4A3CG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3cG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3cG01
3FHWA 1I50H 3WWVA 1MKHA 1NMFA 5C0XI 1XTDA 5GAHC 1MJEA 3TS0A 3S15H 1IBLQ 4DAMA 3CAMA 1MIUA 3G4SA 1PV4A 3HOVH 4A3FG 4K0KL 3PF5A 4YHHQ 2DUDA 1YEZA 1NJIC 1YNXA 2XTIA 5GADC 2CKZB 3G6EA 3F2DA 3CCQA 1QVCA 3ICEA 2N78A 2YV5A 1L2FA 1SR3A 2PI2A 4DK3C 4DK6C 4YWLA 4DV0Q 2K5VA 4DV4L 3T1HL 5IWAL 1HNZL 4L5SA 1JE5A 3TQYA 3HOUH 1IZ6A 2KENA 2JJQA 3PIOA 2UUBL 5BR8L 2Y0SG 4POFA 2Z6KA 2BH2A 3K7UC 1VQLA 2EXDA 3J7ZC 1X65A 4GS3A 2OTLA 3I4NH 5FLMG 3M3YH 4A3KH 3HOZH 2AMCB 2CWAA 4H02A 4X64L 3GD7A 1N36Q 3GTGH 2KHJA 1QVFA 3OTOQ 1T9HA 3PO2H 4A3BH 4KHPQ 1BBWA 1VQ6A 3GTOH 3L7ZC 1N8RC 2K52A 2UXDQ 4GNXC 3S14H 3GTPH 5GAEC 4QY7A 4JI1Q 4DV5L 3BJUA 1YJNA 3G48A 2LSSA 4RG1A 4X66L 5M3MH 2R93H 1PYBA 4LWCA 4AYBG 1N32Q 4L5TA 4YCWA 1SLJA 4DR4Q 3E9HA 4OONA 2HHHQ 2UUCL 2K4KA 1AE3A 1Y14B 1VQEA 4HIOA 1PH7A 4DUZL 1K8AC 1I94Q 4JI2Q 2UU9L 2YTXA 1VQNA 4UP8A 1Q7YC 3SGIA 3VDYA 2RF4A 4BXXG 1XMQQ 1X3EA 2I5MX 4EX5A 3EIVA 2JA7G 2K5NA 4JV5Q 4UP7A 3I56A 1WCMH 3M85A 3RZDH 1PH6A 1B8AA 2ZJPA 3CD6A 4C2MH 2KCTA 1K83H 2FXQA 1E1OA 4OO1I 1UE7A 2CFMA 3KF8B 1C9OA 3GTJH 4QGUA 2NZOA 3J7A5 3E0EA 3FP9A 4P71A 4LF6Q 1XMOL 4A3GH 1N33Q 1E7ZA 2CQOA 4R1JA 4LFCL 4JCVE 1FJGL 1PH5A 1QUQA 2Q2HA 3HOYG 4A3EG 1FVIA 2K5HA 4DV2L 3CF5A 4WJ4A 5C4XH 4LFAQ 4IJHA 4OX9L 1IYJB 1CKNA 4IPGA 5J3BA 3HOXH 3T1YL 3K8AA 4BY1G 1K73C 4GKJQ 1IBML 3RN5A 1GD7A 2I5HA 4GOPB 2HT1A 4A3DG 1EYGA 4LUOA 2JA8H 5LMUL 4DV6L 4HJ5A 3L0OA 2KBNA 5M5YH 1OXTA 2ID0A 3CCUA 1HR0Q 2MO1A 2JA6H 1X9NA 1KHIA 3RZOH 4A93G 3H0GG 4XTCS 3KJOA 1LM0A 2NVYH 4K0KQ 2K75A 3ULLA 1Y1VH 3A5UA 3CP0A 3J80i 1I3QH 4JI5L 4MTNA 3S16H 1DGSA 4B3TL 1WFQA 4IFDI 5IYDH 1P16A 1NTGA 2H5XA 4DV3L 4DV4Q 3T1HQ 3TS2A 1HNZQ 5IWAQ 1GM5A 3NELA 4R4QA 5FLXc 1V9PA 2AWNA 2UUBQ 1D8LA 1VQDA 5IYBH 3S2DH 5BR8Q 1U0LA 1UE1A 1UE5A 3FKIG 3CC4A 1JJGA 2PNHA 1KD1C 1FGUA 3CCVA 5FJ8H 1G51A 4JI2L 2NN6I 1VQIA 4HJ8A 1PYSB 1EFWA 4X64Q 3EBEA 3F2CA 3RR5A 1OTCA 4HIMA 4P75A 1VQPA 1CUKA 4JBWA 4LW1A 2OQ0A 4JYAL 2LXKA 3U58A 2E5LL 4DV5Q 3CCRA 3CCLA 4JI6L 2PI2E 3KYHC 2PMZE 1TWFH 4X66Q 1VQAA 5IP9H 3W1BA 3HOWG 2L15A 2MQHA 3A5ZB 1YHBA 4P73A 4BBRG 3CMAA 4NB3A 4GOPC 2UUCQ 3PGZA 1CKMA 3PUVA 4L5QA 1HH2P 4DUZQ 3ER0A 2MO0A 1XPUA 2N8NA 3U4VA 4DR1Q 2OCEA 1PFSA 1PA6A 3KLWA 1M90C 4X6AH 2D0OA 2BH8A 3Q8DA 5ELNA 3L2PA 3GTLH 1HZCA 4LFAL 2ZM6L 4A3JG 2Q2TA 3PO3H 4GLXA 2RCNA 1VQFA 2WAQE 2VS1A 1RIPA 2AKWB 4A3LG 5K36G 5GROA 4R4OA 5GQOA 1XNRL 3KJPA 3W5OA 1JJCB 2MNAA 4IOCA 4C3HH 3H3VI 4PZ8A 1HR0L 4JOIA 2VUMH 3U4ZA 5LMNL 1XMOQ 2IY5B 2IX1A 1IBKL 4LFCQ 2ALYB 1FJGQ 1HNWL 1IL2A 4JBJA 3HKZE 5EAYA 4LF9L 4GLVB 1WJJA 5ELOA 3CQZH 4DV2Q 4FDBA 4HJAA 4A3FH 3PF4A 4OX9Q 4PZ6A 3M4QA 3T1YQ 3PUYA 3BZKA 1IBMQ 4IJLA 1E22A 4NXNL 5LMUQ 4DV6Q 2GN5A 2B29A 1C7YA 4DKAC 2D0PA 3NEMA 4LF8L 4DR6L 1OXVA 1KXLA 4KLKA 1OXUA 2OQKA 3JAMc 3S2HH 4AQYQ 2BA1A 1PH4A 3CXCA 4L5RC 2WB1E 4JI5Q 3BZCA 4JI3L 4B3TQ 4JI4L 1KL9A 4OXPA 1ASYA 1QZHA 4B3ML 1P8LA 1SN8A 1UWVA 4DV3Q 4ME3A 3PV0A 4MNOA 1LTLA 1SE8A 2A1AA 1XNQL 1UEBA 2YU9H 2JQOA 3I4OA 4GN4B 3A0JA 3PUWA 3H3VH 1S40A 1N9WA 3B6YA 3DLLA 1KIXA 3D0FA 2Z6KC 1Q1EA 1QUQB 2E2HH 3BU2A 4DR7L 2Q2IA 5C3EG 4DR1L 1EIFA 3CCEA 1VQ8A 4JBKA 4A3BG 1ASZA 2R7FA 3RLOA 4B3RQ 4KI0A 3HFZB 1CKNB 2ZJRA 1S72A 2WP8J 3KF6B 4OWTB 4A3MH 2OWOA 3J81c 1UE6A 4JYAQ 1X6OA 2ATWA 1E3PA 2E5LQ 3CCJA 4JI6Q 2JA7H 3S24A 2VW9A 5JJLA 3CC2A 3M4PA 5IE8A 5C0XG 1N34L 4BBSH 4GKKL 4C3JH 1GO3E 2GVBA 1XPRA 3GO5A 4LUZA 1G6PA 1V43A 4HIDA 4POGA 4WJ3M 4P74A 2B63H 1X3FA 3UE1A 1L1OB 2ZM6Q 3AFQA 3CC7A 3HOYH 2WB1G 3W1GA 1C0AA 3KF6A 2IT1A 3I7FA 2R6GA 3I55A 1XNRQ 4NPSA 3UE0A 3PIPA 1YITA 4BY1H 2ES2A 3GDEA 2IHFA 1A62A 4DAYB 5LMNQ 4A3DH 5JJIA 4UP9A 1IBKQ 3STBD 2A8VA 4JG2A 4QL5A 1HNWQ 4A93H 2HQLA 4AH6A 4AQYL 1NY4A 2K14A 1VCIA 4LF9Q 3GTQH 1TWCH 1Y1WG 3MEFA 5M3FH 2CCZA 3OW2A 4YY3L 1OXXK 4A3IG 3GTKH 3HOXG 2UUAL 2VQEL 2UXCL 4GN5A 2R92G 4IO9A 1G291 1L1OA 3AFPA 4NXNQ 1PVOA 1HNXL 4HJ9A 4LF4L 1Q12A 2JA6G 1HJPA 3TEHB 3UDGA 1HZBA 1TWHH 4LF8Q 4DR6Q 1TWGH 1BBUA 1E24A 1O7IA 1W3SA 3M4OH 3JC66 3K7AH 1Y1VG 3FKIH 4JBMA 4Y7NH 1L0WA 3RNUA 1VQOA 1VQ9A 1NE3A 4BY7G 4LUVA 2ZTDA 4DNIA 4DPGA 4B3RL 5C44H 4DR5L 4JI3Q 4JI4Q 1I5FA 1YVCA 3STBC 4B3MQ 3S1RH 3KFUA 4LF5L 1TWAH 3RLNA 3ZJYC 2E8GA 4OO1G 1XNQQ 1R9TH 1HR0W 4A3CG 1B7YB 1CKOA 1EUJA 1LYLA 3PUXA 4JI7L 2HIVA 3S17H 3AQQA 1EQQA 1AH9A 1VQ4A 2JA5H 4Y52H 3F1ZA 1PH2A 4NXML 4DR7Q 1H95A 5C0XJ 4BBRH 1QZGA 1VQ5A 1K8GA 1KRSA 4YCVA 1XPOA 1YBYA 1BKBA 3EN2A 3NBHB 5IYCH 4JI0L 3K81C 4DUYL 1VQGA 3ULPA 5IP9G 2D62A 2Z0SA 1YJ9A 4O0AA 1X54A 1VQBA 2Y0SE 2NVQH 4LFBL 1Q1BA 2YTVA 1N34Q 4GKKQ 3UDIA 2N3SA 1Q8KA 3E9IA 4R4IA 5GAGC 2QEXA 4A3LH 3UDXA 1VS0A 2R7ZG 4IOAA 4QQBX 4IFDG 2JA9A 3CPFA 2EIFA 2AWOA 4C3IH 2Q2UA 3I4MH 3PO3G 5JJKA 2GVAA 2PQAB 5JEAG 1KRTA 1TXYA 2KCMA 5IP7G 1EIYB 3I4MG 4OWWB 1VQCA 3CPWA 1YJWA 1EWIA 2ZJQA 2NN6G 4JOIC 3HOVG 2OTJA 1YI2A 1Q46A 2V1CC 1S3OA 1X55A 5IT9c 4P72A 4YY3Q 5FLMH 1W2BA 3K0XA 2UXCQ 3PSIA 2UUAQ 2VQEQ 2VQFL 1K0RA 1X3GA 1AE2A 4B3SL 4GNXA 3HOUG 2HIXA 4PZ7A 1EOVA 1HZ9A 1PH3A 2PQAA 1HNXQ 1I6HH 4LF4Q 5M5WH 2E2JH 2WAQG 4UY8C 1WOCA 1A63A 1CSPA 1SFOH 3TREA 5AJ3L 4O2DA 2JK8A 1VQHA 4DV7Q 4DR2L 1A8VA 1PH9A 1JMCA 4A3KG 2F4VL 3HOZG 3I4NG 3M7NA 4GLAC 1D7QA 2JEBI 3UDFA 3J80c 2YYZA 3PO2G 3F8TA 2NZHA 4DR5Q 3AEVA 2VY3A 5C3EH 1KQSA 3KDFB 2LXJA 3HKZG 4DR3Q 4BXXH 4LF5Q 3K80C 4JI8L 3M9BA 1J6QA 5M3MG 2YTYA 2R93G 4R4CA 2E2IH 1SROA 4XIGS 5HY6A 4JI7Q 2WFWA 1VQKA 3IRBA 1Q86C 1IXRA 1A0IA 1NBWA 1SMXA 4NXMQ 4DV1L 5DLQE 2UXBL 3ULJA 4X62L 3A74A 4LF7L 4YWMA 1V1QA 1KAWA 1WCMG 1J5EL 3GTMH 4A3MG 2F52A 5E7NA 5HGQA 4A3EH 1QVGA 4HJ7A 4JI0Q 2JEAI 1EQRA 4DUYQ 4IFDJ 1Z9FA 3DM3A 3KDFA 2N49A 3RN2A 1VQJA 1OXSC 4X65L 1YIJA 4BBSG 5JEAJ 4LFBQ 4A3GG 1E1TA 1PHJA 3HKSA 2VL6A 1B70B 3CCSA 2VZAA 4DR3L 2QGQA 4UPAA 3CMEA 2B63G 1IBLL 5C4XG 3H0GH 4PG3A 1Q81C 3JAMi 3MXNB 4YHHL 1JB7A 3S1NH 1Y1WH 2RHSB 3LGJA 2ZTCA 2C35B 2ASBA 2JA8G 4YWKA 4DV0L 4A3IH 3ERSX 2R92H 5C4JH 2DGYA 5M5XH 4MZ9A 3PCOB 3G71A 4DV7L 1K3RA 3I2ZA 4OWXB 1Q82C 1U5KA 4ALPA 1BVSA 2K50A 5M3FG 4QJFA 5IYDG 3U50C 2KHIA 2MFIA 4A4IA 4AIMA 1N36L 4BY7H 3OTOL 3AYHB 3F2BA 1YHAA 2VQFQ 1PH1A 2A19A 3S1QH 4R4TA 1VQMA 4B3SQ 1WYDA 1YHQA 4KHPL 4HIKA 2UXDL 1L1OC 4GN3B 4TVAB 5IYBG 3J81j 4QIWE 4RMFA 4JI1L 3J81i 4A75A 2ZTEA 2IX0A 2I0QA 5LMNW 2BA0A 1KC8C 5AJ3Q 4TQUS 1WI5A 5FJ8G 2F4VQ 4GOPA 1N32L 1GKHA 4DR2Q 4IPHA 3HOWH 3S1MH 4DR4L 2HHHL 4A3CH 4PMWA 4A76A 3CCMA 1I94L 1VQ7A 5C44G 2F3IA 3TRZA 1RL2A 2I5LX 1K9MC 3H15A 1XMQL 2QA4A 1X56A 2AHOB 2JE6I 4JV5L 3RLFA 4IPDA 4JI8Q 1HZAA 4KHZA 4A3JH 3KOJA 4YCUA 4BA2I 3D31A 1CSQA 1GVPA 1YZ6A 1Z47A 4J15A 4BA1I 3PUZA 5H1SE 1FL0A 2IHEA 2CWPA 2JA5G 1JT8A 4DV1Q 4LF6L 1XJVA 2UXBQ 1N33L 2XGTA 4JC0A 4X62Q 2UU9Q 4LF7Q 1J5EQ 1M1KC 2B3GA 2NVTH 5IYCG 4IPCA 2R7DA 4EQ5A 2RHQB 1MJCA 3OYYA 5IY0A 4GNXB 2NVXH 2R7ZH 3NENA 4APVA 1PH8A 4AYBE 4X65Q 4GKJL 2VUMG 2EQSA 1SRUA 1JJ2A 2VNUD 1LUZA 5IP7H 3CW2C 4LNQA 1NMGA
chains in the Genus database with same CATH superfamily
3WWVA 4B9XA 2SCUB 2AGQA 1NMFA 1LV9A 5C0XI 1XTDA 3BG3A 2NN6H 3TS0A 1LT4D 4K0KL 4DF7A 4C3IG 5KFMA 1WTPA 2L12A 4MTKA 3C3LA 1YNXA 3G6EA 3CCQA 2CKZB 3ICEA 1ENCA 4DV4L 2PMZA 2K5VA 2R8KA 1KC7A 3R5XA 2F0HA 3GP7A 2UUBL 5FOBB 5BR8L 4POFA 3HBLA 3GTPB 2E2IB 1X65A 4GS3A 2OTLA 4HNUA 1AEXA 2GLTA 2W6PA 1N36Q 4HMJA 4NKLA 4J0MA 4IAJA 1SFOA 1T9HA 4ECQA 4A3BH 2C28A 2YZMA 1N32H 2I8CA 2SNMA 1O78A 4RAUC 3S14H 2B2VA 4JI1Q 3K5NA 1YJNA 2RDJA 1SYGA 5I9OA 3OMCA 3V4ZA 2B2WA 2K5DA 4LWCA 4HQ6A 2F0GA 4YCWA 1RK6A 3N8DA 2HHHQ 1JR0D 2K4KA 4L8JA 2Q8TA 5C0XH 2XCLA 1K8AC 1U4PA 3HKZA 1AUXA 3SGIA 1WSCA 2I5MX 4J1MA 2VQDA 1QCBD 4EX5A 4EQPA 5FK9C 3M85A 1CT1D 1WCMH 1KJIA 2R7KA 4CHTB 5DG9A 4JV2A 2J6TA 1RYRA 2IWHA 4CKCA 3IFTA 1XWEA 4OGQC 3JAML 4OO1I 3GTMA 4DL2A 3R2TA 2RSOA 4P71A 4A3IB 3HOXB 1XMOL 4A3GH 1N33Q 1E7ZA 5E4WC 2R92B 3LWUA 4LFCL 4JCVE 4CDCC 2BQUA 1GOZA 2Q2HA 4NW2A 1FVIA 2PNRC 2K5HA 1RF2D 2R87A 4DV2L 1K83A 5C4XH 4IJHA 2NUCA 4OX9L 1HR0H 4MV9A 3T1YL 2N55A 4BY1G 4GKJQ 3RN5A 3GQCA 4NLGA 4BY7B 1I3QB 2JA8H 1SE4A 2A69D 4HJ5A 1QNUA 5LOVF 3J80L 2KBNA 3CCUA 2MO1A 1X9NA 2O5JC 5CV6A 2NVYH 1KJ9A 1MZBA 3T1HH 1MSGA 5E1FA 3VR4A 3S2DB 3EPGA 4MHEA 1S0MA 1DGSA 2XSCA 4U6PA 4EGVA 2JA6A 5JH7F 1HNZQ 1GM5A 1ZYRC 3NELA 5BN5A 5JVH3 4V190 4RB3C 1UE1A 4CBVA 3FKIG 3CC4A 2OT2A 1D1KA 4CJ0B 3MWEA 4F50A 3GIKA 4FVMA 2EJGC 1UNSA 1PYSB 2BCOA 4HJ8A 4DV5H 5FKAC 4Z9CB 2AQ3B 1LTBD 4JBWA 4MAMA 3JZIA 2LXKA 4ID6A 3TDQA 1BXRA 3CCLA 4DUZH 3KHRA 5KFCA 4X66Q 3M9OB 4FS2A 2FLPA 1VQAA 3W1BA 4ECRA 1BNCA 3N41B 3PW5A 3I3CA 3BZDB 2NUAB 1FD7D 3MFIA 4JV0A 3LNNA 2FK3A 2DLNA 1XPUA 4O42A 2KEDA 1BCPD 5TSSA 3Q8DA 3SK5A 2PO4A 1F2LA 1TY2A 3PO3H 1UC9A 1N34H 3VR5A 1VQFA 4ZRZA 4A3LG 2A5HA 1EY8A 4CJ1B 3KJPA 3W5OA 1JJCB 4IOCA 4G4KA 4C3HH 3H3VI 4HR7A 4ULLA 1HR0L 2VUMH 4BWSC 3U4ZA 2F0UA 4R9WA 5LMNL 4EYIB 5G3LF 2IX1A 1S97A 4G7HC 4KY7A 4LF9L 1VDZA 1ENAA 4GLVB 1WJJA 5ELOA 3CQZH 5I2XA 2L11A 4DV6H 4FDBA 4BS9A 4A3FH 2B2TC 4KMUC 4DNTB 1I50A 3OHAA 1M0TA 4I7AA 1IBMQ 4NXNL 1BCPC 5JQWA 1XTCD 4RA8A 3BG5A 5LMUQ 4AQYH 1C7YA 1H9RA 1LT5D 3NEMA 1KXLA 4B3TH 2UXCH 2PZWA 3Q8SB 5CORA 1KDAA 3JRWA 3GQBA 1PH4A 3CXCA 5KYIA 4YAKB 4XT1B 4JI5Q 2F0IA 1H9SB 1S68A 1QZHA 1Z2NX 4UCSA 4DV3Q 4ME3A 3RB0A 3NSWA 3PV0A 3SE0A 4MNOA 1SE8A 2NU8B 1UEBA 1Q3LA 2DY7A 4GN4B 1WCMB 3H3VH 3GTGA 4DGZA 4A3MB 1UUPA 3AU7A 3N40P 2IP4A 2Z6KC 4UCVA 1QUQB 3GTOA 1ZQ7A 2Q2IA 2R7MA 4N8X1 3CCEA 3WO1A 1ASZA 4BBSB 4Q5VA 4C3JB 2BE5C 4A3GB 4O3SA 1LTAD 1X6OA 2ATWA 2JA7H 1B33N 3BYYB 5JJLA 3CC2A 1HTPA 3Q1KA 3M4PA 5C4XB 3OWEB 2C2EA 1GLVA 2YS6A 1XXGA 1N34L 1F9SA 3I72A 5IGCA 4KN4C 4JI0H 2JA8B 4LUZA 4RB1A 1G6PA 2C5CA 3BVMA 4IUTA 4POGA 1XNRH 4KY6A 2ZM6Q 3WDNA 3CC7A 3E5SA 2EYOA 3KF6A 1SNQA 3I7FA 2VOBA 1RYSA 1HNWH 4YR0A 2PVPA 2X6GA 3UE0A 2ES2A 1I7NA 2DZDA 3A7AB 4QUFA 2IHFA 4A3DH 2WDTA 3QFFA 3OMGA 2RKSA 3STBD 2W9CA 4JG2A 5KEEA 3GTQH 4AQYL 5KFSA 3FPPA 1VCIA 1TWCH 1AP0A 2CCZA 3M9NB 4A3IG 5I9PA 3S9WA 3HOXG 3GTKH 2UXCL 3D4DA 3N44B 4DR6H 4GN5A 4G57A 2R92G 4Y7NB 5CA1F 1EQVA 2G5DA 4ED3A 1NSNS 1Z6HA 5C44B 1GSOA 4HJ9A 4LF8Q 1BBUA 1TWAB 4JI4H 1O7IA 2Z8LA 2FJZA 3M4OH 3JAME 4B3MH 4CC6A 4ZK9B 3RNUA 1VQ9A 4OIJA 4BY7G 1NE3A 1ILPA 1EHIA 2BQRA 5IT9E 4EFBA 3IG0A 1W6KA 3STBC 3KFUA 2YS7A 1TU2B 4LF5L 3V4SA 1PRTB 2E8GA 4LJZC 3PUXA 1EUJA 4JVZA 3TP6A 2FK1A 2P5ZX 1KBLA 2QEJC 1L0YB 3NTKA 2IL8A 4Y52H 3F1ZA 1H95A 4DR7Q 3JRXA 1LTGD 3J80E 2F0KA 3MWMA 3GV5B 1HQRD 1SNOA 4C3HB 1H9KA 1KRSA 2VUMB 2E75C 4YCVA 1YBYA 2MP1A 3EN2A 3NBHB 1DCZA 4JI0L 5KNBA 4UCUA 3KHGA 3K81C 2V59A 2VB3X 1VQGA 4DL3A 3VPDA 2UVVA 5IP9G 1X54A 2YZNA 1VQBA 4A3FB 1HUNA 5K36H 4WORA 4GKKQ 1J5EH 4KKUA 4IUVA 4O3QA 4RCOA 2DPJA 3E9IA 2NTTA 1EZ1A 4IFDG 2JA9A 2HJWA 3SK4A 3CPFA 4J9MA 4C3IH 2K32A 3MA2B 1JCKB 5JJKA 2RQXA 2Y0SB 5JEAG 1S5BD 2RDIA 1SEBD 4QIWA 1KRTA 1TXYA 4DR3H 4ME5A 5KNDA 2KCMA 1EIYB 1SDFA 3CPWA 1CQIB 3JSLA 4J9SA 2ZJQA 2NN6G 3RB6A 2F0TA 5I6YA 2DPIA 1H9MA 4RCNA 1G91A 1X55A 4YJ3F 5IT9c 5KFFA 1HNXH 4YY3Q 1W2BA 2V4DA 4AYBB 1DIKA 2VQFL 1K0RA 1X3GA 4B3SL 4DV7H 1EOVA 2DWCA 1EEID 5IOCA 2R8HA 3MWYW 4O2DA 2F4VL 