4A3CG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3cG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3cG01
5IT9c 4DR5Q 4JI1Q 3NELA 5FLMH 3PO3H 5BR8L 2NZOA 1HZ9A 1S3OA 1N8RC 5LMNW 4K0KL 3KF6A 2MO1A 4Y52H 5FLXc 3I4NG 1FGUA 4PMWA 3J80i 4GKJL 2ES2A 2ZTDA 4R4QA 2JQOA 2R7DA 3DM3A 3K0XA 3UDIA 4HJ5A 2E2HH 4LF6L 2JA6H 1SROA 3CMEA 4JI6Q 4B3RQ 1AE2A 1X65A 1HZBA 4LWCA 4EX5A 4GOPB 4A93G 3FHWA 1CKNB 1TWAH 1PH8A 2Q2UA 3MEFA 4DV3Q 1Y1WG 4DV6L 4IOCA 4BY7G 1I6HH 4BY1G 2JA8G 2QA4A 3J80c 1XNRQ 2WB1E 4B3SL 5LMNL 3B6YA 2D62A 3GTGH 1E22A 3CCUA 3JC66 1YJNA 1XMOL 3I4NH 3M4QA 2MFIA 4JBJA 4HIMA 1P8LA 2DGYA 3TREA 5GAHC 4A3JH 4A3FH 2F3IA 3L7ZC 5C44G 3RN2A 1N33L 1L0WA 4UY8C 2KCTA 1DGSA 1H95A 1EIFA 2JA7G 1A62A 4HJ9A 2ZJPA 1Y1WH 2I0QA 2UXCQ 4DR6Q 4BY7H 4DUYL 1VQPA 3BZCA 3PF5A 3S24A 2NN6I 2JA8H 3T1HL 4X64L 4JBKA 4MNOA 1VQKA 2KHJA 3ULLA 3ERSX 4IPHA 3J7ZC 1ASYA 4LF9Q 3KF8B 3TEHB 4BBRG 1C9OA 4DNIA 3H3VI 4IFDI 5IWAL 4A3EG 1PH2A 4DV1Q 1X55A 5IP9G 1PHJA 1NJIC 1CSQA 5C44H 1I5FA 5FJ8G 1HNZL 4P75A 2VQEL 2EIFA 2PI2A 1K8AC 2E5LL 1E1OA 4DR2Q 3G4SA 1IBLL 3CAMA 2JA7H 2RCNA 4BA2I 2EXDA 1OXXK 3DLLA 3CD6A 4X65Q 4DR5L 4JI1L 2FXQA 4OXPA 4IO9A 2ALYB 2E2JH 2WAQE 2ZTCA 1RL2A 4IJLA 2I5MX 4BBRH 1VQIA 2I5HA 1VQ5A 3MXNB 3HOWG 4NB3A 3T1YQ 4A3EH 2WP8J 1XPOA 5IP9H 4LF4Q 3S16H 5FJ8H 1JMCA 3NEMA 3KLWA 4PG3A 5ELNA 3F2CA 2OTJA 1MKHA 5IP7G 2Q2IA 1A0IA 2UUBQ 2OCEA 4JI2Q 3CP0A 4GS3A 2RF4A 3GTKH 4DV3L 1PYBA 2HHHQ 2Y0SE 2PI2E 2YTYA 4JBMA 3K81C 2IY5B 2JA9A 4X62L 5IYCG 4DV4Q 4KHPQ 2I5LX 3ULPA 4R1JA 4GLAC 4A3MG 4YWKA 3CC4A 1KQSA 4P74A 2JK8A 2A8VA 1I94Q 5HGQA 5IP7H 3CMAA 3PF4A 4QL5A 4DV0Q 4L5TA 3S1QH 2F52A 4KI0A 4JOIA 1V1QA 1VS0A 2K5HA 3CCQA 1VQ6A 1NY4A 4R4OA 4OO1G 2UXCL 4IPGA 1YHAA 3E0EA 1PH6A 3I4MG 3KFUA 4LF9L 4GOPA 4A3DG 1IL2A 4KLKA 3CF5A 4HJAA 1CKNA 4AQYQ 4A3MH 3GTPH 4H02A 1Z9FA 1PYSB 4DR7L 3H15A 1X56A 1HH2P 1OXSC 1Q1BA 3I55A 1L1OA 1UE6A 3K80C 1HR0Q 2OQKA 2JE6I 2AWOA 2NZHA 4L5RC 4L5SA 1EQRA 4C3JH 5LMUL 1Y14B 5ELOA 1NBWA 2Z6KA 4B3ML 5JEAJ 3GO5A 3G71A 4GNXB 3HKZG 4A3DH 1D7QA 3T1YL 2V1CC 2EQSA 2R6GA 2YYZA 3D0FA 3FP9A 3PUVA 1VQFA 1VQJA 4JV5Q 3AYHB 3PV0A 3LGJA 1JT8A 1SFOH 4QIWE 1GM5A 2B29A 2BH2A 4LF8Q 1X3FA 4YWLA 5C0XG 4GKKQ 4A76A 1VQHA 3S1NH 1EWIA 4ME3A 3S14H 3PUXA 1KRSA 1SMXA 2WFWA 1KD1C 3D31A 2GN5A 2VQFQ 4A4IA 4C3HH 3OW2A 4A3JG 4A3FG 1KXLA 2CKZB 1Q86C 1B7YB 1S40A 4JC0A 2E2IH 1JJGA 4J15A 3U4VA 2RHSB 2UUAQ 3S15H 1JJ2A 1WFQA 1XJVA 4B3TL 4LF5Q 2JEAI 2AKWB 3CQZH 4OWXB 5J3BA 4OONA 3CCMA 2NVQH 4A3CG 4JI7L 3CCSA 4DV0L 1PFSA 3W1GA 5GADC 4A75A 3RLNA 2VS1A 4JG2A 4DV7Q 1HR0W 3CPFA 4LF7Q 4IJHA 2K75A 2LXJA 3F2BA 1Q81C 4JI0L 2B3GA 4IPCA 3S17H 2UXBQ 2ZJRA 1X6OA 1EYGA 4MZ9A 5C0XJ 1SRUA 4JI8L 1L1OC 4EQ5A 1P16A 5GQOA 2CWAA 4PZ6A 4KHPL 4NPSA 3STBC 1NMFA 1NE3A 1BKBA 1HNXL 2YV5A 2Z6KC 4AYBE 1U5KA 5IE8A 4R4TA 4A3IG 4A3CH 1BBWA 4X6AH 1TWCH 1VQ8A 3J81c 2F4VL 1VQ7A 2ZTEA 4GLXA 1C7YA 1HR0L 2PQAA 5C4JH 1N32Q 1HNWL 3A5UA 3RNUA 4DUZQ 3M9BA 1XNQQ 2JA5G 1FL0A 4DK6C 1CUKA 4OO1I 1PH4A 1YI2A 4JI4L 4NXNQ 2IX1A 1CKMA 3EBEA 4DV2Q 4GN4B 3SGIA 5IYBG 4YY3L 5H1SE 1IBKQ 1HZCA 1QVGA 2Q2TA 1QVCA 1SE8A 4O0AA 4BA1I 3M85A 1XPRA 3I7FA 1CKOA 1XMQQ 1PV4A 1CSPA 3PIPA 2R7FA 2UU9L 3AFQA 5M5YH 1K3RA 1YZ6A 1YVCA 3PCOB 4A3IH 4LF4L 2R7ZG 2KHIA 1UE1A 3RLFA 5GROA 4JI3Q 1V9PA 1PH7A 2JA5H 3S1MH 3GTJH 4LF8L 4XIGS 3G48A 4QQBX 3HOZG 5IYBH 4X66Q 1W3SA 1VQ4A 3PSIA 2A1AA 3KF6B 3J81j 2WB1G 2BA1A 3AQQA 5IYDG 1TXYA 3ZJYC 2JJQA 2Z0SA 3CCJA 3OTOQ 2K4KA 4JI6L 3ICEA 4B3RL 2IHFA 1G6PA 1VQOA 1OXTA 2R7ZH 2IT1A 3HFZB 4JYAQ 1VQNA 4DR1Q 1IYJB 1KHIA 1VQGA 3OYYA 4IOAA 4GNXA 1IBMQ 2PMZE 1JB7A 3RZDH 1XNRL 3M7NA 4DV5Q 3PGZA 4BXXG 3TS0A 1S72A 1TWFH 3HOZH 1QUQB 5C0XI 2UXBL 1YJWA 2XTIA 5C3EG 1KC8C 4OX9Q 1V43A 3ER0A 3BJUA 5IYDH 5M3FG 2B63G 4P73A 3UDGA 1AH9A 1EOVA 4HIDA 4GN3B 2CCZA 2K14A 2A19A 3JAMc 5BR8Q 1Q1EA 1UE7A 4WJ4A 1LUZA 1QZHA 4DR6L 5JJLA 4K0KQ 1SN8A 4R4CA 3F2DA 2VY3A 4GKJQ 4LF6Q 4BXXH 2GVBA 5IY0A 3A0JA 3WWVA 2QEXA 1M90C 2D0OA 4LUZA 5C3EH 2C35B 3RLOA 2MQHA 4DV1L 2R92G 2WAQG 1B70B 1Y1VG 5HY6A 1U0LA 4GN5A 4P72A 5M3FH 2B63H 1LTLA 1K8GA 2ASBA 5C4XG 1XMQL 2Q2HA 1PA6A 4DR2L 2CWPA 1XTDA 4B3SQ 3UE0A 1HJPA 2N3SA 5M5WH 3PUYA 1VQCA 2K52A 4X65L 4YHHQ 2K5NA 4IFDG 2YTXA 1KL9A 3IRBA 4JI3L 1PH1A 3UE1A 1N36Q 1N34Q 3GD7A 3CCLA 1E3PA 4Y7NH 4LFCQ 2MNAA 3CPWA 1KIXA 4A3BH 3GDEA 2Y0SG 2R92H 1Y1VH 2ID0A 1YNXA 4RMFA 3S1RH 3I56A 2BH8A 4DUYQ 4RG1A 5C4XH 4A3GG 2D0PA 3OTOL 1UE5A 4R4IA 4LW1A 4X64Q 1E1TA 3T1HQ 2UUBL 3HOUG 1EFWA 1Q12A 2CQOA 4JI2L 3H3VH 1JE5A 4DR4Q 4JYAL 2HHHL 2E8GA 5EAYA 4C2MH 5IWAQ 4DR1L 3RR5A 3CCVA 4UP8A 1WYDA 1IBML 4DV4L 4TVAB 3HKSA 4DR3Q 1X54A 3A5ZB 4JOIC 2VQEQ 3I2ZA 3STBD 3UDXA 4C3IH 4POFA 1YITA 2E5LQ 1Q8KA 4A3KG 1YBYA 5M3MG 2VZAA 3AEVA 1IBLQ 4OX9L 3GTLH 3FKIG 1GO3E 4UP9A 4HIOA 4O2DA 1EIYB 2IHEA 1MJCA 1I94L 4A3LG 1E7ZA 1O7IA 2ZM6Q 4A3GH 4LNQA 1M1KC 3HOUH 3L2PA 5K36G 4GOPC 4YWMA 1L2FA 3A74A 4HIKA 2UXDQ 5AJ3Q 2QGQA 3J81i 2YU9H 4NXMQ 3BZKA 3KYHC 2NVYH 1GKHA 4MTNA 1NTGA 2HT1A 2N78A 3KJPA 5JJKA 1PH3A 3K7AH 2LSSA 4PZ8A 1SLJA 4A3KH 1Q82C 5M3MH 4AQYL 2HIVA 3FKIH 2BA0A 4A3LH 3GTOH 1K83H 2GVAA 3I4OA 3EIVA 4HJ8A 3U4ZA 3S2HH 4X62Q 1EUJA 1QUQA 2ATWA 1L1OB 2DUDA 4LFAQ 4YHHL 4YCUA 1VCIA 1I3QH 2LXKA 1N34L 1N36L 1FVIA 4XTCS 1TWGH 1X3EA 4LFCL 2AWNA 5GAGC 3H0GG 1X9NA 1IXRA 4OWWB 2VL6A 4UPAA 1UWVA 4A93H 4DAYB 3GTQH 1E24A 4KHZA 1MJEA 4JV5L 3KDFB 1VQMA 4BY1H 2VNUD 3E9IA 3CC2A 3HOYG 3CW2C 2OWOA 3K8AA 3TRZA 2L15A 4OWTB 4DPGA 3GTMH 4DR4L 4GKKL 4QGUA 5M5XH 3G6EA 1WCMG 4LFBQ 4DR7Q 1TWHH 2K50A 2VQFL 3TS2A 1J5EQ 2UUCQ 2HIXA 3H0GH 3ULJA 3L0OA 4DR3L 2VUMG 4AIMA 4HJ7A 4YCWA 3S2DH 3RN5A 2OTLA 3KJOA 2UUAL 2R93G 1XPUA 4JBWA 1D8LA 1A63A 3E9HA 2N8NA 4L5QA 5LMUQ 3CXCA 3F8TA 4DK3C 3VDYA 4LF5L 1VQBA 3CCEA 2ZM6L 3JAMi 4B3MQ 4YCVA 4P71A 3TQYA 2MO0A 2AHOB 2PNHA 4PZ7A 1T9HA 1AE3A 1VQ9A 1FJGQ 3W1BA 3HOYH 1W2BA 4DV7L 2NVXH 3PO2G 4LF7L 2JEBI 4AYBG 2UXDL 1UEBA 5AJ3L 4NXML 1YHQA 1QZGA 1WCMH 1GD7A 3PIOA 1R9TH 4JI5Q 1GVPA 4POGA 5GAEC 2VUMH 3HOVG 2HQLA 1WOCA 2CFMA 1HZAA 2H5XA 3KOJA 3UDFA 1KRTA 1G51A 2R93H 1YIJA 3F1ZA 5JJIA 3HKZE 1VQDA 3Q8DA 2IX0A 2AMCB 3AFPA 4IPDA 2NVTH 4GLVB 2KCMA 4UP7A 1N32L 1OXUA 4TQUS 4DUZL 3U50C 1JJCB 1X3GA 1RIPA 2KENA 1XNQL 3PO2H 2OQ0A 2PQAB 3CCRA 5E7NA 4A3BG 4WJ3M 4NXNL 1WJJA 4FDBA 4LFAL 3HOWH 4DV2L 2KBNA 1IBKL 3PUZA 3HOVH 4DV6Q 3RZOH 3HOXG 3PUWA 4B3TQ 4ALPA 4BBSG 1PVOA 4JCVE 1BVSA 1VQAA 2NN6G 1YHBA 4JI7Q 3J7A5 3M3YH 5LMNQ 1KAWA 1LM0A 1XMOQ 5JEAG 1OTCA 4JI0Q 3EN2A 1YEZA 2RHQB 3M4OH 4AH6A 1G291 3CC7A 1QVFA 1Q7YC 1PH9A 1LYLA 1NMGA 4APVA 1A8VA 5DLQE 4JI8Q 3NBHB 5IYCH 2XGTA 3U58A 1N33Q 1ASZA 3NENA 4QJFA 4X66L 1HNXQ 4LFBL 3HOXH 1N9WA 3M4PA 1MIUA 1K9MC 1SR3A 4GNXC 1J5EL 2UUCL 4BBSH 1K0RA 1PH5A 4QY7A 2F4VQ 1BBUA 2K5VA 5FLMG 2YTVA 3PO3G 1YJ9A 2ZJQA 1HNWQ 2VW9A 1J6QA 1C0AA 1IZ6A 4JI4Q 1B8AA 4YY3Q 1VQEA 4DKAC 3BU2A 1HNZQ 1FJGL 3I4MH 4DAMA 1Z47A 4DV5L 4IFDJ 1Q46A 2JA6G 1I50H 3W5OA 4LUOA 4JI5L 2N49A 1VQLA 2UU9Q 1OXVA 3KDFA 3K7UC 4LUVA 1EQQA 1K73C 1WI5A
chains in the Genus database with same CATH superfamily
5IT9c 4DR5Q 4JI1Q 1BBXC 1HZ9A 1F77A 3J80E 4Q8FA 5LMNW 1FKAH 1ONLA 2MO1A 4BY1B 1FGUA 4RAZA 3J80i 2JA8B 3OMGA 2R7DA 3K0XA 3UDIA 1SMYC 4XT3B 4TQSA 1RDPD 1AN8A 4C5BA 3CMEA 4B3RQ 4XYQA 4A93G 4ECWA 5L9XA 4QIWB 1KEEA 4N8X1 4DV3Q 1Y1WG 2PVPA 4IWYA 5KG0A 4DK0A 4BS9A 4X66H 3T53B 1D2BA 2QA4A 5D14A 1AZQA 5LMNL 3OTOH 4FXKC 2UUBH 2XIWA 1DYQA 1EWHA 1LTSD 2MFIA 3HP3A 4MTEA 4JYAH 1MZBA 3QZ8A 5C44G 1QB5D 2EOTA 3TSSA 5DAUA 4DAPA 4BBRB 3MFHA 4DF7A 4LSAA 3URYA 1DGSA 3PW5A 1WCMB 2VQDA 2ZJPA 1S5BD 2UXCQ 2JSOA 3V6HA 1KDCA 1U4MA 3DWPA 5ELFA 5DNFA 2JA8H 2OLSA 2R8HA 1U4LA 2WDTA 4IPHA 3KF8B 3MAQA 3P1HA 1DV1A 4ED3A 5LXTF 5IWAL 2NVTB 4QMGA 1PH2A 1TT2A 4DV1Q 5IP9G 1NJIC 1LO5D 2NU9B 1NCVA 3PO2B 2M05A 1K8AC 2E5LL 3RB4A 1PTOD 4F87A 2JA7H 4JPBW 1EY5A 4QWCA 4R9WA 3DLLA 3CD6A 1E2WA 4AQYH 4X65Q 2F0WA 4IO9A 2ALYB 3JZIA 3KK7A 5KEEA 3H4BA 2ZTCA 2AGQA 4BBRH 1VQIA 4RGMA 1FD7D 1MGSA 5EBCA 3HOWG 1B9MA 4KMUC 5FJ8H 3NEMA 4XQQA 3NXWA 1MKHA 4LH7A 3A7AB 5IP7G 5KFNA 1GXDC 1II3A 1N34H 2IPKD 1N36H 1L2ZA 1STGA 4JI2Q 2J6TA 2L0CA 2FP4B 4O3OA 4JBMA 2IY5B 2JA9A 4X62L 4DUYH 4DV4Q 3ETHA 4XZ3B 2KCCA 4KHPQ 2DZDA 1NR2A 4X64H 4R1JA 1I3QA 4GLAC 4A3MG 2PN1A 1RKNA 1KQSA 1CQJB 1PTOB 2A8VA 1O7ZA 3PW7A 2Z8LA 1M6VA 4Q8EA 1VAJA 2F0NA 4QL5A 4DV0Q 1I50B 2B8GA 3DWAA 5E4WC 1JX4A 2B2WC 1VS0A 1CHQD 1NY4A 1IBLH 5DLFA 5A35A 1LTBD 4IUVA 1OWTA 1EY6A 1STBA 3I4MG 2ZM6H 2F0QA 4FXGC 4LF9L 1F9RA 2N88A 1IL2A 3CF5A 4HJAA 4DV7H 4QIWA 4H02A 3S1NB 1PYSB 4X3UA 1TKWB 3H0GA 1HH2P 3G8CA 2IA6A 1FR3A 1GLVA 2E2HB 1OXSC 1Q1BA 1S9FA 2F0MA 2A69C 3RIZA 2NZHA 2R61A 2BOSA 1Y69U 1EQRA 4IQZA 1Y14B 4DL5A 1NBWA 2Z6KA 1I6HB 3K5HA 2W70A 5DG7A 2IW3A 1SMYD 1ET9A 4C3HG 1N32H 2FLPA 3GTGB 4DUZH 1WCMA 3T1YL 5KG2A 2YYZA 4NXNH 2PZWA 4LFAH 1CZWA 4U673 3AYHB 4A3JB 3PV0A 3LGJA 5KFRA 5D1PA 3KF8A 4RA8A 4LF8Q 2BH2A 1JWMD 5C0XG 1BUVT 4GKKQ 4BY7B 3S1NH 5JPMC 1TWCB 1KRSA 4R8UB 1SMXA 2VQFQ 4A3FG 3SK4A 2CKZB 1Q8IA 4RWSC 3SR1A 4EFEA 1RYRA 3DEPA 3U4VA 5EWGA 3TQ1A 3VA5A 2JEAI 2AKWB 3CQZH 3CCMA 3W3AA 3PW0A 4JI7L 3LX0A 3CCSA 4HEDA 3C0FB 1ZYRC 1C4QA 2HQEA 3VYSA 2QKIC 4LF7Q 1KC7A 2LXJA 2UXBQ 1Q81C 2B3GA 2NTSA 2B2UA 1X6OA 2CQYA 5BPFA 1PZJD 2RGVA 3SI8A 1SRUA 3MHBA 5D65A 4DK1A 1B6RA 3EA6A 1KDBA 2L12A 4JV0A 3I4LA 1J9OA 4DV5H 2QEJC 1I6UA 4Q0YA 1NE3A 1BKBA 1HNXL 2YV5A 1W93A 4AYBE 4A3IG 4R4TA 1TIID 1BBWA 4A3CH 1EL0A 1TWCH 3J81c 3R23A 2F4VL 2LS01 2PQAA 3I91A 1HNWL 2HUGA 1PH4A 4R8NA 1T5XD 1F2LA 2PZUA 2SEBD 1G6ZA 4GN4B 3OW7A 4YY3L 3HEJA 5C5LA 2Q2TA 1SE8A 1XPRA 3KBXA 1TAEA 4DFAA 3VR6A 1XMQQ 1CSPA 3I8ZA 1C3OA 1KJQA 1GOZA 2PMZA 1KLGD 1YZ6A 4LF4L 2EJMA 1AUVA 2R7ZG 1IHZA 4TUYF 3A54A 3R8BA 2RCFA 4EBDA 2F0HA 4G7ZC 2ASJA 1PH7A 1S5DD 3A56A 2K5DA 2J6UA 5KYIA 2V5AA 1Q90A 5LMNH 3MA2B 1JKJB 3RBDA 2A1AA 3KF6B 1KJ9A 2E2HA 3AQQA 1NUCA 4N9TA 3ZJYC 3BDCA 3CCJA 4JI6L 3WNZA 2DIKA 3J7AK 1T3NA 2ZJTA 1VQNA 3SVMA 5D1OA 2WACA 3V05A 1IYJB 1ENCA 1VQGA 5KRUA 3OYYA 4ZYSA 4H44C 1JB7A 1XNRL 3M7NA 3GTGA 4BXXG 1BXTA 3A8JE 5C3EG 2CHBD 1HFGA 3T13A 4OX9Q 5DGAA 4L8JA 3PVXA 4DGZA 5IYDH 5M3FG 2R7NA 5IWAH 3UDGA 2PNRC 4KKUA 4ZK9B 1EOVA 4HIDA 2CCZA 2A69D 3QZ7A 2K14A 2A19A 4ODGA 2E5LH 2WAQB 4DR6L 4XXEA 2F0PA 3R2TA 5JJLA 1BGWA 1TR5A 1WSCA 4K0KQ 5EOYA 4R8UA 4WBNF 5FPOA 2D2CC 1SFOB 1J8IA 2FKLA 4IWXA 3WWVA 3MTSA 2R8IA 3MC0B 2EYJA 1Y1VG 4ECUA 1U0LA 2KA7A 4P72A 5KFPA 1VMPA 3N8DA 3HKZB 5FOBB 5C4XG 1M7JA 4PWQA 1SE4A 2JEGA 1RJRA 4N9PA 4QUFA 1JLLB 3OHBA 2RBMA 1VQCA 5KG5A 2K5NA 4IFDG 1U4PA 1RJPA 5DGBA 4JI3L 1PH1A 1EYAA 3HOUB 4LFCQ 3CPWA 3GIDA 3GQCA 3GDEA 4X62H 1LTGD 1BNZA 4E6IA 1PLFA 4RG1A 3T1HQ 1UE5A 1ZYRD 1E1TA 3CVZA 1Q12A 3NQIA 4OIJA 5BPHA 3FKIB 3H3VH 3X3MA 1EY4A 2I07B 3RR5A 1IBML 3OWFA 4DR3Q 3HKSA 3RAQA 1EEFD 3ORQA 2HD3A 2ICEC 1Q8KA 1KTKA 3IL8A 3AEVA 2EPBA 2DWCA 3CHBD 4LF9H 3FMAA 3H4DA 1PYWD 3ERQA 1I94L 1C48A 1E7ZA 3Q6SA 4A3GH 1PK8A 3HOUH 5K36G 1K28A 1FNUA 1PRTF 5JAVA 2WYOA 3K0YA 1L2FA 4HIKA 2UXDQ 5M5YB 5AJ3Q 1V1OA 1LV9A 4HCSA 5L1LA 2A6ED 2HT1A 4H0LC 1VBHA 3GTJB 1SLJA 3OIPA 3NBIA 3GTMB 1ZKOA 5M5XB 3FKIH 2BA0A 2JN4A 2K5WA 3CU7A 2GVAA 4O3NA 4YIJA 5KFSA 