4A3CG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3cG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3cG01
1HJPA 3T1YL 1EIFA 3CCQA 2Z6KA 3PO2G 2YYZA 1VQOA 3DLLA 1E24A 1MKHA 1KD1C 4MNOA 2HQLA 2OQKA 1E22A 4QY7A 1HNXQ 2E2JH 2WAQG 4GOPC 1FGUA 1SLJA 4L5SA 3M3YH 3TREA 1KRSA 2MNAA 2GN5A 3PSIA 3PIOA 3NENA 2UXCL 3L0OA 1EQRA 3F2CA 4LF9L 2XTIA 3CQZH 5FJ8G 2WP8J 1I6HH 3K7AH 4YCVA 2VL6A 3LGJA 1I5FA 4A3JG 1PH7A 2B29A 1N34L 2KBNA 2IX1A 3OYYA 3PF4A 1WFQA 4EQ5A 4XIGS 2BA0A 3HKSA 2KHJA 2MFIA 1NTGA 2ALYB 4IPGA 4JI1L 4JI5L 5JEAJ 1YJNA 1WCMG 1I94Q 1EFWA 4GKKL 3UDGA 4GLAC 4GN3B 4JOIA 1CKNB 3A0JA 3I4MG 2R7FA 3A5ZB 1PH5A 2UXDL 2UUCQ 1IL2A 1FVIA 4X62L 4JI3Q 4DR6L 1IBKQ 2BH2A 1AE2A 2VUMG 3BJUA 1QUQB 4R4CA 4A3EG 5DLQE 1VS0A 2Z0SA 3OW2A 4A3GH 1YI2A 4OO1G 2JA8H 1S72A 1TXYA 4A3FH 3KF8B 4X64L 3GTKH 4HJ5A 1BVSA 2MO1A 2PQAB 3AYHB 4BBRH 5FLXc 4DV0Q 2F4VL 4OO1I 4IFDJ 2JE6I 2K50A 1X3FA 1SROA 2NVXH 1X54A 3L2PA 3GTLH 3NBHB 4AIMA 3H15A 3GO5A 2Q2TA 2WFWA 1CKMA 3ULPA 1K73C 1PHJA 1Q7YC 4C3HH 4DV0L 4DV5Q 3RNUA 1S3OA 3E9HA 1X65A 4AH6A 4JBWA 3G71A 1C0AA 5C0XJ 1TWAH 4BXXG 5E7NA 1VQ5A 1NE3A 5IYDH 4LUVA 4A3BH 4JC0A 4B3TL 4RG1A 4BA1I 1SFOH 3HOZH 4YWLA 3E9IA 1BBUA 3DM3A 5GROA 3UDIA 3CCVA 4GNXA 4GLXA 2K4KA 3S1RH 1N8RC 1K8AC 2NVTH 1WI5A 1HZBA 3FP9A 4OXPA 1GO3E 5FLMH 1OXUA 1I94L 2YU9H 4LF4Q 4GKKQ 1SMXA 2AMCB 4WJ4A 3GTGH 3ULLA 2K52A 4YWMA 4JI2Q 3F2DA 1GVPA 3J7ZC 2JA5G 1OTCA 2YTVA 3J81j 4DR1Q 2MQHA 5IYBG 3FKIG 1KXLA 2ATWA 1Q82C 1HZAA 2OTLA 4A3KG 4YY3L 1TWFH 3F8TA 2N49A 4PZ8A 3JAMi 2ZTEA 4HIKA 1W2BA 1QVGA 4JI2L 4NXML 5M3FH 2L15A 1O7IA 4JOIC 1XPUA 4O0AA 3TS2A 3KJOA 1KL9A 4B3RQ 1EYGA 4LF5Q 3IRBA 4JV5L 3HOXH 4A3GG 5IYCH 2RHQB 1VQEA 2K5HA 4LF9Q 3M4QA 2CWPA 4JI8Q 3J81i 5LMUQ 3S15H 1EIYB 2K14A 4YWKA 3STBC 3RZDH 2YTYA 1PH3A 4BBSH 5EAYA 3HOYH 2CWAA 5AJ3L 1VQ4A 1U0LA 4DV6Q 4A3DG 1VQCA 4QIWE 4DV6L 4GNXC 3D31A 5C3EH 3GD7A 4A3BG 1XMQL 2N3SA 5IP7G 2BH8A 3NELA 4BXXH 3I4OA 1VQ7A 3UE0A 4GS3A 4DV2L 2B63H 3F1ZA 2NN6G 4X6AH 1JB7A 3GDEA 3CCEA 4DUYQ 3K8AA 1I3QH 4DPGA 1Q81C 1KIXA 1VQLA 4DV1L 1QVCA 4DR7L 1KQSA 3K80C 4UP9A 3EIVA 3PUWA 2B3GA 4Y7NH 2UU9Q 4A3DH 3CC7A 1PV4A 2ZM6L 3S1MH 3GTPH 2IX0A 1N36L 2AHOB 4BBSG 2XGTA 3W1BA 1YJ9A 3HFZB 5C0XI 4A3FG 4LF5L 4JV5Q 4A3LH 4MTNA 1LM0A 1OXXK 1SE8A 1IYJB 1QUQA 3SGIA 4OX9L 4OWXB 1YNXA 4OX9Q 3TRZA 4Y52H 1L0WA 4DR2L 5IWAL 2VQFQ 2NZHA 3UE1A 2HHHL 2OTJA 2GVBA 3CC2A 3KF6A 2Y0SE 5JEAG 4JI5Q 2E2IH 5J3BA 4UP7A 4P73A 4JI6Q 3K7UC 2R92G 4NPSA 3S2HH 2UXCQ 1TWHH 1L2FA 4UY8C 4GN4B 2DGYA 4JG2A 4LWCA 4BY1G 5M3MH 4LF4L 4KHPL 4KHZA 4A3JH 5IYBH 2YV5A 4A3IH 4HJAA 4JI0L 2DUDA 3H0GG 4DV3L 1Y1WG 1JJCB 3J81c 1BKBA 1K83H 1NMGA 3MXNB 1VQJA 4DV4L 1JJ2A 4UPAA 3PO3G 3CPFA 4JYAQ 2Q2UA 2CKZB 2QEXA 4DV1Q 4K0KL 2Q2HA 5C4XH 3K81C 4GN5A 4KI0A 4GOPA 1HNXL 1CKOA 1B70B 2E2HH 3AFPA 1VQ9A 4YHHQ 3PO2H 4LFCL 5C4XG 2WB1G 4JI0Q 4WJ3M 3RN5A 2RHSB 1Y1VG 4LFBQ 2UXDQ 1V1QA 3EN2A 4AYBG 4A4IA 4A93H 3H0GH 3TQYA 4LF8L 2R7ZG 4MZ9A 3B6YA 1HNWQ 2AWOA 4BY1H 4B3RL 5IWAQ 2VQFL 1S40A 3U4VA 2HHHQ 4IPHA 3CCLA 1HH2P 2UUBQ 4BY7G 3H3VH 1HZ9A 5BR8Q 3D0FA 1E1OA 4UP8A 1N33L 3M7NA 1X56A 1PVOA 3OTOQ 1AH9A 4JI4Q 1FJGL 4A3KH 3CCUA 2R6GA 3HOVG 1U5KA 2RCNA 1GD7A 1MIUA 1YBYA 1XMOL 1QVFA 1D8LA 4DR5Q 3W5OA 1G51A 3G48A 2EQSA 1L1OB 1V43A 4FDBA 1XJVA 1WYDA 2ZJRA 1M1KC 4A3LG 5K36G 2VZAA 3ZJYC 5HGQA 5C44G 4DK3C 4DR3Q 1HNZQ 3OTOL 2ZM6Q 5GAEC 4P71A 1OXTA 3U4ZA 4LF6L 5IP9H 2EXDA 5IY0A 4HJ8A 4YCUA 4LFAL 1KC8C 1P16A 1L1OC 2JA6G 1VQNA 5IT9c 2JA7H 2A8VA 3PO3H 1E1TA 4RMFA 2F52A 2LSSA 1JT8A 4X66Q 2JA7G 1VQHA 3I7FA 4LF7L 5IP7H 2HIXA 3U58A 1SR3A 2UUAL 5C3EG 1CKNA 1Z9FA 3CCMA 1R9TH 1JE5A 1N32Q 2UXBL 4JI8L 5LMUL 1JMCA 4GLVB 1XNQQ 2R92H 2JJQA 2K5NA 5C44H 1CSQA 3NEMA 3A74A 1XTDA 3E0EA 3KJPA 1OXVA 1VCIA 2YTXA 2LXKA 2VQEL 3S17H 3KFUA 1L1OA 3K0XA 2OWOA 1VQAA 3I2ZA 5ELNA 1IBML 1IXRA 4YCWA 3HOUH 3CCJA 5IYCG 3UDFA 5IE8A 3HOXG 1YZ6A 1XNRQ 4X64Q 4HIDA 3CCRA 1K9MC 2N8NA 2NZOA 3ERSX 1E7ZA 3EBEA 4DR1L 2LXJA 2PI2E 3W1GA 1M90C 2NN6I 1AE3A 4DUZQ 4JI3L 4X62Q 4DR6Q 4DUZL 4O2DA 2EIFA 3S16H 1PH2A 4XTCS 3WWVA 1PH1A 3ER0A 3GTQH 3KOJA 1EOVA 1K0RA 1NMFA 3BU2A 1Q46A 2WAQE 3BZKA 3G6EA 3T1HQ 1N36Q 2R93G 1OXSC 4R4IA 4NXNQ 4JCVE 2PI2A 3M9BA 1K8GA 1Y1VH 2NVYH 1YHQA 4PG3A 2Z6KC 3RR5A 4LW1A 3RLFA 4IFDG 5C4JH 1J5EQ 4LF8Q 1GKHA 1HR0W 1RL2A 5LMNW 4HIMA 4DV5L 1Q1BA 3KDFA 3L7ZC 1QZHA 3M85A 5HY6A 4GOPB 1NJIC 3CPWA 2NVQH 4LFBL 1PFSA 3PUZA 5GAHC 2IT1A 2GVAA 1RIPA 1Y14B 1A62A 5IYDG 5ELOA 1XMQQ 1FL0A 2I5HA 4QGUA 1X3EA 2BA1A 3HKZG 1P8LA 5H1SE 1VQ6A 3G4SA 4A3MG 1G291 3KYHC 1XNQL 1IBLQ 5AJ3Q 1A0IA 5JJLA 1GM5A 4C3IH 1SRUA 4JYAL 3J80c 1UWVA 4A3CH 1YHBA 1HR0L 4IOCA 4NB3A 5LMNL 4B3SQ 2F4VQ 2VNUD 2JEAI 4A75A 3KF6B 4DV3Q 1N9WA 1W3SA 4DR3L 1VQBA 1HNZL 2E5LL 5M5YH 1UE6A 3GTMH 4A3CG 2IHEA 1LTLA 4DNIA 3CAMA 4AQYQ 1ASZA 1VQIA 1JJGA 4LUZA 2A19A 2I5MX 4JI1Q 1C7YA 4A93G 4DK6C 4NXMQ 1PH8A 3JC66 4ALPA 1D7QA 4A3MH 1MJEA 2E8GA 3VDYA 2CQOA 2ZTDA 3GTJH 4A76A 5FLMG 1X55A 1WCMH 3PUVA 1UEBA 4OWTB 5GAGC 4LNQA 1NBWA 3KLWA 1EWIA 4C3JH 3HOZG 1PYSB 5GQOA 3J80i 2HIVA 2ID0A 4NXNL 4YY3Q 4B3TQ 2OCEA 3S24A 4GKJQ 3U50C 1PH9A 1ASYA 4JI4L 1FJGQ 3AEVA 1PA6A 1EQQA 2ZJQA 1KHIA 2C35B 4BA2I 4IJLA 1Y1WH 2D0OA 2CCZA 4J15A 2UUBL 1DGSA 1TWCH 2Y0SG 3F2BA 4P72A 4IJHA 1UE5A 4TQUS 4L5RC 1J6QA 1LUZA 3PV0A 4YHHL 4X66L 1YITA 2R7DA 1VQ8A 4JI7L 4JI7Q 1HR0Q 2JA8G 1C9OA 1T9HA 1WOCA 4DV4Q 4LFAQ 4A3EH 4LF7Q 3AFQA 4HJ9A 5JJKA 1IBLL 1VQKA 4HJ7A 2VUMH 1PYBA 4DV7L 2KENA 4IPCA 3RZOH 2JEBI 1UE1A 4PZ6A 3CC4A 4B3MQ 1UE7A 1WJJA 1J5EL 2PMZE 4IFDI 2AWNA 4R4TA 1X6OA 4POFA 4KHPQ 2R93H 3CXCA 3AQQA 2H5XA 4K0KQ 1TWGH 4ME3A 4P75A 3GTOH 5M3FG 2ES2A 4DAYB 2VY3A 4IPDA 4POGA 3KDFB 1CSPA 3Q8DA 1Q1EA 3HKZE 4GKJL 3J7A5 1QZGA 5M5XH 1Q8KA 3M4PA 2A1AA 2V1CC 4AYBE 2JA5H 1B7YB 1IBKL 1SN8A 4DR5L 1V9PA 1I50H 2UUCL 1VQGA 1LYLA 2B63G 5GADC 3T1HL 2JA6H 3HOWG 2JQOA 4X65Q 1XNRL 1X3GA 3BZCA 3PF5A 1H95A 4GNXB 3H3VI 4OONA 3CCSA 5LMNQ 2UU9L 3CP0A 4DAMA 3HOYG 3CF5A 1B8AA 1YJWA 4DR7Q 4PMWA 3JAMc 4IOAA 1Q12A 2VS1A 1BBWA 4EX5A 3PGZA 2KHIA 1KRTA 4DV7Q 1IBMQ 1XPRA 2I0QA 3FHWA 3CMAA 1VQPA 1N32L 2UXBQ 3I4NH 1E3PA 2VQEQ 4OWWB 3HOVH 1IZ6A 4L5TA 1CUKA 3TS0A 5JJIA 4LFCQ 3I56A 4R4QA 2Q2IA 4BBRG 3RLOA 2IY5B 4BY7H 2KCMA 1VQMA 3S1QH 2HT1A 3FKIH 1EUJA 2R7ZH 4H02A 4P74A 3M4OH 2D0PA 4L5QA 4APVA 5C0XG 4IO9A 4JI6L 4LF6Q 3I4MH 4LUOA 3ULJA 4QJFA 4QL5A 2K5VA 5M5WH 4X65L 3CMEA 1VQFA 3RN2A 2PQAA 3MEFA 4DR2Q 2ZJPA 5IP9G 1XMOQ 2F3IA 1PH6A 2ZTCA 1NY4A 3HOWH 2WB1E 3CW2C 2QGQA 4PZ7A 3RLNA 2ASBA 4DR4L 5FJ8H 3TEHB 3STBD 3A5UA 1MJCA 4JBJA 4HIOA 5BR8L 1N33Q 1A63A 2OQ0A 1KAWA 4A3IG 1PH4A 1N34Q 1HNWL 4DR4Q 1Z47A 2K75A 2PNHA 5M3MG 1Q86C 2E5LQ 4B3ML 4QQBX 2KCTA 1HZCA 2CFMA 2JA9A 2JK8A 2AKWB 2I5LX 1X9NA 1A8VA 4JBMA 4B3SL 3T1YQ 2RF4A 2QA4A 1YIJA 4JBKA 1XPOA 3UDXA 2UUAQ 4DKAC 3ICEA 1YVCA 3S2DH 2D62A 4AQYL 2MO0A 3S1NH 3I4NG 4DUYL 4R1JA 3PIPA 2IHFA 3CD6A 3PCOB 3HOUG 1YHAA 4TVAB 1VQDA 2VW9A 4KLKA 4R4OA 3PUXA 4DV2Q 1G6PA 1YEZA 3S14H 3PUYA 4C2MH 2N78A 3I55A 1K3RA 2FXQA
chains in the Genus database with same CATH superfamily
1HJPA 4TQRA 1BR9A 1VQOA 1TWAB 1E24A 2J9GA 2HQLA 2OQKA 2G9HD 2F0VA 2WAQG 3OOCA 4FF4A 3M3YH 3TREA 2FJZA 4CC6A 4EGJA 3D6CA 3PR4A 1BDOA 1G2SA 4LF9L 1ZETA 4UCTA 1VBHA 3PMFA 4N8X1 5EQ0A 3E6ZX 1I6HH 3K7AH 4JI7H 2QDBA 4YCVA 3QR8A 2YZMA 4ECTA 3T1YH 4XIGS 3GTOB 2ENBA 2MFIA 2ALYB 3FKIA 1EIGA 1I94Q 1TY2A 3J81E 2F0LA 2X6GA 4JOIA 1SBBB 3I3CA 3WO0A 1SE3A 3CHBD 2CW0C 3NBIA 3F2UA 1FVIA 4F4YA 4DR6L 1IBKQ 3GTJB 2ATLA 1QUQB 1JQYD 3OW2A 5CGKA 4A3GH 3JAML 4MV9A 3I91A 1S72A 3TDQA 5KFZA 4JV5H 4C3JB 1R9TB 1BVSA 3D8GA 4DV0Q 2F4VL 4OO1I 3TQTA 5CYUA 1SROA 3J7AK 3GTLH 1EU4A 4AIMA 3H15A 3GO5A 1H9KA 3ULPA 1K73C 3OTOH 1PHJA 5EZYF 1O80A 4DV0L 2HVSA 3E9HA 3H20A 3DF7A 4BXXG 2E2HA 5IYDH 3JAMW 2FMAA 2NU6B 4F87A 3BYTB 4A3BH 4JC0A 1STAA 4JW0A 3HOZH 4YWLA 3E9IA 1N8RC 3D4DA 4GNXA 1K8AC 2KEEA 5IYZF 1PZKD 1FNUA 3VR4A 1HNZH 1I94L 5CORA 1SMXA 5KFWA 2W9CB 2EYHA 1LT6D 1TWGA 1BGWA 3J7ZC 3J81j 4DR1Q 5IYBG 4OEMB 3FKIG 3CKIB 4R8NA 2ATWA 1KXLA 2W9CA 4JI0H 1Q82C 4KHPH 1W2BA 1DYQA 3F8TA 4PZ8A 1QVGA 2ZXRA 4Q8EA 3OHXC 4NXML 1O7IA 3VA5A 2V4QA 2C2RA 3GTQA 3RTXA 1XPUA 4B3RQ 1WTOA 4ED0A 3V2TA 2F0FA 5KNDA 5BR8H 4JI4H 1SNQA 1JWUD 4JI8Q 3S15H 1EIYB 4YWKA 2YTYA 1MSGA 5C1OA 4ED1A 1FNWA 3BAAA 2K01A 3OWEB 1VQCA 4ECSA 3KTMA 3D31A 4EBEA 5KFEA 4C3HB 4RAZA 2WYOA 4R9WA 3GD7A 4A3BG 1XMQL 2N3SA 5IP7G 1GXDC 2DNEA 3NELA 3S1QB 4K6LA 4BXXH 3ORQA 4DV2L 4ECYA 1F9PA 3RZOB 3F1ZA 4PV1C 1SMYD 3NTHA 2NN6G 2PO4A 4X6AH 2VUMB 2C00A 2XRQD 3CCEA 2NUAB 4KN7C 3V05A 1I7NA 5BPHA 3K8AA 1VQLA 4MTEA 4ECXA 4ED7A 1KQSA 1S0OA 2R6FA 3A7AB 4A3DH 2C22A 1E2VA 2ZM6L 5IOCA 4LF5H 3S1MH 4A2AA 3KHHA 2QDLA 3W1BA 1YJ9A 4DV2H 1SYDA 5C0XI 1I3QB 4A3LH 4MTNA 3SGIA 1OXXK 4OX9L 5BMVF 2EPBA 1JOQA 5F9LA 5M3MB 4DV0H 4DR2L 3GV8B 1BXTA 5CBAE 5IWAL 2HHHL 2OTJA 1UC9A 3G6YA 3KF6A 2Y0SE 5EBDA 4JG2A 2DGYA 1GLVA 2YV5A 4A3IH 2CHBD 4HJAA 3H0GG 3BS1A 4JI0L 4HAEA 4DV3L 4RNOA 2EYJA 2EXZA 1BKBA 3MXNB 1VQJA 4K2KA 1BO0A 4K0KL 4RFBA 3PIO3 3PO3G 2M2LA 5D1PA 2WKDA 5IGEA 1JX4A 4KI0A 5JVLA 1HQRD 1EEFD 3E3XA 3GTMB 4RU9A 2IBKA 2HCIA 3S9WA 5C4XG 2R3ZA 3MFHA 5K5PA 4BY1B 2C5CA 4UAIA 2E75C 2RHSB 3RN5A 1A3UA 2JSOA 1ILQA 1PDQA 2I46A 4A3MB 4PMBA 3QZ8A 2UXDQ 4AYBG 4K6DA 3IFTA 2B2VA 3KBGA 2HD3A 4FXGC 3TQYA 4LF8L 4OHJA 2LS01 1DOMA 2IW3A 1HNWQ 3MXPA 5IIFA 2VQFL 1KDBA 3U4VA 2JA6B 1E4EA 3CCLA 1HH2P 3H3VH 5BR8Q 1N33L 3BA9A 4UP8A 2A74C 3GIDA 3OTOQ 4JI4Q 1LTRD 2PW7A 2R6GA 1S5CD 4HCEA 1U5KA 2A6HC 5D1OA 3AMUA 2EE1A 2FLPA 5TSSA 1D8LA 3GQBA 1F9RA 2W9BA 2QEJC 1D2BA 1SDFA 3R5XA 1V43A 2ZJRA 2PN1A 1LTSD 3ZJYC 2R7KA 4TQSA 4A3KB 4YR0A 1QG7A 2OEOA 5C44G 2RDJA 2CH4A 4DK3C 1HNZQ 5EKKA 4P71A 4B3SH 4HJ8A 3Q8PB 2A68D 4U6PA 1KC8C 1SJED 1TWFA 1O7YA 4H13C 1C30A 4QWCA 4AQYH 5LHY1 5KG5A 4Q8FA 1E1TA 3M4OB 4XQQA 2R7ZB 1B33N 2VA3A 4YY3H 3HXLA 3A55A 4X66Q 3I7FA 4PDBA 2CZGA 5JVDF 2HIXA 2KCCA 4DR2H 4EBDA 4O3RA 1IHZA 1CKNA 5C3EG 3PIP3 3D3RA 2UXBL 3N42B 5KFDA 3GIJA 5KG6A 1B44D 4GLVB 4NXNH 3HKZA 2K5NA 5LL6X 5C44H 4L63B 2RDHA 1FKAH 3NEMA 3E0EA 2F1MA 1ZHSA 2E76C 2EDGA 2L55A 2EYOA 2VQEL 1SYBA 5LOVF 2KUMA 3K0XA 2IJ0A 2B63B 5KG0A 1EYDA 2W7PA 3R2IA 3CCJA 4DR7H 1XNRQ 1K9MC 1GUSA 3OSNA 4K5WA 2PI2E 1IKMA 2HUGA 2XRSD 4JI3L 4X62Q 2D2CC 4ETSA 4R8UA 2EIFA 2XCLA 4QWEA 1EY4A 4XTCS 3K5IA 1D1IA 2YRXA 3FDSA 4IQZA 2NVQB 4R4IA 4ME6A 1RYSA 3L4JA 3T16A 5EPKA 5LL6b 4LW1A 3RLFA 1E4FT 1GKHA 1SNDA 2RVLA 4A3FB 1AN7A 2V4DA 3BG5A 2JA6A 5HY6A 4LFBL 3PUZA 5GAHC 1I50A 2GVAA 1YNJC 1E0BA 1Y14B 4ZRZA 2HVQA 1XMQQ 4QGUA 2E2JB 1LTTD 4EFEA 2Y0SB 2E74C 1AZPA 1A0IA 1GM5A 1F2ZA 3N8DA 3EJIA 1UWVA 2ZM6H 2LMCB 2HCCA 3Q1KA 1HR0L 2R93A 2VNUD 2AUJD 4DR3L 1W3SA 2UUAH 2D9UA 2K6AA 5M5YH 4QMGA 3CAMA 1ASZA 3PW2A 1VQIA 2A19A 2I5MX 2UVRA 3EROA 1XX8A 4DK6C 4A93G 4FP5D 5E3FA 1PH8A 4ALPA 1D7QA 3RB0A 1MJEA 3BYYB 4QUCA 2BQUA 1EQVA 2CQOA 2ZTDA 4UHVA 5KYIA 1X55A 3RB6A 2QF7A 2VQEH 2FPPB 4OWTB 5KFUA 2E2DC 5GAGC 1K1QA 3H3VC 1EZ8A 1PYSB 4NXNL 4YY3Q 1CFMA 4IUQA 1W6KA 1Y1VB 1ZYRC 2NVYB 5D8DA 1DOLA 3D4RA 2NTSA 1B9MA 1HPCA 1PA6A 3BDOA 3G6JB 1JR0D 2A69C 3OIPA 4J15A 2CCZA 2UUBL 4ED2A 2Y0SG 3V6JA 2C2DA 2O5IC 1H9SB 