4A3CG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3cG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3cG01
3BZCA 1BBWA 3CPWA 3HOYG 1E1OA 5FLMG 1N34L 1UE1A 1QVCA 2UXBQ 5HGQA 1NMGA 3S2HH 1LUZA 1XMQL 1K0RA 2OCEA 2PI2E 4L5QA 4JC0A 4DV5L 3H3VH 4POFA 3UE1A 3I4MG 2EQSA 4X66L 4DR4L 5JJKA 4R4TA 1HR0W 5M3FH 3PO2G 4MZ9A 2E5LQ 2WFWA 3U4ZA 3K7AH 4X65L 3J80i 2Z6KC 1WYDA 1XMOL 3GTLH 4JI7L 1W2BA 1YIJA 1IBMQ 4LFBQ 1IBML 3A5UA 1V43A 3F1ZA 3CCQA 1K8GA 4LFBL 1O7IA 2VS1A 3I2ZA 4TQUS 2R7ZG 3RLOA 1JE5A 2ZJQA 4B3SQ 1AH9A 5IT9c 2F52A 3M85A 4R1JA 1X3EA 2BH8A 4BBRG 5C0XG 2N8NA 3ICEA 2B63H 1E1TA 1K73C 1VQBA 2DGYA 1U5KA 3FHWA 1PH2A 2CCZA 1V1QA 3W1GA 1N32Q 3AFQA 3OTOL 3PO3G 2K14A 4GLVB 3FKIH 3MXNB 4ALPA 2Q2TA 4LF4Q 2ZJPA 2YTYA 1XPUA 2R7ZH 1S40A 4EQ5A 1ASYA 3NBHB 3RLNA 4IFDJ 5GAHC 5GQOA 4AIMA 4BA1I 4AYBE 4YCUA 1X55A 4A3JH 1HNWQ 3GTPH 2KHIA 1PH4A 3ULLA 3PCOB 2JA6H 4X62L 4LF5Q 1GM5A 3F2DA 1VQFA 1A63A 3A0JA 4HJ7A 1AE2A 5C4JH 2JEBI 5IYBG 3J81c 2KCTA 3DM3A 4RG1A 4DR1L 4DPGA 1D7QA 2JEAI 2JJQA 1I94Q 3PF4A 1I5FA 5LMUL 4GOPC 1CKNB 2B29A 4XIGS 3KOJA 4HJ8A 1YJNA 4BY7H 1N36Q 1TXYA 1JJCB 1HH2P 1S3OA 2R92G 4O2DA 1FL0A 4C3JH 2VQEQ 4IOCA 4X6AH 3MEFA 4TVAB 4A3BG 1HZAA 4BY1H 3HOUG 3I7FA 2PMZE 1QZGA 4K0KL 3PSIA 3I55A 4X64L 4HJAA 2UUAQ 4KLKA 3TQYA 1Q86C 3H3VI 3PUZA 4DR3L 4POGA 2KENA 3S15H 3HOXG 1G291 1Y1VG 4XTCS 5IWAL 1VQ7A 4HJ9A 2IY5B 1SRUA 3WWVA 4JYAL 1Q7YC 1GKHA 2OTJA 1Z9FA 3TEHB 1Z47A 2VUMH 2PQAB 5BR8L 3IRBA 3S1QH 5E7NA 1EIFA 5AJ3L 3OW2A 3SGIA 2VY3A 1KQSA 4L5TA 5EAYA 1L0WA 4A76A 5GROA 3I56A 1WFQA 1KAWA 4A75A 4DV5Q 2WB1G 3GDEA 4LF7L 3T1YL 4DV4L 4JBKA 2LSSA 4A3CH 4B3TL 1HZCA 1VQGA 1Y14B 2OQKA 3PV0A 4YCWA 2Y0SG 4YHHQ 1K9MC 4DR6L 4JBMA 4HIKA 4ME3A 3S1NH 1PV4A 4B3ML 1L1OA 4LWCA 1Q82C 4B3SL 2JA9A 4A3BH 3S17H 4A3MG 3HOYH 1UE6A 2ATWA 3PUXA 1WJJA 1LYLA 2B3GA 4PMWA 4DV7Q 4YWLA 1X65A 1Y1WH 1B70B 4GLXA 1N32L 2NVYH 4Y52H 2QEXA 1TWGH 1HNZQ 1UE7A 3AYHB 3HFZB 4YWKA 1PH1A 1S72A 3NELA 3G6EA 3KDFA 2Q2UA 4IO9A 2JA8G 3HOWG 4K0KQ 3CCLA 5GAGC 3CF5A 1VQ6A 4A93G 4JBJA 1QUQA 2BA0A 5DLQE 2K50A 4R4OA 2VUMG 3KJOA 2JA5G 1HNWL 1SE8A 2IX0A 2A19A 5LMNW 2HT1A 1IZ6A 1QVGA 3M7NA 3AFPA 1NY4A 1YEZA 1I50H 2CQOA 2UUCQ 3T1HQ 4JI6L 2UUCL 2R6GA 3GTMH 1PA6A 4GS3A 2YTXA 3KDFB 4WJ4A 1PYSB 4KHPQ 4A3DH 3KYHC 1GO3E 3W5OA 1VQCA 5M5WH 4DV2Q 2K75A 2UXBL 1UWVA 1H95A 3E9HA 4LF9L 1HNXL 5LMUQ 4OO1G 4NXMQ 2VQFQ 3GTOH 4B3RL 2PNHA 4OWXB 2PI2A 1PH3A 1GD7A 5ELOA 5JEAJ 3LGJA 1X3FA 4DR7Q 2E2JH 4GN3B 4JI7Q 4A3MH 1OXXK 4JI3L 4BA2I 2ZTDA 3NEMA 1TWAH 1CSQA 5IYCG 4OX9Q 4DUZL 3K81C 4QIWE 3KF6A 4OX9L 2K5VA 4A3LH 4NXNQ 1NMFA 3I4NG 2XTIA 3JAMi 3I4NH 1G51A 3GTGH 2KHJA 1X9NA 1B8AA 1VQDA 1SMXA 4JI5L 1Q12A 1YI2A 2JE6I 2EIFA 1M90C 4WJ3M 2Y0SE 2K4KA 5GAEC 2PQAA 1EYGA 4GKKQ 2JA5H 4IFDG 4IJHA 1EQQA 2RF4A 4DV1L 2YYZA 2D0PA 1B7YB 5AJ3Q 3CCEA 3JC66 1WOCA 1YBYA 4LUOA 4GNXA 3VDYA 2CWAA 4LF4L 4Y7NH 2CWPA 1YITA 2WP8J 3M4QA 1X56A 4LF8L 1FGUA 4JI1Q 3HOUH 4A3FG 4LF6L 2HHHL 1L2FA 2MO0A 3M3YH 4LF7Q 4IPCA 3ER0A 4GN5A 1K83H 4DV6Q 1FJGQ 4LF5L 1VQAA 3M4PA 3NENA 4JI2Q 5LMNL 1IYJB 3GTKH 1N33L 3H0GH 4JI8Q 2F3IA 5C3EH 2JA8H 1EIYB 3HOWH 4DV3L 1VS0A 1XTDA 1C7YA 2UUBQ 4A93H 2I5LX 1BBUA 4B3MQ 4BY1G 2R93G 2BA1A 2C35B 1PVOA 1N36L 1J5EL 1FVIA 1Y1WG 4DV7L 1CKOA 3CP0A 3RNUA 4A3KH 2QA4A 4A3KG 1MJEA 4JI0L 3BU2A 4OWTB 2VQEL 3I4MH 3K7UC 2ZM6L 1V9PA 4C2MH 3DLLA 2CFMA 1KIXA 2ZTEA 3RR5A 3U4VA 2UUAL 4DR2L 1VQIA 3UDGA 2JQOA 3BJUA 3GD7A 2IX1A 2MNAA 1HJPA 3CPFA 4LFCL 1YHQA 4GKJQ 2FXQA 4LFCQ 1IL2A 4IPHA 5C44H 4GKJL 4YWMA 4P73A 4OWWB 3CCVA 1X3GA 3AEVA 2UU9Q 3F2BA 1JB7A 3KLWA 4GKKL 4H02A 3CCRA 3ULPA 1SFOH 2R7FA 5H1SE 1OXSC 1IBLQ 3RLFA 3F8TA 3EBEA 2ID0A 1N9WA 3PIPA 1YVCA 1HNXQ 4DV2L 1NE3A 4HIDA 2V1CC 1RIPA 3H0GG 1HR0L 1SLJA 2VQFL 1VQ5A 4L5RC 2R92H 3S2DH 1KD1C 2E2HH 2E5LL 4DKAC 4BBRH 4B3TQ 3UE0A 1E24A 1EUJA 3G48A 3D31A 5C0XI 4X64Q 2UXCL 3A5ZB 4NXNL 1CKMA 2K5HA 2YU9H 3I4OA 1YHAA 1JJ2A 2Z0SA 2RCNA 1QZHA 1BVSA 4GNXC 1XPOA 1IBKQ 1C0AA 1XJVA 1OXVA 2Q2HA 3CC7A 2XGTA 3S16H 1HNZL 1LM0A 2GVAA 4P75A 3HOZG 3EIVA 1JJGA 5IP7H 2AWNA 1K3RA 5C0XJ 4JV5L 5JJLA 1WCMH 2WB1E 1Q46A 3E0EA 4R4IA 2IT1A 3J7A5 4LF6Q 4P72A 2HHHQ 2K52A 1VQKA 3S24A 3PUWA 3S1MH 2ASBA 3PO3H 4DUYQ 4C3HH 4PZ6A 1PH5A 1VQ9A 3KF6B 3T1HL 4MNOA 3GTQH 4OO1I 4KHZA 4LW1A 3ZJYC 4NB3A 1XNRL 1Q1EA 2E8GA 4YHHL 2VL6A 2N49A 3CC4A 4HIMA 1VQHA 1XNRQ 4KHPL 2JA7H 5IYDH 1N34Q 4AQYL 2UXDQ 5K36G 1P8LA 1W3SA 4A3JG 3GO5A 4IPGA 4LF9Q 4MTNA 4DV3Q 5J3BA 5IYCH 4DAYB 3TS0A 2I5MX 1VQJA 2L15A 2RHQB 3TREA 1VQLA 3S14H 4JBWA 4DK3C 3ERSX 1J5EQ 1AE3A 2I0QA 2LXKA 4YY3L 1KRSA 4JCVE 1HZ9A 4DR7L 3HKZE 1SN8A 4IPDA 4L5SA 3UDXA 2GVBA 4X65Q 1E22A 3A74A 3U50C 1U0LA 4A3FH 1TWHH 4HJ5A 2DUDA 3KF8B 4GLAC 3CW2C 1HZBA 1PHJA 1EFWA 5IWAQ 1E7ZA 2VW9A 1OXTA 4QL5A 1Q1BA 4LFAL 5IP9G 4JYAQ 5FLXc 3B6YA 5ELNA 2Z6KA 4AH6A 4BXXH 4HIOA 1TWCH 3M4OH 3FP9A 1UEBA 4DR5L 2B63G 1GVPA 4DR5Q 3M9BA 3H15A 4FDBA 2WAQE 3PGZA 4A4IA 2RHSB 4DAMA 1NTGA 4DK6C 3CXCA 4PZ8A 4DV1Q 3KFUA 4A3LG 4QGUA 5C4XG 3U58A 1IBLL 4LF8Q 3HOZH 3J7ZC 1TWFH 1G6PA 5C3EG 1DGSA 2ZJRA 5IYDG 1K8AC 3J80c 1L1OB 2JA7G 4J15A 4A3IH 4P71A 2NZOA 1HR0Q 3CCUA 4BXXG 4OXPA 5GADC 4DV6L 1XNQL 1VCIA 1VQ8A 2ZTCA 3PUYA 4P74A 4JI4Q 4JI4L 4JI8L 4QY7A 5LMNQ 4JI2L 4IOAA 4QQBX 1NBWA 1KC8C 4AQYQ 2NVQH 1YJ9A 2UXDL 1WCMG 1A62A 3AQQA 1YNXA 1N8RC 2CKZB 4EX5A 4JI0Q 1Q8KA 3G4SA 2E2IH 3RN5A 1E3PA 3OYYA 3D0FA 5JEAG 1IBKL 1VQMA 2I5HA 3BZKA 3EN2A 5M5XH 3OTOQ 3KJPA 4QJFA 5IP9H 2ZM6Q 2GN5A 4UPAA 4LUVA 4JV5Q 4UP9A 1A8VA 2IHFA 2MO1A 5IYBH 3HOVG 2R93H 2F4VQ 4DR3Q 3CC2A 2MFIA 3CMAA 2KBNA 3JAMc 5M3MH 4LFAQ 1BKBA 3CCMA 3ULJA 1I6HH 2HIXA 2JK8A 4AYBG 4PZ7A 4JI6Q 3TRZA 5FJ8G 3L0OA 4GNXB 1RL2A 3W1BA 1CUKA 1I3QH 2NN6G 4A3IG 1N33Q 3PF5A 2LXJA 1PH8A 3HOVH 2R7DA 1P16A 1JMCA 1YZ6A 1PH6A 3F2CA 1MKHA 3CCJA 1I94L 2OTLA 5HY6A 2BH2A 1M1KC 4DR1Q 1XMQQ 1CKNA 4B3RQ 5M5YH 2N3SA 4NXML 4UP7A 1QUQB 1UE5A 1VQEA 1PH7A 1X54A 4YY3Q 3E9IA 4UY8C 1XNQQ 5IY0A 4DV4Q 2K5NA 3PO2H 4BBSH 4BBSG 4UP8A 1XMOQ 3G71A 4RMFA 4IFDI 4YCVA 1MJCA 1PYBA 5M3MG 4DR6Q 1LTLA 1EQRA 5C44G 4DUZQ 1VQOA 4NPSA 3CD6A 1L1OC 1SROA 2N78A 1KXLA 3PUVA 1KL9A 5IP7G 2OWOA 4JI5Q 3K8AA 2IHEA 2AMCB 4A3EG 3L7ZC 5M3FG 1A0IA 1WI5A 2AKWB 4R4CA 4APVA 5IE8A 3RN2A 5BR8Q 2YTVA 4KI0A 1IXRA 3RZDH 4DV0Q 2KCMA 4JOIC 1XPRA 3HOXH 1KHIA 4DV0L 2YV5A 4OONA 3CMEA 4PG3A 2ES2A 3STBD 4A3GG 3STBC 1YJWA 1KRTA 1VQNA 4LUZA 4JI1L 4X66Q 4DR4Q 2A1AA 4JOIA 1VQPA 2ALYB 1PH9A 2AWOA 2HQLA 2QGQA 3UDIA 1FJGL 3Q8DA 4DNIA 3T1YQ 2WAQG 1OXUA 2JA6G 2MQHA 1Y1VH 4JG2A 2UXCQ 2UUBL 1ASZA 1EOVA 2H5XA 2A8VA 1X6OA 3CQZH 3GTJH 5JJIA 4A3DG 2NVXH 5FLMH 3HKZG 4A3CG 2EXDA 3J81i 3CAMA 4O0AA 3FKIG 4GOPB 3UDFA 4C3IH 2VZAA 4BY7G 2VNUD 2OQ0A 1OTCA 2NN6I 3HKSA 1D8LA 3PIOA 1JT8A 3CCSA 2Q2IA 5C4XH 4JI3Q 1PFSA 1T9HA 3K80C 4A3GH 4A3EH 1EWIA 1SR3A 4DR2Q 4GOPA 1VQ4A 2D0OA 4GN4B 3J81j 4LNQA 1C9OA 2D62A 2F4VL 3RZOH 2HIVA 1MIUA 1YHBA 3K0XA 2NZHA 1R9TH 4R4QA 1NJIC 1QVFA 2NVTH 5FJ8H 4DUYL 3S1RH 1J6QA 2UU9L 3TS2A 1CSPA 3L2PA 4X62Q 4IJLA 2AHOB 1Q81C
chains in the Genus database with same CATH superfamily
3T1HH 3BZCA 1SJHD 3NXWA 3CPWA 1XNRH 3C3LA 1N34L 1TWHA 3OTOH 3RBDA 2ASLA 2UXBQ 5HGQA 1NMGA 3T53B 2O2LD 4DV5L 4EVOA 1KEEA 1K1QA 1EYAA 2HCIA 5BN5A 2VQDA 1HR0W 5M3FH 1STYA 1EUCB 1HQRD 1EYDA 2WFWA 1D5ZC 4FF4A 4MTDA 2E2HB 1W2BA 5CV8A 1FKAH 4LFBQ 5KFCA 3CCQA 2VB3X 3I2ZA 3G6JB 4IN3A 2RGVA 4CDEC 4LH7A 1HA6A 1Y1WA 1II3A 1X3EA 3GV6A 4BBRG 1TWCB 4EYIB 3ICEA 1K73C 1PH2A 4O3RA 3W1GA 1N32Q 4K6LA 3AFQA 3PO3G 4Q0FA 3SDZA 3MXNB 4ALPA 4IALA 1DCZA 2YTYA 1FNUA 2R7ZH 1STHA 5FKAC 1ASYA 4IFDJ 1ENCA 4A3JH 3RF2A 1X55A 3BG3A 4KKUA 3OHXC 1PH4A 4JI7H 2JA6H 3HOXB 2HVQA 1JLLB 1UNSA 4HJ7A 3GQCA 2X0SA 2KCTA 3MWMA 1EL0A 4DPGA 4BWSC 4C56C 2JA8B 4G7OC 4HJ8A 3KOJA 2H1EA 2EVBA 1N36Q 2A73B 3T51B 4FS2A 1HH2P 1FD7D 2WE6A 3WOEA 2R92G 2VQEQ 3U9OA 2ZXOA 4A3BG 3HOUG 3PVXA 2JEJA 4DR6H 3I55A 5DLGA 3C1FA 2NVQB 1Q86C 1FR3A 1EY7A 5EGTA 5C3WA 2NVTB 4M7EA 3S15H 3H40A 2XRQD 1SE4A 3U9SA 1TKWB 4HJ9A 2IY5B 2B2VC 3LWEA 4JYAL 4MV3A 3D4RA 4YIJA 3KAJA 5KGUA 1U9RA 4RFBA 3T13A 1HUNA 3TEHB 5CA0F 2VUMH 3NSWA 2SOBA 1DXMA 2IJ0A 4QF4A 2HJWA 1ZETA 1A2TA 2FMAA 3DEPA 4A76A 4HCSA 1OO9B 3VR4A 4J1MA 2VUMA 5IT9E 4B3TL 1HZCA 1PTOD 2EY2A 2ZDGA 4F4WA 2AU0A 1TAEA 1F2ZA 2KQ3A 1K1SA 2B63A 1JDBB 4B3ML 2OT2A 1SFOB 4C2MA 3S17H 2N55A 1IKLA 1UE6A 3VPCA 1EY0A 2YRWA 2R8GA 1E2VA 2B3GA 4PMWA 3IN5A 1X65A 1E4GT 3RV3A 2Z4HA 4Y52H 1KABA 1S0OA 1TWFB 3BYYB 4YWKA 1NAPA 1PH1A 1RJRA 3NELA 4HN7A 2CH4A 4NKLA 3KDFA 4R8NA 2Q2UA 4IO9A 3HG9A 2JA8G 4KY6A 1WTVA 1BQQT 1E4EB 1QUQA 2PN1A 1SBBB 1H9KA 4UCVA 3FPPA 3NK9A 3KJOA 2XCLA 1SE8A 3EPGA 1PZID 1S4ZA 3PIP3 5EDWA 2F0TA 4B3SH 2BCOA 5T1IA 1QVGA 3OUUA 4Q44A 1PRTD 2CQOA 2K32A 5CV7A 3T1HQ 2AGOA 1PA6A 3H4DA 4GS3A 2YTXA 3GIDA 1KDBA 2GA4B 1QWYA 2XNAC 1V1PA 5C3XA 3W5OA 2UXBH 2WKCA 3C0FB 3E9HA 4OO1G 1WTXA 4OWXB 1TS4A 1PH3A 3HKZB 1V1OA 3LGJA 4GN3B 4JI3L 4BA2I 1SYFA 2ZTDA 3NEMA 2Z9HA 2YCHA 3HOVB 5L1JA 4IRDA 2RKSA 1QG7A 3K81C 1RDPD 4K5VA 2XTIA 5KT5A 3G6XA 1X9NA 1EHIA 4F4ZA 1B8AA 3CKIB 1SMXA 4EGQA 1EIGA 2RDFA 4PMCA 2JE6I 4A3IB 2W71A 3OSPA 1M90C 3MFYA 2Y0SE 1EYGA 4WJWA 4YAJB 4IJHA 4DV1L 4LF9H 2D0PA 1B7YB 5AJ3Q 4LUOA 4GNXA 4LF4L 2JN4A 2CWAA 3H20A 4Y7NH 4EEQA 1BNCA 4HCEA 4JI1Q 3OPOA 4A3FG 4MTEA 2J0TD 2WKDA 1IOVA 1YNND 4DV6Q 3T5LA 4LF5L 3NENA 4DN4M 1N33H 5ELDA 5KT4A 2F3IA 5C3EH 4DV3L 1UUPA 2WIIB 3QJYA 2V4DA 4DV7L 5C5JA 3SE7A 3ORRA 1I7NA 5CORA 1BCPF 3PN1A 1SAPA 3HOZB 1JWSD 3I4MH 3G6VA 4C2MH 1EYCA 1H9SB 2ZTEA 3UDGA 4QW9A 5IGFA 3GD7A 2MGSA 2WTFA 1SNDA 2UVRA 2ICEC 1YHQA 2J9GA 1IL2A 3BYTB 4IPHA 2R84A 4YWMA 5NUCA 3C46A 2R7NA 4LF7H 4ID6A 3R5XA 1HNWH 4P73A 5KFOA 4ODGA 4KD3A 3AEVA 4C3JG 1HUMA 3MTSA 2Z8LA 4GKKL 3BQ1A 5IGEA 4YAKB 4ED1A 5EKIA 4FBUA 2H4OA 5E1FA 1S9FA 3RJ0A 3RLFA 2CW0D 3F2UA 3EBEA 2ID0A 3PIPA 3GTJA 4HIDA 2CQAA 1Q8IA 1RIPA 4DXFA 4UCRA 2F3WA 2VQFL 2R92H 4YJ2F 3VYSA 1F9SA 4L6TB 4DKAC 1GUTA 5KG2A 3RD4A 1EY5A 2RSNA 1E24A 4XQNA 5C0XI 5DQIA 2FHTA 2UXCL 3A5ZB 1HTPA 3K6OA 4NXNL 1CKMA 2YU9H 3N41B 4KHPH 2C28A 4UCUA 1V4YA 2Z0SA 3V6HA 2ZDQA 1KTKA 2RCNA 3FRPB 2V9WA 2BQRA 1BVSA 3I91A 1IBKQ 2EY1A 5GONF 2Q2HA 3CC7A 5LL6X 1K8MA 2I80A 4CDDC 1F2LA 3MFGA 3HOZG 1JJGA 3MR3A 2DWCA 2FKLA 5C0XJ 3KHGA 3GTGA 2DJFC 4B9XA 1Q46A 3E0EA 4R4IA 3DUZA 2I87A 4LF6Q 3SXHA 2HHHQ 4CJ1B 3Q23A 1VQKA 1DONA 3PO3H 1XMOH 2W6ZA 2M2LA 4PZ6A 1FNWA 1AP0A 3TQ1A 5C4HA 5M5WB 4YHHH 5COYA 2JA7H 5IYDH 4JVZA 4AQYL 1CI3M 2UXDQ 1P8LA 4O3NA 1B1ZA 4DV2H 2KJXA 1STBA 5J3BA 4DAYB 2DY8A 2L15A 5L1IA 1DM0B 4JBWA 3Q8SB 4F4XA 4UCSA 1AE3A 5LXTF 4DR7L 3HKZE 2C2EA 4IPDA 2R8KA 4X65Q 3D8GA 1E22A 3A74A 1U0LA 3EVQA 2UVUA 2KHSA 3Q8PB 2K6AA 2L55A 1PHJA 2XRSD 1JQYD 4AQYH 4K5XA 1Q1BA 5KKNB 1QNKA 4RGOS 5FLXc 2YZMA 2Z6KA 3R2TA 4I55F 3H94A 2F1MA 1ILPA 1UEBA 4JI0H 5KFGA 4DR5Q 4IUVA 3H15A 3PGZA 3BS1A 4EQNA 2RDJA 2AGPA 3K3PA 3OSNA 4A3LG 2W8LA 4LF8Q 3HOZH 5HBRB 1TWFH 3D6CA 3NQTA 1G6PA 1DGSA 2VQFH 4JPBW 3J80c 2A6EC 3P7JA 3I72A 4P71A 4A3IH 4H7BA 5KFTA 2DY7A 1XNQL 2RA4A 3PR5B 1VQ8A 5J39A 2PMZB 4JI4L 1EUDB 1G2SA 5LMNQ 5JVG3 1WSCA 1K83B 2DPJA 4E4TA 1KC8C 1TA8A 5KFSA 1YJ9A 2KA7A 2IWHA 3NTHA 1WCMG 4JYAH 3AQQA 3HOUB 4HEDA 