3T1YH 4EQOA 4HJ8A 4CJ2C 4P2CB 1B50A 3S2HH 1EUJA 1S10A 1DOMA 1T36A 3K6OA 2XGPA 3MR6A 1HRJA 4YCUA 1HXYD 1VCIA 3JSLA 2DNCA 4UCTA 1AEXA 4XTCS 2UVVA 4IUQA 3RZDB 3N43B 5GAGC 3H0GG 2W6QA 2VL6A 3R2IA 4UPAA 4A93H 4X3SA 4KY7A 3MFGA 3GTQH 1SNOA 1W96A 3KDFB 2R85A 1WTVA 2VNUD 1WTHA 2NU7B 1SFOA 1B4OA 4ZI7F 3CW2C 2R93B 5J1ZA 3IAYA 3GTMH 5A2QW 5M5XH 4Q0FA 4RAYA 2B2WA 4YR3A 1WCMG 4LFBQ 4UHVA 2VPQA 5FD5A 2PCFB 1B3QA 3TS2A 3HKZA 2HIXA 4YR0A 3RB0A 1TS4A 2J7ZA 4AIMA 1G8ZD 4HJ7A 1SYCA 1WTQA 2OTLA 2E2IA 1D6EC 3JAME 2UUAL 1D8LA 4L5QA 3S17H 3F8TA 4DK3C 4LF5L 2W6NA 2YS7A 3CCEA 1HNXH 3IG0A 3JAMi 4P71A 3TQYA 1VQ9A 3HOYH 2MGSA 1FJGQ 3TINA 5A2QL 1W2BA 2F4VH 2W9BB 3PO2G 5C4ZA 1K8OA 1Q3LA 2ZT9C 2PZTA 1KNEA 1HNWH 1XDNA 3OHAA 2G9HD 1GD7A 1R9TH 2HDLA 3ND8A 1ZETA 1GVPA 3QOJA 2VUMH 4O4IF 2W7OA 2HQLA 2A6HC 4YY3H 3J7YW 4MA5A 2X6GA 4C1NI 2FINB 2OEOA 3KOJA 3UDFA 4C5CA 4H7BA 2R93H 3M9MB 4QW8A 3VYTA 2XSCA 1VQDA 5I2XA 1IYUA 1MSGA 4Q44A 1JOOA 4UP7A 4LAAA 2B39A 4LF4H 4M1UB 4YR2A 3U50C 2H1EA 4WJ3M 3HOWH 1SE3A 1B33N 4ZAIA 4FXDA 2F3VA 4JCVE 1SJED 1K1QA 1VQAA 1BOSA 2XRSD 3M3YH 4JI6H 1XMOQ 2K33A 1GGOA 3JRWA 2Z1CA 3SHLA 1QVFA 1SXTA 1PH9A 5KFOA 1FGBD 3GTJA 1A8VA 5DLQE 4HMJA 4JI8Q 1N33Q 4O3RA 3SE0A 2CQAA 1XNRH 5TSSA 4QJFA 4X66L 4I7AA 4EEQA 2NVYB 1PXUA 2IWHA 1SYDA 4YAJB 2O03A 5KNCA 1J5EL 2UUCL 4IRDA 2W6OA 3K7AB 3GLKA 1MSHA 2R7LA 5M3MB 3PO3G 2K01A 2W6ZA 1HA5A 1J6QA 3Q24A 1C0AA 1IZ6A 2XVSA 2I87A 1DOKA 1AUXA 3BDLA 5EKKA 1E4FT 2XCLA 4DR6H 3I4MH 1X3QA 5KFIA 1Z47A 3EFXD 1Q46A 5IOCA 5KT5A 1W6JA 1WR2A 4LUOA 5FLXW 3IFTA 1VQLA 5BN4A 1OXVA 3KDFA 3NELA 2H4OA 5CBEE 1FNVA 4IUUA 1S3OA 2FJ2A 2B2VA 3MEHA 4CDCC 2Z6BA 1IL8A 4Y52H 5FLXc 4M9UA 4PMWA 3OOCA 4GKJL 2ZTDA 4R4QA 2JQOA 3DM3A 4LF6L 4HJ5A 4JI3H 4KY6A 5FLXL 3LP8A 5G3LF 3GTPA 4KJOA 1HZBA 3NGDA 1TWAH 5L37A 3EVQA 1STHA 4BY7G 1LT5D 3X3NA 5JUMA 5C8YF 2WB1E 3WOEA 1PDQA 4B3SL 3B6YA 1E22A 3CCUA 2QYZA 1SSOA 3I4NH 1P8LA 2DGYA 2VB3X 4A3FH 2WV6D 4DLKA 1IBMH 2R82A 5H80A 4UY8C 1I6VC 3Q8PB 4A3EB 1A62A 3VR5A 2V59A 4DUYL 3PW2A 1WTRA 3UQ8A 3PF5A 1PMRA 2NN6I 4X64L 1I94H 1W6KA 3KTMA 3J7ZC 2BDNA 1ASYA 1C9OA 3RD4A 4LH6A 4IFDI 4C2MA 4K5VA 5CA1F 3KAKA 5J39A 3MFYA 1X55A 5JVDF 1I5FA 3PMFA 3BABA 1WVLA 2VQEL 1WD1A 4DL7A 1F2YA 3G4SA 1IBLL 3CAMA 2XCPA 4Q5VA 2W9CA 2K1BA 1FNWA 2YCHA 5ELEA 1S03G 4EGQA 4DR5L 4JI1L 1KDAA 4OXPA 4PNYA 2E2JH 4NDXA 2WAQE 2WTFA 4IJLA 2R8JA 1D5XC 2I5MX 2I5HA 3QJYA 3MXNB 2O5JC 2NVYA 4RGNA 4A3EH 1JXLA 2FE3A 2FK2A 4DL4A 1SNDA 2QW7A 5LHY1 2Z4IA 3NTHA 2OCEA 4KD3A 4RHSA 2UUBQ 3GTOA 3CP0A 1K83A 2AU0A 2GPSA 3GTKH 4DV3L 3HOXB 4BBSB 1JWSD 2YTYA 2XWJB 3K81C 3A55A 2XD4A 3K5OA 4KKTA 5COYA 2GLTA 4K8JA 4IRKA 1KBLA 4TV8F 1XX8A 4QWAA 5CV5A 4L5TA 2F52A 4KI0A 4K6LA 1I7LA 1S97A 2UXCL 4MAMA 2UUAH 3RGXA 3E0EA 3VPDA 2ZXOA 4LF5H 1JOQA 4HNVA 3BVMA 4ECVA 3OIQA 4MHEA 4A3DG 4KLKA 4AQYQ 5KG4A 1TY2A 4DR7L 3H15A 3HXLA 3I55A 1L1OA 1SNQA 4UCRA 3MVVA 4WD3A 4YBZB 1D1IA 5DQHA 4L5RC 4L5SA 4OO1H 5LMUL 4NKLA 3H40A 2DPJA 1PTOF 5IT9W 3A8KE 4B3ML 2NVQB 2D9UA 2F1MA 2SNMA 1BJTA 3G71A 3HKZG 3FEWX 4JVZA 2XIGA 2UVWA 4JV5Q 3WO0A 4MV1A 4FS2A 3D8GA 1S5CD 4KD4A 1EY0A 3PIO3 5IT9L 5T1GA 3OWEB 2YYAA 1X3FA 1EWCA 4YWLA 1EWIA 4ME3A 1CM9A 2JYOA 1B3AA 2WFWA 4O1NA 4XYOA 1KD1C 3D31A 4AYBA 3BQ0A 5C6AA 4A4IA 5C4JB 1Q86C 1B7YB 4JC0A 3NSWA 4UCVA 2RHSB 4RKBA 5EGTA 4DXGA 2NVQH 1RTOA 5EPJA 4DV0L 5GADC 1J5EH 2UUCH 2JA7B 4DV7Q 3E3XA 2F0JA 2K75A 3F2BA 4IPCA 1EYGA 4MZ9A 5C0XJ 5GQOA 3QIAA 3K59A 2JA5B 4PZ6A 3S1MB 5EKLA 1R4PB 4R8IA 3STBC 5EPKA 1Y1VA 1NMFA 2DPIA 5KFXA 3BYTB 5J22A 2YW2A 1U5KA 4MV9A 2WE6A 4X6AH 2ZTEA 4GLXA 1N32Q 5C4JH 3A5UA 4DUZQ 4HYKA 1FL0A 2DJGC 1CTMA 4NXNQ 1ENFA 5IIFA 4NP5A 3EBEA 2AQ3B 4MTKA 3SGIA 3H20A 4ME6A 5H1SE 1QVGA 1K1SA 1QVCA 4BA1I 4O0AA 3M85A 2NBFA 4GKJH 1CKOA 3HOZB 2BDOA 4LF6H 3PIPA 2UU9L 1QCBD 3K3PA 3W2DA 3T4AC 1MI2A 2KHIA 1XXGA 3V96A 5GROA 3U9SA 4ZLTF 1VKZA 4FU0A 2N55A 4UCUA 4B3TH 2JA5H 1ULZA 3S1MH 4LF8L 3G48A 4QQBX 3HG9A 5JVH3 4B3SH 5IYBH 4ZRZA 4JI0H 3M7GA 2W6MA 3GV6A 2MJ8A 2BA1A 4KV6A 1TXYA 1GUSA 2JJQA 2Z0SA 1Z7TA 1JDBB 3ETJA 5CGKA 3FPPA 1JC7A 4V0BA 4IURA 2B63B 3L4KA 1A2TA 4DR1Q 1S68A 4IOAA 5CAEB 2D5DA 4DV5Q 2IJ0A 4ZUJA 3TS0A 3HOZH 1TWFH 1SCUB 1QUQB 3OSOA 1KNAA 2UXBL 1A9XA 1UC8A 1GJXA 3TQTA 2AQ1B 2FLNA 4EG0A 3PQIA 5F2DA 5KFQA 1U9RA 4ECSA 4YJ3F 2B2TC 2F3WA 3H3VC 4GN3B 5DM63 1CA6A 1Q1EA 3BG3A 2VQEH 4ILWA 1QZHA 2R92B 4C3JG 4DL2A 5IODA 5JJZA 1PX2A 3TMEA 1G2TA 4F4XA 1PZKD 4DR5H 2GVBA 5IY0A 2K05A 3A0JA 2QEXA 4JI1H 4QUCA 2ICIA 2O4XA 4WJWA 2C35B 2FJZA 1B70B 3LWUA 3TZUA 1TVXA 2B63H 2R8KA 1K8GA 2J6SA 4UFZA 2SNSA 2RDIA 2SDFA 1XMQL 5EZYF 4DR2L 2CWPA 5KG3A 4O3QA 2Y0SB 2JA7A 3DUZA 3GTLB 5C5JA 2N3SA 4QWBA 1PFMA 4B3RH 1SYBA 1RJTA 4YHHQ 3IFDA 1MHWC 1KL9A 3P7JA 3CQZB 4DV3H 3K5NA 3GD7A 3BQ2A 4C3IG 3TP7A 2YU9B 3V4SA 2KEDA 2KHSA 2R92H 3D4RA 3Q8SB 2BH8A 5KFBA 2A68C 2YS6A 4DR4Q 1JE5A 5D3DA 2HHHL 2VOBA 5IWAQ 1EUCB 1AW7A 1HFNA 3Q22A 4BWGB 2UXCH 3ORRA 4MV3A 4JOIC 3STBD 1YITA 4I4TF 2K6AA 2E5LQ 5M3MG 3GTLH 4J1MA 3VA7A 4OX9L 1MJCA 5CA0F 3KHLA 4DR7H 1TWGB 1M1KC 4DV1H 4GOPC 4YWMA 5KGUA 5KFFA 5KG7A 2YU9H 2QGQA 4NXMQ 3DF7A 5FO9B 3J81W 3V4ZA 2V4DA 5LMUH 1O78A 3NK9A 1S0OA 1PH3A 4B3MH 1V4YA 1HHVA 3QG1A 5DG9A 4ECQA 4A3KH 4K2LA 1WTPA 3J7AV 3G6YA 4A3LH 1EYZA 1TWHB 3EIVA 3I4OA 1DJRD 3HBLA 1B2TA 1HTLD 4EFBA 2MUYA 4X62Q 4FBUA 1QUQA 2EYLA 3CRLC 2PBZA 3J81L 3MR2A 2EYFA 2VR1A 2MP1A 2DUDA 5CV9A 3Q1KA 1RF2D 3MXPA 4WFN3 1ICFB 1M0WA 5DG8A 1FVIA 1TWGH 1E2VA 4LFCL 1I50A 1Y8OB 2AWNA 4OWWB 5IYZF 4FNFA 2GPWA 5KX5F 1IW7C 3RAXA 4DAYB 1LTTD 4KHZA 2WB1B 1SNPA 5A2QE 4J9SA 4O2BF 3TRZA 2QCPX 4DV0H 2W6PA 5KNDA 3GIJA 2RKSA 2L4NA 2EYHA 3G6EA 1TWHH 4E4TA 4DR3L 5IGCA 3S2DH 3KALA 4YP3A 4YCWA 2ZDQA 1BNCA 1V1PB 2EDGA 3D6WA 3ITPA 3KJOA 1XPUA 1A6XA 3E9HA 2MHVA 1VQBA 3LWEA 3HOVB 1DIKA 4MTDA 3NQTA 4JUZA 1EHIA 1S4ZA 1Y8PB 2F0EA 3Q8RB 1AE3A 2NVXH 2UXDL 2JEBI 4AYBG 2R84A 2K7VA 2IL8A 1BCPF 5AJ3L 4J6HA 1UNSA 4EQPA 4JI5Q 1GSAA 2DLNA 4EGJA 1N48A 4POGA 1RODA 1JQYD 2BQ3A 1ML0D 1PFBA 1WOCA 2YRWA 4F4WA 4RB2C 4CC6A 2Q8TA 2E76C 1TWCA 2UU9H 4FVMA 2IX0A 1F9QA 4CJ1B 4TQUS 2VPSA 4GC7A 1JJCB 1XNQL 2FPIB 2KENA 2OQ0A 1OO9B 4A3BG 4DV2L 2V9WA 2RDFA 3HRZC 1IBKL 4LF8H 2EJGC 3PUZA 4GKKH 2Q8IB 4DV6Q 3HOVH 3HOXG 1LT4D 3RZOH 4ALPA 4BBSG 3PZPA 1JCKB 1BVSA 2NN6G 2A68D 2G9DA 4JI7Q 4ED7A 2VQFH 5KFAA 3RTXA 1XYIA 3AU7A 1B53A 5KT2A 5E1FA 2DN8A 4I7HA 1CA5A 3M9NB 5T1IA 4AH6A 4A3GB 3CC7A 1Q7YC 1LYLA 2FMMA 3NBHB 3U58A 2XGTA 2EY1A 5F9NA 1EQVA 1ASZA 3NENA 1YNNC 3GV3A 1HNXQ 2NYZD 5ELDA 4LFBL 3KAJA 2UXBH 5BMVF 1N9WA 1MIUA 1K0RA 1PH5A 2JA6B 4NW2A 5CYUA 2F4VQ 2A74C 4XQNA 1YJ9A 1HNWQ 4LSXA 2VW9A 5JEAH 1EZ8A 2EYOA 2ASDA 1B8AA 3AMUA 4YY3Q 3Q2OA 4DKAC 4HSPA 1EY8A 5FLXE 1HNZQ 4DA2A 1FJGL 3S2HB 2FMAA 4CGYB 2R7MA 2WB1A 5KT3A 3K7UC 4LF4Q 1WI5A 3Q8QB 2CH4W 5IGDA 5JQWA 5FLMH 4EYHB 5BR8L 4HQ6A 4A93B 3GTQB 1ZEQX 3C3LA 1B6SA 4DR2H 1XMQH 1I4GA 1Y1WB 1SE2A 1SEBD 3KF6A 2BR0A 4RKLA 3I72A 2HDMA 1GYFA 3MXUA 2ES2A 2RSOA 2JA6H 2KOLA 3QR8A 1O75A 1NR4A 4RGOS 4F50A 3E6ZX 4JI6Q 1XWEA 1IW7D 2L5TA 4GOPB 4EX5A 1CKNB 3FMCA 2CW8A 3MEFA 4IOCA 4CJ0B 4BY1G 5C44B 4N8FA 1AZPA 2JA8G 4J9MA 1DOLA 5AFWA 1XNRQ 4ZKBB 1K3BC 1PZID 1CQVA 1YJNA 3JC66 1LTAD 1XMOL 3S17B 4QW9A 4HIMA 5GAHC 3MR3A 3HOYB 2HHHH 1QOHA 5EDWA 3RN2A 1N33L 1CQIB 5C5MA 4J9KA 5I6WA 2L11A 1ILQA 2WAQA 1EIFA 3R5XA 2JA7G 2I0QA 4HJ9A 1Y1WH 1R9TB 4DR6Q 4YJ2F 1SYFA 3BG5A 2VUMB 3TP5A 3BZCA 2ALZA 4OX9H 3S24A 4JBKA 1VQKA 4JV1A 2KHJA 3ULLA 3ERSX 3ZYYX 4L1KA 4QWEA 4BBRG 5DM73 1G2SA 4F8MA 3KUPA 4PV1C 5IGFA 2BCOA 1Z2PX 3T5KA 2QDBA 5C3XA 2FK3A 5LA6F 4L63B 5C44H 5FJ8G 4P75A 5D8DA 2VA2A 5KIXA 4RZRA 3HOWB 1ESFA 4IZOA 3V2TA 1A2UA 2RCNA 4BA2I 2EXDA 2O5IC 1UNNC 5CMDA 4ECTA 3N42B 3PR4A 1BO0A 2FXQA 5KFZA 4X3KA 4ZKCB 4O4LF 4L6TB 3K5MA 1L0XB 2EZVA 4YAKB 4FO2A 2NTTA 3ONAB 1JDEA 3M3YB 4CBVA 1STEA 3OUUA 4APMA 1O7LA 3N6RA 2X0SA 3LWBA 1XPOA 5IP9H 3S16H 4XYMB 4WRDA 5ELNA 3KLWA 4PG3A 2OTJA 1QJOA 1A0IA 1QG7A 3FKIA 4LFCH 4A3MB 4ID6A 5IGEA 5KKNB 4GS3A 2RF4A 3RB3A 2Y0SE 2PI2E 4K14A 1KABA 5ELCA 3IN5A 4JV2A 5IYCG 2F0FA 2K04A 2QDLA 1I7NA 3T1HH 3I73A 5I47A 1YNND 4YWKA 1LLRD 3N6XA 2UVUA 4HAEA 4P74A 4KTAA 3P75A 1Z2OX 3I4MB 1I94Q 3RBEA 5HGQA 5IP7H 1B04A 1SDFA 3CMAA 3S1QH 4DNRB 3TIGA 4DR3H 2RA4A 4JOIA 2K32A 3Q0AA 5I2YA 5E4XA 4R4OA 2KECA 2M9VA 2R86A 3HS0C 1DV2A 4FBTA 5LL6S 3KFUA 3GTMA 2MCTA 4GOPA 5JVLA 4A3MH 5KFJA 1CKNA 3GTPH 2UXDH 1ZQ7A 3TZDA 2EY6A 3GV5B 4DAVA 1I4PA 1X56A 4RGTA 4C3HB 1EQTA 5IT9E 1HR0Q 3K80C 2OQKA 2JE6I 1L0YB 2AWOA 2BQRA 3T56B 1I4HA 3WO1A 4C3JH 1TWAB 1RTNA 5ELOA 5KFYA 2AGPA 4XX0B 3DEOA 2C22A 1QNUA 5T14A 1KAAA 5JEAJ 3GO5A 2LY7A 4FF1A 1UAPA 5JOBA 1G91A 2RVLA 3I3CA 1D7QA 1XNQH 3WDNA 3I4NB 2R6GA 5KFVA 3GIMA 3D0FA 3FP9A 2VUMA 2B2YC 1VQFA 1VQJA 4A3FB 4DV2H 1IBKH 1CK1A 3GIQA 2WINB 2R93A 4O2AF 4FYDA 3KHHA 4A76A 2RQXA 2E75C 3S14H 2EVBA 1ESRA 5JVG3 4HR7B 2GA4B 4MN3A 4H13C 1SNCA 4A3JG 4BWSC 4C3HH 1JR0D 1KXLA 1S40A 2F0OA 1ICWA 4J15A 2UUAQ 3S15H 4ED0A 1WFQA 1B9NA 4K6DA 1XJVA 4B3TL 4LF5Q 1D1KA 4A3CG 4OWXB 1BXRA 5J3BA 4OONA 3VYRA 3G6JB 4LFBH 4PQXA 2W9BA 3W1GA 1WTXA 3F2UA 1CHPD 3RLNA 2VS1A 4JG2A 5C0XH 4ZHQF 1I4XA 4JI0L 4A3IB 2F0SA 2ZJRA 5CORA 2E2JB 1KJ8A 3K5IA 4EQ5A 1FJGH 4NPSA 5KFDA 1EOTA 2O2LD 2Z6KC 5IE8A 2VXWA 5I4DA 3RB6A 1VQ8A 1C7YA 2NUCA 1GUTA 2ZXRA 3BAAA 4OO1I 5BR8H 4CDEC 1YI2A 4JI4L 3GTKB 2V4RA 3MZ5A 4WORA 1IYVA 4RB0A 1HZCA 2A6HD 1EU3A 2BQUA 5HBRB 1VF7A 2MPMA 2R7FA 3I70A 3AFQA 1T94A 4A3IH 2K28A 2J4XA 3RLFA 2FHTA 2CW7A 4HTHA 2PQEA 1A3TA 1Z2NX 2Z9HA 2C2EA 3G6VA 1JOKA 3NUCA 2X69A 2TMPA 5KG1A 4X66Q 4RH6A 3PSIA 2NUAB 3EPGA 1XMOH 1MBYA 1O80A 2WB1G 4CHTB 3GQBA 5IYDG 5IGGA 1STNA 3OTOQ 4ABNA 4B3RL 1N33H 1TWAA 5JPNC 1G6PA 1X32A 1OXTA 3KLSX 1H9KA 4CKBA 2B2UC 4IALA 2R7ZH 4JYAQ 1RJQA 4G7OC 3BJYA 5EWFA 1EU4A 1ZHQA 1GUNA 3G6XA 2W8KA 5C1PA 1S72A 2AQ4A 1SEIA 4O3SA 1YJWA 3OSNA 3T16A 1KC8C 3MWEA 5GONF 2V58A 4FS1A 3Q23A 3BJUA 5KNBA 4XT1B 3NE5B 3JAMc 1UE7A 2IMWP 4X3TA 1ENAA 2BE5C 4XYLB 2DY7A 3S1RB 1B44D 4HR7A 1SN8A 3SK5A 4R4CA 3F2DA 2VY3A 5G3LD 4GKJQ 5C4XB 3N41B 3DMUA 5LYJF 4LF6Q 4BXXH 2RGRA 4ZUIA 3L4JA 5K2MA 1M90C 4LUZA 4K5WA 5C3EH 1K0SA 2HJWA 2MQHA 4DV1L 2WAQG 5M3FH 2XNAC 1LTLA 3DM1A 3VR3A 2AGOA 2F0KA 1EYDA 1PA6A 2FK1A 2R6FA 1XTDA 3WOFA 4B3SQ 1IOVA 5M5WH 3PUYA 1QILA 4X65L 3SEBA 2ZDGA 2YTXA 5EWEA 3IRBA 4IUTA 1JIHA 1N36Q 1N34Q 3J7AF 2NWGA 1E3PA 3E0JA 4Y7NH 2X6LA 2MNAA 4A3BH 1Y1VH 2ID0A 4KN4C 4RMFA 3S1RH 3I56A 4DUYQ 1JWUD 1UUPA 4TSSA 5C4XH 4A3GG 1H9SB 4X64Q 4R4IA 4LW1A 3HOUG 5C1OA 2CQOA 4DN4M 4JI2L 3GTKA 4PMCA 5HGTA 1S0MA 1RYSA 4IFDH 2E8GA 2F03A 1HA6A 3BS1A 4DR1L 3CRKC 5EPLA 3CCVA 4OHJA 4UP8A 4J8QA 1WYDA 4DV4L 1H9JA 3NP8A 4KHPL 1X54A 3A5ZB 3FDTA 2VQEQ 3I2ZA 4POFA 2VZAA 5KFKA 1IBLQ 3FKIG 4RFBA 1GO3E 5FK9C 4HIOA 4O2DA 2IHEA 1K8MA 3KXYT 2ZM6Q 1HUMA 2PO4A 4QF4A 3J81E 3L2PA 1WTOA 1KJIA 3VPCA 3MXNA 2E2DC 2C9OA 4FP5D 2FMCA 3J81i 4U68A 1QNKA 2WKDA 3KYHC 2OF1A 2A5HA 1GKHA 5JJKA 1B1ZA 1NTGA 3KJPA 2SCUB 4RB1A 4PZ8A 2PPBC 2HIVA 1EIGA 5FO7B 4RNNA 3GP7A 2R8GA 3RJ0A 2J9GA 4HNUA 3H09A 4JK1C 1S5FD 4JW0A 2I8CA 3DXJC 2DJFC 3H0GB 2SOBA 2OT2A 4G4KA 4K8IA 3U4ZA 5K36H 5KFHA 3MR5A 3G7LA 5C4HA 4LFAQ 4YHHL 3MWMA 1I3QH 