1HFGA 1PLFA 1J6QA 3PV0A 1YITA 1CQVA 2R7DA 1VQ8A 5IGBA 3U9SA 3C1EA 4X64H 2NVXA 4RUCA 1I94H 3H09A 2JA8G 5KG2A 1C9OA 4KJOA 3NE5B 5C4ZA 3TQ1A 4ILWA 1EWCA 2J6TA 4LFAQ 4LF7Q 1SEBD 2EYMA 2W9BB 1IBLL 4ZKBB 1PFBA 4DV7L 3TP8A 1SCUB 3RBEA 2JEBI 4I7AA 2AGOA 3OMGA 3HEJA 5EGTA 3T1HH 1RTNA 2AWNA 2R93H 4K0KQ 1NNXA 4ME3A 4P75A 4G7OC 4MTDA 1FD7D 4IPDA 3KDFB 1I6HB 1CSPA 3Q8DA 2NUCA 3O13A 3HKZE 4RCOA 1EYCA 3VYUA 4GKJL 2EY1A 4X3UA 5BN4A 1X32A 3S1RB 2A1AA 1B53A 2V1CC 2MGSA 4AYBE 1B7YB 4CBVA 3H4BA 5I2YA 3PVXA 5KFRA 1I50H 1EIHA 1VQGA 1LYLA 2B63G 2KQ3A 5FPOA 3HOWG 5JPMC 4ED3A 1DJRD 3BZCA 3PF5A 3H3VI 4KKSA 4I55F 3RUPA 4DAMA 1F2YA 1WTXA 3HOYG 3CF5A 3Q8RB 4DR7Q 2KOLA 4PMWA 1HQMC 4A3JB 4X62H 3ERQA 1IBMQ 2I0QA 3HGBA 1F2MA 3CMAA 1N32L 4OWWB 3BQ2A 2I87A 4LF4H 2NYZD 4MTKA 4R4QA 1HRJA 2J7ZA 2W6NA 2PZTA 1VQMA 3A7LA 1TS2A 3WO1A 2DJGC 1LT3D 1B6SA 4APMA 1NCVA 1EYZA 5EOYA 3NWSA 4APVA 2M05A 4IO9A 5E4XA 5HGTA 4FBTA 3ULJA 3HOWB 1XMQH 4HN7A 2K5VA 5CB4F 3VYRA 4X65L 3MC0B 2C28A 2PW5A 1TWFB 3DXJC 4I4TF 3CQZB 1DONA 1F77A 1J5EH 1IBLH 1CM9A 5IP9G 2ZJPA 1B3QA 1ULZA 4YAKB 1XNQH 4QIWB 1JORA 1ML0D 2WB1E 2LFNA 3GQCA 2DPIA 4OIJA 2JA7A 1OWTA 1GOZA 2DN8A 3DWPA 2SCUB 4UCVA 3T5HA 4A3IG 2Z4IA 4FBUA 1Z47A 3OPOA 1Q86C 3DM1A 2DIKA 3I90A 1SNCA 5BN3A 4B3ML 4QQBX 2KCTA 1HZCA 1U4MA 1C3OA 2QKIC 2AKWB 2I5LX 5C4XB 4B3SL 3H6MA 2FK2A 2MJ8A 3T1YQ 4RAYA 4J9KA 2IX3A 2QA4A 3SVMA 4JBKA 1XPOA 3UDXA 4KY7A 1JB3A 2JA8B 1E4EB 1WSCA 1SSOA 4AQYL 1Y1WA 4H44C 4KY5A 4DUYL 1CS0A 3PCOB 3HOUG 3MR3A 3BDLA 3KBXA 3PUXA 5KIXA 3BDCA 1G6PA 1QCBD 3QIAA 2HQEA 3LWUA 4KY6A 1LLRD 4O4LF 5DQGA 1I7LA 1EIFA 3FPUB 3CCQA 4KTAA 3T5KA 5JJZA 3GTMA 1KD1C 1HNXQ 1SMYC 5KFCA 4NDXA 2C9OA 4XYLB 4IURA 4L5SA 4DAPA 4GOPC 1FGUA 1SLJA 4DL2A 2NU9B 4LH7A 3I73A 1KRSA 4IZ8A 5M5YB 3PSIA 3PIOA 2UXCL 1WCMB 2XTIA 3PQIA 4X3SA 2YW2A 2WP8J 1BCPC 2HGSA 2B29A 2F0MA 1UAPA 2JXMB 3HKSA 3J81L 2KHJA 1NTGA 4IPGA 2W70A 4JI5L 1YJNA 1WCMG 4GKKL 5J1ZA 3UDGA 1QB5D 4GN3B 2DNCA 1CKNB 4X66H 2R7FA 1TKWB 5EWFA 2UXDH 4X62L 4JI3Q 2BH2A 2VUMG 3BJUA 4R4CA 4A3EG 4OO1G 1VS0A 2Z0SA 2KSWA 1CQIB 1TXYA 1PRTC 4X64L 4FF3A 4V0BA 2PQAB 2K33A 2WAQA 1Q3LA 5JQWA 3KHGA 4IFDJ 2K1BA 1HNWH 2XSCA 1W96A 1X3FA 1SNMA 2VUGA 1VBGA 3L2PA 3I12A 3NBHB 4OGQC 2Q2TA 1BF4A 1JWSD 1HCZA 2R84A 3OMCA 5JVG3 2F0TA 3RNUA 1Q8IA 4JBWA 2JEFA 5COYA 5C0XJ 5JH7F 1TWAH 1MD2D 4XDXA 3U9TA 4BA1I 1SFOH 2AQ1B 5GROA 3DM3A 3UDIA 4YR2A 4GLXA 2NVTH 2K4KA 1CI3M 2W8LA 2E5LH 1WI5A 1MI2A 4OXPA 5FLMH 2EJMA 2ZT9C 4LF4Q 4GKKQ 5DGBA 2AMCB 2ZXPA 2FLLA 2KJXA 4CDFC 3ULLA 4YWMA 3F2DA 1VMCA 1M4VA 3C2PA 1OTCA 2YTVA 1EQTA 2XNAC 1I50B 5KGUA 1KABA 2ASLA 1RJRA 3MXUA 5KFYA 1STBA 4NP5A 2VPQA 4YY3L 4NXNQ 1RTOA 2N49A 4QW9A 2ZTEA 3K3VA 5M3FH 3N41B 3V96A 1LTAD 4WBNF 3TS2A 1KL9A 1IOWA 4LF5Q 3HOXH 4A3GG 4C5AA 5IYCH 3RV3A 1ZKOA 1RCVD 3SI8A 5LMUQ 3MA2B 4OX9H 3STBC 1PH3A 4BBSH 4MA0A 3BQ0A 2R87A 1JXLA 1VQ4A 1AN8A 4DV6Q 1BNZA 4QIWE 1F9QA 1XNRH 5L9XA 1FGBD 1G6ZA 1SYCA 1TS3A 3MWMA 4DUZH 1ET9A 2BCOA 1VQ7A 4GS3A 1SYXB 4XX0B 3HOYB 3LWBA 1SE4A 2L1BA 2IL8A 4OELB 1JB7A 4CDEC 1N33H 4IRCA 3P7JA 1Y1VA 1KIXA 2NVYA 4RB3C 1QVCA 1ZXTA 1K1SA 4JK1C 3EIVA 2UU9Q 1EY9A 2B3GA 4Y7NH 1RHPA 1BXRA 2UVVA 3M4YA 1K3BC 3NUCA 1N36L 2R82A 4BBSG 2XGTA 4JV5Q 2W57A 2R8GA 3LP8A 1OO9B 4RHSA 5M5XB 1IYJB 4HCSA 2DLNA 1MGSA 5D3IB 1TWHB 4OX9Q 1HA6A 1I6UA 1Q90A 3E0JA 3VR6A 2VQFQ 4FNFA 4XYOA 4JI5Q 5KFIA 3MZ5A 2E2IH 4UP7A 1K83B 1I4XA 3CRLC 4MV1A 3RAXA 4FF2A 4RCNA 3BA8A 4HTHA 4YJ2F 5KFTA 4UY8C 3GV6A 5KG3A 4LSXA 3IL8A 4BY1G 4LWCA 3X3MA 1JOOA 4YBZB 4JV1A 1JJCB 3J81c 5D1OB 2Y0SA 4RA8A 3RUZA 1JJ2A 4EYHB 1GUTA 4ZAIA 3JRXA 2Q2HA 5DLFA 4GN5A 4EQPA 1AEXA 4GKKH 2L11A 1CKOA 1B70B 1GSAA 1D1KA 2QW7A 1I4PA 3AB9A 1VQ9A 3PO2H 2WB1G 4JI0Q 3PZPA 2W6ZA 4IRDA 4A3EB 4DXFA 2A6ED 1Z2OX 1Y1VG 1B04A 1SXTA 3V6HA 3LX0A 3BVMA 2A69D 4A4IA 5KFNA 4A3DB 1STYA 2IA6A 2FK3A 1KBLA 4UCRA 4XQJA 3B6YA 2FB9A 2B2WA 1KJ9A 4IPHA 2AGPA 2FHTA 3D0FA 4HNVA 1X56A 4CDDC 3Q8SB 1FJGL 2ZDGA 4CHTB 4JV0A 4A93B 2MP1A 5KT4A 3HOVG 5KFPA 5D14A 1YBYA 4IUTA 4KHVA 2XGPA 3NXWA 1QVFA 4RGMA 3GTKB 2B63A 2P5ZX 3M9NB 4FDBA 2Q8IB 2YYAA 1WYDA 4RAUC 4BWGB 3HBLA 4FS2A 3UQ8A 3OTOL 2ZM6Q 4LF6L 2Z1CA 4ECVA 4YCUA 4KKUA 4K0KH 1BCPF 4Y8VB 2A8VA 3ONAB 4RMFA 3ETHA 2LSSA 3JSNA 4JI2H 1VQHA 4LF7L 4J9NA 4DL4A 1V4YA 3U58A 1H9JA 2UUAL 2MCTA 1Z9FA 2WV6D 1JE5A 2FMMA 1N32Q 4JI8L 4IUUA 4YB8B 4U68A 2DWCA 1XNQQ 4LH6A 3KXYT 5F2DA 1V51A 3R5FA 3PW7A 1XTDA 4QWAA 2FE3A 5J39A 2YTXA 3S17H 2WB1A 4TV8F 1L1OA 4TV9F 5KFQA 3GTGA 2OWOA 3VPBA 1FR3A 5FPRA 5ELNA 1BUVT 3MFIA 1IXRA 2YU9A 4MHEA 2PPBC 3HOUH 3R8BA 2F0DA 5DGAA 4HIDA 3CCRA 3GTPB 4MV6A 2SNSA 1SYEA 1E7ZA 3ERSX 4O4HF 2LXJA 3W1GA 2F0SA 1AE3A 4DUZQ 1LT4D 3RB4A 5CV8A 4DUZL 1NSNS 4ZK9B 3MWEA 1PH2A 1HR0H 1PH1A 4RZRA 2VB2X 3BZKA 4O1NA 3G6EA 1N36Q 4J9RA 3GTKA 1GUOA 3JAME 2GPWA 3I8ZA 3RBDA 5HV6A 2Z6KC 3RR5A 2VOBA 4IFDG 5C4JH 1J5EQ 1L2ZA 4U7CA 2QCPX 1RL2A 1QZHA 1Q1BA 1Z6HA 1NJIC 2IT1A 1RIPA 4PNYA 1BOSA 5ELOA 1FL0A 2EYPA 5E4WC 1X3EA 3OW7A 3HKZG 2RQXA 1T94A 1PYWD 5H1SE 1G291 3KYHC 1XNQL 2W71A 5KG4A 4IR1A 4JI6H 5JJLA 4UCOA 1W6JA 5EKLA 5KEEA 3K7AB 1S97A 4KV6A 4NB3A 2F4VQ 4O3NA 3HKZB 3S14B 4YIJA 4A75A 3GTMH 4A3CG 2E5LL 1TVXA 4RB1A 1JJGA 4LUZA 2W9AA 3IG0A 3SHLA 1C7YA 1YNJD 2YU9B 1AUXA 2UVUA 3JC66 4J9MA 4A3MH 1U4LA 2E8GA 3TN2A 1I3QA 4ABNA 3GTJH 5ELEA 1VKZA 5FLMG 2VQDA 2WDTA 3PUVA 1I4GA 1QE6A 1UEBA 2RGVA 5J22A 2YZGA 3QOLA 3KLWA 4C3JH 2E2IB 5GQOA 1CA5A 5K2MA 5LL6S 2OCEA 4GKJQ 3GIMA 3T5JA 3Q0AA 1EEID 3K5HA 3U50C 1PH9A 1ASYA 1SNOA 3AEVA 1EQQA 1KHIA 3L3OC 4BA2I 4IJLA 1Y1WH 4IN3A 5EWGA 3PW4A 1TWCH 1KNAA 3M9OB 4EEYA 4P72A 1WVLA 4TQUS 3MJFA 2R8KA 4YHHL 3PO3B 4ZLTF 4HMIA 3EA6A 3I4NB 2YZNA 3TINA 3L4KA 4DR4H 5C1PA 1T9HA 2HDMA 1WOCA 4JI1H 2F0WA 3D4WA 4A3EH 4OIKA 3AFQA 4HJ9A 2VUMH 4CKCA 2B8FA 2KENA 2IMWP 5KFVA 4PZ6A 3CC4A 3G6XA 1Z7TA 3SK4A 1KDAA 2ICEC 5KNBA 4KHPQ 3AQQA 2ES2A 3KHRA 2K04A 2R7NA 1YNND 2RSOA 4GKJH 2EJFC 2CW0D 1BCPD 4IUPA 1CHPD 4RWSC 2JA5H 1JDEA 4DR5L 4U673 2WE6A 3UFXB 3RAQA 2JQOA 1N56A 1XNRL 4IALA 1N32H 4OONA 5FD5A 1HTLD 5LMNQ 3HB9A 2WACA 2UUBH 3EPIA 3GTLA 1JWMD 4DL7A 1RK6A 1HNXH 1B8AA 1PZID 1YJWA 4NLGA 1G8ZD 2DY7A 3JAMc 3NQTA 1BBWA 1TQOA 2XWBB 2F0GA 1KRTA 3K5LA 4C3HG 3K57A 5CA1F 4B3MH 3ITPA 1S10A 5C0XH 3FHWA 3VPCA 1VQPA 2RCFA 1E3PA 1D6EC 5DQIA 1CUKA 3TS0A 2I80A 4EGQA 4RGNA 5JJIA 4LFCQ 1B2TA 2ASJA 4BBRG 1XYIA 3EPGA 1NAPA 4BY7H 1PFMA 3TMEA 3WOFA 2R86A 1I4QA 4ZQ3A 1KAAA 4P2CB 3OSPA 1B9NA 1SFOB 2D0PA 5C0XG 3OIQA 2B2TC 4RHRA 4DA2A 3MAQA 3J80E 3I4MH 2IWHA 3H40A 4X65H 2FKLA 4LUOA 1RF2D 3KLSX 4QL5A 2TSSA 3CMEA 1VQFA 1JCKB 4DLKA 2PQAA 2XWJB 2EOTA 1JC7A 5CV9A 5KFLA 4JPBW 3MWDA 4CJ0B 3DEOA 4DR4L 3RLNA 5M5WB 1EFID 4G7ZC 5M3FB 3A5UA 1MJCA 5KG7A 4HIOA 5BR8L 1N33Q 2K28A 2JEGA 4HR7A 2YL2A 2NTTA 1PH4A 1ICFB 1HNWL 1DIKA 4DR4Q 1S5BD 1U4PA 2K75A 1V1OA 4K8JA 4LFAH 2RSNA 3E5SA 3SEBA 2F03A 5C3EB 5JEAH 1YIJA 4I50F 4IR9A 5LA6F 3S2DH 1YVCA 3VMMA 1O7ZA 2UU9H 4NMZA 1YHAA 1VQDA 1Y69U 3BVZA 1M7JA 4LJZC 4XYQA 1KJQA 4X3TA 4RH6A 1L0WA 2FXQA 3T1YL 2FPIB 4F50A 5C44B 1A6XA 1MKHA 2NB0A 3DWAA 4MNOA 2R92B 3K6OA 2VA2A 4ECRA 4B3RH 2MNAA 1V1PA 2GN5A 3K59A 3NENA 3RFCA 3L0OA 3GV5B 4DNRB 3F2CA 4O3SA 3CQZH 5FLXW 2XD4A 5T1IA 1C4QA 5FJ8G 5LMNH 1S9FA 2VL6A 2AQ2B 4A3JG 3GTGB 1N34L 2KBNA 2IX1A 3MFYA 4K8IA 1DOKA 4A3GB 3GV3A 4O2BF 5JEAJ 1K83A 5IT9E 5CR3A 1EFWA 5J2UF 4GLAC 1Z2PX 5IT9L 1PH5A 2B39A 2L5TA 1IL2A 1EY8A 2Z8LA 1ESFA 1TWHA 1AE2A 5C4HA 4J0MA 1WTRA 2BDOA 1IOVA 3J7YW 4A3FH 2ALZA 2MO1A 1KNEA 3AYHB 1EZ6A 3LNNA 4EQOA 3Q6SA 2K50A 4O3PA 3KF8A 2WTFA 2NVXH 1X54A 2NZ1D 3VA7A 4WJWA 1EY7A 2OH2A 2WFWA 5IT9W 1L0XB 3TZDA 3H0GB 5FD6A 1S3OA 4RNMA 1X65A 4AH6A 1C0AA 3G71A 3NHHA 1HA5A 5E7NA 4O4IF 3MHBA 3R23A 3IN5A 4JVZA 1IBMH 1BBUA 2A6HD 3CCVA 1GYFA 1K8OA 2ZJTA 2V4RA 1K8MA 4Q44A 4DR3H 1GO3E 4K2LA 4ZHQF 1WCMA 4JI2Q 4TSSA 1GVPA 2PMZB 2FK1A 2KHSA 2F0QA 3WNZA 3WDNA 5KT7A 1HZAA 4ED8A 1TWFH 1O78A 3JAMi 2RDGA 4HIKA 3G8CA 4JI2L 5LXTF 3S15B 2L15A 1MSHA 2JYOA 4JOIC 1RJQA 3J7AV 1PFNA 3N40P 3KJOA 3TP7A 1EYGA 1ENAA 4QW8A 4HQ6A 1UNNC 3HOVB 4HR7B 4LF9Q 3C0FB 1A2TA 2EJGC 2SOBA 3M4QA 4FVMA 5ELFA 3VR5A 3QFFA 4DL3A 2F0OA 3RZDH 1E4GT 5AJ3L 3OHBA 2L4NA 4A3DG 4DV6L 3G7LA 4JUZA 5ELBA 3WOEA 1HHVA 2BE5C 2BH8A 4K5VA 1WTHA 4RUAA 3UE0A 2O2LD 2WB1B 5IGFA 3GDEA 1CQFA 3GTJA 4DPGA 1I3QH 4QIWA 1SFOA 4DR7L 4DFAA 1TS4A 3K80C 2E2IA 4DV1H 2AUKA 3PUWA 4UP9A 3VR2A 1A3TA 2VXWA 1B6RA 1K28A 1S5ED 3P1HA 3FKIB 3GTPH 1GUGA 2IX0A 2AHOB 4RGOS 1VF7A 4FO2A 2XGQA 3HFZB 4A3FG 4C5CA 3T4AC 1LM0A 1SE8A 1T5EA 4FXKC 2KEDA 4ODGA 3VYTA 4E4TA 2OT2A 3D6WA 3FVQA 5L1KA 3HP3A 4LF6H 1XTCD 5CMDA 4P73A 1EY0A 4JI6Q 4QF4A 3S2HH 5FK9C 1L2FA 4YR3A 4EBCA 3BG3A 4GN4B 4PMCA 5M3MH 1GSOA 2CH4W 3ETJA 4LF7H 4LAAA 4A3JH 5IYBH 4Q0YA 4MAMA 3F8NA 4BBSB 1Y1WG 1D5ZC 3N44B 3MR6A 4DF7A 4DR1H 3JZIA 1QJOA 4UPAA 2Q2UA 2QEXA 4DV1Q 1LO5D 4F4XA 3K81C 2R93B 1DZ1A 4DL5A 4GOPA 4C3JG 2YRWA 2E2HH 1SEIA 2MHVA 4CKEA 4LFCL 3JRWA 3KHLA 2WIIB 1S68A 4QWBA 2X0SA 3NGDA 4J9LA 4CC5A 1KDCA 4LFBQ 1H9RA 4JI8H 1V1QA 3FRPB 5KFGA 2R7ZG 3V6KA 4MZ9A 4FM9A 4BY1H 4ID6A 2B2UA 4EEQA 1QWYA 5FO8B 2UUBQ 1E1OA 3VPDA 1PVOA 3M7NA 2FLNA 1TR5A 4LF9H 4A3KH 1ICWA 1AZQA 1GD7A 1MIUA 1VDZA 3ND8A 3W3AA 4DR5Q 1G51A 2EQSA 2JEAI 1L1OB 2J0TD 1XJVA 5A2QW 2L12A 1M1KC 1ENFA 1ENCA 2VZAA 2XVSA 5HGQA 1CK1A 3NBHA 4ZUJA 4OL7A 4GC6A 3HS0C 4DR3Q 1AP0A 3CU7A 1R4QB 5ELCA 4L8JA 5E1FA 5IY0A 5IGGA 2SNMA 1P16A 3CQZA 4KN4C 5G3LD 1SAPA 2JA6G 2JA7H 3PO3H 1CE8A 1EUCB 3T53B 1N36H 4B3TH 3HZXA 1JT8A 1QNUA 5A2QL 2K05A 1E2ZA 2JA7G 4PWQA 4UDUC 1WTVA 5CV4A 5DLGA 1QOHA 1R9TH 4Y52H 2ZDQA 4I65A 5A2QE 5LMUL 2F0NA 2V5AA 4F4WA 1LTID 2JJQA 4ZYSA 1EOTA 2O4XA 1DM0B 4JI5H 2K32A 1OXVA 1VCIA 3SDZA 2LXKA 3NPPA 3KFUA 2RGRA 3V4SA 4NKLA 1ET6A 5CBEE 3I2ZA 3M9MB 5IYCG 3UDFA 5IE8A 1KEEA 2AU0A 3HOXG 4X64Q 4GC7A 5L37A 2BR0A 5BN5A 3EYYA 5C5LA 4C56C 1AUVA 1JIHA 1JLLB 3MR5A 3LWEA 1XDNA 3A56A 2W6MA 4Y7NB 2A68C 4Q0FA 3FMAA 3WWVA 2BOSA 3ER0A 2F0IA 3GP7A 1NUCA 2FJ2A 3BU2A 1RDPD 1IW7C 2UVWA 1OXSC 3MR2A 4JCVE 3M9BA 1K8GA 1ZHQA 3GIKA 2F0HA 1VMPA 2MPMA 2QYZA 2R8HA 1IYVA 3OWFA 4LF8Q 4DXGA 2R8JA 1STGA 4DV5L 3KDFA 3L7ZC 3M85A 2NVQH 4LFBH 4DAYA 4EGVA 5FO9B 1PFSA 1U9RA 5EKIA 4Z9CB 1A62A 1JDBB 4J6HA 2I5HA 3LMLA 2EY2A 2RKSA 1PK8A 4ZOLF 4YQWA 5HURA 1M0WA 2XN9C 5I6WA 1N34H 5AJ3Q 5LP6F 2EZVA 2PZWA 5CV6A 1AFPA 3J80c 2YS7A 2FP4B 1N48A 1YHBA 4IOCA 4B3SQ 2FMCA 3T13A 2NVTB 3HOZB 4DK1A 3RD4A 1XWEA 4DV3Q 1HNZL 1N9WA 4DR5H 2UXBH 1VQBA 4LMQD 3Q23A 5DAUA 1H9SA 2IHEA 1LTLA 4DNIA 4AQYQ 4QUFA 4OO1H 4JI1Q 3TIGA 1PMRA 1RJPA 4NXMQ 1BQQT 2CQYA 3BZDB 3H91A 4JV2A 3P75A 2NBFA 1EY6A 2L9HA 1CQJB 1WCMH 5DM63 1UUPA 2Z4HA 4A3IB 4O2AF 4LNQA 3S1MB 5M9OA 5I47A 3HOZG 4B3TQ 3FPPA 4IAJA 2GPSA 3E5NA 4NW2A 4YHHH 3S1NB 1LABA 2F0KA 3S24A 3L9AX 3TSSA 3S2HB 1QILA 1WTWA 4AYBA 4ECWA 1H9MA 3IFDA 4JI4L 3QB3A 2ZJQA 2C35B 4XT3B 2R7ZA 4MV4A 1S5FD 4J1MA 4ZCKA 1WD0A 2BE5D 4C2MB 2NU8B 3F2BA 5FKAC 1A9XA 1UE5A 4DU9A 5I9PA 1GSHA 2PYKA 1KJ8A 4UCSA 3C3LA 1M6VA 3J80W 5KFXA 3PR5B 5JAVA 3A8IE 4ME5A 5A35A 5JJKA 2CW8A 1VQKA 4HJ7A 3MWYW 1PYBA 5DNFA 3RZOH 1UE1A 4B3MQ 1F2LA 1UE7A 1WJJA 2PMZE 1J5EL 4R4TA 1X6OA 4POFA 4DNTB 5KRUA 2W6QA 2BQ3A 