4A3CG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3cG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3cG01
4EQ5A 1VQMA 1HZ9A 5M3FH 1KQSA 3J81c 4JCVE 1WCMH 1FGUA 5BR8Q 4DAYB 3M7NA 1VQPA 1PH4A 1S3OA 2K52A 2VQEL 4A3JG 4OWWB 1WI5A 2IHFA 2N78A 3TS0A 4B3MQ 1X56A 4PMWA 2F52A 3CCQA 1MJCA 5FLXc 1FVIA 3STBC 3H3VI 3HOVG 3S15H 1K3RA 5IE8A 4DR6Q 4GKKQ 2QEXA 1VQGA 4JI0L 2NVYH 1XJVA 2YV5A 3PUYA 1SMXA 5IYBG 3B6YA 3S1QH 4DV0L 2IX0A 1JJGA 1XMOL 4KHPL 1K0RA 4BXXH 1FJGL 1TWAH 3I4NH 2R7DA 3KDFA 4OWXB 1QVCA 3GTGH 2UXCQ 3F2BA 2R92G 2H5XA 5ELOA 1QZHA 4LFAL 1BVSA 1OXUA 1YHBA 2YTVA 2OQKA 4GS3A 4R4IA 4YWMA 3WWVA 3KJOA 1C7YA 1JJ2A 5HY6A 2I0QA 4BA2I 4JV5Q 1ASYA 1KRSA 2KENA 3FKIH 2NZHA 5IYCH 4JI8L 3HFZB 2UUCQ 2QGQA 4X62L 4UP9A 1UEBA 4JI5Q 1VQOA 2RCNA 2JA7H 1W3SA 3NEMA 4X64L 1N32L 1V9PA 1YEZA 2KCTA 4GNXA 2HHHL 1N34L 3HOZG 1C9OA 1JT8A 4A3GH 4DV1L 4AQYQ 4QJFA 1CSPA 2JA8H 5H1SE 2K5NA 1UE7A 5C3EG 5LMNQ 3HOXH 5C44H 4A3FH 1VQ5A 4PG3A 1L1OC 4IPGA 1YJWA 1Y14B 3K81C 5M3FG 3AFPA 4DV3L 3U50C 3I4OA 4YWLA 1PYBA 1WCMG 1J5EQ 4A3DH 4KHZA 2UXDL 3UDGA 1P8LA 4HIKA 4LF9L 1VQBA 4JBJA 3H15A 3BU2A 1W2BA 5M3MH 1HNXQ 3RN2A 1UE1A 1PH9A 3G48A 2CKZB 1XMQL 3UDXA 1OXXK 4IJHA 4QGUA 1E24A 3LGJA 4GNXB 2MO1A 2N8NA 3S1RH 4JI2L 4FDBA 4B3RQ 3G6EA 4POGA 3T1HL 4DK3C 4LFBQ 4R4CA 4LF5Q 4OWTB 1KD1C 3KF8B 2K5HA 3I7FA 3NBHB 2D62A 4APVA 2ZJRA 3CCEA 3GTQH 2E5LL 2AWNA 4DK6C 1X55A 4BXXG 4DUYQ 4X65Q 2WP8J 3I4NG 3A74A 1NBWA 1WJJA 5GAEC 1N8RC 3S17H 3J80c 4MZ9A 1E7ZA 1A8VA 2A19A 2GVAA 2B29A 4A3LH 1I94L 3CPWA 5GAGC 4LFCQ 1E1TA 1P16A 4DV2Q 2K4KA 4JOIC 1X65A 3FKIG 5IYCG 1I6HH 1HJPA 2VS1A 2XGTA 5JEAG 2E2IH 1N33L 2JA7G 3HOWH 5IP9H 4NXMQ 4NB3A 3CXCA 3S2HH 1OXSC 2UXBQ 4BBSH 2YTXA 2JQOA 3UE1A 2ZM6L 1IBKQ 1EYGA 1CUKA 4LF8L 4A3GG 3OYYA 2VQFQ 1YHAA 2BA0A 3CCMA 4B3SL 4LWCA 4JI1Q 2JA8G 3K7UC 5E7NA 1L0WA 4BBRH 4A3FG 2E2JH 4DV7Q 3HKZG 5JEAJ 2I5HA 4WJ3M 4YWKA 1YJNA 1XNRQ 4XTCS 2PQAB 1VQ6A 4A3DG 4GOPC 1Z9FA 2JE6I 4UP8A 4HJ9A 3GTLH 3H0GH 4GLXA 3UDIA 1O7IA 2Z6KC 1PH2A 2JA5H 3SGIA 1DGSA 5M3MG 1NJIC 3AQQA 1KC8C 1JB7A 4DV6Q 3KF6B 1S72A 1S40A 4L5SA 1E22A 1BBUA 2AMCB 2WAQG 1SR3A 3RZDH 1IBML 4K0KQ 3BZKA 2VUMH 1VQKA 3L0OA 1VQIA 1AH9A 4NXNQ 1EIYB 2F4VQ 2UUBQ 5IWAQ 4JI4L 4YCVA 4DR5Q 2OTLA 2Z0SA 4DAMA 1HNZQ 4JI3Q 5JJKA 4R1JA 3DM3A 4A76A 2KHIA 4YCUA 2UUAQ 1QUQB 1HZBA 4DR1Q 2NZOA 4JI6L 4DPGA 2WB1G 2F3IA 4JOIA 3RN5A 3GTMH 4LF7Q 2RHQB 1BKBA 3BZCA 3K80C 4DV5L 1PYSB 2ALYB 3RLNA 4YY3L 1ASZA 3I2ZA 2E2HH 1Q86C 1OXVA 1GM5A 4A3LG 1HR0L 1KXLA 1TXYA 2EXDA 2D0OA 1EIFA 3PUZA 1M90C 3RZOH 1WOCA 2VQEQ 3W5OA 1B7YB 4GN3B 1OTCA 4Y7NH 1CKMA 2LXJA 2WAQE 1I3QH 4LUVA 3TREA 3U4VA 4A3EH 1C0AA 4DV4L 5JJIA 1FL0A 4Y52H 4HIOA 5J3BA 5IP9G 3L2PA 4IOCA 4JI0Q 4HJ7A 4BBSG 1K8GA 3K8AA 4IFDG 1IXRA 1YZ6A 4LW1A 1XPUA 1CKNA 1V43A 4DUZL 4GOPA 1JJCB 3JAMc 2L15A 4R4TA 5M5YH 5LMUL 4OO1I 2Z6KA 3PO3H 4AYBG 4DR2L 4BBRG 2WB1E 4DV0Q 1KIXA 4A75A 2K5VA 3NENA 5JJLA 1XMOQ 1NTGA 4QQBX 1IYJB 3KOJA 4KHPQ 1LM0A 3M9BA 1K73C 1VQLA 4PZ7A 3GTPH 2CWAA 4DR4L 1FJGQ 3E0EA 4JYAL 1K83H 2RHSB 1PA6A 3GTOH 4IFDJ 2YYZA 3H0GG 3G4SA 4LFAQ 3CCUA 1GKHA 5IP7H 2JA5G 2Q2TA 1EQQA 1WYDA 4GN4B 3HKSA 4P75A 4OO1G 1VQAA 4OONA 5DLQE 3G71A 1R9TH 2CFMA 3KDFB 3PV0A 3S1MH 3TS2A 4O0AA 2VY3A 4QIWE 4JI8Q 1VQ7A 4JBWA 4X62Q 1VQFA 2K75A 3CCJA 2VUMG 3CW2C 4YHHL 2ID0A 4X64Q 1N32Q 1UE5A 2ZTEA 4A3KH 1VQDA 1VQ9A 2HHHQ 1HZAA 4JI7L 3D31A 1N34Q 2E8GA 4MNOA 2AHOB 4DV1Q 1EOVA 3ULLA 1V1QA 1LTLA 4AYBE 2NVTH 1X9NA 2MO0A 1PH3A 3S14H 3K0XA 1SLJA 2Q2HA 4GN5A 3CP0A 2ES2A 5GROA 2IT1A 3F8TA 1N36L 4DR7L 1Q82C 1CKOA 5EAYA 4EX5A 4DV3Q 1GO3E 3BJUA 4P71A 2UU9L 4IOAA 4GKJL 2I5LX 4LF9Q 2UXDQ 1GVPA 2IHEA 2FXQA 3ER0A 3UDFA 4C3HH 1YHQA 4BY7H 1BBWA 2AWOA 3CQZH 4H02A 4NPSA 3PSIA 1OXTA 2V1CC 4IO9A 1VQ8A 3TRZA 4ALPA 1XMQQ 3CC4A 1QZGA 1PHJA 4A4IA 3JC66 3T1YL 4A93H 1LUZA 4JI2Q 2Q2IA 2A1AA 1PVOA 3NELA 2Y0SG 2LSSA 3OTOL 3FP9A 3M4QA 3T1HQ 1VQ4A 1YI2A 1EQRA 2N49A 4P73A 3J81i 3PO3G 4UY8C 3CC7A 1EFWA 4AH6A 2E5LQ 1SN8A 1XNQL 1HR0W 3GO5A 5IT9c 1IBLL 3I55A 3TQYA 3PO2H 2WFWA 1YIJA 1L1OA 3PIPA 1JMCA 3HOYH 1Q81C 1GD7A 4R4QA 4L5RC 4LF4L 1M1KC 1Y1VH 3U4ZA 4KI0A 1EWIA 5IP7G 5C0XI 2DGYA 3M85A 1B70B 1I94Q 1NMGA 4JBKA 4OX9L 1Q1EA 1D7QA 4OXPA 3HOXG 5C44G 4B3TL 3CD6A 5M5WH 3J7ZC 5IY0A 2GVBA 1XPRA 5IYBH 2JK8A 1Q1BA 4DR3L 3CPFA 3A0JA 5GAHC 2K50A 3A5ZB 4HJ5A 1N33Q 2HT1A 1WFQA 4A3KG 2Y0SE 5M5XH 5AJ3L 3H3VH 3HOUH 4X66L 2ZM6Q 4LF8Q 1YJ9A 5C0XG 3J7A5 3CCSA 2EIFA 4B3SQ 1X3GA 2JEAI 2CCZA 4LF6L 3CMEA 1MJEA 1HNWL 1SE8A 3CAMA 1TWCH 2R7FA 2GN5A 3I4MH 1I50H 3AFQA 1B8AA 2PI2E 3CCVA 3KYHC 2R93H 4J15A 3ICEA 2KHJA 5BR8L 1D8LA 3S24A 1HZCA 5C0XJ 1NE3A 2HIXA 3M3YH 4BY7G 3L7ZC 3GTKH 1YNXA 1Y1WH 1U5KA 1N9WA 3HKZE 4RG1A 3U58A 4IPHA 4B3ML 4P74A 4MTNA 1VCIA 2VL6A 1H95A 1G51A 5C3EH 3D0FA 3A5UA 4GKKL 1IBMQ 4DR6L 1VQHA 4IFDI 3EIVA 1VQEA 1QVGA 4A93G 3PGZA 3CCRA 2B63H 2BH2A 4QL5A 2JA6H 3PF4A 1TWHH 2CWPA 4GNXC 1A63A 1PH5A 4ME3A 4JI4Q 1K8AC 4LUOA 1JE5A 1YVCA 1PH1A 1A0IA 1X3EA 4BY1H 1YBYA 1QVFA 2OQ0A 3PIOA 4HIDA 4JI6Q 3HOWG 3PO2G 2CQOA 1E1OA 3HOYG 2OTJA 3KJPA 4DV5Q 1X3FA 1VS0A 2UXCL 2B3GA 3CCLA 4YY3Q 3M4OH 1Y1VG 4UPAA 3S1NH 2C35B 1HR0Q 4IPCA 4R4OA 2KBNA 4RMFA 2OWOA 4JV5L 2I5MX 2IY5B 2YTYA 2ZTDA 1VQNA 2BH8A 4UP7A 2UUCL 4DKAC 4DV4Q 4JI5L 3OW2A 3K7AH 5FJ8H 4HIMA 1T9HA 3HOUG 3ULJA 1G6PA 5HGQA 1SROA 3RLFA 3W1GA 4DUZQ 5LMUQ 4AQYL 2PMZE 3J80i 1KL9A 3EBEA 1AE3A 4TQUS 5LMNL 4DR2Q 3FHWA 2ASBA 1PFSA 4A3IH 4GLVB 1NY4A 1CKNB 4GOPB 3I4MG 4JYAQ 2R7ZH 3ZJYC 4DR4Q 3ERSX 4LUZA 1PH7A 2JJQA 4PZ6A 2QA4A 1J5EL 1CSQA 2R93G 2JA9A 1SFOH 3I56A 2LXKA 3Q8DA 2KCMA 3S2DH 1Z47A 2EQSA 2ZJPA 2NVXH 1PV4A 1Y1WG 1HNXL 4POFA 3PUXA 1SRUA 2OCEA 3GD7A 4JBMA 1NMFA 5ELNA 2VZAA 3DLLA 2MNAA 3UE0A 3W1BA 3J81j 2JA6G 1PH6A 2B63G 4YHHQ 1Q12A 2BA1A 4B3RL 1PH8A 1AE2A 5C4JH 4L5QA 1YITA 4JI7Q 3CF5A 4LFBL 4A3BH 3E9HA 5K36G 2A8VA 4LF5L 3E9IA 3M4PA 4HJ8A 5C4XH 4A3EG 1L2FA 1RIPA 4BY1G 5FLMH 1A62A 2AKWB 2XTIA 5IYDH 4A3CH 1VQCA 3TEHB 1X6OA 4X65L 1UWVA 4DUYL 4A3MH 1K9MC 3S16H 1N36Q 4DR7Q 1KHIA 3PCOB 4KLKA 3CMAA 4PZ8A 1Q8KA 1I5FA 1KRTA 3MXNB 3F1ZA 2UU9Q 4X6AH 3CC2A 4JC0A 4GKJQ 4BA1I 4LFCL 3PUVA 4DV2L 3KFUA 2HIVA 4P72A 4A3JH 1X54A 4HJAA 1MKHA 3KLWA 4O2DA 3MEFA 4AIMA 1XPOA 3F2CA 1U0LA 3GDEA 3ULPA 3AEVA 1G291 4GLAC 3RLOA 2Q2UA 3HOVH 5FJ8G 3T1YQ 3STBD 4NXML 4LNQA 2ATWA 2UXBL 4WJ4A 3EN2A 4TVAB 5GQOA 1IBKL 3OTOQ 2VNUD 1Q7YC 2ZJQA 1HH2P 2PQAA 2VQFL 2RF4A 1TWGH 4JI1L 3AYHB 1RL2A 4DNIA 3RR5A 1KAWA 5GADC 1TWFH 4DV7L 4A3IG 1IBLQ 1XNQQ 2N3SA 2PNHA 1MIUA 3GTJH 3VDYA 1XNRL 4YCWA 2IX1A 1J6QA 2R7ZG 3KF6A 2K14A 2NVQH 1IZ6A 2NN6I 2R92H 3PUWA 4LF4Q 1Q46A 2VW9A 4OX9Q 2HQLA 3IRBA 4XIGS 1L1OB 4B3TQ 4IJLA 4C2MH 4DV6L 4QY7A 1LYLA 3PF5A 3JAMi 4DR3Q 1XTDA 2PI2A 4K0KL 2D0PA 1E3PA 4JG2A 1QUQA 2ZTCA 4NXNL 2R6GA 5LMNW 5AJ3Q 2UUBL 2F4VL 5IWAL 2NN6G 4X66Q 4A3BG 3HOZH 1UE6A 4DR5L 3RNUA 4JI3L 3F2DA 1HNZL 5C4XG 4L5TA 5FLMG 2UUAL 2DUDA 1EUJA 4C3JH 4DR1L 2MQHA 1IL2A 5IYDG 2MFIA 4LF6Q 4A3CG 1HNWQ 1VQJA 4LF7L 4C3IH 4A3MG 2YU9H 4IPDA 2JEBI
chains in the Genus database with same CATH superfamily
3ITPA 1VQMA 4RUAA 3J81c 2JA7B 3RTXA 3J80E 2XCAA 4JCVE 4EGQA 1FGUA 5BR8Q 1SNPA 2RDGA 1WTWA 3V6HA 1RK5A 4DN4M 4A3JG 4YR0A 4QB4A 4OWWB 2N78A 1HTLD 5KFVA 1X56A 3SEBA 2JA8B 2ICIA 3J7AK 4GKJH 3S15H 1K3RA 5FO7B 5I9PA 1VQGA 3PMFA 3HKZB 2XGQA 2ZXOA 4FNFA 3OUZA 2VUGA 3CQZA 4G57A 3E0JA 2RCFA 3IFTA 1SMXA 4V190 4F50A 1BGWA 3PW5A 5CV5A 1XMOL 2C28A 1Y8OB 1FJGL 2YRWA 3I4NH 2R7DA 3KDFA 1QVCA 3GTGH 3F2BA 1M0WA 2PMZA 4ID6A 1QZHA 3GIPA 4J9NA 3PW4A 1PRTF 3KJOA 4IN3A 2K5DA 1JORA 2I0QA 4ECWA 3CRLC 5NUCA 1WD0A 4R8IA 2NZHA 3D4RA 5IYCH 3NE5B 1SNQA 5C4ZA 1NAPA 1UEBA 4UP9A 4APMA 3QZ7A 3NGDA 5KNCA 2RCNA 2WB1B 3NEMA 4X64L 2O03A 4KTAA 3C46A 5EPKA 5BN5A 1C4QA 1JT8A 3I72A 3LWBA 2NBFA 4QJFA 1CSPA 3RBDA 2K5NA 1UE7A 5I6WA 3BG5A 3H0GA 2KEEA 3HOXH 1WR2A 1TR5A 4C3IG 5KFXA 2B2VC 3ETJA 2JEFA 1PFMA 1D5XC 3AFPA 4DV3L 3I4OA 4O1NA 1WCMG 4CC5A 4KHZA 1ONLA 3BVMA 3UDGA 3GQCA 3J80W 4JBJA 2F0TA 1KEEA 4IRKA 3G48A 2IP4A 4QGUA 3LGJA 2ASJA 2MO1A 1FGBD 4O4LF 2QILA 2J6UA 3N52A 1EQVA 2FMMA 3H0GB 4DR6H 4IWYA 2K5HA 2JA5B 2D62A 5C8YF 2B63A 3GTQH 5DG7A 2AWNA 3VR3A 1A6XA 2XN9C 1G8ZD 4BXXG 1NBWA 3RZDB 3J80c 3SHLA 4MZ9A 3JRWA 1E7ZA 1LABA 4KMUC 3WOEA 2B29A 1I94L 4LMYA 1CQVA 2AQ2B 3ZYYX 3HEJA 1VDZA 3H4DA 4EEQA 2K5WA 2JA7G 1JB3A 2KHSA 5IGFA 2UXBQ 2ZDGA 4FF3A 2UUCH 3K5NA 3R23A 4JI5H 3OYYA 4Q0YA 2VQFQ 2JA8G 2DNCA 1L0WA 4BBRH 2C2EA 4DV7Q 1LT6D 2SNMA 3HKZG 4Q0FA 4RU9A 4O3NA 3VA5A 4YWKA 5D14A 4A3EB 1YJNA 4WJ3M 1R9TA 2PQAB 1GHKA 2EVBA 5CYUA 4UP8A 2JE6I 4GOPC 1HUMA 4GLXA 2EJFC 2Z6KC 1PH2A 1NR4A 3BAAA 4YHHH 1KJIA 4XDXA 2WYOA 1BUVT 1NJIC 4UFZA 1VBHA 2R7ZA 3RF2A 1PFBA 3PO3B 2BQRA 2R8JA 5D3IB 1VQIA 1V1PA 2UUBQ 1EYAA 1RTNA 2B2WC 1GSOA 5KEEA 4DR5Q 4BWSC 1HNZQ 1SDFA 4R1JA 2L11A 3LX0A 4A76A 5IOCA 3A56A 1Y69U 1ULZA 1U9RA 4DR1Q 4JI6L 2WB1G 2F3IA 4JOIA 1RF2D 1R9TB 4LF7Q 2RHQB 1BKBA 1G2TA 1L2ZA 2AGPA 4F87A 1XWEA 1CK1A 1Q86C 1GM5A 3KAKA 2D2CC 1RCVD 2DZDA 1HQMC 1ZHSA 2P0AA 1DOKA 1B7YB 4GN3B 1GXDC 1A3TA 1CKMA 3S14B 3TREA 4LUVA 1B4OA 1C0AA 3TDQA 2DPIA 1SNMA 2PBZA 3PZPA 4JI0Q 1S9FA 2GPWA 4HJ7A 1FR3A 1XNQH 4IFDG 3TP8A 4LW1A 5I4DA 4OO1I 3VYSA 3MJFA 3GQBA 2LMCB 2TSSA 5JJLA 5KIXA 4OX9H 4NP5A 1E4FT 1IYJB 3R93A 1NUCA 4JYAL 3U9TA 1ZKOA 5KYIA 3J81L 1K83H 3GTOH 1TWGA 5E4WC 2R8GA 3H0GG 4B9XA 4LFAQ 3CCUA 1GKHA 2JA5G 3HRZC 1EQQA 1B3QA 4P75A 1IL8A 1LV9A 2E75C 2CFMA 3PV0A 1QB5D 4DLKA 5KT4A 4CJ0B 1C30A 4QIWE 1VQ7A 5J2UF 1O75A 4JBWA 2C00A 4MA0A 5EWGA 5L1JA 3RUZA 4YHHL 3HOYB 4C2MA 4YP3A 2J9GA 4J9OA 1N34Q 4MNOA 4NLGA 4DV1Q 3ULLA 1PRTC 1V1QA 2NVTH 2DIKA 1I50A 4DAVA 4UCSA 2RDIA 2W9AA 1SLJA 2Q2HA 4GN5A 3K5MA 3D8GA 2F0LA 1B44D 1B53A 5IWAH 2EYLA 1Z2OX 5BMVF 3GTKA 3L4KA 2R86A 5FLXE 1CHQD 3BQ0A 4B3MH 1Q82C 1IOVA 5KFUA 2W6MA 1QCBD 4Q8FA 2UXDQ 1DIKA 4LF9Q 3ER0A 2IHEA 4FBTA 2YU9A 3Q8PB 1SMYD 2IA6A 3CQZH 2AQ3B 2AQ1B 4IO9A 4ALPA 5CBEE 3A8KE 3CC4A 1AUVA 1STNA 2V59A 2B2TA 3KLRA 3E5NA 1FNWA 2DY8A 2JYOA 5BN4A 3OIPA 4XQQA 1I50B 3T1HQ 2R8IA 2EJMA 1WTHA 3M4QA 3OWFA 2BOSA 5KG6A 2R93B 4ODGA 1EQRA 2QW7A 2B2UC 3J81i 3PO3G 1OWTA 4J1MA 3GTKB 2E5LQ 1XNQL 3ETHA 1LO5D 3GO5A 4ZUIA 3TQYA 3OW7A 4JV5H 1B6SA 2WFWA 1ESFA 3PIPA 3MWEA 1Q81C 5C3EB 4RGNA 1WTOA 3N6XA 3NHHA 3F8NA 4OX9L 5D3DA 1NMGA 1MSGA 2KECA 3T5JA 4J9LA 5L1IA 4OXPA 3H09A 5C44G 3CD6A 4JK1C 5IY0A 1H9MA 4HN7A 4NMZA 4I7ZC 1Q1BA 3GIDA 2K50A 4RHRA 1N33Q 1WFQA 3G6VA 3MXPA 1VAJA 5JPNC 3UI2A 2L1BA 4LF8Q 5C5MA 3PVXA 1Q8IA 4DU9A 3S1NB 1H9JA 5KFYA 2V5AA 2XC9A 4ECXA 1GLVA 1RK6A 2MGSA 3VMMA 4B3SQ 1J5EH 5KFZA 3NTHA 2RVLA 1LT3D 1X3GA 2JEAI 2NTTA 5H80A 4TQSA 2HJWA 1HNXH 2R7FA 4PDBA 4ZK9B 3LP8A 4ZKCB 3A7LA 5T14A 3J80L 4TKOB 5M9OA 5JVH3 1D8LA 1HZCA 4WRDA 1SMYC 3M3YH 2FPIB 4B3RH 3A8JE 1VF5C 4KKUA 4B3ML 3EQLC 5DLFA 1H95A 1B6RA 4LF5H 4C5AA 3TP5A 3A5UA 4IFDI 1ENCA 1QVGA 3TIIA 2V9WA 3PF4A 2B63H 1A63A 4JV0A 3K3PA 5FD5A 3RD4A 4R7RA 1U4PA 2XNAC 3R2IA 1EU3A 2CW7A 1BR9A 3T16A 1PH1A 1A0IA 3Q6SA 4GC6A 1QVFA 1ICFB 3HOYG 1F9SA 3KJPA 2BDNA 2ICEC 4ED8A 1X3FA 1VS0A 3IL8A 2B2YC 4UPAA 1HR0Q 4ECZA 3GIJA 4JV5L 4C5CA 2KQ3A 4RFBA 1IBKH 3ND9A 3Q1KA 2BDOA 2FB9A 3OW2A 5DEHA 1LLRD 