4J9QA 3LMLA 4ED1A 1X9NA 4PDBA 1TWFB 5L1IA 1H9MA 2OXPA 3RMHA 1E24A 1MJEA 1VQMA 4IAJA 4BY1H 3PW4A 2C00A 4ECXA 3GIPA 4EQNA 5L1KA 3HOYG 3K8AA 2XGQA 4DPGA 4DR4L 4GKKL 4QGUA 5KFGA 4ZQ3A 3JSNA 4MV8A 1S5ED 4DR7Q 2K50A 5KFEA 3OHXC 2VQFL 1GHJA 2DNEA 3H0GH 3L0OA 2VUMG 4Q43A 2EY5A 1I4RA 1SYGA 2R93G 1A63A 4JBWA 2BE5D 5J2TF 5LMUQ 3VDYA 3JRXA 4B3MQ 2MO0A 4PZ7A 3GILA 1T9HA 4Z9CB 4F4ZA 4LF7L 1VBGA 1UEBA 5KT7A 4NXML 3M4OB 2E74C 5CBAE 2QILA 1YHQA 1WCMH 4CKEA 3PIOA 3R5HA 2K03A 4B08A 5FPRA 1R4QB 3GIKA 4JI4H 5EJWA 5GAEC 1H9SA 2QK4A 2PW7A 1HZAA 2C2DA 4RB3C 1KRTA 1G51A 3P20A 1YIJA 2RDJA 2PYKA 3Q8DA 3RUZA 2NVTH 3QFFA 4GLVB 2KCMA 3E5SA 1F2MA 2B2YA 1OXUA 4F88A 4JV5H 3PO2H 4OEMB 1X3PA 2AUKA 2PQAB 3CCRA 5E7NA 5CR3A 3KBGA 4FDBA 1DD2A 4ETSA 3MFIA 1TS3A 3QB3A 5CV7A 4IN3A 1GSOA 5KFLA 5LMNQ 4I55F 2EJFC 3M4OH 1OTCA 2PMZB 3RV4A 1YEZA 4ECYA 3M4IA 1G291 1LTRD 2JA5A 1NMGA 4APVA 5IYCH 4B9XA 3PO3B 3KHRA 4OELB 1VDZA 3D6CA 4GC6A 5CV6A 4GNXC 4LMQD 2P5ZX 4QY7A 4ULLA 1BBUA 2K5VA 4A3KB 3TP8A 3HGBA 2ZJQA 2F4IA 4IZ8A 4KN7C 5KT6A 2NU6B 4ZCKA 1PTOH 2CW0C 3NWTA 3TP6A 3BU2A 4IFDJ 5D1OB 4DAMA 1CS0A 3SK8A 1TWFA 5BN5A 2LFNA 1I50H 4Q45A 3IKJA 4JI5L 2UU9Q 3GIIA 4LUVA 1K73C 4M7EA 4IUPA 3PO3H 3F8NA 2NZOA 1E0BA 1LABA 1LTID 3C46A 1N8RC 5KFWA 3VR2A 3N40P 4K0KL 1ZHSA 2VA3A 3I4NG 4X65H 2FPGB 3J80W 2FPPB 1LT6D 1PFNA 3OPOA 2E2HH 1JORA 1SROA 1U4RA 1IOWA 4O4HF 1AE2A 1X65A 4LWCA 3MJFA 3FHWA 2B63A 1PH8A 1O7YA 2Q2UA 1WH2A 1MD2D 4J9NA 4DV6L 1I6HH 4IR1A 3S2DB 3RGZA 2K5QA 3BQ1A 2WKCA 3J80c 5JH7F 5HV6A 2D62A 3GTGH 2JEJA 1EZ6A 4JI2H 3J80L 3M4QA 4JBJA 3NPPA 4K5XA 3TREA 4A3JH 2F3IA 2KEEA 3L7ZC 2XN9C 4DR1H 3U9TA 2NVXB 1DCZA 3QWNA 1L0WA 1SBBB 5IGBA 3SDZA 4DV4H 4KHPH 2R92A 2KCTA 4ME5A 1H95A 3C2PA 2W57A 4BY7H 1VQPA 1RCVD 2AQ2B 2KVMA 3T1HL 2HGSA 3SE7A 4MNOA 2C28A 1STYA 1EZ1A 2ASLA 1BCPC 2C5CA 5K5PA 4LF9Q 3TEHB 4DNIA 3H3VI 4I7ZC 4J9RA 4KJNA 4A3EG 1BQQT 2F0LA 1PHJA 1CSQA 2A6EC 3OMCA 3QOLA 1HNZL 2RDHA 3H6MA 2Y0SA 2EIFA 2NB0A 2PI2A 4U7CA 2IP4A 3D3RA 3GTLA 1E1OA 3FVQA 3EQLC 4CKCA 2B2VC 3A8IE 3NHHA 4KY5A 3S9WA 4DR2Q 4DL6A 2EXZA 1OXXK 5LL6b 4KK7A 3CQZA 3O13A 2W7PA 4IUNA 3RZOB 3PR5B 4V190 1M8AA 3UI2A 1RL2A 3PN1A 2YU9A 5L1JA 1VQ5A 1WTWA 5KFUA 2ATLA 4NB3A 3T1YQ 4EYIB 2WP8J 2R87A 4YHHH 1JMCA 5KFCA 2XC9A 4ECZA 4UCSA 3F2CA 2NU8B 2Q2IA 2PW5A 3V6JA 4I65A 1PYBA 1QWYA 2HHHQ 3K3VA 1GHKA 2IX3A 3E5NA 4RNMA 1N56A 5D3IB 2I5LX 3T5LA 3ULPA 3CC4A 2OH2A 3LNNA 4DR4H 2JK8A 1TWGA 1CT1D 4DU9A 5FD6A 3BA8A 4G3IA 1TQOA 3PF4A 4A3DB 3K57A 5ISRA 1V1QA 2K5HA 3CCQA 1VQ6A 4OO1G 3BA9A 2CW0D 4IPGA 1YHAA 4MA0A 2F0IA 2F0DA 1PH6A 4TV9F 2HCIA 3TN2A 3BVGA 4ED2A 2G5DA 2Z4HA 1RD9D 1Z9FA 1TWHA 4LF7H 4NXMH 4I50F 1PRTC 2EE1A 1UE6A 3M4YA 3TDQA 2E2IB 4B9WA 4XDXA 2QF7A 4U6PA 2F0TA 3FDSA 5CC4A 2HVQA 3RV3A 3MXGA 2NVXA 3KLRA 3EYYA 3GV7B 4C56C 3DHQA 1CZGA 4GNXB 1A3UA 4A3DH 4DAYA 3D4DA 1IKLA 3NTIA 4ZQIA 2V1CC 2EQSA 3PUVA 2AUJD 1E4EB 5I9OA 1I4QA 1JT8A 1SFOH 4QIWE 1GM5A 2C2RA 4HNTA 2B29A 5J2UF 1BF4A 3MWDA 1VQHA 3ND9A 4PMBA 3PUXA 1UEAB 4RHRA 4CDDC 3RF2A 2GN5A 3OW2A 1EUDB 1V1PA 5KYLA 2E2IH 1JJGA 2UVRA 1JJ2A 1A3VA 3AB9A 2R7KA 4O42A 1NNXA 4ECRA 1PFSA 1E2ZA 3I12A 1BCPD 4DXFA 4A75A 1HR0W 3CPFA 4IJHA 1M4VA 1YNJC 2XCAA 3K58A 4JI8L 1L1OC 1P16A 3D4WA 4LMYA 2CWAA 4HCEA 2L1BA 4RAUC 3EPIA 2YRXA 4KKSA 4G57A 4NLGA 3S16B 1E4GT 4RUCA 4JI5H 2KQ3A 5KFTA 2JEIA 4M8AA 1VQ7A 1HR0L 2YL2A 3RNUA 2B2TA 1CI3M 1EY7A 3M9BA 2JA5G 1XNQQ 4QCLA 4DK6C 1CUKA 4MV7A 1SNMA 4J0MA 2IX1A 1LACA 1CKMA 2RDGA 4RCNA 4DV2Q 5IYBG 1IBKQ 5DQGA 4K0KH 2F0GA 2HCCA 3I7FA 1PV4A 4MIUA 5M5YH 1M0TA 2F0UA 1BCPB 1K3RA 1YVCA 3PCOB 1UE1A 4JI3Q 3NBHA 1V9PA 1RK5A 4DV6H 3S1QB 1C30A 1NAPA 3GTJH 4FF2A 4MV4A 3BDOA 3NWSA 4XIGS 3HOZG 5F9LA 4JI7H 3VMMA 1LT3D 1VQ4A 1W3SA 5DEHA 4FF3A 2JA6A 4HN7A 3J81j 4YB8B 1EIHA 2K4KA 3ICEA 2IHFA 1HUNA 2ENBA 3GTPB 1VQOA 4EGVA 1GSHA 2IT1A 3HFZB 1AFPA 4F7XA 1KHIA 1VMCA 4YQWA 4GNXA 1IBMQ 2PMZE 3RZDH 5CV4A 3R93A 2XWBB 3PGZA 4TRDA 4A2AA 2LMCB 4HMIA 3UFXB 4C3JB 5C0XI 4RZQA 2XTIA 4F4YA 1E4EA 2EYMA 5EQ0A 3SK6A 1V43A 3ER0A 2P0AA 2RSNA 1PRTD 2B63G 4P73A 1FYCA 1HNZH 3GTQA 2DY8A 3L3OC 5BR8Q 4WJ4A 4OGQC 5KT4A 1LUZA 1TS5A 1Y1WA 1C8CA 4QB4A 4UAIA 3RUPA 3N52A 4ZOLF 3OSPA 2D0OA 4RU9A 2B8FA 3RLOA 4C2MB 3BVZA 5HY6A 2R92G 3S14B 4TKOB 4GN5A 4A2BA 2EY2A 2VUGA 4O3PA 2FFKB 2ASBA 2Q2HA 3H91A 4C3IB 1DZ1A 3UE0A 2J0TD 1HJPA 3S15B 2K52A 2W9CB 4EBCA 2YZGA 1BDOA 3UE1A 3VR4A 1WD0A 3CCLA 4RUAA 4TQRA 5EBDA 1PRTB 3TBIB 1KIXA 3GV8B 4EEYA 1R9TA 2TSSA 2Y0SG 2M00A 1KJJA 4C5AA 1HQRD 1YNXA 4ED6A 1T5EA 3HB9A 3EROA 3KLSA 2D0PA 3OTOL 1TU2B 4R7RA 3VYUA 2UUBL 1EFWA 1ZXTA 5I6YA 3T51B 1YNJD 3SXHA 1JE4A 4JYAL 3GTOB 1K83B 3CKIB 5EAYA 4C2MH 1ILPA 1V51A 1IKMA 4UDUC 4TVAB 4MV6A 1QE6A 4Y8VB 3TIIA 1TS2A 1DXMA 3UDXA 4C3IH 4A3KG 1YBYA 2KUMA 4CDFC 4UCOA 1SYEA 4UP9A 1EIYB 4A3LG 5ELBA 3T5JA 4K2KA 1O7IA 2EYPA 2L9HA 4RNOA 4LNQA 3QO2A 4CC5A 4J9OA 2VB2X 3KHGA 3A74A 5EKIA 1GUWA 1D5ZC 5CB4F 3BZKA 2NVYH 4FF4A 4MTNA 1TA8A 2N78A 5LOVF 3K7AH 2LSSA 2KJXA 3N44B 1F9SA 1Q82C 5M3MH 4AQYL 2JP1A 2V4QA 3GTOH 4IR9A 1K83H 3EJIA 2M2LA 1SYXB 2ZDHA 3I90A 2NZ1D 2ATWA 1L1OB 4ED8A 3T5HA 2R7ZB 5M9OA 4HSVA 2HVSA 2A73B 5NUCA 2LXKA 4J9PA 2L55A 4LJZC 1N34L 1N36L 1SAPA 4FM9A 1X3EA 5KFMA 1IXRA 2CZGA 4NMZA 2IBKA 1UWVA 2HVRA 3OUZA 1EEID 1TY0A 4OL7A 4JV5L 1JB3A 3E9IA 2YZMA 3DWQA 2R3ZA 2CVRA 3CC2A 4DL3A 3MWYW 2OWOA 2L15A 3C1EA 4OWTB 1GUGA 4LK1C 5E3FA 2YZNA 1AN7A 3RFCA 4IHJF 1J5EQ 2UUCQ 1Z6HA 3ULJA 4AYBB 3RN5A 4JI8H 5C3EB 4QWDA 1KLUD 2F0VA 2N8NA 3A7LA 3CXCA 1Y8NB 5C3WA 5M3FB 2W9AA 1D5MC 5CV8A 2ZM6L 3C1FA 4YCVA 1DM0B 3HZXA 3JAMW 2AHOB 2PNHA 3W1BA 2ZXPA 4DV7L 1HR0H 1ET6A 1STAA 5M5WB 1EYCA 4RCOA 1A15A 1CQFA 1QZGA 5LP6F 2Q8RE 3R5FA 1JICA 4GZYC 3BZDB 3HOVG 1HPCA 4Y7NB 2CFMA 2H5XA 2LKVA 3U9OA 4A3BB 1DONA 1PTOC 3F1ZA 1Y1VB 5JJIA 3HKZE 2I46A 4IPDA 1H9RA 2AMCB 3AFPA 3JAML 2FLLA 5FO8B 2W8LA 1N32L 4DUZL 1AH9A 1X3GA 1RIPA 4J9LA 2WIIB 4NXNL 1WJJA 4LFAL 4OIKA 5BN3A 2KSWA 5DLGA 1GUOA 2KBNA 1VF5C 3M9OB 5LL6X 2W71A 4XQJA 1PVOA 3PUWA 3K5LA 4B3TQ 1RK6A 2KCNA 1YHBA 4KHVA 3J7A5 3BYYB 5KG6A 4IRCA 4C1NK 3FPUB 1F2ZA 1KAWA 1LM0A 4EVOA 5JEAG 4JI0Q 5DQIA 3EN2A 1BR9A 2RHQB 1HCZA 2CH4A 3NTKA 4EBEA 1AP0A 2XRQD 3PIP3 1SJHD 3FRPB 1F9PA 2JEFA 5I9PA 1S0NA 1UC9A 1HTPA 5HURA 3HOXH 3M4PA 1K9MC 4BBSH 1SR3A 2NN6H 1CE8A 3R3OA 5FLMG 2YTVA 4G7HC 2R7ZA 3H94A 1HQMC 4JI4Q 4S3SA 3V6KA 4DNTB 1NSNS 1EFID 1VQEA 2FB9A 4DV5L 2JA6G 1CFMA 1V8QA 3W5OA 1XTCD 2I80A 3VPBA 1EY9A 2N49A 1I3QB 1EQQA 3L9AX 5FKAC 2JXMB 1RHPA
chains in the Genus database with same CATH topology
5IT9c 4DR5Q 4JI1Q 3NELA 5FLMH 3PO3H 5BR8L 2NZOA 1HZ9A 1S3OA 1N8RC 5LMNW 4K0KL 3KF6A 2MO1A 4Y52H 5FLXc 3I4NG 1FGUA 4PMWA 3J80i 4GKJL 2ES2A 2ZTDA 4R4QA 2JQOA 2R7DA 3DM3A 3K0XA 3UDIA 4HJ5A 2E2HH 4LF6L 2JA6H 1SROA 3CMEA 4JI6Q 4B3RQ 1AE2A 1X65A 1HZBA 4LWCA 4EX5A 4GOPB 4A93G 3FHWA 1CKNB 1TWAH 1PH8A 2Q2UA 3MEFA 4DV3Q 1Y1WG 4DV6L 4IOCA 4BY7G 1I6HH 4BY1G 2JA8G 2QA4A 3J80c 1XNRQ 2WB1E 4B3SL 5LMNL 3B6YA 2D62A 3GTGH 1E22A 3CCUA 3JC66 1YJNA 1XMOL 3I4NH 3M4QA 2MFIA 4JBJA 4HIMA 1P8LA 2DGYA 3TREA 5GAHC 4A3JH 4A3FH 2F3IA 3L7ZC 5C44G 3RN2A 1N33L 1L0WA 4UY8C 2KCTA 1DGSA 1H95A 1EIFA 2JA7G 1A62A 4HJ9A 2ZJPA 1Y1WH 2I0QA 2UXCQ 4DR6Q 4BY7H 4DUYL 1VQPA 3BZCA 3PF5A 3S24A 2NN6I 2JA8H 3T1HL 4X64L 4JBKA 4MNOA 1VQKA 2KHJA 3ULLA 3ERSX 4IPHA 3J7ZC 1ASYA 4LF9Q 3KF8B 3TEHB 4BBRG 1C9OA 4DNIA 3H3VI 4IFDI 5IWAL 4A3EG 1PH2A 4DV1Q 1X55A 5IP9G 1PHJA 1NJIC 1CSQA 5C44H 1I5FA 5FJ8G 1HNZL 4P75A 2VQEL 2EIFA 2PI2A 1K8AC 2E5LL 1E1OA 4DR2Q 3G4SA 1IBLL 3CAMA 2JA7H 2RCNA 4BA2I 2EXDA 1OXXK 3DLLA 3CD6A 4X65Q 4DR5L 4JI1L 2FXQA 4OXPA 4IO9A 2ALYB 2E2JH 2WAQE 2ZTCA 1RL2A 4IJLA 2I5MX 4BBRH 1VQIA 2I5HA 1VQ5A 3MXNB 3HOWG 4NB3A 3T1YQ 4A3EH 2WP8J 1XPOA 5IP9H 4LF4Q 3S16H 5FJ8H 1JMCA 3NEMA 3KLWA 4PG3A 5ELNA 3F2CA 2OTJA 1MKHA 5IP7G 2Q2IA 1A0IA 2UUBQ 2OCEA 4JI2Q 3CP0A 4GS3A 2RF4A 3GTKH 4DV3L 1PYBA 2HHHQ 2Y0SE 2PI2E 2YTYA 4JBMA 3K81C 2IY5B 2JA9A 4X62L 5IYCG 4DV4Q 4KHPQ 2I5LX 3ULPA 4R1JA 4GLAC 4A3MG 4YWKA 3CC4A 1KQSA 4P74A 2JK8A 2A8VA 1I94Q 5HGQA 5IP7H 3CMAA 3PF4A 4QL5A 4DV0Q 4L5TA 3S1QH 2F52A 4KI0A 4JOIA 1V1QA 1VS0A 2K5HA 3CCQA 1VQ6A 1NY4A 4R4OA 4OO1G 2UXCL 4IPGA 1YHAA 3E0EA 1PH6A 3I4MG 3KFUA 4LF9L 4GOPA 4A3DG 1IL2A 4KLKA 3CF5A 4HJAA 1CKNA 4AQYQ 4A3MH 3GTPH 4H02A 1Z9FA 1PYSB 4DR7L 3H15A 1X56A 1HH2P 1OXSC 1Q1BA 3I55A 1L1OA 1UE6A 3K80C 1HR0Q 2OQKA 2JE6I 2AWOA 2NZHA 4L5RC 4L5SA 1EQRA 4C3JH 5LMUL 1Y14B 5ELOA 1NBWA 2Z6KA 4B3ML 5JEAJ 3GO5A 3G71A 4GNXB 3HKZG 4A3DH 1D7QA 3T1YL 2V1CC 2EQSA 2R6GA 2YYZA 3D0FA 3FP9A 3PUVA 1VQFA 1VQJA 4JV5Q 3AYHB 3PV0A 3LGJA 1JT8A 1SFOH 4QIWE 1GM5A 2B29A 2BH2A 4LF8Q 1X3FA 4YWLA 5C0XG 4GKKQ 4A76A 1VQHA 3S1NH 1EWIA 4ME3A 3S14H 3PUXA 1KRSA 1SMXA 2WFWA 1KD1C 3D31A 2GN5A 2VQFQ 4A4IA 4C3HH 3OW2A 4A3JG 4A3FG 1KXLA 2CKZB 1Q86C 1B7YB 1S40A 4JC0A 2E2IH 1JJGA 4J15A 3U4VA 2RHSB 2UUAQ 3S15H 1JJ2A 1WFQA 1XJVA 4B3TL 4LF5Q 2JEAI 2AKWB 3CQZH 4OWXB 5J3BA 4OONA 3CCMA 2NVQH 4A3CG 4JI7L 3CCSA 4DV0L 1PFSA 3W1GA 5GADC 4A75A 3RLNA 2VS1A 4JG2A 4DV7Q 1HR0W 3CPFA 4LF7Q 4IJHA 2K75A 2LXJA 3F2BA 1Q81C 4JI0L 2B3GA 4IPCA 3S17H 2UXBQ 2ZJRA 1X6OA 1EYGA 4MZ9A 5C0XJ 1SRUA 4JI8L 1L1OC 4EQ5A 1P16A 5GQOA 2CWAA 4PZ6A 4KHPL 4NPSA 3STBC 1NMFA 1NE3A 1BKBA 1HNXL 2YV5A 2Z6KC 4AYBE 1U5KA 5IE8A 4R4TA 4A3IG 4A3CH 1BBWA 4X6AH 1TWCH 1VQ8A 3J81c 2F4VL 1VQ7A 2ZTEA 4GLXA 1C7YA 1HR0L 2PQAA 5C4JH 1N32Q 1HNWL 3A5UA 3RNUA 4DUZQ 3M9BA 1XNQQ 2JA5G 1FL0A 4DK6C 1CUKA 4OO1I 1PH4A 1YI2A 4JI4L 4NXNQ 2IX1A 1CKMA 3EBEA 4DV2Q 4GN4B 3SGIA 5IYBG 4YY3L 5H1SE 1IBKQ 1HZCA 1QVGA 2Q2TA 1QVCA 1SE8A 4O0AA 4BA1I 3M85A 1XPRA 3I7FA 1CKOA 1XMQQ 1PV4A 1CSPA 3PIPA 2R7FA 2UU9L 3AFQA 5M5YH 1K3RA 1YZ6A 1YVCA 3PCOB 4A3IH 4LF4L 2R7ZG 2KHIA 1UE1A 3RLFA 5GROA 4JI3Q 1V9PA 1PH7A 2JA5H 3S1MH 3GTJH 4LF8L 4XIGS 3G48A 4QQBX 3HOZG 5IYBH 4X66Q 1W3SA 1VQ4A 3PSIA 2A1AA 3KF6B 3J81j 2WB1G 2BA1A 3AQQA 5IYDG 1TXYA 3ZJYC 2JJQA 2Z0SA 3CCJA 3OTOQ 2K4KA 4JI6L 3ICEA 4B3RL 2IHFA 1G6PA 1VQOA 1OXTA 2R7ZH 2IT1A 3HFZB 4JYAQ 1VQNA 4DR1Q 1IYJB 1KHIA 1VQGA 3OYYA 4IOAA 4GNXA 1IBMQ 2PMZE 1JB7A 3RZDH 1XNRL 3M7NA 4DV5Q 3PGZA 4BXXG 3TS0A 1S72A 1TWFH 3HOZH 1QUQB 5C0XI 2UXBL 1YJWA 2XTIA 5C3EG 1KC8C 4OX9Q 1V43A 3ER0A 3BJUA 5IYDH 5M3FG 2B63G 4P73A 3UDGA 1AH9A 1EOVA 4HIDA 4GN3B 2CCZA 2K14A 2A19A 3JAMc 5BR8Q 1Q1EA 1UE7A 4WJ4A 1LUZA 1QZHA 4DR6L 5JJLA 4K0KQ 1SN8A 4R4CA 3F2DA 2VY3A 4GKJQ 4LF6Q 4BXXH 2GVBA 5IY0A 3A0JA 3WWVA 2QEXA 1M90C 2D0OA 4LUZA 5C3EH 2C35B 3RLOA 2MQHA 4DV1L 2R92G 2WAQG 1B70B 1Y1VG 5HY6A 1U0LA 4GN5A 4P72A 5M3FH 2B63H 1LTLA 1K8GA 2ASBA 5C4XG 1XMQL 2Q2HA 1PA6A 4DR2L 2CWPA 1XTDA 4B3SQ 3UE0A 1HJPA 2N3SA 5M5WH 3PUYA 1VQCA 2K52A 4X65L 4YHHQ 2K5NA 4IFDG 2YTXA 1KL9A 3IRBA 4JI3L 1PH1A 3UE1A 1N36Q 1N34Q 3GD7A 3CCLA 1E3PA 4Y7NH 4LFCQ 2MNAA 3CPWA 1KIXA 4A3BH 3GDEA 2Y0SG 2R92H 1Y1VH 2ID0A 1YNXA 4RMFA 3S1RH 3I56A 2BH8A 4DUYQ 4RG1A 5C4XH 4A3GG 2D0PA 3OTOL 1UE5A 4R4IA 4LW1A 4X64Q 1E1TA 3T1HQ 2UUBL 3HOUG 1EFWA 1Q12A 2CQOA 4JI2L 3H3VH 1JE5A 4DR4Q 4JYAL 2HHHL 2E8GA 5EAYA 4C2MH 5IWAQ 4DR1L 3RR5A 3CCVA 4UP8A 1WYDA 1IBML 4DV4L 4TVAB 3HKSA 4DR3Q 1X54A 3A5ZB 4JOIC 2VQEQ 3I2ZA 3STBD 3UDXA 4C3IH 4POFA 1YITA 2E5LQ 1Q8KA 