2JA7B 1EIHA 1A8VA 4WD3A 1J8IA 2B8FA 1KJJA 3UDFA 3J80c 3E6ZX 4FF1A 1PTOD 5D1OB 1DM0B 1EY0A 1WTOA 3AEVA 5KIXA 2V9WA 3V6JA 2B2YC 3TP8A 2EYMA 2E74C 3M9BA 2YTYA 3PIP3 1CM9A 2HHHH 4NXMH 5D3DA 4JI7Q 1IOVA 4A3EB 3J7AV 3RJ0A 2UVRA 1IXRA 2M00A 1NBWA 4IUNA 4U673 2UXBL 4DUYH 4LF7L 1KAWA 2E2IA 1WCMG 1O7LA 1J5EL 4ZCKA 4A3DB 4A3MG 4C5BA 4TV9F 4HJ7A 5ELFA 1EQRA 4IFDJ 3GTQB 2K03A 3KDFA 5KKNB 1TWCB 1OXSC 2C22A 1N33H 4BBSG 5JEAJ 4C3JG 4A3GG 1PHJA 3U9TA 2LS01 3QO2A 1STEA 3HKSA 3CCSA 3DXJC 2VZAA 4DR3L 2QGQA 1KLUD 1ICFB 3C2PA 2ZDQA 1DD2A 2F0SA 5C4XG 1Q81C 4PG3A 3MXNB 1WTVA 3URYA 1RJQA 1Y1WH 3LGJA 3M4YA 3FMAA 3KUPA 2ASBA 2JA8G 1EEFD 2C9OA 1HUMA 3OOCA 5C4JH 1O75A 5C8YF 2EOTA 4MZ9A 4DV7L 4OWXB 4CDFC 1XDNA 1U5KA 3BYTB 5HV6A 4H7BA 3U50C 2KHIA 1N36L 1D2BA 3HOWB 3AYHB 3F2BA 1GUOA 1PH1A 2A19A 2F0PA 1VQMA 3MWDA 2B2UC 2AQ2B 4GN3B 4TVAB 2EJMA 2EDGA 3J81j 2HUGA 4JI1L 1XYIA 3TP5A 2BA0A 5F9LA 3CRLC 1KC8C 5EBCA 1STNA 2W7OA 1EZ8A 1CTMA 1GKHA 2EY2A 4DR2Q 1SYXB 2FK2A 2HHHL 3G6YA 1F9QA 4A3JB 5ISRA 3NK9A 4PMWA 4A76A 1F2MA 4JI8H 2K28A 1VQ7A 5C44G 2I5LX 1PFBA 2BOSA 3NP8A 4X66H 1BCPB 1STYA 4DV1H 2MHVA 1S9FA 4J9OA 4YCUA 2UU9H 1PRTF 5H1SE 4BA1I 4A3LH 2JA5G 4RNNA 2CWPA 2ICEC 2EY6A 3ITPA 3SI8A 1IW7D 1N33L 1JWMD 4X62Q 3M7GA 1QOHA 1KDCA 1M1KC 3NQIA 1TS4A 4Q43A 1MJCA 2R7ZH 2NVXH 4ED2A 2AGOA 1JOOA 1WTHA 2HCCA 4L63B 4AYBE 4C3HG 4X65Q 4GKJL 2VUMG 2PCFB 2RA4A 3IFDA 2AUJD 1LUZA 5IP7H 5KT5A 3CW2C 1CQVA 5A2QL 1NMGA 3I4MH 3Q24A 4J6HA 4EEYA 1F9RA 3K0YA 2QYZA 5GAHC 1IBLQ 4DAMA 3CAMA 1MIUA 3TSSA 3G4SA 4A3FG 1LTSD 1VBGA 4ILWA 3F2DA 3LP8A 3OSNA 2W6QA 1QVCA 4DV0Q 1A2TA 1HNZL 1O80A 1JWUD 3SEBA 4KK7A 1AZQA 1DONA 1K8MA 3T53B 1Z7TA 2Y0SG 3OTOH 1JDBB 3K7UC 2X6LA 4KHPH 5BN4A 2EXDA 2XC9A 3HOZH 3GD7A 2QKIC 2KHJA 2YL2A 2UXDQ 3A54A 2CW0C 2K52A 4JK1C 5EPJA 4GNXC 1JWSD 3GTPH 3T13A 3BJUA 4NMZA 4JI2H 2LSSA 4RG1A 4X66L 2R93H 1PYBA 2W9AA 4AYBG 3DF7A 1SLJA 4DR4Q 2V58A 1ZXTA 4OONA 5KNCA 1QILA 2CHBD 1PTOH 2NBFA 1VQEA 2UU9L 3U9OA 1Q7YC 4IR9A 2RF4A 1XMQQ 2K05A 4O1NA 1X3EA 1I6UA 2JA7G 2K5NA 2OF1A 3RZDH 2O5IC 2ICIA 4JV5Q 3UI2A 4RNMA 4LF6H 3CD6A 4C2MH 1HA6A 3N42B 4XYLB 3H4DA 3Q8RB 1Y1WB 2Z4IA 3KF8B 3GTJH 2YCHA 3E0EA 3FP9A 3RIZA 5CV5A 3K5MA 4LFAH 4R1JA 1OO9B 1QUQA 2R8IA 5ELDA 4KY5A 4A3EG 3GLKA 1E4EB 2R8GA 1C3OA 2A73B 2JSOA 4WJ4A 4MV6A 1PYWD 3OIPA 1IYJB 3HB9A 3HOXH 3K8AA 5LHY1 1K73C 1Y1VB 1IBML 1TVXA 4A3DG 1EYGA 2ZJTA 5LMUL 4K2KA 1ESRA 3EROA 1MD2D 2ID0A 5JVG3 3BAAA 1KHIA 3H0GG 1HRJA 4XTCS 3TIIA 4J9LA 1VMPA 4ZOLF 3A5UA 4RZQA 3E3XA 1I3QH 4JI5L 4XX0B 3S16H 2AQ1B 4IFDI 1GSHA 4ECUA 4LF8H 4DV3L 4IWXA 1SXTA 4WRDA 5IWAQ 4K5WA 5FLXc 3VYSA 5J22A 2NVYA 2XCPA 3BABA 3S2DH 4R7RA 2G9DA 1JJGA 1UE5A 1JORA 2EPBA 2VR1A 4RWSC 4MV1A 1RCVD 1KTKA 2F4IA 4JI2L 2NN6I 3OWFA 5KFYA 4X64Q 2JXMB 3EBEA 3F2CA 2B8GA 1W6JA 1VQPA 3E0JA 4X3TA 4XXEA 3M9MB 1LO5D 3RAXA 2DY8A 2PI2E 4DR7H 1TWFH 5FD5A 1AW7A 2R7ZB 3WOFA 1QB5D 2NVXB 5IP9H 3GTLB 3HOWG 4ZQIA 4DR1H 2EJFC 4RGMA 3A5ZB 2UUCQ 2RDGA 4GOPC 2F0WA 3N52A 3AMUA 2MO0A 4RHRA 3U4VA 3KTMA 2OCEA 4ZYSA 2ZXPA 3KLWA 1S0NA 3I4MB 1JQYD 3J7AK 3L2PA 3OSPA 4IFDH 4LFAL 2ZM6L 4A3JG 3C46A 4GKKH 1XMOH 5LYJF 4ED0A 1BCPF 3PIO3 5K36G 1RIPA 5JEAH 2CZGA 4LFCH 1G2SA 3CKIB 2IW3A 3TMEA 1GUWA 4DV2H 1KEEA 5F9NA 3H20A 3P75A 5KFNA 1HCZA 3PW7A 3PR5B 2K33A 4OX9H 2ALYB 1FJGQ 3T1YH 3W2DA 2F0LA 5FPOA 3HS0C 3K5HA 3BA8A 1SNPA 3PF4A 1LACA 4PZ6A 2OEOA 2KSWA 2W9BA 2RBMA 3HOZB 1EUDB 1C30A 4IJLA 1WTQA 2GN5A 4I65A 5EOYA 4DKAC 2D0PA 2F03A 4LF8L 3CQZA 1OXVA 1IYVA 5BN3A 4YY3H 1K1SA 4TQSA 2OQKA 2R93B 3S2HH 2BA1A 4V0BA 1NCVA 4H13C 2WB1E 2BR0A 2J0TD 5IYZF 1PTOB 4OXPA 1ASYA 1S10A 2WAQA 1PLFA 4DK0A 2FLLA 1DJRD 3JAMW 2Y0SA 2JQOA 4J9NA 3RZDB 5KFWA 4DXGA 3KHLA 1N9WA 1KNAA 3DLLA 1KIXA 4B3RH 1SYCA 1Q1EA 4HCEA 4C2MB 4Q8FA 3DM1A 4ECSA 4DR7L 5A2QE 1K3BC 4DR1L 5I2YA 3GTJB 1EIFA 1VQ8A 5KG7A 3RAQA 2K5QA 3IAYA 4KI0A 3HFZB 1CKNB 2K01A 2ZJRA 2YRWA 3PW4A 2WP8J 4A3MH 2OWOA 1OWTA 3J81c 1VF5C 1UE6A 4JYAQ 5LXTF 1B6SA 3EPIA 2E5LQ 4JI6Q 5DQHA 3MFYA 2V4QA 2B2VC 1SEIA 1EOTA 5IE8A 4IN3A 1DYQA 2B2WC 2F0MA 4BBSH 4GKKL 4RZRA 4DFAA 4C3JH 2XIGA 5IT9L 1JICA 4KD4A 2FMAA 3RBEA 5KFJA 1GJXA 5LP6F 2JA7A 2XWBB 3D6WA 1ZYRD 1V43A 1JIHA 3D4RA 2DIKA 1X3FA 3UE1A 2W8LA 4F87A 5D1OA 3SE7A 5ELCA 4U7CA 1LTTD 2RCFA 2SOBA 2WB1G 5LMNH 3IN5A 4P2CB 5DLFA 2IT1A 1A3UA 2IA6A 2SEBD 2W6MA 3S16B 4RU9A 3PIPA 4LF9H 4Q0FA 1ET9A 5JJIA 1A62A 1R4PB 5DGAA 1IBKQ 5FO7B 4A93H 2HQLA 1NY4A 2K14A 4NXNH 1Y1WG 3MEFA 4QUCA 3MXGA 2XGPA 1TWGB 1AN8A 4YY3L 1RDPD 1OXXK 1SYFA 2A6EC 4ED1A 1EIGA 4LMQD 1L1OA 4IO9A 3I90A 3GTQA 1HFGA 1YNNC 1Q12A 2K1BA 3K3PA 3V6KA 3UDGA 1TWHH 3HP3A 3A56A 3D8GA 3WNZA 3GTKA 3JC66 4DL7A 1TWFB 4DAYA 1Y1VG 3BDCA 1B50A 4Y7NH 1L0WA 1VQOA 3NWSA 3ORRA 1TS2A 4DNIA 4B3RL 5C44H 4JI3Q 5FPRA 4J9RA 4IRDA 1YVCA 2EZVA 5C4ZA 3FDTA 3MXNA 1TWAH 3RLNA 4DR2H 1R9TH 4WJWA 4OELB 1JE4A 2K04A 3KHHA 1HR0W 2CVRA 4S3SA 1B1ZA 5DNFA 4JI7L 3AQQA 1J9OA 2JA5H 1AFPA 1PH2A 5KX5F 4RB0A 2JEGA 3GV7B 3F8NA 2ATLA 1QNKA 3QIAA 3NWTA 3EQLC 4PQXA 5KYLA 2A68D 1NUCA 3OUUA 3ULPA 3G6JB 4O0AA 3DUZA 2PN1A 4MIUA 3VR2A 2NVQH 2YTVA 3DMUA 3TP7A 1CI3M 2N3SA 5J2TF 4R4IA 4EEQA 4LAAA 2QEXA 1VS0A 2PPBC 2R7ZG 3A8IE 4IOAA 1AN7A 2A74C 1C8CA 4TUYF 2EIFA 3O13A 4XQNA 1STBA 4DA2A 3S2HB 1HFNA 3T5KA 2X69A 4FF4A 3VPCA 1EYCA 5IP7G 2F0NA 1EFID 1EY4A 4OWWB 3I4MG 1CS0A 4YBZB 2A68C 3MEHA 1EWIA 1YJWA 5JVDF 4ZQ3A 2WIIB 5T14A 1CQFA 2BE5D 4JPBW 3NXWA 4L6TB 2OTJA 4YJ2F 4JV1A 4K8IA 2R6FA 2E2JB 1S3OA 1SYDA 5C5JA 2W70A 2I87A 2I46A 4MV7A 2UUAQ 1B9MA 2VQEQ 3V2TA 4IRKA 1AE2A 1EWCA 5I47A 5DGBA 3CRKC 2PQAA 1FR3A 1KJ8A 4O3RA 5F2DA 4LF4Q 2EXZA 5M5WH 3KAJA 1WOCA 1SFOH 1RD9D 4JW0A 4DR2L 3HOZG 3M7NA 4GLAC 4LF5H 1D5XC 2XGQA 2F0FA 2YYZA 3PQIA 2XNAC 5KT2A 3F8TA 1T36A 5DM63 4DR5Q 2CW7A 4IRCA 5C3EH 1KQSA 2PBZA 3VA7A 4DXFA 4EQOA 5KG4A 4OL7A 3GIMA 1PTOF 1J6QA 1KDBA 2R93G 3N6RA 4ZKBB 3QOJA 4K6LA 2HVQA 1SROA 5HY6A 2XRSD 2R84A 4L1KA 3KAKA 2WFWA 2O2LD 3F2UA 3IRBA 3T16A 1Q86C 1VQKA 4GZYC 2R7LA 1XMQH 3TIGA 3ULJA 4X62L 1A2UA 1SCUB 3GTMH 2F52A 5E7NA 5BPFA 4A3EH 2JEAI 2F0EA 4A93B 1Z9FA 4K2LA 3RN2A 4XT3B 1Z2OX 1CA6A 1VQJA 3TINA 1GHJA 4X65L 5DEHA 5AFWA 1BOSA 2F3VA 5CB4F 2Z9HA 2IPKD 4QWCA 2I07B 4FXKC 2VPQA 2B63G 1IBLL 3H0GH 1TWHB 3JAMi 4ETSA 3Q8PB 1KAAA 1JB7A 1O7YA 2MUYA 2RHSB 3ETHA 1ML0D 3TZUA 4DV0L 3ERSX 1EY5A 2DGYA 1D6EC 2W6ZA 5K2MA 4MTEA 3I2ZA 1R9TB 1Q82C 2VQFH 4ALPA 4B3SH 4ZUIA 5KRUA 1A3VA 3EFXD 4Q44A 2HGSA 1KJQA 1VAJA 1A3TA 3MFGA 4AIMA 1MI2A 4ED8A 3S1MB 2JA5B 1YHAA 3SR1A 1B53A 5CV8A 5C4HA 3S1QH 2F4VH 2UXDL 4EBDA 2KQ3A 4RAYA 3FKIA 2JEJA 3K3VA 4A75A 3KBXA 5EKIA 5KG6A 2I0QA 3K58A 2M9VA 4DR4L 3HOWH 4A3CH 1LTID 1V1PB 3CCMA 4M9UA 4HSVA 2NVQB 5KFIA 2VA2A 1HPCA 2UVUA 2L55A 4HEDA 3R5HA 1MBYA 1XMQL 4TKOB 4FO2A 1X56A 2AHOB 2F1MA 4KJNA 4IPDA 4JV5L 5CBAE 1HZAA 4KHZA 4DL6A 1SNCA 4A3JH 4UCTA 2UXBH 5KFKA 3KOJA 4BA2I 4LF7H 1CSQA 4FBTA 1YZ6A 1Z47A 5DAUA 2IHEA 3NBIA 2CQAA 4O4IF 4DNRB 1R4QB 2HCIA 4R8NA 1I4GA 3MC0B 2B3GA 5IYCG 1SBBB 4IPCA 3NPPA 5FLXL 3RGXA 1NR4A 2PMZB 3DWQA 3NENA 3PW0A 5CR3A 2W71A 4R8UA 1RODA 1CK1A 2EQSA 1DOMA 1JJ2A 2JP1A 1Y8PB 3QOLA 1B44D 2R7ZA 2NVXA 1I50H 3CHBD 4QB4A 1MKHA 2K7VA 1TT2A 4MN3A 3LWEA 5M5WB 1PX2A 2W6OA 3T5LA 1SFOB 2D5DA 1CQJB 4RUCA 4A2AA 3PF5A 2H1EA 4YHHQ 2DUDA 5HGTA 2EYHA 2XTIA 2ZT9C 1BGWA 3RB4A 3G7LA 1KNEA 2N78A 4RAZA 1SR3A 4DK6C 1C48A 3EVQA 5IWAL 5C3EB 3ERQA 3RUZA 2KENA 2JJQA 3PIOA 1N36H 2GA4B 2QILA 4HCSA 5KFXA 2BH2A 1PMRA 1VQLA 3J7ZC 4KJOA 1DXMA 1TIID 5ELBA 5FLMG 3M3YH 3VMMA 4I7HA 4JI1H 1L0XB 4X64L 3GTGH 5JOBA 1QVFA 1HQMC 3D4WA 3PO2H 5CBEE 1BBWA 1VQ6A 3GTOH 3L7ZC 5KFBA 2P0AA 2WKDA 3GTMB 1EY9A 2C2DA 3G8CA 3MXUA 3NQTA 1N32Q 2F3WA 4ZUJA 5HBRB 1WTWA 2F0JA 4ZKCB 2FMCA 2UUCL 1AE3A 3UFXB 1BDOA 1I94Q 4YB8B 1K83B 1VQNA 1KABA 3GTPA 4FM9A 1KLGD 1STGA 4JYAH 2E5LH 1BJTA 3GILA 3RMHA 3L3OC 5C6AA 3R5FA 3EIVA 4QMGA 4UP7A 1PH6A 2K5WA 2NYZD 5L9XA 2L5TA 3H0GB 2ZJPA 4EGQA 3QR8A 3CVZA 2KCTA 3PVXA 2BDOA 1GHKA 1II3A 5KFGA 2CFMA 2GPWA 4QGUA 2NB0A 3J7A5 1M0WA 5E3FA 2J6SA 3H40A 1FJGL 4GKJH 4HMIA 2JA6B 4KD3A 3CF5A 3GTJA 5EWFA 4UDUC 4MV3A 1LT6D 4O4LF 3I8ZA 1CKNA 3H09A 1EYAA 5EJWA 1GD7A 2HT1A 4LUOA 1BR9A 2IMWP 3S1QB 3DEPA 1HR0Q 4Q0YA 5M5YH 4A93G 3MR3A 2IJ0A 5EKKA 2V4RA 4Q8EA 3KJOA 4XQJA 3ULLA 2PW5A 4M1UB 3J81L 1Y1VH 1HNZH 3Q23A 2R92A 3ND8A 3D3RA 5CV4A 1PXUA 1WFQA 1WD1A 5IYDH 5KT4A 3T1HQ 4H44C 5C5MA 3TS2A 3R8BA 4R4QA 1V9PA 2AWNA 5KG2A 1U4MA 1EQTA 5KFPA 1U0LA 1Y8NB 1G8ZD 3PN1A 2KCNA 1I3QA 2PNHA 1FGUA 1EWHA 5FJ8H 3VYUA 4DL5A 3I73A 4X3UA 4F4XA 1EFWA 4ABNA 3RR5A 4HIMA 5KFEA 4P75A 4ECZA 1CHPD 5IGBA 2NU7B 1SYEA 2OQ0A 4JYAL 3U58A 2E5LL 4DV5Q 4OIKA 4JI6L 3Q22A 1K8OA 1ENFA 1IKLA 2PMZE 3KYHC 2FKLA 2YW2A 4UAIA 5J39A 1U4LA 2YZGA 5A2QW 2L15A 2MQHA 1B3AA 3FRPB 5C3WA 2BQ3A 4PDBA 1A15A 1YHBA 4P73A 4F88A 4NB3A 3PGZA 3PUVA 4DUZQ 1HH2P 3ER0A 2N8NA 4RNOA 2LFNA 3X3MA 1PFSA 3Q6SA 4X6AH 1M90C 2D0OA 1TWFA 2BH8A 2KECA 1I50B 5ELNA 3ONAB 3GTLH 1HZCA 1EYDA 1GUTA 1PDQA 4GLXA 1C4QA 3WO0A 2WAQE 5D14A 2VS1A 5H80A 4J9PA 1WVLA 1E0BA 1DV1A 4R4OA 5GQOA 3EYYA 2MNAA 4JOIA 1RJRA 4F4YA 2IY5B 1IBKL 1WR2A 4IZ8A 2PW7A 1QG7A 2CW0D 4B9WA 2R61A 1D5ZC 1VF7A 3IL8A 3H4BA 1IBMH 4JBJA 3HKZE 4KV6A 1DZ1A 4ZAIA 5LMUH 5FO8B 4G3IA 4N9PA 1RHPA 5D65A 3M3YB 3PUYA 3BZKA 3GTGB 5D1PA 4DV6Q 3PO2B 4F4WA 4RFBA 2W6NA 1GUGA 4Q45A 2OLSA 3GTOB 5HURA 3RFCA 4JI5H 1UNNC 4KLKA 2KA7A 3T5JA 4DV3H 2HDLA 5FO9B 4AQYQ 5IIFA 2Z4HA 4FP5D 3UQ8A 2DNEA 4JI3L 2WTFA 4B3TQ 1KL9A 1P8LA 1M8AA 1UWVA 5FLXE 1LTLA 4RUAA 3K57A 2YU9H 4FBUA 3SK8A 5DG7A 3PUWA 2EYFA 1L2ZA 3AB9A 1EY6A 1S03G 4K5VA 2WB1B 2E2HH 3GIQA 1V8QA 2QDBA 4O4HF 1CA5A 4PWQA 5C3EG 1ZETA 4JBKA 1AUVA 2R7FA 3RLOA 1S72A 1S5ED 1V51A 3KF6B 4OWTB 4PMCA 2J7ZA 1F9PA 1H9SA 4KN7C 4IUUA 3S24A 1XX8A 4R8IA 1CE8A 4RKLA 2W9CB 2EYPA 2TMPA 3ORQA 3KLSA 2O4XA 2VPSA 1WCMA 1CHQD 3RBDA 1T3NA 4ED7A 4DLKA 2ZM6H 2GVBA 2X0SA 1QE6A 4J9KA 5CMDA 4HIDA 5M5YB 4P74A 2B63H 1HHVA 4N9TA 2VA3A 3H91A 3AFQA 4C5AA 3HOYH 1M6VA 2EY5A 4TSSA 3I55A 5M3FB 1JKJB 5L1JA 1XNRQ 4M7EA 4NPSA 5KG5A 5BPHA 3DWPA 1EY7A 3WOEA 2A8VA 5LL6S 3K5IA 1N56A 1HNWQ 4AH6A 1HTLD 3MZ5A 4O2AF 5DG8A 4MTDA 1JC7A 3QZ7A 3OW2A 2XCAA 3P1HA 4OEMB 2UUAL 2VQEL 3MJFA 1EU4A 4UHVA 4YR2A 1DOLA 2EVBA 2YYAA 5KFTA 4LF4L 2JA6G 1HJPA 1IHZA 1TA8A 4DR6Q 1TWGH 2EE1A 1O7ZA 4C1NK 3CU7A 3TQTA 1HXYD 4LUVA 2NU9B 4DPGA 2XRQD 3RGZA 3KLSX 4QF4A 4DR5L 4IUQA 4JI4Q 3GV8B 4B3MQ 3R23A 3S1RH 3BJYA 1I4QA 2QDLA 1XNQQ 2CQYA 2YRXA 4ECXA 3MTSA 4A3CG 5CV7A 1CKOA 3S17H 2PZUA 5IGDA 5KT7A 2ASDA 1EQQA 1AH9A 1VQ4A 3RV3A 4C5CA 3V96A 1TWAA 2NU6B 4BBRH 1RK5A 3KALA 3Q2OA 1R9TA 4ODGA 1VQ5A 1K8GA 2QW7A 4ECVA 1BKBA 2VB2X 5IYCH 3J81E 5EBDA 2O03A 2JA5A 2LY7A 1ICWA 3T5HA 2WV6D 5DLGA 1Q1BA 3UDIA 3FPUB 4FU0A 1TS3A 5GAGC 3UDXA 5CC4A 2AWOA 1WH2A 2Q2UA 2MCTA 3BA9A 2VUMA 1SE3A 2GVAA 3NBHA 2G9HD 5GONF 4QWEA 1E2WA 1S4ZA 1I4HA 1VQCA 1SJHD 3EJIA 4QWAA 1PRTC 2FE3A 3RF2A 3L4KA 4RHSA 4FNFA 1Q46A 2PZTA 2YU9B 1H9JA 1I6HB 2I80A 2KVMA 4DAVA 4LSXA 5FLMH 4HAEA 2E2HB 3GV3A 2QF7A 2VUGA 5EZYF 2HIXA 1HZ9A 1HNXQ 2E2JH 1A63A 1CSPA 5IT9W 3LWBA 4DV7Q 1T94A 3K59A 2JEBI 1K1QA 5KGUA 1GYFA 3PO2G 1DOKA 5KT3A 2ASLA 3KDFB 4JI7H 4RH6A 5KFAA 1AZPA 1PK8A 4ZLTF 1TR5A 