2A68D 2NN6H 1EIHA 4C5BA 2L0CA 5DM63 4JI0Q 2F0HA 2E2IH 3SK8A 3RN5A 1CFMA 3OYYA 3D0FA 1G2TA 4HNVA 2JEFA 4G7ZC 3BZDB 3EN2A 5M5XH 4Q5VA 3ETHA 3PR4A 2L9HA 2O5JC 4JV5Q 2R93H 4DR3Q 3IL8A 4X64H 3HS0C 1SNOA 3CC2A 3CMAA 5J2TF 1HRJA 4DUZH 1WTHA 4ZYSA 4DNTB 1CQJB 3ULJA 2HIXA 1K8OA 1CHPD 5JEAH 4AYBG 1UEAB 5FK9C 3W1BA 3GV7B 3PF5A 2LXJA 3HOVH 4O3OA 2BQUA 2EXZA 2JSOA 3EA6A 3F2CA 3CCJA 2OTLA 4H13C 1M1KC 1XMQQ 1CKNA 4TRDA 5M5YH 4QMGA 2A6HC 1X54A 4BBSG 2B2WC 4UY8C 2K5NA 3G71A 4IFDI 4LF4H 1JWMD 2D9UA 3MVVA 2FK1A 1MJCA 4DR6Q 5ELBA 2EYMA 2PCFB 5IGGA 1RYRA 2K7VA 5I9OA 4WBNF 1L1OC 2K5WA 1HFNA 3L4JA 4IZ8A 2W70A 3PUVA 4HNTA 2R8JA 2R7KA 5KFDA 3L7ZC 3KAKA 3K58A 1IBKH 1A0IA 2UU9H 1WI5A 1B6SA 3RV4A 4DNRB 3J80E 4A3BB 5BR8Q 3A55A 4DV0Q 2G9DA 3GTKB 3TZUA 3HZXA 2WV6D 2WAQB 1EQVA 3A8IE 5KNCA 4OONA 3HOXH 4J9NA 4DR1H 1GOZA 4PG3A 1M4VA 4JUZA 4RB1A 3MR6A 1B9MA 3STBD 4Q45A 5IODA 3STBC 1YJWA 4JI1L 5IWAH 2A68C 4X66Q 3H4BA 2ALYB 2XGPA 1T94A 2QGQA 5BN4A 3UDIA 2VA3A 1X3PA 2ASJA 1B44D 4MV8A 1YNJC 2W9CA 1TWGB 2F0KA 4L63B 2QYZA 2B2YA 4JG2A 1BNZA 1I4RA 4G4KA 4DK0A 1E0BA 2UXCQ 3H91A 2NYZD 4YBZB 4UCTA 3HKZG 2EXDA 1M7JA 1IW7C 3R8BA 2W9BA 4C3IH 4H0LC 1JB3A 1BOSA 3CHBD 4IWXA 1G8ZD 1B6RA 4CHTB 1T9HA 2NVYB 3UFXB 2K04A 1AN8A 1D6EC 3MA2B 1SR3A 2GPSA 1VQ4A 2VPSA 2KECA 2IW3A 3TINA 1BJTA 3H0GA 2BDNA 1C9OA 2HIVA 1R9TH 2JA6B 2KEEA 4R4QA 3H0GB 2HGSA 3S1RH 2K5DA 3S1QB 4IJLA 2AHOB 4POFA 3MXUA 3FPUB 2UXCH 4ZKBB 1SCUB 1E1OA 5FLMG 5JH7F 1LT4D 1MHWC 1UE1A 2Z1CA 2A6ED 4OHJA 3GTMB 2ZDHA 4YJ3F 2QCPX 3OWEB 2YU9B 2A74C 1K0RA 4GC7A 2FK3A 3UE1A 4DAPA 4EQPA 1GGOA 4DR4L 5JJKA 3ONAB 3PO2G 2RSOA 4GC6A 4XXEA 3TZDA 4DR7H 2LS01 3U4ZA 3K7AH 4X65L 3BVMA 1XMOL 3GTLH 3S9WA 1PYWD 1TWGA 1JCKB 1IBML 3A5UA 3K59A 3TBIB 1O7IA 4C1NK 2VS1A 4ECTA 4TQUS 1YNNC 3RLOA 4NDXA 1WD0A 3J7AF 1AH9A 1S5BD 2F52A 3ND8A 1E1TA 1VQBA 2R85A 1WTOA 4KY5A 1ZYRC 2K14A 3EFXD 4GLVB 1PLFA 1YNJD 5C1OA 3DEOA 1XPUA 2FMMA 4R7RA 1TVXA 4EQ5A 3JSLA 2AQ2B 1I3QB 3RLNA 2K33A 3NTKA 2LMCB 4YCUA 4A3DB 2KHIA 5KFFA 1LLRD 4DV6H 2F0JA 3CVZA 4ZQIA 1RJTA 3GTLB 2E2DC 4RGNA 2AQ1B 3M7GA 5T14A 2JEBI 1CQVA 3KBGA 4XQQA 2CQYA 2JYOA 1W93A 3OWFA 2K05A 3QIAA 2JJQA 4OEMB 2B2WA 1I94Q 1GHKA 4LH6A 1CKNB 2CVRA 3OSOA 4NLGA 1STAA 5FO9B 4BY7H 4IUNA 5C5MA 1JJCB 3P1HA 1S3OA 4O2DA 4ABNA 3MEFA 1B04A 1JICA 1HZAA 4BY1H 2YZGA 3I7FA 2PMZE 1RJPA 4MA0A 5KFYA 4K0KL 4KLKA 2AUJD 3H3VI 1DIKA 2B2VA 4DR3L 4POGA 3NTIA 4XTCS 2B8FA 1VQ7A 3ORQA 3FDTA 1SRUA 5D1OA 5BPHA 5AFWA 1C48A 4K5WA 3K57A 1JOQA 2OTJA 2CW7A 1A3UA 5C4XB 2PQAB 2F0EA 2J4XA 2DN8A 1HNZH 2VY3A 1HHVA 1EYZA 1D2BA 3I56A 1KAWA 4MA5A 3Q8RB 2CHBD 2WB1G 4LF7L 4J9KA 2TMPA 3T1YL 2GPWA 4MHEA 2C5CA 5DGAA 2IA6A 1N56A 2EDGA 1VQGA 1BCPB 4YCWA 2FK2A 2Y0SG 1K9MC 4DR6L 3QZ7A 2NVYA 1FGBD 1ZQ7A 2DZDA 1PV4A 4DV3H 1JOKA 2XCAA 4LWCA 3MWYW 2JA9A 1SSOA 2W9BB 1WJJA 1LT5D 1LYLA 3SR1A 4DAVA 4RU9A 1R4PB 1Y1WH 1SEIA 4PV1C 4GLXA 1U4LA 2NVYH 2XVSA 1N32L 4EYHB 2QEXA 1HNZQ 3AYHB 4O3QA 3FMAA 1S72A 3L3OC 4NMZA 3G6EA 2J6TA 5EBCA 1AEXA 2TSSA 4CKEA 2F0DA 5GAGC 1BGWA 3OIPA 4FXGC 3AB9A 4JBJA 5FO7B 2BA0A 5HURA 4IFDH 2L5TA 3KUPA 2JA5G 1HNWL 4F7XA 3GTQB 1EWCA 2A19A 1CK1A 5JQWA 4FO2A 5KT7A 3AFPA 1DYQA 1ET9A 5FLXE 1I50H 3S1MB 1XTCD 3GIMA 2UUCL 3GTMH 3N6RA 5KRUA 1JKJB 2FJ2A 1EY8A 3LWBA 5JOBA 3M4OB 3KDFB 1WTRA 1PYSB 2FMCA 4X3UA 2R82A 5M5WH 4DV2Q 2K75A 2UXBL 4ECQA 3N52A 4O1NA 5I6YA 4NXMQ 5IYZF 3GTOH 3SK4A 3S1RB 4AYBB 3TQTA 3RGZA 3A7LA 1W6KA 4DR7Q 4JI7Q 1XXGA 4FP5D 3T4AC 4C1NI 4A3MH 3E5NA 1TS2A 4QWAA 2B63B 2NU8B 1CSQA 3E3XA 4WORA 4DUZL 3ERQA 1PFMA 2W7OA 1TS3A 4A3LH 1NMFA 3JAMi 3I4NH 4C5AA 1G51A 3LNNA 2ZXPA 2QW7A 3TSSA 3GIQA 4B3MH 2R93A 3NWSA 2R93B 4M8AA 1Q12A 4ED8A 2EIFA 3K7AB 1B33N 1TR5A 3RB6A 2PBZA 2K4KA 2PQAA 1N36H 3ITPA 3TMEA 2JA5H 4QWBA 1EQQA 2YYZA 3CCEA 4IRCA 1WOCA 4O2AF 3KHLA 3TDQA 4DL4A 1VBHA 2CWPA 4LF8L 5DLFA 3T5KA 5CMDA 2MO0A 4A2AA 3E6ZX 3M3YH 2FP4B 4IPCA 1JOOA 1K83H 4GN5A 2IX3A 3M9OB 4EGVA 1Y8NB 1NSNS 4JI2Q 4RHSA 3GTKH 3H0GH 2JA8H 1VS0A 3I3CA 5K36H 4B3MQ 5DGBA 2Q8RE 2R93G 1LTAD 4B3RH 2BA1A 2C35B 4PNYA 5EWGA 2F0WA 3OUZA 3GTQA 3RNUA 2QA4A 4A3KG 1MJEA 4JI0L 2DLNA 4UFZA 3QO2A 2VQEL 1ICWA 2ZM6L 2CFMA 3LX0A 2UUAL 4DR2L 2N88A 2JQOA 3VA5A 1HJPA 4ECZA 2FXQA 4LFCQ 4PWQA 2W9AA 4JI5H 4ECXA 3X3MA 3GTOA 4DV7H 2FLLA 3S17B 4RHRA 1SFOH 1QCBD 1Y69U 2R7FA 4FVMA 2NBFA 1OXSC 1KAAA 5E3FA 1UC8A 3OHBA 1N9WA 2MUYA 4DL5A 4R8IA 1NE3A 4YR0A 3H0GG 5CV6A 1SLJA 1TWCA 1VQ5A 4L5RC 3EYYA 4R8UB 2E2HH 1AN7A 3L9AX 2HDMA 5KG7A 4DUYH 2P5ZX 4J9LA 2QDLA 3I12A 3D31A 3VR3A 5KFPA 1DD2A 1WTPA 1PRTC 3LP8A 4CC6A 1QB5D 3DXJC 4IZOA 3I4OA 5IIFA 3SK5A 1YHAA 3PW5A 4N8FA 4DAYA 2W6OA 3S16H 1Z2PX 3CQZA 4QIWA 3H09A 4ZOLF 5BPFA 2GVAA 2AWNA 1K3RA 3VPDA 1IW7D 1M0TA 4R8UA 3ZYYX 4OX9H 2RDGA 2IT1A 3J7A5 4FXKC 3J7AV 4RZQA 3RB0A 3S1MH 2ASBA 4C3HH 1PH5A 3R5FA 3M9MB 3T1YH 4HR7A 3GTQH 4XX0B 3GTGB 4A2BA 1KBLA 3CC4A 2VL6A 1XNRQ 5DQGA 4CKBA 4IUPA 1ESRA 4A3JG 5KFJA 1I4XA 1SYDA 3MXGA 2EPBA 3GP7A 3M4YA 4MTNA 4HTHA 5IYCH 2GLTA 4ED0A 1LO5D 2RDHA 4LK1C 5ISRA 1VQLA 4DK3C 3ERSX 3BABA 1PFBA 2VPQA 4CJ2C 2M00A 1I3QA 1EOTA 1S5ED 2GVBA 3O13A 5DQHA 4UCOA 2JEIA 1TWHH 2DUDA 5IT9L 3S1NB 1HZBA 3R5HA 1C4QA 3MJFA 1E7ZA 4QWDA 3E5SA 1CTMA 3UQ8A 4LFAL 4QW8A 5KFUA 3Q8QB 1VF7A 1PZJD 4KHVA 4LJZC 1NR4A 5EPLA 4X62H 4HIOA 1TWCH 4G7HC 4WFN3 3D4DA 4EQOA 4DR5L 1S68A 3M9BA 4MAMA 1TWFA 2RHSB 4G57A 1NTGA 4DK6C 4DV1Q 4MIUA 5G3LF 2F0OA 1IBLL 2NTTA 3FMCA 3J7ZC 1GSHA 4YR3A 4V190 4IR9A 4CDFC 4BXXG 1HR0Q 1B4OA 5EKKA 2W6QA 3LWUA 1SE2A 1TY0A 4B08A 1M6VA 2ZTCA 3X3NA 4JI4Q 3FKIA 3PQIA 4JI2H 4JI8L 1PXUA 4LMYA 2NUCA 3QR8A 2PW7A 5JPMC 4AQYQ 2UXDL 1A9XA 3V4ZA 3Q24A 4HMJA 2XN9C 1A62A 1MBYA 3H6MA 3WO0A 1YNXA 4TUYF 1A6XA 5D65A 2JA6A 1Y8OB 3IAYA 2YS6A 3K3VA 3BZKA 2E74C 5ELFA 4Y8VB 4C3HB 5LHY1 3FVQA 3V6KA 2O5IC 5EPJA 4QIWB 4I7ZC 4UAIA 3I4LA 5JPNC 1KJ9A 3OMCA 5M3MH 1BKBA 4J8QA 4B9WA 2FJZA 2JK8A 4JI6Q 4RB2C 1ZEQX 5DG7A 2M05A 4GNXB 4J9SA 1CQIB 1EZ8A 1I3QH 1PH8A 4YB8B 1KJJA 1GSOA 4DL6A 2C2DA 4I7HA 5HY6A 2BH2A 3J80W 4EG0A 3I4NB 5J2UF 4NXML 5CV4A 1LTTD 1UE5A 1VQEA 5D1PA 1B3AA 3URYA 5A35A 2FINB 4YY3Q 1XNQQ 5IY0A 5EQ0A 3R2IA 1SNMA 4J9RA 4O4LF 2V4QA 2PMZA 4YCVA 3T16A 4DL7A 5CA1F 2A69C 4G3IA 4N9PA 4DUZQ 1VQOA 3BA8A 1SROA 1Z7TA 2N78A 2UXDH 4FU0A 1KL9A 2A5HA 1HXYD 4QB4A 2OWOA 2QK4A 2AMCB 3PW2A 4J9MA 4EBCA 3J81L 3JZIA 3I4MB 5FO8B 4LMQD 3MXNA 1KJQA 5FLXL 4KI0A 2NU7B 3N44B 4EFEA 4JOIC 4TQRA 2YV5A 3CRKC 3VA7A 1TT2A 4DR2H 4A3GG 4YY3H 5DG8A 1VQNA 1IL8A 4ZLTF 2VQEH 1VQPA 5CBAE 4DNIA 3T1YQ 1GUWA 1V8QA 2JA6G 2BOSA 2MQHA 4IHJF 1JE4A 3G6YA 4MTKA 2F0LA 1X6OA 4L8JA 3V96A 2R8IA 4FXDA 3MHBA 2NVXH 3KBXA 4A3CG 3J81i 1FYCA 3FKIG 3UDFA 4C2MB 1SFOA 2VZAA 4BY7G 2NN6I 3HKSA 3MFIA 3PIOA 4NP5A 4A3EH 5TSSA 4Z9CB 1EWIA 4DR2Q 1WR2A 1Z2NX 2D0OA 1CHQD 4JK1C 5KX5F 3NBIA 4ECWA 1F77A 2D62A 2F4VL 3RZOH 3M9NB 1MIUA 1U4PA 1YHBA 2NZHA 2HHHH 2NVTH 1QVFA 3TS2A 2UVWA 1PTOB 4ED7A 2UU9L 1CSPA 4OELB 4X62Q 1Q81C 4TQSA 4K14A 4XYOA 1NUCA 1Z6HA 4RNMA 3AU7A 2FPIB 3J81W 2I46A 4M1UB 1CQFA 1XMQL 5FLXW 2OCEA 3AMUA 1LACA 2PI2E 3H3VH 4JI1H 3DHQA 4AYBA 3I4MG 4X66L 2MPMA 2Z6KC 4JI7L 1IBMQ 4RNNA 2G9HD 4LF5H 4QUFA 5I2XA 1K8GA 1S5FD 5FOBB 4U6PA 5CAEB 5FD6A 3J7AK 4I50F 4B3SQ 5IT9c 3M85A 5KG0A 4R1JA 4RKBA 5ELEA 2BH8A 3GTJB 1UNNC 5C0XG 1XMQH 2CCZA 1U5KA 3FHWA 1V1QA 1CA5A 3OTOL 2SNSA 1RHPA 3FKIH 2JXMB 2E75C 1RJQA 1BDOA 2Q2TA 1RK6A 2ZJPA 1IYUA 4BA1I 4X3TA 4LFAH 2OF1A 3GTPH 2YS7A 1JWUD 2YU9A 2FLPA 1S0NA 3ULLA 3GTMA 1PK8A 3I90A 5IGCA 2XC9A 5EZYF 1GM5A 5KEEA 1VQFA 1A63A 2IP4A 1LTID 1AUXA 5IYBG 5LP6F 1NNXA 2B2YC 3IKJA 2C9OA 2E76C 4DV0H 1STEA 3MR2A 1QNUA 1BXTA 4JV0A 1I5FA 5LMUL 3HOWB 4A93B 5FD5A 4C3IG 1T5EA 5I2YA 1TXYA 1XNQH 4DV4H 3QWNA 3GIJA 4DR4H 4C3JH 1FL0A 4IOCA 3S2HB 3K5HA 3Q2OA 5LA6F 4RZRA 1GYFA 3CQZB 3MWEA 1JORA 3CRLC 3PSIA 2UUAQ 3TQYA 3PUZA 5IT9W 1TU2B 2KENA 3Q1KA 1F2YA 3PW4A 1ML0D 1UC9A 1BO0A 1Q7YC 4ZKCB 1IYVA 1Z9FA 3J80L 5BR8L 2YW2A 3IRBA 3S1QH 2W9CB 5KT2A 3J81E 1I94H 1KQSA 1RK5A 1SYXB 4L5TA 1L0WA 2JP1A 5GROA 4Q0YA 1WFQA 5M5XB 4K0KH 4A75A 4ZCKA 4DV5Q 4CGYB 1ENAA 3DMUA 4JBKA 1X3QA 2LSSA 1VKZA 3GTKA 4A3CH 2Z4IA 1Y14B 2OQKA 4YHHQ 1GXDC 1EY9A 1SEBD 1MSHA 2IPKD 2X69A 3GTOB 3HKZA 3D3RA 1CT1D 1Q82C 2YZNA 3PO2B 4A3MG 3HOYH 2ATWA 3A8KE 2ENBA 5CYUA 1IOWA 4YWLA 3RB4A 2EYFA 1B70B 4A3EB 2D5DA 4ZI7F 4PDBA 4KK7A 1TWGH 3HFZB 1O7YA 5BR8H 2X6LA 2EJMA 1H9SA 3HOWG 4K0KQ 4A93G 3CF5A 4Q8FA 2NVXB 5DLQE 1DOKA 4R4OA 5KNBA 2VUMG 1MSGA 2AUKA 2IX0A 4B3TH 1IZ6A 1H9JA 3VYRA 3M7NA 1H9MA 4RAZA 1NY4A 4EEYA 4KN7C 3R23A 4JI6L 3W3AA 2UUCQ 5D8DA 3MZ5A 2EYOA 2A69D 2R6GA 1LTGD 5KYLA 1L2ZA 3KLRA 1PX2A 3A8JE 1DJRD 4WJ4A 3HEJA 3G8CA 5KFVA 3KYHC 1GO3E 4TV8F 1VF5C 1BCPD 1HNXL 4O4HF 2VQFQ 3L4KA 1PTOH 1SYEA 2PNHA 1QILA 2O03A 2NUAB 3VR6A 1I6UA 3NP8A 5CB4F 5CC4A 1GD7A 4HNUA 2F0NA 1PMRA 5JEAJ 3UI2A 4L1KA 2E2JH 2E5LH 1OXXK 5F9NA 1TWAH 2RQXA 1EEID 3KF6A 4OX9L 2QEJC 2K5VA 1Q3LA 4F4YA 2EJGC 3I4NG 2FFKB 4ZAIA 2UUBH 4J9PA 2UUCH 1ET6A 2ICIA 1YI2A 1BBXC 4O3SA 1X32A 4A3GB 4UHVA 4ZK9B 2ATLA 1F2MA 5IGBA 1N34H 3OHAA 2RF4A 3I70A 3JC66 3WOFA 1KLGD 4XYQA 1YITA 2WP8J 4K8JA 1X56A 3KLSA 2RVLA 1T36A 3RFCA 3ER0A 4MV7A 3H3VC 1VQAA 3M4PA 3DF7A 4JW0A 2AQ3B 1RKNA 1IYJB 5L1LA 5JVDF 1N33L 4JI8Q 5M9OA 1BUVT 1JC7A 2R6FA 4KN4C 1TY2A 4ECVA 4IURA 2I5LX 1BBUA 1GLVA 4BY1G 3SE0A 1IBLH 2G5DA 3Q0AA 1J5EL 1Y1WG 4A3KH 4QWEA 2F0VA 5KG3A 4DR5H 1XWEA 5D3DA 2EJFC 5L37A 2LY7A 3JAMW 1G6ZA 1ZHSA 2B2UC 4OWTB 1B2TA 1WD1A 3K7UC 1C8CA 2WAQA 2ZM6H 3DLLA 4XZ3B 3RR5A 3U4VA 2P0AA 5I6WA 3BJUA 2MNAA 3CPFA 1KNAA 4LFCL 3RB3A 3K0YA 4GKJL 3OIQA 3CCVA 4U673 2ZT9C 1I6VC 1CZGA 4X3KA 4MV9A 2XCPA 1N48A 4JI6H 2UU9Q 2HUGA 3BJYA 1SDFA 2SEBD 3KLWA 3QOLA 4A3FB 4H02A 3ULPA 1XX8A 5L9XA 1RODA 1I50A 4XYLB 5CGKA 3PMFA 2DNEA 4OO1H 4Q43A 5A2QE 1B3QA 1M0WA 1VBGA 3S2DH 3HB9A 2E5LL 4PQXA 4DXGA 3K5OA 3S14B 1JDEA 2J6UA 2DNCA 3HGBA 3UE0A 4U68A 4KTAA 2F4VH 4DR3H 2E2IA 2VXWA 5D1OB 1G91A 4FBTA 2K5HA 1SNPA 5CR3A 1JJ2A 2VUGA 3TP7A 2V58A 3GILA 1ILQA 1QZHA 4ZQ3A 1XPOA 1AFPA 2W7PA 1TWHB 4I4TF 1OXVA 2XGTA 1STNA 1HNZL 1LM0A 3WNZA 3KHHA 4YP3A 1V51A 3EIVA 5IP7H 2PZTA 1JXLA 3RUZA 2L12A 4EFBA 4KY7A 3BQ0A 2KCCA 2EYJA 4P72A 1T5XD 3PUWA 4DUYQ 3JSNA 2C2RA 4IUQA 2WB1A 2IL8A 2EY5A 2Z6BA 4KHZA 4LW1A 3GTLA 5HV6A 3VPBA 4F8MA 1BCPC 1XNRL 1XDNA 4YHHL 2N49A 4KHPL 5KFNA 1VQHA 1QJOA 2XWJB 1ENFA 5K36G 1SYCA 1W3SA 3GO5A 4LF9Q 4DV3Q 2V5AA 5C4JB 3TS0A 3MFHA 2I5MX 5K5PA 2VOBA 3S14H 2NTSA 4CDCC 2LXKA 1KRSA 1SN8A 4DL3A 4P2CB 3UDXA 5C44B 3S16B 2KVMA 2HCCA 3U50C 4LFBH 2E2JB 3K5LA 3WO1A 2R92B 5EOYA 1U4MA 5IWAQ 2VW9A 1OXTA 1O78A 3BDLA 2BE5C 3V6JA 2BE5D 4ME6A 3GV5B 5F9LA 1E4FT 2W6MA 4M9UA 1S0MA 1N32H 4ME5A 2CZGA 3FP9A 2B63G 1GVPA 4BS9A 2WDTA 4FDBA 1KLUD 3CXCA 1WVLA 4K2KA 4QGUA 1OWTA 2K01A 4I7AA 5C3EG 1L1OB 4RNOA 4J9OA 1VCIA 3V2TA 3VYTA 1FJGH 4P74A 1D5XC 3PUYA 4C3HG 2J7ZA 2F0FA 5KYIA 4JI2L 5D3IB 4IOAA 4QQBX 2J6SA 2NVQH 3RGXA 1DV1A 2PNRC 5JVLA 2PO4A 2CKZB 1KJ8A 4RAYA 2DIKA 1Q8KA 4GZYC 4HYKA 3HP3A 5JEAG 1IBKL 1I7LA 2I5HA 3GLKA 3KJPA 3OTOQ 5KG4A 4QJFA 2ZM6Q 2GN5A 4UPAA 3NE5B 4LUVA 1KDCA 4S3SA 4UP9A 1A8VA 2IHFA 4RKLA 5LL6S 4DGZA 3HOVG 2JA7A 4A3MB 2PYKA 2KBNA 2W57A 2FLNA 4LFAQ 1HQMC 2MHVA 