4A3CG

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3cG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3cG01
3I7FA 4B3ML 3GO5A 3CCEA 4R4TA 1I50H 4POGA 2AHOB 4YWMA 4JBMA 4BXXG 4PZ6A 1YI2A 1N34Q 2Q2HA 3UDXA 3EN2A 1X55A 4HJ7A 2JA9A 4A3LG 4XTCS 1VQMA 2R92G 2WB1E 4L5SA 1BBWA 4DR3L 3RN2A 1JB7A 3AYHB 4A3BH 3NEMA 1PYBA 3PIOA 4DV3Q 2VUMH 1ASYA 5FJ8H 3T1HQ 5IP7H 4LF9L 4DNIA 1Q46A 4Y7NH 4JCVE 4GNXC 5JJLA 1A8VA 4DV4L 4DV7L 2JEBI 4YWKA 4A3CH 1DGSA 5IP9G 1PH9A 3GD7A 4LFBL 3DLLA 1YJNA 4OWTB 1Y1VH 4H02A 1RL2A 2EIFA 2PNHA 3CC4A 1JMCA 3L2PA 3W1GA 1L0WA 3ZJYC 3NENA 5ELNA 1X3GA 4IO9A 4DV5Q 5IYCH 5ELOA 3CPWA 4DR6L 4DAYB 4B3RL 3WWVA 2K52A 4DR7Q 2N78A 2VS1A 4JI1Q 1TWAH 4OWWB 1KXLA 1KC8C 4TQUS 4NXMQ 3HOWH 1VQPA 1T9HA 1N8RC 4PG3A 5M5WH 2N49A 3F8TA 1SMXA 5C4JH 4HIKA 5IY0A 1XPOA 1N36L 4JI6L 4LFAL 1P8LA 5M3MH 3VDYA 4JI6Q 4JBWA 5IE8A 3TRZA 1PH7A 1VQKA 2JQOA 2VQEQ 1QUQB 1LYLA 5C0XG 2KCTA 2PQAA 2UUBQ 5GAEC 4YY3Q 4HIOA 1C0AA 1M90C 1OXTA 1NY4A 2AMCB 1CSQA 2JE6I 2AWNA 2CKZB 3BZCA 1Q86C 4JI3Q 3ICEA 3S16H 4DR6Q 1L1OB 1IBLQ 2HT1A 4GKKL 3GTLH 4JBKA 1W2BA 3K81C 1CKNB 2K14A 2GN5A 4A3MG 1PH2A 4LFBQ 4LF4Q 1YHBA 1Q82C 3CXCA 1K83H 1VQNA 1VQ5A 3HOYG 1KHIA 2IHFA 3K0XA 2CQOA 4DV6Q 3HOZH 3UDIA 1IBML 4JI5Q 4HIDA 1Q81C 2IX1A 1GVPA 1EIYB 2YU9H 2GVBA 3TQYA 4IFDG 2ZTEA 1FJGL 4DR3Q 3PUYA 1D8LA 1FJGQ 2E2HH 3H0GG 3JC66 4DUZL 5M3FG 4DV0L 1XMOQ 1I3QH 3D0FA 1UE1A 4LF7L 1K9MC 3I4OA 4BY7G 2GVAA 4MTNA 2A8VA 1D7QA 3HFZB 1GD7A 4JI5L 4R1JA 3PV0A 5BR8Q 4X62L 3CCLA 4X6AH 2IX0A 2NVYH 5IYDG 2ES2A 1XJVA 4BY1H 1VQCA 5C44H 4GOPB 1Q7YC 1UE7A 2HHHL 4UP9A 1V43A 5JJKA 4A3DH 4UPAA 2N8NA 4A3JH 1K8GA 2RCNA 1SLJA 3J81c 3S1NH 4OX9L 1PH1A 3J81i 5IT9c 3G48A 3ULPA 4JI3L 3FHWA 3W5OA 1SN8A 2PQAB 4QJFA 2E5LQ 5GAGC 1KQSA 4LF6L 3HOYH 4R4OA 1C9OA 4A3KH 3S14H 3CCVA 1B7YB 2UU9Q 4LF5Q 4LWCA 2E2IH 3B6YA 2Z6KA 1L1OC 1YVCA 3I55A 2ASBA 3MXNB 4A93H 1TXYA 1K8AC 2Z6KC 2UXDQ 4R4IA 1N9WA 1CSPA 2PI2E 1NTGA 3A74A 1CKNA 1TWGH 1N36Q 5AJ3Q 4QGUA 1XNQQ 1LM0A 4JI4Q 4P74A 5M5YH 2WP8J 1VQ4A 4A3GH 4HJ8A 1N33L 4GS3A 1VQBA 4JI1L 4BY7H 4GKJL 3K7AH 1PFSA 4JI8L 2OTLA 4KHZA 4KI0A 3H0GH 5FLMG 1K73C 3CAMA 1NE3A 5IYDH 2Q2IA 2C35B 3F2CA 4K0KQ 4AYBE 4WJ4A 3U58A 1EFWA 4GN5A 1FVIA 1TWCH 1SROA 2JK8A 1S40A 5M3MG 1YHQA 3PO2G 2EQSA 4LUZA 5LMUQ 2JEAI 2WAQE 3E9HA 2VNUD 2H5XA 2YYZA 1E1OA 3D31A 4JYAQ 4PMWA 1PHJA 2CWPA 1X56A 5IYBG 1N33Q 5H1SE 4DV3L 4A3KG 3T1HL 4A3IG 2XGTA 1E3PA 2NN6G 3T1YL 4NB3A 3Q8DA 3I4NH 4IJHA 2UU9L 4DV2Q 4A3EH 3CCSA 1YITA 5GQOA 2CFMA 1XNRL 1AE2A 3ULJA 4BA1I 1QZGA 1Q1BA 1WFQA 1L2FA 2RF4A 5JEAJ 4DV6L 2ZM6Q 4LF6Q 4IPDA 3U4ZA 2BH8A 3UE1A 1G291 5GAHC 2QEXA 1NJIC 2Q2TA 1V1QA 3J80c 3KF6B 3H15A 4B3SL 3A5ZB 2LXKA 4A3FH 3M7NA 1B70B 1W3SA 1X3EA 2UXCQ 5C3EH 3F2BA 3CQZH 1EYGA 2B3GA 4DR1L 3PO2H 1EQRA 1YHAA 4JC0A 1E7ZA 2L15A 3G71A 1EWIA 1Y14B 3AQQA 2I5HA 1YEZA 3K7UC 4GLVB 4EX5A 3PIPA 4DR5Q 1XNRQ 5C44G 1SRUA 1FL0A 1HJPA 1U5KA 2UXBQ 4LFCL 4QL5A 1VCIA 1QVFA 2UXBL 1X54A 1YJWA 4IJLA 3GDEA 2OQKA 2R7ZH 3RZOH 2JA6G 1I5FA 4A75A 4DR4Q 1KIXA 3CC2A 3W1BA 3F2DA 1R9TH 1UE6A 4DR7L 1Q8KA 4KHPQ 4DR1Q 1VQOA 3FKIH 1K3RA 5M5XH 1H95A 3STBC 1HZAA 4O2DA 3M85A 4JI2Q 3OTOQ 4Y52H 4JOIC 2NVQH 3UDGA 2R6GA 1OXUA 4LF8L 2BH2A 2JA8G 3K80C 1Z47A 4P75A 2R93G 2VZAA 5FLXc 1E22A 1A0IA 2ZTCA 3KF8B 3LGJA 4GKJQ 1HZCA 1P16A 5DLQE 1MKHA 4DV1L 3GTOH 4OO1G 3RN5A 2UUBL 1N32L 5FLMH 2KHIA 2VQFL 1XPRA 1YNXA 5IWAQ 2UUCQ 4JI0Q 5C3EG 3T1YQ 1J6QA 3CC7A 1XMQQ 5IYCG 2VL6A 3UDFA 3G4SA 2DUDA 1XMQL 4X66Q 4NXML 4GN4B 4UY8C 4JOIA 1C7YA 2R7ZG 1VQ9A 5J3BA 2JJQA 2ZJRA 3H3VI 5GADC 4LF8Q 1J5EQ 3J80i 1JE5A 4RMFA 4L5TA 3S2HH 4P73A 3S17H 1HNZQ 1YZ6A 1PYSB 1IZ6A 1A62A 3HOXG 4ALPA 2F4VL 3J81j 2NZOA 4A3BG 1QUQA 4O0AA 4DV4Q 3KYHC 2ZJQA 1AE3A 3HOUG 1PH8A 1GO3E 3L7ZC 1PH4A 4X62Q 5BR8L 1TWFH 3OYYA 1HZ9A 1SR3A 1Z9FA 2BA0A 4LUOA 4X64L 1X6OA 4DV7Q 4A4IA 3GTPH 3AFQA 4JI4L 4DKAC 3SGIA 5IP9H 3A0JA 2JA8H 2PMZE 4C3HH 4IOCA 4UP8A 4YCWA 3KJOA 4R4CA 1EQQA 4FDBA 2LSSA 2B63G 1PH3A 3U50C 4A76A 4DK6C 2ZTDA 3PUZA 5E7NA 4P72A 3CW2C 3I56A 3TREA 2WFWA 1YJ9A 4C2MH 4GNXB 3M4QA 1VQAA 3HKSA 4TVAB 3RLOA 3CCJA 3CCQA 4AQYQ 4LF4L 4AIMA 2IY5B 2K5VA 1EIFA 1VQFA 5M3FH 5C0XJ 2R92H 1IXRA 2KBNA 3S15H 1K0RA 3JAMc 1CUKA 2MQHA 2RHSB 1HR0Q 1BBUA 2HHHQ 1KAWA 3HOXH 3GTMH 1I94L 1YBYA 3EIVA 5C4XG 1J5EL 1OTCA 1NMFA 3HOUH 5IYBH 5C4XH 4YY3L 1KRTA 4BBRG 4DUYL 4HJ5A 1A63A 4A3MH 3ER0A 2CCZA 3CF5A 3CMAA 4EQ5A 4DV2L 4GOPA 1XMOL 2YV5A 3M9BA 4IPHA 3CD6A 4DPGA 2VQFQ 4C3IH 3HOZG 2A1AA 4LFAQ 5LMNQ 1YIJA 3GTQH 4YWLA 2HQLA 2HIXA 2K5HA 2HIVA 2IT1A 3E0EA 3PUVA 1KD1C 1VS0A 2V1CC 2YTXA 3K8AA 2UUAQ 1S3OA 2D0PA 1LTLA 1JJCB 1HR0W 2CWAA 1VQ8A 3KJPA 4BBSG 4JYAL 1XPUA 1AH9A 4P71A 4B3RQ 4LNQA 4DR2L 3U4VA 3M4PA 3RLNA 4DV5L 3RNUA 4JV5L 2PI2A 4DR2Q 4JV5Q 5HY6A 3I4MG 3S1QH 3BU2A 4IPGA 4RG1A 4GKKQ 1G6PA 3NELA 4JI8Q 1BVSA 4YCUA 1Y1WG 2MO1A 3PO3H 2OCEA 4GN3B 1HNXL 2UUAL 1SE8A 1VQGA 4BXXH 1L1OA 4GLAC 1NBWA 4GNXA 1U0LA 2VQEL 2K75A 3DM3A 1KRSA 4BBRH 3J7ZC 4PZ7A 3OW2A 4LFCQ 1OXXK 2WAQG 3J7A5 2MO0A 3CMEA 1OXSC 3KDFA 1VQIA 4ME3A 5AJ3L 3S1RH 1IL2A 1VQJA 1GKHA 1WJJA 2IHEA 3FP9A 2JA6H 4OO1I 2UUCL 4JI0L 5FJ8G 1MJEA 5IP7G 4IFDI 3G6EA 4LF5L 3EBEA 3CCUA 1IBKL 3MEFA 4JG2A 4PZ8A 3RLFA 2KCMA 3KOJA 1VQ7A 1VQ6A 4B3TL 2UXCL 1HR0L 4B3MQ 4MNOA 3ERSX 2N3SA 4HJAA 3I4NG 1EUJA 1PVOA 2Q2UA 1WI5A 2I5MX 3F1ZA 2I0QA 4A93G 2R7FA 2NVTH 3TS0A 2OTJA 3E9IA 5C0XI 2F52A 4NXNL 4R4QA 4UP7A 1GM5A 4KHPL 1PH6A 2D62A 2MNAA 2E8GA 3PF5A 3H3VH 4IOAA 4DUZQ 1PV4A 4AYBG 2FXQA 1QVGA 4A3FG 4X65Q 1Y1WH 4X64Q 3KF6A 3PO3G 4A3DG 4X65L 1X65A 4LUVA 4A3JG 2E2JH 4APVA 2JA5G 3A5UA 4BY1G 1X9NA 3M4OH 3S24A 2YTYA 1NMGA 4A3IH 1IBMQ 2F3IA 1Q12A 1HNWQ 1VQDA 4QIWE 4NXNQ 4DK3C 3AEVA 4J15A 3BJUA 2ZM6L 4A3EG 1HNZL 3GTJH 3I2ZA 2ID0A 1UE5A 2VUMG 1O7IA 1B8AA 2KENA 3KDFB 1JJ2A 4QY7A 1VQHA 2K4KA 2Z0SA 2JA7G 4OXPA 4K0KL 1HH2P 1WYDA 4B3TQ 1IBKQ 3CCRA 5EAYA 4JBJA 2A19A 4X66L 2VW9A 3PSIA 4GLXA 2LXJA 2RHQB 4OONA 1JT8A 4GOPC 2UXDL 2AWOA 2D0OA 1CKOA 1MIUA 1EOVA 4DV1Q 1SFOH 1RIPA 1XNQL 2K5NA 2NVXH 4A3GG 5K36G 3CPFA 2R93H 5IWAL 2ATWA 4QQBX 1OXVA 2Y0SE 1E1TA 3HKZE 3GTKH 4DUYQ 1G51A 3I4MH 1N32Q 1Q1EA 2E5LL 3PCOB 2OQ0A 2EXDA 3S2DH 3PUXA 1QZHA 1HNXQ 3TS2A 4BA2I 5LMUL 3GTGH 3S1MH 4MZ9A 4L5RC 4L5QA 4IFDJ 1QVCA 2NZHA 4OWXB 4A3LH 2DGYA 2JA5H 4IPCA 3OTOL 4JI2L 1HZBA 2AKWB 4OX9Q 3BZKA 3RR5A 3CCMA 1KL9A 3PUWA 4KLKA 1HNWL 3M3YH 1BKBA 3KFUA 3NBHB 3CP0A 3IRBA 4DR4L 2WB1G 4WJ3M 4C3JH 1IYJB 4POFA 4NPSA 2OWOA 2KHJA 4DAMA 1PH5A 5LMNL 3KLWA 2K50A 2R7DA 4DV0Q 4LF9Q 1M1KC 1V9PA 2ALYB 4LF7Q 1S72A 1VQEA 3FKIG 1E24A 2JA7H 4LW1A 5LMNW 4DR5L 2YTVA 4AH6A 4HIMA 3HOVG 2NN6I 2B29A 3L0OA 1WOCA 1ASZA 1VQLA 1N34L 1X3FA 1TWHH 3STBD 1WCMH 3HOVH 4A3CG 5JEAG 1XTDA 3PF4A 1LUZA 4BBSH 3HKZG 2Y0SG 3AFPA 3RZDH 2B63H 1I6HH 1WCMG 5HGQA 1FGUA 1Y1VG 5GROA 3ULLA 3JAMi 2QA4A 2F4VQ 3TEHB 1I94Q 4B3SQ 3PGZA 3UE0A 2BA1A 1MJCA 2ZJPA 5JJIA 3HOWG 1JJGA 4JI7Q 1UWVA 2XTIA 4YHHL 2I5LX 4HJ9A 1IBLL 4JI7L 2VY3A 4YCVA 4AQYL 4YHHQ 1UEBA 2MFIA 1CKMA 1PA6A 2QGQA 4XIGS
chains in the Genus database with same CATH superfamily
3I7FA 3Q8SB 4DR1H 1TVXA 3F8NA 5DLFA 4NLGA 4PZ6A 4X64H 3MFGA 1KTKA 4Q44A 1N34Q 4HJ7A 1J5EH 3T16A 4XTCS 1VQMA 5DEHA 4DUYH 5EWFA 2UXBH 2BE5D 4I55F 3NEMA 1BGWA 1XNRH 2L1BA 1X32A 5BN4A 3R5FA 4KN7C 5FJ8H 4N9PA 3PW5A 1Q46A 3T1YH 3K0YA 2J6UA 4EYIB 5JJLA 4DV7L 4YWKA 4RZQA 5FLXW 4O3SA 4EQNA 4MV4A 4OWTB 4DAPA 1BJTA 1H9RA 4WRDA 2XIGA 1RL2A 2EIFA 4OO1H 1DD2A 3L2PA 3ZJYC 2Z4HA 5JEAH 3FPUB 1X3GA 4B3RL 3KALA 4DAYB 3TN2A 4TQRA 1H9KA 3WWVA 2P0AA 4FM9A 4DR7Q 2N78A 2VS1A 1HNWH 4EEYA 1XXGA 3IFDA 4TQUS 3T5HA 1SBBB 3IN5A 3MR5A 3MAQA 1R4QB 3I4NB 5F2DA 4DN4M 4YIJA 5IY0A 1LTID 4JI6L 1RKNA 4KY6A 2L9HA 3DEOA 5IE8A 1PH7A 3TRZA 2NVYA 2J0TD 1QUQB 2YRXA 2XWBB 2PQAA 3V6KA 1RDPD 3K59A 4IURA 5GAEC 2HVRA 4ULLA 1WCMB 1TWAA 1C0AA 1M90C 5K2MA 3HKZB 2AMCB 2JE6I 1AW7A 2CKZB 1ZKOA 3S16H 5D1OA 5KFXA 1FKAH 5EWEA 4GKKL 3OUUA 3X3MA 4IZOA 1D2BA 1HFNA 4A3MG 5DQGA 3RB4A 5JVDF 3BDOA 4LF4Q 5DG7A 2A68D 2MUYA 2BQUA 3T56B 3SR1A 3HOYG 1KHIA 2KCCA 5IGDA 1LV9A 2CQOA 2R8IA 1FYCA 5D3IB 3S9WA 3R23A 2J7ZA 2O5JC 5C5MA 3H6MA 2A69C 4B9XA 2E2HH 2YCHA 1STNA 3JAME 5CGKA 3M9NB 4DV0L 1BO0A 5CV5A 2A8VA 3T4AC 3GIIA 4X6AH 5L1KA 5IYDG 1A2UA 3NQTA 4BY1H 5C44H 1V43A 1Z6HA 2FJ2A 3TQTA 2A73B 4K14A 5JJKA 4UPAA 3TP8A 3N42B 2RCNA 3J81c 3T5JA 4BBRB 1WH2A 3GTPA 4QMGA 1JWSD 2MGSA 2XRQD 2FE3A 4XYLB 3ULPA 1W96A 1M4VA 3DM1A 4LF6L 5JVLA 1E2ZA 4R4OA 1C9OA 2W9CB 3TBIB 2UUAH 4LWCA 2B8FA 2F0QA 3QJYA 1YVCA 5IT9L 3K3VA 3I55A 3MXNB 4O4HF 1TXYA 2L11A 2HCCA 2UXDQ 4J9RA 1N9WA 2W6QA 1EFID 2PI2E 1SSOA 1TWGH 3BYYB 1N36Q 4QGUA 1D1IA 4JI4Q 1XNQH 2L55A 4DV4H 5DQIA 3TIGA 5KFNA 4JI8L 3KLRA 1I3QA 1K73C 3CAMA 1NE3A 5IYDH 1STHA 3E5NA 4LF8H 4WJ4A 3NTHA 1EFWA 4RNMA 4YB8B 2WE6A 3ERQA 2PCFB 1JDEA 1YHQA 2B63A 5FPRA 3NTKA 4LUZA 4YY3H 3QWNA 2AQ1B 2QCPX 2YYZA 1X56A 5IYBG 1A15A 3QIAA 4DV3L 3RGXA 3T1HL 4NKLA 4WFN3 1E4GT 2NN6G 4MTDA 4NB3A 4U6PA 4A3EH 3TP6A 1J9OA 1PTOC 5GQOA 1AE2A 5KT4A 2QDBA 1I4XA 3KF8A 3P75A 4BA1I 5EKIA 1ML0D 1RHPA 1Q1BA 2I46A 1PTOH 4DK0A 2W6ZA 2HUGA 2RA4A 5JEAJ 3K58A 4Q5VA 5KT2A 4IPDA 2EYFA 4WBNF 5C5JA 5KFQA 1GUOA 2R6FA 3K3PA 5KT3A 2Q2TA 3J80c 1A3VA 1HNZH 4B3SL 3A5ZB 2LXKA 2UXCQ 3QZ7A 1JIHA 2VOBA 1VBHA 1ONLA 3PO2H 1ULZA 4HR7A 1EQRA 1CTMA 3A7LA 2L15A 1EWIA 2I5HA 1YEZA 2KUMA 3S1QB 1Z2PX 1NNXA 1U5KA 2PYKA 1GXDC 2VQEH 3GDEA 2JA6G 2B39A 5KG0A 2B2UC 4DR1Q 1C48A 1K3RA 1H95A 1SNPA 1BNZA 1HZAA 4O2DA 2NTTA 4AYBB 1TWGA 5CC4A 4FU0A 1I94H 4PQXA 3GIQA 4JOIC 1R4PB 2V59A 5BPHA 1H9MA 1SAPA 1Z47A 3H3VC 1FNUA 3HOUB 2KJXA 1E22A 1U4MA 3HZXA 4GKJQ 1HZCA 1P16A 1B4OA 1MKHA 5DLQE 2K7VA 4ZUJA 4DV1L 3GTOH 3RN5A 2UUBL 5ELEA 2A69D 1ET6A 1XPRA 3D6WA 2VL6A 3G4SA 2DUDA 3ONAB 3C46A 1K3BC 1XX8A 4NXML 5KNDA 3GTGB 3I4LA 1X3QA 1O7LA 3BS1A 2ZJRA 1LTTD 3D4RA 4O42A 4LF8Q 2X6LA 1J5EQ 4N8X1 3MC0B 3J80i 5C3EB 3SI8A 3K57A 2JA6B 1EZ8A 1HNZQ 4DXFA 1ENFA 1PYSB 4A3JB 1IZ6A 1A62A 2R8JA 2K03A 2MP1A 4ALPA 5D14A 4UCUA 4C3JG 2GLTA 2NZOA 4A3BG 1QUQA 4DV4Q 4WD3A 1AN8A 1GO3E 2JP1A 3L7ZC 4ZCKA 1Z9FA 1SR3A 2CQAA 3HKZA 5FD5A 4Q43A 1RJPA 1F2LA 2LS01 4QWCA 1JQYD 4C3HH 5K5PA 4UP8A 3R5XA 4YCWA 3KJOA 2E5LH 5KNCA 4GC7A 2LSSA 2PW5A 1PH3A 3U50C 1RODA 3RMHA 5ISRA 2B63G 5LYJF 1IBKH 3GV3A 3I56A 2JEGA 4ME6A 2WFWA 3I91A 1VQAA 3U9OA 2EYMA 4TVAB 1MHWC 4AIMA 3LP8A 2M2LA 3MWDA 1LABA 2KBNA 3S15H 4QCLA 2MQHA 4MTEA 1BBUA 2HHHQ 2IP4A 2YRWA 1IBMH 3V2TA 3GTMH 1I94L 3IG0A 3TQ1A 1K8MA 2NZ1D 3BA9A 1KNEA 3HOUH 1JX4A 3OSNA 3BQ1A 1A63A 1HNXH 4DV2L 1Y1WB 5L1LA 1S0NA 1S5FD 1CT1D 1YIJA 2UXDH 2JN4A 3PUVA 4EEQA 1HUMA 1KD1C 4YP3A 3E5SA 2KA7A 2UUAQ 4BY7B 1HR0W 5EPKA 1XPUA 2R8KA 1EUCB 4OIJA 3MR2A 5K36H 3M4PA 2D2CC 4RKLA 5ELCA 5FO7B 3RLNA 2CVRA 4A3DB 3T5KA 3S1QH 1EYAA 3S1MB 4RG1A 2E2IB 5DGAA 3NELA 2ASDA 1BVSA 4I65A 1KJ9A 2OCEA 3PO2B 3EJIA 2UUAL 3I72A 5IGCA 4FVMA 1NBWA 4GNXA 2R84A 5KG3A 2XSCA 1KRSA 2SOBA 4LFCQ 1OXXK 4RAUC 1OXSC 4CBVA 1VQIA 4ME3A 3S1RH 1GKHA 2IHEA 3S2HB 3MXUA 2UUCL 1CZGA 1PTOB 2XN9C 5FJ8G 3OHAA 4O3QA 2WAQA 4ETSA 4KD3A 2Z9HA 3EBEA 1IBKL 3MEFA 1GGOA 2B2WC 4JI5H 3KOJA 2O2LD 1BR9A 2JYOA 3FMAA 2PW7A 1EUJA 3U9SA 2VR1A 4TUYF 5FLXL 5CB4F 2R7FA 