4A3KG 1YBYA 5M3MG 2VZAA 3AEVA 1IBLQ 4OX9L 3GTLH 3FKIG 1GO3E 4UP9A 4HIOA 4O2DA 1EIYB 2IHEA 1MJCA 1I94L 4A3LG 1E7ZA 1O7IA 2ZM6Q 4A3GH 4LNQA 1M1KC 3HOUH 3L2PA 5K36G 4GOPC 4YWMA 1L2FA 3A74A 4HIKA 2UXDQ 5AJ3Q 2QGQA 3J81i 2YU9H 4NXMQ 3BZKA 3KYHC 2NVYH 1GKHA 4MTNA 1NTGA 2HT1A 2N78A 3KJPA 5JJKA 1PH3A 3K7AH 2LSSA 4PZ8A 1SLJA 4A3KH 1Q82C 5M3MH 4AQYL 2HIVA 3FKIH 2BA0A 4A3LH 3GTOH 1K83H 2GVAA 3I4OA 3EIVA 4HJ8A 3U4ZA 3S2HH 4X62Q 1EUJA 1QUQA 2ATWA 1L1OB 2DUDA 4LFAQ 4YHHL 4YCUA 1VCIA 1I3QH 2LXKA 1N34L 1N36L 1FVIA 4XTCS 1TWGH 1X3EA 4LFCL 2AWNA 5GAGC 3H0GG 1X9NA 1IXRA 4OWWB 2VL6A 4UPAA 1UWVA 4A93H 4DAYB 3GTQH 1E24A 4KHZA 1MJEA 4JV5L 3KDFB 1VQMA 4BY1H 2VNUD 3E9IA 3CC2A 3HOYG 3CW2C 2OWOA 3K8AA 3TRZA 2L15A 4OWTB 4DPGA 3GTMH 4DR4L 4GKKL 4QGUA 5M5XH 3G6EA 1WCMG 4LFBQ 4DR7Q 1TWHH 2K50A 2VQFL 3TS2A 1J5EQ 2UUCQ 2HIXA 3H0GH 3ULJA 3L0OA 4DR3L 2VUMG 4AIMA 4HJ7A 4YCWA 3S2DH 3RN5A 2OTLA 3KJOA 2UUAL 2R93G 1XPUA 4JBWA 1D8LA 1A63A 3E9HA 2N8NA 4L5QA 5LMUQ 3CXCA 3F8TA 4DK3C 3VDYA 4LF5L 1VQBA 3CCEA 2ZM6L 3JAMi 4B3MQ 4YCVA 4P71A 3TQYA 2MO0A 2AHOB 2PNHA 4PZ7A 1T9HA 1AE3A 1VQ9A 1FJGQ 3W1BA 3HOYH 1W2BA 4DV7L 2NVXH 3PO2G 4LF7L 2JEBI 4AYBG 2UXDL 1UEBA 5AJ3L 4NXML 1YHQA 1QZGA 1WCMH 1GD7A 3PIOA 1R9TH 4JI5Q 1GVPA 4POGA 5GAEC 2VUMH 3HOVG 2HQLA 1WOCA 2CFMA 1HZAA 2H5XA 3KOJA 3UDFA 1KRTA 1G51A 2R93H 1YIJA 3F1ZA 5JJIA 3HKZE 1VQDA 3Q8DA 2IX0A 2AMCB 3AFPA 4IPDA 2NVTH 4GLVB 2KCMA 4UP7A 1N32L 1OXUA 4TQUS 4DUZL 3U50C 1JJCB 1X3GA 1RIPA 2KENA 1XNQL 3PO2H 2OQ0A 2PQAB 3CCRA 5E7NA 4A3BG 4WJ3M 4NXNL 1WJJA 4FDBA 4LFAL 3HOWH 4DV2L 2KBNA 1IBKL 3PUZA 3HOVH 4DV6Q 3RZOH 3HOXG 3PUWA 4B3TQ 4ALPA 4BBSG 1PVOA 4JCVE 1BVSA 1VQAA 2NN6G 1YHBA 4JI7Q 3J7A5 3M3YH 5LMNQ 1KAWA 1LM0A 1XMOQ 5JEAG 1OTCA 4JI0Q 3EN2A 1YEZA 2RHQB 3M4OH 4AH6A 1G291 3CC7A 1QVFA 1Q7YC 1PH9A 1LYLA 1NMGA 4APVA 1A8VA 5DLQE 4JI8Q 3NBHB 5IYCH 2XGTA 3U58A 1N33Q 1ASZA 3NENA 4QJFA 4X66L 1HNXQ 4LFBL 3HOXH 1N9WA 3M4PA 1MIUA 1K9MC 1SR3A 4GNXC 1J5EL 2UUCL 4BBSH 1K0RA 1PH5A 4QY7A 2F4VQ 1BBUA 2K5VA 5FLMG 2YTVA 3PO3G 1YJ9A 2ZJQA 1HNWQ 2VW9A 1J6QA 1C0AA 1IZ6A 4JI4Q 1B8AA 4YY3Q 1VQEA 4DKAC 3BU2A 1HNZQ 1FJGL 3I4MH 4DAMA 1Z47A 4DV5L 4IFDJ 1Q46A 2JA6G 1I50H 3W5OA 4LUOA 4JI5L 2N49A 1VQLA 2UU9Q 1OXVA 3KDFA 3K7UC 4LUVA 1EQQA 1K73C 1WI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 c;  4DR5 Q;  4JI1 Q;  3NEL A;  5FLM H;  3PO3 H;  5BR8 L;  2NZO A;  1HZ9 A;  1S3O A;  1N8R C;  5LMN W;  4K0K L;  3KF6 A;  2MO1 A;  4Y52 H;  5FLX c;  3I4N G;  1FGU A;  4PMW A;  3J80 i;  4GKJ L;  2ES2 A;  2ZTD A;  4R4Q A;  2JQO A;  2R7D A;  3DM3 A;  3K0X A;  3UDI A;  4HJ5 A;  2E2H H;  4LF6 L;  2JA6 H;  1SRO A;  3CME A;  4JI6 Q;  4B3R Q;  1AE2 A;  1X65 A;  1HZB A;  4LWC A;  4EX5 A;  4GOP B;  4A93 G;  3FHW A;  1CKN B;  1TWA H;  1PH8 A;  2Q2U A;  3MEF A;  4DV3 Q;  1Y1W G;  4DV6 L;  4IOC A;  4BY7 G;  1I6H H;  4BY1 G;  2JA8 G;  2QA4 A;  3J80 c;  1XNR Q;  2WB1 E;  4B3S L;  5LMN L;  3B6Y A;  2D62 A;  3GTG H;  1E22 A;  3CCU A;  3JC6 6;  1YJN A;  1XMO L;  3I4N H;  3M4Q A;  2MFI A;  4JBJ A;  4HIM A;  1P8L A;  2DGY A;  3TRE A;  5GAH C;  4A3J H;  4A3F H;  2F3I A;  3L7Z C;  5C44 G;  3RN2 A;  1N33 L;  1L0W A;  4UY8 C;  2KCT A;  1DGS A;  1H95 A;  1EIF A;  2JA7 G;  1A62 A;  4HJ9 A;  2ZJP A;  1Y1W H;  2I0Q A;  2UXC Q;  4DR6 Q;  4BY7 H;  4DUY L;  1VQP A;  3BZC A;  3PF5 A;  3S24 A;  2NN6 I;  2JA8 H;  3T1H L;  4X64 L;  4JBK A;  4MNO A;  1VQK A;  2KHJ A;  3ULL A;  3ERS X;  4IPH A;  3J7Z C;  1ASY A;  4LF9 Q;  3KF8 B;  3TEH B;  4BBR G;  1C9O A;  4DNI A;  3H3V I;  4IFD I;  5IWA L;  4A3E G;  1PH2 A;  4DV1 Q;  1X55 A;  5IP9 G;  1PHJ A;  1NJI C;  1CSQ A;  5C44 H;  1I5F A;  5FJ8 G;  1HNZ L;  4P75 A;  2VQE L;  2EIF A;  2PI2 A;  1K8A C;  2E5L L;  1E1O A;  4DR2 Q;  3G4S A;  1IBL L;  3CAM A;  2JA7 H;  2RCN A;  4BA2 I;  2EXD A;  1OXX K;  3DLL A;  3CD6 A;  4X65 Q;  4DR5 L;  4JI1 L;  2FXQ A;  4OXP A;  4IO9 A;  2ALY B;  2E2J H;  2WAQ E;  2ZTC A;  1RL2 A;  4IJL A;  2I5M X;  4BBR H;  1VQI A;  2I5H A;  1VQ5 A;  3MXN B;  3HOW G;  4NB3 A;  3T1Y Q;  4A3E H;  2WP8 J;  1XPO A;  5IP9 H;  4LF4 Q;  3S16 H;  5FJ8 H;  1JMC A;  3NEM A;  3KLW A;  4PG3 A;  5ELN A;  3F2C A;  2OTJ A;  1MKH A;  5IP7 G;  2Q2I A;  1A0I A;  2UUB Q;  2OCE A;  4JI2 Q;  3CP0 A;  4GS3 A;  2RF4 A;  3GTK H;  4DV3 L;  1PYB A;  2HHH Q;  2Y0S E;  2PI2 E;  2YTY A;  4JBM A;  3K81 C;  2IY5 B;  2JA9 A;  4X62 L;  5IYC G;  4DV4 Q;  4KHP Q;  2I5L X;  3ULP A;  4R1J A;  4GLA C;  4A3M G;  4YWK A;  3CC4 A;  1KQS A;  4P74 A;  2JK8 A;  2A8V A;  1I94 Q;  5HGQ A;  5IP7 H;  3CMA A;  3PF4 A;  4QL5 A;  4DV0 Q;  4L5T A;  3S1Q H;  2F52 A;  4KI0 A;  4JOI A;  1V1Q A;  1VS0 A;  2K5H A;  3CCQ A;  1VQ6 A;  1NY4 A;  4R4O A;  4OO1 G;  2UXC L;  4IPG A;  1YHA A;  3E0E A;  1PH6 A;  3I4M G;  3KFU A;  4LF9 L;  4GOP A;  4A3D G;  1IL2 A;  4KLK A;  3CF5 A;  4HJA A;  1CKN A;  4AQY Q;  4A3M H;  3GTP H;  4H02 A;  1Z9F A;  1PYS B;  4DR7 L;  3H15 A;  1X56 A;  1HH2 P;  1OXS C;  1Q1B A;  3I55 A;  1L1O A;  1UE6 A;  3K80 C;  1HR0 Q;  2OQK A;  2JE6 I;  2AWO A;  2NZH A;  4L5R C;  4L5S A;  1EQR A;  4C3J H;  5LMU L;  1Y14 B;  5ELO A;  1NBW A;  2Z6K A;  4B3M L;  5JEA J;  3GO5 A;  3G71 A;  4GNX B;  3HKZ G;  4A3D H;  1D7Q A;  3T1Y L;  2V1C C;  2EQS A;  2R6G A;  2YYZ A;  3D0F A;  3FP9 A;  3PUV A;  1VQF A;  1VQJ A;  4JV5 Q;  3AYH B;  3PV0 A;  3LGJ A;  1JT8 A;  1SFO H;  4QIW E;  1GM5 A;  2B29 A;  2BH2 A;  4LF8 Q;  1X3F A;  4YWL A;  5C0X G;  4GKK Q;  4A76 A;  1VQH A;  3S1N H;  1EWI A;  4ME3 A;  3S14 H;  3PUX A;  1KRS A;  1SMX A;  2WFW A;  1KD1 C;  3D31 A;  2GN5 A;  2VQF Q;  4A4I A;  4C3H H;  3OW2 A;  4A3J G;  4A3F G;  1KXL A;  2CKZ B;  1Q86 C;  1B7Y B;  1S40 A;  4JC0 A;  2E2I H;  1JJG A;  4J15 A;  3U4V A;  2RHS B;  2UUA Q;  3S15 H;  1JJ2 A;  1WFQ A;  1XJV A;  4B3T L;  4LF5 Q;  2JEA I;  2AKW B;  3CQZ H;  4OWX B;  5J3B A;  4OON A;  3CCM A;  2NVQ H;  4A3C G;  4JI7 L;  3CCS A;  4DV0 L;  1PFS A;  3W1G A;  5GAD C;  4A75 A;  3RLN A;  2VS1 A;  4JG2 A;  4DV7 Q;  1HR0 W;  3CPF A;  4LF7 Q;  4IJH A;  2K75 A;  2LXJ A;  3F2B A;  1Q81 C;  4JI0 L;  2B3G A;  4IPC A;  3S17 H;  2UXB Q;  2ZJR A;  1X6O A;  1EYG A;  4MZ9 A;  5C0X J;  1SRU A;  4JI8 L;  1L1O C;  4EQ5 A;  1P16 A;  5GQO A;  2CWA A;  4PZ6 A;  4KHP L;  4NPS A;  3STB C;  1NMF A;  1NE3 A;  1BKB A;  1HNX L;  2YV5 A;  2Z6K C;  4AYB E;  1U5K A;  5IE8 A;  4R4T A;  4A3I G;  4A3C H;  1BBW A;  4X6A H;  1TWC H;  1VQ8 A;  3J81 c;  2F4V L;  1VQ7 A;  2ZTE A;  4GLX A;  1C7Y A;  1HR0 L;  2PQA A;  5C4J H;  1N32 Q;  1HNW L;  3A5U A;  3RNU A;  4DUZ Q;  3M9B A;  1XNQ Q;  2JA5 G;  1FL0 A;  4DK6 C;  1CUK A;  4OO1 I;  1PH4 A;  1YI2 A;  4JI4 L;  4NXN Q;  2IX1 A;  1CKM A;  3EBE A;  4DV2 Q;  4GN4 B;  3SGI A;  5IYB G;  4YY3 L;  5H1S E;  1IBK Q;  1HZC A;  1QVG A;  2Q2T A;  1QVC A;  1SE8 A;  4O0A A;  4BA1 I;  3M85 A;  1XPR A;  3I7F A;  1CKO A;  1XMQ Q;  1PV4 A;  1CSP A;  3PIP A;  2R7F A;  2UU9 L;  3AFQ A;  5M5Y H;  1K3R A;  1YZ6 A;  1YVC A;  3PCO B;  4A3I H;  4LF4 L;  2R7Z G;  2KHI A;  1UE1 A;  3RLF A;  5GRO A;  4JI3 Q;  1V9P A;  1PH7 A;  2JA5 H;  3S1M H;  3GTJ H;  4LF8 L;  4XIG S;  3G48 A;  4QQB X;  3HOZ G;  5IYB H;  4X66 Q;  1W3S A;  1VQ4 A;  3PSI A;  2A1A A;  3KF6 B;  3J81 j;  2WB1 G;  2BA1 A;  3AQQ A;  5IYD G;  1TXY A;  3ZJY C;  2JJQ A;  2Z0S A;  3CCJ A;  3OTO Q;  2K4K A;  4JI6 L;  3ICE A;  4B3R L;  2IHF A;  1G6P A;  1VQO A;  1OXT A;  2R7Z H;  2IT1 A;  3HFZ B;  4JYA Q;  1VQN A;  4DR1 Q;  1IYJ B;  1KHI A;  1VQG A;  3OYY A;  4IOA A;  4GNX A;  1IBM Q;  2PMZ E;  1JB7 A;  3RZD H;  1XNR L;  3M7N A;  4DV5 Q;  3PGZ A;  4BXX G;  3TS0 A;  1S72 A;  1TWF H;  3HOZ H;  1QUQ B;  5C0X I;  2UXB L;  1YJW A;  2XTI A;  5C3E G;  1KC8 C;  4OX9 Q;  1V43 A;  3ER0 A;  3BJU A;  5IYD H;  5M3F G;  2B63 G;  4P73 A;  3UDG A;  1AH9 A;  1EOV A;  4HID A;  4GN3 B;  2CCZ A;  2K14 A;  2A19 A;  3JAM c;  5BR8 Q;  1Q1E A;  1UE7 A;  4WJ4 A;  1LUZ A;  1QZH A;  4DR6 L;  5JJL A;  4K0K Q;  1SN8 A;  4R4C A;  3F2D A;  2VY3 A;  4GKJ Q;  4LF6 Q;  4BXX H;  2GVB A;  5IY0 A;  3A0J A;  3WWV A;  2QEX A;  1M90 C;  2D0O A;  4LUZ A;  5C3E H;  2C35 B;  3RLO A;  2MQH A;  4DV1 L;  2R92 G;  2WAQ G;  1B70 B;  1Y1V G;  5HY6 A;  1U0L A;  4GN5 A;  4P72 A;  5M3F H;  2B63 H;  1LTL A;  1K8G A;  2ASB A;  5C4X G;  1XMQ L;  2Q2H A;  1PA6 A;  4DR2 L;  2CWP A;  1XTD A;  4B3S Q;  3UE0 A;  1HJP A;  2N3S A;  5M5W H;  3PUY A;  1VQC A;  2K52 A;  4X65 L;  4YHH Q;  2K5N A;  4IFD G;  2YTX A;  1KL9 A;  3IRB A;  4JI3 L;  1PH1 A;  3UE1 A;  1N36 Q;  1N34 Q;  3GD7 A;  3CCL A;  1E3P A;  4Y7N H;  4LFC Q;  2MNA A;  3CPW A;  1KIX A;  4A3B H;  3GDE A;  2Y0S G;  2R92 H;  1Y1V H;  2ID0 A;  1YNX A;  4RMF A;  3S1R H;  3I56 A;  2BH8 A;  4DUY Q;  4RG1 A;  5C4X H;  4A3G G;  2D0P A;  3OTO L;  1UE5 A;  4R4I A;  4LW1 A;  4X64 Q;  1E1T A;  3T1H Q;  2UUB L;  3HOU G;  1EFW A;  1Q12 A;  2CQO A;  4JI2 L;  3H3V H;  1JE5 A;  4DR4 Q;  4JYA L;  2HHH L;  2E8G A;  5EAY A;  4C2M H;  5IWA Q;  4DR1 L;  3RR5 A;  3CCV A;  4UP8 A;  1WYD A;  1IBM L;  4DV4 L;  4TVA B;  3HKS A;  4DR3 Q;  1X54 A;  3A5Z B;  4JOI C;  2VQE Q;  3I2Z A;  3STB D;  3UDX A;  4C3I H;  4POF A;  1YIT A;  2E5L Q;  1Q8K A;  4A3K G;  1YBY A;  5M3M G;  2VZA A;  3AEV A;  1IBL Q;  4OX9 L;  3GTL H;  3FKI G;  1GO3 E;  4UP9 A;  4HIO A;  4O2D A;  1EIY B;  2IHE A;  1MJC A;  1I94 L;  4A3L G;  1E7Z A;  1O7I A;  2ZM6 Q;  4A3G H;  4LNQ A;  1M1K C;  3HOU H;  3L2P A;  5K36 G;  4GOP C;  4YWM A;  1L2F A;  3A74 A;  4HIK A;  2UXD Q;  5AJ3 Q;  2QGQ A;  3J81 i;  2YU9 H;  4NXM Q;  3BZK A;  3KYH C;  2NVY H;  1GKH A;  4MTN A;  1NTG A;  2HT1 A;  2N78 A;  3KJP A;  5JJK A;  1PH3 A;  3K7A H;  2LSS A;  4PZ8 A;  1SLJ A;  4A3K H;  1Q82 C;  5M3M H;  4AQY L;  2HIV A;  3FKI H;  2BA0 A;  4A3L H;  3GTO H;  1K83 H;  2GVA A;  3I4O A;  3EIV A;  4HJ8 A;  3U4Z A;  3S2H H;  4X62 Q;  1EUJ A;  1QUQ A;  2ATW A;  1L1O B;  2DUD A;  4LFA Q;  4YHH L;  4YCU A;  1VCI A;  1I3Q H;  2LXK A;  1N34 L;  1N36 L;  1FVI A;  4XTC S;  1TWG H;  1X3E A;  4LFC L;  2AWN A;  5GAG C;  3H0G G;  1X9N A;  1IXR A;  4OWW B;  2VL6 A;  4UPA A;  1UWV A;  4A93 H;  4DAY B;  3GTQ H;  1E24 A;  4KHZ A;  1MJE A;  4JV5 L;  3KDF B;  1VQM A;  4BY1 H;  2VNU D;  3E9I A;  3CC2 A;  3HOY G;  3CW2 C;  2OWO A;  3K8A A;  3TRZ A;  2L15 A;  4OWT B;  4DPG A;  3GTM H;  4DR4 L;  4GKK L;  4QGU A;  5M5X H;  3G6E A;  1WCM G;  4LFB Q;  4DR7 Q;  1TWH H;  2K50 A;  2VQF L;  3TS2 A;  1J5E Q;  2UUC Q;  2HIX A;  3H0G H;  3ULJ A;  3L0O A;  4DR3 L;  2VUM G;  4AIM A;  4HJ7 A;  4YCW A;  3S2D H;  3RN5 A;  2OTL A;  3KJO A;  2UUA L;  2R93 G;  1XPU A;  4JBW A;  1D8L A;  1A63 A;  3E9H A;  2N8N A;  4L5Q A;  5LMU Q;  3CXC A;  3F8T A;  4DK3 C;  3VDY A;  4LF5 L;  1VQB A;  3CCE A;  2ZM6 L;  3JAM i;  4B3M Q;  4YCV A;  4P71 A;  3TQY A;  2MO0 A;  2AHO B;  2PNH A;  4PZ7 A;  1T9H A;  1AE3 A;  1VQ9 A;  1FJG Q;  3W1B A;  3HOY H;  1W2B A;  4DV7 L;  2NVX H;  3PO2 G;  4LF7 L;  2JEB I;  4AYB G;  2UXD L;  1UEB A;  5AJ3 L;  4NXM L;  1YHQ A;  1QZG A;  1WCM H;  1GD7 A;  3PIO A;  1R9T H;  4JI5 Q;  1GVP A;  4POG A;  5GAE C;  2VUM H;  3HOV G;  2HQL A;  1WOC A;  2CFM A;  1HZA A;  2H5X A;  3KOJ A;  3UDF A;  1KRT A;  1G51 A;  2R93 H;  1YIJ A;  3F1Z A;  5JJI A;  3HKZ E;  1VQD A;  3Q8D A;  2IX0 A;  2AMC B;  3AFP A;  4IPD A;  2NVT H;  4GLV B;  2KCM A;  4UP7 A;  1N32 L;  1OXU A;  4TQU S;  4DUZ L;  3U50 C;  1JJC B;  1X3G A;  1RIP A;  2KEN A;  1XNQ L;  3PO2 H;  2OQ0 A;  2PQA B;  3CCR A;  5E7N A;  4A3B G;  4WJ3 M;  4NXN L;  1WJJ A;  4FDB A;  4LFA L;  3HOW H;  4DV2 L;  2KBN A;  1IBK L;  3PUZ A;  3HOV H;  4DV6 Q;  3RZO H;  3HOX G;  3PUW A;  4B3T Q;  4ALP A;  4BBS G;  1PVO A;  4JCV E;  1BVS A;  1VQA A;  2NN6 G;  1YHB A;  4JI7 Q;  3J7A 5;  3M3Y H;  5LMN Q;  1KAW A;  1LM0 A;  1XMO Q;  5JEA G;  1OTC A;  4JI0 Q;  3EN2 A;  1YEZ A;  2RHQ B;  3M4O H;  4AH6 A;  1G29 1;  3CC7 A;  1QVF A;  1Q7Y C;  1PH9 A;  1LYL A;  1NMG A;  4APV A;  1A8V A;  5DLQ E;  4JI8 Q;  3NBH B;  5IYC H;  2XGT A;  3U58 A;  1N33 Q;  1ASZ A;  3NEN A;  4QJF A;  4X66 L;  1HNX Q;  4LFB L;  3HOX H;  1N9W A;  3M4P A;  1MIU A;  1K9M C;  1SR3 A;  4GNX C;  1J5E L;  2UUC L;  4BBS H;  1K0R A;  1PH5 A;  4QY7 A;  2F4V Q;  1BBU A;  2K5V A;  5FLM G;  2YTV A;  3PO3 G;  1YJ9 A;  2ZJQ A;  1HNW Q;  2VW9 A;  1J6Q A;  1C0A A;  1IZ6 A;  4JI4 Q;  1B8A A;  4YY3 Q;  1VQE A;  4DKA C;  3BU2 A;  1HNZ Q;  1FJG L;  3I4M H;  4DAM A;  1Z47 A;  4DV5 L;  4IFD J;  1Q46 A;  2JA6 G;  1I50 H;  3W5O A;  4LUO A;  4JI5 L;  2N49 A;  1VQL A;  2UU9 Q;  1OXV A;  3KDF A;  3K7U C;  4LUV A;  1EQQ A;  1K73 C;  1WI5 A; 