3RMHA 3GTOH 5KFMA 1STEA 1G2TA 2O03A 2QILA 4DAYB 4MN3A 4FXDA 4RGTA 4CGYB 4POGA 1B4OA 5KYLA 4O42A 4G7HC 4ZI7F 1QZGA 3MVVA 5M5XH 1Y8NB 4HSVA 1Q8KA 3TP6A 2A5HA 3S17B 3EFXD 1SN8A 2UUCL 3A54A 1TU2B 3CVZA 3M7GA 5GADC 3T1HL 1UNSA 2JA6H 3GIQA 3VYSA 3GTQB 4X65Q 3KLSA 2A73B 4DV6H 3SK5A 1X3GA 5IODA 3NTKA 1WD1A 1H95A 3CCSA 5ELDA 3CP0A 3JSLA 2W8KA 4DV5H 3TZUA 2IPKD 1YNNC 3GIPA 4BS9A 3PGZA 4DV7Q 2JA7B 4C2MA 1XPRA 1EY5A 1EZ1A 2EY6A 2I8CA 2F0PA 5C6AA 2OF1A 3I4NH 5KFHA 3FDTA 1SJHD 2JA5A 1TY0A 2FFKB 4AYBB 3N6XA 2JN4A 5KFOA 2WAQB 2Q2IA 2ICIA 1LTBD 3RLOA 4UFZA 3K5OA 3QOJA 5EPJA 1KJJA 4L1KA 1EUJA 2R7ZH 4H02A 4P74A 3M4OH 2B8GA 4C1NK 2Q8TA 4C3IB 1PX2A 2M9VA 5FLXL 2LY7A 4QB4A 4LF6Q 1FYCA 4LF8H 4X3KA 3Q2OA 2W7OA 2MUYA 3RGZA 4JI3H 4QJFA 3RB3A 1T5XD 3RN2A 4K5XA 1R9TA 3BVGA 1PTOF 3SK6A 1XMOQ 2F3IA 1PH6A 4F4ZA 3HOWH 2ASBA 3CW2C 2QGQA 4PZ7A 4TRDA 2XCAA 3PW0A 5FJ8H 3TEHB 2VUMA 3DWQA 3STBD 4JBJA 2B2UC 4WFN3 2F0JA 1K0SA 1N34Q 5JUMA 4L6TB 2YS6A 5M3MG 3DMUA 1M0TA 2JA9A 2JK8A 1F9SA 4JBMA 4N8FA 5FOBB 1RD9D 2RF4A 1HTPA 1TAEA 3RV4A 3ICEA 2R93G 3G6VA 5DM73 2MO0A 4YP3A 3CD6A 4R1JA 3PIPA 2IHFA 1V8QA 3U9OA 2X69A 2VW9A 4KLKA 4I7HA 3NP8A 2AQ4A 1Y1WB 4FS1A 2R92A 2OLSA 3PUYA 4XXEA 5KFAA 4TKOB 2OXPA 3I55A 1K3RA 1BBXC 2JA8H 4KJNA 2Z6KA 3PO2G 5ISRA 2YYZA 2AGQA 2PCFB 3DLLA 4QY7A 1E22A 2E2JH 4J9QA 2F3WA 4DAVA 2JEIA 2QK4A 1EQRA 5C5MA 2ZDHA 3HOUB 4RB0A 1FJGH 2UXCH 1STHA 1L0YB 5KT3A 3NK9A 2GLTA 3EQLC 1TA8A 1IW7D 2PZUA 1I5FA 3LGJA 3UI2A 1PH7A 2FPGB 2R61A 3OYYA 3PF4A 1WFQA 1T3NA 4EQ5A 2BA0A 5T1GA 2F0UA 5CA0F 2SDFA 4QWDA 4HYKA 3BABA 4JI1L 1W93A 1S5DD 2RBMA 2P0AA 3GILA 1JE4A 1Y8OB 2DY8A 3I72A 4M7EA 1ESRA 1DV1A 1B3AA 3A0JA 2F3VA 3I4MG 3A5ZB 3SK8A 2UXDL 2UUCQ 4LFCH 3K5NA 2BDNA 3A8KE 5DLQE 1T36A 2WINB 5C4JB 1YI2A 2HVRA 2J4XA 3KF8B 3GTKH 4ZQIA 1X3PA 3NWTA 3QWNA 4HJ5A 3S2DB 4BBRH 5FLXc 4M1UB 3J81W 2JE6I 4LMYA 1AW7A 2Q8RE 1GHKA 3OSOA 4EYIB 3H94A 1CKMA 5IWAH 1ZQ7A 2HHHH 1Q7YC 4C3HH 1S0MA 4DV5Q 4G57A 2HJWA 1C48A 3ORRA 2ASDA 2XIWA 1SYGA 2R7MA 4EQNA 4MA5A 1VQ5A 2RDIA 1NE3A 4LUVA 4N9TA 2EYLA 1PTOB 4ZUIA 1O7LA 4RG1A 4MV8A 2VR1A 2W6PA 3S1RH 4A2BA 3MTSA 1EL0A 2KVMA 2K03A 5FLXE 3NQIA 1HZBA 3FP9A 1RKNA 1OXUA 1XXGA 2YU9H 4YJ3F 4WJ4A 3Q8QB 4WD3A 1R4PB 3GTGH 3HRZC 2K52A 4CJ1B 4DV4H 3RIZA 2JA5G 1HXYD 3DUZA 4PQXA 2MQHA 5KFKA 4MV3A 1PRTD 4J9OA 2OTLA 4A3KG 4B3TL 4IFDI 2O5JC 1EU3A 3C1FA 4O0AA 3Q24A 5H80A 4C3IG 3IRBA 4JV5L 1S03G 2RHQB 2IP4A 2X6LA 1VQEA 2I07B 2K5HA 5DQHA 2CWPA 4B9XA 3J81i 2DPJA 3K5MA 1A2UA 4IZOA 2K14A 1IYUA 5L1LA 1STNA 5EAYA 3HOYH 2CWAA 1Y8PB 5HBRB 1U0LA 1HUMA 4DV3H 2JEJA 4C1NI 1RK5A 3W2DA 4GNXC 1PTOD 3T5LA 3AU7A 5C3EH 4ECZA 1XMOH 2BQRA 5KNCA 4EFBA 3I4OA 2B63H 4WORA 3J7AF 3H0GA 3R5HA 4DUYQ 1Q81C 5KFSA 4DV1L 4M8AA 3M3YB 4QCLA 4Q45A 2CVRA 3SR1A 3CC7A 1PV4A 1RJTA 1LACA 4G3IA 4EG0A 4LF5L 2A6EC 2JA5B 5T14A 3P20A 3KALA 1QUQA 4OWXB 1YNXA 1NR4A 2HDLA 3VR3A 3TRZA 1EUDB 4RKBA 2NZHA 3UE1A 2GVBA 3CC2A 5JEAG 1I6VC 2F4IA 5J3BA 3N6RA 3K7UC 2R92G 4NPSA 5CAEB 2UXCQ 3ND9A 1TWHH 3NSWA 4XQNA 1VF5C 4LF4L 2TMPA 2H4OA 3FEWX 3TBIB 2PNRC 4H0LC 4KHZA 4KHPL 3TIIA 2DUDA 4HNTA 2B2WC 1K83H 1NMGA 4KKTA 2EYFA 4DV4L 1CZWA 4JYAQ 3CPFA 2CKZB 4ZKCB 1PZJD 3GTLB 5C4XH 1HNXL 3PN1A 1TWAA 3AFPA 4DN4M 4DGZA 5DG7A 4YHHQ 2DZDA 4IFDH 4WJ3M 2DJFC 1M8AA 1JOKA 5JPNC 4Q5VA 5C5JA 5K36H 4FYDA 4A3BB 3I4MB 4XYMB 4R8IA 5LMUH 3EN2A 4A93H 4ECQA 3H0GH 1WR2A 1TWGB 1MBYA 2AWOA 4B3RL 5IWAQ 2HHHQ 1S40A 4BY7G 5CV5A 1S0NA 1HZ9A 5JOBA 5KFFA 3SE0A 1AH9A 3Q22A 3CCUA 3K3PA 1GHJA 1SE2A 2RCNA 3N52A 4FF1A 3C46A 1XMOL 4RB2C 2Z6BA 1II3A 3W5OA 2XCPA 4DK0A 3G48A 1MZBA 2VPSA 2J6SA 2D5DA 4A3LG 5K36G 2F4VH 4HMJA 1CT1D 5KT5A 5I4DA 2GA4B 5L1IA 4YAJB 2B2TA 5GAEC 1ILPA 5IGDA 1OXTA 3U4ZA 3GV7B 5IP9H 2B2YA 2R85A 2EXDA 3GTPA 3I4LA 4LFAL 1JKJB 3NTIA 1L1OC 1CHQD 4DUYH 4ECUA 5CV7A 1VQNA 5IT9c 3OUUA 1DXMA 2F52A 3R93A 2RDFA 4V190 2VQFH 4J9SA 5IP7H 5KT6A 1IBKH 3MXGA 1SR3A 2K5WA 1IL8A 3CCMA 4ULLA 1PRTF 5KFBA 2EY5A 5EBCA 1JMCA 4O3OA 2C2EA 2R92H 5LYJF 1CSQA 4HNUA 1I4RA 3A74A 4KK7A 4F8MA 3KJPA 3OHAA 3OUZA 3EVQA 5DG8A 1VQAA 1IBML 1U4RA 5BPFA 4YCWA 1CTMA 1YZ6A 2EVBA 1J8IA 4KD3A 2N8NA 4R7RA 2JP1A 2NZOA 4HEDA 1WH2A 3EBEA 4DR1L 1M90C 2NN6I 1GUWA 4DR6Q 3GLKA 4RZQA 4O2DA 1A15A 5FO7B 3S16H 2NWGA 3R3OA 1E2WA 3GTQH 3KOJA 1EOVA 5KT2A 1K0RA 1NMFA 4B08A 1Q46A 2WAQE 3T1HQ 2L0CA 2N55A 2AQ3B 1ZYRD 4E6IA 5L1JA 1S4ZA 2PI2A 1Z2NX 1Y1VH 2NVYH 1YHQA 5C3XA 4PG3A 1WTQA 2N88A 3DHQA 1BJTA 1HR0W 3QZ7A 5LMNW 4HIMA 4GOPB 2VB3X 3CPWA 4F88A 3GIIA 2NVXB 3BJYA 3N43B 5IYDG 4IRKA 2BA1A 2J6UA 3MEHA 1P8LA 3MXNA 1VQ6A 3G4SA 4A3MG 2YCHA 5KG1A 3KUPA 3X3NA 2K7VA 4IWYA 1IBLQ 4BWSC 4B9WA 4H7BA 4LK1C 1ONLA 5I9OA 4C3IH 4FU0A 1SRUA 4JYAL 2LKVA 1QNKA 4A3CH 4UCUA 1G91A 5LMNL 3HG9A 4LSAA 4KMUC 3KF6B 3URYA 2E2HB 3PW5A 1UE6A 3QG1A 3RF2A 5KX5F 1ZEQX 3KK7A 3IAYA 4C5BA 1PRTB 4CKBA 3VDYA 1KLGD 4A76A 1TT2A 1EWHA 1O75A 3SE7A 4O3QA 1NBWA 1TWCB 1EWIA 3J80i 2HIVA 2ID0A 4MV7A 1B1ZA 5F9NA 1EYAA 1SYFA 5G3LF 1CZGA 4M9UA 4ED6A 1IKLA 4DL6A 1FJGQ 2CW7A 2D0OA 2V59A 1DGSA 3RZDB 2W6OA 4IJHA 4L5RC 3GTOA 5J2TF 1LUZA 1LT5D 1BNCA 4X66L 3K58A 4RNNA 4JI7L 3FMCA 4JI7Q 2R8IA 1HR0Q 4XT1B 5D3DA 3IKJA 5CC4A 1EHIA 3T51B 1C8CA 4DV4Q 1FNVA 3RGXA 2Z9HA 5AFWA 1V1PB 1CA6A 4IPCA 1KJIA 4DV7H 2SEBD 2G5DA 4MIUA 3V4ZA 3I70A 1HFNA 1NR2A 3CXCA 2UUCH 2H5XA 4XZ3B 1TWGH 2FINB 5NUCA 5M3FG 5DG9A 3KAKA 4K14A 2VY3A 1HUNA 1GJXA 5C8YF 2PQEA 1Q1EA 4R8UB 3KAJA 3J7A5 1B50A 2V58A 3M4PA 2KCNA 4IUNA 1IBKL 4I7ZC 1V9PA 1PXUA 2NN6H 2R7LA 5C3WA 4WRDA 5EWEA 2G9DA 1SNPA 1MHWC 1UC8A 4GNXB 1RYRA 2RA4A 1JICA 2PBZA 2CQAA 2UU9L 4RKLA 5I6YA 5JVH3 3TP5A 3T56B 1GGOA 2XIGA 1KTKA 5EPLA 2ZXOA 3CRKC 2K5QA 4IOAA 1D5XC 1Q12A 2VS1A 4EX5A 4BBRB 4DR6H 2KHIA 2K5DA 4BY7B 4IWXA 5IGCA 5KFJA 2UXBQ 2VQEQ 3HOVH 1IZ6A 4L5TA 2NU7B 3I56A 2V9WA 1TS5A 3DEPA 3SXHA 2IY5B 4GZYC 2KCMA 3A8JE 3S1QH 1I4HA 3PO2B 1TWCA 1KLUD 2HT1A 3FKIH 3J80L 1PTOH 3BQ1A 1TIID 4L5QA 4JI6L 2F0EA 1LV9A 1RODA 3KLRA 4S3SA 4CJ2C 5M5WH 1VAJA 3QJYA 5DEHA 3MEFA 4DR2Q 3RJ0A 2B2YC 1PTOC 4J9PA 4EVOA 2KECA 2H1EA 4G4KA 5D65A 2WKCA 3HOXB 2ZTCA 1NY4A 3MFGA 2PVPA 3S16B 1DV2A 4TUYF 1DCZA 4F7XA 4IUVA 1A63A 3QO2A 4JYAH 2OQ0A 1GUNA 1KAWA 4CDCC 3H4DA 1D5MC 2M00A 1LTGD 2PNHA 1BCPB 1WTPA 2E5LQ 4NXMH 3ZYYX 4J8QA 5EDWA 2CFMA 1X9NA 4KD4A 1A3VA 1A8VA 5I2XA 4IHJF 4Q43A 2KA7A 3R2TA 4N9PA 2UUAQ 5GONF 4DKAC 2D62A 1J9OA 3S1NH 5KKNB 3I4NG 1DD2A 5EJWA 1UEAB 2B2VC 4TVAB 2PMZA 1KC7A 4R4OA 1X3QA 4HSPA 4DV2Q 2XC9A 1YEZA 3S14H 3K0YA 4C2MH 2N78A 3M4IA
chains in the Genus database with same CATH topology
1HJPA 3T1YL 1EIFA 3CCQA 2Z6KA 3PO2G 2YYZA 1VQOA 3DLLA 1E24A 1MKHA 1KD1C 4MNOA 2HQLA 2OQKA 1E22A 4QY7A 1HNXQ 2E2JH 2WAQG 4GOPC 1FGUA 1SLJA 4L5SA 3M3YH 3TREA 1KRSA 2MNAA 2GN5A 3PSIA 3PIOA 3NENA 2UXCL 3L0OA 1EQRA 3F2CA 4LF9L 2XTIA 3CQZH 5FJ8G 2WP8J 1I6HH 3K7AH 4YCVA 2VL6A 3LGJA 1I5FA 4A3JG 1PH7A 2B29A 1N34L 2KBNA 2IX1A 3OYYA 3PF4A 1WFQA 4EQ5A 4XIGS 2BA0A 3HKSA 2KHJA 2MFIA 1NTGA 2ALYB 4IPGA 4JI1L 4JI5L 5JEAJ 1YJNA 1WCMG 1I94Q 1EFWA 4GKKL 3UDGA 4GLAC 4GN3B 4JOIA 1CKNB 3A0JA 3I4MG 2R7FA 3A5ZB 1PH5A 2UXDL 2UUCQ 1IL2A 1FVIA 4X62L 4JI3Q 4DR6L 1IBKQ 2BH2A 1AE2A 2VUMG 3BJUA 1QUQB 4R4CA 4A3EG 5DLQE 1VS0A 2Z0SA 3OW2A 4A3GH 1YI2A 4OO1G 2JA8H 1S72A 1TXYA 4A3FH 3KF8B 4X64L 3GTKH 4HJ5A 1BVSA 2MO1A 2PQAB 3AYHB 4BBRH 5FLXc 4DV0Q 2F4VL 4OO1I 4IFDJ 2JE6I 2K50A 1X3FA 1SROA 2NVXH 1X54A 3L2PA 3GTLH 3NBHB 4AIMA 3H15A 3GO5A 2Q2TA 2WFWA 1CKMA 3ULPA 1K73C 1PHJA 1Q7YC 4C3HH 4DV0L 4DV5Q 3RNUA 1S3OA 3E9HA 1X65A 4AH6A 4JBWA 3G71A 1C0AA 5C0XJ 1TWAH 4BXXG 5E7NA 1VQ5A 1NE3A 5IYDH 4LUVA 4A3BH 4JC0A 4B3TL 4RG1A 4BA1I 1SFOH 3HOZH 4YWLA 3E9IA 1BBUA 3DM3A 5GROA 3UDIA 3CCVA 4GNXA 4GLXA 2K4KA 3S1RH 1N8RC 1K8AC 2NVTH 1WI5A 1HZBA 3FP9A 4OXPA 1GO3E 5FLMH 1OXUA 1I94L 2YU9H 4LF4Q 4GKKQ 1SMXA 2AMCB 4WJ4A 3GTGH 3ULLA 2K52A 4YWMA 4JI2Q 3F2DA 1GVPA 3J7ZC 2JA5G 1OTCA 2YTVA 3J81j 4DR1Q 2MQHA 5IYBG 3FKIG 1KXLA 2ATWA 1Q82C 1HZAA 2OTLA 4A3KG 4YY3L 1TWFH 3F8TA 2N49A 4PZ8A 3JAMi 2ZTEA 4HIKA 1W2BA 1QVGA 4JI2L 4NXML 5M3FH 2L15A 1O7IA 4JOIC 1XPUA 4O0AA 3TS2A 3KJOA 1KL9A 4B3RQ 1EYGA 4LF5Q 3IRBA 4JV5L 3HOXH 4A3GG 5IYCH 2RHQB 1VQEA 2K5HA 4LF9Q 3M4QA 2CWPA 4JI8Q 3J81i 5LMUQ 3S15H 1EIYB 2K14A 4YWKA 3STBC 3RZDH 2YTYA 1PH3A 4BBSH 5EAYA 3HOYH 2CWAA 5AJ3L 1VQ4A 1U0LA 4DV6Q 4A3DG 1VQCA 4QIWE 4DV6L 4GNXC 3D31A 5C3EH 3GD7A 4A3BG 1XMQL 2N3SA 5IP7G 2BH8A 3NELA 4BXXH 3I4OA 1VQ7A 3UE0A 4GS3A 4DV2L 2B63H 3F1ZA 2NN6G 4X6AH 1JB7A 3GDEA 3CCEA 4DUYQ 3K8AA 1I3QH 4DPGA 1Q81C 1KIXA 1VQLA 4DV1L 1QVCA 4DR7L 1KQSA 3K80C 4UP9A 3EIVA 3PUWA 2B3GA 4Y7NH 2UU9Q 4A3DH 3CC7A 1PV4A 2ZM6L 3S1MH 3GTPH 2IX0A 1N36L 2AHOB 4BBSG 2XGTA 3W1BA 1YJ9A 3HFZB 5C0XI 4A3FG 4LF5L 4JV5Q 4A3LH 4MTNA 1LM0A 1OXXK 1SE8A 1IYJB 1QUQA 3SGIA 4OX9L 4OWXB 1YNXA 4OX9Q 3TRZA 4Y52H 1L0WA 4DR2L 5IWAL 2VQFQ 2NZHA 3UE1A 2HHHL 2OTJA 2GVBA 3CC2A 3KF6A 2Y0SE 5JEAG 4JI5Q 2E2IH 5J3BA 4UP7A 4P73A 4JI6Q 3K7UC 2R92G 4NPSA 3S2HH 2UXCQ 1TWHH 1L2FA 4UY8C 4GN4B 2DGYA 4JG2A 4LWCA 4BY1G 5M3MH 4LF4L 4KHPL 4KHZA 4A3JH 5IYBH 2YV5A 4A3IH 4HJAA 4JI0L 2DUDA 3H0GG 4DV3L 1Y1WG 1JJCB 3J81c 1BKBA 1K83H 1NMGA 3MXNB 1VQJA 4DV4L 1JJ2A 4UPAA 3PO3G 3CPFA 4JYAQ 2Q2UA 2CKZB 2QEXA 4DV1Q 4K0KL 2Q2HA 5C4XH 3K81C 4GN5A 4KI0A 4GOPA 1HNXL 1CKOA 1B70B 2E2HH 3AFPA 1VQ9A 4YHHQ 3PO2H 4LFCL 5C4XG 2WB1G 4JI0Q 4WJ3M 3RN5A 2RHSB 1Y1VG 4LFBQ 2UXDQ 1V1QA 3EN2A 4AYBG 4A4IA 4A93H 3H0GH 3TQYA 4LF8L 2R7ZG 4MZ9A 3B6YA 1HNWQ 2AWOA 4BY1H 4B3RL 5IWAQ 2VQFL 1S40A 3U4VA 2HHHQ 4IPHA 3CCLA 1HH2P 2UUBQ 4BY7G 3H3VH 1HZ9A 5BR8Q 3D0FA 1E1OA 4UP8A 1N33L 3M7NA 1X56A 1PVOA 3OTOQ 1AH9A 4JI4Q 1FJGL 4A3KH 3CCUA 2R6GA 3HOVG 1U5KA 2RCNA 1GD7A 1MIUA 1YBYA 1XMOL 1QVFA 1D8LA 4DR5Q 3W5OA 1G51A 3G48A 2EQSA 1L1OB 1V43A 4FDBA 1XJVA 1WYDA 2ZJRA 1M1KC 4A3LG 5K36G 2VZAA 3ZJYC 5HGQA 5C44G 4DK3C 4DR3Q 1HNZQ 3OTOL 2ZM6Q 5GAEC 4P71A 1OXTA 3U4ZA 4LF6L 5IP9H 2EXDA 5IY0A 4HJ8A 4YCUA 4LFAL 1KC8C 1P16A 1L1OC 2JA6G 1VQNA 5IT9c 2JA7H 2A8VA 3PO3H 1E1TA 4RMFA 2F52A 2LSSA 1JT8A 4X66Q 2JA7G 1VQHA 3I7FA 4LF7L 5IP7H 2HIXA 3U58A 1SR3A 2UUAL 5C3EG 1CKNA 1Z9FA 3CCMA 1R9TH 1JE5A 1N32Q 2UXBL 4JI8L 5LMUL 1JMCA 4GLVB 1XNQQ 2R92H 2JJQA 2K5NA 5C44H 1CSQA 3NEMA 3A74A 1XTDA 3E0EA 3KJPA 1OXVA 1VCIA 2YTXA 2LXKA 2VQEL 3S17H 3KFUA 1L1OA 3K0XA 2OWOA 1VQAA 3I2ZA 5ELNA 1IBML 1IXRA 4YCWA 3HOUH 3CCJA 5IYCG 3UDFA 5IE8A 3HOXG 1YZ6A 1XNRQ 4X64Q 4HIDA 3CCRA 1K9MC 2N8NA 2NZOA 3ERSX 1E7ZA 3EBEA 4DR1L 2LXJA 2PI2E 3W1GA 1M90C 2NN6I 1AE3A 4DUZQ 4JI3L 4X62Q 4DR6Q 4DUZL 4O2DA 2EIFA 3S16H 1PH2A 4XTCS 3WWVA 1PH1A 3ER0A 3GTQH 3KOJA 1EOVA 1K0RA 1NMFA 3BU2A 1Q46A 2WAQE 3BZKA 3G6EA 3T1HQ 1N36Q 2R93G 1OXSC 4R4IA 4NXNQ 4JCVE 2PI2A 3M9BA 1K8GA 1Y1VH 2NVYH 1YHQA 4PG3A 2Z6KC 3RR5A 4LW1A 3RLFA 4IFDG 5C4JH 1J5EQ 4LF8Q 1GKHA 1HR0W 1RL2A 5LMNW 4HIMA 4DV5L 1Q1BA 3KDFA 3L7ZC 1QZHA 3M85A 5HY6A 4GOPB 1NJIC 3CPWA 2NVQH 4LFBL 1PFSA 3PUZA 5GAHC 2IT1A 2GVAA 1RIPA 1Y14B 1A62A 5IYDG 5ELOA 1XMQQ 1FL0A 2I5HA 4QGUA 1X3EA 2BA1A 3HKZG 1P8LA 5H1SE 1VQ6A 3G4SA 4A3MG 1G291 3KYHC 1XNQL 1IBLQ 5AJ3Q 1A0IA 5JJLA 1GM5A 4C3IH 1SRUA 4JYAL 3J80c 1UWVA 4A3CH 1YHBA 1HR0L 4IOCA 4NB3A 5LMNL 4B3SQ 2F4VQ 2VNUD 2JEAI 4A75A 3KF6B 4DV3Q 1N9WA 