1ICWA 5C0XI 2XCLA 3J80W 3Q8RB 2EXZA 4CJ2C 1PH6A 2W7PA 2MNAA 3H3VH 5JH7F 3PVXA 1STBA 5KFKA 5CV4A 2FXQA 1QVGA 4J9MA 4IAJA 1N34H 2PBZA 4X64Q 2BDNA 1M6VA 5C4JB 2E2JH 2JA5G 2PZUA 5T1GA 1CS0A 1IBMQ 3TMEA 4DR7H 1EU3A 1GSHA 4DK3C 2YW2A 1C8CA 5C5LA 1SYDA 1Y8NB 1HNZL 2ID0A 1PZKD 2L0CA 4F4YA 2A6ED 4CKCA 4KTAA 5M5WB 4QY7A 2K4KA 3RZOB 1HH2P 3VA5A 5IODA 3SXHA 1HXYD 3GV5B 1OO9B 1PRTF 1IBKQ 5EWGA 4P2CB 3I90A 4C5BA 2R7ZA 1FD7D 1RYRA 3NP8A 1JT8A 2LXJA 2RHQB 4EFEA 3P1HA 1AUVA 4JV2A 2AWOA 1TS3A 1EOVA 1SFOH 1SFOB 4AYBA 3GTJA 4KHVA 2NVXH 3CPFA 4QQBX 1OXVA 2ATLA 1E1TA 2Z1CA 3I4MH 4HMIA 3J7AV 1SYBA 1N32Q 4A2AA 4XZ3B 3AB9A 4LSXA 3J81L 1KBLA 3PCOB 4J9SA 2OQ0A 2EXDA 1M0WA 3R2IA 3G8CA 4MV9A 2FK1A 3GTGH 4IFDJ 3PR5B 4JI2L 2AKWB 1CHPD 3RR5A 4OX9Q 4KLKA 1KL9A 5NUCA 3NBHB 4LH7A 4DL3A 1I50B 2NU7B 4WJ3M 4MV1A 3RUPA 3P7JA 5LMNL 4LF9Q 5CA1F 2Q8IB 3BA8A 3FKIG 1E24A 4DA2A 3V4ZA 1TWHH 1WCMH 3HOVH 2DN8A 3PF4A 1WTRA 3HBLA 4BBSH 3J81W 3CQZA 1I6HH 3JAMi 5HGQA 3ULLA 1JKJB 1SCUB 2F4VQ 1I94Q 4B3SQ 1FNVA 4ZUIA 2BA1A 3ND8A 5M5XB 4Q8FA 5J2UF 5F9LA 1O80A 5J39A 2XTIA 1B3AA 1GHJA 2I5LX 1IBLL 4O3NA 5L9XA 3OPOA 2VXWA 4FS1A 1KC7A 1UEBA 4XYQA 2F0UA 1CKMA 4KV6A 2OF1A 4FP5D 3I8ZA 4R4TA 2F0FA 3ZYYX 1WTPA 3Q0AA 1VDZA 1X55A 3OMGA 3IAYA 4FBTA 3C1EA 1BBWA 4M9UA 1LT4D 1WTWA 1JB7A 3R3OA 4OIKA 5ELBA 3S1RB 3M9MB 1XYIA 4DV1H 1TKWB 4DV3Q 2VUMH 3KLSA 5KT6A 4DNIA 5KFHA 4Y7NH 4JCVE 3GP7A 3GV8B 3S2DB 1A8VA 4JI0H 2DJGC 1RD9D 3I73A 5KFPA 4UAIA 2W6OA 5IP9G 3GTKB 4LFBL 3DLLA 1E2VA 2LMCB 1Y1VH 1PTOD 4H02A 3CC4A 3KK7A 3W1GA 3N52A 5ELNA 4IO9A 5HBRB 3DXJC 5C3XA 3H91A 4DK1A 4Q8EA 1DOMA 4I7ZC 2GPSA 1KXLA 4OWWB 1KC8C 1IW7D 1T9HA 2R8HA 1HPCA 3WO1A 4LFCH 3F8TA 4KHPH 3E6ZX 3T13A 1XPOA 1KDCA 4LFAL 5E4WC 1G2SA 2BQ3A 4E4TA 2R82A 1LYLA 4O3PA 2UUBQ 3RZDB 3H20A 3QR8A 3JRXA 4IRDA 4E6IA 4YY3Q 5C0XH 1Q86C 1CSQA 5KFVA 4XXEA 2KVMA 1SYEA 5KFFA 1DM0B 2AQ3B 1L1OB 2RBMA 1WSCA 4JPBW 5A2QE 3S15B 3K81C 1CKNB 1S10A 5DG8A 2PMZA 4UCTA 1PFBA 1YHBA 3D6CA 1Q82C 3DMUA 3CXCA 1VQNA 3H0GB 1RCVD 4MTKA 3X3NA 1VQ5A 4QIWA 2IHFA 4O3RA 4J9KA 2PZWA 3G7LA 2VQFH 2O4XA 1GVPA 5CV7A 4IFDG 3TQYA 4ECZA 3M7GA 1N36H 2ZTEA 4DR3Q 2IBKA 1FJGQ 3JC66 1DXMA 2B2YC 4DV2H 3V6JA 2EY2A 1B3QA 1QJOA 1K9MC 4BY7G 5FOBB 4BY1B 3IL8A 4MTNA 4DAYA 1HR0H 1XTCD 3HFZB 1GD7A 5BR8Q 3PV0A 4X62L 2IX0A 2NVYH 2ES2A 3PO3B 2TSSA 1Q7YC 1Y1WA 1C30A 1T94A 1TIID 4MA0A 3SVMA 4A3JH 1SLJA 1CHQD 2I80A 5JUMA 4OX9L 4DR2H 5IT9c 4DL6A 2NVYB 5KKNB 5KX5F 4EBCA 2PQAB 1YNJC 4BWSC 2E5LQ 2ASJA 2AGPA 5C8YF 3S14H 2UU9Q 4LF5Q 1XMOH 2SEBD 2ASBA 2BQRA 3A74A 1NTGA 2F0PA 4EGVA 1JOKA 1SNQA 4UDUC 5CBAE 1VQ4A 4A3GH 4Y8VB 1LT6D 4LMQD 2YS7A 3NGDA 3FVQA 4KHZA 3CU7A 4RA8A 2VQDA 2WKCA 3H0GH 1YNNC 1FR3A 4KI0A 3FRPB 1PMRA 3RJ0A 1TWCB 5KG7A 2EPBA 3F2CA 4CKBA 2RQXA 4AYBE 5KNBA 2R87A 4I4TF 2F0TA 2M00A 1SROA 4R8UB 1SFOA 2JK8A 1SYGA 1S40A 2PPBC 1BCPF 1EIGA 5I6YA 5KG6A 2WAQE 2H5XA 4C3JB 3D31A 2A6EC 4JYAQ 4X3KA 2NVTB 4A3IG 4PDBA 2XGTA 4C5CA 4A93B 1L2ZA 3CRLC 3BABA 2J6SA 2UU9L 5CV6A 3GTPB 1YITA 3J7YW 3Q24A 4K2LA 1XNRL 2WB1A 4F4WA 4MV3A 3ULJA 3A55A 1QZGA 4RH6A 4CDFC 2FPIB 4XQQA 1LTBD 1PRTC 1WFQA 1L2FA 1T36A 4LF6Q 3U4ZA 3UE1A 2QEXA 1NJIC 4K5WA 2F0GA 3S17B 3H15A 1Q90A 4A3FH 1KABA 3W2DA 1B70B 2XGQA 3GTOA 2CW8A 1UC9A 3F2BA 1CZWA 1EQTA 4JC0A 3R5HA 2N55A 3PZPA 4GLVB 2ZXRA 4U68A 1XNRQ 1SRUA 1KJJA 4DL5A 2UXBQ 2R7KA 3QB3A 2R92A 1D6EC 1X54A 2UXBL 1EY9A 1CFMA 4JI6H 1HTPA 2OQKA 3TIIA 2XCAA 4ED6A 1I5FA 4A75A 4DR4Q 3RV3A 4FXKC 4ZRZA 3ITPA 3F2DA 4RGMA 2CH4A 2C2RA 3H4DA 3EFXD 3STBC 3OSPA 5G3LD 2VPQA 1J8IA 4C3IG 3M85A 1GOZA 5CBEE 3OTOQ 2UVUA 4TSSA 4DV5H 2NVQH 4DNTB 4LF8L 1OXUA 1SEIA 2K32A 2RDHA 5FLXc 2DZDA 2ZTCA 3KF8B 3WO0A 1JXLA 1TWHB 2OT2A 2GA4B 2VPSA 1A6XA 1H9JA 4IN3A 2UUCQ 2E75C 1J6QA 2DY7A 1SNOA 3T1HH 3UDFA 2E76C 4RFBA 4OGQC 2MCTA 5ELFA 4X66Q 3NBHA 5KYLA 1N56A 3HOWB 4GN4B 3N44B 4UY8C 1HA5A 2F0EA 2R7ZG 1Q8IA 2EY5A 1VQ9A 3NK9A 1ZQ7A 4HR7B 3H3VI 5GADC 3GV7B 4JVZA 3UFXB 1JE5A 1T5XD 4R9WA 5FK9C 4QW9A 5HURA 1IKLA 5DG9A 3S17H 1YZ6A 3HOXG 2A68C 3T53B 2F4VL 3J81j 2V58A 5C44B 1GUSA 1ICFB 2B2VA 4CDEC 2JEIA 3CQZB 5EJWA 4X62Q 5BR8L 1BBXC 1TWFH 4PV1C 4DV7Q 3I4MB 4IRKA 1CK1A 1X6OA 3RB6A 2W7OA 3P20A 2DY8A 3GTPH 5KFCA 3OW7A 4A3BB 4RAYA 3OHBA 2RGRA 2EYOA 1B33N 3RB3A 1MD2D 3VYTA 1Y8PB 2E2HB 1EYCA 1Z7TA 5LXTF 5CV9A 4FDBA 3H0GA 5FD6A 4A76A 5L1IA 3PN1A 1Y8OB 2ZTDA 3PUZA 1A3TA 4P72A 4B3TH 3BAAA 1YJ9A 4C2MH 5KG5A 2IY5B 5LOVF 3CCJA 3CCQA 4HQ6A 2K5VA 1EIFA 4ZYSA 5BMVF 2NVXA 1VQFA 1SEBD 2R92H 5DM63 2AGOA 1RYSA 5EKKA 3GIPA 1CUKA 4KKTA 5DAUA 3HOXH 3RBDA 1J5EL 3GTGA 3CKIB 2Z4IA 1NMFA 1IOWA 3I3CA 4J0MA 5F9NA 5IYBH 1QE6A 5C4XH 4YY3L 4HJ5A 1D7QA 2E2JB 3CMAA 4EQ5A 1WTVA 3VA7A 4X65H 4IPHA 4F4XA 3KUPA 3W3AA 2A1AA 1IL8A 4LFAQ 5LMNQ 2HIXA 4RGOS 2K5HA 2HIVA 3PIO3 3MA2B 2V1CC 3K8AA 3K5LA 4J9NA 5T1IA 5I2XA 2DPJA 3BDCA 4LF4H 1LTLA 4IHJF 2CWAA 2PO4A 4BBSG 3HS0C 3JRWA 1AH9A 3GTQA 3ETHA 4LNQA 2E74C 4JV5L 2PI2A 4JV5Q 1TA8A 4B3MH 5J1ZA 3BU2A 4IPGA 1B6RA 3BQ2A 1V1OA 3BG3A 3AMUA 4JI8Q 1Y1WG 3PW7A 3PO3H 5IGGA 1QILA 4GN3B 3HOYB 1VKZA 3VMMA 4FO2A 1OWTA 3N8DA 1SE8A 1VQGA 2IPKD 4BXXH 2ALZA 1L1OA 3GTMA 3DM3A 1PZID 3J7A5 3OW2A 1TWCA 4KKSA 1S5CD 5AJ3L 1VQJA 4Z9CB 4R8UA 4FF1A 1EEID 1EZ1A 5LL6b 1NAPA 2RCFA 4QWDA 4QWEA 1TY0A 4JK1C 2DIKA 3AU7A 2Q8RE 3CCUA 3SK5A 1I6UA 2KCMA 4PMCA 4B3TL 1HR0L 1ET9A 2PN1A 3ERSX 2N3SA 4HJAA 3I4NG 4HNUA 4Q45A 3OMCA 5EBDA 4L8JA 2Q2UA 4ED2A 3GV6A 1WTQA 2LFNA 1IBLH 2YU9B 3RD4A 4JI3H 4RNNA 4ID6A 2HQEA 2AQ2B 3Q2OA 2D62A 3PF5A 3BVGA 4IOAA 1LT5D 1STGA 4O4IF 5KT7A 1Y1WH 3PO3G 4X65L 1X65A 4LUVA 4A3JG 2DNEA 4APVA 2I87A 1JB3A 1X9NA 2FJZA 5EBCA 4ECSA 3TDQA 3OOCA 4NXMH 4ZAIA 1IOVA 1NMGA 2F3IA 4QW8A 5BN5A 4QIWE 3VR2A 4NXNQ 4QUCA 5GONF 4MN3A 1UE5A 1KEEA 3KDFB 5J2TF 4JV5H 2TMPA 1VQHA 5G3LF 1WYDA 3WNZA 3MZ5A 3J80L 1TY2A 4JBJA 4UCSA 4TQSA 4XYMB 2A19A 3PQIA 1HHVA 1AZPA 3VYRA 4GOPC 4C3HB 1MIUA 3KHGA 4J9PA 3K6OA 2BE5C 3HKZE 3K5HA 2CHBD 3CVZA 2E5LL 2UVWA 5EPJA 2J6TA 3TS2A 4KJNA 3SEBA 4BA2I 4M8AA 1TWHA 1W6JA 3MR6A 4MZ9A 4L5RC 2HDLA 4ZK9B 5BPFA 3DWAA 4L5QA 1PLFA 4ME5A 4OWXB 3H94A 1B1ZA 3OTOL 5EDWA 1HZBA 1EQVA 3RIZA 3PUWA 2FMCA 3OUZA 2WB1B 2KECA 3CP0A 3IRBA 1AZQA 1QB5D 2WB1G 1U9RA 4NPSA 1PTOF 3TP5A 1PH5A 2K50A 4RZRA 3MFHA 1BOSA 1PX2A 2XD4A 2JEFA 2B2YA 1VQEA 4V0BA 2RGVA 5IWAH 2PQEA 4DR5L 2YTVA 1S9FA 1F9SA 3GQBA 3HOVG 5C3WA 3GTOB 3L0OA 2B29A 1B9NA 4DU9A 1VQLA 2FP4B 2F1MA 1N34L 4J9OA 4DV0H 4RNOA 2HVSA 1F2ZA 3URYA 4N9TA 1D5MC 1XTDA 3KLSX 1E0BA 4K6DA 3AFPA 4HAEA 1WCMG 3TP7A 3WOFA 2R7ZB 4C3HG 3PGZA 5JJIA 4FNFA 2C9OA 2QILA 4QF4A 4HN7A 2MPMA 4JI7Q 3D4WA 3HOWG 2R92B 2AQ4A 1RK5A 4JI7L 4U7CA 3NTIA 4YHHQ 2E2HA 4XIGS 2V4QA 3T51B 4BWGB 2HGSA 3GO5A 3CCEA 5D65A 1TWAB 4A3KB 1K1SA 4M7EA 4YWMA 4JBMA 4OEMB 2Q2HA 3VYSA 3EN2A 4A3LG 5D1OB 2JA9A 2W70A 2M05A 2WB1E 4DUZH 2MHVA 4DR3L 2NVXB 2XIWA 2XCPA 1BQQT 2W8LA 4A3BH 1O7ZA 1PYBA 1SJED 3PIOA 1G6ZA 3QZ8A 1JC7A 3MXPA 4LK1C 3O13A 1BUVT 4G3IA 4DV4L 5FPOA 3J81E 4DNRB 4A3CH 1PYWD 1SDFA 4QUFA 1I7LA 1YJNA 1JICA 1Q3LA 1LACA 1V8QA 2L5TA 2PNHA 4B08A 1F9RA 4HTHA 2OLSA 1L0WA 3EPIA 3NENA 2ASLA 2G9DA 2SNSA 1ENCA 5ELOA 3H09A 4EBEA 1SMYC 4PMBA 4UFZA 4JI1Q 1WVLA 5LA6F 1R9TA 2G5DA 4NXMQ 3HOWH 3M4IA 4RWSC 1EY6A 4RGTA 2A6HC 4XDXA 2N49A 1F2MA 1CI3M 1SMXA 1SMYD 3NWTA 5CR3A 5C4JH 5IYZF 3GTQB 4KKUA 4ECUA 1H9SB 1SYFA 5M3MH 3D3RA 4JI6Q 4JBWA 1N33H 1VQKA 2JQOA 1SYCA 5C0XG 2KCTA 3FKIA 4G57A 1EHIA 1B44D 2F0VA 4ODGA 2DNCA 3OWFA 1OXTA 2B8GA 3L4KA 2AWNA 3BZCA 2ICIA 4EVOA 4O3OA 1IBLQ 5KFLA 4JBKA 2K14A 1PH2A 4LFBQ 3VR6A 5M3FB 2K5DA 4RB2C 5EKLA 3HOZH 1BXTA 2WTFA 4FXGC 4N8FA 3UDIA 4IFDH 3Q22A 3EYYA 5D1PA 4TRDA 4HIDA 1Q81C 4MV6A 2R61A 1EIYB 2YU9H 1KDAA 2EY1A 5KFDA 2KOLA 2WIIB 1PZJD 3PUYA 5D3DA 4CKEA 3J7AF 2FK2A 3GTLA 2F0JA 3GIMA 4LSAA 4DUZL 5M3FG 4LF7L 2GVAA 4L6TB 5COYA 5KFRA 1QNUA 4JI5L 4R1JA 2K1BA 4RGNA 3G6XA 4A3FB 1UE7A 2HHHL 1EZ6A 5C6AA 4G7ZC 3JSLA 4PWQA 4A3DH 4AQYH 1K8GA 3QOLA 2R86A 3TZDA 3J81i 3VR5A 2AUKA 3G48A 4JI3L 3Q8PB 2NUCA 4K0KH 1SN8A 3HOYH 3JZIA 1KLUD 3KBGA 2A74C 4A3KH 3CCVA 1B7YB 1WCMA 2Z6KA 1L1OC 2H4OA 1BDOA 1STEA 1K83B 4A93H 4KY7A 3A8KE 1CSPA 1CKNA 3IKJA 1PK8A 5JJZA 1LM0A 3L9AX 2IX3A 5M5YH 4IWYA 2J4XA 1ZHQA 1N33L 2QYZA 1VQBA 4IR1A 3M4OB 4GKJL 1KLGD 3K7AH 3DWQA 1STAA 1PFSA 2OTLA 2VB2X 2QKIC 4WORA 4OHJA 2EYJA 3GTMB 1ZXTA 2Q2IA 2C35B 4K0KQ 2QK4A 2R93A 1STYA 3EA6A 5A2QL 4G7HC 2FKLA 4ED1A 1FVIA 1TWCH 4FYDA 4DR6H 5KFGA 1LTAD 3S16B 1L0XB 3PO2G 2YZNA 5LMUQ 4QWBA 5IGEA 3UQ8A 2VNUD 2YS6A 2SCUB 1PHJA 3HOXB 2CWPA 3TINA 3D4DA 5H1SE 4ZLTF 1O78A 4A3KG 1W93A 5JPNC 1ZHSA 3SDZA 3I4NH 3Q8DA 2W6PA 2F0LA 2FPGB 1UAPA 2NU9B 2CFMA 2GPWA 1HCZA 2KCNA 1RTNA 1U4RA 3KBXA 5D8DA 1KJQA 2F0IA 2BDOA 4ED8A 2RF4A 1ILQA 2ZM6Q 1KDBA 2BH8A 5GAHC 1G291 2F03A 1K1QA 2JA7A 2R3ZA 2PZTA 1V1QA 1LLRD 2JXMB 3MXNA 4EFBA 3M7NA 4ZHQF 1W3SA 1S5BD 1X3EA 1EEFD 5FO8B 5C3EH 4FBUA 4H13C 3CQZH 1EYGA 2CW0D 3E0JA 4DR1L 2YL2A 3G71A 1Y14B 2FHTA 3AQQA 1I4GA 3PIPA 4DR5Q 4EX5A 2ZDHA 4X66H 2HJWA 4QB4A 1FL0A 3BYTB 2W9AA 3TZUA 2W9BB 4LFCL 4QL5A 1QVFA 1YJWA 4IJLA 3A7AB 4XYOA 1B6SA 3W1BA 1SE4A 2B63B 3HGBA 1R9TH 1UE6A 4DR7L 4KHPQ 1VQOA 3FKIH 5M5XH 2YZGA 2EY6A 4U673 5KFIA 4O4LF 2RVLA 3A56A 2ZM6H 4IUQA 1U4PA 4JI2Q 2WKDA 5JQWA 2R6GA 4P75A 2BOSA 2B2WA 2F0OA 1WTOA 1B50A 1A0IA 2KEEA 3QO2A 2H1EA 3VPBA 4UCVA 5KFOA 2I07B 4RKBA 2NVQB 1N32L 4QWAA 5FLMH 2KHIA 3OIPA 4R7RA 4IUUA 1QG7A 3K5IA 5C3EG 3PMFA 5IIFA 2JEJA 3EROA 5IYCG 1XMQQ 1XWEA 1XMQL 4MA5A 1I6VC 5KFMA 4DR5H 3HRZC 1C7YA 4RHRA 4EQPA 1A9XA 2EOTA 5J3BA 4ECRA 1SNMA 3MWYW 1EU4A 5AFWA 2FFKB 5I2YA 3DF7A 3V6HA 4L5TA 2K5QA 4P73A 4NW2A 3MR3A 4TV8F 3S1NB 3V05A 3RAQA 1JOQA 4YHHH 5JOBA 3L4JA 1UNNC 3HOUG 3KYHC 3L3OC 2FLNA 1PH4A 3U9TA 2NB0A 1HZ9A 2BA0A 4LUOA 2VUMB 1SE2A 2WV6D 4JI4L 4A3EB 1C4QA 1BNCA 4V190 2PMZE 4R8NA 4YQWA 1DYQA 5EOYA 2B2TA 5CMDA 4R4CA 1EQQA 1C3OA 3BDLA 1EWHA 2AU0A 1NR4A 1F2YA 2F0MA 3TREA 4LF9H 2RDGA 1BXRA 2F3WA 3RLOA 1TAEA 1W6KA 1GSAA 5I4DA 1AN7A 1QWYA 2OH2A 2L4NA 2AUJD 2W6MA 4NXNH 4MV7A 2RHSB 1KAWA 2FMMA 2WAQB 2QW7A 5C4XG 3EIVA 2XGPA 1RTOA 4ZQ3A 4UHVA 4DUYL 3N6XA 2CCZA 1EUDB 1G8ZD 5KFTA 4DFAA 2KSWA 2YV5A 2K5WA 3M9BA 1WTXA 5LP6F 5C1OA 1VMCA 3BVMA 3WOEA 1EYDA 4C3IH 1K0SA 1DV1A 4RAZA 2HQLA 2LKVA 3BG5A 1FGBD 2IT1A 2ZXOA 3E0EA 3NHHA 2YTXA 4DV6H 4ECVA 1R9TB 4C2MB 4MV8A 2UU9H 3KAJA 3MVVA 1UC8A 2D0PA 4LAAA 4F87A 2X0SA 2BCOA 2B2VC 1VQ8A 1SJHD 1S0MA 3A54A 4JV1A 4B3RQ 4DGZA 4DR2L 4EG0A 4DR2Q 4GKKQ 1ZEQX 1Z2OX 2NTSA 5CORA 4YCUA 1MI2A 2N88A 5KYIA 4DAVA 1TWFB 1CQVA 3SHLA 1HNXL 4KY5A 4A2BA 4GLAC 5KG1A 2ZT9C 1U0LA 3DUZA 2K75A 5EZYF 3J7ZC 4EQOA 4EBDA 3CMEA 3C0FB 1IL2A 4K8IA 4OO1I 4XX0B 1FJGH 1E4EB 2XVSA 4GC6A 4CJ1B 4JI1H 4JI0L 1MJEA 3G6YA 2ZDGA 3G6EA 1KJIA 4CC5A 4DLKA 3NPPA 3RZOH 4JG2A 3N6RA 2UXCL 1VQ7A 4GKKH 4NP5A 2SDFA 2Z6BA 1PVOA 1MSHA 3RB0A 1WI5A 2I0QA 3BJYA 4B3RH 4LFBH 2EDGA 4A93G 1K8OA 3LWBA 3TS0A 3N43B 5E3FA 2F52A 4JV0A 4CDCC 4UP7A 4CGYB 4R8IA 2CH4W 5KFUA 1GYFA 4LFAH 2RKSA 4AYBG 4HNVA 4KJOA 5KG2A 4A3FG 2IL8A 3KF6A 1TU2B 4A3DG 4K5XA 4A3MB 3K7AB 3M4OH 3G6VA 1WD1A 4IR9A 4A3IH 3VR3A 1LTGD 1Q12A 1VQDA 4MHEA 1G91A 4ZI7F 5FLXE 5J22A 3DEPA 1K83A 5DLGA 4J15A 2W71A 4YJ2F 4OELB 2NU6B 