4MV9A 1STHA 3ULJA 3RLFA 1YNJD 5KFGA 3BJYA 4EVOA 1XNRH 5LMUQ 2LS01 3J80i 2E2IA 3BQ1A 5DG8A 1S5FD 1EIHA 5LMNL 4FBUA 1EFID 3KUPA 1M8AA 4CGYB 4DL6A 4I7AA 2R7ZH 3ZJYC 1C3OA 3MFGA 3P20A 4PZ6A 2QA4A 1J5EL 2R93G 4FYDA 1SFOH 5G3LD 4RAZA 4I55F 4AYBA 4K0KH 4IR9A 1I7LA 2ZJPA 1HNXL 4RGTA 1PYWD 4JUZA 3PUXA 1CI3M 2F4VH 2OCEA 3GD7A 3CHBD 4JBMA 2VZAA 1RKNA 3UE0A 3W1BA 1TWFB 3SVMA 5KFLA 1RTOA 4B3RL 3GTJB 1B50A 2PCFB 1N56A 4XYQA 2NVQB 4HNVA 2NN6H 5IODA 2N55A 4A3BH 5K36G 4LF5L 3E9IA 1EHIA 3M4PA 3N42B 1VKZA 4MV7A 4DXGA 4ZKBB 3R8BA 1A62A 2AKWB 4ZOLF 4A3CH 1D5ZC 1GSHA 2R7NA 1UWVA 3S16H 2A5HA 1GHJA 3F1ZA 3C3LA 2SNSA 3PUVA 3RB6A 5IGCA 4P72A 3HGBA 1X54A 3JAME 3D3RA 2HVSA 1U0LA 4CBVA 4C3JB 1HRJA 1E4EA 1KLGD 3HOVH 3TINA 3T1YQ 3TBIB 1ICWA 4WFN3 4DV0H 4TVAB 1YNJC 2JP1A 1T36A 4JPBW 1IBKL 3OTOQ 3KHLA 3VPCA 2VNUD 5DQGA 1HH2P 3KBGA 1TWGH 3RR5A 1YNND 4NKLA 2R82A 3RB0A 4HMIA 2Y0SA 1QNUA 1XNRL 3S15B 4R8UA 2NN6I 1ILPA 4DR2H 2C22A 4LF4Q 4X62H 4YAKB 2R8KA 4UHVA 4CKEA 1DONA 1KNEA 2HQLA 1N32H 4ED6A 4C5BA 4B3TQ 4C2MH 2HHHH 1E4EB 4O3SA 1LYLA 3SK8A 4DR3Q 4PV1C 4K0KL 2D0PA 3VYRA 1D2BA 4JG2A 3Q23A 1QUQA 3NTIA 2X6GA 1RD9D 2F4VL 3I3CA 4CDCC 2F0OA 3K59A 3I4NB 4X66Q 3GTGB 2XIGA 3C0FB 1DXMA 4JI3L 3I91A 2F0EA 3BA8A 3MEHA 2Y0SB 4M9UA 1HNWQ 1VQJA 3VR2A 4R8UB 2YU9H 1CTMA 4IPDA 2NB0A 4RGOS 5J22A 4EQ5A 5KX5F 4B9WA 2L4NA 2A6ED 2XD4A 1QE6A 4QUFA 1V4YA 1S3OA 2W6OA 4QW8A 2K52A 5KFIA 5L1KA 1N36H 3H3VC 2Z6BA 2F0UA 1C8CA 4LAAA 3G6JB 5BPHA 4MV1A 2W6QA 2W9CB 3DEPA 3H3VI 4GKKQ 3HOXB 2YCHA 3SE7A 1F2MA 2W7OA 3OOCA 2QEXA 1Z2PX 2GA4B 4MA5A 3GTQA 1S5DD 5ELEA 5DQIA 1KDCA 1RJQA 2YV5A 4HR7A 1YNNC 5KFHA 3B6YA 3MWMA 4DV0L 5BPFA 5EBCA 3N43B 1JJGA 1HA6A 4J8QA 2F0HA 5L9XA 1K0RA 5C5LA 2L0CA 2PN1A 2UXCQ 2WAQB 4OWXB 4CJ1B 5ELBA 3KAJA 5ELOA 1O7LA 1OXUA 2XWBB 5T1IA 1C7YA 3A7AB 1JJ2A 3GTJA 1ASYA 4RZRA 2QDLA 1SE2A 2QGQA 4X62L 3GTQB 4F4XA 4K8JA 5D8DA 1JX4A 1EU4A 1N32L 1B3AA 5EWFA 2HHHL 1G6ZA 3W2DA 4HNUA 4ZHQF 2B39A 1C9OA 1HUNA 4AQYQ 2W70A 2CW0D 4J6HA 1EEID 2MJ8A 3H6MA 4C3JG 3FPUB 3EYYA 3KF8A 4XT3B 4A3FH 1VQ5A 3KHRA 3VPBA 2FINB 4IPGA 1LT4D 1Y14B 2FMCA 2PNRC 2F03A 1SEBD 4A3DH 3X3MA 4E6IA 1B04A 4RWSC 5JH7F 1TS4A 4HIKA 4PNYA 4ZQ3A 4H13C 1K3BC 1UE1A 4O42A 4JI4H 4DXFA 1PH9A 1EUCB 1XMQL 3UDXA 1OXXK 3K57A 4BBRB 1EZ6A 5CV6A 1LTID 4ZI7F 3PN1A 1K28A 2N8NA 3M9NB 4JI2L 4FDBA 1Y1WA 3WOFA 3QFFA 4DK3C 4DV5H 3SXHA 5KFDA 3SDZA 2RDHA 3KF8B 4APVA 2SEBD 2N88A 2JA6A 4S3SA 2KEDA 5A35A 1TWHA 4DK6C 2F0FA 1DV1A 4UCTA 4X65Q 3H20A 5KFJA 1CA6A 2CVRA 3I4NG 3A74A 1N8RC 4WD3A 1WD1A 3IN5A 2A19A 2VOBA 2CQAA 3F2UA 3OSOA 1D1IA 3SI8A 1T5XD 4KD4A 5CV8A 4DV2Q 1EY4A 2HGSA 3OHXC 5IYCG 1I6HH 2UVRA 2XGTA 1S97A 2PW7A 1KTKA 2E2IH 2F0MA 3HOWH 2SCUB 5IP9H 4NXMQ 4NB3A 1ZQ7A 4BBSH 2YTXA 4M8AA 3UE1A 1UUPA 2ZM6L 2I87A 3V6KA 2CW0C 4DR4H 4HCSA 3DF7A 2EPBA 5JVG3 3M7GA 4LWCA 3K7UC 2UVWA 2JEGA 3E6ZX 4TQRA 2I5HA 1M7JA 3NPPA 4PMBA 2A6HD 4XTCS 5C6AA 4OEMB 2VA2A 2D5DA 1O7ZA 2KCCA 1K8MA 3SGIA 1DGSA 5L37A 4HSPA 4RNOA 4C56C 3TZDA 4DV6Q 3KF6B 4JI7H 1AZQA 2YZMA 4IRCA 1K8OA 2AMCB 4QWAA 2WAQG 1IBML 2BE5C 2O4XA 3TIGA 5LA6F 1VQKA 1KJQA 5GONF 4DK0A 4JI4L 2F0KA 4JVZA 1K83B 3GTOB 5ELFA 1SYXB 5D1PA 1SJED 3RGZA 2A68C 3DM3A 2KHIA 3QJYA 5KT2A 1LACA 4G7HC 2UUAQ 2UU9H 4DPGA 1I6UA 5IT9E 3K80C 4DV5L 4NDXA 3K5HA 1GUSA 1WTPA 3DUZA 5IYZF 1S4ZA 2RSNA 4MTDA 1KXLA 4HEDA 4RNMA 3RZOH 1L0YB 1M90C 3W5OA 2CW8A 5KT6A 1O7YA 2NVTB 2LXJA 1UC9A 5JJIA 4HIOA 3DWPA 4HTHA 5J3BA 4MV4A 3JRXA 1F2LA 1K1QA 1IBLH 3K8AA 3IKJA 1CKNA 1V43A 4DUZL 2ZXPA 5M5YH 1WTXA 4M7EA 1QILA 2RQXA 2F0IA 4BBRG 2WB1E 4IUUA 3CQZB 4KD3A 2A6HC 5T1GA 1U4LA 1XMOQ 4QQBX 2F0PA 3GTPH 1Q3LA 4DR4L 1FJGQ 2VQFH 1AUXA 4IFDJ 1ML0D 2EYHA 5C1OA 2VXWA 2VB2X 5IP7H 2Q8RE 2Q2TA 3URYA 4OO1G 1SYCA 3BYYB 4OONA 2VPSA 3KDFB 1S5BD 4LMQD 4XYOA 5JVDF 1TIID 2R92A 2PMZB 2K75A 4OGQC 1F77A 4ZUJA 4Q44A 3CW2C 2ID0A 2E74C 4X64Q 1UE5A 3L9AX 1UNSA 3OHAA 4JI7L 3D31A 4O3OA 1JE4A 5C0XH 5HGTA 4KY6A 1W93A 1GSAA 1PH3A 4IZOA 4ECSA 1PZKD 3MXNA 3LNNA 4V0BA 3VYUA 3TZUA 2WE6A 1KBLA 3QG1A 5EAYA 4DV3Q 5IT9W 1ZEQX 4DR1H 2FK3A 1IHZA 3BJUA 4P71A 2UU9L 4IOAA 4GKJL 2I5LX 4LF7H 4BY7H 1TA8A 1TS3A 1BBWA 1XTCD 4H02A 4NPSA 2XRQD 1OXTA 2V1CC 1PLFA 3TRZA 2CH4W 1JOQA 5CB4F 3JC66 5A2QE 1LUZA 2WV6D 5FO8B 2A1AA 1PVOA 3NELA 2LSSA 5KFAA 1NSNS 2N49A 5C4HA 4G7OC 3M3YB 1KDAA 4UY8C 4O3PA 5ELDA 2NVYA 3HBLA 1HR0W 5IT9c 1IBLL 3FMCA 3PO2H 1JWUD 1IKLA 5JOBA 1BO0A 1LTSD 4R4QA 2GPSA 4L5RC 3UFXB 1M1KC 2B63B 5C0XI 4F4ZA 3M85A 4RKBA 1B70B 1ZYRD 4WORA 1I94Q 3RFCA 3R5FA 2GVBA 2JK8A 1IYVA 1BNZA 3HS0C 5IGGA 2RDJA 1T3NA 4DL5A 1YJ9A 1ZHQA 5BN3A 4EEYA 1ENAA 2R8HA 5DM73 1U4MA 1SFOA 1STYA 4PQXA 2ASLA 1MJEA 3CAMA 2VR1A 2M05A 2IL8A 3I4MH 3HXLA 5KG0A 1B8AA 1F9RA 3KYHC 2R7KA 2OT2A 3S24A 2JEIA 1FNUA 1NE3A 1PK8A 3L7ZC 2G9HD 1EIGA 3BA9A 5KNBA 4J0MA 1Y1WH 4KJNA 1N9WA 4P74A 4LFBH 5F9NA 1VCIA 2SDFA 1G51A 4MIUA 2UXDH 2EE1A 4LF9H 4DR6L 4ECUA 3EIVA 1VQEA 4EGJA 3PGZA 2JA6H 2BH2A 3RB3A 4QL5A 2AU0A 1TWHH 5EZYF 2R7ZB 1MSHA 4DUYH 2FPPB 2J4XA 1SFOB 1LTAD 4G3IA 4LUOA 1TS2A 5EQ0A 1YVCA 3OSNA 4BY1H 1YBYA 1V1PB 4JI6Q 2W8LA 3T1HH 4OIKA 2CQOA 4LFCH 2OTJA 1EL0A 2B3GA 3M4OH 3V6JA 4F7XA 2C35B 1H9SA 5CBAE 2NUCA 4IPCA 2CQYA 2UVVA 1MGSA 4OHJA 4A3BB 1KJJA 2YTYA 4YAJB 4QUCA 2BH8A 1VQNA 2FKLA 3T5HA 1RDPD 2UUCL 4JI5L 3TP6A 4JI1H 4ILWA 4QWEA 1TU2B 5C1PA 3S16B 3HP3A 5HGQA 5FD6A 3ORRA 3WO0A 4KK7A 4QIWA 2HDMA 2IJ0A 1AE3A 3FHWA 4L1KA 3GIKA 4LF8H 1V8QA 2G5DA 3V4ZA 4JYAQ 5EOYA 1H9SB 3M4YA 1PH7A 3HOVB 4XQNA 4X3UA 5CMDA 5CV9A 3Q8DA 3S2DH 5FPOA 3I70A 1CZGA 4NXNH 4POFA 3N40P 1SRUA 5ELNA 4N8FA 3M9MB 1TWGB 1NNXA 4EQOA 3K3VA 4LSAA 3GTLA 2MNAA 2EDGA 3TQTA 2B63G 4YHHQ 2BA1A 4DGZA 1AE2A 4QIWB 1E2WA 5C4JH 4LFBL 3CF5A 5KFFA 2ZDHA 3E9HA 5KRUA 5EJWA 3L3OC 1EUDB 5KFCA 3R5HA 1EY7A 5C4XH 4A3EG 4IURA 5FLMH 2XSCA 4C1NK 2KOLA 4C2MB 5G3LF 4KV6A 1PTOD 4DUYL 2VQEH 1X6OA 4A3MH 1M0TA 3QOLA 3PCOB 1B1ZA 1Q8KA 3GTMA 4JC0A 4LFCL 3K58A 3NQIA 2HIVA 2L55A 5EPJA 4AIMA 1XPOA 2E2HA 1HR0H 3F2CA 1WSCA 3VR6A 4J9MA 1G291 4HSVA 2NYZD 2YU9B 3ORQA 1PTOH 5GQOA 4G7ZC 2C2DA 4KHPH 4DK1A 1I3QA 2RF4A 1X3PA 4JI1L 1XDNA 1WVLA 1S0OA 4A2BA 5LL6b 3Q8SB 1KAWA 1XNQQ 3I4LA 5CC4A 2XWJB 4I4TF 2PNHA 4BS9A 1KLUD 2R7ZG 4HNTA 2IPKD 2BQ3A 1VBGA 3MAQA 4JI8H 2R92H 2G9DA 1B9NA 4MV3A 2J6SA 4OX9Q 2H1EA 3IRBA 4KN7C 1J9OA 2K32A 4DAYA 1I7NA 1JWMD 3OMGA 2NZ1D 2BQUA 1RJPA 3NUCA 1E3PA 5FLXW 2ZTCA 3KBXA 2PZTA 4NXNL 5IWAL 2NN6G 4XQJA 1R4QB 3HOZH 2L5TA 1UE6A 4A3BG 3F2DA 1X32A 4RCOA 4L5TA 5FKAC 2DUDA 1EUJA 4FF4A 4A3CG 2MUYA 3IAYA 3PR5B 1HZ9A 2Z4HA 5M3FH 1KQSA 4DL4A 3K5IA 4DAYB 1CS0A 3M7NA 1PH4A 4KHVA 5LOVF 2WKCA 2VQEL 1LTBD 2QEJC 4MV8A 1WI5A 2IHFA 3TS0A 4B3MQ 3QZ8A 3CCQA 5FLXc 1FVIA 2YRXA 4Y8VB 3HOVG 1HHVA 1S03G 1PDQA 1Y8PB 4K5WA 1BCPB 4A3FB 2YYAA 2NVYH 1HQRD 4YR3A 2ZDQA 3MR2A 3FRPB 1JICA 1XJVA 4A3DB 3PUYA 1UEAB 2ENBA 5IYBG 2FE3A 4X3TA 2E76C 5DNFA 1FKAH 1S0MA 3S1QH 3N6RA 2WINB 4KHPL 1AEXA 1UAPA 4ZAIA 5KFWA 2QK4A 4MTEA 4IUVA 2VPQA 2K28A 2H5XA 1RJRA 1I4PA 5KT3A 4P2CB 1YHBA 2YTVA 4GS3A 2OQKA 4KJOA 4R4IA 4YWMA 3WWVA 4B08A 4EGVA 4BA2I 5HY6A 4JV5Q 1SXTA 2KENA 3FKIH 4RGMA 4JI8L 5KFEA 4LF4H 4ECVA 1Y1VA 2W57A 1K1SA 2R85A 2YS6A 1L0XB 1VQOA 4RUCA 3RV3A 2ZXRA 1V9PA 2NU9B 4B3TH 2DNEA 1YEZA 2KCTA 5DAUA 4E4TA 5E4XA 4GNXA 5FO9B 1AP0A 3MZ5A 4DL2A 4A3GH 1BBXC 2F0QA 3MHBA 5KFPA 5H1SE 5C3EG 1B9MA 1STAA 3MXGA 5LMNQ 2EXZA 4M1UB 5C44H 1SYDA 2EY1A 3NBHA 1I6HB 2HUGA 2X6LA 3K81C 4MHEA 2E2IB 3U50C 3HOWB 2R6FA 1J5EQ 1PYBA 2J0TD 1HNWH 1P8LA 4BBSB 4UCVA 3BU2A 5M3MH 1HNXQ 3H94A 2W71A 1V1OA 2D9UA 2KJXA 5L1LA 2PZUA 3CU7A 2CKZB 3GLKA 4AYBB 3RJ0A 1D6EC 2FFKB 3VPDA 4GNXB 5JVLA 3GIQA 1KC7A 3S1RH 4B3RQ 3JSLA 3G6EA 4YIJA 1GUTA 4FXGC 1PXUA 4LF5Q 4OWTB 1KD1C 4YY3H 3I7FA 3NBHB 2ZJRA 3CCEA 4IWXA 3W3AA 2LFNA 4YQWA 1AZPA 1TAEA 1X55A 3MR6A 3FDSA 1GUGA 3S17H 5GAEC 3Q8QB 1HCZA 2XVSA 2EY2A 2AUKA 4DV4H 1A8VA 5EGTA 2GVAA 1SAPA 2KA7A 4A3LH 3K5OA 1P16A 1U4RA 1Y8NB 3J7AF 2QDBA 2K4KA 4JOIC 1X65A 4N9TA 4ZLTF 3C1FA 5EBDA 5I2YA 1SSOA 3WDNA 5JEAG 3CKIB 2J6TA 1EWHA 3CXCA 4FF1A 1JXLA 3X3NA 3S2HH 3DHQA 4TRDA 2JQOA 2AQ4A 1IBKQ 1EYGA 3OWEB 1DYQA 1R4PB 3IFDA 3GTPA 1HFNA 1YHAA 2BA0A 3AB9A 5K5PA 5E7NA 4ZYSA 3RZOB 2E2JH 4A3FG 3RGXA 1XNRQ 5CR3A 5HURA 1VQ6A 4A3DG 3QOJA 3SR1A 1Z9FA 5JAVA 4HJ9A 3GTLH 1T5EA 2W6PA 1BOSA 3TN2A 1O7IA 4DL7A 4IUTA 5M5YB 1S72A 2HVQA 1S40A 4L5SA 4WJWA 1BBUA 4Z9CB 5DQHA 1SR3A 2FJZA 4K0KQ 2K5QA 5TSSA 3BZKA 2VUMH 2IMWP 5I2XA 3L0OA 3GTPB 1AH9A 2F0WA 1EIYB 1F9PA 2F4VQ 3GV8B 4ED7A 2O2LD 2V4QA 2OTLA 2Z0SA 1TQOA 4DAMA 4JI3Q 1TVXA 4DR7H 2WKDA 3I12A 1STBA 1QUQB 1HZBA 2RA4A 2NZOA 3GTMH 3JAMW 3NP8A 4K5VA 4RB3C 2F4IA 3UQ8A 3BABA 1PYSB 2ALYB 3RLNA 4YY3L 1ASZA 2E2HH 1HA5A 1JWSD 2ASDA 1TXYA 3GILA 3S9WA 2RKSA 4DFAA 4X65H 1HFGA 3PUZA 4ME6A 1JR0D 4DNTB 2Z9HA 4Y7NH 2FK2A 5IIFA 2WAQE 1I3QH 3U4VA 3V2TA 1QNKA 3A8IE 4DV4L 2VQDA 2RBMA 3P7JA 3GV7B 5IP9G 4BBSG 1S5CD 5KG4A 4IUPA 1RYSA 2V58A 1BF4A 1JDBB 4GOPA 4UCUA 1BCPD 3JAMc 4HQ6A 2HD3A 2Z6KA 4NXMH 4AYBG 4BY7B 4DR2L 2JSOA 4DV0Q 4RB2C 4HCEA 4A75A 2B2TC 3ONAB 2Z8LA 3KOJA 3NWTA 1K73C 1VQLA 2CWAA 3EFXD 1BJTA 3E3XA 4HR7B 2RHSB 1FNVA 1SYFA 4N8X1 2CZGA 2YYZA 4OIJA 1TY0A 4O3QA 1WYDA 2B2WA 1VQAA 3WNZA 4LSXA 3GV3A 2JEJA 3D6WA 3S1MH 2DY7A 4O0AA 5FLXL 1JQYD 1A3UA 4X62Q 2A6EC 2RSOA 3PO2B 3O13A 1N32Q 3VR5A 4LF6H 4A3KH 1VQDA 1VQ9A 1QG7A 1HZAA 2HHHQ 2NU6B 3PW2A 2E8GA 2L12A 3J81E 3VYTA 3CVZA 2AHOB 3N8DA 1EOVA 1LTLA 3GP7A 1II3A 2MO0A 1X9NA 2R87A 3K0XA 5BR8H 1CA5A 3RB4A 5J2TF 4ETSA 1W6KA 4LH7A 2IT1A 1N36L 4DR7L 4BWGB 4EX5A 4GC7A 1D5MC 1GO3E 2UUAH 4ECTA 4ABNA 4C3HH 1YHQA 2AWOA 3QR8A 2DWCA 4XT1B 2PQEA 3NXWA 5KG1A 3DWQA 1XMQQ 5KFTA 1WCMA 1QZGA 3RBEA 4A93H 1CQIB 4MV6A 1EY6A 4JI2Q 3I4MB 1BCPC 4GZYC 2Y0SG 3TMEA 3FP9A 1YI2A 2W7PA 3NWSA 3OPOA 4P73A 2YS7A 5KT7A 1EFWA 1SN8A 1Y1WB 3I55A 4XYMB 2F3VA 1YIJA 1L1OA 2NWGA 2X69A 1JMCA 3BQ2A 2PW5A 1GD7A 1EYDA 5E1FA 4F4YA 2M00A 2JA6B 1Y1VH 5IP7G 4KI0A 1EWIA 1TWHB 4OL7A 4JBKA 1I4QA 4U673 1Q1EA 3D4DA 4FS2A 4RH6A 3HOXG 2O5IC 2MCTA 1TWAA 2A73B 5M5WH 1EY8A 1XPRA 3E5SA 3CPFA 4K2LA 3FDTA 5GAHC 4BY1B 3A5ZB 4HJ5A 2HT1A 5KG5A 4UCOA 4EQPA 4PWQA 4UAIA 2R61A 1A2UA 1A3VA 5AJ3L 5M5XH 3HOUH 2XCPA 2ZM6Q 3M4OB 1BQQT 5C0XG 3CCSA 3KTMA 2JA7A 1QWYA 4X64H 4YJ2F 2CCZA 4LF6L 4U7CA 2OH2A 3G7LA 4LK1C 4J9PA 1SE8A 1TWCH 2GN5A 2MP1A 1H9RA 3R5XA 2EY5A 2PI2E 3CCVA 4EFBA 2FPGB 4J15A 3ICEA 2WIIB 5BR8L 3OUUA 2HIXA 1DV2A 4BY7G 3HKZE 4RG1A 3RAXA 4DV3H 4IPHA 1IKMA 5C3XA 4MTNA 2VL6A 4QWBA 4KN4C 5CV7A 2KCNA 1KAAA 1VQHA 1IBMQ 3J7AV 3CCRA 4FS1A 3BZDB 4GNXC 2CH4A 4HYKA 4JI4Q 1IYUA 4J9KA 1K8AC 1JE5A 3S2DB 1DOMA 1X3EA 2OQ0A 3PIOA 4HIDA 4O2BF 3PO2G 1E1OA 4DV5Q 2B8GA 5KYLA 5AFWA 3KK7A 2WB1A 4R4OA 2KBNA 4RMFA 5C4JB 2NTSA 2OWOA 4TSSA 2PPBC 2I5MX 2IY5B 1UNNC 2ZTDA 2UXBH 4L8JA 5C4XB 2EYPA 2DPJA 5CV4A 1I94H 2XCLA 3K7AH 5FJ8H 5IGEA 1T9HA 4HIMA 1DZ1A 4A3MB 4DV7H 4DUZQ 2X0SA 1TKWB 5F2DA 1LTRD 2PMZE 1N48A 2EYFA 4TQUS 2JXMB 3MR3A 2ASBA 4A3IH 4U6PA 4GLVB 4Q5VA 1CKNB 3I4MG 1I4GA 4DR4Q 1Q90A 4LUZA 2JA9A 1PTOB 1S68A 4FM9A 1Z47A 2EQSA 1A15A 1PV4A 2NVXH 1Y1WG 2I80A 4IUQA 2UUBH 5CGKA 4EFEA 3D6CA 1NMFA 2IX3A 3PQIA 4DR5H 1W6JA 2F0NA 3DLLA 3KXYT 4MAMA 1SE4A 1HNZH 2JA5A 