1W3SA 4DR3L 1VQBA 1HNZL 2E5LL 5M5YH 1UE6A 3GTMH 4A3CG 2IHEA 1LTLA 4DNIA 3CAMA 4AQYQ 1ASZA 1VQIA 1JJGA 4LUZA 2A19A 2I5MX 4JI1Q 1C7YA 4A93G 4DK6C 4NXMQ 1PH8A 3JC66 4ALPA 1D7QA 4A3MH 1MJEA 2E8GA 3VDYA 2CQOA 2ZTDA 3GTJH 4A76A 5FLMG 1X55A 1WCMH 3PUVA 1UEBA 4OWTB 5GAGC 4LNQA 1NBWA 3KLWA 1EWIA 4C3JH 3HOZG 1PYSB 5GQOA 3J80i 2HIVA 2ID0A 4NXNL 4YY3Q 4B3TQ 2OCEA 3S24A 4GKJQ 3U50C 1PH9A 1ASYA 4JI4L 1FJGQ 3AEVA 1PA6A 1EQQA 2ZJQA 1KHIA 2C35B 4BA2I 4IJLA 1Y1WH 2D0OA 2CCZA 4J15A 2UUBL 1DGSA 1TWCH 2Y0SG 3F2BA 4P72A 4IJHA 1UE5A 4TQUS 4L5RC 1J6QA 1LUZA 3PV0A 4YHHL 4X66L 1YITA 2R7DA 1VQ8A 4JI7L 4JI7Q 1HR0Q 2JA8G 1C9OA 1T9HA 1WOCA 4DV4Q 4LFAQ 4A3EH 4LF7Q 3AFQA 4HJ9A 5JJKA 1IBLL 1VQKA 4HJ7A 2VUMH 1PYBA 4DV7L 2KENA 4IPCA 3RZOH 2JEBI 1UE1A 4PZ6A 3CC4A 4B3MQ 1UE7A 1WJJA 1J5EL 2PMZE 4IFDI 2AWNA 4R4TA 1X6OA 4POFA 4KHPQ 2R93H 3CXCA 3AQQA 2H5XA 4K0KQ 1TWGH 4ME3A 4P75A 3GTOH 5M3FG 2ES2A 4DAYB 2VY3A 4IPDA 4POGA 3KDFB 1CSPA 3Q8DA 1Q1EA 3HKZE 4GKJL 3J7A5 1QZGA 5M5XH 1Q8KA 3M4PA 2A1AA 2V1CC 4AYBE 2JA5H 1B7YB 1IBKL 1SN8A 4DR5L 1V9PA 1I50H 2UUCL 1VQGA 1LYLA 2B63G 5GADC 3T1HL 2JA6H 3HOWG 2JQOA 4X65Q 1XNRL 1X3GA 3BZCA 3PF5A 1H95A 4GNXB 3H3VI 4OONA 3CCSA 5LMNQ 2UU9L 3CP0A 4DAMA 3HOYG 3CF5A 1B8AA 1YJWA 4DR7Q 4PMWA 3JAMc 4IOAA 1Q12A 2VS1A 1BBWA 4EX5A 3PGZA 2KHIA 1KRTA 4DV7Q 1IBMQ 1XPRA 2I0QA 3FHWA 3CMAA 1VQPA 1N32L 2UXBQ 3I4NH 1E3PA 2VQEQ 4OWWB 3HOVH 1IZ6A 4L5TA 1CUKA 3TS0A 5JJIA 4LFCQ 3I56A 4R4QA 2Q2IA 4BBRG 3RLOA 2IY5B 4BY7H 2KCMA 1VQMA 3S1QH 2HT1A 3FKIH 1EUJA 2R7ZH 4H02A 4P74A 3M4OH 2D0PA 4L5QA 4APVA 5C0XG 4IO9A 4JI6L 4LF6Q 3I4MH 4LUOA 3ULJA 4QJFA 4QL5A 2K5VA 5M5WH 4X65L 3CMEA 1VQFA 3RN2A 2PQAA 3MEFA 4DR2Q 2ZJPA 5IP9G 1XMOQ 2F3IA 1PH6A 2ZTCA 1NY4A 3HOWH 2WB1E 3CW2C 2QGQA 4PZ7A 3RLNA 2ASBA 4DR4L 5FJ8H 3TEHB 3STBD 3A5UA 1MJCA 4JBJA 4HIOA 5BR8L 1N33Q 1A63A 2OQ0A 1KAWA 4A3IG 1PH4A 1N34Q 1HNWL 4DR4Q 1Z47A 2K75A 2PNHA 5M3MG 1Q86C 2E5LQ 4B3ML 4QQBX 2KCTA 1HZCA 2CFMA 2JA9A 2JK8A 2AKWB 2I5LX 1X9NA 1A8VA 4JBMA 4B3SL 3T1YQ 2RF4A 2QA4A 1YIJA 4JBKA 1XPOA 3UDXA 2UUAQ 4DKAC 3ICEA 1YVCA 3S2DH 2D62A 4AQYL 2MO0A 3S1NH 3I4NG 4DUYL 4R1JA 3PIPA 2IHFA 3CD6A 3PCOB 3HOUG 1YHAA 4TVAB 1VQDA 2VW9A 4KLKA 4R4OA 3PUXA 4DV2Q 1G6PA 1YEZA 3S14H 3PUYA 4C2MH 2N78A 3I55A 1K3RA 2FXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJP A;  3T1Y L;  1EIF A;  3CCQ A;  2Z6K A;  3PO2 G;  2YYZ A;  1VQO A;  3DLL A;  1E24 A;  1MKH A;  1KD1 C;  4MNO A;  2HQL A;  2OQK A;  1E22 A;  4QY7 A;  1HNX Q;  2E2J H;  2WAQ G;  4GOP C;  1FGU A;  1SLJ A;  4L5S A;  3M3Y H;  3TRE A;  1KRS A;  2MNA A;  2GN5 A;  3PSI A;  3PIO A;  3NEN A;  2UXC L;  3L0O A;  1EQR A;  3F2C A;  4LF9 L;  2XTI A;  3CQZ H;  5FJ8 G;  2WP8 J;  1I6H H;  3K7A H;  4YCV A;  2VL6 A;  3LGJ A;  1I5F A;  4A3J G;  1PH7 A;  2B29 A;  1N34 L;  2KBN A;  2IX1 A;  3OYY A;  3PF4 A;  1WFQ A;  4EQ5 A;  4XIG S;  2BA0 A;  3HKS A;  2KHJ A;  2MFI A;  1NTG A;  2ALY B;  4IPG A;  4JI1 L;  4JI5 L;  5JEA J;  1YJN A;  1WCM G;  1I94 Q;  1EFW A;  4GKK L;  3UDG A;  4GLA C;  4GN3 B;  4JOI A;  1CKN B;  3A0J A;  3I4M G;  2R7F A;  3A5Z B;  1PH5 A;  2UXD L;  2UUC Q;  1IL2 A;  1FVI A;  4X62 L;  4JI3 Q;  4DR6 L;  1IBK Q;  2BH2 A;  1AE2 A;  2VUM G;  3BJU A;  1QUQ B;  4R4C A;  4A3E G;  5DLQ E;  1VS0 A;  2Z0S A;  3OW2 A;  4A3G H;  1YI2 A;  4OO1 G;  2JA8 H;  1S72 A;  1TXY A;  4A3F H;  3KF8 B;  4X64 L;  3GTK H;  4HJ5 A;  1BVS A;  2MO1 A;  2PQA B;  3AYH B;  4BBR H;  5FLX c;  4DV0 Q;  2F4V L;  4OO1 I;  4IFD J;  2JE6 I;  2K50 A;  1X3F A;  1SRO A;  2NVX H;  1X54 A;  3L2P A;  3GTL H;  3NBH B;  4AIM A;  3H15 A;  3GO5 A;  2Q2T A;  2WFW A;  1CKM A;  3ULP A;  1K73 C;  1PHJ A;  1Q7Y C;  4C3H H;  4DV0 L;  4DV5 Q;  3RNU A;  1S3O A;  3E9H A;  1X65 A;  4AH6 A;  4JBW A;  3G71 A;  1C0A A;  5C0X J;  1TWA H;  4BXX G;  5E7N A;  1VQ5 A;  1NE3 A;  5IYD H;  4LUV A;  4A3B H;  4JC0 A;  4B3T L;  4RG1 A;  4BA1 I;  1SFO H;  3HOZ H;  4YWL A;  3E9I A;  1BBU A;  3DM3 A;  5GRO A;  3UDI A;  3CCV A;  4GNX A;  4GLX A;  2K4K A;  3S1R H;  1N8R C;  1K8A C;  2NVT H;  1WI5 A;  1HZB A;  3FP9 A;  4OXP A;  1GO3 E;  5FLM H;  1OXU A;  1I94 L;  2YU9 H;  4LF4 Q;  4GKK Q;  1SMX A;  2AMC B;  4WJ4 A;  3GTG H;  3ULL A;  2K52 A;  4YWM A;  4JI2 Q;  3F2D A;  1GVP A;  3J7Z C;  2JA5 G;  1OTC A;  2YTV A;  3J81 j;  4DR1 Q;  2MQH A;  5IYB G;  3FKI G;  1KXL A;  2ATW A;  1Q82 C;  1HZA A;  2OTL A;  4A3K G;  4YY3 L;  1TWF H;  3F8T A;  2N49 A;  4PZ8 A;  3JAM i;  2ZTE A;  4HIK A;  1W2B A;  1QVG A;  4JI2 L;  4NXM L;  5M3F H;  2L15 A;  1O7I A;  4JOI C;  1XPU A;  4O0A A;  3TS2 A;  3KJO A;  1KL9 A;  4B3R Q;  1EYG A;  4LF5 Q;  3IRB A;  4JV5 L;  3HOX H;  4A3G G;  5IYC H;  2RHQ B;  1VQE A;  2K5H A;  4LF9 Q;  3M4Q A;  2CWP A;  4JI8 Q;  3J81 i;  5LMU Q;  3S15 H;  1EIY B;  2K14 A;  4YWK A;  3STB C;  3RZD H;  2YTY A;  1PH3 A;  4BBS H;  5EAY A;  3HOY H;  2CWA A;  5AJ3 L;  1VQ4 A;  1U0L A;  4DV6 Q;  4A3D G;  1VQC A;  4QIW E;  4DV6 L;  4GNX C;  3D31 A;  5C3E H;  3GD7 A;  4A3B G;  1XMQ L;  2N3S A;  5IP7 G;  2BH8 A;  3NEL A;  4BXX H;  3I4O A;  1VQ7 A;  3UE0 A;  4GS3 A;  4DV2 L;  2B63 H;  3F1Z A;  2NN6 G;  4X6A H;  1JB7 A;  3GDE A;  3CCE A;  4DUY Q;  3K8A A;  1I3Q H;  4DPG A;  1Q81 C;  1KIX A;  1VQL A;  4DV1 L;  1QVC A;  4DR7 L;  1KQS A;  3K80 C;  4UP9 A;  3EIV A;  3PUW A;  2B3G A;  4Y7N H;  2UU9 Q;  4A3D H;  3CC7 A;  1PV4 A;  2ZM6 L;  3S1M H;  3GTP H;  2IX0 A;  1N36 L;  2AHO B;  4BBS G;  2XGT A;  3W1B A;  1YJ9 A;  3HFZ B;  5C0X I;  4A3F G;  4LF5 L;  4JV5 Q;  4A3L H;  4MTN A;  1LM0 A;  1OXX K;  1SE8 A;  1IYJ B;  1QUQ A;  3SGI A;  4OX9 L;  4OWX B;  1YNX A;  4OX9 Q;  3TRZ A;  4Y52 H;  1L0W A;  4DR2 L;  5IWA L;  2VQF Q;  2NZH A;  3UE1 A;  2HHH L;  2OTJ A;  2GVB A;  3CC2 A;  3KF6 A;  2Y0S E;  5JEA G;  4JI5 Q;  2E2I H;  5J3B A;  4UP7 A;  4P73 A;  4JI6 Q;  3K7U C;  2R92 G;  4NPS A;  3S2H H;  2UXC Q;  1TWH H;  1L2F A;  4UY8 C;  4GN4 B;  2DGY A;  4JG2 A;  4LWC A;  4BY1 G;  5M3M H;  4LF4 L;  4KHP L;  4KHZ A;  4A3J H;  5IYB H;  2YV5 A;  4A3I H;  4HJA A;  4JI0 L;  2DUD A;  3H0G G;  4DV3 L;  1Y1W G;  1JJC B;  3J81 c;  1BKB A;  1K83 H;  1NMG A;  3MXN B;  1VQJ A;  4DV4 L;  1JJ2 A;  4UPA A;  3PO3 G;  3CPF A;  4JYA Q;  2Q2U A;  2CKZ B;  2QEX A;  4DV1 Q;  4K0K L;  2Q2H A;  5C4X H;  3K81 C;  4GN5 A;  4KI0 A;  4GOP A;  1HNX L;  1CKO A;  1B70 B;  2E2H H;  3AFP A;  1VQ9 A;  4YHH Q;  3PO2 H;  4LFC L;  5C4X G;  2WB1 G;  4JI0 Q;  4WJ3 M;  3RN5 A;  2RHS B;  1Y1V G;  4LFB Q;  2UXD Q;  1V1Q A;  3EN2 A;  4AYB G;  4A4I A;  4A93 H;  3H0G H;  3TQY A;  4LF8 L;  2R7Z G;  4MZ9 A;  3B6Y A;  1HNW Q;  2AWO A;  4BY1 H;  4B3R L;  5IWA Q;  2VQF L;  1S40 A;  3U4V A;  2HHH Q;  4IPH A;  3CCL A;  1HH2 P;  2UUB Q;  4BY7 G;  3H3V H;  1HZ9 A;  5BR8 Q;  3D0F A;  1E1O A;  4UP8 A;  1N33 L;  3M7N A;  1X56 A;  1PVO A;  3OTO Q;  1AH9 A;  4JI4 Q;  1FJG L;  4A3K H;  3CCU A;  2R6G A;  3HOV G;  1U5K A;  2RCN A;  1GD7 A;  1MIU A;  1YBY A;  1XMO L;  1QVF A;  1D8L A;  4DR5 Q;  3W5O A;  1G51 A;  3G48 A;  2EQS A;  1L1O B;  1V43 A;  4FDB A;  1XJV A;  1WYD A;  2ZJR A;  1M1K C;  4A3L G;  5K36 G;  2VZA A;  3ZJY C;  5HGQ A;  5C44 G;  4DK3 C;  4DR3 Q;  1HNZ Q;  3OTO L;  2ZM6 Q;  5GAE C;  4P71 A;  1OXT A;  3U4Z A;  4LF6 L;  5IP9 H;  2EXD A;  5IY0 A;  4HJ8 A;  4YCU A;  4LFA L;  1KC8 C;  1P16 A;  1L1O C;  2JA6 G;  1VQN A;  5IT9 c;  2JA7 H;  2A8V A;  3PO3 H;  1E1T A;  4RMF A;  2F52 A;  2LSS A;  1JT8 A;  4X66 Q;  2JA7 G;  1VQH A;  3I7F A;  4LF7 L;  5IP7 H;  2HIX A;  3U58 A;  1SR3 A;  2UUA L;  5C3E G;  1CKN A;  1Z9F A;  3CCM A;  1R9T H;  1JE5 A;  1N32 Q;  2UXB L;  4JI8 L;  5LMU L;  1JMC A;  4GLV B;  1XNQ Q;  2R92 H;  2JJQ A;  2K5N A;  5C44 H;  1CSQ A;  3NEM A;  3A74 A;  1XTD A;  3E0E A;  3KJP A;  1OXV A;  1VCI A;  2YTX A;  2LXK A;  2VQE L;  3S17 H;  3KFU A;  1L1O A;  3K0X A;  2OWO A;  1VQA A;  3I2Z A;  5ELN A;  1IBM L;  1IXR A;  4YCW A;  3HOU H;  3CCJ A;  5IYC G;  3UDF A;  5IE8 A;  3HOX G;  1YZ6 A;  1XNR Q;  4X64 Q;  4HID A;  3CCR A;  1K9M C;  2N8N A;  2NZO A;  3ERS X;  1E7Z A;  3EBE A;  4DR1 L;  2LXJ A;  2PI2 E;  3W1G A;  1M90 C;  2NN6 I;  1AE3 A;  4DUZ Q;  4JI3 L;  4X62 Q;  4DR6 Q;  4DUZ L;  4O2D A;  2EIF A;  3S16 H;  1PH2 A;  4XTC S;  3WWV A;  1PH1 A;  3ER0 A;  3GTQ H;  3KOJ A;  1EOV A;  1K0R A;  1NMF A;  3BU2 A;  1Q46 A;  2WAQ E;  3BZK A;  3G6E A;  3T1H Q;  1N36 Q;  2R93 G;  1OXS C;  4R4I A;  4NXN Q;  4JCV E;  2PI2 A;  3M9B A;  1K8G A;  1Y1V H;  2NVY H;  1YHQ A;  4PG3 A;  2Z6K C;  3RR5 A;  4LW1 A;  3RLF A;  4IFD G;  5C4J H;  1J5E Q;  4LF8 Q;  1GKH A;  1HR0 W;  1RL2 A;  5LMN W;  4HIM A;  4DV5 L;  1Q1B A;  3KDF A;  3L7Z C;  1QZH A;  3M85 A;  5HY6 A;  4GOP B;  1NJI C;  3CPW A;  2NVQ H;  4LFB L;  1PFS A;  3PUZ A;  5GAH C;  2IT1 A;  2GVA A;  1RIP A;  1Y14 B;  1A62 A;  5IYD G;  5ELO A;  1XMQ Q;  1FL0 A;  2I5H A;  4QGU A;  1X3E A;  2BA1 A;  3HKZ G;  1P8L A;  5H1S E;  1VQ6 A;  3G4S A;  4A3M G;  1G29 1;  3KYH C;  1XNQ L;  1IBL Q;  5AJ3 Q;  1A0I A;  5JJL A;  1GM5 A;  4C3I H;  1SRU A;  4JYA L;  3J80 c;  1UWV A;  4A3C H;  1YHB A;  1HR0 L;  4IOC A;  4NB3 A;  5LMN L;  4B3S Q;  2F4V Q;  2VNU D;  2JEA I;  4A75 A;  3KF6 B;  4DV3 Q;  1N9W A;  1W3S A;  4DR3 L;  1VQB A;  1HNZ L;  2E5L L;  5M5Y H;  1UE6 A;  3GTM H;  4A3C G;  2IHE A;  1LTL A;  4DNI A;  3CAM A;  4AQY Q;  1ASZ A;  1VQI A;  1JJG A;  4LUZ A;  2A19 A;  2I5M X;  4JI1 Q;  1C7Y A;  4A93 G;  4DK6 C;  4NXM Q;  1PH8 A;  3JC6 6;  4ALP A;  1D7Q A;  4A3M H;  1MJE A;  2E8G A;  3VDY A;  2CQO A;  2ZTD A;  3GTJ H;  4A76 A;  5FLM G;  1X55 A;  1WCM H;  3PUV A;  1UEB A;  4OWT B;  5GAG C;  4LNQ A;  1NBW A;  3KLW A;  1EWI A;  4C3J H;  3HOZ G;  1PYS B;  5GQO A;  3J80 i;  2HIV A;  2ID0 A;  4NXN L;  4YY3 Q;  4B3T Q;  2OCE A;  3S24 A;  4GKJ Q;  3U50 C;  1PH9 A;  1ASY A;  4JI4 L;  1FJG Q;  3AEV A;  1PA6 A;  1EQQ A;  2ZJQ A;  1KHI A;  2C35 B;  4BA2 I;  4IJL A;  1Y1W H;  2D0O A;  2CCZ A;  4J15 A;  2UUB L;  1DGS A;  1TWC H;  2Y0S G;  3F2B A;  4P72 A;  4IJH A;  1UE5 A;  4TQU S;  4L5R C;  1J6Q A;  1LUZ A;  3PV0 A;  4YHH L;  4X66 L;  1YIT A;  2R7D A;  1VQ8 A;  4JI7 L;  4JI7 Q;  1HR0 Q;  2JA8 G;  1C9O A;  1T9H A;  1WOC A;  4DV4 Q;  4LFA Q;  4A3E H;  4LF7 Q;  3AFQ A;  4HJ9 A;  5JJK A;  1IBL L;  1VQK A;  4HJ7 A;  2VUM H;  1PYB A;  4DV7 L;  2KEN A;  4IPC A;  3RZO H;  2JEB I;  1UE1 A;  4PZ6 A;  3CC4 A;  4B3M Q;  1UE7 A;  1WJJ A;  1J5E L;  2PMZ E;  4IFD I;  2AWN A;  4R4T A;  1X6O A;  4POF A;  4KHP Q;  2R93 H;  3CXC A;  3AQQ A;  2H5X A;  4K0K Q;  1TWG H;  4ME3 A;  4P75 A;  3GTO H;  5M3F G;  2ES2 A;  4DAY B;  2VY3 A;  4IPD A;  4POG A;  3KDF B;  1CSP A;  3Q8D A;  1Q1E A;  3HKZ E;  4GKJ L;  3J7A 5;  1QZG A;  5M5X H;  1Q8K A;  3M4P A;  2A1A A;  2V1C C;  4AYB E;  2JA5 H;  1B7Y B;  1IBK L;  1SN8 A;  4DR5 L;  1V9P A;  1I50 H;  2UUC L;  1VQG A;  1LYL A;  2B63 G;  5GAD C;  3T1H L;  2JA6 H;  3HOW G;  2JQO A;  4X65 Q;  1XNR L;  1X3G A;  3BZC A;  3PF5 A;  1H95 A;  4GNX B;  3H3V I;  4OON A;  3CCS A;  5LMN Q;  2UU9 L;  3CP0 A;  4DAM A;  3HOY G;  3CF5 A;  1B8A A;  1YJW A;  4DR7 Q;  4PMW A;  3JAM c;  4IOA A;  1Q12 A;  2VS1 A;  1BBW A;  4EX5 A;  3PGZ A;  2KHI A;  1KRT A;  4DV7 Q;  1IBM Q;  1XPR A;  2I0Q A;  3FHW A;  3CMA A;  1VQP A;  1N32 L;  2UXB Q;  3I4N H;  1E3P A;  2VQE Q;  4OWW B;  3HOV H;  1IZ6 A;  4L5T A;  1CUK A;  3TS0 A;  5JJI A;  4LFC Q;  3I56 A;  4R4Q A;  2Q2I A;  4BBR G;  3RLO A;  2IY5 B;  4BY7 H;  2KCM A;  1VQM A;  3S1Q H;  2HT1 A;  3FKI H;  1EUJ A;  2R7Z H;  4H02 A;  4P74 A;  3M4O H;  2D0P A;  4L5Q A;  4APV A;  5C0X G;  4IO9 A;  4JI6 L;  4LF6 Q;  3I4M H;  4LUO A;  3ULJ A;  4QJF A;  4QL5 A;  2K5V A;  5M5W H;  4X65 L;  3CME A;  1VQF A;  3RN2 A;  2PQA A;  3MEF A;  4DR2 Q;  2ZJP A;  5IP9 G;  1XMO Q;  2F3I A;  1PH6 A;  2ZTC A;  1NY4 A;  3HOW H;  2WB1 E;  3CW2 C;  2QGQ A;  4PZ7 A;  3RLN A;  2ASB A;  4DR4 L;  5FJ8 H;  3TEH B;  3STB D;  3A5U A;  1MJC A;  4JBJ A;  4HIO A;  5BR8 L;  1N33 Q;  1A63 A;  2OQ0 A;  1KAW A;  4A3I G;  1PH4 A;  1N34 Q;  1HNW L;  4DR4 Q;  1Z47 A;  2K75 A;  2PNH A;  5M3M G;  1Q86 C;  2E5L Q;  4B3M L;  4QQB X;  2KCT A;  1HZC A;  2CFM A;  2JA9 A;  2JK8 A;  2AKW B;  2I5L X;  1X9N A;  1A8V A;  4JBM A;  4B3S L;  3T1Y Q;  2RF4 A;  2QA4 A;  1YIJ A;  4JBK A;  1XPO A;  3UDX A;  2UUA Q;  4DKA C;  3ICE A;  1YVC A;  3S2D H;  2D62 A;  4AQY L;  2MO0 A;  3S1N H;  3I4N G;  4DUY L;  4R1J A;  3PIP A;  2IHF A;  3CD6 A;  3PCO B;  3HOU G;  1YHA A;  4TVA B;  1VQD A;  2VW9 A;  4KLK A;  4R4O A;  3PUX A;  4DV2 Q;  1G6P A;  1YEZ A;  3S14 H;  3PUY A;  4C2M H;  2N78 A;  3I55 A;  1K3R A;  2FXQ A; 