2YRXA 3TRZA 2MCTA 1VMPA 2Y0SB 1RL2A 5E4XA 1CUKA 2NN6G 1N33Q 1FNVA 4ED6A 1WCMA 1P16A 1JMCA 2QILA 2FE3A 5KIXA 2R86A 4LSXA 2AGQA 5EWEA 4B3RQ 2N3SA 3KXYT 1HPCA 4UP7A 2PQEA 1QUQB 5G3LD 1A2UA 1TWAB 4DV4Q 3PO2H 2R8HA 4UP8A 1XMOQ 4RMFA 1I4PA 3PW0A 5KG1A 1PYBA 5M3MG 4U7CA 1LTLA 1EQRA 5C44G 4NPSA 4V0BA 3VR2A 3NPPA 3BQ2A 1KXLA 4LSAA 5LL6b 5IP7G 1Y8PB 2XWBB 4RGMA 4JI5Q 3K8AA 3F8NA 2IHEA 1EU3A 4A3EG 3U9TA 5LOVF 2AQ4A 2AKWB 1C30A 4APVA 3RN2A 5C4ZA 2YTVA 1IXRA 4ED2A 1XPRA 2KCMA 1KHIA 2DJGC 3I8ZA 2FPGB 2ES2A 4RA8A 2VUMB 5LYJF 3GTPA 4IR1A 1CA6A 2RCFA 3PW7A 3M3YB 1DV2A 2W6PA 1R4QB 5KNDA 4DV5H 2BDOA 2F03A 1PH9A 2AWOA 3TP8A 1FJGL 3Q8DA 1PRTB 3LMLA 3RTXA 2WAQG 1OXUA 3VR5A 3S15B 4APMA 2HQEA 2R92A 3W2DA 2UUBL 1ASZA 1EOVA 2H5XA 2A8VA 3CQZH 3D6WA 2XD4A 1VMCA 3GTJH 5JJIA 1ULZA 4NXMH 3DWPA 1J5EH 3G7LA 3HXLA 5EKLA 1O7LA 1EU4A 3RAQA 1OTCA 1LTBD 3BDOA 3DWAA 3JAML 2Q2IA 5E4WC 5C4XH 3CCSA 2CW0C 3K80C 3TP5A 3FDSA 5I4DA 4GOPA 4BY1B 3OOCA 4Q8EA 3J81j 4O2BF 2PZUA 4RGTA 4R9WA 1LT6D 3K0XA 4MN3A 2RBMA 2K28A 3T5HA 4LF6H 1RCVD 5FJ8H 4DUYL 1J6QA 1F9PA 3L2PA 4GOPB 2M9VA 1K83A 4N8X1 1BBWA 4ECSA 3HOYG 2F0IA 3WDNA 1QVCA 4C3JB 1LUZA 2ZXRA 3S2HH 2F0PA 4L5QA 1PRTF 1HFGA 4JC0A 4XDXA 2EQSA 4O3PA 4R4TA 4MZ9A 2E5LQ 4CJ0B 1IKMA 4OIJA 3J80i 2W8KA 2W6NA 1WYDA 1ONLA 1YIJA 4DF7A 1XYIA 4LFBL 1V43A 3F1ZA 5EPKA 4F50A 4HSVA 4NXNH 5C6AA 2R7ZG 3K5MA 1JE5A 5I47A 2ZJQA 1Y1WB 1LABA 4XT1B 4O4IF 3GTPB 2NU6B 2N8NA 4FF2A 2B63H 2DGYA 1ESFA 1E4EA 3N8DA 3V05A 1LTRD 2R7ZB 2E2HA 1I4HA 3KF8A 5KFIA 4K8IA 4LF4Q 1AUVA 1SMYD 1S40A 1PZKD 2ASDA 3NBHB 1EWHA 1Q90A 5T1GA 5KFRA 5GAHC 5GQOA 4AIMA 1HNWQ 4AYBE 4IAJA 5H80A 4J6HA 1MI2A 4J0MA 4F87A 3PCOB 5DM73 1SJED 4X62L 2HVRA 5M5YB 4LF5Q 1C3OA 3F2DA 4KJNA 1KDAA 3MR5A 5DG9A 3A0JA 3OW7A 1AE2A 5C4JH 2Q8TA 1ZXTA 3J7YW 3NUCA 4C5CA 4JI8H 2R7ZA 3HRZC 3J81c 4DU9A 2NB0A 3DM3A 4RG1A 4DR1L 3HOYB 1D7QA 2JEAI 3PF4A 1NR2A 3RBEA 4GOPC 4XIGS 2B29A 1AZQA 1YJNA 2ZJTA 1WTWA 4X66H 1LT3D 1CM9A 2WACA 2SDFA 1EY4A 4X6AH 3R93A 4TVAB 5FPRA 3GIIA 1HA5A 2XSCA 2PPBC 1QZGA 2X6GA 1J8IA 4X64L 3E0JA 4HJAA 2B2TC 4OL7A 3KALA 5KFAA 4E6IA 2IBKA 3JAME 4EBEA 3HOXG 1G291 1Y1VG 2KOLA 5IWAL 1DZ1A 2OH2A 4BY7B 4XQJA 1F9RA 3GIPA 3MC0B 3HBLA 3WWVA 1QOHA 3RZOB 3GQBA 1GKHA 4RH6A 2SNMA 5M3MB 5C0XH 4MV4A 1Z47A 2F0UA 1Z2OX 5KFEA 1O75A 5E7NA 1RTNA 1EIFA 2F0QA 5AJ3L 3SGIA 3OW2A 4F88A 1GHJA 2R61A 5EAYA 1I6HB 2V4RA 3GIKA 2I8CA 2B39A 3BDCA 3GDEA 3JRWA 2JA5A 5JUMA 4DV4L 4O42A 2I07B 4HAEA 1K3BC 4H44C 2UUAH 1ZYRD 2CH4W 3PV0A 4BWGB 5IOCA 4JBMA 4YQWA 1GUNA 3EJIA 2CW8A 4HIKA 1Y1VB 4ME3A 3S1NH 4LFCH 1EZ6A 4A3BH 1L1OA 4B3SL 3PUXA 5KG5A 2YL2A 5L1KA 5LMUH 4DV7Q 2KCNA 2K1BA 4DA2A 1L0YB 4DFAA 3SEBA 1UE7A 5DEHA 4JI3H 2PW5A 4FS1A 2VA2A 1E2WA 3VMMA 3CCLA 1VQ6A 1MZBA 2OEOA 3SI8A 2K50A 2A6HD 5LMNW 2HT1A 3BG5A 3N42B 2R7MA 1YEZA 3VYUA 4X3SA 4DV1H 2KSWA 4WRDA 4KHPQ 4A3DH 4TSSA 4KKSA 1H95A 1VQCA 1UWVA 3RMHA 4LF9L 5LMUQ 4B3RL 1WH2A 3QG1A 5EBDA 1WTQA 1HR0H 3KTMA 2PI2A 1JIHA 1Y1VA 3T56B 3ETJA 5ELOA 5J22A 2EYLA 1X3FA 5LMNH 1S03G 4BBSB 4RWSC 5IYCG 2RGRA 4OX9Q 1S97A 4QIWE 1R9TB 3NHHA 4NXNQ 1TWAA 5KFHA 3GTGH 2KHJA 4C3IB 4MV1A 3R3OA 1JX4A 1GJXA 1VQDA 2NZ1D 4JI5L 4IWYA 3GV3A 4WJ3M 2F0MA 5GAEC 4GKKQ 1R9TA 4CC5A 2D2CC 4IFDG 1WCMB 5BN3A 1YBYA 3VDYA 4KD4A 1MD2D 2Y0SA 1JR0D 2R87A 3M4QA 1FGUA 3HOUH 4LF6L 2V59A 5C1PA 2HHHL 1L2FA 2NU9B 1V1PB 4ED3A 1BXRA 2Q8IB 4LF7Q 4IQZA 2L1BA 1FJGQ 1W6JA 1K0SA 1DOMA 4WD3A 5JAVA 5LMNL 1I4GA 3PZPA 2L11A 1VAJA 4LAAA 1EIYB 3HOWH 1C7YA 2UUBQ 1XTDA 4A93H 4EBDA 3QB3A 4RUCA 1S5DD 1U4RA 2WINB 4KJOA 2ALZA 1AZPA 4BBRB 1PVOA 4FF3A 2K5QA 3NQIA 1N36L 4JV2A 1FVIA 1HNXH 4GKKH 1CKOA 3CP0A 1SE3A 2EYHA 3BU2A 3KK7A 1A3TA 3DWQA 1V9PA 1LTSD 1KIXA 4LF8H 1D1KA 1VQIA 1ZHQA 3RIZA 2IX1A 1EFID 5F2DA 1EY6A 4GKJQ 5C44H 5A2QW 1EZ1A 4OWWB 3TN2A 1CE8A 3V4SA 3FEWX 1X3GA 4RB0A 1F9QA 3QOJA 3F2BA 1JB7A 1A15A 4QCLA 3CCRA 2JEGA 4KMUC 4PMBA 5H1SE 1D5MC 1IBLQ 3F8TA 2B2UA 2FPPB 1EEFD 1YVCA 1HNXQ 4DV2L 1A3VA 1TQOA 2JA5B 2V1CC 1HR0L 1KC7A 4TV9F 4RCNA 1K28A 4RCOA 1KD1C 3P75A 3SK6A 2L4NA 4BBRH 4B3TQ 5JJZA 2R7LA 3JRXA 1EQTA 4ZUJA 1EUJA 5M3FB 3G48A 2HVSA 4GKJH 4X64Q 2QF7A 4QUCA 3PIO3 1SYGA 2F3VA 1O80A 2B2TA 3DM1A 1MGSA 4HQ6A 1O7ZA 2LFNA 4RAUC 4GNXC 2R3ZA 1NCVA 2MP1A 1C0AA 3QFFA 1XJVA 3CU7A 1RTOA 4ECYA 2B8GA 2F0SA 3MEHA 4P75A 2HD3A 4X65H 1CS0A 4JV5L 5JJLA 4HMIA 2BQ3A 1WCMH 2WB1E 1KJIA 2WB1B 3EROA 3BVGA 5KFMA 2K52A 3S24A 1KNEA 5IGDA 3S2DB 4UDUC 3K5IA 1VQ9A 3KF6B 3T1HL 4MNOA 4OO1I 2QDBA 3ZJYC 3OMGA 5A2QL 4NB3A 4IUUA 1Q1EA 2E8GA 4ZUIA 5KFXA 1SYBA 3IFDA 4HIMA 4EGJA 1IHZA 2EYPA 3I73A 1N34Q 2OXPA 2NWGA 2XIGA 3T5JA 4IPGA 4YR2A 3A7AB 2LKVA 1VQJA 2RHQB 3TREA 1J5EQ 2QKIC 3P20A 2I0QA 4YY3L 4JCVE 1PTOF 3M4IA 1HZ9A 4RB3C 4K2LA 2F0GA 4L5SA 1ICFB 3NBHA 1B50A 1RD9D 3KHRA 4A3JB 1IBMH 2E2IB 4A3FH 3N43B 4HJ5A 1D1IA 3KF8B 4GLAC 3CW2C 1PDQA 1EFWA 4QL5A 1DOLA 4IRKA 5CV9A 5IP9G 4JYAQ 3RUPA 4A3KB 3RZDB 3B6YA 5ELNA 4KV6A 1ZKOA 4AH6A 4BXXH 1L0XB 2RDIA 3MXPA 3M4OH 3A54A 4IUTA 2EZVA 5FPOA 5I9PA 2WAQE 5KG6A 4A4IA 4DAMA 1I50B 3KFUA 4PZ8A 1J9OA 2XIWA 3U58A 4ZRZA 1SNCA 5HGTA 3EPIA 2BR0A 2HDLA 3RAXA 4JV5H 1W96A 2OLSA 2ZJRA 5IYDG 1K8AC 2JA7G 5C4XG 3BVZA 4J15A 2NZOA 1STGA 3CCUA 5KFLA 4OXPA 3SHLA 5GADC 4DV6L 1SXTA 2WYOA 3TIIA 3K5NA 5KT3A 1SMYC 4TKOB 1E2ZA 2YYAA 4Y7NB 4K6DA 4QY7A 3Q6SA 4JV1A 1NBWA 3PO3B 2IMWP 2F4IA 5J1ZA 5EJWA 1RF2D 1UAPA 1N8RC 4I65A 4EX5A 3G4SA 1E3PA 1VQMA 5BMVF 4FYDA 3N6XA 5JVH3 5IP9H 1PTOC 3ND9A 4ULLA 1TIID 4FF1A 3A56A 2MO1A 5IYBH 1GUSA 4XYMB 2F4VQ 4KKTA 5C8YF 2EY6A 5EWFA 2MFIA 3JAMc 3Q22A 2VB2X 5KFWA 2JA7B 3CCMA 1I6HH 5CBEE 5C3EB 1QE6A 5KFKA 1S5CD 4PZ7A 1H9RA 5FJ8G 4DL2A 4ILWA 3L0OA 1PFNA 4OGQC 2XGQA 3N40P 3BAAA 4J9QA 4CKCA 5KT6A 4A3IG 4NW2A 2R7DA 4ZHQF 1YZ6A 1PH6A 1MKHA 4FNFA 1I94L 4DR1Q 2UVVA 4HSPA 5KFBA 1PH7A 3E9IA 4BBSH 4FM9A 1LV9A 5ELCA 1TS5A 1RYSA 4N9TA 1BF4A 2MJ8A 3CD6A 3FKIB 5KFZA 1CZWA 5C5LA 2KEDA 4ECRA 1B9NA 3BA9A 4ECUA 5M3FG 3MAQA 2C22A 1T3NA 3D4WA 3MWDA 3EQLC 4R4CA 5DAUA 1S10A 5IE8A 2SCUB 3RZDH 2EOTA 2EE1A 2K03A 3C1EA 3C2PA 2PVPA 2O4XA 4DV0L 2PZWA 3CMEA 1I4QA 4ETSA 1BR9A 1KRTA 2C00A 3TP6A 4LUZA 4DR4Q 2A1AA 4JOIA 2HQLA 2NVXA 4MV6A 3NWTA 5KFQA 1Y1VH 4RUAA 1HCZA 3KLSX 4CBVA 1AW7A 3NGDA 1B53A 5K2MA 4A3DG 3IG0A 5FLMH 2DPIA 4QWCA 3QZ8A 3CAMA 4O0AA 1HTLD 2KUMA 3GV8B 5D14A 2VNUD 4OIKA 2OQ0A 1M8AA 1D8LA 1GUOA 4XT3B 5CV5A 1JT8A 2FB9A 4JI3Q 1PFSA 1GUGA 5DNFA 4A3GH 4JI4H 3IFTA 1GSAA 3SVMA 4DLKA 4GN4B 4LNQA 4HR7B 3TIGA 1NJIC 1SNQA 2VR1A 4DK1A 1VDZA
chains in the Genus database with same CATH topology
3BZCA 1BBWA 3CPWA 3HOYG 1E1OA 5FLMG 1N34L 1UE1A 1QVCA 2UXBQ 5HGQA 1NMGA 3S2HH 1LUZA 1XMQL 1K0RA 2OCEA 2PI2E 4L5QA 4JC0A 4DV5L 3H3VH 4POFA 3UE1A 3I4MG 2EQSA 4X66L 4DR4L 5JJKA 4R4TA 1HR0W 5M3FH 3PO2G 4MZ9A 2E5LQ 2WFWA 3U4ZA 3K7AH 4X65L 3J80i 2Z6KC 1WYDA 1XMOL 3GTLH 4JI7L 1W2BA 1YIJA 1IBMQ 4LFBQ 1IBML 3A5UA 1V43A 3F1ZA 3CCQA 1K8GA 4LFBL 1O7IA 2VS1A 3I2ZA 4TQUS 2R7ZG 3RLOA 1JE5A 2ZJQA 4B3SQ 1AH9A 5IT9c 2F52A 3M85A 4R1JA 1X3EA 2BH8A 4BBRG 5C0XG 2N8NA 3ICEA 2B63H 1E1TA 1K73C 1VQBA 2DGYA 1U5KA 3FHWA 1PH2A 2CCZA 1V1QA 3W1GA 1N32Q 3AFQA 3OTOL 3PO3G 2K14A 4GLVB 3FKIH 3MXNB 4ALPA 2Q2TA 4LF4Q 2ZJPA 2YTYA 1XPUA 2R7ZH 1S40A 4EQ5A 1ASYA 3NBHB 3RLNA 4IFDJ 5GAHC 5GQOA 4AIMA 4BA1I 4AYBE 4YCUA 1X55A 4A3JH 1HNWQ 3GTPH 2KHIA 1PH4A 3ULLA 3PCOB 2JA6H 4X62L 4LF5Q 1GM5A 3F2DA 1VQFA 1A63A 3A0JA 4HJ7A 1AE2A 5C4JH 2JEBI 5IYBG 3J81c 2KCTA 3DM3A 4RG1A 4DR1L 4DPGA 1D7QA 2JEAI 2JJQA 1I94Q 3PF4A 1I5FA 5LMUL 4GOPC 1CKNB 2B29A 4XIGS 3KOJA 4HJ8A 1YJNA 4BY7H 1N36Q 1TXYA 1JJCB 1HH2P 1S3OA 2R92G 4O2DA 1FL0A 4C3JH 2VQEQ 4IOCA 4X6AH 3MEFA 4TVAB 4A3BG 1HZAA 4BY1H 3HOUG 3I7FA 2PMZE 1QZGA 4K0KL 3PSIA 3I55A 4X64L 4HJAA 2UUAQ 4KLKA 3TQYA 1Q86C 3H3VI 3PUZA 4DR3L 4POGA 2KENA 3S15H 3HOXG 1G291 1Y1VG 4XTCS 5IWAL 1VQ7A 4HJ9A 2IY5B 1SRUA 3WWVA 4JYAL 1Q7YC 1GKHA 2OTJA 1Z9FA 3TEHB 1Z47A 2VUMH 2PQAB 5BR8L 3IRBA 3S1QH 5E7NA 1EIFA 5AJ3L 3OW2A 3SGIA 2VY3A 1KQSA 4L5TA 5EAYA 1L0WA 4A76A 5GROA 3I56A 1WFQA 1KAWA 4A75A 4DV5Q 2WB1G 3GDEA 4LF7L 3T1YL 4DV4L 4JBKA 2LSSA 4A3CH 4B3TL 1HZCA 1VQGA 1Y14B 2OQKA 3PV0A 4YCWA 2Y0SG 4YHHQ 1K9MC 4DR6L 4JBMA 4HIKA 4ME3A 3S1NH 1PV4A 4B3ML 1L1OA 4LWCA 1Q82C 4B3SL 2JA9A 4A3BH 3S17H 4A3MG 3HOYH 1UE6A 2ATWA 3PUXA 1WJJA 1LYLA 2B3GA 4PMWA 4DV7Q 4YWLA 1X65A 1Y1WH 1B70B 4GLXA 1N32L 2NVYH 4Y52H 2QEXA 1TWGH 1HNZQ 1UE7A 3AYHB 3HFZB 4YWKA 1PH1A 1S72A 3NELA 3G6EA 3KDFA 2Q2UA 4IO9A 2JA8G 3HOWG 4K0KQ 3CCLA 5GAGC 3CF5A 1VQ6A 4A93G 4JBJA 1QUQA 2BA0A 5DLQE 2K50A 4R4OA 2VUMG 3KJOA 2JA5G 1HNWL 1SE8A 2IX0A 2A19A 5LMNW 2HT1A 1IZ6A 1QVGA 3M7NA 3AFPA 1NY4A 1YEZA 1I50H 2CQOA 2UUCQ 3T1HQ 4JI6L 2UUCL 2R6GA 3GTMH 1PA6A 4GS3A 2YTXA 3KDFB 4WJ4A 1PYSB 4KHPQ 4A3DH 3KYHC 1GO3E 3W5OA 1VQCA 5M5WH 4DV2Q 2K75A 2UXBL 1UWVA 1H95A 3E9HA 4LF9L 1HNXL 5LMUQ 4OO1G 4NXMQ 2VQFQ 3GTOH 4B3RL 2PNHA 4OWXB 2PI2A 1PH3A 1GD7A 5ELOA 5JEAJ 3LGJA 1X3FA 4DR7Q 2E2JH 4GN3B 4JI7Q 4A3MH 1OXXK 4JI3L 4BA2I 2ZTDA 3NEMA 1TWAH 1CSQA 5IYCG 4OX9Q 4DUZL 3K81C 4QIWE 3KF6A 4OX9L 2K5VA 4A3LH 4NXNQ 1NMFA 3I4NG 2XTIA 3JAMi 3I4NH 1G51A 3GTGH 2KHJA 1X9NA 1B8AA 1VQDA 1SMXA 4JI5L 1Q12A 1YI2A 2JE6I 2EIFA 1M90C 4WJ3M 2Y0SE 2K4KA 5GAEC 2PQAA 1EYGA 4GKKQ 2JA5H 4IFDG 4IJHA 1EQQA 2RF4A 4DV1L 2YYZA 2D0PA 1B7YB 5AJ3Q 3CCEA 3JC66 1WOCA 1YBYA 4LUOA 4GNXA 3VDYA 2CWAA 4LF4L 4Y7NH 2CWPA 1YITA 2WP8J 3M4QA 1X56A 4LF8L 1FGUA 4JI1Q 3HOUH 4A3FG 4LF6L 2HHHL 1L2FA 2MO0A 3M3YH 4LF7Q 4IPCA 3ER0A 4GN5A 1K83H 4DV6Q 1FJGQ 4LF5L 1VQAA 3M4PA 3NENA 4JI2Q 5LMNL 1IYJB 3GTKH 1N33L 3H0GH 4JI8Q 2F3IA 5C3EH 2JA8H 1EIYB 3HOWH 4DV3L 1VS0A 1XTDA 1C7YA 2UUBQ 4A93H 2I5LX 1BBUA 4B3MQ 4BY1G 2R93G 2BA1A 2C35B 1PVOA 1N36L 1J5EL 1FVIA 1Y1WG 4DV7L 1CKOA 3CP0A 3RNUA 4A3KH 2QA4A 4A3KG 1MJEA 4JI0L 3BU2A 4OWTB 2VQEL 3I4MH 3K7UC 2ZM6L 1V9PA 4C2MH 3DLLA 2CFMA 1KIXA 2ZTEA 3RR5A 3U4VA 2UUAL 4DR2L 1VQIA 3UDGA 2JQOA 3BJUA 3GD7A 2IX1A 2MNAA 1HJPA 3CPFA 4LFCL 1YHQA 4GKJQ 2FXQA 4LFCQ 1IL2A 4IPHA 5C44H 4GKJL 4YWMA 4P73A 4OWWB 3CCVA 1X3GA 3AEVA 2UU9Q 3F2BA 1JB7A 3KLWA 4GKKL 4H02A 3CCRA 3ULPA 1SFOH 2R7FA 5H1SE 1OXSC 1IBLQ 3RLFA 3F8TA 3EBEA 2ID0A 1N9WA 3PIPA 1YVCA 1HNXQ 4DV2L 1NE3A 4HIDA 2V1CC 1RIPA 3H0GG 1HR0L 1SLJA 2VQFL 1VQ5A 4L5RC 2R92H 3S2DH 1KD1C 2E2HH 2E5LL 4DKAC 4BBRH 4B3TQ 3UE0A 1E24A 1EUJA 3G48A 3D31A 5C0XI 4X64Q 2UXCL 3A5ZB 4NXNL 1CKMA 2K5HA 2YU9H 3I4OA 1YHAA 1JJ2A 2Z0SA 2RCNA 1QZHA 1BVSA 4GNXC 1XPOA 1IBKQ 1C0AA 1XJVA 1OXVA 2Q2HA 3CC7A 2XGTA 3S16H 1HNZL 1LM0A 2GVAA 4P75A 3HOZG 3EIVA 1JJGA 5IP7H 2AWNA 1K3RA 5C0XJ 4JV5L 5JJLA 1WCMH 2WB1E 1Q46A 3E0EA 4R4IA 2IT1A 3J7A5 4LF6Q 4P72A 2HHHQ 2K52A 1VQKA 3S24A 3PUWA 3S1MH 2ASBA 3PO3H 4DUYQ 4C3HH 4PZ6A 1PH5A 1VQ9A 3KF6B 3T1HL 4MNOA 3GTQH 4OO1I 4KHZA 4LW1A 3ZJYC 4NB3A 1XNRL 1Q1EA 2E8GA 4YHHL 2VL6A 2N49A 3CC4A 4HIMA 1VQHA 1XNRQ 4KHPL 2JA7H 5IYDH 1N34Q 4AQYL 2UXDQ 5K36G 1P8LA 1W3SA 4A3JG 3GO5A 4IPGA 4LF9Q 4MTNA 4DV3Q 5J3BA 5IYCH 4DAYB 3TS0A 2I5MX 1VQJA 2L15A 2RHQB 3TREA 1VQLA 3S14H 4JBWA 4DK3C 3ERSX 1J5EQ 1AE3A 2I0QA 2LXKA 4YY3L 1KRSA 4JCVE 1HZ9A 4DR7L 3HKZE 1SN8A 4IPDA 4L5SA 3UDXA 2GVBA 4X65Q 1E22A 3A74A 3U50C 1U0LA 4A3FH 1TWHH 4HJ5A 2DUDA 3KF8B 4GLAC 3CW2C 