1ET9A 2JA6G 4L63B 4JI7Q 5HV6A 4L5QA 3P75A 2B2YA 3JAML 2R92B 3Q0AA 4YBZB 3KHHA 1SYEA 4BY1G 1RIPA 5D1OA 5IYDH 1J8IA 2P5ZX 1JCKB 1VQCA 4MTKA 3TEHB 1SNDA 1K9MC 1XX8A 2FLNA 3CMAA 4K6LA 1KRTA 3MXNB 4JI6H 2UU9Q 4X6AH 3CC2A 4GKJQ 1PX2A 4JI0H 2YL2A 4I7HA 1SJHD 3HOZB 4KKSA 5E3FA 4A3JH 2I8CA 2IBKA 3KLWA 4O2DA 5KFMA 5KKNB 4LJZC 1JLLB 3ULPA 2PVPA 2Q2UA 4GLAC 3JZIA 2BR0A 3MXUA 3STBD 2ATWA 2UXBL 4WJ4A 1BNCA 4UCRA 5M3FB 5COYA 1AN7A 1PTOF 2YZGA 1Q7YC 1M6VA 2PQAA 4K8IA 2VQFL 5D1OB 5EWEA 1AFPA 4DNIA 4ECRA 1RL2A 3C1EA 4LFAH 3GV6A 3V96A 3KLSX 1STGA 4DV7L 1IBLQ 3DEOA 3FVQA 1MIUA 2W6NA 3VDYA 5IGBA 1J6QA 2K14A 1IW7D 5LXTF 1EYCA 3NK9A 3FKIA 1IZ6A 3BVZA 5C5JA 3PUWA 2NVYB 2LY7A 3QB3A 2VW9A 4JYAH 3K6OA 4IJLA 4Q43A 1HXYD 3EROA 2XGPA 1N34H 3JAMi 4DAPA 4DL3A 4DV1H 3S1QB 4HAEA 2RDFA 3PR4A 3DWAA 1PMRA 2R6GA 5LMNW 2UUBL 2GLTA 3LMLA 5DG9A 4DR5L 3PW7A 3DMUA 1HNZL 5KFSA 4RB0A 4O4IF 5LL6S 5C4XG 3VR4A 5FLMG 4OO1H 4DR1L 1IL2A 2MQHA 2MFIA 4LF7L 3FKIB 4C3IH 4A3MG 2JEBI 3U9OA 1MZBA 2ALZA 5A2QW 4RCNA 2NU8B 1WCMH 3MFHA 3H40A 1VQPA 1EYZA 5LP6F 3OHBA 5EKLA 1JC7A 1M4VA 2A69D 4A3GB 4F4WA 3BDLA 2PZWA 2F52A 4PMWA 1MJCA 3JSNA 2HCIA 1RJTA 3STBC 1PRTD 2K33A 3EPGA 5C44B 5IE8A 3LWUA 1DJRD 4JI0L 4DR6Q 1EZ1A 1ZYRC 1S10A 4FVMA 2F0VA 2E5LH 3KLSA 2FJ2A 3G8CA 3NBIA 3Q22A 4ED2A 1GJXA 5M3MB 1Z2NX 1FYCA 2IX0A 1IW7C 2L9HA 3MVVA 4BXXH 1TWAH 4IALA 3MWDA 3MFIA 3SK5A 3WO1A 5ELCA 2R92G 1EY9A 4KKTA 3V4SA 5KFQA 4LFAL 3MFYA 5FK9C 3S1RB 1BVSA 3T5KA 1N33H 3D4WA 2EJGC 4OELB 3EPIA 1DM0B 1V51A 1KRSA 5LYJF 3HFZB 2UUCQ 4JI5Q 4B3SH 2JA7H 1W3SA 3S17B 1N34L 3HOZG 1AW7A 4DV1L 4CDEC 3FPPA 2JA8H 3SE0A 1LT5D 4K14A 2K01A 5CORA 1O80A 4PG3A 1PFNA 4H7BA 1L1OC 5HBRB 2C2RA 1YJWA 4C1NI 1F9QA 5M3FG 1KJ9A 4K6DA 3NQTA 3ND8A 1CQJB 4YWLA 4QMGA 4LH6A 2UXDL 3S2HB 4LF9L 2A69C 1VQBA 3H15A 1W2BA 2VUMA 3RN2A 5LL6X 2R7MA 1DCZA 1ENFA 2R93A 3MA2B 4IJHA 2E2JB 1E24A 4IRDA 1I6VC 1SNOA 2FLPA 4POGA 2EYMA 3T1HL 2Q8IB 4LFBQ 3GTLB 1E0BA 4R4CA 3V05A 1EOTA 5DGAA 2MPMA 1DD2A 1DOLA 2HVRA 2E5LL 5KFOA 2DJGC 4QF4A 2FHTA 4DUYQ 2FMAA 5I47A 1FD7D 1GOZA 2WP8J 3Q8RB 1WJJA 2IWHA 2ZT9C 2V4RA 2VUMB 4DF7A 1BDOA 1KABA 3CPWA 2SOBA 5GAGC 4LFCQ 1E1TA 3T53B 1G91A 1JOKA 3FKIG 1HJPA 2VS1A 5EKKA 5LMUH 1MHWC 1N33L 1HTPA 3GTMB 1SYBA 2IW3A 1LTGD 2AGOA 4ME5A 1OXSC 4FP5D 2A74C 4IFDH 4LF8L 1CUKA 3OSPA 4A3GG 2E2HB 2F0JA 1PZID 3IG0A 3CCMA 1I4XA 4B3SL 4JI1Q 4JV2A 2M9VA 2TMPA 2I46A 2DN8A 2PYKA 5JEAJ 4Y7NB 3BDCA 1I3QB 5LMNH 3H0GH 3UDIA 1UC8A 2JA5H 1G2SA 5M3MG 2EY6A 4R9WA 1PTOC 1SYGA 1JB7A 3AQQA 5IT9L 1KC8C 3A54A 3KALA 1E22A 4F88A 2RGVA 3GIMA 3RZDH 2VA3A 1CE8A 5K2MA 4TUYF 1B33N 1O78A 3R3OA 4O2AF 4NXNQ 4K5XA 5IWAQ 4YCVA 2OLSA 3K5LA 5JJKA 3SK4A 1BXTA 3EVQA 5KT5A 4YCUA 3OIQA 2QF7A 4EBDA 3RN5A 1HPCA 3BZCA 3S1MB 5EDWA 1XXGA 2F3WA 3PIO3 2OXPA 1SNCA 3I2ZA 1OXVA 4A3LG 4I50F 1HR0L 1NCVA 2VB3X 2PO4A 2EXDA 2D0OA 1EIFA 4A3KB 3T1YH 1WOCA 2KVMA 2VQEQ 2F1MA 4R8NA 4RHSA 2OEOA 1OTCA 3OTOH 4J9QA 4A3EH 4RAYA 1FL0A 4Y52H 3L2PA 4IOCA 2HCCA 4DA2A 1ET6A 2Q8TA 4XZ3B 1K8GA 3G6YA 1IXRA 1YZ6A 1EQTA 1XPUA 3L4JA 1JJCB 2L15A 4R4TA 5LMUL 5F9LA 2F0DA 2H4OA 1KNAA 4A2AA 1RODA 3PO3H 4CC6A 4C3HB 5EKIA 1KIXA 3NTKA 3GV5B 2K5VA 3NENA 3T13A 1NTGA 3T51B 1SE3A 4QWDA 3CRKC 1LM0A 4KHPQ 1JOOA 3M9BA 4PZ7A 1X3QA 3E0EA 4X3SA 3AU7A 1PA6A 4DR3H 5DLGA 4A93B 2UVUA 1QJOA 3ERQA 2RGRA 3G4SA 2FP4B 1TWFA 4GN4B 3HKSA 2F0GA 2AUJD 2EYOA 3A55A 2J7ZA 1SCUB 3KHGA 2NUAB 4IR1A 5DLQE 3G71A 1R9TH 5KFNA 2MHVA 3TS2A 4X66H 5LHY1 2EOTA 2VY3A 3FMAA 1PZJD 4JI8Q 1JIHA 4EQNA 4J9RA 4IQZA 2AGQA 1VQFA 3BG3A 3CCJA 1BCPF 2VUMG 4EYHB 3VA7A 2ZTEA 3RV4A 5KNDA 1TWCA 5JUMA 5C3WA 1Y1VB 1AN8A 5CA0F 4AYBE 3S14H 1QOHA 1TS5A 1ZXTA 3DM1A 2EZVA 4ED0A 1E2ZA 5A2QL 3CP0A 5M5WB 1I4HA 4IUNA 2ES2A 1Z6HA 5GROA 4JI3H 3F8TA 2DJFC 1CKOA 2K05A 4RZQA 1MI2A 1B2TA 1EZ8A 4GKKH 5M5XB 4ED3A 1GVPA 2FXQA 3UDFA 3HOUB 4TV8F 3T4AC 3OMCA 3PSIA 1SEIA 3AMUA 1VQ8A 2WTFA 3H4BA 1PHJA 4A4IA 3N41B 2NU7B 3T1YL 1CQFA 3RUPA 4FXKC 1TWCB 2I07B 2Q2IA 1D1KA 5JQWA 3OTOL 1VQ4A 3HG9A 4IHJF 1CFMA 4ECYA 2Z1CA 5KG3A 3QO2A 2UXCH 2BCOA 1WTQA 3CC7A 2FK1A 4AH6A 3BYTB 4XX0B 2Z4IA 3HOYH 2B2VA 4NW2A 4G4KA 2ZJTA 4ECQA 2EYJA 1GYFA 3RMHA 3P1HA 4N9PA 4LF4L 3U4ZA 3QIAA 2XRSD 2DGYA 1D7QA 4IAJA 3BDOA 4B3TL 3J7ZC 3NSWA 5IYBH 3HZXA 3GTGA 5KFRA 4DR3L 3A0JA 4MN3A 1E4GT 4AQYH 4ULLA 4EG0A 3U9SA 3Q2OA 4A3KG 2Y0SE 3I8ZA 3H3VH 3H91A 4X66L 1KJ8A 1STEA 1XYIA 3J7A5 2EIFA 3DXJC 3Q24A 2B8FA 2FLLA 4QW9A 2K03A 4KY7A 4CDDC 1HNWL 3CMEA 1H9KA 4JW0A 4CDFC 1VMCA 3MTSA 4FF2A 2NVXA 3I90A 5KG7A 1I50H 3AFQA 2R93H 3K7AB 2KHJA 2W9CA 1MBYA 4IZ8A 5C0XJ 2K7VA 4C3HG 5DGBA 3GTKH 1OO9B 3C2PA 1EEFD 1YNXA 3QWNA 1U5KA 4H44C 3U58A 3RAQA 4HMJA 5C3EH 3D0FA 1C48A 4GKKL 1S0NA 4CKCA 4A93G 4A3IB 1VMPA 2CWPA 1PH5A 4ME3A 4YJ3F 1XMQH 4RA8A 5K36H 5KFBA 4I65A 2YW2A 2WAQA 5FPRA 3M9OB 2NVXB 4JI2H 3HOWG 4O3RA 4DNRB 1ZETA 3EA6A 4O4HF 4DV2H 4CKBA 3M4IA 1RHPA 2QCPX 2UXCL 1RYRA 3CCLA 5J1ZA 4YY3Q 2M2LA 4YR2A 1Y1VG 3S1NH 4QCLA 4QWCA 3GIIA 1EY5A 4UP7A 2QYZA 3J7YW 4DKAC 4DV4Q 3FEWX 5KG2A 3RIZA 1CT1D 4K2KA 2OF1A 1JDEA 1TT2A 3HOUG 5D65A 4CJ2C 1G6PA 3MC0B 1SROA 3SK6A 1F2YA 3W1GA 4XXEA 4AQYL 1A2TA 1KL9A 2WDTA 3EBEA 4XYLB 4DR2Q 2W6ZA 3TQ1A 4A3JB 1PFSA 2V4DA 4ZQIA 2ZM6H 1ESRA 1NY4A 3TSSA 4GOPB 5I9OA 1EY0A 4DV6H 3ERSX 1GGOA 4JV1A 4X3KA 2JJQA 4RAUC 5JEAH 3N44B 1CSQA 2LKVA 3I56A 1IOWA 4EBCA 2LXKA 2KCMA 1SBBB 3MWYW 5JPMC 4PMCA 2F0SA 2R84A 3PW0A 2K1BA 1LTTD 3J81j 4KY5A 4FXDA 1CHPD 1PH6A 4EYIB 1Q12A 5CA1F 4H0LC 5IGDA 1PH8A 1YITA 4YB8B 4TV9F 1GUOA 2A8VA 4FU0A 1F2ZA 1VF7A 4F8MA 3G6XA 4HJ8A 1IBMH 2K6AA 1K0SA 1L2FA 2W9BA 5JJZA 1CM9A 2XTIA 4Q8EA 4X65L 2JN4A 2WACA 1N36Q 4DR7Q 1KHIA 2CHBD 4KLKA 3EJIA 4PZ8A 4CHTB 5CAEB 1I5FA 4EBEA 2BE5D 5FOBB 4WBNF 3HB9A 4BA1I 1MD2D 2KUMA 4DV2L 3KFUA 4RB1A 3R2TA 4HJAA 1MKHA 3BVGA 1WTRA 3MEFA 1NR2A 2A68D 3GDEA 5KGUA 3AEVA 1T94A 3RLOA 2DLNA 5FJ8G 4NXML 2O5JC 1W96A 1I4RA 5ISRA 4C3IB 4LNQA 2K04A 3EN2A 1BXRA 1XMOH 1GUWA 5KFKA 1EWCA 3MR5A 1FJGH 4J9SA 1WCMB 3PIP3 2R7LA 2R3ZA 2ZJQA 2W9BB 3AYHB 3T5LA 4FO2A 4ZCKA 4ZRZA 3LWEA 5GADC 1TWFH 4A3IG 4RNNA 2N3SA 4U68A 1ILQA 2QKIC 3GTJH 4DUZH 4YCWA 2IX1A 2ATLA 3KF6A 2KSWA 2NVQH 2YZNA 1Q46A 4XIGS 3J81W 4ED1A 2E2DC 1L1OB 1E2VA 1GUNA 4DV6L 1Z7TA 5EPLA 4QY7A 3TP7A 5DM63 3PF5A 1K83A 3GTOA 3K0YA 1XTDA 2PI2A 2XIWA 5J39A 3BS1A 1WTVA 2W8KA 1KDBA 2HQEA 3I73A 1WH2A 1CZWA 1TWAB 2C9OA 5AJ3Q 1PRTB 1TY2A 3HKZA 3RNUA 2HDLA 4L6TB 4RKLA 2B2UA 2UUAL 4C3JH 5I6YA 1A9XA 5IYDG 4LF6Q 2C5CA 1JKJB 4Q45A 4UDUC 1S5ED 3T56B
chains in the Genus database with same CATH topology
4EQ5A 1VQMA 1HZ9A 5M3FH 1KQSA 3J81c 4JCVE 1WCMH 1FGUA 5BR8Q 4DAYB 3M7NA 1VQPA 1PH4A 1S3OA 2K52A 2VQEL 4A3JG 4OWWB 1WI5A 2IHFA 2N78A 3TS0A 4B3MQ 1X56A 4PMWA 2F52A 3CCQA 1MJCA 5FLXc 1FVIA 3STBC 3H3VI 3HOVG 3S15H 1K3RA 5IE8A 4DR6Q 4GKKQ 2QEXA 1VQGA 4JI0L 2NVYH 1XJVA 2YV5A 3PUYA 1SMXA 5IYBG 3B6YA 3S1QH 4DV0L 2IX0A 1JJGA 1XMOL 4KHPL 1K0RA 4BXXH 1FJGL 1TWAH 3I4NH 2R7DA 3KDFA 4OWXB 1QVCA 3GTGH 2UXCQ 3F2BA 2R92G 2H5XA 5ELOA 1QZHA 4LFAL 1BVSA 1OXUA 1YHBA 2YTVA 2OQKA 4GS3A 4R4IA 4YWMA 3WWVA 3KJOA 1C7YA 1JJ2A 5HY6A 2I0QA 4BA2I 4JV5Q 1ASYA 1KRSA 2KENA 3FKIH 2NZHA 5IYCH 4JI8L 3HFZB 2UUCQ 2QGQA 4X62L 4UP9A 1UEBA 4JI5Q 1VQOA 2RCNA 2JA7H 1W3SA 3NEMA 4X64L 1N32L 1V9PA 1YEZA 2KCTA 4GNXA 2HHHL 1N34L 3HOZG 1C9OA 1JT8A 4A3GH 4DV1L 4AQYQ 4QJFA 1CSPA 2JA8H 5H1SE 2K5NA 1UE7A 5C3EG 5LMNQ 3HOXH 5C44H 4A3FH 1VQ5A 4PG3A 1L1OC 4IPGA 1YJWA 1Y14B 3K81C 5M3FG 3AFPA 4DV3L 3U50C 3I4OA 4YWLA 1PYBA 1WCMG 1J5EQ 4A3DH 4KHZA 2UXDL 3UDGA 1P8LA 4HIKA 4LF9L 1VQBA 4JBJA 3H15A 3BU2A 1W2BA 5M3MH 1HNXQ 3RN2A 1UE1A 1PH9A 3G48A 2CKZB 1XMQL 3UDXA 1OXXK 4IJHA 4QGUA 1E24A 3LGJA 4GNXB 2MO1A 2N8NA 3S1RH 4JI2L 4FDBA 4B3RQ 3G6EA 4POGA 3T1HL 4DK3C 4LFBQ 4R4CA 4LF5Q 4OWTB 1KD1C 3KF8B 2K5HA 3I7FA 3NBHB 2D62A 4APVA 2ZJRA 3CCEA 3GTQH 2E5LL 2AWNA 4DK6C 1X55A 4BXXG 4DUYQ 4X65Q 2WP8J 3I4NG 3A74A 1NBWA 1WJJA 5GAEC 1N8RC 3S17H 3J80c 4MZ9A 1E7ZA 1A8VA 2A19A 2GVAA 2B29A 4A3LH 1I94L 3CPWA 5GAGC 4LFCQ 1E1TA 1P16A 4DV2Q 2K4KA 4JOIC 1X65A 3FKIG 5IYCG 1I6HH 1HJPA 2VS1A 2XGTA 5JEAG 2E2IH 1N33L 2JA7G 3HOWH 5IP9H 4NXMQ 4NB3A 3CXCA 3S2HH 1OXSC 2UXBQ 4BBSH 2YTXA 2JQOA 3UE1A 2ZM6L 1IBKQ 1EYGA 1CUKA 4LF8L 4A3GG 3OYYA 2VQFQ 1YHAA 2BA0A 3CCMA 4B3SL 4LWCA 4JI1Q 2JA8G 3K7UC 5E7NA 1L0WA 4BBRH 4A3FG 2E2JH 4DV7Q 3HKZG 5JEAJ 2I5HA 4WJ3M 4YWKA 1YJNA 1XNRQ 4XTCS 2PQAB 1VQ6A 4A3DG 4GOPC 1Z9FA 2JE6I 4UP8A 4HJ9A 3GTLH 3H0GH 4GLXA 3UDIA 1O7IA 2Z6KC 1PH2A 2JA5H 3SGIA 1DGSA 5M3MG 1NJIC 3AQQA 1KC8C 1JB7A 4DV6Q 3KF6B 1S72A 1S40A 4L5SA 1E22A 1BBUA 2AMCB 2WAQG 1SR3A 3RZDH 1IBML 4K0KQ 3BZKA 2VUMH 1VQKA 3L0OA 1VQIA 1AH9A 4NXNQ 1EIYB 2F4VQ 2UUBQ 5IWAQ 4JI4L 4YCVA 4DR5Q 2OTLA 2Z0SA 4DAMA 1HNZQ 4JI3Q 5JJKA 4R1JA 3DM3A 4A76A 2KHIA 4YCUA 2UUAQ 1QUQB 1HZBA 4DR1Q 2NZOA 4JI6L 4DPGA 2WB1G 2F3IA 4JOIA 3RN5A 3GTMH 4LF7Q 2RHQB 1BKBA 3BZCA 3K80C 4DV5L 1PYSB 2ALYB 3RLNA 4YY3L 1ASZA 3I2ZA 2E2HH 1Q86C 1OXVA 1GM5A 4A3LG 1HR0L 1KXLA 1TXYA 2EXDA 2D0OA 1EIFA 3PUZA 1M90C 3RZOH 1WOCA 2VQEQ 3W5OA 1B7YB 4GN3B 1OTCA 4Y7NH 1CKMA 2LXJA 2WAQE 1I3QH 4LUVA 3TREA 3U4VA 4A3EH 1C0AA 4DV4L 5JJIA 1FL0A 4Y52H 4HIOA 5J3BA 5IP9G 3L2PA 4IOCA 4JI0Q 4HJ7A 4BBSG 1K8GA 3K8AA 4IFDG 1IXRA 1YZ6A 4LW1A 1XPUA 1CKNA 1V43A 4DUZL 4GOPA 1JJCB 3JAMc 2L15A 4R4TA 5M5YH 5LMUL 4OO1I 2Z6KA 3PO3H 4AYBG 4DR2L 4BBRG 2WB1E 4DV0Q 1KIXA 4A75A 2K5VA 3NENA 5JJLA 1XMOQ 1NTGA 4QQBX 1IYJB 3KOJA 4KHPQ 1LM0A 3M9BA 1K73C 1VQLA 4PZ7A 3GTPH 2CWAA 4DR4L 1FJGQ 3E0EA 4JYAL 1K83H 2RHSB 1PA6A 3GTOH 4IFDJ 2YYZA 3H0GG 3G4SA 4LFAQ 3CCUA 1GKHA 5IP7H 2JA5G 2Q2TA 1EQQA 1WYDA 4GN4B 3HKSA 4P75A 4OO1G 1VQAA 4OONA 5DLQE 3G71A 1R9TH 2CFMA 3KDFB 3PV0A 3S1MH 3TS2A 4O0AA 2VY3A 4QIWE 4JI8Q 1VQ7A 4JBWA 4X62Q 1VQFA 2K75A 3CCJA 2VUMG 3CW2C 4YHHL 2ID0A 4X64Q 1N32Q 1UE5A 2ZTEA 4A3KH 1VQDA 1VQ9A 2HHHQ 1HZAA 4JI7L 3D31A 1N34Q 2E8GA 4MNOA 2AHOB 4DV1Q 1EOVA 3ULLA 1V1QA 1LTLA 4AYBE 2NVTH 1X9NA 2MO0A 1PH3A 3S14H 3K0XA 1SLJA 2Q2HA 4GN5A 3CP0A 2ES2A 5GROA 2IT1A 3F8TA 1N36L 4DR7L 1Q82C 1CKOA 5EAYA 4EX5A 4DV3Q 1GO3E 3BJUA 4P71A 2UU9L 4IOAA 4GKJL 2I5LX 4LF9Q 2UXDQ 1GVPA 2IHEA 2FXQA 3ER0A 3UDFA 4C3HH 1YHQA 4BY7H 1BBWA 2AWOA 3CQZH 4H02A 4NPSA 3PSIA 1OXTA 2V1CC 4IO9A 1VQ8A 3TRZA 4ALPA 1XMQQ 3CC4A 1QZGA 1PHJA 4A4IA 3JC66 3T1YL 4A93H 1LUZA 4JI2Q 2Q2IA 2A1AA 1PVOA 3NELA 2Y0SG 2LSSA 3OTOL 3FP9A 3M4QA 3T1HQ 1VQ4A 1YI2A 1EQRA 2N49A 4P73A 3J81i 3PO3G 4UY8C 3CC7A 1EFWA 4AH6A 2E5LQ 1SN8A 1XNQL 1HR0W 3GO5A 5IT9c 1IBLL 3I55A 3TQYA 3PO2H 2WFWA 1YIJA 1L1OA 3PIPA 1JMCA 3HOYH 1Q81C 1GD7A 4R4QA 4L5RC 4LF4L 1M1KC 1Y1VH 3U4ZA 4KI0A 1EWIA 5IP7G 5C0XI 2DGYA 3M85A 1B70B 1I94Q 1NMGA 4JBKA 4OX9L 1Q1EA 1D7QA 4OXPA 3HOXG 5C44G 4B3TL 3CD6A 5M5WH 3J7ZC 5IY0A 2GVBA 1XPRA 5IYBH 2JK8A 1Q1BA 4DR3L 3CPFA 3A0JA 5GAHC 2K50A 3A5ZB 4HJ5A 1N33Q 2HT1A 1WFQA 4A3KG 2Y0SE 5M5XH 5AJ3L 3H3VH 3HOUH 4X66L 2ZM6Q 4LF8Q 1YJ9A 5C0XG 3J7A5 3CCSA 2EIFA 4B3SQ 1X3GA 2JEAI 2CCZA 4LF6L 3CMEA 1MJEA 1HNWL 1SE8A 3CAMA 1TWCH 2R7FA 2GN5A 3I4MH 1I50H 3AFQA 1B8AA 2PI2E 3CCVA 3KYHC 2R93H 4J15A 3ICEA 2KHJA 5BR8L 1D8LA 3S24A 1HZCA 5C0XJ 1NE3A 2HIXA 3M3YH 4BY7G 3L7ZC 3GTKH 1YNXA 1Y1WH 1U5KA 1N9WA 3HKZE 4RG1A 3U58A 