#chains in the Genus database with same CATH topology
 1HJP A;  4TQR A;  1BR9 A;  1VQO A;  1TWA B;  1E24 A;  2J9G A;  2HQL A;  2OQK A;  2G9H D;  2F0V A;  2WAQ G;  3OOC A;  4FF4 A;  3M3Y H;  3TRE A;  2FJZ A;  4CC6 A;  4EGJ A;  3D6C A;  3PR4 A;  1BDO A;  1G2S A;  4LF9 L;  1ZET A;  4UCT A;  1VBH A;  3PMF A;  4N8X 1;  5EQ0 A;  3E6Z X;  1I6H H;  3K7A H;  4JI7 H;  2QDB A;  4YCV A;  3QR8 A;  2YZM A;  4ECT A;  3T1Y H;  4XIG S;  3GTO B;  2ENB A;  2MFI A;  2ALY B;  3FKI A;  1EIG A;  1I94 Q;  1TY2 A;  3J81 E;  2F0L A;  2X6G A;  4JOI A;  1SBB B;  3I3C A;  3WO0 A;  1SE3 A;  3CHB D;  2CW0 C;  3NBI A;  3F2U A;  1FVI A;  4F4Y A;  4DR6 L;  1IBK Q;  3GTJ B;  2ATL A;  1QUQ B;  1JQY D;  3OW2 A;  5CGK A;  4A3G H;  3JAM L;  4MV9 A;  3I91 A;  1S72 A;  3TDQ A;  5KFZ A;  4JV5 H;  4C3J B;  1R9T B;  1BVS A;  3D8G A;  4DV0 Q;  2F4V L;  4OO1 I;  3TQT A;  5CYU A;  1SRO A;  3J7A K;  3GTL H;  1EU4 A;  4AIM A;  3H15 A;  3GO5 A;  1H9K A;  3ULP A;  1K73 C;  3OTO H;  1PHJ A;  5EZY F;  1O80 A;  4DV0 L;  2HVS A;  3E9H A;  3H20 A;  3DF7 A;  4BXX G;  2E2H A;  5IYD H;  3JAM W;  2FMA A;  2NU6 B;  4F87 A;  3BYT B;  4A3B H;  4JC0 A;  1STA A;  4JW0 A;  3HOZ H;  4YWL A;  3E9I A;  1N8R C;  3D4D A;  4GNX A;  1K8A C;  2KEE A;  5IYZ F;  1PZK D;  1FNU A;  3VR4 A;  1HNZ H;  1I94 L;  5COR A;  1SMX A;  5KFW A;  2W9C B;  2EYH A;  1LT6 D;  1TWG A;  1BGW A;  3J7Z C;  3J81 j;  4DR1 Q;  5IYB G;  4OEM B;  3FKI G;  3CKI B;  4R8N A;  2ATW A;  1KXL A;  2W9C A;  4JI0 H;  1Q82 C;  4KHP H;  1W2B A;  1DYQ A;  3F8T A;  4PZ8 A;  1QVG A;  2ZXR A;  4Q8E A;  3OHX C;  4NXM L;  1O7I A;  3VA5 A;  2V4Q A;  2C2R A;  3GTQ A;  3RTX A;  1XPU A;  4B3R Q;  1WTO A;  4ED0 A;  3V2T A;  2F0F A;  5KND A;  5BR8 H;  4JI4 H;  1SNQ A;  1JWU D;  4JI8 Q;  3S15 H;  1EIY B;  4YWK A;  2YTY A;  1MSG A;  5C1O A;  4ED1 A;  1FNW A;  3BAA A;  2K01 A;  3OWE B;  1VQC A;  4ECS A;  3KTM A;  3D31 A;  4EBE A;  5KFE A;  4C3H B;  4RAZ A;  2WYO A;  4R9W A;  3GD7 A;  4A3B G;  1XMQ L;  2N3S A;  5IP7 G;  1GXD C;  2DNE A;  3NEL A;  3S1Q B;  4K6L A;  4BXX H;  3ORQ A;  4DV2 L;  4ECY A;  1F9P A;  3RZO B;  3F1Z A;  4PV1 C;  1SMY D;  3NTH A;  2NN6 G;  2PO4 A;  4X6A H;  2VUM B;  2C00 A;  2XRQ D;  3CCE A;  2NUA B;  4KN7 C;  3V05 A;  1I7N A;  5BPH A;  3K8A A;  1VQL A;  4MTE A;  4ECX A;  4ED7 A;  1KQS A;  1S0O A;  2R6F A;  3A7A B;  4A3D H;  2C22 A;  1E2V A;  2ZM6 L;  5IOC A;  4LF5 H;  3S1M H;  4A2A A;  3KHH A;  2QDL A;  3W1B A;  1YJ9 A;  4DV2 H;  1SYD A;  5C0X I;  1I3Q B;  4A3L H;  4MTN A;  3SGI A;  1OXX K;  4OX9 L;  5BMV F;  2EPB A;  1JOQ A;  5F9L A;  5M3M B;  4DV0 H;  4DR2 L;  3GV8 B;  1BXT A;  5CBA E;  5IWA L;  2HHH L;  2OTJ A;  1UC9 A;  3G6Y A;  3KF6 A;  2Y0S E;  5EBD A;  4JG2 A;  2DGY A;  1GLV A;  2YV5 A;  4A3I H;  2CHB D;  4HJA A;  3H0G G;  3BS1 A;  4JI0 L;  4HAE A;  4DV3 L;  4RNO A;  2EYJ A;  2EXZ A;  1BKB A;  3MXN B;  1VQJ A;  4K2K A;  1BO0 A;  4K0K L;  4RFB A;  3PIO 3;  3PO3 G;  2M2L A;  5D1P A;  2WKD A;  5IGE A;  1JX4 A;  4KI0 A;  5JVL A;  1HQR D;  1EEF D;  3E3X A;  3GTM B;  4RU9 A;  2IBK A;  2HCI A;  3S9W A;  5C4X G;  2R3Z A;  3MFH A;  5K5P A;  4BY1 B;  2C5C A;  4UAI A;  2E75 C;  2RHS B;  3RN5 A;  1A3U A;  2JSO A;  1ILQ A;  1PDQ A;  2I46 A;  4A3M B;  4PMB A;  3QZ8 A;  2UXD Q;  4AYB G;  4K6D A;  3IFT A;  2B2V A;  3KBG A;  2HD3 A;  4FXG C;  3TQY A;  4LF8 L;  4OHJ A;  2LS0 1;  1DOM A;  2IW3 A;  1HNW Q;  3MXP A;  5IIF A;  2VQF L;  1KDB A;  3U4V A;  2JA6 B;  1E4E A;  3CCL A;  1HH2 P;  3H3V H;  5BR8 Q;  1N33 L;  3BA9 A;  4UP8 A;  2A74 C;  3GID A;  3OTO Q;  4JI4 Q;  1LTR D;  2PW7 A;  2R6G A;  1S5C D;  4HCE A;  1U5K A;  2A6H C;  5D1O A;  3AMU A;  2EE1 A;  2FLP A;  5TSS A;  1D8L A;  3GQB A;  1F9R A;  2W9B A;  2QEJ C;  1D2B A;  1SDF A;  3R5X A;  1V43 A;  2ZJR A;  2PN1 A;  1LTS D;  3ZJY C;  2R7K A;  4TQS A;  4A3K B;  4YR0 A;  1QG7 A;  2OEO A;  5C44 G;  2RDJ A;  2CH4 A;  4DK3 C;  1HNZ Q;  5EKK A;  4P71 A;  4B3S H;  4HJ8 A;  3Q8P B;  2A68 D;  4U6P A;  1KC8 C;  1SJE D;  1TWF A;  1O7Y A;  4H13 C;  1C30 A;  4QWC A;  4AQY H;  5LHY 1;  5KG5 A;  4Q8F A;  1E1T A;  3M4O B;  4XQQ A;  2R7Z B;  1B33 N;  2VA3 A;  4YY3 H;  3HXL A;  3A55 A;  4X66 Q;  3I7F A;  4PDB A;  2CZG A;  5JVD F;  2HIX A;  2KCC A;  4DR2 H;  4EBD A;  4O3R A;  1IHZ A;  1CKN A;  5C3E G;  3PIP 3;  3D3R A;  2UXB L;  3N42 B;  5KFD A;  3GIJ A;  5KG6 A;  1B44 D;  4GLV B;  4NXN H;  3HKZ A;  2K5N A;  5LL6 X;  5C44 H;  4L63 B;  2RDH A;  1FKA H;  3NEM A;  3E0E A;  2F1M A;  1ZHS A;  2E76 C;  2EDG A;  2L55 A;  2EYO A;  2VQE L;  1SYB A;  5LOV F;  2KUM A;  3K0X A;  2IJ0 A;  2B63 B;  5KG0 A;  1EYD A;  2W7P A;  3R2I A;  3CCJ A;  4DR7 H;  1XNR Q;  1K9M C;  1GUS A;  3OSN A;  4K5W A;  2PI2 E;  1IKM A;  2HUG A;  2XRS D;  4JI3 L;  4X62 Q;  2D2C C;  4ETS A;  4R8U A;  2EIF A;  2XCL A;  4QWE A;  1EY4 A;  4XTC S;  3K5I A;  1D1I A;  2YRX A;  3FDS A;  4IQZ A;  2NVQ B;  4R4I A;  4ME6 A;  1RYS A;  3L4J A;  3T16 A;  5EPK A;  5LL6 b;  4LW1 A;  3RLF A;  1E4F T;  1GKH A;  1SND A;  2RVL A;  4A3F B;  1AN7 A;  2V4D A;  3BG5 A;  2JA6 A;  5HY6 A;  4LFB L;  3PUZ A;  5GAH C;  1I50 A;  2GVA A;  1YNJ C;  1E0B A;  1Y14 B;  4ZRZ A;  2HVQ A;  1XMQ Q;  4QGU A;  2E2J B;  1LTT D;  4EFE A;  2Y0S B;  2E74 C;  1AZP A;  1A0I A;  1GM5 A;  1F2Z A;  3N8D A;  3EJI A;  1UWV A;  2ZM6 H;  2LMC B;  2HCC A;  3Q1K A;  1HR0 L;  2R93 A;  2VNU D;  2AUJ D;  4DR3 L;  1W3S A;  2UUA H;  2D9U A;  2K6A A;  5M5Y H;  4QMG A;  3CAM A;  1ASZ A;  3PW2 A;  1VQI A;  2A19 A;  2I5M X;  2UVR A;  3ERO A;  1XX8 A;  4DK6 C;  4A93 G;  4FP5 D;  5E3F A;  1PH8 A;  4ALP A;  1D7Q A;  3RB0 A;  1MJE A;  3BYY B;  4QUC A;  2BQU A;  1EQV A;  2CQO A;  2ZTD A;  4UHV A;  5KYI A;  1X55 A;  3RB6 A;  2QF7 A;  2VQE H;  2FPP B;  4OWT B;  5KFU A;  2E2D C;  5GAG C;  1K1Q A;  3H3V C;  1EZ8 A;  1PYS B;  4NXN L;  4YY3 Q;  1CFM A;  4IUQ A;  1W6K A;  1Y1V B;  1ZYR C;  2NVY B;  5D8D A;  1DOL A;  3D4R A;  2NTS A;  1B9M A;  1HPC A;  1PA6 A;  3BDO A;  3G6J B;  1JR0 D;  2A69 C;  3OIP A;  4J15 A;  2CCZ A;  2UUB L;  4ED2 A;  2Y0S G;  3V6J A;  2C2D A;  2O5I C;  1H9S B;  1HFG A;  1PLF A;  1J6Q A;  3PV0 A;  1YIT A;  1CQV A;  2R7D A;  1VQ8 A;  5IGB A;  3U9S A;  3C1E A;  4X64 H;  2NVX A;  4RUC A;  1I94 H;  3H09 A;  2JA8 G;  5KG2 A;  1C9O A;  4KJO A;  3NE5 B;  5C4Z A;  3TQ1 A;  4ILW A;  1EWC A;  2J6T A;  4LFA Q;  4LF7 Q;  1SEB D;  2EYM A;  2W9B B;  1IBL L;  4ZKB B;  1PFB A;  4DV7 L;  3TP8 A;  1SCU B;  3RBE A;  2JEB I;  4I7A A;  2AGO A;  3OMG A;  3HEJ A;  5EGT A;  3T1H H;  1RTN A;  2AWN A;  2R93 H;  4K0K Q;  1NNX A;  4ME3 A;  4P75 A;  4G7O C;  4MTD A;  1FD7 D;  4IPD A;  3KDF B;  1I6H B;  1CSP A;  3Q8D A;  2NUC A;  3O13 A;  3HKZ E;  4RCO A;  1EYC A;  3VYU A;  4GKJ L;  2EY1 A;  4X3U A;  5BN4 A;  1X32 A;  3S1R B;  2A1A A;  1B53 A;  2V1C C;  2MGS A;  4AYB E;  1B7Y B;  4CBV A;  3H4B A;  5I2Y A;  3PVX A;  5KFR A;  1I50 H;  1EIH A;  1VQG A;  1LYL A;  2B63 G;  2KQ3 A;  5FPO A;  3HOW G;  5JPM C;  4ED3 A;  1DJR D;  3BZC A;  3PF5 A;  3H3V I;  4KKS A;  4I55 F;  3RUP A;  4DAM A;  1F2Y A;  1WTX A;  3HOY G;  3CF5 A;  3Q8R B;  4DR7 Q;  2KOL A;  4PMW A;  1HQM C;  4A3J B;  4X62 H;  3ERQ A;  1IBM Q;  2I0Q A;  3HGB A;  1F2M A;  3CMA A;  1N32 L;  4OWW B;  3BQ2 A;  2I87 A;  4LF4 H;  2NYZ D;  4MTK A;  4R4Q A;  1HRJ A;  2J7Z A;  2W6N A;  2PZT A;  1VQM A;  3A7L A;  1TS2 A;  3WO1 A;  2DJG C;  1LT3 D;  1B6S A;  4APM A;  1NCV A;  1EYZ A;  5EOY A;  3NWS A;  4APV A;  2M05 A;  4IO9 A;  5E4X A;  5HGT A;  4FBT A;  3ULJ A;  3HOW B;  1XMQ H;  4HN7 A;  2K5V A;  5CB4 F;  3VYR A;  4X65 L;  3MC0 B;  2C28 A;  2PW5 A;  1TWF B;  3DXJ C;  4I4T F;  3CQZ B;  1DON A;  1F77 A;  1J5E H;  1IBL H;  1CM9 A;  5IP9 G;  2ZJP A;  1B3Q A;  1ULZ A;  4YAK B;  1XNQ H;  4QIW B;  1JOR A;  1ML0 D;  2WB1 E;  2LFN A;  3GQC A;  2DPI A;  4OIJ A;  2JA7 A;  1OWT A;  1GOZ A;  2DN8 A;  3DWP A;  2SCU B;  4UCV A;  3T5H A;  4A3I G;  2Z4I A;  4FBU A;  1Z47 A;  3OPO A;  1Q86 C;  3DM1 A;  2DIK A;  3I90 A;  1SNC A;  5BN3 A;  4B3M L;  4QQB X;  2KCT A;  1HZC A;  1U4M A;  1C3O A;  2QKI C;  2AKW B;  2I5L X;  5C4X B;  4B3S L;  3H6M A;  2FK2 A;  2MJ8 A;  3T1Y Q;  4RAY A;  4J9K A;  2IX3 A;  2QA4 A;  3SVM A;  4JBK A;  1XPO A;  3UDX A;  4KY7 A;  1JB3 A;  2JA8 B;  1E4E B;  1WSC A;  1SSO A;  4AQY L;  1Y1W A;  4H44 C;  4KY5 A;  4DUY L;  1CS0 A;  3PCO B;  3HOU G;  3MR3 A;  3BDL A;  3KBX A;  3PUX A;  5KIX A;  3BDC A;  1G6P A;  1QCB D;  3QIA A;  2HQE A;  3LWU A;  4KY6 A;  1LLR D;  4O4L F;  5DQG A;  1I7L A;  1EIF A;  3FPU B;  3CCQ A;  4KTA A;  3T5K A;  5JJZ A;  3GTM A;  1KD1 C;  1HNX Q;  1SMY C;  5KFC A;  4NDX A;  2C9O A;  4XYL B;  4IUR A;  4L5S A;  4DAP A;  4GOP C;  1FGU A;  1SLJ A;  4DL2 A;  2NU9 B;  4LH7 A;  3I73 A;  1KRS A;  4IZ8 A;  5M5Y B;  3PSI A;  3PIO A;  2UXC L;  1WCM B;  2XTI A;  3PQI A;  4X3S A;  2YW2 A;  2WP8 J;  1BCP C;  2HGS A;  2B29 A;  2F0M A;  1UAP A;  2JXM B;  3HKS A;  3J81 L;  2KHJ A;  1NTG A;  4IPG A;  2W70 A;  4JI5 L;  1YJN A;  1WCM G;  4GKK L;  5J1Z A;  3UDG A;  1QB5 D;  4GN3 B;  2DNC A;  1CKN B;  4X66 H;  2R7F A;  1TKW B;  5EWF A;  2UXD H;  4X62 L;  4JI3 Q;  2BH2 A;  2VUM G;  3BJU A;  4R4C A;  4A3E G;  4OO1 G;  1VS0 A;  2Z0S A;  2KSW A;  1CQI B;  1TXY A;  1PRT C;  4X64 L;  4FF3 A;  4V0B A;  2PQA B;  2K33 A;  2WAQ A;  1Q3L A;  5JQW A;  3KHG A;  4IFD J;  2K1B A;  1HNW H;  2XSC A;  1W96 A;  1X3F A;  1SNM A;  2VUG A;  1VBG A;  3L2P A;  3I12 A;  3NBH B;  4OGQ C;  2Q2T A;  1BF4 A;  1JWS D;  1HCZ A;  2R84 A;  3OMC A;  5JVG 3;  2F0T A;  3RNU