#chains in the Genus database with same CATH topology
 5IT9 c;  4DR5 Q;  4JI1 Q;  1BBX C;  1HZ9 A;  1F77 A;  3J80 E;  4Q8F A;  5LMN W;  1FKA H;  1ONL A;  2MO1 A;  4BY1 B;  1FGU A;  4RAZ A;  3J80 i;  2JA8 B;  3OMG A;  2R7D A;  3K0X A;  3UDI A;  1SMY C;  4XT3 B;  4TQS A;  1RDP D;  1AN8 A;  4C5B A;  3CME A;  4B3R Q;  4XYQ A;  4A93 G;  4ECW A;  5L9X A;  4QIW B;  1KEE A;  4N8X 1;  4DV3 Q;  1Y1W G;  2PVP A;  4IWY A;  5KG0 A;  4DK0 A;  4BS9 A;  4X66 H;  3T53 B;  1D2B A;  2QA4 A;  5D14 A;  1AZQ A;  5LMN L;  3OTO H;  4FXK C;  2UUB H;  2XIW A;  1DYQ A;  1EWH A;  1LTS D;  2MFI A;  3HP3 A;  4MTE A;  4JYA H;  1MZB A;  3QZ8 A;  5C44 G;  1QB5 D;  2EOT A;  3TSS A;  5DAU A;  4DAP A;  4BBR B;  3MFH A;  4DF7 A;  4LSA A;  3URY A;  1DGS A;  3PW5 A;  1WCM B;  2VQD A;  2ZJP A;  1S5B D;  2UXC Q;  2JSO A;  3V6H A;  1KDC A;  1U4M A;  3DWP A;  5ELF A;  5DNF A;  2JA8 H;  2OLS A;  2R8H A;  1U4L A;  2WDT A;  4IPH A;  3KF8 B;  3MAQ A;  3P1H A;  1DV1 A;  4ED3 A;  5LXT F;  5IWA L;  2NVT B;  4QMG A;  1PH2 A;  1TT2 A;  4DV1 Q;  5IP9 G;  1NJI C;  1LO5 D;  2NU9 B;  1NCV A;  3PO2 B;  2M05 A;  1K8A C;  2E5L L;  3RB4 A;  1PTO D;  4F87 A;  2JA7 H;  4JPB W;  1EY5 A;  4QWC A;  4R9W A;  3DLL A;  3CD6 A;  1E2W A;  4AQY H;  4X65 Q;  2F0W A;  4IO9 A;  2ALY B;  3JZI A;  3KK7 A;  5KEE A;  3H4B A;  2ZTC A;  2AGQ A;  4BBR H;  1VQI A;  4RGM A;  1FD7 D;  1MGS A;  5EBC A;  3HOW G;  1B9M A;  4KMU C;  5FJ8 H;  3NEM A;  4XQQ A;  3NXW A;  1MKH A;  4LH7 A;  3A7A B;  5IP7 G;  5KFN A;  1GXD C;  1II3 A;  1N34 H;  2IPK D;  1N36 H;  1L2Z A;  1STG A;  4JI2 Q;  2J6T A;  2L0C A;  2FP4 B;  4O3O A;  4JBM A;  2IY5 B;  2JA9 A;  4X62 L;  4DUY H;  4DV4 Q;  3ETH A;  4XZ3 B;  2KCC A;  4KHP Q;  2DZD A;  1NR2 A;  4X64 H;  4R1J A;  1I3Q A;  4GLA C;  4A3M G;  2PN1 A;  1RKN A;  1KQS A;  1CQJ B;  1PTO B;  2A8V A;  1O7Z A;  3PW7 A;  2Z8L A;  1M6V A;  4Q8E A;  1VAJ A;  2F0N A;  4QL5 A;  4DV0 Q;  1I50 B;  2B8G A;  3DWA A;  5E4W C;  1JX4 A;  2B2W C;  1VS0 A;  1CHQ D;  1NY4 A;  1IBL H;  5DLF A;  5A35 A;  1LTB D;  4IUV A;  1OWT A;  1EY6 A;  1STB A;  3I4M G;  2ZM6 H;  2F0Q A;  4FXG C;  4LF9 L;  1F9R A;  2N88 A;  1IL2 A;  3CF5 A;  4HJA A;  4DV7 H;  4QIW A;  4H02 A;  3S1N B;  1PYS B;  4X3U A;  1TKW B;  3H0G A;  1HH2 P;  3G8C A;  2IA6 A;  1FR3 A;  1GLV A;  2E2H B;  1OXS C;  1Q1B A;  1S9F A;  2F0M A;  2A69 C;  3RIZ A;  2NZH A;  2R61 A;  2BOS A;  1Y69 U;  1EQR A;  4IQZ A;  1Y14 B;  4DL5 A;  1NBW A;  2Z6K A;  1I6H B;  3K5H A;  2W70 A;  5DG7 A;  2IW3 A;  1SMY D;  1ET9 A;  4C3H G;  1N32 H;  2FLP A;  3GTG B;  4DUZ H;  1WCM A;  3T1Y L;  5KG2 A;  2YYZ A;  4NXN H;  2PZW A;  4LFA H;  1CZW A;  4U67 3;  3AYH B;  4A3J B;  3PV0 A;  3LGJ A;  5KFR A;  5D1P A;  3KF8 A;  4RA8 A;  4LF8 Q;  2BH2 A;  1JWM D;  5C0X G;  1BUV T;  4GKK Q;  4BY7 B;  3S1N H;  5JPM C;  1TWC B;  1KRS A;  4R8U B;  1SMX A;  2VQF Q;  4A3F G;  3SK4 A;  2CKZ B;  1Q8I A;  4RWS C;  3SR1 A;  4EFE A;  1RYR A;  3DEP A;  3U4V A;  5EWG A;  3TQ1 A;  3VA5 A;  2JEA I;  2AKW B;  3CQZ H;  3CCM A;  3W3A A;  3PW0 A;  4JI7 L;  3LX0 A;  3CCS A;  4HED A;  3C0F B;  1ZYR C;  1C4Q A;  2HQE A;  3VYS A;  2QKI C;  4LF7 Q;  1KC7 A;  2LXJ A;  2UXB Q;  1Q81 C;  2B3G A;  2NTS A;  2B2U A;  1X6O A;  2CQY A;  5BPF A;  1PZJ D;  2RGV A;  3SI8 A;  1SRU A;  3MHB A;  5D65 A;  4DK1 A;  1B6R A;  3EA6 A;  1KDB A;  2L12 A;  4JV0 A;  3I4L A;  1J9O A;  4DV5 H;  2QEJ C;  1I6U A;  4Q0Y A;  1NE3 A;  1BKB A;  1HNX L;  2YV5 A;  1W93 A;  4AYB E;  4A3I G;  4R4T A;  1TII D;  1BBW A;  4A3C H;  1EL0 A;  1TWC H;  3J81 c;  3R23 A;  2F4V L;  2LS0 1;  2PQA A;  3I91 A;  1HNW L;  2HUG A;  1PH4 A;  4R8N A;  1T5X D;  1F2L A;  2PZU A;  2SEB D;  1G6Z A;  4GN4 B;  3OW7 A;  4YY3 L;  3HEJ A;  5C5L A;  2Q2T A;  1SE8 A;  1XPR A;  3KBX A;  1TAE A;  4DFA A;  3VR6 A;  1XMQ Q;  1CSP A;  3I8Z A;  1C3O A;  1KJQ A;  1GOZ A;  2PMZ A;  1KLG D;  1YZ6 A;  4LF4 L;  2EJM A;  1AUV A;  2R7Z G;  1IHZ A;  4TUY F;  3A54 A;  3R8B A;  2RCF A;  4EBD A;  2F0H A;  4G7Z C;  2ASJ A;  1PH7 A;  1S5D D;  3A56 A;  2K5D A;  2J6U A;  5KYI A;  2V5A A;  1Q90 A;  5LMN H;  3MA2 B;  1JKJ B;  3RBD A;  2A1A A;  3KF6 B;  1KJ9 A;  2E2H A;  3AQQ A;  1NUC A;  4N9T A;  3ZJY C;  3BDC A;  3CCJ A;  4JI6 L;  3WNZ A;  2DIK A;  3J7A K;  1T3N A;  2ZJT A;  1VQN A;  3SVM A;  5D1O A;  2WAC A;  3V05 A;  1IYJ B;  1ENC A;  1VQG A;  5KRU A;  3OYY A;  4ZYS A;  4H44 C;  1JB7 A;  1XNR L;  3M7N A;  3GTG A;  4BXX G;  1BXT A;  3A8J E;  5C3E G;  2CHB D;  1HFG A;  3T13 A;  4OX9 Q;  5DGA A;  4L8J A;  3PVX A;  4DGZ A;  5IYD H;  5M3F G;  2R7N A;  5IWA H;  3UDG A;  2PNR C;  4KKU A;  4ZK9 B;  1EOV A;  4HID A;  2CCZ A;  2A69 D;  3QZ7 A;  2K14 A;  2A19 A;  4ODG A;  2E5L H;  2WAQ B;  4DR6 L;  4XXE A;  2F0P A;  3R2T A;  5JJL A;  1BGW A;  1TR5 A;  1WSC A;  4K0K Q;  5EOY A;  4R8U A;  4WBN F;  5FPO A;  2D2C C;  1SFO B;  1J8I A;  2FKL A;  4IWX A;  3WWV A;  3MTS A;  2R8I A;  3MC0 B;  2EYJ A;  1Y1V G;  4ECU A;  1U0L A;  2KA7 A;  4P72 A;  5KFP A;  1VMP A;  3N8D A;  3HKZ B;  5FOB B;  5C4X G;  1M7J A;  4PWQ A;  1SE4 A;  2JEG A;  1RJR A;  4N9P A;  4QUF A;  1JLL B;  3OHB A;  2RBM A;  1VQC A;  5KG5 A;  2K5N A;  4IFD G;  1U4P A;  1RJP A;  5DGB A;  4JI3 L;  1PH1 A;  1EYA A;  3HOU B;  4LFC Q;  3CPW A;  3GID A;  3GQC A;  3GDE A;  4X62 H;  1LTG D;  1BNZ A;  4E6I A;  1PLF A;  4RG1 A;  3T1H Q;  1UE5 A;  1ZYR D;  1E1T A;  3CVZ A;  1Q12 A;  3NQI A;  4OIJ A;  5BPH A;  3FKI B;  3H3V H;  3X3M A;  1EY4 A;  2I07 B;  3RR5 A;  1IBM L;  3OWF A;  4DR3 Q;  3HKS A;  3RAQ A;  1EEF D;  3ORQ A;  2HD3 A;  2ICE C;  1Q8K A;  1KTK A;  3IL8 A;  3AEV A;  2EPB A;  2DWC A;  3CHB D;  4LF9 H;  3FMA A;  3H4D A;  1PYW D;  3ERQ A;  1I94 L;  1C48 A;  1E7Z A;  3Q6S A;  4A3G H;  1PK8 A;  3HOU H;  5K36 G;  1K28 A;  1FNU A;  1PRT F;  5JAV A;  2WYO A;  3K0Y A;  1L2F A;  4HIK A;  2UXD Q;  5M5Y B;  5AJ3 Q;  1V1O A;  1LV9 A;  4HCS A;  5L1L A;  2A6E D;  2HT1 A;  4H0L C;  1VBH A;  3GTJ B;  1SLJ A;  3OIP A;  3NBI A;  3GTM B;  1ZKO A;  5M5X B;  3FKI H;  2BA0 A;  2JN4 A;  2K5W A;  3CU7 A;  2GVA A;  4O3N A;  4YIJ A;  5KFS A;  3T1Y H;  4EQO A;  4HJ8 A;  4CJ2 C;  4P2C B;  1B50 A;  3S2H H;  1EUJ A;  1S10 A;  1DOM A;  1T36 A;  3K6O A;  2XGP A;  3MR6 A;  1HRJ A;  4YCU A;  1HXY D;  1VCI A;  3JSL A;  2DNC A;  4UCT A;  1AEX A;  4XTC S;  2UVV A;  4IUQ A;  3RZD B;  3N43 B;  5GAG C;  3H0G G;  2W6Q A;  2VL6 A;  3R2I A;  4UPA A;  4A93 H;  4X3S A;  4KY7 A;  3MFG A;  3GTQ H;  1SNO A;  1W96 A;  3KDF B;  2R85 A;  1WTV A;  2VNU D;  1WTH A;  2NU7 B;  1SFO A;  1B4O A;  4ZI7 F;  3CW2 C;  2R93 B;  5J1Z A;  3IAY A;  3GTM H;  5A2Q W;  5M5X H;  4Q0F A;  4RAY A;  2B2W A;  4YR3 A;  1WCM G;  4LFB Q;  4UHV A;  2VPQ A;  5FD5 A;  2PCF B;  1B3Q A;  3TS2 A;  3HKZ A;  2HIX A;  4YR0 A;  3RB0 A;  1TS4 A;  2J7Z A;  4AIM A;  1G8Z D;  4HJ7 A;  1SYC A;  1WTQ A;  2OTL A;  2E2I A;  1D6E C;  3JAM E;  2UUA L;  1D8L A;  4L5Q A;  3S17 H;  3F8T A;  4DK3 C;  4LF5 L;  2W6N A;  2YS7 A;  3CCE A;  1HNX H;  3IG0 A;  3JAM i;  4P71 A;  3TQY A;  1VQ9 A;  3HOY H;  2MGS A;  1FJG Q;  3TIN A;  5A2Q L;  1W2B A;  2F4V H;  2W9B B;  3PO2 G;  5C4Z A;  1K8O A;  1Q3L A;  2ZT9 C;  2PZT A;  1KNE A;  1HNW H;  1XDN A;  3OHA A;  2G9H D;  1GD7 A;  1R9T H;  2HDL A;  3ND8 A;  1ZET A;  1GVP A;  3QOJ A;  2VUM H;  4O4I F;  2W7O A;  2HQL A;  2A6H C;  4YY3 H;  3J7Y W;  4MA5 A;  2X6G A;  4C1N I;  2FIN B;  2OEO A;  3KOJ A;  3UDF A;  4C5C A;  4H7B A;  2R93 H;  3M9M B;  4QW8 A;  3VYT A;  2XSC A;  1VQD A;  5I2X A;  1IYU A;  1MSG A;  4Q44 A;  1JOO A;  4UP7 A;  4LAA A;  2B39 A;  4LF4 H;  4M1U B;  4YR2 A;  3U50 C;  2H1E A;  4WJ3 M;  3HOW H;  1SE3 A;  1B33 N;  4ZAI A;  4FXD A;  2F3V A;  4JCV E;  1SJE D;  1K1Q A;  1VQA A;  1BOS A;  2XRS D;  3M3Y H;  4JI6 H;  1XMO Q;  2K33 A;  1GGO A;  3JRW A;  2Z1C A;  3SHL A;  1QVF A;  1SXT A;  1PH9 A;  5KFO A;  1FGB D;  3GTJ A;  1A8V A;  5DLQ E;  4HMJ A;  4JI8 Q;  1N33 Q;  4O3R A;  3SE0 A;  2CQA A;  1XNR H;  5TSS A;  4QJF A;  4X66 L;  4I7A A;  4EEQ A;  2NVY B;  1PXU A;  2IWH A;  1SYD A;  4YAJ B;  2O03 A;  5KNC A;  1J5E L;  2UUC L;  4IRD A;  2W6O A;  3K7A B;  3GLK A;  1MSH A;  2R7L A;  5M3M B;  3PO3 G;  2K01 A;  2W6Z A;  1HA5 A;  1J6Q A;  3Q24 A;  1C0A A;  1IZ6 A;  2XVS A;  2I87 A;  1DOK A;  1AUX A;  3BDL A;  5EKK A;  1E4F T;  2XCL A;  4DR6 H;  3I4M H;  1X3Q A;  5KFI A;  1Z47 A;  3EFX D;  1Q46 A;  5IOC A;  5KT5 A;  1W6J A;  1WR2 A;  4LUO A;  5FLX W;  3IFT A;  1VQL A;  5BN4 A;  1OXV A;  3KDF A;  3NEL A;  2H4O A;  5CBE E;  1FNV A;  4IUU A;  1S3O A;  2FJ2 A;  2B2V A;  3MEH A;  4CDC C;  2Z6B A;  1IL8 A;  4Y52 H;  5FLX c;  4M9U A;  4PMW A;  3OOC A;  4GKJ L;  2ZTD A;  4R4Q A;  2JQO A;  3DM3 A;  4LF6 L;  4HJ5 A;  4JI3 H;  4KY6 A;  5FLX L;  3LP8 A;  5G3L F;  3GTP A;  4KJO A;  1HZB A;  3NGD A;  1TWA H;  5L37 A;  3EVQ A;  1STH A;  4BY7 G;  1LT5 D;  3X3N A;  5JUM A;  5C8Y F;  2WB1 E;  3WOE A;  1PDQ A;  4B3S L;  3B6Y A;  1E22 A;  3CCU A;  2QYZ A;  1SSO A;  3I4N H;  1P8L A;  2DGY A;  2VB3 X;  4A3F H;  2WV6 D;  4DLK A;  1IBM H;  2R82 A;  5H80 A;  4UY8 C;  1I6V C;  3Q8P B;  4A3E B;  1A62 A;  3VR5 A;  2V59 A;  4DUY L;  3PW2 A;  1WTR A;  3UQ8 A;  3PF5 A;  1PMR A;  2NN6 I;  4X64 L;  1I94 H;  1W6K A;  3KTM A;  3J7Z C;  2BDN A;  1ASY A;  1C9O A;  3RD4 A;  4LH6 A;  4IFD I;  4C2M A;  4K5V A;  5CA1 F;  3KAK A;  5J39 A;  3MFY A;  1X55 A;  5JVD F;  1I5F A;  3PMF A;  3BAB A;  1WVL A;  2VQE L;  1WD1 A;  4DL7 A;  1F2Y A;  3G4S A;  1IBL L;  3CAM A;  2XCP A;  4Q5V A;  2W9C A;  2K1B A;  1FNW A;  2YCH