4ILWA 3EQLC 1O7IA 3MHBA 1B8AA 1RJQA 2QEJC 2NN6H 1JJ2A 2Z0SA 3NUCA 4OXPA 1TQOA 2JA7G 1S5DD 2ZDQA 5HGTA 4K6LA 3FDTA 3CCRA 2RDIA 2K01A 4YAKB 5E4XA 2VUGA 3GILA 2V4DA 4OONA 2R93B 2UXDL 2JA8B 1RIPA 1Y1VB 2K5NA 1XNQL 4A3GG 1NUCA 2NYZD 2R93H 3GIKA 3GTKH 2Y0SE 2KEDA 5IGFA 4X62H 2IWHA 1HUNA 2YU9A 1HQMC 3S2DH 2KHSA 3PUXA 4Y7NB 1QZHA 1HNXQ 2IA6A 4IUVA 3S1MH 4F4ZA 1GSOA 4LH6A 4Q0YA 2DGYA 2JA5H 3UI2A 4IPCA 5A2QW 3EPGA 2J9GA 2DJFC 3BZKA 1SNCA 2OEOA 2O03A 1SNDA 2EJMA 2K28A 1A3UA 2SNMA 3RTXA 2F4VH 1T5EA 4DR4L 1ILPA 1NR2A 4J8QA 4C3JH 1IYJB 2QDLA 3VR4A 2OWOA 3N40P 3V4SA 2KHJA 4DAMA 3GTKA 2LY7A 1F9QA 2F0SA 2R7DA 5M9OA 4DV0Q 3RAXA 1D5ZC 4EGQA 1XMQH 4ZKCB 2JA7H 1AFPA 4AH6A 4HIMA 4B9WA 1V1PA 1AEXA 2NN6I 5DGBA 1X3FA 1I6HB 3STBD 1BCPC 1DOLA 2L12A 1AUXA 3DWPA 2Y0SG 4X3TA 1B2TA 3QG1A 2B63H 1FGUA 1TS4A 1Y1VG 2QA4A 4A3GB 2A5HA 2WDTA 3KAKA 3IFTA 4DV7H 3RBEA 4JI2H 2VUMA 1JJGA 3UE0A 2FPPB 1UUPA 1EY7A 1JOOA 1UWVA 2K05A 4YHHL 1LT3D 2VY3A 4YCVA 4AQYL 3C3LA 3FPPA 2D5DA 4YBZB 2MFIA 2ZM6L 2EYHA 1PA6A 1VAJA 4B3ML 3MXGA 3S14B 4J9QA 1I50H 4POGA 2AHOB 5EGTA 4BS9A 1YI2A 4BXXG 1IHZA 1U4LA 2F3VA 2KQ3A 3UDXA 4C1NI 2HD3A 5BN3A 2R92G 1F9PA 3FEWX 1RK6A 4L5SA 1GUNA 3RN2A 3JAML 5JPMC 2YZMA 2XC9A 4HSPA 3AYHB 2K6AA 2RSOA 1ASYA 1TT2A 3T1HQ 5IP7H 4LF9L 4YJ3F 4GNXC 1CA5A 2UUCH 3VPDA 4DL2A 3D8GA 2JEBI 1DOKA 4IWXA 2UVRA 1PRTD 3NBIA 1DGSA 4MIUA 4O2AF 1PFMA 1PH9A 3GD7A 1O75A 2WYOA 4O2BF 3PR4A 3SK6A 4GKJH 3MFYA 4ECXA 2F0WA 4F8MA 1JMCA 2F4IA 4JUZA 1BF4A 2K33A 1EY5A 5IYCH 4DV5Q 3CPWA 4DR6L 3SK4A 5KFEA 2K52A 1CQJB 4DL7A 1TWAH 4ECWA 4IQZA 2XNAC 4KN4C 1JDBB 2NWGA 1VQPA 1N8RC 1IW7C 2VA2A 4PG3A 5M5WH 4HIKA 1MSGA 3LX0A 2JA5A 1N36L 1QNKA 2FB9A 3I12A 5KGUA 3JAMW 1P8LA 3VDYA 3DHQA 2VQEQ 1HFGA 1ESFA 4JI8H 2RDFA 1UNSA 1CQFA 1EY0A 1TWFA 4HIOA 5LMUH 2Y0SB 1NY4A 4JI3Q 3ICEA 4DR6Q 2EYLA 2HT1A 1QOHA 3GTLH 2HCIA 1W2BA 3JSNA 3H4BA 2GN5A 5IOCA 3MWMA 3V96A 1K83H 1X3PA 3LWEA 4EGJA 3K0XA 4DV6Q 2C2DA 5C4HA 1IBML 4JI5Q 1JORA 2IX1A 5KRUA 2IW3A 3R2TA 2GVBA 5KT5A 1FJGL 3J7AK 1D8LA 3HG9A 3H0GG 2B2TC 1TR5A 1JLLB 1EYZA 1XMOQ 1BCPD 1I3QH 1TS2A 1UE1A 3D0FA 4NDXA 3I4OA 4ED3A 3TSSA 2CQYA 1GJXA 3CCLA 1XJVA 1VQCA 4GOPB 2ICEC 1I7NA 4JYAH 5JVG3 4UP9A 4G4KA 1HA6A 4HSVA 1A2TA 2N8NA 3S1NH 1PH1A 1E2WA 2RDJA 3FHWA 4RU9A 3W5OA 4CHTB 4QJFA 5C1PA 1S97A 1KQSA 4RUCA 1F77A 1M8AA 2X69A 3B6YA 2E2IH 4I7AA 1AP0A 3PIP3 3SE7A 4HYKA 3E3XA 1K8AC 2PVPA 2Z6KC 5LMNH 3ORQA 4F50A 4R4IA 2EE1A 1XNQQ 4JI4H 2PMZB 5AJ3Q 5KIXA 4JW0A 5L37A 4P74A 2WP8J 4QIWB 4HJ8A 1DZ1A 2YYAA 4GS3A 4JI1L 4BY7H 2WINB 4BBSB 1WD0A 3NXWA 4YR2A 5KFSA 3HOVB 4LF5H 5FLMG 4APMA 4L63B 3GIDA 3RGZA 2M9VA 1IYUA 3F2UA 3LNNA 3KXYT 3U58A 4C56C 4GN5A 3GTLB 5M3MG 4L1KA 4ZKBB 1GUGA 1V4YA 2EQSA 1S4ZA 2A6HD 2JEAI 3N41B 3E9HA 1B04A 1E1OA 4C5AA 1JCKB 4PMWA 4DXGA 2B2UA 5KFYA 1N33Q 1D1KA 1PDQA 5BR8H 1TWGB 1E4FT 4M1UB 3ORRA 1E3PA 4IUTA 2F0DA 3MWEA 3T1YL 5LHY1 1K28A 1G2TA 4IJHA 4S3SA 4DV2Q 3CCSA 3SE0A 2F0NA 4RB1A 2EVBA 3GQCA 4FS2A 3EVQA 2G9HD 2IJ0A 4I50F 4DV6L 3LWUA 4ZOLF 1YNND 1ZYRD 3KF6B 1RJRA 3ND9A 5E1FA 4F7XA 1V1PB 2CZGA 2K04A 4DR4H 2X6GA 4PNYA 2B3GA 5A35A 4FXDA 1YHAA 5LL6X 1V51A 1DCZA 1EOTA 1E7ZA 1ENAA 5KFBA 2C28A 3K7UC 2JA6A 4RCOA 5C44G 1HJPA 2W8KA 2UUBH 2F0KA 1T3NA 1VCIA 5JAVA 2NBFA 4H44C 2R7ZH 5I9OA 1VF5C 1KIXA 3CC2A 1HTLD 2C00A 3NQIA 4ECYA 1Q8KA 3A8IE 1D5XC 4ECTA 1HQRD 2W6NA 3CHBD 4K8JA 1JWUD 1MGSA 2E2DC 2ZJTA 3KTMA 5L1JA 3NE5B 4F88A 5I47A 4LF6H 4JI7H 4ED0A 2JSOA 5DM73 3WDNA 3C2PA 4Y52H 4UCOA 2EYPA 3UDGA 2P5ZX 4J1MA 3OHXC 3K80C 2BH2A 2JA8G 1IYVA 1DIKA 3HB9A 2R93G 2VZAA 1I4HA 4TV9F 2NUAB 5IT9E 2OXPA 2D9UA 3LGJA 2V5AA 4KD4A 1WTHA 5ELDA 4OO1G 5M5YB 2AGQA 2HDMA 2VQFL 4JI0Q 5KFAA 1YNXA 5IWAQ 2JA7B 4I7HA 3KHHA 3T1YQ 3CC7A 2XWJB 4RB3C 5C4ZA 5KEEA 5KFZA 2R8GA 2W57A 4JOIA 4XQNA 2EJFC 1LTRD 2XRSD 2JJQA 3K5MA 1I4QA 1UEAB 2C22A 2HVQA 1DONA 1GUWA 4RMFA 1EIHA 2UXCH 3S2HH 1MBYA 4RHSA 1LTSD 2JA5B 1HRJA 1CQIB 1ZETA 3QFFA 4CC6A 2W9BA 4DL4A 1CM9A 4KK7A 3RV4A 4O0AA 2ZJQA 1AE3A 1IKMA 5IT9W 1PH8A 3J80E 2PNRC 4NMZA 1MZBA 2BR0A 1CE8A 2I8CA 2UVVA 2FMAA 3OYYA 4X64L 2Y0SA 2EZVA 4A4IA 1M7JA 3AFQA 5FO9B 5I9PA 1Z2NX 1ESRA 4DKAC 3SGIA 5IP9H 3A0JA 2JA8H 4HNTA 4IOCA 1XDNA 2E2IA 5KG4A 4DK6C 2ENBA 2NU8B 2V9WA 5E7NA 4J9LA 2ZXPA 3CW2C 1M0TA 4LF7H 3BZDB 3M4QA 3HKSA 4GNXB 4AQYQ 4LF4L 3HOZB 3Q23A 5M3FH 1TS5A 5C0XJ 4XT3B 4YR0A 4RB0A 1IXRA 1GLVA 3M9OB 1K0RA 3JAMc 1VBGA 1RF2D 1HR0Q 3PW4A 4OX9H 1S0OA 5CA0F 4FF4A 4A3IB 1YBYA 3PW0A 1OTCA 3Q6SA 1KRTA 4BBRG 4EYHB 4A3MH 3ER0A 3PW2A 3CF5A 1NCVA 1PFNA 4GOPA 1XMOL 3CD6A 5M3MB 4DPGA 2VQFQ 3HOZG 2QF7A 3Q1KA 1N32H 3GTQH 4YWLA 4XT1B 1PRTB 1VS0A 4XQJA 2FK3A 5LL6S 4G7OC 4K5VA 1WR2A 2RSNA 5FKAC 1S3OA 1JJCB 4JYAL 1BCPB 3KJPA 3M3YB 3FMCA 4P71A 4ED7A 1Y69U 5HV6A 3U4VA 4DV5L 3RNUA 2WACA 3BVZA 1GHKA 2R7LA 5EQ0A 2IMWP 5HY6A 4IZ8A 3I70A 2C5CA 4CDDC 3I4MG 1G6PA 3G6JB 2MO1A 1S03G 3GLKA 1I4PA 1S5ED 3RFCA 1VMPA 2R7MA 4ZQIA 2VQEL 1I3QB 2Z8LA 2DPIA 4BBRH 1KAAA 4IUPA 4PZ7A 1S68A 4IRCA 2WAQG 5IGBA 5CAEB 2MO0A 3KDFA 1EY4A 4X3SA 3FP9A 1EWCA 1WJJA 5TSSA 2JA6H 2R85A 4HCSA 5H80A 2C2EA 4DR3H 4HEDA 5IP7G 4CJ0B 4IFDI 2O5IC 4YR3A 4LF5L 1VQ6A 4PZ8A 3RLFA 3T5LA 3BQ0A 5KFJA 1N48A 2FLPA 4B3MQ 4MNOA 3GTJB 2I5MX 3F1ZA 2VB3X 2Q8TA 3C1FA 4HCEA 1SYXB 4TKOB 4MAMA 2NVTH 2CW0C 4RUAA 2V4RA 2OTJA 3E9IA 4RCNA 4NXNL 4R4QA 5C4XB 4DF7A 3K5NA 4C2MA 1GM5A 4KHPL 4YAJB 3VYUA 1SE3A 2E8GA 2F0HA 3MTSA 1CA6A 4DUZQ 1PV4A 4C3IB 4X65Q 4H7BA 3MEHA 3NSWA 2CW7A 3A5UA 1ZYRC 1I50A 4FF3A 4BY1G 2DWCA 3S24A 2R7NA 2W9CA 2YTYA 3M4YA 1HNWQ 3AEVA 1JE4A 4B3SH 3CRKC 3BJUA 3HP3A 5I6WA 4ECQA 4A3EG 3GTJH 2MJ8A 3I2ZA 4LJZC 2VUMG 4GZYC 1II3A 2KENA 3HXLA 4X3UA 4K0KL 1E4EA 5CYUA 4J6HA 4K2KA 4B3TQ 1KJ8A 3OWEB 1EY8A 5EAYA 4FF2A 5T14A 4X66L 4C1NK 4ABNA 2VW9A 3PSIA 4GLXA 3MFIA 3MJFA 3HEJA 4DV3H 2D0OA 1CKOA 1GUTA 3QOJA 4DV1Q 5K36G 1DV2A 3KHLA 5DQHA 3R8BA 5IWAL 2ATWA 1I4RA 3R93A 5KFWA 4DUYQ 1G51A 4IUNA 1Q1EA 3SK8A 3OIQA 1DJRD 1FNWA 3K5OA 3H40A 1PXUA 3RUZA 1KNAA 5LMUL 3ETJA 1B53A 3GIJA 4LMYA 3RF2A 1QVCA 2NZHA 4A3LH 1JWMD 1O7YA 2HHHH 3CCMA 3NWSA 1VF7A 1HNWL 3M3YH 1BKBA 1YNJD 3KFUA 4HMJA 4UCRA 3OSOA 5EPLA 1L0YB 4POFA 3KHRA 3KLWA 4WJWA 5CV8A 1M1KC 1V9PA 2ALYB 4KMUC 1S72A 4LF7Q 1LO5D 2FLLA 4Q0FA 4LW1A 5LMNW 1JR0D 3A8JE 1ASZA 1WOCA 3LMLA 5DNFA 2DLNA 1RJTA 4A3CG 2EJGC 4IALA 5JEAG 5JVH3 3VPCA 3FDSA 1LUZA 3HKZG 4O1NA 3RZDH 4OL7A 5GROA 1QCBD 1EL0A 3TEHB 1SXTA 3Q8QB 3OTOH 1MJCA 2ZJPA 1H9SA 2VA3A 1NSNS 2FINB 4HJ9A 1B9MA 1Y1VA 3FKIB 5GAGC 2QGQA 4H0LC
chains in the Genus database with same CATH topology
3I7FA 4B3ML 3GO5A 3CCEA 4R4TA 1I50H 4POGA 2AHOB 4YWMA 4JBMA 4BXXG 4PZ6A 1YI2A 1N34Q 2Q2HA 3UDXA 3EN2A 1X55A 4HJ7A 2JA9A 4A3LG 4XTCS 1VQMA 2R92G 2WB1E 4L5SA 1BBWA 4DR3L 3RN2A 1JB7A 3AYHB 4A3BH 3NEMA 1PYBA 3PIOA 4DV3Q 2VUMH 1ASYA 5FJ8H 3T1HQ 5IP7H 4LF9L 4DNIA 1Q46A 4Y7NH 4JCVE 4GNXC 5JJLA 1A8VA 4DV4L 4DV7L 2JEBI 4YWKA 4A3CH 1DGSA 5IP9G 1PH9A 3GD7A 4LFBL 3DLLA 1YJNA 4OWTB 1Y1VH 4H02A 1RL2A 2EIFA 2PNHA 3CC4A 1JMCA 3L2PA 3W1GA 1L0WA 3ZJYC 3NENA 5ELNA 1X3GA 4IO9A 4DV5Q 5IYCH 5ELOA 3CPWA 4DR6L 4DAYB 4B3RL 3WWVA 2K52A 4DR7Q 2N78A 2VS1A 4JI1Q 1TWAH 4OWWB 1KXLA 1KC8C 4TQUS 4NXMQ 3HOWH 1VQPA 1T9HA 1N8RC 4PG3A 5M5WH 2N49A 3F8TA 1SMXA 5C4JH 4HIKA 5IY0A 1XPOA 1N36L 4JI6L 4LFAL 1P8LA 5M3MH 3VDYA 4JI6Q 4JBWA 5IE8A 3TRZA 1PH7A 1VQKA 2JQOA 2VQEQ 1QUQB 1LYLA 5C0XG 2KCTA 2PQAA 2UUBQ 5GAEC 4YY3Q 4HIOA 1C0AA 1M90C 1OXTA 1NY4A 2AMCB 1CSQA 2JE6I 2AWNA 2CKZB 3BZCA 1Q86C 4JI3Q 3ICEA 3S16H 4DR6Q 1L1OB 1IBLQ 2HT1A 4GKKL 3GTLH 4JBKA 1W2BA 3K81C 1CKNB 2K14A 2GN5A 4A3MG 1PH2A 4LFBQ 4LF4Q 1YHBA 1Q82C 3CXCA 1K83H 1VQNA 1VQ5A 3HOYG 1KHIA 2IHFA 3K0XA 2CQOA 4DV6Q 3HOZH 3UDIA 1IBML 4JI5Q 4HIDA 1Q81C 2IX1A 1GVPA 1EIYB 2YU9H 2GVBA 3TQYA 4IFDG 2ZTEA 1FJGL 4DR3Q 3PUYA 1D8LA 1FJGQ 2E2HH 3H0GG 3JC66 4DUZL 5M3FG 4DV0L 1XMOQ 1I3QH 3D0FA 1UE1A 4LF7L 1K9MC 3I4OA 4BY7G 2GVAA 4MTNA 2A8VA 1D7QA 3HFZB 1GD7A 4JI5L 4R1JA 3PV0A 5BR8Q 4X62L 3CCLA 4X6AH 2IX0A 2NVYH 5IYDG 2ES2A 1XJVA 4BY1H 1VQCA 5C44H 4GOPB 1Q7YC 1UE7A 2HHHL 4UP9A 1V43A 5JJKA 4A3DH 4UPAA 2N8NA 4A3JH 1K8GA 2RCNA 1SLJA 3J81c 3S1NH 4OX9L 1PH1A 3J81i 5IT9c 3G48A 3ULPA 4JI3L 3FHWA 3W5OA 1SN8A 2PQAB 4QJFA 2E5LQ 5GAGC 1KQSA 4LF6L 3HOYH 4R4OA 1C9OA 4A3KH 3S14H 3CCVA 1B7YB 2UU9Q 4LF5Q 4LWCA 2E2IH 3B6YA 2Z6KA 1L1OC 1YVCA 3I55A 2ASBA 3MXNB 4A93H 1TXYA 1K8AC 2Z6KC 2UXDQ 4R4IA 1N9WA 1CSPA 2PI2E 1NTGA 3A74A 1CKNA 1TWGH 1N36Q 5AJ3Q 4QGUA 1XNQQ 1LM0A 4JI4Q 4P74A 5M5YH 2WP8J 1VQ4A 4A3GH 4HJ8A 1N33L 4GS3A 1VQBA 4JI1L 4BY7H 4GKJL 3K7AH 1PFSA 4JI8L 2OTLA 4KHZA 4KI0A 3H0GH 5FLMG 1K73C 3CAMA 1NE3A 5IYDH 2Q2IA 2C35B 3F2CA 4K0KQ 4AYBE 4WJ4A 3U58A 1EFWA 4GN5A 1FVIA 1TWCH 1SROA 2JK8A 1S40A 5M3MG 1YHQA 3PO2G 2EQSA 4LUZA 5LMUQ 2JEAI 2WAQE 3E9HA 2VNUD 2H5XA 2YYZA 1E1OA 3D31A 4JYAQ 4PMWA 1PHJA 2CWPA 1X56A 5IYBG 1N33Q 5H1SE 4DV3L 4A3KG 3T1HL 4A3IG 2XGTA 1E3PA 2NN6G 3T1YL 4NB3A 3Q8DA 3I4NH 4IJHA 2UU9L 4DV2Q 4A3EH 3CCSA 1YITA 5GQOA 2CFMA 1XNRL 1AE2A 3ULJA 4BA1I 1QZGA 1Q1BA 1WFQA 1L2FA 2RF4A 5JEAJ 4DV6L 2ZM6Q 4LF6Q 4IPDA 3U4ZA 2BH8A 3UE1A 1G291 5GAHC 2QEXA 1NJIC 2Q2TA 1V1QA 3J80c 3KF6B 3H15A 4B3SL 3A5ZB 2LXKA 4A3FH 3M7NA 1B70B 1W3SA 1X3EA 2UXCQ 5C3EH 3F2BA 3CQZH 1EYGA 2B3GA 4DR1L 3PO2H 1EQRA 1YHAA 4JC0A 1E7ZA 2L15A 3G71A 1EWIA 1Y14B 3AQQA 2I5HA 1YEZA 3K7UC 4GLVB 4EX5A 3PIPA 4DR5Q 1XNRQ 5C44G 1SRUA 1FL0A 1HJPA 1U5KA 2UXBQ 4LFCL 4QL5A 1VCIA 1QVFA 2UXBL 1X54A 1YJWA 4IJLA 3GDEA 2OQKA 2R7ZH 3RZOH 2JA6G 1I5FA 4A75A 4DR4Q 1KIXA 3CC2A 3W1BA 3F2DA 1R9TH 1UE6A 4DR7L 1Q8KA 4KHPQ 4DR1Q 1VQOA 3FKIH 1K3RA 5M5XH 1H95A 3STBC 1HZAA 4O2DA 3M85A 4JI2Q 3OTOQ 4Y52H 4JOIC 2NVQH 3UDGA 2R6GA 1OXUA 4LF8L 2BH2A 2JA8G 3K80C 1Z47A 4P75A 2R93G 2VZAA 5FLXc 1E22A 1A0IA 2ZTCA 3KF8B 3LGJA 4GKJQ 1HZCA 1P16A 5DLQE 1MKHA 4DV1L 3GTOH 4OO1G 3RN5A 2UUBL 1N32L 5FLMH 2KHIA 2VQFL 1XPRA 1YNXA 5IWAQ 2UUCQ 4JI0Q 5C3EG 3T1YQ 1J6QA 3CC7A 1XMQQ 5IYCG 2VL6A 3UDFA 3G4SA 2DUDA 1XMQL 4X66Q 4NXML 4GN4B 4UY8C 4JOIA 1C7YA 2R7ZG 1VQ9A 5J3BA 2JJQA 2ZJRA 3H3VI 5GADC 4LF8Q 1J5EQ 3J80i 1JE5A 4RMFA 4L5TA 3S2HH 4P73A 3S17H 1HNZQ 1YZ6A 1PYSB 1IZ6A 1A62A 3HOXG 4ALPA 2F4VL 3J81j 2NZOA 4A3BG 1QUQA 4O0AA 4DV4Q 3KYHC 2ZJQA 1AE3A 3HOUG 1PH8A 1GO3E 3L7ZC 1PH4A 4X62Q 5BR8L 1TWFH 3OYYA 1HZ9A 1SR3A 1Z9FA 2BA0A 4LUOA 4X64L 1X6OA 4DV7Q 4A4IA 3GTPH 3AFQA 4JI4L 4DKAC 3SGIA 5IP9H 3A0JA 2JA8H 2PMZE 4C3HH 4IOCA 4UP8A 4YCWA 3KJOA 4R4CA 1EQQA 4FDBA 2LSSA 2B63G 1PH3A 3U50C 4A76A 4DK6C 2ZTDA 3PUZA 5E7NA 4P72A 3CW2C 3I56A 3TREA 2WFWA 1YJ9A 4C2MH 4GNXB 3M4QA 1VQAA 3HKSA 4TVAB 3RLOA 3CCJA 3CCQA 4AQYQ 4LF4L 4AIMA 2IY5B 2K5VA 1EIFA 1VQFA 5M3FH 5C0XJ 2R92H 1IXRA 2KBNA 3S15H 1K0RA 3JAMc 1CUKA 2MQHA 2RHSB 1HR0Q 1BBUA 2HHHQ 1KAWA 3HOXH 3GTMH 1I94L 1YBYA 3EIVA 5C4XG 1J5EL 1OTCA 1NMFA 3HOUH 5IYBH 5C4XH 4YY3L 1KRTA 4BBRG 4DUYL 4HJ5A 1A63A 4A3MH 3ER0A 2CCZA 3CF5A 3CMAA 4EQ5A 4DV2L 4GOPA 1XMOL 2YV5A 3M9BA 4IPHA 3CD6A 4DPGA 2VQFQ 4C3IH 3HOZG 2A1AA 4LFAQ 5LMNQ 1YIJA 3GTQH 4YWLA 2HQLA 2HIXA 2K5HA 2HIVA 2IT1A 3E0EA 3PUVA 1KD1C 1VS0A 2V1CC 2YTXA 3K8AA 2UUAQ 1S3OA 2D0PA 1LTLA 1JJCB 1HR0W 2CWAA 1VQ8A 3KJPA 4BBSG 4JYAL 1XPUA 1AH9A 4P71A 4B3RQ 4LNQA 4DR2L 3U4VA 3M4PA 