A;  1Q8I A;  4JBW A;  2JEF A;  5COY A;  5C0X J;  5JH7 F;  1TWA H;  1MD2 D;  4XDX A;  3U9T A;  4BA1 I;  1SFO H;  2AQ1 B;  5GRO A;  3DM3 A;  3UDI A;  4YR2 A;  4GLX A;  2NVT H;  2K4K A;  1CI3 M;  2W8L A;  2E5L H;  1WI5 A;  1MI2 A;  4OXP A;  5FLM H;  2EJM A;  2ZT9 C;  4LF4 Q;  4GKK Q;  5DGB A;  2AMC B;  2ZXP A;  2FLL A;  2KJX A;  4CDF C;  3ULL A;  4YWM A;  3F2D A;  1VMC A;  1M4V A;  3C2P A;  1OTC A;  2YTV A;  1EQT A;  2XNA C;  1I50 B;  5KGU A;  1KAB A;  2ASL A;  1RJR A;  3MXU A;  5KFY A;  1STB A;  4NP5 A;  2VPQ A;  4YY3 L;  4NXN Q;  1RTO A;  2N49 A;  4QW9 A;  2ZTE A;  3K3V A;  5M3F H;  3N41 B;  3V96 A;  1LTA D;  4WBN F;  3TS2 A;  1KL9 A;  1IOW A;  4LF5 Q;  3HOX H;  4A3G G;  4C5A A;  5IYC H;  3RV3 A;  1ZKO A;  1RCV D;  3SI8 A;  5LMU Q;  3MA2 B;  4OX9 H;  3STB C;  1PH3 A;  4BBS H;  4MA0 A;  3BQ0 A;  2R87 A;  1JXL A;  1VQ4 A;  1AN8 A;  4DV6 Q;  1BNZ A;  4QIW E;  1F9Q A;  1XNR H;  5L9X A;  1FGB D;  1G6Z A;  1SYC A;  1TS3 A;  3MWM A;  4DUZ H;  1ET9 A;  2BCO A;  1VQ7 A;  4GS3 A;  1SYX B;  4XX0 B;  3HOY B;  3LWB A;  1SE4 A;  2L1B A;  2IL8 A;  4OEL B;  1JB7 A;  4CDE C;  1N33 H;  4IRC A;  3P7J A;  1Y1V A;  1KIX A;  2NVY A;  4RB3 C;  1QVC A;  1ZXT A;  1K1S A;  4JK1 C;  3EIV A;  2UU9 Q;  1EY9 A;  2B3G A;  4Y7N H;  1RHP A;  1BXR A;  2UVV A;  3M4Y A;  1K3B C;  3NUC A;  1N36 L;  2R82 A;  4BBS G;  2XGT A;  4JV5 Q;  2W57 A;  2R8G A;  3LP8 A;  1OO9 B;  4RHS A;  5M5X B;  1IYJ B;  4HCS A;  2DLN A;  1MGS A;  5D3I B;  1TWH B;  4OX9 Q;  1HA6 A;  1I6U A;  1Q90 A;  3E0J A;  3VR6 A;  2VQF Q;  4FNF A;  4XYO A;  4JI5 Q;  5KFI A;  3MZ5 A;  2E2I H;  4UP7 A;  1K83 B;  1I4X A;  3CRL C;  4MV1 A;  3RAX A;  4FF2 A;  4RCN A;  3BA8 A;  4HTH A;  4YJ2 F;  5KFT A;  4UY8 C;  3GV6 A;  5KG3 A;  4LSX A;  3IL8 A;  4BY1 G;  4LWC A;  3X3M A;  1JOO A;  4YBZ B;  4JV1 A;  1JJC B;  3J81 c;  5D1O B;  2Y0S A;  4RA8 A;  3RUZ A;  1JJ2 A;  4EYH B;  1GUT A;  4ZAI A;  3JRX A;  2Q2H A;  5DLF A;  4GN5 A;  4EQP A;  1AEX A;  4GKK H;  2L11 A;  1CKO A;  1B70 B;  1GSA A;  1D1K A;  2QW7 A;  1I4P A;  3AB9 A;  1VQ9 A;  3PO2 H;  2WB1 G;  4JI0 Q;  3PZP A;  2W6Z A;  4IRD A;  4A3E B;  4DXF A;  2A6E D;  1Z2O X;  1Y1V G;  1B04 A;  1SXT A;  3V6H A;  3LX0 A;  3BVM A;  2A69 D;  4A4I A;  5KFN A;  4A3D B;  1STY A;  2IA6 A;  2FK3 A;  1KBL A;  4UCR A;  4XQJ A;  3B6Y A;  2FB9 A;  2B2W A;  1KJ9 A;  4IPH A;  2AGP A;  2FHT A;  3D0F A;  4HNV A;  1X56 A;  4CDD C;  3Q8S B;  1FJG L;  2ZDG A;  4CHT B;  4JV0 A;  4A93 B;  2MP1 A;  5KT4 A;  3HOV G;  5KFP A;  5D14 A;  1YBY A;  4IUT A;  4KHV A;  2XGP A;  3NXW A;  1QVF A;  4RGM A;  3GTK B;  2B63 A;  2P5Z X;  3M9N B;  4FDB A;  2Q8I B;  2YYA A;  1WYD A;  4RAU C;  4BWG B;  3HBL A;  4FS2 A;  3UQ8 A;  3OTO L;  2ZM6 Q;  4LF6 L;  2Z1C A;  4ECV A;  4YCU A;  4KKU A;  4K0K H;  1BCP F;  4Y8V B;  2A8V A;  3ONA B;  4RMF A;  3ETH A;  2LSS A;  3JSN A;  4JI2 H;  1VQH A;  4LF7 L;  4J9N A;  4DL4 A;  1V4Y A;  3U58 A;  1H9J A;  2UUA L;  2MCT A;  1Z9F A;  2WV6 D;  1JE5 A;  2FMM A;  1N32 Q;  4JI8 L;  4IUU A;  4YB8 B;  4U68 A;  2DWC A;  1XNQ Q;  4LH6 A;  3KXY T;  5F2D A;  1V51 A;  3R5F A;  3PW7 A;  1XTD A;  4QWA A;  2FE3 A;  5J39 A;  2YTX A;  3S17 H;  2WB1 A;  4TV8 F;  1L1O A;  4TV9 F;  5KFQ A;  3GTG A;  2OWO A;  3VPB A;  1FR3 A;  5FPR A;  5ELN A;  1BUV T;  3MFI A;  1IXR A;  2YU9 A;  4MHE A;  2PPB C;  3HOU H;  3R8B A;  2F0D A;  5DGA A;  4HID A;  3CCR A;  3GTP B;  4MV6 A;  2SNS A;  1SYE A;  1E7Z A;  3ERS X;  4O4H F;  2LXJ A;  3W1G A;  2F0S A;  1AE3 A;  4DUZ Q;  1LT4 D;  3RB4 A;  5CV8 A;  4DUZ L;  1NSN S;  4ZK9 B;  3MWE A;  1PH2 A;  1HR0 H;  1PH1 A;  4RZR A;  2VB2 X;  3BZK A;  4O1N A;  3G6E A;  1N36 Q;  4J9R A;  3GTK A;  1GUO A;  3JAM E;  2GPW A;  3I8Z A;  3RBD A;  5HV6 A;  2Z6K C;  3RR5 A;  2VOB A;  4IFD G;  5C4J H;  1J5E Q;  1L2Z A;  4U7C A;  2QCP X;  1RL2 A;  1QZH A;  1Q1B A;  1Z6H A;  1NJI C;  2IT1 A;  1RIP A;  4PNY A;  1BOS A;  5ELO A;  1FL0 A;  2EYP A;  5E4W C;  1X3E A;  3OW7 A;  3HKZ G;  2RQX A;  1T94 A;  1PYW D;  5H1S E;  1G29 1;  3KYH C;  1XNQ L;  2W71 A;  5KG4 A;  4IR1 A;  4JI6 H;  5JJL A;  4UCO A;  1W6J A;  5EKL A;  5KEE A;  3K7A B;  1S97 A;  4KV6 A;  4NB3 A;  2F4V Q;  4O3N A;  3HKZ B;  3S14 B;  4YIJ A;  4A75 A;  3GTM H;  4A3C G;  2E5L L;  1TVX A;  4RB1 A;  1JJG A;  4LUZ A;  2W9A A;  3IG0 A;  3SHL A;  1C7Y A;  1YNJ D;  2YU9 B;  1AUX A;  2UVU A;  3JC6 6;  4J9M A;  4A3M H;  1U4L A;  2E8G A;  3TN2 A;  1I3Q A;  4ABN A;  3GTJ H;  5ELE A;  1VKZ A;  5FLM G;  2VQD A;  2WDT A;  3PUV A;  1I4G A;  1QE6 A;  1UEB A;  2RGV A;  5J22 A;  2YZG A;  3QOL A;  3KLW A;  4C3J H;  2E2I B;  5GQO A;  1CA5 A;  5K2M A;  5LL6 S;  2OCE A;  4GKJ Q;  3GIM A;  3T5J A;  3Q0A A;  1EEI D;  3K5H A;  3U50 C;  1PH9 A;  1ASY A;  1SNO A;  3AEV A;  1EQQ A;  1KHI A;  3L3O C;  4BA2 I;  4IJL A;  1Y1W H;  4IN3 A;  5EWG A;  3PW4 A;  1TWC H;  1KNA A;  3M9O B;  4EEY A;  4P72 A;  1WVL A;  4TQU S;  3MJF A;  2R8K A;  4YHH L;  3PO3 B;  4ZLT F;  4HMI A;  3EA6 A;  3I4N B;  2YZN A;  3TIN A;  3L4K A;  4DR4 H;  5C1P A;  1T9H A;  2HDM A;  1WOC A;  4JI1 H;  2F0W A;  3D4W A;  4A3E H;  4OIK A;  3AFQ A;  4HJ9 A;  2VUM H;  4CKC A;  2B8F A;  2KEN A;  2IMW P;  5KFV A;  4PZ6 A;  3CC4 A;  3G6X A;  1Z7T A;  3SK4 A;  1KDA A;  2ICE C;  5KNB A;  4KHP Q;  3AQQ A;  2ES2 A;  3KHR A;  2K04 A;  2R7N A;  1YNN D;  2RSO A;  4GKJ H;  2EJF C;  2CW0 D;  1BCP D;  4IUP A;  1CHP D;  4RWS C;  2JA5 H;  1JDE A;  4DR5 L;  4U67 3;  2WE6 A;  3UFX B;  3RAQ A;  2JQO A;  1N56 A;  1XNR L;  4IAL A;  1N32 H;  4OON A;  5FD5 A;  1HTL D;  5LMN Q;  3HB9 A;  2WAC A;  2UUB H;  3EPI A;  3GTL A;  1JWM D;  4DL7 A;  1RK6 A;  1HNX H;  1B8A A;  1PZI D;  1YJW A;  4NLG A;  1G8Z D;  2DY7 A;  3JAM c;  3NQT A;  1BBW A;  1TQO A;  2XWB B;  2F0G A;  1KRT A;  3K5L A;  4C3H G;  3K57 A;  5CA1 F;  4B3M H;  3ITP A;  1S10 A;  5C0X H;  3FHW A;  3VPC A;  1VQP A;  2RCF A;  1E3P A;  1D6E C;  5DQI A;  1CUK A;  3TS0 A;  2I80 A;  4EGQ A;  4RGN A;  5JJI A;  4LFC Q;  1B2T A;  2ASJ A;  4BBR G;  1XYI A;  3EPG A;  1NAP A;  4BY7 H;  1PFM A;  3TME A;  3WOF A;  2R86 A;  1I4Q A;  4ZQ3 A;  1KAA A;  4P2C B;  3OSP A;  1B9N A;  1SFO B;  2D0P A;  5C0X G;  3OIQ A;  2B2T C;  4RHR A;  4DA2 A;  3MAQ A;  3J80 E;  3I4M H;  2IWH A;  3H40 A;  4X65 H;  2FKL A;  4LUO A;  1RF2 D;  3KLS X;  4QL5 A;  2TSS A;  3CME A;  1VQF A;  1JCK B;  4DLK A;  2PQA A;  2XWJ B;  2EOT A;  1JC7 A;  5CV9 A;  5KFL A;  4JPB W;  3MWD A;  4CJ0 B;  3DEO A;  4DR4 L;  3RLN A;  5M5W B;  1EFI D;  4G7Z C;  5M3F B;  3A5U A;  1MJC A;  5KG7 A;  4HIO A;  5BR8 L;  1N33 Q;  2K28 A;  2JEG A;  4HR7 A;  2YL2 A;  2NTT A;  1PH4 A;  1ICF B;  1HNW L;  1DIK A;  4DR4 Q;  1S5B D;  1U4P A;  2K75 A;  1V1O A;  4K8J A;  4LFA H;  2RSN A;  3E5S A;  3SEB A;  2F03 A;  5C3E B;  5JEA H;  1YIJ A;  4I50 F;  4IR9 A;  5LA6 F;  3S2D H;  1YVC A;  3VMM A;  1O7Z A;  2UU9 H;  4NMZ A;  1YHA A;  1VQD A;  1Y69 U;  3BVZ A;  1M7J A;  4LJZ C;  4XYQ A;  1KJQ A;  4X3T A;  4RH6 A;  1L0W A;  2FXQ A;  3T1Y L;  2FPI B;  4F50 A;  5C44 B;  1A6X A;  1MKH A;  2NB0 A;  3DWA A;  4MNO A;  2R92 B;  3K6O A;  2VA2 A;  4ECR A;  4B3R H;  2MNA A;  1V1P A;  2GN5 A;  3K59 A;  3NEN A;  3RFC A;  3L0O A;  3GV5 B;  4DNR B;  3F2C A;  4O3S A;  3CQZ H;  5FLX W;  2XD4 A;  5T1I A;  1C4Q A;  5FJ8 G;  5LMN H;  1S9F A;  2VL6 A;  2AQ2 B;  4A3J G;  3GTG B;  1N34 L;  2KBN A;  2IX1 A;  3MFY A;  4K8I A;  1DOK A;  4A3G B;  3GV3 A;  4O2B F;  5JEA J;  1K83 A;  5IT9 E;  5CR3 A;  1EFW A;  5J2U F;  4GLA C;  1Z2P X;  5IT9 L;  1PH5 A;  2B39 A;  2L5T A;  1IL2 A;  1EY8 A;  2Z8L A;  1ESF A;  1TWH A;  1AE2 A;  5C4H A;  4J0M A;  1WTR A;  2BDO A;  1IOV A;  3J7Y W;  4A3F H;  2ALZ A;  2MO1 A;  1KNE A;  3AYH B;  1EZ6 A;  3LNN A;  4EQO A;  3Q6S A;  2K50 A;  4O3P A;  3KF8 A;  2WTF A;  2NVX H;  1X54 A;  2NZ1 D;  3VA7 A;  4WJW A;  1EY7 A;  2OH2 A;  2WFW A;  5IT9 W;  1L0X B;  3TZD A;  3H0G B;  5FD6 A;  1S3O A;  4RNM A;  1X65 A;  4AH6 A;  1C0A A;  3G71 A;  3NHH A;  1HA5 A;  5E7N A;  4O4I F;  3MHB A;  3R23 A;  3IN5 A;  4JVZ A;  1IBM H;  1BBU A;  2A6H D;  3CCV A;  1GYF A;  1K8O A;  2ZJT A;  2V4R A;  1K8M A;  4Q44 A;  4DR3 H;  1GO3 E;  4K2L A;  4ZHQ F;  1WCM A;  4JI2 Q;  4TSS A;  1GVP A;  2PMZ B;  2FK1 A;  2KHS A;  2F0Q A;  3WNZ A;  3WDN A;  5KT7 A;  1HZA A;  4ED8 A;  1TWF H;  1O78 A;  3JAM i;  2RDG A;  4HIK A;  3G8C A;  4JI2 L;  5LXT F;  3S15 B;  2L15 A;  1MSH A;  2JYO A;  4JOI C;  1RJQ A;  3J7A V;  1PFN A;  3N40 P;  3KJO A;  3TP7 A;  1EYG A;  1ENA A;  4QW8 A;  4HQ6 A;  1UNN C;  3HOV B;  4HR7 B;  4LF9 Q;  3C0F B;  1A2T A;  2EJG C;  2SOB A;  3M4Q A;  4FVM A;  5ELF A;  3VR5 A;  3QFF A;  4DL3 A;  2F0O A;  3RZD H;  1E4G T;  5AJ3 L;  3OHB A;  2L4N A;  4A3D G;  4DV6 L;  3G7L A;  4JUZ A;  5ELB A;  3WOE A;  1HHV A;  2BE5 C;  2BH8 A;  4K5V A;  1WTH A;  4RUA A;  3UE0 A;  2O2L D;  2WB1 B;  5IGF A;  3GDE A;  1CQF A;  3GTJ A;  4DPG A;  1I3Q H;  4QIW A;  1SFO A;  4DR7 L;  4DFA A;  1TS4 A;  3K80 C;  2E2I A;  4DV1 H;  2AUK A;  3PUW A;  4UP9 A;  3VR2 A;  1A3T A;  2VXW A;  1B6R A;  1K28 A;  1S5E D;  3P1H A;  3FKI B;  3GTP H;  1GUG A;  2IX0 A;  2AHO B;  4RGO S;  1VF7 A;  4FO2 A;  2XGQ A;  3HFZ B;  4A3F G;  4C5C A;  3T4A C;  1LM0 A;  1SE8 A;  1T5E A;  4FXK C;  2KED A;  4ODG A;  3VYT A;  4E4T A;  2OT2 A;  3D6W A;  3FVQ A;  5L1K A;  3HP3 A;  4LF6 H;  1XTC D;  5CMD A;  4P73 A;  1EY0 A;  4JI6 Q;  4QF4 A;  3S2H H;  5FK9 C;  1L2F A;  4YR3 A;  4EBC A;  3BG3 A;  4GN4 B;  4PMC A;  5M3M H;  1GSO A;  2CH4 W;  3ETJ A;  4LF7 H;  4LAA A;  4A3J H;  5IYB H;  4Q0Y A;  4MAM A;  3F8N A;  4BBS B;  1Y1W G;  1D5Z C;  3N44 B;  3MR6 A;  4DF7 A;  4DR1 H;  3JZI A;  1QJO A;  4UPA A;  2Q2U A;  2QEX A;  4DV1 Q;  1LO5 D;  4F4X A;  3K81 C;  2R93 B;  1DZ1 A;  4DL5 A;  4GOP A;  4C3J G;  2YRW A;  2E2H H;  1SEI A;  2MHV A;  4CKE A;  4LFC L;  3JRW A;  3KHL A;  2WII B;  1S68 A;  4QWB A;  2X0S A;  3NGD A;  4J9L A;  4CC5 A;  1KDC A;  4LFB Q;  1H9R A;  4JI8 H;  1V1Q A;  3FRP B;  5KFG A;  2R7Z G;  3V6K A;  4MZ9 A;  4FM9 A;  4BY1 H;  4ID6 A;  2B2U A;  4EEQ A;  1QWY A;  5FO8 B;  2UUB Q;  1E1O A;  3VPD A;  1PVO A;  3M7N A;  2FLN A;  1TR5 A;  4LF9 H;  4A3K H;  1ICW A;  1AZQ A;  1GD7 A;  1MIU A;  1VDZ A;  3ND8 A;  3W3A A;  4DR5 Q;  1G51 A;  2EQS A;  2JEA I;  1L1O B;  2J0T D;  1XJV A;  5A2Q W;  2L12 A;  1M1K C;  1ENF A;  1ENC A;  2VZA A;  2XVS A;  5HGQ A;  1CK1 A;  3NBH A;  4ZUJ A;  4OL7 A;  4GC6 A;  3HS0 C;  4DR3 Q;  1AP0 A;  3CU7 A;  1R4Q B;  5ELC A;  4L8J A;  5E1F A;  5IY0 A;  5IGG A;  2SNM A;  1P16 A;  3CQZ A;  4KN4 C;  5G3L D;  1SAP A;  2JA6 G;  2JA7 H;  3PO3 H;  1CE8 A;  1EUC B;  3T53 B;  1N36 H;  4B3T H;  3HZX A;  1JT8 A;  1QNU A;  5A2Q L;  2K05 A;  1E2Z A;  2JA7 G;  4PWQ A;  4UDU C;  1WTV A;  5CV4 A;  5DLG A;  1QOH A;  1R9T H;  4Y52 H;  2ZDQ A;  4I65 A;  5A2Q E;  5LMU L;  2F0N A;  2V5A A;  4F4W A;  1LTI D;  2JJQ A;  4ZYS A;  1EOT A;  2O4X A;  1DM0 B;  4JI5 H;  2K32 A;  1OXV A;  1VCI A;  3SDZ A;  2LXK A;  3NPP A;  3KFU A;  2RGR A;  3V4S A;  4NKL A;  1ET6 A;  5CBE E;  3I2Z A;  