A;  5ELE A;  1S03 G;  4EGQ A;  4DR5 L;  4JI1 L;  1KDA A;  4OXP A;  4PNY A;  2E2J H;  4NDX A;  2WAQ E;  2WTF A;  4IJL A;  2R8J A;  1D5X C;  2I5M X;  2I5H A;  3QJY A;  3MXN B;  2O5J C;  2NVY A;  4RGN A;  4A3E H;  1JXL A;  2FE3 A;  2FK2 A;  4DL4 A;  1SND A;  2QW7 A;  5LHY 1;  2Z4I A;  3NTH A;  2OCE A;  4KD3 A;  4RHS A;  2UUB Q;  3GTO A;  3CP0 A;  1K83 A;  2AU0 A;  2GPS A;  3GTK H;  4DV3 L;  3HOX B;  4BBS B;  1JWS D;  2YTY A;  2XWJ B;  3K81 C;  3A55 A;  2XD4 A;  3K5O A;  4KKT A;  5COY A;  2GLT A;  4K8J A;  4IRK A;  1KBL A;  4TV8 F;  1XX8 A;  4QWA A;  5CV5 A;  4L5T A;  2F52 A;  4KI0 A;  4K6L A;  1I7L A;  1S97 A;  2UXC L;  4MAM A;  2UUA H;  3RGX A;  3E0E A;  3VPD A;  2ZXO A;  4LF5 H;  1JOQ A;  4HNV A;  3BVM A;  4ECV A;  3OIQ A;  4MHE A;  4A3D G;  4KLK A;  4AQY Q;  5KG4 A;  1TY2 A;  4DR7 L;  3H15 A;  3HXL A;  3I55 A;  1L1O A;  1SNQ A;  4UCR A;  3MVV A;  4WD3 A;  4YBZ B;  1D1I A;  5DQH A;  4L5R C;  4L5S A;  4OO1 H;  5LMU L;  4NKL A;  3H40 A;  2DPJ A;  1PTO F;  5IT9 W;  3A8K E;  4B3M L;  2NVQ B;  2D9U A;  2F1M A;  2SNM A;  1BJT A;  3G71 A;  3HKZ G;  3FEW X;  4JVZ A;  2XIG A;  2UVW A;  4JV5 Q;  3WO0 A;  4MV1 A;  4FS2 A;  3D8G A;  1S5C D;  4KD4 A;  1EY0 A;  3PIO 3;  5IT9 L;  5T1G A;  3OWE B;  2YYA A;  1X3F A;  1EWC A;  4YWL A;  1EWI A;  4ME3 A;  1CM9 A;  2JYO A;  1B3A A;  2WFW A;  4O1N A;  4XYO A;  1KD1 C;  3D31 A;  4AYB A;  3BQ0 A;  5C6A A;  4A4I A;  5C4J B;  1Q86 C;  1B7Y B;  4JC0 A;  3NSW A;  4UCV A;  2RHS B;  4RKB A;  5EGT A;  4DXG A;  2NVQ H;  1RTO A;  5EPJ A;  4DV0 L;  5GAD C;  1J5E H;  2UUC H;  2JA7 B;  4DV7 Q;  3E3X A;  2F0J A;  2K75 A;  3F2B A;  4IPC A;  1EYG A;  4MZ9 A;  5C0X J;  5GQO A;  3QIA A;  3K59 A;  2JA5 B;  4PZ6 A;  3S1M B;  5EKL A;  1R4P B;  4R8I A;  3STB C;  5EPK A;  1Y1V A;  1NMF A;  2DPI A;  5KFX A;  3BYT B;  5J22 A;  2YW2 A;  1U5K A;  4MV9 A;  2WE6 A;  4X6A H;  2ZTE A;  4GLX A;  1N32 Q;  5C4J H;  3A5U A;  4DUZ Q;  4HYK A;  1FL0 A;  2DJG C;  1CTM A;  4NXN Q;  1ENF A;  5IIF A;  4NP5 A;  3EBE A;  2AQ3 B;  4MTK A;  3SGI A;  3H20 A;  4ME6 A;  5H1S E;  1QVG A;  1K1S A;  1QVC A;  4BA1 I;  4O0A A;  3M85 A;  2NBF A;  4GKJ H;  1CKO A;  3HOZ B;  2BDO A;  4LF6 H;  3PIP A;  2UU9 L;  1QCB D;  3K3P A;  3W2D A;  3T4A C;  1MI2 A;  2KHI A;  1XXG A;  3V96 A;  5GRO A;  3U9S A;  4ZLT F;  1VKZ A;  4FU0 A;  2N55 A;  4UCU A;  4B3T H;  2JA5 H;  1ULZ A;  3S1M H;  4LF8 L;  3G48 A;  4QQB X;  3HG9 A;  5JVH 3;  4B3S H;  5IYB H;  4ZRZ A;  4JI0 H;  3M7G A;  2W6M A;  3GV6 A;  2MJ8 A;  2BA1 A;  4KV6 A;  1TXY A;  1GUS A;  2JJQ A;  2Z0S A;  1Z7T A;  1JDB B;  3ETJ A;  5CGK A;  3FPP A;  1JC7 A;  4V0B A;  4IUR A;  2B63 B;  3L4K A;  1A2T A;  4DR1 Q;  1S68 A;  4IOA A;  5CAE B;  2D5D A;  4DV5 Q;  2IJ0 A;  4ZUJ A;  3TS0 A;  3HOZ H;  1TWF H;  1SCU B;  1QUQ B;  3OSO A;  1KNA A;  2UXB L;  1A9X A;  1UC8 A;  1GJX A;  3TQT A;  2AQ1 B;  2FLN A;  4EG0 A;  3PQI A;  5F2D A;  5KFQ A;  1U9R A;  4ECS A;  4YJ3 F;  2B2T C;  2F3W A;  3H3V C;  4GN3 B;  5DM6 3;  1CA6 A;  1Q1E A;  3BG3 A;  2VQE H;  4ILW A;  1QZH A;  2R92 B;  4C3J G;  4DL2 A;  5IOD A;  5JJZ A;  1PX2 A;  3TME A;  1G2T A;  4F4X A;  1PZK D;  4DR5 H;  2GVB A;  5IY0 A;  2K05 A;  3A0J A;  2QEX A;  4JI1 H;  4QUC A;  2ICI A;  2O4X A;  4WJW A;  2C35 B;  2FJZ A;  1B70 B;  3LWU A;  3TZU A;  1TVX A;  2B63 H;  2R8K A;  1K8G A;  2J6S A;  4UFZ A;  2SNS A;  2RDI A;  2SDF A;  1XMQ L;  5EZY F;  4DR2 L;  2CWP A;  5KG3 A;  4O3Q A;  2Y0S B;  2JA7 A;  3DUZ A;  3GTL B;  5C5J A;  2N3S A;  4QWB A;  1PFM A;  4B3R H;  1SYB A;  1RJT A;  4YHH Q;  3IFD A;  1MHW C;  1KL9 A;  3P7J A;  3CQZ B;  4DV3 H;  3K5N A;  3GD7 A;  3BQ2 A;  4C3I G;  3TP7 A;  2YU9 B;  3V4S A;  2KED A;  2KHS A;  2R92 H;  3D4R A;  3Q8S B;  2BH8 A;  5KFB A;  2A68 C;  2YS6 A;  4DR4 Q;  1JE5 A;  5D3D A;  2HHH L;  2VOB A;  5IWA Q;  1EUC B;  1AW7 A;  1HFN A;  3Q22 A;  4BWG B;  2UXC H;  3ORR A;  4MV3 A;  4JOI C;  3STB D;  1YIT A;  4I4T F;  2K6A A;  2E5L Q;  5M3M G;  3GTL H;  4J1M A;  3VA7 A;  4OX9 L;  1MJC A;  5CA0 F;  3KHL A;  4DR7 H;  1TWG B;  1M1K C;  4DV1 H;  4GOP C;  4YWM A;  5KGU A;  5KFF A;  5KG7 A;  2YU9 H;  2QGQ A;  4NXM Q;  3DF7 A;  5FO9 B;  3J81 W;  3V4Z A;  2V4D A;  5LMU H;  1O78 A;  3NK9 A;  1S0O A;  1PH3 A;  4B3M H;  1V4Y A;  1HHV A;  3QG1 A;  5DG9 A;  4ECQ A;  4A3K H;  4K2L A;  1WTP A;  3J7A V;  3G6Y A;  4A3L H;  1EYZ A;  1TWH B;  3EIV A;  3I4O A;  1DJR D;  3HBL A;  1B2T A;  1HTL D;  4EFB A;  2MUY A;  4X62 Q;  4FBU A;  1QUQ A;  2EYL A;  3CRL C;  2PBZ A;  3J81 L;  3MR2 A;  2EYF A;  2VR1 A;  2MP1 A;  2DUD A;  5CV9 A;  3Q1K A;  1RF2 D;  3MXP A;  4WFN 3;  1ICF B;  1M0W A;  5DG8 A;  1FVI A;  1TWG H;  1E2V A;  4LFC L;  1I50 A;  1Y8O B;  2AWN A;  4OWW B;  5IYZ F;  4FNF A;  2GPW A;  5KX5 F;  1IW7 C;  3RAX A;  4DAY B;  1LTT D;  4KHZ A;  2WB1 B;  1SNP A;  5A2Q E;  4J9S A;  4O2B F;  3TRZ A;  2QCP X;  4DV0 H;  2W6P A;  5KND A;  3GIJ A;  2RKS A;  2L4N A;  2EYH A;  3G6E A;  1TWH H;  4E4T A;  4DR3 L;  5IGC A;  3S2D H;  3KAL A;  4YP3 A;  4YCW A;  2ZDQ A;  1BNC A;  1V1P B;  2EDG A;  3D6W A;  3ITP A;  3KJO A;  1XPU A;  1A6X A;  3E9H A;  2MHV A;  1VQB A;  3LWE A;  3HOV B;  1DIK A;  4MTD A;  3NQT A;  4JUZ A;  1EHI A;  1S4Z A;  1Y8P B;  2F0E A;  3Q8R B;  1AE3 A;  2NVX H;  2UXD L;  2JEB I;  4AYB G;  2R84 A;  2K7V A;  2IL8 A;  1BCP F;  5AJ3 L;  4J6H A;  1UNS A;  4EQP A;  4JI5 Q;  1GSA A;  2DLN A;  4EGJ A;  1N48 A;  4POG A;  1ROD A;  1JQY D;  2BQ3 A;  1ML0 D;  1PFB A;  1WOC A;  2YRW A;  4F4W A;  4RB2 C;  4CC6 A;  2Q8T A;  2E76 C;  1TWC A;  2UU9 H;  4FVM A;  2IX0 A;  1F9Q A;  4CJ1 B;  4TQU S;  2VPS A;  4GC7 A;  1JJC B;  1XNQ L;  2FPI B;  2KEN A;  2OQ0 A;  1OO9 B;  4A3B G;  4DV2 L;  2V9W A;  2RDF A;  3HRZ C;  1IBK L;  4LF8 H;  2EJG C;  3PUZ A;  4GKK H;  2Q8I B;  4DV6 Q;  3HOV H;  3HOX G;  1LT4 D;  3RZO H;  4ALP A;  4BBS G;  3PZP A;  1JCK B;  1BVS A;  2NN6 G;  2A68 D;  2G9D A;  4JI7 Q;  4ED7 A;  2VQF H;  5KFA A;  3RTX A;  1XYI A;  3AU7 A;  1B53 A;  5KT2 A;  5E1F A;  2DN8 A;  4I7H A;  1CA5 A;  3M9N B;  5T1I A;  4AH6 A;  4A3G B;  3CC7 A;  1Q7Y C;  1LYL A;  2FMM A;  3NBH B;  3U58 A;  2XGT A;  2EY1 A;  5F9N A;  1EQV A;  1ASZ A;  3NEN A;  1YNN C;  3GV3 A;  1HNX Q;  2NYZ D;  5ELD A;  4LFB L;  3KAJ A;  2UXB H;  5BMV F;  1N9W A;  1MIU A;  1K0R A;  1PH5 A;  2JA6 B;  4NW2 A;  5CYU A;  2F4V Q;  2A74 C;  4XQN A;  1YJ9 A;  1HNW Q;  4LSX A;  2VW9 A;  5JEA H;  1EZ8 A;  2EYO A;  2ASD A;  1B8A A;  3AMU A;  4YY3 Q;  3Q2O A;  4DKA C;  4HSP A;  1EY8 A;  5FLX E;  1HNZ Q;  4DA2 A;  1FJG L;  3S2H B;  2FMA A;  4CGY B;  2R7M A;  2WB1 A;  5KT3 A;  3K7U C;  4LF4 Q;  1WI5 A;  3Q8Q B;  2CH4 W;  5IGD A;  5JQW A;  5FLM H;  4EYH B;  5BR8 L;  4HQ6 A;  4A93 B;  3GTQ B;  1ZEQ X;  3C3L A;  1B6S A;  4DR2 H;  1XMQ H;  1I4G A;  1Y1W B;  1SE2 A;  1SEB D;  3KF6 A;  2BR0 A;  4RKL A;  3I72 A;  2HDM A;  1GYF A;  3MXU A;  2ES2 A;  2RSO A;  2JA6 H;  2KOL A;  3QR8 A;  1O75 A;  1NR4 A;  4RGO S;  4F50 A;  3E6Z X;  4JI6 Q;  1XWE A;  1IW7 D;  2L5T A;  4GOP B;  4EX5 A;  1CKN B;  3FMC A;  2CW8 A;  3MEF A;  4IOC A;  4CJ0 B;  4BY1 G;  5C44 B;  4N8F A;  1AZP A;  2JA8 G;  4J9M A;  1DOL A;  5AFW A;  1XNR Q;  4ZKB B;  1K3B C;  1PZI D;  1CQV A;  1YJN A;  3JC6 6;  1LTA D;  1XMO L;  3S17 B;  4QW9 A;  4HIM A;  5GAH C;  3MR3 A;  3HOY B;  2HHH H;  1QOH A;  5EDW A;  3RN2 A;  1N33 L;  1CQI B;  5C5M A;  4J9K A;  5I6W A;  2L11 A;  1ILQ A;  2WAQ A;  1EIF A;  3R5X A;  2JA7 G;  2I0Q A;  4HJ9 A;  1Y1W H;  1R9T B;  4DR6 Q;  4YJ2 F;  1SYF A;  3BG5 A;  2VUM B;  3TP5 A;  3BZC A;  2ALZ A;  4OX9 H;  3S24 A;  4JBK A;  1VQK A;  4JV1 A;  2KHJ A;  3ULL A;  3ERS X;  3ZYY X;  4L1K A;  4QWE A;  4BBR G;  5DM7 3;  1G2S A;  4F8M A;  3KUP A;  4PV1 C;  5IGF A;  2BCO A;  1Z2P X;  3T5K A;  2QDB A;  5C3X A;  2FK3 A;  5LA6 F;  4L63 B;  5C44 H;  5FJ8 G;  4P75 A;  5D8D A;  2VA2 A;  5KIX A;  4RZR A;  3HOW B;  1ESF A;  4IZO A;  3V2T A;  1A2U A;  2RCN A;  4BA2 I;  2EXD A;  2O5I C;  1UNN C;  5CMD A;  4ECT A;  3N42 B;  3PR4 A;  1BO0 A;  2FXQ A;  5KFZ A;  4X3K A;  4ZKC B;  4O4L F;  4L6T B;  3K5M A;  1L0X B;  2EZV A;  4YAK B;  4FO2 A;  2NTT A;  3ONA B;  1JDE A;  3M3Y B;  4CBV A;  1STE A;  3OUU A;  4APM A;  1O7L A;  3N6R A;  2X0S A;  3LWB A;  1XPO A;  5IP9 H;  3S16 H;  4XYM B;  4WRD A;  5ELN A;  3KLW A;  4PG3 A;  2OTJ A;  1QJO A;  1A0I A;  1QG7 A;  3FKI A;  4LFC H;  4A3M B;  4ID6 A;  5IGE A;  5KKN B;  4GS3 A;  2RF4 A;  3RB3 A;  2Y0S E;  2PI2 E;  4K14 A;  1KAB A;  5ELC A;  3IN5 A;  4JV2 A;  5IYC G;  2F0F A;  2K04 A;  2QDL A;  1I7N A;  3T1H H;  3I73 A;  5I47 A;  1YNN D;  4YWK A;  1LLR D;  3N6X A;  2UVU A;  4HAE A;  4P74 A;  4KTA A;  3P75 A;  1Z2O X;  3I4M B;  1I94 Q;  3RBE A;  5HGQ A;  5IP7 H;  1B04 A;  1SDF A;  3CMA A;  3S1Q H;  4DNR B;  3TIG A;  4DR3 H;  2RA4 A;  4JOI A;  2K32 A;  3Q0A A;  5I2Y A;  5E4X A;  4R4O A;  2KEC A;  2M9V A;  2R86 A;  3HS0 C;  1DV2 A;  4FBT A;  5LL6 S;  3KFU A;  3GTM A;  2MCT A;  4GOP A;  5JVL A;  4A3M H;  5KFJ A;  1CKN A;  3GTP H;  2UXD H;  1ZQ7 A;  3TZD A;  2EY6 A;  3GV5 B;  4DAV A;  1I4P A;  1X56 A;  4RGT A;  4C3H B;  1EQT A;  5IT9 E;  1HR0 Q;  3K80 C;  2OQK A;  2JE6 I;  1L0Y B;  2AWO A;  2BQR A;  3T56 B;  1I4H A;  3WO1 A;  4C3J H;  1TWA B;  1RTN A;  5ELO A;  5KFY A;  2AGP A;  4XX0 B;  3DEO A;  2C22 A;  1QNU A;  5T14 A;  1KAA A;  5JEA J;  3GO5 A;  2LY7 A;  4FF1 A;  1UAP A;  5JOB A;  1G91 A;  2RVL A;  3I3C A;  1D7Q A;  1XNQ H;  3WDN A;  3I4N B;  2R6G A;  5KFV A;  3GIM A;  3D0F A;  3FP9 A;  2VUM A;  2B2Y C;  1VQF A;  1VQJ A;  4A3F B;  4DV2 H;  1IBK H;  1CK1 A;  3GIQ A;  2WIN B;  2R93 A;  4O2A F;  4FYD A;  3KHH A;  4A76 A;  2RQX A;  2E75 C;  3S14 H;  2EVB A;  1ESR A;  5JVG 3;  4HR7 B;  2GA4 B;  4MN3 A;  4H13 C;  1SNC A;  4A3J G;  4BWS C;  4C3H H;  1JR0 D;  1KXL A;  1S40 A;  2F0O A;  1ICW A;  4J15 A;  2UUA Q;  3S15 H;  4ED0 A;  1WFQ A;  1B9N A;  4K6D A;  1XJV A;  4B3T L;  4LF5 Q;  1D1K A;  4A3C G;  4OWX B;  1BXR A;  5J3B A;  4OON A;  3VYR A;  3G6J B;  4LFB H;  4PQX A;  2W9B A;  3W1G A;  1WTX A;  3F2U A;  1CHP D;  3RLN A;  2VS1 A;  4JG2 A;  5C0X H;  4ZHQ F;  1I4X A;  4JI0 L;  4A3I B;  2F0S A;  2ZJR A;  5COR A;  2E2J B;  1KJ8 A;  3K5I A;  4EQ5 A;  1FJG H;  4NPS A;  5KFD A;  1EOT A;  2O2L D;  2Z6K C;  5IE8 A;  2VXW A;  5I4D A;  3RB6 A;  1VQ8 A;  1C7Y A;  2NUC A;  1GUT A;  2ZXR A;  3BAA A;  4OO1 I;  5BR8 H;  4CDE C;  1YI2 A;  4JI4 L;  3GTK B;  2V4R A;  3MZ5 A;  4WOR A;  1IYV A;  4RB0 A;  1HZC A;  2A6H D;  1EU3 A;  2BQU A;  5HBR B;  1VF7 A;  2MPM A;  2R7F A;  3I70 A;  3AFQ A;  1T94 A;  4A3I H;  2K28 A;  2J4X A;  3RLF A;  2FHT A;  2CW7 A;  4HTH A;  2PQE A;  1A3T A;  1Z2N X;  2Z9H A;  2C2E A;  3G6V A;  1JOK A;  3NUC A;  2X69 A;  2TMP A;  5KG1 A;  4X66 Q;  4RH6 A;  3PSI A;  2NUA B;  3EPG A;  1XMO H;  1MBY A;  1O80 A;  2WB1 G;  4CHT B;  3GQB A;  5IYD G;  5IGG A;  1STN A;  3OTO Q;  4ABN A;  4B3R L;  1N33 H;  1TWA A;  5JPN C;  1G6P A;  1X32 A;  1OXT A;  3KLS X;  1H9K A;  4CKB A;  2B2U C;  4IAL A;  2R7Z H;  4JYA Q;  1RJQ A;  