H;  4DV7 L;  3NBH B;  4R1J A;  1XTD A;  1IBK L;  2UXB L;  4A3I G;  3G4S A;  1WFQ A;  4GN3 B;  4A3D G;  4DV2 L;  2RF4 A;  5C4X H;  3I56 A;  2A1A A;  2EIF A;  2CCZ A;  2YTV A;  3RLF A;  1VQD A;  2VZA A;  1P8L A;  2IT1 A;  4JI8 Q;  4DK6 C;  1YIT A;  5IYC G;  1K8A C;  3S17 H;  1A63 A;  4OX9 Q;  4B3T Q;  3DLL A;  4WJ4 A;  2VQF L;  1G51 A;  4KHZ A;  3ZJY C;  5IP7 H;  2VY3 A;  5EAY A;  1YZ6 A;  5GAD C;  1UE7 A;  3CPW A;  3T1H Q;  2Z0S A;  3AFP A;  3UDF A;  1VQE A;  4LUO A;  3HKS A;  3PSI A;  1KRT A;  2QEX A;  2IX1 A;  2GVB A;  4BBS H;  4GKK Q;  1VQ7 A;  3GTK H;  4JI8 L;  5C3E H;  4A93 G;  1GO3 E;  2MFI A;  1ASZ A;  4YCW A;  5M3M G;  4QJF A;  3U4Z A;  4LF6 Q;  4GKJ Q;  1CSQ A;  1PH3 A;  1YHA A;  1B7Y B;  5LMN Q;  5IYD H;  3UDI A;  2YTY A;  3HOU H;  1HNW Q;  3HKZ G;  2JEA I;  2LXK A;  1KHI A;  3J80 c;  4ALP A;  4GKK L;  1HR0 L;  3PUW A;  5JJK A;  3HOV H;  2WB1 G;  4A3F G;  4A3E H;  1HZ9 A;  1X6O A;  1W2B A;  3PCO B;  2ASB A;  4IPH A;  3FP9 A;  1PA6 A;  2JA8 H;  3I4O A;  4JI6 Q;  2JA6 G;  2AHO B;  2ALY B;  1KXL A;  2R93 G;  3RN5 A;  1J5E Q;  1NJI C;  1EWI A;  2PI2 E;  1Q82 C;  3ICE A;  4OXP A;  2RHQ B;  4DPG A;  1NTG A;  4QY7 A;  2RHS B;  1XPO A;  4OO1 I;  3H0G H;  2K5H A;  1MKH A;  2R7F A;  2XTI A;  3S16 H;  2JJQ A;  3GTM H;  4P74 A;  3HOY H;  1VQM A;  1N32 L;  4ME3 A;  4JI6 L;  4DR5 L;  2KBN A;  5JJI A;  4XTC S;  4JOI A;  3NEL A;  3TEH B;  5C44 H;  5LMN W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...