1HZBA 1PHJA 1EFWA 5IWAQ 1E7ZA 2VW9A 1OXTA 4QL5A 1Q1BA 4LFAL 5IP9G 4JYAQ 5FLXc 3B6YA 5ELNA 2Z6KA 4AH6A 4BXXH 4HIOA 1TWCH 3M4OH 3FP9A 1UEBA 4DR5L 2B63G 1GVPA 4DR5Q 3M9BA 3H15A 4FDBA 2WAQE 3PGZA 4A4IA 2RHSB 4DAMA 1NTGA 4DK6C 3CXCA 4PZ8A 4DV1Q 3KFUA 4A3LG 4QGUA 5C4XG 3U58A 1IBLL 4LF8Q 3HOZH 3J7ZC 1TWFH 1G6PA 5C3EG 1DGSA 2ZJRA 5IYDG 1K8AC 3J80c 1L1OB 2JA7G 4J15A 4A3IH 4P71A 2NZOA 1HR0Q 3CCUA 4BXXG 4OXPA 5GADC 4DV6L 1XNQL 1VCIA 1VQ8A 2ZTCA 3PUYA 4P74A 4JI4Q 4JI4L 4JI8L 4QY7A 5LMNQ 4JI2L 4IOAA 4QQBX 1NBWA 1KC8C 4AQYQ 2NVQH 1YJ9A 2UXDL 1WCMG 1A62A 3AQQA 1YNXA 1N8RC 2CKZB 4EX5A 4JI0Q 1Q8KA 3G4SA 2E2IH 3RN5A 1E3PA 3OYYA 3D0FA 5JEAG 1IBKL 1VQMA 2I5HA 3BZKA 3EN2A 5M5XH 3OTOQ 3KJPA 4QJFA 5IP9H 2ZM6Q 2GN5A 4UPAA 4LUVA 4JV5Q 4UP9A 1A8VA 2IHFA 2MO1A 5IYBH 3HOVG 2R93H 2F4VQ 4DR3Q 3CC2A 2MFIA 3CMAA 2KBNA 3JAMc 5M3MH 4LFAQ 1BKBA 3CCMA 3ULJA 1I6HH 2HIXA 2JK8A 4AYBG 4PZ7A 4JI6Q 3TRZA 5FJ8G 3L0OA 4GNXB 1RL2A 3W1BA 1CUKA 1I3QH 2NN6G 4A3IG 1N33Q 3PF5A 2LXJA 1PH8A 3HOVH 2R7DA 1P16A 1JMCA 1YZ6A 1PH6A 3F2CA 1MKHA 3CCJA 1I94L 2OTLA 5HY6A 2BH2A 1M1KC 4DR1Q 1XMQQ 1CKNA 4B3RQ 5M5YH 2N3SA 4NXML 4UP7A 1QUQB 1UE5A 1VQEA 1PH7A 1X54A 4YY3Q 3E9IA 4UY8C 1XNQQ 5IY0A 4DV4Q 2K5NA 3PO2H 4BBSH 4BBSG 4UP8A 1XMOQ 3G71A 4RMFA 4IFDI 4YCVA 1MJCA 1PYBA 5M3MG 4DR6Q 1LTLA 1EQRA 5C44G 4DUZQ 1VQOA 4NPSA 3CD6A 1L1OC 1SROA 2N78A 1KXLA 3PUVA 1KL9A 5IP7G 2OWOA 4JI5Q 3K8AA 2IHEA 2AMCB 4A3EG 3L7ZC 5M3FG 1A0IA 1WI5A 2AKWB 4R4CA 4APVA 5IE8A 3RN2A 5BR8Q 2YTVA 4KI0A 1IXRA 3RZDH 4DV0Q 2KCMA 4JOIC 1XPRA 3HOXH 1KHIA 4DV0L 2YV5A 4OONA 3CMEA 4PG3A 2ES2A 3STBD 4A3GG 3STBC 1YJWA 1KRTA 1VQNA 4LUZA 4JI1L 4X66Q 4DR4Q 2A1AA 4JOIA 1VQPA 2ALYB 1PH9A 2AWOA 2HQLA 2QGQA 3UDIA 1FJGL 3Q8DA 4DNIA 3T1YQ 2WAQG 1OXUA 2JA6G 2MQHA 1Y1VH 4JG2A 2UXCQ 2UUBL 1ASZA 1EOVA 2H5XA 2A8VA 1X6OA 3CQZH 3GTJH 5JJIA 4A3DG 2NVXH 5FLMH 3HKZG 4A3CG 2EXDA 3J81i 3CAMA 4O0AA 3FKIG 4GOPB 3UDFA 4C3IH 2VZAA 4BY7G 2VNUD 2OQ0A 1OTCA 2NN6I 3HKSA 1D8LA 3PIOA 1JT8A 3CCSA 2Q2IA 5C4XH 4JI3Q 1PFSA 1T9HA 3K80C 4A3GH 4A3EH 1EWIA 1SR3A 4DR2Q 4GOPA 1VQ4A 2D0OA 4GN4B 3J81j 4LNQA 1C9OA 2D62A 2F4VL 3RZOH 2HIVA 1MIUA 1YHBA 3K0XA 2NZHA 1R9TH 4R4QA 1NJIC 1QVFA 2NVTH 5FJ8H 4DUYL 3S1RH 1J6QA 2UU9L 3TS2A 1CSPA 3L2PA 4X62Q 4IJLA 2AHOB 1Q81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BZC A;  1BBW A;  3CPW A;  3HOY G;  1E1O A;  5FLM G;  1N34 L;  1UE1 A;  1QVC A;  2UXB Q;  5HGQ A;  1NMG A;  3S2H H;  1LUZ A;  1XMQ L;  1K0R A;  2OCE A;  2PI2 E;  4L5Q A;  4JC0 A;  4DV5 L;  3H3V H;  4POF A;  3UE1 A;  3I4M G;  2EQS A;  4X66 L;  4DR4 L;  5JJK A;  4R4T A;  1HR0 W;  5M3F H;  3PO2 G;  4MZ9 A;  2E5L Q;  2WFW A;  3U4Z A;  3K7A H;  4X65 L;  3J80 i;  2Z6K C;  1WYD A;  1XMO L;  3GTL H;  4JI7 L;  1W2B A;  1YIJ A;  1IBM Q;  4LFB Q;  1IBM L;  3A5U A;  1V43 A;  3F1Z A;  3CCQ A;  1K8G A;  4LFB L;  1O7I A;  2VS1 A;  3I2Z A;  4TQU S;  2R7Z G;  3RLO A;  1JE5 A;  2ZJQ A;  4B3S Q;  1AH9 A;  5IT9 c;  2F52 A;  3M85 A;  4R1J A;  1X3E A;  2BH8 A;  4BBR G;  5C0X G;  2N8N A;  3ICE A;  2B63 H;  1E1T A;  1K73 C;  1VQB A;  2DGY A;  1U5K A;  3FHW A;  1PH2 A;  2CCZ A;  1V1Q A;  3W1G A;  1N32 Q;  3AFQ A;  3OTO L;  3PO3 G;  2K14 A;  4GLV B;  3FKI H;  3MXN B;  4ALP A;  2Q2T A;  4LF4 Q;  2ZJP A;  2YTY A;  1XPU A;  2R7Z H;  1S40 A;  4EQ5 A;  1ASY A;  3NBH B;  3RLN A;  4IFD J;  5GAH C;  5GQO A;  4AIM A;  4BA1 I;  4AYB E;  4YCU A;  1X55 A;  4A3J H;  1HNW Q;  3GTP H;  2KHI A;  1PH4 A;  3ULL A;  3PCO B;  2JA6 H;  4X62 L;  4LF5 Q;  1GM5 A;  3F2D A;  1VQF A;  1A63 A;  3A0J A;  4HJ7 A;  1AE2 A;  5C4J H;  2JEB I;  5IYB G;  3J81 c;  2KCT A;  3DM3 A;  4RG1 A;  4DR1 L;  4DPG A;  1D7Q A;  2JEA I;  2JJQ A;  1I94 Q;  3PF4 A;  1I5F A;  5LMU L;  4GOP C;  1CKN B;  2B29 A;  4XIG S;  3KOJ A;  4HJ8 A;  1YJN A;  4BY7 H;  1N36 Q;  1TXY A;  1JJC B;  1HH2 P;  1S3O A;  2R92 G;  4O2D A;  1FL0 A;  4C3J H;  2VQE Q;  4IOC A;  4X6A H;  3MEF A;  4TVA B;  4A3B G;  1HZA A;  4BY1 H;  3HOU G;  3I7F A;  2PMZ E;  1QZG A;  4K0K L;  3PSI A;  3I55 A;  4X64 L;  4HJA A;  2UUA Q;  4KLK A;  3TQY A;  1Q86 C;  3H3V I;  3PUZ A;  4DR3 L;  4POG A;  2KEN A;  3S15 H;  3HOX G;  1G29 1;  1Y1V G;  4XTC S;  5IWA L;  1VQ7 A;  4HJ9 A;  2IY5 B;  1SRU A;  3WWV A;  4JYA L;  1Q7Y C;  1GKH A;  2OTJ A;  1Z9F A;  3TEH B;  1Z47 A;  2VUM H;  2PQA B;  5BR8 L;  3IRB A;  3S1Q H;  5E7N A;  1EIF A;  5AJ3 L;  3OW2 A;  3SGI A;  2VY3 A;  1KQS A;  4L5T A;  5EAY A;  1L0W A;  4A76 A;  5GRO A;  3I56 A;  1WFQ A;  1KAW A;  4A75 A;  4DV5 Q;  2WB1 G;  3GDE A;  4LF7 L;  3T1Y L;  4DV4 L;  4JBK A;  2LSS A;  4A3C H;  4B3T L;  1HZC A;  1VQG A;  1Y14 B;  2OQK A;  3PV0 A;  4YCW A;  2Y0S G;  4YHH Q;  1K9M C;  4DR6 L;  4JBM A;  4HIK A;  4ME3 A;  3S1N H;  1PV4 A;  4B3M L;  1L1O A;  4LWC A;  1Q82 C;  4B3S L;  2JA9 A;  4A3B H;  3S17 H;  4A3M G;  3HOY H;  1UE6 A;  2ATW A;  3PUX A;  1WJJ A;  1LYL A;  2B3G A;  4PMW A;  4DV7 Q;  4YWL A;  1X65 A;  1Y1W H;  1B70 B;  4GLX A;  1N32 L;  2NVY H;  4Y52 H;  2QEX A;  1TWG H;  1HNZ Q;  1UE7 A;  3AYH B;  3HFZ B;  4YWK A;  1PH1 A;  1S72 A;  3NEL A;  3G6E A;  3KDF A;  2Q2U A;  4IO9 A;  2JA8 G;  3HOW G;  4K0K Q;  3CCL A;  5GAG C;  3CF5 A;  1VQ6 A;  4A93 G;  4JBJ A;  1QUQ A;  2BA0 A;  5DLQ E;  2K50 A;  4R4O A;  2VUM G;  3KJO A;  2JA5 G;  1HNW L;  1SE8 A;  2IX0 A;  2A19 A;  5LMN W;  2HT1 A;  1IZ6 A;  1QVG A;  3M7N A;  3AFP A;  1NY4 A;  1YEZ A;  1I50 H;  2CQO A;  2UUC Q;  3T1H Q;  4JI6 L;  2UUC L;  2R6G A;  3GTM H;  1PA6 A;  4GS3 A;  2YTX A;  3KDF B;  4WJ4 A;  1PYS B;  4KHP Q;  4A3D H;  3KYH C;  1GO3 E;  3W5O A;  1VQC A;  5M5W H;  4DV2 Q;  2K75 A;  2UXB L;  1UWV A;  1H95 A;  3E9H A;  4LF9 L;  1HNX L;  5LMU Q;  4OO1 G;  4NXM Q;  2VQF Q;  3GTO H;  4B3R L;  2PNH A;  4OWX B;  2PI2 A;  1PH3 A;  1GD7 A;  5ELO A;  5JEA J;  3LGJ A;  1X3F A;  4DR7 Q;  2E2J H;  4GN3 B;  4JI7 Q;  4A3M H;  1OXX K;  4JI3 L;  4BA2 I;  2ZTD A;  3NEM A;  1TWA H;  1CSQ A;  5IYC G;  4OX9 Q;  4DUZ L;  3K81 C;  4QIW E;  3KF6 A;  4OX9 L;  2K5V A;  4A3L H;  4NXN Q;  1NMF A;  3I4N G;  2XTI A;  3JAM i;  3I4N H;  1G51 A;  3GTG H;  2KHJ A;  1X9N A;  1B8A A;  1VQD A;  1SMX A;  4JI5 L;  1Q12 A;  1YI2 A;  2JE6 I;  2EIF A;  1M90 C;  4WJ3 M;  2Y0S E;  2K4K A;  5GAE C;  2PQA A;  1EYG A;  4GKK Q;  2JA5 H;  4IFD G;  4IJH A;  1EQQ A;  2RF4 A;  4DV1 L;  2YYZ A;  2D0P A;  1B7Y B;  5AJ3 Q;  3CCE A;  3JC6 6;  1WOC A;  1YBY A;  4LUO A;  4GNX A;  3VDY A;  2CWA A;  4LF4 L;  4Y7N H;  2CWP A;  1YIT A;  2WP8 J;  3M4Q A;  1X56 A;  4LF8 L;  1FGU A;  4JI1 Q;  3HOU H;  4A3F G;  4LF6 L;  2HHH L;  1L2F A;  2MO0 A;  3M3Y H;  4LF7 Q;  4IPC A;  3ER0 A;  4GN5 A;  1K83 H;  4DV6 Q;  1FJG Q;  4LF5 L;  1VQA A;  3M4P A;  3NEN A;  4JI2 Q;  5LMN L;  1IYJ B;  3GTK H;  1N33 L;  3H0G H;  4JI8 Q;  2F3I A;  5C3E H;  2JA8 H;  1EIY B;  3HOW H;  4DV3 L;  1VS0 A;  1XTD A;  1C7Y A;  2UUB Q;  4A93 H;  2I5L X;  1BBU A;  4B3M Q;  4BY1 G;  2R93 G;  2BA1 A;  2C35 B;  1PVO A;  1N36 L;  1J5E L;  1FVI A;  1Y1W G;  4DV7 L;  1CKO A;  3CP0 A;  3RNU A;  4A3K H;  2QA4 A;  4A3K G;  1MJE A;  4JI0 L;  3BU2 A;  4OWT B;  2VQE L;  3I4M H;  3K7U C;  2ZM6 L;  1V9P A;  4C2M H;  3DLL A;  2CFM A;  1KIX A;  2ZTE A;  3RR5 A;  3U4V A;  2UUA L;  4DR2 L;  1VQI A;  3UDG A;  2JQO A;  3BJU A;  3GD7 A;  2IX1 A;  2MNA A;  1HJP A;  3CPF A;  4LFC L;  1YHQ A;  4GKJ Q;  2FXQ A;  4LFC Q;  1IL2 A;  4IPH A;  5C44 H;  4GKJ L;  4YWM A;  4P73 A;  4OWW B;  3CCV A;  1X3G A;  3AEV A;  2UU9 Q;  3F2B A;  1JB7 A;  3KLW A;  4GKK L;  4H02 A;  3CCR A;  3ULP A;  1SFO H;  2R7F A;  5H1S E;  1OXS C;  1IBL Q;  3RLF A;  3F8T A;  3EBE A;  2ID0 A;  1N9W A;  3PIP A;  1YVC A;  1HNX Q;  4DV2 L;  1NE3 A;  4HID A;  2V1C C;  1RIP A;  3H0G G;  1HR0 L;  1SLJ A;  2VQF L;  1VQ5 A;  4L5R C;  2R92 H;  3S2D H;  1KD1 C;  2E2H H;  2E5L L;  4DKA C;  4BBR H;  4B3T Q;  3UE0 A;  1E24 A;  1EUJ A;  3G48 A;  3D31 A;  5C0X I;  4X64 Q;  2UXC L;  3A5Z B;  4NXN L;  1CKM A;  2K5H A;  2YU9 H;  3I4O A;  1YHA A;  1JJ2 A;  2Z0S A;  2RCN A;  1QZH A;  1BVS A;  4GNX C;  1XPO A;  1IBK Q;  1C0A A;  1XJV A;  1OXV A;  2Q2H A;  3CC7 A;  2XGT A;  3S16 H;  1HNZ L;  1LM0 A;  2GVA A;  4P75 A;  3HOZ G;  3EIV A;  1JJG A;  5IP7 H;  2AWN A;  1K3R A;  5C0X J;  4JV5 L;  5JJL A;  1WCM H;  2WB1 E;  1Q46 A;  3E0E A;  4R4I A;  2IT1 A;  3J7A 5;  4LF6 Q;  4P72 A;  2HHH Q;  2K52 A;  1VQK A;  3S24 A;  3PUW A;  3S1M H;  2ASB A;  3PO3 H;  4DUY Q;  4C3H H;  4PZ6 A;  1PH5 A;  1VQ9 A;  3KF6 B;  3T1H L;  4MNO A;  3GTQ H;  4OO1 I;  4KHZ A;  4LW1 A;  3ZJY C;  4NB3 A;  1XNR L;  1Q1E A;  2E8G A;  4YHH L;  2VL6 A;  2N49 A;  3CC4 A;  4HIM A;  1VQH A;  1XNR Q;  4KHP L;  2JA7 H;  5IYD H;  1N34 Q;  4AQY L;  2UXD Q;  5K36 G;  1P8L A;  1W3S A;  4A3J G;  3GO5 A;  4IPG A;  4LF9 Q;  4MTN A;  4DV3 Q;  5J3B A;  5IYC H;  4DAY B;  3TS0 A;  2I5M X;  1VQJ A;  2L15 A;  2RHQ B;  3TRE A;  1VQL A;  3S14 H;  4JBW A;  4DK3 C;  3ERS X;  1J5E Q;  1AE3 A;  2I0Q A;  2LXK A;  4YY3 L;  1KRS A;  4JCV E;  1HZ9 A;  4DR7 L;  3HKZ E;  1SN8 A;  4IPD A;  4L5S A;  3UDX A;  2GVB A;  4X65 Q;  1E22 A;  3A74 A;  3U50 C;  1U0L A;  4A3F H;  1TWH H;  4HJ5 A;  2DUD A;  3KF8 B;  4GLA C;  3CW2 C;  1HZB A;  1PHJ A;  1EFW A;  5IWA Q;  1E7Z A;  2VW9 A;  1OXT A;  4QL5 A;  1Q1B A;  4LFA L;  5IP9 G;  4JYA Q;  5FLX c;  3B6Y A;  5ELN A;  2Z6K A;  4AH6 A;  4BXX H;  4HIO A;  1TWC H;  3M4O H;  3FP9 A;  1UEB A;  4DR5 L;  2B63 G;  1GVP A;  4DR5 Q;  3M9B A;  3H15 A;  4FDB A;  2WAQ E;  3PGZ A;  4A4I A;  2RHS B;  4DAM A;  1NTG A;  4DK6 C;  3CXC A;  4PZ8 A;  4DV1 Q;  3KFU A;  4A3L G;  4QGU A;  5C4X G;  3U58 A;  1IBL L;  4LF8 Q;  3HOZ H;  3J7Z C;  1TWF H;  1G6P A;  5C3E G;  1DGS A;  2ZJR A;  5IYD G;  1K8A C;  3J80 c;  1L1O B;  2JA7 G;  4J15 A;  4A3I H;  4P71 A;  2NZO A;  1HR0 Q;  3CCU A;  4BXX G;  4OXP A;  5GAD C;  4DV6 L;  1XNQ L;  1VCI A;  1VQ8 A;  2ZTC A;  3PUY A;  4P74 A;  4JI4 Q;  4JI4 L;  4JI8 L;  4QY7 A;  5LMN Q;  4JI2 L;  4IOA A;  4QQB X;  1NBW A;  1KC8 C;  4AQY Q;  2NVQ H;  1YJ9 A;  2UXD L;  1WCM G;  1A62 A;  3AQQ A;  1YNX A;  1N8R C;  2CKZ B;  4EX5 A;  4JI0 Q;  1Q8K A;  3G4S A;  2E2I H;  3RN5 A;  1E3P A;  3OYY A;  3D0F A;  5JEA G;  1IBK L;  1VQM A;  2I5H A;  3BZK A;  3EN2 A;  5M5X H;  3OTO Q;  3KJP A;  4QJF A;  5IP9 H;  2ZM6 Q;  2GN5 A;  4UPA A;  4LUV A;  4JV5 Q;  4UP9 A;  1A8V A;  2IHF A;  2MO1 A;  5IYB H;  3HOV G;  2R93 H;  2F4V Q;  4DR3 Q;  3CC2 A;  2MFI A;  3CMA A;  2KBN A;  3JAM c;  5M3M H;  4LFA Q;  1BKB A;  3CCM A;  3ULJ A;  1I6H H;  2HIX A;  2JK8 A;  4AYB G;  4PZ7 A;  4JI6 Q;  3TRZ A;  5FJ8 G;  3L0O A;  4GNX B;  1RL2 A;  3W1B A;  1CUK A;  1I3Q H;  2NN6 G;  4A3I G;  1N33 Q;  3PF5 A;  2LXJ A;  1PH8 A;  3HOV H;  2R7D A;  1P16 A;  1JMC A;  1YZ6 A;  1PH6 A;  3F2C A;  1MKH A;  3CCJ A;  1I94 L;  2OTL A;  5HY6 A;  2BH2 A;  1M1K C;  4DR1 Q;  1XMQ Q;  1CKN A;  4B3R Q;  5M5Y H;  2N3S A;  4NXM L;  4UP7 A;  1QUQ B;  1UE5 A;  1VQE A;  1PH7 A;  1X54 A;  4YY3 Q;  3E9I A;  4UY8 C;  1XNQ Q;  5IY0 A;  4DV4 Q;  2K5N A;  3PO2 H;  4BBS H;  4BBS G;  4UP8 A;  1XMO Q;  3G71 A;  4RMF A;  4IFD I;  4YCV A;  1MJC A;  1PYB A;  5M3M G;  4DR6 Q;  1LTL A;  1EQR A;  5C44 G;  4DUZ Q;  1VQO A;  4NPS A;  3CD6 A;  1L1O C;  1SRO A;  2N78 A;  1KXL A;  3PUV A;  1KL9 A;  5IP7 G;  2OWO A;  4JI5 Q;  3K8A A;  2IHE A;  2AMC B;  4A3E G;  3L7Z C;  5M3F G;  1A0I A;  1WI5 A;  2AKW B;  4R4C A;  4APV A;  5IE8 A;  3RN2 A;  5BR8 Q;  2YTV A;  4KI0 A;  1IXR A;  3RZD H;  4DV0 Q;  2KCM A;  4JOI C;  1XPR A;  3HOX H;  1KHI A;  4DV0 L;  2YV5 A;  4OON A;  3CME A;  4PG3 A;  2ES2 A;  3STB D;  4A3G G;  3STB C;  1YJW A;  1KRT A;  1VQN A;  4LUZ A;  4JI1 L;  4X66 Q;  4DR4 Q;  2A1A A;  4JOI A;  1VQP A;  2ALY B;  1PH9 A;  2AWO A;  2HQL A;  2QGQ A;  3UDI A;  1FJG L;  3Q8D A;  4DNI A;  3T1Y Q;  2WAQ G;  1OXU A;  2JA6 G;  2MQH A;  1Y1V H;  4JG2 A;  2UXC Q;  2UUB L;  1ASZ A;  1EOV A;  2H5X A;  2A8V A;  1X6O A;  3CQZ H;  3GTJ H;  5JJI A;  4A3D G;  2NVX H;  5FLM H;  3HKZ G;  4A3C G;  2EXD A;  3J81 i;  3CAM A;  4O0A A;  3FKI G;  4GOP B;  3UDF A;  4C3I H;  2VZA A;  4BY7 G;  2VNU D;  2OQ0 A;  1OTC A;  2NN6 I;  3HKS A;  1D8L A;  3PIO A;  1JT8 A;  3CCS A;  2Q2I A;  5C4X H;  4JI3 Q;  1PFS A;  1T9H A;  3K80 C;  4A3G H;  4A3E H;  1EWI A;  1SR3 A;  4DR2 Q;  4GOP A;  1VQ4 A;  2D0O A;  4GN4 B;  3J81 j;  4LNQ A;  1C9O A;  2D62 A;  2F4V L;  3RZO H;  2HIV A;  1MIU A;  1YHB A;  3K0X A;  2NZH A;  1R9T H;  4R4Q A;  1NJI C;  1QVF A;  2NVT H;  5FJ8 H;  4DUY L;  3S1R H;  1J6Q A;  2UU9 L;  3TS2 A;  1CSP A;  3L2P A;  4X62 Q;  4IJL A;  2AHO B;  1Q81 C; 