3RLNA 4DV5L 3RNUA 4JV5L 2PI2A 4DR2Q 4JV5Q 5HY6A 3I4MG 3S1QH 3BU2A 4IPGA 4RG1A 4GKKQ 1G6PA 3NELA 4JI8Q 1BVSA 4YCUA 1Y1WG 2MO1A 3PO3H 2OCEA 4GN3B 1HNXL 2UUAL 1SE8A 1VQGA 4BXXH 1L1OA 4GLAC 1NBWA 4GNXA 1U0LA 2VQEL 2K75A 3DM3A 1KRSA 4BBRH 3J7ZC 4PZ7A 3OW2A 4LFCQ 1OXXK 2WAQG 3J7A5 2MO0A 3CMEA 1OXSC 3KDFA 1VQIA 4ME3A 5AJ3L 3S1RH 1IL2A 1VQJA 1GKHA 1WJJA 2IHEA 3FP9A 2JA6H 4OO1I 2UUCL 4JI0L 5FJ8G 1MJEA 5IP7G 4IFDI 3G6EA 4LF5L 3EBEA 3CCUA 1IBKL 3MEFA 4JG2A 4PZ8A 3RLFA 2KCMA 3KOJA 1VQ7A 1VQ6A 4B3TL 2UXCL 1HR0L 4B3MQ 4MNOA 3ERSX 2N3SA 4HJAA 3I4NG 1EUJA 1PVOA 2Q2UA 1WI5A 2I5MX 3F1ZA 2I0QA 4A93G 2R7FA 2NVTH 3TS0A 2OTJA 3E9IA 5C0XI 2F52A 4NXNL 4R4QA 4UP7A 1GM5A 4KHPL 1PH6A 2D62A 2MNAA 2E8GA 3PF5A 3H3VH 4IOAA 4DUZQ 1PV4A 4AYBG 2FXQA 1QVGA 4A3FG 4X65Q 1Y1WH 4X64Q 3KF6A 3PO3G 4A3DG 4X65L 1X65A 4LUVA 4A3JG 2E2JH 4APVA 2JA5G 3A5UA 4BY1G 1X9NA 3M4OH 3S24A 2YTYA 1NMGA 4A3IH 1IBMQ 2F3IA 1Q12A 1HNWQ 1VQDA 4QIWE 4NXNQ 4DK3C 3AEVA 4J15A 3BJUA 2ZM6L 4A3EG 1HNZL 3GTJH 3I2ZA 2ID0A 1UE5A 2VUMG 1O7IA 1B8AA 2KENA 3KDFB 1JJ2A 4QY7A 1VQHA 2K4KA 2Z0SA 2JA7G 4OXPA 4K0KL 1HH2P 1WYDA 4B3TQ 1IBKQ 3CCRA 5EAYA 4JBJA 2A19A 4X66L 2VW9A 3PSIA 4GLXA 2LXJA 2RHQB 4OONA 1JT8A 4GOPC 2UXDL 2AWOA 2D0OA 1CKOA 1MIUA 1EOVA 4DV1Q 1SFOH 1RIPA 1XNQL 2K5NA 2NVXH 4A3GG 5K36G 3CPFA 2R93H 5IWAL 2ATWA 4QQBX 1OXVA 2Y0SE 1E1TA 3HKZE 3GTKH 4DUYQ 1G51A 3I4MH 1N32Q 1Q1EA 2E5LL 3PCOB 2OQ0A 2EXDA 3S2DH 3PUXA 1QZHA 1HNXQ 3TS2A 4BA2I 5LMUL 3GTGH 3S1MH 4MZ9A 4L5RC 4L5QA 4IFDJ 1QVCA 2NZHA 4OWXB 4A3LH 2DGYA 2JA5H 4IPCA 3OTOL 4JI2L 1HZBA 2AKWB 4OX9Q 3BZKA 3RR5A 3CCMA 1KL9A 3PUWA 4KLKA 1HNWL 3M3YH 1BKBA 3KFUA 3NBHB 3CP0A 3IRBA 4DR4L 2WB1G 4WJ3M 4C3JH 1IYJB 4POFA 4NPSA 2OWOA 2KHJA 4DAMA 1PH5A 5LMNL 3KLWA 2K50A 2R7DA 4DV0Q 4LF9Q 1M1KC 1V9PA 2ALYB 4LF7Q 1S72A 1VQEA 3FKIG 1E24A 2JA7H 4LW1A 5LMNW 4DR5L 2YTVA 4AH6A 4HIMA 3HOVG 2NN6I 2B29A 3L0OA 1WOCA 1ASZA 1VQLA 1N34L 1X3FA 1TWHH 3STBD 1WCMH 3HOVH 4A3CG 5JEAG 1XTDA 3PF4A 1LUZA 4BBSH 3HKZG 2Y0SG 3AFPA 3RZDH 2B63H 1I6HH 1WCMG 5HGQA 1FGUA 1Y1VG 5GROA 3ULLA 3JAMi 2QA4A 2F4VQ 3TEHB 1I94Q 4B3SQ 3PGZA 3UE0A 2BA1A 1MJCA 2ZJPA 5JJIA 3HOWG 1JJGA 4JI7Q 1UWVA 2XTIA 4YHHL 2I5LX 4HJ9A 1IBLL 4JI7L 2VY3A 4YCVA 4AQYL 4YHHQ 1UEBA 2MFIA 1CKMA 1PA6A 2QGQA 4XIGS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7F A;  4B3M L;  3GO5 A;  3CCE A;  4R4T A;  1I50 H;  4POG A;  2AHO B;  4YWM A;  4JBM A;  4BXX G;  4PZ6 A;  1YI2 A;  1N34 Q;  2Q2H A;  3UDX A;  3EN2 A;  1X55 A;  4HJ7 A;  2JA9 A;  4A3L G;  4XTC S;  1VQM A;  2R92 G;  2WB1 E;  4L5S A;  1BBW A;  4DR3 L;  3RN2 A;  1JB7 A;  3AYH B;  4A3B H;  3NEM A;  1PYB A;  3PIO A;  4DV3 Q;  2VUM H;  1ASY A;  5FJ8 H;  3T1H Q;  5IP7 H;  4LF9 L;  4DNI A;  1Q46 A;  4Y7N H;  4JCV E;  4GNX C;  5JJL A;  1A8V A;  4DV4 L;  4DV7 L;  2JEB I;  4YWK A;  4A3C H;  1DGS A;  5IP9 G;  1PH9 A;  3GD7 A;  4LFB L;  3DLL A;  1YJN A;  4OWT B;  1Y1V H;  4H02 A;  1RL2 A;  2EIF A;  2PNH A;  3CC4 A;  1JMC A;  3L2P A;  3W1G A;  1L0W A;  3ZJY C;  3NEN A;  5ELN A;  1X3G A;  4IO9 A;  4DV5 Q;  5IYC H;  5ELO A;  3CPW A;  4DR6 L;  4DAY B;  4B3R L;  3WWV A;  2K52 A;  4DR7 Q;  2N78 A;  2VS1 A;  4JI1 Q;  1TWA H;  4OWW B;  1KXL A;  1KC8 C;  4TQU S;  4NXM Q;  3HOW H;  1VQP A;  1T9H A;  1N8R C;  4PG3 A;  5M5W H;  2N49 A;  3F8T A;  1SMX A;  5C4J H;  4HIK A;  5IY0 A;  1XPO A;  1N36 L;  4JI6 L;  4LFA L;  1P8L A;  5M3M H;  3VDY A;  4JI6 Q;  4JBW A;  5IE8 A;  3TRZ A;  1PH7 A;  1VQK A;  2JQO A;  2VQE Q;  1QUQ B;  1LYL A;  5C0X G;  2KCT A;  2PQA A;  2UUB Q;  5GAE C;  4YY3 Q;  4HIO A;  1C0A A;  1M90 C;  1OXT A;  1NY4 A;  2AMC B;  1CSQ A;  2JE6 I;  2AWN A;  2CKZ B;  3BZC A;  1Q86 C;  4JI3 Q;  3ICE A;  3S16 H;  4DR6 Q;  1L1O B;  1IBL Q;  2HT1 A;  4GKK L;  3GTL H;  4JBK A;  1W2B A;  3K81 C;  1CKN B;  2K14 A;  2GN5 A;  4A3M G;  1PH2 A;  4LFB Q;  4LF4 Q;  1YHB A;  1Q82 C;  3CXC A;  1K83 H;  1VQN A;  1VQ5 A;  3HOY G;  1KHI A;  2IHF A;  3K0X A;  2CQO A;  4DV6 Q;  3HOZ H;  3UDI A;  1IBM L;  4JI5 Q;  4HID A;  1Q81 C;  2IX1 A;  1GVP A;  1EIY B;  2YU9 H;  2GVB A;  3TQY A;  4IFD G;  2ZTE A;  1FJG L;  4DR3 Q;  3PUY A;  1D8L A;  1FJG Q;  2E2H H;  3H0G G;  3JC6 6;  4DUZ L;  5M3F G;  4DV0 L;  1XMO Q;  1I3Q H;  3D0F A;  1UE1 A;  4LF7 L;  1K9M C;  3I4O A;  4BY7 G;  2GVA A;  4MTN A;  2A8V A;  1D7Q A;  3HFZ B;  1GD7 A;  4JI5 L;  4R1J A;  3PV0 A;  5BR8 Q;  4X62 L;  3CCL A;  4X6A H;  2IX0 A;  2NVY H;  5IYD G;  2ES2 A;  1XJV A;  4BY1 H;  1VQC A;  5C44 H;  4GOP B;  1Q7Y C;  1UE7 A;  2HHH L;  4UP9 A;  1V43 A;  5JJK A;  4A3D H;  4UPA A;  2N8N A;  4A3J H;  1K8G A;  2RCN A;  1SLJ A;  3J81 c;  3S1N H;  4OX9 L;  1PH1 A;  3J81 i;  5IT9 c;  3G48 A;  3ULP A;  4JI3 L;  3FHW A;  3W5O A;  1SN8 A;  2PQA B;  4QJF A;  2E5L Q;  5GAG C;  1KQS A;  4LF6 L;  3HOY H;  4R4O A;  1C9O A;  4A3K H;  3S14 H;  3CCV A;  1B7Y B;  2UU9 Q;  4LF5 Q;  4LWC A;  2E2I H;  3B6Y A;  2Z6K A;  1L1O C;  1YVC A;  3I55 A;  2ASB A;  3MXN B;  4A93 H;  1TXY A;  1K8A C;  2Z6K C;  2UXD Q;  4R4I A;  1N9W A;  1CSP A;  2PI2 E;  1NTG A;  3A74 A;  1CKN A;  1TWG H;  1N36 Q;  5AJ3 Q;  4QGU A;  1XNQ Q;  1LM0 A;  4JI4 Q;  4P74 A;  5M5Y H;  2WP8 J;  1VQ4 A;  4A3G H;  4HJ8 A;  1N33 L;  4GS3 A;  1VQB A;  4JI1 L;  4BY7 H;  4GKJ L;  3K7A H;  1PFS A;  4JI8 L;  2OTL A;  4KHZ A;  4KI0 A;  3H0G H;  5FLM G;  1K73 C;  3CAM A;  1NE3 A;  5IYD H;  2Q2I A;  2C35 B;  3F2C A;  4K0K Q;  4AYB E;  4WJ4 A;  3U58 A;  1EFW A;  4GN5 A;  1FVI A;  1TWC H;  1SRO A;  2JK8 A;  1S40 A;  5M3M G;  1YHQ A;  3PO2 G;  2EQS A;  4LUZ A;  5LMU Q;  2JEA I;  2WAQ E;  3E9H A;  2VNU D;  2H5X A;  2YYZ A;  1E1O A;  3D31 A;  4JYA Q;  4PMW A;  1PHJ A;  2CWP A;  1X56 A;  5IYB G;  1N33 Q;  5H1S E;  4DV3 L;  4A3K G;  3T1H L;  4A3I G;  2XGT A;  1E3P A;  2NN6 G;  3T1Y L;  4NB3 A;  3Q8D A;  3I4N H;  4IJH A;  2UU9 L;  4DV2 Q;  4A3E H;  3CCS A;  1YIT A;  5GQO A;  2CFM A;  1XNR L;  1AE2 A;  3ULJ A;  4BA1 I;  1QZG A;  1Q1B A;  1WFQ A;  1L2F A;  2RF4 A;  5JEA J;  4DV6 L;  2ZM6 Q;  4LF6 Q;  4IPD A;  3U4Z A;  2BH8 A;  3UE1 A;  1G29 1;  5GAH C;  2QEX A;  1NJI C;  2Q2T A;  1V1Q A;  3J80 c;  3KF6 B;  3H15 A;  4B3S L;  3A5Z B;  2LXK A;  4A3F H;  3M7N A;  1B70 B;  1W3S A;  1X3E A;  2UXC Q;  5C3E H;  3F2B A;  3CQZ H;  1EYG A;  2B3G A;  4DR1 L;  3PO2 H;  1EQR A;  1YHA A;  4JC0 A;  1E7Z A;  2L15 A;  3G71 A;  1EWI A;  1Y14 B;  3AQQ A;  2I5H A;  1YEZ A;  3K7U C;  4GLV B;  4EX5 A;  3PIP A;  4DR5 Q;  1XNR Q;  5C44 G;  1SRU A;  1FL0 A;  1HJP A;  1U5K A;  2UXB Q;  4LFC L;  4QL5 A;  1VCI A;  1QVF A;  2UXB L;  1X54 A;  1YJW A;  4IJL A;  3GDE A;  2OQK A;  2R7Z H;  3RZO H;  2JA6 G;  1I5F A;  4A75 A;  4DR4 Q;  1KIX A;  3CC2 A;  3W1B A;  3F2D A;  1R9T H;  1UE6 A;  4DR7 L;  1Q8K A;  4KHP Q;  4DR1 Q;  1VQO A;  3FKI H;  1K3R A;  5M5X H;  1H95 A;  3STB C;  1HZA A;  4O2D A;  3M85 A;  4JI2 Q;  3OTO Q;  4Y52 H;  4JOI C;  2NVQ H;  3UDG A;  2R6G A;  1OXU A;  4LF8 L;  2BH2 A;  2JA8 G;  3K80 C;  1Z47 A;  4P75 A;  2R93 G;  2VZA A;  5FLX c;  1E22 A;  1A0I A;  2ZTC A;  3KF8 B;  3LGJ A;  4GKJ Q;  1HZC A;  1P16 A;  5DLQ E;  1MKH A;  4DV1 L;  3GTO H;  4OO1 G;  3RN5 A;  2UUB L;  1N32 L;  5FLM H;  2KHI A;  2VQF L;  1XPR A;  1YNX A;  5IWA Q;  2UUC Q;  4JI0 Q;  5C3E G;  3T1Y Q;  1J6Q A;  3CC7 A;  1XMQ Q;  5IYC G;  2VL6 A;  3UDF A;  3G4S A;  2DUD A;  1XMQ L;  4X66 Q;  4NXM L;  4GN4 B;  4UY8 C;  4JOI A;  1C7Y A;  2R7Z G;  1VQ9 A;  5J3B A;  2JJQ A;  2ZJR A;  3H3V I;  5GAD C;  4LF8 Q;  1J5E Q;  3J80 i;  1JE5 A;  4RMF A;  4L5T A;  3S2H H;  4P73 A;  3S17 H;  1HNZ Q;  1YZ6 A;  1PYS B;  1IZ6 A;  1A62 A;  3HOX G;  4ALP A;  2F4V L;  3J81 j;  2NZO A;  4A3B G;  1QUQ A;  4O0A A;  4DV4 Q;  3KYH C;  2ZJQ A;  1AE3 A;  3HOU G;  1PH8 A;  1GO3 E;  3L7Z C;  1PH4 A;  4X62 Q;  5BR8 L;  1TWF H;  3OYY A;  1HZ9 A;  1SR3 A;  1Z9F A;  2BA0 A;  4LUO A;  4X64 L;  1X6O A;  4DV7 Q;  4A4I A;  3GTP H;  3AFQ A;  4JI4 L;  4DKA C;  3SGI A;  5IP9 H;  3A0J A;  2JA8 H;  2PMZ E;  4C3H H;  4IOC A;  4UP8 A;  4YCW A;  3KJO A;  4R4C A;  1EQQ A;  4FDB A;  2LSS A;  2B63 G;  1PH3 A;  3U50 C;  4A76 A;  4DK6 C;  2ZTD A;  3PUZ A;  5E7N A;  4P72 A;  3CW2 C;  3I56 A;  3TRE A;  2WFW A;  1YJ9 A;  4C2M H;  4GNX B;  3M4Q A;  1VQA A;  3HKS A;  4TVA B;  3RLO A;  3CCJ A;  3CCQ A;  4AQY Q;  4LF4 L;  4AIM A;  2IY5 B;  2K5V A;  1EIF A;  1VQF A;  5M3F H;  5C0X J;  2R92 H;  1IXR A;  2KBN A;  3S15 H;  1K0R A;  3JAM c;  1CUK A;  2MQH A;  2RHS B;  1HR0 Q;  1BBU A;  2HHH Q;  1KAW A;  3HOX H;  3GTM H;  1I94 L;  1YBY A;  3EIV A;  5C4X G;  1J5E L;  1OTC A;  1NMF A;  3HOU H;  5IYB H;  5C4X H;  4YY3 L;  1KRT A;  4BBR G;  4DUY L;  4HJ5 A;  1A63 A;  4A3M H;  3ER0 A;  2CCZ A;  3CF5 A;  3CMA A;  4EQ5 A;  4DV2 L;  4GOP A;  1XMO L;  2YV5 A;  3M9B A;  4IPH A;  3CD6 A;  4DPG A;  2VQF Q;  4C3I H;  3HOZ G;  2A1A A;  4LFA Q;  5LMN Q;  1YIJ A;  3GTQ H;  4YWL A;  2HQL A;  2HIX A;  2K5H A;  2HIV A;  2IT1 A;  3E0E A;  3PUV A;  1KD1 C;  1VS0 A;  2V1C C;  2YTX A;  3K8A A;  2UUA Q;  1S3O A;  2D0P A;  1LTL A;  1JJC B;  1HR0 W;  2CWA A;  1VQ8 A;  3KJP A;  4BBS G;  4JYA L;  1XPU A;  1AH9 A;  4P71 A;  4B3R Q;  4LNQ A;  4DR2 L;  3U4V A;  3M4P A;  3RLN A;  4DV5 L;  3RNU A;  4JV5 L;  2PI2 A;  4DR2 Q;  4JV5 Q;  5HY6 A;  3I4M G;  3S1Q H;  3BU2 A;  4IPG A;  4RG1 A;  4GKK Q;  1G6P A;  3NEL A;  4JI8 Q;  1BVS A;  4YCU A;  1Y1W G;  2MO1 A;  3PO3 H;  2OCE A;  4GN3 B;  1HNX L;  2UUA L;  1SE8 A;  1VQG A;  4BXX H;  1L1O A;  4GLA C;  1NBW A;  4GNX A;  1U0L A;  2VQE L;  2K75 A;  3DM3 A;  1KRS A;  4BBR H;  3J7Z C;  4PZ7 A;  3OW2 A;  4LFC Q;  1OXX K;  2WAQ G;  3J7A 5;  2MO0 A;  3CME A;  1OXS C;  3KDF A;  1VQI A;  4ME3 A;  5AJ3 L;  3S1R H;  1IL2 A;  1VQJ A;  1GKH A;  1WJJ A;  2IHE A;  3FP9 A;  2JA6 H;  4OO1 I;  2UUC L;  4JI0 L;  5FJ8 G;  1MJE A;  5IP7 G;  4IFD I;  3G6E A;  4LF5 L;  3EBE A;  3CCU A;  1IBK L;  3MEF A;  4JG2 A;  4PZ8 A;  3RLF A;  2KCM A;  3KOJ A;  1VQ7 A;  1VQ6 A;  4B3T L;  2UXC L;  1HR0 L;  4B3M Q;  4MNO A;  3ERS X;  2N3S A;  4HJA A;  3I4N G;  1EUJ A;  1PVO A;  2Q2U A;  1WI5 A;  2I5M X;  3F1Z A;  2I0Q A;  4A93 G;  2R7F A;  2NVT H;  3TS0 A;  2OTJ A;  3E9I A;  5C0X I;  2F52 A;  4NXN L;  4R4Q A;  4UP7 A;  1GM5 A;  4KHP L;  1PH6 A;  2D62 A;  2MNA A;  2E8G A;  3PF5 A;  3H3V H;  4IOA A;  4DUZ Q;  1PV4 A;  4AYB G;  2FXQ A;  1QVG A;  4A3F G;  4X65 Q;  1Y1W H;  4X64 Q;  3KF6 A;  3PO3 G;  4A3D G;  4X65 L;  1X65 A;  4LUV A;  4A3J G;  2E2J H;  4APV A;  2JA5 G;  3A5U A;  4BY1 G;  1X9N A;  3M4O H;  3S24 A;  2YTY A;  1NMG A;  4A3I H;  1IBM Q;  2F3I A;  1Q12 A;  1HNW Q;  1VQD A;  4QIW E;  4NXN Q;  4DK3 C;  3AEV A;  4J15 A;  3BJU A;  2ZM6 L;  4A3E G;  1HNZ L;  3GTJ H;  3I2Z A;  2ID0 A;  1UE5 A;  2VUM G;  1O7I A;  1B8A A;  2KEN A;  3KDF B;  1JJ2 A;  4QY7 A;  1VQH A;  2K4K A;  2Z0S A;  2JA7 G;  4OXP A;  4K0K L;  1HH2 P;  1WYD A;  4B3T Q;  1IBK Q;  3CCR A;  5EAY A;  4JBJ A;  2A19 A;  4X66 L;  2VW9 A;  3PSI A;  4GLX A;  2LXJ A;  2RHQ B;  4OON A;  1JT8 A;  4GOP C;  2UXD L;  2AWO A;  2D0O A;  1CKO A;  1MIU A;  1EOV A;  4DV1 Q;  1SFO H;  1RIP A;  1XNQ L;  2K5N A;  2NVX H;  4A3G G;  5K36 G;  3CPF A;  2R93 H;  5IWA L;  2ATW A;  4QQB X;  1OXV A;  2Y0S E;  1E1T A;  3HKZ E;  3GTK H;  4DUY Q;  1G51 A;  3I4M H;  1N32 Q;  1Q1E A;  2E5L L;  3PCO B;  2OQ0 A;  2EXD A;  3S2D H;  3PUX A;  1QZH A;  1HNX Q;  3TS2 A;  4BA2 I;  5LMU L;  3GTG H;  3S1M H;  4MZ9 A;  4L5R C;  4L5Q A;  4IFD J;  1QVC A;  2NZH A;  4OWX B;  4A3L H;  2DGY A;  2JA5 H;  4IPC A;  3OTO L;  4JI2 L;  1HZB A;  2AKW B;  4OX9 Q;  3BZK A;  3RR5 A;  3CCM A;  1KL9 A;  3PUW A;  4KLK A;  1HNW L;  3M3Y H;  1BKB A;  3KFU A;  3NBH B;  3CP0 A;  3IRB A;  4DR4 L;  2WB1 G;  4WJ3 M;  4C3J H;  1IYJ B;  4POF A;  4NPS A;  2OWO A;  2KHJ A;  4DAM A;  1PH5 A;  5LMN L;  3KLW A;  2K50 A;  2R7D A;  4DV0 Q;  4LF9 Q;  1M1K C;  1V9P A;  2ALY B;  4LF7 Q;  1S72 A;  1VQE A;  3FKI G;  1E24 A;  2JA7 H;  4LW1 A;  5LMN W;  4DR5 L;  2YTV A;  4AH6 A;  4HIM A;  3HOV G;  2NN6 I;  2B29 A;  3L0O A;  1WOC A;  1ASZ A;  1VQL A;  1N34 L;  1X3F A;  1TWH H;  3STB D;  1WCM H;  3HOV H;  4A3C G;  5JEA G;  1XTD A;  3PF4 A;  1LUZ A;  4BBS H;  3HKZ G;  2Y0S G;  3AFP A;  3RZD H;  2B63 H;  1I6H H;  1WCM G;  5HGQ A;  1FGU A;  1Y1V G;  5GRO A;  3ULL A;  3JAM i;  2QA4 A;  2F4V Q;  3TEH B;  1I94 Q;  4B3S Q;  3PGZ A;  3UE0 A;  2BA1 A;  1MJC A;  2ZJP A;  5JJI A;  3HOW G;  1JJG A;  4JI7 Q;  1UWV A;  2XTI A;  4YHH L;  2I5L X;  4HJ9 A;  1IBL L;  4JI7 L;  2VY3 A;  4YCV A;  4AQY L;  4YHH Q;  1UEB A;  2MFI A;  1CKM A;  1PA6 A;  2QGQ A;  4XIG S; 