3M9M B;  5IYC G;  3UDF A;  5IE8 A;  1KEE A;  2AU0 A;  3HOX G;  4X64 Q;  4GC7 A;  5L37 A;  2BR0 A;  5BN5 A;  3EYY A;  5C5L A;  4C56 C;  1AUV A;  1JIH A;  1JLL B;  3MR5 A;  3LWE A;  1XDN A;  3A56 A;  2W6M A;  4Y7N B;  2A68 C;  4Q0F A;  3FMA A;  3WWV A;  2BOS A;  3ER0 A;  2F0I A;  3GP7 A;  1NUC A;  2FJ2 A;  3BU2 A;  1RDP D;  1IW7 C;  2UVW A;  1OXS C;  3MR2 A;  4JCV E;  3M9B A;  1K8G A;  1ZHQ A;  3GIK A;  2F0H A;  1VMP A;  2MPM A;  2QYZ A;  2R8H A;  1IYV A;  3OWF A;  4LF8 Q;  4DXG A;  2R8J A;  1STG A;  4DV5 L;  3KDF A;  3L7Z C;  3M85 A;  2NVQ H;  4LFB H;  4DAY A;  4EGV A;  5FO9 B;  1PFS A;  1U9R A;  5EKI A;  4Z9C B;  1A62 A;  1JDB B;  4J6H A;  2I5H A;  3LML A;  2EY2 A;  2RKS A;  1PK8 A;  4ZOL F;  4YQW A;  5HUR A;  1M0W A;  2XN9 C;  5I6W A;  1N34 H;  5AJ3 Q;  5LP6 F;  2EZV A;  2PZW A;  5CV6 A;  1AFP A;  3J80 c;  2YS7 A;  2FP4 B;  1N48 A;  1YHB A;  4IOC A;  4B3S Q;  2FMC A;  3T13 A;  2NVT B;  3HOZ B;  4DK1 A;  3RD4 A;  1XWE A;  4DV3 Q;  1HNZ L;  1N9W A;  4DR5 H;  2UXB H;  1VQB A;  4LMQ D;  3Q23 A;  5DAU A;  1H9S A;  2IHE A;  1LTL A;  4DNI A;  4AQY Q;  4QUF A;  4OO1 H;  4JI1 Q;  3TIG A;  1PMR A;  1RJP A;  4NXM Q;  1BQQ T;  2CQY A;  3BZD B;  3H91 A;  4JV2 A;  3P75 A;  2NBF A;  1EY6 A;  2L9H A;  1CQJ B;  1WCM H;  5DM6 3;  1UUP A;  2Z4H A;  4A3I B;  4O2A F;  4LNQ A;  3S1M B;  5M9O A;  5I47 A;  3HOZ G;  4B3T Q;  3FPP A;  4IAJ A;  2GPS A;  3E5N A;  4NW2 A;  4YHH H;  3S1N B;  1LAB A;  2F0K A;  3S24 A;  3L9A X;  3TSS A;  3S2H B;  1QIL A;  1WTW A;  4AYB A;  4ECW A;  1H9M A;  3IFD A;  4JI4 L;  3QB3 A;  2ZJQ A;  2C35 B;  4XT3 B;  2R7Z A;  4MV4 A;  1S5F D;  4J1M A;  4ZCK A;  1WD0 A;  2BE5 D;  4C2M B;  2NU8 B;  3F2B A;  5FKA C;  1A9X A;  1UE5 A;  4DU9 A;  5I9P A;  1GSH A;  2PYK A;  1KJ8 A;  4UCS A;  3C3L A;  1M6V A;  3J80 W;  5KFX A;  3PR5 B;  5JAV A;  3A8I E;  4ME5 A;  5A35 A;  5JJK A;  2CW8 A;  1VQK A;  4HJ7 A;  3MWY W;  1PYB A;  5DNF A;  3RZO H;  1UE1 A;  4B3M Q;  1F2L A;  1UE7 A;  1WJJ A;  2PMZ E;  1J5E L;  4R4T A;  1X6O A;  4POF A;  4DNT B;  5KRU A;  2W6Q A;  2BQ3 A;  3RMH A;  3GTO H;  5KFM A;  1STE A;  1G2T A;  2O03 A;  2QIL A;  4DAY B;  4MN3 A;  4FXD A;  4RGT A;  4CGY B;  4POG A;  1B4O A;  5KYL A;  4O42 A;  4G7H C;  4ZI7 F;  1QZG A;  3MVV A;  5M5X H;  1Y8N B;  4HSV A;  1Q8K A;  3TP6 A;  2A5H A;  3S17 B;  3EFX D;  1SN8 A;  2UUC L;  3A54 A;  1TU2 B;  3CVZ A;  3M7G A;  5GAD C;  3T1H L;  1UNS A;  2JA6 H;  3GIQ A;  3VYS A;  3GTQ B;  4X65 Q;  3KLS A;  2A73 B;  4DV6 H;  3SK5 A;  1X3G A;  5IOD A;  3NTK A;  1WD1 A;  1H95 A;  3CCS A;  5ELD A;  3CP0 A;  3JSL A;  2W8K A;  4DV5 H;  3TZU A;  2IPK D;  1YNN C;  3GIP A;  4BS9 A;  3PGZ A;  4DV7 Q;  2JA7 B;  4C2M A;  1XPR A;  1EY5 A;  1EZ1 A;  2EY6 A;  2I8C A;  2F0P A;  5C6A A;  2OF1 A;  3I4N H;  5KFH A;  3FDT A;  1SJH D;  2JA5 A;  1TY0 A;  2FFK B;  4AYB B;  3N6X A;  2JN4 A;  5KFO A;  2WAQ B;  2Q2I A;  2ICI A;  1LTB D;  3RLO A;  4UFZ A;  3K5O A;  3QOJ A;  5EPJ A;  1KJJ A;  4L1K A;  1EUJ A;  2R7Z H;  4H02 A;  4P74 A;  3M4O H;  2B8G A;  4C1N K;  2Q8T A;  4C3I B;  1PX2 A;  2M9V A;  5FLX L;  2LY7 A;  4QB4 A;  4LF6 Q;  1FYC A;  4LF8 H;  4X3K A;  3Q2O A;  2W7O A;  2MUY A;  3RGZ A;  4JI3 H;  4QJF A;  3RB3 A;  1T5X D;  3RN2 A;  4K5X A;  1R9T A;  3BVG A;  1PTO F;  3SK6 A;  1XMO Q;  2F3I A;  1PH6 A;  4F4Z A;  3HOW H;  2ASB A;  3CW2 C;  2QGQ A;  4PZ7 A;  4TRD A;  2XCA A;  3PW0 A;  5FJ8 H;  3TEH B;  2VUM A;  3DWQ A;  3STB D;  4JBJ A;  2B2U C;  4WFN 3;  2F0J A;  1K0S A;  1N34 Q;  5JUM A;  4L6T B;  2YS6 A;  5M3M G;  3DMU A;  1M0T A;  2JA9 A;  2JK8 A;  1F9S A;  4JBM A;  4N8F A;  5FOB B;  1RD9 D;  2RF4 A;  1HTP A;  1TAE A;  3RV4 A;  3ICE A;  2R93 G;  3G6V A;  5DM7 3;  2MO0 A;  4YP3 A;  3CD6 A;  4R1J A;  3PIP A;  2IHF A;  1V8Q A;  3U9O A;  2X69 A;  2VW9 A;  4KLK A;  4I7H A;  3NP8 A;  2AQ4 A;  1Y1W B;  4FS1 A;  2R92 A;  2OLS A;  3PUY A;  4XXE A;  5KFA A;  4TKO B;  2OXP A;  3I55 A;  1K3R A;  1BBX C;  2JA8 H;  4KJN A;  2Z6K A;  3PO2 G;  5ISR A;  2YYZ A;  2AGQ A;  2PCF B;  3DLL A;  4QY7 A;  1E22 A;  2E2J H;  4J9Q A;  2F3W A;  4DAV A;  2JEI A;  2QK4 A;  1EQR A;  5C5M A;  2ZDH A;  3HOU B;  4RB0 A;  1FJG H;  2UXC H;  1STH A;  1L0Y B;  5KT3 A;  3NK9 A;  2GLT A;  3EQL C;  1TA8 A;  1IW7 D;  2PZU A;  1I5F A;  3LGJ A;  3UI2 A;  1PH7 A;  2FPG B;  2R61 A;  3OYY A;  3PF4 A;  1WFQ A;  1T3N A;  4EQ5 A;  2BA0 A;  5T1G A;  2F0U A;  5CA0 F;  2SDF A;  4QWD A;  4HYK A;  3BAB A;  4JI1 L;  1W93 A;  1S5D D;  2RBM A;  2P0A A;  3GIL A;  1JE4 A;  1Y8O B;  2DY8 A;  3I72 A;  4M7E A;  1ESR A;  1DV1 A;  1B3A A;  3A0J A;  2F3V A;  3I4M G;  3A5Z B;  3SK8 A;  2UXD L;  2UUC Q;  4LFC H;  3K5N A;  2BDN A;  3A8K E;  5DLQ E;  1T36 A;  2WIN B;  5C4J B;  1YI2 A;  2HVR A;  2J4X A;  3KF8 B;  3GTK H;  4ZQI A;  1X3P A;  3NWT A;  3QWN A;  4HJ5 A;  3S2D B;  4BBR H;  5FLX c;  4M1U B;  3J81 W;  2JE6 I;  4LMY A;  1AW7 A;  2Q8R E;  1GHK A;  3OSO A;  4EYI B;  3H94 A;  1CKM A;  5IWA H;  1ZQ7 A;  2HHH H;  1Q7Y C;  4C3H H;  1S0M A;  4DV5 Q;  4G57 A;  2HJW A;  1C48 A;  3ORR A;  2ASD A;  2XIW A;  1SYG A;  2R7M A;  4EQN A;  4MA5 A;  1VQ5 A;  2RDI A;  1NE3 A;  4LUV A;  4N9T A;  2EYL A;  1PTO B;  4ZUI A;  1O7L A;  4RG1 A;  4MV8 A;  2VR1 A;  2W6P A;  3S1R H;  4A2B A;  3MTS A;  1EL0 A;  2KVM A;  2K03 A;  5FLX E;  3NQI A;  1HZB A;  3FP9 A;  1RKN A;  1OXU A;  1XXG A;  2YU9 H;  4YJ3 F;  4WJ4 A;  3Q8Q B;  4WD3 A;  1R4P B;  3GTG H;  3HRZ C;  2K52 A;  4CJ1 B;  4DV4 H;  3RIZ A;  2JA5 G;  1HXY D;  3DUZ A;  4PQX A;  2MQH A;  5KFK A;  4MV3 A;  1PRT D;  4J9O A;  2OTL A;  4A3K G;  4B3T L;  4IFD I;  2O5J C;  1EU3 A;  3C1F A;  4O0A A;  3Q24 A;  5H80 A;  4C3I G;  3IRB A;  4JV5 L;  1S03 G;  2RHQ B;  2IP4 A;  2X6L A;  1VQE A;  2I07 B;  2K5H A;  5DQH A;  2CWP A;  4B9X A;  3J81 i;  2DPJ A;  3K5M A;  1A2U A;  4IZO A;  2K14 A;  1IYU A;  5L1L A;  1STN A;  5EAY A;  3HOY H;  2CWA A;  1Y8P B;  5HBR B;  1U0L A;  1HUM A;  4DV3 H;  2JEJ A;  4C1N I;  1RK5 A;  3W2D A;  4GNX C;  1PTO D;  3T5L A;  3AU7 A;  5C3E H;  4ECZ A;  1XMO H;  2BQR A;  5KNC A;  4EFB A;  3I4O A;  2B63 H;  4WOR A;  3J7A F;  3H0G A;  3R5H A;  4DUY Q;  1Q81 C;  5KFS A;  4DV1 L;  4M8A A;  3M3Y B;  4QCL A;  4Q45 A;  2CVR A;  3SR1 A;  3CC7 A;  1PV4 A;  1RJT A;  1LAC A;  4G3I A;  4EG0 A;  4LF5 L;  2A6E C;  2JA5 B;  5T14 A;  3P20 A;  3KAL A;  1QUQ A;  4OWX B;  1YNX A;  1NR4 A;  2HDL A;  3VR3 A;  3TRZ A;  1EUD B;  4RKB A;  2NZH A;  3UE1 A;  2GVB A;  3CC2 A;  5JEA G;  1I6V C;  2F4I A;  5J3B A;  3N6R A;  3K7U C;  2R92 G;  4NPS A;  5CAE B;  2UXC Q;  3ND9 A;  1TWH H;  3NSW A;  4XQN A;  1VF5 C;  4LF4 L;  2TMP A;  2H4O A;  3FEW X;  3TBI B;  2PNR C;  4H0L C;  4KHZ A;  4KHP L;  3TII A;  2DUD A;  4HNT A;  2B2W C;  1K83 H;  1NMG A;  4KKT A;  2EYF A;  4DV4 L;  1CZW A;  4JYA Q;  3CPF A;  2CKZ B;  4ZKC B;  1PZJ D;  3GTL B;  5C4X H;  1HNX L;  3PN1 A;  1TWA A;  3AFP A;  4DN4 M;  4DGZ A;  5DG7 A;  4YHH Q;  2DZD A;  4IFD H;  4WJ3 M;  2DJF C;  1M8A A;  1JOK A;  5JPN C;  4Q5V A;  5C5J A;  5K36 H;  4FYD A;  4A3B B;  3I4M B;  4XYM B;  4R8I A;  5LMU H;  3EN2 A;  4A93 H;  4ECQ A;  3H0G H;  1WR2 A;  1TWG B;  1MBY A;  2AWO A;  4B3R L;  5IWA Q;  2HHH Q;  1S40 A;  4BY7 G;  5CV5 A;  1S0N A;  1HZ9 A;  5JOB A;  5KFF A;  3SE0 A;  1AH9 A;  3Q22 A;  3CCU A;  3K3P A;  1GHJ A;  1SE2 A;  2RCN A;  3N52 A;  4FF1 A;  3C46 A;  1XMO L;  4RB2 C;  2Z6B A;  1II3 A;  3W5O A;  2XCP A;  4DK0 A;  3G48 A;  1MZB A;  2VPS A;  2J6S A;  2D5D A;  4A3L G;  5K36 G;  2F4V H;  4HMJ A;  1CT1 D;  5KT5 A;  5I4D A;  2GA4 B;  5L1I A;  4YAJ B;  2B2T A;  5GAE C;  1ILP A;  5IGD A;  1OXT A;  3U4Z A;  3GV7 B;  5IP9 H;  2B2Y A;  2R85 A;  2EXD A;  3GTP A;  3I4L A;  4LFA L;  1JKJ B;  3NTI A;  1L1O C;  1CHQ D;  4DUY H;  4ECU A;  5CV7 A;  1VQN A;  5IT9 c;  3OUU A;  1DXM A;  2F52 A;  3R93 A;  2RDF A;  4V19 0;  2VQF H;  4J9S A;  5IP7 H;  5KT6 A;  1IBK H;  3MXG A;  1SR3 A;  2K5W A;  1IL8 A;  3CCM A;  4ULL A;  1PRT F;  5KFB A;  2EY5 A;  5EBC A;  1JMC A;  4O3O A;  2C2E A;  2R92 H;  5LYJ F;  1CSQ A;  4HNU A;  1I4R A;  3A74 A;  4KK7 A;  4F8M A;  3KJP A;  3OHA A;  3OUZ A;  3EVQ A;  5DG8 A;  1VQA A;  1IBM L;  1U4R A;  5BPF A;  4YCW A;  1CTM A;  1YZ6 A;  2EVB A;  1J8I A;  4KD3 A;  2N8N A;  4R7R A;  2JP1 A;  2NZO A;  4HED A;  1WH2 A;  3EBE A;  4DR1 L;  1M90 C;  2NN6 I;  1GUW A;  4DR6 Q;  3GLK A;  4RZQ A;  4O2D A;  1A15 A;  5FO7 B;  3S16 H;  2NWG A;  3R3O A;  1E2W A;  3GTQ H;  3KOJ A;  1EOV A;  5KT2 A;  1K0R A;  1NMF A;  4B08 A;  1Q46 A;  2WAQ E;  3T1H Q;  2L0C A;  2N55 A;  2AQ3 B;  1ZYR D;  4E6I A;  5L1J A;  1S4Z A;  2PI2 A;  1Z2N X;  1Y1V H;  2NVY H;  1YHQ A;  5C3X A;  4PG3 A;  1WTQ A;  2N88 A;  3DHQ A;  1BJT A;  1HR0 W;  3QZ7 A;  5LMN W;  4HIM A;  4GOP B;  2VB3 X;  3CPW A;  4F88 A;  3GII A;  2NVX B;  3BJY A;  3N43 B;  5IYD G;  4IRK A;  2BA1 A;  2J6U A;  3MEH A;  1P8L A;  3MXN A;  1VQ6 A;  3G4S A;  4A3M G;  2YCH A;  5KG1 A;  3KUP A;  3X3N A;  2K7V A;  4IWY A;  1IBL Q;  4BWS C;  4B9W A;  4H7B A;  4LK1 C;  1ONL A;  5I9O A;  4C3I H;  4FU0 A;  1SRU A;  4JYA L;  2LKV A;  1QNK A;  4A3C H;  4UCU A;  1G91 A;  5LMN L;  3HG9 A;  4LSA A;  4KMU C;  3KF6 B;  3URY A;  2E2H B;  3PW5 A;  1UE6 A;  3QG1 A;  3RF2 A;  5KX5 F;  1ZEQ X;  3KK7 A;  3IAY A;  4C5B A;  1PRT B;  4CKB A;  3VDY A;  1KLG D;  4A76 A;  1TT2 A;  1EWH A;  1O75 A;  3SE7 A;  4O3Q A;  1NBW A;  1TWC B;  1EWI A;  3J80 i;  2HIV A;  2ID0 A;  4MV7 A;  1B1Z A;  5F9N A;  1EYA A;  1SYF A;  5G3L F;  1CZG A;  4M9U A;  4ED6 A;  1IKL A;  4DL6 A;  1FJG Q;  2CW7 A;  2D0O A;  2V59 A;  1DGS A;  3RZD B;  2W6O A;  4IJH A;  4L5R C;  3GTO A;  5J2T F;  1LUZ A;  1LT5 D;  1BNC A;  4X66 L;  3K58 A;  4RNN A;  4JI7 L;  3FMC A;  4JI7 Q;  2R8I A;  1HR0 Q;  4XT1 B;  5D3D A;  3IKJ A;  5CC4 A;  1EHI A;  3T51 B;  1C8C A;  4DV4 Q;  1FNV A;  3RGX A;  2Z9H A;  5AFW A;  1V1P B;  1CA6 A;  4IPC A;  1KJI A;  4DV7 H;  2SEB D;  2G5D A;  4MIU A;  3V4Z A;  3I70 A;  1HFN A;  1NR2 A;  3CXC A;  2UUC H;  2H5X A;  4XZ3 B;  1TWG H;  2FIN B;  5NUC A;  5M3F G;  5DG9 A;  3KAK A;  4K14 A;  2VY3 A;  1HUN A;  1GJX A;  5C8Y F;  2PQE A;  1Q1E A;  4R8U B;  3KAJ A;  3J7A 5;  1B50 A;  2V58 A;  3M4P A;  2KCN A;  4IUN A;  1IBK L;  4I7Z C;  1V9P A;  1PXU A;  2NN6 H;  2R7L A;  5C3W A;  4WRD A;  5EWE A;  2G9D A;  1SNP A;  1MHW C;  1UC8 A;  4GNX B;  1RYR A;  2RA4 A;  1JIC A;  2PBZ A;  2CQA A;  2UU9 L;  4RKL A;  5I6Y A;  5JVH 3;  3TP5 A;  3T56 B;  1GGO A;  2XIG A;  1KTK A;  5EPL A;  2ZXO A;  3CRK C;  2K5Q A;  4IOA A;  1D5X C;  1Q12 A;  2VS1 A;  4EX5 A;  4BBR B;  4DR6 H;  2KHI A;  2K5D A;  4BY7 B;  4IWX A;  5IGC A;  5KFJ A;  2UXB Q;  2VQE Q;  3HOV H;  1IZ6 A;  4L5T A;  2NU7 B;  3I56 A;  2V9W A;  1TS5 A;  3DEP A;  3SXH A;  2IY5 B;  4GZY C;  2KCM A;  3A8J E;  3S1Q H;  1I4H A;  3PO2 B;  1TWC A;  1KLU D;  2HT1 A;  3FKI H;  3J80 L;  1PTO H;  3BQ1 A;  1TII D;  4L5Q A;  4JI6 L;  2F0E A;  1LV9 A;  1ROD A;  3KLR A;  4S3S A;  4CJ2 C;  5M5W H;  1VAJ A;  3QJY A;  5DEH A;  3MEF A;  4DR2 Q;  3RJ0 A;  2B2Y C;  1PTO C;  4J9P A;  4EVO A;  2KEC A;  2H1E A;  4G4K A;  5D65 A;  2WKC A;  3HOX B;  2ZTC A;  1NY4 A;  3MFG A;  2PVP A;  3S16 B;  1DV2 A;  4TUY F;  1DCZ A;  4F7X A;  4IUV A;  1A63 A;  3QO2 A;  4JYA H;  2OQ0 A;  1GUN A;  1KAW A;  4CDC C;  3H4D A;  1D5M C;  2M00 A;  1LTG D;  2PNH A;  1BCP B;  1WTP A;  2E5L Q;  4NXM H;  3ZYY X;  4J8Q A;  5EDW A;  2CFM A;  1X9N A;  4KD4 A;  1A3V A;  1A8V A;  5I2X A;  4IHJ F;  4Q43 A;  2KA7 A;  3R2T A;  4N9P A;  2UUA Q;  5GON F;  4DKA C;  2D62 A;  1J9O A;  3S1N H;  5KKN B;  3I4N G;  1DD2 A;  5EJW A;  1UEA B;  2B2V C;  4TVA B;  2PMZ A;  1KC7 A;  4R4O A;  1X3Q A;  4HSP A;  4DV2 Q;  2XC9 A;  1YEZ A;  3S14 H;  3K0Y A;  4C2M H;  2N78 A;  3M4I A; 