#chains in the Genus database with same CATH topology
 3T1H H;  3BZC A;  1SJH D;  3NXW A;  3CPW A;  1XNR H;  3C3L A;  1N34 L;  1TWH A;  3OTO H;  3RBD A;  2ASL A;  2UXB Q;  5HGQ A;  1NMG A;  3T53 B;  2O2L D;  4DV5 L;  4EVO A;  1KEE A;  1K1Q A;  1EYA A;  2HCI A;  5BN5 A;  2VQD A;  1HR0 W;  5M3F H;  1STY A;  1EUC B;  1HQR D;  1EYD A;  2WFW A;  1D5Z C;  4FF4 A;  4MTD A;  2E2H B;  1W2B A;  5CV8 A;  1FKA H;  4LFB Q;  5KFC A;  3CCQ A;  2VB3 X;  3I2Z A;  3G6J B;  4IN3 A;  2RGV A;  4CDE C;  4LH7 A;  1HA6 A;  1Y1W A;  1II3 A;  1X3E A;  3GV6 A;  4BBR G;  1TWC B;  4EYI B;  3ICE A;  1K73 C;  1PH2 A;  4O3R A;  3W1G A;  1N32 Q;  4K6L A;  3AFQ A;  3PO3 G;  4Q0F A;  3SDZ A;  3MXN B;  4ALP A;  4IAL A;  1DCZ A;  2YTY A;  1FNU A;  2R7Z H;  1STH A;  5FKA C;  1ASY A;  4IFD J;  1ENC A;  4A3J H;  3RF2 A;  1X55 A;  3BG3 A;  4KKU A;  3OHX C;  1PH4 A;  4JI7 H;  2JA6 H;  3HOX B;  2HVQ A;  1JLL B;  1UNS A;  4HJ7 A;  3GQC A;  2X0S A;  2KCT A;  3MWM A;  1EL0 A;  4DPG A;  4BWS C;  4C56 C;  2JA8 B;  4G7O C;  4HJ8 A;  3KOJ A;  2H1E A;  2EVB A;  1N36 Q;  2A73 B;  3T51 B;  4FS2 A;  1HH2 P;  1FD7 D;  2WE6 A;  3WOE A;  2R92 G;  2VQE Q;  3U9O A;  2ZXO A;  4A3B G;  3HOU G;  3PVX A;  2JEJ A;  4DR6 H;  3I55 A;  5DLG A;  3C1F A;  2NVQ B;  1Q86 C;  1FR3 A;  1EY7 A;  5EGT A;  5C3W A;  2NVT B;  4M7E A;  3S15 H;  3H40 A;  2XRQ D;  1SE4 A;  3U9S A;  1TKW B;  4HJ9 A;  2IY5 B;  2B2V C;  3LWE A;  4JYA L;  4MV3 A;  3D4R A;  4YIJ A;  3KAJ A;  5KGU A;  1U9R A;  4RFB A;  3T13 A;  1HUN A;  3TEH B;  5CA0 F;  2VUM H;  3NSW A;  2SOB A;  1DXM A;  2IJ0 A;  4QF4 A;  2HJW A;  1ZET A;  1A2T A;  2FMA A;  3DEP A;  4A76 A;  4HCS A;  1OO9 B;  3VR4 A;  4J1M A;  2VUM A;  5IT9 E;  4B3T L;  1HZC A;  1PTO D;  2EY2 A;  2ZDG A;  4F4W A;  2AU0 A;  1TAE A;  1F2Z A;  2KQ3 A;  1K1S A;  2B63 A;  1JDB B;  4B3M L;  2OT2 A;  1SFO B;  4C2M A;  3S17 H;  2N55 A;  1IKL A;  1UE6 A;  3VPC A;  1EY0 A;  2YRW A;  2R8G A;  1E2V A;  2B3G A;  4PMW A;  3IN5 A;  1X65 A;  1E4G T;  3RV3 A;  2Z4H A;  4Y52 H;  1KAB A;  1S0O A;  1TWF B;  3BYY B;  4YWK A;  1NAP A;  1PH1 A;  1RJR A;  3NEL A;  4HN7 A;  2CH4 A;  4NKL A;  3KDF A;  4R8N A;  2Q2U A;  4IO9 A;  3HG9 A;  2JA8 G;  4KY6 A;  1WTV A;  1BQQ T;  1E4E B;  1QUQ A;  2PN1 A;  1SBB B;  1H9K A;  4UCV A;  3FPP A;  3NK9 A;  3KJO A;  2XCL A;  1SE8 A;  3EPG A;  1PZI D;  1S4Z A;  3PIP 3;  5EDW A;  2F0T A;  4B3S H;  2BCO A;  5T1I A;  1QVG A;  3OUU A;  4Q44 A;  1PRT D;  2CQO A;  2K32 A;  5CV7 A;  3T1H Q;  2AGO A;  1PA6 A;  3H4D A;  4GS3 A;  2YTX A;  3GID A;  1KDB A;  2GA4 B;  1QWY A;  2XNA C;  1V1P A;  5C3X A;  3W5O A;  2UXB H;  2WKC A;  3C0F B;  3E9H A;  4OO1 G;  1WTX A;  4OWX B;  1TS4 A;  1PH3 A;  3HKZ B;  1V1O A;  3LGJ A;  4GN3 B;  4JI3 L;  4BA2 I;  1SYF A;  2ZTD A;  3NEM A;  2Z9H A;  2YCH A;  3HOV B;  5L1J A;  4IRD A;  2RKS A;  1QG7 A;  3K81 C;  1RDP D;  4K5V A;  2XTI A;  5KT5 A;  3G6X A;  1X9N A;  1EHI A;  4F4Z A;  1B8A A;  3CKI B;  1SMX A;  4EGQ A;  1EIG A;  2RDF A;  4PMC A;  2JE6 I;  4A3I B;  2W71 A;  3OSP A;  1M90 C;  3MFY A;  2Y0S E;  1EYG A;  4WJW A;  4YAJ B;  4IJH A;  4DV1 L;  4LF9 H;  2D0P A;  1B7Y B;  5AJ3 Q;  4LUO A;  4GNX A;  4LF4 L;  2JN4 A;  2CWA A;  3H20 A;  4Y7N H;  4EEQ A;  1BNC A;  4HCE A;  4JI1 Q;  3OPO A;  4A3F G;  4MTE A;  2J0T D;  2WKD A;  1IOV A;  1YNN D;  4DV6 Q;  3T5L A;  4LF5 L;  3NEN A;  4DN4 M;  1N33 H;  5ELD A;  5KT4 A;  2F3I A;  5C3E H;  4DV3 L;  1UUP A;  2WII B;  3QJY A;  2V4D A;  4DV7 L;  5C5J A;  3SE7 A;  3ORR A;  1I7N A;  5COR A;  1BCP F;  3PN1 A;  1SAP A;  3HOZ B;  1JWS D;  3I4M H;  3G6V A;  4C2M H;  1EYC A;  1H9S B;  2ZTE A;  3UDG A;  4QW9 A;  5IGF A;  3GD7 A;  2MGS A;  2WTF A;  1SND A;  2UVR A;  2ICE C;  1YHQ A;  2J9G A;  1IL2 A;  3BYT B;  4IPH A;  2R84 A;  4YWM A;  5NUC A;  3C46 A;  2R7N A;  4LF7 H;  4ID6 A;  3R5X A;  1HNW H;  4P73 A;  5KFO A;  4ODG A;  4KD3 A;  3AEV A;  4C3J G;  1HUM A;  3MTS A;  2Z8L A;  4GKK L;  3BQ1 A;  5IGE A;  4YAK B;  4ED1 A;  5EKI A;  4FBU A;  2H4O A;  5E1F A;  1S9F A;  3RJ0 A;  3RLF A;  2CW0 D;  3F2U A;  3EBE A;  2ID0 A;  3PIP A;  3GTJ A;  4HID A;  2CQA A;  1Q8I A;  1RIP A;  4DXF A;  4UCR A;  2F3W A;  2VQF L;  2R92 H;  4YJ2 F;  3VYS A;  1F9S A;  4L6T B;  4DKA C;  1GUT A;  5KG2 A;  3RD4 A;  1EY5 A;  2RSN A;  1E24 A;  4XQN A;  5C0X I;  5DQI A;  2FHT A;  2UXC L;  3A5Z B;  1HTP A;  3K6O A;  4NXN L;  1CKM A;  2YU9 H;  3N41 B;  4KHP H;  2C28 A;  4UCU A;  1V4Y A;  2Z0S A;  3V6H A;  2ZDQ A;  1KTK A;  2RCN A;  3FRP B;  2V9W A;  2BQR A;  1BVS A;  3I91 A;  1IBK Q;  2EY1 A;  5GON F;  2Q2H A;  3CC7 A;  5LL6 X;  1K8M A;  2I80 A;  4CDD C;  1F2L A;  3MFG A;  3HOZ G;  1JJG A;  3MR3 A;  2DWC A;  2FKL A;  5C0X J;  3KHG A;  3GTG A;  2DJF C;  4B9X A;  1Q46 A;  3E0E A;  4R4I A;  3DUZ A;  2I87 A;  4LF6 Q;  3SXH A;  2HHH Q;  4CJ1 B;  3Q23 A;  1VQK A;  1DON A;  3PO3 H;  1XMO H;  2W6Z A;  2M2L A;  4PZ6 A;  1FNW A;  1AP0 A;  3TQ1 A;  5C4H A;  5M5W B;  4YHH H;  5COY A;  2JA7 H;  5IYD H;  4JVZ A;  4AQY L;  1CI3 M;  2UXD Q;  1P8L A;  4O3N A;  1B1Z A;  4DV2 H;  2KJX A;  1STB A;  5J3B A;  4DAY B;  2DY8 A;  2L15 A;  5L1I A;  1DM0 B;  4JBW A;  3Q8S B;  4F4X A;  4UCS A;  1AE3 A;  5LXT F;  4DR7 L;  3HKZ E;  2C2E A;  4IPD A;  2R8K A;  4X65 Q;  3D8G A;  1E22 A;  3A74 A;  1U0L A;  3EVQ A;  2UVU A;  2KHS A;  3Q8P B;  2K6A A;  2L55 A;  1PHJ A;  2XRS D;  1JQY D;  4AQY H;  4K5X A;  1Q1B A;  5KKN B;  1QNK A;  4RGO S;  5FLX c;  2YZM A;  2Z6K A;  3R2T A;  4I55 F;  3H94 A;  2F1M A;  1ILP A;  1UEB A;  4JI0 H;  5KFG A;  4DR5 Q;  4IUV A;  3H15 A;  3PGZ A;  3BS1 A;  4EQN A;  2RDJ A;  2AGP A;  3K3P A;  3OSN A;  4A3L G;  2W8L A;  4LF8 Q;  3HOZ H;  5HBR B;  1TWF H;  3D6C A;  3NQT A;  1G6P A;  1DGS A;  2VQF H;  4JPB W;  3J80 c;  2A6E C;  3P7J A;  3I72 A;  4P71 A;  4A3I H;  4H7B A;  5KFT A;  2DY7 A;  1XNQ L;  2RA4 A;  3PR5 B;  1VQ8 A;  5J39 A;  2PMZ B;  4JI4 L;  1EUD B;  1G2S A;  5LMN Q;  5JVG 3;  1WSC A;  1K83 B;  2DPJ A;  4E4T A;  1KC8 C;  1TA8 A;  5KFS A;  1YJ9 A;  2KA7 A;  2IWH A;  3NTH A;  1WCM G;  4JYA H;  3AQQ A;  3HOU B;  4HED A;  2A68 D;  2NN6 H;  1EIH A;  4C5B A;  2L0C A;  5DM6 3;  4JI0 Q;  2F0H A;  2E2I H;  3SK8 A;  3RN5 A;  1CFM A;  3OYY A;  3D0F A;  1G2T A;  4HNV A;  2JEF A;  4G7Z C;  3BZD B;  3EN2 A;  5M5X H;  4Q5V A;  3ETH A;  3PR4 A;  2L9H A;  2O5J C;  4JV5 Q;  2R93 H;  4DR3 Q;  3IL8 A;  4X64 H;  3HS0 C;  1SNO A;  3CC2 A;  3CMA A;  5J2T F;  1HRJ A;  4DUZ H;  1WTH A;  4ZYS A;  4DNT B;  1CQJ B;  3ULJ A;  2HIX A;  1K8O A;  1CHP D;  5JEA H;  4AYB G;  1UEA B;  5FK9 C;  3W1B A;  3GV7 B;  3PF5 A;  2LXJ A;  3HOV H;  4O3O A;  2BQU A;  2EXZ A;  2JSO A;  3EA6 A;  3F2C A;  3CCJ A;  2OTL A;  4H13 C;  1M1K C;  1XMQ Q;  1CKN A;  4TRD A;  5M5Y H;  4QMG A;  2A6H C;  1X54 A;  4BBS G;  2B2W C;  4UY8 C;  2K5N A;  3G71 A;  4IFD I;  4LF4 H;  1JWM D;  2D9U A;  3MVV A;  2FK1 A;  1MJC A;  4DR6 Q;  5ELB A;  2EYM A;  2PCF B;  5IGG A;  1RYR A;  2K7V A;  5I9O A;  4WBN F;  1L1O C;  2K5W A;  1HFN A;  3L4J A;  4IZ8 A;  2W70 A;  3PUV A;  4HNT A;  2R8J A;  2R7K A;  5KFD A;  3L7Z C;  3KAK A;  3K58 A;  1IBK H;  1A0I A;  2UU9 H;  1WI5 A;  1B6S A;  3RV4 A;  4DNR B;  3J80 E;  4A3B B;  5BR8 Q;  3A55 A;  4DV0 Q;  2G9D A;  3GTK B;  3TZU A;  3HZX A;  2WV6 D;  2WAQ B;  1EQV A;  3A8I E;  5KNC A;  4OON A;  3HOX H;  4J9N A;  4DR1 H;  1GOZ A;  4PG3 A;  1M4V A;  4JUZ A;  4RB1 A;  3MR6 A;  1B9M A;  3STB D;  4Q45 A;  5IOD A;  3STB C;  1YJW A;  4JI1 L;  5IWA H;  2A68 C;  4X66 Q;  3H4B A;  2ALY B;  2XGP A;  1T94 A;  2QGQ A;  5BN4 A;  3UDI A;  2VA3 A;  1X3P A;  2ASJ A;  1B44 D;  4MV8 A;  1YNJ C;  2W9C A;  1TWG B;  2F0K A;  4L63 B;  2QYZ A;  2B2Y A;  4JG2 A;  1BNZ A;  1I4R A;  4G4K A;  4DK0 A;  1E0B A;  2UXC Q;  3H91 A;  2NYZ D;  4YBZ B;  4UCT A;  3HKZ G;  2EXD A;  1M7J A;  1IW7 C;  3R8B A;  2W9B A;  4C3I H;  4H0L C;  1JB3 A;  1BOS A;  3CHB D;  4IWX A;  1G8Z D;  1B6R A;  4CHT B;  1T9H A;  2NVY B;  3UFX B;  2K04 A;  1AN8 A;  1D6E C;  3MA2 B;  1SR3 A;  2GPS A;  1VQ4 A;  2VPS A;  2KEC A;  2IW3 A;  3TIN A;  1BJT A;  3H0G A;  2BDN A;  1C9O A;  2HIV A;  1R9T H;  2JA6 B;  2KEE A;  4R4Q A;  3H0G B;  2HGS A;  3S1R H;  2K5D A;  3S1Q B;  4IJL A;  2AHO B;  4POF A;  3MXU A;  3FPU B;  2UXC H;  4ZKB B;  1SCU B;  1E1O A;  5FLM G;  5JH7 F;  1LT4 D;  1MHW C;  1UE1 A;  2Z1C A;  2A6E D;  4OHJ A;  3GTM B;  2ZDH A;  4YJ3 F;  2QCP X;  3OWE B;  2YU9 B;  2A74 C;  1K0R A;  4GC7 A;  2FK3 A;  3UE1 A;  4DAP A;  4EQP A;  1GGO A;  4DR4 L;  5JJK A;  3ONA B;  3PO2 G;  2RSO A;  4GC6 A;  4XXE A;  3TZD A;  4DR7 H;  2LS0 1;  3U4Z A;  3K7A H;  4X65 L;  3BVM A;  1XMO L;  3GTL H;  3S9W A;  1PYW D;  1TWG A;  1JCK B;  1IBM L;  3A5U A;  3K59 A;  3TBI B;  1O7I A;  4C1N K;  2VS1 A;  4ECT A;  4TQU S;  1YNN C;  3RLO A;  4NDX A;  1WD0 A;  3J7A F;  1AH9 A;  1S5B D;  2F52 A;  3ND8 A;  1E1T A;  1VQB A;  2R85 A;  1WTO A;  4KY5 A;  1ZYR C;  2K14 A;  3EFX D;  4GLV B;  1PLF A;  1YNJ D;  5C1O A;  3DEO A;  1XPU A;  2FMM A;  4R7R A;  1TVX A;  4EQ5 A;  3JSL A;  2AQ2 B;  1I3Q B;  3RLN A;  2K33 A;  3NTK A;  2LMC B;  4YCU A;  4A3D B;  2KHI A;  5KFF A;  1LLR D;  4DV6 H;  2F0J A;  3CVZ A;  4ZQI A;  1RJT A;  3GTL B;  2E2D C;  4RGN A;  2AQ1 B;  3M7G A;  5T14 A;  2JEB I;  1CQV A;  3KBG A;  4XQQ A;  2CQY A;  2JYO A;  1W93 A;  3OWF A;  2K05 A;  3QIA A;  2JJQ A;  4OEM B;  2B2W A;  1I94 Q;  1GHK A;  4LH6 A;  1CKN B;  2CVR A;  3OSO A;  4NLG A;  1STA A;  5FO9 B;  4BY7 H;  4IUN A;  5C5M A;  1JJC B;  3P1H A;  1S3O A;  4O2D A;  4ABN A;  3MEF