#chains in the Genus database with same CATH topology
 3I7F A;  3Q8S B;  4DR1 H;  1TVX A;  3F8N A;  5DLF A;  4NLG A;  4PZ6 A;  4X64 H;  3MFG A;  1KTK A;  4Q44 A;  1N34 Q;  4HJ7 A;  1J5E H;  3T16 A;  4XTC S;  1VQM A;  5DEH A;  4DUY H;  5EWF A;  2UXB H;  2BE5 D;  4I55 F;  3NEM A;  1BGW A;  1XNR H;  2L1B A;  1X32 A;  5BN4 A;  3R5F A;  4KN7 C;  5FJ8 H;  4N9P A;  3PW5 A;  1Q46 A;  3T1Y H;  3K0Y A;  2J6U A;  4EYI B;  5JJL A;  4DV7 L;  4YWK A;  4RZQ A;  5FLX W;  4O3S A;  4EQN A;  4MV4 A;  4OWT B;  4DAP A;  1BJT A;  1H9R A;  4WRD A;  2XIG A;  1RL2 A;  2EIF A;  4OO1 H;  1DD2 A;  3L2P A;  3ZJY C;  2Z4H A;  5JEA H;  3FPU B;  1X3G A;  4B3R L;  3KAL A;  4DAY B;  3TN2 A;  4TQR A;  1H9K A;  3WWV A;  2P0A A;  4FM9 A;  4DR7 Q;  2N78 A;  2VS1 A;  1HNW H;  4EEY A;  1XXG A;  3IFD A;  4TQU S;  3T5H A;  1SBB B;  3IN5 A;  3MR5 A;  3MAQ A;  1R4Q B;  3I4N B;  5F2D A;  4DN4 M;  4YIJ A;  5IY0 A;  1LTI D;  4JI6 L;  1RKN A;  4KY6 A;  2L9H A;  3DEO A;  5IE8 A;  1PH7 A;  3TRZ A;  2NVY A;  2J0T D;  1QUQ B;  2YRX A;  2XWB B;  2PQA A;  3V6K A;  1RDP D;  3K59 A;  4IUR A;  5GAE C;  2HVR A;  4ULL A;  1WCM B;  1TWA A;  1C0A A;  1M90 C;  5K2M A;  3HKZ B;  2AMC B;  2JE6 I;  1AW7 A;  2CKZ B;  1ZKO A;  3S16 H;  5D1O A;  5KFX A;  1FKA H;  5EWE A;  4GKK L;  3OUU A;  3X3M A;  4IZO A;  1D2B A;  1HFN A;  4A3M G;  5DQG A;  3RB4 A;  5JVD F;  3BDO A;  4LF4 Q;  5DG7 A;  2A68 D;  2MUY A;  2BQU A;  3T56 B;  3SR1 A;  3HOY G;  1KHI A;  2KCC A;  5IGD A;  1LV9 A;  2CQO A;  2R8I A;  1FYC A;  5D3I B;  3S9W A;  3R23 A;  2J7Z A;  2O5J C;  5C5M A;  3H6M A;  2A69 C;  4B9X A;  2E2H H;  2YCH A;  1STN A;  3JAM E;  5CGK A;  3M9N B;  4DV0 L;  1BO0 A;  5CV5 A;  2A8V A;  3T4A C;  3GII A;  4X6A H;  5L1K A;  5IYD G;  1A2U A;  3NQT A;  4BY1 H;  5C44 H;  1V43 A;  1Z6H A;  2FJ2 A;  3TQT A;  2A73 B;  4K14 A;  5JJK A;  4UPA A;  3TP8 A;  3N42 B;  2RCN A;  3J81 c;  3T5J A;  4BBR B;  1WH2 A;  3GTP A;  4QMG A;  1JWS D;  2MGS A;  2XRQ D;  2FE3 A;  4XYL B;  3ULP A;  1W96 A;  1M4V A;  3DM1 A;  4LF6 L;  5JVL A;  1E2Z A;  4R4O A;  1C9O A;  2W9C B;  3TBI B;  2UUA H;  4LWC A;  2B8F A;  2F0Q A;  3QJY A;  1YVC A;  5IT9 L;  3K3V A;  3I55 A;  3MXN B;  4O4H F;  1TXY A;  2L11 A;  2HCC A;  2UXD Q;  4J9R A;  1N9W A;  2W6Q A;  1EFI D;  2PI2 E;  1SSO A;  1TWG H;  3BYY B;  1N36 Q;  4QGU A;  1D1I A;  4JI4 Q;  1XNQ H;  2L55 A;  4DV4 H;  5DQI A;  3TIG A;  5KFN A;  4JI8 L;  3KLR A;  1I3Q A;  1K73 C;  3CAM A;  1NE3 A;  5IYD H;  1STH A;  3E5N A;  4LF8 H;  4WJ4 A;  3NTH A;  1EFW A;  4RNM A;  4YB8 B;  2WE6 A;  3ERQ A;  2PCF B;  1JDE A;  1YHQ A;  2B63 A;  5FPR A;  3NTK A;  4LUZ A;  4YY3 H;  3QWN A;  2AQ1 B;  2QCP X;  2YYZ A;  1X56 A;  5IYB G;  1A15 A;  3QIA A;  4DV3 L;  3RGX A;  3T1H L;  4NKL A;  4WFN 3;  1E4G T;  2NN6 G;  4MTD A;  4NB3 A;  4U6P A;  4A3E H;  3TP6 A;  1J9O A;  1PTO C;  5GQO A;  1AE2 A;  5KT4 A;  2QDB A;  1I4X A;  3KF8 A;  3P75 A;  4BA1 I;  5EKI A;  1ML0 D;  1RHP A;  1Q1B A;  2I46 A;  1PTO H;  4DK0 A;  2W6Z A;  2HUG A;  2RA4 A;  5JEA J;  3K58 A;  4Q5V A;  5KT2 A;  4IPD A;  2EYF A;  4WBN F;  5C5J A;  5KFQ A;  1GUO A;  2R6F A;  3K3P A;  5KT3 A;  2Q2T A;  3J80 c;  1A3V A;  1HNZ H;  4B3S L;  3A5Z B;  2LXK A;  2UXC Q;  3QZ7 A;  1JIH A;  2VOB A;  1VBH A;  1ONL A;  3PO2 H;  1ULZ A;  4HR7 A;  1EQR A;  1CTM A;  3A7L A;  2L15 A;  1EWI A;  2I5H A;  1YEZ A;  2KUM A;  3S1Q B;  1Z2P X;  1NNX A;  1U5K A;  2PYK A;  1GXD C;  2VQE H;  3GDE A;  2JA6 G;  2B39 A;  5KG0 A;  2B2U C;  4DR1 Q;  1C48 A;  1K3R A;  1H95 A;  1SNP A;  1BNZ A;  1HZA A;  4O2D A;  2NTT A;  4AYB B;  1TWG A;  5CC4 A;  4FU0 A;  1I94 H;  4PQX A;  3GIQ A;  4JOI C;  1R4P B;  2V59 A;  5BPH A;  1H9M A;  1SAP A;  1Z47 A;  3H3V C;  1FNU A;  3HOU B;  2KJX A;  1E22 A;  1U4M A;  3HZX A;  4GKJ Q;  1HZC A;  1P16 A;  1B4O A;  1MKH A;  5DLQ E;  2K7V A;  4ZUJ A;  4DV1 L;  3GTO H;  3RN5 A;  2UUB L;  5ELE A;  2A69 D;  1ET6 A;  1XPR A;  3D6W A;  2VL6 A;  3G4S A;  2DUD A;  3ONA B;  3C46 A;  1K3B C;  1XX8 A;  4NXM L;  5KND A;  3GTG B;  3I4L A;  1X3Q A;  1O7L A;  3BS1 A;  2ZJR A;  1LTT D;  3D4R A;  4O42 A;  4LF8 Q;  2X6L A;  1J5E Q;  4N8X 1;  3MC0 B;  3J80 i;  5C3E B;  3SI8 A;  3K57 A;  2JA6 B;  1EZ8 A;  1HNZ Q;  4DXF A;  1ENF A;  1PYS B;  4A3J B;  1IZ6 A;  1A62 A;  2R8J A;  2K03 A;  2MP1 A;  4ALP A;  5D14 A;  4UCU A;  4C3J G;  2GLT A;  2NZO A;  4A3B G;  1QUQ A;  4DV4 Q;  4WD3 A;  1AN8 A;  1GO3 E;  2JP1 A;  3L7Z C;  4ZCK A;  1Z9F A;  1SR3 A;  2CQA A;  3HKZ A;  5FD5 A;  4Q43 A;  1RJP A;  1F2L A;  2LS0 1;  4QWC A;  1JQY D;  4C3H H;  5K5P A;  4UP8 A;  3R5X A;  4YCW A;  3KJO A;  2E5L H;  5KNC A;  4GC7 A;  2LSS A;  2PW5 A;  1PH3 A;  3U50 C;  1ROD A;  3RMH A;  5ISR A;  2B63 G;  5LYJ F;  1IBK H;  3GV3 A;  3I56 A;  2JEG A;  4ME6 A;  2WFW A;  3I91 A;  1VQA A;  3U9O A;  2EYM A;  4TVA B;  1MHW C;  4AIM A;  3LP8 A;  2M2L A;  3MWD A;  1LAB A;  2KBN A;  3S15 H;  4QCL A;  2MQH A;  4MTE A;  1BBU A;  2HHH Q;  2IP4 A;  2YRW A;  1IBM H;  3V2T A;  3GTM H;  1I94 L;  3IG0 A;  3TQ1 A;  1K8M A;  2NZ1 D;  3BA9 A;  1KNE A;  3HOU H;  1JX4 A;  3OSN A;  3BQ1 A;  1A63 A;  1HNX H;  4DV2 L;  1Y1W B;  5L1L A;  1S0N A;  1S5F D;  1CT1 D;  1YIJ A;  2UXD H;  2JN4 A;  3PUV A;  4EEQ A;  1HUM A;  1KD1 C;  4YP3 A;  3E5S A;  2KA7 A;  2UUA Q;  4BY7 B;  1HR0 W;  5EPK A;  1XPU A;  2R8K A;  1EUC B;  4OIJ A;  3MR2 A;  5K36 H;  3M4P A;  2D2C C;  4RKL A;  5ELC A;  5FO7 B;  3RLN A;  2CVR A;  4A3D B;  3T5K A;  3S1Q H;  1EYA A;  3S1M B;  4RG1 A;  2E2I B;  5DGA A;  3NEL A;  2ASD A;  1BVS A;  4I65 A;  1KJ9 A;  2OCE A;  3PO2 B;  3EJI A;  2UUA L;  3I72 A;  5IGC A;  4FVM A;  1NBW A;  4GNX A;  2R84 A;  5KG3 A;  2XSC A;  1KRS A;  2SOB A;  4LFC Q;  1OXX K;  4RAU C;  1OXS C;  4CBV A;  1VQI A;  4ME3 A;  3S1R H;  1GKH A;  2IHE A;  3S2H B;  3MXU A;  2UUC L;  1CZG A;  1PTO B;  2XN9 C;  5FJ8 G;  3OHA A;  4O3Q A;  2WAQ A;  4ETS A;  4KD3 A;  2Z9H A;  3EBE A;  1IBK L;  3MEF A;  1GGO A;  2B2W C;  4JI5 H;  3KOJ A;  2O2L D;  1BR9 A;  2JYO A;  3FMA A;  2PW7 A;  1EUJ A;  3U9S A;  2VR1 A;  4TUY F;  5FLX L;  5CB4 F;  2R7F A;  1ICW A;  5C0X I;  2XCL A;  3J80 W;  3Q8R B;  2EXZ A;  4CJ2 C;  1PH6 A;  2W7P A;  2MNA A;  3H3V H;  5JH7 F;  3PVX A;  1STB A;  5KFK A;  5CV4 A;  2FXQ A;  1QVG A;  4J9M A;  4IAJ A;  1N34 H;  2PBZ A;  4X64 Q;  2BDN A;  1M6V A;  5C4J B;  2E2J H;  2JA5 G;  2PZU A;  5T1G A;  1CS0 A;  1IBM Q;  3TME A;  4DR7 H;  1EU3 A;  1GSH A;  4DK3 C;  2YW2 A;  1C8C A;  5C5L A;  1SYD A;  1Y8N B;  1HNZ L;  2ID0 A;  1PZK D;  2L0C A;  4F4Y A;  2A6E D;  4CKC A;  4KTA A;  5M5W B;  4QY7 A;  2K4K A;  3RZO B;  1HH2 P;  3VA5 A;  5IOD A;  3SXH A;  1HXY D;  3GV5 B;  1OO9 B;  1PRT F;  1IBK Q;  5EWG A;  4P2C B;  3I90 A;  4C5B A;  2R7Z A;  1FD7 D;  1RYR A;  3NP8 A;  1JT8 A;  2LXJ A;  2RHQ B;  4EFE A;  3P1H A;  1AUV A;  4JV2 A;  2AWO A;  1TS3 A;  1EOV A;  1SFO H;  1SFO B;  4AYB A;  3GTJ A;  4KHV A;  2NVX H;  3CPF A;  4QQB X;  1OXV A;  2ATL A;  1E1T A;  2Z1C A;  3I4M H;  4HMI A;  3J7A V;  1SYB A;  1N32 Q;  4A2A A;  4XZ3 B;  3AB9 A;  4LSX A;  3J81 L;  1KBL A;  3PCO B;  4J9S A;  2OQ0 A;  2EXD A;  1M0W A;  3R2I A;  3G8C A;  4MV9 A;  2FK1 A;  3GTG H;  4IFD J;  3PR5 B;  4JI2 L;  2AKW B;  1CHP D;  3RR5 A;  4OX9 Q;  4KLK A;  1KL9 A;  5NUC A;  3NBH B;  4LH7 A;  4DL3 A;  1I50 B;  2NU7 B;  4WJ3 M;  4MV1 A;  3RUP A;  3P7J A;  5LMN L;  4LF9 Q;  5CA1 F;  2Q8I B;  3BA8 A;  3FKI G;  1E24 A;  4DA2 A;  3V4Z A;  1TWH H;  1WCM H;  3HOV H;  2DN8 A;  3PF4 A;  1WTR A;  3HBL A;  4BBS H;  3J81 W;  3CQZ A;  1I6H H;  3JAM i;  5HGQ A;  3ULL A;  1JKJ B;  1SCU B;  2F4V Q;  1I94 Q;  4B3S Q;  1FNV A;  4ZUI A;  2BA1 A;  3ND8 A;  5M5X B;  4Q8F A;  5J2U F;  5F9L A;  1O80 A;  5J39 A;  2XTI A;  1B3A A;  1GHJ A;  2I5L X;  1IBL L;  4O3N A;  5L9X A;  3OPO A;  2VXW A;  4FS1 A;  1KC7 A;  1UEB A;  4XYQ A;  2F0U A;  1CKM A;  4KV6 A;  2OF1 A;  4FP5 D;  3I8Z A;  4R4T A;  2F0F A;  3ZYY X;  1WTP A;  3Q0A A;  1VDZ A;  1X55 A;  3OMG A;  3IAY A;  4FBT A;  3C1E A;  1BBW A;  4M9U A;  1LT4 D;  1WTW A;  1JB7 A;  3R3O A;  4OIK A;  5ELB A;  3S1R B;  3M9M B;  1XYI A;  4DV1 H;  1TKW B;  4DV3 Q;  2VUM H;  3KLS A;  5KT6 A;  4DNI A;  5KFH A;  4Y7N H;  4JCV E;  3GP7 A;  3GV8 B;  3S2D B;  1A8V A;  4JI0 H;  2DJG C;  1RD9 D;  3I73 A;  5KFP A;  4UAI A;  2W6O A;  5IP9 G;  3GTK B;  4LFB L;  3DLL A;  1E2V A;  2LMC B;  1Y1V H;  1PTO D;  4H02 A;  3CC4 A;  3KK7 A;  3W1G A;  3N52 A;  5ELN A;  4IO9 A;  5HBR B;  3DXJ C;  5C3X A;  3H91 A;  4DK1 A;  4Q8E A;  1DOM A;  4I7Z C;  2GPS A;  1KXL A;  4OWW B;  1KC8 C;  1IW7 D;  1T9H A;  2R8H A;  1HPC A;  3WO1 A;  4LFC H;  3F8T A;  4KHP H;  3E6Z X;  3T13 A;  1XPO A;  1KDC A;  4LFA L;  5E4W C;  1G2S A;  2BQ3 A;  4E4T A;  2R82 A;  1LYL A;  4O3P A;  2UUB Q;  3RZD B;  3H20 A;  3QR8 A;  3JRX A;  4IRD A;  4E6I A;  4YY3 Q;  5C0X H;  1Q86 C;  1CSQ A;  5KFV A;  4XXE A;  2KVM A;  1SYE A;  5KFF A;  1DM0 B;  2AQ3 B;  1L1O B;  2RBM A;  1WSC A;  4JPB W;  5A2Q E;  3S15 B;  3K81 C;  1CKN B;  1S10 A;  5DG8 A;  2PMZ A;  4UCT A;  1PFB A;  1YHB A;  3D6C A;  1Q82 C;  3DMU A;  3CXC A;  1VQN A;  3H0G B;  1RCV D;  4MTK A;  3X3N A;  1VQ5 A;  4QIW A;  2IHF A;  4O3R A;  4J9K A;  2PZW A;  3G7L A;  2VQF H;  2O4X A;  1GVP A;  5CV7 A;  4IFD G;  3TQY A;  4ECZ A;  3M7G A;  1N36 H;  2ZTE A;  4DR3 Q;  2IBK A;  1FJG Q;  3JC6 6;  1DXM A;  2B2Y C;  4DV2 H;  3V6J A;  2EY2 A;  1B3Q A;  1QJO A;  1K9M C;  4BY7 G;  5FOB B;  4BY1 B;  3IL8 A;  4MTN A;  4DAY A;  1HR0 H;  1XTC D;  3HFZ B;  1GD7 A;  5BR8 Q;  3PV0 