4G7OC 3FDSA 4HNTA 4AYBA 2L0CA 3X3NA 2R82A 2HD3A 2B63B 3PMFA 3N6XA 3J80W 1I94H 1A6XA 1V1OA 3HOYB 2C2RA 4YIJA 4EBEA 1GXDC 1VMCA 3SHLA 4NXMQ 2A6ED 5DLQE 1E2VA 3RUPA 1V1QA 1A9XA 1GSAA 4DL4A 1YNND 5HGQA 3H3VC 1X32A 4DUYQ 3DM3A 2N49A 1Q8IA 5BMVF 4LFBQ 2RVLA 2WACA 1B70B 4NP5A 4JUZA 1F2YA 3KBGA 3TBIB 4HTHA 2OXPA 3DHQA 3CMEA 2FLNA 3HG9A 1BUVT 1BBXC 2M05A 4GC7A 4YHHL 3RTXA 3ZYYX 3S1NH 1MGSA 2ZTCA 1STHA 2A6HD 4YWKA 1JOQA 2J9GA 1Y8OB 5KFQA 4FF3A 1TWCA 5M5XH 3H0GA 1S5CD 3S1RB 3L9AX 4UFZA 3G71A 1K3RA 2F0VA 3J7AF 2K50A 5M3FG 2WYOA 1I4PA 5IYDG 3S17B 2MFIA 4A4IA 1WTXA 1W93A 1FKAH 2K6AA 3H94A 1FGBD 1JDEA 3A8JE 4R4TA 1N48A 4BBRB 1JXLA 5D3IB 5KG3A 4HIKA 1SJED 1L1OC 1S5FD 4QIWE 4RMFA 3VA5A 2IX0A 1Q90A 5LMNW 4OO1H 1PZKD 3GIJA 5AJ3Q 1ESFA 5FJ8G 1N32L 3S1MH 2A6HC 1RJPA 2LKVA 1G2TA 4UCOA 1I94L 3TRZA 3HZXA 2HVRA 2A69C 1K0SA 5J1ZA 2JE6I 2R86A 4JI8Q 2AQ4A 3JSNA 5KG0A 3N43B 1GGOA 1B2TA 4X62H 2RSNA 3PUZA 1SSOA 1FL0A 3BVZA 5KFHA 4DV1Q 3VYRA 5KG1A 5LL6b 3FMCA 3K6OA 1XJVA 4IZOA 2XGTA 4JC0A 2UU9Q 4MA5A 3MFHA 4X65H 2NVTH 4GNXB 5IY0A 3RD4A 2B2TA 3A55A 2ZXOA 4APVA 2VXWA 4HN7A 2WINB 3V6HA 1IBLH 1FNWA 3P7JA 4EQNA 5IGEA 4QCLA 4UCRA 3FHWA 1UC8A 4IALA 1MJEA 2L1BA 3S15H 4CC5A 3HOVH 1PV4A 3C1EA 4DV0H 1SNMA 1YEZA 1NJIC 2V5AA 4ZI7F 5GADC 2JN4A 4E4TA 4YQWA 2YV5A 1L2FA 4XYQA 2PI2A 3MVVA 1I6VC 5ELEA 4YWLA 5NUCA 4DK3C 3T1HL 4L5SA 1JE5A 3TQYA 3HOUH 1IZ6A 5IODA 4A3BB 4X3KA 2DNCA 4PMBA 2Z6KA 1TKWB 3S14B 4XQQA 2SDFA 2UXDH 5COYA 2ALZA 4U68A 5EQ0A 3I4NH 2ZDGA 4A3KH 2AMCB 2CWAA 3H6MA 1U9RA 4H02A 3OTOQ 4KHPQ 3VR6A 2XN9C 2AU0A 5KFLA 1M7JA 4XZ3B 2BDNA 3PR4A 4DR4H 1N8RC 5GAEC 4QY7A 2OH2A 4DV5L 3G48A 1NNXA 1SYBA 5M3MH 2R8JA 3K5LA 4L5TA 3E9HA 3ETJA 4B08A 3RV4A 1Y14B 3SDZA 4HIOA 4JV5H 1PH7A 4DUZL 4JI2Q 2YTXA 4UP8A 1B9NA 3VDYA 4BXXG 3NTIA 5JPNC 3I56A 1SE2A 1B8AA 2J4XA 1PFNA 1S5DD 1BXTA 1W96A 1K83H 3S1NB 2F0OA 1E1OA 2FXQA 1UE7A 3T51B 1C9OA 1GUNA 2L9HA 2NZOA 5KT6A 4G7ZC 4LF6Q 1Z2PX 2FJ2A 2NWGA 2CQOA 5M5XB 1TS5A 1PH5A 2WB1A 3HOYG 5JPMC 2E2DC 3OUZA 4LFAQ 5CYUA 2NVYB 4IPGA 5J3BA 4EYHB 4FS1A 1VKZA 1BO0A 2I5HA 4GOPB 4KTAA 2UVWA 4DV6L 1TAEA 3L0OA 2JA6H 4QW8A 1OXTA 3RZOH 2AUKA 2DJGC 5C1PA 1Y1WA 3KF8A 3LMLA 4K0KQ 1LM0A 2K75A 5IWAH 2XIWA 3CP0A 3J80i 4MTNA 1ULZA 4B3TL 2F0QA 3NGDA 4O3PA 1P16A 1E4EA 4K5XA 1NTGA 2H5XA 3V05A 4DV4Q 2KEEA 5E4XA 4RKBA 2UUBQ 1D8LA 1PZID 1VQDA 5IYBH 5BR8Q 1Y1VA 4X64H 4LK1C 2KJXA 1KD1C 5IGGA 2RDFA 4CDEC 1FNVA 3CCVA 1NAPA 1G51A 3KXYT 5KFVA 1VQIA 2EY1A 3NE5B 4PNYA 2FMMA 1DV2A 5FLXW 1MSHA 1XNQH 1OTCA 4LH7A 1RJTA 1JOKA 4YP3A 3ND9A 1CUKA 3BVGA 4LW1A 2UUCH 4I7ZC 2NVTB 3CCRA 5EWEA 5M9OA 1EUCB 4FF2A 3PO3B 4KKSA 3CMAA 1E4FT 4BBRG 4Y8VB 1CKMA 4L5QA 4KHVA 4DAPA 4DR1Q 3R3OA 1RTNA 1PA6A 2W9BB 3J7YW 4QWDA 2Q2TA 3S15B 3HOVB 2RCNA 3OIQA 5EPLA 5G3LD 2AKWB 1MHWC 1FJGH 3CQZB 5GROA 1BQQT 1XNRL 4MV4A 3GIPA 2C00A 4PZ8A 1B04A 1WD0A 4ECTA 1WTRA 2XWJB 1XMOQ 3GTLA 2FB9A 4LFCQ 1FYCA 3HOUB 1HNWL 1IL2A 3I70A 3GIDA 5EAYA 3GV6A 4MA0A 4DV2Q 2WAQB 4IURA 2XVSA 4HJAA 3OSOA 4OX9Q 3VPBA 2SNSA 3M4QA 3T1YQ 3I4NB 4ME6A 1PZJD 4A3KB 4FXDA 1E22A 3PW2A 3FVQA 5CA0F 2B29A 4DR6L 4O3OA 3HKZB 1ZHSA 1OXUA 3JAMc 4IWYA 5M3MB 2N88A 4L5RC 4EFEA 4C1NI 5CGKA 2JYOA 3BZCA 3I4LA 3OW7A 4JI4L 2B2YA 4B3ML 4XYMB 1BF4A 3GIIA 1SN8A 3QJYA 1LLRD 2A1AA 3QZ8A 1XNQL 5JVLA 3I4OA 4IUPA 5DM73 3A0JA 1IKMA 5KFOA 4PV1C 1S40A 3B6YA 3OHXC 1E4GT 1RKNA 5J2UF 3D0FA 2XD4A 1LT3D 3BU2A 4TRDA 3TQ1A 4J9QA 5EPKA 4JI6H 5I6WA 4A3BG 1RTOA 2YU9A 4B3RQ 2R93A 3HXLA 4X3SA 4XYOA 1E3PA 3CCJA 2E2HA 3RB3A 2WE6A 2VW9A 3SXHA 4HYKA 1T5XD 5C0XG 1YNJD 1EU3A 3IKJA 1Y69U 1GO3E 1XPRA 1X3PA 3GO5A 3J81W 4C2MA 4WJ3M 2FFKB 1K28A 2PYKA 3RZOB 1L1OB 3VR3A 5LL6X 4LFBH 4MV8A 4YR3A 3W1GA 1IBKH 2ENBA 1PTOC 1C0AA 4ECWA 2R6GA 2H4OA 1YITA 4BY1H 3GTKB 3GDEA 2HQEA 2WKCA 3G6XA 2W8KA 5LMNQ 2B63A 4DAYB 4UP9A 5DQGA 2AGPA 5KFZA 2CH4A 2MGSA 4QL5A 2FPIB 1NR2A 2IX3A 2MPMA 4I4TF 4LF9Q 1YNJC 3HGBA 1F77A 5M3FH 3M4OB 1I7LA 4N8FA 1G291 2B2UA 1BNZA 1G6ZA 3AFPA 4NXNQ 1IOWA 1LABA 5EGTA 5T1IA 3BQ1A 1PVOA 4CKBA 1HNXL 3QG1A 3W3AA 4CJ2C 2EYLA 4RGTA 3TEHB 2W57A 1HZBA 4F4ZA 4JI3H 1V4YA 4CKEA 1E24A 5K5PA 1W3SA 4APMA 3K7AH 1M4VA 3FKIH 3Q0AA 4JBMA 5FD6A 2ZTDA 2ASJA 2TSSA 1I5FA 1ILQA 2D9UA 1TWGA 1IYUA 2RGVA 5JUMA 3ZJYC 4OO1G 1D1IA 4HR7B 2JEFA 1SMYD 2NZ1D 1EZ6A 1B7YB 1F2ZA 3VYTA 3HEJA 1LYLA 2Q8RE 2HIVA 5LA6F 4NXML 5T1GA 1TY0A 5C0XJ 4RB2C 1QZGA 2RDHA 5CV9A 1XPOA 3SVMA 4I50F 2R3ZA 4DUYL 3EA6A 2M2LA 4A2BA 3BQ2A 2E76C 2D62A 2Z0SA 1YJ9A 1SAPA 5KFDA 2NTSA 2LMCB 4C3IB 2Y0SE 4TV8F 4LFBL 1N34Q 1LTRD 4O3NA 3BS1A 1Q8KA 1JB3A 1SMYC 4FYDA 4QQBX 3TN2A 1T5EA 4C56C 5EWGA 3SK6A 2Z1CA 3PO3G 4ED6A 1PFMA 2PQAB 3QB3A 4CDDC 4EBCA 3D6CA 2J6UA 4RGOS 1U4RA 2IBKA 4HSPA 4H0LC 2DN8A 4JOIC 3HOVG 1EYZA 4EG0A 1YI2A 2UUAH 2VQEH 2KHSA 5L1KA 1B4OA 2KOLA 1UEAB 2V1CC 1S0OA 2RGRA 2HVSA 1CZWA 4P72A 4LF4H 3K0XA 2UXCQ 3PSIA 4K14A 4FXGC 1IW7C 1ONLA 4ECYA 4GNXA 2FP4B 3HOUG 4PZ7A 3I91A 1PH3A 2W7PA 3MR5A 1I6HH 2WAQG 4UY8C 3TREA 2MJ8A 5AJ3L 4DR5H 2JK8A 1VQHA 3R2IA 2FHTA 1PH9A 2F0DA 2PQEA 3U9SA 4A3KG 1JMCA 3I4NG 1D7QA 5IGFA 3Q8QB 3DWAA 2NZHA 2VY3A 2LXJA 3HKZG 4BXXH 3DEOA 2CW8A 4LF5Q 4I55F 3MR2A 3K80C 4JI8L 5M3MG 2FPGB 4HNVA 4WBNF 4R4CA 2E2IH 3KK7A 3MAQA 4XIGS 1ZEQX 4DU9A 3PZPA 1QJOA 1JLLB 2QK4A 1A0IA 1SMXA 2KCCA 4DV1L 4DK1A 1TQOA 3A74A 3MXPA 4YWMA 4BY1B 5JAVA 1ZHQA 1FNUA 5L1LA 3TZDA 1QVGA 3QWNA 4EVOA 4JI0Q 2R7NA 3T56B 4NDXA 5D8DA 4GC6A 1ZKOA 1YIJA 4EGJA 3OPOA 3MR6A 4F8MA 1E1TA 3HRZC 1VBHA 2VL6A 5KFRA 4QWBA 4UPAA 2Z6BA 2R85A 2JEIA 5C4JB 3P20A 1D5MC 4XDXA 4TQRA 2HDMA 2FPPB 5CAEB 3K7AB 3FKIB 5KFUA 1QWYA 2GPSA 4IHJF 2C35B 2QCPX 4O2BF 4A3IH 5I4DA 2Q8IB 2R92H 3C0FB 4DN4M 4M8AA 4K8JA 4BWGB 4K0KH 2DJFC 3PCOB 3T4AC 4LSAA 4LH6A 1BVSA 4CGYB 1HA5A 2D2CC 4DV4H 4QJFA 4E6IA 3KLRA 5L1IA 3NUCA 1SNDA 3MHBA 4BY7H 3OTOL 1TWHA 2VQFQ 4KHPL 2UUBH 4ZHQF 4B3SQ 1WYDA 1YHQA 5BR8H 3OHBA 1E2ZA 3A8KE 5IYBG 3J81i 2ZTEA 2L4NA 2CH4W 3BDLA 3NTHA 4KKTA 5C3XA 5DQIA 4TQUS 1WI5A 5L37A 2F4VQ 4GOPA 1STAA 4F7XA 4IPHA 4IQZA 3G6VA 5EDWA 1JX4A 2F3IA 3LX0A 1RL2A 3A7LA 2B39A 5A35A 4OHJA 3H15A 1K9MC 1EL0A 3M4IA 4IR1A 3BQ0A 2QA4A 1CZGA 4QIWB 1PRTD 2ZDHA 5C1OA 3K5OA 3RLFA 4J8QA 4R8UB 1I4RA 1IL8A 3E5NA 4RGNA 3R93A 2KUMA 3D31A 3BDOA 3NHHA 1GVPA 1B3QA 4YAJB 4J15A 5EKLA 1JT8A 3L4JA 1UAPA 4LF6L 1X3QA 2UXBQ 4LF7Q 2EYJA 3C1FA 1J5EQ 1V1PA 4QW9A 1GUSA 4EQ5A 2R7DA 2RHQB 3OYYA 5C5LA 1I4XA 4K6DA 5JJZA 3I12A 4LMYA 1B6RA 1PH8A 4WFN3 3FEWX 1CFMA 1SRUA 2FINB 2VNUD 2ZXRA 1ET6A 4YHHH 4LNQA 4DR3Q
chains in the Genus database with same CATH topology
3FHWA 1I50H 3WWVA 1MKHA 1NMFA 5C0XI 1XTDA 5GAHC 1MJEA 3TS0A 3S15H 1IBLQ 4DAMA 3CAMA 1MIUA 3G4SA 1PV4A 3HOVH 4A3FG 4K0KL 3PF5A 4YHHQ 2DUDA 1YEZA 1NJIC 1YNXA 2XTIA 5GADC 2CKZB 3G6EA 3F2DA 3CCQA 1QVCA 3ICEA 2N78A 2YV5A 1L2FA 1SR3A 2PI2A 4DK3C 4DK6C 4YWLA 4DV0Q 2K5VA 4DV4L 3T1HL 5IWAL 1HNZL 4L5SA 1JE5A 3TQYA 3HOUH 1IZ6A 2KENA 2JJQA 3PIOA 2UUBL 5BR8L 2Y0SG 4POFA 2Z6KA 2BH2A 3K7UC 1VQLA 2EXDA 3J7ZC 1X65A 4GS3A 2OTLA 3I4NH 5FLMG 3M3YH 4A3KH 3HOZH 2AMCB 2CWAA 4H02A 4X64L 3GD7A 1N36Q 3GTGH 2KHJA 1QVFA 3OTOQ 1T9HA 3PO2H 4A3BH 4KHPQ 1BBWA 1VQ6A 3GTOH 3L7ZC 1N8RC 2K52A 2UXDQ 4GNXC 3S14H 3GTPH 5GAEC 4QY7A 4JI1Q 4DV5L 3BJUA 1YJNA 3G48A 2LSSA 4RG1A 4X66L 5M3MH 2R93H 1PYBA 4LWCA 4AYBG 1N32Q 4L5TA 4YCWA 1SLJA 4DR4Q 3E9HA 4OONA 2HHHQ 2UUCL 2K4KA 1AE3A 1Y14B 1VQEA 4HIOA 1PH7A 4DUZL 1K8AC 1I94Q 4JI2Q 2UU9L 2YTXA 1VQNA 4UP8A 1Q7YC 3SGIA 3VDYA 2RF4A 4BXXG 1XMQQ 1X3EA 2I5MX 4EX5A 3EIVA 2JA7G 2K5NA 4JV5Q 4UP7A 3I56A 1WCMH 3M85A 3RZDH 1PH6A 1B8AA 2ZJPA 3CD6A 4C2MH 2KCTA 1K83H 2FXQA 1E1OA 4OO1I 1UE7A 2CFMA 3KF8B 1C9OA 3GTJH 4QGUA 2NZOA 3J7A5 3E0EA 3FP9A 4P71A 4LF6Q 1XMOL 4A3GH 1N33Q 1E7ZA 2CQOA 4R1JA 4LFCL 4JCVE 1FJGL 1PH5A 1QUQA 2Q2HA 3HOYG 4A3EG 1FVIA 2K5HA 4DV2L 3CF5A 4WJ4A 5C4XH 4LFAQ 4IJHA 4OX9L 1IYJB 1CKNA 4IPGA 5J3BA 3HOXH 3T1YL 3K8AA 4BY1G 1K73C 4GKJQ 1IBML 3RN5A 1GD7A 2I5HA 4GOPB 2HT1A 4A3DG 1EYGA 4LUOA 2JA8H 5LMUL 4DV6L 4HJ5A 3L0OA 2KBNA 5M5YH 1OXTA 2ID0A 3CCUA 1HR0Q 2MO1A 2JA6H 1X9NA 1KHIA 3RZOH 4A93G 3H0GG 4XTCS 3KJOA 1LM0A 2NVYH 4K0KQ 2K75A 3ULLA 1Y1VH 3A5UA 3CP0A 3J80i 1I3QH 4JI5L 4MTNA 3S16H 1DGSA 4B3TL 1WFQA 4IFDI 5IYDH 1P16A 1NTGA 2H5XA 4DV3L 4DV4Q 3T1HQ 3TS2A 1HNZQ 5IWAQ 1GM5A 3NELA 4R4QA 5FLXc 1V9PA 2AWNA 2UUBQ 1D8LA 1VQDA 5IYBH 3S2DH 5BR8Q 1U0LA 1UE1A 1UE5A 3FKIG 3CC4A 1JJGA 2PNHA 1KD1C 1FGUA 3CCVA 5FJ8H 1G51A 4JI2L 2NN6I 1VQIA 4HJ8A 1PYSB 1EFWA 4X64Q 3EBEA 3F2CA 3RR5A 1OTCA 4HIMA 4P75A 1VQPA 1CUKA 4JBWA 4LW1A 2OQ0A 4JYAL 2LXKA 3U58A 2E5LL 4DV5Q 3CCRA 3CCLA 4JI6L 2PI2E 3KYHC 2PMZE 1TWFH 4X66Q 1VQAA 5IP9H 3W1BA 3HOWG 2L15A 2MQHA 3A5ZB 1YHBA 4P73A 4BBRG 3CMAA 4NB3A 4GOPC 2UUCQ 3PGZA 1CKMA 3PUVA 4L5QA 1HH2P 4DUZQ 3ER0A 2MO0A 1XPUA 2N8NA 3U4VA 4DR1Q 2OCEA 1PFSA 1PA6A 3KLWA 1M90C 4X6AH 2D0OA 2BH8A 3Q8DA 5ELNA 3L2PA 3GTLH 1HZCA 4LFAL 2ZM6L 4A3JG 2Q2TA 3PO3H 4GLXA 2RCNA 1VQFA 2WAQE 2VS1A 1RIPA 2AKWB 4A3LG 5K36G 5GROA 4R4OA 5GQOA 1XNRL 3KJPA 3W5OA 1JJCB 2MNAA 4IOCA 4C3HH 3H3VI 4PZ8A 1HR0L 4JOIA 2VUMH 3U4ZA 5LMNL 1XMOQ 2IY5B 2IX1A 1IBKL 4LFCQ 2ALYB 1FJGQ 1HNWL 1IL2A 4JBJA 3HKZE 5EAYA 4LF9L 4GLVB 1WJJA 5ELOA 3CQZH 4DV2Q 4FDBA 4HJAA 4A3FH 3PF4A 4OX9Q 4PZ6A 3M4QA 3T1YQ 3PUYA 3BZKA 1IBMQ 4IJLA 1E22A 4NXNL 5LMUQ 4DV6Q 2GN5A 2B29A 1C7YA 4DKAC 2D0PA 3NEMA 4LF8L 4DR6L 1OXVA 1KXLA 4KLKA 1OXUA 2OQKA 3JAMc 3S2HH 4AQYQ 2BA1A 1PH4A 3CXCA 4L5RC 2WB1E 4JI5Q 3BZCA 4JI3L 4B3TQ 4JI4L 1KL9A 4OXPA 1ASYA 1QZHA 4B3ML 1P8LA 1SN8A 1UWVA 4DV3Q 4ME3A 3PV0A 4MNOA 1LTLA 1SE8A 2A1AA 1XNQL 1UEBA 2YU9H 2JQOA 3I4OA 4GN4B 3A0JA 3PUWA 3H3VH 1S40A 1N9WA 3B6YA 3DLLA 1KIXA 3D0FA 2Z6KC 1Q1EA 1QUQB 2E2HH 3BU2A 4DR7L 2Q2IA 5C3EG 4DR1L 1EIFA 3CCEA 1VQ8A 4JBKA 4A3BG 1ASZA 2R7FA 3RLOA 4B3RQ 4KI0A 3HFZB 1CKNB 2ZJRA 1S72A 2WP8J 3KF6B 4OWTB 4A3MH 2OWOA 3J81c 1UE6A 4JYAQ 1X6OA 2ATWA 1E3PA 2E5LQ 3CCJA 4JI6Q 2JA7H 3S24A 2VW9A 5JJLA 3CC2A 3M4PA 5IE8A 5C0XG 1N34L 4BBSH 4GKKL 4C3JH 1GO3E 2GVBA 1XPRA 3GO5A 4LUZA 1G6PA 1V43A 4HIDA 4POGA 4WJ3M 4P74A 2B63H 1X3FA 3UE1A 1L1OB 2ZM6Q 3AFQA 3CC7A 3HOYH 2WB1G 3W1GA 1C0AA 3KF6A 2IT1A 3I7FA 2R6GA 3I55A 1XNRQ 4NPSA 3UE0A 3PIPA 1YITA 4BY1H 2ES2A 3GDEA 2IHFA 1A62A 4DAYB 5LMNQ 4A3DH 5JJIA 4UP9A 1IBKQ 3STBD 2A8VA 4JG2A 4QL5A 1HNWQ 4A93H 2HQLA 4AH6A 4AQYL 1NY4A 2K14A 1VCIA 4LF9Q 3GTQH 1TWCH 1Y1WG 3MEFA 5M3FH 2CCZA 3OW2A 4YY3L 1OXXK 4A3IG 3GTKH 3HOXG 2UUAL 2VQEL 2UXCL 4GN5A 2R92G 4IO9A 1G291 1L1OA 3AFPA 4NXNQ 1PVOA 1HNXL 4HJ9A 4LF4L 1Q12A 2JA6G 1HJPA 3TEHB 3UDGA 1HZBA 1TWHH 4LF8Q 4DR6Q 1TWGH 1BBUA 1E24A 1O7IA 1W3SA 3M4OH 3JC66 3K7AH 1Y1VG 3FKIH 4JBMA 4Y7NH 1L0WA 3RNUA 1VQOA 1VQ9A 1NE3A 4BY7G 4LUVA 2ZTDA 4DNIA 4DPGA 4B3RL 5C44H 4DR5L 4JI3Q 4JI4Q 1I5FA 1YVCA 3STBC 4B3MQ 3S1RH 3KFUA 4LF5L 1TWAH 3RLNA 3ZJYC 2E8GA 4OO1G 1XNQQ 1R9TH 1HR0W 4A3CG 1B7YB 1CKOA 1EUJA 1LYLA 3PUXA 4JI7L 2HIVA 3S17H 3AQQA 1EQQA 1AH9A 1VQ4A 2JA5H 4Y52H 3F1ZA 1PH2A 4NXML 4DR7Q 1H95A 5C0XJ 4BBRH 1QZGA 1VQ5A 1K8GA 1KRSA 4YCVA 1XPOA 1YBYA 1BKBA 3EN2A 3NBHB 5IYCH 4JI0L 3K81C 4DUYL 1VQGA 3ULPA 5IP9G 2D62A 2Z0SA 1YJ9A 4O0AA 1X54A 1VQBA 2Y0SE 2NVQH 4LFBL 1Q1BA 2YTVA 1N34Q 4GKKQ 3UDIA 2N3SA 1Q8KA 3E9IA 4R4IA 5GAGC 