A;  1B04 A;  1JIC A;  1HZA A;  4BY1 H;  2YZG A;  3I7F A;  2PMZ E;  1RJP A;  4MA0 A;  5KFY A;  4K0K L;  4KLK A;  2AUJ D;  3H3V I;  1DIK A;  2B2V A;  4DR3 L;  4POG A;  3NTI A;  4XTC S;  2B8F A;  1VQ7 A;  3ORQ A;  3FDT A;  1SRU A;  5D1O A;  5BPH A;  5AFW A;  1C48 A;  4K5W A;  3K57 A;  1JOQ A;  2OTJ A;  2CW7 A;  1A3U A;  5C4X B;  2PQA B;  2F0E A;  2J4X A;  2DN8 A;  1HNZ H;  2VY3 A;  1HHV A;  1EYZ A;  1D2B A;  3I56 A;  1KAW A;  4MA5 A;  3Q8R B;  2CHB D;  2WB1 G;  4LF7 L;  4J9K A;  2TMP A;  3T1Y L;  2GPW A;  4MHE A;  2C5C A;  5DGA A;  2IA6 A;  1N56 A;  2EDG A;  1VQG A;  1BCP B;  4YCW A;  2FK2 A;  2Y0S G;  1K9M C;  4DR6 L;  3QZ7 A;  2NVY A;  1FGB D;  1ZQ7 A;  2DZD A;  1PV4 A;  4DV3 H;  1JOK A;  2XCA A;  4LWC A;  3MWY W;  2JA9 A;  1SSO A;  2W9B B;  1WJJ A;  1LT5 D;  1LYL A;  3SR1 A;  4DAV A;  4RU9 A;  1R4P B;  1Y1W H;  1SEI A;  4PV1 C;  4GLX A;  1U4L A;  2NVY H;  2XVS A;  1N32 L;  4EYH B;  2QEX A;  1HNZ Q;  3AYH B;  4O3Q A;  3FMA A;  1S72 A;  3L3O C;  4NMZ A;  3G6E A;  2J6T A;  5EBC A;  1AEX A;  2TSS A;  4CKE A;  2F0D A;  5GAG C;  1BGW A;  3OIP A;  4FXG C;  3AB9 A;  4JBJ A;  5FO7 B;  2BA0 A;  5HUR A;  4IFD H;  2L5T A;  3KUP A;  2JA5 G;  1HNW L;  4F7X A;  3GTQ B;  1EWC A;  2A19 A;  1CK1 A;  5JQW A;  4FO2 A;  5KT7 A;  3AFP A;  1DYQ A;  1ET9 A;  5FLX E;  1I50 H;  3S1M B;  1XTC D;  3GIM A;  2UUC L;  3GTM H;  3N6R A;  5KRU A;  1JKJ B;  2FJ2 A;  1EY8 A;  3LWB A;  5JOB A;  3M4O B;  3KDF B;  1WTR A;  1PYS B;  2FMC A;  4X3U A;  2R82 A;  5M5W H;  4DV2 Q;  2K75 A;  2UXB L;  4ECQ A;  3N52 A;  4O1N A;  5I6Y A;  4NXM Q;  5IYZ F;  3GTO H;  3SK4 A;  3S1R B;  4AYB B;  3TQT A;  3RGZ A;  3A7L A;  1W6K A;  4DR7 Q;  4JI7 Q;  1XXG A;  4FP5 D;  3T4A C;  4C1N I;  4A3M H;  3E5N A;  1TS2 A;  4QWA A;  2B63 B;  2NU8 B;  1CSQ A;  3E3X A;  4WOR A;  4DUZ L;  3ERQ A;  1PFM A;  2W7O A;  1TS3 A;  4A3L H;  1NMF A;  3JAM i;  3I4N H;  4C5A A;  1G51 A;  3LNN A;  2ZXP A;  2QW7 A;  3TSS A;  3GIQ A;  4B3M H;  2R93 A;  3NWS A;  2R93 B;  4M8A A;  1Q12 A;  4ED8 A;  2EIF A;  3K7A B;  1B33 N;  1TR5 A;  3RB6 A;  2PBZ A;  2K4K A;  2PQA A;  1N36 H;  3ITP A;  3TME A;  2JA5 H;  4QWB A;  1EQQ A;  2YYZ A;  3CCE A;  4IRC A;  1WOC A;  4O2A F;  3KHL A;  3TDQ A;  4DL4 A;  1VBH A;  2CWP A;  4LF8 L;  5DLF A;  3T5K A;  5CMD A;  2MO0 A;  4A2A A;  3E6Z X;  3M3Y H;  2FP4 B;  4IPC A;  1JOO A;  1K83 H;  4GN5 A;  2IX3 A;  3M9O B;  4EGV A;  1Y8N B;  1NSN S;  4JI2 Q;  4RHS A;  3GTK H;  3H0G H;  2JA8 H;  1VS0 A;  3I3C A;  5K36 H;  4B3M Q;  5DGB A;  2Q8R E;  2R93 G;  1LTA D;  4B3R H;  2BA1 A;  2C35 B;  4PNY A;  5EWG A;  2F0W A;  3OUZ A;  3GTQ A;  3RNU A;  2QA4 A;  4A3K G;  1MJE A;  4JI0 L;  2DLN A;  4UFZ A;  3QO2 A;  2VQE L;  1ICW A;  2ZM6 L;  2CFM A;  3LX0 A;  2UUA L;  4DR2 L;  2N88 A;  2JQO A;  3VA5 A;  1HJP A;  4ECZ A;  2FXQ A;  4LFC Q;  4PWQ A;  2W9A A;  4JI5 H;  4ECX A;  3X3M A;  3GTO A;  4DV7 H;  2FLL A;  3S17 B;  4RHR A;  1SFO H;  1QCB D;  1Y69 U;  2R7F A;  4FVM A;  2NBF A;  1OXS C;  1KAA A;  5E3F A;  1UC8 A;  3OHB A;  1N9W A;  2MUY A;  4DL5 A;  4R8I A;  1NE3 A;  4YR0 A;  3H0G G;  5CV6 A;  1SLJ A;  1TWC A;  1VQ5 A;  4L5R C;  3EYY A;  4R8U B;  2E2H H;  1AN7 A;  3L9A X;  2HDM A;  5KG7 A;  4DUY H;  2P5Z X;  4J9L A;  2QDL A;  3I12 A;  3D31 A;  3VR3 A;  5KFP A;  1DD2 A;  1WTP A;  1PRT C;  3LP8 A;  4CC6 A;  1QB5 D;  3DXJ C;  4IZO A;  3I4O A;  5IIF A;  3SK5 A;  1YHA A;  3PW5 A;  4N8F A;  4DAY A;  2W6O A;  3S16 H;  1Z2P X;  3CQZ A;  4QIW A;  3H09 A;  4ZOL F;  5BPF A;  2GVA A;  2AWN A;  1K3R A;  3VPD A;  1IW7 D;  1M0T A;  4R8U A;  3ZYY X;  4OX9 H;  2RDG A;  2IT1 A;  3J7A 5;  4FXK C;  3J7A V;  4RZQ A;  3RB0 A;  3S1M H;  2ASB A;  4C3H H;  1PH5 A;  3R5F A;  3M9M B;  3T1Y H;  4HR7 A;  3GTQ H;  4XX0 B;  3GTG B;  4A2B A;  1KBL A;  3CC4 A;  2VL6 A;  1XNR Q;  5DQG A;  4CKB A;  4IUP A;  1ESR A;  4A3J G;  5KFJ A;  1I4X A;  1SYD A;  3MXG A;  2EPB A;  3GP7 A;  3M4Y A;  4MTN A;  4HTH A;  5IYC H;  2GLT A;  4ED0 A;  1LO5 D;  2RDH A;  4LK1 C;  5ISR A;  1VQL A;  4DK3 C;  3ERS X;  3BAB A;  1PFB A;  2VPQ A;  4CJ2 C;  2M00 A;  1I3Q A;  1EOT A;  1S5E D;  2GVB A;  3O13 A;  5DQH A;  4UCO A;  2JEI A;  1TWH H;  2DUD A;  5IT9 L;  3S1N B;  1HZB A;  3R5H A;  1C4Q A;  3MJF A;  1E7Z A;  4QWD A;  3E5S A;  1CTM A;  3UQ8 A;  4LFA L;  4QW8 A;  5KFU A;  3Q8Q B;  1VF7 A;  1PZJ D;  4KHV A;  4LJZ C;  1NR4 A;  5EPL A;  4X62 H;  4HIO A;  1TWC H;  4G7H C;  4WFN 3;  3D4D A;  4EQO A;  4DR5 L;  1S68 A;  3M9B A;  4MAM A;  1TWF A;  2RHS B;  4G57 A;  1NTG A;  4DK6 C;  4DV1 Q;  4MIU A;  5G3L F;  2F0O A;  1IBL L;  2NTT A;  3FMC A;  3J7Z C;  1GSH A;  4YR3 A;  4V19 0;  4IR9 A;  4CDF C;  4BXX G;  1HR0 Q;  1B4O A;  5EKK A;  2W6Q A;  3LWU A;  1SE2 A;  1TY0 A;  4B08 A;  1M6V A;  2ZTC A;  3X3N A;  4JI4 Q;  3FKI A;  3PQI A;  4JI2 H;  4JI8 L;  1PXU A;  4LMY A;  2NUC A;  3QR8 A;  2PW7 A;  5JPM C;  4AQY Q;  2UXD L;  1A9X A;  3V4Z A;  3Q24 A;  4HMJ A;  2XN9 C;  1A62 A;  1MBY A;  3H6M A;  3WO0 A;  1YNX A;  4TUY F;  1A6X A;  5D65 A;  2JA6 A;  1Y8O B;  3IAY A;  2YS6 A;  3K3V A;  3BZK A;  2E74 C;  5ELF A;  4Y8V B;  4C3H B;  5LHY 1;  3FVQ A;  3V6K A;  2O5I C;  5EPJ A;  4QIW B;  4I7Z C;  4UAI A;  3I4L A;  5JPN C;  1KJ9 A;  3OMC A;  5M3M H;  1BKB A;  4J8Q A;  4B9W A;  2FJZ A;  2JK8 A;  4JI6 Q;  4RB2 C;  1ZEQ X;  5DG7 A;  2M05 A;  4GNX B;  4J9S A;  1CQI B;  1EZ8 A;  1I3Q H;  1PH8 A;  4YB8 B;  1KJJ A;  1GSO A;  4DL6 A;  2C2D A;  4I7H A;  5HY6 A;  2BH2 A;  3J80 W;  4EG0 A;  3I4N B;  5J2U F;  4NXM L;  5CV4 A;  1LTT D;  1UE5 A;  1VQE A;  5D1P A;  1B3A A;  3URY A;  5A35 A;  2FIN B;  4YY3 Q;  1XNQ Q;  5IY0 A;  5EQ0 A;  3R2I A;  1SNM A;  4J9R A;  4O4L F;  2V4Q A;  2PMZ A;  4YCV A;  3T16 A;  4DL7 A;  5CA1 F;  2A69 C;  4G3I A;  4N9P A;  4DUZ Q;  1VQO A;  3BA8 A;  1SRO A;  1Z7T A;  2N78 A;  2UXD H;  4FU0 A;  1KL9 A;  2A5H A;  1HXY D;  4QB4 A;  2OWO A;  2QK4 A;  2AMC B;  3PW2 A;  4J9M A;  4EBC A;  3J81 L;  3JZI A;  3I4M B;  5FO8 B;  4LMQ D;  3MXN A;  1KJQ A;  5FLX L;  4KI0 A;  2NU7 B;  3N44 B;  4EFE A;  4JOI C;  4TQR A;  2YV5 A;  3CRK C;  3VA7 A;  1TT2 A;  4DR2 H;  4A3G G;  4YY3 H;  5DG8 A;  1VQN A;  1IL8 A;  4ZLT F;  2VQE H;  1VQP A;  5CBA E;  4DNI A;  3T1Y Q;  1GUW A;  1V8Q A;  2JA6 G;  2BOS A;  2MQH A;  4IHJ F;  1JE4 A;  3G6Y A;  4MTK A;  2F0L A;  1X6O A;  4L8J A;  3V96 A;  2R8I A;  4FXD A;  3MHB A;  2NVX H;  3KBX A;  4A3C G;  3J81 i;  1FYC A;  3FKI G;  3UDF A;  4C2M B;  1SFO A;  2VZA A;  4BY7 G;  2NN6 I;  3HKS A;  3MFI A;  3PIO A;  4NP5 A;  4A3E H;  5TSS A;  4Z9C B;  1EWI A;  4DR2 Q;  1WR2 A;  1Z2N X;  2D0O A;  1CHQ D;  4JK1 C;  5KX5 F;  3NBI A;  4ECW A;  1F77 A;  2D62 A;  2F4V L;  3RZO H;  3M9N B;  1MIU A;  1U4P A;  1YHB A;  2NZH A;  2HHH H;  2NVT H;  1QVF A;  3TS2 A;  2UVW A;  1PTO B;  4ED7 A;  2UU9 L;  1CSP A;  4OEL B;  4X62 Q;  1Q81 C;  4TQS A;  4K14 A;  4XYO A;  1NUC A;  1Z6H A;  4RNM A;  3AU7 A;  2FPI B;  3J81 W;  2I46 A;  4M1U B;  1CQF A;  1XMQ L;  5FLX W;  2OCE A;  3AMU A;  1LAC A;  2PI2 E;  3H3V H;  4JI1 H;  3DHQ A;  4AYB A;  3I4M G;  4X66 L;  2MPM A;  2Z6K C;  4JI7 L;  1IBM Q;  4RNN A;  2G9H D;  4LF5 H;  4QUF A;  5I2X A;  1K8G A;  1S5F D;  5FOB B;  4U6P A;  5CAE B;  5FD6 A;  3J7A K;  4I50 F;  4B3S Q;  5IT9 c;  3M85 A;  5KG0 A;  4R1J A;  4RKB A;  5ELE A;  2BH8 A;  3GTJ B;  1UNN C;  5C0X G;  1XMQ H;  2CCZ A;  1U5K A;  3FHW A;  1V1Q A;  1CA5 A;  3OTO L;  2SNS A;  1RHP A;  3FKI H;  2JXM B;  2E75 C;  1RJQ A;  1BDO A;  2Q2T A;  1RK6 A;  2ZJP A;  1IYU A;  4BA1 I;  4X3T A;  4LFA H;  2OF1 A;  3GTP H;  2YS7 A;  1JWU D;  2YU9 A;  2FLP A;  1S0N A;  3ULL A;  3GTM A;  1PK8 A;  3I90 A;  5IGC A;  2XC9 A;  5EZY F;  1GM5 A;  5KEE A;  1VQF A;  1A63 A;  2IP4 A;  1LTI D;  1AUX A;  5IYB G;  5LP6 F;  1NNX A;  2B2Y C;  3IKJ A;  2C9O A;  2E76 C;  4DV0 H;  1STE A;  3MR2 A;  1QNU A;  1BXT A;  4JV0 A;  1I5F A;  5LMU L;  3HOW B;  4A93 B;  5FD5 A;  4C3I G;  1T5E A;  5I2Y A;  1TXY A;  1XNQ H;  4DV4 H;  3QWN A;  3GIJ A;  4DR4 H;  4C3J H;  1FL0 A;  4IOC A;  3S2H B;  3K5H A;  3Q2O A;  5LA6 F;  4RZR A;  1GYF A;  3CQZ B;  3MWE A;  1JOR A;  3CRL C;  3PSI A;  2UUA Q;  3TQY A;  3PUZ A;  5IT9 W;  1TU2 B;  2KEN A;  3Q1K A;  1F2Y A;  3PW4 A;  1ML0 D;  1UC9 A;  1BO0 A;  1Q7Y C;  4ZKC B;  1IYV A;  1Z9F A;  3J80 L;  5BR8 L;  2YW2 A;  3IRB A;  3S1Q H;  2W9C B;  5KT2 A;  3J81 E;  1I94 H;  1KQS A;  1RK5 A;  1SYX B;  4L5T A;  1L0W A;  2JP1 A;  5GRO A;  4Q0Y A;  1WFQ A;  5M5X B;  4K0K H;  4A75 A;  4ZCK A;  4DV5 Q;  4CGY B;  1ENA A;  3DMU A;  4JBK A;  1X3Q A;  2LSS A;  1VKZ A;  3GTK A;  4A3C H;  2Z4I A;  1Y14 B;  2OQK A;  4YHH Q;  1GXD C;  1EY9 A;  1SEB D;  1MSH A;  2IPK D;  2X69 A;  3GTO B;  3HKZ A;  3D3R A;  1CT1 D;  1Q82 C;  2YZN A;  3PO2 B;  4A3M G;  3HOY H;  2ATW A;  3A8K E;  2ENB A;  5CYU A;  1IOW A;  4YWL A;  3RB4 A;  2EYF A;  1B70 B;  4A3E B;  2D5D A;  4ZI7 F;  4PDB A;  4KK7 A;  1TWG H;  3HFZ B;  1O7Y A;  5BR8 H;  2X6L A;  2EJM A;  1H9S A;  3HOW G;  4K0K Q;  4A93 G;  3CF5 A;  4Q8F A;  2NVX B;  5DLQ E;  1DOK A;  4R4O A;  5KNB A;  2VUM G;  1MSG A;  2AUK A;  2IX0 A;  4B3T H;  1IZ6 A;  1H9J A;  3VYR A;  3M7N A;  1H9M A;  4RAZ A;  1NY4 A;  4EEY A;  4KN7 C;  3R23 A;  4JI6 L;  3W3A A;  2UUC Q;  5D8D A;  3MZ5 A;  2EYO A;  2A69 D;  2R6G A;  1LTG D;  5KYL A;  1L2Z A;  3KLR A;  1PX2 A;  3A8J E;  1DJR D;  4WJ4 A;  3HEJ A;  3G8C A;  5KFV A;  3KYH C;  1GO3 E;  4TV8 F;  1VF5 C;  1BCP D;  1HNX L;  4O4H F;  2VQF Q;  3L4K A;  1PTO H;  1SYE A;  2PNH A;  1QIL A;  2O03 A;  2NUA B;  3VR6 A;  1I6U A;  3NP8 A;  5CB4 F;  5CC4 A;  1GD7 A;  4HNU A;  2F0N A;  1PMR A;  5JEA J;  3UI2 A;  4L1K A;  2E2J H;  2E5L H;  1OXX K;  5F9N A;  1TWA H;  2RQX A;  1EEI D;  3KF6 A;  4OX9 L;  2QEJ C;  2K5V A;  1Q3L A;  4F4Y A;  2EJG C;  3I4N G;  2FFK B;  4ZAI A;  2UUB H;  4J9P A;  2UUC H;  1ET6 A;  2ICI A;  1YI2 A;  1BBX C;  4O3S A;  1X32 A;  4A3G B;  4UHV A;  4ZK9 B;  2ATL A;  1F2M A;  5IGB A;  1N34 H;  3OHA A;  2RF4 A;  3I70 A;  3JC6 6;  3WOF A;  1KLG D;  4XYQ A;  1YIT A;  2WP8 J;  4K8J A;  1X56 A;  3KLS A;  2RVL A;  1T36 A;  3RFC A;  3ER0 A;  4MV7 A;  3H3V C;  1VQA A;  3M4P A;  3DF7 A;  4JW0 A;  2AQ3 B;  1RKN A;  1IYJ B;  5L1L A;  5JVD F;  1N33 L;  4JI8 Q;  5M9O A;  1BUV T;  1JC7 A;  2R6F A;  4KN4 C;  1TY2 A;  4ECV A;  4IUR A;  2I5L X;  1BBU A;  1GLV A;  4BY1 G;  3SE0 A;  1IBL H;  2G5D A;  3Q0A A;  1J5E L;  1Y1W G;  4A3K H;  4QWE A;  2F0V A;  5KG3 A;  4DR5 H;  1XWE A;  5D3D A;  2EJF C;  5L37 A;  2LY7 A;  3JAM W;  1G6Z A;  1ZHS A;  2B2U C;  4OWT B;  1B2T A;  1WD1 A;  3K7U C;  1C8C A;  2WAQ A;  2ZM6 H;  3DLL A;  4XZ3 B;  3RR5 A;  3U4V A;  2P0A A;  5I6W A;  3BJU A;  2MNA A;  3CPF A;  1KNA A;  4LFC L;  3RB3 A;  3K0Y A;  4GKJ L;  3OIQ A;  3CCV A;  4U67 3;  2ZT9 C;  1I6V C;  1CZG A;  4X3K A;  4MV9 A;  2XCP A;  1N48 A;  4JI6 H;  2UU9 Q;  2HUG A;  3BJY A;  1SDF A;  2SEB D;  3KLW A;  3QOL A;  4A3F B;  4H02 A;  3ULP A;  1XX8 A;  5L9X A;  1ROD A;  1I50 A;  4XYL B;  5CGK A;  3PMF A;  2DNE A;  4OO1 H;  4Q43 A;  