A;  4X62 L;  2IX0 A;  2NVY H;  2ES2 A;  3PO3 B;  2TSS A;  1Q7Y C;  1Y1W A;  1C30 A;  1T94 A;  1TII D;  4MA0 A;  3SVM A;  4A3J H;  1SLJ A;  1CHQ D;  2I80 A;  5JUM A;  4OX9 L;  4DR2 H;  5IT9 c;  4DL6 A;  2NVY B;  5KKN B;  5KX5 F;  4EBC A;  2PQA B;  1YNJ C;  4BWS C;  2E5L Q;  2ASJ A;  2AGP A;  5C8Y F;  3S14 H;  2UU9 Q;  4LF5 Q;  1XMO H;  2SEB D;  2ASB A;  2BQR A;  3A74 A;  1NTG A;  2F0P A;  4EGV A;  1JOK A;  1SNQ A;  4UDU C;  5CBA E;  1VQ4 A;  4A3G H;  4Y8V B;  1LT6 D;  4LMQ D;  2YS7 A;  3NGD A;  3FVQ A;  4KHZ A;  3CU7 A;  4RA8 A;  2VQD A;  2WKC A;  3H0G H;  1YNN C;  1FR3 A;  4KI0 A;  3FRP B;  1PMR A;  3RJ0 A;  1TWC B;  5KG7 A;  2EPB A;  3F2C A;  4CKB A;  2RQX A;  4AYB E;  5KNB A;  2R87 A;  4I4T F;  2F0T A;  2M00 A;  1SRO A;  4R8U B;  1SFO A;  2JK8 A;  1SYG A;  1S40 A;  2PPB C;  1BCP F;  1EIG A;  5I6Y A;  5KG6 A;  2WAQ E;  2H5X A;  4C3J B;  3D31 A;  2A6E C;  4JYA Q;  4X3K A;  2NVT B;  4A3I G;  4PDB A;  2XGT A;  4C5C A;  4A93 B;  1L2Z A;  3CRL C;  3BAB A;  2J6S A;  2UU9 L;  5CV6 A;  3GTP B;  1YIT A;  3J7Y W;  3Q24 A;  4K2L A;  1XNR L;  2WB1 A;  4F4W A;  4MV3 A;  3ULJ A;  3A55 A;  1QZG A;  4RH6 A;  4CDF C;  2FPI B;  4XQQ A;  1LTB D;  1PRT C;  1WFQ A;  1L2F A;  1T36 A;  4LF6 Q;  3U4Z A;  3UE1 A;  2QEX A;  1NJI C;  4K5W A;  2F0G A;  3S17 B;  3H15 A;  1Q90 A;  4A3F H;  1KAB A;  3W2D A;  1B70 B;  2XGQ A;  3GTO A;  2CW8 A;  1UC9 A;  3F2B A;  1CZW A;  1EQT A;  4JC0 A;  3R5H A;  2N55 A;  3PZP A;  4GLV B;  2ZXR A;  4U68 A;  1XNR Q;  1SRU A;  1KJJ A;  4DL5 A;  2UXB Q;  2R7K A;  3QB3 A;  2R92 A;  1D6E C;  1X54 A;  2UXB L;  1EY9 A;  1CFM A;  4JI6 H;  1HTP A;  2OQK A;  3TII A;  2XCA A;  4ED6 A;  1I5F A;  4A75 A;  4DR4 Q;  3RV3 A;  4FXK C;  4ZRZ A;  3ITP A;  3F2D A;  4RGM A;  2CH4 A;  2C2R A;  3H4D A;  3EFX D;  3STB C;  3OSP A;  5G3L D;  2VPQ A;  1J8I A;  4C3I G;  3M85 A;  1GOZ A;  5CBE E;  3OTO Q;  2UVU A;  4TSS A;  4DV5 H;  2NVQ H;  4DNT B;  4LF8 L;  1OXU A;  1SEI A;  2K32 A;  2RDH A;  5FLX c;  2DZD A;  2ZTC A;  3KF8 B;  3WO0 A;  1JXL A;  1TWH B;  2OT2 A;  2GA4 B;  2VPS A;  1A6X A;  1H9J A;  4IN3 A;  2UUC Q;  2E75 C;  1J6Q A;  2DY7 A;  1SNO A;  3T1H H;  3UDF A;  2E76 C;  4RFB A;  4OGQ C;  2MCT A;  5ELF A;  4X66 Q;  3NBH A;  5KYL A;  1N56 A;  3HOW B;  4GN4 B;  3N44 B;  4UY8 C;  1HA5 A;  2F0E A;  2R7Z G;  1Q8I A;  2EY5 A;  1VQ9 A;  3NK9 A;  1ZQ7 A;  4HR7 B;  3H3V I;  5GAD C;  3GV7 B;  4JVZ A;  3UFX B;  1JE5 A;  1T5X D;  4R9W A;  5FK9 C;  4QW9 A;  5HUR A;  1IKL A;  5DG9 A;  3S17 H;  1YZ6 A;  3HOX G;  2A68 C;  3T53 B;  2F4V L;  3J81 j;  2V58 A;  5C44 B;  1GUS A;  1ICF B;  2B2V A;  4CDE C;  2JEI A;  3CQZ B;  5EJW A;  4X62 Q;  5BR8 L;  1BBX C;  1TWF H;  4PV1 C;  4DV7 Q;  3I4M B;  4IRK A;  1CK1 A;  1X6O A;  3RB6 A;  2W7O A;  3P20 A;  2DY8 A;  3GTP H;  5KFC A;  3OW7 A;  4A3B B;  4RAY A;  3OHB A;  2RGR A;  2EYO A;  1B33 N;  3RB3 A;  1MD2 D;  3VYT A;  1Y8P B;  2E2H B;  1EYC A;  1Z7T A;  5LXT F;  5CV9 A;  4FDB A;  3H0G A;  5FD6 A;  4A76 A;  5L1I A;  3PN1 A;  1Y8O B;  2ZTD A;  3PUZ A;  1A3T A;  4P72 A;  4B3T H;  3BAA A;  1YJ9 A;  4C2M H;  5KG5 A;  2IY5 B;  5LOV F;  3CCJ A;  3CCQ A;  4HQ6 A;  2K5V A;  1EIF A;  4ZYS A;  5BMV F;  2NVX A;  1VQF A;  1SEB D;  2R92 H;  5DM6 3;  2AGO A;  1RYS A;  5EKK A;  3GIP A;  1CUK A;  4KKT A;  5DAU A;  3HOX H;  3RBD A;  1J5E L;  3GTG A;  3CKI B;  2Z4I A;  1NMF A;  1IOW A;  3I3C A;  4J0M A;  5F9N A;  5IYB H;  1QE6 A;  5C4X H;  4YY3 L;  4HJ5 A;  1D7Q A;  2E2J B;  3CMA A;  4EQ5 A;  1WTV A;  3VA7 A;  4X65 H;  4IPH A;  4F4X A;  3KUP A;  3W3A A;  2A1A A;  1IL8 A;  4LFA Q;  5LMN Q;  2HIX A;  4RGO S;  2K5H A;  2HIV A;  3PIO 3;  3MA2 B;  2V1C C;  3K8A A;  3K5L A;  4J9N A;  5T1I A;  5I2X A;  2DPJ A;  3BDC A;  4LF4 H;  1LTL A;  4IHJ F;  2CWA A;  2PO4 A;  4BBS G;  3HS0 C;  3JRW A;  1AH9 A;  3GTQ A;  3ETH A;  4LNQ A;  2E74 C;  4JV5 L;  2PI2 A;  4JV5 Q;  1TA8 A;  4B3M H;  5J1Z A;  3BU2 A;  4IPG A;  1B6R A;  3BQ2 A;  1V1O A;  3BG3 A;  3AMU A;  4JI8 Q;  1Y1W G;  3PW7 A;  3PO3 H;  5IGG A;  1QIL A;  4GN3 B;  3HOY B;  1VKZ A;  3VMM A;  4FO2 A;  1OWT A;  3N8D A;  1SE8 A;  1VQG A;  2IPK D;  4BXX H;  2ALZ A;  1L1O A;  3GTM A;  3DM3 A;  1PZI D;  3J7A 5;  3OW2 A;  1TWC A;  4KKS A;  1S5C D;  5AJ3 L;  1VQJ A;  4Z9C B;  4R8U A;  4FF1 A;  1EEI D;  1EZ1 A;  5LL6 b;  1NAP A;  2RCF A;  4QWD A;  4QWE A;  1TY0 A;  4JK1 C;  2DIK A;  3AU7 A;  2Q8R E;  3CCU A;  3SK5 A;  1I6U A;  2KCM A;  4PMC A;  4B3T L;  1HR0 L;  1ET9 A;  2PN1 A;  3ERS X;  2N3S A;  4HJA A;  3I4N G;  4HNU A;  4Q45 A;  3OMC A;  5EBD A;  4L8J A;  2Q2U A;  4ED2 A;  3GV6 A;  1WTQ A;  2LFN A;  1IBL H;  2YU9 B;  3RD4 A;  4JI3 H;  4RNN A;  4ID6 A;  2HQE A;  2AQ2 B;  3Q2O A;  2D62 A;  3PF5 A;  3BVG A;  4IOA A;  1LT5 D;  1STG A;  4O4I F;  5KT7 A;  1Y1W H;  3PO3 G;  4X65 L;  1X65 A;  4LUV A;  4A3J G;  2DNE A;  4APV A;  2I87 A;  1JB3 A;  1X9N A;  2FJZ A;  5EBC A;  4ECS A;  3TDQ A;  3OOC A;  4NXM H;  4ZAI A;  1IOV A;  1NMG A;  2F3I A;  4QW8 A;  5BN5 A;  4QIW E;  3VR2 A;  4NXN Q;  4QUC A;  5GON F;  4MN3 A;  1UE5 A;  1KEE A;  3KDF B;  5J2T F;  4JV5 H;  2TMP A;  1VQH A;  5G3L F;  1WYD A;  3WNZ A;  3MZ5 A;  3J80 L;  1TY2 A;  4JBJ A;  4UCS A;  4TQS A;  4XYM B;  2A19 A;  3PQI A;  1HHV A;  1AZP A;  3VYR A;  4GOP C;  4C3H B;  1MIU A;  3KHG A;  4J9P A;  3K6O A;  2BE5 C;  3HKZ E;  3K5H A;  2CHB D;  3CVZ A;  2E5L L;  2UVW A;  5EPJ A;  2J6T A;  3TS2 A;  4KJN A;  3SEB A;  4BA2 I;  4M8A A;  1TWH A;  1W6J A;  3MR6 A;  4MZ9 A;  4L5R C;  2HDL A;  4ZK9 B;  5BPF A;  3DWA A;  4L5Q A;  1PLF A;  4ME5 A;  4OWX B;  3H94 A;  1B1Z A;  3OTO L;  5EDW A;  1HZB A;  1EQV A;  3RIZ A;  3PUW A;  2FMC A;  3OUZ A;  2WB1 B;  2KEC A;  3CP0 A;  3IRB A;  1AZQ A;  1QB5 D;  2WB1 G;  1U9R A;  4NPS A;  1PTO F;  3TP5 A;  1PH5 A;  2K50 A;  4RZR A;  3MFH A;  1BOS A;  1PX2 A;  2XD4 A;  2JEF A;  2B2Y A;  1VQE A;  4V0B A;  2RGV A;  5IWA H;  2PQE A;  4DR5 L;  2YTV A;  1S9F A;  1F9S A;  3GQB A;  3HOV G;  5C3W A;  3GTO B;  3L0O A;  2B29 A;  1B9N A;  4DU9 A;  1VQL A;  2FP4 B;  2F1M A;  1N34 L;  4J9O A;  4DV0 H;  4RNO A;  2HVS A;  1F2Z A;  3URY A;  4N9T A;  1D5M C;  1XTD A;  3KLS X;  1E0B A;  4K6D A;  3AFP A;  4HAE A;  1WCM G;  3TP7 A;  3WOF A;  2R7Z B;  4C3H G;  3PGZ A;  5JJI A;  4FNF A;  2C9O A;  2QIL A;  4QF4 A;  4HN7 A;  2MPM A;  4JI7 Q;  3D4W A;  3HOW G;  2R92 B;  2AQ4 A;  1RK5 A;  4JI7 L;  4U7C A;  3NTI A;  4YHH Q;  2E2H A;  4XIG S;  2V4Q A;  3T51 B;  4BWG B;  2HGS A;  3GO5 A;  3CCE A;  5D65 A;  1TWA B;  4A3K B;  1K1S A;  4M7E A;  4YWM A;  4JBM A;  4OEM B;  2Q2H A;  3VYS A;  3EN2 A;  4A3L G;  5D1O B;  2JA9 A;  2W70 A;  2M05 A;  2WB1 E;  4DUZ H;  2MHV A;  4DR3 L;  2NVX B;  2XIW A;  2XCP A;  1BQQ T;  2W8L A;  4A3B H;  1O7Z A;  1PYB A;  1SJE D;  3PIO A;  1G6Z A;  3QZ8 A;  1JC7 A;  3MXP A;  4LK1 C;  3O13 A;  1BUV T;  4G3I A;  4DV4 L;  5FPO A;  3J81 E;  4DNR B;  4A3C H;  1PYW D;  1SDF A;  4QUF A;  1I7L A;  1YJN A;  1JIC A;  1Q3L A;  1LAC A;  1V8Q A;  2L5T A;  2PNH A;  4B08 A;  1F9R A;  4HTH A;  2OLS A;  1L0W A;  3EPI A;  3NEN A;  2ASL A;  2G9D A;  2SNS A;  1ENC A;  5ELO A;  3H09 A;  4EBE A;  1SMY C;  4PMB A;  4UFZ A;  4JI1 Q;  1WVL A;  5LA6 F;  1R9T A;  2G5D A;  4NXM Q;  3HOW H;  3M4I A;  4RWS C;  1EY6 A;  4RGT A;  2A6H C;  4XDX A;  2N49 A;  1F2M A;  1CI3 M;  1SMX A;  1SMY D;  3NWT A;  5CR3 A;  5C4J H;  5IYZ F;  3GTQ B;  4KKU A;  4ECU A;  1H9S B;  1SYF A;  5M3M H;  3D3R A;  4JI6 Q;  4JBW A;  1N33 H;  1VQK A;  2JQO A;  1SYC A;  5C0X G;  2KCT A;  3FKI A;  4G57 A;  1EHI A;  1B44 D;  2F0V A;  4ODG A;  2DNC A;  3OWF A;  1OXT A;  2B8G A;  3L4K A;  2AWN A;  3BZC A;  2ICI A;  4EVO A;  4O3O A;  1IBL Q;  5KFL A;  4JBK A;  2K14 A;  1PH2 A;  4LFB Q;  3VR6 A;  5M3F B;  2K5D A;  4RB2 C;  5EKL A;  3HOZ H;  1BXT A;  2WTF A;  4FXG C;  4N8F A;  3UDI A;  4IFD H;  3Q22 A;  3EYY A;  5D1P A;  4TRD A;  4HID A;  1Q81 C;  4MV6 A;  2R61 A;  1EIY B;  2YU9 H;  1KDA A;  2EY1 A;  5KFD A;  2KOL A;  2WII B;  1PZJ D;  3PUY A;  5D3D A;  4CKE A;  3J7A F;  2FK2 A;  3GTL A;  2F0J A;  3GIM A;  4LSA A;  4DUZ L;  5M3F G;  4LF7 L;  2GVA A;  4L6T B;  5COY A;  5KFR A;  1QNU A;  4JI5 L;  4R1J A;  2K1B A;  4RGN A;  3G6X A;  4A3F B;  1UE7 A;  2HHH L;  1EZ6 A;  5C6A A;  4G7Z C;  3JSL A;  4PWQ A;  4A3D H;  4AQY H;  1K8G A;  3QOL A;  2R86 A;  3TZD A;  3J81 i;  3VR5 A;  2AUK A;  3G48 A;  4JI3 L;  3Q8P B;  2NUC A;  4K0K H;  1SN8 A;  3HOY H;  3JZI A;  1KLU D;  3KBG A;  2A74 C;  4A3K H;  3CCV A;  1B7Y B;  1WCM A;  2Z6K A;  1L1O C;  2H4O A;  1BDO A;  1STE A;  1K83 B;  4A93 H;  4KY7 A;  3A8K E;  1CSP A;  1CKN A;  3IKJ A;  1PK8 A;  5JJZ A;  1LM0 A;  3L9A X;  2IX3 A;  5M5Y H;  4IWY A;  2J4X A;  1ZHQ A;  1N33 L;  2QYZ A;  1VQB A;  4IR1 A;  3M4O B;  4GKJ L;  1KLG D;  3K7A H;  3DWQ A;  1STA A;  1PFS A;  2OTL A;  2VB2 X;  2QKI C;  4WOR A;  4OHJ A;  2EYJ A;  3GTM B;  1ZXT A;  2Q2I A;  2C35 B;  4K0K Q;  2QK4 A;  2R93 A;  1STY A;  3EA6 A;  5A2Q L;  4G7H C;  2FKL A;  4ED1 A;  1FVI A;  1TWC H;  4FYD A;  4DR6 H;  5KFG A;  1LTA D;  3S16 B;  1L0X B;  3PO2 G;  2YZN A;  5LMU Q;  4QWB A;  5IGE A;  3UQ8 A;  2VNU D;  2YS6 A;  2SCU B;  1PHJ A;  3HOX B;  2CWP A;  3TIN A;  3D4D A;  5H1S E;  4ZLT F;  1O78 A;  4A3K G;  1W93 A;  5JPN C;  1ZHS A;  3SDZ A;  3I4N H;  3Q8D A;  2W6P A;  2F0L A;  2FPG B;  1UAP A;  2NU9 B;  2CFM A;  2GPW A;  1HCZ A;  2KCN A;  1RTN A;  1U4R A;  3KBX A;  5D8D A;  1KJQ A;  2F0I A;  2BDO A;  4ED8 A;  2RF4 A;  1ILQ A;  2ZM6 Q;  1KDB A;  2BH8 A;  5GAH C;  1G29 1;  2F03 A;  1K1Q A;  2JA7 A;  2R3Z A;  2PZT A;  1V1Q A;  1LLR D;  2JXM B;  3MXN A;  4EFB A;  3M7N A;  4ZHQ F;  1W3S A;  1S5B D;  1X3E A;  1EEF D;  5FO8 B;  5C3E H;  4FBU A;  4H13 C;  3CQZ H;  1EYG A;  2CW0 D;  3E0J A;  4DR1 L;  2YL2 A;  3G71 A;  1Y14 B;  2FHT A;  3AQQ A;  1I4G A;  3PIP A;  4DR5 Q;  4EX5 A;  2ZDH A;  4X66 H;  2HJW A;  4QB4 A;  1FL0 A;  3BYT B;  2W9A A;  3TZU A;  2W9B B;  4LFC L;  4QL5 A;  1QVF A;  1YJW A;  4IJL A;  3A7A B;  4XYO A;  1B6S A;  3W1B A;  1SE4 A;  2B63 B;  3HGB A;  1R9T H;  1UE6 A;  4DR7 L;  4KHP Q;  1VQO A;  3FKI H;  5M5X H;  2YZG A;  2EY6 A;  4U67 3;  5KFI A;  4O4L F;  2RVL A;  3A56 A;  2ZM6 H;  4IUQ A;  1U4P A;  4JI2 Q;  2WKD A;  5JQW A;  2R6G A;  4P75 A;  2BOS A;  2B2W A;  2F0O A;  1WTO A;  1B50 A;  1A0I A;  2KEE A;  3QO2 A;  2H1E A;  3VPB A;  4UCV A;  5KFO A;  2I07 B;  4RKB A;  2NVQ B;  1N32 L;  4QWA A;  5FLM H;  2KHI A;  3OIP A;  4R7R A;  4IUU A;  1QG7 A;  3K5I A;  5C3E G;  3PMF A;  5IIF A;  2JEJ A;  3ERO A;  5IYC G;  1XMQ Q;  1XWE A;  1XMQ L;  4MA5 A;  1I6V C;  5KFM A;  4DR5 H;  3HRZ C;  1C7Y A;  4RHR A;  4EQP A;  1A9X A;  2EOT A;  5J3B A;  4ECR A;  1SNM A;  3MWY W;  1EU4 A;  5AFW A;  2FFK B;  5I2Y A;  3DF7 A;  3V6H A;  4L5T A;  2K5Q A;  4P73 A;  4NW2 A;  3MR3 A;  4TV8 F;  3S1N B;  3V05 A;  3RAQ A;  1JOQ A;  4YHH H;  5JOB A;  3L4J A;  1UNN C;  3HOU G;  3KYH C;  3L3O C;  2FLN A;  1PH4 A;  3U9T A;  2NB0 A;  1HZ9 A;  2BA0 A;  4LUO A;  2VUM B;  1SE2 A;  2WV6 D;  4JI4 L;  