#chains in the Genus database with same CATH homology
 1HJP A;  3T1Y L;  1EIF A;  3CCQ A;  2Z6K A;  3PO2 G;  2YYZ A;  1VQO A;  3DLL A;  1E24 A;  1MKH A;  1KD1 C;  4MNO A;  2HQL A;  2OQK A;  1E22 A;  4QY7 A;  1HNX Q;  2E2J H;  2WAQ G;  4GOP C;  1FGU A;  1SLJ A;  4L5S A;  3M3Y H;  3TRE A;  1KRS A;  2MNA A;  2GN5 A;  3PSI A;  3PIO A;  3NEN A;  2UXC L;  3L0O A;  1EQR A;  3F2C A;  4LF9 L;  2XTI A;  3CQZ H;  5FJ8 G;  2WP8 J;  1I6H H;  3K7A H;  4YCV A;  2VL6 A;  3LGJ A;  1I5F A;  4A3J G;  1PH7 A;  2B29 A;  1N34 L;  2KBN A;  2IX1 A;  3OYY A;  3PF4 A;  1WFQ A;  4EQ5 A;  4XIG S;  2BA0 A;  3HKS A;  2KHJ A;  2MFI A;  1NTG A;  2ALY B;  4IPG A;  4JI1 L;  4JI5 L;  5JEA J;  1YJN A;  1WCM G;  1I94 Q;  1EFW A;  4GKK L;  3UDG A;  4GLA C;  4GN3 B;  4JOI A;  1CKN B;  3A0J A;  3I4M G;  2R7F A;  3A5Z B;  1PH5 A;  2UXD L;  2UUC Q;  1IL2 A;  1FVI A;  4X62 L;  4JI3 Q;  4DR6 L;  1IBK Q;  2BH2 A;  1AE2 A;  2VUM G;  3BJU A;  1QUQ B;  4R4C A;  4A3E G;  5DLQ E;  1VS0 A;  2Z0S A;  3OW2 A;  4A3G H;  1YI2 A;  4OO1 G;  2JA8 H;  1S72 A;  1TXY A;  4A3F H;  3KF8 B;  4X64 L;  3GTK H;  4HJ5 A;  1BVS A;  2MO1 A;  2PQA B;  3AYH B;  4BBR H;  5FLX c;  4DV0 Q;  2F4V L;  4OO1 I;  4IFD J;  2JE6 I;  2K50 A;  1X3F A;  1SRO A;  2NVX H;  1X54 A;  3L2P A;  3GTL H;  3NBH B;  4AIM A;  3H15 A;  3GO5 A;  2Q2T A;  2WFW A;  1CKM A;  3ULP A;  1K73 C;  1PHJ A;  1Q7Y C;  4C3H H;  4DV0 L;  4DV5 Q;  3RNU A;  1S3O A;  3E9H A;  1X65 A;  4AH6 A;  4JBW A;  3G71 A;  1C0A A;  5C0X J;  1TWA H;  4BXX G;  5E7N A;  1VQ5 A;  1NE3 A;  5IYD H;  4LUV A;  4A3B H;  4JC0 A;  4B3T L;  4RG1 A;  4BA1 I;  1SFO H;  3HOZ H;  4YWL A;  3E9I A;  1BBU A;  3DM3 A;  5GRO A;  3UDI A;  3CCV A;  4GNX A;  4GLX A;  2K4K A;  3S1R H;  1N8R C;  1K8A C;  2NVT H;  1WI5 A;  1HZB A;  3FP9 A;  4OXP A;  1GO3 E;  5FLM H;  1OXU A;  1I94 L;  2YU9 H;  4LF4 Q;  4GKK Q;  1SMX A;  2AMC B;  4WJ4 A;  3GTG H;  3ULL A;  2K52 A;  4YWM A;  4JI2 Q;  3F2D A;  1GVP A;  3J7Z C;  2JA5 G;  1OTC A;  2YTV A;  3J81 j;  4DR1 Q;  2MQH A;  5IYB G;  3FKI G;  1KXL A;  2ATW A;  1Q82 C;  1HZA A;  2OTL A;  4A3K G;  4YY3 L;  1TWF H;  3F8T A;  2N49 A;  4PZ8 A;  3JAM i;  2ZTE A;  4HIK A;  1W2B A;  1QVG A;  4JI2 L;  4NXM L;  5M3F H;  2L15 A;  1O7I A;  4JOI C;  1XPU A;  4O0A A;  3TS2 A;  3KJO A;  1KL9 A;  4B3R Q;  1EYG A;  4LF5 Q;  3IRB A;  4JV5 L;  3HOX H;  4A3G G;  5IYC H;  2RHQ B;  1VQE A;  2K5H A;  4LF9 Q;  3M4Q A;  2CWP A;  4JI8 Q;  3J81 i;  5LMU Q;  3S15 H;  1EIY B;  2K14 A;  4YWK A;  3STB C;  3RZD H;  2YTY A;  1PH3 A;  4BBS H;  5EAY A;  3HOY H;  2CWA A;  5AJ3 L;  1VQ4 A;  1U0L A;  4DV6 Q;  4A3D G;  1VQC A;  4QIW E;  4DV6 L;  4GNX C;  3D31 A;  5C3E H;  3GD7 A;  4A3B G;  1XMQ L;  2N3S A;  5IP7 G;  2BH8 A;  3NEL A;  4BXX H;  3I4O A;  1VQ7 A;  3UE0 A;  4GS3 A;  4DV2 L;  2B63 H;  3F1Z A;  2NN6 G;  4X6A H;  1JB7 A;  3GDE A;  3CCE A;  4DUY Q;  3K8A A;  1I3Q H;  4DPG A;  1Q81 C;  1KIX A;  1VQL A;  4DV1 L;  1QVC A;  4DR7 L;  1KQS A;  3K80 C;  4UP9 A;  3EIV A;  3PUW A;  2B3G A;  4Y7N H;  2UU9 Q;  4A3D H;  3CC7 A;  1PV4 A;  2ZM6 L;  3S1M H;  3GTP H;  2IX0 A;  1N36 L;  2AHO B;  4BBS G;  2XGT A;  3W1B A;  1YJ9 A;  3HFZ B;  5C0X I;  4A3F G;  4LF5 L;  4JV5 Q;  4A3L H;  4MTN A;  1LM0 A;  1OXX K;  1SE8 A;  1IYJ B;  1QUQ A;  3SGI A;  4OX9 L;  4OWX B;  1YNX A;  4OX9 Q;  3TRZ A;  4Y52 H;  1L0W A;  4DR2 L;  5IWA L;  2VQF Q;  2NZH A;  3UE1 A;  2HHH L;  2OTJ A;  2GVB A;  3CC2 A;  3KF6 A;  2Y0S E;  5JEA G;  4JI5 Q;  2E2I H;  5J3B A;  4UP7 A;  4P73 A;  4JI6 Q;  3K7U C;  2R92 G;  4NPS A;  3S2H H;  2UXC Q;  1TWH H;  1L2F A;  4UY8 C;  4GN4 B;  2DGY A;  4JG2 A;  4LWC A;  4BY1 G;  5M3M H;  4LF4 L;  4KHP L;  4KHZ A;  4A3J H;  5IYB H;  2YV5 A;  4A3I H;  4HJA A;  4JI0 L;  2DUD A;  3H0G G;  4DV3 L;  1Y1W G;  1JJC B;  3J81 c;  1BKB A;  1K83 H;  1NMG A;  3MXN B;  1VQJ A;  4DV4 L;  1JJ2 A;  4UPA A;  3PO3 G;  3CPF A;  4JYA Q;  2Q2U A;  2CKZ B;  2QEX A;  4DV1 Q;  4K0K L;  2Q2H A;  5C4X H;  3K81 C;  4GN5 A;  4KI0 A;  4GOP A;  1HNX L;  1CKO A;  1B70 B;  2E2H H;  3AFP A;  1VQ9 A;  4YHH Q;  3PO2 H;  4LFC L;  5C4X G;  2WB1 G;  4JI0 Q;  4WJ3 M;  3RN5 A;  2RHS B;  1Y1V G;  4LFB Q;  2UXD Q;  1V1Q A;  3EN2 A;  4AYB G;  4A4I A;  4A93 H;  3H0G H;  3TQY A;  4LF8 L;  2R7Z G;  4MZ9 A;  3B6Y A;  1HNW Q;  2AWO A;  4BY1 H;  4B3R L;  5IWA Q;  2VQF L;  1S40 A;  3U4V A;  2HHH Q;  4IPH A;  3CCL A;  1HH2 P;  2UUB Q;  4BY7 G;  3H3V H;  1HZ9 A;  5BR8 Q;  3D0F A;  1E1O A;  4UP8 A;  1N33 L;  3M7N A;  1X56 A;  1PVO A;  3OTO Q;  1AH9 A;  4JI4 Q;  1FJG L;  4A3K H;  3CCU A;  2R6G A;  3HOV G;  1U5K A;  2RCN A;  1GD7 A;  1MIU A;  1YBY A;  1XMO L;  1QVF A;  1D8L A;  4DR5 Q;  3W5O A;  1G51 A;  3G48 A;  2EQS A;  1L1O B;  1V43 A;  4FDB A;  1XJV A;  1WYD A;  2ZJR A;  1M1K C;  4A3L G;  5K36 G;  2VZA A;  3ZJY C;  5HGQ A;  5C44 G;  4DK3 C;  4DR3 Q;  1HNZ Q;  3OTO L;  2ZM6 Q;  5GAE C;  4P71 A;  1OXT A;  3U4Z A;  4LF6 L;  5IP9 H;  2EXD A;  5IY0 A;  4HJ8 A;  4YCU A;  4LFA L;  1KC8 C;  1P16 A;  1L1O C;  2JA6 G;  1VQN A;  5IT9 c;  2JA7 H;  2A8V A;  3PO3 H;  1E1T A;  4RMF A;  2F52 A;  2LSS A;  1JT8 A;  4X66 Q;  2JA7 G;  1VQH A;  3I7F A;  4LF7 L;  5IP7 H;  2HIX A;  3U58 A;  1SR3 A;  2UUA L;  5C3E G;  1CKN A;  1Z9F A;  3CCM A;  1R9T H;  1JE5 A;  1N32 Q;  2UXB L;  4JI8 L;  5LMU L;  1JMC A;  4GLV B;  1XNQ Q;  2R92 H;  2JJQ A;  2K5N A;  5C44 H;  1CSQ A;  3NEM A;  3A74 A;  1XTD A;  3E0E A;  3KJP A;  1OXV A;  1VCI A;  2YTX A;  2LXK A;  2VQE L;  3S17 H;  3KFU A;  1L1O A;  3K0X A;  2OWO A;  1VQA A;  3I2Z A;  5ELN A;  1IBM L;  1IXR A;  4YCW A;  3HOU H;  3CCJ A;  5IYC G;  3UDF A;  5IE8 A;  3HOX G;  1YZ6 A;  1XNR Q;  4X64 Q;  4HID A;  3CCR A;  1K9M C;  2N8N A;  2NZO A;  3ERS X;  1E7Z A;  3EBE A;  4DR1 L;  2LXJ A;  2PI2 E;  3W1G A;  1M90 C;  2NN6 I;  1AE3 A;  4DUZ Q;  4JI3 L;  4X62 Q;  4DR6 Q;  4DUZ L;  4O2D A;  2EIF A;  3S16 H;  1PH2 A;  4XTC S;  3WWV A;  1PH1 A;  3ER0 A;  3GTQ H;  3KOJ A;  1EOV A;  1K0R A;  1NMF A;  3BU2 A;  1Q46 A;  2WAQ E;  3BZK A;  3G6E A;  3T1H Q;  1N36 Q;  2R93 G;  1OXS C;  4R4I A;  4NXN Q;  4JCV E;  2PI2 A;  3M9B A;  1K8G A;  1Y1V H;  2NVY H;  1YHQ A;  4PG3 A;  2Z6K C;  3RR5 A;  4LW1 A;  3RLF A;  4IFD G;  5C4J H;  1J5E Q;  4LF8 Q;  1GKH A;  1HR0 W;  1RL2 A;  5LMN W;  4HIM A;  4DV5 L;  1Q1B A;  3KDF A;  3L7Z C;  1QZH A;  3M85 A;  5HY6 A;  4GOP B;  1NJI C;  3CPW A;  2NVQ H;  4LFB L;  1PFS A;  3PUZ A;  5GAH C;  2IT1 A;  2GVA A;  1RIP A;  1Y14 B;  1A62 A;  5IYD G;  5ELO A;  1XMQ Q;  1FL0 A;  2I5H A;  4QGU A;  1X3E A;  2BA1 A;  3HKZ G;  1P8L A;  5H1S E;  1VQ6 A;  3G4S A;  4A3M G;  1G29 1;  3KYH C;  1XNQ L;  1IBL Q;  5AJ3 Q;  1A0I A;  5JJL A;  1GM5 A;  4C3I H;  1SRU A;  4JYA L;  3J80 c;  1UWV A;  4A3C H;  1YHB A;  1HR0 L;  4IOC A;  4NB3 A;  5LMN L;  4B3S Q;  2F4V Q;  2VNU D;  2JEA I;  4A75 A;  3KF6 B;  4DV3 Q;  1N9W A;  1W3S A;  4DR3 L;  1VQB A;  1HNZ L;  2E5L L;  5M5Y H;  1UE6 A;  3GTM H;  4A3C G;  2IHE A;  1LTL A;  4DNI A;  3CAM A;  4AQY Q;  1ASZ A;  1VQI A;  1JJG A;  4LUZ A;  2A19 A;  2I5M X;  4JI1 Q;  1C7Y A;  4A93 G;  4DK6 C;  4NXM Q;  1PH8 A;  3JC6 6;  4ALP A;  1D7Q A;  4A3M H;  1MJE A;  2E8G A;  3VDY A;  2CQO A;  2ZTD A;  3GTJ H;  4A76 A;  5FLM G;  1X55 A;  1WCM H;  3PUV A;  1UEB A;  4OWT B;  5GAG C;  4LNQ A;  1NBW A;  3KLW A;  1EWI A;  4C3J H;  3HOZ G;  1PYS B;  5GQO A;  3J80 i;  2HIV A;  2ID0 A;  4NXN L;  4YY3 Q;  4B3T Q;  2OCE A;  3S24 A;  4GKJ Q;  3U50 C;  1PH9 A;  1ASY A;  4JI4 L;  1FJG Q;  3AEV A;  1PA6 A;  1EQQ A;  2ZJQ A;  1KHI A;  2C35 B;  4BA2 I;  4IJL A;  1Y1W H;  2D0O A;  2CCZ A;  4J15 A;  2UUB L;  1DGS A;  1TWC H;  2Y0S G;  3F2B A;  4P72 A;  4IJH A;  1UE5 A;  4TQU S;  4L5R C;  1J6Q A;  1LUZ A;  3PV0 A;  4YHH L;  4X66 L;  1YIT A;  2R7D A;  1VQ8 A;  4JI7 L;  4JI7 Q;  1HR0 Q;  2JA8 G;  1C9O A;  1T9H A;  1WOC A;  4DV4 Q;  4LFA Q;  4A3E H;  4LF7 Q;  3AFQ A;  4HJ9 A;  5JJK A;  1IBL L;  1VQK A;  4HJ7 A;  2VUM H;  1PYB A;  4DV7 L;  2KEN A;  4IPC A;  3RZO H;  2JEB I;  1UE1 A;  4PZ6 A;  3CC4 A;  4B3M Q;  1UE7 A;  1WJJ A;  1J5E L;  2PMZ E;  4IFD I;  2AWN A;  4R4T A;  1X6O A;  4POF A;  4KHP Q;  2R93 H;  3CXC A;  3AQQ A;  2H5X A;  4K0K Q;  1TWG H;  4ME3 A;  4P75 A;  3GTO H;  5M3F G;  2ES2 A;  4DAY B;  2VY3 A;  4IPD A;  4POG A;  3KDF B;  1CSP A;  3Q8D A;  1Q1E A;  3HKZ E;  4GKJ L;  3J7A 5;  1QZG A;  5M5X H;  1Q8K A;  3M4P A;  2A1A A;  2V1C C;  4AYB E;  2JA5 H;  1B7Y B;  1IBK L;  1SN8 A;  4DR5 L;  1V9P A;  1I50 H;  2UUC L;  1VQG A;  1LYL A;  2B63 G;  5GAD C;  3T1H L;  2JA6 H;  3HOW G;  2JQO A;  4X65 Q;  1XNR L;  1X3G A;  3BZC A;  3PF5 A;  1H95 A;  4GNX B;  3H3V I;  4OON A;  3CCS A;  5LMN Q;  2UU9 L;  3CP0 A;  4DAM A;  3HOY G;  3CF5 A;  1B8A A;  1YJW A;  4DR7 Q;  4PMW A;  3JAM c;  4IOA A;  1Q12 A;  2VS1 A;  1BBW A;  4EX5 A;  3PGZ A;  2KHI A;  1KRT A;  4DV7 Q;  1IBM Q;  1XPR A;  2I0Q A;  3FHW A;  3CMA A;  1VQP A;  1N32 L;  2UXB Q;  3I4N H;  1E3P A;  2VQE Q;  4OWW B;  3HOV H;  1IZ6 A;  4L5T A;  1CUK A;  3TS0 A;  5JJI A;  4LFC Q;  3I56 A;  4R4Q A;  2Q2I A;  4BBR G;  3RLO A;  2IY5 B;  4BY7 H;  2KCM A;  1VQM A;  3S1Q H;  2HT1 A;  3FKI H;  1EUJ A;  2R7Z H;  4H02 A;  4P74 A;  3M4O H;  2D0P A;  4L5Q A;  4APV A;  5C0X G;  4IO9 A;  4JI6 L;  4LF6 Q;  3I4M H;  4LUO A;  3ULJ A;  4QJF A;  4QL5 A;  2K5V A;  5M5W H;  4X65 L;  3CME A;  1VQF A;  3RN2 A;  2PQA A;  3MEF A;  4DR2 Q;  2ZJP A;  5IP9 G;  1XMO Q;  2F3I A;  1PH6 A;  2ZTC A;  1NY4 A;  3HOW H;  2WB1 E;  3CW2 C;  2QGQ A;  4PZ7 A;  3RLN A;  2ASB A;  4DR4 L;  5FJ8 H;  3TEH B;  3STB D;  3A5U A;  1MJC A;  4JBJ A;  4HIO A;  5BR8 L;  1N33 Q;  1A63 A;  2OQ0 A;  1KAW A;  4A3I G;  1PH4 A;  1N34 Q;  1HNW L;  4DR4 Q;  1Z47 A;  2K75 A;  2PNH A;  5M3M G;  1Q86 C;  2E5L Q;  4B3M L;  4QQB X;  2KCT A;  1HZC A;  2CFM A;  2JA9 A;  2JK8 A;  2AKW B;  2I5L X;  1X9N A;  1A8V A;  4JBM A;  4B3S L;  3T1Y Q;  2RF4 A;  2QA4 A;  1YIJ A;  4JBK A;  1XPO A;  3UDX A;  2UUA Q;  4DKA C;  3ICE A;  1YVC A;  3S2D H;  2D62 A;  4AQY L;  2MO0 A;  3S1N H;  3I4N G;  4DUY L;  4R1J A;  3PIP A;  2IHF A;  3CD6 A;  3PCO B;  3HOU G;  1YHA A;  4TVA B;  1VQD A;  2VW9 A;  4KLK A;  4R4O A;  3PUX A;  4DV2 Q;  1G6P A;  1YEZ A;  3S14 H;  3PUY A;  4C2M H;  2N78 A;  3I55 A;  1K3R A;  2FXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...