2QEXA 4A3LH 3UDXA 1VS0A 2R7ZG 4IOAA 4QQBX 4IFDG 2JA9A 3CPFA 2EIFA 2AWOA 4C3IH 2Q2UA 3I4MH 3PO3G 5JJKA 2GVAA 2PQAB 5JEAG 1KRTA 1TXYA 2KCMA 5IP7G 1EIYB 3I4MG 4OWWB 1VQCA 3CPWA 1YJWA 1EWIA 2ZJQA 2NN6G 4JOIC 3HOVG 2OTJA 1YI2A 1Q46A 2V1CC 1S3OA 1X55A 5IT9c 4P72A 4YY3Q 5FLMH 1W2BA 3K0XA 2UXCQ 3PSIA 2UUAQ 2VQEQ 2VQFL 1K0RA 1X3GA 1AE2A 4B3SL 4GNXA 3HOUG 2HIXA 4PZ7A 1EOVA 1HZ9A 1PH3A 2PQAA 1HNXQ 1I6HH 4LF4Q 5M5WH 2E2JH 2WAQG 4UY8C 1WOCA 1A63A 1CSPA 1SFOH 3TREA 5AJ3L 4O2DA 2JK8A 1VQHA 4DV7Q 4DR2L 1A8VA 1PH9A 1JMCA 4A3KG 2F4VL 3HOZG 3I4NG 3M7NA 4GLAC 1D7QA 2JEBI 3UDFA 3J80c 2YYZA 3PO2G 3F8TA 2NZHA 4DR5Q 3AEVA 2VY3A 5C3EH 1KQSA 3KDFB 2LXJA 3HKZG 4DR3Q 4BXXH 4LF5Q 3K80C 4JI8L 3M9BA 1J6QA 5M3MG 2YTYA 2R93G 4R4CA 2E2IH 1SROA 4XIGS 5HY6A 4JI7Q 2WFWA 1VQKA 3IRBA 1Q86C 1IXRA 1A0IA 1NBWA 1SMXA 4NXMQ 4DV1L 5DLQE 2UXBL 3ULJA 4X62L 3A74A 4LF7L 4YWMA 1V1QA 1KAWA 1WCMG 1J5EL 3GTMH 4A3MG 2F52A 5E7NA 5HGQA 4A3EH 1QVGA 4HJ7A 4JI0Q 2JEAI 1EQRA 4DUYQ 4IFDJ 1Z9FA 3DM3A 3KDFA 2N49A 3RN2A 1VQJA 1OXSC 4X65L 1YIJA 4BBSG 5JEAJ 4LFBQ 4A3GG 1E1TA 1PHJA 3HKSA 2VL6A 1B70B 3CCSA 2VZAA 4DR3L 2QGQA 4UPAA 3CMEA 2B63G 1IBLL 5C4XG 3H0GH 4PG3A 1Q81C 3JAMi 3MXNB 4YHHL 1JB7A 3S1NH 1Y1WH 2RHSB 3LGJA 2ZTCA 2C35B 2ASBA 2JA8G 4YWKA 4DV0L 4A3IH 3ERSX 2R92H 5C4JH 2DGYA 5M5XH 4MZ9A 3PCOB 3G71A 4DV7L 1K3RA 3I2ZA 4OWXB 1Q82C 1U5KA 4ALPA 1BVSA 2K50A 5M3FG 4QJFA 5IYDG 3U50C 2KHIA 2MFIA 4A4IA 4AIMA 1N36L 4BY7H 3OTOL 3AYHB 3F2BA 1YHAA 2VQFQ 1PH1A 2A19A 3S1QH 4R4TA 1VQMA 4B3SQ 1WYDA 1YHQA 4KHPL 4HIKA 2UXDL 1L1OC 4GN3B 4TVAB 5IYBG 3J81j 4QIWE 4RMFA 4JI1L 3J81i 4A75A 2ZTEA 2IX0A 2I0QA 5LMNW 2BA0A 1KC8C 5AJ3Q 4TQUS 1WI5A 5FJ8G 2F4VQ 4GOPA 1N32L 1GKHA 4DR2Q 4IPHA 3HOWH 3S1MH 4DR4L 2HHHL 4A3CH 4PMWA 4A76A 3CCMA 1I94L 1VQ7A 5C44G 2F3IA 3TRZA 1RL2A 2I5LX 1K9MC 3H15A 1XMQL 2QA4A 1X56A 2AHOB 2JE6I 4JV5L 3RLFA 4IPDA 4JI8Q 1HZAA 4KHZA 4A3JH 3KOJA 4YCUA 4BA2I 3D31A 1CSQA 1GVPA 1YZ6A 1Z47A 4J15A 4BA1I 3PUZA 5H1SE 1FL0A 2IHEA 2CWPA 2JA5G 1JT8A 4DV1Q 4LF6L 1XJVA 2UXBQ 1N33L 2XGTA 4JC0A 4X62Q 2UU9Q 4LF7Q 1J5EQ 1M1KC 2B3GA 2NVTH 5IYCG 4IPCA 2R7DA 4EQ5A 2RHQB 1MJCA 3OYYA 5IY0A 4GNXB 2NVXH 2R7ZH 3NENA 4APVA 1PH8A 4AYBE 4X65Q 4GKJL 2VUMG 2EQSA 1SRUA 1JJ2A 2VNUD 1LUZA 5IP7H 3CW2C 4LNQA 1NMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHW A;  1I50 H;  3WWV A;  1MKH A;  1NMF A;  5C0X I;  1XTD A;  5GAH C;  1MJE A;  3TS0 A;  3S15 H;  1IBL Q;  4DAM A;  3CAM A;  1MIU A;  3G4S A;  1PV4 A;  3HOV H;  4A3F G;  4K0K L;  3PF5 A;  4YHH Q;  2DUD A;  1YEZ A;  1NJI C;  1YNX A;  2XTI A;  5GAD C;  2CKZ B;  3G6E A;  3F2D A;  3CCQ A;  1QVC A;  3ICE A;  2N78 A;  2YV5 A;  1L2F A;  1SR3 A;  2PI2 A;  4DK3 C;  4DK6 C;  4YWL A;  4DV0 Q;  2K5V A;  4DV4 L;  3T1H L;  5IWA L;  1HNZ L;  4L5S A;  1JE5 A;  3TQY A;  3HOU H;  1IZ6 A;  2KEN A;  2JJQ A;  3PIO A;  2UUB L;  5BR8 L;  2Y0S G;  4POF A;  2Z6K A;  2BH2 A;  3K7U C;  1VQL A;  2EXD A;  3J7Z C;  1X65 A;  4GS3 A;  2OTL A;  3I4N H;  5FLM G;  3M3Y H;  4A3K H;  3HOZ H;  2AMC B;  2CWA A;  4H02 A;  4X64 L;  3GD7 A;  1N36 Q;  3GTG H;  2KHJ A;  1QVF A;  3OTO Q;  1T9H A;  3PO2 H;  4A3B H;  4KHP Q;  1BBW A;  1VQ6 A;  3GTO H;  3L7Z C;  1N8R C;  2K52 A;  2UXD Q;  4GNX C;  3S14 H;  3GTP H;  5GAE C;  4QY7 A;  4JI1 Q;  4DV5 L;  3BJU A;  1YJN A;  3G48 A;  2LSS A;  4RG1 A;  4X66 L;  5M3M H;  2R93 H;  1PYB A;  4LWC A;  4AYB G;  1N32 Q;  4L5T A;  4YCW A;  1SLJ A;  4DR4 Q;  3E9H A;  4OON A;  2HHH Q;  2UUC L;  2K4K A;  1AE3 A;  1Y14 B;  1VQE A;  4HIO A;  1PH7 A;  4DUZ L;  1K8A C;  1I94 Q;  4JI2 Q;  2UU9 L;  2YTX A;  1VQN A;  4UP8 A;  1Q7Y C;  3SGI A;  3VDY A;  2RF4 A;  4BXX G;  1XMQ Q;  1X3E A;  2I5M X;  4EX5 A;  3EIV A;  2JA7 G;  2K5N A;  4JV5 Q;  4UP7 A;  3I56 A;  1WCM H;  3M85 A;  3RZD H;  1PH6 A;  1B8A A;  2ZJP A;  3CD6 A;  4C2M H;  2KCT A;  1K83 H;  2FXQ A;  1E1O A;  4OO1 I;  1UE7 A;  2CFM A;  3KF8 B;  1C9O A;  3GTJ H;  4QGU A;  2NZO A;  3J7A 5;  3E0E A;  3FP9 A;  4P71 A;  4LF6 Q;  1XMO L;  4A3G H;  1N33 Q;  1E7Z A;  2CQO A;  4R1J A;  4LFC L;  4JCV E;  1FJG L;  1PH5 A;  1QUQ A;  2Q2H A;  3HOY G;  4A3E G;  1FVI A;  2K5H A;  4DV2 L;  3CF5 A;  4WJ4 A;  5C4X H;  4LFA Q;  4IJH A;  4OX9 L;  1IYJ B;  1CKN A;  4IPG A;  5J3B A;  3HOX H;  3T1Y L;  3K8A A;  4BY1 G;  1K73 C;  4GKJ Q;  1IBM L;  3RN5 A;  1GD7 A;  2I5H A;  4GOP B;  2HT1 A;  4A3D G;  1EYG A;  4LUO A;  2JA8 H;  5LMU L;  4DV6 L;  4HJ5 A;  3L0O A;  2KBN A;  5M5Y H;  1OXT A;  2ID0 A;  3CCU A;  1HR0 Q;  2MO1 A;  2JA6 H;  1X9N A;  1KHI A;  3RZO H;  4A93 G;  3H0G G;  4XTC S;  3KJO A;  1LM0 A;  2NVY H;  4K0K Q;  2K75 A;  3ULL A;  1Y1V H;  3A5U A;  3CP0 A;  3J80 i;  1I3Q H;  4JI5 L;  4MTN A;  3S16 H;  1DGS A;  4B3T L;  1WFQ A;  4IFD I;  5IYD H;  1P16 A;  1NTG A;  2H5X A;  4DV3 L;  4DV4 Q;  3T1H Q;  3TS2 A;  1HNZ Q;  5IWA Q;  1GM5 A;  3NEL A;  4R4Q A;  5FLX c;  1V9P A;  2AWN A;  2UUB Q;  1D8L A;  1VQD A;  5IYB H;  3S2D H;  5BR8 Q;  1U0L A;  1UE1 A;  1UE5 A;  3FKI G;  3CC4 A;  1JJG A;  2PNH A;  1KD1 C;  1FGU A;  3CCV A;  5FJ8 H;  1G51 A;  4JI2 L;  2NN6 I;  1VQI A;  4HJ8 A;  1PYS B;  1EFW A;  4X64 Q;  3EBE A;  3F2C A;  3RR5 A;  1OTC A;  4HIM A;  4P75 A;  1VQP A;  1CUK A;  4JBW A;  4LW1 A;  2OQ0 A;  4JYA L;  2LXK A;  3U58 A;  2E5L L;  4DV5 Q;  3CCR A;  3CCL A;  4JI6 L;  2PI2 E;  3KYH C;  2PMZ E;  1TWF H;  4X66 Q;  1VQA A;  5IP9 H;  3W1B A;  3HOW G;  2L15 A;  2MQH A;  3A5Z B;  1YHB A;  4P73 A;  4BBR G;  3CMA A;  4NB3 A;  4GOP C;  2UUC Q;  3PGZ A;  1CKM A;  3PUV A;  4L5Q A;  1HH2 P;  4DUZ Q;  3ER0 A;  2MO0 A;  1XPU A;  2N8N A;  3U4V A;  4DR1 Q;  2OCE A;  1PFS A;  1PA6 A;  3KLW A;  1M90 C;  4X6A H;  2D0O A;  2BH8 A;  3Q8D A;  5ELN A;  3L2P A;  3GTL H;  1HZC A;  4LFA L;  2ZM6 L;  4A3J G;  2Q2T A;  3PO3 H;  4GLX A;  2RCN A;  1VQF A;  2WAQ E;  2VS1 A;  1RIP A;  2AKW B;  4A3L G;  5K36 G;  5GRO A;  4R4O A;  5GQO A;  1XNR L;  3KJP A;  3W5O A;  1JJC B;  2MNA A;  4IOC A;  4C3H H;  3H3V I;  4PZ8 A;  1HR0 L;  4JOI A;  2VUM H;  3U4Z A;  5LMN L;  1XMO Q;  2IY5 B;  2IX1 A;  1IBK L;  4LFC Q;  2ALY B;  1FJG Q;  1HNW L;  1IL2 A;  4JBJ A;  3HKZ E;  5EAY A;  4LF9 L;  4GLV B;  1WJJ A;  5ELO A;  3CQZ H;  4DV2 Q;  4FDB A;  4HJA A;  4A3F H;  3PF4 A;  4OX9 Q;  4PZ6 A;  3M4Q A;  3T1Y Q;  3PUY A;  3BZK A;  1IBM Q;  4IJL A;  1E22 A;  4NXN L;  5LMU Q;  4DV6 Q;  2GN5 A;  2B29 A;  1C7Y A;  4DKA C;  2D0P A;  3NEM A;  4LF8 L;  4DR6 L;  1OXV A;  1KXL A;  4KLK A;  1OXU A;  2OQK A;  3JAM c;  3S2H H;  4AQY Q;  2BA1 A;  1PH4 A;  3CXC A;  4L5R C;  2WB1 E;  4JI5 Q;  3BZC A;  4JI3 L;  4B3T Q;  4JI4 L;  1KL9 A;  4OXP A;  1ASY A;  1QZH A;  4B3M L;  1P8L A;  1SN8 A;  1UWV A;  4DV3 Q;  4ME3 A;  3PV0 A;  4MNO A;  1LTL A;  1SE8 A;  2A1A A;  1XNQ L;  1UEB A;  2YU9 H;  2JQO A;  3I4O A;  4GN4 B;  3A0J A;  3PUW A;  3H3V H;  1S40 A;  1N9W A;  3B6Y A;  3DLL A;  1KIX A;  3D0F A;  2Z6K C;  1Q1E A;  1QUQ B;  2E2H H;  3BU2 A;  4DR7 L;  2Q2I A;  5C3E G;  4DR1 L;  1EIF A;  3CCE A;  1VQ8 A;  4JBK A;  4A3B G;  1ASZ A;  2R7F A;  3RLO A;  4B3R Q;  4KI0 A;  3HFZ B;  1CKN B;  2ZJR A;  1S72 A;  2WP8 J;  3KF6 B;  4OWT B;  4A3M H;  2OWO A;  3J81 c;  1UE6 A;  4JYA Q;  1X6O A;  2ATW A;  1E3P A;  2E5L Q;  3CCJ A;  4JI6 Q;  2JA7 H;  3S24 A;  2VW9 A;  5JJL A;  3CC2 A;  3M4P A;  5IE8 A;  5C0X G;  1N34 L;  4BBS H;  4GKK L;  4C3J H;  1GO3 E;  2GVB A;  1XPR A;  3GO5 A;  4LUZ A;  1G6P A;  1V43 A;  4HID A;  4POG A;  4WJ3 M;  4P74 A;  2B63 H;  1X3F A;  3UE1 A;  1L1O B;  2ZM6 Q;  3AFQ A;  3CC7 A;  3HOY H;  2WB1 G;  3W1G A;  1C0A A;  3KF6 A;  2IT1 A;  3I7F A;  2R6G A;  3I55 A;  1XNR Q;  4NPS A;  3UE0 A;  3PIP A;  1YIT A;  4BY1 H;  2ES2 A;  3GDE A;  2IHF A;  1A62 A;  4DAY B;  5LMN Q;  4A3D H;  5JJI A;  4UP9 A;  1IBK Q;  3STB D;  2A8V A;  4JG2 A;  4QL5 A;  1HNW Q;  4A93 H;  2HQL A;  4AH6 A;  4AQY L;  1NY4 A;  2K14 A;  1VCI A;  4LF9 Q;  3GTQ H;  1TWC H;  1Y1W G;  3MEF A;  5M3F H;  2CCZ A;  3OW2 A;  4YY3 L;  1OXX K;  4A3I G;  3GTK H;  3HOX G;  2UUA L;  2VQE L;  2UXC L;  4GN5 A;  2R92 G;  4IO9 A;  1G29 1;  1L1O A;  3AFP A;  4NXN Q;  1PVO A;  1HNX L;  4HJ9 A;  4LF4 L;  1Q12 A;  2JA6 G;  1HJP A;  3TEH B;  3UDG A;  1HZB A;  1TWH H;  4LF8 Q;  4DR6 Q;  1TWG H;  1BBU A;  1E24 A;  1O7I A;  1W3S A;  3M4O H;  3JC6 6;  3K7A H;  1Y1V G;  3FKI H;  4JBM A;  4Y7N H;  1L0W A;  3RNU A;  1VQO A;  1VQ9 A;  1NE3 A;  4BY7 G;  4LUV A;  2ZTD A;  4DNI A;  4DPG A;  4B3R L;  5C44 H;  4DR5 L;  4JI3 Q;  4JI4 Q;  1I5F A;  1YVC A;  3STB C;  4B3M Q;  3S1R H;  3KFU A;  4LF5 L;  1TWA H;  3RLN A;  3ZJY C;  2E8G A;  4OO1 G;  1XNQ Q;  1R9T H;  1HR0 W;  4A3C G;  1B7Y B;  1CKO A;  1EUJ A;  1LYL A;  3PUX A;  4JI7 L;  2HIV A;  3S17 H;  3AQQ A;  1EQQ A;  1AH9 A;  1VQ4 A;  2JA5 H;  4Y52 H;  3F1Z A;  1PH2 A;  4NXM L;  4DR7 Q;  1H95 A;  5C0X J;  4BBR H;  1QZG A;  1VQ5 A;  1K8G A;  1KRS A;  4YCV A;  1XPO A;  1YBY A;  1BKB A;  3EN2 A;  3NBH B;  5IYC H;  4JI0 L;  3K81 C;  4DUY L;  1VQG A;  3ULP A;  5IP9 G;  2D62 A;  2Z0S A;  1YJ9 A;  4O0A A;  1X54 A;  1VQB A;  2Y0S E;  2NVQ H;  4LFB L;  1Q1B A;  2YTV A;  1N34 Q;  4GKK Q;  3UDI A;  2N3S A;  1Q8K A;  3E9I A;  4R4I A;  5GAG C;  2QEX A;  4A3L H;  3UDX A;  1VS0 A;  2R7Z G;  4IOA A;  4QQB X;  4IFD G;  2JA9 A;  3CPF A;  2EIF A;  2AWO A;  4C3I H;  2Q2U A;  3I4M H;  3PO3 G;  5JJK A;  2GVA A;  2PQA B;  5JEA G;  1KRT A;  1TXY A;  2KCM A;  5IP7 G;  1EIY B;  3I4M G;  4OWW B;  1VQC A;  3CPW A;  1YJW A;  1EWI A;  2ZJQ A;  2NN6 G;  4JOI C;  3HOV G;  2OTJ A;  1YI2 A;  1Q46 A;  2V1C C;  1S3O A;  1X55 A;  5IT9 c;  4P72 A;  4YY3 Q;  5FLM H;  1W2B A;  3K0X A;  2UXC Q;  3PSI A;  2UUA Q;  2VQE Q;  2VQF L;  1K0R A;  1X3G A;  1AE2 A;  4B3S L;  4GNX A;  3HOU G;  2HIX A;  4PZ7 A;  1EOV A;  1HZ9 A;  1PH3 A;  2PQA A;  1HNX Q;  1I6H H;  4LF4 Q;  5M5W H;  2E2J H;  2WAQ G;  4UY8 C;  1WOC A;  1A63 A;  1CSP A;  1SFO H;  3TRE A;  5AJ3 L;  4O2D A;  2JK8 A;  1VQH A;  4DV7 Q;  4DR2 L;  1A8V A;  1PH9 A;  1JMC A;  4A3K G;  2F4V L;  3HOZ G;  3I4N G;  3M7N A;  4GLA C;  1D7Q A;  2JEB I;  3UDF A;  3J80 c;  2YYZ A;  3PO2 G;  3F8T A;  2NZH A;  4DR5 Q;  3AEV A;  2VY3 A;  5C3E H;  1KQS A;  3KDF B;  2LXJ A;  3HKZ G;  4DR3 Q;  4BXX H;  4LF5 Q;  3K80 C;  4JI8 L;  3M9B A;  1J6Q A;  5M3M G;  2YTY A;  2R93 G;  4R4C A;  2E2I H;  1SRO A;  4XIG S;  5HY6 A;  4JI7 Q;  2WFW A;  1VQK A;  3IRB A;  1Q86 C;  1IXR A;  1A0I A;  1NBW A;  1SMX A;  4NXM Q;  4DV1 L;  5DLQ E;  2UXB L;  3ULJ A;  4X62 L;  3A74 A;  4LF7 L;  4YWM A;  1V1Q A;  1KAW A;  1WCM G;  1J5E L;  3GTM H;  4A3M G;  2F52 A;  5E7N A;  5HGQ A;  4A3E H;  1QVG A;  4HJ7 A;  4JI0 Q;  2JEA I;  1EQR A;  4DUY Q;  4IFD J;  1Z9F A;  3DM3 A;  3KDF A;  2N49 A;  3RN2 A;  1VQJ A;  1OXS C;  4X65 L;  1YIJ A;  4BBS G;  5JEA J;  4LFB Q;  4A3G G;  1E1T A;  1PHJ A;  3HKS A;  2VL6 A;  1B70 B;  3CCS A;  2VZA A;  4DR3 L;  2QGQ A;  4UPA A;  3CME A;  2B63 G;  1IBL L;  5C4X G;  3H0G H;  4PG3 A;  1Q81 C;  3JAM i;  3MXN B;  4YHH L;  1JB7 A;  3S1N H;  1Y1W H;  2RHS B;  3LGJ A;  2ZTC A;  2C35 B;  2ASB A;  2JA8 G;  4YWK A;  4DV0 L;  4A3I H;  3ERS X;  2R92 H;  5C4J H;  2DGY A;  5M5X H;  4MZ9 A;  3PCO B;  3G71 A;  4DV7 L;  1K3R A;  3I2Z A;  4OWX B;  1Q82 C;  1U5K A;  4ALP A;  1BVS A;  2K50 A;  5M3F G;  4QJF A;  5IYD G;  3U50 C;  2KHI A;  2MFI A;  4A4I A;  4AIM A;  1N36 L;  4BY7 H;  3OTO L;  3AYH B;  3F2B A;  1YHA A;  2VQF Q;  1PH1 A;  2A19 A;  3S1Q H;  4R4T A;  1VQM A;  4B3S Q;  1WYD A;  1YHQ A;  4KHP L;  4HIK A;  2UXD L;  1L1O C;  4GN3 B;  4TVA B;  5IYB G;  3J81 j;  4QIW E;  4RMF A;  4JI1 L;  3J81 i;  4A75 A;  2ZTE A;  2IX0 A;  2I0Q A;  5LMN W;  2BA0 A;  1KC8 C;  5AJ3 Q;  4TQU S;  1WI5 A;  5FJ8 G;  2F4V Q;  4GOP A;  1N32 L;  1GKH A;  4DR2 Q;  4IPH A;  3HOW H;  3S1M H;  4DR4 L;  2HHH L;  4A3C H;  4PMW A;  4A76 A;  3CCM A;  1I94 L;  1VQ7 A;  5C44 G;  2F3I A;  3TRZ A;  1RL2 A;  2I5L X;  1K9M C;  3H15 A;  1XMQ L;  2QA4 A;  1X56 A;  2AHO B;  2JE6 I;  4JV5 L;  3RLF A;  4IPD A;  4JI8 Q;  1HZA A;  4KHZ A;  4A3J H;  3KOJ A;  4YCU A;  4BA2 I;  3D31 A;  1CSQ A;  1GVP A;  1YZ6 A;  1Z47 A;  4J15 A;  4BA1 I;  3PUZ A;  5H1S E;  1FL0 A;  2IHE A;  2CWP A;  2JA5 G;  1JT8 A;  4DV1 Q;  4LF6 L;  1XJV A;  2UXB Q;  1N33 L;  2XGT A;  4JC0 A;  4X62 Q;  2UU9 Q;  4LF7 Q;  1J5E Q;  1M1K C;  2B3G A;  2NVT H;  5IYC G;  4IPC A;  2R7D A;  4EQ5 A;  2RHQ B;  1MJC A;  3OYY A;  5IY0 A;  4GNX B;  2NVX H;  2R7Z H;  3NEN A;  4APV A;  1PH8 A;  4AYB E;  4X65 Q;  4GKJ L;  2VUM G;  2EQS A;  1SRU A;  1JJ2 A;  2VNU D;  1LUZ A;  5IP7 H;  3CW2 C;  4LNQ A;  1NMG A; 