4G7O C;  3BJY A;  5EWF A;  1EU4 A;  1ZHQ A;  1GUN A;  3G6X A;  2W8K A;  5C1P A;  1S72 A;  2AQ4 A;  1SEI A;  4O3S A;  1YJW A;  3OSN A;  3T16 A;  1KC8 C;  3MWE A;  5GON F;  2V58 A;  4FS1 A;  3Q23 A;  3BJU A;  5KNB A;  4XT1 B;  3NE5 B;  3JAM c;  1UE7 A;  2IMW P;  4X3T A;  1ENA A;  2BE5 C;  4XYL B;  2DY7 A;  3S1R B;  1B44 D;  4HR7 A;  1SN8 A;  3SK5 A;  4R4C A;  3F2D A;  2VY3 A;  5G3L D;  4GKJ Q;  5C4X B;  3N41 B;  3DMU A;  5LYJ F;  4LF6 Q;  4BXX H;  2RGR A;  4ZUI A;  3L4J A;  5K2M A;  1M90 C;  4LUZ A;  4K5W A;  5C3E H;  1K0S A;  2HJW A;  2MQH A;  4DV1 L;  2WAQ G;  5M3F H;  2XNA C;  1LTL A;  3DM1 A;  3VR3 A;  2AGO A;  2F0K A;  1EYD A;  1PA6 A;  2FK1 A;  2R6F A;  1XTD A;  3WOF A;  4B3S Q;  1IOV A;  5M5W H;  3PUY A;  1QIL A;  4X65 L;  3SEB A;  2ZDG A;  2YTX A;  5EWE A;  3IRB A;  4IUT A;  1JIH A;  1N36 Q;  1N34 Q;  3J7A F;  2NWG A;  1E3P A;  3E0J A;  4Y7N H;  2X6L A;  2MNA A;  4A3B H;  1Y1V H;  2ID0 A;  4KN4 C;  4RMF A;  3S1R H;  3I56 A;  4DUY Q;  1JWU D;  1UUP A;  4TSS A;  5C4X H;  4A3G G;  1H9S B;  4X64 Q;  4R4I A;  4LW1 A;  3HOU G;  5C1O A;  2CQO A;  4DN4 M;  4JI2 L;  3GTK A;  4PMC A;  5HGT A;  1S0M A;  1RYS A;  4IFD H;  2E8G A;  2F03 A;  1HA6 A;  3BS1 A;  4DR1 L;  3CRK C;  5EPL A;  3CCV A;  4OHJ A;  4UP8 A;  4J8Q A;  1WYD A;  4DV4 L;  1H9J A;  3NP8 A;  4KHP L;  1X54 A;  3A5Z B;  3FDT A;  2VQE Q;  3I2Z A;  4POF A;  2VZA A;  5KFK A;  1IBL Q;  3FKI G;  4RFB A;  1GO3 E;  5FK9 C;  4HIO A;  4O2D A;  2IHE A;  1K8M A;  3KXY T;  2ZM6 Q;  1HUM A;  2PO4 A;  4QF4 A;  3J81 E;  3L2P A;  1WTO A;  1KJI A;  3VPC A;  3MXN A;  2E2D C;  2C9O A;  4FP5 D;  2FMC A;  3J81 i;  4U68 A;  1QNK A;  2WKD A;  3KYH C;  2OF1 A;  2A5H A;  1GKH A;  5JJK A;  1B1Z A;  1NTG A;  3KJP A;  2SCU B;  4RB1 A;  4PZ8 A;  2PPB C;  2HIV A;  1EIG A;  5FO7 B;  4RNN A;  3GP7 A;  2R8G A;  3RJ0 A;  2J9G A;  4HNU A;  3H09 A;  4JK1 C;  1S5F D;  4JW0 A;  2I8C A;  3DXJ C;  2DJF C;  3H0G B;  2SOB A;  2OT2 A;  4G4K A;  4K8I A;  3U4Z A;  5K36 H;  5KFH A;  3MR5 A;  3G7L A;  5C4H A;  4LFA Q;  4YHH L;  3MWM A;  1I3Q H;  4J9Q A;  3LML A;  4ED1 A;  1X9N A;  4PDB A;  1TWF B;  5L1I A;  1H9M A;  2OXP A;  3RMH A;  1E24 A;  1MJE A;  1VQM A;  4IAJ A;  4BY1 H;  3PW4 A;  2C00 A;  4ECX A;  3GIP A;  4EQN A;  5L1K A;  3HOY G;  3K8A A;  2XGQ A;  4DPG A;  4DR4 L;  4GKK L;  4QGU A;  5KFG A;  4ZQ3 A;  3JSN A;  4MV8 A;  1S5E D;  4DR7 Q;  2K50 A;  5KFE A;  3OHX C;  2VQF L;  1GHJ A;  2DNE A;  3H0G H;  3L0O A;  2VUM G;  4Q43 A;  2EY5 A;  1I4R A;  1SYG A;  2R93 G;  1A63 A;  4JBW A;  2BE5 D;  5J2T F;  5LMU Q;  3VDY A;  3JRX A;  4B3M Q;  2MO0 A;  4PZ7 A;  3GIL A;  1T9H A;  4Z9C B;  4F4Z A;  4LF7 L;  1VBG A;  1UEB A;  5KT7 A;  4NXM L;  3M4O B;  2E74 C;  5CBA E;  2QIL A;  1YHQ A;  1WCM H;  4CKE A;  3PIO A;  3R5H A;  2K03 A;  4B08 A;  5FPR A;  1R4Q B;  3GIK A;  4JI4 H;  5EJW A;  5GAE C;  1H9S A;  2QK4 A;  2PW7 A;  1HZA A;  2C2D A;  4RB3 C;  1KRT A;  1G51 A;  3P20 A;  1YIJ A;  2RDJ A;  2PYK A;  3Q8D A;  3RUZ A;  2NVT H;  3QFF A;  4GLV B;  2KCM A;  3E5S A;  1F2M A;  2B2Y A;  1OXU A;  4F88 A;  4JV5 H;  3PO2 H;  4OEM B;  1X3P A;  2AUK A;  2PQA B;  3CCR A;  5E7N A;  5CR3 A;  3KBG A;  4FDB A;  1DD2 A;  4ETS A;  3MFI A;  1TS3 A;  3QB3 A;  5CV7 A;  4IN3 A;  1GSO A;  5KFL A;  5LMN Q;  4I55 F;  2EJF C;  3M4O H;  1OTC A;  2PMZ B;  3RV4 A;  1YEZ A;  4ECY A;  3M4I A;  1G29 1;  1LTR D;  2JA5 A;  1NMG A;  4APV A;  5IYC H;  4B9X A;  3PO3 B;  3KHR A;  4OEL B;  1VDZ A;  3D6C A;  4GC6 A;  5CV6 A;  4GNX C;  4LMQ D;  2P5Z X;  4QY7 A;  4ULL A;  1BBU A;  2K5V A;  4A3K B;  3TP8 A;  3HGB A;  2ZJQ A;  2F4I A;  4IZ8 A;  4KN7 C;  5KT6 A;  2NU6 B;  4ZCK A;  1PTO H;  2CW0 C;  3NWT A;  3TP6 A;  3BU2 A;  4IFD J;  5D1O B;  4DAM A;  1CS0 A;  3SK8 A;  1TWF A;  5BN5 A;  2LFN A;  1I50 H;  4Q45 A;  3IKJ A;  4JI5 L;  2UU9 Q;  3GII A;  4LUV A;  1K73 C;  4M7E A;  4IUP A;  3PO3 H;  3F8N A;  2NZO A;  1E0B A;  1LAB A;  1LTI D;  3C46 A;  1N8R C;  5KFW A;  3VR2 A;  3N40 P;  4K0K L;  1ZHS A;  2VA3 A;  3I4N G;  4X65 H;  2FPG B;  3J80 W;  2FPP B;  1LT6 D;  1PFN A;  3OPO A;  2E2H H;  1JOR A;  1SRO A;  1U4R A;  1IOW A;  4O4H F;  1AE2 A;  1X65 A;  4LWC A;  3MJF A;  3FHW A;  2B63 A;  1PH8 A;  1O7Y A;  2Q2U A;  1WH2 A;  1MD2 D;  4J9N A;  4DV6 L;  1I6H H;  4IR1 A;  3S2D B;  3RGZ A;  2K5Q A;  3BQ1 A;  2WKC A;  3J80 c;  5JH7 F;  5HV6 A;  2D62 A;  3GTG H;  2JEJ A;  1EZ6 A;  4JI2 H;  3J80 L;  3M4Q A;  4JBJ A;  3NPP A;  4K5X A;  3TRE A;  4A3J H;  2F3I A;  2KEE A;  3L7Z C;  2XN9 C;  4DR1 H;  3U9T A;  2NVX B;  1DCZ A;  3QWN A;  1L0W A;  1SBB B;  5IGB A;  3SDZ A;  4DV4 H;  4KHP H;  2R92 A;  2KCT A;  4ME5 A;  1H95 A;  3C2P A;  2W57 A;  4BY7 H;  1VQP A;  1RCV D;  2AQ2 B;  2KVM A;  3T1H L;  2HGS A;  3SE7 A;  4MNO A;  2C28 A;  1STY A;  1EZ1 A;  2ASL A;  1BCP C;  2C5C A;  5K5P A;  4LF9 Q;  3TEH B;  4DNI A;  3H3V I;  4I7Z C;  4J9R A;  4KJN A;  4A3E G;  1BQQ T;  2F0L A;  1PHJ A;  1CSQ A;  2A6E C;  3OMC A;  3QOL A;  1HNZ L;  2RDH A;  3H6M A;  2Y0S A;  2EIF A;  2NB0 A;  2PI2 A;  4U7C A;  2IP4 A;  3D3R A;  3GTL A;  1E1O A;  3FVQ A;  3EQL C;  4CKC A;  2B2V C;  3A8I E;  3NHH A;  4KY5 A;  3S9W A;  4DR2 Q;  4DL6 A;  2EXZ A;  1OXX K;  5LL6 b;  4KK7 A;  3CQZ A;  3O13 A;  2W7P A;  4IUN A;  3RZO B;  3PR5 B;  4V19 0;  1M8A A;  3UI2 A;  1RL2 A;  3PN1 A;  2YU9 A;  5L1J A;  1VQ5 A;  1WTW A;  5KFU A;  2ATL A;  4NB3 A;  3T1Y Q;  4EYI B;  2WP8 J;  2R87 A;  4YHH H;  1JMC A;  5KFC A;  2XC9 A;  4ECZ A;  4UCS A;  3F2C A;  2NU8 B;  2Q2I A;  2PW5 A;  3V6J A;  4I65 A;  1PYB A;  1QWY A;  2HHH Q;  3K3V A;  1GHK A;  2IX3 A;  3E5N A;  4RNM A;  1N56 A;  5D3I B;  2I5L X;  3T5L A;  3ULP A;  3CC4 A;  2OH2 A;  3LNN A;  4DR4 H;  2JK8 A;  1TWG A;  1CT1 D;  4DU9 A;  5FD6 A;  3BA8 A;  4G3I A;  1TQO A;  3PF4 A;  4A3D B;  3K57 A;  5ISR A;  1V1Q A;  2K5H A;  3CCQ A;  1VQ6 A;  4OO1 G;  3BA9 A;  2CW0 D;  4IPG A;  1YHA A;  4MA0 A;  2F0I A;  2F0D A;  1PH6 A;  4TV9 F;  2HCI A;  3TN2 A;  3BVG A;  4ED2 A;  2G5D A;  2Z4H A;  1RD9 D;  1Z9F A;  1TWH A;  4LF7 H;  4NXM H;  4I50 F;  1PRT C;  2EE1 A;  1UE6 A;  3M4Y A;  3TDQ A;  2E2I B;  4B9W A;  4XDX A;  2QF7 A;  4U6P A;  2F0T A;  3FDS A;  5CC4 A;  2HVQ A;  3RV3 A;  3MXG A;  2NVX A;  3KLR A;  3EYY A;  3GV7 B;  4C56 C;  3DHQ A;  1CZG A;  4GNX B;  1A3U A;  4A3D H;  4DAY A;  3D4D A;  1IKL A;  3NTI A;  4ZQI A;  2V1C C;  2EQS A;  3PUV A;  2AUJ D;  1E4E B;  5I9O A;  1I4Q A;  1JT8 A;  1SFO H;  4QIW E;  1GM5 A;  2C2R A;  4HNT A;  2B29 A;  5J2U F;  1BF4 A;  3MWD A;  1VQH A;  3ND9 A;  4PMB A;  3PUX A;  1UEA B;  4RHR A;  4CDD C;  3RF2 A;  2GN5 A;  3OW2 A;  1EUD B;  1V1P A;  5KYL A;  2E2I H;  1JJG A;  2UVR A;  1JJ2 A;  1A3V A;  3AB9 A;  2R7K A;  4O42 A;  1NNX A;  4ECR A;  1PFS A;  1E2Z A;  3I12 A;  1BCP D;  4DXF A;  4A75 A;  1HR0 W;  3CPF A;  4IJH A;  1M4V A;  1YNJ C;  2XCA A;  3K58 A;  4JI8 L;  1L1O C;  1P16 A;  3D4W A;  4LMY A;  2CWA A;  4HCE A;  2L1B A;  4RAU C;  3EPI A;  2YRX A;  4KKS A;  4G57 A;  4NLG A;  3S16 B;  1E4G T;  4RUC A;  4JI5 H;  2KQ3 A;  5KFT A;  2JEI A;  4M8A A;  1VQ7 A;  1HR0 L;  2YL2 A;  3RNU A;  2B2T A;  1CI3 M;  1EY7 A;  3M9B A;  2JA5 G;  1XNQ Q;  4QCL A;  4DK6 C;  1CUK A;  4MV7 A;  1SNM A;  4J0M A;  2IX1 A;  1LAC A;  1CKM A;  2RDG A;  4RCN A;  4DV2 Q;  5IYB G;  1IBK Q;  5DQG A;  4K0K H;  2F0G A;  2HCC A;  3I7F A;  1PV4 A;  4MIU A;  5M5Y H;  1M0T A;  2F0U A;  1BCP B;  1K3R A;  1YVC A;  3PCO B;  1UE1 A;  4JI3 Q;  3NBH A;  1V9P A;  1RK5 A;  4DV6 H;  3S1Q B;  1C30 A;  1NAP A;  3GTJ H;  4FF2 A;  4MV4 A;  3BDO A;  3NWS A;  4XIG S;  3HOZ G;  5F9L A;  4JI7 H;  3VMM A;  1LT3 D;  1VQ4 A;  1W3S A;  5DEH A;  4FF3 A;  2JA6 A;  4HN7 A;  3J81 j;  4YB8 B;  1EIH A;  2K4K A;  3ICE A;  2IHF A;  1HUN A;  2ENB A;  3GTP B;  1VQO A;  4EGV A;  1GSH A;  2IT1 A;  3HFZ B;  1AFP A;  4F7X A;  1KHI A;  1VMC A;  4YQW A;  4GNX A;  1IBM Q;  2PMZ E;  3RZD H;  5CV4 A;  3R93 A;  2XWB B;  3PGZ A;  4TRD A;  4A2A A;  2LMC B;  4HMI A;  3UFX B;  4C3J B;  5C0X I;  4RZQ A;  2XTI A;  4F4Y A;  1E4E A;  2EYM A;  5EQ0 A;  3SK6 A;  1V43 A;  3ER0 A;  2P0A A;  2RSN A;  1PRT D;  2B63 G;  4P73 A;  1FYC A;  1HNZ H;  3GTQ A;  2DY8 A;  3L3O C;  5BR8 Q;  4WJ4 A;  4OGQ C;  5KT4 A;  1LUZ A;  1TS5 A;  1Y1W A;  1C8C A;  4QB4 A;  4UAI A;  3RUP A;  3N52 A;  4ZOL F;  3OSP A;  2D0O A;  4RU9 A;  2B8F A;  3RLO A;  4C2M B;  3BVZ A;  5HY6 A;  2R92 G;  3S14 B;  4TKO B;  4GN5 A;  4A2B A;  2EY2 A;  2VUG A;  4O3P A;  2FFK B;  2ASB A;  2Q2H A;  3H91 A;  4C3I B;  1DZ1 A;  3UE0 A;  2J0T D;  1HJP A;  3S15 B;  2K52 A;  2W9C B;  4EBC A;  2YZG A;  1BDO A;  3UE1 A;  3VR4 A;  1WD0 A;  3CCL A;  4RUA A;  4TQR A;  5EBD A;  1PRT B;  3TBI B;  1KIX A;  3GV8 B;  4EEY A;  1R9T A;  2TSS A;  2Y0S G;  2M00 A;  1KJJ A;  4C5A A;  1HQR D;  1YNX A;  4ED6 A;  1T5E A;  3HB9 A;  3ERO A;  3KLS A;  2D0P A;  3OTO L;  1TU2 B;  4R7R A;  3VYU A;  2UUB L;  1EFW A;  1ZXT A;  5I6Y A;  3T51 B;  1YNJ D;  3SXH A;  1JE4 A;  4JYA L;  3GTO B;  1K83 B;  3CKI B;  5EAY A;  4C2M H;  1ILP A;  1V51 A;  1IKM A;  4UDU C;  4TVA B;  4MV6 A;  1QE6 A;  4Y8V B;  3TII A;  1TS2 A;  1DXM A;  3UDX A;  4C3I H;  4A3K G;  1YBY A;  2KUM A;  4CDF C;  4UCO A;  1SYE A;  4UP9 A;  1EIY B;  4A3L G;  5ELB A;  3T5J A;  4K2K A;  1O7I A;  2EYP A;  2L9H A;  4RNO A;  4LNQ A;  3QO2 A;  4CC5 A;  4J9O A;  2VB2 X;  3KHG A;  3A74 A;  5EKI A;  1GUW A;  1D5Z C;  5CB4 F;  3BZK A;  2NVY H;  4FF4 A;  4MTN A;  1TA8 A;  2N78 A;  5LOV F;  3K7A H;  2LSS A;  2KJX A;  3N44 B;  1F9S A;  1Q82 C;  5M3M H;  4AQY L;  2JP1 A;  2V4Q A;  3GTO H;  4IR9 A;  1K83 H;  3EJI A;  2M2L A;  1SYX B;  2ZDH A;  3I90 A;  2NZ1 D;  2ATW A;  1L1O B;  4ED8 A;  3T5H A;  2R7Z B;  5M9O A;  4HSV A;  2HVS A;  2A73 B;  5NUC A;  2LXK A;  4J9P A;  2L55 A;  4LJZ C;  1N34 L;  1N36 L;  1SAP A;  4FM9 A;  1X3E A;  5KFM A;  1IXR A;  2CZG A;  4NMZ A;  2IBK A;  1UWV A;  2HVR A;  3OUZ A;  1EEI D;  1TY0 A;  4OL7 A;  4JV5 L;  1JB3 A;  3E9I A;  2YZM A;  3DWQ A;  2R3Z A;  2CVR A;  3CC2 A;  4DL3 A;  3MWY W;  2OWO A;  2L15 A;  3C1E A;  4OWT B;  1GUG A;  4LK1 C;  5E3F A;  2YZN A;  1AN7 A;  3RFC A;  4IHJ F;  1J5E Q;  2UUC Q;  1Z6H A;  3ULJ A;  4AYB B;  3RN5 A;  4JI8 H;  5C3E B;  4QWD A;  1KLU D;  2F0V A;  2N8N A;  3A7L A;  3CXC A;  1Y8N B;  5C3W A;  5M3F B;  2W9A A;  1D5M C;  5CV8 A;  2ZM6 L;  3C1F A;  4YCV A;  1DM0 B;  3HZX A;  3JAM W;  2AHO B;  2PNH A;  3W1B A;  2ZXP A;  4DV7 L;  1HR0 H;  1ET6 A;  1STA A;  5M5W B;  1EYC A;  4RCO A;  1A15 A;  1CQF A;  1QZG A;  5LP6 F;  2Q8R E;  3R5F A;  1JIC A;  4GZY C;  3BZD B;  3HOV G;  1HPC A;  4Y7N B;  2CFM A;  2H5X A;  2LKV A;  3U9O A;  4A3B B;  1DON A;  1PTO C;  3F1Z A;  1Y1V B;  5JJI A;  3HKZ E;  2I46 A;  4IPD A;  1H9R A;  2AMC B;  3AFP A;  3JAM L;  2FLL A;  5FO8 B;  2W8L A;  1N32 L;  4DUZ L;  1AH9 A;  1X3G A;  1RIP A;  4J9L A;  2WII B;  4NXN L;  1WJJ A;  4LFA L;  4OIK A;  5BN3 A;  2KSW A;  5DLG A;  1GUO A;  2KBN A;  1VF5 C;  3M9O B;  5LL6 X;  2W71 A;  4XQJ A;  1PVO A;  3PUW A;  3K5L A;  4B3T Q;  1RK6 A;  2KCN A;  1YHB A;  4KHV A;  3J7A 5;  3BYY B;  5KG6 A;  4IRC A;  4C1N K;  3FPU B;  1F2Z A;  1KAW A;  1LM0 A;  4EVO A;  5JEA G;  4JI0 Q;  5DQI A;  3EN2 A;  1BR9 A;  2RHQ B;  1HCZ A;  2CH4 A;  3NTK A;  4EBE A;  1AP0 A;  2XRQ D;  3PIP 3;  1SJH D;  3FRP B;  1F9P A;  2JEF A;  5I9P A;  1S0N A;  1UC9 A;  1HTP A;  5HUR A;  3HOX H;  3M4P A;  1K9M C;  4BBS H;  1SR3 A;  2NN6 H;  1CE8 A;  3R3O A;  5FLM G;  2YTV A;  4G7H C;  2R7Z A;  3H94 A;  1HQM C;  4JI4 Q;  4S3S A;  3V6K A;  4DNT B;  1NSN S;  1EFI D;  1VQE A;  2FB9 A;  4DV5 L;  2JA6 G;  1CFM A;  1V8Q A;  3W5O A;  1XTC D;  2I80 A;  3VPB A;  1EY9 A;  2N49 A;  1I3Q B;  1EQQ A;  3L9A X;  5FKA C;  2JXM B;  1RHP A; 