4A3E B;  1C4Q A;  1BNC A;  4V19 0;  2PMZ E;  4R8N A;  4YQW A;  1DYQ A;  5EOY A;  2B2T A;  5CMD A;  4R4C A;  1EQQ A;  1C3O A;  3BDL A;  1EWH A;  2AU0 A;  1NR4 A;  1F2Y A;  2F0M A;  3TRE A;  4LF9 H;  2RDG A;  1BXR A;  2F3W A;  3RLO A;  1TAE A;  1W6K A;  1GSA A;  5I4D A;  1AN7 A;  1QWY A;  2OH2 A;  2L4N A;  2AUJ D;  2W6M A;  4NXN H;  4MV7 A;  2RHS B;  1KAW A;  2FMM A;  2WAQ B;  2QW7 A;  5C4X G;  3EIV A;  2XGP A;  1RTO A;  4ZQ3 A;  4UHV A;  4DUY L;  3N6X A;  2CCZ A;  1EUD B;  1G8Z D;  5KFT A;  4DFA A;  2KSW A;  2YV5 A;  2K5W A;  3M9B A;  1WTX A;  5LP6 F;  5C1O A;  1VMC A;  3BVM A;  3WOE A;  1EYD A;  4C3I H;  1K0S A;  1DV1 A;  4RAZ A;  2HQL A;  2LKV A;  3BG5 A;  1FGB D;  2IT1 A;  2ZXO A;  3E0E A;  3NHH A;  2YTX A;  4DV6 H;  4ECV A;  1R9T B;  4C2M B;  4MV8 A;  2UU9 H;  3KAJ A;  3MVV A;  1UC8 A;  2D0P A;  4LAA A;  4F87 A;  2X0S A;  2BCO A;  2B2V C;  1VQ8 A;  1SJH D;  1S0M A;  3A54 A;  4JV1 A;  4B3R Q;  4DGZ A;  4DR2 L;  4EG0 A;  4DR2 Q;  4GKK Q;  1ZEQ X;  1Z2O X;  2NTS A;  5COR A;  4YCU A;  1MI2 A;  2N88 A;  5KYI A;  4DAV A;  1TWF B;  1CQV A;  3SHL A;  1HNX L;  4KY5 A;  4A2B A;  4GLA C;  5KG1 A;  2ZT9 C;  1U0L A;  3DUZ A;  2K75 A;  5EZY F;  3J7Z C;  4EQO A;  4EBD A;  3CME A;  3C0F B;  1IL2 A;  4K8I A;  4OO1 I;  4XX0 B;  1FJG H;  1E4E B;  2XVS A;  4GC6 A;  4CJ1 B;  4JI1 H;  4JI0 L;  1MJE A;  3G6Y A;  2ZDG A;  3G6E A;  1KJI A;  4CC5 A;  4DLK A;  3NPP A;  3RZO H;  4JG2 A;  3N6R A;  2UXC L;  1VQ7 A;  4GKK H;  4NP5 A;  2SDF A;  2Z6B A;  1PVO A;  1MSH A;  3RB0 A;  1WI5 A;  2I0Q A;  3BJY A;  4B3R H;  4LFB H;  2EDG A;  4A93 G;  1K8O A;  3LWB A;  3TS0 A;  3N43 B;  5E3F A;  2F52 A;  4JV0 A;  4CDC C;  4UP7 A;  4CGY B;  4R8I A;  2CH4 W;  5KFU A;  1GYF A;  4LFA H;  2RKS A;  4AYB G;  4HNV A;  4KJO A;  5KG2 A;  4A3F G;  2IL8 A;  3KF6 A;  1TU2 B;  4A3D G;  4K5X A;  4A3M B;  3K7A B;  3M4O H;  3G6V A;  1WD1 A;  4IR9 A;  4A3I H;  3VR3 A;  1LTG D;  1Q12 A;  1VQD A;  4MHE A;  1G91 A;  4ZI7 F;  5FLX E;  5J22 A;  3DEP A;  1K83 A;  5DLG A;  4J15 A;  2W71 A;  4YJ2 F;  4OEL B;  2NU6 B;  4ILW A;  3EQL C;  1O7I A;  3MHB A;  1B8A A;  1RJQ A;  2QEJ C;  2NN6 H;  1JJ2 A;  2Z0S A;  3NUC A;  4OXP A;  1TQO A;  2JA7 G;  1S5D D;  2ZDQ A;  5HGT A;  4K6L A;  3FDT A;  3CCR A;  2RDI A;  2K01 A;  4YAK B;  5E4X A;  2VUG A;  3GIL A;  2V4D A;  4OON A;  2R93 B;  2UXD L;  2JA8 B;  1RIP A;  1Y1V B;  2K5N A;  1XNQ L;  4A3G G;  1NUC A;  2NYZ D;  2R93 H;  3GIK A;  3GTK H;  2Y0S E;  2KED A;  5IGF A;  4X62 H;  2IWH A;  1HUN A;  2YU9 A;  1HQM C;  3S2D H;  2KHS A;  3PUX A;  4Y7N B;  1QZH A;  1HNX Q;  2IA6 A;  4IUV A;  3S1M H;  4F4Z A;  1GSO A;  4LH6 A;  4Q0Y A;  2DGY A;  2JA5 H;  3UI2 A;  4IPC A;  5A2Q W;  3EPG A;  2J9G A;  2DJF C;  3BZK A;  1SNC A;  2OEO A;  2O03 A;  1SND A;  2EJM A;  2K28 A;  1A3U A;  2SNM A;  3RTX A;  2F4V H;  1T5E A;  4DR4 L;  1ILP A;  1NR2 A;  4J8Q A;  4C3J H;  1IYJ B;  2QDL A;  3VR4 A;  2OWO A;  3N40 P;  3V4S A;  2KHJ A;  4DAM A;  3GTK A;  2LY7 A;  1F9Q A;  2F0S A;  2R7D A;  5M9O A;  4DV0 Q;  3RAX A;  1D5Z C;  4EGQ A;  1XMQ H;  4ZKC B;  2JA7 H;  1AFP A;  4AH6 A;  4HIM A;  4B9W A;  1V1P A;  1AEX A;  2NN6 I;  5DGB A;  1X3F A;  1I6H B;  3STB D;  1BCP C;  1DOL A;  2L12 A;  1AUX A;  3DWP A;  2Y0S G;  4X3T A;  1B2T A;  3QG1 A;  2B63 H;  1FGU A;  1TS4 A;  1Y1V G;  2QA4 A;  4A3G B;  2A5H A;  2WDT A;  3KAK A;  3IFT A;  4DV7 H;  3RBE A;  4JI2 H;  2VUM A;  1JJG A;  3UE0 A;  2FPP B;  1UUP A;  1EY7 A;  1JOO A;  1UWV A;  2K05 A;  4YHH L;  1LT3 D;  2VY3 A;  4YCV A;  4AQY L;  3C3L A;  3FPP A;  2D5D A;  4YBZ B;  2MFI A;  2ZM6 L;  2EYH A;  1PA6 A;  1VAJ A;  4B3M L;  3MXG A;  3S14 B;  4J9Q A;  1I50 H;  4POG A;  2AHO B;  5EGT A;  4BS9 A;  1YI2 A;  4BXX G;  1IHZ A;  1U4L A;  2F3V A;  2KQ3 A;  3UDX A;  4C1N I;  2HD3 A;  5BN3 A;  2R92 G;  1F9P A;  3FEW X;  1RK6 A;  4L5S A;  1GUN A;  3RN2 A;  3JAM L;  5JPM C;  2YZM A;  2XC9 A;  4HSP A;  3AYH B;  2K6A A;  2RSO A;  1ASY A;  1TT2 A;  3T1H Q;  5IP7 H;  4LF9 L;  4YJ3 F;  4GNX C;  1CA5 A;  2UUC H;  3VPD A;  4DL2 A;  3D8G A;  2JEB I;  1DOK A;  4IWX A;  2UVR A;  1PRT D;  3NBI A;  1DGS A;  4MIU A;  4O2A F;  1PFM A;  1PH9 A;  3GD7 A;  1O75 A;  2WYO A;  4O2B F;  3PR4 A;  3SK6 A;  4GKJ H;  3MFY A;  4ECX A;  2F0W A;  4F8M A;  1JMC A;  2F4I A;  4JUZ A;  1BF4 A;  2K33 A;  1EY5 A;  5IYC H;  4DV5 Q;  3CPW A;  4DR6 L;  3SK4 A;  5KFE A;  2K52 A;  1CQJ B;  4DL7 A;  1TWA H;  4ECW A;  4IQZ A;  2XNA C;  4KN4 C;  1JDB B;  2NWG A;  1VQP A;  1N8R C;  1IW7 C;  2VA2 A;  4PG3 A;  5M5W H;  4HIK A;  1MSG A;  3LX0 A;  2JA5 A;  1N36 L;  1QNK A;  2FB9 A;  3I12 A;  5KGU A;  3JAM W;  1P8L A;  3VDY A;  3DHQ A;  2VQE Q;  1HFG A;  1ESF A;  4JI8 H;  2RDF A;  1UNS A;  1CQF A;  1EY0 A;  1TWF A;  4HIO A;  5LMU H;  2Y0S B;  1NY4 A;  4JI3 Q;  3ICE A;  4DR6 Q;  2EYL A;  2HT1 A;  1QOH A;  3GTL H;  2HCI A;  1W2B A;  3JSN A;  3H4B A;  2GN5 A;  5IOC A;  3MWM A;  3V96 A;  1K83 H;  1X3P A;  3LWE A;  4EGJ A;  3K0X A;  4DV6 Q;  2C2D A;  5C4H A;  1IBM L;  4JI5 Q;  1JOR A;  2IX1 A;  5KRU A;  2IW3 A;  3R2T A;  2GVB A;  5KT5 A;  1FJG L;  3J7A K;  1D8L A;  3HG9 A;  3H0G G;  2B2T C;  1TR5 A;  1JLL B;  1EYZ A;  1XMO Q;  1BCP D;  1I3Q H;  1TS2 A;  1UE1 A;  3D0F A;  4NDX A;  3I4O A;  4ED3 A;  3TSS A;  2CQY A;  1GJX A;  3CCL A;  1XJV A;  1VQC A;  4GOP B;  2ICE C;  1I7N A;  4JYA H;  5JVG 3;  4UP9 A;  4G4K A;  1HA6 A;  4HSV A;  1A2T A;  2N8N A;  3S1N H;  1PH1 A;  1E2W A;  2RDJ A;  3FHW A;  4RU9 A;  3W5O A;  4CHT B;  4QJF A;  5C1P A;  1S97 A;  1KQS A;  4RUC A;  1F77 A;  1M8A A;  2X69 A;  3B6Y A;  2E2I H;  4I7A A;  1AP0 A;  3PIP 3;  3SE7 A;  4HYK A;  3E3X A;  1K8A C;  2PVP A;  2Z6K C;  5LMN H;  3ORQ A;  4F50 A;  4R4I A;  2EE1 A;  1XNQ Q;  4JI4 H;  2PMZ B;  5AJ3 Q;  5KIX A;  4JW0 A;  5L37 A;  4P74 A;  2WP8 J;  4QIW B;  4HJ8 A;  1DZ1 A;  2YYA A;  4GS3 A;  4JI1 L;  4BY7 H;  2WIN B;  4BBS B;  1WD0 A;  3NXW A;  4YR2 A;  5KFS A;  3HOV B;  4LF5 H;  5FLM G;  4APM A;  4L63 B;  3GID A;  3RGZ A;  2M9V A;  1IYU A;  3F2U A;  3LNN A;  3KXY T;  3U58 A;  4C56 C;  4GN5 A;  3GTL B;  5M3M G;  4L1K A;  4ZKB B;  1GUG A;  1V4Y A;  2EQS A;  1S4Z A;  2A6H D;  2JEA I;  3N41 B;  3E9H A;  1B04 A;  1E1O A;  4C5A A;  1JCK B;  4PMW A;  4DXG A;  2B2U A;  5KFY A;  1N33 Q;  1D1K A;  1PDQ A;  5BR8 H;  1TWG B;  1E4F T;  4M1U B;  3ORR A;  1E3P A;  4IUT A;  2F0D A;  3MWE A;  3T1Y L;  5LHY 1;  1K28 A;  1G2T A;  4IJH A;  4S3S A;  4DV2 Q;  3CCS A;  3SE0 A;  2F0N A;  4RB1 A;  2EVB A;  3GQC A;  4FS2 A;  3EVQ A;  2G9H D;  2IJ0 A;  4I50 F;  4DV6 L;  3LWU A;  4ZOL F;  1YNN D;  1ZYR D;  3KF6 B;  1RJR A;  3ND9 A;  5E1F A;  4F7X A;  1V1P B;  2CZG A;  2K04 A;  4DR4 H;  2X6G A;  4PNY A;  2B3G A;  5A35 A;  4FXD A;  1YHA A;  5LL6 X;  1V51 A;  1DCZ A;  1EOT A;  1E7Z A;  1ENA A;  5KFB A;  2C28 A;  3K7U C;  2JA6 A;  4RCO A;  5C44 G;  1HJP A;  2W8K A;  2UUB H;  2F0K A;  1T3N A;  1VCI A;  5JAV A;  2NBF A;  4H44 C;  2R7Z H;  5I9O A;  1VF5 C;  1KIX A;  3CC2 A;  1HTL D;  2C00 A;  3NQI A;  4ECY A;  1Q8K A;  3A8I E;  1D5X C;  4ECT A;  1HQR D;  2W6N A;  3CHB D;  4K8J A;  1JWU D;  1MGS A;  2E2D C;  2ZJT A;  3KTM A;  5L1J A;  3NE5 B;  4F88 A;  5I47 A;  4LF6 H;  4JI7 H;  4ED0 A;  2JSO A;  5DM7 3;  3WDN A;  3C2P A;  4Y52 H;  4UCO A;  2EYP A;  3UDG A;  2P5Z X;  4J1M A;  3OHX C;  3K80 C;  2BH2 A;  2JA8 G;  1IYV A;  1DIK A;  3HB9 A;  2R93 G;  2VZA A;  1I4H A;  4TV9 F;  2NUA B;  5IT9 E;  2OXP A;  2D9U A;  3LGJ A;  2V5A A;  4KD4 A;  1WTH A;  5ELD A;  4OO1 G;  5M5Y B;  2AGQ A;  2HDM A;  2VQF L;  4JI0 Q;  5KFA A;  1YNX A;  5IWA Q;  2JA7 B;  4I7H A;  3KHH A;  3T1Y Q;  3CC7 A;  2XWJ B;  4RB3 C;  5C4Z A;  5KEE A;  5KFZ A;  2R8G A;  2W57 A;  4JOI A;  4XQN A;  2EJF C;  1LTR D;  2XRS D;  2JJQ A;  3K5M A;  1I4Q A;  1UEA B;  2C22 A;  2HVQ A;  1DON A;  1GUW A;  4RMF A;  1EIH A;  2UXC H;  3S2H H;  1MBY A;  4RHS A;  1LTS D;  2JA5 B;  1HRJ A;  1CQI B;  1ZET A;  3QFF A;  4CC6 A;  2W9B A;  4DL4 A;  1CM9 A;  4KK7 A;  3RV4 A;  4O0A A;  2ZJQ A;  1AE3 A;  1IKM A;  5IT9 W;  1PH8 A;  3J80 E;  2PNR C;  4NMZ A;  1MZB A;  2BR0 A;  1CE8 A;  2I8C A;  2UVV A;  2FMA A;  3OYY A;  4X64 L;  2Y0S A;  2EZV A;  4A4I A;  1M7J A;  3AFQ A;  5FO9 B;  5I9P A;  1Z2N X;  1ESR A;  4DKA C;  3SGI A;  5IP9 H;  3A0J A;  2JA8 H;  4HNT A;  4IOC A;  1XDN A;  2E2I A;  5KG4 A;  4DK6 C;  2ENB A;  2NU8 B;  2V9W A;  5E7N A;  4J9L A;  2ZXP A;  3CW2 C;  1M0T A;  4LF7 H;  3BZD B;  3M4Q A;  3HKS A;  4GNX B;  4AQY Q;  4LF4 L;  3HOZ B;  3Q23 A;  5M3F H;  1TS5 A;  5C0X J;  4XT3 B;  4YR0 A;  4RB0 A;  1IXR A;  1GLV A;  3M9O B;  1K0R A;  3JAM c;  1VBG A;  1RF2 D;  1HR0 Q;  3PW4 A;  4OX9 H;  1S0O A;  5CA0 F;  4FF4 A;  4A3I B;  1YBY A;  3PW0 A;  1OTC A;  3Q6S A;  1KRT A;  4BBR G;  4EYH B;  4A3M H;  3ER0 A;  3PW2 A;  3CF5 A;  1NCV A;  1PFN A;  4GOP A;  1XMO L;  3CD6 A;  5M3M B;  4DPG A;  2VQF Q;  3HOZ G;  2QF7 A;  3Q1K A;  1N32 H;  3GTQ H;  4YWL A;  4XT1 B;  1PRT B;  1VS0 A;  4XQJ A;  2FK3 A;  5LL6 S;  4G7O C;  4K5V A;  1WR2 A;  2RSN A;  5FKA C;  1S3O A;  1JJC B;  4JYA L;  1BCP B;  3KJP A;  3M3Y B;  3FMC A;  4P71 A;  4ED7 A;  1Y69 U;  5HV6 A;  3U4V A;  4DV5 L;  3RNU A;  2WAC A;  3BVZ A;  1GHK A;  2R7L A;  5EQ0 A;  2IMW P;  5HY6 A;  4IZ8 A;  3I70 A;  2C5C A;  4CDD C;  3I4M G;  1G6P A;  3G6J B;  2MO1 A;  1S03 G;  3GLK A;  1I4P A;  1S5E D;  3RFC A;  1VMP A;  2R7M A;  4ZQI A;  2VQE L;  1I3Q B;  2Z8L A;  2DPI A;  4BBR H;  1KAA A;  4IUP A;  4PZ7 A;  1S68 A;  4IRC A;  2WAQ G;  5IGB A;  5CAE B;  2MO0 A;  3KDF A;  1EY4 A;  4X3S A;  3FP9 A;  1EWC A;  1WJJ A;  5TSS A;  2JA6 H;  2R85 A;  4HCS A;  5H80 A;  2C2E A;  4DR3 H;  4HED A;  5IP7 G;  4CJ0 B;  4IFD I;  2O5I C;  4YR3 A;  4LF5 L;  1VQ6 A;  4PZ8 A;  3RLF A;  3T5L A;  3BQ0 A;  5KFJ A;  1N48 A;  2FLP A;  4B3M Q;  4MNO A;  3GTJ B;  2I5M X;  3F1Z A;  2VB3 X;  2Q8T A;  3C1F A;  4HCE A;  1SYX B;  4TKO B;  4MAM A;  2NVT H;  2CW0 C;  4RUA A;  2V4R A;  2OTJ A;  3E9I A;  4RCN A;  4NXN L;  4R4Q A;  5C4X B;  4DF7 A;  3K5N A;  4C2M A;  1GM5 A;  4KHP L;  4YAJ B;  3VYU A;  1SE3 A;  2E8G A;  2F0H A;  3MTS A;  1CA6 A;  4DUZ Q;  1PV4 A;  4C3I B;  4X65 Q;  4H7B A;  3MEH A;  3NSW A;  2CW7 A;  3A5U A;  1ZYR C;  1I50 A;  4FF3 A;  4BY1 G;  2DWC A;  3S24 A;  2R7N A;  2W9C A;  2YTY A;  3M4Y A;  1HNW Q;  3AEV A;  1JE4 A;  4B3S H;  3CRK C;  3BJU A;  3HP3 A;  5I6W A;  4ECQ A;  4A3E G;  3GTJ H;  2MJ8 A;  3I2Z A;  4LJZ C;  2VUM G;  4GZY C;  1II3 A;  2KEN A;  3HXL A;  4X3U A;  4K0K L;  1E4E A;  5CYU A;  4J6H A;  4K2K A;  4B3T Q;  1KJ8 A;  3OWE B;  1EY8 A;  5EAY A;  4FF2 A;  5T14 A;  4X66 L;  4C1N K;  4ABN A;  2VW9 A;  3PSI A;  4GLX A;  3MFI A;  3MJF A;  3HEJ A;  4DV3 H;  2D0O A;  1CKO A;  1GUT A;  3QOJ A;  4DV1 Q;  5K36 G;  1DV2 A;  3KHL A;  5DQH A;  3R8B A;  5IWA L;  2ATW A;  1I4R A;  3R93 A;  5KFW A;  4DUY Q;  1G51 A;  4IUN A;  1Q1E A;  3SK8 A;  3OIQ A;  1DJR D;  1FNW A;  3K5O A;  3H40 A;  1PXU A;  3RUZ A;  1KNA A;  5LMU L;  3ETJ A;  1B53 A;  3GIJ A;  4LMY A;  3RF2 A;  1QVC A;  2NZH A;  4A3L H;  1JWM D;  1O7Y A;  2HHH H;  3CCM A;  3NWS A;  1VF7 A;  1HNW L;  3M3Y H;  1BKB A;  1YNJ D;  3KFU A;  4HMJ A;  4UCR A;  3OSO A;  5EPL A;  1L0Y B;  4POF A;  3KHR A;  3KLW A;  4WJW A;  5CV8 A;  1M1K C;  1V9P A;  2ALY B;  4KMU C;  1S72 A;  4LF7 Q;  1LO5 D;  2FLL A;  4Q0F A;  4LW1 A;  5LMN W;  1JR0 D;  3A8J E;  1ASZ A;  1WOC A;  3LML A;  5DNF A;  2DLN A;  1RJT A;  4A3C G;  2EJG C;  4IAL A;  5JEA G;  5JVH 3;  3VPC A;  3FDS A;  1LUZ A;  3HKZ G;  4O1N A;  3RZD H;  4OL7 A;  5GRO A;  1QCB D;  1EL0 A;  3TEH B;  1SXT A;  3Q8Q B;  3OTO H;  1MJC A;  2ZJP A;  1H9S A;  2VA3 A;  1NSN S;  2FIN B;  4HJ9 A;  1B9M A;  1Y1V A;  3FKI B;  5GAG C;  2QGQ A;  4H0L C; 