#chains in the Genus database with same CATH topology
 3WWV A;  4B9X A;  2SCU B;  2AGQ A;  1NMF A;  1LV9 A;  5C0X I;  1XTD A;  3BG3 A;  2NN6 H;  3TS0 A;  1LT4 D;  4K0K L;  4DF7 A;  4C3I G;  5KFM A;  1WTP A;  2L12 A;  4MTK A;  3C3L A;  1YNX A;  3G6E A;  3CCQ A;  2CKZ B;  3ICE A;  1ENC A;  4DV4 L;  2PMZ A;  2K5V A;  2R8K A;  1KC7 A;  3R5X A;  2F0H A;  3GP7 A;  2UUB L;  5FOB B;  5BR8 L;  4POF A;  3HBL A;  3GTP B;  2E2I B;  1X65 A;  4GS3 A;  2OTL A;  4HNU A;  1AEX A;  2GLT A;  2W6P A;  1N36 Q;  4HMJ A;  4NKL A;  4J0M A;  4IAJ A;  1SFO A;  1T9H A;  4ECQ A;  4A3B H;  2C28 A;  2YZM A;  1N32 H;  2I8C A;  2SNM A;  1O78 A;  4RAU C;  3S14 H;  2B2V A;  4JI1 Q;  3K5N A;  1YJN A;  2RDJ A;  1SYG A;  5I9O A;  3OMC A;  3V4Z A;  2B2W A;  2K5D A;  4LWC A;  4HQ6 A;  2F0G A;  4YCW A;  1RK6 A;  3N8D A;  2HHH Q;  1JR0 D;  2K4K A;  4L8J A;  2Q8T A;  5C0X H;  2XCL A;  1K8A C;  1U4P A;  3HKZ A;  1AUX A;  3SGI A;  1WSC A;  2I5M X;  4J1M A;  2VQD A;  1QCB D;  4EX5 A;  4EQP A;  5FK9 C;  3M85 A;  1CT1 D;  1WCM H;  1KJI A;  2R7K A;  4CHT B;  5DG9 A;  4JV2 A;  2J6T A;  1RYR A;  2IWH A;  4CKC A;  3IFT A;  1XWE A;  4OGQ C;  3JAM L;  4OO1 I;  3GTM A;  4DL2 A;  3R2T A;  2RSO A;  4P71 A;  4A3I B;  3HOX B;  1XMO L;  4A3G H;  1N33 Q;  1E7Z A;  5E4W C;  2R92 B;  3LWU A;  4LFC L;  4JCV E;  4CDC C;  2BQU A;  1GOZ A;  2Q2H A;  4NW2 A;  1FVI A;  2PNR C;  2K5H A;  1RF2 D;  2R87 A;  4DV2 L;  1K83 A;  5C4X H;  4IJH A;  2NUC A;  4OX9 L;  1HR0 H;  4MV9 A;  3T1Y L;  2N55 A;  4BY1 G;  4GKJ Q;  3RN5 A;  3GQC A;  4NLG A;  4BY7 B;  1I3Q B;  2JA8 H;  1SE4 A;  2A69 D;  4HJ5 A;  1QNU A;  5LOV F;  3J80 L;  2KBN A;  3CCU A;  2MO1 A;  1X9N A;  2O5J C;  5CV6 A;  2NVY H;  1KJ9 A;  1MZB A;  3T1H H;  1MSG A;  5E1F A;  3VR4 A;  3S2D B;  3EPG A;  4MHE A;  1S0M A;  1DGS A;  2XSC A;  4U6P A;  4EGV A;  2JA6 A;  5JH7 F;  1HNZ Q;  1GM5 A;  1ZYR C;  3NEL A;  5BN5 A;  5JVH 3;  4V19 0;  4RB3 C;  1UE1 A;  4CBV A;  3FKI G;  3CC4 A;  2OT2 A;  1D1K A;  4CJ0 B;  3MWE A;  4F50 A;  3GIK A;  4FVM A;  2EJG C;  1UNS A;  1PYS B;  2BCO A;  4HJ8 A;  4DV5 H;  5FKA C;  4Z9C B;  2AQ3 B;  1LTB D;  4JBW A;  4MAM A;  3JZI A;  2LXK A;  4ID6 A;  3TDQ A;  1BXR A;  3CCL A;  4DUZ H;  3KHR A;  5KFC A;  4X66 Q;  3M9O B;  4FS2 A;  2FLP A;  1VQA A;  3W1B A;  4ECR A;  1BNC A;  3N41 B;  3PW5 A;  3I3C A;  3BZD B;  2NUA B;  1FD7 D;  3MFI A;  4JV0 A;  3LNN A;  2FK3 A;  2DLN A;  1XPU A;  4O42 A;  2KED A;  1BCP D;  5TSS A;  3Q8D A;  3SK5 A;  2PO4 A;  1F2L A;  1TY2 A;  3PO3 H;  1UC9 A;  1N34 H;  3VR5 A;  1VQF A;  4ZRZ A;  4A3L G;  2A5H A;  1EY8 A;  4CJ1 B;  3KJP A;  3W5O A;  1JJC B;  4IOC A;  4G4K A;  4C3H H;  3H3V I;  4HR7 A;  4ULL A;  1HR0 L;  2VUM H;  4BWS C;  3U4Z A;  2F0U A;  4R9W A;  5LMN L;  4EYI B;  5G3L F;  2IX1 A;  1S97 A;  4G7H C;  4KY7 A;  4LF9 L;  1VDZ A;  1ENA A;  4GLV B;  1WJJ A;  5ELO A;  3CQZ H;  5I2X A;  2L11 A;  4DV6 H;  4FDB A;  4BS9 A;  4A3F H;  2B2T C;  4KMU C;  4DNT B;  1I50 A;  3OHA A;  1M0T A;  4I7A A;  1IBM Q;  4NXN L;  1BCP C;  5JQW A;  1XTC D;  4RA8 A;  3BG5 A;  5LMU Q;  4AQY H;  1C7Y A;  1H9R A;  1LT5 D;  3NEM A;  1KXL A;  4B3T H;  2UXC H;  2PZW A;  3Q8S B;  5COR A;  1KDA A;  3JRW A;  3GQB A;  1PH4 A;  3CXC A;  5KYI A;  4YAK B;  4XT1 B;  4JI5 Q;  2F0I A;  1H9S B;  1S68 A;  1QZH A;  1Z2N X;  4UCS A;  4DV3 Q;  4ME3 A;  3RB0 A;  3NSW A;  3PV0 A;  3SE0 A;  4MNO A;  1SE8 A;  2NU8 B;  1UEB A;  1Q3L A;  2DY7 A;  4GN4 B;  1WCM B;  3H3V H;  3GTG A;  4DGZ A;  4A3M B;  1UUP A;  3AU7 A;  3N40 P;  2IP4 A;  2Z6K C;  4UCV A;  1QUQ B;  3GTO A;  1ZQ7 A;  2Q2I A;  2R7M A;  4N8X 1;  3CCE A;  3WO1 A;  1ASZ A;  4BBS B;  4Q5V A;  4C3J B;  2BE5 C;  4A3G B;  4O3S A;  1LTA D;  1X6O A;  2ATW A;  2JA7 H;  1B33 N;  3BYY B;  5JJL A;  3CC2 A;  1HTP A;  3Q1K A;  3M4P A;  5C4X B;  3OWE B;  2C2E A;  1GLV A;  2YS6 A;  1XXG A;  1N34 L;  1F9S A;  3I72 A;  5IGC A;  4KN4 C;  4JI0 H;  2JA8 B;  4LUZ A;  4RB1 A;  1G6P A;  2C5C A;  3BVM A;  4IUT A;  4POG A;  1XNR H;  4KY6 A;  2ZM6 Q;  3WDN A;  3CC7 A;  3E5S A;  2EYO A;  3KF6 A;  1SNQ A;  3I7F A;  2VOB A;  1RYS A;  1HNW H;  4YR0 A;  2PVP A;  2X6G A;  3UE0 A;  2ES2 A;  1I7N A;  2DZD A;  3A7A B;  4QUF A;  2IHF A;  4A3D H;  2WDT A;  3QFF A;  3OMG A;  2RKS A;  3STB D;  2W9C A;  4JG2 A;  5KEE A;  3GTQ H;  4AQY L;  5KFS A;  3FPP A;  1VCI A;  1TWC H;  1AP0 A;  2CCZ A;  3M9N B;  4A3I G;  5I9P A;  3S9W A;  3HOX G;  3GTK H;  2UXC L;  3D4D A;  3N44 B;  4DR6 H;  4GN5 A;  4G57 A;  2R92 G;  4Y7N B;  5CA1 F;  1EQV A;  2G5D A;  4ED3 A;  1NSN S;  1Z6H A;  5C44 B;  1GSO A;  4HJ9 A;  4LF8 Q;  1BBU A;  1TWA B;  4JI4 H;  1O7I A;  2Z8L A;  2FJZ A;  3M4O H;  3JAM E;  4B3M H;  4CC6 A;  4ZK9 B;  3RNU A;  1VQ9 A;  4OIJ A;  4BY7 G;  1NE3 A;  1ILP A;  1EHI A;  2BQR A;  5IT9 E;  4EFB A;  3IG0 A;  1W6K A;  3STB C;  3KFU A;  2YS7 A;  1TU2 B;  4LF5 L;  3V4S A;  1PRT B;  2E8G A;  4LJZ C;  3PUX A;  1EUJ A;  4JVZ A;  3TP6 A;  2FK1 A;  2P5Z X;  1KBL A;  2QEJ C;  1L0Y B;  3NTK A;  2IL8 A;  4Y52 H;  3F1Z A;  1H95 A;  4DR7 Q;  3JRX A;  1LTG D;  3J80 E;  2F0K A;  3MWM A;  3GV5 B;  1HQR D;  1SNO A;  4C3H B;  1H9K A;  1KRS A;  2VUM B;  2E75 C;  4YCV A;  1YBY A;  2MP1 A;  3EN2 A;  3NBH B;  1DCZ A;  4JI0 L;  5KNB A;  4UCU A;  3KHG A;  3K81 C;  2V59 A;  2VB3 X;  1VQG A;  4DL3 A;  3VPD A;  2UVV A;  5IP9 G;  1X54 A;  2YZN A;  1VQB A;  4A3F B;  1HUN A;  5K36 H;  4WOR A;  4GKK Q;  1J5E H;  4KKU A;  4IUV A;  4O3Q A;  4RCO A;  2DPJ A;  3E9I A;  2NTT A;  1EZ1 A;  4IFD G;  2JA9 A;  2HJW A;  3SK4 A;  3CPF A;  4J9M A;  4C3I H;  2K32 A;  3MA2 B;  1JCK B;  5JJK A;  2RQX A;  2Y0S B;  5JEA G;  1S5B D;  2RDI A;  1SEB D;  4QIW A;  1KRT A;  1TXY A;  4DR3 H;  4ME5 A;  5KND A;  2KCM A;  1EIY B;  1SDF A;  3CPW A;  1CQI B;  3JSL A;  4J9S A;  2ZJQ A;  2NN6 G;  3RB6 A;  2F0T A;  5I6Y A;  2DPI A;  1H9M A;  4RCN A;  1G91 A;  1X55 A;  4YJ3 F;  5IT9 c;  5KFF A;  1HNX H;  4YY3 Q;  1W2B A;  2V4D A;  4AYB B;  1DIK A;  2VQF L;  1K0R A;  1X3G A;  4B3S L;  4DV7 H;  1EOV A;  2DWC A;  1EEI D;  5IOC A;  2R8H A;  3MWY W;  4O2D A;  2F4V L;  2JA7 B;  1EIH A;  1A8V A;  4WD3 A;  1J8I A;  2B8F A;  1KJJ A;  3UDF A;  3J80 c;  3E6Z X;  4FF1 A;  1PTO D;  5D1O B;  1DM0 B;  1EY0 A;  1WTO A;  3AEV A;  5KIX A;  2V9W A;  3V6J A;  2B2Y C;  3TP8 A;  2EYM A;  2E74 C;  3M9B A;  2YTY A;  3PIP 3;  1CM9 A;  2HHH H;  4NXM H;  5D3D A;  4JI7 Q;  1IOV A;  4A3E B;  3J7A V;  3RJ0 A;  2UVR A;  1IXR A;  2M00 A;  1NBW A;  4IUN A;  4U67 3;  2UXB L;  4DUY H;  4LF7 L;  1KAW A;  2E2I A;  1WCM G;  1O7L A;  1J5E L;  4ZCK A;  4A3D B;  4A3M G;  4C5B A;  4TV9 F;  4HJ7 A;  5ELF A;  1EQR A;  4IFD J;  3GTQ B;  2K03 A;  3KDF A;  5KKN B;  1TWC B;  1OXS C;  2C22 A;  1N33 H;  4BBS G;  5JEA J;  4C3J G;  4A3G G;  1PHJ A;  3U9T A;  2LS0 1;  3QO2 A;  1STE A;  3HKS A;  3CCS A;  3DXJ C;  2VZA A;  4DR3 L;  2QGQ A;  1KLU D;  1ICF B;  3C2P A;  2ZDQ A;  1DD2 A;  2F0S A;  5C4X G;  1Q81 C;  4PG3 A;  3MXN B;  1WTV A;  3URY A;  1RJQ A;  1Y1W H;  3LGJ A;  3M4Y A;  3FMA A;  3KUP A;  2ASB A;  2JA8 G;  1EEF D;  2C9O A;  1HUM A;  3OOC A;  5C4J H;  1O75 A;  5C8Y F;  2EOT A;  4MZ9 A;  4DV7 L;  4OWX B;  4CDF C;  1XDN A;  1U5K A;  3BYT B;  5HV6 A;  4H7B A;  3U50 C;  2KHI A;  1N36 L;  1D2B A;  3HOW B;  3AYH B;  3F2B A;  1GUO A;  1PH1 A;  2A19 A;  2F0P A;  1VQM A;  3MWD A;  2B2U C;  2AQ2 B;  4GN3 B;  4TVA B;  2EJM A;  2EDG A;  3J81 j;  2HUG A;  4JI1 L;  1XYI A;  3TP5 A;  2BA0 A;  5F9L A;  3CRL C;  1KC8 C;  5EBC A;  1STN A;  2W7O A;  1EZ8 A;  1CTM A;  1GKH A;  2EY2 A;  4DR2 Q;  1SYX B;  2FK2 A;  2HHH L;  3G6Y A;  1F9Q A;  4A3J B;  5ISR A;  3NK9 A;  4PMW A;  4A76 A;  1F2M A;  4JI8 H;  2K28 A;  1VQ7 A;  5C44 G;  2I5L X;  1PFB A;  2BOS A;  3NP8 A;  4X66 H;  1BCP B;  1STY A;  4DV1 H;  2MHV A;  1S9F A;  4J9O A;  4YCU A;  2UU9 H;  1PRT F;  5H1S E;  4BA1 I;  4A3L H;  2JA5 G;  4RNN A;  2CWP A;  2ICE C;  2EY6 A;  3ITP A;  3SI8 A;  1IW7 D;  1N33 L;  1JWM D;  4X62 Q;  3M7G A;  1QOH A;  1KDC A;  1M1K C;  3NQI A;  1TS4 A;  4Q43 A;  1MJC A;  2R7Z H;  2NVX H;  4ED2 A;  2AGO A;  1JOO A;  1WTH A;  2HCC A;  4L63 B;  4AYB E;  4C3H G;  4X65 Q;  4GKJ L;  2VUM G;  2PCF B;  2RA4 A;  3IFD A;  2AUJ D;  1LUZ A;  5IP7 H;  5KT5 A;  3CW2 C;  1CQV A;  5A2Q L;  1NMG A;  3I4M H;  3Q24 A;  4J6H A;  4EEY A;  1F9R A;  3K0Y A;  2QYZ A;  5GAH C;  1IBL Q;  4DAM A;  3CAM A;  1MIU A;  3TSS A;  3G4S A;  4A3F G;  1LTS D;  1VBG A;  4ILW A;  3F2D A;  3LP8 A;  3OSN A;  2W6Q A;  1QVC A;  4DV0 Q;  1A2T A;  1HNZ L;  1O80 A;  1JWU D;  3SEB A;  4KK7 A;  1AZQ A;  1DON A;  1K8M A;  3T53 B;  1Z7T A;  2Y0S G;  3OTO H;  1JDB B;  3K7U C;  2X6L A;  4KHP H;  5BN4 A;  2EXD A;  2XC9 A;  3HOZ H;  3GD7 A;  2QKI C;  2KHJ A;  2YL2 A;  2UXD Q;  3A54 A;  2CW0 C;  2K52 A;  4JK1 C;  5EPJ A;  4GNX C;  1JWS D;  3GTP H;  3T13 A;  3BJU A;  4NMZ A;  4JI2 H;  2LSS A;  4RG1 A;  4X66 L;  2R93 H;  1PYB A;  2W9A A;  4AYB G;  3DF7 A;  1SLJ A;  4DR4 Q;  2V58 A;  1ZXT A;  4OON A;  5KNC A;  1QIL A;  2CHB D;  1PTO H;  2NBF A;  1VQE A;  2UU9 L;  3U9O A;  1Q7Y C;  4IR9 A;  2RF4 A;  1XMQ Q;  2K05 A;  4O1N A;  1X3E A;  1I6U A;  2JA7 G;  2K5N A;  2OF1 A;  3RZD H;  2O5I C;  2ICI A;  4JV5 Q;  3UI2 A;  4RNM A;  4LF6 H;  3CD6 A;  4C2M H;  1HA6 A;  3N42 B;  4XYL B;  3H4D A;  3Q8R B;  1Y1W B;  2Z4I A;  3KF8 B;  3GTJ H;  2YCH A;  3E0E A;  3FP9 A;  3RIZ A;  5CV5 A;  3K5M A;  4LFA H;  4R1J A;  1OO9 B;  1QUQ A;  2R8I A;  5ELD A;  4KY5 A;  4A3E G;  3GLK A;  1E4E B;  2R8G A;  1C3O A;  2A73 B;  2JSO