5A2Q E;  1B3Q A;  1M0W A;  1VBG A;  3S2D H;  3HB9 A;  2E5L L;  4PQX A;  4DXG A;  3K5O A;  3S14 B;  1JDE A;  2J6U A;  2DNC A;  3HGB A;  3UE0 A;  4U68 A;  4KTA A;  2F4V H;  4DR3 H;  2E2I A;  2VXW A;  5D1O B;  1G91 A;  4FBT A;  2K5H A;  1SNP A;  5CR3 A;  1JJ2 A;  2VUG A;  3TP7 A;  2V58 A;  3GIL A;  1ILQ A;  1QZH A;  4ZQ3 A;  1XPO A;  1AFP A;  2W7P A;  1TWH B;  4I4T F;  1OXV A;  2XGT A;  1STN A;  1HNZ L;  1LM0 A;  3WNZ A;  3KHH A;  4YP3 A;  1V51 A;  3EIV A;  5IP7 H;  2PZT A;  1JXL A;  3RUZ A;  2L12 A;  4EFB A;  4KY7 A;  3BQ0 A;  2KCC A;  2EYJ A;  4P72 A;  1T5X D;  3PUW A;  4DUY Q;  3JSN A;  2C2R A;  4IUQ A;  2WB1 A;  2IL8 A;  2EY5 A;  2Z6B A;  4KHZ A;  4LW1 A;  3GTL A;  5HV6 A;  3VPB A;  4F8M A;  1BCP C;  1XNR L;  1XDN A;  4YHH L;  2N49 A;  4KHP L;  5KFN A;  1VQH A;  1QJO A;  2XWJ B;  1ENF A;  5K36 G;  1SYC A;  1W3S A;  3GO5 A;  4LF9 Q;  4DV3 Q;  2V5A A;  5C4J B;  3TS0 A;  3MFH A;  2I5M X;  5K5P A;  2VOB A;  3S14 H;  2NTS A;  4CDC C;  2LXK A;  1KRS A;  1SN8 A;  4DL3 A;  4P2C B;  3UDX A;  5C44 B;  3S16 B;  2KVM A;  2HCC A;  3U50 C;  4LFB H;  2E2J B;  3K5L A;  3WO1 A;  2R92 B;  5EOY A;  1U4M A;  5IWA Q;  2VW9 A;  1OXT A;  1O78 A;  3BDL A;  2BE5 C;  3V6J A;  2BE5 D;  4ME6 A;  3GV5 B;  5F9L A;  1E4F T;  2W6M A;  4M9U A;  1S0M A;  1N32 H;  4ME5 A;  2CZG A;  3FP9 A;  2B63 G;  1GVP A;  4BS9 A;  2WDT A;  4FDB A;  1KLU D;  3CXC A;  1WVL A;  4K2K A;  4QGU A;  1OWT A;  2K01 A;  4I7A A;  5C3E G;  1L1O B;  4RNO A;  4J9O A;  1VCI A;  3V2T A;  3VYT A;  1FJG H;  4P74 A;  1D5X C;  3PUY A;  4C3H G;  2J7Z A;  2F0F A;  5KYI A;  4JI2 L;  5D3I B;  4IOA A;  4QQB X;  2J6S A;  2NVQ H;  3RGX A;  1DV1 A;  2PNR C;  5JVL A;  2PO4 A;  2CKZ B;  1KJ8 A;  4RAY A;  2DIK A;  1Q8K A;  4GZY C;  4HYK A;  3HP3 A;  5JEA G;  1IBK L;  1I7L A;  2I5H A;  3GLK A;  3KJP A;  3OTO Q;  5KG4 A;  4QJF A;  2ZM6 Q;  2GN5 A;  4UPA A;  3NE5 B;  4LUV A;  1KDC A;  4S3S A;  4UP9 A;  1A8V A;  2IHF A;  4RKL A;  5LL6 S;  4DGZ A;  3HOV G;  2JA7 A;  4A3M B;  2PYK A;  2KBN A;  2W57 A;  2FLN A;  4LFA Q;  1HQM C;  2MHV A;  2YRX A;  3TRZ A;  2MCT A;  1VMP A;  2Y0S B;  1RL2 A;  5E4X A;  1CUK A;  2NN6 G;  1N33 Q;  1FNV A;  4ED6 A;  1WCM A;  1P16 A;  1JMC A;  2QIL A;  2FE3 A;  5KIX A;  2R86 A;  4LSX A;  2AGQ A;  5EWE A;  4B3R Q;  2N3S A;  3KXY T;  1HPC A;  4UP7 A;  2PQE A;  1QUQ B;  5G3L D;  1A2U A;  1TWA B;  4DV4 Q;  3PO2 H;  2R8H A;  4UP8 A;  1XMO Q;  4RMF A;  1I4P A;  3PW0 A;  5KG1 A;  1PYB A;  5M3M G;  4U7C A;  1LTL A;  1EQR A;  5C44 G;  4NPS A;  4V0B A;  3VR2 A;  3NPP A;  3BQ2 A;  1KXL A;  4LSA A;  5LL6 b;  5IP7 G;  1Y8P B;  2XWB B;  4RGM A;  4JI5 Q;  3K8A A;  3F8N A;  2IHE A;  1EU3 A;  4A3E G;  3U9T A;  5LOV F;  2AQ4 A;  2AKW B;  1C30 A;  4APV A;  3RN2 A;  5C4Z A;  2YTV A;  1IXR A;  4ED2 A;  1XPR A;  2KCM A;  1KHI A;  2DJG C;  3I8Z A;  2FPG B;  2ES2 A;  4RA8 A;  2VUM B;  5LYJ F;  3GTP A;  4IR1 A;  1CA6 A;  2RCF A;  3PW7 A;  3M3Y B;  1DV2 A;  2W6P A;  1R4Q B;  5KND A;  4DV5 H;  2BDO A;  2F03 A;  1PH9 A;  2AWO A;  3TP8 A;  1FJG L;  3Q8D A;  1PRT B;  3LML A;  3RTX A;  2WAQ G;  1OXU A;  3VR5 A;  3S15 B;  4APM A;  2HQE A;  2R92 A;  3W2D A;  2UUB L;  1ASZ A;  1EOV A;  2H5X A;  2A8V A;  3CQZ H;  3D6W A;  2XD4 A;  1VMC A;  3GTJ H;  5JJI A;  1ULZ A;  4NXM H;  3DWP A;  1J5E H;  3G7L A;  3HXL A;  5EKL A;  1O7L A;  1EU4 A;  3RAQ A;  1OTC A;  1LTB D;  3BDO A;  3DWA A;  3JAM L;  2Q2I A;  5E4W C;  5C4X H;  3CCS A;  2CW0 C;  3K80 C;  3TP5 A;  3FDS A;  5I4D A;  4GOP A;  4BY1 B;  3OOC A;  4Q8E A;  3J81 j;  4O2B F;  2PZU A;  4RGT A;  4R9W A;  1LT6 D;  3K0X A;  4MN3 A;  2RBM A;  2K28 A;  3T5H A;  4LF6 H;  1RCV D;  5FJ8 H;  4DUY L;  1J6Q A;  1F9P A;  3L2P A;  4GOP B;  2M9V A;  1K83 A;  4N8X 1;  1BBW A;  4ECS A;  3HOY G;  2F0I A;  3WDN A;  1QVC A;  4C3J B;  1LUZ A;  2ZXR A;  3S2H H;  2F0P A;  4L5Q A;  1PRT F;  1HFG A;  4JC0 A;  4XDX A;  2EQS A;  4O3P A;  4R4T A;  4MZ9 A;  2E5L Q;  4CJ0 B;  1IKM A;  4OIJ A;  3J80 i;  2W8K A;  2W6N A;  1WYD A;  1ONL A;  1YIJ A;  4DF7 A;  1XYI A;  4LFB L;  1V43 A;  3F1Z A;  5EPK A;  4F50 A;  4HSV A;  4NXN H;  5C6A A;  2R7Z G;  3K5M A;  1JE5 A;  5I47 A;  2ZJQ A;  1Y1W B;  1LAB A;  4XT1 B;  4O4I F;  3GTP B;  2NU6 B;  2N8N A;  4FF2 A;  2B63 H;  2DGY A;  1ESF A;  1E4E A;  3N8D A;  3V05 A;  1LTR D;  2R7Z B;  2E2H A;  1I4H A;  3KF8 A;  5KFI A;  4K8I A;  4LF4 Q;  1AUV A;  1SMY D;  1S40 A;  1PZK D;  2ASD A;  3NBH B;  1EWH A;  1Q90 A;  5T1G A;  5KFR A;  5GAH C;  5GQO A;  4AIM A;  1HNW Q;  4AYB E;  4IAJ A;  5H80 A;  4J6H A;  1MI2 A;  4J0M A;  4F87 A;  3PCO B;  5DM7 3;  1SJE D;  4X62 L;  2HVR A;  5M5Y B;  4LF5 Q;  1C3O A;  3F2D A;  4KJN A;  1KDA A;  3MR5 A;  5DG9 A;  3A0J A;  3OW7 A;  1AE2 A;  5C4J H;  2Q8T A;  1ZXT A;  3J7Y W;  3NUC A;  4C5C A;  4JI8 H;  2R7Z A;  3HRZ C;  3J81 c;  4DU9 A;  2NB0 A;  3DM3 A;  4RG1 A;  4DR1 L;  3HOY B;  1D7Q A;  2JEA I;  3PF4 A;  1NR2 A;  3RBE A;  4GOP C;  4XIG S;  2B29 A;  1AZQ A;  1YJN A;  2ZJT A;  1WTW A;  4X66 H;  1LT3 D;  1CM9 A;  2WAC A;  2SDF A;  1EY4 A;  4X6A H;  3R93 A;  4TVA B;  5FPR A;  3GII A;  1HA5 A;  2XSC A;  2PPB C;  1QZG A;  2X6G A;  1J8I A;  4X64 L;  3E0J A;  4HJA A;  2B2T C;  4OL7 A;  3KAL A;  5KFA A;  4E6I A;  2IBK A;  3JAM E;  4EBE A;  3HOX G;  1G29 1;  1Y1V G;  2KOL A;  5IWA L;  1DZ1 A;  2OH2 A;  4BY7 B;  4XQJ A;  1F9R A;  3GIP A;  3MC0 B;  3HBL A;  3WWV A;  1QOH A;  3RZO B;  3GQB A;  1GKH A;  4RH6 A;  2SNM A;  5M3M B;  5C0X H;  4MV4 A;  1Z47 A;  2F0U A;  1Z2O X;  5KFE A;  1O75 A;  5E7N A;  1RTN A;  1EIF A;  2F0Q A;  5AJ3 L;  3SGI A;  3OW2 A;  4F88 A;  1GHJ A;  2R61 A;  5EAY A;  1I6H B;  2V4R A;  3GIK A;  2I8C A;  2B39 A;  3BDC A;  3GDE A;  3JRW A;  2JA5 A;  5JUM A;  4DV4 L;  4O42 A;  2I07 B;  4HAE A;  1K3B C;  4H44 C;  2UUA H;  1ZYR D;  2CH4 W;  3PV0 A;  4BWG B;  5IOC A;  4JBM A;  4YQW A;  1GUN A;  3EJI A;  2CW8 A;  4HIK A;  1Y1V B;  4ME3 A;  3S1N H;  4LFC H;  1EZ6 A;  4A3B H;  1L1O A;  4B3S L;  3PUX A;  5KG5 A;  2YL2 A;  5L1K A;  5LMU H;  4DV7 Q;  2KCN A;  2K1B A;  4DA2 A;  1L0Y B;  4DFA A;  3SEB A;  1UE7 A;  5DEH A;  4JI3 H;  2PW5 A;  4FS1 A;  2VA2 A;  1E2W A;  3VMM A;  3CCL A;  1VQ6 A;  1MZB A;  2OEO A;  3SI8 A;  2K50 A;  2A6H D;  5LMN W;  2HT1 A;  3BG5 A;  3N42 B;  2R7M A;  1YEZ A;  3VYU A;  4X3S A;  4DV1 H;  2KSW A;  4WRD A;  4KHP Q;  4A3D H;  4TSS A;  4KKS A;  1H95 A;  1VQC A;  1UWV A;  3RMH A;  4LF9 L;  5LMU Q;  4B3R L;  1WH2 A;  3QG1 A;  5EBD A;  1WTQ A;  1HR0 H;  3KTM A;  2PI2 A;  1JIH A;  1Y1V A;  3T56 B;  3ETJ A;  5ELO A;  5J22 A;  2EYL A;  1X3F A;  5LMN H;  1S03 G;  4BBS B;  4RWS C;  5IYC G;  2RGR A;  4OX9 Q;  1S97 A;  4QIW E;  1R9T B;  3NHH A;  4NXN Q;  1TWA A;  5KFH A;  3GTG H;  2KHJ A;  4C3I B;  4MV1 A;  3R3O A;  1JX4 A;  1GJX A;  1VQD A;  2NZ1 D;  4JI5 L;  4IWY A;  3GV3 A;  4WJ3 M;  2F0M A;  5GAE C;  4GKK Q;  1R9T A;  4CC5 A;  2D2C C;  4IFD G;  1WCM B;  5BN3 A;  1YBY A;  3VDY A;  4KD4 A;  1MD2 D;  2Y0S A;  1JR0 D;  2R87 A;  3M4Q A;  1FGU A;  3HOU H;  4LF6 L;  2V59 A;  5C1P A;  2HHH L;  1L2F A;  2NU9 B;  1V1P B;  4ED3 A;  1BXR A;  2Q8I B;  4LF7 Q;  4IQZ A;  2L1B A;  1FJG Q;  1W6J A;  1K0S A;  1DOM A;  4WD3 A;  5JAV A;  5LMN L;  1I4G A;  3PZP A;  2L11 A;  1VAJ A;  4LAA A;  1EIY B;  3HOW H;  1C7Y A;  2UUB Q;  1XTD A;  4A93 H;  4EBD A;  3QB3 A;  4RUC A;  1S5D D;  1U4R A;  2WIN B;  4KJO A;  2ALZ A;  1AZP A;  4BBR B;  1PVO A;  4FF3 A;  2K5Q A;  3NQI A;  1N36 L;  4JV2 A;  1FVI A;  1HNX H;  4GKK H;  1CKO A;  3CP0 A;  1SE3 A;  2EYH A;  3BU2 A;  3KK7 A;  1A3T A;  3DWQ A;  1V9P A;  1LTS D;  1KIX A;  4LF8 H;  1D1K A;  1VQI A;  1ZHQ A;  3RIZ A;  2IX1 A;  1EFI D;  5F2D A;  1EY6 A;  4GKJ Q;  5C44 H;  5A2Q W;  1EZ1 A;  4OWW B;  3TN2 A;  1CE8 A;  3V4S A;  3FEW X;  1X3G A;  4RB0 A;  1F9Q A;  3QOJ A;  3F2B A;  1JB7 A;  1A15 A;  4QCL A;  3CCR A;  2JEG A;  4KMU C;  4PMB A;  5H1S E;  1D5M C;  1IBL Q;  3F8T A;  2B2U A;  2FPP B;  1EEF D;  1YVC A;  1HNX Q;  4DV2 L;  1A3V A;  1TQO A;  2JA5 B;  2V1C C;  1HR0 L;  1KC7 A;  4TV9 F;  4RCN A;  1K28 A;  4RCO A;  1KD1 C;  3P75 A;  3SK6 A;  2L4N A;  4BBR H;  4B3T Q;  5JJZ A;  2R7L A;  3JRX A;  1EQT A;  4ZUJ A;  1EUJ A;  5M3F B;  3G48 A;  2HVS A;  4GKJ H;  4X64 Q;  2QF7 A;  4QUC A;  3PIO 3;  1SYG A;  2F3V A;  1O80 A;  2B2T A;  3DM1 A;  1MGS A;  4HQ6 A;  1O7Z A;  2LFN A;  4RAU C;  4GNX C;  2R3Z A;  1NCV A;  2MP1 A;  1C0A A;  3QFF A;  1XJV A;  3CU7 A;  1RTO A;  4ECY A;  2B8G A;  2F0S A;  3MEH A;  4P75 A;  2HD3 A;  4X65 H;  1CS0 A;  4JV5 L;  5JJL A;  4HMI A;  2BQ3 A;  1WCM H;  2WB1 E;  1KJI A;  2WB1 B;  3ERO A;  3BVG A;  5KFM A;  2K52 A;  3S24 A;  1KNE A;  5IGD A;  3S2D B;  4UDU C;  3K5I A;  1VQ9 A;  3KF6 B;  3T1H L;  4MNO A;  4OO1 I;  2QDB A;  3ZJY C;  3OMG A;  5A2Q L;  4NB3 A;  4IUU A;  1Q1E A;  2E8G A;  4ZUI A;  5KFX A;  1SYB A;  3IFD A;  4HIM A;  4EGJ A;  1IHZ A;  2EYP A;  3I73 A;  1N34 Q;  2OXP A;  2NWG A;  2XIG A;  3T5J A;  4IPG A;  4YR2 A;  3A7A B;  2LKV A;  1VQJ A;  2RHQ B;  3TRE A;  1J5E Q;  2QKI C;  3P20 A;  2I0Q A;  4YY3 L;  4JCV E;  1PTO F;  3M4I A;  1HZ9 A;  4RB3 C;  4K2L A;  2F0G A;  4L5S A;  1ICF B;  3NBH A;  1B50 A;  1RD9 D;  3KHR A;  4A3J B;  1IBM H;  2E2I B;  4A3F H;  3N43 B;  4HJ5 A;  1D1I A;  3KF8 B;  4GLA C;  3CW2 C;  1PDQ A;  1EFW A;  4QL5 A;  1DOL A;  4IRK A;  5CV9 A;  5IP9 G;  4JYA Q;  3RUP A;  4A3K B;  3RZD B;  3B6Y A;  5ELN A;  4KV6 A;  1ZKO A;  4AH6 A;  4BXX H;  1L0X B;  2RDI A;  3MXP A;  3M4O H;  3A54 A;  4IUT A;  2EZV A;  5FPO A;  5I9P A;  2WAQ E;  5KG6 A;  4A4I A;  4DAM A;  1I50 B;  3KFU A;  4PZ8 A;  1J9O A;  2XIW A;  3U58 A;  4ZRZ A;  1SNC A;  5HGT A;  3EPI A;  2BR0 A;  2HDL A;  3RAX A;  4JV5 H;  1W96 A;  2OLS A;  2ZJR A;  5IYD G;  1K8A C;  2JA7 G;  5C4X G;  3BVZ A;  4J15 A;  2NZO A;  1STG A;  3CCU A;  5KFL A;  4OXP A;  3SHL A;  5GAD C;  4DV6 L;  1SXT A;  2WYO A;  3TII A;  3K5N A;  5KT3 A;  1SMY C;  4TKO B;  1E2Z A;  2YYA A;  4Y7N B;  4K6D A;  4QY7 A;  3Q6S A;  4JV1 A;  1NBW A;  3PO3 B;  2IMW P;  2F4I A;  5J1Z A;  5EJW A;  1RF2 D;  1UAP A;  1N8R C;  4I65 A;  4EX5 A;  3G4S A;  1E3P A;  1VQM A;  5BMV F;  4FYD A;  3N6X A;  5JVH 3;  5IP9 H;  1PTO C;  3ND9 A;  4ULL A;  1TII D;  4FF1 A;  3A56 A;  2MO1 A;  5IYB H;  1GUS A;  4XYM B;  2F4V Q;  4KKT A;  5C8Y F;  2EY6 A;  5EWF A;  2MFI A;  3JAM c;  3Q22 A;  2VB2 X;  5KFW A;  2JA7 B;  3CCM A;  1I6H H;  5CBE E;  5C3E B;  1QE6 A;  5KFK A;  1S5C D;  4PZ7 A;  1H9R A;  5FJ8 G;  4DL2 A;  4ILW A;  3L0O A;  1PFN A;  4OGQ C;  2XGQ A;  3N40 P;  3BAA A;  4J9Q A;  4CKC A;  5KT6 A;  4A3I G;  4NW2 A;  2R7D A;  4ZHQ F;  1YZ6 A;  1PH6 A;  1MKH A;  4FNF A;  1I94 L;  4DR1 Q;  2UVV A;  4HSP A;  5KFB A;  1PH7 A;  3E9I A;  4BBS H;  4FM9 A;  1LV9 A;  5ELC A;  1TS5 A;  1RYS A;  4N9T A;  1BF4 A;  2MJ8 A;  3CD6 A;  3FKI B;  5KFZ A;  1CZW A;  5C5L A;  2KED A;  4ECR A;  1B9N A;  3BA9 A;  4ECU A;  5M3F G;  3MAQ A;  2C22 A;  1T3N A;  3D4W A;  3MWD A;  3EQL C;  4R4C A;  5DAU A;  1S10 A;  5IE8 A;  2SCU B;  3RZD H;  2EOT A;  2EE1 A;  2K03 A;  3C1E A;  3C2P A;  2PVP A;  2O4X A;  4DV0 L;  2PZW A;  3CME A;  1I4Q A;  4ETS A;  1BR9 A;  1KRT A;  2C00 A;  3TP6 A;  4LUZ A;  4DR4 Q;  2A1A A;  4JOI A;  2HQL A;  2NVX A;  4MV6 A;  3NWT A;  5KFQ A;  1Y1V H;  4RUA A;  1HCZ A;  3KLS X;  4CBV A;  1AW7 A;  3NGD A;  1B53 A;  5K2M A;  4A3D G;  3IG0 A;  5FLM H;  2DPI A;  4QWC A;  3QZ8 A;  3CAM A;  4O0A A;  1HTL D;  2KUM A;  3GV8 B;  5D14 A;  2VNU D;  4OIK A;  2OQ0 A;  1M8A A;  1D8L A;  1GUO A;  4XT3 B;  5CV5 A;  1JT8 A;  2FB9 A;  4JI3 Q;  1PFS A;  1GUG A;  5DNF A;  4A3G H;  4JI4 H;  3IFT A;  1GSA A;  3SVM A;  4DLK A;  4GN4 B;  4LNQ A;  4HR7 B;  3TIG A;  1NJI C;  1SNQ A;  2VR1 A;  4DK1 A;  1VDZ A; 