4IPHA 4B3ML 4P74A 4MTNA 1VCIA 2VL6A 1H95A 1G51A 5C3EH 3D0FA 3A5UA 4GKKL 1IBMQ 4DR6L 1VQHA 4IFDI 3EIVA 1VQEA 1QVGA 4A93G 3PGZA 3CCRA 2B63H 2BH2A 4QL5A 2JA6H 3PF4A 1TWHH 2CWPA 4GNXC 1A63A 1PH5A 4ME3A 4JI4Q 1K8AC 4LUOA 1JE5A 1YVCA 1PH1A 1A0IA 1X3EA 4BY1H 1YBYA 1QVFA 2OQ0A 3PIOA 4HIDA 4JI6Q 3HOWG 3PO2G 2CQOA 1E1OA 3HOYG 2OTJA 3KJPA 4DV5Q 1X3FA 1VS0A 2UXCL 2B3GA 3CCLA 4YY3Q 3M4OH 1Y1VG 4UPAA 3S1NH 2C35B 1HR0Q 4IPCA 4R4OA 2KBNA 4RMFA 2OWOA 4JV5L 2I5MX 2IY5B 2YTYA 2ZTDA 1VQNA 2BH8A 4UP7A 2UUCL 4DKAC 4DV4Q 4JI5L 3OW2A 3K7AH 5FJ8H 4HIMA 1T9HA 3HOUG 3ULJA 1G6PA 5HGQA 1SROA 3RLFA 3W1GA 4DUZQ 5LMUQ 4AQYL 2PMZE 3J80i 1KL9A 3EBEA 1AE3A 4TQUS 5LMNL 4DR2Q 3FHWA 2ASBA 1PFSA 4A3IH 4GLVB 1NY4A 1CKNB 4GOPB 3I4MG 4JYAQ 2R7ZH 3ZJYC 4DR4Q 3ERSX 4LUZA 1PH7A 2JJQA 4PZ6A 2QA4A 1J5EL 1CSQA 2R93G 2JA9A 1SFOH 3I56A 2LXKA 3Q8DA 2KCMA 3S2DH 1Z47A 2EQSA 2ZJPA 2NVXH 1PV4A 1Y1WG 1HNXL 4POFA 3PUXA 1SRUA 2OCEA 3GD7A 4JBMA 1NMFA 5ELNA 2VZAA 3DLLA 2MNAA 3UE0A 3W1BA 3J81j 2JA6G 1PH6A 2B63G 4YHHQ 1Q12A 2BA1A 4B3RL 1PH8A 1AE2A 5C4JH 4L5QA 1YITA 4JI7Q 3CF5A 4LFBL 4A3BH 3E9HA 5K36G 2A8VA 4LF5L 3E9IA 3M4PA 4HJ8A 5C4XH 4A3EG 1L2FA 1RIPA 4BY1G 5FLMH 1A62A 2AKWB 2XTIA 5IYDH 4A3CH 1VQCA 3TEHB 1X6OA 4X65L 1UWVA 4DUYL 4A3MH 1K9MC 3S16H 1N36Q 4DR7Q 1KHIA 3PCOB 4KLKA 3CMAA 4PZ8A 1Q8KA 1I5FA 1KRTA 3MXNB 3F1ZA 2UU9Q 4X6AH 3CC2A 4JC0A 4GKJQ 4BA1I 4LFCL 3PUVA 4DV2L 3KFUA 2HIVA 4P72A 4A3JH 1X54A 4HJAA 1MKHA 3KLWA 4O2DA 3MEFA 4AIMA 1XPOA 3F2CA 1U0LA 3GDEA 3ULPA 3AEVA 1G291 4GLAC 3RLOA 2Q2UA 3HOVH 5FJ8G 3T1YQ 3STBD 4NXML 4LNQA 2ATWA 2UXBL 4WJ4A 3EN2A 4TVAB 5GQOA 1IBKL 3OTOQ 2VNUD 1Q7YC 2ZJQA 1HH2P 2PQAA 2VQFL 2RF4A 1TWGH 4JI1L 3AYHB 1RL2A 4DNIA 3RR5A 1KAWA 5GADC 1TWFH 4DV7L 4A3IG 1IBLQ 1XNQQ 2N3SA 2PNHA 1MIUA 3GTJH 3VDYA 1XNRL 4YCWA 2IX1A 1J6QA 2R7ZG 3KF6A 2K14A 2NVQH 1IZ6A 2NN6I 2R92H 3PUWA 4LF4Q 1Q46A 2VW9A 4OX9Q 2HQLA 3IRBA 4XIGS 1L1OB 4B3TQ 4IJLA 4C2MH 4DV6L 4QY7A 1LYLA 3PF5A 3JAMi 4DR3Q 1XTDA 2PI2A 4K0KL 2D0PA 1E3PA 4JG2A 1QUQA 2ZTCA 4NXNL 2R6GA 5LMNW 5AJ3Q 2UUBL 2F4VL 5IWAL 2NN6G 4X66Q 4A3BG 3HOZH 1UE6A 4DR5L 3RNUA 4JI3L 3F2DA 1HNZL 5C4XG 4L5TA 5FLMG 2UUAL 2DUDA 1EUJA 4C3JH 4DR1L 2MQHA 1IL2A 5IYDG 2MFIA 4LF6Q 4A3CG 1HNWQ 1VQJA 4LF7L 4C3IH 4A3MG 2YU9H 4IPDA 2JEBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQ5 A;  1VQM A;  1HZ9 A;  5M3F H;  1KQS A;  3J81 c;  4JCV E;  1WCM H;  1FGU A;  5BR8 Q;  4DAY B;  3M7N A;  1VQP A;  1PH4 A;  1S3O A;  2K52 A;  2VQE L;  4A3J G;  4OWW B;  1WI5 A;  2IHF A;  2N78 A;  3TS0 A;  4B3M Q;  1X56 A;  4PMW A;  2F52 A;  3CCQ A;  1MJC A;  5FLX c;  1FVI A;  3STB C;  3H3V I;  3HOV G;  3S15 H;  1K3R A;  5IE8 A;  4DR6 Q;  4GKK Q;  2QEX A;  1VQG A;  4JI0 L;  2NVY H;  1XJV A;  2YV5 A;  3PUY A;  1SMX A;  5IYB G;  3B6Y A;  3S1Q H;  4DV0 L;  2IX0 A;  1JJG A;  1XMO L;  4KHP L;  1K0R A;  4BXX H;  1FJG L;  1TWA H;  3I4N H;  2R7D A;  3KDF A;  4OWX B;  1QVC A;  3GTG H;  2UXC Q;  3F2B A;  2R92 G;  2H5X A;  5ELO A;  1QZH A;  4LFA L;  1BVS A;  1OXU A;  1YHB A;  2YTV A;  2OQK A;  4GS3 A;  4R4I A;  4YWM A;  3WWV A;  3KJO A;  1C7Y A;  1JJ2 A;  5HY6 A;  2I0Q A;  4BA2 I;  4JV5 Q;  1ASY A;  1KRS A;  2KEN A;  3FKI H;  2NZH A;  5IYC H;  4JI8 L;  3HFZ B;  2UUC Q;  2QGQ A;  4X62 L;  4UP9 A;  1UEB A;  4JI5 Q;  1VQO A;  2RCN A;  2JA7 H;  1W3S A;  3NEM A;  4X64 L;  1N32 L;  1V9P A;  1YEZ A;  2KCT A;  4GNX A;  2HHH L;  1N34 L;  3HOZ G;  1C9O A;  1JT8 A;  4A3G H;  4DV1 L;  4AQY Q;  4QJF A;  1CSP A;  2JA8 H;  5H1S E;  2K5N A;  1UE7 A;  5C3E G;  5LMN Q;  3HOX H;  5C44 H;  4A3F H;  1VQ5 A;  4PG3 A;  1L1O C;  4IPG A;  1YJW A;  1Y14 B;  3K81 C;  5M3F G;  3AFP A;  4DV3 L;  3U50 C;  3I4O A;  4YWL A;  1PYB A;  1WCM G;  1J5E Q;  4A3D H;  4KHZ A;  2UXD L;  3UDG A;  1P8L A;  4HIK A;  4LF9 L;  1VQB A;  4JBJ A;  3H15 A;  3BU2 A;  1W2B A;  5M3M H;  1HNX Q;  3RN2 A;  1UE1 A;  1PH9 A;  3G48 A;  2CKZ B;  1XMQ L;  3UDX A;  1OXX K;  4IJH A;  4QGU A;  1E24 A;  3LGJ A;  4GNX B;  2MO1 A;  2N8N A;  3S1R H;  4JI2 L;  4FDB A;  4B3R Q;  3G6E A;  4POG A;  3T1H L;  4DK3 C;  4LFB Q;  4R4C A;  4LF5 Q;  4OWT B;  1KD1 C;  3KF8 B;  2K5H A;  3I7F A;  3NBH B;  2D62 A;  4APV A;  2ZJR A;  3CCE A;  3GTQ H;  2E5L L;  2AWN A;  4DK6 C;  1X55 A;  4BXX G;  4DUY Q;  4X65 Q;  2WP8 J;  3I4N G;  3A74 A;  1NBW A;  1WJJ A;  5GAE C;  1N8R C;  3S17 H;  3J80 c;  4MZ9 A;  1E7Z A;  1A8V A;  2A19 A;  2GVA A;  2B29 A;  4A3L H;  1I94 L;  3CPW A;  5GAG C;  4LFC Q;  1E1T A;  1P16 A;  4DV2 Q;  2K4K A;  4JOI C;  1X65 A;  3FKI G;  5IYC G;  1I6H H;  1HJP A;  2VS1 A;  2XGT A;  5JEA G;  2E2I H;  1N33 L;  2JA7 G;  3HOW H;  5IP9 H;  4NXM Q;  4NB3 A;  3CXC A;  3S2H H;  1OXS C;  2UXB Q;  4BBS H;  2YTX A;  2JQO A;  3UE1 A;  2ZM6 L;  1IBK Q;  1EYG A;  1CUK A;  4LF8 L;  4A3G G;  3OYY A;  2VQF Q;  1YHA A;  2BA0 A;  3CCM A;  4B3S L;  4LWC A;  4JI1 Q;  2JA8 G;  3K7U C;  5E7N A;  1L0W A;  4BBR H;  4A3F G;  2E2J H;  4DV7 Q;  3HKZ G;  5JEA J;  2I5H A;  4WJ3 M;  4YWK A;  1YJN A;  1XNR Q;  4XTC S;  2PQA B;  1VQ6 A;  4A3D G;  4GOP C;  1Z9F A;  2JE6 I;  4UP8 A;  4HJ9 A;  3GTL H;  3H0G H;  4GLX A;  3UDI A;  1O7I A;  2Z6K C;  1PH2 A;  2JA5 H;  3SGI A;  1DGS A;  5M3M G;  1NJI C;  3AQQ A;  1KC8 C;  1JB7 A;  4DV6 Q;  3KF6 B;  1S72 A;  1S40 A;  4L5S A;  1E22 A;  1BBU A;  2AMC B;  2WAQ G;  1SR3 A;  3RZD H;  1IBM L;  4K0K Q;  3BZK A;  2VUM H;  1VQK A;  3L0O A;  1VQI A;  1AH9 A;  4NXN Q;  1EIY B;  2F4V Q;  2UUB Q;  5IWA Q;  4JI4 L;  4YCV A;  4DR5 Q;  2OTL A;  2Z0S A;  4DAM A;  1HNZ Q;  4JI3 Q;  5JJK A;  4R1J A;  3DM3 A;  4A76 A;  2KHI A;  4YCU A;  2UUA Q;  1QUQ B;  1HZB A;  4DR1 Q;  2NZO A;  4JI6 L;  4DPG A;  2WB1 G;  2F3I A;  4JOI A;  3RN5 A;  3GTM H;  4LF7 Q;  2RHQ B;  1BKB A;  3BZC A;  3K80 C;  4DV5 L;  1PYS B;  2ALY B;  3RLN A;  4YY3 L;  1ASZ A;  3I2Z A;  2E2H H;  1Q86 C;  1OXV A;  1GM5 A;  4A3L G;  1HR0 L;  1KXL A;  1TXY A;  2EXD A;  2D0O A;  1EIF A;  3PUZ A;  1M90 C;  3RZO H;  1WOC A;  2VQE Q;  3W5O A;  1B7Y B;  4GN3 B;  1OTC A;  4Y7N H;  1CKM A;  2LXJ A;  2WAQ E;  1I3Q H;  4LUV A;  3TRE A;  3U4V A;  4A3E H;  1C0A A;  4DV4 L;  5JJI A;  1FL0 A;  4Y52 H;  4HIO A;  5J3B A;  5IP9 G;  3L2P A;  4IOC A;  4JI0 Q;  4HJ7 A;  4BBS G;  1K8G A;  3K8A A;  4IFD G;  1IXR A;  1YZ6 A;  4LW1 A;  1XPU A;  1CKN A;  1V43 A;  4DUZ L;  4GOP A;  1JJC B;  3JAM c;  2L15 A;  4R4T A;  5M5Y H;  5LMU L;  4OO1 I;  2Z6K A;  3PO3 H;  4AYB G;  4DR2 L;  4BBR G;  2WB1 E;  4DV0 Q;  1KIX A;  4A75 A;  2K5V A;  3NEN A;  5JJL A;  1XMO Q;  1NTG A;  4QQB X;  1IYJ B;  3KOJ A;  4KHP Q;  1LM0 A;  3M9B A;  1K73 C;  1VQL A;  4PZ7 A;  3GTP H;  2CWA A;  4DR4 L;  1FJG Q;  3E0E A;  4JYA L;  1K83 H;  2RHS B;  1PA6 A;  3GTO H;  4IFD J;  2YYZ A;  3H0G G;  3G4S A;  4LFA Q;  3CCU A;  1GKH A;  5IP7 H;  2JA5 G;  2Q2T A;  1EQQ A;  1WYD A;  4GN4 B;  3HKS A;  4P75 A;  4OO1 G;  1VQA A;  4OON A;  5DLQ E;  3G71 A;  1R9T H;  2CFM A;  3KDF B;  3PV0 A;  3S1M H;  3TS2 A;  4O0A A;  2VY3 A;  4QIW E;  4JI8 Q;  1VQ7 A;  4JBW A;  4X62 Q;  1VQF A;  2K75 A;  3CCJ A;  2VUM G;  3CW2 C;  4YHH L;  2ID0 A;  4X64 Q;  1N32 Q;  1UE5 A;  2ZTE A;  4A3K H;  1VQD A;  1VQ9 A;  2HHH Q;  1HZA A;  4JI7 L;  3D31 A;  1N34 Q;  2E8G A;  4MNO A;  2AHO B;  4DV1 Q;  1EOV A;  3ULL A;  1V1Q A;  1LTL A;  4AYB E;  2NVT H;  1X9N A;  2MO0 A;  1PH3 A;  3S14 H;  3K0X A;  1SLJ A;  2Q2H A;  4GN5 A;  3CP0 A;  2ES2 A;  5GRO A;  2IT1 A;  3F8T A;  1N36 L;  4DR7 L;  1Q82 C;  1CKO A;  5EAY A;  4EX5 A;  4DV3 Q;  1GO3 E;  3BJU A;  4P71 A;  2UU9 L;  4IOA A;  4GKJ L;  2I5L X;  4LF9 Q;  2UXD Q;  1GVP A;  2IHE A;  2FXQ A;  3ER0 A;  3UDF A;  4C3H H;  1YHQ A;  4BY7 H;  1BBW A;  2AWO A;  3CQZ H;  4H02 A;  4NPS A;  3PSI A;  1OXT A;  2V1C C;  4IO9 A;  1VQ8 A;  3TRZ A;  4ALP A;  1XMQ Q;  3CC4 A;  1QZG A;  1PHJ A;  4A4I A;  3JC6 6;  3T1Y L;  4A93 H;  1LUZ A;  4JI2 Q;  2Q2I A;  2A1A A;  1PVO A;  3NEL A;  2Y0S G;  2LSS A;  3OTO L;  3FP9 A;  3M4Q A;  3T1H Q;  1VQ4 A;  1YI2 A;  1EQR A;  2N49 A;  4P73 A;  3J81 i;  3PO3 G;  4UY8 C;  3CC7 A;  1EFW A;  4AH6 A;  2E5L Q;  1SN8 A;  1XNQ L;  1HR0 W;  3GO5 A;  5IT9 c;  1IBL L;  3I55 A;  3TQY A;  3PO2 H;  2WFW A;  1YIJ A;  1L1O A;  3PIP A;  1JMC A;  3HOY H;  1Q81 C;  1GD7 A;  4R4Q A;  4L5R C;  4LF4 L;  1M1K C;  1Y1V H;  3U4Z A;  4KI0 A;  1EWI A;  5IP7 G;  5C0X I;  2DGY A;  3M85 A;  1B70 B;  1I94 Q;  1NMG A;  4JBK A;  4OX9 L;  1Q1E A;  1D7Q A;  4OXP A;  3HOX G;  5C44 G;  4B3T L;  3CD6 A;  5M5W H;  3J7Z C;  5IY0 A;  2GVB A;  1XPR A;  5IYB H;  2JK8 A;  1Q1B A;  4DR3 L;  3CPF A;  3A0J A;  5GAH C;  2K50 A;  3A5Z B;  4HJ5 A;  1N33 Q;  2HT1 A;  1WFQ A;  4A3K G;  2Y0S E;  5M5X H;  5AJ3 L;  3H3V H;  3HOU H;  4X66 L;  2ZM6 Q;  4LF8 Q;  1YJ9 A;  5C0X G;  3J7A 5;  3CCS A;  2EIF A;  4B3S Q;  1X3G A;  2JEA I;  2CCZ A;  4LF6 L;  3CME A;  1MJE A;  1HNW L;  1SE8 A;  3CAM A;  1TWC H;  2R7F A;  2GN5 A;  3I4M H;  1I50 H;  3AFQ A;  1B8A A;  2PI2 E;  3CCV A;  3KYH C;  2R93 H;  4J15 A;  3ICE A;  2KHJ A;  5BR8 L;  1D8L A;  3S24 A;  1HZC A;  5C0X J;  1NE3 A;  2HIX A;  3M3Y H;  4BY7 G;  3L7Z C;  3GTK H;  1YNX A;  1Y1W H;  1U5K A;  1N9W A;  3HKZ E;  4RG1 A;  3U58 A;  4IPH A;  4B3M L;  4P74 A;  4MTN A;  1VCI A;  2VL6 A;  1H95 A;  1G51 A;  5C3E H;  3D0F A;  3A5U A;  4GKK L;  1IBM Q;  4DR6 L;  1VQH A;  4IFD I;  3EIV A;  1VQE A;  1QVG A;  4A93 G;  3PGZ A;  3CCR A;  2B63 H;  2BH2 A;  4QL5 A;  2JA6 H;  3PF4 A;  1TWH H;  2CWP A;  4GNX C;  1A63 A;  1PH5 A;  4ME3 A;  4JI4 Q;  1K8A C;  4LUO A;  1JE5 A;  1YVC A;  1PH1 A;  1A0I A;  1X3E A;  4BY1 H;  1YBY A;  1QVF A;  2OQ0 A;  3PIO A;  4HID A;  4JI6 Q;  3HOW G;  3PO2 G;  2CQO A;  1E1O A;  3HOY G;  2OTJ A;  3KJP A;  4DV5 Q;  1X3F A;  1VS0 A;  2UXC L;  2B3G A;  3CCL A;  4YY3 Q;  3M4O H;  1Y1V G;  4UPA A;  3S1N H;  2C35 B;  1HR0 Q;  4IPC A;  4R4O A;  2KBN A;  4RMF A;  2OWO A;  4JV5 L;  2I5M X;  2IY5 B;  2YTY A;  2ZTD A;  1VQN A;  2BH8 A;  4UP7 A;  2UUC L;  4DKA C;  4DV4 Q;  4JI5 L;  3OW2 A;  3K7A H;  5FJ8 H;  4HIM A;  1T9H A;  3HOU G;  3ULJ A;  1G6P A;  5HGQ A;  1SRO A;  3RLF A;  3W1G A;  4DUZ Q;  5LMU Q;  4AQY L;  2PMZ E;  3J80 i;  1KL9 A;  3EBE A;  1AE3 A;  4TQU S;  5LMN L;  4DR2 Q;  3FHW A;  2ASB A;  1PFS A;  4A3I H;  4GLV B;  1NY4 A;  1CKN B;  4GOP B;  3I4M G;  4JYA Q;  2R7Z H;  3ZJY C;  4DR4 Q;  3ERS X;  4LUZ A;  1PH7 A;  2JJQ A;  4PZ6 A;  2QA4 A;  1J5E L;  1CSQ A;  2R93 G;  2JA9 A;  1SFO H;  3I56 A;  2LXK A;  3Q8D A;  2KCM A;  3S2D H;  1Z47 A;  2EQS A;  2ZJP A;  2NVX H;  1PV4 A;  1Y1W G;  1HNX L;  4POF A;  3PUX A;  1SRU A;  2OCE A;  3GD7 A;  4JBM A;  1NMF A;  5ELN A;  2VZA A;  3DLL A;  2MNA A;  3UE0 A;  3W1B A;  3J81 j;  2JA6 G;  1PH6 A;  2B63 G;  4YHH Q;  1Q12 A;  2BA1 A;  4B3R L;  1PH8 A;  1AE2 A;  5C4J H;  4L5Q A;  1YIT A;  4JI7 Q;  3CF5 A;  4LFB L;  4A3B H;  3E9H A;  5K36 G;  2A8V A;  4LF5 L;  3E9I A;  3M4P A;  4HJ8 A;  5C4X H;  4A3E G;  1L2F A;  1RIP A;  4BY1 G;  5FLM H;  1A62 A;  2AKW B;  2XTI A;  5IYD H;  4A3C H;  1VQC A;  3TEH B;  1X6O A;  4X65 L;  1UWV A;  4DUY L;  4A3M H;  1K9M C;  3S16 H;  1N36 Q;  4DR7 Q;  1KHI A;  3PCO B;  4KLK A;  3CMA A;  4PZ8 A;  1Q8K A;  1I5F A;  1KRT A;  3MXN B;  3F1Z A;  2UU9 Q;  4X6A H;  3CC2 A;  4JC0 A;  4GKJ Q;  4BA1 I;  4LFC L;  3PUV A;  4DV2 L;  3KFU A;  2HIV A;  4P72 A;  4A3J H;  1X54 A;  4HJA A;  1MKH A;  3KLW A;  4O2D A;  3MEF A;  4AIM A;  1XPO A;  3F2C A;  1U0L A;  3GDE A;  3ULP A;  3AEV A;  1G29 1;  4GLA C;  3RLO A;  2Q2U A;  3HOV H;  5FJ8 G;  3T1Y Q;  3STB D;  4NXM L;  4LNQ A;  2ATW A;  2UXB L;  4WJ4 A;  3EN2 A;  4TVA B;  5GQO A;  1IBK L;  3OTO Q;  2VNU D;  1Q7Y C;  2ZJQ A;  1HH2 P;  2PQA A;  2VQF L;  2RF4 A;  1TWG H;  4JI1 L;  3AYH B;  1RL2 A;  4DNI A;  3RR5 A;  1KAW A;  5GAD C;  1TWF H;  4DV7 L;  4A3I G;  1IBL Q;  1XNQ Q;  2N3S A;  2PNH A;  1MIU A;  3GTJ H;  3VDY A;  1XNR L;  4YCW A;  2IX1 A;  1J6Q A;  2R7Z G;  3KF6 A;  2K14 A;  2NVQ H;  1IZ6 A;  2NN6 I;  2R92 H;  3PUW A;  4LF4 Q;  1Q46 A;  2VW9 A;  4OX9 Q;  2HQL A;  3IRB A;  4XIG S;  1L1O B;  4B3T Q;  4IJL A;  4C2M H;  4DV6 L;  4QY7 A;  1LYL A;  3PF5 A;  3JAM i;  4DR3 Q;  1XTD A;  2PI2 A;  4K0K L;  2D0P A;  1E3P A;  4JG2 A;  1QUQ A;  2ZTC A;  4NXN L;  2R6G A;  5LMN W;  5AJ3 Q;  2UUB L;  2F4V L;  5IWA L;  2NN6 G;  4X66 Q;  4A3B G;  3HOZ H;  1UE6 A;  4DR5 L;  3RNU A;  4JI3 L;  3F2D A;  1HNZ L;  5C4X G;  4L5T A;  5FLM G;  2UUA L;  2DUD A;  1EUJ A;  4C3J H;  4DR1 L;  2MQH A;  1IL2 A;  5IYD G;  2MFI A;  4LF6 Q;  4A3C G;  1HNW Q;  1VQJ A;  4LF7 L;  4C3I H;  4A3M G;  2YU9 H;  4IPD A;  2JEB I; 