#chains in the Genus database with same CATH homology
 3I7F A;  4B3M L;  3GO5 A;  3CCE A;  4R4T A;  1I50 H;  4POG A;  2AHO B;  4YWM A;  4JBM A;  4BXX G;  4PZ6 A;  1YI2 A;  1N34 Q;  2Q2H A;  3UDX A;  3EN2 A;  1X55 A;  4HJ7 A;  2JA9 A;  4A3L G;  4XTC S;  1VQM A;  2R92 G;  2WB1 E;  4L5S A;  1BBW A;  4DR3 L;  3RN2 A;  1JB7 A;  3AYH B;  4A3B H;  3NEM A;  1PYB A;  3PIO A;  4DV3 Q;  2VUM H;  1ASY A;  5FJ8 H;  3T1H Q;  5IP7 H;  4LF9 L;  4DNI A;  1Q46 A;  4Y7N H;  4JCV E;  4GNX C;  5JJL A;  1A8V A;  4DV4 L;  4DV7 L;  2JEB I;  4YWK A;  4A3C H;  1DGS A;  5IP9 G;  1PH9 A;  3GD7 A;  4LFB L;  3DLL A;  1YJN A;  4OWT B;  1Y1V H;  4H02 A;  1RL2 A;  2EIF A;  2PNH A;  3CC4 A;  1JMC A;  3L2P A;  3W1G A;  1L0W A;  3ZJY C;  3NEN A;  5ELN A;  1X3G A;  4IO9 A;  4DV5 Q;  5IYC H;  5ELO A;  3CPW A;  4DR6 L;  4DAY B;  4B3R L;  3WWV A;  2K52 A;  4DR7 Q;  2N78 A;  2VS1 A;  4JI1 Q;  1TWA H;  4OWW B;  1KXL A;  1KC8 C;  4TQU S;  4NXM Q;  3HOW H;  1VQP A;  1T9H A;  1N8R C;  4PG3 A;  5M5W H;  2N49 A;  3F8T A;  1SMX A;  5C4J H;  4HIK A;  5IY0 A;  1XPO A;  1N36 L;  4JI6 L;  4LFA L;  1P8L A;  5M3M H;  3VDY A;  4JI6 Q;  4JBW A;  5IE8 A;  3TRZ A;  1PH7 A;  1VQK A;  2JQO A;  2VQE Q;  1QUQ B;  1LYL A;  5C0X G;  2KCT A;  2PQA A;  2UUB Q;  5GAE C;  4YY3 Q;  4HIO A;  1C0A A;  1M90 C;  1OXT A;  1NY4 A;  2AMC B;  1CSQ A;  2JE6 I;  2AWN A;  2CKZ B;  3BZC A;  1Q86 C;  4JI3 Q;  3ICE A;  3S16 H;  4DR6 Q;  1L1O B;  1IBL Q;  2HT1 A;  4GKK L;  3GTL H;  4JBK A;  1W2B A;  3K81 C;  1CKN B;  2K14 A;  2GN5 A;  4A3M G;  1PH2 A;  4LFB Q;  4LF4 Q;  1YHB A;  1Q82 C;  3CXC A;  1K83 H;  1VQN A;  1VQ5 A;  3HOY G;  1KHI A;  2IHF A;  3K0X A;  2CQO A;  4DV6 Q;  3HOZ H;  3UDI A;  1IBM L;  4JI5 Q;  4HID A;  1Q81 C;  2IX1 A;  1GVP A;  1EIY B;  2YU9 H;  2GVB A;  3TQY A;  4IFD G;  2ZTE A;  1FJG L;  4DR3 Q;  3PUY A;  1D8L A;  1FJG Q;  2E2H H;  3H0G G;  3JC6 6;  4DUZ L;  5M3F G;  4DV0 L;  1XMO Q;  1I3Q H;  3D0F A;  1UE1 A;  4LF7 L;  1K9M C;  3I4O A;  4BY7 G;  2GVA A;  4MTN A;  2A8V A;  1D7Q A;  3HFZ B;  1GD7 A;  4JI5 L;  4R1J A;  3PV0 A;  5BR8 Q;  4X62 L;  3CCL A;  4X6A H;  2IX0 A;  2NVY H;  5IYD G;  2ES2 A;  1XJV A;  4BY1 H;  1VQC A;  5C44 H;  4GOP B;  1Q7Y C;  1UE7 A;  2HHH L;  4UP9 A;  1V43 A;  5JJK A;  4A3D H;  4UPA A;  2N8N A;  4A3J H;  1K8G A;  2RCN A;  1SLJ A;  3J81 c;  3S1N H;  4OX9 L;  1PH1 A;  3J81 i;  5IT9 c;  3G48 A;  3ULP A;  4JI3 L;  3FHW A;  3W5O A;  1SN8 A;  2PQA B;  4QJF A;  2E5L Q;  5GAG C;  1KQS A;  4LF6 L;  3HOY H;  4R4O A;  1C9O A;  4A3K H;  3S14 H;  3CCV A;  1B7Y B;  2UU9 Q;  4LF5 Q;  4LWC A;  2E2I H;  3B6Y A;  2Z6K A;  1L1O C;  1YVC A;  3I55 A;  2ASB A;  3MXN B;  4A93 H;  1TXY A;  1K8A C;  2Z6K C;  2UXD Q;  4R4I A;  1N9W A;  1CSP A;  2PI2 E;  1NTG A;  3A74 A;  1CKN A;  1TWG H;  1N36 Q;  5AJ3 Q;  4QGU A;  1XNQ Q;  1LM0 A;  4JI4 Q;  4P74 A;  5M5Y H;  2WP8 J;  1VQ4 A;  4A3G H;  4HJ8 A;  1N33 L;  4GS3 A;  1VQB A;  4JI1 L;  4BY7 H;  4GKJ L;  3K7A H;  1PFS A;  4JI8 L;  2OTL A;  4KHZ A;  4KI0 A;  3H0G H;  5FLM G;  1K73 C;  3CAM A;  1NE3 A;  5IYD H;  2Q2I A;  2C35 B;  3F2C A;  4K0K Q;  4AYB E;  4WJ4 A;  3U58 A;  1EFW A;  4GN5 A;  1FVI A;  1TWC H;  1SRO A;  2JK8 A;  1S40 A;  5M3M G;  1YHQ A;  3PO2 G;  2EQS A;  4LUZ A;  5LMU Q;  2JEA I;  2WAQ E;  3E9H A;  2VNU D;  2H5X A;  2YYZ A;  1E1O A;  3D31 A;  4JYA Q;  4PMW A;  1PHJ A;  2CWP A;  1X56 A;  5IYB G;  1N33 Q;  5H1S E;  4DV3 L;  4A3K G;  3T1H L;  4A3I G;  2XGT A;  1E3P A;  2NN6 G;  3T1Y L;  4NB3 A;  3Q8D A;  3I4N H;  4IJH A;  2UU9 L;  4DV2 Q;  4A3E H;  3CCS A;  1YIT A;  5GQO A;  2CFM A;  1XNR L;  1AE2 A;  3ULJ A;  4BA1 I;  1QZG A;  1Q1B A;  1WFQ A;  1L2F A;  2RF4 A;  5JEA J;  4DV6 L;  2ZM6 Q;  4LF6 Q;  4IPD A;  3U4Z A;  2BH8 A;  3UE1 A;  1G29 1;  5GAH C;  2QEX A;  1NJI C;  2Q2T A;  1V1Q A;  3J80 c;  3KF6 B;  3H15 A;  4B3S L;  3A5Z B;  2LXK A;  4A3F H;  3M7N A;  1B70 B;  1W3S A;  1X3E A;  2UXC Q;  5C3E H;  3F2B A;  3CQZ H;  1EYG A;  2B3G A;  4DR1 L;  3PO2 H;  1EQR A;  1YHA A;  4JC0 A;  1E7Z A;  2L15 A;  3G71 A;  1EWI A;  1Y14 B;  3AQQ A;  2I5H A;  1YEZ A;  3K7U C;  4GLV B;  4EX5 A;  3PIP A;  4DR5 Q;  1XNR Q;  5C44 G;  1SRU A;  1FL0 A;  1HJP A;  1U5K A;  2UXB Q;  4LFC L;  4QL5 A;  1VCI A;  1QVF A;  2UXB L;  1X54 A;  1YJW A;  4IJL A;  3GDE A;  2OQK A;  2R7Z H;  3RZO H;  2JA6 G;  1I5F A;  4A75 A;  4DR4 Q;  1KIX A;  3CC2 A;  3W1B A;  3F2D A;  1R9T H;  1UE6 A;  4DR7 L;  1Q8K A;  4KHP Q;  4DR1 Q;  1VQO A;  3FKI H;  1K3R A;  5M5X H;  1H95 A;  3STB C;  1HZA A;  4O2D A;  3M85 A;  4JI2 Q;  3OTO Q;  4Y52 H;  4JOI C;  2NVQ H;  3UDG A;  2R6G A;  1OXU A;  4LF8 L;  2BH2 A;  2JA8 G;  3K80 C;  1Z47 A;  4P75 A;  2R93 G;  2VZA A;  5FLX c;  1E22 A;  1A0I A;  2ZTC A;  3KF8 B;  3LGJ A;  4GKJ Q;  1HZC A;  1P16 A;  5DLQ E;  1MKH A;  4DV1 L;  3GTO H;  4OO1 G;  3RN5 A;  2UUB L;  1N32 L;  5FLM H;  2KHI A;  2VQF L;  1XPR A;  1YNX A;  5IWA Q;  2UUC Q;  4JI0 Q;  5C3E G;  3T1Y Q;  1J6Q A;  3CC7 A;  1XMQ Q;  5IYC G;  2VL6 A;  3UDF A;  3G4S A;  2DUD A;  1XMQ L;  4X66 Q;  4NXM L;  4GN4 B;  4UY8 C;  4JOI A;  1C7Y A;  2R7Z G;  1VQ9 A;  5J3B A;  2JJQ A;  2ZJR A;  3H3V I;  5GAD C;  4LF8 Q;  1J5E Q;  3J80 i;  1JE5 A;  4RMF A;  4L5T A;  3S2H H;  4P73 A;  3S17 H;  1HNZ Q;  1YZ6 A;  1PYS B;  1IZ6 A;  1A62 A;  3HOX G;  4ALP A;  2F4V L;  3J81 j;  2NZO A;  4A3B G;  1QUQ A;  4O0A A;  4DV4 Q;  3KYH C;  2ZJQ A;  1AE3 A;  3HOU G;  1PH8 A;  1GO3 E;  3L7Z C;  1PH4 A;  4X62 Q;  5BR8 L;  1TWF H;  3OYY A;  1HZ9 A;  1SR3 A;  1Z9F A;  2BA0 A;  4LUO A;  4X64 L;  1X6O A;  4DV7 Q;  4A4I A;  3GTP H;  3AFQ A;  4JI4 L;  4DKA C;  3SGI A;  5IP9 H;  3A0J A;  2JA8 H;  2PMZ E;  4C3H H;  4IOC A;  4UP8 A;  4YCW A;  3KJO A;  4R4C A;  1EQQ A;  4FDB A;  2LSS A;  2B63 G;  1PH3 A;  3U50 C;  4A76 A;  4DK6 C;  2ZTD A;  3PUZ A;  5E7N A;  4P72 A;  3CW2 C;  3I56 A;  3TRE A;  2WFW A;  1YJ9 A;  4C2M H;  4GNX B;  3M4Q A;  1VQA A;  3HKS A;  4TVA B;  3RLO A;  3CCJ A;  3CCQ A;  4AQY Q;  4LF4 L;  4AIM A;  2IY5 B;  2K5V A;  1EIF A;  1VQF A;  5M3F H;  5C0X J;  2R92 H;  1IXR A;  2KBN A;  3S15 H;  1K0R A;  3JAM c;  1CUK A;  2MQH A;  2RHS B;  1HR0 Q;  1BBU A;  2HHH Q;  1KAW A;  3HOX H;  3GTM H;  1I94 L;  1YBY A;  3EIV A;  5C4X G;  1J5E L;  1OTC A;  1NMF A;  3HOU H;  5IYB H;  5C4X H;  4YY3 L;  1KRT A;  4BBR G;  4DUY L;  4HJ5 A;  1A63 A;  4A3M H;  3ER0 A;  2CCZ A;  3CF5 A;  3CMA A;  4EQ5 A;  4DV2 L;  4GOP A;  1XMO L;  2YV5 A;  3M9B A;  4IPH A;  3CD6 A;  4DPG A;  2VQF Q;  4C3I H;  3HOZ G;  2A1A A;  4LFA Q;  5LMN Q;  1YIJ A;  3GTQ H;  4YWL A;  2HQL A;  2HIX A;  2K5H A;  2HIV A;  2IT1 A;  3E0E A;  3PUV A;  1KD1 C;  1VS0 A;  2V1C C;  2YTX A;  3K8A A;  2UUA Q;  1S3O A;  2D0P A;  1LTL A;  1JJC B;  1HR0 W;  2CWA A;  1VQ8 A;  3KJP A;  4BBS G;  4JYA L;  1XPU A;  1AH9 A;  4P71 A;  4B3R Q;  4LNQ A;  4DR2 L;  3U4V A;  3M4P A;  3RLN A;  4DV5 L;  3RNU A;  4JV5 L;  2PI2 A;  4DR2 Q;  4JV5 Q;  5HY6 A;  3I4M G;  3S1Q H;  3BU2 A;  4IPG A;  4RG1 A;  4GKK Q;  1G6P A;  3NEL A;  4JI8 Q;  1BVS A;  4YCU A;  1Y1W G;  2MO1 A;  3PO3 H;  2OCE A;  4GN3 B;  1HNX L;  2UUA L;  1SE8 A;  1VQG A;  4BXX H;  1L1O A;  4GLA C;  1NBW A;  4GNX A;  1U0L A;  2VQE L;  2K75 A;  3DM3 A;  1KRS A;  4BBR H;  3J7Z C;  4PZ7 A;  3OW2 A;  4LFC Q;  1OXX K;  2WAQ G;  3J7A 5;  2MO0 A;  3CME A;  1OXS C;  3KDF A;  1VQI A;  4ME3 A;  5AJ3 L;  3S1R H;  1IL2 A;  1VQJ A;  1GKH A;  1WJJ A;  2IHE A;  3FP9 A;  2JA6 H;  4OO1 I;  2UUC L;  4JI0 L;  5FJ8 G;  1MJE A;  5IP7 G;  4IFD I;  3G6E A;  4LF5 L;  3EBE A;  3CCU A;  1IBK L;  3MEF A;  4JG2 A;  4PZ8 A;  3RLF A;  2KCM A;  3KOJ A;  1VQ7 A;  1VQ6 A;  4B3T L;  2UXC L;  1HR0 L;  4B3M Q;  4MNO A;  3ERS X;  2N3S A;  4HJA A;  3I4N G;  1EUJ A;  1PVO A;  2Q2U A;  1WI5 A;  2I5M X;  3F1Z A;  2I0Q A;  4A93 G;  2R7F A;  2NVT H;  3TS0 A;  2OTJ A;  3E9I A;  5C0X I;  2F52 A;  4NXN L;  4R4Q A;  4UP7 A;  1GM5 A;  4KHP L;  1PH6 A;  2D62 A;  2MNA A;  2E8G A;  3PF5 A;  3H3V H;  4IOA A;  4DUZ Q;  1PV4 A;  4AYB G;  2FXQ A;  1QVG A;  4A3F G;  4X65 Q;  1Y1W H;  4X64 Q;  3KF6 A;  3PO3 G;  4A3D G;  4X65 L;  1X65 A;  4LUV A;  4A3J G;  2E2J H;  4APV A;  2JA5 G;  3A5U A;  4BY1 G;  1X9N A;  3M4O H;  3S24 A;  2YTY A;  1NMG A;  4A3I H;  1IBM Q;  2F3I A;  1Q12 A;  1HNW Q;  1VQD A;  4QIW E;  4NXN Q;  4DK3 C;  3AEV A;  4J15 A;  3BJU A;  2ZM6 L;  4A3E G;  1HNZ L;  3GTJ H;  3I2Z A;  2ID0 A;  1UE5 A;  2VUM G;  1O7I A;  1B8A A;  2KEN A;  3KDF B;  1JJ2 A;  4QY7 A;  1VQH A;  2K4K A;  2Z0S A;  2JA7 G;  4OXP A;  4K0K L;  1HH2 P;  1WYD A;  4B3T Q;  1IBK Q;  3CCR A;  5EAY A;  4JBJ A;  2A19 A;  4X66 L;  2VW9 A;  3PSI A;  4GLX A;  2LXJ A;  2RHQ B;  4OON A;  1JT8 A;  4GOP C;  2UXD L;  2AWO A;  2D0O A;  1CKO A;  1MIU A;  1EOV A;  4DV1 Q;  1SFO H;  1RIP A;  1XNQ L;  2K5N A;  2NVX H;  4A3G G;  5K36 G;  3CPF A;  2R93 H;  5IWA L;  2ATW A;  4QQB X;  1OXV A;  2Y0S E;  1E1T A;  3HKZ E;  3GTK H;  4DUY Q;  1G51 A;  3I4M H;  1N32 Q;  1Q1E A;  2E5L L;  3PCO B;  2OQ0 A;  2EXD A;  3S2D H;  3PUX A;  1QZH A;  1HNX Q;  3TS2 A;  4BA2 I;  5LMU L;  3GTG H;  3S1M H;  4MZ9 A;  4L5R C;  4L5Q A;  4IFD J;  1QVC A;  2NZH A;  4OWX B;  4A3L H;  2DGY A;  2JA5 H;  4IPC A;  3OTO L;  4JI2 L;  1HZB A;  2AKW B;  4OX9 Q;  3BZK A;  3RR5 A;  3CCM A;  1KL9 A;  3PUW A;  4KLK A;  1HNW L;  3M3Y H;  1BKB A;  3KFU A;  3NBH B;  3CP0 A;  3IRB A;  4DR4 L;  2WB1 G;  4WJ3 M;  4C3J H;  1IYJ B;  4POF A;  4NPS A;  2OWO A;  2KHJ A;  4DAM A;  1PH5 A;  5LMN L;  3KLW A;  2K50 A;  2R7D A;  4DV0 Q;  4LF9 Q;  1M1K C;  1V9P A;  2ALY B;  4LF7 Q;  1S72 A;  1VQE A;  3FKI G;  1E24 A;  2JA7 H;  4LW1 A;  5LMN W;  4DR5 L;  2YTV A;  4AH6 A;  4HIM A;  3HOV G;  2NN6 I;  2B29 A;  3L0O A;  1WOC A;  1ASZ A;  1VQL A;  1N34 L;  1X3F A;  1TWH H;  3STB D;  1WCM H;  3HOV H;  4A3C G;  5JEA G;  1XTD A;  3PF4 A;  1LUZ A;  4BBS H;  3HKZ G;  2Y0S G;  3AFP A;  3RZD H;  2B63 H;  1I6H H;  1WCM G;  5HGQ A;  1FGU A;  1Y1V G;  5GRO A;  3ULL A;  3JAM i;  2QA4 A;  2F4V Q;  3TEH B;  1I94 Q;  4B3S Q;  3PGZ A;  3UE0 A;  2BA1 A;  1MJC A;  2ZJP A;  5JJI A;  3HOW G;  1JJG A;  4JI7 Q;  1UWV A;  2XTI A;  4YHH L;  2I5L X;  4HJ9 A;  1IBL L;  4JI7 L;  2VY3 A;  4YCV A;  4AQY L;  4YHH Q;  1UEB A;  2MFI A;  1CKM A;  1PA6 A;  2QGQ A;  4XIG S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...