A;  4WJ4 A;  4MV6 A;  1PYW D;  3OIP A;  1IYJ B;  3HB9 A;  3HOX H;  3K8A A;  5LHY 1;  1K73 C;  1Y1V B;  1IBM L;  1TVX A;  4A3D G;  1EYG A;  2ZJT A;  5LMU L;  4K2K A;  1ESR A;  3ERO A;  1MD2 D;  2ID0 A;  5JVG 3;  3BAA A;  1KHI A;  3H0G G;  1HRJ A;  4XTC S;  3TII A;  4J9L A;  1VMP A;  4ZOL F;  3A5U A;  4RZQ A;  3E3X A;  1I3Q H;  4JI5 L;  4XX0 B;  3S16 H;  2AQ1 B;  4IFD I;  1GSH A;  4ECU A;  4LF8 H;  4DV3 L;  4IWX A;  1SXT A;  4WRD A;  5IWA Q;  4K5W A;  5FLX c;  3VYS A;  5J22 A;  2NVY A;  2XCP A;  3BAB A;  3S2D H;  4R7R A;  2G9D A;  1JJG A;  1UE5 A;  1JOR A;  2EPB A;  2VR1 A;  4RWS C;  4MV1 A;  1RCV D;  1KTK A;  2F4I A;  4JI2 L;  2NN6 I;  3OWF A;  5KFY A;  4X64 Q;  2JXM B;  3EBE A;  3F2C A;  2B8G A;  1W6J A;  1VQP A;  3E0J A;  4X3T A;  4XXE A;  3M9M B;  1LO5 D;  3RAX A;  2DY8 A;  2PI2 E;  4DR7 H;  1TWF H;  5FD5 A;  1AW7 A;  2R7Z B;  3WOF A;  1QB5 D;  2NVX B;  5IP9 H;  3GTL B;  3HOW G;  4ZQI A;  4DR1 H;  2EJF C;  4RGM A;  3A5Z B;  2UUC Q;  2RDG A;  4GOP C;  2F0W A;  3N52 A;  3AMU A;  2MO0 A;  4RHR A;  3U4V A;  3KTM A;  2OCE A;  4ZYS A;  2ZXP A;  3KLW A;  1S0N A;  3I4M B;  1JQY D;  3J7A K;  3L2P A;  3OSP A;  4IFD H;  4LFA L;  2ZM6 L;  4A3J G;  3C46 A;  4GKK H;  1XMO H;  5LYJ F;  4ED0 A;  1BCP F;  3PIO 3;  5K36 G;  1RIP A;  5JEA H;  2CZG A;  4LFC H;  1G2S A;  3CKI B;  2IW3 A;  3TME A;  1GUW A;  4DV2 H;  1KEE A;  5F9N A;  3H20 A;  3P75 A;  5KFN A;  1HCZ A;  3PW7 A;  3PR5 B;  2K33 A;  4OX9 H;  2ALY B;  1FJG Q;  3T1Y H;  3W2D A;  2F0L A;  5FPO A;  3HS0 C;  3K5H A;  3BA8 A;  1SNP A;  3PF4 A;  1LAC A;  4PZ6 A;  2OEO A;  2KSW A;  2W9B A;  2RBM A;  3HOZ B;  1EUD B;  1C30 A;  4IJL A;  1WTQ A;  2GN5 A;  4I65 A;  5EOY A;  4DKA C;  2D0P A;  2F03 A;  4LF8 L;  3CQZ A;  1OXV A;  1IYV A;  5BN3 A;  4YY3 H;  1K1S A;  4TQS A;  2OQK A;  2R93 B;  3S2H H;  2BA1 A;  4V0B A;  1NCV A;  4H13 C;  2WB1 E;  2BR0 A;  2J0T D;  5IYZ F;  1PTO B;  4OXP A;  1ASY A;  1S10 A;  2WAQ A;  1PLF A;  4DK0 A;  2FLL A;  1DJR D;  3JAM W;  2Y0S A;  2JQO A;  4J9N A;  3RZD B;  5KFW A;  4DXG A;  3KHL A;  1N9W A;  1KNA A;  3DLL A;  1KIX A;  4B3R H;  1SYC A;  1Q1E A;  4HCE A;  4C2M B;  4Q8F A;  3DM1 A;  4ECS A;  4DR7 L;  5A2Q E;  1K3B C;  4DR1 L;  5I2Y A;  3GTJ B;  1EIF A;  1VQ8 A;  5KG7 A;  3RAQ A;  2K5Q A;  3IAY A;  4KI0 A;  3HFZ B;  1CKN B;  2K01 A;  2ZJR A;  2YRW A;  3PW4 A;  2WP8 J;  4A3M H;  2OWO A;  1OWT A;  3J81 c;  1VF5 C;  1UE6 A;  4JYA Q;  5LXT F;  1B6S A;  3EPI A;  2E5L Q;  4JI6 Q;  5DQH A;  3MFY A;  2V4Q A;  2B2V C;  1SEI A;  1EOT A;  5IE8 A;  4IN3 A;  1DYQ A;  2B2W C;  2F0M A;  4BBS H;  4GKK L;  4RZR A;  4DFA A;  4C3J H;  2XIG A;  5IT9 L;  1JIC A;  4KD4 A;  2FMA A;  3RBE A;  5KFJ A;  1GJX A;  5LP6 F;  2JA7 A;  2XWB B;  3D6W A;  1ZYR D;  1V43 A;  1JIH A;  3D4R A;  2DIK A;  1X3F A;  3UE1 A;  2W8L A;  4F87 A;  5D1O A;  3SE7 A;  5ELC A;  4U7C A;  1LTT D;  2RCF A;  2SOB A;  2WB1 G;  5LMN H;  3IN5 A;  4P2C B;  5DLF A;  2IT1 A;  1A3U A;  2IA6 A;  2SEB D;  2W6M A;  3S16 B;  4RU9 A;  3PIP A;  4LF9 H;  4Q0F A;  1ET9 A;  5JJI A;  1A62 A;  1R4P B;  5DGA A;  1IBK Q;  5FO7 B;  4A93 H;  2HQL A;  1NY4 A;  2K14 A;  4NXN H;  1Y1W G;  3MEF A;  4QUC A;  3MXG A;  2XGP A;  1TWG B;  1AN8 A;  4YY3 L;  1RDP D;  1OXX K;  1SYF A;  2A6E C;  4ED1 A;  1EIG A;  4LMQ D;  1L1O A;  4IO9 A;  3I90 A;  3GTQ A;  1HFG A;  1YNN C;  1Q12 A;  2K1B A;  3K3P A;  3V6K A;  3UDG A;  1TWH H;  3HP3 A;  3A56 A;  3D8G A;  3WNZ A;  3GTK A;  3JC6 6;  4DL7 A;  1TWF B;  4DAY A;  1Y1V G;  3BDC A;  1B50 A;  4Y7N H;  1L0W A;  1VQO A;  3NWS A;  3ORR A;  1TS2 A;  4DNI A;  4B3R L;  5C44 H;  4JI3 Q;  5FPR A;  4J9R A;  4IRD A;  1YVC A;  2EZV A;  5C4Z A;  3FDT A;  3MXN A;  1TWA H;  3RLN A;  4DR2 H;  1R9T H;  4WJW A;  4OEL B;  1JE4 A;  2K04 A;  3KHH A;  1HR0 W;  2CVR A;  4S3S A;  1B1Z A;  5DNF A;  4JI7 L;  3AQQ A;  1J9O A;  2JA5 H;  1AFP A;  1PH2 A;  5KX5 F;  4RB0 A;  2JEG A;  3GV7 B;  3F8N A;  2ATL A;  1QNK A;  3QIA A;  3NWT A;  3EQL C;  4PQX A;  5KYL A;  2A68 D;  1NUC A;  3OUU A;  3ULP A;  3G6J B;  4O0A A;  3DUZ A;  2PN1 A;  4MIU A;  3VR2 A;  2NVQ H;  2YTV A;  3DMU A;  3TP7 A;  1CI3 M;  2N3S A;  5J2T F;  4R4I A;  4EEQ A;  4LAA A;  2QEX A;  1VS0 A;  2PPB C;  2R7Z G;  3A8I E;  4IOA A;  1AN7 A;  2A74 C;  1C8C A;  4TUY F;  2EIF A;  3O13 A;  4XQN A;  1STB A;  4DA2 A;  3S2H B;  1HFN A;  3T5K A;  2X69 A;  4FF4 A;  3VPC A;  1EYC A;  5IP7 G;  2F0N A;  1EFI D;  1EY4 A;  4OWW B;  3I4M G;  1CS0 A;  4YBZ B;  2A68 C;  3MEH A;  1EWI A;  1YJW A;  5JVD F;  4ZQ3 A;  2WII B;  5T14 A;  1CQF A;  2BE5 D;  4JPB W;  3NXW A;  4L6T B;  2OTJ A;  4YJ2 F;  4JV1 A;  4K8I A;  2R6F A;  2E2J B;  1S3O A;  1SYD A;  5C5J A;  2W70 A;  2I87 A;  2I46 A;  4MV7 A;  2UUA Q;  1B9M A;  2VQE Q;  3V2T A;  4IRK A;  1AE2 A;  1EWC A;  5I47 A;  5DGB A;  3CRK C;  2PQA A;  1FR3 A;  1KJ8 A;  4O3R A;  5F2D A;  4LF4 Q;  2EXZ A;  5M5W H;  3KAJ A;  1WOC A;  1SFO H;  1RD9 D;  4JW0 A;  4DR2 L;  3HOZ G;  3M7N A;  4GLA C;  4LF5 H;  1D5X C;  2XGQ A;  2F0F A;  2YYZ A;  3PQI A;  2XNA C;  5KT2 A;  3F8T A;  1T36 A;  5DM6 3;  4DR5 Q;  2CW7 A;  4IRC A;  5C3E H;  1KQS A;  2PBZ A;  3VA7 A;  4DXF A;  4EQO A;  5KG4 A;  4OL7 A;  3GIM A;  1PTO F;  1J6Q A;  1KDB A;  2R93 G;  3N6R A;  4ZKB B;  3QOJ A;  4K6L A;  2HVQ A;  1SRO A;  5HY6 A;  2XRS D;  2R84 A;  4L1K A;  3KAK A;  2WFW A;  2O2L D;  3F2U A;  3IRB A;  3T16 A;  1Q86 C;  1VQK A;  4GZY C;  2R7L A;  1XMQ H;  3TIG A;  3ULJ A;  4X62 L;  1A2U A;  1SCU B;  3GTM H;  2F52 A;  5E7N A;  5BPF A;  4A3E H;  2JEA I;  2F0E A;  4A93 B;  1Z9F A;  4K2L A;  3RN2 A;  4XT3 B;  1Z2O X;  1CA6 A;  1VQJ A;  3TIN A;  1GHJ A;  4X65 L;  5DEH A;  5AFW A;  1BOS A;  2F3V A;  5CB4 F;  2Z9H A;  2IPK D;  4QWC A;  2I07 B;  4FXK C;  2VPQ A;  2B63 G;  1IBL L;  3H0G H;  1TWH B;  3JAM i;  4ETS A;  3Q8P B;  1KAA A;  1JB7 A;  1O7Y A;  2MUY A;  2RHS B;  3ETH A;  1ML0 D;  3TZU A;  4DV0 L;  3ERS X;  1EY5 A;  2DGY A;  1D6E C;  2W6Z A;  5K2M A;  4MTE A;  3I2Z A;  1R9T B;  1Q82 C;  2VQF H;  4ALP A;  4B3S H;  4ZUI A;  5KRU A;  1A3V A;  3EFX D;  4Q44 A;  2HGS A;  1KJQ A;  1VAJ A;  1A3T A;  3MFG A;  4AIM A;  1MI2 A;  4ED8 A;  3S1M B;  2JA5 B;  1YHA A;  3SR1 A;  1B53 A;  5CV8 A;  5C4H A;  3S1Q H;  2F4V H;  2UXD L;  4EBD A;  2KQ3 A;  4RAY A;  3FKI A;  2JEJ A;  3K3V A;  4A75 A;  3KBX A;  5EKI A;  5KG6 A;  2I0Q A;  3K58 A;  2M9V A;  4DR4 L;  3HOW H;  4A3C H;  1LTI D;  1V1P B;  3CCM A;  4M9U A;  4HSV A;  2NVQ B;  5KFI A;  2VA2 A;  1HPC A;  2UVU A;  2L55 A;  4HED A;  3R5H A;  1MBY A;  1XMQ L;  4TKO B;  4FO2 A;  1X56 A;  2AHO B;  2F1M A;  4KJN A;  4IPD A;  4JV5 L;  5CBA E;  1HZA A;  4KHZ A;  4DL6 A;  1SNC A;  4A3J H;  4UCT A;  2UXB H;  5KFK A;  3KOJ A;  4BA2 I;  4LF7 H;  1CSQ A;  4FBT A;  1YZ6 A;  1Z47 A;  5DAU A;  2IHE A;  3NBI A;  2CQA A;  4O4I F;  4DNR B;  1R4Q B;  2HCI A;  4R8N A;  1I4G A;  3MC0 B;  2B3G A;  5IYC G;  1SBB B;  4IPC A;  3NPP A;  5FLX L;  3RGX A;  1NR4 A;  2PMZ B;  3DWQ A;  3NEN A;  3PW0 A;  5CR3 A;  2W71 A;  4R8U A;  1ROD A;  1CK1 A;  2EQS A;  1DOM A;  1JJ2 A;  2JP1 A;  1Y8P B;  3QOL A;  1B44 D;  2R7Z A;  2NVX A;  1I50 H;  3CHB D;  4QB4 A;  1MKH A;  2K7V A;  1TT2 A;  4MN3 A;  3LWE A;  5M5W B;  1PX2 A;  2W6O A;  3T5L A;  1SFO B;  2D5D A;  1CQJ B;  4RUC A;  4A2A A;  3PF5 A;  2H1E A;  4YHH Q;  2DUD A;  5HGT A;  2EYH A;  2XTI A;  2ZT9 C;  1BGW A;  3RB4 A;  3G7L A;  1KNE A;  2N78 A;  4RAZ A;  1SR3 A;  4DK6 C;  1C48 A;  3EVQ A;  5IWA L;  5C3E B;  3ERQ A;  3RUZ A;  2KEN A;  2JJQ A;  3PIO A;  1N36 H;  2GA4 B;  2QIL A;  4HCS A;  5KFX A;  2BH2 A;  1PMR A;  1VQL A;  3J7Z C;  4KJO A;  1DXM A;  1TII D;  5ELB A;  5FLM G;  3M3Y H;  3VMM A;  4I7H A;  4JI1 H;  1L0X B;  4X64 L;  3GTG H;  5JOB A;  1QVF A;  1HQM C;  3D4W A;  3PO2 H;  5CBE E;  1BBW A;  1VQ6 A;  3GTO H;  3L7Z C;  5KFB A;  2P0A A;  2WKD A;  3GTM B;  1EY9 A;  2C2D A;  3G8C A;  3MXU A;  3NQT A;  1N32 Q;  2F3W A;  4ZUJ A;  5HBR B;  1WTW A;  2F0J A;  4ZKC B;  2FMC A;  2UUC L;  1AE3 A;  3UFX B;  1BDO A;  1I94 Q;  4YB8 B;  1K83 B;  1VQN A;  1KAB A;  3GTP A;  4FM9 A;  1KLG D;  1STG A;  4JYA H;  2E5L H;  1BJT A;  3GIL A;  3RMH A;  3L3O C;  5C6A A;  3R5F A;  3EIV A;  4QMG A;  4UP7 A;  1PH6 A;  2K5W A;  2NYZ D;  5L9X A;  2L5T A;  3H0G B;  2ZJP A;  4EGQ A;  3QR8 A;  3CVZ A;  2KCT A;  3PVX A;  2BDO A;  1GHK A;  1II3 A;  5KFG A;  2CFM A;  2GPW A;  4QGU A;  2NB0 A;  3J7A 5;  1M0W A;  5E3F A;  2J6S A;  3H40 A;  1FJG L;  4GKJ H;  4HMI A;  2JA6 B;  4KD3 A;  3CF5 A;  3GTJ A;  5EWF A;  4UDU C;  4MV3 A;  1LT6 D;  4O4L F;  3I8Z A;  1CKN A;  3H09 A;  1EYA A;  5EJW A;  1GD7 A;  2HT1 A;  4LUO A;  1BR9 A;  2IMW P;  3S1Q B;  3DEP A;  1HR0 Q;  4Q0Y A;  5M5Y H;  4A93 G;  3MR3 A;  2IJ0 A;  5EKK A;  2V4R A;  4Q8E A;  3KJO A;  4XQJ A;  3ULL A;  2PW5 A;  4M1U B;  3J81 L;  1Y1V H;  1HNZ H;  3Q23 A;  2R92 A;  3ND8 A;  3D3R A;  5CV4 A;  1PXU A;  1WFQ A;  1WD1 A;  5IYD H;  5KT4 A;  3T1H Q;  4H44 C;  5C5M A;  3TS2 A;  3R8B A;  4R4Q A;  1V9P A;  2AWN A;  5KG2 A;  1U4M A;  1EQT A;  5KFP A;  1U0L A;  1Y8N B;  1G8Z D;  3PN1 A;  2KCN A;  1I3Q A;  2PNH A;  1FGU A;  1EWH A;  5FJ8 H;  3VYU A;  4DL5 A;  3I73 A;  4X3U A;  4F4X A;  1EFW A;  4ABN A;  3RR5 A;  4HIM A;  5KFE A;  4P75 A;  4ECZ A;  1CHP D;  5IGB A;  2NU7 B;  1SYE A;  2OQ0 A;  4JYA L;  3U58 A;  2E5L L;  4DV5 Q;  4OIK A;  4JI6 L;  3Q22 A;  1K8O A;  1ENF A;  1IKL A;  2PMZ E;  3KYH C;  2FKL A;  2YW2 A;  4UAI A;  5J39 A;  1U4L A;  2YZG A;  5A2Q W;  2L15 A;  2MQH A;  1B3A A;  3FRP B;  5C3W A;  2BQ3 A;  4PDB A;  1A15 A;  1YHB A;  4P73 A;  4F88 A;  4NB3 A;  3PGZ A;  3PUV A;  4DUZ Q;  1HH2 P;  3ER0 A;  2N8N A;  4RNO A;  2LFN A;  3X3M A;  1PFS A;  3Q6S A;  4X6A H;  1M90 C;  2D0O A;  1TWF A;  2BH8 A;  2KEC A;  1I50 B;  5ELN A;  3ONA B;  3GTL H;  1HZC A;  1EYD A;  1GUT A;  1PDQ A;  4GLX A;  1C4Q A;  3WO0 A;  2WAQ E;  5D14 A;  2VS1 A;  5H80 A;  4J9P A;  1WVL A;  1E0B A;  1DV1 A;  4R4O A;  5GQO A;  3EYY A;  2MNA A;  4JOI A;  1RJR A;  4F4Y A;  2IY5 B;  1IBK L;  1WR2 A;  4IZ8 A;  2PW7 A;  1QG7 A;  2CW0 D;  4B9W A;  2R61 A;  1D5Z C;  1VF7 A;  3IL8 A;  3H4B A;  1IBM H;  4JBJ A;  3HKZ E;  4KV6 A;  1DZ1 A;  4ZAI A;  5LMU H;  5FO8 B;  4G3I A;  4N9P A;  1RHP A;  5D65 A;  3M3Y B;  3PUY A;  3BZK A;  3GTG B;  5D1P A;  4DV6 Q;  3PO2 B;  4F4W A;  4RFB A;  2W6N A;  1GUG A;  4Q45 A;  2OLS A;  3GTO B;  5HUR A;  3RFC A;  4JI5 H;  1UNN C;  4KLK A;  2KA7 A;  3T5J A;  4DV3 H;  2HDL A;  5FO9 B;  4AQY Q;  5IIF A;  2Z4H A;  4FP5 D;  3UQ8 A;  2DNE A;  4JI3 L;  2WTF A;  4B3T Q;  1KL9 A;  1P8L A;  1M8A A;  1UWV A;  5FLX E;  1LTL A;  4RUA A;  3K57 A;  2YU9 H;  4FBU A;  3SK8 A;  5DG7 A;  3PUW A;  2EYF A;  1L2Z A;  3AB9 A;  1EY6 A;  1S03 G;  4K5V A;  2WB1 B;  2E2H H;  3GIQ A;  1V8Q A;  2QDB A;  4O4H F;  1CA5 A;  4PWQ A;  5C3E G;  1ZET A;  4JBK A;  1AUV A;  2R7F A;  3RLO A;  1S72 A;  1S5E D;  1V51 A;  3KF6 B;  4OWT B;  4PMC A;  2J7Z A;  1F9P A;  1H9S A;  4KN7 C;  4IUU A;  3S24 A;  1XX8 A;  4R8I A;  1CE8 A;  4RKL A;  