#chains in the Genus database with same CATH topology
 3ITP A;  1VQM A;  4RUA A;  3J81 c;  2JA7 B;  3RTX A;  3J80 E;  2XCA A;  4JCV E;  4EGQ A;  1FGU A;  5BR8 Q;  1SNP A;  2RDG A;  1WTW A;  3V6H A;  1RK5 A;  4DN4 M;  4A3J G;  4YR0 A;  4QB4 A;  4OWW B;  2N78 A;  1HTL D;  5KFV A;  1X56 A;  3SEB A;  2JA8 B;  2ICI A;  3J7A K;  4GKJ H;  3S15 H;  1K3R A;  5FO7 B;  5I9P A;  1VQG A;  3PMF A;  3HKZ B;  2XGQ A;  2ZXO A;  4FNF A;  3OUZ A;  2VUG A;  3CQZ A;  4G57 A;  3E0J A;  2RCF A;  3IFT A;  1SMX A;  4V19 0;  4F50 A;  1BGW A;  3PW5 A;  5CV5 A;  1XMO L;  2C28 A;  1Y8O B;  1FJG L;  2YRW A;  3I4N H;  2R7D A;  3KDF A;  1QVC A;  3GTG H;  3F2B A;  1M0W A;  2PMZ A;  4ID6 A;  1QZH A;  3GIP A;  4J9N A;  3PW4 A;  1PRT F;  3KJO A;  4IN3 A;  2K5D A;  1JOR A;  2I0Q A;  4ECW A;  3CRL C;  5NUC A;  1WD0 A;  4R8I A;  2NZH A;  3D4R A;  5IYC H;  3NE5 B;  1SNQ A;  5C4Z A;  1NAP A;  1UEB A;  4UP9 A;  4APM A;  3QZ7 A;  3NGD A;  5KNC A;  2RCN A;  2WB1 B;  3NEM A;  4X64 L;  2O03 A;  4KTA A;  3C46 A;  5EPK A;  5BN5 A;  1C4Q A;  1JT8 A;  3I72 A;  3LWB A;  2NBF A;  4QJF A;  1CSP A;  3RBD A;  2K5N A;  1UE7 A;  5I6W A;  3BG5 A;  3H0G A;  2KEE A;  3HOX H;  1WR2 A;  1TR5 A;  4C3I G;  5KFX A;  2B2V C;  3ETJ A;  2JEF A;  1PFM A;  1D5X C;  3AFP A;  4DV3 L;  3I4O A;  4O1N A;  1WCM G;  4CC5 A;  4KHZ A;  1ONL A;  3BVM A;  3UDG A;  3GQC A;  3J80 W;  4JBJ A;  2F0T A;  1KEE A;  4IRK A;  3G48 A;  2IP4 A;  4QGU A;  3LGJ A;  2ASJ A;  2MO1 A;  1FGB D;  4O4L F;  2QIL A;  2J6U A;  3N52 A;  1EQV A;  2FMM A;  3H0G B;  4DR6 H;  4IWY A;  2K5H A;  2JA5 B;  2D62 A;  5C8Y F;  2B63 A;  3GTQ H;  5DG7 A;  2AWN A;  3VR3 A;  1A6X A;  2XN9 C;  1G8Z D;  4BXX G;  1NBW A;  3RZD B;  3J80 c;  3SHL A;  4MZ9 A;  3JRW A;  1E7Z A;  1LAB A;  4KMU C;  3WOE A;  2B29 A;  1I94 L;  4LMY A;  1CQV A;  2AQ2 B;  3ZYY X;  3HEJ A;  1VDZ A;  3H4D A;  4EEQ A;  2K5W A;  2JA7 G;  1JB3 A;  2KHS A;  5IGF A;  2UXB Q;  2ZDG A;  4FF3 A;  2UUC H;  3K5N A;  3R23 A;  4JI5 H;  3OYY A;  4Q0Y A;  2VQF Q;  2JA8 G;  2DNC A;  1L0W A;  4BBR H;  2C2E A;  4DV7 Q;  1LT6 D;  2SNM A;  3HKZ G;  4Q0F A;  4RU9 A;  4O3N A;  3VA5 A;  4YWK A;  5D14 A;  4A3E B;  1YJN A;  4WJ3 M;  1R9T A;  2PQA B;  1GHK A;  2EVB A;  5CYU A;  4UP8 A;  2JE6 I;  4GOP C;  1HUM A;  4GLX A;  2EJF C;  2Z6K C;  1PH2 A;  1NR4 A;  3BAA A;  4YHH H;  1KJI A;  4XDX A;  2WYO A;  1BUV T;  1NJI C;  4UFZ A;  1VBH A;  2R7Z A;  3RF2 A;  1PFB A;  3PO3 B;  2BQR A;  2R8J A;  5D3I B;  1VQI A;  1V1P A;  2UUB Q;  1EYA A;  1RTN A;  2B2W C;  1GSO A;  5KEE A;  4DR5 Q;  4BWS C;  1HNZ Q;  1SDF A;  4R1J A;  2L11 A;  3LX0 A;  4A76 A;  5IOC A;  3A56 A;  1Y69 U;  1ULZ A;  1U9R A;  4DR1 Q;  4JI6 L;  2WB1 G;  2F3I A;  4JOI A;  1RF2 D;  1R9T B;  4LF7 Q;  2RHQ B;  1BKB A;  1G2T A;  1L2Z A;  2AGP A;  4F87 A;  1XWE A;  1CK1 A;  1Q86 C;  1GM5 A;  3KAK A;  2D2C C;  1RCV D;  2DZD A;  1HQM C;  1ZHS A;  2P0A A;  1DOK A;  1B7Y B;  4GN3 B;  1GXD C;  1A3T A;  1CKM A;  3S14 B;  3TRE A;  4LUV A;  1B4O A;  1C0A A;  3TDQ A;  2DPI A;  1SNM A;  2PBZ A;  3PZP A;  4JI0 Q;  1S9F A;  2GPW A;  4HJ7 A;  1FR3 A;  1XNQ H;  4IFD G;  3TP8 A;  4LW1 A;  5I4D A;  4OO1 I;  3VYS A;  3MJF A;  3GQB A;  2LMC B;  2TSS A;  5JJL A;  5KIX A;  4OX9 H;  4NP5 A;  1E4F T;  1IYJ B;  3R93 A;  1NUC A;  4JYA L;  3U9T A;  1ZKO A;  5KYI A;  3J81 L;  1K83 H;  3GTO H;  1TWG A;  5E4W C;  2R8G A;  3H0G G;  4B9X A;  4LFA Q;  3CCU A;  1GKH A;  2JA5 G;  3HRZ C;  1EQQ A;  1B3Q A;  4P75 A;  1IL8 A;  1LV9 A;  2E75 C;  2CFM A;  3PV0 A;  1QB5 D;  4DLK A;  5KT4 A;  4CJ0 B;  1C30 A;  4QIW E;  1VQ7 A;  5J2U F;  1O75 A;  4JBW A;  2C00 A;  4MA0 A;  5EWG A;  5L1J A;  3RUZ A;  4YHH L;  3HOY B;  4C2M A;  4YP3 A;  2J9G A;  4J9O A;  1N34 Q;  4MNO A;  4NLG A;  4DV1 Q;  3ULL A;  1PRT C;  1V1Q A;  2NVT H;  2DIK A;  1I50 A;  4DAV A;  4UCS A;  2RDI A;  2W9A A;  1SLJ A;  2Q2H A;  4GN5 A;  3K5M A;  3D8G A;  2F0L A;  1B44 D;  1B53 A;  5IWA H;  2EYL A;  1Z2O X;  5BMV F;  3GTK A;  3L4K A;  2R86 A;  5FLX E;  1CHQ D;  3BQ0 A;  4B3M H;  1Q82 C;  1IOV A;  5KFU A;  2W6M A;  1QCB D;  4Q8F A;  2UXD Q;  1DIK A;  4LF9 Q;  3ER0 A;  2IHE A;  4FBT A;  2YU9 A;  3Q8P B;  1SMY D;  2IA6 A;  3CQZ H;  2AQ3 B;  2AQ1 B;  4IO9 A;  4ALP A;  5CBE E;  3A8K E;  3CC4 A;  1AUV A;  1STN A;  2V59 A;  2B2T A;  3KLR A;  3E5N A;  1FNW A;  2DY8 A;  2JYO A;  5BN4 A;  3OIP A;  4XQQ A;  1I50 B;  3T1H Q;  2R8I A;  2EJM A;  1WTH A;  3M4Q A;  3OWF A;  2BOS A;  5KG6 A;  2R93 B;  4ODG A;  1EQR A;  2QW7 A;  2B2U C;  3J81 i;  3PO3 G;  1OWT A;  4J1M A;  3GTK B;  2E5L Q;  1XNQ L;  3ETH A;  1LO5 D;  3GO5 A;  4ZUI A;  3TQY A;  3OW7 A;  4JV5 H;  1B6S A;  2WFW A;  1ESF A;  3PIP A;  3MWE A;  1Q81 C;  5C3E B;  4RGN A;  1WTO A;  3N6X A;  3NHH A;  3F8N A;  4OX9 L;  5D3D A;  1NMG A;  1MSG A;  2KEC A;  3T5J A;  4J9L A;  5L1I A;  4OXP A;  3H09 A;  5C44 G;  3CD6 A;  4JK1 C;  5IY0 A;  1H9M A;  4HN7 A;  4NMZ A;  4I7Z C;  1Q1B A;  3GID A;  2K50 A;  4RHR A;  1N33 Q;  1WFQ A;  3G6V A;  3MXP A;  1VAJ A;  5JPN C;  3UI2 A;  2L1B A;  4LF8 Q;  5C5M A;  3PVX A;  1Q8I A;  4DU9 A;  3S1N B;  1H9J A;  5KFY A;  2V5A A;  2XC9 A;  4ECX A;  1GLV A;  1RK6 A;  2MGS A;  3VMM A;  4B3S Q;  1J5E H;  5KFZ A;  3NTH A;  2RVL A;  1LT3 D;  1X3G A;  2JEA I;  2NTT A;  5H80 A;  4TQS A;  2HJW A;  1HNX H;  2R7F A;  4PDB A;  4ZK9 B;  3LP8 A;  4ZKC B;  3A7L A;  5T14 A;  3J80 L;  4TKO B;  5M9O A;  5JVH 3;  1D8L A;  1HZC A;  4WRD A;  1SMY C;  3M3Y H;  2FPI B;  4B3R H;  3A8J E;  1VF5 C;  4KKU A;  4B3M L;  3EQL C;  5DLF A;  1H95 A;  1B6R A;  4LF5 H;  4C5A A;  3TP5 A;  3A5U A;  4IFD I;  1ENC A;  1QVG A;  3TII A;  2V9W A;  3PF4 A;  2B63 H;  1A63 A;  4JV0 A;  3K3P A;  5FD5 A;  3RD4 A;  4R7R A;  1U4P A;  2XNA C;  3R2I A;  1EU3 A;  2CW7 A;  1BR9 A;  3T16 A;  1PH1 A;  1A0I A;  3Q6S A;  4GC6 A;  1QVF A;  1ICF B;  3HOY G;  1F9S A;  3KJP A;  2BDN A;  2ICE C;  4ED8 A;  1X3F A;  1VS0 A;  3IL8 A;  2B2Y C;  4UPA A;  1HR0 Q;  4ECZ A;  3GIJ A;  4JV5 L;  4C5C A;  2KQ3 A;  4RFB A;  1IBK H;  3ND9 A;  3Q1K A;  2BDO A;  2FB9 A;  3OW2 A;  5DEH A;  1LLR D;  4MV9 A;  1STH A;  3ULJ A;  3RLF A;  1YNJ D;  5KFG A;  3BJY A;  4EVO A;  1XNR H;  5LMU Q;  2LS0 1;  3J80 i;  2E2I A;  3BQ1 A;  5DG8 A;  1S5F D;  1EIH A;  5LMN L;  4FBU A;  1EFI D;  3KUP A;  1M8A A;  4CGY B;  4DL6 A;  4I7A A;  2R7Z H;  3ZJY C;  1C3O A;  3MFG A;  3P20 A;  4PZ6 A;  2QA4 A;  1J5E L;  2R93 G;  4FYD A;  1SFO H;  5G3L D;  4RAZ A;  4I55 F;  4AYB A;  4K0K H;  4IR9 A;  1I7L A;  2ZJP A;  1HNX L;  4RGT A;  1PYW D;  4JUZ A;  3PUX A;  1CI3 M;  2F4V H;  2OCE A;  3GD7 A;  3CHB D;  4JBM A;  2VZA A;  1RKN A;  3UE0 A;  3W1B A;  1TWF B;  3SVM A;  5KFL A;  1RTO A;  4B3R L;  3GTJ B;  1B50 A;  2PCF B;  1N56 A;  4XYQ A;  2NVQ B;  4HNV A;  2NN6 H;  5IOD A;  2N55 A;  4A3B H;  5K36 G;  4LF5 L;  3E9I A;  1EHI A;  3M4P A;  3N42 B;  1VKZ A;  4MV7 A;  4DXG A;  4ZKB B;  3R8B A;  1A62 A;  2AKW B;  4ZOL F;  4A3C H;  1D5Z C;  1GSH A;  2R7N A;  1UWV A;  3S16 H;  2A5H A;  1GHJ A;  3F1Z A;  3C3L A;  2SNS A;  3PUV A;  3RB6 A;  5IGC A;  4P72 A;  3HGB A;  1X54 A;  3JAM E;  3D3R A;  2HVS A;  1U0L A;  4CBV A;  4C3J B;  1HRJ A;  1E4E A;  1KLG D;  3HOV H;  3TIN A;  3T1Y Q;  3TBI B;  1ICW A;  4WFN 3;  4DV0 H;  4TVA B;  1YNJ C;  2JP1 A;  1T36 A;  4JPB W;  1IBK L;  3OTO Q;  3KHL A;  3VPC A;  2VNU D;  5DQG A;  1HH2 P;  3KBG A;  1TWG H;  3RR5 A;  1YNN D;  4NKL A;  2R82 A;  3RB0 A;  4HMI A;  2Y0S A;  1QNU A;  1XNR L;  3S15 B;  4R8U A;  2NN6 I;  1ILP A;  4DR2 H;  2C22 A;  4LF4 Q;  4X62 H;  4YAK B;  2R8K A;  4UHV A;  4CKE A;  1DON A;  1KNE A;  2HQL A;  1N32 H;  4ED6 A;  4C5B A;  4B3T Q;  4C2M H;  2HHH H;  1E4E B;  4O3S A;  1LYL A;  3SK8 A;  4DR3 Q;  4PV1 C;  4K0K L;  2D0P A;  3VYR A;  1D2B A;  4JG2 A;  3Q23 A;  1QUQ A;  3NTI A;  2X6G A;  1RD9 D;  2F4V L;  3I3C A;  4CDC C;  2F0O A;  3K59 A;  3I4N B;  4X66 Q;  3GTG B;  2XIG A;  3C0F B;  1DXM A;  4JI3 L;  3I91 A;  2F0E A;  3BA8 A;  3MEH A;  2Y0S B;  4M9U A;  1HNW Q;  1VQJ A;  3VR2 A;  4R8U B;  2YU9 H;  1CTM A;  4IPD A;  2NB0 A;  4RGO S;  5J22 A;  4EQ5 A;  5KX5 F;  4B9W A;  2L4N A;  2A6E D;  2XD4 A;  1QE6 A;  4QUF A;  1V4Y A;  1S3O A;  2W6O A;  4QW8 A;  2K52 A;  5KFI A;  5L1K A;  1N36 H;  3H3V C;  2Z6B A;  2F0U A;  1C8C A;  4LAA A;  3G6J B;  5BPH A;  4MV1 A;  2W6Q A;  2W9C B;  3DEP A;  3H3V I;  4GKK Q;  3HOX B;  2YCH A;  3SE7 A;  1F2M A;  2W7O A;  3OOC A;  2QEX A;  1Z2P X;  2GA4 B;  4MA5 A;  3GTQ A;  1S5D D;  5ELE A;  5DQI A;  1KDC A;  1RJQ A;  2YV5 A;  4HR7 A;  1YNN C;  5KFH A;  3B6Y A;  3MWM A;  4DV0 L;  5BPF A;  5EBC A;  3N43 B;  1JJG A;  1HA6 A;  4J8Q A;  2F0H A;  5L9X A;  1K0R A;  5C5L A;  2L0C A;  2PN1 A;  2UXC Q;  2WAQ B;  4OWX B;  4CJ1 B;  5ELB A;  3KAJ A;  5ELO A;  1O7L A;  1OXU A;  2XWB B;  5T1I A;  1C7Y A;  3A7A B;  1JJ2 A;  3GTJ A;  1ASY A;  4RZR A;  2QDL A;  1SE2 A;  2QGQ A;  4X62 L;  3GTQ B;  4F4X A;  4K8J A;  5D8D A;  1JX4 A;  1EU4 A;  1N32 L;  1B3A A;  5EWF A;  2HHH L;  1G6Z A;  3W2D A;  4HNU A;  4ZHQ F;  2B39 A;  1C9O A;  1HUN A;  4AQY Q;  2W70 A;  2CW0 D;  4J6H A;  1EEI D;  2MJ8 A;  3H6M A;  4C3J G;  3FPU B;  3EYY A;  3KF8 A;  4XT3 B;  4A3F H;  1VQ5 A;  3KHR A;  3VPB A;  2FIN B;  4IPG A;  1LT4 D;  1Y14 B;  2FMC A;  2PNR C;  2F03 A;  1SEB D;  4A3D H;  3X3M A;  4E6I A;  1B04 A;  4RWS C;  5JH7 F;  1TS4 A;  4HIK A;  4PNY A;  4ZQ3 A;  4H13 C;  1K3B C;  1UE1 A;  4O42 A;  4JI4 H;  4DXF A;  1PH9 A;  1EUC B;  1XMQ L;  3UDX A;  1OXX K;  3K57 A;  4BBR B;  1EZ6 A;  5CV6 A;  1LTI