#chains in the Genus database with same CATH homology
 3BZC A;  1BBW A;  3CPW A;  3HOY G;  1E1O A;  5FLM G;  1N34 L;  1UE1 A;  1QVC A;  2UXB Q;  5HGQ A;  1NMG A;  3S2H H;  1LUZ A;  1XMQ L;  1K0R A;  2OCE A;  2PI2 E;  4L5Q A;  4JC0 A;  4DV5 L;  3H3V H;  4POF A;  3UE1 A;  3I4M G;  2EQS A;  4X66 L;  4DR4 L;  5JJK A;  4R4T A;  1HR0 W;  5M3F H;  3PO2 G;  4MZ9 A;  2E5L Q;  2WFW A;  3U4Z A;  3K7A H;  4X65 L;  3J80 i;  2Z6K C;  1WYD A;  1XMO L;  3GTL H;  4JI7 L;  1W2B A;  1YIJ A;  1IBM Q;  4LFB Q;  1IBM L;  3A5U A;  1V43 A;  3F1Z A;  3CCQ A;  1K8G A;  4LFB L;  1O7I A;  2VS1 A;  3I2Z A;  4TQU S;  2R7Z G;  3RLO A;  1JE5 A;  2ZJQ A;  4B3S Q;  1AH9 A;  5IT9 c;  2F52 A;  3M85 A;  4R1J A;  1X3E A;  2BH8 A;  4BBR G;  5C0X G;  2N8N A;  3ICE A;  2B63 H;  1E1T A;  1K73 C;  1VQB A;  2DGY A;  1U5K A;  3FHW A;  1PH2 A;  2CCZ A;  1V1Q A;  3W1G A;  1N32 Q;  3AFQ A;  3OTO L;  3PO3 G;  2K14 A;  4GLV B;  3FKI H;  3MXN B;  4ALP A;  2Q2T A;  4LF4 Q;  2ZJP A;  2YTY A;  1XPU A;  2R7Z H;  1S40 A;  4EQ5 A;  1ASY A;  3NBH B;  3RLN A;  4IFD J;  5GAH C;  5GQO A;  4AIM A;  4BA1 I;  4AYB E;  4YCU A;  1X55 A;  4A3J H;  1HNW Q;  3GTP H;  2KHI A;  1PH4 A;  3ULL A;  3PCO B;  2JA6 H;  4X62 L;  4LF5 Q;  1GM5 A;  3F2D A;  1VQF A;  1A63 A;  3A0J A;  4HJ7 A;  1AE2 A;  5C4J H;  2JEB I;  5IYB G;  3J81 c;  2KCT A;  3DM3 A;  4RG1 A;  4DR1 L;  4DPG A;  1D7Q A;  2JEA I;  2JJQ A;  1I94 Q;  3PF4 A;  1I5F A;  5LMU L;  4GOP C;  1CKN B;  2B29 A;  4XIG S;  3KOJ A;  4HJ8 A;  1YJN A;  4BY7 H;  1N36 Q;  1TXY A;  1JJC B;  1HH2 P;  1S3O A;  2R92 G;  4O2D A;  1FL0 A;  4C3J H;  2VQE Q;  4IOC A;  4X6A H;  3MEF A;  4TVA B;  4A3B G;  1HZA A;  4BY1 H;  3HOU G;  3I7F A;  2PMZ E;  1QZG A;  4K0K L;  3PSI A;  3I55 A;  4X64 L;  4HJA A;  2UUA Q;  4KLK A;  3TQY A;  1Q86 C;  3H3V I;  3PUZ A;  4DR3 L;  4POG A;  2KEN A;  3S15 H;  3HOX G;  1G29 1;  1Y1V G;  4XTC S;  5IWA L;  1VQ7 A;  4HJ9 A;  2IY5 B;  1SRU A;  3WWV A;  4JYA L;  1Q7Y C;  1GKH A;  2OTJ A;  1Z9F A;  3TEH B;  1Z47 A;  2VUM H;  2PQA B;  5BR8 L;  3IRB A;  3S1Q H;  5E7N A;  1EIF A;  5AJ3 L;  3OW2 A;  3SGI A;  2VY3 A;  1KQS A;  4L5T A;  5EAY A;  1L0W A;  4A76 A;  5GRO A;  3I56 A;  1WFQ A;  1KAW A;  4A75 A;  4DV5 Q;  2WB1 G;  3GDE A;  4LF7 L;  3T1Y L;  4DV4 L;  4JBK A;  2LSS A;  4A3C H;  4B3T L;  1HZC A;  1VQG A;  1Y14 B;  2OQK A;  3PV0 A;  4YCW A;  2Y0S G;  4YHH Q;  1K9M C;  4DR6 L;  4JBM A;  4HIK A;  4ME3 A;  3S1N H;  1PV4 A;  4B3M L;  1L1O A;  4LWC A;  1Q82 C;  4B3S L;  2JA9 A;  4A3B H;  3S17 H;  4A3M G;  3HOY H;  1UE6 A;  2ATW A;  3PUX A;  1WJJ A;  1LYL A;  2B3G A;  4PMW A;  4DV7 Q;  4YWL A;  1X65 A;  1Y1W H;  1B70 B;  4GLX A;  1N32 L;  2NVY H;  4Y52 H;  2QEX A;  1TWG H;  1HNZ Q;  1UE7 A;  3AYH B;  3HFZ B;  4YWK A;  1PH1 A;  1S72 A;  3NEL A;  3G6E A;  3KDF A;  2Q2U A;  4IO9 A;  2JA8 G;  3HOW G;  4K0K Q;  3CCL A;  5GAG C;  3CF5 A;  1VQ6 A;  4A93 G;  4JBJ A;  1QUQ A;  2BA0 A;  5DLQ E;  2K50 A;  4R4O A;  2VUM G;  3KJO A;  2JA5 G;  1HNW L;  1SE8 A;  2IX0 A;  2A19 A;  5LMN W;  2HT1 A;  1IZ6 A;  1QVG A;  3M7N A;  3AFP A;  1NY4 A;  1YEZ A;  1I50 H;  2CQO A;  2UUC Q;  3T1H Q;  4JI6 L;  2UUC L;  2R6G A;  3GTM H;  1PA6 A;  4GS3 A;  2YTX A;  3KDF B;  4WJ4 A;  1PYS B;  4KHP Q;  4A3D H;  3KYH C;  1GO3 E;  3W5O A;  1VQC A;  5M5W H;  4DV2 Q;  2K75 A;  2UXB L;  1UWV A;  1H95 A;  3E9H A;  4LF9 L;  1HNX L;  5LMU Q;  4OO1 G;  4NXM Q;  2VQF Q;  3GTO H;  4B3R L;  2PNH A;  4OWX B;  2PI2 A;  1PH3 A;  1GD7 A;  5ELO A;  5JEA J;  3LGJ A;  1X3F A;  4DR7 Q;  2E2J H;  4GN3 B;  4JI7 Q;  4A3M H;  1OXX K;  4JI3 L;  4BA2 I;  2ZTD A;  3NEM A;  1TWA H;  1CSQ A;  5IYC G;  4OX9 Q;  4DUZ L;  3K81 C;  4QIW E;  3KF6 A;  4OX9 L;  2K5V A;  4A3L H;  4NXN Q;  1NMF A;  3I4N G;  2XTI A;  3JAM i;  3I4N H;  1G51 A;  3GTG H;  2KHJ A;  1X9N A;  1B8A A;  1VQD A;  1SMX A;  4JI5 L;  1Q12 A;  1YI2 A;  2JE6 I;  2EIF A;  1M90 C;  4WJ3 M;  2Y0S E;  2K4K A;  5GAE C;  2PQA A;  1EYG A;  4GKK Q;  2JA5 H;  4IFD G;  4IJH A;  1EQQ A;  2RF4 A;  4DV1 L;  2YYZ A;  2D0P A;  1B7Y B;  5AJ3 Q;  3CCE A;  3JC6 6;  1WOC A;  1YBY A;  4LUO A;  4GNX A;  3VDY A;  2CWA A;  4LF4 L;  4Y7N H;  2CWP A;  1YIT A;  2WP8 J;  3M4Q A;  1X56 A;  4LF8 L;  1FGU A;  4JI1 Q;  3HOU H;  4A3F G;  4LF6 L;  2HHH L;  1L2F A;  2MO0 A;  3M3Y H;  4LF7 Q;  4IPC A;  3ER0 A;  4GN5 A;  1K83 H;  4DV6 Q;  1FJG Q;  4LF5 L;  1VQA A;  3M4P A;  3NEN A;  4JI2 Q;  5LMN L;  1IYJ B;  3GTK H;  1N33 L;  3H0G H;  4JI8 Q;  2F3I A;  5C3E H;  2JA8 H;  1EIY B;  3HOW H;  4DV3 L;  1VS0 A;  1XTD A;  1C7Y A;  2UUB Q;  4A93 H;  2I5L X;  1BBU A;  4B3M Q;  4BY1 G;  2R93 G;  2BA1 A;  2C35 B;  1PVO A;  1N36 L;  1J5E L;  1FVI A;  1Y1W G;  4DV7 L;  1CKO A;  3CP0 A;  3RNU A;  4A3K H;  2QA4 A;  4A3K G;  1MJE A;  4JI0 L;  3BU2 A;  4OWT B;  2VQE L;  3I4M H;  3K7U C;  2ZM6 L;  1V9P A;  4C2M H;  3DLL A;  2CFM A;  1KIX A;  2ZTE A;  3RR5 A;  3U4V A;  2UUA L;  4DR2 L;  1VQI A;  3UDG A;  2JQO A;  3BJU A;  3GD7 A;  2IX1 A;  2MNA A;  1HJP A;  3CPF A;  4LFC L;  1YHQ A;  4GKJ Q;  2FXQ A;  4LFC Q;  1IL2 A;  4IPH A;  5C44 H;  4GKJ L;  4YWM A;  4P73 A;  4OWW B;  3CCV A;  1X3G A;  3AEV A;  2UU9 Q;  3F2B A;  1JB7 A;  3KLW A;  4GKK L;  4H02 A;  3CCR A;  3ULP A;  1SFO H;  2R7F A;  5H1S E;  1OXS C;  1IBL Q;  3RLF A;  3F8T A;  3EBE A;  2ID0 A;  1N9W A;  3PIP A;  1YVC A;  1HNX Q;  4DV2 L;  1NE3 A;  4HID A;  2V1C C;  1RIP A;  3H0G G;  1HR0 L;  1SLJ A;  2VQF L;  1VQ5 A;  4L5R C;  2R92 H;  3S2D H;  1KD1 C;  2E2H H;  2E5L L;  4DKA C;  4BBR H;  4B3T Q;  3UE0 A;  1E24 A;  1EUJ A;  3G48 A;  3D31 A;  5C0X I;  4X64 Q;  2UXC L;  3A5Z B;  4NXN L;  1CKM A;  2K5H A;  2YU9 H;  3I4O A;  1YHA A;  1JJ2 A;  2Z0S A;  2RCN A;  1QZH A;  1BVS A;  4GNX C;  1XPO A;  1IBK Q;  1C0A A;  1XJV A;  1OXV A;  2Q2H A;  3CC7 A;  2XGT A;  3S16 H;  1HNZ L;  1LM0 A;  2GVA A;  4P75 A;  3HOZ G;  3EIV A;  1JJG A;  5IP7 H;  2AWN A;  1K3R A;  5C0X J;  4JV5 L;  5JJL A;  1WCM H;  2WB1 E;  1Q46 A;  3E0E A;  4R4I A;  2IT1 A;  3J7A 5;  4LF6 Q;  4P72 A;  2HHH Q;  2K52 A;  1VQK A;  3S24 A;  3PUW A;  3S1M H;  2ASB A;  3PO3 H;  4DUY Q;  4C3H H;  4PZ6 A;  1PH5 A;  1VQ9 A;  3KF6 B;  3T1H L;  4MNO A;  3GTQ H;  4OO1 I;  4KHZ A;  4LW1 A;  3ZJY C;  4NB3 A;  1XNR L;  1Q1E A;  2E8G A;  4YHH L;  2VL6 A;  2N49 A;  3CC4 A;  4HIM A;  1VQH A;  1XNR Q;  4KHP L;  2JA7 H;  5IYD H;  1N34 Q;  4AQY L;  2UXD Q;  5K36 G;  1P8L A;  1W3S A;  4A3J G;  3GO5 A;  4IPG A;  4LF9 Q;  4MTN A;  4DV3 Q;  5J3B A;  5IYC H;  4DAY B;  3TS0 A;  2I5M X;  1VQJ A;  2L15 A;  2RHQ B;  3TRE A;  1VQL A;  3S14 H;  4JBW A;  4DK3 C;  3ERS X;  1J5E Q;  1AE3 A;  2I0Q A;  2LXK A;  4YY3 L;  1KRS A;  4JCV E;  1HZ9 A;  4DR7 L;  3HKZ E;  1SN8 A;  4IPD A;  4L5S A;  3UDX A;  2GVB A;  4X65 Q;  1E22 A;  3A74 A;  3U50 C;  1U0L A;  4A3F H;  1TWH H;  4HJ5 A;  2DUD A;  3KF8 B;  4GLA C;  3CW2 C;  1HZB A;  1PHJ A;  1EFW A;  5IWA Q;  1E7Z A;  2VW9 A;  1OXT A;  4QL5 A;  1Q1B A;  4LFA L;  5IP9 G;  4JYA Q;  5FLX c;  3B6Y A;  5ELN A;  2Z6K A;  4AH6 A;  4BXX H;  4HIO A;  1TWC H;  3M4O H;  3FP9 A;  1UEB A;  4DR5 L;  2B63 G;  1GVP A;  4DR5 Q;  3M9B A;  3H15 A;  4FDB A;  2WAQ E;  3PGZ A;  4A4I A;  2RHS B;  4DAM A;  1NTG A;  4DK6 C;  3CXC A;  4PZ8 A;  4DV1 Q;  3KFU A;  4A3L G;  4QGU A;  5C4X G;  3U58 A;  1IBL L;  4LF8 Q;  3HOZ H;  3J7Z C;  1TWF H;  1G6P A;  5C3E G;  1DGS A;  2ZJR A;  5IYD G;  1K8A C;  3J80 c;  1L1O B;  2JA7 G;  4J15 A;  4A3I H;  4P71 A;  2NZO A;  1HR0 Q;  3CCU A;  4BXX G;  4OXP A;  5GAD C;  4DV6 L;  1XNQ L;  1VCI A;  1VQ8 A;  2ZTC A;  3PUY A;  4P74 A;  4JI4 Q;  4JI4 L;  4JI8 L;  4QY7 A;  5LMN Q;  4JI2 L;  4IOA A;  4QQB X;  1NBW A;  1KC8 C;  4AQY Q;  2NVQ H;  1YJ9 A;  2UXD L;  1WCM G;  1A62 A;  3AQQ A;  1YNX A;  1N8R C;  2CKZ B;  4EX5 A;  4JI0 Q;  1Q8K A;  3G4S A;  2E2I H;  3RN5 A;  1E3P A;  3OYY A;  3D0F A;  5JEA G;  1IBK L;  1VQM A;  2I5H A;  3BZK A;  3EN2 A;  5M5X H;  3OTO Q;  3KJP A;  4QJF A;  5IP9 H;  2ZM6 Q;  2GN5 A;  4UPA A;  4LUV A;  4JV5 Q;  4UP9 A;  1A8V A;  2IHF A;  2MO1 A;  5IYB H;  3HOV G;  2R93 H;  2F4V Q;  4DR3 Q;  3CC2 A;  2MFI A;  3CMA A;  2KBN A;  3JAM c;  5M3M H;  4LFA Q;  1BKB A;  3CCM A;  3ULJ A;  1I6H H;  2HIX A;  2JK8 A;  4AYB G;  4PZ7 A;  4JI6 Q;  3TRZ A;  5FJ8 G;  3L0O A;  4GNX B;  1RL2 A;  3W1B A;  1CUK A;  1I3Q H;  2NN6 G;  4A3I G;  1N33 Q;  3PF5 A;  2LXJ A;  1PH8 A;  3HOV H;  2R7D A;  1P16 A;  1JMC A;  1YZ6 A;  1PH6 A;  3F2C A;  1MKH A;  3CCJ A;  1I94 L;  2OTL A;  5HY6 A;  2BH2 A;  1M1K C;  4DR1 Q;  1XMQ Q;  1CKN A;  4B3R Q;  5M5Y H;  2N3S A;  4NXM L;  4UP7 A;  1QUQ B;  1UE5 A;  1VQE A;  1PH7 A;  1X54 A;  4YY3 Q;  3E9I A;  4UY8 C;  1XNQ Q;  5IY0 A;  4DV4 Q;  2K5N A;  3PO2 H;  4BBS H;  4BBS G;  4UP8 A;  1XMO Q;  3G71 A;  4RMF A;  4IFD I;  4YCV A;  1MJC A;  1PYB A;  5M3M G;  4DR6 Q;  1LTL A;  1EQR A;  5C44 G;  4DUZ Q;  1VQO A;  4NPS A;  3CD6 A;  1L1O C;  1SRO A;  2N78 A;  1KXL A;  3PUV A;  1KL9 A;  5IP7 G;  2OWO A;  4JI5 Q;  3K8A A;  2IHE A;  2AMC B;  4A3E G;  3L7Z C;  5M3F G;  1A0I A;  1WI5 A;  2AKW B;  4R4C A;  4APV A;  5IE8 A;  3RN2 A;  5BR8 Q;  2YTV A;  4KI0 A;  1IXR A;  3RZD H;  4DV0 Q;  2KCM A;  4JOI C;  1XPR A;  3HOX H;  1KHI A;  4DV0 L;  2YV5 A;  4OON A;  3CME A;  4PG3 A;  2ES2 A;  3STB D;  4A3G G;  3STB C;  1YJW A;  1KRT A;  1VQN A;  4LUZ A;  4JI1 L;  4X66 Q;  4DR4 Q;  2A1A A;  4JOI A;  1VQP A;  2ALY B;  1PH9 A;  2AWO A;  2HQL A;  2QGQ A;  3UDI A;  1FJG L;  3Q8D A;  4DNI A;  3T1Y Q;  2WAQ G;  1OXU A;  2JA6 G;  2MQH A;  1Y1V H;  4JG2 A;  2UXC Q;  2UUB L;  1ASZ A;  1EOV A;  2H5X A;  2A8V A;  1X6O A;  3CQZ H;  3GTJ H;  5JJI A;  4A3D G;  2NVX H;  5FLM H;  3HKZ G;  4A3C G;  2EXD A;  3J81 i;  3CAM A;  4O0A A;  3FKI G;  4GOP B;  3UDF A;  4C3I H;  2VZA A;  4BY7 G;  2VNU D;  2OQ0 A;  1OTC A;  2NN6 I;  3HKS A;  1D8L A;  3PIO A;  1JT8 A;  3CCS A;  2Q2I A;  5C4X H;  4JI3 Q;  1PFS A;  1T9H A;  3K80 C;  4A3G H;  4A3E H;  1EWI A;  1SR3 A;  4DR2 Q;  4GOP A;  1VQ4 A;  2D0O A;  4GN4 B;  3J81 j;  4LNQ A;  1C9O A;  2D62 A;  2F4V L;  3RZO H;  2HIV A;  1MIU A;  1YHB A;  3K0X A;  2NZH A;  1R9T H;  4R4Q A;  1NJI C;  1QVF A;  2NVT H;  5FJ8 H;  4DUY L;  3S1R H;  1J6Q A;  2UU9 L;  3TS2 A;  1CSP A;  3L2P A;  4X62 Q;  4IJL A;  2AHO B;  1Q81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...