2W9C B;  2EYP A;  2TMP A;  3ORQ A;  3KLS A;  2O4X A;  2VPS A;  1WCM A;  1CHQ D;  3RBD A;  1T3N A;  4ED7 A;  4DLK A;  2ZM6 H;  2GVB A;  2X0S A;  1QE6 A;  4J9K A;  5CMD A;  4HID A;  5M5Y B;  4P74 A;  2B63 H;  1HHV A;  4N9T A;  2VA3 A;  3H91 A;  3AFQ A;  4C5A A;  3HOY H;  1M6V A;  2EY5 A;  4TSS A;  3I55 A;  5M3F B;  1JKJ B;  5L1J A;  1XNR Q;  4M7E A;  4NPS A;  5KG5 A;  5BPH A;  3DWP A;  1EY7 A;  3WOE A;  2A8V A;  5LL6 S;  3K5I A;  1N56 A;  1HNW Q;  4AH6 A;  1HTL D;  3MZ5 A;  4O2A F;  5DG8 A;  4MTD A;  1JC7 A;  3QZ7 A;  3OW2 A;  2XCA A;  3P1H A;  4OEM B;  2UUA L;  2VQE L;  3MJF A;  1EU4 A;  4UHV A;  4YR2 A;  1DOL A;  2EVB A;  2YYA A;  5KFT A;  4LF4 L;  2JA6 G;  1HJP A;  1IHZ A;  1TA8 A;  4DR6 Q;  1TWG H;  2EE1 A;  1O7Z A;  4C1N K;  3CU7 A;  3TQT A;  1HXY D;  4LUV A;  2NU9 B;  4DPG A;  2XRQ D;  3RGZ A;  3KLS X;  4QF4 A;  4DR5 L;  4IUQ A;  4JI4 Q;  3GV8 B;  4B3M Q;  3R23 A;  3S1R H;  3BJY A;  1I4Q A;  2QDL A;  1XNQ Q;  2CQY A;  2YRX A;  4ECX A;  3MTS A;  4A3C G;  5CV7 A;  1CKO A;  3S17 H;  2PZU A;  5IGD A;  5KT7 A;  2ASD A;  1EQQ A;  1AH9 A;  1VQ4 A;  3RV3 A;  4C5C A;  3V96 A;  1TWA A;  2NU6 B;  4BBR H;  1RK5 A;  3KAL A;  3Q2O A;  1R9T A;  4ODG A;  1VQ5 A;  1K8G A;  2QW7 A;  4ECV A;  1BKB A;  2VB2 X;  5IYC H;  3J81 E;  5EBD A;  2O03 A;  2JA5 A;  2LY7 A;  1ICW A;  3T5H A;  2WV6 D;  5DLG A;  1Q1B A;  3UDI A;  3FPU B;  4FU0 A;  1TS3 A;  5GAG C;  3UDX A;  5CC4 A;  2AWO A;  1WH2 A;  2Q2U A;  2MCT A;  3BA9 A;  2VUM A;  1SE3 A;  2GVA A;  3NBH A;  2G9H D;  5GON F;  4QWE A;  1E2W A;  1S4Z A;  1I4H A;  1VQC A;  1SJH D;  3EJI A;  4QWA A;  1PRT C;  2FE3 A;  3RF2 A;  3L4K A;  4RHS A;  4FNF A;  1Q46 A;  2PZT A;  2YU9 B;  1H9J A;  1I6H B;  2I80 A;  2KVM A;  4DAV A;  4LSX A;  5FLM H;  4HAE A;  2E2H B;  3GV3 A;  2QF7 A;  2VUG A;  5EZY F;  2HIX A;  1HZ9 A;  1HNX Q;  2E2J H;  1A63 A;  1CSP A;  5IT9 W;  3LWB A;  4DV7 Q;  1T94 A;  3K59 A;  2JEB I;  1K1Q A;  5KGU A;  1GYF A;  3PO2 G;  1DOK A;  5KT3 A;  2ASL A;  3KDF B;  4JI7 H;  4RH6 A;  5KFA A;  1AZP A;  1PK8 A;  4ZLT F;  1TR5 A;  4G7O C;  3FDS A;  4HNT A;  4AYB A;  2L0C A;  3X3N A;  2R82 A;  2HD3 A;  2B63 B;  3PMF A;  3N6X A;  3J80 W;  1I94 H;  1A6X A;  1V1O A;  3HOY B;  2C2R A;  4YIJ A;  4EBE A;  1GXD C;  1VMC A;  3SHL A;  4NXM Q;  2A6E D;  5DLQ E;  1E2V A;  3RUP A;  1V1Q A;  1A9X A;  1GSA A;  4DL4 A;  1YNN D;  5HGQ A;  3H3V C;  1X32 A;  4DUY Q;  3DM3 A;  2N49 A;  1Q8I A;  5BMV F;  4LFB Q;  2RVL A;  2WAC A;  1B70 B;  4NP5 A;  4JUZ A;  1F2Y A;  3KBG A;  3TBI B;  4HTH A;  2OXP A;  3DHQ A;  3CME A;  2FLN A;  3HG9 A;  1BUV T;  1BBX C;  2M05 A;  4GC7 A;  4YHH L;  3RTX A;  3ZYY X;  3S1N H;  1MGS A;  2ZTC A;  1STH A;  2A6H D;  4YWK A;  1JOQ A;  2J9G A;  1Y8O B;  5KFQ A;  4FF3 A;  1TWC A;  5M5X H;  3H0G A;  1S5C D;  3S1R B;  3L9A X;  4UFZ A;  3G71 A;  1K3R A;  2F0V A;  3J7A F;  2K50 A;  5M3F G;  2WYO A;  1I4P A;  5IYD G;  3S17 B;  2MFI A;  4A4I A;  1WTX A;  1W93 A;  1FKA H;  2K6A A;  3H94 A;  1FGB D;  1JDE A;  3A8J E;  4R4T A;  1N48 A;  4BBR B;  1JXL A;  5D3I B;  5KG3 A;  4HIK A;  1SJE D;  1L1O C;  1S5F D;  4QIW E;  4RMF A;  3VA5 A;  2IX0 A;  1Q90 A;  5LMN W;  4OO1 H;  1PZK D;  3GIJ A;  5AJ3 Q;  1ESF A;  5FJ8 G;  1N32 L;  3S1M H;  2A6H C;  1RJP A;  2LKV A;  1G2T A;  4UCO A;  1I94 L;  3TRZ A;  3HZX A;  2HVR A;  2A69 C;  1K0S A;  5J1Z A;  2JE6 I;  2R86 A;  4JI8 Q;  2AQ4 A;  3JSN A;  5KG0 A;  3N43 B;  1GGO A;  1B2T A;  4X62 H;  2RSN A;  3PUZ A;  1SSO A;  1FL0 A;  3BVZ A;  5KFH A;  4DV1 Q;  3VYR A;  5KG1 A;  5LL6 b;  3FMC A;  3K6O A;  1XJV A;  4IZO A;  2XGT A;  4JC0 A;  2UU9 Q;  4MA5 A;  3MFH A;  4X65 H;  2NVT H;  4GNX B;  5IY0 A;  3RD4 A;  2B2T A;  3A55 A;  2ZXO A;  4APV A;  2VXW A;  4HN7 A;  2WIN B;  3V6H A;  1IBL H;  1FNW A;  3P7J A;  4EQN A;  5IGE A;  4QCL A;  4UCR A;  3FHW A;  1UC8 A;  4IAL A;  1MJE A;  2L1B A;  3S15 H;  4CC5 A;  3HOV H;  1PV4 A;  3C1E A;  4DV0 H;  1SNM A;  1YEZ A;  1NJI C;  2V5A A;  4ZI7 F;  5GAD C;  2JN4 A;  4E4T A;  4YQW A;  2YV5 A;  1L2F A;  4XYQ A;  2PI2 A;  3MVV A;  1I6V C;  5ELE A;  4YWL A;  5NUC A;  4DK3 C;  3T1H L;  4L5S A;  1JE5 A;  3TQY A;  3HOU H;  1IZ6 A;  5IOD A;  4A3B B;  4X3K A;  2DNC A;  4PMB A;  2Z6K A;  1TKW B;  3S14 B;  4XQQ A;  2SDF A;  2UXD H;  5COY A;  2ALZ A;  4U68 A;  5EQ0 A;  3I4N H;  2ZDG A;  4A3K H;  2AMC B;  2CWA A;  3H6M A;  1U9R A;  4H02 A;  3OTO Q;  4KHP Q;  3VR6 A;  2XN9 C;  2AU0 A;  5KFL A;  1M7J A;  4XZ3 B;  2BDN A;  3PR4 A;  4DR4 H;  1N8R C;  5GAE C;  4QY7 A;  2OH2 A;  4DV5 L;  3G48 A;  1NNX A;  1SYB A;  5M3M H;  2R8J A;  3K5L A;  4L5T A;  3E9H A;  3ETJ A;  4B08 A;  3RV4 A;  1Y14 B;  3SDZ A;  4HIO A;  4JV5 H;  1PH7 A;  4DUZ L;  4JI2 Q;  2YTX A;  4UP8 A;  1B9N A;  3VDY A;  4BXX G;  3NTI A;  5JPN C;  3I56 A;  1SE2 A;  1B8A A;  2J4X A;  1PFN A;  1S5D D;  1BXT A;  1W96 A;  1K83 H;  3S1N B;  2F0O A;  1E1O A;  2FXQ A;  1UE7 A;  3T51 B;  1C9O A;  1GUN A;  2L9H A;  2NZO A;  5KT6 A;  4G7Z C;  4LF6 Q;  1Z2P X;  2FJ2 A;  2NWG A;  2CQO A;  5M5X B;  1TS5 A;  1PH5 A;  2WB1 A;  3HOY G;  5JPM C;  2E2D C;  3OUZ A;  4LFA Q;  5CYU A;  2NVY B;  4IPG A;  5J3B A;  4EYH B;  4FS1 A;  1VKZ A;  1BO0 A;  2I5H A;  4GOP B;  4KTA A;  2UVW A;  4DV6 L;  1TAE A;  3L0O A;  2JA6 H;  4QW8 A;  1OXT A;  3RZO H;  2AUK A;  2DJG C;  5C1P A;  1Y1W A;  3KF8 A;  3LML A;  4K0K Q;  1LM0 A;  2K75 A;  5IWA H;  2XIW A;  3CP0 A;  3J80 i;  4MTN A;  1ULZ A;  4B3T L;  2F0Q A;  3NGD A;  4O3P A;  1P16 A;  1E4E A;  4K5X A;  1NTG A;  2H5X A;  3V05 A;  4DV4 Q;  2KEE A;  5E4X A;  4RKB A;  2UUB Q;  1D8L A;  1PZI D;  1VQD A;  5IYB H;  5BR8 Q;  1Y1V A;  4X64 H;  4LK1 C;  2KJX A;  1KD1 C;  5IGG A;  2RDF A;  4CDE C;  1FNV A;  3CCV A;  1NAP A;  1G51 A;  3KXY T;  5KFV A;  1VQI A;  2EY1 A;  3NE5 B;  4PNY A;  2FMM A;  1DV2 A;  5FLX W;  1MSH A;  1XNQ H;  1OTC A;  4LH7 A;  1RJT A;  1JOK A;  4YP3 A;  3ND9 A;  1CUK A;  3BVG A;  4LW1 A;  2UUC H;  4I7Z C;  2NVT B;  3CCR A;  5EWE A;  5M9O A;  1EUC B;  4FF2 A;  3PO3 B;  4KKS A;  3CMA A;  1E4F T;  4BBR G;  4Y8V B;  1CKM A;  4L5Q A;  4KHV A;  4DAP A;  4DR1 Q;  3R3O A;  1RTN A;  1PA6 A;  2W9B B;  3J7Y W;  4QWD A;  2Q2T A;  3S15 B;  3HOV B;  2RCN A;  3OIQ A;  5EPL A;  5G3L D;  2AKW B;  1MHW C;  1FJG H;  3CQZ B;  5GRO A;  1BQQ T;  1XNR L;  4MV4 A;  3GIP A;  2C00 A;  4PZ8 A;  1B04 A;  1WD0 A;  4ECT A;  1WTR A;  2XWJ B;  1XMO Q;  3GTL A;  2FB9 A;  4LFC Q;  1FYC A;  3HOU B;  1HNW L;  1IL2 A;  3I70 A;  3GID A;  5EAY A;  3GV6 A;  4MA0 A;  4DV2 Q;  2WAQ B;  4IUR A;  2XVS A;  4HJA A;  3OSO A;  4OX9 Q;  3VPB A;  2SNS A;  3M4Q A;  3T1Y Q;  3I4N B;  4ME6 A;  1PZJ D;  4A3K B;  4FXD A;  1E22 A;  3PW2 A;  3FVQ A;  5CA0 F;  2B29 A;  4DR6 L;  4O3O A;  3HKZ B;  1ZHS A;  1OXU A;  3JAM c;  4IWY A;  5M3M B;  2N88 A;  4L5R C;  4EFE A;  4C1N I;  5CGK A;  2JYO A;  3BZC A;  3I4L A;  3OW7 A;  4JI4 L;  2B2Y A;  4B3M L;  4XYM B;  1BF4 A;  3GII A;  1SN8 A;  3QJY A;  1LLR D;  2A1A A;  3QZ8 A;  1XNQ L;  5JVL A;  3I4O A;  4IUP A;  5DM7 3;  3A0J A;  1IKM A;  5KFO A;  4PV1 C;  1S40 A;  3B6Y A;  3OHX C;  1E4G T;  1RKN A;  5J2U F;  3D0F A;  2XD4 A;  1LT3 D;  3BU2 A;  4TRD A;  3TQ1 A;  4J9Q A;  5EPK A;  4JI6 H;  5I6W A;  4A3B G;  1RTO A;  2YU9 A;  4B3R Q;  2R93 A;  3HXL A;  4X3S A;  4XYO A;  1E3P A;  3CCJ A;  2E2H A;  3RB3 A;  2WE6 A;  2VW9 A;  3SXH A;  4HYK A;  1T5X D;  5C0X G;  1YNJ D;  1EU3 A;  3IKJ A;  1Y69 U;  1GO3 E;  1XPR A;  1X3P A;  3GO5 A;  3J81 W;  4C2M A;  4WJ3 M;  2FFK B;  1K28 A;  2PYK A;  3RZO B;  1L1O B;  3VR3 A;  5LL6 X;  4LFB H;  4MV8 A;  4YR3 A;  3W1G A;  1IBK H;  2ENB A;  1PTO C;  1C0A A;  4ECW A;  2R6G A;  2H4O A;  1YIT A;  4BY1 H;  3GTK B;  3GDE A;  2HQE A;  2WKC A;  3G6X A;  2W8K A;  5LMN Q;  2B63 A;  4DAY B;  4UP9 A;  5DQG A;  2AGP A;  5KFZ A;  2CH4 A;  2MGS A;  4QL5 A;  2FPI B;  1NR2 A;  2IX3 A;  2MPM A;  4I4T F;  4LF9 Q;  1YNJ C;  3HGB A;  1F77 A;  5M3F H;  3M4O B;  1I7L A;  4N8F A;  1G29 1;  2B2U A;  1BNZ A;  1G6Z A;  3AFP A;  4NXN Q;  1IOW A;  1LAB A;  5EGT A;  5T1I A;  3BQ1 A;  1PVO A;  4CKB A;  1HNX L;  3QG1 A;  3W3A A;  4CJ2 C;  2EYL A;  4RGT A;  3TEH B;  2W57 A;  1HZB A;  4F4Z A;  4JI3 H;  1V4Y A;  4CKE A;  1E24 A;  5K5P A;  1W3S A;  4APM A;  3K7A H;  1M4V A;  3FKI H;  3Q0A A;  4JBM A;  5FD6 A;  2ZTD A;  2ASJ A;  2TSS A;  1I5F A;  1ILQ A;  2D9U A;  1TWG A;  1IYU A;  2RGV A;  5JUM A;  3ZJY C;  4OO1 G;  1D1I A;  4HR7 B;  2JEF A;  1SMY D;  2NZ1 D;  1EZ6 A;  1B7Y B;  1F2Z A;  3VYT A;  3HEJ A;  1LYL A;  2Q8R E;  2HIV A;  5LA6 F;  4NXM L;  5T1G A;  1TY0 A;  5C0X J;  4RB2 C;  1QZG A;  2RDH A;  5CV9 A;  1XPO A;  3SVM A;  4I50 F;  2R3Z A;  4DUY L;  3EA6 A;  2M2L A;  4A2B A;  3BQ2 A;  2E76 C;  2D62 A;  2Z0S A;  1YJ9 A;  1SAP A;  5KFD A;  2NTS A;  2LMC B;  4C3I B;  2Y0S E;  4TV8 F;  4LFB L;  1N34 Q;  1LTR D;  4O3N A;  3BS1 A;  1Q8K A;  1JB3 A;  1SMY C;  4FYD A;  4QQB X;  3TN2 A;  1T5E A;  4C56 C;  5EWG A;  3SK6 A;  2Z1C A;  3PO3 G;  4ED6 A;  1PFM A;  2PQA B;  3QB3 A;  4CDD C;  4EBC A;  3D6C A;  2J6U A;  4RGO S;  1U4R A;  2IBK A;  4HSP A;  4H0L C;  2DN8 A;  4JOI C;  3HOV G;  1EYZ A;  4EG0 A;  1YI2 A;  2UUA H;  2VQE H;  2KHS A;  5L1K A;  1B4O A;  2KOL A;  1UEA B;  2V1C C;  1S0O A;  2RGR A;  2HVS A;  1CZW A;  4P72 A;  4LF4 H;  3K0X A;  2UXC Q;  3PSI A;  4K14 A;  4FXG C;  1IW7 C;  1ONL A;  4ECY A;  4GNX A;  2FP4 B;  3HOU G;  4PZ7 A;  3I91 A;  1PH3 A;  2W7P A;  3MR5 A;  1I6H H;  2WAQ G;  4UY8 C;  3TRE A;  2MJ8 A;  5AJ3 L;  4DR5 H;  2JK8 A;  1VQH A;  3R2I A;  2FHT A;  1PH9 A;  2F0D A;  2PQE A;  3U9S A;  4A3K G;  1JMC A;  3I4N G;  1D7Q A;  5IGF A;  3Q8Q B;  3DWA A;  2NZH A;  2VY3 A;  2LXJ A;  3HKZ G;  4BXX H;  3DEO A;  2CW8 A;  4LF5 Q;  4I55 F;  3MR2 A;  3K80 C;  4JI8 L;  5M3M G;  2FPG B;  4HNV A;  4WBN F;  4R4C A;  2E2I H;  3KK7 A;  3MAQ A;  4XIG S;  1ZEQ X;  4DU9 A;  3PZP A;  1QJO A;  1JLL B;  2QK4 A;  1A0I A;  1SMX A;  2KCC A;  4DV1 L;  4DK1 A;  1TQO A;  3A74 A;  3MXP A;  4YWM A;  4BY1 B;  5JAV A;  1ZHQ A;  1FNU A;  5L1L A;  3TZD A;  1QVG A;  3QWN A;  4EVO A;  4JI0 Q;  2R7N A;  3T56 B;  4NDX A;  5D8D A;  4GC6 A;  1ZKO A;  1YIJ A;  4EGJ A;  3OPO A;  3MR6 A;  4F8M A;  1E1T A;  3HRZ C;  1VBH A;  2VL6 A;  5KFR A;  4QWB A;  4UPA A;  2Z6B A;  2R85 A;  2JEI A;  5C4J B;  3P20 A;  1D5M C;  4XDX A;  4TQR A;  2HDM A;  2FPP B;  5CAE B;  3K7A B;  3FKI B;  5KFU A;  1QWY A;  2GPS A;  4IHJ F;  2C35 B;  2QCP X;  4O2B F;  4A3I H;  5I4D A;  2Q8I B;  2R92 H;  3C0F B;  4DN4 M;  4M8A A;  4K8J A;  4BWG B;  4K0K H;  2DJF C;  3PCO B;  3T4A C;  4LSA A;  4LH6 A;  1BVS A;  4CGY B;  1HA5 A;  2D2C C;  4DV4 H;  4QJF A;  4E6I A;  3KLR A;  5L1I A;  3NUC A;  1SND A;  3MHB A;  4BY7 H;  3OTO L;  1TWH A;  2VQF Q;  4KHP L;  2UUB H;  4ZHQ F;  4B3S Q;  1WYD A;  1YHQ A;  5BR8 H;  3OHB A;  1E2Z A;  3A8K E;  5IYB G;  3J81 i;  2ZTE A;  2L4N A;  2CH4 W;  3BDL A;  3NTH A;  4KKT A;  5C3X A;  5DQI A;  4TQU S;  1WI5 A;  5L37 A;  2F4V Q;  4GOP A;  1STA A;  4F7X A;  4IPH A;  4IQZ A;  3G6V A;  5EDW A;  1JX4 A;  2F3I A;  3LX0 A;  1RL2 A;  3A7L A;  2B39 A;  5A35 A;  4OHJ A;  3H15 A;  1K9M C;  1EL0 A;  3M4I A;  4IR1 A;  3BQ0 A;  2QA4 A;  1CZG A;  4QIW B;  1PRT D;  2ZDH A;  5C1O A;  3K5O A;  3RLF A;  4J8Q A;  4R8U B;  1I4R A;  1IL8 A;  3E5N A;  4RGN A;  3R93 A;  2KUM A;  3D31 A;  3BDO A;  3NHH A;  1GVP A;  1B3Q A;  4YAJ B;  4J15 A;  5EKL A;  1JT8 A;  3L4J A;  1UAP A;  4LF6 L;  1X3Q A;  2UXB Q;  4LF7 Q;  2EYJ A;  3C1F A;  1J5E Q;  1V1P A;  4QW9 A;  1GUS A;  4EQ5 A;  2R7D A;  2RHQ B;  3OYY A;  5C5L A;  1I4X A;  4K6D A;  5JJZ A;  3I12 A;  4LMY A;  1B6R A;  1PH8 A;  4WFN 3;  3FEW X;  1CFM A;  1SRU A;  2FIN B;  2VNU D;  2ZXR A;  1ET6 A;  4YHH H;  4LNQ A;  4DR3 Q; 