D;  4ZI7 F;  3PN1 A;  1K28 A;  2N8N A;  3M9N B;  4JI2 L;  4FDB A;  1Y1W A;  3WOF A;  3QFF A;  4DK3 C;  4DV5 H;  3SXH A;  5KFD A;  3SDZ A;  2RDH A;  3KF8 B;  4APV A;  2SEB D;  2N88 A;  2JA6 A;  4S3S A;  2KED A;  5A35 A;  1TWH A;  4DK6 C;  2F0F A;  1DV1 A;  4UCT A;  4X65 Q;  3H20 A;  5KFJ A;  1CA6 A;  2CVR A;  3I4N G;  3A74 A;  1N8R C;  4WD3 A;  1WD1 A;  3IN5 A;  2A19 A;  2VOB A;  2CQA A;  3F2U A;  3OSO A;  1D1I A;  3SI8 A;  1T5X D;  4KD4 A;  5CV8 A;  4DV2 Q;  1EY4 A;  2HGS A;  3OHX C;  5IYC G;  1I6H H;  2UVR A;  2XGT A;  1S97 A;  2PW7 A;  1KTK A;  2E2I H;  2F0M A;  3HOW H;  2SCU B;  5IP9 H;  4NXM Q;  4NB3 A;  1ZQ7 A;  4BBS H;  2YTX A;  4M8A A;  3UE1 A;  1UUP A;  2ZM6 L;  2I87 A;  3V6K A;  2CW0 C;  4DR4 H;  4HCS A;  3DF7 A;  2EPB A;  5JVG 3;  3M7G A;  4LWC A;  3K7U C;  2UVW A;  2JEG A;  3E6Z X;  4TQR A;  2I5H A;  1M7J A;  3NPP A;  4PMB A;  2A6H D;  4XTC S;  5C6A A;  4OEM B;  2VA2 A;  2D5D A;  1O7Z A;  2KCC A;  1K8M A;  3SGI A;  1DGS A;  5L37 A;  4HSP A;  4RNO A;  4C56 C;  3TZD A;  4DV6 Q;  3KF6 B;  4JI7 H;  1AZQ A;  2YZM A;  4IRC A;  1K8O A;  2AMC B;  4QWA A;  2WAQ G;  1IBM L;  2BE5 C;  2O4X A;  3TIG A;  5LA6 F;  1VQK A;  1KJQ A;  5GON F;  4DK0 A;  4JI4 L;  2F0K A;  4JVZ A;  1K83 B;  3GTO B;  5ELF A;  1SYX B;  5D1P A;  1SJE D;  3RGZ A;  2A68 C;  3DM3 A;  2KHI A;  3QJY A;  5KT2 A;  1LAC A;  4G7H C;  2UUA Q;  2UU9 H;  4DPG A;  1I6U A;  5IT9 E;  3K80 C;  4DV5 L;  4NDX A;  3K5H A;  1GUS A;  1WTP A;  3DUZ A;  5IYZ F;  1S4Z A;  2RSN A;  4MTD A;  1KXL A;  4HED A;  4RNM A;  3RZO H;  1L0Y B;  1M90 C;  3W5O A;  2CW8 A;  5KT6 A;  1O7Y A;  2NVT B;  2LXJ A;  1UC9 A;  5JJI A;  4HIO A;  3DWP A;  4HTH A;  5J3B A;  4MV4 A;  3JRX A;  1F2L A;  1K1Q A;  1IBL H;  3K8A A;  3IKJ A;  1CKN A;  1V43 A;  4DUZ L;  2ZXP A;  5M5Y H;  1WTX A;  4M7E A;  1QIL A;  2RQX A;  2F0I A;  4BBR G;  2WB1 E;  4IUU A;  3CQZ B;  4KD3 A;  2A6H C;  5T1G A;  1U4L A;  1XMO Q;  4QQB X;  2F0P A;  3GTP H;  1Q3L A;  4DR4 L;  1FJG Q;  2VQF H;  1AUX A;  4IFD J;  1ML0 D;  2EYH A;  5C1O A;  2VXW A;  2VB2 X;  5IP7 H;  2Q8R E;  2Q2T A;  3URY A;  4OO1 G;  1SYC A;  3BYY B;  4OON A;  2VPS A;  3KDF B;  1S5B D;  4LMQ D;  4XYO A;  5JVD F;  1TII D;  2R92 A;  2PMZ B;  2K75 A;  4OGQ C;  1F77 A;  4ZUJ A;  4Q44 A;  3CW2 C;  2ID0 A;  2E74 C;  4X64 Q;  1UE5 A;  3L9A X;  1UNS A;  3OHA A;  4JI7 L;  3D31 A;  4O3O A;  1JE4 A;  5C0X H;  5HGT A;  4KY6 A;  1W93 A;  1GSA A;  1PH3 A;  4IZO A;  4ECS A;  1PZK D;  3MXN A;  3LNN A;  4V0B A;  3VYU A;  3TZU A;  2WE6 A;  1KBL A;  3QG1 A;  5EAY A;  4DV3 Q;  5IT9 W;  1ZEQ X;  4DR1 H;  2FK3 A;  1IHZ A;  3BJU A;  4P71 A;  2UU9 L;  4IOA A;  4GKJ L;  2I5L X;  4LF7 H;  4BY7 H;  1TA8 A;  1TS3 A;  1BBW A;  1XTC D;  4H02 A;  4NPS A;  2XRQ D;  1OXT A;  2V1C C;  1PLF A;  3TRZ A;  2CH4 W;  1JOQ A;  5CB4 F;  3JC6 6;  5A2Q E;  1LUZ A;  2WV6 D;  5FO8 B;  2A1A A;  1PVO A;  3NEL A;  2LSS A;  5KFA A;  1NSN S;  2N49 A;  5C4H A;  4G7O C;  3M3Y B;  1KDA A;  4UY8 C;  4O3P A;  5ELD A;  2NVY A;  3HBL A;  1HR0 W;  5IT9 c;  1IBL L;  3FMC A;  3PO2 H;  1JWU D;  1IKL A;  5JOB A;  1BO0 A;  1LTS D;  4R4Q A;  2GPS A;  4L5R C;  3UFX B;  1M1K C;  2B63 B;  5C0X I;  4F4Z A;  3M85 A;  4RKB A;  1B70 B;  1ZYR D;  4WOR A;  1I94 Q;  3RFC A;  3R5F A;  2GVB A;  2JK8 A;  1IYV A;  1BNZ A;  3HS0 C;  5IGG A;  2RDJ A;  1T3N A;  4DL5 A;  1YJ9 A;  1ZHQ A;  5BN3 A;  4EEY A;  1ENA A;  2R8H A;  5DM7 3;  1U4M A;  1SFO A;  1STY A;  4PQX A;  2ASL A;  1MJE A;  3CAM A;  2VR1 A;  2M05 A;  2IL8 A;  3I4M H;  3HXL A;  5KG0 A;  1B8A A;  1F9R A;  3KYH C;  2R7K A;  2OT2 A;  3S24 A;  2JEI A;  1FNU A;  1NE3 A;  1PK8 A;  3L7Z C;  2G9H D;  1EIG A;  3BA9 A;  5KNB A;  4J0M A;  1Y1W H;  4KJN A;  1N9W A;  4P74 A;  4LFB H;  5F9N A;  1VCI A;  2SDF A;  1G51 A;  4MIU A;  2UXD H;  2EE1 A;  4LF9 H;  4DR6 L;  4ECU A;  3EIV A;  1VQE A;  4EGJ A;  3PGZ A;  2JA6 H;  2BH2 A;  3RB3 A;  4QL5 A;  2AU0 A;  1TWH H;  5EZY F;  2R7Z B;  1MSH A;  4DUY H;  2FPP B;  2J4X A;  1SFO B;  1LTA D;  4G3I A;  4LUO A;  1TS2 A;  5EQ0 A;  1YVC A;  3OSN A;  4BY1 H;  1YBY A;  1V1P B;  4JI6 Q;  2W8L A;  3T1H H;  4OIK A;  2CQO A;  4LFC H;  2OTJ A;  1EL0 A;  2B3G A;  3M4O H;  3V6J A;  4F7X A;  2C35 B;  1H9S A;  5CBA E;  2NUC A;  4IPC A;  2CQY A;  2UVV A;  1MGS A;  4OHJ A;  4A3B B;  1KJJ A;  2YTY A;  4YAJ B;  4QUC A;  2BH8 A;  1VQN A;  2FKL A;  3T5H A;  1RDP D;  2UUC L;  4JI5 L;  3TP6 A;  4JI1 H;  4ILW A;  4QWE A;  1TU2 B;  5C1P A;  3S16 B;  3HP3 A;  5HGQ A;  5FD6 A;  3ORR A;  3WO0 A;  4KK7 A;  4QIW A;  2HDM A;  2IJ0 A;  1AE3 A;  3FHW A;  4L1K A;  3GIK A;  4LF8 H;  1V8Q A;  2G5D A;  3V4Z A;  4JYA Q;  5EOY A;  1H9S B;  3M4Y A;  1PH7 A;  3HOV B;  4XQN A;  4X3U A;  5CMD A;  5CV9 A;  3Q8D A;  3S2D H;  5FPO A;  3I70 A;  1CZG A;  4NXN H;  4POF A;  3N40 P;  1SRU A;  5ELN A;  4N8F A;  3M9M B;  1TWG B;  1NNX A;  4EQO A;  3K3V A;  4LSA A;  3GTL A;  2MNA A;  2EDG A;  3TQT A;  2B63 G;  4YHH Q;  2BA1 A;  4DGZ A;  1AE2 A;  4QIW B;  1E2W A;  5C4J H;  4LFB L;  3CF5 A;  5KFF A;  2ZDH A;  3E9H A;  5KRU A;  5EJW A;  3L3O C;  1EUD B;  5KFC A;  3R5H A;  1EY7 A;  5C4X H;  4A3E G;  4IUR A;  5FLM H;  2XSC A;  4C1N K;  2KOL A;  4C2M B;  5G3L F;  4KV6 A;  1PTO D;  4DUY L;  2VQE H;  1X6O A;  4A3M H;  1M0T A;  3QOL A;  3PCO B;  1B1Z A;  1Q8K A;  3GTM A;  4JC0 A;  4LFC L;  3K58 A;  3NQI A;  2HIV A;  2L55 A;  5EPJ A;  4AIM A;  1XPO A;  2E2H A;  1HR0 H;  3F2C A;  1WSC A;  3VR6 A;  4J9M A;  1G29 1;  4HSV A;  2NYZ D;  2YU9 B;  3ORQ A;  1PTO H;  5GQO A;  4G7Z C;  2C2D A;  4KHP H;  4DK1 A;  1I3Q A;  2RF4 A;  1X3P A;  4JI1 L;  1XDN A;  1WVL A;  1S0O A;  4A2B A;  5LL6 b;  3Q8S B;  1KAW A;  1XNQ Q;  3I4L A;  5CC4 A;  2XWJ B;  4I4T F;  2PNH A;  4BS9 A;  1KLU D;  2R7Z G;  4HNT A;  2IPK D;  2BQ3 A;  1VBG A;  3MAQ A;  4JI8 H;  2R92 H;  2G9D A;  1B9N A;  4MV3 A;  2J6S A;  4OX9 Q;  2H1E A;  3IRB A;  4KN7 C;  1J9O A;  2K32 A;  4DAY A;  1I7N A;  1JWM D;  3OMG A;  2NZ1 D;  2BQU A;  1RJP A;  3NUC A;  1E3P A;  5FLX W;  2ZTC A;  3KBX A;  2PZT A;  4NXN L;  5IWA L;  2NN6 G;  4XQJ A;  1R4Q B;  3HOZ H;  2L5T A;  1UE6 A;  4A3B G;  3F2D A;  1X32 A;  4RCO A;  4L5T A;  5FKA C;  2DUD A;  1EUJ A;  4FF4 A;  4A3C G;  2MUY A;  3IAY A;  3PR5 B;  1HZ9 A;  2Z4H A;  5M3F H;  1KQS A;  4DL4 A;  3K5I A;  4DAY B;  1CS0 A;  3M7N A;  1PH4 A;  4KHV A;  5LOV F;  2WKC A;  2VQE L;  1LTB D;  2QEJ C;  4MV8 A;  1WI5 A;  2IHF A;  3TS0 A;  4B3M Q;  3QZ8 A;  3CCQ A;  5FLX c;  1FVI A;  2YRX A;  4Y8V B;  3HOV G;  1HHV A;  1S03 G;  1PDQ A;  1Y8P B;  4K5W A;  1BCP B;  4A3F B;  2YYA A;  2NVY H;  1HQR D;  4YR3 A;  2ZDQ A;  3MR2 A;  3FRP B;  1JIC A;  1XJV A;  4A3D B;  3PUY A;  1UEA B;  2ENB A;  5IYB G;  2FE3 A;  4X3T A;  2E76 C;  5DNF A;  1FKA H;  1S0M A;  3S1Q H;  3N6R A;  2WIN B;  4KHP L;  1AEX A;  1UAP A;  4ZAI A;  5KFW A;  2QK4 A;  4MTE A;  4IUV A;  2VPQ A;  2K28 A;  2H5X A;  1RJR A;  1I4P A;  5KT3 A;  4P2C B;  1YHB A;  2YTV A;  4GS3 A;  2OQK A;  4KJO A;  4R4I A;  4YWM A;  3WWV A;  4B08 A;  4EGV A;  4BA2 I;  5HY6 A;  4JV5 Q;  1SXT A;  2KEN A;  3FKI H;  4RGM A;  4JI8 L;  5KFE A;  4LF4 H;  4ECV A;  1Y1V A;  2W57 A;  1K1S A;  2R85 A;  2YS6 A;  1L0X B;  1VQO A;  4RUC A;  3RV3 A;  2ZXR A;  1V9P A;  2NU9 B;  4B3T H;  2DNE A;  1YEZ A;  2KCT A;  5DAU A;  4E4T A;  5E4X A;  4GNX A;  5FO9 B;  1AP0 A;  3MZ5 A;  4DL2 A;  4A3G H;  1BBX C;  2F0Q A;  3MHB A;  5KFP A;  5H1S E;  5C3E G;  1B9M A;  1STA A;  3MXG A;  5LMN Q;  2EXZ A;  4M1U B;  5C44 H;  1SYD A;  2EY1 A;  3NBH A;  1I6H B;  2HUG A;  2X6L A;  3K81 C;  4MHE A;  2E2I B;  3U50 C;  3HOW B;  2R6F A;  1J5E Q;  1PYB A;  2J0T D;  1HNW H;  1P8L A;  4BBS B;  4UCV A;  3BU2 A;  5M3M H;  1HNX Q;  3H94 A;  2W71 A;  1V1O A;  2D9U A;  2KJX A;  5L1L A;  2PZU A;  3CU7 A;  2CKZ B;  3GLK A;  4AYB B;  3RJ0 A;  1D6E C;  2FFK B;  3VPD A;  4GNX B;  5JVL A;  3GIQ A;  1KC7 A;  3S1R H;  4B3R Q;  3JSL A;  3G6E A;  4YIJ A;  1GUT A;  4FXG C;  1PXU A;  4LF5 Q;  4OWT B;  1KD1 C;  4YY3 H;  3I7F A;  3NBH B;  2ZJR A;  3CCE A;  4IWX A;  3W3A A;  2LFN A;  4YQW A;  1AZP A;  1TAE A;  1X55 A;  3MR6 A;  3FDS A;  1GUG A;  3S17 H;  5GAE C;  3Q8Q B;  1HCZ A;  2XVS A;  2EY2 A;  2AUK A;  4DV4 H;  1A8V A;  5EGT A;  2GVA A;  1SAP A;  2KA7 A;  4A3L H;  3K5O A;  1P16 A;  1U4R A;  1Y8N B;  3J7A F;  2QDB A;  2K4K A;  4JOI C;  1X65 A;  4N9T A;  4ZLT F;  3C1F A;  5EBD A;  5I2Y A;  1SSO A;  3WDN A;  5JEA G;  3CKI B;  2J6T A;  1EWH A;  3CXC A;  4FF1 A;  1JXL A;  3X3N A;  3S2H H;  3DHQ A;  4TRD A;  2JQO A;  2AQ4 A;  1IBK Q;  1EYG A;  3OWE B;  1DYQ A;  1R4P B;  3IFD A;  3GTP A;  1HFN A;  1YHA A;  2BA0 A;  3AB9 A;  5K5P A;  5E7N A;  4ZYS A;  3RZO B;  2E2J H;  4A3F G;  3RGX A;  1XNR Q;  5CR3 A;  5HUR A;  1VQ6 A;  4A3D G;  3QOJ A;  3SR1 A;  1Z9F A;  5JAV A;  4HJ9 A;  3GTL H;  1T5E A;  2W6P A;  1BOS A;  3TN2 A;  1O7I A;  4DL7 A;  4IUT A;  5M5Y B;  1S72 A;  2HVQ A;  1S40 A;  4L5S A;  4WJW A;  1BBU A;  4Z9C B;  5DQH A;  1SR3 A;  2FJZ A;  4K0K Q;  2K5Q A;  5TSS A;  3BZK A;  2VUM H;  2IMW P;  5I2X A;  3L0O A;  3GTP B;  1AH9 A;  2F0W A;  1EIY B;  1F9P A;  2F4V Q;  3GV8 B;  4ED7 A;  2O2L D;  2V4Q A;  2OTL A;  2Z0S A;  1TQO A;  4DAM A;  4JI3 Q;  1TVX A;  4DR7 H;  2WKD A;  3I12 A;  1STB A;  1QUQ B;  1HZB A;  2RA4 A;  2NZO A;  3GTM H;  3JAM W;  3NP8 A;  4K5V A;  4RB3 C;  2F4I A;  3UQ8 A;  3BAB A;  1PYS B;  2ALY B;  3RLN A;  4YY3 L;  1ASZ A;  2E2H H;  1HA5 A;  1JWS D;  2ASD A;  1TXY A;  3GIL A;  3S9W A;  2RKS A;  4DFA A;  4X65 H;  1HFG A;  3PUZ A;  4ME6 A;  1JR0 D;  4DNT B;  2Z9H A;  4Y7N H;  2FK2 A;  5IIF A;  2WAQ E;  1I3Q H;  3U4V A;  3V2T A;  1QNK A;  3A8I E;  4DV4 L;  2VQD A;  2RBM A;  3P7J A;  3GV7 B;  5IP9 G;  4BBS G;  1S5C D;  5KG4 A;  4IUP A;  1RYS A;  2V58 A;  1BF4 A;  1JDB B;  4GOP A;  4UCU A;  1BCP D;  3JAM c;  4HQ6 A;  2HD3 A;  2Z6K A;  4NXM H;  4AYB G;  4BY7 B;  4DR2 L;  2JSO A;  4DV0 Q;  4RB2 C;  4HCE A;  4A75 A;  2B2T C;  3ONA B;  2Z8L A;  3KOJ A;  3NWT A;  1K73 C;  1VQL A;  2CWA A;  3EFX D;  1BJT A;  3E3X A;  4HR7 B;  2RHS B;  1FNV A;  1SYF A;  4N8X 1;  2CZG A;  2YYZ A;  4OIJ A;  1TY0 A;  4O3Q A;  1WYD A;  2B2W A;  1VQA A;  3WNZ A;  4LSX A;  3GV3 A;  2JEJ A;  3D6W A;  3S1M H;  2DY7 A;  4O0A A;  5FLX L;  1JQY D;  1A3U A;  4X62 Q;  2A6E C;  2RSO A;  3PO2 B;  3O13 A;  1N32 Q;  3VR5 A;  4LF6 H;  4A3K H;  1VQD A;  1VQ9 A;  1QG7 A;  1HZA A;  2HHH Q;  2NU6 B;  3PW2 A;  2E8G A;  2L12 A;  3J81 E;  3VYT A;  3CVZ A;  2AHO B;  3N8D A;  1EOV A;  1LTL A;  3GP7 A;  1II3 A;  2MO0 A;  1X9N A;  2R87 A;  3K0X A;  5BR8 H;  1CA5 A;  3RB4 A;  5J2T F;  4ETS A;  1W6K A;  4LH7 A;  2IT1 A;  1N36 L;  4DR7 L;  4BWG B;  4EX5 A;  4GC7 A;  1D5M C;  1GO3 E;  2UUA H;  4ECT A;  4ABN A;  4C3H H;  1YHQ A;  2AWO A;  3QR8 A;  2DWC A;  4XT1 B;  2PQE A;  3NXW A;  5KG1 A;  3DWQ A;  1XMQ Q;  5KFT A;  1WCM A;  1QZG A;  3RBE A;  4A93 H;  1CQI B;  4MV6 A;  1EY6 A;  4JI2 Q;  3I4M B;  1BCP C;  4GZY C;  2Y0S G;  3TME A;  3FP9 A;  1YI2 A;  2W7P A;  3NWS A;  3OPO A;  4P73 