#chains in the Genus database with same CATH homology
 5IT9 c;  4DR5 Q;  4JI1 Q;  3NEL A;  5FLM H;  3PO3 H;  5BR8 L;  2NZO A;  1HZ9 A;  1S3O A;  1N8R C;  5LMN W;  4K0K L;  3KF6 A;  2MO1 A;  4Y52 H;  5FLX c;  3I4N G;  1FGU A;  4PMW A;  3J80 i;  4GKJ L;  2ES2 A;  2ZTD A;  4R4Q A;  2JQO A;  2R7D A;  3DM3 A;  3K0X A;  3UDI A;  4HJ5 A;  2E2H H;  4LF6 L;  2JA6 H;  1SRO A;  3CME A;  4JI6 Q;  4B3R Q;  1AE2 A;  1X65 A;  1HZB A;  4LWC A;  4EX5 A;  4GOP B;  4A93 G;  3FHW A;  1CKN B;  1TWA H;  1PH8 A;  2Q2U A;  3MEF A;  4DV3 Q;  1Y1W G;  4DV6 L;  4IOC A;  4BY7 G;  1I6H H;  4BY1 G;  2JA8 G;  2QA4 A;  3J80 c;  1XNR Q;  2WB1 E;  4B3S L;  5LMN L;  3B6Y A;  2D62 A;  3GTG H;  1E22 A;  3CCU A;  3JC6 6;  1YJN A;  1XMO L;  3I4N H;  3M4Q A;  2MFI A;  4JBJ A;  4HIM A;  1P8L A;  2DGY A;  3TRE A;  5GAH C;  4A3J H;  4A3F H;  2F3I A;  3L7Z C;  5C44 G;  3RN2 A;  1N33 L;  1L0W A;  4UY8 C;  2KCT A;  1DGS A;  1H95 A;  1EIF A;  2JA7 G;  1A62 A;  4HJ9 A;  2ZJP A;  1Y1W H;  2I0Q A;  2UXC Q;  4DR6 Q;  4BY7 H;  4DUY L;  1VQP A;  3BZC A;  3PF5 A;  3S24 A;  2NN6 I;  2JA8 H;  3T1H L;  4X64 L;  4JBK A;  4MNO A;  1VQK A;  2KHJ A;  3ULL A;  3ERS X;  4IPH A;  3J7Z C;  1ASY A;  4LF9 Q;  3KF8 B;  3TEH B;  4BBR G;  1C9O A;  4DNI A;  3H3V I;  4IFD I;  5IWA L;  4A3E G;  1PH2 A;  4DV1 Q;  1X55 A;  5IP9 G;  1PHJ A;  1NJI C;  1CSQ A;  5C44 H;  1I5F A;  5FJ8 G;  1HNZ L;  4P75 A;  2VQE L;  2EIF A;  2PI2 A;  1K8A C;  2E5L L;  1E1O A;  4DR2 Q;  3G4S A;  1IBL L;  3CAM A;  2JA7 H;  2RCN A;  4BA2 I;  2EXD A;  1OXX K;  3DLL A;  3CD6 A;  4X65 Q;  4DR5 L;  4JI1 L;  2FXQ A;  4OXP A;  4IO9 A;  2ALY B;  2E2J H;  2WAQ E;  2ZTC A;  1RL2 A;  4IJL A;  2I5M X;  4BBR H;  1VQI A;  2I5H A;  1VQ5 A;  3MXN B;  3HOW G;  4NB3 A;  3T1Y Q;  4A3E H;  2WP8 J;  1XPO A;  5IP9 H;  4LF4 Q;  3S16 H;  5FJ8 H;  1JMC A;  3NEM A;  3KLW A;  4PG3 A;  5ELN A;  3F2C A;  2OTJ A;  1MKH A;  5IP7 G;  2Q2I A;  1A0I A;  2UUB Q;  2OCE A;  4JI2 Q;  3CP0 A;  4GS3 A;  2RF4 A;  3GTK H;  4DV3 L;  1PYB A;  2HHH Q;  2Y0S E;  2PI2 E;  2YTY A;  4JBM A;  3K81 C;  2IY5 B;  2JA9 A;  4X62 L;  5IYC G;  4DV4 Q;  4KHP Q;  2I5L X;  3ULP A;  4R1J A;  4GLA C;  4A3M G;  4YWK A;  3CC4 A;  1KQS A;  4P74 A;  2JK8 A;  2A8V A;  1I94 Q;  5HGQ A;  5IP7 H;  3CMA A;  3PF4 A;  4QL5 A;  4DV0 Q;  4L5T A;  3S1Q H;  2F52 A;  4KI0 A;  4JOI A;  1V1Q A;  1VS0 A;  2K5H A;  3CCQ A;  1VQ6 A;  1NY4 A;  4R4O A;  4OO1 G;  2UXC L;  4IPG A;  1YHA A;  3E0E A;  1PH6 A;  3I4M G;  3KFU A;  4LF9 L;  4GOP A;  4A3D G;  1IL2 A;  4KLK A;  3CF5 A;  4HJA A;  1CKN A;  4AQY Q;  4A3M H;  3GTP H;  4H02 A;  1Z9F A;  1PYS B;  4DR7 L;  3H15 A;  1X56 A;  1HH2 P;  1OXS C;  1Q1B A;  3I55 A;  1L1O A;  1UE6 A;  3K80 C;  1HR0 Q;  2OQK A;  2JE6 I;  2AWO A;  2NZH A;  4L5R C;  4L5S A;  1EQR A;  4C3J H;  5LMU L;  1Y14 B;  5ELO A;  1NBW A;  2Z6K A;  4B3M L;  5JEA J;  3GO5 A;  3G71 A;  4GNX B;  3HKZ G;  4A3D H;  1D7Q A;  3T1Y L;  2V1C C;  2EQS A;  2R6G A;  2YYZ A;  3D0F A;  3FP9 A;  3PUV A;  1VQF A;  1VQJ A;  4JV5 Q;  3AYH B;  3PV0 A;  3LGJ A;  1JT8 A;  1SFO H;  4QIW E;  1GM5 A;  2B29 A;  2BH2 A;  4LF8 Q;  1X3F A;  4YWL A;  5C0X G;  4GKK Q;  4A76 A;  1VQH A;  3S1N H;  1EWI A;  4ME3 A;  3S14 H;  3PUX A;  1KRS A;  1SMX A;  2WFW A;  1KD1 C;  3D31 A;  2GN5 A;  2VQF Q;  4A4I A;  4C3H H;  3OW2 A;  4A3J G;  4A3F G;  1KXL A;  2CKZ B;  1Q86 C;  1B7Y B;  1S40 A;  4JC0 A;  2E2I H;  1JJG A;  4J15 A;  3U4V A;  2RHS B;  2UUA Q;  3S15 H;  1JJ2 A;  1WFQ A;  1XJV A;  4B3T L;  4LF5 Q;  2JEA I;  2AKW B;  3CQZ H;  4OWX B;  5J3B A;  4OON A;  3CCM A;  2NVQ H;  4A3C G;  4JI7 L;  3CCS A;  4DV0 L;  1PFS A;  3W1G A;  5GAD C;  4A75 A;  3RLN A;  2VS1 A;  4JG2 A;  4DV7 Q;  1HR0 W;  3CPF A;  4LF7 Q;  4IJH A;  2K75 A;  2LXJ A;  3F2B A;  1Q81 C;  4JI0 L;  2B3G A;  4IPC A;  3S17 H;  2UXB Q;  2ZJR A;  1X6O A;  1EYG A;  4MZ9 A;  5C0X J;  1SRU A;  4JI8 L;  1L1O C;  4EQ5 A;  1P16 A;  5GQO A;  2CWA A;  4PZ6 A;  4KHP L;  4NPS A;  3STB C;  1NMF A;  1NE3 A;  1BKB A;  1HNX L;  2YV5 A;  2Z6K C;  4AYB E;  1U5K A;  5IE8 A;  4R4T A;  4A3I G;  4A3C H;  1BBW A;  4X6A H;  1TWC H;  1VQ8 A;  3J81 c;  2F4V L;  1VQ7 A;  2ZTE A;  4GLX A;  1C7Y A;  1HR0 L;  2PQA A;  5C4J H;  1N32 Q;  1HNW L;  3A5U A;  3RNU A;  4DUZ Q;  3M9B A;  1XNQ Q;  2JA5 G;  1FL0 A;  4DK6 C;  1CUK A;  4OO1 I;  1PH4 A;  1YI2 A;  4JI4 L;  4NXN Q;  2IX1 A;  1CKM A;  3EBE A;  4DV2 Q;  4GN4 B;  3SGI A;  5IYB G;  4YY3 L;  5H1S E;  1IBK Q;  1HZC A;  1QVG A;  2Q2T A;  1QVC A;  1SE8 A;  4O0A A;  4BA1 I;  3M85 A;  1XPR A;  3I7F A;  1CKO A;  1XMQ Q;  1PV4 A;  1CSP A;  3PIP A;  2R7F A;  2UU9 L;  3AFQ A;  5M5Y H;  1K3R A;  1YZ6 A;  1YVC A;  3PCO B;  4A3I H;  4LF4 L;  2R7Z G;  2KHI A;  1UE1 A;  3RLF A;  5GRO A;  4JI3 Q;  1V9P A;  1PH7 A;  2JA5 H;  3S1M H;  3GTJ H;  4LF8 L;  4XIG S;  3G48 A;  4QQB X;  3HOZ G;  5IYB H;  4X66 Q;  1W3S A;  1VQ4 A;  3PSI A;  2A1A A;  3KF6 B;  3J81 j;  2WB1 G;  2BA1 A;  3AQQ A;  5IYD G;  1TXY A;  3ZJY C;  2JJQ A;  2Z0S A;  3CCJ A;  3OTO Q;  2K4K A;  4JI6 L;  3ICE A;  4B3R L;  2IHF A;  1G6P A;  1VQO A;  1OXT A;  2R7Z H;  2IT1 A;  3HFZ B;  4JYA Q;  1VQN A;  4DR1 Q;  1IYJ B;  1KHI A;  1VQG A;  3OYY A;  4IOA A;  4GNX A;  1IBM Q;  2PMZ E;  1JB7 A;  3RZD H;  1XNR L;  3M7N A;  4DV5 Q;  3PGZ A;  4BXX G;  3TS0 A;  1S72 A;  1TWF H;  3HOZ H;  1QUQ B;  5C0X I;  2UXB L;  1YJW A;  2XTI A;  5C3E G;  1KC8 C;  4OX9 Q;  1V43 A;  3ER0 A;  3BJU A;  5IYD H;  5M3F G;  2B63 G;  4P73 A;  3UDG A;  1AH9 A;  1EOV A;  4HID A;  4GN3 B;  2CCZ A;  2K14 A;  2A19 A;  3JAM c;  5BR8 Q;  1Q1E A;  1UE7 A;  4WJ4 A;  1LUZ A;  1QZH A;  4DR6 L;  5JJL A;  4K0K Q;  1SN8 A;  4R4C A;  3F2D A;  2VY3 A;  4GKJ Q;  4LF6 Q;  4BXX H;  2GVB A;  5IY0 A;  3A0J A;  3WWV A;  2QEX A;  1M90 C;  2D0O A;  4LUZ A;  5C3E H;  2C35 B;  3RLO A;  2MQH A;  4DV1 L;  2R92 G;  2WAQ G;  1B70 B;  1Y1V G;  5HY6 A;  1U0L A;  4GN5 A;  4P72 A;  5M3F H;  2B63 H;  1LTL A;  1K8G A;  2ASB A;  5C4X G;  1XMQ L;  2Q2H A;  1PA6 A;  4DR2 L;  2CWP A;  1XTD A;  4B3S Q;  3UE0 A;  1HJP A;  2N3S A;  5M5W H;  3PUY A;  1VQC A;  2K52 A;  4X65 L;  4YHH Q;  2K5N A;  4IFD G;  2YTX A;  1KL9 A;  3IRB A;  4JI3 L;  1PH1 A;  3UE1 A;  1N36 Q;  1N34 Q;  3GD7 A;  3CCL A;  1E3P A;  4Y7N H;  4LFC Q;  2MNA A;  3CPW A;  1KIX A;  4A3B H;  3GDE A;  2Y0S G;  2R92 H;  1Y1V H;  2ID0 A;  1YNX A;  4RMF A;  3S1R H;  3I56 A;  2BH8 A;  4DUY Q;  4RG1 A;  5C4X H;  4A3G G;  2D0P A;  3OTO L;  1UE5 A;  4R4I A;  4LW1 A;  4X64 Q;  1E1T A;  3T1H Q;  2UUB L;  3HOU G;  1EFW A;  1Q12 A;  2CQO A;  4JI2 L;  3H3V H;  1JE5 A;  4DR4 Q;  4JYA L;  2HHH L;  2E8G A;  5EAY A;  4C2M H;  5IWA Q;  4DR1 L;  3RR5 A;  3CCV A;  4UP8 A;  1WYD A;  1IBM L;  4DV4 L;  4TVA B;  3HKS A;  4DR3 Q;  1X54 A;  3A5Z B;  4JOI C;  2VQE Q;  3I2Z A;  3STB D;  3UDX A;  4C3I H;  4POF A;  1YIT A;  2E5L Q;  1Q8K A;  4A3K G;  1YBY A;  5M3M G;  2VZA A;  3AEV A;  1IBL Q;  4OX9 L;  3GTL H;  3FKI G;  1GO3 E;  4UP9 A;  4HIO A;  4O2D A;  1EIY B;  2IHE A;  1MJC A;  1I94 L;  4A3L G;  1E7Z A;  1O7I A;  2ZM6 Q;  4A3G H;  4LNQ A;  1M1K C;  3HOU H;  3L2P A;  5K36 G;  4GOP C;  4YWM A;  1L2F A;  3A74 A;  4HIK A;  2UXD Q;  5AJ3 Q;  2QGQ A;  3J81 i;  2YU9 H;  4NXM Q;  3BZK A;  3KYH C;  2NVY H;  1GKH A;  4MTN A;  1NTG A;  2HT1 A;  2N78 A;  3KJP A;  5JJK A;  1PH3 A;  3K7A H;  2LSS A;  4PZ8 A;  1SLJ A;  4A3K H;  1Q82 C;  5M3M H;  4AQY L;  2HIV A;  3FKI H;  2BA0 A;  4A3L H;  3GTO H;  1K83 H;  2GVA A;  3I4O A;  3EIV A;  4HJ8 A;  3U4Z A;  3S2H H;  4X62 Q;  1EUJ A;  1QUQ A;  2ATW A;  1L1O B;  2DUD A;  4LFA Q;  4YHH L;  4YCU A;  1VCI A;  1I3Q H;  2LXK A;  1N34 L;  1N36 L;  1FVI A;  4XTC S;  1TWG H;  1X3E A;  4LFC L;  2AWN A;  5GAG C;  3H0G G;  1X9N A;  1IXR A;  4OWW B;  2VL6 A;  4UPA A;  1UWV A;  4A93 H;  4DAY B;  3GTQ H;  1E24 A;  4KHZ A;  1MJE A;  4JV5 L;  3KDF B;  1VQM A;  4BY1 H;  2VNU D;  3E9I A;  3CC2 A;  3HOY G;  3CW2 C;  2OWO A;  3K8A A;  3TRZ A;  2L15 A;  4OWT B;  4DPG A;  3GTM H;  4DR4 L;  4GKK L;  4QGU A;  5M5X H;  3G6E A;  1WCM G;  4LFB Q;  4DR7 Q;  1TWH H;  2K50 A;  2VQF L;  3TS2 A;  1J5E Q;  2UUC Q;  2HIX A;  3H0G H;  3ULJ A;  3L0O A;  4DR3 L;  2VUM G;  4AIM A;  4HJ7 A;  4YCW A;  3S2D H;  3RN5 A;  2OTL A;  3KJO A;  2UUA L;  2R93 G;  1XPU A;  4JBW A;  1D8L A;  1A63 A;  3E9H A;  2N8N A;  4L5Q A;  5LMU Q;  3CXC A;  3F8T A;  4DK3 C;  3VDY A;  4LF5 L;  1VQB A;  3CCE A;  2ZM6 L;  3JAM i;  4B3M Q;  4YCV A;  4P71 A;  3TQY A;  2MO0 A;  2AHO B;  2PNH A;  4PZ7 A;  1T9H A;  1AE3 A;  1VQ9 A;  1FJG Q;  3W1B A;  3HOY H;  1W2B A;  4DV7 L;  2NVX H;  3PO2 G;  4LF7 L;  2JEB I;  4AYB G;  2UXD L;  1UEB A;  5AJ3 L;  4NXM L;  1YHQ A;  1QZG A;  1WCM H;  1GD7 A;  3PIO A;  1R9T H;  4JI5 Q;  1GVP A;  4POG A;  5GAE C;  2VUM H;  3HOV G;  2HQL A;  1WOC A;  2CFM A;  1HZA A;  2H5X A;  3KOJ A;  3UDF A;  1KRT A;  1G51 A;  2R93 H;  1YIJ A;  3F1Z A;  5JJI A;  3HKZ E;  1VQD A;  3Q8D A;  2IX0 A;  2AMC B;  3AFP A;  4IPD A;  2NVT H;  4GLV B;  2KCM A;  4UP7 A;  1N32 L;  1OXU A;  4TQU S;  4DUZ L;  3U50 C;  1JJC B;  1X3G A;  1RIP A;  2KEN A;  1XNQ L;  3PO2 H;  2OQ0 A;  2PQA B;  3CCR A;  5E7N A;  4A3B G;  4WJ3 M;  4NXN L;  1WJJ A;  4FDB A;  4LFA L;  3HOW H;  4DV2 L;  2KBN A;  1IBK L;  3PUZ A;  3HOV H;  4DV6 Q;  3RZO H;  3HOX G;  3PUW A;  4B3T Q;  4ALP A;  4BBS G;  1PVO A;  4JCV E;  1BVS A;  1VQA A;  2NN6 G;  1YHB A;  4JI7 Q;  3J7A 5;  3M3Y H;  5LMN Q;  1KAW A;  1LM0 A;  1XMO Q;  5JEA G;  1OTC A;  4JI0 Q;  3EN2 A;  1YEZ A;  2RHQ B;  3M4O H;  4AH6 A;  1G29 1;  3CC7 A;  1QVF A;  1Q7Y C;  1PH9 A;  1LYL A;  1NMG A;  4APV A;  1A8V A;  5DLQ E;  4JI8 Q;  3NBH B;  5IYC H;  2XGT A;  3U58 A;  1N33 Q;  1ASZ A;  3NEN A;  4QJF A;  4X66 L;  1HNX Q;  4LFB L;  3HOX H;  1N9W A;  3M4P A;  1MIU A;  1K9M C;  1SR3 A;  4GNX C;  1J5E L;  2UUC L;  4BBS H;  1K0R A;  1PH5 A;  4QY7 A;  2F4V Q;  1BBU A;  2K5V A;  5FLM G;  2YTV A;  3PO3 G;  1YJ9 A;  2ZJQ A;  1HNW Q;  2VW9 A;  1J6Q A;  1C0A A;  1IZ6 A;  4JI4 Q;  1B8A A;  4YY3 Q;  1VQE A;  4DKA C;  3BU2 A;  1HNZ Q;  1FJG L;  3I4M H;  4DAM A;  1Z47 A;  4DV5 L;  4IFD J;  1Q46 A;  2JA6 G;  1I50 H;  3W5O A;  4LUO A;  4JI5 L;  2N49 A;  1VQL A;  2UU9 Q;  1OXV A;  3KDF A;  3K7U C;  4LUV A;  1EQQ A;  1K73 C;  1WI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...