#chains in the Genus database with same CATH homology
 3FHW A;  1I50 H;  3WWV A;  1MKH A;  1NMF A;  5C0X I;  1XTD A;  5GAH C;  1MJE A;  3TS0 A;  3S15 H;  1IBL Q;  4DAM A;  3CAM A;  1MIU A;  3G4S A;  1PV4 A;  3HOV H;  4A3F G;  4K0K L;  3PF5 A;  4YHH Q;  2DUD A;  1YEZ A;  1NJI C;  1YNX A;  2XTI A;  5GAD C;  2CKZ B;  3G6E A;  3F2D A;  3CCQ A;  1QVC A;  3ICE A;  2N78 A;  2YV5 A;  1L2F A;  1SR3 A;  2PI2 A;  4DK3 C;  4DK6 C;  4YWL A;  4DV0 Q;  2K5V A;  4DV4 L;  3T1H L;  5IWA L;  1HNZ L;  4L5S A;  1JE5 A;  3TQY A;  3HOU H;  1IZ6 A;  2KEN A;  2JJQ A;  3PIO A;  2UUB L;  5BR8 L;  2Y0S G;  4POF A;  2Z6K A;  2BH2 A;  3K7U C;  1VQL A;  2EXD A;  3J7Z C;  1X65 A;  4GS3 A;  2OTL A;  3I4N H;  5FLM G;  3M3Y H;  4A3K H;  3HOZ H;  2AMC B;  2CWA A;  4H02 A;  4X64 L;  3GD7 A;  1N36 Q;  3GTG H;  2KHJ A;  1QVF A;  3OTO Q;  1T9H A;  3PO2 H;  4A3B H;  4KHP Q;  1BBW A;  1VQ6 A;  3GTO H;  3L7Z C;  1N8R C;  2K52 A;  2UXD Q;  4GNX C;  3S14 H;  3GTP H;  5GAE C;  4QY7 A;  4JI1 Q;  4DV5 L;  3BJU A;  1YJN A;  3G48 A;  2LSS A;  4RG1 A;  4X66 L;  5M3M H;  2R93 H;  1PYB A;  4LWC A;  4AYB G;  1N32 Q;  4L5T A;  4YCW A;  1SLJ A;  4DR4 Q;  3E9H A;  4OON A;  2HHH Q;  2UUC L;  2K4K A;  1AE3 A;  1Y14 B;  1VQE A;  4HIO A;  1PH7 A;  4DUZ L;  1K8A C;  1I94 Q;  4JI2 Q;  2UU9 L;  2YTX A;  1VQN A;  4UP8 A;  1Q7Y C;  3SGI A;  3VDY A;  2RF4 A;  4BXX G;  1XMQ Q;  1X3E A;  2I5M X;  4EX5 A;  3EIV A;  2JA7 G;  2K5N A;  4JV5 Q;  4UP7 A;  3I56 A;  1WCM H;  3M85 A;  3RZD H;  1PH6 A;  1B8A A;  2ZJP A;  3CD6 A;  4C2M H;  2KCT A;  1K83 H;  2FXQ A;  1E1O A;  4OO1 I;  1UE7 A;  2CFM A;  3KF8 B;  1C9O A;  3GTJ H;  4QGU A;  2NZO A;  3J7A 5;  3E0E A;  3FP9 A;  4P71 A;  4LF6 Q;  1XMO L;  4A3G H;  1N33 Q;  1E7Z A;  2CQO A;  4R1J A;  4LFC L;  4JCV E;  1FJG L;  1PH5 A;  1QUQ A;  2Q2H A;  3HOY G;  4A3E G;  1FVI A;  2K5H A;  4DV2 L;  3CF5 A;  4WJ4 A;  5C4X H;  4LFA Q;  4IJH A;  4OX9 L;  1IYJ B;  1CKN A;  4IPG A;  5J3B A;  3HOX H;  3T1Y L;  3K8A A;  4BY1 G;  1K73 C;  4GKJ Q;  1IBM L;  3RN5 A;  1GD7 A;  2I5H A;  4GOP B;  2HT1 A;  4A3D G;  1EYG A;  4LUO A;  2JA8 H;  5LMU L;  4DV6 L;  4HJ5 A;  3L0O A;  2KBN A;  5M5Y H;  1OXT A;  2ID0 A;  3CCU A;  1HR0 Q;  2MO1 A;  2JA6 H;  1X9N A;  1KHI A;  3RZO H;  4A93 G;  3H0G G;  4XTC S;  3KJO A;  1LM0 A;  2NVY H;  4K0K Q;  2K75 A;  3ULL A;  1Y1V H;  3A5U A;  3CP0 A;  3J80 i;  1I3Q H;  4JI5 L;  4MTN A;  3S16 H;  1DGS A;  4B3T L;  1WFQ A;  4IFD I;  5IYD H;  1P16 A;  1NTG A;  2H5X A;  4DV3 L;  4DV4 Q;  3T1H Q;  3TS2 A;  1HNZ Q;  5IWA Q;  1GM5 A;  3NEL A;  4R4Q A;  5FLX c;  1V9P A;  2AWN A;  2UUB Q;  1D8L A;  1VQD A;  5IYB H;  3S2D H;  5BR8 Q;  1U0L A;  1UE1 A;  1UE5 A;  3FKI G;  3CC4 A;  1JJG A;  2PNH A;  1KD1 C;  1FGU A;  3CCV A;  5FJ8 H;  1G51 A;  4JI2 L;  2NN6 I;  1VQI A;  4HJ8 A;  1PYS B;  1EFW A;  4X64 Q;  3EBE A;  3F2C A;  3RR5 A;  1OTC A;  4HIM A;  4P75 A;  1VQP A;  1CUK A;  4JBW A;  4LW1 A;  2OQ0 A;  4JYA L;  2LXK A;  3U58 A;  2E5L L;  4DV5 Q;  3CCR A;  3CCL A;  4JI6 L;  2PI2 E;  3KYH C;  2PMZ E;  1TWF H;  4X66 Q;  1VQA A;  5IP9 H;  3W1B A;  3HOW G;  2L15 A;  2MQH A;  3A5Z B;  1YHB A;  4P73 A;  4BBR G;  3CMA A;  4NB3 A;  4GOP C;  2UUC Q;  3PGZ A;  1CKM A;  3PUV A;  4L5Q A;  1HH2 P;  4DUZ Q;  3ER0 A;  2MO0 A;  1XPU A;  2N8N A;  3U4V A;  4DR1 Q;  2OCE A;  1PFS A;  1PA6 A;  3KLW A;  1M90 C;  4X6A H;  2D0O A;  2BH8 A;  3Q8D A;  5ELN A;  3L2P A;  3GTL H;  1HZC A;  4LFA L;  2ZM6 L;  4A3J G;  2Q2T A;  3PO3 H;  4GLX A;  2RCN A;  1VQF A;  2WAQ E;  2VS1 A;  1RIP A;  2AKW B;  4A3L G;  5K36 G;  5GRO A;  4R4O A;  5GQO A;  1XNR L;  3KJP A;  3W5O A;  1JJC B;  2MNA A;  4IOC A;  4C3H H;  3H3V I;  4PZ8 A;  1HR0 L;  4JOI A;  2VUM H;  3U4Z A;  5LMN L;  1XMO Q;  2IY5 B;  2IX1 A;  1IBK L;  4LFC Q;  2ALY B;  1FJG Q;  1HNW L;  1IL2 A;  4JBJ A;  3HKZ E;  5EAY A;  4LF9 L;  4GLV B;  1WJJ A;  5ELO A;  3CQZ H;  4DV2 Q;  4FDB A;  4HJA A;  4A3F H;  3PF4 A;  4OX9 Q;  4PZ6 A;  3M4Q A;  3T1Y Q;  3PUY A;  3BZK A;  1IBM Q;  4IJL A;  1E22 A;  4NXN L;  5LMU Q;  4DV6 Q;  2GN5 A;  2B29 A;  1C7Y A;  4DKA C;  2D0P A;  3NEM A;  4LF8 L;  4DR6 L;  1OXV A;  1KXL A;  4KLK A;  1OXU A;  2OQK A;  3JAM c;  3S2H H;  4AQY Q;  2BA1 A;  1PH4 A;  3CXC A;  4L5R C;  2WB1 E;  4JI5 Q;  3BZC A;  4JI3 L;  4B3T Q;  4JI4 L;  1KL9 A;  4OXP A;  1ASY A;  1QZH A;  4B3M L;  1P8L A;  1SN8 A;  1UWV A;  4DV3 Q;  4ME3 A;  3PV0 A;  4MNO A;  1LTL A;  1SE8 A;  2A1A A;  1XNQ L;  1UEB A;  2YU9 H;  2JQO A;  3I4O A;  4GN4 B;  3A0J A;  3PUW A;  3H3V H;  1S40 A;  1N9W A;  3B6Y A;  3DLL A;  1KIX A;  3D0F A;  2Z6K C;  1Q1E A;  1QUQ B;  2E2H H;  3BU2 A;  4DR7 L;  2Q2I A;  5C3E G;  4DR1 L;  1EIF A;  3CCE A;  1VQ8 A;  4JBK A;  4A3B G;  1ASZ A;  2R7F A;  3RLO A;  4B3R Q;  4KI0 A;  3HFZ B;  1CKN B;  2ZJR A;  1S72 A;  2WP8 J;  3KF6 B;  4OWT B;  4A3M H;  2OWO A;  3J81 c;  1UE6 A;  4JYA Q;  1X6O A;  2ATW A;  1E3P A;  2E5L Q;  3CCJ A;  4JI6 Q;  2JA7 H;  3S24 A;  2VW9 A;  5JJL A;  3CC2 A;  3M4P A;  5IE8 A;  5C0X G;  1N34 L;  4BBS H;  4GKK L;  4C3J H;  1GO3 E;  2GVB A;  1XPR A;  3GO5 A;  4LUZ A;  1G6P A;  1V43 A;  4HID A;  4POG A;  4WJ3 M;  4P74 A;  2B63 H;  1X3F A;  3UE1 A;  1L1O B;  2ZM6 Q;  3AFQ A;  3CC7 A;  3HOY H;  2WB1 G;  3W1G A;  1C0A A;  3KF6 A;  2IT1 A;  3I7F A;  2R6G A;  3I55 A;  1XNR Q;  4NPS A;  3UE0 A;  3PIP A;  1YIT A;  4BY1 H;  2ES2 A;  3GDE A;  2IHF A;  1A62 A;  4DAY B;  5LMN Q;  4A3D H;  5JJI A;  4UP9 A;  1IBK Q;  3STB D;  2A8V A;  4JG2 A;  4QL5 A;  1HNW Q;  4A93 H;  2HQL A;  4AH6 A;  4AQY L;  1NY4 A;  2K14 A;  1VCI A;  4LF9 Q;  3GTQ H;  1TWC H;  1Y1W G;  3MEF A;  5M3F H;  2CCZ A;  3OW2 A;  4YY3 L;  1OXX K;  4A3I G;  3GTK H;  3HOX G;  2UUA L;  2VQE L;  2UXC L;  4GN5 A;  2R92 G;  4IO9 A;  1G29 1;  1L1O A;  3AFP A;  4NXN Q;  1PVO A;  1HNX L;  4HJ9 A;  4LF4 L;  1Q12 A;  2JA6 G;  1HJP A;  3TEH B;  3UDG A;  1HZB A;  1TWH H;  4LF8 Q;  4DR6 Q;  1TWG H;  1BBU A;  1E24 A;  1O7I A;  1W3S A;  3M4O H;  3JC6 6;  3K7A H;  1Y1V G;  3FKI H;  4JBM A;  4Y7N H;  1L0W A;  3RNU A;  1VQO A;  1VQ9 A;  1NE3 A;  4BY7 G;  4LUV A;  2ZTD A;  4DNI A;  4DPG A;  4B3R L;  5C44 H;  4DR5 L;  4JI3 Q;  4JI4 Q;  1I5F A;  1YVC A;  3STB C;  4B3M Q;  3S1R H;  3KFU A;  4LF5 L;  1TWA H;  3RLN A;  3ZJY C;  2E8G A;  4OO1 G;  1XNQ Q;  1R9T H;  1HR0 W;  4A3C G;  1B7Y B;  1CKO A;  1EUJ A;  1LYL A;  3PUX A;  4JI7 L;  2HIV A;  3S17 H;  3AQQ A;  1EQQ A;  1AH9 A;  1VQ4 A;  2JA5 H;  4Y52 H;  3F1Z A;  1PH2 A;  4NXM L;  4DR7 Q;  1H95 A;  5C0X J;  4BBR H;  1QZG A;  1VQ5 A;  1K8G A;  1KRS A;  4YCV A;  1XPO A;  1YBY A;  1BKB A;  3EN2 A;  3NBH B;  5IYC H;  4JI0 L;  3K81 C;  4DUY L;  1VQG A;  3ULP A;  5IP9 G;  2D62 A;  2Z0S A;  1YJ9 A;  4O0A A;  1X54 A;  1VQB A;  2Y0S E;  2NVQ H;  4LFB L;  1Q1B A;  2YTV A;  1N34 Q;  4GKK Q;  3UDI A;  2N3S A;  1Q8K A;  3E9I A;  4R4I A;  5GAG C;  2QEX A;  4A3L H;  3UDX A;  1VS0 A;  2R7Z G;  4IOA A;  4QQB X;  4IFD G;  2JA9 A;  3CPF A;  2EIF A;  2AWO A;  4C3I H;  2Q2U A;  3I4M H;  3PO3 G;  5JJK A;  2GVA A;  2PQA B;  5JEA G;  1KRT A;  1TXY A;  2KCM A;  5IP7 G;  1EIY B;  3I4M G;  4OWW B;  1VQC A;  3CPW A;  1YJW A;  1EWI A;  2ZJQ A;  2NN6 G;  4JOI C;  3HOV G;  2OTJ A;  1YI2 A;  1Q46 A;  2V1C C;  1S3O A;  1X55 A;  5IT9 c;  4P72 A;  4YY3 Q;  5FLM H;  1W2B A;  3K0X A;  2UXC Q;  3PSI A;  2UUA Q;  2VQE Q;  2VQF L;  1K0R A;  1X3G A;  1AE2 A;  4B3S L;  4GNX A;  3HOU G;  2HIX A;  4PZ7 A;  1EOV A;  1HZ9 A;  1PH3 A;  2PQA A;  1HNX Q;  1I6H H;  4LF4 Q;  5M5W H;  2E2J H;  2WAQ G;  4UY8 C;  1WOC A;  1A63 A;  1CSP A;  1SFO H;  3TRE A;  5AJ3 L;  4O2D A;  2JK8 A;  1VQH A;  4DV7 Q;  4DR2 L;  1A8V A;  1PH9 A;  1JMC A;  4A3K G;  2F4V L;  3HOZ G;  3I4N G;  3M7N A;  4GLA C;  1D7Q A;  2JEB I;  3UDF A;  3J80 c;  2YYZ A;  3PO2 G;  3F8T A;  2NZH A;  4DR5 Q;  3AEV A;  2VY3 A;  5C3E H;  1KQS A;  3KDF B;  2LXJ A;  3HKZ G;  4DR3 Q;  4BXX H;  4LF5 Q;  3K80 C;  4JI8 L;  3M9B A;  1J6Q A;  5M3M G;  2YTY A;  2R93 G;  4R4C A;  2E2I H;  1SRO A;  4XIG S;  5HY6 A;  4JI7 Q;  2WFW A;  1VQK A;  3IRB A;  1Q86 C;  1IXR A;  1A0I A;  1NBW A;  1SMX A;  4NXM Q;  4DV1 L;  5DLQ E;  2UXB L;  3ULJ A;  4X62 L;  3A74 A;  4LF7 L;  4YWM A;  1V1Q A;  1KAW A;  1WCM G;  1J5E L;  3GTM H;  4A3M G;  2F52 A;  5E7N A;  5HGQ A;  4A3E H;  1QVG A;  4HJ7 A;  4JI0 Q;  2JEA I;  1EQR A;  4DUY Q;  4IFD J;  1Z9F A;  3DM3 A;  3KDF A;  2N49 A;  3RN2 A;  1VQJ A;  1OXS C;  4X65 L;  1YIJ A;  4BBS G;  5JEA J;  4LFB Q;  4A3G G;  1E1T A;  1PHJ A;  3HKS A;  2VL6 A;  1B70 B;  3CCS A;  2VZA A;  4DR3 L;  2QGQ A;  4UPA A;  3CME A;  2B63 G;  1IBL L;  5C4X G;  3H0G H;  4PG3 A;  1Q81 C;  3JAM i;  3MXN B;  4YHH L;  1JB7 A;  3S1N H;  1Y1W H;  2RHS B;  3LGJ A;  2ZTC A;  2C35 B;  2ASB A;  2JA8 G;  4YWK A;  4DV0 L;  4A3I H;  3ERS X;  2R92 H;  5C4J H;  2DGY A;  5M5X H;  4MZ9 A;  3PCO B;  3G71 A;  4DV7 L;  1K3R A;  3I2Z A;  4OWX B;  1Q82 C;  1U5K A;  4ALP A;  1BVS A;  2K50 A;  5M3F G;  4QJF A;  5IYD G;  3U50 C;  2KHI A;  2MFI A;  4A4I A;  4AIM A;  1N36 L;  4BY7 H;  3OTO L;  3AYH B;  3F2B A;  1YHA A;  2VQF Q;  1PH1 A;  2A19 A;  3S1Q H;  4R4T A;  1VQM A;  4B3S Q;  1WYD A;  1YHQ A;  4KHP L;  4HIK A;  2UXD L;  1L1O C;  4GN3 B;  4TVA B;  5IYB G;  3J81 j;  4QIW E;  4RMF A;  4JI1 L;  3J81 i;  4A75 A;  2ZTE A;  2IX0 A;  2I0Q A;  5LMN W;  2BA0 A;  1KC8 C;  5AJ3 Q;  4TQU S;  1WI5 A;  5FJ8 G;  2F4V Q;  4GOP A;  1N32 L;  1GKH A;  4DR2 Q;  4IPH A;  3HOW H;  3S1M H;  4DR4 L;  2HHH L;  4A3C H;  4PMW A;  4A76 A;  3CCM A;  1I94 L;  1VQ7 A;  5C44 G;  2F3I A;  3TRZ A;  1RL2 A;  2I5L X;  1K9M C;  3H15 A;  1XMQ L;  2QA4 A;  1X56 A;  2AHO B;  2JE6 I;  4JV5 L;  3RLF A;  4IPD A;  4JI8 Q;  1HZA A;  4KHZ A;  4A3J H;  3KOJ A;  4YCU A;  4BA2 I;  3D31 A;  1CSQ A;  1GVP A;  1YZ6 A;  1Z47 A;  4J15 A;  4BA1 I;  3PUZ A;  5H1S E;  1FL0 A;  2IHE A;  2CWP A;  2JA5 G;  1JT8 A;  4DV1 Q;  4LF6 L;  1XJV A;  2UXB Q;  1N33 L;  2XGT A;  4JC0 A;  4X62 Q;  2UU9 Q;  4LF7 Q;  1J5E Q;  1M1K C;  2B3G A;  2NVT H;  5IYC G;  4IPC A;  2R7D A;  4EQ5 A;  2RHQ B;  1MJC A;  3OYY A;  5IY0 A;  4GNX B;  2NVX H;  2R7Z H;  3NEN A;  4APV A;  1PH8 A;  4AYB E;  4X65 Q;  4GKJ L;  2VUM G;  2EQS A;  1SRU A;  1JJ2 A;  2VNU D;  1LUZ A;  5IP7 H;  3CW2 C;  4LNQ A;  1NMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...