A;  2YS7 A;  5KT7 A;  1EFW A;  1SN8 A;  1Y1W B;  3I55 A;  4XYM B;  2F3V A;  1YIJ A;  1L1O A;  2NWG A;  2X69 A;  1JMC A;  3BQ2 A;  2PW5 A;  1GD7 A;  1EYD A;  5E1F A;  4F4Y A;  2M00 A;  2JA6 B;  1Y1V H;  5IP7 G;  4KI0 A;  1EWI A;  1TWH B;  4OL7 A;  4JBK A;  1I4Q A;  4U67 3;  1Q1E A;  3D4D A;  4FS2 A;  4RH6 A;  3HOX G;  2O5I C;  2MCT A;  1TWA A;  2A73 B;  5M5W H;  1EY8 A;  1XPR A;  3E5S A;  3CPF A;  4K2L A;  3FDT A;  5GAH C;  4BY1 B;  3A5Z B;  4HJ5 A;  2HT1 A;  5KG5 A;  4UCO A;  4EQP A;  4PWQ A;  4UAI A;  2R61 A;  1A2U A;  1A3V A;  5AJ3 L;  5M5X H;  3HOU H;  2XCP A;  2ZM6 Q;  3M4O B;  1BQQ T;  5C0X G;  3CCS A;  3KTM A;  2JA7 A;  1QWY A;  4X64 H;  4YJ2 F;  2CCZ A;  4LF6 L;  4U7C A;  2OH2 A;  3G7L A;  4LK1 C;  4J9P A;  1SE8 A;  1TWC H;  2GN5 A;  2MP1 A;  1H9R A;  3R5X A;  2EY5 A;  2PI2 E;  3CCV A;  4EFB A;  2FPG B;  4J15 A;  3ICE A;  2WII B;  5BR8 L;  3OUU A;  2HIX A;  1DV2 A;  4BY7 G;  3HKZ E;  4RG1 A;  3RAX A;  4DV3 H;  4IPH A;  1IKM A;  5C3X A;  4MTN A;  2VL6 A;  4QWB A;  4KN4 C;  5CV7 A;  2KCN A;  1KAA A;  1VQH A;  1IBM Q;  3J7A V;  3CCR A;  4FS1 A;  3BZD B;  4GNX C;  2CH4 A;  4HYK A;  4JI4 Q;  1IYU A;  4J9K A;  1K8A C;  1JE5 A;  3S2D B;  1DOM A;  1X3E A;  2OQ0 A;  3PIO A;  4HID A;  4O2B F;  3PO2 G;  1E1O A;  4DV5 Q;  2B8G A;  5KYL A;  5AFW A;  3KK7 A;  2WB1 A;  4R4O A;  2KBN A;  4RMF A;  5C4J B;  2NTS A;  2OWO A;  4TSS A;  2PPB C;  2I5M X;  2IY5 B;  1UNN C;  2ZTD A;  2UXB H;  4L8J A;  5C4X B;  2EYP A;  2DPJ A;  5CV4 A;  1I94 H;  2XCL A;  3K7A H;  5FJ8 H;  5IGE A;  1T9H A;  4HIM A;  1DZ1 A;  4A3M B;  4DV7 H;  4DUZ Q;  2X0S A;  1TKW B;  5F2D A;  1LTR D;  2PMZ E;  1N48 A;  2EYF A;  4TQU S;  2JXM B;  3MR3 A;  2ASB A;  4A3I H;  4U6P A;  4GLV B;  4Q5V A;  1CKN B;  3I4M G;  1I4G A;  4DR4 Q;  1Q90 A;  4LUZ A;  2JA9 A;  1PTO B;  1S68 A;  4FM9 A;  1Z47 A;  2EQS A;  1A15 A;  1PV4 A;  2NVX H;  1Y1W G;  2I80 A;  4IUQ A;  2UUB H;  5CGK A;  4EFE A;  3D6C A;  1NMF A;  2IX3 A;  3PQI A;  4DR5 H;  1W6J A;  2F0N A;  3DLL A;  3KXY T;  4MAM A;  1SE4 A;  1HNZ H;  2JA5 A;  1ET9 A;  2JA6 G;  4L63 B;  4JI7 Q;  5HV6 A;  4L5Q A;  3P75 A;  2B2Y A;  3JAM L;  2R92 B;  3Q0A A;  4YBZ B;  3KHH A;  1SYE A;  4BY1 G;  1RIP A;  5D1O A;  5IYD H;  1J8I A;  2P5Z X;  1JCK B;  1VQC A;  4MTK A;  3TEH B;  1SND A;  1K9M C;  1XX8 A;  2FLN A;  3CMA A;  4K6L A;  1KRT A;  3MXN B;  4JI6 H;  2UU9 Q;  4X6A H;  3CC2 A;  4GKJ Q;  1PX2 A;  4JI0 H;  2YL2 A;  4I7H A;  1SJH D;  3HOZ B;  4KKS A;  5E3F A;  4A3J H;  2I8C A;  2IBK A;  3KLW A;  4O2D A;  5KFM A;  5KKN B;  4LJZ C;  1JLL B;  3ULP A;  2PVP A;  2Q2U A;  4GLA C;  3JZI A;  2BR0 A;  3MXU A;  3STB D;  2ATW A;  2UXB L;  4WJ4 A;  1BNC A;  4UCR A;  5M3F B;  5COY A;  1AN7 A;  1PTO F;  2YZG A;  1Q7Y C;  1M6V A;  2PQA A;  4K8I A;  2VQF L;  5D1O B;  5EWE A;  1AFP A;  4DNI A;  4ECR A;  1RL2 A;  3C1E A;  4LFA H;  3GV6 A;  3V96 A;  3KLS X;  1STG A;  4DV7 L;  1IBL Q;  3DEO A;  3FVQ A;  1MIU A;  2W6N A;  3VDY A;  5IGB A;  1J6Q A;  2K14 A;  1IW7 D;  5LXT F;  1EYC A;  3NK9 A;  3FKI A;  1IZ6 A;  3BVZ A;  5C5J A;  3PUW A;  2NVY B;  2LY7 A;  3QB3 A;  2VW9 A;  4JYA H;  3K6O A;  4IJL A;  4Q43 A;  1HXY D;  3ERO A;  2XGP A;  1N34 H;  3JAM i;  4DAP A;  4DL3 A;  4DV1 H;  3S1Q B;  4HAE A;  2RDF A;  3PR4 A;  3DWA A;  1PMR A;  2R6G A;  5LMN W;  2UUB L;  2GLT A;  3LML A;  5DG9 A;  4DR5 L;  3PW7 A;  3DMU A;  1HNZ L;  5KFS A;  4RB0 A;  4O4I F;  5LL6 S;  5C4X G;  3VR4 A;  5FLM G;  4OO1 H;  4DR1 L;  1IL2 A;  2MQH A;  2MFI A;  4LF7 L;  3FKI B;  4C3I H;  4A3M G;  2JEB I;  3U9O A;  1MZB A;  2ALZ A;  5A2Q W;  4RCN A;  2NU8 B;  1WCM H;  3MFH A;  3H40 A;  1VQP A;  1EYZ A;  5LP6 F;  3OHB A;  5EKL A;  1JC7 A;  1M4V A;  2A69 D;  4A3G B;  4F4W A;  3BDL A;  2PZW A;  2F52 A;  4PMW A;  1MJC A;  3JSN A;  2HCI A;  1RJT A;  3STB C;  1PRT D;  2K33 A;  3EPG A;  5C44 B;  5IE8 A;  3LWU A;  1DJR D;  4JI0 L;  4DR6 Q;  1EZ1 A;  1ZYR C;  1S10 A;  4FVM A;  2F0V A;  2E5L H;  3KLS A;  2FJ2 A;  3G8C A;  3NBI A;  3Q22 A;  4ED2 A;  1GJX A;  5M3M B;  1Z2N X;  1FYC A;  2IX0 A;  1IW7 C;  2L9H A;  3MVV A;  4BXX H;  1TWA H;  4IAL A;  3MWD A;  3MFI A;  3SK5 A;  3WO1 A;  5ELC A;  2R92 G;  1EY9 A;  4KKT A;  3V4S A;  5KFQ A;  4LFA L;  3MFY A;  5FK9 C;  3S1R B;  1BVS A;  3T5K A;  1N33 H;  3D4W A;  2EJG C;  4OEL B;  3EPI A;  1DM0 B;  1V51 A;  1KRS A;  5LYJ F;  3HFZ B;  2UUC Q;  4JI5 Q;  4B3S H;  2JA7 H;  1W3S A;  3S17 B;  1N34 L;  3HOZ G;  1AW7 A;  4DV1 L;  4CDE C;  3FPP A;  2JA8 H;  3SE0 A;  1LT5 D;  4K14 A;  2K01 A;  5COR A;  1O80 A;  4PG3 A;  1PFN A;  4H7B A;  1L1O C;  5HBR B;  2C2R A;  1YJW A;  4C1N I;  1F9Q A;  5M3F G;  1KJ9 A;  4K6D A;  3NQT A;  3ND8 A;  1CQJ B;  4YWL A;  4QMG A;  4LH6 A;  2UXD L;  3S2H B;  4LF9 L;  2A69 C;  1VQB A;  3H15 A;  1W2B A;  2VUM A;  3RN2 A;  5LL6 X;  2R7M A;  1DCZ A;  1ENF A;  2R93 A;  3MA2 B;  4IJH A;  2E2J B;  1E24 A;  4IRD A;  1I6V C;  1SNO A;  2FLP A;  4POG A;  2EYM A;  3T1H L;  2Q8I B;  4LFB Q;  3GTL B;  1E0B A;  4R4C A;  3V05 A;  1EOT A;  5DGA A;  2MPM A;  1DD2 A;  1DOL A;  2HVR A;  2E5L L;  5KFO A;  2DJG C;  4QF4 A;  2FHT A;  4DUY Q;  2FMA A;  5I47 A;  1FD7 D;  1GOZ A;  2WP8 J;  3Q8R B;  1WJJ A;  2IWH A;  2ZT9 C;  2V4R A;  2VUM B;  4DF7 A;  1BDO A;  1KAB A;  3CPW A;  2SOB A;  5GAG C;  4LFC Q;  1E1T A;  3T53 B;  1G91 A;  1JOK A;  3FKI G;  1HJP A;  2VS1 A;  5EKK A;  5LMU H;  1MHW C;  1N33 L;  1HTP A;  3GTM B;  1SYB A;  2IW3 A;  1LTG D;  2AGO A;  4ME5 A;  1OXS C;  4FP5 D;  2A74 C;  4IFD H;  4LF8 L;  1CUK A;  3OSP A;  4A3G G;  2E2H B;  2F0J A;  1PZI D;  3IG0 A;  3CCM A;  1I4X A;  4B3S L;  4JI1 Q;  4JV2 A;  2M9V A;  2TMP A;  2I46 A;  2DN8 A;  2PYK A;  5JEA J;  4Y7N B;  3BDC A;  1I3Q B;  5LMN H;  3H0G H;  3UDI A;  1UC8 A;  2JA5 H;  1G2S A;  5M3M G;  2EY6 A;  4R9W A;  1PTO C;  1SYG A;  1JB7 A;  3AQQ A;  5IT9 L;  1KC8 C;  3A54 A;  3KAL A;  1E22 A;  4F88 A;  2RGV A;  3GIM A;  3RZD H;  2VA3 A;  1CE8 A;  5K2M A;  4TUY F;  1B33 N;  1O78 A;  3R3O A;  4O2A F;  4NXN Q;  4K5X A;  5IWA Q;  4YCV A;  2OLS A;  3K5L A;  5JJK A;  3SK4 A;  1BXT A;  3EVQ A;  5KT5 A;  4YCU A;  3OIQ A;  2QF7 A;  4EBD A;  3RN5 A;  1HPC A;  3BZC A;  3S1M B;  5EDW A;  1XXG A;  2F3W A;  3PIO 3;  2OXP A;  1SNC A;  3I2Z A;  1OXV A;  4A3L G;  4I50 F;  1HR0 L;  1NCV A;  2VB3 X;  2PO4 A;  2EXD A;  2D0O A;  1EIF A;  4A3K B;  3T1Y H;  1WOC A;  2KVM A;  2VQE Q;  2F1M A;  4R8N A;  4RHS A;  2OEO A;  1OTC A;  3OTO H;  4J9Q A;  4A3E H;  4RAY A;  1FL0 A;  4Y52 H;  3L2P A;  4IOC A;  2HCC A;  4DA2 A;  1ET6 A;  2Q8T A;  4XZ3 B;  1K8G A;  3G6Y A;  1IXR A;  1YZ6 A;  1EQT A;  1XPU A;  3L4J A;  1JJC B;  2L15 A;  4R4T A;  5LMU L;  5F9L A;  2F0D A;  2H4O A;  1KNA A;  4A2A A;  1ROD A;  3PO3 H;  4CC6 A;  4C3H B;  5EKI A;  1KIX A;  3NTK A;  3GV5 B;  2K5V A;  3NEN A;  3T13 A;  1NTG A;  3T51 B;  1SE3 A;  4QWD A;  3CRK C;  1LM0 A;  4KHP Q;  1JOO A;  3M9B A;  4PZ7 A;  1X3Q A;  3E0E A;  4X3S A;  3AU7 A;  1PA6 A;  4DR3 H;  5DLG A;  4A93 B;  2UVU A;  1QJO A;  3ERQ A;  2RGR A;  3G4S A;  2FP4 B;  1TWF A;  4GN4 B;  3HKS A;  2F0G A;  2AUJ D;  2EYO A;  3A55 A;  2J7Z A;  1SCU B;  3KHG A;  2NUA B;  4IR1 A;  5DLQ E;  3G71 A;  1R9T H;  5KFN A;  2MHV A;  3TS2 A;  4X66 H;  5LHY 1;  2EOT A;  2VY3 A;  3FMA A;  1PZJ D;  4JI8 Q;  1JIH A;  4EQN A;  4J9R A;  4IQZ A;  2AGQ A;  1VQF A;  3BG3 A;  3CCJ A;  1BCP F;  2VUM G;  4EYH B;  3VA7 A;  2ZTE A;  3RV4 A;  5KND A;  1TWC A;  5JUM A;  5C3W A;  1Y1V B;  1AN8 A;  5CA0 F;  4AYB E;  3S14 H;  1QOH A;  1TS5 A;  1ZXT A;  3DM1 A;  2EZV A;  4ED0 A;  1E2Z A;  5A2Q L;  3CP0 A;  5M5W B;  1I4H A;  4IUN A;  2ES2 A;  1Z6H A;  5GRO A;  4JI3 H;  3F8T A;  2DJF C;  1CKO A;  2K05 A;  4RZQ A;  1MI2 A;  1B2T A;  1EZ8 A;  4GKK H;  5M5X B;  4ED3 A;  1GVP A;  2FXQ A;  3UDF A;  3HOU B;  4TV8 F;  3T4A C;  3OMC A;  3PSI A;  1SEI A;  3AMU A;  1VQ8 A;  2WTF A;  3H4B A;  1PHJ A;  4A4I A;  3N41 B;  2NU7 B;  3T1Y L;  1CQF A;  3RUP A;  4FXK C;  1TWC B;  2I07 B;  2Q2I A;  1D1K A;  5JQW A;  3OTO L;  1VQ4 A;  3HG9 A;  4IHJ F;  1CFM A;  4ECY A;  2Z1C A;  5KG3 A;  3QO2 A;  2UXC H;  2BCO A;  1WTQ A;  3CC7 A;  2FK1 A;  4AH6 A;  3BYT B;  4XX0 B;  2Z4I A;  3HOY H;  2B2V A;  4NW2 A;  4G4K A;  2ZJT A;  4ECQ A;  2EYJ A;  1GYF A;  3RMH A;  3P1H A;  4N9P A;  4LF4 L;  3U4Z A;  3QIA A;  2XRS D;  2DGY A;  1D7Q A;  4IAJ A;  3BDO A;  4B3T L;  3J7Z C;  3NSW A;  5IYB H;  3HZX A;  3GTG A;  5KFR A;  4DR3 L;  3A0J A;  4MN3 A;  1E4G T;  4AQY H;  4ULL A;  4EG0 A;  3U9S A;  3Q2O A;  4A3K G;  2Y0S E;  3I8Z A;  3H3V H;  3H91 A;  4X66 L;  1KJ8 A;  1STE A;  1XYI A;  3J7A 5;  2EIF A;  3DXJ C;  3Q24 A;  2B8F A;  2FLL A;  4QW9 A;  2K03 A;  4KY7 A;  4CDD C;  1HNW L;  3CME A;  1H9K A;  4JW0 A;  4CDF C;  1VMC A;  3MTS A;  4FF2 A;  2NVX A;  3I90 A;  5KG7 A;  1I50 H;  3AFQ A;  2R93 H;  3K7A B;  2KHJ A;  2W9C A;  1MBY A;  4IZ8 A;  5C0X J;  2K7V A;  4C3H G;  5DGB A;  3GTK H;  1OO9 B;  3C2P A;  1EEF D;  1YNX A;  3QWN A;  1U5K A;  4H44 C;  3U58 A;  3RAQ A;  4HMJ A;  5C3E H;  3D0F A;  1C48 A;  4GKK L;  1S0N A;  4CKC A;  4A93 G;  4A3I B;  1VMP A;  2CWP A;  1PH5 A;  4ME3 A;  4YJ3 F;  1XMQ H;  4RA8 A;  5K36 H;  5KFB A;  4I65 A;  2YW2 A;  2WAQ A;  5FPR A;  3M9O B;  2NVX B;  4JI2 H;  3HOW G;  4O3R A;  4DNR B;  1ZET A;  3EA6 A;  4O4H F;  4DV2 H;  4CKB A;  3M4I A;  1RHP A;  2QCP X;  2UXC L;  1RYR A;  3CCL A;  5J1Z A;  4YY3 Q;  2M2L A;  4YR2 A;  1Y1V G;  3S1N H;  4QCL A;  4QWC A;  3GII A;  1EY5 A;  4UP7 A;  2QYZ A;  3J7Y W;  4DKA C;  4DV4 Q;  3FEW X;  5KG2 A;  3RIZ A;  1CT1 D;  4K2K A;  2OF1 A;  1JDE A;  1TT2 A;  3HOU G;  5D65 A;  4CJ2 C;  1G6P A;  3MC0 B;  1SRO A;  3SK6 A;  1F2Y A;  3W1G A;  4XXE A;  4AQY L;  1A2T A;  1KL9 A;  2WDT A;  3EBE A;  4XYL B;  4DR2 Q;  2W6Z A;  3TQ1 A;  4A3J B;  1PFS A;  2V4D A;  4ZQI A;  2ZM6 H;  1ESR A;  1NY4 A;  3TSS A;  4GOP B;  5I9O A;  1EY0 A;  4DV6 H;  3ERS X;  1GGO A;  4JV1 A;  4X3K A;  2JJQ A;  4RAU C;  5JEA H;  3N44 B;  1CSQ A;  2LKV A;  3I56 A;  1IOW A;  4EBC A;  2LXK A;  2KCM A;  1SBB B;  3MWY W;  5JPM C;  4PMC A;  2F0S A;  2R84 A;  3PW0 A;  2K1B A;  1LTT D;  3J81 j;  4KY5 A;  4FXD A;  1CHP D;  1PH6 A;  4EYI B;  1Q12 A;  5CA1 F;  4H0L C;  5IGD A;  1PH8 A;  1YIT A;  4YB8 B;  4TV9 F;  1GUO A;  2A8V A;  4FU0 A;  1F2Z A;  1VF7 A;  4F8M A;  3G6X A;  4HJ8 A;  1IBM H;  2K6A A;  1K0S A;  1L2F A;  2W9B A;  5JJZ A;  1CM9 A;  2XTI A;  4Q8E A;  4X65 L;  2JN4 A;  2WAC A;  1N36 Q;  4DR7 Q;  1KHI A;  2CHB D;  4KLK A;  3EJI A;  4PZ8 A;  4CHT B;  5CAE B;  1I5F A;  4EBE A;  2BE5 D;  5FOB B;  4WBN F;  3HB9 A;  4BA1 I;  1MD2 D;  2KUM A;  4DV2 L;  3KFU A;  4RB1 A;  3R2T A;  4HJA A;  1MKH A;  3BVG A;  1WTR A;  3MEF A;  1NR2 A;  2A68 D;  3GDE A;  5KGU A;  3AEV A;  1T94 A;  3RLO A;  2DLN A;  5FJ8 G;  4NXM L;  2O5J C;  1W96 A;  1I4R A;  5ISR A;  4C3I B;  4LNQ A;  2K04 A;  3EN2 A;  1BXR A;  1XMO H;  1GUW A;  5KFK A;  1EWC A;  3MR5 A;  1FJG H;  4J9S A;  1WCM B;  3PIP 3;  2R7L A;  2R3Z A;  2ZJQ A;  2W9B B;  3AYH B;  3T5L A;  4FO2 A;  4ZCK A;  4ZRZ A;  3LWE A;  5GAD C;  1TWF H;  4A3I G;  4RNN A;  2N3S A;  4U68 A;  1ILQ A;  2QKI C;  3GTJ H;  4DUZ H;  4YCW A;  2IX1 A;  2ATL A;  3KF6 A;  2KSW A;  2NVQ H;  2YZN A;  1Q46 A;  4XIG S;  3J81 W;  4ED1 A;  2E2D C;  1L1O B;  1E2V A;  1GUN A;  4DV6 L;  1Z7T A;  5EPL A;  4QY7 A;  3TP7 A;  5DM6 3;  3PF5 A;  1K83 A;  3GTO A;  3K0Y A;  1XTD A;  2PI2 A;  2XIW A;  5J39 A;  3BS1 A;  1WTV A;  2W8K A;  1KDB A;  2HQE A;  3I73 A;  1WH2 A;  1CZW A;  1TWA B;  2C9O A;  5AJ3 Q;  1PRT B;  1TY2 A;  3HKZ A;  3RNU A;  2HDL A;  4L6T B;  4RKL A;  2B2U A;  2UUA L;  4C3J H;  5I6Y A;  1A9X A;  5IYD G;  4LF6 Q;  2C5C A;  1JKJ B;  4Q45 A;  4UDU C;  1S5E D;  3T56 B; 
#chains in the Genus database with same CATH homology
 4EQ5 A;  1VQM A;  1HZ9 A;  5M3F H;  1KQS A;  3J81 c;  4JCV E;  1WCM H;  1FGU A;  5BR8 Q;  4DAY B;  3M7N A;  1VQP A;  1PH4 A;  1S3O A;  2K52 A;  2VQE L;  4A3J G;  4OWW B;  1WI5 A;  2IHF A;  2N78 A;  3TS0 A;  4B3M Q;  1X56 A;  4PMW A;  2F52 A;  3CCQ A;  1MJC A;  5FLX c;  1FVI A;  3STB C;  3H3V I;  3HOV G;  3S15 H;  1K3R A;  5IE8 A;  4DR6 Q;  4GKK Q;  2QEX A;  1VQG A;  4JI0 L;  2NVY H;  1XJV A;  2YV5 A;  3PUY A;  1SMX A;  5IYB G;  3B6Y A;  3S1Q H;  4DV0 L;  2IX0 A;  1JJG A;  1XMO L;  4KHP L;  1K0R A;  4BXX H;  1FJG L;  1TWA H;  3I4N H;  2R7D A;  3KDF A;  4OWX B;  1QVC A;  3GTG H;  2UXC Q;  3F2B A;  2R92 G;  2H5X A;  5ELO A;  1QZH A;  4LFA L;  1BVS A;  1OXU A;  1YHB A;  2YTV A;  2OQK A;  4GS3 A;  4R4I A;  4YWM A;  3WWV A;  3KJO A;  1C7Y A;  1JJ2 A;  5HY6 A;  2I0Q A;  4BA2 I;  4JV5 Q;  1ASY A;  1KRS A;  2KEN A;  3FKI H;  2NZH A;  5IYC H;  4JI8 L;  3HFZ B;  2UUC Q;  2QGQ A;  4X62 L;  4UP9 A;  1UEB A;  4JI5 Q;  1VQO A;  2RCN A;  2JA7 H;  1W3S A;  3NEM A;  4X64 L;  1N32 L;  1V9P A;  1YEZ A;  2KCT A;  4GNX A;  2HHH L;  1N34 L;  3HOZ G;  1C9O A;  1JT8 A;  4A3G H;  4DV1 L;  4AQY Q;  4QJF A;  1CSP A;  2JA8 H;  5H1S E;  2K5N A;  1UE7 A;  5C3E G;  5LMN Q;  3HOX H;  5C44 H;  4A3F H;  1VQ5 A;  4PG3 A;  1L1O C;  4IPG A;  1YJW A;  1Y14 B;  3K81 C;  5M3F G;  3AFP A;  4DV3 L;  3U50 C;  3I4O A;  4YWL A;  1PYB A;  1WCM G;  1J5E Q;  4A3D H;  4KHZ A;  2UXD L;  3UDG A;  1P8L A;  4HIK A;  4LF9 L;  1VQB A;  4JBJ A;  3H15 A;  3BU2 A;  1W2B A;  5M3M H;  1HNX Q;  3RN2 A;  1UE1 A;  1PH9 A;  3G48 A;  2CKZ B;  1XMQ L;  3UDX A;  1OXX K;  4IJH A;  4QGU A;  1E24 A;  3LGJ A;  4GNX B;  2MO1 A;  2N8N A;  3S1R H;  4JI2 L;  4FDB A;  4B3R Q;  3G6E A;  4POG A;  3T1H L;  4DK3 C;  4LFB Q;  4R4C A;  4LF5 Q;  4OWT B;  1KD1 C;  3KF8 B;  2K5H A;  3I7F A;  3NBH B;  2D62 A;  4APV A;  2ZJR A;  3CCE A;  3GTQ H;  2E5L L;  2AWN A;  4DK6 C;  1X55 A;  4BXX G;  4DUY Q;  4X65 Q;  2WP8 J;  3I4N G;  3A74 A;  1NBW A;  1WJJ A;  5GAE C;  1N8R C;  3S17 H;  3J80 c;  4MZ9 A;  1E7Z A;  1A8V A;  2A19 A;  2GVA A;  2B29 A;  4A3L H;  1I94 L;  3CPW A;  5GAG C;  4LFC Q;  1E1T A;  1P16 A;  4DV2 Q;  2K4K A;  4JOI C;  1X65 A;  3FKI G;  5IYC G;  1I6H H;  1HJP A;  2VS1 A;  2XGT A;  5JEA G;  2E2I H;  1N33 L;  2JA7 G;  3HOW H;  5IP9 H;  4NXM Q;  4NB3 A;  3CXC A;  3S2H H;  1OXS C;  2UXB Q;  4BBS H;  2YTX A;  2JQO A;  3UE1 A;  2ZM6 L;  1IBK Q;  1EYG A;  1CUK A;  4LF8 L;  4A3G G;  3OYY A;  2VQF Q;  1YHA A;  2BA0 A;  3CCM A;  4B3S L;  4LWC A;  4JI1 Q;  2JA8 G;  3K7U C;  5E7N A;  1L0W A;  4BBR H;  4A3F G;  2E2J H;  4DV7 Q;  3HKZ G;  5JEA J;  2I5H A;  4WJ3 M;  4YWK A;  1YJN A;  1XNR Q;  4XTC S;  2PQA B;  1VQ6 A;  4A3D G;  4GOP C;  1Z9F A;  2JE6 I;  4UP8 A;  4HJ9 A;  3GTL H;  3H0G H;  4GLX A;  3UDI A;  1O7I A;  2Z6K C;  1PH2 A;  2JA5 H;  3SGI A;  1DGS A;  5M3M G;  1NJI C;  3AQQ A;  1KC8 C;  1JB7 A;  4DV6 Q;  3KF6 B;  1S72 A;  1S40 A;  4L5S A;  1E22 A;  1BBU A;  2AMC B;  2WAQ G;  1SR3 A;  3RZD H;  1IBM L;  4K0K Q;  3BZK A;  2VUM H;  1VQK A;  3L0O A;  1VQI A;  1AH9 A;  4NXN Q;  1EIY B;  2F4V Q;  2UUB Q;  5IWA Q;  4JI4 L;  4YCV A;  4DR5 Q;  2OTL A;  2Z0S A;  4DAM A;  1HNZ Q;  4JI3 Q;  5JJK A;  4R1J A;  3DM3 A;  4A76 A;  2KHI A;  4YCU A;  2UUA Q;  1QUQ B;  1HZB A;  4DR1 Q;  2NZO A;  4JI6 L;  4DPG A;  2WB1 G;  2F3I A;  4JOI A;  3RN5 A;  3GTM H;  4LF7 Q;  2RHQ B;  1BKB A;  3BZC A;  3K80 C;  4DV5 L;  1PYS B;  2ALY B;  3RLN A;  4YY3 L;  1ASZ A;  3I2Z A;  2E2H H;  1Q86 C;  1OXV A;  1GM5 A;  4A3L G;  1HR0 L;  1KXL A;  1TXY A;  2EXD A;  2D0O A;  1EIF A;  3PUZ A;  1M90 C;  3RZO H;  1WOC A;  2VQE Q;  3W5O A;  1B7Y B;  4GN3 B;  1OTC A;  4Y7N H;  1CKM A;  2LXJ A;  2WAQ E;  1I3Q H;  4LUV A;  3TRE A;  3U4V A;  4A3E H;  1C0A A;  4DV4 L;  5JJI A;  1FL0 A;  4Y52 H;  4HIO A;  5J3B A;  5IP9 G;  3L2P A;  4IOC A;  4JI0 Q;  4HJ7 A;  4BBS G;  1K8G A;  3K8A A;  4IFD G;  1IXR A;  1YZ6 A;  4LW1 A;  1XPU A;  1CKN A;  1V43 A;  4DUZ L;  4GOP A;  1JJC B;  3JAM c;  2L15 A;  4R4T A;  5M5Y H;  5LMU L;  4OO1 I;  2Z6K A;  3PO3 H;  4AYB G;  4DR2 L;  4BBR G;  2WB1 E;  4DV0 Q;  1KIX A;  4A75 A;  2K5V A;  3NEN A;  5JJL A;  1XMO Q;  1NTG A;  4QQB X;  1IYJ B;  3KOJ A;  4KHP Q;  1LM0 A;  3M9B A;  1K73 C;  1VQL A;  4PZ7 A;  3GTP H;  2CWA A;  4DR4 L;  1FJG Q;  3E0E A;  4JYA L;  1K83 H;  2RHS B;  1PA6 A;  3GTO H;  4IFD J;  2YYZ A;  3H0G G;  3G4S A;  4LFA Q;  3CCU A;  1GKH A;  5IP7 H;  2JA5 G;  2Q2T A;  1EQQ A;  1WYD A;  4GN4 B;  3HKS A;  4P75 A;  4OO1 G;  1VQA A;  4OON A;  5DLQ E;  3G71 A;  1R9T H;  2CFM A;  3KDF B;  3PV0 A;  3S1M H;  3TS2 A;  4O0A A;  2VY3 A;  4QIW E;  4JI8 Q;  1VQ7 A;  4JBW A;  4X62 Q;  1VQF A;  2K75 A;  3CCJ A;  2VUM G;  3CW2 C;  4YHH L;  2ID0 A;  4X64 Q;  1N32 Q;  1UE5 A;  2ZTE A;  4A3K H;  1VQD A;  1VQ9 A;  2HHH Q;  1HZA A;  4JI7 L;  3D31 A;  1N34 Q;  2E8G A;  4MNO A;  2AHO B;  4DV1 Q;  1EOV A;  3ULL A;  1V1Q A;  1LTL A;  4AYB E;  2NVT H;  1X9N A;  2MO0 A;  1PH3 A;  3S14 H;  3K0X A;  1SLJ A;  2Q2H A;  4GN5 A;  3CP0 A;  2ES2 A;  5GRO A;  2IT1 A;  3F8T A;  1N36 L;  4DR7 L;  1Q82 C;  1CKO A;  5EAY A;  4EX5 A;  4DV3 Q;  1GO3 E;  3BJU A;  4P71 A;  2UU9 L;  4IOA A;  4GKJ L;  2I5L X;  4LF9 Q;  2UXD Q;  1GVP A;  2IHE A;  2FXQ A;  3ER0 A;  3UDF A;  4C3H H;  1YHQ A;  4BY7 H;  1BBW A;  2AWO A;  3CQZ H;  4H02 A;  4NPS A;  3PSI A;  1OXT A;  2V1C C;  4IO9 A;  1VQ8 A;  3TRZ A;  4ALP A;  1XMQ Q;  3CC4 A;  1QZG A;  1PHJ A;  4A4I A;  3JC6 6;  3T1Y L;  4A93 H;  1LUZ A;  4JI2 Q;  2Q2I A;  2A1A A;  1PVO A;  3NEL A;  2Y0S G;  2LSS A;  3OTO L;  3FP9 A;  3M4Q A;  3T1H Q;  1VQ4 A;  1YI2 A;  1EQR A;  2N49 A;  4P73 A;  3J81 i;  3PO3 G;  4UY8 C;  3CC7 A;  1EFW A;  4AH6 A;  2E5L Q;  1SN8 A;  1XNQ L;  1HR0 W;  3GO5 A;  5IT9 c;  1IBL L;  3I55 A;  3TQY A;  3PO2 H;  2WFW A;  1YIJ A;  1L1O A;  3PIP A;  1JMC A;  3HOY H;  1Q81 C;  1GD7 A;  4R4Q A;  4L5R C;  4LF4 L;  1M1K C;  1Y1V H;  3U4Z A;  4KI0 A;  1EWI A;  5IP7 G;  5C0X I;  2DGY A;  3M85 A;  1B70 B;  1I94 Q;  1NMG A;  4JBK A;  4OX9 L;  1Q1E A;  1D7Q A;  4OXP A;  3HOX G;  5C44 G;  4B3T L;  3CD6 A;  5M5W H;  3J7Z C;  5IY0 A;  2GVB A;  1XPR A;  5IYB H;  2JK8 A;  1Q1B A;  4DR3 L;  3CPF A;  3A0J A;  5GAH C;  2K50 A;  3A5Z B;  4HJ5 A;  1N33 Q;  2HT1 A;  1WFQ A;  4A3K G;  2Y0S E;  5M5X H;  5AJ3 L;  3H3V H;  3HOU H;  4X66 L;  2ZM6 Q;  4LF8 Q;  1YJ9 A;  5C0X G;  3J7A 5;  3CCS A;  2EIF A;  4B3S Q;  1X3G A;  2JEA I;  2CCZ A;  4LF6 L;  3CME A;  1MJE A;  1HNW L;  1SE8 A;  3CAM A;  1TWC H;  2R7F A;  2GN5 A;  3I4M H;  1I50 H;  3AFQ A;  1B8A A;  2PI2 E;  3CCV A;  3KYH C;  2R93 H;  4J15 A;  3ICE A;  2KHJ A;  5BR8 L;  1D8L A;  3S24 A;  1HZC A;  5C0X J;  1NE3 A;  2HIX A;  3M3Y H;  4BY7 G;  3L7Z C;  3GTK H;  1YNX A;  1Y1W H;  1U5K A;  1N9W A;  3HKZ E;  4RG1 A;  3U58 A;  4IPH A;  4B3M L;  4P74 A;  4MTN A;  1VCI A;  2VL6 A;  1H95 A;  1G51 A;  5C3E H;  3D0F A;  3A5U A;  4GKK L;  1IBM Q;  4DR6 L;  1VQH A;  4IFD I;  3EIV A;  1VQE A;  1QVG A;  4A93 G;  3PGZ A;  3CCR A;  2B63 H;  2BH2 A;  4QL5 A;  2JA6 H;  3PF4 A;  1TWH H;  2CWP A;  4GNX C;  1A63 A;  1PH5 A;  4ME3 A;  4JI4 Q;  1K8A C;  4LUO A;  1JE5 A;  1YVC A;  1PH1 A;  1A0I A;  1X3E A;  4BY1 H;  1YBY A;  1QVF A;  2OQ0 A;  3PIO A;  4HID A;  4JI6 Q;  3HOW G;  3PO2 G;  2CQO A;  1E1O A;  3HOY G;  2OTJ A;  3KJP A;  4DV5 Q;  1X3F A;  1VS0 A;  2UXC L;  2B3G A;  3CCL A;  4YY3 Q;  3M4O H;  1Y1V G;  4UPA A;  3S1N H;  2C35 B;  1HR0 Q;  4IPC A;  4R4O A;  2KBN A;  4RMF A;  2OWO A;  4JV5 L;  2I5M X;  2IY5 B;  2YTY A;  2ZTD A;  1VQN A;  2BH8 A;  4UP7 A;  2UUC L;  4DKA C;  4DV4 Q;  4JI5 L;  3OW2 A;  3K7A H;  5FJ8 H;  4HIM A;  1T9H A;  3HOU G;  3ULJ A;  1G6P A;  5HGQ A;  1SRO A;  3RLF A;  3W1G A;  4DUZ Q;  5LMU Q;  4AQY L;  2PMZ E;  3J80 i;  1KL9 A;  3EBE A;  1AE3 A;  4TQU S;  5LMN L;  4DR2 Q;  3FHW A;  2ASB A;  1PFS A;  4A3I H;  4GLV B;  1NY4 A;  1CKN B;  4GOP B;  3I4M G;  4JYA Q;  2R7Z H;  3ZJY C;  4DR4 Q;  3ERS X;  4LUZ A;  1PH7 A;  2JJQ A;  4PZ6 A;  2QA4 A;  1J5E L;  1CSQ A;  2R93 G;  2JA9 A;  1SFO H;  3I56 A;  2LXK A;  3Q8D A;  2KCM A;  3S2D H;  1Z47 A;  2EQS A;  2ZJP A;  2NVX H;  1PV4 A;  1Y1W G;  1HNX L;  4POF A;  3PUX A;  1SRU A;  2OCE A;  3GD7 A;  4JBM A;  1NMF A;  5ELN A;  2VZA A;  3DLL A;  2MNA A;  3UE0 A;  3W1B A;  3J81 j;  2JA6 G;  1PH6 A;  2B63 G;  4YHH Q;  1Q12 A;  2BA1 A;  4B3R L;  1PH8 A;  1AE2 A;  5C4J H;  4L5Q A;  1YIT A;  4JI7 Q;  3CF5 A;  4LFB L;  4A3B H;  3E9H A;  5K36 G;  2A8V A;  4LF5 L;  3E9I A;  3M4P A;  4HJ8 A;  5C4X H;  4A3E G;  1L2F A;  1RIP A;  4BY1 G;  5FLM H;  1A62 A;  2AKW B;  2XTI A;  5IYD H;  4A3C H;  1VQC A;  3TEH B;  1X6O A;  4X65 L;  1UWV A;  4DUY L;  4A3M H;  1K9M C;  3S16 H;  1N36 Q;  4DR7 Q;  1KHI A;  3PCO B;  4KLK A;  3CMA A;  4PZ8 A;  1Q8K A;  1I5F A;  1KRT A;  3MXN B;  3F1Z A;  2UU9 Q;  4X6A H;  3CC2 A;  4JC0 A;  4GKJ Q;  4BA1 I;  4LFC L;  3PUV A;  4DV2 L;  3KFU A;  2HIV A;  4P72 A;  4A3J H;  1X54 A;  4HJA A;  1MKH A;  3KLW A;  4O2D A;  3MEF A;  4AIM A;  1XPO A;  3F2C A;  1U0L A;  3GDE A;  3ULP A;  3AEV A;  1G29 1;  4GLA C;  3RLO A;  2Q2U A;  3HOV H;  5FJ8 G;  3T1Y Q;  3STB D;  4NXM L;  4LNQ A;  2ATW A;  2UXB L;  4WJ4 A;  3EN2 A;  4TVA B;  5GQO A;  1IBK L;  3OTO Q;  2VNU D;  1Q7Y C;  2ZJQ A;  1HH2 P;  2PQA A;  2VQF L;  2RF4 A;  1TWG H;  4JI1 L;  3AYH B;  1RL2 A;  4DNI A;  3RR5 A;  1KAW A;  5GAD C;  1TWF H;  4DV7 L;  4A3I G;  1IBL Q;  1XNQ Q;  2N3S A;  2PNH A;  1MIU A;  3GTJ H;  3VDY A;  1XNR L;  4YCW A;  2IX1 A;  1J6Q A;  2R7Z G;  3KF6 A;  2K14 A;  2NVQ H;  1IZ6 A;  2NN6 I;  2R92 H;  3PUW A;  4LF4 Q;  1Q46 A;  2VW9 A;  4OX9 Q;  2HQL A;  3IRB A;  4XIG S;  1L1O B;  4B3T Q;  4IJL A;  4C2M H;  4DV6 L;  4QY7 A;  1LYL A;  3PF5 A;  3JAM i;  4DR3 Q;  1XTD A;  2PI2 A;  4K0K L;  2D0P A;  1E3P A;  4JG2 A;  1QUQ A;  2ZTC A;  4NXN L;  2R6G A;  5LMN W;  5AJ3 Q;  2UUB L;  2F4V L;  5IWA L;  2NN6 G;  4X66 Q;  4A3B G;  3HOZ H;  1UE6 A;  4DR5 L;  3RNU A;  4JI3 L;  3F2D A;  1HNZ L;  5C4X G;  4L5T A;  5FLM G;  2UUA L;  2DUD A;  1EUJ A;  4C3J H;  4DR1 L;  2MQH A;  1IL2 A;  5IYD G;  2MFI A;  4LF6 Q;  4A3C G;  1HNW Q;  1VQJ A;  4LF7 L;  4C3I H;  4A3M G;  2YU9 H;  4IPD A;  2JEB I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...